5KRHA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with 16-benzylidene estrone
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
231
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 231
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krhA00
1R1KA 1A52A 2HB8A 2GIUA 2AX8A 5HCVA 3W5PA 3KFCA 5DZ3A 1XQ3A 5JJMB 2BJ4B 1NAXA 1R20D 1XPCA 4DMAA 2P1UA 3WT6A 1Y9RA 1PQCA 3GYTA 2AXAA 3DZUD 1EXXA 1ZAFA 3GZ9A 4M8EA 1FCYA 4CI4A 1NQ2A 5HJPA 5M96A 2ABIA 2PIWA 1GWQA 3UUAA 2I0GA 5DKBA 3VT9A 4PRGA 2Q7LA 3OS8A 4G1YA 4JYGA 3GD2A 2QGTA 1IE9A 1G2NA 2NXXA 4EM9A 2Q5GA 4X1FA 3G9EA 4MG9A 1UPVA 2ZFXA 1X7RA 3L3XA 4MGAA 3KDUA 5AVLA 5GIEA 3SP6A 2YJAB 4S15A 3VJTA 4PP5A 2Q5SA 5KRAA 3MNPA 4LBDA 1YJEA 2OM9A 3HODA 1ZGYA 2Q70A 3ADUA 4Q0AC 5AWJA 3VJHA 2PIUA 3HC5A 3OOKA 4MGCA 4PLDA 3E00D 1S19A 2VSRA 5DWEA 5IAWA 5JY3A 1X7EA 4RE8A 4JL4A 3ZR7A 2QW4A 5L11A 5DV8A 3VHUA 1IE8A 3A40X 4NIEA 3RLLA 1TFCA 3R2AA 3VSOA 1Q4XA 4OH6A 3VSPA 3PBAA 4R6SA 3CWDA 2JFAA 2H77A 3F5CA 3VRVA 3VT6A 3CLDA 4OKBA 1XP1A 2AA2A 4ZNVA 4X1GA 3X36A 2ZK1A 5DZ1A 4Q13A 1T7RA 5DLRA 3FALA 2PJLA 1MZNA 4J5XA 3FC6A 2QH6A 2HARA 4REFA 1HG4A 3V3EA 2Q6JA 3P89A 2R40D 3N00A 2AO6A 3OSIA 3RVFA 2G0HA 2PITA 5KRJA 5DTVA 2PIRA 3VRUA 1YIMA 1EREA 3D57A 3NSQA 3ADWA 1NDEA 4RZEA 5LGAA 1T65A 1YOKA 2ZXZA 5E0WA 5B5BA 1P93A 4POHA 5FQPA 1DKFA 3U9QA 1FD0A 2YJDA 1PCGA 4PLEA 3P0UA 3ADSA 2FSZA 2JJ3A 3OZ0A 5G43A 2Q1HA 2Q59B 2REWA 2GPVA 3PLZA 2P1VA 2ZL9A 3AN4A 3DR1A 1NUOA 2Q6SA 4TV1A 2AB2A 3KYTA 4OARA 1NQ1A 5KCFA 3OOFA 5AWKA 3X1HA 4MGDA 1K4WA 4OJ4A 1XOWA 1YUCA 3KBAA 4S0TA 3FUGA 5GT4A 5KCUA 4OKWA 4N8RA 3A9EB 3OKHA 4PWLA 3V9YA 4RZFA 2EWPA 5K13A 5C4OA 1ZH7A 3UU7B 1XP9A 4NQAB 4MG7A 5KRHA 5E14A 4YT1A 2AWHA 3FURA 5HYRA 4FHIA 1XP6A 2QA8B 1OVLB 5KYAA 4ZNUA 1ZDTA 3WJ5A 4K6IA 3WTQA 2J4AA 2XYXA 1T73A 2Q5PA 2QMVA 1MVCA 4G1ZA 4RZGA 4P6WA 3K6PA 3HO0A 3MNOA 4OHAA 3OS9A 5DWGA 1SR7A 1K7LA 1ZUCA 2PIOA 2A3IA 2Q3YA 2ZBSA 2XYWA 3NOAA 4PP6A 1XQCA 5KRLA 1M7WA 4OH5A 1ILGA 1H9UA 2ACLB 3K23A 4E4QA 1NQ0A 1PZLA 3A2JA 4DK8A 1QKUA 4P6XA 3W0CA 3S9SA 3OLSA 4OJBA 3UVVA 1HJ1A 5DRMA 1PK5A 1RJKA 3O1DA 2YATA 3L3ZA 4RWVA 4WHFA 4PVUA 1ERRA 2QE4A 1T63A 3OSWA 4J26A 2PKLA 1FCXA 5G44A 2I4ZA 2ZMJA 2PIXA 5DU5A 1GS4A 3HLVA 5L7GA 1M2ZA 5DK9A 3ADVA 5G5WA 5ICKA 3VT4A 5KD9A 2OUZA 4XLDA 3G8IA 1XVPB 5F9BA 3D24A 4IQRA 4IA3A 2GTKA 3AN3A 3CJWA 1ZDUA 2ZY0A 3DCTA 5DUHA 3B0QA 1S9PA 3ERDA 3VHVA 2G44A 3UUDA 2ZK3A 3R29A 1OSVA 3KMZA 1T7TA 2HWQA 2OZ7A 3VT7A 5AAVA 4PPSA 5DX3A 2VV4B 1ZEOA 5DIDA 1NYXA 5KRCA 5HJPB 4ZN7A 2AA5A 2ATHA 5KROA 3RY9A 3VJIA 1MV9A 1RKGA 1ZKYA 2JF9A 2O4RA 3K22A 1XJ7A 3JZCA 4J5WA 2VV1A 4WHGA 5EHJA 5DL4A 5AVIA 2LBDA 1KV6A 4NY9A 5KCWA 2AX6A 3ZRBA 3IXPA 2VV0A 4OEYA 4A4WA 1S9QA 4MG9B 4MGAB 5DI7A 2GWXA 2W8YA 2ZK0A 3ADTA 4IUIA 2QSEA 2ZK4A 3ZRAA 4RMEA 1R5KA 5JI0D 2ZK6A 1QKMA 3GWSX 3AUQA 3DZYD 4XUMA 3OKIA 3DCUA 3PO9A 4FHHA 2E2RA 3FEJA 5FQTA 4PP3A 4NB6A 3CTBA 1Z95A 3LBDA 2NV7A 3E7CA 3ET2A 2AM9A 3KMRA 2AA7A 3GWXA 5DXKA 5DVVA 1T7MA 1X78A 2B1ZA 2JFAB 1S0ZA 4OIVA 1K74D 3F5CB 5C4UA 2NPAA 3MNEA 5JJMA 2BJ4A 1FCZA 2HWRA 5G3JA 2P7GA 4OZTE 3R5MA 1T7FA 3ET0A 4HLWA 3VT5A 5DVCA 1N83A 3ZQTA 5ACCA 1YY4A 4OEDA 4UDAA 4IWFA 4B7WA 3AFRA 3VN2A 2FVJA 3OAPA 2I4PA 1M13A 1XIUA 5APJA 2GPPA 1E3GA 2OCFA 4K7AA 3D90A 3RLJA 1FM6A 2ZKCA 3CS4A 3NSPA 4JYHA 3ADXA 4PF3A 1G5YA 3HM1A 4IWCA 2ZASA 3OMQA 3PEQA 2QNVA 1PQ9A 1YP0A 2QZOB 4LTWA 1G1UA 4MGBB 2P4YA 5DKSA 1P8DA 5E15A 4ITEA 3UUCA 2AMAA 2XHSA 2YLYA 3VRWA 1A28A 4FGYA 1U9EA 2GP7A 4HEEX 1R1KD 5FQRA 4EMAA 5HYKA 3BC5A 5KCTA 2O4JA 3WFFA 5G46A 2YLOA 4K4JA 1L2IA 2IOGA 3OSAA 5HZCA 1SQNA 1TXIA 1GWRA 4OKXA 5AYGA 4OILA 1XNNA 1NAVA 3VTDA 1N46A 4A4VA 4FNEA 1VJBA 1ILHA 4TV1B 4FN9A 3VT3A 2AMBA 3OS8C 3TKCA 1YOWA 4MG5A 2HASA 4UDDA 3JZBA 3TY0A 4ZJWA 1XV9A 2G0GA 4OGHA 5E1CA 5B41A 1N4HA 3P8XA 2I4JA 4RUOX 2PIQA 3PCUA 4PPPA 5SYZA 3GBKA 3CS8A 5CJ6A 4OIUA 2PNUA 4OZRE 4REEA 5I4VA 3L03A 1FM9A 4ZNSA 4OC7A 3DT3A 3EYBA 4MG7B 2YLQA 4IU7A 3B1MA 1UHLB 3B0RA 4Q50A 1T5ZA 2PINA 2V0VA 3B0WA 4G1DA 4MDDA 1XDKA 2HVCA 4G2HA 3W0HA 3KWYA 3B5RA 5G42A 4E4KA 2VSTA 4PXMA 2Q6RA 2XYJA 4MG8B 1E3KA 4XUHA 4YNKA 3W0JA 3OMMA 3H52A 2H79A 3VTCA 2P54A 2Q8SA 4IA2A 5KCEA 4RUJA 1YYEA 3A78A 4LNWA 4J5XC 5IXKA 2NW4A 4IV4A 4N1YA 5H1EA 1U3SA 3B66A 2ZNOA 5DXQA 4IVYA 4OK1A 5C4SA 2HC4A 5DUEA 4M8HA 3HC6A 3R8IA 4F9MA 3RUTA 2P7ZA 4OEZA 5DIGA 1FM6D 1UOMA 2AX7A 3FLIA 4QJRA 2Q7JA 3CDSA 4O8FA 2I0JA 3A3ZX 3D6DA 3AZ3A 3FEIA 3F7DA 3UUDB 2Q61A 3WGPA 4R06A 5DZ0A 3G0WA 3L1BA 2R6YA 2ZVTA 3Q95B 3KMGA 4JAZA 4JYIA 1QKNA 4N5GA 1Y0XX 2AAXA 4G21A 5AAVB 4L96A 5DX3B 3A2HA 4DM6A 3AZ1A 4XT9A 3OMPA 4QK4A 3R8DA 3E00A 2HCDA 2GPOA 3HQ5A 2QA8A 2QPYA 5DXBA 1I7IA 2QXMA 2VV1B 3TKMA 3W5QA 4CI5A 2ZK2A 5EC9A 2ZNPA 3G8OA 5KRKA 3W0AA 2YHDA 5DVSA 4KZJA 5DRJA 4QE8A 5DXPA 2QA6A 3E94A 3UUAB 4DQMA 5DXEA 2ACLA 1FM9D 2Q1VA 3ET3A 3PRGA 3P88A 5APKA 1T74A 4S14A 5DYDA 5AZTA 2B23A 3OLFA 4Y29A 5FQSA 4DM8A 4ZN9A 3OMKA 1YA3A 3B3KA 4QM0A 4TUZA 3K8SA 4WLBA 5DXMA 3GN8A 3T03A 4DORA 4ZO1B 1RDTA 3D5FA 3W0YA 2V7CA 4OZTU 1T79A 4N73A 4QE6A 4IA7A 2BAWA 2R40A 3AURA 2VV2A 2P7AA 1I7GA 1XVPA 1LBDA 2Q7IA 5HJSA 5DY8A 2GL8A 3GYUA 3BQDA 5AK2A 2AX9A 3WFGA 2QABA 1U3QA 4QL8A 4RAKA 4G20A 2OVMA 1XLSE 3IA6A 3B68A 4WVDA 3ET1A 2Q7KA 1BSXA 2AA6A 2VV4A 5G45A 3V9VA 2OVHA 5EGVA 1Z5XE 2HBHA 5DWJA 5C4TA 5DSHA 3WWRA 1XAPA 5GIDA 4CSJA 2ZXNA 3KPZA 5DXRA 4OLMA 5L7HA 3FALB 2HAMA 5FQVA 1X7BA 3UP3A 3FC6B 5A86A 2B50A 4POJA 3L0EA 1X7JA 3OZJA 4MG6A 4OKTA 3W5RA 1T76A 2IHQA 5DUGA 4OFRA 5DXGA 2J7YA 2G5OA 4IVWA 2J14A 2IOKA 2ZLCA 3AUNA 2F4BA 4BCRA 4XHDA 3ERTA 2PIVA 4J5WC 3HZFA 2AYRA 1DKFB 5EI1A 3FXVA 1GWXA 3ILZA 4IV2A 4OZRU 1XV9B 3VRTA 1KNUA 3W0GA 3WT7A 1SJ0A 5AAUA 1XZXX 2Z4BA 4G2IA 3SP9A 3V9TA 4UDCA 3OLLA 4MGDB 3IXPD 3OGTA 1FBYA 3H0AA 4R2UA 3DY6A 4DK7A 4ZOMA 3IPSA 3O1EA 3CDPA 2PRGA 5DWIA 1KKQA 1RDTD 1RKHA 4S0SA 1XDKB 5DKGA 4OEAA 1NHZA 5AZVA 1I38A 2Z4JA 4RUPA 3VT8A 3OMOA 3R5NA 2QTUA 5DZIA 1XLSA 3B0TA 2P15A 4ONIA 1U3RA 4MGBA 2QZOA 3IMYA 3VJSA 5DWLA 4ZI1A 4LSJA 1PRGA 2B1VA 2J7XA 4ITFA 3QT0A 1I37A 1UPWA 1LV2A 3B65A 3FS1A 3M7RA 4A2JA 4XAOA 5GICA 2YLPA 4ZNWA 3AX8A 4JGVA 3WJ4A 5L7EA 3UP0A 1R20A 5KCDA 5DKEA 3CS6A 1DB1A 4WQPA 3AZ2A 3UVVB 3VTBA 3DZUA 3WT5A 3IPQA 5KCCA 5LWPA 1EXAA 3V49A 4WPFA 4NUFA 1WM0X 5DMCA 3X31A 2Q59A 3X1IA 2ZK5A 5DV3A 5DYBA 1XB7A 3L0LA 4J24A 5DP0A 1RK3A 3L0JA 2QGWA 5DIEA 1XNXA 4YMQA 4RMCA 4OFUA 4IS8A 5E19A 4YPQA 2FAIA 3DZYA 5KRMA 1YMTA 2ZNNA 2ZMIA 4LNXA 5IZ0A 3V3QA 1UHLA 2HB7A 3SZ1A 4E2JA 4ZNTA 1L2JA 3V4AA 1YINA 3A9EA 1PDUA 5DXBB 5KYJA 3VHWA 5E0XA 3TX7B 2HFPA 5DV6A 2NXXE 4KZIA 5KRFA 3UU7A 3BEJA 2QXSA 4XTAA 5DMFA 3RUUA 5E7VA 4MG8A 4IW6A 1K74A 1S0XA 1NQ7A 4KZMA 1OVLA 2ZLAA 4DOSA 2GPUA 2VV3A 3B67A 4APUA 1G50A 3LMPA 1R6GA 3H0AD 5APHA 3IPUA 2PIPL 3VI8A 1Y0SA 4TUZB 2P1TA 2ZMHA 5DZHA 5ETHA 1X76A 3W5TA 2O9IA 1SKXA 4L98A 1OSHA 2YFEA 3HVLA 2XKWA 3KDTA 4OJ9A 3R8AA 2ZNQA 2POBA 2POGA 2Q60A 4XI3A 4ZNHA 3WMHA 4ZJRA 5KR9A 4ZO1X 4RFWA 3CQVA 1QKTA 4UDBA 2ZXMA 5EJVA 1PQ6A 1Z5XU 3A2IA 4IW8A 2OAXA 3W0IA 5KRIA 2R6WA 1OT7A 4IA1A 1NRLA 5EITA 3Q95A 2QR9A 4RMDA
