5M96A

Synthesis and biological evaluation of new triazolo and imidazolopyridine rorgt inverse agonists
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
225
structure length
225
Chain Sequence
ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Nuclear receptor ROR-gamma
publication title Synthesis and Biological Evaluation of New Triazolo- and Imidazolopyridine ROR gamma t Inverse Agonists.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5m96A00
1R5KA 4J5XC 3EYBA 1NQ1A 1NQ0A 2AX9A 3RY9A 1P8DA 4N1YA 3W0JA 3V3EA 1IE9A 3VRWA 2Z4JA 1OVLA 3VHVA 3R8DA 4QL8A 5HCVA 2QNVA 2JJ3A 2BJ4A 3RUTA 3HO0A 1X7JA 2I4JA 1OVLB 4FNEA 4ZNUA 3OOKA 2BJ4B 3LMPA 5G44A 3NSPA 5GIDA 2PINA 4LNXA 1E3GA 4QJRA 4RZEA 5E7VA 5AAVB 4DQMA 3IMYA 3WJ4A 1YJEA 4OEZA 1I7GA 5DKEA 2GPOA 2AXAA 1ZEOA 4OEYA 1PK5A 2IHQA 4NY9A 1T5ZA 5DV8A 2VSTA 2ZK1A 3OSAA 1FBYA 2P1VA 3KDUA 4Q0AC 3K6PA 5DP0A 3V4AA 1XAPA 3OMQA 4MG9A 2AA7A 3AZ3A 2QMVA 4IW8A 4RMEA 5DVCA 4G1DA 1TXIA 1G1UA 3W0HA 2OAXA 2B1ZA 2GTKA 3Q95A 4MGDA 1FCYA 4OZTE 3FEJA 4PWLA 4IVWA 3E00A 1I7IA 3KWYA 2AO6A 4PPPA 1FD0A 5KRAA 3VT7A 3ET1A 3K22A 3Q95B 4RUOX 4MGDB 5DKGA 3B66A 3TX7B 3H52A 2IOGA 2OCFA 2A3IA 3CDPA 2AMAA 5IAWA 4WPFA 4DK7A 2VSRA 5DXGA 4CI5A 1YOKA 2ZLAA 3FLIA 3G9EA 3VN2A 3CJWA 2FVJA 3BQDA 3VHUA 4E2JA 2QA8A 4A4WA 1P93A 2XYWA 2AM9A 3AUQA 1Y0SA 5DYBA 4J24A 1XQ3A 3KDTA 5EGVA 3VSPA 1ILGA 2P7GA 5DIGA 4YNKA 3PEQA 2Q60A 1NQ2A 1FM6D 2QA8B 5DL4A 4JYGA 1RDTA 2NW4A 4S14A 4P6WA 4RUJA 4JYIA 4OFRA 2YLYA 5SYZA 1FM9D 2JFAA 3VI8A 2O4RA 3ZQTA 1SQNA 3K23A 2VV4A 5APHA 5C4TA 5L11A 2QW4A 4POHA 4E4KA 5AVIA 5GIEA 4MGBA 2JFAB 4FGYA 2VV2A 3L3ZA 5G43A 3AZ1A 2QA6A 5H1EA 5HJPA 3P89A 4MGBB 4HEEX 5KD9A 3A40X 3B68A 4WQPA 3W0CA 3UU7A 5JJMA 2AX8A 1X7RA 2ZXZA 5HJPB 3KFCA 2POBA 5FQVA 4K7AA 5G5WA 5AZVA 3AZ2A 3BEJA 4EM9A 1S9PA 2JF9A 3UU7B 5JJMB 2J7YA 1N4HA 1XNXA 4FN9A 1ZGYA 5DVVA 5KCEA 3U9QA 4IW6A 5DLRA 4ZOMA 1U3SA 3CWDA 2ZKCA 1SKXA 3CQVA 3GD2A 5G46A 3AX8A 3X1HA 4J26A 2AB2A 1XIUA 2ZMJA 3DY6A 3WT7A 4OZRU 4DOSA 2QE4A 2H77A 1S9QA 1L2JA 4PF3A 3F5CA 1R1KA 5KRLA 4ZJRA 3OLLA 2HB7A 5DUEA 2GL8A 3CTBA 3N00A 3BC5A 1ZAFA 4ZO1B 2P7ZA 3F5CB 4HLWA 3KYTA 5JY3A 2QTUA 1XJ7A 3GN8A 4FHHA 4Q50A 4G20A 2PIWA 3PO9A 5DUGA 5LWPA 4TUZA 2NV7A 2PIOA 5DZ3A 1XV9B 3ILZA 4J5XA 5B5BA 1K74D 4OKBA 4IV2A 5AK2A 2NXXA 3WTQA 1T63A 2Q6SA 4Y29A 2P1UA 1KV6A 4MGAA 4IA3A 5AZTA 3CS4A 4QM0A 1Z5XE 2QXSA 4G1ZA 1R20D 1YIMA 4NB6A 3WT5A 1S0ZA 1KKQA 2GPUA 2IOKA 4MGAB 5KRCA 3R29A 3D24A 4JGVA 2ZK2A 4OK1A 5DMFA 1XOWA 4IWFA 1ILHA 2Q1HA 5AYGA 3PCUA 5LGAA 3OKIA 2EWPA 4IU7A 4OH5A 5DI7A 1FM9A 5DXBA 2I4PA 3B0TA 4OH6A 3E94A 5IXKA 1XNNA 5A86A 3FXVA 1XB7A 3IXPD 1E3KA 3OMKA 3UUAA 3UP3A 3HM1A 3OSWA 2B50A 4R6SA 5DK9A 5DXBB 5GICA 2ZL9A 1X76A 3NOAA 5AAVA 4MGCA 4IA1A 3OLFA 3VRTA 5AWKA 3B1MA 5DMCA 4OFUA 3UUAB 3KPZA 3V49A 4XI3A 2ZNOA 3W0AA 3DZUD 3HQ5A 2I4ZA 1RKGA 2ATHA 1HJ1A 1XP6A 2V7CA 4OKTA 3RLLA 5KRHA 5KCWA 1XLSA 1EXXA 2V0VA 5APKA 4XTAA 5DWJA 2QPYA 2ZVTA 1XDKA 3SP6A 2ZY0A 1BSXA 4O8FA 1GWRA 1GWQA 1MV9A 3ADWA 3ET2A 3H0AD 4S0SA 1M2ZA 2HWRA 1H9UA 2QSEA 1U9EA 2AA6A 4PP5A 1XDKB 1LBDA 2Q5GA 1X78A 3B0WA 5G42A 4KZIA 5AWJA 4RMCA 5C4UA 3VRUA 2YLPA 3FURA 1XQCA 4KZJA 1Z95A 3AURA 1ZDTA 3B65A 3D5FA 5CJ6A 1U3RA 2PJLA 1M7WA 1FCXA 4WHFA 5DKSA 1RK3A 2G44A 3ADXA 3KBAA 5FQRA 5DWGA 3ET3A 1X7BA 4OILA 1K4WA 4N73A 1OT7A 2AA2A 1PQ9A 3OOFA 2AX6A 1G5YA 4QK4A 5DV3A 1I38A 2P15A 3IPSA 3HC6A 4RE8A 3DCUA 3W5PA 5DXRA 2GIUA 2HWQA 4J5WC 1QKUA 1M13A 1K74A 4B7WA 2AWHA 4R2UA 2HC4A 2F4BA 3FS1A 2O9IA 4G2IA 3VRVA 3W0GA 1T7RA 1PQ6A 3KMRA 5I4VA 3HVLA 3R2AA 2Q61A 1NAVA 2AX7A 1Y0XX 1DKFA 2YJAB 5DX3A 3A2HA 3WFFA 3M7RA 2ZMHA 3P8XA 5AVLA 4ONIA 4JAZA 3CS8A 3A3ZX 3L3XA 1DKFB 1YMTA 4PRGA 5DWLA 5DX3B 1YOWA 4A2JA 1T65A 3CDSA 4ITEA 4L98A 1YYEA 3LBDA 2Q5PA 4A4VA 5KRFA 1PRGA 3CLDA 3CS6A 3ADTA 3VHWA 5E1CA 3WMHA 4E4QA 3V9TA 1EXAA 2POGA 3IXPA 4M8HA 2J4AA 3ADUA 5ICKA 4IV4A 5DZHA 5M96A 1QKMA 3PRGA 5EJVA 4OARA 3WJ5A 2ZNQA 3JZBA 3HZFA 2FSZA 3A78A 2E2RA 1U3QA 2OM9A 4YMQA 3K8SA 5DXKA 4OJ4A 2QZOA 4X1FA 3ZRAA 4DK8A 5F9BA 1YP0A 1GS4A 3D90A 1XP1A 3OMPA 4WHGA 4XHDA 3HC5A 3IA6A 5KRMA 5KROA 5KCUA 1NYXA 2QZOB 1Z5XU 2GPVA 3OLSA 2Q3YA 3H0AA 2ZXNA 3FC6B 2XYJA 1SJ0A 1ERRA 2OUZA 2QR9A 5IZ0A 3ZR7A 1I37A 2ZK4A 1PQCA 4OIUA 4QE6A 2P7AA 3D57A 5FQSA 1HG4A 4P6XA 5DXPA 4PP6A 5EHJA 3A2JA 3TKMA 1ZDUA 3W5TA 5DWIA 1XV9A 4DM6A 3A9EA 4RMDA 1S0XA 2ABIA 4OKWA 5DXQA 1XPCA 4NQAB 2PIUA 4REEA 5DIDA 1G50A 3GWSX 4XUMA 5HYRA 3OS8C 3B0QA 3ZRBA 4OKXA 3OZ0A 1UPVA 3A9EB 2ACLA 1ZH7A 5E14A 3FALA 2GP7A 5DVSA 5DKBA 2OVMA 2YJDA 3ERDA 2FAIA 3V9YA 3AN3A 5AAUA 3WGPA 1L2IA 5HYKA 4K4JA 4UDBA 2ACLB 4S0TA 3X36A 2P54A 5KRIA 4OGHA 3FALB 5DIEA 4TV1A 4LBDA 2QXMA 3DZYD 1R6GA 2R40D 4REFA 2GPPA 2HASA 4OJBA 2Q7KA 2PKLA 1IE8A 1FM6A 2ZFXA 4IUIA 4X1GA 5DU5A 4TV1B 3UVVB 1A28A 2Q7JA 3HODA 1Y9RA 4APUA 3PLZA 1EREA 2HBHA 2ZK3A 3DCTA 5DY8A 5G45A 2HARA 3L03A 4OHAA 2Z4BA 5E15A 5KCTA 5FQTA 3TY0A 3KMZA 2QGTA 1UHLA 4OZTU 3RLJA 1NQ7A 2ZXMA 3L0JA 3MNOA 4K6IA 1XLSE 4OC7A 5DV6A 1NUOA 3P0UA 1RDTD 1X7EA 3QT0A 1RKHA 1UHLB 4PPSA 4RZGA 4UDCA 1YINA 2P4YA 2Q6JA 3OS9A 5FQPA 2OZ7A 1XZXX 3O1EA 3UP0A 3HLVA 3VT5A 2QABA 3SP9A 2Q7LA 2XKWA 3L0LA 5K13A 5GT4A 2Q59A 1XVPA 3MNPA 2I0JA 3X31A 1PCGA 2ZK5A 5KRKA 2Q6RA 3W5RA 3FEIA 4CI4A 2AMBA 1MZNA 4UDDA 3AN4A 2ZASA 1G2NA 1XVPB 2Q59B 1FCZA 3MNEA 3VJSA 2Q5SA 3OSIA 4IVYA 4ZNHA 3KMGA 2HB8A 3O1DA 5DRMA 5DTVA 4IQRA 4M8EA 2AYRA 3A2IA 3ADVA 4IS8A 1NAXA 1VJBA 1Q4XA 2LBDA 3RVFA 4J5WA 3GYTA 3VJIA 3VTCA 2G0HA 4MG8A 5E19A 2J7XA 1OSHA 4WLBA 2ZNNA 2YFEA 3R5NA 1TFCA 2Q7IA 4R06A 5KCCA 4EMAA 1YA3A 4MG7A 4MG8B 1PZLA 3VT9A 5ACCA 1R1KD 3OAPA 4ZJWA 1KNUA 4N5GA 2B1VA 5C4OA 2Q8SA 4OJ9A 1S19A 4ZNWA 4G1YA 4MG7B 4BCRA 4MG9B 3V9VA 2H79A 2W8YA 1YY4A 2AAXA 3V3QA 4PLDA 2PNUA 4DMAA 1R20A 3DZYA 5E0XA 2R40A 3JZCA 4RZFA 4IA2A 3GWXA 4JL4A 4YPQA 1T73A 3E7CA 4RWVA 2YLQA 4PP3A 5G3JA 2YATA 4LTWA 1T79A 2YLOA 3F7DA 3G0WA 1T74A 5KCDA 5KRJA 1T7TA 4RAKA 1K7LA 1RJKA 2PRGA 3G8OA 5DZ1A 5JI0D 2R6YA 2XYXA 4ZNTA 2R6WA 5E0WA 2ZNPA 3VT6A 5DYDA 2G0GA 1NHZA 2VV1A 2HAMA 4IWCA 4G2HA 5DXEA 3VSOA 3W5QA 3X1IA 4LNWA 4ITFA 5DWEA 2PIQA 5EC9A 4POJA 4L96A 4ZN7A 5KR9A 4F9MA 1WM0X 2VV1B 1DB1A 2PIXA 3OGTA 4ZO1X 3VTDA 3DZUA 3R8AA 4OIVA 3GBKA 1UPWA 2Q1VA 2AA5A 2HVCA 4XLDA 3P88A 4N8RA 3TKCA 2YHDA 3IPQA 3SZ1A 1ZUCA 5DRJA 3OZJA 2J14A 3FC6A 3AUNA 4FHIA 4OEAA 2BAWA 3UUDA 2Q70A 5DUHA 5DXMA 5KCFA 2VV4B 1QKNA 4NUFA 4MG6A 3AFRA 3B3KA 4RUPA 5HZCA 2I0GA 1LV2A 1NRLA 2PITA 5DSHA 2PIPL 3UUDB 3OS8A 4RFWA 3D6DA 4XAOA 1N83A 5APJA 1ZKYA 3WFGA 2HCDA 4DM8A 3L0EA 3R8IA 4UDAA 2QGWA 2HFPA 4WVDA 3B67A 4S15A 2PIRA 2NXXE 5HJSA 3VJTA 1QKTA 3WT6A 4ZI1A 5L7EA 4QE8A 5DZIA 3VJHA 2OVHA 3B0RA 4XUHA 4IA7A 4XT9A 4ZNVA 1T76A 2XHSA 1GWXA 3PBAA 5EI1A 1SR7A 1XP9A 3GZ9A 1PDUA 2P1TA 3DR1A 3OMOA 4YT1A 3VT8A 3R5MA 4Q13A 2QH6A 2VV0A 2PIVA 2GWXA 5L7HA 5L7GA 3E00D 3ET0A 3IPUA 2G5OA 3VT3A 2ZK6A 3G8IA 4MG5A 5DZ0A 3UVVA 5EITA 4PLEA 5KYAA 1NDEA 3ERTA 4CSJA 4ZN9A 4KZMA 4LSJA 2ZK0A 4MDDA 1UOMA 2ZLCA 4JYHA 5C4SA 2ZBSA 3ADSA 3S9SA 2B23A 2NPAA 3VTBA 2REWA 1A52A 3UUCA 3T03A 3L1BA 1OSVA 1YUCA 3NSQA 4TUZB 4NIEA 4G21A 2O4JA 3RUUA 1MVCA 4PXMA 5B41A 3OMMA 3DT3A 3W0YA 4ZNSA 1T7MA 4PVUA 3VT4A 3W0IA 4DORA 5KYJA 3OKHA 4OEDA 3FUGA 4OZRE 5ETHA 2ZMIA 1N46A 1T7FA 3WWRA 4OLMA 3B5RA 2VV3A 3GYUA
