5KROA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with the methyl(phenyl)amino-substituted estrogen, (8r,9s,13s,14s,17s)-13-methyl-17-(methyl(phenyl)amino)-7,8,9,11,12,13,14,15,16,17-decahydro-6h-cyclopenta[a]phenanthren-3-ol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
243
structure length
229
Chain Sequence
LALSLTADQMVSALLDAEPPILYSEYRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 229
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kroA00
2PIPL 4G1ZA 1OVLB 3V9YA 3IXPA 5M96A 1QKNA 3AX8A 3O1EA 1U9EA 3GD2A 3RUUA 2NPAA 3DZYD 2PIRA 2ZXMA 4MG7A 2HB7A 3B66A 1T63A 2OVHA 3A2HA 3ADTA 4G2IA 4PP6A 4XT9A 4Q0AC 1YJEA 4IWCA 1PDUA 4DOSA 5KCDA 1XNNA 3D5FA 1XQCA 1I38A 4Q13A 5DKGA 5JJMA 1ILGA 5DVCA 3VSOA 4ONIA 1ZEOA 3ET0A 4ZOMA 4IA2A 2AX6A 5DWEA 4IA3A 3R29A 3V3EA 2NXXE 3RLLA 4FHHA 4CI4A 3OOKA 4ZO1B 2Q7IA 1GWRA 4KZJA 3VJHA 2HCDA 3OSIA 1UHLA 4REEA 1QKTA 3W0GA 4J24A 3K8SA 2IOGA 5E0XA 1K4WA 1MZNA 5DXBB 2AMBA 4R2UA 3HZFA 1SJ0A 3UUDB 1L2JA 2OUZA 2Q59B 2Q7KA 2ZXZA 3VT9A 3W0CA 4Q50A 1ZAFA 4RAKA 5EC9A 3SP6A 2J7XA 4N73A 4M8HA 4L98A 5KCEA 4J5XC 1DKFA 3FC6A 1XLSA 3FEJA 4S14A 3ADSA 1UPWA 2Q1HA 3SZ1A 5B5BA 3TKCA 2I4JA 4XUHA 2GP7A 4S15A 5A86A 5DMFA 1OVLA 4RUJA 1R20D 4J26A 3CS6A 2PRGA 1XZXX 1TXIA 4NB6A 4IVYA 3MNPA 2R40D 4LTWA 4L96A 3OKHA 3L0EA 4JGVA 3B5RA 1P93A 1T73A 2Q5PA 4OHAA 3G8OA 4OEDA 2P15A 3LMPA 4JYGA 4N8RA 2Q7LA 2ZK0A 5DXQA 1PQ9A 1X7EA 5DMCA 3K22A 4E4KA 3KMRA 3CJWA 3DZUD 4PLEA 5HCVA 3A2JA 4YPQA 4R06A 5DZIA 2QE4A 2Q8SA 5AYGA 1G2NA 4OIUA 1XJ7A 2QMVA 3FURA 1KNUA 4OLMA 4ZNUA 4APUA 4OZRU 3HQ5A 1RKGA 3VHWA 5DYBA 1FCXA 2QZOA 2ZK1A 4G1YA 5DXBA 5G5WA 3KMGA 4B7WA 2G0HA 4RMCA 2GPPA 2Q59A 4QM0A 5DKSA 3V49A 3V9TA 3VT8A 2YATA 5DXGA 5APHA 3SP9A 4LSJA 3N00A 2ZK4A 1T74A 2PINA 3L0JA 3CLDA 3ADWA 1FM9A 2P7ZA 3QT0A 4OFRA 3VT3A 1YY4A 1XP9A 4N5GA 1M13A 3A78A 4JYIA 2GPUA 3DCTA 2QXMA 1XPCA 2JJ3A 3H0AD 4ZNHA 5DZHA 3WFGA 4EMAA 4TV1B 2A3IA 1ZDUA 3OZ0A 2OVMA 3ET3A 4WHGA 4CI5A 1FBYA 5DWIA 4A2JA 3DZYA 4NQAB 1XDKB 2J14A 1XQ3A 3GBKA 2V0VA 3L3XA 2EWPA 3TX7B 3R5NA 1E3KA 5KRHA 2P7GA 5DIEA 1T7RA 5G46A 2AA2A 4X1FA 5APJA 2HVCA 1FCZA 2QNVA 3K6PA 5KYJA 1Y0SA 1SKXA 1ZUCA 5JY3A 4MGBB 2AX8A 2PIWA 5DWGA 5IXKA 1Q4XA 4QK4A 3IPSA 3VSPA 2ZL9A 4ZN7A 4S0SA 2QABA 4YNKA 2P4YA 2Z4JA 3HVLA 2G5OA 5DXPA 1G1UA 3VTBA 5DX3B 2QH6A 3L3ZA 4OZTU 2GL8A 3R8DA 1YYEA 2E2RA 5KCFA 3ADVA 3OMMA 4OKTA 1U3SA 3V9VA 4IW8A 1EXAA 5DKBA 3ZRBA 4RE8A 5C4SA 2FSZA 4K4JA 3L1BA 3R2AA 3VI8A 2Q3YA 4OZTE 2OM9A 2POBA 1BSXA 1YOWA 4G2HA 1NQ0A 2IOKA 3GWXA 4LNXA 3ADUA 1NUOA 5E15A 3TKMA 4YT1A 2Q6SA 3OS8A 5E7VA 4DORA 4PVUA 5GICA 1T7TA 4TV1A 3BQDA 4J5WA 4OIVA 3OLLA 4XI3A 1R20A 4MGCA 3B67A 4ZNWA 4OILA 3X1HA 1XVPB 2VV2A 4DM6A 1M7WA 4NIEA 3PCUA 4PP5A 5G42A 2HWRA 5HYKA 1X7JA 2R40A 2YFEA 5AAVB 1KV6A 1XP1A 4ZNVA 2QXSA 2YJAB 3VT5A 4ITEA 2ZVTA 3UU7B 4DMAA 3H52A 5EGVA 2P1UA 5DV6A 5EI1A 3FEIA 2LBDA 2AWHA 4MGBA 2NXXA 3RVFA 3DZUA 5DWJA 4RZFA 4TUZB 5DZ3A 5KRAA 2ABIA 1IE9A 3LBDA 3A3ZX 3W0HA 5KCUA 5DZ1A 1K7LA 1U3RA 5KYAA 2AX7A 1T7FA 1PK5A 3D6DA 5DX3A 3ZR7A 2ATHA 4G1DA 1H9UA 3AFRA 4K7AA 4P6XA 2B1ZA 3HC6A 1P8DA 1YIMA 1NQ7A 1XV9B 2VV0A 3CQVA 4OK1A 1HJ1A 4RUPA 1E3GA 3X36A 5DIGA 4OKBA 5L11A 3IPQA 4P6WA 3V3QA 2Q5GA 1RK3A 3DT3A 4IA7A 3OMKA 4MG9B 2NW4A 5KR9A 2AYRA 2VSRA 1RKHA 4LBDA 4PWLA 4XTAA 5GT4A 4ZJRA 2AA6A 2XYXA 4MGDB 1XIUA 3KDTA 3H0AA 3A9EB 4RUOX 2XHSA 1PQCA 4RWVA 3VJSA 3V4AA 1N4HA 4POHA 4IW6A 1XNXA 1FM6D 5IAWA 5KRKA 1XB7A 4IV2A 1OT7A 3VRVA 1N83A 4PPPA 5AAVA 5SYZA 2VV3A 5ETHA 3WT7A 3AZ2A 3F5CB 5DXRA 2HBHA 4ZI1A 4JL4A 3MNOA 1NAXA 3UU7A 1RDTD 4WQPA 4EM9A 3Q95B 5KD9A 2AO6A 1UOMA 3NOAA 4M8EA 3JZBA 3BEJA 2PIXA 3PBAA 4ZO1X 4TUZA 1LV2A 2OZ7A 3R8IA 4E4QA 3CS8A 1EREA 1A28A 4QJRA 5FQSA 3UVVB 3WTQA 1NQ1A 5EJVA 4MG8B 3NSPA 5IZ0A 2H77A 1R5KA 1UPVA 4UDAA 5KRLA 5DU5A 5AK2A 2ZK5A 3BC5A 3AN3A 2XYWA 5AZTA 4IQRA 1YMTA 3UUDA 2POGA 2PIOA 1XV9A 3D24A 1PQ6A 4OFUA 5DLRA 4OKXA 1NHZA 2G0GA 4OZRE 4RFWA 5L7HA 2AXAA 2GIUA 2QPYA 5DYDA 3JZCA 5I4VA 2YLQA 4MG9A 4X1GA 5KCCA 3G0WA 3B0TA 4WHFA 3UUCA 4ZN9A 5GIEA 2O4RA 2R6YA 4MGDA 1Z5XU 3A9EA 1R6GA 3GWSX 2HFPA 3NSQA 3CDSA 3OGTA 1KKQA 5DKEA 4DQMA 3GYUA 2HWQA 2ZNOA 3L03A 5C4TA 2HAMA 2ZMIA 1NRLA 3B0RA 2W8YA 5DRJA 1SQNA 3F5CA 1K74D 3F7DA 3WWRA 3OLFA 3W0IA 3ERTA 3W5QA 3GZ9A 3W0YA 2QW4A 5KRCA 2GTKA 3B68A 3OKIA 1I37A 2QTUA 3WT6A 3Q95A 2ZK3A 5H1EA 4G21A 1Z95A 3R5MA 1S9PA 3VTCA 5EITA 5L7EA 5E14A 3UVVA 3VJTA 4MG8A 1FD0A 2OAXA 3L0LA 4N1YA 2AMAA 1Y9RA 1HG4A 3OAPA 3OMPA 2YHDA 3A2IA 3OS8C 1LBDA 5FQVA 4J5WC 4F9MA 2AM9A 4WPFA 3HM1A 3W5TA 4ZNTA 1I7IA 4IWFA 3VRTA 2HARA 4OARA 4RZGA 1YP0A 3UUAB 2HB8A 1TFCA 3PEQA 5L7GA 4ITFA 3IA6A 4FHIA 4HLWA 4JYHA 2ZLCA 5E1CA 3AZ3A 2HC4A 1GWXA 2ZKCA 3AZ1A 2I0JA 2PIVA 5ICKA 3W5PA 3B65A 3M7RA 2PIUA 3ADXA 2P54A 4UDDA 5DXKA 3ZRAA 5AWKA 2YLYA 5HJSA 1XAPA 1YA3A 4UDCA 1T7MA 4IUIA 4WLBA 2ZY0A 2B1VA 4PRGA 2Q60A 5HZCA 1OSVA 3VN2A 1NQ2A 2JFAB 3HLVA 5DWLA 5GIDA 4HEEX 5DXMA 4OJBA 5FQTA 1L2IA 1XDKA 3P88A 2V7CA 4MG6A 4MG5A 3O1DA 3P8XA 1R1KD 3FALB 3DR1A 1RDTA 3K23A 4WVDA 4FN9A 2ZMJA 3WT5A 2I4ZA 4IV4A 4QE6A 4XLDA 5G43A 3HODA 3PRGA 2NV7A 3CS4A 3FXVA 3IPUA 3WJ5A 5G3JA 5G44A 1OSHA 2Q6RA 3W0JA 3WFFA 4BCRA 1T5ZA 1GS4A 4O8FA 5E19A 5DXEA 2G44A 5DSHA 2YJDA 4QE8A 2O9IA 2ACLB 2GWXA 5KRFA 3KBAA 2AA7A 3FUGA 1YUCA 3UUAA 5DV8A 5AAUA 2PIQA 5JI0D 5FQRA 1S0ZA 2R6WA 3U9QA 3E00D 2BAWA 2VV4B 1T76A 2I0GA 1DB1A 3AN4A 3B0QA 3ZQTA 2GPOA 3AUNA 1NAVA 3FS1A 4REFA 3S9SA 3VT7A 2YLPA 2JF9A 4IVWA 3ET1A 4XHDA 3WJ4A 1G50A 1YOKA 3ERDA 3VT4A 2PJLA 1ZDTA 5CJ6A 3P0UA 4DM8A 2BJ4B 1NDEA 1X78A 2ZLAA 4ZNSA 1S9QA 5DTVA 2XYJA 4PLDA 3VT6A 4FNEA 3W5RA 3T03A 4KZMA 3VJIA 2AB2A 2JFAA 1A52A 1XVPA 2QZOB 3VRUA 2XKWA 1T79A 2Q7JA 2HASA 4POJA 4OJ4A 1VJBA 2P7AA 5DZ0A 4YMQA 2O4JA 3D90A 1K74A 2B50A 2PNUA 2ZASA 3FALA 5EHJA 3OLSA 2ZFXA 3D57A 3KYTA 5DL4A 1Y0XX 2QA8B 4A4WA 2ZK6A 5KCTA 1S0XA 1XLSE 3EYBA 1NYXA 2PITA 4R6SA 3MNEA 4MGAB 3VHUA 3OMOA 5K13A 3IXPD 2Q6JA 4RZEA 2FVJA 3AUQA 1YINA 2J7YA 2ACLA 2Q5SA 2QR9A 3PO9A 5AZVA 3RUTA 1X76A 2VV4A 4J5XA 3HC5A 1EXXA 2REWA 4PXMA 1WM0X 3X1IA 3CTBA 1I7GA 3E7CA 3FLIA 3VRWA 4A4VA 4DK7A 3W0AA 2ZMHA 1ZGYA 5F9BA 3R8AA 4RMDA 4OKWA 1ILHA 2BJ4A 2PKLA 3CWDA 4OEZA 5KRIA 5LGAA 5C4UA 2ZBSA 2GPVA 4PF3A 2Q61A 2P1VA 4FGYA 3ET2A 5DRMA 5DIDA 3TY0A 1T65A 1GWQA 2H79A 4IS8A 3ILZA 4OGHA 5HJPB 1ZH7A 1XP6A 4OH5A 3CDPA 5AWJA 2I4PA 1Z5XE 3B1MA 1PZLA 1FCYA 5DY8A 2Q1VA 5KRJA 5DP0A 4LNWA 5B41A 5C4OA 1S19A 3GYTA 2F4BA 3OSAA 4XAOA 5AVIA 3UP3A 2B23A 4OC7A 1R1KA 1ERRA 5HYRA 2Z4BA 2QA8A 3DCUA 3KPZA 4OH6A 2QGWA 2AAXA 5DI7A 3OZJA 2YLOA 4MGAA 4Y29A 4MDDA 5DUEA 4RMEA 5DUGA 4OJ9A 5KROA 5E0WA 5KRMA 1QKUA 5LWPA 3OSWA 2VV1B 2FAIA 1G5YA 5ACCA 2ZK2A 3E94A 2Q70A 3OMQA 5DK9A 5DUHA 2QGTA 2ZNQA 2IHQA 3GN8A 1MV9A 1XOWA 5KCWA 3VTDA 3AURA 3G9EA 3HO0A 3IMYA 4E2JA 3OS9A 4K6IA 2QSEA 4CSJA 4MG7B 3B3KA 3E00A 4IU7A 3G8IA 2J4AA 3WGPA 2QA6A 4XUMA 5FQPA 3KWYA 5DVVA 1M2ZA 3VHVA 3KDUA 4JAZA 5JJMB 1PCGA 2ZNPA 1RJKA 4DK8A 5AVLA 1X7RA 3KMZA 4UDBA 3RY9A 4OEAA 1U3QA 2ZXNA 3RLJA 1IE8A 1UHLB 1FM6A 5HJPA 3KFCA 3PLZA 2P1TA 3WMHA 4ZJWA 4PP3A 1PRGA 3A40X 5G45A 4OEYA 1SR7A 3P89A 4NUFA 2VSTA 4S0TA 4NY9A 2ZNNA 2AA5A 5DV3A 1FM9D 3DY6A 4KZIA 3X31A 1DKFB 3FC6B 5APKA 1QKMA 5DVSA 3B0WA 1ZKYA 2OCFA 2AX9A 3UP0A 1X7BA 3OOFA 4QL8A 4G20A 1MVCA 1N46A 4PPSA 2VV1A 4IA1A
