5KR9A

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with coumestrol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
236
Chain Sequence
NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 236
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kr9A00
2OM9A 2QSEA 3VHUA 3SP9A 5FQTA 4OIUA 1RJKA 3OSAA 5E0WA 1XOWA 3CS8A 3UUDA 2FAIA 2J7YA 1FM6A 2VV2A 4FNEA 1YMTA 3RUTA 3D24A 3DR1A 3OLFA 4REEA 5DZIA 5DVCA 3S9SA 2I4JA 4G21A 5DWJA 4L98A 1KKQA 4RZEA 2I4ZA 2XYXA 2GPVA 4OGHA 5JJMA 2AO6A 3G0WA 3K6PA 3E00A 2G0HA 2P7ZA 1X7RA 4N1YA 1OSHA 4NB6A 3UU7A 5CJ6A 5F9BA 2R6WA 4O8FA 4OLMA 1T5ZA 5DXBA 1YP0A 3OMQA 1S0ZA 3F5CA 2Q70A 1EREA 3A78A 1G50A 2QW4A 3A2IA 5A86A 1ZAFA 3CDSA 1MV9A 5DIGA 5L11A 2LBDA 3ET2A 5DYDA 4IUIA 2AXAA 5AK2A 3UUAA 4YPQA 4ZOMA 3OMPA 2QTUA 5LWPA 3RLJA 2OUZA 2Z4JA 2YLPA 5KRIA 5HYRA 3L3ZA 2POGA 4CI4A 4LTWA 3W0GA 4WHGA 5KRMA 4PPPA 4K7AA 4L96A 2Q6JA 2VV0A 2QH6A 4MG5A 4PF3A 4MG7A 4KZIA 1TXIA 3OZJA 3B3KA 2ACLB 2QPYA 3FC6B 1R20A 2P4YA 1S9QA 4MG8B 2R40D 4TV1A 1YJEA 2I0JA 1ZH7A 5E0XA 4JGVA 3VJTA 1GS4A 1SKXA 4ZJRA 4S0SA 4PXMA 2B1VA 4OEZA 5EGVA 3X1HA 1DKFB 4OFUA 5DL4A 5EC9A 3TY0A 3VTBA 3WTQA 3WMHA 4IW8A 2EWPA 5G44A 3ERTA 4LBDA 3P0UA 3TX7B 5KRFA 2YLYA 4OHAA 4KZJA 2P7AA 4MDDA 4G1DA 4XLDA 3KWYA 1RDTD 2Q60A 3DY6A 2PIPL 2NPAA 3FALA 3UU7B 3DZUD 1PDUA 4MGBB 3P88A 4WQPA 4ZNUA 1T74A 3PRGA 3W0JA 3AUNA 1XJ7A 4DM6A 4TUZB 5DZ0A 5AAVA 5G46A 5DV3A 4RUJA 2BJ4B 3OSIA 3F5CB 1R1KA 5DXMA 3VRVA 5DY8A 2JFAA 3TKMA 5DMFA 2HB8A 3UVVB 1Y0SA 5DVSA 5AZVA 4IU7A 1FCXA 5APJA 4ZNVA 5EITA 2VV3A 4J5WA 2AAXA 1NAXA 2PITA 3OSWA 5C4UA 4ZN7A 4NQAB 3P8XA 1U3RA 3FLIA 5E1CA 5FQSA 3OMKA 1PK5A 4WLBA 2J14A 2QXSA 2ZLCA 3ILZA 1PQ9A 3OKHA 4MG7B 5G3JA 3WT5A 5GIDA 2HC4A 3P89A 2Q6SA 4XUMA 1FD0A 4TV1B 2GWXA 4IVWA 3AZ3A 4QE8A 1UHLA 4N73A 4UDDA 4XT9A 1XV9A 3FEIA 4XI3A 3PLZA 4DOSA 3DT3A 2ZLAA 2AX8A 3SZ1A 1T7MA 1FM9A 1RKGA 4JYHA 4MGDA 3CQVA 3H52A 3AX8A 4APUA 1I7IA 2GPPA 4A4VA 5IAWA 5DUGA 4S0TA 5DU5A 1K4WA 3NSQA 3CWDA 1U3SA 4N8RA 1N4HA 4QE6A 5KRLA 4UDBA 2FVJA 3ET3A 3PO9A 2VSTA 2GPOA 3L03A 2ZMJA 4EMAA 4OZTE 2ZY0A 5KCWA 3AN3A 3Q95A 1PQ6A 3A9EA 1EXXA 1XNNA 2J4AA 3ADXA 3ZRBA 1IE8A 1NYXA 5KCTA 4OKBA 5KROA 1T63A 2QZOB 3FEJA 3UP3A 1Z5XE 5G43A 4P6WA 3A2JA 4G2IA 4RWVA 2QA8B 2VV4B 3K23A 5DX3A 1YA3A 2V0VA 3FS1A 3ET0A 4OKXA 5DRMA 3VRUA 3PBAA 2O4RA 2R6YA 3B1MA 4OC7A 1UOMA 2AM9A 2QGTA 4FHHA 4KZMA 3UP0A 1UPWA 3IXPD 3B0WA 4MGAA 3R8DA 2Z4BA 3L3XA 4LSJA 4S14A 2QMVA 3DZYA 1K74A 1RK3A 5GIEA 2PIOA 3WT7A 1KV6A 2AA6A 5B5BA 4DMAA 4E4QA 4HLWA 1R5KA 1XIUA 2Q5PA 4RFWA 5ETHA 4J5XC 3B68A 3WWRA 5IXKA 5G5WA 2B50A 1PRGA 4CSJA 1K7LA 4A4WA 3RUUA 1XNXA 1NQ7A 1RKHA 2PJLA 2XHSA 2ZNQA 5DUEA 1OVLB 2GL8A 4FHIA 2G0GA 2NXXE 1UHLB 1G5YA 1QKMA 3WJ4A 3MNOA 3KMRA 2Q1HA 2BAWA 2HAMA 5DXEA 2ZNNA 2Q7JA 4MGDB 1X78A 4OZTU 2B1ZA 2IOGA 4UDAA 2VSRA 4PVUA 1X76A 5AZTA 5KCFA 1FM6D 5E15A 1T73A 1ZDUA 4REFA 1S19A 1VJBA 4MG6A 1ILHA 1EXAA 1MZNA 4J24A 3OS8C 1NRLA 3GYTA 1OT7A 1Z5XU 1X7BA 2P54A 4IA2A 3VI8A 2Q1VA 2NV7A 3VT8A 1E3GA 3KYTA 2HBHA 5KCDA 4RMEA 4N5GA 2ZFXA 3X36A 2PINA 1IE9A 3B0QA 4POJA 1P93A 1NAVA 3OOFA 5DV6A 4IV4A 2NXXA 5APKA 1XP1A 5DX3B 3WJ5A 4E2JA 1L2JA 5DXPA 3OOKA 3R5NA 4Q13A 3AUQA 4OK1A 1G2NA 4QM0A 2ZBSA 5APHA 2GIUA 3UUDB 1I37A 4FN9A 5DZHA 2ZXZA 5I4VA 3VRWA 2IHQA 4BCRA 4MGAB 2QR9A 2ZL9A 5KD9A 4OZRE 4ZNWA 5DXKA 5JI0D 3W0YA 3ZQTA 5JJMB 1T7RA 2VV1A 4J26A 4OFRA 3B66A 5DI7A 5ICKA 3CDPA 2P1VA 1SJ0A 2AX7A 2YHDA 4F9MA 1ZUCA 3A40X 2ZK5A 2AX6A 4PPSA 4ZNTA 3AFRA 1ILGA 3D90A 3DCTA 3IA6A 3OMOA 4QL8A 2J7XA 1R20D 5DXBB 2I0GA 2H79A 2YATA 4LNXA 4RAKA 2Q59A 2QA6A 1A52A 3OGTA 3HC6A 1XP9A 3V9VA 5DYBA 3G8OA 3VT5A 3GZ9A 4YNKA 2OZ7A 2QNVA 2ZK6A 1GWQA 3EYBA 3LMPA 4WHFA 2GP7A 4XUHA 4POHA 1U9EA 2YFEA 4R06A 4XAOA 5AVLA 3SP6A 3FUGA 5DWIA 2XYWA 3UUAB 2ZMHA 3CS4A 4ZN9A 2AA7A 3CS6A 3WFFA 3R2AA 1XAPA 5FQPA 3UUCA 2PIUA 3V4AA 2YLOA 4JYIA 3A2HA 3BEJA 5DMCA 5DZ1A 3VSOA 2V7CA 4RMCA 2PIWA 3H0AA 1P8DA 1E3KA 1X7JA 3ADWA 1KNUA 1NHZA 3ADUA 3RLLA 4HEEX 2AA5A 1ZGYA 5EI1A 1GWRA 3V9YA 1Y0XX 1R1KD 3O1DA 4X1FA 4YMQA 2NW4A 3W5RA 2QABA 2REWA 2YJAB 3JZCA 4PLEA 1ERRA 4YT1A 3RY9A 3HZFA 2POBA 1T79A 3OKIA 5KCCA 3AURA 5DUHA 3VT4A 5C4SA 5DLRA 1PCGA 5HCVA 1GWXA 2O4JA 1Z95A 3KBAA 5AVIA 3FALB 3KPZA 3V3EA 3VSPA 4EM9A 1X7EA 5K13A 1OSVA 2F4BA 3N00A 5DZ3A 4RUPA 1ZDTA 1YIMA 5EHJA 5L7HA 5AAVB 3ERDA 3OLLA 5GT4A 3B0TA 3ET1A 2Q59B 2AYRA 4OJ9A 4DK8A 1QKTA 1S0XA 3E94A 2JFAB 2ZXMA 1M13A 4ITFA 5E7VA 3WFGA 4E4KA 1YY4A 3M7RA 2B23A 3RVFA 1MVCA 4UDCA 5L7GA 4OKTA 3VT9A 4K4JA 3O1EA 1YUCA 3W0CA 3GWXA 5KR9A 4WVDA 2PNUA 3R8IA 2QE4A 2Q5GA 3DCUA 3CLDA 5JY3A 3BC5A 1FCYA 4JL4A 2AMAA 3ADSA 3TKCA 4CI5A 5FQRA 5DP0A 1R6GA 3B65A 4MG8A 1H9UA 4XHDA 4OH5A 5DKEA 1UPVA 5KYJA 3QT0A 3B0RA 1S9PA 3D5FA 3HVLA 4RZGA 1HG4A 2PRGA 3L0JA 3GD2A 4RZFA 3VHVA 1TFCA 1XV9B 4OEYA 4J5XA 1DKFA 1NQ2A 2Q7LA 5KCEA 4PRGA 3VT6A 2O9IA 3L0EA 2ZASA 5DWGA 2JJ3A 3W5TA 5DKSA 4OILA 5G42A 4K6IA 1N46A 1Q4XA 2FSZA 4S15A 1M7WA 5ACCA 3ZRAA 3G9EA 3D57A 4OEDA 5DK9A 3W0AA 4B7WA 2AWHA 4IA3A 3DZYD 1K74D 3A3ZX 3AZ2A 4NUFA 3W5QA 3K22A 4ZO1X 4IVYA 2HARA 2AMBA 2ZNOA 4MGBA 3W5PA 4DK7A 3L0LA 1A28A 2OAXA 5IZ0A 5KRAA 2G44A 4P6XA 2HWRA 2OVMA 4MGCA 4TUZA 3E00D 4IW6A 2R40A 1T65A 2Q8SA 3A9EB 3GWSX 3Q95B 3VTDA 2BJ4A 5C4OA 2YLQA 1I7GA 2ZKCA 3OS8A 2PIVA 2Q7IA 3KDUA 3PCUA 4OH6A 3UVVA 4IV2A 2Q5SA 3B67A 1YINA 5DKBA 5GICA 4ZNSA 4DORA 4M8EA 2QGWA 1XVPA 1T7TA 4OJ4A 4QJRA 3WT6A 3KDTA 5H1EA 4G2HA 4OIVA 3MNEA 1NDEA 3NSPA 3VN2A 3HC5A 3OZ0A 1NQ1A 2XKWA 1T76A 4JAZA 2PKLA 4IA1A 1L2IA 3HM1A 1BSXA 3IPUA 5DIDA 1U3QA 2W8YA 5KCUA 5FQVA 1RDTA 2Q3YA 3DZUA 1XLSE 1SQNA 3U9QA 2H77A 4OKWA 5G45A 3PEQA 4MG9A 5C4TA 4JYGA 5DWLA 4WPFA 3WGPA 1PZLA 5KRJA 4IS8A 2ZVTA 4PP6A 1WM0X 1XDKA 5KYAA 1YYEA 4NIEA 4ZJWA 3V3QA 5LGAA 4ZO1B 2HVCA 3LBDA 1N83A 4NY9A 2ZK1A 3IMYA 2XYJA 1XB7A 3KFCA 4PWLA 4Q50A 3CTBA 1XP6A 2ZNPA 2E2RA 2GTKA 4ONIA 2AA2A 3CJWA 5DVVA 5HJPA 4PLDA 5HZCA 3GYUA 2HFPA 4Q0AC 5DXRA 2ZK2A 5AWJA 1LBDA 1LV2A 2P15A 4A2JA 5AAUA 4R2UA 2AB2A 4QK4A 3GBKA 3R5MA 3W0IA 2Q7KA 1XLSA 3K8SA 3VJSA 5DXQA 2GPUA 3W0HA 4DM8A 3G8IA 1XZXX 2ATHA 3FURA 2AX9A 5L7EA 2ZK0A 5DXGA 5HJSA 4J5WC 5DV8A 2QZOA 5KRCA 3HO0A 3KMGA 1ZEOA 3OLSA 3T03A 5B41A 2I4PA 2QA8A 2VV4A 5EJVA 4OZRU 1PQCA 5E14A 5E19A 4G1ZA 2A3IA 2ZXNA 3VHWA 3VT3A 1HJ1A 1XVPB 5DSHA 1FBYA 2ZK4A 4ITEA 2OCFA 2QXMA 3X31A 2JF9A 1NUOA 2Q61A 3ADTA 2HASA 4IWFA 3ZR7A 4G1YA 3VT7A 1Y9RA 3E7CA 1YOWA 3OMMA 2Q6RA 4Y29A 1YOKA 4FGYA 3V49A 4M8HA 2VV1B 1NQ0A 1XQ3A 1XQCA 4PP3A 4MG9B 3HODA 4G20A 1SR7A 3HLVA 5DKGA 3X1IA 4OARA 3V9TA 4IA7A 3F7DA 3VTCA 1OVLA 2PIRA 1M2ZA 2PIXA 1T7FA 3H0AD 5HYKA 1XDKB 3OS9A 5DIEA 3R8AA 3VJIA 3MNPA 4OJBA 5KRKA 2ABIA 2OVHA 4R6SA 1XPCA 2ZMIA 1G1UA 4XTAA 2ZK3A 4OEAA 1QKUA 3FXVA 3KMZA 4IWCA 2P1UA 4LNWA 5HJPB 3L1BA 2P7GA 4RE8A 5DWEA 3IXPA 1FM9D 1QKNA 3GN8A 5AYGA 3VJHA 2HWQA 4X1GA 3JZBA 1ZKYA 5M96A 3B5RA 4PP5A 3NOAA 2HCDA 3ADVA 4RMDA 2HB7A 1DB1A 5DRJA 2PIQA 2P1TA 5SYZA 2IOKA 4RUOX 3R29A 1FCZA 2G5OA 2YJDA 3AZ1A 3VRTA 5AWKA 5KRHA 5DTVA 3HQ5A 2ACLA 3IPSA 3OAPA 1I38A 3FC6A 4ZI1A 3AN4A 3BQDA 3D6DA 4IQRA 4ZNHA 3IPQA 4DQMA
