3E00D

Intact ppar gamma - rxr alpha nuclear receptor complex on dna bound with gw9662, 9-cis retinoic acid and ncoa2 peptide
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
363
Chain Sequence
MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Retinoic acid receptor RXR-alpha
publication title Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 363
sequence length 371
ec nomenclature
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
D PF00105 zf-C4 Zinc finger, C4 type (two domains)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3e00D02
3.30.50.10 Alpha Beta 2-Layer Sandwich Erythroid Transcription Factor GATA-1; Chain A Erythroid Transcription Factor GATA-1, subunit A 3e00D01
2AO6A 5DVSA 3IPQA 5DMCA 3GYUA 3OMKA 2QSEA 1FM6A 1YIMA 3HO0A 1ILGA 4CN2C 3OGTA 1XLSE 3V9VA 4DMAA 4WVDA 2HC4A 2R6WA 3TKMA 3GD2A 4WHFA 3A40X 2R40A 3D90A 5ACCA 2QMVA 3OZ0A 3M7RA 2W8YA 1ZKYA 2HWQA 4CN3D 3OSIA 5G3JA 3RVFA 1EXXA 1YINA 5AAUA 2ZK1A 4PF3A 1OVLB 2YLYA 1T7FA 2AX7A 4ITEA 2QPYA 3ADTA 5DLRA 1XV9A 3RY9A 4MGCA 5L11A 2B50A 3PCUA 4FN9A 1R20A 3OLSA 3HC6A 2AX6A 2Q7LA 2QH6A 1RGDA 4RE8A 2QE4A 2AAXA 4N73A 2VUTI 3W0GA 3TX7B 1SKXA 3VTDA 1YOWA 4A4WA 5I4VA 2VV4B 3H0AA 2HFPA 1H9UA 1XDKA 3FLIA 3TKCA 1ILHA 3G9EA 4XAOA 5DZ0A 5ETHA 5G43A 5KCEA 2ZK2A 5EMPA 3SP6A 3VJHA 3W5QA 5B5BA 4MGBA 2ZMHA 3OSWA 2QZOB 2AWHA 2ZK6A 3VT4A 3NSPA 1RXRA 3L3ZA 2ZK3A 3Q95A 1XVPB 2OZ7A 1LATA 5GIDA 4A4VA 5KROA 1DSZA 1HJ1A 5C4UA 3V4AA 1X7JA 4OHAA 4IA7A 4ZOMA 3PLZA 4OJ9A 2ACLB 2AMBA 5DU5A 2PIUA 3AZ2A 2PIWA 2POGA 4OEYA 4YT1A 1FCXA 3W0HA 5L7HA 1ZDUA 2QR9A 1OT7A 3ADXA 2Q59B 3O1DA 4G21A 4J26A 2NXXA 5KRLA 1R0OB 2Q5GA 5DXBB 5E7VA 5KYAA 3RLJA 1GA5A 2BAWA 5K13A 3D5FA 1KB6A 1QKMA 1RK3A 4XI3A 4UDDA 3DZUD 3L0LA 5APKA 3WFFA 5DL4A 3UUCA 2Q1VA 2B1VA 3ZR7A 5H1EA 2ZMJA 4PRGA 3VJSA 2O4RA 4MG9A 5KCUA 2QXSA 3R5NA 1IE9A 2ATHA 2I0JA 3UUDA 3ADVA 4IW8A 5E19A 2PINA 3VHUA 3G6RA 1MV9A 3OAPA 4WHGA 3ADUA 3UUAB 5CBXA 3IXPA 3F7DA 2F4BA 5DWGA 1FD0A 3HZFA 4IWCA 2I4ZA 1Z5XE 2J14A 1DKFA 4DK8A 2P54A 2QTUA 2XHSA 4OH5A 3OLLA 3VT9A 1Z5XU 5KRCA 1PQ9A 2GPVA 4OC7A 2Q60A 4LNWA 4ZNTA 3D6DA 1U3QA 2FF0A 1R5KA 1XV9B 4XLDA 4K7AA 1GWRA 3OOKA 2I0GA 5DX3A 3SP9A 3VN2A 4S14A 3ET2A 1SQNA 3AUQA 2PITA 2EWPA 4DQMA 4NQAB 3G9OA 1NYXA 1PZLA 3UVVB 4EM9A 1UHLB 3FEJA 2HANB 2ZNQA 2OUZA 4RUOX 2HCDA 3UU7B 1FBYA 2ZASA 4PXMA 3X31A 5EJVA 3VJIA 2H77A 5AVLA 3W0CA 4NIEA 2HARA 1LBDA 3VT3A 3G97A 1SJ0A 4HCAA 5FQSA 2Q70A 2B23A 3PRGA 3R2AA 1U3SA 1LO1A 2HWRA 3HLVA 4CN7A 2ZLAA 2J7XA 5DXRA 4ZI1A 4QM0A 3M9EA 5DK9A 3HVLA 3WFGA 5HJSA 4J5XC 4K4JA 2JF9A 1UPVA 5KCTA 2V7CA 2ZL9A 4OILA 1ZEOA 5KCDA 3G6PA 3B68A 5E0XA 5IXKA 5KRFA 2PIQA 3AZ3A 3PEQA 3OMMA 1R4IA 1OSVA 1L2JA 3ADSA 1RKGA 2O9IA 2VV1A 2NV7A 4OKWA 1T65A 2GDAA 4GATA 1G5YA 4PPPA 4S15A 5DTVA 5FQVA 3VHVA 5APJA 2Q3YA 1WM0X 4MG5A 5AAVB 4OEDA 2NLLB 4KZJA 2BJ4A 1G1UA 3FXVA 2ZK5A 5DRJA 5DVVA 3B66A 1XZXX 2JFAA 5DKGA 3MNOA 3KDUA 4MG7A 3OMOA 5DYBA 1S9QA 2PNUA 3DT3A 2AM9A 4HLWA 3KDTA 4J5XA 5DZHA 5KRMA 2AA2A 1NHZA 2GIUA 4OFRA 1XJ7A 4PLEA 4TMAI 1FCYA 3VT7A 3FC6A 5DXMA 5JI0D 4CN3A 1YNWB 2QA8A 1YOKA 3T03A 2HASA 4CSJA 3ZRAA 3PBAA 5JJMB 2HB8A 3IPUA 3DZYD 2Z4BA 3FYLA 1KB2A 1XB7A 4YPQA 3VD6C 2FVJA 4R2UA 5KRBB 5KRJA 5DSHA 4IA1A 5LWPA 5E6CA 2OAXA 2EBLA 5G46A 2QA6A 4UDCA 4POHA 4QK4A 5EHJA 3R29A 5CC0A 5HCVA 2C7AA 1T73A 4OLNA 5DWLA 3A2HA 1XQ3A 2P7ZA 3E7CA 3E00D 2ZNPA 4F9MA 1Y0XX 3GWXA 4OH6A 4P6WA 4POJA 4RZFA 1LV3A 3G9JA 1K74D 1IE8A 2PIPL 2E2RA 3DCTA 4QE8A 2V0VA 2P1TA 4TV1A 2IHQA 4L96A 4Q0AC 3CTBA 5EGVA 3WT5A 5CC1A 3K8SA 5DWJA 1ZUCA 2YJDA 4PVUA 5DWIA 3FEIA 3JZCA 4RAKA 5DXPA 2ZXZA 4DM6A 5EMCA 3JZBA 1HCPA 4Q13A 1NAVA 4REFA 4APUA 1U3RA 3NOAA 4LNXA 1T7RA 3G8UA 5HJPB 1HRAA 4OKTA 3IMYA 3V49A 2AB2A 3WGPA 1XAPA 4IA3A 4X1GA 5KCWA 2B1ZA 2YLPA 2O4JA 2VV3A 1KB4A 4OV7A 4MGAA 3G8IA 4TUZA 1OSHA 3G9MA 4WPFA 5A86A 3U9QA 4A2JA 1R20D 1T5ZA 1X76A 4OKBA 3W0AA 1YMTA 2VV2A 2VSTA 3OSAA 5DKEA 1UPWA 4YNKA 3P88A 5FQTA 2JFAB 3F5CB 3FURA 4CN5A 2GP7A 2Q61A 4OZRE 5HYRA 3H0AD 4XT9A 5DMFA 5KR9A 5KCFA 5DXKA 1XQCA 4PP5A 3SZ1A 2XKWA 3L03A 2P1UA 4OZRU 2ZK4A 3A3ZX 5L0MA 2ZK0A 1RDTA 1YP0A 1QKTA 5DV8A 3FC6B 4X1FA 1R1KA 3E94A 4RFWA 2GTKA 3KMRA 2YHDA 3OZJA 4IW6A 4ZN7A 5M96A 3DFXA 5EI1A 3WT7A 5DVCA 2Q7JA 3N00A 4IV4A 3D24A 4LBDA 5EITA 2ENVA 3MNEA 1GWQA 4MG8A 5DY8A 4OZTE 4UDBA 3GATA 3R8AA 2OCFA 3ERDA 3B0WA 4PLDA 3A9EA 5DXQA 1R0NA 4M8HA 2HBHA 5DUHA 3R8DA 1HG4A 4OZTU 3FALA 1NUOA 1UOMA 1YY4A 1ZDTA 3CQVA 4G1YA 4ZNVA 2FAIA 4CI5A 1N46A 1CITA 4WLBA 4IV2A 2R6YA 1T74A 3CBBA 5DZ1A 4FHHA 4DORA 1GNFA 1XDKB 3OS9A 5CBYA 2QW4A 3D57A 1XNXA 2A3IA 5AWJA 2ZKCA 4MGBB 3GBKA 1Z95A 4PP3A 5F9BA 2YLQA 3B3KA 1FM9D 2AA6A 1T79A 3VRVA 5E1CA 3L1BA 3Q95B 3B67A 4G2HA 4PWLA 3V3EA 1HLZA 4JL4A 2ABIA 1RKHA 4HN6A 1DSZB 2A66A 2P4YA 1EREA 4RUPA 3FUGA 2NXXE 1YUCA 2GPOA 2ZMIA 3QT0A 4G20A 4PPSA 3W0JA 2GWXA 5C4TA 2ZNNA 2GATA 1XLSA 3CWDA 1OVLA 1XP9A 1ZH7A 3TY0A 3VT8A 4EMAA 4L98A 5EMQA 3DR1A 5DXGA 5B41A 2Q1HA 3IPSA 4KZMA 3VRUA 2I4JA 3B0QA 1S9PA 3B0RA 3ET0A 4M8EA 5KRIA 4JYGA 1HCQA 3GWSX 4RWVA 2P1VA 5DIGA 2Q6SA 3W5PA 2VV4A 2P7AA 1P93A 2YFEA 1GDCA 4MG9B 3G99A 4TNTA 2FSZA 4R06A 3L0EA 3OS8C 3VI8A 3UUDB 4OFUA 3K6PA 5E6AA 2QZOA 4OEZA 1X7RA 2AMAA 4IVYA 2NPAA 3KPZA 1G2NA 4MDDA 3CS4A 5DUEA 5GIEA 1XVPA 3VJTA 2Q7IA 1DKFB 3W0IA 1GS4A 5DUGA 3WMHA 4OARA 4QE6A 1I37A 3DFVC 1YA3A 2QGWA 2ACLA 2GPUA 4OJ4A 4CI4A 5DZ3A 1EXAA 1QKNA 1NQ0A 1U9EA 2IOGA 5DV3A 3X36A 4IQRA 5AWKA 5KCCA 4MGDA 5DX3B 3E00A 2Q59A 3B65A 3G9IA 3OS8A 5EC9A 5DXBA 2J4AA 2P15A 3EYBA 1R0OA 1K74A 2HAMA 3ADWA 3G0WA 4IUIA 1PQCA 3X1IA 2PJLA 5KYJA 2AX9A 2P7GA 2JJ3A 1RJKA 3L0JA 3V3QA 3WWRA 2M9WA 5AZTA 1NQ7A 3GN8A 3VSOA 1M13A 2OVMA 3B0TA 3W0YA 1XPCA 2HVCA 1ZGYA 3HQ5A 3UUAA 4DK7A 5G42A 4ZN9A 4XUMA 2G44A 4E2JA 5KRHA 3OKIA 3CJWA 4N5GA 2PIRA 1M2ZA 3CDPA 3KWYA 2OVHA 4Y29A 3G8OA 4JYHA 1BSXA 1I7GA 2LBDA 4OIUA 1X78A 1SR7A 5DI7A 5AYGA 3VHWA 5DIDA 4DOSA 3ET1A 1FM6D 2AXAA 1I38A 1XP1A 1S0XA 5DV6A 4OIVA 4J5WC 4E4KA 1I7IA 5IAWA 4ONDA 1ERRA 2Z4JA 4OGHA 4OLMA 2R40D 3CLDA 3AN4A 5G44A 5SYZA 2ZXNA 2OM9A 3RUTA 1PDUA 3ZRBA 1M7WA 2VUSI 1XNNA 2VV1B 3P0UA 4ZJWA 5KD9A 5CBZA 2NW4A 7GATA 2YLOA 2ZFXA 3L3XA 1N83A 4HEEX 4IS8A 5E15A 2AX8A 5AZVA 5HZCA 3DZUA 3G8XA 3GZ9A 4N1YA 2YJAB 3KBAA 3VT5A 3UVVA 2BJ4B 1UHLA 3W5RA 4G2IA 2G5OA 4B7WA 2J7YA 2HANA 1P8DA 1TFCA 1XIUA 3BC5A 1E3KA 3OMQA 4OK1A 1Q4XA 1T63A 4QL8A 3HODA 1A28A 4MG7B 4RUJA 1KV6A 3UU7A 4E4QA 1R4RA 3DY6A 1XOWA 4IWFA 2Q6RA 4J5WA 3LMPA 5L7EA 3ERTA 3VT6A 4HC9A 3BQDA 2ZNOA 2Q7KA 2I4PA 3PO9A 3FS1A 2KAEA 1R4OA 4DM8A 4RMDA 1K4WA 2G0GA 4ITFA 4QJRA 5G45A 3VRWA 3CDSA 1PK5A 2QA8B 3VSPA 3VTCA 2GPPA 5DKSA 3AZ1A 4IU7A 2ZLCA 1T76A 3A2JA 3KYTA 2XYWA 4ZNHA 5G5WA 3BEJA 4YMQA 3B5RA 2IOKA 4MGDB 3X1HA 4ZNSA 3RUUA 3A78A 4Q50A 1X7EA 4RZGA 5C4SA 4G1DA 1FCZA 1KNUA 2XYJA 1T7TA 3R5MA 3G9PA 4O8FA 2GL8A 3K23A 1ZAFA 4R6SA 1A6YA 5AAVA 5LGAA 3KFCA 5HYKA 4FNEA 5DP0A 2NLLA 3ET3A 5AVIA 2PRGA 1YYEA 3V9TA 3W5TA 3WTQA 1NQ2A 1K7LA 3KMGA 5DZIA 4TV1B 1FM9A 5GATA 4J24A 3RLLA 3UP3A 2ZY0A 4S0SA 3G6UA 5CJ6A 1BY4A 4HN5A 4KZIA 1LV2A 3CS8A 1T7MA 4JAZA 5GICA 3NSQA 2ZXMA 1X7BA 1QKUA 1RDTD 1TXIA 2AA5A 2POBA 2Q6JA 3H52A 3P89A 1S0ZA 4LSJA 5C4OA 1GWXA 1YJEA 3A2IA 1R1KD 1KKQA 3IXPD 1YNWA 3VRTA 4K6IA 4G1ZA 5JJMA 3UP0A 1NDEA 4FGYA 3G6QA 1XP6A 2QGTA 3DCUA 4NY9A 1MZNA 3R8IA 1MVCA 4XTAA 3OLFA 3AX8A 1PCGA 4IVWA 4XUHA 4MGAB 2XYXA 3AN3A 3IA6A 3ZQTA 4TUZB 5ICKA 5KRKA 4AA6A 1GATA 1PQ6A 4OKXA 2QABA 5L7GA 5E69A 3S9SA 2VUUI 1N4HA 4ZO1X 3KMZA 3WT6A 3WJ5A 4P6XA 5E6DA 3HC5A 4JYIA 5DRMA 1NAXA 1A52A 5IZ0A 4PP6A 3K22A 2PIXA 2Q5SA 3AUNA 2Q5PA 4RMEA 3P8XA 5DKBA 4ZJRA 5E6BA 5E0WA 1Y9RA 3G6TA 1GAUA 5DXEA 3O1EA 4HC7A 2G0HA 1NQ1A 4ZO1B 4N8RA 1G50A 2PKLA 4ZNWA 4RMCA 2PIOA 1PRGA 2REWA 3OKHA 4ZNUA 5HJPA 5FQPA 4BCRA 2ZVTA 4REEA 4NB6A 4OEAA 3B1MA 3DZYA 5FQRA 4LTWA 3OMPA 2QNVA 4WQPA 1DB1A 1VJBA 4IA2A 4MG8B 4XHDA 3GYTA 4MG6A 3WJ4A 5E14A 1R6GA 2VV0A 4ONIA 5DYDA 3A9EB 1R0NB 4OJBA 4NUFA 5GT4A 1NRLA 2QXMA 2VSRA 3AFRA 4S0TA 3FALB 4RZEA 1Y0SA 3CS6A 2YATA 5DWEA 5DIEA 1L2IA 3MNPA 4FHIA 3V9YA 6GATA 2ZBSA 3OOFA 2AYRA 2PIVA 2HB7A 2H79A 3AURA 3F5CA 5AK2A 2Q8SA 4UDAA 1E3GA 5APHA 1GLUA 3VEKC 4JGVA 4OORA 2AA7A 1S19A 3LBDA 3HM1A 5JY3A 5KRAA 3ILZA 3VTBA
