5KRLA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with the a-cd ring estrogen, (1s,7as)-5-(2-chloro-4-hydroxyphenyl)-7a-methyl-2,3,3a,4,7,7a-hexahydro-1h-inden-1-ol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
244
structure length
236
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 236
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krlA00
3AZ3A 5APHA 3ZRAA 4EMAA 4ITFA 4QK4A 1HJ1A 3CS8A 1S9PA 3M7RA 3ADWA 4N1YA 1ZUCA 1XVPA 3GYUA 3F5CA 5HJPB 5E0WA 2NPAA 4WHGA 4ITEA 1G5YA 3OMPA 2QPYA 5KRHA 1YYEA 3GYTA 1XQ3A 1ZDUA 4ZO1B 1XNNA 1XV9B 2VV4A 3VJTA 2PIPL 3W0IA 1R20D 2XYJA 2ZL9A 3RLJA 1DKFA 1NAXA 2VV3A 4FGYA 4KZJA 3AZ2A 1FBYA 5DWJA 3HC6A 2Q5SA 2QTUA 4N8RA 2QA8A 1RDTA 2P15A 2AXAA 3KMGA 4HLWA 1R6GA 4OFUA 1L2JA 1T74A 4K6IA 2QXMA 1X78A 4PXMA 2HB8A 2R6YA 3LMPA 5KRFA 3VT9A 2O9IA 2ZY0A 2P1VA 4JGVA 1YP0A 1M7WA 2ZNPA 3D6DA 4X1FA 5AZTA 2IOKA 3BQDA 5KCWA 1XVPB 2P7AA 3OS9A 3ET2A 4N73A 4QM0A 3F5CB 2ZFXA 4ZNWA 4P6WA 1G50A 2AMBA 4LBDA 2O4RA 5DUGA 5SYZA 4PRGA 2QGTA 3A78A 4A4WA 1K4WA 4WQPA 4G21A 1G1UA 1YJEA 3VHWA 5KYJA 2AX9A 2PRGA 3FXVA 2VV4B 4LTWA 3UP3A 1X7BA 2Q6SA 1XLSA 4OEYA 4RMDA 4XI3A 5AWJA 3X1IA 2OUZA 1RKGA 4XLDA 2ZMJA 3HM1A 1DKFB 4HEEX 3SZ1A 2ZLCA 1FM6A 1K74A 2HC4A 3SP9A 3P88A 2QW4A 3H52A 2QA8B 2QR9A 3AN3A 4S0SA 5GICA 2Q60A 2Q1VA 5DL4A 3JZCA 3OZJA 4CI5A 2PIUA 4OLMA 2ZNNA 1QKMA 1S0XA 1DB1A 2ATHA 2PIWA 3MNPA 1LV2A 4OILA 3OOKA 2QA6A 2ZXZA 1UPVA 3K8SA 4O8FA 1A52A 2GPOA 1WM0X 1FM9A 4IQRA 5DWGA 3RLLA 4XT9A 4S15A 4DM8A 3B1MA 3KBAA 3B0RA 5DXBA 1ZEOA 2AA5A 4PLEA 5DV6A 1OVLA 3WT7A 4S0TA 3W0AA 1XDKA 4UDCA 4PP3A 2J7YA 2QH6A 4J5XA 5APJA 3OKIA 4IW8A 4DMAA 1NQ2A 2I4PA 3ZQTA 2G0HA 2FAIA 2ZK3A 3KMRA 1SKXA 3AUQA 1Y0XX 4R06A 4IA1A 4S14A 2AX7A 1FCYA 1XNXA 2VV2A 3P89A 1EXXA 4L98A 3OSIA 5DK9A 3UU7A 3FEIA 3OOFA 4ZNTA 5C4OA 3V3QA 3L3XA 5KCEA 5KR9A 1P8DA 4IWFA 2G44A 3DZUD 2AA7A 3B3KA 4JAZA 4K7AA 3UUAA 4M8HA 2JJ3A 1IE8A 3B0WA 5IZ0A 3TY0A 1EXAA 2XYWA 4ZOMA 2O4JA 2IHQA 3AZ1A 4Q0AC 4RZEA 4P6XA 2ZXNA 4ZNVA 2AM9A 2PIOA 1XB7A 2HWRA 1NDEA 5E15A 3RUTA 3IXPA 2GP7A 5DIDA 5DXBB 4RE8A 3FC6B 3V4AA 5KCTA 5DZIA 2V0VA 2AWHA 3OS8C 1NQ7A 1OVLB 5DYBA 1XDKB 1ZKYA 4OK1A 5DXPA 3SP6A 1OSHA 5GIEA 2NXXE 1PDUA 2QMVA 3ADSA 1L2IA 3H0AA 4R6SA 3UP0A 3ZRBA 3VJIA 1YINA 2QSEA 4OGHA 5FQVA 4E4QA 5KRJA 3CDSA 5DV8A 4DOSA 1NQ0A 3X31A 3QT0A 4ZN7A 1M13A 1K7LA 2HWQA 3OAPA 3UU7B 2QXSA 2ZK2A 2B1ZA 3VT8A 2QE4A 3FLIA 3KPZA 3TX7B 2I0GA 3HODA 3PRGA 3PCUA 5DWLA 2ZKCA 3CLDA 3VRWA 2OCFA 1A28A 2OM9A 3UUAB 4OC7A 2IOGA 4QE6A 3AN4A 4OKTA 4ZNHA 3IPQA 2AB2A 3VSOA 5DRMA 5AK2A 1E3GA 1RJKA 4IU7A 3L1BA 1I7GA 3DY6A 5B5BA 5KCFA 1XOWA 1FCXA 2I0JA 1YOKA 3H0AD 1T7MA 5DXEA 2G5OA 3GBKA 1Y9RA 3WFGA 1E3KA 4YPQA 4XAOA 3W0YA 3W0JA 4Q50A 4J5WC 4CSJA 5DMCA 3L0JA 2H79A 3MNEA 1OSVA 1FCZA 4JYGA 5M96A 4FHHA 4OJBA 3B5RA 3NSQA 4R2UA 1KKQA 4MG6A 1X76A 3OMMA 1R1KD 2HB7A 3RUUA 1ZDTA 4PPSA 3FUGA 3K22A 3VJSA 2AA6A 1H9UA 4OARA 3UVVA 2P54A 5DIGA 3D90A 1XPCA 4IUIA 4IVWA 3HZFA 1S0ZA 4WPFA 5FQPA 4B7WA 5C4TA 2YLYA 3AFRA 2G0GA 2GL8A 2ZK4A 3OMOA 4REEA 3P0UA 3L3ZA 4RWVA 1MVCA 5DUEA 1SR7A 3Q95A 4MGAA 5DVSA 2LBDA 5DYDA 3ET1A 2ZK1A 1XP1A 5KROA 2V7CA 5L7GA 1OT7A 5IXKA 1EREA 2GPPA 3X36A 1NUOA 2ZLAA 3CQVA 5L11A 3GWSX 5G5WA 1R5KA 2F4BA 1Y0SA 2YJDA 3ET3A 3WT5A 4DORA 5HZCA 5I4VA 4DK8A 5C4SA 5KRIA 3DCUA 4L96A 4Q13A 3UVVB 3WTQA 1FD0A 5DX3A 3WGPA 3GWXA 1PQCA 5KCDA 4IA2A 1N83A 2ZNQA 1Z5XU 4FNEA 4OEDA 4K4JA 3UUCA 4LNXA 1T79A 1RDTD 2J7XA 2OVHA 5DXKA 3KMZA 1Z5XE 3VTDA 5EHJA 2Q5PA 2Q7LA 5DWIA 1QKUA 3G8IA 4G2IA 2YFEA 3VT4A 3Q95B 4MGAB 3R8AA 3FALA 4G20A 3R8IA 3OSAA 3X1HA 3ET0A 4OEZA 3HVLA 3OLLA 5E19A 2QZOB 5G46A 5ICKA 1T7TA 2FSZA 3OKHA 3OS8A 3R29A 3V3EA 1UPWA 3F7DA 4KZMA 1T65A 3ADUA 3E00A 3ERDA 3PEQA 4IS8A 4XHDA 3VJHA 2VV1A 1U9EA 5G43A 2HVCA 5DRJA 5E1CA 2Q59A 1U3RA 2HASA 5IAWA 2QGWA 4J26A 2HAMA 3FC6A 5DX3B 4PP6A 4OH6A 3NOAA 2JFAA 2P4YA 3DCTA 5DKGA 3GD2A 5KRKA 1FM6D 2PITA 1K74D 2Q3YA 1X7JA 2XKWA 4WVDA 4PF3A 5EITA 1PK5A 2ZK6A 3GZ9A 5ETHA 4JL4A 5DZ3A 4QE8A 4POHA 4Y29A 3OLSA 4MGDA 1N46A 3FALB 3VRUA 4MDDA 3VT7A 5HYRA 4UDBA 4OFRA 4MG8A 1FM9D 4IA7A 1NYXA 2A3IA 3G8OA 5E0XA 4MGCA 1HG4A 1XZXX 2OVMA 2QNVA 5DVVA 2ZXMA 4XUMA 2AX6A 4BCRA 2VV1B 2PINA 3MNOA 5DLRA 1RK3A 2Q59B 4J5WA 4PVUA 2ACLA 4ZN9A 5DP0A 5EJVA 5KCUA 4IV4A 4OJ9A 3OMQA 5FQRA 2PIXA 3CTBA 3OMKA 3P8XA 5HYKA 2JFAB 5E14A 2AA2A 2R40A 2VV0A 3IMYA 4UDAA 5FQTA 1PCGA 1ZGYA 2P1TA 2Z4JA 5GIDA 3TKCA 2XHSA 1KNUA 4OKXA 4RUPA 2REWA 4LNWA 2ZBSA 3CS4A 5A86A 3WWRA 4RZFA 4A2JA 4ZJWA 3OSWA 3PO9A 4MGDB 3CS6A 2B23A 2AYRA 3E7CA 5DXQA 3VTCA 3S9SA 5C4UA 4MG8B 3FURA 2GTKA 1I7IA 1I37A 4OZRU 4PP5A 4DQMA 4CI4A 4NIEA 3IPSA 2Q8SA 4ZNSA 3RY9A 4M8EA 3IXPD 1NHZA 5KRAA 3ZR7A 3W5PA 5AVLA 2Q5GA 4OZRE 2ACLB 4YT1A 2YLOA 4OKBA 2PIQA 2Q1HA 3WT6A 3JZBA 2PIVA 2ZNOA 3B0TA 4X1GA 1MV9A 2YHDA 5F9BA 3T03A 4YNKA 2QABA 3B0QA 4ZJRA 4OIUA 4JYIA 5EGVA 4POJA 2I4JA 5L7EA 3D57A 4QL8A 3W5TA 3DZYA 3HO0A 4XTAA 1X7EA 2FVJA 2XYXA 3K6PA 4MG5A 1I38A 1NRLA 5KYAA 2AMAA 1U3QA 3E94A 2ZK0A 3N00A 2Q6RA 2BAWA 1T7RA 1SQNA 5DVCA 1GWQA 2HARA 3FS1A 4E4KA 4MGBA 5G45A 4MG9A 2J4AA 2Q70A 3W0HA 1XJ7A 5JI0D 3VT6A 1T73A 1XP6A 1YUCA 1R20A 3L03A 1T63A 1XIUA 1XLSE 3UUDA 3W5RA 4OJ4A 5L7HA 5DKBA 2GPVA 1PRGA 1ILGA 4RUJA 3W5QA 3KDUA 2P7ZA 3OGTA 4RZGA 3DZYD 3L0EA 4WHFA 5B41A 5DY8A 3VI8A 4ZI1A 4JYHA 3VHVA 3V9VA 2Q7IA 3K23A 5DZHA 2QZOA 1YIMA 1TXIA 3CJWA 4WLBA 2W8YA 3FEJA 1S19A 2ZK5A 3BEJA 1YA3A 2NV7A 2YLPA 3IPUA 5DKSA 5LWPA 2B50A 2BJ4A 5DXMA 4MGBB 3B67A 3GN8A 5FQSA 2Z4BA 4LSJA 4MG9B 3A2HA 5G42A 3VSPA 5DWEA 2J14A 1GS4A 2AAXA 2P1UA 4RAKA 3UUDB 3W0CA 3WFFA 1Z95A 4G1YA 4MG7A 5GT4A 1YMTA 2JF9A 3KWYA 1ERRA 3VRVA 5DZ0A 2ZMHA 5DI7A 4NUFA 1Q4XA 4IVYA 4FN9A 3U9QA 3VRTA 5HJSA 3EYBA 2PNUA 5AAVA 3WMHA 5H1EA 1T5ZA 3OLFA 1KV6A 3V9TA 4PWLA 1X7RA 5DU5A 5CJ6A 1PQ9A 2AO6A 2Q61A 4A4VA 5AWKA 4F9MA 5DXRA 3R5MA 5DUHA 4RMEA 5LGAA 2BJ4B 1T7FA 4PLDA 5K13A 2GPUA 2PKLA 4ZNUA 4UDDA 3VT3A 2R6WA 3G9EA 3ADXA 4IW6A 2ZVTA 3B65A 5DKEA 3WJ4A 2Q6JA 1QKTA 1SJ0A 3KFCA 2OZ7A 4MG7B 5G3JA 2EWPA 2Q7KA 5AVIA 5EI1A 1BSXA 1XP9A 4OZTU 4APUA 2PIRA 3PLZA 2NW4A 3KDTA 5DIEA 1G2NA 4IWCA 3VTBA 2PJLA 5EC9A 1ZH7A 3W0GA 4OZTE 5AAVB 2E2RA 4OHAA 3PBAA 5AYGA 4RFWA 3ADVA 4OH5A 3DZUA 5AZVA 3E00D 2OAXA 1XAPA 3G0WA 2AX8A 4TUZA 4TV1A 4PPPA 4E2JA 2ZASA 1IE9A 2GWXA 3D5FA 3R8DA 3HQ5A 2ZMIA 2HFPA 3A3ZX 3ADTA 5KRLA 4IA3A 2HCDA 1U3SA 3A2JA 5DV3A 3B66A 5JY3A 4REFA 5ACCA 4OIVA 4N5GA 1PZLA 3OZ0A 3ERTA 1GWRA 3AUNA 5DZ1A 3AX8A 4G1DA 3VN2A 5KRCA 3R5NA 2YJAB 2VSRA 3RVFA 2I4ZA 1LBDA 3CDPA 1RKHA 3WJ5A 3VHUA 1VJBA 3BC5A 1NQ1A 4KZIA 5AAUA 2H77A 5KCCA 1N4HA 3A9EA 3O1DA 3TKMA 4TUZB 4TV1B 3V9YA 5KD9A 4J24A 5HCVA 1YY4A 3IA6A 1PQ6A 3O1EA 4NB6A 3R2AA 1ILHA 3A40X 5JJMA 3A2IA 3LBDA 2R40D 4IV2A 3KYTA 3L0LA 1UOMA 4OKWA 4XUHA 1NAVA 1UHLA 2POGA 3HC5A 1P93A 3HLVA 2Q7JA 1ZAFA 5DSHA 2GIUA 3D24A 1MZNA 2ABIA 4FHIA 4EM9A 1YOWA 5DXGA 4NY9A 3DT3A 4RMCA 3V49A 1QKNA 4J5XC 4G1ZA 5HJPA 4NQAB 4ZO1X 3B68A 5DTVA 2POBA 1XQCA 4DK7A 2VSTA 4DM6A 1T76A 3AURA 3ILZA 1GWXA 1S9QA 5KRMA 3A9EB 5APKA 4QJRA 5E7VA 1R1KA 1XV9A 3CWDA 4YMQA 2YATA 2B1VA 3DR1A 5DMFA 5G44A 4ONIA 2HBHA 2P7GA 5JJMB 3NSPA 3VT5A 2YLQA 1TFCA 4G2HA 2NXXA 1UHLB 4OEAA 1M2ZA 4RUOX
