3DZUD

Intact ppar gamma - rxr alpha nuclear receptor complex on dna bound with bvt.13, 9-cis retinoic acid and ncoa2 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
370
structure length
359
Chain Sequence
AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Retinoic acid receptor RXR-alpha
publication title Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 359
sequence length 370
ec nomenclature
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
D PF00105 zf-C4 Zinc finger, C4 type (two domains)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3dzuD02
3.30.50.10 Alpha Beta 2-Layer Sandwich Erythroid Transcription Factor GATA-1; Chain A Erythroid Transcription Factor GATA-1, subunit A 3dzuD01
2J14A 4OORA 2EBLA 1X7EA 5EMCA 1GNFA 1UPWA 4RWVA 5DXBA 4IWFA 4RAKA 4LSJA 3VN2A 4OLNA 5G44A 5C4SA 5H1EA 1PZLA 2QH6A 1YNWA 3WTQA 2AMBA 2YLOA 4FGYA 4PRGA 4OIUA 4XUMA 3UP3A 3PO9A 2Q70A 3R2AA 3OZJA 3UUAA 3DZYD 2VUUI 5JJMB 4AA6A 1BSXA 1S19A 4IA1A 4DORA 4S14A 5E69A 3BQDA 2YJAB 1XZXX 4PXMA 3VRUA 3BC5A 1FM9A 1PQ6A 3WT6A 5E6BA 2ZNNA 1XV9A 2PIPL 1X76A 3DCUA 5LWPA 5E7VA 1GWRA 2POGA 5DVCA 3W5RA 2Q7JA 4TMAI 4WQPA 3UVVB 3G8IA 3KYTA 5DXPA 2KAEA 1OSHA 2FVJA 5DWGA 2H77A 1NRLA 2I4ZA 3O1DA 1N46A 4PWLA 2ZASA 3CDSA 1NQ7A 2I4PA 4MGAA 5KRFA 4HC7A 3L0EA 4QE8A 1I7IA 4RUOX 5DWJA 3VT7A 3VT4A 2FF0A 3ET2A 4WHFA 3UP0A 5DSHA 2ZLAA 3B67A 3CS4A 2NPAA 3UU7A 4MGDA 3OS8A 4OJBA 2GPVA 4OEAA 2HVCA 3G99A 5DMCA 1Q4XA 3OMQA 4RZFA 5G42A 3E00A 3CJWA 3D5FA 2G0GA 4L98A 5KRAA 2ZMIA 5APJA 4DM6A 3FC6B 4OFUA 2O4JA 1YJEA 3RUUA 5IXKA 4CI5A 4OV7A 1X7BA 3SP9A 3OMPA 3VHVA 5HYKA 2JJ3A 4MG8A 3IXPA 5DI7A 4ZNSA 3CLDA 2B23A 1G1UA 2HANA 2QSEA 3AZ1A 3WFFA 5L7GA 1GAUA 2PIQA 1XQCA 4RZGA 1XLSA 3F7DA 3UUDA 5KCFA 4OKXA 2PIRA 1XP9A 4ZNTA 3CDPA 2F4BA 3LMPA 3OAPA 5APKA 5FQTA 5E6CA 4CN2C 4TNTA 3H52A 3SZ1A 3VRWA 3WJ5A 1XPCA 2ZLCA 3G6PA 1U3RA 1UOMA 5FQRA 5E6DA 1XDKB 2GIUA 1IE9A 3FS1A 3JZCA 4N73A 3U9QA 3VJHA 1YOWA 3W0AA 4A4VA 1GWXA 1TFCA 5GIDA 2HBHA 1RGDA 1N83A 3G0WA 2ACLB 5AZVA 2HCDA 5HYRA 2AA2A 1Z95A 4MGBA 1RDTD 2AM9A 3G8OA 3OSWA 4QM0A 1HJ1A 2YATA 2XYJA 1XVPB 3WT7A 5CBYA 4HCAA 5DIDA 1T7MA 1NAVA 5FQSA 1XJ7A 2ABIA 2AA5A 3VD6C 4ZNUA 1LATA 4CI4A 1HG4A 1Y0XX 5ICKA 2GATA 4IU7A 5DLRA 4O8FA 1FBYA 1YMTA 5DZHA 2NV7A 1ZGYA 5EI1A 2GWXA 3B5RA 2QXSA 3JZBA 3GN8A 2I0GA 3OGTA 1Z5XU 3GD2A 3GZ9A 3IXPD 3FLIA 4E4QA 4OLMA 5A86A 2HC4A 5G46A 2QE4A 4NY9A 4QE6A 4YT1A 2VV3A 2A3IA 2ZFXA 2ZL9A 4XT9A 3VRTA 4OKWA 3VSPA 2GTKA 2AAXA 2OCFA 3B3KA 1MVCA 3FALA 2FAIA 3FXVA 4TV1B 5DXEA 2ZK3A 4X1FA 4E4KA 4REEA 1PRGA 2Q5PA 3G6QA 2R6WA 2VV1B 2AA7A 2PJLA 2P7GA 2PKLA 3R8DA 2Q59A 3ZR7A 4ZOMA 2OVHA 4QK4A 2PIUA 1MV9A 4IW8A 2R40D 5DU5A 4ONIA 2AMAA 3CS6A 3OMKA 2ZNQA 2QTUA 1KNUA 1R20A 4WPFA 3FYLA 4JYHA 4IA7A 4PF3A 4R6SA 3VT5A 3X31A 1I7GA 4CN5A 5DX3B 1QKUA 2QR9A 1HCPA 3MNEA 2HFPA 2VV4B 3E7CA 1EXAA 1BY4A 2BJ4B 3FEJA 1E3KA 5HCVA 2QA8B 2JFAB 1R1KD 2ZKCA 1QKTA 4BCRA 5B41A 1UPVA 5E0XA 5CC0A 3DCTA 1LO1A 5DZ3A 3KDTA 2P54A 4E2JA 1R4IA 3RLLA 3ZQTA 5AWKA 2OM9A 5E1CA 4UDCA 3EYBA 1YOKA 1XP6A 3IPQA 5DRJA 1FCZA 1XB7A 4IS8A 3G9OA 4DOSA 3H0AD 1GLUA 4ZN9A 2FSZA 1ERRA 4PLEA 3FEIA 3KDUA 5AWJA 3N00A 3DZUA 3A40X 1ILGA 3B66A 2AXAA 2QA6A 2QGTA 4OKTA 4S0SA 1GATA 5L7HA 5KRHA 4OC7A 3GWXA 3V3EA 3GATA 2ZMJA 5SYZA 2QGWA 1DSZB 1G2NA 5DXKA 4N8RA 1KB4A 4CN7A 2VUTI 4J5WC 3IA6A 3VI8A 1YA3A 3Q95B 3D57A 5AK2A 2OZ7A 5CC1A 1VJBA 3DFXA 3NSQA 1T79A 2Q7KA 3HO0A 3M7RA 3G9PA 1ZUCA 1R20D 5E19A 3RLJA 5I4VA 4WLBA 4POJA 4MG7A 3R8IA 4HN6A 2PRGA 3V3QA 3B1MA 4OIVA 1NQ0A 2P1UA 4NUFA 3L0LA 4OGHA 2G5OA 4XLDA 5KRIA 1K7LA 2AX7A 5DP0A 4ONDA 1EREA 1S9QA 3FC6A 3PRGA 4G1YA 4IVWA 5AYGA 2C7AA 1LV2A 2Q7IA 2Q8SA 4M8HA 2QMVA 4MGCA 4XHDA 5DV3A 2I0JA 4OZTE 5DXBB 2ZXNA 4HC9A 1RDTA 5DTVA 4G2IA 5DVVA 1YNWB 1YUCA 4KZIA 1S0ZA 5DKSA 3UUAB 5HZCA 2B1ZA 3L0JA 1M2ZA 1YINA 3OOFA 1ZKYA 3B0TA 2HAMA 2GDAA 3KFCA 4IA2A 5KCWA 1E3GA 2AYRA 3WFGA 2AO6A 2GPUA 3MNOA 2HWQA 5KCUA 2J7YA 3KMRA 2GPOA 1U3QA 1U9EA 4OZRU 3KMZA 5C4TA 1FM6D 4JGVA 1XV9B 1Z5XE 3DZUD 5EHJA 2VV0A 4ZI1A 4G1DA 5DXGA 4OILA 3W5TA 1X7JA 1XDKA 1ZDTA 5E14A 3ADTA 2PINA 4Y29A 2GP7A 3A2JA 4DQMA 4EM9A 5DXMA 1XAPA 3RY9A 5DXRA 3L3ZA 2B1VA 4JYIA 3HC5A 3OKHA 5B5BA 2HB7A 2P1VA 3LBDA 4L96A 1R0OA 4A2JA 2XYXA 3B0QA 1XVPA 2VSTA 2NLLB 5KRCA 4OARA 2QW4A 3G6UA 2ENVA 4CN3D 2R40A 3FUGA 1EXXA 3QT0A 1ZH7A 1MZNA 4G1ZA 5G43A 2PIVA 3TKMA 1CITA 3AFRA 3HLVA 2HARA 1ILHA 2Z4BA 3VEKC 2QZOA 2AX8A 2E2RA 4G20A 4K7AA 5DY8A 3VT9A 2P7ZA 4OZTU 4JL4A 1GWQA 2QABA 2HASA 1T7RA 4J5XC 5AAVA 1NUOA 5EITA 3VSOA 4IQRA 4RE8A 1XIUA 4IA3A 4PP3A 3A3ZX 1QKNA 5DWEA 2QNVA 3CQVA 1DKFA 5E0WA 2JF9A 1KB6A 5M96A 3WGPA 1R1KA 2ATHA 3L03A 2VUSI 1X7RA 1A6YA 3L3XA 1OT7A 4K4JA 4MG8B 5GATA 1WM0X 2V7CA 3A78A 4ZO1B 1UHLA 5JY3A 2HANB 4IV4A 5DK9A 3ERTA 1LBDA 2GL8A 3W0JA 3G9MA 3SP6A 1K74A 1T63A 2VV1A 1M13A 3K6PA 4J5WA 4RMDA 2J4AA 5CJ6A 5FQPA 4CSJA 4DM8A 5KCDA 2G44A 2ZK2A 3WT5A 3H0AA 2XYWA 2ZBSA 1IE8A 1Y0SA 3AZ2A 4JAZA 3ERDA 4OKBA 1SQNA 3B68A 1RKGA 3PCUA 5KYAA 1U3SA 3W0IA 1Y9RA 1GDCA 3BEJA 1GS4A 2QPYA 4QJRA 2AWHA 5DX3A 1LV3A 5GT4A 2VV4A 5DUHA 1R0NB 2BJ4A 4TUZB 5IZ0A 1RK3A 4APUA 4MDDA 1R0NA 2VSRA 4KZMA 1NQ1A 3GBKA 2JFAA 2EWPA 2R6YA 3HVLA 4MGBB 4LNXA 3ADSA 4N1YA 2PNUA 4MG9A 2OVMA 3A9EA 5KYJA 4WHGA 2Q6JA 1T7TA 1NYXA 2ZK6A 2AB2A 5G5WA 4RMEA 5K13A 1NAXA 2Q6RA 2Q61A 3WMHA 3AURA 3MNPA 4IWCA 2IOKA 2NXXA 4OJ4A 4P6XA 5KRKA 3OSAA 5AVLA 4MG6A 3W0YA 2ZK1A 1RJKA 5ETHA 5GICA 1HCQA 3ADWA 3VJTA 5L0MA 3CTBA 4JYGA 3P88A 5JJMA 4NB6A 3P8XA 4ZNVA 3ZRBA 2OUZA 3KBAA 3D24A 5APHA 3O1EA 3IPUA 2Q60A 7GATA 3IMYA 1KKQA 4LNWA 4RUPA 4YNKA 4Q50A 1K74D 1DSZA 1OVLB 1XOWA 2G0HA 2REWA 2YLQA 3R29A 1ZAFA 3FALB 1R4OA 5LGAA 3ET1A 3Q95A 4DMAA 1FCXA 1R6GA 1PK5A 3UVVA 3V9VA 2OAXA 3V9TA 3S9SA 1KV6A 6GATA 3V9YA 3ADXA 4OZRE 1FM6A 1PQCA 3D90A 3FURA 3E94A 1X78A 5DWLA 4DK7A 3CS8A 4HN5A 5DVSA 2PITA 4RFWA 4EMAA 1XLSE 2Q3YA 3A2HA 4J5XA 3NOAA 5F9BA 3F5CB 5KRMA 5KRJA 1M7WA 3NSPA 3W0HA 3DY6A 4N5GA 3G9EA 3WJ4A 3HC6A 4FHIA 5DUGA 4NIEA 1R4RA 3ILZA 4ZJRA 4CN3A 3VRVA 4ZN7A 1KB2A 5DV8A 5EC9A 4S15A 5DWIA 3AZ3A 1XNXA 2ZNPA 3OKIA 5G45A 5GIEA 1RXRA 3IPSA 3VT3A 1TXIA 1L2IA 5KCEA 2ZNOA 4RUJA 4ZO1X 3PBAA 2I4JA 2P1TA 5KRLA 4XUHA 2V0VA 4FNEA 5DYDA 3X1IA 3HM1A 4F9MA 4PVUA 3B0WA 3VTBA 2B50A 5HJSA 4IUIA 5L7EA 4PPPA 3W0CA 3G97A 2YJDA 1XQ3A 4Q0AC 3AN4A 4ITEA 4S0TA 3VHUA 5DKGA 2Q1VA 1QKMA 3OLLA 2PIXA 4OK1A 5EMPA 3VT8A 4G21A 4UDBA 5DMFA 3A2IA 1FD0A 5DZ0A 5KCCA 5AAUA 1R5KA 1T73A 4M8EA 4PP6A 4UDDA 3VTCA 4WVDA 2IHQA 5DL4A 3G6RA 2NLLA 3PLZA 3HODA 3CBBA 4GATA 1SKXA 4R2UA 5KD9A 4LTWA 5KRBB 3ADUA 4HEEX 4XI3A 1T76A 2QXMA 4IV2A 1YP0A 2LBDA 3AUQA 3P89A 2W8YA 3DT3A 4J24A 4XAOA 5DYBA 3T03A 1YIMA 2P15A 4MG7B 5DIGA 5DKEA 3G8UA 2ACLA 1GA5A 3VTDA 3OOKA 5EMQA 2YHDA 3GWSX 5EJVA 4MGAB 3R8AA 2H79A 2J7XA 3W5PA 3UUCA 5HJPA 4OEDA 2NW4A 3P0UA 3OLFA 4IVYA 3TKCA 5EGVA 2PIWA 1NHZA 4PLDA 3UU7B 4MGDB 4Q13A 3VJSA 3W0GA 2HWRA 4PPSA 5DIEA 1FCYA 2GPPA 1PCGA 1S9PA 3HQ5A 3K8SA 3OS9A 3WWRA 2Q5SA 3VHWA 1FM9D 1P93A 4POHA 2VV2A 4X1GA 2AA6A 2PIOA 4OHAA 1A28A 4ZNHA 3X36A 3HZFA 5C4OA 5E6AA 2POBA 4A4WA 2NXXE 4FN9A 3ADVA 3G8XA 1HLZA 3ET0A 5JI0D 4ZNWA 4IW6A 