5KRCA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with zearalenone
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
245
structure length
233
Chain Sequence
NSLALSLTADQMVSALLDAEPPILYSEYDRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 233
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krcA00
1R1KA 3AZ2A 4EM9A 4OJBA 4WHFA 1PZLA 2Q8SA 3LMPA 1RDTA 2QZOA 3HLVA 3UUAB 2Q61A 4XLDA 4JAZA 3X1IA 3VTDA 4NQAB 3F7DA 1PQ9A 1GS4A 4IWFA 4E2JA 1S9PA 4OZRE 1PDUA 1PCGA 1NQ0A 1T5ZA 1XP9A 3TKCA 3R8DA 4PP6A 1M13A 4MG8B 3W0CA 3KMGA 1T74A 2Z4BA 2A3IA 4OK1A 2AA5A 4OZRU 4PWLA 2YFEA 4TUZB 1Y0SA 1I38A 2B23A 1OSVA 2OVMA 3UP3A 4R2UA 4DM6A 4DOSA 2VV1A 1R6GA 3K6PA 4OEYA 3FLIA 1XVPA 3AZ3A 4ZJWA 4Y29A 3OSWA 3VRWA 3FC6B 4ITFA 3VTBA 3FEIA 2OUZA 3MNPA 3CDPA 5DK9A 4MGBB 2AA7A 2AYRA 2GPPA 5HJPB 5DKGA 5DXBA 1RKHA 4PLDA 2PITA 4OKTA 5DVCA 5AZTA 1A28A 1XPCA 3VTCA 5KR9A 4UDDA 2I4JA 2G0HA 2Q6JA 4OGHA 4XUMA 1XQCA 5AVLA 3UVVB 3A78A 4G1YA 2Q5PA 3IPQA 5KCWA 2Q70A 3OMPA 3W0JA 1ZDTA 1FCXA 5KCFA 2H79A 5DRMA 5AVIA 4J24A 1H9UA 1DKFA 2PIRA 2XKWA 1EXAA 3L0LA 5DXQA 3R8IA 4MGDA 1YMTA 4HEEX 5IZ0A 1TFCA 4ZOMA 5CJ6A 3AZ1A 3IPSA 4XT9A 3TX7B 4B7WA 3O1DA 4IVWA 2Q5GA 1HJ1A 5JI0D 5APKA 2ZFXA 3PCUA 4FN9A 2IOKA 1ZKYA 4OH5A 4IS8A 3WWRA 3FUGA 3S9SA 1S0ZA 3B0WA 3OSAA 4M8EA 2PRGA 4JGVA 3VJTA 3VRUA 1ZUCA 4IW6A 3K8SA 2HWRA 3FEJA 5G42A 2Q6SA 3R5MA 3B67A 3HVLA 5DIGA 1NQ2A 3CQVA 2V0VA 2QR9A 2ZK1A 3V49A 4OC7A 4RZGA 5AAVB 3RUTA 2H77A 2Z4JA 1RKGA 4P6XA 2Q59B 4IWCA 4LNXA 4PP5A 3OZ0A 3AN3A 3HO0A 5A86A 5H1EA 5FQPA 4R6SA 2ACLB 5K13A 5DL4A 3BC5A 2HCDA 5DYDA 1G50A 3PO9A 3VJHA 5KRKA 3D57A 2O4JA 3SZ1A 5HCVA 1EXXA 2BJ4A 2ZLCA 4MG7A 4N1YA 3FALA 3KDTA 1M2ZA 5DKBA 5DXMA 3RLLA 2ZNNA 4N5GA 3N00A 2Q7KA 2HB7A 2ZKCA 3L1BA 1ZDUA 2QH6A 4APUA 1L2IA 1K74D 1MZNA 4MG9B 1R20A 5FQSA 2AA2A 5EJVA 2OAXA 4CSJA 1ZGYA 4RAKA 4UDCA 2NV7A 3V4AA 2ZMHA 1U3RA 2XYJA 3GD2A 1ZEOA 3GYTA 4NIEA 4ZNWA 5DZIA 3RY9A 3TY0A 3E00D 1K74A 1NHZA 4WPFA 4A2JA 3OSIA 3VHUA 3WGPA 2FSZA 5DXKA 2NPAA 1N4HA 2Q7IA 3AN4A 1T7TA 3M7RA 1PK5A 3ZRBA 2YJDA 4TV1B 3GZ9A 5DZHA 3D24A 4RE8A 3E00A 1YA3A 1NRLA 4OKBA 1TXIA 5DUGA 3W0GA 4DQMA 1OT7A 3HODA 1KNUA 5GICA 2J14A 2ZXZA 2PIVA 1UPVA 5DVSA 3B5RA 5HYKA 2LBDA 5L7EA 3UP0A 3AX8A 3HC6A 5DXEA 5JJMA 3UU7A 3ADUA 3AURA 1S0XA 3RUUA 2AXAA 1L2JA 2VV4B 4PXMA 4ZI1A 3A9EA 1XV9B 5E1CA 2OVHA 4Q13A 2OZ7A 1MV9A 5APJA 3OKIA 3F5CB 4OKWA 5DY8A 1XZXX 4IA2A 1UHLA 4IV2A 2QGWA 2QA8A 2QXMA 3CS4A 2QE4A 4KZMA 4M8HA 4YT1A 1LBDA 5KD9A 4POHA 4PLEA 2Q6RA 1T79A 5FQRA 4S15A 4ZN7A 3WTQA 5ACCA 4OEDA 2Q5SA 2QPYA 3OAPA 2GPUA 2QXSA 4IVYA 2XYWA 5KRLA 2PJLA 2W8YA 3KMRA 4OARA 5G46A 2ZNOA 4NUFA 3DCUA 5DV8A 5DXPA 3ZRAA 5B41A 1YOWA 2QW4A 4ZNUA 2J7XA 4O8FA 4IA3A 2JF9A 3Q95A 4LNWA 1XP1A 1NUOA 3JZCA 5G5WA 2HVCA 4N8RA 5EHJA 1Y9RA 3ET1A 3FURA 1E3GA 2AX9A 4G1DA 4XTAA 5IAWA 3CS8A 5KYAA 2OCFA 2P1UA 3OLSA 3DZYD 5EI1A 1S9QA 5E19A 5G45A 3K23A 2AM9A 3ADVA 2QMVA 3AUNA 3R2AA 4MGAA 3W5TA 1K4WA 1N46A 1ILHA 5DMFA 4QL8A 1P8DA 1SQNA 2HBHA 3DZYA 5KRIA 4IQRA 5DRJA 3ILZA 5DTVA 3KYTA 4IA1A 1OVLB 1IE8A 2YATA 2ZY0A 5HJSA 1T63A 4J5XC 3GN8A 4PVUA 2Q7JA 3G0WA 3OLFA 4OJ9A 4XUHA 4EMAA 5KROA 5E0XA 5HZCA 3VRTA 4FGYA 2FAIA 1FM9D 3A2HA 1XNNA 4G20A 3KBAA 5AAUA 2HB8A 2XYXA 4R06A 3AUQA 3UUDB 2HC4A 3ZR7A 5DU5A 5DYBA 1XLSE 3IMYA 1EREA 2Q60A 4ONIA 3W5RA 1U3SA 1X78A 3B0QA 4RMCA 3VN2A 3G8IA 3WJ4A 3UUAA 4OJ4A 1GWQA 2QABA 2GP7A 3OOKA 4ZN9A 2PIPL 4OEZA 4WVDA 5DXGA 5KRMA 5I4VA 1G2NA 2YLQA 4G1ZA 3V3EA 5L7GA 1WM0X 3P0UA 4OIVA 3V9YA 4PPSA 4A4WA 4MG8A 5KRFA 5DIEA 4BCRA 4K7AA 3ET3A 4UDBA 2QTUA 1XAPA 4TUZA 4MG6A 3SP6A 2JFAB 4RZFA 3VT8A 3KFCA 3A3ZX 1K7LA 3G9EA 3GYUA 4OFUA 2XHSA 4ZJRA 2PIWA 3BQDA 3FXVA 4CI5A 1RJKA 4OZTU 3ZQTA 5E7VA 1NAXA 3H0AD 1X7RA 2R6YA 4DMAA 1XJ7A 1Y0XX 3OOFA 4RZEA 3WMHA 2I4ZA 3FC6A 5L11A 2FVJA 3HZFA 2G44A 2AO6A 1FCYA 3H0AA 3CTBA 4MGBA 4S0SA 5HJPA 1T7FA 1XLSA 3OGTA 3V3QA 5KCDA 5KYJA 2I4PA 4N73A 5LWPA 4OH6A 1FM6D 4F9MA 3DCTA 3A2IA 3EYBA 2R40D 3NSPA 4PRGA 5F9BA 4QJRA 5AZVA 1FCZA 2QSEA 3DZUD 3UVVA 2ZK3A 2V7CA 2YHDA 5DZ0A 1SKXA 5DX3B 1NDEA 3T03A 4ZO1B 1FM6A 4MG5A 5DKSA 4Q50A 2Q3YA 3FS1A 3SP9A 3L03A 2R40A 5GIEA 2YLPA 3ADWA 3B3KA 4RFWA 3JZBA 3WJ5A 1XDKB 3UUCA 1Z95A 2ATHA 3ERTA 1QKTA 2O9IA 2PNUA 3L3XA 2PIQA 2VSRA 4KZIA 2ZXNA 3W5QA 2PIXA 1NAVA 2ZMIA 2I0GA 3P89A 3B0RA 2HARA 4PPPA 5E14A 1T76A 3ADXA 3VHWA 2HASA 2QZOB 1N83A 1SJ0A 3PEQA 5EGVA 5DV3A 5DWIA 4NB6A 5ETHA 2I0JA 4RMEA 4WLBA 2R6WA 5DP0A 4Q0AC 5M96A 3H52A 4XAOA 5HYRA 2B1ZA 4G21A 2Q1HA 2AMAA 2PIOA 3X1HA 5AAVA 3CS6A 1MVCA 5DWJA 3VT4A 3WFFA 2ZNQA 2Q59A 2P54A 4RUPA 5FQVA 4ZNTA 3O1EA 2ACLA 2P15A 5DKEA 3D90A 4G2HA 5KRAA 4WHGA 2NXXE 2VV1B 1XQ3A 3DT3A 4IW8A 1PQCA 3B0TA 2ZK4A 5DZ3A 5DVVA 5C4TA 1XVPB 1YJEA 4RUJA 4JYHA 2HAMA 3GWSX 3W0AA 4J5WC 1NYXA 5DWEA 5KCCA 4JYGA 2GIUA 2GPOA 2G5OA 2Q1VA 5EITA 1T65A 1X76A 4MG9A 5DXBB 2P1VA 1ZAFA 5EC9A 1I37A 1KV6A 5APHA 2VSTA 4PF3A 3OKHA 4RMDA 2AAXA 2JJ3A 2GPVA 1X7BA 2AMBA 1E3KA 4QM0A 1I7IA 5FQTA 1R1KD 5DSHA 5JY3A 5AWJA 2Q7LA 3KWYA 5ICKA 5DXRA 4OKXA 1GWRA 3OMOA 1IE9A 3PBAA 3VT7A 1YIMA 1DKFB 3X36A 3DY6A 4TV1A 1P93A 1GWXA 2OM9A 3P88A 5DZ1A 1XIUA 1T7RA 2AX7A 4MGDB 1YY4A 2ZK5A 3E94A 3HC5A 4J5XA 4LSJA 3VI8A 3OS8A 5DWLA 3CLDA 5DLRA 2P7GA 2REWA 2ZBSA 3KMZA 4REFA 2P1TA 4UDAA 3G8OA 3HQ5A 4XHDA 3MNOA 3GWXA 3IXPD 3V9TA 4E4QA 2NXXA 4X1FA 2AA6A 3CJWA 4IUIA 3E7CA 2ZVTA 4PP3A 2VV4A 3BEJA 2VV3A 3OS8C 5DWGA 2QA6A 3W0YA 1XV9A 4DORA 2BAWA 3IXPA 4WQPA 4JL4A 3F5CA 1X7EA 1SR7A 2O4RA 1HG4A 3LBDA 4K6IA 3W5PA 5KCUA 4OEAA 4YNKA 4OIUA 3D6DA 3CDSA 3R8AA 1FM9A 2POBA 1DB1A 4OHAA 1YUCA 3B65A 3ET2A 2GTKA 3VSPA 4ZNHA 1I7GA 2AX6A 1S19A 4RWVA 3VHVA 2ZK2A 2ZNPA 5DMCA 4XI3A 1LV2A 3HM1A 4A4VA 4FHHA 2BJ4B 4MG7B 3OS9A 3WFGA 3IPUA 3MNEA 2E2RA 2F4BA 3FALB 4QE6A 2EWPA 5G44A 4POJA 2J7YA 2POGA 4HLWA 4J26A 4ZO1X 1UPWA 2B50A 3VRVA 3OMKA 4X1GA 4OZTE 4E4KA 5KCEA 4LTWA 5SYZA 2IOGA 5GIDA 4L96A 4ITEA 1G1UA 4DK8A 1XB7A 3WT6A 2ZMJA 4ZNVA 5E0WA 3NSQA 4P6WA 1BSXA 1QKNA 4FNEA 1ZH7A 1M7WA 3TKMA 3VT9A 4CI4A 5IXKA 2ZXMA 3DR1A 2IHQA 3PRGA 1OVLA 1NQ1A 1R5KA 1UOMA 4S14A 2PKLA 1QKUA 2P7AA 3OLLA 3VT6A 1KKQA 1U3QA 2B1VA 3V9VA 3A2JA 4YMQA 5C4OA 2AX8A 4K4JA 5AK2A 2PINA 5AWKA 5JJMB 3W0HA 2NW4A 3KPZA 4FHIA 2AB2A 3UU7B 4G2IA 3L0EA 3UUDA 3VT3A 1G5YA 3DZUA 3WT5A 3A9EB 3R5NA 3VJIA 2J4AA 1XNXA 3VJSA 1UHLB 3R29A 2QA8B 2ZLAA 2PIUA 3L3ZA 5C4SA 5KRHA 3ET0A 4QK4A 2QGTA 4MGCA 3D5FA 4QE8A 5KCTA 4DM8A 1Z5XE 1FBYA 1R20D 3AFRA 3U9QA 1QKMA 1T7MA 2YJAB 4ZNSA 1RK3A 1X7JA 3QT0A 1OSHA 3KDUA 1ERRA 3WT7A 2YLOA 2ZL9A 1Z5XU 2GL8A 1PQ6A 2JFAA 3PLZA 2AWHA 3B1MA 1YP0A 5DI7A 1VJBA 5AYGA 2G0GA 3NOAA 3OMMA 3Q95B 5C4UA 3VSOA 2YLYA 5GT4A 2ABIA 3L0JA 4NY9A 5DUEA 3GBKA 4J5WA 4KZJA 2P7ZA 5B5BA 1YYEA 1T73A 1U9EA 5DV6A 3ADTA 2ZK6A 3OMQA 4YPQA 4REEA 1ILGA 3ADSA 1YINA 4IV4A 2GWXA 1XP6A 5E15A 3OZJA 2HFPA 4MGAB 1YOKA 3K22A 3VT5A 5DIDA 4MDDA 3A40X 2QNVA 4IU7A 2VV0A 4JYIA 2HWQA 5DX3A 3CWDA 4OFRA 5G43A 5L7HA 1Q4XA 3X31A 1A52A 1NQ7A 5G3JA 3RVFA 2ZASA 3IA6A 4L98A 5LGAA 5KRCA 3B68A 4OLMA 5DUHA 2P4YA 4S0TA 1XOWA 3W0IA 5KRJA 1XDKA 2ZK0A 4DK7A 1RDTD 4OILA 4IA7A 4LBDA 1FD0A 3RLJA 3P8XA 4RUOX 3ERDA 3B66A 2VV2A 1PRGA