chains in the Genus database with same CATH superfamily
3AZ3A 5APHA 3ZRAA 4EMAA 4ITFA 4QK4A 1HJ1A 3CS8A 1S9PA 3M7RA 3ADWA 4N1YA 1ZUCA 1XVPA 3GYUA 3F5CA 5HJPB 5E0WA 2NPAA 4WHGA 4ITEA 1G5YA 3OMPA 2QPYA 5KRHA 1YYEA 3GYTA 1XQ3A 1ZDUA 4ZO1B 1XNNA 1XV9B 2VV4A 3VJTA 2PIPL 3W0IA 1R20D 2XYJA 2ZL9A 3RLJA 1DKFA 1NAXA 2VV3A 4FGYA 4KZJA 3AZ2A 1FBYA 5DWJA 3HC6A 2Q5SA 2QTUA 4N8RA 2QA8A 1RDTA 2P15A 2AXAA 3KMGA 4HLWA 1R6GA 4OFUA 1L2JA 1T74A 4K6IA 2QXMA 1X78A 4PXMA 2HB8A 2R6YA 3LMPA 5KRFA 3VT9A 2O9IA 2ZY0A 2P1VA 4JGVA 1YP0A 1M7WA 2ZNPA 3D6DA 4X1FA 5AZTA 2IOKA 3BQDA 5KCWA 1XVPB 2P7AA 3OS9A 3ET2A 4N73A 4QM0A 3F5CB 2ZFXA 4ZNWA 4P6WA 1G50A 2AMBA 4LBDA 2O4RA 5DUGA 5SYZA 4PRGA 2QGTA 3A78A 4A4WA 1K4WA 4WQPA 4G21A 1G1UA 1YJEA 3VHWA 5KYJA 2AX9A 2PRGA 3FXVA 2VV4B 4LTWA 3UP3A 1X7BA 2Q6SA 1XLSA 4OEYA 4RMDA 4XI3A 5AWJA 3X1IA 2OUZA 1RKGA 4XLDA 2ZMJA 3HM1A 1DKFB 4HEEX 3SZ1A 2ZLCA 1FM6A 1K74A 2HC4A 3SP9A 3P88A 2QW4A 3H52A 2QA8B 2QR9A 3AN3A 4S0SA 5GICA 2Q60A 2Q1VA 5DL4A 3JZCA 3OZJA 4CI5A 2PIUA 4OLMA 2ZNNA 1QKMA 1S0XA 1DB1A 2ATHA 2PIWA 3MNPA 1LV2A 4OILA 3OOKA 2QA6A 2ZXZA 1UPVA 3K8SA 4O8FA 1A52A 2GPOA 1WM0X 1FM9A 4IQRA 5DWGA 3RLLA 4XT9A 4S15A 4DM8A 3B1MA 3KBAA 3B0RA 5DXBA 1ZEOA 2AA5A 4PLEA 5DV6A 1OVLA 3WT7A 4S0TA 3W0AA 1XDKA 4UDCA 4PP3A 2J7YA 2QH6A 4J5XA 5APJA 3OKIA 4IW8A 4DMAA 1NQ2A 2I4PA 3ZQTA 2G0HA 2FAIA 2ZK3A 3KMRA 1SKXA 3AUQA 1Y0XX 4R06A 4IA1A 4S14A 2AX7A 1FCYA 1XNXA 2VV2A 3P89A 1EXXA 4L98A 3OSIA 5DK9A 3UU7A 3FEIA 3OOFA 4ZNTA 5C4OA 3V3QA 3L3XA 5KCEA 5KR9A 1P8DA 4IWFA 2G44A 3DZUD 2AA7A 3B3KA 4JAZA 4K7AA 3UUAA 4M8HA 2JJ3A 1IE8A 3B0WA 5IZ0A 3TY0A 1EXAA 2XYWA 4ZOMA 2O4JA 2IHQA 3AZ1A 4Q0AC 4RZEA 4P6XA 2ZXNA 4ZNVA 2AM9A 2PIOA 1XB7A 2HWRA 1NDEA 5E15A 3RUTA 3IXPA 2GP7A 5DIDA 5DXBB 4RE8A 3FC6B 3V4AA 5KCTA 5DZIA 2V0VA 2AWHA 3OS8C 1NQ7A 1OVLB 5DYBA 1XDKB 1ZKYA 4OK1A 5DXPA 3SP6A 1OSHA 5GIEA 2NXXE 1PDUA 2QMVA 3ADSA 1L2IA 3H0AA 4R6SA 3UP0A 3ZRBA 3VJIA 1YINA 2QSEA 4OGHA 5FQVA 4E4QA 5KRJA 3CDSA 5DV8A 4DOSA 1NQ0A 3X31A 3QT0A 4ZN7A 1M13A 1K7LA 2HWQA 3OAPA 3UU7B 2QXSA 2ZK2A 2B1ZA 3VT8A 2QE4A 3FLIA 3KPZA 3TX7B 2I0GA 3HODA 3PRGA 3PCUA 5DWLA 2ZKCA 3CLDA 3VRWA 2OCFA 1A28A 2OM9A 3UUAB 4OC7A 2IOGA 4QE6A 3AN4A 4OKTA 4ZNHA 3IPQA 2AB2A 3VSOA 5DRMA 5AK2A 1E3GA 1RJKA 4IU7A 3L1BA 1I7GA 3DY6A 5B5BA 5KCFA 1XOWA 1FCXA 2I0JA 1YOKA 3H0AD 1T7MA 5DXEA 2G5OA 3GBKA 1Y9RA 3WFGA 1E3KA 4YPQA 4XAOA 3W0YA 3W0JA 4Q50A 4J5WC 4CSJA 5DMCA 3L0JA 2H79A 3MNEA 1OSVA 1FCZA 4JYGA 5M96A 4FHHA 4OJBA 3B5RA 3NSQA 4R2UA 1KKQA 4MG6A 1X76A 3OMMA 1R1KD 2HB7A 3RUUA 1ZDTA 4PPSA 3FUGA 3K22A 3VJSA 2AA6A 1H9UA 4OARA 3UVVA 2P54A 5DIGA 3D90A 1XPCA 4IUIA 4IVWA 3HZFA 1S0ZA 4WPFA 5FQPA 4B7WA 5C4TA 2YLYA 3AFRA 2G0GA 2GL8A 2ZK4A 3OMOA 4REEA 3P0UA 3L3ZA 4RWVA 1MVCA 5DUEA 1SR7A 3Q95A 4MGAA 5DVSA 2LBDA 5DYDA 3ET1A 2ZK1A 1XP1A 5KROA 2V7CA 5L7GA 1OT7A 5IXKA 1EREA 2GPPA 3X36A 1NUOA 2ZLAA 3CQVA 5L11A 3GWSX 5G5WA 1R5KA 2F4BA 1Y0SA 2YJDA 3ET3A 3WT5A 4DORA 5HZCA 5I4VA 4DK8A 5C4SA 5KRIA 3DCUA 4L96A 4Q13A 3UVVB 3WTQA 1FD0A 5DX3A 3WGPA 3GWXA 1PQCA 5KCDA 4IA2A 1N83A 2ZNQA 1Z5XU 4FNEA 4OEDA 4K4JA 3UUCA 4LNXA 1T79A 1RDTD 2J7XA 2OVHA 5DXKA 3KMZA 1Z5XE 3VTDA 5EHJA 2Q5PA 2Q7LA 5DWIA 1QKUA 3G8IA 4G2IA 2YFEA 3VT4A 3Q95B 4MGAB 3R8AA 3FALA 4G20A 3R8IA 3OSAA 3X1HA 3ET0A 4OEZA 3HVLA 3OLLA 5E19A 2QZOB 5G46A 5ICKA 1T7TA 2FSZA 3OKHA 3OS8A 3R29A 3V3EA 1UPWA 3F7DA 4KZMA 1T65A 3ADUA 3E00A 3ERDA 3PEQA 4IS8A 4XHDA 3VJHA 2VV1A 1U9EA 5G43A 2HVCA 5DRJA 5E1CA 2Q59A 1U3RA 2HASA 5IAWA 2QGWA 4J26A 2HAMA 3FC6A 5DX3B 4PP6A 4OH6A 3NOAA 2JFAA 2P4YA 3DCTA 5DKGA 3GD2A 5KRKA 1FM6D 2PITA 1K74D 2Q3YA 1X7JA 2XKWA 4WVDA 4PF3A 5EITA 1PK5A 2ZK6A 3GZ9A 5ETHA 4JL4A 5DZ3A 4QE8A 4POHA 4Y29A 3OLSA 4MGDA 1N46A 3FALB 3VRUA 4MDDA 3VT7A 5HYRA 4UDBA 4OFRA 4MG8A 1FM9D 4IA7A 1NYXA 2A3IA 3G8OA 5E0XA 4MGCA 1HG4A 1XZXX 2OVMA 2QNVA 5DVVA 2ZXMA 4XUMA 2AX6A 4BCRA 2VV1B 2PINA 3MNOA 5DLRA 1RK3A 2Q59B 4J5WA 4PVUA 2ACLA 4ZN9A 5DP0A 5EJVA 5KCUA 4IV4A 4OJ9A 3OMQA 5FQRA 2PIXA 3CTBA 3OMKA 3P8XA 5HYKA 2JFAB 5E14A 2AA2A 2R40A 2VV0A 3IMYA 4UDAA 5FQTA 1PCGA 1ZGYA 2P1TA 2Z4JA 5GIDA 3TKCA 2XHSA 1KNUA 4OKXA 4RUPA 2REWA 4LNWA 2ZBSA 3CS4A 5A86A 3WWRA 4RZFA 4A2JA 4ZJWA 3OSWA 3PO9A 4MGDB 3CS6A 2B23A 2AYRA 3E7CA 5DXQA 3VTCA 3S9SA 5C4UA 4MG8B 3FURA 2GTKA 1I7IA 1I37A 4OZRU 4PP5A 4DQMA 4CI4A 4NIEA 3IPSA 2Q8SA 4ZNSA 3RY9A 4M8EA 3IXPD 1NHZA 5KRAA 3ZR7A 3W5PA 5AVLA 2Q5GA 4OZRE 2ACLB 4YT1A 2YLOA 4OKBA 2PIQA 2Q1HA 3WT6A 3JZBA 2PIVA 2ZNOA 3B0TA 4X1GA 1MV9A 2YHDA 5F9BA 3T03A 4YNKA 2QABA 3B0QA 4ZJRA 4OIUA 4JYIA 5EGVA 4POJA 2I4JA 5L7EA 3D57A 4QL8A 3W5TA 3DZYA 3HO0A 4XTAA 1X7EA 2FVJA 2XYXA 3K6PA 4MG5A 1I38A 1NRLA 5KYAA 2AMAA 1U3QA 3E94A 2ZK0A 3N00A 2Q6RA 2BAWA 1T7RA 1SQNA 5DVCA 1GWQA 2HARA 3FS1A 4E4KA 4MGBA 5G45A 4MG9A 2J4AA 2Q70A 3W0HA 1XJ7A 5JI0D 3VT6A 1T73A 1XP6A 1YUCA 1R20A 3L03A 1T63A 1XIUA 1XLSE 3UUDA 3W5RA 4OJ4A 5L7HA 5DKBA 2GPVA 1PRGA 1ILGA 4RUJA 3W5QA 3KDUA 2P7ZA 3OGTA 4RZGA 3DZYD 3L0EA 4WHFA 5B41A 5DY8A 3VI8A 4ZI1A 4JYHA 3VHVA 3V9VA 2Q7IA 3K23A 5DZHA 2QZOA 1YIMA 1TXIA 3CJWA 4WLBA 2W8YA 3FEJA 1S19A 2ZK5A 3BEJA 1YA3A 2NV7A 2YLPA 3IPUA 5DKSA 5LWPA 2B50A 2BJ4A 5DXMA 4MGBB 3B67A 3GN8A 5FQSA 2Z4BA 4LSJA 4MG9B 3A2HA 5G42A 3VSPA 5DWEA 2J14A 1GS4A 2AAXA 2P1UA 4RAKA 3UUDB 3W0CA 3WFFA 1Z95A 4G1YA 4MG7A 5GT4A 1YMTA 2JF9A 3KWYA 1ERRA 3VRVA 5DZ0A 2ZMHA 5DI7A 4NUFA 1Q4XA 4IVYA 4FN9A 3U9QA 3VRTA 5HJSA 3EYBA 2PNUA 5AAVA 3WMHA 5H1EA 1T5ZA 3OLFA 1KV6A 3V9TA 4PWLA 1X7RA 5DU5A 5CJ6A 1PQ9A 2AO6A 2Q61A 4A4VA 5AWKA 4F9MA 5DXRA 3R5MA 5DUHA 4RMEA 5LGAA 2BJ4B 1T7FA 4PLDA 5K13A 2GPUA 2PKLA 4ZNUA 4UDDA 3VT3A 2R6WA 3G9EA 3ADXA 4IW6A 2ZVTA 3B65A 5DKEA 3WJ4A 2Q6JA 1QKTA 1SJ0A 3KFCA 2OZ7A 4MG7B 5G3JA 2EWPA 2Q7KA 5AVIA 5EI1A 1BSXA 1XP9A 4OZTU 4APUA 