4ZRKA

Merlin-ferm and lats1 complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
b'KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/transferase
total genus 83
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrkA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrkA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrkA01
4WJPA 4JQWC 1U5GA 3FSSA 4MK0A 5D3VA 2L2IA 1AARA 4A5KA 4I6LB 3ZRFA 2DHJA 3ODWA 1V2YA 3EECA 2LI5A 4HLEA 3H7PA 4II3B 2IYDB 2MBHA 1K5GB 4HAVB 1E7VA 4GMVA 5DPTA 3NSUA 2M17A 4HDOA 2N1WA 3PGEA 3IG3A 1EAZA 4HB4B 2DX5A 2I1KA 1DBHA 1WI0A 3A1QA 1L2NA 2L8JA 1EF1A 2N1VA 3HK0A 3W1SA 4K81A 3UF8A 2CU1A 5JH5C 3DQVA 4A20A 5JHBA 1BT0A 4ANWA 1EO6A 4MM3A 3BINA 4XZ4A 4HAYB 2DZKA 2MQJA 2GBKA 3DPDA 2LJ5A 2LUEA 3KYDD 5IAAC 2AL3A 3CMMB 5CHFA 2N9EB 5C16A 1Y5OA 1ZM0A 2COAA 1WX7A 2LWPA 4KHAA 3IVFA 2CQUA 5DCNA 3NHEB 2D10A 2NBVB 1MKEA 2RD0A 4MGKE 2JF5A 2LZ6A 2Y5BB 1HBKA 1WGHA 1U4AA 4DDGD 2GMIC 1H4RA 3ENEA 2K6DB 2NBWB 4FADA 5AZFA 3A4RA 3MDBC 2M8SA 3UZTA 2RVBB 2UZSA 4HXDA 1E5WA 1E90A 1TTNA 4FLHA 4IWPA 5E6NA 2DFKA 1OY2A 3PZDA 4DHZE 1OEYJ 1V86A 2X18A 2IO0B 4C0AA 4A3PA 1KOTA 3D8FA 1MPHA 4GGQA 3V5WA 1FAOA 3ODOA 2W9NA 4HCPB 3GYPA 2FCNA 4PS7A 1V5TA 1NU2A 1PLSA 2EJ8A 1RFAA 2BCJA 2PZ1A 1EGXA 2ZNVB 1F9JA 3A9JA 1BTKA 4HAWB 3SUZA 2KUPA 4LJPB 4GU2A 1E7UA 3ML9A 1N3HA 1VCBA 2KJ6A 2OTXA 2GBMA 2CHWA 2KLCA 1WR1A 2NR2A 3P7ZA 4AWJA 3OJ4B 3V6CB 4CHKA 4WJNA 1OQNA 1WGRA 3GYOA 2K1FA 4HHVA 2KDIA 2BWES 5KHOA 1U5EA 3M1IB 2YLMA 4IM3A 4TYZA 4NJ6A 5D6JB 2ZNVC 3L16A 2WYQA 4JLCA 4IWQA 4DX8A 2KMAA 3RZFA 2R09A 4W9HA 3QHTA 2MWNB 3AU5A 5AEKB 1U5FA 2GJYA 1WZ3A 2K8CA 1L7YA 1OEYA 2QKMA 4K7SA 3PHWB 4WJ7A 3SNHA 2RNRB 4G11A 2D11A 2KK8A 3ECIA 3PTFC 2JZ3B 1V81A 1MIXA 1LB1A 1YJ1A 2DX5B 2K00A 1W1HA 1EUVB 4DXAB 5L81A 2ELBA 2GBRA 4HWIB 3A33B 1TXDA 4G3XB 1Q5WB 3APCA 2BF8B 1WZ0A 2QHOA 3QIJA 4M0WB 4K2OA 2KANA 4MELA 1C1YB 3V60A 4K17A 2N9XA 2ZPNA 2UYZB 3S2AA 3TL5A 3VTWA 5C5BA 5HKHA 4NQLB 3U7DA 5AZGA 1B55A 3RUIB 3W1SC 1RJ2A 5EFXA 1WG7A 4HB2B 3TVVA 3QWMA 4IFSA 4EEWA 3PVUA 3PV1A 2AWTA 2KTFA 4IAPA 1KZGA 4GN1A 4WWPA 1G6JA 1XODA 3RULA 2BYVE 3L13A 1KM7A 2R2QA 2N4FA 3KUZA 2DAFA 1SGHA 3V62A 3D8DA 1RRPB 2MBQA 4GXBA 5D3YA 2LOZA 5HE0A 4PYUA 3KRXA 2M14A 2GOWA 2QKLA 1GC6A 3IFWB 2N7DA 3N3KB 4IG7B 3W1YA 3KUCB 2MP2A 3CSTA 3APFA 5E6PA 3KSYA 4FHJA 3WANA 2MSED 3A9JB 3KVFB 2J7QB 2NZ8B 1CMXB 3WAPA 5DIFB 2LASA 5GOWB 4AP4C 3KYCD 1MAIA 1FHOA 2DAJA 4IM0A 1Q1OA 2PJHA 3R7QA 2IY1B 1H10A 5D2MB 3PRZA 5E6OA 2COFA 1V5MA 3PG7A 3GOEA 4DX90 4PYZA 2R0DA 1XD4A 2JT4B 3N30A 4FJZA 3WAMA 5J18A 4MGYE 2NMBA 1W1GA 3QQ8B 3DVNV 4HK2A 3G9WA 3MPXA 4MGIE 2Q13A 4K1RB 2IBIB 1UNQA 3PSCA 2BYEA 3ZTCA 4NAWB 1PQSA 1XT9B 3DXDA 2C60A 3O65B 2DYBA 2RPQA 2KO3A 1WJMA 4NNJB 4F7ZA 2FDQA 1WM3A 3ZO5B 1NBFC 1TBEA 2GS0A 2KWUB 1WMHA 4IWOA 3T9LA 2KFKB 2Z0PA 3HM3A 1DROA 2V76A 5LONB 3KW5B 4OVVA 1SE9A 1ISNA 4KIKB 1ZKHA 1TQZA 1WE6A 1DDWA 1XX0A 1BWNA 4HAUB 3UQAA 2RSGA 2D4QA 3OJ3A 4K7UA 2L76A 2DHKA 5C5BB 4BVUC 2KTRB 2Y7BA 3K9PB 3NY5A 3QWZB 4NY0A 1DDVA 4HCNB 1WR6E 1FHXA 1PMSA 3AXCA 2DZMA 3OLMD 1IRSA 2LOXA 1M7EA 1R4MI 4KAXB 1P3QU 1V61A 3HIZA 2HE7A 4Z2NA 5DPSA 1KZ7A 1X05A 3DVNU 3Q3FA 2DLWA 3SD5A 1WM2A 1UH6A 2IO3B 3PRPB 2UZRA 4PS8A 1NTYA 4M8NA 4KSLC 1P0RA 2LRUA 4E74A 2W2XC 1NVLA 2KZRA 3QJZA 5CX3A 5LOPB 2AL6A 1WIAA 3PLUA 5D94A 1ACAA 3AJ4A 4LDTB 1MK9B 3HHMA 4TV3A 3ULCA 1V88A 2M38A 3UINB 2Z0OA 2IO1B 4MEMA 4BBNC 2WDTB 4EUTA 4EZLA 2UVMA 3TFMA 4F8CB 4RMAA 2H7EA 4WQOB 1WGQA 3ZTDA 4NJ7A 1KLVA 1ZC3B 2N7EA 2WX0A 3NOBA 3RZWC 3TW1A 2KHWB 3P2BA 4XC2A 2MP2B 3PS6A 1V6EA 3WA0A 2D07B 2JVCA 2I1JA 5BO4B 3Q3JA 4GZUA 3VUXA 3PEGA 2D9WA 4EZKA 3PREA 2VSZA 2J0JA 1WGDA 5CHWA 2FAZA 4MGZE 1AWEA 5AZHA 4DDID 2LULA 2EMSA 1FXTB 1S3SG 1WH3A 2MKRA 4XX5A 4ZYNA 2O2VA 2J0MA 4IC7B 3SDLC 2I5FA 1UBQA 1GG3A 2MFQA 1SHCA 4DHZB 2CRFA 1DDMA 2XK5A 2RSUA 2KC1A 3RCZA 2L1CA 1UNRA 2PPHA 2HTHB 2MCNB 2K2UA 1P9DU 3I3TB 1V5UA 3M95A 2ELAA 2Z0QA 4KZCA 3H6NA 3SO6A 3L08A 3ALBA 1OTRB 4OVUA 3R3MA 1LFDA 1Q67A 3BJIA 1UGMA 2KDFB 4WJQA 3KH0A 1S1QB 2FUHB 3T8MA 1I2HA 2FIDA 2DHIA 4PS3A 2MWSB 2O6VB 2L0FA 4W9EA 2M4NA 1RAXA 2K8BA 3VUWA 1P1AA 2M1MA 3L54A 4RM8A 2CHZA 4KHBB 4A6KA 2DKPA 1OGWA 4URKA 2P0HA 1J0WA 5GMVA 2AYOB 3R7RA 5CLQB 2W2XD 4YONA 3FM8C 1BAKA 3SU8X 4N9F4 2YT1A 1X1FA 3CXBB 4D0NB 4MY6A 1MIZB 4MJSA 3ZDTA 2C7HA 2DENB 5DH9B 5C79A 2RR9A 3F0WA 5C1ZA 1FGZA 4YL8A 2NPTA 2CY5A 4MSQB 2C7NB 1WJ4A 2CS4A 2V3SA 2FNJB 2ASQA 3L10B 2N0YA 5CLLB 3ZUNA 1Y19B 1TJ6A 3MJWA 2DX1A 2ROVA 5C23A 3DOWA 3BY4B 4LDTD 4A6HA 3H7PB 3AULA 2MDXA 5G2NA 1FHWA 4DBBA 3F5RA 3ZKJC 1GJZA 2XQNM 1XKEA 2KOXA 1MK7B 1IPGA 3A1QB 3VTVA 4WAAA 3H9DA 1X1MA 3FEHA 4WVFB 3EFUA 1I42A 1KI1B 4NSWA 2OJRA 2ADZA 3U8ZA 1K5DB 2CODA 2COCA 2C7MB 1GNUA 5FR6A 3ZNHB 3B1LX 1IYFA 1H8CA 3VHTC 2PE9A 1J8CA 1P6SA 2KVRA 4LJOB 3ZW3A 1ZW7A 2K6QA 3R66C 2O2VB 3M63B 4P7IA 1ZGUB 2XBBC 2P0FA 1XCGA 3EPYA 3QBVB 2RUKB 2CKHB 4II2B 3HQCA 2XK5B 4HB0B 2JXXA 2DTCA 2G45B 3ZLZA 2L00B 3JVZX 4GIVA 2KXJA 2LD9A 3SYXA 1RRBA 3H7SA 1YQBA 2FCMA 3T06A 1OMWA 4ICUA 1UEFA 4BKSD 3PP2A 4HPLB 4A6FA 1UBIA 4F7UP 4GMXB 2ZCBA 3JSVA 2D9ZA 2ABDA 4A3OA 1I7AA 4NQKE 5KQ1A 4XWXA 2MBEA 4EZJA 1QZEA 1WF9A 3N32A 1WI1A 4WWNA 2O6VD 3ZDMC 4GSWA 1FB8A 2KKCA 3B08A 5CTRC 4DWFA 4F7GA 5JHGA 3ULBA 1WXVA 2KJRA 5HE3A 2EC1A 5KQ4A 3OAWA 3APDA 3TMPB 2OOBB 1E8YA 1ZVRA 1QC6A 1UD7A 3WYFB 4BKTA 3RYTA 4DHJB 1XR0B 2G3QB 4WWOA 5D7GA 4W9GA 2ZJDA 1WXSA 3VOQA 1WFYA 1WVHA 5EDSA 1E8XA 4HAXB 1WGUA 2NPTB 1XD3B 3PLVA 2YF0A 4Y94A 5D3WA 3EHVA 1GUAB 2CHXA 1PFJA 2DN6A 3AI5A 2J0KA 4Z2MB 5DHFB 3DCGA 4KDLB 3X23A 4J6IA 1UELA 2MW5A 3PVLA 2CY4A 1WX9A 2KQSA 3VAWA 4ANVA 2K8HA 1X1GA 1WXMA 2K39A 4EFOA 4WSFA 3O96A 3ZVVA 3L0WB 3SHQA 2I5CA 2YS3A 3ZIMA 1R4NI 1LW3A 3TCAA 2LVOA 2ZVNA 4FHKA 2ZPYA 4PNKA 2P8VA 2L0TA 2LGXA 4EKUA 4LCDE 1Z5SB 2RGFA 3LJ3A 2IY0B 2JZZA 2Z0DB 2DYQA 4EOYA 1UNPA 1V89A 4EJNA 5G55A 2KDBA 5DHAB 1FGYA 5J3YA 4NPNA 1M7RA 2DA0A 2GBNA 4M8MA 4G0NB 5LLIA 3UQBA 4KVGB 2KNBA 5DPWA 1P98A 4WJOA 4K7WA 4ANXA 3IHPC 4K2PA 5KCVA 3JSVB 1NTVA 2JP2A 2A5UA 3QCAA 2RQ1A 3RT3B 1UZXB 3FLVA 2JRIB 4F7HA 2WWZA 3MTNB 3DBHI 2VRWB 1U5DA 3ONSA 2MLBA 4B95A 1E8ZA 2HD5B 4FJYA 3N7CA 3VVWB 4KHOA 4HAZB 4CYEA 4E71A 1V5PA 4ASWC 4B6HA 3VTUA 1LM8B 2LKOA 1WE7A 2R2OA 4BOZB 1IP9A 3MHSD 2KGXB 4JGHB 3PT2B 2GCLA 2JY6A 4DHJD 2ROZB 3KUDB 4IW0A 2EKEC 3WAOA 1UPQA 2KFJA 1QQGA 3NS8A 2DZIA 1X86A 4CHMA 1HB6A 2PE6B 3A8PA 2KQ7A 4MT7A 2YS1A 2MBOA 4W9IA 2NS5A 3AU4A 2YRYA 5JLJB 2HJ8A 3A8QA 4FA6A 1Q0WB 5L95C 4IM2A 3PRMB 1YX5B 2EMTA 4FBJB 4BBNF 2LXCA 2RGNB 3KY9A 1WJ6A 2IO2B 1A5RA 2KJHB 2KCJA 4ZRKA 1WGGA 3OANA 4BOSC 2KN5A 1NI2A 4EMOA 2MX2A 4ICVA 3A9KA 3TIXA 4X57B 4BKGA 2FJ9A 1M94A 1SIFA 3C0RB 4KDIC 4ZDVA 3ZNZB 4GDKA 3L17A 1U27A 4JL9A 3ZVRA 1WMHB 1V80A 1J0GA 3QX1A 4ANUA 4IUMB 2DYNA 4ZRIA 2UWQA 4B9KA 3QC8B 1AQCA 2P0DA 2WX1A 4HDQA 2MBBB 2ZEQA 2FIFA 5J2RA 4RM9A 3ZRCA 1V49A 1EF5A 4GDLA 2IZVB 3X0WA 4L6EA 2KD0A 3DBRI 3KZ1A 1E8WA 1ST7A 1JRUA 2V4LA 3M62B 2BYFA 3VH4B 5JZEB 1YD8U 3VFKA 4DK5A 2IFSA 3TJPA 4B6WA 2REXA 3PHXB 5FI1A 3V61A 1RLFA 3D32A 2LYDA 2YVCA 5D27A 3VXWA 3VIAA 1YIWA 4PQ0A 3DBSA 1WX8A 4I6PA 3V6EB 3HW2B 2LXAA 2GBJA 1EVHA 2VKIA 2KLGA 1TGZB 3ML8A 1BTNA 1U29A 2RLOA 3RCPA 3SV1A 2LGDA 3VDZA 1DYNA 5L83A 4W9LA 3ZNGC 3JW0X 1WJUA 4NAWA 2KX0A 3HM6X 4HPMB 2L05A 2KMCA 1WJ1A 4W9FA 1OQYA 1HB8A 2FJLA 3LDZE 3PVWA 3VH3B 2Y8GA 2NBUA 4W9KA 2KDEB 3DBLI 3WALA 3ODXA 5TR5A 2ZVOA 3CIKA 2G35A 2YT0A 4KV2A 2N23A 1TZ1A 2CB8A 2KFKA 1VD2A 2BWFA 4I6NB 2MA9B 5JP4A 2CAYA 2MRPA 5DI9B 3LJUX 4KIKA 2M0XA 3PSEB 3VQIA 4HJKA 2IYBA 4E3CA 3DDCB 4H8SA 3KRWA 2JUOA 4MDKE 5CHVC 1KJTA 3K9OB 2LGYA 2C9WB 4HVBA 2NVUI 3CF6E 2B3AA 1UPRA 1C3TA 2KTRA 3EC8A 4GPTB 1D3ZA 2KWCA 2XEWA 4BFRA 3VUYA 2WH5A 5KHQA 5DPRA 2BKRB 4TQ1A 4FN2A 5J17A 3A9KB 3A98B 1NTIA 4GDKB 1WY8A 3QA8A 3P6AA 1I35A 2VRRB 5JHAA 5HE1A 1ZSQA 2K2JA 4F1SA 3TO1A 4TUUA 3GZNI 5FI0A 3U30A 1FOEA 2G4DB 3DXEA 2LVQA 3ZNID 4AUQC 3QK0A 1WYWB 3PPAA 2OQBA 1W1DA 5JHHA 2DZJA 1X11A 2COPA 3UGBB 2D9VA 2JRHA 4HB3B 2GCJA 4GDLB 3H1UA 4DBGA 1LXDA 2W2WA 4JIOU 3A4SC 3QAQA 4MJSB 4MH0E 4CO7A 1Y8RC 5HE2A 2YSZA 1WXAA 1V5OA 1LQBA 3QARA 1Z2MA 4AJYB 1P3RA 3CSFA 2KC2A 2D9XA 4CHJA 3ML4A 2LG1A 1P5TA 1K8RB 5J3QA 4HATB 3NZSA 4TQ0A 1V9JA 2DHZA 3RD2A 3UIOB 2BPSA 2H7DA 1YX6B 4GOCA 5C6RA 2ZCCA 1XQQA 4GB9A 4BBKA 5LXHA 4KSKC 2V1YA 4W9JA 2HTHA 3JYUA 4AOFA 1J19A 1WJNA 4KZ0A 2JPHA 1U2BA 1WRDB 2LBBA 2PEAA 4BKSA 5IJMA 2C5LC 5D3XA 4G50A 3WIMA 2K25A 2N9PC 4W9DA 3M3JA 4FULA 2Z59B 2D9YA 3D8EA 2FCSA 4IOYX 3DXCA 2AEHA 2O6VA 2LVPA 1WGYA 2ZZPB 5IA7A 1MG8A 1ZC4B 3DVGX 4TKNA 2G4SA 3UIPB 2J59M 3IBEA 1NDDA 1T0YA 2KX3A 2CR5A 2DYMA 2Z0EB 2A4ZA 2DKQA 1HE8A 2D2QA 3FP5A 3DVGY 2FCQA 2E2XA 2DYOA 2KWVB 2YS5A 4W9CA 1GC7A 4ZRJA 3TBLD 5J3TA 4FJVB 3NZUA 2L3ZA 2NCNA 2BKFA 4MSMB 5LXIB 2L7RA 2D3GA 4A6FB 2LRWA 2Y8FA 3B0AA 4AJWA 2JWZA 2HRJA 1Z87A 2BGFA
chains in the Genus database with same CATH superfamily