4TV1A 2ZXMA 4XTAA 1SR7A 4J26A 3AUNA 3KMGA 1T7FA 1L2JA 1G50A 4K6IA 4OH6A 5AVIA 1T74A 3TX7B 5CBZA 2O9IA 1NQ2A 5DUEA 3OMOA 2Z4JA 2YFEA 4TUZA 4P6WA 1T65A 3D6DA 4REFA 5DV6A 3UUDB 3K23A 1ZDUA 4HLWA 3RVFA 4YMQA 4FHHA 1NDEA 3GYTA 4LBDA 1DB1A 3G6TA 1R0OB 3V49A 1RKHA 4ZJWA 2ZK5A 3PEQA 2YLYA 3L1BA 5KROA 3E00D 3VT6A 2Q6SA 3VJIA 1N4HA 3B0RA 4OEZA 3RUTA 2ZY0A 3G9JA 1PQ9A 2Q7LA 3AN3A 2QA8A 2QZOB 3DR1A 3DFVC 5AAVB 2ZVTA 3OSIA 5ACCA 3V4AA 4R06A 2ZK0A 2AX6A 1H9UA 3OS8C 3GYUA 3KWYA 1DKFB 4ITFA 2XKWA 4RZEA 5DXQA 5E15A 1OVLA 3OMMA 4QL8A 4MG5A 1K4WA 3DZYA 1OSVA 3R5NA 1A52A 1YYEA 4UDAA 1I38A 3OLSA 5AZTA 5G3JA 1HRAA 2BAWA 5KCTA 1UHLB 2O4RA 5HJPB 5C4UA 2ZMHA 3TY0A 1P8DA 3AX8A 4DK8A 4YPQA 1SJ0A 3CWDA 3ET3A 3W5QA 2HB8A 5L11A 1PDUA 4OH5A 2P4YA 1ZEOA 2M9WA 2Q1HA 2XHSA 1XNNA 4OFRA 3B65A 3ZRAA 3G9IA 2A66A 2P7AA 3X1HA 1G5YA 5IAWA 4KZJA 2YLPA 3F5CA 3R5MA 3K22A 2ZXZA 5DKBA 4OJ9A 2AX9A 2ZK4A 3OZ0A 1YY4A 5DRMA 2Q59B 5DZIA 3KPZA 4G2HA 4B7WA 1I37A 2IOGA 5CBXA 4OEYA 2Q5GA 5KR9A 5FQVA 4RMCA 5DZ1A 3M9EA 4NQAB 1S0XA 4PP5A 1T5ZA 4MG9B 1XP1A 3A9EB
chains in the Genus database with same CATH superfamily
2J14A 4OORA 2EBLA 1X7EA 5EMCA 1GNFA 1UPWA 4RWVA 5DXBA 4IWFA 4RAKA 4LSJA 3VN2A 4OLNA 5G44A 5C4SA 5H1EA 1PZLA 2QH6A 1YNWA 3WTQA 2AMBA 2YLOA 4FGYA 4PRGA 4OIUA 4XUMA 3UP3A 3PO9A 2Q70A 3R2AA 3OZJA 3UUAA 3DZYD 2VUUI 5JJMB 4AA6A 1BSXA 1S19A 4IA1A 4DORA 4S14A 5E69A 3BQDA 2YJAB 1XZXX 4PXMA 3VRUA 3BC5A 1FM9A 1PQ6A 3WT6A 5E6BA 2ZNNA 1XV9A 2PIPL 1X76A 3DCUA 5LWPA 5E7VA 1GWRA 2POGA 5DVCA 3W5RA 2Q7JA 4TMAI 4WQPA 3UVVB 3G8IA 3KYTA 5DXPA 2KAEA 1OSHA 2FVJA 5DWGA 2H77A 1NRLA 2I4ZA 2DS5A 3O1DA 1N46A 4PWLA 2ZASA 3CDSA 1NQ7A 2I4PA 4MGAA 5KRFA 4HC7A 3L0EA 4QE8A 1I7IA 4RUOX 5DWJA 3VT7A 3VT4A 2FF0A 3ET2A 4WHFA 3UP0A 5DSHA 2ZLAA 3B67A 3CS4A 2NPAA 3UU7A 4MGDA 3OS8A 4OJBA 2GPVA 4OEAA 2HVCA 3G99A 5DMCA 1Q4XA 3OMQA 4RZFA 5G42A 3E00A 3CJWA 3D5FA 2G0GA 4L98A 5KRAA 2ZMIA 5APJA 4DM6A 3FC6B 4OFUA 2O4JA 1YJEA 3RUUA 5IXKA 4CI5A 4OV7A 1X7BA 3SP9A 3OMPA 3VHVA 5HYKA 2JJ3A 4MG8A 3IXPA 5DI7A 4ZNSA 3CLDA 2B23A 1G1UA 2HANA 2QSEA 3AZ1A 3WFFA 5L7GA 1GAUA 2PIQA 1XQCA 4RZGA 1XLSA 3F7DA 3UUDA 5KCFA 4OKXA 2PIRA 1XP9A 4ZNTA 3CDPA 2F4BA 3LMPA 3OAPA 5APKA 5FQTA 5E6CA 4CN2C 4TNTA 3H52A 3SZ1A 3VRWA 3WJ5A 1XPCA 2ZLCA 3G6PA 1U3RA 1UOMA 5FQRA 5E6DA 1XDKB 2GIUA 1IE9A 3FS1A 3JZCA 4N73A 3U9QA 3VJHA 1YOWA 3W0AA 4A4VA 1GWXA 1TFCA 5GIDA 2HBHA 1RGDA 1N83A 3G0WA 2ACLB 5AZVA 2HCDA 5HYRA 2AA2A 1Z95A 4MGBA 1RDTD 2AM9A 3G8OA 3OSWA 4QM0A 1HJ1A 2YATA 2XYJA 1XVPB 3WT7A 5CBYA 4HCAA 5DIDA 1T7MA 1NAVA 5FQSA 1XJ7A 2ABIA 2AA5A 3VD6C 4ZNUA 1LATA 4CI4A 1HG4A 1Y0XX 5ICKA 2GATA 4IU7A 5DLRA 4O8FA 1FBYA 1YMTA 5DZHA 2NV7A 1ZGYA 5EI1A 2GWXA 3B5RA 2QXSA 3JZBA 3GN8A 2I0GA 3OGTA 1Z5XU 3GD2A 3GZ9A 3IXPD 3FLIA 4E4QA 4OLMA 5A86A 2HC4A 5G46A 2QE4A 4NY9A 4QE6A 4YT1A 2VV3A 2A3IA 2ZFXA 2ZL9A 4XT9A 3VRTA 4OKWA 3VSPA 2GTKA 2AAXA 2OCFA 3B3KA 1MVCA 3FALA 2FAIA 3FXVA 4TV1B 5DXEA 2ZK3A 4X1FA 4E4KA 4REEA 1PRGA 2Q5PA 3G6QA 2R6WA 2VV1B 2AA7A 2PJLA 2P7GA 2PKLA 3R8DA 2Q59A 3ZR7A 4ZOMA 2OVHA 4QK4A 2PIUA 1MV9A 4IW8A 2R40D 5DU5A 4ONIA 2AMAA 3CS6A 3OMKA 2ZNQA 2QTUA 1KNUA 1R20A 4WPFA 3FYLA 4JYHA 4IA7A 4PF3A 4R6SA 3VT5A 3X31A 1I7GA 4CN5A 5DX3B 1QKUA 2QR9A 1HCPA 3MNEA 2HFPA 2VV4B 3E7CA 1EXAA 1BY4A 2BJ4B 3FEJA 1E3KA 5HCVA 2QA8B 2JFAB 1R1KD 2ZKCA 1QKTA 4BCRA 5B41A 1UPVA 5E0XA 5CC0A 3DCTA 1LO1A 5DZ3A 3KDTA 2P54A 4E2JA 1R4IA 2DS6A 3RLLA 3ZQTA 5AWKA 2OM9A 5E1CA 4UDCA 3EYBA 1YOKA 1XP6A 3IPQA 5DRJA 1FCZA 1XB7A 4IS8A 3G9OA 4DOSA 3H0AD 1GLUA 4ZN9A 2FSZA 1ERRA 4PLEA 3FEIA 3KDUA 5AWJA 3N00A 3DZUA 3A40X 1ILGA 3B66A 2AXAA 2QA6A 2QGTA 4OKTA 4S0SA 1GATA 5L7HA 5KRHA 4OC7A 3GWXA 3V3EA 3GATA 2ZMJA 5SYZA 2QGWA 1DSZB 1G2NA 5DXKA 4N8RA 1KB4A 4CN7A 2VUTI 4J5WC 3IA6A 3VI8A 1YA3A 3Q95B 3D57A 5AK2A 2OZ7A 5CC1A 1VJBA 3DFXA 3NSQA 1T79A 2Q7KA 3HO0A 3M7RA 3G9PA 1ZUCA 1R20D 5E19A 3RLJA 5I4VA 4WLBA 4POJA 4MG7A 3R8IA 4HN6A 2PRGA 3V3QA 3B1MA 4OIVA 1NQ0A 2P1UA 4NUFA 3L0LA 4OGHA 2G5OA 4XLDA 5KRIA 1K7LA 2AX7A 5DP0A 4ONDA 1EREA 1S9QA 3FC6A 3PRGA 4G1YA 4IVWA 5AYGA 2C7AA 1LV2A 2Q7IA 2Q8SA 4M8HA 2QMVA 4MGCA 4XHDA 5DV3A 2I0JA 4OZTE 5DXBB 2ZXNA 4HC9A 1RDTA 5DTVA 4G2IA 5DVVA 1YNWB 1YUCA 4KZIA 1S0ZA 5DKSA 3UUAB 5HZCA 2B1ZA 3L0JA 1M2ZA 1YINA 3OOFA 1ZKYA 3B0TA 2HAMA 2GDAA 3KFCA 4IA2A 5KCWA 1E3GA 2AYRA 3WFGA 2AO6A 2GPUA 3MNOA 2HWQA 5KCUA 2J7YA 3KMRA 2GPOA 1U3QA 1U9EA 4OZRU 3KMZA 5C4TA 1FM6D 4JGVA 1XV9B 1Z5XE 3DZUD 5EHJA 2VV0A 4ZI1A 4G1DA 5DXGA 4OILA 3W5TA 1X7JA 1XDKA 1ZDTA 5E14A 3ADTA 2PINA 4Y29A 2GP7A 3A2JA 4DQMA 4EM9A 5DXMA 1XAPA 3RY9A 5DXRA 3L3ZA 2B1VA 4JYIA 3HC5A 3OKHA 5B5BA 2HB7A 2P1VA 3LBDA 4L96A 1R0OA 4A2JA 2XYXA 3B0QA 1XVPA 2VSTA 2NLLB 5KRCA 4OARA 2QW4A 3G6UA 2ENVA 4CN3D 2R40A 3FUGA 1EXXA 3QT0A 1ZH7A 1MZNA 4G1ZA 5G43A 2PIVA 3TKMA 1CITA 3AFRA 3HLVA 2HARA 1ILHA 2Z4BA 3VEKC 2QZOA 2AX8A 2E2RA 4G20A 4K7AA 5DY8A 3VT9A 2P7ZA 4OZTU 4JL4A 1GWQA 2QABA 2HASA 1T7RA 4J5XC 5AAVA 1NUOA 5EITA 3VSOA 4IQRA 4RE8A 1XIUA 4IA3A 4PP3A 3A3ZX 1QKNA 5DWEA 2QNVA 3CQVA 1DKFA 5E0WA 2JF9A 1KB6A 5M96A 3WGPA 1R1KA 2ATHA 3L03A 2VUSI 1X7RA 1A6YA 3L3XA 1OT7A 4K4JA 4MG8B 5GATA 1WM0X 2V7CA 3A78A 4ZO1B 1UHLA 5JY3A 2HANB 4IV4A 5DK9A 3ERTA 1LBDA 2GL8A 3W0JA 3G9MA 3SP6A 1K74A 1T63A 2VV1A 1M13A 3K6PA 4J5WA 4RMDA 2J4AA 5CJ6A 5FQPA 4CSJA 4DM8A 5KCDA 2G44A 2ZK2A 3WT5A 3H0AA 2XYWA 2ZBSA 1IE8A 1Y0SA 3AZ2A 4JAZA 3ERDA 4OKBA 1SQNA 3B68A 1RKGA 3PCUA 5KYAA 1U3SA 3W0IA 1Y9RA 1GDCA 3BEJA 1GS4A 2QPYA 4QJRA 2AWHA 5DX3A 1LV3A 5GT4A 2VV4A 5DUHA 1R0NB 2BJ4A 4TUZB 5IZ0A 1RK3A 4APUA 4MDDA 1R0NA 2VSRA 4KZMA 1NQ1A 3GBKA 2JFAA 2EWPA 2R6YA 3HVLA 4MGBB 4LNXA 3ADSA 4N1YA 2PNUA 4MG9A 2OVMA 3A9EA 5KYJA 4WHGA 2Q6JA 1T7TA 1NYXA 2ZK6A 2AB2A 5G5WA 4RMEA 5K13A 1NAXA 2Q6RA 2Q61A 3WMHA 3AURA 3MNPA 4IWCA 2IOKA 2NXXA 4OJ4A 4P6XA 5KRKA 3OSAA 5AVLA 4MG6A 3W0YA 2ZK1A 1RJKA 5ETHA 5GICA 1HCQA 3ADWA 3VJTA 5L0MA 3CTBA 4JYGA 3P88A 5JJMA 4NB6A 3P8XA 4ZNVA 3ZRBA 2OUZA 3KBAA 3D24A 5APHA 3O1EA 3IPUA 2Q60A 7GATA 3IMYA 1KKQA 4LNWA 4RUPA 4YNKA 4Q50A 1K74D 1DSZA 1OVLB 1XOWA 2G0HA 2REWA 2YLQA 3R29A 1ZAFA 3FALB 1R4OA 5LGAA 3ET1A 3Q95A 4DMAA 1FCXA 1R6GA 1PK5A 3UVVA 3V9VA 2OAXA 3V9TA 3S9SA 1KV6A 6GATA 3V9YA 3ADXA 4OZRE 1FM6A 1PQCA 3D90A 3FURA 3E94A 1X78A 5DWLA 4DK7A 3CS8A 4HN5A 5DVSA 2PITA 4RFWA 4EMAA 1XLSE 2Q3YA 3A2HA 4J5XA 3NOAA 5F9BA 3F5CB 5KRMA 5KRJA 1M7WA 3NSPA 3W0HA 3DY6A 4N5GA 3G9EA 3WJ4A 3HC6A 4FHIA 5DUGA 4NIEA 1R4RA 3ILZA 4ZJRA 4CN3A 3VRVA 4ZN7A 1KB2A 5DV8A 5EC9A 4S15A 5DWIA 3AZ3A 1XNXA 2ZNPA 3OKIA 5G45A 5GIEA 1RXRA 3IPSA 3VT3A 1TXIA 1L2IA 5KCEA 2ZNOA 4RUJA 4ZO1X 3PBAA 2I4JA 2P1TA 5KRLA 4XUHA 2V0VA 4FNEA 5DYDA 3X1IA 3HM1A 4F9MA 4PVUA 3B0WA 3VTBA 2B50A 5HJSA 4IUIA 5L7EA 4PPPA 3W0CA 3G97A 2YJDA 1XQ3A 4Q0AC 3AN4A 4ITEA 4S0TA 3VHUA 5DKGA 2Q1VA 1QKMA 3OLLA 2PIXA 4OK1A 5EMPA 3VT8A 4G21A 4UDBA 5DMFA 3A2IA 1FD0A 5DZ0A 5KCCA 5AAUA 1R5KA 1T73A 4M8EA 4PP6A 4UDDA 3VTCA 4WVDA 2IHQA 5DL4A 3G6RA 2NLLA 3PLZA 3HODA 3CBBA 4GATA 1SKXA 4R2UA 5KD9A 4LTWA 5KRBB 3ADUA 4HEEX 4XI3A 1T76A 2QXMA 4IV2A 1YP0A 2LBDA 3AUQA 3P89A 2W8YA 3DT3A 4J24A 4XAOA 5DYBA 3T03A 1YIMA 2P15A 4MG7B 5DIGA 5DKEA 3G8UA 2ACLA 1GA5A 3VTDA 3OOKA 5EMQA 2YHDA 