5L7EA

Mcr in complex with ligand
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
248
structure length
243
Chain Sequence
SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKSQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Mineralocorticoid receptor
publication title Structure-Based Drug Design of Mineralocorticoid Receptor Antagonists to Explore Oxosteroid Receptor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 243
sequence length 248
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5l7eA00
1LV2A 4K7AA 3D24A 4MG7A 2Q61A 2JF9A 5FQVA 3OMKA 3GBKA 5C4TA 1RJKA 2JJ3A 3R2AA 5G42A 4XUHA 4G2HA 1FM9A 4Q0AC 2QR9A 5KCUA 4NB6A 5G46A 1G5YA 2H79A 4RUPA 1X7BA 1T79A 4WPFA 5DZ1A 4OEDA 5DL4A 2B1ZA 3CWDA 3VT7A 1YA3A 4JAZA 2J7YA 3FXVA 3H52A 5DKGA 5AVLA 5LGAA 1RK3A 5C4OA 4LBDA 3JZBA 3RUTA 2PIOA 2GPOA 1TXIA 1X78A 2QZOA 5C4SA 1T7RA 2QGTA 2J7XA 4REFA 4XLDA 3E00D 3LMPA 2ZK4A 1UHLB 3L0LA 1U3SA 4B7WA 3ADUA 1XAPA 5DRMA 1YOWA 3U9QA 4QE6A 5DUEA 1ILHA 3CS4A 2ZFXA 3DY6A 4ITEA 4N8RA 5DP0A 1XNNA 2AA2A 4ZO1B 4IA7A 3ADVA 4EM9A 3V4AA 2ZBSA 2EWPA 2O4JA 3E00A 3B1MA 5KCEA 5DXBB 5B41A 3R5MA 2GTKA 2R40D 4G1DA 4IW8A 2YFEA 2VV4B 4TV1A 5DYBA 2XYJA 4ZJWA 5KRHA 2PKLA 1EREA 2AA7A 1NYXA 3VTDA 1ZH7A 2NXXE 2Q59A 2YLYA 3B0TA 3HM1A 3FUGA 5IXKA 5KRMA 1YMTA 5FQTA 3VSPA 1UPWA 1R5KA 4OZRE 2Q70A 2ZNQA 3VJHA 4N73A 4OILA 2Q60A 3ERTA 4L98A 3OSWA 1U3RA 3VT9A 2IOGA 3D6DA 1I38A 3A2IA 3W5QA 4KZMA 2AA5A 5E19A 4O8FA 2Z4JA 1YINA 3A2JA 1PCGA 2GIUA 2PJLA 4JYIA 3HQ5A 2A3IA 3B67A 3W5RA 5G45A 2ZNPA 4E4KA 5KD9A 3KBAA 1KKQA 3OMOA 3OZ0A 4ZOMA 2P7GA 5DTVA 4OKBA 3WJ4A 5GICA 4DOSA 2HVCA 1XV9B 1R6GA 5E0XA 5DZ0A 5KYAA 2R6WA 1NHZA 3UUDA 5KRFA 5E14A 3B5RA 3W5PA 3B65A 4K6IA 5DU5A 2PIWA 3OGTA 3R29A 5KRLA 4XUMA 4Q13A 4YPQA 1N46A 3KMZA 3X1IA 5C4UA 4IVYA 2OM9A 3TKMA 2VV1B 1T63A 3IMYA 3FLIA 2Q6JA 3OS8A 3R8DA 2OUZA 1T7MA 1HJ1A 2P54A 1OVLB 2YJAB 3DT3A 1Y0SA 1M13A 1GWRA 5DX3A 5GIEA 1NQ1A 3Q95A 3W0JA 2AX7A 3E94A 3FS1A 4DK7A 1RDTD 4CI4A 5IZ0A 2OAXA 5DLRA 1XQ3A 1YUCA 2QXMA 2PIRA 5KROA 2ZLAA 4IA1A 4M8EA 5KRAA 4IWFA 3FALA 4ZO1X 1Y9RA 2AWHA 1N83A 5JJMB 3HO0A 1IE9A 2OCFA 2W8YA 1RDTA 3OLSA 3B66A 5M96A 4RFWA 4YNKA 4OEYA 3VT3A 3DCTA 1QKMA 1OSHA 2HARA 4DM8A 2P4YA 1ZUCA 2ZK1A 4DK8A 5KCFA 1Z5XU 3F5CB 4G20A 3UVVA 1XIUA 1GWXA 4J26A 3GN8A 4ZNWA 4RZFA 1XVPB 1GS4A 4IUIA 5APHA 4YT1A 3R8IA 1I7GA 2QSEA 3FEIA 2YLOA 4MG7B 1RKHA 3BC5A 2H77A 3VTBA 2R6YA 3KFCA 4XAOA 2ZK0A 2ZXNA 1XNXA 1BSXA 3QT0A 5E1CA 4WVDA 2AYRA 3VJIA 4OHAA 1T7FA 5KCWA 4YMQA 4EMAA 5AK2A 5G43A 5JJMA 4ONIA 5L7GA 5ICKA 4J5XA 1G50A 5DXRA 3KDUA 1DKFA 1XDKA 2PIUA 2POBA 1KV6A 4PPPA 2Q3YA 5DXGA 3DZYD 1A52A 1QKNA 3PEQA 5AWKA 1IE8A 3R5NA 3CDSA 5DUGA 3VT4A 3FEJA 3OLLA 2QZOB 4WHFA 4DORA 3T03A 2VV0A 5DWLA 4CSJA 3L1BA 2I4ZA 3IXPD 1XVPA 3IPQA 1S0XA 3M7RA 3DZYA 5DKBA 3VT5A 2NV7A 2ZMJA 1K74D 1UPVA 3X36A 3ET3A 5DZHA 4JL4A 5FQSA 4DM6A 1Y0XX 3S9SA 1PRGA 3IXPA 1PQCA 2B23A 2V7CA 3W0HA 4ZI1A 3G9EA 4TV1B 2ZNNA 4ZN7A 3MNOA 5E0WA 3X31A 1K74A 2IHQA 2Q59B 1S9QA 3HC6A 3ZQTA 4DMAA 3OLFA 2ABIA 2Q6SA 1NUOA 2PIQA 1FCYA 2P15A 4FNEA 3G8OA 4OZTE 3UP3A 5DIGA 3UU7A 4MG9A 1MZNA 3W0AA 3FC6B 5KCCA 1PZLA 5EHJA 2QGWA 2B50A 2XHSA 3D5FA 4HEEX 4HLWA 3W0IA 2AX9A 4P6WA 2I0GA 3PLZA 4RUOX 3OAPA 4OARA 4MG5A 2QTUA 3V49A 2YLPA 1L2IA 3L3ZA 3UUCA 4OKWA 1KNUA 2I4PA 1XJ7A 1S19A 4J5WC 4LNXA 2P1UA 2VV3A 3G8IA 4QJRA 4IA2A 1I7IA 3OSAA 4S14A 2HWRA 3VTCA 3UUDB 1OT7A 1DB1A 1NQ0A 4FHIA 2IOKA 4RZEA 2GPPA 4Q50A 4FN9A 2HWQA 3WMHA 5DIDA 4OK1A 3VI8A 1T73A 2Q8SA 5APJA 3X1HA 4NQAB 2AAXA 2ZL9A 5DUHA 3FC6A 4N1YA 3UUAA 4OH6A 3TKCA 5DYDA 2XYWA 3A9EA 4IV4A 5EJVA 5HYRA 1X7JA 2PINA 1ERRA 3WTQA 1YJEA 5DX3B 3RUUA 4PPSA 2PIXA 3PO9A 3B68A 3IPUA 3Q95B 3K22A 4KZJA 4XTAA 1LBDA 4MGDA 1PK5A 3WFFA 4ZNTA 2Z4BA 3AN3A 4OJBA 4OFUA 1YIMA 4XHDA 3CQVA 4JYHA 4PVUA 4NIEA 4NY9A 4OGHA 4Y29A 3V9YA 3W0YA 3FALB 5DVCA 2LBDA 3GZ9A 2ZK5A 4APUA 4DQMA 5KRIA 4OKXA 3LBDA 2G0GA 1U3QA 2HB7A 3CDPA 4ITFA 1PDUA 1ZKYA 3GWSX 4IVWA 3RVFA 3MNPA 4POJA 2NXXA 1QKTA 2QXSA 4MGAA 4BCRA 4E2JA 1T74A 4KZIA 1K7LA 3ILZA 5EI1A 3DR1A 3D57A 2AM9A 5E7VA 1YYEA 3A40X 3AURA 3UVVB 1T7TA 4WQPA 4ZNSA 1GWQA 3VT8A 2QPYA 4LNWA 3ET2A 3ET0A 1M7WA 1R20D 5JI0D 5DKSA 1XB7A 3VHWA 3G0WA 1XPCA 2QMVA 3FURA 3V9TA 3WT5A 2QA8A 2AB2A 3ET1A 5ACCA 2ZK6A 3OS8C 3SZ1A 2GP7A 3VRTA 2Q5PA 1SJ0A 1YY4A 1FCZA 5G5WA 4OFRA 4RZGA 3AUNA 1DKFB 1XDKB 1EXAA 1R20A 3ADWA 2ZMHA 3K8SA 3AZ3A 1P93A 3NOAA 1ZAFA 1A28A 3PCUA 4G21A 1FM6D 4IU7A 4QE8A 5DY8A 1XZXX 2ZY0A 3ZRBA 5KCTA 5HZCA 1R1KD 3DZUD 3BQDA 4IS8A 3OMMA 5L7EA 2GL8A 5DWEA 4IQRA 4NUFA 2P1VA 1NQ7A 1ZDTA 4A4WA 1FM6A 1WM0X 2REWA 4POHA 5DV6A 3VRUA 4OLMA 4WHGA 5EC9A 1PQ6A 3KPZA 1G2NA 2G5OA 3L0JA 2OVMA 4LSJA 1R1KA 3P8XA 4OZRU 3DZUA 4OIVA 2PIVA 1N4HA 4PP5A 2Q6RA 4TUZA 1XQCA 4G2IA 3V9VA 2HB8A 3PBAA 3CLDA 5B5BA 4ZNVA 5AAVB 5L11A 3ADSA 2J14A 3GD2A 4RUJA 4L96A 4PLDA 3OS9A 2AX6A 3A78A 4RMCA 2AXAA 4PXMA 3UU7B 2VSRA 4PP6A 4RWVA 4MG9B 5F9BA 3VSOA 2AX8A 3WFGA 2QW4A 4MG8A 2POGA 2NW4A 2VV2A 3P0UA 5GT4A 1FBYA 5DWJA 5HJPB 1XP9A 4UDAA 3B0WA 4FHHA 4X1GA 1OSVA 3ZR7A 3HVLA 2ACLA 4J5XC 1FCXA 3W5TA 1NDEA 3VRVA 5AZVA 1HG4A 2I0JA 4ZNUA 5FQPA 4R2UA 3CTBA 3L3XA 4RAKA 3KYTA 5AAVA 2BJ4A 2PNUA 2HC4A 2V0VA 3WJ5A 2QABA 5ETHA 3RY9A 1YOKA 2ZMIA 1G1UA 4R6SA 3UUAB 3VHUA 5DMCA 3VHVA 2OVHA 3OMQA 4OJ4A 5HJPA 3A9EB 3KMRA 2HASA 2O4RA 3BEJA 5K13A 3KWYA 3AN4A 4K4JA 4R06A 4IWCA 3D90A 1EXXA 3ERDA 5IAWA 1T65A 1XOWA 2HBHA 2P7AA 1ZGYA 2YATA 4MGDB 4S15A 2AA6A 3B3KA 1Q4XA 3HODA 5DIEA 3VJSA 5I4VA 2AMBA 2FSZA 3GYUA 3OOKA 3P89A 2Q5SA 1E3GA 2ZASA 3K23A 4LTWA 5HJSA 4IV2A 2FVJA 5DI7A 1XP6A 1YP0A 2BAWA 2JFAA 5DVVA 1NQ2A 5DKEA 2ATHA 3ADXA 3R8AA 5HYKA 4J5WA 3O1DA 2Q5GA 2AO6A 2O9IA 2ZVTA 4MGBA 5EGVA 5KR9A 1XP1A 3GYTA 2GPUA 4UDCA 5GIDA 4QK4A 3L0EA 4ZN9A 2VSTA 4MGAB 2FAIA 1MVCA 3GWXA 2ZNOA 4PWLA 5LWPA 2P7ZA 3NSQA 3OZJA 4IA3A 5EITA 3CS6A 3NSPA 3RLLA 1H9UA 1RKGA 1XLSE 4QM0A 1Z5XE 4PLEA 2Q7IA 4IW6A 4OIUA 5DZIA 2GWXA 2OZ7A 4PF3A 4F9MA 3E7CA 3WT7A 1U9EA 1X76A 2HFPA 4UDDA 1SKXA 3P88A 2QA8B 3WWRA 5G44A 2ZXMA 3DCUA 3B0QA 5DV8A 5DV3A 2NPAA 4M8HA 2R40A 4MDDA 5KYJA 3SP6A 4FGYA 4G1ZA 3KMGA 1UHLA 2G44A 1QKUA 3UP0A 3ZRAA 5DSHA 3O1EA 1SQNA 2ZKCA 2ZXZA 3OSIA 4MGCA 5DXKA 2Q7LA 2ZK2A 4P6XA 2HAMA 3SP9A 2HCDA 3A3ZX 3IA6A 4N5GA 3RLJA 5DZ3A 2J4AA 5L7HA 1NRLA 2QH6A 3F7DA 5DXBA 3VRWA 5DVSA 1PQ9A 4REEA 2VV4A 1X7EA 3HZFA 3OKIA 3VT6A 1XLSA 3AUQA 3EYBA 4MG6A 4OZTU 3V3EA 3N00A 3W0CA 3OOFA 4TUZB 4WLBA 5E15A 2PITA 5FQRA 1X7RA 5AAUA 5APKA 3WGPA 1T5ZA 2F4BA 2QA6A 1UOMA 5KCDA 3W0GA 5KRCA 5A86A 3MNEA 4RE8A 4UDBA 1ZDUA 1L2JA 2Q1HA 2Q1VA 4MG8B 4RMDA 5AWJA 2PRGA 3IPSA 3ADTA 1VJBA 1Z95A 1XV9A 2ACLB 5H1EA 4PRGA 1I37A 2YLQA 3H0AD 4CI5A 3VN2A 3PRGA 4S0SA 2B1VA 4G1YA 5SYZA 1SR7A 5AYGA 2ZK3A 1NAVA 1S9PA 3KDTA 4XT9A 5DXPA 2BJ4B 3AX8A 2VV1A 5DWGA 3VJTA 1NAXA 2G0HA 3V3QA 2GPVA 4RMEA 3TX7B 3H0AA 1OVLA 3CS8A 5KRKA 2YHDA 2Q7KA 4ZNHA 4X1FA 1TFCA 5KRJA 1E3KA 4OKTA 4PP3A 5DK9A 3AZ2A 3HLVA 5CJ6A 5DRJA 4OC7A 4OJ9A 2QE4A 2XYXA 4XI3A 5DXQA 5JY3A 1T76A 2PIPL 2I4JA 5DWIA 5DXEA 2YJDA 4OH5A 5AVIA 3TY0A 2E2RA 3CJWA 1MV9A 3JZCA 4OEAA 5AZTA 2AMAA 4A4VA 4ZJRA 5HCVA 3AFRA 5DMFA 1K4WA 3HC5A 4QL8A 3A2HA 1ILGA 3K6PA 5DXMA 2XKWA 2JFAB 3WT6A 4OEZA 4JGVA 4E4QA 1ZEOA 5G3JA 3OMPA 4J24A 1M2ZA 3B0RA 3L03A 2QNVA 1S0ZA 2P1TA 4MGBB 1FM9D 3F5CA 2Q7JA 4S0TA 2ZLCA 3OKHA 3AZ1A 4A2JA 1P8DA 4JYGA 1FD0A
