5KRMA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with the a-cd ring estrogen, (1s,7as)-5-(2,5-difluoro-4-hydroxyphenyl)-7a-methyl-2,3,3a,4,7,7a-hexahydro-1h-inden-1-ol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
245
structure length
237
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 237
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krmA00
3AURA 3W0HA 5FQRA 5JJMB 1XNXA 1PRGA 2Q60A 1QKTA 3ADVA 3L1BA 4WHFA 5JJMA 1E3GA 3FC6A 3OS8A 5DYBA 3R8DA 4RZGA 2G0GA 2ZASA 2ZLCA 2ZXMA 4OJBA 2VV1A 1XP6A 2GPPA 2QR9A 2HC4A 1NQ1A 5KYJA 3VI8A 1X7RA 3QT0A 4REEA 1OSVA 5IAWA 3DZUD 1PQCA 2AM9A 1LBDA 2ZLAA 1H9UA 1XNNA 4ZO1X 5DXGA 4WPFA 3BQDA 4OKTA 2LBDA 5DUGA 4YNKA 4MGDB 3V9TA 3VTCA 3VHVA 5G5WA 1YOKA 1T5ZA 1MVCA 2VV4B 3D24A 4MGDA 4XUMA 4E2JA 3B66A 5DZHA 1U3QA 5AWJA 4OZTE 1FBYA 4P6XA 3SP9A 4J26A 4OKXA 3PLZA 1PZLA 3OSAA 5EGVA 5G45A 1K4WA 3DZYA 2HWQA 3ADTA 2H79A 3RY9A 4APUA 3X36A 4OEYA 2O9IA 4N8RA 3Q95A 4LTWA 1ZH7A 2P1TA 3GZ9A 4M8EA 3B5RA 5DUEA 2NPAA 3AN3A 1YIMA 1T7FA 1OT7A 2AX7A 2Q59B 2YLOA 1FCZA 4UDDA 5G42A 5KRMA 2R6WA 2Q59A 4XLDA 2V0VA 4JYHA 1QKMA 1XP1A 1RK3A 3KYTA 5AAVA 5L7GA 3MNEA 3AZ3A 2Q7JA 2OCFA 2Q7IA 5DVCA 5DVSA 1EREA 3AX8A 3ERTA 3H0AD 4BCRA 5ACCA 1OVLB 3DY6A 4S0SA 1R1KA 2PIRA 1OVLA 3VSOA 4RFWA 1GS4A 2Q1VA 4LBDA 5G43A 3VRWA 1XPCA 2O4RA 3DCUA 1Y9RA 3KFCA 3ERDA 4LSJA 4PP3A 3K8SA 3W5PA 3S9SA 3R2AA 1A52A 5LWPA 3P88A 4PVUA 4PF3A 5C4UA 3A2HA 3CS4A 1U3SA 1MZNA 4DM6A 1S0XA 2Q8SA 4FN9A 2QZOB 1ILGA 1G5YA 1TXIA 2QZOA 1XVPB 2B23A 4JL4A 4ZNWA 3ZRBA 3UP0A 4FNEA 3JZBA 1L2IA 1YY4A 2PINA 2B1ZA 2PNUA 2QH6A 2ZMHA 3E7CA 4M8HA 4PP5A 5DV6A 4NIEA 1N4HA 4OH5A 1GWXA 2YHDA 3FALB 3IMYA 4RUJA 2PIVA 4JAZA 4NUFA 5HJPB 4PRGA 4J5XC 3BEJA 3DR1A 1PCGA 5IZ0A 3VJSA 5HJPA 3B1MA 2ZK6A 3OMMA 4RMCA 5DL4A 3H0AA 1T7TA 1M13A 4ZNUA 4IW6A 5AVIA 2P7GA 4CI4A 3OKHA 4ZN7A 5B41A 4PLDA 1K74D 4IA7A 4EM9A 1FM9D 1T76A 1XQCA 5DIGA 3VT8A 2P15A 1EXXA 3X31A 1X76A 3VJIA 4E4KA 4IS8A 1BSXA 2AB2A 3NOAA 5DRMA 2HARA 2HAMA 3R29A 3WT6A 3OZ0A 1T7MA 3SZ1A 3VT9A 4OH6A 2QA8B 1RDTA 3TX7B 2I0GA 3ADSA 5DY8A 3B65A 2ZL9A 3G0WA 5DXQA 4ZNHA 2PIWA 1SR7A 1XAPA 3AN4A 1PQ6A 3VT6A 5KCTA 5EHJA 5EJVA 4L96A 4RUPA 2Q7LA 3KDTA 3RLJA 5C4TA 5FQVA 3O1DA 3VRTA 3VHWA 5DXBA 1R20D 4ITEA 3ET3A 3TKMA 2REWA 4G2HA 2P1UA 4ZNTA 1FD0A 3FXVA 3HQ5A 1VJBA 2GPOA 2ATHA 1GWRA 1I7IA 2PITA 3A78A 4RAKA 4ZO1B 4FHHA 5L11A 3OMPA 4MGCA 2XYWA 5LGAA 1FCYA 5HJSA 5CJ6A 3R8IA 3W5TA 5GIEA 2QSEA 4S15A 1NDEA 4OKBA 3TY0A 1FM9A 2I0JA 3L0LA 2Z4BA 5DWIA 5GIDA 4CI5A 3MNOA 1PK5A 5L7EA 3AUNA 3DZYD 5EC9A 4F9MA 4IVWA 3EYBA 3B0WA 4IA3A 3VN2A 5KRHA 4J5WC 4OK1A 4RWVA 2HFPA 5DXKA 5DX3B 3WWRA 2XHSA 5APHA 4S14A 4PP6A 2YATA 5DV8A 4LNWA 1YUCA 3CDSA 5AYGA 2HWRA 3OMOA 4N73A 4Q50A 3IPUA 2AO6A 5DIEA 2QXMA 2OVMA 3R8AA 4B7WA 3SP6A 4ZJRA 2ZFXA 4QL8A 1R20A 1XJ7A 3OMKA 1T7RA 4X1GA 1M7WA 1R1KD 2FAIA 2Q3YA 3WT5A 5KCEA 2QABA 2VV3A 4OZTU 3M7RA 1E3KA 3D57A 4TUZB 1YINA 4KZJA 1Z95A 3H52A 4TUZA 3UP3A 3HODA 3T03A 3KMRA 1G2NA 1IE8A 1R6GA 4ZJWA 1QKNA 1UPWA 5DZ1A 1GWQA 2VV4A 4XUHA 4P6WA 5DXEA 4IV2A 4OZRE 3G8IA 3OOKA 4A4WA 2ZK1A 2F4BA 2ZK2A 3TKCA 4QK4A 4IA1A 3NSPA 1DKFB 3WTQA 5ICKA 3HLVA 1DKFA 4G2IA 4OIVA 2GPUA 1NRLA 3WT7A 5DWGA 2YLYA 4G21A 1LV2A 3A40X 2ZKCA 4RMDA 4TV1B 3KMZA 4IU7A 4IVYA 4L98A 3UVVB 4DM8A 1N83A 2R40D 1T73A 2GTKA 5KRIA 3V3QA 3KPZA 3CJWA 3LMPA 4OIUA 5EI1A 3OGTA 2QMVA 5DLRA 2AA2A 3B0QA 4J5XA 5H1EA 3GYTA 3OS9A 4FHIA 4OILA 3VTDA 1K7LA 4NB6A 5F9BA 5SYZA 3OMQA 3ILZA 4XTAA 2AMAA 2VSTA 3N00A 1ZGYA 1NAXA 1XDKB 2HVCA 2QW4A 1XDKA 2YLQA 1S9PA 1XOWA 3OZJA 2Q5PA 2YFEA 4K6IA 5DYDA 5EITA 2J4AA 1KNUA 3DCTA 1RKGA 2JFAB 2POGA 4IV4A 1G50A 4X1FA 4DOSA 5KCCA 2AYRA 5JY3A 3RUTA 4G1YA 2ZNQA 1ZDUA 5ETHA 5E15A 1RDTD 1YOWA 2V7CA 3FEJA 5DKGA 3W0GA 1EXAA 4QM0A 2NV7A 1NAVA 1XVPA 1UOMA 1ERRA 2P7AA 3L3ZA 3HZFA 1T79A 2AAXA 4JGVA 4MG7B 3E94A 2R40A 4MG7A 5JI0D 1T74A 2YLPA 2H77A 3D90A 4OLMA 2J7YA 4MG9B 5DMCA 2PIOA 2B1VA 3FALA 2ABIA 3HC6A 4MG9A 2Q5SA 2EWPA 4KZIA 5G44A 3LBDA 5DKEA 5DTVA 2E2RA 5G3JA 2ZMJA 3FLIA 4PPPA 1U3RA 3NSQA 4Q0AC 3RUUA 2GPVA 4OC7A 5DZ3A 1UHLB 4G1DA 2YJAB 3WJ4A 1UHLA 4PPSA 2ACLB 2POBA 3OOFA 1L2JA 2ACLA 3K23A 4OFRA 2Q61A 3CS6A 5DXMA 3WFGA 4IQRA 5DI7A 3IXPD 3RVFA 3WFFA 1PQ9A 4J5WA 2Q70A 4Q13A 4RE8A 5E14A 3ZR7A 2PIXA 2I4ZA 1X7BA 1ILHA 3B68A 3K22A 3OLFA 4MDDA 3X1HA 3AFRA 3PO9A 4DQMA 4NQAB 2AXAA 2QA8A 2AWHA 5DXRA 3HM1A 3FUGA 2ZNOA 4WHGA 4WQPA 1XP9A 3VT7A 1ZUCA 4OEDA 1FM6A 2IOKA 4WVDA 1ZEOA 3GWSX 3W5RA 4DK7A 5FQSA 5B5BA 5DMFA 5AZTA 3FURA 5AAUA 1YA3A 3WMHA 1XLSE 4HEEX 2NW4A 3VSPA 5DZIA 4IA2A 5GT4A 1KV6A 2G44A 1XLSA 2JF9A 5E0XA 3V3EA 4XT9A 3VRUA 5DVVA 2JJ3A 4POHA 3CDPA 2A3IA 4ITFA 3V9YA 2HCDA 4LNXA 5APKA 5KRCA 3A3ZX 4PWLA 2QGTA 4XAOA 2QNVA 1I38A 2YJDA 3IPQA 4QE8A 4QE6A 5C4SA 3AZ1A 3W5QA 5K13A 3L0JA 2W8YA 3OSIA 1XV9B 3VJTA 2NXXA 3IXPA 3W0JA 2AA5A 5DX3A 3W0IA 5E0WA 3P8XA 5KD9A 1T65A 5AVLA 3ET2A 3VHUA 1IE9A 3HO0A 3A2IA 3W0YA 3UUDB 1NHZA 4KZMA 3F7DA 4G20A 3CS8A 5E1CA 3UUDA 2PIUA 4YMQA 3FEIA 3A9EB 2I4JA 2OZ7A 3B3KA 4N5GA 2ZMIA 2QXSA 1I37A 3CWDA 2IOGA 3KBAA 3P0UA 4K4JA 3B67A 4OZRU 1XIUA 3AZ2A 3GWXA 4MG6A 4R2UA 5DU5A 5E19A 1Y0SA 3F5CB 4A4VA 3UU7B 2PRGA 2OUZA 1I7GA 3UU7A 1FCXA 3ADWA 3W0CA 4CSJA 2QGWA 3AUQA 3FC6B 4IWFA 1YP0A 3JZCA 4ZOMA 1P8DA 4S0TA 4DK8A 5KROA 3DT3A 5FQTA 4OKWA 2VV1B 2FSZA 2G0HA 3ZQTA 4R06A 5DSHA 1SKXA 5DXPA 5KR9A 3UUCA 4TV1A 1SQNA 3W0AA 2XKWA 3UVVA 3L03A 1P93A 4ZI1A 1TFCA 1RJKA 2P54A 4REFA 4A2JA 5KRLA 1UPVA 3PBAA 2OM9A 2PKLA 2VV2A 4DMAA 1YJEA 1NQ2A 3ZRAA 2Q7KA 5HYRA 3ET0A 3ET1A 2QTUA 1NUOA 3VRVA 5GICA 5IXKA 5DKBA 2ZY0A 2BJ4B 2GL8A 2PJLA 4N1YA 3GD2A 4DORA 2ZNNA 2BJ4A 2Z4JA 2O4JA 2P4YA 4MGAB 4Y29A 2HB7A 3Q95B 3RLLA 4MG8B 4OJ4A 3O1EA 4MGAA 5KCWA 3VT5A 5KYAA 4MGBB 4MG8A 3IPSA 2Q5GA 5APJA 4ZNVA 1SJ0A 4ZNSA 4MGBA 3GN8A 5E7VA 3G8OA 3WGPA 5HZCA 2ZK4A 2JFAA 1MV9A 3CLDA 3IA6A 4JYGA 1PDUA 3OS8C 3P89A 3V9VA 1S19A 5AAVB 3OLLA 5DV3A 4POJA 2ZXNA 2Q6RA 2IHQA 4HLWA 4XI3A 3A2JA 4RZEA 5AK2A 3V4AA 4OFUA 2VV0A 5FQPA 3K6PA 3D5FA 1FM6D 3DZUA 2AX8A 3VTBA 4FGYA 4UDBA 2ZVTA 1S9QA 2AA7A 2P1VA 4RUOX 4UDAA 1HJ1A 2QPYA 5DWEA 2J14A 1NQ7A 1YMTA 4OHAA 3OLSA 5A86A 4OJ9A 3B0TA 5DIDA 5G46A 2OAXA 2GP7A 5KRJA 1Z5XU 5KCFA 1Y0XX 4YT1A 3L3XA 2OVHA 1M2ZA 2AX9A 5M96A 2AMBA 3V49A 3PEQA 1Z5XE 3KDUA 4RZFA 4PXMA 2BAWA 4NY9A 5KRAA 1U9EA 3R5MA 2HBHA 3ADUA 5DRJA 2J7XA 3OKIA 4ONIA 3GYUA 1ZKYA 5AWKA 4YPQA 3WJ5A 2ZK0A 4K7AA 2AX6A 1XQ3A 1G1UA 2QE4A 2R6YA 5KRKA 1X78A 2FVJA 4J24A 2AA6A 5DWJA 2HASA 5DKSA 4OARA 4G1ZA 2PIQA 5AZVA 5DWLA 1N46A 4EMAA 1QKUA 4RMEA 3CQVA 3PRGA 1ZDTA 3B0RA 3VT3A 2PIPL 3GBKA 4WLBA 2Q1HA 3PCUA 3E00D 5KCUA 2GWXA 3UUAB 5L7HA 3D6DA 4OEZA 3CTBA 5DP0A 3G9EA 3UUAA 3VJHA 5KRFA 4ZN9A 1YYEA 3HC5A 4MG5A 2G5OA 2NXXE 1KKQA 2ZK5A 2VSRA 3HVLA 3OAPA 3FS1A 3KMGA 1OSHA 2P7ZA 1XV9A 4PLEA 5DXBB 5HCVA 1Q4XA 4IUIA 3OSWA 2ZXZA 2ZK3A 1ZAFA 2B50A 2Q6SA 1HG4A 3U9QA 5HYKA 1NQ0A 5KCDA 5C4OA 5I4VA 1XB7A 1WM0X 1DB1A 1X7EA 2XYJA 3X1IA 2HB8A 3L0EA 2QA6A 5DK9A 4QJRA 2ZBSA 2GIUA 1S0ZA 1T63A 1A28A 4E4QA 4UDCA 3MNPA 3ADXA 1RKHA 1K74A 3A9EA 4O8FA 4R6SA 1X7JA 2Q6JA 3R5NA 4XHDA 1XZXX 3E00A 5DUHA 2I4PA 1NYXA 1R5KA 3BC5A 4IW8A 4OGHA 4OEAA 5DZ0A 2XYXA 4JYIA 2ZNPA 3VT4A 3KWYA 4IWCA 3F5CA