chains in the Genus database with same CATH superfamily
2OM9A 2QSEA 3VHUA 3SP9A 5FQTA 4OIUA 1RJKA 3OSAA 5E0WA 1XOWA 3CS8A 3UUDA 2FAIA 2J7YA 1FM6A 2VV2A 4FNEA 1YMTA 3RUTA 3D24A 3DR1A 3OLFA 4REEA 5DZIA 5DVCA 3S9SA 2I4JA 4G21A 5DWJA 4L98A 1KKQA 4RZEA 2I4ZA 2XYXA 2GPVA 4OGHA 5JJMA 2AO6A 3G0WA 3K6PA 3E00A 2G0HA 2P7ZA 1X7RA 4N1YA 1OSHA 4NB6A 3UU7A 5CJ6A 5F9BA 2R6WA 4O8FA 4OLMA 1T5ZA 5DXBA 1YP0A 3OMQA 1S0ZA 3F5CA 2Q70A 1EREA 3A78A 1G50A 2QW4A 3A2IA 5A86A 1ZAFA 3CDSA 1MV9A 5DIGA 5L11A 2LBDA 3ET2A 5DYDA 4IUIA 2AXAA 5AK2A 3UUAA 4YPQA 4ZOMA 3OMPA 2QTUA 5LWPA 3RLJA 2OUZA 2Z4JA 2YLPA 5KRIA 5HYRA 3L3ZA 2POGA 4CI4A 4LTWA 3W0GA 4WHGA 5KRMA 4PPPA 4K7AA 4L96A 2Q6JA 2VV0A 2QH6A 4MG5A 4PF3A 4MG7A 4KZIA 1TXIA 3OZJA 3B3KA 2ACLB 2QPYA 3FC6B 1R20A 2P4YA 1S9QA 4MG8B 2R40D 4TV1A 1YJEA 2I0JA 1ZH7A 5E0XA 4JGVA 3VJTA 1GS4A 1SKXA 4ZJRA 4S0SA 4PXMA 2B1VA 4OEZA 5EGVA 3X1HA 1DKFB 4OFUA 5DL4A 5EC9A 3TY0A 3VTBA 3WTQA 3WMHA 4IW8A 2EWPA 5G44A 3ERTA 4LBDA 3P0UA 3TX7B 5KRFA 2YLYA 4OHAA 4KZJA 2P7AA 4MDDA 4G1DA 4XLDA 3KWYA 1RDTD 2Q60A 3DY6A 2PIPL 2NPAA 3FALA 3UU7B 3DZUD 1PDUA 4MGBB 3P88A 4WQPA 4ZNUA 1T74A 3PRGA 3W0JA 3AUNA 1XJ7A 4DM6A 4TUZB 5DZ0A 5AAVA 5G46A 5DV3A 4RUJA 2BJ4B 3OSIA 3F5CB 1R1KA 5DXMA 3VRVA 5DY8A 2JFAA 3TKMA 5DMFA 2HB8A 3UVVB 1Y0SA 5DVSA 5AZVA 4IU7A 1FCXA 5APJA 4ZNVA 5EITA 2VV3A 4J5WA 2AAXA 1NAXA 2PITA 3OSWA 5C4UA 4ZN7A 4NQAB 3P8XA 1U3RA 3FLIA 5E1CA 5FQSA 3OMKA 1PK5A 4WLBA 2J14A 2QXSA 2ZLCA 3ILZA 1PQ9A 3OKHA 4MG7B 5G3JA 3WT5A 5GIDA 2HC4A 3P89A 2Q6SA 4XUMA 1FD0A 4TV1B 2GWXA 4IVWA 3AZ3A 4QE8A 1UHLA 4N73A 4UDDA 4XT9A 1XV9A 3FEIA 4XI3A 3PLZA 4DOSA 3DT3A 2ZLAA 2AX8A 3SZ1A 1T7MA 1FM9A 1RKGA 4JYHA 4MGDA 3CQVA 3H52A 3AX8A 4APUA 1I7IA 2GPPA 4A4VA 5IAWA 5DUGA 4S0TA 5DU5A 1K4WA 3NSQA 3CWDA 1U3SA 4N8RA 1N4HA 4QE6A 5KRLA 4UDBA 2FVJA 3ET3A 3PO9A 2VSTA 2GPOA 3L03A 2ZMJA 4EMAA 4OZTE 2ZY0A 5KCWA 3AN3A 3Q95A 1PQ6A 3A9EA 1EXXA 1XNNA 2J4AA 3ADXA 3ZRBA 1IE8A 1NYXA 5KCTA 4OKBA 5KROA 1T63A 2QZOB 3FEJA 3UP3A 1Z5XE 5G43A 4P6WA 3A2JA 4G2IA 4RWVA 2QA8B 2VV4B 3K23A 5DX3A 1YA3A 2V0VA 3FS1A 3ET0A 4OKXA 5DRMA 3VRUA 3PBAA 2O4RA 2R6YA 3B1MA 4OC7A 1UOMA 2AM9A 2QGTA 4FHHA 4KZMA 3UP0A 1UPWA 3IXPD 3B0WA 4MGAA 3R8DA 2Z4BA 3L3XA 4LSJA 4S14A 2QMVA 3DZYA 1K74A 1RK3A 5GIEA 2PIOA 3WT7A 1KV6A 2AA6A 5B5BA 4DMAA 4E4QA 4HLWA 1R5KA 1XIUA 2Q5PA 4RFWA 5ETHA 4J5XC 3B68A 3WWRA 5IXKA 5G5WA 2B50A 1PRGA 4CSJA 1K7LA 4A4WA 3RUUA 1XNXA 1NQ7A 1RKHA 2PJLA 2XHSA 2ZNQA 5DUEA 1OVLB 2GL8A 4FHIA 2G0GA 2NXXE 1UHLB 1G5YA 1QKMA 3WJ4A 3MNOA 3KMRA 2Q1HA 2BAWA 2HAMA 5DXEA 2ZNNA 2Q7JA 4MGDB 1X78A 4OZTU 2B1ZA 2IOGA 4UDAA 2VSRA 4PVUA 1X76A 5AZTA 5KCFA 1FM6D 5E15A 1T73A 1ZDUA 4REFA 1S19A 1VJBA 4MG6A 1ILHA 1EXAA 1MZNA 4J24A 3OS8C 1NRLA 3GYTA 1OT7A 1Z5XU 1X7BA 2P54A 4IA2A 3VI8A 2Q1VA 2NV7A 3VT8A 1E3GA 3KYTA 2HBHA 5KCDA 4RMEA 4N5GA 2ZFXA 3X36A 2PINA 1IE9A 3B0QA 4POJA 1P93A 1NAVA 3OOFA 5DV6A 4IV4A 2NXXA 5APKA 1XP1A 5DX3B 3WJ5A 4E2JA 1L2JA 5DXPA 3OOKA 3R5NA 4Q13A 3AUQA 4OK1A 1G2NA 4QM0A 2ZBSA 5APHA 2GIUA 3UUDB 1I37A 4FN9A 5DZHA 2ZXZA 5I4VA 3VRWA 2IHQA 4BCRA 4MGAB 2QR9A 2ZL9A 5KD9A 4OZRE 4ZNWA 5DXKA 5JI0D 3W0YA 3ZQTA 5JJMB 1T7RA 2VV1A 4J26A 4OFRA 3B66A 5DI7A 5ICKA 3CDPA 2P1VA 1SJ0A 2AX7A 2YHDA 4F9MA 1ZUCA 3A40X 2ZK5A 2AX6A 4PPSA 4ZNTA 3AFRA 1ILGA 3D90A 3DCTA 3IA6A 3OMOA 4QL8A 2J7XA 1R20D 5DXBB 2I0GA 2H79A 2YATA 4LNXA 4RAKA 2Q59A 2QA6A 1A52A 3OGTA 3HC6A 1XP9A 3V9VA 5DYBA 3G8OA 3VT5A 3GZ9A 4YNKA 2OZ7A 2QNVA 2ZK6A 1GWQA 3EYBA 3LMPA 4WHFA 2GP7A 4XUHA 4POHA 1U9EA 2YFEA 4R06A 4XAOA 5AVLA 3SP6A 3FUGA 5DWIA 2XYWA 3UUAB 2ZMHA 3CS4A 4ZN9A 2AA7A 3CS6A 3WFFA 3R2AA 1XAPA 5FQPA 3UUCA 2PIUA 3V4AA 2YLOA 4JYIA 3A2HA 3BEJA 5DMCA 5DZ1A 3VSOA 2V7CA 4RMCA 2PIWA 3H0AA 1P8DA 1E3KA 1X7JA 3ADWA 1KNUA 1NHZA 3ADUA 3RLLA 4HEEX 2AA5A 1ZGYA 5EI1A 1GWRA 3V9YA 1Y0XX 1R1KD 3O1DA 4X1FA 4YMQA 2NW4A 3W5RA 2QABA 2REWA 2YJAB 3JZCA 4PLEA 1ERRA 4YT1A 3RY9A 3HZFA 2POBA 1T79A 3OKIA 5KCCA 3AURA 5DUHA 3VT4A 5C4SA 5DLRA 1PCGA 5HCVA 1GWXA 2O4JA 1Z95A 3KBAA 5AVIA 3FALB 3KPZA 3V3EA 3VSPA 4EM9A 1X7EA 5K13A 1OSVA 2F4BA 3N00A 5DZ3A 4RUPA 1ZDTA 1YIMA 5EHJA 5L7HA 5AAVB 3ERDA 3OLLA 5GT4A 3B0TA 3ET1A 2Q59B 2AYRA 4OJ9A 4DK8A 1QKTA 1S0XA 3E94A 2JFAB 2ZXMA 1M13A 4ITFA 5E7VA 3WFGA 4E4KA 1YY4A 3M7RA 2B23A 3RVFA 1MVCA 4UDCA 5L7GA 4OKTA 3VT9A 4K4JA 3O1EA 1YUCA 3W0CA 3GWXA 5KR9A 4WVDA 2PNUA 3R8IA 2QE4A 2Q5GA 3DCUA 3CLDA 5JY3A 3BC5A 1FCYA 4JL4A 2AMAA 3ADSA 3TKCA 4CI5A 5FQRA 5DP0A 1R6GA 3B65A 4MG8A 1H9UA 4XHDA 4OH5A 5DKEA 1UPVA 5KYJA 3QT0A 3B0RA 1S9PA 3D5FA 3HVLA 4RZGA 1HG4A 2PRGA 3L0JA 3GD2A 4RZFA 3VHVA 1TFCA 1XV9B 4OEYA 4J5XA 1DKFA 1NQ2A 2Q7LA 5KCEA 4PRGA 3VT6A 2O9IA 3L0EA 2ZASA 5DWGA 2JJ3A 3W5TA 5DKSA 4OILA 5G42A 4K6IA 1N46A 1Q4XA 2FSZA 4S15A 1M7WA 5ACCA 3ZRAA 3G9EA 3D57A 4OEDA 5DK9A 3W0AA 4B7WA 2AWHA 4IA3A 3DZYD 1K74D 3A3ZX 3AZ2A 4NUFA 3W5QA 3K22A 4ZO1X 4IVYA 2HARA 2AMBA 2ZNOA 4MGBA 3W5PA 4DK7A 3L0LA 1A28A 2OAXA 5IZ0A 5KRAA 2G44A 4P6XA 2HWRA 2OVMA 4MGCA 4TUZA 3E00D 4IW6A 2R40A 1T65A 2Q8SA 3A9EB 3GWSX 3Q95B 3VTDA 2BJ4A 5C4OA 2YLQA 1I7GA 2ZKCA 3OS8A 2PIVA 2Q7IA 3KDUA 3PCUA 4OH6A 3UVVA 4IV2A 2Q5SA 3B67A 1YINA 5DKBA 5GICA 4ZNSA 4DORA 4M8EA 2QGWA 1XVPA 1T7TA 4OJ4A 4QJRA 3WT6A 3KDTA 5H1EA 4G2HA 4OIVA 3MNEA 1NDEA 3NSPA 3VN2A 3HC5A 3OZ0A 1NQ1A 2XKWA 1T76A 4JAZA 2PKLA 4IA1A 1L2IA 3HM1A 1BSXA 3IPUA 5DIDA 1U3QA 2W8YA 5KCUA 5FQVA 1RDTA 2Q3YA 3DZUA 1XLSE 1SQNA 3U9QA 2H77A 4OKWA 5G45A 3PEQA 4MG9A 5C4TA 4JYGA 5DWLA 4WPFA 3WGPA 1PZLA 5KRJA 4IS8A 2ZVTA 4PP6A 1WM0X 1XDKA 5KYAA 1YYEA 4NIEA 4ZJWA 3V3QA 5LGAA 4ZO1B 2HVCA 3LBDA 1N83A 4NY9A 2ZK1A 3IMYA 2XYJA 1XB7A 3KFCA 4PWLA 4Q50A 3CTBA 1XP6A 2ZNPA 2E2RA 2GTKA 4ONIA 2AA2A 3CJWA 5DVVA 5HJPA 4PLDA 5HZCA 3GYUA 2HFPA 4Q0AC 5DXRA 2ZK2A 5AWJA 1LBDA 1LV2A 2P15A 4A2JA 5AAUA 4R2UA 2AB2A 4QK4A 3GBKA 3R5MA 3W0IA 2Q7KA 1XLSA 3K8SA 3VJSA 5DXQA 