chains in the Genus database with same CATH superfamily
1R1KA 1A52A 2HB8A 2GIUA 2AX8A 5HCVA 3W5PA 3KFCA 5DZ3A 1XQ3A 5JJMB 2BJ4B 1NAXA 1R20D 1XPCA 4DMAA 2P1UA 3WT6A 1Y9RA 1PQCA 3GYTA 2AXAA 3DZUD 1EXXA 1ZAFA 3GZ9A 4M8EA 1FCYA 4CI4A 1NQ2A 5HJPA 5M96A 2ABIA 2PIWA 1GWQA 3UUAA 2I0GA 5DKBA 3VT9A 4PRGA 2Q7LA 3OS8A 4G1YA 4JYGA 3GD2A 2QGTA 1IE9A 1G2NA 2NXXA 4EM9A 2Q5GA 4X1FA 3G9EA 4MG9A 1UPVA 2ZFXA 1X7RA 3L3XA 4MGAA 3KDUA 5AVLA 5GIEA 3SP6A 2YJAB 4S15A 3VJTA 4PP5A 2Q5SA 5KRAA 3MNPA 4LBDA 1YJEA 2OM9A 3HODA 1ZGYA 2Q70A 3ADUA 4Q0AC 5AWJA 3VJHA 2PIUA 3HC5A 3OOKA 4MGCA 4PLDA 3E00D 1S19A 2VSRA 5DWEA 5IAWA 5JY3A 1X7EA 4RE8A 4JL4A 3ZR7A 2QW4A 5L11A 5DV8A 3VHUA 1IE8A 3A40X 4NIEA 3RLLA 1TFCA 3R2AA 3VSOA 1Q4XA 4OH6A 3VSPA 3PBAA 4R6SA 3CWDA 2JFAA 2H77A 3F5CA 3VRVA 3VT6A 3CLDA 4OKBA 1XP1A 2AA2A 4ZNVA 4X1GA 3X36A 2ZK1A 5DZ1A 4Q13A 1T7RA 5DLRA 3FALA 2PJLA 1MZNA 4J5XA 3FC6A 2QH6A 2HARA 4REFA 1HG4A 3V3EA 2Q6JA 3P89A 2R40D 3N00A 2AO6A 3OSIA 3RVFA 2G0HA 2PITA 5KRJA 5DTVA 2PIRA 3VRUA 1YIMA 1EREA 3D57A 3NSQA 3ADWA 1NDEA 4RZEA 5LGAA 1T65A 1YOKA 2ZXZA 5E0WA 5B5BA 1P93A 4POHA 5FQPA 1DKFA 3U9QA 1FD0A 2YJDA 1PCGA 4PLEA 3P0UA 3ADSA 2FSZA 2JJ3A 3OZ0A 5G43A 2Q1HA 2Q59B 2REWA 2GPVA 3PLZA 2P1VA 2ZL9A 3AN4A 3DR1A 1NUOA 2Q6SA 4TV1A 2AB2A 3KYTA 4OARA 1NQ1A 5KCFA 3OOFA 5AWKA 3X1HA 4MGDA 1K4WA 4OJ4A 1XOWA 1YUCA 3KBAA 4S0TA 3FUGA 5GT4A 5KCUA 4OKWA 4N8RA 3A9EB 3OKHA 4PWLA 3V9YA 4RZFA 2EWPA 5K13A 5C4OA 1ZH7A 3UU7B 1XP9A 4NQAB 4MG7A 5KRHA 5E14A 4YT1A 2AWHA 3FURA 5HYRA 4FHIA 1XP6A 2QA8B 1OVLB 5KYAA 4ZNUA 1ZDTA 3WJ5A 4K6IA 3WTQA 2J4AA 2XYXA 1T73A 2Q5PA 2QMVA 1MVCA 4G1ZA 4RZGA 4P6WA 3K6PA 3HO0A 3MNOA 4OHAA 3OS9A 5DWGA 1SR7A 1K7LA 1ZUCA 2PIOA 2A3IA 2Q3YA 2ZBSA 2XYWA 3NOAA 4PP6A 1XQCA 5KRLA 1M7WA 4OH5A 1ILGA 1H9UA 2ACLB 3K23A 4E4QA 1NQ0A 1PZLA 3A2JA 4DK8A 1QKUA 4P6XA 3W0CA 3S9SA 3OLSA 4OJBA 3UVVA 1HJ1A 5DRMA 1PK5A 1RJKA 3O1DA 2YATA 3L3ZA 4RWVA 4WHFA 4PVUA 1ERRA 2QE4A 1T63A 3OSWA 4J26A 2PKLA 1FCXA 5G44A 2I4ZA 2ZMJA 2PIXA 5DU5A 1GS4A 3HLVA 5L7GA 1M2ZA 5DK9A 3ADVA 5G5WA 5ICKA 3VT4A 5KD9A 2OUZA 4XLDA 3G8IA 1XVPB 5F9BA 3D24A 4IQRA 4IA3A 2GTKA 3AN3A 3CJWA 1ZDUA 2ZY0A 3DCTA 5DUHA 3B0QA 1S9PA 3ERDA 3VHVA 2G44A 3UUDA 2ZK3A 3R29A 1OSVA 3KMZA 1T7TA 2HWQA 2OZ7A 3VT7A 5AAVA 4PPSA 5DX3A 2VV4B 1ZEOA 5DIDA 1NYXA 5KRCA 5HJPB 4ZN7A 2AA5A 2ATHA 5KROA 3RY9A 3VJIA 1MV9A 1RKGA 1ZKYA 2JF9A 2O4RA 3K22A 1XJ7A 3JZCA 4J5WA 2VV1A 4WHGA 5EHJA 5DL4A 5AVIA 2LBDA 1KV6A 4NY9A 5KCWA 2AX6A 3ZRBA 3IXPA 2VV0A 4OEYA 4A4WA 1S9QA 4MG9B 4MGAB 5DI7A 2GWXA 2W8YA 2ZK0A 3ADTA 4IUIA 2QSEA 2ZK4A 3ZRAA 4RMEA 1R5KA 5JI0D 2ZK6A 1QKMA 3GWSX 3AUQA 3DZYD 4XUMA 3OKIA 3DCUA 3PO9A 4FHHA 2E2RA 3FEJA 5FQTA 4PP3A 4NB6A 3CTBA 1Z95A 3LBDA 2NV7A 3E7CA 3ET2A 2AM9A 3KMRA 2AA7A 3GWXA 5DXKA 5DVVA 1T7MA 1X78A 2B1ZA 2JFAB 1S0ZA 4OIVA 1K74D 3F5CB 5C4UA 2NPAA 3MNEA 5JJMA 2BJ4A 1FCZA 2HWRA 5G3JA 2P7GA 4OZTE 3R5MA 1T7FA 3ET0A 4HLWA 3VT5A 5DVCA 1N83A 3ZQTA 5ACCA 1YY4A 4OEDA 4UDAA 4IWFA 4B7WA 3AFRA 3VN2A 2FVJA 3OAPA 2I4PA 1M13A 1XIUA 5APJA 2GPPA 1E3GA 2OCFA 4K7AA 3D90A 3RLJA 1FM6A 2ZKCA 3CS4A 3NSPA 4JYHA 3ADXA 4PF3A 1G5YA 3HM1A 4IWCA 2ZASA 3OMQA 3PEQA 2QNVA 1PQ9A 1YP0A 2QZOB 4LTWA 1G1UA 4MGBB 2P4YA 5DKSA 1P8DA 5E15A 4ITEA 3UUCA 2AMAA 2XHSA 2YLYA 3VRWA 1A28A 4FGYA 1U9EA 2GP7A 4HEEX 1R1KD 5FQRA 4EMAA 5HYKA 3BC5A 5KCTA 2O4JA 3WFFA 5G46A 2YLOA 4K4JA 1L2IA 2IOGA 3OSAA 5HZCA 1SQNA 1TXIA 1GWRA 4OKXA 5AYGA 4OILA 1XNNA 1NAVA 3VTDA 1N46A 4A4VA 4FNEA 1VJBA 1ILHA 4TV1B 4FN9A 3VT3A 2AMBA 3OS8C 3TKCA 1YOWA 4MG5A 2HASA 4UDDA 3JZBA 3TY0A 4ZJWA 1XV9A 2G0GA 4OGHA 5E1CA 5B41A 1N4HA 3P8XA 2I4JA 4RUOX 2PIQA 3PCUA 4PPPA 5SYZA 3GBKA 3CS8A 5CJ6A 4OIUA 2PNUA 4OZRE 4REEA 5I4VA 3L03A 1FM9A 4ZNSA 4OC7A 3DT3A 3EYBA 4MG7B 2YLQA 4IU7A 3B1MA 1UHLB 3B0RA 4Q50A 1T5ZA 2PINA 2V0VA 3B0WA 4G1DA 4MDDA 1XDKA 2HVCA 4G2HA 3W0HA 3KWYA 3B5RA 5G42A 4E4KA 2VSTA 4PXMA 2Q6RA 2XYJA 4MG8B 1E3KA 4XUHA 4YNKA 3W0JA 3OMMA 3H52A 2H79A 3VTCA 2P54A 2Q8SA 4IA2A 5KCEA 4RUJA 1YYEA 3A78A 4LNWA 4J5XC 5IXKA 2NW4A 4IV4A 4N1YA 5H1EA 1U3SA 3B66A 2ZNOA 5DXQA 4IVYA 4OK1A 5C4SA 2HC4A 5DUEA 4M8HA 3HC6A 3R8IA 4F9MA 3RUTA 2P7ZA 4OEZA 5DIGA 1FM6D 1UOMA 2AX7A 3FLIA 4QJRA 2Q7JA 3CDSA 4O8FA 2I0JA 3A3ZX 3D6DA 3AZ3A 3FEIA 3F7DA 3UUDB 2Q61A 3WGPA 4R06A 5DZ0A 3G0WA 3L1BA 2R6YA 2ZVTA 3Q95B 3KMGA 4JAZA 4JYIA 1QKNA 4N5GA 1Y0XX 2AAXA 4G21A 5AAVB 4L96A 5DX3B 3A2HA 4DM6A 3AZ1A 4XT9A 3OMPA 4QK4A 3R8DA 3E00A 2HCDA 2GPOA 3HQ5A 2QA8A 2QPYA 5DXBA 1I7IA 2QXMA 2VV1B 3TKMA 3W5QA 4CI5A 2ZK2A 5EC9A 2ZNPA 3G8OA 5KRKA 3W0AA 2YHDA 5DVSA 4KZJA 5DRJA 4QE8A 5DXPA 2QA6A 3E94A 3UUAB 4DQMA 5DXEA 2ACLA 1FM9D 2Q1VA 3ET3A 3PRGA 3P88A 5APKA 1T74A 4S14A 5DYDA 5AZTA 2B23A 3OLFA 4Y29A 5FQSA 4DM8A 4ZN9A 3OMKA 1YA3A 3B3KA 4QM0A 4TUZA 3K8SA 4WLBA 5DXMA 3GN8A 3T03A 4DORA 4ZO1B 1RDTA 3D5FA 3W0YA 2V7CA 4OZTU 1T79A 4N73A 4QE6A 4IA7A 2BAWA 2R40A 3AURA 2VV2A 2P7AA 1I7GA 1XVPA 1LBDA 2Q7IA 5HJSA 5DY8A 2GL8A 3GYUA 3BQDA 5AK2A 2AX9A 3WFGA 2QABA 1U3QA 4QL8A 4RAKA 4G20A 2OVMA 1XLSE 3IA6A 3B68A 4WVDA 3ET1A 2Q7KA 1BSXA 2AA6A 2VV4A 5G45A 3V9VA 2OVHA 5EGVA 1Z5XE 2HBHA 5DWJA 5C4TA 5DSHA 3WWRA 1XAPA 5GIDA 4CSJA 2ZXNA 3KPZA 5DXRA 4OLMA 5L7HA 3FALB 2HAMA 5FQVA 1X7BA 3UP3A 3FC6B 5A86A 2B50A 4POJA 3L0EA 1X7JA 3OZJA 4MG6A 4OKTA 3W5RA 1T76A 2IHQA 5DUGA 4OFRA 5DXGA 2J7YA 2G5OA 4IVWA 2J14A 2IOKA 2ZLCA 3AUNA 2F4BA 4BCRA 4XHDA 3ERTA 2PIVA 4J5WC 3HZFA 2AYRA 1DKFB 5EI1A 3FXVA 1GWXA 3ILZA 4IV2A 4OZRU 1XV9B 3VRTA 1KNUA 3W0GA 3WT7A 1SJ0A 5AAUA 1XZXX 2Z4BA 4G2IA 3SP9A 3V9TA 4UDCA 3OLLA 4MGDB 3IXPD 3OGTA 1FBYA 3H0AA 4R2UA 3DY6A 4DK7A 4ZOMA 3IPSA 3O1EA 3CDPA 2PRGA 5DWIA 1KKQA 1RDTD 1RKHA 4S0SA 1XDKB 5DKGA 4OEAA 1NHZA 5AZVA 1I38A 2Z4JA 4RUPA 3VT8A 3OMOA 3R5NA 2QTUA 5DZIA 1XLSA 3B0TA 2P15A 4ONIA 1U3RA 4MGBA 2QZOA 3IMYA 3VJSA 5DWLA 4ZI1A 4LSJA 1PRGA 2B1VA 2J7XA 4ITFA 3QT0A 