2PIRA 3PLZA 2NW4A 3KDTA 5DIEA 1G2NA 4IWCA 3VTBA 2PJLA 5EC9A 1ZH7A 3W0GA 4OZTE 5AAVB 2E2RA 4OHAA 3PBAA 5AYGA 4RFWA 3ADVA 4OH5A 3DZUA 5AZVA 3E00D 2OAXA 1XAPA 3G0WA 2AX8A 4TUZA 4TV1A 4PPPA 4E2JA 2ZASA 1IE9A 2GWXA 3D5FA 3R8DA 3HQ5A 2ZMIA 2HFPA 3A3ZX 3ADTA 5KRLA 4IA3A 2HCDA 1U3SA 3A2JA 5DV3A 3B66A 5JY3A 4REFA 5ACCA 4OIVA 4N5GA 1PZLA 3OZ0A 3ERTA 1GWRA 3AUNA 5DZ1A 3AX8A 4G1DA 3VN2A 5KRCA 3R5NA 2YJAB 2VSRA 3RVFA 2I4ZA 1LBDA 3CDPA 1RKHA 3WJ5A 3VHUA 1VJBA 3BC5A 1NQ1A 4KZIA 5AAUA 2H77A 5KCCA 1N4HA 3A9EA 3O1DA 3TKMA 4TUZB 4TV1B 3V9YA 5KD9A 4J24A 5HCVA 1YY4A 3IA6A 1PQ6A 3O1EA 4NB6A 3R2AA 1ILHA 3A40X 5JJMA 3A2IA 3LBDA 2R40D 4IV2A 3KYTA 3L0LA 1UOMA 4OKWA 4XUHA 1NAVA 1UHLA 2POGA 3HC5A 1P93A 3HLVA 2Q7JA 1ZAFA 5DSHA 2GIUA 3D24A 1MZNA 2ABIA 4FHIA 4EM9A 1YOWA 5DXGA 4NY9A 3DT3A 4RMCA 3V49A 1QKNA 4J5XC 4G1ZA 5HJPA 4NQAB 4ZO1X 3B68A 5DTVA 2POBA 1XQCA 4DK7A 2VSTA 4DM6A 1T76A 3AURA 3ILZA 1GWXA 1S9QA 5KRMA 3A9EB 5APKA 4QJRA 5E7VA 1R1KA 1XV9A 3CWDA 4YMQA 2YATA 2B1VA 3DR1A 5DMFA 5G44A 4ONIA 2HBHA 2P7GA 5JJMB 3NSPA 3VT5A 2YLQA 1TFCA 4G2HA 2NXXA 1UHLB 4OEAA 1M2ZA 4RUOX
chains in the Genus database with same CATH topology
3AZ3A 5APHA 3ZRAA 4EMAA 4ITFA 4QK4A 1HJ1A 3CS8A 1S9PA 3M7RA 3ADWA 4N1YA 1ZUCA 1XVPA 3GYUA 3F5CA 5HJPB 5E0WA 2NPAA 4WHGA 4ITEA 1G5YA 3OMPA 2QPYA 5KRHA 1YYEA 3GYTA 1XQ3A 1ZDUA 4ZO1B 1XNNA 1XV9B 2VV4A 3VJTA 2PIPL 3W0IA 1R20D 2XYJA 2ZL9A 3RLJA 1DKFA 1NAXA 2VV3A 4FGYA 4KZJA 3AZ2A 1FBYA 5DWJA 3HC6A 2Q5SA 2QTUA 4N8RA 2QA8A 1RDTA 2P15A 2AXAA 3KMGA 4HLWA 1R6GA 4OFUA 1L2JA 1T74A 4K6IA 2QXMA 1X78A 4PXMA 2HB8A 2R6YA 3LMPA 5KRFA 3VT9A 2O9IA 2ZY0A 2P1VA 4JGVA 1YP0A 1M7WA 2ZNPA 3D6DA 4X1FA 5AZTA 2IOKA 3BQDA 5KCWA 1XVPB 2P7AA 3OS9A 3ET2A 4N73A 4QM0A 3F5CB 2ZFXA 4ZNWA 4P6WA 1G50A 2AMBA 4LBDA 2O4RA 5DUGA 5SYZA 4PRGA 2QGTA 3A78A 4A4WA 1K4WA 4WQPA 4G21A 1G1UA 1YJEA 3VHWA 5KYJA 2AX9A 2PRGA 3FXVA 2VV4B 4LTWA 3UP3A 1X7BA 2Q6SA 1XLSA 4OEYA 4RMDA 4XI3A 5AWJA 3X1IA 2OUZA 1RKGA 4XLDA 2ZMJA 3HM1A 1DKFB 4HEEX 3SZ1A 2ZLCA 1FM6A 1K74A 2HC4A 3SP9A 3P88A 2QW4A 3H52A 2QA8B 2QR9A 3AN3A 4S0SA 5GICA 2Q60A 2Q1VA 5DL4A 3JZCA 3OZJA 4CI5A 2PIUA 4OLMA 2ZNNA 1QKMA 1S0XA 1DB1A 2ATHA 2PIWA 3MNPA 1LV2A 4OILA 3OOKA 2QA6A 2ZXZA 1UPVA 3K8SA 4O8FA 1A52A 2GPOA 1WM0X 1FM9A 4IQRA 5DWGA 3RLLA 4XT9A 4S15A 4DM8A 3B1MA 3KBAA 3B0RA 5DXBA 1ZEOA 2AA5A 4PLEA 5DV6A 1OVLA 3WT7A 4S0TA 3W0AA 1XDKA 4UDCA 4PP3A 2J7YA 2QH6A 4J5XA 5APJA 3OKIA 4IW8A 4DMAA 1NQ2A 2I4PA 3ZQTA 2G0HA 2FAIA 2ZK3A 3KMRA 1SKXA 3AUQA 1Y0XX 4R06A 4IA1A 4S14A 2AX7A 1FCYA 1XNXA 2VV2A 3P89A 1EXXA 4L98A 3OSIA 5DK9A 3UU7A 3FEIA 3OOFA 4ZNTA 5C4OA 3V3QA 3L3XA 5KCEA 5KR9A 1P8DA 4IWFA 2G44A 3DZUD 2AA7A 3B3KA 4JAZA 4K7AA 3UUAA 4M8HA 2JJ3A 1IE8A 3B0WA 5IZ0A 3TY0A 1EXAA 2XYWA 4ZOMA 2O4JA 2IHQA 3AZ1A 4Q0AC 4RZEA 4P6XA 2ZXNA 4ZNVA 2AM9A 2PIOA 1XB7A 2HWRA 1NDEA 5E15A 3RUTA 3IXPA 2GP7A 5DIDA 5DXBB 4RE8A 3FC6B 3V4AA 5KCTA 5DZIA 2V0VA 2AWHA 3OS8C 1NQ7A 1OVLB 5DYBA 1XDKB 1ZKYA 4OK1A 5DXPA 3SP6A 1OSHA 5GIEA 2NXXE 1PDUA 2QMVA 3ADSA 1L2IA 3H0AA 4R6SA 3UP0A 3ZRBA 3VJIA 1YINA 2QSEA 4OGHA 5FQVA 4E4QA 5KRJA 3CDSA 5DV8A 4DOSA 1NQ0A 3X31A 3QT0A 4ZN7A 1M13A 1K7LA 2HWQA 3OAPA 3UU7B 2QXSA 2ZK2A 2B1ZA 3VT8A 2QE4A 3FLIA 3KPZA 3TX7B 2I0GA 3HODA 3PRGA 3PCUA 5DWLA 2ZKCA 3CLDA 3VRWA 2OCFA 1A28A 2OM9A 3UUAB 4OC7A 2IOGA 4QE6A 3AN4A 4OKTA 4ZNHA 3IPQA 2AB2A 3VSOA 5DRMA 5AK2A 1E3GA 1RJKA 4IU7A 3L1BA 1I7GA 3DY6A 5B5BA 5KCFA 1XOWA 1FCXA 2I0JA 1YOKA 3H0AD 1T7MA 5DXEA 2G5OA 3GBKA 1Y9RA 3WFGA 1E3KA 4YPQA 4XAOA 3W0YA 3W0JA 4Q50A 4J5WC 4CSJA 5DMCA 3L0JA 2H79A 3MNEA 1OSVA 1FCZA 4JYGA 5M96A 4FHHA 4OJBA 3B5RA 3NSQA 4R2UA 1KKQA 4MG6A 1X76A 3OMMA 1R1KD 2HB7A 3RUUA 1ZDTA 4PPSA 3FUGA 3K22A 3VJSA 2AA6A 1H9UA 4OARA 3UVVA 2P54A 5DIGA 3D90A 1XPCA 4IUIA 4IVWA 3HZFA 1S0ZA 4WPFA 5FQPA 4B7WA 5C4TA 2YLYA 3AFRA 2G0GA 2GL8A 2ZK4A 3OMOA 4REEA 3P0UA 3L3ZA 4RWVA 1MVCA 5DUEA 1SR7A 3Q95A 4MGAA 5DVSA 2LBDA 5DYDA 3ET1A 2ZK1A 1XP1A 5KROA 2V7CA 5L7GA 1OT7A 5IXKA 1EREA 2GPPA 3X36A 1NUOA 2ZLAA 3CQVA 5L11A 3GWSX 5G5WA 1R5KA 2F4BA 1Y0SA 2YJDA 3ET3A 3WT5A 4DORA 5HZCA 5I4VA 4DK8A 5C4SA 5KRIA 3DCUA 4L96A 4Q13A 3UVVB 3WTQA 1FD0A 5DX3A 3WGPA 3GWXA 1PQCA 5KCDA 4IA2A 1N83A 2ZNQA 1Z5XU 4FNEA 4OEDA 4K4JA 3UUCA 4LNXA 1T79A 1RDTD 2J7XA 2OVHA 5DXKA 3KMZA 1Z5XE 3VTDA 5EHJA 2Q5PA 2Q7LA 5DWIA 1QKUA 3G8IA 4G2IA 2YFEA 3VT4A 3Q95B 4MGAB 3R8AA 3FALA 4G20A 3R8IA 3OSAA 3X1HA 3ET0A 4OEZA 3HVLA 3OLLA 5E19A 2QZOB 5G46A 5ICKA 1T7TA 2FSZA 3OKHA 3OS8A 3R29A 3V3EA 1UPWA 3F7DA 4KZMA 1T65A 3ADUA 3E00A 3ERDA 3PEQA 4IS8A 4XHDA 3VJHA 2VV1A 1U9EA 5G43A 2HVCA 5DRJA 5E1CA 2Q59A 1U3RA 2HASA 5IAWA 2QGWA 4J26A 2HAMA 3FC6A 5DX3B 4PP6A 4OH6A 3NOAA 2JFAA 2P4YA 3DCTA 5DKGA 3GD2A 5KRKA 1FM6D 2PITA 1K74D 2Q3YA 1X7JA 2XKWA 4WVDA 4PF3A 5EITA 1PK5A 2ZK6A 3GZ9A 5ETHA 4JL4A 5DZ3A 4QE8A 4POHA 4Y29A 3OLSA 4MGDA 1N46A 3FALB 3VRUA 4MDDA 3VT7A 5HYRA 4UDBA 4OFRA 4MG8A 1FM9D 4IA7A 1NYXA 2A3IA 3G8OA 5E0XA 4MGCA 1HG4A 1XZXX 2OVMA 2QNVA 5DVVA 2ZXMA 4XUMA 2AX6A 4BCRA 2VV1B 2PINA 3MNOA 5DLRA 1RK3A 2Q59B 4J5WA 4PVUA 2ACLA 4ZN9A 5DP0A 5EJVA 5KCUA 4IV4A 4OJ9A 3OMQA 5FQRA 2PIXA 3CTBA 3OMKA 3P8XA 5HYKA 2JFAB 5E14A 2AA2A 2R40A 2VV0A 3IMYA 4UDAA 5FQTA 1PCGA 1ZGYA 2P1TA 2Z4JA 5GIDA 3TKCA 2XHSA 1KNUA 4OKXA 4RUPA 2REWA 4LNWA 2ZBSA 3CS4A 5A86A 3WWRA 4RZFA 4A2JA 4ZJWA 3OSWA 3PO9A 4MGDB 3CS6A 2B23A 2AYRA 3E7CA 5DXQA 3VTCA 3S9SA 5C4UA 4MG8B 3FURA 2GTKA 1I7IA 1I37A 4OZRU 4PP5A 4DQMA 4CI4A 4NIEA 3IPSA 2Q8SA 4ZNSA 3RY9A 4M8EA 3IXPD 1NHZA 5KRAA 3ZR7A 3W5PA 5AVLA 2Q5GA 4OZRE 2ACLB 4YT1A 2YLOA 4OKBA 2PIQA 2Q1HA 3WT6A 3JZBA 2PIVA 2ZNOA 3B0TA 4X1GA 1MV9A 2YHDA 5F9BA 3T03A 4YNKA 2QABA 3B0QA 4ZJRA 4OIUA 4JYIA 5EGVA 4POJA 2I4JA 5L7EA 3D57A 4QL8A 3W5TA 3DZYA 3HO0A 4XTAA 1X7EA 2FVJA 2XYXA 3K6PA 4MG5A 1I38A 1NRLA 5KYAA 2AMAA 1U3QA 3E94A 2ZK0A 3N00A 2Q6RA 2BAWA 1T7RA 1SQNA 5DVCA 1GWQA 2HARA 3FS1A 4E4KA 4MGBA 5G45A 4MG9A 2J4AA 2Q70A 3W0HA 1XJ7A 5JI0D 3VT6A 1T73A 1XP6A 1YUCA 1R20A 3L03A 1T63A 1XIUA 1XLSE 3UUDA 3W5RA 4OJ4A 5L7HA 5DKBA 2GPVA 1PRGA 1ILGA 4RUJA 3W5QA 3KDUA 2P7ZA 3OGTA 4RZGA 3DZYD 3L0EA 4WHFA 5B41A 5DY8A 3VI8A 4ZI1A 4JYHA 3VHVA 3V9VA 2Q7IA 3K23A 5DZHA 2QZOA 1YIMA 1TXIA 3CJWA 4WLBA 2W8YA 3FEJA 1S19A 2ZK5A 3BEJA 1YA3A 2NV7A 2YLPA 3IPUA 5DKSA 5LWPA 2B50A 2BJ4A 5DXMA 4MGBB 3B67A 3GN8A 5FQSA 2Z4BA 4LSJA 4MG9B 3A2HA 5G42A 3VSPA 5DWEA 2J14A 1GS4A 2AAXA 2P1UA 4RAKA 3UUDB 3W0CA 3WFFA 1Z95A 4G1YA 4MG7A 5GT4A 1YMTA 2JF9A 3KWYA 1ERRA 3VRVA 5DZ0A 2ZMHA 5DI7A 4NUFA 1Q4XA 