2GPUA 3W0HA 4DM8A 3G8IA 1XZXX 2ATHA 3FURA 2AX9A 5L7EA 2ZK0A 5DXGA 5HJSA 4J5WC 5DV8A 2QZOA 5KRCA 3HO0A 3KMGA 1ZEOA 3OLSA 3T03A 5B41A 2I4PA 2QA8A 2VV4A 5EJVA 4OZRU 1PQCA 5E14A 5E19A 4G1ZA 2A3IA 2ZXNA 3VHWA 3VT3A 1HJ1A 1XVPB 5DSHA 1FBYA 2ZK4A 4ITEA 2OCFA 2QXMA 3X31A 2JF9A 1NUOA 2Q61A 3ADTA 2HASA 4IWFA 3ZR7A 4G1YA 3VT7A 1Y9RA 3E7CA 1YOWA 3OMMA 2Q6RA 4Y29A 1YOKA 4FGYA 3V49A 4M8HA 2VV1B 1NQ0A 1XQ3A 1XQCA 4PP3A 4MG9B 3HODA 4G20A 1SR7A 3HLVA 5DKGA 3X1IA 4OARA 3V9TA 4IA7A 3F7DA 3VTCA 1OVLA 2PIRA 1M2ZA 2PIXA 1T7FA 3H0AD 5HYKA 1XDKB 3OS9A 5DIEA 3R8AA 3VJIA 3MNPA 4OJBA 5KRKA 2ABIA 2OVHA 4R6SA 1XPCA 2ZMIA 1G1UA 4XTAA 2ZK3A 4OEAA 1QKUA 3FXVA 3KMZA 4IWCA 2P1UA 4LNWA 5HJPB 3L1BA 2P7GA 4RE8A 5DWEA 3IXPA 1FM9D 1QKNA 3GN8A 5AYGA 3VJHA 2HWQA 4X1GA 3JZBA 1ZKYA 5M96A 3B5RA 4PP5A 3NOAA 2HCDA 3ADVA 4RMDA 2HB7A 1DB1A 5DRJA 2PIQA 2P1TA 5SYZA 2IOKA 4RUOX 3R29A 1FCZA 2G5OA 2YJDA 3AZ1A 3VRTA 5AWKA 5KRHA 5DTVA 3HQ5A 2ACLA 3IPSA 3OAPA 1I38A 3FC6A 4ZI1A 3AN4A 3BQDA 3D6DA 4IQRA 4ZNHA 3IPQA 4DQMA
chains in the Genus database with same CATH topology
2OM9A 2QSEA 3VHUA 3SP9A 5FQTA 4OIUA 1RJKA 3OSAA 5E0WA 1XOWA 3CS8A 3UUDA 2FAIA 2J7YA 1FM6A 2VV2A 4FNEA 1YMTA 3RUTA 3D24A 3DR1A 3OLFA 4REEA 5DZIA 5DVCA 3S9SA 2I4JA 4G21A 5DWJA 4L98A 1KKQA 4RZEA 2I4ZA 2XYXA 2GPVA 4OGHA 5JJMA 2AO6A 3G0WA 3K6PA 3E00A 2G0HA 2P7ZA 1X7RA 4N1YA 1OSHA 4NB6A 3UU7A 5CJ6A 5F9BA 2R6WA 4O8FA 4OLMA 1T5ZA 5DXBA 1YP0A 3OMQA 1S0ZA 3F5CA 2Q70A 1EREA 3A78A 1G50A 2QW4A 3A2IA 5A86A 1ZAFA 3CDSA 1MV9A 5DIGA 5L11A 2LBDA 3ET2A 5DYDA 4IUIA 2AXAA 5AK2A 3UUAA 4YPQA 4ZOMA 3OMPA 2QTUA 5LWPA 3RLJA 2OUZA 2Z4JA 2YLPA 5KRIA 5HYRA 3L3ZA 2POGA 4CI4A 4LTWA 3W0GA 4WHGA 5KRMA 4PPPA 4K7AA 4L96A 2Q6JA 2VV0A 2QH6A 4MG5A 4PF3A 4MG7A 4KZIA 1TXIA 3OZJA 3B3KA 2ACLB 2QPYA 3FC6B 1R20A 2P4YA 1S9QA 4MG8B 2R40D 4TV1A 1YJEA 2I0JA 1ZH7A 5E0XA 4JGVA 3VJTA 1GS4A 1SKXA 4ZJRA 4S0SA 4PXMA 2B1VA 4OEZA 5EGVA 3X1HA 1DKFB 4OFUA 5DL4A 5EC9A 3TY0A 3VTBA 3WTQA 3WMHA 4IW8A 2EWPA 5G44A 3ERTA 4LBDA 3P0UA 3TX7B 5KRFA 2YLYA 4OHAA 4KZJA 2P7AA 4MDDA 4G1DA 4XLDA 3KWYA 1RDTD 2Q60A 3DY6A 2PIPL 2NPAA 3FALA 3UU7B 3DZUD 1PDUA 4MGBB 3P88A 4WQPA 4ZNUA 1T74A 3PRGA 3W0JA 3AUNA 1XJ7A 4DM6A 4TUZB 5DZ0A 5AAVA 5G46A 5DV3A 4RUJA 2BJ4B 3OSIA 3F5CB 1R1KA 5DXMA 3VRVA 5DY8A 2JFAA 3TKMA 5DMFA 2HB8A 3UVVB 1Y0SA 5DVSA 5AZVA 4IU7A 1FCXA 5APJA 4ZNVA 5EITA 2VV3A 4J5WA 2AAXA 1NAXA 2PITA 3OSWA 5C4UA 4ZN7A 4NQAB 3P8XA 1U3RA 3FLIA 5E1CA 5FQSA 3OMKA 1PK5A 4WLBA 2J14A 2QXSA 2ZLCA 3ILZA 1PQ9A 3OKHA 4MG7B 5G3JA 3WT5A 5GIDA 2HC4A 3P89A 2Q6SA 4XUMA 1FD0A 4TV1B 2GWXA 4IVWA 3AZ3A 4QE8A 1UHLA 4N73A 4UDDA 4XT9A 1XV9A 3FEIA 4XI3A 3PLZA 4DOSA 3DT3A 2ZLAA 2AX8A 3SZ1A 1T7MA 1FM9A 1RKGA 4JYHA 4MGDA 3CQVA 3H52A 3AX8A 4APUA 1I7IA 2GPPA 4A4VA 5IAWA 5DUGA 4S0TA 5DU5A 1K4WA 3NSQA 3CWDA 1U3SA 4N8RA 1N4HA 4QE6A 5KRLA 4UDBA 2FVJA 3ET3A 3PO9A 2VSTA 2GPOA 3L03A 2ZMJA 4EMAA 4OZTE 2ZY0A 5KCWA 3AN3A 3Q95A 1PQ6A 3A9EA 1EXXA 1XNNA 2J4AA 3ADXA 3ZRBA 1IE8A 1NYXA 5KCTA 4OKBA 5KROA 1T63A 2QZOB 3FEJA 3UP3A 1Z5XE 5G43A 4P6WA 3A2JA 4G2IA 4RWVA 2QA8B 2VV4B 3K23A 5DX3A 1YA3A 2V0VA 3FS1A 3ET0A 4OKXA 5DRMA 3VRUA 3PBAA 2O4RA 2R6YA 3B1MA 4OC7A 1UOMA 2AM9A 2QGTA 4FHHA 4KZMA 3UP0A 1UPWA 3IXPD 3B0WA 4MGAA 3R8DA 2Z4BA 3L3XA 4LSJA 4S14A 2QMVA 3DZYA 1K74A 1RK3A 5GIEA 2PIOA 3WT7A 1KV6A 2AA6A 5B5BA 4DMAA 4E4QA 4HLWA 1R5KA 1XIUA 2Q5PA 4RFWA 5ETHA 4J5XC 3B68A 3WWRA 5IXKA 5G5WA 2B50A 1PRGA 4CSJA 1K7LA 4A4WA 3RUUA 1XNXA 1NQ7A 1RKHA 2PJLA 2XHSA 2ZNQA 5DUEA 1OVLB 2GL8A 4FHIA 2G0GA 2NXXE 1UHLB 1G5YA 1QKMA 3WJ4A 3MNOA 3KMRA 2Q1HA 2BAWA 2HAMA 5DXEA 2ZNNA 2Q7JA 4MGDB 1X78A 4OZTU 2B1ZA 2IOGA 4UDAA 2VSRA 4PVUA 1X76A 5AZTA 5KCFA 1FM6D 5E15A 1T73A 1ZDUA 4REFA 1S19A 1VJBA 4MG6A 1ILHA 1EXAA 1MZNA 4J24A 3OS8C 1NRLA 3GYTA 1OT7A 1Z5XU 1X7BA 2P54A 4IA2A 3VI8A 2Q1VA 2NV7A 3VT8A 1E3GA 3KYTA 2HBHA 5KCDA 4RMEA 4N5GA 2ZFXA 3X36A 2PINA 1IE9A 3B0QA 4POJA 1P93A 1NAVA 3OOFA 5DV6A 4IV4A 2NXXA 5APKA 1XP1A 5DX3B 3WJ5A 4E2JA 1L2JA 5DXPA 3OOKA 3R5NA 4Q13A 3AUQA 4OK1A 1G2NA 4QM0A 2ZBSA 5APHA 2GIUA 3UUDB 1I37A 4FN9A 5DZHA 2ZXZA 5I4VA 3VRWA 2IHQA 4BCRA 4MGAB 2QR9A 2ZL9A 5KD9A 4OZRE 4ZNWA 5DXKA 5JI0D 3W0YA 3ZQTA 5JJMB 1T7RA 2VV1A 4J26A 4OFRA 3B66A 5DI7A 5ICKA 3CDPA 2P1VA 1SJ0A 2AX7A 2YHDA 4F9MA 1ZUCA 3A40X 2ZK5A 2AX6A 4PPSA 4ZNTA 3AFRA 1ILGA 3D90A 3DCTA 3IA6A 3OMOA 4QL8A 2J7XA 1R20D 5DXBB 2I0GA 2H79A 2YATA 4LNXA 4RAKA 2Q59A 2QA6A 1A52A 3OGTA 3HC6A 1XP9A 3V9VA 5DYBA 3G8OA 3VT5A 3GZ9A 4YNKA 2OZ7A 2QNVA 2ZK6A 1GWQA 3EYBA 3LMPA 4WHFA 2GP7A 4XUHA 4POHA 1U9EA 2YFEA 4R06A 4XAOA 5AVLA 3SP6A 3FUGA 5DWIA 2XYWA 3UUAB 2ZMHA 3CS4A 4ZN9A 2AA7A 3CS6A 3WFFA 3R2AA 1XAPA 5FQPA 3UUCA 2PIUA 3V4AA 2YLOA 4JYIA 3A2HA 3BEJA 5DMCA 5DZ1A 3VSOA 2V7CA 4RMCA 2PIWA 3H0AA 1P8DA 1E3KA 1X7JA 3ADWA 1KNUA 1NHZA 3ADUA 3RLLA 4HEEX 2AA5A 1ZGYA 5EI1A 1GWRA 3V9YA 1Y0XX 1R1KD 3O1DA 4X1FA 4YMQA 2NW4A 3W5RA 2QABA 2REWA 2YJAB 3JZCA 4PLEA 1ERRA 4YT1A 3RY9A 3HZFA 2POBA 1T79A 3OKIA 5KCCA 3AURA 5DUHA 3VT4A 5C4SA 5DLRA 1PCGA 5HCVA 1GWXA 2O4JA 1Z95A 3KBAA 5AVIA 3FALB 3KPZA 3V3EA 3VSPA 4EM9A 1X7EA 5K13A 1OSVA 2F4BA 3N00A 5DZ3A 4RUPA 1ZDTA 1YIMA 5EHJA 5L7HA 5AAVB 3ERDA 3OLLA 5GT4A 3B0TA 3ET1A 2Q59B 2AYRA 4OJ9A 4DK8A 1QKTA 1S0XA 3E94A 2JFAB 2ZXMA 1M13A 4ITFA 5E7VA 3WFGA 4E4KA 1YY4A 3M7RA 2B23A 3RVFA 1MVCA 4UDCA 5L7GA 4OKTA 3VT9A 4K4JA 3O1EA 1YUCA 3W0CA 3GWXA 5KR9A 4WVDA 2PNUA 3R8IA 2QE4A 2Q5GA 3DCUA 3CLDA 5JY3A 3BC5A 1FCYA 4JL4A 2AMAA 3ADSA 3TKCA 4CI5A 5FQRA 5DP0A 1R6GA 3B65A 4MG8A 1H9UA 4XHDA 4OH5A 5DKEA 1UPVA 5KYJA 3QT0A 3B0RA 1S9PA 3D5FA 3HVLA 4RZGA 1HG4A 2PRGA 3L0JA 3GD2A 4RZFA 3VHVA 1TFCA 1XV9B 4OEYA 4J5XA 1DKFA 1NQ2A 2Q7LA 5KCEA 4PRGA 3VT6A 2O9IA 3L0EA 2ZASA 5DWGA 2JJ3A 3W5TA 5DKSA 4OILA 5G42A 4K6IA 1N46A 1Q4XA 2FSZA 4S15A 1M7WA 5ACCA 3ZRAA 3G9EA 3D57A 4OEDA 5DK9A 3W0AA 4B7WA 2AWHA 4IA3A 3DZYD 1K74D 3A3ZX 3AZ2A 4NUFA 3W5QA 3K22A 4ZO1X 4IVYA 2HARA 2AMBA 2ZNOA 4MGBA 3W5PA 4DK7A 3L0LA 1A28A 2OAXA 5IZ0A 5KRAA 2G44A 4P6XA 2HWRA 2OVMA 4MGCA 4TUZA 3E00D 4IW6A 2R40A 1T65A 2Q8SA 3A9EB 3GWSX 3Q95B 3VTDA 2BJ4A 5C4OA 2YLQA 1I7GA 2ZKCA 3OS8A 2PIVA 2Q7IA 3KDUA 3PCUA 4OH6A 3UVVA 4IV2A 2Q5SA 3B67A 1YINA 5DKBA 5GICA 4ZNSA 4DORA 4M8EA 2QGWA 1XVPA 1T7TA 4OJ4A 4QJRA 3WT6A 3KDTA 5H1EA 4G2HA 4OIVA 3MNEA 1NDEA 3NSPA 3VN2A 3HC5A 3OZ0A 1NQ1A 2XKWA 1T76A 4JAZA 2PKLA 4IA1A 1L2IA 3HM1A 1BSXA 3IPUA 5DIDA 1U3QA 2W8YA 5KCUA 5FQVA 1RDTA 2Q3YA 3DZUA 1XLSE 1SQNA 3U9QA 2H77A 4OKWA 5G45A 3PEQA 4MG9A 