5L7GA

Mcr in complex with ligand
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
248
structure length
247
Chain Sequence
SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKSPNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Mineralocorticoid receptor
publication title Structure-Based Drug Design of Mineralocorticoid Receptor Antagonists to Explore Oxosteroid Receptor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 247
sequence length 248
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5l7gA00
1E3KA 3HLVA 1SJ0A 2VV0A 2ZNOA 1S9QA 4MG8B 3MNEA 5DWGA 2Q7JA 4L96A 1ZUCA 4PP5A 3FEJA 2ACLB 2B50A 2ZMHA 3A2HA 2XHSA 1XVPB 4DQMA 5LGAA 5DXGA 2HB7A 4MGAA 2JJ3A 2PRGA 1M7WA 1XP6A 1QKMA 1S19A 2PIPL 4LSJA 1ZKYA 4PLEA 2ZL9A 2Q7LA 4MG8A 3RVFA 5I4VA 3CS4A 3UUDA 5G5WA 2ACLA 1MV9A 1ZDTA 4POJA 3RUTA 1HG4A 1XVPA 5DIGA 4IQRA 3F7DA 5JY3A 2BAWA 5JJMA 1Y0XX 4IV2A 3FS1A 5L11A 1TFCA 1PDUA 2V7CA 1M2ZA 2AB2A 2AX8A 2J7YA 4E4KA 3E00A 5DV6A 1YA3A 1X7BA 2GL8A 4IV4A 5KYJA 2PIRA 4OHAA 1H9UA 2ZK6A 2R40A 3GZ9A 1PZLA 4IWCA 4XT9A 3TKCA 3WT7A 2ZK5A 5EC9A 4FHHA 4OJBA 2R6WA 1NAVA 5KCCA 3OS9A 3VSOA 5DK9A 4G1ZA 4MGCA 4YNKA 1Q4XA 4OKBA 5K13A 3X36A 4JYIA 1RK3A 1I38A 2FSZA 4RZGA 4NIEA 3KDUA 1K74A 3FALB 2B1ZA 1NQ2A 5DVSA 1R1KA 2QZOA 4G1YA 4ZNSA 3CS6A 4J5WC 4RUPA 3ET1A 4OFRA 4UDCA 4WHFA 2ZVTA 4ZN7A 2VV4B 1SQNA 1X78A 4XTAA 4BCRA 3E00D 2Q6RA 3A9EA 5DWJA 5DUHA 2AA6A 1PQ6A 5AVIA 3FURA 3OMQA 4XUMA 4X1FA 5DMCA 5C4UA 5DL4A 3AX8A 4CSJA 3V3EA 2R40D 3W5TA 5B5BA 2QPYA 3DT3A 4MG5A 2O4JA 3ILZA 4G2HA 3PLZA 4ONIA 1GWQA 3GWXA 3FALA 3HO0A 4ZO1B 2OCFA 5G42A 3B0QA 1XZXX 1ZGYA 2OVMA 3OKIA 3P89A 3OGTA 4UDAA 1WM0X 3L3XA 4OEDA 3UUAB 2VSTA 2VV4A 1OSHA 1YP0A 4G1DA 3VJHA 2AO6A 2ZASA 5DYDA 3NSQA 3UUCA 2QGTA 4JL4A 1K74D 5A86A 1XB7A 5DZHA 3OSAA 1R1KD 1S9PA 4IA2A 4OIVA 3KMGA 4WVDA 4XLDA 4KZIA 2GWXA 5AAVA 4G20A 4WHGA 3RY9A 2YLPA 4PPSA 4REFA 3AN3A 4JYHA 1ZDUA 3AZ1A 3R29A 2H79A 4RWVA 5E15A 3UUAA 3CDSA 5B41A 3UP0A 2ZY0A 5DSHA 4UDDA 3ET0A 1RKGA 3W5RA 2Q5SA 2ZLAA 3L0JA 4E2JA 2P1UA 4WLBA 4LBDA 1XIUA 3GWSX 2HB8A 4ZI1A 1DKFA 3LBDA 2ZFXA 3WMHA 2O9IA 3ADUA 3DCTA 4IA7A 3WJ5A 3DZUA 3BEJA 1P93A 1XQCA 2JF9A 3VJIA 1NDEA 2JFAB 2NXXE 2Z4JA 2FAIA 3OLLA 4RMEA 4JGVA 5G45A 3X1IA 4RZEA 5KRAA 3M7RA 2HCDA 2HVCA 1NYXA 2Q3YA 1EXXA 2ZBSA 3K8SA 5EI1A 3UU7B 3WFFA 5KR9A 2XKWA 1SR7A 3A3ZX 2W8YA 1I7IA 3D6DA 3F5CB 3GBKA 3K23A 1XNNA 4HEEX 5DLRA 4DM8A 3W0JA 3IPQA 5DIDA 3KBAA 1T79A 4L98A 2B1VA 2Q6SA 1R5KA 3AZ3A 4QL8A 3VT5A 2GPOA 1T5ZA 3BC5A 2JFAA 4TV1A 2F4BA 4OH5A 3WJ4A 3OLFA 3SP9A 5KD9A 4MGAB 5KRCA 1ZAFA 3UU7A 3R5MA 4IUIA 3DZUD 3H0AA 2I0GA 2G44A 3F5CA 5GIDA 4FN9A 3VI8A 4G2IA 3VHUA 4IA3A 1QKNA 2Q1VA 2BJ4B 3W0AA 2OVHA 3Q95B 1G5YA 4ITFA 5E19A 1NRLA 3P88A 1YMTA 3ZRAA 1NAXA 2QR9A 3UUDB 5JI0D 2YHDA 1XLSE 4RUJA 3CLDA 4M8HA 5KCWA 2QMVA 2AMBA 3MNPA 4K7AA 4OGHA 5G44A 2I0JA 3WWRA 2YLYA 5DXPA 4YMQA 5JJMB 2A3IA 2PIUA 1YUCA 2VV3A 1I37A 5DV3A 1X7EA 2EWPA 2BJ4A 5DXEA 1FM9A 1T7MA 3G0WA 3Q95A 4OEAA 1YY4A 3GN8A 3V9YA 1MVCA 4PWLA 5DWEA 4ZNVA 3AZ2A 3TX7B 5C4OA 3H0AD 5ICKA 3CS8A 3D90A 4A4WA 4Q50A 4OEZA 2QXMA 1XOWA 2HARA 2AA5A 2OAXA 3PO9A 3OMMA 3ET2A 5G3JA 3VHWA 3VHVA 4OARA 2ZLCA 3FEIA 5APKA 1NQ0A 1YOWA 4N5GA 4YT1A 3PBAA 1T74A 1UHLA 2QZOB 3IPSA 4P6XA 5DXRA 1EREA 4QE6A 3L3ZA 1XPCA 2Q61A 1L2JA 3OLSA 2AAXA 3HZFA 3B0RA 3K22A 1A28A 1ZEOA 2H77A 1G2NA 4TUZB 1FM9D 1T63A 2VSRA 2PNUA 3A9EB 2Q59A 5KRIA 5DXQA 3OS8A 3VRUA 5DIEA 4WPFA 3GYUA 3S9SA 4J5XA 3OMOA 5DXMA 3AURA 4A2JA 5HYKA 2QA6A 2OM9A 1S0XA 2YLOA 2ZNQA 3GYTA 3R5NA 5DV8A 3VT3A 4N1YA 5KRJA 2XYXA 4ZO1X 5KRLA 5M96A 1YJEA 4MG6A 1U3QA 3LMPA 5HJPB 4TUZA 5FQSA 3U9QA 1GS4A 4ZNTA 4OK1A 1I7GA 4RE8A 5EITA 5SYZA 3BQDA 3WGPA 3X1HA 1A52A 4K4JA 4PXMA 5L7GA 3B5RA 3RUUA 2YFEA 1XQ3A 3OZ0A 5IZ0A 5AAVB 5HZCA 2P54A 2Q7IA 3G8IA 4S14A 3W0IA 2I4ZA 5KCFA 2ZXNA 3VJSA 4XHDA 5IXKA 2Q60A 5AZVA 4NQAB 1K7LA 2J4AA 3D5FA 3N00A 5AWKA 4MDDA 2OZ7A 5AAUA 3ADTA 3VN2A 5GT4A 1XJ7A 5DZ0A 2AM9A 2ZMJA 4XAOA 5DXBB 3ZQTA 2PINA 5DZIA 1QKTA 3KDTA 5DP0A 1NQ1A 1ERRA 2FVJA 2HFPA 1PQCA 2J14A 2P7ZA 2Q7KA 2QABA 1DKFB 4OFUA 5C4TA 1QKUA 4RAKA 2AMAA 2I4PA 4IU7A 3RLJA 3VJTA 3AUNA 4IVYA 4RUOX 3ERTA 2Q5GA 5AYGA 4E4QA 3E94A 1X76A 4O8FA 2HC4A 3KPZA 4OKXA 3AUQA 2Q70A 3P8XA 2VV2A 4POHA 3CJWA 1FCZA 5DXBA 5F9BA 3TY0A 3VTCA 3HQ5A 4OZTE 4OKTA 2PKLA 2ZK1A 3WT5A 1YINA 1XP1A 2HBHA 5DKGA 2V0VA 1X7JA 2ZNPA 3ZRBA 1BSXA 1UPWA 1KNUA 5CJ6A 4APUA 1RDTA 3IXPA 3VT7A 5AVLA 5KCUA 4TV1B 2G0GA 3V9TA 1YOKA 2YJAB 1Y0SA 3D57A 3E7CA 4J24A 1TXIA 1T65A 5HJSA 4CI4A 1NUOA 3R2AA 4UDBA 3R8IA 1S0ZA 1VJBA 2ZMIA 4IVWA 4RZFA 3WTQA 3KMZA 2IHQA 1L2IA 4OILA 1U9EA 5DMFA 1UOMA 5FQVA 5DXKA 4F9MA 5E14A 1T7RA 4ZNUA 5H1EA 2G5OA 2IOGA 3FLIA 5LWPA 1NQ7A 4MGDB 2XYJA 1KKQA 3B66A 4IWFA 1XV9B 1T7FA 4OH6A 1RJKA 4X1GA 4OKWA 4PLDA 1NHZA 1IE8A 4RFWA 5DTVA 2LBDA 4PVUA 1RDTD 3IXPD 5FQPA 3HM1A 1OSVA 3OSIA 4Y29A 5HJPA 4PF3A 3HODA 3OMKA 4LNWA 1Z5XU 2QNVA 4MGDA 3G9EA 3NOAA 3DR1A 3KFCA 3PEQA 4OC7A 5DUGA 1G50A 1XV9A 3B1MA 3T03A 5DRMA 3OS8C 4OLMA 5ETHA 4DK8A 4ZN9A 2NPAA 4J5XC 3SP6A 5EHJA 3O1EA 2VV1B 3VRWA 2NXXA 1UHLB 4S15A 3W0GA 5DZ3A 3L0EA 2GPPA 2YLQA 2QGWA 2POGA 5FQRA 1XDKA 5EGVA 4NY9A 2P1VA 4FHIA 1DB1A 2HWRA 3VSPA 3G8OA 5E0XA 1R6GA 3DY6A 3A2JA 2Q1HA 5G43A 2Q59B 5EJVA 2AWHA 1T73A 3L0LA 3GD2A 4MGBA 2QH6A 5FQTA 5HYRA 4FNEA 2QSEA 3KYTA 3B0TA 3W0CA 2VV1A 4MG7B 4FGYA 2HWQA 5GIEA 3UP3A 3ET3A 5KCTA 3VTDA 5E0WA 3FC6B 4LNXA 3IPUA 3ERDA 1XAPA 4PP3A 4ZNHA 1LV2A 4OEYA 5APHA 3OMPA 4PP6A 1M13A 2PIWA 1PRGA 1U3RA 2HAMA 3VT6A 1KV6A 5C4SA 2B23A 3CTBA 4R06A 2PIVA 3W0YA 4Q13A 2ZXMA 4B7WA 1LBDA 2AXAA 1T76A 3TKMA 5KRHA 1R20A 4Q0AC 2Q8SA 4RMDA 4MG7A 2P7AA 1XLSA 2Q5PA 5AWJA 3OZJA 5APJA 3W5PA 3V9VA 3FC6A 3V4AA 5DKEA 3B65A 5KRMA 2P15A 2ZK3A 2NW4A 4NUFA 1Y9RA 3HC6A 3L1BA 1SKXA 3B0WA 1YIMA 3DZYA 1FCXA 2IOKA 1E3GA 4M8EA 2ZNNA 3A2IA 5DI7A 5G46A 4OIUA 3SZ1A 1Z5XE 4A4VA 2P1TA 4IW8A 4QE8A 5DVCA 3K6PA 2GPVA 1P8DA 3W0HA 3ZR7A 3W5QA 1N83A 2ZK0A 3AN4A 3O1DA 4S0TA 2AA7A 3ADXA 2ZKCA 4G21A 3VTBA 2ZK4A 1EXAA 4IS8A 1RKHA 3A78A 3P0UA 4HLWA 4MG9B 5DKBA 4EM9A 4QM0A 3FUGA 3MNOA 5DY8A 2GPUA 3VT8A 4P6WA 3L03A 4R6SA 1R20D 1YYEA 3ADVA 4OJ9A 3CQVA 3EYBA 2QA8B 5KROA 4NB6A 2E2RA 1G1UA 3VT4A 3X31A 4DORA 4N8RA 4KZJA 2GP7A 4ZJRA 5IAWA 4ITEA 2PIOA 4KZMA 3FXVA 2Z4BA 4MG9A 5L7EA 3DZYD 1FCYA 2PITA 3R8AA 3R8DA 5DWIA 4OZRU 2REWA 2HASA 2QW4A 1XNXA 4REEA 5DKSA 4YPQA 2QA8A 4OZTU 1ILGA 2J7XA 3HC5A 2GIUA 5ACCA 5KCDA 5GICA 3ADSA 2YJDA 4XI3A 1XP9A 3DCUA 4DM6A 2Q6JA 2P7GA 2PIXA 4K6IA 1K4WA 4PRGA 4DK7A 2POBA 3HVLA 5KRFA 2AX7A 2AX6A 4ZNWA 3H52A 5DYBA 3IMYA 4PPPA 4WQPA 2NV7A 5E7VA 4J26A 2ZXZA 4OJ4A 3OAPA 3JZBA 1UPVA 3D24A 5AK2A 4J5WA 5DX3B 2ABIA 4DMAA 5DZ1A 1N46A 2QXSA 5L7HA 3UVVB 3B68A 4S0SA 3AFRA 4DOSA 3NSPA 2OUZA 3RLLA 3CWDA 3KWYA 3WT6A 1OT7A 2R6YA 3V49A 2PJLA 3JZCA 2ZK2A 4N73A 4LTWA 1FM6A 5DUEA 3VT9A 1GWXA 1U3SA 4ZJWA 1GWRA 2PIQA 4RMCA 2QTUA 4EMAA 3PCUA 2I4JA 1OVLB 1HJ1A 5DRJA 5HCVA 5DWLA 1T7TA 3CDPA 1FD0A 5KCEA 1X7RA 2QE4A 3V3QA 2XYWA 1Z95A 5DX3A 3UVVA 3IA6A 2AYRA 2P4YA 3WFGA 1FBYA 5DVVA 5KRKA 3B3KA 1ZH7A 5AZTA 1PK5A 3OKHA 4QJRA 5E1CA 2YATA 2O4RA 1MZNA 1PQ9A 1XDKB 3A40X 3VRTA 4IA1A 2GTKA 4ZOMA 1OVLA 2G0HA 1PCGA 1N4HA 1ILHA 4IW6A 5DU5A 2AA2A 1IE9A 3QT0A 4R2UA 4MGBB 4XUHA 2ATHA 4QK4A 2AX9A 3OSWA 1FM6D 5KYAA 3PRGA 4JYGA 4OZRE 3VRVA 3B67A 4CI5A 3ADWA 4JAZA 3OOFA 3KMRA 3OOKA
