5KRKA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with 4,4'-((5-bromo-2,3-dihydro-1h-inden-1-ylidene)methylene)diphenol
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krkA00
2QXMA 1FM9D 3HLVA 3LBDA 3GWXA 3OS8C 4E2JA 3OMOA 2YFEA 3L0LA 2AAXA 3CJWA 3R5NA 4UDDA 5B5BA 5JY3A 4WHFA 1NQ2A 5DYDA 5KYAA 4RMDA 3EYBA 4G1ZA 1QKUA 3RY9A 4OZTU 4EMAA 3P0UA 4RUJA 4WVDA 4MG8B 4X1FA 3KPZA 4ZNHA 4IVWA 4N5GA 4IA3A 2ZK2A 3UVVA 2Q7IA 3ZRBA 2QXSA 3UUDB 2A3IA 2QTUA 3CS8A 2OZ7A 2IOKA 2J4AA 3UU7B 2AA2A 1X7JA 2ZKCA 1N4HA 4N1YA 2HBHA 4XUHA 4LTWA 4PVUA 5EITA 3OMKA 5DWLA 2XHSA 5DWGA 3WJ4A 4A2JA 1Q4XA 4ZO1X 4QE8A 2OAXA 3CS6A 4OEZA 4CI5A 1I7GA 5C4TA 4FGYA 2I4PA 3OOFA 3B66A 4N8RA 1OSHA 5E14A 3T03A 3L0JA 2BAWA 2P4YA 2YJAB 3VRUA 4IW8A 4K6IA 3CQVA 3FLIA 2ZMHA 4XHDA 4WQPA 4FNEA 3UVVB 4B7WA 3A40X 2HB8A 2ZK1A 4P6XA 5FQPA 3VHUA 4F9MA 3IPSA 3OS8A 5DZ1A 2AXAA 1RK3A 2HASA 2Q59A 5AVIA 2ZK6A 1M13A 5DXGA 5DIEA 3VSOA 3WGPA 3KMGA 5K13A 1NUOA 5E15A 3B3KA 1T7RA 2EWPA 4R06A 1XZXX 5CJ6A 3DCUA 4IUIA 4CI4A 2QPYA 1MZNA 4JGVA 3ADTA 4FHIA 1XQ3A 5AWKA 4MG6A 1Z5XE 3VRWA 2PIPL 2H79A 3FALA 1R20A 4RMCA 1G2NA 5KRFA 5C4SA 3F7DA 2PIVA 2ZK4A 4S0SA 1XLSA 2QE4A 4MG5A 1YOWA 1FM9A 5JI0D 2JFAA 4JYIA 5KD9A 4TUZA 4LNWA 4MGDA 5KCFA 3ZR7A 2Q59B 5GIDA 5DTVA 4L98A 1ILGA 1P8DA 1VJBA 1XP6A 4QM0A 4S14A 2AWHA 1FCZA 5KRJA 1XOWA 2ZK0A 2O9IA 3HQ5A 1ILHA 4PP5A 1FM6D 4KZIA 5DUEA 3MNPA 2PIOA 1FCYA 1ZEOA 1IE8A 2Q6JA 3A3ZX 3IA6A 3KYTA 3DT3A 1MVCA 3WT6A 5DMCA 2GTKA 5KRAA 3R2AA 1NRLA 1Y9RA 3D5FA 3WT5A 3FALB 4Q13A 2AMAA 2YLYA 3DR1A 5G43A 3V4AA 4FHHA 5GT4A 5ICKA 2GPPA 3CDPA 2ZL9A 4TV1A 3D6DA 5DRMA 5DUGA 3R5MA 2JFAB 2Q5PA 3ET3A 4TUZB 2HVCA 3NOAA 2HWRA 4MGDB 4XI3A 5IXKA 4X1GA 3VTDA 2PRGA 2Z4BA 3HM1A 5DXBA 5C4OA 4OH6A 2VV1A 4RFWA 1OSVA 3G8OA 3FUGA 4IW6A 5KRLA 2OM9A 5DVSA 3HC5A 3G9EA 1XJ7A 3AFRA 3ILZA 3MNOA 5A86A 5APJA 4J5XA 5HZCA 3RUTA 2ZNNA 3VSPA 5AVLA 3TKMA 2QZOA 2VV4A 3B0WA 2OCFA 2POBA 4JL4A 4TV1B 1RJKA 1K4WA 3ADVA 3HO0A 3OKHA 3B67A 3HZFA 4G1DA 5DZIA 3IMYA 3N00A 1XNXA 2QNVA 3K23A 3DZYD 3D24A 4J26A 3CTBA 1DB1A 4P6WA 3OS9A 1T73A 3VHVA 1XIUA 3W5PA 3IPQA 3L3XA 5DXBB 2YATA 2VV1B 2HCDA 3K8SA 4RZGA 2Q8SA 5DKSA 2Q70A 4PWLA 1GWXA 3AZ1A 1E3KA 1T74A 1XDKA 2VV0A 5DKGA 3JZCA 4RZFA 2Q61A 4OJ4A 2V0VA 5ETHA 3L03A 5DZHA 3DZUD 4KZJA 3R8IA 2FVJA 4XT9A 2Q60A 3SP6A 2B1VA 2QZOB 2VV4B 5HJSA 3TX7B 4ONIA 2Q6SA 4LBDA 2QSEA 4ZNVA 5KCUA 1FM6A 4PPPA 4Q0AC 4NY9A 3VRVA 3W0IA 3S9SA 3WJ5A 1XAPA 1BSXA 2ZK5A 1X78A 4XTAA 1T65A 4IA1A 5C4UA 2ZVTA 3VI8A 3G0WA 4IA7A 3PO9A 1S9PA 2AX8A 5F9BA 3B0QA 2Q7LA 2AO6A 2HFPA 5KCTA 1I7IA 3PEQA 1XDKB 2ZY0A 2H77A 5DXRA 2HWQA 3RLJA 2GL8A 3WTQA 5ACCA 4RE8A 3IPUA 4OKTA 3FS1A 2BJ4A 3X1HA 3E00D 1ERRA 1X7BA 3OZ0A 4S0TA 4OFUA 3UUAA 5KRMA 1PQ9A 2HAMA 3PCUA 4OZRU 4MGBA 5DL4A 2LBDA 3AZ2A 4IV4A 1U3RA 3R8AA 2Q6RA 5KRCA 3OMPA 2HB7A 2HARA 2AMBA 3G8IA 4IA2A 5IZ0A 4YMQA 5KCWA 2G5OA 2Q7JA 4PP6A 1Y0SA 2HC4A 3TKCA 4ZN7A 1I37A 2I4JA 1G50A 4RMEA 1L2IA 3VHWA 1T63A 2P15A 3H0AD 5DUHA 3ADUA 3W0CA 2PKLA 4DK7A 5L7EA 3VJSA 1N46A 1NQ1A 2AA7A 4NQAB 1N83A 5DWEA 2P54A 1H9UA 2O4JA 1G5YA 2BJ4B 4RUPA 5G3JA 2Q7KA 5EJVA 1A28A 2G0GA 3DZYA 3UUAB 2XYWA 2XKWA 3A2HA 1XLSE 4OGHA 3RLLA 3OSWA 4MGBB 3W5RA 1ZDTA 3B65A 3X31A 1TFCA 2GPVA 2ZNPA 4DOSA 3E7CA 4PLDA 3VJTA 2AX7A 3WFGA 2FAIA 3OOKA 5I4VA 3DZUA 4XAOA 4RUOX 3UP0A 3Q95A 4G20A 2QR9A 4FN9A 4KZMA 4LSJA 3AX8A 4J5XC 4E4KA 3VT6A 1NQ7A 1XB7A 3DCTA 2AA6A 4L96A 1LV2A 4OJBA 2I0GA 3B1MA 3GYUA 2Q5GA 5DU5A 2JF9A 2IHQA 5DV6A 5AWJA 3H52A 1PK5A 2GPOA 3AUNA 4Q50A 5GIEA 4ZN9A 5KRHA 2Z4JA 3ET2A 3W0YA 4E4QA 4G2HA 4MG9A 1IE9A 1S0XA 3GYTA 1ZGYA 3KFCA 5EC9A 2ZXZA 3KDTA 2GPUA 5G45A 2PIWA 5E0XA 1YYEA 3W5TA 1T5ZA 4MGCA 3E00A 5DXQA 5DKBA 3Q95B 1NQ0A 4JAZA 2ACLA 3VT9A 5E7VA 2NXXA 5EHJA 2OVHA 4ZNTA 5FQRA 2PITA 4ZO1B 2P1VA 4OZTE 2V7CA 1A52A 4POHA 5DXMA 1TXIA 3VTBA 1M2ZA 4R2UA 3W5QA 1U3QA 2ZXNA 3KMZA 4OIUA 4UDCA 3ERDA 2GP7A 4MG9B 2ZMIA 1U3SA 1T79A 4QE6A 1FBYA 4PPSA 3QT0A 3H0AA 3RUUA 4HLWA 4Y29A 1K74D 3F5CA 4DK8A 3W0GA 1M7WA 2GIUA 2PIUA 3D90A 4IS8A 4QK4A 5AZVA 1QKMA 5DWIA 4ZNWA 2ACLB 4RAKA 1SJ0A 3A2JA 3AN3A 3HVLA 2XYXA 4S15A 3L0EA 2PJLA 2O4RA 3MNEA 2ATHA 1WM0X 2ZK3A 4OFRA 1LBDA 3BQDA 3WFFA 4OKWA 3ADWA 2QA8A 3FXVA 3O1EA 1G1UA 4K7AA 3WT7A 4REFA 2Q1VA 2QGWA 5AK2A 3OLLA 1T7MA 2Q3YA 2F4BA 1NYXA 4WHGA 3VN2A 1HJ1A 2ZLAA 5HCVA 3O1DA 3VT8A 4A4WA 1X7RA 3OLFA 4K4JA 3HODA 2ZLCA 5E0WA 3P88A 5LGAA 1Z5XU 3F5CB 1NDEA 1MV9A 2AX9A 2YLPA 3FURA 3CDSA 3X1IA 2ZBSA 4CSJA 1PDUA 3L1BA 5JJMA 4MG7A 3FC6A 3M7RA 2VSTA 4ITEA 4IU7A 5G44A 3AUQA 1UOMA 5G5WA 5FQSA 1EREA 3KDUA 4MDDA 3VT5A 5KR9A 2ABIA 2JJ3A 2PIQA 3BC5A 4G2IA 5AAUA 2QH6A 1X76A 2QA8B 4PXMA 3GN8A 3PLZA 3OMMA 4XLDA 5DLRA 2R40D 3KBAA 4G1YA 2P7ZA 5FQTA 1PZLA 1XV9A 4QJRA 3B5RA 2YLQA 5GICA 3UUCA 3FEIA 1R1KD 3B0TA 4OEYA 1HG4A 1PCGA 4ITFA 1X7EA 4RZEA 5G42A 5DX3A 3VJHA 3NSQA 2ZMJA 1DKFA 5DRJA 5AZTA 4IVYA 4WPFA 5G46A 2NPAA 4MG7B 1RKGA 3U9QA 3FC6B 4XUMA 3GZ9A 4APUA 5JJMB 5IAWA 1ZKYA 3WWRA 5DYBA 4JYHA 1NAVA 2P7AA 3BEJA 4YPQA 5KCEA 1YUCA 3L3ZA 3E94A 5EI1A 1T7TA 1K74A 3OZJA 3PRGA 1YMTA 5DMFA 3D57A 3VT3A 2ZNOA 4RWVA 3JZBA 3OGTA 4QL8A 5B41A 1XV9B 3CS4A 1RDTD 2R6YA 5DXPA 2B23A 2PINA 3OKIA 2G0HA 1I38A 4R6SA 1GWRA 4IWCA 4ZOMA 5DX3B 3VT7A 1GS4A 1DKFB 2NV7A 3V49A 4DMAA 4PRGA 1XVPA 5DXEA 2GWXA 3OSIA 2PIXA 5APKA 1UPVA 3V3EA 1OVLA 5DIDA 2AA5A 2NW4A 4ZJWA 3A2IA 1XPCA 2VSRA 1E3GA 1S0ZA 1ZH7A 2ZNQA 4M8EA 3KWYA 3SZ1A 4DM8A 5DV3A 3ADSA 5DXKA 5DZ3A 5HJPA 1ZUCA 1T76A 1NAXA 3RVFA 1XP1A 4YNKA 5APHA 3R29A 3ZQTA 1EXXA 4POJA 5L7GA 3OSAA 1ZAFA 5SYZA 1SQNA 4M8HA 1QKNA 3ET0A 4O8FA 4OKBA 1YOKA 3W0HA 1PQ6A 5FQVA 1UHLA 3VT4A 4OH5A 5DP0A 1XQCA 1XVPB 1YINA 1PRGA 4DQMA 2AM9A 2NXXE 4YT1A 2R40A 5HYKA 4HEEX 2AYRA 1YY4A 5E19A 1OVLB 3AURA 3GWSX 3PBAA 1KNUA 4ZNUA 4IQRA 3P8XA 4IWFA 3B68A 3OMQA 4OEAA 5DKEA 1UPWA 2XYJA 3IXPD 5EGVA 1R1KA 3UP3A 4J24A 3ERTA 3LMPA 4N73A 5KRKA 3DY6A 2QW4A 2I0JA 5HJPB 4G21A 3CLDA 5HYRA 1RKHA 3OAPA 2I4ZA 3VRTA 2IOGA 3NSPA 1XP9A 4OHAA 5KCCA 2REWA 2Q1HA 5E1CA 3X36A 2B50A 3A9EA 4OLMA 4JYGA 1UHLB 1ZDUA 2B1ZA 2W8YA 5DWJA 1R5KA 5DI7A 5DY8A 3FEJA 2QMVA 2OVMA 2P7GA 2POGA 2YJDA 3GBKA 5M96A 1YJEA 4ZNSA 1RDTA 3WMHA 4NB6A 1KKQA 3V9TA 2FSZA 3ET1A 2G44A 4J5WC 2J7XA 4UDAA 3R8DA 5DV8A 5KCDA 1PQCA 2AB2A 2P1TA 4OZRE 3VTCA 1YA3A 3K6PA 4OILA 5KYJA 5AAVA 1XNNA 3V9YA 4EM9A 3V3QA 1R6GA 4DM6A 1P93A 2ZXMA 4NIEA 4OC7A 4ZJRA 4OIVA 4PLEA 3P89A 2PNUA 3K22A 5L11A 3OLSA 4ZI1A 5KRIA 2QABA 3A9EB 1Z95A 3CWDA 4MGAA 4OJ9A 4OKXA 2VV2A 3VJIA 1QKTA 1SR7A 4NUFA 1L2JA 2R6WA 2VV3A 5AYGA 3W0AA 2ZFXA 5H1EA 3A78A 4OEDA 5DVVA 5DK9A 1OT7A 2J14A 3HC6A 4OARA 2PIRA 4WLBA 5DZ0A 3AN4A 3KMRA 4PF3A 1T7FA 1K7LA 4IV2A 1S9QA 4LNXA 1S19A 3W0JA 5AAVB 2ZASA 3V9VA 2YHDA 4UDBA 4OK1A 1KV6A 1GWQA 4REEA 3SP9A 2E2RA 4DORA 5L7HA 4PP3A 4MG8A 1FCXA 1Y0XX 3ADXA 1U9EA 4MGAB 1FD0A 3ZRAA 2P1UA 3IXPA 3B0RA 2J7YA 2Q5SA 2QGTA 1YP0A 5DIGA 4BCRA 3TY0A 5KROA 1EXAA 4J5WA 2QA6A 5DSHA 4A4VA 2YLOA 3GD2A 2AX6A 3UUDA 5LWPA 1R20D 3UU7A 3AZ3A 2OUZA 1SKXA 5DVCA 1YIMA 1NHZA
