1HBKA

Acyl-coa binding protein from plasmodium falciparum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
HMAQVFEECVSFINGLPRTINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDRKKYEAWKSVENLNREDAQKRYVDIVSEIFPYWQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding site differences revealed by crystal structures of Plasmodium falciparum and bovine acyl-CoA binding protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Fatty acid metabolism
molecule keywords ACYL-COA BINDING PROTEIN
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hbkA00
1MIZB 2CQUA 3U8ZA 2FJ9A 2LBBA 3ZDTA 2HRJA 2I1JA 3AU5A 1NTIA 2AEHA 2D11A 4HDOA 2RQ1A 2D2QA 2YVCA 3FLVA 3QIJA 4EKUA 2HE7A 2J0JA 3PZDA 1NI2A 2WH5A 2FDQA 2ABDA 3AU4A 1MIXA 3G9WA 1SGHA 1J19A 1ISNA 1HBKA 2D10A 3PVLA 4ZRJA 4HDQA 2CB8A 2COPA 1ACAA 1Y19B 4ZRKA 4NY0A 1GG3A 1MK9B 1ST7A 3EPYA 2EMTA 4F7GA 2J0MA 3FP5A 2ZPYA 1EF1A 3X23A 2AL6A 1E5WA 2EMSA 1GC6A 3WA0A 3IVFA 2J0KA 3U7DA 4P7IA 4YL8A 4DXAB 1GC7A 2I1KA 4CYEA 1H4RA 1HB8A 1HB6A 1NVLA 3BINA 1MK7B 4ZRIA 5IJMA
chains in the Genus database with same CATH superfamily
1JDEA 2I1JA 3AU5A 4JKBA 3QIJA 4JKAA 4JKFA 2ABDA 4JKGB 1J19A 4ILGB 1VBHA 3PVLA 1ACAA 1Y19B 4ILJA 4JKCA 2EMTA 1DIKA 3E66A 2J0KA 4YL8A 1VBGA 4CYEA 1H4RA 2X0SA 3FLVA 3BINA 1MK7B 1MIZB 2D11A 1GGOA 3PZDA 1NI2A 2WH5A 2R82A 1SGHA 2D10A 4HDQA 2CB8A 3SBTA 4JKDA 3SBGA 3FP5A 2ZPYA 5JVLA 4JKHA 2EMSA 1GC6A 4DXAB 4TKNA 2I1KA 1HB8A 1HB6A 5IJMA 2FJ9A 1NTIA 2RQ1A 4EKUA 4JK9A 2FDQA 1MIXA 3G9WA 3ENBA 1ISNA 1KBLA 2COPA 4ZRKA 1GG3A 1MK9B 4F7GA 2J0MA 3E9LA 4JK7A 3E9OA 3WA0A 3IVFA 4P7IA 4GXBA 3E9PA 1NVLA 3ZDTA 4ZRIA 2CQUA 3U8ZA 2LBBA 4JK8A 2HRJA 4HDOA 2AEHA 2YVCA 2D2QA 1KC7A 2HE7A 3AU4A 1HBKA 4ZRJA 4NY0A 4ILHA 1ST7A 3EPYA 1EF1A 4JKEA 2AL6A 3X23A 1E5WA 3U7DA 4JKGA 1GC7A 2DIKA 2J0JA
chains in the Genus database with same CATH topology
1JDEA 2I1JA 3AU5A 4JKBA 3QIJA 4JKAA 4JKFA 2ABDA 4JKGB 1J19A 4ILGB 1VBHA 3PVLA 1ACAA 1Y19B 4ILJA 4JKCA 2EMTA 1DIKA 3E66A 2J0KA 4YL8A 1VBGA 4CYEA 1H4RA 2X0SA 3FLVA 3BINA 1MK7B 1MIZB 2D11A 1GGOA 3PZDA 1NI2A 2WH5A 2R82A 1SGHA 2D10A 4HDQA 2CB8A 3SBTA 4JKDA 3SBGA 3FP5A 2ZPYA 5JVLA 4JKHA 2EMSA 1GC6A 4DXAB 4TKNA 2I1KA 1HB8A 1HB6A 5IJMA 2FJ9A 1NTIA 2RQ1A 4EKUA 4JK9A 2FDQA 1MIXA 3G9WA 3ENBA 1ISNA 1KBLA 2COPA 4ZRKA 1GG3A 1MK9B 4F7GA 2J0MA 3E9LA 4JK7A 3E9OA 3WA0A 3IVFA 4P7IA 4GXBA 3E9PA 1NVLA 3ZDTA 4ZRIA 2CQUA 3U8ZA 2LBBA 4JK8A 2HRJA 4HDOA 2AEHA 2YVCA 2D2QA 1KC7A 2HE7A 3AU4A 1HBKA 4ZRJA 4NY0A 4ILHA 1ST7A 3EPYA 1EF1A 4JKEA 2AL6A 3X23A 1E5WA 3U7DA 4JKGA 1GC7A 2DIKA 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIZ B;  2CQU A;  3U8Z A;  2FJ9 A;  2LBB A;  3ZDT A;  2HRJ A;  2I1J A;  3AU5 A;  1NTI A;  2AEH A;  2D11 A;  4HDO A;  2RQ1 A;  2D2Q A;  2YVC A;  3FLV A;  3QIJ A;  4EKU