5LGAA

Structural analysis and biological activities of bxl0124, a gemini analog of vitamin d
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
299
structure length
238
Chain Sequence
HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Vitamin D3 receptor A
publication title Structural analysis and biological activities of BXL0124, a gemini analog of vitamin D.
pubmed doi rcsb
source organism Danio rerio
total genus 94
structure length 238
sequence length 299
ec nomenclature
pdb deposition date 2016-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5lgaA00
3VT7A 5DWJA 5HYRA 1DB1A 3V9YA 3DZUD 5AWJA 3IMYA 3K6PA 2AX8A 4IA7A 1BSXA 1XDKB 1T79A 4K4JA 2Q7JA 2O4RA 3MNOA 3OLSA 2Q59B 4XHDA 3F5CA 5DRMA 5DKSA 3VSPA 2VSRA 2ZASA 3L0JA 4X1GA 2GPOA 4XUMA 5C4OA 4OEAA 3ET2A 3DZUA 4PP6A 4OKXA 5DXQA 3UUDA 3OLFA 1PCGA 1P8DA 2OUZA 2ZNPA 3IPUA 4OEDA 3P8XA 4PWLA 4PVUA 4XLDA 2OZ7A 1I7IA 3N00A 3VTCA 4YT1A 4DORA 4MG6A 3FC6B 5DZHA 2Q8SA 4UDBA 2YLPA 3VTDA 3CS6A 2AWHA 4OLMA 4DOSA 3B0TA 4IS8A 4IQRA 4CI4A 5DV6A 2G0GA 2PIVA 5KRCA 5DXEA 2VV1B 4ZN7A 1XIUA 5G3JA 2P1VA 4OARA 4OILA 2O4JA 1A52A 1XAPA 2FSZA 5JJMA 4IW6A 4TUZB 3HO0A 2Q6RA 5G5WA 1VJBA 5GT4A 3CS4A 1UPWA 2QGWA 5L11A 2ZFXA 2PRGA 3FALB 1R1KD 3GYTA 3OOFA 4PLEA 3ADXA 3KDTA 5DWLA 2ZBSA 4WVDA 3CDSA 3DZYA 1NRLA 5KRAA 5G46A 3L0LA 1T7RA 3VT6A 3RUTA 1OT7A 4R06A 3DT3A 4L98A 2HASA 5DXRA 5AYGA 1T73A 2HC4A 3AURA 1T65A 2ZKCA 2ZNOA 3DY6A 3O1EA 2B1ZA 2HB8A 2NV7A 4YNKA 3OMOA 3P88A 5DWEA 3X31A 4YPQA 4OIVA 5E0WA 5G43A 2ZK5A 4F9MA 2YLQA 5E1CA 3VI8A 4IWCA 1IE8A 1K74A 1H9UA 2A3IA 3AZ3A 5FQVA 4RMDA 3L1BA 3KFCA 2IOKA 3CJWA 3A3ZX 1NDEA 1NQ1A 4XT9A 1G1UA 3HLVA 3WJ4A 2Q6JA 4OJ9A 1X7RA 2GP7A 2QE4A 3VRWA 3KMGA 3W0AA 4ZNTA 1LV2A 1OSHA 1XP1A 2QA8A 2HBHA 1Z5XE 4QE8A 1MVCA 4NIEA 4QJRA 5GIDA 4B7WA 3ILZA 5I4VA 2O9IA 3V49A 3UVVA 3OMQA 1R20A 4IV2A 1S9QA 2HARA 3B68A 3Q95B 5KRIA 3B3KA 5ACCA 2NPAA 2I0GA 1XP9A 2ZLCA 2QPYA 5DXGA 1WM0X 1XQCA 2PIRA 1GWRA 4WLBA 1R6GA 3TY0A 5L7GA 5KCFA 4S14A 5DX3A 2Z4JA 3B0QA 1EREA 3CLDA 4OHAA 3OLLA 1U3SA 4MG5A 3OMMA 4S0TA 2ZVTA 3UUAA 4QE6A 2P1TA 3OSWA 1T7MA 3IXPA 1Z5XU 1YIMA 4TV1B 1FM9A 5EC9A 1MZNA 3H0AD 4IA3A 2AMAA 1XV9A 2OCFA 4OKTA 1NHZA 2AO6A 4ONIA 2ZMIA 4UDAA 2OVMA 2AX9A 1ERRA 4G1YA 4ZOMA 1UHLA 4LBDA 2HVCA 3AN3A 1I37A 2LBDA 2ZK1A 3DCUA 3PCUA 3SP9A 3BC5A 3VSOA 1PRGA 1I7GA 4MGDB 1NUOA 4IU7A 5HZCA 1X7EA 2HWQA 5F9BA 4REEA 2VV2A 3GN8A 2VV4A 3A9EB 1E3GA 1P93A 4JYGA 5HCVA 4HLWA 1QKMA 2XYXA 3U9QA 1YMTA 4N5GA 3GYUA 3WFFA 4Q13A 3K8SA 4ZN9A 1RDTD 3E7CA 4PPSA 3WT6A 2AX7A 5DUEA 3VTBA 3W0HA 1OSVA 1DKFA 2AA6A 3FEJA 3KDUA 4XAOA 3SZ1A 2PIWA 5EHJA 5DYDA 4CI5A 2BJ4B 3S9SA 4FGYA 2AA7A 4MG7A 5FQPA 1Y9RA 4M8EA 2J4AA 2GPVA 2HB7A 3D6DA 2J7XA 4FHHA 3ADWA 2ZY0A 3CQVA 2I4PA 2P54A 1HG4A 3OMPA 1ZEOA 3WMHA 3LMPA 2HFPA 1XZXX 2P7GA 5DUGA 1FCYA 4E4KA 4P6WA 3GWSX 4MG9A 2PIQA 5GIEA 5KROA 4POHA 4OEYA 5DRJA 3ADSA 4OH6A 2ZXNA 3A2JA 5LGAA 1YUCA 2P7ZA 3KMZA 2PINA 1FBYA 2EWPA 2P4YA 2PKLA 1XVPA 3NSQA 5APHA 2NW4A 2QW4A 5E0XA 3OS8A 3OZ0A 5EI1A 1R5KA 1SJ0A 3KYTA 4JL4A 3KMRA 5DSHA 3PRGA 4JAZA 5DIEA 1RK3A 3R8IA 4X1FA 1UPVA 4NY9A 2P7AA 4BCRA 4ZO1B 3R5NA 5GICA 3WWRA 1S0XA 1EXXA 3OOKA 3TKCA 2QH6A 1ZH7A 4JGVA 2QXSA 5DU5A 1YOWA 3E00D 3VHUA 3W5QA 3AZ2A 1M2ZA 1ZAFA 3FURA 5E14A 2R6WA 4G21A 2YHDA 4MGAB 1XDKA 4OJBA 2AYRA 5KCDA 3JZCA 2Q59A 4MG8B 4OZRE 4KZIA 5EGVA 1XNNA 1S0ZA 2GIUA 4RUJA 5DTVA 5DVCA 2YJAB 3NSPA 4IV4A 1XJ7A 5C4UA 5DI7A 5KCUA 1PK5A 4EMAA 3OMKA 3GD2A 1R1KA 4G2IA 4PP3A 3PBAA 2XYWA 2YFEA 3M7RA 4RAKA 5DXKA 5DZ3A 4JYIA 3FC6A 3UP0A 5JY3A 5DY8A 4DK7A 1T7TA 1UOMA 4J5WA 3DR1A 3G8OA 2J14A 2POBA 2QA8B 3PEQA 2JFAB 4E4QA 4FHIA 3V9VA 2VV1A 2YATA 4KZMA 4WHGA 5E19A 4N8RA 2F4BA 1YP0A 3HZFA 4QM0A 4XUHA 1SR7A 1XB7A 5HJSA 5A86A 4RMCA 3SP6A 4DQMA 1XPCA 5DIDA 3VT3A 3WTQA 4MGBA 1X76A 2R40D 1NQ0A 2G5OA 3R5MA 4XI3A 2IOGA 2J7YA 1FM6D 3X1IA 2FAIA 4LSJA 4PF3A 4Q0AC 2QZOB 3UU7B 5B5BA 4M8HA 5AZTA 3NOAA 3QT0A 5KYJA 3K23A 3WT5A 5DMFA 3OS9A 1L2IA 5DP0A 4HEEX 4OK1A 4DMAA 2AA2A 1XQ3A 3FEIA 5JI0D 1ZDTA 2ACLA 5G42A 4ZO1X 4K7AA 2ABIA 3FLIA 2VSTA 1I38A 3AX8A 2H77A 3VHWA 3G9EA 3TX7B 1T63A 2HAMA 2YJDA 4YMQA 4ZNHA 3ET3A 1X7JA 3D5FA 4RZEA 5H1EA 1OVLA 2ZMJA 1LBDA 3VT9A 3B0WA 3KPZA 4RE8A 5DXBB 3VJHA 5AVLA 2P1UA 3IPSA 2ZK2A 3H0AA 4J5XA 3D57A 5K13A 5FQRA 2H79A 3VRTA 1N46A 1E3KA 4ZNUA 5ICKA 4ZJWA 5AVIA 5IXKA 4LNWA 2PIPL 2V0VA 3GZ9A 4LTWA 1G50A 2PNUA 4PLDA 1DKFB 4NUFA 3V9TA 4OH5A 4J24A 5DVVA 2Q60A 3H52A 2AX6A 2REWA 3FXVA 2IHQA 3IPQA 3PLZA 4UDDA 1N4HA 2AB2A 4IVWA 3CS8A 1XP6A 4MG7B 2XHSA 5C4TA 2XKWA 3L3XA 3R8DA 4IA1A 3RLLA 1NYXA 1EXAA 1MV9A 2AA5A 1PQ9A 1XVPB 2AMBA 3D24A 1T76A 4OFUA 4TV1A 4OJ4A 2GTKA 5DLRA 5LWPA 2FVJA 1RDTA 4FNEA 5DMCA 3AZ1A 1PQCA 1FCZA 3HC5A 2QABA 3RLJA 3WGPA 5KCTA 4ZNWA 2QMVA 1YY4A 3HC6A 5AWKA 4PPPA 3OSAA 4S15A 2VV3A 5G45A 5HJPB 3F5CB 3CTBA 2I4ZA 2ZK4A 1M13A 3WFGA 5KYAA 3ZR7A 1YOKA 4MGDA 3ZQTA 5E15A 3UUDB 1YA3A 2JF9A 1TXIA 4PP5A 3B67A 3BQDA 2PIOA 1RJKA 1NQ2A 2OVHA 2Q7LA 4ZNVA 3OZJA 2E2RA 4IUIA 3OAPA 4QL8A 5KR9A 3HODA 4RMEA 3B5RA 2PIXA 5DL4A 4J5XC 4JYHA 3B65A 5G44A 1U3RA 2Q5SA 2ZLAA 1QKTA 4RFWA 3TKMA 1TFCA 3BEJA 5DWIA 1X78A 4RZGA 5KCEA 2ATHA 2AM9A 2GPUA 5FQSA 5L7EA 5JJMB 2BJ4A 3KWYA 1Q4XA 3WJ5A 1ZKYA 1RKGA 2PJLA 3X1HA 5IAWA 1XOWA 3OKIA 3A2HA 3FS1A 4R6SA 4EM9A 5AAVA 1K4WA 2Q1VA 1ILHA 1L2JA 3X36A 3ET1A 3UUCA 4RWVA 1GWXA 3V3EA 2P15A 3HQ5A 3VT4A 3ZRAA 5DKEA 5AZVA 1T5ZA 4OKWA 2ZNQA 3L03A 2QGTA 2V7CA 3E00A 1FCXA 1ZDUA 3CDPA 2ZK3A 3G0WA 5DV8A 4LNXA 2G0HA 3R2AA 3AUQA 5KCCA 2QXMA 4G1ZA 5FQTA 4A4WA 1FD0A 3VJSA 2OM9A 3VT5A 3VT8A 5B41A 1G5YA 2GWXA 4IA2A 5DZ0A 2ZMHA 4REFA 3V3QA 4ZJRA 2XYJA 2B23A 3ADTA 4DM8A 1PZLA 1YJEA 1XLSE 3ADUA 4G2HA 2AXAA 5KRLA 2Q5GA 1YINA 5DYBA 2POGA 4MGBB 2Q7IA 3VJTA 3P89A 3DZYD 3AUNA 1ZGYA 3MNPA 3UP3A 4OKBA 4Y29A 3AN4A 5DXMA 3R29A 3OS8C 3B1MA 3MNEA 4OZRU 5KD9A 1RKHA 3W5PA 3LBDA 3UVVB 4TUZA 5IZ0A 2YLYA 1N83A 3WT7A 5KRJA 3VN2A 5ETHA 2BAWA 3CWDA 3RVFA 4NQAB 4MGAA 4RUOX 3FUGA 3FALA 1G2NA 1K74D 5E7VA 3OKHA 5HJPA 1QKUA 2QA6A 4MG8A 1ZUCA 1NAVA 5DX3B 1KNUA 3ZRBA 5DKGA 1QKNA 5KRMA 2Q5PA 2ACLB 1SKXA 2R40A 4UDCA 2ZK6A 3UUAB 3VRUA 3W0IA 2NXXE 2JJ3A 5DZ1A 1FM6A 3RUUA 2PIUA 3KBAA 5CJ6A 1S19A 1XV9B 2QR9A 3PO9A 5EJVA 3R8AA 4N1YA 4WPFA 2QTUA 4DK8A 4PRGA 2Q3YA 3VJIA 1OVLB 1R20D 5KRKA 3W0JA 1UHLB 1KKQA 2GPPA 1IE9A 2VV0A 2JFAA 4NB6A 4OZTE 4G1DA 1Y0XX 4PXMA 4KZJA 1A28A 2I4JA 1GWQA 3GWXA 5APJA 1SQNA 3P0UA 3DCTA 4ITFA 4RZFA 2Q61A 3EYBA 1Z95A 4IW8A 3G8IA 2ZXMA 3K22A 5M96A 2Q7KA 1NQ7A 1U9EA 2VV4B 4J5WC 5DZIA 3F7DA 3V4AA 2G44A 2R6YA 5DV3A 2QNVA 2ZK0A 1HJ1A 2GL8A 2HCDA 3IXPD 3JZBA 2Z4BA 5DK9A 4ZNSA 1FM9D 3A78A 2QZOA 3UU7A 4J26A 4FN9A 4APUA 2B1VA 2OAXA 4K6IA 3Q95A 3VRVA 1PDUA 5DKBA 4N73A 2ZL9A 5DVSA 3HVLA 3W0CA 4ITEA 1XLSA 4A4VA 3AFRA 4OZTU 4IVYA 3HM1A 2PITA 1NAXA 1X7BA 3ADVA 1T74A 1T7FA 2YLOA 2B50A 3ERDA 4WQPA 5L7HA 2ZXZA 3T03A 3IA6A 3OGTA 3GBKA 4IWFA 4OIUA 1K7LA 4DM6A 4A2JA 1GS4A 4QK4A 4P6XA 5DIGA 4Q50A 5AK2A 3W0YA 1Y0SA 3A2IA 3ET0A 1M7WA 3D90A 4MDDA 4OEZA 5HYKA 4XTAA 2Q6SA 4MG9B 4S0SA 4O8FA 3A40X 5DXBA 3L3ZA 4POJA 3B66A 5KRHA 4CSJA 2QSEA 1KV6A 3W5RA 1XNXA 4G20A 2NXXA 3E94A 4R2UA 5APKA 5C4SA 3B0RA 4OFRA 3RY9A 3W0GA 2HWRA 4MGCA 4OGHA 4E2JA 2I0JA 3A9EA 3OSIA 2W8YA 5KCWA 2Q70A 3L0EA 2AAXA 5DXPA 2ZNNA 3VHVA 4ZI1A 5AAUA 1ILGA 1S9PA 1U3QA 5KRFA 5SYZA 3W5TA 5DWGA 3O1DA 1PQ6A 4WHFA 3ERTA 4RUPA 4OC7A 1YYEA 5AAVB 5DUHA 5EITA 2Q1HA 4L96A
