5KRIA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with 16b-benzyl 17b-estradiol
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
234
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 234
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kriA00
5DL4A 3VJSA 3GYTA 3RUTA 5DWEA 4PRGA 2YATA 3D5FA 4MGBB 1L2IA 3R29A 4NQAB 3ET3A 5DZ1A 1GWXA 3CTBA 3D24A 4JAZA 1ZDTA 4ZO1B 2AA2A 2OVMA 1XQ3A 1S19A 2YLPA 4IS8A 5AYGA 1H9UA 4MGBA 5G5WA 3X1HA 4G1YA 3M7RA 4UDCA 5B5BA 5KRJA 2GL8A 4K7AA 4MGDB 2VSTA 3DZYA 3PO9A 2V0VA 1NYXA 3W0JA 2EWPA 2J7XA 4ZNSA 3OGTA 3MNEA 1S0XA 4A4WA 4WPFA 2HFPA 3JZCA 1K7LA 3L3XA 3A2JA 4YPQA 3H52A 1Z95A 1T74A 2ZY0A 3L1BA 3R8DA 2XYJA 5AWKA 5DXRA 2JF9A 2ZBSA 3NSQA 3OZJA 2I0GA 4FNEA 4S14A 1R5KA 5DX3B 3A40X 2I0JA 3K6PA 2ZNOA 3VRWA 4F9MA 1XP6A 5KRCA 4MG9B 5ETHA 1NRLA 5DIDA 5DTVA 4OZRU 2B50A 4EM9A 1ZDUA 2POBA 4OEYA 2QZOB 5FQSA 1M7WA 3G0WA 3IXPD 4OGHA 3AZ2A 1WM0X 3O1DA 5DRMA 1FCXA 1ZAFA 2PIWA 3A78A 3OOFA 3V3EA 1MV9A 3OLFA 2VV3A 3LMPA 2PNUA 4OEDA 4OZTE 2ZK6A 3E94A 5EHJA 3WFFA 4M8HA 2QZOA 3E7CA 4YMQA 4Q13A 4A4VA 3D6DA 2NPAA 4OIUA 2VV4B 5KRLA 3L03A 4ZNHA 3UP3A 3P0UA 3W5RA 3BQDA 2Q61A 5DMFA 1TXIA 4S0TA 4X1GA 2VV4A 5APKA 1Z5XU 3DT3A 5DZHA 4XUMA 3TKMA 5I4VA 3B0TA 4LSJA 4MGAB 1X78A 1N83A 1YOWA 3CLDA 4XTAA 1U9EA 3IPUA 4NB6A 5IAWA 3IPSA 3V3QA 2J7YA 3FS1A 2QMVA 1XDKB 2ZK1A 1PQ9A 4MGAA 4OARA 3U9QA 1QKMA 4CI4A 2PIXA 2XHSA 3OMPA 2B23A 4OJBA 4ONIA 4WLBA 3CS4A 1PDUA 4ZOMA 3AFRA 5KD9A 1PCGA 3AZ3A 3GD2A 2Q59B 2PRGA 3HODA 3VJHA 3F5CB 2QA6A 3VSOA 2P1UA 2HCDA 3UVVB 3A2IA 3IA6A 5C4UA 2Q59A 1S0ZA 1ILHA 1U3QA 3NSPA 5DWGA 3UUAB 3ADUA 5DXKA 4OH6A 5DXGA 5AVIA 5C4OA 3PLZA 1DB1A 2HB8A 2YJDA 4OFRA 3UVVA 4RZFA 3VT7A 3OMOA 4LNWA 3UUAA 4CSJA 1R1KA 5KROA 3DZUD 3W0CA 5DYDA 1N4HA 2ZNPA 3AZ1A 4ZNUA 5DLRA 2W8YA 4KZIA 5JJMA 4J24A 5DVCA 4OKXA 2J4AA 2Q7LA 3WT7A 1X7JA 3W0IA 5DWJA 4QE8A 2AA7A 3L0JA 5EJVA 4WHFA 3ADTA 1I37A 1RDTA 2Q5GA 1FM6A 2AX8A 4OLMA 4RUOX 5EITA 3SP6A 3WFGA 5H1EA 5KRIA 3ADVA 1OSHA 1XV9B 5DWIA 1GWQA 3ET0A 3W5QA 4RMEA 3K23A 1N46A 1YOKA 4J5WC 1MVCA 3HC5A 4JYGA 5C4SA 2G0HA 2ZVTA 2Q8SA 3OLSA 3P88A 1XV9A 2R40D 4MGCA 2YHDA 2OZ7A 4IV2A 4DMAA 3G8IA 3WTQA 1R6GA 4IV4A 2AMBA 3UU7A 4WVDA 1K74D 3CWDA 1PRGA 4OILA 4P6WA 5E19A 4OC7A 2JFAB 2G5OA 4XLDA 5DKEA 2XKWA 4S15A 4YNKA 3GN8A 2AYRA 3MNOA 1MZNA 4FN9A 4ZNWA 3BC5A 3KBAA 1X76A 2JFAA 3OZ0A 4MG6A 2Q1VA 1LBDA 3V9YA 1FD0A 2IOKA 3KPZA 5DU5A 3HLVA 3IPQA 1GS4A 1KNUA 5DXQA 1Y9RA 1KKQA 1FBYA 4NY9A 2AA6A 4LNXA 4ZNTA 2AXAA 1XB7A 3HQ5A 4L98A 2ZK2A 1ZGYA 3BEJA 1SQNA 2ZLAA 4JGVA 4E4KA 3O1EA 4RAKA 2R6WA 2ZXNA 3VHUA 5IZ0A 4TUZB 1XVPA 4IA2A 4UDBA 5JI0D 2YLOA 3HM1A 1P8DA 4N8RA 5B41A 2P7GA 4RE8A 2AX6A 4TUZA 3QT0A 3V9TA 2P7ZA 3B3KA 3IXPA 3VHVA 1R20A 1G5YA 3TKCA 4TV1B 5SYZA 4RWVA 2ZK0A 5DVSA 3T03A 4J5WA 4A2JA 2VV1B 1XJ7A 3ADXA 4TV1A 3VRVA 5KCTA 1HJ1A 4FGYA 2PKLA 3OLLA 4IVYA 4G20A 3JZBA 2ZASA 5G46A 5DSHA 2VV1A 5HZCA 3VT4A 1XLSE 3R2AA 3VT6A 2AB2A 5CJ6A 4R6SA 2OAXA 5APJA 3FEJA 2Q6JA 3VRTA 4G1DA 4RMCA 4P6XA 3VRUA 4DK8A 3X36A 5GT4A 4PVUA 1OT7A 2HARA 4E4QA 1NDEA 4JL4A 5DY8A 2H77A 5E7VA 3OMQA 5DXPA 4OK1A 4UDDA 1LV2A 5DMCA 3ET2A 3TX7B 2POGA 3FEIA 5HJSA 3FLIA 1Y0XX 4JYHA 1XP9A 5ICKA 1UPVA 4DOSA 1ZH7A 2GPVA 4PLDA 5GIEA 1YP0A 3PRGA 4MDDA 3KWYA 2IOGA 4E2JA 4X1FA 4RZGA 1SKXA 4G1ZA 3VTBA 5KCUA 1FM9D 2ZK5A 3B68A 3AN3A 4OH5A 4RUJA 1NAXA 4L96A 3W0AA 1YINA 2GPPA 1X7BA 3DZYD 2F4BA 4ZN9A 5L11A 2Q1HA 3OSWA 4NUFA 2GPOA 3OSAA 1G50A 5KCFA 1U3RA 2AMAA 2ZL9A 2PIOA 1IE8A 1X7RA 3VTDA 4PXMA 1XAPA 4HEEX 1T7TA 2O4RA 2OUZA 3WT5A 1RKHA 5KCEA 2NXXE 3WMHA 3OSIA 2HBHA 3D90A 5KCCA 4ZJWA 2ZLCA 4M8EA 3OMMA 4HLWA 5DYBA 2PIRA 4MG5A 3VTCA 4ZN7A 2GWXA 2ABIA 3UUDA 4QJRA 5FQTA 5GIDA 4EMAA 3KYTA 5JJMB 3OS8C 4NIEA 3E00A 4OEAA 4POHA 1T63A 3B1MA 4MG8B 1EREA 1HG4A 3A9EB 2ZXMA 4PPSA 2Q7JA 2QNVA 2E2RA 5AZVA 4N73A 4Q50A 5KYAA 3ZRBA 1SJ0A 5F9BA 5KRMA 3H0AD 3W0GA 4PPPA 3CDSA 2PIPL 3B65A 4MG8A 3A9EA 2ACLB 4ITFA 2O4JA 4IU7A 3L0EA 3W5TA 2Q7KA 4OJ9A 3AURA 2QR9A 4PF3A 2HWQA 3RVFA 2ZK4A 4OIVA 2ACLA 4IQRA 3CS6A 3OMKA 1YIMA 3K22A 1K4WA 4PP3A 4G2IA 3CDPA 5DVVA 3WJ5A 2QSEA 5KRKA 3FUGA 4LTWA 3UU7B 2AX9A 2Q6SA 1Y0SA 3K8SA 3AUQA 1P93A 1PQ6A 3G8OA 2AA5A 3L0LA 4IUIA 4REEA 5EGVA 1YUCA 2I4JA 4R2UA 5DIEA 2YFEA 5HYRA 3KMZA 3R5MA 4DQMA 4ZNVA 1M13A 2Q70A 2O9IA 4G2HA 5DXMA 5E0WA 5AZTA 2VV0A 3GBKA 2HVCA 2ZKCA 4JYIA 5DZ3A 1ERRA 1ZEOA 1R1KD 3CS8A 3R8AA 4OHAA 2I4ZA 3HC6A 3VT9A 4XT9A 3OS8A 4QL8A 4ITEA 3DY6A 3OAPA 5M96A 2P1VA 5G44A 5G45A 5DZ0A 1XVPB 2HASA 5FQPA 1YA3A 1XZXX 2QA8A 4IW6A 5DP0A 2ZK3A 4K6IA 1NHZA 1QKNA 3SP9A 5K13A 5AWJA 3W0HA 3AN4A 2AM9A 2IHQA 2QPYA 2YLQA 1T7RA 3PBAA 3X31A 2QH6A 1RDTD 5DRJA 3ERDA 3OKHA 3ILZA 3WT6A 4IWCA 1YYEA 3V9VA 1G1UA 2A3IA 4XHDA 3B0QA 3R8IA 3KMGA 4ZI1A 4RMDA 2XYWA 4RUPA 5KR9A 1U3SA 2PIVA 5DWLA 2FAIA 5DV6A 3OOKA 4R06A 1UOMA 5L7EA 4KZJA 3VJIA 1E3KA 3ZRAA 2REWA 4YT1A 3V4AA 1M2ZA 2Q60A 5APHA 1I38A 4IW8A 2YLYA 3VI8A 4IWFA 1XNNA 2ZMHA 5EI1A 3LBDA 2BJ4B 2JJ3A 3EYBA 1BSXA 5E1CA 2NV7A 5AAUA 3Q95B 5DKBA 1X7EA 1FM9A 3ADSA 2Q6RA 2BJ4A 1T73A 1DKFB 2G0GA 3Q95A 1XP1A 2QTUA 4FHHA 1EXAA 3KDTA 2Q7IA 3CJWA 4J26A 4OEZA 4MGDA 4WQPA 4IA1A 1DKFA 2QXMA 4LBDA 3HVLA 5A86A 5IXKA 4MG7B 2OM9A 1XIUA 3OS9A 3RY9A 3VT3A 5KRHA 2ZNQA 4B7WA 5KCDA 1ZUCA 3AX8A 3G9EA 4MG7A 4DM6A 5LGAA 2ATHA 1A28A 5DKSA 5G42A 2J14A 3DR1A 3GYUA 4O8FA 5DX3A 3B66A 4S0SA 1SR7A 5DV8A 5LWPA 3A2HA 3ET1A 1R20D 2BAWA 4MG9A 4POJA 4WHGA 3VJTA 3A3ZX 1RKGA 3ZR7A 2QXSA 4BCRA 2QGTA 1XLSA 1YY4A 3DZUA 5KCWA 3P8XA 3MNPA 1XOWA 3P89A 2H79A 1YJEA 3D57A 4PWLA 3WGPA 4XAOA 1IE9A 5KRFA 1QKTA 3H0AA 4QK4A 3S9SA 2PJLA 3B5RA 2V7CA 3FXVA 4XUHA 4ZJRA 3NOAA 2HB7A 5E0XA 4DK7A 3ZQTA 3HO0A 1I7IA 3UUDB 2OCFA 4RZEA 4N1YA 4FHIA 1FCYA 5DV3A 1G2NA 1PK5A 4REFA 4OFUA 3DCTA 5DUGA 2OVHA 3KDUA 3L3ZA 1NQ2A 2ZMJA 3WWRA 5C4TA 5GICA 3AUNA 3PCUA 1OVLB 5AVLA 1VJBA 1T65A 5DK9A 1Q4XA 3GZ9A 3HZFA 4KZMA 4XI3A 4ZO1X 3UUCA 3X1IA 1XDKA 2ZNNA 2VSRA 2R40A 4N5GA 3GWSX 1OVLA 1GWRA 4DM8A 2ZMIA 4J5XC 2PITA 2FSZA 1FCZA 5FQRA 3FC6B 2FVJA 2P54A 3GWXA 5AAVB 3ADWA 3DCUA 4K4JA 3FALB 4QM0A 1K74A 4OJ4A 2Q3YA 2PINA 3KMRA 4OKBA 3B67A 2GPUA 3F5CA 1OSVA 3FC6A 5AAVA 1PZLA 3IMYA 5DKGA 5AK2A 2PIUA 3FALA 4OKTA 5DIGA 5DXEA 3OKIA 5G43A 3W5PA 1PQCA 1XPCA 5DZIA 1I7GA 2AO6A 3N00A 1T76A 5DUEA 4IA3A 1T79A 2GP7A 2NXXA 3VSPA 4OKWA 1XQCA 5DXBB 5FQVA 2P1TA 1T7MA 3RUUA 3V49A 4PP5A 2PIQA 3CQVA 2QE4A 5DXBA 5HCVA 1A52A 1S9QA 5EC9A 4CI5A 2R6YA 1NUOA 4RFWA 2QABA 2QGWA 1L2JA 2AX7A 2LBDA 2Q5PA 3KFCA 2B1ZA 1KV6A 2B1VA 5G3JA 4OZRE 2Q5SA 1QKUA 4OZTU 3VT5A 4APUA 1RJKA 1S9PA 3RLJA 3TY0A 3E00D 1RK3A 2Z4BA 1NQ0A 3F7DA 1ZKYA 3PEQA 3SZ1A 2QA8B 3VT8A 2HC4A 5KRAA 1YMTA 2P7AA 2HAMA 3VHWA 1E3GA 2AWHA 1TFCA 2NW4A 2ZXZA 5DUHA 5E14A 2VV2A 2Z4JA 1EXXA 4UDAA 5DI7A 5E15A 4J5XA 1ILGA 3B0WA 1UHLB 5JY3A 1T7FA 5L7HA 2I4PA 2P4YA 4IVWA 1XNXA 3RLLA 3W0YA 1FM6D 2QW4A 4Q0AC 1Z5XE 2P15A 4G21A 2XYXA 1UHLA 2GTKA 1T5ZA 3UP0A 5HJPB 1NQ7A 3B0RA 3ERTA 2HWRA 1NQ1A 4IA7A 5KYJA 1NAVA 3FURA 2G44A 5L7GA 5HYKA 2ZFXA 2GIUA 2YJAB 3R5NA 4Y29A 5HJPA 1UPWA 4QE6A 3VN2A 4PP6A 4DORA 5ACCA 3WJ4A 2AAXA 4PLEA