chains in the Genus database with same CATH superfamily
1R1KA 3AZ2A 4EM9A 4OJBA 4WHFA 1PZLA 2Q8SA 3LMPA 1RDTA 2QZOA 3HLVA 3UUAB 2Q61A 4XLDA 4JAZA 3X1IA 3VTDA 4NQAB 3F7DA 1PQ9A 1GS4A 4IWFA 4E2JA 1S9PA 4OZRE 1PDUA 1PCGA 1NQ0A 1T5ZA 1XP9A 3TKCA 3R8DA 4PP6A 1M13A 4MG8B 3W0CA 3KMGA 1T74A 2Z4BA 2A3IA 4OK1A 2AA5A 4OZRU 4PWLA 2YFEA 4TUZB 1Y0SA 1I38A 2B23A 1OSVA 2OVMA 3UP3A 4R2UA 4DM6A 4DOSA 2VV1A 1R6GA 3K6PA 4OEYA 3FLIA 1XVPA 3AZ3A 4ZJWA 4Y29A 3OSWA 3VRWA 3FC6B 4ITFA 3VTBA 3FEIA 2OUZA 3MNPA 3CDPA 5DK9A 4MGBB 2AA7A 2AYRA 2GPPA 5HJPB 5DKGA 5DXBA 1RKHA 4PLDA 2PITA 4OKTA 5DVCA 5AZTA 1A28A 1XPCA 3VTCA 5KR9A 4UDDA 2I4JA 2G0HA 2Q6JA 4OGHA 4XUMA 1XQCA 5AVLA 3UVVB 3A78A 4G1YA 2Q5PA 3IPQA 5KCWA 2Q70A 3OMPA 3W0JA 1ZDTA 1FCXA 5KCFA 2H79A 5DRMA 5AVIA 4J24A 1H9UA 1DKFA 2PIRA 2XKWA 1EXAA 3L0LA 5DXQA 3R8IA 4MGDA 1YMTA 4HEEX 5IZ0A 1TFCA 4ZOMA 5CJ6A 3AZ1A 3IPSA 4XT9A 3TX7B 4B7WA 3O1DA 4IVWA 2Q5GA 1HJ1A 5JI0D 5APKA 2ZFXA 3PCUA 4FN9A 2IOKA 1ZKYA 4OH5A 4IS8A 3WWRA 3FUGA 3S9SA 1S0ZA 3B0WA 3OSAA 4M8EA 2PRGA 4JGVA 3VJTA 3VRUA 1ZUCA 4IW6A 3K8SA 2HWRA 3FEJA 5G42A 2Q6SA 3R5MA 3B67A 3HVLA 5DIGA 1NQ2A 3CQVA 2V0VA 2QR9A 2ZK1A 3V49A 4OC7A 4RZGA 5AAVB 3RUTA 2H77A 2Z4JA 1RKGA 4P6XA 2Q59B 4IWCA 4LNXA 4PP5A 3OZ0A 3AN3A 3HO0A 5A86A 5H1EA 5FQPA 4R6SA 2ACLB 5K13A 5DL4A 3BC5A 2HCDA 5DYDA 1G50A 3PO9A 3VJHA 5KRKA 3D57A 2O4JA 3SZ1A 5HCVA 1EXXA 2BJ4A 2ZLCA 4MG7A 4N1YA 3FALA 3KDTA 1M2ZA 5DKBA 5DXMA 3RLLA 2ZNNA 4N5GA 3N00A 2Q7KA 2HB7A 2ZKCA 3L1BA 1ZDUA 2QH6A 4APUA 1L2IA 1K74D 1MZNA 4MG9B 1R20A 5FQSA 2AA2A 5EJVA 2OAXA 4CSJA 1ZGYA 4RAKA 4UDCA 2NV7A 3V4AA 2ZMHA 1U3RA 2XYJA 3GD2A 1ZEOA 3GYTA 4NIEA 4ZNWA 5DZIA 3RY9A 3TY0A 3E00D 1K74A 1NHZA 4WPFA 4A2JA 3OSIA 3VHUA 3WGPA 2FSZA 5DXKA 2NPAA 1N4HA 2Q7IA 3AN4A 1T7TA 3M7RA 1PK5A 3ZRBA 2YJDA 4TV1B 3GZ9A 5DZHA 3D24A 4RE8A 3E00A 1YA3A 1NRLA 4OKBA 1TXIA 5DUGA 3W0GA 4DQMA 1OT7A 3HODA 1KNUA 5GICA 2J14A 2ZXZA 2PIVA 1UPVA 5DVSA 3B5RA 5HYKA 2LBDA 5L7EA 3UP0A 3AX8A 3HC6A 5DXEA 5JJMA 3UU7A 3ADUA 3AURA 1S0XA 3RUUA 2AXAA 1L2JA 2VV4B 4PXMA 4ZI1A 3A9EA 1XV9B 5E1CA 2OVHA 4Q13A 2OZ7A 1MV9A 5APJA 3OKIA 3F5CB 4OKWA 5DY8A 1XZXX 4IA2A 1UHLA 4IV2A 2QGWA 2QA8A 2QXMA 3CS4A 2QE4A 4KZMA 4M8HA 4YT1A 1LBDA 5KD9A 4POHA 4PLEA 2Q6RA 1T79A 5FQRA 4S15A 4ZN7A 3WTQA 5ACCA 4OEDA 2Q5SA 2QPYA 3OAPA 2GPUA 2QXSA 4IVYA 2XYWA 5KRLA 2PJLA 2W8YA 3KMRA 4OARA 5G46A 2ZNOA 4NUFA 3DCUA 5DV8A 5DXPA 3ZRAA 5B41A 1YOWA 2QW4A 4ZNUA 2J7XA 4O8FA 4IA3A 2JF9A 3Q95A 4LNWA 1XP1A 1NUOA 3JZCA 5G5WA 2HVCA 4N8RA 5EHJA 1Y9RA 3ET1A 3FURA 1E3GA 2AX9A 4G1DA 4XTAA 5IAWA 3CS8A 5KYAA 2OCFA 2P1UA 3OLSA 3DZYD 5EI1A 1S9QA 5E19A 5G45A 3K23A 2AM9A 3ADVA 2QMVA 3AUNA 3R2AA 4MGAA 3W5TA 1K4WA 1N46A 1ILHA 5DMFA 4QL8A 1P8DA 1SQNA 2HBHA 3DZYA 5KRIA 4IQRA 5DRJA 3ILZA 5DTVA 3KYTA 4IA1A 1OVLB 1IE8A 2YATA 2ZY0A 5HJSA 1T63A 4J5XC 3GN8A 4PVUA 2Q7JA 3G0WA 3OLFA 4OJ9A 4XUHA 4EMAA 5KROA 5E0XA 5HZCA 3VRTA 4FGYA 2FAIA 1FM9D 3A2HA 1XNNA 4G20A 3KBAA 5AAUA 2HB8A 2XYXA 4R06A 3AUQA 3UUDB 2HC4A 3ZR7A 5DU5A 5DYBA 1XLSE 3IMYA 1EREA 2Q60A 4ONIA 3W5RA 1U3SA 1X78A 3B0QA 4RMCA 3VN2A 3G8IA 3WJ4A 3UUAA 4OJ4A 1GWQA 2QABA 2GP7A 3OOKA 4ZN9A 2PIPL 4OEZA 4WVDA 5DXGA 5KRMA 5I4VA 1G2NA 2YLQA 4G1ZA 3V3EA 5L7GA 1WM0X 3P0UA 4OIVA 3V9YA 4PPSA 4A4WA 4MG8A 5KRFA 5DIEA 4BCRA 4K7AA 3ET3A 4UDBA 2QTUA 1XAPA 4TUZA 4MG6A 3SP6A 2JFAB 4RZFA 3VT8A 3KFCA 3A3ZX 1K7LA 3G9EA 3GYUA 4OFUA 2XHSA 4ZJRA 2PIWA 3BQDA 3FXVA 4CI5A 1RJKA 4OZTU 3ZQTA 5E7VA 1NAXA 3H0AD 1X7RA 2R6YA 4DMAA 1XJ7A 1Y0XX 3OOFA 4RZEA 3WMHA 2I4ZA 3FC6A 5L11A 2FVJA 3HZFA 2G44A 2AO6A 1FCYA 3H0AA 3CTBA 4MGBA 4S0SA 5HJPA 1T7FA 1XLSA 3OGTA 3V3QA 5KCDA 5KYJA 2I4PA 4N73A 5LWPA 4OH6A 1FM6D 4F9MA 3DCTA 3A2IA 3EYBA 2R40D 3NSPA 4PRGA 5F9BA 4QJRA 5AZVA 1FCZA 2QSEA 3DZUD 3UVVA 2ZK3A 2V7CA 2YHDA 5DZ0A 1SKXA 5DX3B 1NDEA 3T03A 4ZO1B 1FM6A 4MG5A 5DKSA 4Q50A 2Q3YA 3FS1A 3SP9A 3L03A 2R40A 5GIEA 2YLPA 3ADWA 3B3KA 4RFWA 3JZBA 3WJ5A 1XDKB 3UUCA 1Z95A 2ATHA 3ERTA 1QKTA 2O9IA 2PNUA 3L3XA 2PIQA 2VSRA 4KZIA 2ZXNA 3W5QA 2PIXA 1NAVA 2ZMIA 2I0GA 3P89A 3B0RA 2HARA 4PPPA 5E14A 1T76A 3ADXA 3VHWA 2HASA 2QZOB 1N83A 1SJ0A 3PEQA 5EGVA 5DV3A 5DWIA 4NB6A 5ETHA 2I0JA 4RMEA 4WLBA 2R6WA 5DP0A 4Q0AC 5M96A 3H52A 4XAOA 5HYRA 2B1ZA 4G21A 2Q1HA 2AMAA 2PIOA 3X1HA 5AAVA 3CS6A 1MVCA 5DWJA 3VT4A 3WFFA 2ZNQA 2Q59A 2P54A 4RUPA 5FQVA 4ZNTA 3O1EA 2ACLA 2P15A 5DKEA 3D90A 4G2HA 5KRAA 4WHGA 2NXXE 2VV1B 1XQ3A 3DT3A 4IW8A 1PQCA 3B0TA 2ZK4A 5DZ3A 5DVVA 5C4TA 1XVPB 1YJEA 4RUJA 4JYHA 2HAMA 3GWSX 3W0AA 4J5WC 1NYXA 5DWEA 5KCCA 4JYGA 2GIUA 2GPOA 2G5OA 2Q1VA 5EITA 1T65A 1X76A 4MG9A 5DXBB 2P1VA 1ZAFA 5EC9A 1I37A 1KV6A 5APHA 2VSTA 4PF3A 3OKHA 4RMDA 2AAXA 2JJ3A 2GPVA 1X7BA 2AMBA 1E3KA 4QM0A 1I7IA 5FQTA 1R1KD 5DSHA 5JY3A 5AWJA 2Q7LA 3KWYA 5ICKA 5DXRA 4OKXA 1GWRA 3OMOA 1IE9A 3PBAA 3VT7A 1YIMA 1DKFB 3X36A 3DY6A 4TV1A 1P93A 1GWXA 2OM9A 3P88A 5DZ1A 1XIUA 1T7RA 2AX7A 4MGDB 1YY4A 2ZK5A 3E94A 3HC5A 4J5XA 4LSJA 3VI8A 3OS8A 5DWLA 3CLDA 5DLRA 2P7GA 2REWA 2ZBSA 3KMZA 4REFA 2P1TA 4UDAA 3G8OA 3HQ5A 4XHDA 3MNOA 3GWXA 3IXPD 3V9TA 4E4QA 2NXXA 4X1FA 2AA6A 3CJWA 4IUIA 3E7CA 2ZVTA 4PP3A 2VV4A 3BEJA 2VV3A 3OS8C 5DWGA 2QA6A 3W0YA 1XV9A 4DORA 2BAWA 3IXPA 4WQPA 4JL4A 3F5CA 1X7EA 1SR7A 2O4RA 1HG4A 3LBDA 4K6IA 3W5PA 5KCUA 4OEAA 4YNKA 4OIUA 3D6DA 3CDSA 3R8AA 1FM9A 2POBA 1DB1A 4OHAA 1YUCA 3B65A 3ET2A 2GTKA 3VSPA 4ZNHA 1I7GA 2AX6A 1S19A 4RWVA 3VHVA 2ZK2A 2ZNPA 5DMCA 4XI3A 1LV2A 3HM1A 4A4VA 4FHHA 2BJ4B 4MG7B 3OS9A 3WFGA 3IPUA 3MNEA 2E2RA 2F4BA 3FALB 4QE6A 2EWPA 5G44A 4POJA 2J7YA 2POGA 4HLWA 4J26A 4ZO1X 1UPWA 2B50A 3VRVA 3OMKA 4X1GA 4OZTE 4E4KA 5KCEA 4LTWA 5SYZA 2IOGA 5GIDA 4L96A 4ITEA 1G1UA 4DK8A 1XB7A 3WT6A 2ZMJA 4ZNVA 5E0WA 3NSQA 4P6WA 1BSXA 1QKNA 4FNEA 1ZH7A 1M7WA 3TKMA 3VT9A 4CI4A 5IXKA 2ZXMA 3DR1A 2IHQA 3PRGA 1OVLA 1NQ1A 1R5KA 