chains in the Genus database with same CATH superfamily
1R5KA 4J5XC 3EYBA 1NQ1A 1NQ0A 2AX9A 3RY9A 1P8DA 4N1YA 3W0JA 3V3EA 1IE9A 3VRWA 2Z4JA 1OVLA 3VHVA 3R8DA 4QL8A 5HCVA 2QNVA 2JJ3A 2BJ4A 3RUTA 3HO0A 1X7JA 2I4JA 1OVLB 4FNEA 4ZNUA 3OOKA 2BJ4B 3LMPA 5G44A 3NSPA 5GIDA 2PINA 4LNXA 1E3GA 4QJRA 4RZEA 5E7VA 5AAVB 4DQMA 3IMYA 3WJ4A 1YJEA 4OEZA 1I7GA 5DKEA 2GPOA 2AXAA 1ZEOA 4OEYA 1PK5A 2IHQA 4NY9A 1T5ZA 5DV8A 2VSTA 2ZK1A 3OSAA 1FBYA 2P1VA 3KDUA 4Q0AC 3K6PA 5DP0A 3V4AA 1XAPA 3OMQA 4MG9A 2AA7A 3AZ3A 2QMVA 4IW8A 4RMEA 5DVCA 4G1DA 1TXIA 1G1UA 3W0HA 2OAXA 2B1ZA 2GTKA 3Q95A 4MGDA 1FCYA 4OZTE 3FEJA 4PWLA 4IVWA 3E00A 1I7IA 3KWYA 2AO6A 4PPPA 1FD0A 5KRAA 3VT7A 3ET1A 3K22A 3Q95B 4RUOX 4MGDB 5DKGA 3B66A 3TX7B 3H52A 2IOGA 2OCFA 2A3IA 3CDPA 2AMAA 5IAWA 4WPFA 4DK7A 2VSRA 5DXGA 4CI5A 1YOKA 2ZLAA 3FLIA 3G9EA 3VN2A 3CJWA 2FVJA 3BQDA 3VHUA 4E2JA 2QA8A 4A4WA 1P93A 2XYWA 2AM9A 3AUQA 1Y0SA 5DYBA 4J24A 1XQ3A 3KDTA 5EGVA 3VSPA 1ILGA 2P7GA 5DIGA 4YNKA 3PEQA 2Q60A 1NQ2A 1FM6D 2QA8B 5DL4A 4JYGA 1RDTA 2NW4A 4S14A 4P6WA 4RUJA 4JYIA 4OFRA 2YLYA 5SYZA 1FM9D 2JFAA 3VI8A 2O4RA 3ZQTA 1SQNA 3K23A 2VV4A 5APHA 5C4TA 5L11A 2QW4A 4POHA 4E4KA 5AVIA 5GIEA 4MGBA 2JFAB 4FGYA 2VV2A 3L3ZA 5G43A 3AZ1A 2QA6A 5H1EA 5HJPA 3P89A 4MGBB 4HEEX 5KD9A 3A40X 3B68A 4WQPA 3W0CA 3UU7A 5JJMA 2AX8A 1X7RA 2ZXZA 5HJPB 3KFCA 2POBA 5FQVA 4K7AA 5G5WA 5AZVA 3AZ2A 3BEJA 4EM9A 1S9PA 2JF9A 3UU7B 5JJMB 2J7YA 1N4HA 1XNXA 4FN9A 1ZGYA 5DVVA 5KCEA 3U9QA 4IW6A 5DLRA 4ZOMA 1U3SA 3CWDA 2ZKCA 1SKXA 3CQVA 3GD2A 5G46A 3AX8A 3X1HA 4J26A 2AB2A 1XIUA 2ZMJA 3DY6A 3WT7A 4OZRU 4DOSA 2QE4A 2H77A 1S9QA 1L2JA 4PF3A 3F5CA 1R1KA 5KRLA 4ZJRA 3OLLA 2HB7A 5DUEA 2GL8A 3CTBA 3N00A 3BC5A 1ZAFA 4ZO1B 2P7ZA 3F5CB 4HLWA 3KYTA 5JY3A 2QTUA 1XJ7A 3GN8A 4FHHA 4Q50A 4G20A 2PIWA 3PO9A 5DUGA 5LWPA 4TUZA 2NV7A 2PIOA 5DZ3A 1XV9B 3ILZA 4J5XA 5B5BA 1K74D 4OKBA 4IV2A 5AK2A 2NXXA 3WTQA 1T63A 2Q6SA 4Y29A 2P1UA 1KV6A 4MGAA 4IA3A 5AZTA 3CS4A 4QM0A 1Z5XE 2QXSA 4G1ZA 1R20D 1YIMA 4NB6A 3WT5A 1S0ZA 1KKQA 2GPUA 2IOKA 4MGAB 5KRCA 3R29A 3D24A 4JGVA 2ZK2A 4OK1A 5DMFA 1XOWA 4IWFA 1ILHA 2Q1HA 5AYGA 3PCUA 5LGAA 3OKIA 2EWPA 4IU7A 4OH5A 5DI7A 1FM9A 5DXBA 2I4PA 3B0TA 4OH6A 3E94A 5IXKA 1XNNA 5A86A 3FXVA 1XB7A 3IXPD 1E3KA 3OMKA 3UUAA 3UP3A 3HM1A 3OSWA 2B50A 4R6SA 5DK9A 5DXBB 5GICA 2ZL9A 1X76A 3NOAA 5AAVA 4MGCA 4IA1A 3OLFA 3VRTA 5AWKA 3B1MA 5DMCA 4OFUA 3UUAB 3KPZA 3V49A 4XI3A 2ZNOA 3W0AA 3DZUD 3HQ5A 2I4ZA 1RKGA 2ATHA 1HJ1A 1XP6A 2V7CA 4OKTA 3RLLA 5KRHA 5KCWA 1XLSA 1EXXA 2V0VA 5APKA 4XTAA 5DWJA 2QPYA 2ZVTA 1XDKA 3SP6A 2ZY0A 1BSXA 4O8FA 1GWRA 1GWQA 1MV9A 3ADWA 3ET2A 3H0AD 4S0SA 1M2ZA 2HWRA 1H9UA 2QSEA 1U9EA 2AA6A 4PP5A 1XDKB 1LBDA 2Q5GA 1X78A 3B0WA 5G42A 4KZIA 5AWJA 4RMCA 5C4UA 3VRUA 2YLPA 3FURA 1XQCA 4KZJA 1Z95A 3AURA 1ZDTA 3B65A 3D5FA 5CJ6A 1U3RA 2PJLA 1M7WA 1FCXA 4WHFA 5DKSA 1RK3A 2G44A 3ADXA 3KBAA 5FQRA 5DWGA 3ET3A 1X7BA 4OILA 1K4WA 4N73A 1OT7A 2AA2A 1PQ9A 3OOFA 2AX6A 1G5YA 4QK4A 5DV3A 1I38A 2P15A 3IPSA 3HC6A 4RE8A 3DCUA 3W5PA 5DXRA 2GIUA 2HWQA 4J5WC 1QKUA 1M13A 1K74A 4B7WA 2AWHA 4R2UA 2HC4A 2F4BA 3FS1A 2O9IA 4G2IA 3VRVA 3W0GA 1T7RA 1PQ6A 3KMRA 5I4VA 3HVLA 3R2AA 2Q61A 1NAVA 2AX7A 1Y0XX 1DKFA 2YJAB 5DX3A 3A2HA 3WFFA 3M7RA 2ZMHA 3P8XA 5AVLA 4ONIA 4JAZA 3CS8A 3A3ZX 3L3XA 1DKFB 1YMTA 4PRGA 5DWLA 5DX3B 1YOWA 4A2JA 1T65A 3CDSA 4ITEA 4L98A 1YYEA 3LBDA 2Q5PA 4A4VA 5KRFA 1PRGA 3CLDA 3CS6A 3ADTA 3VHWA 5E1CA 3WMHA 4E4QA 3V9TA 1EXAA 2POGA 3IXPA 4M8HA 2J4AA 3ADUA 5ICKA 4IV4A 5DZHA 5M96A 1QKMA 3PRGA 5EJVA 4OARA 3WJ5A 2ZNQA 3JZBA 3HZFA 2FSZA 3A78A 2E2RA 1U3QA 2OM9A 4YMQA 3K8SA 5DXKA 4OJ4A 2QZOA 4X1FA 3ZRAA 4DK8A 5F9BA 1YP0A 1GS4A 3D90A 1XP1A 3OMPA 4WHGA 4XHDA 3HC5A 3IA6A 5KRMA 5KROA 5KCUA 1NYXA 2QZOB 1Z5XU 2GPVA 3OLSA 2Q3YA 3H0AA 2ZXNA 3FC6B 2XYJA 1SJ0A 1ERRA 2OUZA 2QR9A 5IZ0A 3ZR7A 1I37A 2ZK4A 1PQCA 4OIUA 4QE6A 2P7AA 3D57A 5FQSA 1HG4A 4P6XA 5DXPA 4PP6A 5EHJA 3A2JA 3TKMA 1ZDUA 3W5TA 5DWIA 1XV9A 4DM6A 3A9EA 4RMDA 1S0XA 2ABIA 4OKWA 5DXQA 1XPCA 4NQAB 2PIUA 4REEA 5DIDA 1G50A 3GWSX 4XUMA 5HYRA 3OS8C 3B0QA 3ZRBA 4OKXA 3OZ0A 1UPVA 3A9EB 2ACLA 1ZH7A 5E14A 3FALA 2GP7A 5DVSA 5DKBA 2OVMA 2YJDA 3ERDA 2FAIA 3V9YA 3AN3A 5AAUA 3WGPA 1L2IA 5HYKA 4K4JA 4UDBA 2ACLB 4S0TA 3X36A 2P54A 5KRIA 4OGHA 3FALB 5DIEA 4TV1A 4LBDA 2QXMA 3DZYD 1R6GA 2R40D 4REFA 2GPPA 2HASA 4OJBA 2Q7KA 2PKLA 1IE8A 1FM6A 2ZFXA 4IUIA 4X1GA 5DU5A 4TV1B 3UVVB 1A28A 2Q7JA 3HODA 1Y9RA 4APUA 3PLZA 1EREA 2HBHA 2ZK3A 3DCTA 5DY8A 5G45A 2HARA 3L03A 4OHAA 2Z4BA 5E15A 5KCTA 5FQTA 3TY0A 3KMZA 2QGTA 1UHLA 4OZTU 3RLJA 1NQ7A 2ZXMA 3L0JA 3MNOA 4K6IA 1XLSE 4OC7A 5DV6A 1NUOA 3P0UA 1RDTD 1X7EA 3QT0A 1RKHA 1UHLB 4PPSA 4RZGA 4UDCA 1YINA 2P4YA 2Q6JA 3OS9A 5FQPA 2OZ7A 1XZXX 3O1EA 3UP0A 3HLVA 3VT5A 2QABA 3SP9A 2Q7LA 2XKWA 3L0LA 5K13A 5GT4A 2Q59A 1XVPA 3MNPA 2I0JA 3X31A 1PCGA 2ZK5A 5KRKA 2Q6RA 3W5RA 3FEIA 4CI4A 2AMBA 1MZNA 4UDDA 3AN4A 2ZASA 1G2NA 1XVPB 2Q59B 1FCZA 3MNEA 3VJSA 2Q5SA 3OSIA 4IVYA 4ZNHA 3KMGA 2HB8A 3O1DA 5DRMA 5DTVA 4IQRA 4M8EA 2AYRA 3A2IA 3ADVA 4IS8A 1NAXA 1VJBA 1Q4XA 2LBDA 3RVFA 4J5WA 3GYTA 3VJIA 3VTCA 2G0HA 4MG8A 5E19A 2J7XA 1OSHA 4WLBA 2ZNNA 2YFEA 3R5NA 1TFCA 2Q7IA 4R06A 5KCCA 4EMAA 1YA3A 4MG7A 4MG8B 1PZLA 3VT9A 5ACCA 1R1KD 3OAPA 4ZJWA 1KNUA 4N5GA 2B1VA 5C4OA 2Q8SA 4OJ9A 1S19A 4ZNWA 4G1YA 4MG7B 4BCRA 4MG9B 3V9VA 2H79A 2W8YA 1YY4A 2AAXA 3V3QA 4PLDA 2PNUA 4DMAA 1R20A 3DZYA 5E0XA 2R40A 3JZCA 4RZFA 4IA2A 3GWXA 4JL4A 4YPQA 1T73A 3E7CA 4RWVA 2YLQA 4PP3A 5G3JA 2YATA 4LTWA 1T79A 2YLOA 3F7DA 3G0WA 1T74A 5KCDA 5KRJA 1T7TA 4RAKA 1K7LA 1RJKA 2PRGA 3G8OA 5DZ1A 5JI0D 2R6YA 2XYXA 4ZNTA 2R6WA 5E0WA 2ZNPA 3VT6A 5DYDA 2G0GA 1NHZA 2VV1A 2HAMA 4IWCA 4G2HA 5DXEA 3VSOA 3W5QA 3X1IA 