chains in the Genus database with same CATH superfamily
5DL4A 3VJSA 3GYTA 3RUTA 5DWEA 4PRGA 2YATA 3D5FA 4MGBB 1L2IA 3R29A 4NQAB 3ET3A 5DZ1A 1GWXA 3CTBA 3D24A 4JAZA 1ZDTA 4ZO1B 2AA2A 2OVMA 1XQ3A 1S19A 2YLPA 4IS8A 5AYGA 1H9UA 4MGBA 5G5WA 3X1HA 4G1YA 3M7RA 4UDCA 5B5BA 5KRJA 2GL8A 4K7AA 4MGDB 2VSTA 3DZYA 3PO9A 2V0VA 1NYXA 3W0JA 2EWPA 2J7XA 4ZNSA 3OGTA 3MNEA 1S0XA 4A4WA 4WPFA 2HFPA 3JZCA 1K7LA 3L3XA 3A2JA 4YPQA 3H52A 1Z95A 1T74A 2ZY0A 3L1BA 3R8DA 2XYJA 5AWKA 5DXRA 2JF9A 2ZBSA 3NSQA 3OZJA 2I0GA 4FNEA 4S14A 1R5KA 5DX3B 3A40X 2I0JA 3K6PA 2ZNOA 3VRWA 4F9MA 1XP6A 5KRCA 4MG9B 5ETHA 1NRLA 5DIDA 5DTVA 4OZRU 2B50A 4EM9A 1ZDUA 2POBA 4OEYA 2QZOB 5FQSA 1M7WA 3G0WA 3IXPD 4OGHA 3AZ2A 1WM0X 3O1DA 5DRMA 1FCXA 1ZAFA 2PIWA 3A78A 3OOFA 3V3EA 1MV9A 3OLFA 2VV3A 3LMPA 2PNUA 4OEDA 4OZTE 2ZK6A 3E94A 5EHJA 3WFFA 4M8HA 2QZOA 3E7CA 4YMQA 4Q13A 4A4VA 3D6DA 2NPAA 4OIUA 2VV4B 5KRLA 3L03A 4ZNHA 3UP3A 3P0UA 3W5RA 3BQDA 2Q61A 5DMFA 1TXIA 4S0TA 4X1GA 2VV4A 5APKA 1Z5XU 3DT3A 5DZHA 4XUMA 3TKMA 5I4VA 3B0TA 4LSJA 4MGAB 1X78A 1N83A 1YOWA 3CLDA 4XTAA 1U9EA 3IPUA 4NB6A 5IAWA 3IPSA 3V3QA 2J7YA 3FS1A 2QMVA 1XDKB 2ZK1A 1PQ9A 4MGAA 4OARA 3U9QA 1QKMA 4CI4A 2PIXA 2XHSA 3OMPA 2B23A 4OJBA 4ONIA 4WLBA 3CS4A 1PDUA 4ZOMA 3AFRA 5KD9A 1PCGA 3AZ3A 3GD2A 2Q59B 2PRGA 3HODA 3VJHA 3F5CB 2QA6A 3VSOA 2P1UA 2HCDA 3UVVB 3A2IA 3IA6A 5C4UA 2Q59A 1S0ZA 1ILHA 1U3QA 3NSPA 5DWGA 3UUAB 3ADUA 5DXKA 4OH6A 5DXGA 5AVIA 5C4OA 3PLZA 1DB1A 2HB8A 2YJDA 4OFRA 3UVVA 4RZFA 3VT7A 3OMOA 4LNWA 3UUAA 4CSJA 1R1KA 5KROA 3DZUD 3W0CA 5DYDA 1N4HA 2ZNPA 3AZ1A 4ZNUA 5DLRA 2W8YA 4KZIA 5JJMA 4J24A 5DVCA 4OKXA 2J4AA 2Q7LA 3WT7A 1X7JA 3W0IA 5DWJA 4QE8A 2AA7A 3L0JA 5EJVA 4WHFA 3ADTA 1I37A 1RDTA 2Q5GA 1FM6A 2AX8A 4OLMA 4RUOX 5EITA 3SP6A 3WFGA 5H1EA 5KRIA 3ADVA 1OSHA 1XV9B 5DWIA 1GWQA 3ET0A 3W5QA 4RMEA 3K23A 1N46A 1YOKA 4J5WC 1MVCA 3HC5A 4JYGA 5C4SA 2G0HA 2ZVTA 2Q8SA 3OLSA 3P88A 1XV9A 2R40D 4MGCA 2YHDA 2OZ7A 4IV2A 4DMAA 3G8IA 3WTQA 1R6GA 4IV4A 2AMBA 3UU7A 4WVDA 1K74D 3CWDA 1PRGA 4OILA 4P6WA 5E19A 4OC7A 2JFAB 2G5OA 4XLDA 5DKEA 2XKWA 4S15A 4YNKA 3GN8A 2AYRA 3MNOA 1MZNA 4FN9A 4ZNWA 3BC5A 3KBAA 1X76A 2JFAA 3OZ0A 4MG6A 2Q1VA 1LBDA 3V9YA 1FD0A 2IOKA 3KPZA 5DU5A 3HLVA 3IPQA 1GS4A 1KNUA 5DXQA 1Y9RA 1KKQA 1FBYA 4NY9A 2AA6A 4LNXA 4ZNTA 2AXAA 1XB7A 3HQ5A 4L98A 2ZK2A 1ZGYA 3BEJA 1SQNA 2ZLAA 4JGVA 4E4KA 3O1EA 4RAKA 2R6WA 2ZXNA 3VHUA 5IZ0A 4TUZB 1XVPA 4IA2A 4UDBA 5JI0D 2YLOA 3HM1A 1P8DA 4N8RA 5B41A 2P7GA 4RE8A 2AX6A 4TUZA 3QT0A 3V9TA 2P7ZA 3B3KA 3IXPA 3VHVA 1R20A 1G5YA 3TKCA 4TV1B 5SYZA 4RWVA 2ZK0A 5DVSA 3T03A 4J5WA 4A2JA 2VV1B 1XJ7A 3ADXA 4TV1A 3VRVA 5KCTA 1HJ1A 4FGYA 2PKLA 3OLLA 4IVYA 4G20A 3JZBA 2ZASA 5G46A 5DSHA 2VV1A 5HZCA 3VT4A 1XLSE 3R2AA 3VT6A 2AB2A 5CJ6A 4R6SA 2OAXA 5APJA 3FEJA 2Q6JA 3VRTA 4G1DA 4RMCA 4P6XA 3VRUA 4DK8A 3X36A 5GT4A 4PVUA 1OT7A 2HARA 4E4QA 1NDEA 4JL4A 5DY8A 2H77A 5E7VA 3OMQA 5DXPA 4OK1A 4UDDA 1LV2A 5DMCA 3ET2A 3TX7B 2POGA 3FEIA 5HJSA 3FLIA 1Y0XX 4JYHA 1XP9A 5ICKA 1UPVA 4DOSA 1ZH7A 2GPVA 4PLDA 5GIEA 1YP0A 3PRGA 4MDDA 3KWYA 2IOGA 4E2JA 4X1FA 4RZGA 1SKXA 4G1ZA 3VTBA 5KCUA 1FM9D 2ZK5A 3B68A 3AN3A 4OH5A 4RUJA 1NAXA 4L96A 3W0AA 1YINA 2GPPA 1X7BA 3DZYD 2F4BA 4ZN9A 5L11A 2Q1HA 3OSWA 4NUFA 2GPOA 3OSAA 1G50A 5KCFA 1U3RA 2AMAA 2ZL9A 2PIOA 1IE8A 1X7RA 3VTDA 4PXMA 1XAPA 4HEEX 1T7TA 2O4RA 2OUZA 3WT5A 1RKHA 5KCEA 2NXXE 3WMHA 3OSIA 2HBHA 3D90A 5KCCA 4ZJWA 2ZLCA 4M8EA 3OMMA 4HLWA 5DYBA 2PIRA 4MG5A 3VTCA 4ZN7A 2GWXA 2ABIA 3UUDA 4QJRA 5FQTA 5GIDA 4EMAA 3KYTA 5JJMB 3OS8C 4NIEA 3E00A 4OEAA 4POHA 1T63A 3B1MA 4MG8B 1EREA 1HG4A 3A9EB 2ZXMA 4PPSA 2Q7JA 2QNVA 2E2RA 5AZVA 4N73A 4Q50A 5KYAA 3ZRBA 1SJ0A 5F9BA 5KRMA 3H0AD 3W0GA 4PPPA 3CDSA 2PIPL 3B65A 4MG8A 3A9EA 2ACLB 4ITFA 2O4JA 4IU7A 3L0EA 3W5TA 2Q7KA 4OJ9A 3AURA 2QR9A 4PF3A 2HWQA 3RVFA 2ZK4A 4OIVA 2ACLA 4IQRA 3CS6A 3OMKA 1YIMA 3K22A 1K4WA 4PP3A 4G2IA 3CDPA 5DVVA 3WJ5A 2QSEA 5KRKA 3FUGA 4LTWA 3UU7B 2AX9A 2Q6SA 1Y0SA 3K8SA 3AUQA 1P93A 1PQ6A 3G8OA 2AA5A 3L0LA 4IUIA 4REEA 5EGVA 1YUCA 2I4JA 4R2UA 5DIEA 2YFEA 5HYRA 3KMZA 3R5MA 4DQMA 4ZNVA 1M13A 2Q70A 2O9IA 4G2HA 5DXMA 5E0WA 5AZTA 2VV0A 3GBKA 2HVCA 2ZKCA 4JYIA 5DZ3A 1ERRA 1ZEOA 1R1KD 3CS8A 3R8AA 4OHAA 2I4ZA 3HC6A 3VT9A 4XT9A 3OS8A 4QL8A 4ITEA 3DY6A 3OAPA 5M96A 2P1VA 5G44A 5G45A 5DZ0A 1XVPB 2HASA 5FQPA 1YA3A 1XZXX 2QA8A 4IW6A 5DP0A 2ZK3A 4K6IA 1NHZA 1QKNA 3SP9A 5K13A 5AWJA 3W0HA 3AN4A 2AM9A 2IHQA 2QPYA 2YLQA 1T7RA 3PBAA 3X31A 2QH6A 1RDTD 5DRJA 3ERDA 3OKHA 3ILZA 3WT6A 4IWCA 1YYEA 3V9VA 1G1UA 2A3IA 4XHDA 3B0QA 3R8IA 3KMGA 4ZI1A 4RMDA 2XYWA 4RUPA 5KR9A 1U3SA 2PIVA 5DWLA 2FAIA 5DV6A 3OOKA 4R06A 1UOMA 5L7EA 4KZJA 3VJIA 1E3KA 3ZRAA 2REWA 4YT1A 3V4AA 1M2ZA 2Q60A 5APHA 1I38A 4IW8A 2YLYA 3VI8A 4IWFA 1XNNA 2ZMHA 5EI1A 3LBDA 2BJ4B 2JJ3A 3EYBA 1BSXA 5E1CA 2NV7A 5AAUA 3Q95B 5DKBA 1X7EA 1FM9A 3ADSA 2Q6RA 2BJ4A 1T73A 1DKFB 2G0GA 3Q95A 1XP1A 2QTUA 4FHHA 1EXAA 3KDTA 2Q7IA 3CJWA 4J26A 4OEZA 4MGDA 4WQPA 4IA1A 1DKFA 2QXMA 4LBDA 3HVLA 5A86A 5IXKA 4MG7B 2OM9A 1XIUA 3OS9A 3RY9A 3VT3A 5KRHA 2ZNQA 4B7WA 5KCDA 1ZUCA 3AX8A 3G9EA 4MG7A 4DM6A 5LGAA 2ATHA 1A28A 5DKSA 5G42A 2J14A 3DR1A 3GYUA 4O8FA 5DX3A 3B66A 4S0SA 1SR7A 5DV8A 5LWPA 3A2HA 3ET1A 1R20D 2BAWA 4MG9A 4POJA 4WHGA 3VJTA 3A3ZX 1RKGA 3ZR7A 2QXSA 4BCRA 2QGTA 1XLSA 1YY4A 3DZUA 5KCWA 3P8XA 3MNPA 1XOWA 3P89A 2H79A 1YJEA 3D57A 4PWLA 3WGPA 4XAOA 1IE9A 5KRFA 1QKTA 3H0AA 4QK4A 3S9SA 2PJLA 3B5RA 2V7CA 3FXVA 4XUHA 4ZJRA 3NOAA 2HB7A 5E0XA 4DK7A 3ZQTA 3HO0A 1I7IA 3UUDB 2OCFA 4RZEA 4N1YA 4FHIA 1FCYA 5DV3A 1G2NA 1PK5A 4REFA 4OFUA 3DCTA 5DUGA 2OVHA 3KDUA 3L3ZA 1NQ2A 2ZMJA 3WWRA 5C4TA 5GICA 3AUNA 3PCUA 1OVLB 5AVLA 1VJBA 1T65A 5DK9A 1Q4XA 3GZ9A 3HZFA 4KZMA 4XI3A 4ZO1X 3UUCA 3X1IA 1XDKA 2ZNNA 2VSRA 2R40A 4N5GA 3GWSX 1OVLA 1GWRA 4DM8A 2ZMIA 4J5XC 2PITA 2FSZA 1FCZA 5FQRA 3FC6B 2FVJA 2P54A 3GWXA 5AAVB 3ADWA 3DCUA 