chains in the Genus database with same CATH superfamily
1E3KA 3HLVA 1SJ0A 2VV0A 2ZNOA 1S9QA 4MG8B 3MNEA 5DWGA 2Q7JA 4L96A 1ZUCA 4PP5A 3FEJA 2ACLB 2B50A 2ZMHA 3A2HA 2XHSA 1XVPB 4DQMA 5LGAA 5DXGA 2HB7A 4MGAA 2JJ3A 2PRGA 1M7WA 1XP6A 1QKMA 1S19A 2PIPL 4LSJA 1ZKYA 4PLEA 2ZL9A 2Q7LA 4MG8A 3RVFA 5I4VA 3CS4A 3UUDA 5G5WA 2ACLA 1MV9A 1ZDTA 4POJA 3RUTA 1HG4A 1XVPA 5DIGA 4IQRA 3F7DA 5JY3A 2BAWA 5JJMA 1Y0XX 4IV2A 3FS1A 5L11A 1TFCA 1PDUA 2V7CA 1M2ZA 2AB2A 2AX8A 2J7YA 4E4KA 3E00A 5DV6A 1YA3A 1X7BA 2GL8A 4IV4A 5KYJA 2PIRA 4OHAA 1H9UA 2ZK6A 2R40A 3GZ9A 1PZLA 4IWCA 4XT9A 3TKCA 3WT7A 2ZK5A 5EC9A 4FHHA 4OJBA 2R6WA 1NAVA 5KCCA 3OS9A 3VSOA 5DK9A 4G1ZA 4MGCA 4YNKA 1Q4XA 4OKBA 5K13A 3X36A 4JYIA 1RK3A 1I38A 2FSZA 4RZGA 4NIEA 3KDUA 1K74A 3FALB 2B1ZA 1NQ2A 5DVSA 1R1KA 2QZOA 4G1YA 4ZNSA 3CS6A 4J5WC 4RUPA 3ET1A 4OFRA 4UDCA 4WHFA 2ZVTA 4ZN7A 2VV4B 1SQNA 1X78A 4XTAA 4BCRA 3E00D 2Q6RA 3A9EA 5DWJA 5DUHA 2AA6A 1PQ6A 5AVIA 3FURA 3OMQA 4XUMA 4X1FA 5DMCA 5C4UA 5DL4A 3AX8A 4CSJA 3V3EA 2R40D 3W5TA 5B5BA 2QPYA 3DT3A 4MG5A 2O4JA 3ILZA 4G2HA 3PLZA 4ONIA 1GWQA 3GWXA 3FALA 3HO0A 4ZO1B 2OCFA 5G42A 3B0QA 1XZXX 1ZGYA 2OVMA 3OKIA 3P89A 3OGTA 4UDAA 1WM0X 3L3XA 4OEDA 3UUAB 2VSTA 2VV4A 1OSHA 1YP0A 4G1DA 3VJHA 2AO6A 2ZASA 5DYDA 3NSQA 3UUCA 2QGTA 4JL4A 1K74D 5A86A 1XB7A 5DZHA 3OSAA 1R1KD 1S9PA 4IA2A 4OIVA 3KMGA 4WVDA 4XLDA 4KZIA 2GWXA 5AAVA 4G20A 4WHGA 3RY9A 2YLPA 4PPSA 4REFA 3AN3A 4JYHA 1ZDUA 3AZ1A 3R29A 2H79A 4RWVA 5E15A 3UUAA 3CDSA 5B41A 3UP0A 2ZY0A 5DSHA 4UDDA 3ET0A 1RKGA 3W5RA 2Q5SA 2ZLAA 3L0JA 4E2JA 2P1UA 4WLBA 4LBDA 1XIUA 3GWSX 2HB8A 4ZI1A 1DKFA 3LBDA 2ZFXA 3WMHA 2O9IA 3ADUA 3DCTA 4IA7A 3WJ5A 3DZUA 3BEJA 1P93A 1XQCA 2JF9A 3VJIA 1NDEA 2JFAB 2NXXE 2Z4JA 2FAIA 3OLLA 4RMEA 4JGVA 5G45A 3X1IA 4RZEA 5KRAA 3M7RA 2HCDA 2HVCA 1NYXA 2Q3YA 1EXXA 2ZBSA 3K8SA 5EI1A 3UU7B 3WFFA 5KR9A 2XKWA 1SR7A 3A3ZX 2W8YA 1I7IA 3D6DA 3F5CB 3GBKA 3K23A 1XNNA 4HEEX 5DLRA 4DM8A 3W0JA 3IPQA 5DIDA 3KBAA 1T79A 4L98A 2B1VA 2Q6SA 1R5KA 3AZ3A 4QL8A 3VT5A 2GPOA 1T5ZA 3BC5A 2JFAA 4TV1A 2F4BA 4OH5A 3WJ4A 3OLFA 3SP9A 5KD9A 4MGAB 5KRCA 1ZAFA 3UU7A 3R5MA 4IUIA 3DZUD 3H0AA 2I0GA 2G44A 3F5CA 5GIDA 4FN9A 3VI8A 4G2IA 3VHUA 4IA3A 1QKNA 2Q1VA 2BJ4B 3W0AA 2OVHA 3Q95B 1G5YA 4ITFA 5E19A 1NRLA 3P88A 1YMTA 3ZRAA 1NAXA 2QR9A 3UUDB 5JI0D 2YHDA 1XLSE 4RUJA 3CLDA 4M8HA 5KCWA 2QMVA 2AMBA 3MNPA 4K7AA 4OGHA 5G44A 2I0JA 3WWRA 2YLYA 5DXPA 4YMQA 5JJMB 2A3IA 2PIUA 1YUCA 2VV3A 1I37A 5DV3A 1X7EA 2EWPA 2BJ4A 5DXEA 1FM9A 1T7MA 3G0WA 3Q95A 4OEAA 1YY4A 3GN8A 3V9YA 1MVCA 4PWLA 5DWEA 4ZNVA 3AZ2A 3TX7B 5C4OA 3H0AD 5ICKA 3CS8A 3D90A 4A4WA 4Q50A 4OEZA 2QXMA 1XOWA 2HARA 2AA5A 2OAXA 3PO9A 3OMMA 3ET2A 5G3JA 3VHWA 3VHVA 4OARA 2ZLCA 3FEIA 5APKA 1NQ0A 1YOWA 4N5GA 4YT1A 3PBAA 1T74A 1UHLA 2QZOB 3IPSA 4P6XA 5DXRA 1EREA 4QE6A 3L3ZA 1XPCA 2Q61A 1L2JA 3OLSA 2AAXA 3HZFA 3B0RA 3K22A 1A28A 1ZEOA 2H77A 1G2NA 4TUZB 1FM9D 1T63A 2VSRA 2PNUA 3A9EB 2Q59A 5KRIA 5DXQA 3OS8A 3VRUA 5DIEA 4WPFA 3GYUA 3S9SA 4J5XA 3OMOA 5DXMA 3AURA 4A2JA 5HYKA 2QA6A 2OM9A 1S0XA 2YLOA 2ZNQA 3GYTA 3R5NA 5DV8A 3VT3A 4N1YA 5KRJA 2XYXA 4ZO1X 5KRLA 5M96A 1YJEA 4MG6A 1U3QA 3LMPA 5HJPB 4TUZA 5FQSA 3U9QA 1GS4A 4ZNTA 4OK1A 1I7GA 4RE8A 5EITA 5SYZA 3BQDA 3WGPA 3X1HA 1A52A 4K4JA 4PXMA 5L7GA 3B5RA 3RUUA 2YFEA 1XQ3A 3OZ0A 5IZ0A 5AAVB 5HZCA 2P54A 2Q7IA 3G8IA 4S14A 3W0IA 2I4ZA 5KCFA 2ZXNA 3VJSA 4XHDA 5IXKA 2Q60A 5AZVA 4NQAB 1K7LA 2J4AA 3D5FA 3N00A 5AWKA 4MDDA 2OZ7A 5AAUA 3ADTA 3VN2A 5GT4A 1XJ7A 5DZ0A 2AM9A 2ZMJA 4XAOA 5DXBB 3ZQTA 2PINA 5DZIA 1QKTA 3KDTA 5DP0A 1NQ1A 1ERRA 2FVJA 2HFPA 1PQCA 2J14A 2P7ZA 2Q7KA 2QABA 1DKFB 4OFUA 5C4TA 1QKUA 4RAKA 2AMAA 2I4PA 4IU7A 3RLJA 3VJTA 3AUNA 4IVYA 4RUOX 3ERTA 2Q5GA 5AYGA 4E4QA 3E94A 1X76A 4O8FA 2HC4A 3KPZA 4OKXA 3AUQA 2Q70A 3P8XA 2VV2A 4POHA 3CJWA 1FCZA 5DXBA 5F9BA 3TY0A 3VTCA 3HQ5A 4OZTE 4OKTA 2PKLA 2ZK1A 3WT5A 1YINA 1XP1A 2HBHA 5DKGA 2V0VA 1X7JA 2ZNPA 3ZRBA 1BSXA 1UPWA 1KNUA 5CJ6A 4APUA 1RDTA 3IXPA 3VT7A 5AVLA 5KCUA 4TV1B 2G0GA 3V9TA 1YOKA 2YJAB 1Y0SA 3D57A 3E7CA 4J24A 1TXIA 1T65A 5HJSA 4CI4A 1NUOA 3R2AA 4UDBA 3R8IA 1S0ZA 1VJBA 2ZMIA 4IVWA 4RZFA 3WTQA 3KMZA 2IHQA 1L2IA 4OILA 1U9EA 5DMFA 1UOMA 5FQVA 5DXKA 4F9MA 5E14A 1T7RA 4ZNUA 5H1EA 2G5OA 2IOGA 3FLIA 5LWPA 1NQ7A 4MGDB 2XYJA 1KKQA 3B66A 4IWFA 1XV9B 1T7FA 4OH6A 1RJKA 4X1GA 4OKWA 4PLDA 1NHZA 1IE8A 4RFWA 5DTVA 2LBDA 4PVUA 1RDTD 3IXPD 5FQPA 3HM1A 1OSVA 3OSIA 4Y29A 5HJPA 4PF3A 3HODA 3OMKA 4LNWA 1Z5XU 2QNVA 4MGDA 3G9EA 3NOAA 3DR1A 3KFCA 3PEQA 4OC7A 5DUGA 1G50A 1XV9A 3B1MA 3T03A 5DRMA 3OS8C 4OLMA 5ETHA 4DK8A 4ZN9A 2NPAA 4J5XC 3SP6A 5EHJA 3O1EA 2VV1B 3VRWA 2NXXA 1UHLB 4S15A 3W0GA 5DZ3A 3L0EA 2GPPA 2YLQA 2QGWA 2POGA 5FQRA 1XDKA 5EGVA 4NY9A 2P1VA 4FHIA 1DB1A 2HWRA 3VSPA 3G8OA 5E0XA 1R6GA 3DY6A 3A2JA 2Q1HA 5G43A 2Q59B 5EJVA 2AWHA 1T73A 3L0LA 3GD2A 4MGBA 2QH6A 5FQTA 5HYRA 4FNEA 2QSEA 3KYTA 3B0TA 3W0CA 2VV1A 4MG7B 4FGYA 2HWQA 5GIEA 3UP3A 3ET3A 5KCTA 3VTDA 5E0WA 3FC6B 4LNXA 3IPUA 3ERDA 1XAPA 4PP3A 4ZNHA 1LV2A 4OEYA 5APHA 3OMPA 4PP6A 1M13A 2PIWA 1PRGA 1U3RA 2HAMA 3VT6A 1KV6A 5C4SA 2B23A 3CTBA 4R06A 2PIVA 3W0YA 4Q13A 2ZXMA 4B7WA 1LBDA 2AXAA 1T76A 3TKMA 5KRHA 1R20A 4Q0AC 2Q8SA 4RMDA 4MG7A 2P7AA 1XLSA 2Q5PA 5AWJA 3OZJA 5APJA 3W5PA 3V9VA 3FC6A 3V4AA 5DKEA 3B65A 5KRMA 2P15A 2ZK3A 2NW4A 4NUFA 1Y9RA 3HC6A 3L1BA 1SKXA 3B0WA 1YIMA 3DZYA 1FCXA 2IOKA 1E3GA 4M8EA 2ZNNA 3A2IA 5DI7A 5G46A 4OIUA 3SZ1A 1Z5XE 4A4VA 2P1TA 4IW8A 4QE8A 5DVCA 3K6PA 2GPVA 1P8DA 3W0HA 3ZR7A 3W5QA 1N83A 2ZK0A 3AN4A 3O1DA 4S0TA 2AA7A 3ADXA 2ZKCA 4G21A 3VTBA 2ZK4A 1EXAA 4IS8A 1RKHA 3A78A 3P0UA 4HLWA 4MG9B 5DKBA 4EM9A 4QM0A 3FUGA 3MNOA 5DY8A 2GPUA 3VT8A 4P6WA 