4LNWA 4ITFA 5DWEA 2PIQA 5EC9A 4POJA 4L96A 4ZN7A 5KR9A 4F9MA 1WM0X 2VV1B 1DB1A 2PIXA 3OGTA 4ZO1X 3VTDA 3DZUA 3R8AA 4OIVA 3GBKA 1UPWA 2Q1VA 2AA5A 2HVCA 4XLDA 3P88A 4N8RA 3TKCA 2YHDA 3IPQA 3SZ1A 1ZUCA 5DRJA 3OZJA 2J14A 3FC6A 3AUNA 4FHIA 4OEAA 2BAWA 3UUDA 2Q70A 5DUHA 5DXMA 5KCFA 2VV4B 1QKNA 4NUFA 4MG6A 3AFRA 3B3KA 4RUPA 5HZCA 2I0GA 1LV2A 1NRLA 2PITA 5DSHA 2PIPL 3UUDB 3OS8A 4RFWA 3D6DA 4XAOA 1N83A 5APJA 1ZKYA 3WFGA 2HCDA 4DM8A 3L0EA 3R8IA 4UDAA 2QGWA 2HFPA 4WVDA 3B67A 4S15A 2PIRA 2NXXE 5HJSA 3VJTA 1QKTA 3WT6A 4ZI1A 5L7EA 4QE8A 5DZIA 3VJHA 2OVHA 3B0RA 4XUHA 4IA7A 4XT9A 4ZNVA 1T76A 2XHSA 1GWXA 3PBAA 5EI1A 1SR7A 1XP9A 3GZ9A 1PDUA 2P1TA 3DR1A 3OMOA 4YT1A 3VT8A 3R5MA 4Q13A 2QH6A 2VV0A 2PIVA 2GWXA 5L7HA 5L7GA 3E00D 3ET0A 3IPUA 2G5OA 3VT3A 2ZK6A 3G8IA 4MG5A 5DZ0A 3UVVA 5EITA 4PLEA 5KYAA 1NDEA 3ERTA 4CSJA 4ZN9A 4KZMA 4LSJA 2ZK0A 4MDDA 1UOMA 2ZLCA 4JYHA 5C4SA 2ZBSA 3ADSA 3S9SA 2B23A 2NPAA 3VTBA 2REWA 1A52A 3UUCA 3T03A 3L1BA 1OSVA 1YUCA 3NSQA 4TUZB 4NIEA 4G21A 2O4JA 3RUUA 1MVCA 4PXMA 5B41A 3OMMA 3DT3A 3W0YA 4ZNSA 1T7MA 4PVUA 3VT4A 3W0IA 4DORA 5KYJA 3OKHA 4OEDA 3FUGA 4OZRE 5ETHA 2ZMIA 1N46A 1T7FA 3WWRA 4OLMA 3B5RA 2VV3A 3GYUA
chains in the Genus database with same CATH topology
1R5KA 4J5XC 3EYBA 1NQ1A 1NQ0A 2AX9A 3RY9A 1P8DA 4N1YA 3W0JA 3V3EA 1IE9A 3VRWA 2Z4JA 1OVLA 3VHVA 3R8DA 4QL8A 5HCVA 2QNVA 2JJ3A 2BJ4A 3RUTA 3HO0A 1X7JA 2I4JA 1OVLB 4FNEA 4ZNUA 3OOKA 2BJ4B 3LMPA 5G44A 3NSPA 5GIDA 2PINA 4LNXA 1E3GA 4QJRA 4RZEA 5E7VA 5AAVB 4DQMA 3IMYA 3WJ4A 1YJEA 4OEZA 1I7GA 5DKEA 2GPOA 2AXAA 1ZEOA 4OEYA 1PK5A 2IHQA 4NY9A 1T5ZA 5DV8A 2VSTA 2ZK1A 3OSAA 1FBYA 2P1VA 3KDUA 4Q0AC 3K6PA 5DP0A 3V4AA 1XAPA 3OMQA 4MG9A 2AA7A 3AZ3A 2QMVA 4IW8A 4RMEA 5DVCA 4G1DA 1TXIA 1G1UA 3W0HA 2OAXA 2B1ZA 2GTKA 3Q95A 4MGDA 1FCYA 4OZTE 3FEJA 4PWLA 4IVWA 3E00A 1I7IA 3KWYA 2AO6A 4PPPA 1FD0A 5KRAA 3VT7A 3ET1A 3K22A 3Q95B 4RUOX 4MGDB 5DKGA 3B66A 3TX7B 3H52A 2IOGA 2OCFA 2A3IA 3CDPA 2AMAA 5IAWA 4WPFA 4DK7A 2VSRA 5DXGA 4CI5A 1YOKA 2ZLAA 3FLIA 3G9EA 3VN2A 3CJWA 2FVJA 3BQDA 3VHUA 4E2JA 2QA8A 4A4WA 1P93A 2XYWA 2AM9A 3AUQA 1Y0SA 5DYBA 4J24A 1XQ3A 3KDTA 5EGVA 3VSPA 1ILGA 2P7GA 5DIGA 4YNKA 3PEQA 2Q60A 1NQ2A 1FM6D 2QA8B 5DL4A 4JYGA 1RDTA 2NW4A 4S14A 4P6WA 4RUJA 4JYIA 4OFRA 2YLYA 5SYZA 1FM9D 2JFAA 3VI8A 2O4RA 3ZQTA 1SQNA 3K23A 2VV4A 5APHA 5C4TA 5L11A 2QW4A 4POHA 4E4KA 5AVIA 5GIEA 4MGBA 2JFAB 4FGYA 2VV2A 3L3ZA 5G43A 3AZ1A 2QA6A 5H1EA 5HJPA 3P89A 4MGBB 4HEEX 5KD9A 3A40X 3B68A 4WQPA 3W0CA 3UU7A 5JJMA 2AX8A 1X7RA 2ZXZA 5HJPB 3KFCA 2POBA 5FQVA 4K7AA 5G5WA 5AZVA 3AZ2A 3BEJA 4EM9A 1S9PA 2JF9A 3UU7B 5JJMB 2J7YA 1N4HA 1XNXA 4FN9A 1ZGYA 5DVVA 5KCEA 3U9QA 4IW6A 5DLRA 4ZOMA 1U3SA 3CWDA 2ZKCA 1SKXA 3CQVA 3GD2A 5G46A 3AX8A 3X1HA 4J26A 2AB2A 1XIUA 2ZMJA 3DY6A 3WT7A 4OZRU 4DOSA 2QE4A 2H77A 1S9QA 1L2JA 4PF3A 3F5CA 1R1KA 5KRLA 4ZJRA 3OLLA 2HB7A 5DUEA 2GL8A 3CTBA 3N00A 3BC5A 1ZAFA 4ZO1B 2P7ZA 3F5CB 4HLWA 3KYTA 5JY3A 2QTUA 1XJ7A 3GN8A 4FHHA 4Q50A 4G20A 2PIWA 3PO9A 5DUGA 5LWPA 4TUZA 2NV7A 2PIOA 5DZ3A 1XV9B 3ILZA 4J5XA 5B5BA 1K74D 4OKBA 4IV2A 5AK2A 2NXXA 3WTQA 1T63A 2Q6SA 4Y29A 2P1UA 1KV6A 4MGAA 4IA3A 5AZTA 3CS4A 4QM0A 1Z5XE 2QXSA 4G1ZA 1R20D 1YIMA 4NB6A 3WT5A 1S0ZA 1KKQA 2GPUA 2IOKA 4MGAB 5KRCA 3R29A 3D24A 4JGVA 2ZK2A 4OK1A 5DMFA 1XOWA 4IWFA 1ILHA 2Q1HA 5AYGA 3PCUA 5LGAA 3OKIA 2EWPA 4IU7A 4OH5A 5DI7A 1FM9A 5DXBA 2I4PA 3B0TA 4OH6A 3E94A 5IXKA 1XNNA 5A86A 3FXVA 1XB7A 3IXPD 1E3KA 3OMKA 3UUAA 3UP3A 3HM1A 3OSWA 2B50A 4R6SA 5DK9A 5DXBB 5GICA 2ZL9A 1X76A 3NOAA 5AAVA 4MGCA 4IA1A 3OLFA 3VRTA 5AWKA 3B1MA 5DMCA 4OFUA 3UUAB 3KPZA 3V49A 4XI3A 2ZNOA 3W0AA 3DZUD 3HQ5A 2I4ZA 1RKGA 2ATHA 1HJ1A 1XP6A 2V7CA 4OKTA 3RLLA 5KRHA 5KCWA 1XLSA 1EXXA 2V0VA 5APKA 4XTAA 5DWJA 2QPYA 2ZVTA 1XDKA 3SP6A 2ZY0A 1BSXA 4O8FA 1GWRA 1GWQA 1MV9A 3ADWA 3ET2A 3H0AD 4S0SA 1M2ZA 2HWRA 1H9UA 2QSEA 1U9EA 2AA6A 4PP5A 1XDKB 1LBDA 2Q5GA 1X78A 3B0WA 5G42A 4KZIA 5AWJA 4RMCA 5C4UA 3VRUA 2YLPA 3FURA 1XQCA 4KZJA 1Z95A 3AURA 1ZDTA 3B65A 3D5FA 5CJ6A 1U3RA 2PJLA 1M7WA 1FCXA 4WHFA 5DKSA 1RK3A 2G44A 3ADXA 3KBAA 5FQRA 5DWGA 3ET3A 1X7BA 4OILA 1K4WA 4N73A 1OT7A 2AA2A 1PQ9A 3OOFA 2AX6A 1G5YA 4QK4A 5DV3A 1I38A 2P15A 3IPSA 3HC6A 4RE8A 3DCUA 3W5PA 5DXRA 2GIUA 2HWQA 4J5WC 1QKUA 1M13A 1K74A 4B7WA 2AWHA 4R2UA 2HC4A 2F4BA 3FS1A 2O9IA 4G2IA 3VRVA 3W0GA 1T7RA 1PQ6A 3KMRA 5I4VA 3HVLA 3R2AA 2Q61A 1NAVA 2AX7A 1Y0XX 1DKFA 2YJAB 5DX3A 3A2HA 3WFFA 3M7RA 2ZMHA 3P8XA 5AVLA 4ONIA 4JAZA 3CS8A 3A3ZX 3L3XA 1DKFB 1YMTA 4PRGA 5DWLA 5DX3B 1YOWA 4A2JA 1T65A 3CDSA 4ITEA 4L98A 1YYEA 3LBDA 2Q5PA 4A4VA 5KRFA 1PRGA 3CLDA 3CS6A 3ADTA 3VHWA 5E1CA 3WMHA 4E4QA 3V9TA 1EXAA 2POGA 3IXPA 4M8HA 2J4AA 3ADUA 5ICKA 4IV4A 5DZHA 5M96A 1QKMA 3PRGA 5EJVA 4OARA 3WJ5A 2ZNQA 3JZBA 3HZFA 2FSZA 3A78A 2E2RA 1U3QA 2OM9A 4YMQA 3K8SA 5DXKA 4OJ4A 2QZOA 4X1FA 3ZRAA 4DK8A 5F9BA 1YP0A 1GS4A 3D90A 1XP1A 3OMPA 4WHGA 4XHDA 3HC5A 3IA6A 5KRMA 5KROA 5KCUA 1NYXA 2QZOB 1Z5XU 2GPVA 3OLSA 2Q3YA 3H0AA 2ZXNA 3FC6B 2XYJA 1SJ0A 1ERRA 2OUZA 2QR9A 5IZ0A 3ZR7A 1I37A 2ZK4A 1PQCA 4OIUA 4QE6A 2P7AA 3D57A 5FQSA 1HG4A 4P6XA 5DXPA 4PP6A 5EHJA 3A2JA 3TKMA 1ZDUA 3W5TA 5DWIA 1XV9A 4DM6A 3A9EA 4RMDA 1S0XA 2ABIA 4OKWA 5DXQA 1XPCA 4NQAB 2PIUA 4REEA 5DIDA 1G50A 3GWSX 4XUMA 5HYRA 3OS8C 3B0QA 3ZRBA 4OKXA 3OZ0A 1UPVA 3A9EB 2ACLA 1ZH7A 5E14A 3FALA 2GP7A 5DVSA 5DKBA 2OVMA 2YJDA 3ERDA 2FAIA 3V9YA 3AN3A 5AAUA 3WGPA 1L2IA 5HYKA 4K4JA 4UDBA 2ACLB 4S0TA 3X36A 2P54A 5KRIA 4OGHA 3FALB 5DIEA 4TV1A 4LBDA 2QXMA 3DZYD 1R6GA 2R40D 4REFA 2GPPA 2HASA 4OJBA 2Q7KA 2PKLA 1IE8A 1FM6A 2ZFXA 4IUIA 4X1GA 5DU5A 4TV1B 3UVVB 1A28A 2Q7JA 3HODA 1Y9RA 4APUA 3PLZA 1EREA 2HBHA 2ZK3A 3DCTA 5DY8A 5G45A 2HARA 3L03A 4OHAA 2Z4BA 5E15A 5KCTA 5FQTA 3TY0A 3KMZA 2QGTA 1UHLA 4OZTU 3RLJA 1NQ7A 2ZXMA 3L0JA 3MNOA 4K6IA 1XLSE 4OC7A 5DV6A 1NUOA 3P0UA 1RDTD 1X7EA 3QT0A 1RKHA 1UHLB 4PPSA 4RZGA 4UDCA 1YINA 2P4YA 2Q6JA 3OS9A 5FQPA 2OZ7A 1XZXX 3O1EA 3UP0A 3HLVA 3VT5A 2QABA 3SP9A 2Q7LA 2XKWA 3L0LA 5K13A 5GT4A 2Q59A 1XVPA 3MNPA 2I0JA 3X31A 1PCGA 2ZK5A 5KRKA 2Q6RA 3W5RA 3FEIA 4CI4A 2AMBA 1MZNA 4UDDA 3AN4A 2ZASA 1G2NA 1XVPB 2Q59B 1FCZA 3MNEA 3VJSA 2Q5SA 3OSIA 4IVYA 4ZNHA 3KMGA 2HB8A 3O1DA 5DRMA 5DTVA 4IQRA 4M8EA 2AYRA 3A2IA 3ADVA 4IS8A 1NAXA 1VJBA 1Q4XA 2LBDA 3RVFA 4J5WA 3GYTA 3VJIA 3VTCA 2G0HA 4MG8A 5E19A 2J7XA 1OSHA 4WLBA 2ZNNA 2YFEA 3R5NA 1TFCA 2Q7IA 4R06A 5KCCA 4EMAA 1YA3A 4MG7A 4MG8B 1PZLA 3VT9A 5ACCA 1R1KD 3OAPA 4ZJWA 1KNUA 4N5GA 2B1VA 5C4OA 2Q8SA 4OJ9A 1S19A 4ZNWA 4G1YA 4MG7B 4BCRA 4MG9B 3V9VA 