3GWSX 5EJVA 4MGAB 3R8AA 2H79A 2J7XA 3W5PA 3UUCA 5HJPA 4OEDA 2NW4A 3P0UA 3G27A 3OLFA 4IVYA 3TKCA 5EGVA 2PIWA 1NHZA 4PLDA 3UU7B 4MGDB 4Q13A 3VJSA 3W0GA 2HWRA 4PPSA 5DIEA 1FCYA 2GPPA 1PCGA 1S9PA 3HQ5A 3K8SA 3OS9A 3WWRA 2Q5SA 3VHWA 1FM9D 1P93A 4POHA 2VV2A 4X1GA 2AA6A 2PIOA 4OHAA 1A28A 4ZNHA 3X36A 3HZFA 5C4OA 5E6AA 2POBA 4A4WA 2NXXE 4FN9A 3ADVA 3G8XA 1HLZA 3ET0A 5JI0D 4ZNWA 4IW6A 4TV1A 2ZXMA 4XTAA 1SR7A 4J26A 3AUNA 3KMGA 1T7FA 1L2JA 1G50A 4K6IA 4OH6A 5AVIA 1T74A 3TX7B 5CBZA 2O9IA 1NQ2A 5DUEA 3OMOA 2Z4JA 2YFEA 4TUZA 4P6WA 1T65A 3D6DA 4REFA 5DV6A 3UUDB 3K23A 1ZDUA 4HLWA 3RVFA 4YMQA 4FHHA 1NDEA 3GYTA 4LBDA 1DB1A 3G6TA 2DS8A 1R0OB 3V49A 1RKHA 4ZJWA 2ZK5A 3PEQA 2YLYA 3L1BA 5KROA 3E00D 3VT6A 2Q6SA 3VJIA 1N4HA 3B0RA 4OEZA 3RUTA 2ZY0A 3G9JA 1PQ9A 2Q7LA 3AN3A 2QA8A 2QZOB 3DR1A 3DFVC 5AAVB 2ZVTA 3OSIA 5ACCA 3V4AA 4R06A 2ZK0A 2AX6A 1H9UA 3OS8C 3GYUA 3KWYA 1DKFB 4ITFA 2XKWA 4RZEA 5DXQA 5E15A 1OVLA 3OMMA 4QL8A 4MG5A 1K4WA 3DZYA 1OSVA 3R5NA 1A52A 1YYEA 4UDAA 1I38A 3OLSA 5AZTA 5G3JA 1HRAA 2BAWA 5KCTA 1UHLB 2O4RA 5HJPB 5C4UA 2ZMHA 3TY0A 1P8DA 3AX8A 4DK8A 4YPQA 1SJ0A 3CWDA 3ET3A 3W5QA 2HB8A 5L11A 1PDUA 4OH5A 2P4YA 1ZEOA 2M9WA 2Q1HA 2XHSA 1XNNA 4OFRA 3B65A 3ZRAA 3G9IA 2A66A 2P7AA 3X1HA 1G5YA 5IAWA 4KZJA 2YLPA 3F5CA 3R5MA 3K22A 2ZXZA 5DKBA 4OJ9A 2AX9A 2ZK4A 3OZ0A 1YY4A 5DRMA 2Q59B 5DZIA 3KPZA 4G2HA 4B7WA 1I37A 2IOGA 5CBXA 4OEYA 2Q5GA 5KR9A 5FQVA 4RMCA 5DZ1A 3M9EA 4NQAB 1S0XA 4PP5A 1T5ZA 4MG9B 1XP1A 3A9EB
chains in the Genus database with same CATH topology
2J14A 4OORA 2EBLA 1X7EA 5EMCA 1GNFA 1UPWA 4RWVA 5DXBA 4IWFA 4RAKA 4LSJA 3VN2A 4OLNA 5G44A 5C4SA 5H1EA 1PZLA 2QH6A 1YNWA 3WTQA 2AMBA 2YLOA 4FGYA 4PRGA 4OIUA 4XUMA 3UP3A 3PO9A 2Q70A 3R2AA 3OZJA 3UUAA 3DZYD 2VUUI 5JJMB 4AA6A 1BSXA 1S19A 4IA1A 4DORA 4S14A 5E69A 3BQDA 2YJAB 1XZXX 4PXMA 3VRUA 3BC5A 1FM9A 1PQ6A 3WT6A 5E6BA 2ZNNA 1XV9A 2PIPL 1X76A 3DCUA 5LWPA 5E7VA 1GWRA 2POGA 5DVCA 3W5RA 2Q7JA 4TMAI 4WQPA 3UVVB 3G8IA 3KYTA 5DXPA 2KAEA 1OSHA 2FVJA 5DWGA 2H77A 1NRLA 2I4ZA 3O1DA 1N46A 4PWLA 2ZASA 3CDSA 1NQ7A 2I4PA 4MGAA 5KRFA 4HC7A 3L0EA 4QE8A 1I7IA 4RUOX 5DWJA 3VT7A 3VT4A 2FF0A 3ET2A 4WHFA 3UP0A 5DSHA 2ZLAA 3B67A 3CS4A 2NPAA 3UU7A 4MGDA 3OS8A 4OJBA 2GPVA 4OEAA 2HVCA 3G99A 5DMCA 1Q4XA 3OMQA 4RZFA 5G42A 3E00A 3CJWA 3D5FA 2G0GA 4L98A 5KRAA 2ZMIA 5APJA 4DM6A 3FC6B 4OFUA 2O4JA 1YJEA 3RUUA 5IXKA 4CI5A 4OV7A 1X7BA 3SP9A 3OMPA 3VHVA 5HYKA 2JJ3A 4MG8A 3IXPA 5DI7A 4ZNSA 3CLDA 2B23A 1G1UA 2HANA 2QSEA 3AZ1A 3WFFA 5L7GA 1GAUA 2PIQA 1XQCA 4RZGA 1XLSA 3F7DA 3UUDA 5KCFA 4OKXA 2PIRA 1XP9A 4ZNTA 3CDPA 2F4BA 3LMPA 3OAPA 5APKA 5FQTA 5E6CA 4CN2C 4TNTA 3H52A 3SZ1A 3VRWA 3WJ5A 1XPCA 2ZLCA 3G6PA 1U3RA 1UOMA 5FQRA 5E6DA 1XDKB 2GIUA 1IE9A 3FS1A 3JZCA 4N73A 3U9QA 3VJHA 1YOWA 3W0AA 4A4VA 1GWXA 1TFCA 5GIDA 2HBHA 1RGDA 1N83A 3G0WA 2ACLB 5AZVA 2HCDA 5HYRA 2AA2A 1Z95A 4MGBA 1RDTD 2AM9A 3G8OA 3OSWA 4QM0A 1HJ1A 2YATA 2XYJA 1XVPB 3WT7A 5CBYA 4HCAA 5DIDA 1T7MA 1NAVA 5FQSA 1XJ7A 2ABIA 2AA5A 3VD6C 4ZNUA 1LATA 4CI4A 1HG4A 1Y0XX 5ICKA 2GATA 4IU7A 5DLRA 4O8FA 1FBYA 1YMTA 5DZHA 2NV7A 1ZGYA 5EI1A 2GWXA 3B5RA 2QXSA 3JZBA 3GN8A 2I0GA 3OGTA 1Z5XU 3GD2A 3GZ9A 3IXPD 3FLIA 4E4QA 4OLMA 5A86A 2HC4A 5G46A 2QE4A 4NY9A 4QE6A 4YT1A 2VV3A 2A3IA 2ZFXA 2ZL9A 4XT9A 3VRTA 4OKWA 3VSPA 2GTKA 2AAXA 2OCFA 3B3KA 1MVCA 3FALA 2FAIA 3FXVA 4TV1B 5DXEA 2ZK3A 4X1FA 4E4KA 4REEA 1PRGA 2Q5PA 3G6QA 2R6WA 2VV1B 2AA7A 2PJLA 2P7GA 2PKLA 3R8DA 2Q59A 3ZR7A 4ZOMA 2OVHA 4QK4A 2PIUA 1MV9A 4IW8A 2R40D 5DU5A 4ONIA 2AMAA 3CS6A 3OMKA 2ZNQA 2QTUA 1KNUA 1R20A 4WPFA 3FYLA 4JYHA 4IA7A 4PF3A 4R6SA 3VT5A 3X31A 1I7GA 4CN5A 5DX3B 1QKUA 2QR9A 1HCPA 3MNEA 2HFPA 2VV4B 3E7CA 1EXAA 1BY4A 2BJ4B 3FEJA 1E3KA 5HCVA 2QA8B 2JFAB 1R1KD 2ZKCA 1QKTA 4BCRA 5B41A 1UPVA 5E0XA 5CC0A 3DCTA 1LO1A 5DZ3A 3KDTA 2P54A 4E2JA 1R4IA 3RLLA 3ZQTA 5AWKA 2OM9A 5E1CA 4UDCA 3EYBA 1YOKA 1XP6A 3IPQA 5DRJA 1FCZA 1XB7A 4IS8A 3G9OA 4DOSA 3H0AD 1GLUA 4ZN9A 2FSZA 1ERRA 4PLEA 3FEIA 3KDUA 5AWJA 3N00A 3DZUA 3A40X 1ILGA 3B66A 2AXAA 2QA6A 2QGTA 4OKTA 4S0SA 1GATA 5L7HA 5KRHA 4OC7A 3GWXA 3V3EA 3GATA 2ZMJA 5SYZA 2QGWA 1DSZB 1G2NA 5DXKA 4N8RA 1KB4A 4CN7A 2VUTI 4J5WC 3IA6A 3VI8A 1YA3A 3Q95B 3D57A 5AK2A 2OZ7A 5CC1A 1VJBA 3DFXA 3NSQA 1T79A 2Q7KA 3HO0A 3M7RA 3G9PA 1ZUCA 1R20D 5E19A 3RLJA 5I4VA 4WLBA 4POJA 4MG7A 3R8IA 4HN6A 2PRGA 3V3QA 3B1MA 4OIVA 1NQ0A 2P1UA 4NUFA 3L0LA 4OGHA 2G5OA 4XLDA 5KRIA 1K7LA 2AX7A 5DP0A 4ONDA 1EREA 1S9QA 3FC6A 3PRGA 4G1YA 4IVWA 5AYGA 2C7AA 1LV2A 2Q7IA 2Q8SA 4M8HA 2QMVA 4MGCA 4XHDA 5DV3A 2I0JA 4OZTE 5DXBB 2ZXNA 4HC9A 1RDTA 5DTVA 4G2IA 5DVVA 1YNWB 1YUCA 4KZIA 1S0ZA 5DKSA 3UUAB 5HZCA 2B1ZA 3L0JA 1M2ZA 1YINA 3OOFA 1ZKYA 3B0TA 2HAMA 2GDAA 3KFCA 4IA2A 5KCWA 1E3GA 2AYRA 3WFGA 2AO6A 2GPUA 3MNOA 2HWQA 5KCUA 2J7YA 3KMRA 2GPOA 1U3QA 1U9EA 4OZRU 3KMZA 5C4TA 1FM6D 4JGVA 1XV9B 1Z5XE 3DZUD 5EHJA 2VV0A 4ZI1A 4G1DA 5DXGA 4OILA 3W5TA 1X7JA 1XDKA 1ZDTA 5E14A 3ADTA 2PINA 4Y29A 2GP7A 3A2JA 4DQMA 4EM9A 5DXMA 1XAPA 3RY9A 5DXRA 3L3ZA 2B1VA 4JYIA 3HC5A 3OKHA 5B5BA 2HB7A 2P1VA 3LBDA 4L96A 1R0OA 4A2JA 2XYXA 3B0QA 1XVPA 2VSTA 2NLLB 5KRCA 4OARA 2QW4A 3G6UA 2ENVA 4CN3D 2R40A 3FUGA 1EXXA 3QT0A 1ZH7A 1MZNA 4G1ZA 5G43A 2PIVA 3TKMA 1CITA 3AFRA 3HLVA 2HARA 1ILHA 2Z4BA 3VEKC 2QZOA 2AX8A 2E2RA 4G20A 4K7AA 5DY8A 3VT9A 2P7ZA 4OZTU 4JL4A 1GWQA 2QABA 2HASA 1T7RA 4J5XC 5AAVA 1NUOA 5EITA 3VSOA 4IQRA 4RE8A 1XIUA 4IA3A 4PP3A 3A3ZX 1QKNA 5DWEA 2QNVA 3CQVA 1DKFA 5E0WA 2JF9A 1KB6A 5M96A 3WGPA 1R1KA 2ATHA 3L03A 2VUSI 1X7RA 1A6YA 3L3XA 1OT7A 4K4JA 4MG8B 5GATA 1WM0X 2V7CA 3A78A 4ZO1B 1UHLA 5JY3A 2HANB 4IV4A 5DK9A 3ERTA 1LBDA 2GL8A 3W0JA 3G9MA 3SP6A 1K74A 1T63A 2VV1A 1M13A 3K6PA 4J5WA 4RMDA 2J4AA 5CJ6A 5FQPA 4CSJA 4DM8A 5KCDA 2G44A 2ZK2A 3WT5A 3H0AA 2XYWA 2ZBSA 1IE8A 1Y0SA 3AZ2A 4JAZA 3ERDA 4OKBA 1SQNA 3B68A 1RKGA 3PCUA 5KYAA 1U3SA 3W0IA 1Y9RA 1GDCA 3BEJA 1GS4A 2QPYA 4QJRA 2AWHA 5DX3A 1LV3A 5GT4A 2VV4A 5DUHA 1R0NB 2BJ4A 4TUZB 5IZ0A 1RK3A 4APUA 4MDDA 1R0NA 2VSRA 4KZMA 1NQ1A 3GBKA 2JFAA 2EWPA 2R6YA 3HVLA 4MGBB 4LNXA 3ADSA 4N1YA 2PNUA 4MG9A 2OVMA 3A9EA 5KYJA 4WHGA 2Q6JA 1T7TA 1NYXA 2ZK6A 2AB2A 5G5WA 4RMEA 5K13A 1NAXA 2Q6RA 2Q61A 3WMHA 3AURA 3MNPA 4IWCA 2IOKA 2NXXA 4OJ4A 4P6XA 5KRKA 3OSAA 5AVLA 4MG6A 3W0YA 2ZK1A 1RJKA 5ETHA 5GICA 1HCQA 3ADWA 3VJTA 5L0MA 3CTBA 4JYGA 3P88A 5JJMA 4NB6A 3P8XA 4ZNVA 3ZRBA 2OUZA 3KBAA 3D24A 5APHA 3O1EA 3IPUA 2Q60A 7GATA 3IMYA 1KKQA 4LNWA 4RUPA 4YNKA 4Q50A 1K74D 1DSZA 1OVLB 1XOWA 2G0HA 2REWA 2YLQA 3R29A 1ZAFA 3FALB 1R4OA 5LGAA 3ET1A 3Q95A 4DMAA 1FCXA 1R6GA 1PK5A 3UVVA 3V9VA 2OAXA 3V9TA 3S9SA 1KV6A 6GATA 3V9YA 3ADXA 4OZRE 1FM6A 1PQCA 3D90A 3FURA 3E94A 1X78A 5DWLA 4DK7A 3CS8A 4HN5A 5DVSA 2PITA 4RFWA 4EMAA 1XLSE 2Q3YA 3A2HA 4J5XA 3NOAA 5F9BA 3F5CB 5KRMA 5KRJA 1M7WA 3NSPA 3W0HA 3DY6A 4N5GA 3G9EA 3WJ4A 3HC6A 4FHIA 5DUGA 4NIEA 1R4RA 3ILZA 4ZJRA 4CN3A 3VRVA 4ZN7A 1KB2A 5DV8A 5EC9A 4S15A 5DWIA 3AZ3A 1XNXA 2ZNPA 3OKIA 5G45A 5GIEA 1RXRA 3IPSA 3VT3A 1TXIA 1L2IA 5KCEA 2ZNOA 4RUJA 4ZO1X 3PBAA 2I4JA 2P1TA 5KRLA 4XUHA 2V0VA 4FNEA 5DYDA 3X1IA 3HM1A 4F9MA 4PVUA 3B0WA 3VTBA 2B50A 5HJSA 4IUIA 5L7EA 4PPPA 3W0CA 3G97A 2YJDA 1XQ3A 4Q0AC 3AN4A 4ITEA 4S0TA 3VHUA 5DKGA 2Q1VA 