chains in the Genus database with same CATH superfamily
2PIPL 4G1ZA 1OVLB 3V9YA 3IXPA 5M96A 1QKNA 3AX8A 3O1EA 1U9EA 3GD2A 3RUUA 2NPAA 3DZYD 2PIRA 2ZXMA 4MG7A 2HB7A 3B66A 1T63A 2OVHA 3A2HA 3ADTA 4G2IA 4PP6A 4XT9A 4Q0AC 1YJEA 4IWCA 1PDUA 4DOSA 5KCDA 1XNNA 3D5FA 1XQCA 1I38A 4Q13A 5DKGA 5JJMA 1ILGA 5DVCA 3VSOA 4ONIA 1ZEOA 3ET0A 4ZOMA 4IA2A 2AX6A 5DWEA 4IA3A 3R29A 3V3EA 2NXXE 3RLLA 4FHHA 4CI4A 3OOKA 4ZO1B 2Q7IA 1GWRA 4KZJA 3VJHA 2HCDA 3OSIA 1UHLA 4REEA 1QKTA 3W0GA 4J24A 3K8SA 2IOGA 5E0XA 1K4WA 1MZNA 5DXBB 2AMBA 4R2UA 3HZFA 1SJ0A 3UUDB 1L2JA 2OUZA 2Q59B 2Q7KA 2ZXZA 3VT9A 3W0CA 4Q50A 1ZAFA 4RAKA 5EC9A 3SP6A 2J7XA 4N73A 4M8HA 4L98A 5KCEA 4J5XC 1DKFA 3FC6A 1XLSA 3FEJA 4S14A 3ADSA 1UPWA 2Q1HA 3SZ1A 5B5BA 3TKCA 2I4JA 4XUHA 2GP7A 4S15A 5A86A 5DMFA 1OVLA 4RUJA 1R20D 4J26A 3CS6A 2PRGA 1XZXX 1TXIA 4NB6A 4IVYA 3MNPA 2R40D 4LTWA 4L96A 3OKHA 3L0EA 4JGVA 3B5RA 1P93A 1T73A 2Q5PA 4OHAA 3G8OA 4OEDA 2P15A 3LMPA 4JYGA 4N8RA 2Q7LA 2ZK0A 5DXQA 1PQ9A 1X7EA 5DMCA 3K22A 4E4KA 3KMRA 3CJWA 3DZUD 4PLEA 5HCVA 3A2JA 4YPQA 4R06A 5DZIA 2QE4A 2Q8SA 5AYGA 1G2NA 4OIUA 1XJ7A 2QMVA 3FURA 1KNUA 4OLMA 4ZNUA 4APUA 4OZRU 3HQ5A 1RKGA 3VHWA 5DYBA 1FCXA 2QZOA 2ZK1A 4G1YA 5DXBA 5G5WA 3KMGA 4B7WA 2G0HA 4RMCA 2GPPA 2Q59A 4QM0A 5DKSA 3V49A 3V9TA 3VT8A 2YATA 5DXGA 5APHA 3SP9A 4LSJA 3N00A 2ZK4A 1T74A 2PINA 3L0JA 3CLDA 3ADWA 1FM9A 2P7ZA 3QT0A 4OFRA 3VT3A 1YY4A 1XP9A 4N5GA 1M13A 3A78A 4JYIA 2GPUA 3DCTA 2QXMA 1XPCA 2JJ3A 3H0AD 4ZNHA 5DZHA 3WFGA 4EMAA 4TV1B 2A3IA 1ZDUA 3OZ0A 2OVMA 3ET3A 4WHGA 4CI5A 1FBYA 5DWIA 4A2JA 3DZYA 4NQAB 1XDKB 2J14A 1XQ3A 3GBKA 2V0VA 3L3XA 2EWPA 3TX7B 3R5NA 1E3KA 5KRHA 2P7GA 5DIEA 1T7RA 5G46A 2AA2A 4X1FA 5APJA 2HVCA 1FCZA 2QNVA 3K6PA 5KYJA 1Y0SA 1SKXA 1ZUCA 5JY3A 4MGBB 2AX8A 2PIWA 5DWGA 5IXKA 1Q4XA 4QK4A 3IPSA 3VSPA 2ZL9A 4ZN7A 4S0SA 2QABA 4YNKA 2P4YA 2Z4JA 3HVLA 2G5OA 5DXPA 1G1UA 3VTBA 5DX3B 2QH6A 3L3ZA 4OZTU 2GL8A 3R8DA 1YYEA 2E2RA 5KCFA 3ADVA 3OMMA 4OKTA 1U3SA 3V9VA 4IW8A 1EXAA 5DKBA 3ZRBA 4RE8A 5C4SA 2FSZA 4K4JA 3L1BA 3R2AA 3VI8A 2Q3YA 4OZTE 2OM9A 2POBA 1BSXA 1YOWA 4G2HA 1NQ0A 2IOKA 3GWXA 4LNXA 3ADUA 1NUOA 5E15A 3TKMA 4YT1A 2Q6SA 3OS8A 5E7VA 4DORA 4PVUA 5GICA 1T7TA 4TV1A 3BQDA 4J5WA 4OIVA 3OLLA 4XI3A 1R20A 4MGCA 3B67A 4ZNWA 4OILA 3X1HA 1XVPB 2VV2A 4DM6A 1M7WA 4NIEA 3PCUA 4PP5A 5G42A 2HWRA 5HYKA 1X7JA 2R40A 2YFEA 5AAVB 1KV6A 1XP1A 4ZNVA 2QXSA 2YJAB 3VT5A 4ITEA 2ZVTA 3UU7B 4DMAA 3H52A 5EGVA 2P1UA 5DV6A 5EI1A 3FEIA 2LBDA 2AWHA 4MGBA 2NXXA 3RVFA 3DZUA 5DWJA 4RZFA 4TUZB 5DZ3A 5KRAA 2ABIA 1IE9A 3LBDA 3A3ZX 3W0HA 5KCUA 5DZ1A 1K7LA 1U3RA 5KYAA 2AX7A 1T7FA 1PK5A 3D6DA 5DX3A 3ZR7A 2ATHA 4G1DA 1H9UA 3AFRA 4K7AA 4P6XA 2B1ZA 3HC6A 1P8DA 1YIMA 1NQ7A 1XV9B 2VV0A 3CQVA 4OK1A 1HJ1A 4RUPA 1E3GA 3X36A 5DIGA 4OKBA 5L11A 3IPQA 4P6WA 3V3QA 2Q5GA 1RK3A 3DT3A 4IA7A 3OMKA 4MG9B 2NW4A 5KR9A 2AYRA 2VSRA 1RKHA 4LBDA 4PWLA 4XTAA 5GT4A 4ZJRA 2AA6A 2XYXA 4MGDB 1XIUA 3KDTA 3H0AA 3A9EB 4RUOX 2XHSA 1PQCA 4RWVA 3VJSA 3V4AA 1N4HA 4POHA 4IW6A 1XNXA 1FM6D 5IAWA 5KRKA 1XB7A 4IV2A 1OT7A 3VRVA 1N83A 4PPPA 5AAVA 5SYZA 2VV3A 5ETHA 3WT7A 3AZ2A 3F5CB 5DXRA 2HBHA 4ZI1A 4JL4A 3MNOA 1NAXA 3UU7A 1RDTD 4WQPA 4EM9A 3Q95B 5KD9A 2AO6A 1UOMA 3NOAA 4M8EA 3JZBA 3BEJA 2PIXA 3PBAA 4ZO1X 4TUZA 1LV2A 2OZ7A 3R8IA 4E4QA 3CS8A 1EREA 1A28A 4QJRA 5FQSA 3UVVB 3WTQA 1NQ1A 5EJVA 4MG8B 3NSPA 5IZ0A 2H77A 1R5KA 1UPVA 4UDAA 5KRLA 5DU5A 5AK2A 2ZK5A 3BC5A 3AN3A 2XYWA 5AZTA 4IQRA 1YMTA 3UUDA 2POGA 2PIOA 1XV9A 3D24A 1PQ6A 4OFUA 5DLRA 4OKXA 1NHZA 2G0GA 4OZRE 4RFWA 5L7HA 2AXAA 2GIUA 2QPYA 5DYDA 3JZCA 5I4VA 2YLQA 4MG9A 4X1GA 5KCCA 3G0WA 3B0TA 4WHFA 3UUCA 4ZN9A 5GIEA 2O4RA 2R6YA 4MGDA 1Z5XU 3A9EA 1R6GA 3GWSX 2HFPA 3NSQA 3CDSA 3OGTA 1KKQA 5DKEA 4DQMA 3GYUA 2HWQA 2ZNOA 3L03A 5C4TA 2HAMA 2ZMIA 1NRLA 3B0RA 2W8YA 5DRJA 1SQNA 3F5CA 1K74D 3F7DA 3WWRA 3OLFA 3W0IA 3ERTA 3W5QA 3GZ9A 3W0YA 2QW4A 5KRCA 2GTKA 3B68A 3OKIA 1I37A 2QTUA 3WT6A 3Q95A 2ZK3A 5H1EA 4G21A 1Z95A 3R5MA 1S9PA 3VTCA 5EITA 5L7EA 5E14A 3UVVA 3VJTA 4MG8A 1FD0A 2OAXA 3L0LA 4N1YA 2AMAA 1Y9RA 1HG4A 3OAPA 3OMPA 2YHDA 3A2IA 3OS8C 1LBDA 5FQVA 4J5WC 4F9MA 2AM9A 4WPFA 3HM1A 3W5TA 4ZNTA 1I7IA 4IWFA 3VRTA 2HARA 4OARA 4RZGA 1YP0A 3UUAB 2HB8A 1TFCA 3PEQA 5L7GA 4ITFA 3IA6A 4FHIA 4HLWA 4JYHA 2ZLCA 5E1CA 3AZ3A 2HC4A 1GWXA 2ZKCA 3AZ1A 2I0JA 2PIVA 5ICKA 3W5PA 3B65A 3M7RA 2PIUA 3ADXA 2P54A 4UDDA 5DXKA 3ZRAA 5AWKA 2YLYA 5HJSA 1XAPA 1YA3A 4UDCA 1T7MA 4IUIA 4WLBA 2ZY0A 2B1VA 4PRGA 2Q60A 5HZCA 1OSVA 3VN2A 1NQ2A 2JFAB 3HLVA 5DWLA 5GIDA 4HEEX 5DXMA 4OJBA 5FQTA 1L2IA 1XDKA 3P88A 2V7CA 4MG6A 4MG5A 3O1DA 3P8XA 1R1KD 3FALB 3DR1A 1RDTA 3K23A 4WVDA 4FN9A 2ZMJA 3WT5A 2I4ZA 4IV4A 4QE6A 4XLDA 5G43A 3HODA 3PRGA 2NV7A 3CS4A 3FXVA 3IPUA 3WJ5A 5G3JA 5G44A 1OSHA 2Q6RA 3W0JA 3WFFA 4BCRA 1T5ZA 1GS4A 4O8FA 5E19A 5DXEA 2G44A 5DSHA 2YJDA 4QE8A 2O9IA 2ACLB 2GWXA 5KRFA 3KBAA 2AA7A 3FUGA 1YUCA 3UUAA 5DV8A 5AAUA 2PIQA 5JI0D 5FQRA 1S0ZA 2R6WA 3U9QA 3E00D 2BAWA 2VV4B 1T76A 2I0GA 1DB1A 3AN4A 3B0QA 3ZQTA 2GPOA 3AUNA 1NAVA 3FS1A 4REFA 3S9SA 3VT7A 2YLPA 2JF9A 4IVWA 3ET1A 4XHDA 3WJ4A 1G50A 1YOKA 3ERDA 3VT4A 2PJLA 1ZDTA 5CJ6A 3P0UA 4DM8A 2BJ4B 1NDEA 1X78A 2ZLAA 4ZNSA 1S9QA 5DTVA 2XYJA 4PLDA 3VT6A 4FNEA 3W5RA 3T03A 4KZMA 3VJIA 2AB2A 2JFAA 1A52A 1XVPA 2QZOB 3VRUA 2XKWA 1T79A 2Q7JA 2HASA 4POJA 4OJ4A 1VJBA 2P7AA 5DZ0A 4YMQA 2O4JA 3D90A 1K74A 2B50A 2PNUA 2ZASA 3FALA 5EHJA 3OLSA 2ZFXA 3D57A 3KYTA 5DL4A 1Y0XX 2QA8B 4A4WA 2ZK6A 5KCTA 1S0XA 1XLSE 3EYBA 1NYXA 2PITA 4R6SA 3MNEA 4MGAB 3VHUA 3OMOA 5K13A 3IXPD 2Q6JA 4RZEA 2FVJA 3AUQA 1YINA 2J7YA 2ACLA 2Q5SA 2QR9A 3PO9A 5AZVA 3RUTA 1X76A 2VV4A 4J5XA 3HC5A 1EXXA 2REWA 4PXMA 1WM0X 3X1IA 3CTBA 1I7GA 3E7CA 3FLIA 3VRWA 