chains in the Genus database with same CATH superfamily
1LV2A 4K7AA 3D24A 4MG7A 2Q61A 2JF9A 5FQVA 3OMKA 3GBKA 5C4TA 1RJKA 2JJ3A 3R2AA 5G42A 4XUHA 4G2HA 1FM9A 4Q0AC 2QR9A 5KCUA 4NB6A 5G46A 1G5YA 2H79A 4RUPA 1X7BA 1T79A 4WPFA 5DZ1A 4OEDA 5DL4A 2B1ZA 3CWDA 3VT7A 1YA3A 4JAZA 2J7YA 3FXVA 3H52A 5DKGA 5AVLA 5LGAA 1RK3A 5C4OA 4LBDA 3JZBA 3RUTA 2PIOA 2GPOA 1TXIA 1X78A 2QZOA 5C4SA 1T7RA 2QGTA 2J7XA 4REFA 4XLDA 3E00D 3LMPA 2ZK4A 1UHLB 3L0LA 1U3SA 4B7WA 3ADUA 1XAPA 5DRMA 1YOWA 3U9QA 4QE6A 5DUEA 1ILHA 3CS4A 2ZFXA 3DY6A 4ITEA 4N8RA 5DP0A 1XNNA 2AA2A 4ZO1B 4IA7A 3ADVA 4EM9A 3V4AA 2ZBSA 2EWPA 2O4JA 3E00A 3B1MA 5KCEA 5DXBB 5B41A 3R5MA 2GTKA 2R40D 4G1DA 4IW8A 2YFEA 2VV4B 4TV1A 5DYBA 2XYJA 4ZJWA 5KRHA 2PKLA 1EREA 2AA7A 1NYXA 3VTDA 1ZH7A 2NXXE 2Q59A 2YLYA 3B0TA 3HM1A 3FUGA 5IXKA 5KRMA 1YMTA 5FQTA 3VSPA 1UPWA 1R5KA 4OZRE 2Q70A 2ZNQA 3VJHA 4N73A 4OILA 2Q60A 3ERTA 4L98A 3OSWA 1U3RA 3VT9A 2IOGA 3D6DA 1I38A 3A2IA 3W5QA 4KZMA 2AA5A 5E19A 4O8FA 2Z4JA 1YINA 3A2JA 1PCGA 2GIUA 2PJLA 4JYIA 3HQ5A 2A3IA 3B67A 3W5RA 5G45A 2ZNPA 4E4KA 5KD9A 3KBAA 1KKQA 3OMOA 3OZ0A 4ZOMA 2P7GA 5DTVA 4OKBA 3WJ4A 5GICA 4DOSA 2HVCA 1XV9B 1R6GA 5E0XA 5DZ0A 5KYAA 2R6WA 1NHZA 3UUDA 5KRFA 5E14A 3B5RA 3W5PA 3B65A 4K6IA 5DU5A 2PIWA 3OGTA 3R29A 5KRLA 4XUMA 4Q13A 4YPQA 1N46A 3KMZA 3X1IA 5C4UA 4IVYA 2OM9A 3TKMA 2VV1B 1T63A 3IMYA 3FLIA 2Q6JA 3OS8A 3R8DA 2OUZA 1T7MA 1HJ1A 2P54A 1OVLB 2YJAB 3DT3A 1Y0SA 1M13A 1GWRA 5DX3A 5GIEA 1NQ1A 3Q95A 3W0JA 2AX7A 3E94A 3FS1A 4DK7A 1RDTD 4CI4A 5IZ0A 2OAXA 5DLRA 1XQ3A 1YUCA 2QXMA 2PIRA 5KROA 2ZLAA 4IA1A 4M8EA 5KRAA 4IWFA 3FALA 4ZO1X 1Y9RA 2AWHA 1N83A 5JJMB 3HO0A 1IE9A 2OCFA 2W8YA 1RDTA 3OLSA 3B66A 5M96A 4RFWA 4YNKA 4OEYA 3VT3A 3DCTA 1QKMA 1OSHA 2HARA 4DM8A 2P4YA 1ZUCA 2ZK1A 4DK8A 5KCFA 1Z5XU 3F5CB 4G20A 3UVVA 1XIUA 1GWXA 4J26A 3GN8A 4ZNWA 4RZFA 1XVPB 1GS4A 4IUIA 5APHA 4YT1A 3R8IA 1I7GA 2QSEA 3FEIA 2YLOA 4MG7B 1RKHA 3BC5A 2H77A 3VTBA 2R6YA 3KFCA 4XAOA 2ZK0A 2ZXNA 1XNXA 1BSXA 3QT0A 5E1CA 4WVDA 2AYRA 3VJIA 4OHAA 1T7FA 5KCWA 4YMQA 4EMAA 5AK2A 5G43A 5JJMA 4ONIA 5L7GA 5ICKA 4J5XA 1G50A 5DXRA 3KDUA 1DKFA 1XDKA 2PIUA 2POBA 1KV6A 4PPPA 2Q3YA 5DXGA 3DZYD 1A52A 1QKNA 3PEQA 5AWKA 1IE8A 3R5NA 3CDSA 5DUGA 3VT4A 3FEJA 3OLLA 2QZOB 4WHFA 4DORA 3T03A 2VV0A 5DWLA 4CSJA 3L1BA 2I4ZA 3IXPD 1XVPA 3IPQA 1S0XA 3M7RA 3DZYA 5DKBA 3VT5A 2NV7A 2ZMJA 1K74D 1UPVA 3X36A 3ET3A 5DZHA 4JL4A 5FQSA 4DM6A 1Y0XX 3S9SA 1PRGA 3IXPA 1PQCA 2B23A 2V7CA 3W0HA 4ZI1A 3G9EA 4TV1B 2ZNNA 4ZN7A 3MNOA 5E0WA 3X31A 1K74A 2IHQA 2Q59B 1S9QA 3HC6A 3ZQTA 4DMAA 3OLFA 2ABIA 2Q6SA 1NUOA 2PIQA 1FCYA 2P15A 4FNEA 3G8OA 4OZTE 3UP3A 5DIGA 3UU7A 4MG9A 1MZNA 3W0AA 3FC6B 5KCCA 1PZLA 5EHJA 2QGWA 2B50A 2XHSA 3D5FA 4HEEX 4HLWA 3W0IA 2AX9A 4P6WA 2I0GA 3PLZA 4RUOX 3OAPA 4OARA 4MG5A 2QTUA 3V49A 2YLPA 1L2IA 3L3ZA 3UUCA 4OKWA 1KNUA 2I4PA 1XJ7A 1S19A 4J5WC 4LNXA 2P1UA 2VV3A 3G8IA 4QJRA 4IA2A 1I7IA 3OSAA 4S14A 2HWRA 3VTCA 3UUDB 1OT7A 1DB1A 1NQ0A 4FHIA 2IOKA 4RZEA 2GPPA 4Q50A 4FN9A 2HWQA 3WMHA 5DIDA 4OK1A 3VI8A 1T73A 2Q8SA 5APJA 3X1HA 4NQAB 2AAXA 2ZL9A 5DUHA 3FC6A 4N1YA 3UUAA 4OH6A 3TKCA 5DYDA 2XYWA 3A9EA 4IV4A 5EJVA 5HYRA 1X7JA 2PINA 1ERRA 3WTQA 1YJEA 5DX3B 3RUUA 4PPSA 2PIXA 3PO9A 3B68A 3IPUA 3Q95B 3K22A 4KZJA 4XTAA 1LBDA 4MGDA 1PK5A 3WFFA 4ZNTA 2Z4BA 3AN3A 4OJBA 4OFUA 1YIMA 4XHDA 3CQVA 4JYHA 4PVUA 4NIEA 4NY9A 4OGHA 4Y29A 3V9YA 3W0YA 3FALB 5DVCA 2LBDA 3GZ9A 2ZK5A 4APUA 4DQMA 5KRIA 4OKXA 3LBDA 2G0GA 1U3QA 2HB7A 3CDPA 4ITFA 1PDUA 1ZKYA 3GWSX 4IVWA 3RVFA 3MNPA 4POJA 2NXXA 1QKTA 2QXSA 4MGAA 4BCRA 4E2JA 1T74A 4KZIA 1K7LA 3ILZA 5EI1A 3DR1A 3D57A 2AM9A 5E7VA 1YYEA 3A40X 3AURA 3UVVB 1T7TA 4WQPA 4ZNSA 1GWQA 3VT8A 2QPYA 4LNWA 3ET2A 3ET0A 1M7WA 1R20D 5JI0D 5DKSA 1XB7A 3VHWA 3G0WA 1XPCA 2QMVA 3FURA 3V9TA 3WT5A 2QA8A 2AB2A 3ET1A 5ACCA 2ZK6A 3OS8C 3SZ1A 2GP7A 3VRTA 2Q5PA 1SJ0A 1YY4A 1FCZA 5G5WA 4OFRA 4RZGA 3AUNA 1DKFB 1XDKB 1EXAA 1R20A 3ADWA 2ZMHA 3K8SA 3AZ3A 1P93A 3NOAA 1ZAFA 1A28A 3PCUA 4G21A 1FM6D 4IU7A 4QE8A 5DY8A 1XZXX 2ZY0A 3ZRBA 5KCTA 5HZCA 1R1KD 3DZUD 3BQDA 4IS8A 3OMMA 5L7EA 2GL8A 5DWEA 4IQRA 4NUFA 2P1VA 1NQ7A 1ZDTA 4A4WA 1FM6A 1WM0X 2REWA 4POHA 5DV6A 3VRUA 4OLMA 4WHGA 5EC9A 1PQ6A 3KPZA 1G2NA 2G5OA 3L0JA 2OVMA 4LSJA 1R1KA 3P8XA 4OZRU 3DZUA 4OIVA 2PIVA 1N4HA 4PP5A 2Q6RA 4TUZA 1XQCA 4G2IA 3V9VA 2HB8A 3PBAA 3CLDA 5B5BA 4ZNVA 5AAVB 5L11A 3ADSA 2J14A 3GD2A 4RUJA 4L96A 4PLDA 3OS9A 2AX6A 3A78A 4RMCA 2AXAA 4PXMA 3UU7B 2VSRA 4PP6A 4RWVA 4MG9B 5F9BA 3VSOA 2AX8A 3WFGA 2QW4A 4MG8A 2POGA 2NW4A 2VV2A 3P0UA 5GT4A 1FBYA 5DWJA 5HJPB 1XP9A 4UDAA 3B0WA 4FHHA 4X1GA 1OSVA 3ZR7A 3HVLA 2ACLA 4J5XC 1FCXA 3W5TA 1NDEA 3VRVA 5AZVA 1HG4A 2I0JA 4ZNUA 5FQPA 4R2UA 3CTBA 3L3XA 4RAKA 3KYTA 5AAVA 2BJ4A 2PNUA 2HC4A 2V0VA 3WJ5A 2QABA 5ETHA 3RY9A 1YOKA 2ZMIA 1G1UA 4R6SA 3UUAB 3VHUA 5DMCA 3VHVA 2OVHA 3OMQA 4OJ4A 5HJPA 3A9EB 3KMRA 2HASA 2O4RA 3BEJA 5K13A 3KWYA 3AN4A 4K4JA 4R06A 4IWCA 3D90A 1EXXA 3ERDA 5IAWA 1T65A 1XOWA 2HBHA 2P7AA 1ZGYA 2YATA 4MGDB 4S15A 2AA6A 3B3KA 1Q4XA 3HODA 5DIEA 3VJSA 5I4VA 2AMBA 2FSZA 3GYUA 3OOKA 3P89A 2Q5SA 1E3GA 2ZASA 3K23A 4LTWA 5HJSA 4IV2A 2FVJA 5DI7A 1XP6A 1YP0A 2BAWA 2JFAA 5DVVA 1NQ2A 5DKEA 2ATHA 3ADXA 3R8AA 5HYKA 4J5WA 3O1DA 2Q5GA 2AO6A 2O9IA 2ZVTA 4MGBA 5EGVA 5KR9A 1XP1A 3GYTA 2GPUA 4UDCA 5GIDA 4QK4A 3L0EA 4ZN9A 2VSTA 4MGAB 2FAIA 1MVCA 3GWXA 2ZNOA 4PWLA 5LWPA 2P7ZA 3NSQA 3OZJA 4IA3A 5EITA 3CS6A 3NSPA 3RLLA 1H9UA 1RKGA 1XLSE 4QM0A 1Z5XE 4PLEA 2Q7IA 4IW6A 4OIUA 5DZIA 2GWXA 2OZ7A 4PF3A 4F9MA 3E7CA 3WT7A 1U9EA 1X76A 2HFPA 4UDDA 1SKXA 3P88A 2QA8B 3WWRA 5G44A 2ZXMA 3DCUA 3B0QA 5DV8A 5DV3A 2NPAA 4M8HA 2R40A 4MDDA 5KYJA 3SP6A 4FGYA 4G1ZA 