1UOMA 4S14A 2PKLA 1QKUA 2P7AA 3OLLA 3VT6A 1KKQA 1U3QA 2B1VA 3V9VA 3A2JA 4YMQA 5C4OA 2AX8A 4K4JA 5AK2A 2PINA 5AWKA 5JJMB 3W0HA 2NW4A 3KPZA 4FHIA 2AB2A 3UU7B 4G2IA 3L0EA 3UUDA 3VT3A 1G5YA 3DZUA 3WT5A 3A9EB 3R5NA 3VJIA 2J4AA 1XNXA 3VJSA 1UHLB 3R29A 2QA8B 2ZLAA 2PIUA 3L3ZA 5C4SA 5KRHA 3ET0A 4QK4A 2QGTA 4MGCA 3D5FA 4QE8A 5KCTA 4DM8A 1Z5XE 1FBYA 1R20D 3AFRA 3U9QA 1QKMA 1T7MA 2YJAB 4ZNSA 1RK3A 1X7JA 3QT0A 1OSHA 3KDUA 1ERRA 3WT7A 2YLOA 2ZL9A 1Z5XU 2GL8A 1PQ6A 2JFAA 3PLZA 2AWHA 3B1MA 1YP0A 5DI7A 1VJBA 5AYGA 2G0GA 3NOAA 3OMMA 3Q95B 5C4UA 3VSOA 2YLYA 5GT4A 2ABIA 3L0JA 4NY9A 5DUEA 3GBKA 4J5WA 4KZJA 2P7ZA 5B5BA 1YYEA 1T73A 1U9EA 5DV6A 3ADTA 2ZK6A 3OMQA 4YPQA 4REEA 1ILGA 3ADSA 1YINA 4IV4A 2GWXA 1XP6A 5E15A 3OZJA 2HFPA 4MGAB 1YOKA 3K22A 3VT5A 5DIDA 4MDDA 3A40X 2QNVA 4IU7A 2VV0A 4JYIA 2HWQA 5DX3A 3CWDA 4OFRA 5G43A 5L7HA 1Q4XA 3X31A 1A52A 1NQ7A 5G3JA 3RVFA 2ZASA 3IA6A 4L98A 5LGAA 5KRCA 3B68A 4OLMA 5DUHA 2P4YA 4S0TA 1XOWA 3W0IA 5KRJA 1XDKA 2ZK0A 4DK7A 1RDTD 4OILA 4IA7A 4LBDA 1FD0A 3RLJA 3P8XA 4RUOX 3ERDA 3B66A 2VV2A 1PRGA
chains in the Genus database with same CATH topology
1R1KA 3AZ2A 4EM9A 4OJBA 4WHFA 1PZLA 2Q8SA 3LMPA 1RDTA 2QZOA 3HLVA 3UUAB 2Q61A 4XLDA 4JAZA 3X1IA 3VTDA 4NQAB 3F7DA 1PQ9A 1GS4A 4IWFA 4E2JA 1S9PA 4OZRE 1PDUA 1PCGA 1NQ0A 1T5ZA 1XP9A 3TKCA 3R8DA 4PP6A 1M13A 4MG8B 3W0CA 3KMGA 1T74A 2Z4BA 2A3IA 4OK1A 2AA5A 4OZRU 4PWLA 2YFEA 4TUZB 1Y0SA 1I38A 2B23A 1OSVA 2OVMA 3UP3A 4R2UA 4DM6A 4DOSA 2VV1A 1R6GA 3K6PA 4OEYA 3FLIA 1XVPA 3AZ3A 4ZJWA 4Y29A 3OSWA 3VRWA 3FC6B 4ITFA 3VTBA 3FEIA 2OUZA 3MNPA 3CDPA 5DK9A 4MGBB 2AA7A 2AYRA 2GPPA 5HJPB 5DKGA 5DXBA 1RKHA 4PLDA 2PITA 4OKTA 5DVCA 5AZTA 1A28A 1XPCA 3VTCA 5KR9A 4UDDA 2I4JA 2G0HA 2Q6JA 4OGHA 4XUMA 1XQCA 5AVLA 3UVVB 3A78A 4G1YA 2Q5PA 3IPQA 5KCWA 2Q70A 3OMPA 3W0JA 1ZDTA 1FCXA 5KCFA 2H79A 5DRMA 5AVIA 4J24A 1H9UA 1DKFA 2PIRA 2XKWA 1EXAA 3L0LA 5DXQA 3R8IA 4MGDA 1YMTA 4HEEX 5IZ0A 1TFCA 4ZOMA 5CJ6A 3AZ1A 3IPSA 4XT9A 3TX7B 4B7WA 3O1DA 4IVWA 2Q5GA 1HJ1A 5JI0D 5APKA 2ZFXA 3PCUA 4FN9A 2IOKA 1ZKYA 4OH5A 4IS8A 3WWRA 3FUGA 3S9SA 1S0ZA 3B0WA 3OSAA 4M8EA 2PRGA 4JGVA 3VJTA 3VRUA 1ZUCA 4IW6A 3K8SA 2HWRA 3FEJA 5G42A 2Q6SA 3R5MA 3B67A 3HVLA 5DIGA 1NQ2A 3CQVA 2V0VA 2QR9A 2ZK1A 3V49A 4OC7A 4RZGA 5AAVB 3RUTA 2H77A 2Z4JA 1RKGA 4P6XA 2Q59B 4IWCA 4LNXA 4PP5A 3OZ0A 3AN3A 3HO0A 5A86A 5H1EA 5FQPA 4R6SA 2ACLB 5K13A 5DL4A 3BC5A 2HCDA 5DYDA 1G50A 3PO9A 3VJHA 5KRKA 3D57A 2O4JA 3SZ1A 5HCVA 1EXXA 2BJ4A 2ZLCA 4MG7A 4N1YA 3FALA 3KDTA 1M2ZA 5DKBA 5DXMA 3RLLA 2ZNNA 4N5GA 3N00A 2Q7KA 2HB7A 2ZKCA 3L1BA 1ZDUA 2QH6A 4APUA 1L2IA 1K74D 1MZNA 4MG9B 1R20A 5FQSA 2AA2A 5EJVA 2OAXA 4CSJA 1ZGYA 4RAKA 4UDCA 2NV7A 3V4AA 2ZMHA 1U3RA 2XYJA 3GD2A 1ZEOA 3GYTA 4NIEA 4ZNWA 5DZIA 3RY9A 3TY0A 3E00D 1K74A 1NHZA 4WPFA 4A2JA 3OSIA 3VHUA 3WGPA 2FSZA 5DXKA 2NPAA 1N4HA 2Q7IA 3AN4A 1T7TA 3M7RA 1PK5A 3ZRBA 2YJDA 4TV1B 3GZ9A 5DZHA 3D24A 4RE8A 3E00A 1YA3A 1NRLA 4OKBA 1TXIA 5DUGA 3W0GA 4DQMA 1OT7A 3HODA 1KNUA 5GICA 2J14A 2ZXZA 2PIVA 1UPVA 5DVSA 3B5RA 5HYKA 2LBDA 5L7EA 3UP0A 3AX8A 3HC6A 5DXEA 5JJMA 3UU7A 3ADUA 3AURA 1S0XA 3RUUA 2AXAA 1L2JA 2VV4B 4PXMA 4ZI1A 3A9EA 1XV9B 5E1CA 2OVHA 4Q13A 2OZ7A 1MV9A 5APJA 3OKIA 3F5CB 4OKWA 5DY8A 1XZXX 4IA2A 1UHLA 4IV2A 2QGWA 2QA8A 2QXMA 3CS4A 2QE4A 4KZMA 4M8HA 4YT1A 1LBDA 5KD9A 4POHA 4PLEA 2Q6RA 1T79A 5FQRA 4S15A 4ZN7A 3WTQA 5ACCA 4OEDA 2Q5SA 2QPYA 3OAPA 2GPUA 2QXSA 4IVYA 2XYWA 5KRLA 2PJLA 2W8YA 3KMRA 4OARA 5G46A 2ZNOA 4NUFA 3DCUA 5DV8A 5DXPA 3ZRAA 5B41A 1YOWA 2QW4A 4ZNUA 2J7XA 4O8FA 4IA3A 2JF9A 3Q95A 4LNWA 1XP1A 1NUOA 3JZCA 5G5WA 2HVCA 4N8RA 5EHJA 1Y9RA 3ET1A 3FURA 1E3GA 2AX9A 4G1DA 4XTAA 5IAWA 3CS8A 5KYAA 2OCFA 2P1UA 3OLSA 3DZYD 5EI1A 1S9QA 5E19A 5G45A 3K23A 2AM9A 3ADVA 2QMVA 3AUNA 3R2AA 4MGAA 3W5TA 1K4WA 1N46A 1ILHA 5DMFA 4QL8A 1P8DA 1SQNA 2HBHA 3DZYA 5KRIA 4IQRA 5DRJA 3ILZA 5DTVA 3KYTA 4IA1A 1OVLB 1IE8A 2YATA 2ZY0A 5HJSA 1T63A 4J5XC 3GN8A 4PVUA 2Q7JA 3G0WA 3OLFA 4OJ9A 4XUHA 4EMAA 5KROA 5E0XA 5HZCA 3VRTA 4FGYA 2FAIA 1FM9D 3A2HA 1XNNA 4G20A 3KBAA 5AAUA 2HB8A 2XYXA 4R06A 3AUQA 3UUDB 2HC4A 3ZR7A 5DU5A 5DYBA 1XLSE 3IMYA 1EREA 2Q60A 4ONIA 3W5RA 1U3SA 1X78A 3B0QA 4RMCA 3VN2A 3G8IA 3WJ4A 3UUAA 4OJ4A 1GWQA 2QABA 2GP7A 3OOKA 4ZN9A 2PIPL 4OEZA 4WVDA 5DXGA 5KRMA 5I4VA 1G2NA 2YLQA 4G1ZA 3V3EA 5L7GA 1WM0X 3P0UA 4OIVA 3V9YA 4PPSA 4A4WA 4MG8A 5KRFA 5DIEA 4BCRA 4K7AA 3ET3A 4UDBA 2QTUA 1XAPA 4TUZA 4MG6A 3SP6A 2JFAB 4RZFA 3VT8A 3KFCA 3A3ZX 1K7LA 3G9EA 3GYUA 4OFUA 2XHSA 4ZJRA 2PIWA 3BQDA 3FXVA 4CI5A 1RJKA 4OZTU 3ZQTA 5E7VA 1NAXA 3H0AD 1X7RA 2R6YA 4DMAA 1XJ7A 1Y0XX 3OOFA 4RZEA 3WMHA 2I4ZA 3FC6A 5L11A 2FVJA 3HZFA 2G44A 2AO6A 1FCYA 3H0AA 3CTBA 4MGBA 4S0SA 5HJPA 1T7FA 1XLSA 3OGTA 3V3QA 5KCDA 5KYJA 2I4PA 4N73A 5LWPA 4OH6A 1FM6D 4F9MA 3DCTA 3A2IA 3EYBA 2R40D 3NSPA 4PRGA 5F9BA 4QJRA 5AZVA 1FCZA 2QSEA 3DZUD 3UVVA 2ZK3A 2V7CA 2YHDA 5DZ0A 1SKXA 5DX3B 1NDEA 3T03A 4ZO1B 1FM6A 4MG5A 5DKSA 4Q50A 2Q3YA 3FS1A 3SP9A 3L03A 2R40A 5GIEA 2YLPA 3ADWA 3B3KA 4RFWA 3JZBA 3WJ5A 1XDKB 3UUCA 1Z95A 2ATHA 3ERTA 1QKTA 2O9IA 2PNUA 3L3XA 2PIQA 2VSRA 4KZIA 2ZXNA 3W5QA 2PIXA 1NAVA 2ZMIA 2I0GA 3P89A 3B0RA 2HARA 4PPPA 5E14A 1T76A 3ADXA 3VHWA 2HASA 2QZOB 1N83A 1SJ0A 3PEQA 5EGVA 5DV3A 5DWIA 4NB6A 5ETHA 2I0JA 4RMEA 4WLBA 2R6WA 5DP0A 4Q0AC 5M96A 3H52A 4XAOA 5HYRA 2B1ZA 4G21A 2Q1HA 2AMAA 2PIOA 3X1HA 5AAVA 3CS6A 1MVCA 5DWJA 3VT4A 3WFFA 2ZNQA 2Q59A 2P54A 4RUPA 5FQVA 4ZNTA 3O1EA 2ACLA 2P15A 5DKEA 3D90A 4G2HA 5KRAA 4WHGA 2NXXE 2VV1B 1XQ3A 3DT3A 4IW8A 1PQCA 3B0TA 2ZK4A 5DZ3A 5DVVA 5C4TA 1XVPB 1YJEA 4RUJA 4JYHA 2HAMA 3GWSX 3W0AA 4J5WC 1NYXA 5DWEA 5KCCA 4JYGA 2GIUA 2GPOA 2G5OA 2Q1VA 5EITA 1T65A 1X76A 4MG9A 5DXBB 2P1VA 1ZAFA 5EC9A 1I37A 1KV6A 5APHA 2VSTA 4PF3A 3OKHA 4RMDA 2AAXA 2JJ3A 2GPVA 1X7BA 2AMBA 1E3KA 4QM0A 1I7IA 5FQTA 1R1KD 5DSHA 5JY3A 5AWJA 2Q7LA 3KWYA 5ICKA 5DXRA 4OKXA 1GWRA 3OMOA 1IE9A 3PBAA 3VT7A 1YIMA 1DKFB 3X36A 3DY6A 4TV1A 1P93A 1GWXA 2OM9A 3P88A 5DZ1A 1XIUA 1T7RA 2AX7A 4MGDB 1YY4A 2ZK5A 3E94A 3HC5A 4J5XA 4LSJA 3VI8A 3OS8A 5DWLA 3CLDA 5DLRA 2P7GA 2REWA 2ZBSA 3KMZA 4REFA 2P1TA 4UDAA 3G8OA 3HQ5A 4XHDA 3MNOA 3GWXA 3IXPD 3V9TA 4E4QA 2NXXA 4X1FA 2AA6A 3CJWA 4IUIA 3E7CA 2ZVTA 4PP3A 2VV4A 3BEJA 2VV3A 3OS8C 5DWGA 2QA6A 3W0YA 1XV9A 4DORA 2BAWA 3IXPA 4WQPA 4JL4A 3F5CA 1X7EA 1SR7A 2O4RA 1HG4A 3LBDA 4K6IA 3W5PA 5KCUA 4OEAA 4YNKA 4OIUA 3D6DA 3CDSA 3R8AA 1FM9A 2POBA 1DB1A 4OHAA 1YUCA 3B65A 3ET2A 2GTKA 3VSPA 4ZNHA 1I7GA 2AX6A 1S19A 4RWVA 3VHVA 2ZK2A 2ZNPA 5DMCA 