5LWPA

Discovery of phenoxyindazoles and phenylthioindazoles as rorg inverse agonists
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
244
structure length
244
Chain Sequence
HMASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Nuclear receptor ROR-gamma
publication title Discovery of phenoxyindazoles and phenylthioindazoles as ROR gamma inverse agonists.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5lwpA00
1ILGA 2GPPA 2YHDA 3DCUA 2QR9A 1PCGA 2VV1A 2Q3YA 4IV4A 4J5XC 3VTBA 1EXXA 4G1YA 2ZLCA 5DXBA 5DLRA 1UPVA 4M8HA 1RKHA 2PIUA 3WT5A 3AZ1A 3VT5A 4S0SA 4KZMA 3B3KA 4LBDA 5IXKA 3ZR7A 4Q0AC 1BSXA 1PRGA 2OUZA 3ADVA 3RUTA 3Q95B 4J5WC 5SYZA 5KCEA 4JAZA 5DZHA 3KMGA 3B0TA 2QA6A 5DWGA 3RLLA 4OIUA 5DRJA 3L3XA 2O4RA 3L1BA 2QABA 5E14A 5ICKA 1R5KA 2IHQA 1S9QA 1ZDTA 3GWXA 4WVDA 5DWIA 5F9BA 2AXAA 3VJSA 5DUHA 3E00A 2ZK1A 3IPSA 4DORA 5HJPB 4QE8A 4YT1A 1YINA 4HEEX 2GP7A 2J7YA 3B1MA 4OILA 5G3JA 1KKQA 1M7WA 2QXMA 3PEQA 1K4WA 5DIEA 1UHLB 2ZLAA 3DZYA 3MNEA 1FCXA 2I0GA 3G9EA 4JL4A 4RFWA 4JYHA 3X31A 3OMMA 2XYXA 5ETHA 5KYAA 3FALA 1XNNA 4BCRA 2QH6A 3R5MA 1G50A 3LBDA 4OKWA 1ZDUA 5DWJA 1RDTA 2REWA 3GYTA 3R8IA 2A3IA 3HC5A 4DQMA 4MG7B 4IVWA 4YMQA 1N4HA 1VJBA 5DZ0A 2AB2A 3ET0A 2AO6A 2P7GA 3VRUA 5K13A 3L3ZA 1NQ1A 5DV6A 2B50A 3FC6A 5B41A 5DX3A 2AYRA 5M96A 3K8SA 4NQAB 1NHZA 1YYEA 1K7LA 5KRIA 2Q5SA 2ABIA 4QK4A 1LBDA 1RKGA 1IE8A 3F5CA 4OZTE 2I4JA 5KD9A 1IE9A 4FHHA 2ZNOA 3KWYA 2GPOA 2R40A 3X1HA 1K74A 3FURA 3WTQA 2QGTA 3ADTA 3DT3A 5DXQA 4K4JA 3V9TA 3KMRA 2B23A 1XDKB 1Y0XX 1KNUA 2BJ4A 3L0JA 3OS8A 3B5RA 2VSTA 4K6IA 3VRWA 3IMYA 3H52A 4E4QA 1LV2A 4OEAA 3OSIA 1YOKA 2Q6SA 2ZNNA 1XV9B 4PF3A 2OVHA 4IW6A 2GWXA 3A9EA 3E7CA 2GIUA 3OMPA 3UUDB 1PQCA 4OEZA 5DVVA 3VT9A 5KCWA 4EMAA 5DKBA 3RVFA 3CWDA 2EWPA 4LNWA 4REFA 3W0JA 1XVPA 5DXEA 5GICA 4DMAA 2QA8A 3VTDA 3WJ4A 5HYKA 4RUOX 3D24A 3V9VA 3KFCA 1YOWA 3GYUA 3OSWA 1FM6D 5AYGA 3TY0A 3CS4A 4PXMA 2Q5GA 2PIRA 4ZNSA 2P4YA 5DRMA 2Q1HA 2P7ZA 2R6YA 4MG8B 4RMEA 2XYWA 2Z4JA 5AWKA 1XQCA 3UUAB 1I7GA 5DXGA 3P8XA 4ZN7A 4IQRA 2FVJA 2HCDA 2GPVA 4LNXA 5E0XA 2Z4BA 3OOKA 1A52A 3OKHA 1GWRA 2HB8A 3CQVA 3OMOA 3VRVA 3H0AD 2JF9A 1T74A 4MGAB 1R6GA 5E15A 3WGPA 1X7EA 1RJKA 2QSEA 2AMBA 3CLDA 4G1ZA 3DY6A 1NAXA 5GIDA 3VHWA 1U3SA 1Z95A 2G44A 2V7CA 3KMZA 3X36A 1P8DA 3A40X 1XLSA 2HASA 3OZJA 3VI8A 5KCUA 3O1EA 5KRLA 2VV4A 5DIGA 3F7DA 3UP3A 5DV3A 5C4TA 5IAWA 4WPFA 5KRKA 3E00D 2ZASA 1I38A 4WQPA 5KROA 2ZXZA 4IA2A 5DWEA 3ZRBA 1YY4A 1GS4A 5E0WA 1T7MA 3HQ5A 4FN9A 4UDBA 1NDEA 2JFAB 3JZCA 3A9EB 4N1YA 5KYJA 5C4UA 3W5TA 2G0GA 4OK1A 4R6SA 5DZ3A 2YLPA 3VT3A 4J5XA 4RMCA 4RZGA 4EM9A 3WT6A 3FS1A 3OMKA 4YPQA 1XVPB 2IOKA 2NV7A 4IA1A 3CTBA 4CI5A 3A78A 1YMTA 4RWVA 1U3RA 4PPSA 5G44A 2Q59A 3NSPA 3WT7A 2P1UA 3FUGA 5AZVA 1FM9A 4OEDA 1T7FA 4J5WA 3B68A 1Y9RA 4E4KA 4PP3A 1Z5XE 4DM8A 4XAOA 1Y0SA 5JY3A 1XP6A 4WLBA 4ZNHA 4S0TA 1PQ9A 1ZH7A 3AN4A 3OLFA 1GWXA 1X76A 5DYDA 4PWLA 3BC5A 1OVLB 3CS6A 2PIXA 4TUZB 5G5WA 1DKFA 1XLSE 3KBAA 5GT4A 5L7HA 3TKMA 1R20D 5EJVA 4CI4A 1DB1A 3D6DA 3D90A 3CS8A 2V0VA 5G45A 2YLOA 2PKLA 5DWLA 2P7AA 1EREA 5HZCA 2P54A 1NRLA 5AAUA 2ACLB 3WWRA 3R2AA 2HFPA 4Q50A 3PCUA 3RY9A 5H1EA 2POBA 2AX8A 1GWQA 5DIDA 3IXPA 2VV3A 3PO9A 2I0JA 5DKEA 1UPWA 5AAVA 2GTKA 2Q6JA 1KV6A 3UU7B 2YFEA 5DMFA 2JJ3A 3AZ2A 3KYTA 4ITEA 3TX7B 4MGDB 3K23A 4OHAA 2AA5A 2QZOA 1NQ7A 2QNVA 3AFRA 4M8EA 5LGAA 2ZMHA 2ZK4A 3CDPA 2PIQA 2ZK3A 2VV1B 2LBDA 2PRGA 1QKUA 2YLQA 5DXBB 3VJIA 4E2JA 3W5QA 2Q60A 3HM1A 3AURA 2YATA 3SP6A 4ZN9A 3UVVA 2HB7A 3GN8A 5DXRA 3BQDA 5DI7A 3ERDA 4OLMA 4FHIA 2B1ZA 3V4AA 4OJBA 3ET3A 3VTCA 4IWFA 5DUGA 3OLLA 3ILZA 4ZNWA 4A4WA 4UDDA 3AUNA 4OH5A 3K22A 1NQ2A 3QT0A 3HVLA 2ZY0A 5DMCA 3V49A 1XAPA 3DZUD 2F4BA 3K6PA 2ZKCA 3ADSA 2AWHA 3PRGA 1DKFB 2YJAB 4OC7A 3FEIA 1FCZA 4IU7A 4XI3A 4PLEA 5KRJA 2NXXA 4Q13A 2J7XA 2P15A 3GBKA 3B67A 5E7VA 2Q61A 5DXPA 4G2IA 3VJHA 5IZ0A 2Q6RA 3VT6A 4RUPA 5L11A 5E1CA 3A2HA 2Q5PA 4LTWA 1SKXA 4ZJWA 3U9QA 3FALB 1G1UA 1PZLA 4OKXA 5AVIA 2OZ7A 2ZVTA 5AK2A 2POGA 1X78A 4ZO1B 1R20A 1XP1A 4FGYA 1N46A 1S0XA 4NY9A 5KRFA 1S0ZA 2XYJA 4MGBA 1M13A 3LMPA 4OH6A 4J26A 4XT9A 4PP5A 4QJRA 5FQRA 1T7TA 2VV2A 5EGVA 4MGCA 5C4SA 4ZNVA 3A2JA 4PPPA 3FC6B 5B5BA 3IPUA 5DX3B 3WFGA 5G42A 3M7RA 5FQPA 3SP9A 4B7WA 2QPYA 5DYBA 3VHUA 4OZRU 4RAKA 5HCVA 2ATHA 4N8RA 4LSJA 1ERRA 3OSAA 4ZO1X 5KRCA 5KCFA 1QKNA 3OS9A 2PNUA 4JYGA 3F5CB 2PITA 1YP0A 4PLDA 1ZEOA 3PLZA 3Q95A 3VN2A 4K7AA 2ZMIA 3W0CA 5L7EA 3DZYD 2NXXE 4WHGA 3VRTA 1MZNA 1P93A 2E2RA 2HWRA 2H79A 4FNEA 2ZBSA 4IA3A 2ZMJA 2BJ4B 4KZJA 4L96A 5E19A 2ZFXA 4DK8A 5KRHA 5DKGA 3KPZA 5DL4A 1N83A 4OZRE 2AA6A 5EC9A 5GIEA 1X7RA 3V3QA 1FBYA 1RK3A 1ZGYA 2PJLA 3IPQA 5CJ6A 5DP0A 3W0YA 5HJPA 2AX9A 3R29A 4KZIA 4DM6A 2YJDA 1OT7A 1T65A 3CDSA 5APJA 5EHJA 1MVCA 4A4VA 1L2JA 3TKCA 2AX6A 1UHLA 1R1KD 4PP6A 4TV1A 2VV0A 5HYRA 3R5NA 4NUFA 3ADWA 1YJEA 2QA8B 4X1FA 5KRAA 2Q7KA 2PIOA 3OLSA 3W0AA 4MG7A 5FQTA 3WMHA 1SQNA 3G8IA 3VHVA 2P1VA 3D57A 3W5PA 1E3KA 3W0HA 3GWSX 3WJ5A 1XQ3A 1PQ6A 1XNXA 3X1IA 2QE4A 4DOSA 2R40D 2QGWA 1K74D 1Q4XA 3A2IA 3AN3A 5DUEA 4OGHA 4JGVA 5JJMA 2QXSA 4NB6A 2AAXA 1T73A 1WM0X 1HJ1A 4R2UA 1I7IA 2GL8A 5DTVA 5DVSA 3ADUA 3B0QA 3NSQA 3PBAA 5DY8A 3FEJA 3HO0A 3SZ1A 2Q1VA 3RUUA 1FM6A 4XUMA 4P6WA 4UDAA 1U3QA 2ZL9A 2W8YA 4OJ4A 3HLVA 4POJA 1T7RA 4IWCA 4QM0A 1UOMA 4IA7A 5LWPA 2I4ZA 3OKIA 3EYBA 3HZFA 1XDKA 1XB7A 3ET2A 5DSHA 4JYIA 3IA6A 3FXVA 2VV4B 1TFCA 2OM9A 2J4AA 4XHDA 1T63A 5FQSA 3S9SA 5KCTA 3H0AA 1XV9A 3R8DA 4MDDA 5I4VA 5KCDA 5G46A 2Q7JA 3UUDA 2AM9A 3V3EA 2ZNPA 3B65A 5L7GA 2OVMA 4IS8A 4PVUA 4RZEA 3ZQTA 2FSZA 3P88A 4IV2A 5G43A 3HODA 4NIEA 4G2HA 4MG9A 4TV1B 1XJ7A 1YA3A 1NQ0A 2QW4A 3BEJA 2ZXMA 1PDUA 2R6WA 5EITA 1XP9A 1YIMA 4L98A 1ZKYA 3OAPA 2O4JA 2Q59B 3WFFA 4YNKA 4OZTU 4N73A 1ZAFA 3AZ3A 5APHA 1SR7A 3B66A 4OJ9A 4MG8A 3FLIA 3UUAA 2G0HA 2ZK6A 3MNPA 4QE6A 4RE8A 1S19A 1U9EA 1R1KA 3G8OA 2P1TA 1S9PA 4XUHA 2PIVA 3DCTA 4OARA 4OEYA 5JJMB 2GPUA 1X7JA 2O9IA 2HARA 3O1DA 5APKA 5AVLA 4MGAA 4IVYA 2J14A 4POHA 2HBHA 5DZIA 1FCYA 3L0EA 3W0IA 1NYXA 4UDCA 1ILHA 3ADXA 3B0WA 3P0UA 3A3ZX 3VSOA 1ZUCA 2ZK5A 3MNOA 1EXAA 1XZXX 3G0WA 5DXMA 3GZ9A 3VJTA 2Q7LA 4PRGA 5EI1A 2PIWA 5AWJA 5HJSA 4HLWA 4IUIA 3OZ0A 3DR1A 3B0RA 2G5OA 3ET1A 4ZOMA 1L2IA 4ITFA 2NPAA 2BAWA 3JZBA 3GD2A 2PIPL 1A28A 3HC6A 4Y29A 3VSPA 1YUCA 3OS8C 5AAVB 5DU5A 3RLJA 5ACCA 3E94A 5C4OA 5KCCA 4R06A 1FM9D 2JFAA 4OIVA 2H77A 2PINA 1OSVA 2OAXA 4RMDA 4ZJRA 3UP0A 3AUQA 1OSHA 2YLYA 4F9MA 2QZOB 4X1GA 4MG6A 3VT7A 2ZNQA 4ONIA 5AZTA 2ZK0A 4G1DA 2FAIA 3D5FA 1NUOA 3V9YA 1HG4A 1G2NA 2OCFA 2HAMA 3OGTA 3OMQA 4MG9B 2ZXNA 3R8AA 1E3GA 4OKBA 5DVCA 1XOWA 3UVVB 1T76A 2I4PA 1I37A 4MG5A 5DKSA 3CJWA 3T03A 1FD0A 2HWQA 4REEA 1T79A 4S15A 1M2ZA 1QKMA 2HVCA 4QL8A 1MV9A 3ZRAA 3W0GA 4ZNUA 4G20A 4P6XA 4OFRA 5JI0D 1T5ZA 4N5GA 1OVLA 4TUZA 3IXPD 2XKWA 4OKTA 2AX7A 1X7BA 3W5RA 1RDTD 1XPCA 3L0LA 2Q7IA 5DK9A 4ZI1A 3OOFA 4A2JA 2NW4A 4J24A 1G5YA 5DV8A 2VSRA 1XIUA 3KDTA 4O8FA 2HC4A 4OFUA 3UUCA 3VT4A 3N00A 2ACLA 3P89A 2QMVA 5A86A 1H9UA 1SJ0A 2QTUA 4XTAA 1QKTA 4G21A 3VT8A 3KDUA 3L03A 4WHFA 2ZK2A 3AX8A 4DK7A 3DZUA 1TXIA 2XHSA 2AA7A 3ERTA 5KR9A 2AMAA 1NAVA 3NOAA 4IW8A 4S14A 2Q70A 3UU7A 4ZNTA 2Q8SA 5KRMA 4RUJA 4RZFA 4XLDA 4APUA 2IOGA 5DZ1A 4MGDA 1PK5A 4MGBB 4CSJA 1Z5XU 5FQVA 5DXKA 2AA2A 2B1VA