3KMGA 1UHLA 2G44A 1QKUA 3UP0A 3ZRAA 5DSHA 3O1EA 1SQNA 2ZKCA 2ZXZA 3OSIA 4MGCA 5DXKA 2Q7LA 2ZK2A 4P6XA 2HAMA 3SP9A 2HCDA 3A3ZX 3IA6A 4N5GA 3RLJA 5DZ3A 2J4AA 5L7HA 1NRLA 2QH6A 3F7DA 5DXBA 3VRWA 5DVSA 1PQ9A 4REEA 2VV4A 1X7EA 3HZFA 3OKIA 3VT6A 1XLSA 3AUQA 3EYBA 4MG6A 4OZTU 3V3EA 3N00A 3W0CA 3OOFA 4TUZB 4WLBA 5E15A 2PITA 5FQRA 1X7RA 5AAUA 5APKA 3WGPA 1T5ZA 2F4BA 2QA6A 1UOMA 5KCDA 3W0GA 5KRCA 5A86A 3MNEA 4RE8A 4UDBA 1ZDUA 1L2JA 2Q1HA 2Q1VA 4MG8B 4RMDA 5AWJA 2PRGA 3IPSA 3ADTA 1VJBA 1Z95A 1XV9A 2ACLB 5H1EA 4PRGA 1I37A 2YLQA 3H0AD 4CI5A 3VN2A 3PRGA 4S0SA 2B1VA 4G1YA 5SYZA 1SR7A 5AYGA 2ZK3A 1NAVA 1S9PA 3KDTA 4XT9A 5DXPA 2BJ4B 3AX8A 2VV1A 5DWGA 3VJTA 1NAXA 2G0HA 3V3QA 2GPVA 4RMEA 3TX7B 3H0AA 1OVLA 3CS8A 5KRKA 2YHDA 2Q7KA 4ZNHA 4X1FA 1TFCA 5KRJA 1E3KA 4OKTA 4PP3A 5DK9A 3AZ2A 3HLVA 5CJ6A 5DRJA 4OC7A 4OJ9A 2QE4A 2XYXA 4XI3A 5DXQA 5JY3A 1T76A 2PIPL 2I4JA 5DWIA 5DXEA 2YJDA 4OH5A 5AVIA 3TY0A 2E2RA 3CJWA 1MV9A 3JZCA 4OEAA 5AZTA 2AMAA 4A4VA 4ZJRA 5HCVA 3AFRA 5DMFA 1K4WA 3HC5A 4QL8A 3A2HA 1ILGA 3K6PA 5DXMA 2XKWA 2JFAB 3WT6A 4OEZA 4JGVA 4E4QA 1ZEOA 5G3JA 3OMPA 4J24A 1M2ZA 3B0RA 3L03A 2QNVA 1S0ZA 2P1TA 4MGBB 1FM9D 3F5CA 2Q7JA 4S0TA 2ZLCA 3OKHA 3AZ1A 4A2JA 1P8DA 4JYGA 1FD0A
chains in the Genus database with same CATH topology
1LV2A 4K7AA 3D24A 4MG7A 2Q61A 2JF9A 5FQVA 3OMKA 3GBKA 5C4TA 1RJKA 2JJ3A 3R2AA 5G42A 4XUHA 4G2HA 1FM9A 4Q0AC 2QR9A 5KCUA 4NB6A 5G46A 1G5YA 2H79A 4RUPA 1X7BA 1T79A 4WPFA 5DZ1A 4OEDA 5DL4A 2B1ZA 3CWDA 3VT7A 1YA3A 4JAZA 2J7YA 3FXVA 3H52A 5DKGA 5AVLA 5LGAA 1RK3A 5C4OA 4LBDA 3JZBA 3RUTA 2PIOA 2GPOA 1TXIA 1X78A 2QZOA 5C4SA 1T7RA 2QGTA 2J7XA 4REFA 4XLDA 3E00D 3LMPA 2ZK4A 1UHLB 3L0LA 1U3SA 4B7WA 3ADUA 1XAPA 5DRMA 1YOWA 3U9QA 4QE6A 5DUEA 1ILHA 3CS4A 2ZFXA 3DY6A 4ITEA 4N8RA 5DP0A 1XNNA 2AA2A 4ZO1B 4IA7A 3ADVA 4EM9A 3V4AA 2ZBSA 2EWPA 2O4JA 3E00A 3B1MA 5KCEA 5DXBB 5B41A 3R5MA 2GTKA 2R40D 4G1DA 4IW8A 2YFEA 2VV4B 4TV1A 5DYBA 2XYJA 4ZJWA 5KRHA 2PKLA 1EREA 2AA7A 1NYXA 3VTDA 1ZH7A 2NXXE 2Q59A 2YLYA 3B0TA 3HM1A 3FUGA 5IXKA 5KRMA 1YMTA 5FQTA 3VSPA 1UPWA 1R5KA 4OZRE 2Q70A 2ZNQA 3VJHA 4N73A 4OILA 2Q60A 3ERTA 4L98A 3OSWA 1U3RA 3VT9A 2IOGA 3D6DA 1I38A 3A2IA 3W5QA 4KZMA 2AA5A 5E19A 4O8FA 2Z4JA 1YINA 3A2JA 1PCGA 2GIUA 2PJLA 4JYIA 3HQ5A 2A3IA 3B67A 3W5RA 5G45A 2ZNPA 4E4KA 5KD9A 3KBAA 1KKQA 3OMOA 3OZ0A 4ZOMA 2P7GA 5DTVA 4OKBA 3WJ4A 5GICA 4DOSA 2HVCA 1XV9B 1R6GA 5E0XA 5DZ0A 5KYAA 2R6WA 1NHZA 3UUDA 5KRFA 5E14A 3B5RA 3W5PA 3B65A 4K6IA 5DU5A 2PIWA 3OGTA 3R29A 5KRLA 4XUMA 4Q13A 4YPQA 1N46A 3KMZA 3X1IA 5C4UA 4IVYA 2OM9A 3TKMA 2VV1B 1T63A 3IMYA 3FLIA 2Q6JA 3OS8A 3R8DA 2OUZA 1T7MA 1HJ1A 2P54A 1OVLB 2YJAB 3DT3A 1Y0SA 1M13A 1GWRA 5DX3A 5GIEA 1NQ1A 3Q95A 3W0JA 2AX7A 3E94A 3FS1A 4DK7A 1RDTD 4CI4A 5IZ0A 2OAXA 5DLRA 1XQ3A 1YUCA 2QXMA 2PIRA 5KROA 2ZLAA 4IA1A 4M8EA 5KRAA 4IWFA 3FALA 4ZO1X 1Y9RA 2AWHA 1N83A 5JJMB 3HO0A 1IE9A 2OCFA 2W8YA 1RDTA 3OLSA 3B66A 5M96A 4RFWA 4YNKA 4OEYA 3VT3A 3DCTA 1QKMA 1OSHA 2HARA 4DM8A 2P4YA 1ZUCA 2ZK1A 4DK8A 5KCFA 1Z5XU 3F5CB 4G20A 3UVVA 1XIUA 1GWXA 4J26A 3GN8A 4ZNWA 4RZFA 1XVPB 1GS4A 4IUIA 5APHA 4YT1A 3R8IA 1I7GA 2QSEA 3FEIA 2YLOA 4MG7B 1RKHA 3BC5A 2H77A 3VTBA 2R6YA 3KFCA 4XAOA 2ZK0A 2ZXNA 1XNXA 1BSXA 3QT0A 5E1CA 4WVDA 2AYRA 3VJIA 4OHAA 1T7FA 5KCWA 4YMQA 4EMAA 5AK2A 5G43A 5JJMA 4ONIA 5L7GA 5ICKA 4J5XA 1G50A 5DXRA 3KDUA 1DKFA 1XDKA 2PIUA 2POBA 1KV6A 4PPPA 2Q3YA 5DXGA 3DZYD 1A52A 1QKNA 3PEQA 5AWKA 1IE8A 3R5NA 3CDSA 5DUGA 3VT4A 3FEJA 3OLLA 2QZOB 4WHFA 4DORA 3T03A 2VV0A 5DWLA 4CSJA 3L1BA 2I4ZA 3IXPD 1XVPA 3IPQA 1S0XA 3M7RA 3DZYA 5DKBA 3VT5A 2NV7A 2ZMJA 1K74D 1UPVA 3X36A 3ET3A 5DZHA 4JL4A 5FQSA 4DM6A 1Y0XX 3S9SA 1PRGA 3IXPA 1PQCA 2B23A 2V7CA 3W0HA 4ZI1A 3G9EA 4TV1B 2ZNNA 4ZN7A 3MNOA 5E0WA 3X31A 1K74A 2IHQA 2Q59B 1S9QA 3HC6A 3ZQTA 4DMAA 3OLFA 2ABIA 2Q6SA 1NUOA 2PIQA 1FCYA 2P15A 4FNEA 3G8OA 4OZTE 3UP3A 5DIGA 3UU7A 4MG9A 1MZNA 3W0AA 3FC6B 5KCCA 1PZLA 5EHJA 2QGWA 2B50A 2XHSA 3D5FA 4HEEX 4HLWA 3W0IA 2AX9A 4P6WA 2I0GA 3PLZA 4RUOX 3OAPA 4OARA 4MG5A 2QTUA 3V49A 2YLPA 1L2IA 3L3ZA 3UUCA 4OKWA 1KNUA 2I4PA 1XJ7A 1S19A 4J5WC 4LNXA 2P1UA 2VV3A 3G8IA 4QJRA 4IA2A 1I7IA 3OSAA 4S14A 2HWRA 3VTCA 3UUDB 1OT7A 1DB1A 1NQ0A 4FHIA 2IOKA 4RZEA 2GPPA 4Q50A 4FN9A 2HWQA 3WMHA 5DIDA 4OK1A 3VI8A 1T73A 2Q8SA 5APJA 3X1HA 4NQAB 2AAXA 2ZL9A 5DUHA 3FC6A 4N1YA 3UUAA 4OH6A 3TKCA 5DYDA 2XYWA 3A9EA 4IV4A 5EJVA 5HYRA 1X7JA 2PINA 1ERRA 3WTQA 1YJEA 5DX3B 3RUUA 4PPSA 2PIXA 3PO9A 3B68A 3IPUA 3Q95B 3K22A 4KZJA 4XTAA 1LBDA 4MGDA 1PK5A 3WFFA 4ZNTA 2Z4BA 3AN3A 4OJBA 4OFUA 1YIMA 4XHDA 3CQVA 4JYHA 4PVUA 4NIEA 4NY9A 4OGHA 4Y29A 3V9YA 3W0YA 3FALB 5DVCA 2LBDA 3GZ9A 2ZK5A 4APUA 4DQMA 5KRIA 4OKXA 3LBDA 2G0GA 1U3QA 2HB7A 3CDPA 4ITFA 1PDUA 1ZKYA 3GWSX 4IVWA 3RVFA 3MNPA 4POJA 2NXXA 1QKTA 2QXSA 4MGAA 4BCRA 4E2JA 1T74A 4KZIA 1K7LA 3ILZA 5EI1A 3DR1A 3D57A 2AM9A 5E7VA 1YYEA 3A40X 3AURA 3UVVB 1T7TA 4WQPA 4ZNSA 1GWQA 3VT8A 2QPYA 4LNWA 3ET2A 3ET0A 1M7WA 1R20D 5JI0D 5DKSA 1XB7A 3VHWA 3G0WA 1XPCA 2QMVA 3FURA 3V9TA 3WT5A 2QA8A 2AB2A 3ET1A 5ACCA 2ZK6A 3OS8C 3SZ1A 2GP7A 3VRTA 2Q5PA 1SJ0A 1YY4A 1FCZA 5G5WA 4OFRA 4RZGA 3AUNA 1DKFB 1XDKB 1EXAA 1R20A 3ADWA 2ZMHA 3K8SA 3AZ3A 1P93A 3NOAA 1ZAFA 1A28A 3PCUA 4G21A 1FM6D 4IU7A 4QE8A 5DY8A 1XZXX 2ZY0A 3ZRBA 5KCTA 5HZCA 1R1KD 3DZUD 3BQDA 4IS8A 3OMMA 5L7EA 2GL8A 5DWEA 4IQRA 4NUFA 2P1VA 1NQ7A 1ZDTA 4A4WA 1FM6A 1WM0X 2REWA 4POHA 5DV6A 3VRUA 4OLMA 4WHGA 5EC9A 1PQ6A 3KPZA 1G2NA 2G5OA 3L0JA 2OVMA 4LSJA 1R1KA 3P8XA 4OZRU 3DZUA 4OIVA 2PIVA 1N4HA 4PP5A 2Q6RA 4TUZA 1XQCA 4G2IA 3V9VA 2HB8A 3PBAA 3CLDA 5B5BA 4ZNVA 5AAVB 5L11A 3ADSA 2J14A 3GD2A 4RUJA 4L96A 4PLDA 3OS9A 2AX6A 3A78A 4RMCA 2AXAA 4PXMA 3UU7B 2VSRA 4PP6A 4RWVA 4MG9B 5F9BA 3VSOA 2AX8A 3WFGA 2QW4A 4MG8A 2POGA 2NW4A 2VV2A 3P0UA 5GT4A 1FBYA 5DWJA 5HJPB 1XP9A 4UDAA 3B0WA 4FHHA 4X1GA 1OSVA 3ZR7A 3HVLA 2ACLA 4J5XC 1FCXA 3W5TA 1NDEA 3VRVA 5AZVA 1HG4A 2I0JA 4ZNUA 5FQPA 4R2UA 3CTBA 3L3XA 4RAKA 3KYTA 5AAVA 2BJ4A 2PNUA 2HC4A 2V0VA 3WJ5A 2QABA 5ETHA 3RY9A 1YOKA 2ZMIA 1G1UA 4R6SA 3UUAB 3VHUA 5DMCA 3VHVA 2OVHA 3OMQA 4OJ4A 5HJPA 3A9EB 3KMRA 2HASA 2O4RA 3BEJA 5K13A 3KWYA 3AN4A 4K4JA 4R06A 4IWCA 3D90A 1EXXA 3ERDA 5IAWA 1T65A 1XOWA 2HBHA 2P7AA 1ZGYA 2YATA 4MGDB 4S15A 2AA6A 3B3KA 1Q4XA 3HODA 5DIEA 3VJSA 5I4VA 2AMBA 2FSZA 3GYUA 3OOKA 3P89A 2Q5SA 1E3GA 2ZASA 3K23A 4LTWA 5HJSA 4IV2A 2FVJA 5DI7A 1XP6A 1YP0A 2BAWA 2JFAA 5DVVA 1NQ2A 5DKEA 2ATHA 3ADXA 3R8AA 5HYKA 4J5WA 3O1DA 2Q5GA 2AO6A 2O9IA 2ZVTA 4MGBA 5EGVA 5KR9A 1XP1A 3GYTA 2GPUA 4UDCA 