1QKMA 3OLLA 2PIXA 4OK1A 5EMPA 3VT8A 4G21A 4UDBA 5DMFA 3A2IA 1FD0A 5DZ0A 5KCCA 5AAUA 1R5KA 1T73A 4M8EA 4PP6A 4UDDA 3VTCA 4WVDA 2IHQA 5DL4A 3G6RA 2NLLA 3PLZA 3HODA 3CBBA 4GATA 1SKXA 4R2UA 5KD9A 4LTWA 5KRBB 3ADUA 4HEEX 4XI3A 1T76A 2QXMA 4IV2A 1YP0A 2LBDA 3AUQA 3P89A 2W8YA 3DT3A 4J24A 4XAOA 5DYBA 3T03A 1YIMA 2P15A 4MG7B 5DIGA 5DKEA 3G8UA 2ACLA 1GA5A 3VTDA 3OOKA 5EMQA 2YHDA 3GWSX 5EJVA 4MGAB 3R8AA 2H79A 2J7XA 3W5PA 3UUCA 5HJPA 4OEDA 2NW4A 3P0UA 3OLFA 4IVYA 3TKCA 5EGVA 2PIWA 1NHZA 4PLDA 3UU7B 4MGDB 4Q13A 3VJSA 3W0GA 2HWRA 4PPSA 5DIEA 1FCYA 2GPPA 1PCGA 1S9PA 3HQ5A 3K8SA 3OS9A 3WWRA 2Q5SA 3VHWA 1FM9D 1P93A 4POHA 2VV2A 4X1GA 2AA6A 2PIOA 4OHAA 1A28A 4ZNHA 3X36A 3HZFA 5C4OA 5E6AA 2POBA 4A4WA 2NXXE 4FN9A 3ADVA 3G8XA 1HLZA 3ET0A 5JI0D 4ZNWA 4IW6A 4TV1A 2ZXMA 4XTAA 1SR7A 4J26A 3AUNA 3KMGA 1T7FA 1L2JA 1G50A 4K6IA 4OH6A 5AVIA 1T74A 3TX7B 5CBZA 2O9IA 1NQ2A 5DUEA 3OMOA 2Z4JA 2YFEA 4TUZA 4P6WA 1T65A 3D6DA 4REFA 5DV6A 3UUDB 3K23A 1ZDUA 4HLWA 3RVFA 4YMQA 4FHHA 1NDEA 3GYTA 4LBDA 1DB1A 3G6TA 1R0OB 3V49A 1RKHA 4ZJWA 2ZK5A 3PEQA 2YLYA 3L1BA 5KROA 3E00D 3VT6A 2Q6SA 3VJIA 1N4HA 3B0RA 4OEZA 3RUTA 2ZY0A 3G9JA 1PQ9A 2Q7LA 3AN3A 2QA8A 2QZOB 3DR1A 3DFVC 5AAVB 2ZVTA 3OSIA 5ACCA 3V4AA 4R06A 2ZK0A 2AX6A 1H9UA 3OS8C 3GYUA 3KWYA 1DKFB 4ITFA 2XKWA 4RZEA 5DXQA 5E15A 1OVLA 3OMMA 4QL8A 4MG5A 1K4WA 3DZYA 1OSVA 3R5NA 1A52A 1YYEA 4UDAA 1I38A 3OLSA 5AZTA 5G3JA 1HRAA 2BAWA 5KCTA 1UHLB 2O4RA 5HJPB 5C4UA 2ZMHA 3TY0A 1P8DA 3AX8A 4DK8A 4YPQA 1SJ0A 3CWDA 3ET3A 3W5QA 2HB8A 5L11A 1PDUA 4OH5A 2P4YA 1ZEOA 2M9WA 2Q1HA 2XHSA 1XNNA 4OFRA 3B65A 3ZRAA 3G9IA 2A66A 2P7AA 3X1HA 1G5YA 5IAWA 4KZJA 2YLPA 3F5CA 3R5MA 3K22A 2ZXZA 5DKBA 4OJ9A 2AX9A 2ZK4A 3OZ0A 1YY4A 5DRMA 2Q59B 5DZIA 3KPZA 4G2HA 4B7WA 1I37A 2IOGA 5CBXA 4OEYA 2Q5GA 5KR9A 5FQVA 4RMCA 5DZ1A 3M9EA 4NQAB 1S0XA 4PP5A 1T5ZA 4MG9B 1XP1A 3A9EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J14 A;  4OOR A;  2EBL A;  1X7E A;  5EMC A;  1GNF A;  1UPW A;  4RWV A;  5DXB A;  4IWF A;  4RAK A;  4LSJ A;  3VN2 A;  4OLN A;  5G44 A;  5C4S A;  5H1E A;  1PZL A;  2QH6 A;  1YNW A;  3WTQ A;  2AMB A;  2YLO A;  4FGY A;  4PRG A;  4OIU A;  4XUM A;  3UP3 A;  3PO9 A;  2Q70 A;  3R2A A;  3OZJ A;  3UUA A;  3DZY D;  2VUU I;  5JJM B;  4AA6 A;  1BSX A;  1S19 A;  4IA1 A;  4DOR A;  4S14 A;  5E69 A;  3BQD A;  2YJA B;  1XZX X;  4PXM A;  3VRU A;  3BC5 A;  1FM9 A;  1PQ6 A;  3WT6 A;  5E6B A;  2ZNN A;  1XV9 A;  2PIP L;  1X76 A;  3DCU A;  5LWP A;  5E7V A;  1GWR A;  2POG A;  5DVC A;  3W5R A;  2Q7J A;  4TMA I;  4WQP A;  3UVV B;  3G8I A;  3KYT A;  5DXP A;  2KAE A;  1OSH A;  2FVJ A;  5DWG A;  2H77 A;  1NRL A;  2I4Z A;  3O1D A;  1N46 A;  4PWL A;  2ZAS A;  3CDS A;  1NQ7 A;  2I4P A;  4MGA A;  5KRF A;  4HC7 A;  3L0E A;  4QE8 A;  1I7I A;  4RUO X;  5DWJ A;  3VT7 A;  3VT4 A;  2FF0 A;  3ET2 A;  4WHF A;  3UP0 A;  5DSH A;  2ZLA A;  3B67 A;  3CS4 A;  2NPA A;  3UU7 A;  4MGD A;  3OS8 A;  4OJB A;  2GPV A;  4OEA A;  2HVC A;  3G99 A;  5DMC A;  1Q4X A;  3OMQ A;  4RZF A;  5G42 A;  3E00 A;  3CJW A;  3D5F A;  2G0G A;  4L98 A;  5KRA A;  2ZMI A;  5APJ A;  4DM6 A;  3FC6 B;  4OFU A;  2O4J A;  1YJE A;  3RUU A;  5IXK A;  4CI5 A;  4OV7 A;  1X7B A;  3SP9 A;  3OMP A;  3VHV A;  5HYK A;  2JJ3 A;  4MG8 A;  3IXP A;  5DI7 A;  4ZNS A;  3CLD A;  2B23 A;  1G1U A;  2HAN A;  2QSE A;  3AZ1 A;  3WFF A;  5L7G A;  1GAU A;  2PIQ A;  1XQC A;  4RZG A;  1XLS A;  3F7D A;  3UUD A;  5KCF A;  4OKX A;  2PIR A;  1XP9 A;  4ZNT A;  3CDP A;  2F4B A;  3LMP A;  3OAP A;  5APK A;  5FQT A;  5E6C A;  4CN2 C;  4TNT A;  3H52 A;  3SZ1 A;  3VRW A;  3WJ5 A;  1XPC A;  2ZLC A;  3G6P A;  1U3R A;  1UOM A;  5FQR A;  5E6D A;  1XDK B;  2GIU A;  1IE9 A;  3FS1 A;  3JZC A;  4N73 A;  3U9Q A;  3VJH A;  1YOW A;  3W0A A;  4A4V A;  1GWX A;  1TFC A;  5GID A;  2HBH A;  1RGD A;  1N83 A;  3G0W A;  2ACL B;  5AZV A;  2HCD A;  5HYR A;  2AA2 A;  1Z95 A;  4MGB A;  1RDT D;  2AM9 A;  3G8O A;  3OSW A;  4QM0 A;  1HJ1 A;  2YAT A;  2XYJ A;  1XVP B;  3WT7 A;  5CBY A;  4HCA A;  5DID A;  1T7M A;  1NAV A;  5FQS A;  1XJ7 A;  2ABI A;  2AA5 A;  3VD6 C;  4ZNU A;  1LAT A;  4CI4 A;  1HG4 A;  1Y0X X;  5ICK A;  2GAT A;  4IU7 A;  5DLR A;  4O8F A;  1FBY A;  1YMT A;  5DZH A;  2NV7 A;  1ZGY A;  5EI1 A;  2GWX A;  3B5R A;  2QXS A;  3JZB A;  3GN8 A;  2I0G A;  3OGT A;  1Z5X U;  3GD2 A;  3GZ9 A;  3IXP D;  3FLI A;  4E4Q A;  4OLM A;  5A86 A;  2HC4 A;  5G46 A;  2QE4 A;  4NY9 A;  4QE6 A;  4YT1 A;  2VV3 A;  2A3I A;  2ZFX A;  2ZL9 A;  4XT9 A;  3VRT A;  4OKW A;  3VSP A;  2GTK A;  2AAX A;  2OCF A;  3B3K A;  1MVC A;  3FAL A;  2FAI A;  3FXV A;  4TV1 B;  5DXE A;  2ZK3 A;  4X1F A;  4E4K A;  4REE A;  1PRG A;  2Q5P A;  3G6Q A;  2R6W A;  2VV1 B;  2AA7 A;  2PJL A;  2P7G A;  2PKL A;  3R8D A;  2Q59 A;  3ZR7 A;  4ZOM A;  2OVH A;  4QK4 A;  2PIU A;  1MV9 A;  4IW8 A;  2R40 D;  5DU5 A;  4ONI A;  2AMA A;  3CS6 A;  3OMK A;  2ZNQ A;  2QTU A;  1KNU A;  1R20 A;  4WPF A;  3FYL A;  4JYH A;  4IA7 A;  4PF3 A;  4R6S A;  3VT5 A;  3X31 A;  1I7G A;  4CN5 A;  5DX3 B;  1QKU A;  2QR9 A;  1HCP A;  3MNE A;  2HFP A;  2VV4 B;  3E7C A;  1EXA A;  1BY4 A;  2BJ4 B;  3FEJ A;  1E3K A;  5HCV A;  2QA8 B;  2JFA B;  1R1K D;  2ZKC A;  1QKT A;  4BCR A;  5B41 A;  1UPV A;  5E0X A;  5CC0 A;  3DCT A;  1LO1 A;  5DZ3 A;  3KDT A;  2P54 A;  4E2J A;  1R4I A;  3RLL A;  3ZQT A;  5AWK A;  2OM9 A;  5E1C A;  4UDC A;  3EYB A;  1YOK A;  1XP6 A;  3IPQ A;  5DRJ A;  1FCZ A;  1XB7 A;  4IS8 A;  3G9O A;  4DOS A;  3H0A D;  1GLU A;  4ZN9 A;  2FSZ A;  1ERR A;  4PLE A;  3FEI A;  3KDU A;  5AWJ A;  3N00 A;  3DZU A;  3A40 X;  1ILG A;  3B66 A;  2AXA A;  2QA6 A;  2QGT A;  4OKT A;  4S0S A;  1GAT A;  5L7H A;  5KRH A;  4OC7 A;  3GWX A;  3V3E A;  3GAT A;  2ZMJ A;  5SYZ A;  2QGW A;  1DSZ B;  1G2N A;  5DXK A;  4N8R A;  1KB4 A;  4CN7 A;  2VUT I;  4J5W C;  3IA6 A;  3VI8 A;  1YA3 A;  3Q95 B;  3D57 A;  5AK2 A;  2OZ7 A;  5CC1 A;  1VJB A;  3DFX A;  3NSQ A;  1T79 A;  2Q7K A;  3HO0 A;  3M7R A;  3G9P A;  1ZUC A;  1R20 D;  5E19 A;  3RLJ A;  5I4V A;  4WLB A;  4POJ A;  4MG7 A;  3R8I A;  4HN6 A;  2PRG A;  3V3Q A;  3B1M A;  4OIV A;  1NQ0 A;  2P1U A;  4NUF A;  3L0L A;  4OGH A;  2G5O A;  4XLD A;  5KRI A;  1K7L A;  2AX7 A;  5DP0 A;  4OND A;  1ERE A;  1S9Q A;  3FC6 A;  3PRG A;  4G1Y A;  4IVW A;  5AYG A;  2C7A A;  1LV2 A;  2Q7I A;  2Q8S A;  4M8H A;  2QMV A;  4MGC A;  4XHD A;  5DV3 A;  2I0J A;  4OZT E;  5DXB B;  2ZXN A;  4HC9 A;  1RDT A;  5DTV A;  4G2I A;  5DVV A;  1YNW B;  1YUC A;  4KZI A;  1S0Z A;  5DKS A;  3UUA B;  5HZC A;  2B1Z A;  3L0J A;  1M2Z A;  1YIN A;  3OOF A;  1ZKY A;  3B0T A;  2HAM A;  2GDA A;  3KFC A;  4IA2 A;  5KCW A;  1E3G A;  2AYR A;  3WFG A;  2AO6 A;  2GPU A;  3MNO A;  2HWQ A;  5KCU A;  2J7Y A;  3KMR A;  2GPO A;  1U3Q A;  1U9E A;  4OZR U;  3KMZ A;  5C4T A;  1FM6 D;  4JGV A;  1XV9 B;  1Z5X E;  3DZU D;  5EHJ A;  2VV0 A;  4ZI1 A;  4G1D A;  5DXG A;  4OIL A;  3W5T A;  1X7J A;  1XDK A;  1ZDT A;  5E14 A;  3ADT A;  2PIN A;  4Y29 A;  2GP7 A;  3A2J A;  4DQM A;  4EM9 A;  5DXM A;  1XAP A;  3RY9 A;  5DXR A;  3L3Z A;  2B1V A;  4JYI A;  3HC5 A;  3OKH A;  5B5B A;  2HB7 A;  2P1V A;  3LBD A;  4L96 A;  