chains in the Genus database with same CATH superfamily
1ILGA 2GPPA 2YHDA 3DCUA 2QR9A 1PCGA 2VV1A 2Q3YA 4IV4A 4J5XC 3VTBA 1EXXA 4G1YA 2ZLCA 5DXBA 5DLRA 1UPVA 4M8HA 1RKHA 2PIUA 3WT5A 3AZ1A 3VT5A 4S0SA 4KZMA 3B3KA 4LBDA 5IXKA 3ZR7A 4Q0AC 1BSXA 1PRGA 2OUZA 3ADVA 3RUTA 3Q95B 4J5WC 5SYZA 5KCEA 4JAZA 5DZHA 3KMGA 3B0TA 2QA6A 5DWGA 3RLLA 4OIUA 5DRJA 3L3XA 2O4RA 3L1BA 2QABA 5E14A 5ICKA 1R5KA 2IHQA 1S9QA 1ZDTA 3GWXA 4WVDA 5DWIA 5F9BA 2AXAA 3VJSA 5DUHA 3E00A 2ZK1A 3IPSA 4DORA 5HJPB 4QE8A 4YT1A 1YINA 4HEEX 2GP7A 2J7YA 3B1MA 4OILA 5G3JA 1KKQA 1M7WA 2QXMA 3PEQA 1K4WA 5DIEA 1UHLB 2ZLAA 3DZYA 3MNEA 1FCXA 2I0GA 3G9EA 4JL4A 4RFWA 4JYHA 3X31A 3OMMA 2XYXA 5ETHA 5KYAA 3FALA 1XNNA 4BCRA 2QH6A 3R5MA 1G50A 3LBDA 4OKWA 1ZDUA 5DWJA 1RDTA 2REWA 3GYTA 3R8IA 2A3IA 3HC5A 4DQMA 4MG7B 4IVWA 4YMQA 1N4HA 1VJBA 5DZ0A 2AB2A 3ET0A 2AO6A 2P7GA 3VRUA 5K13A 3L3ZA 1NQ1A 5DV6A 2B50A 3FC6A 5B41A 5DX3A 2AYRA 5M96A 3K8SA 4NQAB 1NHZA 1YYEA 1K7LA 5KRIA 2Q5SA 2ABIA 4QK4A 1LBDA 1RKGA 1IE8A 3F5CA 4OZTE 2I4JA 5KD9A 1IE9A 4FHHA 2ZNOA 3KWYA 2GPOA 2R40A 3X1HA 1K74A 3FURA 3WTQA 2QGTA 3ADTA 3DT3A 5DXQA 4K4JA 3V9TA 3KMRA 2B23A 1XDKB 1Y0XX 1KNUA 2BJ4A 3L0JA 3OS8A 3B5RA 2VSTA 4K6IA 3VRWA 3IMYA 3H52A 4E4QA 1LV2A 4OEAA 3OSIA 1YOKA 2Q6SA 2ZNNA 1XV9B 4PF3A 2OVHA 4IW6A 2GWXA 3A9EA 3E7CA 2GIUA 3OMPA 3UUDB 1PQCA 4OEZA 5DVVA 3VT9A 5KCWA 4EMAA 5DKBA 3RVFA 3CWDA 2EWPA 4LNWA 4REFA 3W0JA 1XVPA 5DXEA 5GICA 4DMAA 2QA8A 3VTDA 3WJ4A 5HYKA 4RUOX 3D24A 3V9VA 3KFCA 1YOWA 3GYUA 3OSWA 1FM6D 5AYGA 3TY0A 3CS4A 4PXMA 2Q5GA 2PIRA 4ZNSA 2P4YA 5DRMA 2Q1HA 2P7ZA 2R6YA 4MG8B 4RMEA 2XYWA 2Z4JA 5AWKA 1XQCA 3UUAB 1I7GA 5DXGA 3P8XA 4ZN7A 4IQRA 2FVJA 2HCDA 2GPVA 4LNXA 5E0XA 2Z4BA 3OOKA 1A52A 3OKHA 1GWRA 2HB8A 3CQVA 3OMOA 3VRVA 3H0AD 2JF9A 1T74A 4MGAB 1R6GA 5E15A 3WGPA 1X7EA 1RJKA 2QSEA 2AMBA 3CLDA 4G1ZA 3DY6A 1NAXA 5GIDA 3VHWA 1U3SA 1Z95A 2G44A 2V7CA 3KMZA 3X36A 1P8DA 3A40X 1XLSA 2HASA 3OZJA 3VI8A 5KCUA 3O1EA 5KRLA 2VV4A 5DIGA 3F7DA 3UP3A 5DV3A 5C4TA 5IAWA 4WPFA 5KRKA 3E00D 2ZASA 1I38A 4WQPA 5KROA 2ZXZA 4IA2A 5DWEA 3ZRBA 1YY4A 1GS4A 5E0WA 1T7MA 3HQ5A 4FN9A 4UDBA 1NDEA 2JFAB 3JZCA 3A9EB 4N1YA 5KYJA 5C4UA 3W5TA 2G0GA 4OK1A 4R6SA 5DZ3A 2YLPA 3VT3A 4J5XA 4RMCA 4RZGA 4EM9A 3WT6A 3FS1A 3OMKA 4YPQA 1XVPB 2IOKA 2NV7A 4IA1A 3CTBA 4CI5A 3A78A 1YMTA 4RWVA 1U3RA 4PPSA 5G44A 2Q59A 3NSPA 3WT7A 2P1UA 3FUGA 5AZVA 1FM9A 4OEDA 1T7FA 4J5WA 3B68A 1Y9RA 4E4KA 4PP3A 1Z5XE 4DM8A 4XAOA 1Y0SA 5JY3A 1XP6A 4WLBA 4ZNHA 4S0TA 1PQ9A 1ZH7A 3AN4A 3OLFA 1GWXA 1X76A 5DYDA 4PWLA 3BC5A 1OVLB 3CS6A 2PIXA 4TUZB 5G5WA 1DKFA 1XLSE 3KBAA 5GT4A 5L7HA 3TKMA 1R20D 5EJVA 4CI4A 1DB1A 3D6DA 3D90A 3CS8A 2V0VA 5G45A 2YLOA 2PKLA 5DWLA 2P7AA 1EREA 5HZCA 2P54A 1NRLA 5AAUA 2ACLB 3WWRA 3R2AA 2HFPA 4Q50A 3PCUA 3RY9A 5H1EA 2POBA 2AX8A 1GWQA 5DIDA 3IXPA 2VV3A 3PO9A 2I0JA 5DKEA 1UPWA 5AAVA 2GTKA 2Q6JA 1KV6A 3UU7B 2YFEA 5DMFA 2JJ3A 3AZ2A 3KYTA 4ITEA 3TX7B 4MGDB 3K23A 4OHAA 2AA5A 2QZOA 1NQ7A 2QNVA 3AFRA 4M8EA 5LGAA 2ZMHA 2ZK4A 3CDPA 2PIQA 2ZK3A 2VV1B 2LBDA 2PRGA 1QKUA 2YLQA 5DXBB 3VJIA 4E2JA 3W5QA 2Q60A 3HM1A 3AURA 2YATA 3SP6A 4ZN9A 3UVVA 2HB7A 3GN8A 5DXRA 3BQDA 5DI7A 3ERDA 4OLMA 4FHIA 2B1ZA 3V4AA 4OJBA 3ET3A 3VTCA 4IWFA 5DUGA 3OLLA 3ILZA 4ZNWA 4A4WA 4UDDA 3AUNA 4OH5A 3K22A 1NQ2A 3QT0A 3HVLA 2ZY0A 5DMCA 3V49A 1XAPA 3DZUD 2F4BA 3K6PA 2ZKCA 3ADSA 2AWHA 3PRGA 1DKFB 2YJAB 4OC7A 3FEIA 1FCZA 4IU7A 4XI3A 4PLEA 5KRJA 2NXXA 4Q13A 2J7XA 2P15A 3GBKA 3B67A 5E7VA 2Q61A 5DXPA 4G2IA 3VJHA 5IZ0A 2Q6RA 3VT6A 4RUPA 5L11A 5E1CA 3A2HA 2Q5PA 4LTWA 1SKXA 4ZJWA 3U9QA 3FALB 1G1UA 1PZLA 4OKXA 5AVIA 2OZ7A 2ZVTA 5AK2A 2POGA 1X78A 4ZO1B 1R20A 1XP1A 4FGYA 1N46A 1S0XA 4NY9A 5KRFA 1S0ZA 2XYJA 4MGBA 1M13A 3LMPA 4OH6A 4J26A 4XT9A 4PP5A 4QJRA 5FQRA 1T7TA 2VV2A 5EGVA 4MGCA 5C4SA 4ZNVA 3A2JA 4PPPA 3FC6B 5B5BA 3IPUA 5DX3B 3WFGA 5G42A 3M7RA 5FQPA 3SP9A 4B7WA 2QPYA 5DYBA 3VHUA 4OZRU 4RAKA 5HCVA 2ATHA 4N8RA 4LSJA 1ERRA 3OSAA 4ZO1X 5KRCA 5KCFA 1QKNA 3OS9A 2PNUA 4JYGA 3F5CB 2PITA 1YP0A 4PLDA 1ZEOA 3PLZA 3Q95A 3VN2A 4K7AA 2ZMIA 3W0CA 5L7EA 3DZYD 2NXXE 4WHGA 3VRTA 1MZNA 1P93A 2E2RA 2HWRA 2H79A 4FNEA 2ZBSA 4IA3A 2ZMJA 2BJ4B 4KZJA 4L96A 5E19A 2ZFXA 4DK8A 5KRHA 5DKGA 3KPZA 5DL4A 1N83A 4OZRE 2AA6A 5EC9A 5GIEA 1X7RA 3V3QA 1FBYA 1RK3A 1ZGYA 2PJLA 3IPQA 5CJ6A 5DP0A 3W0YA 5HJPA 2AX9A 3R29A 4KZIA 4DM6A 2YJDA 1OT7A 1T65A 3CDSA 5APJA 5EHJA 1MVCA 4A4VA 1L2JA 3TKCA 2AX6A 1UHLA 1R1KD 4PP6A 4TV1A 2VV0A 5HYRA 3R5NA 4NUFA 3ADWA 1YJEA 2QA8B 4X1FA 5KRAA 2Q7KA 2PIOA 3OLSA 3W0AA 4MG7A 5FQTA 3WMHA 1SQNA 3G8IA 3VHVA 2P1VA 3D57A 3W5PA 1E3KA 3W0HA 3GWSX 3WJ5A 1XQ3A 1PQ6A 1XNXA 3X1IA 2QE4A 4DOSA 2R40D 2QGWA 1K74D 1Q4XA 3A2IA 3AN3A 5DUEA 4OGHA 4JGVA 5JJMA 2QXSA 4NB6A 2AAXA 1T73A 1WM0X 1HJ1A 4R2UA 1I7IA 2GL8A 5DTVA 5DVSA 3ADUA 3B0QA 3NSQA 3PBAA 5DY8A 3FEJA 3HO0A 3SZ1A 2Q1VA 3RUUA 1FM6A 4XUMA 4P6WA 4UDAA 1U3QA 2ZL9A 2W8YA 4OJ4A 3HLVA 4POJA 1T7RA 4IWCA 4QM0A 1UOMA 4IA7A 5LWPA 2I4ZA 3OKIA 3EYBA 3HZFA 1XDKA 1XB7A 3ET2A 5DSHA 4JYIA 3IA6A 3FXVA 2VV4B 1TFCA 2OM9A 2J4AA 4XHDA 1T63A 5FQSA 3S9SA 5KCTA 3H0AA 1XV9A 3R8DA 4MDDA 5I4VA 5KCDA 5G46A 2Q7JA 3UUDA 2AM9A 3V3EA 2ZNPA 3B65A 5L7GA 2OVMA 4IS8A 4PVUA 4RZEA 3ZQTA 2FSZA 3P88A 4IV2A 5G43A 3HODA 4NIEA 4G2HA 4MG9A 4TV1B 1XJ7A 1YA3A 1NQ0A 2QW4A 3BEJA 2ZXMA 1PDUA 2R6WA 5EITA 1XP9A 1YIMA 4L98A 1ZKYA 3OAPA 2O4JA 2Q59B 3WFFA 4YNKA 4OZTU 4N73A 1ZAFA 3AZ3A 5APHA 1SR7A 3B66A 4OJ9A 4MG8A 3FLIA 3UUAA 2G0HA 2ZK6A 3MNPA 4QE6A 4RE8A 1S19A 1U9EA 1R1KA 3G8OA 2P1TA 1S9PA 4XUHA 2PIVA 3DCTA 4OARA 4OEYA 5JJMB 2GPUA 1X7JA 2O9IA 2HARA 3O1DA 5APKA 5AVLA 4MGAA 4IVYA 2J14A 4POHA 2HBHA 5DZIA 1FCYA 3L0EA 3W0IA 1NYXA 4UDCA 1ILHA 3ADXA 3B0WA 3P0UA 3A3ZX 3VSOA 1ZUCA 2ZK5A 3MNOA 1EXAA 1XZXX 