2H79A 2W8YA 1YY4A 2AAXA 3V3QA 4PLDA 2PNUA 4DMAA 1R20A 3DZYA 5E0XA 2R40A 3JZCA 4RZFA 4IA2A 3GWXA 4JL4A 4YPQA 1T73A 3E7CA 4RWVA 2YLQA 4PP3A 5G3JA 2YATA 4LTWA 1T79A 2YLOA 3F7DA 3G0WA 1T74A 5KCDA 5KRJA 1T7TA 4RAKA 1K7LA 1RJKA 2PRGA 3G8OA 5DZ1A 5JI0D 2R6YA 2XYXA 4ZNTA 2R6WA 5E0WA 2ZNPA 3VT6A 5DYDA 2G0GA 1NHZA 2VV1A 2HAMA 4IWCA 4G2HA 5DXEA 3VSOA 3W5QA 3X1IA 4LNWA 4ITFA 5DWEA 2PIQA 5EC9A 4POJA 4L96A 4ZN7A 5KR9A 4F9MA 1WM0X 2VV1B 1DB1A 2PIXA 3OGTA 4ZO1X 3VTDA 3DZUA 3R8AA 4OIVA 3GBKA 1UPWA 2Q1VA 2AA5A 2HVCA 4XLDA 3P88A 4N8RA 3TKCA 2YHDA 3IPQA 3SZ1A 1ZUCA 5DRJA 3OZJA 2J14A 3FC6A 3AUNA 4FHIA 4OEAA 2BAWA 3UUDA 2Q70A 5DUHA 5DXMA 5KCFA 2VV4B 1QKNA 4NUFA 4MG6A 3AFRA 3B3KA 4RUPA 5HZCA 2I0GA 1LV2A 1NRLA 2PITA 5DSHA 2PIPL 3UUDB 3OS8A 4RFWA 3D6DA 4XAOA 1N83A 5APJA 1ZKYA 3WFGA 2HCDA 4DM8A 3L0EA 3R8IA 4UDAA 2QGWA 2HFPA 4WVDA 3B67A 4S15A 2PIRA 2NXXE 5HJSA 3VJTA 1QKTA 3WT6A 4ZI1A 5L7EA 4QE8A 5DZIA 3VJHA 2OVHA 3B0RA 4XUHA 4IA7A 4XT9A 4ZNVA 1T76A 2XHSA 1GWXA 3PBAA 5EI1A 1SR7A 1XP9A 3GZ9A 1PDUA 2P1TA 3DR1A 3OMOA 4YT1A 3VT8A 3R5MA 4Q13A 2QH6A 2VV0A 2PIVA 2GWXA 5L7HA 5L7GA 3E00D 3ET0A 3IPUA 2G5OA 3VT3A 2ZK6A 3G8IA 4MG5A 5DZ0A 3UVVA 5EITA 4PLEA 5KYAA 1NDEA 3ERTA 4CSJA 4ZN9A 4KZMA 4LSJA 2ZK0A 4MDDA 1UOMA 2ZLCA 4JYHA 5C4SA 2ZBSA 3ADSA 3S9SA 2B23A 2NPAA 3VTBA 2REWA 1A52A 3UUCA 3T03A 3L1BA 1OSVA 1YUCA 3NSQA 4TUZB 4NIEA 4G21A 2O4JA 3RUUA 1MVCA 4PXMA 5B41A 3OMMA 3DT3A 3W0YA 4ZNSA 1T7MA 4PVUA 3VT4A 3W0IA 4DORA 5KYJA 3OKHA 4OEDA 3FUGA 4OZRE 5ETHA 2ZMIA 1N46A 1T7FA 3WWRA 4OLMA 3B5RA 2VV3A 3GYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5K A;  4J5X C;  3EYB A;  1NQ1 A;  1NQ0 A;  2AX9 A;  3RY9 A;  1P8D A;  4N1Y A;  3W0J A;  3V3E A;  1IE9 A;  3VRW A;  2Z4J A;  1OVL A;  3VHV A;  3R8D A;  4QL8 A;  5HCV A;  2QNV A;  2JJ3 A;  2BJ4 A;  3RUT A;  3HO0 A;  1X7J A;  2I4J A;  1OVL B;  4FNE A;  4ZNU A;  3OOK A;  2BJ4 B;  3LMP A;  5G44 A;  3NSP A;  5GID A;  2PIN A;  4LNX A;  1E3G A;  4QJR A;  4RZE A;  5E7V A;  5AAV B;  4DQM A;  3IMY A;  3WJ4 A;  1YJE A;  4OEZ A;  1I7G A;  5DKE A;  2GPO A;  2AXA A;  1ZEO A;  4OEY A;  1PK5 A;  2IHQ A;  4NY9 A;  1T5Z A;  5DV8 A;  2VST A;  2ZK1 A;  3OSA A;  1FBY A;  2P1V A;  3KDU A;  4Q0A C;  3K6P A;  5DP0 A;  3V4A A;  1XAP A;  3OMQ A;  4MG9 A;  2AA7 A;  3AZ3 A;  2QMV A;  4IW8 A;  4RME A;  5DVC A;  4G1D A;  1TXI A;  1G1U A;  3W0H A;  2OAX A;  2B1Z A;  2GTK A;  3Q95 A;  4MGD A;  1FCY A;  4OZT E;  3FEJ A;  4PWL A;  4IVW A;  3E00 A;  1I7I A;  3KWY A;  2AO6 A;  4PPP A;  1FD0 A;  5KRA A;  3VT7 A;  3ET1 A;  3K22 A;  3Q95 B;  4RUO X;  4MGD B;  5DKG A;  3B66 A;  3TX7 B;  3H52 A;  2IOG A;  2OCF A;  2A3I A;  3CDP A;  2AMA A;  5IAW A;  4WPF A;  4DK7 A;  2VSR A;  5DXG A;  4CI5 A;  1YOK A;  2ZLA A;  3FLI A;  3G9E A;  3VN2 A;  3CJW A;  2FVJ A;  3BQD A;  3VHU A;  4E2J A;  2QA8 A;  4A4W A;  1P93 A;  2XYW A;  2AM9 A;  3AUQ A;  1Y0S A;  5DYB A;  4J24 A;  1XQ3 A;  3KDT A;  5EGV A;  3VSP A;  1ILG A;  2P7G A;  5DIG A;  4YNK A;  3PEQ A;  2Q60 A;  1NQ2 A;  1FM6 D;  2QA8 B;  5DL4 A;  4JYG A;  1RDT A;  2NW4 A;  4S14 A;  4P6W A;  4RUJ A;  4JYI A;  4OFR A;  2YLY A;  5SYZ A;  1FM9 D;  2JFA A;  3VI8 A;  2O4R A;  3ZQT A;  1SQN A;  3K23 A;  2VV4 A;  5APH A;  5C4T A;  5L11 A;  2QW4 A;  4POH A;  4E4K A;  5AVI A;  5GIE A;  4MGB A;  2JFA B;  4FGY A;  2VV2 A;  3L3Z A;  5G43 A;  3AZ1 A;  2QA6 A;  5H1E A;  5HJP A;  3P89 A;  4MGB B;  4HEE X;  5KD9 A;  3A40 X;  3B68 A;  4WQP A;  3W0C A;  3UU7 A;  5JJM A;  2AX8 A;  1X7R A;  2ZXZ A;  5HJP B;  3KFC A;  2POB A;  5FQV A;  4K7A A;  5G5W A;  5AZV A;  3AZ2 A;  3BEJ A;  4EM9 A;  1S9P A;  2JF9 A;  3UU7 B;  5JJM B;  2J7Y A;  1N4H A;  1XNX A;  4FN9 A;  1ZGY A;  5DVV A;  5KCE A;  3U9Q A;  4IW6 A;  5DLR A;  4ZOM A;  1U3S A;  3CWD A;  2ZKC A;  1SKX A;  3CQV A;  3GD2 A;  5G46 A;  3AX8 A;  3X1H A;  4J26 A;  2AB2 A;  1XIU A;  2ZMJ A;  3DY6 A;  3WT7 A;  4OZR U;  4DOS A;  2QE4 A;  2H77 A;  1S9Q A;  1L2J A;  4PF3 A;  3F5C A;  1R1K A;  5KRL A;  4ZJR A;  3OLL A;  2HB7 A;  5DUE A;  2GL8 A;  3CTB A;  3N00 A;  3BC5 A;  1ZAF A;  4ZO1 B;  2P7Z A;  3F5C B;  4HLW A;  3KYT A;  5JY3 A;  2QTU A;  1XJ7 A;  3GN8 A;  4FHH A;  4Q50 A;  4G20 A;  2PIW A;  3PO9 A;  5DUG A;  5LWP A;  4TUZ A;  2NV7 A;  2PIO A;  5DZ3 A;  1XV9 B;  3ILZ A;  4J5X A;  5B5B A;  1K74 D;  4OKB A;  4IV2 A;  5AK2 A;  2NXX A;  3WTQ A;  1T63 A;  2Q6S A;  4Y29 A;  2P1U A;  1KV6 A;  4MGA A;  4IA3 A;  5AZT A;  3CS4 A;  4QM0 A;  1Z5X E;  2QXS A;  4G1Z A;  1R20 D;  1YIM A;  4NB6 A;  3WT5 A;  1S0Z A;  1KKQ A;  2GPU A;  2IOK A;  4MGA B;  5KRC A;  3R29 A;  3D24 A;  4JGV A;  2ZK2 A;  4OK1 A;  5DMF A;  1XOW A;  4IWF A;  1ILH A;  2Q1H A;  5AYG A;  3PCU A;  5LGA A;  3OKI A;  2EWP A;  4IU7 A;  4OH5 A;  5DI7 A;  1FM9 A;  5DXB A;  2I4P A;  3B0T A;  4OH6 A;  3E94 A;  5IXK A;  1XNN A;  5A86 A;  3FXV A;  1XB7 A;  3IXP D;  1E3K A;  3OMK A;  3UUA A;  3UP3 A;  3HM1 A;  3OSW A;  2B50 A;  4R6S A;  5DK9 A;  5DXB B;  5GIC A;  2ZL9 A;  1X76 A;  3NOA A;  5AAV A;  4MGC A;  4IA1 A;  3OLF A;  3VRT A;  5AWK A;  3B1M A;  5DMC A;  4OFU A;  3UUA B;  3KPZ A;  3V49 A;  4XI3 A;  2ZNO A;  3W0A A;  3DZU D;  3HQ5 A;  2I4Z A;  1RKG A;  2ATH A;  1HJ1 A;  1XP6 A;  2V7C A;  4OKT A;  3RLL A;  5KRH A;  5KCW A;  1XLS A;  1EXX A;  2V0V A;  5APK A;  4XTA A;  5DWJ A;  2QPY A;  2ZVT A;  1XDK A;  3SP6 A;  2ZY0 A;  1BSX A;  4O8F A;  1GWR A;  1GWQ A;  1MV9 A;  3ADW A;  3ET2 A;  3H0A D;  4S0S A;  1M2Z A;  2HWR A;  1H9U A;  2QSE A;  1U9E A;  2AA6 A;  4PP5 A;  1XDK B;  1LBD A;  2Q5G A;  1X78 A;  3B0W A;  5G42 A;  4KZI A;  5AWJ A;  4RMC A;  5C4U A;  3VRU A;  2YLP A;  3FUR A;  1XQC A;  4KZJ A;  1Z95 A;  3AUR A;  1ZDT A;  3B65 A;  3D5F A;  5CJ6 A;  1U3R A;  2PJL A;  1M7W A;  1FCX A;  4WHF A;  5DKS A;  1RK3 A;  2G44 A;  3ADX A;  3KBA A;  5FQR A;  5DWG A;  3ET3 A;  1X7B A;  4OIL A;  1K4W A;  4N73 A;  1OT7 A;  2AA2 A;  1PQ9 A;  3OOF A;  2AX6 A;  1G5Y A;  4QK4 A;  5DV3 A;  1I38 A;  2P15 A;  3IPS A;  3HC6 A;  4RE8 A;  3DCU A;  3W5P A;  5DXR A;  2GIU A;  2HWQ A;  4J5W C;  1QKU A;  1M13 A;  1K74 A;  4B7W A;  2AWH A;  4R2U A;  2HC4 A;  2F4B A;  3FS1 A;  2O9I A;  4G2I A;  3VRV A;  3W0G A;  1T7R A;  1PQ6 A;  3KMR A;  5I4V A;  3HVL A;  3R2A A;  2Q61 A;  1NAV A;  2AX7 A;  1Y0X X;  1DKF A;  2YJA B;  5DX3 A;  3A2H A;  3WFF A;  3M7R A;  2ZMH A;  3P8X A;  5AVL A;  4ONI A;  4JAZ A;  3CS8 A;  3A3Z X;  3L3X A;  1DKF B;  1YMT A;  4PRG A;  5DWL A;  5DX3 