3DZYD

Intact ppar gamma - rxr alpha nuclear receptor complex on dna bound with rosiglitazone, 9-cis retinoic acid and ncoa2 peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
370
structure length
354
Chain Sequence
AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Retinoic acid receptor RXR-alpha
publication title Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 354
sequence length 370
ec nomenclature
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
D PF00105 zf-C4 Zinc finger, C4 type (two domains)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3dzyD02
3.30.50.10 Alpha Beta 2-Layer Sandwich Erythroid Transcription Factor GATA-1; Chain A Erythroid Transcription Factor GATA-1, subunit A 3dzyD01
1FM9A 1U9EA 3ERTA 2BAWA 5H1EA 2XHSA 1TFCA 4DMAA 4JL4A 3ADVA 1U3SA 5DXBB 2QW4A 3V49A 4B7WA 4N73A 4OEYA 3LBDA 5GATA 3VTBA 1XOWA 5CBZA 1R20D 5AK2A 4J5WA 2ZNOA 5DUGA 1T63A 1T5ZA 2PIOA 2Q6JA 3RVFA 3T03A 3ZQTA 1YINA 1K74D 3ADXA 2Q5GA 3FUGA 5KR9A 2ACLB 5KRIA 1NQ1A 4QE8A 4OJ9A 1CITA 2AX8A 4S0SA 2OUZA 4O8FA 4Y29A 1Z5XE 3V3QA 4DM6A 4MGBB 4PLEA 5E0XA 3VHVA 1ERRA 4OK1A 3CS8A 3OSIA 4MGDA 5AZTA 3VN2A 2HFPA 3OS8C 4OZRE 3ZRAA 4OH6A 3G6PA 5KRLA 3GWSX 1XP1A 2PITA 1NQ2A 2Q61A 1M7WA 3HLVA 3W0GA 3TY0A 2Z4JA 3ADUA 4RMEA 2GP7A 1SQNA 2REWA 3VHWA 3NOAA 3R5MA 2VUUI 3A2HA 3DFVC 1PQCA 4REFA 1GDCA 2Q1HA 1HCQA 3OGTA 2NLLA 2ZFXA 2H77A 3B68A 4CSJA 3E00D 2A66A 1G50A 2QSEA 1GS4A 1PRGA 5AVLA 3IMYA 1NAXA 1Y9RA 4IU7A 5K13A 3G6RA 4OIVA 3E7CA 2QABA 1A6YA 1UOMA 1XV9A 3O1EA 1YJEA 5E7VA 2QH6A 5E6BA 3W0AA 1FM9D 3G97A 1XLSE 4RFWA 4MG5A 3SZ1A 1XVPA 1LBDA 1T7RA 3BEJA 3UUAB 3OSAA 3JZBA 1A28A 4P6XA 2VSRA 1GA5A 4WLBA 3CJWA 3VRWA 3AN4A 3TKCA 4J5XA 3VSPA 1XDKB 2XYJA 4L98A 4OKBA 3UVVA 4OJ4A 2QTUA 1T76A 1T7MA 4IVWA 5DV3A 4DORA 2QE4A 2EWPA 4IS8A 1R1KA 2YLOA 4IV2A 4G21A 5G5WA 4YNKA 5DYDA 2BJ4B 5FQPA 2AO6A 5M96A 4MG7A 3G8OA 2FVJA 4HC7A 5KCUA 3G0WA 5DIGA 1LV3A 6GATA 4YT1A 5FQSA 2O4JA 4M8EA 3ZR7A 5E14A 3OOKA 2AA5A 3W0YA 1Z5XU 3G99A 1I38A 4OGHA 1GAUA 4NIEA 4ZNSA 5EHJA 3WGPA 4CN5A 3VT6A 3FEJA 4APUA 1I7GA 2JJ3A 2PIWA 4OZRU 4S0TA 3ET2A 5CJ6A 5DV8A 5KYJA 1HCPA 1XQ3A 2QA6A 4UDCA 3A40X 1L2IA 4HC9A 2HASA 1IE9A 1DB1A 2AA2A 2AAXA 2ZNQA 2AX9A 3B0WA 4A2JA 5AAVB 3TKMA 3A2IA 2R40A 3KMRA 5E6AA 3V3EA 1G1UA 3KPZA 4MGBA 2P1UA 4OKXA 4DQMA 1KV6A 3G9OA 1KNUA 1R4OA 1U3RA 3F7DA 5DZ3A 4OKWA 2GPPA 3PO9A 3AZ1A 2FSZA 2AA7A 5L11A 3G6QA 7GATA 3G9IA 4TV1A 1R4RA 3GYUA 5G44A 4OLNA 4J24A 3VRTA 2POBA 4RMCA 2HVCA 3WMHA 5HZCA 1HRAA 3G9JA 4LNXA 1NAVA 3Q95B 1PZLA 2AM9A 1R1KD 1RDTA 3D90A 4JAZA 4PPPA 4N1YA 1N4HA 4ZN9A 2HB7A 3X36A 1YIMA 5DU5A 2HWQA 1RKGA 3L1BA 2VV3A 2QMVA 3W5TA 5KRJA 4R2UA 3CWDA 1RK3A 3V9YA 4ZNUA 4CI5A 5JJMB 1MVCA 3ADTA 4XI3A 4F9MA 5DY8A 4R06A 4JYHA 4KZMA 1NQ7A 2ATHA 2YLPA 3AUQA 1QKMA 3FS1A 2GIUA 2Q7LA 2NXXA 2HARA 5B5BA 4IA1A 3GZ9A 4G2IA 3MNOA 1XNXA 3E94A 2V7CA 3KWYA 3X1IA 4WPFA 4CN2C 2AA6A 3FALA 3K8SA 2J4AA 1KB6A 5KCTA 5DZHA 5DRMA 1XQCA 3KFCA 3LMPA 2GTKA 1PDUA 1XPCA 5DL4A 2ZLAA 5AWKA 3VEKC 3OLLA 2AB2A 3MNPA 4WQPA 3AUNA 1N46A 2BJ4A 4FN9A 4MGCA 3DT3A 5E1CA 2QNVA 1WM0X 3V4AA 3F5CA 4XUMA 4NY9A 5FQVA 2YHDA 2Q70A 2GPVA 2OVHA 4RZFA 5L7HA 2YLQA 5KCWA 4PF3A 1EREA 2AWHA 1P93A 2HWRA 5DXEA 5L0MA 3V9VA 3VT3A 2ZMHA 4RUOX 4IVYA 4WHGA 5GIDA 3SP6A 4BCRA 1RDTD 3TX7B 2P54A 3H52A 4HN6A 4UDDA 4L96A 5DK9A 1R0NA 2HANA 4OORA 1PK5A 2ZK0A 1YA3A 1YMTA 3L3ZA 5EJVA 2PIRA 3W5QA 1ZKYA 4RE8A 1YY4A 3KMGA 3ILZA 3UUDB 5JI0D 1QKUA 2I4PA 5C4OA 2VV4B 5G3JA 5AWJA 1KB2A 3X31A 1DKFA 2Q5SA 1PQ9A 2G5OA 4LBDA 4OARA 1I37A 2VV1B 2ZVTA 3AFRA 3HQ5A 4P6WA 5DV6A 5DXGA 1OSVA 4AA6A 3B67A 3CBBA 3WFFA 3OMKA 4RUPA 2Q1VA 4OC7A 1Y0XX 4TUZA 3W5PA 2J7YA 4ZNWA 5EMPA 1RJKA 1R0OB 4MG9B 2Q3YA 4JYIA 2P1TA 2B1ZA 3P89A 1ZEOA 5E69A 1X7EA 4UDAA 1DSZA 1GWRA 1HG4A 5KRKA 3X1HA 4IUIA 5SYZA 2V0VA 3G9MA 5CC0A 3GN8A 4UDBA 1U3QA 5DX3B 2QGTA 1Z95A 2H79A 5DYBA 3R8DA 3W0IA 4PXMA 3SP9A 2G0HA 4MG6A 4N5GA 5JJMA 1M2ZA 4PPSA 3VSOA 3W0CA 1MV9A 3B1MA 2QA8A 2B50A 4RMDA 4ZOMA 5E15A 1XZXX 2Q60A 3D57A 2ZK5A 3OS9A 1GLUA 3W0HA 4OV7A 2Q5PA 3O1DA 3W0JA 3DFXA 4MG8B 4S14A 2OCFA 1YYEA 3OSWA 4OEDA 3VRVA 4N8RA 3K22A 3RY9A 1N83A 2ZK4A 3OMMA 4MGAB 4ZNTA 2GPOA 2FF0A 2ZNPA 4S15A 3B0TA 3ADSA 3WT7A 5GICA 3CS6A 1LATA 5B41A 4ONIA 1Q4XA 3VT8A 2ZMIA 4G20A 1NHZA 1S9PA 5DTVA 4E4KA 4ZJRA 5DRJA 2Q7IA 4Q50A 4QM0A 3OLFA 2PINA 5DXBA 2JFAB 2GWXA 3PBAA 1S0XA 1T73A 2PIPL 4FHIA 4X1FA 3UU7B 2M9WA 3OZ0A 2HCDA 1K4WA 2PIXA 5HJPB 3OLSA 3K6PA 2PKLA 2ACLA 2HAMA 4M8HA 3WT6A 4A4VA 4E4QA 4ONDA 5G46A 5KRMA 4IWCA 3D5FA 2I0GA 2Q8SA 3OMPA 1GATA 3IPSA 2YJDA 4OILA 4PRGA 4YMQA 4PWLA 5JY3A 3IXPA 4FHHA 2VV4A 4J5WC 3VT4A 1XNNA 2OM9A 2ZKCA 5IXKA 4HEEX 4E2JA 4CN3A 2YATA 3ET3A 5I4VA 2P4YA 3GATA 4GATA 2HB8A 2NXXE 5C4UA 5DWIA 3L3XA 4XAOA 4DOSA 1RGDA 5AAUA 1FM6A 3R8IA 3RLLA 4CN7A 1SJ0A 1RKHA 2ZXNA 2IOGA 4ZN7A 3QT0A 1YNWB 2VV2A 1ZDUA 3AZ2A 3NSPA 4MG9A 4YPQA 5EITA 4TNTA 1XIUA 2ZK2A 1NRLA 2Q59B 1PCGA 2XKWA 3B5RA 3G6UA 3VJTA 4PLDA 4MGDB 3WT5A 1NDEA 4JYGA 5EI1A 4HLWA 3VTCA 2PJLA 2QZOB 5GIEA 3VHUA 3VJSA 2P7AA 3N00A 5DSHA 5KRAA 5IZ0A 4G1YA 3MNEA 3IA6A 2ZK6A 3GWXA 2GATA 2LBDA 1EXXA 1SR7A 1OT7A 3UUAA 3DZYA 3CTBA 1FCZA 1BY4A 4IW8A 4K6IA 4XLDA 2ZMJA 3VD6C 3ERDA 4OJBA 3K23A 1R20A 3IPUA 1L2JA 5DWGA 4ZI1A 1XDKA 3BQDA 2P7ZA 2NPAA 2PIQA 4OEZA 2R40D 3FC6B 1OVLB 1NQ0A 5DXPA 5DP0A 2Q7KA 1RXRA 1XV9B 1X7RA 1G5YA 5GT4A 3RLJA 3IXPD 4KZIA 5HJSA 5DXKA 2OZ7A 2ZL9A 2P15A 3OMOA 2PIVA 5DVSA 2YFEA 5LWPA 4CN3D 3VTDA 4HN5A 2FAIA 4J5XC 1NYXA 1T74A 2NW4A 2AMBA 4ITFA 2AX7A 5DMFA 5FQTA 3L0LA 3R8AA 3UP3A 2I4ZA 4WVDA 2AYRA 3DY6A 4XT9A 2Q6SA 3EYBA 3DZYD 3GYTA 2E2RA 3VT5A 2GL8A 2JFAA 2ABIA 5APKA 2I4JA 1QKNA 4TMAI 1M13A 2AXAA 3A78A 4PP3A 3H0AA 3P0UA 3NSQA 4G1ZA 4OZTE 2J7XA 2YLYA 5KCCA 5KRCA 3S9SA 2ENVA 3G9PA 5HYKA 3VJIA 5AAVA 4MG7B 3RUUA 3E00A 2ZLCA 4RZEA 5EMCA 5G42A 1R5KA 3L0JA 5KD9A 4EMAA 2KAEA 4JGVA 3G8IA 3ZRBA 2ZY0A 1FD0A 1XP9A 1UHLB 3A2JA 5DKGA 3B0QA 4IA2A 5E19A 3VT9A 1E3GA 4CI4A 1S0ZA 1X78A 2B1VA 4OFRA 3DCUA 1ILHA 2ZBSA 4FGYA 3PCUA 4G1DA 2HBHA 5DLRA 1OSHA 4XHDA 4NUFA 4Q13A 1ZGYA 2R6YA 3GBKA 3Q95A 1YNWA 5L7EA 5KROA 1ILGA 3D6DA 5A86A 2Q7JA 2Q59A 3HVLA 5ACCA 2EBLA 3V9TA 3OAPA 3WTQA 5DKBA 1EXAA 1ZH7A 2QPYA 3G8XA 2OAXA 3HC6A 1GWXA 2QZOA 3HC5A 2YJAB 2ZNNA 3OOFA 4DK8A 5L7GA 1T7TA 3KDUA 4TV1B 3VI8A 1ZAFA 3VJHA 3OKIA 1LO1A 4IQRA 2GDAA 2C7AA 4QL8A 4PP6A 3ET1A 3A9EB 2ZXMA 5IAWA 2A3IA 3FLIA 1R4IA 5DUHA 5HYRA 3UP0A 5KRBB 1S19A 3CDPA 3H0AD 4ZO1X 2GPUA 5DXMA 5C4SA 1XB7A 3M9EA 2O4RA 3L0EA 3P8XA 5C4TA 2G44A 4IWFA 3PRGA 5DWEA 3KMZA 4A4WA 5KRHA 3DZUA 3FC6A 1FBYA 3PLZA 4NB6A 1OVLA 4DK7A 4HCAA 4OIUA 2VUSI 1R6GA 1PQ6A 3FURA 4K4JA 4RUJA 5DXRA 3HO0A 3HZFA 4ITEA 3UUCA 4OZTU 3CLDA 3VT7A 5DWLA 4FNEA 5EGVA 5LGAA 3WFGA 1YP0A 3DCTA 5DKEA 1KKQA 3FALB 2P1VA 4OH5A 4RZGA 5DZ1A 2P7GA 2AX6A 1KB4A 2POGA 3HM1A 2Z4BA 5ICKA 5KCEA 1GNFA 5KRFA 3R29A 4PVUA 3WWRA 1GWQA 5E6CA 1NUOA 2PNUA 2F4BA 3F5CB 4ZNVA 1Y0SA 5DIDA 1YOWA 3OZJA 4LTWA 1XLSA 3UUDA 3OMQA 5AVIA 3FYLA 3M7RA 5DWJA 1E3KA 4K7AA 4MDDA 3AX8A 5DZ0A 3B0RA 3BC5A 4IW6A 5DUEA 3WJ4A 1UHLA 1T7FA 2VV1A 1LV2A 3OS8A 1K7LA 2PRGA 2HANB 3GD2A 3B65A 3ET0A 1QKTA 2R6WA 