1HBKA

Acyl-coa binding protein from plasmodium falciparum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
HMAQVFEECVSFINGLPRTINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDRKKYEAWKSVENLNREDAQKRYVDIVSEIFPYWQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA BINDING PROTEIN
publication title Binding site differences revealed by crystal structures of Plasmodium falciparum and bovine acyl-CoA binding protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Fatty acid metabolism
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hbkA00
4ZRJA 1MIXA 4ZRKA 1GG3A 3AU4A 2I1JA 2CB8A 2J0KA 1ST7A 4NY0A 2ABDA 2D10A 3U8ZA 3G9WA 3ZDTA 2I1KA 4EKUA 4CYEA 2YVCA 2J0MA 4YL8A 1MIZB 1HB6A 3AU5A 4DXAB 1NTIA 1MK9B 1GC7A 1J19A 1NVLA 3IVFA 3PZDA 2D2QA 4F7GA 1NI2A 2D11A 1ACAA 3X23A 3EPYA 2WH5A 3QIJA 1HBKA 4HDOA 2HRJA 3PVLA 4P7IA 3BINA 4ZRIA 3WA0A 2ZPYA 2FJ9A 1H4RA 2J0JA 2CQUA 1EF1A 2EMSA 2FDQA 2LBBA 5IJMA 1SGHA 1Y19B 1ISNA 1MK7B 2AEHA 1GC6A 2COPA 1HB8A 2AL6A 2EMTA 2HE7A 2RQ1A 3FLVA 3FP5A 4HDQA 3U7DA 1E5WA
chains in the Genus database with same CATH superfamily
4ZRKA 1GG3A 3AU4A 2CB8A 2J0KA 2ABDA 3G9WA 4EKUA 4JKGB 4CYEA 2YVCA 4YL8A 4JK9A 3PZDA 2R82A 4JKCA 1ACAA 1HBKA 4ILJA 3BINA 2ZPYA 2AEHA 1MK7B 1HB8A 2HE7A 4ZRJA 1MIXA 2I1JA 3ENBA 3ZDTA 3AU5A 1MK9B 1J19A 2D2QA 2DIKA 2D11A 4JKEA 3EPYA 4HDOA 3WA0A 2FJ9A 3SBGA 4GXBA 2CQUA 1EF1A 2EMSA 2FDQA 2X0SA 1GGOA 1Y19B 1ISNA 1GC6A 2COPA 2RQ1A 4HDQA 3E9PA 1E5WA 4JKDA 4JK8A 4JKGA 1ST7A 4NY0A 4JKHA 2D10A 2I1KA 3SBTA 1VBHA 4DXAB 1MIZB 4ILGB 1NVLA 4JK7A 1NI2A 4TKNA 3X23A 2WH5A 3QIJA 4P7IA 2HRJA 4ZRIA 3E9OA 4JKAA 2J0JA 5IJMA 2LBBA 4ILHA 5JVLA 3FLVA 1KBLA 1JDEA 4JKFA 3U8ZA 1VBGA 2J0MA 1HB6A 1NTIA 3E66A 1GC7A 3IVFA 1KC7A 4JKBA 3PVLA 1DIKA 3E9LA 1H4RA 1SGHA 4F7GA 3FP5A 2AL6A 2EMTA 3U7DA
chains in the Genus database with same CATH topology
4ZRKA 1GG3A 3AU4A 2CB8A 2J0KA 2ABDA 3G9WA 4EKUA 4JKGB 4CYEA 2YVCA 4YL8A 4JK9A 3PZDA 2R82A 4JKCA 1ACAA 1HBKA 4ILJA 3BINA 2ZPYA 2AEHA 1MK7B 1HB8A 2HE7A 4ZRJA 1MIXA 2I1JA 3ENBA 3ZDTA 3AU5A 1MK9B 1J19A 2D2QA 2DIKA 2D11A 4JKEA 3EPYA 4HDOA 3WA0A 2FJ9A 3SBGA 4GXBA 2CQUA 1EF1A 2EMSA 2FDQA 2X0SA 1GGOA 1Y19B 1ISNA 1GC6A 2COPA 2RQ1A 4HDQA 3E9PA 1E5WA 4JKDA 4JK8A 4JKGA 1ST7A 4NY0A 4JKHA 2D10A 2I1KA 3SBTA 1VBHA 4DXAB 1MIZB 4ILGB 1NVLA 4JK7A 1NI2A 4TKNA 3X23A 2WH5A 3QIJA 4P7IA 2HRJA 4ZRIA 3E9OA 4JKAA 2J0JA 5IJMA 2LBBA 4ILHA 5JVLA 3FLVA 1KBLA 1JDEA 4JKFA 3U8ZA 1VBGA 2J0MA 1HB6A 1NTIA 3E66A 1GC7A 3IVFA 1KC7A 4JKBA 3PVLA 1DIKA 3E9LA 1H4RA 1SGHA 4F7GA 3FP5A 2AL6A 2EMTA 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  1MIX A;  4ZRK A;  1GG3 A;  3AU4 A;  2I1J A;  2CB8 A;  2J0K A;  1ST7 A;  4NY0 A;  2ABD A;  2D10 A;  3U8Z A;  3G9W A;  3ZDT A;  2I1K A;  4EKU A;  4CYE A;  2YVC A;  