chains in the Genus database with same CATH superfamily
3AURA 3W0HA 5FQRA 5JJMB 1XNXA 1PRGA 2Q60A 1QKTA 3ADVA 3L1BA 4WHFA 5JJMA 1E3GA 3FC6A 3OS8A 5DYBA 3R8DA 4RZGA 2G0GA 2ZASA 2ZLCA 2ZXMA 4OJBA 2VV1A 1XP6A 2GPPA 2QR9A 2HC4A 1NQ1A 5KYJA 3VI8A 1X7RA 3QT0A 4REEA 1OSVA 5IAWA 3DZUD 1PQCA 2AM9A 1LBDA 2ZLAA 1H9UA 1XNNA 4ZO1X 5DXGA 4WPFA 3BQDA 4OKTA 2LBDA 5DUGA 4YNKA 4MGDB 3V9TA 3VTCA 3VHVA 5G5WA 1YOKA 1T5ZA 1MVCA 2VV4B 3D24A 4MGDA 4XUMA 4E2JA 3B66A 5DZHA 1U3QA 5AWJA 4OZTE 1FBYA 4P6XA 3SP9A 4J26A 4OKXA 3PLZA 1PZLA 3OSAA 5EGVA 5G45A 1K4WA 3DZYA 2HWQA 3ADTA 2H79A 3RY9A 4APUA 3X36A 4OEYA 2O9IA 4N8RA 3Q95A 4LTWA 1ZH7A 2P1TA 3GZ9A 4M8EA 3B5RA 5DUEA 2NPAA 3AN3A 1YIMA 1T7FA 1OT7A 2AX7A 2Q59B 2YLOA 1FCZA 4UDDA 5G42A 5KRMA 2R6WA 2Q59A 4XLDA 2V0VA 4JYHA 1QKMA 1XP1A 1RK3A 3KYTA 5AAVA 5L7GA 3MNEA 3AZ3A 2Q7JA 2OCFA 2Q7IA 5DVCA 5DVSA 1EREA 3AX8A 3ERTA 3H0AD 4BCRA 5ACCA 1OVLB 3DY6A 4S0SA 1R1KA 2PIRA 1OVLA 3VSOA 4RFWA 1GS4A 2Q1VA 4LBDA 5G43A 3VRWA 1XPCA 2O4RA 3DCUA 1Y9RA 3KFCA 3ERDA 4LSJA 4PP3A 3K8SA 3W5PA 3S9SA 3R2AA 1A52A 5LWPA 3P88A 4PVUA 4PF3A 5C4UA 3A2HA 3CS4A 1U3SA 1MZNA 4DM6A 1S0XA 2Q8SA 4FN9A 2QZOB 1ILGA 1G5YA 1TXIA 2QZOA 1XVPB 2B23A 4JL4A 4ZNWA 3ZRBA 3UP0A 4FNEA 3JZBA 1L2IA 1YY4A 2PINA 2B1ZA 2PNUA 2QH6A 2ZMHA 3E7CA 4M8HA 4PP5A 5DV6A 4NIEA 1N4HA 4OH5A 1GWXA 2YHDA 3FALB 3IMYA 4RUJA 2PIVA 4JAZA 4NUFA 5HJPB 4PRGA 4J5XC 3BEJA 3DR1A 1PCGA 5IZ0A 3VJSA 5HJPA 3B1MA 2ZK6A 3OMMA 4RMCA 5DL4A 3H0AA 1T7TA 1M13A 4ZNUA 4IW6A 5AVIA 2P7GA 4CI4A 3OKHA 4ZN7A 5B41A 4PLDA 1K74D 4IA7A 4EM9A 1FM9D 1T76A 1XQCA 5DIGA 3VT8A 2P15A 1EXXA 3X31A 1X76A 3VJIA 4E4KA 4IS8A 1BSXA 2AB2A 3NOAA 5DRMA 2HARA 2HAMA 3R29A 3WT6A 3OZ0A 1T7MA 3SZ1A 3VT9A 4OH6A 2QA8B 1RDTA 3TX7B 2I0GA 3ADSA 5DY8A 3B65A 2ZL9A 3G0WA 5DXQA 4ZNHA 2PIWA 1SR7A 1XAPA 3AN4A 1PQ6A 3VT6A 5KCTA 5EHJA 5EJVA 4L96A 4RUPA 2Q7LA 3KDTA 3RLJA 5C4TA 5FQVA 3O1DA 3VRTA 3VHWA 5DXBA 1R20D 4ITEA 3ET3A 3TKMA 2REWA 4G2HA 2P1UA 4ZNTA 1FD0A 3FXVA 3HQ5A 1VJBA 2GPOA 2ATHA 1GWRA 1I7IA 2PITA 3A78A 4RAKA 4ZO1B 4FHHA 5L11A 3OMPA 4MGCA 2XYWA 5LGAA 1FCYA 5HJSA 5CJ6A 3R8IA 3W5TA 5GIEA 2QSEA 4S15A 1NDEA 4OKBA 3TY0A 1FM9A 2I0JA 3L0LA 2Z4BA 5DWIA 5GIDA 4CI5A 3MNOA 1PK5A 5L7EA 3AUNA 3DZYD 5EC9A 4F9MA 4IVWA 3EYBA 3B0WA 4IA3A 3VN2A 5KRHA 4J5WC 4OK1A 4RWVA 2HFPA 5DXKA 5DX3B 3WWRA 2XHSA 5APHA 4S14A 4PP6A 2YATA 5DV8A 4LNWA 1YUCA 3CDSA 5AYGA 2HWRA 3OMOA 4N73A 4Q50A 3IPUA 2AO6A 5DIEA 2QXMA 2OVMA 3R8AA 4B7WA 3SP6A 4ZJRA 2ZFXA 4QL8A 1R20A 1XJ7A 3OMKA 1T7RA 4X1GA 1M7WA 1R1KD 2FAIA 2Q3YA 3WT5A 5KCEA 2QABA 2VV3A 4OZTU 3M7RA 1E3KA 3D57A 4TUZB 1YINA 4KZJA 1Z95A 3H52A 4TUZA 3UP3A 3HODA 3T03A 3KMRA 1G2NA 1IE8A 1R6GA 4ZJWA 1QKNA 1UPWA 5DZ1A 1GWQA 2VV4A 4XUHA 4P6WA 5DXEA 4IV2A 4OZRE 3G8IA 3OOKA 4A4WA 2ZK1A 2F4BA 2ZK2A 3TKCA 4QK4A 4IA1A 3NSPA 1DKFB 3WTQA 5ICKA 3HLVA 1DKFA 4G2IA 4OIVA 2GPUA 1NRLA 3WT7A 5DWGA 2YLYA 4G21A 1LV2A 3A40X 2ZKCA 4RMDA 4TV1B 3KMZA 4IU7A 4IVYA 4L98A 3UVVB 4DM8A 1N83A 2R40D 1T73A 2GTKA 5KRIA 3V3QA 3KPZA 3CJWA 3LMPA 4OIUA 5EI1A 3OGTA 2QMVA 5DLRA 2AA2A 3B0QA 4J5XA 5H1EA 3GYTA 3OS9A 4FHIA 4OILA 3VTDA 1K7LA 4NB6A 5F9BA 5SYZA 3OMQA 3ILZA 4XTAA 2AMAA 2VSTA 3N00A 1ZGYA 1NAXA 1XDKB 2HVCA 2QW4A 1XDKA 2YLQA 1S9PA 1XOWA 3OZJA 2Q5PA 2YFEA 4K6IA 5DYDA 5EITA 2J4AA 1KNUA 3DCTA 1RKGA 2JFAB 2POGA 4IV4A 1G50A 4X1FA 4DOSA 5KCCA 2AYRA 5JY3A 3RUTA 4G1YA 2ZNQA 1ZDUA 5ETHA 5E15A 1RDTD 1YOWA 2V7CA 3FEJA 5DKGA 3W0GA 1EXAA 4QM0A 2NV7A 1NAVA 1XVPA 1UOMA 1ERRA 2P7AA 3L3ZA 3HZFA 1T79A 2AAXA 4JGVA 4MG7B 3E94A 2R40A 4MG7A 5JI0D 1T74A 2YLPA 2H77A 3D90A 4OLMA 2J7YA 4MG9B 5DMCA 2PIOA 2B1VA 3FALA 2ABIA 3HC6A 4MG9A 2Q5SA 2EWPA 4KZIA 5G44A 3LBDA 5DKEA 5DTVA 2E2RA 5G3JA 2ZMJA 3FLIA 4PPPA 1U3RA 3NSQA 4Q0AC 3RUUA 2GPVA 4OC7A 5DZ3A 1UHLB 4G1DA 2YJAB 3WJ4A 1UHLA 4PPSA 2ACLB 2POBA 3OOFA 1L2JA 2ACLA 3K23A 4OFRA 2Q61A 3CS6A 5DXMA 3WFGA 4IQRA 5DI7A 3IXPD 3RVFA 3WFFA 1PQ9A 4J5WA 2Q70A 4Q13A 4RE8A 5E14A 3ZR7A 2PIXA 2I4ZA 1X7BA 1ILHA 3B68A 3K22A 3OLFA 4MDDA 3X1HA 3AFRA 3PO9A 4DQMA 4NQAB 2AXAA 2QA8A 2AWHA 5DXRA 3HM1A 3FUGA 2ZNOA 4WHGA 4WQPA 1XP9A 3VT7A 1ZUCA 4OEDA 1FM6A 2IOKA 4WVDA 1ZEOA 3GWSX 3W5RA 4DK7A 5FQSA 5B5BA 5DMFA 5AZTA 3FURA 5AAUA 1YA3A 3WMHA 1XLSE 4HEEX 2NW4A 3VSPA 5DZIA 4IA2A 5GT4A 1KV6A 2G44A 1XLSA 2JF9A 5E0XA 3V3EA 4XT9A 3VRUA 5DVVA 2JJ3A 4POHA 3CDPA 2A3IA 4ITFA 3V9YA 2HCDA 4LNXA 5APKA 5KRCA 3A3ZX 4PWLA 2QGTA 4XAOA 2QNVA 1I38A 2YJDA 3IPQA 4QE8A 4QE6A 5C4SA 3AZ1A 3W5QA 5K13A 3L0JA 2W8YA 3OSIA 1XV9B 3VJTA 2NXXA 3IXPA 3W0JA 2AA5A 5DX3A 3W0IA 5E0WA 3P8XA 5KD9A 1T65A 5AVLA 3ET2A 3VHUA 1IE9A 3HO0A 3A2IA 3W0YA 3UUDB 1NHZA 4KZMA 3F7DA 4G20A 3CS8A 5E1CA 3UUDA 2PIUA 4YMQA 3FEIA 3A9EB 2I4JA 2OZ7A 3B3KA 4N5GA 2ZMIA 2QXSA 1I37A 3CWDA 2IOGA 3KBAA 3P0UA 4K4JA 3B67A 4OZRU 1XIUA 3AZ2A 3GWXA 4MG6A 4R2UA 5DU5A 5E19A 1Y0SA 3F5CB 4A4VA 3UU7B 2PRGA 2OUZA 1I7GA 3UU7A 1FCXA 3ADWA 3W0CA 4CSJA 2QGWA 3AUQA 3FC6B 4IWFA 1YP0A 3JZCA 4ZOMA 1P8DA 4S0TA 4DK8A 5KROA 3DT3A 5FQTA 4OKWA 2VV1B 2FSZA 2G0HA 3ZQTA 4R06A 5DSHA 1SKXA 5DXPA 5KR9A 3UUCA 4TV1A 1SQNA 3W0AA 2XKWA 3UVVA 3L03A 1P93A 4ZI1A 1TFCA 1RJKA 2P54A 4REFA 4A2JA 5KRLA 1UPVA 3PBAA 2OM9A 2PKLA 2VV2A 4DMAA 1YJEA 1NQ2A 3ZRAA 2Q7KA 5HYRA 3ET0A 3ET1A 2QTUA 1NUOA 3VRVA 5GICA 5IXKA 5DKBA 2ZY0A 2BJ4B 2GL8A 2PJLA 4N1YA 3GD2A 4DORA 2ZNNA 2BJ4A 2Z4JA 2O4JA 2P4YA 4MGAB 4Y29A 2HB7A 3Q95B 3RLLA 4MG8B 4OJ4A 3O1EA 4MGAA 5KCWA 3VT5A 5KYAA 4MGBB 4MG8A 3IPSA 2Q5GA 5APJA 4ZNVA 1SJ0A 4ZNSA 4MGBA 3GN8A 5E7VA 3G8OA 3WGPA 5HZCA 2ZK4A 2JFAA 1MV9A 3CLDA 3IA6A 4JYGA 1PDUA 3OS8C 3P89A 3V9VA 1S19A 5AAVB 3OLLA 5DV3A 4POJA 2ZXNA 2Q6RA 2IHQA 4HLWA 4XI3A 3A2JA 4RZEA 5AK2A 3V4AA 4OFUA 2VV0A 5FQPA 3K6PA 3D5FA 1FM6D 3DZUA 2AX8A 3VTBA 4FGYA 4UDBA 2ZVTA 1S9QA 2AA7A 2P1VA 4RUOX 