3L03A 4R6SA 1R20D 1YYEA 3ADVA 4OJ9A 3CQVA 3EYBA 2QA8B 5KROA 4NB6A 2E2RA 1G1UA 3VT4A 3X31A 4DORA 4N8RA 4KZJA 2GP7A 4ZJRA 5IAWA 4ITEA 2PIOA 4KZMA 3FXVA 2Z4BA 4MG9A 5L7EA 3DZYD 1FCYA 2PITA 3R8AA 3R8DA 5DWIA 4OZRU 2REWA 2HASA 2QW4A 1XNXA 4REEA 5DKSA 4YPQA 2QA8A 4OZTU 1ILGA 2J7XA 3HC5A 2GIUA 5ACCA 5KCDA 5GICA 3ADSA 2YJDA 4XI3A 1XP9A 3DCUA 4DM6A 2Q6JA 2P7GA 2PIXA 4K6IA 1K4WA 4PRGA 4DK7A 2POBA 3HVLA 5KRFA 2AX7A 2AX6A 4ZNWA 3H52A 5DYBA 3IMYA 4PPPA 4WQPA 2NV7A 5E7VA 4J26A 2ZXZA 4OJ4A 3OAPA 3JZBA 1UPVA 3D24A 5AK2A 4J5WA 5DX3B 2ABIA 4DMAA 5DZ1A 1N46A 2QXSA 5L7HA 3UVVB 3B68A 4S0SA 3AFRA 4DOSA 3NSPA 2OUZA 3RLLA 3CWDA 3KWYA 3WT6A 1OT7A 2R6YA 3V49A 2PJLA 3JZCA 2ZK2A 4N73A 4LTWA 1FM6A 5DUEA 3VT9A 1GWXA 1U3SA 4ZJWA 1GWRA 2PIQA 4RMCA 2QTUA 4EMAA 3PCUA 2I4JA 1OVLB 1HJ1A 5DRJA 5HCVA 5DWLA 1T7TA 3CDPA 1FD0A 5KCEA 1X7RA 2QE4A 3V3QA 2XYWA 1Z95A 5DX3A 3UVVA 3IA6A 2AYRA 2P4YA 3WFGA 1FBYA 5DVVA 5KRKA 3B3KA 1ZH7A 5AZTA 1PK5A 3OKHA 4QJRA 5E1CA 2YATA 2O4RA 1MZNA 1PQ9A 1XDKB 3A40X 3VRTA 4IA1A 2GTKA 4ZOMA 1OVLA 2G0HA 1PCGA 1N4HA 1ILHA 4IW6A 5DU5A 2AA2A 1IE9A 3QT0A 4R2UA 4MGBB 4XUHA 2ATHA 4QK4A 2AX9A 3OSWA 1FM6D 5KYAA 3PRGA 4JYGA 4OZRE 3VRVA 3B67A 4CI5A 3ADWA 4JAZA 3OOFA 3KMRA 3OOKA
chains in the Genus database with same CATH topology
1E3KA 3HLVA 1SJ0A 2VV0A 2ZNOA 1S9QA 4MG8B 3MNEA 5DWGA 2Q7JA 4L96A 1ZUCA 4PP5A 3FEJA 2ACLB 2B50A 2ZMHA 3A2HA 2XHSA 1XVPB 4DQMA 5LGAA 5DXGA 2HB7A 4MGAA 2JJ3A 2PRGA 1M7WA 1XP6A 1QKMA 1S19A 2PIPL 4LSJA 1ZKYA 4PLEA 2ZL9A 2Q7LA 4MG8A 3RVFA 5I4VA 3CS4A 3UUDA 5G5WA 2ACLA 1MV9A 1ZDTA 4POJA 3RUTA 1HG4A 1XVPA 5DIGA 4IQRA 3F7DA 5JY3A 2BAWA 5JJMA 1Y0XX 4IV2A 3FS1A 5L11A 1TFCA 1PDUA 2V7CA 1M2ZA 2AB2A 2AX8A 2J7YA 4E4KA 3E00A 5DV6A 1YA3A 1X7BA 2GL8A 4IV4A 5KYJA 2PIRA 4OHAA 1H9UA 2ZK6A 2R40A 3GZ9A 1PZLA 4IWCA 4XT9A 3TKCA 3WT7A 2ZK5A 5EC9A 4FHHA 4OJBA 2R6WA 1NAVA 5KCCA 3OS9A 3VSOA 5DK9A 4G1ZA 4MGCA 4YNKA 1Q4XA 4OKBA 5K13A 3X36A 4JYIA 1RK3A 1I38A 2FSZA 4RZGA 4NIEA 3KDUA 1K74A 3FALB 2B1ZA 1NQ2A 5DVSA 1R1KA 2QZOA 4G1YA 4ZNSA 3CS6A 4J5WC 4RUPA 3ET1A 4OFRA 4UDCA 4WHFA 2ZVTA 4ZN7A 2VV4B 1SQNA 1X78A 4XTAA 4BCRA 3E00D 2Q6RA 3A9EA 5DWJA 5DUHA 2AA6A 1PQ6A 5AVIA 3FURA 3OMQA 4XUMA 4X1FA 5DMCA 5C4UA 5DL4A 3AX8A 4CSJA 3V3EA 2R40D 3W5TA 5B5BA 2QPYA 3DT3A 4MG5A 2O4JA 3ILZA 4G2HA 3PLZA 4ONIA 1GWQA 3GWXA 3FALA 3HO0A 4ZO1B 2OCFA 5G42A 3B0QA 1XZXX 1ZGYA 2OVMA 3OKIA 3P89A 3OGTA 4UDAA 1WM0X 3L3XA 4OEDA 3UUAB 2VSTA 2VV4A 1OSHA 1YP0A 4G1DA 3VJHA 2AO6A 2ZASA 5DYDA 3NSQA 3UUCA 2QGTA 4JL4A 1K74D 5A86A 1XB7A 5DZHA 3OSAA 1R1KD 1S9PA 4IA2A 4OIVA 3KMGA 4WVDA 4XLDA 4KZIA 2GWXA 5AAVA 4G20A 4WHGA 3RY9A 2YLPA 4PPSA 4REFA 3AN3A 4JYHA 1ZDUA 3AZ1A 3R29A 2H79A 4RWVA 5E15A 3UUAA 3CDSA 5B41A 3UP0A 2ZY0A 5DSHA 4UDDA 3ET0A 1RKGA 3W5RA 2Q5SA 2ZLAA 3L0JA 4E2JA 2P1UA 4WLBA 4LBDA 1XIUA 3GWSX 2HB8A 4ZI1A 1DKFA 3LBDA 2ZFXA 3WMHA 2O9IA 3ADUA 3DCTA 4IA7A 3WJ5A 3DZUA 3BEJA 1P93A 1XQCA 2JF9A 3VJIA 1NDEA 2JFAB 2NXXE 2Z4JA 2FAIA 3OLLA 4RMEA 4JGVA 5G45A 3X1IA 4RZEA 5KRAA 3M7RA 2HCDA 2HVCA 1NYXA 2Q3YA 1EXXA 2ZBSA 3K8SA 5EI1A 3UU7B 3WFFA 5KR9A 2XKWA 1SR7A 3A3ZX 2W8YA 1I7IA 3D6DA 3F5CB 3GBKA 3K23A 1XNNA 4HEEX 5DLRA 4DM8A 3W0JA 3IPQA 5DIDA 3KBAA 1T79A 4L98A 2B1VA 2Q6SA 1R5KA 3AZ3A 4QL8A 3VT5A 2GPOA 1T5ZA 3BC5A 2JFAA 4TV1A 2F4BA 4OH5A 3WJ4A 3OLFA 3SP9A 5KD9A 4MGAB 5KRCA 1ZAFA 3UU7A 3R5MA 4IUIA 3DZUD 3H0AA 2I0GA 2G44A 3F5CA 5GIDA 4FN9A 3VI8A 4G2IA 3VHUA 4IA3A 1QKNA 2Q1VA 2BJ4B 3W0AA 2OVHA 3Q95B 1G5YA 4ITFA 5E19A 1NRLA 3P88A 1YMTA 3ZRAA 1NAXA 2QR9A 3UUDB 5JI0D 2YHDA 1XLSE 4RUJA 3CLDA 4M8HA 5KCWA 2QMVA 2AMBA 3MNPA 4K7AA 4OGHA 5G44A 2I0JA 3WWRA 2YLYA 5DXPA 4YMQA 5JJMB 2A3IA 2PIUA 1YUCA 2VV3A 1I37A 5DV3A 1X7EA 2EWPA 2BJ4A 5DXEA 1FM9A 1T7MA 3G0WA 3Q95A 4OEAA 1YY4A 3GN8A 3V9YA 1MVCA 4PWLA 5DWEA 4ZNVA 3AZ2A 3TX7B 5C4OA 3H0AD 5ICKA 3CS8A 3D90A 4A4WA 4Q50A 4OEZA 2QXMA 1XOWA 2HARA 2AA5A 2OAXA 3PO9A 3OMMA 3ET2A 5G3JA 3VHWA 3VHVA 4OARA 2ZLCA 3FEIA 5APKA 1NQ0A 1YOWA 4N5GA 4YT1A 3PBAA 1T74A 1UHLA 2QZOB 3IPSA 4P6XA 5DXRA 1EREA 4QE6A 3L3ZA 1XPCA 2Q61A 1L2JA 3OLSA 2AAXA 3HZFA 3B0RA 3K22A 1A28A 1ZEOA 2H77A 1G2NA 4TUZB 1FM9D 1T63A 2VSRA 2PNUA 3A9EB 2Q59A 5KRIA 5DXQA 3OS8A 3VRUA 5DIEA 4WPFA 3GYUA 3S9SA 4J5XA 3OMOA 5DXMA 3AURA 4A2JA 5HYKA 2QA6A 2OM9A 1S0XA 2YLOA 2ZNQA 3GYTA 3R5NA 5DV8A 3VT3A 4N1YA 5KRJA 2XYXA 4ZO1X 5KRLA 5M96A 1YJEA 4MG6A 1U3QA 3LMPA 5HJPB 4TUZA 5FQSA 3U9QA 1GS4A 4ZNTA 4OK1A 1I7GA 4RE8A 5EITA 5SYZA 3BQDA 3WGPA 3X1HA 1A52A 4K4JA 4PXMA 5L7GA 3B5RA 3RUUA 2YFEA 1XQ3A 3OZ0A 5IZ0A 5AAVB 5HZCA 2P54A 2Q7IA 3G8IA 4S14A 3W0IA 2I4ZA 5KCFA 2ZXNA 3VJSA 4XHDA 5IXKA 2Q60A 5AZVA 4NQAB 1K7LA 2J4AA 3D5FA 3N00A 5AWKA 4MDDA 2OZ7A 5AAUA 3ADTA 3VN2A 5GT4A 1XJ7A 5DZ0A 2AM9A 2ZMJA 4XAOA 5DXBB 3ZQTA 2PINA 5DZIA 1QKTA 3KDTA 5DP0A 1NQ1A 1ERRA 2FVJA 2HFPA 1PQCA 2J14A 2P7ZA 2Q7KA 2QABA 1DKFB 4OFUA 5C4TA 1QKUA 4RAKA 2AMAA 2I4PA 4IU7A 3RLJA 3VJTA 3AUNA 4IVYA 4RUOX 3ERTA 2Q5GA 5AYGA 4E4QA 3E94A 1X76A 4O8FA 2HC4A 3KPZA 4OKXA 3AUQA 2Q70A 3P8XA 2VV2A 4POHA 3CJWA 1FCZA 5DXBA 5F9BA 3TY0A 3VTCA 3HQ5A 4OZTE 4OKTA 2PKLA 2ZK1A 3WT5A 1YINA 1XP1A 2HBHA 5DKGA 2V0VA 1X7JA 2ZNPA 3ZRBA 1BSXA 1UPWA 1KNUA 5CJ6A 4APUA 1RDTA 3IXPA 3VT7A 5AVLA 5KCUA 4TV1B 2G0GA 3V9TA 1YOKA 2YJAB 1Y0SA 3D57A 3E7CA 4J24A 1TXIA 1T65A 5HJSA 4CI4A 1NUOA 3R2AA 4UDBA 3R8IA 1S0ZA 1VJBA 2ZMIA 4IVWA 4RZFA 3WTQA 3KMZA 2IHQA 1L2IA 4OILA 1U9EA 5DMFA 1UOMA 5FQVA 5DXKA 4F9MA 5E14A 1T7RA 4ZNUA 5H1EA 2G5OA 2IOGA 3FLIA 5LWPA 1NQ7A 4MGDB 2XYJA 1KKQA 3B66A 4IWFA 1XV9B 1T7FA 4OH6A 1RJKA 4X1GA 4OKWA 4PLDA 1NHZA 1IE8A 4RFWA 5DTVA 2LBDA 4PVUA 1RDTD 3IXPD 5FQPA 3HM1A 1OSVA 3OSIA 4Y29A 5HJPA 4PF3A 3HODA 3OMKA 4LNWA 1Z5XU 2QNVA 4MGDA 3G9EA 3NOAA 3DR1A 3KFCA 3PEQA 4OC7A 5DUGA 1G50A 1XV9A 3B1MA 3T03A 5DRMA 3OS8C 4OLMA 5ETHA 4DK8A 4ZN9A 2NPAA 4J5XC 3SP6A 5EHJA 3O1EA 2VV1B 3VRWA 2NXXA 1UHLB 4S15A 3W0GA 5DZ3A 3L0EA 2GPPA 2YLQA 2QGWA 2POGA 5FQRA 1XDKA 5EGVA 4NY9A 2P1VA 4FHIA 1DB1A 2HWRA 3VSPA 3G8OA 5E0XA 1R6GA 3DY6A 3A2JA 2Q1HA 5G43A 2Q59B 5EJVA 2AWHA 1T73A 3L0LA 3GD2A 4MGBA 2QH6A 5FQTA 5HYRA 4FNEA 2QSEA 3KYTA 3B0TA 3W0CA 2VV1A 4MG7B 4FGYA 2HWQA 5GIEA 3UP3A 3ET3A 5KCTA 3VTDA 5E0WA 3FC6B 4LNXA 3IPUA 3ERDA 1XAPA 4PP3A 4ZNHA 1LV2A 4OEYA 5APHA 3OMPA 4PP6A 1M13A 2PIWA 1PRGA 1U3RA 2HAMA 3VT6A 1KV6A 5C4SA 2B23A 3CTBA 4R06A 2PIVA 3W0YA 4Q13A 2ZXMA 4B7WA 1LBDA 2AXAA 1T76A 3TKMA 5KRHA 1R20A 4Q0AC 2Q8SA 4RMDA 4MG7A 2P7AA 1XLSA 2Q5PA 5AWJA 3OZJA 5APJA 3W5PA 3V9VA 3FC6A 3V4AA 5DKEA 3B65A 5KRMA 2P15A 2ZK3A 