4OEAA 3G9EA 5ETHA 1R0NB 3CDSA 2I0JA 2XYWA 3P88A 5DKSA 1R0OA 2IOKA 4QK4A 1UPWA 3DZUD 1S9QA 5CBXA 1I7IA 3FXVA 4REEA 3AN3A 1ZDTA 5CC1A 2HC4A 1HJ1A 1SKXA 1YOKA 1X7BA 2ZXZA 1T79A 3FEIA 5KCFA 1MZNA 5DI7A 4RAKA 5E0WA 3KBAA 5DZIA 3RUTA 1DKFB 5DX3A 5EC9A 5KCDA 3IPQA 3PEQA 4EM9A 4G2HA 4NQAB 4PP5A 5CBYA 1T65A 2B23A 1XJ7A 2W8YA 3ADWA 4TUZB 5APJA 5F9BA 1XAPA 4ZO1B 1YUCA 3AZ3A 3R2AA 4IA3A 1VJBA 3B3KA 4IA7A 4QE6A 3A9EA 5APHA 1ZUCA 2QXMA 1P8DA 4OFUA 3W5RA 1DSZB 2NLLB 4WHFA 5HCVA 1K74A 5KYAA 1IE8A 2PIUA 2Q6RA 3A3ZX 4IV4A 4MG8A 2ZASA 4J26A 4DM8A 4XUHA 3OKHA 4KZJA 1G2NA 4QJRA 4OLMA 3VRUA 4MGAA 2NV7A 4XTAA 2J14A 1X76A 1UPVA 1XVPB 2ZK1A 2VUTI 2QR9A 4POJA 1FCYA 3CQVA 3D24A 2AMAA 2ZK3A 3KDTA 3G6TA 1A52A 3B66A 5DVVA 3JZCA 1BSXA 2OVMA 3CS4A 5DMCA 5AYGA 2QA8B 3G8UA 4X1GA 1HLZA 5DIEA 1FM6D 1XP6A 1TXIA 5DVCA 3R5NA 5FQRA 5EMQA 3UVVB 3L03A 4POHA 3DR1A 4Q0AC 4ZNHA 2JF9A 3HODA 4OHAA 3U9QA 4OKTA 4ZJWA 5G45A 3UU7A 3WJ5A 2VSTA 1X7JA 1H9UA 5DXQA 4LSJA 5HJPA 2QGWA 4RWVA 5AZVA 3AURA 5E6DA 2VV0A 5G43A 2QXSA 1FCXA 4R6SA 2G0GA 2XYXA 4LNWA 3KYTA 2IHQA 2O9IA
chains in the Genus database with same CATH superfamily
1FM9A 1U9EA 3ERTA 2BAWA 5H1EA 2XHSA 1TFCA 4DMAA 4JL4A 3ADVA 1U3SA 5DXBB 2QW4A 3V49A 4B7WA 4N73A 4OEYA 3LBDA 5GATA 3VTBA 1XOWA 5CBZA 1R20D 5AK2A 4J5WA 2ZNOA 5DUGA 1T63A 1T5ZA 2PIOA 2Q6JA 3RVFA 3T03A 3ZQTA 1YINA 1K74D 3ADXA 2Q5GA 3FUGA 5KR9A 2ACLB 5KRIA 1NQ1A 4QE8A 4OJ9A 1CITA 2AX8A 4S0SA 2OUZA 4O8FA 4Y29A 1Z5XE 3V3QA 4DM6A 4MGBB 4PLEA 5E0XA 3VHVA 1ERRA 4OK1A 3CS8A 3OSIA 4MGDA 5AZTA 3VN2A 2HFPA 3OS8C 4OZRE 3ZRAA 4OH6A 3G6PA 5KRLA 3GWSX 1XP1A 2PITA 1NQ2A 2Q61A 1M7WA 3HLVA 3W0GA 3TY0A 2Z4JA 3ADUA 4RMEA 2DS5A 2GP7A 1SQNA 2REWA 3VHWA 3NOAA 3R5MA 2VUUI 3A2HA 3DFVC 1PQCA 4REFA 1GDCA 2Q1HA 1HCQA 3OGTA 2NLLA 2ZFXA 2H77A 3B68A 4CSJA 3E00D 2A66A 1G50A 2QSEA 1GS4A 1PRGA 5AVLA 3IMYA 1NAXA 1Y9RA 4IU7A 5K13A 3G6RA 4OIVA 3E7CA 2QABA 1A6YA 1UOMA 1XV9A 3O1EA 1YJEA 5E7VA 2QH6A 5E6BA 3W0AA 1FM9D 3G97A 1XLSE 4RFWA 4MG5A 3SZ1A 1XVPA 1LBDA 1T7RA 3BEJA 3UUAB 3OSAA 3JZBA 1A28A 4P6XA 2VSRA 1GA5A 4WLBA 3CJWA 3VRWA 3AN4A 3TKCA 4J5XA 3VSPA 1XDKB 2XYJA 4L98A 4OKBA 3UVVA 4OJ4A 2QTUA 1T76A 1T7MA 4IVWA 5DV3A 4DORA 2QE4A 2EWPA 4IS8A 1R1KA 2YLOA 4IV2A 4G21A 5G5WA 4YNKA 5DYDA 2BJ4B 5FQPA 2AO6A 5M96A 4MG7A 3G8OA 2FVJA 4HC7A 5KCUA 3G0WA 5DIGA 1LV3A 6GATA 4YT1A 5FQSA 2O4JA 4M8EA 3ZR7A 5E14A 3OOKA 2AA5A 3W0YA 1Z5XU 3G99A 1I38A 4OGHA 1GAUA 4NIEA 4ZNSA 5EHJA 3WGPA 4CN5A 3VT6A 3FEJA 4APUA 1I7GA 2JJ3A 2PIWA 4OZRU 4S0TA 3ET2A 5CJ6A 5DV8A 5KYJA 1HCPA 1XQ3A 2QA6A 4UDCA 3A40X 1L2IA 4HC9A 2HASA 1IE9A 1DB1A 2AA2A 2AAXA 2ZNQA 2AX9A 3B0WA 4A2JA 5AAVB 3TKMA 3A2IA 2R40A 3KMRA 5E6AA 3V3EA 1G1UA 3KPZA 4MGBA 2P1UA 4OKXA 4DQMA 1KV6A 3G9OA 1KNUA 1R4OA 1U3RA 3F7DA 5DZ3A 4OKWA 2GPPA 3PO9A 3AZ1A 2FSZA 2AA7A 5L11A 3G6QA 7GATA 3G9IA 4TV1A 1R4RA 3GYUA 5G44A 4OLNA 4J24A 3VRTA 2POBA 4RMCA 2HVCA 3WMHA 5HZCA 1HRAA 3G9JA 4LNXA 1NAVA 3Q95B 1PZLA 2AM9A 1R1KD 1RDTA 3D90A 4JAZA 4PPPA 4N1YA 1N4HA 4ZN9A 2HB7A 3X36A 1YIMA 5DU5A 2HWQA 1RKGA 3L1BA 2VV3A 2QMVA 3W5TA 5KRJA 4R2UA 3CWDA 1RK3A 3V9YA 4ZNUA 4CI5A 5JJMB 1MVCA 3ADTA 4XI3A 4F9MA 5DY8A 4R06A 4JYHA 4KZMA 1NQ7A 2ATHA 2YLPA 3AUQA 1QKMA 3FS1A 2GIUA 2Q7LA 2NXXA 2HARA 5B5BA 4IA1A 3GZ9A 4G2IA 3MNOA 1XNXA 3E94A 2V7CA 3KWYA 3X1IA 4WPFA 4CN2C 2AA6A 3FALA 3K8SA 2J4AA 1KB6A 5KCTA 5DZHA 5DRMA 1XQCA 3KFCA 3LMPA 2GTKA 1PDUA 1XPCA 5DL4A 2ZLAA 5AWKA 3VEKC 3OLLA 2AB2A 3MNPA 4WQPA 3AUNA 1N46A 2BJ4A 4FN9A 4MGCA 3DT3A 5E1CA 2QNVA 1WM0X 3V4AA 3F5CA 4XUMA 4NY9A 5FQVA 2YHDA 2Q70A 2GPVA 2OVHA 4RZFA 5L7HA 2YLQA 5KCWA 4PF3A 1EREA 2AWHA 1P93A 2HWRA 5DXEA 5L0MA 3V9VA 3VT3A 2ZMHA 4RUOX 4IVYA 4WHGA 5GIDA 3SP6A 4BCRA 1RDTD 3TX7B 2P54A 3H52A 4HN6A 4UDDA 4L96A 5DK9A 1R0NA 2HANA 4OORA 1PK5A 2ZK0A 1YA3A 1YMTA 3L3ZA 5EJVA 2PIRA 3W5QA 1ZKYA 4RE8A 1YY4A 3KMGA 3ILZA 3UUDB 5JI0D 1QKUA 2I4PA 5C4OA 2VV4B 5G3JA 5AWJA 1KB2A 3X31A 1DKFA 2Q5SA 1PQ9A 2G5OA 4LBDA 4OARA 1I37A 2VV1B 2ZVTA 3AFRA 3HQ5A 4P6WA 5DV6A 5DXGA 1OSVA 4AA6A 3B67A 3CBBA 3WFFA 3OMKA 4RUPA 2Q1VA 4OC7A 1Y0XX 4TUZA 3W5PA 2J7YA 4ZNWA 5EMPA 1RJKA 1R0OB 4MG9B 2Q3YA 4JYIA 2P1TA 2B1ZA 3P89A 1ZEOA 5E69A 1X7EA 4UDAA 1DSZA 1GWRA 1HG4A 5KRKA 3X1HA 4IUIA 5SYZA 2V0VA 3G9MA 5CC0A 3GN8A 4UDBA 1U3QA 5DX3B 2QGTA 1Z95A 2H79A 5DYBA 3R8DA 3W0IA 4PXMA 3SP9A 2G0HA 4MG6A 4N5GA 5JJMA 1M2ZA 4PPSA 3VSOA 3W0CA 1MV9A 3B1MA 2QA8A 2B50A 4RMDA 4ZOMA 5E15A 1XZXX 2Q60A 3D57A 2ZK5A 3OS9A 1GLUA 3W0HA 4OV7A 2Q5PA 3O1DA 3W0JA 3DFXA 4MG8B 4S14A 2OCFA 1YYEA 3OSWA 4OEDA 3VRVA 4N8RA 3K22A 3RY9A 1N83A 2ZK4A 3OMMA 4MGAB 4ZNTA 2GPOA 2FF0A 2ZNPA 4S15A 3B0TA 3ADSA 3WT7A 5GICA 3CS6A 1LATA 5B41A 4ONIA 1Q4XA 3VT8A 2ZMIA 4G20A 1NHZA 1S9PA 5DTVA 4E4KA 4ZJRA 5DRJA 2Q7IA 4Q50A 4QM0A 3OLFA 2PINA 5DXBA 2JFAB 2GWXA 3PBAA 1S0XA 1T73A 2PIPL 4FHIA 4X1FA 3UU7B 2M9WA 3OZ0A 2HCDA 1K4WA 2PIXA 5HJPB 3OLSA 3K6PA 2PKLA 2ACLA 2HAMA 4M8HA 3WT6A 4A4VA 4E4QA 4ONDA 5G46A 5KRMA 4IWCA 3D5FA 2I0GA 2Q8SA 3OMPA 1GATA 3IPSA 2YJDA 4OILA 4PRGA 4YMQA 4PWLA 5JY3A 3IXPA 4FHHA 2VV4A 4J5WC 3VT4A 1XNNA 2OM9A 2ZKCA 5IXKA 4HEEX 4E2JA 4CN3A 2YATA 3ET3A 5I4VA 2P4YA 3GATA 4GATA 2HB8A 2NXXE 5C4UA 5DWIA 3L3XA 4XAOA 4DOSA 1RGDA 5AAUA 1FM6A 3R8IA 3RLLA 4CN7A 1SJ0A 1RKHA 2ZXNA 2IOGA 4ZN7A 3QT0A 1YNWB 2VV2A 1ZDUA 3AZ2A 3NSPA 4MG9A 4YPQA 5EITA 4TNTA 1XIUA 2ZK2A 1NRLA 2Q59B 1PCGA 2XKWA 3B5RA 3G6UA 3VJTA 4PLDA 4MGDB 3WT5A 1NDEA 4JYGA 5EI1A 4HLWA 3VTCA 2PJLA 2QZOB 5GIEA 3VHUA 3VJSA 2P7AA 3N00A 5DSHA 5KRAA 5IZ0A 4G1YA 3MNEA 3IA6A 2ZK6A 3GWXA 2GATA 2LBDA 1EXXA 1SR7A 1OT7A 3UUAA 3DZYA 3CTBA 1FCZA 1BY4A 4IW8A 4K6IA 4XLDA 2ZMJA 3VD6C 3ERDA 4OJBA 3K23A 1R20A 3IPUA 2DS6A 1L2JA 5DWGA 4ZI1A 1XDKA 3BQDA 2P7ZA 2NPAA 2PIQA 4OEZA 2R40D 3FC6B 1OVLB 1NQ0A 5DXPA 5DP0A 2Q7KA 1RXRA 1XV9B 1X7RA 1G5YA 5GT4A 3RLJA 3IXPD 4KZIA 5HJSA 5DXKA 2OZ7A 2ZL9A 2P15A 3OMOA 2PIVA 5DVSA 2YFEA 5LWPA 4CN3D 3VTDA 4HN5A 2FAIA 4J5XC 1NYXA 1T74A 2NW4A 2AMBA 4ITFA 2AX7A 5DMFA 5FQTA 3L0LA 3R8AA 3UP3A 2I4ZA 4WVDA 2AYRA 3DY6A 4XT9A 2Q6SA 3EYBA 3DZYD 3GYTA 2E2RA 3VT5A 2GL8A 2JFAA 2ABIA 5APKA 2I4JA 1QKNA 4TMAI 1M13A 2AXAA 3A78A 4PP3A 3H0AA 3P0UA 3NSQA 4G1ZA 4OZTE 2J7XA 2YLYA 5KCCA 5KRCA 3S9SA 2ENVA 3G9PA 5HYKA 3VJIA 5AAVA 4MG7B 3RUUA 3E00A 2ZLCA 4RZEA 5EMCA 5G42A 1R5KA 2DS8A 3L0JA 5KD9A 4EMAA 2KAEA 4JGVA 3G8IA 3ZRBA 2ZY0A 1FD0A 1XP9A 1UHLB 3A2JA 5DKGA 3B0QA 4IA2A 5E19A 3VT9A 1E3GA 4CI4A 1S0ZA 1X78A 2B1VA 4OFRA 3DCUA 1ILHA 2ZBSA 4FGYA 3PCUA 4G1DA 2HBHA 5DLRA 1OSHA 4XHDA 4NUFA 4Q13A 1ZGYA 2R6YA 3GBKA 3Q95A 1YNWA 5L7EA 5KROA 1ILGA 3D6DA 5A86A 2Q7JA 2Q59A 3HVLA 5ACCA 2EBLA 3V9TA 3OAPA 3WTQA 5DKBA 1EXAA 1ZH7A 2QPYA 3G8XA 2OAXA 3HC6A 1GWXA 2QZOA 3HC5A 2YJAB 2ZNNA 3OOFA 4DK8A 5L7GA 1T7TA 3KDUA 4TV1B 3VI8A 1ZAFA 3VJHA 3OKIA 1LO1A 4IQRA 2GDAA 2C7AA 4QL8A 4PP6A 3ET1A 3A9EB 2ZXMA 5IAWA 2A3IA 3FLIA 1R4IA 5DUHA 5HYRA 3UP0A 5KRBB 1S19A 3CDPA 3H0AD 4ZO1X 2GPUA 5DXMA 5C4SA 1XB7A 3M9EA 2O4RA 3L0EA 3P8XA 5C4TA 2G44A 4IWFA 3PRGA 5DWEA 3KMZA 4A4WA 5KRHA 3DZUA 3FC6A 1FBYA 3PLZA 4NB6A 1OVLA 4DK7A 4HCAA 4OIUA 2VUSI 1R6GA 1PQ6A 3FURA 4K4JA 4RUJA 5DXRA 3HO0A 3HZFA 4ITEA 3UUCA 4OZTU 3CLDA 3VT7A 5DWLA 4FNEA 5EGVA 5LGAA 3WFGA 1YP0A 3DCTA 