chains in the Genus database with same CATH superfamily
2AO6A 5DVSA 3IPQA 5DMCA 3GYUA 3OMKA 2QSEA 1FM6A 1YIMA 3HO0A 1ILGA 4CN2C 3OGTA 1XLSE 3V9VA 4DMAA 4WVDA 2HC4A 2R6WA 3TKMA 3GD2A 4WHFA 3A40X 2R40A 3D90A 5ACCA 2QMVA 3OZ0A 3M7RA 2W8YA 1ZKYA 2HWQA 4CN3D 3OSIA 5G3JA 3RVFA 1EXXA 1YINA 5AAUA 2ZK1A 4PF3A 1OVLB 2YLYA 1T7FA 2AX7A 4ITEA 2QPYA 3ADTA 5DLRA 1XV9A 3RY9A 4MGCA 5L11A 2B50A 3PCUA 4FN9A 1R20A 3OLSA 3HC6A 2AX6A 2Q7LA 2QH6A 1RGDA 4RE8A 2QE4A 2AAXA 4N73A 2VUTI 3W0GA 3TX7B 1SKXA 3VTDA 1YOWA 4A4WA 5I4VA 2VV4B 3H0AA 2HFPA 1H9UA 1XDKA 3FLIA 3TKCA 1ILHA 3G9EA 4XAOA 5DZ0A 5ETHA 5G43A 5KCEA 2ZK2A 5EMPA 3SP6A 3VJHA 3W5QA 5B5BA 4MGBA 2ZMHA 3OSWA 2QZOB 2AWHA 2ZK6A 3VT4A 3NSPA 1RXRA 3L3ZA 2ZK3A 3Q95A 1XVPB 2OZ7A 1LATA 5GIDA 4A4VA 5KROA 1DSZA 1HJ1A 5C4UA 3V4AA 1X7JA 4OHAA 4IA7A 4ZOMA 3PLZA 4OJ9A 2ACLB 2AMBA 5DU5A 2PIUA 3AZ2A 2PIWA 2POGA 4OEYA 4YT1A 1FCXA 3W0HA 5L7HA 1ZDUA 2QR9A 1OT7A 3ADXA 2Q59B 3O1DA 4G21A 4J26A 2NXXA 5KRLA 1R0OB 2Q5GA 5DXBB 5E7VA 5KYAA 3RLJA 1GA5A 2BAWA 5K13A 3D5FA 1KB6A 1QKMA 1RK3A 4XI3A 4UDDA 3DZUD 3L0LA 5APKA 3WFFA 5DL4A 3UUCA 2Q1VA 2B1VA 3ZR7A 5H1EA 2ZMJA 4PRGA 3VJSA 2O4RA 4MG9A 5KCUA 2QXSA 3R5NA 1IE9A 2ATHA 2I0JA 3UUDA 3ADVA 4IW8A 5E19A 2PINA 3VHUA 3G6RA 1MV9A 3OAPA 4WHGA 3ADUA 3UUAB 5CBXA 3IXPA 3F7DA 2F4BA 5DWGA 1FD0A 3HZFA 4IWCA 2I4ZA 1Z5XE 2J14A 1DKFA 4DK8A 2P54A 2QTUA 2XHSA 4OH5A 3OLLA 3VT9A 1Z5XU 5KRCA 1PQ9A 2GPVA 4OC7A 2Q60A 4LNWA 4ZNTA 3D6DA 1U3QA 2FF0A 1R5KA 1XV9B 4XLDA 4K7AA 1GWRA 3OOKA 2I0GA 5DX3A 3SP9A 3VN2A 4S14A 3ET2A 1SQNA 3AUQA 2PITA 2EWPA 4DQMA 4NQAB 3G9OA 1NYXA 1PZLA 3UVVB 4EM9A 1UHLB 3FEJA 2HANB 2ZNQA 2OUZA 4RUOX 2HCDA 3UU7B 1FBYA 2ZASA 4PXMA 3X31A 5EJVA 3VJIA 2H77A 5AVLA 3W0CA 4NIEA 2HARA 1LBDA 3VT3A 3G97A 1SJ0A 4HCAA 5FQSA 2Q70A 2B23A 3PRGA 3R2AA 2DS6A 1U3SA 1LO1A 2HWRA 3HLVA 4CN7A 2ZLAA 2J7XA 5DXRA 4ZI1A 4QM0A 3M9EA 5DK9A 3HVLA 3WFGA 5HJSA 4J5XC 4K4JA 2JF9A 1UPVA 5KCTA 2V7CA 2ZL9A 4OILA 1ZEOA 5KCDA 3G6PA 3B68A 5E0XA 5IXKA 5KRFA 2PIQA 3AZ3A 3PEQA 3OMMA 1R4IA 1OSVA 1L2JA 3ADSA 1RKGA 2O9IA 2VV1A 2NV7A 4OKWA 1T65A 2GDAA 4GATA 1G5YA 4PPPA 4S15A 5DTVA 5FQVA 3VHVA 5APJA 2Q3YA 1WM0X 4MG5A 5AAVB 4OEDA 2NLLB 4KZJA 2BJ4A 1G1UA 3FXVA 2ZK5A 5DRJA 5DVVA 3B66A 1XZXX 2JFAA 5DKGA 3MNOA 3KDUA 4MG7A 3OMOA 5DYBA 1S9QA 2PNUA 3DT3A 2AM9A 4HLWA 3KDTA 4J5XA 5DZHA 5KRMA 2AA2A 1NHZA 2GIUA 4OFRA 1XJ7A 4PLEA 4TMAI 1FCYA 3VT7A 3FC6A 5DXMA 5JI0D 4CN3A 1YNWB 2QA8A 1YOKA 3T03A 2HASA 4CSJA 3ZRAA 3PBAA 5JJMB 2HB8A 3IPUA 3DZYD 2Z4BA 3FYLA 1KB2A 1XB7A 4YPQA 3VD6C 2FVJA 4R2UA 5KRBB 5KRJA 5DSHA 4IA1A 5LWPA 5E6CA 2OAXA 2EBLA 5G46A 2QA6A 4UDCA 4POHA 4QK4A 5EHJA 3R29A 5CC0A 5HCVA 2C7AA 1T73A 4OLNA 5DWLA 3A2HA 1XQ3A 2P7ZA 3E7CA 3E00D 2ZNPA 4F9MA 1Y0XX 3GWXA 4OH6A 4P6WA 4POJA 4RZFA 1LV3A 3G9JA 1K74D 1IE8A 2PIPL 2E2RA 3DCTA 4QE8A 2V0VA 2P1TA 4TV1A 2IHQA 4L96A 4Q0AC 3CTBA 5EGVA 3WT5A 5CC1A 3K8SA 5DWJA 1ZUCA 2YJDA 4PVUA 5DWIA 3FEIA 3JZCA 4RAKA 5DXPA 2ZXZA 4DM6A 5EMCA 3JZBA 1HCPA 4Q13A 1NAVA 4REFA 4APUA 1U3RA 3NOAA 3G27A 4LNXA 1T7RA 3G8UA 5HJPB 1HRAA 4OKTA 3IMYA 3V49A 2AB2A 3WGPA 1XAPA 4IA3A 4X1GA 5KCWA 2B1ZA 2YLPA 2O4JA 2VV3A 1KB4A 4OV7A 4MGAA 3G8IA 4TUZA 1OSHA 3G9MA 4WPFA 5A86A 3U9QA 4A2JA 1R20D 1T5ZA 1X76A 4OKBA 3W0AA 1YMTA 2VV2A 2VSTA 3OSAA 5DKEA 1UPWA 4YNKA 3P88A 5FQTA 2JFAB 3F5CB 3FURA 4CN5A 2GP7A 2Q61A 4OZRE 5HYRA 3H0AD 4XT9A 5DMFA 5KR9A 5KCFA 5DXKA 1XQCA 4PP5A 3SZ1A 2XKWA 3L03A 2P1UA 4OZRU 2ZK4A 3A3ZX 5L0MA 2ZK0A 1RDTA 1YP0A 1QKTA 5DV8A 3FC6B 4X1FA 1R1KA 3E94A 4RFWA 2GTKA 3KMRA 2YHDA 3OZJA 4IW6A 4ZN7A 5M96A 3DFXA 5EI1A 3WT7A 5DVCA 2Q7JA 3N00A 4IV4A 3D24A 4LBDA 5EITA 2ENVA 3MNEA 1GWQA 4MG8A 5DY8A 4OZTE 4UDBA 3GATA 3R8AA 2OCFA 3ERDA 3B0WA 4PLDA 3A9EA 5DXQA 1R0NA 4M8HA 2HBHA 5DUHA 3R8DA 1HG4A 4OZTU 3FALA 1NUOA 1UOMA 1YY4A 1ZDTA 3CQVA 4G1YA 4ZNVA 2FAIA 4CI5A 1N46A 1CITA 4WLBA 4IV2A 2R6YA 1T74A 3CBBA 5DZ1A 4FHHA 4DORA 1GNFA 1XDKB 3OS9A 5CBYA 2QW4A 3D57A 1XNXA 2A3IA 5AWJA 2ZKCA 4MGBB 3GBKA 1Z95A 4PP3A 5F9BA 2YLQA 3B3KA 1FM9D 2AA6A 1T79A 3VRVA 5E1CA 3L1BA 3Q95B 3B67A 4G2HA 4PWLA 3V3EA 1HLZA 4JL4A 2ABIA 1RKHA 4HN6A 1DSZB 2A66A 2P4YA 1EREA 4RUPA 3FUGA 2NXXE 1YUCA 2GPOA 2ZMIA 3QT0A 4G20A 4PPSA 3W0JA 2GWXA 5C4TA 2ZNNA 2GATA 1XLSA 3CWDA 1OVLA 1XP9A 1ZH7A 3TY0A 3VT8A 4EMAA 4L98A 5EMQA 3DR1A 5DXGA 5B41A 2Q1HA 3IPSA 4KZMA 3VRUA 2I4JA 3B0QA 1S9PA 3B0RA 3ET0A 4M8EA 5KRIA 4JYGA 1HCQA 3GWSX 4RWVA 2P1VA 5DIGA 2Q6SA 3W5PA 2VV4A 2P7AA 1P93A 2YFEA 1GDCA 4MG9B 3G99A 4TNTA 2FSZA 4R06A 3L0EA 3OS8C 3VI8A 3UUDB 4OFUA 3K6PA 5E6AA 2QZOA 4OEZA 1X7RA 2AMAA 4IVYA 2NPAA 3KPZA 1G2NA 4MDDA 3CS4A 5DUEA 5GIEA 1XVPA 3VJTA 2Q7IA 1DKFB 3W0IA 1GS4A 5DUGA 3WMHA 4OARA 4QE6A 1I37A 3DFVC 1YA3A 2QGWA 2ACLA 2GPUA 4OJ4A 4CI4A 5DZ3A 1EXAA 1QKNA 1NQ0A 1U9EA 2IOGA 5DV3A 3X36A 4IQRA 5AWKA 5KCCA 4MGDA 5DX3B 3E00A 2Q59A 3B65A 3G9IA 3OS8A 5EC9A 5DXBA 2J4AA 2P15A 3EYBA 1R0OA 1K74A 2HAMA 3ADWA 3G0WA 4IUIA 1PQCA 3X1IA 2PJLA 5KYJA 2AX9A 2P7GA 2JJ3A 1RJKA 3L0JA 3V3QA 3WWRA 2M9WA 5AZTA 1NQ7A 3GN8A 3VSOA 1M13A 2OVMA 3B0TA 3W0YA 1XPCA 2HVCA 1ZGYA 3HQ5A 3UUAA 4DK7A 5G42A 4ZN9A 4XUMA 2G44A 4E2JA 5KRHA 3OKIA 3CJWA 4N5GA 2PIRA 1M2ZA 3CDPA 3KWYA 2OVHA 4Y29A 3G8OA 4JYHA 1BSXA 1I7GA 2LBDA 4OIUA 1X78A 1SR7A 5DI7A 5AYGA 3VHWA 5DIDA 4DOSA 3ET1A 1FM6D 2AXAA 1I38A 1XP1A 1S0XA 5DV6A 4OIVA 4J5WC 4E4KA 1I7IA 5IAWA 4ONDA 1ERRA 2Z4JA 4OGHA 4OLMA 2R40D 3CLDA 3AN4A 5G44A 5SYZA 2ZXNA 2OM9A 3RUTA 1PDUA 3ZRBA 1M7WA 2VUSI 1XNNA 2VV1B 3P0UA 4ZJWA 5KD9A 5CBZA 2NW4A 7GATA 2YLOA 2ZFXA 3L3XA 1N83A 4HEEX 4IS8A 5E15A 2AX8A 5AZVA 5HZCA 3DZUA 3G8XA 3GZ9A 4N1YA 2YJAB 3KBAA 3VT5A 3UVVA 2BJ4B 1UHLA 3W5RA 4G2IA 2G5OA 4B7WA 2J7YA 2HANA 1P8DA 1TFCA 1XIUA 3BC5A 1E3KA 3OMQA 4OK1A 1Q4XA 1T63A 4QL8A 3HODA 1A28A 4MG7B 4RUJA 1KV6A 3UU7A 4E4QA 1R4RA 3DY6A 1XOWA 4IWFA 2Q6RA 4J5WA 3LMPA 5L7EA 3ERTA 3VT6A 4HC9A 3BQDA 2ZNOA 2Q7KA 2I4PA 3PO9A 3FS1A 2KAEA 1R4OA 4DM8A 4RMDA 1K4WA 2G0GA 4ITFA 4QJRA 5G45A 3VRWA 3CDSA 1PK5A 2QA8B 3VSPA 3VTCA 2GPPA 5DKSA 3AZ1A 4IU7A 2ZLCA 1T76A 3A2JA 3KYTA 2XYWA 4ZNHA 5G5WA 3BEJA 4YMQA 3B5RA 2IOKA 4MGDB 3X1HA 4ZNSA 3RUUA 