5C4TA 4JYGA 5DWLA 4WPFA 3WGPA 1PZLA 5KRJA 4IS8A 2ZVTA 4PP6A 1WM0X 1XDKA 5KYAA 1YYEA 4NIEA 4ZJWA 3V3QA 5LGAA 4ZO1B 2HVCA 3LBDA 1N83A 4NY9A 2ZK1A 3IMYA 2XYJA 1XB7A 3KFCA 4PWLA 4Q50A 3CTBA 1XP6A 2ZNPA 2E2RA 2GTKA 4ONIA 2AA2A 3CJWA 5DVVA 5HJPA 4PLDA 5HZCA 3GYUA 2HFPA 4Q0AC 5DXRA 2ZK2A 5AWJA 1LBDA 1LV2A 2P15A 4A2JA 5AAUA 4R2UA 2AB2A 4QK4A 3GBKA 3R5MA 3W0IA 2Q7KA 1XLSA 3K8SA 3VJSA 5DXQA 2GPUA 3W0HA 4DM8A 3G8IA 1XZXX 2ATHA 3FURA 2AX9A 5L7EA 2ZK0A 5DXGA 5HJSA 4J5WC 5DV8A 2QZOA 5KRCA 3HO0A 3KMGA 1ZEOA 3OLSA 3T03A 5B41A 2I4PA 2QA8A 2VV4A 5EJVA 4OZRU 1PQCA 5E14A 5E19A 4G1ZA 2A3IA 2ZXNA 3VHWA 3VT3A 1HJ1A 1XVPB 5DSHA 1FBYA 2ZK4A 4ITEA 2OCFA 2QXMA 3X31A 2JF9A 1NUOA 2Q61A 3ADTA 2HASA 4IWFA 3ZR7A 4G1YA 3VT7A 1Y9RA 3E7CA 1YOWA 3OMMA 2Q6RA 4Y29A 1YOKA 4FGYA 3V49A 4M8HA 2VV1B 1NQ0A 1XQ3A 1XQCA 4PP3A 4MG9B 3HODA 4G20A 1SR7A 3HLVA 5DKGA 3X1IA 4OARA 3V9TA 4IA7A 3F7DA 3VTCA 1OVLA 2PIRA 1M2ZA 2PIXA 1T7FA 3H0AD 5HYKA 1XDKB 3OS9A 5DIEA 3R8AA 3VJIA 3MNPA 4OJBA 5KRKA 2ABIA 2OVHA 4R6SA 1XPCA 2ZMIA 1G1UA 4XTAA 2ZK3A 4OEAA 1QKUA 3FXVA 3KMZA 4IWCA 2P1UA 4LNWA 5HJPB 3L1BA 2P7GA 4RE8A 5DWEA 3IXPA 1FM9D 1QKNA 3GN8A 5AYGA 3VJHA 2HWQA 4X1GA 3JZBA 1ZKYA 5M96A 3B5RA 4PP5A 3NOAA 2HCDA 3ADVA 4RMDA 2HB7A 1DB1A 5DRJA 2PIQA 2P1TA 5SYZA 2IOKA 4RUOX 3R29A 1FCZA 2G5OA 2YJDA 3AZ1A 3VRTA 5AWKA 5KRHA 5DTVA 3HQ5A 2ACLA 3IPSA 3OAPA 1I38A 3FC6A 4ZI1A 3AN4A 3BQDA 3D6DA 4IQRA 4ZNHA 3IPQA 4DQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OM9 A;  2QSE A;  3VHU A;  3SP9 A;  5FQT A;  4OIU A;  1RJK A;  3OSA A;  5E0W A;  1XOW A;  3CS8 A;  3UUD A;  2FAI A;  2J7Y A;  1FM6 A;  2VV2 A;  4FNE A;  1YMT A;  3RUT A;  3D24 A;  3DR1 A;  3OLF A;  4REE A;  5DZI A;  5DVC A;  3S9S A;  2I4J A;  4G21 A;  5DWJ A;  4L98 A;  1KKQ A;  4RZE A;  2I4Z A;  2XYX A;  2GPV A;  4OGH A;  5JJM A;  2AO6 A;  3G0W A;  3K6P A;  3E00 A;  2G0H A;  2P7Z A;  1X7R A;  4N1Y A;  1OSH A;  4NB6 A;  3UU7 A;  5CJ6 A;  5F9B A;  2R6W A;  4O8F A;  4OLM A;  1T5Z A;  5DXB A;  1YP0 A;  3OMQ A;  1S0Z A;  3F5C A;  2Q70 A;  1ERE A;  3A78 A;  1G50 A;  2QW4 A;  3A2I A;  5A86 A;  1ZAF A;  3CDS A;  1MV9 A;  5DIG A;  5L11 A;  2LBD A;  3ET2 A;  5DYD A;  4IUI A;  2AXA A;  5AK2 A;  3UUA A;  4YPQ A;  4ZOM A;  3OMP A;  2QTU A;  5LWP A;  3RLJ A;  2OUZ A;  2Z4J A;  2YLP A;  5KRI A;  5HYR A;  3L3Z A;  2POG A;  4CI4 A;  4LTW A;  3W0G A;  4WHG A;  5KRM A;  4PPP A;  4K7A A;  4L96 A;  2Q6J A;  2VV0 A;  2QH6 A;  4MG5 A;  4PF3 A;  4MG7 A;  4KZI A;  1TXI A;  3OZJ A;  3B3K A;  2ACL B;  2QPY A;  3FC6 B;  1R20 A;  2P4Y A;  1S9Q A;  4MG8 B;  2R40 D;  4TV1 A;  1YJE A;  2I0J A;  1ZH7 A;  5E0X A;  4JGV A;  3VJT A;  1GS4 A;  1SKX A;  4ZJR A;  4S0S A;  4PXM A;  2B1V A;  4OEZ A;  5EGV A;  3X1H A;  1DKF B;  4OFU A;  5DL4 A;  5EC9 A;  3TY0 A;  3VTB A;  3WTQ A;  3WMH A;  4IW8 A;  2EWP A;  5G44 A;  3ERT A;  4LBD A;  3P0U A;  3TX7 B;  5KRF A;  2YLY A;  4OHA A;  4KZJ A;  2P7A A;  4MDD A;  4G1D A;  4XLD A;  3KWY A;  1RDT D;  2Q60 A;  3DY6 A;  2PIP L;  2NPA A;  3FAL A;  3UU7 B;  3DZU D;  1PDU A;  4MGB B;  3P88 A;  4WQP A;  4ZNU A;  1T74 A;  3PRG A;  3W0J A;  3AUN A;  1XJ7 A;  4DM6 A;  4TUZ B;  5DZ0 A;  5AAV A;  5G46 A;  5DV3 A;  4RUJ A;  2BJ4 B;  3OSI A;  3F5C B;  1R1K A;  5DXM A;  3VRV A;  5DY8 A;  2JFA A;  3TKM A;  5DMF A;  2HB8 A;  3UVV B;  1Y0S A;  5DVS A;  5AZV A;  4IU7 A;  1FCX A;  5APJ A;  4ZNV A;  5EIT A;  2VV3 A;  4J5W A;  2AAX A;  1NAX A;  2PIT A;  3OSW A;  5C4U A;  4ZN7 A;  4NQA B;  3P8X A;  1U3R A;  3FLI A;  5E1C A;  5FQS A;  3OMK A;  1PK5 A;  4WLB A;  2J14 A;  2QXS A;  2ZLC A;  3ILZ A;  1PQ9 A;  3OKH A;  4MG7 B;  5G3J A;  3WT5 A;  5GID A;  2HC4 A;  3P89 A;  2Q6S A;  4XUM A;  1FD0 A;  4TV1 B;  2GWX A;  4IVW A;  3AZ3 A;  4QE8 A;  1UHL A;  4N73 A;  4UDD A;  4XT9 A;  1XV9 A;  3FEI A;  4XI3 A;  3PLZ A;  4DOS A;  3DT3 A;  2ZLA A;  2AX8 A;  3SZ1 A;  1T7M A;  1FM9 A;  1RKG A;  4JYH A;  4MGD A;  3CQV A;  3H52 A;  3AX8 A;  4APU A;  1I7I A;  2GPP A;  4A4V A;  5IAW A;  5DUG A;  4S0T A;  5DU5 A;  1K4W A;  3NSQ A;  3CWD A;  1U3S A;  4N8R A;  1N4H A;  4QE6 A;  5KRL A;  4UDB A;  2FVJ A;  3ET3 A;  3PO9 A;  2VST A;  2GPO A;  3L03 A;  2ZMJ A;  4EMA A;  4OZT E;  2ZY0 A;  5KCW A;  3AN3 A;  3Q95 A;  1PQ6 A;  3A9E A;  1EXX A;  1XNN A;  2J4A A;  3ADX A;  3ZRB A;  1IE8 A;  1NYX A;  5KCT A;  4OKB A;  5KRO A;  1T63 A;  2QZO B;  3FEJ A;  3UP3 A;  1Z5X E;  5G43 A;  4P6W A;  3A2J A;  4G2I A;  4RWV A;  2QA8 B;  2VV4 B;  3K23 A;  5DX3 A;  1YA3 A;  2V0V A;  3FS1 A;  3ET0 A;  4OKX A;  5DRM A;  3VRU A;  3PBA A;  2O4R A;  2R6Y A;  3B1M A;  4OC7 A;  1UOM A;  2AM9 A;  2QGT A;  4FHH A;  4KZM A;  3UP0 A;  1UPW A;  3IXP D;  3B0W A;  4MGA A;  3R8D A;  2Z4B A;  3L3X A;  4LSJ A;  4S14 A;  2QMV A;  3DZY A;  1K74 A;  1RK3 A;  5GIE A;  2PIO A;  3WT7 A;  1KV6 A;  2AA6 A;  5B5B A;  4DMA A;  4E4Q A;  4HLW A;  1R5K A;  1XIU A;  2Q5P A;  4RFW A;  5ETH A;  4J5X C;  3B68 A;  3WWR A;  5IXK A;  5G5W A;  2B50 A;  1PRG A;  4CSJ A;  1K7L A;  4A4W A;  3RUU A;  1XNX A;  1NQ7 A;  1RKH A;  2PJL A;  2XHS A;  2ZNQ A;  5DUE A;  1OVL B;  2GL8 A;  4FHI A;  2G0G A;  2NXX E;  1UHL B;  1G5Y A;  1QKM A;  3WJ4 A;  3MNO A;  3KMR A;  2Q1H A;  2BAW A;  2HAM A;  5DXE A;  2ZNN A;  2Q7J A;  4MGD B;  1X78 A;  4OZT U;  2B1Z A;  2IOG A;  4UDA A;  2VSR A;  4PVU A;  1X76 A;  5AZT A;  5KCF A;  1FM6 D;  5E15 A;  1T73 A;  1ZDU A;  4REF A;  1S19 A;  1VJB A;  4MG6 A;  1ILH A;  1EXA A;  1MZN A;  4J24 A;  3OS8 C;  1NRL A;  3GYT A;  1OT7 A;  1Z5X U;  1X7B A;  2P54 A;  4IA2 A;  3VI8 A;  2Q1V A;  2NV7 A;  3VT8 A;  1E3G A;  3KYT A;  2HBH A;  5KCD A;  4RME A;  4N5G A;  2ZFX A;  3X36 A;  2PIN A;  1IE9 A;  3B0Q A;  4POJ A;  1P93 A;  1NAV A;  3OOF A;  5DV6 A;  4IV4 A;  2NXX A;  5APK A;  1XP1 A;  5DX3 B;  3WJ5 A;  4E2J A;  1L2J A;  5DXP A;  3OOK A;  3R5N A;  4Q13 A;  3AUQ A;  4OK1 A;  1G2N A;  4QM0 A;  2ZBS A;  5APH A;  2GIU A;  3UUD B;  1I37 A;  4FN9 A;  5DZH A;  2ZXZ A;  5I4V A;  3VRW A;  2IHQ A;  4BCR A;  4MGA B;  2QR9 A;  2ZL9 A;  5KD9 A;  4OZR E;  4ZNW A;  5DXK A;  5JI0 D;  3W0Y A;  3ZQT A;  5JJM B;  1T7R A;  2VV1 A;  4J26 A;  4OFR A;  3B66 A;  5DI7 A;  5ICK A;  3CDP A;  2P1V A;  1SJ0 A;  2AX7 A;  2YHD A;  4F9M A;  1ZUC A;  3A40 X;  2ZK5 A;  2AX6 A;  4PPS A;  4ZNT A;  3AFR A;  1ILG A;  3D90 A;  3DCT A;  3IA6 A;  3OMO A;  4QL8 A;  2J7X A;  1R20 D;  5DXB B;  2I0G A;  2H79 A;  2YAT A;  4LNX A;  4RAK A;  