5DKEA 1KKQA 3FALB 2P1VA 4OH5A 4RZGA 5DZ1A 2P7GA 2AX6A 1KB4A 2POGA 3HM1A 2Z4BA 5ICKA 5KCEA 1GNFA 5KRFA 3R29A 4PVUA 3WWRA 1GWQA 5E6CA 1NUOA 2PNUA 2F4BA 3F5CB 4ZNVA 1Y0SA 5DIDA 1YOWA 3OZJA 4LTWA 1XLSA 3UUDA 3OMQA 5AVIA 3FYLA 3M7RA 5DWJA 1E3KA 4K7AA 4MDDA 3AX8A 5DZ0A 3B0RA 3BC5A 4IW6A 5DUEA 3WJ4A 1UHLA 1T7FA 2VV1A 1LV2A 3OS8A 1K7LA 2PRGA 2HANB 3GD2A 3B65A 3ET0A 1QKTA 2R6WA 4OEAA 3G9EA 5ETHA 1R0NB 3CDSA 2I0JA 2XYWA 3P88A 5DKSA 1R0OA 2IOKA 4QK4A 1UPWA 3DZUD 1S9QA 5CBXA 1I7IA 3FXVA 4REEA 3AN3A 1ZDTA 5CC1A 2HC4A 1HJ1A 1SKXA 1YOKA 1X7BA 2ZXZA 1T79A 3FEIA 5KCFA 1MZNA 5DI7A 4RAKA 5E0WA 3KBAA 3G27A 5DZIA 3RUTA 1DKFB 5DX3A 5EC9A 5KCDA 3IPQA 3PEQA 4EM9A 4G2HA 4NQAB 4PP5A 5CBYA 1T65A 2B23A 1XJ7A 2W8YA 3ADWA 4TUZB 5APJA 5F9BA 1XAPA 4ZO1B 1YUCA 3AZ3A 3R2AA 4IA3A 1VJBA 3B3KA 4IA7A 4QE6A 3A9EA 5APHA 1ZUCA 2QXMA 1P8DA 4OFUA 3W5RA 1DSZB 2NLLB 4WHFA 5HCVA 1K74A 5KYAA 1IE8A 2PIUA 2Q6RA 3A3ZX 4IV4A 4MG8A 2ZASA 4J26A 4DM8A 4XUHA 3OKHA 4KZJA 1G2NA 4QJRA 4OLMA 3VRUA 4MGAA 2NV7A 4XTAA 2J14A 1X76A 1UPVA 1XVPB 2ZK1A 2VUTI 2QR9A 4POJA 1FCYA 3CQVA 3D24A 2AMAA 2ZK3A 3KDTA 3G6TA 1A52A 3B66A 5DVVA 3JZCA 1BSXA 2OVMA 3CS4A 5DMCA 5AYGA 2QA8B 3G8UA 4X1GA 1HLZA 5DIEA 1FM6D 1XP6A 1TXIA 5DVCA 3R5NA 5FQRA 5EMQA 3UVVB 3L03A 4POHA 3DR1A 4Q0AC 4ZNHA 2JF9A 3HODA 4OHAA 3U9QA 4OKTA 4ZJWA 5G45A 3UU7A 3WJ5A 2VSTA 1X7JA 1H9UA 5DXQA 4LSJA 5HJPA 2QGWA 4RWVA 5AZVA 3AURA 5E6DA 2VV0A 5G43A 2QXSA 1FCXA 4R6SA 2G0GA 2XYXA 4LNWA 3KYTA 2IHQA 2O9IA
chains in the Genus database with same CATH topology
1FM9A 1U9EA 3ERTA 2BAWA 5H1EA 2XHSA 1TFCA 4DMAA 4JL4A 3ADVA 1U3SA 5DXBB 2QW4A 3V49A 4B7WA 4N73A 4OEYA 3LBDA 5GATA 3VTBA 1XOWA 5CBZA 1R20D 5AK2A 4J5WA 2ZNOA 5DUGA 1T63A 1T5ZA 2PIOA 2Q6JA 3RVFA 3T03A 3ZQTA 1YINA 1K74D 3ADXA 2Q5GA 3FUGA 5KR9A 2ACLB 5KRIA 1NQ1A 4QE8A 4OJ9A 1CITA 2AX8A 4S0SA 2OUZA 4O8FA 4Y29A 1Z5XE 3V3QA 4DM6A 4MGBB 4PLEA 5E0XA 3VHVA 1ERRA 4OK1A 3CS8A 3OSIA 4MGDA 5AZTA 3VN2A 2HFPA 3OS8C 4OZRE 3ZRAA 4OH6A 3G6PA 5KRLA 3GWSX 1XP1A 2PITA 1NQ2A 2Q61A 1M7WA 3HLVA 3W0GA 3TY0A 2Z4JA 3ADUA 4RMEA 2GP7A 1SQNA 2REWA 3VHWA 3NOAA 3R5MA 2VUUI 3A2HA 3DFVC 1PQCA 4REFA 1GDCA 2Q1HA 1HCQA 3OGTA 2NLLA 2ZFXA 2H77A 3B68A 4CSJA 3E00D 2A66A 1G50A 2QSEA 1GS4A 1PRGA 5AVLA 3IMYA 1NAXA 1Y9RA 4IU7A 5K13A 3G6RA 4OIVA 3E7CA 2QABA 1A6YA 1UOMA 1XV9A 3O1EA 1YJEA 5E7VA 2QH6A 5E6BA 3W0AA 1FM9D 3G97A 1XLSE 4RFWA 4MG5A 3SZ1A 1XVPA 1LBDA 1T7RA 3BEJA 3UUAB 3OSAA 3JZBA 1A28A 4P6XA 2VSRA 1GA5A 4WLBA 3CJWA 3VRWA 3AN4A 3TKCA 4J5XA 3VSPA 1XDKB 2XYJA 4L98A 4OKBA 3UVVA 4OJ4A 2QTUA 1T76A 1T7MA 4IVWA 5DV3A 4DORA 2QE4A 2EWPA 4IS8A 1R1KA 2YLOA 4IV2A 4G21A 5G5WA 4YNKA 5DYDA 2BJ4B 5FQPA 2AO6A 5M96A 4MG7A 3G8OA 2FVJA 4HC7A 5KCUA 3G0WA 5DIGA 1LV3A 6GATA 4YT1A 5FQSA 2O4JA 4M8EA 3ZR7A 5E14A 3OOKA 2AA5A 3W0YA 1Z5XU 3G99A 1I38A 4OGHA 1GAUA 4NIEA 4ZNSA 5EHJA 3WGPA 4CN5A 3VT6A 3FEJA 4APUA 1I7GA 2JJ3A 2PIWA 4OZRU 4S0TA 3ET2A 5CJ6A 5DV8A 5KYJA 1HCPA 1XQ3A 2QA6A 4UDCA 3A40X 1L2IA 4HC9A 2HASA 1IE9A 1DB1A 2AA2A 2AAXA 2ZNQA 2AX9A 3B0WA 4A2JA 5AAVB 3TKMA 3A2IA 2R40A 3KMRA 5E6AA 3V3EA 1G1UA 3KPZA 4MGBA 2P1UA 4OKXA 4DQMA 1KV6A 3G9OA 1KNUA 1R4OA 1U3RA 3F7DA 5DZ3A 4OKWA 2GPPA 3PO9A 3AZ1A 2FSZA 2AA7A 5L11A 3G6QA 7GATA 3G9IA 4TV1A 1R4RA 3GYUA 5G44A 4OLNA 4J24A 3VRTA 2POBA 4RMCA 2HVCA 3WMHA 5HZCA 1HRAA 3G9JA 4LNXA 1NAVA 3Q95B 1PZLA 2AM9A 1R1KD 1RDTA 3D90A 4JAZA 4PPPA 4N1YA 1N4HA 4ZN9A 2HB7A 3X36A 1YIMA 5DU5A 2HWQA 1RKGA 3L1BA 2VV3A 2QMVA 3W5TA 5KRJA 4R2UA 3CWDA 1RK3A 3V9YA 4ZNUA 4CI5A 5JJMB 1MVCA 3ADTA 4XI3A 4F9MA 5DY8A 4R06A 4JYHA 4KZMA 1NQ7A 2ATHA 2YLPA 3AUQA 1QKMA 3FS1A 2GIUA 2Q7LA 2NXXA 2HARA 5B5BA 4IA1A 3GZ9A 4G2IA 3MNOA 1XNXA 3E94A 2V7CA 3KWYA 3X1IA 4WPFA 4CN2C 2AA6A 3FALA 3K8SA 2J4AA 1KB6A 5KCTA 5DZHA 5DRMA 1XQCA 3KFCA 3LMPA 2GTKA 1PDUA 1XPCA 5DL4A 2ZLAA 5AWKA 3VEKC 3OLLA 2AB2A 3MNPA 4WQPA 3AUNA 1N46A 2BJ4A 4FN9A 4MGCA 3DT3A 5E1CA 2QNVA 1WM0X 3V4AA 3F5CA 4XUMA 4NY9A 5FQVA 2YHDA 2Q70A 2GPVA 2OVHA 4RZFA 5L7HA 2YLQA 5KCWA 4PF3A 1EREA 2AWHA 1P93A 2HWRA 5DXEA 5L0MA 3V9VA 3VT3A 2ZMHA 4RUOX 4IVYA 4WHGA 5GIDA 3SP6A 4BCRA 1RDTD 3TX7B 2P54A 3H52A 4HN6A 4UDDA 4L96A 5DK9A 1R0NA 2HANA 4OORA 1PK5A 2ZK0A 1YA3A 1YMTA 3L3ZA 5EJVA 2PIRA 3W5QA 1ZKYA 4RE8A 1YY4A 3KMGA 3ILZA 3UUDB 5JI0D 1QKUA 2I4PA 5C4OA 2VV4B 5G3JA 5AWJA 1KB2A 3X31A 1DKFA 2Q5SA 1PQ9A 2G5OA 4LBDA 4OARA 1I37A 2VV1B 2ZVTA 3AFRA 3HQ5A 4P6WA 5DV6A 5DXGA 1OSVA 4AA6A 3B67A 3CBBA 3WFFA 3OMKA 4RUPA 2Q1VA 4OC7A 1Y0XX 4TUZA 3W5PA 2J7YA 4ZNWA 5EMPA 1RJKA 1R0OB 4MG9B 2Q3YA 4JYIA 2P1TA 2B1ZA 3P89A 1ZEOA 5E69A 1X7EA 4UDAA 1DSZA 1GWRA 1HG4A 5KRKA 3X1HA 4IUIA 5SYZA 2V0VA 3G9MA 5CC0A 3GN8A 4UDBA 1U3QA 5DX3B 2QGTA 1Z95A 2H79A 5DYBA 3R8DA 3W0IA 4PXMA 3SP9A 2G0HA 4MG6A 4N5GA 5JJMA 1M2ZA 4PPSA 3VSOA 3W0CA 1MV9A 3B1MA 2QA8A 2B50A 4RMDA 4ZOMA 5E15A 1XZXX 2Q60A 3D57A 2ZK5A 3OS9A 1GLUA 3W0HA 4OV7A 2Q5PA 3O1DA 3W0JA 3DFXA 4MG8B 4S14A 2OCFA 1YYEA 3OSWA 4OEDA 3VRVA 4N8RA 3K22A 3RY9A 1N83A 2ZK4A 3OMMA 4MGAB 4ZNTA 2GPOA 2FF0A 2ZNPA 4S15A 3B0TA 3ADSA 3WT7A 5GICA 3CS6A 1LATA 5B41A 4ONIA 1Q4XA 3VT8A 2ZMIA 4G20A 1NHZA 1S9PA 5DTVA 4E4KA 4ZJRA 5DRJA 2Q7IA 4Q50A 4QM0A 3OLFA 2PINA 5DXBA 2JFAB 2GWXA 3PBAA 1S0XA 1T73A 2PIPL 4FHIA 4X1FA 3UU7B 2M9WA 3OZ0A 2HCDA 1K4WA 2PIXA 5HJPB 3OLSA 3K6PA 2PKLA 2ACLA 2HAMA 4M8HA 3WT6A 4A4VA 4E4QA 4ONDA 5G46A 5KRMA 4IWCA 3D5FA 2I0GA 2Q8SA 3OMPA 1GATA 3IPSA 2YJDA 4OILA 4PRGA 4YMQA 4PWLA 5JY3A 3IXPA 4FHHA 2VV4A 4J5WC 3VT4A 1XNNA 2OM9A 2ZKCA 5IXKA 4HEEX 4E2JA 4CN3A 2YATA 3ET3A 5I4VA 2P4YA 3GATA 4GATA 2HB8A 2NXXE 5C4UA 5DWIA 3L3XA 4XAOA 4DOSA 1RGDA 5AAUA 1FM6A 3R8IA 3RLLA 4CN7A 1SJ0A 1RKHA 2ZXNA 2IOGA 4ZN7A 3QT0A 1YNWB 2VV2A 1ZDUA 3AZ2A 3NSPA 4MG9A 4YPQA 5EITA 4TNTA 1XIUA 2ZK2A 1NRLA 2Q59B 1PCGA 2XKWA 3B5RA 3G6UA 3VJTA 4PLDA 4MGDB 3WT5A 1NDEA 4JYGA 5EI1A 4HLWA 3VTCA 2PJLA 2QZOB 5GIEA 3VHUA 3VJSA 2P7AA 3N00A 5DSHA 5KRAA 5IZ0A 4G1YA 3MNEA 3IA6A 2ZK6A 3GWXA 2GATA 2LBDA 1EXXA 1SR7A 1OT7A 3UUAA 3DZYA 3CTBA 1FCZA 1BY4A 4IW8A 4K6IA 4XLDA 2ZMJA 3VD6C 3ERDA 4OJBA 3K23A 1R20A 3IPUA 1L2JA 5DWGA 4ZI1A 1XDKA 3BQDA 2P7ZA 2NPAA 2PIQA 4OEZA 2R40D 3FC6B 1OVLB 1NQ0A 5DXPA 5DP0A 2Q7KA 1RXRA 1XV9B 1X7RA 1G5YA 5GT4A 3RLJA 3IXPD 4KZIA 5HJSA 5DXKA 2OZ7A 2ZL9A 2P15A 3OMOA 2PIVA 5DVSA 2YFEA 5LWPA 4CN3D 3VTDA 4HN5A 2FAIA 4J5XC 1NYXA 1T74A 2NW4A 2AMBA 4ITFA 2AX7A 5DMFA 5FQTA 3L0LA 3R8AA 3UP3A 2I4ZA 4WVDA 2AYRA 3DY6A 4XT9A 2Q6SA 3EYBA 3DZYD 3GYTA 2E2RA 3VT5A 2GL8A 2JFAA 2ABIA 5APKA 2I4JA 1QKNA 4TMAI 1M13A 2AXAA 3A78A 4PP3A 3H0AA 3P0UA 3NSQA 4G1ZA 4OZTE 2J7XA 2YLYA 5KCCA 5KRCA 3S9SA 2ENVA 3G9PA 5HYKA 3VJIA 5AAVA 4MG7B 3RUUA 3E00A 2ZLCA 4RZEA 5EMCA 5G42A 1R5KA 3L0JA 5KD9A 4EMAA 2KAEA 4JGVA 3G8IA 3ZRBA 2ZY0A 1FD0A 1XP9A 1UHLB 3A2JA 5DKGA 3B0QA 4IA2A 5E19A 3VT9A 1E3GA 4CI4A 1S0ZA 1X78A 2B1VA 4OFRA 3DCUA 1ILHA 2ZBSA 4FGYA 3PCUA 4G1DA 2HBHA 5DLRA 1OSHA 4XHDA 4NUFA 4Q13A 1ZGYA 2R6YA 3GBKA 3Q95A 1YNWA 5L7EA 5KROA 1ILGA 3D6DA 5A86A 2Q7JA 2Q59A 3HVLA 5ACCA 2EBLA 3V9TA 3OAPA 3WTQA 5DKBA 1EXAA 1ZH7A 2QPYA 3G8XA 2OAXA 3HC6A 1GWXA 2QZOA 3HC5A 2YJAB 2ZNNA 3OOFA 4DK8A 5L7GA 1T7TA 3KDUA 4TV1B 3VI8A 1ZAFA 3VJHA 3OKIA 1LO1A 4IQRA 2GDAA 2C7AA 4QL8A 4PP6A 