chains in the Genus database with same CATH superfamily
3VT7A 5DWJA 5HYRA 1DB1A 3V9YA 3DZUD 5AWJA 3IMYA 3K6PA 2AX8A 4IA7A 1BSXA 1XDKB 1T79A 4K4JA 2Q7JA 2O4RA 3MNOA 3OLSA 2Q59B 4XHDA 3F5CA 5DRMA 5DKSA 3VSPA 2VSRA 2ZASA 3L0JA 4X1GA 2GPOA 4XUMA 5C4OA 4OEAA 3ET2A 3DZUA 4PP6A 4OKXA 5DXQA 3UUDA 3OLFA 1PCGA 1P8DA 2OUZA 2ZNPA 3IPUA 4OEDA 3P8XA 4PWLA 4PVUA 4XLDA 2OZ7A 1I7IA 3N00A 3VTCA 4YT1A 4DORA 4MG6A 3FC6B 5DZHA 2Q8SA 4UDBA 2YLPA 3VTDA 3CS6A 2AWHA 4OLMA 4DOSA 3B0TA 4IS8A 4IQRA 4CI4A 5DV6A 2G0GA 2PIVA 5KRCA 5DXEA 2VV1B 4ZN7A 1XIUA 5G3JA 2P1VA 4OARA 4OILA 2O4JA 1A52A 1XAPA 2FSZA 5JJMA 4IW6A 4TUZB 3HO0A 2Q6RA 5G5WA 1VJBA 5GT4A 3CS4A 1UPWA 2QGWA 5L11A 2ZFXA 2PRGA 3FALB 1R1KD 3GYTA 3OOFA 4PLEA 3ADXA 3KDTA 5DWLA 2ZBSA 4WVDA 3CDSA 3DZYA 1NRLA 5KRAA 5G46A 3L0LA 1T7RA 3VT6A 3RUTA 1OT7A 4R06A 3DT3A 4L98A 2HASA 5DXRA 5AYGA 1T73A 2HC4A 3AURA 1T65A 2ZKCA 2ZNOA 3DY6A 3O1EA 2B1ZA 2HB8A 2NV7A 4YNKA 3OMOA 3P88A 5DWEA 3X31A 4YPQA 4OIVA 5E0WA 5G43A 2ZK5A 4F9MA 2YLQA 5E1CA 3VI8A 4IWCA 1IE8A 1K74A 1H9UA 2A3IA 3AZ3A 5FQVA 4RMDA 3L1BA 3KFCA 2IOKA 3CJWA 3A3ZX 1NDEA 1NQ1A 4XT9A 1G1UA 3HLVA 3WJ4A 2Q6JA 4OJ9A 1X7RA 2GP7A 2QE4A 3VRWA 3KMGA 3W0AA 4ZNTA 1LV2A 1OSHA 1XP1A 2QA8A 2HBHA 1Z5XE 4QE8A 1MVCA 4NIEA 4QJRA 5GIDA 4B7WA 3ILZA 5I4VA 2O9IA 3V49A 3UVVA 3OMQA 1R20A 4IV2A 1S9QA 2HARA 3B68A 3Q95B 5KRIA 3B3KA 5ACCA 2NPAA 2I0GA 1XP9A 2ZLCA 2QPYA 5DXGA 1WM0X 1XQCA 2PIRA 1GWRA 4WLBA 1R6GA 3TY0A 5L7GA 5KCFA 4S14A 5DX3A 2Z4JA 3B0QA 1EREA 3CLDA 4OHAA 3OLLA 1U3SA 4MG5A 3OMMA 4S0TA 2ZVTA 3UUAA 4QE6A 2P1TA 3OSWA 1T7MA 3IXPA 1Z5XU 1YIMA 4TV1B 1FM9A 5EC9A 1MZNA 3H0AD 4IA3A 2AMAA 1XV9A 2OCFA 4OKTA 1NHZA 2AO6A 4ONIA 2ZMIA 4UDAA 2OVMA 2AX9A 1ERRA 4G1YA 4ZOMA 1UHLA 4LBDA 2HVCA 3AN3A 1I37A 2LBDA 2ZK1A 3DCUA 3PCUA 3SP9A 3BC5A 3VSOA 1PRGA 1I7GA 4MGDB 1NUOA 4IU7A 5HZCA 1X7EA 2HWQA 5F9BA 4REEA 2VV2A 3GN8A 2VV4A 3A9EB 1E3GA 1P93A 4JYGA 5HCVA 4HLWA 1QKMA 2XYXA 3U9QA 1YMTA 4N5GA 3GYUA 3WFFA 4Q13A 3K8SA 4ZN9A 1RDTD 3E7CA 4PPSA 3WT6A 2AX7A 5DUEA 3VTBA 3W0HA 1OSVA 1DKFA 2AA6A 3FEJA 3KDUA 4XAOA 3SZ1A 2PIWA 5EHJA 5DYDA 4CI5A 2BJ4B 3S9SA 4FGYA 2AA7A 4MG7A 5FQPA 1Y9RA 4M8EA 2J4AA 2GPVA 2HB7A 3D6DA 2J7XA 4FHHA 3ADWA 2ZY0A 3CQVA 2I4PA 2P54A 1HG4A 3OMPA 1ZEOA 3WMHA 3LMPA 2HFPA 1XZXX 2P7GA 5DUGA 1FCYA 4E4KA 4P6WA 3GWSX 4MG9A 2PIQA 5GIEA 5KROA 4POHA 4OEYA 5DRJA 3ADSA 4OH6A 2ZXNA 3A2JA 5LGAA 1YUCA 2P7ZA 3KMZA 2PINA 1FBYA 2EWPA 2P4YA 2PKLA 1XVPA 3NSQA 5APHA 2NW4A 2QW4A 5E0XA 3OS8A 3OZ0A 5EI1A 1R5KA 1SJ0A 3KYTA 4JL4A 3KMRA 5DSHA 3PRGA 4JAZA 5DIEA 1RK3A 3R8IA 4X1FA 1UPVA 4NY9A 2P7AA 4BCRA 4ZO1B 3R5NA 5GICA 3WWRA 1S0XA 1EXXA 3OOKA 3TKCA 2QH6A 1ZH7A 4JGVA 2QXSA 5DU5A 1YOWA 3E00D 3VHUA 3W5QA 3AZ2A 1M2ZA 1ZAFA 3FURA 5E14A 2R6WA 4G21A 2YHDA 4MGAB 1XDKA 4OJBA 2AYRA 5KCDA 3JZCA 2Q59A 4MG8B 4OZRE 4KZIA 5EGVA 1XNNA 1S0ZA 2GIUA 4RUJA 5DTVA 5DVCA 2YJAB 3NSPA 4IV4A 1XJ7A 5C4UA 5DI7A 5KCUA 1PK5A 4EMAA 3OMKA 3GD2A 1R1KA 4G2IA 4PP3A 3PBAA 2XYWA 2YFEA 3M7RA 4RAKA 5DXKA 5DZ3A 4JYIA 3FC6A 3UP0A 5JY3A 5DY8A 4DK7A 1T7TA 1UOMA 4J5WA 3DR1A 3G8OA 2J14A 2POBA 2QA8B 3PEQA 2JFAB 4E4QA 4FHIA 3V9VA 2VV1A 2YATA 4KZMA 4WHGA 5E19A 4N8RA 2F4BA 1YP0A 3HZFA 4QM0A 4XUHA 1SR7A 1XB7A 5HJSA 5A86A 4RMCA 3SP6A 4DQMA 1XPCA 5DIDA 3VT3A 3WTQA 4MGBA 1X76A 2R40D 1NQ0A 2G5OA 3R5MA 4XI3A 2IOGA 2J7YA 1FM6D 3X1IA 2FAIA 4LSJA 4PF3A 4Q0AC 2QZOB 3UU7B 5B5BA 4M8HA 5AZTA 3NOAA 3QT0A 5KYJA 3K23A 3WT5A 5DMFA 3OS9A 1L2IA 5DP0A 4HEEX 4OK1A 4DMAA 2AA2A 1XQ3A 3FEIA 5JI0D 1ZDTA 2ACLA 5G42A 4ZO1X 4K7AA 2ABIA 3FLIA 2VSTA 1I38A 3AX8A 2H77A 3VHWA 3G9EA 3TX7B 1T63A 2HAMA 2YJDA 4YMQA 4ZNHA 3ET3A 1X7JA 3D5FA 4RZEA 5H1EA 1OVLA 2ZMJA 1LBDA 3VT9A 3B0WA 3KPZA 4RE8A 5DXBB 3VJHA 5AVLA 2P1UA 3IPSA 2ZK2A 3H0AA 4J5XA 3D57A 5K13A 5FQRA 2H79A 3VRTA 1N46A 1E3KA 4ZNUA 5ICKA 4ZJWA 5AVIA 5IXKA 4LNWA 2PIPL 2V0VA 3GZ9A 4LTWA 1G50A 2PNUA 4PLDA 1DKFB 4NUFA 3V9TA 4OH5A 4J24A 5DVVA 2Q60A 3H52A 2AX6A 2REWA 3FXVA 2IHQA 3IPQA 3PLZA 4UDDA 1N4HA 2AB2A 4IVWA 3CS8A 1XP6A 4MG7B 2XHSA 5C4TA 2XKWA 3L3XA 3R8DA 4IA1A 3RLLA 1NYXA 1EXAA 1MV9A 2AA5A 1PQ9A 1XVPB 2AMBA 3D24A 1T76A 4OFUA 4TV1A 4OJ4A 2GTKA 5DLRA 5LWPA 2FVJA 1RDTA 4FNEA 5DMCA 3AZ1A 1PQCA 1FCZA 3HC5A 2QABA 3RLJA 3WGPA 5KCTA 4ZNWA 2QMVA 1YY4A 3HC6A 5AWKA 4PPPA 3OSAA 4S15A 2VV3A 5G45A 5HJPB 3F5CB 3CTBA 2I4ZA 2ZK4A 1M13A 3WFGA 5KYAA 3ZR7A 1YOKA 4MGDA 3ZQTA 5E15A 3UUDB 1YA3A 2JF9A 1TXIA 4PP5A 3B67A 3BQDA 2PIOA 1RJKA 1NQ2A 2OVHA 2Q7LA 4ZNVA 3OZJA 2E2RA 4IUIA 3OAPA 4QL8A 5KR9A 3HODA 4RMEA 3B5RA 2PIXA 5DL4A 4J5XC 4JYHA 3B65A 5G44A 1U3RA 2Q5SA 2ZLAA 1QKTA 4RFWA 3TKMA 1TFCA 3BEJA 5DWIA 1X78A 4RZGA 5KCEA 2ATHA 2AM9A 2GPUA 5FQSA 5L7EA 5JJMB 2BJ4A 3KWYA 1Q4XA 3WJ5A 1ZKYA 1RKGA 2PJLA 3X1HA 5IAWA 1XOWA 3OKIA 3A2HA 3FS1A 4R6SA 4EM9A 5AAVA 1K4WA 2Q1VA 1ILHA 1L2JA 3X36A 3ET1A 3UUCA 4RWVA 1GWXA 3V3EA 2P15A 3HQ5A 3VT4A 3ZRAA 5DKEA 5AZVA 1T5ZA 4OKWA 2ZNQA 3L03A 2QGTA 2V7CA 3E00A 1FCXA 1ZDUA 3CDPA 2ZK3A 3G0WA 5DV8A 4LNXA 2G0HA 3R2AA 3AUQA 5KCCA 2QXMA 4G1ZA 5FQTA 4A4WA 1FD0A 3VJSA 2OM9A 3VT5A 3VT8A 5B41A 1G5YA 2GWXA 4IA2A 5DZ0A 2ZMHA 4REFA 3V3QA 4ZJRA 2XYJA 2B23A 3ADTA 4DM8A 1PZLA 1YJEA 1XLSE 3ADUA 4G2HA 2AXAA 5KRLA 2Q5GA 1YINA 5DYBA 2POGA 4MGBB 2Q7IA 3VJTA 3P89A 3DZYD 3AUNA 1ZGYA 3MNPA 3UP3A 4OKBA 4Y29A 3AN4A 5DXMA 3R29A 3OS8C 3B1MA 3MNEA 4OZRU 5KD9A 1RKHA 3W5PA 3LBDA 3UVVB 4TUZA 5IZ0A 2YLYA 1N83A 3WT7A 5KRJA 3VN2A 5ETHA 2BAWA 3CWDA 3RVFA 4NQAB 4MGAA 4RUOX 3FUGA 3FALA 1G2NA 1K74D 5E7VA 3OKHA 5HJPA 1QKUA 2QA6A 4MG8A 1ZUCA 1NAVA 5DX3B 1KNUA 3ZRBA 5DKGA 1QKNA 5KRMA 2Q5PA 2ACLB 1SKXA 2R40A 4UDCA 2ZK6A 3UUAB 3VRUA 