4XI3A 1LV2A 3HM1A 4A4VA 4FHHA 2BJ4B 4MG7B 3OS9A 3WFGA 3IPUA 3MNEA 2E2RA 2F4BA 3FALB 4QE6A 2EWPA 5G44A 4POJA 2J7YA 2POGA 4HLWA 4J26A 4ZO1X 1UPWA 2B50A 3VRVA 3OMKA 4X1GA 4OZTE 4E4KA 5KCEA 4LTWA 5SYZA 2IOGA 5GIDA 4L96A 4ITEA 1G1UA 4DK8A 1XB7A 3WT6A 2ZMJA 4ZNVA 5E0WA 3NSQA 4P6WA 1BSXA 1QKNA 4FNEA 1ZH7A 1M7WA 3TKMA 3VT9A 4CI4A 5IXKA 2ZXMA 3DR1A 2IHQA 3PRGA 1OVLA 1NQ1A 1R5KA 1UOMA 4S14A 2PKLA 1QKUA 2P7AA 3OLLA 3VT6A 1KKQA 1U3QA 2B1VA 3V9VA 3A2JA 4YMQA 5C4OA 2AX8A 4K4JA 5AK2A 2PINA 5AWKA 5JJMB 3W0HA 2NW4A 3KPZA 4FHIA 2AB2A 3UU7B 4G2IA 3L0EA 3UUDA 3VT3A 1G5YA 3DZUA 3WT5A 3A9EB 3R5NA 3VJIA 2J4AA 1XNXA 3VJSA 1UHLB 3R29A 2QA8B 2ZLAA 2PIUA 3L3ZA 5C4SA 5KRHA 3ET0A 4QK4A 2QGTA 4MGCA 3D5FA 4QE8A 5KCTA 4DM8A 1Z5XE 1FBYA 1R20D 3AFRA 3U9QA 1QKMA 1T7MA 2YJAB 4ZNSA 1RK3A 1X7JA 3QT0A 1OSHA 3KDUA 1ERRA 3WT7A 2YLOA 2ZL9A 1Z5XU 2GL8A 1PQ6A 2JFAA 3PLZA 2AWHA 3B1MA 1YP0A 5DI7A 1VJBA 5AYGA 2G0GA 3NOAA 3OMMA 3Q95B 5C4UA 3VSOA 2YLYA 5GT4A 2ABIA 3L0JA 4NY9A 5DUEA 3GBKA 4J5WA 4KZJA 2P7ZA 5B5BA 1YYEA 1T73A 1U9EA 5DV6A 3ADTA 2ZK6A 3OMQA 4YPQA 4REEA 1ILGA 3ADSA 1YINA 4IV4A 2GWXA 1XP6A 5E15A 3OZJA 2HFPA 4MGAB 1YOKA 3K22A 3VT5A 5DIDA 4MDDA 3A40X 2QNVA 4IU7A 2VV0A 4JYIA 2HWQA 5DX3A 3CWDA 4OFRA 5G43A 5L7HA 1Q4XA 3X31A 1A52A 1NQ7A 5G3JA 3RVFA 2ZASA 3IA6A 4L98A 5LGAA 5KRCA 3B68A 4OLMA 5DUHA 2P4YA 4S0TA 1XOWA 3W0IA 5KRJA 1XDKA 2ZK0A 4DK7A 1RDTD 4OILA 4IA7A 4LBDA 1FD0A 3RLJA 3P8XA 4RUOX 3ERDA 3B66A 2VV2A 1PRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1K A;  3AZ2 A;  4EM9 A;  4OJB A;  4WHF A;  1PZL A;  2Q8S A;  3LMP A;  1RDT A;  2QZO A;  3HLV A;  3UUA B;  2Q61 A;  4XLD A;  4JAZ A;  3X1I A;  3VTD A;  4NQA B;  3F7D A;  1PQ9 A;  1GS4 A;  4IWF A;  4E2J A;  1S9P A;  4OZR E;  1PDU A;  1PCG A;  1NQ0 A;  1T5Z A;  1XP9 A;  3TKC A;  3R8D A;  4PP6 A;  1M13 A;  4MG8 B;  3W0C A;  3KMG A;  1T74 A;  2Z4B A;  2A3I A;  4OK1 A;  2AA5 A;  4OZR U;  4PWL A;  2YFE A;  4TUZ B;  1Y0S A;  1I38 A;  2B23 A;  1OSV A;  2OVM A;  3UP3 A;  4R2U A;  4DM6 A;  4DOS A;  2VV1 A;  1R6G A;  3K6P A;  4OEY A;  3FLI A;  1XVP A;  3AZ3 A;  4ZJW A;  4Y29 A;  3OSW A;  3VRW A;  3FC6 B;  4ITF A;  3VTB A;  3FEI A;  2OUZ A;  3MNP A;  3CDP A;  5DK9 A;  4MGB B;  2AA7 A;  2AYR A;  2GPP A;  5HJP B;  5DKG A;  5DXB A;  1RKH A;  4PLD A;  2PIT A;  4OKT A;  5DVC A;  5AZT A;  1A28 A;  1XPC A;  3VTC A;  5KR9 A;  4UDD A;  2I4J A;  2G0H A;  2Q6J A;  4OGH A;  4XUM A;  1XQC A;  5AVL A;  3UVV B;  3A78 A;  4G1Y A;  2Q5P A;  3IPQ A;  5KCW A;  2Q70 A;  3OMP A;  3W0J A;  1ZDT A;  1FCX A;  5KCF A;  2H79 A;  5DRM A;  5AVI A;  4J24 A;  1H9U A;  1DKF A;  2PIR A;  2XKW A;  1EXA A;  3L0L A;  5DXQ A;  3R8I A;  4MGD A;  1YMT A;  4HEE X;  5IZ0 A;  1TFC A;  4ZOM A;  5CJ6 A;  3AZ1 A;  3IPS A;  4XT9 A;  3TX7 B;  4B7W A;  3O1D A;  4IVW A;  2Q5G A;  1HJ1 A;  5JI0 D;  5APK A;  2ZFX A;  3PCU A;  4FN9 A;  2IOK A;  1ZKY A;  4OH5 A;  4IS8 A;  3WWR A;  3FUG A;  3S9S A;  1S0Z A;  3B0W A;  3OSA A;  4M8E A;  2PRG A;  4JGV A;  3VJT A;  3VRU A;  1ZUC A;  4IW6 A;  3K8S A;  2HWR A;  3FEJ A;  5G42 A;  2Q6S A;  3R5M A;  3B67 A;  3HVL A;  5DIG A;  1NQ2 A;  3CQV A;  2V0V A;  2QR9 A;  2ZK1 A;  3V49 A;  4OC7 A;  4RZG A;  5AAV B;  3RUT A;  2H77 A;  2Z4J A;  1RKG A;  4P6X A;  2Q59 B;  4IWC A;  4LNX A;  4PP5 A;  3OZ0 A;  3AN3 A;  3HO0 A;  5A86 A;  5H1E A;  5FQP A;  4R6S A;  2ACL B;  5K13 A;  5DL4 A;  3BC5 A;  2HCD A;  5DYD A;  1G50 A;  3PO9 A;  3VJH A;  5KRK A;  3D57 A;  2O4J A;  3SZ1 A;  5HCV A;  1EXX A;  2BJ4 A;  2ZLC A;  4MG7 A;  4N1Y A;  3FAL A;  3KDT A;  1M2Z A;  5DKB A;  5DXM A;  3RLL A;  2ZNN A;  4N5G A;  3N00 A;  2Q7K A;  2HB7 A;  2ZKC A;  3L1B A;  1ZDU A;  2QH6 A;  4APU A;  1L2I A;  1K74 D;  1MZN A;  4MG9 B;  1R20 A;  5FQS A;  2AA2 A;  5EJV A;  2OAX A;  4CSJ A;  1ZGY A;  4RAK A;  4UDC A;  2NV7 A;  3V4A A;  2ZMH A;  1U3R A;  2XYJ A;  3GD2 A;  1ZEO A;  3GYT A;  4NIE A;  4ZNW A;  5DZI A;  3RY9 A;  3TY0 A;  3E00 D;  1K74 A;  1NHZ A;  4WPF A;  4A2J A;  3OSI A;  3VHU A;  3WGP A;  2FSZ A;  5DXK A;  2NPA A;  1N4H A;  2Q7I A;  3AN4 A;  1T7T A;  3M7R A;  1PK5 A;  3ZRB A;  2YJD A;  4TV1 B;  3GZ9 A;  5DZH A;  3D24 A;  4RE8 A;  3E00 A;  1YA3 A;  1NRL A;  4OKB A;  1TXI A;  5DUG A;  3W0G A;  4DQM A;  1OT7 A;  3HOD A;  1KNU A;  5GIC A;  2J14 A;  2ZXZ A;  2PIV A;  1UPV A;  5DVS A;  3B5R A;  5HYK A;  2LBD A;  5L7E A;  3UP0 A;  3AX8 A;  3HC6 A;  5DXE A;  5JJM A;  3UU7 A;  3ADU A;  3AUR A;  1S0X A;  3RUU A;  2AXA A;  1L2J A;  2VV4 B;  4PXM A;  4ZI1 A;  3A9E A;  1XV9 B;  5E1C A;  2OVH A;  4Q13 A;  2OZ7 A;  1MV9 A;  5APJ A;  3OKI A;  3F5C B;  4OKW A;  5DY8 A;  1XZX X;  4IA2 A;  1UHL A;  4IV2 A;  2QGW A;  2QA8 A;  2QXM A;  3CS4 A;  2QE4 A;  4KZM A;  4M8H A;  4YT1 A;  1LBD A;  5KD9 A;  4POH A;  4PLE A;  2Q6R A;  1T79 A;  5FQR A;  4S15 A;  4ZN7 A;  3WTQ A;  5ACC A;  4OED A;  2Q5S A;  2QPY A;  3OAP A;  2GPU A;  2QXS A;  4IVY A;  2XYW A;  5KRL A;  2PJL A;  2W8Y A;  3KMR A;  4OAR A;  5G46 A;  2ZNO A;  4NUF A;  3DCU A;  5DV8 A;  5DXP A;  3ZRA A;  5B41 A;  1YOW A;  2QW4 A;  4ZNU A;  2J7X A;  4O8F A;  4IA3 A;  2JF9 A;  3Q95 A;  4LNW A;  1XP1 A;  1NUO A;  3JZC A;  5G5W A;  2HVC A;  4N8R A;  5EHJ A;  1Y9R A;  3ET1 A;  3FUR A;  1E3G A;  2AX9 A;  4G1D A;  4XTA A;  5IAW A;  3CS8 A;  5KYA A;  2OCF A;  2P1U A;  3OLS A;  3DZY D;  5EI1 A;  1S9Q A;  5E19 A;  5G45 A;  3K23 A;  2AM9 A;  3ADV A;  2QMV A;  3AUN A;  3R2A A;  4MGA A;  3W5T A;  1K4W A;  1N46 A;  1ILH A;  5DMF A;  4QL8 A;  1P8D A;  1SQN A;  2HBH A;  3DZY A;  5KRI A;  4IQR A;  5DRJ A;  3ILZ A;  5DTV A;  3KYT A;  4IA1 A;  1OVL B;  1IE8 A;  2YAT A;  2ZY0 A;  5HJS A;  1T63 A;  4J5X C;  3GN8 A;  4PVU A;  2Q7J A;  3G0W A;  3OLF A;  4OJ9 A;  4XUH A;  4EMA A;  5KRO A;  5E0X A;  5HZC A;  3VRT A;  4FGY A;  2FAI A;  1FM9 D;  3A2H A;  1XNN A;  4G20 A;  3KBA A;  5AAU A;  2HB8 A;  2XYX A;  4R06 A;  3AUQ A;  3UUD B;  2HC4 A;  3ZR7 A;  5DU5 A;  5DYB A;  1XLS E;  3IMY A;  1ERE A;  2Q60 A;  4ONI A;  3W5R A;  1U3S A;  1X78 A;  3B0Q A;  4RMC A;  3VN2 A;  3G8I A;  3WJ4 A;  3UUA A;  4OJ4 A;  1GWQ A;  2QAB A;  2GP7 A;  3OOK A;  4ZN9 A;  2PIP L;  4OEZ A;  4WVD A;  5DXG A;  5KRM A;  5I4V A;  1G2N A;  2YLQ A;  4G1Z A;  3V3E A;  5L7G A;  1WM0 X;  3P0U A;  4OIV A;  3V9Y A;  4PPS A;  4A4W A;  4MG8 A;  5KRF A;  5DIE A;  4BCR A;  4K7A A;  3ET3 A;  4UDB A;  2QTU A;  1XAP A;  4TUZ A;  4MG6 A;  3SP6 A;  2JFA B;  4RZF A;  3VT8 