4WJPA 4JQWC 1U5GA 3FSSA 4MK0A 5D3VA 5HHDG 2L2IA 1AARA 4A5KA 4I6LB 2CJNA 2IJ0A 3IT6B 4L2YA 1XO3A 3ZRFA 2J4XA 3E66A 2DHJA 3ODWA 1V2YA 3EECA 3HVDA 2LI5A 4HLEA 3H7PA 4II3B 2IYDB 2MBHA 1K5GB 4HAVB 1E7VA 4GMVA 4S0RA 5DPTA 3NSUA 2M17A 4HDOA 2N1WA 3PGEA 3IG3A 1EAZA 4HB4B 2DX5A 2I1KA 1DBHA 1PDXA 3KWVA 1WI0A 3A1QA 4JKBA 1SSNA 2NMQA 5GXGB 1L2NA 2L8JA 4DXGA 4XYCA 4K3BA 1EF1A 1C77A 4OHJA 5I4DA 3P4SB 1TKYA 1F2RI 2N1VA 1ZXHA 3HK0A 3W1SA 4K81A 3UF8A 2CU1A 4WAFA 5JH5C 3AECB 4QJ3B 3DQVA 1TKGA 1KLUD 4A20A 5JHBA 3DCXA 1BT0A 3NZ3A 1FFVA 2RDHA 4ANWA 1EO6A 4P16A 3P42A 4MM3A 3BINA 4XZ4A 4HAYB 1K53A 2DZKA 1E10A 2MQJA 2GBKA 1N60A 4B0MA 2TSSA 3DPDA 5C3JB 2LJ5A 1V1PB 5M4YB 2LUEA 3KYDD 5IAAC 2AL3A 3CMMB 5CHFA 1N5WA 2ACZB 3LXFA 4LLGM 4QJ5B 2N9EB 5C16A 1Y5OA 1ZM0A 1F1HA 2COAA 1WX7A 2LWPA 1OFFA 3I63C 4KHAA 3IVFA 2CQUA 5DCNA 4CSQA 1NYRA 3NHEB 5E6JA 2D10A 2PTLA 2NBVB 1C9FA 1KF6B 1MKEA 3FKYA 2UU7A 2RD0A 3I57A 4MGKE 2INPE 2JF5A 3NVWA 2LZ6A 2Y5BB 1HBKA 5EE1A 2K49A 1WGHA 1U4AA 3Q14C 1T77A 5C2TB 4XDDA 4DDGD 2GMIC 1I4HA 1H4RA 3ENEA 2K6DB 2NBWB 3FILA 4FADA 5AZFA 1OQQA 4A8XC 3OWEB 2I2YA 3A4RA 3MDBC 2M8SA 1PYWD 3UZTA 2RVBB 2UZSA 4HXDA 3AEGB 5G5HA 1E5WA 2JWUA 1E90A 1TTNA 1ZPSA 3FVCA 2K3UA 1C4CA 4FLHA 4IWPA 5E6NA 2DFKA 1OY2A 3PZDA 1Y56A 4DHZE 1OEYJ 3CWIA 2V4IB 1V86A 5AUIA 1P7EA 2X18A 3A58A 2IO0B 5LNK1 4C0AA 4A3PA 1KOTA 3AE6B 3D8FA 1MPHA 4GGQA 1TKEA 2JSVX 3V5WA 1FAOA 3ODOA 2W9NA 4HCPB 1HTOA 3GYPA 2FCNA 4PS7A 1V5TA 1NU2A 1PLSA 4DQOC 2EJ8A 1RFAA 2BCJA 2E6XA 4ZHOA 2PZ1A 2JZPA 2KIEA 1VZ6A 2HJ1A 2KMMA 2JXTA 1EGXA 2ZNVB 4MH8A 3BVZA 4NJCA 1F9JA 2QEJC 3A9JA 3NVVA 1BTKA 4HAWB 3SUZA 2KUPA 4LJPB 4US8A 1RM6C 1ZE3D 4GU2A 1E7UA 3ML9A 4HPPA 1N3HA 1VCBA 4MT5A 1VJKA 2OTXA 2KJ6A 4WURA 3RN9C 2GBMA 2BYTA 1A70A 2CHWA 2KLCA 1WR1A 2NR2A 3BWUD 3P7ZA 4AWJA 3OJ4B 3V6CB 4CHKA 1KTKA 4WJNA 1OQNA 1WGRA 3GYOA 2NTTA 1R4NB 2K1FA 4HHVA 2ON8A 3RNAC 2KDIA 2BWES 2GI9A 1FXIA 5KHOA 2VZKD 1U5EA 3M1IB 2YLMA 2ONQA 4IM3A 4TYZA 4NJ6A 5D6JB 2ZNVC 1QKZA 2RRFA 1NEKB 3L16A 2WYQA 4JLCA 1N62A 4HSIA 4WIPA 4IWQA 4DX8A 2KMAA 3RZFA 3AEDB 4REZA 3AE9B 2BTEA 3J9CA 2N7JA 2R09A 4W9HA 3QHTA 2MWNB 5IO9A 3AU5A 5AEKB 2X8XX 1U5FA 2GJYA 1WZ3A 2K8CA 1L7YA 1QOAA 1OEYA 2QKMA 2M56B 3PZ8A 4K7SA 3PHWB 4WJ7A 3SNHA 1EWYC 2RNRB 4G11A 2D11A 2KK8A 3ECIA 4YTMB 4LNKA 3PTFC 2JZ3B 2QIEB 5LG4B 1V81A 1MIXA 1LB1A 1YJ1A 1L5PA 2DX5B 2K00A 1W1HA 1EUVB 2G1EA 2FE8A 1D5ZC 4DXAB 4KGTA 5L81A 3NVZA 1GB1A 2ELBA 2GBRA 1RYJA 4HWIB 1EU3A 3A33B 1TXDA 4G3XB 3AE2B 1Q5WB 3APCA 2BF8B 1WZ0A 5T8IA 2QHOA 2JYTA 3QIJA 1XLPA 4M0WB 4K2OA 2Z4DA 2LFIA 2KANA 4MELA 1WWTA 4ILHA 1C1YB 1VBGA 3V60A 4K17A 1EWCA 1AW7A 2QDFA 2GB1A 3IAM1 2N9XA 2KQ4X 2ZPNA 1HXYD 2UYZB 3S2AA 3TL5A 3DBHB 3VTWA 5C5BA 5HKHA 1UWXA 4NQLB 3VRAB 3U7DA 5AZGA 1FNWA 1B55A 1ET6A 3RUIB 3BK1A 3W1SC 1RJ2A 5EFXA 1WG7A 1L6UA 4HB2B 3TVVA 3MC0B 1FNUA 4BZAA 3QWMA 4IFSA 5FK9C 4EEWA 3PVUA 3PV1A 4LNNA 2AWTA 1YN4A 3ETRA 1C79A 2KTFA 4IAPA 1KZGA 4GN1A 4WWPA 5IRSA 1G6JA 1XODA 3RULA 3FILB 3ZXVA 2BYVE 4WQMA 3AB5A 1T0SC 1N63A 2JU6X 1D4BA 3L13A 1KM7A 2R2QA 1JDEA 2N4FA 2SEBD 3KUZA 2DAFA 4EE2A 1SGHA 3V62A 3D8DA 1RRPB 2MBQA 3RNFC 4GXBA 3SFEB 1TS3A 5D3YA 2LOZA 2DLBA 4YXDB 5HE0A 5HG2A 2AQ1B 3AN1A 4PYUA 3KRXA 2M14A 4WH4A 2GOWA 2QKLA 2ZKMX 1GC6A 4NAMA 3IFWB 1IBXA 2N7DA 3N3KB 4IG7B 1DIKA 3W1YA 3KUCB 2MP2A 3CSTA 3APFA 4OVZA 5E6PA 1ACCA 2Q5WD 3KSYA 4HROA 3VR9B 4FHJA 2M0AA 2MSED 3WANA 3A9JB 3KVFB 2J7QB 2NZ8B 1CMXB 3WAPA 3Q8EA 1N6ZA 5DIFB 2LASA 5GOWB 1V8CA 4AP4C 3KYCD 1MAIA 1FHOA 2DAJA 4IM0A 1Q1OA 2PJHA 3DHGC 3R7QA 1M4VA 2IY1B 1H10A 5D2MB 2WQYB 1AN8A 3PRZA 5E6OA 3NWDA 4D2KA 2COFA 1V5MA 2KVZA 1FCLA 5IOIA 3IXSA 3PG7A 3GOEA 3TEXA 2N0SB 4DX90 4PYZA 2R0DA 1ZP0B 1L4DB 1XD4A 2JT4B 3N30A 3NS1A 4FJZA 3GB1A 1TYGB 3WAMA 5IKCM 1PGXA 4MGYE 2NMBA 5J18A 1W1GA 2LGSA 1E9MA 3DVNV 1QOBA 3QQ8B 4HK2A 1GAQB 3G9WA 1CJEA 3GP7A 3MPXA 1MPEA 2N9KA 3U2SC 2QC8A 4MGIE 2Q13A 4K1RB 4KX6B 2IBIB 1UNQA 3PSCA 1TIFA 2BYEA 5D3DA 3ZTCA 1FCCC 4NAWB 1PQSA 4M01A 1XT9B 3DXDA 2C60A 3SFDB 3O65B 2DYBA 4JPSA 1SE2A 2RPQA 1C4PA 1HTQA 1I4RA 3DWMA 2KO3A 3AEFB 1D5MC 3HIEA 1XCQL 1WJMA 4NNJB 4F7ZA 2FDQA 1WM3A 3R8BA 3ZO5B 1NBFC 1K52A 1UWMA 3BK2A 1TBEA 2GS0A 3DHHC 1WYGA 2KWUB 1WMHA 1VBHA 4IWOA 3T9LA 2KFKB 4RF0A 2L52A 2Z0PA 2K5PA 3HRDD 3HM3A 1DROA 2V76A 1MG4A 5LONB 3EGRA 3KW5B 4OVVA 3URYA 4ZOHC 1SE9A 1ISNA 4KIKB 4KKJA 1ZKHA 1TQZA 1WE6A 1MI0A 1DDWA 1XX0A 4RGNA 1BWNA 4HAUB 3UQAA 1QF6A 2RSGA 2D4QA 4QJ4B 3OJ3A 4K7UA 2L76A 3AE7B 4JK7A 4ZHPA 3NWAA 2DHKA 2DBYA 5C5BB 4JWUC 4BVUC 2KTRB 2Y7BA 2N9LA 3K9PB 4M00A 3NY5A 3QWZB 1L4ZB 4NY0A 1ROEA 2IPKD 1DDVA 1JWUD 4HCNB 2Y5PA 1WR6E 1FHXA 1PMSA 2WXLA 3AXCA 2DZMA 2QCZA 1IRSA 2LOXA 3OLMD 2J53A 1M7EA 1R4MI 4A6QA 4KAXB 1P3QU 1V61A 3HIZA 2HE7A 4Z2NA 5DPSA 1KZ7A 1X05A 3DVNU 3Q3FA 2DLWA 3SD5A 1WM2A 1UH6A 3C8YA 2IO3B 4KGRA 3PRPB 2UZRA 4PS8A 3C19A 1NTYA 4M8NA 2AQ2B 4KSLC 1P0RA 2LRUA 3MHZA 3AE8B 4E74A 2W2XC 1NVLA 4P1BC 2KZRA 3QJZA 5CX3A 3AE4B 5LOPB 2AL6A 1WIAA 3PLUA 5D94A 1ACAA 3AJ4A 2IGGA 1KH0A 1F77A 4LDTB 1MK9B 3HHMA 4TV3A 3ULCA 1V88A 2M38A 3UINB 2Z0OA 2IO1B 1T3QA 3U7ZA 1NI3A 4MEMA 4BBNC 2WDTB 4EUTA 4EZLA 2UVMA 5H92C 3TFMA 2KYWA 4F8CB 4RMAA 2H7EA 4WQOB 1WGQA 4IOIE 3ZTDA 4NJ7A 1KLVA 4RCOA 1ZC3B 2N7EA 2WX0A 3NOBA 3RZWC 1N5XA 3TW1A 2KHWB 3P2BA 4XC2A 3FAHA 2MP2B 3PS6A 5EE9A 4JX1C 1V6EA 4JWSC 3WA0A 2D07B 3LYYA 5BMHA 4AS1A 4N59A 2JVCA 2I1JA 5BO4B 2W3RA 3Q3JA 4GZUA 3VUXA 3PEGA 2D9WA 4GNKB 4TSSA 3RNGC 3PREA 4EZKA 2VSZA 2J0JA 1QOGA 1WGDA 4RH6A 2FAZA 5CHWA 4MGZE 1AWEA 5AZHA 3ZXRA 4DDID 2MJDA 2LULA 2EMSA 2CU3A 1FXTB 1S3SG 2L1AA 4RFBA 4LK0M 1WH3A 1XLNA 2PLPA 2MKRA 3PZ7A 2PW9A 4XX5A 2WXGA 4ZYNA 2O2VA 1LGRA 2J0MA 1GPXA 3GZNB 4IC7B 3SDLC 1EM7A 2I5FA 4P6VF 1UBQA 1GG3A 2MFQA 1YOVB 3BYYB 1SHCA 4OZAA 4DHZB 2CRFA 1DDMA 1T0RC 2KR0A 2XK5A 2RSUA 1E7PB 2KC1A 1EU4A 4ZRPA 3RCZA 2L1CA 1UNRA 2PPHA 2HTHB 2MCNB 2K2UA 3ZYYX 1P9DU 3I3TB 4DXFA 1SB3C 1XCTL 1V5UA 3M95A 2ELAA 2Z0QA 4KZCA 4M02A 4K3CA 4C80A 3H6NA 3SO6A 3L08A 3ALBA 1SEBD 1OTRB 4OVUA 3NW8A 3R3MA 1LFDA 2WXOA 1Q67A 4IDIA 1SE4A 3IAS1 3BJIA 1UGMA 4JKGA 3I9V1 2KDFB 4WJQA 3KH0A 1SIJA 4ILJA 3AEBB 5FKAC 1S1QB 2FUHB 2RMMA 1I2HA 3T8MA 3SR6A 2FIDA 2RDBC 2DHIA 4PS3A 2MWSB 2O6VB 1BMLC 2WXFA 2L0FA 4W9EA 2BVCA 5I2SA 1TY2A 2M4NA 1RAXA 5G5GA 2K8BA 3VUWA 1YJIA 1P1AA 2M1MA 1VZ8A 3BYTB 4Q2JA 3L54A 4RM8A 2CHZA 4KHBB 2GRIA 2WXIA 4A6KA 2DKPA 3OHMB 2DIKA 2IGDA 1OGWA 4URKA 3Q8BA 2P0HA 1J0WA 5GMVA 2GLSA 2EKIA 3KLSX 2AYOB 3R7RA 5CLQB 2W2XD 4YONA 3FM8C 4S17A 1BAKA 2WXKA 1VLBA 3SU8X 4N9F4 2YT1A 1X1FA 3CXBB 4D0NB 4MY6A 3NUHB 3TUOA 1MIZB 4MJSA 3U4EG 3ZDTA 2C7HA 2KIGA 2DENB 5DH9B 3KWLA 5C79A 2RR9A 1V1OA 2G9HD 3VR8B 1JCKB 3F0WA 3T3OA 4JKFA 5C1ZA 1FGZA 4YL8A 1SF0A 2NPTA 2CY5A 4MSQB 2C7NB 1WJ4A 2CS4A 2V3SA 4TMAB 5BMGA 2FNJB 2ASQA 1KC7A 3L10B 2VH2A 2N0YA 2L32A 2OHFA 5CLLB 3ZUNA 1Y19B 2M19A 1TJ6A 3MJWA 3RNEC 2DX1A 2ROVA 5C23A 3DOWA 3BY4B 3Q2AC 4LDTD 4A6HA 4YSZB 3H7PB 3AULA 2MDXA 5G2NA 1FHWA 4DBBA 3F5RA 3W5VB 3ZKJC 1GJZA 1YMHE 4A55A 2XQNM 1XKEA 2KOXA 2WXMA 1MK7B 1IPGA 3A1QB 3VTVA 4WAAA 4H2AA 3H9DA 1IGCA 1X1MA 1FEHA 3FEHA 1ZUD2 4WVFB 3EFUA 1I42A 1KI1B 4NSWA 1NYQA 2OJRA 1FMAD 2MJEA 3RMKC 1R4MB 2INDC 2ADZA 2Z59A 3U8ZA 1K5DB 2CODA 3RNBC 2COCA 1F0ZA 2C7MB 1GNUA 1FO4A 4MM3B 5FR6A 3B1LX 3ZNHB 1IYFA 2WLBA 1H8CA 1SXTA 2LMCA 3U12A 1C4AA 3VHTC 3E9LA 2PE9A 3ZGZA 1J8CA 3RFZB 1P6SA 2KVRA 4LJOB 3ZW3A 1ZW7A 2K6QA 3R66C 2O2VB 3M63B 3P4QB 4P7IA 1ZGUB 2L83A 3L4PA 2XBBC 2P0FA 1XCGA 3EPYA 3QBVB 2RUKB 2CKHB 2V0GA 2KAJA 3HQCA 1XLOA 4II2B 5BYSA 2XK5B 4QXAB 4HB0B 2JXXA 2LJIA 2DTCA 3AE3B 3R2IA 2G45B 3ZLZA 2L00B 3JVZX 4GIVA 2KXJA 2LD9A 3SYXA 1R7SA 1RRBA 3H7SA 1YQBA 2FCMA 3T06A 1OMWA 4ICUA 4C56C 1UEFA 3P1MA 1T0QC 2LGIA 4BKSD 2FUG1 3PP2A 4KKIA 3ZJUA 4HPLB 4A6FA 2INNE 1UBIA 4F7UP 4GMXB 2ZCBA 3JSVA 3U52E 1TJEA 2D9ZA 2ABDA 4J3OD 2PVOD 4A3OA 2W54A 2WXHA 1I7AA 4NQKE 5KQ1A 4XWXA 2MBEA 2YT2A 1SJED 4EZJA 1QZEA 4JK9A 1WF9A 4C4VA 3N32A 1WI1A 1C76A 4WWNA 2O6VD 3ZDMC 4GSWA 4ILGB 1FB8A 2KKCA 2WU5B 2VH1A 2PMVA 4AQ7A 3E9SA 4ZYSA 4BAXA 3EA6A 3Q3NC 2BS2B 3B08A 1DOIA 2KUQA 1F2RC 5CTRC 4DWFA 4F7GA 5JHGA 3ULBA 1WXVA 3SBGA 2KJRA 5HE3A 2EC1A 1GB4A 5KQ4A 3OAWA 3APDA 3LB8C 3TMPB 1B9RA 2OOBB 2LHEA 1E8YA 3HSAA 1ZVRA 1QC6A 2WDRB 4OW0A 1UD7A 3WYFB 1QQRA 4CQNA 4BKTA 2XNAC 3RYTA 4DHJB 3AH7A 1XR0B 2G3QB 4WWOA 3DHIC 1I4XA 4N58A 4XGAB 5D7GA 4W9GA 1TS2A 2QMTA 2ZJDA 1KFYB 2BB6A 2OEDA 3MC9A 1HQRD 1VZ7A 4A9AA 1IGDA 1WXSA 2X0SA 1ZOYB 3VOQA 1WFYA 1WVHA 5EDSA 1E8XA 4OZCA 3BZDB 4HAXB 1WGUA 2NPTB 1XD3B 3PLVA 1KBLA 1ZYIA 2YF0A 4Y94A 5D3WA 3EHVA 1FRRA 2FBWB 3DWGC 1CK1A 1GUAB 2CHXA 4YSYB 1V1PA 1PFJA 2DN6A 2RDGA 1UNSA 3TEZA 4R3DA 3AI5A 2J0KA 1N61A 1DOYA 5FR3A 4Z2MB 4JE3B 3MFGA 5DHFB 3DCGA 3BVGA 4KDLB 5BMIA 3X23A 2J52A 2MH7A 4J6IA 1UELA 2W55A 3N20C 2MW5A 3PVLA 2CY4A 1WX9A 2NBVA 1QT9A 2KQSA 2MHJA 3VAWA 2LHDA 4ANVA 2K8HA 1X1GA 1WXMA 4ZRQA 2E3TA 3RPFC 2K39A 4EFOA 4WSFA 3O96A 1MHXA 1J7AA 3ZVVA 3L0WB 3SHQA 2Y5CA 2I5CA 2YS3A 3GE8C 3ZIMA 4L1RA 3BVMA 3N9YC 1R4NI 4GOUA 1LW3A 3TCAA 2LVOA 2BS3B 1L0VB 1Q10A 2ZVNA 1TS5A 1YJJA 4FHKA 2ZPYA 4PNKA 2P8VA 2L0TA 2LGXA 1J7CA 1JQ4A 4EKUA 4LCDE 1Z5SB 2RGFA 3LJ3A 2IY0B 2JZZA 2Z0DB 5EE3A 4HEA1 2DYQA 4EOYA 4JKEA 1HA5A 3VRBB 1UNPA 4FXCA 3NG0A 1C78A 2QSDA 1V89A 2RPVA 4EJNA 5G55A 2KDBA 4JK8A 1J7BA 5DHAB 1FGYA 5J3YA 4NPNA 2I38A 5H8YE 3HUIA 1M7RA 5BYRA 2Z8LA 1XEEA 4KGSA 2DA0A 3SEBA 2GBNA 4M8MA 3Q69A 1VRAB 4G0NB 5LLIA 3UI3A 4C7YA 3UQBA 4KVGB 2GUMA 2BT6A 2JX5A 3TEWA 3I5JC 1ZXIA 2KNBA 5DPWA 1PFDA 1P98A 4WJOA 1WXQA 4K7WA 4ANXA 3IHPC 2HTME 1VR9A 3NWFA 5I2MA 2B76B 4K2PA 5KCVA 3JSVB 1NTVA 2BBCA 1JWMD 3H8HA 2JP2A 2A5UA 3QCAA 2RQ1A 3RT3B 2QJLA 1UZXB 3FLVA 4B0EA 2JRIB 4C4VB 1MVKA 2BQQA 4F7HA 2WWZA 3MTNB 1AYFA 3DBHI 1ENFA 2VRWB 1U5DA 1IUEA 3ONSA 2MLBA 2OJWA 4B95A 1E8ZA 2HD5B 1P7FA 1XF5L 4US9A 3P4PB 4FJYA 1IBXB 3R2TA 2R2YA 3N7CA 3VVWB 4KHOA 4HAZB 3FC4A 4CYEA 1K51A 4E71A 1V5PA 4ASWC 3TEYA 1LO5D 3TSSA 2LEKA 2WDVB 1TT5B 4B6HA 3VTUA 1LM8B 5HFYA 2LKOA 4ITKA 1WE7A 2R2OA 3OG5A 4BOZB 4NZLB 1IP9A 3MHSD 3RI7C 2KGXB 1GOZA 2R61A 3PT2B 4JGHB 4QAYA 2GCLA 1MJDA 2R82A 2JY6A 4IKGA 4DHJD 2ROZB 3KUDB 4IW0A 4YT0B 3WCQA 2EKEC 3WAOA 1RWSA 1UPQA 2BB5A 2KFJA 1QQGA 3NS8A 2DZIA 2WU2B 1JW9D 4M0WA 1X86A 4CHMA 1MHHE 1HB6A 2PE6B 3A8PA 2INCC 2KQ7A 4MT7A 2YS1A 2MBOA 4W9IA 1RFKA 2HDEA 2NS5A 3AU4A 2YRYA 3B9JA 3AE1B 5JLJB 2HJ8A 3A8QA 4HKZE 1T6BX 4FA6A 1Q0WB 2PVGC 1L0XB 1FXAA 1L6VA 5L95C 2WP9B 4IM2A 3PRMB 1YX5B 2EMTA 1NVID 4FBJB 4BBNF 3E9OA 2LXCA 2RGNB 1YN5A 1DGJA 3MC8A 1JWAD 3KY9A 1WJ6A 2WXPA 2W82A 2IO2B 1D6EC 1A5RA 2KJHB 3ZJTA 2KCJA 1YQ3B 3BIID 2YEPB 4ZRKA 1WGGA 3OANA 1DYQA 3EUB2 4BOSC 2KN5A 1NI2A 4EMOA 2ZW0A 2MX2A 4ICVA 3A9KA 3TIXA 2WHIA 4X57B 4BKGA 2FJ9A 1M94A 3AE5B 1SIFA 3C0RB 4KDIC 4ZDVA 4JKCA 4GDKA 3ZNZB 2WNMA 3L17A 1U27A 3IT4B 4JL9A 3ZVRA 1WMHB 2AX5A 3B2FA 4YWGG 1V80A 4GLSC 3AEEB 1JWSD 2WGSA 1J0GA 4OSNA 3QX1A 4ANUA 4IUMB 2DYNA 4USAA 4ZRIA 2UWQA 2BS4B 1QILA 4B9KA 3QC8B 1AQCA 2P0DA 2XN9C 2KWDA 1OQRA 5JXVA 2WX1A 4HDQA 2MBBB 1B1ZA 2ZEQA 