3W0IA 2NXXE 2JJ3A 5DZ1A 1FM6A 3RUUA 2PIUA 3KBAA 5CJ6A 1S19A 1XV9B 2QR9A 3PO9A 5EJVA 3R8AA 4N1YA 4WPFA 2QTUA 4DK8A 4PRGA 2Q3YA 3VJIA 1OVLB 1R20D 5KRKA 3W0JA 1UHLB 1KKQA 2GPPA 1IE9A 2VV0A 2JFAA 4NB6A 4OZTE 4G1DA 1Y0XX 4PXMA 4KZJA 1A28A 2I4JA 1GWQA 3GWXA 5APJA 1SQNA 3P0UA 3DCTA 4ITFA 4RZFA 2Q61A 3EYBA 1Z95A 4IW8A 3G8IA 2ZXMA 3K22A 5M96A 2Q7KA 1NQ7A 1U9EA 2VV4B 4J5WC 5DZIA 3F7DA 3V4AA 2G44A 2R6YA 5DV3A 2QNVA 2ZK0A 1HJ1A 2GL8A 2HCDA 3IXPD 3JZBA 2Z4BA 5DK9A 4ZNSA 1FM9D 3A78A 2QZOA 3UU7A 4J26A 4FN9A 4APUA 2B1VA 2OAXA 4K6IA 3Q95A 3VRVA 1PDUA 5DKBA 4N73A 2ZL9A 5DVSA 3HVLA 3W0CA 4ITEA 1XLSA 4A4VA 3AFRA 4OZTU 4IVYA 3HM1A 2PITA 1NAXA 1X7BA 3ADVA 1T74A 1T7FA 2YLOA 2B50A 3ERDA 4WQPA 5L7HA 2ZXZA 3T03A 3IA6A 3OGTA 3GBKA 4IWFA 4OIUA 1K7LA 4DM6A 4A2JA 1GS4A 4QK4A 4P6XA 5DIGA 4Q50A 5AK2A 3W0YA 1Y0SA 3A2IA 3ET0A 1M7WA 3D90A 4MDDA 4OEZA 5HYKA 4XTAA 2Q6SA 4MG9B 4S0SA 4O8FA 3A40X 5DXBA 3L3ZA 4POJA 3B66A 5KRHA 4CSJA 2QSEA 1KV6A 3W5RA 1XNXA 4G20A 2NXXA 3E94A 4R2UA 5APKA 5C4SA 3B0RA 4OFRA 3RY9A 3W0GA 2HWRA 4MGCA 4OGHA 4E2JA 2I0JA 3A9EA 3OSIA 2W8YA 5KCWA 2Q70A 3L0EA 2AAXA 5DXPA 2ZNNA 3VHVA 4ZI1A 5AAUA 1ILGA 1S9PA 1U3QA 5KRFA 5SYZA 3W5TA 5DWGA 3O1DA 1PQ6A 4WHFA 3ERTA 4RUPA 4OC7A 1YYEA 5AAVB 5DUHA 5EITA 2Q1HA 4L96A
chains in the Genus database with same CATH topology
3VT7A 5DWJA 5HYRA 1DB1A 3V9YA 3DZUD 5AWJA 3IMYA 3K6PA 2AX8A 4IA7A 1BSXA 1XDKB 1T79A 4K4JA 2Q7JA 2O4RA 3MNOA 3OLSA 2Q59B 4XHDA 3F5CA 5DRMA 5DKSA 3VSPA 2VSRA 2ZASA 3L0JA 4X1GA 2GPOA 4XUMA 5C4OA 4OEAA 3ET2A 3DZUA 4PP6A 4OKXA 5DXQA 3UUDA 3OLFA 1PCGA 1P8DA 2OUZA 2ZNPA 3IPUA 4OEDA 3P8XA 4PWLA 4PVUA 4XLDA 2OZ7A 1I7IA 3N00A 3VTCA 4YT1A 4DORA 4MG6A 3FC6B 5DZHA 2Q8SA 4UDBA 2YLPA 3VTDA 3CS6A 2AWHA 4OLMA 4DOSA 3B0TA 4IS8A 4IQRA 4CI4A 5DV6A 2G0GA 2PIVA 5KRCA 5DXEA 2VV1B 4ZN7A 1XIUA 5G3JA 2P1VA 4OARA 4OILA 2O4JA 1A52A 1XAPA 2FSZA 5JJMA 4IW6A 4TUZB 3HO0A 2Q6RA 5G5WA 1VJBA 5GT4A 3CS4A 1UPWA 2QGWA 5L11A 2ZFXA 2PRGA 3FALB 1R1KD 3GYTA 3OOFA 4PLEA 3ADXA 3KDTA 5DWLA 2ZBSA 4WVDA 3CDSA 3DZYA 1NRLA 5KRAA 5G46A 3L0LA 1T7RA 3VT6A 3RUTA 1OT7A 4R06A 3DT3A 4L98A 2HASA 5DXRA 5AYGA 1T73A 2HC4A 3AURA 1T65A 2ZKCA 2ZNOA 3DY6A 3O1EA 2B1ZA 2HB8A 2NV7A 4YNKA 3OMOA 3P88A 5DWEA 3X31A 4YPQA 4OIVA 5E0WA 5G43A 2ZK5A 4F9MA 2YLQA 5E1CA 3VI8A 4IWCA 1IE8A 1K74A 1H9UA 2A3IA 3AZ3A 5FQVA 4RMDA 3L1BA 3KFCA 2IOKA 3CJWA 3A3ZX 1NDEA 1NQ1A 4XT9A 1G1UA 3HLVA 3WJ4A 2Q6JA 4OJ9A 1X7RA 2GP7A 2QE4A 3VRWA 3KMGA 3W0AA 4ZNTA 1LV2A 1OSHA 1XP1A 2QA8A 2HBHA 1Z5XE 4QE8A 1MVCA 4NIEA 4QJRA 5GIDA 4B7WA 3ILZA 5I4VA 2O9IA 3V49A 3UVVA 3OMQA 1R20A 4IV2A 1S9QA 2HARA 3B68A 3Q95B 5KRIA 3B3KA 5ACCA 2NPAA 2I0GA 1XP9A 2ZLCA 2QPYA 5DXGA 1WM0X 1XQCA 2PIRA 1GWRA 4WLBA 1R6GA 3TY0A 5L7GA 5KCFA 4S14A 5DX3A 2Z4JA 3B0QA 1EREA 3CLDA 4OHAA 3OLLA 1U3SA 4MG5A 3OMMA 4S0TA 2ZVTA 3UUAA 4QE6A 2P1TA 3OSWA 1T7MA 3IXPA 1Z5XU 1YIMA 4TV1B 1FM9A 5EC9A 1MZNA 3H0AD 4IA3A 2AMAA 1XV9A 2OCFA 4OKTA 1NHZA 2AO6A 4ONIA 2ZMIA 4UDAA 2OVMA 2AX9A 1ERRA 4G1YA 4ZOMA 1UHLA 4LBDA 2HVCA 3AN3A 1I37A 2LBDA 2ZK1A 3DCUA 3PCUA 3SP9A 3BC5A 3VSOA 1PRGA 1I7GA 4MGDB 1NUOA 4IU7A 5HZCA 1X7EA 2HWQA 5F9BA 4REEA 2VV2A 3GN8A 2VV4A 3A9EB 1E3GA 1P93A 4JYGA 5HCVA 4HLWA 1QKMA 2XYXA 3U9QA 1YMTA 4N5GA 3GYUA 3WFFA 4Q13A 3K8SA 4ZN9A 1RDTD 3E7CA 4PPSA 3WT6A 2AX7A 5DUEA 3VTBA 3W0HA 1OSVA 1DKFA 2AA6A 3FEJA 3KDUA 4XAOA 3SZ1A 2PIWA 5EHJA 5DYDA 4CI5A 2BJ4B 3S9SA 4FGYA 2AA7A 4MG7A 5FQPA 1Y9RA 4M8EA 2J4AA 2GPVA 2HB7A 3D6DA 2J7XA 4FHHA 3ADWA 2ZY0A 3CQVA 2I4PA 2P54A 1HG4A 3OMPA 1ZEOA 3WMHA 3LMPA 2HFPA 1XZXX 2P7GA 5DUGA 1FCYA 4E4KA 4P6WA 3GWSX 4MG9A 2PIQA 5GIEA 5KROA 4POHA 4OEYA 5DRJA 3ADSA 4OH6A 2ZXNA 3A2JA 5LGAA 1YUCA 2P7ZA 3KMZA 2PINA 1FBYA 2EWPA 2P4YA 2PKLA 1XVPA 3NSQA 5APHA 2NW4A 2QW4A 5E0XA 3OS8A 3OZ0A 5EI1A 1R5KA 1SJ0A 3KYTA 4JL4A 3KMRA 5DSHA 3PRGA 4JAZA 5DIEA 1RK3A 3R8IA 4X1FA 1UPVA 4NY9A 2P7AA 4BCRA 4ZO1B 3R5NA 5GICA 3WWRA 1S0XA 1EXXA 3OOKA 3TKCA 2QH6A 1ZH7A 4JGVA 2QXSA 5DU5A 1YOWA 3E00D 3VHUA 3W5QA 3AZ2A 1M2ZA 1ZAFA 3FURA 5E14A 2R6WA 4G21A 2YHDA 4MGAB 1XDKA 4OJBA 2AYRA 5KCDA 3JZCA 2Q59A 4MG8B 4OZRE 4KZIA 5EGVA 1XNNA 1S0ZA 2GIUA 4RUJA 5DTVA 5DVCA 2YJAB 3NSPA 4IV4A 1XJ7A 5C4UA 5DI7A 5KCUA 1PK5A 4EMAA 3OMKA 3GD2A 1R1KA 4G2IA 4PP3A 3PBAA 2XYWA 2YFEA 3M7RA 4RAKA 5DXKA 5DZ3A 4JYIA 3FC6A 3UP0A 5JY3A 5DY8A 4DK7A 1T7TA 1UOMA 4J5WA 3DR1A 3G8OA 2J14A 2POBA 2QA8B 3PEQA 2JFAB 4E4QA 4FHIA 3V9VA 2VV1A 2YATA 4KZMA 4WHGA 5E19A 4N8RA 2F4BA 1YP0A 3HZFA 4QM0A 4XUHA 1SR7A 1XB7A 5HJSA 5A86A 4RMCA 3SP6A 4DQMA 1XPCA 5DIDA 3VT3A 3WTQA 4MGBA 1X76A 2R40D 1NQ0A 2G5OA 3R5MA 4XI3A 2IOGA 2J7YA 1FM6D 3X1IA 2FAIA 4LSJA 4PF3A 4Q0AC 2QZOB 3UU7B 5B5BA 4M8HA 5AZTA 3NOAA 3QT0A 5KYJA 3K23A 3WT5A 5DMFA 3OS9A 1L2IA 5DP0A 4HEEX 4OK1A 4DMAA 2AA2A 1XQ3A 3FEIA 5JI0D 1ZDTA 2ACLA 5G42A 4ZO1X 4K7AA 2ABIA 3FLIA 2VSTA 1I38A 3AX8A 2H77A 3VHWA 3G9EA 3TX7B 1T63A 2HAMA 2YJDA 4YMQA 4ZNHA 3ET3A 1X7JA 3D5FA 4RZEA 5H1EA 1OVLA 2ZMJA 1LBDA 3VT9A 3B0WA 3KPZA 4RE8A 5DXBB 3VJHA 5AVLA 2P1UA 3IPSA 2ZK2A 3H0AA 4J5XA 3D57A 5K13A 5FQRA 2H79A 3VRTA 1N46A 1E3KA 4ZNUA 5ICKA 4ZJWA 5AVIA 5IXKA 4LNWA 2PIPL 2V0VA 3GZ9A 4LTWA 1G50A 2PNUA 4PLDA 1DKFB 4NUFA 3V9TA 4OH5A 4J24A 5DVVA 2Q60A 3H52A 2AX6A 2REWA 3FXVA 2IHQA 3IPQA 3PLZA 4UDDA 1N4HA 2AB2A 4IVWA 3CS8A 1XP6A 4MG7B 2XHSA 5C4TA 2XKWA 3L3XA 3R8DA 4IA1A 3RLLA 1NYXA 1EXAA 1MV9A 2AA5A 1PQ9A 1XVPB 2AMBA 3D24A 1T76A 4OFUA 4TV1A 4OJ4A 2GTKA 5DLRA 5LWPA 2FVJA 1RDTA 4FNEA 5DMCA 3AZ1A 1PQCA 1FCZA 3HC5A 2QABA 3RLJA 3WGPA 5KCTA 4ZNWA 2QMVA 1YY4A 3HC6A 5AWKA 4PPPA 3OSAA 4S15A 2VV3A 5G45A 5HJPB 3F5CB 3CTBA 2I4ZA 2ZK4A 1M13A 3WFGA 5KYAA 3ZR7A 1YOKA 4MGDA 3ZQTA 5E15A 3UUDB 1YA3A 2JF9A 1TXIA 4PP5A 3B67A 3BQDA 2PIOA 1RJKA 1NQ2A 2OVHA 2Q7LA 4ZNVA 3OZJA 2E2RA 4IUIA 3OAPA 4QL8A 5KR9A 3HODA 4RMEA 3B5RA 2PIXA 5DL4A 4J5XC 4JYHA 3B65A 5G44A 1U3RA 2Q5SA 2ZLAA 1QKTA 4RFWA 3TKMA 1TFCA 3BEJA 5DWIA 1X78A 4RZGA 5KCEA 2ATHA 2AM9A 2GPUA 5FQSA 5L7EA 5JJMB 2BJ4A 3KWYA 1Q4XA 3WJ5A 1ZKYA 1RKGA 2PJLA 3X1HA 5IAWA 1XOWA 3OKIA 3A2HA 3FS1A 4R6SA 4EM9A 5AAVA 1K4WA 2Q1VA 1ILHA 1L2JA 3X36A 3ET1A 3UUCA 4RWVA 1GWXA 3V3EA 2P15A 3HQ5A 3VT4A 3ZRAA 5DKEA 5AZVA 1T5ZA 4OKWA 2ZNQA 3L03A 2QGTA 2V7CA 3E00A 1FCXA 1ZDUA 3CDPA 2ZK3A 3G0WA 5DV8A 4LNXA 2G0HA 3R2AA 3AUQA 5KCCA 2QXMA 4G1ZA 5FQTA 4A4WA 1FD0A 3VJSA 2OM9A 3VT5A 3VT8A 5B41A 1G5YA 2GWXA 4IA2A 5DZ0A 2ZMHA 4REFA 3V3QA 4ZJRA 2XYJA 2B23A 3ADTA 4DM8A 1PZLA 1YJEA 1XLSE 3ADUA 4G2HA 2AXAA 5KRLA 2Q5GA 1YINA 5DYBA 2POGA 4MGBB 2Q7IA 3VJTA 3P89A 3DZYD 3AUNA 