2NW4A 4NUFA 1Y9RA 3HC6A 3L1BA 1SKXA 3B0WA 1YIMA 3DZYA 1FCXA 2IOKA 1E3GA 4M8EA 2ZNNA 3A2IA 5DI7A 5G46A 4OIUA 3SZ1A 1Z5XE 4A4VA 2P1TA 4IW8A 4QE8A 5DVCA 3K6PA 2GPVA 1P8DA 3W0HA 3ZR7A 3W5QA 1N83A 2ZK0A 3AN4A 3O1DA 4S0TA 2AA7A 3ADXA 2ZKCA 4G21A 3VTBA 2ZK4A 1EXAA 4IS8A 1RKHA 3A78A 3P0UA 4HLWA 4MG9B 5DKBA 4EM9A 4QM0A 3FUGA 3MNOA 5DY8A 2GPUA 3VT8A 4P6WA 3L03A 4R6SA 1R20D 1YYEA 3ADVA 4OJ9A 3CQVA 3EYBA 2QA8B 5KROA 4NB6A 2E2RA 1G1UA 3VT4A 3X31A 4DORA 4N8RA 4KZJA 2GP7A 4ZJRA 5IAWA 4ITEA 2PIOA 4KZMA 3FXVA 2Z4BA 4MG9A 5L7EA 3DZYD 1FCYA 2PITA 3R8AA 3R8DA 5DWIA 4OZRU 2REWA 2HASA 2QW4A 1XNXA 4REEA 5DKSA 4YPQA 2QA8A 4OZTU 1ILGA 2J7XA 3HC5A 2GIUA 5ACCA 5KCDA 5GICA 3ADSA 2YJDA 4XI3A 1XP9A 3DCUA 4DM6A 2Q6JA 2P7GA 2PIXA 4K6IA 1K4WA 4PRGA 4DK7A 2POBA 3HVLA 5KRFA 2AX7A 2AX6A 4ZNWA 3H52A 5DYBA 3IMYA 4PPPA 4WQPA 2NV7A 5E7VA 4J26A 2ZXZA 4OJ4A 3OAPA 3JZBA 1UPVA 3D24A 5AK2A 4J5WA 5DX3B 2ABIA 4DMAA 5DZ1A 1N46A 2QXSA 5L7HA 3UVVB 3B68A 4S0SA 3AFRA 4DOSA 3NSPA 2OUZA 3RLLA 3CWDA 3KWYA 3WT6A 1OT7A 2R6YA 3V49A 2PJLA 3JZCA 2ZK2A 4N73A 4LTWA 1FM6A 5DUEA 3VT9A 1GWXA 1U3SA 4ZJWA 1GWRA 2PIQA 4RMCA 2QTUA 4EMAA 3PCUA 2I4JA 1OVLB 1HJ1A 5DRJA 5HCVA 5DWLA 1T7TA 3CDPA 1FD0A 5KCEA 1X7RA 2QE4A 3V3QA 2XYWA 1Z95A 5DX3A 3UVVA 3IA6A 2AYRA 2P4YA 3WFGA 1FBYA 5DVVA 5KRKA 3B3KA 1ZH7A 5AZTA 1PK5A 3OKHA 4QJRA 5E1CA 2YATA 2O4RA 1MZNA 1PQ9A 1XDKB 3A40X 3VRTA 4IA1A 2GTKA 4ZOMA 1OVLA 2G0HA 1PCGA 1N4HA 1ILHA 4IW6A 5DU5A 2AA2A 1IE9A 3QT0A 4R2UA 4MGBB 4XUHA 2ATHA 4QK4A 2AX9A 3OSWA 1FM6D 5KYAA 3PRGA 4JYGA 4OZRE 3VRVA 3B67A 4CI5A 3ADWA 4JAZA 3OOFA 3KMRA 3OOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3K A;  3HLV A;  1SJ0 A;  2VV0 A;  2ZNO A;  1S9Q A;  4MG8 B;  3MNE A;  5DWG A;  2Q7J A;  4L96 A;  1ZUC A;  4PP5 A;  3FEJ A;  2ACL B;  2B50 A;  2ZMH A;  3A2H A;  2XHS A;  1XVP B;  4DQM A;  5LGA A;  5DXG A;  2HB7 A;  4MGA A;  2JJ3 A;  2PRG A;  1M7W A;  1XP6 A;  1QKM A;  1S19 A;  2PIP L;  4LSJ A;  1ZKY A;  4PLE A;  2ZL9 A;  2Q7L A;  4MG8 A;  3RVF A;  5I4V A;  3CS4 A;  3UUD A;  5G5W A;  2ACL A;  1MV9 A;  1ZDT A;  4POJ A;  3RUT A;  1HG4 A;  1XVP A;  5DIG A;  4IQR A;  3F7D A;  5JY3 A;  2BAW A;  5JJM A;  1Y0X X;  4IV2 A;  3FS1 A;  5L11 A;  1TFC A;  1PDU A;  2V7C A;  1M2Z A;  2AB2 A;  2AX8 A;  2J7Y A;  4E4K A;  3E00 A;  5DV6 A;  1YA3 A;  1X7B A;  2GL8 A;  4IV4 A;  5KYJ A;  2PIR A;  4OHA A;  1H9U A;  2ZK6 A;  2R40 A;  3GZ9 A;  1PZL A;  4IWC A;  4XT9 A;  3TKC A;  3WT7 A;  2ZK5 A;  5EC9 A;  4FHH A;  4OJB A;  2R6W A;  1NAV A;  5KCC A;  3OS9 A;  3VSO A;  5DK9 A;  4G1Z A;  4MGC A;  4YNK A;  1Q4X A;  4OKB A;  5K13 A;  3X36 A;  4JYI A;  1RK3 A;  1I38 A;  2FSZ A;  4RZG A;  4NIE A;  3KDU A;  1K74 A;  3FAL B;  2B1Z A;  1NQ2 A;  5DVS A;  1R1K A;  2QZO A;  4G1Y A;  4ZNS A;  3CS6 A;  4J5W C;  4RUP A;  3ET1 A;  4OFR A;  4UDC A;  4WHF A;  2ZVT A;  4ZN7 A;  2VV4 B;  1SQN A;  1X78 A;  4XTA A;  4BCR A;  3E00 D;  2Q6R A;  3A9E A;  5DWJ A;  5DUH A;  2AA6 A;  1PQ6 A;  5AVI A;  3FUR A;  3OMQ A;  4XUM A;  4X1F A;  5DMC A;  5C4U A;  5DL4 A;  3AX8 A;  4CSJ A;  3V3E A;  2R40 D;  3W5T A;  5B5B A;  2QPY A;  3DT3 A;  4MG5 A;  2O4J A;  3ILZ A;  4G2H A;  3PLZ A;  4ONI A;  1GWQ A;  3GWX A;  3FAL A;  3HO0 A;  4ZO1 B;  2OCF A;  5G42 A;  3B0Q A;  1XZX X;  1ZGY A;  2OVM A;  3OKI A;  3P89 A;  3OGT A;  4UDA A;  1WM0 X;  3L3X A;  4OED A;  3UUA B;  2VST A;  2VV4 A;  1OSH A;  1YP0 A;  4G1D A;  3VJH A;  2AO6 A;  2ZAS A;  5DYD A;  3NSQ A;  3UUC A;  2QGT A;  4JL4 A;  1K74 D;  5A86 A;  1XB7 A;  5DZH A;  3OSA A;  1R1K D;  1S9P A;  4IA2 A;  4OIV A;  3KMG A;  4WVD A;  4XLD A;  4KZI A;  2GWX A;  5AAV A;  4G20 A;  4WHG A;  3RY9 A;  2YLP A;  4PPS A;  4REF A;  3AN3 A;  4JYH A;  1ZDU A;  3AZ1 A;  3R29 A;  2H79 A;  4RWV A;  5E15 A;  3UUA A;  3CDS A;  5B41 A;  3UP0 A;  2ZY0 A;  5DSH A;  4UDD A;  3ET0 A;  1RKG A;  3W5R A;  2Q5S A;  2ZLA A;  3L0J A;  4E2J A;  2P1U A;  4WLB A;  4LBD A;  1XIU A;  3GWS X;  2HB8 A;  4ZI1 A;  1DKF A;  3LBD A;  2ZFX A;  3WMH A;  2O9I A;  3ADU A;  3DCT A;  4IA7 A;  3WJ5 A;  3DZU A;  3BEJ A;  1P93 A;  1XQC A;  2JF9 A;  3VJI A;  1NDE A;  2JFA B;  2NXX E;  2Z4J A;  2FAI A;  3OLL A;  4RME A;  4JGV A;  5G45 A;  3X1I A;  4RZE A;  5KRA A;  3M7R A;  2HCD A;  2HVC A;  1NYX A;  2Q3Y A;  1EXX A;  2ZBS A;  3K8S A;  5EI1 A;  3UU7 B;  3WFF A;  5KR9 A;  2XKW A;  1SR7 A;  3A3Z X;  2W8Y A;  1I7I A;  3D6D A;  3F5C B;  3GBK A;  3K23 A;  1XNN A;  4HEE X;  5DLR A;  4DM8 A;  3W0J A;  3IPQ A;  5DID A;  3KBA A;  1T79 A;  4L98 A;  2B1V A;  2Q6S A;  1R5K A;  3AZ3 A;  4QL8 A;  3VT5 A;  2GPO A;  1T5Z A;  3BC5 A;  2JFA A;  4TV1 A;  2F4B A;  4OH5 A;  3WJ4 A;  3OLF A;  3SP9 A;  5KD9 A;  4MGA B;  5KRC A;  1ZAF A;  3UU7 A;  3R5M A;  4IUI A;  3DZU D;  3H0A A;  2I0G A;  2G44 A;  3F5C A;  5GID A;  4FN9 A;  3VI8 A;  4G2I A;  3VHU A;  4IA3 A;  1QKN A;  2Q1V A;  2BJ4 B;  3W0A A;  2OVH A;  3Q95 B;  1G5Y A;  4ITF A;  5E19 A;  1NRL A;  3P88 A;  1YMT A;  3ZRA A;  1NAX A;  2QR9 A;  3UUD B;  5JI0 D;  2YHD A;  1XLS E;  4RUJ A;  3CLD A;  4M8H A;  5KCW A;  2QMV A;  2AMB A;  3MNP A;  4K7A A;  4OGH A;  5G44 A;  2I0J A;  3WWR A;  2YLY A;  5DXP A;  4YMQ A;  5JJM B;  2A3I A;  2PIU A;  1YUC A;  2VV3 A;  1I37 A;  5DV3 A;  1X7E A;  2EWP A;  2BJ4 A;  5DXE A;  1FM9 A;  1T7M A;  3G0W A;  3Q95 A;  4OEA A;  1YY4 A;  3GN8 A;  3V9Y A;  1MVC A;  4PWL A;  5DWE A;  4ZNV A;  3AZ2 A;  3TX7 B;  5C4O A;  3H0A D;  5ICK A;  3CS8 A;  3D90 A;  4A4W A;  4Q50 A;  4OEZ A;  2QXM A;  1XOW A;  2HAR A;  2AA5 A;  2OAX A;  3PO9 A;  3OMM A;  3ET2 A;  5G3J A;  3VHW A;  3VHV A;  4OAR A;  2ZLC A;  3FEI A;  5APK A;  1NQ0 A;  1YOW A;  4N5G A;  4YT1 A;  3PBA A;  1T74 A;  1UHL A;  2QZO B;  3IPS A;  4P6X A;  5DXR A;  1ERE A;  4QE6 A;  3L3Z A;  1XPC A;  2Q61 A;  1L2J A;  3OLS A;  2AAX A;  3HZF A;  3B0R A;  3K22 A;  1A28 A;  1ZEO A;  2H77 A;  1G2N A;  4TUZ B;  1FM9 D;  1T63 A;  2VSR A;  2PNU A;  3A9E B;  2Q59 A;  5KRI A;  5DXQ A;  3OS8 A;  3VRU A;  5DIE A;  4WPF A;  3GYU A;  3S9S A;  4J5X A;  3OMO A;  5DXM A;  3AUR A;  4A2J A;  5HYK A;  2QA6 A;  2OM9 A;  1S0X A;  2YLO A;  2ZNQ A;  3GYT A;  3R5N A;  5DV8 A;  3VT3 A;  4N1Y A;  5KRJ A;  2XYX A;  4ZO1 X;  5KRL A;  5M96 A;  1YJE A;  4MG6 A;  1U3Q A;  3LMP A;  5HJP B;  4TUZ A;  5FQS A;  3U9Q A;  1GS4 A;  4ZNT A;  4OK1 A;  1I7G A;  4RE8 A;  5EIT A;  5SYZ A;  3BQD A;  3WGP A;  3X1H A;  1A52 A;  4K4J A;  4PXM A;  5L7G A;  3B5R A;  3RUU A;  2YFE A;  1XQ3 A;  