A;  3KFC A;  3A3Z X;  1K7L A;  3G9E A;  3GYU A;  4OFU A;  2XHS A;  4ZJR A;  2PIW A;  3BQD A;  3FXV A;  4CI5 A;  1RJK A;  4OZT U;  3ZQT A;  5E7V A;  1NAX A;  3H0A D;  1X7R A;  2R6Y A;  4DMA A;  1XJ7 A;  1Y0X X;  3OOF A;  4RZE A;  3WMH A;  2I4Z A;  3FC6 A;  5L11 A;  2FVJ A;  3HZF A;  2G44 A;  2AO6 A;  1FCY A;  3H0A A;  3CTB A;  4MGB A;  4S0S A;  5HJP A;  1T7F A;  1XLS A;  3OGT A;  3V3Q A;  5KCD A;  5KYJ A;  2I4P A;  4N73 A;  5LWP A;  4OH6 A;  1FM6 D;  4F9M A;  3DCT A;  3A2I A;  3EYB A;  2R40 D;  3NSP A;  4PRG A;  5F9B A;  4QJR A;  5AZV A;  1FCZ A;  2QSE A;  3DZU D;  3UVV A;  2ZK3 A;  2V7C A;  2YHD A;  5DZ0 A;  1SKX A;  5DX3 B;  1NDE A;  3T03 A;  4ZO1 B;  1FM6 A;  4MG5 A;  5DKS A;  4Q50 A;  2Q3Y A;  3FS1 A;  3SP9 A;  3L03 A;  2R40 A;  5GIE A;  2YLP A;  3ADW A;  3B3K A;  4RFW A;  3JZB A;  3WJ5 A;  1XDK B;  3UUC A;  1Z95 A;  2ATH A;  3ERT A;  1QKT A;  2O9I A;  2PNU A;  3L3X A;  2PIQ A;  2VSR A;  4KZI A;  2ZXN A;  3W5Q A;  2PIX A;  1NAV A;  2ZMI A;  2I0G A;  3P89 A;  3B0R A;  2HAR A;  4PPP A;  5E14 A;  1T76 A;  3ADX A;  3VHW A;  2HAS A;  2QZO B;  1N83 A;  1SJ0 A;  3PEQ A;  5EGV A;  5DV3 A;  5DWI A;  4NB6 A;  5ETH A;  2I0J A;  4RME A;  4WLB A;  2R6W A;  5DP0 A;  4Q0A C;  5M96 A;  3H52 A;  4XAO A;  5HYR A;  2B1Z A;  4G21 A;  2Q1H A;  2AMA A;  2PIO A;  3X1H A;  5AAV A;  3CS6 A;  1MVC A;  5DWJ A;  3VT4 A;  3WFF A;  2ZNQ A;  2Q59 A;  2P54 A;  4RUP A;  5FQV A;  4ZNT A;  3O1E A;  2ACL A;  2P15 A;  5DKE A;  3D90 A;  4G2H A;  5KRA A;  4WHG A;  2NXX E;  2VV1 B;  1XQ3 A;  3DT3 A;  4IW8 A;  1PQC A;  3B0T A;  2ZK4 A;  5DZ3 A;  5DVV A;  5C4T A;  1XVP B;  1YJE A;  4RUJ A;  4JYH A;  2HAM A;  3GWS X;  3W0A A;  4J5W C;  1NYX A;  5DWE A;  5KCC A;  4JYG A;  2GIU A;  2GPO A;  2G5O A;  2Q1V A;  5EIT A;  1T65 A;  1X76 A;  4MG9 A;  5DXB B;  2P1V A;  1ZAF A;  5EC9 A;  1I37 A;  1KV6 A;  5APH A;  2VST A;  4PF3 A;  3OKH A;  4RMD A;  2AAX A;  2JJ3 A;  2GPV A;  1X7B A;  2AMB A;  1E3K A;  4QM0 A;  1I7I A;  5FQT A;  1R1K D;  5DSH A;  5JY3 A;  5AWJ A;  2Q7L A;  3KWY A;  5ICK A;  5DXR A;  4OKX A;  1GWR A;  3OMO A;  1IE9 A;  3PBA A;  3VT7 A;  1YIM A;  1DKF B;  3X36 A;  3DY6 A;  4TV1 A;  1P93 A;  1GWX A;  2OM9 A;  3P88 A;  5DZ1 A;  1XIU A;  1T7R A;  2AX7 A;  4MGD B;  1YY4 A;  2ZK5 A;  3E94 A;  3HC5 A;  4J5X A;  4LSJ A;  3VI8 A;  3OS8 A;  5DWL A;  3CLD A;  5DLR A;  2P7G A;  2REW A;  2ZBS A;  3KMZ A;  4REF A;  2P1T A;  4UDA A;  3G8O A;  3HQ5 A;  4XHD A;  3MNO A;  3GWX A;  3IXP D;  3V9T A;  4E4Q A;  2NXX A;  4X1F A;  2AA6 A;  3CJW A;  4IUI A;  3E7C A;  2ZVT A;  4PP3 A;  2VV4 A;  3BEJ A;  2VV3 A;  3OS8 C;  5DWG A;  2QA6 A;  3W0Y A;  1XV9 A;  4DOR A;  2BAW A;  3IXP A;  4WQP A;  4JL4 A;  3F5C A;  1X7E A;  1SR7 A;  2O4R A;  1HG4 A;  3LBD A;  4K6I A;  3W5P A;  5KCU A;  4OEA A;  4YNK A;  4OIU A;  3D6D A;  3CDS A;  3R8A A;  1FM9 A;  2POB A;  1DB1 A;  4OHA A;  1YUC A;  3B65 A;  3ET2 A;  2GTK A;  3VSP A;  4ZNH A;  1I7G A;  2AX6 A;  1S19 A;  4RWV A;  3VHV A;  2ZK2 A;  2ZNP A;  5DMC A;  4XI3 A;  1LV2 A;  3HM1 A;  4A4V A;  4FHH A;  2BJ4 B;  4MG7 B;  3OS9 A;  3WFG A;  3IPU A;  3MNE A;  2E2R A;  2F4B A;  3FAL B;  4QE6 A;  2EWP A;  5G44 A;  4POJ A;  2J7Y A;  2POG A;  4HLW A;  4J26 A;  4ZO1 X;  1UPW A;  2B50 A;  3VRV A;  3OMK A;  4X1G A;  4OZT E;  4E4K A;  5KCE A;  4LTW A;  5SYZ A;  2IOG A;  5GID A;  4L96 A;  4ITE A;  1G1U A;  4DK8 A;  1XB7 A;  3WT6 A;  2ZMJ A;  4ZNV A;  5E0W A;  3NSQ A;  4P6W A;  1BSX A;  1QKN A;  4FNE A;  1ZH7 A;  1M7W A;  3TKM A;  3VT9 A;  4CI4 A;  5IXK A;  2ZXM A;  3DR1 A;  2IHQ A;  3PRG A;  1OVL A;  1NQ1 A;  1R5K A;  1UOM A;  4S14 A;  2PKL A;  1QKU A;  2P7A A;  3OLL A;  3VT6 A;  1KKQ A;  1U3Q A;  2B1V A;  3V9V A;  3A2J A;  4YMQ A;  5C4O A;  2AX8 A;  4K4J A;  5AK2 A;  2PIN A;  5AWK A;  5JJM B;  3W0H A;  2NW4 A;  3KPZ A;  4FHI A;  2AB2 A;  3UU7 B;  4G2I A;  3L0E A;  3UUD A;  3VT3 A;  1G5Y A;  3DZU A;  3WT5 A;  3A9E B;  3R5N A;  3VJI A;  2J4A A;  1XNX A;  3VJS A;  1UHL B;  3R29 A;  2QA8 B;  2ZLA A;  2PIU A;  3L3Z A;  5C4S A;  5KRH A;  3ET0 A;  4QK4 A;  2QGT A;  4MGC A;  3D5F A;  4QE8 A;  5KCT A;  4DM8 A;  1Z5X E;  1FBY A;  1R20 D;  3AFR A;  3U9Q A;  1QKM A;  1T7M A;  2YJA B;  4ZNS A;  1RK3 A;  1X7J A;  3QT0 A;  1OSH A;  3KDU A;  1ERR A;  3WT7 A;  2YLO A;  2ZL9 A;  1Z5X U;  2GL8 A;  1PQ6 A;  2JFA A;  3PLZ A;  2AWH A;  3B1M A;  1YP0 A;  5DI7 A;  1VJB A;  5AYG A;  2G0G A;  3NOA A;  3OMM A;  3Q95 B;  5C4U A;  3VSO A;  2YLY A;  5GT4 A;  2ABI A;  3L0J A;  4NY9 A;  5DUE A;  3GBK A;  4J5W A;  4KZJ A;  2P7Z A;  5B5B A;  1YYE A;  1T73 A;  1U9E A;  5DV6 A;  3ADT A;  2ZK6 A;  3OMQ A;  4YPQ A;  4REE A;  1ILG A;  3ADS A;  1YIN A;  4IV4 A;  2GWX A;  1XP6 A;  5E15 A;  3OZJ A;  2HFP A;  4MGA B;  1YOK A;  3K22 A;  3VT5 A;  5DID A;  4MDD A;  3A40 X;  2QNV A;  4IU7 A;  2VV0 A;  4JYI A;  2HWQ A;  5DX3 A;  3CWD A;  4OFR A;  5G43 A;  5L7H A;  1Q4X A;  3X31 A;  1A52 A;  1NQ7 A;  5G3J A;  3RVF A;  2ZAS A;  3IA6 A;  4L98 A;  5LGA A;  5KRC A;  3B68 A;  4OLM A;  5DUH A;  2P4Y A;  4S0T A;  1XOW A;  3W0I A;  5KRJ A;  1XDK A;  2ZK0 A;  4DK7 A;  1RDT D;  4OIL A;  4IA7 A;  4LBD A;  1FD0 A;  3RLJ A;  3P8X A;  4RUO X;  3ERD A;  3B66 A;  2VV2 A;  1PRG A; 
#chains in the Genus database with same CATH topology
 1R1K A;  3AZ2 A;  4EM9 A;  4OJB A;  4WHF A;  1PZL A;  2Q8S A;  3LMP A;  1RDT A;  2QZO A;  3HLV A;  3UUA B;  2Q61 A;  4XLD A;  4JAZ A;  3X1I A;  3VTD A;  4NQA B;  3F7D A;  1PQ9 A;  1GS4 A;  4IWF A;  4E2J A;  1S9P A;  4OZR E;  1PDU A;  1PCG A;  1NQ0 A;  1T5Z A;  1XP9 A;  3TKC A;  3R8D A;  4PP6 A;  1M13 A;  4MG8 B;  3W0C A;  3KMG A;  1T74 A;  2Z4B A;  2A3I A;  4OK1 A;  2AA5 A;  4OZR U;  4PWL A;  2YFE A;  4TUZ B;  1Y0S A;  1I38 A;  2B23 A;  1OSV A;  2OVM A;  3UP3 A;  4R2U A;  4DM6 A;  4DOS A;  2VV1 A;  1R6G A;  3K6P A;  4OEY A;  3FLI A;  1XVP A;  3AZ3 A;  4ZJW A;  4Y29 A;  3OSW A;  3VRW A;  3FC6 B;  4ITF A;  3VTB A;  3FEI A;  2OUZ A;  3MNP A;  3CDP A;  5DK9 A;  4MGB B;  2AA7 A;  2AYR A;  2GPP A;  5HJP B;  5DKG A;  5DXB A;  1RKH A;  4PLD A;  2PIT A;  4OKT A;  5DVC A;  5AZT A;  1A28 A;  1XPC A;  3VTC A;  5KR9 A;  4UDD A;  2I4J A;  2G0H A;  2Q6J A;  4OGH A;  4XUM A;  1XQC A;  5AVL A;  3UVV B;  3A78 A;  4G1Y A;  2Q5P A;  3IPQ A;  5KCW A;  2Q70 A;  3OMP A;  3W0J A;  1ZDT A;  1FCX A;  5KCF A;  2H79 A;  5DRM A;  5AVI A;  4J24 A;  1H9U A;  1DKF A;  2PIR A;  2XKW A;  