3A78A 4Q50A 1X7EA 4RZGA 5C4SA 4G1DA 1FCZA 1KNUA 2XYJA 1T7TA 3R5MA 3G9PA 4O8FA 2GL8A 3K23A 1ZAFA 4R6SA 1A6YA 5AAVA 5LGAA 3KFCA 5HYKA 4FNEA 5DP0A 2NLLA 3ET3A 5AVIA 2PRGA 1YYEA 3V9TA 3W5TA 3WTQA 1NQ2A 1K7LA 3KMGA 5DZIA 4TV1B 1FM9A 5GATA 4J24A 3RLLA 3UP3A 2ZY0A 4S0SA 3G6UA 5CJ6A 1BY4A 4HN5A 4KZIA 1LV2A 3CS8A 1T7MA 4JAZA 5GICA 3NSQA 2ZXMA 1X7BA 1QKUA 1RDTD 1TXIA 2AA5A 2POBA 2Q6JA 3H52A 3P89A 1S0ZA 4LSJA 5C4OA 1GWXA 1YJEA 3A2IA 1R1KD 1KKQA 3IXPD 1YNWA 3VRTA 4K6IA 4G1ZA 5JJMA 3UP0A 1NDEA 4FGYA 3G6QA 1XP6A 2QGTA 3DCUA 4NY9A 1MZNA 2DS5A 3R8IA 1MVCA 4XTAA 3OLFA 3AX8A 1PCGA 4IVWA 4XUHA 4MGAB 2XYXA 3AN3A 3IA6A 3ZQTA 4TUZB 5ICKA 5KRKA 4AA6A 1GATA 1PQ6A 4OKXA 2QABA 5L7GA 5E69A 3S9SA 2VUUI 1N4HA 4ZO1X 3KMZA 3WT6A 3WJ5A 4P6XA 5E6DA 3HC5A 4JYIA 5DRMA 1NAXA 1A52A 5IZ0A 4PP6A 3K22A 2PIXA 2Q5SA 3AUNA 2Q5PA 4RMEA 3P8XA 5DKBA 4ZJRA 5E6BA 5E0WA 1Y9RA 3G6TA 1GAUA 5DXEA 3O1EA 4HC7A 2G0HA 1NQ1A 4ZO1B 4N8RA 1G50A 2PKLA 4ZNWA 4RMCA 2PIOA 1PRGA 2REWA 3OKHA 4ZNUA 5HJPA 5FQPA 4BCRA 2DS8A 2ZVTA 4REEA 4NB6A 4OEAA 3B1MA 3DZYA 5FQRA 4LTWA 3OMPA 2QNVA 4WQPA 1DB1A 1VJBA 4IA2A 4MG8B 4XHDA 3GYTA 4MG6A 3WJ4A 5E14A 1R6GA 2VV0A 4ONIA 5DYDA 3A9EB 1R0NB 4OJBA 4NUFA 5GT4A 1NRLA 2QXMA 2VSRA 3AFRA 4S0TA 3FALB 4RZEA 1Y0SA 3CS6A 2YATA 5DWEA 5DIEA 1L2IA 3MNPA 4FHIA 3V9YA 6GATA 2ZBSA 3OOFA 2AYRA 2PIVA 2HB7A 2H79A 3AURA 3F5CA 5AK2A 2Q8SA 4UDAA 1E3GA 5APHA 1GLUA 3VEKC 4JGVA 4OORA 2AA7A 1S19A 3LBDA 3HM1A 5JY3A 5KRAA 3ILZA 3VTBA
chains in the Genus database with same CATH topology
2AO6A 5DVSA 3IPQA 5DMCA 3GYUA 3OMKA 2QSEA 1FM6A 1YIMA 3HO0A 1ILGA 4CN2C 3OGTA 1XLSE 3V9VA 4DMAA 4WVDA 2HC4A 2R6WA 3TKMA 3GD2A 4WHFA 3A40X 2R40A 3D90A 5ACCA 2QMVA 3OZ0A 3M7RA 2W8YA 1ZKYA 2HWQA 4CN3D 3OSIA 5G3JA 3RVFA 1EXXA 1YINA 5AAUA 2ZK1A 4PF3A 1OVLB 2YLYA 1T7FA 2AX7A 4ITEA 2QPYA 3ADTA 5DLRA 1XV9A 3RY9A 4MGCA 5L11A 2B50A 3PCUA 4FN9A 1R20A 3OLSA 3HC6A 2AX6A 2Q7LA 2QH6A 1RGDA 4RE8A 2QE4A 2AAXA 4N73A 2VUTI 3W0GA 3TX7B 1SKXA 3VTDA 1YOWA 4A4WA 5I4VA 2VV4B 3H0AA 2HFPA 1H9UA 1XDKA 3FLIA 3TKCA 1ILHA 3G9EA 4XAOA 5DZ0A 5ETHA 5G43A 5KCEA 2ZK2A 5EMPA 3SP6A 3VJHA 3W5QA 5B5BA 4MGBA 2ZMHA 3OSWA 2QZOB 2AWHA 2ZK6A 3VT4A 3NSPA 1RXRA 3L3ZA 2ZK3A 3Q95A 1XVPB 2OZ7A 1LATA 5GIDA 4A4VA 5KROA 1DSZA 1HJ1A 5C4UA 3V4AA 1X7JA 4OHAA 4IA7A 4ZOMA 3PLZA 4OJ9A 2ACLB 2AMBA 5DU5A 2PIUA 3AZ2A 2PIWA 2POGA 4OEYA 4YT1A 1FCXA 3W0HA 5L7HA 1ZDUA 2QR9A 1OT7A 3ADXA 2Q59B 3O1DA 4G21A 4J26A 2NXXA 5KRLA 1R0OB 2Q5GA 5DXBB 5E7VA 5KYAA 3RLJA 1GA5A 2BAWA 5K13A 3D5FA 1KB6A 1QKMA 1RK3A 4XI3A 4UDDA 3DZUD 3L0LA 5APKA 3WFFA 5DL4A 3UUCA 2Q1VA 2B1VA 3ZR7A 5H1EA 2ZMJA 4PRGA 3VJSA 2O4RA 4MG9A 5KCUA 2QXSA 3R5NA 1IE9A 2ATHA 2I0JA 3UUDA 3ADVA 4IW8A 5E19A 2PINA 3VHUA 3G6RA 1MV9A 3OAPA 4WHGA 3ADUA 3UUAB 5CBXA 3IXPA 3F7DA 2F4BA 5DWGA 1FD0A 3HZFA 4IWCA 2I4ZA 1Z5XE 2J14A 1DKFA 4DK8A 2P54A 2QTUA 2XHSA 4OH5A 3OLLA 3VT9A 1Z5XU 5KRCA 1PQ9A 2GPVA 4OC7A 2Q60A 4LNWA 4ZNTA 3D6DA 1U3QA 2FF0A 1R5KA 1XV9B 4XLDA 4K7AA 1GWRA 3OOKA 2I0GA 5DX3A 3SP9A 3VN2A 4S14A 3ET2A 1SQNA 3AUQA 2PITA 2EWPA 4DQMA 4NQAB 3G9OA 1NYXA 1PZLA 3UVVB 4EM9A 1UHLB 3FEJA 2HANB 2ZNQA 2OUZA 4RUOX 2HCDA 3UU7B 1FBYA 2ZASA 4PXMA 3X31A 5EJVA 3VJIA 2H77A 5AVLA 3W0CA 4NIEA 2HARA 1LBDA 3VT3A 3G97A 1SJ0A 4HCAA 5FQSA 2Q70A 2B23A 3PRGA 3R2AA 1U3SA 1LO1A 2HWRA 3HLVA 4CN7A 2ZLAA 2J7XA 5DXRA 4ZI1A 4QM0A 3M9EA 5DK9A 3HVLA 3WFGA 5HJSA 4J5XC 4K4JA 2JF9A 1UPVA 5KCTA 2V7CA 2ZL9A 4OILA 1ZEOA 5KCDA 3G6PA 3B68A 5E0XA 5IXKA 5KRFA 2PIQA 3AZ3A 3PEQA 3OMMA 1R4IA 1OSVA 1L2JA 3ADSA 1RKGA 2O9IA 2VV1A 2NV7A 4OKWA 1T65A 2GDAA 4GATA 1G5YA 4PPPA 4S15A 5DTVA 5FQVA 3VHVA 5APJA 2Q3YA 1WM0X 4MG5A 5AAVB 4OEDA 2NLLB 4KZJA 2BJ4A 1G1UA 3FXVA 2ZK5A 5DRJA 5DVVA 3B66A 1XZXX 2JFAA 5DKGA 3MNOA 3KDUA 4MG7A 3OMOA 5DYBA 1S9QA 2PNUA 3DT3A 2AM9A 4HLWA 3KDTA 4J5XA 5DZHA 5KRMA 2AA2A 1NHZA 2GIUA 4OFRA 1XJ7A 4PLEA 4TMAI 1FCYA 3VT7A 3FC6A 5DXMA 5JI0D 4CN3A 1YNWB 2QA8A 1YOKA 3T03A 2HASA 4CSJA 3ZRAA 3PBAA 5JJMB 2HB8A 3IPUA 3DZYD 2Z4BA 3FYLA 1KB2A 1XB7A 4YPQA 3VD6C 2FVJA 4R2UA 5KRBB 5KRJA 5DSHA 4IA1A 5LWPA 5E6CA 2OAXA 2EBLA 5G46A 2QA6A 4UDCA 4POHA 4QK4A 5EHJA 3R29A 5CC0A 5HCVA 2C7AA 1T73A 4OLNA 5DWLA 3A2HA 1XQ3A 2P7ZA 3E7CA 3E00D 2ZNPA 4F9MA 1Y0XX 3GWXA 4OH6A 4P6WA 4POJA 4RZFA 1LV3A 3G9JA 1K74D 1IE8A 2PIPL 2E2RA 3DCTA 4QE8A 2V0VA 2P1TA 4TV1A 2IHQA 4L96A 4Q0AC 3CTBA 5EGVA 3WT5A 5CC1A 3K8SA 5DWJA 1ZUCA 2YJDA 4PVUA 5DWIA 3FEIA 3JZCA 4RAKA 5DXPA 2ZXZA 4DM6A 5EMCA 3JZBA 1HCPA 4Q13A 1NAVA 4REFA 4APUA 1U3RA 3NOAA 4LNXA 1T7RA 3G8UA 5HJPB 1HRAA 4OKTA 3IMYA 3V49A 2AB2A 3WGPA 1XAPA 4IA3A 4X1GA 5KCWA 2B1ZA 2YLPA 2O4JA 2VV3A 1KB4A 4OV7A 4MGAA 3G8IA 4TUZA 1OSHA 3G9MA 4WPFA 5A86A 3U9QA 4A2JA 1R20D 1T5ZA 1X76A 4OKBA 3W0AA 1YMTA 2VV2A 2VSTA 3OSAA 5DKEA 1UPWA 4YNKA 3P88A 5FQTA 2JFAB 3F5CB 3FURA 4CN5A 2GP7A 2Q61A 4OZRE 5HYRA 3H0AD 4XT9A 5DMFA 5KR9A 5KCFA 5DXKA 1XQCA 4PP5A 3SZ1A 2XKWA 3L03A 2P1UA 4OZRU 2ZK4A 3A3ZX 5L0MA 2ZK0A 1RDTA 1YP0A 1QKTA 5DV8A 3FC6B 4X1FA 1R1KA 3E94A 4RFWA 2GTKA 3KMRA 2YHDA 3OZJA 4IW6A 4ZN7A 5M96A 3DFXA 5EI1A 3WT7A 5DVCA 2Q7JA 3N00A 4IV4A 3D24A 4LBDA 5EITA 2ENVA 3MNEA 1GWQA 4MG8A 5DY8A 4OZTE 4UDBA 3GATA 3R8AA 2OCFA 3ERDA 3B0WA 4PLDA 3A9EA 5DXQA 1R0NA 4M8HA 2HBHA 5DUHA 3R8DA 1HG4A 4OZTU 3FALA 1NUOA 1UOMA 1YY4A 1ZDTA 3CQVA 4G1YA 4ZNVA 2FAIA 4CI5A 1N46A 1CITA 4WLBA 4IV2A 2R6YA 1T74A 3CBBA 5DZ1A 4FHHA 4DORA 1GNFA 1XDKB 3OS9A 5CBYA 2QW4A 3D57A 1XNXA 2A3IA 5AWJA 2ZKCA 4MGBB 3GBKA 1Z95A 4PP3A 5F9BA 2YLQA 3B3KA 1FM9D 2AA6A 1T79A 3VRVA 5E1CA 3L1BA 3Q95B 3B67A 4G2HA 4PWLA 3V3EA 1HLZA 4JL4A 2ABIA 1RKHA 4HN6A 1DSZB 2A66A 2P4YA 1EREA 4RUPA 3FUGA 2NXXE 1YUCA 2GPOA 2ZMIA 3QT0A 4G20A 4PPSA 3W0JA 2GWXA 5C4TA 2ZNNA 2GATA 1XLSA 3CWDA 1OVLA 1XP9A 1ZH7A 3TY0A 3VT8A 4EMAA 4L98A 5EMQA 3DR1A 5DXGA 5B41A 2Q1HA 3IPSA 4KZMA 3VRUA 2I4JA 3B0QA 1S9PA 3B0RA 3ET0A 4M8EA 5KRIA 4JYGA 1HCQA 3GWSX 4RWVA 2P1VA 5DIGA 2Q6SA 3W5PA 2VV4A 2P7AA 1P93A 2YFEA 1GDCA 4MG9B 3G99A 4TNTA 2FSZA 4R06A 3L0EA 3OS8C 3VI8A 3UUDB 4OFUA 3K6PA 5E6AA 2QZOA 4OEZA 1X7RA 2AMAA 4IVYA 2NPAA 3KPZA 1G2NA 4MDDA 3CS4A 5DUEA 5GIEA 1XVPA 3VJTA 2Q7IA 1DKFB 3W0IA 1GS4A 5DUGA 3WMHA 4OARA 4QE6A 1I37A 3DFVC 1YA3A 2QGWA 2ACLA 2GPUA 4OJ4A 4CI4A 5DZ3A 1EXAA 1QKNA 1NQ0A 1U9EA 2IOGA 5DV3A 3X36A 4IQRA 5AWKA 5KCCA 4MGDA 5DX3B 3E00A 2Q59A 3B65A 3G9IA 3OS8A 5EC9A 5DXBA 2J4AA 2P15A 3EYBA 1R0OA 1K74A 2HAMA 3ADWA 3G0WA 4IUIA 1PQCA 3X1IA 2PJLA 5KYJA 2AX9A 2P7GA 2JJ3A 1RJKA 3L0JA 3V3QA 3WWRA 2M9WA 5AZTA 1NQ7A 3GN8A 3VSOA 1M13A 2OVMA 3B0TA 3W0YA 1XPCA 2HVCA 1ZGYA 3HQ5A 3UUAA 4DK7A 5G42A 4ZN9A 4XUMA 2G44A 4E2JA 5KRHA 3OKIA 3CJWA 4N5GA 2PIRA 1M2ZA 3CDPA 3KWYA 2OVHA 4Y29A 3G8OA 4JYHA 1BSXA 1I7GA 2LBDA 4OIUA 1X78A 1SR7A 5DI7A 5AYGA 3VHWA 5DIDA 4DOSA 3ET1A 1FM6D 2AXAA 1I38A 1XP1A 1S0XA 5DV6A 4OIVA 4J5WC 4E4KA 1I7IA 5IAWA 4ONDA 1ERRA 2Z4JA 4OGHA 4OLMA 2R40D 3CLDA 3AN4A 5G44A 5SYZA 2ZXNA 2OM9A 3RUTA 1PDUA 3ZRBA 1M7WA 2VUSI 1XNNA 2VV1B 3P0UA 4ZJWA 5KD9A 5CBZA 2NW4A 7GATA 2YLOA 2ZFXA 3L3XA 1N83A 4HEEX 4IS8A 5E15A 2AX8A 5AZVA 5HZCA 3DZUA 3G8XA 3GZ9A 4N1YA 2YJAB 3KBAA 3VT5A 3UVVA 2BJ4B 1UHLA 3W5RA 4G2IA 2G5OA 4B7WA 2J7YA 2HANA 1P8DA 1TFCA 1XIUA 3BC5A 1E3KA 3OMQA 