2Q59 A;  2QA6 A;  1A52 A;  3OGT A;  3HC6 A;  1XP9 A;  3V9V A;  5DYB A;  3G8O A;  3VT5 A;  3GZ9 A;  4YNK A;  2OZ7 A;  2QNV A;  2ZK6 A;  1GWQ A;  3EYB A;  3LMP A;  4WHF A;  2GP7 A;  4XUH A;  4POH A;  1U9E A;  2YFE A;  4R06 A;  4XAO A;  5AVL A;  3SP6 A;  3FUG A;  5DWI A;  2XYW A;  3UUA B;  2ZMH A;  3CS4 A;  4ZN9 A;  2AA7 A;  3CS6 A;  3WFF A;  3R2A A;  1XAP A;  5FQP A;  3UUC A;  2PIU A;  3V4A A;  2YLO A;  4JYI A;  3A2H A;  3BEJ A;  5DMC A;  5DZ1 A;  3VSO A;  2V7C A;  4RMC A;  2PIW A;  3H0A A;  1P8D A;  1E3K A;  1X7J A;  3ADW A;  1KNU A;  1NHZ A;  3ADU A;  3RLL A;  4HEE X;  2AA5 A;  1ZGY A;  5EI1 A;  1GWR A;  3V9Y A;  1Y0X X;  1R1K D;  3O1D A;  4X1F A;  4YMQ A;  2NW4 A;  3W5R A;  2QAB A;  2REW A;  2YJA B;  3JZC A;  4PLE A;  1ERR A;  4YT1 A;  3RY9 A;  3HZF A;  2POB A;  1T79 A;  3OKI A;  5KCC A;  3AUR A;  5DUH A;  3VT4 A;  5C4S A;  5DLR A;  1PCG A;  5HCV A;  1GWX A;  2O4J A;  1Z95 A;  3KBA A;  5AVI A;  3FAL B;  3KPZ A;  3V3E A;  3VSP A;  4EM9 A;  1X7E A;  5K13 A;  1OSV A;  2F4B A;  3N00 A;  5DZ3 A;  4RUP A;  1ZDT A;  1YIM A;  5EHJ A;  5L7H A;  5AAV B;  3ERD A;  3OLL A;  5GT4 A;  3B0T A;  3ET1 A;  2Q59 B;  2AYR A;  4OJ9 A;  4DK8 A;  1QKT A;  1S0X A;  3E94 A;  2JFA B;  2ZXM A;  1M13 A;  4ITF A;  5E7V A;  3WFG A;  4E4K A;  1YY4 A;  3M7R A;  2B23 A;  3RVF A;  1MVC A;  4UDC A;  5L7G A;  4OKT A;  3VT9 A;  4K4J A;  3O1E A;  1YUC A;  3W0C A;  3GWX A;  5KR9 A;  4WVD A;  2PNU A;  3R8I A;  2QE4 A;  2Q5G A;  3DCU A;  3CLD A;  5JY3 A;  3BC5 A;  1FCY A;  4JL4 A;  2AMA A;  3ADS A;  3TKC A;  4CI5 A;  5FQR A;  5DP0 A;  1R6G A;  3B65 A;  4MG8 A;  1H9U A;  4XHD A;  4OH5 A;  5DKE A;  1UPV A;  5KYJ A;  3QT0 A;  3B0R A;  1S9P A;  3D5F A;  3HVL A;  4RZG A;  1HG4 A;  2PRG A;  3L0J A;  3GD2 A;  4RZF A;  3VHV A;  1TFC A;  1XV9 B;  4OEY A;  4J5X A;  1DKF A;  1NQ2 A;  2Q7L A;  5KCE A;  4PRG A;  3VT6 A;  2O9I A;  3L0E A;  2ZAS A;  5DWG A;  2JJ3 A;  3W5T A;  5DKS A;  4OIL A;  5G42 A;  4K6I A;  1N46 A;  1Q4X A;  2FSZ A;  4S15 A;  1M7W A;  5ACC A;  3ZRA A;  3G9E A;  3D57 A;  4OED A;  5DK9 A;  3W0A A;  4B7W A;  2AWH A;  4IA3 A;  3DZY D;  1K74 D;  3A3Z X;  3AZ2 A;  4NUF A;  3W5Q A;  3K22 A;  4ZO1 X;  4IVY A;  2HAR A;  2AMB A;  2ZNO A;  4MGB A;  3W5P A;  4DK7 A;  3L0L A;  1A28 A;  2OAX A;  5IZ0 A;  5KRA A;  2G44 A;  4P6X A;  2HWR A;  2OVM A;  4MGC A;  4TUZ A;  3E00 D;  4IW6 A;  2R40 A;  1T65 A;  2Q8S A;  3A9E B;  3GWS X;  3Q95 B;  3VTD A;  2BJ4 A;  5C4O A;  2YLQ A;  1I7G A;  2ZKC A;  3OS8 A;  2PIV A;  2Q7I A;  3KDU A;  3PCU A;  4OH6 A;  3UVV A;  4IV2 A;  2Q5S A;  3B67 A;  1YIN A;  5DKB A;  5GIC A;  4ZNS A;  4DOR A;  4M8E A;  2QGW A;  1XVP A;  1T7T A;  4OJ4 A;  4QJR A;  3WT6 A;  3KDT A;  5H1E A;  4G2H A;  4OIV A;  3MNE A;  1NDE A;  3NSP A;  3VN2 A;  3HC5 A;  3OZ0 A;  1NQ1 A;  2XKW A;  1T76 A;  4JAZ A;  2PKL A;  4IA1 A;  1L2I A;  3HM1 A;  1BSX A;  3IPU A;  5DID A;  1U3Q A;  2W8Y A;  5KCU A;  5FQV A;  1RDT A;  2Q3Y A;  3DZU A;  1XLS E;  1SQN A;  3U9Q A;  2H77 A;  4OKW A;  5G45 A;  3PEQ A;  4MG9 A;  5C4T A;  4JYG A;  5DWL A;  4WPF A;  3WGP A;  1PZL A;  5KRJ A;  4IS8 A;  2ZVT A;  4PP6 A;  1WM0 X;  1XDK A;  5KYA A;  1YYE A;  4NIE A;  4ZJW A;  3V3Q A;  5LGA A;  4ZO1 B;  2HVC A;  3LBD A;  1N83 A;  4NY9 A;  2ZK1 A;  3IMY A;  2XYJ A;  1XB7 A;  3KFC A;  4PWL A;  4Q50 A;  3CTB A;  1XP6 A;  2ZNP A;  2E2R A;  2GTK A;  4ONI A;  2AA2 A;  3CJW A;  5DVV A;  5HJP A;  4PLD A;  5HZC A;  3GYU A;  2HFP A;  4Q0A C;  5DXR A;  2ZK2 A;  5AWJ A;  1LBD A;  1LV2 A;  2P15 A;  4A2J A;  5AAU A;  4R2U A;  2AB2 A;  4QK4 A;  3GBK A;  3R5M A;  3W0I A;  2Q7K A;  1XLS A;  3K8S A;  3VJS A;  5DXQ A;  2GPU A;  3W0H A;  4DM8 A;  3G8I A;  1XZX X;  2ATH A;  3FUR A;  2AX9 A;  5L7E A;  2ZK0 A;  5DXG A;  5HJS A;  4J5W C;  5DV8 A;  2QZO A;  5KRC A;  3HO0 A;  3KMG A;  1ZEO A;  3OLS A;  3T03 A;  5B41 A;  2I4P A;  2QA8 A;  2VV4 A;  5EJV A;  4OZR U;  1PQC A;  5E14 A;  5E19 A;  4G1Z A;  2A3I A;  2ZXN A;  3VHW A;  3VT3 A;  1HJ1 A;  1XVP B;  5DSH A;  1FBY A;  2ZK4 A;  4ITE A;  2OCF A;  2QXM A;  3X31 A;  2JF9 A;  1NUO A;  2Q61 A;  3ADT A;  2HAS A;  4IWF A;  3ZR7 A;  4G1Y A;  3VT7 A;  1Y9R A;  3E7C A;  1YOW A;  3OMM A;  2Q6R A;  4Y29 A;  1YOK A;  4FGY A;  3V49 A;  4M8H A;  2VV1 B;  1NQ0 A;  1XQ3 A;  1XQC A;  4PP3 A;  4MG9 B;  3HOD A;  4G20 A;  1SR7 A;  3HLV A;  5DKG A;  3X1I A;  4OAR A;  3V9T A;  4IA7 A;  3F7D A;  3VTC A;  1OVL A;  2PIR A;  1M2Z A;  2PIX A;  1T7F A;  3H0A D;  5HYK A;  1XDK B;  3OS9 A;  5DIE A;  3R8A A;  3VJI A;  3MNP A;  4OJB A;  5KRK A;  2ABI A;  2OVH A;  4R6S A;  1XPC A;  2ZMI A;  1G1U A;  4XTA A;  2ZK3 A;  4OEA A;  1QKU A;  3FXV A;  3KMZ A;  4IWC A;  2P1U A;  4LNW A;  5HJP B;  3L1B A;  2P7G A;  4RE8 A;  5DWE A;  3IXP A;  1FM9 D;  1QKN A;  3GN8 A;  5AYG A;  3VJH A;  2HWQ A;  4X1G A;  3JZB A;  1ZKY A;  5M96 A;  3B5R A;  4PP5 A;  3NOA A;  2HCD A;  3ADV A;  4RMD A;  2HB7 A;  1DB1 A;  5DRJ A;  2PIQ A;  2P1T A;  5SYZ A;  2IOK A;  4RUO X;  3R29 A;  1FCZ A;  2G5O A;  2YJD A;  3AZ1 A;  3VRT A;  5AWK A;  5KRH A;  5DTV A;  3HQ5 A;  2ACL A;  3IPS A;  3OAP A;  1I38 A;  3FC6 A;  4ZI1 A;  3AN4 A;  3BQD A;  3D6D A;  4IQR A;  4ZNH A;  3IPQ A;  4DQM A; 
#chains in the Genus database with same CATH topology
 2OM9 A;  2QSE A;  3VHU A;  3SP9 A;  5FQT A;  4OIU A;  1RJK A;  3OSA A;  5E0W A;  1XOW A;  3CS8 A;  3UUD A;  2FAI A;  2J7Y A;  1FM6 A;  2VV2 A;  4FNE A;  1YMT A;  3RUT A;  3D24 A;  3DR1 A;  3OLF A;  4REE A;  5DZI A;  5DVC A;  3S9S A;  2I4J A;  4G21 A;  5DWJ A;  4L98 A;  1KKQ A;  4RZE A;  2I4Z A;  2XYX A;  2GPV A;  4OGH A;  5JJM A;  2AO6 A;  3G0W A;  3K6P A;  3E00 A;  2G0H A;  2P7Z A;  1X7R A;  4N1Y A;  1OSH A;  4NB6 A;  3UU7 A;  5CJ6 A;  5F9B A;  2R6W A;  4O8F A;  4OLM A;  1T5Z A;  5DXB A;  1YP0 A;  3OMQ A;  1S0Z A;  3F5C A;  2Q70 A;  1ERE A;  3A78 A;  1G50 A;  2QW4 A;  3A2I A;  5A86 A;  1ZAF A;  3CDS A;  1MV9 A;  5DIG A;  5L11 A;  2LBD A;  3ET2 A;  5DYD A;  4IUI A;  2AXA A;  5AK2 A;  3UUA A;  4YPQ A;  4ZOM A;  3OMP A;  2QTU A;  5LWP A;  3RLJ A;  2OUZ A;  2Z4J A;  2YLP A;  5KRI A;  5HYR A;  3L3Z A;  2POG A;  4CI4 A;  4LTW A;  3W0G A;  4WHG A;  5KRM A;  4PPP A;  4K7A A;  4L96 A;  2Q6J A;  2VV0 A;  2QH6 A;  4MG5 A;  4PF3 A;  4MG7 A;  4KZI A;  1TXI A;  3OZJ A;  3B3K A;  2ACL B;  2QPY A;  3FC6 B;  1R20 A;  2P4Y A;  1S9Q A;  4MG8 B;  2R40 D;  4TV1 A;  1YJE A;  2I0J A;  1ZH7 A;  