1EXA A;  3L0L A;  5DXQ A;  3R8I A;  4MGD A;  1YMT A;  4HEE X;  5IZ0 A;  1TFC A;  4ZOM A;  5CJ6 A;  3AZ1 A;  3IPS A;  4XT9 A;  3TX7 B;  4B7W A;  3O1D A;  4IVW A;  2Q5G A;  1HJ1 A;  5JI0 D;  5APK A;  2ZFX A;  3PCU A;  4FN9 A;  2IOK A;  1ZKY A;  4OH5 A;  4IS8 A;  3WWR A;  3FUG A;  3S9S A;  1S0Z A;  3B0W A;  3OSA A;  4M8E A;  2PRG A;  4JGV A;  3VJT A;  3VRU A;  1ZUC A;  4IW6 A;  3K8S A;  2HWR A;  3FEJ A;  5G42 A;  2Q6S A;  3R5M A;  3B67 A;  3HVL A;  5DIG A;  1NQ2 A;  3CQV A;  2V0V A;  2QR9 A;  2ZK1 A;  3V49 A;  4OC7 A;  4RZG A;  5AAV B;  3RUT A;  2H77 A;  2Z4J A;  1RKG A;  4P6X A;  2Q59 B;  4IWC A;  4LNX A;  4PP5 A;  3OZ0 A;  3AN3 A;  3HO0 A;  5A86 A;  5H1E A;  5FQP A;  4R6S A;  2ACL B;  5K13 A;  5DL4 A;  3BC5 A;  2HCD A;  5DYD A;  1G50 A;  3PO9 A;  3VJH A;  5KRK A;  3D57 A;  2O4J A;  3SZ1 A;  5HCV A;  1EXX A;  2BJ4 A;  2ZLC A;  4MG7 A;  4N1Y A;  3FAL A;  3KDT A;  1M2Z A;  5DKB A;  5DXM A;  3RLL A;  2ZNN A;  4N5G A;  3N00 A;  2Q7K A;  2HB7 A;  2ZKC A;  3L1B A;  1ZDU A;  2QH6 A;  4APU A;  1L2I A;  1K74 D;  1MZN A;  4MG9 B;  1R20 A;  5FQS A;  2AA2 A;  5EJV A;  2OAX A;  4CSJ A;  1ZGY A;  4RAK A;  4UDC A;  2NV7 A;  3V4A A;  2ZMH A;  1U3R A;  2XYJ A;  3GD2 A;  1ZEO A;  3GYT A;  4NIE A;  4ZNW A;  5DZI A;  3RY9 A;  3TY0 A;  3E00 D;  1K74 A;  1NHZ A;  4WPF A;  4A2J A;  3OSI A;  3VHU A;  3WGP A;  2FSZ A;  5DXK A;  2NPA A;  1N4H A;  2Q7I A;  3AN4 A;  1T7T A;  3M7R A;  1PK5 A;  3ZRB A;  2YJD A;  4TV1 B;  3GZ9 A;  5DZH A;  3D24 A;  4RE8 A;  3E00 A;  1YA3 A;  1NRL A;  4OKB A;  1TXI A;  5DUG A;  3W0G A;  4DQM A;  1OT7 A;  3HOD A;  1KNU A;  5GIC A;  2J14 A;  2ZXZ A;  2PIV A;  1UPV A;  5DVS A;  3B5R A;  5HYK A;  2LBD A;  5L7E A;  3UP0 A;  3AX8 A;  3HC6 A;  5DXE A;  5JJM A;  3UU7 A;  3ADU A;  3AUR A;  1S0X A;  3RUU A;  2AXA A;  1L2J A;  2VV4 B;  4PXM A;  4ZI1 A;  3A9E A;  1XV9 B;  5E1C A;  2OVH A;  4Q13 A;  2OZ7 A;  1MV9 A;  5APJ A;  3OKI A;  3F5C B;  4OKW A;  5DY8 A;  1XZX X;  4IA2 A;  1UHL A;  4IV2 A;  2QGW A;  2QA8 A;  2QXM A;  3CS4 A;  2QE4 A;  4KZM A;  4M8H A;  4YT1 A;  1LBD A;  5KD9 A;  4POH A;  4PLE A;  2Q6R A;  1T79 A;  5FQR A;  4S15 A;  4ZN7 A;  3WTQ A;  5ACC A;  4OED A;  2Q5S A;  2QPY A;  3OAP A;  2GPU A;  2QXS A;  4IVY A;  2XYW A;  5KRL A;  2PJL A;  2W8Y A;  3KMR A;  4OAR A;  5G46 A;  2ZNO A;  4NUF A;  3DCU A;  5DV8 A;  5DXP A;  3ZRA A;  5B41 A;  1YOW A;  2QW4 A;  4ZNU A;  2J7X A;  4O8F A;  4IA3 A;  2JF9 A;  3Q95 A;  4LNW A;  1XP1 A;  1NUO A;  3JZC A;  5G5W A;  2HVC A;  4N8R A;  5EHJ A;  1Y9R A;  3ET1 A;  3FUR A;  1E3G A;  2AX9 A;  4G1D A;  4XTA A;  5IAW A;  3CS8 A;  5KYA A;  2OCF A;  2P1U A;  3OLS A;  3DZY D;  5EI1 A;  1S9Q A;  5E19 A;  5G45 A;  3K23 A;  2AM9 A;  3ADV A;  2QMV A;  3AUN A;  3R2A A;  4MGA A;  3W5T A;  1K4W A;  1N46 A;  1ILH A;  5DMF A;  4QL8 A;  1P8D A;  1SQN A;  2HBH A;  3DZY A;  5KRI A;  4IQR A;  5DRJ A;  3ILZ A;  5DTV A;  3KYT A;  4IA1 A;  1OVL B;  1IE8 A;  2YAT A;  2ZY0 A;  5HJS A;  1T63 A;  4J5X C;  3GN8 A;  4PVU A;  2Q7J A;  3G0W A;  3OLF A;  4OJ9 A;  4XUH A;  4EMA A;  5KRO A;  5E0X A;  5HZC A;  3VRT A;  4FGY A;  2FAI A;  1FM9 D;  3A2H A;  1XNN A;  4G20 A;  3KBA A;  5AAU A;  2HB8 A;  2XYX A;  4R06 A;  3AUQ A;  3UUD B;  2HC4 A;  3ZR7 A;  5DU5 A;  5DYB A;  1XLS E;  3IMY A;  1ERE A;  2Q60 A;  4ONI A;  3W5R A;  1U3S A;  1X78 A;  3B0Q A;  4RMC A;  3VN2 A;  3G8I A;  3WJ4 A;  3UUA A;  4OJ4 A;  1GWQ A;  2QAB A;  2GP7 A;  3OOK A;  4ZN9 A;  2PIP L;  4OEZ A;  4WVD A;  5DXG A;  5KRM A;  5I4V A;  1G2N A;  2YLQ A;  4G1Z A;  3V3E A;  5L7G A;  1WM0 X;  3P0U A;  4OIV A;  3V9Y A;  4PPS A;  4A4W A;  4MG8 A;  5KRF A;  5DIE A;  4BCR A;  4K7A A;  3ET3 A;  4UDB A;  2QTU A;  1XAP A;  4TUZ A;  4MG6 A;  3SP6 A;  2JFA B;  4RZF A;  3VT8 A;  3KFC A;  3A3Z X;  1K7L A;  3G9E A;  3GYU A;  4OFU A;  2XHS A;  4ZJR A;  2PIW A;  3BQD A;  3FXV A;  4CI5 A;  1RJK A;  4OZT U;  3ZQT A;  5E7V A;  1NAX A;  3H0A D;  1X7R A;  2R6Y A;  4DMA A;  1XJ7 A;  1Y0X X;  3OOF A;  4RZE A;  3WMH A;  2I4Z A;  3FC6 A;  5L11 A;  2FVJ A;  3HZF A;  2G44 A;  2AO6 A;  1FCY A;  3H0A A;  3CTB A;  4MGB A;  4S0S A;  5HJP A;  1T7F A;  1XLS A;  3OGT A;  3V3Q A;  5KCD A;  5KYJ A;  2I4P A;  4N73 A;  5LWP A;  4OH6 A;  1FM6 D;  4F9M A;  3DCT A;  3A2I A;  3EYB A;  2R40 D;  3NSP A;  4PRG A;  5F9B A;  4QJR A;  5AZV A;  1FCZ A;  2QSE A;  3DZU D;  3UVV A;  2ZK3 A;  2V7C A;  2YHD A;  5DZ0 A;  1SKX A;  5DX3 B;  1NDE A;  3T03 A;  4ZO1 B;  1FM6 A;  4MG5 A;  5DKS A;  4Q50 A;  2Q3Y A;  3FS1 A;  3SP9 A;  3L03 A;  2R40 A;  5GIE A;  2YLP A;  3ADW A;  3B3K A;  4RFW A;  3JZB A;  3WJ5 A;  1XDK B;  3UUC A;  1Z95 A;  2ATH A;  3ERT A;  1QKT A;  2O9I A;  2PNU A;  3L3X A;  2PIQ A;  2VSR A;  4KZI A;  2ZXN A;  3W5Q A;  2PIX A;  1NAV A;  2ZMI A;  2I0G A;  3P89 A;  3B0R A;  2HAR A;  4PPP A;  5E14 A;  1T76 A;  3ADX A;  3VHW A;  2HAS A;  2QZO B;  1N83 A;  1SJ0 A;  3PEQ A;  5EGV A;  5DV3 A;  5DWI A;  4NB6 A;  5ETH A;  2I0J A;  4RME A;  4WLB A;  2R6W A;  5DP0 A;  4Q0A C;  5M96 A;  3H52 A;  4XAO A;  5HYR A;  2B1Z A;  4G21 A;  2Q1H A;  2AMA A;  2PIO A;  3X1H A;  5AAV A;  3CS6 A;  1MVC A;  5DWJ A;  3VT4 A;  3WFF A;  2ZNQ A;  2Q59 A;  2P54 A;  4RUP A;  5FQV A;  4ZNT A;  3O1E A;  2ACL A;  2P15 A;  5DKE A;  3D90 A;  4G2H A;  5KRA A;  4WHG A;  2NXX E;  2VV1 B;  1XQ3 A;  3DT3 A;  4IW8 A;  1PQC A;  3B0T A;  2ZK4 A;  5DZ3 A;  5DVV A;  5C4T A;  1XVP B;  1YJE A;  4RUJ A;  4JYH A;  2HAM A;  3GWS X;  3W0A A;  4J5W C;  1NYX A;  5DWE A;  5KCC A;  4JYG A;  2GIU A;  2GPO A;  2G5O A;  2Q1V A;  5EIT A;  1T65 A;  1X76 A;  4MG9 A;  5DXB B;  2P1V A;  1ZAF A;  5EC9 A;  1I37 A;  1KV6 A;  5APH A;  2VST A;  4PF3 A;  3OKH A;  4RMD A;  2AAX A;  2JJ3 A;  2GPV A;  1X7B A;  2AMB A;  1E3K A;  4QM0 A;  1I7I A;  5FQT A;  1R1K D;  5DSH A;  5JY3 A;  5AWJ A;  2Q7L A;  3KWY A;  5ICK A;  5DXR A;  4OKX A;  1GWR A;  3OMO A;  1IE9 A;  3PBA A;  3VT7 A;  1YIM A;  1DKF B;  3X36 A;  3DY6 A;  4TV1 A;  1P93 A;  1GWX A;  2OM9 A;  3P88 A;  5DZ1 A;  1XIU A;  1T7R A;  2AX7 A;  4MGD B;  1YY4 A;  2ZK5 A;  3E94 A;  3HC5 A;  4J5X A;  4LSJ A;  3VI8 A;  3OS8 A;  5DWL A;  3CLD A;  5DLR A;  2P7G A;  2REW A;  2ZBS A;  3KMZ A;  4REF A;  2P1T A;  4UDA A;  3G8O A;  3HQ5 A;  4XHD A;  3MNO A;  3GWX A;  3IXP D;  3V9T A;  4E4Q A;  2NXX A;  4X1F A;  2AA6 A;  3CJW A;  4IUI A;  3E7C A;  2ZVT A;  4PP3 A;  2VV4 A;  3BEJ A;  2VV3 A;  3OS8 C;  5DWG