1R0O A;  4A2J A;  2XYX A;  3B0Q A;  1XVP A;  2VST A;  2NLL B;  5KRC A;  4OAR A;  2QW4 A;  3G6U A;  2ENV A;  4CN3 D;  2R40 A;  3FUG A;  1EXX A;  3QT0 A;  1ZH7 A;  1MZN A;  4G1Z A;  5G43 A;  2PIV A;  3TKM A;  1CIT A;  3AFR A;  3HLV A;  2HAR A;  1ILH A;  2Z4B A;  3VEK C;  2QZO A;  2AX8 A;  2E2R A;  4G20 A;  4K7A A;  5DY8 A;  3VT9 A;  2P7Z A;  4OZT U;  4JL4 A;  1GWQ A;  2QAB A;  2HAS A;  1T7R A;  4J5X C;  5AAV A;  1NUO A;  5EIT A;  3VSO A;  4IQR A;  4RE8 A;  1XIU A;  4IA3 A;  4PP3 A;  3A3Z X;  1QKN A;  5DWE A;  2QNV A;  3CQV A;  1DKF A;  5E0W A;  2JF9 A;  1KB6 A;  5M96 A;  3WGP A;  1R1K A;  2ATH A;  3L03 A;  2VUS I;  1X7R A;  1A6Y A;  3L3X A;  1OT7 A;  4K4J A;  4MG8 B;  5GAT A;  1WM0 X;  2V7C A;  3A78 A;  4ZO1 B;  1UHL A;  5JY3 A;  2HAN B;  4IV4 A;  5DK9 A;  3ERT A;  1LBD A;  2GL8 A;  3W0J A;  3G9M A;  3SP6 A;  1K74 A;  1T63 A;  2VV1 A;  1M13 A;  3K6P A;  4J5W A;  4RMD A;  2J4A A;  5CJ6 A;  5FQP A;  4CSJ A;  4DM8 A;  5KCD A;  2G44 A;  2ZK2 A;  3WT5 A;  3H0A A;  2XYW A;  2ZBS A;  1IE8 A;  1Y0S A;  3AZ2 A;  4JAZ A;  3ERD A;  4OKB A;  1SQN A;  3B68 A;  1RKG A;  3PCU A;  5KYA A;  1U3S A;  3W0I A;  1Y9R A;  1GDC A;  3BEJ A;  1GS4 A;  2QPY A;  4QJR A;  2AWH A;  5DX3 A;  1LV3 A;  5GT4 A;  2VV4 A;  5DUH A;  1R0N B;  2BJ4 A;  4TUZ B;  5IZ0 A;  1RK3 A;  4APU A;  4MDD A;  1R0N A;  2VSR A;  4KZM A;  1NQ1 A;  3GBK A;  2JFA A;  2EWP A;  2R6Y A;  3HVL A;  4MGB B;  4LNX A;  3ADS A;  4N1Y A;  2PNU A;  4MG9 A;  2OVM A;  3A9E A;  5KYJ A;  4WHG A;  2Q6J A;  1T7T A;  1NYX A;  2ZK6 A;  2AB2 A;  5G5W A;  4RME A;  5K13 A;  1NAX A;  2Q6R A;  2Q61 A;  3WMH A;  3AUR A;  3MNP A;  4IWC A;  2IOK A;  2NXX A;  4OJ4 A;  4P6X A;  5KRK A;  3OSA A;  5AVL A;  4MG6 A;  3W0Y A;  2ZK1 A;  1RJK A;  5ETH A;  5GIC A;  1HCQ A;  3ADW A;  3VJT A;  5L0M A;  3CTB A;  4JYG A;  3P88 A;  5JJM A;  4NB6 A;  3P8X A;  4ZNV A;  3ZRB A;  2OUZ A;  3KBA A;  3D24 A;  5APH A;  3O1E A;  3IPU A;  2Q60 A;  7GAT A;  3IMY A;  1KKQ A;  4LNW A;  4RUP A;  4YNK A;  4Q50 A;  1K74 D;  1DSZ A;  1OVL B;  1XOW A;  2G0H A;  2REW A;  2YLQ A;  3R29 A;  1ZAF A;  3FAL B;  1R4O A;  5LGA A;  3ET1 A;  3Q95 A;  4DMA A;  1FCX A;  1R6G A;  1PK5 A;  3UVV A;  3V9V A;  2OAX A;  3V9T A;  3S9S A;  1KV6 A;  6GAT A;  3V9Y A;  3ADX A;  4OZR E;  1FM6 A;  1PQC A;  3D90 A;  3FUR A;  3E94 A;  1X78 A;  5DWL A;  4DK7 A;  3CS8 A;  4HN5 A;  5DVS A;  2PIT A;  4RFW A;  4EMA A;  1XLS E;  2Q3Y A;  3A2H A;  4J5X A;  3NOA A;  5F9B A;  3F5C B;  5KRM A;  5KRJ A;  1M7W A;  3NSP A;  3W0H A;  3DY6 A;  4N5G A;  3G9E A;  3WJ4 A;  3HC6 A;  4FHI A;  5DUG A;  4NIE A;  1R4R A;  3ILZ A;  4ZJR A;  4CN3 A;  3VRV A;  4ZN7 A;  1KB2 A;  5DV8 A;  5EC9 A;  4S15 A;  5DWI A;  3AZ3 A;  1XNX A;  2ZNP A;  3OKI A;  5G45 A;  5GIE A;  1RXR A;  3IPS A;  3VT3 A;  1TXI A;  1L2I A;  5KCE A;  2ZNO A;  4RUJ A;  4ZO1 X;  3PBA A;  2I4J A;  2P1T A;  5KRL A;  4XUH A;  2V0V A;  4FNE A;  5DYD A;  3X1I A;  3HM1 A;  4F9M A;  4PVU A;  3B0W A;  3VTB A;  2B50 A;  5HJS A;  4IUI A;  5L7E A;  4PPP A;  3W0C A;  3G97 A;  2YJD A;  1XQ3 A;  4Q0A C;  3AN4 A;  4ITE A;  4S0T A;  3VHU A;  5DKG A;  2Q1V A;  1QKM A;  3OLL A;  2PIX A;  4OK1 A;  5EMP A;  3VT8 A;  4G21 A;  4UDB A;  5DMF A;  3A2I A;  1FD0 A;  5DZ0 A;  5KCC A;  5AAU A;  1R5K A;  1T73 A;  4M8E A;  4PP6 A;  4UDD A;  3VTC A;  4WVD A;  2IHQ A;  5DL4 A;  3G6R A;  2NLL A;  3PLZ A;  3HOD A;  3CBB A;  4GAT A;  1SKX A;  4R2U A;  5KD9 A;  4LTW A;  5KRB B;  3ADU A;  4HEE X;  4XI3 A;  1T76 A;  2QXM A;  4IV2 A;  1YP0 A;  2LBD A;  3AUQ A;  3P89 A;  2W8Y A;  3DT3 A;  4J24 A;  4XAO A;  5DYB A;  3T03 A;  1YIM A;  2P15 A;  4MG7 B;  5DIG A;  5DKE A;  3G8U A;  2ACL A;  1GA5 A;  3VTD A;  3OOK A;  5EMQ A;  2YHD A;  3GWS X;  5EJV A;  4MGA B;  3R8A A;  2H79 A;  2J7X A;  3W5P A;  3UUC A;  5HJP A;  4OED A;  2NW4 A;  3P0U A;  3OLF A;  4IVY A;  3TKC A;  5EGV A;  2PIW A;  1NHZ A;  4PLD A;  3UU7 B;  4MGD B;  4Q13 A;  3VJS A;  3W0G A;  2HWR A;  4PPS A;  5DIE A;  1FCY A;  2GPP A;  1PCG A;  1S9P A;  3HQ5 A;  3K8S A;  3OS9 A;  3WWR A;  2Q5S A;  3VHW A;  1FM9 D;  1P93 A;  4POH A;  2VV2 A;  4X1G A;  2AA6 A;  2PIO A;  4OHA A;  1A28 A;  4ZNH A;  3X36 A;  3HZF A;  5C4O A;  5E6A A;  2POB A;  4A4W A;  2NXX E;  4FN9 A;  3ADV A;  3G8X A;  1HLZ A;  3ET0 A;  5JI0 D;  4ZNW A;  4IW6 A;  4TV1 A;  2ZXM A;  4XTA A;  1SR7 A;  4J26 A;  3AUN A;  3KMG A;  1T7F A;  1L2J A;  1G50 A;  4K6I A;  4OH6 A;  5AVI A;  1T74 A;  3TX7 B;  5CBZ A;  2O9I A;  1NQ2 A;  5DUE A;  3OMO A;  2Z4J A;  2YFE A;  4TUZ A;  4P6W A;  1T65 A;  3D6D A;  4REF A;  5DV6 A;  3UUD B;  3K23 A;  1ZDU A;  4HLW A;  3RVF A;  4YMQ A;  4FHH A;  1NDE A;  3GYT A;  4LBD A;  1DB1 A;  3G6T A;  1R0O B;  3V49 A;  1RKH A;  4ZJW A;  2ZK5 A;  3PEQ A;  2YLY A;  3L1B A;  5KRO A;  3E00 D;  3VT6 A;  2Q6S A;  3VJI A;  1N4H A;  3B0R A;  4OEZ A;  3RUT A;  2ZY0 A;  3G9J A;  1PQ9 A;  2Q7L A;  3AN3 A;  2QA8 A;  2QZO B;  3DR1 A;  3DFV C;  5AAV B;  2ZVT A;  3OSI A;  5ACC A;  3V4A A;  4R06 A;  2ZK0 A;  2AX6 A;  1H9U A;  3OS8 C;  3GYU A;  3KWY A;  1DKF B;  4ITF A;  2XKW A;  4RZE A;  5DXQ A;  5E15 A;  1OVL A;  3OMM A;  4QL8 A;  4MG5 A;  1K4W A;  3DZY A;  1OSV A;  3R5N A;  1A52 A;  1YYE A;  4UDA A;  1I38 A;  3OLS A;  5AZT A;  5G3J A;  1HRA A;  2BAW A;  5KCT A;  1UHL B;  2O4R A;  5HJP B;  5C4U A;  2ZMH A;  3TY0 A;  1P8D A;  3AX8 A;  4DK8 A;  4YPQ A;  1SJ0 A;  3CWD A;  3ET3 A;  3W5Q A;  2HB8 A;  5L11 A;  1PDU A;  4OH5 A;  2P4Y A;  1ZEO A;  2M9W A;  2Q1H A;  2XHS A;  1XNN A;  4OFR A;  3B65 A;  3ZRA A;  3G9I A;  2A66 A;  2P7A A;  3X1H A;  1G5Y A;  5IAW A;  4KZJ A;  2YLP A;  3F5C A;  3R5M A;  3K22 A;  2ZXZ A;  5DKB A;  4OJ9 A;  2AX9 A;  2ZK4 A;  3OZ0 A;  1YY4 A;  5DRM A;  2Q59 B;  5DZI A;  3KPZ A;  4G2H A;  4B7W A;  1I37 A;  2IOG A;  5CBX A;  4OEY A;  2Q5G A;  5KR9 A;  5FQV A;  4RMC A;  5DZ1 A;  3M9E A;  4NQA B;  1S0X A;  4PP5 A;  1T5Z A;  4MG9 B;  1XP1 A;  3A9E B; 
#chains in the Genus database with same CATH topology
 2J14 A;  4OOR A;  2EBL A;  1X7E A;  5EMC A;  1GNF A;  1UPW A;  4RWV A;  5DXB A;  4IWF A;  4RAK A;  4LSJ A;  3VN2 A;  4OLN A;  5G44 A;  5C4S A;  5H1E A;  1PZL A;  2QH6 A;  1YNW A;  3WTQ A;  2AMB A;  2YLO A;  4FGY A;  4PRG A;  4OIU A;  4XUM A;  3UP3 A;  3PO9 A;  2Q70 A;  3R2A A;  3OZJ A;  3UUA A;  3DZY D;  2VUU I;  5JJM B;  4AA6 A;  1BSX A;  1S19 A;  4IA1 A;  4DOR A;  4S14 A;  5E69 A;  3BQD A;  2YJA B;  1XZX X;  4PXM A;  3VRU A;  3BC5 A;  1FM9 A;  1PQ6 A;  3WT6 A;  5E6B A;  2ZNN A;  1XV9 A;  2PIP L;  1X76 A;  3DCU A;  5LWP A;  5E7V A;  1GWR A;  2POG A;  5DVC A;  3W5R A;  2Q7J A;  4TMA I;  4WQP A;  3UVV B;  3G8I A;  3KYT A;  5DXP A;  2KAE A;  1OSH A;  2FVJ A;  5DWG A;  2H77 A;  1NRL A;  2I4Z A;  2DS5 A;  3O1D A;  1N46 A;  4PWL A;  2ZAS A;  3CDS A;  1NQ7 A;  2I4P A;  4MGA A;  5KRF A;  4HC7 A;  3L0E A;  4QE8 A;  1I7I A;  4RUO X;  5DWJ A;  3VT7 A;  3VT4 A;  2FF0 A;  3ET2 A;  4WHF A;  3UP0 A;  5DSH A;  2ZLA A;  3B67 A;  3CS4 A;  2NPA A;  3UU7 A;  4MGD A;  3OS8 A;  4OJB A;  2GPV A;  4OEA A;  2HVC A;  3G99 A;  5DMC A;  1Q4X A;  3OMQ A;  4RZF A;  