5GIDA 4QK4A 3L0EA 4ZN9A 2VSTA 4MGAB 2FAIA 1MVCA 3GWXA 2ZNOA 4PWLA 5LWPA 2P7ZA 3NSQA 3OZJA 4IA3A 5EITA 3CS6A 3NSPA 3RLLA 1H9UA 1RKGA 1XLSE 4QM0A 1Z5XE 4PLEA 2Q7IA 4IW6A 4OIUA 5DZIA 2GWXA 2OZ7A 4PF3A 4F9MA 3E7CA 3WT7A 1U9EA 1X76A 2HFPA 4UDDA 1SKXA 3P88A 2QA8B 3WWRA 5G44A 2ZXMA 3DCUA 3B0QA 5DV8A 5DV3A 2NPAA 4M8HA 2R40A 4MDDA 5KYJA 3SP6A 4FGYA 4G1ZA 3KMGA 1UHLA 2G44A 1QKUA 3UP0A 3ZRAA 5DSHA 3O1EA 1SQNA 2ZKCA 2ZXZA 3OSIA 4MGCA 5DXKA 2Q7LA 2ZK2A 4P6XA 2HAMA 3SP9A 2HCDA 3A3ZX 3IA6A 4N5GA 3RLJA 5DZ3A 2J4AA 5L7HA 1NRLA 2QH6A 3F7DA 5DXBA 3VRWA 5DVSA 1PQ9A 4REEA 2VV4A 1X7EA 3HZFA 3OKIA 3VT6A 1XLSA 3AUQA 3EYBA 4MG6A 4OZTU 3V3EA 3N00A 3W0CA 3OOFA 4TUZB 4WLBA 5E15A 2PITA 5FQRA 1X7RA 5AAUA 5APKA 3WGPA 1T5ZA 2F4BA 2QA6A 1UOMA 5KCDA 3W0GA 5KRCA 5A86A 3MNEA 4RE8A 4UDBA 1ZDUA 1L2JA 2Q1HA 2Q1VA 4MG8B 4RMDA 5AWJA 2PRGA 3IPSA 3ADTA 1VJBA 1Z95A 1XV9A 2ACLB 5H1EA 4PRGA 1I37A 2YLQA 3H0AD 4CI5A 3VN2A 3PRGA 4S0SA 2B1VA 4G1YA 5SYZA 1SR7A 5AYGA 2ZK3A 1NAVA 1S9PA 3KDTA 4XT9A 5DXPA 2BJ4B 3AX8A 2VV1A 5DWGA 3VJTA 1NAXA 2G0HA 3V3QA 2GPVA 4RMEA 3TX7B 3H0AA 1OVLA 3CS8A 5KRKA 2YHDA 2Q7KA 4ZNHA 4X1FA 1TFCA 5KRJA 1E3KA 4OKTA 4PP3A 5DK9A 3AZ2A 3HLVA 5CJ6A 5DRJA 4OC7A 4OJ9A 2QE4A 2XYXA 4XI3A 5DXQA 5JY3A 1T76A 2PIPL 2I4JA 5DWIA 5DXEA 2YJDA 4OH5A 5AVIA 3TY0A 2E2RA 3CJWA 1MV9A 3JZCA 4OEAA 5AZTA 2AMAA 4A4VA 4ZJRA 5HCVA 3AFRA 5DMFA 1K4WA 3HC5A 4QL8A 3A2HA 1ILGA 3K6PA 5DXMA 2XKWA 2JFAB 3WT6A 4OEZA 4JGVA 4E4QA 1ZEOA 5G3JA 3OMPA 4J24A 1M2ZA 3B0RA 3L03A 2QNVA 1S0ZA 2P1TA 4MGBB 1FM9D 3F5CA 2Q7JA 4S0TA 2ZLCA 3OKHA 3AZ1A 4A2JA 1P8DA 4JYGA 1FD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV2 A;  4K7A A;  3D24 A;  4MG7 A;  2Q61 A;  2JF9 A;  5FQV A;  3OMK A;  3GBK A;  5C4T A;  1RJK A;  2JJ3 A;  3R2A A;  5G42 A;  4XUH A;  4G2H A;  1FM9 A;  4Q0A C;  2QR9 A;  5KCU A;  4NB6 A;  5G46 A;  1G5Y A;  2H79 A;  4RUP A;  1X7B A;  1T79 A;  4WPF A;  5DZ1 A;  4OED A;  5DL4 A;  2B1Z A;  3CWD A;  3VT7 A;  1YA3 A;  4JAZ A;  2J7Y A;  3FXV A;  3H52 A;  5DKG A;  5AVL A;  5LGA A;  1RK3 A;  5C4O A;  4LBD A;  3JZB A;  3RUT A;  2PIO A;  2GPO A;  1TXI A;  1X78 A;  2QZO A;  5C4S A;  1T7R A;  2QGT A;  2J7X A;  4REF A;  4XLD A;  3E00 D;  3LMP A;  2ZK4 A;  1UHL B;  3L0L A;  1U3S A;  4B7W A;  3ADU A;  1XAP A;  5DRM A;  1YOW A;  3U9Q A;  4QE6 A;  5DUE A;  1ILH A;  3CS4 A;  2ZFX A;  3DY6 A;  4ITE A;  4N8R A;  5DP0 A;  1XNN A;  2AA2 A;  4ZO1 B;  4IA7 A;  3ADV A;  4EM9 A;  3V4A A;  2ZBS A;  2EWP A;  2O4J A;  3E00 A;  3B1M A;  5KCE A;  5DXB B;  5B41 A;  3R5M A;  2GTK A;  2R40 D;  4G1D A;  4IW8 A;  2YFE A;  2VV4 B;  4TV1 A;  5DYB A;  2XYJ A;  4ZJW A;  5KRH A;  2PKL A;  1ERE A;  2AA7 A;  1NYX A;  3VTD A;  1ZH7 A;  2NXX E;  2Q59 A;  2YLY A;  3B0T A;  3HM1 A;  3FUG A;  5IXK A;  5KRM A;  1YMT A;  5FQT A;  3VSP A;  1UPW A;  1R5K A;  4OZR E;  2Q70 A;  2ZNQ A;  3VJH A;  4N73 A;  4OIL A;  2Q60 A;  3ERT A;  4L98 A;  3OSW A;  1U3R A;  3VT9 A;  2IOG A;  3D6D A;  1I38 A;  3A2I A;  3W5Q A;  4KZM A;  2AA5 A;  5E19 A;  4O8F A;  2Z4J A;  1YIN A;  3A2J A;  1PCG A;  2GIU A;  2PJL A;  4JYI A;  3HQ5 A;  2A3I A;  3B67 A;  3W5R A;  5G45 A;  2ZNP A;  4E4K A;  5KD9 A;  3KBA A;  1KKQ A;  3OMO A;  3OZ0 A;  4ZOM A;  2P7G A;  5DTV A;  4OKB A;  3WJ4 A;  5GIC A;  4DOS A;  2HVC A;  1XV9 B;  1R6G A;  5E0X A;  5DZ0 A;  5KYA A;  2R6W A;  1NHZ A;  3UUD A;  5KRF A;  5E14 A;  3B5R A;  3W5P A;  3B65 A;  4K6I A;  5DU5 A;  2PIW A;  3OGT A;  3R29 A;  5KRL A;  4XUM A;  4Q13 A;  4YPQ A;  1N46 A;  3KMZ A;  3X1I A;  5C4U A;  4IVY A;  2OM9 A;  3TKM A;  2VV1 B;  1T63 A;  3IMY A;  3FLI A;  2Q6J A;  3OS8 A;  3R8D A;  2OUZ A;  1T7M A;  1HJ1 A;  2P54 A;  1OVL B;  2YJA B;  3DT3 A;  1Y0S A;  1M13 A;  1GWR A;  5DX3 A;  5GIE A;  1NQ1 A;  3Q95 A;  3W0J A;  2AX7 A;  3E94 A;  3FS1 A;  4DK7 A;  1RDT D;  4CI4 A;  5IZ0 A;  2OAX A;  5DLR A;  1XQ3 A;  1YUC A;  2QXM A;  2PIR A;  5KRO A;  2ZLA A;  4IA1 A;  4M8E A;  5KRA A;  4IWF A;  3FAL A;  4ZO1 X;  1Y9R A;  2AWH A;  1N83 A;  5JJM B;  3HO0 A;  1IE9 A;  2OCF A;  2W8Y A;  1RDT A;  3OLS A;  3B66 A;  5M96 A;  4RFW A;  4YNK A;  4OEY A;  3VT3 A;  3DCT A;  1QKM A;  1OSH A;  2HAR A;  4DM8 A;  2P4Y A;  1ZUC A;  2ZK1 A;  4DK8 A;  5KCF A;  1Z5X U;  3F5C B;  4G20 A;  3UVV A;  1XIU A;  1GWX A;  4J26 A;  3GN8 A;  4ZNW A;  4RZF A;  1XVP B;  1GS4 A;  4IUI A;  5APH A;  4YT1 A;  3R8I A;  1I7G A;  2QSE A;  3FEI A;  2YLO A;  4MG7 B;  1RKH A;  3BC5 A;  2H77 A;  3VTB A;  2R6Y A;  3KFC A;  4XAO A;  2ZK0 A;  2ZXN A;  1XNX A;  1BSX A;  3QT0 A;  5E1C A;  4WVD A;  2AYR A;  3VJI A;  4OHA A;  1T7F A;  5KCW A;  4YMQ A;  4EMA A;  5AK2 A;  5G43 A;  5JJM A;  4ONI A;  5L7G A;  5ICK A;  4J5X A;  1G50 A;  5DXR A;  3KDU A;  1DKF A;  1XDK A;  2PIU A;  2POB A;  1KV6 A;  4PPP A;  2Q3Y A;  5DXG A;  3DZY D;  1A52 A;  1QKN A;  3PEQ A;  5AWK A;  1IE8 A;  3R5N A;  3CDS A;  5DUG A;  3VT4 A;  3FEJ A;  3OLL A;  2QZO B;  4WHF A;  4DOR A;  3T03 A;  2VV0 A;  5DWL A;  4CSJ A;  3L1B A;  2I4Z A;  3IXP D;  1XVP A;  3IPQ A;  1S0X A;  3M7R A;  3DZY A;  5DKB A;  3VT5 A;  2NV7 A;  2ZMJ A;  1K74 D;  1UPV A;  3X36 A;  3ET3 A;  5DZH A;  4JL4 A;  5FQS A;  4DM6 A;  1Y0X X;  3S9S A;  1PRG A;  3IXP A;  1PQC A;  2B23 A;  2V7C A;  3W0H A;  4ZI1 A;  3G9E A;  4TV1 B;  2ZNN A;  4ZN7 A;  3MNO A;  5E0W A;  3X31 A;  1K74 A;  2IHQ A;  2Q59 B;  1S9Q A;  3HC6 A;  3ZQT A;  4DMA A;  3OLF A;  2ABI A;  2Q6S A;  1NUO A;  2PIQ A;  1FCY A;  2P15 A;  4FNE A;  3G8O A;  4OZT E;  3UP3 A;  5DIG A;  3UU7 A;  4MG9 A;  1MZN A;  3W0A A;  3FC6 B;  5KCC A;  1PZL A;  5EHJ A;  2QGW A;  2B50 A;  2XHS A;  3D5F A;  4HEE X;  4HLW A;  3W0I A;  2AX9 A;  4P6W A;  2I0G A;  3PLZ A;  4RUO X;  3OAP A;  4OAR A;  4MG5 A;  2QTU A;  3V49 A;  2YLP A;  1L2I A;  3L3Z A;  3UUC A;  4OKW A;  1KNU A;  2I4P A;  1XJ7 A;  1S19 A;  4J5W C;  4LNX A;  2P1U A;  2VV3 A;  3G8I A;  4QJR A;  4IA2 A;  1I7I A;  3OSA A;  4S14 A;  2HWR A;  3VTC A;  3UUD B;  1OT7 A;  1DB1 A;  1NQ0 A;  4FHI A;  2IOK A;  4RZE A;  2GPP A;  4Q50 A;  4FN9 A;  2HWQ A;  3WMH A;  5DID A;  4OK1 A;  3VI8 A;  1T73 A;  2Q8S A;  5APJ A;  3X1H A;  4NQA B;  2AAX A;  2ZL9 A;  5DUH A;  3FC6 A;  4N1Y A;  3UUA A;  4OH6 A;  3TKC A;  5DYD A;  2XYW A;  3A9E A;  4IV4 A;  5EJV A;  5HYR A;  1X7J A;  2PIN A;  1ERR A;  3WTQ A;  1YJE A;  5DX3 B;  3RUU A;  4PPS A;  2PIX A;  3PO9 A;  3B68 A;  3IPU A;  3Q95 B;  3K22 A;  4KZJ A;  4XTA A;  1LBD A;  4MGD A;  1PK5 A;  3WFF A;  4ZNT A;  