4A4VA 4DK7A 3W0AA 2ZMHA 1ZGYA 5F9BA 3R8AA 4RMDA 4OKWA 1ILHA 2BJ4A 2PKLA 3CWDA 4OEZA 5KRIA 5LGAA 5C4UA 2ZBSA 2GPVA 4PF3A 2Q61A 2P1VA 4FGYA 3ET2A 5DRMA 5DIDA 3TY0A 1T65A 1GWQA 2H79A 4IS8A 3ILZA 4OGHA 5HJPB 1ZH7A 1XP6A 4OH5A 3CDPA 5AWJA 2I4PA 1Z5XE 3B1MA 1PZLA 1FCYA 5DY8A 2Q1VA 5KRJA 5DP0A 4LNWA 5B41A 5C4OA 1S19A 3GYTA 2F4BA 3OSAA 4XAOA 5AVIA 3UP3A 2B23A 4OC7A 1R1KA 1ERRA 5HYRA 2Z4BA 2QA8A 3DCUA 3KPZA 4OH6A 2QGWA 2AAXA 5DI7A 3OZJA 2YLOA 4MGAA 4Y29A 4MDDA 5DUEA 4RMEA 5DUGA 4OJ9A 5KROA 5E0WA 5KRMA 1QKUA 5LWPA 3OSWA 2VV1B 2FAIA 1G5YA 5ACCA 2ZK2A 3E94A 2Q70A 3OMQA 5DK9A 5DUHA 2QGTA 2ZNQA 2IHQA 3GN8A 1MV9A 1XOWA 5KCWA 3VTDA 3AURA 3G9EA 3HO0A 3IMYA 4E2JA 3OS9A 4K6IA 2QSEA 4CSJA 4MG7B 3B3KA 3E00A 4IU7A 3G8IA 2J4AA 3WGPA 2QA6A 4XUMA 5FQPA 3KWYA 5DVVA 1M2ZA 3VHVA 3KDUA 4JAZA 5JJMB 1PCGA 2ZNPA 1RJKA 4DK8A 5AVLA 1X7RA 3KMZA 4UDBA 3RY9A 4OEAA 1U3QA 2ZXNA 3RLJA 1IE8A 1UHLB 1FM6A 5HJPA 3KFCA 3PLZA 2P1TA 3WMHA 4ZJWA 4PP3A 1PRGA 3A40X 5G45A 4OEYA 1SR7A 3P89A 4NUFA 2VSTA 4S0TA 4NY9A 2ZNNA 2AA5A 5DV3A 1FM9D 3DY6A 4KZIA 3X31A 1DKFB 3FC6B 5APKA 1QKMA 5DVSA 3B0WA 1ZKYA 2OCFA 2AX9A 3UP0A 1X7BA 3OOFA 4QL8A 4G20A 1MVCA 1N46A 4PPSA 2VV1A 4IA1A
chains in the Genus database with same CATH topology
2PIPL 4G1ZA 1OVLB 3V9YA 3IXPA 5M96A 1QKNA 3AX8A 3O1EA 1U9EA 3GD2A 3RUUA 2NPAA 3DZYD 2PIRA 2ZXMA 4MG7A 2HB7A 3B66A 1T63A 2OVHA 3A2HA 3ADTA 4G2IA 4PP6A 4XT9A 4Q0AC 1YJEA 4IWCA 1PDUA 4DOSA 5KCDA 1XNNA 3D5FA 1XQCA 1I38A 4Q13A 5DKGA 5JJMA 1ILGA 5DVCA 3VSOA 4ONIA 1ZEOA 3ET0A 4ZOMA 4IA2A 2AX6A 5DWEA 4IA3A 3R29A 3V3EA 2NXXE 3RLLA 4FHHA 4CI4A 3OOKA 4ZO1B 2Q7IA 1GWRA 4KZJA 3VJHA 2HCDA 3OSIA 1UHLA 4REEA 1QKTA 3W0GA 4J24A 3K8SA 2IOGA 5E0XA 1K4WA 1MZNA 5DXBB 2AMBA 4R2UA 3HZFA 1SJ0A 3UUDB 1L2JA 2OUZA 2Q59B 2Q7KA 2ZXZA 3VT9A 3W0CA 4Q50A 1ZAFA 4RAKA 5EC9A 3SP6A 2J7XA 4N73A 4M8HA 4L98A 5KCEA 4J5XC 1DKFA 3FC6A 1XLSA 3FEJA 4S14A 3ADSA 1UPWA 2Q1HA 3SZ1A 5B5BA 3TKCA 2I4JA 4XUHA 2GP7A 4S15A 5A86A 5DMFA 1OVLA 4RUJA 1R20D 4J26A 3CS6A 2PRGA 1XZXX 1TXIA 4NB6A 4IVYA 3MNPA 2R40D 4LTWA 4L96A 3OKHA 3L0EA 4JGVA 3B5RA 1P93A 1T73A 2Q5PA 4OHAA 3G8OA 4OEDA 2P15A 3LMPA 4JYGA 4N8RA 2Q7LA 2ZK0A 5DXQA 1PQ9A 1X7EA 5DMCA 3K22A 4E4KA 3KMRA 3CJWA 3DZUD 4PLEA 5HCVA 3A2JA 4YPQA 4R06A 5DZIA 2QE4A 2Q8SA 5AYGA 1G2NA 4OIUA 1XJ7A 2QMVA 3FURA 1KNUA 4OLMA 4ZNUA 4APUA 4OZRU 3HQ5A 1RKGA 3VHWA 5DYBA 1FCXA 2QZOA 2ZK1A 4G1YA 5DXBA 5G5WA 3KMGA 4B7WA 2G0HA 4RMCA 2GPPA 2Q59A 4QM0A 5DKSA 3V49A 3V9TA 3VT8A 2YATA 5DXGA 5APHA 3SP9A 4LSJA 3N00A 2ZK4A 1T74A 2PINA 3L0JA 3CLDA 3ADWA 1FM9A 2P7ZA 3QT0A 4OFRA 3VT3A 1YY4A 1XP9A 4N5GA 1M13A 3A78A 4JYIA 2GPUA 3DCTA 2QXMA 1XPCA 2JJ3A 3H0AD 4ZNHA 5DZHA 3WFGA 4EMAA 4TV1B 2A3IA 1ZDUA 3OZ0A 2OVMA 3ET3A 4WHGA 4CI5A 1FBYA 5DWIA 4A2JA 3DZYA 4NQAB 1XDKB 2J14A 1XQ3A 3GBKA 2V0VA 3L3XA 2EWPA 3TX7B 3R5NA 1E3KA 5KRHA 2P7GA 5DIEA 1T7RA 5G46A 2AA2A 4X1FA 5APJA 2HVCA 1FCZA 2QNVA 3K6PA 5KYJA 1Y0SA 1SKXA 1ZUCA 5JY3A 4MGBB 2AX8A 2PIWA 5DWGA 5IXKA 1Q4XA 4QK4A 3IPSA 3VSPA 2ZL9A 4ZN7A 4S0SA 2QABA 4YNKA 2P4YA 2Z4JA 3HVLA 2G5OA 5DXPA 1G1UA 3VTBA 5DX3B 2QH6A 3L3ZA 4OZTU 2GL8A 3R8DA 1YYEA 2E2RA 5KCFA 3ADVA 3OMMA 4OKTA 1U3SA 3V9VA 4IW8A 1EXAA 5DKBA 3ZRBA 4RE8A 5C4SA 2FSZA 4K4JA 3L1BA 3R2AA 3VI8A 2Q3YA 4OZTE 2OM9A 2POBA 1BSXA 1YOWA 4G2HA 1NQ0A 2IOKA 3GWXA 4LNXA 3ADUA 1NUOA 5E15A 3TKMA 4YT1A 2Q6SA 3OS8A 5E7VA 4DORA 4PVUA 5GICA 1T7TA 4TV1A 3BQDA 4J5WA 4OIVA 3OLLA 4XI3A 1R20A 4MGCA 3B67A 4ZNWA 4OILA 3X1HA 1XVPB 2VV2A 4DM6A 1M7WA 4NIEA 3PCUA 4PP5A 5G42A 2HWRA 5HYKA 1X7JA 2R40A 2YFEA 5AAVB 1KV6A 1XP1A 4ZNVA 2QXSA 2YJAB 3VT5A 4ITEA 2ZVTA 3UU7B 4DMAA 3H52A 5EGVA 2P1UA 5DV6A 5EI1A 3FEIA 2LBDA 2AWHA 4MGBA 2NXXA 3RVFA 3DZUA 5DWJA 4RZFA 4TUZB 5DZ3A 5KRAA 2ABIA 1IE9A 3LBDA 3A3ZX 3W0HA 5KCUA 5DZ1A 1K7LA 1U3RA 5KYAA 2AX7A 1T7FA 1PK5A 3D6DA 5DX3A 3ZR7A 2ATHA 4G1DA 1H9UA 3AFRA 4K7AA 4P6XA 2B1ZA 3HC6A 1P8DA 1YIMA 1NQ7A 1XV9B 2VV0A 3CQVA 4OK1A 1HJ1A 4RUPA 1E3GA 3X36A 5DIGA 4OKBA 5L11A 3IPQA 4P6WA 3V3QA 2Q5GA 1RK3A 3DT3A 4IA7A 3OMKA 4MG9B 2NW4A 5KR9A 2AYRA 2VSRA 1RKHA 4LBDA 4PWLA 4XTAA 5GT4A 4ZJRA 2AA6A 2XYXA 4MGDB 1XIUA 3KDTA 3H0AA 3A9EB 4RUOX 2XHSA 1PQCA 4RWVA 3VJSA 3V4AA 1N4HA 4POHA 4IW6A 1XNXA 1FM6D 5IAWA 5KRKA 1XB7A 4IV2A 1OT7A 3VRVA 1N83A 4PPPA 5AAVA 5SYZA 2VV3A 5ETHA 3WT7A 3AZ2A 3F5CB 5DXRA 2HBHA 4ZI1A 4JL4A 3MNOA 1NAXA 3UU7A 1RDTD 4WQPA 4EM9A 3Q95B 5KD9A 2AO6A 1UOMA 3NOAA 4M8EA 3JZBA 3BEJA 2PIXA 3PBAA 4ZO1X 4TUZA 1LV2A 2OZ7A 3R8IA 4E4QA 3CS8A 1EREA 1A28A 4QJRA 5FQSA 3UVVB 3WTQA 1NQ1A 5EJVA 4MG8B 3NSPA 5IZ0A 2H77A 1R5KA 1UPVA 4UDAA 5KRLA 5DU5A 5AK2A 2ZK5A 3BC5A 3AN3A 2XYWA 5AZTA 4IQRA 1YMTA 3UUDA 2POGA 2PIOA 1XV9A 3D24A 1PQ6A 4OFUA 5DLRA 4OKXA 1NHZA 2G0GA 4OZRE 4RFWA 5L7HA 2AXAA 2GIUA 2QPYA 5DYDA 3JZCA 5I4VA 2YLQA 4MG9A 4X1GA 5KCCA 3G0WA 3B0TA 4WHFA 3UUCA 4ZN9A 5GIEA 2O4RA 2R6YA 4MGDA 1Z5XU 3A9EA 1R6GA 3GWSX 2HFPA 3NSQA 3CDSA 3OGTA 1KKQA 5DKEA 4DQMA 3GYUA 2HWQA 2ZNOA 3L03A 5C4TA 2HAMA 2ZMIA 1NRLA 3B0RA 2W8YA 5DRJA 1SQNA 3F5CA 1K74D 3F7DA 3WWRA 3OLFA 3W0IA 3ERTA 3W5QA 3GZ9A 3W0YA 2QW4A 5KRCA 2GTKA 3B68A 3OKIA 1I37A 2QTUA 3WT6A 3Q95A 2ZK3A 5H1EA 4G21A 1Z95A 3R5MA 1S9PA 3VTCA 5EITA 5L7EA 5E14A 3UVVA 3VJTA 4MG8A 1FD0A 2OAXA 3L0LA 4N1YA 2AMAA 1Y9RA 1HG4A 3OAPA 3OMPA 2YHDA 3A2IA 3OS8C 1LBDA 5FQVA 4J5WC 4F9MA 2AM9A 4WPFA 3HM1A 3W5TA 4ZNTA 1I7IA 4IWFA 3VRTA 2HARA 4OARA 4RZGA 1YP0A 3UUAB 2HB8A 1TFCA 3PEQA 5L7GA 4ITFA 3IA6A 4FHIA 4HLWA 4JYHA 2ZLCA 5E1CA 3AZ3A 2HC4A 1GWXA 2ZKCA 3AZ1A 2I0JA 2PIVA 5ICKA 3W5PA 3B65A 3M7RA 2PIUA 3ADXA 2P54A 4UDDA 5DXKA 3ZRAA 5AWKA 2YLYA 5HJSA 1XAPA 1YA3A 4UDCA 1T7MA 4IUIA 4WLBA 2ZY0A 2B1VA 4PRGA 2Q60A 5HZCA 1OSVA 3VN2A 1NQ2A 2JFAB 3HLVA 5DWLA 5GIDA 4HEEX 5DXMA 4OJBA 5FQTA 1L2IA 1XDKA 3P88A 2V7CA 4MG6A 4MG5A 3O1DA 3P8XA 1R1KD 3FALB 3DR1A 1RDTA 3K23A 4WVDA 4FN9A 2ZMJA 3WT5A 2I4ZA 4IV4A 4QE6A 4XLDA 5G43A 3HODA 3PRGA 2NV7A 3CS4A 3FXVA 3IPUA 3WJ5A 5G3JA 5G44A 1OSHA 2Q6RA 3W0JA 3WFFA 4BCRA 1T5ZA 1GS4A 4O8FA 5E19A 5DXEA 2G44A 5DSHA 2YJDA 4QE8A 2O9IA 2ACLB 2GWXA 5KRFA 3KBAA 2AA7A 3FUGA 1YUCA 3UUAA 5DV8A 5AAUA 2PIQA 5JI0D 5FQRA 1S0ZA 2R6WA 3U9QA 3E00D 2BAWA 2VV4B 1T76A 2I0GA 1DB1A 3AN4A 3B0QA 3ZQTA 2GPOA 3AUNA 1NAVA 3FS1A 4REFA 3S9SA 3VT7A 2YLPA 2JF9A 4IVWA 3ET1A 4XHDA 3WJ4A 1G50A 1YOKA 3ERDA 3VT4A 2PJLA 1ZDTA 5CJ6A 3P0UA 4DM8A 2BJ4B 1NDEA 1X78A 2ZLAA 4ZNSA 1S9QA 5DTVA 2XYJA 4PLDA 3VT6A 4FNEA 3W5RA 3T03A 4KZMA 3VJIA 2AB2A 2JFAA 1A52A 1XVPA 2QZOB 3VRUA 2XKWA 1T79A 2Q7JA 2HASA 4POJA 4OJ4A 1VJBA 