chains in the Genus database with same CATH superfamily
2QXMA 1FM9D 3HLVA 3LBDA 3GWXA 3OS8C 4E2JA 3OMOA 2YFEA 3L0LA 2AAXA 3CJWA 3R5NA 4UDDA 5B5BA 5JY3A 4WHFA 1NQ2A 5DYDA 5KYAA 4RMDA 3EYBA 4G1ZA 1QKUA 3RY9A 4OZTU 4EMAA 3P0UA 4RUJA 4WVDA 4MG8B 4X1FA 3KPZA 4ZNHA 4IVWA 4N5GA 4IA3A 2ZK2A 3UVVA 2Q7IA 3ZRBA 2QXSA 3UUDB 2A3IA 2QTUA 3CS8A 2OZ7A 2IOKA 2J4AA 3UU7B 2AA2A 1X7JA 2ZKCA 1N4HA 4N1YA 2HBHA 4XUHA 4LTWA 4PVUA 5EITA 3OMKA 5DWLA 2XHSA 5DWGA 3WJ4A 4A2JA 1Q4XA 4ZO1X 4QE8A 2OAXA 3CS6A 4OEZA 4CI5A 1I7GA 5C4TA 4FGYA 2I4PA 3OOFA 3B66A 4N8RA 1OSHA 5E14A 3T03A 3L0JA 2BAWA 2P4YA 2YJAB 3VRUA 4IW8A 4K6IA 3CQVA 3FLIA 2ZMHA 4XHDA 4WQPA 4FNEA 3UVVB 4B7WA 3A40X 2HB8A 2ZK1A 4P6XA 5FQPA 3VHUA 4F9MA 3IPSA 3OS8A 5DZ1A 2AXAA 1RK3A 2HASA 2Q59A 5AVIA 2ZK6A 1M13A 5DXGA 5DIEA 3VSOA 3WGPA 3KMGA 5K13A 1NUOA 5E15A 3B3KA 1T7RA 2EWPA 4R06A 1XZXX 5CJ6A 3DCUA 4IUIA 4CI4A 2QPYA 1MZNA 4JGVA 3ADTA 4FHIA 1XQ3A 5AWKA 4MG6A 1Z5XE 3VRWA 2PIPL 2H79A 3FALA 1R20A 4RMCA 1G2NA 5KRFA 5C4SA 3F7DA 2PIVA 2ZK4A 4S0SA 1XLSA 2QE4A 4MG5A 1YOWA 1FM9A 5JI0D 2JFAA 4JYIA 5KD9A 4TUZA 4LNWA 4MGDA 5KCFA 3ZR7A 2Q59B 5GIDA 5DTVA 4L98A 1ILGA 1P8DA 1VJBA 1XP6A 4QM0A 4S14A 2AWHA 1FCZA 5KRJA 1XOWA 2ZK0A 2O9IA 3HQ5A 1ILHA 4PP5A 1FM6D 4KZIA 5DUEA 3MNPA 2PIOA 1FCYA 1ZEOA 1IE8A 2Q6JA 3A3ZX 3IA6A 3KYTA 3DT3A 1MVCA 3WT6A 5DMCA 2GTKA 5KRAA 3R2AA 1NRLA 1Y9RA 3D5FA 3WT5A 3FALB 4Q13A 2AMAA 2YLYA 3DR1A 5G43A 3V4AA 4FHHA 5GT4A 5ICKA 2GPPA 3CDPA 2ZL9A 4TV1A 3D6DA 5DRMA 5DUGA 3R5MA 2JFAB 2Q5PA 3ET3A 4TUZB 2HVCA 3NOAA 2HWRA 4MGDB 4XI3A 5IXKA 4X1GA 3VTDA 2PRGA 2Z4BA 3HM1A 5DXBA 5C4OA 4OH6A 2VV1A 4RFWA 1OSVA 3G8OA 3FUGA 4IW6A 5KRLA 2OM9A 5DVSA 3HC5A 3G9EA 1XJ7A 3AFRA 3ILZA 3MNOA 5A86A 5APJA 4J5XA 5HZCA 3RUTA 2ZNNA 3VSPA 5AVLA 3TKMA 2QZOA 2VV4A 3B0WA 2OCFA 2POBA 4JL4A 4TV1B 1RJKA 1K4WA 3ADVA 3HO0A 3OKHA 3B67A 3HZFA 4G1DA 5DZIA 3IMYA 3N00A 1XNXA 2QNVA 3K23A 3DZYD 3D24A 4J26A 3CTBA 1DB1A 4P6WA 3OS9A 1T73A 3VHVA 1XIUA 3W5PA 3IPQA 3L3XA 5DXBB 2YATA 2VV1B 2HCDA 3K8SA 4RZGA 2Q8SA 5DKSA 2Q70A 4PWLA 1GWXA 3AZ1A 1E3KA 1T74A 1XDKA 2VV0A 5DKGA 3JZCA 4RZFA 2Q61A 4OJ4A 2V0VA 5ETHA 3L03A 5DZHA 3DZUD 4KZJA 3R8IA 2FVJA 4XT9A 2Q60A 3SP6A 2B1VA 2QZOB 2VV4B 5HJSA 3TX7B 4ONIA 2Q6SA 4LBDA 2QSEA 4ZNVA 5KCUA 1FM6A 4PPPA 4Q0AC 4NY9A 3VRVA 3W0IA 3S9SA 3WJ5A 1XAPA 1BSXA 2ZK5A 1X78A 4XTAA 1T65A 4IA1A 5C4UA 2ZVTA 3VI8A 3G0WA 4IA7A 3PO9A 1S9PA 2AX8A 5F9BA 3B0QA 2Q7LA 2AO6A 2HFPA 5KCTA 1I7IA 3PEQA 1XDKB 2ZY0A 2H77A 5DXRA 2HWQA 3RLJA 2GL8A 3WTQA 5ACCA 4RE8A 3IPUA 4OKTA 3FS1A 2BJ4A 3X1HA 3E00D 1ERRA 1X7BA 3OZ0A 4S0TA 4OFUA 3UUAA 5KRMA 1PQ9A 2HAMA 3PCUA 4OZRU 4MGBA 5DL4A 2LBDA 3AZ2A 4IV4A 1U3RA 3R8AA 2Q6RA 5KRCA 3OMPA 2HB7A 2HARA 2AMBA 3G8IA 4IA2A 5IZ0A 4YMQA 5KCWA 2G5OA 2Q7JA 4PP6A 1Y0SA 2HC4A 3TKCA 4ZN7A 1I37A 2I4JA 1G50A 4RMEA 1L2IA 3VHWA 1T63A 2P15A 3H0AD 5DUHA 3ADUA 3W0CA 2PKLA 4DK7A 5L7EA 3VJSA 1N46A 1NQ1A 2AA7A 4NQAB 1N83A 5DWEA 2P54A 1H9UA 2O4JA 1G5YA 2BJ4B 4RUPA 5G3JA 2Q7KA 5EJVA 1A28A 2G0GA 3DZYA 3UUAB 2XYWA 2XKWA 3A2HA 1XLSE 4OGHA 3RLLA 3OSWA 4MGBB 3W5RA 1ZDTA 3B65A 3X31A 1TFCA 2GPVA 2ZNPA 4DOSA 3E7CA 4PLDA 3VJTA 2AX7A 3WFGA 2FAIA 3OOKA 5I4VA 3DZUA 4XAOA 4RUOX 3UP0A 3Q95A 4G20A 2QR9A 4FN9A 4KZMA 4LSJA 3AX8A 4J5XC 4E4KA 3VT6A 1NQ7A 1XB7A 3DCTA 2AA6A 4L96A 1LV2A 4OJBA 2I0GA 3B1MA 3GYUA 2Q5GA 5DU5A 2JF9A 2IHQA 5DV6A 5AWJA 3H52A 1PK5A 2GPOA 3AUNA 4Q50A 5GIEA 4ZN9A 5KRHA 2Z4JA 3ET2A 3W0YA 4E4QA 4G2HA 4MG9A 1IE9A 1S0XA 3GYTA 1ZGYA 3KFCA 5EC9A 2ZXZA 3KDTA 2GPUA 5G45A 2PIWA 5E0XA 1YYEA 3W5TA 1T5ZA 4MGCA 3E00A 5DXQA 5DKBA 3Q95B 1NQ0A 4JAZA 2ACLA 3VT9A 5E7VA 2NXXA 5EHJA 2OVHA 4ZNTA 5FQRA 2PITA 4ZO1B 2P1VA 4OZTE 2V7CA 1A52A 4POHA 5DXMA 1TXIA 3VTBA 1M2ZA 4R2UA 3W5QA 1U3QA 2ZXNA 3KMZA 4OIUA 4UDCA 3ERDA 2GP7A 4MG9B 2ZMIA 1U3SA 1T79A 4QE6A 1FBYA 4PPSA 3QT0A 3H0AA 3RUUA 4HLWA 4Y29A 1K74D 3F5CA 4DK8A 3W0GA 1M7WA 2GIUA 2PIUA 3D90A 4IS8A 4QK4A 5AZVA 1QKMA 5DWIA 4ZNWA 2ACLB 4RAKA 1SJ0A 3A2JA 3AN3A 3HVLA 2XYXA 4S15A 3L0EA 2PJLA 2O4RA 3MNEA 2ATHA 1WM0X 2ZK3A 4OFRA 1LBDA 3BQDA 3WFFA 4OKWA 3ADWA 2QA8A 3FXVA 3O1EA 1G1UA 4K7AA 3WT7A 4REFA 2Q1VA 2QGWA 5AK2A 3OLLA 1T7MA 2Q3YA 2F4BA 1NYXA 4WHGA 3VN2A 1HJ1A 2ZLAA 5HCVA 3O1DA 3VT8A 4A4WA 1X7RA 3OLFA 4K4JA 3HODA 2ZLCA 5E0WA 3P88A 5LGAA 1Z5XU 3F5CB 1NDEA 1MV9A 2AX9A 2YLPA 3FURA 3CDSA 3X1IA 2ZBSA 4CSJA 1PDUA 3L1BA 5JJMA 4MG7A 3FC6A 3M7RA 2VSTA 4ITEA 4IU7A 5G44A 3AUQA 1UOMA 5G5WA 5FQSA 1EREA 3KDUA 4MDDA 3VT5A 5KR9A 2ABIA 2JJ3A 2PIQA 3BC5A 4G2IA 5AAUA 2QH6A 1X76A 2QA8B 4PXMA 3GN8A 3PLZA 3OMMA 4XLDA 5DLRA 2R40D 3KBAA 4G1YA 2P7ZA 5FQTA 1PZLA 1XV9A 4QJRA 3B5RA 2YLQA 5GICA 3UUCA 3FEIA 1R1KD 3B0TA 4OEYA 1HG4A 1PCGA 4ITFA 1X7EA 4RZEA 5G42A 5DX3A 3VJHA 3NSQA 2ZMJA 1DKFA 5DRJA 5AZTA 4IVYA 4WPFA 5G46A 2NPAA 4MG7B 1RKGA 3U9QA 3FC6B 4XUMA 3GZ9A 4APUA 5JJMB 5IAWA 1ZKYA 3WWRA 5DYBA 4JYHA 1NAVA 2P7AA 3BEJA 4YPQA 5KCEA 1YUCA 3L3ZA 3E94A 5EI1A 1T7TA 1K74A 3OZJA 3PRGA 1YMTA 5DMFA 3D57A 3VT3A 2ZNOA 4RWVA 3JZBA 3OGTA 4QL8A 5B41A 1XV9B 3CS4A 1RDTD 2R6YA 5DXPA 2B23A 2PINA 3OKIA 2G0HA 1I38A 4R6SA 1GWRA 4IWCA 4ZOMA 5DX3B 3VT7A 1GS4A 1DKFB 2NV7A 3V49A 4DMAA 4PRGA 1XVPA 5DXEA 2GWXA 3OSIA 2PIXA 5APKA 1UPVA 3V3EA 1OVLA 5DIDA 2AA5A 2NW4A 4ZJWA 3A2IA 1XPCA 2VSRA 1E3GA 1S0ZA 1ZH7A 2ZNQA 4M8EA 3KWYA 3SZ1A 4DM8A 5DV3A 3ADSA 5DXKA 5DZ3A 5HJPA 1ZUCA 1T76A 1NAXA 3RVFA 1XP1A 4YNKA 5APHA 3R29A 3ZQTA 1EXXA 4POJA 5L7GA 3OSAA 1ZAFA 5SYZA 1SQNA 4M8HA 1QKNA 3ET0A 4O8FA 4OKBA 1YOKA 3W0HA 1PQ6A 5FQVA 1UHLA 3VT4A 4OH5A 5DP0A 1XQCA 1XVPB 1YINA 1PRGA 4DQMA 2AM9A 2NXXE 4YT1A 2R40A 5HYKA 4HEEX 2AYRA 1YY4A 5E19A 1OVLB 3AURA 3GWSX 3PBAA 1KNUA 4ZNUA 4IQRA 3P8XA 4IWFA 3B68A 3OMQA 4OEAA 5DKEA 1UPWA 2XYJA 3IXPD 5EGVA 1R1KA 3UP3A 4J24A 3ERTA 3LMPA 4N73A 5KRKA 3DY6A 2QW4A 2I0JA 5HJPB 4G21A 3CLDA 5HYRA 1RKHA 3OAPA 2I4ZA 3VRTA 2IOGA 3NSPA 1XP9A 4OHAA 5KCCA 2REWA 2Q1HA 5E1CA 3X36A 2B50A 3A9EA 4OLMA 4JYGA 