B;  1YOW A;  4A2J A;  1T65 A;  3CDS A;  4ITE A;  4L98 A;  1YYE A;  3LBD A;  2Q5P A;  4A4V A;  5KRF A;  1PRG A;  3CLD A;  3CS6 A;  3ADT A;  3VHW A;  5E1C A;  3WMH A;  4E4Q A;  3V9T A;  1EXA A;  2POG A;  3IXP A;  4M8H A;  2J4A A;  3ADU A;  5ICK A;  4IV4 A;  5DZH A;  5M96 A;  1QKM A;  3PRG A;  5EJV A;  4OAR A;  3WJ5 A;  2ZNQ A;  3JZB A;  3HZF A;  2FSZ A;  3A78 A;  2E2R A;  1U3Q A;  2OM9 A;  4YMQ A;  3K8S A;  5DXK A;  4OJ4 A;  2QZO A;  4X1F A;  3ZRA A;  4DK8 A;  5F9B A;  1YP0 A;  1GS4 A;  3D90 A;  1XP1 A;  3OMP A;  4WHG A;  4XHD A;  3HC5 A;  3IA6 A;  5KRM A;  5KRO A;  5KCU A;  1NYX A;  2QZO B;  1Z5X U;  2GPV A;  3OLS A;  2Q3Y A;  3H0A A;  2ZXN A;  3FC6 B;  2XYJ A;  1SJ0 A;  1ERR A;  2OUZ A;  2QR9 A;  5IZ0 A;  3ZR7 A;  1I37 A;  2ZK4 A;  1PQC A;  4OIU A;  4QE6 A;  2P7A A;  3D57 A;  5FQS A;  1HG4 A;  4P6X A;  5DXP A;  4PP6 A;  5EHJ A;  3A2J A;  3TKM A;  1ZDU A;  3W5T A;  5DWI A;  1XV9 A;  4DM6 A;  3A9E A;  4RMD A;  1S0X A;  2ABI A;  4OKW A;  5DXQ A;  1XPC A;  4NQA B;  2PIU A;  4REE A;  5DID A;  1G50 A;  3GWS X;  4XUM A;  5HYR A;  3OS8 C;  3B0Q A;  3ZRB A;  4OKX A;  3OZ0 A;  1UPV A;  3A9E B;  2ACL A;  1ZH7 A;  5E14 A;  3FAL A;  2GP7 A;  5DVS A;  5DKB A;  2OVM A;  2YJD A;  3ERD A;  2FAI A;  3V9Y A;  3AN3 A;  5AAU A;  3WGP A;  1L2I A;  5HYK A;  4K4J A;  4UDB A;  2ACL B;  4S0T A;  3X36 A;  2P54 A;  5KRI A;  4OGH A;  3FAL B;  5DIE A;  4TV1 A;  4LBD A;  2QXM A;  3DZY D;  1R6G A;  2R40 D;  4REF A;  2GPP A;  2HAS A;  4OJB A;  2Q7K A;  2PKL A;  1IE8 A;  1FM6 A;  2ZFX A;  4IUI A;  4X1G A;  5DU5 A;  4TV1 B;  3UVV B;  1A28 A;  2Q7J A;  3HOD A;  1Y9R A;  4APU A;  3PLZ A;  1ERE A;  2HBH A;  2ZK3 A;  3DCT A;  5DY8 A;  5G45 A;  2HAR A;  3L03 A;  4OHA A;  2Z4B A;  5E15 A;  5KCT A;  5FQT A;  3TY0 A;  3KMZ A;  2QGT A;  1UHL A;  4OZT U;  3RLJ A;  1NQ7 A;  2ZXM A;  3L0J A;  3MNO A;  4K6I A;  1XLS E;  4OC7 A;  5DV6 A;  1NUO A;  3P0U A;  1RDT D;  1X7E A;  3QT0 A;  1RKH A;  1UHL B;  4PPS A;  4RZG A;  4UDC A;  1YIN A;  2P4Y A;  2Q6J A;  3OS9 A;  5FQP A;  2OZ7 A;  1XZX X;  3O1E A;  3UP0 A;  3HLV A;  3VT5 A;  2QAB A;  3SP9 A;  2Q7L A;  2XKW A;  3L0L A;  5K13 A;  5GT4 A;  2Q59 A;  1XVP A;  3MNP A;  2I0J A;  3X31 A;  1PCG A;  2ZK5 A;  5KRK A;  2Q6R A;  3W5R A;  3FEI A;  4CI4 A;  2AMB A;  1MZN A;  4UDD A;  3AN4 A;  2ZAS A;  1G2N A;  1XVP B;  2Q59 B;  1FCZ A;  3MNE A;  3VJS A;  2Q5S A;  3OSI A;  4IVY A;  4ZNH A;  3KMG A;  2HB8 A;  3O1D A;  5DRM A;  5DTV A;  4IQR A;  4M8E A;  2AYR A;  3A2I A;  3ADV A;  4IS8 A;  1NAX A;  1VJB A;  1Q4X A;  2LBD A;  3RVF A;  4J5W A;  3GYT A;  3VJI A;  3VTC A;  2G0H A;  4MG8 A;  5E19 A;  2J7X A;  1OSH A;  4WLB A;  2ZNN A;  2YFE A;  3R5N A;  1TFC A;  2Q7I A;  4R06 A;  5KCC A;  4EMA A;  1YA3 A;  4MG7 A;  4MG8 B;  1PZL A;  3VT9 A;  5ACC A;  1R1K D;  3OAP A;  4ZJW A;  1KNU A;  4N5G A;  2B1V A;  5C4O A;  2Q8S A;  4OJ9 A;  1S19 A;  4ZNW A;  4G1Y A;  4MG7 B;  4BCR A;  4MG9 B;  3V9V A;  2H79 A;  2W8Y A;  1YY4 A;  2AAX A;  3V3Q A;  4PLD A;  2PNU A;  4DMA A;  1R20 A;  3DZY A;  5E0X A;  2R40 A;  3JZC A;  4RZF A;  4IA2 A;  3GWX A;  4JL4 A;  4YPQ A;  1T73 A;  3E7C A;  4RWV A;  2YLQ A;  4PP3 A;  5G3J A;  2YAT A;  4LTW A;  1T79 A;  2YLO A;  3F7D A;  3G0W A;  1T74 A;  5KCD A;  5KRJ A;  1T7T A;  4RAK A;  1K7L A;  1RJK A;  2PRG A;  3G8O A;  5DZ1 A;  5JI0 D;  2R6Y A;  2XYX A;  4ZNT A;  2R6W A;  5E0W A;  2ZNP A;  3VT6 A;  5DYD A;  2G0G A;  1NHZ A;  2VV1 A;  2HAM A;  4IWC A;  4G2H A;  5DXE A;  3VSO A;  3W5Q A;  3X1I A;  4LNW A;  4ITF A;  5DWE A;  2PIQ A;  5EC9 A;  4POJ A;  4L96 A;  4ZN7 A;  5KR9 A;  4F9M A;  1WM0 X;  2VV1 B;  1DB1 A;  2PIX A;  3OGT A;  4ZO1 X;  3VTD A;  3DZU A;  3R8A A;  4OIV A;  3GBK A;  1UPW A;  2Q1V A;  2AA5 A;  2HVC A;  4XLD A;  3P88 A;  4N8R A;  3TKC A;  2YHD A;  3IPQ A;  3SZ1 A;  1ZUC A;  5DRJ A;  3OZJ A;  2J14 A;  3FC6 A;  3AUN A;  4FHI A;  4OEA A;  2BAW A;  3UUD A;  2Q70 A;  5DUH A;  5DXM A;  5KCF A;  2VV4 B;  1QKN A;  4NUF A;  4MG6 A;  3AFR A;  3B3K A;  4RUP A;  5HZC A;  2I0G A;  1LV2 A;  1NRL A;  2PIT A;  5DSH A;  2PIP L;  3UUD B;  3OS8 A;  4RFW A;  3D6D A;  4XAO A;  1N83 A;  5APJ A;  1ZKY A;  3WFG A;  2HCD A;  4DM8 A;  3L0E A;  3R8I A;  4UDA A;  2QGW A;  2HFP A;  4WVD A;  3B67 A;  4S15 A;  2PIR A;  2NXX E;  5HJS A;  3VJT A;  1QKT A;  3WT6 A;  4ZI1 A;  5L7E A;  4QE8 A;  5DZI A;  3VJH A;  2OVH A;  3B0R A;  4XUH A;  4IA7 A;  4XT9 A;  4ZNV A;  1T76 A;  2XHS A;  1GWX A;  3PBA A;  5EI1 A;  1SR7 A;  1XP9 A;  3GZ9 A;  1PDU A;  2P1T A;  3DR1 A;  3OMO A;  4YT1 A;  3VT8 A;  3R5M A;  4Q13 A;  2QH6 A;  2VV0 A;  2PIV A;  2GWX A;  5L7H A;  5L7G A;  3E00 D;  3ET0 A;  3IPU A;  2G5O A;  3VT3 A;  2ZK6 A;  3G8I A;  4MG5 A;  5DZ0 A;  3UVV A;  5EIT A;  4PLE A;  5KYA A;  1NDE A;  3ERT A;  4CSJ A;  4ZN9 A;  4KZM A;  4LSJ A;  2ZK0 A;  4MDD A;  1UOM A;  2ZLC A;  4JYH A;  5C4S A;  2ZBS A;  3ADS A;  3S9S A;  2B23 A;  2NPA A;  3VTB A;  2REW A;  1A52 A;  3UUC A;  3T03 A;  3L1B A;  1OSV A;  1YUC A;  3NSQ A;  4TUZ B;  4NIE A;  4G21 A;  2O4J A;  3RUU A;  1MVC A;  4PXM A;  5B41 A;  3OMM A;  3DT3 A;  3W0Y A;  4ZNS A;  1T7M A;  4PVU A;  3VT4 A;  3W0I A;  4DOR A;  5KYJ A;  3OKH A;  4OED A;  3FUG A;  4OZR E;  5ETH A;  2ZMI A;  1N46 A;  1T7F A;  3WWR A;  4OLM A;  3B5R A;  2VV3 A;  3GYU A; 
#chains in the Genus database with same CATH topology
 1R5K A;  4J5X C;  3EYB A;  1NQ1 A;  1NQ0 A;  2AX9 A;  3RY9 A;  1P8D A;  4N1Y A;  3W0J A;  3V3E A;  1IE9 A;  3VRW A;  2Z4J A;  1OVL A;  3VHV A;  3R8D A;  4QL8 A;  5HCV A;  2QNV A;  2JJ3 A;  2BJ4 A;  3RUT A;  3HO0 A;  1X7J A;  2I4J A;  1OVL B;  4FNE A;  4ZNU A;  3OOK A;  2BJ4 B;  3LMP A;  5G44 A;  3NSP A;  5GID A;  2PIN A;  4LNX A;  1E3G A;  4QJR A;  4RZE A;  5E7V A;  5AAV B;  4DQM A;  3IMY A;  3WJ4 A;  1YJE A;  4OEZ A;  1I7G A;  5DKE A;  2GPO A;  2AXA A;  1ZEO A;  4OEY A;  1PK5 A;  2IHQ A;  4NY9 A;  1T5Z A;  5DV8 A;  2VST A;  2ZK1 A;  3OSA A;  1FBY A;  2P1V A;  3KDU A;  4Q0A C;  3K6P A;  5DP0 A;  3V4A A;  1XAP A;  3OMQ A;  4MG9 A;  2AA7 A;  3AZ3 A;  2QMV A;  4IW8 A;  4RME A;  5DVC A;  4G1D A;  1TXI A;  1G1U A;  3W0H A;  2OAX A;  2B1Z A;  2GTK A;  3Q95 A;  4MGD A;  1FCY A;  4OZT E;  3FEJ A;  4PWL A;  4IVW A;  3E00 A;  1I7I A;  3KWY A;  2AO6 A;  4PPP A;  1FD0 A;  5KRA A;  3VT7 A;  3ET1 A;  3K22 A;  3Q95 B;  4RUO X;  4MGD B;  5DKG A;  3B66 A;  3TX7 B;  3H52 A;  2IOG A;  2OCF A;  2A3I A;  3CDP A;  2AMA A;  