2J0M A;  4YL8 A;  1MIZ B;  1HB6 A;  3AU5 A;  4DXA B;  1NTI A;  1MK9 B;  1GC7 A;  1J19 A;  1NVL A;  3IVF A;  3PZD A;  2D2Q A;  4F7G A;  1NI2 A;  2D11 A;  1ACA A;  3X23 A;  3EPY A;  2WH5 A;  3QIJ A;  1HBK A;  4HDO A;  2HRJ A;  3PVL A;  4P7I A;  3BIN A;  4ZRI A;  3WA0 A;  2ZPY A;  2FJ9 A;  1H4R A;  2J0J A;  2CQU A;  1EF1 A;  2EMS A;  2FDQ A;  2LBB A;  5IJM A;  1SGH A;  1Y19 B;  1ISN A;  1MK7 B;  2AEH A;  1GC6 A;  2COP A;  1HB8 A;  2AL6 A;  2EMT A;  2HE7 A;  2RQ1 A;  3FLV A;  3FP5 A;  4HDQ A;  3U7D A;  1E5W A; 
#chains in the Genus database with same CATH topology
 4ZRK A;  1GG3 A;  3AU4 A;  2CB8 A;  2J0K A;  2ABD A;  3G9W A;  4EKU A;  4JKG B;  4CYE A;  2YVC A;  4YL8 A;  4JK9 A;  3PZD A;  2R82 A;  4JKC A;  1ACA A;  1HBK A;  4ILJ A;  3BIN A;  2ZPY A;  2AEH A;  1MK7 B;  1HB8 A;  2HE7 A;  4ZRJ A;  1MIX A;  2I1J A;  3ENB A;  3ZDT A;  3AU5 A;  1MK9 B;  1J19 A;  2D2Q A;  2DIK A;  2D11 A;  4JKE A;  3EPY A;  4HDO A;  3WA0 A;  2FJ9 A;  3SBG A;  4GXB A;  2CQU A;  1EF1 A;  2EMS A;  2FDQ A;  2X0S A;  1GGO A;  1Y19 B;  1ISN A;  1GC6 A;  2COP A;  2RQ1 A;  4HDQ A;  3E9P A;  1E5W A;  4JKD A;  4JK8 A;  4JKG A;  1ST7 A;  4NY0 A;  4JKH A;  2D10 A;  2I1K A;  3SBT A;  1VBH A;  4DXA B;  1MIZ B;  4ILG B;  1NVL A;  4JK7 A;  1NI2 A;  4TKN A;  3X23 A;  2WH5 A;  3QIJ A;  4P7I A;  2HRJ A;  4ZRI A;  3E9O A;  4JKA A;  2J0J A;  5IJM A;  2LBB A;  4ILH A;  5JVL A;  3FLV A;  1KBL A;  1JDE A;  4JKF A;  3U8Z A;  1VBG A;  2J0M A;  1HB6 A;  1NTI A;  3E66 A;  1GC7 A;  3IVF A;  1KC7 A;  4JKB A;  3PVL A;  1DIK A;  3E9L A;  1H4R A;  1SGH A;  4F7G A;  3FP5 A;  2AL6 A;  2EMT A;  3U7D A; 
#chains in the Genus database with same CATH homology
 4ZRK A;  1GG3 A;  3AU4 A;  2CB8 A;  2J0K A;  2ABD A;  3G9W A;  4EKU A;  4JKG B;  4CYE A;  2YVC A;  4YL8 A;  4JK9 A;  3PZD A;  2R82 A;  4JKC A;  1ACA A;  1HBK A;  4ILJ A;  3BIN A;  2ZPY A;  2AEH A;  1MK7 B;  1HB8 A;  2HE7 A;  4ZRJ A;  1MIX A;  2I1J A;  3ENB A;  3ZDT A;  3AU5 A;  1MK9 B;  1J19 A;  2D2Q A;  2DIK A;  2D11 A;  4JKE A;  3EPY A;  4HDO A;  3WA0 A;  2FJ9 A;  3SBG A;  4GXB A;  2CQU A;  1EF1 A;  2EMS A;  2FDQ A;  2X0S A;  1GGO A;  1Y19 B;  1ISN A;  1GC6 A;  2COP A;  2RQ1 A;  4HDQ A;  3E9P A;  1E5W A;  4JKD A;  4JK8 A;  4JKG A;  1ST7 A;  4NY0 A;  4JKH A;  2D10 A;  2I1K A;  3SBT A;  1VBH A;  4DXA B;  1MIZ B;  4ILG B;  1NVL A;  4JK7 A;  1NI2 A;  4TKN A;  3X23 A;  2WH5 A;  3QIJ A;  4P7I A;  2HRJ A;  4ZRI A;  3E9O A;  4JKA A;  2J0J A;  5IJM A;  2LBB A;  4ILH A;  5JVL A;  3FLV A;  1KBL A;  1JDE A;  4JKF A;  3U8Z A;  1VBG A;  2J0M A;  1HB6 A;  1NTI A;  3E66 A;  1GC7 A;  3IVF A;  1KC7 A;  4JKB A;  3PVL A;  1DIK A;  3E9L A;  1H4R A;  1SGH A;  4F7G A;  3FP5 A;  2AL6 A;  2EMT A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...