3ET1A 3A9EB 2ZXMA 5IAWA 2A3IA 3FLIA 1R4IA 5DUHA 5HYRA 3UP0A 5KRBB 1S19A 3CDPA 3H0AD 4ZO1X 2GPUA 5DXMA 5C4SA 1XB7A 3M9EA 2O4RA 3L0EA 3P8XA 5C4TA 2G44A 4IWFA 3PRGA 5DWEA 3KMZA 4A4WA 5KRHA 3DZUA 3FC6A 1FBYA 3PLZA 4NB6A 1OVLA 4DK7A 4HCAA 4OIUA 2VUSI 1R6GA 1PQ6A 3FURA 4K4JA 4RUJA 5DXRA 3HO0A 3HZFA 4ITEA 3UUCA 4OZTU 3CLDA 3VT7A 5DWLA 4FNEA 5EGVA 5LGAA 3WFGA 1YP0A 3DCTA 5DKEA 1KKQA 3FALB 2P1VA 4OH5A 4RZGA 5DZ1A 2P7GA 2AX6A 1KB4A 2POGA 3HM1A 2Z4BA 5ICKA 5KCEA 1GNFA 5KRFA 3R29A 4PVUA 3WWRA 1GWQA 5E6CA 1NUOA 2PNUA 2F4BA 3F5CB 4ZNVA 1Y0SA 5DIDA 1YOWA 3OZJA 4LTWA 1XLSA 3UUDA 3OMQA 5AVIA 3FYLA 3M7RA 5DWJA 1E3KA 4K7AA 4MDDA 3AX8A 5DZ0A 3B0RA 3BC5A 4IW6A 5DUEA 3WJ4A 1UHLA 1T7FA 2VV1A 1LV2A 3OS8A 1K7LA 2PRGA 2HANB 3GD2A 3B65A 3ET0A 1QKTA 2R6WA 4OEAA 3G9EA 5ETHA 1R0NB 3CDSA 2I0JA 2XYWA 3P88A 5DKSA 1R0OA 2IOKA 4QK4A 1UPWA 3DZUD 1S9QA 5CBXA 1I7IA 3FXVA 4REEA 3AN3A 1ZDTA 5CC1A 2HC4A 1HJ1A 1SKXA 1YOKA 1X7BA 2ZXZA 1T79A 3FEIA 5KCFA 1MZNA 5DI7A 4RAKA 5E0WA 3KBAA 5DZIA 3RUTA 1DKFB 5DX3A 5EC9A 5KCDA 3IPQA 3PEQA 4EM9A 4G2HA 4NQAB 4PP5A 5CBYA 1T65A 2B23A 1XJ7A 2W8YA 3ADWA 4TUZB 5APJA 5F9BA 1XAPA 4ZO1B 1YUCA 3AZ3A 3R2AA 4IA3A 1VJBA 3B3KA 4IA7A 4QE6A 3A9EA 5APHA 1ZUCA 2QXMA 1P8DA 4OFUA 3W5RA 1DSZB 2NLLB 4WHFA 5HCVA 1K74A 5KYAA 1IE8A 2PIUA 2Q6RA 3A3ZX 4IV4A 4MG8A 2ZASA 4J26A 4DM8A 4XUHA 3OKHA 4KZJA 1G2NA 4QJRA 4OLMA 3VRUA 4MGAA 2NV7A 4XTAA 2J14A 1X76A 1UPVA 1XVPB 2ZK1A 2VUTI 2QR9A 4POJA 1FCYA 3CQVA 3D24A 2AMAA 2ZK3A 3KDTA 3G6TA 1A52A 3B66A 5DVVA 3JZCA 1BSXA 2OVMA 3CS4A 5DMCA 5AYGA 2QA8B 3G8UA 4X1GA 1HLZA 5DIEA 1FM6D 1XP6A 1TXIA 5DVCA 3R5NA 5FQRA 5EMQA 3UVVB 3L03A 4POHA 3DR1A 4Q0AC 4ZNHA 2JF9A 3HODA 4OHAA 3U9QA 4OKTA 4ZJWA 5G45A 3UU7A 3WJ5A 2VSTA 1X7JA 1H9UA 5DXQA 4LSJA 5HJPA 2QGWA 4RWVA 5AZVA 3AURA 5E6DA 2VV0A 5G43A 2QXSA 1FCXA 4R6SA 2G0GA 2XYXA 4LNWA 3KYTA 2IHQA 2O9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FM9 A;  1U9E A;  3ERT A;  2BAW A;  5H1E A;  2XHS A;  1TFC A;  4DMA A;  4JL4 A;  3ADV A;  1U3S A;  5DXB B;  2QW4 A;  3V49 A;  4B7W A;  4N73 A;  4OEY A;  3LBD A;  5GAT A;  3VTB A;  1XOW A;  5CBZ A;  1R20 D;  5AK2 A;  4J5W A;  2ZNO A;  5DUG A;  1T63 A;  1T5Z A;  2PIO A;  2Q6J A;  3RVF A;  3T03 A;  3ZQT A;  1YIN A;  1K74 D;  3ADX A;  2Q5G A;  3FUG A;  5KR9 A;  2ACL B;  5KRI A;  1NQ1 A;  4QE8 A;  4OJ9 A;  1CIT A;  2AX8 A;  4S0S A;  2OUZ A;  4O8F A;  4Y29 A;  1Z5X E;  3V3Q A;  4DM6 A;  4MGB B;  4PLE A;  5E0X A;  3VHV A;  1ERR A;  4OK1 A;  3CS8 A;  3OSI A;  4MGD A;  5AZT A;  3VN2 A;  2HFP A;  3OS8 C;  4OZR E;  3ZRA A;  4OH6 A;  3G6P A;  5KRL A;  3GWS X;  1XP1 A;  2PIT A;  1NQ2 A;  2Q61 A;  1M7W A;  3HLV A;  3W0G A;  3TY0 A;  2Z4J A;  3ADU A;  4RME A;  2GP7 A;  1SQN A;  2REW A;  3VHW A;  3NOA A;  3R5M A;  2VUU I;  3A2H A;  3DFV C;  1PQC A;  4REF A;  1GDC A;  2Q1H A;  1HCQ A;  3OGT A;  2NLL A;  2ZFX A;  2H77 A;  3B68 A;  4CSJ A;  3E00 D;  2A66 A;  1G50 A;  2QSE A;  1GS4 A;  1PRG A;  5AVL A;  3IMY A;  1NAX A;  1Y9R A;  4IU7 A;  5K13 A;  3G6R A;  4OIV A;  3E7C A;  2QAB A;  1A6Y A;  1UOM A;  1XV9 A;  3O1E A;  1YJE A;  5E7V A;  2QH6 A;  5E6B A;  3W0A A;  1FM9 D;  3G97 A;  1XLS E;  4RFW A;  4MG5 A;  3SZ1 A;  1XVP A;  1LBD A;  1T7R A;  3BEJ A;  3UUA B;  3OSA A;  3JZB A;  1A28 A;  4P6X A;  2VSR A;  1GA5 A;  4WLB A;  3CJW A;  3VRW A;  3AN4 A;  3TKC A;  4J5X A;  3VSP A;  1XDK B;  2XYJ A;  4L98 A;  4OKB A;  3UVV A;  4OJ4 A;  2QTU A;  1T76 A;  1T7M A;  4IVW A;  5DV3 A;  4DOR A;  2QE4 A;  2EWP A;  4IS8 A;  1R1K A;  2YLO A;  4IV2 A;  4G21 A;  5G5W A;  4YNK A;  5DYD A;  2BJ4 B;  5FQP A;  2AO6 A;  5M96 A;  4MG7 A;  3G8O A;  2FVJ A;  4HC7 A;  5KCU A;  3G0W A;  5DIG A;  1LV3 A;  6GAT A;  4YT1 A;  5FQS A;  2O4J A;  4M8E A;  3ZR7 A;  5E14 A;  3OOK A;  2AA5 A;  3W0Y A;  1Z5X U;  3G99 A;  1I38 A;  4OGH A;  1GAU A;  4NIE A;  4ZNS A;  5EHJ A;  3WGP A;  4CN5 A;  3VT6 A;  3FEJ A;  4APU A;  1I7G A;  2JJ3 A;  2PIW A;  4OZR U;  4S0T A;  3ET2 A;  5CJ6 A;  5DV8 A;  5KYJ A;  1HCP A;  1XQ3 A;  2QA6 A;  4UDC A;  3A40 X;  1L2I A;  4HC9 A;  2HAS A;  1IE9 A;  1DB1 A;  2AA2 A;  2AAX A;  2ZNQ A;  2AX9 A;  3B0W A;  4A2J A;  5AAV B;  3TKM A;  3A2I A;  2R40 A;  3KMR A;  5E6A A;  3V3E A;  1G1U A;  3KPZ A;  4MGB A;  2P1U A;  4OKX A;  4DQM A;  1KV6 A;  3G9O A;  1KNU A;  1R4O A;  1U3R A;  3F7D A;  5DZ3 A;  4OKW A;  2GPP A;  3PO9 A;  3AZ1 A;  2FSZ A;  2AA7 A;  5L11 A;  3G6Q A;  7GAT A;  3G9I A;  4TV1 A;  1R4R A;  3GYU A;  5G44 A;  4OLN A;  4J24 A;  3VRT A;  2POB A;  4RMC A;  2HVC A;  3WMH A;  5HZC A;  1HRA A;  3G9J A;  4LNX A;  1NAV A;  3Q95 B;  1PZL A;  2AM9 A;  1R1K D;  1RDT A;  3D90 A;  4JAZ A;  4PPP A;  4N1Y A;  1N4H A;  4ZN9 A;  2HB7 A;  3X36 A;  1YIM A;  5DU5 A;  2HWQ A;  1RKG A;  3L1B A;  2VV3 A;  2QMV A;  3W5T A;  5KRJ A;  4R2U A;  3CWD A;  1RK3 A;  3V9Y A;  4ZNU A;  4CI5 A;  5JJM B;  1MVC A;  3ADT A;  4XI3 A;  4F9M A;  5DY8 A;  4R06 A;  4JYH A;  4KZM A;  1NQ7 A;  2ATH A;  2YLP A;  3AUQ A;  1QKM A;  3FS1 A;  2GIU A;  2Q7L A;  2NXX A;  2HAR A;  5B5B A;  4IA1 A;  3GZ9 A;  4G2I A;  3MNO A;  1XNX A;  3E94 A;  2V7C A;  3KWY A;  3X1I A;  4WPF A;  4CN2 C;  2AA6 A;  3FAL A;  3K8S A;  2J4A A;  1KB6 A;  5KCT A;  5DZH A;  5DRM A;  1XQC A;  3KFC A;  3LMP A;  2GTK A;  1PDU A;  1XPC A;  5DL4 A;  2ZLA A;  5AWK A;  3VEK C;  3OLL A;  2AB2 A;  3MNP A;  4WQP A;  3AUN A;  1N46 A;  2BJ4 A;  4FN9 A;  4MGC A;  3DT3 A;  5E1C A;  2QNV A;  1WM0 X;  3V4A A;  3F5C A;  4XUM A;  4NY9 A;  5FQV A;  2YHD A;  2Q70 A;  2GPV A;  2OVH A;  4RZF A;  5L7H A;  2YLQ A;  5KCW A;  4PF3 A;  1ERE A;  2AWH A;  1P93 A;  2HWR A;  5DXE A;  5L0M A;  3V9V A;  3VT3 A;  2ZMH A;  4RUO X;  4IVY A;  4WHG A;  5GID A;  3SP6 A;  4BCR A;  1RDT D;  3TX7 B;  2P54 A;  3H52 A;  4HN6 A;  4UDD A;  4L96 A;  5DK9 A;  1R0N A;  2HAN A;  4OOR A;  1PK5 A;  2ZK0 A;  1YA3 A;  1YMT A;  3L3Z A;  5EJV A;  2PIR A;  3W5Q A;  1ZKY A;  4RE8 A;  1YY4 A;  3KMG A;  3ILZ A;  3UUD B;  5JI0 D;  1QKU A;  2I4P A;  5C4O A;  2VV4 B;  5G3J A;  5AWJ A;  1KB2 A;  3X31 A;  1DKF A;  2Q5S A;  1PQ9 A;  2G5O A;  4LBD A;  4OAR A;  1I37 A;  2VV1 B;  2ZVT A;  3AFR A;  3HQ5 A;  4P6W A;  5DV6 A;  5DXG A;  1OSV A;  4AA6 A;  3B67 A;  3CBB A;  3WFF A;  3OMK A;  4RUP A;  2Q1V A;  4OC7 A;  1Y0X X;  4TUZ A;  3W5P A;  2J7Y A;  4ZNW A;  5EMP A;  1RJK A;  1R0O B;  4MG9 B;  2Q3Y A;  4JYI A;  2P1T A;  2B1Z A;  3P89 A;  1ZEO A;  5E69 A;  1X7E A;  4UDA A;  1DSZ A;  1GWR A;  1HG4 A;  5KRK A;  3X1H A;  4IUI A;  5SYZ A;  2V0V A;  3G9M A;  5CC0 A;  3GN8 A;  4UDB A;  1U3Q A;  5DX3 B;  2QGT A;  1Z95 A;  2H79 A;  5DYB A;  3R8D A;  3W0I A;  4PXM A;  3SP9 A;  2G0H A;  4MG6 A;  4N5G A;  5JJM A;  1M2Z A;  4PPS A;  3VSO A;  3W0C A;  1MV9 A;  3B1M A;  2QA8 A;  2B50 A;  4RMD A;  4ZOM A;  5E15 A;  1XZX X;  2Q60 A;  3D57 A;  2ZK5 A;  3OS9 A;  1GLU A;  3W0H A;  4OV7 A;  2Q5P A;  3O1D A;  3W0J A;  3DFX A;  4MG8 B;  4S14 A;  2OCF A;  1YYE A;  3OSW A;  4OED A;  3VRV A;  4N8R A;  3K22 A;  3RY9 A;  1N83 A;  2ZK4 A;  3OMM A;  4MGA B;  4ZNT A;  2GPO A;  2FF0 A;  2ZNP A;  4S15 A;  3B0T A;  3ADS A;  3WT7 A;  5GIC A;  3CS6 A;  1LAT