2FIFA 5J2RA 4RM9A 1YNTE 3EFCA 2PKOA 2WXNA 1CQVA 2D3CA 3ZRCA 1V49A 2V3PA 1EF5A 4RF1A 4GDLA 4XWTA 1I7HA 2IZVB 2DNFA 3X0WA 4ARIA 1K50A 4L6EA 2KD0A 3DBRI 3KZ1A 1E8WA 1ST7A 1JRUA 1T5XD 1JALA 2V4LA 3M62B 2Z14A 2BYFA 3NRZA 3VH4B 5JZEB 1YD8U 3Q3OC 3VFKA 4DK5A 2IFSA 3TJPA 4B6WA 5IP4D 2REXA 3PHXB 5FI1A 3CIRB 3V61A 2K8EA 1RLFA 3D32A 1F52A 3N1YC 2LYDA 2YVCA 5D27A 2CJOA 1CZPA 3VXWA 3VIAA 1YIWA 4O1NA 4WWMA 2SAKA 5IN7A 4PQ0A 3DBSA 1BUIC 1HEZE 1WX8A 4I6PA 4LTUA 5AUKA 3V6EB 2WDQB 1KRHA 3HW2B 4HKQA 2LXAA 2GBJA 1EVHA 2VKIA 2KLGA 2W3SA 4XE0A 1FD6A 3MJ5A 1I4QA 3ABVB 1TGZB 3ML8A 3AMZA 3Q6BA 1BTNA 5JVLA 1U29A 2RLOA 3RCPA 3Q3MC 2WS3B 3SV1A 2LGDA 3N1ZC 4RGOS 3VDZA 2Z13A 2YEPF 1DYNA 1SJHD 4P1CC 4W9LA 5L83A 3ZNGC 3JW0X 1WJUA 4NAWA 2KX0A 3HM6X 4HPMB 1UF0A 2L05A 2KMCA 1WJ1A 4W9FA 5HI1A 1OQYA 1L0YB 1HB8A 2FJLA 3LDZE 4UDUC 3PVWA 1ZDXA 1BXTA 3VH3B 2Y8GA 1FM0D 2NBUA 2FJUB 2WXQA 1FIQA 4W9KA 2KDEB 1SE3A 3DBLI 3WALA 2IDYA 3ODXA 5TR5A 2ZVOA 3CIKA 2LUMA 2G35A 2YT0A 4KV2A 4XDCA 2N23A 1TZ1A 3NJTA 2CB8A 2KFKA 2WXRA 3AV8A 1VD2A 2BWFA 4I6NB 2MA9B 5JP4A 2CAYA 2MJ3A 1QOFA 2MRPA 4OZBA 5DI9B 3LJUX 4KIKA 4JKAA 1QLBB 2M0XA 3PSEB 3VQIA 4HJKA 2IYBA 4JKDA 1PGAA 4E3CA 3DDCB 4H8SA 3KRWA 3P63A 2JUOA 4MDKE 3Q8AA 5CHVC 4XWWA 5D3IB 1JROA 1SBBB 1KJTA 3K9OB 3B77A 1MI1A 2LGYA 2C9WB 4HVBA 2NVUI 3CF6E 2B3AA 1UPRA 2ZW1A 1C3TA 2KTRA 3EC8A 1WSPA 2X38A 4GPTB 1E0ZA 1D3ZA 2KWCA 4D6WA 2XEWA 4BFRA 1FFUA 3VUYA 1FRDA 2PIAA 2WH5A 5KHQA 5DPRA 1GGOA 2BKRB 4TQ1A 4FN2A 5J17A 4HJGE 3A9KB 3A98B 2IGHA 3Q8CA 1NTIA 4JKGB 4GDKB 1WY8A 1DOXA 3QA8A 3P6AA 1D5XC 1I35A 2D5GA 1V97A 2VRRB 5JHAA 5HE1A 3E9PA 1ZSQA 2K2JA 4F1SA 3TO1A 4TUUA 1VDVA 3GZNI 4C00A 4LNFA 5FI0A 3U30A 4OT1A 1FOEA 2G4DB 2KDMA 5TSSA 3DXEA 2J42A 2LVQA 4JKHA 2K0PA 3ZNID 4AUQC 3QK0A 1WYWB 4N6EB 4YTNB 2NTSA 3PPAA 2OQBA 1W1DA 1MFWA 5JHHA 1STEA 2DZJA 1X11A 2COPA 3UGBB 2BW2A 2D9VA 4YTPB 2JRHA 4HB3B 1HZ6A 2GCJA 4GDLB 3H1UA 1JMLA 4DBGA 1LXDA 2K9XA 4PK1A 1XLQA 4ARCA 2W2WA 1XXGA 4JIOU 3A4SC 3KQ4A 3QAQA 3GS2A 4MJSB 1YN3A 4DIXA 4MH0E 2V9HA 4CO7A 1Y8RC 5HE2A 2YSZA 1WXAA 1V5OA 1HZ5A 1LQBA 3QARA 1Z2MA 3W5UB 4AJYB 1P3RA 1FNVA 3CSFA 2KC2A 3V05A 2D9XA 1ESFA 4CHJA 4RGTA 3ML4A 2LG1A 2V3NA 1P5TA 1K8RB 5J3QA 4LNIA 3P4RB 4HATB 3NZSA 4TQ0A 1JWBD 1V9JA 3W2DA 2DHZA 3RD2A 2Y3AA 3UIOB 2BPSA 1TY0A 2H7DA 1YX6B 4GOCA 5C6RA 2MEKA 1XQQA 2ZCCA 4GB9A 4L1BA 4RGMA 1JRPA 2QILA 4BBKA 5LXHA 4KSKC 4ACFA 2V1YA 4W9JA 2HTHA 1PUTA 3JYUA 4AOFA 1J19A 1WJNA 2WXJA 1KLGD 4PT5A 3RNCC 3NVYA 1E6EB 4KZ0A 1WGKA 1ZDVA 2JPHA 4MACA 1AWDA 5BYQA 2H88B 1U2BA 1WRDB 2LBBA 3B2GA 2KN4A 2PEAA 4BKSA 5IJMA 3DBRB 2C5LC 1YQ4B 5D3XA 4G50A 3WIMA 2K25A 2N9PC 2JQRB 4A90A 4W9DA 3M3JA 4FULA 2D3BA 3AEAB 2Z59B 1NENB 2H89B 2D9YA 3D8EA 3O13A 2AQ3B 2FCSA 4IOYX 3DXCA 2AEHA 3GE3C 3HVZA 5EE0A 2O6VA 2LVPA 4YSXB 1WGYA 2ZZPB 5IA7A 1MG8A 1ZC4B 3E56A 3DVGX 4C7ZA 4TKNA 2G4SA 3UIPB 2J59M 3IBEA 1NDDA 5MPOA 2EELA 1T0YA 3W9CB 1ET9A 2KX3A 2DWQA 3MP9A 3Q8FA 4KHBA 2CR5A 2DYMA 2Z0EB 2A4ZA 2DKQA 2K22A 1HE8A 2D2QA 3FP5A 3DVGY 1FPYA 2FCQA 2E2XA 2DYOA 2KWVB 4LNOA 2YS5A 4W9CA 1GC7A 1UGJA 4ZRJA 5J3TA 4FJVB 3TBLD 3ZQ4A 3NZUA 2L3ZA 2NCNA 3V3XA 2BKFA 1PGBA 3AM9A 2D3AA 4MSMB 1WRIA 3N1XC 1I4PA 4RNAA 2JYEA 3ENBA 4HRSA 5LXIB 3ZJVA 2ICIA 2L7RA 2VZKB 1TZOA 2D3GA 2KT7A 3T3NA 4A6FB 1UUPA 2LRWA 4L23A 1I4GA 3PO0A 3DBLB 2Y8FA 2KACA 3B0AA 4AJWA 1TS4A 2JWZA 2HRJA 3SBTA 1Z87A 2BGFA
chains in the Genus database with same CATH topology
4WJPA 4JQWC 1U5GA 3FSSA 4MK0A 5D3VA 2L2IA 1AARA 4A5KA 4I6LB 3ZRFA 3E66A 2DHJA 3ODWA 1V2YA 3EECA 2LI5A 4HLEA 3H7PA 4II3B 2IYDB 2MBHA 1K5GB 4HAVB 1E7VA 4GMVA 5DPTA 3NSUA 2M17A 4HDOA 2N1WA 3PGEA 3IG3A 1EAZA 4HB4B 2DX5A 2I1KA 1DBHA 1WI0A 3A1QA 4JKBA 1L2NA 2L8JA 1EF1A 2N1VA 3HK0A 3W1SA 4K81A 3UF8A 2CU1A 5JH5C 3DQVA 4A20A 5JHBA 1BT0A 4ANWA 1EO6A 4MM3A 3BINA 4XZ4A 4HAYB 2DZKA 2MQJA 2GBKA 3DPDA 2LJ5A 2LUEA 3KYDD 5IAAC 2AL3A 3CMMB 5CHFA 2N9EB 5C16A 1Y5OA 1ZM0A 2COAA 1WX7A 2LWPA 4KHAA 3IVFA 2CQUA 5DCNA 3NHEB 2D10A 2NBVB 1MKEA 2RD0A 4MGKE 2JF5A 2LZ6A 2Y5BB 1HBKA 1WGHA 1U4AA 4DDGD 2GMIC 1H4RA 3ENEA 2K6DB 2NBWB 4FADA 5AZFA 3A4RA 3MDBC 2M8SA 3UZTA 2RVBB 2UZSA 4HXDA 1E5WA 1E90A 1TTNA 4FLHA 4IWPA 5E6NA 2DFKA 1OY2A 3PZDA 4DHZE 1OEYJ 1V86A 2X18A 2IO0B 4C0AA 4A3PA 1KOTA 3D8FA 1MPHA 4GGQA 3V5WA 1FAOA 3ODOA 2W9NA 4HCPB 3GYPA 2FCNA 4PS7A 1V5TA 1NU2A 1PLSA 2EJ8A 1RFAA 2BCJA 2PZ1A 1EGXA 2ZNVB 1F9JA 3A9JA 1BTKA 4HAWB 3SUZA 2KUPA 4LJPB 4GU2A 1E7UA 3ML9A 1N3HA 1VCBA 2KJ6A 2OTXA 2GBMA 2CHWA 2KLCA 1WR1A 2NR2A 3P7ZA 4AWJA 3OJ4B 3V6CB 4CHKA 4WJNA 1OQNA 1WGRA 3GYOA 2K1FA 4HHVA 2KDIA 2BWES 5KHOA 1U5EA 3M1IB 2YLMA 4IM3A 4TYZA 4NJ6A 5D6JB 2ZNVC 3L16A 2WYQA 4JLCA 4IWQA 4DX8A 2KMAA 3RZFA 2R09A 4W9HA 3QHTA 2MWNB 3AU5A 5AEKB 1U5FA 2GJYA 1WZ3A 2K8CA 1L7YA 1OEYA 2QKMA 4K7SA 3PHWB 4WJ7A 3SNHA 2RNRB 4G11A 2D11A 2KK8A 3ECIA 3PTFC 2JZ3B 1V81A 1MIXA 1LB1A 1YJ1A 2DX5B 2K00A 1W1HA 1EUVB 4DXAB 5L81A 2ELBA 2GBRA 4HWIB 3A33B 1TXDA 4G3XB 1Q5WB 3APCA 2BF8B 1WZ0A 2QHOA 3QIJA 4M0WB 4K2OA 2KANA 4MELA 4ILHA 1C1YB 1VBGA 3V60A 4K17A 2N9XA 2ZPNA 2UYZB 3S2AA 3TL5A 3VTWA 5C5BA 5HKHA 4NQLB 3U7DA 5AZGA 1B55A 3RUIB 3W1SC 1RJ2A 5EFXA 1WG7A 4HB2B 3TVVA 3QWMA 4IFSA 4EEWA 3PVUA 3PV1A 2AWTA 2KTFA 4IAPA 1KZGA 4GN1A 4WWPA 1G6JA 1XODA 3RULA 2BYVE 3L13A 1KM7A 2R2QA 1JDEA 2N4FA 3KUZA 2DAFA 1SGHA 3V62A 3D8DA 1RRPB 2MBQA 4GXBA 5D3YA 2LOZA 5HE0A 4PYUA 3KRXA 2M14A 2GOWA 2QKLA 1GC6A 3IFWB 2N7DA 3N3KB 4IG7B 1DIKA 3W1YA 3KUCB 2MP2A 3CSTA 3APFA 5E6PA 3KSYA 4FHJA 3WANA 2MSED 3A9JB 3KVFB 2J7QB 2NZ8B 1CMXB 3WAPA 5DIFB 2LASA 5GOWB 4AP4C 3KYCD 1MAIA 1FHOA 2DAJA 4IM0A 1Q1OA 2PJHA 3R7QA 2IY1B 1H10A 5D2MB 3PRZA 5E6OA 2COFA 1V5MA 3PG7A 3GOEA 4DX90 4PYZA 2R0DA 1XD4A 2JT4B 3N30A 4FJZA 3WAMA 5J18A 4MGYE 2NMBA 1W1GA 3QQ8B 3DVNV 4HK2A 3G9WA 3MPXA 4MGIE 2Q13A 4K1RB 2IBIB 1UNQA 3PSCA 2BYEA 3ZTCA 4NAWB 1PQSA 1XT9B 3DXDA 2C60A 3O65B 2DYBA 2RPQA 2KO3A 1WJMA 4NNJB 4F7ZA 2FDQA 1WM3A 3ZO5B 1NBFC 1TBEA 2GS0A 2KWUB 1WMHA 1VBHA 4IWOA 3T9LA 2KFKB 2Z0PA 3HM3A 1DROA 2V76A 5LONB 3KW5B 4OVVA 1SE9A 1ISNA 4KIKB 1ZKHA 1TQZA 1WE6A 1DDWA 1XX0A 1BWNA 4HAUB 3UQAA 2RSGA 2D4QA 3OJ3A 4K7UA 2L76A 4JK7A 2DHKA 5C5BB 4BVUC 2KTRB 2Y7BA 3K9PB 3NY5A 3QWZB 4NY0A 1DDVA 4HCNB 1WR6E 1FHXA 1PMSA 3AXCA 2DZMA 3OLMD 1IRSA 2LOXA 1M7EA 1R4MI 4KAXB 1P3QU 1V61A 3HIZA 2HE7A 4Z2NA 5DPSA 1KZ7A 1X05A 3DVNU 3Q3FA 2DLWA 3SD5A 1WM2A 1UH6A 2IO3B 3PRPB 2UZRA 4PS8A 1NTYA 4M8NA 4KSLC 1P0RA 2LRUA 4E74A 2W2XC 1NVLA 2KZRA 3QJZA 5CX3A 5LOPB 2AL6A 1WIAA 3PLUA 5D94A 1ACAA 3AJ4A 4LDTB 1MK9B 3HHMA 4TV3A 3ULCA 1V88A 2M38A 3UINB 2Z0OA 2IO1B 4MEMA 4BBNC 2WDTB 4EUTA 4EZLA 2UVMA 3TFMA 4F8CB 4RMAA 2H7EA 4WQOB 1WGQA 3ZTDA 4NJ7A 1KLVA 1ZC3B 2N7EA 2WX0A 3NOBA 3RZWC 3TW1A 2KHWB 3P2BA 4XC2A 2MP2B 3PS6A 1V6EA 3WA0A 2D07B 2JVCA 2I1JA 5BO4B 3Q3JA 4GZUA 3VUXA 3PEGA 2D9WA 4EZKA 3PREA 2VSZA 2J0JA 1WGDA 5CHWA 2FAZA 4MGZE 1AWEA 5AZHA 4DDID 2LULA 2EMSA 1FXTB 1S3SG 1WH3A 2MKRA 4XX5A 4ZYNA 2O2VA 2J0MA 4IC7B 3SDLC 2I5FA 1UBQA 1GG3A 2MFQA 1SHCA 4DHZB 2CRFA 1DDMA 2XK5A 2RSUA 2KC1A 3RCZA 2L1CA 1UNRA 2PPHA 2HTHB 2MCNB 2K2UA 1P9DU 3I3TB 1V5UA 3M95A 2ELAA 2Z0QA 4KZCA 3H6NA 3SO6A 3L08A 3ALBA 1OTRB 4OVUA 3R3MA 1LFDA 1Q67A 3BJIA 1UGMA 4JKGA 2KDFB 4WJQA 3KH0A 4ILJA 1S1QB 2FUHB 3T8MA 1I2HA 2FIDA 2DHIA 4PS3A 2MWSB 2O6VB 2L0FA 4W9EA 2M4NA 1RAXA 2K8BA 3VUWA 1P1AA 2M1MA 3L54A 4RM8A 2CHZA 4KHBB 4A6KA 2DKPA 2DIKA 1OGWA 4URKA 2P0HA 1J0WA 5GMVA 2AYOB 3R7RA 5CLQB 2W2XD 4YONA 3FM8C 1BAKA 3SU8X 4N9F4 2YT1A 1X1FA 3CXBB 4D0NB 4MY6A 1MIZB 4MJSA 3ZDTA 2C7HA 2DENB 5DH9B 5C79A 2RR9A 3F0WA 4JKFA 5C1ZA 1FGZA 4YL8A 2NPTA 2CY5A 4MSQB 2C7NB 1WJ4A 2CS4A 2V3SA 2FNJB 2ASQA 1KC7A 3L10B 2N0YA 5CLLB 3ZUNA 1Y19B 1TJ6A 3MJWA 2DX1A 2ROVA 5C23A 3DOWA 3BY4B 4LDTD 4A6HA 3H7PB 3AULA 2MDXA 5G2NA 1FHWA 4DBBA 3F5RA 3ZKJC 1GJZA 2XQNM 1XKEA 2KOXA 1MK7B 1IPGA 3A1QB 3VTVA 4WAAA 3H9DA 1X1MA 3FEHA 4WVFB 3EFUA 1I42A 1KI1B 4NSWA 2OJRA 2ADZA 3U8ZA 1K5DB 2CODA 2COCA 2C7MB 1GNUA 5FR6A 3ZNHB 3B1LX 1IYFA 1H8CA 3VHTC 3E9LA 2PE9A 1J8CA 1P6SA 2KVRA 4LJOB 3ZW3A 1ZW7A 2K6QA 3R66C 2O2VB 3M63B 4P7IA 1ZGUB 2XBBC 2P0FA 1XCGA 3EPYA 3QBVB 2RUKB 2CKHB 4II2B 3HQCA 2XK5B 4HB0B 2JXXA 2DTCA 2G45B 3ZLZA 2L00B 3JVZX 4GIVA 2KXJA 2LD9A 3SYXA 1RRBA 3H7SA 1YQBA 2FCMA 3T06A 1OMWA 4ICUA 1UEFA 4BKSD 3PP2A 4HPLB 4A6FA 1UBIA 4F7UP 4GMXB 2ZCBA 3JSVA 2D9ZA 2ABDA 4A3OA 1I7AA 4NQKE 5KQ1A 4XWXA 2MBEA 4EZJA 1QZEA 4JK9A 1WF9A 3N32A 1WI1A 4WWNA 2O6VD 3ZDMC 4GSWA 4ILGB 1FB8A 2KKCA 3B08A 5CTRC 4DWFA 4F7GA 5JHGA 3ULBA 1WXVA 3SBGA 2KJRA 5HE3A 2EC1A 5KQ4A 3OAWA 3APDA 3TMPB 2OOBB 1E8YA 1ZVRA 1QC6A 1UD7A 3WYFB 4BKTA 3RYTA 4DHJB 1XR0B 2G3QB 4WWOA 5D7GA 4W9GA 2ZJDA 1WXSA 2X0SA 3VOQA 1WFYA 1WVHA 5EDSA 1E8XA 4HAXB 1WGUA 2NPTB 1XD3B 3PLVA 1KBLA 2YF0A 4Y94A 5D3WA 3EHVA 1GUAB 2CHXA 1PFJA 2DN6A 3AI5A 2J0KA 4Z2MB 5DHFB 3DCGA 4KDLB 3X23A 4J6IA 1UELA 2MW5A 3PVLA 2CY4A 1WX9A 2KQSA 3VAWA 4ANVA 2K8HA 1X1GA 1WXMA 2K39A 4EFOA 4WSFA 3O96A 3ZVVA 3L0WB 3SHQA 2I5CA 2YS3A 3ZIMA 1R4NI 1LW3A 3TCAA 2LVOA 2ZVNA 4FHKA 2ZPYA 4PNKA 2P8VA 2L0TA 2LGXA 4EKUA 4LCDE 1Z5SB 2RGFA 3LJ3A 2IY0B 2JZZA 2Z0DB 2DYQA 4EOYA 4JKEA 1UNPA 1V89A 4EJNA 5G55A 2KDBA 4JK8A 5DHAB 1FGYA 5J3YA 4NPNA 1M7RA 2DA0A 2GBNA 4M8MA 4G0NB 5LLIA 3UQBA 4KVGB 2KNBA 5DPWA 1P98A 4WJOA 4K7WA 4ANXA 3IHPC 4K2PA 5KCVA 3JSVB 1NTVA 2JP2A 2A5UA 3QCAA 2RQ1A 3RT3B 1UZXB 3FLVA 2JRIB 4F7HA 2WWZA 3MTNB 3DBHI 2VRWB 1U5DA 3ONSA 2MLBA 4B95A 1E8ZA 2HD5B 4FJYA 3N7CA 3VVWB 4KHOA 4HAZB 4CYEA 4E71A 1V5PA 4ASWC 4B6HA 3VTUA 1LM8B 2LKOA 1WE7A 2R2OA 4BOZB 1IP9A 3MHSD 2KGXB 4JGHB 3PT2B 2GCLA 2R82A 2JY6A 4DHJD 2ROZB 3KUDB 4IW0A 2EKEC 3WAOA 1UPQA 2KFJA 1QQGA 3NS8A 2DZIA 1X86A 4CHMA 1HB6A 2PE6B 3A8PA 2KQ7A 4MT7A 2YS1A 2MBOA 4W9IA 2NS5A 3AU4A 2YRYA 5JLJB 2HJ8A 3A8QA 4FA6A 1Q0WB 5L95C 4IM2A 3PRMB 1YX5B 2EMTA 4FBJB 4BBNF 3E9OA 2LXCA 2RGNB 3KY9A 1WJ6A 2IO2B 1A5RA 2KJHB 2KCJA 4ZRKA 1WGGA 3OANA 4BOSC 2KN5A 1NI2A 4EMOA 2MX2A 4ICVA 3A9KA 3TIXA 4X57B 4BKGA 2FJ9A 1M94A 1SIFA 3C0RB 4KDIC 4ZDVA 4JKCA 4GDKA 3ZNZB 