5IAW A;  4WPF A;  4DK7 A;  2VSR A;  5DXG A;  4CI5 A;  1YOK A;  2ZLA A;  3FLI A;  3G9E A;  3VN2 A;  3CJW A;  2FVJ A;  3BQD A;  3VHU A;  4E2J A;  2QA8 A;  4A4W A;  1P93 A;  2XYW A;  2AM9 A;  3AUQ A;  1Y0S A;  5DYB A;  4J24 A;  1XQ3 A;  3KDT A;  5EGV A;  3VSP A;  1ILG A;  2P7G A;  5DIG A;  4YNK A;  3PEQ A;  2Q60 A;  1NQ2 A;  1FM6 D;  2QA8 B;  5DL4 A;  4JYG A;  1RDT A;  2NW4 A;  4S14 A;  4P6W A;  4RUJ A;  4JYI A;  4OFR A;  2YLY A;  5SYZ A;  1FM9 D;  2JFA A;  3VI8 A;  2O4R A;  3ZQT A;  1SQN A;  3K23 A;  2VV4 A;  5APH A;  5C4T A;  5L11 A;  2QW4 A;  4POH A;  4E4K A;  5AVI A;  5GIE A;  4MGB A;  2JFA B;  4FGY A;  2VV2 A;  3L3Z A;  5G43 A;  3AZ1 A;  2QA6 A;  5H1E A;  5HJP A;  3P89 A;  4MGB B;  4HEE X;  5KD9 A;  3A40 X;  3B68 A;  4WQP A;  3W0C A;  3UU7 A;  5JJM A;  2AX8 A;  1X7R A;  2ZXZ A;  5HJP B;  3KFC A;  2POB A;  5FQV A;  4K7A A;  5G5W A;  5AZV A;  3AZ2 A;  3BEJ A;  4EM9 A;  1S9P A;  2JF9 A;  3UU7 B;  5JJM B;  2J7Y A;  1N4H A;  1XNX A;  4FN9 A;  1ZGY A;  5DVV A;  5KCE A;  3U9Q A;  4IW6 A;  5DLR A;  4ZOM A;  1U3S A;  3CWD A;  2ZKC A;  1SKX A;  3CQV A;  3GD2 A;  5G46 A;  3AX8 A;  3X1H A;  4J26 A;  2AB2 A;  1XIU A;  2ZMJ A;  3DY6 A;  3WT7 A;  4OZR U;  4DOS A;  2QE4 A;  2H77 A;  1S9Q A;  1L2J A;  4PF3 A;  3F5C A;  1R1K A;  5KRL A;  4ZJR A;  3OLL A;  2HB7 A;  5DUE A;  2GL8 A;  3CTB A;  3N00 A;  3BC5 A;  1ZAF A;  4ZO1 B;  2P7Z A;  3F5C B;  4HLW A;  3KYT A;  5JY3 A;  2QTU A;  1XJ7 A;  3GN8 A;  4FHH A;  4Q50 A;  4G20 A;  2PIW A;  3PO9 A;  5DUG A;  5LWP A;  4TUZ A;  2NV7 A;  2PIO A;  5DZ3 A;  1XV9 B;  3ILZ A;  4J5X A;  5B5B A;  1K74 D;  4OKB A;  4IV2 A;  5AK2 A;  2NXX A;  3WTQ A;  1T63 A;  2Q6S A;  4Y29 A;  2P1U A;  1KV6 A;  4MGA A;  4IA3 A;  5AZT A;  3CS4 A;  4QM0 A;  1Z5X E;  2QXS A;  4G1Z A;  1R20 D;  1YIM A;  4NB6 A;  3WT5 A;  1S0Z A;  1KKQ A;  2GPU A;  2IOK A;  4MGA B;  5KRC A;  3R29 A;  3D24 A;  4JGV A;  2ZK2 A;  4OK1 A;  5DMF A;  1XOW A;  4IWF A;  1ILH A;  2Q1H A;  5AYG A;  3PCU A;  5LGA A;  3OKI A;  2EWP A;  4IU7 A;  4OH5 A;  5DI7 A;  1FM9 A;  5DXB A;  2I4P A;  3B0T A;  4OH6 A;  3E94 A;  5IXK A;  1XNN A;  5A86 A;  3FXV A;  1XB7 A;  3IXP D;  1E3K A;  3OMK A;  3UUA A;  3UP3 A;  3HM1 A;  3OSW A;  2B50 A;  4R6S A;  5DK9 A;  5DXB B;  5GIC A;  2ZL9 A;  1X76 A;  3NOA A;  5AAV A;  4MGC A;  4IA1 A;  3OLF A;  3VRT A;  5AWK A;  3B1M A;  5DMC A;  4OFU A;  3UUA B;  3KPZ A;  3V49 A;  4XI3 A;  2ZNO A;  3W0A A;  3DZU D;  3HQ5 A;  2I4Z A;  1RKG A;  2ATH A;  1HJ1 A;  1XP6 A;  2V7C A;  4OKT A;  3RLL A;  5KRH A;  5KCW A;  1XLS A;  1EXX A;  2V0V A;  5APK A;  4XTA A;  5DWJ A;  2QPY A;  2ZVT A;  1XDK A;  3SP6 A;  2ZY0 A;  1BSX A;  4O8F A;  1GWR A;  1GWQ A;  1MV9 A;  3ADW A;  3ET2 A;  3H0A D;  4S0S A;  1M2Z A;  2HWR A;  1H9U A;  2QSE A;  1U9E A;  2AA6 A;  4PP5 A;  1XDK B;  1LBD A;  2Q5G A;  1X78 A;  3B0W A;  5G42 A;  4KZI A;  5AWJ A;  4RMC A;  5C4U A;  3VRU A;  2YLP A;  3FUR A;  1XQC A;  4KZJ A;  1Z95 A;  3AUR A;  1ZDT A;  3B65 A;  3D5F A;  5CJ6 A;  1U3R A;  2PJL A;  1M7W A;  1FCX A;  4WHF A;  5DKS A;  1RK3 A;  2G44 A;  3ADX A;  3KBA A;  5FQR A;  5DWG A;  3ET3 A;  1X7B A;  4OIL A;  1K4W A;  4N73 A;  1OT7 A;  2AA2 A;  1PQ9 A;  3OOF A;  2AX6 A;  1G5Y A;  4QK4 A;  5DV3 A;  1I38 A;  2P15 A;  3IPS A;  3HC6 A;  4RE8 A;  3DCU A;  3W5P A;  5DXR A;  2GIU A;  2HWQ A;  4J5W C;  1QKU A;  1M13 A;  1K74 A;  4B7W A;  2AWH A;  4R2U A;  2HC4 A;  2F4B A;  3FS1 A;  2O9I A;  4G2I A;  3VRV A;  3W0G A;  1T7R A;  1PQ6 A;  3KMR A;  5I4V A;  3HVL A;  3R2A A;  2Q61 A;  1NAV A;  2AX7 A;  1Y0X X;  1DKF A;  2YJA B;  5DX3 A;  3A2H A;  3WFF A;  3M7R A;  2ZMH A;  3P8X A;  5AVL A;  4ONI A;  4JAZ A;  3CS8 A;  3A3Z X;  3L3X A;  1DKF B;  1YMT A;  4PRG A;  5DWL A;  5DX3 B;  1YOW A;  4A2J A;  1T65 A;  3CDS A;  4ITE A;  4L98 A;  1YYE A;  3LBD A;  2Q5P A;  4A4V A;  5KRF A;  1PRG A;  3CLD A;  3CS6 A;  3ADT A;  3VHW A;  5E1C A;  3WMH A;  4E4Q A;  3V9T A;  1EXA A;  2POG A;  3IXP A;  4M8H A;  2J4A A;  3ADU A;  5ICK A;  4IV4 A;  5DZH A;  5M96 A;  1QKM A;  3PRG A;  5EJV A;  4OAR A;  3WJ5 A;  2ZNQ A;  3JZB A;  3HZF A;  2FSZ A;  3A78 A;  2E2R A;  1U3Q A;  2OM9 A;  4YMQ A;  3K8S A;  5DXK A;  4OJ4 A;  2QZO A;  4X1F A;  3ZRA A;  4DK8 A;  5F9B A;  1YP0 A;  1GS4 A;  3D90 A;  1XP1 A;  3OMP A;  4WHG A;  4XHD A;  3HC5 A;  3IA6 A;  5KRM A;  5KRO A;  5KCU A;  1NYX A;  2QZO B;  1Z5X U;  2GPV A;  3OLS A;  2Q3Y A;  3H0A A;  2ZXN A;  3FC6 B;  2XYJ A;  1SJ0 A;  1ERR A;  2OUZ A;  2QR9 A;  5IZ0 A;  3ZR7 A;  1I37 A;  2ZK4 A;  1PQC A;  4OIU A;  4QE6 A;  2P7A A;  3D57 A;  5FQS A;  1HG4 A;  4P6X A;  5DXP A;  4PP6 A;  5EHJ A;  3A2J A;  3TKM A;  1ZDU A;  3W5T A;  5DWI A;  1XV9 A;  4DM6 A;  3A9E A;  4RMD A;  1S0X A;  2ABI A;  4OKW A;  5DXQ A;  1XPC A;  4NQA B;  2PIU A;  4REE A;  5DID A;  1G50 A;  3GWS X;  4XUM A;  5HYR A;  3OS8 C;  3B0Q A;  3ZRB A;  4OKX A;  3OZ0 A;  1UPV A;  3A9E B;  2ACL A;  1ZH7 A;  5E14 A;  3FAL A;  2GP7 A;  5DVS A;  5DKB A;  2OVM A;  2YJD A;  3ERD A;  2FAI A;  3V9Y A;  3AN3 A;  5AAU A;  3WGP A;  1L2I A;  5HYK A;  4K4J A;  4UDB A;  2ACL B;  4S0T A;  3X36 A;  2P54 A;  5KRI A;  4OGH A;  3FAL B;  5DIE A;  4TV1 A;  4LBD A;  2QXM A;  3DZY D;  1R6G A;  2R40 D;  4REF A;  2GPP A;  2HAS A;  4OJB A;  2Q7K A;  2PKL A;  1IE8 A;  1FM6 A;  2ZFX A;  4IUI A;  4X1G A;  5DU5 A;  4TV1 B;  3UVV B;  1A28 A;  2Q7J A;  3HOD A;  1Y9R A;  4APU A;  3PLZ A;  1ERE A;  2HBH A;  2ZK3 A;  3DCT A;  5DY8 A;  5G45 A;  2HAR A;  3L03 A;  4OHA A;  2Z4B A;  5E15 A;  5KCT A;  5FQT A;  3TY0 A;  3KMZ A;  2QGT A;  1UHL A;  4OZT U;  3RLJ A;  1NQ7 A;  2ZXM A;  3L0J A;  3MNO A;  4K6I A;  1XLS E;  4OC7 A;  5DV6 A;  1NUO A;  3P0U A;  1RDT D;  1X7E A;  3QT0 A;  1RKH A;  1UHL B;  4PPS A;  4RZG A;  4UDC A;  1YIN A;  2P4Y A;  2Q6J A;  3OS9 A;  5FQP A;  2OZ7 A;  1XZX X;  3O1E A;  3UP0 A;  3HLV A;  3VT5 A;  2QAB A;  3SP9 A;  2Q7L A;  2XKW A;  3L0L A;  5K13 A;  5GT4 A;  2Q59 A;  1XVP A;  3MNP A;  2I0J A;  3X31 A;  1PCG A;  2ZK5 A;  5KRK A;  2Q6R A;  3W5R A;  3FEI A;  4CI4 A;  2AMB A;  1MZN A;  4UDD A;  3AN4 A;  2ZAS A;  1G2N A;  1XVP B;  2Q59 B;  1FCZ A;  3MNE A;  3VJS A;  2Q5S A;  3OSI A;  4IVY A;  4ZNH A;  3KMG A;  2HB8 A;  3O1D A;  5DRM A;  5DTV A;  4IQR A;  4M8E A;  2AYR A;  3A2I A;  3ADV A;  4IS8 A;  1NAX A;  1VJB A;  1Q4X A;  2LBD A;  3RVF A;  4J5W A;  3GYT A;  3VJI A;  3VTC A;  2G0H A;  4MG8 A;  5E19 A;  2J7X A;  1OSH A;  4WLB