2P7AA 5DZ0A 4YMQA 2O4JA 3D90A 1K74A 2B50A 2PNUA 2ZASA 3FALA 5EHJA 3OLSA 2ZFXA 3D57A 3KYTA 5DL4A 1Y0XX 2QA8B 4A4WA 2ZK6A 5KCTA 1S0XA 1XLSE 3EYBA 1NYXA 2PITA 4R6SA 3MNEA 4MGAB 3VHUA 3OMOA 5K13A 3IXPD 2Q6JA 4RZEA 2FVJA 3AUQA 1YINA 2J7YA 2ACLA 2Q5SA 2QR9A 3PO9A 5AZVA 3RUTA 1X76A 2VV4A 4J5XA 3HC5A 1EXXA 2REWA 4PXMA 1WM0X 3X1IA 3CTBA 1I7GA 3E7CA 3FLIA 3VRWA 4A4VA 4DK7A 3W0AA 2ZMHA 1ZGYA 5F9BA 3R8AA 4RMDA 4OKWA 1ILHA 2BJ4A 2PKLA 3CWDA 4OEZA 5KRIA 5LGAA 5C4UA 2ZBSA 2GPVA 4PF3A 2Q61A 2P1VA 4FGYA 3ET2A 5DRMA 5DIDA 3TY0A 1T65A 1GWQA 2H79A 4IS8A 3ILZA 4OGHA 5HJPB 1ZH7A 1XP6A 4OH5A 3CDPA 5AWJA 2I4PA 1Z5XE 3B1MA 1PZLA 1FCYA 5DY8A 2Q1VA 5KRJA 5DP0A 4LNWA 5B41A 5C4OA 1S19A 3GYTA 2F4BA 3OSAA 4XAOA 5AVIA 3UP3A 2B23A 4OC7A 1R1KA 1ERRA 5HYRA 2Z4BA 2QA8A 3DCUA 3KPZA 4OH6A 2QGWA 2AAXA 5DI7A 3OZJA 2YLOA 4MGAA 4Y29A 4MDDA 5DUEA 4RMEA 5DUGA 4OJ9A 5KROA 5E0WA 5KRMA 1QKUA 5LWPA 3OSWA 2VV1B 2FAIA 1G5YA 5ACCA 2ZK2A 3E94A 2Q70A 3OMQA 5DK9A 5DUHA 2QGTA 2ZNQA 2IHQA 3GN8A 1MV9A 1XOWA 5KCWA 3VTDA 3AURA 3G9EA 3HO0A 3IMYA 4E2JA 3OS9A 4K6IA 2QSEA 4CSJA 4MG7B 3B3KA 3E00A 4IU7A 3G8IA 2J4AA 3WGPA 2QA6A 4XUMA 5FQPA 3KWYA 5DVVA 1M2ZA 3VHVA 3KDUA 4JAZA 5JJMB 1PCGA 2ZNPA 1RJKA 4DK8A 5AVLA 1X7RA 3KMZA 4UDBA 3RY9A 4OEAA 1U3QA 2ZXNA 3RLJA 1IE8A 1UHLB 1FM6A 5HJPA 3KFCA 3PLZA 2P1TA 3WMHA 4ZJWA 4PP3A 1PRGA 3A40X 5G45A 4OEYA 1SR7A 3P89A 4NUFA 2VSTA 4S0TA 4NY9A 2ZNNA 2AA5A 5DV3A 1FM9D 3DY6A 4KZIA 3X31A 1DKFB 3FC6B 5APKA 1QKMA 5DVSA 3B0WA 1ZKYA 2OCFA 2AX9A 3UP0A 1X7BA 3OOFA 4QL8A 4G20A 1MVCA 1N46A 4PPSA 2VV1A 4IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIP L;  4G1Z A;  1OVL B;  3V9Y A;  3IXP A;  5M96 A;  1QKN A;  3AX8 A;  3O1E A;  1U9E A;  3GD2 A;  3RUU A;  2NPA A;  3DZY D;  2PIR A;  2ZXM A;  4MG7 A;  2HB7 A;  3B66 A;  1T63 A;  2OVH A;  3A2H A;  3ADT A;  4G2I A;  4PP6 A;  4XT9 A;  4Q0A C;  1YJE A;  4IWC A;  1PDU A;  4DOS A;  5KCD A;  1XNN A;  3D5F A;  1XQC A;  1I38 A;  4Q13 A;  5DKG A;  5JJM A;  1ILG A;  5DVC A;  3VSO A;  4ONI A;  1ZEO A;  3ET0 A;  4ZOM A;  4IA2 A;  2AX6 A;  5DWE A;  4IA3 A;  3R29 A;  3V3E A;  2NXX E;  3RLL A;  4FHH A;  4CI4 A;  3OOK A;  4ZO1 B;  2Q7I A;  1GWR A;  4KZJ A;  3VJH A;  2HCD A;  3OSI A;  1UHL A;  4REE A;  1QKT A;  3W0G A;  4J24 A;  3K8S A;  2IOG A;  5E0X A;  1K4W A;  1MZN A;  5DXB B;  2AMB A;  4R2U A;  3HZF A;  1SJ0 A;  3UUD B;  1L2J A;  2OUZ A;  2Q59 B;  2Q7K A;  2ZXZ A;  3VT9 A;  3W0C A;  4Q50 A;  1ZAF A;  4RAK A;  5EC9 A;  3SP6 A;  2J7X A;  4N73 A;  4M8H A;  4L98 A;  5KCE A;  4J5X C;  1DKF A;  3FC6 A;  1XLS A;  3FEJ A;  4S14 A;  3ADS A;  1UPW A;  2Q1H A;  3SZ1 A;  5B5B A;  3TKC A;  2I4J A;  4XUH A;  2GP7 A;  4S15 A;  5A86 A;  5DMF A;  1OVL A;  4RUJ A;  1R20 D;  4J26 A;  3CS6 A;  2PRG A;  1XZX X;  1TXI A;  4NB6 A;  4IVY A;  3MNP A;  2R40 D;  4LTW A;  4L96 A;  3OKH A;  3L0E A;  4JGV A;  3B5R A;  1P93 A;  1T73 A;  2Q5P A;  4OHA A;  3G8O A;  4OED A;  2P15 A;  3LMP A;  4JYG A;  4N8R A;  2Q7L A;  2ZK0 A;  5DXQ A;  1PQ9 A;  1X7E A;  5DMC A;  3K22 A;  4E4K A;  3KMR A;  3CJW A;  3DZU D;  4PLE A;  5HCV A;  3A2J A;  4YPQ A;  4R06 A;  5DZI A;  2QE4 A;  2Q8S A;  5AYG A;  1G2N A;  4OIU A;  1XJ7 A;  2QMV A;  3FUR A;  1KNU A;  4OLM A;  4ZNU A;  4APU A;  4OZR U;  3HQ5 A;  1RKG A;  3VHW A;  5DYB A;  1FCX A;  2QZO A;  2ZK1 A;  4G1Y A;  5DXB A;  5G5W A;  3KMG A;  4B7W A;  2G0H A;  4RMC A;  2GPP A;  2Q59 A;  4QM0 A;  5DKS A;  3V49 A;  3V9T A;  3VT8 A;  2YAT A;  5DXG A;  5APH A;  3SP9 A;  4LSJ A;  3N00 A;  2ZK4 A;  1T74 A;  2PIN A;  3L0J A;  3CLD A;  3ADW A;  1FM9 A;  2P7Z A;  3QT0 A;  4OFR A;  3VT3 A;  1YY4 A;  1XP9 A;  4N5G A;  1M13 A;  3A78 A;  4JYI A;  2GPU A;  3DCT A;  2QXM A;  1XPC A;  2JJ3 A;  3H0A D;  4ZNH A;  5DZH A;  3WFG A;  4EMA A;  4TV1 B;  2A3I A;  1ZDU A;  3OZ0 A;  2OVM A;  3ET3 A;  4WHG A;  4CI5 A;  1FBY A;  5DWI A;  4A2J A;  3DZY A;  4NQA B;  1XDK B;  2J14 A;  1XQ3 A;  3GBK A;  2V0V A;  3L3X A;  2EWP A;  3TX7 B;  3R5N A;  1E3K A;  5KRH A;  2P7G A;  5DIE A;  1T7R A;  5G46 A;  2AA2 A;  4X1F A;  5APJ A;  2HVC A;  1FCZ A;  2QNV A;  3K6P A;  5KYJ A;  1Y0S A;  1SKX A;  1ZUC A;  5JY3 A;  4MGB B;  2AX8 A;  2PIW A;  5DWG A;  5IXK A;  1Q4X A;  4QK4 A;  3IPS A;  3VSP A;  2ZL9 A;  4ZN7 A;  4S0S A;  2QAB A;  4YNK A;  2P4Y A;  2Z4J A;  3HVL A;  2G5O A;  5DXP A;  1G1U A;  3VTB A;  5DX3 B;  2QH6 A;  3L3Z A;  4OZT U;  2GL8 A;  3R8D A;  1YYE A;  2E2R A;  5KCF A;  3ADV A;  3OMM A;  4OKT A;  1U3S A;  3V9V A;  4IW8 A;  1EXA A;  5DKB A;  3ZRB A;  4RE8 A;  5C4S A;  2FSZ A;  4K4J A;  3L1B A;  3R2A A;  3VI8 A;  2Q3Y A;  4OZT E;  2OM9 A;  2POB A;  1BSX A;  1YOW A;  4G2H A;  1NQ0 A;  2IOK A;  3GWX A;  4LNX A;  3ADU A;  1NUO A;  5E15 A;  3TKM A;  4YT1 A;  2Q6S A;  3OS8 A;  5E7V A;  4DOR A;  4PVU A;  5GIC A;  1T7T A;  4TV1 A;  3BQD A;  4J5W A;  4OIV A;  3OLL A;  4XI3 A;  1R20 A;  4MGC A;  3B67 A;  4ZNW A;  4OIL A;  3X1H A;  1XVP B;  2VV2 A;  4DM6 A;  1M7W A;  4NIE A;  3PCU A;  4PP5 A;  5G42 A;  2HWR A;  5HYK A;  1X7J A;  2R40 A;  2YFE A;  5AAV B;  1KV6 A;  1XP1 A;  4ZNV A;  2QXS A;  2YJA B;  3VT5 A;  4ITE A;  2ZVT A;  3UU7 B;  4DMA A;  3H52 A;  5EGV A;  2P1U A;  5DV6 A;  5EI1 A;  3FEI A;  2LBD A;  2AWH A;  4MGB A;  2NXX A;  3RVF A;  3DZU A;  5DWJ A;  4RZF A;  4TUZ B;  5DZ3 A;  5KRA A;  2ABI A;  1IE9 A;  3LBD A;  3A3Z X;  3W0H A;  5KCU A;  5DZ1 A;  1K7L A;  1U3R A;  5KYA A;  2AX7 A;  1T7F A;  1PK5 A;  3D6D A;  5DX3 A;  3ZR7 A;  2ATH A;  4G1D A;  1H9U A;  3AFR A;  4K7A A;  4P6X A;  2B1Z A;  3HC6 A;  1P8D A;  1YIM A;  1NQ7 A;  1XV9 B;  2VV0 A;  3CQV A;  4OK1 A;  1HJ1 A;  4RUP A;  1E3G A;  3X36 A;  5DIG A;  4OKB A;  5L11 A;  3IPQ A;  4P6W A;  3V3Q A;  2Q5G A;  1RK3 A;  3DT3 A;  4IA7 A;  3OMK A;  4MG9 B;  2NW4 A;  5KR9 A;  2AYR A;  2VSR A;  1RKH A;  4LBD A;  4PWL A;  4XTA A;  5GT4 A;  4ZJR A;  2AA6 A;  2XYX A;  4MGD B;  1XIU A;  3KDT A;  3H0A A;  3A9E B;  4RUO X;  2XHS A;  1PQC A;  4RWV A;  3VJS A;  3V4A A;  1N4H A;  4POH A;  4IW6 A;  1XNX A;  1FM6 D;  5IAW A;  5KRK A;  1XB7 A;  4IV2 A;  1OT7 A;  3VRV A;  1N83 A;  4PPP A;  5AAV A;  5SYZ A;  2VV3 A;  5ETH A;  3WT7 A;  3AZ2 A;  3F5C B;  5DXR A;  2HBH A;  4ZI1 A;  4JL4 A;  3MNO A;  1NAX A;  3UU7 A;  1RDT D;  4WQP A;  4EM9 A;  3Q95 B;  5KD9 A;  2AO6 A;  1UOM A;  3NOA A;  4M8E A;  3JZB A;  3BEJ A;  2PIX A;  3PBA A;  4ZO1 X;  4TUZ A;  1LV2 A;  2OZ7 A;  3R8I A;  4E4Q A;  3CS8 A;  1ERE A;  1A28 A;  4QJR A;  