4UDAA 1HJ1A 2QPYA 5DWEA 2J14A 1NQ7A 1YMTA 4OHAA 3OLSA 5A86A 4OJ9A 3B0TA 5DIDA 5G46A 2OAXA 2GP7A 5KRJA 1Z5XU 5KCFA 1Y0XX 4YT1A 3L3XA 2OVHA 1M2ZA 2AX9A 5M96A 2AMBA 3V49A 3PEQA 1Z5XE 3KDUA 4RZFA 4PXMA 2BAWA 4NY9A 5KRAA 1U9EA 3R5MA 2HBHA 3ADUA 5DRJA 2J7XA 3OKIA 4ONIA 3GYUA 1ZKYA 5AWKA 4YPQA 3WJ5A 2ZK0A 4K7AA 2AX6A 1XQ3A 1G1UA 2QE4A 2R6YA 5KRKA 1X78A 2FVJA 4J24A 2AA6A 5DWJA 2HASA 5DKSA 4OARA 4G1ZA 2PIQA 5AZVA 5DWLA 1N46A 4EMAA 1QKUA 4RMEA 3CQVA 3PRGA 1ZDTA 3B0RA 3VT3A 2PIPL 3GBKA 4WLBA 2Q1HA 3PCUA 3E00D 5KCUA 2GWXA 3UUAB 5L7HA 3D6DA 4OEZA 3CTBA 5DP0A 3G9EA 3UUAA 3VJHA 5KRFA 4ZN9A 1YYEA 3HC5A 4MG5A 2G5OA 2NXXE 1KKQA 2ZK5A 2VSRA 3HVLA 3OAPA 3FS1A 3KMGA 1OSHA 2P7ZA 1XV9A 4PLEA 5DXBB 5HCVA 1Q4XA 4IUIA 3OSWA 2ZXZA 2ZK3A 1ZAFA 2B50A 2Q6SA 1HG4A 3U9QA 5HYKA 1NQ0A 5KCDA 5C4OA 5I4VA 1XB7A 1WM0X 1DB1A 1X7EA 2XYJA 3X1IA 2HB8A 3L0EA 2QA6A 5DK9A 4QJRA 2ZBSA 2GIUA 1S0ZA 1T63A 1A28A 4E4QA 4UDCA 3MNPA 3ADXA 1RKHA 1K74A 3A9EA 4O8FA 4R6SA 1X7JA 2Q6JA 3R5NA 4XHDA 1XZXX 3E00A 5DUHA 2I4PA 1NYXA 1R5KA 3BC5A 4IW8A 4OGHA 4OEAA 5DZ0A 2XYXA 4JYIA 2ZNPA 3VT4A 3KWYA 4IWCA 3F5CA
chains in the Genus database with same CATH topology
3AURA 3W0HA 5FQRA 5JJMB 1XNXA 1PRGA 2Q60A 1QKTA 3ADVA 3L1BA 4WHFA 5JJMA 1E3GA 3FC6A 3OS8A 5DYBA 3R8DA 4RZGA 2G0GA 2ZASA 2ZLCA 2ZXMA 4OJBA 2VV1A 1XP6A 2GPPA 2QR9A 2HC4A 1NQ1A 5KYJA 3VI8A 1X7RA 3QT0A 4REEA 1OSVA 5IAWA 3DZUD 1PQCA 2AM9A 1LBDA 2ZLAA 1H9UA 1XNNA 4ZO1X 5DXGA 4WPFA 3BQDA 4OKTA 2LBDA 5DUGA 4YNKA 4MGDB 3V9TA 3VTCA 3VHVA 5G5WA 1YOKA 1T5ZA 1MVCA 2VV4B 3D24A 4MGDA 4XUMA 4E2JA 3B66A 5DZHA 1U3QA 5AWJA 4OZTE 1FBYA 4P6XA 3SP9A 4J26A 4OKXA 3PLZA 1PZLA 3OSAA 5EGVA 5G45A 1K4WA 3DZYA 2HWQA 3ADTA 2H79A 3RY9A 4APUA 3X36A 4OEYA 2O9IA 4N8RA 3Q95A 4LTWA 1ZH7A 2P1TA 3GZ9A 4M8EA 3B5RA 5DUEA 2NPAA 3AN3A 1YIMA 1T7FA 1OT7A 2AX7A 2Q59B 2YLOA 1FCZA 4UDDA 5G42A 5KRMA 2R6WA 2Q59A 4XLDA 2V0VA 4JYHA 1QKMA 1XP1A 1RK3A 3KYTA 5AAVA 5L7GA 3MNEA 3AZ3A 2Q7JA 2OCFA 2Q7IA 5DVCA 5DVSA 1EREA 3AX8A 3ERTA 3H0AD 4BCRA 5ACCA 1OVLB 3DY6A 4S0SA 1R1KA 2PIRA 1OVLA 3VSOA 4RFWA 1GS4A 2Q1VA 4LBDA 5G43A 3VRWA 1XPCA 2O4RA 3DCUA 1Y9RA 3KFCA 3ERDA 4LSJA 4PP3A 3K8SA 3W5PA 3S9SA 3R2AA 1A52A 5LWPA 3P88A 4PVUA 4PF3A 5C4UA 3A2HA 3CS4A 1U3SA 1MZNA 4DM6A 1S0XA 2Q8SA 4FN9A 2QZOB 1ILGA 1G5YA 1TXIA 2QZOA 1XVPB 2B23A 4JL4A 4ZNWA 3ZRBA 3UP0A 4FNEA 3JZBA 1L2IA 1YY4A 2PINA 2B1ZA 2PNUA 2QH6A 2ZMHA 3E7CA 4M8HA 4PP5A 5DV6A 4NIEA 1N4HA 4OH5A 1GWXA 2YHDA 3FALB 3IMYA 4RUJA 2PIVA 4JAZA 4NUFA 5HJPB 4PRGA 4J5XC 3BEJA 3DR1A 1PCGA 5IZ0A 3VJSA 5HJPA 3B1MA 2ZK6A 3OMMA 4RMCA 5DL4A 3H0AA 1T7TA 1M13A 4ZNUA 4IW6A 5AVIA 2P7GA 4CI4A 3OKHA 4ZN7A 5B41A 4PLDA 1K74D 4IA7A 4EM9A 1FM9D 1T76A 1XQCA 5DIGA 3VT8A 2P15A 1EXXA 3X31A 1X76A 3VJIA 4E4KA 4IS8A 1BSXA 2AB2A 3NOAA 5DRMA 2HARA 2HAMA 3R29A 3WT6A 3OZ0A 1T7MA 3SZ1A 3VT9A 4OH6A 2QA8B 1RDTA 3TX7B 2I0GA 3ADSA 5DY8A 3B65A 2ZL9A 3G0WA 5DXQA 4ZNHA 2PIWA 1SR7A 1XAPA 3AN4A 1PQ6A 3VT6A 5KCTA 5EHJA 5EJVA 4L96A 4RUPA 2Q7LA 3KDTA 3RLJA 5C4TA 5FQVA 3O1DA 3VRTA 3VHWA 5DXBA 1R20D 4ITEA 3ET3A 3TKMA 2REWA 4G2HA 2P1UA 4ZNTA 1FD0A 3FXVA 3HQ5A 1VJBA 2GPOA 2ATHA 1GWRA 1I7IA 2PITA 3A78A 4RAKA 4ZO1B 4FHHA 5L11A 3OMPA 4MGCA 2XYWA 5LGAA 1FCYA 5HJSA 5CJ6A 3R8IA 3W5TA 5GIEA 2QSEA 4S15A 1NDEA 4OKBA 3TY0A 1FM9A 2I0JA 3L0LA 2Z4BA 5DWIA 5GIDA 4CI5A 3MNOA 1PK5A 5L7EA 3AUNA 3DZYD 5EC9A 4F9MA 4IVWA 3EYBA 3B0WA 4IA3A 3VN2A 5KRHA 4J5WC 4OK1A 4RWVA 2HFPA 5DXKA 5DX3B 3WWRA 2XHSA 5APHA 4S14A 4PP6A 2YATA 5DV8A 4LNWA 1YUCA 3CDSA 5AYGA 2HWRA 3OMOA 4N73A 4Q50A 3IPUA 2AO6A 5DIEA 2QXMA 2OVMA 3R8AA 4B7WA 3SP6A 4ZJRA 2ZFXA 4QL8A 1R20A 1XJ7A 3OMKA 1T7RA 4X1GA 1M7WA 1R1KD 2FAIA 2Q3YA 3WT5A 5KCEA 2QABA 2VV3A 4OZTU 3M7RA 1E3KA 3D57A 4TUZB 1YINA 4KZJA 1Z95A 3H52A 4TUZA 3UP3A 3HODA 3T03A 3KMRA 1G2NA 1IE8A 1R6GA 4ZJWA 1QKNA 1UPWA 5DZ1A 1GWQA 2VV4A 4XUHA 4P6WA 5DXEA 4IV2A 4OZRE 3G8IA 3OOKA 4A4WA 2ZK1A 2F4BA 2ZK2A 3TKCA 4QK4A 4IA1A 3NSPA 1DKFB 3WTQA 5ICKA 3HLVA 1DKFA 4G2IA 4OIVA 2GPUA 1NRLA 3WT7A 5DWGA 2YLYA 4G21A 1LV2A 3A40X 2ZKCA 4RMDA 4TV1B 3KMZA 4IU7A 4IVYA 4L98A 3UVVB 4DM8A 1N83A 2R40D 1T73A 2GTKA 5KRIA 3V3QA 3KPZA 3CJWA 3LMPA 4OIUA 5EI1A 3OGTA 2QMVA 5DLRA 2AA2A 3B0QA 4J5XA 5H1EA 3GYTA 3OS9A 4FHIA 4OILA 3VTDA 1K7LA 4NB6A 5F9BA 5SYZA 3OMQA 3ILZA 4XTAA 2AMAA 2VSTA 3N00A 1ZGYA 1NAXA 1XDKB 2HVCA 2QW4A 1XDKA 2YLQA 1S9PA 1XOWA 3OZJA 2Q5PA 2YFEA 4K6IA 5DYDA 5EITA 2J4AA 1KNUA 3DCTA 1RKGA 2JFAB 2POGA 4IV4A 1G50A 4X1FA 4DOSA 5KCCA 2AYRA 5JY3A 3RUTA 4G1YA 2ZNQA 1ZDUA 5ETHA 5E15A 1RDTD 1YOWA 2V7CA 3FEJA 5DKGA 3W0GA 1EXAA 4QM0A 2NV7A 1NAVA 1XVPA 1UOMA 1ERRA 2P7AA 3L3ZA 3HZFA 1T79A 2AAXA 4JGVA 4MG7B 3E94A 2R40A 4MG7A 5JI0D 1T74A 2YLPA 2H77A 3D90A 4OLMA 2J7YA 4MG9B 5DMCA 2PIOA 2B1VA 3FALA 2ABIA 3HC6A 4MG9A 2Q5SA 2EWPA 4KZIA 5G44A 3LBDA 5DKEA 5DTVA 2E2RA 5G3JA 2ZMJA 3FLIA 4PPPA 1U3RA 3NSQA 4Q0AC 3RUUA 2GPVA 4OC7A 5DZ3A 1UHLB 4G1DA 2YJAB 3WJ4A 1UHLA 4PPSA 2ACLB 2POBA 3OOFA 1L2JA 2ACLA 3K23A 4OFRA 2Q61A 3CS6A 5DXMA 3WFGA 4IQRA 5DI7A 3IXPD 3RVFA 3WFFA 1PQ9A 4J5WA 2Q70A 4Q13A 4RE8A 5E14A 3ZR7A 2PIXA 2I4ZA 1X7BA 1ILHA 3B68A 3K22A 3OLFA 4MDDA 3X1HA 3AFRA 3PO9A 4DQMA 4NQAB 2AXAA 2QA8A 2AWHA 5DXRA 3HM1A 3FUGA 2ZNOA 4WHGA 4WQPA 1XP9A 3VT7A 1ZUCA 4OEDA 1FM6A 2IOKA 4WVDA 1ZEOA 3GWSX 3W5RA 4DK7A 5FQSA 5B5BA 5DMFA 5AZTA 3FURA 5AAUA 1YA3A 3WMHA 1XLSE 4HEEX 2NW4A 3VSPA 5DZIA 4IA2A 5GT4A 1KV6A 2G44A 1XLSA 2JF9A 5E0XA 3V3EA 4XT9A 3VRUA 5DVVA 2JJ3A 4POHA 3CDPA 2A3IA 4ITFA 3V9YA 2HCDA 4LNXA 5APKA 5KRCA 3A3ZX 4PWLA 2QGTA 4XAOA 2QNVA 1I38A 2YJDA 3IPQA 4QE8A 4QE6A 5C4SA 3AZ1A 3W5QA 5K13A 3L0JA 2W8YA 3OSIA 1XV9B 3VJTA 2NXXA 3IXPA 3W0JA 2AA5A 5DX3A 3W0IA 5E0WA 3P8XA 5KD9A 1T65A 5AVLA 3ET2A 3VHUA 1IE9A 3HO0A 3A2IA 3W0YA 3UUDB 1NHZA 4KZMA 3F7DA 4G20A 3CS8A 5E1CA 3UUDA 2PIUA 4YMQA 3FEIA 3A9EB 2I4JA 2OZ7A 3B3KA 4N5GA 2ZMIA 2QXSA 1I37A 3CWDA 2IOGA 3KBAA 3P0UA 4K4JA 3B67A 4OZRU 1XIUA 3AZ2A 3GWXA 4MG6A 4R2UA 5DU5A 5E19A 1Y0SA 3F5CB 4A4VA 3UU7B 2PRGA 2OUZA 1I7GA 3UU7A 1FCXA 3ADWA 3W0CA 4CSJA 2QGWA 3AUQA 3FC6B 4IWFA 1YP0A 3JZCA 4ZOMA 1P8DA 4S0TA 4DK8A 5KROA 3DT3A 5FQTA 4OKWA 2VV1B 2FSZA 2G0HA 3ZQTA 4R06A 5DSHA 1SKXA 5DXPA 5KR9A 3UUCA 4TV1A 1SQNA 3W0AA 2XKWA 3UVVA 3L03A 1P93A 4ZI1A 1TFCA 1RJKA 2P54A 4REFA 4A2JA 5KRLA 1UPVA 3PBAA 2OM9A 2PKLA 2VV2A 4DMAA 1YJEA 1NQ2A 3ZRAA 2Q7KA 5HYRA 3ET0A 3ET1A 2QTUA 1NUOA 3VRVA 5GICA 5IXKA 5DKBA 2ZY0A 2BJ4B 2GL8A 2PJLA 4N1YA 3GD2A 4DORA 2ZNNA 2BJ4A 2Z4JA 2O4JA 2P4YA 4MGAB 4Y29A 2HB7A 3Q95B 3RLLA 