A;  2HE7 A;  2J0J A;  3PZD A;  1NI2 A;  2WH5 A;  2FDQ A;  2ABD A;  3AU4 A;  1MIX A;  3G9W A;  1SGH A;  1J19 A;  1ISN A;  1HBK A;  2D10 A;  3PVL A;  4ZRJ A;  4HDQ A;  2CB8 A;  2COP A;  1ACA A;  1Y19 B;  4ZRK A;  4NY0 A;  1GG3 A;  1MK9 B;  1ST7 A;  3EPY A;  2EMT A;  4F7G A;  2J0M A;  3FP5 A;  2ZPY A;  1EF1 A;  3X23 A;  2AL6 A;  1E5W A;  2EMS A;  1GC6 A;  3WA0 A;  3IVF A;  2J0K A;  3U7D A;  4P7I A;  4YL8 A;  4DXA B;  1GC7 A;  2I1K A;  4CYE A;  1H4R A;  1HB8 A;  1HB6 A;  1NVL A;  3BIN A;  1MK7 B;  4ZRI A;  5IJM A; 
#chains in the Genus database with same CATH topology
 1JDE A;  2I1J A;  3AU5 A;  4JKB A;  3QIJ A;  4JKA A;  4JKF A;  2ABD A;  4JKG B;  1J19 A;  4ILG B;  1VBH A;  3PVL A;  1ACA A;  1Y19 B;  4ILJ A;  4JKC A;  2EMT A;  1DIK A;  3E66 A;  2J0K A;  4YL8 A;  1VBG A;  4CYE A;  1H4R A;  2X0S A;  3FLV A;  3BIN A;  1MK7 B;  1MIZ B;  2D11 A;  1GGO A;  3PZD A;  1NI2 A;  2WH5 A;  2R82 A;  1SGH A;  2D10 A;  4HDQ A;  2CB8 A;  3SBT A;  4JKD A;  3SBG A;  3FP5 A;  2ZPY A;  5JVL A;  4JKH A;  2EMS A;  1GC6 A;  4DXA B;  4TKN A;  2I1K A;  1HB8 A;  1HB6 A;  5IJM A;  2FJ9 A;  1NTI A;  2RQ1 A;  4EKU A;  4JK9 A;  2FDQ A;  1MIX A;  3G9W A;  3ENB A;  1ISN A;  1KBL A;  2COP A;  4ZRK A;  1GG3 A;  1MK9 B;  4F7G A;  2J0M A;  3E9L A;  4JK7 A;  3E9O A;  3WA0 A;  3IVF A;  4P7I A;  4GXB A;  3E9P A;  1NVL A;  3ZDT A;  4ZRI A;  2CQU A;  3U8Z A;  2LBB A;  4JK8 A;  2HRJ A;  4HDO A;  2AEH A;  2YVC A;  2D2Q A;  1KC7 A;  2HE7 A;  3AU4 A;  1HBK A;  4ZRJ A;  4NY0 A;  4ILH A;  1ST7 A;  3EPY A;  1EF1 A;  4JKE A;  2AL6 A;  3X23 A;  1E5W A;  3U7D A;  4JKG A;  1GC7 A;  2DIK A;  2J0J A; 
#chains in the Genus database with same CATH homology
 1JDE A;  2I1J A;  3AU5 A;  4JKB A;  3QIJ A;  4JKA A;  4JKF A;  2ABD A;  4JKG B;  1J19 A;  4ILG B;  1VBH A;  3PVL A;  1ACA A;  1Y19 B;  4ILJ A;  4JKC A;  2EMT A;  1DIK A;  3E66 A;  2J0K A;  4YL8 A;  1VBG A;  4CYE A;  1H4R A;  2X0S A;  3FLV A;  3BIN A;  1MK7 B;  1MIZ B;  2D11 A;  1GGO A;  3PZD A;  1NI2 A;  2WH5 A;  2R82 A;  1SGH A;  2D10 A;  4HDQ A;  2CB8 A;  3SBT A;  4JKD A;  3SBG A;  3FP5 A;  2ZPY A;  5JVL A;  4JKH A;  2EMS A;  1GC6 A;  4DXA B;  4TKN A;  2I1K A;  1HB8 A;  1HB6 A;  5IJM A;  2FJ9 A;  1NTI A;  2RQ1 A;  4EKU A;  4JK9 A;  2FDQ A;  1MIX A;  3G9W A;  3ENB A;  1ISN A;  1KBL A;  2COP A;  4ZRK A;  1GG3 A;  1MK9 B;  4F7G A;  2J0M A;  3E9L A;  4JK7 A;  3E9O A;  3WA0 A;  3IVF A;  4P7I A;  4GXB A;  3E9P A;  1NVL A;  3ZDT A;  4ZRI A;  2CQU A;  3U8Z A;  2LBB A;  4JK8 A;  2HRJ A;  4HDO A;  2AEH A;  2YVC A;  2D2Q A;  1KC7 A;  2HE7 A;  3AU4 A;  1HBK A;  4ZRJ A;  4NY0 A;  4ILH A;  1ST7 A;  3EPY A;  1EF1 A;  4JKE A;  2AL6 A;  3X23 A;  1E5W A;  3U7D A;  4JKG A;  1GC7 A;  2DIK A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...