4OK1A 1Q4XA 1T63A 4QL8A 3HODA 1A28A 4MG7B 4RUJA 1KV6A 3UU7A 4E4QA 1R4RA 3DY6A 1XOWA 4IWFA 2Q6RA 4J5WA 3LMPA 5L7EA 3ERTA 3VT6A 4HC9A 3BQDA 2ZNOA 2Q7KA 2I4PA 3PO9A 3FS1A 2KAEA 1R4OA 4DM8A 4RMDA 1K4WA 2G0GA 4ITFA 4QJRA 5G45A 3VRWA 3CDSA 1PK5A 2QA8B 3VSPA 3VTCA 2GPPA 5DKSA 3AZ1A 4IU7A 2ZLCA 1T76A 3A2JA 3KYTA 2XYWA 4ZNHA 5G5WA 3BEJA 4YMQA 3B5RA 2IOKA 4MGDB 3X1HA 4ZNSA 3RUUA 3A78A 4Q50A 1X7EA 4RZGA 5C4SA 4G1DA 1FCZA 1KNUA 2XYJA 1T7TA 3R5MA 3G9PA 4O8FA 2GL8A 3K23A 1ZAFA 4R6SA 1A6YA 5AAVA 5LGAA 3KFCA 5HYKA 4FNEA 5DP0A 2NLLA 3ET3A 5AVIA 2PRGA 1YYEA 3V9TA 3W5TA 3WTQA 1NQ2A 1K7LA 3KMGA 5DZIA 4TV1B 1FM9A 5GATA 4J24A 3RLLA 3UP3A 2ZY0A 4S0SA 3G6UA 5CJ6A 1BY4A 4HN5A 4KZIA 1LV2A 3CS8A 1T7MA 4JAZA 5GICA 3NSQA 2ZXMA 1X7BA 1QKUA 1RDTD 1TXIA 2AA5A 2POBA 2Q6JA 3H52A 3P89A 1S0ZA 4LSJA 5C4OA 1GWXA 1YJEA 3A2IA 1R1KD 1KKQA 3IXPD 1YNWA 3VRTA 4K6IA 4G1ZA 5JJMA 3UP0A 1NDEA 4FGYA 3G6QA 1XP6A 2QGTA 3DCUA 4NY9A 1MZNA 3R8IA 1MVCA 4XTAA 3OLFA 3AX8A 1PCGA 4IVWA 4XUHA 4MGAB 2XYXA 3AN3A 3IA6A 3ZQTA 4TUZB 5ICKA 5KRKA 4AA6A 1GATA 1PQ6A 4OKXA 2QABA 5L7GA 5E69A 3S9SA 2VUUI 1N4HA 4ZO1X 3KMZA 3WT6A 3WJ5A 4P6XA 5E6DA 3HC5A 4JYIA 5DRMA 1NAXA 1A52A 5IZ0A 4PP6A 3K22A 2PIXA 2Q5SA 3AUNA 2Q5PA 4RMEA 3P8XA 5DKBA 4ZJRA 5E6BA 5E0WA 1Y9RA 3G6TA 1GAUA 5DXEA 3O1EA 4HC7A 2G0HA 1NQ1A 4ZO1B 4N8RA 1G50A 2PKLA 4ZNWA 4RMCA 2PIOA 1PRGA 2REWA 3OKHA 4ZNUA 5HJPA 5FQPA 4BCRA 2ZVTA 4REEA 4NB6A 4OEAA 3B1MA 3DZYA 5FQRA 4LTWA 3OMPA 2QNVA 4WQPA 1DB1A 1VJBA 4IA2A 4MG8B 4XHDA 3GYTA 4MG6A 3WJ4A 5E14A 1R6GA 2VV0A 4ONIA 5DYDA 3A9EB 1R0NB 4OJBA 4NUFA 5GT4A 1NRLA 2QXMA 2VSRA 3AFRA 4S0TA 3FALB 4RZEA 1Y0SA 3CS6A 2YATA 5DWEA 5DIEA 1L2IA 3MNPA 4FHIA 3V9YA 6GATA 2ZBSA 3OOFA 2AYRA 2PIVA 2HB7A 2H79A 3AURA 3F5CA 5AK2A 2Q8SA 4UDAA 1E3GA 5APHA 1GLUA 3VEKC 4JGVA 4OORA 2AA7A 1S19A 3LBDA 3HM1A 5JY3A 5KRAA 3ILZA 3VTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO6 A;  5DVS A;  3IPQ A;  5DMC A;  3GYU A;  3OMK A;  2QSE A;  1FM6 A;  1YIM A;  3HO0 A;  1ILG A;  4CN2 C;  3OGT A;  1XLS E;  3V9V A;  4DMA A;  4WVD A;  2HC4 A;  2R6W A;  3TKM A;  3GD2 A;  4WHF A;  3A40 X;  2R40 A;  3D90 A;  5ACC A;  2QMV A;  3OZ0 A;  3M7R A;  2W8Y A;  1ZKY A;  2HWQ A;  4CN3 D;  3OSI A;  5G3J A;  3RVF A;  1EXX A;  1YIN A;  5AAU A;  2ZK1 A;  4PF3 A;  1OVL B;  2YLY A;  1T7F A;  2AX7 A;  4ITE A;  2QPY A;  3ADT A;  5DLR A;  1XV9 A;  3RY9 A;  4MGC A;  5L11 A;  2B50 A;  3PCU A;  4FN9 A;  1R20 A;  3OLS A;  3HC6 A;  2AX6 A;  2Q7L A;  2QH6 A;  1RGD A;  4RE8 A;  2QE4 A;  2AAX A;  4N73 A;  2VUT I;  3W0G A;  3TX7 B;  1SKX A;  3VTD A;  1YOW A;  4A4W A;  5I4V A;  2VV4 B;  3H0A A;  2HFP A;  1H9U A;  1XDK A;  3FLI A;  3TKC A;  1ILH A;  3G9E A;  4XAO A;  5DZ0 A;  5ETH A;  5G43 A;  5KCE A;  2ZK2 A;  5EMP A;  3SP6 A;  3VJH A;  3W5Q A;  5B5B A;  4MGB A;  2ZMH A;  3OSW A;  2QZO B;  2AWH A;  2ZK6 A;  3VT4 A;  3NSP A;  1RXR A;  3L3Z A;  2ZK3 A;  3Q95 A;  1XVP B;  2OZ7 A;  1LAT A;  5GID A;  4A4V A;  5KRO A;  1DSZ A;  1HJ1 A;  5C4U A;  3V4A A;  1X7J A;  4OHA A;  4IA7 A;  4ZOM A;  3PLZ A;  4OJ9 A;  2ACL B;  2AMB A;  5DU5 A;  2PIU A;  3AZ2 A;  2PIW A;  2POG A;  4OEY A;  4YT1 A;  1FCX A;  3W0H A;  5L7H A;  1ZDU A;  2QR9 A;  1OT7 A;  3ADX A;  2Q59 B;  3O1D A;  4G21 A;  4J26 A;  2NXX A;  5KRL A;  1R0O B;  2Q5G A;  5DXB B;  5E7V A;  5KYA A;  3RLJ A;  1GA5 A;  2BAW A;  5K13 A;  3D5F A;  1KB6 A;  1QKM A;  1RK3 A;  4XI3 A;  4UDD A;  3DZU D;  3L0L A;  5APK A;  3WFF A;  5DL4 A;  3UUC A;  2Q1V A;  2B1V A;  3ZR7 A;  5H1E A;  2ZMJ A;  4PRG A;  3VJS A;  2O4R A;  4MG9 A;  5KCU A;  2QXS A;  3R5N A;  1IE9 A;  2ATH A;  2I0J A;  3UUD A;  3ADV A;  4IW8 A;  5E19 A;  2PIN A;  3VHU A;  3G6R A;  1MV9 A;  3OAP A;  4WHG A;  3ADU A;  3UUA B;  5CBX A;  3IXP A;  3F7D A;  2F4B A;  5DWG A;  1FD0 A;  3HZF A;  4IWC A;  2I4Z A;  1Z5X E;  2J14 A;  1DKF A;  4DK8 A;  2P54 A;  2QTU A;  2XHS A;  4OH5 A;  3OLL A;  3VT9 A;  1Z5X U;  5KRC A;  1PQ9 A;  2GPV A;  4OC7 A;  2Q60 A;  4LNW A;  4ZNT A;  3D6D A;  1U3Q A;  2FF0 A;  1R5K A;  1XV9 B;  4XLD A;  4K7A A;  1GWR A;  3OOK A;  2I0G A;  5DX3 A;  3SP9 A;  3VN2 A;  4S14 A;  3ET2 A;  1SQN A;  3AUQ A;  2PIT A;  2EWP A;  4DQM A;  4NQA B;  3G9O A;  1NYX A;  1PZL A;  3UVV B;  4EM9 A;  1UHL B;  3FEJ A;  2HAN B;  2ZNQ A;  2OUZ A;  4RUO X;  2HCD A;  3UU7 B;  1FBY A;  2ZAS A;  4PXM A;  3X31 A;  5EJV A;  3VJI A;  2H77 A;  5AVL A;  3W0C A;  4NIE A;  2HAR A;  1LBD A;  3VT3 A;  3G97 A;  1SJ0 A;  4HCA A;  5FQS A;  2Q70 A;  2B23 A;  3PRG A;  3R2A A;  1U3S A;  1LO1 A;  2HWR A;  3HLV A;  4CN7 A;  2ZLA A;  2J7X A;  5DXR A;  4ZI1 A;  4QM0 A;  3M9E A;  5DK9 A;  3HVL A;  3WFG A;  5HJS A;  4J5X C;  4K4J A;  2JF9 A;  1UPV A;  5KCT A;  2V7C A;  2ZL9 A;  4OIL A;  1ZEO A;  5KCD A;  3G6P A;  3B68 A;  5E0X A;  5IXK A;  5KRF A;  2PIQ A;  3AZ3 A;  3PEQ A;  3OMM A;  1R4I A;  1OSV A;  1L2J A;  3ADS A;  1RKG A;  2O9I A;  2VV1 A;  2NV7 A;  4OKW A;  1T65 A;  2GDA A;  4GAT A;  1G5Y A;  4PPP A;  4S15 A;  5DTV A;  5FQV A;  3VHV A;  5APJ A;  2Q3Y A;  1WM0 X;  4MG5 A;  5AAV B;  4OED A;  2NLL B;  4KZJ A;  2BJ4 A;  1G1U A;  3FXV A;  2ZK5 A;  5DRJ A;  5DVV A;  3B66 A;  1XZX X;  2JFA A;  5DKG A;  3MNO A;  3KDU A;  4MG7 A;  3OMO A;  5DYB A;  1S9Q A;  2PNU A;  3DT3 A;  2AM9 A;  4HLW A;  3KDT A;  4J5X A;  5DZH A;  5KRM A;  2AA2 A;  1NHZ A;  2GIU A;  4OFR A;  1XJ7 A;  4PLE A;  4TMA I;  1FCY A;  3VT7 A;  3FC6 A;  5DXM A;  5JI0 D;  4CN3 A;  1YNW B;  2QA8 A;  1YOK A;  3T03 A;  2HAS A;  4CSJ A;  3ZRA A;  3PBA A;  5JJM B;  2HB8 A;  3IPU A;  3DZY D;  2Z4B A;  3FYL A;  1KB2 A;  1XB7 A;  4YPQ A;  3VD6 C;  2FVJ A;  4R2U A;  5KRB B;  5KRJ A;  5DSH A;  4IA1 A;  5LWP A;  5E6C A;  2OAX A;  2EBL A;  5G46 A;  2QA6 A;  4UDC A;  4POH A;  4QK4 A;  5EHJ A;  3R29 A;  5CC0 A;  5HCV A;  2C7A A;  1T73 A;  4OLN A;  5DWL A;  3A2H A;  1XQ3 A;  2P7Z A;  3E7C A;  3E00 D;  2ZNP A;  4F9M A;  1Y0X X;  3GWX A;  4OH6 A;  4P6W A;  4POJ A;  4RZF A;  1LV3 A;  3G9J A;  1K74 D;  1IE8 A;  2PIP L;  2E2R A;  3DCT A;  4QE8 A;  2V0V A;  2P1T A;  4TV1 A;  2IHQ A;  4L96 A;  4Q0A C;  3CTB A;  5EGV A;  3WT5 A;  5CC1 A;  3K8S A;  5DWJ A;  1ZUC A;  2YJD A;  4PVU A;  5DWI A;  3FEI A;  3JZC A;  4RAK A;  5DXP A;  2ZXZ A;  4DM6 A;  5EMC A;  3JZB A;  1HCP A;  4Q13 A;  1NAV A;  4REF A;  4APU A;  1U3R A;  3NOA A;  4LNX A;  1T7R A;  3G8U A;  5HJP B;  1HRA A;  4OKT A;  3IMY A;  3V49 A;  2AB2 A;  3WGP A;  1XAP A;  4IA3 A;  4X1G A;  5KCW A;  2B1Z A;  2YLP A;  2O4J A;  2VV3 A;  1KB4 A;  4OV7 A;  4MGA A;  3G8I A;  4TUZ A;  1OSH A;  3G9M A;  4WPF A;  5A86 A;  3U9Q A;  4A2J A;  1R20 D;  1T5Z A;  1X76 A;  4OKB A;  3W0A A;  1YMT A;  2VV2 A;  2VST A;  3OSA A;  5DKE A;  1UPW A;  4YNK A;  3P88 A;  5FQT A;  2JFA B;  3F5C B;  3FUR A;  4CN5 A;  2GP7 A;  2Q61 A;  4OZR E;  5HYR A;  3H0A D;  4XT9 A;  5DMF A;  5KR9 A;  5KCF A;  5DXK A;  1XQC A;  4PP5 A;  3SZ1 A;  2XKW A;  3L03 A;  2P1U A;  4OZR U;  2ZK4 A;  3A3Z X;  5L0M A;  2ZK0 A;  1RDT A;  1YP0 A;  1QKT A;  5DV8 A;  3FC6 B;  4X1F A;  1R1K A;  3E94 A;  4RFW A;  2GTK A;  3KMR A;  2YHD A;  3OZJ A;  4IW6 A;  4ZN7 A;  5M96 A;  3DFX