1ZGYA 3MNPA 3UP3A 4OKBA 4Y29A 3AN4A 5DXMA 3R29A 3OS8C 3B1MA 3MNEA 4OZRU 5KD9A 1RKHA 3W5PA 3LBDA 3UVVB 4TUZA 5IZ0A 2YLYA 1N83A 3WT7A 5KRJA 3VN2A 5ETHA 2BAWA 3CWDA 3RVFA 4NQAB 4MGAA 4RUOX 3FUGA 3FALA 1G2NA 1K74D 5E7VA 3OKHA 5HJPA 1QKUA 2QA6A 4MG8A 1ZUCA 1NAVA 5DX3B 1KNUA 3ZRBA 5DKGA 1QKNA 5KRMA 2Q5PA 2ACLB 1SKXA 2R40A 4UDCA 2ZK6A 3UUAB 3VRUA 3W0IA 2NXXE 2JJ3A 5DZ1A 1FM6A 3RUUA 2PIUA 3KBAA 5CJ6A 1S19A 1XV9B 2QR9A 3PO9A 5EJVA 3R8AA 4N1YA 4WPFA 2QTUA 4DK8A 4PRGA 2Q3YA 3VJIA 1OVLB 1R20D 5KRKA 3W0JA 1UHLB 1KKQA 2GPPA 1IE9A 2VV0A 2JFAA 4NB6A 4OZTE 4G1DA 1Y0XX 4PXMA 4KZJA 1A28A 2I4JA 1GWQA 3GWXA 5APJA 1SQNA 3P0UA 3DCTA 4ITFA 4RZFA 2Q61A 3EYBA 1Z95A 4IW8A 3G8IA 2ZXMA 3K22A 5M96A 2Q7KA 1NQ7A 1U9EA 2VV4B 4J5WC 5DZIA 3F7DA 3V4AA 2G44A 2R6YA 5DV3A 2QNVA 2ZK0A 1HJ1A 2GL8A 2HCDA 3IXPD 3JZBA 2Z4BA 5DK9A 4ZNSA 1FM9D 3A78A 2QZOA 3UU7A 4J26A 4FN9A 4APUA 2B1VA 2OAXA 4K6IA 3Q95A 3VRVA 1PDUA 5DKBA 4N73A 2ZL9A 5DVSA 3HVLA 3W0CA 4ITEA 1XLSA 4A4VA 3AFRA 4OZTU 4IVYA 3HM1A 2PITA 1NAXA 1X7BA 3ADVA 1T74A 1T7FA 2YLOA 2B50A 3ERDA 4WQPA 5L7HA 2ZXZA 3T03A 3IA6A 3OGTA 3GBKA 4IWFA 4OIUA 1K7LA 4DM6A 4A2JA 1GS4A 4QK4A 4P6XA 5DIGA 4Q50A 5AK2A 3W0YA 1Y0SA 3A2IA 3ET0A 1M7WA 3D90A 4MDDA 4OEZA 5HYKA 4XTAA 2Q6SA 4MG9B 4S0SA 4O8FA 3A40X 5DXBA 3L3ZA 4POJA 3B66A 5KRHA 4CSJA 2QSEA 1KV6A 3W5RA 1XNXA 4G20A 2NXXA 3E94A 4R2UA 5APKA 5C4SA 3B0RA 4OFRA 3RY9A 3W0GA 2HWRA 4MGCA 4OGHA 4E2JA 2I0JA 3A9EA 3OSIA 2W8YA 5KCWA 2Q70A 3L0EA 2AAXA 5DXPA 2ZNNA 3VHVA 4ZI1A 5AAUA 1ILGA 1S9PA 1U3QA 5KRFA 5SYZA 3W5TA 5DWGA 3O1DA 1PQ6A 4WHFA 3ERTA 4RUPA 4OC7A 1YYEA 5AAVB 5DUHA 5EITA 2Q1HA 4L96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT7 A;  5DWJ A;  5HYR A;  1DB1 A;  3V9Y A;  3DZU D;  5AWJ A;  3IMY A;  3K6P A;  2AX8 A;  4IA7 A;  1BSX A;  1XDK B;  1T79 A;  4K4J A;  2Q7J A;  2O4R A;  3MNO A;  3OLS A;  2Q59 B;  4XHD A;  3F5C A;  5DRM A;  5DKS A;  3VSP A;  2VSR A;  2ZAS A;  3L0J A;  4X1G A;  2GPO A;  4XUM A;  5C4O A;  4OEA A;  3ET2 A;  3DZU A;  4PP6 A;  4OKX A;  5DXQ A;  3UUD A;  3OLF A;  1PCG A;  1P8D A;  2OUZ A;  2ZNP A;  3IPU A;  4OED A;  3P8X A;  4PWL A;  4PVU A;  4XLD A;  2OZ7 A;  1I7I A;  3N00 A;  3VTC A;  4YT1 A;  4DOR A;  4MG6 A;  3FC6 B;  5DZH A;  2Q8S A;  4UDB A;  2YLP A;  3VTD A;  3CS6 A;  2AWH A;  4OLM A;  4DOS A;  3B0T A;  4IS8 A;  4IQR A;  4CI4 A;  5DV6 A;  2G0G A;  2PIV A;  5KRC A;  5DXE A;  2VV1 B;  4ZN7 A;  1XIU A;  5G3J A;  2P1V A;  4OAR A;  4OIL A;  2O4J A;  1A52 A;  1XAP A;  2FSZ A;  5JJM A;  4IW6 A;  4TUZ B;  3HO0 A;  2Q6R A;  5G5W A;  1VJB A;  5GT4 A;  3CS4 A;  1UPW A;  2QGW A;  5L11 A;  2ZFX A;  2PRG A;  3FAL B;  1R1K D;  3GYT A;  3OOF A;  4PLE A;  3ADX A;  3KDT A;  5DWL A;  2ZBS A;  4WVD A;  3CDS A;  3DZY A;  1NRL A;  5KRA A;  5G46 A;  3L0L A;  1T7R A;  3VT6 A;  3RUT A;  1OT7 A;  4R06 A;  3DT3 A;  4L98 A;  2HAS A;  5DXR A;  5AYG A;  1T73 A;  2HC4 A;  3AUR A;  1T65 A;  2ZKC A;  2ZNO A;  3DY6 A;  3O1E A;  2B1Z A;  2HB8 A;  2NV7 A;  4YNK A;  3OMO A;  3P88 A;  5DWE A;  3X31 A;  4YPQ A;  4OIV A;  5E0W A;  5G43 A;  2ZK5 A;  4F9M A;  2YLQ A;  5E1C A;  3VI8 A;  4IWC A;  1IE8 A;  1K74 A;  1H9U A;  2A3I A;  3AZ3 A;  5FQV A;  4RMD A;  3L1B A;  3KFC A;  2IOK A;  3CJW A;  3A3Z X;  1NDE A;  1NQ1 A;  4XT9 A;  1G1U A;  3HLV A;  3WJ4 A;  2Q6J A;  4OJ9 A;  1X7R A;  2GP7 A;  2QE4 A;  3VRW A;  3KMG A;  3W0A A;  4ZNT A;  1LV2 A;  1OSH A;  1XP1 A;  2QA8 A;  2HBH A;  1Z5X E;  4QE8 A;  1MVC A;  4NIE A;  4QJR A;  5GID A;  4B7W A;  3ILZ A;  5I4V A;  2O9I A;  3V49 A;  3UVV A;  3OMQ A;  1R20 A;  4IV2 A;  1S9Q A;  2HAR A;  3B68 A;  3Q95 B;  5KRI A;  3B3K A;  5ACC A;  2NPA A;  2I0G A;  1XP9 A;  2ZLC A;  2QPY A;  5DXG A;  1WM0 X;  1XQC A;  2PIR A;  1GWR A;  4WLB A;  1R6G A;  3TY0 A;  5L7G A;  5KCF A;  4S14 A;  5DX3 A;  2Z4J A;  3B0Q A;  1ERE A;  3CLD A;  4OHA A;  3OLL A;  1U3S A;  4MG5 A;  3OMM A;  4S0T A;  2ZVT A;  3UUA A;  4QE6 A;  2P1T A;  3OSW A;  1T7M A;  3IXP A;  1Z5X U;  1YIM A;  4TV1 B;  1FM9 A;  5EC9 A;  1MZN A;  3H0A D;  4IA3 A;  2AMA A;  1XV9 A;  2OCF A;  4OKT A;  1NHZ A;  2AO6 A;  4ONI A;  2ZMI A;  4UDA A;  2OVM A;  2AX9 A;  1ERR A;  4G1Y A;  4ZOM A;  1UHL A;  4LBD A;  2HVC A;  3AN3 A;  1I37 A;  2LBD A;  2ZK1 A;  3DCU A;  3PCU A;  3SP9 A;  3BC5 A;  3VSO A;  1PRG A;  1I7G A;  4MGD B;  1NUO A;  4IU7 A;  5HZC A;  1X7E A;  2HWQ A;  5F9B A;  4REE A;  2VV2 A;  3GN8 A;  2VV4 A;  3A9E B;  1E3G A;  1P93 A;  4JYG A;  5HCV A;  4HLW A;  1QKM A;  2XYX A;  3U9Q A;  1YMT A;  4N5G A;  3GYU A;  3WFF A;  4Q13 A;  3K8S A;  4ZN9 A;  1RDT D;  3E7C A;  4PPS A;  3WT6 A;  2AX7 A;  5DUE A;  3VTB A;  3W0H A;  1OSV A;  1DKF A;  2AA6 A;  3FEJ A;  3KDU A;  4XAO A;  3SZ1 A;  2PIW A;  5EHJ A;  5DYD A;  4CI5 A;  2BJ4 B;  3S9S A;  4FGY A;  2AA7 A;  4MG7 A;  5FQP A;  1Y9R A;  4M8E A;  2J4A A;  2GPV A;  2HB7 A;  3D6D A;  2J7X A;  4FHH A;  3ADW A;  2ZY0 A;  3CQV A;  2I4P A;  2P54 A;  1HG4 A;  3OMP A;  1ZEO A;  3WMH A;  3LMP A;  2HFP A;  1XZX X;  2P7G A;  5DUG A;  1FCY A;  4E4K A;  4P6W A;  3GWS X;  4MG9 A;  2PIQ A;  5GIE A;  5KRO A;  4POH A;  4OEY A;  5DRJ A;  3ADS A;  4OH6 A;  2ZXN A;  3A2J A;  5LGA A;  1YUC A;  2P7Z A;  3KMZ A;  2PIN A;  1FBY A;  2EWP A;  2P4Y A;  2PKL A;  1XVP A;  3NSQ A;  5APH A;  2NW4 A;  2QW4 A;  5E0X A;  3OS8 A;  3OZ0 A;  5EI1 A;  1R5K A;  1SJ0 A;  3KYT A;  4JL4 A;  3KMR A;  5DSH A;  3PRG A;  4JAZ A;  5DIE A;  1RK3 A;  3R8I A;  4X1F A;  1UPV A;  4NY9 A;  2P7A A;  4BCR A;  4ZO1 B;  3R5N A;  5GIC A;  3WWR A;  1S0X A;  1EXX A;  3OOK A;  3TKC A;  2QH6 A;  1ZH7 A;  4JGV A;  2QXS A;  5DU5 A;  1YOW A;  3E00 D;  3VHU A;  3W5Q A;  3AZ2 A;  1M2Z A;  1ZAF A;  3FUR A;  5E14 A;  2R6W A;  4G21 A;  2YHD A;  4MGA B;  1XDK A;  4OJB A;  2AYR A;  5KCD A;  3JZC A;  2Q59 A;  4MG8 B;  4OZR E;  4KZI A;  5EGV A;  1XNN A;  1S0Z A;  2GIU A;  4RUJ A;  5DTV A;  5DVC A;  2YJA B;  3NSP A;  4IV4 A;  1XJ7 A;  5C4U A;  5DI7 A;  5KCU A;  1PK5 A;  4EMA A;  3OMK A;  3GD2 A;  1R1K A;  4G2I A;  4PP3 A;  3PBA A;  2XYW A;  2YFE A;  3M7R A;  4RAK A;  5DXK A;  5DZ3 A;  4JYI A;  3FC6 A;  3UP0 A;  5JY3 A;  5DY8 A;  4DK7 A;  1T7T A;  1UOM A;  4J5W A;  3DR1 A;  3G8O A;  2J14 A;  2POB A;  2QA8 B;  3PEQ A;  2JFA B;  4E4Q A;  4FHI A;  3V9V A;  2VV1 A;  2YAT A;  4KZM A;  4WHG A;  5E19 A;  4N8R A;  2F4B A;  1YP0 A;  3HZF A;  4QM0 A;  4XUH A;  1SR7 A;  1XB7 A;  5HJS A;  5A86 A;  4RMC A;  3SP6 A;  4DQM A;  1XPC A;  5DID A;  3VT3 A;  3WTQ A;  4MGB A;  1X76 A;  2R40 D;  1NQ0 A;  2G5O A;  3R5M A;  4XI3 A;  2IOG A;  2J7Y A;  1FM6 D;  3X1I A;  2FAI A;  4LSJ A;  4PF3 A;  4Q0A C;  2QZO B;  3UU7 B;  5B5B A;  4M8H A;  5AZT A;  3NOA A;  3QT0 A;  5KYJ A;  3K23 A;  3WT5 A;  5DMF A;  3OS9 A;  1L2I A;  5DP0 A;  4HEE X;  4OK1 A;  4DMA A;  2AA2 A;  1XQ3 A;  3FEI A;  5JI0 D;  1ZDT A;  2ACL A;  5G42 A;  4ZO1 X;  4K7A A;  2ABI A;  3FLI A;  2VST A;  1I38 A;  3AX8 A;  2H77 A;  3VHW A;  3G9E A;  3TX7 B;  1T63 A;  2HAM A;  2YJD A;  4YMQ A;  4ZNH A;  3ET3 A;  1X7J A;  3D5F A;  4RZE A;  5H1E A;  1OVL A;  2ZMJ A;  1LBD A;  3VT9 A;  3B0W A;  3KPZ A;  4RE8 A;  5DXB B;  3VJH A;  5AVL A;  2P1U A;  3IPS A;  2ZK2 A;  3H0A A;  4J5X A;  3D57 A;  5K13 A;  5FQR A;  2H79 A;  3VRT A;  1N46 A;  1E3K A;  4ZNU A;  5ICK A;  4ZJW A;  5AVI A;  5IXK A;  4LNW A;  2PIP L;  2V0V A;  3GZ9 A;  4LTW A;  1G50 A;  2PNU A;  4PLD A;  1DKF B;  4NUF A;  3V9T A;  4OH5 A;  4J24 A;  5DVV A;  2Q60 A;  3H52 A;  2AX6 A;  2REW A;  3FXV A;  2IHQ A;  3IPQ A;  3PLZ A;  4UDD A;  1N4H A;  2AB2 A;  4IVW A;  3CS8 A;  1XP6 A;  4MG7 B;  2XHS A;  5C4T A;  2XKW A;  3L3X A;  3R8D A;  4IA1 A;  3RLL A;  1NYX A;  1EXA A;  1MV9 A;  2AA5 A;  1PQ9 A;  1XVP B;  2AMB A;  3D24 A;  1T76 A;  4OFU A;  4TV1 A;  4OJ4 A;  2GTK A;  5DLR A;  5LWP A;  2FVJ A;  1RDT A;  4FNE A;  5DMC A;  3AZ1 A;  1PQC A;  1FCZ A;  3HC5 A;  2QAB A;  3RLJ A;  3WGP A;  5KCT A;  4ZNW A;  2QMV A;  1YY4 A;  3HC6 A;  5AWK A;  4PPP A;  3OSA A;  4S15 A;  2VV3 A;  5G45 A;  5HJP B;  3F5C B;  3CTB A;  2I4Z A;  2ZK4 A;  1M13 A;  3WFG A;  5KYA A;  3ZR7 A;  1YOK A;  4MGD A;  3ZQT A;  5E15 A;  3UUD B;  1YA3 A;  2JF9 A;  1TXI A;  4PP5 A;  3B67 A;  3BQD A;  2PIO A;  1RJK A;  1NQ2 A;  2OVH A;  2Q7L A;  4ZNV A;  3OZJ A;  2E2R A;  4IUI A;  3OAP A;  4QL8 A;  5KR9 A;  3HOD A;  4RME A;  3B5R A;  2PIX A;  5DL4 A;  4J5X C;  4JYH A;  3B65 A;  5G44 A;  1U3R A;  2Q5S A;  2ZLA A;  1QKT A;  4RFW A;  3TKM A;  1TFC A;  3BEJ A;  5DWI A;  1X78 A;  4RZG A;  5KCE A;  2ATH A;  2AM9 A;  2GPU A;  5FQS A;  5L7E A;  5JJM B;  2BJ4 A;  3KWY A;  1Q4X A;  3WJ5 A;  1ZKY A;  1RKG A;  2PJL A;  3X1H A;  5IAW A;  1XOW A;  3OKI A;  3A2H A;  3FS1 A;  4R6S A;  4EM9 A;  5AAV A;  1K4W A;  2Q1V A;  1ILH A;  1L2J A;  3X36 A;  3ET1 A;  3UUC A;  4RWV A;  1GWX A;  3V3E A;  2P15 A;  3HQ5 A;  3VT4 A;  3ZRA A;  5DKE A;  5AZV A;  1T5Z A;  4OKW A;  2ZNQ A;  3L03 A;  2QGT A;  2V7C A;  3E00 A;  1FCX A;  1ZDU A;  3CDP A;  2ZK3 A;  3G0W A;  5DV8 A;  4LNX A;  2G0H A;  3R2A A;  3AUQ A;  5KCC A;  2QXM A;  4G1Z A;  5FQT A;  4A4W A;  1FD0 A;  3VJS A;  2OM9 A;  3VT5 A;  3VT8 A;  5B41 A;  1G5Y A;  2GWX A;  4IA2 A;  5DZ0 A;  2ZMH A;  4REF A;  3V3Q A;  4ZJR A;  2XYJ A;  2B23 A;  3ADT A;  4DM8 A;  1PZL A;  1YJE A;  1XLS E;  3ADU A;  4G2H A;  2AXA A;  5KRL A;  2Q5G A;  1YIN A;  5DYB A;  2POG A;  4MGB B;  2Q7I A;  3VJT A;  3P89 A;  3DZY D;  3AUN A;  1ZGY A;  3MNP A;  3UP3 A;  4OKB A;  4Y29 A;  3AN4 A;  5DXM A;  3R29 A;  3OS8 C;  3B1M A;  3MNE A;  4OZR U;  5KD9 A;  1RKH A;  3W5P A;  3LBD A;  3UVV B;  4TUZ A;  5IZ0 A;  2YLY A;  1N83 A;  3WT7 A;  5KRJ A;  3VN2 A;  5ETH A;  2BAW A;  3CWD A;  3RVF A;  4NQA B;  4MGA A;  4RUO X;  3FUG A;  3FAL A;  1G2N A;  1K74 D;  5E7V A;  3OKH A;  5HJP A;  1QKU A;  2QA6 A;  4MG8 A;  1ZUC A;  1NAV A;  5DX3 B;  1KNU A;  3ZRB A;  5DKG A;  1QKN A;  5KRM A;  2Q5P A;  2ACL B;  1SKX A;  2R40 A;  4UDC A;  2ZK6 A;  3UUA B;  3VRU A;  3W0I A;  2NXX E;  2JJ3 A;  5DZ1 A;  1FM6 A;  3RUU A;  2PIU A;  3KBA A;  5CJ6 A;  1S19 A;  1XV9 B;  2QR9 A;  3PO9 A;  5EJV A;  3R8A A;  4N1Y A;  4WPF A;  2QTU A;  4DK8 A;  4PRG A;  2Q3Y A;  3VJI A;  1OVL B;  1R20 D;  5KRK A;  3W0J A;  1UHL B;  1KKQ A;  2GPP A;  1IE9 A;  2VV0 A;  2JFA A;  4NB6 A;  4OZT E;  4G1D A;  1Y0X X;  4PXM A;  4KZJ A;  1A28 A;  2I4J A;  1GWQ A;  3GWX A;  5APJ A;  1SQN A;  3P0U A;  3DCT A;  4ITF A;  4RZF A;  2Q61 A;  3EYB A;  1Z95 A;  4IW8 A;  3G8I A;  2ZXM A;  3K22 A;  5M96 A;  2Q7K A;  1NQ7 A;  1U9E A;  2VV4 B;  4J5W C;  5DZI A;  3F7D A;  3V4A A;  2G44 A;  2R6Y A;  5DV3 A;  2QNV A;  2ZK0 A;  1HJ1 A;  2GL8 A;  2HCD A;  3IXP D;  3JZB A;  2Z4B A;  5DK9 A;  4ZNS A;  1FM9 D;  3A78 A;  2QZO A;  3UU7 A;  4J26 A;  4FN9 A;  4APU A;  2B1V A;  2OAX A;  4K6I A;  3Q95 A;  3VRV A;  1PDU A;  5DKB A;  4N73 A;  2ZL9 A;  5DVS A;  3HVL A;  3W0C A;  4ITE A;  1XLS A;  4A4V A;  3AFR A;  4OZT U;  4IVY A;  3HM1 A;  2PIT A;  1NAX A;  1X7B A;  3ADV A;  1T74 A;  1T7F A;  2YLO A;  2B50 A;  3ERD A;  4WQP A;  5L7H A;  2ZXZ A;  3T03 A;  3IA6 A;  3OGT A;  3GBK A;  4IWF A;  4OIU A;  1K7L A;  4DM6 A;  4A2J A;  1GS4 A;  4QK4 A;  4P6X A;  5DIG A;  4Q50 A;  5AK2 A;  3W0Y A;  1Y0S A;  3A2I A;  3ET0 A;  1M7W A;  3D90 A;  4MDD A;  4OEZ A;  5HYK A;  4XTA A;  2Q6S A;  4MG9 B;  4S0S A;  4O8F A;  3A40 X;  5DXB A;  3L3Z A;  4POJ A;  3B66 A;  5KRH A;  4CSJ A;  2QSE A;  1KV6 A;  3W5R A;  1XNX A;  4G20 A;  2NXX A;  3E94 A;  4R2U A;  5APK A;  5C4S A;  3B0R A;  4OFR A;  3RY9 A;  3W0G A;  2HWR A;  4MGC A;  4OGH A;  4E2J A;  2I0J A;  3A9E A;  3OSI A;  2W8Y A;  5KCW A;  2Q70 A;  3L0E A;  2AAX A;  5DXP A;  2ZNN A;  3VHV A;  4ZI1 A;  5AAU A;  1ILG A;  1S9P A;  1U3Q A;  5KRF A;  5SYZ A;  3W5T A;  5DWG A;  3O1D A;  1PQ6 A;  4WHF A;  3ERT A;  4RUP A;  4OC7 A;  1YYE A;  5AAV B;  5DUH A;  5EIT A;  2Q1H A;  4L96 A; 
#chains in the Genus database with same CATH topology
 3VT7 A;  5DWJ A;  5HYR A;  1DB1 A;  3V9Y A;  3DZU D;  5AWJ A;  3IMY A;  3K6P A;  2AX8 A;  4IA7 A;  1BSX A;  1XDK B;  1T79 A;  4K4J A;  2Q7J A;  2O4R A;  3MNO A;  3OLS A;  2Q59 B;  4XHD A;  3F5C A;  5DRM A;  5DKS A;  3VSP A;  2VSR A;  2ZAS A;  3L0J A;  4X1G A;  2GPO A;  4XUM A;  5C4O A;  4OEA A;  3ET2 A;  3DZU A;  4PP6 A;  4OKX A;  5DXQ A;  3UUD A;  3OLF A;  1PCG A;  1P8D A;  2OUZ A;  2ZNP A;  3IPU A;  4OED A;  3P8X A;  4PWL A;  4PVU A;  4XLD A;  2OZ7 A;  1I7I A;  3N00 A;  3VTC A;  4YT1 A;  4DOR A;  4MG6 A;  3FC6 B;  5DZH A;  2Q8S A;  4UDB A;  2YLP A;  3VTD A;  3CS6 A;  2AWH A;  4OLM A;  4DOS A;  3B0T A;  4IS8 A;  4IQR A;  4CI4 A;  5DV6 A;  2G0G A;  2PIV A;  5KRC A;  5DXE A;  2VV1 B;  4ZN7 A;  1XIU A;  5G3J A;  2P1V A;  4OAR A;  4OIL A;  2O4J A;  1A52 A;  1XAP A;  2FSZ A;  5JJM A;  4IW6 A;  4TUZ B;  3HO0 A;  2Q6R A;  5G5W A;  1VJB A;  5GT4 A;  3CS4 A;  1UPW A;  2QGW A;  5L11 A;  2ZFX A;  2PRG A;  3FAL B;  1R1K D;  3GYT A;  3OOF A;  4PLE A;  3ADX A;  3KDT A;  5DWL