2Z4B A;  3AN3 A;  4OJB A;  4OFU A;  1YIM A;  4XHD A;  3CQV A;  4JYH A;  4PVU A;  4NIE A;  4NY9 A;  4OGH A;  4Y29 A;  3V9Y A;  3W0Y A;  3FAL B;  5DVC A;  2LBD A;  3GZ9 A;  2ZK5 A;  4APU A;  4DQM A;  5KRI A;  4OKX A;  3LBD A;  2G0G A;  1U3Q A;  2HB7 A;  3CDP A;  4ITF A;  1PDU A;  1ZKY A;  3GWS X;  4IVW A;  3RVF A;  3MNP A;  4POJ A;  2NXX A;  1QKT A;  2QXS A;  4MGA A;  4BCR A;  4E2J A;  1T74 A;  4KZI A;  1K7L A;  3ILZ A;  5EI1 A;  3DR1 A;  3D57 A;  2AM9 A;  5E7V A;  1YYE A;  3A40 X;  3AUR A;  3UVV B;  1T7T A;  4WQP A;  4ZNS A;  1GWQ A;  3VT8 A;  2QPY A;  4LNW A;  3ET2 A;  3ET0 A;  1M7W A;  1R20 D;  5JI0 D;  5DKS A;  1XB7 A;  3VHW A;  3G0W A;  1XPC A;  2QMV A;  3FUR A;  3V9T A;  3WT5 A;  2QA8 A;  2AB2 A;  3ET1 A;  5ACC A;  2ZK6 A;  3OS8 C;  3SZ1 A;  2GP7 A;  3VRT A;  2Q5P A;  1SJ0 A;  1YY4 A;  1FCZ A;  5G5W A;  4OFR A;  4RZG A;  3AUN A;  1DKF B;  1XDK B;  1EXA A;  1R20 A;  3ADW A;  2ZMH A;  3K8S A;  3AZ3 A;  1P93 A;  3NOA A;  1ZAF A;  1A28 A;  3PCU A;  4G21 A;  1FM6 D;  4IU7 A;  4QE8 A;  5DY8 A;  1XZX X;  2ZY0 A;  3ZRB A;  5KCT A;  5HZC A;  1R1K D;  3DZU D;  3BQD A;  4IS8 A;  3OMM A;  5L7E A;  2GL8 A;  5DWE A;  4IQR A;  4NUF A;  2P1V A;  1NQ7 A;  1ZDT A;  4A4W A;  1FM6 A;  1WM0 X;  2REW A;  4POH A;  5DV6 A;  3VRU A;  4OLM A;  4WHG A;  5EC9 A;  1PQ6 A;  3KPZ A;  1G2N A;  2G5O A;  3L0J A;  2OVM A;  4LSJ A;  1R1K A;  3P8X A;  4OZR U;  3DZU A;  4OIV A;  2PIV A;  1N4H A;  4PP5 A;  2Q6R A;  4TUZ A;  1XQC A;  4G2I A;  3V9V A;  2HB8 A;  3PBA A;  3CLD A;  5B5B A;  4ZNV A;  5AAV B;  5L11 A;  3ADS A;  2J14 A;  3GD2 A;  4RUJ A;  4L96 A;  4PLD A;  3OS9 A;  2AX6 A;  3A78 A;  4RMC A;  2AXA A;  4PXM A;  3UU7 B;  2VSR A;  4PP6 A;  4RWV A;  4MG9 B;  5F9B A;  3VSO A;  2AX8 A;  3WFG A;  2QW4 A;  4MG8 A;  2POG A;  2NW4 A;  2VV2 A;  3P0U A;  5GT4 A;  1FBY A;  5DWJ A;  5HJP B;  1XP9 A;  4UDA A;  3B0W A;  4FHH A;  4X1G A;  1OSV A;  3ZR7 A;  3HVL A;  2ACL A;  4J5X C;  1FCX A;  3W5T A;  1NDE A;  3VRV A;  5AZV A;  1HG4 A;  2I0J A;  4ZNU A;  5FQP A;  4R2U A;  3CTB A;  3L3X A;  4RAK A;  3KYT A;  5AAV A;  2BJ4 A;  2PNU A;  2HC4 A;  2V0V A;  3WJ5 A;  2QAB A;  5ETH A;  3RY9 A;  1YOK A;  2ZMI A;  1G1U A;  4R6S A;  3UUA B;  3VHU A;  5DMC A;  3VHV A;  2OVH A;  3OMQ A;  4OJ4 A;  5HJP A;  3A9E B;  3KMR A;  2HAS A;  2O4R A;  3BEJ A;  5K13 A;  3KWY A;  3AN4 A;  4K4J A;  4R06 A;  4IWC A;  3D90 A;  1EXX A;  3ERD A;  5IAW A;  1T65 A;  1XOW A;  2HBH A;  2P7A A;  1ZGY A;  2YAT A;  4MGD B;  4S15 A;  2AA6 A;  3B3K A;  1Q4X A;  3HOD A;  5DIE A;  3VJS A;  5I4V A;  2AMB A;  2FSZ A;  3GYU A;  3OOK A;  3P89 A;  2Q5S A;  1E3G A;  2ZAS A;  3K23 A;  4LTW A;  5HJS A;  4IV2 A;  2FVJ A;  5DI7 A;  1XP6 A;  1YP0 A;  2BAW A;  2JFA A;  5DVV A;  1NQ2 A;  5DKE A;  2ATH A;  3ADX A;  3R8A A;  5HYK A;  4J5W A;  3O1D A;  2Q5G A;  2AO6 A;  2O9I A;  2ZVT A;  4MGB A;  5EGV A;  5KR9 A;  1XP1 A;  3GYT A;  2GPU A;  4UDC A;  5GID A;  4QK4 A;  3L0E A;  4ZN9 A;  2VST A;  4MGA B;  2FAI A;  1MVC A;  3GWX A;  2ZNO A;  4PWL A;  5LWP A;  2P7Z A;  3NSQ A;  3OZJ A;  4IA3 A;  5EIT A;  3CS6 A;  3NSP A;  3RLL A;  1H9U A;  1RKG A;  1XLS E;  4QM0 A;  1Z5X E;  4PLE A;  2Q7I A;  4IW6 A;  4OIU A;  5DZI A;  2GWX A;  2OZ7 A;  4PF3 A;  4F9M A;  3E7C A;  3WT7 A;  1U9E A;  1X76 A;  2HFP A;  4UDD A;  1SKX A;  3P88 A;  2QA8 B;  3WWR A;  5G44 A;  2ZXM A;  3DCU A;  3B0Q A;  5DV8 A;  5DV3 A;  2NPA A;  4M8H A;  2R40 A;  4MDD A;  5KYJ A;  3SP6 A;  4FGY A;  4G1Z A;  3KMG A;  1UHL A;  2G44 A;  1QKU A;  3UP0 A;  3ZRA A;  5DSH A;  3O1E A;  1SQN A;  2ZKC A;  2ZXZ A;  3OSI A;  4MGC A;  5DXK A;  2Q7L A;  2ZK2 A;  4P6X A;  2HAM A;  3SP9 A;  2HCD A;  3A3Z X;  3IA6 A;  4N5G A;  3RLJ A;  5DZ3 A;  2J4A A;  5L7H A;  1NRL A;  2QH6 A;  3F7D A;  5DXB A;  3VRW A;  5DVS A;  1PQ9 A;  4REE A;  2VV4 A;  1X7E A;  3HZF A;  3OKI A;  3VT6 A;  1XLS A;  3AUQ A;  3EYB A;  4MG6 A;  4OZT U;  3V3E A;  3N00 A;  3W0C A;  3OOF A;  4TUZ B;  4WLB A;  5E15 A;  2PIT A;  5FQR A;  1X7R A;  5AAU A;  5APK A;  3WGP A;  1T5Z A;  2F4B A;  2QA6 A;  1UOM A;  5KCD A;  3W0G A;  5KRC A;  5A86 A;  3MNE A;  4RE8 A;  4UDB A;  1ZDU A;  1L2J A;  2Q1H A;  2Q1V A;  4MG8 B;  4RMD A;  5AWJ A;  2PRG A;  3IPS A;  3ADT A;  1VJB A;  1Z95 A;  1XV9 A;  2ACL B;  5H1E A;  4PRG A;  1I37 A;  2YLQ A;  3H0A D;  4CI5 A;  3VN2 A;  3PRG A;  4S0S A;  2B1V A;  4G1Y A;  5SYZ A;  1SR7 A;  5AYG A;  2ZK3 A;  1NAV A;  1S9P A;  3KDT A;  4XT9 A;  5DXP A;  2BJ4 B;  3AX8 A;  2VV1 A;  5DWG A;  3VJT A;  1NAX A;  2G0H A;  3V3Q A;  2GPV A;  4RME A;  3TX7 B;  3H0A A;  1OVL A;  3CS8 A;  5KRK A;  2YHD A;  2Q7K A;  4ZNH A;  4X1F A;  1TFC A;  5KRJ A;  1E3K A;  4OKT A;  4PP3 A;  5DK9 A;  3AZ2 A;  3HLV A;  5CJ6 A;  5DRJ A;  4OC7 A;  4OJ9 A;  2QE4 A;  2XYX A;  4XI3 A;  5DXQ A;  5JY3 A;  1T76 A;  2PIP L;  2I4J A;  5DWI A;  5DXE A;  2YJD A;  4OH5 A;  5AVI A;  3TY0 A;  2E2R A;  3CJW A;  1MV9 A;  3JZC A;  4OEA A;  5AZT A;  2AMA A;  4A4V A;  4ZJR A;  5HCV A;  3AFR A;  5DMF A;  1K4W A;  3HC5 A;  4QL8 A;  3A2H A;  1ILG A;  3K6P A;  5DXM A;  2XKW A;  2JFA B;  3WT6 A;  4OEZ A;  4JGV A;  4E4Q A;  1ZEO A;  5G3J A;  3OMP A;  4J24 A;  1M2Z A;  3B0R A;  3L03 A;  2QNV A;  1S0Z A;  2P1T A;  4MGB B;  1FM9 D;  3F5C A;  2Q7J A;  4S0T A;  2ZLC A;  3OKH A;  3AZ1 A;  4A2J A;  1P8D A;  4JYG A;  1FD0 A; 
#chains in the Genus database with same CATH topology
 1LV2 A;  4K7A A;  3D24 A;  4MG7 A;  2Q61 A;  2JF9 A;  5FQV A;  3OMK A;  3GBK A;  5C4T A;  1RJK A;  2JJ3 A;  3R2A A;  5G42 A;  4XUH A;  4G2H A;  1FM9 A;  4Q0A C;  2QR9 A;  5KCU A;  4NB6 A;  5G46 A;  1G5Y A;  2H79 A;  4RUP A;  1X7B A;  1T79 A;  4WPF A;  5DZ1 A;  4OED A;  5DL4 A;  2B1Z A;  3CWD A;  3VT7 A;  1YA3 A;  4JAZ A;  2J7Y A;  3FXV A;  3H52 A;  5DKG A;  5AVL A;  5LGA A;  1RK3 A;  5C4O A;  4LBD A;  3JZB A;  3RUT A;  2PIO A;  2GPO A;  1TXI A;  1X78 A;  2QZO A;  5C4S A;  1T7R A;  2QGT A;  2J7X A;  4REF A;  4XLD A;  3E00 D;  3LMP A;  2ZK4 A;  1UHL B;  3L0L A;  1U3S A;  4B7W A;  3ADU A;  1XAP A;  5DRM A;  1YOW A;  3U9Q A;  4QE6 A;  5DUE A;  1ILH A;  3CS4 A;  2ZFX A;  3DY6 A;  4ITE A;  4N8R A;  5DP0 A;  1XNN A;  2AA2 A;  4ZO1 B;  4IA7 A;  3ADV A;  4EM9 A;  3V4A A;  2ZBS A;  2EWP A;  2O4J A;  3E00 A;  3B1M A;  5KCE A;  5DXB B;  5B41 A;  3R5M A;  2GTK A;  2R40 D;  4G1D A;  4IW8 A;  2YFE A;  2VV4 B;  4TV1 A;  5DYB A;  2XYJ A;  4ZJW A;  5KRH A;  2PKL A;  1ERE A;  2AA7 A;  1NYX A;  3VTD