4MG8B 4OJ4A 3O1EA 4MGAA 5KCWA 3VT5A 5KYAA 4MGBB 4MG8A 3IPSA 2Q5GA 5APJA 4ZNVA 1SJ0A 4ZNSA 4MGBA 3GN8A 5E7VA 3G8OA 3WGPA 5HZCA 2ZK4A 2JFAA 1MV9A 3CLDA 3IA6A 4JYGA 1PDUA 3OS8C 3P89A 3V9VA 1S19A 5AAVB 3OLLA 5DV3A 4POJA 2ZXNA 2Q6RA 2IHQA 4HLWA 4XI3A 3A2JA 4RZEA 5AK2A 3V4AA 4OFUA 2VV0A 5FQPA 3K6PA 3D5FA 1FM6D 3DZUA 2AX8A 3VTBA 4FGYA 4UDBA 2ZVTA 1S9QA 2AA7A 2P1VA 4RUOX 4UDAA 1HJ1A 2QPYA 5DWEA 2J14A 1NQ7A 1YMTA 4OHAA 3OLSA 5A86A 4OJ9A 3B0TA 5DIDA 5G46A 2OAXA 2GP7A 5KRJA 1Z5XU 5KCFA 1Y0XX 4YT1A 3L3XA 2OVHA 1M2ZA 2AX9A 5M96A 2AMBA 3V49A 3PEQA 1Z5XE 3KDUA 4RZFA 4PXMA 2BAWA 4NY9A 5KRAA 1U9EA 3R5MA 2HBHA 3ADUA 5DRJA 2J7XA 3OKIA 4ONIA 3GYUA 1ZKYA 5AWKA 4YPQA 3WJ5A 2ZK0A 4K7AA 2AX6A 1XQ3A 1G1UA 2QE4A 2R6YA 5KRKA 1X78A 2FVJA 4J24A 2AA6A 5DWJA 2HASA 5DKSA 4OARA 4G1ZA 2PIQA 5AZVA 5DWLA 1N46A 4EMAA 1QKUA 4RMEA 3CQVA 3PRGA 1ZDTA 3B0RA 3VT3A 2PIPL 3GBKA 4WLBA 2Q1HA 3PCUA 3E00D 5KCUA 2GWXA 3UUAB 5L7HA 3D6DA 4OEZA 3CTBA 5DP0A 3G9EA 3UUAA 3VJHA 5KRFA 4ZN9A 1YYEA 3HC5A 4MG5A 2G5OA 2NXXE 1KKQA 2ZK5A 2VSRA 3HVLA 3OAPA 3FS1A 3KMGA 1OSHA 2P7ZA 1XV9A 4PLEA 5DXBB 5HCVA 1Q4XA 4IUIA 3OSWA 2ZXZA 2ZK3A 1ZAFA 2B50A 2Q6SA 1HG4A 3U9QA 5HYKA 1NQ0A 5KCDA 5C4OA 5I4VA 1XB7A 1WM0X 1DB1A 1X7EA 2XYJA 3X1IA 2HB8A 3L0EA 2QA6A 5DK9A 4QJRA 2ZBSA 2GIUA 1S0ZA 1T63A 1A28A 4E4QA 4UDCA 3MNPA 3ADXA 1RKHA 1K74A 3A9EA 4O8FA 4R6SA 1X7JA 2Q6JA 3R5NA 4XHDA 1XZXX 3E00A 5DUHA 2I4PA 1NYXA 1R5KA 3BC5A 4IW8A 4OGHA 4OEAA 5DZ0A 2XYXA 4JYIA 2ZNPA 3VT4A 3KWYA 4IWCA 3F5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUR A;  3W0H A;  5FQR A;  5JJM B;  1XNX A;  1PRG A;  2Q60 A;  1QKT A;  3ADV A;  3L1B A;  4WHF A;  5JJM A;  1E3G A;  3FC6 A;  3OS8 A;  5DYB A;  3R8D A;  4RZG A;  2G0G A;  2ZAS A;  2ZLC A;  2ZXM A;  4OJB A;  2VV1 A;  1XP6 A;  2GPP A;  2QR9 A;  2HC4 A;  1NQ1 A;  5KYJ A;  3VI8 A;  1X7R A;  3QT0 A;  4REE A;  1OSV A;  5IAW A;  3DZU D;  1PQC A;  2AM9 A;  1LBD A;  2ZLA A;  1H9U A;  1XNN A;  4ZO1 X;  5DXG A;  4WPF A;  3BQD A;  4OKT A;  2LBD A;  5DUG A;  4YNK A;  4MGD B;  3V9T A;  3VTC A;  3VHV A;  5G5W A;  1YOK A;  1T5Z A;  1MVC A;  2VV4 B;  3D24 A;  4MGD A;  4XUM A;  4E2J A;  3B66 A;  5DZH A;  1U3Q A;  5AWJ A;  4OZT E;  1FBY A;  4P6X A;  3SP9 A;  4J26 A;  4OKX A;  3PLZ A;  1PZL A;  3OSA A;  5EGV A;  5G45 A;  1K4W A;  3DZY A;  2HWQ A;  3ADT A;  2H79 A;  3RY9 A;  4APU A;  3X36 A;  4OEY A;  2O9I A;  4N8R A;  3Q95 A;  4LTW A;  1ZH7 A;  2P1T A;  3GZ9 A;  4M8E A;  3B5R A;  5DUE A;  2NPA A;  3AN3 A;  1YIM A;  1T7F A;  1OT7 A;  2AX7 A;  2Q59 B;  2YLO A;  1FCZ A;  4UDD A;  5G42 A;  5KRM A;  2R6W A;  2Q59 A;  4XLD A;  2V0V A;  4JYH A;  1QKM A;  1XP1 A;  1RK3 A;  3KYT A;  5AAV A;  5L7G A;  3MNE A;  3AZ3 A;  2Q7J A;  2OCF A;  2Q7I A;  5DVC A;  5DVS A;  1ERE A;  3AX8 A;  3ERT A;  3H0A D;  4BCR A;  5ACC A;  1OVL B;  3DY6 A;  4S0S A;  1R1K A;  2PIR A;  1OVL A;  3VSO A;  4RFW A;  1GS4 A;  2Q1V A;  4LBD A;  5G43 A;  3VRW A;  1XPC A;  2O4R A;  3DCU A;  1Y9R A;  3KFC A;  3ERD A;  4LSJ A;  4PP3 A;  3K8S A;  3W5P A;  3S9S A;  3R2A A;  1A52 A;  5LWP A;  3P88 A;  4PVU A;  4PF3 A;  5C4U A;  3A2H A;  3CS4 A;  1U3S A;  1MZN A;  4DM6 A;  1S0X A;  2Q8S A;  4FN9 A;  2QZO B;  1ILG A;  1G5Y A;  1TXI A;  2QZO A;  1XVP B;  2B23 A;  4JL4 A;  4ZNW A;  3ZRB A;  3UP0 A;  4FNE A;  3JZB A;  1L2I A;  1YY4 A;  2PIN A;  2B1Z A;  2PNU A;  2QH6 A;  2ZMH A;  3E7C A;  4M8H A;  4PP5 A;  5DV6 A;  4NIE A;  1N4H A;  4OH5 A;  1GWX A;  2YHD A;  3FAL B;  3IMY A;  4RUJ A;  2PIV A;  4JAZ A;  4NUF A;  5HJP B;  4PRG A;  4J5X C;  3BEJ A;  3DR1 A;  1PCG A;  5IZ0 A;  3VJS A;  5HJP A;  3B1M A;  2ZK6 A;  3OMM A;  4RMC A;  5DL4 A;  3H0A A;  1T7T A;  1M13 A;  4ZNU A;  4IW6 A;  5AVI A;  2P7G A;  4CI4 A;  3OKH A;  4ZN7 A;  5B41 A;  4PLD A;  1K74 D;  4IA7 A;  4EM9 A;  1FM9 D;  1T76 A;  1XQC A;  5DIG A;  3VT8 A;  2P15 A;  1EXX A;  3X31 A;  1X76 A;  3VJI A;  4E4K A;  4IS8 A;  1BSX A;  2AB2 A;  3NOA A;  5DRM A;  2HAR A;  2HAM A;  3R29 A;  3WT6 A;  3OZ0 A;  1T7M A;  3SZ1 A;  3VT9 A;  4OH6 A;  2QA8 B;  1RDT A;  3TX7 B;  2I0G A;  3ADS A;  5DY8 A;  3B65 A;  2ZL9 A;  3G0W A;  5DXQ A;  4ZNH A;  2PIW A;  1SR7 A;  1XAP A;  3AN4 A;  1PQ6 A;  3VT6 A;  5KCT A;  5EHJ A;  5EJV A;  4L96 A;  4RUP A;  2Q7L A;  3KDT A;  3RLJ A;  5C4T A;  5FQV A;  3O1D A;  3VRT A;  3VHW A;  5DXB A;  1R20 D;  4ITE A;  3ET3 A;  3TKM A;  2REW A;  4G2H A;  2P1U A;  4ZNT A;  1FD0 A;  3FXV A;  3HQ5 A;  1VJB A;  2GPO A;  2ATH A;  1GWR A;  1I7I A;  2PIT A;  3A78 A;  4RAK A;  4ZO1 B;  4FHH A;  5L11 A;  3OMP A;  4MGC A;  2XYW A;  5LGA A;  1FCY A;  5HJS A;  5CJ6 A;  3R8I A;  3W5T A;  5GIE A;  2QSE A;  4S15 A;  1NDE A;  4OKB A;  3TY0 A;  1FM9 A;  2I0J A;  3L0L A;  2Z4B A;  5DWI A;  5GID A;  4CI5 A;  3MNO A;  1PK5 A;  5L7E A;  3AUN A;  3DZY D;  5EC9 A;  4F9M A;  4IVW A;  3EYB A;  3B0W A;  4IA3 A;  3VN2 A;  5KRH A;  4J5W C;  4OK1 A;  4RWV A;  2HFP A;  5DXK A;  5DX3 B;  3WWR A;  2XHS A;  5APH A;  4S14 A;  4PP6 A;  2YAT A;  5DV8 A;  4LNW A;  1YUC A;  3CDS A;  5AYG A;  2HWR A;  3OMO A;  4N73 A;  4Q50 A;  3IPU A;  2AO6 A;  5DIE A;  2QXM A;  2OVM A;  3R8A A;  4B7W A;  3SP6 A;  4ZJR A;  2ZFX A;  4QL8 A;  1R20 A;  1XJ7 A;  3OMK A;  1T7R A;  4X1G A;  1M7W A;  1R1K D;  2FAI A;  2Q3Y A;  3WT5 A;  5KCE A;  2QAB A;  2VV3 A;  4OZT U;  3M7R A;  1E3K A;  3D57 A;  4TUZ B;  1YIN A;  4KZJ A;  1Z95 A;  3H52 A;  4TUZ A;  3UP3 A;  3HOD A;  3T03 A;  3KMR A;  1G2N A;  1IE8 A;  1R6G A;  4ZJW A;  1QKN A;  1UPW A;  5DZ1 A;  1GWQ A;  2VV4 A;  4XUH A;  4P6W A;  5DXE A;  4IV2 A;  4OZR E;  3G8I A;  3OOK A;  4A4W A;  2ZK1 A;  2F4B A;  2ZK2 A;  3TKC A;  4QK4 A;  4IA1 A;  3NSP A;  1DKF B;  3WTQ A;  5ICK A;  3HLV A;  1DKF A;  4G2I A;  4OIV A;  2GPU A;  1NRL A;  3WT7 A;  5DWG A;  2YLY A;  4G21 A;  1LV2 A;  3A40 X;  2ZKC A;  4RMD A;  4TV1 B;  3KMZ A;  4IU7 A;  4IVY A;  4L98 A;  3UVV B;  4DM8 A;  1N83 A;  2R40 D;  1T73 A;  2GTK A;  5KRI A;  3V3Q A;  3KPZ A;  3CJW A;  3LMP A;  4OIU A;  5EI1 A;  3OGT A;  2QMV A;  5DLR A;  2AA2 A;  3B0Q A;  4J5X A;  5H1E A;  3GYT A;  3OS9 A;  4FHI A;  4OIL A;  3VTD A;  1K7L A;  4NB6 A;  5F9B A;  5SYZ A;  3OMQ A;  3ILZ A;  4XTA A;  2AMA A;  2VST A;  3N00 A;  1ZGY A;  1NAX A;  1XDK B;  2HVC A;  2QW4 A;  1XDK A;  2YLQ A;  1S9P A;  1XOW A;  3OZJ A;  2Q5P A;  2YFE A;  4K6I A;  5DYD A;  5EIT A;  2J4A A;  1KNU A;  3DCT A;  1RKG A;  2JFA B;  2POG A;  4IV4 A;  1G50 A;  4X1F A;  4DOS