A;  5EI1 A;  3WT7 A;  5DVC A;  2Q7J A;  3N00 A;  4IV4 A;  3D24 A;  4LBD A;  5EIT A;  2ENV A;  3MNE A;  1GWQ A;  4MG8 A;  5DY8 A;  4OZT E;  4UDB A;  3GAT A;  3R8A A;  2OCF A;  3ERD A;  3B0W A;  4PLD A;  3A9E A;  5DXQ A;  1R0N A;  4M8H A;  2HBH A;  5DUH A;  3R8D A;  1HG4 A;  4OZT U;  3FAL A;  1NUO A;  1UOM A;  1YY4 A;  1ZDT A;  3CQV A;  4G1Y A;  4ZNV A;  2FAI A;  4CI5 A;  1N46 A;  1CIT A;  4WLB A;  4IV2 A;  2R6Y A;  1T74 A;  3CBB A;  5DZ1 A;  4FHH A;  4DOR A;  1GNF A;  1XDK B;  3OS9 A;  5CBY A;  2QW4 A;  3D57 A;  1XNX A;  2A3I A;  5AWJ A;  2ZKC A;  4MGB B;  3GBK A;  1Z95 A;  4PP3 A;  5F9B A;  2YLQ A;  3B3K A;  1FM9 D;  2AA6 A;  1T79 A;  3VRV A;  5E1C A;  3L1B A;  3Q95 B;  3B67 A;  4G2H A;  4PWL A;  3V3E A;  1HLZ A;  4JL4 A;  2ABI A;  1RKH A;  4HN6 A;  1DSZ B;  2A66 A;  2P4Y A;  1ERE A;  4RUP A;  3FUG A;  2NXX E;  1YUC A;  2GPO A;  2ZMI A;  3QT0 A;  4G20 A;  4PPS A;  3W0J A;  2GWX A;  5C4T A;  2ZNN A;  2GAT A;  1XLS A;  3CWD A;  1OVL A;  1XP9 A;  1ZH7 A;  3TY0 A;  3VT8 A;  4EMA A;  4L98 A;  5EMQ A;  3DR1 A;  5DXG A;  5B41 A;  2Q1H A;  3IPS A;  4KZM A;  3VRU A;  2I4J A;  3B0Q A;  1S9P A;  3B0R A;  3ET0 A;  4M8E A;  5KRI A;  4JYG A;  1HCQ A;  3GWS X;  4RWV A;  2P1V A;  5DIG A;  2Q6S A;  3W5P A;  2VV4 A;  2P7A A;  1P93 A;  2YFE A;  1GDC A;  4MG9 B;  3G99 A;  4TNT A;  2FSZ A;  4R06 A;  3L0E A;  3OS8 C;  3VI8 A;  3UUD B;  4OFU A;  3K6P A;  5E6A A;  2QZO A;  4OEZ A;  1X7R A;  2AMA A;  4IVY A;  2NPA A;  3KPZ A;  1G2N A;  4MDD A;  3CS4 A;  5DUE A;  5GIE A;  1XVP A;  3VJT A;  2Q7I A;  1DKF B;  3W0I A;  1GS4 A;  5DUG A;  3WMH A;  4OAR A;  4QE6 A;  1I37 A;  3DFV C;  1YA3 A;  2QGW A;  2ACL A;  2GPU A;  4OJ4 A;  4CI4 A;  5DZ3 A;  1EXA A;  1QKN A;  1NQ0 A;  1U9E A;  2IOG A;  5DV3 A;  3X36 A;  4IQR A;  5AWK A;  5KCC A;  4MGD A;  5DX3 B;  3E00 A;  2Q59 A;  3B65 A;  3G9I A;  3OS8 A;  5EC9 A;  5DXB A;  2J4A A;  2P15 A;  3EYB A;  1R0O A;  1K74 A;  2HAM A;  3ADW A;  3G0W A;  4IUI A;  1PQC A;  3X1I A;  2PJL A;  5KYJ A;  2AX9 A;  2P7G A;  2JJ3 A;  1RJK A;  3L0J A;  3V3Q A;  3WWR A;  2M9W A;  5AZT A;  1NQ7 A;  3GN8 A;  3VSO A;  1M13 A;  2OVM A;  3B0T A;  3W0Y A;  1XPC A;  2HVC A;  1ZGY A;  3HQ5 A;  3UUA A;  4DK7 A;  5G42 A;  4ZN9 A;  4XUM A;  2G44 A;  4E2J A;  5KRH A;  3OKI A;  3CJW A;  4N5G A;  2PIR A;  1M2Z A;  3CDP A;  3KWY A;  2OVH A;  4Y29 A;  3G8O A;  4JYH A;  1BSX A;  1I7G A;  2LBD A;  4OIU A;  1X78 A;  1SR7 A;  5DI7 A;  5AYG A;  3VHW A;  5DID A;  4DOS A;  3ET1 A;  1FM6 D;  2AXA A;  1I38 A;  1XP1 A;  1S0X A;  5DV6 A;  4OIV A;  4J5W C;  4E4K A;  1I7I A;  5IAW A;  4OND A;  1ERR A;  2Z4J A;  4OGH A;  4OLM A;  2R40 D;  3CLD A;  3AN4 A;  5G44 A;  5SYZ A;  2ZXN A;  2OM9 A;  3RUT A;  1PDU A;  3ZRB A;  1M7W A;  2VUS I;  1XNN A;  2VV1 B;  3P0U A;  4ZJW A;  5KD9 A;  5CBZ A;  2NW4 A;  7GAT A;  2YLO A;  2ZFX A;  3L3X A;  1N83 A;  4HEE X;  4IS8 A;  5E15 A;  2AX8 A;  5AZV A;  5HZC A;  3DZU A;  3G8X A;  3GZ9 A;  4N1Y A;  2YJA B;  3KBA A;  3VT5 A;  3UVV A;  2BJ4 B;  1UHL A;  3W5R A;  4G2I A;  2G5O A;  4B7W A;  2J7Y A;  2HAN A;  1P8D A;  1TFC A;  1XIU A;  3BC5 A;  1E3K A;  3OMQ A;  4OK1 A;  1Q4X A;  1T63 A;  4QL8 A;  3HOD A;  1A28 A;  4MG7 B;  4RUJ A;  1KV6 A;  3UU7 A;  4E4Q A;  1R4R A;  3DY6 A;  1XOW A;  4IWF A;  2Q6R A;  4J5W A;  3LMP A;  5L7E A;  3ERT A;  3VT6 A;  4HC9 A;  3BQD A;  2ZNO A;  2Q7K A;  2I4P A;  3PO9 A;  3FS1 A;  2KAE A;  1R4O A;  4DM8 A;  4RMD A;  1K4W A;  2G0G A;  4ITF A;  4QJR A;  5G45 A;  3VRW A;  3CDS A;  1PK5 A;  2QA8 B;  3VSP A;  3VTC A;  2GPP A;  5DKS A;  3AZ1 A;  4IU7 A;  2ZLC A;  1T76 A;  3A2J A;  3KYT A;  2XYW A;  4ZNH A;  5G5W A;  3BEJ A;  4YMQ A;  3B5R A;  2IOK A;  4MGD B;  3X1H A;  4ZNS A;  3RUU A;  3A78 A;  4Q50 A;  1X7E A;  4RZG A;  5C4S A;  4G1D A;  1FCZ A;  1KNU A;  2XYJ A;  1T7T A;  3R5M A;  3G9P A;  4O8F A;  2GL8 A;  3K23 A;  1ZAF A;  4R6S A;  1A6Y A;  5AAV A;  5LGA A;  3KFC A;  5HYK A;  4FNE A;  5DP0 A;  2NLL A;  3ET3 A;  5AVI A;  2PRG A;  1YYE A;  3V9T A;  3W5T A;  3WTQ A;  1NQ2 A;  1K7L A;  3KMG A;  5DZI A;  4TV1 B;  1FM9 A;  5GAT A;  4J24 A;  3RLL A;  3UP3 A;  2ZY0 A;  4S0S A;  3G6U A;  5CJ6 A;  1BY4 A;  4HN5 A;  4KZI A;  1LV2 A;  3CS8 A;  1T7M A;  4JAZ A;  5GIC A;  3NSQ A;  2ZXM A;  1X7B A;  1QKU A;  1RDT D;  1TXI A;  2AA5 A;  2POB A;  2Q6J A;  3H52 A;  3P89 A;  1S0Z A;  4LSJ A;  5C4O A;  1GWX A;  1YJE A;  3A2I A;  1R1K D;  1KKQ A;  3IXP D;  1YNW A;  3VRT A;  4K6I A;  4G1Z A;  5JJM A;  3UP0 A;  1NDE A;  4FGY A;  3G6Q A;  1XP6 A;  2QGT A;  3DCU A;  4NY9 A;  1MZN A;  3R8I A;  1MVC A;  4XTA A;  3OLF A;  3AX8 A;  1PCG A;  4IVW A;  4XUH A;  4MGA B;  2XYX A;  3AN3 A;  3IA6 A;  3ZQT A;  4TUZ B;  5ICK A;  5KRK A;  4AA6 A;  1GAT A;  1PQ6 A;  4OKX A;  2QAB A;  5L7G A;  5E69 A;  3S9S A;  2VUU I;  1N4H A;  4ZO1 X;  3KMZ A;  3WT6 A;  3WJ5 A;  4P6X A;  5E6D A;  3HC5 A;  4JYI A;  5DRM A;  1NAX A;  1A52 A;  5IZ0 A;  4PP6 A;  3K22 A;  2PIX A;  2Q5S A;  3AUN A;  2Q5P A;  4RME A;  3P8X A;  5DKB A;  4ZJR A;  5E6B A;  5E0W A;  1Y9R A;  3G6T A;  1GAU A;  5DXE A;  3O1E A;  4HC7 A;  2G0H A;  1NQ1 A;  4ZO1 B;  4N8R A;  1G50 A;  2PKL A;  4ZNW A;  4RMC A;  2PIO A;  1PRG A;  2REW A;  3OKH A;  4ZNU A;  5HJP A;  5FQP A;  4BCR A;  2ZVT A;  4REE A;  4NB6 A;  4OEA A;  3B1M A;  3DZY A;  5FQR A;  4LTW A;  3OMP A;  2QNV A;  4WQP A;  1DB1 A;  1VJB A;  4IA2 A;  4MG8 B;  4XHD A;  3GYT A;  4MG6 A;  3WJ4 A;  5E14 A;  1R6G A;  2VV0 A;  4ONI A;  5DYD A;  3A9E B;  1R0N B;  4OJB A;  4NUF A;  5GT4 A;  1NRL A;  2QXM A;  2VSR A;  3AFR A;  4S0T A;  3FAL B;  4RZE A;  1Y0S A;  3CS6 A;  2YAT A;  5DWE A;  5DIE A;  1L2I A;  3MNP A;  4FHI A;  3V9Y A;  6GAT A;  2ZBS A;  3OOF A;  2AYR A;  2PIV A;  2HB7 A;  2H79 A;  3AUR A;  3F5C A;  5AK2 A;  2Q8S A;  4UDA A;  1E3G A;  5APH A;  1GLU A;  3VEK C;  4JGV A;  4OOR A;  2AA7 A;  1S19 A;  3LBD A;  3HM1 A;  5JY3 A;  5KRA A;  3ILZ A;  3VTB A; 
#chains in the Genus database with same CATH topology
 2AO6 A;  5DVS A;  3IPQ A;  5DMC A;  3GYU A;  3OMK A;  2QSE A;  1FM6 A;  1YIM A;  3HO0 A;  1ILG A;  4CN2 C;  3OGT A;  1XLS E;  3V9V A;  4DMA A;  4WVD A;  2HC4 A;  2R6W A;  3TKM A;  3GD2 A;  4WHF A;  3A40 X;  2R40 A;  3D90 A;  5ACC A;  2QMV A;  3OZ0 A;  3M7R A;  2W8Y A;  1ZKY A;  2HWQ A;  4CN3 D;  3OSI A;  5G3J A;  3RVF A;  1EXX A;  1YIN A;  5AAU A;  2ZK1 A;  4PF3 A;  1OVL B;  2YLY A;  1T7F A;  2AX7 A;  4ITE A;  2QPY A;  3ADT A;  5DLR A;  1XV9 A;  3RY9 A;  4MGC A;  5L11 A;  2B50 A;  3PCU A;  4FN9 A;  1R20 A;  3OLS A;  3HC6 A;  2AX6 A;  2Q7L A;  2QH6 A;  1RGD A;  4RE8 A;  2QE4 A;  2AAX A;  4N73 A;  2VUT I;  3W0G A;  3TX7 B;  1SKX A;  3VTD A;  1YOW A;  4A4W A;  5I4V A;  2VV4 B;  3H0A A;  2HFP A;  1H9U A;  1XDK A;  3FLI A;  3TKC A;  1ILH A;  3G9E A;  4XAO A;  5DZ0 A;  5ETH A;  5G43 A;  5KCE A;  2ZK2 A;  5EMP A;  3SP6 A;  3VJH A;  3W5Q A;  5B5B A;  4MGB A;  2ZMH A;  3OSW A;  2QZO B;  2AWH A;  2ZK6 A;  3VT4 A;  3NSP A;  1RXR A;  3L3Z A;  2ZK3 A;  3Q95 A;  1XVP B;  2OZ7 A;  1LAT A;  5GID A;  4A4V A;  5KRO A;  1DSZ A;  1HJ1 A;  5C4U A;  3V4A A;  1X7J