4IVYA 4FN9A 3U9QA 3VRTA 5HJSA 3EYBA 2PNUA 5AAVA 3WMHA 5H1EA 1T5ZA 3OLFA 1KV6A 3V9TA 4PWLA 1X7RA 5DU5A 5CJ6A 1PQ9A 2AO6A 2Q61A 4A4VA 5AWKA 4F9MA 5DXRA 3R5MA 5DUHA 4RMEA 5LGAA 2BJ4B 1T7FA 4PLDA 5K13A 2GPUA 2PKLA 4ZNUA 4UDDA 3VT3A 2R6WA 3G9EA 3ADXA 4IW6A 2ZVTA 3B65A 5DKEA 3WJ4A 2Q6JA 1QKTA 1SJ0A 3KFCA 2OZ7A 4MG7B 5G3JA 2EWPA 2Q7KA 5AVIA 5EI1A 1BSXA 1XP9A 4OZTU 4APUA 2PIRA 3PLZA 2NW4A 3KDTA 5DIEA 1G2NA 4IWCA 3VTBA 2PJLA 5EC9A 1ZH7A 3W0GA 4OZTE 5AAVB 2E2RA 4OHAA 3PBAA 5AYGA 4RFWA 3ADVA 4OH5A 3DZUA 5AZVA 3E00D 2OAXA 1XAPA 3G0WA 2AX8A 4TUZA 4TV1A 4PPPA 4E2JA 2ZASA 1IE9A 2GWXA 3D5FA 3R8DA 3HQ5A 2ZMIA 2HFPA 3A3ZX 3ADTA 5KRLA 4IA3A 2HCDA 1U3SA 3A2JA 5DV3A 3B66A 5JY3A 4REFA 5ACCA 4OIVA 4N5GA 1PZLA 3OZ0A 3ERTA 1GWRA 3AUNA 5DZ1A 3AX8A 4G1DA 3VN2A 5KRCA 3R5NA 2YJAB 2VSRA 3RVFA 2I4ZA 1LBDA 3CDPA 1RKHA 3WJ5A 3VHUA 1VJBA 3BC5A 1NQ1A 4KZIA 5AAUA 2H77A 5KCCA 1N4HA 3A9EA 3O1DA 3TKMA 4TUZB 4TV1B 3V9YA 5KD9A 4J24A 5HCVA 1YY4A 3IA6A 1PQ6A 3O1EA 4NB6A 3R2AA 1ILHA 3A40X 5JJMA 3A2IA 3LBDA 2R40D 4IV2A 3KYTA 3L0LA 1UOMA 4OKWA 4XUHA 1NAVA 1UHLA 2POGA 3HC5A 1P93A 3HLVA 2Q7JA 1ZAFA 5DSHA 2GIUA 3D24A 1MZNA 2ABIA 4FHIA 4EM9A 1YOWA 5DXGA 4NY9A 3DT3A 4RMCA 3V49A 1QKNA 4J5XC 4G1ZA 5HJPA 4NQAB 4ZO1X 3B68A 5DTVA 2POBA 1XQCA 4DK7A 2VSTA 4DM6A 1T76A 3AURA 3ILZA 1GWXA 1S9QA 5KRMA 3A9EB 5APKA 4QJRA 5E7VA 1R1KA 1XV9A 3CWDA 4YMQA 2YATA 2B1VA 3DR1A 5DMFA 5G44A 4ONIA 2HBHA 2P7GA 5JJMB 3NSPA 3VT5A 2YLQA 1TFCA 4G2HA 2NXXA 1UHLB 4OEAA 1M2ZA 4RUOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZ3 A;  5APH A;  3ZRA A;  4EMA A;  4ITF A;  4QK4 A;  1HJ1 A;  3CS8 A;  1S9P A;  3M7R A;  3ADW A;  4N1Y A;  1ZUC A;  1XVP A;  3GYU A;  3F5C A;  5HJP B;  5E0W A;  2NPA A;  4WHG A;  4ITE A;  1G5Y A;  3OMP A;  2QPY A;  5KRH A;  1YYE A;  3GYT A;  1XQ3 A;  1ZDU A;  4ZO1 B;  1XNN A;  1XV9 B;  2VV4 A;  3VJT A;  2PIP L;  3W0I A;  1R20 D;  2XYJ A;  2ZL9 A;  3RLJ A;  1DKF A;  1NAX A;  2VV3 A;  4FGY A;  4KZJ A;  3AZ2 A;  1FBY A;  5DWJ A;  3HC6 A;  2Q5S A;  2QTU A;  4N8R A;  2QA8 A;  1RDT A;  2P15 A;  2AXA A;  3KMG A;  4HLW A;  1R6G A;  4OFU A;  1L2J A;  1T74 A;  4K6I A;  2QXM A;  1X78 A;  4PXM A;  2HB8 A;  2R6Y A;  3LMP A;  5KRF A;  3VT9 A;  2O9I A;  2ZY0 A;  2P1V A;  4JGV A;  1YP0 A;  1M7W A;  2ZNP A;  3D6D A;  4X1F A;  5AZT A;  2IOK A;  3BQD A;  5KCW A;  1XVP B;  2P7A A;  3OS9 A;  3ET2 A;  4N73 A;  4QM0 A;  3F5C B;  2ZFX A;  4ZNW A;  4P6W A;  1G50 A;  2AMB A;  4LBD A;  2O4R A;  5DUG A;  5SYZ A;  4PRG A;  2QGT A;  3A78 A;  4A4W A;  1K4W A;  4WQP A;  4G21 A;  1G1U A;  1YJE A;  3VHW A;  5KYJ A;  2AX9 A;  2PRG A;  3FXV A;  2VV4 B;  4LTW A;  3UP3 A;  1X7B A;  2Q6S A;  1XLS A;  4OEY A;  4RMD A;  4XI3 A;  5AWJ A;  3X1I A;  2OUZ A;  1RKG A;  4XLD A;  2ZMJ A;  3HM1 A;  1DKF B;  4HEE X;  3SZ1 A;  2ZLC A;  1FM6 A;  1K74 A;  2HC4 A;  3SP9 A;  3P88 A;  2QW4 A;  3H52 A;  2QA8 B;  2QR9 A;  3AN3 A;  4S0S A;  5GIC A;  2Q60 A;  2Q1V A;  5DL4 A;  3JZC A;  3OZJ A;  4CI5 A;  2PIU A;  4OLM A;  2ZNN A;  1QKM A;  1S0X A;  1DB1 A;  2ATH A;  2PIW A;  3MNP A;  1LV2 A;  4OIL A;  3OOK A;  2QA6 A;  2ZXZ A;  1UPV A;  3K8S A;  4O8F A;  1A52 A;  2GPO A;  1WM0 X;  1FM9 A;  4IQR A;  5DWG A;  3RLL A;  4XT9 A;  4S15 A;  4DM8 A;  3B1M A;  3KBA A;  3B0R A;  5DXB A;  1ZEO A;  2AA5 A;  4PLE A;  5DV6 A;  1OVL A;  3WT7 A;  4S0T A;  3W0A A;  1XDK A;  4UDC A;  4PP3 A;  2J7Y A;  2QH6 A;  4J5X A;  5APJ A;  3OKI A;  4IW8 A;  4DMA A;  1NQ2 A;  2I4P A;  3ZQT A;  2G0H A;  2FAI A;  2ZK3 A;  3KMR A;  1SKX A;  3AUQ A;  1Y0X X;  4R06 A;  4IA1 A;  4S14 A;  2AX7 A;  1FCY A;  1XNX A;  2VV2 A;  3P89 A;  1EXX A;  4L98 A;  3OSI A;  5DK9 A;  3UU7 A;  3FEI A;  3OOF A;  4ZNT A;  5C4O A;  3V3Q A;  3L3X A;  5KCE A;  5KR9 A;  1P8D A;  4IWF A;  2G44 A;  3DZU D;  2AA7 A;  3B3K A;  4JAZ A;  4K7A A;  3UUA A;  4M8H A;  2JJ3 A;  1IE8 A;  3B0W A;  5IZ0 A;  3TY0 A;  1EXA A;  2XYW A;  4ZOM A;  2O4J A;  2IHQ A;  3AZ1 A;  4Q0A C;  4RZE A;  4P6X A;  2ZXN A;  4ZNV A;  2AM9 A;  2PIO A;  1XB7 A;  2HWR A;  1NDE A;  5E15 A;  3RUT A;  3IXP A;  2GP7 A;  5DID A;  5DXB B;  4RE8 A;  3FC6 B;  3V4A A;  5KCT A;  5DZI A;  2V0V A;  2AWH A;  3OS8 C;  1NQ7 A;  1OVL B;  5DYB A;  1XDK B;  1ZKY A;  4OK1 A;  5DXP A;  3SP6 A;  1OSH A;  5GIE A;  2NXX E;  1PDU A;  2QMV A;  3ADS A;  1L2I A;  3H0A A;  4R6S A;  3UP0 A;  3ZRB A;  3VJI A;  1YIN A;  2QSE A;  4OGH A;  5FQV A;  4E4Q A;  5KRJ A;  3CDS A;  5DV8 A;  4DOS A;  1NQ0 A;  3X31 A;  3QT0 A;  4ZN7 A;  1M13 A;  1K7L A;  2HWQ A;  3OAP A;  3UU7 B;  2QXS A;  2ZK2 A;  2B1Z A;  3VT8 A;  2QE4 A;  3FLI A;  3KPZ A;  3TX7 B;  2I0G A;  3HOD A;  3PRG A;  3PCU A;  5DWL A;  2ZKC A;  3CLD A;  3VRW A;  2OCF A;  1A28 A;  2OM9 A;  3UUA B;  4OC7 A;  2IOG A;  4QE6 A;  3AN4 A;  4OKT A;  4ZNH A;  3IPQ A;  2AB2 A;  3VSO A;  5DRM A;  5AK2 A;  1E3G A;  1RJK A;  4IU7 A;  3L1B A;  1I7G A;  3DY6 A;  5B5B A;  5KCF A;  1XOW A;  1FCX A;  2I0J A;  1YOK A;  3H0A D;  1T7M A;  5DXE A;  2G5O A;  3GBK A;  1Y9R A;  3WFG A;  1E3K A;  4YPQ A;  4XAO A;  3W0Y A;  3W0J A;  4Q50 A;  4J5W C;  4CSJ A;  5DMC A;  3L0J A;  2H79 A;  3MNE A;  1OSV A;  1FCZ A;  4JYG A;  5M96 A;  4FHH A;  4OJB A;  3B5R A;  3NSQ A;  4R2U A;  1KKQ A;  4MG6 A;  1X76 A;  3OMM A;  1R1K D;  2HB7 A;  3RUU A;  1ZDT A;  4PPS A;  3FUG A;  3K22 A;  3VJS A;  2AA6 A;  1H9U A;  4OAR A;  3UVV A;  2P54 A;  5DIG A;  3D90 A;  1XPC A;  4IUI A;  4IVW A;  3HZF A;  1S0Z A;  4WPF A;  5FQP A;  4B7W A;  5C4T A;  2YLY A;  3AFR A;  2G0G A;  2GL8 A;  2ZK4 A;  3OMO A;  4REE A;  3P0U A;  3L3Z A;  4RWV A;  1MVC A;  5DUE A;  1SR7 A;  3Q95 A;  4MGA A;  5DVS A;  2LBD A;  5DYD A;  3ET1 A;  2ZK1 A;  1XP1 A;  5KRO A;  2V7C A;  5L7G A;  1OT7 A;  5IXK A;  1ERE A;  2GPP A;  3X36 A;  1NUO A;  2ZLA A;  3CQV A;  5L11 A;  3GWS X;  5G5W A;  1R5K A;  2F4B A;  1Y0S A;  2YJD A;  3ET3 A;  3WT5 A;  4DOR A;  5HZC A;  5I4V A;  4DK8 A;  5C4S A;  5KRI A;  3DCU A;  4L96 A;  4Q13 A;  3UVV B;  3WTQ A;  1FD0 A;  5DX3 A;  3WGP A;  3GWX A;  1PQC A;  5KCD A;  4IA2 A;  1N83 A;  2ZNQ A;  1Z5X U;  4FNE A;  4OED A;  4K4J A;  3UUC A;  4LNX A;  1T79 A;  1RDT D;  2J7X A;  2OVH A;  5DXK A;  3KMZ A;  1Z5X E;  3VTD A;  5EHJ A;  2Q5P A;  2Q7L A;  5DWI A;  1QKU A;  3G8I A;  4G2I A;  2YFE A;  3VT4 A;  3Q95 B;  4MGA B;  3R8A A;  3FAL A;  4G20 A;  3R8I A;  3OSA A;  3X1H A;  3ET0 A;  4OEZ A;  3HVL A;  3OLL A;  5E19 A;  2QZO B;  5G46 A;  5ICK A;  1T7T A;  2FSZ A;  3OKH A;  3OS8 A;  3R29 A;  3V3E A;  1UPW A;  3F7D A;  4KZM A;  1T65 A;  3ADU A;  3E00 A;  3ERD A;  3PEQ A;  4IS8 A;  4XHD A;  3VJH A;  2VV1 A;  1U9E A;  5G43 A;  2HVC A;  5DRJ A;  5E1C A;  2Q59 A;  1U3R A;  2HAS A;  5IAW A;  2QGW A;  4J26 A;  2HAM A;  3FC6 A;  5DX3 B;  4PP6 A;  4OH6 A;  3NOA A;  2JFA A;  2P4Y A;  3DCT A;  5DKG A;  3GD2 A;  5KRK A;  1FM6 D;  2PIT A;  1K74 D;  2Q3Y A;  1X7J A;  2XKW A;  4WVD A;  4PF3 A;  5EIT A;  1PK5 A;  2ZK6 A;  3GZ9 A;  5ETH A;  4JL4 A;  5DZ3 A;  4QE8 A;  4POH A;  4Y29 A;  3OLS A;  4MGD A;  1N46 A;  3FAL B;  3VRU A;  4MDD A;  3VT7 A;  5HYR A;  4UDB A;  4OFR A;  4MG8 A;  1FM9 D;  4IA7 A;  1NYX A;  2A3I A;  3G8O A;  5E0X A;  4MGC A;  1HG4 A;  1XZX X;  2OVM A;  2QNV A;  5DVV A;  2ZXM A;  4XUM A;  2AX6 A;  4BCR A;  2VV1 B;  2PIN A;  3MNO A;  5DLR A;  1RK3 A;  2Q59 B;  4J5W A;  4PVU A;  2ACL A;  4ZN9 A;  5DP0 A;  5EJV A;  5KCU A;  4IV4 A;  4OJ9 A;  3OMQ A;  5FQR A;  2PIX A;  3CTB A;  3OMK A;  3P8X A;  5HYK A;  2JFA B;  5E14 A;  2AA2 A;  2R40 A;  2VV0 A;  3IMY A;  4UDA A;  5FQT A;  1PCG A;  1ZGY A;  2P1T A;  2Z4J A;  5GID A;  3TKC A;  2XHS A;  1KNU A;  4OKX A;  4RUP A;  2REW A;  4LNW A;  2ZBS A;  3CS4 A;  5A86 A;  3WWR A;  4RZF A;  4A2J A;  4ZJW A;  3OSW A;  3PO9 A;  4MGD B;  3CS6 A;  2B23 A;  2AYR A;  3E7C A;  5DXQ A;  3VTC A;  3S9S A;  5C4U A;  4MG8 B;  3FUR A;  2GTK A;  1I7I A;  1I37 A;  4OZR U;  4PP5 A;  4DQM A;  4CI4 A;  4NIE A;  3IPS A;  2Q8S A;  4ZNS A;  3RY9 A;  4M8E A;  3IXP D;  1NHZ A;  5KRA A;  3ZR7 A;  3W5P A;  5AVL A;  2Q5G A;  4OZR E;  2ACL B;  4YT1 A;  2YLO A;  4OKB A;  2PIQ A;  2Q1H A;  3WT6 A;  3JZB A;  2PIV A;  2ZNO A;  3B0T A;  4X1G A;  1MV9 A;  2YHD A;  5F9B A;  3T03 A;  4YNK A;  2QAB A;  3B0Q A;  4ZJR A;  4OIU A;  4JYI A;  5EGV A;  4POJ A;  2I4J A;  5L7E A;  3D57 A;  4QL8 A;  3W5T A;  3DZY A;  3HO0 A;  4XTA A;  1X7E A;  2FVJ A;  2XYX A;  3K6P A;  4MG5 A;  1I38 A;  1NRL A;  5KYA A;  2AMA A;  1U3Q A;  3E94 A;  2ZK0 A;  3N00 A;  2Q6R A;  2BAW A;  1T7R A;  1SQN A;  5DVC A;  1GWQ A;  2HAR A;  3FS1 A;  4E4K A;  4MGB A;  5G45 A;  4MG9 A;  2J4A A;  2Q70 A;  3W0H A;  1XJ7 A;  5JI0 D;  3VT6 A;  1T73 A;  1XP6 A;  1YUC A;  1R20 A;  3L03 A;  1T63 A;  1XIU A;  1XLS E;  3UUD A;  3W5R A;  4OJ4 A;  5L7H A;  5DKB A;  2GPV A;  1PRG A;  1ILG A;  4RUJ A;  3W5Q A;  3KDU A;  2P7Z A;  3OGT A;  4RZG A;  3DZY D;  3L0E A;  4WHF A;  5B41 A;  5DY8 A;  3VI8 A;  4ZI1 A;  4JYH A;  3VHV A;  3V9V A;  2Q7I A;  3K23 A;  5DZH A;  2QZO A;  1YIM A;  1TXI A;  3CJW A;  4WLB A;  2W8Y A;  3FEJ A;  1S19 A;  2ZK5 A;  3BEJ A;  1YA3 A;  2NV7 A;  2YLP A;  3IPU A;  5DKS A;  5LWP A;  2B50 A;  2BJ4 A;  5DXM A;  4MGB B;  3B67 A;  3GN8 A;  5FQS A;  2Z4B A;  4LSJ A;  4MG9 B;  3A2H A;  5G42 A;  3VSP A;  5DWE A;  2J14 A;  1GS4 A;  2AAX A;  2P1U A;  4RAK A;  3UUD B;  3W0C A;  3WFF A;  1Z95 A;  4G1Y A;  4MG7 A;  5GT4 A;  1YMT A;  2JF9 A;  3KWY A;  1ERR A;  3VRV A;  5DZ0 A;  2ZMH A;  5DI7 A;  4NUF A;  1Q4X A;  4IVY A;  4FN9 A;  3U9Q A;  3VRT A;  5HJS A;  3EYB A;  2PNU A;  5AAV A;  3WMH A;  5H1E A;  1T5Z A;  3OLF A;  1KV6 A;  3V9T A;  4PWL A;  1X7R A;  5DU5 A;  5CJ6 A;  1PQ9 A;  2AO6 A;  2Q61 A;  4A4V A;  5AWK A;  4F9M A;  5DXR A;  3R5M A;  5DUH A;  4RME A;  5LGA A;  2BJ4 B;  1T7F A;  4PLD A;  5K13 A;  2GPU A;  2PKL A;  4ZNU A;  4UDD A;  3VT3 A;  2R6W A;  3G9E A;  3ADX A;  4IW6 A;  2ZVT A;  3B65 A;  5DKE A;  3WJ4 A;  2Q6J A;  1QKT A;  1SJ0 A;  3KFC A;  2OZ7 A;  4MG7 B;  5G3J A;  2EWP A;  2Q7K A;  5AVI A;  5EI1 A;  1BSX A;  1XP9 A;  4OZT U;  4APU A;  2PIR A;  3PLZ A;  2NW4 A;  3KDT A;  5DIE A;  1G2N A;  4IWC A;  3VTB A;  2PJL A;  5EC9 A;  1ZH7 A;  3W0G A;  4OZT E;  5AAV B;  2E2R A;  4OHA A;  3PBA A;  5AYG A;  4RFW A;  3ADV A;  4OH5 A;  3DZU A;  5AZV A;  3E00 D;  2OAX A;  1XAP A;  3G0W A;  2AX8 A;  4TUZ A;  4TV1 A;  4PPP A;  4E2J A;  2ZAS A;  1IE9 A;  2GWX A;  3D5F A;  3R8D A;  3HQ5 A;  2ZMI A;  2HFP A;  3A3Z X;  3ADT A;  5KRL A;  4IA3 A;  2HCD A;  1U3S A;  3A2J A;  5DV3 A;  3B66 A;  5JY3 A;  4REF A;  5ACC A;  4OIV A;  4N5G A;  1PZL A;  3OZ0 A;  3ERT A;  1GWR A;  3AUN A;  5DZ1 A;  3AX8 A;  4G1D A;  3VN2 A;  5KRC A;  3R5N A;  2YJA B;  2VSR A;  3RVF A;  2I4Z A;  1LBD A;  3CDP A;  1RKH A;  3WJ5 A;  3VHU A;  1VJB A;  3BC5 A;  1NQ1 A;  4KZI A;  5AAU A;  2H77 A;  5KCC A;  1N4H A;  3A9E A;  3O1D A;  3TKM A;  4TUZ B;  4TV1 B;  3V9Y A;  5KD9 A;  4J24 A;  5HCV A;  1YY4 A;  3IA6 A;  1PQ6 A;  3O1E A;  4NB6 A;  3R2A A;  1ILH A;  3A40 X;  5JJM A;  3A2I A;  3LBD A;  2R40 D;  4IV2 A;  3KYT A;  3L0L A;  1UOM A;  4OKW A;  4XUH A;  1NAV A;  1UHL A;  2POG A;  3HC5 A;  1P93 A;  3HLV A;  2Q7J A;  1ZAF A;  5DSH A;  2GIU A;  3D24 A;  1MZN A;  2ABI A;  4FHI A;  4EM9 A;  1YOW A;  5DXG A;  4NY9 A;  3DT3 A;  4RMC A;  3V49 A;  1QKN A;  4J5X C;  4G1Z A;  5HJP A;  4NQA B;  4ZO1 X;  3B68 A;  5DTV A;  2POB A;  1XQC A;  4DK7 A;  2VST A;  4DM6 A;  1T76 A;  3AUR A;  3ILZ A;  1GWX A;  1S9Q A;  5KRM A;  3A9E B;  5APK A;  4QJR A;  5E7V A;  1R1K A;  1XV9 A;  3CWD A;  4YMQ A;  2YAT A;  2B1V A;  3DR1 A;  5DMF A;  5G44 A;  4ONI A;  2HBH A;  2P7G A;  5JJM B;  3NSP A;  3VT5 A;  2YLQ A;  1TFC A;  4G2H A;  2NXX A;  1UHL B;  4OEA A;  1M2Z A;  4RUO X; 
#chains in the Genus database with same CATH topology
 3AZ3 A;  5APH A;  3ZRA A;  4EMA A;  4ITF A;  4QK4 A;  1HJ1 A;  3CS8 A;  1S9P A;  3M7R A;  3ADW A;  4N1Y A;  1ZUC A;  1XVP A;  3GYU A;  3F5C A;  5HJP B;  5E0W A;  2NPA A;  4WHG A;  4ITE A;  1G5Y A;  3OMP A;  2QPY A;  5KRH A;  1YYE A;  3GYT A;  1XQ3 A;  1ZDU A;  4ZO1 B;  1XNN A;  1XV9 B;  2VV4 A;  3VJT A;  2PIP L;  3W0I A;  1R20 D;  2XYJ A;  2ZL9 A;  3RLJ A;  1DKF A;  1NAX A;  2VV3 A;  4FGY A;  4KZJ A;  3AZ2 A;  1FBY A;  5DWJ A;  3HC6 A;  2Q5S A;  2QTU A;  4N8R A;  2QA8 A;  1RDT A;  2P15 A;  2AXA A;  3KMG A;  4HLW A;  1R6G A;  4OFU A;  1L2J A;  1T74 A;  4K6I A;  2QXM A;  1X78 A;  4PXM A;  2HB8 A;  2R6Y A;  3LMP A;  5KRF A;  3VT9 A;  2O9I A;  2ZY0 A;  2P1V A;  4JGV A;  1YP0 A;  1M7W A;  2ZNP A;  3D6D A;  4X1F A;  5AZT A;  2IOK A;  3BQD A;  5KCW A;  1XVP B;  2P7A A;  3OS9 A;  3ET2 A;  4N73 A;  4QM0 A;  3F5C B;  2ZFX A;  4ZNW A;  4P6W A;  1G50 A;  2AMB A;  4LBD A;  2O4R A;  5DUG A;  5SYZ A;  4PRG A;  2QGT A;  3A78 A;  4A4W A;  1K4W A;  4WQP A;  4G21 A;  1G1U A;  1YJE A;  3VHW A;  5KYJ A;  2AX9 A;  2PRG A;  3FXV A;  2VV4 B;  4LTW A;  3UP3 A;  