5E0X A;  4JGV A;  3VJT A;  1GS4 A;  1SKX A;  4ZJR A;  4S0S A;  4PXM A;  2B1V A;  4OEZ A;  5EGV A;  3X1H A;  1DKF B;  4OFU A;  5DL4 A;  5EC9 A;  3TY0 A;  3VTB A;  3WTQ A;  3WMH A;  4IW8 A;  2EWP A;  5G44 A;  3ERT A;  4LBD A;  3P0U A;  3TX7 B;  5KRF A;  2YLY A;  4OHA A;  4KZJ A;  2P7A A;  4MDD A;  4G1D A;  4XLD A;  3KWY A;  1RDT D;  2Q60 A;  3DY6 A;  2PIP L;  2NPA A;  3FAL A;  3UU7 B;  3DZU D;  1PDU A;  4MGB B;  3P88 A;  4WQP A;  4ZNU A;  1T74 A;  3PRG A;  3W0J A;  3AUN A;  1XJ7 A;  4DM6 A;  4TUZ B;  5DZ0 A;  5AAV A;  5G46 A;  5DV3 A;  4RUJ A;  2BJ4 B;  3OSI A;  3F5C B;  1R1K A;  5DXM A;  3VRV A;  5DY8 A;  2JFA A;  3TKM A;  5DMF A;  2HB8 A;  3UVV B;  1Y0S A;  5DVS A;  5AZV A;  4IU7 A;  1FCX A;  5APJ A;  4ZNV A;  5EIT A;  2VV3 A;  4J5W A;  2AAX A;  1NAX A;  2PIT A;  3OSW A;  5C4U A;  4ZN7 A;  4NQA B;  3P8X A;  1U3R A;  3FLI A;  5E1C A;  5FQS A;  3OMK A;  1PK5 A;  4WLB A;  2J14 A;  2QXS A;  2ZLC A;  3ILZ A;  1PQ9 A;  3OKH A;  4MG7 B;  5G3J A;  3WT5 A;  5GID A;  2HC4 A;  3P89 A;  2Q6S A;  4XUM A;  1FD0 A;  4TV1 B;  2GWX A;  4IVW A;  3AZ3 A;  4QE8 A;  1UHL A;  4N73 A;  4UDD A;  4XT9 A;  1XV9 A;  3FEI A;  4XI3 A;  3PLZ A;  4DOS A;  3DT3 A;  2ZLA A;  2AX8 A;  3SZ1 A;  1T7M A;  1FM9 A;  1RKG A;  4JYH A;  4MGD A;  3CQV A;  3H52 A;  3AX8 A;  4APU A;  1I7I A;  2GPP A;  4A4V A;  5IAW A;  5DUG A;  4S0T A;  5DU5 A;  1K4W A;  3NSQ A;  3CWD A;  1U3S A;  4N8R A;  1N4H A;  4QE6 A;  5KRL A;  4UDB A;  2FVJ A;  3ET3 A;  3PO9 A;  2VST A;  2GPO A;  3L03 A;  2ZMJ A;  4EMA A;  4OZT E;  2ZY0 A;  5KCW A;  3AN3 A;  3Q95 A;  1PQ6 A;  3A9E A;  1EXX A;  1XNN A;  2J4A A;  3ADX A;  3ZRB A;  1IE8 A;  1NYX A;  5KCT A;  4OKB A;  5KRO A;  1T63 A;  2QZO B;  3FEJ A;  3UP3 A;  1Z5X E;  5G43 A;  4P6W A;  3A2J A;  4G2I A;  4RWV A;  2QA8 B;  2VV4 B;  3K23 A;  5DX3 A;  1YA3 A;  2V0V A;  3FS1 A;  3ET0 A;  4OKX A;  5DRM A;  3VRU A;  3PBA A;  2O4R A;  2R6Y A;  3B1M A;  4OC7 A;  1UOM A;  2AM9 A;  2QGT A;  4FHH A;  4KZM A;  3UP0 A;  1UPW A;  3IXP D;  3B0W A;  4MGA A;  3R8D A;  2Z4B A;  3L3X A;  4LSJ A;  4S14 A;  2QMV A;  3DZY A;  1K74 A;  1RK3 A;  5GIE A;  2PIO A;  3WT7 A;  1KV6 A;  2AA6 A;  5B5B A;  4DMA A;  4E4Q A;  4HLW A;  1R5K A;  1XIU A;  2Q5P A;  4RFW A;  5ETH A;  4J5X C;  3B68 A;  3WWR A;  5IXK A;  5G5W A;  2B50 A;  1PRG A;  4CSJ A;  1K7L A;  4A4W A;  3RUU A;  1XNX A;  1NQ7 A;  1RKH A;  2PJL A;  2XHS A;  2ZNQ A;  5DUE A;  1OVL B;  2GL8 A;  4FHI A;  2G0G A;  2NXX E;  1UHL B;  1G5Y A;  1QKM A;  3WJ4 A;  3MNO A;  3KMR A;  2Q1H A;  2BAW A;  2HAM A;  5DXE A;  2ZNN A;  2Q7J A;  4MGD B;  1X78 A;  4OZT U;  2B1Z A;  2IOG A;  4UDA A;  2VSR A;  4PVU A;  1X76 A;  5AZT A;  5KCF A;  1FM6 D;  5E15 A;  1T73 A;  1ZDU A;  4REF A;  1S19 A;  1VJB A;  4MG6 A;  1ILH A;  1EXA A;  1MZN A;  4J24 A;  3OS8 C;  1NRL A;  3GYT A;  1OT7 A;  1Z5X U;  1X7B A;  2P54 A;  4IA2 A;  3VI8 A;  2Q1V A;  2NV7 A;  3VT8 A;  1E3G A;  3KYT A;  2HBH A;  5KCD A;  4RME A;  4N5G A;  2ZFX A;  3X36 A;  2PIN A;  1IE9 A;  3B0Q A;  4POJ A;  1P93 A;  1NAV A;  3OOF A;  5DV6 A;  4IV4 A;  2NXX A;  5APK A;  1XP1 A;  5DX3 B;  3WJ5 A;  4E2J A;  1L2J A;  5DXP A;  3OOK A;  3R5N A;  4Q13 A;  3AUQ A;  4OK1 A;  1G2N A;  4QM0 A;  2ZBS A;  5APH A;  2GIU A;  3UUD B;  1I37 A;  4FN9 A;  5DZH A;  2ZXZ A;  5I4V A;  3VRW A;  2IHQ A;  4BCR A;  4MGA B;  2QR9 A;  2ZL9 A;  5KD9 A;  4OZR E;  4ZNW A;  5DXK A;  5JI0 D;  3W0Y A;  3ZQT A;  5JJM B;  1T7R A;  2VV1 A;  4J26 A;  4OFR A;  3B66 A;  5DI7 A;  5ICK A;  3CDP A;  2P1V A;  1SJ0 A;  2AX7 A;  2YHD A;  4F9M A;  1ZUC A;  3A40 X;  2ZK5 A;  2AX6 A;  4PPS A;  4ZNT A;  3AFR A;  1ILG A;  3D90 A;  3DCT A;  3IA6 A;  3OMO A;  4QL8 A;  2J7X A;  1R20 D;  5DXB B;  2I0G A;  2H79 A;  2YAT A;  4LNX A;  4RAK A;  2Q59 A;  2QA6 A;  1A52 A;  3OGT A;  3HC6 A;  1XP9 A;  3V9V A;  5DYB A;  3G8O A;  3VT5 A;  3GZ9 A;  4YNK A;  2OZ7 A;  2QNV A;  2ZK6 A;  1GWQ A;  3EYB A;  3LMP A;  4WHF A;  2GP7 A;  4XUH A;  4POH A;  1U9E A;  2YFE A;  4R06 A;  4XAO A;  5AVL A;  3SP6 A;  3FUG A;  5DWI A;  2XYW A;  3UUA B;  2ZMH A;  3CS4 A;  4ZN9 A;  2AA7 A;  3CS6 A;  3WFF A;  3R2A A;  1XAP A;  5FQP A;  3UUC A;  2PIU A;  3V4A A;  2YLO A;  4JYI A;  3A2H A;  3BEJ A;  5DMC A;  5DZ1 A;  3VSO A;  2V7C A;  4RMC A;  2PIW A;  3H0A A;  1P8D A;  1E3K A;  1X7J A;  3ADW A;  1KNU A;  1NHZ A;  3ADU A;  3RLL A;  4HEE X;  2AA5 A;  1ZGY A;  5EI1 A;  1GWR A;  3V9Y A;  1Y0X X;  1R1K D;  3O1D A;  4X1F A;  4YMQ A;  2NW4 A;  3W5R A;  2QAB A;  2REW A;  2YJA B;  3JZC A;  4PLE A;  1ERR A;  4YT1 A;  3RY9 A;  3HZF A;  2POB A;  1T79 A;  3OKI A;  5KCC A;  3AUR A;  5DUH A;  3VT4 A;  5C4S A;  5DLR A;  1PCG A;  5HCV A;  1GWX A;  2O4J A;  1Z95 A;  3KBA A;  5AVI A;  3FAL B;  3KPZ A;  3V3E A;  3VSP A;  4EM9 A;  1X7E A;  5K13 A;  1OSV A;  2F4B A;  3N00 A;  5DZ3 A;  4RUP A;  1ZDT A;  1YIM A;  5EHJ A;  5L7H A;  5AAV B;  3ERD A;  3OLL A;  5GT4 A;  3B0T A;  3ET1 A;  2Q59 B;  2AYR A;  4OJ9 A;  4DK8 A;  1QKT A;  1S0X A;  3E94 A;  2JFA B;  2ZXM A;  1M13 A;  4ITF A;  5E7V A;  3WFG A;  4E4K A;  1YY4 A;  3M7R A;  2B23 A;  3RVF A;  1MVC A;  4UDC A;  5L7G A;  4OKT A;  3VT9 A;  4K4J A;  3O1E A;  1YUC A;  3W0C A;  3GWX A;  5KR9 A;  4WVD A;  2PNU A;  3R8I A;  2QE4 A;  2Q5G A;  3DCU A;  3CLD A;  5JY3 A;  3BC5 A;  1FCY A;  4JL4 A;  2AMA A;  3ADS A;  3TKC A;  4CI5 A;  5FQR A;  5DP0 A;  1R6G A;  3B65 A;  4MG8 A;  1H9U A;  4XHD A;  4OH5 A;  5DKE A;  1UPV A;  5KYJ A;  3QT0 A;  3B0R A;  1S9P A;  3D5F A;  3HVL A;  4RZG A;  1HG4 A;  2PRG A;  3L0J A;  3GD2 A;  4RZF A;  3VHV A;  1TFC A;  1XV9 B;  4OEY A;  4J5X A;  1DKF A;  1NQ2 A;  2Q7L A;  5KCE A;  4PRG A;  3VT6 A;  2O9I A;  3L0E A;  2ZAS A;  5DWG A;  2JJ3 A;  3W5T A;  5DKS A;  4OIL A;  5G42 A;  4K6I A;  1N46 A;  1Q4X A;  2FSZ A;  4S15 A;  1M7W A;  5ACC A;  3ZRA A;  3G9E A;  3D57 A;  4OED A;  5DK9 A;  3W0A A;  4B7W A;  2AWH A;  4IA3 A;  3DZY D;  1K74 D;  3A3Z X;  3AZ2 A;  4NUF A;  3W5Q A;  3K22 A;  4ZO1 X;  4IVY A;  2HAR A;  2AMB A;  2ZNO A;  4MGB A;  3W5P A;  4DK7 A;  3L0L A;  1A28 A;  2OAX A;  5IZ0 A;  5KRA A;  2G44 A;  4P6X A;  2HWR A;  2OVM A;  4MGC A;  4TUZ A;  3E00 D;  4IW6 A;  2R40 A;  1T65 A;  2Q8S A;  3A9E B;  3GWS X;  3Q95 B;  3VTD A;  2BJ4 A;  5C4O A;  2YLQ A;  1I7G A;  2ZKC A;  3OS8 A;  2PIV A;  2Q7I A;  3KDU A;  3PCU A;  4OH6 A;  3UVV A;  4IV2 A;  2Q5S A;  3B67 A;  1YIN A;  5DKB A;  5GIC A;  