A;  2ZBS A;  4WVD A;  3CDS A;  3DZY A;  1NRL A;  5KRA A;  5G46 A;  3L0L A;  1T7R A;  3VT6 A;  3RUT A;  1OT7 A;  4R06 A;  3DT3 A;  4L98 A;  2HAS A;  5DXR A;  5AYG A;  1T73 A;  2HC4 A;  3AUR A;  1T65 A;  2ZKC A;  2ZNO A;  3DY6 A;  3O1E A;  2B1Z A;  2HB8 A;  2NV7 A;  4YNK A;  3OMO A;  3P88 A;  5DWE A;  3X31 A;  4YPQ A;  4OIV A;  5E0W A;  5G43 A;  2ZK5 A;  4F9M A;  2YLQ A;  5E1C A;  3VI8 A;  4IWC A;  1IE8 A;  1K74 A;  1H9U A;  2A3I A;  3AZ3 A;  5FQV A;  4RMD A;  3L1B A;  3KFC A;  2IOK A;  3CJW A;  3A3Z X;  1NDE A;  1NQ1 A;  4XT9 A;  1G1U A;  3HLV A;  3WJ4 A;  2Q6J A;  4OJ9 A;  1X7R A;  2GP7 A;  2QE4 A;  3VRW A;  3KMG A;  3W0A A;  4ZNT A;  1LV2 A;  1OSH A;  1XP1 A;  2QA8 A;  2HBH A;  1Z5X E;  4QE8 A;  1MVC A;  4NIE A;  4QJR A;  5GID A;  4B7W A;  3ILZ A;  5I4V A;  2O9I A;  3V49 A;  3UVV A;  3OMQ A;  1R20 A;  4IV2 A;  1S9Q A;  2HAR A;  3B68 A;  3Q95 B;  5KRI A;  3B3K A;  5ACC A;  2NPA A;  2I0G A;  1XP9 A;  2ZLC A;  2QPY A;  5DXG A;  1WM0 X;  1XQC A;  2PIR A;  1GWR A;  4WLB A;  1R6G A;  3TY0 A;  5L7G A;  5KCF A;  4S14 A;  5DX3 A;  2Z4J A;  3B0Q A;  1ERE A;  3CLD A;  4OHA A;  3OLL A;  1U3S A;  4MG5 A;  3OMM A;  4S0T A;  2ZVT A;  3UUA A;  4QE6 A;  2P1T A;  3OSW A;  1T7M A;  3IXP A;  1Z5X U;  1YIM A;  4TV1 B;  1FM9 A;  5EC9 A;  1MZN A;  3H0A D;  4IA3 A;  2AMA A;  1XV9 A;  2OCF A;  4OKT A;  1NHZ A;  2AO6 A;  4ONI A;  2ZMI A;  4UDA A;  2OVM A;  2AX9 A;  1ERR A;  4G1Y A;  4ZOM A;  1UHL A;  4LBD A;  2HVC A;  3AN3 A;  1I37 A;  2LBD A;  2ZK1 A;  3DCU A;  3PCU A;  3SP9 A;  3BC5 A;  3VSO A;  1PRG A;  1I7G A;  4MGD B;  1NUO A;  4IU7 A;  5HZC A;  1X7E A;  2HWQ A;  5F9B A;  4REE A;  2VV2 A;  3GN8 A;  2VV4 A;  3A9E B;  1E3G A;  1P93 A;  4JYG A;  5HCV A;  4HLW A;  1QKM A;  2XYX A;  3U9Q A;  1YMT A;  4N5G A;  3GYU A;  3WFF A;  4Q13 A;  3K8S A;  4ZN9 A;  1RDT D;  3E7C A;  4PPS A;  3WT6 A;  2AX7 A;  5DUE A;  3VTB A;  3W0H A;  1OSV A;  1DKF A;  2AA6 A;  3FEJ A;  3KDU A;  4XAO A;  3SZ1 A;  2PIW A;  5EHJ A;  5DYD A;  4CI5 A;  2BJ4 B;  3S9S A;  4FGY A;  2AA7 A;  4MG7 A;  5FQP A;  1Y9R A;  4M8E A;  2J4A A;  2GPV A;  2HB7 A;  3D6D A;  2J7X A;  4FHH A;  3ADW A;  2ZY0 A;  3CQV A;  2I4P A;  2P54 A;  1HG4 A;  3OMP A;  1ZEO A;  3WMH A;  3LMP A;  2HFP A;  1XZX X;  2P7G A;  5DUG A;  1FCY A;  4E4K A;  4P6W A;  3GWS X;  4MG9 A;  2PIQ A;  5GIE A;  5KRO A;  4POH A;  4OEY A;  5DRJ A;  3ADS A;  4OH6 A;  2ZXN A;  3A2J A;  5LGA A;  1YUC A;  2P7Z A;  3KMZ A;  2PIN A;  1FBY A;  2EWP A;  2P4Y A;  2PKL A;  1XVP A;  3NSQ A;  5APH A;  2NW4 A;  2QW4 A;  5E0X A;  3OS8 A;  3OZ0 A;  5EI1 A;  1R5K A;  1SJ0 A;  3KYT A;  4JL4 A;  3KMR A;  5DSH A;  3PRG A;  4JAZ A;  5DIE A;  1RK3 A;  3R8I A;  4X1F A;  1UPV A;  4NY9 A;  2P7A A;  4BCR A;  4ZO1 B;  3R5N A;  5GIC A;  3WWR A;  1S0X A;  1EXX A;  3OOK A;  3TKC A;  2QH6 A;  1ZH7 A;  4JGV A;  2QXS A;  5DU5 A;  1YOW A;  3E00 D;  3VHU A;  3W5Q A;  3AZ2 A;  1M2Z A;  1ZAF A;  3FUR A;  5E14 A;  2R6W A;  4G21 A;  2YHD A;  4MGA B;  1XDK A;  4OJB A;  2AYR A;  5KCD A;  3JZC A;  2Q59 A;  4MG8 B;  4OZR E;  4KZI A;  5EGV A;  1XNN A;  1S0Z A;  2GIU A;  4RUJ A;  5DTV A;  5DVC A;  2YJA B;  3NSP A;  4IV4 A;  1XJ7 A;  5C4U A;  5DI7 A;  5KCU A;  1PK5 A;  4EMA A;  3OMK A;  3GD2 A;  1R1K A;  4G2I A;  4PP3 A;  3PBA A;  2XYW A;  2YFE A;  3M7R A;  4RAK A;  5DXK A;  5DZ3 A;  4JYI A;  3FC6 A;  3UP0 A;  5JY3 A;  5DY8 A;  4DK7 A;  1T7T A;  1UOM A;  4J5W A;  3DR1 A;  3G8O A;  2J14 A;  2POB A;  2QA8 B;  3PEQ A;  2JFA B;  4E4Q A;  4FHI A;  3V9V A;  2VV1 A;  2YAT A;  4KZM A;  4WHG A;  5E19 A;  4N8R A;  2F4B A;  1YP0 A;  3HZF A;  4QM0 A;  4XUH A;  1SR7 A;  1XB7 A;  5HJS A;  5A86 A;  4RMC A;  3SP6 A;  4DQM A;  1XPC A;  5DID A;  3VT3 A;  3WTQ A;  4MGB A;  1X76 A;  2R40 D;  1NQ0 A;  2G5O A;  3R5M A;  4XI3 A;  2IOG A;  2J7Y A;  1FM6 D;  3X1I A;  2FAI A;  4LSJ A;  4PF3 A;  4Q0A C;  2QZO B;  3UU7 B;  5B5B A;  4M8H A;  5AZT A;  3NOA A;  3QT0 A;  5KYJ A;  3K23 A;  3WT5 A;  5DMF A;  3OS9 A;  1L2I A;  5DP0 A;  4HEE X;  4OK1 A;  4DMA A;  2AA2 A;  1XQ3 A;  3FEI A;  5JI0 D;  1ZDT A;  2ACL A;  5G42 A;  4ZO1 X;  4K7A A;  2ABI A;  3FLI A;  2VST A;  1I38 A;  3AX8 A;  2H77 A;  3VHW A;  3G9E A;  3TX7 B;  1T63 A;  2HAM A;  2YJD A;  4YMQ A;  4ZNH A;  3ET3 A;  1X7J A;  3D5F A;  4RZE A;  5H1E A;  1OVL A;  2ZMJ A;  1LBD A;  3VT9 A;  3B0W A;  3KPZ A;  4RE8 A;  5DXB B;  3VJH A;  5AVL A;  2P1U A;  3IPS A;  2ZK2 A;  3H0A A;  4J5X A;  3D57 A;  5K13 A;  5FQR A;  2H79 A;  3VRT A;  1N46 A;  1E3K A;  4ZNU A;  5ICK A;  4ZJW A;  5AVI A;  5IXK A;  4LNW A;  2PIP L;  2V0V A;  3GZ9 A;  4LTW A;  1G50 A;  2PNU A;  4PLD A;  1DKF B;  4NUF A;  3V9T A;  4OH5 A;  4J24 A;  5DVV A;  2Q60 A;  3H52 A;  2AX6 A;  2REW A;  3FXV A;  2IHQ A;  3IPQ A;  3PLZ A;  4UDD A;  1N4H A;  2AB2 A;  4IVW A;  3CS8 A;  1XP6 A;  4MG7 B;  2XHS A;  5C4T A;  2XKW A;  3L3X A;  3R8D A;  4IA1 A;  3RLL A;  1NYX A;  1EXA A;  1MV9 A;  2AA5 A;  1PQ9 A;  1XVP B;  2AMB A;  3D24 A;  1T76 A;  4OFU A;  4TV1 A;  4OJ4 A;  2GTK A;  5DLR A;  5LWP A;  2FVJ A;  1RDT A;  4FNE A;  5DMC A;  3AZ1 A;  1PQC A;  1FCZ A;  3HC5 A;  2QAB A;  3RLJ A;  3WGP A;  5KCT A;  4ZNW A;  2QMV A;  1YY4 A;  3HC6 A;  5AWK A;  4PPP A;  3OSA A;  4S15 A;  2VV3 A;  5G45 A;  5HJP B;  3F5C B;  3CTB A;  2I4Z A;  2ZK4 A;  1M13 A;  3WFG A;  5KYA A;  3ZR7 A;  1YOK A;  4MGD A;  3ZQT A;  5E15 A;  3UUD B;  1YA3 A;  2JF9 A;  1TXI A;  4PP5 A;  3B67 A;  3BQD A;  2PIO A;  1RJK A;  1NQ2 A;  2OVH A;  2Q7L A;  4ZNV A;  3OZJ A;  2E2R A;  4IUI A;  3OAP A;  4QL8 A;  5KR9 A;  3HOD A;  4RME A;  3B5R A;  2PIX A;  5DL4 A;  4J5X C;  4JYH A;  3B65 A;  5G44 A;  1U3R A;  2Q5S A;  2ZLA A;  1QKT A;  4RFW A;  3TKM A;  1TFC A;  3BEJ A;  5DWI A;  1X78 A;  4RZG A;  5KCE A;  2ATH A;  2AM9 A;  2GPU A;  5FQS A;  5L7E A;  5JJM B;  2BJ4 A;  3KWY A;  1Q4X A;  3WJ5 A;  1ZKY A;  1RKG A;  2PJL A;  3X1H A;  5IAW A;  1XOW A;  3OKI A;  3A2H A;  3FS1 A;  4R6S A;  4EM9 A;  5AAV A;  1K4W A;  2Q1V A;  1ILH A;  1L2J A;  3X36 A;  3ET1 A;  3UUC A;  4RWV A;  1GWX A;  3V3E A;  2P15 A;  3HQ5 A;  3VT4 A;  3ZRA A;  5DKE A;  5AZV A;  1T5Z A;  4OKW A;  2ZNQ A;  3L03 A;  2QGT A;  2V7C A;  3E00 A;  1FCX A;  1ZDU A;  3CDP A;  2ZK3 A;  3G0W A;  5DV8 A;  4LNX A;  2G0H A;  3R2A A;  3AUQ A;  5KCC A;  2QXM A;  4G1Z A;  5FQT A;  4A4W A;  1FD0 A;  3VJS A;  2OM9 A;  3VT5 A;  3VT8 A;  5B41 A;  1G5Y A;  2GWX A;  4IA2 A;  5DZ0 A;  2ZMH A;  4REF A;  3V3Q