A;  4OHA A;  4IA7 A;  4ZOM A;  3PLZ A;  4OJ9 A;  2ACL B;  2AMB A;  5DU5 A;  2PIU A;  3AZ2 A;  2PIW A;  2POG A;  4OEY A;  4YT1 A;  1FCX A;  3W0H A;  5L7H A;  1ZDU A;  2QR9 A;  1OT7 A;  3ADX A;  2Q59 B;  3O1D A;  4G21 A;  4J26 A;  2NXX A;  5KRL A;  1R0O B;  2Q5G A;  5DXB B;  5E7V A;  5KYA A;  3RLJ A;  1GA5 A;  2BAW A;  5K13 A;  3D5F A;  1KB6 A;  1QKM A;  1RK3 A;  4XI3 A;  4UDD A;  3DZU D;  3L0L A;  5APK A;  3WFF A;  5DL4 A;  3UUC A;  2Q1V A;  2B1V A;  3ZR7 A;  5H1E A;  2ZMJ A;  4PRG A;  3VJS A;  2O4R A;  4MG9 A;  5KCU A;  2QXS A;  3R5N A;  1IE9 A;  2ATH A;  2I0J A;  3UUD A;  3ADV A;  4IW8 A;  5E19 A;  2PIN A;  3VHU A;  3G6R A;  1MV9 A;  3OAP A;  4WHG A;  3ADU A;  3UUA B;  5CBX A;  3IXP A;  3F7D A;  2F4B A;  5DWG A;  1FD0 A;  3HZF A;  4IWC A;  2I4Z A;  1Z5X E;  2J14 A;  1DKF A;  4DK8 A;  2P54 A;  2QTU A;  2XHS A;  4OH5 A;  3OLL A;  3VT9 A;  1Z5X U;  5KRC A;  1PQ9 A;  2GPV A;  4OC7 A;  2Q60 A;  4LNW A;  4ZNT A;  3D6D A;  1U3Q A;  2FF0 A;  1R5K A;  1XV9 B;  4XLD A;  4K7A A;  1GWR A;  3OOK A;  2I0G A;  5DX3 A;  3SP9 A;  3VN2 A;  4S14 A;  3ET2 A;  1SQN A;  3AUQ A;  2PIT A;  2EWP A;  4DQM A;  4NQA B;  3G9O A;  1NYX A;  1PZL A;  3UVV B;  4EM9 A;  1UHL B;  3FEJ A;  2HAN B;  2ZNQ A;  2OUZ A;  4RUO X;  2HCD A;  3UU7 B;  1FBY A;  2ZAS A;  4PXM A;  3X31 A;  5EJV A;  3VJI A;  2H77 A;  5AVL A;  3W0C A;  4NIE A;  2HAR A;  1LBD A;  3VT3 A;  3G97 A;  1SJ0 A;  4HCA A;  5FQS A;  2Q70 A;  2B23 A;  3PRG A;  3R2A A;  2DS6 A;  1U3S A;  1LO1 A;  2HWR A;  3HLV A;  4CN7 A;  2ZLA A;  2J7X A;  5DXR A;  4ZI1 A;  4QM0 A;  3M9E A;  5DK9 A;  3HVL A;  3WFG A;  5HJS A;  4J5X C;  4K4J A;  2JF9 A;  1UPV A;  5KCT A;  2V7C A;  2ZL9 A;  4OIL A;  1ZEO A;  5KCD A;  3G6P A;  3B68 A;  5E0X A;  5IXK A;  5KRF A;  2PIQ A;  3AZ3 A;  3PEQ A;  3OMM A;  1R4I A;  1OSV A;  1L2J A;  3ADS A;  1RKG A;  2O9I A;  2VV1 A;  2NV7 A;  4OKW A;  1T65 A;  2GDA A;  4GAT A;  1G5Y A;  4PPP A;  4S15 A;  5DTV A;  5FQV A;  3VHV A;  5APJ A;  2Q3Y A;  1WM0 X;  4MG5 A;  5AAV B;  4OED A;  2NLL B;  4KZJ A;  2BJ4 A;  1G1U A;  3FXV A;  2ZK5 A;  5DRJ A;  5DVV A;  3B66 A;  1XZX X;  2JFA A;  5DKG A;  3MNO A;  3KDU A;  4MG7 A;  3OMO A;  5DYB A;  1S9Q A;  2PNU A;  3DT3 A;  2AM9 A;  4HLW A;  3KDT A;  4J5X A;  5DZH A;  5KRM A;  2AA2 A;  1NHZ A;  2GIU A;  4OFR A;  1XJ7 A;  4PLE A;  4TMA I;  1FCY A;  3VT7 A;  3FC6 A;  5DXM A;  5JI0 D;  4CN3 A;  1YNW B;  2QA8 A;  1YOK A;  3T03 A;  2HAS A;  4CSJ A;  3ZRA A;  3PBA A;  5JJM B;  2HB8 A;  3IPU A;  3DZY D;  2Z4B A;  3FYL A;  1KB2 A;  1XB7 A;  4YPQ A;  3VD6 C;  2FVJ A;  4R2U A;  5KRB B;  5KRJ A;  5DSH A;  4IA1 A;  5LWP A;  5E6C A;  2OAX A;  2EBL A;  5G46 A;  2QA6 A;  4UDC A;  4POH A;  4QK4 A;  5EHJ A;  3R29 A;  5CC0 A;  5HCV A;  2C7A A;  1T73 A;  4OLN A;  5DWL A;  3A2H A;  1XQ3 A;  2P7Z A;  3E7C A;  3E00 D;  2ZNP A;  4F9M A;  1Y0X X;  3GWX A;  4OH6 A;  4P6W A;  4POJ A;  4RZF A;  1LV3 A;  3G9J A;  1K74 D;  1IE8 A;  2PIP L;  2E2R A;  3DCT A;  4QE8 A;  2V0V A;  2P1T A;  4TV1 A;  2IHQ A;  4L96 A;  4Q0A C;  3CTB A;  5EGV A;  3WT5 A;  5CC1 A;  3K8S A;  5DWJ A;  1ZUC A;  2YJD A;  4PVU A;  5DWI A;  3FEI A;  3JZC A;  4RAK A;  5DXP A;  2ZXZ A;  4DM6 A;  5EMC A;  3JZB A;  1HCP A;  4Q13 A;  1NAV A;  4REF A;  4APU A;  1U3R A;  3NOA A;  3G27 A;  4LNX A;  1T7R A;  3G8U A;  5HJP B;  1HRA A;  4OKT A;  3IMY A;  3V49 A;  2AB2 A;  3WGP A;  1XAP A;  4IA3 A;  4X1G A;  5KCW A;  2B1Z A;  2YLP A;  2O4J A;  2VV3 A;  1KB4 A;  4OV7 A;  4MGA A;  3G8I A;  4TUZ A;  1OSH A;  3G9M A;  4WPF A;  5A86 A;  3U9Q A;  4A2J A;  1R20 D;  1T5Z A;  1X76 A;  4OKB A;  3W0A A;  1YMT A;  2VV2 A;  2VST A;  3OSA A;  5DKE A;  1UPW A;  4YNK A;  3P88 A;  5FQT A;  2JFA B;  3F5C B;  3FUR A;  4CN5 A;  2GP7 A;  2Q61 A;  4OZR E;  5HYR A;  3H0A D;  4XT9 A;  5DMF A;  5KR9 A;  5KCF A;  5DXK A;  1XQC A;  4PP5 A;  3SZ1 A;  2XKW A;  3L03 A;  2P1U A;  4OZR U;  2ZK4 A;  3A3Z X;  5L0M A;  2ZK0 A;  1RDT A;  1YP0 A;  1QKT A;  5DV8 A;  3FC6 B;  4X1F A;  1R1K A;  3E94 A;  4RFW A;  2GTK A;  3KMR A;  2YHD A;  3OZJ A;  4IW6 A;  4ZN7 A;  5M96 A;  3DFX A;  5EI1 A;  3WT7 A;  5DVC A;  2Q7J A;  3N00 A;  4IV4 A;  3D24 A;  4LBD A;  5EIT A;  2ENV A;  3MNE A;  1GWQ A;  4MG8 A;  5DY8 A;  4OZT E;  4UDB A;  3GAT A;  3R8A A;  2OCF A;  3ERD A;  3B0W A;  4PLD A;  3A9E A;  5DXQ A;  1R0N A;  4M8H A;  2HBH A;  5DUH A;  3R8D A;  1HG4 A;  4OZT U;  3FAL A;  1NUO A;  1UOM A;  1YY4 A;  1ZDT A;  3CQV A;  4G1Y A;  4ZNV A;  2FAI A;  4CI5 A;  1N46 A;  1CIT A;  4WLB A;  4IV2 A;  2R6Y A;  1T74 A;  3CBB A;  5DZ1 A;  4FHH A;  4DOR A;  1GNF A;  1XDK B;  3OS9 A;  5CBY A;  2QW4 A;  3D57 A;  1XNX A;  2A3I A;  5AWJ A;  2ZKC A;  4MGB B;  3GBK A;  1Z95 A;  4PP3 A;  5F9B A;  2YLQ A;  3B3K A;  1FM9 D;  2AA6 A;  1T79 A;  3VRV A;  5E1C A;  3L1B A;  3Q95 B;  3B67 A;  4G2H A;  4PWL A;  3V3E A;  1HLZ A;  4JL4 A;  2ABI A;  1RKH A;  4HN6 A;  1DSZ B;  2A66 A;  2P4Y A;  1ERE A;  4RUP A;  3FUG A;  2NXX E;  1YUC A;  2GPO A;  2ZMI A;  3QT0 A;  4G20 A;  4PPS A;  3W0J A;  2GWX A;  5C4T A;  2ZNN A;  2GAT A;  1XLS A;  3CWD A;  1OVL A;  1XP9 A;  1ZH7 A;  3TY0 A;  3VT8 A;  4EMA A;  4L98 A;  5EMQ A;  3DR1 A;  5DXG A;  5B41 A;  2Q1H A;  3IPS A;  4KZM A;  3VRU A;  2I4J A;  3B0Q A;  1S9P A;  3B0R A;  3ET0 A;  4M8E A;  5KRI A;  4JYG A;  1HCQ A;  3GWS X;  4RWV A;  2P1V A;  5DIG A;  2Q6S A;  3W5P A;  2VV4 A;  2P7A A;  1P93 A;  2YFE A;  1GDC A;  4MG9 B;  3G99 A;  4TNT A;  2FSZ A;  4R06 A;  3L0E A;  3OS8 C;  3VI8 A;  3UUD B;  4OFU A;  3K6P A;  5E6A A;  2QZO A;  4OEZ A;  1X7R A;  2AMA A;  4IVY A;  2NPA A;  3KPZ A;  1G2N A;  4MDD A;  3CS4 A;  5DUE A;  5GIE A;  1XVP A;  3VJT A;  2Q7I A;  1DKF B;  3W0I A;  1GS4 A;  5DUG A;  3WMH A;  4OAR A;  4QE6 A;  1I37 A;  3DFV C;  1YA3 A;  2QGW A;  2ACL A;  2GPU A;  4OJ4 A;  4CI4 A;  5DZ3 A;  1EXA A;  1QKN A;  1NQ0 A;  1U9E A;  2IOG A;  5DV3 A;  3X36 A;  4IQR A;  5AWK A;  5KCC A;  4MGD A;  5DX3 B;  3E00 A;  2Q59 A;  3B65 A;  3G9I A;  3OS8 A;  5EC9 A;  5DXB A;  2J4A A;  2P15 A;  3EYB A;  1R0O A;  1K74 A;  2HAM A;  3ADW A;  3G0W A;  4IUI A;  1PQC A;  3X1I A;  2PJL A;  5KYJ A;  2AX9 A;  2P7G A;  2JJ3 A;  1RJK A;  3L0J A;  3V3Q A;  3WWR A;  2M9W A;  5AZT A;  1NQ7 A;  3GN8 A;  3VSO A;  1M13 A;  2OVM A;  3B0T A;  3W0Y A;  1XPC A;  2HVC A;  1ZGY A;  3HQ5 A;  3UUA A;  4DK7 A;  5G42 A;  4ZN9 A;  4XUM A;  2G44 A;  4E2J A;  5KRH A;  3OKI A;  3CJW A;  4N5G A;  2PIR A;  1M2Z A;  3CDP A;  3KWY A;  2OVH A;  4Y29 A;  3G8O A;  4JYH A;  1BSX A;  1I7G A;  2LBD A;  4OIU A;  1X78 A;  1SR7 A;  5DI7 A;  5AYG A;  3VHW A;  5DID A;  4DOS A;  3ET1 A;  1FM6 D;  2AXA A;  1I38 A;  1XP1 A;  1S0X A;  5DV6 A;  4OIV A;  4J5W C;  4E4K A;  1I7I A;  5IAW A;  4OND A;  1ERR A;  2Z4J A;  4OGH A;  4OLM A;  2R40 D;  3CLD A;  3AN4 A;  5G44 A;  5SYZ A;  2ZXN A;  2OM9 A;  3RUT A;  1PDU A;  3ZRB A;  1M7W A;  2VUS I;  1XNN A;  2VV1 B;  3P0U A;  4ZJW A;  5KD9 A;  5CBZ A;  2NW4 A;  7GAT A;  2YLO A;  2ZFX A;  3L3X A;  1N83 A;  4HEE X;  4IS8 A;  5E15 A;  2AX8 A;  5AZV A;  5HZC A;  3DZU A;  3G8X A;  3GZ9 A;  4N1Y A;  2YJA