1X7B A;  2Q6S A;  1XLS A;  4OEY A;  4RMD A;  4XI3 A;  5AWJ A;  3X1I A;  2OUZ A;  1RKG A;  4XLD A;  2ZMJ A;  3HM1 A;  1DKF B;  4HEE X;  3SZ1 A;  2ZLC A;  1FM6 A;  1K74 A;  2HC4 A;  3SP9 A;  3P88 A;  2QW4 A;  3H52 A;  2QA8 B;  2QR9 A;  3AN3 A;  4S0S A;  5GIC A;  2Q60 A;  2Q1V A;  5DL4 A;  3JZC A;  3OZJ A;  4CI5 A;  2PIU A;  4OLM A;  2ZNN A;  1QKM A;  1S0X A;  1DB1 A;  2ATH A;  2PIW A;  3MNP A;  1LV2 A;  4OIL A;  3OOK A;  2QA6 A;  2ZXZ A;  1UPV A;  3K8S A;  4O8F A;  1A52 A;  2GPO A;  1WM0 X;  1FM9 A;  4IQR A;  5DWG A;  3RLL A;  4XT9 A;  4S15 A;  4DM8 A;  3B1M A;  3KBA A;  3B0R A;  5DXB A;  1ZEO A;  2AA5 A;  4PLE A;  5DV6 A;  1OVL A;  3WT7 A;  4S0T A;  3W0A A;  1XDK A;  4UDC A;  4PP3 A;  2J7Y A;  2QH6 A;  4J5X A;  5APJ A;  3OKI A;  4IW8 A;  4DMA A;  1NQ2 A;  2I4P A;  3ZQT A;  2G0H A;  2FAI A;  2ZK3 A;  3KMR A;  1SKX A;  3AUQ A;  1Y0X X;  4R06 A;  4IA1 A;  4S14 A;  2AX7 A;  1FCY A;  1XNX A;  2VV2 A;  3P89 A;  1EXX A;  4L98 A;  3OSI A;  5DK9 A;  3UU7 A;  3FEI A;  3OOF A;  4ZNT A;  5C4O A;  3V3Q A;  3L3X A;  5KCE A;  5KR9 A;  1P8D A;  4IWF A;  2G44 A;  3DZU D;  2AA7 A;  3B3K A;  4JAZ A;  4K7A A;  3UUA A;  4M8H A;  2JJ3 A;  1IE8 A;  3B0W A;  5IZ0 A;  3TY0 A;  1EXA A;  2XYW A;  4ZOM A;  2O4J A;  2IHQ A;  3AZ1 A;  4Q0A C;  4RZE A;  4P6X A;  2ZXN A;  4ZNV A;  2AM9 A;  2PIO A;  1XB7 A;  2HWR A;  1NDE A;  5E15 A;  3RUT A;  3IXP A;  2GP7 A;  5DID A;  5DXB B;  4RE8 A;  3FC6 B;  3V4A A;  5KCT A;  5DZI A;  2V0V A;  2AWH A;  3OS8 C;  1NQ7 A;  1OVL B;  5DYB A;  1XDK B;  1ZKY A;  4OK1 A;  5DXP A;  3SP6 A;  1OSH A;  5GIE A;  2NXX E;  1PDU A;  2QMV A;  3ADS A;  1L2I A;  3H0A A;  4R6S A;  3UP0 A;  3ZRB A;  3VJI A;  1YIN A;  2QSE A;  4OGH A;  5FQV A;  4E4Q A;  5KRJ A;  3CDS A;  5DV8 A;  4DOS A;  1NQ0 A;  3X31 A;  3QT0 A;  4ZN7 A;  1M13 A;  1K7L A;  2HWQ A;  3OAP A;  3UU7 B;  2QXS A;  2ZK2 A;  2B1Z A;  3VT8 A;  2QE4 A;  3FLI A;  3KPZ A;  3TX7 B;  2I0G A;  3HOD A;  3PRG A;  3PCU A;  5DWL A;  2ZKC A;  3CLD A;  3VRW A;  2OCF A;  1A28 A;  2OM9 A;  3UUA B;  4OC7 A;  2IOG A;  4QE6 A;  3AN4 A;  4OKT A;  4ZNH A;  3IPQ A;  2AB2 A;  3VSO A;  5DRM A;  5AK2 A;  1E3G A;  1RJK A;  4IU7 A;  3L1B A;  1I7G A;  3DY6 A;  5B5B A;  5KCF A;  1XOW A;  1FCX A;  2I0J A;  1YOK A;  3H0A D;  1T7M A;  5DXE A;  2G5O A;  3GBK A;  1Y9R A;  3WFG A;  1E3K A;  4YPQ A;  4XAO A;  3W0Y A;  3W0J A;  4Q50 A;  4J5W C;  4CSJ A;  5DMC A;  3L0J A;  2H79 A;  3MNE A;  1OSV A;  1FCZ A;  4JYG A;  5M96 A;  4FHH A;  4OJB A;  3B5R A;  3NSQ A;  4R2U A;  1KKQ A;  4MG6 A;  1X76 A;  3OMM A;  1R1K D;  2HB7 A;  3RUU A;  1ZDT A;  4PPS A;  3FUG A;  3K22 A;  3VJS A;  2AA6 A;  1H9U A;  4OAR A;  3UVV A;  2P54 A;  5DIG A;  3D90 A;  1XPC A;  4IUI A;  4IVW A;  3HZF A;  1S0Z A;  4WPF A;  5FQP A;  4B7W A;  5C4T A;  2YLY A;  3AFR A;  2G0G A;  2GL8 A;  2ZK4 A;  3OMO A;  4REE A;  3P0U A;  3L3Z A;  4RWV A;  1MVC A;  5DUE A;  1SR7 A;  3Q95 A;  4MGA A;  5DVS A;  2LBD A;  5DYD A;  3ET1 A;  2ZK1 A;  1XP1 A;  5KRO A;  2V7C A;  5L7G A;  1OT7 A;  5IXK A;  1ERE A;  2GPP A;  3X36 A;  1NUO A;  2ZLA A;  3CQV A;  5L11 A;  3GWS X;  5G5W A;  1R5K A;  2F4B A;  1Y0S A;  2YJD A;  3ET3 A;  3WT5 A;  4DOR A;  5HZC A;  5I4V A;  4DK8 A;  5C4S A;  5KRI A;  3DCU A;  4L96 A;  4Q13 A;  3UVV B;  3WTQ A;  1FD0 A;  5DX3 A;  3WGP A;  3GWX A;  1PQC A;  5KCD A;  4IA2 A;  1N83 A;  2ZNQ A;  1Z5X U;  4FNE A;  4OED A;  4K4J A;  3UUC A;  4LNX A;  1T79 A;  1RDT D;  2J7X A;  2OVH A;  5DXK A;  3KMZ A;  1Z5X E;  3VTD A;  5EHJ A;  2Q5P A;  2Q7L A;  5DWI A;  1QKU A;  3G8I A;  4G2I A;  2YFE A;  3VT4 A;  3Q95 B;  4MGA B;  3R8A A;  3FAL A;  4G20 A;  3R8I A;  3OSA A;  3X1H A;  3ET0 A;  4OEZ A;  3HVL A;  3OLL A;  5E19 A;  2QZO B;  5G46 A;  5ICK A;  1T7T A;  2FSZ A;  3OKH A;  3OS8 A;  3R29 A;  3V3E A;  1UPW A;  3F7D A;  4KZM A;  1T65 A;  3ADU A;  3E00 A;  3ERD A;  3PEQ A;  4IS8 A;  4XHD A;  3VJH A;  2VV1 A;  1U9E A;  5G43 A;  2HVC A;  5DRJ A;  5E1C A;  2Q59 A;  1U3R A;  2HAS A;  5IAW A;  2QGW A;  4J26 A;  2HAM A;  3FC6 A;  5DX3 B;  4PP6 A;  4OH6 A;  3NOA A;  2JFA A;  2P4Y A;  3DCT A;  5DKG A;  3GD2 A;  5KRK A;  1FM6 D;  2PIT A;  1K74 D;  2Q3Y A;  1X7J A;  2XKW A;  4WVD A;  4PF3 A;  5EIT A;  1PK5 A;  2ZK6 A;  3GZ9 A;  5ETH A;  4JL4 A;  5DZ3 A;  4QE8 A;  4POH A;  4Y29 A;  3OLS A;  4MGD A;  1N46 A;  3FAL B;  3VRU A;  4MDD A;  3VT7 A;  5HYR A;  4UDB A;  4OFR A;  4MG8 A;  1FM9 D;  4IA7 A;  1NYX A;  2A3I A;  3G8O A;  5E0X A;  4MGC A;  1HG4 A;  1XZX X;  2OVM A;  2QNV A;  5DVV A;  2ZXM A;  4XUM A;  2AX6 A;  4BCR A;  2VV1 B;  2PIN A;  3MNO A;  5DLR A;  1RK3 A;  2Q59 B;  4J5W A;  4PVU A;  2ACL A;  4ZN9 A;  5DP0 A;  5EJV A;  5KCU A;  4IV4 A;  4OJ9 A;  3OMQ A;  5FQR A;  2PIX A;  3CTB A;  3OMK A;  3P8X A;  5HYK A;  2JFA B;  5E14 A;  2AA2 A;  2R40 A;  2VV0 A;  3IMY A;  4UDA A;  5FQT A;  1PCG A;  1ZGY A;  2P1T A;  2Z4J A;  5GID A;  3TKC A;  2XHS A;  1KNU A;  4OKX A;  4RUP A;  2REW A;  4LNW A;  2ZBS A;  3CS4 A;  5A86 A;  3WWR A;  4RZF A;  4A2J A;  4ZJW A;  3OSW A;  3PO9 A;  4MGD B;  3CS6 A;  2B23 A;  2AYR A;  3E7C A;  5DXQ A;  3VTC A;  3S9S A;  5C4U A;  4MG8 B;  3FUR A;  2GTK A;  1I7I A;  1I37 A;  4OZR U;  4PP5 A;  4DQM A;  4CI4 A;  4NIE A;  3IPS A;  2Q8S A;  4ZNS A;  3RY9 A;  4M8E A;  3IXP D;  1NHZ A;  5KRA A;  3ZR7 A;  3W5P A;  5AVL A;  2Q5G A;  4OZR E;  2ACL B;  4YT1 A;  2YLO A;  4OKB A;  2PIQ A;  2Q1H A;  3WT6 A;  3JZB A;  2PIV A;  2ZNO A;  3B0T A;  4X1G A;  1MV9 A;  2YHD A;  5F9B A;  3T03 A;  4YNK A;  2QAB A;  3B0Q A;  4ZJR A;  4OIU A;  4JYI A;  5EGV A;  4POJ A;  2I4J A;  5L7E A;  3D57 A;  4QL8 A;  3W5T A;  3DZY A;  3HO0 A;  4XTA A;  1X7E A;  2FVJ A;  2XYX A;  3K6P A;  4MG5 A;  1I38 A;  1NRL A;  5KYA A;  2AMA A;  1U3Q A;  3E94 A;  2ZK0 A;  3N00 A;  2Q6R A;  2BAW A;  1T7R A;  1SQN A;  5DVC A;  1GWQ A;  2HAR A;  3FS1 A;  4E4K A;  4MGB A;  5G45 A;  4MG9 A;  2J4A A;  2Q70 A;  3W0H A;  1XJ7 A;  5JI0 D;  3VT6 A;  1T73 A;  1XP6 A;  1YUC A;  1R20 A;  3L03 A;  1T63 A;  1XIU A;  1XLS E;  3UUD A;  3W5R A;  4OJ4 A;  5L7H A;  5DKB A;  2GPV A;  1PRG A;  1ILG A;  4RUJ A;  3W5Q A;  3KDU A;  2P7Z A;  3OGT A;  4RZG A;  3DZY D;  3L0E A;  4WHF A;  5B41 A;  5DY8 A;  3VI8 A;  4ZI1 A;  4JYH A;  3VHV A;  3V9V A;  2Q7I A;  3K23 A;  5DZH A;  2QZO A;  1YIM A;  1TXI A;  3CJW A;  4WLB A;  2W8Y A;  3FEJ A;  1S19 A;  2ZK5 A;  3BEJ A;  1YA3 A;  2NV7 A;  2YLP A;  3IPU A;  