1UHLB 1ZDUA 2B1ZA 2W8YA 5DWJA 1R5KA 5DI7A 5DY8A 3FEJA 2QMVA 2OVMA 2P7GA 2POGA 2YJDA 3GBKA 5M96A 1YJEA 4ZNSA 1RDTA 3WMHA 4NB6A 1KKQA 3V9TA 2FSZA 3ET1A 2G44A 4J5WC 2J7XA 4UDAA 3R8DA 5DV8A 5KCDA 1PQCA 2AB2A 2P1TA 4OZRE 3VTCA 1YA3A 3K6PA 4OILA 5KYJA 5AAVA 1XNNA 3V9YA 4EM9A 3V3QA 1R6GA 4DM6A 1P93A 2ZXMA 4NIEA 4OC7A 4ZJRA 4OIVA 4PLEA 3P89A 2PNUA 3K22A 5L11A 3OLSA 4ZI1A 5KRIA 2QABA 3A9EB 1Z95A 3CWDA 4MGAA 4OJ9A 4OKXA 2VV2A 3VJIA 1QKTA 1SR7A 4NUFA 1L2JA 2R6WA 2VV3A 5AYGA 3W0AA 2ZFXA 5H1EA 3A78A 4OEDA 5DVVA 5DK9A 1OT7A 2J14A 3HC6A 4OARA 2PIRA 4WLBA 5DZ0A 3AN4A 3KMRA 4PF3A 1T7FA 1K7LA 4IV2A 1S9QA 4LNXA 1S19A 3W0JA 5AAVB 2ZASA 3V9VA 2YHDA 4UDBA 4OK1A 1KV6A 1GWQA 4REEA 3SP9A 2E2RA 4DORA 5L7HA 4PP3A 4MG8A 1FCXA 1Y0XX 3ADXA 1U9EA 4MGAB 1FD0A 3ZRAA 2P1UA 3IXPA 3B0RA 2J7YA 2Q5SA 2QGTA 1YP0A 5DIGA 4BCRA 3TY0A 5KROA 1EXAA 4J5WA 2QA6A 5DSHA 4A4VA 2YLOA 3GD2A 2AX6A 3UUDA 5LWPA 1R20D 3UU7A 3AZ3A 2OUZA 1SKXA 5DVCA 1YIMA 1NHZA
chains in the Genus database with same CATH topology
2QXMA 1FM9D 3HLVA 3LBDA 3GWXA 3OS8C 4E2JA 3OMOA 2YFEA 3L0LA 2AAXA 3CJWA 3R5NA 4UDDA 5B5BA 5JY3A 4WHFA 1NQ2A 5DYDA 5KYAA 4RMDA 3EYBA 4G1ZA 1QKUA 3RY9A 4OZTU 4EMAA 3P0UA 4RUJA 4WVDA 4MG8B 4X1FA 3KPZA 4ZNHA 4IVWA 4N5GA 4IA3A 2ZK2A 3UVVA 2Q7IA 3ZRBA 2QXSA 3UUDB 2A3IA 2QTUA 3CS8A 2OZ7A 2IOKA 2J4AA 3UU7B 2AA2A 1X7JA 2ZKCA 1N4HA 4N1YA 2HBHA 4XUHA 4LTWA 4PVUA 5EITA 3OMKA 5DWLA 2XHSA 5DWGA 3WJ4A 4A2JA 1Q4XA 4ZO1X 4QE8A 2OAXA 3CS6A 4OEZA 4CI5A 1I7GA 5C4TA 4FGYA 2I4PA 3OOFA 3B66A 4N8RA 1OSHA 5E14A 3T03A 3L0JA 2BAWA 2P4YA 2YJAB 3VRUA 4IW8A 4K6IA 3CQVA 3FLIA 2ZMHA 4XHDA 4WQPA 4FNEA 3UVVB 4B7WA 3A40X 2HB8A 2ZK1A 4P6XA 5FQPA 3VHUA 4F9MA 3IPSA 3OS8A 5DZ1A 2AXAA 1RK3A 2HASA 2Q59A 5AVIA 2ZK6A 1M13A 5DXGA 5DIEA 3VSOA 3WGPA 3KMGA 5K13A 1NUOA 5E15A 3B3KA 1T7RA 2EWPA 4R06A 1XZXX 5CJ6A 3DCUA 4IUIA 4CI4A 2QPYA 1MZNA 4JGVA 3ADTA 4FHIA 1XQ3A 5AWKA 4MG6A 1Z5XE 3VRWA 2PIPL 2H79A 3FALA 1R20A 4RMCA 1G2NA 5KRFA 5C4SA 3F7DA 2PIVA 2ZK4A 4S0SA 1XLSA 2QE4A 4MG5A 1YOWA 1FM9A 5JI0D 2JFAA 4JYIA 5KD9A 4TUZA 4LNWA 4MGDA 5KCFA 3ZR7A 2Q59B 5GIDA 5DTVA 4L98A 1ILGA 1P8DA 1VJBA 1XP6A 4QM0A 4S14A 2AWHA 1FCZA 5KRJA 1XOWA 2ZK0A 2O9IA 3HQ5A 1ILHA 4PP5A 1FM6D 4KZIA 5DUEA 3MNPA 2PIOA 1FCYA 1ZEOA 1IE8A 2Q6JA 3A3ZX 3IA6A 3KYTA 3DT3A 1MVCA 3WT6A 5DMCA 2GTKA 5KRAA 3R2AA 1NRLA 1Y9RA 3D5FA 3WT5A 3FALB 4Q13A 2AMAA 2YLYA 3DR1A 5G43A 3V4AA 4FHHA 5GT4A 5ICKA 2GPPA 3CDPA 2ZL9A 4TV1A 3D6DA 5DRMA 5DUGA 3R5MA 2JFAB 2Q5PA 3ET3A 4TUZB 2HVCA 3NOAA 2HWRA 4MGDB 4XI3A 5IXKA 4X1GA 3VTDA 2PRGA 2Z4BA 3HM1A 5DXBA 5C4OA 4OH6A 2VV1A 4RFWA 1OSVA 3G8OA 3FUGA 4IW6A 5KRLA 2OM9A 5DVSA 3HC5A 3G9EA 1XJ7A 3AFRA 3ILZA 3MNOA 5A86A 5APJA 4J5XA 5HZCA 3RUTA 2ZNNA 3VSPA 5AVLA 3TKMA 2QZOA 2VV4A 3B0WA 2OCFA 2POBA 4JL4A 4TV1B 1RJKA 1K4WA 3ADVA 3HO0A 3OKHA 3B67A 3HZFA 4G1DA 5DZIA 3IMYA 3N00A 1XNXA 2QNVA 3K23A 3DZYD 3D24A 4J26A 3CTBA 1DB1A 4P6WA 3OS9A 1T73A 3VHVA 1XIUA 3W5PA 3IPQA 3L3XA 5DXBB 2YATA 2VV1B 2HCDA 3K8SA 4RZGA 2Q8SA 5DKSA 2Q70A 4PWLA 1GWXA 3AZ1A 1E3KA 1T74A 1XDKA 2VV0A 5DKGA 3JZCA 4RZFA 2Q61A 4OJ4A 2V0VA 5ETHA 3L03A 5DZHA 3DZUD 4KZJA 3R8IA 2FVJA 4XT9A 2Q60A 3SP6A 2B1VA 2QZOB 2VV4B 5HJSA 3TX7B 4ONIA 2Q6SA 4LBDA 2QSEA 4ZNVA 5KCUA 1FM6A 4PPPA 4Q0AC 4NY9A 3VRVA 3W0IA 3S9SA 3WJ5A 1XAPA 1BSXA 2ZK5A 1X78A 4XTAA 1T65A 4IA1A 5C4UA 2ZVTA 3VI8A 3G0WA 4IA7A 3PO9A 1S9PA 2AX8A 5F9BA 3B0QA 2Q7LA 2AO6A 2HFPA 5KCTA 1I7IA 3PEQA 1XDKB 2ZY0A 2H77A 5DXRA 2HWQA 3RLJA 2GL8A 3WTQA 5ACCA 4RE8A 3IPUA 4OKTA 3FS1A 2BJ4A 3X1HA 3E00D 1ERRA 1X7BA 3OZ0A 4S0TA 4OFUA 3UUAA 5KRMA 1PQ9A 2HAMA 3PCUA 4OZRU 4MGBA 5DL4A 2LBDA 3AZ2A 4IV4A 1U3RA 3R8AA 2Q6RA 5KRCA 3OMPA 2HB7A 2HARA 2AMBA 3G8IA 4IA2A 5IZ0A 4YMQA 5KCWA 2G5OA 2Q7JA 4PP6A 1Y0SA 2HC4A 3TKCA 4ZN7A 1I37A 2I4JA 1G50A 4RMEA 1L2IA 3VHWA 1T63A 2P15A 3H0AD 5DUHA 3ADUA 3W0CA 2PKLA 4DK7A 5L7EA 3VJSA 1N46A 1NQ1A 2AA7A 4NQAB 1N83A 5DWEA 2P54A 1H9UA 2O4JA 1G5YA 2BJ4B 4RUPA 5G3JA 2Q7KA 5EJVA 1A28A 2G0GA 3DZYA 3UUAB 2XYWA 2XKWA 3A2HA 1XLSE 4OGHA 3RLLA 3OSWA 4MGBB 3W5RA 1ZDTA 3B65A 3X31A 1TFCA 2GPVA 2ZNPA 4DOSA 3E7CA 4PLDA 3VJTA 2AX7A 3WFGA 2FAIA 3OOKA 5I4VA 3DZUA 4XAOA 4RUOX 3UP0A 3Q95A 4G20A 2QR9A 4FN9A 4KZMA 4LSJA 3AX8A 4J5XC 4E4KA 3VT6A 1NQ7A 1XB7A 3DCTA 2AA6A 4L96A 1LV2A 4OJBA 2I0GA 3B1MA 3GYUA 2Q5GA 5DU5A 2JF9A 2IHQA 5DV6A 5AWJA 3H52A 1PK5A 2GPOA 3AUNA 4Q50A 5GIEA 4ZN9A 5KRHA 2Z4JA 3ET2A 3W0YA 4E4QA 4G2HA 4MG9A 1IE9A 1S0XA 3GYTA 1ZGYA 3KFCA 5EC9A 2ZXZA 3KDTA 2GPUA 5G45A 2PIWA 5E0XA 1YYEA 3W5TA 1T5ZA 4MGCA 3E00A 5DXQA 5DKBA 3Q95B 1NQ0A 4JAZA 2ACLA 3VT9A 5E7VA 2NXXA 5EHJA 2OVHA 4ZNTA 5FQRA 2PITA 4ZO1B 2P1VA 4OZTE 2V7CA 1A52A 4POHA 5DXMA 1TXIA 3VTBA 1M2ZA 4R2UA 3W5QA 1U3QA 2ZXNA 3KMZA 4OIUA 4UDCA 3ERDA 2GP7A 4MG9B 2ZMIA 1U3SA 1T79A 4QE6A 1FBYA 4PPSA 3QT0A 3H0AA 3RUUA 4HLWA 4Y29A 1K74D 3F5CA 4DK8A 3W0GA 1M7WA 2GIUA 2PIUA 3D90A 4IS8A 4QK4A 5AZVA 1QKMA 5DWIA 4ZNWA 2ACLB 4RAKA 1SJ0A 3A2JA 3AN3A 3HVLA 2XYXA 4S15A 3L0EA 2PJLA 2O4RA 3MNEA 2ATHA 1WM0X 2ZK3A 4OFRA 1LBDA 3BQDA 3WFFA 4OKWA 3ADWA 2QA8A 3FXVA 3O1EA 1G1UA 4K7AA 3WT7A 4REFA 2Q1VA 2QGWA 5AK2A 3OLLA 1T7MA 2Q3YA 2F4BA 1NYXA 4WHGA 3VN2A 1HJ1A 2ZLAA 5HCVA 3O1DA 3VT8A 4A4WA 1X7RA 3OLFA 4K4JA 3HODA 2ZLCA 5E0WA 3P88A 5LGAA 1Z5XU 3F5CB 1NDEA 1MV9A 2AX9A 2YLPA 3FURA 3CDSA 3X1IA 2ZBSA 4CSJA 1PDUA 3L1BA 5JJMA 4MG7A 3FC6A 3M7RA 2VSTA 4ITEA 4IU7A 5G44A 3AUQA 1UOMA 5G5WA 5FQSA 1EREA 3KDUA 4MDDA 3VT5A 5KR9A 2ABIA 2JJ3A 2PIQA 3BC5A 4G2IA 5AAUA 2QH6A 1X76A 2QA8B 4PXMA 3GN8A 3PLZA 3OMMA 4XLDA 5DLRA 2R40D 3KBAA 4G1YA 2P7ZA 5FQTA 1PZLA 1XV9A 4QJRA 3B5RA 2YLQA 5GICA 3UUCA 3FEIA 1R1KD 3B0TA 4OEYA 1HG4A 1PCGA 4ITFA 1X7EA 4RZEA 5G42A 5DX3A 3VJHA 3NSQA 2ZMJA 1DKFA 5DRJA 5AZTA 4IVYA 4WPFA 5G46A 2NPAA 4MG7B 1RKGA 3U9QA 3FC6B 4XUMA 3GZ9A 4APUA 5JJMB 5IAWA 1ZKYA 3WWRA 5DYBA 4JYHA 1NAVA 2P7AA 3BEJA 4YPQA 5KCEA 1YUCA 3L3ZA 3E94A 5EI1A 1T7TA 1K74A 3OZJA 3PRGA 1YMTA 5DMFA 3D57A 3VT3A 2ZNOA 4RWVA 3JZBA 3OGTA 4QL8A 5B41A 1XV9B 3CS4A 1RDTD 2R6YA 5DXPA 2B23A 2PINA 3OKIA 2G0HA 1I38A 4R6SA 1GWRA 4IWCA 4ZOMA 5DX3B 3VT7A 1GS4A 1DKFB 2NV7A 3V49A 4DMAA 4PRGA 1XVPA 5DXEA 2GWXA 3OSIA 2PIXA 5APKA 1UPVA 3V3EA 1OVLA 5DIDA 2AA5A 2NW4A 4ZJWA 3A2IA 1XPCA 2VSRA 1E3GA 1S0ZA 1ZH7A 2ZNQA 4M8EA 3KWYA 3SZ1A 4DM8A 5DV3A 3ADSA 5DXKA 5DZ3A 5HJPA 1ZUCA 1T76A 1NAXA 3RVFA 1XP1A 4YNKA 5APHA 3R29A 3ZQTA 1EXXA 4POJA 5L7GA 3OSAA 1ZAFA 5SYZA 1SQNA 4M8HA 1QKNA 3ET0A 4O8FA 4OKBA 1YOKA 3W0HA 1PQ6A 5FQVA 