3L17A 1U27A 4JL9A 3ZVRA 1WMHB 1V80A 1J0GA 3QX1A 4ANUA 4IUMB 2DYNA 4ZRIA 2UWQA 4B9KA 3QC8B 1AQCA 2P0DA 2WX1A 4HDQA 2MBBB 2ZEQA 2FIFA 5J2RA 4RM9A 3ZRCA 1V49A 1EF5A 4GDLA 2IZVB 3X0WA 4L6EA 2KD0A 3DBRI 3KZ1A 1E8WA 1ST7A 1JRUA 2V4LA 3M62B 2BYFA 3VH4B 5JZEB 1YD8U 3VFKA 4DK5A 2IFSA 3TJPA 4B6WA 2REXA 3PHXB 5FI1A 3V61A 1RLFA 3D32A 2LYDA 2YVCA 5D27A 3VXWA 3VIAA 1YIWA 4PQ0A 3DBSA 1WX8A 4I6PA 3V6EB 3HW2B 2LXAA 2GBJA 1EVHA 2VKIA 2KLGA 1TGZB 3ML8A 1BTNA 5JVLA 1U29A 2RLOA 3RCPA 3SV1A 2LGDA 3VDZA 1DYNA 5L83A 4W9LA 3ZNGC 3JW0X 1WJUA 4NAWA 2KX0A 3HM6X 4HPMB 2L05A 2KMCA 1WJ1A 4W9FA 1OQYA 1HB8A 2FJLA 3LDZE 3PVWA 3VH3B 2Y8GA 2NBUA 4W9KA 2KDEB 3DBLI 3WALA 3ODXA 5TR5A 2ZVOA 3CIKA 2G35A 2YT0A 4KV2A 2N23A 1TZ1A 2CB8A 2KFKA 1VD2A 2BWFA 4I6NB 2MA9B 5JP4A 2CAYA 2MRPA 5DI9B 3LJUX 4KIKA 4JKAA 2M0XA 3PSEB 3VQIA 4HJKA 2IYBA 4JKDA 4E3CA 3DDCB 4H8SA 3KRWA 2JUOA 4MDKE 5CHVC 1KJTA 3K9OB 2LGYA 2C9WB 4HVBA 2NVUI 3CF6E 2B3AA 1UPRA 1C3TA 2KTRA 3EC8A 4GPTB 1D3ZA 2KWCA 2XEWA 4BFRA 3VUYA 2WH5A 5KHQA 5DPRA 1GGOA 2BKRB 4TQ1A 4FN2A 5J17A 3A9KB 3A98B 1NTIA 4JKGB 4GDKB 1WY8A 3QA8A 3P6AA 1I35A 2VRRB 5JHAA 5HE1A 3E9PA 1ZSQA 2K2JA 4F1SA 3TO1A 4TUUA 3GZNI 5FI0A 3U30A 1FOEA 2G4DB 3DXEA 2LVQA 4JKHA 3ZNID 4AUQC 3QK0A 1WYWB 3PPAA 2OQBA 1W1DA 5JHHA 2DZJA 1X11A 2COPA 3UGBB 2D9VA 2JRHA 4HB3B 2GCJA 4GDLB 3H1UA 4DBGA 1LXDA 2W2WA 4JIOU 3A4SC 3QAQA 4MJSB 4MH0E 4CO7A 1Y8RC 5HE2A 2YSZA 1WXAA 1V5OA 1LQBA 3QARA 1Z2MA 4AJYB 1P3RA 3CSFA 2KC2A 2D9XA 4CHJA 3ML4A 2LG1A 1P5TA 1K8RB 5J3QA 4HATB 3NZSA 4TQ0A 1V9JA 2DHZA 3RD2A 3UIOB 2BPSA 2H7DA 1YX6B 4GOCA 5C6RA 2ZCCA 1XQQA 4GB9A 4BBKA 5LXHA 4KSKC 2V1YA 4W9JA 2HTHA 3JYUA 4AOFA 1J19A 1WJNA 4KZ0A 2JPHA 1U2BA 1WRDB 2LBBA 2PEAA 4BKSA 5IJMA 2C5LC 5D3XA 4G50A 3WIMA 2K25A 2N9PC 4W9DA 3M3JA 4FULA 2Z59B 2D9YA 3D8EA 2FCSA 4IOYX 3DXCA 2AEHA 2O6VA 2LVPA 1WGYA 2ZZPB 5IA7A 1MG8A 1ZC4B 3DVGX 4TKNA 2G4SA 3UIPB 2J59M 3IBEA 1NDDA 1T0YA 2KX3A 2CR5A 2DYMA 2Z0EB 2A4ZA 2DKQA 1HE8A 2D2QA 3FP5A 3DVGY 2FCQA 2E2XA 2DYOA 2KWVB 2YS5A 4W9CA 1GC7A 4ZRJA 3TBLD 5J3TA 4FJVB 3NZUA 2L3ZA 2NCNA 2BKFA 4MSMB 3ENBA 5LXIB 2L7RA 2D3GA 4A6FB 2LRWA 2Y8FA 3B0AA 4AJWA 2JWZA 2HRJA 3SBTA 1Z87A 2BGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJP A;  4JQW C;  1U5G A;  3FSS A;  4MK0 A;  5D3V A;  2L2I A;  1AAR A;  4A5K A;  4I6L B;  3ZRF A;  2DHJ A;  3ODW A;  1V2Y A;  3EEC A;  2LI5 A;  4HLE A;  3H7P A;  4II3 B;  2IYD B;  2MBH A;  1K5G B;  4HAV B;  1E7V A;  4GMV A;  5DPT A;  3NSU A;  2M17 A;  4HDO A;  2N1W A;  3PGE A;  3IG3 A;  1EAZ A;  4HB4 B;  2DX5 A;  2I1K A;  1DBH A;  1WI0 A;  3A1Q A;  1L2N A;  2L8J A;  1EF1 A;  2N1V A;  3HK0 A;  3W1S A;  4K81 A;  3UF8 A;  2CU1 A;  5JH5 C;  3DQV A;  4A20 A;  5JHB A;  1BT0 A;  4ANW A;  1EO6 A;  4MM3 A;  3BIN A;  4XZ4 A;  4HAY B;  2DZK A;  2MQJ A;  2GBK A;  3DPD A;  2LJ5 A;  2LUE A;  3KYD D;  5IAA C;  2AL3 A;  3CMM B;  5CHF A;  2N9E B;  5C16 A;  1Y5O A;  1ZM0 A;  2COA A;  1WX7 A;  2LWP A;  4KHA A;  3IVF A;  2CQU A;  5DCN A;  3NHE B;  2D10 A;  2NBV B;  1MKE A;  2RD0 A;  4MGK E;  2JF5 A;  2LZ6 A;  2Y5B B;  1HBK A;  1WGH A;  1U4A A;  4DDG D;  2GMI C;  1H4R A;  3ENE A;  2K6D B;  2NBW B;  4FAD A;  5AZF A;  3A4R A;  3MDB C;  2M8S A;  3UZT A;  2RVB B;  2UZS A;  4HXD A;  1E5W A;  1E90 A;  1TTN A;  4FLH A;  4IWP A;  5E6N A;  2DFK A;  1OY2 A;  3PZD A;  4DHZ E;  1OEY J;  1V86 A;  2X18 A;  2IO0 B;  4C0A A;  4A3P A;  1KOT A;  3D8F A;  1MPH A;  4GGQ A;  3V5W A;  1FAO A;  3ODO A;  2W9N A;  4HCP B;  3GYP A;  2FCN A;  4PS7 A;  1V5T A;  1NU2 A;  1PLS A;  2EJ8 A;  1RFA A;  2BCJ A;  2PZ1 A;  1EGX A;  2ZNV B;  1F9J A;  3A9J A;  1BTK A;  4HAW B;  3SUZ A;  2KUP A;  4LJP B;  4GU2 A;  1E7U A;  3ML9 A;  1N3H A;  1VCB A;  2KJ6 A;  2OTX A;  2GBM A;  2CHW A;  2KLC A;  1WR1 A;  2NR2 A;  3P7Z A;  4AWJ A;  3OJ4 B;  3V6C B;  4CHK A;  4WJN A;  1OQN A;  1WGR A;  3GYO A;  2K1F A;  4HHV A;  2KDI A;  2BWE S;  5KHO A;  1U5E A;  3M1I B;  2YLM A;  4IM3 A;  4TYZ A;  4NJ6 A;  5D6J B;  2ZNV C;  3L16 A;  2WYQ A;  4JLC A;  4IWQ A;  4DX8 A;  2KMA A;  3RZF A;  2R09 A;  4W9H A;  3QHT A;  2MWN B;  3AU5 A;  5AEK B;  1U5F A;  2GJY A;  1WZ3 A;  2K8C A;  1L7Y A;  1OEY A;  2QKM A;  4K7S A;  3PHW B;  4WJ7 A;  3SNH A;  2RNR B;  4G11 A;  2D11 A;  2KK8 A;  3ECI A;  3PTF C;  2JZ3 B;  1V81 A;  1MIX A;  1LB1 A;  1YJ1 A;  2DX5 B;  2K00 A;  1W1H A;  1EUV B;  4DXA B;  5L81 A;  2ELB A;  2GBR A;  4HWI B;  3A33 B;  1TXD A;  4G3X B;  1Q5W B;  3APC A;  2BF8 B;  1WZ0 A;  2QHO A;  3QIJ A;  4M0W B;  4K2O A;  2KAN A;  4MEL A;  1C1Y B;  3V60 A;  4K17 A;  2N9X A;  2ZPN A;  2UYZ B;  3S2A A;  3TL5 A;  3VTW A;  5C5B A;  5HKH A;  4NQL B;  3U7D A;  5AZG A;  1B55 A;  3RUI B;  3W1S C;  1RJ2 A;  5EFX A;  1WG7 A;  4HB2 B;  3TVV A;  3QWM A;  4IFS A;  4EEW A;  3PVU A;  3PV1 A;  2AWT A;  2KTF A;  4IAP A;  1KZG A;  4GN1 A;  4WWP A;  1G6J A;  1XOD A;  3RUL A;  2BYV E;  3L13 A;  1KM7 A;  2R2Q A;  2N4F A;  3KUZ A;  2DAF A;  1SGH A;  3V62 A;  3D8D A;  1RRP B;  2MBQ A;  4GXB A;  5D3Y A;  2LOZ A;  5HE0 A;  4PYU A;  3KRX A;  2M14 A;  2GOW A;  2QKL A;  1GC6 A;  3IFW B;  2N7D A;  3N3K B;  4IG7 B;  3W1Y A;  3KUC B;  2MP2 A;  3CST A;  3APF A;  5E6P A;  3KSY A;  4FHJ A;  3WAN A;  2MSE D;  3A9J B;  3KVF B;  2J7Q B;  2NZ8 B;  1CMX B;  3WAP A;  5DIF B;  2LAS A;  5GOW B;  4AP4 C;  3KYC D;  1MAI A;  1FHO A;  2DAJ A;  4IM0 A;  1Q1O A;  2PJH A;  3R7Q A;  2IY1 B;  1H10 A;  5D2M B;  3PRZ A;  5E6O A;  2COF A;  1V5M A;  3PG7 A;  3GOE A;  4DX9 0;  4PYZ A;  2R0D A;  1XD4 A;  2JT4 B;  3N30 A;  4FJZ A;  3WAM A;  5J18 A;  4MGY E;  2NMB A;  1W1G A;  3QQ8 B;  3DVN V;  4HK2 A;  3G9W A;  3MPX A;  4MGI E;  2Q13 A;  4K1R B;  2IBI B;  1UNQ A;  3PSC A;  2BYE A;  3ZTC A;  4NAW B;  1PQS A;  1XT9 B;  3DXD A;  2C60 A;  3O65 B;  2DYB A;  2RPQ A;  2KO3 A;  1WJM A;  4NNJ B;  4F7Z A;  2FDQ A;  1WM3 A;  3ZO5 B;  1NBF C;  1TBE A;  2GS0 A;  2KWU B;  1WMH A;  4IWO A;  3T9L A;  2KFK B;  2Z0P A;  3HM3 A;  1DRO A;  2V76 A;  5LON B;  3KW5 B;  4OVV A;  1SE9 A;  1ISN A;  4KIK B;  1ZKH A;  1TQZ A;  1WE6 A;  1DDW A;  1XX0 A;  1BWN A;  4HAU B;  3UQA A;  2RSG A;  2D4Q A;  3OJ3 A;  4K7U A;  2L76 A;  2DHK A;  5C5B B;  4BVU C;  2KTR B;  2Y7B A;  3K9P B;  3NY5 A;  3QWZ B;  4NY0 A;  1DDV A;  4HCN B;  1WR6 E;  1FHX A;  1PMS A;  3AXC A;  2DZM A;  3OLM D;  1IRS A;  2LOX A;  1M7E A;  1R4M I;  4KAX B;  1P3Q U;  1V61 A;  3HIZ A;  2HE7 A;  4Z2N A;  5DPS A;  1KZ7 A;  1X05 A;  3DVN U;  3Q3F A;  2DLW A;  3SD5 A;  1WM2 A;  1UH6 A;  2IO3 B;  3PRP B;  2UZR A;  4PS8 A;  1NTY A;  4M8N A;  4KSL C;  1P0R A;  2LRU A;  4E74 A;  2W2X C;  1NVL A;  2KZR A;  3QJZ A;  5CX3 A;  5LOP B;  2AL6 A;  1WIA A;  3PLU A;  5D94 A;  1ACA A;  3AJ4 A;  4LDT B;  1MK9 B;  3HHM A;  4TV3 A;  3ULC A;  1V88 A;  2M38 A;  3UIN B;  2Z0O A;  2IO1 B;  4MEM A;  4BBN C;  2WDT B;  4EUT A;  4EZL A;  2UVM A;  3TFM A;  4F8C B;  4RMA A;  2H7E A;  4WQO B;  1WGQ A;  3ZTD A;  4NJ7 A;  1KLV A;  1ZC3 B;  2N7E A;  2WX0 A;  3NOB A;  3RZW C;  3TW1 A;  2KHW B;  3P2B A;  4XC2 A;  2MP2 B;  3PS6 A;  1V6E A;  3WA0 A;  2D07 B;  2JVC A;  2I1J A;  5BO4 B;  3Q3J A;  4GZU A;  3VUX A;  3PEG A;  2D9W A;  4EZK A;  3PRE A;  2VSZ A;  2J0J A;  1WGD A;  5CHW A;  2FAZ A;  4MGZ E;  1AWE A;  5AZH A;  4DDI D;  2LUL A;  2EMS A;  1FXT B;  1S3S G;  1WH3 A;  2MKR A;  4XX5 A;  4ZYN A;  2O2V A;  2J0M A;  4IC7 B;  3SDL C;  2I5F A;  1UBQ A;  1GG3 A;  2MFQ A;  1SHC A;  4DHZ B;  2CRF A;  1DDM A;  2XK5 A;  2RSU A;  2KC1 A;  3RCZ A;  2L1C A;  1UNR A;  2PPH A;  2HTH B;  2MCN B;  2K2U A;  1P9D U;  3I3T B;  1V5U A;  3M95 A;  2ELA A;  2Z0Q A;  4KZC A;  3H6N A;  3SO6 A;  3L08 A;  3ALB A;  1OTR B;  4OVU A;  3R3M A;  1LFD A;  1Q67 A;  3BJI A;  1UGM A;  2KDF B;  4WJQ A;  3KH0 A;  1S1Q B;  2FUH B;  3T8M A;  1I2H A;  2FID A;  2DHI A;  4PS3 A;  2MWS B;  2O6V B;  2L0F A;  4W9E A;  2M4N A;  1RAX A;  2K8B A;  3VUW A;  1P1A A;  2M1M A;  3L54 A;  4RM8 A;  2CHZ A;  4KHB B;  4A6K A;  2DKP A;  1OGW A;  4URK A;  2P0H A;  1J0W A;  5GMV A;  2AYO B;  3R7R A;  5CLQ B;  2W2X D;  4YON A;  3FM8 C;  1BAK A;  3SU8 X;  4N9F 4;  2YT1 A;  1X1F A;  3CXB B;  4D0N B;  4MY6 A;  1MIZ B;  4MJS A;  3ZDT A;  2C7H A;  2DEN B;  5DH9 B;  5C79 A;  2RR9 A;  3F0W A;  5C1Z A;  1FGZ A;  4YL8 A;  2NPT A;  2CY5 A;  4MSQ B;  2C7N B;  1WJ4 A;  2CS4 A;  2V3S A;  2FNJ B;  2ASQ A;  3L10 B;  2N0Y A;  5CLL B;  3ZUN A;  1Y19 B;  1TJ6 A;  3MJW A;  2DX1 A;  2ROV A;  5C23 A;  3DOW A;  3BY4 B;  4LDT D;  4A6H A;  3H7P B;  3AUL A;  2MDX A;  5G2N A;  1FHW A;  4DBB A;  3F5R A;  3ZKJ C;  1GJZ A;  2XQN M;  1XKE A;  2KOX A;  1MK7 B;  1IPG A;  3A1Q B;  3VTV A;  4WAA A;  3H9D A;  1X1M A;  3FEH A;  4WVF B;  3EFU A;  1I42 A;  1KI1 B;  4NSW A;  2OJR A;  2ADZ A;  3U8Z A;  1K5D B;  2COD A;  2COC A;  2C7M B;  1GNU A;  5FR6 A;  3ZNH B;  3B1L X;  1IYF A;  1H8C A;  3VHT C;  2PE9 A;  1J8C A;  1P6S A;  2KVR A;  4LJO B;  3ZW3 A;  1ZW7 A;  2K6Q A;  3R66 C;  2O2V B;  3M63 B;  4P7I A;  1ZGU B;  2XBB C;  2P0F A;  1XCG A;  3EPY A;  3QBV B;  2RUK B;  2CKH B;  4II2 B;  3HQC A;  2XK5 B;  4HB0 B;  2JXX A;  2DTC A;  2G45 B;  3ZLZ A;  2L00 B;  3JVZ X;  4GIV A;  2KXJ A;  2LD9 A;  3SYX A;  1RRB A;  3H7S A;  1YQB A;  2FCM A;  3T06 A;  1OMW A;  4ICU A;  1UEF A;  4BKS D;  3PP2 A;  4HPL B;  4A6F A;  1UBI A;  4F7U P;  4GMX B;  2ZCB A;  3JSV A;  2D9Z A;  2ABD A;  4A3O A;  1I7A A;  4NQK E;  5KQ1 A;  4XWX A;  2MBE A;  4EZJ A;  1QZE A;  1WF9 A;  3N32 A;  1WI1 A;  4WWN A;  2O6V D;  3ZDM C;  4GSW A;  1FB8 A;  2KKC A;  3B08 A;  5CTR C;  4DWF A;  4F7G A;  5JHG A;  3ULB A;  1WXV A;  2KJR A;  5HE3 A;  2EC1 A;  5KQ4 A;  3OAW A;  3APD A;  3TMP B;  2OOB B;  1E8Y A;  1ZVR A;  1QC6 A;  1UD7 A;  3WYF B;  4BKT A;  3RYT A;  4DHJ B;  1XR0 B;  2G3Q B;  4WWO A;  5D7G A;  4W9G A;  2ZJD A;  1WXS A;  3VOQ A;  1WFY A;  1WVH A;  5EDS A;  1E8X A;  4HAX B;  1WGU A;  2NPT B;  1XD3 B;  3PLV A;  2YF0 A;  4Y94 A;  