1I37A 1UPWA 1LV2A 3B65A 3FS1A 3M7RA 4A2JA 4XAOA 5GICA 2YLPA 4ZNWA 3AX8A 4JGVA 3WJ4A 5L7EA 3UP0A 1R20A 5KCDA 5DKEA 3CS6A 1DB1A 4WQPA 3AZ2A 3UVVB 3VTBA 3DZUA 3WT5A 3IPQA 5KCCA 5LWPA 1EXAA 3V49A 4WPFA 4NUFA 1WM0X 5DMCA 3X31A 2Q59A 3X1IA 2ZK5A 5DV3A 5DYBA 1XB7A 3L0LA 4J24A 5DP0A 1RK3A 3L0JA 2QGWA 5DIEA 1XNXA 4YMQA 4RMCA 4OFUA 4IS8A 5E19A 4YPQA 2FAIA 3DZYA 5KRMA 1YMTA 2ZNNA 2ZMIA 4LNXA 5IZ0A 3V3QA 1UHLA 2HB7A 3SZ1A 4E2JA 4ZNTA 1L2JA 3V4AA 1YINA 3A9EA 1PDUA 5DXBB 5KYJA 3VHWA 5E0XA 3TX7B 2HFPA 5DV6A 2NXXE 4KZIA 5KRFA 3UU7A 3BEJA 2QXSA 4XTAA 5DMFA 3RUUA 5E7VA 4MG8A 4IW6A 1K74A 1S0XA 1NQ7A 4KZMA 1OVLA 2ZLAA 4DOSA 2GPUA 2VV3A 3B67A 4APUA 1G50A 3LMPA 1R6GA 3H0AD 5APHA 3IPUA 2PIPL 3VI8A 1Y0SA 4TUZB 2P1TA 2ZMHA 5DZHA 5ETHA 1X76A 3W5TA 2O9IA 1SKXA 4L98A 1OSHA 2YFEA 3HVLA 2XKWA 3KDTA 4OJ9A 3R8AA 2ZNQA 2POBA 2POGA 2Q60A 4XI3A 4ZNHA 3WMHA 4ZJRA 5KR9A 4ZO1X 4RFWA 3CQVA 1QKTA 4UDBA 2ZXMA 5EJVA 1PQ6A 1Z5XU 3A2IA 4IW8A 2OAXA 3W0IA 5KRIA 2R6WA 1OT7A 4IA1A 1NRLA 5EITA 3Q95A 2QR9A 4RMDA
chains in the Genus database with same CATH topology
1R1KA 1A52A 2HB8A 2GIUA 2AX8A 5HCVA 3W5PA 3KFCA 5DZ3A 1XQ3A 5JJMB 2BJ4B 1NAXA 1R20D 1XPCA 4DMAA 2P1UA 3WT6A 1Y9RA 1PQCA 3GYTA 2AXAA 3DZUD 1EXXA 1ZAFA 3GZ9A 4M8EA 1FCYA 4CI4A 1NQ2A 5HJPA 5M96A 2ABIA 2PIWA 1GWQA 3UUAA 2I0GA 5DKBA 3VT9A 4PRGA 2Q7LA 3OS8A 4G1YA 4JYGA 3GD2A 2QGTA 1IE9A 1G2NA 2NXXA 4EM9A 2Q5GA 4X1FA 3G9EA 4MG9A 1UPVA 2ZFXA 1X7RA 3L3XA 4MGAA 3KDUA 5AVLA 5GIEA 3SP6A 2YJAB 4S15A 3VJTA 4PP5A 2Q5SA 5KRAA 3MNPA 4LBDA 1YJEA 2OM9A 3HODA 1ZGYA 2Q70A 3ADUA 4Q0AC 5AWJA 3VJHA 2PIUA 3HC5A 3OOKA 4MGCA 4PLDA 3E00D 1S19A 2VSRA 5DWEA 5IAWA 5JY3A 1X7EA 4RE8A 4JL4A 3ZR7A 2QW4A 5L11A 5DV8A 3VHUA 1IE8A 3A40X 4NIEA 3RLLA 1TFCA 3R2AA 3VSOA 1Q4XA 4OH6A 3VSPA 3PBAA 4R6SA 3CWDA 2JFAA 2H77A 3F5CA 3VRVA 3VT6A 3CLDA 4OKBA 1XP1A 2AA2A 4ZNVA 4X1GA 3X36A 2ZK1A 5DZ1A 4Q13A 1T7RA 5DLRA 3FALA 2PJLA 1MZNA 4J5XA 3FC6A 2QH6A 2HARA 4REFA 1HG4A 3V3EA 2Q6JA 3P89A 2R40D 3N00A 2AO6A 3OSIA 3RVFA 2G0HA 2PITA 5KRJA 5DTVA 2PIRA 3VRUA 1YIMA 1EREA 3D57A 3NSQA 3ADWA 1NDEA 4RZEA 5LGAA 1T65A 1YOKA 2ZXZA 5E0WA 5B5BA 1P93A 4POHA 5FQPA 1DKFA 3U9QA 1FD0A 2YJDA 1PCGA 4PLEA 3P0UA 3ADSA 2FSZA 2JJ3A 3OZ0A 5G43A 2Q1HA 2Q59B 2REWA 2GPVA 3PLZA 2P1VA 2ZL9A 3AN4A 3DR1A 1NUOA 2Q6SA 4TV1A 2AB2A 3KYTA 4OARA 1NQ1A 5KCFA 3OOFA 5AWKA 3X1HA 4MGDA 1K4WA 4OJ4A 1XOWA 1YUCA 3KBAA 4S0TA 3FUGA 5GT4A 5KCUA 4OKWA 4N8RA 3A9EB 3OKHA 4PWLA 3V9YA 4RZFA 2EWPA 5K13A 5C4OA 1ZH7A 3UU7B 1XP9A 4NQAB 4MG7A 5KRHA 5E14A 4YT1A 2AWHA 3FURA 5HYRA 4FHIA 1XP6A 2QA8B 1OVLB 5KYAA 4ZNUA 1ZDTA 3WJ5A 4K6IA 3WTQA 2J4AA 2XYXA 1T73A 2Q5PA 2QMVA 1MVCA 4G1ZA 4RZGA 4P6WA 3K6PA 3HO0A 3MNOA 4OHAA 3OS9A 5DWGA 1SR7A 1K7LA 1ZUCA 2PIOA 2A3IA 2Q3YA 2ZBSA 2XYWA 3NOAA 4PP6A 1XQCA 5KRLA 1M7WA 4OH5A 1ILGA 1H9UA 2ACLB 3K23A 4E4QA 1NQ0A 1PZLA 3A2JA 4DK8A 1QKUA 4P6XA 3W0CA 3S9SA 3OLSA 4OJBA 3UVVA 1HJ1A 5DRMA 1PK5A 1RJKA 3O1DA 2YATA 3L3ZA 4RWVA 4WHFA 4PVUA 1ERRA 2QE4A 1T63A 3OSWA 4J26A 2PKLA 1FCXA 5G44A 2I4ZA 2ZMJA 2PIXA 5DU5A 1GS4A 3HLVA 5L7GA 1M2ZA 5DK9A 3ADVA 5G5WA 5ICKA 3VT4A 5KD9A 2OUZA 4XLDA 3G8IA 1XVPB 5F9BA 3D24A 4IQRA 4IA3A 2GTKA 3AN3A 3CJWA 1ZDUA 2ZY0A 3DCTA 5DUHA 3B0QA 1S9PA 3ERDA 3VHVA 2G44A 3UUDA 2ZK3A 3R29A 1OSVA 3KMZA 1T7TA 2HWQA 2OZ7A 3VT7A 5AAVA 4PPSA 5DX3A 2VV4B 1ZEOA 5DIDA 1NYXA 5KRCA 5HJPB 4ZN7A 2AA5A 2ATHA 5KROA 3RY9A 3VJIA 1MV9A 1RKGA 1ZKYA 2JF9A 2O4RA 3K22A 1XJ7A 3JZCA 4J5WA 2VV1A 4WHGA 5EHJA 5DL4A 5AVIA 2LBDA 1KV6A 4NY9A 5KCWA 2AX6A 3ZRBA 3IXPA 2VV0A 4OEYA 4A4WA 1S9QA 4MG9B 4MGAB 5DI7A 2GWXA 2W8YA 2ZK0A 3ADTA 4IUIA 2QSEA 2ZK4A 3ZRAA 4RMEA 1R5KA 5JI0D 2ZK6A 1QKMA 3GWSX 3AUQA 3DZYD 4XUMA 3OKIA 3DCUA 3PO9A 4FHHA 2E2RA 3FEJA 5FQTA 4PP3A 4NB6A 3CTBA 1Z95A 3LBDA 2NV7A 3E7CA 3ET2A 2AM9A 3KMRA 2AA7A 3GWXA 5DXKA 5DVVA 1T7MA 1X78A 2B1ZA 2JFAB 1S0ZA 4OIVA 1K74D 3F5CB 5C4UA 2NPAA 3MNEA 5JJMA 2BJ4A 1FCZA 2HWRA 5G3JA 2P7GA 4OZTE 3R5MA 1T7FA 3ET0A 4HLWA 3VT5A 5DVCA 1N83A 3ZQTA 5ACCA 1YY4A 4OEDA 4UDAA 4IWFA 4B7WA 3AFRA 3VN2A 2FVJA 3OAPA 2I4PA 1M13A 1XIUA 5APJA 2GPPA 1E3GA 2OCFA 4K7AA 3D90A 3RLJA 1FM6A 2ZKCA 3CS4A 3NSPA 4JYHA 3ADXA 4PF3A 1G5YA 3HM1A 4IWCA 2ZASA 3OMQA 3PEQA 2QNVA 1PQ9A 1YP0A 2QZOB 4LTWA 1G1UA 4MGBB 2P4YA 5DKSA 1P8DA 5E15A 4ITEA 3UUCA 2AMAA 2XHSA 2YLYA 3VRWA 1A28A 4FGYA 1U9EA 2GP7A 4HEEX 1R1KD 5FQRA 4EMAA 5HYKA 3BC5A 5KCTA 2O4JA 3WFFA 5G46A 2YLOA 4K4JA 1L2IA 2IOGA 3OSAA 5HZCA 1SQNA 1TXIA 1GWRA 4OKXA 5AYGA 4OILA 1XNNA 1NAVA 3VTDA 1N46A 4A4VA 4FNEA 1VJBA 1ILHA 4TV1B 4FN9A 3VT3A 2AMBA 3OS8C 3TKCA 1YOWA 4MG5A 2HASA 4UDDA 3JZBA 3TY0A 4ZJWA 1XV9A 2G0GA 4OGHA 5E1CA 5B41A 1N4HA 3P8XA 2I4JA 4RUOX 2PIQA 3PCUA 4PPPA 5SYZA 3GBKA 3CS8A 5CJ6A 4OIUA 2PNUA 4OZRE 4REEA 5I4VA 3L03A 1FM9A 4ZNSA 4OC7A 3DT3A 3EYBA 4MG7B 2YLQA 4IU7A 3B1MA 1UHLB 3B0RA 4Q50A 1T5ZA 2PINA 2V0VA 3B0WA 4G1DA 4MDDA 1XDKA 2HVCA 4G2HA 3W0HA 3KWYA 3B5RA 5G42A 4E4KA 2VSTA 4PXMA 2Q6RA 2XYJA 4MG8B 1E3KA 4XUHA 4YNKA 3W0JA 3OMMA 3H52A 2H79A 3VTCA 2P54A 2Q8SA 4IA2A 5KCEA 4RUJA 1YYEA 3A78A 4LNWA 4J5XC 5IXKA 2NW4A 4IV4A 4N1YA 5H1EA 1U3SA 3B66A 2ZNOA 5DXQA 4IVYA 4OK1A 5C4SA 2HC4A 5DUEA 4M8HA 3HC6A 3R8IA 4F9MA 3RUTA 2P7ZA 4OEZA 5DIGA 1FM6D 1UOMA 2AX7A 3FLIA 4QJRA 2Q7JA 3CDSA 4O8FA 2I0JA 3A3ZX 3D6DA 3AZ3A 3FEIA 3F7DA 3UUDB 2Q61A 3WGPA 4R06A 5DZ0A 3G0WA 3L1BA 2R6YA 2ZVTA 3Q95B 3KMGA 4JAZA 4JYIA 1QKNA 4N5GA 1Y0XX 2AAXA 4G21A 5AAVB 4L96A 5DX3B 3A2HA 4DM6A 3AZ1A 4XT9A 3OMPA 4QK4A 3R8DA 3E00A 2HCDA 2GPOA 3HQ5A 2QA8A 2QPYA 5DXBA 1I7IA 2QXMA 2VV1B 3TKMA 3W5QA 4CI5A 2ZK2A 5EC9A 2ZNPA 3G8OA 5KRKA 3W0AA 2YHDA 5DVSA 4KZJA 5DRJA 4QE8A 5DXPA 2QA6A 3E94A 3UUAB 4DQMA 5DXEA 2ACLA 1FM9D 2Q1VA 3ET3A 3PRGA 3P88A 5APKA 1T74A 4S14A 5DYDA 5AZTA 2B23A 3OLFA 4Y29A 5FQSA 4DM8A 4ZN9A 3OMKA 1YA3A 3B3KA 4QM0A 4TUZA 3K8SA 4WLBA 5DXMA 3GN8A 3T03A 4DORA 4ZO1B 1RDTA 3D5FA 3W0YA 2V7CA 4OZTU 1T79A 4N73A 4QE6A 4IA7A 2BAWA 2R40A 3AURA 2VV2A 2P7AA 1I7GA 1XVPA 1LBDA 2Q7IA 5HJSA 5DY8A 2GL8A 3GYUA 3BQDA 5AK2A 2AX9A 3WFGA 2QABA 1U3QA 4QL8A 4RAKA 4G20A 2OVMA 1XLSE 3IA6A 3B68A 4WVDA 3ET1A 2Q7KA 1BSXA 2AA6A 2VV4A 5G45A 3V9VA 2OVHA 5EGVA 1Z5XE 2HBHA 5DWJA 5C4TA 5DSHA 3WWRA 1XAPA 5GIDA 4CSJA 2ZXNA 3KPZA 5DXRA 4OLMA 5L7HA 3FALB 2HAMA 5FQVA 1X7BA 3UP3A 3FC6B 5A86A 2B50A 4POJA 3L0EA 1X7JA 3OZJA 4MG6A 4OKTA 3W5RA 1T76A 2IHQA 5DUGA 4OFRA 5DXGA 2J7YA 2G5OA 4IVWA 2J14A 2IOKA 2ZLCA 3AUNA 2F4BA 4BCRA 4XHDA 3ERTA 2PIVA 4J5WC 3HZFA 2AYRA 1DKFB 5EI1A 3FXVA 1GWXA 3ILZA 4IV2A 