1UHLA 3VT4A 4OH5A 5DP0A 1XQCA 1XVPB 1YINA 1PRGA 4DQMA 2AM9A 2NXXE 4YT1A 2R40A 5HYKA 4HEEX 2AYRA 1YY4A 5E19A 1OVLB 3AURA 3GWSX 3PBAA 1KNUA 4ZNUA 4IQRA 3P8XA 4IWFA 3B68A 3OMQA 4OEAA 5DKEA 1UPWA 2XYJA 3IXPD 5EGVA 1R1KA 3UP3A 4J24A 3ERTA 3LMPA 4N73A 5KRKA 3DY6A 2QW4A 2I0JA 5HJPB 4G21A 3CLDA 5HYRA 1RKHA 3OAPA 2I4ZA 3VRTA 2IOGA 3NSPA 1XP9A 4OHAA 5KCCA 2REWA 2Q1HA 5E1CA 3X36A 2B50A 3A9EA 4OLMA 4JYGA 1UHLB 1ZDUA 2B1ZA 2W8YA 5DWJA 1R5KA 5DI7A 5DY8A 3FEJA 2QMVA 2OVMA 2P7GA 2POGA 2YJDA 3GBKA 5M96A 1YJEA 4ZNSA 1RDTA 3WMHA 4NB6A 1KKQA 3V9TA 2FSZA 3ET1A 2G44A 4J5WC 2J7XA 4UDAA 3R8DA 5DV8A 5KCDA 1PQCA 2AB2A 2P1TA 4OZRE 3VTCA 1YA3A 3K6PA 4OILA 5KYJA 5AAVA 1XNNA 3V9YA 4EM9A 3V3QA 1R6GA 4DM6A 1P93A 2ZXMA 4NIEA 4OC7A 4ZJRA 4OIVA 4PLEA 3P89A 2PNUA 3K22A 5L11A 3OLSA 4ZI1A 5KRIA 2QABA 3A9EB 1Z95A 3CWDA 4MGAA 4OJ9A 4OKXA 2VV2A 3VJIA 1QKTA 1SR7A 4NUFA 1L2JA 2R6WA 2VV3A 5AYGA 3W0AA 2ZFXA 5H1EA 3A78A 4OEDA 5DVVA 5DK9A 1OT7A 2J14A 3HC6A 4OARA 2PIRA 4WLBA 5DZ0A 3AN4A 3KMRA 4PF3A 1T7FA 1K7LA 4IV2A 1S9QA 4LNXA 1S19A 3W0JA 5AAVB 2ZASA 3V9VA 2YHDA 4UDBA 4OK1A 1KV6A 1GWQA 4REEA 3SP9A 2E2RA 4DORA 5L7HA 4PP3A 4MG8A 1FCXA 1Y0XX 3ADXA 1U9EA 4MGAB 1FD0A 3ZRAA 2P1UA 3IXPA 3B0RA 2J7YA 2Q5SA 2QGTA 1YP0A 5DIGA 4BCRA 3TY0A 5KROA 1EXAA 4J5WA 2QA6A 5DSHA 4A4VA 2YLOA 3GD2A 2AX6A 3UUDA 5LWPA 1R20D 3UU7A 3AZ3A 2OUZA 1SKXA 5DVCA 1YIMA 1NHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXM A;  1FM9 D;  3HLV A;  3LBD A;  3GWX A;  3OS8 C;  4E2J A;  3OMO A;  2YFE A;  3L0L A;  2AAX A;  3CJW A;  3R5N A;  4UDD A;  5B5B A;  5JY3 A;  4WHF A;  1NQ2 A;  5DYD A;  5KYA A;  4RMD A;  3EYB A;  4G1Z A;  1QKU A;  3RY9 A;  4OZT U;  4EMA A;  3P0U A;  4RUJ A;  4WVD A;  4MG8 B;  4X1F A;  3KPZ A;  4ZNH A;  4IVW A;  4N5G A;  4IA3 A;  2ZK2 A;  3UVV A;  2Q7I A;  3ZRB A;  2QXS A;  3UUD B;  2A3I A;  2QTU A;  3CS8 A;  2OZ7 A;  2IOK A;  2J4A A;  3UU7 B;  2AA2 A;  1X7J A;  2ZKC A;  1N4H A;  4N1Y A;  2HBH A;  4XUH A;  4LTW A;  4PVU A;  5EIT A;  3OMK A;  5DWL A;  2XHS A;  5DWG A;  3WJ4 A;  4A2J A;  1Q4X A;  4ZO1 X;  4QE8 A;  2OAX A;  3CS6 A;  4OEZ A;  4CI5 A;  1I7G A;  5C4T A;  4FGY A;  2I4P A;  3OOF A;  3B66 A;  4N8R A;  1OSH A;  5E14 A;  3T03 A;  3L0J A;  2BAW A;  2P4Y A;  2YJA B;  3VRU A;  4IW8 A;  4K6I A;  3CQV A;  3FLI A;  2ZMH A;  4XHD A;  4WQP A;  4FNE A;  3UVV B;  4B7W A;  3A40 X;  2HB8 A;  2ZK1 A;  4P6X A;  5FQP A;  3VHU A;  4F9M A;  3IPS A;  3OS8 A;  5DZ1 A;  2AXA A;  1RK3 A;  2HAS A;  2Q59 A;  5AVI A;  2ZK6 A;  1M13 A;  5DXG A;  5DIE A;  3VSO A;  3WGP A;  3KMG A;  5K13 A;  1NUO A;  5E15 A;  3B3K A;  1T7R A;  2EWP A;  4R06 A;  1XZX X;  5CJ6 A;  3DCU A;  4IUI A;  4CI4 A;  2QPY A;  1MZN A;  4JGV A;  3ADT A;  4FHI A;  1XQ3 A;  5AWK A;  4MG6 A;  1Z5X E;  3VRW A;  2PIP L;  2H79 A;  3FAL A;  1R20 A;  4RMC A;  1G2N A;  5KRF A;  5C4S A;  3F7D A;  2PIV A;  2ZK4 A;  4S0S A;  1XLS A;  2QE4 A;  4MG5 A;  1YOW A;  1FM9 A;  5JI0 D;  2JFA A;  4JYI A;  5KD9 A;  4TUZ A;  4LNW A;  4MGD A;  5KCF A;  3ZR7 A;  2Q59 B;  5GID A;  5DTV A;  4L98 A;  1ILG A;  1P8D A;  1VJB A;  1XP6 A;  4QM0 A;  4S14 A;  2AWH A;  1FCZ A;  5KRJ A;  1XOW A;  2ZK0 A;  2O9I A;  3HQ5 A;  1ILH A;  4PP5 A;  1FM6 D;  4KZI A;  5DUE A;  3MNP A;  2PIO A;  1FCY A;  1ZEO A;  1IE8 A;  2Q6J A;  3A3Z X;  3IA6 A;  3KYT A;  3DT3 A;  1MVC A;  3WT6 A;  5DMC A;  2GTK A;  5KRA A;  3R2A A;  1NRL A;  1Y9R A;  3D5F A;  3WT5 A;  3FAL B;  4Q13 A;  2AMA A;  2YLY A;  3DR1 A;  5G43 A;  3V4A A;  4FHH A;  5GT4 A;  5ICK A;  2GPP A;  3CDP A;  2ZL9 A;  4TV1 A;  3D6D A;  5DRM A;  5DUG A;  3R5M A;  2JFA B;  2Q5P A;  3ET3 A;  4TUZ B;  2HVC A;  3NOA A;  2HWR A;  4MGD B;  4XI3 A;  5IXK A;  4X1G A;  3VTD A;  2PRG A;  2Z4B A;  3HM1 A;  5DXB A;  5C4O A;  4OH6 A;  2VV1 A;  4RFW A;  1OSV A;  3G8O A;  3FUG A;  4IW6 A;  5KRL A;  2OM9 A;  5DVS A;  3HC5 A;  3G9E A;  1XJ7 A;  3AFR A;  3ILZ A;  3MNO A;  5A86 A;  5APJ A;  4J5X A;  5HZC A;  3RUT A;  2ZNN A;  3VSP A;  5AVL A;  3TKM A;  2QZO A;  2VV4 A;  3B0W A;  2OCF A;  2POB A;  4JL4 A;  4TV1 B;  1RJK A;  1K4W A;  3ADV A;  3HO0 A;  3OKH A;  3B67 A;  3HZF A;  4G1D A;  5DZI A;  3IMY A;  3N00 A;  1XNX A;  2QNV A;  3K23 A;  3DZY D;  3D24 A;  4J26 A;  3CTB A;  1DB1 A;  4P6W A;  3OS9 A;  1T73 A;  3VHV A;  1XIU A;  3W5P A;  3IPQ A;  3L3X A;  5DXB B;  2YAT A;  2VV1 B;  2HCD A;  3K8S A;  4RZG A;  2Q8S A;  5DKS A;  2Q70 A;  4PWL A;  1GWX A;  3AZ1 A;  1E3K A;  1T74 A;  1XDK A;  2VV0 A;  5DKG A;  3JZC A;  4RZF A;  2Q61 A;  4OJ4 A;  2V0V A;  5ETH A;  3L03 A;  5DZH A;  3DZU D;  4KZJ A;  3R8I A;  2FVJ A;  4XT9 A;  2Q60 A;  3SP6 A;  2B1V A;  2QZO B;  2VV4 B;  5HJS A;  3TX7 B;  4ONI A;  2Q6S A;  4LBD A;  2QSE A;  4ZNV A;  5KCU A;  1FM6 A;  4PPP A;  4Q0A C;  4NY9 A;  3VRV A;  3W0I A;  3S9S A;  3WJ5 A;  1XAP A;  1BSX A;  2ZK5 A;  1X78 A;  4XTA A;  1T65 A;  4IA1 A;  5C4U A;  2ZVT A;  3VI8 A;  3G0W A;  4IA7 A;  3PO9 A;  1S9P A;  2AX8 A;  5F9B A;  3B0Q A;  2Q7L A;  2AO6 A;  2HFP A;  5KCT A;  1I7I A;  3PEQ A;  1XDK B;  2ZY0 A;  2H77 A;  5DXR A;  2HWQ A;  3RLJ A;  2GL8 A;  3WTQ A;  5ACC A;  4RE8 A;  3IPU A;  4OKT A;  3FS1 A;  2BJ4 A;  3X1H A;  3E00 D;  1ERR A;  1X7B A;  3OZ0 A;  4S0T A;  4OFU A;  3UUA A;  5KRM A;  1PQ9 A;  2HAM A;  3PCU A;  4OZR U;  4MGB A;  5DL4 A;  2LBD A;  3AZ2 A;  4IV4 A;  1U3R A;  3R8A A;  2Q6R A;  5KRC A;  3OMP A;  2HB7 A;  2HAR A;  2AMB A;  3G8I A;  4IA2 A;  5IZ0 A;  4YMQ A;  5KCW A;  2G5O A;  2Q7J A;  4PP6 A;  1Y0S A;  2HC4 A;  3TKC A;  4ZN7 A;  1I37 A;  2I4J A;  1G50 A;  4RME A;  1L2I A;  3VHW A;  1T63 A;  2P15 A;  3H0A D;  5DUH A;  3ADU A;  3W0C A;  2PKL A;  4DK7 A;  5L7E A;  3VJS A;  1N46 A;  1NQ1 A;  2AA7 A;  4NQA B;  1N83 A;  5DWE A;  2P54 A;  1H9U A;  2O4J A;  1G5Y A;  2BJ4 B;  4RUP A;  5G3J A;  2Q7K A;  5EJV A;  1A28 A;  2G0G A;  3DZY A;  3UUA B;  2XYW A;  2XKW A;  3A2H A;  1XLS E;  4OGH A;  3RLL A;  3OSW A;  4MGB B;  3W5R A;  1ZDT A;  3B65 A;  3X31 A;  1TFC A;  2GPV A;  2ZNP A;  4DOS A;  3E7C A;  4PLD A;  3VJT A;  2AX7 A;  3WFG A;  2FAI A;  3OOK A;  5I4V A;  3DZU A;  4XAO A;  4RUO X;  3UP0 A;  3Q95 A;  4G20 A;  2QR9 A;  4FN9 A;  4KZM A;  4LSJ A;  3AX8 A;  4J5X C;  4E4K A;  3VT6 A;  1NQ7 A;  1XB7 A;  3DCT A;  2AA6 A;  4L96 A;  1LV2 A;  4OJB A;  2I0G A;  3B1M A;  3GYU A;  2Q5G A;  5DU5 A;  2JF9 A;  2IHQ A;  5DV6 A;  5AWJ A;  3H52 A;  1PK5 A;  2GPO A;  3AUN A;  4Q50 A;  5GIE