4K4JA 3FALB 4QM0A 1K74A 4OJ4A 2Q3YA 2PINA 3KMRA 4OKBA 3B67A 2GPUA 3F5CA 1OSVA 3FC6A 5AAVA 1PZLA 3IMYA 5DKGA 5AK2A 2PIUA 3FALA 4OKTA 5DIGA 5DXEA 3OKIA 5G43A 3W5PA 1PQCA 1XPCA 5DZIA 1I7GA 2AO6A 3N00A 1T76A 5DUEA 4IA3A 1T79A 2GP7A 2NXXA 3VSPA 4OKWA 1XQCA 5DXBB 5FQVA 2P1TA 1T7MA 3RUUA 3V49A 4PP5A 2PIQA 3CQVA 2QE4A 5DXBA 5HCVA 1A52A 1S9QA 5EC9A 4CI5A 2R6YA 1NUOA 4RFWA 2QABA 2QGWA 1L2JA 2AX7A 2LBDA 2Q5PA 3KFCA 2B1ZA 1KV6A 2B1VA 5G3JA 4OZRE 2Q5SA 1QKUA 4OZTU 3VT5A 4APUA 1RJKA 1S9PA 3RLJA 3TY0A 3E00D 1RK3A 2Z4BA 1NQ0A 3F7DA 1ZKYA 3PEQA 3SZ1A 2QA8B 3VT8A 2HC4A 5KRAA 1YMTA 2P7AA 2HAMA 3VHWA 1E3GA 2AWHA 1TFCA 2NW4A 2ZXZA 5DUHA 5E14A 2VV2A 2Z4JA 1EXXA 4UDAA 5DI7A 5E15A 4J5XA 1ILGA 3B0WA 1UHLB 5JY3A 1T7FA 5L7HA 2I4PA 2P4YA 4IVWA 1XNXA 3RLLA 3W0YA 1FM6D 2QW4A 4Q0AC 1Z5XE 2P15A 4G21A 2XYXA 1UHLA 2GTKA 1T5ZA 3UP0A 5HJPB 1NQ7A 3B0RA 3ERTA 2HWRA 1NQ1A 4IA7A 5KYJA 1NAVA 3FURA 2G44A 5L7GA 5HYKA 2ZFXA 2GIUA 2YJAB 3R5NA 4Y29A 5HJPA 1UPWA 4QE6A 3VN2A 4PP6A 4DORA 5ACCA 3WJ4A 2AAXA 4PLEA
chains in the Genus database with same CATH topology
5DL4A 3VJSA 3GYTA 3RUTA 5DWEA 4PRGA 2YATA 3D5FA 4MGBB 1L2IA 3R29A 4NQAB 3ET3A 5DZ1A 1GWXA 3CTBA 3D24A 4JAZA 1ZDTA 4ZO1B 2AA2A 2OVMA 1XQ3A 1S19A 2YLPA 4IS8A 5AYGA 1H9UA 4MGBA 5G5WA 3X1HA 4G1YA 3M7RA 4UDCA 5B5BA 5KRJA 2GL8A 4K7AA 4MGDB 2VSTA 3DZYA 3PO9A 2V0VA 1NYXA 3W0JA 2EWPA 2J7XA 4ZNSA 3OGTA 3MNEA 1S0XA 4A4WA 4WPFA 2HFPA 3JZCA 1K7LA 3L3XA 3A2JA 4YPQA 3H52A 1Z95A 1T74A 2ZY0A 3L1BA 3R8DA 2XYJA 5AWKA 5DXRA 2JF9A 2ZBSA 3NSQA 3OZJA 2I0GA 4FNEA 4S14A 1R5KA 5DX3B 3A40X 2I0JA 3K6PA 2ZNOA 3VRWA 4F9MA 1XP6A 5KRCA 4MG9B 5ETHA 1NRLA 5DIDA 5DTVA 4OZRU 2B50A 4EM9A 1ZDUA 2POBA 4OEYA 2QZOB 5FQSA 1M7WA 3G0WA 3IXPD 4OGHA 3AZ2A 1WM0X 3O1DA 5DRMA 1FCXA 1ZAFA 2PIWA 3A78A 3OOFA 3V3EA 1MV9A 3OLFA 2VV3A 3LMPA 2PNUA 4OEDA 4OZTE 2ZK6A 3E94A 5EHJA 3WFFA 4M8HA 2QZOA 3E7CA 4YMQA 4Q13A 4A4VA 3D6DA 2NPAA 4OIUA 2VV4B 5KRLA 3L03A 4ZNHA 3UP3A 3P0UA 3W5RA 3BQDA 2Q61A 5DMFA 1TXIA 4S0TA 4X1GA 2VV4A 5APKA 1Z5XU 3DT3A 5DZHA 4XUMA 3TKMA 5I4VA 3B0TA 4LSJA 4MGAB 1X78A 1N83A 1YOWA 3CLDA 4XTAA 1U9EA 3IPUA 4NB6A 5IAWA 3IPSA 3V3QA 2J7YA 3FS1A 2QMVA 1XDKB 2ZK1A 1PQ9A 4MGAA 4OARA 3U9QA 1QKMA 4CI4A 2PIXA 2XHSA 3OMPA 2B23A 4OJBA 4ONIA 4WLBA 3CS4A 1PDUA 4ZOMA 3AFRA 5KD9A 1PCGA 3AZ3A 3GD2A 2Q59B 2PRGA 3HODA 3VJHA 3F5CB 2QA6A 3VSOA 2P1UA 2HCDA 3UVVB 3A2IA 3IA6A 5C4UA 2Q59A 1S0ZA 1ILHA 1U3QA 3NSPA 5DWGA 3UUAB 3ADUA 5DXKA 4OH6A 5DXGA 5AVIA 5C4OA 3PLZA 1DB1A 2HB8A 2YJDA 4OFRA 3UVVA 4RZFA 3VT7A 3OMOA 4LNWA 3UUAA 4CSJA 1R1KA 5KROA 3DZUD 3W0CA 5DYDA 1N4HA 2ZNPA 3AZ1A 4ZNUA 5DLRA 2W8YA 4KZIA 5JJMA 4J24A 5DVCA 4OKXA 2J4AA 2Q7LA 3WT7A 1X7JA 3W0IA 5DWJA 4QE8A 2AA7A 3L0JA 5EJVA 4WHFA 3ADTA 1I37A 1RDTA 2Q5GA 1FM6A 2AX8A 4OLMA 4RUOX 5EITA 3SP6A 3WFGA 5H1EA 5KRIA 3ADVA 1OSHA 1XV9B 5DWIA 1GWQA 3ET0A 3W5QA 4RMEA 3K23A 1N46A 1YOKA 4J5WC 1MVCA 3HC5A 4JYGA 5C4SA 2G0HA 2ZVTA 2Q8SA 3OLSA 3P88A 1XV9A 2R40D 4MGCA 2YHDA 2OZ7A 4IV2A 4DMAA 3G8IA 3WTQA 1R6GA 4IV4A 2AMBA 3UU7A 4WVDA 1K74D 3CWDA 1PRGA 4OILA 4P6WA 5E19A 4OC7A 2JFAB 2G5OA 4XLDA 5DKEA 2XKWA 4S15A 4YNKA 3GN8A 2AYRA 3MNOA 1MZNA 4FN9A 4ZNWA 3BC5A 3KBAA 1X76A 2JFAA 3OZ0A 4MG6A 2Q1VA 1LBDA 3V9YA 1FD0A 2IOKA 3KPZA 5DU5A 3HLVA 3IPQA 1GS4A 1KNUA 5DXQA 1Y9RA 1KKQA 1FBYA 4NY9A 2AA6A 4LNXA 4ZNTA 2AXAA 1XB7A 3HQ5A 4L98A 2ZK2A 1ZGYA 3BEJA 1SQNA 2ZLAA 4JGVA 4E4KA 3O1EA 4RAKA 2R6WA 2ZXNA 3VHUA 5IZ0A 4TUZB 1XVPA 4IA2A 4UDBA 5JI0D 2YLOA 3HM1A 1P8DA 4N8RA 5B41A 2P7GA 4RE8A 2AX6A 4TUZA 3QT0A 3V9TA 2P7ZA 3B3KA 3IXPA 3VHVA 1R20A 1G5YA 3TKCA 4TV1B 5SYZA 4RWVA 2ZK0A 5DVSA 3T03A 4J5WA 4A2JA 2VV1B 1XJ7A 3ADXA 4TV1A 3VRVA 5KCTA 1HJ1A 4FGYA 2PKLA 3OLLA 4IVYA 4G20A 3JZBA 2ZASA 5G46A 5DSHA 2VV1A 5HZCA 3VT4A 1XLSE 3R2AA 3VT6A 2AB2A 5CJ6A 4R6SA 2OAXA 5APJA 3FEJA 2Q6JA 3VRTA 4G1DA 4RMCA 4P6XA 3VRUA 4DK8A 3X36A 5GT4A 4PVUA 1OT7A 2HARA 4E4QA 1NDEA 4JL4A 5DY8A 2H77A 5E7VA 3OMQA 5DXPA 4OK1A 4UDDA 1LV2A 5DMCA 3ET2A 3TX7B 2POGA 3FEIA 5HJSA 3FLIA 1Y0XX 4JYHA 1XP9A 5ICKA 1UPVA 4DOSA 1ZH7A 2GPVA 4PLDA 5GIEA 1YP0A 3PRGA 4MDDA 3KWYA 2IOGA 4E2JA 4X1FA 4RZGA 1SKXA 4G1ZA 3VTBA 5KCUA 1FM9D 2ZK5A 3B68A 3AN3A 4OH5A 4RUJA 1NAXA 4L96A 3W0AA 1YINA 2GPPA 1X7BA 3DZYD 2F4BA 4ZN9A 5L11A 2Q1HA 3OSWA 4NUFA 2GPOA 3OSAA 1G50A 5KCFA 1U3RA 2AMAA 2ZL9A 2PIOA 1IE8A 1X7RA 3VTDA 4PXMA 1XAPA 4HEEX 1T7TA 2O4RA 2OUZA 3WT5A 1RKHA 5KCEA 2NXXE 3WMHA 3OSIA 2HBHA 3D90A 5KCCA 4ZJWA 2ZLCA 4M8EA 3OMMA 4HLWA 5DYBA 2PIRA 4MG5A 3VTCA 4ZN7A 2GWXA 2ABIA 3UUDA 4QJRA 5FQTA 5GIDA 4EMAA 3KYTA 5JJMB 3OS8C 4NIEA 3E00A 4OEAA 4POHA 1T63A 3B1MA 4MG8B 1EREA 1HG4A 3A9EB 2ZXMA 4PPSA 2Q7JA 2QNVA 2E2RA 5AZVA 4N73A 4Q50A 5KYAA 3ZRBA 1SJ0A 5F9BA 5KRMA 3H0AD 3W0GA 4PPPA 3CDSA 2PIPL 3B65A 4MG8A 3A9EA 2ACLB 4ITFA 2O4JA 4IU7A 3L0EA 3W5TA 2Q7KA 4OJ9A 3AURA 2QR9A 4PF3A 2HWQA 3RVFA 2ZK4A 4OIVA 2ACLA 4IQRA 3CS6A 3OMKA 1YIMA 3K22A 1K4WA 4PP3A 4G2IA 3CDPA 5DVVA 3WJ5A 2QSEA 5KRKA 3FUGA 4LTWA 3UU7B 2AX9A 2Q6SA 1Y0SA 3K8SA 3AUQA 1P93A 1PQ6A 3G8OA 2AA5A 3L0LA 4IUIA 4REEA 5EGVA 1YUCA 2I4JA 4R2UA 5DIEA 2YFEA 5HYRA 3KMZA 3R5MA 4DQMA 4ZNVA 1M13A 2Q70A 2O9IA 4G2HA 5DXMA 5E0WA 5AZTA 2VV0A 3GBKA 2HVCA 2ZKCA 4JYIA 5DZ3A 1ERRA 1ZEOA 1R1KD 3CS8A 3R8AA 4OHAA 2I4ZA 3HC6A 3VT9A 4XT9A 3OS8A 4QL8A 4ITEA 3DY6A 3OAPA 5M96A 2P1VA 5G44A 5G45A 5DZ0A 1XVPB 2HASA 5FQPA 1YA3A 1XZXX 2QA8A 4IW6A 5DP0A 2ZK3A 4K6IA 1NHZA 1QKNA 3SP9A 5K13A 5AWJA 3W0HA 3AN4A 2AM9A 2IHQA 2QPYA 2YLQA 1T7RA 3PBAA 3X31A 2QH6A 1RDTD 5DRJA 3ERDA 3OKHA 3ILZA 3WT6A 4IWCA 1YYEA 3V9VA 1G1UA 2A3IA 4XHDA 3B0QA 3R8IA 3KMGA 4ZI1A 4RMDA 2XYWA 4RUPA 5KR9A 1U3SA 2PIVA 5DWLA 2FAIA 5DV6A 3OOKA 4R06A 1UOMA 5L7EA 4KZJA 3VJIA 1E3KA 3ZRAA 2REWA 4YT1A 3V4AA 1M2ZA 2Q60A 5APHA 1I38A 4IW8A 2YLYA 3VI8A 4IWFA 1XNNA 2ZMHA 5EI1A 3LBDA 2BJ4B 2JJ3A 3EYBA 1BSXA 5E1CA 2NV7A 5AAUA 3Q95B 5DKBA 1X7EA 1FM9A 3ADSA 2Q6RA 2BJ4A 1T73A 1DKFB 2G0GA 3Q95A 1XP1A 2QTUA 4FHHA 1EXAA 3KDTA 2Q7IA 3CJWA 4J26A 4OEZA 4MGDA 4WQPA 4IA1A 1DKFA 2QXMA 4LBDA 3HVLA 5A86A 5IXKA 4MG7B 2OM9A 1XIUA 3OS9A 3RY9A 3VT3A 5KRHA 2ZNQA 4B7WA 5KCDA 1ZUCA 3AX8A 3G9EA 4MG7A 4DM6A 5LGAA 2ATHA 1A28A 5DKSA 5G42A 2J14A 3DR1A 3GYUA 4O8FA 5DX3A 3B66A 4S0SA 1SR7A 5DV8A 5LWPA 3A2HA 3ET1A 1R20D 2BAWA 4MG9A 4POJA 4WHGA 3VJTA 3A3ZX 1RKGA 3ZR7A 2QXSA 4BCRA 2QGTA 1XLSA 1YY4A 3DZUA 5KCWA 3P8XA 3MNPA 1XOWA 3P89A 2H79A 1YJEA 3D57A 4PWLA 3WGPA 4XAOA 1IE9A 5KRFA 1QKTA 3H0AA 4QK4A 3S9SA 2PJLA 3B5RA 2V7CA 3FXVA 4XUHA 4ZJRA 3NOAA 2HB7A 