3G0WA 5DXMA 3GZ9A 3VJTA 2Q7LA 4PRGA 5EI1A 2PIWA 5AWJA 5HJSA 4HLWA 4IUIA 3OZ0A 3DR1A 3B0RA 2G5OA 3ET1A 4ZOMA 1L2IA 4ITFA 2NPAA 2BAWA 3JZBA 3GD2A 2PIPL 1A28A 3HC6A 4Y29A 3VSPA 1YUCA 3OS8C 5AAVB 5DU5A 3RLJA 5ACCA 3E94A 5C4OA 5KCCA 4R06A 1FM9D 2JFAA 4OIVA 2H77A 2PINA 1OSVA 2OAXA 4RMDA 4ZJRA 3UP0A 3AUQA 1OSHA 2YLYA 4F9MA 2QZOB 4X1GA 4MG6A 3VT7A 2ZNQA 4ONIA 5AZTA 2ZK0A 4G1DA 2FAIA 3D5FA 1NUOA 3V9YA 1HG4A 1G2NA 2OCFA 2HAMA 3OGTA 3OMQA 4MG9B 2ZXNA 3R8AA 1E3GA 4OKBA 5DVCA 1XOWA 3UVVB 1T76A 2I4PA 1I37A 4MG5A 5DKSA 3CJWA 3T03A 1FD0A 2HWQA 4REEA 1T79A 4S15A 1M2ZA 1QKMA 2HVCA 4QL8A 1MV9A 3ZRAA 3W0GA 4ZNUA 4G20A 4P6XA 4OFRA 5JI0D 1T5ZA 4N5GA 1OVLA 4TUZA 3IXPD 2XKWA 4OKTA 2AX7A 1X7BA 3W5RA 1RDTD 1XPCA 3L0LA 2Q7IA 5DK9A 4ZI1A 3OOFA 4A2JA 2NW4A 4J24A 1G5YA 5DV8A 2VSRA 1XIUA 3KDTA 4O8FA 2HC4A 4OFUA 3UUCA 3VT4A 3N00A 2ACLA 3P89A 2QMVA 5A86A 1H9UA 1SJ0A 2QTUA 4XTAA 1QKTA 4G21A 3VT8A 3KDUA 3L03A 4WHFA 2ZK2A 3AX8A 4DK7A 3DZUA 1TXIA 2XHSA 2AA7A 3ERTA 5KR9A 2AMAA 1NAVA 3NOAA 4IW8A 4S14A 2Q70A 3UU7A 4ZNTA 2Q8SA 5KRMA 4RUJA 4RZFA 4XLDA 4APUA 2IOGA 5DZ1A 4MGDA 1PK5A 4MGBB 4CSJA 1Z5XU 5FQVA 5DXKA 2AA2A 2B1VA
chains in the Genus database with same CATH topology
1ILGA 2GPPA 2YHDA 3DCUA 2QR9A 1PCGA 2VV1A 2Q3YA 4IV4A 4J5XC 3VTBA 1EXXA 4G1YA 2ZLCA 5DXBA 5DLRA 1UPVA 4M8HA 1RKHA 2PIUA 3WT5A 3AZ1A 3VT5A 4S0SA 4KZMA 3B3KA 4LBDA 5IXKA 3ZR7A 4Q0AC 1BSXA 1PRGA 2OUZA 3ADVA 3RUTA 3Q95B 4J5WC 5SYZA 5KCEA 4JAZA 5DZHA 3KMGA 3B0TA 2QA6A 5DWGA 3RLLA 4OIUA 5DRJA 3L3XA 2O4RA 3L1BA 2QABA 5E14A 5ICKA 1R5KA 2IHQA 1S9QA 1ZDTA 3GWXA 4WVDA 5DWIA 5F9BA 2AXAA 3VJSA 5DUHA 3E00A 2ZK1A 3IPSA 4DORA 5HJPB 4QE8A 4YT1A 1YINA 4HEEX 2GP7A 2J7YA 3B1MA 4OILA 5G3JA 1KKQA 1M7WA 2QXMA 3PEQA 1K4WA 5DIEA 1UHLB 2ZLAA 3DZYA 3MNEA 1FCXA 2I0GA 3G9EA 4JL4A 4RFWA 4JYHA 3X31A 3OMMA 2XYXA 5ETHA 5KYAA 3FALA 1XNNA 4BCRA 2QH6A 3R5MA 1G50A 3LBDA 4OKWA 1ZDUA 5DWJA 1RDTA 2REWA 3GYTA 3R8IA 2A3IA 3HC5A 4DQMA 4MG7B 4IVWA 4YMQA 1N4HA 1VJBA 5DZ0A 2AB2A 3ET0A 2AO6A 2P7GA 3VRUA 5K13A 3L3ZA 1NQ1A 5DV6A 2B50A 3FC6A 5B41A 5DX3A 2AYRA 5M96A 3K8SA 4NQAB 1NHZA 1YYEA 1K7LA 5KRIA 2Q5SA 2ABIA 4QK4A 1LBDA 1RKGA 1IE8A 3F5CA 4OZTE 2I4JA 5KD9A 1IE9A 4FHHA 2ZNOA 3KWYA 2GPOA 2R40A 3X1HA 1K74A 3FURA 3WTQA 2QGTA 3ADTA 3DT3A 5DXQA 4K4JA 3V9TA 3KMRA 2B23A 1XDKB 1Y0XX 1KNUA 2BJ4A 3L0JA 3OS8A 3B5RA 2VSTA 4K6IA 3VRWA 3IMYA 3H52A 4E4QA 1LV2A 4OEAA 3OSIA 1YOKA 2Q6SA 2ZNNA 1XV9B 4PF3A 2OVHA 4IW6A 2GWXA 3A9EA 3E7CA 2GIUA 3OMPA 3UUDB 1PQCA 4OEZA 5DVVA 3VT9A 5KCWA 4EMAA 5DKBA 3RVFA 3CWDA 2EWPA 4LNWA 4REFA 3W0JA 1XVPA 5DXEA 5GICA 4DMAA 2QA8A 3VTDA 3WJ4A 5HYKA 4RUOX 3D24A 3V9VA 3KFCA 1YOWA 3GYUA 3OSWA 1FM6D 5AYGA 3TY0A 3CS4A 4PXMA 2Q5GA 2PIRA 4ZNSA 2P4YA 5DRMA 2Q1HA 2P7ZA 2R6YA 4MG8B 4RMEA 2XYWA 2Z4JA 5AWKA 1XQCA 3UUAB 1I7GA 5DXGA 3P8XA 4ZN7A 4IQRA 2FVJA 2HCDA 2GPVA 4LNXA 5E0XA 2Z4BA 3OOKA 1A52A 3OKHA 1GWRA 2HB8A 3CQVA 3OMOA 3VRVA 3H0AD 2JF9A 1T74A 4MGAB 1R6GA 5E15A 3WGPA 1X7EA 1RJKA 2QSEA 2AMBA 3CLDA 4G1ZA 3DY6A 1NAXA 5GIDA 3VHWA 1U3SA 1Z95A 2G44A 2V7CA 3KMZA 3X36A 1P8DA 3A40X 1XLSA 2HASA 3OZJA 3VI8A 5KCUA 3O1EA 5KRLA 2VV4A 5DIGA 3F7DA 3UP3A 5DV3A 5C4TA 5IAWA 4WPFA 5KRKA 3E00D 2ZASA 1I38A 4WQPA 5KROA 2ZXZA 4IA2A 5DWEA 3ZRBA 1YY4A 1GS4A 5E0WA 1T7MA 3HQ5A 4FN9A 4UDBA 1NDEA 2JFAB 3JZCA 3A9EB 4N1YA 5KYJA 5C4UA 3W5TA 2G0GA 4OK1A 4R6SA 5DZ3A 2YLPA 3VT3A 4J5XA 4RMCA 4RZGA 4EM9A 3WT6A 3FS1A 3OMKA 4YPQA 1XVPB 2IOKA 2NV7A 4IA1A 3CTBA 4CI5A 3A78A 1YMTA 4RWVA 1U3RA 4PPSA 5G44A 2Q59A 3NSPA 3WT7A 2P1UA 3FUGA 5AZVA 1FM9A 4OEDA 1T7FA 4J5WA 3B68A 1Y9RA 4E4KA 4PP3A 1Z5XE 4DM8A 4XAOA 1Y0SA 5JY3A 1XP6A 4WLBA 4ZNHA 4S0TA 1PQ9A 1ZH7A 3AN4A 3OLFA 1GWXA 1X76A 5DYDA 4PWLA 3BC5A 1OVLB 3CS6A 2PIXA 4TUZB 5G5WA 1DKFA 1XLSE 3KBAA 5GT4A 5L7HA 3TKMA 1R20D 5EJVA 4CI4A 1DB1A 3D6DA 3D90A 3CS8A 2V0VA 5G45A 2YLOA 2PKLA 5DWLA 2P7AA 1EREA 5HZCA 2P54A 1NRLA 5AAUA 2ACLB 3WWRA 3R2AA 2HFPA 4Q50A 3PCUA 3RY9A 5H1EA 2POBA 2AX8A 1GWQA 5DIDA 3IXPA 2VV3A 3PO9A 2I0JA 5DKEA 1UPWA 5AAVA 2GTKA 2Q6JA 1KV6A 3UU7B 2YFEA 5DMFA 2JJ3A 3AZ2A 3KYTA 4ITEA 3TX7B 4MGDB 3K23A 4OHAA 2AA5A 2QZOA 1NQ7A 2QNVA 3AFRA 4M8EA 5LGAA 2ZMHA 2ZK4A 3CDPA 2PIQA 2ZK3A 2VV1B 2LBDA 2PRGA 1QKUA 2YLQA 5DXBB 3VJIA 4E2JA 3W5QA 2Q60A 3HM1A 3AURA 2YATA 3SP6A 4ZN9A 3UVVA 2HB7A 3GN8A 5DXRA 3BQDA 5DI7A 3ERDA 4OLMA 4FHIA 2B1ZA 3V4AA 4OJBA 3ET3A 3VTCA 4IWFA 5DUGA 3OLLA 3ILZA 4ZNWA 4A4WA 4UDDA 3AUNA 4OH5A 3K22A 1NQ2A 3QT0A 3HVLA 2ZY0A 5DMCA 3V49A 1XAPA 3DZUD 2F4BA 3K6PA 2ZKCA 3ADSA 2AWHA 3PRGA 1DKFB 2YJAB 4OC7A 3FEIA 1FCZA 4IU7A 4XI3A 4PLEA 5KRJA 2NXXA 4Q13A 2J7XA 2P15A 3GBKA 3B67A 5E7VA 2Q61A 5DXPA 4G2IA 3VJHA 5IZ0A 2Q6RA 3VT6A 4RUPA 5L11A 5E1CA 3A2HA 2Q5PA 4LTWA 1SKXA 4ZJWA 3U9QA 3FALB 1G1UA 1PZLA 4OKXA 5AVIA 2OZ7A 2ZVTA 5AK2A 2POGA 1X78A 4ZO1B 1R20A 1XP1A 4FGYA 1N46A 1S0XA 4NY9A 5KRFA 1S0ZA 2XYJA 4MGBA 1M13A 3LMPA 4OH6A 4J26A 4XT9A 4PP5A 4QJRA 5FQRA 1T7TA 2VV2A 5EGVA 4MGCA 5C4SA 4ZNVA 3A2JA 4PPPA 3FC6B 5B5BA 3IPUA 5DX3B 3WFGA 5G42A 3M7RA 5FQPA 3SP9A 4B7WA 2QPYA 5DYBA 3VHUA 4OZRU 4RAKA 5HCVA 2ATHA 4N8RA 4LSJA 1ERRA 3OSAA 4ZO1X 5KRCA 5KCFA 1QKNA 3OS9A 2PNUA 4JYGA 3F5CB 2PITA 1YP0A 4PLDA 1ZEOA 3PLZA 3Q95A 3VN2A 4K7AA 2ZMIA 3W0CA 5L7EA 3DZYD 2NXXE 4WHGA 3VRTA 1MZNA 1P93A 2E2RA 2HWRA 2H79A 4FNEA 2ZBSA 4IA3A 2ZMJA 2BJ4B 4KZJA 4L96A 5E19A 2ZFXA 4DK8A 5KRHA 5DKGA 3KPZA 5DL4A 1N83A 4OZRE 2AA6A 5EC9A 5GIEA 1X7RA 3V3QA 1FBYA 1RK3A 1ZGYA 2PJLA 3IPQA 5CJ6A 5DP0A 3W0YA 5HJPA 2AX9A 3R29A 4KZIA 4DM6A 2YJDA 1OT7A 1T65A 3CDSA 5APJA 5EHJA 1MVCA 4A4VA 1L2JA 3TKCA 2AX6A 1UHLA 1R1KD 4PP6A 4TV1A 2VV0A 5HYRA 3R5NA 4NUFA 3ADWA 1YJEA 2QA8B 4X1FA 5KRAA 2Q7KA 2PIOA 3OLSA 3W0AA 4MG7A 5FQTA 3WMHA 1SQNA 3G8IA 3VHVA 2P1VA 3D57A 3W5PA 1E3KA 3W0HA 3GWSX 3WJ5A 1XQ3A 1PQ6A 1XNXA 3X1IA 2QE4A 4DOSA 2R40D 2QGWA 1K74D 1Q4XA 3A2IA 3AN3A 5DUEA 4OGHA 4JGVA 5JJMA 2QXSA 4NB6A 2AAXA 1T73A 1WM0X 1HJ1A 4R2UA 1I7IA 2GL8A 5DTVA 5DVSA 3ADUA 3B0QA 3NSQA 3PBAA 5DY8A 3FEJA 3HO0A 3SZ1A 2Q1VA 3RUUA 1FM6A 4XUMA 4P6WA 4UDAA 1U3QA 2ZL9A 2W8YA 4OJ4A 3HLVA 4POJA 1T7RA 4IWCA 4QM0A 1UOMA 4IA7A 5LWPA 2I4ZA 3OKIA 3EYBA 3HZFA 1XDKA 1XB7A 3ET2A 5DSHA 4JYIA 3IA6A 3FXVA 2VV4B 1TFCA 2OM9A 2J4AA 4XHDA 1T63A 5FQSA 3S9SA 5KCTA 3H0AA 1XV9A 3R8DA 4MDDA 5I4VA 5KCDA 5G46A 2Q7JA 3UUDA 2AM9A 3V3EA 2ZNPA 3B65A 5L7GA 2OVMA 4IS8A 4PVUA 4RZEA 3ZQTA 2FSZA 3P88A 4IV2A 5G43A 3HODA 4NIEA 4G2HA 4MG9A 4TV1B 1XJ7A 1YA3A 1NQ0A 2QW4A 3BEJA 2ZXMA 1PDUA 2R6WA 5EITA 1XP9A 1YIMA 4L98A 1ZKYA 3OAPA 2O4JA 