5G42 A;  3E00 A;  3CJW A;  3D5F A;  2G0G A;  4L98 A;  5KRA A;  2ZMI A;  5APJ A;  4DM6 A;  3FC6 B;  4OFU A;  2O4J A;  1YJE A;  3RUU A;  5IXK A;  4CI5 A;  4OV7 A;  1X7B A;  3SP9 A;  3OMP A;  3VHV A;  5HYK A;  2JJ3 A;  4MG8 A;  3IXP A;  5DI7 A;  4ZNS A;  3CLD A;  2B23 A;  1G1U A;  2HAN A;  2QSE A;  3AZ1 A;  3WFF A;  5L7G A;  1GAU A;  2PIQ A;  1XQC A;  4RZG A;  1XLS A;  3F7D A;  3UUD A;  5KCF A;  4OKX A;  2PIR A;  1XP9 A;  4ZNT A;  3CDP A;  2F4B A;  3LMP A;  3OAP A;  5APK A;  5FQT A;  5E6C A;  4CN2 C;  4TNT A;  3H52 A;  3SZ1 A;  3VRW A;  3WJ5 A;  1XPC A;  2ZLC A;  3G6P A;  1U3R A;  1UOM A;  5FQR A;  5E6D A;  1XDK B;  2GIU A;  1IE9 A;  3FS1 A;  3JZC A;  4N73 A;  3U9Q A;  3VJH A;  1YOW A;  3W0A A;  4A4V A;  1GWX A;  1TFC A;  5GID A;  2HBH A;  1RGD A;  1N83 A;  3G0W A;  2ACL B;  5AZV A;  2HCD A;  5HYR A;  2AA2 A;  1Z95 A;  4MGB A;  1RDT D;  2AM9 A;  3G8O A;  3OSW A;  4QM0 A;  1HJ1 A;  2YAT A;  2XYJ A;  1XVP B;  3WT7 A;  5CBY A;  4HCA A;  5DID A;  1T7M A;  1NAV A;  5FQS A;  1XJ7 A;  2ABI A;  2AA5 A;  3VD6 C;  4ZNU A;  1LAT A;  4CI4 A;  1HG4 A;  1Y0X X;  5ICK A;  2GAT A;  4IU7 A;  5DLR A;  4O8F A;  1FBY A;  1YMT A;  5DZH A;  2NV7 A;  1ZGY A;  5EI1 A;  2GWX A;  3B5R A;  2QXS A;  3JZB A;  3GN8 A;  2I0G A;  3OGT A;  1Z5X U;  3GD2 A;  3GZ9 A;  3IXP D;  3FLI A;  4E4Q A;  4OLM A;  5A86 A;  2HC4 A;  5G46 A;  2QE4 A;  4NY9 A;  4QE6 A;  4YT1 A;  2VV3 A;  2A3I A;  2ZFX A;  2ZL9 A;  4XT9 A;  3VRT A;  4OKW A;  3VSP A;  2GTK A;  2AAX A;  2OCF A;  3B3K A;  1MVC A;  3FAL A;  2FAI A;  3FXV A;  4TV1 B;  5DXE A;  2ZK3 A;  4X1F A;  4E4K A;  4REE A;  1PRG A;  2Q5P A;  3G6Q A;  2R6W A;  2VV1 B;  2AA7 A;  2PJL A;  2P7G A;  2PKL A;  3R8D A;  2Q59 A;  3ZR7 A;  4ZOM A;  2OVH A;  4QK4 A;  2PIU A;  1MV9 A;  4IW8 A;  2R40 D;  5DU5 A;  4ONI A;  2AMA A;  3CS6 A;  3OMK A;  2ZNQ A;  2QTU A;  1KNU A;  1R20 A;  4WPF A;  3FYL A;  4JYH A;  4IA7 A;  4PF3 A;  4R6S A;  3VT5 A;  3X31 A;  1I7G A;  4CN5 A;  5DX3 B;  1QKU A;  2QR9 A;  1HCP A;  3MNE A;  2HFP A;  2VV4 B;  3E7C A;  1EXA A;  1BY4 A;  2BJ4 B;  3FEJ A;  1E3K A;  5HCV A;  2QA8 B;  2JFA B;  1R1K D;  2ZKC A;  1QKT A;  4BCR A;  5B41 A;  1UPV A;  5E0X A;  5CC0 A;  3DCT A;  1LO1 A;  5DZ3 A;  3KDT A;  2P54 A;  4E2J A;  1R4I A;  2DS6 A;  3RLL A;  3ZQT A;  5AWK A;  2OM9 A;  5E1C A;  4UDC A;  3EYB A;  1YOK A;  1XP6 A;  3IPQ A;  5DRJ A;  1FCZ A;  1XB7 A;  4IS8 A;  3G9O A;  4DOS A;  3H0A D;  1GLU A;  4ZN9 A;  2FSZ A;  1ERR A;  4PLE A;  3FEI A;  3KDU A;  5AWJ A;  3N00 A;  3DZU A;  3A40 X;  1ILG A;  3B66 A;  2AXA A;  2QA6 A;  2QGT A;  4OKT A;  4S0S A;  1GAT A;  5L7H A;  5KRH A;  4OC7 A;  3GWX A;  3V3E A;  3GAT A;  2ZMJ A;  5SYZ A;  2QGW A;  1DSZ B;  1G2N A;  5DXK A;  4N8R A;  1KB4 A;  4CN7 A;  2VUT I;  4J5W C;  3IA6 A;  3VI8 A;  1YA3 A;  3Q95 B;  3D57 A;  5AK2 A;  2OZ7 A;  5CC1 A;  1VJB A;  3DFX A;  3NSQ A;  1T79 A;  2Q7K A;  3HO0 A;  3M7R A;  3G9P A;  1ZUC A;  1R20 D;  5E19 A;  3RLJ A;  5I4V A;  4WLB A;  4POJ A;  4MG7 A;  3R8I A;  4HN6 A;  2PRG A;  3V3Q A;  3B1M A;  4OIV A;  1NQ0 A;  2P1U A;  4NUF A;  3L0L A;  4OGH A;  2G5O A;  4XLD A;  5KRI A;  1K7L A;  2AX7 A;  5DP0 A;  4OND A;  1ERE A;  1S9Q A;  3FC6 A;  3PRG A;  4G1Y A;  4IVW A;  5AYG A;  2C7A A;  1LV2 A;  2Q7I A;  2Q8S A;  4M8H A;  2QMV A;  4MGC A;  4XHD A;  5DV3 A;  2I0J A;  4OZT E;  5DXB B;  2ZXN A;  4HC9 A;  1RDT A;  5DTV A;  4G2I A;  5DVV A;  1YNW B;  1YUC A;  4KZI A;  1S0Z A;  5DKS A;  3UUA B;  5HZC A;  2B1Z A;  3L0J A;  1M2Z A;  1YIN A;  3OOF A;  1ZKY A;  3B0T A;  2HAM A;  2GDA A;  3KFC A;  4IA2 A;  5KCW A;  1E3G A;  2AYR A;  3WFG A;  2AO6 A;  2GPU A;  3MNO A;  2HWQ A;  5KCU A;  2J7Y A;  3KMR A;  2GPO A;  1U3Q A;  1U9E A;  4OZR U;  3KMZ A;  5C4T A;  1FM6 D;  4JGV A;  1XV9 B;  1Z5X E;  3DZU D;  5EHJ A;  2VV0 A;  4ZI1 A;  4G1D A;  5DXG A;  4OIL A;  3W5T A;  1X7J A;  1XDK A;  1ZDT A;  5E14 A;  3ADT A;  2PIN A;  4Y29 A;  2GP7 A;  3A2J A;  4DQM A;  4EM9 A;  5DXM A;  1XAP A;  3RY9 A;  5DXR A;  3L3Z A;  2B1V A;  4JYI A;  3HC5 A;  3OKH A;  5B5B A;  2HB7 A;  2P1V A;  3LBD A;  4L96 A;  1R0O A;  4A2J A;  2XYX A;  3B0Q A;  1XVP A;  2VST A;  2NLL B;  5KRC A;  4OAR A;  2QW4 A;  3G6U A;  2ENV A;  4CN3 D;  2R40 A;  3FUG A;  1EXX A;  3QT0 A;  1ZH7 A;  1MZN A;  4G1Z A;  5G43 A;  2PIV A;  3TKM A;  1CIT A;  3AFR A;  3HLV A;  2HAR A;  1ILH A;  2Z4B A;  3VEK C;  2QZO A;  2AX8 A;  2E2R A;  4G20 A;  4K7A A;  5DY8 A;  3VT9 A;  2P7Z A;  4OZT U;  4JL4 A;  1GWQ A;  2QAB A;  2HAS A;  1T7R A;  4J5X C;  5AAV A;  1NUO A;  5EIT A;  3VSO A;  4IQR A;  4RE8 A;  1XIU A;  4IA3 A;  4PP3 A;  3A3Z X;  1QKN A;  5DWE A;  2QNV A;  3CQV A;  1DKF A;  5E0W A;  2JF9 A;  1KB6 A;  5M96 A;  3WGP A;  1R1K A;  2ATH A;  3L03 A;  2VUS I;  1X7R A;  1A6Y A;  3L3X A;  1OT7 A;  4K4J A;  4MG8 B;  5GAT A;  1WM0 X;  2V7C A;  3A78 A;  4ZO1 B;  1UHL A;  5JY3 A;  2HAN B;  4IV4 A;  5DK9 A;  3ERT A;  1LBD A;  2GL8 A;  3W0J A;  3G9M A;  3SP6 A;  1K74 A;  1T63 A;  2VV1 A;  1M13 A;  3K6P A;  4J5W A;  4RMD A;  2J4A A;  5CJ6 A;  5FQP A;  4CSJ A;  4DM8 A;  5KCD A;  2G44 A;  2ZK2 A;  3WT5 A;  3H0A A;  2XYW A;  2ZBS A;  1IE8 A;  1Y0S A;  3AZ2 A;  4JAZ A;  3ERD A;  4OKB A;  1SQN A;  3B68 A;  1RKG A;  3PCU A;  5KYA A;  1U3S A;  3W0I A;  1Y9R A;  1GDC A;  3BEJ A;  1GS4 A;  2QPY A;  4QJR A;  2AWH A;  5DX3 A;  1LV3 A;  5GT4 A;  2VV4 A;  5DUH A;  1R0N B;  2BJ4 A;  4TUZ B;  5IZ0 A;  1RK3 A;  4APU A;  4MDD A;  1R0N A;  2VSR A;  4KZM A;  1NQ1 A;  3GBK A;  2JFA A;  2EWP A;  2R6Y A;  3HVL A;  4MGB B;  4LNX A;  3ADS A;  4N1Y A;  2PNU A;  4MG9 A;  2OVM A;  3A9E A;  5KYJ A;  4WHG A;  2Q6J A;  1T7T A;  1NYX A;  2ZK6 A;  2AB2 A;  5G5W A;  4RME A;  5K13 A;  1NAX A;  2Q6R A;  2Q61 A;  3WMH A;  3AUR A;  3MNP A;  4IWC A;  2IOK A;  2NXX A;  4OJ4 A;  4P6X A;  5KRK A;  3OSA A;  5AVL A;  4MG6 A;  3W0Y A;  2ZK1 A;  1RJK A;  5ETH A;  5GIC A;  1HCQ A;  3ADW A;  3VJT A;  5L0M A;  3CTB A;  4JYG A;  3P88 A;  5JJM A;  4NB6 A;  3P8X A;  4ZNV A;  3ZRB A;  2OUZ A;  3KBA A;  3D24 A;  5APH A;  3O1E A;  3IPU A;  2Q60 A;  7GAT A;  3IMY A;  1KKQ A;  4LNW A;  4RUP A;  4YNK A;  4Q50 A;  1K74 D;  1DSZ A;  1OVL B;  1XOW A;  2G0H A;  2REW A;  2YLQ A;  3R29 A;  1ZAF A;  3FAL B;  1R4O A;  5LGA A;  3ET1 A;  3Q95 A;  4DMA A;  1FCX A;  1R6G A;  1PK5 A;  3UVV A;  3V9V A;  2OAX A;  3V9T A;  3S9S A;  1KV6 A;  6GAT A;  3V9Y A;  3ADX A;  4OZR E;  1FM6 A;  1PQC A;  3D90 A;  3FUR A;  3E94 A;  1X78 A;  5DWL A;  4DK7 A;  3CS8 A;  4HN5 A;  5DVS A;  2PIT A;  4RFW A;  4EMA A;  1XLS E;  2Q3Y A;  3A2H A;  4J5X A;  3NOA A;  5F9B A;  3F5C B;  5KRM A;  5KRJ A;  1M7W A;  3NSP A;  3W0H A;  3DY6 A;  4N5G A;  3G9E A;  3WJ4 A;  3HC6 A;  4FHI A;  5DUG A;  4NIE A;  1R4R A;  3ILZ A;  4ZJR A;  4CN3 A;  3VRV A;  4ZN7 A;  1KB2 A;  5DV8 A;  5EC9 A;  4S15 A;  5DWI A;  3AZ3 A;  1XNX A;  2ZNP A;  3OKI A;  5G45 A;  5GIE A;  1RXR A;  3IPS A;  3VT3 A;  1TXI A;  1L2I A;  5KCE A;  2ZNO A;  4RUJ A;  4ZO1 X;  3PBA A;  2I4J A;  2P1T A;  5KRL A;  4XUH A;  2V0V A;  4FNE A;  5DYD A;  3X1I A;  3HM1 A;  4F9M A;  4PVU A;  3B0W A;  