A;  1ZH7 A;  2NXX E;  2Q59 A;  2YLY A;  3B0T A;  3HM1 A;  3FUG A;  5IXK A;  5KRM A;  1YMT A;  5FQT A;  3VSP A;  1UPW A;  1R5K A;  4OZR E;  2Q70 A;  2ZNQ A;  3VJH A;  4N73 A;  4OIL A;  2Q60 A;  3ERT A;  4L98 A;  3OSW A;  1U3R A;  3VT9 A;  2IOG A;  3D6D A;  1I38 A;  3A2I A;  3W5Q A;  4KZM A;  2AA5 A;  5E19 A;  4O8F A;  2Z4J A;  1YIN A;  3A2J A;  1PCG A;  2GIU A;  2PJL A;  4JYI A;  3HQ5 A;  2A3I A;  3B67 A;  3W5R A;  5G45 A;  2ZNP A;  4E4K A;  5KD9 A;  3KBA A;  1KKQ A;  3OMO A;  3OZ0 A;  4ZOM A;  2P7G A;  5DTV A;  4OKB A;  3WJ4 A;  5GIC A;  4DOS A;  2HVC A;  1XV9 B;  1R6G A;  5E0X A;  5DZ0 A;  5KYA A;  2R6W A;  1NHZ A;  3UUD A;  5KRF A;  5E14 A;  3B5R A;  3W5P A;  3B65 A;  4K6I A;  5DU5 A;  2PIW A;  3OGT A;  3R29 A;  5KRL A;  4XUM A;  4Q13 A;  4YPQ A;  1N46 A;  3KMZ A;  3X1I A;  5C4U A;  4IVY A;  2OM9 A;  3TKM A;  2VV1 B;  1T63 A;  3IMY A;  3FLI A;  2Q6J A;  3OS8 A;  3R8D A;  2OUZ A;  1T7M A;  1HJ1 A;  2P54 A;  1OVL B;  2YJA B;  3DT3 A;  1Y0S A;  1M13 A;  1GWR A;  5DX3 A;  5GIE A;  1NQ1 A;  3Q95 A;  3W0J A;  2AX7 A;  3E94 A;  3FS1 A;  4DK7 A;  1RDT D;  4CI4 A;  5IZ0 A;  2OAX A;  5DLR A;  1XQ3 A;  1YUC A;  2QXM A;  2PIR A;  5KRO A;  2ZLA A;  4IA1 A;  4M8E A;  5KRA A;  4IWF A;  3FAL A;  4ZO1 X;  1Y9R A;  2AWH A;  1N83 A;  5JJM B;  3HO0 A;  1IE9 A;  2OCF A;  2W8Y A;  1RDT A;  3OLS A;  3B66 A;  5M96 A;  4RFW A;  4YNK A;  4OEY A;  3VT3 A;  3DCT A;  1QKM A;  1OSH A;  2HAR A;  4DM8 A;  2P4Y A;  1ZUC A;  2ZK1 A;  4DK8 A;  5KCF A;  1Z5X U;  3F5C B;  4G20 A;  3UVV A;  1XIU A;  1GWX A;  4J26 A;  3GN8 A;  4ZNW A;  4RZF A;  1XVP B;  1GS4 A;  4IUI A;  5APH A;  4YT1 A;  3R8I A;  1I7G A;  2QSE A;  3FEI A;  2YLO A;  4MG7 B;  1RKH A;  3BC5 A;  2H77 A;  3VTB A;  2R6Y A;  3KFC A;  4XAO A;  2ZK0 A;  2ZXN A;  1XNX A;  1BSX A;  3QT0 A;  5E1C A;  4WVD A;  2AYR A;  3VJI A;  4OHA A;  1T7F A;  5KCW A;  4YMQ A;  4EMA A;  5AK2 A;  5G43 A;  5JJM A;  4ONI A;  5L7G A;  5ICK A;  4J5X A;  1G50 A;  5DXR A;  3KDU A;  1DKF A;  1XDK A;  2PIU A;  2POB A;  1KV6 A;  4PPP A;  2Q3Y A;  5DXG A;  3DZY D;  1A52 A;  1QKN A;  3PEQ A;  5AWK A;  1IE8 A;  3R5N A;  3CDS A;  5DUG A;  3VT4 A;  3FEJ A;  3OLL A;  2QZO B;  4WHF A;  4DOR A;  3T03 A;  2VV0 A;  5DWL A;  4CSJ A;  3L1B A;  2I4Z A;  3IXP D;  1XVP A;  3IPQ A;  1S0X A;  3M7R A;  3DZY A;  5DKB A;  3VT5 A;  2NV7 A;  2ZMJ A;  1K74 D;  1UPV A;  3X36 A;  3ET3 A;  5DZH A;  4JL4 A;  5FQS A;  4DM6 A;  1Y0X X;  3S9S A;  1PRG A;  3IXP A;  1PQC A;  2B23 A;  2V7C A;  3W0H A;  4ZI1 A;  3G9E A;  4TV1 B;  2ZNN A;  4ZN7 A;  3MNO A;  5E0W A;  3X31 A;  1K74 A;  2IHQ A;  2Q59 B;  1S9Q A;  3HC6 A;  3ZQT A;  4DMA A;  3OLF A;  2ABI A;  2Q6S A;  1NUO A;  2PIQ A;  1FCY A;  2P15 A;  4FNE A;  3G8O A;  4OZT E;  3UP3 A;  5DIG A;  3UU7 A;  4MG9 A;  1MZN A;  3W0A A;  3FC6 B;  5KCC A;  1PZL A;  5EHJ A;  2QGW A;  2B50 A;  2XHS A;  3D5F A;  4HEE X;  4HLW A;  3W0I A;  2AX9 A;  4P6W A;  2I0G A;  3PLZ A;  4RUO X;  3OAP A;  4OAR A;  4MG5 A;  2QTU A;  3V49 A;  2YLP A;  1L2I A;  3L3Z A;  3UUC A;  4OKW A;  1KNU A;  2I4P A;  1XJ7 A;  1S19 A;  4J5W C;  4LNX A;  2P1U A;  2VV3 A;  3G8I A;  4QJR A;  4IA2 A;  1I7I A;  3OSA A;  4S14 A;  2HWR A;  3VTC A;  3UUD B;  1OT7 A;  1DB1 A;  1NQ0 A;  4FHI A;  2IOK A;  4RZE A;  2GPP A;  4Q50 A;  4FN9 A;  2HWQ A;  3WMH A;  5DID A;  4OK1 A;  3VI8 A;  1T73 A;  2Q8S A;  5APJ A;  3X1H A;  4NQA B;  2AAX A;  2ZL9 A;  5DUH A;  3FC6 A;  4N1Y A;  3UUA A;  4OH6 A;  3TKC A;  5DYD A;  2XYW A;  3A9E A;  4IV4 A;  5EJV A;  5HYR A;  1X7J A;  2PIN A;  1ERR A;  3WTQ A;  1YJE A;  5DX3 B;  3RUU A;  4PPS A;  2PIX A;  3PO9 A;  3B68 A;  3IPU A;  3Q95 B;  3K22 A;  4KZJ A;  4XTA A;  1LBD A;  4MGD A;  1PK5 A;  3WFF A;  4ZNT A;  2Z4B A;  3AN3 A;  4OJB A;  4OFU A;  1YIM A;  4XHD A;  3CQV A;  4JYH A;  4PVU A;  4NIE A;  4NY9 A;  4OGH A;  4Y29 A;  3V9Y A;  3W0Y A;  3FAL B;  5DVC A;  2LBD A;  3GZ9 A;  2ZK5 A;  4APU A;  4DQM A;  5KRI A;  4OKX A;  3LBD A;  2G0G A;  1U3Q A;  2HB7 A;  3CDP A;  4ITF A;  1PDU A;  1ZKY A;  3GWS X;  4IVW A;  3RVF A;  3MNP A;  4POJ A;  2NXX A;  1QKT A;  2QXS A;  4MGA A;  4BCR A;  4E2J A;  1T74 A;  4KZI A;  1K7L A;  3ILZ A;  5EI1 A;  3DR1 A;  3D57 A;  2AM9 A;  5E7V A;  1YYE A;  3A40 X;  3AUR A;  3UVV B;  1T7T A;  4WQP A;  4ZNS A;  1GWQ A;  3VT8 A;  2QPY A;  4LNW A;  3ET2 A;  3ET0 A;  1M7W A;  1R20 D;  5JI0 D;  5DKS A;  1XB7 A;  3VHW A;  3G0W A;  1XPC A;  2QMV A;  3FUR A;  3V9T A;  3WT5 A;  2QA8 A;  2AB2 A;  3ET1 A;  5ACC A;  2ZK6 A;  3OS8 C;  3SZ1 A;  2GP7 A;  3VRT A;  2Q5P A;  1SJ0 A;  1YY4 A;  1FCZ A;  5G5W A;  4OFR A;  4RZG A;  3AUN A;  1DKF B;  1XDK B;  1EXA A;  1R20 A;  3ADW A;  2ZMH A;  3K8S A;  3AZ3 A;  1P93 A;  3NOA A;  1ZAF A;  1A28 A;  3PCU A;  4G21 A;  1FM6 D;  4IU7 A;  4QE8 A;  5DY8 A;  1XZX X;  2ZY0 A;  3ZRB A;  5KCT A;  5HZC A;  1R1K D;  3DZU D;  3BQD A;  4IS8 A;  3OMM A;  5L7E A;  2GL8 A;  5DWE A;  4IQR A;  4NUF A;  2P1V A;  1NQ7 A;  1ZDT A;  4A4W A;  1FM6 A;  1WM0 X;  2REW A;  4POH A;  5DV6 A;  3VRU A;  4OLM A;  4WHG A;  5EC9 A;  1PQ6 A;  3KPZ A;  1G2N A;  2G5O A;  3L0J A;  2OVM A;  4LSJ A;  1R1K A;  3P8X A;  4OZR U;  3DZU A;  4OIV A;  2PIV A;  1N4H A;  4PP5 A;  2Q6R A;  4TUZ A;  1XQC A;  4G2I A;  3V9V A;  2HB8 A;  3PBA A;  3CLD A;  5B5B A;  4ZNV A;  5AAV B;  5L11 A;  3ADS A;  2J14 A;  3GD2 A;  4RUJ A;  4L96 A;  4PLD A;  3OS9 A;  2AX6 A;  3A78 A;  4RMC A;  2AXA A;  4PXM A;  3UU7 B;  2VSR A;  4PP6 A;  4RWV A;  4MG9 B;  5F9B A;  3VSO A;  2AX8 A;  3WFG A;  2QW4 A;  4MG8 A;  2POG A;  2NW4 A;  2VV2 A;  3P0U A;  5GT4 A;  1FBY A;  5DWJ A;  5HJP B;  1XP9 A;  4UDA A;  3B0W A;  4FHH A;  4X1G A;  1OSV A;  3ZR7 A;  3HVL A;  2ACL A;  4J5X C;  1FCX A;  3W5T A;  1NDE A;  3VRV A;  5AZV A;  1HG4 A;  2I0J A;  4ZNU A;  5FQP A;  4R2U A;  3CTB A;  3L3X A;  4RAK A;  3KYT A;  5AAV A;  2BJ4 A;  2PNU A;  2HC4 A;  2V0V A;  3WJ5 A;  2QAB A;  5ETH A;  3RY9 A;  1YOK A;  2ZMI A;  1G1U A;  4R6S A;  3UUA B;  3VHU A;  5DMC A;  3VHV A;  2OVH A;  3OMQ A;  4OJ4 A;  5HJP A;  3A9E B;  3KMR A;  2HAS A;  2O4R A;  3BEJ A;  5K13 A;  3KWY A;  3AN4 A;  4K4J A;  4R06 A;  4IWC A;  3D90 A;  1EXX A;  3ERD A;  5IAW A;  1T65 A;  1XOW A;  2HBH A;  2P7A A;  1ZGY A;  2YAT A;  4MGD B;  4S15 A;  2AA6 A;  3B3K A;  1Q4X A;  3HOD A;  5DIE A;  3VJS A;  5I4V A;  2AMB A;  2FSZ A;  3GYU A;  3OOK A;  3P89 A;  2Q5S A;  1E3G A;  2ZAS A;  3K23 A;  4LTW A;  5HJS A;  4IV2 A;  