2Q59B 3WFFA 4YNKA 4OZTU 4N73A 1ZAFA 3AZ3A 5APHA 1SR7A 3B66A 4OJ9A 4MG8A 3FLIA 3UUAA 2G0HA 2ZK6A 3MNPA 4QE6A 4RE8A 1S19A 1U9EA 1R1KA 3G8OA 2P1TA 1S9PA 4XUHA 2PIVA 3DCTA 4OARA 4OEYA 5JJMB 2GPUA 1X7JA 2O9IA 2HARA 3O1DA 5APKA 5AVLA 4MGAA 4IVYA 2J14A 4POHA 2HBHA 5DZIA 1FCYA 3L0EA 3W0IA 1NYXA 4UDCA 1ILHA 3ADXA 3B0WA 3P0UA 3A3ZX 3VSOA 1ZUCA 2ZK5A 3MNOA 1EXAA 1XZXX 3G0WA 5DXMA 3GZ9A 3VJTA 2Q7LA 4PRGA 5EI1A 2PIWA 5AWJA 5HJSA 4HLWA 4IUIA 3OZ0A 3DR1A 3B0RA 2G5OA 3ET1A 4ZOMA 1L2IA 4ITFA 2NPAA 2BAWA 3JZBA 3GD2A 2PIPL 1A28A 3HC6A 4Y29A 3VSPA 1YUCA 3OS8C 5AAVB 5DU5A 3RLJA 5ACCA 3E94A 5C4OA 5KCCA 4R06A 1FM9D 2JFAA 4OIVA 2H77A 2PINA 1OSVA 2OAXA 4RMDA 4ZJRA 3UP0A 3AUQA 1OSHA 2YLYA 4F9MA 2QZOB 4X1GA 4MG6A 3VT7A 2ZNQA 4ONIA 5AZTA 2ZK0A 4G1DA 2FAIA 3D5FA 1NUOA 3V9YA 1HG4A 1G2NA 2OCFA 2HAMA 3OGTA 3OMQA 4MG9B 2ZXNA 3R8AA 1E3GA 4OKBA 5DVCA 1XOWA 3UVVB 1T76A 2I4PA 1I37A 4MG5A 5DKSA 3CJWA 3T03A 1FD0A 2HWQA 4REEA 1T79A 4S15A 1M2ZA 1QKMA 2HVCA 4QL8A 1MV9A 3ZRAA 3W0GA 4ZNUA 4G20A 4P6XA 4OFRA 5JI0D 1T5ZA 4N5GA 1OVLA 4TUZA 3IXPD 2XKWA 4OKTA 2AX7A 1X7BA 3W5RA 1RDTD 1XPCA 3L0LA 2Q7IA 5DK9A 4ZI1A 3OOFA 4A2JA 2NW4A 4J24A 1G5YA 5DV8A 2VSRA 1XIUA 3KDTA 4O8FA 2HC4A 4OFUA 3UUCA 3VT4A 3N00A 2ACLA 3P89A 2QMVA 5A86A 1H9UA 1SJ0A 2QTUA 4XTAA 1QKTA 4G21A 3VT8A 3KDUA 3L03A 4WHFA 2ZK2A 3AX8A 4DK7A 3DZUA 1TXIA 2XHSA 2AA7A 3ERTA 5KR9A 2AMAA 1NAVA 3NOAA 4IW8A 4S14A 2Q70A 3UU7A 4ZNTA 2Q8SA 5KRMA 4RUJA 4RZFA 4XLDA 4APUA 2IOGA 5DZ1A 4MGDA 1PK5A 4MGBB 4CSJA 1Z5XU 5FQVA 5DXKA 2AA2A 2B1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILG A;  2GPP A;  2YHD A;  3DCU A;  2QR9 A;  1PCG A;  2VV1 A;  2Q3Y A;  4IV4 A;  4J5X C;  3VTB A;  1EXX A;  4G1Y A;  2ZLC A;  5DXB A;  5DLR A;  1UPV A;  4M8H A;  1RKH A;  2PIU A;  3WT5 A;  3AZ1 A;  3VT5 A;  4S0S A;  4KZM A;  3B3K A;  4LBD A;  5IXK A;  3ZR7 A;  4Q0A C;  1BSX A;  1PRG A;  2OUZ A;  3ADV A;  3RUT A;  3Q95 B;  4J5W C;  5SYZ A;  5KCE A;  4JAZ A;  5DZH A;  3KMG A;  3B0T A;  2QA6 A;  5DWG A;  3RLL A;  4OIU A;  5DRJ A;  3L3X A;  2O4R A;  3L1B A;  2QAB A;  5E14 A;  5ICK A;  1R5K A;  2IHQ A;  1S9Q A;  1ZDT A;  3GWX A;  4WVD A;  5DWI A;  5F9B A;  2AXA A;  3VJS A;  5DUH A;  3E00 A;  2ZK1 A;  3IPS A;  4DOR A;  5HJP B;  4QE8 A;  4YT1 A;  1YIN A;  4HEE X;  2GP7 A;  2J7Y A;  3B1M A;  4OIL A;  5G3J A;  1KKQ A;  1M7W A;  2QXM A;  3PEQ A;  1K4W A;  5DIE A;  1UHL B;  2ZLA A;  3DZY A;  3MNE A;  1FCX A;  2I0G A;  3G9E A;  4JL4 A;  4RFW A;  4JYH A;  3X31 A;  3OMM A;  2XYX A;  5ETH A;  5KYA A;  3FAL A;  1XNN A;  4BCR A;  2QH6 A;  3R5M A;  1G50 A;  3LBD A;  4OKW A;  1ZDU A;  5DWJ A;  1RDT A;  2REW A;  3GYT A;  3R8I A;  2A3I A;  3HC5 A;  4DQM A;  4MG7 B;  4IVW A;  4YMQ A;  1N4H A;  1VJB A;  5DZ0 A;  2AB2 A;  3ET0 A;  2AO6 A;  2P7G A;  3VRU A;  5K13 A;  3L3Z A;  1NQ1 A;  5DV6 A;  2B50 A;  3FC6 A;  5B41 A;  5DX3 A;  2AYR A;  5M96 A;  3K8S A;  4NQA B;  1NHZ A;  1YYE A;  1K7L A;  5KRI A;  2Q5S A;  2ABI A;  4QK4 A;  1LBD A;  1RKG A;  1IE8 A;  3F5C A;  4OZT E;  2I4J A;  5KD9 A;  1IE9 A;  4FHH A;  2ZNO A;  3KWY A;  2GPO A;  2R40 A;  3X1H A;  1K74 A;  3FUR A;  3WTQ A;  2QGT A;  3ADT A;  3DT3 A;  5DXQ A;  4K4J A;  3V9T A;  3KMR A;  2B23 A;  1XDK B;  1Y0X X;  1KNU A;  2BJ4 A;  3L0J A;  3OS8 A;  3B5R A;  2VST A;  4K6I A;  3VRW A;  3IMY A;  3H52 A;  4E4Q A;  1LV2 A;  4OEA A;  3OSI A;  1YOK A;  2Q6S A;  2ZNN A;  1XV9 B;  4PF3 A;  2OVH A;  4IW6 A;  2GWX A;  3A9E A;  3E7C A;  2GIU A;  3OMP A;  3UUD B;  1PQC A;  4OEZ A;  5DVV A;  3VT9 A;  5KCW A;  4EMA A;  5DKB A;  3RVF A;  3CWD A;  2EWP A;  4LNW A;  4REF A;  3W0J A;  1XVP A;  5DXE A;  5GIC A;  4DMA A;  2QA8 A;  3VTD A;  3WJ4 A;  5HYK A;  4RUO X;  3D24 A;  3V9V A;  3KFC A;  1YOW A;  3GYU A;  3OSW A;  1FM6 D;  5AYG A;  3TY0 A;  3CS4 A;  4PXM A;  2Q5G A;  2PIR A;  4ZNS A;  2P4Y A;  5DRM A;  2Q1H A;  2P7Z A;  2R6Y A;  4MG8 B;  4RME A;  2XYW A;  2Z4J A;  5AWK A;  1XQC A;  3UUA B;  1I7G A;  5DXG A;  3P8X A;  4ZN7 A;  4IQR A;  2FVJ A;  2HCD A;  2GPV A;  4LNX A;  5E0X A;  2Z4B A;  3OOK A;  1A52 A;  3OKH A;  1GWR A;  2HB8 A;  3CQV A;  3OMO A;  3VRV A;  3H0A D;  2JF9 A;  1T74 A;  4MGA B;  1R6G A;  5E15 A;  3WGP A;  1X7E A;  1RJK A;  2QSE A;  2AMB A;  3CLD A;  4G1Z A;  3DY6 A;  1NAX A;  5GID A;  3VHW A;  1U3S A;  1Z95 A;  2G44 A;  2V7C A;  3KMZ A;  3X36 A;  1P8D A;  3A40 X;  1XLS A;  2HAS A;  3OZJ A;  3VI8 A;  5KCU A;  3O1E A;  5KRL A;  2VV4 A;  5DIG A;  3F7D A;  3UP3 A;  5DV3 A;  5C4T A;  5IAW A;  4WPF A;  5KRK A;  3E00 D;  2ZAS A;  1I38 A;  4WQP A;  5KRO A;  2ZXZ A;  4IA2 A;  5DWE A;  3ZRB A;  1YY4 A;  1GS4 A;  5E0W A;  1T7M A;  3HQ5 A;  4FN9 A;  4UDB A;  1NDE A;  2JFA B;  3JZC A;  3A9E B;  4N1Y A;  5KYJ A;  5C4U A;  3W5T A;  2G0G A;  4OK1 A;  4R6S A;  5DZ3 A;  2YLP A;  3VT3 A;  4J5X A;  4RMC A;  4RZG A;  4EM9 A;  3WT6 A;  3FS1 A;  3OMK A;  4YPQ A;  1XVP B;  2IOK A;  2NV7 A;  4IA1 A;  3CTB A;  4CI5 A;  3A78 A;  1YMT A;  4RWV A;  1U3R A;  4PPS A;  5G44 A;  2Q59 A;  3NSP A;  3WT7 A;  2P1U A;  3FUG A;  5AZV A;  1FM9 A;  4OED A;  1T7F A;  4J5W A;  3B68 A;  1Y9R A;  4E4K A;  4PP3 A;  1Z5X E;  4DM8 A;  4XAO A;  1Y0S A;  5JY3 A;  1XP6 A;  4WLB A;  4ZNH A;  4S0T A;  1PQ9 A;  1ZH7 A;  3AN4 A;  3OLF A;  1GWX A;  1X76 A;  5DYD A;  4PWL A;  3BC5 A;  1OVL B;  3CS6 A;  2PIX A;  4TUZ B;  5G5W A;  1DKF A;  1XLS E;  3KBA A;  5GT4 A;  5L7H A;  3TKM A;  1R20 D;  5EJV A;  4CI4 A;  1DB1 A;  3D6D A;  3D90 A;  3CS8 A;  2V0V A;  5G45 A;  2YLO A;  2PKL A;  5DWL A;  2P7A A;  1ERE A;  5HZC A;  2P54 A;  1NRL A;  5AAU A;  2ACL B;  3WWR A;  3R2A A;  2HFP A;  4Q50 A;  3PCU A;  3RY9 A;  5H1E A;  2POB A;  2AX8 A;  1GWQ A;  5DID A;  3IXP A;  2VV3 A;  3PO9 A;  2I0J A;  5DKE A;  1UPW A;  5AAV A;  2GTK A;  2Q6J A;  1KV6 A;  3UU7 B;  2YFE A;  5DMF A;  2JJ3 A;  3AZ2 A;  3KYT A;  4ITE A;  3TX7 B;  4MGD B;  3K23 A;  4OHA A;  2AA5 A;  2QZO A;  1NQ7 A;  2QNV A;  3AFR A;  4M8E A;  5LGA A;  2ZMH A;  2ZK4 A;  3CDP A;  2PIQ A;  2ZK3 A;  2VV1 B;  2LBD A;  2PRG A;  1QKU A;  2YLQ A;  5DXB B;  3VJI A;  4E2J A;  3W5Q A;  2Q60 A;  3HM1 A;  3AUR A;  2YAT A;  3SP6 A;  4ZN9 A;  3UVV A;  2HB7 A;  3GN8 A;  5DXR A;  3BQD A;  5DI7 A;  3ERD A;  4OLM A;  4FHI A;  2B1Z A;  3V4A A;  4OJB A;  3ET3 A;  3VTC A;  4IWF A;  5DUG A;  3OLL A;  3ILZ A;  4ZNW A;  4A4W A;  4UDD A;  3AUN A;  4OH5 A;  3K22 A;  1NQ2 A;  3QT0 A;  3HVL A;  2ZY0 A;  5DMC A;  3V49 A;  1XAP A;  3DZU