3OZ0 A;  5IZ0 A;  5AAV B;  5HZC A;  2P54 A;  2Q7I A;  3G8I A;  4S14 A;  3W0I A;  2I4Z A;  5KCF A;  2ZXN A;  3VJS A;  4XHD A;  5IXK A;  2Q60 A;  5AZV A;  4NQA B;  1K7L A;  2J4A A;  3D5F A;  3N00 A;  5AWK A;  4MDD A;  2OZ7 A;  5AAU A;  3ADT A;  3VN2 A;  5GT4 A;  1XJ7 A;  5DZ0 A;  2AM9 A;  2ZMJ A;  4XAO A;  5DXB B;  3ZQT A;  2PIN A;  5DZI A;  1QKT A;  3KDT A;  5DP0 A;  1NQ1 A;  1ERR A;  2FVJ A;  2HFP A;  1PQC A;  2J14 A;  2P7Z A;  2Q7K A;  2QAB A;  1DKF B;  4OFU A;  5C4T A;  1QKU A;  4RAK A;  2AMA A;  2I4P A;  4IU7 A;  3RLJ A;  3VJT A;  3AUN A;  4IVY A;  4RUO X;  3ERT A;  2Q5G A;  5AYG A;  4E4Q A;  3E94 A;  1X76 A;  4O8F A;  2HC4 A;  3KPZ A;  4OKX A;  3AUQ A;  2Q70 A;  3P8X A;  2VV2 A;  4POH A;  3CJW A;  1FCZ A;  5DXB A;  5F9B A;  3TY0 A;  3VTC A;  3HQ5 A;  4OZT E;  4OKT A;  2PKL A;  2ZK1 A;  3WT5 A;  1YIN A;  1XP1 A;  2HBH A;  5DKG A;  2V0V A;  1X7J A;  2ZNP A;  3ZRB A;  1BSX A;  1UPW A;  1KNU A;  5CJ6 A;  4APU A;  1RDT A;  3IXP A;  3VT7 A;  5AVL A;  5KCU A;  4TV1 B;  2G0G A;  3V9T A;  1YOK A;  2YJA B;  1Y0S A;  3D57 A;  3E7C A;  4J24 A;  1TXI A;  1T65 A;  5HJS A;  4CI4 A;  1NUO A;  3R2A A;  4UDB A;  3R8I A;  1S0Z A;  1VJB A;  2ZMI A;  4IVW A;  4RZF A;  3WTQ A;  3KMZ A;  2IHQ A;  1L2I A;  4OIL A;  1U9E A;  5DMF A;  1UOM A;  5FQV A;  5DXK A;  4F9M A;  5E14 A;  1T7R A;  4ZNU A;  5H1E A;  2G5O A;  2IOG A;  3FLI A;  5LWP A;  1NQ7 A;  4MGD B;  2XYJ A;  1KKQ A;  3B66 A;  4IWF A;  1XV9 B;  1T7F A;  4OH6 A;  1RJK A;  4X1G A;  4OKW A;  4PLD A;  1NHZ A;  1IE8 A;  4RFW A;  5DTV A;  2LBD A;  4PVU A;  1RDT D;  3IXP D;  5FQP A;  3HM1 A;  1OSV A;  3OSI A;  4Y29 A;  5HJP A;  4PF3 A;  3HOD A;  3OMK A;  4LNW A;  1Z5X U;  2QNV A;  4MGD A;  3G9E A;  3NOA A;  3DR1 A;  3KFC A;  3PEQ A;  4OC7 A;  5DUG A;  1G50 A;  1XV9 A;  3B1M A;  3T03 A;  5DRM A;  3OS8 C;  4OLM A;  5ETH A;  4DK8 A;  4ZN9 A;  2NPA A;  4J5X C;  3SP6 A;  5EHJ A;  3O1E A;  2VV1 B;  3VRW A;  2NXX A;  1UHL B;  4S15 A;  3W0G A;  5DZ3 A;  3L0E A;  2GPP A;  2YLQ A;  2QGW A;  2POG A;  5FQR A;  1XDK A;  5EGV A;  4NY9 A;  2P1V A;  4FHI A;  1DB1 A;  2HWR A;  3VSP A;  3G8O A;  5E0X A;  1R6G A;  3DY6 A;  3A2J A;  2Q1H A;  5G43 A;  2Q59 B;  5EJV A;  2AWH A;  1T73 A;  3L0L A;  3GD2 A;  4MGB A;  2QH6 A;  5FQT A;  5HYR A;  4FNE A;  2QSE A;  3KYT A;  3B0T A;  3W0C A;  2VV1 A;  4MG7 B;  4FGY A;  2HWQ A;  5GIE A;  3UP3 A;  3ET3 A;  5KCT A;  3VTD A;  5E0W A;  3FC6 B;  4LNX A;  3IPU A;  3ERD A;  1XAP A;  4PP3 A;  4ZNH A;  1LV2 A;  4OEY A;  5APH A;  3OMP A;  4PP6 A;  1M13 A;  2PIW A;  1PRG A;  1U3R A;  2HAM A;  3VT6 A;  1KV6 A;  5C4S A;  2B23 A;  3CTB A;  4R06 A;  2PIV A;  3W0Y A;  4Q13 A;  2ZXM A;  4B7W A;  1LBD A;  2AXA A;  1T76 A;  3TKM A;  5KRH A;  1R20 A;  4Q0A C;  2Q8S A;  4RMD A;  4MG7 A;  2P7A A;  1XLS A;  2Q5P A;  5AWJ A;  3OZJ A;  5APJ A;  3W5P A;  3V9V A;  3FC6 A;  3V4A A;  5DKE A;  3B65 A;  5KRM A;  2P15 A;  2ZK3 A;  2NW4 A;  4NUF A;  1Y9R A;  3HC6 A;  3L1B A;  1SKX A;  3B0W A;  1YIM A;  3DZY A;  1FCX A;  2IOK A;  1E3G A;  4M8E A;  2ZNN A;  3A2I A;  5DI7 A;  5G46 A;  4OIU A;  3SZ1 A;  1Z5X E;  4A4V A;  2P1T A;  4IW8 A;  4QE8 A;  5DVC A;  3K6P A;  2GPV A;  1P8D A;  3W0H A;  3ZR7 A;  3W5Q A;  1N83 A;  2ZK0 A;  3AN4 A;  3O1D A;  4S0T A;  2AA7 A;  3ADX A;  2ZKC A;  4G21 A;  3VTB A;  2ZK4 A;  1EXA A;  4IS8 A;  1RKH A;  3A78 A;  3P0U A;  4HLW A;  4MG9 B;  5DKB A;  4EM9 A;  4QM0 A;  3FUG A;  3MNO A;  5DY8 A;  2GPU A;  3VT8 A;  4P6W A;  3L03 A;  4R6S A;  1R20 D;  1YYE A;  3ADV A;  4OJ9 A;  3CQV A;  3EYB A;  2QA8 B;  5KRO A;  4NB6 A;  2E2R A;  1G1U A;  3VT4 A;  3X31 A;  4DOR A;  4N8R A;  4KZJ A;  2GP7 A;  4ZJR A;  5IAW A;  4ITE A;  2PIO A;  4KZM A;  3FXV A;  2Z4B A;  4MG9 A;  5L7E A;  3DZY D;  1FCY A;  2PIT A;  3R8A A;  3R8D A;  5DWI A;  4OZR U;  2REW A;  2HAS A;  2QW4 A;  1XNX A;  4REE A;  5DKS A;  4YPQ A;  2QA8 A;  4OZT U;  1ILG A;  2J7X A;  3HC5 A;  2GIU A;  5ACC A;  5KCD A;  5GIC A;  3ADS A;  2YJD A;  4XI3 A;  1XP9 A;  3DCU A;  4DM6 A;  2Q6J A;  2P7G A;  2PIX A;  4K6I A;  1K4W A;  4PRG A;  4DK7 A;  2POB A;  3HVL A;  5KRF A;  2AX7 A;  2AX6 A;  4ZNW A;  3H52 A;  5DYB A;  3IMY A;  4PPP A;  4WQP A;  2NV7 A;  5E7V A;  4J26 A;  2ZXZ A;  4OJ4 A;  3OAP A;  3JZB A;  1UPV A;  3D24 A;  5AK2 A;  4J5W A;  5DX3 B;  2ABI A;  4DMA A;  5DZ1 A;  1N46 A;  2QXS A;  5L7H A;  3UVV B;  3B68 A;  4S0S A;  3AFR A;  4DOS A;  3NSP A;  2OUZ A;  3RLL A;  3CWD A;  3KWY A;  3WT6 A;  1OT7 A;  2R6Y A;  3V49 A;  2PJL A;  3JZC A;  2ZK2 A;  4N73 A;  4LTW A;  1FM6 A;  5DUE A;  3VT9 A;  1GWX A;  1U3S A;  4ZJW A;  1GWR A;  2PIQ A;  4RMC A;  2QTU A;  4EMA A;  3PCU A;  2I4J A;  1OVL B;  1HJ1 A;  5DRJ A;  5HCV A;  5DWL A;  1T7T A;  3CDP A;  1FD0 A;  5KCE A;  1X7R A;  2QE4 A;  3V3Q A;  2XYW A;  1Z95 A;  5DX3 A;  3UVV A;  3IA6 A;  2AYR A;  2P4Y A;  3WFG A;  1FBY A;  5DVV A;  5KRK A;  3B3K A;  1ZH7 A;  5AZT A;  1PK5 A;  3OKH A;  4QJR A;  5E1C A;  2YAT A;  2O4R A;  1MZN A;  1PQ9 A;  1XDK B;  3A40 X;  3VRT A;  4IA1 A;  2GTK A;  4ZOM A;  1OVL A;  2G0H A;  1PCG A;  1N4H A;  1ILH A;  4IW6 A;  5DU5 A;  2AA2 A;  1IE9 A;  3QT0 A;  4R2U A;  4MGB B;  4XUH A;  2ATH A;  4QK4 A;  2AX9 A;  3OSW A;  1FM6 D;  5KYA A;  3PRG A;  4JYG A;  4OZR E;  3VRV A;  3B67 A;  4CI5 A;  3ADW A;  4JAZ A;  3OOF A;  3KMR A;  3OOK A; 
#chains in the Genus database with same CATH topology
 1E3K A;  3HLV A;  1SJ0 A;  2VV0 A;  2ZNO A;  1S9Q A;  4MG8 B;  3MNE A;  5DWG A;  2Q7J A;  4L96 A;  1ZUC A;  4PP5 A;  3FEJ A;  2ACL B;  2B50 A;  2ZMH A;  3A2H A;  2XHS A;  1XVP B;  4DQM A;  5LGA A;  5DXG A;  2HB7 A;  4MGA A;  2JJ3 A;  2PRG A;  1M7W A;  1XP6 A;  1QKM A;  1S19 A;  2PIP L;  4LSJ A;  1ZKY A;  4PLE A;  2ZL9 A;  2Q7L A;  4MG8 A;  3RVF A;  5I4V A;  3CS4 A;  3UUD A;  5G5W A;  2ACL A;  1MV9 A;  1ZDT A;  4POJ A;  3RUT A;  1HG4 A;  1XVP A;  5DIG A;  4IQR A;  3F7D A;  5JY3 A;  2BAW A;  5JJM A;  1Y0X X;  4IV2 A;  3FS1 A;  5L11 A;  1TFC A;  1PDU A;  2V7C A;  1M2Z A;  2AB2 A;  2AX8 A;  2J7Y A;  4E4K A;  3E00 A;  5DV6 A;  1YA3 A;  1X7B A;  2GL8 A;  4IV4 A;  5KYJ A;  2PIR A;  4OHA A;  1H9U A;  2ZK6 A;  2R40 A;  3GZ9 A;  1PZL A;  4IWC A;  4XT9 A;  3TKC A;  3WT7 A;  2ZK5 A;  5EC9 A;  4FHH A;  4OJB A;  2R6W A;  1NAV A;  5KCC A;  3OS9 A;  3VSO A;  5DK9 A;  4G1Z A;  4MGC A;  4YNK A;  1Q4X A;  4OKB A;  5K13 A;  3X36 A;  4JYI A;  1RK3 A;  1I38 A;  2FSZ A;  4RZG A;  4NIE A;  3KDU A;  1K74 