5E0XA 4DK7A 3ZQTA 3HO0A 1I7IA 3UUDB 2OCFA 4RZEA 4N1YA 4FHIA 1FCYA 5DV3A 1G2NA 1PK5A 4REFA 4OFUA 3DCTA 5DUGA 2OVHA 3KDUA 3L3ZA 1NQ2A 2ZMJA 3WWRA 5C4TA 5GICA 3AUNA 3PCUA 1OVLB 5AVLA 1VJBA 1T65A 5DK9A 1Q4XA 3GZ9A 3HZFA 4KZMA 4XI3A 4ZO1X 3UUCA 3X1IA 1XDKA 2ZNNA 2VSRA 2R40A 4N5GA 3GWSX 1OVLA 1GWRA 4DM8A 2ZMIA 4J5XC 2PITA 2FSZA 1FCZA 5FQRA 3FC6B 2FVJA 2P54A 3GWXA 5AAVB 3ADWA 3DCUA 4K4JA 3FALB 4QM0A 1K74A 4OJ4A 2Q3YA 2PINA 3KMRA 4OKBA 3B67A 2GPUA 3F5CA 1OSVA 3FC6A 5AAVA 1PZLA 3IMYA 5DKGA 5AK2A 2PIUA 3FALA 4OKTA 5DIGA 5DXEA 3OKIA 5G43A 3W5PA 1PQCA 1XPCA 5DZIA 1I7GA 2AO6A 3N00A 1T76A 5DUEA 4IA3A 1T79A 2GP7A 2NXXA 3VSPA 4OKWA 1XQCA 5DXBB 5FQVA 2P1TA 1T7MA 3RUUA 3V49A 4PP5A 2PIQA 3CQVA 2QE4A 5DXBA 5HCVA 1A52A 1S9QA 5EC9A 4CI5A 2R6YA 1NUOA 4RFWA 2QABA 2QGWA 1L2JA 2AX7A 2LBDA 2Q5PA 3KFCA 2B1ZA 1KV6A 2B1VA 5G3JA 4OZRE 2Q5SA 1QKUA 4OZTU 3VT5A 4APUA 1RJKA 1S9PA 3RLJA 3TY0A 3E00D 1RK3A 2Z4BA 1NQ0A 3F7DA 1ZKYA 3PEQA 3SZ1A 2QA8B 3VT8A 2HC4A 5KRAA 1YMTA 2P7AA 2HAMA 3VHWA 1E3GA 2AWHA 1TFCA 2NW4A 2ZXZA 5DUHA 5E14A 2VV2A 2Z4JA 1EXXA 4UDAA 5DI7A 5E15A 4J5XA 1ILGA 3B0WA 1UHLB 5JY3A 1T7FA 5L7HA 2I4PA 2P4YA 4IVWA 1XNXA 3RLLA 3W0YA 1FM6D 2QW4A 4Q0AC 1Z5XE 2P15A 4G21A 2XYXA 1UHLA 2GTKA 1T5ZA 3UP0A 5HJPB 1NQ7A 3B0RA 3ERTA 2HWRA 1NQ1A 4IA7A 5KYJA 1NAVA 3FURA 2G44A 5L7GA 5HYKA 2ZFXA 2GIUA 2YJAB 3R5NA 4Y29A 5HJPA 1UPWA 4QE6A 3VN2A 4PP6A 4DORA 5ACCA 3WJ4A 2AAXA 4PLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL4 A;  3VJS A;  3GYT A;  3RUT A;  5DWE A;  4PRG A;  2YAT A;  3D5F A;  4MGB B;  1L2I A;  3R29 A;  4NQA B;  3ET3 A;  5DZ1 A;  1GWX A;  3CTB A;  3D24 A;  4JAZ A;  1ZDT A;  4ZO1 B;  2AA2 A;  2OVM A;  1XQ3 A;  1S19 A;  2YLP A;  4IS8 A;  5AYG A;  1H9U A;  4MGB A;  5G5W A;  3X1H A;  4G1Y A;  3M7R A;  4UDC A;  5B5B A;  5KRJ A;  2GL8 A;  4K7A A;  4MGD B;  2VST A;  3DZY A;  3PO9 A;  2V0V A;  1NYX A;  3W0J A;  2EWP A;  2J7X A;  4ZNS A;  3OGT A;  3MNE A;  1S0X A;  4A4W A;  4WPF A;  2HFP A;  3JZC A;  1K7L A;  3L3X A;  3A2J A;  4YPQ A;  3H52 A;  1Z95 A;  1T74 A;  2ZY0 A;  3L1B A;  3R8D A;  2XYJ A;  5AWK A;  5DXR A;  2JF9 A;  2ZBS A;  3NSQ A;  3OZJ A;  2I0G A;  4FNE A;  4S14 A;  1R5K A;  5DX3 B;  3A40 X;  2I0J A;  3K6P A;  2ZNO A;  3VRW A;  4F9M A;  1XP6 A;  5KRC A;  4MG9 B;  5ETH A;  1NRL A;  5DID A;  5DTV A;  4OZR U;  2B50 A;  4EM9 A;  1ZDU A;  2POB A;  4OEY A;  2QZO B;  5FQS A;  1M7W A;  3G0W A;  3IXP D;  4OGH A;  3AZ2 A;  1WM0 X;  3O1D A;  5DRM A;  1FCX A;  1ZAF A;  2PIW A;  3A78 A;  3OOF A;  3V3E A;  1MV9 A;  3OLF A;  2VV3 A;  3LMP A;  2PNU A;  4OED A;  4OZT E;  2ZK6 A;  3E94 A;  5EHJ A;  3WFF A;  4M8H A;  2QZO A;  3E7C A;  4YMQ A;  4Q13 A;  4A4V A;  3D6D A;  2NPA A;  4OIU A;  2VV4 B;  5KRL A;  3L03 A;  4ZNH A;  3UP3 A;  3P0U A;  3W5R A;  3BQD A;  2Q61 A;  5DMF A;  1TXI A;  4S0T A;  4X1G A;  2VV4 A;  5APK A;  1Z5X U;  3DT3 A;  5DZH A;  4XUM A;  3TKM A;  5I4V A;  3B0T A;  4LSJ A;  4MGA B;  1X78 A;  1N83 A;  1YOW A;  3CLD A;  4XTA A;  1U9E A;  3IPU A;  4NB6 A;  5IAW A;  3IPS A;  3V3Q A;  2J7Y A;  3FS1 A;  2QMV A;  1XDK B;  2ZK1 A;  1PQ9 A;  4MGA A;  4OAR A;  3U9Q A;  1QKM A;  4CI4 A;  2PIX A;  2XHS A;  3OMP A;  2B23 A;  4OJB A;  4ONI A;  4WLB A;  3CS4 A;  1PDU A;  4ZOM A;  3AFR A;  5KD9 A;  1PCG A;  3AZ3 A;  3GD2 A;  2Q59 B;  2PRG A;  3HOD A;  3VJH A;  3F5C B;  2QA6 A;  3VSO A;  2P1U A;  2HCD A;  3UVV B;  3A2I A;  3IA6 A;  5C4U A;  2Q59 A;  1S0Z A;  1ILH A;  1U3Q A;  3NSP A;  5DWG A;  3UUA B;  3ADU A;  5DXK A;  4OH6 A;  5DXG A;  5AVI A;  5C4O A;  3PLZ A;  1DB1 A;  2HB8 A;  2YJD A;  4OFR A;  3UVV A;  4RZF A;  3VT7 A;  3OMO A;  4LNW A;  3UUA A;  4CSJ A;  1R1K A;  5KRO A;  3DZU D;  3W0C A;  5DYD A;  1N4H A;  2ZNP A;  3AZ1 A;  4ZNU A;  5DLR A;  2W8Y A;  4KZI A;  5JJM A;  4J24 A;  5DVC A;  4OKX A;  2J4A A;  2Q7L A;  3WT7 A;  1X7J A;  3W0I A;  5DWJ A;  4QE8 A;  2AA7 A;  3L0J A;  5EJV A;  4WHF A;  3ADT A;  1I37 A;  1RDT A;  2Q5G A;  1FM6 A;  2AX8 A;  4OLM A;  4RUO X;  5EIT A;  3SP6 A;  3WFG A;  5H1E A;  5KRI A;  3ADV A;  1OSH A;  1XV9 B;  5DWI A;  1GWQ A;  3ET0 A;  3W5Q A;  4RME A;  3K23 A;  1N46 A;  1YOK A;  4J5W C;  1MVC A;  3HC5 A;  4JYG A;  5C4S A;  2G0H A;  2ZVT A;  2Q8S A;  3OLS A;  3P88 A;  1XV9 A;  2R40 D;  4MGC A;  2YHD A;  2OZ7 A;  4IV2 A;  4DMA A;  3G8I A;  3WTQ A;  1R6G A;  4IV4 A;  2AMB A;  3UU7 A;  4WVD A;  1K74 D;  3CWD A;  1PRG A;  4OIL A;  4P6W A;  5E19 A;  4OC7 A;  2JFA B;  2G5O A;  4XLD A;  5DKE A;  2XKW A;  4S15 A;  4YNK A;  3GN8 A;  2AYR A;  3MNO A;  1MZN A;  4FN9 A;  4ZNW A;  3BC5 A;  3KBA A;  1X76 A;  2JFA A;  3OZ0 A;  4MG6 A;  2Q1V A;  1LBD A;  3V9Y A;  1FD0 A;  2IOK A;  3KPZ A;  5DU5 A;  3HLV A;  3IPQ A;  1GS4 A;  1KNU A;  5DXQ A;  1Y9R A;  1KKQ A;  1FBY A;  4NY9 A;  2AA6 A;  4LNX A;  4ZNT A;  2AXA A;  1XB7 A;  3HQ5 A;  4L98 A;  2ZK2 A;  1ZGY A;  3BEJ A;  1SQN A;  2ZLA A;  4JGV A;  4E4K A;  3O1E A;  4RAK A;  2R6W A;  2ZXN A;  3VHU A;  5IZ0 A;  4TUZ B;  1XVP A;  4IA2 A;  4UDB A;  5JI0 D;  2YLO A;  3HM1 A;  1P8D A;  4N8R A;  5B41 A;  2P7G A;  4RE8 A;  2AX6 A;  4TUZ A;  3QT0 A;  3V9T A;  2P7Z A;  3B3K A;  3IXP A;  3VHV A;  1R20 A;  1G5Y A;  3TKC A;  4TV1 B;  5SYZ A;  4RWV A;  2ZK0 A;  5DVS A;  3T03 A;  4J5W A;  4A2J A;  2VV1 B;  1XJ7 A;  3ADX A;  4TV1 A;  3VRV A;  5KCT A;  1HJ1 A;  4FGY A;  2PKL A;  3OLL A;  4IVY A;  4G20 A;  3JZB A;  2ZAS A;  5G46 A;  5DSH A;  2VV1 A;  5HZC A;  3VT4 A;  1XLS E;  3R2A A;  3VT6 A;  2AB2 A;  5CJ6 A;  4R6S A;  2OAX A;  5APJ A;  3FEJ A;  2Q6J A;  3VRT A;  4G1D A;  4RMC A;  4P6X A;  3VRU A;  4DK8 A;  3X36 A;  5GT4 A;  4PVU A;  1OT7 A;  2HAR A;  4E4Q A;  1NDE A;  4JL4 A;  5DY8 A;  2H77 A;  5E7V A;  3OMQ A;  5DXP A;  4OK1 A;  4UDD A;  1LV2 A;  5DMC A;  3ET2 A;  3TX7 B;  2POG A;  3FEI A;  5HJS A;  3FLI A;  1Y0X X;  4JYH A;  1XP9 A;  5ICK A;  1UPV A;  4DOS A;  1ZH7 A;  2GPV A;  4PLD A;  5GIE A;  1YP0 A;  3PRG A;  4MDD A;  3KWY A;  2IOG A;  4E2J A;  4X1F A;  4RZG A;  1SKX A;  4G1Z A;  3VTB A;  5KCU A;  1FM9 D;  2ZK5 A;  3B68 A;  3AN3 A;  4OH5 A;  4RUJ A;  1NAX A;  4L96 A;  3W0A A;  1YIN A;  2GPP A;  1X7B A;  3DZY D;  2F4B A;  4ZN9 A;  5L11 A;  2Q1H A;  3OSW A;  4NUF A;  2GPO A;  3OSA A;  1G50 A;  5KCF A;  1U3R A;  2AMA A;  2ZL9 A;  2PIO A;  1IE8 A;  1X7R A;  3VTD A;  4PXM A;  1XAP A;  4HEE X;  1T7T A;  2O4R A;  2OUZ A;  3WT5 A;  1RKH A;  5KCE A;  2NXX E;  3WMH A;  3OSI