5FQS A;  3UVV B;  3WTQ A;  1NQ1 A;  5EJV A;  4MG8 B;  3NSP A;  5IZ0 A;  2H77 A;  1R5K A;  1UPV A;  4UDA A;  5KRL A;  5DU5 A;  5AK2 A;  2ZK5 A;  3BC5 A;  3AN3 A;  2XYW A;  5AZT A;  4IQR A;  1YMT A;  3UUD A;  2POG A;  2PIO A;  1XV9 A;  3D24 A;  1PQ6 A;  4OFU A;  5DLR A;  4OKX A;  1NHZ A;  2G0G A;  4OZR E;  4RFW A;  5L7H A;  2AXA A;  2GIU A;  2QPY A;  5DYD A;  3JZC A;  5I4V A;  2YLQ A;  4MG9 A;  4X1G A;  5KCC A;  3G0W A;  3B0T A;  4WHF A;  3UUC A;  4ZN9 A;  5GIE A;  2O4R A;  2R6Y A;  4MGD A;  1Z5X U;  3A9E A;  1R6G A;  3GWS X;  2HFP A;  3NSQ A;  3CDS A;  3OGT A;  1KKQ A;  5DKE A;  4DQM A;  3GYU A;  2HWQ A;  2ZNO A;  3L03 A;  5C4T A;  2HAM A;  2ZMI A;  1NRL A;  3B0R A;  2W8Y A;  5DRJ A;  1SQN A;  3F5C A;  1K74 D;  3F7D A;  3WWR A;  3OLF A;  3W0I A;  3ERT A;  3W5Q A;  3GZ9 A;  3W0Y A;  2QW4 A;  5KRC A;  2GTK A;  3B68 A;  3OKI A;  1I37 A;  2QTU A;  3WT6 A;  3Q95 A;  2ZK3 A;  5H1E A;  4G21 A;  1Z95 A;  3R5M A;  1S9P A;  3VTC A;  5EIT A;  5L7E A;  5E14 A;  3UVV A;  3VJT A;  4MG8 A;  1FD0 A;  2OAX A;  3L0L A;  4N1Y A;  2AMA A;  1Y9R A;  1HG4 A;  3OAP A;  3OMP A;  2YHD A;  3A2I A;  3OS8 C;  1LBD A;  5FQV A;  4J5W C;  4F9M A;  2AM9 A;  4WPF A;  3HM1 A;  3W5T A;  4ZNT A;  1I7I A;  4IWF A;  3VRT A;  2HAR A;  4OAR A;  4RZG A;  1YP0 A;  3UUA B;  2HB8 A;  1TFC A;  3PEQ A;  5L7G A;  4ITF A;  3IA6 A;  4FHI A;  4HLW A;  4JYH A;  2ZLC A;  5E1C A;  3AZ3 A;  2HC4 A;  1GWX A;  2ZKC A;  3AZ1 A;  2I0J A;  2PIV A;  5ICK A;  3W5P A;  3B65 A;  3M7R A;  2PIU A;  3ADX A;  2P54 A;  4UDD A;  5DXK A;  3ZRA A;  5AWK A;  2YLY A;  5HJS A;  1XAP A;  1YA3 A;  4UDC A;  1T7M A;  4IUI A;  4WLB A;  2ZY0 A;  2B1V A;  4PRG A;  2Q60 A;  5HZC A;  1OSV A;  3VN2 A;  1NQ2 A;  2JFA B;  3HLV A;  5DWL A;  5GID A;  4HEE X;  5DXM A;  4OJB A;  5FQT A;  1L2I A;  1XDK A;  3P88 A;  2V7C A;  4MG6 A;  4MG5 A;  3O1D A;  3P8X A;  1R1K D;  3FAL B;  3DR1 A;  1RDT A;  3K23 A;  4WVD A;  4FN9 A;  2ZMJ A;  3WT5 A;  2I4Z A;  4IV4 A;  4QE6 A;  4XLD A;  5G43 A;  3HOD A;  3PRG A;  2NV7 A;  3CS4 A;  3FXV A;  3IPU A;  3WJ5 A;  5G3J A;  5G44 A;  1OSH A;  2Q6R A;  3W0J A;  3WFF A;  4BCR A;  1T5Z A;  1GS4 A;  4O8F A;  5E19 A;  5DXE A;  2G44 A;  5DSH A;  2YJD A;  4QE8 A;  2O9I A;  2ACL B;  2GWX A;  5KRF A;  3KBA A;  2AA7 A;  3FUG A;  1YUC A;  3UUA A;  5DV8 A;  5AAU A;  2PIQ A;  5JI0 D;  5FQR A;  1S0Z A;  2R6W A;  3U9Q A;  3E00 D;  2BAW A;  2VV4 B;  1T76 A;  2I0G A;  1DB1 A;  3AN4 A;  3B0Q A;  3ZQT A;  2GPO A;  3AUN A;  1NAV A;  3FS1 A;  4REF A;  3S9S A;  3VT7 A;  2YLP A;  2JF9 A;  4IVW A;  3ET1 A;  4XHD A;  3WJ4 A;  1G50 A;  1YOK A;  3ERD A;  3VT4 A;  2PJL A;  1ZDT A;  5CJ6 A;  3P0U A;  4DM8 A;  2BJ4 B;  1NDE A;  1X78 A;  2ZLA A;  4ZNS A;  1S9Q A;  5DTV A;  2XYJ A;  4PLD A;  3VT6 A;  4FNE A;  3W5R A;  3T03 A;  4KZM A;  3VJI A;  2AB2 A;  2JFA A;  1A52 A;  1XVP A;  2QZO B;  3VRU A;  2XKW A;  1T79 A;  2Q7J A;  2HAS A;  4POJ A;  4OJ4 A;  1VJB A;  2P7A A;  5DZ0 A;  4YMQ A;  2O4J A;  3D90 A;  1K74 A;  2B50 A;  2PNU A;  2ZAS A;  3FAL A;  5EHJ A;  3OLS A;  2ZFX A;  3D57 A;  3KYT A;  5DL4 A;  1Y0X X;  2QA8 B;  4A4W A;  2ZK6 A;  5KCT A;  1S0X A;  1XLS E;  3EYB A;  1NYX A;  2PIT A;  4R6S A;  3MNE A;  4MGA B;  3VHU A;  3OMO A;  5K13 A;  3IXP D;  2Q6J A;  4RZE A;  2FVJ A;  3AUQ A;  1YIN A;  2J7Y A;  2ACL A;  2Q5S A;  2QR9 A;  3PO9 A;  5AZV A;  3RUT A;  1X76 A;  2VV4 A;  4J5X A;  3HC5 A;  1EXX A;  2REW A;  4PXM A;  1WM0 X;  3X1I A;  3CTB A;  1I7G A;  3E7C A;  3FLI A;  3VRW A;  4A4V A;  4DK7 A;  3W0A A;  2ZMH A;  1ZGY A;  5F9B A;  3R8A A;  4RMD A;  4OKW A;  1ILH A;  2BJ4 A;  2PKL A;  3CWD A;  4OEZ A;  5KRI A;  5LGA A;  5C4U A;  2ZBS A;  2GPV A;  4PF3 A;  2Q61 A;  2P1V A;  4FGY A;  3ET2 A;  5DRM A;  5DID A;  3TY0 A;  1T65 A;  1GWQ A;  2H79 A;  4IS8 A;  3ILZ A;  4OGH A;  5HJP B;  1ZH7 A;  1XP6 A;  4OH5 A;  3CDP A;  5AWJ A;  2I4P A;  1Z5X E;  3B1M A;  1PZL A;  1FCY A;  5DY8 A;  2Q1V A;  5KRJ A;  5DP0 A;  4LNW A;  5B41 A;  5C4O A;  1S19 A;  3GYT A;  2F4B A;  3OSA A;  4XAO A;  5AVI A;  3UP3 A;  2B23 A;  4OC7 A;  1R1K A;  1ERR A;  5HYR A;  2Z4B A;  2QA8 A;  3DCU A;  3KPZ A;  4OH6 A;  2QGW A;  2AAX A;  5DI7 A;  3OZJ A;  2YLO A;  4MGA A;  4Y29 A;  4MDD A;  5DUE A;  4RME A;  5DUG A;  4OJ9 A;  5KRO A;  5E0W A;  5KRM A;  1QKU A;  5LWP A;  3OSW A;  2VV1 B;  2FAI A;  1G5Y A;  5ACC A;  2ZK2 A;  3E94 A;  2Q70 A;  3OMQ A;  5DK9 A;  5DUH A;  2QGT A;  2ZNQ A;  2IHQ A;  3GN8 A;  1MV9 A;  1XOW A;  5KCW A;  3VTD A;  3AUR A;  3G9E A;  3HO0 A;  3IMY A;  4E2J A;  3OS9 A;  4K6I A;  2QSE A;  4CSJ A;  4MG7 B;  3B3K A;  3E00 A;  4IU7 A;  3G8I A;  2J4A A;  3WGP A;  2QA6 A;  4XUM A;  5FQP A;  3KWY A;  5DVV A;  1M2Z A;  3VHV A;  3KDU A;  4JAZ A;  5JJM B;  1PCG A;  2ZNP A;  1RJK A;  4DK8 A;  5AVL A;  1X7R A;  3KMZ A;  4UDB A;  3RY9 A;  4OEA A;  1U3Q A;  2ZXN A;  3RLJ A;  1IE8 A;  1UHL B;  1FM6 A;  5HJP A;  3KFC A;  3PLZ A;  2P1T A;  3WMH A;  4ZJW A;  4PP3 A;  1PRG A;  3A40 X;  5G45 A;  4OEY A;  1SR7 A;  3P89 A;  4NUF A;  2VST A;  4S0T A;  4NY9 A;  2ZNN A;  2AA5 A;  5DV3 A;  1FM9 D;  3DY6 A;  4KZI A;  3X31 A;  1DKF B;  3FC6 B;  5APK A;  1QKM A;  5DVS A;  3B0W A;  1ZKY A;  2OCF A;  2AX9 A;  3UP0 A;  1X7B A;  3OOF A;  4QL8 A;  4G20 A;  1MVC A;  1N46 A;  4PPS A;  2VV1 A;  4IA1 A; 
#chains in the Genus database with same CATH topology
 2PIP L;  4G1Z A;  1OVL B;  3V9Y A;  3IXP A;  5M96 A;  1QKN A;  3AX8 A;  3O1E A;  1U9E A;  3GD2 A;  3RUU A;  2NPA A;  3DZY D;  2PIR A;  2ZXM A;  4MG7 A;  2HB7 A;  3B66 A;  1T63 A;  2OVH A;  3A2H A;  3ADT A;  4G2I A;  4PP6 A;  4XT9 A;  4Q0A C;  1YJE A;  4IWC A;  1PDU A;  4DOS A;  5KCD A;  1XNN A;  3D5F A;  1XQC A;  1I38 A;  4Q13 A;  5DKG A;  5JJM A;  1ILG A;  5DVC A;  3VSO A;  4ONI A;  1ZEO A;  3ET0 A;  4ZOM A;  4IA2 A;  2AX6 A;  5DWE A;  4IA3 A;  3R29 A;  3V3E A;  2NXX E;  3RLL A;  4FHH A;  4CI4 A;  3OOK A;  4ZO1 B;  2Q7I A;  1GWR A;  4KZJ A;  3VJH A;  2HCD A;  3OSI A;  1UHL A;  4REE A;  1QKT A;  3W0G A;  4J24 A;  3K8S A;  2IOG A;  5E0X A;  1K4W A;  1MZN A;  5DXB B;  2AMB A;  4R2U A;  3HZF A;  1SJ0 A;  3UUD B;  1L2J A;  2OUZ A;  2Q59 B;  2Q7K A;  2ZXZ A;  3VT9 A;  3W0C A;  4Q50 A;  1ZAF A;  4RAK A;  5EC9 A;  3SP6 A;  2J7X A;  4N73 A;  4M8H A;  4L98 A;  5KCE A;  4J5X C;  1DKF A;  3FC6 A;  1XLS A;  3FEJ A;  4S14 A;  3ADS A;  1UPW A;  2Q1H A;  3SZ1 A;  5B5B A;  3TKC A;  2I4J A;  4XUH A;  2GP7 A;  4S15 