A;  3FAL B;  2B1Z A;  1NQ2 A;  5DVS A;  1R1K A;  2QZO A;  4G1Y A;  4ZNS A;  3CS6 A;  4J5W C;  4RUP A;  3ET1 A;  4OFR A;  4UDC A;  4WHF A;  2ZVT A;  4ZN7 A;  2VV4 B;  1SQN A;  1X78 A;  4XTA A;  4BCR A;  3E00 D;  2Q6R A;  3A9E A;  5DWJ A;  5DUH A;  2AA6 A;  1PQ6 A;  5AVI A;  3FUR A;  3OMQ A;  4XUM A;  4X1F A;  5DMC A;  5C4U A;  5DL4 A;  3AX8 A;  4CSJ A;  3V3E A;  2R40 D;  3W5T A;  5B5B A;  2QPY A;  3DT3 A;  4MG5 A;  2O4J A;  3ILZ A;  4G2H A;  3PLZ A;  4ONI A;  1GWQ A;  3GWX A;  3FAL A;  3HO0 A;  4ZO1 B;  2OCF A;  5G42 A;  3B0Q A;  1XZX X;  1ZGY A;  2OVM A;  3OKI A;  3P89 A;  3OGT A;  4UDA A;  1WM0 X;  3L3X A;  4OED A;  3UUA B;  2VST A;  2VV4 A;  1OSH A;  1YP0 A;  4G1D A;  3VJH A;  2AO6 A;  2ZAS A;  5DYD A;  3NSQ A;  3UUC A;  2QGT A;  4JL4 A;  1K74 D;  5A86 A;  1XB7 A;  5DZH A;  3OSA A;  1R1K D;  1S9P A;  4IA2 A;  4OIV A;  3KMG A;  4WVD A;  4XLD A;  4KZI A;  2GWX A;  5AAV A;  4G20 A;  4WHG A;  3RY9 A;  2YLP A;  4PPS A;  4REF A;  3AN3 A;  4JYH A;  1ZDU A;  3AZ1 A;  3R29 A;  2H79 A;  4RWV A;  5E15 A;  3UUA A;  3CDS A;  5B41 A;  3UP0 A;  2ZY0 A;  5DSH A;  4UDD A;  3ET0 A;  1RKG A;  3W5R A;  2Q5S A;  2ZLA A;  3L0J A;  4E2J A;  2P1U A;  4WLB A;  4LBD A;  1XIU A;  3GWS X;  2HB8 A;  4ZI1 A;  1DKF A;  3LBD A;  2ZFX A;  3WMH A;  2O9I A;  3ADU A;  3DCT A;  4IA7 A;  3WJ5 A;  3DZU A;  3BEJ A;  1P93 A;  1XQC A;  2JF9 A;  3VJI A;  1NDE A;  2JFA B;  2NXX E;  2Z4J A;  2FAI A;  3OLL A;  4RME A;  4JGV A;  5G45 A;  3X1I A;  4RZE A;  5KRA A;  3M7R A;  2HCD A;  2HVC A;  1NYX A;  2Q3Y A;  1EXX A;  2ZBS A;  3K8S A;  5EI1 A;  3UU7 B;  3WFF A;  5KR9 A;  2XKW A;  1SR7 A;  3A3Z X;  2W8Y A;  1I7I A;  3D6D A;  3F5C B;  3GBK A;  3K23 A;  1XNN A;  4HEE X;  5DLR A;  4DM8 A;  3W0J A;  3IPQ A;  5DID A;  3KBA A;  1T79 A;  4L98 A;  2B1V A;  2Q6S A;  1R5K A;  3AZ3 A;  4QL8 A;  3VT5 A;  2GPO A;  1T5Z A;  3BC5 A;  2JFA A;  4TV1 A;  2F4B A;  4OH5 A;  3WJ4 A;  3OLF A;  3SP9 A;  5KD9 A;  4MGA B;  5KRC A;  1ZAF A;  3UU7 A;  3R5M A;  4IUI A;  3DZU D;  3H0A A;  2I0G A;  2G44 A;  3F5C A;  5GID A;  4FN9 A;  3VI8 A;  4G2I A;  3VHU A;  4IA3 A;  1QKN A;  2Q1V A;  2BJ4 B;  3W0A A;  2OVH A;  3Q95 B;  1G5Y A;  4ITF A;  5E19 A;  1NRL A;  3P88 A;  1YMT A;  3ZRA A;  1NAX A;  2QR9 A;  3UUD B;  5JI0 D;  2YHD A;  1XLS E;  4RUJ A;  3CLD A;  4M8H A;  5KCW A;  2QMV A;  2AMB A;  3MNP A;  4K7A A;  4OGH A;  5G44 A;  2I0J A;  3WWR A;  2YLY A;  5DXP A;  4YMQ A;  5JJM B;  2A3I A;  2PIU A;  1YUC A;  2VV3 A;  1I37 A;  5DV3 A;  1X7E A;  2EWP A;  2BJ4 A;  5DXE A;  1FM9 A;  1T7M A;  3G0W A;  3Q95 A;  4OEA A;  1YY4 A;  3GN8 A;  3V9Y A;  1MVC A;  4PWL A;  5DWE A;  4ZNV A;  3AZ2 A;  3TX7 B;  5C4O A;  3H0A D;  5ICK A;  3CS8 A;  3D90 A;  4A4W A;  4Q50 A;  4OEZ A;  2QXM A;  1XOW A;  2HAR A;  2AA5 A;  2OAX A;  3PO9 A;  3OMM A;  3ET2 A;  5G3J A;  3VHW A;  3VHV A;  4OAR A;  2ZLC A;  3FEI A;  5APK A;  1NQ0 A;  1YOW A;  4N5G A;  4YT1 A;  3PBA A;  1T74 A;  1UHL A;  2QZO B;  3IPS A;  4P6X A;  5DXR A;  1ERE A;  4QE6 A;  3L3Z A;  1XPC A;  2Q61 A;  1L2J A;  3OLS A;  2AAX A;  3HZF A;  3B0R A;  3K22 A;  1A28 A;  1ZEO A;  2H77 A;  1G2N A;  4TUZ B;  1FM9 D;  1T63 A;  2VSR A;  2PNU A;  3A9E B;  2Q59 A;  5KRI A;  5DXQ A;  3OS8 A;  3VRU A;  5DIE A;  4WPF A;  3GYU A;  3S9S A;  4J5X A;  3OMO A;  5DXM A;  3AUR A;  4A2J A;  5HYK A;  2QA6 A;  2OM9 A;  1S0X A;  2YLO A;  2ZNQ A;  3GYT A;  3R5N A;  5DV8 A;  3VT3 A;  4N1Y A;  5KRJ A;  2XYX A;  4ZO1 X;  5KRL A;  5M96 A;  1YJE A;  4MG6 A;  1U3Q A;  3LMP A;  5HJP B;  4TUZ A;  5FQS A;  3U9Q A;  1GS4 A;  4ZNT A;  4OK1 A;  1I7G A;  4RE8 A;  5EIT A;  5SYZ A;  3BQD A;  3WGP A;  3X1H A;  1A52 A;  4K4J A;  4PXM A;  5L7G A;  3B5R A;  3RUU A;  2YFE A;  1XQ3 A;  3OZ0 A;  5IZ0 A;  5AAV B;  5HZC A;  2P54 A;  2Q7I A;  3G8I A;  4S14 A;  3W0I A;  2I4Z A;  5KCF A;  2ZXN A;  3VJS A;  4XHD A;  5IXK A;  2Q60 A;  5AZV A;  4NQA B;  1K7L A;  2J4A A;  3D5F A;  3N00 A;  5AWK A;  4MDD A;  2OZ7 A;  5AAU A;  3ADT A;  3VN2 A;  5GT4 A;  1XJ7 A;  5DZ0 A;  2AM9 A;  2ZMJ A;  4XAO A;  5DXB B;  3ZQT A;  2PIN A;  5DZI A;  1QKT A;  3KDT A;  5DP0 A;  1NQ1 A;  1ERR A;  2FVJ A;  2HFP A;  1PQC A;  2J14 A;  2P7Z A;  2Q7K A;  2QAB A;  1DKF B;  4OFU A;  5C4T A;  1QKU A;  4RAK A;  2AMA A;  2I4P A;  4IU7 A;  3RLJ A;  3VJT A;  3AUN A;  4IVY A;  4RUO X;  3ERT A;  2Q5G A;  5AYG A;  4E4Q A;  3E94 A;  1X76 A;  4O8F A;  2HC4 A;  3KPZ A;  4OKX A;  3AUQ A;  2Q70 A;  3P8X A;  2VV2 A;  4POH A;  3CJW A;  1FCZ A;  5DXB A;  5F9B A;  3TY0 A;  3VTC A;  3HQ5 A;  4OZT E;  4OKT A;  2PKL A;  2ZK1 A;  3WT5 A;  1YIN A;  1XP1 A;  2HBH A;  5DKG A;  2V0V A;  1X7J A;  2ZNP A;  3ZRB A;  1BSX A;  1UPW A;  1KNU A;  5CJ6 A;  4APU A;  1RDT A;  3IXP A;  3VT7 A;  5AVL A;  5KCU A;  4TV1 B;  2G0G A;  3V9T A;  1YOK A;  2YJA B;  1Y0S A;  3D57 A;  3E7C A;  4J24 A;  1TXI A;  1T65 A;  5HJS A;  4CI4 A;  1NUO A;  3R2A A;  4UDB A;  3R8I A;  1S0Z A;  1VJB A;  2ZMI A;  4IVW A;  4RZF A;  3WTQ A;  3KMZ A;  2IHQ A;  1L2I A;  4OIL A;  1U9E A;  5DMF A;  1UOM A;  5FQV A;  5DXK A;  4F9M A;  5E14 A;  1T7R A;  4ZNU A;  5H1E A;  2G5O A;  2IOG A;  3FLI A;  5LWP A;  1NQ7 A;  4MGD B;  2XYJ A;  1KKQ A;  3B66 A;  4IWF A;  1XV9 B;  1T7F A;  4OH6 A;  1RJK A;  4X1G A;  4OKW A;  4PLD A;  1NHZ A;  1IE8 A;  4RFW A;  5DTV A;  2LBD A;  4PVU A;  1RDT D;  3IXP D;  5FQP A;  3HM1 A;  1OSV A;  3OSI A;  4Y29 A;  5HJP A;  4PF3 A;  3HOD A;  3OMK A;  4LNW A;  1Z5X U;  2QNV A;  4MGD A;  3G9E A;  3NOA A;  3DR1 A;  3KFC A;  3PEQ A;  4OC7 A;  5DUG A;  1G50 A;  1XV9 A;  3B1M A;  3T03 A;  5DRM A;  3OS8 C;  4OLM A;  5ETH A;  4DK8 A;  4ZN9 A;  2NPA A;  4J5X C;  3SP6 A;  5EHJ A;  3O1E A;  2VV1 B;  3VRW A;  2NXX A;  1UHL B;  4S15 A;  3W0G A;  5DZ3 A;  3L0E A;  2GPP A;  2YLQ A;  2QGW A;  2POG A;  5FQR A;  1XDK A;  5EGV A;  4NY9 A;  2P1V A;  4FHI A;  1DB1 A;  2HWR A;  3VSP A;  3G8O A;  5E0X A;  1R6G A;  3DY6 A;  3A2J A;  2Q1H A;  5G43 A;  2Q59 B;  5EJV A;  2AWH A;  1T73 A;  3L0L A;  3GD2 A;  4MGB A;  2QH6 A;  5FQT A;  5HYR A;  4FNE A;  2QSE A;  3KYT A;  3B0T A;  3W0C A;  2VV1 A;  4MG7 B;  4FGY A;  2HWQ A;  5GIE A;  3UP3 A;  3ET3 A;  5KCT A;  3VTD A;  5E0W A;  3FC6 B;  4LNX A;  3IPU A;  3ERD A;  1XAP A;  4PP3 A;  4ZNH A;  1LV2 A;  4OEY A;  5APH A;  3OMP A;  4PP6 A;  1M13 A;  2PIW A;  1PRG A;  1U3R A;  2HAM A;  3VT6 A;  1KV6 A;  5C4S A;  2B23 A;  3CTB A;  4R06 A;  2PIV A;  3W0Y A;  4Q13 A;  2ZXM A;  