4ZNS A;  4DOR A;  4M8E A;  2QGW A;  1XVP A;  1T7T A;  4OJ4 A;  4QJR A;  3WT6 A;  3KDT A;  5H1E A;  4G2H A;  4OIV A;  3MNE A;  1NDE A;  3NSP A;  3VN2 A;  3HC5 A;  3OZ0 A;  1NQ1 A;  2XKW A;  1T76 A;  4JAZ A;  2PKL A;  4IA1 A;  1L2I A;  3HM1 A;  1BSX A;  3IPU A;  5DID A;  1U3Q A;  2W8Y A;  5KCU A;  5FQV A;  1RDT A;  2Q3Y A;  3DZU A;  1XLS E;  1SQN A;  3U9Q A;  2H77 A;  4OKW A;  5G45 A;  3PEQ A;  4MG9 A;  5C4T A;  4JYG A;  5DWL A;  4WPF A;  3WGP A;  1PZL A;  5KRJ A;  4IS8 A;  2ZVT A;  4PP6 A;  1WM0 X;  1XDK A;  5KYA A;  1YYE A;  4NIE A;  4ZJW A;  3V3Q A;  5LGA A;  4ZO1 B;  2HVC A;  3LBD A;  1N83 A;  4NY9 A;  2ZK1 A;  3IMY A;  2XYJ A;  1XB7 A;  3KFC A;  4PWL A;  4Q50 A;  3CTB A;  1XP6 A;  2ZNP A;  2E2R A;  2GTK A;  4ONI A;  2AA2 A;  3CJW A;  5DVV A;  5HJP A;  4PLD A;  5HZC A;  3GYU A;  2HFP A;  4Q0A C;  5DXR A;  2ZK2 A;  5AWJ A;  1LBD A;  1LV2 A;  2P15 A;  4A2J A;  5AAU A;  4R2U A;  2AB2 A;  4QK4 A;  3GBK A;  3R5M A;  3W0I A;  2Q7K A;  1XLS A;  3K8S A;  3VJS A;  5DXQ A;  2GPU A;  3W0H A;  4DM8 A;  3G8I A;  1XZX X;  2ATH A;  3FUR A;  2AX9 A;  5L7E A;  2ZK0 A;  5DXG A;  5HJS A;  4J5W C;  5DV8 A;  2QZO A;  5KRC A;  3HO0 A;  3KMG A;  1ZEO A;  3OLS A;  3T03 A;  5B41 A;  2I4P A;  2QA8 A;  2VV4 A;  5EJV A;  4OZR U;  1PQC A;  5E14 A;  5E19 A;  4G1Z A;  2A3I A;  2ZXN A;  3VHW A;  3VT3 A;  1HJ1 A;  1XVP B;  5DSH A;  1FBY A;  2ZK4 A;  4ITE A;  2OCF A;  2QXM A;  3X31 A;  2JF9 A;  1NUO A;  2Q61 A;  3ADT A;  2HAS A;  4IWF A;  3ZR7 A;  4G1Y A;  3VT7 A;  1Y9R A;  3E7C A;  1YOW A;  3OMM A;  2Q6R A;  4Y29 A;  1YOK A;  4FGY A;  3V49 A;  4M8H A;  2VV1 B;  1NQ0 A;  1XQ3 A;  1XQC A;  4PP3 A;  4MG9 B;  3HOD A;  4G20 A;  1SR7 A;  3HLV A;  5DKG A;  3X1I A;  4OAR A;  3V9T A;  4IA7 A;  3F7D A;  3VTC A;  1OVL A;  2PIR A;  1M2Z A;  2PIX A;  1T7F A;  3H0A D;  5HYK A;  1XDK B;  3OS9 A;  5DIE A;  3R8A A;  3VJI A;  3MNP A;  4OJB A;  5KRK A;  2ABI A;  2OVH A;  4R6S A;  1XPC A;  2ZMI A;  1G1U A;  4XTA A;  2ZK3 A;  4OEA A;  1QKU A;  3FXV A;  3KMZ A;  4IWC A;  2P1U A;  4LNW A;  5HJP B;  3L1B A;  2P7G A;  4RE8 A;  5DWE A;  3IXP A;  1FM9 D;  1QKN A;  3GN8 A;  5AYG A;  3VJH A;  2HWQ A;  4X1G A;  3JZB A;  1ZKY A;  5M96 A;  3B5R A;  4PP5 A;  3NOA A;  2HCD A;  3ADV A;  4RMD A;  2HB7 A;  1DB1 A;  5DRJ A;  2PIQ A;  2P1T A;  5SYZ A;  2IOK A;  4RUO X;  3R29 A;  1FCZ A;  2G5O A;  2YJD A;  3AZ1 A;  3VRT A;  5AWK A;  5KRH A;  5DTV A;  3HQ5 A;  2ACL A;  3IPS A;  3OAP A;  1I38 A;  3FC6 A;  4ZI1 A;  3AN4 A;  3BQD A;  3D6D A;  4IQR A;  4ZNH A;  3IPQ A;  4DQM A; 
#chains in the Genus database with same CATH homology
 2OM9 A;  2QSE A;  3VHU A;  3SP9 A;  5FQT A;  4OIU A;  1RJK A;  3OSA A;  5E0W A;  1XOW A;  3CS8 A;  3UUD A;  2FAI A;  2J7Y A;  1FM6 A;  2VV2 A;  4FNE A;  1YMT A;  3RUT A;  3D24 A;  3DR1 A;  3OLF A;  4REE A;  5DZI A;  5DVC A;  3S9S A;  2I4J A;  4G21 A;  5DWJ A;  4L98 A;  1KKQ A;  4RZE A;  2I4Z A;  2XYX A;  2GPV A;  4OGH A;  5JJM A;  2AO6 A;  3G0W A;  3K6P A;  3E00 A;  2G0H A;  2P7Z A;  1X7R A;  4N1Y A;  1OSH A;  4NB6 A;  3UU7 A;  5CJ6 A;  5F9B A;  2R6W A;  4O8F A;  4OLM A;  1T5Z A;  5DXB A;  1YP0 A;  3OMQ A;  1S0Z A;  3F5C A;  2Q70 A;  1ERE A;  3A78 A;  1G50 A;  2QW4 A;  3A2I A;  5A86 A;  1ZAF A;  3CDS A;  1MV9 A;  5DIG A;  5L11 A;  2LBD A;  3ET2 A;  5DYD A;  4IUI A;  2AXA A;  5AK2 A;  3UUA A;  4YPQ A;  4ZOM A;  3OMP A;  2QTU A;  5LWP A;  3RLJ A;  2OUZ A;  2Z4J A;  2YLP A;  5KRI A;  5HYR A;  3L3Z A;  2POG A;  4CI4 A;  4LTW A;  3W0G A;  4WHG A;  5KRM A;  4PPP A;  4K7A A;  4L96 A;  2Q6J A;  2VV0 A;  2QH6 A;  4MG5 A;  4PF3 A;  4MG7 A;  4KZI A;  1TXI A;  3OZJ A;  3B3K A;  2ACL B;  2QPY A;  3FC6 B;  1R20 A;  2P4Y A;  1S9Q A;  4MG8 B;  2R40 D;  4TV1 A;  1YJE A;  2I0J A;  1ZH7 A;  5E0X A;  4JGV A;  3VJT A;  1GS4 A;  1SKX A;  4ZJR A;  4S0S A;  4PXM A;  2B1V A;  4OEZ A;  5EGV A;  3X1H A;  1DKF B;  4OFU A;  5DL4 A;  5EC9 A;  3TY0 A;  3VTB A;  3WTQ A;  3WMH A;  4IW8 A;  2EWP A;  5G44 A;  3ERT A;  4LBD A;  3P0U A;  3TX7 B;  5KRF A;  2YLY A;  4OHA A;  4KZJ A;  2P7A A;  4MDD A;  4G1D A;  4XLD A;  3KWY A;  1RDT D;  2Q60 A;  3DY6 A;  2PIP L;  2NPA A;  3FAL A;  3UU7 B;  3DZU D;  1PDU A;  4MGB B;  3P88 A;  4WQP A;  4ZNU A;  1T74 A;  3PRG A;  3W0J A;  3AUN A;  1XJ7 A;  4DM6 A;  4TUZ B;  5DZ0 A;  5AAV A;  5G46 A;  5DV3 A;  4RUJ A;  2BJ4 B;  3OSI A;  3F5C B;  1R1K A;  5DXM A;  3VRV A;  5DY8 A;  2JFA A;  3TKM A;  5DMF A;  2HB8 A;  3UVV B;  1Y0S A;  5DVS A;  5AZV A;  4IU7 A;  1FCX A;  5APJ A;  4ZNV A;  5EIT A;  2VV3 A;  4J5W A;  2AAX A;  1NAX A;  2PIT A;  3OSW A;  5C4U A;  4ZN7 A;  4NQA B;  3P8X A;  1U3R A;  3FLI A;  5E1C A;  5FQS A;  3OMK A;  1PK5 A;  4WLB A;  2J14 A;  2QXS A;  2ZLC A;  3ILZ A;  1PQ9 A;  3OKH A;  4MG7 B;  5G3J A;  3WT5 A;  5GID A;  2HC4 A;  3P89 A;  2Q6S A;  4XUM A;  1FD0 A;  4TV1 B;  2GWX A;  4IVW A;  3AZ3 A;  4QE8 A;  1UHL A;  4N73 A;  4UDD A;  4XT9 A;  1XV9 A;  3FEI A;  4XI3 A;  3PLZ A;  4DOS A;  3DT3 A;  2ZLA A;  2AX8 A;  3SZ1 A;  1T7M A;  1FM9 A;  1RKG A;  4JYH A;  4MGD A;  3CQV A;  3H52 A;  3AX8 A;  4APU A;  1I7I A;  2GPP A;  4A4V A;  5IAW A;  5DUG A;  4S0T A;  5DU5 A;  1K4W A;  3NSQ A;  3CWD A;  1U3S A;  4N8R A;  1N4H A;  4QE6 A;  5KRL A;  4UDB A;  2FVJ A;  3ET3 A;  3PO9 A;  2VST A;  2GPO A;  3L03 A;  2ZMJ A;  4EMA A;  4OZT E;  2ZY0 A;  5KCW A;  3AN3 A;  3Q95 A;  1PQ6 A;  3A9E A;  1EXX A;  1XNN A;  2J4A A;  3ADX A;  3ZRB A;  1IE8 A;  1NYX A;  5KCT A;  4OKB A;  5KRO A;  1T63 A;  2QZO B;  3FEJ A;  3UP3 A;  1Z5X E;  5G43 A;  4P6W A;  3A2J A;  4G2I A;  4RWV A;  2QA8 B;  2VV4 B;  3K23 A;  5DX3 A;  1YA3 A;  2V0V A;  3FS1 A;  3ET0 A;  4OKX A;  5DRM A;  3VRU A;  3PBA A;  2O4R A;  2R6Y A;  3B1M A;  4OC7 A;  1UOM A;  2AM9 A;  2QGT A;  4FHH A;  4KZM A;  3UP0 A;  1UPW A;  3IXP D;  3B0W A;  4MGA A;  3R8D A;  2Z4B A;  3L3X A;  4LSJ A;  4S14 A;  2QMV A;  3DZY A;  1K74 A;  1RK3 A;  5GIE A;  2PIO A;  3WT7 A;  1KV6 A;  2AA6 A;  5B5B A;  4DMA A;  4E4Q A;  4HLW A;  1R5K A;  1XIU A;  2Q5P A;  4RFW A;  5ETH A;  4J5X C;  3B68 A;  3WWR A;  5IXK A;  5G5W A;  2B50 A;  1PRG A;  4CSJ A;  1K7L A;  4A4W A;  3RUU A;  1XNX A;  1NQ7 A;  1RKH A;  2PJL A;  2XHS A;  2ZNQ A;  5DUE A;  1OVL B;  2GL8 A;  4FHI A;  2G0G A;  2NXX E;  1UHL B;  1G5Y A;  1QKM A;  3WJ4 A;  3MNO A;  3KMR A;  2Q1H A;  2BAW A;  2HAM A;  5DXE A;  2ZNN A;  2Q7J A;  4MGD B;  1X78 A;  4OZT