A;  2QA6 A;  3W0Y A;  1XV9 A;  4DOR A;  2BAW A;  3IXP A;  4WQP A;  4JL4 A;  3F5C A;  1X7E A;  1SR7 A;  2O4R A;  1HG4 A;  3LBD A;  4K6I A;  3W5P A;  5KCU A;  4OEA A;  4YNK A;  4OIU A;  3D6D A;  3CDS A;  3R8A A;  1FM9 A;  2POB A;  1DB1 A;  4OHA A;  1YUC A;  3B65 A;  3ET2 A;  2GTK A;  3VSP A;  4ZNH A;  1I7G A;  2AX6 A;  1S19 A;  4RWV A;  3VHV A;  2ZK2 A;  2ZNP A;  5DMC A;  4XI3 A;  1LV2 A;  3HM1 A;  4A4V A;  4FHH A;  2BJ4 B;  4MG7 B;  3OS9 A;  3WFG A;  3IPU A;  3MNE A;  2E2R A;  2F4B A;  3FAL B;  4QE6 A;  2EWP A;  5G44 A;  4POJ A;  2J7Y A;  2POG A;  4HLW A;  4J26 A;  4ZO1 X;  1UPW A;  2B50 A;  3VRV A;  3OMK A;  4X1G A;  4OZT E;  4E4K A;  5KCE A;  4LTW A;  5SYZ A;  2IOG A;  5GID A;  4L96 A;  4ITE A;  1G1U A;  4DK8 A;  1XB7 A;  3WT6 A;  2ZMJ A;  4ZNV A;  5E0W A;  3NSQ A;  4P6W A;  1BSX A;  1QKN A;  4FNE A;  1ZH7 A;  1M7W A;  3TKM A;  3VT9 A;  4CI4 A;  5IXK A;  2ZXM A;  3DR1 A;  2IHQ A;  3PRG A;  1OVL A;  1NQ1 A;  1R5K A;  1UOM A;  4S14 A;  2PKL A;  1QKU A;  2P7A A;  3OLL A;  3VT6 A;  1KKQ A;  1U3Q A;  2B1V A;  3V9V A;  3A2J A;  4YMQ A;  5C4O A;  2AX8 A;  4K4J A;  5AK2 A;  2PIN A;  5AWK A;  5JJM B;  3W0H A;  2NW4 A;  3KPZ A;  4FHI A;  2AB2 A;  3UU7 B;  4G2I A;  3L0E A;  3UUD A;  3VT3 A;  1G5Y A;  3DZU A;  3WT5 A;  3A9E B;  3R5N A;  3VJI A;  2J4A A;  1XNX A;  3VJS A;  1UHL B;  3R29 A;  2QA8 B;  2ZLA A;  2PIU A;  3L3Z A;  5C4S A;  5KRH A;  3ET0 A;  4QK4 A;  2QGT A;  4MGC A;  3D5F A;  4QE8 A;  5KCT A;  4DM8 A;  1Z5X E;  1FBY A;  1R20 D;  3AFR A;  3U9Q A;  1QKM A;  1T7M A;  2YJA B;  4ZNS A;  1RK3 A;  1X7J A;  3QT0 A;  1OSH A;  3KDU A;  1ERR A;  3WT7 A;  2YLO A;  2ZL9 A;  1Z5X U;  2GL8 A;  1PQ6 A;  2JFA A;  3PLZ A;  2AWH A;  3B1M A;  1YP0 A;  5DI7 A;  1VJB A;  5AYG A;  2G0G A;  3NOA A;  3OMM A;  3Q95 B;  5C4U A;  3VSO A;  2YLY A;  5GT4 A;  2ABI A;  3L0J A;  4NY9 A;  5DUE A;  3GBK A;  4J5W A;  4KZJ A;  2P7Z A;  5B5B A;  1YYE A;  1T73 A;  1U9E A;  5DV6 A;  3ADT A;  2ZK6 A;  3OMQ A;  4YPQ A;  4REE A;  1ILG A;  3ADS A;  1YIN A;  4IV4 A;  2GWX A;  1XP6 A;  5E15 A;  3OZJ A;  2HFP A;  4MGA B;  1YOK A;  3K22 A;  3VT5 A;  5DID A;  4MDD A;  3A40 X;  2QNV A;  4IU7 A;  2VV0 A;  4JYI A;  2HWQ A;  5DX3 A;  3CWD A;  4OFR A;  5G43 A;  5L7H A;  1Q4X A;  3X31 A;  1A52 A;  1NQ7 A;  5G3J A;  3RVF A;  2ZAS A;  3IA6 A;  4L98 A;  5LGA A;  5KRC A;  3B68 A;  4OLM A;  5DUH A;  2P4Y A;  4S0T A;  1XOW A;  3W0I A;  5KRJ A;  1XDK A;  2ZK0 A;  4DK7 A;  1RDT D;  4OIL A;  4IA7 A;  4LBD A;  1FD0 A;  3RLJ A;  3P8X A;  4RUO X;  3ERD A;  3B66 A;  2VV2 A;  1PRG A; 
#chains in the Genus database with same CATH homology
 1R1K A;  3AZ2 A;  4EM9 A;  4OJB A;  4WHF A;  1PZL A;  2Q8S A;  3LMP A;  1RDT A;  2QZO A;  3HLV A;  3UUA B;  2Q61 A;  4XLD A;  4JAZ A;  3X1I A;  3VTD A;  4NQA B;  3F7D A;  1PQ9 A;  1GS4 A;  4IWF A;  4E2J A;  1S9P A;  4OZR E;  1PDU A;  1PCG A;  1NQ0 A;  1T5Z A;  1XP9 A;  3TKC A;  3R8D A;  4PP6 A;  1M13 A;  4MG8 B;  3W0C A;  3KMG A;  1T74 A;  2Z4B A;  2A3I A;  4OK1 A;  2AA5 A;  4OZR U;  4PWL A;  2YFE A;  4TUZ B;  1Y0S A;  1I38 A;  2B23 A;  1OSV A;  2OVM A;  3UP3 A;  4R2U A;  4DM6 A;  4DOS A;  2VV1 A;  1R6G A;  3K6P A;  4OEY A;  3FLI A;  1XVP A;  3AZ3 A;  4ZJW A;  4Y29 A;  3OSW A;  3VRW A;  3FC6 B;  4ITF A;  3VTB A;  3FEI A;  2OUZ A;  3MNP A;  3CDP A;  5DK9 A;  4MGB B;  2AA7 A;  2AYR A;  2GPP A;  5HJP B;  5DKG A;  5DXB A;  1RKH A;  4PLD A;  2PIT A;  4OKT A;  5DVC A;  5AZT A;  1A28 A;  1XPC A;  3VTC A;  5KR9 A;  4UDD A;  2I4J A;  2G0H A;  2Q6J A;  4OGH A;  4XUM A;  1XQC A;  5AVL A;  3UVV B;  3A78 A;  4G1Y A;  2Q5P A;  3IPQ A;  5KCW A;  2Q70 A;  3OMP A;  3W0J A;  1ZDT A;  1FCX A;  5KCF A;  2H79 A;  5DRM A;  5AVI A;  4J24 A;  1H9U A;  1DKF A;  2PIR A;  2XKW A;  1EXA A;  3L0L A;  5DXQ A;  3R8I A;  4MGD A;  1YMT A;  4HEE X;  5IZ0 A;  1TFC A;  4ZOM A;  5CJ6 A;  3AZ1 A;  3IPS A;  4XT9 A;  3TX7 B;  4B7W A;  3O1D A;  4IVW A;  2Q5G A;  1HJ1 A;  5JI0 D;  5APK A;  2ZFX A;  3PCU A;  4FN9 A;  2IOK A;  1ZKY A;  4OH5 A;  4IS8 A;  3WWR A;  3FUG A;  3S9S A;  1S0Z A;  3B0W A;  3OSA A;  4M8E A;  2PRG A;  4JGV A;  3VJT A;  3VRU A;  1ZUC A;  4IW6 A;  3K8S A;  2HWR A;  3FEJ A;  5G42 A;  2Q6S A;  3R5M A;  3B67 A;  3HVL A;  5DIG A;  1NQ2 A;  3CQV A;  2V0V A;  2QR9 A;  2ZK1 A;  3V49 A;  4OC7 A;  4RZG A;  5AAV B;  3RUT A;  2H77 A;  2Z4J A;  1RKG A;  4P6X A;  2Q59 B;  4IWC A;  4LNX A;  4PP5 A;  3OZ0 A;  3AN3 A;  3HO0 A;  5A86 A;  5H1E A;  5FQP A;  4R6S A;  2ACL B;  5K13 A;  5DL4 A;  3BC5 A;  2HCD A;  5DYD A;  1G50 A;  3PO9 A;  3VJH A;  5KRK A;  3D57 A;  2O4J A;  3SZ1 A;  5HCV A;  1EXX A;  2BJ4 A;  2ZLC A;  4MG7 A;  4N1Y A;  3FAL A;  3KDT A;  1M2Z A;  5DKB A;  5DXM A;  3RLL A;  2ZNN A;  4N5G A;  3N00 A;  2Q7K A;  2HB7 A;  2ZKC A;  3L1B A;  1ZDU A;  2QH6 A;  4APU A;  1L2I A;  1K74 D;  1MZN A;  4MG9 B;  1R20 A;  5FQS A;  2AA2 A;  5EJV A;  2OAX A;  4CSJ A;  1ZGY A;  4RAK A;  4UDC A;  2NV7 A;  3V4A A;  2ZMH A;  1U3R A;  2XYJ A;  3GD2 A;  1ZEO A;  3GYT A;  4NIE A;  4ZNW A;  5DZI A;  3RY9 A;  3TY0 A;  3E00 D;  1K74 A;  1NHZ A;  4WPF A;  4A2J A;  3OSI A;  3VHU A;  3WGP A;  2FSZ A;  5DXK A;  2NPA A;  1N4H A;  2Q7I A;  3AN4 A;  1T7T A;  3M7R A;  1PK5 A;  3ZRB A;  2YJD A;  4TV1 B;  3GZ9 A;  5DZH A;  3D24 A;  4RE8 A;  3E00 A;  1YA3 A;  1NRL A;  4OKB A;  1TXI A;  5DUG A;  3W0G A;  4DQM A;  1OT7 A;  3HOD A;  1KNU A;  5GIC A;  2J14 A;  2ZXZ A;  2PIV A;  1UPV A;  5DVS A;  3B5R A;  5HYK A;  2LBD A;  5L7E A;  3UP0 A;  3AX8 A;  3HC6 A;  5DXE A;  5JJM A;  3UU7 A;  3ADU A;  3AUR A;  1S0X A;  3RUU A;  2AXA A;  1L2J A;  2VV4 B;  4PXM A;  4ZI1 A;  3A9E A;  1XV9 B;  5E1C A;  2OVH A;  4Q13 A;  2OZ7 A;  1MV9 A;  5APJ A;  3OKI A;  3F5C B;  4OKW A;  5DY8 A;  1XZX X;  4IA2 A;  1UHL A;  4IV2 A;  2QGW A;  2QA8 A;  2QXM A;  3CS4 A;  2QE4 A;  4KZM A;  4M8H A;  4YT1 A;  1LBD A;  5KD9 A;  4POH A;  4PLE A;  2Q6R A;  1T79 A;  5FQR A;  4S15 A;  4ZN7 A;  3WTQ A;  5ACC A;  4OED A;  2Q5S A;  2QPY A;  3OAP A;  2GPU A;  2QXS A;  4IVY A;  2XYW A;  5KRL A;  2PJL A;  2W8Y A;  3KMR A;  4OAR A;  5G46 A;  2ZNO A;  4NUF A;  3DCU A;  5DV8 A;  5DXP A;  3ZRA A;  5B41 A;  1YOW A;  2QW4 A;  4ZNU A;  2J7X A;  4O8F A;  4IA3 A;  2JF9 A;  3Q95 A;  4LNW A;  1XP1 A;  1NUO A;  3JZC A;  5G5W A;  2HVC A;  4N8R A;  5EHJ A;  1Y9R A;  3ET1 A;  3FUR A;  1E3G A;  2AX9 A;  4G1D A;  4XTA A;  5IAW A;  3CS8 A;  5KYA A;  