A;  2HBH A;  3D90 A;  5KCC A;  4ZJW A;  2ZLC A;  4M8E A;  3OMM A;  4HLW A;  5DYB A;  2PIR A;  4MG5 A;  3VTC A;  4ZN7 A;  2GWX A;  2ABI A;  3UUD A;  4QJR A;  5FQT A;  5GID A;  4EMA A;  3KYT A;  5JJM B;  3OS8 C;  4NIE A;  3E00 A;  4OEA A;  4POH A;  1T63 A;  3B1M A;  4MG8 B;  1ERE A;  1HG4 A;  3A9E B;  2ZXM A;  4PPS A;  2Q7J A;  2QNV A;  2E2R A;  5AZV A;  4N73 A;  4Q50 A;  5KYA A;  3ZRB A;  1SJ0 A;  5F9B A;  5KRM A;  3H0A D;  3W0G A;  4PPP A;  3CDS A;  2PIP L;  3B65 A;  4MG8 A;  3A9E A;  2ACL B;  4ITF A;  2O4J A;  4IU7 A;  3L0E A;  3W5T A;  2Q7K A;  4OJ9 A;  3AUR A;  2QR9 A;  4PF3 A;  2HWQ A;  3RVF A;  2ZK4 A;  4OIV A;  2ACL A;  4IQR A;  3CS6 A;  3OMK A;  1YIM A;  3K22 A;  1K4W A;  4PP3 A;  4G2I A;  3CDP A;  5DVV A;  3WJ5 A;  2QSE A;  5KRK A;  3FUG A;  4LTW A;  3UU7 B;  2AX9 A;  2Q6S A;  1Y0S A;  3K8S A;  3AUQ A;  1P93 A;  1PQ6 A;  3G8O A;  2AA5 A;  3L0L A;  4IUI A;  4REE A;  5EGV A;  1YUC A;  2I4J A;  4R2U A;  5DIE A;  2YFE A;  5HYR A;  3KMZ A;  3R5M A;  4DQM A;  4ZNV A;  1M13 A;  2Q70 A;  2O9I A;  4G2H A;  5DXM A;  5E0W A;  5AZT A;  2VV0 A;  3GBK A;  2HVC A;  2ZKC A;  4JYI A;  5DZ3 A;  1ERR A;  1ZEO A;  1R1K D;  3CS8 A;  3R8A A;  4OHA A;  2I4Z A;  3HC6 A;  3VT9 A;  4XT9 A;  3OS8 A;  4QL8 A;  4ITE A;  3DY6 A;  3OAP A;  5M96 A;  2P1V A;  5G44 A;  5G45 A;  5DZ0 A;  1XVP B;  2HAS A;  5FQP A;  1YA3 A;  1XZX X;  2QA8 A;  4IW6 A;  5DP0 A;  2ZK3 A;  4K6I A;  1NHZ A;  1QKN A;  3SP9 A;  5K13 A;  5AWJ A;  3W0H A;  3AN4 A;  2AM9 A;  2IHQ A;  2QPY A;  2YLQ A;  1T7R A;  3PBA A;  3X31 A;  2QH6 A;  1RDT D;  5DRJ A;  3ERD A;  3OKH A;  3ILZ A;  3WT6 A;  4IWC A;  1YYE A;  3V9V A;  1G1U A;  2A3I A;  4XHD A;  3B0Q A;  3R8I A;  3KMG A;  4ZI1 A;  4RMD A;  2XYW A;  4RUP A;  5KR9 A;  1U3S A;  2PIV A;  5DWL A;  2FAI A;  5DV6 A;  3OOK A;  4R06 A;  1UOM A;  5L7E A;  4KZJ A;  3VJI A;  1E3K A;  3ZRA A;  2REW A;  4YT1 A;  3V4A A;  1M2Z A;  2Q60 A;  5APH A;  1I38 A;  4IW8 A;  2YLY A;  3VI8 A;  4IWF A;  1XNN A;  2ZMH A;  5EI1 A;  3LBD A;  2BJ4 B;  2JJ3 A;  3EYB A;  1BSX A;  5E1C A;  2NV7 A;  5AAU A;  3Q95 B;  5DKB A;  1X7E A;  1FM9 A;  3ADS A;  2Q6R A;  2BJ4 A;  1T73 A;  1DKF B;  2G0G A;  3Q95 A;  1XP1 A;  2QTU A;  4FHH A;  1EXA A;  3KDT A;  2Q7I A;  3CJW A;  4J26 A;  4OEZ A;  4MGD A;  4WQP A;  4IA1 A;  1DKF A;  2QXM A;  4LBD A;  3HVL A;  5A86 A;  5IXK A;  4MG7 B;  2OM9 A;  1XIU A;  3OS9 A;  3RY9 A;  3VT3 A;  5KRH A;  2ZNQ A;  4B7W A;  5KCD A;  1ZUC A;  3AX8 A;  3G9E A;  4MG7 A;  4DM6 A;  5LGA A;  2ATH A;  1A28 A;  5DKS A;  5G42 A;  2J14 A;  3DR1 A;  3GYU A;  4O8F A;  5DX3 A;  3B66 A;  4S0S A;  1SR7 A;  5DV8 A;  5LWP A;  3A2H A;  3ET1 A;  1R20 D;  2BAW A;  4MG9 A;  4POJ A;  4WHG A;  3VJT A;  3A3Z X;  1RKG A;  3ZR7 A;  2QXS A;  4BCR A;  2QGT A;  1XLS A;  1YY4 A;  3DZU A;  5KCW A;  3P8X A;  3MNP A;  1XOW A;  3P89 A;  2H79 A;  1YJE A;  3D57 A;  4PWL A;  3WGP A;  4XAO A;  1IE9 A;  5KRF A;  1QKT A;  3H0A A;  4QK4 A;  3S9S A;  2PJL A;  3B5R A;  2V7C A;  3FXV A;  4XUH A;  4ZJR A;  3NOA A;  2HB7 A;  5E0X A;  4DK7 A;  3ZQT A;  3HO0 A;  1I7I A;  3UUD B;  2OCF A;  4RZE A;  4N1Y A;  4FHI A;  1FCY A;  5DV3 A;  1G2N A;  1PK5 A;  4REF A;  4OFU A;  3DCT A;  5DUG A;  2OVH A;  3KDU A;  3L3Z A;  1NQ2 A;  2ZMJ A;  3WWR A;  5C4T A;  5GIC A;  3AUN A;  3PCU A;  1OVL B;  5AVL A;  1VJB A;  1T65 A;  5DK9 A;  1Q4X A;  3GZ9 A;  3HZF A;  4KZM A;  4XI3 A;  4ZO1 X;  3UUC A;  3X1I A;  1XDK A;  2ZNN A;  2VSR A;  2R40 A;  4N5G A;  3GWS X;  1OVL A;  1GWR A;  4DM8 A;  2ZMI A;  4J5X C;  2PIT A;  2FSZ A;  1FCZ A;  5FQR A;  3FC6 B;  2FVJ A;  2P54 A;  3GWX A;  5AAV B;  3ADW A;  3DCU A;  4K4J A;  3FAL B;  4QM0 A;  1K74 A;  4OJ4 A;  2Q3Y A;  2PIN A;  3KMR A;  4OKB A;  3B67 A;  2GPU A;  3F5C A;  1OSV A;  3FC6 A;  5AAV A;  1PZL A;  3IMY A;  5DKG A;  5AK2 A;  2PIU A;  3FAL A;  4OKT A;  5DIG A;  5DXE A;  3OKI A;  5G43 A;  3W5P A;  1PQC A;  1XPC A;  5DZI A;  1I7G A;  2AO6 A;  3N00 A;  1T76 A;  5DUE A;  4IA3 A;  1T79 A;  2GP7 A;  2NXX A;  3VSP A;  4OKW A;  1XQC A;  5DXB B;  5FQV A;  2P1T A;  1T7M A;  3RUU A;  3V49 A;  4PP5 A;  2PIQ A;  3CQV A;  2QE4 A;  5DXB A;  5HCV A;  1A52 A;  1S9Q A;  5EC9 A;  4CI5 A;  2R6Y A;  1NUO A;  4RFW A;  2QAB A;  2QGW A;  1L2J A;  2AX7 A;  2LBD A;  2Q5P A;  3KFC A;  2B1Z A;  1KV6 A;  2B1V A;  5G3J A;  4OZR E;  2Q5S A;  1QKU A;  4OZT U;  3VT5 A;  4APU A;  1RJK A;  1S9P A;  3RLJ A;  3TY0 A;  3E00 D;  1RK3 A;  2Z4B A;  1NQ0 A;  3F7D A;  1ZKY A;  3PEQ A;  3SZ1 A;  2QA8 B;  3VT8 A;  2HC4 A;  5KRA A;  1YMT A;  2P7A A;  2HAM A;  3VHW A;  1E3G A;  2AWH A;  1TFC A;  2NW4 A;  2ZXZ A;  5DUH A;  5E14 A;  2VV2 A;  2Z4J A;  1EXX A;  4UDA A;  5DI7 A;  5E15 A;  4J5X A;  1ILG A;  3B0W A;  1UHL B;  5JY3 A;  1T7F A;  5L7H A;  2I4P A;  2P4Y A;  4IVW A;  1XNX A;  3RLL A;  3W0Y A;  1FM6 D;  2QW4 A;  4Q0A C;  1Z5X E;  2P15 A;  4G21 A;  2XYX A;  1UHL A;  2GTK A;  1T5Z A;  3UP0 A;  5HJP B;  1NQ7 A;  3B0R A;  3ERT A;  2HWR A;  1NQ1 A;  4IA7 A;  5KYJ A;  1NAV A;  3FUR A;  2G44 A;  5L7G A;  5HYK A;  2ZFX A;  2GIU A;  2YJA B;  3R5N A;  4Y29 A;  5HJP A;  1UPW A;  4QE6 A;  3VN2 A;  4PP6 A;  4DOR A;  5ACC A;  3WJ4 A;  2AAX A;  4PLE A; 
#chains in the Genus database with same CATH topology
 5DL4 A;  3VJS A;  3GYT A;  3RUT A;  5DWE A;  4PRG A;  2YAT A;  3D5F A;  4MGB B;  1L2I A;  3R29 A;  4NQA B;  3ET3 A;  5DZ1 A;  1GWX A;  3CTB A;  3D24 A;  4JAZ A;  1ZDT A;  4ZO1 B;  2AA2 A;  2OVM A;  1XQ3 A;  1S19 A;  2YLP A;  4IS8 A;  5AYG A;  1H9U A;  4MGB A;  5G5W A;  3X1H A;  4G1Y A;  3M7R A;  4UDC A;  5B5B A;  5KRJ A;  2GL8 A;  4K7A A;  4MGD B;  2VST A;  3DZY A;  3PO9 A;  2V0V A;  1NYX A;  3W0J A;  2EWP A;  2J7X A;  4ZNS A;  3OGT A;  3MNE A;  1S0X A;  4A4W A;  4WPF A;  2HFP A;  3JZC A;  1K7L A;  3L3X A;  3A2J A;  4YPQ A;  3H52 A;  1Z95 A;  1T74 A;  2ZY0 A;  3L1B A;  3R8D A;  2XYJ A;  5AWK A;  5DXR A;  2JF9 A;  2ZBS A;  3NSQ A;  3OZJ A;  2I0G A;  4FNE A;  4S14 A;  1R5K A;  5DX3 B;  3A40 X;  2I0J A;  3K6P A;  2ZNO A;  3VRW A;  4F9M A;  1XP6 A;  5KRC A;  4MG9 B;  5ETH A;  1NRL A;  5DID A;  5DTV A;  4OZR U;  2B50 A;  4EM9 A;  1ZDU A;  2POB A;  4OEY A;  2QZO B;  5FQS A;  1M7W A;  3G0W A;  3IXP D;  4OGH A;  3AZ2 A;  1WM0 X;  3O1D A;  5DRM A;  1FCX A;  1ZAF A;  2PIW A;  3A78 A;  3OOF A;  3V3E A;  1MV9 A;  3OLF A;  2VV3 A;  3LMP A;  2PNU A;  4OED A;  4OZT E;  2ZK6 A;  3E94 A;  