A;  5KCC A;  2AYR A;  5JY3 A;  3RUT A;  4G1Y A;  2ZNQ A;  1ZDU A;  5ETH A;  5E15 A;  1RDT D;  1YOW A;  2V7C A;  3FEJ A;  5DKG A;  3W0G A;  1EXA A;  4QM0 A;  2NV7 A;  1NAV A;  1XVP A;  1UOM A;  1ERR A;  2P7A A;  3L3Z A;  3HZF A;  1T79 A;  2AAX A;  4JGV A;  4MG7 B;  3E94 A;  2R40 A;  4MG7 A;  5JI0 D;  1T74 A;  2YLP A;  2H77 A;  3D90 A;  4OLM A;  2J7Y A;  4MG9 B;  5DMC A;  2PIO A;  2B1V A;  3FAL A;  2ABI A;  3HC6 A;  4MG9 A;  2Q5S A;  2EWP A;  4KZI A;  5G44 A;  3LBD A;  5DKE A;  5DTV A;  2E2R A;  5G3J A;  2ZMJ A;  3FLI A;  4PPP A;  1U3R A;  3NSQ A;  4Q0A C;  3RUU A;  2GPV A;  4OC7 A;  5DZ3 A;  1UHL B;  4G1D A;  2YJA B;  3WJ4 A;  1UHL A;  4PPS A;  2ACL B;  2POB A;  3OOF A;  1L2J A;  2ACL A;  3K23 A;  4OFR A;  2Q61 A;  3CS6 A;  5DXM A;  3WFG A;  4IQR A;  5DI7 A;  3IXP D;  3RVF A;  3WFF A;  1PQ9 A;  4J5W A;  2Q70 A;  4Q13 A;  4RE8 A;  5E14 A;  3ZR7 A;  2PIX A;  2I4Z A;  1X7B A;  1ILH A;  3B68 A;  3K22 A;  3OLF A;  4MDD A;  3X1H A;  3AFR A;  3PO9 A;  4DQM A;  4NQA B;  2AXA A;  2QA8 A;  2AWH A;  5DXR A;  3HM1 A;  3FUG A;  2ZNO A;  4WHG A;  4WQP A;  1XP9 A;  3VT7 A;  1ZUC A;  4OED A;  1FM6 A;  2IOK A;  4WVD A;  1ZEO A;  3GWS X;  3W5R A;  4DK7 A;  5FQS A;  5B5B A;  5DMF A;  5AZT A;  3FUR A;  5AAU A;  1YA3 A;  3WMH A;  1XLS E;  4HEE X;  2NW4 A;  3VSP A;  5DZI A;  4IA2 A;  5GT4 A;  1KV6 A;  2G44 A;  1XLS A;  2JF9 A;  5E0X A;  3V3E A;  4XT9 A;  3VRU A;  5DVV A;  2JJ3 A;  4POH A;  3CDP A;  2A3I A;  4ITF A;  3V9Y A;  2HCD A;  4LNX A;  5APK A;  5KRC A;  3A3Z X;  4PWL A;  2QGT A;  4XAO A;  2QNV A;  1I38 A;  2YJD A;  3IPQ A;  4QE8 A;  4QE6 A;  5C4S A;  3AZ1 A;  3W5Q A;  5K13 A;  3L0J A;  2W8Y A;  3OSI A;  1XV9 B;  3VJT A;  2NXX A;  3IXP A;  3W0J A;  2AA5 A;  5DX3 A;  3W0I A;  5E0W A;  3P8X A;  5KD9 A;  1T65 A;  5AVL A;  3ET2 A;  3VHU A;  1IE9 A;  3HO0 A;  3A2I A;  3W0Y A;  3UUD B;  1NHZ A;  4KZM A;  3F7D A;  4G20 A;  3CS8 A;  5E1C A;  3UUD A;  2PIU A;  4YMQ A;  3FEI A;  3A9E B;  2I4J A;  2OZ7 A;  3B3K A;  4N5G A;  2ZMI A;  2QXS A;  1I37 A;  3CWD A;  2IOG A;  3KBA A;  3P0U A;  4K4J A;  3B67 A;  4OZR U;  1XIU A;  3AZ2 A;  3GWX A;  4MG6 A;  4R2U A;  5DU5 A;  5E19 A;  1Y0S A;  3F5C B;  4A4V A;  3UU7 B;  2PRG A;  2OUZ A;  1I7G A;  3UU7 A;  1FCX A;  3ADW A;  3W0C A;  4CSJ A;  2QGW A;  3AUQ A;  3FC6 B;  4IWF A;  1YP0 A;  3JZC A;  4ZOM A;  1P8D A;  4S0T A;  4DK8 A;  5KRO A;  3DT3 A;  5FQT A;  4OKW A;  2VV1 B;  2FSZ A;  2G0H A;  3ZQT A;  4R06 A;  5DSH A;  1SKX A;  5DXP A;  5KR9 A;  3UUC A;  4TV1 A;  1SQN A;  3W0A A;  2XKW A;  3UVV A;  3L03 A;  1P93 A;  4ZI1 A;  1TFC A;  1RJK A;  2P54 A;  4REF A;  4A2J A;  5KRL A;  1UPV A;  3PBA A;  2OM9 A;  2PKL A;  2VV2 A;  4DMA A;  1YJE A;  1NQ2 A;  3ZRA A;  2Q7K A;  5HYR A;  3ET0 A;  3ET1 A;  2QTU A;  1NUO A;  3VRV A;  5GIC A;  5IXK A;  5DKB A;  2ZY0 A;  2BJ4 B;  2GL8 A;  2PJL A;  4N1Y A;  3GD2 A;  4DOR A;  2ZNN A;  2BJ4 A;  2Z4J A;  2O4J A;  2P4Y A;  4MGA B;  4Y29 A;  2HB7 A;  3Q95 B;  3RLL A;  4MG8 B;  4OJ4 A;  3O1E A;  4MGA A;  5KCW A;  3VT5 A;  5KYA A;  4MGB B;  4MG8 A;  3IPS A;  2Q5G A;  5APJ A;  4ZNV A;  1SJ0 A;  4ZNS A;  4MGB A;  3GN8 A;  5E7V A;  3G8O A;  3WGP A;  5HZC A;  2ZK4 A;  2JFA A;  1MV9 A;  3CLD A;  3IA6 A;  4JYG A;  1PDU A;  3OS8 C;  3P89 A;  3V9V A;  1S19 A;  5AAV B;  3OLL A;  5DV3 A;  4POJ A;  2ZXN A;  2Q6R A;  2IHQ A;  4HLW A;  4XI3 A;  3A2J A;  4RZE A;  5AK2 A;  3V4A A;  4OFU A;  2VV0 A;  5FQP A;  3K6P A;  3D5F A;  1FM6 D;  3DZU A;  2AX8 A;  3VTB A;  4FGY A;  4UDB A;  2ZVT A;  1S9Q A;  2AA7 A;  2P1V A;  4RUO X;  4UDA A;  1HJ1 A;  2QPY A;  5DWE A;  2J14 A;  1NQ7 A;  1YMT A;  4OHA A;  3OLS A;  5A86 A;  4OJ9 A;  3B0T A;  5DID A;  5G46 A;  2OAX A;  2GP7 A;  5KRJ A;  1Z5X U;  5KCF A;  1Y0X X;  4YT1 A;  3L3X A;  2OVH A;  1M2Z A;  2AX9 A;  5M96 A;  2AMB A;  3V49 A;  3PEQ A;  1Z5X E;  3KDU A;  4RZF A;  4PXM A;  2BAW A;  4NY9 A;  5KRA A;  1U9E A;  3R5M A;  2HBH A;  3ADU A;  5DRJ A;  2J7X A;  3OKI A;  4ONI A;  3GYU A;  1ZKY A;  5AWK A;  4YPQ A;  3WJ5 A;  2ZK0 A;  4K7A A;  2AX6 A;  1XQ3 A;  1G1U A;  2QE4 A;  2R6Y A;  5KRK A;  1X78 A;  2FVJ A;  4J24 A;  2AA6 A;  5DWJ A;  2HAS A;  5DKS A;  4OAR A;  4G1Z A;  2PIQ A;  5AZV A;  5DWL A;  1N46 A;  4EMA A;  1QKU A;  4RME A;  3CQV A;  3PRG A;  1ZDT A;  3B0R A;  3VT3 A;  2PIP L;  3GBK A;  4WLB A;  2Q1H A;  3PCU A;  3E00 D;  5KCU A;  2GWX A;  3UUA B;  5L7H A;  3D6D A;  4OEZ A;  3CTB A;  5DP0 A;  3G9E A;  3UUA A;  3VJH A;  5KRF A;  4ZN9 A;  1YYE A;  3HC5 A;  4MG5 A;  2G5O A;  2NXX E;  1KKQ A;  2ZK5 A;  2VSR A;  3HVL A;  3OAP A;  3FS1 A;  3KMG A;  1OSH A;  2P7Z A;  1XV9 A;  4PLE A;  5DXB B;  5HCV A;  1Q4X A;  4IUI A;  3OSW A;  2ZXZ A;  2ZK3 A;  1ZAF A;  2B50 A;  2Q6S A;  1HG4 A;  3U9Q A;  5HYK A;  1NQ0 A;  5KCD A;  5C4O A;  5I4V A;  1XB7 A;  1WM0 X;  1DB1 A;  1X7E A;  2XYJ A;  3X1I A;  2HB8 A;  3L0E A;  2QA6 A;  5DK9 A;  4QJR A;  2ZBS A;  2GIU A;  1S0Z A;  1T63 A;  1A28 A;  4E4Q A;  4UDC A;  3MNP A;  3ADX A;  1RKH A;  1K74 A;  3A9E A;  4O8F A;  4R6S A;  1X7J A;  2Q6J A;  3R5N A;  4XHD A;  1XZX X;  3E00 A;  5DUH A;  2I4P A;  1NYX A;  1R5K A;  3BC5 A;  4IW8 A;  4OGH A;  4OEA A;  5DZ0 A;  2XYX A;  4JYI A;  2ZNP A;  3VT4 A;  3KWY A;  4IWC A;  3F5C A; 
#chains in the Genus database with same CATH topology
 3AUR A;  3W0H A;  5FQR A;  5JJM B;  1XNX A;  1PRG A;  2Q60 A;  1QKT A;  3ADV A;  3L1B A;  4WHF A;  5JJM A;  1E3G A;  3FC6 A;  3OS8 A;  5DYB A;  3R8D A;  4RZG A;  2G0G A;  2ZAS A;  2ZLC A;  2ZXM A;  4OJB A;  2VV1 A;  1XP6 A;  2GPP A;  2QR9 A;  2HC4 A;  1NQ1 A;  5KYJ A;  3VI8 A;  1X7R A;  3QT0 A;  4REE A;  1OSV A;  5IAW A;  3DZU D;  1PQC A;  2AM9 A;  1LBD A;  2ZLA A;  1H9U A;  1XNN A;  4ZO1 X;  5DXG A;  4WPF A;  3BQD A;  4OKT A;  2LBD A;  5DUG A;  4YNK A;  4MGD B;  3V9T A;  3VTC A;  3VHV A;  5G5W A;  1YOK A;  1T5Z A;  1MVC A;  2VV4 B;  3D24 A;  4MGD A;  4XUM A;  4E2J A;  3B66 A;  5DZH A;  1U3Q A;  5AWJ A;  4OZT E;  1FBY A;  4P6X A;  3SP9 A;  4J26 A;  4OKX A;  3PLZ A;  1PZL A;  3OSA A;  5EGV A;  5G45 A;  1K4W A;  3DZY A;  2HWQ A;  3ADT A;  2H79 A;  3RY9 A;  4APU A;  3X36 A;  4OEY A;  2O9I A;  4N8R A;  3Q95 A;  4LTW A;  1ZH7 A;  2P1T A;  3GZ9 A;  4M8E A;  3B5R A;  5DUE A;  2NPA A;  3AN3 A;  1YIM A;  1T7F A;  1OT7 A;  2AX7 A;  2Q59 B;  2YLO A;  1FCZ A;  4UDD A;  5G42 A;  5KRM A;  2R6W A;  2Q59 A;  4XLD A;  2V0V A;  4JYH A;  1QKM A;  1XP1 