2OCF A;  2P1U A;  3OLS A;  3DZY D;  5EI1 A;  1S9Q A;  5E19 A;  5G45 A;  3K23 A;  2AM9 A;  3ADV A;  2QMV A;  3AUN A;  3R2A A;  4MGA A;  3W5T A;  1K4W A;  1N46 A;  1ILH A;  5DMF A;  4QL8 A;  1P8D A;  1SQN A;  2HBH A;  3DZY A;  5KRI A;  4IQR A;  5DRJ A;  3ILZ A;  5DTV A;  3KYT A;  4IA1 A;  1OVL B;  1IE8 A;  2YAT A;  2ZY0 A;  5HJS A;  1T63 A;  4J5X C;  3GN8 A;  4PVU A;  2Q7J A;  3G0W A;  3OLF A;  4OJ9 A;  4XUH A;  4EMA A;  5KRO A;  5E0X A;  5HZC A;  3VRT A;  4FGY A;  2FAI A;  1FM9 D;  3A2H A;  1XNN A;  4G20 A;  3KBA A;  5AAU A;  2HB8 A;  2XYX A;  4R06 A;  3AUQ A;  3UUD B;  2HC4 A;  3ZR7 A;  5DU5 A;  5DYB A;  1XLS E;  3IMY A;  1ERE A;  2Q60 A;  4ONI A;  3W5R A;  1U3S A;  1X78 A;  3B0Q A;  4RMC A;  3VN2 A;  3G8I A;  3WJ4 A;  3UUA A;  4OJ4 A;  1GWQ A;  2QAB A;  2GP7 A;  3OOK A;  4ZN9 A;  2PIP L;  4OEZ A;  4WVD A;  5DXG A;  5KRM A;  5I4V A;  1G2N A;  2YLQ A;  4G1Z A;  3V3E A;  5L7G A;  1WM0 X;  3P0U A;  4OIV A;  3V9Y A;  4PPS A;  4A4W A;  4MG8 A;  5KRF A;  5DIE A;  4BCR A;  4K7A A;  3ET3 A;  4UDB A;  2QTU A;  1XAP A;  4TUZ A;  4MG6 A;  3SP6 A;  2JFA B;  4RZF A;  3VT8 A;  3KFC A;  3A3Z X;  1K7L A;  3G9E A;  3GYU A;  4OFU A;  2XHS A;  4ZJR A;  2PIW A;  3BQD A;  3FXV A;  4CI5 A;  1RJK A;  4OZT U;  3ZQT A;  5E7V A;  1NAX A;  3H0A D;  1X7R A;  2R6Y A;  4DMA A;  1XJ7 A;  1Y0X X;  3OOF A;  4RZE A;  3WMH A;  2I4Z A;  3FC6 A;  5L11 A;  2FVJ A;  3HZF A;  2G44 A;  2AO6 A;  1FCY A;  3H0A A;  3CTB A;  4MGB A;  4S0S A;  5HJP A;  1T7F A;  1XLS A;  3OGT A;  3V3Q A;  5KCD A;  5KYJ A;  2I4P A;  4N73 A;  5LWP A;  4OH6 A;  1FM6 D;  4F9M A;  3DCT A;  3A2I A;  3EYB A;  2R40 D;  3NSP A;  4PRG A;  5F9B A;  4QJR A;  5AZV A;  1FCZ A;  2QSE A;  3DZU D;  3UVV A;  2ZK3 A;  2V7C A;  2YHD A;  5DZ0 A;  1SKX A;  5DX3 B;  1NDE A;  3T03 A;  4ZO1 B;  1FM6 A;  4MG5 A;  5DKS A;  4Q50 A;  2Q3Y A;  3FS1 A;  3SP9 A;  3L03 A;  2R40 A;  5GIE A;  2YLP A;  3ADW A;  3B3K A;  4RFW A;  3JZB A;  3WJ5 A;  1XDK B;  3UUC A;  1Z95 A;  2ATH A;  3ERT A;  1QKT A;  2O9I A;  2PNU A;  3L3X A;  2PIQ A;  2VSR A;  4KZI A;  2ZXN A;  3W5Q A;  2PIX A;  1NAV A;  2ZMI A;  2I0G A;  3P89 A;  3B0R A;  2HAR A;  4PPP A;  5E14 A;  1T76 A;  3ADX A;  3VHW A;  2HAS A;  2QZO B;  1N83 A;  1SJ0 A;  3PEQ A;  5EGV A;  5DV3 A;  5DWI A;  4NB6 A;  5ETH A;  2I0J A;  4RME A;  4WLB A;  2R6W A;  5DP0 A;  4Q0A C;  5M96 A;  3H52 A;  4XAO A;  5HYR A;  2B1Z A;  4G21 A;  2Q1H A;  2AMA A;  2PIO A;  3X1H A;  5AAV A;  3CS6 A;  1MVC A;  5DWJ A;  3VT4 A;  3WFF A;  2ZNQ A;  2Q59 A;  2P54 A;  4RUP A;  5FQV A;  4ZNT A;  3O1E A;  2ACL A;  2P15 A;  5DKE A;  3D90 A;  4G2H A;  5KRA A;  4WHG A;  2NXX E;  2VV1 B;  1XQ3 A;  3DT3 A;  4IW8 A;  1PQC A;  3B0T A;  2ZK4 A;  5DZ3 A;  5DVV A;  5C4T A;  1XVP B;  1YJE A;  4RUJ A;  4JYH A;  2HAM A;  3GWS X;  3W0A A;  4J5W C;  1NYX A;  5DWE A;  5KCC A;  4JYG A;  2GIU A;  2GPO A;  2G5O A;  2Q1V A;  5EIT A;  1T65 A;  1X76 A;  4MG9 A;  5DXB B;  2P1V A;  1ZAF A;  5EC9 A;  1I37 A;  1KV6 A;  5APH A;  2VST A;  4PF3 A;  3OKH A;  4RMD A;  2AAX A;  2JJ3 A;  2GPV A;  1X7B A;  2AMB A;  1E3K A;  4QM0 A;  1I7I A;  5FQT A;  1R1K D;  5DSH A;  5JY3 A;  5AWJ A;  2Q7L A;  3KWY A;  5ICK A;  5DXR A;  4OKX A;  1GWR A;  3OMO A;  1IE9 A;  3PBA A;  3VT7 A;  1YIM A;  1DKF B;  3X36 A;  3DY6 A;  4TV1 A;  1P93 A;  1GWX A;  2OM9 A;  3P88 A;  5DZ1 A;  1XIU A;  1T7R A;  2AX7 A;  4MGD B;  1YY4 A;  2ZK5 A;  3E94 A;  3HC5 A;  4J5X A;  4LSJ A;  3VI8 A;  3OS8 A;  5DWL A;  3CLD A;  5DLR A;  2P7G A;  2REW A;  2ZBS A;  3KMZ A;  4REF A;  2P1T A;  4UDA A;  3G8O A;  3HQ5 A;  4XHD A;  3MNO A;  3GWX A;  3IXP D;  3V9T A;  4E4Q A;  2NXX A;  4X1F A;  2AA6 A;  3CJW A;  4IUI A;  3E7C A;  2ZVT A;  4PP3 A;  2VV4 A;  3BEJ A;  2VV3 A;  3OS8 C;  5DWG A;  2QA6 A;  3W0Y A;  1XV9 A;  4DOR A;  2BAW A;  3IXP A;  4WQP A;  4JL4 A;  3F5C A;  1X7E A;  1SR7 A;  2O4R A;  1HG4 A;  3LBD A;  4K6I A;  3W5P A;  5KCU A;  4OEA A;  4YNK A;  4OIU A;  3D6D A;  3CDS A;  3R8A A;  1FM9 A;  2POB A;  1DB1 A;  4OHA A;  1YUC A;  3B65 A;  3ET2 A;  2GTK A;  3VSP A;  4ZNH A;  1I7G A;  2AX6 A;  1S19 A;  4RWV A;  3VHV A;  2ZK2 A;  2ZNP A;  5DMC A;  4XI3 A;  1LV2 A;  3HM1 A;  4A4V A;  4FHH A;  2BJ4 B;  4MG7 B;  3OS9 A;  3WFG A;  3IPU A;  3MNE A;  2E2R A;  2F4B A;  3FAL B;  4QE6 A;  2EWP A;  5G44 A;  4POJ A;  2J7Y A;  2POG A;  4HLW A;  4J26 A;  4ZO1 X;  1UPW A;  2B50 A;  3VRV A;  3OMK A;  4X1G A;  4OZT E;  4E4K A;  5KCE A;  4LTW A;  5SYZ A;  2IOG A;  5GID A;  4L96 A;  4ITE A;  1G1U A;  4DK8 A;  1XB7 A;  3WT6 A;  2ZMJ A;  4ZNV A;  5E0W A;  3NSQ A;  4P6W A;  1BSX A;  1QKN A;  4FNE A;  1ZH7 A;  1M7W A;  3TKM A;  3VT9 A;  4CI4 A;  5IXK A;  2ZXM A;  3DR1 A;  2IHQ A;  3PRG A;  1OVL A;  1NQ1 A;  1R5K A;  1UOM A;  4S14 A;  2PKL A;  1QKU A;  2P7A A;  3OLL A;  3VT6 A;  1KKQ A;  1U3Q A;  2B1V A;  3V9V A;  3A2J A;  4YMQ A;  5C4O A;  2AX8 A;  4K4J A;  5AK2 A;  2PIN A;  5AWK A;  5JJM B;  3W0H A;  2NW4 A;  3KPZ A;  4FHI A;  2AB2 A;  3UU7 B;  4G2I A;  3L0E A;  3UUD A;  3VT3 A;  1G5Y A;  3DZU A;  3WT5 A;  3A9E B;  3R5N A;  3VJI A;  2J4A A;  1XNX A;  3VJS A;  1UHL B;  3R29 A;  2QA8 B;  2ZLA A;  2PIU A;  3L3Z A;  5C4S A;  5KRH A;  3ET0 A;  4QK4 A;  2QGT A;  4MGC A;  3D5F A;  4QE8 A;  5KCT A;  4DM8 A;  1Z5X E;  1FBY A;  1R20 D;  3AFR A;  3U9Q A;  1QKM A;  1T7M A;  2YJA B;  4ZNS A;  1RK3 A;  1X7J A;  3QT0 A;  1OSH A;  3KDU A;  1ERR A;  3WT7 A;  2YLO A;  2ZL9 A;  1Z5X U;  2GL8 A;  1PQ6 A;  2JFA A;  3PLZ A;  2AWH A;  3B1M A;  1YP0 A;  5DI7 A;  1VJB A;  5AYG A;  2G0G A;  3NOA A;  3OMM A;  3Q95 B;  5C4U A;  3VSO A;  2YLY A;  5GT4 A;  2ABI A;  3L0J A;  4NY9 A;  5DUE A;  3GBK A;  4J5W A;  4KZJ A;  2P7Z A;  5B5B A;  1YYE A;  1T73 A;  1U9E A;  5DV6 A;  3ADT A;  2ZK6 A;  3OMQ A;  4YPQ A;  4REE A;  1ILG A;  3ADS A;  1YIN A;  4IV4 A;  2GWX A;  1XP6 A;  5E15 A;  3OZJ A;  2HFP A;  4MGA B;  1YOK A;  3K22 A;  3VT5 A;  5DID A;  4MDD A;  3A40 X;  2QNV A;  4IU7 A;  2VV0 A;  4JYI A;  2HWQ A;  5DX3 A;  3CWD A;  4OFR A;  5G43 A;  5L7H A;  1Q4X A;  3X31 A;  1A52 A;  1NQ7 A;  5G3J A;  3RVF A;  2ZAS A;  3IA6 A;  4L98 A;  5LGA A;  5KRC A;  3B68 A;  4OLM A;  5DUH A;  2P4Y A;  4S0T A;  1XOW A;  3W0I A;  5KRJ A;  1XDK A;  2ZK0 A;  4DK7 A;  1RDT D;  4OIL A;  4IA7 A;  4LBD A;  1FD0 A;  3RLJ A;  3P8X A;  4RUO X;  3ERD A;  3B66 A;  2VV2 A;  1PRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...