5D3W A;  3EHV A;  1GUA B;  2CHX A;  1PFJ A;  2DN6 A;  3AI5 A;  2J0K A;  4Z2M B;  5DHF B;  3DCG A;  4KDL B;  3X23 A;  4J6I A;  1UEL A;  2MW5 A;  3PVL A;  2CY4 A;  1WX9 A;  2KQS A;  3VAW A;  4ANV A;  2K8H A;  1X1G A;  1WXM A;  2K39 A;  4EFO A;  4WSF A;  3O96 A;  3ZVV A;  3L0W B;  3SHQ A;  2I5C A;  2YS3 A;  3ZIM A;  1R4N I;  1LW3 A;  3TCA A;  2LVO A;  2ZVN A;  4FHK A;  2ZPY A;  4PNK A;  2P8V A;  2L0T A;  2LGX A;  4EKU A;  4LCD E;  1Z5S B;  2RGF A;  3LJ3 A;  2IY0 B;  2JZZ A;  2Z0D B;  2DYQ A;  4EOY A;  1UNP A;  1V89 A;  4EJN A;  5G55 A;  2KDB A;  5DHA B;  1FGY A;  5J3Y A;  4NPN A;  1M7R A;  2DA0 A;  2GBN A;  4M8M A;  4G0N B;  5LLI A;  3UQB A;  4KVG B;  2KNB A;  5DPW A;  1P98 A;  4WJO A;  4K7W A;  4ANX A;  3IHP C;  4K2P A;  5KCV A;  3JSV B;  1NTV A;  2JP2 A;  2A5U A;  3QCA A;  2RQ1 A;  3RT3 B;  1UZX B;  3FLV A;  2JRI B;  4F7H A;  2WWZ A;  3MTN B;  3DBH I;  2VRW B;  1U5D A;  3ONS A;  2MLB A;  4B95 A;  1E8Z A;  2HD5 B;  4FJY A;  3N7C A;  3VVW B;  4KHO A;  4HAZ B;  4CYE A;  4E71 A;  1V5P A;  4ASW C;  4B6H A;  3VTU A;  1LM8 B;  2LKO A;  1WE7 A;  2R2O A;  4BOZ B;  1IP9 A;  3MHS D;  2KGX B;  4JGH B;  3PT2 B;  2GCL A;  2JY6 A;  4DHJ D;  2ROZ B;  3KUD B;  4IW0 A;  2EKE C;  3WAO A;  1UPQ A;  2KFJ A;  1QQG A;  3NS8 A;  2DZI A;  1X86 A;  4CHM A;  1HB6 A;  2PE6 B;  3A8P A;  2KQ7 A;  4MT7 A;  2YS1 A;  2MBO A;  4W9I A;  2NS5 A;  3AU4 A;  2YRY A;  5JLJ B;  2HJ8 A;  3A8Q A;  4FA6 A;  1Q0W B;  5L95 C;  4IM2 A;  3PRM B;  1YX5 B;  2EMT A;  4FBJ B;  4BBN F;  2LXC A;  2RGN B;  3KY9 A;  1WJ6 A;  2IO2 B;  1A5R A;  2KJH B;  2KCJ A;  4ZRK A;  1WGG A;  3OAN A;  4BOS C;  2KN5 A;  1NI2 A;  4EMO A;  2MX2 A;  4ICV A;  3A9K A;  3TIX A;  4X57 B;  4BKG A;  2FJ9 A;  1M94 A;  1SIF A;  3C0R B;  4KDI C;  4ZDV A;  3ZNZ B;  4GDK A;  3L17 A;  1U27 A;  4JL9 A;  3ZVR A;  1WMH B;  1V80 A;  1J0G A;  3QX1 A;  4ANU A;  4IUM B;  2DYN A;  4ZRI A;  2UWQ A;  4B9K A;  3QC8 B;  1AQC A;  2P0D A;  2WX1 A;  4HDQ A;  2MBB B;  2ZEQ A;  2FIF A;  5J2R A;  4RM9 A;  3ZRC A;  1V49 A;  1EF5 A;  4GDL A;  2IZV B;  3X0W A;  4L6E A;  2KD0 A;  3DBR I;  3KZ1 A;  1E8W A;  1ST7 A;  1JRU A;  2V4L A;  3M62 B;  2BYF A;  3VH4 B;  5JZE B;  1YD8 U;  3VFK A;  4DK5 A;  2IFS A;  3TJP A;  4B6W A;  2REX A;  3PHX B;  5FI1 A;  3V61 A;  1RLF A;  3D32 A;  2LYD A;  2YVC A;  5D27 A;  3VXW A;  3VIA A;  1YIW A;  4PQ0 A;  3DBS A;  1WX8 A;  4I6P A;  3V6E B;  3HW2 B;  2LXA A;  2GBJ A;  1EVH A;  2VKI A;  2KLG A;  1TGZ B;  3ML8 A;  1BTN A;  1U29 A;  2RLO A;  3RCP A;  3SV1 A;  2LGD A;  3VDZ A;  1DYN A;  5L83 A;  4W9L A;  3ZNG C;  3JW0 X;  1WJU A;  4NAW A;  2KX0 A;  3HM6 X;  4HPM B;  2L05 A;  2KMC A;  1WJ1 A;  4W9F A;  1OQY A;  1HB8 A;  2FJL A;  3LDZ E;  3PVW A;  3VH3 B;  2Y8G A;  2NBU A;  4W9K A;  2KDE B;  3DBL I;  3WAL A;  3ODX A;  5TR5 A;  2ZVO A;  3CIK A;  2G35 A;  2YT0 A;  4KV2 A;  2N23 A;  1TZ1 A;  2CB8 A;  2KFK A;  1VD2 A;  2BWF A;  4I6N B;  2MA9 B;  5JP4 A;  2CAY A;  2MRP A;  5DI9 B;  3LJU X;  4KIK A;  2M0X A;  3PSE B;  3VQI A;  4HJK A;  2IYB A;  4E3C A;  3DDC B;  4H8S A;  3KRW A;  2JUO A;  4MDK E;  5CHV C;  1KJT A;  3K9O B;  2LGY A;  2C9W B;  4HVB A;  2NVU I;  3CF6 E;  2B3A A;  1UPR A;  1C3T A;  2KTR A;  3EC8 A;  4GPT B;  1D3Z A;  2KWC A;  2XEW A;  4BFR A;  3VUY A;  2WH5 A;  5KHQ A;  5DPR A;  2BKR B;  4TQ1 A;  4FN2 A;  5J17 A;  3A9K B;  3A98 B;  1NTI A;  4GDK B;  1WY8 A;  3QA8 A;  3P6A A;  1I35 A;  2VRR B;  5JHA A;  5HE1 A;  1ZSQ A;  2K2J A;  4F1S A;  3TO1 A;  4TUU A;  3GZN I;  5FI0 A;  3U30 A;  1FOE A;  2G4D B;  3DXE A;  2LVQ A;  3ZNI D;  4AUQ C;  3QK0 A;  1WYW B;  3PPA A;  2OQB A;  1W1D A;  5JHH A;  2DZJ A;  1X11 A;  2COP A;  3UGB B;  2D9V A;  2JRH A;  4HB3 B;  2GCJ A;  4GDL B;  3H1U A;  4DBG A;  1LXD A;  2W2W A;  4JIO U;  3A4S C;  3QAQ A;  4MJS B;  4MH0 E;  4CO7 A;  1Y8R C;  5HE2 A;  2YSZ A;  1WXA A;  1V5O A;  1LQB A;  3QAR A;  1Z2M A;  4AJY B;  1P3R A;  3CSF A;  2KC2 A;  2D9X A;  4CHJ A;  3ML4 A;  2LG1 A;  1P5T A;  1K8R B;  5J3Q A;  4HAT B;  3NZS A;  4TQ0 A;  1V9J A;  2DHZ A;  3RD2 A;  3UIO B;  2BPS A;  2H7D A;  1YX6 B;  4GOC A;  5C6R A;  2ZCC A;  1XQQ A;  4GB9 A;  4BBK A;  5LXH A;  4KSK C;  2V1Y A;  4W9J A;  2HTH A;  3JYU A;  4AOF A;  1J19 A;  1WJN A;  4KZ0 A;  2JPH A;  1U2B A;  1WRD B;  2LBB A;  2PEA A;  4BKS A;  5IJM A;  2C5L C;  5D3X A;  4G50 A;  3WIM A;  2K25 A;  2N9P C;  4W9D A;  3M3J A;  4FUL A;  2Z59 B;  2D9Y A;  3D8E A;  2FCS A;  4IOY X;  3DXC A;  2AEH A;  2O6V A;  2LVP A;  1WGY A;  2ZZP B;  5IA7 A;  1MG8 A;  1ZC4 B;  3DVG X;  4TKN A;  2G4S A;  3UIP B;  2J59 M;  3IBE A;  1NDD A;  1T0Y A;  2KX3 A;  2CR5 A;  2DYM A;  2Z0E B;  2A4Z A;  2DKQ A;  1HE8 A;  2D2Q A;  3FP5 A;  3DVG Y;  2FCQ A;  2E2X A;  2DYO A;  2KWV B;  2YS5 A;  4W9C A;  1GC7 A;  4ZRJ A;  3TBL D;  5J3T A;  4FJV B;  3NZU A;  2L3Z A;  2NCN A;  2BKF A;  4MSM B;  5LXI B;  2L7R A;  2D3G A;  4A6F B;  2LRW A;  2Y8F A;  3B0A A;  4AJW A;  2JWZ A;  2HRJ A;  1Z87 A;  2BGF A; 
#chains in the Genus database with same CATH topology
 4WJP A;  4JQW C;  1U5G A;  3FSS A;  4MK0 A;  5D3V A;  5HHD G;  2L2I A;  1AAR A;  4A5K A;  4I6L B;  2CJN A;  2IJ0 A;  3IT6 B;  4L2Y A;  1XO3 A;  3ZRF A;  2J4X A;  3E66 A;  2DHJ A;  3ODW A;  1V2Y A;  3EEC A;  3HVD A;  2LI5 A;  4HLE A;  3H7P A;  4II3 B;  2IYD B;  2MBH A;  1K5G B;  4HAV B;  1E7V A;  4GMV A;  4S0R A;  5DPT A;  3NSU A;  2M17 A;  4HDO A;  2N1W A;  3PGE A;  3IG3 A;  1EAZ A;  4HB4 B;  2DX5 A;  2I1K A;  1DBH A;  1PDX A;  3KWV A;  1WI0 A;  3A1Q A;  4JKB A;  1SSN A;  2NMQ A;  5GXG B;  1L2N A;  2L8J A;  4DXG A;  4XYC A;  4K3B A;  1EF1 A;  1C77 A;  4OHJ A;  5I4D A;  3P4S B;  1TKY A;  1F2R I;  2N1V A;  1ZXH A;  3HK0 A;  3W1S A;  4K81 A;  3UF8 A;  2CU1 A;  4WAF A;  5JH5 C;  3AEC B;  4QJ3 B;  3DQV A;  1TKG A;  1KLU D;  4A20 A;  5JHB A;  3DCX A;  1BT0 A;  3NZ3 A;  1FFV A;  2RDH A;  4ANW A;  1EO6 A;  4P16 A;  3P42 A;  4MM3 A;  3BIN A;  4XZ4 A;  4HAY B;  1K53 A;  2DZK A;  1E10 A;  2MQJ A;  2GBK A;  1N60 A;  4B0M A;  2TSS A;  3DPD A;  5C3J B;  2LJ5 A;  1V1P B;  5M4Y B;  2LUE A;  3KYD D;  5IAA C;  2AL3 A;  3CMM B;  5CHF A;  1N5W A;  2ACZ B;  3LXF A;  4LLG M;  4QJ5 B;  2N9E B;  5C16 A;  1Y5O A;  1ZM0 A;  1F1H A;  2COA A;  1WX7 A;  2LWP A;  1OFF A;  3I63 C;  4KHA A;  3IVF A;  2CQU A;  5DCN A;  4CSQ A;  1NYR A;  3NHE B;  5E6J A;  2D10 A;  2PTL A;  2NBV B;  1C9F A;  1KF6 B;  1MKE A;  3FKY A;  2UU7 A;  2RD0 A;  3I57 A;  4MGK E;  2INP E;  2JF5 A;  3NVW A;  2LZ6 A;  2Y5B B;  1HBK A;  5EE1 A;  2K49 A;  1WGH A;  1U4A A;  3Q14 C;  1T77 A;  5C2T B;  4XDD A;  4DDG D;  2GMI C;  1I4H A;  1H4R A;  3ENE A;  2K6D B;  2NBW B;  3FIL A;  4FAD A;  5AZF A;  1OQQ A;  4A8X C;  3OWE B;  2I2Y A;  3A4R A;  3MDB C;  2M8S A;  1PYW D;  3UZT A;  2RVB B;  2UZS A;  4HXD A;  3AEG B;  5G5H A;  1E5W A;  2JWU A;  1E90 A;  1TTN A;  1ZPS A;  3FVC A;  2K3U A;  1C4C A;  4FLH A;  4IWP A;  5E6N A;  2DFK A;  1OY2 A;  3PZD A;  1Y56 A;  4DHZ E;  1OEY J;  3CWI A;  2V4I B;  1V86 A;  5AUI A;  1P7E A;  2X18 A;  3A58 A;  2IO0 B;  5LNK 1;  4C0A A;  4A3P A;  1KOT A;  3AE6 B;  3D8F A;  1MPH A;  4GGQ A;  1TKE A;  2JSV X;  3V5W A;  1FAO A;  3ODO A;  2W9N A;  4HCP B;  1HTO A;  3GYP A;  2FCN A;  4PS7 A;  1V5T A;  1NU2 A;  1PLS A;  4DQO C;  2EJ8 A;  1RFA A;  2BCJ A;  2E6X A;  4ZHO A;  2PZ1 A;  2JZP A;  2KIE A;  1VZ6 A;  2HJ1 A;  2KMM A;  2JXT A;  1EGX A;  2ZNV B;  4MH8 A;  3BVZ A;  4NJC A;  1F9J A;  2QEJ C;  3A9J A;  3NVV A;  1BTK A;  4HAW B;  3SUZ A;  2KUP A;  4LJP B;  4US8 A;  1RM6 C;  1ZE3 D;  4GU2 A;  1E7U A;  3ML9 A;  4HPP A;  1N3H A;  1VCB A;  4MT5 A;  1VJK A;  2OTX A;  2KJ6 A;  4WUR A;  3RN9 C;  2GBM A;  2BYT A;  1A70 A;  2CHW A;  2KLC A;  1WR1 A;  2NR2 A;  3BWU D;  3P7Z A;  4AWJ A;  3OJ4 B;  3V6C B;  4CHK A;  1KTK A;  4WJN A;  1OQN A;  1WGR A;  3GYO A;  2NTT A;  1R4N B;  2K1F A;  4HHV A;  2ON8 A;  3RNA C;  2KDI A;  2BWE S;  2GI9 A;  1FXI A;  5KHO A;  2VZK D;  1U5E A;  3M1I B;  2YLM A;  2ONQ A;  4IM3 A;  4TYZ A;  4NJ6 A;  5D6J B;  2ZNV C;  1QKZ A;  2RRF A;  1NEK B;  3L16 A;  2WYQ A;  4JLC A;  1N62 A;  4HSI A;  4WIP A;  4IWQ A;  4DX8 A;  2KMA A;  3RZF A;  3AED B;  4REZ A;  3AE9 B;  2BTE A;  3J9C A;  2N7J A;  2R09 A;  4W9H A;  3QHT A;  2MWN B;  5IO9 A;  3AU5 A;  5AEK B;  2X8X X;  1U5F A;  2GJY A;  1WZ3 A;  2K8C A;  1L7Y A;  1QOA A;  1OEY A;  2QKM A;  2M56 B;  3PZ8 A;  4K7S A;  3PHW B;  4WJ7 A;  3SNH A;  1EWY C;  2RNR B;  4G11 A;  2D11 A;  2KK8 A;  3ECI A;  4YTM B;  4LNK A;  3PTF C;  2JZ3 B;  2QIE B;  5LG4 B;  1V81 A;  1MIX A;  1LB1 A;  1YJ1 A;  1L5P A;  2DX5 B;  2K00 A;  1W1H A;  1EUV B;  2G1E A;  2FE8 A;  1D5Z C;  4DXA B;  4KGT A;  5L81 A;  3NVZ A;  1GB1 A;  2ELB A;  2GBR A;  1RYJ A;  4HWI B;  1EU3 A;  3A33 B;  1TXD A;  4G3X B;  3AE2 B;  1Q5W B;  3APC A;  2BF8 B;  1WZ0 A;  5T8I A;  2QHO A;  2JYT A;  3QIJ A;  1XLP A;  4M0W B;  4K2O A;  2Z4D A;  2LFI A;  2KAN A;  4MEL A;  1WWT A;  4ILH A;  1C1Y B;  1VBG A;  3V60 A;  4K17 A;  1EWC A;  1AW7 A;  2QDF A;  2GB1 A;  3IAM 1;  2N9X A;  2KQ4 X;  2ZPN A;  1HXY D;  2UYZ B;  3S2A A;  3TL5 A;  3DBH B;  3VTW A;  5C5B A;  5HKH A;  1UWX A;  4NQL B;  3VRA B;  3U7D A;  5AZG A;  1FNW A;  1B55 A;  1ET6 A;  3RUI B;  3BK1 A;  3W1S C;  1RJ2 A;  5EFX A;  1WG7 A;  1L6U A;  4HB2 B;  3TVV A;  3MC0 B;  1FNU A;  4BZA A;  3QWM A;  4IFS A;  5FK9 C;  4EEW A;  3PVU A;  3PV1 A;  4LNN A;  2AWT A;  1YN4 A;  3ETR A;  1C79 A;  2KTF A;  4IAP A;  1KZG A;  4GN1 A;  4WWP A;  5IRS A;  1G6J A;  1XOD A;  3RUL A;  3FIL B;  3ZXV A;  2BYV E;  4WQM A;  3AB5 A;  1T0S C;  1N63 A;  2JU6 X;  1D4B A;  3L13 A;  1KM7 A;  2R2Q A;  1JDE A;  2N4F A;  2SEB D;  3KUZ A;  2DAF A;  4EE2 A;  1SGH A;  3V62 A;  3D8D A;  1RRP B;  2MBQ A;  3RNF C;  4GXB A;  3SFE B;  1TS3 A;  5D3Y A;  2LOZ A;  2DLB A;  4YXD B;  5HE0 A;  5HG2 A;  2AQ1 B;  3AN1 A;  4PYU A;  3KRX A;  2M14 A;  4WH4 A;  2GOW A;  2QKL