A;  2ZNN A;  2YFE A;  3R5N A;  1TFC A;  2Q7I A;  4R06 A;  5KCC A;  4EMA A;  1YA3 A;  4MG7 A;  4MG8 B;  1PZL A;  3VT9 A;  5ACC A;  1R1K D;  3OAP A;  4ZJW A;  1KNU A;  4N5G A;  2B1V A;  5C4O A;  2Q8S A;  4OJ9 A;  1S19 A;  4ZNW A;  4G1Y A;  4MG7 B;  4BCR A;  4MG9 B;  3V9V A;  2H79 A;  2W8Y A;  1YY4 A;  2AAX A;  3V3Q A;  4PLD A;  2PNU A;  4DMA A;  1R20 A;  3DZY A;  5E0X A;  2R40 A;  3JZC A;  4RZF A;  4IA2 A;  3GWX A;  4JL4 A;  4YPQ A;  1T73 A;  3E7C A;  4RWV A;  2YLQ A;  4PP3 A;  5G3J A;  2YAT A;  4LTW A;  1T79 A;  2YLO A;  3F7D A;  3G0W A;  1T74 A;  5KCD A;  5KRJ A;  1T7T A;  4RAK A;  1K7L A;  1RJK A;  2PRG A;  3G8O A;  5DZ1 A;  5JI0 D;  2R6Y A;  2XYX A;  4ZNT A;  2R6W A;  5E0W A;  2ZNP A;  3VT6 A;  5DYD A;  2G0G A;  1NHZ A;  2VV1 A;  2HAM A;  4IWC A;  4G2H A;  5DXE A;  3VSO A;  3W5Q A;  3X1I A;  4LNW A;  4ITF A;  5DWE A;  2PIQ A;  5EC9 A;  4POJ A;  4L96 A;  4ZN7 A;  5KR9 A;  4F9M A;  1WM0 X;  2VV1 B;  1DB1 A;  2PIX A;  3OGT A;  4ZO1 X;  3VTD A;  3DZU A;  3R8A A;  4OIV A;  3GBK A;  1UPW A;  2Q1V A;  2AA5 A;  2HVC A;  4XLD A;  3P88 A;  4N8R A;  3TKC A;  2YHD A;  3IPQ A;  3SZ1 A;  1ZUC A;  5DRJ A;  3OZJ A;  2J14 A;  3FC6 A;  3AUN A;  4FHI A;  4OEA A;  2BAW A;  3UUD A;  2Q70 A;  5DUH A;  5DXM A;  5KCF A;  2VV4 B;  1QKN A;  4NUF A;  4MG6 A;  3AFR A;  3B3K A;  4RUP A;  5HZC A;  2I0G A;  1LV2 A;  1NRL A;  2PIT A;  5DSH A;  2PIP L;  3UUD B;  3OS8 A;  4RFW A;  3D6D A;  4XAO A;  1N83 A;  5APJ A;  1ZKY A;  3WFG A;  2HCD A;  4DM8 A;  3L0E A;  3R8I A;  4UDA A;  2QGW A;  2HFP A;  4WVD A;  3B67 A;  4S15 A;  2PIR A;  2NXX E;  5HJS A;  3VJT A;  1QKT A;  3WT6 A;  4ZI1 A;  5L7E A;  4QE8 A;  5DZI A;  3VJH A;  2OVH A;  3B0R A;  4XUH A;  4IA7 A;  4XT9 A;  4ZNV A;  1T76 A;  2XHS A;  1GWX A;  3PBA A;  5EI1 A;  1SR7 A;  1XP9 A;  3GZ9 A;  1PDU A;  2P1T A;  3DR1 A;  3OMO A;  4YT1 A;  3VT8 A;  3R5M A;  4Q13 A;  2QH6 A;  2VV0 A;  2PIV A;  2GWX A;  5L7H A;  5L7G A;  3E00 D;  3ET0 A;  3IPU A;  2G5O A;  3VT3 A;  2ZK6 A;  3G8I A;  4MG5 A;  5DZ0 A;  3UVV A;  5EIT A;  4PLE A;  5KYA A;  1NDE A;  3ERT A;  4CSJ A;  4ZN9 A;  4KZM A;  4LSJ A;  2ZK0 A;  4MDD A;  1UOM A;  2ZLC A;  4JYH A;  5C4S A;  2ZBS A;  3ADS A;  3S9S A;  2B23 A;  2NPA A;  3VTB A;  2REW A;  1A52 A;  3UUC A;  3T03 A;  3L1B A;  1OSV A;  1YUC A;  3NSQ A;  4TUZ B;  4NIE A;  4G21 A;  2O4J A;  3RUU A;  1MVC A;  4PXM A;  5B41 A;  3OMM A;  3DT3 A;  3W0Y A;  4ZNS A;  1T7M A;  4PVU A;  3VT4 A;  3W0I A;  4DOR A;  5KYJ A;  3OKH A;  4OED A;  3FUG A;  4OZR E;  5ETH A;  2ZMI A;  1N46 A;  1T7F A;  3WWR A;  4OLM A;  3B5R A;  2VV3 A;  3GYU A; 
#chains in the Genus database with same CATH homology
 1R5K A;  4J5X C;  3EYB A;  1NQ1 A;  1NQ0 A;  2AX9 A;  3RY9 A;  1P8D A;  4N1Y A;  3W0J A;  3V3E A;  1IE9 A;  3VRW A;  2Z4J A;  1OVL A;  3VHV A;  3R8D A;  4QL8 A;  5HCV A;  2QNV A;  2JJ3 A;  2BJ4 A;  3RUT A;  3HO0 A;  1X7J A;  2I4J A;  1OVL B;  4FNE A;  4ZNU A;  3OOK A;  2BJ4 B;  3LMP A;  5G44 A;  3NSP A;  5GID A;  2PIN A;  4LNX A;  1E3G A;  4QJR A;  4RZE A;  5E7V A;  5AAV B;  4DQM A;  3IMY A;  3WJ4 A;  1YJE A;  4OEZ A;  1I7G A;  5DKE A;  2GPO A;  2AXA A;  1ZEO A;  4OEY A;  1PK5 A;  2IHQ A;  4NY9 A;  1T5Z A;  5DV8 A;  2VST A;  2ZK1 A;  3OSA A;  1FBY A;  2P1V A;  3KDU A;  4Q0A C;  3K6P A;  5DP0 A;  3V4A A;  1XAP A;  3OMQ A;  4MG9 A;  2AA7 A;  3AZ3 A;  2QMV A;  4IW8 A;  4RME A;  5DVC A;  4G1D A;  1TXI A;  1G1U A;  3W0H A;  2OAX A;  2B1Z A;  2GTK A;  3Q95 A;  4MGD A;  1FCY A;  4OZT E;  3FEJ A;  4PWL A;  4IVW A;  3E00 A;  1I7I A;  3KWY A;  2AO6 A;  4PPP A;  1FD0 A;  5KRA A;  3VT7 A;  3ET1 A;  3K22 A;  3Q95 B;  4RUO X;  4MGD B;  5DKG A;  3B66 A;  3TX7 B;  3H52 A;  2IOG A;  2OCF A;  2A3I A;  3CDP A;  2AMA A;  5IAW A;  4WPF A;  4DK7 A;  2VSR A;  5DXG A;  4CI5 A;  1YOK A;  2ZLA A;  3FLI A;  3G9E A;  3VN2 A;  3CJW A;  2FVJ A;  3BQD A;  3VHU A;  4E2J A;  2QA8 A;  4A4W A;  1P93 A;  2XYW A;  2AM9 A;  3AUQ A;  1Y0S A;  5DYB A;  4J24 A;  1XQ3 A;  3KDT A;  5EGV A;  3VSP A;  1ILG A;  2P7G A;  5DIG A;  4YNK A;  3PEQ A;  2Q60 A;  1NQ2 A;  1FM6 D;  2QA8 B;  5DL4 A;  4JYG A;  1RDT A;  2NW4 A;  4S14 A;  4P6W A;  4RUJ A;  4JYI A;  4OFR A;  2YLY A;  5SYZ A;  1FM9 D;  2JFA A;  3VI8 A;  2O4R A;  3ZQT A;  1SQN A;  3K23 A;  2VV4 A;  5APH A;  5C4T A;  5L11 A;  2QW4 A;  4POH A;  4E4K A;  5AVI A;  5GIE A;  4MGB A;  2JFA B;  4FGY A;  2VV2 A;  3L3Z A;  5G43 A;  3AZ1 A;  2QA6 A;  5H1E A;  5HJP A;  3P89 A;  4MGB B;  4HEE X;  5KD9 A;  3A40 X;  3B68 A;  4WQP A;  3W0C A;  3UU7 A;  5JJM A;  2AX8 A;  1X7R A;  2ZXZ A;  5HJP B;  3KFC A;  2POB A;  5FQV A;  4K7A A;  5G5W A;  5AZV A;  3AZ2 A;  3BEJ A;  4EM9 A;  1S9P A;  2JF9 A;  3UU7 B;  5JJM B;  2J7Y A;  1N4H A;  1XNX A;  4FN9 A;  1ZGY A;  5DVV A;  5KCE A;  3U9Q A;  4IW6 A;  5DLR A;  4ZOM A;  1U3S A;  3CWD A;  2ZKC A;  1SKX A;  3CQV A;  3GD2 A;  5G46 A;  3AX8 A;  3X1H A;  4J26 A;  2AB2 A;  1XIU A;  2ZMJ A;  3DY6 A;  3WT7 A;  4OZR U;  4DOS A;  2QE4 A;  2H77 A;  1S9Q A;  1L2J A;  4PF3 A;  3F5C A;  1R1K A;  5KRL A;  4ZJR A;  3OLL A;  2HB7 A;  5DUE A;  2GL8 A;  3CTB A;  3N00 A;  3BC5 A;  1ZAF A;  4ZO1 B;  2P7Z A;  3F5C B;  4HLW A;  3KYT A;  5JY3 A;  2QTU A;  1XJ7 A;  3GN8 A;  4FHH A;  4Q50 A;  4G20 A;  2PIW A;  3PO9 A;  5DUG A;  5LWP A;  4TUZ A;  2NV7 A;  2PIO A;  5DZ3 A;  1XV9 B;  3ILZ A;  4J5X A;  5B5B A;  1K74 D;  4OKB A;  4IV2 A;  5AK2 A;  2NXX A;  3WTQ A;  1T63 A;  2Q6S A;  4Y29 A;  2P1U A;  1KV6 A;  4MGA A;  4IA3 A;  5AZT A;  3CS4 A;  4QM0 A;  1Z5X E;  2QXS A;  4G1Z A;  1R20 D;  1YIM A;  4NB6 A;  3WT5 A;  1S0Z A;  1KKQ A;  2GPU A;  2IOK A;  4MGA B;  5KRC A;  3R29 A;  3D24 A;  4JGV A;  2ZK2 A;  4OK1 A;  5DMF A;  1XOW A;  4IWF A;  1ILH A;  2Q1H A;  5AYG A;  3PCU A;  5LGA A;  3OKI A;  2EWP A;  4IU7 A;  4OH5 A;  5DI7 A;  1FM9 A;  5DXB A;  2I4P A;  3B0T A;  4OH6 A;  3E94 A;  5IXK A;  1XNN A;  5A86 A;  3FXV A;  1XB7 A;  3IXP D;  1E3K A;  3OMK A;  3UUA A;  3UP3 A;  3HM1 A;  3OSW A;  2B50 A;  4R6S A;  5DK9 A;  5DXB B;  5GIC A;  2ZL9 A;  1X76 A;  3NOA A;  5AAV A;  4MGC A;  4IA1 A;  3OLF A;  3VRT A;  5AWK A;  3B1M A;  5DMC A;  4OFU A;  3UUA B;  3KPZ A;  3V49 A;  4XI3 A;  2ZNO A;  3W0A A;  3DZU D;  3HQ5 A;  2I4Z A;  1RKG A;  2ATH A;  1HJ1 A;  1XP6 A;  2V7C A;  4OKT A;  3RLL A;  5KRH A;  5KCW A;  1XLS A;  1EXX A;  2V0V A;  5APK A;  4XTA A;  5DWJ A;  2QPY A;  2ZVT A;  1XDK A;  3SP6 A;  2ZY0 A;  1BSX A;  