D;  2F4B A;  3K6P A;  2ZKC A;  3ADS A;  2AWH A;  3PRG A;  1DKF B;  2YJA B;  4OC7 A;  3FEI A;  1FCZ A;  4IU7 A;  4XI3 A;  4PLE A;  5KRJ A;  2NXX A;  4Q13 A;  2J7X A;  2P15 A;  3GBK A;  3B67 A;  5E7V A;  2Q61 A;  5DXP A;  4G2I A;  3VJH A;  5IZ0 A;  2Q6R A;  3VT6 A;  4RUP A;  5L11 A;  5E1C A;  3A2H A;  2Q5P A;  4LTW A;  1SKX A;  4ZJW A;  3U9Q A;  3FAL B;  1G1U A;  1PZL A;  4OKX A;  5AVI A;  2OZ7 A;  2ZVT A;  5AK2 A;  2POG A;  1X78 A;  4ZO1 B;  1R20 A;  1XP1 A;  4FGY A;  1N46 A;  1S0X A;  4NY9 A;  5KRF A;  1S0Z A;  2XYJ A;  4MGB A;  1M13 A;  3LMP A;  4OH6 A;  4J26 A;  4XT9 A;  4PP5 A;  4QJR A;  5FQR A;  1T7T A;  2VV2 A;  5EGV A;  4MGC A;  5C4S A;  4ZNV A;  3A2J A;  4PPP A;  3FC6 B;  5B5B A;  3IPU A;  5DX3 B;  3WFG A;  5G42 A;  3M7R A;  5FQP A;  3SP9 A;  4B7W A;  2QPY A;  5DYB A;  3VHU A;  4OZR U;  4RAK A;  5HCV A;  2ATH A;  4N8R A;  4LSJ A;  1ERR A;  3OSA A;  4ZO1 X;  5KRC A;  5KCF A;  1QKN A;  3OS9 A;  2PNU A;  4JYG A;  3F5C B;  2PIT A;  1YP0 A;  4PLD A;  1ZEO A;  3PLZ A;  3Q95 A;  3VN2 A;  4K7A A;  2ZMI A;  3W0C A;  5L7E A;  3DZY D;  2NXX E;  4WHG A;  3VRT A;  1MZN A;  1P93 A;  2E2R A;  2HWR A;  2H79 A;  4FNE A;  2ZBS A;  4IA3 A;  2ZMJ A;  2BJ4 B;  4KZJ A;  4L96 A;  5E19 A;  2ZFX A;  4DK8 A;  5KRH A;  5DKG A;  3KPZ A;  5DL4 A;  1N83 A;  4OZR E;  2AA6 A;  5EC9 A;  5GIE A;  1X7R A;  3V3Q A;  1FBY A;  1RK3 A;  1ZGY A;  2PJL A;  3IPQ A;  5CJ6 A;  5DP0 A;  3W0Y A;  5HJP A;  2AX9 A;  3R29 A;  4KZI A;  4DM6 A;  2YJD A;  1OT7 A;  1T65 A;  3CDS A;  5APJ A;  5EHJ A;  1MVC A;  4A4V A;  1L2J A;  3TKC A;  2AX6 A;  1UHL A;  1R1K D;  4PP6 A;  4TV1 A;  2VV0 A;  5HYR A;  3R5N A;  4NUF A;  3ADW A;  1YJE A;  2QA8 B;  4X1F A;  5KRA A;  2Q7K A;  2PIO A;  3OLS A;  3W0A A;  4MG7 A;  5FQT A;  3WMH A;  1SQN A;  3G8I A;  3VHV A;  2P1V A;  3D57 A;  3W5P A;  1E3K A;  3W0H A;  3GWS X;  3WJ5 A;  1XQ3 A;  1PQ6 A;  1XNX A;  3X1I A;  2QE4 A;  4DOS A;  2R40 D;  2QGW A;  1K74 D;  1Q4X A;  3A2I A;  3AN3 A;  5DUE A;  4OGH A;  4JGV A;  5JJM A;  2QXS A;  4NB6 A;  2AAX A;  1T73 A;  1WM0 X;  1HJ1 A;  4R2U A;  1I7I A;  2GL8 A;  5DTV A;  5DVS A;  3ADU A;  3B0Q A;  3NSQ A;  3PBA A;  5DY8 A;  3FEJ A;  3HO0 A;  3SZ1 A;  2Q1V A;  3RUU A;  1FM6 A;  4XUM A;  4P6W A;  4UDA A;  1U3Q A;  2ZL9 A;  2W8Y A;  4OJ4 A;  3HLV A;  4POJ A;  1T7R A;  4IWC A;  4QM0 A;  1UOM A;  4IA7 A;  5LWP A;  2I4Z A;  3OKI A;  3EYB A;  3HZF A;  1XDK A;  1XB7 A;  3ET2 A;  5DSH A;  4JYI A;  3IA6 A;  3FXV A;  2VV4 B;  1TFC A;  2OM9 A;  2J4A A;  4XHD A;  1T63 A;  5FQS A;  3S9S A;  5KCT A;  3H0A A;  1XV9 A;  3R8D A;  4MDD A;  5I4V A;  5KCD A;  5G46 A;  2Q7J A;  3UUD A;  2AM9 A;  3V3E A;  2ZNP A;  3B65 A;  5L7G A;  2OVM A;  4IS8 A;  4PVU A;  4RZE A;  3ZQT A;  2FSZ A;  3P88 A;  4IV2 A;  5G43 A;  3HOD A;  4NIE A;  4G2H A;  4MG9 A;  4TV1 B;  1XJ7 A;  1YA3 A;  1NQ0 A;  2QW4 A;  3BEJ A;  2ZXM A;  1PDU A;  2R6W A;  5EIT A;  1XP9 A;  1YIM A;  4L98 A;  1ZKY A;  3OAP A;  2O4J A;  2Q59 B;  3WFF A;  4YNK A;  4OZT U;  4N73 A;  1ZAF A;  3AZ3 A;  5APH A;  1SR7 A;  3B66 A;  4OJ9 A;  4MG8 A;  3FLI A;  3UUA A;  2G0H A;  2ZK6 A;  3MNP A;  4QE6 A;  4RE8 A;  1S19 A;  1U9E A;  1R1K A;  3G8O A;  2P1T A;  1S9P A;  4XUH A;  2PIV A;  3DCT A;  4OAR A;  4OEY A;  5JJM B;  2GPU A;  1X7J A;  2O9I A;  2HAR A;  3O1D A;  5APK A;  5AVL A;  4MGA A;  4IVY A;  2J14 A;  4POH A;  2HBH A;  5DZI A;  1FCY A;  3L0E A;  3W0I A;  1NYX A;  4UDC A;  1ILH A;  3ADX A;  3B0W A;  3P0U A;  3A3Z X;  3VSO A;  1ZUC A;  2ZK5 A;  3MNO A;  1EXA A;  1XZX X;  3G0W A;  5DXM A;  3GZ9 A;  3VJT A;  2Q7L A;  4PRG A;  5EI1 A;  2PIW A;  5AWJ A;  5HJS A;  4HLW A;  4IUI A;  3OZ0 A;  3DR1 A;  3B0R A;  2G5O A;  3ET1 A;  4ZOM A;  1L2I A;  4ITF A;  2NPA A;  2BAW A;  3JZB A;  3GD2 A;  2PIP L;  1A28 A;  3HC6 A;  4Y29 A;  3VSP A;  1YUC A;  3OS8 C;  5AAV B;  5DU5 A;  3RLJ A;  5ACC A;  3E94 A;  5C4O A;  5KCC A;  4R06 A;  1FM9 D;  2JFA A;  4OIV A;  2H77 A;  2PIN A;  1OSV A;  2OAX A;  4RMD A;  4ZJR A;  3UP0 A;  3AUQ A;  1OSH A;  2YLY A;  4F9M A;  2QZO B;  4X1G A;  4MG6 A;  3VT7 A;  2ZNQ A;  4ONI A;  5AZT A;  2ZK0 A;  4G1D A;  2FAI A;  3D5F A;  1NUO A;  3V9Y A;  1HG4 A;  1G2N A;  2OCF A;  2HAM A;  3OGT A;  3OMQ A;  4MG9 B;  2ZXN A;  3R8A A;  1E3G A;  4OKB A;  5DVC A;  1XOW A;  3UVV B;  1T76 A;  2I4P A;  1I37 A;  4MG5 A;  5DKS A;  3CJW A;  3T03 A;  1FD0 A;  2HWQ A;  4REE A;  1T79 A;  4S15 A;  1M2Z A;  1QKM A;  2HVC A;  4QL8 A;  1MV9 A;  3ZRA A;  3W0G A;  4ZNU A;  4G20 A;  4P6X A;  4OFR A;  5JI0 D;  1T5Z A;  4N5G A;  1OVL A;  4TUZ A;  3IXP D;  2XKW A;  4OKT A;  2AX7 A;  1X7B A;  3W5R A;  1RDT D;  1XPC A;  3L0L A;  2Q7I A;  5DK9 A;  4ZI1 A;  3OOF A;  4A2J A;  2NW4 A;  4J24 A;  1G5Y A;  5DV8 A;  2VSR A;  1XIU A;  3KDT A;  4O8F A;  2HC4 A;  4OFU A;  3UUC A;  3VT4 A;  3N00 A;  2ACL A;  3P89 A;  2QMV A;  5A86 A;  1H9U A;  1SJ0 A;  2QTU A;  4XTA A;  1QKT A;  4G21 A;  3VT8 A;  3KDU A;  3L03 A;  4WHF A;  2ZK2 A;  3AX8 A;  4DK7 A;  3DZU A;  1TXI A;  2XHS A;  2AA7 A;  3ERT A;  5KR9 A;  2AMA A;  1NAV A;  3NOA A;  4IW8 A;  4S14 A;  2Q70 A;  3UU7 A;  4ZNT A;  2Q8S A;  5KRM A;  4RUJ A;  4RZF A;  4XLD A;  4APU A;  2IOG A;  5DZ1 A;  4MGD A;  1PK5 A;  4MGB B;  4CSJ A;  1Z5X U;  5FQV A;  5DXK A;  2AA2 A;  2B1V A; 
#chains in the Genus database with same CATH topology
 1ILG A;  2GPP A;  2YHD A;  3DCU A;  2QR9 A;  1PCG A;  2VV1 A;  2Q3Y A;  4IV4 A;  4J5X C;  3VTB A;  1EXX A;  4G1Y A;  2ZLC A;  5DXB A;  5DLR A;  1UPV A;  4M8H A;  1RKH A;  2PIU A;  3WT5 A;  3AZ1 A;  3VT5 A;  4S0S A;  4KZM A;  3B3K A;  4LBD A;  5IXK A;  3ZR7 A;  4Q0A C;  1BSX A;  1PRG A;  2OUZ A;  3ADV A;  3RUT A;  3Q95 B;  4J5W C;  5SYZ A;  5KCE A;  4JAZ A;  5DZH A;  3KMG A;  3B0T A;  2QA6 A;  5DWG A;  3RLL A;  4OIU A;  5DRJ A;  3L3X A;  2O4R A;  3L1B A;  2QAB A;  5E14 A;  5ICK A;  1R5K A;  2IHQ A;  1S9Q A;  1ZDT A;  3GWX A;  4WVD A;  5DWI A;  5F9B A;  2AXA A;  3VJS A;  5DUH A;  3E00 A;  2ZK1 A;  3IPS A;  4DOR A;  5HJP B;  4QE8 A;  4YT1 A;  1YIN A;  4HEE X;  2GP7 A;  2J7Y A;  3B1M A;  4OIL A;  5G3J A;  1KKQ A;  1M7W A;  2QXM A;  3PEQ A;  1K4W A;  5DIE A;  1UHL B;  2ZLA A;  3DZY A;  3MNE A;  1FCX A;  2I0G A;  3G9E A;  4JL4 A;  4RFW A;  4JYH A;  3X31 A;  3OMM A;  2XYX A;  5ETH A;  5KYA A;  3FAL A;  1XNN A;  4BCR A;  2QH6 A;  3R5M A;  1G50 A;  3LBD A;  4OKW A;  1ZDU A;  5DWJ A;  1RDT A;  2REW A;  3GYT A;  3R8I A;  2A3I