4OZRU 1XV9B 3VRTA 1KNUA 3W0GA 3WT7A 1SJ0A 5AAUA 1XZXX 2Z4BA 4G2IA 3SP9A 3V9TA 4UDCA 3OLLA 4MGDB 3IXPD 3OGTA 1FBYA 3H0AA 4R2UA 3DY6A 4DK7A 4ZOMA 3IPSA 3O1EA 3CDPA 2PRGA 5DWIA 1KKQA 1RDTD 1RKHA 4S0SA 1XDKB 5DKGA 4OEAA 1NHZA 5AZVA 1I38A 2Z4JA 4RUPA 3VT8A 3OMOA 3R5NA 2QTUA 5DZIA 1XLSA 3B0TA 2P15A 4ONIA 1U3RA 4MGBA 2QZOA 3IMYA 3VJSA 5DWLA 4ZI1A 4LSJA 1PRGA 2B1VA 2J7XA 4ITFA 3QT0A 1I37A 1UPWA 1LV2A 3B65A 3FS1A 3M7RA 4A2JA 4XAOA 5GICA 2YLPA 4ZNWA 3AX8A 4JGVA 3WJ4A 5L7EA 3UP0A 1R20A 5KCDA 5DKEA 3CS6A 1DB1A 4WQPA 3AZ2A 3UVVB 3VTBA 3DZUA 3WT5A 3IPQA 5KCCA 5LWPA 1EXAA 3V49A 4WPFA 4NUFA 1WM0X 5DMCA 3X31A 2Q59A 3X1IA 2ZK5A 5DV3A 5DYBA 1XB7A 3L0LA 4J24A 5DP0A 1RK3A 3L0JA 2QGWA 5DIEA 1XNXA 4YMQA 4RMCA 4OFUA 4IS8A 5E19A 4YPQA 2FAIA 3DZYA 5KRMA 1YMTA 2ZNNA 2ZMIA 4LNXA 5IZ0A 3V3QA 1UHLA 2HB7A 3SZ1A 4E2JA 4ZNTA 1L2JA 3V4AA 1YINA 3A9EA 1PDUA 5DXBB 5KYJA 3VHWA 5E0XA 3TX7B 2HFPA 5DV6A 2NXXE 4KZIA 5KRFA 3UU7A 3BEJA 2QXSA 4XTAA 5DMFA 3RUUA 5E7VA 4MG8A 4IW6A 1K74A 1S0XA 1NQ7A 4KZMA 1OVLA 2ZLAA 4DOSA 2GPUA 2VV3A 3B67A 4APUA 1G50A 3LMPA 1R6GA 3H0AD 5APHA 3IPUA 2PIPL 3VI8A 1Y0SA 4TUZB 2P1TA 2ZMHA 5DZHA 5ETHA 1X76A 3W5TA 2O9IA 1SKXA 4L98A 1OSHA 2YFEA 3HVLA 2XKWA 3KDTA 4OJ9A 3R8AA 2ZNQA 2POBA 2POGA 2Q60A 4XI3A 4ZNHA 3WMHA 4ZJRA 5KR9A 4ZO1X 4RFWA 3CQVA 1QKTA 4UDBA 2ZXMA 5EJVA 1PQ6A 1Z5XU 3A2IA 4IW8A 2OAXA 3W0IA 5KRIA 2R6WA 1OT7A 4IA1A 1NRLA 5EITA 3Q95A 2QR9A 4RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1K A;  1A52 A;  2HB8 A;  2GIU A;  2AX8 A;  5HCV A;  3W5P A;  3KFC A;  5DZ3 A;  1XQ3 A;  5JJM B;  2BJ4 B;  1NAX A;  1R20 D;  1XPC A;  4DMA A;  2P1U A;  3WT6 A;  1Y9R A;  1PQC A;  3GYT A;  2AXA A;  3DZU D;  1EXX A;  1ZAF A;  3GZ9 A;  4M8E A;  1FCY A;  4CI4 A;  1NQ2 A;  5HJP A;  5M96 A;  2ABI A;  2PIW A;  1GWQ A;  3UUA A;  2I0G A;  5DKB A;  3VT9 A;  4PRG A;  2Q7L A;  3OS8 A;  4G1Y A;  4JYG A;  3GD2 A;  2QGT A;  1IE9 A;  1G2N A;  2NXX A;  4EM9 A;  2Q5G A;  4X1F A;  3G9E A;  4MG9 A;  1UPV A;  2ZFX A;  1X7R A;  3L3X A;  4MGA A;  3KDU A;  5AVL A;  5GIE A;  3SP6 A;  2YJA B;  4S15 A;  3VJT A;  4PP5 A;  2Q5S A;  5KRA A;  3MNP A;  4LBD A;  1YJE A;  2OM9 A;  3HOD A;  1ZGY A;  2Q70 A;  3ADU A;  4Q0A C;  5AWJ A;  3VJH A;  2PIU A;  3HC5 A;  3OOK A;  4MGC A;  4PLD A;  3E00 D;  1S19 A;  2VSR A;  5DWE A;  5IAW A;  5JY3 A;  1X7E A;  4RE8 A;  4JL4 A;  3ZR7 A;  2QW4 A;  5L11 A;  5DV8 A;  3VHU A;  1IE8 A;  3A40 X;  4NIE A;  3RLL A;  1TFC A;  3R2A A;  3VSO A;  1Q4X A;  4OH6 A;  3VSP A;  3PBA A;  4R6S A;  3CWD A;  2JFA A;  2H77 A;  3F5C A;  3VRV A;  3VT6 A;  3CLD A;  4OKB A;  1XP1 A;  2AA2 A;  4ZNV A;  4X1G A;  3X36 A;  2ZK1 A;  5DZ1 A;  4Q13 A;  1T7R A;  5DLR A;  3FAL A;  2PJL A;  1MZN A;  4J5X A;  3FC6 A;  2QH6 A;  2HAR A;  4REF A;  1HG4 A;  3V3E A;  2Q6J A;  3P89 A;  2R40 D;  3N00 A;  2AO6 A;  3OSI A;  3RVF A;  2G0H A;  2PIT A;  5KRJ A;  5DTV A;  2PIR A;  3VRU A;  1YIM A;  1ERE A;  3D57 A;  3NSQ A;  3ADW A;  1NDE A;  4RZE A;  5LGA A;  1T65 A;  1YOK A;  2ZXZ A;  5E0W A;  5B5B A;  1P93 A;  4POH A;  5FQP A;  1DKF A;  3U9Q A;  1FD0 A;  2YJD A;  1PCG A;  4PLE A;  3P0U A;  3ADS A;  2FSZ A;  2JJ3 A;  3OZ0 A;  5G43 A;  2Q1H A;  2Q59 B;  2REW A;  2GPV A;  3PLZ A;  2P1V A;  2ZL9 A;  3AN4 A;  3DR1 A;  1NUO A;  2Q6S A;  4TV1 A;  2AB2 A;  3KYT A;  4OAR A;  1NQ1 A;  5KCF A;  3OOF A;  5AWK A;  3X1H A;  4MGD A;  1K4W A;  4OJ4 A;  1XOW A;  1YUC A;  3KBA A;  4S0T A;  3FUG A;  5GT4 A;  5KCU A;  4OKW A;  4N8R A;  3A9E B;  3OKH A;  4PWL A;  3V9Y A;  4RZF A;  2EWP A;  5K13 A;  5C4O A;  1ZH7 A;  3UU7 B;  1XP9 A;  4NQA B;  4MG7 A;  5KRH A;  5E14 A;  4YT1 A;  2AWH A;  3FUR A;  5HYR A;  4FHI A;  1XP6 A;  2QA8 B;  1OVL B;  5KYA A;  4ZNU A;  1ZDT A;  3WJ5 A;  4K6I A;  3WTQ A;  2J4A A;  2XYX A;  1T73 A;  2Q5P A;  2QMV A;  1MVC A;  4G1Z A;  4RZG A;  4P6W A;  3K6P A;  3HO0 A;  3MNO A;  4OHA A;  3OS9 A;  5DWG A;  1SR7 A;  1K7L A;  1ZUC A;  2PIO A;  2A3I A;  2Q3Y A;  2ZBS A;  2XYW A;  3NOA A;  4PP6 A;  1XQC A;  5KRL A;  1M7W A;  4OH5 A;  1ILG A;  1H9U A;  2ACL B;  3K23 A;  4E4Q A;  1NQ0 A;  1PZL A;  3A2J A;  4DK8 A;  1QKU A;  4P6X A;  3W0C A;  3S9S A;  3OLS A;  4OJB A;  3UVV A;  1HJ1 A;  5DRM A;  1PK5 A;  1RJK A;  3O1D A;  2YAT A;  3L3Z A;  4RWV A;  4WHF A;  4PVU A;  1ERR A;  2QE4 A;  1T63 A;  3OSW A;  4J26 A;  2PKL A;  1FCX A;  5G44 A;  2I4Z A;  2ZMJ A;  2PIX A;  5DU5 A;  1GS4 A;  3HLV A;  5L7G A;  1M2Z A;  5DK9 A;  3ADV A;  5G5W A;  5ICK A;  3VT4 A;  5KD9 A;  2OUZ A;  4XLD A;  3G8I A;  1XVP B;  5F9B A;  3D24 A;  4IQR A;  4IA3 A;  2GTK A;  3AN3 A;  3CJW A;  1ZDU A;  2ZY0 A;  3DCT A;  5DUH A;  3B0Q A;  1S9P A;  3ERD A;  3VHV A;  2G44 A;  3UUD A;  2ZK3 A;  3R29 A;  1OSV A;  3KMZ A;  1T7T A;  2HWQ A;  2OZ7 A;  3VT7 A;  5AAV A;  4PPS A;  5DX3 A;  2VV4 B;  1ZEO A;  5DID A;  1NYX A;  5KRC A;  5HJP B;  4ZN7 A;  2AA5 A;  2ATH A;  5KRO A;  3RY9 A;  3VJI A;  1MV9 A;  1RKG A;  1ZKY A;  2JF9 A;  2O4R A;  3K22 A;  1XJ7 A;  3JZC A;  4J5W A;  2VV1 A;  4WHG A;  5EHJ A;  5DL4 A;  5AVI A;  2LBD A;  1KV6 A;  4NY9 A;  5KCW A;  2AX6 A;  3ZRB A;  3IXP A;  2VV0 A;  4OEY A;  4A4W A;  1S9Q A;  4MG9 B;  4MGA B;  5DI7 A;  2GWX A;  2W8Y A;  2ZK0 A;  3ADT A;  4IUI A;  2QSE A;  2ZK4 A;  3ZRA A;  4RME A;  1R5K A;  5JI0 D;  2ZK6 A;  1QKM A;  3GWS X;  3AUQ A;  3DZY D;  4XUM A;  3OKI A;  3DCU A;  3PO9 A;  4FHH A;  2E2R A;  3FEJ A;  5FQT A;  4PP3 A;  4NB6 A;  3CTB A;  1Z95 A;  3LBD A;  2NV7 A;  3E7C A;  3ET2 A;  2AM9 A;  3KMR A;  2AA7 A;  3GWX A;  5DXK A;  5DVV A;  1T7M A;  1X78 A;  2B1Z A;  2JFA B;  1S0Z A;  4OIV A;  1K74 D;  3F5C B;  5C4U A;  2NPA A;  3MNE A;  5JJM A;  2BJ4 A;  1FCZ A;  2HWR A;  5G3J A;  2P7G A;  4OZT E;  3R5M A;  1T7F A;  3ET0 A;  4HLW A;  3VT5 A;  5DVC A;  1N83 A;  3ZQT A;  5ACC A;  1YY4 A;  4OED A;  4UDA A;  4IWF A;  4B7W A;  3AFR A;  3VN2 A;  2FVJ A;  3OAP A;  2I4P A;  1M13 A;  1XIU A;  5APJ A;  2GPP A;  1E3G A;  2OCF A;  4K7A A;  3D90 A;  3RLJ A;  1FM6 A;  2ZKC A;  3CS4 A;  3NSP A;  4JYH A;  3ADX A;  4PF3 A;  1G5Y A;  3HM1 A;  4IWC A;  2ZAS A;  3OMQ A;  3PEQ A;  2QNV A;  1PQ9 A;  1YP0 A;  2QZO B;  4LTW A;  1G1U A;  4MGB B;  2P4Y A;  5DKS A;  1P8D A;  5E15 A;  4ITE A;  3UUC A;  2AMA A;  2XHS A;  2YLY A;  3VRW A;  1A28 A;  4FGY A;  1U9E A;  2GP7 A;  4HEE X;  1R1K D;  5FQR A;  4EMA A;  5HYK A;  3BC5 A;  5KCT A;  2O4J A;  3WFF A;  5G46 A;  2YLO A;  4K4J A;  1L2I