A;  2ZKM X;  1GC6 A;  4NAM A;  3IFW B;  1IBX A;  2N7D A;  3N3K B;  4IG7 B;  1DIK A;  3W1Y A;  3KUC B;  2MP2 A;  3CST A;  3APF A;  4OVZ A;  5E6P A;  1ACC A;  2Q5W D;  3KSY A;  4HRO A;  3VR9 B;  4FHJ A;  2M0A A;  2MSE D;  3WAN A;  3A9J B;  3KVF B;  2J7Q B;  2NZ8 B;  1CMX B;  3WAP A;  3Q8E A;  1N6Z A;  5DIF B;  2LAS A;  5GOW B;  1V8C A;  4AP4 C;  3KYC D;  1MAI A;  1FHO A;  2DAJ A;  4IM0 A;  1Q1O A;  2PJH A;  3DHG C;  3R7Q A;  1M4V A;  2IY1 B;  1H10 A;  5D2M B;  2WQY B;  1AN8 A;  3PRZ A;  5E6O A;  3NWD A;  4D2K A;  2COF A;  1V5M A;  2KVZ A;  1FCL A;  5IOI A;  3IXS A;  3PG7 A;  3GOE A;  3TEX A;  2N0S B;  4DX9 0;  4PYZ A;  2R0D A;  1ZP0 B;  1L4D B;  1XD4 A;  2JT4 B;  3N30 A;  3NS1 A;  4FJZ A;  3GB1 A;  1TYG B;  3WAM A;  5IKC M;  1PGX A;  4MGY E;  2NMB A;  5J18 A;  1W1G A;  2LGS A;  1E9M A;  3DVN V;  1QOB A;  3QQ8 B;  4HK2 A;  1GAQ B;  3G9W A;  1CJE A;  3GP7 A;  3MPX A;  1MPE A;  2N9K A;  3U2S C;  2QC8 A;  4MGI E;  2Q13 A;  4K1R B;  4KX6 B;  2IBI B;  1UNQ A;  3PSC A;  1TIF A;  2BYE A;  5D3D A;  3ZTC A;  1FCC C;  4NAW B;  1PQS A;  4M01 A;  1XT9 B;  3DXD A;  2C60 A;  3SFD B;  3O65 B;  2DYB A;  4JPS A;  1SE2 A;  2RPQ A;  1C4P A;  1HTQ A;  1I4R A;  3DWM A;  2KO3 A;  3AEF B;  1D5M C;  3HIE A;  1XCQ L;  1WJM A;  4NNJ B;  4F7Z A;  2FDQ A;  1WM3 A;  3R8B A;  3ZO5 B;  1NBF C;  1K52 A;  1UWM A;  3BK2 A;  1TBE A;  2GS0 A;  3DHH C;  1WYG A;  2KWU B;  1WMH A;  1VBH A;  4IWO A;  3T9L A;  2KFK B;  4RF0 A;  2L52 A;  2Z0P A;  2K5P A;  3HRD D;  3HM3 A;  1DRO A;  2V76 A;  1MG4 A;  5LON B;  3EGR A;  3KW5 B;  4OVV A;  3URY A;  4ZOH C;  1SE9 A;  1ISN A;  4KIK B;  4KKJ A;  1ZKH A;  1TQZ A;  1WE6 A;  1MI0 A;  1DDW A;  1XX0 A;  4RGN A;  1BWN A;  4HAU B;  3UQA A;  1QF6 A;  2RSG A;  2D4Q A;  4QJ4 B;  3OJ3 A;  4K7U A;  2L76 A;  3AE7 B;  4JK7 A;  4ZHP A;  3NWA A;  2DHK A;  2DBY A;  5C5B B;  4JWU C;  4BVU C;  2KTR B;  2Y7B A;  2N9L A;  3K9P B;  4M00 A;  3NY5 A;  3QWZ B;  1L4Z B;  4NY0 A;  1ROE A;  2IPK D;  1DDV A;  1JWU D;  4HCN B;  2Y5P A;  1WR6 E;  1FHX A;  1PMS A;  2WXL A;  3AXC A;  2DZM A;  2QCZ A;  1IRS A;  2LOX A;  3OLM D;  2J53 A;  1M7E A;  1R4M I;  4A6Q A;  4KAX B;  1P3Q U;  1V61 A;  3HIZ A;  2HE7 A;  4Z2N A;  5DPS A;  1KZ7 A;  1X05 A;  3DVN U;  3Q3F A;  2DLW A;  3SD5 A;  1WM2 A;  1UH6 A;  3C8Y A;  2IO3 B;  4KGR A;  3PRP B;  2UZR A;  4PS8 A;  3C19 A;  1NTY A;  4M8N A;  2AQ2 B;  4KSL C;  1P0R A;  2LRU A;  3MHZ A;  3AE8 B;  4E74 A;  2W2X C;  1NVL A;  4P1B C;  2KZR A;  3QJZ A;  5CX3 A;  3AE4 B;  5LOP B;  2AL6 A;  1WIA A;  3PLU A;  5D94 A;  1ACA A;  3AJ4 A;  2IGG A;  1KH0 A;  1F77 A;  4LDT B;  1MK9 B;  3HHM A;  4TV3 A;  3ULC A;  1V88 A;  2M38 A;  3UIN B;  2Z0O A;  2IO1 B;  1T3Q A;  3U7Z A;  1NI3 A;  4MEM A;  4BBN C;  2WDT B;  4EUT A;  4EZL A;  2UVM A;  5H92 C;  3TFM A;  2KYW A;  4F8C B;  4RMA A;  2H7E A;  4WQO B;  1WGQ A;  4IOI E;  3ZTD A;  4NJ7 A;  1KLV A;  4RCO A;  1ZC3 B;  2N7E A;  2WX0 A;  3NOB A;  3RZW C;  1N5X A;  3TW1 A;  2KHW B;  3P2B A;  4XC2 A;  3FAH A;  2MP2 B;  3PS6 A;  5EE9 A;  4JX1 C;  1V6E A;  4JWS C;  3WA0 A;  2D07 B;  3LYY A;  5BMH A;  4AS1 A;  4N59 A;  2JVC A;  2I1J A;  5BO4 B;  2W3R A;  3Q3J A;  4GZU A;  3VUX A;  3PEG A;  2D9W A;  4GNK B;  4TSS A;  3RNG C;  3PRE A;  4EZK A;  2VSZ A;  2J0J A;  1QOG A;  1WGD A;  4RH6 A;  2FAZ A;  5CHW A;  4MGZ E;  1AWE A;  5AZH A;  3ZXR A;  4DDI D;  2MJD A;  2LUL A;  2EMS A;  2CU3 A;  1FXT B;  1S3S G;  2L1A A;  4RFB A;  4LK0 M;  1WH3 A;  1XLN A;  2PLP A;  2MKR A;  3PZ7 A;  2PW9 A;  4XX5 A;  2WXG A;  4ZYN A;  2O2V A;  1LGR A;  2J0M A;  1GPX A;  3GZN B;  4IC7 B;  3SDL C;  1EM7 A;  2I5F A;  4P6V F;  1UBQ A;  1GG3 A;  2MFQ A;  1YOV B;  3BYY B;  1SHC A;  4OZA A;  4DHZ B;  2CRF A;  1DDM A;  1T0R C;  2KR0 A;  2XK5 A;  2RSU A;  1E7P B;  2KC1 A;  1EU4 A;  4ZRP A;  3RCZ A;  2L1C A;  1UNR A;  2PPH A;  2HTH B;  2MCN B;  2K2U A;  3ZYY X;  1P9D U;  3I3T B;  4DXF A;  1SB3 C;  1XCT L;  1V5U A;  3M95 A;  2ELA A;  2Z0Q A;  4KZC A;  4M02 A;  4K3C A;  4C80 A;  3H6N A;  3SO6 A;  3L08 A;  3ALB A;  1SEB D;  1OTR B;  4OVU A;  3NW8 A;  3R3M A;  1LFD A;  2WXO A;  1Q67 A;  4IDI A;  1SE4 A;  3IAS 1;  3BJI A;  1UGM A;  4JKG A;  3I9V 1;  2KDF B;  4WJQ A;  3KH0 A;  1SIJ A;  4ILJ A;  3AEB B;  5FKA C;  1S1Q B;  2FUH B;  2RMM A;  1I2H A;  3T8M A;  3SR6 A;  2FID A;  2RDB C;  2DHI A;  4PS3 A;  2MWS B;  2O6V B;  1BML C;  2WXF A;  2L0F A;  4W9E A;  2BVC A;  5I2S A;  1TY2 A;  2M4N A;  1RAX A;  5G5G A;  2K8B A;  3VUW A;  1YJI A;  1P1A A;  2M1M A;  1VZ8 A;  3BYT B;  4Q2J A;  3L54 A;  4RM8 A;  2CHZ A;  4KHB B;  2GRI A;  2WXI A;  4A6K A;  2DKP A;  3OHM B;  2DIK A;  2IGD A;  1OGW A;  4URK A;  3Q8B A;  2P0H A;  1J0W A;  5GMV A;  2GLS A;  2EKI A;  3KLS X;  2AYO B;  3R7R A;  5CLQ B;  2W2X D;  4YON A;  3FM8 C;  4S17 A;  1BAK A;  2WXK A;  1VLB A;  3SU8 X;  4N9F 4;  2YT1 A;  1X1F A;  3CXB B;  4D0N B;  4MY6 A;  3NUH B;  3TUO A;  1MIZ B;  4MJS A;  3U4E G;  3ZDT A;  2C7H A;  2KIG A;  2DEN B;  5DH9 B;  3KWL A;  5C79 A;  2RR9 A;  1V1O A;  2G9H D;  3VR8 B;  1JCK B;  3F0W A;  3T3O A;  4JKF A;  5C1Z A;  1FGZ A;  4YL8 A;  1SF0 A;  2NPT A;  2CY5 A;  4MSQ B;  2C7N B;  1WJ4 A;  2CS4 A;  2V3S A;  4TMA B;  5BMG A;  2FNJ B;  2ASQ A;  1KC7 A;  3L10 B;  2VH2 A;  2N0Y A;  2L32 A;  2OHF A;  5CLL B;  3ZUN A;  1Y19 B;  2M19 A;  1TJ6 A;  3MJW A;  3RNE C;  2DX1 A;  2ROV A;  5C23 A;  3DOW A;  3BY4 B;  3Q2A C;  4LDT D;  4A6H A;  4YSZ B;  3H7P B;  3AUL A;  2MDX A;  5G2N A;  1FHW A;  4DBB A;  3F5R A;  3W5V B;  3ZKJ C;  1GJZ A;  1YMH E;  4A55 A;  2XQN M;  1XKE A;  2KOX A;  2WXM A;  1MK7 B;  1IPG A;  3A1Q B;  3VTV A;  4WAA A;  4H2A A;  3H9D A;  1IGC A;  1X1M A;  1FEH A;  3FEH A;  1ZUD 2;  4WVF B;  3EFU A;  1I42 A;  1KI1 B;  4NSW A;  1NYQ A;  2OJR A;  1FMA D;  2MJE A;  3RMK C;  1R4M B;  2IND C;  2ADZ A;  2Z59 A;  3U8Z A;  1K5D B;  2COD A;  3RNB C;  2COC A;  1F0Z A;  2C7M B;  1GNU A;  1FO4 A;  4MM3 B;  5FR6 A;  3B1L X;  3ZNH B;  1IYF A;  2WLB A;  1H8C A;  1SXT A;  2LMC A;  3U12 A;  1C4A A;  3VHT C;  3E9L A;  2PE9 A;  3ZGZ A;  1J8C A;  3RFZ B;  1P6S A;  2KVR A;  4LJO B;  3ZW3 A;  1ZW7 A;  2K6Q A;  3R66 C;  2O2V B;  3M63 B;  3P4Q B;  4P7I A;  1ZGU B;  2L83 A;  3L4P A;  2XBB C;  2P0F A;  1XCG A;  3EPY A;  3QBV B;  2RUK B;  2CKH B;  2V0G A;  2KAJ A;  3HQC A;  1XLO A;  4II2 B;  5BYS A;  2XK5 B;  4QXA B;  4HB0 B;  2JXX A;  2LJI A;  2DTC A;  3AE3 B;  3R2I A;  2G45 B;  3ZLZ A;  2L00 B;  3JVZ X;  4GIV A;  2KXJ A;  2LD9 A;  3SYX A;  1R7S A;  1RRB A;  3H7S A;  1YQB A;  2FCM A;  3T06 A;  1OMW A;  4ICU A;  4C56 C;  1UEF A;  3P1M A;  1T0Q C;  2LGI A;  4BKS D;  2FUG 1;  3PP2 A;  4KKI A;  3ZJU A;  4HPL B;  4A6F A;  2INN E;  1UBI A;  4F7U P;  4GMX B;  2ZCB A;  3JSV A;  3U52 E;  1TJE A;  2D9Z A;  2ABD A;  4J3O D;  2PVO D;  4A3O A;  2W54 A;  2WXH A;  1I7A A;  4NQK E;  5KQ1 A;  4XWX A;  2MBE A;  2YT2 A;  1SJE D;  4EZJ A;  1QZE A;  4JK9 A;  1WF9 A;  4C4V A;  3N32 A;  1WI1 A;  1C76 A;  4WWN A;  2O6V D;  3ZDM C;  4GSW A;  4ILG B;  1FB8 A;  2KKC A;  2WU5 B;  2VH1 A;  2PMV A;  4AQ7 A;  3E9S A;  4ZYS A;  4BAX A;  3EA6 A;  3Q3N C;  2BS2 B;  3B08 A;  1DOI A;  2KUQ A;  1F2R C;  5CTR C;  4DWF A;  4F7G A;  5JHG A;  3ULB A;  1WXV A;  3SBG A;  2KJR A;  5HE3 A;  2EC1 A;  1GB4 A;  5KQ4 A;  3OAW A;  3APD A;  3LB8 C;  3TMP B;  1B9R A;  2OOB B;  2LHE A;  1E8Y A;  3HSA A;  1ZVR A;  1QC6 A;  2WDR B;  4OW0 A;  1UD7 A;  3WYF B;  1QQR A;  4CQN A;  4BKT A;  2XNA C;  3RYT A;  4DHJ B;  3AH7 A;  1XR0 B;  2G3Q B;  4WWO A;  3DHI C;  1I4X A;  4N58 A;  4XGA B;  5D7G A;  4W9G A;  1TS2 A;  2QMT A;  2ZJD A;  1KFY B;  2BB6 A;  2OED A;  3MC9 A;  1HQR D;  1VZ7 A;  4A9A A;  1IGD A;  1WXS A;  2X0S A;  1ZOY B;  3VOQ A;  1WFY A;  1WVH A;  5EDS A;  1E8X A;  4OZC A;  3BZD B;  4HAX B;  1WGU A;  2NPT B;  1XD3 B;  3PLV A;  1KBL A;  1ZYI A;  2YF0 A;  4Y94 A;  5D3W A;  3EHV A;  1FRR A;  2FBW B;  3DWG C;  1CK1 A;  1GUA B;  2CHX A;  4YSY B;  1V1P A;  1PFJ A;  2DN6 A;  2RDG A;  1UNS A;  3TEZ A;  4R3D A;  3AI5 A;  2J0K A;  1N61 A;  1DOY A;  5FR3 A;  4Z2M B;  4JE3 B;  3MFG A;  5DHF B;  3DCG A;  3BVG A;  4KDL B;  5BMI A;  3X23 A;  2J52 A;  2MH7 A;  4J6I A;  1UEL A;  2W55 A;  3N20 C;  2MW5 A;  3PVL A;  2CY4 A;  1WX9 A;  2NBV A;  1QT9 A;  2KQS A;  2MHJ A;  3VAW A;  2LHD A;  4ANV A;  2K8H A;  1X1G A;  1WXM A;  4ZRQ A;  2E3T A;  3RPF C;  2K39 A;  4EFO A;  4WSF A;  3O96 A;  1MHX A;  1J7A A;  3ZVV A;  3L0W B;  3SHQ A;  2Y5C A;  2I5C A;  2YS3 A;  3GE8 C;  3ZIM A;  4L1R A;  3BVM A;  3N9Y C;  1R4N I;  4GOU A;  1LW3 A;  3TCA A;  2LVO A;  2BS3 B;  1L0V B;  1Q10 A;  2ZVN A;  1TS5 A;  1YJJ A;  4FHK A;  2ZPY A;  4PNK A;  2P8V A;  2L0T A;  2LGX A;  1J7C A;  1JQ4 A;  4EKU A;  4LCD E;  1Z5S B;  2RGF A;  3LJ3 A;  2IY0 B;  2JZZ A;  2Z0D B;  5EE3 A;  4HEA 1;  2DYQ A;  4EOY A;  4JKE A;  1HA5 A;  3VRB B;  1UNP A;  4FXC A;  3NG0 A;  1C78 A;  2QSD A;  1V89 A;  2RPV A;  4EJN A;  5G55 A;  2KDB A;  4JK8 A;  1J7B A;  5DHA B;  1FGY A;  5J3Y A;  4NPN A;  2I38 A;  5H8Y E;  3HUI A;  1M7R A;  5BYR A;  2Z8L A;  1XEE A;  4KGS A;  2DA0 A;  3SEB A;  2GBN A;  4M8M A;  3Q69 A;  1VRA B;  4G0N B;  5LLI A;  3UI3 A;  4C7Y A;  3UQB A;  4KVG B;  2GUM A;  2BT6 A;  2JX5 A;  3TEW A;  3I5J C;  1ZXI A;  2KNB A;  5DPW A;  1PFD A;  1P98 A;  4WJO A;  1WXQ A;  4K7W A;  4ANX A;  3IHP C;  2HTM E;  1VR9 A;  3NWF A;  5I2M A;  2B76 B;  4K2P A;  5KCV A;  3JSV B;  1NTV A;  2BBC A;  1JWM D;  3H8H A;  2JP2 A;  2A5U A;  3QCA A;  2RQ1 A;  3RT3 B;  2QJL A;  1UZX B;  3FLV A;  4B0E A;  2JRI B;  4C4V B;  1MVK A;  2BQQ A;  4F7H A;  2WWZ A;  3MTN B;  1AYF A;  3DBH I;  1ENF A;  2VRW B;  1U5D A;  1IUE A;  3ONS A;  2MLB A;  2OJW A;  4B95 A;  1E8Z A;  2HD5 B;  1P7F A;  1XF5 L;  4US9 A;  3P4P B;  4FJY A;  1IBX B;  3R2T A;  2R2Y A;  3N7C A;  3VVW B;  4KHO A;  4HAZ B;  3FC4 A;  4CYE A;  1K51 A;  4E71 A;  1V5P A;  4ASW