A;  3HC5 A;  4DQM A;  4MG7 B;  4IVW A;  4YMQ A;  1N4H A;  1VJB A;  5DZ0 A;  2AB2 A;  3ET0 A;  2AO6 A;  2P7G A;  3VRU A;  5K13 A;  3L3Z A;  1NQ1 A;  5DV6 A;  2B50 A;  3FC6 A;  5B41 A;  5DX3 A;  2AYR A;  5M96 A;  3K8S A;  4NQA B;  1NHZ A;  1YYE A;  1K7L A;  5KRI A;  2Q5S A;  2ABI A;  4QK4 A;  1LBD A;  1RKG A;  1IE8 A;  3F5C A;  4OZT E;  2I4J A;  5KD9 A;  1IE9 A;  4FHH A;  2ZNO A;  3KWY A;  2GPO A;  2R40 A;  3X1H A;  1K74 A;  3FUR A;  3WTQ A;  2QGT A;  3ADT A;  3DT3 A;  5DXQ A;  4K4J A;  3V9T A;  3KMR A;  2B23 A;  1XDK B;  1Y0X X;  1KNU A;  2BJ4 A;  3L0J A;  3OS8 A;  3B5R A;  2VST A;  4K6I A;  3VRW A;  3IMY A;  3H52 A;  4E4Q A;  1LV2 A;  4OEA A;  3OSI A;  1YOK A;  2Q6S A;  2ZNN A;  1XV9 B;  4PF3 A;  2OVH A;  4IW6 A;  2GWX A;  3A9E A;  3E7C A;  2GIU A;  3OMP A;  3UUD B;  1PQC A;  4OEZ A;  5DVV A;  3VT9 A;  5KCW A;  4EMA A;  5DKB A;  3RVF A;  3CWD A;  2EWP A;  4LNW A;  4REF A;  3W0J A;  1XVP A;  5DXE A;  5GIC A;  4DMA A;  2QA8 A;  3VTD A;  3WJ4 A;  5HYK A;  4RUO X;  3D24 A;  3V9V A;  3KFC A;  1YOW A;  3GYU A;  3OSW A;  1FM6 D;  5AYG A;  3TY0 A;  3CS4 A;  4PXM A;  2Q5G A;  2PIR A;  4ZNS A;  2P4Y A;  5DRM A;  2Q1H A;  2P7Z A;  2R6Y A;  4MG8 B;  4RME A;  2XYW A;  2Z4J A;  5AWK A;  1XQC A;  3UUA B;  1I7G A;  5DXG A;  3P8X A;  4ZN7 A;  4IQR A;  2FVJ A;  2HCD A;  2GPV A;  4LNX A;  5E0X A;  2Z4B A;  3OOK A;  1A52 A;  3OKH A;  1GWR A;  2HB8 A;  3CQV A;  3OMO A;  3VRV A;  3H0A D;  2JF9 A;  1T74 A;  4MGA B;  1R6G A;  5E15 A;  3WGP A;  1X7E A;  1RJK A;  2QSE A;  2AMB A;  3CLD A;  4G1Z A;  3DY6 A;  1NAX A;  5GID A;  3VHW A;  1U3S A;  1Z95 A;  2G44 A;  2V7C A;  3KMZ A;  3X36 A;  1P8D A;  3A40 X;  1XLS A;  2HAS A;  3OZJ A;  3VI8 A;  5KCU A;  3O1E A;  5KRL A;  2VV4 A;  5DIG A;  3F7D A;  3UP3 A;  5DV3 A;  5C4T A;  5IAW A;  4WPF A;  5KRK A;  3E00 D;  2ZAS A;  1I38 A;  4WQP A;  5KRO A;  2ZXZ A;  4IA2 A;  5DWE A;  3ZRB A;  1YY4 A;  1GS4 A;  5E0W A;  1T7M A;  3HQ5 A;  4FN9 A;  4UDB A;  1NDE A;  2JFA B;  3JZC A;  3A9E B;  4N1Y A;  5KYJ A;  5C4U A;  3W5T A;  2G0G A;  4OK1 A;  4R6S A;  5DZ3 A;  2YLP A;  3VT3 A;  4J5X A;  4RMC A;  4RZG A;  4EM9 A;  3WT6 A;  3FS1 A;  3OMK A;  4YPQ A;  1XVP B;  2IOK A;  2NV7 A;  4IA1 A;  3CTB A;  4CI5 A;  3A78 A;  1YMT A;  4RWV A;  1U3R A;  4PPS A;  5G44 A;  2Q59 A;  3NSP A;  3WT7 A;  2P1U A;  3FUG A;  5AZV A;  1FM9 A;  4OED A;  1T7F A;  4J5W A;  3B68 A;  1Y9R A;  4E4K A;  4PP3 A;  1Z5X E;  4DM8 A;  4XAO A;  1Y0S A;  5JY3 A;  1XP6 A;  4WLB A;  4ZNH A;  4S0T A;  1PQ9 A;  1ZH7 A;  3AN4 A;  3OLF A;  1GWX A;  1X76 A;  5DYD A;  4PWL A;  3BC5 A;  1OVL B;  3CS6 A;  2PIX A;  4TUZ B;  5G5W A;  1DKF A;  1XLS E;  3KBA A;  5GT4 A;  5L7H A;  3TKM A;  1R20 D;  5EJV A;  4CI4 A;  1DB1 A;  3D6D A;  3D90 A;  3CS8 A;  2V0V A;  5G45 A;  2YLO A;  2PKL A;  5DWL A;  2P7A A;  1ERE A;  5HZC A;  2P54 A;  1NRL A;  5AAU A;  2ACL B;  3WWR A;  3R2A A;  2HFP A;  4Q50 A;  3PCU A;  3RY9 A;  5H1E A;  2POB A;  2AX8 A;  1GWQ A;  5DID A;  3IXP A;  2VV3 A;  3PO9 A;  2I0J A;  5DKE A;  1UPW A;  5AAV A;  2GTK A;  2Q6J A;  1KV6 A;  3UU7 B;  2YFE A;  5DMF A;  2JJ3 A;  3AZ2 A;  3KYT A;  4ITE A;  3TX7 B;  4MGD B;  3K23 A;  4OHA A;  2AA5 A;  2QZO A;  1NQ7 A;  2QNV A;  3AFR A;  4M8E A;  5LGA A;  2ZMH A;  2ZK4 A;  3CDP A;  2PIQ A;  2ZK3 A;  2VV1 B;  2LBD A;  2PRG A;  1QKU A;  2YLQ A;  5DXB B;  3VJI A;  4E2J A;  3W5Q A;  2Q60 A;  3HM1 A;  3AUR A;  2YAT A;  3SP6 A;  4ZN9 A;  3UVV A;  2HB7 A;  3GN8 A;  5DXR A;  3BQD A;  5DI7 A;  3ERD A;  4OLM A;  4FHI A;  2B1Z A;  3V4A A;  4OJB A;  3ET3 A;  3VTC A;  4IWF A;  5DUG A;  3OLL A;  3ILZ A;  4ZNW A;  4A4W A;  4UDD A;  3AUN A;  4OH5 A;  3K22 A;  1NQ2 A;  3QT0 A;  3HVL A;  2ZY0 A;  5DMC A;  3V49 A;  1XAP A;  3DZU D;  2F4B A;  3K6P A;  2ZKC A;  3ADS A;  2AWH A;  3PRG A;  1DKF B;  2YJA B;  4OC7 A;  3FEI A;  1FCZ A;  4IU7 A;  4XI3 A;  4PLE A;  5KRJ A;  2NXX A;  4Q13 A;  2J7X A;  2P15 A;  3GBK A;  3B67 A;  5E7V A;  2Q61 A;  5DXP A;  4G2I A;  3VJH A;  5IZ0 A;  2Q6R A;  3VT6 A;  4RUP A;  5L11 A;  5E1C A;  3A2H A;  2Q5P A;  4LTW A;  1SKX A;  4ZJW A;  3U9Q A;  3FAL B;  1G1U A;  1PZL A;  4OKX A;  5AVI A;  2OZ7 A;  2ZVT A;  5AK2 A;  2POG A;  1X78 A;  4ZO1 B;  1R20 A;  1XP1 A;  4FGY A;  1N46 A;  1S0X A;  4NY9 A;  5KRF A;  1S0Z A;  2XYJ A;  4MGB A;  1M13 A;  3LMP A;  4OH6 A;  4J26 A;  4XT9 A;  4PP5 A;  4QJR A;  5FQR A;  1T7T A;  2VV2 A;  5EGV A;  4MGC A;  5C4S A;  4ZNV A;  3A2J A;  4PPP A;  3FC6 B;  5B5B A;  3IPU A;  5DX3 B;  3WFG A;  5G42 A;  3M7R A;  5FQP A;  3SP9 A;  4B7W A;  2QPY A;  5DYB A;  3VHU A;  4OZR U;  4RAK A;  5HCV A;  2ATH A;  4N8R A;  4LSJ A;  1ERR A;  3OSA A;  4ZO1 X;  5KRC A;  5KCF A;  1QKN A;  3OS9 A;  2PNU A;  4JYG A;  3F5C B;  2PIT A;  1YP0 A;  4PLD A;  1ZEO A;  3PLZ A;  3Q95 A;  3VN2 A;  4K7A A;  2ZMI A;  3W0C A;  5L7E A;  3DZY D;  2NXX E;  4WHG A;  3VRT A;  1MZN A;  1P93 A;  2E2R A;  2HWR A;  2H79 A;  4FNE A;  2ZBS A;  4IA3 A;  2ZMJ A;  2BJ4 B;  4KZJ A;  4L96 A;  5E19 A;  2ZFX A;  4DK8 A;  5KRH A;  5DKG A;  3KPZ A;  5DL4 A;  1N83 A;  4OZR E;  2AA6 A;  5EC9 A;  5GIE A;  1X7R A;  3V3Q A;  1FBY A;  1RK3 A;  1ZGY A;  2PJL A;  3IPQ A;  5CJ6 A;  5DP0 A;  3W0Y A;  5HJP A;  2AX9 A;  3R29 A;  4KZI A;  4DM6 A;  2YJD A;  1OT7 A;  1T65 A;  3CDS A;  5APJ A;  5EHJ A;  1MVC A;  4A4V A;  1L2J A;  3TKC A;  2AX6 A;  1UHL A;  1R1K D;  4PP6 A;  4TV1 A;  2VV0 A;  5HYR A;  3R5N A;  4NUF A;  3ADW A;  1YJE A;  2QA8 B;  4X1F A;  5KRA A;  2Q7K A;  2PIO A;  3OLS A;  3W0A A;  4MG7 A;  5FQT A;  3WMH A;  1SQN A;  3G8I A;  3VHV A;  2P1V A;  3D57 A;  3W5P A;  1E3K A;  3W0H A;  3GWS X;  3WJ5 A;  1XQ3 A;  1PQ6 A;  1XNX A;  3X1I A;  2QE4 A;  4DOS A;  2R40 D;  2QGW A;  1K74 D;  1Q4X A;  3A2I A;  3AN3 A;  5DUE A;  4OGH A;  4JGV A;  5JJM A;  2QXS A;  4NB6 A;  2AAX A;  1T73 A;  1WM0 X;  1HJ1 A;  4R2U A;  1I7I A;  2GL8 A;  5DTV A;  5DVS A;  3ADU A;  3B0Q A;  3NSQ A;  3PBA A;  5DY8 A;  3FEJ A;  3HO0 A;  3SZ1 A;  2Q1V A;  3RUU A;  1FM6 A;  4XUM A;  4P6W A;  4UDA A;  1U3Q A;  2ZL9 A;  2W8Y A;  4OJ4 A;  3HLV A;  4POJ A;  1T7R A;  4IWC A;  4QM0 A;  1UOM A;  4IA7 A;  5LWP A;  2I4Z A;  3OKI A;  3EYB A;  3HZF A;  1XDK A;  1XB7 A;  3ET2 A;  5DSH A;  4JYI A;  3IA6 A;  3FXV A;  2VV4 B;  1TFC A;  2OM9 A;  2J4A A;  4XHD A;  1T63 A;  5FQS A;  3S9S A;  5KCT A;  3H0A A;  1XV9 A;  3R8D A;  4MDD A;  5I4V A;  5KCD A;  5G46 A;  2Q7J A;  3UUD A;  2AM9 