A;  5B41 A;  4ONI A;  1Q4X A;  3VT8 A;  2ZMI A;  4G20 A;  1NHZ A;  1S9P A;  5DTV A;  4E4K A;  4ZJR A;  5DRJ A;  2Q7I A;  4Q50 A;  4QM0 A;  3OLF A;  2PIN A;  5DXB A;  2JFA B;  2GWX A;  3PBA A;  1S0X A;  1T73 A;  2PIP L;  4FHI A;  4X1F A;  3UU7 B;  2M9W A;  3OZ0 A;  2HCD A;  1K4W A;  2PIX A;  5HJP B;  3OLS A;  3K6P A;  2PKL A;  2ACL A;  2HAM A;  4M8H A;  3WT6 A;  4A4V A;  4E4Q A;  4OND A;  5G46 A;  5KRM A;  4IWC A;  3D5F A;  2I0G A;  2Q8S A;  3OMP A;  1GAT A;  3IPS A;  2YJD A;  4OIL A;  4PRG A;  4YMQ A;  4PWL A;  5JY3 A;  3IXP A;  4FHH A;  2VV4 A;  4J5W C;  3VT4 A;  1XNN A;  2OM9 A;  2ZKC A;  5IXK A;  4HEE X;  4E2J A;  4CN3 A;  2YAT A;  3ET3 A;  5I4V A;  2P4Y A;  3GAT A;  4GAT A;  2HB8 A;  2NXX E;  5C4U A;  5DWI A;  3L3X A;  4XAO A;  4DOS A;  1RGD A;  5AAU A;  1FM6 A;  3R8I A;  3RLL A;  4CN7 A;  1SJ0 A;  1RKH A;  2ZXN A;  2IOG A;  4ZN7 A;  3QT0 A;  1YNW B;  2VV2 A;  1ZDU A;  3AZ2 A;  3NSP A;  4MG9 A;  4YPQ A;  5EIT A;  4TNT A;  1XIU A;  2ZK2 A;  1NRL A;  2Q59 B;  1PCG A;  2XKW A;  3B5R A;  3G6U A;  3VJT A;  4PLD A;  4MGD B;  3WT5 A;  1NDE A;  4JYG A;  5EI1 A;  4HLW A;  3VTC A;  2PJL A;  2QZO B;  5GIE A;  3VHU A;  3VJS A;  2P7A A;  3N00 A;  5DSH A;  5KRA A;  5IZ0 A;  4G1Y A;  3MNE A;  3IA6 A;  2ZK6 A;  3GWX A;  2GAT A;  2LBD A;  1EXX A;  1SR7 A;  1OT7 A;  3UUA A;  3DZY A;  3CTB A;  1FCZ A;  1BY4 A;  4IW8 A;  4K6I A;  4XLD A;  2ZMJ A;  3VD6 C;  3ERD A;  4OJB A;  3K23 A;  1R20 A;  3IPU A;  1L2J A;  5DWG A;  4ZI1 A;  1XDK A;  3BQD A;  2P7Z A;  2NPA A;  2PIQ A;  4OEZ A;  2R40 D;  3FC6 B;  1OVL B;  1NQ0 A;  5DXP A;  5DP0 A;  2Q7K A;  1RXR A;  1XV9 B;  1X7R A;  1G5Y A;  5GT4 A;  3RLJ A;  3IXP D;  4KZI A;  5HJS A;  5DXK A;  2OZ7 A;  2ZL9 A;  2P15 A;  3OMO A;  2PIV A;  5DVS A;  2YFE A;  5LWP A;  4CN3 D;  3VTD A;  4HN5 A;  2FAI A;  4J5X C;  1NYX A;  1T74 A;  2NW4 A;  2AMB A;  4ITF A;  2AX7 A;  5DMF A;  5FQT A;  3L0L A;  3R8A A;  3UP3 A;  2I4Z A;  4WVD A;  2AYR A;  3DY6 A;  4XT9 A;  2Q6S A;  3EYB A;  3DZY D;  3GYT A;  2E2R A;  3VT5 A;  2GL8 A;  2JFA A;  2ABI A;  5APK A;  2I4J A;  1QKN A;  4TMA I;  1M13 A;  2AXA A;  3A78 A;  4PP3 A;  3H0A A;  3P0U A;  3NSQ A;  4G1Z A;  4OZT E;  2J7X A;  2YLY A;  5KCC A;  5KRC A;  3S9S A;  2ENV A;  3G9P A;  5HYK A;  3VJI A;  5AAV A;  4MG7 B;  3RUU A;  3E00 A;  2ZLC A;  4RZE A;  5EMC A;  5G42 A;  1R5K A;  3L0J A;  5KD9 A;  4EMA A;  2KAE A;  4JGV A;  3G8I A;  3ZRB A;  2ZY0 A;  1FD0 A;  1XP9 A;  1UHL B;  3A2J A;  5DKG A;  3B0Q A;  4IA2 A;  5E19 A;  3VT9 A;  1E3G A;  4CI4 A;  1S0Z A;  1X78 A;  2B1V A;  4OFR A;  3DCU A;  1ILH A;  2ZBS A;  4FGY A;  3PCU A;  4G1D A;  2HBH A;  5DLR A;  1OSH A;  4XHD A;  4NUF A;  4Q13 A;  1ZGY A;  2R6Y A;  3GBK A;  3Q95 A;  1YNW A;  5L7E A;  5KRO A;  1ILG A;  3D6D A;  5A86 A;  2Q7J A;  2Q59 A;  3HVL A;  5ACC A;  2EBL A;  3V9T A;  3OAP A;  3WTQ A;  5DKB A;  1EXA A;  1ZH7 A;  2QPY A;  3G8X A;  2OAX A;  3HC6 A;  1GWX A;  2QZO A;  3HC5 A;  2YJA B;  2ZNN A;  3OOF A;  4DK8 A;  5L7G A;  1T7T A;  3KDU A;  4TV1 B;  3VI8 A;  1ZAF A;  3VJH A;  3OKI A;  1LO1 A;  4IQR A;  2GDA A;  2C7A A;  4QL8 A;  4PP6 A;  3ET1 A;  3A9E B;  2ZXM A;  5IAW A;  2A3I A;  3FLI A;  1R4I A;  5DUH A;  5HYR A;  3UP0 A;  5KRB B;  1S19 A;  3CDP A;  3H0A D;  4ZO1 X;  2GPU A;  5DXM A;  5C4S A;  1XB7 A;  3M9E A;  2O4R A;  3L0E A;  3P8X A;  5C4T A;  2G44 A;  4IWF A;  3PRG A;  5DWE A;  3KMZ A;  4A4W A;  5KRH A;  3DZU A;  3FC6 A;  1FBY A;  3PLZ A;  4NB6 A;  1OVL A;  4DK7 A;  4HCA A;  4OIU A;  2VUS I;  1R6G A;  1PQ6 A;  3FUR A;  4K4J A;  4RUJ A;  5DXR A;  3HO0 A;  3HZF A;  4ITE A;  3UUC A;  4OZT U;  3CLD A;  3VT7 A;  5DWL A;  4FNE A;  5EGV A;  5LGA A;  3WFG A;  1YP0 A;  3DCT A;  5DKE A;  1KKQ A;  3FAL B;  2P1V A;  4OH5 A;  4RZG A;  5DZ1 A;  2P7G A;  2AX6 A;  1KB4 A;  2POG A;  3HM1 A;  2Z4B A;  5ICK A;  5KCE A;  1GNF A;  5KRF A;  3R29 A;  4PVU A;  3WWR A;  1GWQ A;  5E6C A;  1NUO A;  2PNU A;  2F4B A;  3F5C B;  4ZNV A;  1Y0S A;  5DID A;  1YOW A;  3OZJ A;  4LTW A;  1XLS A;  3UUD A;  3OMQ A;  5AVI A;  3FYL A;  3M7R A;  5DWJ A;  1E3K A;  4K7A A;  4MDD A;  3AX8 A;  5DZ0 A;  3B0R A;  3BC5 A;  4IW6 A;  5DUE A;  3WJ4 A;  1UHL A;  1T7F A;  2VV1 A;  1LV2 A;  3OS8 A;  1K7L A;  2PRG A;  2HAN B;  3GD2 A;  3B65 A;  3ET0 A;  1QKT A;  2R6W A;  4OEA A;  3G9E A;  5ETH A;  1R0N B;  3CDS A;  2I0J A;  2XYW A;  3P88 A;  5DKS A;  1R0O A;  2IOK A;  4QK4 A;  1UPW A;  3DZU D;  1S9Q A;  5CBX A;  1I7I A;  3FXV A;  4REE A;  3AN3 A;  1ZDT A;  5CC1 A;  2HC4 A;  1HJ1 A;  1SKX A;  1YOK A;  1X7B A;  2ZXZ A;  1T79 A;  3FEI A;  5KCF A;  1MZN A;  5DI7 A;  4RAK A;  5E0W A;  3KBA A;  5DZI A;  3RUT A;  1DKF B;  5DX3 A;  5EC9 A;  5KCD A;  3IPQ A;  3PEQ A;  4EM9 A;  4G2H A;  4NQA B;  4PP5 A;  5CBY A;  1T65 A;  2B23 A;  1XJ7 A;  2W8Y A;  3ADW A;  4TUZ B;  5APJ A;  5F9B A;  1XAP A;  4ZO1 B;  1YUC A;  3AZ3 A;  3R2A A;  4IA3 A;  1VJB A;  3B3K A;  4IA7 A;  4QE6 A;  3A9E A;  5APH A;  1ZUC A;  2QXM A;  1P8D A;  4OFU A;  3W5R A;  1DSZ B;  2NLL B;  4WHF A;  5HCV A;  1K74 A;  5KYA A;  1IE8 A;  2PIU A;  2Q6R A;  3A3Z X;  4IV4 A;  4MG8 A;  2ZAS A;  4J26 A;  4DM8 A;  4XUH A;  3OKH A;  4KZJ A;  1G2N A;  4QJR A;  4OLM A;  3VRU A;  4MGA A;  2NV7 A;  4XTA A;  2J14 A;  1X76 A;  1UPV A;  1XVP B;  2ZK1 A;  2VUT I;  2QR9 A;  4POJ A;  1FCY A;  3CQV A;  3D24 A;  2AMA A;  2ZK3 A;  3KDT A;  3G6T A;  1A52 A;  3B66 A;  5DVV A;  3JZC A;  1BSX A;  2OVM A;  3CS4 A;  5DMC A;  5AYG A;  2QA8 B;  3G8U A;  4X1G A;  1HLZ A;  5DIE A;  1FM6 D;  1XP6 A;  1TXI A;  5DVC A;  3R5N A;  5FQR A;  5EMQ A;  3UVV B;  3L03 A;  4POH A;  3DR1 A;  4Q0A C;  4ZNH A;  2JF9 A;  3HOD A;  4OHA A;  3U9Q A;  4OKT A;  4ZJW A;  5G45 A;  3UU7 A;  3WJ5 A;  2VST A;  1X7J A;  1H9U A;  5DXQ A;  4LSJ A;  5HJP A;  2QGW A;  4RWV A;  5AZV A;  3AUR A;  5E6D A;  2VV0 A;  5G43 A;  2QXS A;  1FCX A;  4R6S A;  2G0G A;  2XYX A;  4LNW A;  3KYT A;  2IHQ A;  2O9I A; 
#chains in the Genus database with same CATH topology
 1FM9 A;  1U9E A;  3ERT A;  2BAW A;  5H1E A;  2XHS A;  1TFC A;  4DMA A;  4JL4 A;  3ADV A;  1U3S A;  5DXB B;  2QW4 A;  3V49 A;  4B7W A;  4N73 A;  4OEY A;  3LBD A;  5GAT A;  3VTB A;  1XOW A;  5CBZ A;  1R20 D;  5AK2 A;  4J5W A;  2ZNO A;  5DUG A;  1T63 A;  1T5Z A;  2PIO A;  2Q6J A;  3RVF A;  3T03 A;  3ZQT A;  1YIN A;  1K74 D;  3ADX A;  2Q5G A;  3FUG A;  5KR9 A;  2ACL B;  5KRI A;  1NQ1 A;  4QE8 A;  4OJ9 A;  1CIT A;  2AX8 A;  4S0S A;  2OUZ A;  4O8F A;  4Y29 A;  1Z5X E;  3V3Q A;  4DM6 A;  4MGB B;  4PLE A;  5E0X A;  3VHV A;  1ERR A;  4OK1 A;  3CS8 A;  3OSI A;  4MGD A;  5AZT A;  3VN2 A;  2HFP A;  3OS8 C;  4OZR E;  3ZRA A;  4OH6 A;  3G6P A;  5KRL A;  3GWS X;  1XP1 A;  2PIT A;  1NQ2 A;  2Q61 A;  1M7W A;  3HLV A;  3W0G A;  3TY0 A;  2Z4J A;  3ADU A;  4RME A;  2DS5 A;  2GP7 A;  1SQN A;  2REW A;  3VHW A;  3NOA A;  3R5M A;  2VUU I;  3A2H A;  3DFV C;  1PQC A;  4REF A;  1GDC A;  2Q1H A;  1HCQ A;  3OGT A;  2NLL A;  2ZFX A;  2H77 A;  3B68 A;  4CSJ A;  3E00 D;  2A66 A;  1G50 A;  2QSE A;  1GS4 A;  1PRG A;  5AVL A;  3IMY A;  1NAX A;  1Y9R A;  4IU7 A;  5K13 