A;  1RK3 A;  3KYT A;  5AAV A;  5L7G A;  3MNE A;  3AZ3 A;  2Q7J A;  2OCF A;  2Q7I A;  5DVC A;  5DVS A;  1ERE A;  3AX8 A;  3ERT A;  3H0A D;  4BCR A;  5ACC A;  1OVL B;  3DY6 A;  4S0S A;  1R1K A;  2PIR A;  1OVL A;  3VSO A;  4RFW A;  1GS4 A;  2Q1V A;  4LBD A;  5G43 A;  3VRW A;  1XPC A;  2O4R A;  3DCU A;  1Y9R A;  3KFC A;  3ERD A;  4LSJ A;  4PP3 A;  3K8S A;  3W5P A;  3S9S A;  3R2A A;  1A52 A;  5LWP A;  3P88 A;  4PVU A;  4PF3 A;  5C4U A;  3A2H A;  3CS4 A;  1U3S A;  1MZN A;  4DM6 A;  1S0X A;  2Q8S A;  4FN9 A;  2QZO B;  1ILG A;  1G5Y A;  1TXI A;  2QZO A;  1XVP B;  2B23 A;  4JL4 A;  4ZNW A;  3ZRB A;  3UP0 A;  4FNE A;  3JZB A;  1L2I A;  1YY4 A;  2PIN A;  2B1Z A;  2PNU A;  2QH6 A;  2ZMH A;  3E7C A;  4M8H A;  4PP5 A;  5DV6 A;  4NIE A;  1N4H A;  4OH5 A;  1GWX A;  2YHD A;  3FAL B;  3IMY A;  4RUJ A;  2PIV A;  4JAZ A;  4NUF A;  5HJP B;  4PRG A;  4J5X C;  3BEJ A;  3DR1 A;  1PCG A;  5IZ0 A;  3VJS A;  5HJP A;  3B1M A;  2ZK6 A;  3OMM A;  4RMC A;  5DL4 A;  3H0A A;  1T7T A;  1M13 A;  4ZNU A;  4IW6 A;  5AVI A;  2P7G A;  4CI4 A;  3OKH A;  4ZN7 A;  5B41 A;  4PLD A;  1K74 D;  4IA7 A;  4EM9 A;  1FM9 D;  1T76 A;  1XQC A;  5DIG A;  3VT8 A;  2P15 A;  1EXX A;  3X31 A;  1X76 A;  3VJI A;  4E4K A;  4IS8 A;  1BSX A;  2AB2 A;  3NOA A;  5DRM A;  2HAR A;  2HAM A;  3R29 A;  3WT6 A;  3OZ0 A;  1T7M A;  3SZ1 A;  3VT9 A;  4OH6 A;  2QA8 B;  1RDT A;  3TX7 B;  2I0G A;  3ADS A;  5DY8 A;  3B65 A;  2ZL9 A;  3G0W A;  5DXQ A;  4ZNH A;  2PIW A;  1SR7 A;  1XAP A;  3AN4 A;  1PQ6 A;  3VT6 A;  5KCT A;  5EHJ A;  5EJV A;  4L96 A;  4RUP A;  2Q7L A;  3KDT A;  3RLJ A;  5C4T A;  5FQV A;  3O1D A;  3VRT A;  3VHW A;  5DXB A;  1R20 D;  4ITE A;  3ET3 A;  3TKM A;  2REW A;  4G2H A;  2P1U A;  4ZNT A;  1FD0 A;  3FXV A;  3HQ5 A;  1VJB A;  2GPO A;  2ATH A;  1GWR A;  1I7I A;  2PIT A;  3A78 A;  4RAK A;  4ZO1 B;  4FHH A;  5L11 A;  3OMP A;  4MGC A;  2XYW A;  5LGA A;  1FCY A;  5HJS A;  5CJ6 A;  3R8I A;  3W5T A;  5GIE A;  2QSE A;  4S15 A;  1NDE A;  4OKB A;  3TY0 A;  1FM9 A;  2I0J A;  3L0L A;  2Z4B A;  5DWI A;  5GID A;  4CI5 A;  3MNO A;  1PK5 A;  5L7E A;  3AUN A;  3DZY D;  5EC9 A;  4F9M A;  4IVW A;  3EYB A;  3B0W A;  4IA3 A;  3VN2 A;  5KRH A;  4J5W C;  4OK1 A;  4RWV A;  2HFP A;  5DXK A;  5DX3 B;  3WWR A;  2XHS A;  5APH A;  4S14 A;  4PP6 A;  2YAT A;  5DV8 A;  4LNW A;  1YUC A;  3CDS A;  5AYG A;  2HWR A;  3OMO A;  4N73 A;  4Q50 A;  3IPU A;  2AO6 A;  5DIE A;  2QXM A;  2OVM A;  3R8A A;  4B7W A;  3SP6 A;  4ZJR A;  2ZFX A;  4QL8 A;  1R20 A;  1XJ7 A;  3OMK A;  1T7R A;  4X1G A;  1M7W A;  1R1K D;  2FAI A;  2Q3Y A;  3WT5 A;  5KCE A;  2QAB A;  2VV3 A;  4OZT U;  3M7R A;  1E3K A;  3D57 A;  4TUZ B;  1YIN A;  4KZJ A;  1Z95 A;  3H52 A;  4TUZ A;  3UP3 A;  3HOD A;  3T03 A;  3KMR A;  1G2N A;  1IE8 A;  1R6G A;  4ZJW A;  1QKN A;  1UPW A;  5DZ1 A;  1GWQ A;  2VV4 A;  4XUH A;  4P6W A;  5DXE A;  4IV2 A;  4OZR E;  3G8I A;  3OOK A;  4A4W A;  2ZK1 A;  2F4B A;  2ZK2 A;  3TKC A;  4QK4 A;  4IA1 A;  3NSP A;  1DKF B;  3WTQ A;  5ICK A;  3HLV A;  1DKF A;  4G2I A;  4OIV A;  2GPU A;  1NRL A;  3WT7 A;  5DWG A;  2YLY A;  4G21 A;  1LV2 A;  3A40 X;  2ZKC A;  4RMD A;  4TV1 B;  3KMZ A;  4IU7 A;  4IVY A;  4L98 A;  3UVV B;  4DM8 A;  1N83 A;  2R40 D;  1T73 A;  2GTK A;  5KRI A;  3V3Q A;  3KPZ A;  3CJW A;  3LMP A;  4OIU A;  5EI1 A;  3OGT A;  2QMV A;  5DLR A;  2AA2 A;  3B0Q A;  4J5X A;  5H1E A;  3GYT A;  3OS9 A;  4FHI A;  4OIL A;  3VTD A;  1K7L A;  4NB6 A;  5F9B A;  5SYZ A;  3OMQ A;  3ILZ A;  4XTA A;  2AMA A;  2VST A;  3N00 A;  1ZGY A;  1NAX A;  1XDK B;  2HVC A;  2QW4 A;  1XDK A;  2YLQ A;  1S9P A;  1XOW A;  3OZJ A;  2Q5P A;  2YFE A;  4K6I A;  5DYD A;  5EIT A;  2J4A A;  1KNU A;  3DCT A;  1RKG A;  2JFA B;  2POG A;  4IV4 A;  1G50 A;  4X1F A;  4DOS A;  5KCC A;  2AYR A;  5JY3 A;  3RUT A;  4G1Y A;  2ZNQ A;  1ZDU A;  5ETH A;  5E15 A;  1RDT D;  1YOW A;  2V7C A;  3FEJ A;  5DKG A;  3W0G A;  1EXA A;  4QM0 A;  2NV7 A;  1NAV A;  1XVP A;  1UOM A;  1ERR A;  2P7A A;  3L3Z A;  3HZF A;  1T79 A;  2AAX A;  4JGV A;  4MG7 B;  3E94 A;  2R40 A;  4MG7 A;  5JI0 D;  1T74 A;  2YLP A;  2H77 A;  3D90 A;  4OLM A;  2J7Y A;  4MG9 B;  5DMC A;  2PIO A;  2B1V A;  3FAL A;  2ABI A;  3HC6 A;  4MG9 A;  2Q5S A;  2EWP A;  4KZI A;  5G44 A;  3LBD A;  5DKE A;  5DTV A;  2E2R A;  5G3J A;  2ZMJ A;  3FLI A;  4PPP A;  1U3R A;  3NSQ A;  4Q0A C;  3RUU A;  2GPV A;  4OC7 A;  5DZ3 A;  1UHL B;  4G1D A;  2YJA B;  3WJ4 A;  1UHL A;  4PPS A;  2ACL B;  2POB A;  3OOF A;  1L2J A;  2ACL A;  3K23 A;  4OFR A;  2Q61 A;  3CS6 A;  5DXM A;  3WFG A;  4IQR A;  5DI7 A;  3IXP D;  3RVF A;  3WFF A;  1PQ9 A;  4J5W A;  2Q70 A;  4Q13 A;  4RE8 A;  5E14 A;  3ZR7 A;  2PIX A;  2I4Z A;  1X7B A;  1ILH A;  3B68 A;  3K22 A;  3OLF A;  4MDD A;  3X1H A;  3AFR A;  3PO9 A;  4DQM A;  4NQA B;  2AXA A;  2QA8 A;  2AWH A;  5DXR A;  3HM1 A;  3FUG A;  2ZNO A;  4WHG A;  4WQP A;  1XP9 A;  3VT7 A;  1ZUC A;  4OED A;  1FM6 A;  2IOK A;  4WVD A;  1ZEO A;  3GWS X;  3W5R A;  4DK7 A;  5FQS A;  5B5B A;  5DMF A;  5AZT A;  3FUR A;  5AAU A;  1YA3 A;  3WMH A;  1XLS E;  4HEE X;  2NW4 A;  3VSP A;  5DZI A;  4IA2 A;  5GT4 A;  1KV6 A;  2G44 A;  1XLS A;  2JF9 A;  5E0X A;  3V3E A;  4XT9 A;  3VRU A;  5DVV A;  2JJ3 A;  4POH A;  3CDP A;  2A3I A;  4ITF A;  3V9Y A;  2HCD A;  4LNX A;  5APK A;  5KRC A;  3A3Z X;  4PWL A;  2QGT A;  4XAO A;  2QNV A;  1I38 A;  2YJD A;  3IPQ A;  4QE8 A;  4QE6 A;  5C4S A;  3AZ1 A;  3W5Q A;  5K13 A;  3L0J A;  2W8Y A;  3OSI A;  1XV9 B;  3VJT A;  2NXX A;  3IXP A;  3W0J A;  2AA5 A;  5DX3 A;  3W0I A;  5E0W A;  3P8X A;  5KD9 A;  1T65 A;  5AVL A;  3ET2 A;  3VHU A;  1IE9 A;  3HO0 A;  3A2I A;  3W0Y A;  3UUD B;  1NHZ A;  4KZM A;  3F7D A;  4G20 A;  3CS8 A;  5E1C A;  3UUD A;  2PIU A;  4YMQ A;  3FEI A;  3A9E B;  2I4J A;  2OZ7 A;  3B3K A;  4N5G A;  2ZMI A;  2QXS A;  1I37 A;  3CWD A;  2IOG A;  3KBA A;  3P0U A;  4K4J A;  3B67 A;  4OZR U;  1XIU A;  3AZ2 A;  3GWX A;  4MG6 A;  4R2U A;  5DU5 A;  5E19 A;  1Y0S A;  3F5C B;  4A4V A;  3UU7 B;  2PRG A;  2OUZ A;  1I7G A;  3UU7 A;  1FCX A;  3ADW A;  3W0C A;  4CSJ A;  2QGW A;  3AUQ A;  3FC6 B;  4IWF A;  1YP0 A;  3JZC A;  4ZOM A;  1P8D A;  4S0T A;  4DK8 A;  5KRO A;  3DT3 A;  5FQT A;  4OKW A;  2VV1 B;  2FSZ A;  2G0H A;  3ZQT A;  4R06 A;  5DSH A;  1SKX A;  5DXP A;  5KR9 A;  3UUC A;  4TV1 A;  1SQN A;  3W0A A;  2XKW A;  3UVV A;  3L03 A;  1P93 A;  4ZI1 A;  1TFC A;  1RJK A;  2P54 A;  4REF A;  4A2J A;  