A;  2IOG A;  3OSA A;  5HZC A;  1SQN A;  1TXI A;  1GWR A;  4OKX A;  5AYG A;  4OIL A;  1XNN A;  1NAV A;  3VTD A;  1N46 A;  4A4V A;  4FNE A;  1VJB A;  1ILH A;  4TV1 B;  4FN9 A;  3VT3 A;  2AMB A;  3OS8 C;  3TKC A;  1YOW A;  4MG5 A;  2HAS A;  4UDD A;  3JZB A;  3TY0 A;  4ZJW A;  1XV9 A;  2G0G A;  4OGH A;  5E1C A;  5B41 A;  1N4H A;  3P8X A;  2I4J A;  4RUO X;  2PIQ A;  3PCU A;  4PPP A;  5SYZ A;  3GBK A;  3CS8 A;  5CJ6 A;  4OIU A;  2PNU A;  4OZR E;  4REE A;  5I4V A;  3L03 A;  1FM9 A;  4ZNS A;  4OC7 A;  3DT3 A;  3EYB A;  4MG7 B;  2YLQ A;  4IU7 A;  3B1M A;  1UHL B;  3B0R A;  4Q50 A;  1T5Z A;  2PIN A;  2V0V A;  3B0W A;  4G1D A;  4MDD A;  1XDK A;  2HVC A;  4G2H A;  3W0H A;  3KWY A;  3B5R A;  5G42 A;  4E4K A;  2VST A;  4PXM A;  2Q6R A;  2XYJ A;  4MG8 B;  1E3K A;  4XUH A;  4YNK A;  3W0J A;  3OMM A;  3H52 A;  2H79 A;  3VTC A;  2P54 A;  2Q8S A;  4IA2 A;  5KCE A;  4RUJ A;  1YYE A;  3A78 A;  4LNW A;  4J5X C;  5IXK A;  2NW4 A;  4IV4 A;  4N1Y A;  5H1E A;  1U3S A;  3B66 A;  2ZNO A;  5DXQ A;  4IVY A;  4OK1 A;  5C4S A;  2HC4 A;  5DUE A;  4M8H A;  3HC6 A;  3R8I A;  4F9M A;  3RUT A;  2P7Z A;  4OEZ A;  5DIG A;  1FM6 D;  1UOM A;  2AX7 A;  3FLI A;  4QJR A;  2Q7J A;  3CDS A;  4O8F A;  2I0J A;  3A3Z X;  3D6D A;  3AZ3 A;  3FEI A;  3F7D A;  3UUD B;  2Q61 A;  3WGP A;  4R06 A;  5DZ0 A;  3G0W A;  3L1B A;  2R6Y A;  2ZVT A;  3Q95 B;  3KMG A;  4JAZ A;  4JYI A;  1QKN A;  4N5G A;  1Y0X X;  2AAX A;  4G21 A;  5AAV B;  4L96 A;  5DX3 B;  3A2H A;  4DM6 A;  3AZ1 A;  4XT9 A;  3OMP A;  4QK4 A;  3R8D A;  3E00 A;  2HCD A;  2GPO A;  3HQ5 A;  2QA8 A;  2QPY A;  5DXB A;  1I7I A;  2QXM A;  2VV1 B;  3TKM A;  3W5Q A;  4CI5 A;  2ZK2 A;  5EC9 A;  2ZNP A;  3G8O A;  5KRK A;  3W0A A;  2YHD A;  5DVS A;  4KZJ A;  5DRJ A;  4QE8 A;  5DXP A;  2QA6 A;  3E94 A;  3UUA B;  4DQM A;  5DXE A;  2ACL A;  1FM9 D;  2Q1V A;  3ET3 A;  3PRG A;  3P88 A;  5APK A;  1T74 A;  4S14 A;  5DYD A;  5AZT A;  2B23 A;  3OLF A;  4Y29 A;  5FQS A;  4DM8 A;  4ZN9 A;  3OMK A;  1YA3 A;  3B3K A;  4QM0 A;  4TUZ A;  3K8S A;  4WLB A;  5DXM A;  3GN8 A;  3T03 A;  4DOR A;  4ZO1 B;  1RDT A;  3D5F A;  3W0Y A;  2V7C A;  4OZT U;  1T79 A;  4N73 A;  4QE6 A;  4IA7 A;  2BAW A;  2R40 A;  3AUR A;  2VV2 A;  2P7A A;  1I7G A;  1XVP A;  1LBD A;  2Q7I A;  5HJS A;  5DY8 A;  2GL8 A;  3GYU A;  3BQD A;  5AK2 A;  2AX9 A;  3WFG A;  2QAB A;  1U3Q A;  4QL8 A;  4RAK A;  4G20 A;  2OVM A;  1XLS E;  3IA6 A;  3B68 A;  4WVD A;  3ET1 A;  2Q7K A;  1BSX A;  2AA6 A;  2VV4 A;  5G45 A;  3V9V A;  2OVH A;  5EGV A;  1Z5X E;  2HBH A;  5DWJ A;  5C4T A;  5DSH A;  3WWR A;  1XAP A;  5GID A;  4CSJ A;  2ZXN A;  3KPZ A;  5DXR A;  4OLM A;  5L7H A;  3FAL B;  2HAM A;  5FQV A;  1X7B A;  3UP3 A;  3FC6 B;  5A86 A;  2B50 A;  4POJ A;  3L0E A;  1X7J A;  3OZJ A;  4MG6 A;  4OKT A;  3W5R A;  1T76 A;  2IHQ A;  5DUG A;  4OFR A;  5DXG A;  2J7Y A;  2G5O A;  4IVW A;  2J14 A;  2IOK A;  2ZLC A;  3AUN A;  2F4B A;  4BCR A;  4XHD A;  3ERT A;  2PIV A;  4J5W C;  3HZF A;  2AYR A;  1DKF B;  5EI1 A;  3FXV A;  1GWX A;  3ILZ A;  4IV2 A;  4OZR U;  1XV9 B;  3VRT A;  1KNU A;  3W0G A;  3WT7 A;  1SJ0 A;  5AAU A;  1XZX X;  2Z4B A;  4G2I A;  3SP9 A;  3V9T A;  4UDC A;  3OLL A;  4MGD B;  3IXP D;  3OGT A;  1FBY A;  3H0A A;  4R2U A;  3DY6 A;  4DK7 A;  4ZOM A;  3IPS A;  3O1E A;  3CDP A;  2PRG A;  5DWI A;  1KKQ A;  1RDT D;  1RKH A;  4S0S A;  1XDK B;  5DKG A;  4OEA A;  1NHZ A;  5AZV A;  1I38 A;  2Z4J A;  4RUP A;  3VT8 A;  3OMO A;  3R5N A;  2QTU A;  5DZI A;  1XLS A;  3B0T A;  2P15 A;  4ONI A;  1U3R A;  4MGB A;  2QZO A;  3IMY A;  3VJS A;  5DWL A;  4ZI1 A;  4LSJ A;  1PRG A;  2B1V A;  2J7X A;  4ITF A;  3QT0 A;  1I37 A;  1UPW A;  1LV2 A;  3B65 A;  3FS1 A;  3M7R A;  4A2J A;  4XAO A;  5GIC A;  2YLP A;  4ZNW A;  3AX8 A;  4JGV A;  3WJ4 A;  5L7E A;  3UP0 A;  1R20 A;  5KCD A;  5DKE A;  3CS6 A;  1DB1 A;  4WQP A;  3AZ2 A;  3UVV B;  3VTB A;  3DZU A;  3WT5 A;  3IPQ A;  5KCC A;  5LWP A;  1EXA A;  3V49 A;  4WPF A;  4NUF A;  1WM0 X;  5DMC A;  3X31 A;  2Q59 A;  3X1I A;  2ZK5 A;  5DV3 A;  5DYB A;  1XB7 A;  3L0L A;  4J24 A;  5DP0 A;  1RK3 A;  3L0J A;  2QGW A;  5DIE A;  1XNX A;  4YMQ A;  4RMC A;  4OFU A;  4IS8 A;  5E19 A;  4YPQ A;  2FAI A;  3DZY A;  5KRM A;  1YMT A;  2ZNN A;  2ZMI A;  4LNX A;  5IZ0 A;  3V3Q A;  1UHL A;  2HB7 A;  3SZ1 A;  4E2J A;  4ZNT A;  1L2J A;  3V4A A;  1YIN A;  3A9E A;  1PDU A;  5DXB B;  5KYJ A;  3VHW A;  5E0X A;  3TX7 B;  2HFP A;  5DV6 A;  2NXX E;  4KZI A;  5KRF A;  3UU7 A;  3BEJ A;  2QXS A;  4XTA A;  5DMF A;  3RUU A;  5E7V A;  4MG8 A;  4IW6 A;  1K74 A;  1S0X A;  1NQ7 A;  4KZM A;  1OVL A;  2ZLA A;  4DOS A;  2GPU A;  2VV3 A;  3B67 A;  4APU A;  1G50 A;  3LMP A;  1R6G A;  3H0A D;  5APH A;  3IPU A;  2PIP L;  3VI8 A;  1Y0S A;  4TUZ B;  2P1T A;  2ZMH A;  5DZH A;  5ETH A;  1X76 A;  3W5T A;  2O9I A;  1SKX A;  4L98 A;  1OSH A;  2YFE A;  3HVL A;  2XKW A;  3KDT A;  4OJ9 A;  3R8A A;  2ZNQ A;  2POB A;  2POG A;  2Q60 A;  4XI3 A;  4ZNH A;  3WMH A;  4ZJR A;  5KR9 A;  4ZO1 X;  4RFW A;  3CQV A;  1QKT A;  4UDB A;  2ZXM A;  5EJV A;  1PQ6 A;  1Z5X U;  3A2I A;  4IW8 A;  2OAX A;  3W0I A;  5KRI A;  2R6W A;  1OT7 A;  4IA1 A;  1NRL A;  5EIT A;  3Q95 A;  2QR9 A;  4RMD A; 
#chains in the Genus database with same CATH topology
 1R1K A;  1A52 A;  2HB8 A;  2GIU A;  2AX8 A;  5HCV A;  3W5P A;  3KFC A;  5DZ3 A;  1XQ3 A;  5JJM B;  2BJ4 B;  1NAX A;  1R20 D;  1XPC A;  4DMA A;  2P1U A;  3WT6 A;  1Y9R A;  1PQC A;  3GYT A;  2AXA A;  3DZU D;  1EXX A;  1ZAF A;  3GZ9 A;  4M8E A;  1FCY A;  4CI4 A;  1NQ2 A;  5HJP A;  5M96 A;  2ABI A;  2PIW A;  1GWQ A;  3UUA A;  2I0G A;  5DKB A;  3VT9 A;  4PRG A;  2Q7L A;  3OS8 A;  4G1Y A;  4JYG A;  3GD2 A;  2QGT A;  1IE9 A;  1G2N A;  2NXX A;  4EM9 A;  2Q5G A;  4X1F A;  3G9E A;  4MG9 A;  1UPV A;  2ZFX A;  1X7R A;  3L3X A;  4MGA A;  3KDU A;  5AVL A;  5GIE A;  3SP6 A;  2YJA B;  4S15 A;  3VJT A;  4PP5 A;  2Q5S A;  5KRA A;  3MNP A;  4LBD A;  1YJE A;  2OM9 A;  3HOD A;  1ZGY A;  2Q70 A;  3ADU A;  4Q0A C;  5AWJ A;  3VJH A;  2PIU A;  3HC5 A;  3OOK A;  4MGC A;  4PLD A;  3E00 D;  1S19 A;  2VSR A;  5DWE A;  5IAW A;  5JY3 A;  1X7E A;  4RE8 A;  4JL4 A;  3ZR7 A;  2QW4 A;  5L11 A;  5DV8 A;  3VHU A;  1IE8 A;  3A40 X;  4NIE A;  3RLL A;  1TFC A;  3R2A A;  3VSO A;  1Q4X A;  4OH6 A;  3VSP A;  3PBA A;  4R6S A;  3CWD A;  2JFA A;  2H77 A;  3F5C A;  3VRV A;  3VT6 A;  3CLD A;  4OKB A;  1XP1 A;  2AA2 A;  