A;  3G6R A;  4OIV A;  3E7C A;  2QAB A;  1A6Y A;  1UOM A;  1XV9 A;  3O1E A;  1YJE A;  5E7V A;  2QH6 A;  5E6B A;  3W0A A;  1FM9 D;  3G97 A;  1XLS E;  4RFW A;  4MG5 A;  3SZ1 A;  1XVP A;  1LBD A;  1T7R A;  3BEJ A;  3UUA B;  3OSA A;  3JZB A;  1A28 A;  4P6X A;  2VSR A;  1GA5 A;  4WLB A;  3CJW A;  3VRW A;  3AN4 A;  3TKC A;  4J5X A;  3VSP A;  1XDK B;  2XYJ A;  4L98 A;  4OKB A;  3UVV A;  4OJ4 A;  2QTU A;  1T76 A;  1T7M A;  4IVW A;  5DV3 A;  4DOR A;  2QE4 A;  2EWP A;  4IS8 A;  1R1K A;  2YLO A;  4IV2 A;  4G21 A;  5G5W A;  4YNK A;  5DYD A;  2BJ4 B;  5FQP A;  2AO6 A;  5M96 A;  4MG7 A;  3G8O A;  2FVJ A;  4HC7 A;  5KCU A;  3G0W A;  5DIG A;  1LV3 A;  6GAT A;  4YT1 A;  5FQS A;  2O4J A;  4M8E A;  3ZR7 A;  5E14 A;  3OOK A;  2AA5 A;  3W0Y A;  1Z5X U;  3G99 A;  1I38 A;  4OGH A;  1GAU A;  4NIE A;  4ZNS A;  5EHJ A;  3WGP A;  4CN5 A;  3VT6 A;  3FEJ A;  4APU A;  1I7G A;  2JJ3 A;  2PIW A;  4OZR U;  4S0T A;  3ET2 A;  5CJ6 A;  5DV8 A;  5KYJ A;  1HCP A;  1XQ3 A;  2QA6 A;  4UDC A;  3A40 X;  1L2I A;  4HC9 A;  2HAS A;  1IE9 A;  1DB1 A;  2AA2 A;  2AAX A;  2ZNQ A;  2AX9 A;  3B0W A;  4A2J A;  5AAV B;  3TKM A;  3A2I A;  2R40 A;  3KMR A;  5E6A A;  3V3E A;  1G1U A;  3KPZ A;  4MGB A;  2P1U A;  4OKX A;  4DQM A;  1KV6 A;  3G9O A;  1KNU A;  1R4O A;  1U3R A;  3F7D A;  5DZ3 A;  4OKW A;  2GPP A;  3PO9 A;  3AZ1 A;  2FSZ A;  2AA7 A;  5L11 A;  3G6Q A;  7GAT A;  3G9I A;  4TV1 A;  1R4R A;  3GYU A;  5G44 A;  4OLN A;  4J24 A;  3VRT A;  2POB A;  4RMC A;  2HVC A;  3WMH A;  5HZC A;  1HRA A;  3G9J A;  4LNX A;  1NAV A;  3Q95 B;  1PZL A;  2AM9 A;  1R1K D;  1RDT A;  3D90 A;  4JAZ A;  4PPP A;  4N1Y A;  1N4H A;  4ZN9 A;  2HB7 A;  3X36 A;  1YIM A;  5DU5 A;  2HWQ A;  1RKG A;  3L1B A;  2VV3 A;  2QMV A;  3W5T A;  5KRJ A;  4R2U A;  3CWD A;  1RK3 A;  3V9Y A;  4ZNU A;  4CI5 A;  5JJM B;  1MVC A;  3ADT A;  4XI3 A;  4F9M A;  5DY8 A;  4R06 A;  4JYH A;  4KZM A;  1NQ7 A;  2ATH A;  2YLP A;  3AUQ A;  1QKM A;  3FS1 A;  2GIU A;  2Q7L A;  2NXX A;  2HAR A;  5B5B A;  4IA1 A;  3GZ9 A;  4G2I A;  3MNO A;  1XNX A;  3E94 A;  2V7C A;  3KWY A;  3X1I A;  4WPF A;  4CN2 C;  2AA6 A;  3FAL A;  3K8S A;  2J4A A;  1KB6 A;  5KCT A;  5DZH A;  5DRM A;  1XQC A;  3KFC A;  3LMP A;  2GTK A;  1PDU A;  1XPC A;  5DL4 A;  2ZLA A;  5AWK A;  3VEK C;  3OLL A;  2AB2 A;  3MNP A;  4WQP A;  3AUN A;  1N46 A;  2BJ4 A;  4FN9 A;  4MGC A;  3DT3 A;  5E1C A;  2QNV A;  1WM0 X;  3V4A A;  3F5C A;  4XUM A;  4NY9 A;  5FQV A;  2YHD A;  2Q70 A;  2GPV A;  2OVH A;  4RZF A;  5L7H A;  2YLQ A;  5KCW A;  4PF3 A;  1ERE A;  2AWH A;  1P93 A;  2HWR A;  5DXE A;  5L0M A;  3V9V A;  3VT3 A;  2ZMH A;  4RUO X;  4IVY A;  4WHG A;  5GID A;  3SP6 A;  4BCR A;  1RDT D;  3TX7 B;  2P54 A;  3H52 A;  4HN6 A;  4UDD A;  4L96 A;  5DK9 A;  1R0N A;  2HAN A;  4OOR A;  1PK5 A;  2ZK0 A;  1YA3 A;  1YMT A;  3L3Z A;  5EJV A;  2PIR A;  3W5Q A;  1ZKY A;  4RE8 A;  1YY4 A;  3KMG A;  3ILZ A;  3UUD B;  5JI0 D;  1QKU A;  2I4P A;  5C4O A;  2VV4 B;  5G3J A;  5AWJ A;  1KB2 A;  3X31 A;  1DKF A;  2Q5S A;  1PQ9 A;  2G5O A;  4LBD A;  4OAR A;  1I37 A;  2VV1 B;  2ZVT A;  3AFR A;  3HQ5 A;  4P6W A;  5DV6 A;  5DXG A;  1OSV A;  4AA6 A;  3B67 A;  3CBB A;  3WFF A;  3OMK A;  4RUP A;  2Q1V A;  4OC7 A;  1Y0X X;  4TUZ A;  3W5P A;  2J7Y A;  4ZNW A;  5EMP A;  1RJK A;  1R0O B;  4MG9 B;  2Q3Y A;  4JYI A;  2P1T A;  2B1Z A;  3P89 A;  1ZEO A;  5E69 A;  1X7E A;  4UDA A;  1DSZ A;  1GWR A;  1HG4 A;  5KRK A;  3X1H A;  4IUI A;  5SYZ A;  2V0V A;  3G9M A;  5CC0 A;  3GN8 A;  4UDB A;  1U3Q A;  5DX3 B;  2QGT A;  1Z95 A;  2H79 A;  5DYB A;  3R8D A;  3W0I A;  4PXM A;  3SP9 A;  2G0H A;  4MG6 A;  4N5G A;  5JJM A;  1M2Z A;  4PPS A;  3VSO A;  3W0C A;  1MV9 A;  3B1M A;  2QA8 A;  2B50 A;  4RMD A;  4ZOM A;  5E15 A;  1XZX X;  2Q60 A;  3D57 A;  2ZK5 A;  3OS9 A;  1GLU A;  3W0H A;  4OV7 A;  2Q5P A;  3O1D A;  3W0J A;  3DFX A;  4MG8 B;  4S14 A;  2OCF A;  1YYE A;  3OSW A;  4OED A;  3VRV A;  4N8R A;  3K22 A;  3RY9 A;  1N83 A;  2ZK4 A;  3OMM A;  4MGA B;  4ZNT A;  2GPO A;  2FF0 A;  2ZNP A;  4S15 A;  3B0T A;  3ADS A;  3WT7 A;  5GIC A;  3CS6 A;  1LAT A;  5B41 A;  4ONI A;  1Q4X A;  3VT8 A;  2ZMI A;  4G20 A;  1NHZ A;  1S9P A;  5DTV A;  4E4K A;  4ZJR A;  5DRJ A;  2Q7I A;  4Q50 A;  4QM0 A;  3OLF A;  2PIN A;  5DXB A;  2JFA B;  2GWX A;  3PBA A;  1S0X A;  1T73 A;  2PIP L;  4FHI A;  4X1F A;  3UU7 B;  2M9W A;  3OZ0 A;  2HCD A;  1K4W A;  2PIX A;  5HJP B;  3OLS A;  3K6P A;  2PKL A;  2ACL A;  2HAM A;  4M8H A;  3WT6 A;  4A4V A;  4E4Q A;  4OND A;  5G46 A;  5KRM A;  4IWC A;  3D5F A;  2I0G A;  2Q8S A;  3OMP A;  1GAT A;  3IPS A;  2YJD A;  4OIL A;  4PRG A;  4YMQ A;  4PWL A;  5JY3 A;  3IXP A;  4FHH A;  2VV4 A;  4J5W C;  3VT4 A;  1XNN A;  2OM9 A;  2ZKC A;  5IXK A;  4HEE X;  4E2J A;  4CN3 A;  2YAT A;  3ET3 A;  5I4V A;  2P4Y A;  3GAT A;  4GAT A;  2HB8 A;  2NXX E;  5C4U A;  5DWI A;  3L3X A;  4XAO A;  4DOS A;  1RGD A;  5AAU A;  1FM6 A;  3R8I A;  3RLL A;  4CN7 A;  1SJ0 A;  1RKH A;  2ZXN A;  2IOG A;  4ZN7 A;  3QT0 A;  1YNW B;  2VV2 A;  1ZDU A;  3AZ2 A;  3NSP A;  4MG9 A;  4YPQ A;  5EIT A;  4TNT A;  1XIU A;  2ZK2 A;  1NRL A;  2Q59 B;  1PCG A;  2XKW A;  3B5R A;  3G6U A;  3VJT A;  4PLD A;  4MGD B;  3WT5 A;  1NDE A;  4JYG A;  5EI1 A;  4HLW A;  3VTC A;  2PJL A;  2QZO B;  5GIE A;  3VHU A;  3VJS A;  2P7A A;  3N00 A;  5DSH A;  5KRA A;  5IZ0 A;  4G1Y A;  3MNE A;  3IA6 A;  2ZK6 A;  3GWX A;  2GAT A;  2LBD A;  1EXX A;  1SR7 A;  1OT7 A;  3UUA A;  3DZY A;  3CTB A;  1FCZ A;  1BY4 A;  4IW8 A;  4K6I A;  4XLD A;  2ZMJ A;  3VD6 C;  3ERD A;  4OJB A;  3K23 A;  1R20 A;  3IPU A;  2DS6 A;  1L2J A;  5DWG A;  4ZI1 A;  1XDK A;  3BQD A;  2P7Z A;  2NPA A;  2PIQ A;  4OEZ A;  2R40 D;  3FC6 B;  1OVL B;  1NQ0 A;  5DXP A;  5DP0 A;  2Q7K A;  1RXR A;  1XV9 B;  1X7R A;  1G5Y A;  5GT4 A;  3RLJ A;  3IXP D;  4KZI A;  5HJS A;  5DXK A;  2OZ7 A;  2ZL9 A;  2P15 A;  3OMO A;  2PIV A;  5DVS A;  2YFE A;  5LWP A;  4CN3 D;  3VTD A;  4HN5 A;  2FAI A;  4J5X C;  1NYX A;  1T74 A;  2NW4 A;  2AMB A;  4ITF A;  2AX7 A;  5DMF A;  5FQT A;  3L0L A;  3R8A A;  3UP3 A;  2I4Z A;  4WVD A;  2AYR A;  3DY6 A;  4XT9 A;  2Q6S A;  3EYB A;  3DZY D;  3GYT A;  2E2R A;  3VT5 A;  2GL8 A;  2JFA A;  2ABI A;  5APK A;  2I4J A;  1QKN A;  4TMA I;  1M13 A;  2AXA A;  3A78 A;  4PP3 A;  3H0A A;  3P0U A;  3NSQ A;  4G1Z A;  4OZT E;  2J7X A;  2YLY A;  5KCC A;  5KRC A;  3S9S A;  2ENV A;  3G9P A;  5HYK A;  3VJI A;  5AAV A;  4MG7 B;  3RUU A;  3E00 A;  2ZLC A;  4RZE A;  5EMC A;  5G42 A;  1R5K A;  2DS8 A;  3L0J A;  5KD9 A;  4EMA A;  2KAE A;  4JGV A;  3G8I A;  3ZRB A;  2ZY0 A;  1FD0 A;  1XP9 A;  1UHL B;  3A2J A;  5DKG A;  3B0Q A;  4IA2 A;  5E19 A;  3VT9 A;  1E3G A;  4CI4 A;  1S0Z A;  1X78 A;  2B1V A;  4OFR A;  3DCU A;  1ILH A;  2ZBS A;  4FGY A;  3PCU A;  4G1D A;  2HBH A;  5DLR A;  1OSH A;  4XHD A;  4NUF A;  4Q13 A;  1ZGY A;  2R6Y A;  3GBK A;  3Q95 A;  1YNW A;  5L7E A;  5KRO A;  1ILG A;  3D6D A;  5A86 A;  2Q7J A;  2Q59 A;  3HVL A;  5ACC A;  2EBL A;  3V9T A;  3OAP A;  3WTQ A;  5DKB A;  1EXA A;  1ZH7 A;  2QPY A;  3G8X A;  2OAX A;  3HC6 A;  1GWX A;  2QZO A;  3HC5 A;  2YJA B;  