C;  3TEY A;  1LO5 D;  3TSS A;  2LEK A;  2WDV B;  1TT5 B;  4B6H A;  3VTU A;  1LM8 B;  5HFY A;  2LKO A;  4ITK A;  1WE7 A;  2R2O A;  3OG5 A;  4BOZ B;  4NZL B;  1IP9 A;  3MHS D;  3RI7 C;  2KGX B;  1GOZ A;  2R61 A;  3PT2 B;  4JGH B;  4QAY A;  2GCL A;  1MJD A;  2R82 A;  2JY6 A;  4IKG A;  4DHJ D;  2ROZ B;  3KUD B;  4IW0 A;  4YT0 B;  3WCQ A;  2EKE C;  3WAO A;  1RWS A;  1UPQ A;  2BB5 A;  2KFJ A;  1QQG A;  3NS8 A;  2DZI A;  2WU2 B;  1JW9 D;  4M0W A;  1X86 A;  4CHM A;  1MHH E;  1HB6 A;  2PE6 B;  3A8P A;  2INC C;  2KQ7 A;  4MT7 A;  2YS1 A;  2MBO A;  4W9I A;  1RFK A;  2HDE A;  2NS5 A;  3AU4 A;  2YRY A;  3B9J A;  3AE1 B;  5JLJ B;  2HJ8 A;  3A8Q A;  4HKZ E;  1T6B X;  4FA6 A;  1Q0W B;  2PVG C;  1L0X B;  1FXA A;  1L6V A;  5L95 C;  2WP9 B;  4IM2 A;  3PRM B;  1YX5 B;  2EMT A;  1NVI D;  4FBJ B;  4BBN F;  3E9O A;  2LXC A;  2RGN B;  1YN5 A;  1DGJ A;  3MC8 A;  1JWA D;  3KY9 A;  1WJ6 A;  2WXP A;  2W82 A;  2IO2 B;  1D6E C;  1A5R A;  2KJH B;  3ZJT A;  2KCJ A;  1YQ3 B;  3BII D;  2YEP B;  4ZRK A;  1WGG A;  3OAN A;  1DYQ A;  3EUB 2;  4BOS C;  2KN5 A;  1NI2 A;  4EMO A;  2ZW0 A;  2MX2 A;  4ICV A;  3A9K A;  3TIX A;  2WHI A;  4X57 B;  4BKG A;  2FJ9 A;  1M94 A;  3AE5 B;  1SIF A;  3C0R B;  4KDI C;  4ZDV A;  4JKC A;  4GDK A;  3ZNZ B;  2WNM A;  3L17 A;  1U27 A;  3IT4 B;  4JL9 A;  3ZVR A;  1WMH B;  2AX5 A;  3B2F A;  4YWG G;  1V80 A;  4GLS C;  3AEE B;  1JWS D;  2WGS A;  1J0G A;  4OSN A;  3QX1 A;  4ANU A;  4IUM B;  2DYN A;  4USA A;  4ZRI A;  2UWQ A;  2BS4 B;  1QIL A;  4B9K A;  3QC8 B;  1AQC A;  2P0D A;  2XN9 C;  2KWD A;  1OQR A;  5JXV A;  2WX1 A;  4HDQ A;  2MBB B;  1B1Z A;  2ZEQ A;  2FIF A;  5J2R A;  4RM9 A;  1YNT E;  3EFC A;  2PKO A;  2WXN A;  1CQV A;  2D3C A;  3ZRC A;  1V49 A;  2V3P A;  1EF5 A;  4RF1 A;  4GDL A;  4XWT A;  1I7H A;  2IZV B;  2DNF A;  3X0W A;  4ARI A;  1K50 A;  4L6E A;  2KD0 A;  3DBR I;  3KZ1 A;  1E8W A;  1ST7 A;  1JRU A;  1T5X D;  1JAL A;  2V4L A;  3M62 B;  2Z14 A;  2BYF A;  3NRZ A;  3VH4 B;  5JZE B;  1YD8 U;  3Q3O C;  3VFK A;  4DK5 A;  2IFS A;  3TJP A;  4B6W A;  5IP4 D;  2REX A;  3PHX B;  5FI1 A;  3CIR B;  3V61 A;  2K8E A;  1RLF A;  3D32 A;  1F52 A;  3N1Y C;  2LYD A;  2YVC A;  5D27 A;  2CJO A;  1CZP A;  3VXW A;  3VIA A;  1YIW A;  4O1N A;  4WWM A;  2SAK A;  5IN7 A;  4PQ0 A;  3DBS A;  1BUI C;  1HEZ E;  1WX8 A;  4I6P A;  4LTU A;  5AUK A;  3V6E B;  2WDQ B;  1KRH A;  3HW2 B;  4HKQ A;  2LXA A;  2GBJ A;  1EVH A;  2VKI A;  2KLG A;  2W3S A;  4XE0 A;  1FD6 A;  3MJ5 A;  1I4Q A;  3ABV B;  1TGZ B;  3ML8 A;  3AMZ A;  3Q6B A;  1BTN A;  5JVL A;  1U29 A;  2RLO A;  3RCP A;  3Q3M C;  2WS3 B;  3SV1 A;  2LGD A;  3N1Z C;  4RGO S;  3VDZ A;  2Z13 A;  2YEP F;  1DYN A;  1SJH D;  4P1C C;  4W9L A;  5L83 A;  3ZNG C;  3JW0 X;  1WJU A;  4NAW A;  2KX0 A;  3HM6 X;  4HPM B;  1UF0 A;  2L05 A;  2KMC A;  1WJ1 A;  4W9F A;  5HI1 A;  1OQY A;  1L0Y B;  1HB8 A;  2FJL A;  3LDZ E;  4UDU C;  3PVW A;  1ZDX A;  1BXT A;  3VH3 B;  2Y8G A;  1FM0 D;  2NBU A;  2FJU B;  2WXQ A;  1FIQ A;  4W9K A;  2KDE B;  1SE3 A;  3DBL I;  3WAL A;  2IDY A;  3ODX A;  5TR5 A;  2ZVO A;  3CIK A;  2LUM A;  2G35 A;  2YT0 A;  4KV2 A;  4XDC A;  2N23 A;  1TZ1 A;  3NJT A;  2CB8 A;  2KFK A;  2WXR A;  3AV8 A;  1VD2 A;  2BWF A;  4I6N B;  2MA9 B;  5JP4 A;  2CAY A;  2MJ3 A;  1QOF A;  2MRP A;  4OZB A;  5DI9 B;  3LJU X;  4KIK A;  4JKA A;  1QLB B;  2M0X A;  3PSE B;  3VQI A;  4HJK A;  2IYB A;  4JKD A;  1PGA A;  4E3C A;  3DDC B;  4H8S A;  3KRW A;  3P63 A;  2JUO A;  4MDK E;  3Q8A A;  5CHV C;  4XWW A;  5D3I B;  1JRO A;  1SBB B;  1KJT A;  3K9O B;  3B77 A;  1MI1 A;  2LGY A;  2C9W B;  4HVB A;  2NVU I;  3CF6 E;  2B3A A;  1UPR A;  2ZW1 A;  1C3T A;  2KTR A;  3EC8 A;  1WSP A;  2X38 A;  4GPT B;  1E0Z A;  1D3Z A;  2KWC A;  4D6W A;  2XEW A;  4BFR A;  1FFU A;  3VUY A;  1FRD A;  2PIA A;  2WH5 A;  5KHQ A;  5DPR A;  1GGO A;  2BKR B;  4TQ1 A;  4FN2 A;  5J17 A;  4HJG E;  3A9K B;  3A98 B;  2IGH A;  3Q8C A;  1NTI A;  4JKG B;  4GDK B;  1WY8 A;  1DOX A;  3QA8 A;  3P6A A;  1D5X C;  1I35 A;  2D5G A;  1V97 A;  2VRR B;  5JHA A;  5HE1 A;  3E9P A;  1ZSQ A;  2K2J A;  4F1S A;  3TO1 A;  4TUU A;  1VDV A;  3GZN I;  4C00 A;  4LNF A;  5FI0 A;  3U30 A;  4OT1 A;  1FOE A;  2G4D B;  2KDM A;  5TSS A;  3DXE A;  2J42 A;  2LVQ A;  4JKH A;  2K0P A;  3ZNI D;  4AUQ C;  3QK0 A;  1WYW B;  4N6E B;  4YTN B;  2NTS A;  3PPA A;  2OQB A;  1W1D A;  1MFW A;  5JHH A;  1STE A;  2DZJ A;  1X11 A;  2COP A;  3UGB B;  2BW2 A;  2D9V A;  4YTP B;  2JRH A;  4HB3 B;  1HZ6 A;  2GCJ A;  4GDL B;  3H1U A;  1JML A;  4DBG A;  1LXD A;  2K9X A;  4PK1 A;  1XLQ A;  4ARC A;  2W2W A;  1XXG A;  4JIO U;  3A4S C;  3KQ4 A;  3QAQ A;  3GS2 A;  4MJS B;  1YN3 A;  4DIX A;  4MH0 E;  2V9H A;  4CO7 A;  1Y8R C;  5HE2 A;  2YSZ A;  1WXA A;  1V5O A;  1HZ5 A;  1LQB A;  3QAR A;  1Z2M A;  3W5U B;  4AJY B;  1P3R A;  1FNV A;  3CSF A;  2KC2 A;  3V05 A;  2D9X A;  1ESF A;  4CHJ A;  4RGT A;  3ML4 A;  2LG1 A;  2V3N A;  1P5T A;  1K8R B;  5J3Q A;  4LNI A;  3P4R B;  4HAT B;  3NZS A;  4TQ0 A;  1JWB D;  1V9J A;  3W2D A;  2DHZ A;  3RD2 A;  2Y3A A;  3UIO B;  2BPS A;  1TY0 A;  2H7D A;  1YX6 B;  4GOC A;  5C6R A;  2MEK A;  1XQQ A;  2ZCC A;  4GB9 A;  4L1B A;  4RGM A;  1JRP A;  2QIL A;  4BBK A;  5LXH A;  4KSK C;  4ACF A;  2V1Y A;  4W9J A;  2HTH A;  1PUT A;  3JYU A;  4AOF A;  1J19 A;  1WJN A;  2WXJ A;  1KLG D;  4PT5 A;  3RNC C;  3NVY A;  1E6E B;  4KZ0 A;  1WGK A;  1ZDV A;  2JPH A;  4MAC A;  1AWD A;  5BYQ A;  2H88 B;  1U2B A;  1WRD B;  2LBB A;  3B2G A;  2KN4 A;  2PEA A;  4BKS A;  5IJM A;  3DBR B;  2C5L C;  1YQ4 B;  5D3X A;  4G50 A;  3WIM A;  2K25 A;  2N9P C;  2JQR B;  4A90 A;  4W9D A;  3M3J A;  4FUL A;  2D3B A;  3AEA B;  2Z59 B;  1NEN B;  2H89 B;  2D9Y A;  3D8E A;  3O13 A;  2AQ3 B;  2FCS A;  4IOY X;  3DXC A;  2AEH A;  3GE3 C;  3HVZ A;  5EE0 A;  2O6V A;  2LVP A;  4YSX B;  1WGY A;  2ZZP B;  5IA7 A;  1MG8 A;  1ZC4 B;  3E56 A;  3DVG X;  4C7Z A;  4TKN A;  2G4S A;  3UIP B;  2J59 M;  3IBE A;  1NDD A;  5MPO A;  2EEL A;  1T0Y A;  3W9C B;  1ET9 A;  2KX3 A;  2DWQ A;  3MP9 A;  3Q8F A;  4KHB A;  2CR5 A;  2DYM A;  2Z0E B;  2A4Z A;  2DKQ A;  2K22 A;  1HE8 A;  2D2Q A;  3FP5 A;  3DVG Y;  1FPY A;  2FCQ A;  2E2X A;  2DYO A;  2KWV B;  4LNO A;  2YS5 A;  4W9C A;  1GC7 A;  1UGJ A;  4ZRJ A;  5J3T A;  4FJV B;  3TBL D;  3ZQ4 A;  3NZU A;  2L3Z A;  2NCN A;  3V3X A;  2BKF A;  1PGB A;  3AM9 A;  2D3A A;  4MSM B;  1WRI A;  3N1X C;  1I4P A;  4RNA A;  2JYE A;  3ENB A;  4HRS A;  5LXI B;  3ZJV A;  2ICI A;  2L7R A;  2VZK B;  1TZO A;  2D3G A;  2KT7 A;  3T3N A;  4A6F B;  1UUP A;  2LRW A;  4L23 A;  1I4G A;  3PO0 A;  3DBL B;  2Y8F A;  2KAC A;  3B0A A;  4AJW A;  1TS4 A;  2JWZ A;  2HRJ A;  3SBT A;  1Z87 A;  2BGF A; 
#chains in the Genus database with same CATH homology
 4WJP A;  4JQW C;  1U5G A;  3FSS A;  4MK0 A;  5D3V A;  2L2I A;  1AAR A;  4A5K A;  4I6L B;  3ZRF A;  3E66 A;  2DHJ A;  3ODW A;  1V2Y A;  3EEC A;  2LI5 A;  4HLE A;  3H7P A;  4II3 B;  2IYD B;  2MBH A;  1K5G B;  4HAV B;  1E7V A;  4GMV A;  5DPT A;  3NSU A;  2M17 A;  4HDO A;  2N1W A;  3PGE A;  3IG3 A;  1EAZ A;  4HB4 B;  2DX5 A;  2I1K A;  1DBH A;  1WI0 A;  3A1Q A;  4JKB A;  1L2N A;  2L8J A;  1EF1 A;  2N1V A;  3HK0 A;  3W1S A;  4K81 A;  3UF8 A;  2CU1 A;  5JH5 C;  3DQV A;  4A20 A;  5JHB A;  1BT0 A;  4ANW A;  1EO6 A;  4MM3 A;  3BIN A;  4XZ4 A;  4HAY B;  2DZK A;  2MQJ A;  2GBK A;  3DPD A;  2LJ5 A;  2LUE A;  3KYD D;  5IAA C;  2AL3 A;  3CMM B;  5CHF A;  2N9E B;  5C16 A;  1Y5O A;  1ZM0 A;  2COA A;  1WX7 A;  2LWP A;  4KHA A;  3IVF A;  2CQU A;  5DCN A;  3NHE B;  2D10 A;  2NBV B;  1MKE A;  2RD0 A;  4MGK E;  2JF5 A;  2LZ6 A;  2Y5B B;  1HBK A;  1WGH A;  1U4A A;  4DDG D;  2GMI C;  1H4R A;  3ENE A;  2K6D B;  2NBW B;  4FAD A;  5AZF A;  3A4R A;  3MDB C;  2M8S A;  3UZT A;  2RVB B;  2UZS A;  4HXD A;  1E5W A;  1E90 A;  1TTN A;  4FLH A;  4IWP A;  5E6N A;  2DFK A;  1OY2 A;  3PZD A;  4DHZ E;  1OEY J;  1V86 A;  2X18 A;  2IO0 B;  4C0A A;  4A3P A;  1KOT A;  3D8F A;  1MPH A;  4GGQ A;  3V5W A;  1FAO A;  3ODO A;  2W9N A;  4HCP B;  3GYP A;  2FCN A;  4PS7 A;  1V5T A;  1NU2 A;  1PLS A;  2EJ8 A;  1RFA A;  2BCJ A;  2PZ1 A;  1EGX A;  2ZNV B;  1F9J A;  3A9J A;  1BTK A;  4HAW B;  3SUZ A;  2KUP A;  4LJP B;  4GU2 A;  1E7U A;  3ML9 A;  1N3H A;  1VCB A;  2KJ6 A;  2OTX A;  2GBM A;  2CHW A;  2KLC A;  1WR1 A;  2NR2 A;  3P7Z A;  4AWJ A;  3OJ4 B;  3V6C B;  4CHK A;  4WJN A;  1OQN A;  1WGR A;  3GYO A;  2K1F A;  4HHV A;  2KDI A;  2BWE S;  5KHO A;  1U5E A;  3M1I B;  2YLM A;  4IM3 A;  4TYZ A;  4NJ6 A;  5D6J B;  2ZNV C;  3L16 A;  2WYQ A;  4JLC A;  4IWQ A;  4DX8 A;  2KMA A;  3RZF A;  2R09 A;  4W9H A;  3QHT A;  2MWN B;  3AU5 A;  5AEK B;  1U5F A;  2GJY A;  1WZ3 A;  2K8C A;  1L7Y A;  1OEY A;  2QKM A;  4K7S A;  3PHW B;  4WJ7 A;  3SNH A;  2RNR B;  4G11 A;  2D11 A;  2KK8 A;  3ECI A;  3PTF C;  2JZ3 B;  1V81 A;  1MIX A;  1LB1 A;  1YJ1 A;  2DX5 B;  2K00 A;  1W1H A;  1EUV B;  4DXA B;  5L81 A;  2ELB A;  2GBR A;  4HWI B;  3A33 B;  1TXD A;  4G3X B;  1Q5W B;  3APC A;  2BF8 B;  1WZ0 A;  2QHO A;  3QIJ A;  4M0W B;  4K2O A;  2KAN A;  4MEL A;  4ILH A;  1C1Y B;  1VBG A;  3V60 A;  4K17 A;  2N9X A;  2ZPN A;  2UYZ B;  3S2A A;  3TL5 A;  3VTW A;  5C5B A;  5HKH A;  4NQL B;  3U7D A;  5AZG A;  1B55 A;  3RUI B;  3W1S C;  1RJ2 A;  5EFX A;  1WG7 A;  4HB2 B;  3TVV A;  3QWM A;  4IFS A;  4EEW A;  3PVU A;  3PV1 A;  2AWT A;  2KTF A;  4IAP A;  1KZG A;  4GN1 A;  4WWP A;  1G6J A;  1XOD A;  3RUL A;  2BYV E;  3L13 A;  1KM7 A;  2R2Q A;  1JDE A;  2N4F A;  3KUZ A;  2DAF A;  1SGH A;  3V62 A;  3D8D A;  1RRP B;  2MBQ A;  4GXB A;  5D3Y A;  2LOZ A;  5HE0 A;  4PYU A;  3KRX A;  2M14 A;  2GOW A;  2QKL A;  1GC6 A;  3IFW B;  2N7D A;  3N3K B;  4IG7 B;  1DIK A;  3W1Y A;  3KUC B;  2MP2 A;  3CST A;  3APF A;  5E6P A;  3KSY A;  4FHJ A;  3WAN A;  2MSE D;  3A9J B;  3KVF B;  2J7Q B;  2NZ8 B;  1CMX B;  3WAP A;  5DIF B;  2LAS A;  5GOW