5EHJ A;  3WFF A;  4M8H A;  2QZO A;  3E7C A;  4YMQ A;  4Q13 A;  4A4V A;  3D6D A;  2NPA A;  4OIU A;  2VV4 B;  5KRL A;  3L03 A;  4ZNH A;  3UP3 A;  3P0U A;  3W5R A;  3BQD A;  2Q61 A;  5DMF A;  1TXI A;  4S0T A;  4X1G A;  2VV4 A;  5APK A;  1Z5X U;  3DT3 A;  5DZH A;  4XUM A;  3TKM A;  5I4V A;  3B0T A;  4LSJ A;  4MGA B;  1X78 A;  1N83 A;  1YOW A;  3CLD A;  4XTA A;  1U9E A;  3IPU A;  4NB6 A;  5IAW A;  3IPS A;  3V3Q A;  2J7Y A;  3FS1 A;  2QMV A;  1XDK B;  2ZK1 A;  1PQ9 A;  4MGA A;  4OAR A;  3U9Q A;  1QKM A;  4CI4 A;  2PIX A;  2XHS A;  3OMP A;  2B23 A;  4OJB A;  4ONI A;  4WLB A;  3CS4 A;  1PDU A;  4ZOM A;  3AFR A;  5KD9 A;  1PCG A;  3AZ3 A;  3GD2 A;  2Q59 B;  2PRG A;  3HOD A;  3VJH A;  3F5C B;  2QA6 A;  3VSO A;  2P1U A;  2HCD A;  3UVV B;  3A2I A;  3IA6 A;  5C4U A;  2Q59 A;  1S0Z A;  1ILH A;  1U3Q A;  3NSP A;  5DWG A;  3UUA B;  3ADU A;  5DXK A;  4OH6 A;  5DXG A;  5AVI A;  5C4O A;  3PLZ A;  1DB1 A;  2HB8 A;  2YJD A;  4OFR A;  3UVV A;  4RZF A;  3VT7 A;  3OMO A;  4LNW A;  3UUA A;  4CSJ A;  1R1K A;  5KRO A;  3DZU D;  3W0C A;  5DYD A;  1N4H A;  2ZNP A;  3AZ1 A;  4ZNU A;  5DLR A;  2W8Y A;  4KZI A;  5JJM A;  4J24 A;  5DVC A;  4OKX A;  2J4A A;  2Q7L A;  3WT7 A;  1X7J A;  3W0I A;  5DWJ A;  4QE8 A;  2AA7 A;  3L0J A;  5EJV A;  4WHF A;  3ADT A;  1I37 A;  1RDT A;  2Q5G A;  1FM6 A;  2AX8 A;  4OLM A;  4RUO X;  5EIT A;  3SP6 A;  3WFG A;  5H1E A;  5KRI A;  3ADV A;  1OSH A;  1XV9 B;  5DWI A;  1GWQ A;  3ET0 A;  3W5Q A;  4RME A;  3K23 A;  1N46 A;  1YOK A;  4J5W C;  1MVC A;  3HC5 A;  4JYG A;  5C4S A;  2G0H A;  2ZVT A;  2Q8S A;  3OLS A;  3P88 A;  1XV9 A;  2R40 D;  4MGC A;  2YHD A;  2OZ7 A;  4IV2 A;  4DMA A;  3G8I A;  3WTQ A;  1R6G A;  4IV4 A;  2AMB A;  3UU7 A;  4WVD A;  1K74 D;  3CWD A;  1PRG A;  4OIL A;  4P6W A;  5E19 A;  4OC7 A;  2JFA B;  2G5O A;  4XLD A;  5DKE A;  2XKW A;  4S15 A;  4YNK A;  3GN8 A;  2AYR A;  3MNO A;  1MZN A;  4FN9 A;  4ZNW A;  3BC5 A;  3KBA A;  1X76 A;  2JFA A;  3OZ0 A;  4MG6 A;  2Q1V A;  1LBD A;  3V9Y A;  1FD0 A;  2IOK A;  3KPZ A;  5DU5 A;  3HLV A;  3IPQ A;  1GS4 A;  1KNU A;  5DXQ A;  1Y9R A;  1KKQ A;  1FBY A;  4NY9 A;  2AA6 A;  4LNX A;  4ZNT A;  2AXA A;  1XB7 A;  3HQ5 A;  4L98 A;  2ZK2 A;  1ZGY A;  3BEJ A;  1SQN A;  2ZLA A;  4JGV A;  4E4K A;  3O1E A;  4RAK A;  2R6W A;  2ZXN A;  3VHU A;  5IZ0 A;  4TUZ B;  1XVP A;  4IA2 A;  4UDB A;  5JI0 D;  2YLO A;  3HM1 A;  1P8D A;  4N8R A;  5B41 A;  2P7G A;  4RE8 A;  2AX6 A;  4TUZ A;  3QT0 A;  3V9T A;  2P7Z A;  3B3K A;  3IXP A;  3VHV A;  1R20 A;  1G5Y A;  3TKC A;  4TV1 B;  5SYZ A;  4RWV A;  2ZK0 A;  5DVS A;  3T03 A;  4J5W A;  4A2J A;  2VV1 B;  1XJ7 A;  3ADX A;  4TV1 A;  3VRV A;  5KCT A;  1HJ1 A;  4FGY A;  2PKL A;  3OLL A;  4IVY A;  4G20 A;  3JZB A;  2ZAS A;  5G46 A;  5DSH A;  2VV1 A;  5HZC A;  3VT4 A;  1XLS E;  3R2A A;  3VT6 A;  2AB2 A;  5CJ6 A;  4R6S A;  2OAX A;  5APJ A;  3FEJ A;  2Q6J A;  3VRT A;  4G1D A;  4RMC A;  4P6X A;  3VRU A;  4DK8 A;  3X36 A;  5GT4 A;  4PVU A;  1OT7 A;  2HAR A;  4E4Q A;  1NDE A;  4JL4 A;  5DY8 A;  2H77 A;  5E7V A;  3OMQ A;  5DXP A;  4OK1 A;  4UDD A;  1LV2 A;  5DMC A;  3ET2 A;  3TX7 B;  2POG A;  3FEI A;  5HJS A;  3FLI A;  1Y0X X;  4JYH A;  1XP9 A;  5ICK A;  1UPV A;  4DOS A;  1ZH7 A;  2GPV A;  4PLD A;  5GIE A;  1YP0 A;  3PRG A;  4MDD A;  3KWY A;  2IOG A;  4E2J A;  4X1F A;  4RZG A;  1SKX A;  4G1Z A;  3VTB A;  5KCU A;  1FM9 D;  2ZK5 A;  3B68 A;  3AN3 A;  4OH5 A;  4RUJ A;  1NAX A;  4L96 A;  3W0A A;  1YIN A;  2GPP A;  1X7B A;  3DZY D;  2F4B A;  4ZN9 A;  5L11 A;  2Q1H A;  3OSW A;  4NUF A;  2GPO A;  3OSA A;  1G50 A;  5KCF A;  1U3R A;  2AMA A;  2ZL9 A;  2PIO A;  1IE8 A;  1X7R A;  3VTD A;  4PXM A;  1XAP A;  4HEE X;  1T7T A;  2O4R A;  2OUZ A;  3WT5 A;  1RKH A;  5KCE A;  2NXX E;  3WMH A;  3OSI A;  2HBH A;  3D90 A;  5KCC A;  4ZJW A;  2ZLC A;  4M8E A;  3OMM A;  4HLW A;  5DYB A;  2PIR A;  4MG5 A;  3VTC A;  4ZN7 A;  2GWX A;  2ABI A;  3UUD A;  4QJR A;  5FQT A;  5GID A;  4EMA A;  3KYT A;  5JJM B;  3OS8 C;  4NIE A;  3E00 A;  4OEA A;  4POH A;  1T63 A;  3B1M A;  4MG8 B;  1ERE A;  1HG4 A;  3A9E B;  2ZXM A;  4PPS A;  2Q7J A;  2QNV A;  2E2R A;  5AZV A;  4N73 A;  4Q50 A;  5KYA A;  3ZRB A;  1SJ0 A;  5F9B A;  5KRM A;  3H0A D;  3W0G A;  4PPP A;  3CDS A;  2PIP L;  3B65 A;  4MG8 A;  3A9E A;  2ACL B;  4ITF A;  2O4J A;  4IU7 A;  3L0E A;  3W5T A;  2Q7K A;  4OJ9 A;  3AUR A;  2QR9 A;  4PF3 A;  2HWQ A;  3RVF A;  2ZK4 A;  4OIV A;  2ACL A;  4IQR A;  3CS6 A;  3OMK A;  1YIM A;  3K22 A;  1K4W A;  4PP3 A;  4G2I A;  3CDP A;  5DVV A;  3WJ5 A;  2QSE A;  5KRK A;  3FUG A;  4LTW A;  3UU7 B;  2AX9 A;  2Q6S A;  1Y0S A;  3K8S A;  3AUQ A;  1P93 A;  1PQ6 A;  3G8O A;  2AA5 A;  3L0L A;  4IUI A;  4REE A;  5EGV A;  1YUC A;  2I4J A;  4R2U A;  5DIE A;  2YFE A;  5HYR A;  3KMZ A;  3R5M A;  4DQM A;  4ZNV A;  1M13 A;  2Q70 A;  2O9I A;  4G2H A;  5DXM A;  5E0W A;  5AZT A;  2VV0 A;  3GBK A;  2HVC A;  2ZKC A;  4JYI A;  5DZ3 A;  1ERR A;  1ZEO A;  1R1K D;  3CS8 A;  3R8A A;  4OHA A;  2I4Z A;  3HC6 A;  3VT9 A;  4XT9 A;  3OS8 A;  4QL8 A;  4ITE A;  3DY6 A;  3OAP A;  5M96 A;  2P1V A;  5G44 A;  5G45 A;  5DZ0 A;  1XVP B;  2HAS A;  5FQP A;  1YA3 A;  1XZX X;  2QA8 A;  4IW6 A;  5DP0 A;  2ZK3 A;  4K6I A;  1NHZ A;  1QKN A;  3SP9 A;  5K13 A;  5AWJ A;  3W0H A;  3AN4 A;  2AM9 A;  2IHQ A;  2QPY A;  2YLQ A;  1T7R A;  3PBA A;  3X31 A;  2QH6 A;  1RDT D;  5DRJ A;  3ERD A;  3OKH A;  3ILZ A;  3WT6 A;  4IWC A;  1YYE A;  3V9V A;  1G1U A;  2A3I A;  4XHD A;  3B0Q A;  3R8I A;  3KMG A;  4ZI1 A;  4RMD A;  2XYW A;  4RUP A;  5KR9 A;  1U3S A;  2PIV A;  5DWL A;  2FAI A;  5DV6 A;  3OOK A;  4R06 A;  1UOM A;  5L7E A;  4KZJ A;  3VJI A;  1E3K A;  3ZRA A;  2REW A;  4YT1 A;  3V4A A;  1M2Z A;  2Q60 A;  5APH A;  1I38 A;  4IW8 A;  2YLY A;  3VI8 A;  4IWF A;  1XNN A;  2ZMH A;  5EI1 A;  3LBD A;  2BJ4 B;  2JJ3 A;  3EYB A;  1BSX A;  5E1C A;  2NV7 A;  5AAU A;  3Q95 B;  5DKB A;  1X7E A;  1FM9 A;  3ADS A;  2Q6R A;  2BJ4 A;  1T73 A;  1DKF B;  2G0G A;  3Q95 A;  1XP1 A;  2QTU A;  4FHH A;  1EXA A;  3KDT A;  2Q7I A;  3CJW A;  4J26 A;  4OEZ A;  4MGD A;  4WQP A;  4IA1 A;  1DKF A;  2QXM A;  4LBD A;  3HVL A;  5A86 A;  5IXK A;  4MG7 B;  2OM9 A;  1XIU A;  3OS9 A;  3RY9 A;  3VT3 A;  5KRH A;  2ZNQ A;  4B7W A;  5KCD A;  1ZUC A;  3AX8 A;  3G9E A;  4MG7 A;  4DM6 A;  5LGA A;  2ATH A;  1A28 A;  5DKS A;  5G42 A;  2J14 A;  3DR1 A;  3GYU A;  4O8F A;  5DX3 A;  3B66 A;  