A;  4ZN9 A;  5KRH A;  2Z4J A;  3ET2 A;  3W0Y A;  4E4Q A;  4G2H A;  4MG9 A;  1IE9 A;  1S0X A;  3GYT A;  1ZGY A;  3KFC A;  5EC9 A;  2ZXZ A;  3KDT A;  2GPU A;  5G45 A;  2PIW A;  5E0X A;  1YYE A;  3W5T A;  1T5Z A;  4MGC A;  3E00 A;  5DXQ A;  5DKB A;  3Q95 B;  1NQ0 A;  4JAZ A;  2ACL A;  3VT9 A;  5E7V A;  2NXX A;  5EHJ A;  2OVH A;  4ZNT A;  5FQR A;  2PIT A;  4ZO1 B;  2P1V A;  4OZT E;  2V7C A;  1A52 A;  4POH A;  5DXM A;  1TXI A;  3VTB A;  1M2Z A;  4R2U A;  3W5Q A;  1U3Q A;  2ZXN A;  3KMZ A;  4OIU A;  4UDC A;  3ERD A;  2GP7 A;  4MG9 B;  2ZMI A;  1U3S A;  1T79 A;  4QE6 A;  1FBY A;  4PPS A;  3QT0 A;  3H0A A;  3RUU A;  4HLW A;  4Y29 A;  1K74 D;  3F5C A;  4DK8 A;  3W0G A;  1M7W A;  2GIU A;  2PIU A;  3D90 A;  4IS8 A;  4QK4 A;  5AZV A;  1QKM A;  5DWI A;  4ZNW A;  2ACL B;  4RAK A;  1SJ0 A;  3A2J A;  3AN3 A;  3HVL A;  2XYX A;  4S15 A;  3L0E A;  2PJL A;  2O4R A;  3MNE A;  2ATH A;  1WM0 X;  2ZK3 A;  4OFR A;  1LBD A;  3BQD A;  3WFF A;  4OKW A;  3ADW A;  2QA8 A;  3FXV A;  3O1E A;  1G1U A;  4K7A A;  3WT7 A;  4REF A;  2Q1V A;  2QGW A;  5AK2 A;  3OLL A;  1T7M A;  2Q3Y A;  2F4B A;  1NYX A;  4WHG A;  3VN2 A;  1HJ1 A;  2ZLA A;  5HCV A;  3O1D A;  3VT8 A;  4A4W A;  1X7R A;  3OLF A;  4K4J A;  3HOD A;  2ZLC A;  5E0W A;  3P88 A;  5LGA A;  1Z5X U;  3F5C B;  1NDE A;  1MV9 A;  2AX9 A;  2YLP A;  3FUR A;  3CDS A;  3X1I A;  2ZBS A;  4CSJ A;  1PDU A;  3L1B A;  5JJM A;  4MG7 A;  3FC6 A;  3M7R A;  2VST A;  4ITE A;  4IU7 A;  5G44 A;  3AUQ A;  1UOM A;  5G5W A;  5FQS A;  1ERE A;  3KDU A;  4MDD A;  3VT5 A;  5KR9 A;  2ABI A;  2JJ3 A;  2PIQ A;  3BC5 A;  4G2I A;  5AAU A;  2QH6 A;  1X76 A;  2QA8 B;  4PXM A;  3GN8 A;  3PLZ A;  3OMM A;  4XLD A;  5DLR A;  2R40 D;  3KBA A;  4G1Y A;  2P7Z A;  5FQT A;  1PZL A;  1XV9 A;  4QJR A;  3B5R A;  2YLQ A;  5GIC A;  3UUC A;  3FEI A;  1R1K D;  3B0T A;  4OEY A;  1HG4 A;  1PCG A;  4ITF A;  1X7E A;  4RZE A;  5G42 A;  5DX3 A;  3VJH A;  3NSQ A;  2ZMJ A;  1DKF A;  5DRJ A;  5AZT A;  4IVY A;  4WPF A;  5G46 A;  2NPA A;  4MG7 B;  1RKG A;  3U9Q A;  3FC6 B;  4XUM A;  3GZ9 A;  4APU A;  5JJM B;  5IAW A;  1ZKY A;  3WWR A;  5DYB A;  4JYH A;  1NAV A;  2P7A A;  3BEJ A;  4YPQ A;  5KCE A;  1YUC A;  3L3Z A;  3E94 A;  5EI1 A;  1T7T A;  1K74 A;  3OZJ A;  3PRG A;  1YMT A;  5DMF A;  3D57 A;  3VT3 A;  2ZNO A;  4RWV A;  3JZB A;  3OGT A;  4QL8 A;  5B41 A;  1XV9 B;  3CS4 A;  1RDT D;  2R6Y A;  5DXP A;  2B23 A;  2PIN A;  3OKI A;  2G0H A;  1I38 A;  4R6S A;  1GWR A;  4IWC A;  4ZOM A;  5DX3 B;  3VT7 A;  1GS4 A;  1DKF B;  2NV7 A;  3V49 A;  4DMA A;  4PRG A;  1XVP A;  5DXE A;  2GWX A;  3OSI A;  2PIX A;  5APK A;  1UPV A;  3V3E A;  1OVL A;  5DID A;  2AA5 A;  2NW4 A;  4ZJW A;  3A2I A;  1XPC A;  2VSR A;  1E3G A;  1S0Z A;  1ZH7 A;  2ZNQ A;  4M8E A;  3KWY A;  3SZ1 A;  4DM8 A;  5DV3 A;  3ADS A;  5DXK A;  5DZ3 A;  5HJP A;  1ZUC A;  1T76 A;  1NAX A;  3RVF A;  1XP1 A;  4YNK A;  5APH A;  3R29 A;  3ZQT A;  1EXX A;  4POJ A;  5L7G A;  3OSA A;  1ZAF A;  5SYZ A;  1SQN A;  4M8H A;  1QKN A;  3ET0 A;  4O8F A;  4OKB A;  1YOK A;  3W0H A;  1PQ6 A;  5FQV A;  1UHL A;  3VT4 A;  4OH5 A;  5DP0 A;  1XQC A;  1XVP B;  1YIN A;  1PRG A;  4DQM A;  2AM9 A;  2NXX E;  4YT1 A;  2R40 A;  5HYK A;  4HEE X;  2AYR A;  1YY4 A;  5E19 A;  1OVL B;  3AUR A;  3GWS X;  3PBA A;  1KNU A;  4ZNU A;  4IQR A;  3P8X A;  4IWF A;  3B68 A;  3OMQ A;  4OEA A;  5DKE A;  1UPW A;  2XYJ A;  3IXP D;  5EGV A;  1R1K A;  3UP3 A;  4J24 A;  3ERT A;  3LMP A;  4N73 A;  5KRK A;  3DY6 A;  2QW4 A;  2I0J A;  5HJP B;  4G21 A;  3CLD A;  5HYR A;  1RKH A;  3OAP A;  2I4Z A;  3VRT A;  2IOG A;  3NSP A;  1XP9 A;  4OHA A;  5KCC A;  2REW A;  2Q1H A;  5E1C A;  3X36 A;  2B50 A;  3A9E A;  4OLM A;  4JYG A;  1UHL B;  1ZDU A;  2B1Z A;  2W8Y A;  5DWJ A;  1R5K A;  5DI7 A;  5DY8 A;  3FEJ A;  2QMV A;  2OVM A;  2P7G A;  2POG A;  2YJD A;  3GBK A;  5M96 A;  1YJE A;  4ZNS A;  1RDT A;  3WMH A;  4NB6 A;  1KKQ A;  3V9T A;  2FSZ A;  3ET1 A;  2G44 A;  4J5W C;  2J7X A;  4UDA A;  3R8D A;  5DV8 A;  5KCD A;  1PQC A;  2AB2 A;  2P1T A;  4OZR E;  3VTC A;  1YA3 A;  3K6P A;  4OIL A;  5KYJ A;  5AAV A;  1XNN A;  3V9Y A;  4EM9 A;  3V3Q A;  1R6G A;  4DM6 A;  1P93 A;  2ZXM A;  4NIE A;  4OC7 A;  4ZJR A;  4OIV A;  4PLE A;  3P89 A;  2PNU A;  3K22 A;  5L11 A;  3OLS A;  4ZI1 A;  5KRI A;  2QAB A;  3A9E B;  1Z95 A;  3CWD A;  4MGA A;  4OJ9 A;  4OKX A;  2VV2 A;  3VJI A;  1QKT A;  1SR7 A;  4NUF A;  1L2J A;  2R6W A;  2VV3 A;  5AYG A;  3W0A A;  2ZFX A;  5H1E A;  3A78 A;  4OED A;  5DVV A;  5DK9 A;  1OT7 A;  2J14 A;  3HC6 A;  4OAR A;  2PIR A;  4WLB A;  5DZ0 A;  3AN4 A;  3KMR A;  4PF3 A;  1T7F A;  1K7L A;  4IV2 A;  1S9Q A;  4LNX A;  1S19 A;  3W0J A;  5AAV B;  2ZAS A;  3V9V A;  2YHD A;  4UDB A;  4OK1 A;  1KV6 A;  1GWQ A;  4REE A;  3SP9 A;  2E2R A;  4DOR A;  5L7H A;  4PP3 A;  4MG8 A;  1FCX A;  1Y0X X;  3ADX A;  1U9E A;  4MGA B;  1FD0 A;  3ZRA A;  2P1U A;  3IXP A;  3B0R A;  2J7Y A;  2Q5S A;  2QGT A;  1YP0 A;  5DIG A;  4BCR A;  3TY0 A;  5KRO A;  1EXA A;  4J5W A;  2QA6 A;  5DSH A;  4A4V A;  2YLO A;  3GD2 A;  2AX6 A;  3UUD A;  5LWP A;  1R20 D;  3UU7 A;  3AZ3 A;  2OUZ A;  1SKX A;  5DVC A;  1YIM A;  1NHZ A; 
#chains in the Genus database with same CATH topology
 2QXM A;  1FM9 D;  3HLV A;  3LBD A;  3GWX A;  3OS8 C;  4E2J A;  3OMO A;  2YFE A;  3L0L A;  2AAX A;  3CJW A;  3R5N A;  4UDD A;  5B5B A;  5JY3 A;  4WHF A;  1NQ2 A;  5DYD A;  5KYA A;  4RMD A;  3EYB A;  4G1Z A;  1QKU A;  3RY9 A;  4OZT U;  4EMA A;  3P0U A;  4RUJ A;  4WVD A;  4MG8 B;  4X1F A;  3KPZ A;  4ZNH A;  4IVW A;  4N5G A;  4IA3 A;  2ZK2 A;  3UVV A;  2Q7I A;  3ZRB A;  2QXS A;  3UUD B;  2A3I A;  2QTU A;  3CS8 A;  2OZ7 A;  2IOK A;  2J4A A;  3UU7 B;  2AA2 A;  1X7J A;  2ZKC A;  1N4H A;  4N1Y A;  2HBH A;  4XUH A;  4LTW A;  4PVU A;  5EIT A;  3OMK A;  5DWL A;  2XHS A;  5DWG A;  3WJ4 A;  4A2J A;  1Q4X A;  4ZO1 X;  4QE8 A;  2OAX A;  3CS6 A;  4OEZ A;  4CI5 A;  1I7G A;  5C4T A;  4FGY A;  2I4P A;  3OOF A;  3B66 A;  4N8R A;  1OSH A;  5E14 A;  3T03 A;  3L0J A;  2BAW A;  2P4Y A;  2YJA B;  3VRU A;  4IW8 A;  4K6I A;  3CQV A;  3FLI A;  2ZMH A;  4XHD A;  4WQP A;  4FNE A;  3UVV B;  4B7W A;  3A40 X;  2HB8 A;  2ZK1 A;  4P6X A;  5FQP A;  3VHU A;  4F9M A;  3IPS A;  3OS8 A;  5DZ1 A;  2AXA A;  1RK3 A;  2HAS A;  2Q59 A;  5AVI A;  2ZK6 A;  1M13 A;  5DXG A;  5DIE A;  3VSO A;  3WGP A;  3KMG A;  5K13 A;  1NUO A;  5E15 A;  3B3K A;  1T7R