4O8F A;  1GWR A;  1GWQ A;  1MV9 A;  3ADW A;  3ET2 A;  3H0A D;  4S0S A;  1M2Z A;  2HWR A;  1H9U A;  2QSE A;  1U9E A;  2AA6 A;  4PP5 A;  1XDK B;  1LBD A;  2Q5G A;  1X78 A;  3B0W A;  5G42 A;  4KZI A;  5AWJ A;  4RMC A;  5C4U A;  3VRU A;  2YLP A;  3FUR A;  1XQC A;  4KZJ A;  1Z95 A;  3AUR A;  1ZDT A;  3B65 A;  3D5F A;  5CJ6 A;  1U3R A;  2PJL A;  1M7W A;  1FCX A;  4WHF A;  5DKS A;  1RK3 A;  2G44 A;  3ADX A;  3KBA A;  5FQR A;  5DWG A;  3ET3 A;  1X7B A;  4OIL A;  1K4W A;  4N73 A;  1OT7 A;  2AA2 A;  1PQ9 A;  3OOF A;  2AX6 A;  1G5Y A;  4QK4 A;  5DV3 A;  1I38 A;  2P15 A;  3IPS A;  3HC6 A;  4RE8 A;  3DCU A;  3W5P A;  5DXR A;  2GIU A;  2HWQ A;  4J5W C;  1QKU A;  1M13 A;  1K74 A;  4B7W A;  2AWH A;  4R2U A;  2HC4 A;  2F4B A;  3FS1 A;  2O9I A;  4G2I A;  3VRV A;  3W0G A;  1T7R A;  1PQ6 A;  3KMR A;  5I4V A;  3HVL A;  3R2A A;  2Q61 A;  1NAV A;  2AX7 A;  1Y0X X;  1DKF A;  2YJA B;  5DX3 A;  3A2H A;  3WFF A;  3M7R A;  2ZMH A;  3P8X A;  5AVL A;  4ONI A;  4JAZ A;  3CS8 A;  3A3Z X;  3L3X A;  1DKF B;  1YMT A;  4PRG A;  5DWL A;  5DX3 B;  1YOW A;  4A2J A;  1T65 A;  3CDS A;  4ITE A;  4L98 A;  1YYE A;  3LBD A;  2Q5P A;  4A4V A;  5KRF A;  1PRG A;  3CLD A;  3CS6 A;  3ADT A;  3VHW A;  5E1C A;  3WMH A;  4E4Q A;  3V9T A;  1EXA A;  2POG A;  3IXP A;  4M8H A;  2J4A A;  3ADU A;  5ICK A;  4IV4 A;  5DZH A;  5M96 A;  1QKM A;  3PRG A;  5EJV A;  4OAR A;  3WJ5 A;  2ZNQ A;  3JZB A;  3HZF A;  2FSZ A;  3A78 A;  2E2R A;  1U3Q A;  2OM9 A;  4YMQ A;  3K8S A;  5DXK A;  4OJ4 A;  2QZO A;  4X1F A;  3ZRA A;  4DK8 A;  5F9B A;  1YP0 A;  1GS4 A;  3D90 A;  1XP1 A;  3OMP A;  4WHG A;  4XHD A;  3HC5 A;  3IA6 A;  5KRM A;  5KRO A;  5KCU A;  1NYX A;  2QZO B;  1Z5X U;  2GPV A;  3OLS A;  2Q3Y A;  3H0A A;  2ZXN A;  3FC6 B;  2XYJ A;  1SJ0 A;  1ERR A;  2OUZ A;  2QR9 A;  5IZ0 A;  3ZR7 A;  1I37 A;  2ZK4 A;  1PQC A;  4OIU A;  4QE6 A;  2P7A A;  3D57 A;  5FQS A;  1HG4 A;  4P6X A;  5DXP A;  4PP6 A;  5EHJ A;  3A2J A;  3TKM A;  1ZDU A;  3W5T A;  5DWI A;  1XV9 A;  4DM6 A;  3A9E A;  4RMD A;  1S0X A;  2ABI A;  4OKW A;  5DXQ A;  1XPC A;  4NQA B;  2PIU A;  4REE A;  5DID A;  1G50 A;  3GWS X;  4XUM A;  5HYR A;  3OS8 C;  3B0Q A;  3ZRB A;  4OKX A;  3OZ0 A;  1UPV A;  3A9E B;  2ACL A;  1ZH7 A;  5E14 A;  3FAL A;  2GP7 A;  5DVS A;  5DKB A;  2OVM A;  2YJD A;  3ERD A;  2FAI A;  3V9Y A;  3AN3 A;  5AAU A;  3WGP A;  1L2I A;  5HYK A;  4K4J A;  4UDB A;  2ACL B;  4S0T A;  3X36 A;  2P54 A;  5KRI A;  4OGH A;  3FAL B;  5DIE A;  4TV1 A;  4LBD A;  2QXM A;  3DZY D;  1R6G A;  2R40 D;  4REF A;  2GPP A;  2HAS A;  4OJB A;  2Q7K A;  2PKL A;  1IE8 A;  1FM6 A;  2ZFX A;  4IUI A;  4X1G A;  5DU5 A;  4TV1 B;  3UVV B;  1A28 A;  2Q7J A;  3HOD A;  1Y9R A;  4APU A;  3PLZ A;  1ERE A;  2HBH A;  2ZK3 A;  3DCT A;  5DY8 A;  5G45 A;  2HAR A;  3L03 A;  4OHA A;  2Z4B A;  5E15 A;  5KCT A;  5FQT A;  3TY0 A;  3KMZ A;  2QGT A;  1UHL A;  4OZT U;  3RLJ A;  1NQ7 A;  2ZXM A;  3L0J A;  3MNO A;  4K6I A;  1XLS E;  4OC7 A;  5DV6 A;  1NUO A;  3P0U A;  1RDT D;  1X7E A;  3QT0 A;  1RKH A;  1UHL B;  4PPS A;  4RZG A;  4UDC A;  1YIN A;  2P4Y A;  2Q6J A;  3OS9 A;  5FQP A;  2OZ7 A;  1XZX X;  3O1E A;  3UP0 A;  3HLV A;  3VT5 A;  2QAB A;  3SP9 A;  2Q7L A;  2XKW A;  3L0L A;  5K13 A;  5GT4 A;  2Q59 A;  1XVP A;  3MNP A;  2I0J A;  3X31 A;  1PCG A;  2ZK5 A;  5KRK A;  2Q6R A;  3W5R A;  3FEI A;  4CI4 A;  2AMB A;  1MZN A;  4UDD A;  3AN4 A;  2ZAS A;  1G2N A;  1XVP B;  2Q59 B;  1FCZ A;  3MNE A;  3VJS A;  2Q5S A;  3OSI A;  4IVY A;  4ZNH A;  3KMG A;  2HB8 A;  3O1D A;  5DRM A;  5DTV A;  4IQR A;  4M8E A;  2AYR A;  3A2I A;  3ADV A;  4IS8 A;  1NAX A;  1VJB A;  1Q4X A;  2LBD A;  3RVF A;  4J5W A;  3GYT A;  3VJI A;  3VTC A;  2G0H A;  4MG8 A;  5E19 A;  2J7X A;  1OSH A;  4WLB A;  2ZNN A;  2YFE A;  3R5N A;  1TFC A;  2Q7I A;  4R06 A;  5KCC A;  4EMA A;  1YA3 A;  4MG7 A;  4MG8 B;  1PZL A;  3VT9 A;  5ACC A;  1R1K D;  3OAP A;  4ZJW A;  1KNU A;  4N5G A;  2B1V A;  5C4O A;  2Q8S A;  4OJ9 A;  1S19 A;  4ZNW A;  4G1Y A;  4MG7 B;  4BCR A;  4MG9 B;  3V9V A;  2H79 A;  2W8Y A;  1YY4 A;  2AAX A;  3V3Q A;  4PLD A;  2PNU A;  4DMA A;  1R20 A;  3DZY A;  5E0X A;  2R40 A;  3JZC A;  4RZF A;  4IA2 A;  3GWX A;  4JL4 A;  4YPQ A;  1T73 A;  3E7C A;  4RWV A;  2YLQ A;  4PP3 A;  5G3J A;  2YAT A;  4LTW A;  1T79 A;  2YLO A;  3F7D A;  3G0W A;  1T74 A;  5KCD A;  5KRJ A;  1T7T A;  4RAK A;  1K7L A;  1RJK A;  2PRG A;  3G8O A;  5DZ1 A;  5JI0 D;  2R6Y A;  2XYX A;  4ZNT A;  2R6W A;  5E0W A;  2ZNP A;  3VT6 A;  5DYD A;  2G0G A;  1NHZ A;  2VV1 A;  2HAM A;  4IWC A;  4G2H A;  5DXE A;  3VSO A;  3W5Q A;  3X1I A;  4LNW A;  4ITF A;  5DWE A;  2PIQ A;  5EC9 A;  4POJ A;  4L96 A;  4ZN7 A;  5KR9 A;  4F9M A;  1WM0 X;  2VV1 B;  1DB1 A;  2PIX A;  3OGT A;  4ZO1 X;  3VTD A;  3DZU A;  3R8A A;  4OIV A;  3GBK A;  1UPW A;  2Q1V A;  2AA5 A;  2HVC A;  4XLD A;  3P88 A;  4N8R A;  3TKC A;  2YHD A;  3IPQ A;  3SZ1 A;  1ZUC A;  5DRJ A;  3OZJ A;  2J14 A;  3FC6 A;  3AUN A;  4FHI A;  4OEA A;  2BAW A;  3UUD A;  2Q70 A;  5DUH A;  5DXM A;  5KCF A;  2VV4 B;  1QKN A;  4NUF A;  4MG6 A;  3AFR A;  3B3K A;  4RUP A;  5HZC A;  2I0G A;  1LV2 A;  1NRL A;  2PIT A;  5DSH A;  2PIP L;  3UUD B;  3OS8 A;  4RFW A;  3D6D A;  4XAO A;  1N83 A;  5APJ A;  1ZKY A;  3WFG A;  2HCD A;  4DM8 A;  3L0E A;  3R8I A;  4UDA A;  2QGW A;  2HFP A;  4WVD A;  3B67 A;  4S15 A;  2PIR A;  2NXX E;  5HJS A;  3VJT A;  1QKT A;  3WT6 A;  4ZI1 A;  5L7E A;  4QE8 A;  5DZI A;  3VJH A;  2OVH A;  3B0R A;  4XUH A;  4IA7 A;  4XT9 A;  4ZNV A;  1T76 A;  2XHS A;  1GWX A;  3PBA A;  5EI1 A;  1SR7 A;  1XP9 A;  3GZ9 A;  1PDU A;  2P1T A;  3DR1 A;  3OMO A;  4YT1 A;  3VT8 A;  3R5M A;  4Q13 A;  2QH6 A;  2VV0 A;  2PIV A;  2GWX A;  5L7H A;  5L7G A;  3E00 D;  3ET0 A;  3IPU A;  2G5O A;  3VT3 A;  2ZK6 A;  3G8I A;  4MG5 A;  5DZ0 A;  3UVV A;  5EIT A;  4PLE A;  5KYA A;  1NDE A;  3ERT A;  4CSJ A;  4ZN9 A;  4KZM A;  4LSJ A;  2ZK0 A;  4MDD A;  1UOM A;  2ZLC A;  4JYH A;  5C4S A;  2ZBS A;  3ADS A;  3S9S A;  2B23 A;  2NPA A;  3VTB A;  2REW A;  1A52 A;  3UUC A;  3T03 A;  3L1B A;  1OSV A;  1YUC A;  3NSQ A;  4TUZ B;  4NIE A;  4G21 A;  2O4J A;  3RUU A;  1MVC A;  4PXM A;  5B41 A;  3OMM A;  3DT3 A;  3W0Y A;  4ZNS A;  1T7M A;  4PVU A;  3VT4 A;  3W0I A;  4DOR A;  5KYJ A;  3OKH A;  4OED A;  3FUG A;  4OZR E;  5ETH A;  2ZMI A;  1N46 A;  1T7F A;  3WWR A;  4OLM A;  3B5R A;  2VV3 A;  3GYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...