4ZNV A;  4X1G A;  3X36 A;  2ZK1 A;  5DZ1 A;  4Q13 A;  1T7R A;  5DLR A;  3FAL A;  2PJL A;  1MZN A;  4J5X A;  3FC6 A;  2QH6 A;  2HAR A;  4REF A;  1HG4 A;  3V3E A;  2Q6J A;  3P89 A;  2R40 D;  3N00 A;  2AO6 A;  3OSI A;  3RVF A;  2G0H A;  2PIT A;  5KRJ A;  5DTV A;  2PIR A;  3VRU A;  1YIM A;  1ERE A;  3D57 A;  3NSQ A;  3ADW A;  1NDE A;  4RZE A;  5LGA A;  1T65 A;  1YOK A;  2ZXZ A;  5E0W A;  5B5B A;  1P93 A;  4POH A;  5FQP A;  1DKF A;  3U9Q A;  1FD0 A;  2YJD A;  1PCG A;  4PLE A;  3P0U A;  3ADS A;  2FSZ A;  2JJ3 A;  3OZ0 A;  5G43 A;  2Q1H A;  2Q59 B;  2REW A;  2GPV A;  3PLZ A;  2P1V A;  2ZL9 A;  3AN4 A;  3DR1 A;  1NUO A;  2Q6S A;  4TV1 A;  2AB2 A;  3KYT A;  4OAR A;  1NQ1 A;  5KCF A;  3OOF A;  5AWK A;  3X1H A;  4MGD A;  1K4W A;  4OJ4 A;  1XOW A;  1YUC A;  3KBA A;  4S0T A;  3FUG A;  5GT4 A;  5KCU A;  4OKW A;  4N8R A;  3A9E B;  3OKH A;  4PWL A;  3V9Y A;  4RZF A;  2EWP A;  5K13 A;  5C4O A;  1ZH7 A;  3UU7 B;  1XP9 A;  4NQA B;  4MG7 A;  5KRH A;  5E14 A;  4YT1 A;  2AWH A;  3FUR A;  5HYR A;  4FHI A;  1XP6 A;  2QA8 B;  1OVL B;  5KYA A;  4ZNU A;  1ZDT A;  3WJ5 A;  4K6I A;  3WTQ A;  2J4A A;  2XYX A;  1T73 A;  2Q5P A;  2QMV A;  1MVC A;  4G1Z A;  4RZG A;  4P6W A;  3K6P A;  3HO0 A;  3MNO A;  4OHA A;  3OS9 A;  5DWG A;  1SR7 A;  1K7L A;  1ZUC A;  2PIO A;  2A3I A;  2Q3Y A;  2ZBS A;  2XYW A;  3NOA A;  4PP6 A;  1XQC A;  5KRL A;  1M7W A;  4OH5 A;  1ILG A;  1H9U A;  2ACL B;  3K23 A;  4E4Q A;  1NQ0 A;  1PZL A;  3A2J A;  4DK8 A;  1QKU A;  4P6X A;  3W0C A;  3S9S A;  3OLS A;  4OJB A;  3UVV A;  1HJ1 A;  5DRM A;  1PK5 A;  1RJK A;  3O1D A;  2YAT A;  3L3Z A;  4RWV A;  4WHF A;  4PVU A;  1ERR A;  2QE4 A;  1T63 A;  3OSW A;  4J26 A;  2PKL A;  1FCX A;  5G44 A;  2I4Z A;  2ZMJ A;  2PIX A;  5DU5 A;  1GS4 A;  3HLV A;  5L7G A;  1M2Z A;  5DK9 A;  3ADV A;  5G5W A;  5ICK A;  3VT4 A;  5KD9 A;  2OUZ A;  4XLD A;  3G8I A;  1XVP B;  5F9B A;  3D24 A;  4IQR A;  4IA3 A;  2GTK A;  3AN3 A;  3CJW A;  1ZDU A;  2ZY0 A;  3DCT A;  5DUH A;  3B0Q A;  1S9P A;  3ERD A;  3VHV A;  2G44 A;  3UUD A;  2ZK3 A;  3R29 A;  1OSV A;  3KMZ A;  1T7T A;  2HWQ A;  2OZ7 A;  3VT7 A;  5AAV A;  4PPS A;  5DX3 A;  2VV4 B;  1ZEO A;  5DID A;  1NYX A;  5KRC A;  5HJP B;  4ZN7 A;  2AA5 A;  2ATH A;  5KRO A;  3RY9 A;  3VJI A;  1MV9 A;  1RKG A;  1ZKY A;  2JF9 A;  2O4R A;  3K22 A;  1XJ7 A;  3JZC A;  4J5W A;  2VV1 A;  4WHG A;  5EHJ A;  5DL4 A;  5AVI A;  2LBD A;  1KV6 A;  4NY9 A;  5KCW A;  2AX6 A;  3ZRB A;  3IXP A;  2VV0 A;  4OEY A;  4A4W A;  1S9Q A;  4MG9 B;  4MGA B;  5DI7 A;  2GWX A;  2W8Y A;  2ZK0 A;  3ADT A;  4IUI A;  2QSE A;  2ZK4 A;  3ZRA A;  4RME A;  1R5K A;  5JI0 D;  2ZK6 A;  1QKM A;  3GWS X;  3AUQ A;  3DZY D;  4XUM A;  3OKI A;  3DCU A;  3PO9 A;  4FHH A;  2E2R A;  3FEJ A;  5FQT A;  4PP3 A;  4NB6 A;  3CTB A;  1Z95 A;  3LBD A;  2NV7 A;  3E7C A;  3ET2 A;  2AM9 A;  3KMR A;  2AA7 A;  3GWX A;  5DXK A;  5DVV A;  1T7M A;  1X78 A;  2B1Z A;  2JFA B;  1S0Z A;  4OIV A;  1K74 D;  3F5C B;  5C4U A;  2NPA A;  3MNE A;  5JJM A;  2BJ4 A;  1FCZ A;  2HWR A;  5G3J A;  2P7G A;  4OZT E;  3R5M A;  1T7F A;  3ET0 A;  4HLW A;  3VT5 A;  5DVC A;  1N83 A;  3ZQT A;  5ACC A;  1YY4 A;  4OED A;  4UDA A;  4IWF A;  4B7W A;  3AFR A;  3VN2 A;  2FVJ A;  3OAP A;  2I4P A;  1M13 A;  1XIU A;  5APJ A;  2GPP A;  1E3G A;  2OCF A;  4K7A A;  3D90 A;  3RLJ A;  1FM6 A;  2ZKC A;  3CS4 A;  3NSP A;  4JYH A;  3ADX A;  4PF3 A;  1G5Y A;  3HM1 A;  4IWC A;  2ZAS A;  3OMQ A;  3PEQ A;  2QNV A;  1PQ9 A;  1YP0 A;  2QZO B;  4LTW A;  1G1U A;  4MGB B;  2P4Y A;  5DKS A;  1P8D A;  5E15 A;  4ITE A;  3UUC A;  2AMA A;  2XHS A;  2YLY A;  3VRW A;  1A28 A;  4FGY A;  1U9E A;  2GP7 A;  4HEE X;  1R1K D;  5FQR A;  4EMA A;  5HYK A;  3BC5 A;  5KCT A;  2O4J A;  3WFF A;  5G46 A;  2YLO A;  4K4J A;  1L2I A;  2IOG A;  3OSA A;  5HZC A;  1SQN A;  1TXI A;  1GWR A;  4OKX A;  5AYG A;  4OIL A;  1XNN A;  1NAV A;  3VTD A;  1N46 A;  4A4V A;  4FNE A;  1VJB A;  1ILH A;  4TV1 B;  4FN9 A;  3VT3 A;  2AMB A;  3OS8 C;  3TKC A;  1YOW A;  4MG5 A;  2HAS A;  4UDD A;  3JZB A;  3TY0 A;  4ZJW A;  1XV9 A;  2G0G A;  4OGH A;  5E1C A;  5B41 A;  1N4H A;  3P8X A;  2I4J A;  4RUO X;  2PIQ A;  3PCU A;  4PPP A;  5SYZ A;  3GBK A;  3CS8 A;  5CJ6 A;  4OIU A;  2PNU A;  4OZR E;  4REE A;  5I4V A;  3L03 A;  1FM9 A;  4ZNS A;  4OC7 A;  3DT3 A;  3EYB A;  4MG7 B;  2YLQ A;  4IU7 A;  3B1M A;  1UHL B;  3B0R A;  4Q50 A;  1T5Z A;  2PIN A;  2V0V A;  3B0W A;  4G1D A;  4MDD A;  1XDK A;  2HVC A;  4G2H A;  3W0H A;  3KWY A;  3B5R A;  5G42 A;  4E4K A;  2VST A;  4PXM A;  2Q6R A;  2XYJ A;  4MG8 B;  1E3K A;  4XUH A;  4YNK A;  3W0J A;  3OMM A;  3H52 A;  2H79 A;  3VTC A;  2P54 A;  2Q8S A;  4IA2 A;  5KCE A;  4RUJ A;  1YYE A;  3A78 A;  4LNW A;  4J5X C;  5IXK A;  2NW4 A;  4IV4 A;  4N1Y A;  5H1E A;  1U3S A;  3B66 A;  2ZNO A;  5DXQ A;  4IVY A;  4OK1 A;  5C4S A;  2HC4 A;  5DUE A;  4M8H A;  3HC6 A;  3R8I A;  4F9M A;  3RUT A;  2P7Z A;  4OEZ A;  5DIG A;  1FM6 D;  1UOM A;  2AX7 A;  3FLI A;  4QJR A;  2Q7J A;  3CDS A;  4O8F A;  2I0J A;  3A3Z X;  3D6D A;  3AZ3 A;  3FEI A;  3F7D A;  3UUD B;  2Q61 A;  3WGP A;  4R06 A;  5DZ0 A;  3G0W A;  3L1B A;  2R6Y A;  2ZVT A;  3Q95 B;  3KMG A;  4JAZ A;  4JYI A;  1QKN A;  4N5G A;  1Y0X X;  2AAX A;  4G21 A;  5AAV B;  4L96 A;  5DX3 B;  3A2H A;  4DM6 A;  3AZ1 A;  4XT9 A;  3OMP A;  4QK4 A;  3R8D A;  3E00 A;  2HCD A;  2GPO A;  3HQ5 A;  2QA8 A;  2QPY A;  5DXB A;  1I7I A;  2QXM A;  2VV1 B;  3TKM A;  3W5Q A;  4CI5 A;  2ZK2 A;  5EC9 A;  2ZNP A;  3G8O A;  5KRK A;  3W0A A;  2YHD A;  5DVS A;  4KZJ A;  5DRJ A;  4QE8 A;  5DXP A;  2QA6 A;  3E94 A;  3UUA B;  4DQM A;  5DXE A;  2ACL A;  1FM9 D;  2Q1V A;  3ET3 A;  3PRG A;  3P88 A;  5APK A;  1T74 A;  4S14 A;  5DYD A;  5AZT A;  2B23 A;  3OLF A;  4Y29 A;  5FQS A;  4DM8 A;  4ZN9 A;  3OMK A;  1YA3 A;  3B3K A;  4QM0 A;  4TUZ A;  3K8S A;  4WLB A;  5DXM A;  3GN8 A;  3T03 A;  4DOR A;  4ZO1 B;  1RDT A;  3D5F A;  3W0Y A;  2V7C A;  4OZT U;  1T79 A;  4N73 A;  4QE6 A;  4IA7 A;  2BAW A;  2R40 A;  3AUR A;  2VV2 A;  2P7A A;  1I7G A;  1XVP A;  1LBD A;  2Q7I A;  5HJS A;  5DY8 A;  2GL8 A;  3GYU A;  3BQD A;  5AK2 A;  2AX9 A;  3WFG A;  2QAB A;  1U3Q A;  4QL8 A;  4RAK A;  4G20 A;  2OVM A;  1XLS E;  3IA6 A;  3B68 A;  4WVD A;  3ET1 A;  2Q7K A;  1BSX A;  2AA6 A;  2VV4 A;  5G45 A;  3V9V A;  2OVH A;  5EGV A;  1Z5X E;  2HBH A;  5DWJ A;  5C4T A;  5DSH A;  3WWR A;  1XAP A;  5GID A;  4CSJ A;  