B;  3KBA A;  3VT5 A;  3UVV A;  2BJ4 B;  1UHL A;  3W5R A;  4G2I A;  2G5O A;  4B7W A;  2J7Y A;  2HAN A;  1P8D A;  1TFC A;  1XIU A;  3BC5 A;  1E3K A;  3OMQ A;  4OK1 A;  1Q4X A;  1T63 A;  4QL8 A;  3HOD A;  1A28 A;  4MG7 B;  4RUJ A;  1KV6 A;  3UU7 A;  4E4Q A;  1R4R A;  3DY6 A;  1XOW A;  4IWF A;  2Q6R A;  4J5W A;  3LMP A;  5L7E A;  3ERT A;  3VT6 A;  4HC9 A;  3BQD A;  2ZNO A;  2Q7K A;  2I4P A;  3PO9 A;  3FS1 A;  2KAE A;  1R4O A;  4DM8 A;  4RMD A;  1K4W A;  2G0G A;  4ITF A;  4QJR A;  5G45 A;  3VRW A;  3CDS A;  1PK5 A;  2QA8 B;  3VSP A;  3VTC A;  2GPP A;  5DKS A;  3AZ1 A;  4IU7 A;  2ZLC A;  1T76 A;  3A2J A;  3KYT A;  2XYW A;  4ZNH A;  5G5W A;  3BEJ A;  4YMQ A;  3B5R A;  2IOK A;  4MGD B;  3X1H A;  4ZNS A;  3RUU A;  3A78 A;  4Q50 A;  1X7E A;  4RZG A;  5C4S A;  4G1D A;  1FCZ A;  1KNU A;  2XYJ A;  1T7T A;  3R5M A;  3G9P A;  4O8F A;  2GL8 A;  3K23 A;  1ZAF A;  4R6S A;  1A6Y A;  5AAV A;  5LGA A;  3KFC A;  5HYK A;  4FNE A;  5DP0 A;  2NLL A;  3ET3 A;  5AVI A;  2PRG A;  1YYE A;  3V9T A;  3W5T A;  3WTQ A;  1NQ2 A;  1K7L A;  3KMG A;  5DZI A;  4TV1 B;  1FM9 A;  5GAT A;  4J24 A;  3RLL A;  3UP3 A;  2ZY0 A;  4S0S A;  3G6U A;  5CJ6 A;  1BY4 A;  4HN5 A;  4KZI A;  1LV2 A;  3CS8 A;  1T7M A;  4JAZ A;  5GIC A;  3NSQ A;  2ZXM A;  1X7B A;  1QKU A;  1RDT D;  1TXI A;  2AA5 A;  2POB A;  2Q6J A;  3H52 A;  3P89 A;  1S0Z A;  4LSJ A;  5C4O A;  1GWX A;  1YJE A;  3A2I A;  1R1K D;  1KKQ A;  3IXP D;  1YNW A;  3VRT A;  4K6I A;  4G1Z A;  5JJM A;  3UP0 A;  1NDE A;  4FGY A;  3G6Q A;  1XP6 A;  2QGT A;  3DCU A;  4NY9 A;  1MZN A;  2DS5 A;  3R8I A;  1MVC A;  4XTA A;  3OLF A;  3AX8 A;  1PCG A;  4IVW A;  4XUH A;  4MGA B;  2XYX A;  3AN3 A;  3IA6 A;  3ZQT A;  4TUZ B;  5ICK A;  5KRK A;  4AA6 A;  1GAT A;  1PQ6 A;  4OKX A;  2QAB A;  5L7G A;  5E69 A;  3S9S A;  2VUU I;  1N4H A;  4ZO1 X;  3KMZ A;  3WT6 A;  3WJ5 A;  4P6X A;  5E6D A;  3HC5 A;  4JYI A;  5DRM A;  1NAX A;  1A52 A;  5IZ0 A;  4PP6 A;  3K22 A;  2PIX A;  2Q5S A;  3AUN A;  2Q5P A;  4RME A;  3P8X A;  5DKB A;  4ZJR A;  5E6B A;  5E0W A;  1Y9R A;  3G6T A;  1GAU A;  5DXE A;  3O1E A;  4HC7 A;  2G0H A;  1NQ1 A;  4ZO1 B;  4N8R A;  1G50 A;  2PKL A;  4ZNW A;  4RMC A;  2PIO A;  1PRG A;  2REW A;  3OKH A;  4ZNU A;  5HJP A;  5FQP A;  4BCR A;  2DS8 A;  2ZVT A;  4REE A;  4NB6 A;  4OEA A;  3B1M A;  3DZY A;  5FQR A;  4LTW A;  3OMP A;  2QNV A;  4WQP A;  1DB1 A;  1VJB A;  4IA2 A;  4MG8 B;  4XHD A;  3GYT A;  4MG6 A;  3WJ4 A;  5E14 A;  1R6G A;  2VV0 A;  4ONI A;  5DYD A;  3A9E B;  1R0N B;  4OJB A;  4NUF A;  5GT4 A;  1NRL A;  2QXM A;  2VSR A;  3AFR A;  4S0T A;  3FAL B;  4RZE A;  1Y0S A;  3CS6 A;  2YAT A;  5DWE A;  5DIE A;  1L2I A;  3MNP A;  4FHI A;  3V9Y A;  6GAT A;  2ZBS A;  3OOF A;  2AYR A;  2PIV A;  2HB7 A;  2H79 A;  3AUR A;  3F5C A;  5AK2 A;  2Q8S A;  4UDA A;  1E3G A;  5APH A;  1GLU A;  3VEK C;  4JGV A;  4OOR A;  2AA7 A;  1S19 A;  3LBD A;  3HM1 A;  5JY3 A;  5KRA A;  3ILZ A;  3VTB A; 
#chains in the Genus database with same CATH homology
 2AO6 A;  5DVS A;  3IPQ A;  5DMC A;  3GYU A;  3OMK A;  2QSE A;  1FM6 A;  1YIM A;  3HO0 A;  1ILG A;  4CN2 C;  3OGT A;  1XLS E;  3V9V A;  4DMA A;  4WVD A;  2HC4 A;  2R6W A;  3TKM A;  3GD2 A;  4WHF A;  3A40 X;  2R40 A;  3D90 A;  5ACC A;  2QMV A;  3OZ0 A;  3M7R A;  2W8Y A;  1ZKY A;  2HWQ A;  4CN3 D;  3OSI A;  5G3J A;  3RVF A;  1EXX A;  1YIN A;  5AAU A;  2ZK1 A;  4PF3 A;  1OVL B;  2YLY A;  1T7F A;  2AX7 A;  4ITE A;  2QPY A;  3ADT A;  5DLR A;  1XV9 A;  3RY9 A;  4MGC A;  5L11 A;  2B50 A;  3PCU A;  4FN9 A;  1R20 A;  3OLS A;  3HC6 A;  2AX6 A;  2Q7L A;  2QH6 A;  1RGD A;  4RE8 A;  2QE4 A;  2AAX A;  4N73 A;  2VUT I;  3W0G A;  3TX7 B;  1SKX A;  3VTD A;  1YOW A;  4A4W A;  5I4V A;  2VV4 B;  3H0A A;  2HFP A;  1H9U A;  1XDK A;  3FLI A;  3TKC A;  1ILH A;  3G9E A;  4XAO A;  5DZ0 A;  5ETH A;  5G43 A;  5KCE A;  2ZK2 A;  5EMP A;  3SP6 A;  3VJH A;  3W5Q A;  5B5B A;  4MGB A;  2ZMH A;  3OSW A;  2QZO B;  2AWH A;  2ZK6 A;  3VT4 A;  3NSP A;  1RXR A;  3L3Z A;  2ZK3 A;  3Q95 A;  1XVP B;  2OZ7 A;  1LAT A;  5GID A;  4A4V A;  5KRO A;  1DSZ A;  1HJ1 A;  5C4U A;  3V4A A;  1X7J A;  4OHA A;  4IA7 A;  4ZOM A;  3PLZ A;  4OJ9 A;  2ACL B;  2AMB A;  5DU5 A;  2PIU A;  3AZ2 A;  2PIW A;  2POG A;  4OEY A;  4YT1 A;  1FCX A;  3W0H A;  5L7H A;  1ZDU A;  2QR9 A;  1OT7 A;  3ADX A;  2Q59 B;  3O1D A;  4G21 A;  4J26 A;  2NXX A;  5KRL A;  1R0O B;  2Q5G A;  5DXB B;  5E7V A;  5KYA A;  3RLJ A;  1GA5 A;  2BAW A;  5K13 A;  3D5F A;  1KB6 A;  1QKM A;  1RK3 A;  4XI3 A;  4UDD A;  3DZU D;  3L0L A;  5APK A;  3WFF A;  5DL4 A;  3UUC A;  2Q1V A;  2B1V A;  3ZR7 A;  5H1E A;  2ZMJ A;  4PRG A;  3VJS A;  2O4R A;  4MG9 A;  5KCU A;  2QXS A;  3R5N A;  1IE9 A;  2ATH A;  2I0J A;  3UUD A;  3ADV A;  4IW8 A;  5E19 A;  2PIN A;  3VHU A;  3G6R A;  1MV9 A;  3OAP A;  4WHG A;  3ADU A;  3UUA B;  5CBX A;  3IXP A;  3F7D A;  2F4B A;  5DWG A;  1FD0 A;  3HZF A;  4IWC A;  2I4Z A;  1Z5X E;  2J14 A;  1DKF A;  4DK8 A;  2P54 A;  2QTU A;  2XHS A;  4OH5 A;  3OLL A;  3VT9 A;  1Z5X U;  5KRC A;  1PQ9 A;  2GPV A;  4OC7 A;  2Q60 A;  4LNW A;  4ZNT A;  3D6D A;  1U3Q A;  2FF0 A;  1R5K A;  1XV9 B;  4XLD A;  4K7A A;  1GWR A;  3OOK A;  2I0G A;  5DX3 A;  3SP9 A;  3VN2 A;  4S14 A;  3ET2 A;  1SQN A;  3AUQ A;  2PIT A;  2EWP A;  4DQM A;  4NQA B;  3G9O A;  1NYX A;  1PZL A;  3UVV B;  4EM9 A;  1UHL B;  3FEJ A;  2HAN B;  2ZNQ A;  2OUZ A;  4RUO X;  2HCD A;  3UU7 B;  1FBY A;  2ZAS A;  4PXM A;  3X31 A;  5EJV A;  3VJI A;  2H77 A;  5AVL A;  3W0C A;  4NIE A;  2HAR A;  1LBD A;  3VT3 A;  3G97 A;  1SJ0 A;  4HCA A;  5FQS A;  2Q70 A;  2B23 A;  3PRG A;  3R2A A;  1U3S A;  1LO1 A;  2HWR A;  3HLV A;  4CN7 A;  2ZLA A;  2J7X A;  5DXR A;  4ZI1 A;  4QM0 A;  3M9E A;  5DK9 A;  3HVL A;  3WFG A;  5HJS A;  4J5X C;  4K4J A;  2JF9 A;  1UPV A;  5KCT A;  2V7C A;  2ZL9 A;  4OIL A;  1ZEO A;  5KCD A;  3G6P A;  3B68 A;  5E0X A;  5IXK A;  5KRF A;  2PIQ A;  3AZ3 A;  3PEQ A;  3OMM A;  1R4I A;  1OSV A;  1L2J A;  3ADS A;  1RKG A;  2O9I A;  2VV1 A;  2NV7 A;  4OKW A;  1T65 A;  2GDA A;  4GAT A;  1G5Y A;  4PPP A;  4S15 A;  5DTV A;  5FQV A;  3VHV A;  5APJ A;  2Q3Y A;  1WM0 X;  4MG5 A;  5AAV B;  4OED A;  2NLL B;  4KZJ A;  2BJ4 A;  1G1U A;  3FXV A;  2ZK5 A;  5DRJ A;  5DVV A;  3B66 A;  1XZX X;  2JFA A;  5DKG A;  3MNO A;  3KDU A;  4MG7 A;  3OMO A;  5DYB A;  1S9Q A;  2PNU A;  3DT3 A;  2AM9 A;  4HLW A;  3KDT A;  4J5X A;  5DZH A;  5KRM A;  2AA2 A;  1NHZ A;  2GIU A;  4OFR A;  1XJ7 A;  4PLE A;  4TMA I;  1FCY A;  3VT7 A;  3FC6 A;  5DXM A;  5JI0 D;  4CN3 A;  1YNW B;  2QA8 A;  1YOK A;  3T03 A;  2HAS A;  4CSJ A;  3ZRA A;  3PBA A;  5JJM B;  2HB8 A;  3IPU A;  3DZY D;  2Z4B A;  3FYL A;  1KB2 A;  1XB7 A;  4YPQ A;  3VD6 C;  2FVJ A;  4R2U A;  5KRB B;  5KRJ A;  5DSH A;  4IA1 A;  5LWP A;  5E6C A;  2OAX A;  2EBL A;  5G46 A;  2QA6 A;  4UDC A;  4POH A;  4QK4 A;  5EHJ A;  3R29 A;  5CC0 A;  5HCV A;  2C7A A;  1T73 A;  4OLN A;  5DWL A;  3A2H A;  1XQ3 A;  2P7Z A;  3E7C A;  3E00 D;  2ZNP A;  4F9M A;  1Y0X X;  3GWX A;  4OH6 A;  4P6W A;  4POJ A;  4RZF A;  1LV3 A;  3G9J A;  1K74 D;  1IE8 A;  2PIP L;  2E2R