2ZNN A;  3OOF A;  4DK8 A;  5L7G A;  1T7T A;  3KDU A;  4TV1 B;  3VI8 A;  1ZAF A;  3VJH A;  3OKI A;  1LO1 A;  4IQR A;  2GDA A;  2C7A A;  4QL8 A;  4PP6 A;  3ET1 A;  3A9E B;  2ZXM A;  5IAW A;  2A3I A;  3FLI A;  1R4I A;  5DUH A;  5HYR A;  3UP0 A;  5KRB B;  1S19 A;  3CDP A;  3H0A D;  4ZO1 X;  2GPU A;  5DXM A;  5C4S A;  1XB7 A;  3M9E A;  2O4R A;  3L0E A;  3P8X A;  5C4T A;  2G44 A;  4IWF A;  3PRG A;  5DWE A;  3KMZ A;  4A4W A;  5KRH A;  3DZU A;  3FC6 A;  1FBY A;  3PLZ A;  4NB6 A;  1OVL A;  4DK7 A;  4HCA A;  4OIU A;  2VUS I;  1R6G A;  1PQ6 A;  3FUR A;  4K4J A;  4RUJ A;  5DXR A;  3HO0 A;  3HZF A;  4ITE A;  3UUC A;  4OZT U;  3CLD A;  3VT7 A;  5DWL A;  4FNE A;  5EGV A;  5LGA A;  3WFG A;  1YP0 A;  3DCT A;  5DKE A;  1KKQ A;  3FAL B;  2P1V A;  4OH5 A;  4RZG A;  5DZ1 A;  2P7G A;  2AX6 A;  1KB4 A;  2POG A;  3HM1 A;  2Z4B A;  5ICK A;  5KCE A;  1GNF A;  5KRF A;  3R29 A;  4PVU A;  3WWR A;  1GWQ A;  5E6C A;  1NUO A;  2PNU A;  2F4B A;  3F5C B;  4ZNV A;  1Y0S A;  5DID A;  1YOW A;  3OZJ A;  4LTW A;  1XLS A;  3UUD A;  3OMQ A;  5AVI A;  3FYL A;  3M7R A;  5DWJ A;  1E3K A;  4K7A A;  4MDD A;  3AX8 A;  5DZ0 A;  3B0R A;  3BC5 A;  4IW6 A;  5DUE A;  3WJ4 A;  1UHL A;  1T7F A;  2VV1 A;  1LV2 A;  3OS8 A;  1K7L A;  2PRG A;  2HAN B;  3GD2 A;  3B65 A;  3ET0 A;  1QKT A;  2R6W A;  4OEA A;  3G9E A;  5ETH A;  1R0N B;  3CDS A;  2I0J A;  2XYW A;  3P88 A;  5DKS A;  1R0O A;  2IOK A;  4QK4 A;  1UPW A;  3DZU D;  1S9Q A;  5CBX A;  1I7I A;  3FXV A;  4REE A;  3AN3 A;  1ZDT A;  5CC1 A;  2HC4 A;  1HJ1 A;  1SKX A;  1YOK A;  1X7B A;  2ZXZ A;  1T79 A;  3FEI A;  5KCF A;  1MZN A;  5DI7 A;  4RAK A;  5E0W A;  3KBA A;  3G27 A;  5DZI A;  3RUT A;  1DKF B;  5DX3 A;  5EC9 A;  5KCD A;  3IPQ A;  3PEQ A;  4EM9 A;  4G2H A;  4NQA B;  4PP5 A;  5CBY A;  1T65 A;  2B23 A;  1XJ7 A;  2W8Y A;  3ADW A;  4TUZ B;  5APJ A;  5F9B A;  1XAP A;  4ZO1 B;  1YUC A;  3AZ3 A;  3R2A A;  4IA3 A;  1VJB A;  3B3K A;  4IA7 A;  4QE6 A;  3A9E A;  5APH A;  1ZUC A;  2QXM A;  1P8D A;  4OFU A;  3W5R A;  1DSZ B;  2NLL B;  4WHF A;  5HCV A;  1K74 A;  5KYA A;  1IE8 A;  2PIU A;  2Q6R A;  3A3Z X;  4IV4 A;  4MG8 A;  2ZAS A;  4J26 A;  4DM8 A;  4XUH A;  3OKH A;  4KZJ A;  1G2N A;  4QJR A;  4OLM A;  3VRU A;  4MGA A;  2NV7 A;  4XTA A;  2J14 A;  1X76 A;  1UPV A;  1XVP B;  2ZK1 A;  2VUT I;  2QR9 A;  4POJ A;  1FCY A;  3CQV A;  3D24 A;  2AMA A;  2ZK3 A;  3KDT A;  3G6T A;  1A52 A;  3B66 A;  5DVV A;  3JZC A;  1BSX A;  2OVM A;  3CS4 A;  5DMC A;  5AYG A;  2QA8 B;  3G8U A;  4X1G A;  1HLZ A;  5DIE A;  1FM6 D;  1XP6 A;  1TXI A;  5DVC A;  3R5N A;  5FQR A;  5EMQ A;  3UVV B;  3L03 A;  4POH A;  3DR1 A;  4Q0A C;  4ZNH A;  2JF9 A;  3HOD A;  4OHA A;  3U9Q A;  4OKT A;  4ZJW A;  5G45 A;  3UU7 A;  3WJ5 A;  2VST A;  1X7J A;  1H9U A;  5DXQ A;  4LSJ A;  5HJP A;  2QGW A;  4RWV A;  5AZV A;  3AUR A;  5E6D A;  2VV0 A;  5G43 A;  2QXS A;  1FCX A;  4R6S A;  2G0G A;  2XYX A;  4LNW A;  3KYT A;  2IHQ A;  2O9I A; 
#chains in the Genus database with same CATH homology
 1FM9 A;  1U9E A;  3ERT A;  2BAW A;  5H1E A;  2XHS A;  1TFC A;  4DMA A;  4JL4 A;  3ADV A;  1U3S A;  5DXB B;  2QW4 A;  3V49 A;  4B7W A;  4N73 A;  4OEY A;  3LBD A;  5GAT A;  3VTB A;  1XOW A;  5CBZ A;  1R20 D;  5AK2 A;  4J5W A;  2ZNO A;  5DUG A;  1T63 A;  1T5Z A;  2PIO A;  2Q6J A;  3RVF A;  3T03 A;  3ZQT A;  1YIN A;  1K74 D;  3ADX A;  2Q5G A;  3FUG A;  5KR9 A;  2ACL B;  5KRI A;  1NQ1 A;  4QE8 A;  4OJ9 A;  1CIT A;  2AX8 A;  4S0S A;  2OUZ A;  4O8F A;  4Y29 A;  1Z5X E;  3V3Q A;  4DM6 A;  4MGB B;  4PLE A;  5E0X A;  3VHV A;  1ERR A;  4OK1 A;  3CS8 A;  3OSI A;  4MGD A;  5AZT A;  3VN2 A;  2HFP A;  3OS8 C;  4OZR E;  3ZRA A;  4OH6 A;  3G6P A;  5KRL A;  3GWS X;  1XP1 A;  2PIT A;  1NQ2 A;  2Q61 A;  1M7W A;  3HLV A;  3W0G A;  3TY0 A;  2Z4J A;  3ADU A;  4RME A;  2GP7 A;  1SQN A;  2REW A;  3VHW A;  3NOA A;  3R5M A;  2VUU I;  3A2H A;  3DFV C;  1PQC A;  4REF A;  1GDC A;  2Q1H A;  1HCQ A;  3OGT A;  2NLL A;  2ZFX A;  2H77 A;  3B68 A;  4CSJ A;  3E00 D;  2A66 A;  1G50 A;  2QSE A;  1GS4 A;  1PRG A;  5AVL A;  3IMY A;  1NAX A;  1Y9R A;  4IU7 A;  5K13 A;  3G6R A;  4OIV A;  3E7C A;  2QAB A;  1A6Y A;  1UOM A;  1XV9 A;  3O1E A;  1YJE A;  5E7V A;  2QH6 A;  5E6B A;  3W0A A;  1FM9 D;  3G97 A;  1XLS E;  4RFW A;  4MG5 A;  3SZ1 A;  1XVP A;  1LBD A;  1T7R A;  3BEJ A;  3UUA B;  3OSA A;  3JZB A;  1A28 A;  4P6X A;  2VSR A;  1GA5 A;  4WLB A;  3CJW A;  3VRW A;  3AN4 A;  3TKC A;  4J5X A;  3VSP A;  1XDK B;  2XYJ A;  4L98 A;  4OKB A;  3UVV A;  4OJ4 A;  2QTU A;  1T76 A;  1T7M A;  4IVW A;  5DV3 A;  4DOR A;  2QE4 A;  2EWP A;  4IS8 A;  1R1K A;  2YLO A;  4IV2 A;  4G21 A;  5G5W A;  4YNK A;  5DYD A;  2BJ4 B;  5FQP A;  2AO6 A;  5M96 A;  4MG7 A;  3G8O A;  2FVJ A;  4HC7 A;  5KCU A;  3G0W A;  5DIG A;  1LV3 A;  6GAT A;  4YT1 A;  5FQS A;  2O4J A;  4M8E A;  3ZR7 A;  5E14 A;  3OOK A;  2AA5 A;  3W0Y A;  1Z5X U;  3G99 A;  1I38 A;  4OGH A;  1GAU A;  4NIE A;  4ZNS A;  5EHJ A;  3WGP A;  4CN5 A;  3VT6 A;  3FEJ A;  4APU A;  1I7G A;  2JJ3 A;  2PIW A;  4OZR U;  4S0T A;  3ET2 A;  5CJ6 A;  5DV8 A;  5KYJ A;  1HCP A;  1XQ3 A;  2QA6 A;  4UDC A;  3A40 X;  1L2I A;  4HC9 A;  2HAS A;  1IE9 A;  1DB1 A;  2AA2 A;  2AAX A;  2ZNQ A;  2AX9 A;  3B0W A;  4A2J A;  5AAV B;  3TKM A;  3A2I A;  2R40 A;  3KMR A;  5E6A A;  3V3E A;  1G1U A;  3KPZ A;  4MGB A;  2P1U A;  4OKX A;  4DQM A;  1KV6 A;  3G9O A;  1KNU A;  1R4O A;  1U3R A;  3F7D A;  5DZ3 A;  4OKW A;  2GPP A;  3PO9 A;  3AZ1 A;  2FSZ A;  2AA7 A;  5L11 A;  3G6Q A;  7GAT A;  3G9I A;  4TV1 A;  1R4R A;  3GYU A;  5G44 A;  4OLN A;  4J24 A;  3VRT A;  2POB A;  4RMC A;  2HVC A;  3WMH A;  5HZC A;  1HRA A;  3G9J A;  4LNX A;  1NAV A;  3Q95 B;  1PZL A;  2AM9 A;  1R1K D;  1RDT A;  3D90 A;  4JAZ A;  4PPP A;  4N1Y A;  1N4H A;  4ZN9 A;  2HB7 A;  3X36 A;  1YIM A;  5DU5 A;  2HWQ A;  1RKG A;  3L1B A;  2VV3 A;  2QMV A;  3W5T A;  5KRJ A;  4R2U A;  3CWD A;  1RK3 A;  3V9Y A;  4ZNU A;  4CI5 A;  5JJM B;  1MVC A;  3ADT A;  4XI3 A;  4F9M A;  5DY8 A;  4R06 A;  4JYH A;  4KZM A;  1NQ7 A;  2ATH A;  2YLP A;  3AUQ A;  1QKM A;  3FS1 A;  2GIU A;  2Q7L A;  2NXX A;  2HAR A;  5B5B A;  4IA1 A;  3GZ9 A;  4G2I A;  3MNO A;  1XNX A;  3E94 A;  2V7C A;  3KWY A;  3X1I A;  4WPF A;  4CN2 C;  2AA6 A;  3FAL A;  3K8S A;  2J4A A;  1KB6 A;  5KCT A;  5DZH A;  5DRM A;  1XQC A;  3KFC A;  3LMP A;  2GTK A;  1PDU A;  1XPC A;  5DL4 A;  2ZLA A;  5AWK A;  3VEK C;  3OLL A;  2AB2 A;  3MNP A;  4WQP A;  3AUN A;  1N46 A;  2BJ4 A;  4FN9 A;  4MGC A;  3DT3 A;  5E1C A;  2QNV A;  1WM0 X;  3V4A A;  3F5C A;  4XUM A;  4NY9 A;  5FQV A;  2YHD A;  2Q70 A;  2GPV A;  2OVH A;  4RZF A;  5L7H A;  2YLQ A;  5KCW A;  4PF3 A;  1ERE A;  2AWH A;  1P93 A;  2HWR A;  5DXE A;  5L0M A;  3V9V A;  3VT3 A;  2ZMH A;  4RUO X;  4IVY A;  4WHG A;  5GID A;  3SP6 A;  4BCR A;  1RDT D;  3TX7 B;  2P54 A;  3H52 A;  4HN6 A;  4UDD A;  4L96 A;  5DK9 A;  1R0N A;  2HAN A;  4OOR A;  1PK5 A;  2ZK0 A;  1YA3 A;  1YMT A;  3L3Z A;  5EJV A;  2PIR A;  3W5Q A;  1ZKY A;  4RE8 A;  1YY4 A;  3KMG A;  3ILZ A;  3UUD B;  5JI0 D;  1QKU A;  2I4P A;  5C4O A;  2VV4 B;  5G3J A;  