4B7W A;  1LBD A;  2AXA A;  1T76 A;  3TKM A;  5KRH A;  1R20 A;  4Q0A C;  2Q8S A;  4RMD A;  4MG7 A;  2P7A A;  1XLS A;  2Q5P A;  5AWJ A;  3OZJ A;  5APJ A;  3W5P A;  3V9V A;  3FC6 A;  3V4A A;  5DKE A;  3B65 A;  5KRM A;  2P15 A;  2ZK3 A;  2NW4 A;  4NUF A;  1Y9R A;  3HC6 A;  3L1B A;  1SKX A;  3B0W A;  1YIM A;  3DZY A;  1FCX A;  2IOK A;  1E3G A;  4M8E A;  2ZNN A;  3A2I A;  5DI7 A;  5G46 A;  4OIU A;  3SZ1 A;  1Z5X E;  4A4V A;  2P1T A;  4IW8 A;  4QE8 A;  5DVC A;  3K6P A;  2GPV A;  1P8D A;  3W0H A;  3ZR7 A;  3W5Q A;  1N83 A;  2ZK0 A;  3AN4 A;  3O1D A;  4S0T A;  2AA7 A;  3ADX A;  2ZKC A;  4G21 A;  3VTB A;  2ZK4 A;  1EXA A;  4IS8 A;  1RKH A;  3A78 A;  3P0U A;  4HLW A;  4MG9 B;  5DKB A;  4EM9 A;  4QM0 A;  3FUG A;  3MNO A;  5DY8 A;  2GPU A;  3VT8 A;  4P6W A;  3L03 A;  4R6S A;  1R20 D;  1YYE A;  3ADV A;  4OJ9 A;  3CQV A;  3EYB A;  2QA8 B;  5KRO A;  4NB6 A;  2E2R A;  1G1U A;  3VT4 A;  3X31 A;  4DOR A;  4N8R A;  4KZJ A;  2GP7 A;  4ZJR A;  5IAW A;  4ITE A;  2PIO A;  4KZM A;  3FXV A;  2Z4B A;  4MG9 A;  5L7E A;  3DZY D;  1FCY A;  2PIT A;  3R8A A;  3R8D A;  5DWI A;  4OZR U;  2REW A;  2HAS A;  2QW4 A;  1XNX A;  4REE A;  5DKS A;  4YPQ A;  2QA8 A;  4OZT U;  1ILG A;  2J7X A;  3HC5 A;  2GIU A;  5ACC A;  5KCD A;  5GIC A;  3ADS A;  2YJD A;  4XI3 A;  1XP9 A;  3DCU A;  4DM6 A;  2Q6J A;  2P7G A;  2PIX A;  4K6I A;  1K4W A;  4PRG A;  4DK7 A;  2POB A;  3HVL A;  5KRF A;  2AX7 A;  2AX6 A;  4ZNW A;  3H52 A;  5DYB A;  3IMY A;  4PPP A;  4WQP A;  2NV7 A;  5E7V A;  4J26 A;  2ZXZ A;  4OJ4 A;  3OAP A;  3JZB A;  1UPV A;  3D24 A;  5AK2 A;  4J5W A;  5DX3 B;  2ABI A;  4DMA A;  5DZ1 A;  1N46 A;  2QXS A;  5L7H A;  3UVV B;  3B68 A;  4S0S A;  3AFR A;  4DOS A;  3NSP A;  2OUZ A;  3RLL A;  3CWD A;  3KWY A;  3WT6 A;  1OT7 A;  2R6Y A;  3V49 A;  2PJL A;  3JZC A;  2ZK2 A;  4N73 A;  4LTW A;  1FM6 A;  5DUE A;  3VT9 A;  1GWX A;  1U3S A;  4ZJW A;  1GWR A;  2PIQ A;  4RMC A;  2QTU A;  4EMA A;  3PCU A;  2I4J A;  1OVL B;  1HJ1 A;  5DRJ A;  5HCV A;  5DWL A;  1T7T A;  3CDP A;  1FD0 A;  5KCE A;  1X7R A;  2QE4 A;  3V3Q A;  2XYW A;  1Z95 A;  5DX3 A;  3UVV A;  3IA6 A;  2AYR A;  2P4Y A;  3WFG A;  1FBY A;  5DVV A;  5KRK A;  3B3K A;  1ZH7 A;  5AZT A;  1PK5 A;  3OKH A;  4QJR A;  5E1C A;  2YAT A;  2O4R A;  1MZN A;  1PQ9 A;  1XDK B;  3A40 X;  3VRT A;  4IA1 A;  2GTK A;  4ZOM A;  1OVL A;  2G0H A;  1PCG A;  1N4H A;  1ILH A;  4IW6 A;  5DU5 A;  2AA2 A;  1IE9 A;  3QT0 A;  4R2U A;  4MGB B;  4XUH A;  2ATH A;  4QK4 A;  2AX9 A;  3OSW A;  1FM6 D;  5KYA A;  3PRG A;  4JYG A;  4OZR E;  3VRV A;  3B67 A;  4CI5 A;  3ADW A;  4JAZ A;  3OOF A;  3KMR A;  3OOK A; 
#chains in the Genus database with same CATH homology
 1E3K A;  3HLV A;  1SJ0 A;  2VV0 A;  2ZNO A;  1S9Q A;  4MG8 B;  3MNE A;  5DWG A;  2Q7J A;  4L96 A;  1ZUC A;  4PP5 A;  3FEJ A;  2ACL B;  2B50 A;  2ZMH A;  3A2H A;  2XHS A;  1XVP B;  4DQM A;  5LGA A;  5DXG A;  2HB7 A;  4MGA A;  2JJ3 A;  2PRG A;  1M7W A;  1XP6 A;  1QKM A;  1S19 A;  2PIP L;  4LSJ A;  1ZKY A;  4PLE A;  2ZL9 A;  2Q7L A;  4MG8 A;  3RVF A;  5I4V A;  3CS4 A;  3UUD A;  5G5W A;  2ACL A;  1MV9 A;  1ZDT A;  4POJ A;  3RUT A;  1HG4 A;  1XVP A;  5DIG A;  4IQR A;  3F7D A;  5JY3 A;  2BAW A;  5JJM A;  1Y0X X;  4IV2 A;  3FS1 A;  5L11 A;  1TFC A;  1PDU A;  2V7C A;  1M2Z A;  2AB2 A;  2AX8 A;  2J7Y A;  4E4K A;  3E00 A;  5DV6 A;  1YA3 A;  1X7B A;  2GL8 A;  4IV4 A;  5KYJ A;  2PIR A;  4OHA A;  1H9U A;  2ZK6 A;  2R40 A;  3GZ9 A;  1PZL A;  4IWC A;  4XT9 A;  3TKC A;  3WT7 A;  2ZK5 A;  5EC9 A;  4FHH A;  4OJB A;  2R6W A;  1NAV A;  5KCC A;  3OS9 A;  3VSO A;  5DK9 A;  4G1Z A;  4MGC A;  4YNK A;  1Q4X A;  4OKB A;  5K13 A;  3X36 A;  4JYI A;  1RK3 A;  1I38 A;  2FSZ A;  4RZG A;  4NIE A;  3KDU A;  1K74 A;  3FAL B;  2B1Z A;  1NQ2 A;  5DVS A;  1R1K A;  2QZO A;  4G1Y A;  4ZNS A;  3CS6 A;  4J5W C;  4RUP A;  3ET1 A;  4OFR A;  4UDC A;  4WHF A;  2ZVT A;  4ZN7 A;  2VV4 B;  1SQN A;  1X78 A;  4XTA A;  4BCR A;  3E00 D;  2Q6R A;  3A9E A;  5DWJ A;  5DUH A;  2AA6 A;  1PQ6 A;  5AVI A;  3FUR A;  3OMQ A;  4XUM A;  4X1F A;  5DMC A;  5C4U A;  5DL4 A;  3AX8 A;  4CSJ A;  3V3E A;  2R40 D;  3W5T A;  5B5B A;  2QPY A;  3DT3 A;  4MG5 A;  2O4J A;  3ILZ A;  4G2H A;  3PLZ A;  4ONI A;  1GWQ A;  3GWX A;  3FAL A;  3HO0 A;  4ZO1 B;  2OCF A;  5G42 A;  3B0Q A;  1XZX X;  1ZGY A;  2OVM A;  3OKI A;  3P89 A;  3OGT A;  4UDA A;  1WM0 X;  3L3X A;  4OED A;  3UUA B;  2VST A;  2VV4 A;  1OSH A;  1YP0 A;  4G1D A;  3VJH A;  2AO6 A;  2ZAS A;  5DYD A;  3NSQ A;  3UUC A;  2QGT A;  4JL4 A;  1K74 D;  5A86 A;  1XB7 A;  5DZH A;  3OSA A;  1R1K D;  1S9P A;  4IA2 A;  4OIV A;  3KMG A;  4WVD A;  4XLD A;  4KZI A;  2GWX A;  5AAV A;  4G20 A;  4WHG A;  3RY9 A;  2YLP A;  4PPS A;  4REF A;  3AN3 A;  4JYH A;  1ZDU A;  3AZ1 A;  3R29 A;  2H79 A;  4RWV A;  5E15 A;  3UUA A;  3CDS A;  5B41 A;  3UP0 A;  2ZY0 A;  5DSH A;  4UDD A;  3ET0 A;  1RKG A;  3W5R A;  2Q5S A;  2ZLA A;  3L0J A;  4E2J A;  2P1U A;  4WLB A;  4LBD A;  1XIU A;  3GWS X;  2HB8 A;  4ZI1 A;  1DKF A;  3LBD A;  2ZFX A;  3WMH A;  2O9I A;  3ADU A;  3DCT A;  4IA7 A;  3WJ5 A;  3DZU A;  3BEJ A;  1P93 A;  1XQC A;  2JF9 A;  3VJI A;  1NDE A;  2JFA B;  2NXX E;  2Z4J A;  2FAI A;  3OLL A;  4RME A;  4JGV A;  5G45 A;  3X1I A;  4RZE A;  5KRA A;  3M7R A;  2HCD A;  2HVC A;  1NYX A;  2Q3Y A;  1EXX A;  2ZBS A;  3K8S A;  5EI1 A;  3UU7 B;  3WFF A;  5KR9 A;  2XKW A;  1SR7 A;  3A3Z X;  2W8Y A;  1I7I A;  3D6D A;  3F5C B;  3GBK A;  3K23 A;  1XNN A;  4HEE X;  5DLR A;  4DM8 A;  3W0J A;  3IPQ A;  5DID A;  3KBA A;  1T79 A;  4L98 A;  2B1V A;  2Q6S A;  1R5K A;  3AZ3 A;  4QL8 A;  3VT5 A;  2GPO A;  1T5Z A;  3BC5 A;  2JFA A;  4TV1 A;  2F4B A;  4OH5 A;  3WJ4 A;  3OLF A;  3SP9 A;  5KD9 A;  4MGA B;  5KRC A;  1ZAF A;  3UU7 A;  3R5M A;  4IUI A;  3DZU D;  3H0A A;  2I0G A;  2G44 A;  3F5C A;  5GID A;  4FN9 A;  3VI8 A;  4G2I A;  3VHU A;  4IA3 A;  1QKN A;  2Q1V A;  2BJ4 B;  3W0A A;  2OVH A;  3Q95 B;  1G5Y A;  4ITF A;  5E19 A;  1NRL A;  3P88 A;  1YMT A;  3ZRA A;  1NAX A;  2QR9 A;  3UUD B;  5JI0 D;  2YHD A;  1XLS E;  4RUJ A;  3CLD A;  4M8H A;  5KCW A;  2QMV A;  2AMB A;  3MNP A;  4K7A A;  4OGH A;  5G44 A;  2I0J A;  3WWR A;  2YLY A;  5DXP A;  4YMQ A;  5JJM B;  2A3I A;  2PIU A;  1YUC A;  2VV3 A;  1I37 A;  5DV3 A;  1X7E A;  2EWP A;  2BJ4 A;  5DXE A;  1FM9 A;  1T7M A;  3G0W A;  3Q95 A;  4OEA A;  1YY4 A;  3GN8 A;  3V9Y A;  1MVC A;  4PWL A;  5DWE A;  4ZNV A;  3AZ2 A;  3TX7 B;  