A;  3V3E A;  2ZNP A;  3B65 A;  5L7G A;  2OVM A;  4IS8 A;  4PVU A;  4RZE A;  3ZQT A;  2FSZ A;  3P88 A;  4IV2 A;  5G43 A;  3HOD A;  4NIE A;  4G2H A;  4MG9 A;  4TV1 B;  1XJ7 A;  1YA3 A;  1NQ0 A;  2QW4 A;  3BEJ A;  2ZXM A;  1PDU A;  2R6W A;  5EIT A;  1XP9 A;  1YIM A;  4L98 A;  1ZKY A;  3OAP A;  2O4J A;  2Q59 B;  3WFF A;  4YNK A;  4OZT U;  4N73 A;  1ZAF A;  3AZ3 A;  5APH A;  1SR7 A;  3B66 A;  4OJ9 A;  4MG8 A;  3FLI A;  3UUA A;  2G0H A;  2ZK6 A;  3MNP A;  4QE6 A;  4RE8 A;  1S19 A;  1U9E A;  1R1K A;  3G8O A;  2P1T A;  1S9P A;  4XUH A;  2PIV A;  3DCT A;  4OAR A;  4OEY A;  5JJM B;  2GPU A;  1X7J A;  2O9I A;  2HAR A;  3O1D A;  5APK A;  5AVL A;  4MGA A;  4IVY A;  2J14 A;  4POH A;  2HBH A;  5DZI A;  1FCY A;  3L0E A;  3W0I A;  1NYX A;  4UDC A;  1ILH A;  3ADX A;  3B0W A;  3P0U A;  3A3Z X;  3VSO A;  1ZUC A;  2ZK5 A;  3MNO A;  1EXA A;  1XZX X;  3G0W A;  5DXM A;  3GZ9 A;  3VJT A;  2Q7L A;  4PRG A;  5EI1 A;  2PIW A;  5AWJ A;  5HJS A;  4HLW A;  4IUI A;  3OZ0 A;  3DR1 A;  3B0R A;  2G5O A;  3ET1 A;  4ZOM A;  1L2I A;  4ITF A;  2NPA A;  2BAW A;  3JZB A;  3GD2 A;  2PIP L;  1A28 A;  3HC6 A;  4Y29 A;  3VSP A;  1YUC A;  3OS8 C;  5AAV B;  5DU5 A;  3RLJ A;  5ACC A;  3E94 A;  5C4O A;  5KCC A;  4R06 A;  1FM9 D;  2JFA A;  4OIV A;  2H77 A;  2PIN A;  1OSV A;  2OAX A;  4RMD A;  4ZJR A;  3UP0 A;  3AUQ A;  1OSH A;  2YLY A;  4F9M A;  2QZO B;  4X1G A;  4MG6 A;  3VT7 A;  2ZNQ A;  4ONI A;  5AZT A;  2ZK0 A;  4G1D A;  2FAI A;  3D5F A;  1NUO A;  3V9Y A;  1HG4 A;  1G2N A;  2OCF A;  2HAM A;  3OGT A;  3OMQ A;  4MG9 B;  2ZXN A;  3R8A A;  1E3G A;  4OKB A;  5DVC A;  1XOW A;  3UVV B;  1T76 A;  2I4P A;  1I37 A;  4MG5 A;  5DKS A;  3CJW A;  3T03 A;  1FD0 A;  2HWQ A;  4REE A;  1T79 A;  4S15 A;  1M2Z A;  1QKM A;  2HVC A;  4QL8 A;  1MV9 A;  3ZRA A;  3W0G A;  4ZNU A;  4G20 A;  4P6X A;  4OFR A;  5JI0 D;  1T5Z A;  4N5G A;  1OVL A;  4TUZ A;  3IXP D;  2XKW A;  4OKT A;  2AX7 A;  1X7B A;  3W5R A;  1RDT D;  1XPC A;  3L0L A;  2Q7I A;  5DK9 A;  4ZI1 A;  3OOF A;  4A2J A;  2NW4 A;  4J24 A;  1G5Y A;  5DV8 A;  2VSR A;  1XIU A;  3KDT A;  4O8F A;  2HC4 A;  4OFU A;  3UUC A;  3VT4 A;  3N00 A;  2ACL A;  3P89 A;  2QMV A;  5A86 A;  1H9U A;  1SJ0 A;  2QTU A;  4XTA A;  1QKT A;  4G21 A;  3VT8 A;  3KDU A;  3L03 A;  4WHF A;  2ZK2 A;  3AX8 A;  4DK7 A;  3DZU A;  1TXI A;  2XHS A;  2AA7 A;  3ERT A;  5KR9 A;  2AMA A;  1NAV A;  3NOA A;  4IW8 A;  4S14 A;  2Q70 A;  3UU7 A;  4ZNT A;  2Q8S A;  5KRM A;  4RUJ A;  4RZF A;  4XLD A;  4APU A;  2IOG A;  5DZ1 A;  4MGD A;  1PK5 A;  4MGB B;  4CSJ A;  1Z5X U;  5FQV A;  5DXK A;  2AA2 A;  2B1V A; 
#chains in the Genus database with same CATH homology
 1ILG A;  2GPP A;  2YHD A;  3DCU A;  2QR9 A;  1PCG A;  2VV1 A;  2Q3Y A;  4IV4 A;  4J5X C;  3VTB A;  1EXX A;  4G1Y A;  2ZLC A;  5DXB A;  5DLR A;  1UPV A;  4M8H A;  1RKH A;  2PIU A;  3WT5 A;  3AZ1 A;  3VT5 A;  4S0S A;  4KZM A;  3B3K A;  4LBD A;  5IXK A;  3ZR7 A;  4Q0A C;  1BSX A;  1PRG A;  2OUZ A;  3ADV A;  3RUT A;  3Q95 B;  4J5W C;  5SYZ A;  5KCE A;  4JAZ A;  5DZH A;  3KMG A;  3B0T A;  2QA6 A;  5DWG A;  3RLL A;  4OIU A;  5DRJ A;  3L3X A;  2O4R A;  3L1B A;  2QAB A;  5E14 A;  5ICK A;  1R5K A;  2IHQ A;  1S9Q A;  1ZDT A;  3GWX A;  4WVD A;  5DWI A;  5F9B A;  2AXA A;  3VJS A;  5DUH A;  3E00 A;  2ZK1 A;  3IPS A;  4DOR A;  5HJP B;  4QE8 A;  4YT1 A;  1YIN A;  4HEE X;  2GP7 A;  2J7Y A;  3B1M A;  4OIL A;  5G3J A;  1KKQ A;  1M7W A;  2QXM A;  3PEQ A;  1K4W A;  5DIE A;  1UHL B;  2ZLA A;  3DZY A;  3MNE A;  1FCX A;  2I0G A;  3G9E A;  4JL4 A;  4RFW A;  4JYH A;  3X31 A;  3OMM A;  2XYX A;  5ETH A;  5KYA A;  3FAL A;  1XNN A;  4BCR A;  2QH6 A;  3R5M A;  1G50 A;  3LBD A;  4OKW A;  1ZDU A;  5DWJ A;  1RDT A;  2REW A;  3GYT A;  3R8I A;  2A3I A;  3HC5 A;  4DQM A;  4MG7 B;  4IVW A;  4YMQ A;  1N4H A;  1VJB A;  5DZ0 A;  2AB2 A;  3ET0 A;  2AO6 A;  2P7G A;  3VRU A;  5K13 A;  3L3Z A;  1NQ1 A;  5DV6 A;  2B50 A;  3FC6 A;  5B41 A;  5DX3 A;  2AYR A;  5M96 A;  3K8S A;  4NQA B;  1NHZ A;  1YYE A;  1K7L A;  5KRI A;  2Q5S A;  2ABI A;  4QK4 A;  1LBD A;  1RKG A;  1IE8 A;  3F5C A;  4OZT E;  2I4J A;  5KD9 A;  1IE9 A;  4FHH A;  2ZNO A;  3KWY A;  2GPO A;  2R40 A;  3X1H A;  1K74 A;  3FUR A;  3WTQ A;  2QGT A;  3ADT A;  3DT3 A;  5DXQ A;  4K4J A;  3V9T A;  3KMR A;  2B23 A;  1XDK B;  1Y0X X;  1KNU A;  2BJ4 A;  3L0J A;  3OS8 A;  3B5R A;  2VST A;  4K6I A;  3VRW A;  3IMY A;  3H52 A;  4E4Q A;  1LV2 A;  4OEA A;  3OSI A;  1YOK A;  2Q6S A;  2ZNN A;  1XV9 B;  4PF3 A;  2OVH A;  4IW6 A;  2GWX A;  3A9E A;  3E7C A;  2GIU A;  3OMP A;  3UUD B;  1PQC A;  4OEZ A;  5DVV A;  3VT9 A;  5KCW A;  4EMA A;  5DKB A;  3RVF A;  3CWD A;  2EWP A;  4LNW A;  4REF A;  3W0J A;  1XVP A;  5DXE A;  5GIC A;  4DMA A;  2QA8 A;  3VTD A;  3WJ4 A;  5HYK A;  4RUO X;  3D24 A;  3V9V A;  3KFC A;  1YOW A;  3GYU A;  3OSW A;  1FM6 D;  5AYG A;  3TY0 A;  3CS4 A;  4PXM A;  2Q5G A;  2PIR A;  4ZNS A;  2P4Y A;  5DRM A;  2Q1H A;  2P7Z A;  2R6Y A;  4MG8 B;  4RME A;  2XYW A;  2Z4J A;  5AWK A;  1XQC A;  3UUA B;  1I7G A;  5DXG A;  3P8X A;  4ZN7 A;  4IQR A;  2FVJ A;  2HCD A;  2GPV A;  4LNX A;  5E0X A;  2Z4B A;  3OOK A;  1A52 A;  3OKH A;  1GWR A;  2HB8 A;  3CQV A;  3OMO A;  3VRV A;  3H0A D;  2JF9 A;  1T74 A;  4MGA B;  1R6G A;  5E15 A;  3WGP A;  1X7E A;  1RJK A;  2QSE A;  2AMB A;  3CLD A;  4G1Z A;  3DY6 A;  1NAX A;  5GID A;  3VHW A;  1U3S A;  1Z95 A;  2G44 A;  2V7C A;  3KMZ A;  3X36 A;  1P8D A;  3A40 X;  1XLS A;  2HAS A;  3OZJ A;  3VI8 A;  5KCU A;  3O1E A;  5KRL A;  2VV4 A;  5DIG A;  3F7D A;  3UP3 A;  5DV3 A;  5C4T A;  5IAW A;  4WPF A;  5KRK A;  3E00 D;  2ZAS A;  1I38 A;  4WQP A;  5KRO A;  2ZXZ A;  4IA2 A;  5DWE A;  3ZRB A;  1YY4 A;  1GS4 A;  5E0W A;  1T7M A;  3HQ5 A;  4FN9 A;  4UDB A;  1NDE A;  2JFA B;  3JZC A;  3A9E B;  4N1Y A;  5KYJ A;  5C4U A;  3W5T A;  2G0G A;  4OK1 A;  4R6S A;  5DZ3 A;  2YLP A;  3VT3 A;  4J5X A;  4RMC A;  4RZG A;  4EM9 A;  3WT6 A;  3FS1 A;  3OMK A;  4YPQ A;  1XVP B;  2IOK A;  2NV7 A;  4IA1 A;  3CTB A;  4CI5 A;  3A78 A;  1YMT A;  4RWV A;  1U3R A;  4PPS A;  5G44 A;  2Q59 A;  3NSP A;  3WT7 A;  2P1U A;  3FUG A;  5AZV A;  1FM9 A;  4OED A;  1T7F A;  4J5W A;  3B68 A;  1Y9R A;  4E4K A;  4PP3 A;  1Z5X E;  4DM8 A;  4XAO A;  1Y0S A;  5JY3 A;  1XP6 A;  4WLB A;  4ZNH A;  4S0T A;  1PQ9 A;  1ZH7 A;  3AN4 A;  3OLF A;  1GWX A;  1X76 A;  5DYD A;  4PWL A;  3BC5 A;  1OVL B;  3CS6 A;  2PIX A;  4TUZ B;  5G5W A;  1DKF