A;  2EWP A;  4R06 A;  1XZX X;  5CJ6 A;  3DCU A;  4IUI A;  4CI4 A;  2QPY A;  1MZN A;  4JGV A;  3ADT A;  4FHI A;  1XQ3 A;  5AWK A;  4MG6 A;  1Z5X E;  3VRW A;  2PIP L;  2H79 A;  3FAL A;  1R20 A;  4RMC A;  1G2N A;  5KRF A;  5C4S A;  3F7D A;  2PIV A;  2ZK4 A;  4S0S A;  1XLS A;  2QE4 A;  4MG5 A;  1YOW A;  1FM9 A;  5JI0 D;  2JFA A;  4JYI A;  5KD9 A;  4TUZ A;  4LNW A;  4MGD A;  5KCF A;  3ZR7 A;  2Q59 B;  5GID A;  5DTV A;  4L98 A;  1ILG A;  1P8D A;  1VJB A;  1XP6 A;  4QM0 A;  4S14 A;  2AWH A;  1FCZ A;  5KRJ A;  1XOW A;  2ZK0 A;  2O9I A;  3HQ5 A;  1ILH A;  4PP5 A;  1FM6 D;  4KZI A;  5DUE A;  3MNP A;  2PIO A;  1FCY A;  1ZEO A;  1IE8 A;  2Q6J A;  3A3Z X;  3IA6 A;  3KYT A;  3DT3 A;  1MVC A;  3WT6 A;  5DMC A;  2GTK A;  5KRA A;  3R2A A;  1NRL A;  1Y9R A;  3D5F A;  3WT5 A;  3FAL B;  4Q13 A;  2AMA A;  2YLY A;  3DR1 A;  5G43 A;  3V4A A;  4FHH A;  5GT4 A;  5ICK A;  2GPP A;  3CDP A;  2ZL9 A;  4TV1 A;  3D6D A;  5DRM A;  5DUG A;  3R5M A;  2JFA B;  2Q5P A;  3ET3 A;  4TUZ B;  2HVC A;  3NOA A;  2HWR A;  4MGD B;  4XI3 A;  5IXK A;  4X1G A;  3VTD A;  2PRG A;  2Z4B A;  3HM1 A;  5DXB A;  5C4O A;  4OH6 A;  2VV1 A;  4RFW A;  1OSV A;  3G8O A;  3FUG A;  4IW6 A;  5KRL A;  2OM9 A;  5DVS A;  3HC5 A;  3G9E A;  1XJ7 A;  3AFR A;  3ILZ A;  3MNO A;  5A86 A;  5APJ A;  4J5X A;  5HZC A;  3RUT A;  2ZNN A;  3VSP A;  5AVL A;  3TKM A;  2QZO A;  2VV4 A;  3B0W A;  2OCF A;  2POB A;  4JL4 A;  4TV1 B;  1RJK A;  1K4W A;  3ADV A;  3HO0 A;  3OKH A;  3B67 A;  3HZF A;  4G1D A;  5DZI A;  3IMY A;  3N00 A;  1XNX A;  2QNV A;  3K23 A;  3DZY D;  3D24 A;  4J26 A;  3CTB A;  1DB1 A;  4P6W A;  3OS9 A;  1T73 A;  3VHV A;  1XIU A;  3W5P A;  3IPQ A;  3L3X A;  5DXB B;  2YAT A;  2VV1 B;  2HCD A;  3K8S A;  4RZG A;  2Q8S A;  5DKS A;  2Q70 A;  4PWL A;  1GWX A;  3AZ1 A;  1E3K A;  1T74 A;  1XDK A;  2VV0 A;  5DKG A;  3JZC A;  4RZF A;  2Q61 A;  4OJ4 A;  2V0V A;  5ETH A;  3L03 A;  5DZH A;  3DZU D;  4KZJ A;  3R8I A;  2FVJ A;  4XT9 A;  2Q60 A;  3SP6 A;  2B1V A;  2QZO B;  2VV4 B;  5HJS A;  3TX7 B;  4ONI A;  2Q6S A;  4LBD A;  2QSE A;  4ZNV A;  5KCU A;  1FM6 A;  4PPP A;  4Q0A C;  4NY9 A;  3VRV A;  3W0I A;  3S9S A;  3WJ5 A;  1XAP A;  1BSX A;  2ZK5 A;  1X78 A;  4XTA A;  1T65 A;  4IA1 A;  5C4U A;  2ZVT A;  3VI8 A;  3G0W A;  4IA7 A;  3PO9 A;  1S9P A;  2AX8 A;  5F9B A;  3B0Q A;  2Q7L A;  2AO6 A;  2HFP A;  5KCT A;  1I7I A;  3PEQ A;  1XDK B;  2ZY0 A;  2H77 A;  5DXR A;  2HWQ A;  3RLJ A;  2GL8 A;  3WTQ A;  5ACC A;  4RE8 A;  3IPU A;  4OKT A;  3FS1 A;  2BJ4 A;  3X1H A;  3E00 D;  1ERR A;  1X7B A;  3OZ0 A;  4S0T A;  4OFU A;  3UUA A;  5KRM A;  1PQ9 A;  2HAM A;  3PCU A;  4OZR U;  4MGB A;  5DL4 A;  2LBD A;  3AZ2 A;  4IV4 A;  1U3R A;  3R8A A;  2Q6R A;  5KRC A;  3OMP A;  2HB7 A;  2HAR A;  2AMB A;  3G8I A;  4IA2 A;  5IZ0 A;  4YMQ A;  5KCW A;  2G5O A;  2Q7J A;  4PP6 A;  1Y0S A;  2HC4 A;  3TKC A;  4ZN7 A;  1I37 A;  2I4J A;  1G50 A;  4RME A;  1L2I A;  3VHW A;  1T63 A;  2P15 A;  3H0A D;  5DUH A;  3ADU A;  3W0C A;  2PKL A;  4DK7 A;  5L7E A;  3VJS A;  1N46 A;  1NQ1 A;  2AA7 A;  4NQA B;  1N83 A;  5DWE A;  2P54 A;  1H9U A;  2O4J A;  1G5Y A;  2BJ4 B;  4RUP A;  5G3J A;  2Q7K A;  5EJV A;  1A28 A;  2G0G A;  3DZY A;  3UUA B;  2XYW A;  2XKW A;  3A2H A;  1XLS E;  4OGH A;  3RLL A;  3OSW A;  4MGB B;  3W5R A;  1ZDT A;  3B65 A;  3X31 A;  1TFC A;  2GPV A;  2ZNP A;  4DOS A;  3E7C A;  4PLD A;  3VJT A;  2AX7 A;  3WFG A;  2FAI A;  3OOK A;  5I4V A;  3DZU A;  4XAO A;  4RUO X;  3UP0 A;  3Q95 A;  4G20 A;  2QR9 A;  4FN9 A;  4KZM A;  4LSJ A;  3AX8 A;  4J5X C;  4E4K A;  3VT6 A;  1NQ7 A;  1XB7 A;  3DCT A;  2AA6 A;  4L96 A;  1LV2 A;  4OJB A;  2I0G A;  3B1M A;  3GYU A;  2Q5G A;  5DU5 A;  2JF9 A;  2IHQ A;  5DV6 A;  5AWJ A;  3H52 A;  1PK5 A;  2GPO A;  3AUN A;  4Q50 A;  5GIE A;  4ZN9 A;  5KRH A;  2Z4J A;  3ET2 A;  3W0Y A;  4E4Q A;  4G2H A;  4MG9 A;  1IE9 A;  1S0X A;  3GYT A;  1ZGY A;  3KFC A;  5EC9 A;  2ZXZ A;  3KDT A;  2GPU A;  5G45 A;  2PIW A;  5E0X A;  1YYE A;  3W5T A;  1T5Z A;  4MGC A;  3E00 A;  5DXQ A;  5DKB A;  3Q95 B;  1NQ0 A;  4JAZ A;  2ACL A;  3VT9 A;  5E7V A;  2NXX A;  5EHJ A;  2OVH A;  4ZNT A;  5FQR A;  2PIT A;  4ZO1 B;  2P1V A;  4OZT E;  2V7C A;  1A52 A;  4POH A;  5DXM A;  1TXI A;  3VTB A;  1M2Z A;  4R2U A;  3W5Q A;  1U3Q A;  2ZXN A;  3KMZ A;  4OIU A;  4UDC A;  3ERD A;  2GP7 A;  4MG9 B;  2ZMI A;  1U3S A;  1T79 A;  4QE6 A;  1FBY A;  4PPS A;  3QT0 A;  3H0A A;  3RUU A;  4HLW A;  4Y29 A;  1K74 D;  3F5C A;  4DK8 A;  3W0G A;  1M7W A;  2GIU A;  2PIU A;  3D90 A;  4IS8 A;  4QK4 A;  5AZV A;  1QKM A;  5DWI A;  4ZNW A;  2ACL B;  4RAK A;  1SJ0 A;  3A2J A;  3AN3 A;  3HVL A;  2XYX A;  4S15 A;  3L0E A;  2PJL A;  2O4R A;  3MNE A;  2ATH A;  1WM0 X;  2ZK3 A;  4OFR A;  1LBD A;  3BQD A;  3WFF A;  4OKW A;  3ADW A;  2QA8 A;  3FXV A;  3O1E A;  1G1U A;  4K7A A;  3WT7 A;  4REF A;  2Q1V A;  2QGW A;  5AK2 A;  3OLL A;  1T7M A;  2Q3Y A;  2F4B A;  1NYX A;  4WHG A;  3VN2 A;  1HJ1 A;  2ZLA A;  5HCV A;  3O1D A;  3VT8 A;  4A4W A;  1X7R A;  3OLF A;  4K4J A;  3HOD A;  2ZLC A;  5E0W A;  3P88 A;  5LGA A;  1Z5X U;  3F5C B;  1NDE A;  1MV9 A;  2AX9 A;  2YLP A;  3FUR A;  3CDS A;  3X1I A;  2ZBS A;  4CSJ A;  1PDU A;  3L1B A;  5JJM A;  4MG7 A;  3FC6 A;  3M7R A;  2VST A;  4ITE A;  4IU7 A;  5G44 A;  3AUQ A;  1UOM A;  5G5W A;  5FQS A;  1ERE A;  3KDU A;  4MDD A;  3VT5 A;  5KR9 A;  2ABI A;  2JJ3 A;  2PIQ A;  3BC5 A;  4G2I A;  5AAU A;  2QH6 A;  1X76 A;  2QA8 B;  4PXM A;  3GN8 A;  3PLZ A;  3OMM A;  4XLD A;  5DLR A;  2R40 D;  3KBA A;  4G1Y A;  2P7Z A;  5FQT A;  1PZL A;  1XV9 A;  4QJR A;  3B5R A;  2YLQ A;  5GIC A;  3UUC A;  3FEI A;  1R1K D;  3B0T A;  4OEY A;  1HG4 A;  1PCG A;  4ITF A;  1X7E A;  4RZE A;  5G42 A;  5DX3 A;  3VJH A;  3NSQ A;  2ZMJ A;  1DKF A;  5DRJ A;  5AZT A;  4IVY A;  4WPF A;  5G46 A;  2NPA A;  4MG7 B;  1RKG A;  3U9Q A;  3FC6 B;  4XUM A;  3GZ9 A;  4APU A;  5JJM B;  5IAW A;  1ZKY A;  3WWR A;  5DYB A;  4JYH A;  1NAV A;  2P7A A;  3BEJ A;  4YPQ A;  5KCE A;  1YUC A;  3L3Z A;  3E94 A;  5EI1 A;  1T7T A;  1K74 A;  3OZJ A;  3PRG A;  1YMT A;  5DMF A;  3D57 A;  3VT3 A;  2ZNO A;  4RWV A;  3JZB A;  3OGT A;  4QL8 A;  5B41 A;  1XV9 B;  3CS4 A;  1RDT D;  2R6Y A;  5DXP A;  2B23 A;  2PIN A;  3OKI A;  2G0H A;  1I38 A;  4R6S A;  1GWR A;  4IWC A;  4ZOM A;  5DX3 B;  3VT7 A;  1GS4 A;  1DKF B;  2NV7 A;  3V49 A;  4DMA A;  4PRG A;  1XVP A;  5DXE A;  2GWX A;  