2FVJ A;  5DI7 A;  1XP6 A;  1YP0 A;  2BAW A;  2JFA A;  5DVV A;  1NQ2 A;  5DKE A;  2ATH A;  3ADX A;  3R8A A;  5HYK A;  4J5W A;  3O1D A;  2Q5G A;  2AO6 A;  2O9I A;  2ZVT A;  4MGB A;  5EGV A;  5KR9 A;  1XP1 A;  3GYT A;  2GPU A;  4UDC A;  5GID A;  4QK4 A;  3L0E A;  4ZN9 A;  2VST A;  4MGA B;  2FAI A;  1MVC A;  3GWX A;  2ZNO A;  4PWL A;  5LWP A;  2P7Z A;  3NSQ A;  3OZJ A;  4IA3 A;  5EIT A;  3CS6 A;  3NSP A;  3RLL A;  1H9U A;  1RKG A;  1XLS E;  4QM0 A;  1Z5X E;  4PLE A;  2Q7I A;  4IW6 A;  4OIU A;  5DZI A;  2GWX A;  2OZ7 A;  4PF3 A;  4F9M A;  3E7C A;  3WT7 A;  1U9E A;  1X76 A;  2HFP A;  4UDD A;  1SKX A;  3P88 A;  2QA8 B;  3WWR A;  5G44 A;  2ZXM A;  3DCU A;  3B0Q A;  5DV8 A;  5DV3 A;  2NPA A;  4M8H A;  2R40 A;  4MDD A;  5KYJ A;  3SP6 A;  4FGY A;  4G1Z A;  3KMG A;  1UHL A;  2G44 A;  1QKU A;  3UP0 A;  3ZRA A;  5DSH A;  3O1E A;  1SQN A;  2ZKC A;  2ZXZ A;  3OSI A;  4MGC A;  5DXK A;  2Q7L A;  2ZK2 A;  4P6X A;  2HAM A;  3SP9 A;  2HCD A;  3A3Z X;  3IA6 A;  4N5G A;  3RLJ A;  5DZ3 A;  2J4A A;  5L7H A;  1NRL A;  2QH6 A;  3F7D A;  5DXB A;  3VRW A;  5DVS A;  1PQ9 A;  4REE A;  2VV4 A;  1X7E A;  3HZF A;  3OKI A;  3VT6 A;  1XLS A;  3AUQ A;  3EYB A;  4MG6 A;  4OZT U;  3V3E A;  3N00 A;  3W0C A;  3OOF A;  4TUZ B;  4WLB A;  5E15 A;  2PIT A;  5FQR A;  1X7R A;  5AAU A;  5APK A;  3WGP A;  1T5Z A;  2F4B A;  2QA6 A;  1UOM A;  5KCD A;  3W0G A;  5KRC A;  5A86 A;  3MNE A;  4RE8 A;  4UDB A;  1ZDU A;  1L2J A;  2Q1H A;  2Q1V A;  4MG8 B;  4RMD A;  5AWJ A;  2PRG A;  3IPS A;  3ADT A;  1VJB A;  1Z95 A;  1XV9 A;  2ACL B;  5H1E A;  4PRG A;  1I37 A;  2YLQ A;  3H0A D;  4CI5 A;  3VN2 A;  3PRG A;  4S0S A;  2B1V A;  4G1Y A;  5SYZ A;  1SR7 A;  5AYG A;  2ZK3 A;  1NAV A;  1S9P A;  3KDT A;  4XT9 A;  5DXP A;  2BJ4 B;  3AX8 A;  2VV1 A;  5DWG A;  3VJT A;  1NAX A;  2G0H A;  3V3Q A;  2GPV A;  4RME A;  3TX7 B;  3H0A A;  1OVL A;  3CS8 A;  5KRK A;  2YHD A;  2Q7K A;  4ZNH A;  4X1F A;  1TFC A;  5KRJ A;  1E3K A;  4OKT A;  4PP3 A;  5DK9 A;  3AZ2 A;  3HLV A;  5CJ6 A;  5DRJ A;  4OC7 A;  4OJ9 A;  2QE4 A;  2XYX A;  4XI3 A;  5DXQ A;  5JY3 A;  1T76 A;  2PIP L;  2I4J A;  5DWI A;  5DXE A;  2YJD A;  4OH5 A;  5AVI A;  3TY0 A;  2E2R A;  3CJW A;  1MV9 A;  3JZC A;  4OEA A;  5AZT A;  2AMA A;  4A4V A;  4ZJR A;  5HCV A;  3AFR A;  5DMF A;  1K4W A;  3HC5 A;  4QL8 A;  3A2H A;  1ILG A;  3K6P A;  5DXM A;  2XKW A;  2JFA B;  3WT6 A;  4OEZ A;  4JGV A;  4E4Q A;  1ZEO A;  5G3J A;  3OMP A;  4J24 A;  1M2Z A;  3B0R A;  3L03 A;  2QNV A;  1S0Z A;  2P1T A;  4MGB B;  1FM9 D;  3F5C A;  2Q7J A;  4S0T A;  2ZLC A;  3OKH A;  3AZ1 A;  4A2J A;  1P8D A;  4JYG A;  1FD0 A; 
#chains in the Genus database with same CATH homology
 1LV2 A;  4K7A A;  3D24 A;  4MG7 A;  2Q61 A;  2JF9 A;  5FQV A;  3OMK A;  3GBK A;  5C4T A;  1RJK A;  2JJ3 A;  3R2A A;  5G42 A;  4XUH A;  4G2H A;  1FM9 A;  4Q0A C;  2QR9 A;  5KCU A;  4NB6 A;  5G46 A;  1G5Y A;  2H79 A;  4RUP A;  1X7B A;  1T79 A;  4WPF A;  5DZ1 A;  4OED A;  5DL4 A;  2B1Z A;  3CWD A;  3VT7 A;  1YA3 A;  4JAZ A;  2J7Y A;  3FXV A;  3H52 A;  5DKG A;  5AVL A;  5LGA A;  1RK3 A;  5C4O A;  4LBD A;  3JZB A;  3RUT A;  2PIO A;  2GPO A;  1TXI A;  1X78 A;  2QZO A;  5C4S A;  1T7R A;  2QGT A;  2J7X A;  4REF A;  4XLD A;  3E00 D;  3LMP A;  2ZK4 A;  1UHL B;  3L0L A;  1U3S A;  4B7W A;  3ADU A;  1XAP A;  5DRM A;  1YOW A;  3U9Q A;  4QE6 A;  5DUE A;  1ILH A;  3CS4 A;  2ZFX A;  3DY6 A;  4ITE A;  4N8R A;  5DP0 A;  1XNN A;  2AA2 A;  4ZO1 B;  4IA7 A;  3ADV A;  4EM9 A;  3V4A A;  2ZBS A;  2EWP A;  2O4J A;  3E00 A;  3B1M A;  5KCE A;  5DXB B;  5B41 A;  3R5M A;  2GTK A;  2R40 D;  4G1D A;  4IW8 A;  2YFE A;  2VV4 B;  4TV1 A;  5DYB A;  2XYJ A;  4ZJW A;  5KRH A;  2PKL A;  1ERE A;  2AA7 A;  1NYX A;  3VTD A;  1ZH7 A;  2NXX E;  2Q59 A;  2YLY A;  3B0T A;  3HM1 A;  3FUG A;  5IXK A;  5KRM A;  1YMT A;  5FQT A;  3VSP A;  1UPW A;  1R5K A;  4OZR E;  2Q70 A;  2ZNQ A;  3VJH A;  4N73 A;  4OIL A;  2Q60 A;  3ERT A;  4L98 A;  3OSW A;  1U3R A;  3VT9 A;  2IOG A;  3D6D A;  1I38 A;  3A2I A;  3W5Q A;  4KZM A;  2AA5 A;  5E19 A;  4O8F A;  2Z4J A;  1YIN A;  3A2J A;  1PCG A;  2GIU A;  2PJL A;  4JYI A;  3HQ5 A;  2A3I A;  3B67 A;  3W5R A;  5G45 A;  2ZNP A;  4E4K A;  5KD9 A;  3KBA A;  1KKQ A;  3OMO A;  3OZ0 A;  4ZOM A;  2P7G A;  5DTV A;  4OKB A;  3WJ4 A;  5GIC A;  4DOS A;  2HVC A;  1XV9 B;  1R6G A;  5E0X A;  5DZ0 A;  5KYA A;  2R6W A;  1NHZ A;  3UUD A;  5KRF A;  5E14 A;  3B5R A;  3W5P A;  3B65 A;  4K6I A;  5DU5 A;  2PIW A;  3OGT A;  3R29 A;  5KRL A;  4XUM A;  4Q13 A;  4YPQ A;  1N46 A;  3KMZ A;  3X1I A;  5C4U A;  4IVY A;  2OM9 A;  3TKM A;  2VV1 B;  1T63 A;  3IMY A;  3FLI A;  2Q6J A;  3OS8 A;  3R8D A;  2OUZ A;  1T7M A;  1HJ1 A;  2P54 A;  1OVL B;  2YJA B;  3DT3 A;  1Y0S A;  1M13 A;  1GWR A;  5DX3 A;  5GIE A;  1NQ1 A;  3Q95 A;  3W0J A;  2AX7 A;  3E94 A;  3FS1 A;  4DK7 A;  1RDT D;  4CI4 A;  5IZ0 A;  2OAX A;  5DLR A;  1XQ3 A;  1YUC A;  2QXM A;  2PIR A;  5KRO A;  2ZLA A;  4IA1 A;  4M8E A;  5KRA A;  4IWF A;  3FAL A;  4ZO1 X;  1Y9R A;  2AWH A;  1N83 A;  5JJM B;  3HO0 A;  1IE9 A;  2OCF A;  2W8Y A;  1RDT A;  3OLS A;  3B66 A;  5M96 A;  4RFW A;  4YNK A;  4OEY A;  3VT3 A;  3DCT A;  1QKM A;  1OSH A;  2HAR A;  4DM8 A;  2P4Y A;  1ZUC A;  2ZK1 A;  4DK8 A;  5KCF A;  1Z5X U;  3F5C B;  4G20 A;  3UVV A;  1XIU A;  1GWX A;  4J26 A;  3GN8 A;  4ZNW A;  4RZF A;  1XVP B;  1GS4 A;  4IUI A;  5APH A;  4YT1 A;  3R8I A;  1I7G A;  2QSE A;  3FEI A;  2YLO A;  4MG7 B;  1RKH A;  3BC5 A;  2H77 A;  3VTB A;  2R6Y A;  3KFC A;  4XAO A;  2ZK0 A;  2ZXN A;  1XNX A;  1BSX A;  3QT0 A;  5E1C A;  4WVD A;  2AYR A;  3VJI A;  4OHA A;  1T7F A;  5KCW A;  4YMQ A;  4EMA A;  5AK2 A;  5G43 A;  5JJM A;  4ONI A;  5L7G A;  5ICK A;  4J5X A;  1G50 A;  5DXR A;  3KDU A;  1DKF A;  1XDK A;  2PIU A;  2POB A;  1KV6 A;  4PPP A;  2Q3Y A;  5DXG A;  3DZY D;  1A52 A;  1QKN A;  3PEQ A;  5AWK A;  1IE8 A;  3R5N A;  3CDS A;  5DUG A;  3VT4 A;  3FEJ A;  3OLL A;  2QZO B;  4WHF A;  4DOR A;  3T03 A;  2VV0 A;  5DWL A;  4CSJ A;  3L1B A;  2I4Z A;  3IXP D;  1XVP A;  3IPQ A;  1S0X A;  3M7R A;  3DZY A;  5DKB A;  3VT5 A;  2NV7 A;  2ZMJ A;  1K74 D;  1UPV A;  3X36 A;  3ET3 A;  5DZH A;  4JL4 A;  5FQS A;  4DM6 A;  1Y0X X;  3S9S A;  1PRG A;  3IXP A;  1PQC A;  2B23 A;  2V7C A;  3W0H A;  4ZI1 A;  3G9E A;  4TV1 B;  2ZNN A;  4ZN7 A;  3MNO A;  5E0W A;  3X31 A;  1K74 A;  2IHQ A;  2Q59 B;  1S9Q A;  3HC6 A;  3ZQT A;  4DMA A;  3OLF A;  2ABI A;  