A;  5A86 A;  5DMF A;  1OVL A;  4RUJ A;  1R20 D;  4J26 A;  3CS6 A;  2PRG A;  1XZX X;  1TXI A;  4NB6 A;  4IVY A;  3MNP A;  2R40 D;  4LTW A;  4L96 A;  3OKH A;  3L0E A;  4JGV A;  3B5R A;  1P93 A;  1T73 A;  2Q5P A;  4OHA A;  3G8O A;  4OED A;  2P15 A;  3LMP A;  4JYG A;  4N8R A;  2Q7L A;  2ZK0 A;  5DXQ A;  1PQ9 A;  1X7E A;  5DMC A;  3K22 A;  4E4K A;  3KMR A;  3CJW A;  3DZU D;  4PLE A;  5HCV A;  3A2J A;  4YPQ A;  4R06 A;  5DZI A;  2QE4 A;  2Q8S A;  5AYG A;  1G2N A;  4OIU A;  1XJ7 A;  2QMV A;  3FUR A;  1KNU A;  4OLM A;  4ZNU A;  4APU A;  4OZR U;  3HQ5 A;  1RKG A;  3VHW A;  5DYB A;  1FCX A;  2QZO A;  2ZK1 A;  4G1Y A;  5DXB A;  5G5W A;  3KMG A;  4B7W A;  2G0H A;  4RMC A;  2GPP A;  2Q59 A;  4QM0 A;  5DKS A;  3V49 A;  3V9T A;  3VT8 A;  2YAT A;  5DXG A;  5APH A;  3SP9 A;  4LSJ A;  3N00 A;  2ZK4 A;  1T74 A;  2PIN A;  3L0J A;  3CLD A;  3ADW A;  1FM9 A;  2P7Z A;  3QT0 A;  4OFR A;  3VT3 A;  1YY4 A;  1XP9 A;  4N5G A;  1M13 A;  3A78 A;  4JYI A;  2GPU A;  3DCT A;  2QXM A;  1XPC A;  2JJ3 A;  3H0A D;  4ZNH A;  5DZH A;  3WFG A;  4EMA A;  4TV1 B;  2A3I A;  1ZDU A;  3OZ0 A;  2OVM A;  3ET3 A;  4WHG A;  4CI5 A;  1FBY A;  5DWI A;  4A2J A;  3DZY A;  4NQA B;  1XDK B;  2J14 A;  1XQ3 A;  3GBK A;  2V0V A;  3L3X A;  2EWP A;  3TX7 B;  3R5N A;  1E3K A;  5KRH A;  2P7G A;  5DIE A;  1T7R A;  5G46 A;  2AA2 A;  4X1F A;  5APJ A;  2HVC A;  1FCZ A;  2QNV A;  3K6P A;  5KYJ A;  1Y0S A;  1SKX A;  1ZUC A;  5JY3 A;  4MGB B;  2AX8 A;  2PIW A;  5DWG A;  5IXK A;  1Q4X A;  4QK4 A;  3IPS A;  3VSP A;  2ZL9 A;  4ZN7 A;  4S0S A;  2QAB A;  4YNK A;  2P4Y A;  2Z4J A;  3HVL A;  2G5O A;  5DXP A;  1G1U A;  3VTB A;  5DX3 B;  2QH6 A;  3L3Z A;  4OZT U;  2GL8 A;  3R8D A;  1YYE A;  2E2R A;  5KCF A;  3ADV A;  3OMM A;  4OKT A;  1U3S A;  3V9V A;  4IW8 A;  1EXA A;  5DKB A;  3ZRB A;  4RE8 A;  5C4S A;  2FSZ A;  4K4J A;  3L1B A;  3R2A A;  3VI8 A;  2Q3Y A;  4OZT E;  2OM9 A;  2POB A;  1BSX A;  1YOW A;  4G2H A;  1NQ0 A;  2IOK A;  3GWX A;  4LNX A;  3ADU A;  1NUO A;  5E15 A;  3TKM A;  4YT1 A;  2Q6S A;  3OS8 A;  5E7V A;  4DOR A;  4PVU A;  5GIC A;  1T7T A;  4TV1 A;  3BQD A;  4J5W A;  4OIV A;  3OLL A;  4XI3 A;  1R20 A;  4MGC A;  3B67 A;  4ZNW A;  4OIL A;  3X1H A;  1XVP B;  2VV2 A;  4DM6 A;  1M7W A;  4NIE A;  3PCU A;  4PP5 A;  5G42 A;  2HWR A;  5HYK A;  1X7J A;  2R40 A;  2YFE A;  5AAV B;  1KV6 A;  1XP1 A;  4ZNV A;  2QXS A;  2YJA B;  3VT5 A;  4ITE A;  2ZVT A;  3UU7 B;  4DMA A;  3H52 A;  5EGV A;  2P1U A;  5DV6 A;  5EI1 A;  3FEI A;  2LBD A;  2AWH A;  4MGB A;  2NXX A;  3RVF A;  3DZU A;  5DWJ A;  4RZF A;  4TUZ B;  5DZ3 A;  5KRA A;  2ABI A;  1IE9 A;  3LBD A;  3A3Z X;  3W0H A;  5KCU A;  5DZ1 A;  1K7L A;  1U3R A;  5KYA A;  2AX7 A;  1T7F A;  1PK5 A;  3D6D A;  5DX3 A;  3ZR7 A;  2ATH A;  4G1D A;  1H9U A;  3AFR A;  4K7A A;  4P6X A;  2B1Z A;  3HC6 A;  1P8D A;  1YIM A;  1NQ7 A;  1XV9 B;  2VV0 A;  3CQV A;  4OK1 A;  1HJ1 A;  4RUP A;  1E3G A;  3X36 A;  5DIG A;  4OKB A;  5L11 A;  3IPQ A;  4P6W A;  3V3Q A;  2Q5G A;  1RK3 A;  3DT3 A;  4IA7 A;  3OMK A;  4MG9 B;  2NW4 A;  5KR9 A;  2AYR A;  2VSR A;  1RKH A;  4LBD A;  4PWL A;  4XTA A;  5GT4 A;  4ZJR A;  2AA6 A;  2XYX A;  4MGD B;  1XIU A;  3KDT A;  3H0A A;  3A9E B;  4RUO X;  2XHS A;  1PQC A;  4RWV A;  3VJS A;  3V4A A;  1N4H A;  4POH A;  4IW6 A;  1XNX A;  1FM6 D;  5IAW A;  5KRK A;  1XB7 A;  4IV2 A;  1OT7 A;  3VRV A;  1N83 A;  4PPP A;  5AAV A;  5SYZ A;  2VV3 A;  5ETH A;  3WT7 A;  3AZ2 A;  3F5C B;  5DXR A;  2HBH A;  4ZI1 A;  4JL4 A;  3MNO A;  1NAX A;  3UU7 A;  1RDT D;  4WQP A;  4EM9 A;  3Q95 B;  5KD9 A;  2AO6 A;  1UOM A;  3NOA A;  4M8E A;  3JZB A;  3BEJ A;  2PIX A;  3PBA A;  4ZO1 X;  4TUZ A;  1LV2 A;  2OZ7 A;  3R8I A;  4E4Q A;  3CS8 A;  1ERE A;  1A28 A;  4QJR A;  5FQS A;  3UVV B;  3WTQ A;  1NQ1 A;  5EJV A;  4MG8 B;  3NSP A;  5IZ0 A;  2H77 A;  1R5K A;  1UPV A;  4UDA A;  5KRL A;  5DU5 A;  5AK2 A;  2ZK5 A;  3BC5 A;  3AN3 A;  2XYW A;  5AZT A;  4IQR A;  1YMT A;  3UUD A;  2POG A;  2PIO A;  1XV9 A;  3D24 A;  1PQ6 A;  4OFU A;  5DLR A;  4OKX A;  1NHZ A;  2G0G A;  4OZR E;  4RFW A;  5L7H A;  2AXA A;  2GIU A;  2QPY A;  5DYD A;  3JZC A;  5I4V A;  2YLQ A;  4MG9 A;  4X1G A;  5KCC A;  3G0W A;  3B0T A;  4WHF A;  3UUC A;  4ZN9 A;  5GIE A;  2O4R A;  2R6Y A;  4MGD A;  1Z5X U;  3A9E A;  1R6G A;  3GWS X;  2HFP A;  3NSQ A;  3CDS A;  3OGT A;  1KKQ A;  5DKE A;  4DQM A;  3GYU A;  2HWQ A;  2ZNO A;  3L03 A;  5C4T A;  2HAM A;  2ZMI A;  1NRL A;  3B0R A;  2W8Y A;  5DRJ A;  1SQN A;  3F5C A;  1K74 D;  3F7D A;  3WWR A;  3OLF A;  3W0I A;  3ERT A;  3W5Q A;  3GZ9 A;  3W0Y A;  2QW4 A;  5KRC A;  2GTK A;  3B68 A;  3OKI A;  1I37 A;  2QTU A;  3WT6 A;  3Q95 A;  2ZK3 A;  5H1E A;  4G21 A;  1Z95 A;  3R5M A;  1S9P A;  3VTC A;  5EIT A;  5L7E A;  5E14 A;  3UVV A;  3VJT A;  4MG8 A;  1FD0 A;  2OAX A;  3L0L A;  4N1Y A;  2AMA A;  1Y9R A;  1HG4 A;  3OAP A;  3OMP A;  2YHD A;  3A2I A;  3OS8 C;  1LBD A;  5FQV A;  4J5W C;  4F9M A;  2AM9 A;  4WPF A;  3HM1 A;  3W5T A;  4ZNT A;  1I7I A;  4IWF A;  3VRT A;  2HAR A;  4OAR A;  4RZG A;  1YP0 A;  3UUA B;  2HB8 A;  1TFC A;  3PEQ A;  5L7G A;  4ITF A;  3IA6 A;  4FHI A;  4HLW A;  4JYH A;  2ZLC A;  5E1C A;  3AZ3 A;  2HC4 A;  1GWX A;  2ZKC A;  3AZ1 A;  2I0J A;  2PIV A;  5ICK A;  3W5P A;  3B65 A;  3M7R A;  2PIU A;  3ADX A;  2P54 A;  4UDD A;  5DXK A;  3ZRA A;  5AWK A;  2YLY A;  5HJS A;  1XAP A;  1YA3 A;  4UDC A;  1T7M A;  4IUI A;  4WLB A;  2ZY0 A;  2B1V A;  4PRG A;  2Q60 A;  5HZC A;  1OSV A;  3VN2 A;  1NQ2 A;  2JFA B;  3HLV A;  5DWL A;  5GID A;  4HEE X;  5DXM A;  4OJB A;  5FQT A;  1L2I A;  1XDK A;  3P88 A;  2V7C A;  4MG6 A;  4MG5 A;  3O1D A;  3P8X A;  1R1K D;  3FAL B;  3DR1 A;  1RDT A;  3K23 A;  4WVD A;  4FN9 A;  2ZMJ A;  3WT5 A;  2I4Z A;  4IV4 A;  4QE6 A;  4XLD A;  5G43 A;  3HOD A;  3PRG A;  2NV7 A;  3CS4 A;  3FXV A;  3IPU A;  3WJ5 A;  5G3J A;  5G44 A;  1OSH A;  2Q6R A;  3W0J A;  3WFF A;  4BCR A;  1T5Z A;  1GS4 A;  4O8F A;  5E19 A;  5DXE A;  2G44 A;  5DSH A;  2YJD A;  4QE8 A;  2O9I A;  2ACL B;  2GWX A;  5KRF A;  3KBA A;  2AA7 A;  3FUG A;  1YUC A;  3UUA A;  5DV8 A;  5AAU A;  2PIQ A;  5JI0 D;  5FQR A;  1S0Z A;  2R6W A;  3U9Q A;  3E00 D;  2BAW A;  2VV4 B;  1T76 A;  2I0G A;  1DB1 A;  3AN4 A;  3B0Q A;  3ZQT A;  2GPO A;  3AUN A;  1NAV A;  3FS1 A;  4REF A;  3S9S A;  3VT7 A;  2YLP A;  2JF9 A;  4IVW A;  3ET1 A;  4XHD A;  3WJ4 A;  1G50 A;  1YOK A;  3ERD A;  3VT4 A;  2PJL A;  1ZDT A;  5CJ6 A;  