5C4O A;  3H0A D;  5ICK A;  3CS8 A;  3D90 A;  4A4W A;  4Q50 A;  4OEZ A;  2QXM A;  1XOW A;  2HAR A;  2AA5 A;  2OAX A;  3PO9 A;  3OMM A;  3ET2 A;  5G3J A;  3VHW A;  3VHV A;  4OAR A;  2ZLC A;  3FEI A;  5APK A;  1NQ0 A;  1YOW A;  4N5G A;  4YT1 A;  3PBA A;  1T74 A;  1UHL A;  2QZO B;  3IPS A;  4P6X A;  5DXR A;  1ERE A;  4QE6 A;  3L3Z A;  1XPC A;  2Q61 A;  1L2J A;  3OLS A;  2AAX A;  3HZF A;  3B0R A;  3K22 A;  1A28 A;  1ZEO A;  2H77 A;  1G2N A;  4TUZ B;  1FM9 D;  1T63 A;  2VSR A;  2PNU A;  3A9E B;  2Q59 A;  5KRI A;  5DXQ A;  3OS8 A;  3VRU A;  5DIE A;  4WPF A;  3GYU A;  3S9S A;  4J5X A;  3OMO A;  5DXM A;  3AUR A;  4A2J A;  5HYK A;  2QA6 A;  2OM9 A;  1S0X A;  2YLO A;  2ZNQ A;  3GYT A;  3R5N A;  5DV8 A;  3VT3 A;  4N1Y A;  5KRJ A;  2XYX A;  4ZO1 X;  5KRL A;  5M96 A;  1YJE A;  4MG6 A;  1U3Q A;  3LMP A;  5HJP B;  4TUZ A;  5FQS A;  3U9Q A;  1GS4 A;  4ZNT A;  4OK1 A;  1I7G A;  4RE8 A;  5EIT A;  5SYZ A;  3BQD A;  3WGP A;  3X1H A;  1A52 A;  4K4J A;  4PXM A;  5L7G A;  3B5R A;  3RUU A;  2YFE A;  1XQ3 A;  3OZ0 A;  5IZ0 A;  5AAV B;  5HZC A;  2P54 A;  2Q7I A;  3G8I A;  4S14 A;  3W0I A;  2I4Z A;  5KCF A;  2ZXN A;  3VJS A;  4XHD A;  5IXK A;  2Q60 A;  5AZV A;  4NQA B;  1K7L A;  2J4A A;  3D5F A;  3N00 A;  5AWK A;  4MDD A;  2OZ7 A;  5AAU A;  3ADT A;  3VN2 A;  5GT4 A;  1XJ7 A;  5DZ0 A;  2AM9 A;  2ZMJ A;  4XAO A;  5DXB B;  3ZQT A;  2PIN A;  5DZI A;  1QKT A;  3KDT A;  5DP0 A;  1NQ1 A;  1ERR A;  2FVJ A;  2HFP A;  1PQC A;  2J14 A;  2P7Z A;  2Q7K A;  2QAB A;  1DKF B;  4OFU A;  5C4T A;  1QKU A;  4RAK A;  2AMA A;  2I4P A;  4IU7 A;  3RLJ A;  3VJT A;  3AUN A;  4IVY A;  4RUO X;  3ERT A;  2Q5G A;  5AYG A;  4E4Q A;  3E94 A;  1X76 A;  4O8F A;  2HC4 A;  3KPZ A;  4OKX A;  3AUQ A;  2Q70 A;  3P8X A;  2VV2 A;  4POH A;  3CJW A;  1FCZ A;  5DXB A;  5F9B A;  3TY0 A;  3VTC A;  3HQ5 A;  4OZT E;  4OKT A;  2PKL A;  2ZK1 A;  3WT5 A;  1YIN A;  1XP1 A;  2HBH A;  5DKG A;  2V0V A;  1X7J A;  2ZNP A;  3ZRB A;  1BSX A;  1UPW A;  1KNU A;  5CJ6 A;  4APU A;  1RDT A;  3IXP A;  3VT7 A;  5AVL A;  5KCU A;  4TV1 B;  2G0G A;  3V9T A;  1YOK A;  2YJA B;  1Y0S A;  3D57 A;  3E7C A;  4J24 A;  1TXI A;  1T65 A;  5HJS A;  4CI4 A;  1NUO A;  3R2A A;  4UDB A;  3R8I A;  1S0Z A;  1VJB A;  2ZMI A;  4IVW A;  4RZF A;  3WTQ A;  3KMZ A;  2IHQ A;  1L2I A;  4OIL A;  1U9E A;  5DMF A;  1UOM A;  5FQV A;  5DXK A;  4F9M A;  5E14 A;  1T7R A;  4ZNU A;  5H1E A;  2G5O A;  2IOG A;  3FLI A;  5LWP A;  1NQ7 A;  4MGD B;  2XYJ A;  1KKQ A;  3B66 A;  4IWF A;  1XV9 B;  1T7F A;  4OH6 A;  1RJK A;  4X1G A;  4OKW A;  4PLD A;  1NHZ A;  1IE8 A;  4RFW A;  5DTV A;  2LBD A;  4PVU A;  1RDT D;  3IXP D;  5FQP A;  3HM1 A;  1OSV A;  3OSI A;  4Y29 A;  5HJP A;  4PF3 A;  3HOD A;  3OMK A;  4LNW A;  1Z5X U;  2QNV A;  4MGD A;  3G9E A;  3NOA A;  3DR1 A;  3KFC A;  3PEQ A;  4OC7 A;  5DUG A;  1G50 A;  1XV9 A;  3B1M A;  3T03 A;  5DRM A;  3OS8 C;  4OLM A;  5ETH A;  4DK8 A;  4ZN9 A;  2NPA A;  4J5X C;  3SP6 A;  5EHJ A;  3O1E A;  2VV1 B;  3VRW A;  2NXX A;  1UHL B;  4S15 A;  3W0G A;  5DZ3 A;  3L0E A;  2GPP A;  2YLQ A;  2QGW A;  2POG A;  5FQR A;  1XDK A;  5EGV A;  4NY9 A;  2P1V A;  4FHI A;  1DB1 A;  2HWR A;  3VSP A;  3G8O A;  5E0X A;  1R6G A;  3DY6 A;  3A2J A;  2Q1H A;  5G43 A;  2Q59 B;  5EJV A;  2AWH A;  1T73 A;  3L0L A;  3GD2 A;  4MGB A;  2QH6 A;  5FQT A;  5HYR A;  4FNE A;  2QSE A;  3KYT A;  3B0T A;  3W0C A;  2VV1 A;  4MG7 B;  4FGY A;  2HWQ A;  5GIE A;  3UP3 A;  3ET3 A;  5KCT A;  3VTD A;  5E0W A;  3FC6 B;  4LNX A;  3IPU A;  3ERD A;  1XAP A;  4PP3 A;  4ZNH A;  1LV2 A;  4OEY A;  5APH A;  3OMP A;  4PP6 A;  1M13 A;  2PIW A;  1PRG A;  1U3R A;  2HAM A;  3VT6 A;  1KV6 A;  5C4S A;  2B23 A;  3CTB A;  4R06 A;  2PIV A;  3W0Y A;  4Q13 A;  2ZXM A;  4B7W A;  1LBD A;  2AXA A;  1T76 A;  3TKM A;  5KRH A;  1R20 A;  4Q0A C;  2Q8S A;  4RMD A;  4MG7 A;  2P7A A;  1XLS A;  2Q5P A;  5AWJ A;  3OZJ A;  5APJ A;  3W5P A;  3V9V A;  3FC6 A;  3V4A A;  5DKE A;  3B65 A;  5KRM A;  2P15 A;  2ZK3 A;  2NW4 A;  4NUF A;  1Y9R A;  3HC6 A;  3L1B A;  1SKX A;  3B0W A;  1YIM A;  3DZY A;  1FCX A;  2IOK A;  1E3G A;  4M8E A;  2ZNN A;  3A2I A;  5DI7 A;  5G46 A;  4OIU A;  3SZ1 A;  1Z5X E;  4A4V A;  2P1T A;  4IW8 A;  4QE8 A;  5DVC A;  3K6P A;  2GPV A;  1P8D A;  3W0H A;  3ZR7 A;  3W5Q A;  1N83 A;  2ZK0 A;  3AN4 A;  3O1D A;  4S0T A;  2AA7 A;  3ADX A;  2ZKC A;  4G21 A;  3VTB A;  2ZK4 A;  1EXA A;  4IS8 A;  1RKH A;  3A78 A;  3P0U A;  4HLW A;  4MG9 B;  5DKB A;  4EM9 A;  4QM0 A;  3FUG A;  3MNO A;  5DY8 A;  2GPU A;  3VT8 A;  4P6W A;  3L03 A;  4R6S A;  1R20 D;  1YYE A;  3ADV A;  4OJ9 A;  3CQV A;  3EYB A;  2QA8 B;  5KRO A;  4NB6 A;  2E2R A;  1G1U A;  3VT4 A;  3X31 A;  4DOR A;  4N8R A;  4KZJ A;  2GP7 A;  4ZJR A;  5IAW A;  4ITE A;  2PIO A;  4KZM A;  3FXV A;  2Z4B A;  4MG9 A;  5L7E A;  3DZY D;  1FCY A;  2PIT A;  3R8A A;  3R8D A;  5DWI A;  4OZR U;  2REW A;  2HAS A;  2QW4 A;  1XNX A;  4REE A;  5DKS A;  4YPQ A;  2QA8 A;  4OZT U;  1ILG A;  2J7X A;  3HC5 A;  2GIU A;  5ACC A;  5KCD A;  5GIC A;  3ADS A;  2YJD A;  4XI3 A;  1XP9 A;  3DCU A;  4DM6 A;  2Q6J A;  2P7G A;  2PIX A;  4K6I A;  1K4W A;  4PRG A;  4DK7 A;  2POB A;  3HVL A;  5KRF A;  2AX7 A;  2AX6 A;  4ZNW A;  3H52 A;  5DYB A;  3IMY A;  4PPP A;  4WQP A;  2NV7 A;  5E7V A;  4J26 A;  2ZXZ A;  4OJ4 A;  3OAP A;  3JZB A;  1UPV A;  3D24 A;  5AK2 A;  4J5W A;  5DX3 B;  2ABI A;  4DMA A;  5DZ1 A;  1N46 A;  2QXS A;  5L7H A;  3UVV B;  3B68 A;  4S0S A;  3AFR A;  4DOS A;  3NSP A;  2OUZ A;  3RLL A;  3CWD A;  3KWY A;  3WT6 A;  1OT7 A;  2R6Y A;  3V49 A;  2PJL A;  3JZC A;  2ZK2 A;  4N73 A;  4LTW A;  1FM6 A;  5DUE A;  3VT9 A;  1GWX A;  1U3S A;  4ZJW A;  1GWR A;  2PIQ A;  4RMC A;  2QTU A;  4EMA A;  3PCU A;  2I4J A;  1OVL B;  1HJ1 A;  5DRJ A;  5HCV A;  5DWL A;  1T7T A;  3CDP A;  1FD0 A;  5KCE A;  1X7R A;  2QE4 A;  3V3Q A;  2XYW A;  1Z95 A;  5DX3 A;  3UVV A;  3IA6 A;  2AYR A;  2P4Y A;  3WFG A;  1FBY A;  5DVV A;  5KRK A;  3B3K A;  1ZH7 A;  5AZT A;  1PK5 A;  3OKH A;  4QJR A;  5E1C A;  2YAT A;  2O4R A;  1MZN A;  1PQ9 A;  1XDK B;  3A40 X;  3VRT A;  4IA1 A;  2GTK A;  4ZOM A;  1OVL A;  2G0H A;  1PCG A;  1N4H A;  1ILH A;  4IW6 A;  5DU5 A;  2AA2 A;  1IE9 A;  3QT0 A;  4R2U A;  4MGB B;  4XUH A;  2ATH A;  4QK4 A;  2AX9 A;  3OSW A;  1FM6 D;  5KYA A;  3PRG A;  4JYG A;  4OZR E;  3VRV A;  3B67 A;  4CI5 A;  3ADW A;  4JAZ A;  3OOF A;  3KMR A;  3OOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...