3VTB A;  2B50 A;  5HJS A;  4IUI A;  5L7E A;  4PPP A;  3W0C A;  3G97 A;  2YJD A;  1XQ3 A;  4Q0A C;  3AN4 A;  4ITE A;  4S0T A;  3VHU A;  5DKG A;  2Q1V A;  1QKM A;  3OLL A;  2PIX A;  4OK1 A;  5EMP A;  3VT8 A;  4G21 A;  4UDB A;  5DMF A;  3A2I A;  1FD0 A;  5DZ0 A;  5KCC A;  5AAU A;  1R5K A;  1T73 A;  4M8E A;  4PP6 A;  4UDD A;  3VTC A;  4WVD A;  2IHQ A;  5DL4 A;  3G6R A;  2NLL A;  3PLZ A;  3HOD A;  3CBB A;  4GAT A;  1SKX A;  4R2U A;  5KD9 A;  4LTW A;  5KRB B;  3ADU A;  4HEE X;  4XI3 A;  1T76 A;  2QXM A;  4IV2 A;  1YP0 A;  2LBD A;  3AUQ A;  3P89 A;  2W8Y A;  3DT3 A;  4J24 A;  4XAO A;  5DYB A;  3T03 A;  1YIM A;  2P15 A;  4MG7 B;  5DIG A;  5DKE A;  3G8U A;  2ACL A;  1GA5 A;  3VTD A;  3OOK A;  5EMQ A;  2YHD A;  3GWS X;  5EJV A;  4MGA B;  3R8A A;  2H79 A;  2J7X A;  3W5P A;  3UUC A;  5HJP A;  4OED A;  2NW4 A;  3P0U A;  3G27 A;  3OLF A;  4IVY A;  3TKC A;  5EGV A;  2PIW A;  1NHZ A;  4PLD A;  3UU7 B;  4MGD B;  4Q13 A;  3VJS A;  3W0G A;  2HWR A;  4PPS A;  5DIE A;  1FCY A;  2GPP A;  1PCG A;  1S9P A;  3HQ5 A;  3K8S A;  3OS9 A;  3WWR A;  2Q5S A;  3VHW A;  1FM9 D;  1P93 A;  4POH A;  2VV2 A;  4X1G A;  2AA6 A;  2PIO A;  4OHA A;  1A28 A;  4ZNH A;  3X36 A;  3HZF A;  5C4O A;  5E6A A;  2POB A;  4A4W A;  2NXX E;  4FN9 A;  3ADV A;  3G8X A;  1HLZ A;  3ET0 A;  5JI0 D;  4ZNW A;  4IW6 A;  4TV1 A;  2ZXM A;  4XTA A;  1SR7 A;  4J26 A;  3AUN A;  3KMG A;  1T7F A;  1L2J A;  1G50 A;  4K6I A;  4OH6 A;  5AVI A;  1T74 A;  3TX7 B;  5CBZ A;  2O9I A;  1NQ2 A;  5DUE A;  3OMO A;  2Z4J A;  2YFE A;  4TUZ A;  4P6W A;  1T65 A;  3D6D A;  4REF A;  5DV6 A;  3UUD B;  3K23 A;  1ZDU A;  4HLW A;  3RVF A;  4YMQ A;  4FHH A;  1NDE A;  3GYT A;  4LBD A;  1DB1 A;  3G6T A;  2DS8 A;  1R0O B;  3V49 A;  1RKH A;  4ZJW A;  2ZK5 A;  3PEQ A;  2YLY A;  3L1B A;  5KRO A;  3E00 D;  3VT6 A;  2Q6S A;  3VJI A;  1N4H A;  3B0R A;  4OEZ A;  3RUT A;  2ZY0 A;  3G9J A;  1PQ9 A;  2Q7L A;  3AN3 A;  2QA8 A;  2QZO B;  3DR1 A;  3DFV C;  5AAV B;  2ZVT A;  3OSI A;  5ACC A;  3V4A A;  4R06 A;  2ZK0 A;  2AX6 A;  1H9U A;  3OS8 C;  3GYU A;  3KWY A;  1DKF B;  4ITF A;  2XKW A;  4RZE A;  5DXQ A;  5E15 A;  1OVL A;  3OMM A;  4QL8 A;  4MG5 A;  1K4W A;  3DZY A;  1OSV A;  3R5N A;  1A52 A;  1YYE A;  4UDA A;  1I38 A;  3OLS A;  5AZT A;  5G3J A;  1HRA A;  2BAW A;  5KCT A;  1UHL B;  2O4R A;  5HJP B;  5C4U A;  2ZMH A;  3TY0 A;  1P8D A;  3AX8 A;  4DK8 A;  4YPQ A;  1SJ0 A;  3CWD A;  3ET3 A;  3W5Q A;  2HB8 A;  5L11 A;  1PDU A;  4OH5 A;  2P4Y A;  1ZEO A;  2M9W A;  2Q1H A;  2XHS A;  1XNN A;  4OFR A;  3B65 A;  3ZRA A;  3G9I A;  2A66 A;  2P7A A;  3X1H A;  1G5Y A;  5IAW A;  4KZJ A;  2YLP A;  3F5C A;  3R5M A;  3K22 A;  2ZXZ A;  5DKB A;  4OJ9 A;  2AX9 A;  2ZK4 A;  3OZ0 A;  1YY4 A;  5DRM A;  2Q59 B;  5DZI A;  3KPZ A;  4G2H A;  4B7W A;  1I37 A;  2IOG A;  5CBX A;  4OEY A;  2Q5G A;  5KR9 A;  5FQV A;  4RMC A;  5DZ1 A;  3M9E A;  4NQA B;  1S0X A;  4PP5 A;  1T5Z A;  4MG9 B;  1XP1 A;  3A9E B; 
#chains in the Genus database with same CATH homology
 2J14 A;  4OOR A;  2EBL A;  1X7E A;  5EMC A;  1GNF A;  1UPW A;  4RWV A;  5DXB A;  4IWF A;  4RAK A;  4LSJ A;  3VN2 A;  4OLN A;  5G44 A;  5C4S A;  5H1E A;  1PZL A;  2QH6 A;  1YNW A;  3WTQ A;  2AMB A;  2YLO A;  4FGY A;  4PRG A;  4OIU A;  4XUM A;  3UP3 A;  3PO9 A;  2Q70 A;  3R2A A;  3OZJ A;  3UUA A;  3DZY D;  2VUU I;  5JJM B;  4AA6 A;  1BSX A;  1S19 A;  4IA1 A;  4DOR A;  4S14 A;  5E69 A;  3BQD A;  2YJA B;  1XZX X;  4PXM A;  3VRU A;  3BC5 A;  1FM9 A;  1PQ6 A;  3WT6 A;  5E6B A;  2ZNN A;  1XV9 A;  2PIP L;  1X76 A;  3DCU A;  5LWP A;  5E7V A;  1GWR A;  2POG A;  5DVC A;  3W5R A;  2Q7J A;  4TMA I;  4WQP A;  3UVV B;  3G8I A;  3KYT A;  5DXP A;  2KAE A;  1OSH A;  2FVJ A;  5DWG A;  2H77 A;  1NRL A;  2I4Z A;  3O1D A;  1N46 A;  4PWL A;  2ZAS A;  3CDS A;  1NQ7 A;  2I4P A;  4MGA A;  5KRF A;  4HC7 A;  3L0E A;  4QE8 A;  1I7I A;  4RUO X;  5DWJ A;  3VT7 A;  3VT4 A;  2FF0 A;  3ET2 A;  4WHF A;  3UP0 A;  5DSH A;  2ZLA A;  3B67 A;  3CS4 A;  2NPA A;  3UU7 A;  4MGD A;  3OS8 A;  4OJB A;  2GPV A;  4OEA A;  2HVC A;  3G99 A;  5DMC A;  1Q4X A;  3OMQ A;  4RZF A;  5G42 A;  3E00 A;  3CJW A;  3D5F A;  2G0G A;  4L98 A;  5KRA A;  2ZMI A;  5APJ A;  4DM6 A;  3FC6 B;  4OFU A;  2O4J A;  1YJE A;  3RUU A;  5IXK A;  4CI5 A;  4OV7 A;  1X7B A;  3SP9 A;  3OMP A;  3VHV A;  5HYK A;  2JJ3 A;  4MG8 A;  3IXP A;  5DI7 A;  4ZNS A;  3CLD A;  2B23 A;  1G1U A;  2HAN A;  2QSE A;  3AZ1 A;  3WFF A;  5L7G A;  1GAU A;  2PIQ A;  1XQC A;  4RZG A;  1XLS A;  3F7D A;  3UUD A;  5KCF A;  4OKX A;  2PIR A;  1XP9 A;  4ZNT A;  3CDP A;  2F4B A;  3LMP A;  3OAP A;  5APK A;  5FQT A;  5E6C A;  4CN2 C;  4TNT A;  3H52 A;  3SZ1 A;  3VRW A;  3WJ5 A;  1XPC A;  2ZLC A;  3G6P A;  1U3R A;  1UOM A;  5FQR A;  5E6D A;  1XDK B;  2GIU A;  1IE9 A;  3FS1 A;  3JZC A;  4N73 A;  3U9Q A;  3VJH A;  1YOW A;  3W0A A;  4A4V A;  1GWX A;  1TFC A;  5GID A;  2HBH A;  1RGD A;  1N83 A;  3G0W A;  2ACL B;  5AZV A;  2HCD A;  5HYR A;  2AA2 A;  1Z95 A;  4MGB A;  1RDT D;  2AM9 A;  3G8O A;  3OSW A;  4QM0 A;  1HJ1 A;  2YAT A;  2XYJ A;  1XVP B;  3WT7 A;  5CBY A;  4HCA A;  5DID A;  1T7M A;  1NAV A;  5FQS A;  1XJ7 A;  2ABI A;  2AA5 A;  3VD6 C;  4ZNU A;  1LAT A;  4CI4 A;  1HG4 A;  1Y0X X;  5ICK A;  2GAT A;  4IU7 A;  5DLR A;  4O8F A;  1FBY A;  1YMT A;  5DZH A;  2NV7 A;  1ZGY A;  5EI1 A;  2GWX A;  3B5R A;  2QXS A;  3JZB A;  3GN8 A;  2I0G A;  3OGT A;  1Z5X U;  3GD2 A;  3GZ9 A;  3IXP D;  3FLI A;  4E4Q A;  4OLM A;  5A86 A;  2HC4 A;  5G46 A;  2QE4 A;  4NY9 A;  4QE6 A;  4YT1 A;  2VV3 A;  2A3I A;  2ZFX A;  2ZL9 A;  4XT9 A;  3VRT A;  4OKW A;  3VSP A;  2GTK A;  2AAX A;  2OCF A;  3B3K A;  1MVC A;  3FAL A;  2FAI A;  3FXV A;  4TV1 B;  5DXE A;  2ZK3 A;  4X1F A;  4E4K A;  4REE A;  1PRG A;  2Q5P A;  3G6Q A;  2R6W A;  2VV1 B;  2AA7 A;  2PJL A;  2P7G A;  2PKL A;  3R8D A;  2Q59 A;  3ZR7 A;  4ZOM A;  2OVH A;  4QK4 A;  2PIU A;  1MV9 A;  4IW8 A;  2R40 D;  5DU5 A;  4ONI A;  2AMA A;  3CS6 A;  3OMK A;  2ZNQ A;  2QTU A;  1KNU A;  1R20 A;  4WPF A;  3FYL A;  4JYH A;  4IA7 A;  4PF3 A;  4R6S A;  3VT5 A;  3X31 A;  1I7G A;  4CN5 A;  5DX3 B;  1QKU A;  2QR9 A;  1HCP A;  3MNE A;  2HFP A;  2VV4 B;  3E7C A;  1EXA A;  1BY4 A;  2BJ4 B;  3FEJ A;  1E3K A;  5HCV A;  2QA8 B;  2JFA B;  1R1K D;  2ZKC A;  1QKT A;  4BCR A;  5B41 A;  1UPV A;  5E0X A;  5CC0 A;  3DCT A;  1LO1 A;  5DZ3 A;  3KDT A;  2P54 A;  4E2J A;  1R4I A;  3RLL A;  3ZQT A;  5AWK A;  2OM9 A;  5E1C A;  4UDC A;  3EYB A;  1YOK A;  1XP6 A;  3IPQ A;  5DRJ A;  1FCZ A;  1XB7 A;  4IS8 A;  3G9O A;  4DOS A;  3H0A D;  1GLU A;  4ZN9 A;  2FSZ A;  1ERR A;  4PLE A;  3FEI A;  3KDU A;  5AWJ A;  3N00 A;  3DZU A;  3A40 X;  1ILG A;  3B66 A;  2AXA A;  2QA6 A;  2QGT A;  4OKT A;  4S0S A;  1GAT A;  5L7H A;  5KRH A;  4OC7 A;  3GWX A;  3V3E A;  3GAT A;  2ZMJ A;  5SYZ A;  2QGW A;  1DSZ B;  1G2N A;  5DXK A;  4N8R A;  1KB4 A;  4CN7 A;  2VUT I;  4J5W C;  3IA6 A;  3VI8 A;  1YA3 A;  3Q95 B;  3D57 A;  5AK2 A;  2OZ7 A;  5CC1 A;  1VJB A;  3DFX A;  3NSQ A;  1T79 A;  2Q7K A;  3HO0 A;  3M7R A;  3G9P A;  1ZUC A;  1R20 D;  5E19 A;  3RLJ A;  5I4V A;  4WLB