4S0S A;  1SR7 A;  5DV8 A;  5LWP A;  3A2H A;  3ET1 A;  1R20 D;  2BAW A;  4MG9 A;  4POJ A;  4WHG A;  3VJT A;  3A3Z X;  1RKG A;  3ZR7 A;  2QXS A;  4BCR A;  2QGT A;  1XLS A;  1YY4 A;  3DZU A;  5KCW A;  3P8X A;  3MNP A;  1XOW A;  3P89 A;  2H79 A;  1YJE A;  3D57 A;  4PWL A;  3WGP A;  4XAO A;  1IE9 A;  5KRF A;  1QKT A;  3H0A A;  4QK4 A;  3S9S A;  2PJL A;  3B5R A;  2V7C A;  3FXV A;  4XUH A;  4ZJR A;  3NOA A;  2HB7 A;  5E0X A;  4DK7 A;  3ZQT A;  3HO0 A;  1I7I A;  3UUD B;  2OCF A;  4RZE A;  4N1Y A;  4FHI A;  1FCY A;  5DV3 A;  1G2N A;  1PK5 A;  4REF A;  4OFU A;  3DCT A;  5DUG A;  2OVH A;  3KDU A;  3L3Z A;  1NQ2 A;  2ZMJ A;  3WWR A;  5C4T A;  5GIC A;  3AUN A;  3PCU A;  1OVL B;  5AVL A;  1VJB A;  1T65 A;  5DK9 A;  1Q4X A;  3GZ9 A;  3HZF A;  4KZM A;  4XI3 A;  4ZO1 X;  3UUC A;  3X1I A;  1XDK A;  2ZNN A;  2VSR A;  2R40 A;  4N5G A;  3GWS X;  1OVL A;  1GWR A;  4DM8 A;  2ZMI A;  4J5X C;  2PIT A;  2FSZ A;  1FCZ A;  5FQR A;  3FC6 B;  2FVJ A;  2P54 A;  3GWX A;  5AAV B;  3ADW A;  3DCU A;  4K4J A;  3FAL B;  4QM0 A;  1K74 A;  4OJ4 A;  2Q3Y A;  2PIN A;  3KMR A;  4OKB A;  3B67 A;  2GPU A;  3F5C A;  1OSV A;  3FC6 A;  5AAV A;  1PZL A;  3IMY A;  5DKG A;  5AK2 A;  2PIU A;  3FAL A;  4OKT A;  5DIG A;  5DXE A;  3OKI A;  5G43 A;  3W5P A;  1PQC A;  1XPC A;  5DZI A;  1I7G A;  2AO6 A;  3N00 A;  1T76 A;  5DUE A;  4IA3 A;  1T79 A;  2GP7 A;  2NXX A;  3VSP A;  4OKW A;  1XQC A;  5DXB B;  5FQV A;  2P1T A;  1T7M A;  3RUU A;  3V49 A;  4PP5 A;  2PIQ A;  3CQV A;  2QE4 A;  5DXB A;  5HCV A;  1A52 A;  1S9Q A;  5EC9 A;  4CI5 A;  2R6Y A;  1NUO A;  4RFW A;  2QAB A;  2QGW A;  1L2J A;  2AX7 A;  2LBD A;  2Q5P A;  3KFC A;  2B1Z A;  1KV6 A;  2B1V A;  5G3J A;  4OZR E;  2Q5S A;  1QKU A;  4OZT U;  3VT5 A;  4APU A;  1RJK A;  1S9P A;  3RLJ A;  3TY0 A;  3E00 D;  1RK3 A;  2Z4B A;  1NQ0 A;  3F7D A;  1ZKY A;  3PEQ A;  3SZ1 A;  2QA8 B;  3VT8 A;  2HC4 A;  5KRA A;  1YMT A;  2P7A A;  2HAM A;  3VHW A;  1E3G A;  2AWH A;  1TFC A;  2NW4 A;  2ZXZ A;  5DUH A;  5E14 A;  2VV2 A;  2Z4J A;  1EXX A;  4UDA A;  5DI7 A;  5E15 A;  4J5X A;  1ILG A;  3B0W A;  1UHL B;  5JY3 A;  1T7F A;  5L7H A;  2I4P A;  2P4Y A;  4IVW A;  1XNX A;  3RLL A;  3W0Y A;  1FM6 D;  2QW4 A;  4Q0A C;  1Z5X E;  2P15 A;  4G21 A;  2XYX A;  1UHL A;  2GTK A;  1T5Z A;  3UP0 A;  5HJP B;  1NQ7 A;  3B0R A;  3ERT A;  2HWR A;  1NQ1 A;  4IA7 A;  5KYJ A;  1NAV A;  3FUR A;  2G44 A;  5L7G A;  5HYK A;  2ZFX A;  2GIU A;  2YJA B;  3R5N A;  4Y29 A;  5HJP A;  1UPW A;  4QE6 A;  3VN2 A;  4PP6 A;  4DOR A;  5ACC A;  3WJ4 A;  2AAX A;  4PLE A; 
#chains in the Genus database with same CATH homology
 5DL4 A;  3VJS A;  3GYT A;  3RUT A;  5DWE A;  4PRG A;  2YAT A;  3D5F A;  4MGB B;  1L2I A;  3R29 A;  4NQA B;  3ET3 A;  5DZ1 A;  1GWX A;  3CTB A;  3D24 A;  4JAZ A;  1ZDT A;  4ZO1 B;  2AA2 A;  2OVM A;  1XQ3 A;  1S19 A;  2YLP A;  4IS8 A;  5AYG A;  1H9U A;  4MGB A;  5G5W A;  3X1H A;  4G1Y A;  3M7R A;  4UDC A;  5B5B A;  5KRJ A;  2GL8 A;  4K7A A;  4MGD B;  2VST A;  3DZY A;  3PO9 A;  2V0V A;  1NYX A;  3W0J A;  2EWP A;  2J7X A;  4ZNS A;  3OGT A;  3MNE A;  1S0X A;  4A4W A;  4WPF A;  2HFP A;  3JZC A;  1K7L A;  3L3X A;  3A2J A;  4YPQ A;  3H52 A;  1Z95 A;  1T74 A;  2ZY0 A;  3L1B A;  3R8D A;  2XYJ A;  5AWK A;  5DXR A;  2JF9 A;  2ZBS A;  3NSQ A;  3OZJ A;  2I0G A;  4FNE A;  4S14 A;  1R5K A;  5DX3 B;  3A40 X;  2I0J A;  3K6P A;  2ZNO A;  3VRW A;  4F9M A;  1XP6 A;  5KRC A;  4MG9 B;  5ETH A;  1NRL A;  5DID A;  5DTV A;  4OZR U;  2B50 A;  4EM9 A;  1ZDU A;  2POB A;  4OEY A;  2QZO B;  5FQS A;  1M7W A;  3G0W A;  3IXP D;  4OGH A;  3AZ2 A;  1WM0 X;  3O1D A;  5DRM A;  1FCX A;  1ZAF A;  2PIW A;  3A78 A;  3OOF A;  3V3E A;  1MV9 A;  3OLF A;  2VV3 A;  3LMP A;  2PNU A;  4OED A;  4OZT E;  2ZK6 A;  3E94 A;  5EHJ A;  3WFF A;  4M8H A;  2QZO A;  3E7C A;  4YMQ A;  4Q13 A;  4A4V A;  3D6D A;  2NPA A;  4OIU A;  2VV4 B;  5KRL A;  3L03 A;  4ZNH A;  3UP3 A;  3P0U A;  3W5R A;  3BQD A;  2Q61 A;  5DMF A;  1TXI A;  4S0T A;  4X1G A;  2VV4 A;  5APK A;  1Z5X U;  3DT3 A;  5DZH A;  4XUM A;  3TKM A;  5I4V A;  3B0T A;  4LSJ A;  4MGA B;  1X78 A;  1N83 A;  1YOW A;  3CLD A;  4XTA A;  1U9E A;  3IPU A;  4NB6 A;  5IAW A;  3IPS A;  3V3Q A;  2J7Y A;  3FS1 A;  2QMV A;  1XDK B;  2ZK1 A;  1PQ9 A;  4MGA A;  4OAR A;  3U9Q A;  1QKM A;  4CI4 A;  2PIX A;  2XHS A;  3OMP A;  2B23 A;  4OJB A;  4ONI A;  4WLB A;  3CS4 A;  1PDU A;  4ZOM A;  3AFR A;  5KD9 A;  1PCG A;  3AZ3 A;  3GD2 A;  2Q59 B;  2PRG A;  3HOD A;  3VJH A;  3F5C B;  2QA6 A;  3VSO A;  2P1U A;  2HCD A;  3UVV B;  3A2I A;  3IA6 A;  5C4U A;  2Q59 A;  1S0Z A;  1ILH A;  1U3Q A;  3NSP A;  5DWG A;  3UUA B;  3ADU A;  5DXK A;  4OH6 A;  5DXG A;  5AVI A;  5C4O A;  3PLZ A;  1DB1 A;  2HB8 A;  2YJD A;  4OFR A;  3UVV A;  4RZF A;  3VT7 A;  3OMO A;  4LNW A;  3UUA A;  4CSJ A;  1R1K A;  5KRO A;  3DZU D;  3W0C A;  5DYD A;  1N4H A;  2ZNP A;  3AZ1 A;  4ZNU A;  5DLR A;  2W8Y A;  4KZI A;  5JJM A;  4J24 A;  5DVC A;  4OKX A;  2J4A A;  2Q7L A;  3WT7 A;  1X7J A;  3W0I A;  5DWJ A;  4QE8 A;  2AA7 A;  3L0J A;  5EJV A;  4WHF A;  3ADT A;  1I37 A;  1RDT A;  2Q5G A;  1FM6 A;  2AX8 A;  4OLM A;  4RUO X;  5EIT A;  3SP6 A;  3WFG A;  5H1E A;  5KRI A;  3ADV A;  1OSH A;  1XV9 B;  5DWI A;  1GWQ A;  3ET0 A;  3W5Q A;  4RME A;  3K23 A;  1N46 A;  1YOK A;  4J5W C;  1MVC A;  3HC5 A;  4JYG A;  5C4S A;  2G0H A;  2ZVT A;  2Q8S A;  3OLS A;  3P88 A;  1XV9 A;  2R40 D;  4MGC A;  2YHD A;  2OZ7 A;  4IV2 A;  4DMA A;  3G8I A;  3WTQ A;  1R6G A;  4IV4 A;  2AMB A;  3UU7 A;  4WVD A;  1K74 D;  3CWD A;  1PRG A;  4OIL A;  4P6W A;  5E19 A;  4OC7 A;  2JFA B;  2G5O A;  4XLD A;  5DKE A;  2XKW A;  4S15 A;  4YNK A;  3GN8 A;  2AYR A;  3MNO A;  1MZN A;  4FN9 A;  4ZNW A;  3BC5 A;  3KBA A;  1X76 A;  2JFA A;  3OZ0 A;  4MG6 A;  2Q1V A;  1LBD A;  3V9Y A;  1FD0 A;  2IOK A;  3KPZ A;  5DU5 A;  3HLV A;  3IPQ A;  1GS4 A;  1KNU A;  5DXQ A;  1Y9R A;  1KKQ A;  1FBY A;  4NY9 A;  2AA6 A;  4LNX A;  4ZNT A;  2AXA A;  1XB7 A;  3HQ5 A;  4L98 A;  2ZK2 A;  1ZGY A;  3BEJ A;  1SQN A;  2ZLA A;  4JGV A;  4E4K A;  3O1E A;  4RAK A;  2R6W A;  2ZXN A;  3VHU A;  5IZ0 A;  4TUZ B;  1XVP A;  4IA2 A;  4UDB A;  5JI0 D;  2YLO A;  3HM1 A;  1P8D A;  4N8R A;  5B41 A;  2P7G A;  4RE8 A;  2AX6 A;  4TUZ A;  3QT0 A;  3V9T A;  2P7Z A;  3B3K A;  3IXP A;  3VHV A;  1R20 A;  1G5Y A;  3TKC A;  4TV1 B;  5SYZ A;  4RWV A;  2ZK0 A;  5DVS A;  3T03 A;  4J5W A;  4A2J