A;  4ZJR A;  2XYJ A;  2B23 A;  3ADT A;  4DM8 A;  1PZL A;  1YJE A;  1XLS E;  3ADU A;  4G2H A;  2AXA A;  5KRL A;  2Q5G A;  1YIN A;  5DYB A;  2POG A;  4MGB B;  2Q7I A;  3VJT A;  3P89 A;  3DZY D;  3AUN A;  1ZGY A;  3MNP A;  3UP3 A;  4OKB A;  4Y29 A;  3AN4 A;  5DXM A;  3R29 A;  3OS8 C;  3B1M A;  3MNE A;  4OZR U;  5KD9 A;  1RKH A;  3W5P A;  3LBD A;  3UVV B;  4TUZ A;  5IZ0 A;  2YLY A;  1N83 A;  3WT7 A;  5KRJ A;  3VN2 A;  5ETH A;  2BAW A;  3CWD A;  3RVF A;  4NQA B;  4MGA A;  4RUO X;  3FUG A;  3FAL A;  1G2N A;  1K74 D;  5E7V A;  3OKH A;  5HJP A;  1QKU A;  2QA6 A;  4MG8 A;  1ZUC A;  1NAV A;  5DX3 B;  1KNU A;  3ZRB A;  5DKG A;  1QKN A;  5KRM A;  2Q5P A;  2ACL B;  1SKX A;  2R40 A;  4UDC A;  2ZK6 A;  3UUA B;  3VRU A;  3W0I A;  2NXX E;  2JJ3 A;  5DZ1 A;  1FM6 A;  3RUU A;  2PIU A;  3KBA A;  5CJ6 A;  1S19 A;  1XV9 B;  2QR9 A;  3PO9 A;  5EJV A;  3R8A A;  4N1Y A;  4WPF A;  2QTU A;  4DK8 A;  4PRG A;  2Q3Y A;  3VJI A;  1OVL B;  1R20 D;  5KRK A;  3W0J A;  1UHL B;  1KKQ A;  2GPP A;  1IE9 A;  2VV0 A;  2JFA A;  4NB6 A;  4OZT E;  4G1D A;  1Y0X X;  4PXM A;  4KZJ A;  1A28 A;  2I4J A;  1GWQ A;  3GWX A;  5APJ A;  1SQN A;  3P0U A;  3DCT A;  4ITF A;  4RZF A;  2Q61 A;  3EYB A;  1Z95 A;  4IW8 A;  3G8I A;  2ZXM A;  3K22 A;  5M96 A;  2Q7K A;  1NQ7 A;  1U9E A;  2VV4 B;  4J5W C;  5DZI A;  3F7D A;  3V4A A;  2G44 A;  2R6Y A;  5DV3 A;  2QNV A;  2ZK0 A;  1HJ1 A;  2GL8 A;  2HCD A;  3IXP D;  3JZB A;  2Z4B A;  5DK9 A;  4ZNS A;  1FM9 D;  3A78 A;  2QZO A;  3UU7 A;  4J26 A;  4FN9 A;  4APU A;  2B1V A;  2OAX A;  4K6I A;  3Q95 A;  3VRV A;  1PDU A;  5DKB A;  4N73 A;  2ZL9 A;  5DVS A;  3HVL A;  3W0C A;  4ITE A;  1XLS A;  4A4V A;  3AFR A;  4OZT U;  4IVY A;  3HM1 A;  2PIT A;  1NAX A;  1X7B A;  3ADV A;  1T74 A;  1T7F A;  2YLO A;  2B50 A;  3ERD A;  4WQP A;  5L7H A;  2ZXZ A;  3T03 A;  3IA6 A;  3OGT A;  3GBK A;  4IWF A;  4OIU A;  1K7L A;  4DM6 A;  4A2J A;  1GS4 A;  4QK4 A;  4P6X A;  5DIG A;  4Q50 A;  5AK2 A;  3W0Y A;  1Y0S A;  3A2I A;  3ET0 A;  1M7W A;  3D90 A;  4MDD A;  4OEZ A;  5HYK A;  4XTA A;  2Q6S A;  4MG9 B;  4S0S A;  4O8F A;  3A40 X;  5DXB A;  3L3Z A;  4POJ A;  3B66 A;  5KRH A;  4CSJ A;  2QSE A;  1KV6 A;  3W5R A;  1XNX A;  4G20 A;  2NXX A;  3E94 A;  4R2U A;  5APK A;  5C4S A;  3B0R A;  4OFR A;  3RY9 A;  3W0G A;  2HWR A;  4MGC A;  4OGH A;  4E2J A;  2I0J A;  3A9E A;  3OSI A;  2W8Y A;  5KCW A;  2Q70 A;  3L0E A;  2AAX A;  5DXP A;  2ZNN A;  3VHV A;  4ZI1 A;  5AAU A;  1ILG A;  1S9P A;  1U3Q A;  5KRF A;  5SYZ A;  3W5T A;  5DWG A;  3O1D A;  1PQ6 A;  4WHF A;  3ERT A;  4RUP A;  4OC7 A;  1YYE A;  5AAV B;  5DUH A;  5EIT A;  2Q1H A;  4L96 A; 
#chains in the Genus database with same CATH homology
 3VT7 A;  5DWJ A;  5HYR A;  1DB1 A;  3V9Y A;  3DZU D;  5AWJ A;  3IMY A;  3K6P A;  2AX8 A;  4IA7 A;  1BSX A;  1XDK B;  1T79 A;  4K4J A;  2Q7J A;  2O4R A;  3MNO A;  3OLS A;  2Q59 B;  4XHD A;  3F5C A;  5DRM A;  5DKS A;  3VSP A;  2VSR A;  2ZAS A;  3L0J A;  4X1G A;  2GPO A;  4XUM A;  5C4O A;  4OEA A;  3ET2 A;  3DZU A;  4PP6 A;  4OKX A;  5DXQ A;  3UUD A;  3OLF A;  1PCG A;  1P8D A;  2OUZ A;  2ZNP A;  3IPU A;  4OED A;  3P8X A;  4PWL A;  4PVU A;  4XLD A;  2OZ7 A;  1I7I A;  3N00 A;  3VTC A;  4YT1 A;  4DOR A;  4MG6 A;  3FC6 B;  5DZH A;  2Q8S A;  4UDB A;  2YLP A;  3VTD A;  3CS6 A;  2AWH A;  4OLM A;  4DOS A;  3B0T A;  4IS8 A;  4IQR A;  4CI4 A;  5DV6 A;  2G0G A;  2PIV A;  5KRC A;  5DXE A;  2VV1 B;  4ZN7 A;  1XIU A;  5G3J A;  2P1V A;  4OAR A;  4OIL A;  2O4J A;  1A52 A;  1XAP A;  2FSZ A;  5JJM A;  4IW6 A;  4TUZ B;  3HO0 A;  2Q6R A;  5G5W A;  1VJB A;  5GT4 A;  3CS4 A;  1UPW A;  2QGW A;  5L11 A;  2ZFX A;  2PRG A;  3FAL B;  1R1K D;  3GYT A;  3OOF A;  4PLE A;  3ADX A;  3KDT A;  5DWL A;  2ZBS A;  4WVD A;  3CDS A;  3DZY A;  1NRL A;  5KRA A;  5G46 A;  3L0L A;  1T7R A;  3VT6 A;  3RUT A;  1OT7 A;  4R06 A;  3DT3 A;  4L98 A;  2HAS A;  5DXR A;  5AYG A;  1T73 A;  2HC4 A;  3AUR A;  1T65 A;  2ZKC A;  2ZNO A;  3DY6 A;  3O1E A;  2B1Z A;  2HB8 A;  2NV7 A;  4YNK A;  3OMO A;  3P88 A;  5DWE A;  3X31 A;  4YPQ A;  4OIV A;  5E0W A;  5G43 A;  2ZK5 A;  4F9M A;  2YLQ A;  5E1C A;  3VI8 A;  4IWC A;  1IE8 A;  1K74 A;  1H9U A;  2A3I A;  3AZ3 A;  5FQV A;  4RMD A;  3L1B A;  3KFC A;  2IOK A;  3CJW A;  3A3Z X;  1NDE A;  1NQ1 A;  4XT9 A;  1G1U A;  3HLV A;  3WJ4 A;  2Q6J A;  4OJ9 A;  1X7R A;  2GP7 A;  2QE4 A;  3VRW A;  3KMG A;  3W0A A;  4ZNT A;  1LV2 A;  1OSH A;  1XP1 A;  2QA8 A;  2HBH A;  1Z5X E;  4QE8 A;  1MVC A;  4NIE A;  4QJR A;  5GID A;  4B7W A;  3ILZ A;  5I4V A;  2O9I A;  3V49 A;  3UVV A;  3OMQ A;  1R20 A;  4IV2 A;  1S9Q A;  2HAR A;  3B68 A;  3Q95 B;  5KRI A;  3B3K A;  5ACC A;  2NPA A;  2I0G A;  1XP9 A;  2ZLC A;  2QPY A;  5DXG A;  1WM0 X;  1XQC A;  2PIR A;  1GWR A;  4WLB A;  1R6G A;  3TY0 A;  5L7G A;  5KCF A;  4S14 A;  5DX3 A;  2Z4J A;  3B0Q A;  1ERE A;  3CLD A;  4OHA A;  3OLL A;  1U3S A;  4MG5 A;  3OMM A;  4S0T A;  2ZVT A;  3UUA A;  4QE6 A;  2P1T A;  3OSW A;  1T7M A;  3IXP A;  1Z5X U;  1YIM A;  4TV1 B;  1FM9 A;  5EC9 A;  1MZN A;  3H0A D;  4IA3 A;  2AMA A;  1XV9 A;  2OCF A;  4OKT A;  1NHZ A;  2AO6 A;  4ONI A;  2ZMI A;  4UDA A;  2OVM A;  2AX9 A;  1ERR A;  4G1Y A;  4ZOM A;  1UHL A;  4LBD A;  2HVC A;  3AN3 A;  1I37 A;  2LBD A;  2ZK1 A;  3DCU A;  3PCU A;  3SP9 A;  3BC5 A;  3VSO A;  1PRG A;  1I7G A;  4MGD B;  1NUO A;  4IU7 A;  5HZC A;  1X7E A;  2HWQ A;  5F9B A;  4REE A;  2VV2 A;  3GN8 A;  2VV4 A;  3A9E B;  1E3G A;  1P93 A;  4JYG A;  5HCV A;  4HLW A;  1QKM A;  2XYX A;  3U9Q A;  1YMT A;  4N5G A;  3GYU A;  3WFF A;  4Q13 A;  3K8S A;  4ZN9 A;  1RDT D;  3E7C A;  4PPS A;  3WT6 A;  2AX7 A;  5DUE A;  3VTB A;  3W0H A;  1OSV A;  1DKF A;  2AA6 A;  3FEJ A;  3KDU A;  4XAO A;  3SZ1 A;  2PIW A;  5EHJ A;  5DYD A;  4CI5 A;  2BJ4 B;  3S9S A;  4FGY A;  2AA7 A;  4MG7 A;  5FQP A;  1Y9R A;  4M8E A;  2J4A A;  2GPV A;  2HB7 A;  3D6D A;  2J7X A;  4FHH A;  3ADW A;  2ZY0 A;  3CQV A;  2I4P A;  2P54 A;  1HG4 A;  3OMP A;  1ZEO A;  3WMH A;  3LMP A;  2HFP A;  1XZX X;  2P7G A;  5DUG A;  1FCY A;  4E4K A;  4P6W A;  3GWS X;  4MG9 A;  2PIQ A;  5GIE A;  5KRO A;  4POH A;  4OEY A;  5DRJ A;  3ADS A;  4OH6 A;  2ZXN A;  3A2J A;  5LGA A;  1YUC A;  2P7Z A;  3KMZ A;  2PIN A;  1FBY A;  2EWP A;  2P4Y A;  2PKL A;  1XVP A;  3NSQ A;  5APH A;  2NW4 A;  2QW4 A;  5E0X A;  3OS8 A;  3OZ0 A;  5EI1 A;  1R5K A;  1SJ0 A;  3KYT A;  4JL4 A;  3KMR A;  5DSH A;  3PRG A;  4JAZ A;  5DIE A;  1RK3 A;  3R8I