A;  1XLS E;  3KBA A;  5GT4 A;  5L7H A;  3TKM A;  1R20 D;  5EJV A;  4CI4 A;  1DB1 A;  3D6D A;  3D90 A;  3CS8 A;  2V0V A;  5G45 A;  2YLO A;  2PKL A;  5DWL A;  2P7A A;  1ERE A;  5HZC A;  2P54 A;  1NRL A;  5AAU A;  2ACL B;  3WWR A;  3R2A A;  2HFP A;  4Q50 A;  3PCU A;  3RY9 A;  5H1E A;  2POB A;  2AX8 A;  1GWQ A;  5DID A;  3IXP A;  2VV3 A;  3PO9 A;  2I0J A;  5DKE A;  1UPW A;  5AAV A;  2GTK A;  2Q6J A;  1KV6 A;  3UU7 B;  2YFE A;  5DMF A;  2JJ3 A;  3AZ2 A;  3KYT A;  4ITE A;  3TX7 B;  4MGD B;  3K23 A;  4OHA A;  2AA5 A;  2QZO A;  1NQ7 A;  2QNV A;  3AFR A;  4M8E A;  5LGA A;  2ZMH A;  2ZK4 A;  3CDP A;  2PIQ A;  2ZK3 A;  2VV1 B;  2LBD A;  2PRG A;  1QKU A;  2YLQ A;  5DXB B;  3VJI A;  4E2J A;  3W5Q A;  2Q60 A;  3HM1 A;  3AUR A;  2YAT A;  3SP6 A;  4ZN9 A;  3UVV A;  2HB7 A;  3GN8 A;  5DXR A;  3BQD A;  5DI7 A;  3ERD A;  4OLM A;  4FHI A;  2B1Z A;  3V4A A;  4OJB A;  3ET3 A;  3VTC A;  4IWF A;  5DUG A;  3OLL A;  3ILZ A;  4ZNW A;  4A4W A;  4UDD A;  3AUN A;  4OH5 A;  3K22 A;  1NQ2 A;  3QT0 A;  3HVL A;  2ZY0 A;  5DMC A;  3V49 A;  1XAP A;  3DZU D;  2F4B A;  3K6P A;  2ZKC A;  3ADS A;  2AWH A;  3PRG A;  1DKF B;  2YJA B;  4OC7 A;  3FEI A;  1FCZ A;  4IU7 A;  4XI3 A;  4PLE A;  5KRJ A;  2NXX A;  4Q13 A;  2J7X A;  2P15 A;  3GBK A;  3B67 A;  5E7V A;  2Q61 A;  5DXP A;  4G2I A;  3VJH A;  5IZ0 A;  2Q6R A;  3VT6 A;  4RUP A;  5L11 A;  5E1C A;  3A2H A;  2Q5P A;  4LTW A;  1SKX A;  4ZJW A;  3U9Q A;  3FAL B;  1G1U A;  1PZL A;  4OKX A;  5AVI A;  2OZ7 A;  2ZVT A;  5AK2 A;  2POG A;  1X78 A;  4ZO1 B;  1R20 A;  1XP1 A;  4FGY A;  1N46 A;  1S0X A;  4NY9 A;  5KRF A;  1S0Z A;  2XYJ A;  4MGB A;  1M13 A;  3LMP A;  4OH6 A;  4J26 A;  4XT9 A;  4PP5 A;  4QJR A;  5FQR A;  1T7T A;  2VV2 A;  5EGV A;  4MGC A;  5C4S A;  4ZNV A;  3A2J A;  4PPP A;  3FC6 B;  5B5B A;  3IPU A;  5DX3 B;  3WFG A;  5G42 A;  3M7R A;  5FQP A;  3SP9 A;  4B7W A;  2QPY A;  5DYB A;  3VHU A;  4OZR U;  4RAK A;  5HCV A;  2ATH A;  4N8R A;  4LSJ A;  1ERR A;  3OSA A;  4ZO1 X;  5KRC A;  5KCF A;  1QKN A;  3OS9 A;  2PNU A;  4JYG A;  3F5C B;  2PIT A;  1YP0 A;  4PLD A;  1ZEO A;  3PLZ A;  3Q95 A;  3VN2 A;  4K7A A;  2ZMI A;  3W0C A;  5L7E A;  3DZY D;  2NXX E;  4WHG A;  3VRT A;  1MZN A;  1P93 A;  2E2R A;  2HWR A;  2H79 A;  4FNE A;  2ZBS A;  4IA3 A;  2ZMJ A;  2BJ4 B;  4KZJ A;  4L96 A;  5E19 A;  2ZFX A;  4DK8 A;  5KRH A;  5DKG A;  3KPZ A;  5DL4 A;  1N83 A;  4OZR E;  2AA6 A;  5EC9 A;  5GIE A;  1X7R A;  3V3Q A;  1FBY A;  1RK3 A;  1ZGY A;  2PJL A;  3IPQ A;  5CJ6 A;  5DP0 A;  3W0Y A;  5HJP A;  2AX9 A;  3R29 A;  4KZI A;  4DM6 A;  2YJD A;  1OT7 A;  1T65 A;  3CDS A;  5APJ A;  5EHJ A;  1MVC A;  4A4V A;  1L2J A;  3TKC A;  2AX6 A;  1UHL A;  1R1K D;  4PP6 A;  4TV1 A;  2VV0 A;  5HYR A;  3R5N A;  4NUF A;  3ADW A;  1YJE A;  2QA8 B;  4X1F A;  5KRA A;  2Q7K A;  2PIO A;  3OLS A;  3W0A A;  4MG7 A;  5FQT A;  3WMH A;  1SQN A;  3G8I A;  3VHV A;  2P1V A;  3D57 A;  3W5P A;  1E3K A;  3W0H A;  3GWS X;  3WJ5 A;  1XQ3 A;  1PQ6 A;  1XNX A;  3X1I A;  2QE4 A;  4DOS A;  2R40 D;  2QGW A;  1K74 D;  1Q4X A;  3A2I A;  3AN3 A;  5DUE A;  4OGH A;  4JGV A;  5JJM A;  2QXS A;  4NB6 A;  2AAX A;  1T73 A;  1WM0 X;  1HJ1 A;  4R2U A;  1I7I A;  2GL8 A;  5DTV A;  5DVS A;  3ADU A;  3B0Q A;  3NSQ A;  3PBA A;  5DY8 A;  3FEJ A;  3HO0 A;  3SZ1 A;  2Q1V A;  3RUU A;  1FM6 A;  4XUM A;  4P6W A;  4UDA A;  1U3Q A;  2ZL9 A;  2W8Y A;  4OJ4 A;  3HLV A;  4POJ A;  1T7R A;  4IWC A;  4QM0 A;  1UOM A;  4IA7 A;  5LWP A;  2I4Z A;  3OKI A;  3EYB A;  3HZF A;  1XDK A;  1XB7 A;  3ET2 A;  5DSH A;  4JYI A;  3IA6 A;  3FXV A;  2VV4 B;  1TFC A;  2OM9 A;  2J4A A;  4XHD A;  1T63 A;  5FQS A;  3S9S A;  5KCT A;  3H0A A;  1XV9 A;  3R8D A;  4MDD A;  5I4V A;  5KCD A;  5G46 A;  2Q7J A;  3UUD A;  2AM9 A;  3V3E A;  2ZNP A;  3B65 A;  5L7G A;  2OVM A;  4IS8 A;  4PVU A;  4RZE A;  3ZQT A;  2FSZ A;  3P88 A;  4IV2 A;  5G43 A;  3HOD A;  4NIE A;  4G2H A;  4MG9 A;  4TV1 B;  1XJ7 A;  1YA3 A;  1NQ0 A;  2QW4 A;  3BEJ A;  2ZXM A;  1PDU A;  2R6W A;  5EIT A;  1XP9 A;  1YIM A;  4L98 A;  1ZKY A;  3OAP A;  2O4J A;  2Q59 B;  3WFF A;  4YNK A;  4OZT U;  4N73 A;  1ZAF A;  3AZ3 A;  5APH A;  1SR7 A;  3B66 A;  4OJ9 A;  4MG8 A;  3FLI A;  3UUA A;  2G0H A;  2ZK6 A;  3MNP A;  4QE6 A;  4RE8 A;  1S19 A;  1U9E A;  1R1K A;  3G8O A;  2P1T A;  1S9P A;  4XUH A;  2PIV A;  3DCT A;  4OAR A;  4OEY A;  5JJM B;  2GPU A;  1X7J A;  2O9I A;  2HAR A;  3O1D A;  5APK A;  5AVL A;  4MGA A;  4IVY A;  2J14 A;  4POH A;  2HBH A;  5DZI A;  1FCY A;  3L0E A;  3W0I A;  1NYX A;  4UDC A;  1ILH A;  3ADX A;  3B0W A;  3P0U A;  3A3Z X;  3VSO A;  1ZUC A;  2ZK5 A;  3MNO A;  1EXA A;  1XZX X;  3G0W A;  5DXM A;  3GZ9 A;  3VJT A;  2Q7L A;  4PRG A;  5EI1 A;  2PIW A;  5AWJ A;  5HJS A;  4HLW A;  4IUI A;  3OZ0 A;  3DR1 A;  3B0R A;  2G5O A;  3ET1 A;  4ZOM A;  1L2I A;  4ITF A;  2NPA A;  2BAW A;  3JZB A;  3GD2 A;  2PIP L;  1A28 A;  3HC6 A;  4Y29 A;  3VSP A;  1YUC A;  3OS8 C;  5AAV B;  5DU5 A;  3RLJ A;  5ACC A;  3E94 A;  5C4O A;  5KCC A;  4R06 A;  1FM9 D;  2JFA A;  4OIV A;  2H77 A;  2PIN A;  1OSV A;  2OAX A;  4RMD A;  4ZJR A;  3UP0 A;  3AUQ A;  1OSH A;  2YLY A;  4F9M A;  2QZO B;  4X1G A;  4MG6 A;  3VT7 A;  2ZNQ A;  4ONI A;  5AZT A;  2ZK0 A;  4G1D A;  2FAI A;  3D5F A;  1NUO A;  3V9Y A;  1HG4 A;  1G2N A;  2OCF A;  2HAM A;  3OGT A;  3OMQ A;  4MG9 B;  2ZXN A;  3R8A A;  1E3G A;  4OKB A;  5DVC A;  1XOW A;  3UVV B;  1T76 A;  2I4P A;  1I37 A;  4MG5 A;  5DKS A;  3CJW A;  3T03 A;  1FD0 A;  2HWQ A;  4REE A;  1T79 A;  4S15 A;  1M2Z A;  1QKM A;  2HVC A;  4QL8 A;  1MV9 A;  3ZRA A;  3W0G A;  4ZNU A;  4G20 A;  4P6X A;  4OFR A;  5JI0 D;  1T5Z A;  4N5G A;  1OVL A;  4TUZ A;  3IXP D;  2XKW A;  4OKT A;  2AX7 A;  1X7B A;  3W5R A;  1RDT D;  1XPC A;  3L0L A;  2Q7I A;  5DK9 A;  4ZI1 A;  3OOF A;  4A2J A;  2NW4 A;  4J24 A;  1G5Y A;  5DV8 A;  2VSR A;  1XIU A;  3KDT A;  4O8F A;  2HC4 A;  4OFU A;  3UUC A;  3VT4 A;  3N00 A;  2ACL A;  3P89 A;  2QMV A;  5A86 A;  1H9U A;  1SJ0 A;  2QTU A;  4XTA A;  1QKT A;  4G21 A;  3VT8 A;  3KDU A;  3L03 A;  4WHF A;  2ZK2 A;  3AX8 A;  4DK7 A;  3DZU A;  1TXI A;  2XHS A;  2AA7 A;  3ERT A;  5KR9 A;  2AMA A;  1NAV A;  3NOA A;  4IW8 A;  4S14 A;  2Q70 A;  3UU7 A;  4ZNT A;  2Q8S A;  5KRM A;  4RUJ A;  4RZF A;  4XLD A;  4APU A;  2IOG A;  5DZ1 A;  4MGD A;  1PK5 A;  4MGB B;  4CSJ A;  1Z5X U;  5FQV A;  5DXK A;  2AA2 A;  2B1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...