5DKS A;  5LWP A;  2B50 A;  2BJ4 A;  5DXM A;  4MGB B;  3B67 A;  3GN8 A;  5FQS A;  2Z4B A;  4LSJ A;  4MG9 B;  3A2H A;  5G42 A;  3VSP A;  5DWE A;  2J14 A;  1GS4 A;  2AAX A;  2P1U A;  4RAK A;  3UUD B;  3W0C A;  3WFF A;  1Z95 A;  4G1Y A;  4MG7 A;  5GT4 A;  1YMT A;  2JF9 A;  3KWY A;  1ERR A;  3VRV A;  5DZ0 A;  2ZMH A;  5DI7 A;  4NUF A;  1Q4X A;  4IVY A;  4FN9 A;  3U9Q A;  3VRT A;  5HJS A;  3EYB A;  2PNU A;  5AAV A;  3WMH A;  5H1E A;  1T5Z A;  3OLF A;  1KV6 A;  3V9T A;  4PWL A;  1X7R A;  5DU5 A;  5CJ6 A;  1PQ9 A;  2AO6 A;  2Q61 A;  4A4V A;  5AWK A;  4F9M A;  5DXR A;  3R5M A;  5DUH A;  4RME A;  5LGA A;  2BJ4 B;  1T7F A;  4PLD A;  5K13 A;  2GPU A;  2PKL A;  4ZNU A;  4UDD A;  3VT3 A;  2R6W A;  3G9E A;  3ADX A;  4IW6 A;  2ZVT A;  3B65 A;  5DKE A;  3WJ4 A;  2Q6J A;  1QKT A;  1SJ0 A;  3KFC A;  2OZ7 A;  4MG7 B;  5G3J A;  2EWP A;  2Q7K A;  5AVI A;  5EI1 A;  1BSX A;  1XP9 A;  4OZT U;  4APU A;  2PIR A;  3PLZ A;  2NW4 A;  3KDT A;  5DIE A;  1G2N A;  4IWC A;  3VTB A;  2PJL A;  5EC9 A;  1ZH7 A;  3W0G A;  4OZT E;  5AAV B;  2E2R A;  4OHA A;  3PBA A;  5AYG A;  4RFW A;  3ADV A;  4OH5 A;  3DZU A;  5AZV A;  3E00 D;  2OAX A;  1XAP A;  3G0W A;  2AX8 A;  4TUZ A;  4TV1 A;  4PPP A;  4E2J A;  2ZAS A;  1IE9 A;  2GWX A;  3D5F A;  3R8D A;  3HQ5 A;  2ZMI A;  2HFP A;  3A3Z X;  3ADT A;  5KRL A;  4IA3 A;  2HCD A;  1U3S A;  3A2J A;  5DV3 A;  3B66 A;  5JY3 A;  4REF A;  5ACC A;  4OIV A;  4N5G A;  1PZL A;  3OZ0 A;  3ERT A;  1GWR A;  3AUN A;  5DZ1 A;  3AX8 A;  4G1D A;  3VN2 A;  5KRC A;  3R5N A;  2YJA B;  2VSR A;  3RVF A;  2I4Z A;  1LBD A;  3CDP A;  1RKH A;  3WJ5 A;  3VHU A;  1VJB A;  3BC5 A;  1NQ1 A;  4KZI A;  5AAU A;  2H77 A;  5KCC A;  1N4H A;  3A9E A;  3O1D A;  3TKM A;  4TUZ B;  4TV1 B;  3V9Y A;  5KD9 A;  4J24 A;  5HCV A;  1YY4 A;  3IA6 A;  1PQ6 A;  3O1E A;  4NB6 A;  3R2A A;  1ILH A;  3A40 X;  5JJM A;  3A2I A;  3LBD A;  2R40 D;  4IV2 A;  3KYT A;  3L0L A;  1UOM A;  4OKW A;  4XUH A;  1NAV A;  1UHL A;  2POG A;  3HC5 A;  1P93 A;  3HLV A;  2Q7J A;  1ZAF A;  5DSH A;  2GIU A;  3D24 A;  1MZN A;  2ABI A;  4FHI A;  4EM9 A;  1YOW A;  5DXG A;  4NY9 A;  3DT3 A;  4RMC A;  3V49 A;  1QKN A;  4J5X C;  4G1Z A;  5HJP A;  4NQA B;  4ZO1 X;  3B68 A;  5DTV A;  2POB A;  1XQC A;  4DK7 A;  2VST A;  4DM6 A;  1T76 A;  3AUR A;  3ILZ A;  1GWX A;  1S9Q A;  5KRM A;  3A9E B;  5APK A;  4QJR A;  5E7V A;  1R1K A;  1XV9 A;  3CWD A;  4YMQ A;  2YAT A;  2B1V A;  3DR1 A;  5DMF A;  5G44 A;  4ONI A;  2HBH A;  2P7G A;  5JJM B;  3NSP A;  3VT5 A;  2YLQ A;  1TFC A;  4G2H A;  2NXX A;  1UHL B;  4OEA A;  1M2Z A;  4RUO X; 
#chains in the Genus database with same CATH homology
 3AZ3 A;  5APH A;  3ZRA A;  4EMA A;  4ITF A;  4QK4 A;  1HJ1 A;  3CS8 A;  1S9P A;  3M7R A;  3ADW A;  4N1Y A;  1ZUC A;  1XVP A;  3GYU A;  3F5C A;  5HJP B;  5E0W A;  2NPA A;  4WHG A;  4ITE A;  1G5Y A;  3OMP A;  2QPY A;  5KRH A;  1YYE A;  3GYT A;  1XQ3 A;  1ZDU A;  4ZO1 B;  1XNN A;  1XV9 B;  2VV4 A;  3VJT A;  2PIP L;  3W0I A;  1R20 D;  2XYJ A;  2ZL9 A;  3RLJ A;  1DKF A;  1NAX A;  2VV3 A;  4FGY A;  4KZJ A;  3AZ2 A;  1FBY A;  5DWJ A;  3HC6 A;  2Q5S A;  2QTU A;  4N8R A;  2QA8 A;  1RDT A;  2P15 A;  2AXA A;  3KMG A;  4HLW A;  1R6G A;  4OFU A;  1L2J A;  1T74 A;  4K6I A;  2QXM A;  1X78 A;  4PXM A;  2HB8 A;  2R6Y A;  3LMP A;  5KRF A;  3VT9 A;  2O9I A;  2ZY0 A;  2P1V A;  4JGV A;  1YP0 A;  1M7W A;  2ZNP A;  3D6D A;  4X1F A;  5AZT A;  2IOK A;  3BQD A;  5KCW A;  1XVP B;  2P7A A;  3OS9 A;  3ET2 A;  4N73 A;  4QM0 A;  3F5C B;  2ZFX A;  4ZNW A;  4P6W A;  1G50 A;  2AMB A;  4LBD A;  2O4R A;  5DUG A;  5SYZ A;  4PRG A;  2QGT A;  3A78 A;  4A4W A;  1K4W A;  4WQP A;  4G21 A;  1G1U A;  1YJE A;  3VHW A;  5KYJ A;  2AX9 A;  2PRG A;  3FXV A;  2VV4 B;  4LTW A;  3UP3 A;  1X7B A;  2Q6S A;  1XLS A;  4OEY A;  4RMD A;  4XI3 A;  5AWJ A;  3X1I A;  2OUZ A;  1RKG A;  4XLD A;  2ZMJ A;  3HM1 A;  1DKF B;  4HEE X;  3SZ1 A;  2ZLC A;  1FM6 A;  1K74 A;  2HC4 A;  3SP9 A;  3P88 A;  2QW4 A;  3H52 A;  2QA8 B;  2QR9 A;  3AN3 A;  4S0S A;  5GIC A;  2Q60 A;  2Q1V A;  5DL4 A;  3JZC A;  3OZJ A;  4CI5 A;  2PIU A;  4OLM A;  2ZNN A;  1QKM A;  1S0X A;  1DB1 A;  2ATH A;  2PIW A;  3MNP A;  1LV2 A;  4OIL A;  3OOK A;  2QA6 A;  2ZXZ A;  1UPV A;  3K8S A;  4O8F A;  1A52 A;  2GPO A;  1WM0 X;  1FM9 A;  4IQR A;  5DWG A;  3RLL A;  4XT9 A;  4S15 A;  4DM8 A;  3B1M A;  3KBA A;  3B0R A;  5DXB A;  1ZEO A;  2AA5 A;  4PLE A;  5DV6 A;  1OVL A;  3WT7 A;  4S0T A;  3W0A A;  1XDK A;  4UDC A;  4PP3 A;  2J7Y A;  2QH6 A;  4J5X A;  5APJ A;  3OKI A;  4IW8 A;  4DMA A;  1NQ2 A;  2I4P A;  3ZQT A;  2G0H A;  2FAI A;  2ZK3 A;  3KMR A;  1SKX A;  3AUQ A;  1Y0X X;  4R06 A;  4IA1 A;  4S14 A;  2AX7 A;  1FCY A;  1XNX A;  2VV2 A;  3P89 A;  1EXX A;  4L98 A;  3OSI A;  5DK9 A;  3UU7 A;  3FEI A;  3OOF A;  4ZNT A;  5C4O A;  3V3Q A;  3L3X A;  5KCE A;  5KR9 A;  1P8D A;  4IWF A;  2G44 A;  3DZU D;  2AA7 A;  3B3K A;  4JAZ A;  4K7A A;  3UUA A;  4M8H A;  2JJ3 A;  1IE8 A;  3B0W A;  5IZ0 A;  3TY0 A;  1EXA A;  2XYW A;  4ZOM A;  2O4J A;  2IHQ A;  3AZ1 A;  4Q0A C;  4RZE A;  4P6X A;  2ZXN A;  4ZNV A;  2AM9 A;  2PIO A;  1XB7 A;  2HWR A;  1NDE A;  5E15 A;  3RUT A;  3IXP A;  2GP7 A;  5DID A;  5DXB B;  4RE8 A;  3FC6 B;  3V4A A;  5KCT A;  5DZI A;  2V0V A;  2AWH A;  3OS8 C;  1NQ7 A;  1OVL B;  5DYB A;  1XDK B;  1ZKY A;  4OK1 A;  5DXP A;  3SP6 A;  1OSH A;  5GIE A;  2NXX E;  1PDU A;  2QMV A;  3ADS A;  1L2I A;  3H0A A;  4R6S A;  3UP0 A;  3ZRB A;  3VJI A;  1YIN A;  2QSE A;  4OGH A;  5FQV A;  4E4Q A;  5KRJ A;  3CDS A;  5DV8 A;  4DOS A;  1NQ0 A;  3X31 A;  3QT0 A;  4ZN7 A;  1M13 A;  1K7L A;  2HWQ A;  3OAP A;  3UU7 B;  2QXS A;  2ZK2 A;  2B1Z A;  3VT8 A;  2QE4 A;  3FLI A;  3KPZ A;  3TX7 B;  2I0G A;  3HOD A;  3PRG A;  3PCU A;  5DWL A;  2ZKC A;  3CLD A;  3VRW A;  2OCF A;  1A28 A;  2OM9 A;  3UUA B;  4OC7 A;  2IOG A;  4QE6 A;  3AN4 A;  4OKT A;  4ZNH A;  3IPQ A;  2AB2 A;  3VSO A;  5DRM A;  5AK2 A;  1E3G A;  1RJK A;  4IU7 A;  3L1B A;  1I7G A;  3DY6 A;  5B5B A;  5KCF A;  1XOW A;  1FCX A;  2I0J A;  1YOK A;  3H0A D;  1T7M A;  5DXE A;  2G5O A;  3GBK A;  1Y9R A;  3WFG A;  1E3K A;  4YPQ A;  4XAO A;  3W0Y A;  3W0J A;  4Q50 A;  4J5W C;  4CSJ A;  5DMC A;  3L0J A;  2H79 A;  3MNE A;  1OSV A;  1FCZ A;  4JYG A;  5M96 A;  4FHH A;  4OJB A;  3B5R A;  3NSQ A;  4R2U A;  1KKQ A;  4MG6 A;  1X76 A;  3OMM A;  1R1K D;  2HB7 A;  3RUU A;  1ZDT A;  4PPS A;  3FUG A;  3K22 A;  3VJS