A;  2VV1 B;  1XJ7 A;  3ADX A;  4TV1 A;  3VRV A;  5KCT A;  1HJ1 A;  4FGY A;  2PKL A;  3OLL A;  4IVY A;  4G20 A;  3JZB A;  2ZAS A;  5G46 A;  5DSH A;  2VV1 A;  5HZC A;  3VT4 A;  1XLS E;  3R2A A;  3VT6 A;  2AB2 A;  5CJ6 A;  4R6S A;  2OAX A;  5APJ A;  3FEJ A;  2Q6J A;  3VRT A;  4G1D A;  4RMC A;  4P6X A;  3VRU A;  4DK8 A;  3X36 A;  5GT4 A;  4PVU A;  1OT7 A;  2HAR A;  4E4Q A;  1NDE A;  4JL4 A;  5DY8 A;  2H77 A;  5E7V A;  3OMQ A;  5DXP A;  4OK1 A;  4UDD A;  1LV2 A;  5DMC A;  3ET2 A;  3TX7 B;  2POG A;  3FEI A;  5HJS A;  3FLI A;  1Y0X X;  4JYH A;  1XP9 A;  5ICK A;  1UPV A;  4DOS A;  1ZH7 A;  2GPV A;  4PLD A;  5GIE A;  1YP0 A;  3PRG A;  4MDD A;  3KWY A;  2IOG A;  4E2J A;  4X1F A;  4RZG A;  1SKX A;  4G1Z A;  3VTB A;  5KCU A;  1FM9 D;  2ZK5 A;  3B68 A;  3AN3 A;  4OH5 A;  4RUJ A;  1NAX A;  4L96 A;  3W0A A;  1YIN A;  2GPP A;  1X7B A;  3DZY D;  2F4B A;  4ZN9 A;  5L11 A;  2Q1H A;  3OSW A;  4NUF A;  2GPO A;  3OSA A;  1G50 A;  5KCF A;  1U3R A;  2AMA A;  2ZL9 A;  2PIO A;  1IE8 A;  1X7R A;  3VTD A;  4PXM A;  1XAP A;  4HEE X;  1T7T A;  2O4R A;  2OUZ A;  3WT5 A;  1RKH A;  5KCE A;  2NXX E;  3WMH A;  3OSI A;  2HBH A;  3D90 A;  5KCC A;  4ZJW A;  2ZLC A;  4M8E A;  3OMM A;  4HLW A;  5DYB A;  2PIR A;  4MG5 A;  3VTC A;  4ZN7 A;  2GWX A;  2ABI A;  3UUD A;  4QJR A;  5FQT A;  5GID A;  4EMA A;  3KYT A;  5JJM B;  3OS8 C;  4NIE A;  3E00 A;  4OEA A;  4POH A;  1T63 A;  3B1M A;  4MG8 B;  1ERE A;  1HG4 A;  3A9E B;  2ZXM A;  4PPS A;  2Q7J A;  2QNV A;  2E2R A;  5AZV A;  4N73 A;  4Q50 A;  5KYA A;  3ZRB A;  1SJ0 A;  5F9B A;  5KRM A;  3H0A D;  3W0G A;  4PPP A;  3CDS A;  2PIP L;  3B65 A;  4MG8 A;  3A9E A;  2ACL B;  4ITF A;  2O4J A;  4IU7 A;  3L0E A;  3W5T A;  2Q7K A;  4OJ9 A;  3AUR A;  2QR9 A;  4PF3 A;  2HWQ A;  3RVF A;  2ZK4 A;  4OIV A;  2ACL A;  4IQR A;  3CS6 A;  3OMK A;  1YIM A;  3K22 A;  1K4W A;  4PP3 A;  4G2I A;  3CDP A;  5DVV A;  3WJ5 A;  2QSE A;  5KRK A;  3FUG A;  4LTW A;  3UU7 B;  2AX9 A;  2Q6S A;  1Y0S A;  3K8S A;  3AUQ A;  1P93 A;  1PQ6 A;  3G8O A;  2AA5 A;  3L0L A;  4IUI A;  4REE A;  5EGV A;  1YUC A;  2I4J A;  4R2U A;  5DIE A;  2YFE A;  5HYR A;  3KMZ A;  3R5M A;  4DQM A;  4ZNV A;  1M13 A;  2Q70 A;  2O9I A;  4G2H A;  5DXM A;  5E0W A;  5AZT A;  2VV0 A;  3GBK A;  2HVC A;  2ZKC A;  4JYI A;  5DZ3 A;  1ERR A;  1ZEO A;  1R1K D;  3CS8 A;  3R8A A;  4OHA A;  2I4Z A;  3HC6 A;  3VT9 A;  4XT9 A;  3OS8 A;  4QL8 A;  4ITE A;  3DY6 A;  3OAP A;  5M96 A;  2P1V A;  5G44 A;  5G45 A;  5DZ0 A;  1XVP B;  2HAS A;  5FQP A;  1YA3 A;  1XZX X;  2QA8 A;  4IW6 A;  5DP0 A;  2ZK3 A;  4K6I A;  1NHZ A;  1QKN A;  3SP9 A;  5K13 A;  5AWJ A;  3W0H A;  3AN4 A;  2AM9 A;  2IHQ A;  2QPY A;  2YLQ A;  1T7R A;  3PBA A;  3X31 A;  2QH6 A;  1RDT D;  5DRJ A;  3ERD A;  3OKH A;  3ILZ A;  3WT6 A;  4IWC A;  1YYE A;  3V9V A;  1G1U A;  2A3I A;  4XHD A;  3B0Q A;  3R8I A;  3KMG A;  4ZI1 A;  4RMD A;  2XYW A;  4RUP A;  5KR9 A;  1U3S A;  2PIV A;  5DWL A;  2FAI A;  5DV6 A;  3OOK A;  4R06 A;  1UOM A;  5L7E A;  4KZJ A;  3VJI A;  1E3K A;  3ZRA A;  2REW A;  4YT1 A;  3V4A A;  1M2Z A;  2Q60 A;  5APH A;  1I38 A;  4IW8 A;  2YLY A;  3VI8 A;  4IWF A;  1XNN A;  2ZMH A;  5EI1 A;  3LBD A;  2BJ4 B;  2JJ3 A;  3EYB A;  1BSX A;  5E1C A;  2NV7 A;  5AAU A;  3Q95 B;  5DKB A;  1X7E A;  1FM9 A;  3ADS A;  2Q6R A;  2BJ4 A;  1T73 A;  1DKF B;  2G0G A;  3Q95 A;  1XP1 A;  2QTU A;  4FHH A;  1EXA A;  3KDT A;  2Q7I A;  3CJW A;  4J26 A;  4OEZ A;  4MGD A;  4WQP A;  4IA1 A;  1DKF A;  2QXM A;  4LBD A;  3HVL A;  5A86 A;  5IXK A;  4MG7 B;  2OM9 A;  1XIU A;  3OS9 A;  3RY9 A;  3VT3 A;  5KRH A;  2ZNQ A;  4B7W A;  5KCD A;  1ZUC A;  3AX8 A;  3G9E A;  4MG7 A;  4DM6 A;  5LGA A;  2ATH A;  1A28 A;  5DKS A;  5G42 A;  2J14 A;  3DR1 A;  3GYU A;  4O8F A;  5DX3 A;  3B66 A;  4S0S A;  1SR7 A;  5DV8 A;  5LWP A;  3A2H A;  3ET1 A;  1R20 D;  2BAW A;  4MG9 A;  4POJ A;  4WHG A;  3VJT A;  3A3Z X;  1RKG A;  3ZR7 A;  2QXS A;  4BCR A;  2QGT A;  1XLS A;  1YY4 A;  3DZU A;  5KCW A;  3P8X A;  3MNP A;  1XOW A;  3P89 A;  2H79 A;  1YJE A;  3D57 A;  4PWL A;  3WGP A;  4XAO A;  1IE9 A;  5KRF A;  1QKT A;  3H0A A;  4QK4 A;  3S9S A;  2PJL A;  3B5R A;  2V7C A;  3FXV A;  4XUH A;  4ZJR A;  3NOA A;  2HB7 A;  5E0X A;  4DK7 A;  3ZQT A;  3HO0 A;  1I7I A;  3UUD B;  2OCF A;  4RZE A;  4N1Y A;  4FHI A;  1FCY A;  5DV3 A;  1G2N A;  1PK5 A;  4REF A;  4OFU A;  3DCT A;  5DUG A;  2OVH A;  3KDU A;  3L3Z A;  1NQ2 A;  2ZMJ A;  3WWR A;  5C4T A;  5GIC A;  3AUN A;  3PCU A;  1OVL B;  5AVL A;  1VJB A;  1T65 A;  5DK9 A;  1Q4X A;  3GZ9 A;  3HZF A;  4KZM A;  4XI3 A;  4ZO1 X;  3UUC A;  3X1I A;  1XDK A;  2ZNN A;  2VSR A;  2R40 A;  4N5G A;  3GWS X;  1OVL A;  1GWR A;  4DM8 A;  2ZMI A;  4J5X C;  2PIT A;  2FSZ A;  1FCZ A;  5FQR A;  3FC6 B;  2FVJ A;  2P54 A;  3GWX A;  5AAV B;  3ADW A;  3DCU A;  4K4J A;  3FAL B;  4QM0 A;  1K74 A;  4OJ4 A;  2Q3Y A;  2PIN A;  3KMR A;  4OKB A;  3B67 A;  2GPU A;  3F5C A;  1OSV A;  3FC6 A;  5AAV A;  1PZL A;  3IMY A;  5DKG A;  5AK2 A;  2PIU A;  3FAL A;  4OKT A;  5DIG A;  5DXE A;  3OKI A;  5G43 A;  3W5P A;  1PQC A;  1XPC A;  5DZI A;  1I7G A;  2AO6 A;  3N00 A;  1T76 A;  5DUE A;  4IA3 A;  1T79 A;  2GP7 A;  2NXX A;  3VSP A;  4OKW A;  1XQC A;  5DXB B;  5FQV A;  2P1T A;  1T7M A;  3RUU A;  3V49 A;  4PP5 A;  2PIQ A;  3CQV A;  2QE4 A;  5DXB A;  5HCV A;  1A52 A;  1S9Q A;  5EC9 A;  4CI5 A;  2R6Y A;  1NUO A;  4RFW A;  2QAB A;  2QGW A;  1L2J A;  2AX7 A;  2LBD A;  2Q5P A;  3KFC A;  2B1Z A;  1KV6 A;  2B1V A;  5G3J A;  4OZR E;  2Q5S A;  1QKU A;  4OZT U;  3VT5 A;  4APU A;  1RJK A;  1S9P A;  3RLJ A;  3TY0 A;  3E00 D;  1RK3 A;  2Z4B A;  1NQ0 A;  3F7D A;  1ZKY A;  3PEQ A;  3SZ1 A;  2QA8 B;  3VT8 A;  2HC4 A;  5KRA A;  1YMT A;  2P7A A;  2HAM A;  3VHW A;  1E3G A;  2AWH A;  1TFC A;  2NW4 A;  2ZXZ A;  5DUH A;  5E14 A;  2VV2 A;  2Z4J A;  1EXX A;  4UDA A;  5DI7 A;  5E15 A;  4J5X A;  1ILG A;  3B0W A;  1UHL B;  5JY3 A;  1T7F A;  5L7H A;  2I4P A;  2P4Y A;  4IVW A;  1XNX A;  3RLL A;  3W0Y A;  1FM6 D;  2QW4 A;  4Q0A C;  1Z5X E;  2P15 A;  4G21 A;  2XYX A;  1UHL A;  2GTK A;  1T5Z A;  3UP0 A;  5HJP B;  1NQ7 A;  3B0R A;  3ERT A;  2HWR A;  1NQ1 A;  4IA7 A;  5KYJ A;  1NAV A;  3FUR A;  2G44 A;  5L7G A;  5HYK A;  2ZFX A;  2GIU A;  2YJA B;  3R5N A;  4Y29 A;  5HJP A;  1UPW A;  4QE6 A;  3VN2 A;  4PP6 A;  4DOR A;  5ACC A;  3WJ4 A;  2AAX A;  4PLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...