A;  4POJ A;  4MG7 A;  3R8I A;  4HN6 A;  2PRG A;  3V3Q A;  3B1M A;  4OIV A;  1NQ0 A;  2P1U A;  4NUF A;  3L0L A;  4OGH A;  2G5O A;  4XLD A;  5KRI A;  1K7L A;  2AX7 A;  5DP0 A;  4OND A;  1ERE A;  1S9Q A;  3FC6 A;  3PRG A;  4G1Y A;  4IVW A;  5AYG A;  2C7A A;  1LV2 A;  2Q7I A;  2Q8S A;  4M8H A;  2QMV A;  4MGC A;  4XHD A;  5DV3 A;  2I0J A;  4OZT E;  5DXB B;  2ZXN A;  4HC9 A;  1RDT A;  5DTV A;  4G2I A;  5DVV A;  1YNW B;  1YUC A;  4KZI A;  1S0Z A;  5DKS A;  3UUA B;  5HZC A;  2B1Z A;  3L0J A;  1M2Z A;  1YIN A;  3OOF A;  1ZKY A;  3B0T A;  2HAM A;  2GDA A;  3KFC A;  4IA2 A;  5KCW A;  1E3G A;  2AYR A;  3WFG A;  2AO6 A;  2GPU A;  3MNO A;  2HWQ A;  5KCU A;  2J7Y A;  3KMR A;  2GPO A;  1U3Q A;  1U9E A;  4OZR U;  3KMZ A;  5C4T A;  1FM6 D;  4JGV A;  1XV9 B;  1Z5X E;  3DZU D;  5EHJ A;  2VV0 A;  4ZI1 A;  4G1D A;  5DXG A;  4OIL A;  3W5T A;  1X7J A;  1XDK A;  1ZDT A;  5E14 A;  3ADT A;  2PIN A;  4Y29 A;  2GP7 A;  3A2J A;  4DQM A;  4EM9 A;  5DXM A;  1XAP A;  3RY9 A;  5DXR A;  3L3Z A;  2B1V A;  4JYI A;  3HC5 A;  3OKH A;  5B5B A;  2HB7 A;  2P1V A;  3LBD A;  4L96 A;  1R0O A;  4A2J A;  2XYX A;  3B0Q A;  1XVP A;  2VST A;  2NLL B;  5KRC A;  4OAR A;  2QW4 A;  3G6U A;  2ENV A;  4CN3 D;  2R40 A;  3FUG A;  1EXX A;  3QT0 A;  1ZH7 A;  1MZN A;  4G1Z A;  5G43 A;  2PIV A;  3TKM A;  1CIT A;  3AFR A;  3HLV A;  2HAR A;  1ILH A;  2Z4B A;  3VEK C;  2QZO A;  2AX8 A;  2E2R A;  4G20 A;  4K7A A;  5DY8 A;  3VT9 A;  2P7Z A;  4OZT U;  4JL4 A;  1GWQ A;  2QAB A;  2HAS A;  1T7R A;  4J5X C;  5AAV A;  1NUO A;  5EIT A;  3VSO A;  4IQR A;  4RE8 A;  1XIU A;  4IA3 A;  4PP3 A;  3A3Z X;  1QKN A;  5DWE A;  2QNV A;  3CQV A;  1DKF A;  5E0W A;  2JF9 A;  1KB6 A;  5M96 A;  3WGP A;  1R1K A;  2ATH A;  3L03 A;  2VUS I;  1X7R A;  1A6Y A;  3L3X A;  1OT7 A;  4K4J A;  4MG8 B;  5GAT A;  1WM0 X;  2V7C A;  3A78 A;  4ZO1 B;  1UHL A;  5JY3 A;  2HAN B;  4IV4 A;  5DK9 A;  3ERT A;  1LBD A;  2GL8 A;  3W0J A;  3G9M A;  3SP6 A;  1K74 A;  1T63 A;  2VV1 A;  1M13 A;  3K6P A;  4J5W A;  4RMD A;  2J4A A;  5CJ6 A;  5FQP A;  4CSJ A;  4DM8 A;  5KCD A;  2G44 A;  2ZK2 A;  3WT5 A;  3H0A A;  2XYW A;  2ZBS A;  1IE8 A;  1Y0S A;  3AZ2 A;  4JAZ A;  3ERD A;  4OKB A;  1SQN A;  3B68 A;  1RKG A;  3PCU A;  5KYA A;  1U3S A;  3W0I A;  1Y9R A;  1GDC A;  3BEJ A;  1GS4 A;  2QPY A;  4QJR A;  2AWH A;  5DX3 A;  1LV3 A;  5GT4 A;  2VV4 A;  5DUH A;  1R0N B;  2BJ4 A;  4TUZ B;  5IZ0 A;  1RK3 A;  4APU A;  4MDD A;  1R0N A;  2VSR A;  4KZM A;  1NQ1 A;  3GBK A;  2JFA A;  2EWP A;  2R6Y A;  3HVL A;  4MGB B;  4LNX A;  3ADS A;  4N1Y A;  2PNU A;  4MG9 A;  2OVM A;  3A9E A;  5KYJ A;  4WHG A;  2Q6J A;  1T7T A;  1NYX A;  2ZK6 A;  2AB2 A;  5G5W A;  4RME A;  5K13 A;  1NAX A;  2Q6R A;  2Q61 A;  3WMH A;  3AUR A;  3MNP A;  4IWC A;  2IOK A;  2NXX A;  4OJ4 A;  4P6X A;  5KRK A;  3OSA A;  5AVL A;  4MG6 A;  3W0Y A;  2ZK1 A;  1RJK A;  5ETH A;  5GIC A;  1HCQ A;  3ADW A;  3VJT A;  5L0M A;  3CTB A;  4JYG A;  3P88 A;  5JJM A;  4NB6 A;  3P8X A;  4ZNV A;  3ZRB A;  2OUZ A;  3KBA A;  3D24 A;  5APH A;  3O1E A;  3IPU A;  2Q60 A;  7GAT A;  3IMY A;  1KKQ A;  4LNW A;  4RUP A;  4YNK A;  4Q50 A;  1K74 D;  1DSZ A;  1OVL B;  1XOW A;  2G0H A;  2REW A;  2YLQ A;  3R29 A;  1ZAF A;  3FAL B;  1R4O A;  5LGA A;  3ET1 A;  3Q95 A;  4DMA A;  1FCX A;  1R6G A;  1PK5 A;  3UVV A;  3V9V A;  2OAX A;  3V9T A;  3S9S A;  1KV6 A;  6GAT A;  3V9Y A;  3ADX A;  4OZR E;  1FM6 A;  1PQC A;  3D90 A;  3FUR A;  3E94 A;  1X78 A;  5DWL A;  4DK7 A;  3CS8 A;  4HN5 A;  5DVS A;  2PIT A;  4RFW A;  4EMA A;  1XLS E;  2Q3Y A;  3A2H A;  4J5X A;  3NOA A;  5F9B A;  3F5C B;  5KRM A;  5KRJ A;  1M7W A;  3NSP A;  3W0H A;  3DY6 A;  4N5G A;  3G9E A;  3WJ4 A;  3HC6 A;  4FHI A;  5DUG A;  4NIE A;  1R4R A;  3ILZ A;  4ZJR A;  4CN3 A;  3VRV A;  4ZN7 A;  1KB2 A;  5DV8 A;  5EC9 A;  4S15 A;  5DWI A;  3AZ3 A;  1XNX A;  2ZNP A;  3OKI A;  5G45 A;  5GIE A;  1RXR A;  3IPS A;  3VT3 A;  1TXI A;  1L2I A;  5KCE A;  2ZNO A;  4RUJ A;  4ZO1 X;  3PBA A;  2I4J A;  2P1T A;  5KRL A;  4XUH A;  2V0V A;  4FNE A;  5DYD A;  3X1I A;  3HM1 A;  4F9M A;  4PVU A;  3B0W A;  3VTB A;  2B50 A;  5HJS A;  4IUI A;  5L7E A;  4PPP A;  3W0C A;  3G97 A;  2YJD A;  1XQ3 A;  4Q0A C;  3AN4 A;  4ITE A;  4S0T A;  3VHU A;  5DKG A;  2Q1V A;  1QKM A;  3OLL A;  2PIX A;  4OK1 A;  5EMP A;  3VT8 A;  4G21 A;  4UDB A;  5DMF A;  3A2I A;  1FD0 A;  5DZ0 A;  5KCC A;  5AAU A;  1R5K A;  1T73 A;  4M8E A;  4PP6 A;  4UDD A;  3VTC A;  4WVD A;  2IHQ A;  5DL4 A;  3G6R A;  2NLL A;  3PLZ A;  3HOD A;  3CBB A;  4GAT A;  1SKX A;  4R2U A;  5KD9 A;  4LTW A;  5KRB B;  3ADU A;  4HEE X;  4XI3 A;  1T76 A;  2QXM A;  4IV2 A;  1YP0 A;  2LBD A;  3AUQ A;  3P89 A;  2W8Y A;  3DT3 A;  4J24 A;  4XAO A;  5DYB A;  3T03 A;  1YIM A;  2P15 A;  4MG7 B;  5DIG A;  5DKE A;  3G8U A;  2ACL A;  1GA5 A;  3VTD A;  3OOK A;  5EMQ A;  2YHD A;  3GWS X;  5EJV A;  4MGA B;  3R8A A;  2H79 A;  2J7X A;  3W5P A;  3UUC A;  5HJP A;  4OED A;  2NW4 A;  3P0U A;  3OLF A;  4IVY A;  3TKC A;  5EGV A;  2PIW A;  1NHZ A;  4PLD A;  3UU7 B;  4MGD B;  4Q13 A;  3VJS A;  3W0G A;  2HWR A;  4PPS A;  5DIE A;  1FCY A;  2GPP A;  1PCG A;  1S9P A;  3HQ5 A;  3K8S A;  3OS9 A;  3WWR A;  2Q5S A;  3VHW A;  1FM9 D;  1P93 A;  4POH A;  2VV2 A;  4X1G A;  2AA6 A;  2PIO A;  4OHA A;  1A28 A;  4ZNH A;  3X36 A;  3HZF A;  5C4O A;  5E6A A;  2POB A;  4A4W A;  2NXX E;  4FN9 A;  3ADV A;  3G8X A;  1HLZ A;  3ET0 A;  5JI0 D;  4ZNW A;  4IW6 A;  4TV1 A;  2ZXM A;  4XTA A;  1SR7 A;  4J26 A;  3AUN A;  3KMG A;  1T7F A;  1L2J A;  1G50 A;  4K6I A;  4OH6 A;  5AVI A;  1T74 A;  3TX7 B;  5CBZ A;  2O9I A;  1NQ2 A;  5DUE A;  3OMO A;  2Z4J A;  2YFE A;  4TUZ A;  4P6W A;  1T65 A;  3D6D A;  4REF A;  5DV6 A;  3UUD B;  3K23 A;  1ZDU A;  4HLW A;  3RVF A;  4YMQ A;  4FHH A;  1NDE A;  3GYT A;  4LBD A;  1DB1 A;  3G6T A;  1R0O B;  3V49 A;  1RKH A;  4ZJW A;  2ZK5 A;  3PEQ A;  2YLY A;  3L1B A;  5KRO A;  3E00 D;  3VT6 A;  2Q6S A;  3VJI A;  1N4H A;  3B0R A;  4OEZ A;  3RUT A;  2ZY0 A;  3G9J A;  1PQ9 A;  2Q7L A;  3AN3 A;  2QA8 A;  2QZO B;  3DR1 A;  3DFV C;  5AAV B;  2ZVT A;  3OSI A;  5ACC A;  3V4A A;  4R06 A;  2ZK0 A;  2AX6 A;  1H9U A;  3OS8 C;  3GYU A;  3KWY A;  1DKF B;  4ITF A;  2XKW A;  4RZE A;  5DXQ A;  5E15 A;  1OVL A;  3OMM A;  4QL8 A;  4MG5 A;  1K4W A;  3DZY A;  1OSV A;  3R5N A;  1A52 A;  1YYE A;  4UDA A;  1I38 A;  3OLS A;  5AZT A;  5G3J A;  1HRA A;  2BAW A;  5KCT A;  1UHL B;  2O4R A;  5HJP B;  5C4U A;  2ZMH A;  3TY0 A;  1P8D A;  3AX8 A;  4DK8 A;  4YPQ A;  1SJ0 A;  3CWD A;  3ET3 A;  3W5Q A;  2HB8 A;  5L11 A;  1PDU A;  4OH5 A;  2P4Y A;  1ZEO A;  2M9W A;  2Q1H A;  2XHS A;  1XNN A;  4OFR A;  3B65 A;  3ZRA A;  3G9I A;  2A66 A;  2P7A A;  3X1H A;  1G5Y A;  5IAW A;  4KZJ A;  2YLP A;  3F5C A;  3R5M A;  3K22 A;  2ZXZ A;  5DKB A;  4OJ9 A;  2AX9 A;  2ZK4 A;  3OZ0 A;  1YY4 A;  5DRM A;  2Q59 B;  5DZI A;  3KPZ A;  4G2H A;  4B7W A;  1I37 A;  2IOG A;  5CBX A;  4OEY A;  2Q5G A;  5KR9 A;  5FQV A;  4RMC A;  5DZ1 A;  3M9E A;  4NQA B;  1S0X A;  4PP5 A;  1T5Z A;  4MG9 B;  1XP1 A;  3A9E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...