B;  4AP4 C;  3KYC D;  1MAI A;  1FHO A;  2DAJ A;  4IM0 A;  1Q1O A;  2PJH A;  3R7Q A;  2IY1 B;  1H10 A;  5D2M B;  3PRZ A;  5E6O A;  2COF A;  1V5M A;  3PG7 A;  3GOE A;  4DX9 0;  4PYZ A;  2R0D A;  1XD4 A;  2JT4 B;  3N30 A;  4FJZ A;  3WAM A;  5J18 A;  4MGY E;  2NMB A;  1W1G A;  3QQ8 B;  3DVN V;  4HK2 A;  3G9W A;  3MPX A;  4MGI E;  2Q13 A;  4K1R B;  2IBI B;  1UNQ A;  3PSC A;  2BYE A;  3ZTC A;  4NAW B;  1PQS A;  1XT9 B;  3DXD A;  2C60 A;  3O65 B;  2DYB A;  2RPQ A;  2KO3 A;  1WJM A;  4NNJ B;  4F7Z A;  2FDQ A;  1WM3 A;  3ZO5 B;  1NBF C;  1TBE A;  2GS0 A;  2KWU B;  1WMH A;  1VBH A;  4IWO A;  3T9L A;  2KFK B;  2Z0P A;  3HM3 A;  1DRO A;  2V76 A;  5LON B;  3KW5 B;  4OVV A;  1SE9 A;  1ISN A;  4KIK B;  1ZKH A;  1TQZ A;  1WE6 A;  1DDW A;  1XX0 A;  1BWN A;  4HAU B;  3UQA A;  2RSG A;  2D4Q A;  3OJ3 A;  4K7U A;  2L76 A;  4JK7 A;  2DHK A;  5C5B B;  4BVU C;  2KTR B;  2Y7B A;  3K9P B;  3NY5 A;  3QWZ B;  4NY0 A;  1DDV A;  4HCN B;  1WR6 E;  1FHX A;  1PMS A;  3AXC A;  2DZM A;  3OLM D;  1IRS A;  2LOX A;  1M7E A;  1R4M I;  4KAX B;  1P3Q U;  1V61 A;  3HIZ A;  2HE7 A;  4Z2N A;  5DPS A;  1KZ7 A;  1X05 A;  3DVN U;  3Q3F A;  2DLW A;  3SD5 A;  1WM2 A;  1UH6 A;  2IO3 B;  3PRP B;  2UZR A;  4PS8 A;  1NTY A;  4M8N A;  4KSL C;  1P0R A;  2LRU A;  4E74 A;  2W2X C;  1NVL A;  2KZR A;  3QJZ A;  5CX3 A;  5LOP B;  2AL6 A;  1WIA A;  3PLU A;  5D94 A;  1ACA A;  3AJ4 A;  4LDT B;  1MK9 B;  3HHM A;  4TV3 A;  3ULC A;  1V88 A;  2M38 A;  3UIN B;  2Z0O A;  2IO1 B;  4MEM A;  4BBN C;  2WDT B;  4EUT A;  4EZL A;  2UVM A;  3TFM A;  4F8C B;  4RMA A;  2H7E A;  4WQO B;  1WGQ A;  3ZTD A;  4NJ7 A;  1KLV A;  1ZC3 B;  2N7E A;  2WX0 A;  3NOB A;  3RZW C;  3TW1 A;  2KHW B;  3P2B A;  4XC2 A;  2MP2 B;  3PS6 A;  1V6E A;  3WA0 A;  2D07 B;  2JVC A;  2I1J A;  5BO4 B;  3Q3J A;  4GZU A;  3VUX A;  3PEG A;  2D9W A;  4EZK A;  3PRE A;  2VSZ A;  2J0J A;  1WGD A;  5CHW A;  2FAZ A;  4MGZ E;  1AWE A;  5AZH A;  4DDI D;  2LUL A;  2EMS A;  1FXT B;  1S3S G;  1WH3 A;  2MKR A;  4XX5 A;  4ZYN A;  2O2V A;  2J0M A;  4IC7 B;  3SDL C;  2I5F A;  1UBQ A;  1GG3 A;  2MFQ A;  1SHC A;  4DHZ B;  2CRF A;  1DDM A;  2XK5 A;  2RSU A;  2KC1 A;  3RCZ A;  2L1C A;  1UNR A;  2PPH A;  2HTH B;  2MCN B;  2K2U A;  1P9D U;  3I3T B;  1V5U A;  3M95 A;  2ELA A;  2Z0Q A;  4KZC A;  3H6N A;  3SO6 A;  3L08 A;  3ALB A;  1OTR B;  4OVU A;  3R3M A;  1LFD A;  1Q67 A;  3BJI A;  1UGM A;  4JKG A;  2KDF B;  4WJQ A;  3KH0 A;  4ILJ A;  1S1Q B;  2FUH B;  3T8M A;  1I2H A;  2FID A;  2DHI A;  4PS3 A;  2MWS B;  2O6V B;  2L0F A;  4W9E A;  2M4N A;  1RAX A;  2K8B A;  3VUW A;  1P1A A;  2M1M A;  3L54 A;  4RM8 A;  2CHZ A;  4KHB B;  4A6K A;  2DKP A;  2DIK A;  1OGW A;  4URK A;  2P0H A;  1J0W A;  5GMV A;  2AYO B;  3R7R A;  5CLQ B;  2W2X D;  4YON A;  3FM8 C;  1BAK A;  3SU8 X;  4N9F 4;  2YT1 A;  1X1F A;  3CXB B;  4D0N B;  4MY6 A;  1MIZ B;  4MJS A;  3ZDT A;  2C7H A;  2DEN B;  5DH9 B;  5C79 A;  2RR9 A;  3F0W A;  4JKF A;  5C1Z A;  1FGZ A;  4YL8 A;  2NPT A;  2CY5 A;  4MSQ B;  2C7N B;  1WJ4 A;  2CS4 A;  2V3S A;  2FNJ B;  2ASQ A;  1KC7 A;  3L10 B;  2N0Y A;  5CLL B;  3ZUN A;  1Y19 B;  1TJ6 A;  3MJW A;  2DX1 A;  2ROV A;  5C23 A;  3DOW A;  3BY4 B;  4LDT D;  4A6H A;  3H7P B;  3AUL A;  2MDX A;  5G2N A;  1FHW A;  4DBB A;  3F5R A;  3ZKJ C;  1GJZ A;  2XQN M;  1XKE A;  2KOX A;  1MK7 B;  1IPG A;  3A1Q B;  3VTV A;  4WAA A;  3H9D A;  1X1M A;  3FEH A;  4WVF B;  3EFU A;  1I42 A;  1KI1 B;  4NSW A;  2OJR A;  2ADZ A;  3U8Z A;  1K5D B;  2COD A;  2COC A;  2C7M B;  1GNU A;  5FR6 A;  3ZNH B;  3B1L X;  1IYF A;  1H8C A;  3VHT C;  3E9L A;  2PE9 A;  1J8C A;  1P6S A;  2KVR A;  4LJO B;  3ZW3 A;  1ZW7 A;  2K6Q A;  3R66 C;  2O2V B;  3M63 B;  4P7I A;  1ZGU B;  2XBB C;  2P0F A;  1XCG A;  3EPY A;  3QBV B;  2RUK B;  2CKH B;  4II2 B;  3HQC A;  2XK5 B;  4HB0 B;  2JXX A;  2DTC A;  2G45 B;  3ZLZ A;  2L00 B;  3JVZ X;  4GIV A;  2KXJ A;  2LD9 A;  3SYX A;  1RRB A;  3H7S A;  1YQB A;  2FCM A;  3T06 A;  1OMW A;  4ICU A;  1UEF A;  4BKS D;  3PP2 A;  4HPL B;  4A6F A;  1UBI A;  4F7U P;  4GMX B;  2ZCB A;  3JSV A;  2D9Z A;  2ABD A;  4A3O A;  1I7A A;  4NQK E;  5KQ1 A;  4XWX A;  2MBE A;  4EZJ A;  1QZE A;  4JK9 A;  1WF9 A;  3N32 A;  1WI1 A;  4WWN A;  2O6V D;  3ZDM C;  4GSW A;  4ILG B;  1FB8 A;  2KKC A;  3B08 A;  5CTR C;  4DWF A;  4F7G A;  5JHG A;  3ULB A;  1WXV A;  3SBG A;  2KJR A;  5HE3 A;  2EC1 A;  5KQ4 A;  3OAW A;  3APD A;  3TMP B;  2OOB B;  1E8Y A;  1ZVR A;  1QC6 A;  1UD7 A;  3WYF B;  4BKT A;  3RYT A;  4DHJ B;  1XR0 B;  2G3Q B;  4WWO A;  5D7G A;  4W9G A;  2ZJD A;  1WXS A;  2X0S A;  3VOQ A;  1WFY A;  1WVH A;  5EDS A;  1E8X A;  4HAX B;  1WGU A;  2NPT B;  1XD3 B;  3PLV A;  1KBL A;  2YF0 A;  4Y94 A;  5D3W A;  3EHV A;  1GUA B;  2CHX A;  1PFJ A;  2DN6 A;  3AI5 A;  2J0K A;  4Z2M B;  5DHF B;  3DCG A;  4KDL B;  3X23 A;  4J6I A;  1UEL A;  2MW5 A;  3PVL A;  2CY4 A;  1WX9 A;  2KQS A;  3VAW A;  4ANV A;  2K8H A;  1X1G A;  1WXM A;  2K39 A;  4EFO A;  4WSF A;  3O96 A;  3ZVV A;  3L0W B;  3SHQ A;  2I5C A;  2YS3 A;  3ZIM A;  1R4N I;  1LW3 A;  3TCA A;  2LVO A;  2ZVN A;  4FHK A;  2ZPY A;  4PNK A;  2P8V A;  2L0T A;  2LGX A;  4EKU A;  4LCD E;  1Z5S B;  2RGF A;  3LJ3 A;  2IY0 B;  2JZZ A;  2Z0D B;  2DYQ A;  4EOY A;  4JKE A;  1UNP A;  1V89 A;  4EJN A;  5G55 A;  2KDB A;  4JK8 A;  5DHA B;  1FGY A;  5J3Y A;  4NPN A;  1M7R A;  2DA0 A;  2GBN A;  4M8M A;  4G0N B;  5LLI A;  3UQB A;  4KVG B;  2KNB A;  5DPW A;  1P98 A;  4WJO A;  4K7W A;  4ANX A;  3IHP C;  4K2P A;  5KCV A;  3JSV B;  1NTV A;  2JP2 A;  2A5U A;  3QCA A;  2RQ1 A;  3RT3 B;  1UZX B;  3FLV A;  2JRI B;  4F7H A;  2WWZ A;  3MTN B;  3DBH I;  2VRW B;  1U5D A;  3ONS A;  2MLB A;  4B95 A;  1E8Z A;  2HD5 B;  4FJY A;  3N7C A;  3VVW B;  4KHO A;  4HAZ B;  4CYE A;  4E71 A;  1V5P A;  4ASW C;  4B6H A;  3VTU A;  1LM8 B;  2LKO A;  1WE7 A;  2R2O A;  4BOZ B;  1IP9 A;  3MHS D;  2KGX B;  4JGH B;  3PT2 B;  2GCL A;  2R82 A;  2JY6 A;  4DHJ D;  2ROZ B;  3KUD B;  4IW0 A;  2EKE C;  3WAO A;  1UPQ A;  2KFJ A;  1QQG A;  3NS8 A;  2DZI A;  1X86 A;  4CHM A;  1HB6 A;  2PE6 B;  3A8P A;  2KQ7 A;  4MT7 A;  2YS1 A;  2MBO A;  4W9I A;  2NS5 A;  3AU4 A;  2YRY A;  5JLJ B;  2HJ8 A;  3A8Q A;  4FA6 A;  1Q0W B;  5L95 C;  4IM2 A;  3PRM B;  1YX5 B;  2EMT A;  4FBJ B;  4BBN F;  3E9O A;  2LXC A;  2RGN B;  3KY9 A;  1WJ6 A;  2IO2 B;  1A5R A;  2KJH B;  2KCJ A;  4ZRK A;  1WGG A;  3OAN A;  4BOS C;  2KN5 A;  1NI2 A;  4EMO A;  2MX2 A;  4ICV A;  3A9K A;  3TIX A;  4X57 B;  4BKG A;  2FJ9 A;  1M94 A;  1SIF A;  3C0R B;  4KDI C;  4ZDV A;  4JKC A;  4GDK A;  3ZNZ B;  3L17 A;  1U27 A;  4JL9 A;  3ZVR A;  1WMH B;  1V80 A;  1J0G A;  3QX1 A;  4ANU A;  4IUM B;  2DYN A;  4ZRI A;  2UWQ A;  4B9K A;  3QC8 B;  1AQC A;  2P0D A;  2WX1 A;  4HDQ A;  2MBB B;  2ZEQ A;  2FIF A;  5J2R A;  4RM9 A;  3ZRC A;  1V49 A;  1EF5 A;  4GDL A;  2IZV B;  3X0W A;  4L6E A;  2KD0 A;  3DBR I;  3KZ1 A;  1E8W A;  1ST7 A;  1JRU A;  2V4L A;  3M62 B;  2BYF A;  3VH4 B;  5JZE B;  1YD8 U;  3VFK A;  4DK5 A;  2IFS A;  3TJP A;  4B6W A;  2REX A;  3PHX B;  5FI1 A;  3V61 A;  1RLF A;  3D32 A;  2LYD A;  2YVC A;  5D27 A;  3VXW A;  3VIA A;  1YIW A;  4PQ0 A;  3DBS A;  1WX8 A;  4I6P A;  3V6E B;  3HW2 B;  2LXA A;  2GBJ A;  1EVH A;  2VKI A;  2KLG A;  1TGZ B;  3ML8 A;  1BTN A;  5JVL A;  1U29 A;  2RLO A;  3RCP A;  3SV1 A;  2LGD A;  3VDZ A;  1DYN A;  5L83 A;  4W9L A;  3ZNG C;  3JW0 X;  1WJU A;  4NAW A;  2KX0 A;  3HM6 X;  4HPM B;  2L05 A;  2KMC A;  1WJ1 A;  4W9F A;  1OQY A;  1HB8 A;  2FJL A;  3LDZ E;  3PVW A;  3VH3 B;  2Y8G A;  2NBU A;  4W9K A;  2KDE B;  3DBL I;  3WAL A;  3ODX A;  5TR5 A;  2ZVO A;  3CIK A;  2G35 A;  2YT0 A;  4KV2 A;  2N23 A;  1TZ1 A;  2CB8 A;  2KFK A;  1VD2 A;  2BWF A;  4I6N B;  2MA9 B;  5JP4 A;  2CAY A;  2MRP A;  5DI9 B;  3LJU X;  4KIK A;  4JKA A;  2M0X A;  3PSE B;  3VQI A;  4HJK A;  2IYB A;  4JKD A;  4E3C A;  3DDC B;  4H8S A;  3KRW A;  2JUO A;  4MDK E;  5CHV C;  1KJT A;  3K9O B;  2LGY A;  2C9W B;  4HVB A;  2NVU I;  3CF6 E;  2B3A A;  1UPR A;  1C3T A;  2KTR A;  3EC8 A;  4GPT B;  1D3Z A;  2KWC A;  2XEW A;  4BFR A;  3VUY A;  2WH5 A;  5KHQ A;  5DPR A;  1GGO A;  2BKR B;  4TQ1 A;  4FN2 A;  5J17 A;  3A9K B;  3A98 B;  1NTI A;  4JKG B;  4GDK B;  1WY8 A;  3QA8 A;  3P6A A;  1I35 A;  2VRR B;  5JHA A;  5HE1 A;  3E9P A;  1ZSQ A;  2K2J A;  4F1S A;  3TO1 A;  4TUU A;  3GZN I;  5FI0 A;  3U30 A;  1FOE A;  2G4D B;  3DXE A;  2LVQ A;  4JKH A;  3ZNI D;  4AUQ C;  3QK0 A;  1WYW B;  3PPA A;  2OQB A;  1W1D A;  5JHH A;  2DZJ A;  1X11 A;  2COP A;  3UGB B;  2D9V A;  2JRH A;  4HB3 B;  2GCJ A;  4GDL B;  3H1U A;  4DBG A;  1LXD A;  2W2W A;  4JIO U;  3A4S C;  3QAQ A;  4MJS B;  4MH0 E;  4CO7 A;  1Y8R C;  5HE2 A;  2YSZ A;  1WXA A;  1V5O A;  1LQB A;  3QAR A;  1Z2M A;  4AJY B;  1P3R A;  3CSF A;  2KC2 A;  2D9X A;  4CHJ A;  3ML4 A;  2LG1 A;  1P5T A;  1K8R B;  5J3Q A;  4HAT B;  3NZS A;  4TQ0 A;  1V9J A;  2DHZ A;  3RD2 A;  3UIO B;  2BPS A;  2H7D A;  1YX6 B;  4GOC A;  5C6R A;  2ZCC A;  1XQQ A;  4GB9 A;  4BBK A;  5LXH A;  4KSK C;  2V1Y A;  4W9J A;  2HTH A;  3JYU A;  4AOF A;  1J19 A;  1WJN A;  4KZ0 A;  2JPH A;  1U2B A;  1WRD B;  2LBB A;  2PEA A;  4BKS A;  5IJM A;  2C5L C;  5D3X A;  4G50 A;  3WIM A;  2K25 A;  2N9P C;  4W9D A;  3M3J A;  4FUL A;  2Z59 B;  2D9Y A;  3D8E A;  2FCS A;  4IOY X;  3DXC A;  2AEH A;  2O6V A;  2LVP A;  1WGY A;  2ZZP B;  5IA7 A;  1MG8 A;  1ZC4 B;  3DVG X;  4TKN A;  2G4S A;  3UIP B;  2J59 M;  3IBE A;  1NDD A;  1T0Y A;  2KX3 A;  2CR5 A;  2DYM A;  2Z0E B;  2A4Z A;  2DKQ A;  1HE8 A;  2D2Q A;  3FP5 A;  3DVG Y;  2FCQ A;  2E2X A;  2DYO A;  2KWV B;  2YS5 A;  4W9C A;  1GC7 A;  4ZRJ A;  3TBL D;  5J3T A;  4FJV B;  3NZU A;  2L3Z A;  2NCN A;  2BKF A;  4MSM B;  3ENB A;  5LXI B;  2L7R A;  2D3G A;  4A6F B;  2LRW A;  2Y8F A;  3B0A A;  4AJW A;  2JWZ A;  2HRJ A;  3SBT A;  1Z87 A;  2BGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...