U;  2B1Z A;  2IOG A;  4UDA A;  2VSR A;  4PVU A;  1X76 A;  5AZT A;  5KCF A;  1FM6 D;  5E15 A;  1T73 A;  1ZDU A;  4REF A;  1S19 A;  1VJB A;  4MG6 A;  1ILH A;  1EXA A;  1MZN A;  4J24 A;  3OS8 C;  1NRL A;  3GYT A;  1OT7 A;  1Z5X U;  1X7B A;  2P54 A;  4IA2 A;  3VI8 A;  2Q1V A;  2NV7 A;  3VT8 A;  1E3G A;  3KYT A;  2HBH A;  5KCD A;  4RME A;  4N5G A;  2ZFX A;  3X36 A;  2PIN A;  1IE9 A;  3B0Q A;  4POJ A;  1P93 A;  1NAV A;  3OOF A;  5DV6 A;  4IV4 A;  2NXX A;  5APK A;  1XP1 A;  5DX3 B;  3WJ5 A;  4E2J A;  1L2J A;  5DXP A;  3OOK A;  3R5N A;  4Q13 A;  3AUQ A;  4OK1 A;  1G2N A;  4QM0 A;  2ZBS A;  5APH A;  2GIU A;  3UUD B;  1I37 A;  4FN9 A;  5DZH A;  2ZXZ A;  5I4V A;  3VRW A;  2IHQ A;  4BCR A;  4MGA B;  2QR9 A;  2ZL9 A;  5KD9 A;  4OZR E;  4ZNW A;  5DXK A;  5JI0 D;  3W0Y A;  3ZQT A;  5JJM B;  1T7R A;  2VV1 A;  4J26 A;  4OFR A;  3B66 A;  5DI7 A;  5ICK A;  3CDP A;  2P1V A;  1SJ0 A;  2AX7 A;  2YHD A;  4F9M A;  1ZUC A;  3A40 X;  2ZK5 A;  2AX6 A;  4PPS A;  4ZNT A;  3AFR A;  1ILG A;  3D90 A;  3DCT A;  3IA6 A;  3OMO A;  4QL8 A;  2J7X A;  1R20 D;  5DXB B;  2I0G A;  2H79 A;  2YAT A;  4LNX A;  4RAK A;  2Q59 A;  2QA6 A;  1A52 A;  3OGT A;  3HC6 A;  1XP9 A;  3V9V A;  5DYB A;  3G8O A;  3VT5 A;  3GZ9 A;  4YNK A;  2OZ7 A;  2QNV A;  2ZK6 A;  1GWQ A;  3EYB A;  3LMP A;  4WHF A;  2GP7 A;  4XUH A;  4POH A;  1U9E A;  2YFE A;  4R06 A;  4XAO A;  5AVL A;  3SP6 A;  3FUG A;  5DWI A;  2XYW A;  3UUA B;  2ZMH A;  3CS4 A;  4ZN9 A;  2AA7 A;  3CS6 A;  3WFF A;  3R2A A;  1XAP A;  5FQP A;  3UUC A;  2PIU A;  3V4A A;  2YLO A;  4JYI A;  3A2H A;  3BEJ A;  5DMC A;  5DZ1 A;  3VSO A;  2V7C A;  4RMC A;  2PIW A;  3H0A A;  1P8D A;  1E3K A;  1X7J A;  3ADW A;  1KNU A;  1NHZ A;  3ADU A;  3RLL A;  4HEE X;  2AA5 A;  1ZGY A;  5EI1 A;  1GWR A;  3V9Y A;  1Y0X X;  1R1K D;  3O1D A;  4X1F A;  4YMQ A;  2NW4 A;  3W5R A;  2QAB A;  2REW A;  2YJA B;  3JZC A;  4PLE A;  1ERR A;  4YT1 A;  3RY9 A;  3HZF A;  2POB A;  1T79 A;  3OKI A;  5KCC A;  3AUR A;  5DUH A;  3VT4 A;  5C4S A;  5DLR A;  1PCG A;  5HCV A;  1GWX A;  2O4J A;  1Z95 A;  3KBA A;  5AVI A;  3FAL B;  3KPZ A;  3V3E A;  3VSP A;  4EM9 A;  1X7E A;  5K13 A;  1OSV A;  2F4B A;  3N00 A;  5DZ3 A;  4RUP A;  1ZDT A;  1YIM A;  5EHJ A;  5L7H A;  5AAV B;  3ERD A;  3OLL A;  5GT4 A;  3B0T A;  3ET1 A;  2Q59 B;  2AYR A;  4OJ9 A;  4DK8 A;  1QKT A;  1S0X A;  3E94 A;  2JFA B;  2ZXM A;  1M13 A;  4ITF A;  5E7V A;  3WFG A;  4E4K A;  1YY4 A;  3M7R A;  2B23 A;  3RVF A;  1MVC A;  4UDC A;  5L7G A;  4OKT A;  3VT9 A;  4K4J A;  3O1E A;  1YUC A;  3W0C A;  3GWX A;  5KR9 A;  4WVD A;  2PNU A;  3R8I A;  2QE4 A;  2Q5G A;  3DCU A;  3CLD A;  5JY3 A;  3BC5 A;  1FCY A;  4JL4 A;  2AMA A;  3ADS A;  3TKC A;  4CI5 A;  5FQR A;  5DP0 A;  1R6G A;  3B65 A;  4MG8 A;  1H9U A;  4XHD A;  4OH5 A;  5DKE A;  1UPV A;  5KYJ A;  3QT0 A;  3B0R A;  1S9P A;  3D5F A;  3HVL A;  4RZG A;  1HG4 A;  2PRG A;  3L0J A;  3GD2 A;  4RZF A;  3VHV A;  1TFC A;  1XV9 B;  4OEY A;  4J5X A;  1DKF A;  1NQ2 A;  2Q7L A;  5KCE A;  4PRG A;  3VT6 A;  2O9I A;  3L0E A;  2ZAS A;  5DWG A;  2JJ3 A;  3W5T A;  5DKS A;  4OIL A;  5G42 A;  4K6I A;  1N46 A;  1Q4X A;  2FSZ A;  4S15 A;  1M7W A;  5ACC A;  3ZRA A;  3G9E A;  3D57 A;  4OED A;  5DK9 A;  3W0A A;  4B7W A;  2AWH A;  4IA3 A;  3DZY D;  1K74 D;  3A3Z X;  3AZ2 A;  4NUF A;  3W5Q A;  3K22 A;  4ZO1 X;  4IVY A;  2HAR A;  2AMB A;  2ZNO A;  4MGB A;  3W5P A;  4DK7 A;  3L0L A;  1A28 A;  2OAX A;  5IZ0 A;  5KRA A;  2G44 A;  4P6X A;  2HWR A;  2OVM A;  4MGC A;  4TUZ A;  3E00 D;  4IW6 A;  2R40 A;  1T65 A;  2Q8S A;  3A9E B;  3GWS X;  3Q95 B;  3VTD A;  2BJ4 A;  5C4O A;  2YLQ A;  1I7G A;  2ZKC A;  3OS8 A;  2PIV A;  2Q7I A;  3KDU A;  3PCU A;  4OH6 A;  3UVV A;  4IV2 A;  2Q5S A;  3B67 A;  1YIN A;  5DKB A;  5GIC A;  4ZNS A;  4DOR A;  4M8E A;  2QGW A;  1XVP A;  1T7T A;  4OJ4 A;  4QJR A;  3WT6 A;  3KDT A;  5H1E A;  4G2H A;  4OIV A;  3MNE A;  1NDE A;  3NSP A;  3VN2 A;  3HC5 A;  3OZ0 A;  1NQ1 A;  2XKW A;  1T76 A;  4JAZ A;  2PKL A;  4IA1 A;  1L2I A;  3HM1 A;  1BSX A;  3IPU A;  5DID A;  1U3Q A;  2W8Y A;  5KCU A;  5FQV A;  1RDT A;  2Q3Y A;  3DZU A;  1XLS E;  1SQN A;  3U9Q A;  2H77 A;  4OKW A;  5G45 A;  3PEQ A;  4MG9 A;  5C4T A;  4JYG A;  5DWL A;  4WPF A;  3WGP A;  1PZL A;  5KRJ A;  4IS8 A;  2ZVT A;  4PP6 A;  1WM0 X;  1XDK A;  5KYA A;  1YYE A;  4NIE A;  4ZJW A;  3V3Q A;  5LGA A;  4ZO1 B;  2HVC A;  3LBD A;  1N83 A;  4NY9 A;  2ZK1 A;  3IMY A;  2XYJ A;  1XB7 A;  3KFC A;  4PWL A;  4Q50 A;  3CTB A;  1XP6 A;  2ZNP A;  2E2R A;  2GTK A;  4ONI A;  2AA2 A;  3CJW A;  5DVV A;  5HJP A;  4PLD A;  5HZC A;  3GYU A;  2HFP A;  4Q0A C;  5DXR A;  2ZK2 A;  5AWJ A;  1LBD A;  1LV2 A;  2P15 A;  4A2J A;  5AAU A;  4R2U A;  2AB2 A;  4QK4 A;  3GBK A;  3R5M A;  3W0I A;  2Q7K A;  1XLS A;  3K8S A;  3VJS A;  5DXQ A;  2GPU A;  3W0H A;  4DM8 A;  3G8I A;  1XZX X;  2ATH A;  3FUR A;  2AX9 A;  5L7E A;  2ZK0 A;  5DXG A;  5HJS A;  4J5W C;  5DV8 A;  2QZO A;  5KRC A;  3HO0 A;  3KMG A;  1ZEO A;  3OLS A;  3T03 A;  5B41 A;  2I4P A;  2QA8 A;  2VV4 A;  5EJV A;  4OZR U;  1PQC A;  5E14 A;  5E19 A;  4G1Z A;  2A3I A;  2ZXN A;  3VHW A;  3VT3 A;  1HJ1 A;  1XVP B;  5DSH A;  1FBY A;  2ZK4 A;  4ITE A;  2OCF A;  2QXM A;  3X31 A;  2JF9 A;  1NUO A;  2Q61 A;  3ADT A;  2HAS A;  4IWF A;  3ZR7 A;  4G1Y A;  3VT7 A;  1Y9R A;  3E7C A;  1YOW A;  3OMM A;  2Q6R A;  4Y29 A;  1YOK A;  4FGY A;  3V49 A;  4M8H A;  2VV1 B;  1NQ0 A;  1XQ3 A;  1XQC A;  4PP3 A;  4MG9 B;  3HOD A;  4G20 A;  1SR7 A;  3HLV A;  5DKG A;  3X1I A;  4OAR A;  3V9T A;  4IA7 A;  3F7D A;  3VTC A;  1OVL A;  2PIR A;  1M2Z A;  2PIX A;  1T7F A;  3H0A D;  5HYK A;  1XDK B;  3OS9 A;  5DIE A;  3R8A A;  3VJI A;  3MNP A;  4OJB A;  5KRK A;  2ABI A;  2OVH A;  4R6S A;  1XPC A;  2ZMI A;  1G1U A;  4XTA A;  2ZK3 A;  4OEA A;  1QKU A;  3FXV A;  3KMZ A;  4IWC A;  2P1U A;  4LNW A;  5HJP B;  3L1B A;  2P7G A;  4RE8 A;  5DWE A;  3IXP A;  1FM9 D;  1QKN A;  3GN8 A;  5AYG A;  3VJH A;  2HWQ A;  4X1G A;  3JZB A;  1ZKY A;  5M96 A;  3B5R A;  4PP5 A;  3NOA A;  2HCD A;  3ADV A;  4RMD A;  2HB7 A;  1DB1 A;  5DRJ A;  2PIQ A;  2P1T A;  5SYZ A;  2IOK A;  4RUO X;  3R29 A;  1FCZ A;  2G5O A;  2YJD A;  3AZ1 A;  3VRT A;  5AWK A;  5KRH A;  5DTV A;  3HQ5 A;  2ACL A;  3IPS A;  3OAP A;  1I38 A;  3FC6 A;  4ZI1 A;  3AN4 A;  3BQD A;  3D6D A;  4IQR A;  4ZNH A;  3IPQ A;  4DQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...