3OSI A;  2PIX A;  5APK A;  1UPV A;  3V3E A;  1OVL A;  5DID A;  2AA5 A;  2NW4 A;  4ZJW A;  3A2I A;  1XPC A;  2VSR A;  1E3G A;  1S0Z A;  1ZH7 A;  2ZNQ A;  4M8E A;  3KWY A;  3SZ1 A;  4DM8 A;  5DV3 A;  3ADS A;  5DXK A;  5DZ3 A;  5HJP A;  1ZUC A;  1T76 A;  1NAX A;  3RVF A;  1XP1 A;  4YNK A;  5APH A;  3R29 A;  3ZQT A;  1EXX A;  4POJ A;  5L7G A;  3OSA A;  1ZAF A;  5SYZ A;  1SQN A;  4M8H A;  1QKN A;  3ET0 A;  4O8F A;  4OKB A;  1YOK A;  3W0H A;  1PQ6 A;  5FQV A;  1UHL A;  3VT4 A;  4OH5 A;  5DP0 A;  1XQC A;  1XVP B;  1YIN A;  1PRG A;  4DQM A;  2AM9 A;  2NXX E;  4YT1 A;  2R40 A;  5HYK A;  4HEE X;  2AYR A;  1YY4 A;  5E19 A;  1OVL B;  3AUR A;  3GWS X;  3PBA A;  1KNU A;  4ZNU A;  4IQR A;  3P8X A;  4IWF A;  3B68 A;  3OMQ A;  4OEA A;  5DKE A;  1UPW A;  2XYJ A;  3IXP D;  5EGV A;  1R1K A;  3UP3 A;  4J24 A;  3ERT A;  3LMP A;  4N73 A;  5KRK A;  3DY6 A;  2QW4 A;  2I0J A;  5HJP B;  4G21 A;  3CLD A;  5HYR A;  1RKH A;  3OAP A;  2I4Z A;  3VRT A;  2IOG A;  3NSP A;  1XP9 A;  4OHA A;  5KCC A;  2REW A;  2Q1H A;  5E1C A;  3X36 A;  2B50 A;  3A9E A;  4OLM A;  4JYG A;  1UHL B;  1ZDU A;  2B1Z A;  2W8Y A;  5DWJ A;  1R5K A;  5DI7 A;  5DY8 A;  3FEJ A;  2QMV A;  2OVM A;  2P7G A;  2POG A;  2YJD A;  3GBK A;  5M96 A;  1YJE A;  4ZNS A;  1RDT A;  3WMH A;  4NB6 A;  1KKQ A;  3V9T A;  2FSZ A;  3ET1 A;  2G44 A;  4J5W C;  2J7X A;  4UDA A;  3R8D A;  5DV8 A;  5KCD A;  1PQC A;  2AB2 A;  2P1T A;  4OZR E;  3VTC A;  1YA3 A;  3K6P A;  4OIL A;  5KYJ A;  5AAV A;  1XNN A;  3V9Y A;  4EM9 A;  3V3Q A;  1R6G A;  4DM6 A;  1P93 A;  2ZXM A;  4NIE A;  4OC7 A;  4ZJR A;  4OIV A;  4PLE A;  3P89 A;  2PNU A;  3K22 A;  5L11 A;  3OLS A;  4ZI1 A;  5KRI A;  2QAB A;  3A9E B;  1Z95 A;  3CWD A;  4MGA A;  4OJ9 A;  4OKX A;  2VV2 A;  3VJI A;  1QKT A;  1SR7 A;  4NUF A;  1L2J A;  2R6W A;  2VV3 A;  5AYG A;  3W0A A;  2ZFX A;  5H1E A;  3A78 A;  4OED A;  5DVV A;  5DK9 A;  1OT7 A;  2J14 A;  3HC6 A;  4OAR A;  2PIR A;  4WLB A;  5DZ0 A;  3AN4 A;  3KMR A;  4PF3 A;  1T7F A;  1K7L A;  4IV2 A;  1S9Q A;  4LNX A;  1S19 A;  3W0J A;  5AAV B;  2ZAS A;  3V9V A;  2YHD A;  4UDB A;  4OK1 A;  1KV6 A;  1GWQ A;  4REE A;  3SP9 A;  2E2R A;  4DOR A;  5L7H A;  4PP3 A;  4MG8 A;  1FCX A;  1Y0X X;  3ADX A;  1U9E A;  4MGA B;  1FD0 A;  3ZRA A;  2P1U A;  3IXP A;  3B0R A;  2J7Y A;  2Q5S A;  2QGT A;  1YP0 A;  5DIG A;  4BCR A;  3TY0 A;  5KRO A;  1EXA A;  4J5W A;  2QA6 A;  5DSH A;  4A4V A;  2YLO A;  3GD2 A;  2AX6 A;  3UUD A;  5LWP A;  1R20 D;  3UU7 A;  3AZ3 A;  2OUZ A;  1SKX A;  5DVC A;  1YIM A;  1NHZ A; 
#chains in the Genus database with same CATH homology
 2QXM A;  1FM9 D;  3HLV A;  3LBD A;  3GWX A;  3OS8 C;  4E2J A;  3OMO A;  2YFE A;  3L0L A;  2AAX A;  3CJW A;  3R5N A;  4UDD A;  5B5B A;  5JY3 A;  4WHF A;  1NQ2 A;  5DYD A;  5KYA A;  4RMD A;  3EYB A;  4G1Z A;  1QKU A;  3RY9 A;  4OZT U;  4EMA A;  3P0U A;  4RUJ A;  4WVD A;  4MG8 B;  4X1F A;  3KPZ A;  4ZNH A;  4IVW A;  4N5G A;  4IA3 A;  2ZK2 A;  3UVV A;  2Q7I A;  3ZRB A;  2QXS A;  3UUD B;  2A3I A;  2QTU A;  3CS8 A;  2OZ7 A;  2IOK A;  2J4A A;  3UU7 B;  2AA2 A;  1X7J A;  2ZKC A;  1N4H A;  4N1Y A;  2HBH A;  4XUH A;  4LTW A;  4PVU A;  5EIT A;  3OMK A;  5DWL A;  2XHS A;  5DWG A;  3WJ4 A;  4A2J A;  1Q4X A;  4ZO1 X;  4QE8 A;  2OAX A;  3CS6 A;  4OEZ A;  4CI5 A;  1I7G A;  5C4T A;  4FGY A;  2I4P A;  3OOF A;  3B66 A;  4N8R A;  1OSH A;  5E14 A;  3T03 A;  3L0J A;  2BAW A;  2P4Y A;  2YJA B;  3VRU A;  4IW8 A;  4K6I A;  3CQV A;  3FLI A;  2ZMH A;  4XHD A;  4WQP A;  4FNE A;  3UVV B;  4B7W A;  3A40 X;  2HB8 A;  2ZK1 A;  4P6X A;  5FQP A;  3VHU A;  4F9M A;  3IPS A;  3OS8 A;  5DZ1 A;  2AXA A;  1RK3 A;  2HAS A;  2Q59 A;  5AVI A;  2ZK6 A;  1M13 A;  5DXG A;  5DIE A;  3VSO A;  3WGP A;  3KMG A;  5K13 A;  1NUO A;  5E15 A;  3B3K A;  1T7R A;  2EWP A;  4R06 A;  1XZX X;  5CJ6 A;  3DCU A;  4IUI A;  4CI4 A;  2QPY A;  1MZN A;  4JGV A;  3ADT A;  4FHI A;  1XQ3 A;  5AWK A;  4MG6 A;  1Z5X E;  3VRW A;  2PIP L;  2H79 A;  3FAL A;  1R20 A;  4RMC A;  1G2N A;  5KRF A;  5C4S A;  3F7D A;  2PIV A;  2ZK4 A;  4S0S A;  1XLS A;  2QE4 A;  4MG5 A;  1YOW A;  1FM9 A;  5JI0 D;  2JFA A;  4JYI A;  5KD9 A;  4TUZ A;  4LNW A;  4MGD A;  5KCF A;  3ZR7 A;  2Q59 B;  5GID A;  5DTV A;  4L98 A;  1ILG A;  1P8D A;  1VJB A;  1XP6 A;  4QM0 A;  4S14 A;  2AWH A;  1FCZ A;  5KRJ A;  1XOW A;  2ZK0 A;  2O9I A;  3HQ5 A;  1ILH A;  4PP5 A;  1FM6 D;  4KZI A;  5DUE A;  3MNP A;  2PIO A;  1FCY A;  1ZEO A;  1IE8 A;  2Q6J A;  3A3Z X;  3IA6 A;  3KYT A;  3DT3 A;  1MVC A;  3WT6 A;  5DMC A;  2GTK A;  5KRA A;  3R2A A;  1NRL A;  1Y9R A;  3D5F A;  3WT5 A;  3FAL B;  4Q13 A;  2AMA A;  2YLY A;  3DR1 A;  5G43 A;  3V4A A;  4FHH A;  5GT4 A;  5ICK A;  2GPP A;  3CDP A;  2ZL9 A;  4TV1 A;  3D6D A;  5DRM A;  5DUG A;  3R5M A;  2JFA B;  2Q5P A;  3ET3 A;  4TUZ B;  2HVC A;  3NOA A;  2HWR A;  4MGD B;  4XI3 A;  5IXK A;  4X1G A;  3VTD A;  2PRG A;  2Z4B A;  3HM1 A;  5DXB A;  5C4O A;  4OH6 A;  2VV1 A;  4RFW A;  1OSV A;  3G8O A;  3FUG A;  4IW6 A;  5KRL A;  2OM9 A;  5DVS A;  3HC5 A;  3G9E A;  1XJ7 A;  3AFR A;  3ILZ A;  3MNO A;  5A86 A;  5APJ A;  4J5X A;  5HZC A;  3RUT A;  2ZNN A;  3VSP A;  5AVL A;  3TKM A;  2QZO A;  2VV4 A;  3B0W A;  2OCF A;  2POB A;  4JL4 A;  4TV1 B;  1RJK A;  1K4W A;  3ADV A;  3HO0 A;  3OKH A;  3B67 A;  3HZF A;  4G1D A;  5DZI A;  3IMY A;  3N00 A;  1XNX A;  2QNV A;  3K23 A;  3DZY D;  3D24 A;  4J26 A;  3CTB A;  1DB1 A;  4P6W A;  3OS9 A;  1T73 A;  3VHV A;  1XIU A;  3W5P A;  3IPQ A;  3L3X A;  5DXB B;  2YAT A;  2VV1 B;  2HCD A;  3K8S A;  4RZG A;  2Q8S A;  5DKS A;  2Q70 A;  4PWL A;  1GWX A;  3AZ1 A;  1E3K A;  1T74 A;  1XDK A;  2VV0 A;  5DKG A;  3JZC A;  4RZF A;  2Q61 A;  4OJ4 A;  2V0V A;  5ETH A;  3L03 A;  5DZH A;  3DZU D;  4KZJ A;  3R8I A;  2FVJ A;  4XT9 A;  2Q60 A;  3SP6 A;  2B1V A;  2QZO B;  2VV4 B;  5HJS A;  3TX7 B;  4ONI A;  2Q6S A;  4LBD A;  2QSE A;  4ZNV A;  5KCU A;  1FM6 A;  4PPP A;  4Q0A C;  4NY9 A;  3VRV A;  3W0I A;  3S9S A;  3WJ5 A;  1XAP A;  1BSX A;  2ZK5 A;  1X78 A;  4XTA A;  1T65 A;  4IA1 A;  5C4U A;  2ZVT A;  3VI8 A;  3G0W A;  4IA7 A;  3PO9 A;  1S9P A;  2AX8 A;  5F9B A;  3B0Q A;  2Q7L A;  2AO6 A;  2HFP A;  5KCT A;  1I7I A;  3PEQ A;  1XDK B;  2ZY0 A;  2H77 A;  5DXR A;  2HWQ A;  3RLJ A;  2GL8 A;  3WTQ A;  5ACC A;  4RE8 A;  3IPU A;  4OKT A;  3FS1 A;  2BJ4 A;  3X1H A;  3E00 D;  1ERR A;  1X7B A;  3OZ0 A;  4S0T A;  4OFU A;  3UUA A;  