5KRL A;  1UPV A;  3PBA A;  2OM9 A;  2PKL A;  2VV2 A;  4DMA A;  1YJE A;  1NQ2 A;  3ZRA A;  2Q7K A;  5HYR A;  3ET0 A;  3ET1 A;  2QTU A;  1NUO A;  3VRV A;  5GIC A;  5IXK A;  5DKB A;  2ZY0 A;  2BJ4 B;  2GL8 A;  2PJL A;  4N1Y A;  3GD2 A;  4DOR A;  2ZNN A;  2BJ4 A;  2Z4J A;  2O4J A;  2P4Y A;  4MGA B;  4Y29 A;  2HB7 A;  3Q95 B;  3RLL A;  4MG8 B;  4OJ4 A;  3O1E A;  4MGA A;  5KCW A;  3VT5 A;  5KYA A;  4MGB B;  4MG8 A;  3IPS A;  2Q5G A;  5APJ A;  4ZNV A;  1SJ0 A;  4ZNS A;  4MGB A;  3GN8 A;  5E7V A;  3G8O A;  3WGP A;  5HZC A;  2ZK4 A;  2JFA A;  1MV9 A;  3CLD A;  3IA6 A;  4JYG A;  1PDU A;  3OS8 C;  3P89 A;  3V9V A;  1S19 A;  5AAV B;  3OLL A;  5DV3 A;  4POJ A;  2ZXN A;  2Q6R A;  2IHQ A;  4HLW A;  4XI3 A;  3A2J A;  4RZE A;  5AK2 A;  3V4A A;  4OFU A;  2VV0 A;  5FQP A;  3K6P A;  3D5F A;  1FM6 D;  3DZU A;  2AX8 A;  3VTB A;  4FGY A;  4UDB A;  2ZVT A;  1S9Q A;  2AA7 A;  2P1V A;  4RUO X;  4UDA A;  1HJ1 A;  2QPY A;  5DWE A;  2J14 A;  1NQ7 A;  1YMT A;  4OHA A;  3OLS A;  5A86 A;  4OJ9 A;  3B0T A;  5DID A;  5G46 A;  2OAX A;  2GP7 A;  5KRJ A;  1Z5X U;  5KCF A;  1Y0X X;  4YT1 A;  3L3X A;  2OVH A;  1M2Z A;  2AX9 A;  5M96 A;  2AMB A;  3V49 A;  3PEQ A;  1Z5X E;  3KDU A;  4RZF A;  4PXM A;  2BAW A;  4NY9 A;  5KRA A;  1U9E A;  3R5M A;  2HBH A;  3ADU A;  5DRJ A;  2J7X A;  3OKI A;  4ONI A;  3GYU A;  1ZKY A;  5AWK A;  4YPQ A;  3WJ5 A;  2ZK0 A;  4K7A A;  2AX6 A;  1XQ3 A;  1G1U A;  2QE4 A;  2R6Y A;  5KRK A;  1X78 A;  2FVJ A;  4J24 A;  2AA6 A;  5DWJ A;  2HAS A;  5DKS A;  4OAR A;  4G1Z A;  2PIQ A;  5AZV A;  5DWL A;  1N46 A;  4EMA A;  1QKU A;  4RME A;  3CQV A;  3PRG A;  1ZDT A;  3B0R A;  3VT3 A;  2PIP L;  3GBK A;  4WLB A;  2Q1H A;  3PCU A;  3E00 D;  5KCU A;  2GWX A;  3UUA B;  5L7H A;  3D6D A;  4OEZ A;  3CTB A;  5DP0 A;  3G9E A;  3UUA A;  3VJH A;  5KRF A;  4ZN9 A;  1YYE A;  3HC5 A;  4MG5 A;  2G5O A;  2NXX E;  1KKQ A;  2ZK5 A;  2VSR A;  3HVL A;  3OAP A;  3FS1 A;  3KMG A;  1OSH A;  2P7Z A;  1XV9 A;  4PLE A;  5DXB B;  5HCV A;  1Q4X A;  4IUI A;  3OSW A;  2ZXZ A;  2ZK3 A;  1ZAF A;  2B50 A;  2Q6S A;  1HG4 A;  3U9Q A;  5HYK A;  1NQ0 A;  5KCD A;  5C4O A;  5I4V A;  1XB7 A;  1WM0 X;  1DB1 A;  1X7E A;  2XYJ A;  3X1I A;  2HB8 A;  3L0E A;  2QA6 A;  5DK9 A;  4QJR A;  2ZBS A;  2GIU A;  1S0Z A;  1T63 A;  1A28 A;  4E4Q A;  4UDC A;  3MNP A;  3ADX A;  1RKH A;  1K74 A;  3A9E A;  4O8F A;  4R6S A;  1X7J A;  2Q6J A;  3R5N A;  4XHD A;  1XZX X;  3E00 A;  5DUH A;  2I4P A;  1NYX A;  1R5K A;  3BC5 A;  4IW8 A;  4OGH A;  4OEA A;  5DZ0 A;  2XYX A;  4JYI A;  2ZNP A;  3VT4 A;  3KWY A;  4IWC A;  3F5C A; 
#chains in the Genus database with same CATH homology
 3AUR A;  3W0H A;  5FQR A;  5JJM B;  1XNX A;  1PRG A;  2Q60 A;  1QKT A;  3ADV A;  3L1B A;  4WHF A;  5JJM A;  1E3G A;  3FC6 A;  3OS8 A;  5DYB A;  3R8D A;  4RZG A;  2G0G A;  2ZAS A;  2ZLC A;  2ZXM A;  4OJB A;  2VV1 A;  1XP6 A;  2GPP A;  2QR9 A;  2HC4 A;  1NQ1 A;  5KYJ A;  3VI8 A;  1X7R A;  3QT0 A;  4REE A;  1OSV A;  5IAW A;  3DZU D;  1PQC A;  2AM9 A;  1LBD A;  2ZLA A;  1H9U A;  1XNN A;  4ZO1 X;  5DXG A;  4WPF A;  3BQD A;  4OKT A;  2LBD A;  5DUG A;  4YNK A;  4MGD B;  3V9T A;  3VTC A;  3VHV A;  5G5W A;  1YOK A;  1T5Z A;  1MVC A;  2VV4 B;  3D24 A;  4MGD A;  4XUM A;  4E2J A;  3B66 A;  5DZH A;  1U3Q A;  5AWJ A;  4OZT E;  1FBY A;  4P6X A;  3SP9 A;  4J26 A;  4OKX A;  3PLZ A;  1PZL A;  3OSA A;  5EGV A;  5G45 A;  1K4W A;  3DZY A;  2HWQ A;  3ADT A;  2H79 A;  3RY9 A;  4APU A;  3X36 A;  4OEY A;  2O9I A;  4N8R A;  3Q95 A;  4LTW A;  1ZH7 A;  2P1T A;  3GZ9 A;  4M8E A;  3B5R A;  5DUE A;  2NPA A;  3AN3 A;  1YIM A;  1T7F A;  1OT7 A;  2AX7 A;  2Q59 B;  2YLO A;  1FCZ A;  4UDD A;  5G42 A;  5KRM A;  2R6W A;  2Q59 A;  4XLD A;  2V0V A;  4JYH A;  1QKM A;  1XP1 A;  1RK3 A;  3KYT A;  5AAV A;  5L7G A;  3MNE A;  3AZ3 A;  2Q7J A;  2OCF A;  2Q7I A;  5DVC A;  5DVS A;  1ERE A;  3AX8 A;  3ERT A;  3H0A D;  4BCR A;  5ACC A;  1OVL B;  3DY6 A;  4S0S A;  1R1K A;  2PIR A;  1OVL A;  3VSO A;  4RFW A;  1GS4 A;  2Q1V A;  4LBD A;  5G43 A;  3VRW A;  1XPC A;  2O4R A;  3DCU A;  1Y9R A;  3KFC A;  3ERD A;  4LSJ A;  4PP3 A;  3K8S A;  3W5P A;  3S9S A;  3R2A A;  1A52 A;  5LWP A;  3P88 A;  4PVU A;  4PF3 A;  5C4U A;  3A2H A;  3CS4 A;  1U3S A;  1MZN A;  4DM6 A;  1S0X A;  2Q8S A;  4FN9 A;  2QZO B;  1ILG A;  1G5Y A;  1TXI A;  2QZO A;  1XVP B;  2B23 A;  4JL4 A;  4ZNW A;  3ZRB A;  3UP0 A;  4FNE A;  3JZB A;  1L2I A;  1YY4 A;  2PIN A;  2B1Z A;  2PNU A;  2QH6 A;  2ZMH A;  3E7C A;  4M8H A;  4PP5 A;  5DV6 A;  4NIE A;  1N4H A;  4OH5 A;  1GWX A;  2YHD A;  3FAL B;  3IMY A;  4RUJ A;  2PIV A;  4JAZ A;  4NUF A;  5HJP B;  4PRG A;  4J5X C;  3BEJ A;  3DR1 A;  1PCG A;  5IZ0 A;  3VJS A;  5HJP A;  3B1M A;  2ZK6 A;  3OMM A;  4RMC A;  5DL4 A;  3H0A A;  1T7T A;  1M13 A;  4ZNU A;  4IW6 A;  5AVI A;  2P7G A;  4CI4 A;  3OKH A;  4ZN7 A;  5B41 A;  4PLD A;  1K74 D;  4IA7 A;  4EM9 A;  1FM9 D;  1T76 A;  1XQC A;  5DIG A;  3VT8 A;  2P15 A;  1EXX A;  3X31 A;  1X76 A;  3VJI A;  4E4K A;  4IS8 A;  1BSX A;  2AB2 A;  3NOA A;  5DRM A;  2HAR A;  2HAM A;  3R29 A;  3WT6 A;  3OZ0 A;  1T7M A;  3SZ1 A;  3VT9 A;  4OH6 A;  2QA8 B;  1RDT A;  3TX7 B;  2I0G A;  3ADS A;  5DY8 A;  3B65 A;  2ZL9 A;  3G0W A;  5DXQ A;  4ZNH A;  2PIW A;  1SR7 A;  1XAP A;  3AN4 A;  1PQ6 A;  3VT6 A;  5KCT A;  5EHJ A;  5EJV A;  4L96 A;  4RUP A;  2Q7L A;  3KDT A;  3RLJ A;  5C4T A;  5FQV A;  3O1D A;  3VRT A;  3VHW A;  5DXB A;  1R20 D;  4ITE A;  3ET3 A;  3TKM A;  2REW A;  4G2H A;  2P1U A;  4ZNT A;  1FD0 A;  3FXV A;  3HQ5 A;  1VJB A;  2GPO A;  2ATH A;  1GWR A;  1I7I A;  2PIT A;  3A78 A;  4RAK A;  4ZO1 B;  4FHH A;  5L11 A;  3OMP A;  4MGC A;  2XYW A;  5LGA A;  1FCY A;  5HJS A;  5CJ6 A;  3R8I A;  3W5T A;  5GIE A;  2QSE A;  4S15 A;  1NDE A;  4OKB A;  3TY0 A;  1FM9 A;  2I0J A;  3L0L A;  2Z4B A;  5DWI A;  5GID A;  4CI5 A;  3MNO A;  1PK5 A;  5L7E A;  3AUN A;  3DZY D;  5EC9 A;  4F9M A;  4IVW A;  3EYB A;  3B0W A;  4IA3 A;  3VN2 A;  5KRH A;  4J5W C;  4OK1 A;  4RWV A;  2HFP A;  5DXK A;  5DX3 B;  3WWR A;  2XHS A;  5APH A;  4S14 A;  4PP6 A;  2YAT A;  5DV8 A;  4LNW A;  1YUC A;  3CDS A;  5AYG A;  2HWR A;  3OMO A;  4N73 A;  4Q50 A;  3IPU A;  2AO6 A;  5DIE A;  2QXM A;  2OVM A;  3R8A A;  4B7W A;  3SP6 A;  4ZJR A;  2ZFX A;  4QL8 A;  1R20 A;  1XJ7 A;  3OMK A;  1T7R A;  4X1G A;  1M7W A;  1R1K D;  2FAI A;  2Q3Y A;  3WT5 A;  5KCE A;  2QAB A;  2VV3 A;  4OZT U;  3M7R A;  