3P0U A;  4DM8 A;  2BJ4 B;  1NDE A;  1X78 A;  2ZLA A;  4ZNS A;  1S9Q A;  5DTV A;  2XYJ A;  4PLD A;  3VT6 A;  4FNE A;  3W5R A;  3T03 A;  4KZM A;  3VJI A;  2AB2 A;  2JFA A;  1A52 A;  1XVP A;  2QZO B;  3VRU A;  2XKW A;  1T79 A;  2Q7J A;  2HAS A;  4POJ A;  4OJ4 A;  1VJB A;  2P7A A;  5DZ0 A;  4YMQ A;  2O4J A;  3D90 A;  1K74 A;  2B50 A;  2PNU A;  2ZAS A;  3FAL A;  5EHJ A;  3OLS A;  2ZFX A;  3D57 A;  3KYT A;  5DL4 A;  1Y0X X;  2QA8 B;  4A4W A;  2ZK6 A;  5KCT A;  1S0X A;  1XLS E;  3EYB A;  1NYX A;  2PIT A;  4R6S A;  3MNE A;  4MGA B;  3VHU A;  3OMO A;  5K13 A;  3IXP D;  2Q6J A;  4RZE A;  2FVJ A;  3AUQ A;  1YIN A;  2J7Y A;  2ACL A;  2Q5S A;  2QR9 A;  3PO9 A;  5AZV A;  3RUT A;  1X76 A;  2VV4 A;  4J5X A;  3HC5 A;  1EXX A;  2REW A;  4PXM A;  1WM0 X;  3X1I A;  3CTB A;  1I7G A;  3E7C A;  3FLI A;  3VRW A;  4A4V A;  4DK7 A;  3W0A A;  2ZMH A;  1ZGY A;  5F9B A;  3R8A A;  4RMD A;  4OKW A;  1ILH A;  2BJ4 A;  2PKL A;  3CWD A;  4OEZ A;  5KRI A;  5LGA A;  5C4U A;  2ZBS A;  2GPV A;  4PF3 A;  2Q61 A;  2P1V A;  4FGY A;  3ET2 A;  5DRM A;  5DID A;  3TY0 A;  1T65 A;  1GWQ A;  2H79 A;  4IS8 A;  3ILZ A;  4OGH A;  5HJP B;  1ZH7 A;  1XP6 A;  4OH5 A;  3CDP A;  5AWJ A;  2I4P A;  1Z5X E;  3B1M A;  1PZL A;  1FCY A;  5DY8 A;  2Q1V A;  5KRJ A;  5DP0 A;  4LNW A;  5B41 A;  5C4O A;  1S19 A;  3GYT A;  2F4B A;  3OSA A;  4XAO A;  5AVI A;  3UP3 A;  2B23 A;  4OC7 A;  1R1K A;  1ERR A;  5HYR A;  2Z4B A;  2QA8 A;  3DCU A;  3KPZ A;  4OH6 A;  2QGW A;  2AAX A;  5DI7 A;  3OZJ A;  2YLO A;  4MGA A;  4Y29 A;  4MDD A;  5DUE A;  4RME A;  5DUG A;  4OJ9 A;  5KRO A;  5E0W A;  5KRM A;  1QKU A;  5LWP A;  3OSW A;  2VV1 B;  2FAI A;  1G5Y A;  5ACC A;  2ZK2 A;  3E94 A;  2Q70 A;  3OMQ A;  5DK9 A;  5DUH A;  2QGT A;  2ZNQ A;  2IHQ A;  3GN8 A;  1MV9 A;  1XOW A;  5KCW A;  3VTD A;  3AUR A;  3G9E A;  3HO0 A;  3IMY A;  4E2J A;  3OS9 A;  4K6I A;  2QSE A;  4CSJ A;  4MG7 B;  3B3K A;  3E00 A;  4IU7 A;  3G8I A;  2J4A A;  3WGP A;  2QA6 A;  4XUM A;  5FQP A;  3KWY A;  5DVV A;  1M2Z A;  3VHV A;  3KDU A;  4JAZ A;  5JJM B;  1PCG A;  2ZNP A;  1RJK A;  4DK8 A;  5AVL A;  1X7R A;  3KMZ A;  4UDB A;  3RY9 A;  4OEA A;  1U3Q A;  2ZXN A;  3RLJ A;  1IE8 A;  1UHL B;  1FM6 A;  5HJP A;  3KFC A;  3PLZ A;  2P1T A;  3WMH A;  4ZJW A;  4PP3 A;  1PRG A;  3A40 X;  5G45 A;  4OEY A;  1SR7 A;  3P89 A;  4NUF A;  2VST A;  4S0T A;  4NY9 A;  2ZNN A;  2AA5 A;  5DV3 A;  1FM9 D;  3DY6 A;  4KZI A;  3X31 A;  1DKF B;  3FC6 B;  5APK A;  1QKM A;  5DVS A;  3B0W A;  1ZKY A;  2OCF A;  2AX9 A;  3UP0 A;  1X7B A;  3OOF A;  4QL8 A;  4G20 A;  1MVC A;  1N46 A;  4PPS A;  2VV1 A;  4IA1 A; 
#chains in the Genus database with same CATH homology
 2PIP L;  4G1Z A;  1OVL B;  3V9Y A;  3IXP A;  5M96 A;  1QKN A;  3AX8 A;  3O1E A;  1U9E A;  3GD2 A;  3RUU A;  2NPA A;  3DZY D;  2PIR A;  2ZXM A;  4MG7 A;  2HB7 A;  3B66 A;  1T63 A;  2OVH A;  3A2H A;  3ADT A;  4G2I A;  4PP6 A;  4XT9 A;  4Q0A C;  1YJE A;  4IWC A;  1PDU A;  4DOS A;  5KCD A;  1XNN A;  3D5F A;  1XQC A;  1I38 A;  4Q13 A;  5DKG A;  5JJM A;  1ILG A;  5DVC A;  3VSO A;  4ONI A;  1ZEO A;  3ET0 A;  4ZOM A;  4IA2 A;  2AX6 A;  5DWE A;  4IA3 A;  3R29 A;  3V3E A;  2NXX E;  3RLL A;  4FHH A;  4CI4 A;  3OOK A;  4ZO1 B;  2Q7I A;  1GWR A;  4KZJ A;  3VJH A;  2HCD A;  3OSI A;  1UHL A;  4REE A;  1QKT A;  3W0G A;  4J24 A;  3K8S A;  2IOG A;  5E0X A;  1K4W A;  1MZN A;  5DXB B;  2AMB A;  4R2U A;  3HZF A;  1SJ0 A;  3UUD B;  1L2J A;  2OUZ A;  2Q59 B;  2Q7K A;  2ZXZ A;  3VT9 A;  3W0C A;  4Q50 A;  1ZAF A;  4RAK A;  5EC9 A;  3SP6 A;  2J7X A;  4N73 A;  4M8H A;  4L98 A;  5KCE A;  4J5X C;  1DKF A;  3FC6 A;  1XLS A;  3FEJ A;  4S14 A;  3ADS A;  1UPW A;  2Q1H A;  3SZ1 A;  5B5B A;  3TKC A;  2I4J A;  4XUH A;  2GP7 A;  4S15 A;  5A86 A;  5DMF A;  1OVL A;  4RUJ A;  1R20 D;  4J26 A;  3CS6 A;  2PRG A;  1XZX X;  1TXI A;  4NB6 A;  4IVY A;  3MNP A;  2R40 D;  4LTW A;  4L96 A;  3OKH A;  3L0E A;  4JGV A;  3B5R A;  1P93 A;  1T73 A;  2Q5P A;  4OHA A;  3G8O A;  4OED A;  2P15 A;  3LMP A;  4JYG A;  4N8R A;  2Q7L A;  2ZK0 A;  5DXQ A;  1PQ9 A;  1X7E A;  5DMC A;  3K22 A;  4E4K A;  3KMR A;  3CJW A;  3DZU D;  4PLE A;  5HCV A;  3A2J A;  4YPQ A;  4R06 A;  5DZI A;  2QE4 A;  2Q8S A;  5AYG A;  1G2N A;  4OIU A;  1XJ7 A;  2QMV A;  3FUR A;  1KNU A;  4OLM A;  4ZNU A;  4APU A;  4OZR U;  3HQ5 A;  1RKG A;  3VHW A;  5DYB A;  1FCX A;  2QZO A;  2ZK1 A;  4G1Y A;  5DXB A;  5G5W A;  3KMG A;  4B7W A;  2G0H A;  4RMC A;  2GPP A;  2Q59 A;  4QM0 A;  5DKS A;  3V49 A;  3V9T A;  3VT8 A;  2YAT A;  5DXG A;  5APH A;  3SP9 A;  4LSJ A;  3N00 A;  2ZK4 A;  1T74 A;  2PIN A;  3L0J A;  3CLD A;  3ADW A;  1FM9 A;  2P7Z A;  3QT0 A;  4OFR A;  3VT3 A;  1YY4 A;  1XP9 A;  4N5G A;  1M13 A;  3A78 A;  4JYI A;  2GPU A;  3DCT A;  2QXM A;  1XPC A;  2JJ3 A;  3H0A D;  4ZNH A;  5DZH A;  3WFG A;  4EMA A;  4TV1 B;  2A3I A;  1ZDU A;  3OZ0 A;  2OVM A;  3ET3 A;  4WHG A;  4CI5 A;  1FBY A;  5DWI A;  4A2J A;  3DZY A;  4NQA B;  1XDK B;  2J14 A;  1XQ3 A;  3GBK A;  2V0V A;  3L3X A;  2EWP A;  3TX7 B;  3R5N A;  1E3K A;  5KRH A;  2P7G A;  5DIE A;  1T7R A;  5G46 A;  2AA2 A;  4X1F A;  5APJ A;  2HVC A;  1FCZ A;  2QNV A;  3K6P A;  5KYJ A;  1Y0S A;  1SKX A;  1ZUC A;  5JY3 A;  4MGB B;  2AX8 A;  2PIW A;  5DWG A;  5IXK A;  1Q4X A;  4QK4 A;  3IPS A;  3VSP A;  2ZL9 A;  4ZN7 A;  4S0S A;  2QAB A;  4YNK A;  2P4Y A;  2Z4J A;  3HVL A;  2G5O A;  5DXP A;  1G1U A;  3VTB A;  5DX3 B;  2QH6 A;  3L3Z A;  4OZT U;  2GL8 A;  3R8D A;  1YYE A;  2E2R A;  5KCF A;  3ADV A;  3OMM A;  4OKT A;  1U3S A;  3V9V A;  4IW8 A;  1EXA A;  5DKB A;  3ZRB A;  4RE8 A;  5C4S A;  2FSZ A;  4K4J A;  3L1B A;  3R2A A;  3VI8 A;  2Q3Y A;  4OZT E;  2OM9 A;  2POB A;  1BSX A;  1YOW A;  4G2H A;  1NQ0 A;  2IOK A;  3GWX A;  4LNX A;  3ADU A;  1NUO A;  5E15 A;  3TKM A;  4YT1 A;  2Q6S A;  3OS8 A;  5E7V A;  4DOR A;  4PVU A;  5GIC A;  1T7T A;  4TV1 A;  3BQD A;  4J5W A;  4OIV A;  3OLL A;  4XI3 A;  1R20 A;  4MGC A;  3B67 A;  4ZNW A;  4OIL A;  3X1H A;  1XVP B;  2VV2 A;  4DM6 A;  1M7W A;  4NIE A;  3PCU A;  4PP5 A;  5G42 A;  2HWR A;  5HYK A;  1X7J A;  2R40 A;  2YFE A;  5AAV B;  1KV6 A;  1XP1 A;  4ZNV A;  2QXS A;  2YJA B;  3VT5 A;  4ITE A;  2ZVT A;  3UU7 B;  4DMA A;  3H52 A;  5EGV A;  2P1U A;  5DV6 A;  5EI1 A;  3FEI A;  2LBD A;  2AWH A;  4MGB A;  2NXX A;  3RVF A;  3DZU A;  5DWJ A;  4RZF A;  4TUZ B;  5DZ3 A;  5KRA A;  2ABI A;  1IE9 A;  3LBD A;  3A3Z X;  3W0H A;  5KCU A;  5DZ1 