5AWJ A;  1KB2 A;  3X31 A;  1DKF A;  2Q5S A;  1PQ9 A;  2G5O A;  4LBD A;  4OAR A;  1I37 A;  2VV1 B;  2ZVT A;  3AFR A;  3HQ5 A;  4P6W A;  5DV6 A;  5DXG A;  1OSV A;  4AA6 A;  3B67 A;  3CBB A;  3WFF A;  3OMK A;  4RUP A;  2Q1V A;  4OC7 A;  1Y0X X;  4TUZ A;  3W5P A;  2J7Y A;  4ZNW A;  5EMP A;  1RJK A;  1R0O B;  4MG9 B;  2Q3Y A;  4JYI A;  2P1T A;  2B1Z A;  3P89 A;  1ZEO A;  5E69 A;  1X7E A;  4UDA A;  1DSZ A;  1GWR A;  1HG4 A;  5KRK A;  3X1H A;  4IUI A;  5SYZ A;  2V0V A;  3G9M A;  5CC0 A;  3GN8 A;  4UDB A;  1U3Q A;  5DX3 B;  2QGT A;  1Z95 A;  2H79 A;  5DYB A;  3R8D A;  3W0I A;  4PXM A;  3SP9 A;  2G0H A;  4MG6 A;  4N5G A;  5JJM A;  1M2Z A;  4PPS A;  3VSO A;  3W0C A;  1MV9 A;  3B1M A;  2QA8 A;  2B50 A;  4RMD A;  4ZOM A;  5E15 A;  1XZX X;  2Q60 A;  3D57 A;  2ZK5 A;  3OS9 A;  1GLU A;  3W0H A;  4OV7 A;  2Q5P A;  3O1D A;  3W0J A;  3DFX A;  4MG8 B;  4S14 A;  2OCF A;  1YYE A;  3OSW A;  4OED A;  3VRV A;  4N8R A;  3K22 A;  3RY9 A;  1N83 A;  2ZK4 A;  3OMM A;  4MGA B;  4ZNT A;  2GPO A;  2FF0 A;  2ZNP A;  4S15 A;  3B0T A;  3ADS A;  3WT7 A;  5GIC A;  3CS6 A;  1LAT A;  5B41 A;  4ONI A;  1Q4X A;  3VT8 A;  2ZMI A;  4G20 A;  1NHZ A;  1S9P A;  5DTV A;  4E4K A;  4ZJR A;  5DRJ A;  2Q7I A;  4Q50 A;  4QM0 A;  3OLF A;  2PIN A;  5DXB A;  2JFA B;  2GWX A;  3PBA A;  1S0X A;  1T73 A;  2PIP L;  4FHI A;  4X1F A;  3UU7 B;  2M9W A;  3OZ0 A;  2HCD A;  1K4W A;  2PIX A;  5HJP B;  3OLS A;  3K6P A;  2PKL A;  2ACL A;  2HAM A;  4M8H A;  3WT6 A;  4A4V A;  4E4Q A;  4OND A;  5G46 A;  5KRM A;  4IWC A;  3D5F A;  2I0G A;  2Q8S A;  3OMP A;  1GAT A;  3IPS A;  2YJD A;  4OIL A;  4PRG A;  4YMQ A;  4PWL A;  5JY3 A;  3IXP A;  4FHH A;  2VV4 A;  4J5W C;  3VT4 A;  1XNN A;  2OM9 A;  2ZKC A;  5IXK A;  4HEE X;  4E2J A;  4CN3 A;  2YAT A;  3ET3 A;  5I4V A;  2P4Y A;  3GAT A;  4GAT A;  2HB8 A;  2NXX E;  5C4U A;  5DWI A;  3L3X A;  4XAO A;  4DOS A;  1RGD A;  5AAU A;  1FM6 A;  3R8I A;  3RLL A;  4CN7 A;  1SJ0 A;  1RKH A;  2ZXN A;  2IOG A;  4ZN7 A;  3QT0 A;  1YNW B;  2VV2 A;  1ZDU A;  3AZ2 A;  3NSP A;  4MG9 A;  4YPQ A;  5EIT A;  4TNT A;  1XIU A;  2ZK2 A;  1NRL A;  2Q59 B;  1PCG A;  2XKW A;  3B5R A;  3G6U A;  3VJT A;  4PLD A;  4MGD B;  3WT5 A;  1NDE A;  4JYG A;  5EI1 A;  4HLW A;  3VTC A;  2PJL A;  2QZO B;  5GIE A;  3VHU A;  3VJS A;  2P7A A;  3N00 A;  5DSH A;  5KRA A;  5IZ0 A;  4G1Y A;  3MNE A;  3IA6 A;  2ZK6 A;  3GWX A;  2GAT A;  2LBD A;  1EXX A;  1SR7 A;  1OT7 A;  3UUA A;  3DZY A;  3CTB A;  1FCZ A;  1BY4 A;  4IW8 A;  4K6I A;  4XLD A;  2ZMJ A;  3VD6 C;  3ERD A;  4OJB A;  3K23 A;  1R20 A;  3IPU A;  1L2J A;  5DWG A;  4ZI1 A;  1XDK A;  3BQD A;  2P7Z A;  2NPA A;  2PIQ A;  4OEZ A;  2R40 D;  3FC6 B;  1OVL B;  1NQ0 A;  5DXP A;  5DP0 A;  2Q7K A;  1RXR A;  1XV9 B;  1X7R A;  1G5Y A;  5GT4 A;  3RLJ A;  3IXP D;  4KZI A;  5HJS A;  5DXK A;  2OZ7 A;  2ZL9 A;  2P15 A;  3OMO A;  2PIV A;  5DVS A;  2YFE A;  5LWP A;  4CN3 D;  3VTD A;  4HN5 A;  2FAI A;  4J5X C;  1NYX A;  1T74 A;  2NW4 A;  2AMB A;  4ITF A;  2AX7 A;  5DMF A;  5FQT A;  3L0L A;  3R8A A;  3UP3 A;  2I4Z A;  4WVD A;  2AYR A;  3DY6 A;  4XT9 A;  2Q6S A;  3EYB A;  3DZY D;  3GYT A;  2E2R A;  3VT5 A;  2GL8 A;  2JFA A;  2ABI A;  5APK A;  2I4J A;  1QKN A;  4TMA I;  1M13 A;  2AXA A;  3A78 A;  4PP3 A;  3H0A A;  3P0U A;  3NSQ A;  4G1Z A;  4OZT E;  2J7X A;  2YLY A;  5KCC A;  5KRC A;  3S9S A;  2ENV A;  3G9P A;  5HYK A;  3VJI A;  5AAV A;  4MG7 B;  3RUU A;  3E00 A;  2ZLC A;  4RZE A;  5EMC A;  5G42 A;  1R5K A;  3L0J A;  5KD9 A;  4EMA A;  2KAE A;  4JGV A;  3G8I A;  3ZRB A;  2ZY0 A;  1FD0 A;  1XP9 A;  1UHL B;  3A2J A;  5DKG A;  3B0Q A;  4IA2 A;  5E19 A;  3VT9 A;  1E3G A;  4CI4 A;  1S0Z A;  1X78 A;  2B1V A;  4OFR A;  3DCU A;  1ILH A;  2ZBS A;  4FGY A;  3PCU A;  4G1D A;  2HBH A;  5DLR A;  1OSH A;  4XHD A;  4NUF A;  4Q13 A;  1ZGY A;  2R6Y A;  3GBK A;  3Q95 A;  1YNW A;  5L7E A;  5KRO A;  1ILG A;  3D6D A;  5A86 A;  2Q7J A;  2Q59 A;  3HVL A;  5ACC A;  2EBL A;  3V9T A;  3OAP A;  3WTQ A;  5DKB A;  1EXA A;  1ZH7 A;  2QPY A;  3G8X A;  2OAX A;  3HC6 A;  1GWX A;  2QZO A;  3HC5 A;  2YJA B;  2ZNN A;  3OOF A;  4DK8 A;  5L7G A;  1T7T A;  3KDU A;  4TV1 B;  3VI8 A;  1ZAF A;  3VJH A;  3OKI A;  1LO1 A;  4IQR A;  2GDA A;  2C7A A;  4QL8 A;  4PP6 A;  3ET1 A;  3A9E B;  2ZXM A;  5IAW A;  2A3I A;  3FLI A;  1R4I A;  5DUH A;  5HYR A;  3UP0 A;  5KRB B;  1S19 A;  3CDP A;  3H0A D;  4ZO1 X;  2GPU A;  5DXM A;  5C4S A;  1XB7 A;  3M9E A;  2O4R A;  3L0E A;  3P8X A;  5C4T A;  2G44 A;  4IWF A;  3PRG A;  5DWE A;  3KMZ A;  4A4W A;  5KRH A;  3DZU A;  3FC6 A;  1FBY A;  3PLZ A;  4NB6 A;  1OVL A;  4DK7 A;  4HCA A;  4OIU A;  2VUS I;  1R6G A;  1PQ6 A;  3FUR A;  4K4J A;  4RUJ A;  5DXR A;  3HO0 A;  3HZF A;  4ITE A;  3UUC A;  4OZT U;  3CLD A;  3VT7 A;  5DWL A;  4FNE A;  5EGV A;  5LGA A;  3WFG A;  1YP0 A;  3DCT A;  5DKE A;  1KKQ A;  3FAL B;  2P1V A;  4OH5 A;  4RZG A;  5DZ1 A;  2P7G A;  2AX6 A;  1KB4 A;  2POG A;  3HM1 A;  2Z4B A;  5ICK A;  5KCE A;  1GNF A;  5KRF A;  3R29 A;  4PVU A;  3WWR A;  1GWQ A;  5E6C A;  1NUO A;  2PNU A;  2F4B A;  3F5C B;  4ZNV A;  1Y0S A;  5DID A;  1YOW A;  3OZJ A;  4LTW A;  1XLS A;  3UUD A;  3OMQ A;  5AVI A;  3FYL A;  3M7R A;  5DWJ A;  1E3K A;  4K7A A;  4MDD A;  3AX8 A;  5DZ0 A;  3B0R A;  3BC5 A;  4IW6 A;  5DUE A;  3WJ4 A;  1UHL A;  1T7F A;  2VV1 A;  1LV2 A;  3OS8 A;  1K7L A;  2PRG A;  2HAN B;  3GD2 A;  3B65 A;  3ET0 A;  1QKT A;  2R6W A;  4OEA A;  3G9E A;  5ETH A;  1R0N B;  3CDS A;  2I0J A;  2XYW A;  3P88 A;  5DKS A;  1R0O A;  2IOK A;  4QK4 A;  1UPW A;  3DZU D;  1S9Q A;  5CBX A;  1I7I A;  3FXV A;  4REE A;  3AN3 A;  1ZDT A;  5CC1 A;  2HC4 A;  1HJ1 A;  1SKX A;  1YOK A;  1X7B A;  2ZXZ A;  1T79 A;  3FEI A;  5KCF A;  1MZN A;  5DI7 A;  4RAK A;  5E0W A;  3KBA A;  5DZI A;  3RUT A;  1DKF B;  5DX3 A;  5EC9 A;  5KCD A;  3IPQ A;  3PEQ A;  4EM9 A;  4G2H A;  4NQA B;  4PP5 A;  5CBY A;  1T65 A;  2B23 A;  1XJ7 A;  2W8Y A;  3ADW A;  4TUZ B;  5APJ A;  5F9B A;  1XAP A;  4ZO1 B;  1YUC A;  3AZ3 A;  3R2A A;  4IA3 A;  1VJB A;  3B3K A;  4IA7 A;  4QE6 A;  3A9E A;  5APH A;  1ZUC A;  2QXM A;  1P8D A;  4OFU A;  3W5R A;  1DSZ B;  2NLL B;  4WHF A;  5HCV A;  1K74 A;  5KYA A;  1IE8 A;  2PIU A;  2Q6R A;  3A3Z X;  4IV4 A;  4MG8 A;  2ZAS A;  4J26 A;  4DM8 A;  4XUH A;  3OKH A;  4KZJ A;  1G2N A;  4QJR A;  4OLM A;  3VRU A;  4MGA A;  2NV7 A;  4XTA A;  2J14 A;  1X76 A;  1UPV A;  1XVP B;  2ZK1 A;  2VUT I;  2QR9 A;  4POJ A;  1FCY A;  3CQV A;  3D24 A;  2AMA A;  2ZK3 A;  3KDT A;  3G6T A;  1A52 A;  3B66 A;  5DVV A;  3JZC A;  1BSX A;  2OVM A;  3CS4 A;  5DMC A;  5AYG A;  2QA8 B;  3G8U A;  4X1G A;  1HLZ A;  5DIE A;  1FM6 D;  1XP6 A;  1TXI A;  5DVC A;  3R5N A;  5FQR A;  5EMQ A;  3UVV B;  3L03 A;  4POH A;  3DR1 A;  4Q0A C;  4ZNH A;  2JF9 A;  3HOD A;  4OHA A;  3U9Q A;  4OKT A;  4ZJW A;  5G45 A;  3UU7 A;  3WJ5 A;  2VST A;  1X7J A;  1H9U A;  5DXQ A;  4LSJ A;  5HJP A;  2QGW A;  4RWV A;  5AZV A;  3AUR A;  5E6D A;  2VV0 A;  5G43 A;  2QXS A;  1FCX A;  4R6S A;  2G0G A;  2XYX A;  4LNW A;  3KYT A;  2IHQ A;  2O9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...