A;  3DCT A;  4QE8 A;  2V0V A;  2P1T A;  4TV1 A;  2IHQ A;  4L96 A;  4Q0A C;  3CTB A;  5EGV A;  3WT5 A;  5CC1 A;  3K8S A;  5DWJ A;  1ZUC A;  2YJD A;  4PVU A;  5DWI A;  3FEI A;  3JZC A;  4RAK A;  5DXP A;  2ZXZ A;  4DM6 A;  5EMC A;  3JZB A;  1HCP A;  4Q13 A;  1NAV A;  4REF A;  4APU A;  1U3R A;  3NOA A;  4LNX A;  1T7R A;  3G8U A;  5HJP B;  1HRA A;  4OKT A;  3IMY A;  3V49 A;  2AB2 A;  3WGP A;  1XAP A;  4IA3 A;  4X1G A;  5KCW A;  2B1Z A;  2YLP A;  2O4J A;  2VV3 A;  1KB4 A;  4OV7 A;  4MGA A;  3G8I A;  4TUZ A;  1OSH A;  3G9M A;  4WPF A;  5A86 A;  3U9Q A;  4A2J A;  1R20 D;  1T5Z A;  1X76 A;  4OKB A;  3W0A A;  1YMT A;  2VV2 A;  2VST A;  3OSA A;  5DKE A;  1UPW A;  4YNK A;  3P88 A;  5FQT A;  2JFA B;  3F5C B;  3FUR A;  4CN5 A;  2GP7 A;  2Q61 A;  4OZR E;  5HYR A;  3H0A D;  4XT9 A;  5DMF A;  5KR9 A;  5KCF A;  5DXK A;  1XQC A;  4PP5 A;  3SZ1 A;  2XKW A;  3L03 A;  2P1U A;  4OZR U;  2ZK4 A;  3A3Z X;  5L0M A;  2ZK0 A;  1RDT A;  1YP0 A;  1QKT A;  5DV8 A;  3FC6 B;  4X1F A;  1R1K A;  3E94 A;  4RFW A;  2GTK A;  3KMR A;  2YHD A;  3OZJ A;  4IW6 A;  4ZN7 A;  5M96 A;  3DFX A;  5EI1 A;  3WT7 A;  5DVC A;  2Q7J A;  3N00 A;  4IV4 A;  3D24 A;  4LBD A;  5EIT A;  2ENV A;  3MNE A;  1GWQ A;  4MG8 A;  5DY8 A;  4OZT E;  4UDB A;  3GAT A;  3R8A A;  2OCF A;  3ERD A;  3B0W A;  4PLD A;  3A9E A;  5DXQ A;  1R0N A;  4M8H A;  2HBH A;  5DUH A;  3R8D A;  1HG4 A;  4OZT U;  3FAL A;  1NUO A;  1UOM A;  1YY4 A;  1ZDT A;  3CQV A;  4G1Y A;  4ZNV A;  2FAI A;  4CI5 A;  1N46 A;  1CIT A;  4WLB A;  4IV2 A;  2R6Y A;  1T74 A;  3CBB A;  5DZ1 A;  4FHH A;  4DOR A;  1GNF A;  1XDK B;  3OS9 A;  5CBY A;  2QW4 A;  3D57 A;  1XNX A;  2A3I A;  5AWJ A;  2ZKC A;  4MGB B;  3GBK A;  1Z95 A;  4PP3 A;  5F9B A;  2YLQ A;  3B3K A;  1FM9 D;  2AA6 A;  1T79 A;  3VRV A;  5E1C A;  3L1B A;  3Q95 B;  3B67 A;  4G2H A;  4PWL A;  3V3E A;  1HLZ A;  4JL4 A;  2ABI A;  1RKH A;  4HN6 A;  1DSZ B;  2A66 A;  2P4Y A;  1ERE A;  4RUP A;  3FUG A;  2NXX E;  1YUC A;  2GPO A;  2ZMI A;  3QT0 A;  4G20 A;  4PPS A;  3W0J A;  2GWX A;  5C4T A;  2ZNN A;  2GAT A;  1XLS A;  3CWD A;  1OVL A;  1XP9 A;  1ZH7 A;  3TY0 A;  3VT8 A;  4EMA A;  4L98 A;  5EMQ A;  3DR1 A;  5DXG A;  5B41 A;  2Q1H A;  3IPS A;  4KZM A;  3VRU A;  2I4J A;  3B0Q A;  1S9P A;  3B0R A;  3ET0 A;  4M8E A;  5KRI A;  4JYG A;  1HCQ A;  3GWS X;  4RWV A;  2P1V A;  5DIG A;  2Q6S A;  3W5P A;  2VV4 A;  2P7A A;  1P93 A;  2YFE A;  1GDC A;  4MG9 B;  3G99 A;  4TNT A;  2FSZ A;  4R06 A;  3L0E A;  3OS8 C;  3VI8 A;  3UUD B;  4OFU A;  3K6P A;  5E6A A;  2QZO A;  4OEZ A;  1X7R A;  2AMA A;  4IVY A;  2NPA A;  3KPZ A;  1G2N A;  4MDD A;  3CS4 A;  5DUE A;  5GIE A;  1XVP A;  3VJT A;  2Q7I A;  1DKF B;  3W0I A;  1GS4 A;  5DUG A;  3WMH A;  4OAR A;  4QE6 A;  1I37 A;  3DFV C;  1YA3 A;  2QGW A;  2ACL A;  2GPU A;  4OJ4 A;  4CI4 A;  5DZ3 A;  1EXA A;  1QKN A;  1NQ0 A;  1U9E A;  2IOG A;  5DV3 A;  3X36 A;  4IQR A;  5AWK A;  5KCC A;  4MGD A;  5DX3 B;  3E00 A;  2Q59 A;  3B65 A;  3G9I A;  3OS8 A;  5EC9 A;  5DXB A;  2J4A A;  2P15 A;  3EYB A;  1R0O A;  1K74 A;  2HAM A;  3ADW A;  3G0W A;  4IUI A;  1PQC A;  3X1I A;  2PJL A;  5KYJ A;  2AX9 A;  2P7G A;  2JJ3 A;  1RJK A;  3L0J A;  3V3Q A;  3WWR A;  2M9W A;  5AZT A;  1NQ7 A;  3GN8 A;  3VSO A;  1M13 A;  2OVM A;  3B0T A;  3W0Y A;  1XPC A;  2HVC A;  1ZGY A;  3HQ5 A;  3UUA A;  4DK7 A;  5G42 A;  4ZN9 A;  4XUM A;  2G44 A;  4E2J A;  5KRH A;  3OKI A;  3CJW A;  4N5G A;  2PIR A;  1M2Z A;  3CDP A;  3KWY A;  2OVH A;  4Y29 A;  3G8O A;  4JYH A;  1BSX A;  1I7G A;  2LBD A;  4OIU A;  1X78 A;  1SR7 A;  5DI7 A;  5AYG A;  3VHW A;  5DID A;  4DOS A;  3ET1 A;  1FM6 D;  2AXA A;  1I38 A;  1XP1 A;  1S0X A;  5DV6 A;  4OIV A;  4J5W C;  4E4K A;  1I7I A;  5IAW A;  4OND A;  1ERR A;  2Z4J A;  4OGH A;  4OLM A;  2R40 D;  3CLD A;  3AN4 A;  5G44 A;  5SYZ A;  2ZXN A;  2OM9 A;  3RUT A;  1PDU A;  3ZRB A;  1M7W A;  2VUS I;  1XNN A;  2VV1 B;  3P0U A;  4ZJW A;  5KD9 A;  5CBZ A;  2NW4 A;  7GAT A;  2YLO A;  2ZFX A;  3L3X A;  1N83 A;  4HEE X;  4IS8 A;  5E15 A;  2AX8 A;  5AZV A;  5HZC A;  3DZU A;  3G8X A;  3GZ9 A;  4N1Y A;  2YJA B;  3KBA A;  3VT5 A;  3UVV A;  2BJ4 B;  1UHL A;  3W5R A;  4G2I A;  2G5O A;  4B7W A;  2J7Y A;  2HAN A;  1P8D A;  1TFC A;  1XIU A;  3BC5 A;  1E3K A;  3OMQ A;  4OK1 A;  1Q4X A;  1T63 A;  4QL8 A;  3HOD A;  1A28 A;  4MG7 B;  4RUJ A;  1KV6 A;  3UU7 A;  4E4Q A;  1R4R A;  3DY6 A;  1XOW A;  4IWF A;  2Q6R A;  4J5W A;  3LMP A;  5L7E A;  3ERT A;  3VT6 A;  4HC9 A;  3BQD A;  2ZNO A;  2Q7K A;  2I4P A;  3PO9 A;  3FS1 A;  2KAE A;  1R4O A;  4DM8 A;  4RMD A;  1K4W A;  2G0G A;  4ITF A;  4QJR A;  5G45 A;  3VRW A;  3CDS A;  1PK5 A;  2QA8 B;  3VSP A;  3VTC A;  2GPP A;  5DKS A;  3AZ1 A;  4IU7 A;  2ZLC A;  1T76 A;  3A2J A;  3KYT A;  2XYW A;  4ZNH A;  5G5W A;  3BEJ A;  4YMQ A;  3B5R A;  2IOK A;  4MGD B;  3X1H A;  4ZNS A;  3RUU A;  3A78 A;  4Q50 A;  1X7E A;  4RZG A;  5C4S A;  4G1D A;  1FCZ A;  1KNU A;  2XYJ A;  1T7T A;  3R5M A;  3G9P A;  4O8F A;  2GL8 A;  3K23 A;  1ZAF A;  4R6S A;  1A6Y A;  5AAV A;  5LGA A;  3KFC A;  5HYK A;  4FNE A;  5DP0 A;  2NLL A;  3ET3 A;  5AVI A;  2PRG A;  1YYE A;  3V9T A;  3W5T A;  3WTQ A;  1NQ2 A;  1K7L A;  3KMG A;  5DZI A;  4TV1 B;  1FM9 A;  5GAT A;  4J24 A;  3RLL A;  3UP3 A;  2ZY0 A;  4S0S A;  3G6U A;  5CJ6 A;  1BY4 A;  4HN5 A;  4KZI A;  1LV2 A;  3CS8 A;  1T7M A;  4JAZ A;  5GIC A;  3NSQ A;  2ZXM A;  1X7B A;  1QKU A;  1RDT D;  1TXI A;  2AA5 A;  2POB A;  2Q6J A;  3H52 A;  3P89 A;  1S0Z A;  4LSJ A;  5C4O A;  1GWX A;  1YJE A;  3A2I A;  1R1K D;  1KKQ A;  3IXP D;  1YNW A;  3VRT A;  4K6I A;  4G1Z A;  5JJM A;  3UP0 A;  1NDE A;  4FGY A;  3G6Q A;  1XP6 A;  2QGT A;  3DCU A;  4NY9 A;  1MZN A;  3R8I A;  1MVC A;  4XTA A;  3OLF A;  3AX8 A;  1PCG A;  4IVW A;  4XUH A;  4MGA B;  2XYX A;  3AN3 A;  3IA6 A;  3ZQT A;  4TUZ B;  5ICK A;  5KRK A;  4AA6 A;  1GAT A;  1PQ6 A;  4OKX A;  2QAB A;  5L7G A;  5E69 A;  3S9S A;  2VUU I;  1N4H A;  4ZO1 X;  3KMZ A;  3WT6 A;  3WJ5 A;  4P6X A;  5E6D A;  3HC5 A;  4JYI A;  5DRM A;  1NAX A;  1A52 A;  5IZ0 A;  4PP6 A;  3K22 A;  2PIX A;  2Q5S A;  3AUN A;  2Q5P A;  4RME A;  3P8X A;  5DKB A;  4ZJR A;  5E6B A;  5E0W A;  1Y9R A;  3G6T A;  1GAU A;  5DXE A;  3O1E A;  4HC7 A;  2G0H A;  1NQ1 A;  4ZO1 B;  4N8R A;  1G50 A;  2PKL A;  4ZNW A;  4RMC A;  2PIO A;  1PRG A;  2REW A;  3OKH A;  4ZNU A;  5HJP A;  5FQP A;  4BCR A;  2ZVT A;  4REE A;  4NB6 A;  4OEA A;  3B1M A;  3DZY A;  5FQR A;  4LTW A;  3OMP A;  2QNV A;  4WQP A;  1DB1 A;  1VJB A;  4IA2 A;  4MG8 B;  4XHD A;  3GYT A;  4MG6 A;  3WJ4 A;  5E14 A;  1R6G A;  2VV0 A;  4ONI A;  5DYD A;  3A9E B;  1R0N B;  4OJB A;  4NUF A;  5GT4 A;  1NRL A;  2QXM A;  2VSR A;  3AFR A;  4S0T A;  3FAL B;  4RZE A;  1Y0S A;  3CS6 A;  2YAT A;  5DWE A;  5DIE A;  1L2I A;  3MNP A;  4FHI A;  3V9Y A;  6GAT A;  2ZBS A;  3OOF A;  2AYR A;  2PIV A;  2HB7 A;  2H79 A;  3AUR A;  3F5C A;  5AK2 A;  2Q8S A;  4UDA A;  1E3G A;  5APH A;  1GLU A;  3VEK C;  4JGV A;  4OOR A;  2AA7 A;  1S19 A;  3LBD A;  3HM1 A;  5JY3 A;  5KRA A;  3ILZ A;  3VTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...