2Q6S A;  1NUO A;  2PIQ A;  1FCY A;  2P15 A;  4FNE A;  3G8O A;  4OZT E;  3UP3 A;  5DIG A;  3UU7 A;  4MG9 A;  1MZN A;  3W0A A;  3FC6 B;  5KCC A;  1PZL A;  5EHJ A;  2QGW A;  2B50 A;  2XHS A;  3D5F A;  4HEE X;  4HLW A;  3W0I A;  2AX9 A;  4P6W A;  2I0G A;  3PLZ A;  4RUO X;  3OAP A;  4OAR A;  4MG5 A;  2QTU A;  3V49 A;  2YLP A;  1L2I A;  3L3Z A;  3UUC A;  4OKW A;  1KNU A;  2I4P A;  1XJ7 A;  1S19 A;  4J5W C;  4LNX A;  2P1U A;  2VV3 A;  3G8I A;  4QJR A;  4IA2 A;  1I7I A;  3OSA A;  4S14 A;  2HWR A;  3VTC A;  3UUD B;  1OT7 A;  1DB1 A;  1NQ0 A;  4FHI A;  2IOK A;  4RZE A;  2GPP A;  4Q50 A;  4FN9 A;  2HWQ A;  3WMH A;  5DID A;  4OK1 A;  3VI8 A;  1T73 A;  2Q8S A;  5APJ A;  3X1H A;  4NQA B;  2AAX A;  2ZL9 A;  5DUH A;  3FC6 A;  4N1Y A;  3UUA A;  4OH6 A;  3TKC A;  5DYD A;  2XYW A;  3A9E A;  4IV4 A;  5EJV A;  5HYR A;  1X7J A;  2PIN A;  1ERR A;  3WTQ A;  1YJE A;  5DX3 B;  3RUU A;  4PPS A;  2PIX A;  3PO9 A;  3B68 A;  3IPU A;  3Q95 B;  3K22 A;  4KZJ A;  4XTA A;  1LBD A;  4MGD A;  1PK5 A;  3WFF A;  4ZNT A;  2Z4B A;  3AN3 A;  4OJB A;  4OFU A;  1YIM A;  4XHD A;  3CQV A;  4JYH A;  4PVU A;  4NIE A;  4NY9 A;  4OGH A;  4Y29 A;  3V9Y A;  3W0Y A;  3FAL B;  5DVC A;  2LBD A;  3GZ9 A;  2ZK5 A;  4APU A;  4DQM A;  5KRI A;  4OKX A;  3LBD A;  2G0G A;  1U3Q A;  2HB7 A;  3CDP A;  4ITF A;  1PDU A;  1ZKY A;  3GWS X;  4IVW A;  3RVF A;  3MNP A;  4POJ A;  2NXX A;  1QKT A;  2QXS A;  4MGA A;  4BCR A;  4E2J A;  1T74 A;  4KZI A;  1K7L A;  3ILZ A;  5EI1 A;  3DR1 A;  3D57 A;  2AM9 A;  5E7V A;  1YYE A;  3A40 X;  3AUR A;  3UVV B;  1T7T A;  4WQP A;  4ZNS A;  1GWQ A;  3VT8 A;  2QPY A;  4LNW A;  3ET2 A;  3ET0 A;  1M7W A;  1R20 D;  5JI0 D;  5DKS A;  1XB7 A;  3VHW A;  3G0W A;  1XPC A;  2QMV A;  3FUR A;  3V9T A;  3WT5 A;  2QA8 A;  2AB2 A;  3ET1 A;  5ACC A;  2ZK6 A;  3OS8 C;  3SZ1 A;  2GP7 A;  3VRT A;  2Q5P A;  1SJ0 A;  1YY4 A;  1FCZ A;  5G5W A;  4OFR A;  4RZG A;  3AUN A;  1DKF B;  1XDK B;  1EXA A;  1R20 A;  3ADW A;  2ZMH A;  3K8S A;  3AZ3 A;  1P93 A;  3NOA A;  1ZAF A;  1A28 A;  3PCU A;  4G21 A;  1FM6 D;  4IU7 A;  4QE8 A;  5DY8 A;  1XZX X;  2ZY0 A;  3ZRB A;  5KCT A;  5HZC A;  1R1K D;  3DZU D;  3BQD A;  4IS8 A;  3OMM A;  5L7E A;  2GL8 A;  5DWE A;  4IQR A;  4NUF A;  2P1V A;  1NQ7 A;  1ZDT A;  4A4W A;  1FM6 A;  1WM0 X;  2REW A;  4POH A;  5DV6 A;  3VRU A;  4OLM A;  4WHG A;  5EC9 A;  1PQ6 A;  3KPZ A;  1G2N A;  2G5O A;  3L0J A;  2OVM A;  4LSJ A;  1R1K A;  3P8X A;  4OZR U;  3DZU A;  4OIV A;  2PIV A;  1N4H A;  4PP5 A;  2Q6R A;  4TUZ A;  1XQC A;  4G2I A;  3V9V A;  2HB8 A;  3PBA A;  3CLD A;  5B5B A;  4ZNV A;  5AAV B;  5L11 A;  3ADS A;  2J14 A;  3GD2 A;  4RUJ A;  4L96 A;  4PLD A;  3OS9 A;  2AX6 A;  3A78 A;  4RMC A;  2AXA A;  4PXM A;  3UU7 B;  2VSR A;  4PP6 A;  4RWV A;  4MG9 B;  5F9B A;  3VSO A;  2AX8 A;  3WFG A;  2QW4 A;  4MG8 A;  2POG A;  2NW4 A;  2VV2 A;  3P0U A;  5GT4 A;  1FBY A;  5DWJ A;  5HJP B;  1XP9 A;  4UDA A;  3B0W A;  4FHH A;  4X1G A;  1OSV A;  3ZR7 A;  3HVL A;  2ACL A;  4J5X C;  1FCX A;  3W5T A;  1NDE A;  3VRV A;  5AZV A;  1HG4 A;  2I0J A;  4ZNU A;  5FQP A;  4R2U A;  3CTB A;  3L3X A;  4RAK A;  3KYT A;  5AAV A;  2BJ4 A;  2PNU A;  2HC4 A;  2V0V A;  3WJ5 A;  2QAB A;  5ETH A;  3RY9 A;  1YOK A;  2ZMI A;  1G1U A;  4R6S A;  3UUA B;  3VHU A;  5DMC A;  3VHV A;  2OVH A;  3OMQ A;  4OJ4 A;  5HJP A;  3A9E B;  3KMR A;  2HAS A;  2O4R A;  3BEJ A;  5K13 A;  3KWY A;  3AN4 A;  4K4J A;  4R06 A;  4IWC A;  3D90 A;  1EXX A;  3ERD A;  5IAW A;  1T65 A;  1XOW A;  2HBH A;  2P7A A;  1ZGY A;  2YAT A;  4MGD B;  4S15 A;  2AA6 A;  3B3K A;  1Q4X A;  3HOD A;  5DIE A;  3VJS A;  5I4V A;  2AMB A;  2FSZ A;  3GYU A;  3OOK A;  3P89 A;  2Q5S A;  1E3G A;  2ZAS A;  3K23 A;  4LTW A;  5HJS A;  4IV2 A;  2FVJ A;  5DI7 A;  1XP6 A;  1YP0 A;  2BAW A;  2JFA A;  5DVV A;  1NQ2 A;  5DKE A;  2ATH A;  3ADX A;  3R8A A;  5HYK A;  4J5W A;  3O1D A;  2Q5G A;  2AO6 A;  2O9I A;  2ZVT A;  4MGB A;  5EGV A;  5KR9 A;  1XP1 A;  3GYT A;  2GPU A;  4UDC A;  5GID A;  4QK4 A;  3L0E A;  4ZN9 A;  2VST A;  4MGA B;  2FAI A;  1MVC A;  3GWX A;  2ZNO A;  4PWL A;  5LWP A;  2P7Z A;  3NSQ A;  3OZJ A;  4IA3 A;  5EIT A;  3CS6 A;  3NSP A;  3RLL A;  1H9U A;  1RKG A;  1XLS E;  4QM0 A;  1Z5X E;  4PLE A;  2Q7I A;  4IW6 A;  4OIU A;  5DZI A;  2GWX A;  2OZ7 A;  4PF3 A;  4F9M A;  3E7C A;  3WT7 A;  1U9E A;  1X76 A;  2HFP A;  4UDD A;  1SKX A;  3P88 A;  2QA8 B;  3WWR A;  5G44 A;  2ZXM A;  3DCU A;  3B0Q A;  5DV8 A;  5DV3 A;  2NPA A;  4M8H A;  2R40 A;  4MDD A;  5KYJ A;  3SP6 A;  4FGY A;  4G1Z A;  3KMG A;  1UHL A;  2G44 A;  1QKU A;  3UP0 A;  3ZRA A;  5DSH A;  3O1E A;  1SQN A;  2ZKC A;  2ZXZ A;  3OSI A;  4MGC A;  5DXK A;  2Q7L A;  2ZK2 A;  4P6X A;  2HAM A;  3SP9 A;  2HCD A;  3A3Z X;  3IA6 A;  4N5G A;  3RLJ A;  5DZ3 A;  2J4A A;  5L7H A;  1NRL A;  2QH6 A;  3F7D A;  5DXB A;  3VRW A;  5DVS A;  1PQ9 A;  4REE A;  2VV4 A;  1X7E A;  3HZF A;  3OKI A;  3VT6 A;  1XLS A;  3AUQ A;  3EYB A;  4MG6 A;  4OZT U;  3V3E A;  3N00 A;  3W0C A;  3OOF A;  4TUZ B;  4WLB A;  5E15 A;  2PIT A;  5FQR A;  1X7R A;  5AAU A;  5APK A;  3WGP A;  1T5Z A;  2F4B A;  2QA6 A;  1UOM A;  5KCD A;  3W0G A;  5KRC A;  5A86 A;  3MNE A;  4RE8 A;  4UDB A;  1ZDU A;  1L2J A;  2Q1H A;  2Q1V A;  4MG8 B;  4RMD A;  5AWJ A;  2PRG A;  3IPS A;  3ADT A;  1VJB A;  1Z95 A;  1XV9 A;  2ACL B;  5H1E A;  4PRG A;  1I37 A;  2YLQ A;  3H0A D;  4CI5 A;  3VN2 A;  3PRG A;  4S0S A;  2B1V A;  4G1Y A;  5SYZ A;  1SR7 A;  5AYG A;  2ZK3 A;  1NAV A;  1S9P A;  3KDT A;  4XT9 A;  5DXP A;  2BJ4 B;  3AX8 A;  2VV1 A;  5DWG A;  3VJT A;  1NAX A;  2G0H A;  3V3Q A;  2GPV A;  4RME A;  3TX7 B;  3H0A A;  1OVL A;  3CS8 A;  5KRK A;  2YHD A;  2Q7K A;  4ZNH A;  4X1F A;  1TFC A;  5KRJ A;  1E3K A;  4OKT A;  4PP3 A;  5DK9 A;  3AZ2 A;  3HLV A;  5CJ6 A;  5DRJ A;  4OC7 A;  4OJ9 A;  2QE4 A;  2XYX A;  4XI3 A;  5DXQ A;  5JY3 A;  1T76 A;  2PIP L;  2I4J A;  5DWI A;  5DXE A;  2YJD A;  4OH5 A;  5AVI A;  3TY0 A;  2E2R A;  3CJW A;  1MV9 A;  3JZC A;  4OEA A;  5AZT A;  2AMA A;  4A4V A;  4ZJR A;  5HCV A;  3AFR A;  5DMF A;  1K4W A;  3HC5 A;  4QL8 A;  3A2H A;  1ILG A;  3K6P A;  5DXM A;  2XKW A;  2JFA B;  3WT6 A;  4OEZ A;  4JGV A;  4E4Q A;  1ZEO A;  5G3J A;  3OMP A;  4J24 A;  1M2Z A;  3B0R A;  3L03 A;  2QNV A;  1S0Z A;  2P1T A;  4MGB B;  1FM9 D;  3F5C A;  2Q7J A;  4S0T A;  2ZLC A;  3OKH A;  3AZ1 A;  4A2J A;  1P8D A;  4JYG A;  1FD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...