A;  2AA6 A;  1H9U A;  4OAR A;  3UVV A;  2P54 A;  5DIG A;  3D90 A;  1XPC A;  4IUI A;  4IVW A;  3HZF A;  1S0Z A;  4WPF A;  5FQP A;  4B7W A;  5C4T A;  2YLY A;  3AFR A;  2G0G A;  2GL8 A;  2ZK4 A;  3OMO A;  4REE A;  3P0U A;  3L3Z A;  4RWV A;  1MVC A;  5DUE A;  1SR7 A;  3Q95 A;  4MGA A;  5DVS A;  2LBD A;  5DYD A;  3ET1 A;  2ZK1 A;  1XP1 A;  5KRO A;  2V7C A;  5L7G A;  1OT7 A;  5IXK A;  1ERE A;  2GPP A;  3X36 A;  1NUO A;  2ZLA A;  3CQV A;  5L11 A;  3GWS X;  5G5W A;  1R5K A;  2F4B A;  1Y0S A;  2YJD A;  3ET3 A;  3WT5 A;  4DOR A;  5HZC A;  5I4V A;  4DK8 A;  5C4S A;  5KRI A;  3DCU A;  4L96 A;  4Q13 A;  3UVV B;  3WTQ A;  1FD0 A;  5DX3 A;  3WGP A;  3GWX A;  1PQC A;  5KCD A;  4IA2 A;  1N83 A;  2ZNQ A;  1Z5X U;  4FNE A;  4OED A;  4K4J A;  3UUC A;  4LNX A;  1T79 A;  1RDT D;  2J7X A;  2OVH A;  5DXK A;  3KMZ A;  1Z5X E;  3VTD A;  5EHJ A;  2Q5P A;  2Q7L A;  5DWI A;  1QKU A;  3G8I A;  4G2I A;  2YFE A;  3VT4 A;  3Q95 B;  4MGA B;  3R8A A;  3FAL A;  4G20 A;  3R8I A;  3OSA A;  3X1H A;  3ET0 A;  4OEZ A;  3HVL A;  3OLL A;  5E19 A;  2QZO B;  5G46 A;  5ICK A;  1T7T A;  2FSZ A;  3OKH A;  3OS8 A;  3R29 A;  3V3E A;  1UPW A;  3F7D A;  4KZM A;  1T65 A;  3ADU A;  3E00 A;  3ERD A;  3PEQ A;  4IS8 A;  4XHD A;  3VJH A;  2VV1 A;  1U9E A;  5G43 A;  2HVC A;  5DRJ A;  5E1C A;  2Q59 A;  1U3R A;  2HAS A;  5IAW A;  2QGW A;  4J26 A;  2HAM A;  3FC6 A;  5DX3 B;  4PP6 A;  4OH6 A;  3NOA A;  2JFA A;  2P4Y A;  3DCT A;  5DKG A;  3GD2 A;  5KRK A;  1FM6 D;  2PIT A;  1K74 D;  2Q3Y A;  1X7J A;  2XKW A;  4WVD A;  4PF3 A;  5EIT A;  1PK5 A;  2ZK6 A;  3GZ9 A;  5ETH A;  4JL4 A;  5DZ3 A;  4QE8 A;  4POH A;  4Y29 A;  3OLS A;  4MGD A;  1N46 A;  3FAL B;  3VRU A;  4MDD A;  3VT7 A;  5HYR A;  4UDB A;  4OFR A;  4MG8 A;  1FM9 D;  4IA7 A;  1NYX A;  2A3I A;  3G8O A;  5E0X A;  4MGC A;  1HG4 A;  1XZX X;  2OVM A;  2QNV A;  5DVV A;  2ZXM A;  4XUM A;  2AX6 A;  4BCR A;  2VV1 B;  2PIN A;  3MNO A;  5DLR A;  1RK3 A;  2Q59 B;  4J5W A;  4PVU A;  2ACL A;  4ZN9 A;  5DP0 A;  5EJV A;  5KCU A;  4IV4 A;  4OJ9 A;  3OMQ A;  5FQR A;  2PIX A;  3CTB A;  3OMK A;  3P8X A;  5HYK A;  2JFA B;  5E14 A;  2AA2 A;  2R40 A;  2VV0 A;  3IMY A;  4UDA A;  5FQT A;  1PCG A;  1ZGY A;  2P1T A;  2Z4J A;  5GID A;  3TKC A;  2XHS A;  1KNU A;  4OKX A;  4RUP A;  2REW A;  4LNW A;  2ZBS A;  3CS4 A;  5A86 A;  3WWR A;  4RZF A;  4A2J A;  4ZJW A;  3OSW A;  3PO9 A;  4MGD B;  3CS6 A;  2B23 A;  2AYR A;  3E7C A;  5DXQ A;  3VTC A;  3S9S A;  5C4U A;  4MG8 B;  3FUR A;  2GTK A;  1I7I A;  1I37 A;  4OZR U;  4PP5 A;  4DQM A;  4CI4 A;  4NIE A;  3IPS A;  2Q8S A;  4ZNS A;  3RY9 A;  4M8E A;  3IXP D;  1NHZ A;  5KRA A;  3ZR7 A;  3W5P A;  5AVL A;  2Q5G A;  4OZR E;  2ACL B;  4YT1 A;  2YLO A;  4OKB A;  2PIQ A;  2Q1H A;  3WT6 A;  3JZB A;  2PIV A;  2ZNO A;  3B0T A;  4X1G A;  1MV9 A;  2YHD A;  5F9B A;  3T03 A;  4YNK A;  2QAB A;  3B0Q A;  4ZJR A;  4OIU A;  4JYI A;  5EGV A;  4POJ A;  2I4J A;  5L7E A;  3D57 A;  4QL8 A;  3W5T A;  3DZY A;  3HO0 A;  4XTA A;  1X7E A;  2FVJ A;  2XYX A;  3K6P A;  4MG5 A;  1I38 A;  1NRL A;  5KYA A;  2AMA A;  1U3Q A;  3E94 A;  2ZK0 A;  3N00 A;  2Q6R A;  2BAW A;  1T7R A;  1SQN A;  5DVC A;  1GWQ A;  2HAR A;  3FS1 A;  4E4K A;  4MGB A;  5G45 A;  4MG9 A;  2J4A A;  2Q70 A;  3W0H A;  1XJ7 A;  5JI0 D;  3VT6 A;  1T73 A;  1XP6 A;  1YUC A;  1R20 A;  3L03 A;  1T63 A;  1XIU A;  1XLS E;  3UUD A;  3W5R A;  4OJ4 A;  5L7H A;  5DKB A;  2GPV A;  1PRG A;  1ILG A;  4RUJ A;  3W5Q A;  3KDU A;  2P7Z A;  3OGT A;  4RZG A;  3DZY D;  3L0E A;  4WHF A;  5B41 A;  5DY8 A;  3VI8 A;  4ZI1 A;  4JYH A;  3VHV A;  3V9V A;  2Q7I A;  3K23 A;  5DZH A;  2QZO A;  1YIM A;  1TXI A;  3CJW A;  4WLB A;  2W8Y A;  3FEJ A;  1S19 A;  2ZK5 A;  3BEJ A;  1YA3 A;  2NV7 A;  2YLP A;  3IPU A;  5DKS A;  5LWP A;  2B50 A;  2BJ4 A;  5DXM A;  4MGB B;  3B67 A;  3GN8 A;  5FQS A;  2Z4B A;  4LSJ A;  4MG9 B;  3A2H A;  5G42 A;  3VSP A;  5DWE A;  2J14 A;  1GS4 A;  2AAX A;  2P1U A;  4RAK A;  3UUD B;  3W0C A;  3WFF A;  1Z95 A;  4G1Y A;  4MG7 A;  5GT4 A;  1YMT A;  2JF9 A;  3KWY A;  1ERR A;  3VRV A;  5DZ0 A;  2ZMH A;  5DI7 A;  4NUF A;  1Q4X A;  4IVY A;  4FN9 A;  3U9Q A;  3VRT A;  5HJS A;  3EYB A;  2PNU A;  5AAV A;  3WMH A;  5H1E A;  1T5Z A;  3OLF A;  1KV6 A;  3V9T A;  4PWL A;  1X7R A;  5DU5 A;  5CJ6 A;  1PQ9 A;  2AO6 A;  2Q61 A;  4A4V A;  5AWK A;  4F9M A;  5DXR A;  3R5M A;  5DUH A;  4RME A;  5LGA A;  2BJ4 B;  1T7F A;  4PLD A;  5K13 A;  2GPU A;  2PKL A;  4ZNU A;  4UDD A;  3VT3 A;  2R6W A;  3G9E A;  3ADX A;  4IW6 A;  2ZVT A;  3B65 A;  5DKE A;  3WJ4 A;  2Q6J A;  1QKT A;  1SJ0 A;  3KFC A;  2OZ7 A;  4MG7 B;  5G3J A;  2EWP A;  2Q7K A;  5AVI A;  5EI1 A;  1BSX A;  1XP9 A;  4OZT U;  4APU A;  2PIR A;  3PLZ A;  2NW4 A;  3KDT A;  5DIE A;  1G2N A;  4IWC A;  3VTB A;  2PJL A;  5EC9 A;  1ZH7 A;  3W0G A;  4OZT E;  5AAV B;  2E2R A;  4OHA A;  3PBA A;  5AYG A;  4RFW A;  3ADV A;  4OH5 A;  3DZU A;  5AZV A;  3E00 D;  2OAX A;  1XAP A;  3G0W A;  2AX8 A;  4TUZ A;  4TV1 A;  4PPP A;  4E2J A;  2ZAS A;  1IE9 A;  2GWX A;  3D5F A;  3R8D A;  3HQ5 A;  2ZMI A;  2HFP A;  3A3Z X;  3ADT A;  5KRL A;  4IA3 A;  2HCD A;  1U3S A;  3A2J A;  5DV3 A;  3B66 A;  5JY3 A;  4REF A;  5ACC A;  4OIV A;  4N5G A;  1PZL A;  3OZ0 A;  3ERT A;  1GWR A;  3AUN A;  5DZ1 A;  3AX8 A;  4G1D A;  3VN2 A;  5KRC A;  3R5N A;  2YJA B;  2VSR A;  3RVF A;  2I4Z A;  1LBD A;  3CDP A;  1RKH A;  3WJ5 A;  3VHU A;  1VJB A;  3BC5 A;  1NQ1 A;  4KZI A;  5AAU A;  2H77 A;  5KCC A;  1N4H A;  3A9E A;  3O1D A;  3TKM A;  4TUZ B;  4TV1 B;  3V9Y A;  5KD9 A;  4J24 A;  5HCV A;  1YY4 A;  3IA6 A;  1PQ6 A;  3O1E A;  4NB6 A;  3R2A A;  1ILH A;  3A40 X;  5JJM A;  3A2I A;  3LBD A;  2R40 D;  4IV2 A;  3KYT A;  3L0L A;  1UOM A;  4OKW A;  4XUH A;  1NAV A;  1UHL A;  2POG A;  3HC5 A;  1P93 A;  3HLV A;  2Q7J A;  1ZAF A;  5DSH A;  2GIU A;  3D24 A;  1MZN A;  2ABI A;  4FHI A;  4EM9 A;  1YOW A;  5DXG A;  4NY9 A;  3DT3 A;  4RMC A;  3V49 A;  1QKN A;  4J5X C;  4G1Z A;  5HJP A;  4NQA B;  4ZO1 X;  3B68 A;  5DTV A;  2POB A;  1XQC A;  4DK7 A;  2VST A;  4DM6 A;  1T76 A;  3AUR A;  3ILZ A;  1GWX A;  1S9Q A;  5KRM A;  3A9E B;  5APK A;  4QJR A;  5E7V A;  1R1K A;  1XV9 A;  3CWD A;  4YMQ A;  2YAT A;  2B1V A;  3DR1 A;  5DMF A;  5G44 A;  4ONI A;  2HBH A;  2P7G A;  5JJM B;  3NSP A;  3VT5 A;  2YLQ A;  1TFC A;  4G2H A;  2NXX A;  1UHL B;  4OEA A;  1M2Z A;  4RUO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...