2ZXN A;  3KPZ A;  5DXR A;  4OLM A;  5L7H A;  3FAL B;  2HAM A;  5FQV A;  1X7B A;  3UP3 A;  3FC6 B;  5A86 A;  2B50 A;  4POJ A;  3L0E A;  1X7J A;  3OZJ A;  4MG6 A;  4OKT A;  3W5R A;  1T76 A;  2IHQ A;  5DUG A;  4OFR A;  5DXG A;  2J7Y A;  2G5O A;  4IVW A;  2J14 A;  2IOK A;  2ZLC A;  3AUN A;  2F4B A;  4BCR A;  4XHD A;  3ERT A;  2PIV A;  4J5W C;  3HZF A;  2AYR A;  1DKF B;  5EI1 A;  3FXV A;  1GWX A;  3ILZ A;  4IV2 A;  4OZR U;  1XV9 B;  3VRT A;  1KNU A;  3W0G A;  3WT7 A;  1SJ0 A;  5AAU A;  1XZX X;  2Z4B A;  4G2I A;  3SP9 A;  3V9T A;  4UDC A;  3OLL A;  4MGD B;  3IXP D;  3OGT A;  1FBY A;  3H0A A;  4R2U A;  3DY6 A;  4DK7 A;  4ZOM A;  3IPS A;  3O1E A;  3CDP A;  2PRG A;  5DWI A;  1KKQ A;  1RDT D;  1RKH A;  4S0S A;  1XDK B;  5DKG A;  4OEA A;  1NHZ A;  5AZV A;  1I38 A;  2Z4J A;  4RUP A;  3VT8 A;  3OMO A;  3R5N A;  2QTU A;  5DZI A;  1XLS A;  3B0T A;  2P15 A;  4ONI A;  1U3R A;  4MGB A;  2QZO A;  3IMY A;  3VJS A;  5DWL A;  4ZI1 A;  4LSJ A;  1PRG A;  2B1V A;  2J7X A;  4ITF A;  3QT0 A;  1I37 A;  1UPW A;  1LV2 A;  3B65 A;  3FS1 A;  3M7R A;  4A2J A;  4XAO A;  5GIC A;  2YLP A;  4ZNW A;  3AX8 A;  4JGV A;  3WJ4 A;  5L7E A;  3UP0 A;  1R20 A;  5KCD A;  5DKE A;  3CS6 A;  1DB1 A;  4WQP A;  3AZ2 A;  3UVV B;  3VTB A;  3DZU A;  3WT5 A;  3IPQ A;  5KCC A;  5LWP A;  1EXA A;  3V49 A;  4WPF A;  4NUF A;  1WM0 X;  5DMC A;  3X31 A;  2Q59 A;  3X1I A;  2ZK5 A;  5DV3 A;  5DYB A;  1XB7 A;  3L0L A;  4J24 A;  5DP0 A;  1RK3 A;  3L0J A;  2QGW A;  5DIE A;  1XNX A;  4YMQ A;  4RMC A;  4OFU A;  4IS8 A;  5E19 A;  4YPQ A;  2FAI A;  3DZY A;  5KRM A;  1YMT A;  2ZNN A;  2ZMI A;  4LNX A;  5IZ0 A;  3V3Q A;  1UHL A;  2HB7 A;  3SZ1 A;  4E2J A;  4ZNT A;  1L2J A;  3V4A A;  1YIN A;  3A9E A;  1PDU A;  5DXB B;  5KYJ A;  3VHW A;  5E0X A;  3TX7 B;  2HFP A;  5DV6 A;  2NXX E;  4KZI A;  5KRF A;  3UU7 A;  3BEJ A;  2QXS A;  4XTA A;  5DMF A;  3RUU A;  5E7V A;  4MG8 A;  4IW6 A;  1K74 A;  1S0X A;  1NQ7 A;  4KZM A;  1OVL A;  2ZLA A;  4DOS A;  2GPU A;  2VV3 A;  3B67 A;  4APU A;  1G50 A;  3LMP A;  1R6G A;  3H0A D;  5APH A;  3IPU A;  2PIP L;  3VI8 A;  1Y0S A;  4TUZ B;  2P1T A;  2ZMH A;  5DZH A;  5ETH A;  1X76 A;  3W5T A;  2O9I A;  1SKX A;  4L98 A;  1OSH A;  2YFE A;  3HVL A;  2XKW A;  3KDT A;  4OJ9 A;  3R8A A;  2ZNQ A;  2POB A;  2POG A;  2Q60 A;  4XI3 A;  4ZNH A;  3WMH A;  4ZJR A;  5KR9 A;  4ZO1 X;  4RFW A;  3CQV A;  1QKT A;  4UDB A;  2ZXM A;  5EJV A;  1PQ6 A;  1Z5X U;  3A2I A;  4IW8 A;  2OAX A;  3W0I A;  5KRI A;  2R6W A;  1OT7 A;  4IA1 A;  1NRL A;  5EIT A;  3Q95 A;  2QR9 A;  4RMD A; 
#chains in the Genus database with same CATH homology
 1R1K A;  1A52 A;  2HB8 A;  2GIU A;  2AX8 A;  5HCV A;  3W5P A;  3KFC A;  5DZ3 A;  1XQ3 A;  5JJM B;  2BJ4 B;  1NAX A;  1R20 D;  1XPC A;  4DMA A;  2P1U A;  3WT6 A;  1Y9R A;  1PQC A;  3GYT A;  2AXA A;  3DZU D;  1EXX A;  1ZAF A;  3GZ9 A;  4M8E A;  1FCY A;  4CI4 A;  1NQ2 A;  5HJP A;  5M96 A;  2ABI A;  2PIW A;  1GWQ A;  3UUA A;  2I0G A;  5DKB A;  3VT9 A;  4PRG A;  2Q7L A;  3OS8 A;  4G1Y A;  4JYG A;  3GD2 A;  2QGT A;  1IE9 A;  1G2N A;  2NXX A;  4EM9 A;  2Q5G A;  4X1F A;  3G9E A;  4MG9 A;  1UPV A;  2ZFX A;  1X7R A;  3L3X A;  4MGA A;  3KDU A;  5AVL A;  5GIE A;  3SP6 A;  2YJA B;  4S15 A;  3VJT A;  4PP5 A;  2Q5S A;  5KRA A;  3MNP A;  4LBD A;  1YJE A;  2OM9 A;  3HOD A;  1ZGY A;  2Q70 A;  3ADU A;  4Q0A C;  5AWJ A;  3VJH A;  2PIU A;  3HC5 A;  3OOK A;  4MGC A;  4PLD A;  3E00 D;  1S19 A;  2VSR A;  5DWE A;  5IAW A;  5JY3 A;  1X7E A;  4RE8 A;  4JL4 A;  3ZR7 A;  2QW4 A;  5L11 A;  5DV8 A;  3VHU A;  1IE8 A;  3A40 X;  4NIE A;  3RLL A;  1TFC A;  3R2A A;  3VSO A;  1Q4X A;  4OH6 A;  3VSP A;  3PBA A;  4R6S A;  3CWD A;  2JFA A;  2H77 A;  3F5C A;  3VRV A;  3VT6 A;  3CLD A;  4OKB A;  1XP1 A;  2AA2 A;  4ZNV A;  4X1G A;  3X36 A;  2ZK1 A;  5DZ1 A;  4Q13 A;  1T7R A;  5DLR A;  3FAL A;  2PJL A;  1MZN A;  4J5X A;  3FC6 A;  2QH6 A;  2HAR A;  4REF A;  1HG4 A;  3V3E A;  2Q6J A;  3P89 A;  2R40 D;  3N00 A;  2AO6 A;  3OSI A;  3RVF A;  2G0H A;  2PIT A;  5KRJ A;  5DTV A;  2PIR A;  3VRU A;  1YIM A;  1ERE A;  3D57 A;  3NSQ A;  3ADW A;  1NDE A;  4RZE A;  5LGA A;  1T65 A;  1YOK A;  2ZXZ A;  5E0W A;  5B5B A;  1P93 A;  4POH A;  5FQP A;  1DKF A;  3U9Q A;  1FD0 A;  2YJD A;  1PCG A;  4PLE A;  3P0U A;  3ADS A;  2FSZ A;  2JJ3 A;  3OZ0 A;  5G43 A;  2Q1H A;  2Q59 B;  2REW A;  2GPV A;  3PLZ A;  2P1V A;  2ZL9 A;  3AN4 A;  3DR1 A;  1NUO A;  2Q6S A;  4TV1 A;  2AB2 A;  3KYT A;  4OAR A;  1NQ1 A;  5KCF A;  3OOF A;  5AWK A;  3X1H A;  4MGD A;  1K4W A;  4OJ4 A;  1XOW A;  1YUC A;  3KBA A;  4S0T A;  3FUG A;  5GT4 A;  5KCU A;  4OKW A;  4N8R A;  3A9E B;  3OKH A;  4PWL A;  3V9Y A;  4RZF A;  2EWP A;  5K13 A;  5C4O A;  1ZH7 A;  3UU7 B;  1XP9 A;  4NQA B;  4MG7 A;  5KRH A;  5E14 A;  4YT1 A;  2AWH A;  3FUR A;  5HYR A;  4FHI A;  1XP6 A;  2QA8 B;  1OVL B;  5KYA A;  4ZNU A;  1ZDT A;  3WJ5 A;  4K6I A;  3WTQ A;  2J4A A;  2XYX A;  1T73 A;  2Q5P A;  2QMV A;  1MVC A;  4G1Z A;  4RZG A;  4P6W A;  3K6P A;  3HO0 A;  3MNO A;  4OHA A;  3OS9 A;  5DWG A;  1SR7 A;  1K7L A;  1ZUC A;  2PIO A;  2A3I A;  2Q3Y A;  2ZBS A;  2XYW A;  3NOA A;  4PP6 A;  1XQC A;  5KRL A;  1M7W A;  4OH5 A;  1ILG A;  1H9U A;  2ACL B;  3K23 A;  4E4Q A;  1NQ0 A;  1PZL A;  3A2J A;  4DK8 A;  1QKU A;  4P6X A;  3W0C A;  3S9S A;  3OLS A;  4OJB A;  3UVV A;  1HJ1 A;  5DRM A;  1PK5 A;  1RJK A;  3O1D A;  2YAT A;  3L3Z A;  4RWV A;  4WHF A;  4PVU A;  1ERR A;  2QE4 A;  1T63 A;  3OSW A;  4J26 A;  2PKL A;  1FCX A;  5G44 A;  2I4Z A;  2ZMJ A;  2PIX A;  5DU5 A;  1GS4 A;  3HLV A;  5L7G A;  1M2Z A;  5DK9 A;  3ADV A;  5G5W A;  5ICK A;  3VT4 A;  5KD9 A;  2OUZ A;  4XLD A;  3G8I A;  1XVP B;  5F9B A;  3D24 A;  4IQR A;  4IA3 A;  2GTK A;  3AN3 A;  3CJW A;  1ZDU A;  2ZY0 A;  3DCT A;  5DUH A;  3B0Q A;  1S9P A;  3ERD A;  3VHV A;  2G44 A;  3UUD A;  2ZK3 A;  3R29 A;  1OSV A;  3KMZ A;  1T7T A;  2HWQ A;  2OZ7 A;  3VT7 A;  5AAV A;  4PPS A;  5DX3 A;  2VV4 B;  1ZEO A;  5DID A;  1NYX A;  5KRC A;  5HJP B;  4ZN7 A;  2AA5 A;  2ATH A;  5KRO A;  3RY9 A;  3VJI A;  1MV9 A;  1RKG A;  1ZKY A;  2JF9 A;  2O4R A;  3K22 A;  1XJ7 A;  3JZC A;  4J5W A;  2VV1 A;  4WHG A;  5EHJ A;  5DL4 A;  5AVI A;  2LBD A;  1KV6 A;  4NY9 A;  5KCW A;  2AX6 A;  3ZRB A;  3IXP A;  2VV0 A;  4OEY A;  4A4W A;  1S9Q A;  4MG9 B;  4MGA B;  5DI7 A;  2GWX A;  2W8Y A;  2ZK0 A;  3ADT A;  4IUI A;  2QSE A;  2ZK4 A;  3ZRA A;  4RME