A;  4X1F A;  1UPV A;  4NY9 A;  2P7A A;  4BCR A;  4ZO1 B;  3R5N A;  5GIC A;  3WWR A;  1S0X A;  1EXX A;  3OOK A;  3TKC A;  2QH6 A;  1ZH7 A;  4JGV A;  2QXS A;  5DU5 A;  1YOW A;  3E00 D;  3VHU A;  3W5Q A;  3AZ2 A;  1M2Z A;  1ZAF A;  3FUR A;  5E14 A;  2R6W A;  4G21 A;  2YHD A;  4MGA B;  1XDK A;  4OJB A;  2AYR A;  5KCD A;  3JZC A;  2Q59 A;  4MG8 B;  4OZR E;  4KZI A;  5EGV A;  1XNN A;  1S0Z A;  2GIU A;  4RUJ A;  5DTV A;  5DVC A;  2YJA B;  3NSP A;  4IV4 A;  1XJ7 A;  5C4U A;  5DI7 A;  5KCU A;  1PK5 A;  4EMA A;  3OMK A;  3GD2 A;  1R1K A;  4G2I A;  4PP3 A;  3PBA A;  2XYW A;  2YFE A;  3M7R A;  4RAK A;  5DXK A;  5DZ3 A;  4JYI A;  3FC6 A;  3UP0 A;  5JY3 A;  5DY8 A;  4DK7 A;  1T7T A;  1UOM A;  4J5W A;  3DR1 A;  3G8O A;  2J14 A;  2POB A;  2QA8 B;  3PEQ A;  2JFA B;  4E4Q A;  4FHI A;  3V9V A;  2VV1 A;  2YAT A;  4KZM A;  4WHG A;  5E19 A;  4N8R A;  2F4B A;  1YP0 A;  3HZF A;  4QM0 A;  4XUH A;  1SR7 A;  1XB7 A;  5HJS A;  5A86 A;  4RMC A;  3SP6 A;  4DQM A;  1XPC A;  5DID A;  3VT3 A;  3WTQ A;  4MGB A;  1X76 A;  2R40 D;  1NQ0 A;  2G5O A;  3R5M A;  4XI3 A;  2IOG A;  2J7Y A;  1FM6 D;  3X1I A;  2FAI A;  4LSJ A;  4PF3 A;  4Q0A C;  2QZO B;  3UU7 B;  5B5B A;  4M8H A;  5AZT A;  3NOA A;  3QT0 A;  5KYJ A;  3K23 A;  3WT5 A;  5DMF A;  3OS9 A;  1L2I A;  5DP0 A;  4HEE X;  4OK1 A;  4DMA A;  2AA2 A;  1XQ3 A;  3FEI A;  5JI0 D;  1ZDT A;  2ACL A;  5G42 A;  4ZO1 X;  4K7A A;  2ABI A;  3FLI A;  2VST A;  1I38 A;  3AX8 A;  2H77 A;  3VHW A;  3G9E A;  3TX7 B;  1T63 A;  2HAM A;  2YJD A;  4YMQ A;  4ZNH A;  3ET3 A;  1X7J A;  3D5F A;  4RZE A;  5H1E A;  1OVL A;  2ZMJ A;  1LBD A;  3VT9 A;  3B0W A;  3KPZ A;  4RE8 A;  5DXB B;  3VJH A;  5AVL A;  2P1U A;  3IPS A;  2ZK2 A;  3H0A A;  4J5X A;  3D57 A;  5K13 A;  5FQR A;  2H79 A;  3VRT A;  1N46 A;  1E3K A;  4ZNU A;  5ICK A;  4ZJW A;  5AVI A;  5IXK A;  4LNW A;  2PIP L;  2V0V A;  3GZ9 A;  4LTW A;  1G50 A;  2PNU A;  4PLD A;  1DKF B;  4NUF A;  3V9T A;  4OH5 A;  4J24 A;  5DVV A;  2Q60 A;  3H52 A;  2AX6 A;  2REW A;  3FXV A;  2IHQ A;  3IPQ A;  3PLZ A;  4UDD A;  1N4H A;  2AB2 A;  4IVW A;  3CS8 A;  1XP6 A;  4MG7 B;  2XHS A;  5C4T A;  2XKW A;  3L3X A;  3R8D A;  4IA1 A;  3RLL A;  1NYX A;  1EXA A;  1MV9 A;  2AA5 A;  1PQ9 A;  1XVP B;  2AMB A;  3D24 A;  1T76 A;  4OFU A;  4TV1 A;  4OJ4 A;  2GTK A;  5DLR A;  5LWP A;  2FVJ A;  1RDT A;  4FNE A;  5DMC A;  3AZ1 A;  1PQC A;  1FCZ A;  3HC5 A;  2QAB A;  3RLJ A;  3WGP A;  5KCT A;  4ZNW A;  2QMV A;  1YY4 A;  3HC6 A;  5AWK A;  4PPP A;  3OSA A;  4S15 A;  2VV3 A;  5G45 A;  5HJP B;  3F5C B;  3CTB A;  2I4Z A;  2ZK4 A;  1M13 A;  3WFG A;  5KYA A;  3ZR7 A;  1YOK A;  4MGD A;  3ZQT A;  5E15 A;  3UUD B;  1YA3 A;  2JF9 A;  1TXI A;  4PP5 A;  3B67 A;  3BQD A;  2PIO A;  1RJK A;  1NQ2 A;  2OVH A;  2Q7L A;  4ZNV A;  3OZJ A;  2E2R A;  4IUI A;  3OAP A;  4QL8 A;  5KR9 A;  3HOD A;  4RME A;  3B5R A;  2PIX A;  5DL4 A;  4J5X C;  4JYH A;  3B65 A;  5G44 A;  1U3R A;  2Q5S A;  2ZLA A;  1QKT A;  4RFW A;  3TKM A;  1TFC A;  3BEJ A;  5DWI A;  1X78 A;  4RZG A;  5KCE A;  2ATH A;  2AM9 A;  2GPU A;  5FQS A;  5L7E A;  5JJM B;  2BJ4 A;  3KWY A;  1Q4X A;  3WJ5 A;  1ZKY A;  1RKG A;  2PJL A;  3X1H A;  5IAW A;  1XOW A;  3OKI A;  3A2H A;  3FS1 A;  4R6S A;  4EM9 A;  5AAV A;  1K4W A;  2Q1V A;  1ILH A;  1L2J A;  3X36 A;  3ET1 A;  3UUC A;  4RWV A;  1GWX A;  3V3E A;  2P15 A;  3HQ5 A;  3VT4 A;  3ZRA A;  5DKE A;  5AZV A;  1T5Z A;  4OKW A;  2ZNQ A;  3L03 A;  2QGT A;  2V7C A;  3E00 A;  1FCX A;  1ZDU A;  3CDP A;  2ZK3 A;  3G0W A;  5DV8 A;  4LNX A;  2G0H A;  3R2A A;  3AUQ A;  5KCC A;  2QXM A;  4G1Z A;  5FQT A;  4A4W A;  1FD0 A;  3VJS A;  2OM9 A;  3VT5 A;  3VT8 A;  5B41 A;  1G5Y A;  2GWX A;  4IA2 A;  5DZ0 A;  2ZMH A;  4REF A;  3V3Q A;  4ZJR A;  2XYJ A;  2B23 A;  3ADT A;  4DM8 A;  1PZL A;  1YJE A;  1XLS E;  3ADU A;  4G2H A;  2AXA A;  5KRL A;  2Q5G A;  1YIN A;  5DYB A;  2POG A;  4MGB B;  2Q7I A;  3VJT A;  3P89 A;  3DZY D;  3AUN A;  1ZGY A;  3MNP A;  3UP3 A;  4OKB A;  4Y29 A;  3AN4 A;  5DXM A;  3R29 A;  3OS8 C;  3B1M A;  3MNE A;  4OZR U;  5KD9 A;  1RKH A;  3W5P A;  3LBD A;  3UVV B;  4TUZ A;  5IZ0 A;  2YLY A;  1N83 A;  3WT7 A;  5KRJ A;  3VN2 A;  5ETH A;  2BAW A;  3CWD A;  3RVF A;  4NQA B;  4MGA A;  4RUO X;  3FUG A;  3FAL A;  1G2N A;  1K74 D;  5E7V A;  3OKH A;  5HJP A;  1QKU A;  2QA6 A;  4MG8 A;  1ZUC A;  1NAV A;  5DX3 B;  1KNU A;  3ZRB A;  5DKG A;  1QKN A;  5KRM A;  2Q5P A;  2ACL B;  1SKX A;  2R40 A;  4UDC A;  2ZK6 A;  3UUA B;  3VRU A;  3W0I A;  2NXX E;  2JJ3 A;  5DZ1 A;  1FM6 A;  3RUU A;  2PIU A;  3KBA A;  5CJ6 A;  1S19 A;  1XV9 B;  2QR9 A;  3PO9 A;  5EJV A;  3R8A A;  4N1Y A;  4WPF A;  2QTU A;  4DK8 A;  4PRG A;  2Q3Y A;  3VJI A;  1OVL B;  1R20 D;  5KRK A;  3W0J A;  1UHL B;  1KKQ A;  2GPP A;  1IE9 A;  2VV0 A;  2JFA A;  4NB6 A;  4OZT E;  4G1D A;  1Y0X X;  4PXM A;  4KZJ A;  1A28 A;  2I4J A;  1GWQ A;  3GWX A;  5APJ A;  1SQN A;  3P0U A;  3DCT A;  4ITF A;  4RZF A;  2Q61 A;  3EYB A;  1Z95 A;  4IW8 A;  3G8I A;  2ZXM A;  3K22 A;  5M96 A;  2Q7K A;  1NQ7 A;  1U9E A;  2VV4 B;  4J5W C;  5DZI A;  3F7D A;  3V4A A;  2G44 A;  2R6Y A;  5DV3 A;  2QNV A;  2ZK0 A;  1HJ1 A;  2GL8 A;  2HCD A;  3IXP D;  3JZB A;  2Z4B A;  5DK9 A;  4ZNS A;  1FM9 D;  3A78 A;  2QZO A;  3UU7 A;  4J26 A;  4FN9 A;  4APU A;  2B1V A;  2OAX A;  4K6I A;  3Q95 A;  3VRV A;  1PDU A;  5DKB A;  4N73 A;  2ZL9 A;  5DVS A;  3HVL A;  3W0C A;  4ITE A;  1XLS A;  4A4V A;  3AFR A;  4OZT U;  4IVY A;  3HM1 A;  2PIT A;  1NAX A;  1X7B A;  3ADV A;  1T74 A;  1T7F A;  2YLO A;  2B50 A;  3ERD A;  4WQP A;  5L7H A;  2ZXZ A;  3T03 A;  3IA6 A;  3OGT A;  3GBK A;  4IWF A;  4OIU A;  1K7L A;  4DM6 A;  4A2J A;  1GS4 A;  4QK4 A;  4P6X A;  5DIG A;  4Q50 A;  5AK2 A;  3W0Y A;  1Y0S A;  3A2I A;  3ET0 A;  1M7W A;  3D90 A;  4MDD A;  4OEZ A;  5HYK A;  4XTA A;  2Q6S A;  4MG9 B;  4S0S A;  4O8F A;  3A40 X;  5DXB A;  3L3Z A;  4POJ A;  3B66 A;  5KRH A;  4CSJ A;  2QSE A;  1KV6 A;  3W5R A;  1XNX A;  4G20 A;  2NXX A;  3E94 A;  4R2U A;  5APK A;  5C4S A;  3B0R A;  4OFR A;  3RY9 A;  3W0G A;  2HWR A;  4MGC A;  4OGH A;  4E2J A;  2I0J A;  3A9E A;  3OSI A;  2W8Y A;  5KCW A;  2Q70 A;  3L0E A;  2AAX A;  5DXP A;  2ZNN A;  3VHV A;  4ZI1 A;  5AAU A;  1ILG A;  1S9P A;  1U3Q A;  5KRF A;  5SYZ A;  3W5T A;  5DWG A;  3O1D A;  1PQ6 A;  4WHF A;  3ERT A;  4RUP A;  4OC7 A;  1YYE A;  5AAV B;  5DUH A;  5EIT A;  2Q1H A;  4L96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...