5KRM A;  1PQ9 A;  2HAM A;  3PCU A;  4OZR U;  4MGB A;  5DL4 A;  2LBD A;  3AZ2 A;  4IV4 A;  1U3R A;  3R8A A;  2Q6R A;  5KRC A;  3OMP A;  2HB7 A;  2HAR A;  2AMB A;  3G8I A;  4IA2 A;  5IZ0 A;  4YMQ A;  5KCW A;  2G5O A;  2Q7J A;  4PP6 A;  1Y0S A;  2HC4 A;  3TKC A;  4ZN7 A;  1I37 A;  2I4J A;  1G50 A;  4RME A;  1L2I A;  3VHW A;  1T63 A;  2P15 A;  3H0A D;  5DUH A;  3ADU A;  3W0C A;  2PKL A;  4DK7 A;  5L7E A;  3VJS A;  1N46 A;  1NQ1 A;  2AA7 A;  4NQA B;  1N83 A;  5DWE A;  2P54 A;  1H9U A;  2O4J A;  1G5Y A;  2BJ4 B;  4RUP A;  5G3J A;  2Q7K A;  5EJV A;  1A28 A;  2G0G A;  3DZY A;  3UUA B;  2XYW A;  2XKW A;  3A2H A;  1XLS E;  4OGH A;  3RLL A;  3OSW A;  4MGB B;  3W5R A;  1ZDT A;  3B65 A;  3X31 A;  1TFC A;  2GPV A;  2ZNP A;  4DOS A;  3E7C A;  4PLD A;  3VJT A;  2AX7 A;  3WFG A;  2FAI A;  3OOK A;  5I4V A;  3DZU A;  4XAO A;  4RUO X;  3UP0 A;  3Q95 A;  4G20 A;  2QR9 A;  4FN9 A;  4KZM A;  4LSJ A;  3AX8 A;  4J5X C;  4E4K A;  3VT6 A;  1NQ7 A;  1XB7 A;  3DCT A;  2AA6 A;  4L96 A;  1LV2 A;  4OJB A;  2I0G A;  3B1M A;  3GYU A;  2Q5G A;  5DU5 A;  2JF9 A;  2IHQ A;  5DV6 A;  5AWJ A;  3H52 A;  1PK5 A;  2GPO A;  3AUN A;  4Q50 A;  5GIE A;  4ZN9 A;  5KRH A;  2Z4J A;  3ET2 A;  3W0Y A;  4E4Q A;  4G2H A;  4MG9 A;  1IE9 A;  1S0X A;  3GYT A;  1ZGY A;  3KFC A;  5EC9 A;  2ZXZ A;  3KDT A;  2GPU A;  5G45 A;  2PIW A;  5E0X A;  1YYE A;  3W5T A;  1T5Z A;  4MGC A;  3E00 A;  5DXQ A;  5DKB A;  3Q95 B;  1NQ0 A;  4JAZ A;  2ACL A;  3VT9 A;  5E7V A;  2NXX A;  5EHJ A;  2OVH A;  4ZNT A;  5FQR A;  2PIT A;  4ZO1 B;  2P1V A;  4OZT E;  2V7C A;  1A52 A;  4POH A;  5DXM A;  1TXI A;  3VTB A;  1M2Z A;  4R2U A;  3W5Q A;  1U3Q A;  2ZXN A;  3KMZ A;  4OIU A;  4UDC A;  3ERD A;  2GP7 A;  4MG9 B;  2ZMI A;  1U3S A;  1T79 A;  4QE6 A;  1FBY A;  4PPS A;  3QT0 A;  3H0A A;  3RUU A;  4HLW A;  4Y29 A;  1K74 D;  3F5C A;  4DK8 A;  3W0G A;  1M7W A;  2GIU A;  2PIU A;  3D90 A;  4IS8 A;  4QK4 A;  5AZV A;  1QKM A;  5DWI A;  4ZNW A;  2ACL B;  4RAK A;  1SJ0 A;  3A2J A;  3AN3 A;  3HVL A;  2XYX A;  4S15 A;  3L0E A;  2PJL A;  2O4R A;  3MNE A;  2ATH A;  1WM0 X;  2ZK3 A;  4OFR A;  1LBD A;  3BQD A;  3WFF A;  4OKW A;  3ADW A;  2QA8 A;  3FXV A;  3O1E A;  1G1U A;  4K7A A;  3WT7 A;  4REF A;  2Q1V A;  2QGW A;  5AK2 A;  3OLL A;  1T7M A;  2Q3Y A;  2F4B A;  1NYX A;  4WHG A;  3VN2 A;  1HJ1 A;  2ZLA A;  5HCV A;  3O1D A;  3VT8 A;  4A4W A;  1X7R A;  3OLF A;  4K4J A;  3HOD A;  2ZLC A;  5E0W A;  3P88 A;  5LGA A;  1Z5X U;  3F5C B;  1NDE A;  1MV9 A;  2AX9 A;  2YLP A;  3FUR A;  3CDS A;  3X1I A;  2ZBS A;  4CSJ A;  1PDU A;  3L1B A;  5JJM A;  4MG7 A;  3FC6 A;  3M7R A;  2VST A;  4ITE A;  4IU7 A;  5G44 A;  3AUQ A;  1UOM A;  5G5W A;  5FQS A;  1ERE A;  3KDU A;  4MDD A;  3VT5 A;  5KR9 A;  2ABI A;  2JJ3 A;  2PIQ A;  3BC5 A;  4G2I A;  5AAU A;  2QH6 A;  1X76 A;  2QA8 B;  4PXM A;  3GN8 A;  3PLZ A;  3OMM A;  4XLD A;  5DLR A;  2R40 D;  3KBA A;  4G1Y A;  2P7Z A;  5FQT A;  1PZL A;  1XV9 A;  4QJR A;  3B5R A;  2YLQ A;  5GIC A;  3UUC A;  3FEI A;  1R1K D;  3B0T A;  4OEY A;  1HG4 A;  1PCG A;  4ITF A;  1X7E A;  4RZE A;  5G42 A;  5DX3 A;  3VJH A;  3NSQ A;  2ZMJ A;  1DKF A;  5DRJ A;  5AZT A;  4IVY A;  4WPF A;  5G46 A;  2NPA A;  4MG7 B;  1RKG A;  3U9Q A;  3FC6 B;  4XUM A;  3GZ9 A;  4APU A;  5JJM B;  5IAW A;  1ZKY A;  3WWR A;  5DYB A;  4JYH A;  1NAV A;  2P7A A;  3BEJ A;  4YPQ A;  5KCE A;  1YUC A;  3L3Z A;  3E94 A;  5EI1 A;  1T7T A;  1K74 A;  3OZJ A;  3PRG A;  1YMT A;  5DMF A;  3D57 A;  3VT3 A;  2ZNO A;  4RWV A;  3JZB A;  3OGT A;  4QL8 A;  5B41 A;  1XV9 B;  3CS4 A;  1RDT D;  2R6Y A;  5DXP A;  2B23 A;  2PIN A;  3OKI A;  2G0H A;  1I38 A;  4R6S A;  1GWR A;  4IWC A;  4ZOM A;  5DX3 B;  3VT7 A;  1GS4 A;  1DKF B;  2NV7 A;  3V49 A;  4DMA A;  4PRG A;  1XVP A;  5DXE A;  2GWX A;  3OSI A;  2PIX A;  5APK A;  1UPV A;  3V3E A;  1OVL A;  5DID A;  2AA5 A;  2NW4 A;  4ZJW A;  3A2I A;  1XPC A;  2VSR A;  1E3G A;  1S0Z A;  1ZH7 A;  2ZNQ A;  4M8E A;  3KWY A;  3SZ1 A;  4DM8 A;  5DV3 A;  3ADS A;  5DXK A;  5DZ3 A;  5HJP A;  1ZUC A;  1T76 A;  1NAX A;  3RVF A;  1XP1 A;  4YNK A;  5APH A;  3R29 A;  3ZQT A;  1EXX A;  4POJ A;  5L7G A;  3OSA A;  1ZAF A;  5SYZ A;  1SQN A;  4M8H A;  1QKN A;  3ET0 A;  4O8F A;  4OKB A;  1YOK A;  3W0H A;  1PQ6 A;  5FQV A;  1UHL A;  3VT4 A;  4OH5 A;  5DP0 A;  1XQC A;  1XVP B;  1YIN A;  1PRG A;  4DQM A;  2AM9 A;  2NXX E;  4YT1 A;  2R40 A;  5HYK A;  4HEE X;  2AYR A;  1YY4 A;  5E19 A;  1OVL B;  3AUR A;  3GWS X;  3PBA A;  1KNU A;  4ZNU A;  4IQR A;  3P8X A;  4IWF A;  3B68 A;  3OMQ A;  4OEA A;  5DKE A;  1UPW A;  2XYJ A;  3IXP D;  5EGV A;  1R1K A;  3UP3 A;  4J24 A;  3ERT A;  3LMP A;  4N73 A;  5KRK A;  3DY6 A;  2QW4 A;  2I0J A;  5HJP B;  4G21 A;  3CLD A;  5HYR A;  1RKH A;  3OAP A;  2I4Z A;  3VRT A;  2IOG A;  3NSP A;  1XP9 A;  4OHA A;  5KCC A;  2REW A;  2Q1H A;  5E1C A;  3X36 A;  2B50 A;  3A9E A;  4OLM A;  4JYG A;  1UHL B;  1ZDU A;  2B1Z A;  2W8Y A;  5DWJ A;  1R5K A;  5DI7 A;  5DY8 A;  3FEJ A;  2QMV A;  2OVM A;  2P7G A;  2POG A;  2YJD A;  3GBK A;  5M96 A;  1YJE A;  4ZNS A;  1RDT A;  3WMH A;  4NB6 A;  1KKQ A;  3V9T A;  2FSZ A;  3ET1 A;  2G44 A;  4J5W C;  2J7X A;  4UDA A;  3R8D A;  5DV8 A;  5KCD A;  1PQC A;  2AB2 A;  2P1T A;  4OZR E;  3VTC A;  1YA3 A;  3K6P A;  4OIL A;  5KYJ A;  5AAV A;  1XNN A;  3V9Y A;  4EM9 A;  3V3Q A;  1R6G A;  4DM6 A;  1P93 A;  2ZXM A;  4NIE A;  4OC7 A;  4ZJR A;  4OIV A;  4PLE A;  3P89 A;  2PNU A;  3K22 A;  5L11 A;  3OLS A;  4ZI1 A;  5KRI A;  2QAB A;  3A9E B;  1Z95 A;  3CWD A;  4MGA A;  4OJ9 A;  4OKX A;  2VV2 A;  3VJI A;  1QKT A;  1SR7 A;  4NUF A;  1L2J A;  2R6W A;  2VV3 A;  5AYG A;  3W0A A;  2ZFX A;  5H1E A;  3A78 A;  4OED A;  5DVV A;  5DK9 A;  1OT7 A;  2J14 A;  3HC6 A;  4OAR A;  2PIR A;  4WLB A;  5DZ0 A;  3AN4 A;  3KMR A;  4PF3 A;  1T7F A;  1K7L A;  4IV2 A;  1S9Q A;  4LNX A;  1S19 A;  3W0J A;  5AAV B;  2ZAS A;  3V9V A;  2YHD A;  4UDB A;  4OK1 A;  1KV6 A;  1GWQ A;  4REE A;  3SP9 A;  2E2R A;  4DOR A;  5L7H A;  4PP3 A;  4MG8 A;  1FCX A;  1Y0X X;  3ADX A;  1U9E A;  4MGA B;  1FD0 A;  3ZRA A;  2P1U A;  3IXP A;  3B0R A;  2J7Y A;  2Q5S A;  2QGT A;  1YP0 A;  5DIG A;  4BCR A;  3TY0 A;  5KRO A;  1EXA A;  4J5W A;  2QA6 A;  5DSH A;  4A4V A;  2YLO A;  3GD2 A;  2AX6 A;  3UUD A;  5LWP A;  1R20 D;  3UU7 A;  3AZ3 A;  2OUZ A;  1SKX A;  5DVC A;  1YIM A;  1NHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...