A;  1K7L A;  1U3R A;  5KYA A;  2AX7 A;  1T7F A;  1PK5 A;  3D6D A;  5DX3 A;  3ZR7 A;  2ATH A;  4G1D A;  1H9U A;  3AFR A;  4K7A A;  4P6X A;  2B1Z A;  3HC6 A;  1P8D A;  1YIM A;  1NQ7 A;  1XV9 B;  2VV0 A;  3CQV A;  4OK1 A;  1HJ1 A;  4RUP A;  1E3G A;  3X36 A;  5DIG A;  4OKB A;  5L11 A;  3IPQ A;  4P6W A;  3V3Q A;  2Q5G A;  1RK3 A;  3DT3 A;  4IA7 A;  3OMK A;  4MG9 B;  2NW4 A;  5KR9 A;  2AYR A;  2VSR A;  1RKH A;  4LBD A;  4PWL A;  4XTA A;  5GT4 A;  4ZJR A;  2AA6 A;  2XYX A;  4MGD B;  1XIU A;  3KDT A;  3H0A A;  3A9E B;  4RUO X;  2XHS A;  1PQC A;  4RWV A;  3VJS A;  3V4A A;  1N4H A;  4POH A;  4IW6 A;  1XNX A;  1FM6 D;  5IAW A;  5KRK A;  1XB7 A;  4IV2 A;  1OT7 A;  3VRV A;  1N83 A;  4PPP A;  5AAV A;  5SYZ A;  2VV3 A;  5ETH A;  3WT7 A;  3AZ2 A;  3F5C B;  5DXR A;  2HBH A;  4ZI1 A;  4JL4 A;  3MNO A;  1NAX A;  3UU7 A;  1RDT D;  4WQP A;  4EM9 A;  3Q95 B;  5KD9 A;  2AO6 A;  1UOM A;  3NOA A;  4M8E A;  3JZB A;  3BEJ A;  2PIX A;  3PBA A;  4ZO1 X;  4TUZ A;  1LV2 A;  2OZ7 A;  3R8I A;  4E4Q A;  3CS8 A;  1ERE A;  1A28 A;  4QJR A;  5FQS A;  3UVV B;  3WTQ A;  1NQ1 A;  5EJV A;  4MG8 B;  3NSP A;  5IZ0 A;  2H77 A;  1R5K A;  1UPV A;  4UDA A;  5KRL A;  5DU5 A;  5AK2 A;  2ZK5 A;  3BC5 A;  3AN3 A;  2XYW A;  5AZT A;  4IQR A;  1YMT A;  3UUD A;  2POG A;  2PIO A;  1XV9 A;  3D24 A;  1PQ6 A;  4OFU A;  5DLR A;  4OKX A;  1NHZ A;  2G0G A;  4OZR E;  4RFW A;  5L7H A;  2AXA A;  2GIU A;  2QPY A;  5DYD A;  3JZC A;  5I4V A;  2YLQ A;  4MG9 A;  4X1G A;  5KCC A;  3G0W A;  3B0T A;  4WHF A;  3UUC A;  4ZN9 A;  5GIE A;  2O4R A;  2R6Y A;  4MGD A;  1Z5X U;  3A9E A;  1R6G A;  3GWS X;  2HFP A;  3NSQ A;  3CDS A;  3OGT A;  1KKQ A;  5DKE A;  4DQM A;  3GYU A;  2HWQ A;  2ZNO A;  3L03 A;  5C4T A;  2HAM A;  2ZMI A;  1NRL A;  3B0R A;  2W8Y A;  5DRJ A;  1SQN A;  3F5C A;  1K74 D;  3F7D A;  3WWR A;  3OLF A;  3W0I A;  3ERT A;  3W5Q A;  3GZ9 A;  3W0Y A;  2QW4 A;  5KRC A;  2GTK A;  3B68 A;  3OKI A;  1I37 A;  2QTU A;  3WT6 A;  3Q95 A;  2ZK3 A;  5H1E A;  4G21 A;  1Z95 A;  3R5M A;  1S9P A;  3VTC A;  5EIT A;  5L7E A;  5E14 A;  3UVV A;  3VJT A;  4MG8 A;  1FD0 A;  2OAX A;  3L0L A;  4N1Y A;  2AMA A;  1Y9R A;  1HG4 A;  3OAP A;  3OMP A;  2YHD A;  3A2I A;  3OS8 C;  1LBD A;  5FQV A;  4J5W C;  4F9M A;  2AM9 A;  4WPF A;  3HM1 A;  3W5T A;  4ZNT A;  1I7I A;  4IWF A;  3VRT A;  2HAR A;  4OAR A;  4RZG A;  1YP0 A;  3UUA B;  2HB8 A;  1TFC A;  3PEQ A;  5L7G A;  4ITF A;  3IA6 A;  4FHI A;  4HLW A;  4JYH A;  2ZLC A;  5E1C A;  3AZ3 A;  2HC4 A;  1GWX A;  2ZKC A;  3AZ1 A;  2I0J A;  2PIV A;  5ICK A;  3W5P A;  3B65 A;  3M7R A;  2PIU A;  3ADX A;  2P54 A;  4UDD A;  5DXK A;  3ZRA A;  5AWK A;  2YLY A;  5HJS A;  1XAP A;  1YA3 A;  4UDC A;  1T7M A;  4IUI A;  4WLB A;  2ZY0 A;  2B1V A;  4PRG A;  2Q60 A;  5HZC A;  1OSV A;  3VN2 A;  1NQ2 A;  2JFA B;  3HLV A;  5DWL A;  5GID A;  4HEE X;  5DXM A;  4OJB A;  5FQT A;  1L2I A;  1XDK A;  3P88 A;  2V7C A;  4MG6 A;  4MG5 A;  3O1D A;  3P8X A;  1R1K D;  3FAL B;  3DR1 A;  1RDT A;  3K23 A;  4WVD A;  4FN9 A;  2ZMJ A;  3WT5 A;  2I4Z A;  4IV4 A;  4QE6 A;  4XLD A;  5G43 A;  3HOD A;  3PRG A;  2NV7 A;  3CS4 A;  3FXV A;  3IPU A;  3WJ5 A;  5G3J A;  5G44 A;  1OSH A;  2Q6R A;  3W0J A;  3WFF A;  4BCR A;  1T5Z A;  1GS4 A;  4O8F A;  5E19 A;  5DXE A;  2G44 A;  5DSH A;  2YJD A;  4QE8 A;  2O9I A;  2ACL B;  2GWX A;  5KRF A;  3KBA A;  2AA7 A;  3FUG A;  1YUC A;  3UUA A;  5DV8 A;  5AAU A;  2PIQ A;  5JI0 D;  5FQR A;  1S0Z A;  2R6W A;  3U9Q A;  3E00 D;  2BAW A;  2VV4 B;  1T76 A;  2I0G A;  1DB1 A;  3AN4 A;  3B0Q A;  3ZQT A;  2GPO A;  3AUN A;  1NAV A;  3FS1 A;  4REF A;  3S9S A;  3VT7 A;  2YLP A;  2JF9 A;  4IVW A;  3ET1 A;  4XHD A;  3WJ4 A;  1G50 A;  1YOK A;  3ERD A;  3VT4 A;  2PJL A;  1ZDT A;  5CJ6 A;  3P0U A;  4DM8 A;  2BJ4 B;  1NDE A;  1X78 A;  2ZLA A;  4ZNS A;  1S9Q A;  5DTV A;  2XYJ A;  4PLD A;  3VT6 A;  4FNE A;  3W5R A;  3T03 A;  4KZM A;  3VJI A;  2AB2 A;  2JFA A;  1A52 A;  1XVP A;  2QZO B;  3VRU A;  2XKW A;  1T79 A;  2Q7J A;  2HAS A;  4POJ A;  4OJ4 A;  1VJB A;  2P7A A;  5DZ0 A;  4YMQ A;  2O4J A;  3D90 A;  1K74 A;  2B50 A;  2PNU A;  2ZAS A;  3FAL A;  5EHJ A;  3OLS A;  2ZFX A;  3D57 A;  3KYT A;  5DL4 A;  1Y0X X;  2QA8 B;  4A4W A;  2ZK6 A;  5KCT A;  1S0X A;  1XLS E;  3EYB A;  1NYX A;  2PIT A;  4R6S A;  3MNE A;  4MGA B;  3VHU A;  3OMO A;  5K13 A;  3IXP D;  2Q6J A;  4RZE A;  2FVJ A;  3AUQ A;  1YIN A;  2J7Y A;  2ACL A;  2Q5S A;  2QR9 A;  3PO9 A;  5AZV A;  3RUT A;  1X76 A;  2VV4 A;  4J5X A;  3HC5 A;  1EXX A;  2REW A;  4PXM A;  1WM0 X;  3X1I A;  3CTB A;  1I7G A;  3E7C A;  3FLI A;  3VRW A;  4A4V A;  4DK7 A;  3W0A A;  2ZMH A;  1ZGY A;  5F9B A;  3R8A A;  4RMD A;  4OKW A;  1ILH A;  2BJ4 A;  2PKL A;  3CWD A;  4OEZ A;  5KRI A;  5LGA A;  5C4U A;  2ZBS A;  2GPV A;  4PF3 A;  2Q61 A;  2P1V A;  4FGY A;  3ET2 A;  5DRM A;  5DID A;  3TY0 A;  1T65 A;  1GWQ A;  2H79 A;  4IS8 A;  3ILZ A;  4OGH A;  5HJP B;  1ZH7 A;  1XP6 A;  4OH5 A;  3CDP A;  5AWJ A;  2I4P A;  1Z5X E;  3B1M A;  1PZL A;  1FCY A;  5DY8 A;  2Q1V A;  5KRJ A;  5DP0 A;  4LNW A;  5B41 A;  5C4O A;  1S19 A;  3GYT A;  2F4B A;  3OSA A;  4XAO A;  5AVI A;  3UP3 A;  2B23 A;  4OC7 A;  1R1K A;  1ERR A;  5HYR A;  2Z4B A;  2QA8 A;  3DCU A;  3KPZ A;  4OH6 A;  2QGW A;  2AAX A;  5DI7 A;  3OZJ A;  2YLO A;  4MGA A;  4Y29 A;  4MDD A;  5DUE A;  4RME A;  5DUG A;  4OJ9 A;  5KRO A;  5E0W A;  5KRM A;  1QKU A;  5LWP A;  3OSW A;  2VV1 B;  2FAI A;  1G5Y A;  5ACC A;  2ZK2 A;  3E94 A;  2Q70 A;  3OMQ A;  5DK9 A;  5DUH A;  2QGT A;  2ZNQ A;  2IHQ A;  3GN8 A;  1MV9 A;  1XOW A;  5KCW A;  3VTD A;  3AUR A;  3G9E A;  3HO0 A;  3IMY A;  4E2J A;  3OS9 A;  4K6I A;  2QSE A;  4CSJ A;  4MG7 B;  3B3K A;  3E00 A;  4IU7 A;  3G8I A;  2J4A A;  3WGP A;  2QA6 A;  4XUM A;  5FQP A;  3KWY A;  5DVV A;  1M2Z A;  3VHV A;  3KDU A;  4JAZ A;  5JJM B;  1PCG A;  2ZNP A;  1RJK A;  4DK8 A;  5AVL A;  1X7R A;  3KMZ A;  4UDB A;  3RY9 A;  4OEA A;  1U3Q A;  2ZXN A;  3RLJ A;  1IE8 A;  1UHL B;  1FM6 A;  5HJP A;  3KFC A;  3PLZ A;  2P1T A;  3WMH A;  4ZJW A;  4PP3 A;  1PRG A;  3A40 X;  5G45 A;  4OEY A;  1SR7 A;  3P89 A;  4NUF A;  2VST A;  4S0T A;  4NY9 A;  2ZNN A;  2AA5 A;  5DV3 A;  1FM9 D;  3DY6 A;  4KZI A;  3X31 A;  1DKF B;  3FC6 B;  5APK A;  1QKM A;  5DVS A;  3B0W A;  1ZKY A;  2OCF A;  2AX9 A;  3UP0 A;  1X7B A;  3OOF A;  4QL8 A;  4G20 A;  1MVC A;  1N46 A;  4PPS A;  2VV1 A;  4IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...