1E3K A;  3D57 A;  4TUZ B;  1YIN A;  4KZJ A;  1Z95 A;  3H52 A;  4TUZ A;  3UP3 A;  3HOD A;  3T03 A;  3KMR A;  1G2N A;  1IE8 A;  1R6G A;  4ZJW A;  1QKN A;  1UPW A;  5DZ1 A;  1GWQ A;  2VV4 A;  4XUH A;  4P6W A;  5DXE A;  4IV2 A;  4OZR E;  3G8I A;  3OOK A;  4A4W A;  2ZK1 A;  2F4B A;  2ZK2 A;  3TKC A;  4QK4 A;  4IA1 A;  3NSP A;  1DKF B;  3WTQ A;  5ICK A;  3HLV A;  1DKF A;  4G2I A;  4OIV A;  2GPU A;  1NRL A;  3WT7 A;  5DWG A;  2YLY A;  4G21 A;  1LV2 A;  3A40 X;  2ZKC A;  4RMD A;  4TV1 B;  3KMZ A;  4IU7 A;  4IVY A;  4L98 A;  3UVV B;  4DM8 A;  1N83 A;  2R40 D;  1T73 A;  2GTK A;  5KRI A;  3V3Q A;  3KPZ A;  3CJW A;  3LMP A;  4OIU A;  5EI1 A;  3OGT A;  2QMV A;  5DLR A;  2AA2 A;  3B0Q A;  4J5X A;  5H1E A;  3GYT A;  3OS9 A;  4FHI A;  4OIL A;  3VTD A;  1K7L A;  4NB6 A;  5F9B A;  5SYZ A;  3OMQ A;  3ILZ A;  4XTA A;  2AMA A;  2VST A;  3N00 A;  1ZGY A;  1NAX A;  1XDK B;  2HVC A;  2QW4 A;  1XDK A;  2YLQ A;  1S9P A;  1XOW A;  3OZJ A;  2Q5P A;  2YFE A;  4K6I A;  5DYD A;  5EIT A;  2J4A A;  1KNU A;  3DCT A;  1RKG A;  2JFA B;  2POG A;  4IV4 A;  1G50 A;  4X1F A;  4DOS A;  5KCC A;  2AYR A;  5JY3 A;  3RUT A;  4G1Y A;  2ZNQ A;  1ZDU A;  5ETH A;  5E15 A;  1RDT D;  1YOW A;  2V7C A;  3FEJ A;  5DKG A;  3W0G A;  1EXA A;  4QM0 A;  2NV7 A;  1NAV A;  1XVP A;  1UOM A;  1ERR A;  2P7A A;  3L3Z A;  3HZF A;  1T79 A;  2AAX A;  4JGV A;  4MG7 B;  3E94 A;  2R40 A;  4MG7 A;  5JI0 D;  1T74 A;  2YLP A;  2H77 A;  3D90 A;  4OLM A;  2J7Y A;  4MG9 B;  5DMC A;  2PIO A;  2B1V A;  3FAL A;  2ABI A;  3HC6 A;  4MG9 A;  2Q5S A;  2EWP A;  4KZI A;  5G44 A;  3LBD A;  5DKE A;  5DTV A;  2E2R A;  5G3J A;  2ZMJ A;  3FLI A;  4PPP A;  1U3R A;  3NSQ A;  4Q0A C;  3RUU A;  2GPV A;  4OC7 A;  5DZ3 A;  1UHL B;  4G1D A;  2YJA B;  3WJ4 A;  1UHL A;  4PPS A;  2ACL B;  2POB A;  3OOF A;  1L2J A;  2ACL A;  3K23 A;  4OFR A;  2Q61 A;  3CS6 A;  5DXM A;  3WFG A;  4IQR A;  5DI7 A;  3IXP D;  3RVF A;  3WFF A;  1PQ9 A;  4J5W A;  2Q70 A;  4Q13 A;  4RE8 A;  5E14 A;  3ZR7 A;  2PIX A;  2I4Z A;  1X7B A;  1ILH A;  3B68 A;  3K22 A;  3OLF A;  4MDD A;  3X1H A;  3AFR A;  3PO9 A;  4DQM A;  4NQA B;  2AXA A;  2QA8 A;  2AWH A;  5DXR A;  3HM1 A;  3FUG A;  2ZNO A;  4WHG A;  4WQP A;  1XP9 A;  3VT7 A;  1ZUC A;  4OED A;  1FM6 A;  2IOK A;  4WVD A;  1ZEO A;  3GWS X;  3W5R A;  4DK7 A;  5FQS A;  5B5B A;  5DMF A;  5AZT A;  3FUR A;  5AAU A;  1YA3 A;  3WMH A;  1XLS E;  4HEE X;  2NW4 A;  3VSP A;  5DZI A;  4IA2 A;  5GT4 A;  1KV6 A;  2G44 A;  1XLS A;  2JF9 A;  5E0X A;  3V3E A;  4XT9 A;  3VRU A;  5DVV A;  2JJ3 A;  4POH A;  3CDP A;  2A3I A;  4ITF A;  3V9Y A;  2HCD A;  4LNX A;  5APK A;  5KRC A;  3A3Z X;  4PWL A;  2QGT A;  4XAO A;  2QNV A;  1I38 A;  2YJD A;  3IPQ A;  4QE8 A;  4QE6 A;  5C4S A;  3AZ1 A;  3W5Q A;  5K13 A;  3L0J A;  2W8Y A;  3OSI A;  1XV9 B;  3VJT A;  2NXX A;  3IXP A;  3W0J A;  2AA5 A;  5DX3 A;  3W0I A;  5E0W A;  3P8X A;  5KD9 A;  1T65 A;  5AVL A;  3ET2 A;  3VHU A;  1IE9 A;  3HO0 A;  3A2I A;  3W0Y A;  3UUD B;  1NHZ A;  4KZM A;  3F7D A;  4G20 A;  3CS8 A;  5E1C A;  3UUD A;  2PIU A;  4YMQ A;  3FEI A;  3A9E B;  2I4J A;  2OZ7 A;  3B3K A;  4N5G A;  2ZMI A;  2QXS A;  1I37 A;  3CWD A;  2IOG A;  3KBA A;  3P0U A;  4K4J A;  3B67 A;  4OZR U;  1XIU A;  3AZ2 A;  3GWX A;  4MG6 A;  4R2U A;  5DU5 A;  5E19 A;  1Y0S A;  3F5C B;  4A4V A;  3UU7 B;  2PRG A;  2OUZ A;  1I7G A;  3UU7 A;  1FCX A;  3ADW A;  3W0C A;  4CSJ A;  2QGW A;  3AUQ A;  3FC6 B;  4IWF A;  1YP0 A;  3JZC A;  4ZOM A;  1P8D A;  4S0T A;  4DK8 A;  5KRO A;  3DT3 A;  5FQT A;  4OKW A;  2VV1 B;  2FSZ A;  2G0H A;  3ZQT A;  4R06 A;  5DSH A;  1SKX A;  5DXP A;  5KR9 A;  3UUC A;  4TV1 A;  1SQN A;  3W0A A;  2XKW A;  3UVV A;  3L03 A;  1P93 A;  4ZI1 A;  1TFC A;  1RJK A;  2P54 A;  4REF A;  4A2J A;  5KRL A;  1UPV A;  3PBA A;  2OM9 A;  2PKL A;  2VV2 A;  4DMA A;  1YJE A;  1NQ2 A;  3ZRA A;  2Q7K A;  5HYR A;  3ET0 A;  3ET1 A;  2QTU A;  1NUO A;  3VRV A;  5GIC A;  5IXK A;  5DKB A;  2ZY0 A;  2BJ4 B;  2GL8 A;  2PJL A;  4N1Y A;  3GD2 A;  4DOR A;  2ZNN A;  2BJ4 A;  2Z4J A;  2O4J A;  2P4Y A;  4MGA B;  4Y29 A;  2HB7 A;  3Q95 B;  3RLL A;  4MG8 B;  4OJ4 A;  3O1E A;  4MGA A;  5KCW A;  3VT5 A;  5KYA A;  4MGB B;  4MG8 A;  3IPS A;  2Q5G A;  5APJ A;  4ZNV A;  1SJ0 A;  4ZNS A;  4MGB A;  3GN8 A;  5E7V A;  3G8O A;  3WGP A;  5HZC A;  2ZK4 A;  2JFA A;  1MV9 A;  3CLD A;  3IA6 A;  4JYG A;  1PDU A;  3OS8 C;  3P89 A;  3V9V A;  1S19 A;  5AAV B;  3OLL A;  5DV3 A;  4POJ A;  2ZXN A;  2Q6R A;  2IHQ A;  4HLW A;  4XI3 A;  3A2J A;  4RZE A;  5AK2 A;  3V4A A;  4OFU A;  2VV0 A;  5FQP A;  3K6P A;  3D5F A;  1FM6 D;  3DZU A;  2AX8 A;  3VTB A;  4FGY A;  4UDB A;  2ZVT A;  1S9Q A;  2AA7 A;  2P1V A;  4RUO X;  4UDA A;  1HJ1 A;  2QPY A;  5DWE A;  2J14 A;  1NQ7 A;  1YMT A;  4OHA A;  3OLS A;  5A86 A;  4OJ9 A;  3B0T A;  5DID A;  5G46 A;  2OAX A;  2GP7 A;  5KRJ A;  1Z5X U;  5KCF A;  1Y0X X;  4YT1 A;  3L3X A;  2OVH A;  1M2Z A;  2AX9 A;  5M96 A;  2AMB A;  3V49 A;  3PEQ A;  1Z5X E;  3KDU A;  4RZF A;  4PXM A;  2BAW A;  4NY9 A;  5KRA A;  1U9E A;  3R5M A;  2HBH A;  3ADU A;  5DRJ A;  2J7X A;  3OKI A;  4ONI A;  3GYU A;  1ZKY A;  5AWK A;  4YPQ A;  3WJ5 A;  2ZK0 A;  4K7A A;  2AX6 A;  1XQ3 A;  1G1U A;  2QE4 A;  2R6Y A;  5KRK A;  1X78 A;  2FVJ A;  4J24 A;  2AA6 A;  5DWJ A;  2HAS A;  5DKS A;  4OAR A;  4G1Z A;  2PIQ A;  5AZV A;  5DWL A;  1N46 A;  4EMA A;  1QKU A;  4RME A;  3CQV A;  3PRG A;  1ZDT A;  3B0R A;  3VT3 A;  2PIP L;  3GBK A;  4WLB A;  2Q1H A;  3PCU A;  3E00 D;  5KCU A;  2GWX A;  3UUA B;  5L7H A;  3D6D A;  4OEZ A;  3CTB A;  5DP0 A;  3G9E A;  3UUA A;  3VJH A;  5KRF A;  4ZN9 A;  1YYE A;  3HC5 A;  4MG5 A;  2G5O A;  2NXX E;  1KKQ A;  2ZK5 A;  2VSR A;  3HVL A;  3OAP A;  3FS1 A;  3KMG A;  1OSH A;  2P7Z A;  1XV9 A;  4PLE A;  5DXB B;  5HCV A;  1Q4X A;  4IUI A;  3OSW A;  2ZXZ A;  2ZK3 A;  1ZAF A;  2B50 A;  2Q6S A;  1HG4 A;  3U9Q A;  5HYK A;  1NQ0 A;  5KCD A;  5C4O A;  5I4V A;  1XB7 A;  1WM0 X;  1DB1 A;  1X7E A;  2XYJ A;  3X1I A;  2HB8 A;  3L0E A;  2QA6 A;  5DK9 A;  4QJR A;  2ZBS A;  2GIU A;  1S0Z A;  1T63 A;  1A28 A;  4E4Q A;  4UDC A;  3MNP A;  3ADX A;  1RKH A;  1K74 A;  3A9E A;  4O8F A;  4R6S A;  1X7J A;  2Q6J A;  3R5N A;  4XHD A;  1XZX X;  3E00 A;  5DUH A;  2I4P A;  1NYX A;  1R5K A;  3BC5 A;  4IW8 A;  4OGH A;  4OEA A;  5DZ0 A;  2XYX A;  4JYI A;  2ZNP A;  3VT4 A;  3KWY A;  4IWC A;  3F5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...