A;  1R5K A;  5JI0 D;  2ZK6 A;  1QKM A;  3GWS X;  3AUQ A;  3DZY D;  4XUM A;  3OKI A;  3DCU A;  3PO9 A;  4FHH A;  2E2R A;  3FEJ A;  5FQT A;  4PP3 A;  4NB6 A;  3CTB A;  1Z95 A;  3LBD A;  2NV7 A;  3E7C A;  3ET2 A;  2AM9 A;  3KMR A;  2AA7 A;  3GWX A;  5DXK A;  5DVV A;  1T7M A;  1X78 A;  2B1Z A;  2JFA B;  1S0Z A;  4OIV A;  1K74 D;  3F5C B;  5C4U A;  2NPA A;  3MNE A;  5JJM A;  2BJ4 A;  1FCZ A;  2HWR A;  5G3J A;  2P7G A;  4OZT E;  3R5M A;  1T7F A;  3ET0 A;  4HLW A;  3VT5 A;  5DVC A;  1N83 A;  3ZQT A;  5ACC A;  1YY4 A;  4OED A;  4UDA A;  4IWF A;  4B7W A;  3AFR A;  3VN2 A;  2FVJ A;  3OAP A;  2I4P A;  1M13 A;  1XIU A;  5APJ A;  2GPP A;  1E3G A;  2OCF A;  4K7A A;  3D90 A;  3RLJ A;  1FM6 A;  2ZKC A;  3CS4 A;  3NSP A;  4JYH A;  3ADX A;  4PF3 A;  1G5Y A;  3HM1 A;  4IWC A;  2ZAS A;  3OMQ A;  3PEQ A;  2QNV A;  1PQ9 A;  1YP0 A;  2QZO B;  4LTW A;  1G1U A;  4MGB B;  2P4Y A;  5DKS A;  1P8D A;  5E15 A;  4ITE A;  3UUC A;  2AMA A;  2XHS A;  2YLY A;  3VRW A;  1A28 A;  4FGY A;  1U9E A;  2GP7 A;  4HEE X;  1R1K D;  5FQR A;  4EMA A;  5HYK A;  3BC5 A;  5KCT A;  2O4J A;  3WFF A;  5G46 A;  2YLO A;  4K4J A;  1L2I A;  2IOG A;  3OSA A;  5HZC A;  1SQN A;  1TXI A;  1GWR A;  4OKX A;  5AYG A;  4OIL A;  1XNN A;  1NAV A;  3VTD A;  1N46 A;  4A4V A;  4FNE A;  1VJB A;  1ILH A;  4TV1 B;  4FN9 A;  3VT3 A;  2AMB A;  3OS8 C;  3TKC A;  1YOW A;  4MG5 A;  2HAS A;  4UDD A;  3JZB A;  3TY0 A;  4ZJW A;  1XV9 A;  2G0G A;  4OGH A;  5E1C A;  5B41 A;  1N4H A;  3P8X A;  2I4J A;  4RUO X;  2PIQ A;  3PCU A;  4PPP A;  5SYZ A;  3GBK A;  3CS8 A;  5CJ6 A;  4OIU A;  2PNU A;  4OZR E;  4REE A;  5I4V A;  3L03 A;  1FM9 A;  4ZNS A;  4OC7 A;  3DT3 A;  3EYB A;  4MG7 B;  2YLQ A;  4IU7 A;  3B1M A;  1UHL B;  3B0R A;  4Q50 A;  1T5Z A;  2PIN A;  2V0V A;  3B0W A;  4G1D A;  4MDD A;  1XDK A;  2HVC A;  4G2H A;  3W0H A;  3KWY A;  3B5R A;  5G42 A;  4E4K A;  2VST A;  4PXM A;  2Q6R A;  2XYJ A;  4MG8 B;  1E3K A;  4XUH A;  4YNK A;  3W0J A;  3OMM A;  3H52 A;  2H79 A;  3VTC A;  2P54 A;  2Q8S A;  4IA2 A;  5KCE A;  4RUJ A;  1YYE A;  3A78 A;  4LNW A;  4J5X C;  5IXK A;  2NW4 A;  4IV4 A;  4N1Y A;  5H1E A;  1U3S A;  3B66 A;  2ZNO A;  5DXQ A;  4IVY A;  4OK1 A;  5C4S A;  2HC4 A;  5DUE A;  4M8H A;  3HC6 A;  3R8I A;  4F9M A;  3RUT A;  2P7Z A;  4OEZ A;  5DIG A;  1FM6 D;  1UOM A;  2AX7 A;  3FLI A;  4QJR A;  2Q7J A;  3CDS A;  4O8F A;  2I0J A;  3A3Z X;  3D6D A;  3AZ3 A;  3FEI A;  3F7D A;  3UUD B;  2Q61 A;  3WGP A;  4R06 A;  5DZ0 A;  3G0W A;  3L1B A;  2R6Y A;  2ZVT A;  3Q95 B;  3KMG A;  4JAZ A;  4JYI A;  1QKN A;  4N5G A;  1Y0X X;  2AAX A;  4G21 A;  5AAV B;  4L96 A;  5DX3 B;  3A2H A;  4DM6 A;  3AZ1 A;  4XT9 A;  3OMP A;  4QK4 A;  3R8D A;  3E00 A;  2HCD A;  2GPO A;  3HQ5 A;  2QA8 A;  2QPY A;  5DXB A;  1I7I A;  2QXM A;  2VV1 B;  3TKM A;  3W5Q A;  4CI5 A;  2ZK2 A;  5EC9 A;  2ZNP A;  3G8O A;  5KRK A;  3W0A A;  2YHD A;  5DVS A;  4KZJ A;  5DRJ A;  4QE8 A;  5DXP A;  2QA6 A;  3E94 A;  3UUA B;  4DQM A;  5DXE A;  2ACL A;  1FM9 D;  2Q1V A;  3ET3 A;  3PRG A;  3P88 A;  5APK A;  1T74 A;  4S14 A;  5DYD A;  5AZT A;  2B23 A;  3OLF A;  4Y29 A;  5FQS A;  4DM8 A;  4ZN9 A;  3OMK A;  1YA3 A;  3B3K A;  4QM0 A;  4TUZ A;  3K8S A;  4WLB A;  5DXM A;  3GN8 A;  3T03 A;  4DOR A;  4ZO1 B;  1RDT A;  3D5F A;  3W0Y A;  2V7C A;  4OZT U;  1T79 A;  4N73 A;  4QE6 A;  4IA7 A;  2BAW A;  2R40 A;  3AUR A;  2VV2 A;  2P7A A;  1I7G A;  1XVP A;  1LBD A;  2Q7I A;  5HJS A;  5DY8 A;  2GL8 A;  3GYU A;  3BQD A;  5AK2 A;  2AX9 A;  3WFG A;  2QAB A;  1U3Q A;  4QL8 A;  4RAK A;  4G20 A;  2OVM A;  1XLS E;  3IA6 A;  3B68 A;  4WVD A;  3ET1 A;  2Q7K A;  1BSX A;  2AA6 A;  2VV4 A;  5G45 A;  3V9V A;  2OVH A;  5EGV A;  1Z5X E;  2HBH A;  5DWJ A;  5C4T A;  5DSH A;  3WWR A;  1XAP A;  5GID A;  4CSJ A;  2ZXN A;  3KPZ A;  5DXR A;  4OLM A;  5L7H A;  3FAL B;  2HAM A;  5FQV A;  1X7B A;  3UP3 A;  3FC6 B;  5A86 A;  2B50 A;  4POJ A;  3L0E A;  1X7J A;  3OZJ A;  4MG6 A;  4OKT A;  3W5R A;  1T76 A;  2IHQ A;  5DUG A;  4OFR A;  5DXG A;  2J7Y A;  2G5O A;  4IVW A;  2J14 A;  2IOK A;  2ZLC A;  3AUN A;  2F4B A;  4BCR A;  4XHD A;  3ERT A;  2PIV A;  4J5W C;  3HZF A;  2AYR A;  1DKF B;  5EI1 A;  3FXV A;  1GWX A;  3ILZ A;  4IV2 A;  4OZR U;  1XV9 B;  3VRT A;  1KNU A;  3W0G A;  3WT7 A;  1SJ0 A;  5AAU A;  1XZX X;  2Z4B A;  4G2I A;  3SP9 A;  3V9T A;  4UDC A;  3OLL A;  4MGD B;  3IXP D;  3OGT A;  1FBY A;  3H0A A;  4R2U A;  3DY6 A;  4DK7 A;  4ZOM A;  3IPS A;  3O1E A;  3CDP A;  2PRG A;  5DWI A;  1KKQ A;  1RDT D;  1RKH A;  4S0S A;  1XDK B;  5DKG A;  4OEA A;  1NHZ A;  5AZV A;  1I38 A;  2Z4J A;  4RUP A;  3VT8 A;  3OMO A;  3R5N A;  2QTU A;  5DZI A;  1XLS A;  3B0T A;  2P15 A;  4ONI A;  1U3R A;  4MGB A;  2QZO A;  3IMY A;  3VJS A;  5DWL A;  4ZI1 A;  4LSJ A;  1PRG A;  2B1V A;  2J7X A;  4ITF A;  3QT0 A;  1I37 A;  1UPW A;  1LV2 A;  3B65 A;  3FS1 A;  3M7R A;  4A2J A;  4XAO A;  5GIC A;  2YLP A;  4ZNW A;  3AX8 A;  4JGV A;  3WJ4 A;  5L7E A;  3UP0 A;  1R20 A;  5KCD A;  5DKE A;  3CS6 A;  1DB1 A;  4WQP A;  3AZ2 A;  3UVV B;  3VTB A;  3DZU A;  3WT5 A;  3IPQ A;  5KCC A;  5LWP A;  1EXA A;  3V49 A;  4WPF A;  4NUF A;  1WM0 X;  5DMC A;  3X31 A;  2Q59 A;  3X1I A;  2ZK5 A;  5DV3 A;  5DYB A;  1XB7 A;  3L0L A;  4J24 A;  5DP0 A;  1RK3 A;  3L0J A;  2QGW A;  5DIE A;  1XNX A;  4YMQ A;  4RMC A;  4OFU A;  4IS8 A;  5E19 A;  4YPQ A;  2FAI A;  3DZY A;  5KRM A;  1YMT A;  2ZNN A;  2ZMI A;  4LNX A;  5IZ0 A;  3V3Q A;  1UHL A;  2HB7 A;  3SZ1 A;  4E2J A;  4ZNT A;  1L2J A;  3V4A A;  1YIN A;  3A9E A;  1PDU A;  5DXB B;  5KYJ A;  3VHW A;  5E0X A;  3TX7 B;  2HFP A;  5DV6 A;  2NXX E;  4KZI A;  5KRF A;  3UU7 A;  3BEJ A;  2QXS A;  4XTA A;  5DMF A;  3RUU A;  5E7V A;  4MG8 A;  4IW6 A;  1K74 A;  1S0X A;  1NQ7 A;  4KZM A;  1OVL A;  2ZLA A;  4DOS A;  2GPU A;  2VV3 A;  3B67 A;  4APU A;  1G50 A;  3LMP A;  1R6G A;  3H0A D;  5APH A;  3IPU A;  2PIP L;  3VI8 A;  1Y0S A;  4TUZ B;  2P1T A;  2ZMH A;  5DZH A;  5ETH A;  1X76 A;  3W5T A;  2O9I A;  1SKX A;  4L98 A;  1OSH A;  2YFE A;  3HVL A;  2XKW A;  3KDT A;  4OJ9 A;  3R8A A;  2ZNQ A;  2POB A;  2POG A;  2Q60 A;  4XI3 A;  4ZNH A;  3WMH A;  4ZJR A;  5KR9 A;  4ZO1 X;  4RFW A;  3CQV A;  1QKT A;  4UDB A;  2ZXM A;  5EJV A;  1PQ6 A;  1Z5X U;  3A2I A;  4IW8 A;  2OAX A;  3W0I A;  5KRI A;  2R6W A;  1OT7 A;  4IA1 A;  1NRL A;  5EIT A;  3Q95 A;  2QR9 A;  4RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...