4ZRKA

Merlin-ferm and lats1 complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/transferase
molecule keywords Merlin
total genus 83
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrkA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrkA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrkA01
5DHFB 2VSZA 3TMPB 4PYUA 1WI1A 2ROZB 3A9KA 3R3MA 4NAWA 3A9KB 3QA8A 3V61A 5AZFA 4HB2B 2KDIA 2D9YA 4FJZA 5JHGA 1WJUA 2KTFA 4BOSC 4ZRJA 2G35A 2W2XD 1E8XA 4TYZA 1J19A 1WGHA 2P8VA 4TQ0A 2RNRB 5JZEB 1WE7A 4FADA 3TO1A 4JIOU 1WX8A 2E2XA 4AWJA 1WR1A 2COAA 5CTRC 1HBKA 2K6QA 3PRPB 4HB3B 3MDBC 2PPHA 4HLEA 3V5WA 1EF5A 1WJNA 2J0MA 3QJZA 5C1ZA 2C7NB 1WXVA 4KAXB 2WYQA 1QQGA 3UF8A 4KVGB 3UIOB 1BAKA 4OVUA 4EUTA 3ULBA 1V80A 3W1SC 2BF8B 4HPLB 3L0WB 4MY6A 1E5WA 1WJ6A 1LW3A 1WM3A 1OTRB 2CHZA 1WVHA 4EMOA 2N0YA 4I6LB 3VQIA 3A98B 2KDEB 1RAXA 3L08A 2WH5A 3VTWA 2DFKA 2YVCA 3MHSD 4FA6A 2LOZA 5FR6A 4G0NB 4NY0A 2UZSA 4HB0B 2DHKA 4TKNA 1V9JA 2KHWB 2IY1B 2L7RA 2LASA 2Z0PA 2KFKA 2NBUA 4B95A 2COFA 4H8SA 2GS0A 4F7HA 4W9FA 3DPDA 3IG3A 1Q0WB 3PEGA 4F7GA 2DKQA 2ZJDA 2HTHB 1MG8A 3NHEB 2ZEQA 3CF6E 4HDOA 5DPSA 2AL6A 1UNRA 1WH3A 3CMMB 2FCSA 3M63B 4AOFA 3ULCA 4K7WA 4B9KA 2FIFA 5D7GA 4IC7B 3BJIA 2ADZA 2DYNA 5J3YA 2MFQA 5BO4B 1L2NA 3DVNU 1A5RA 4F1SA 2NPTB 2WWZA 3HHMA 2ELBA 2Y7BA 1U5DA 1BT0A 1M7EA 3ODXA 2DZJA 2KQSA 2MDXA 4EJNA 3ZRFA 1KZGA 1U5GA 5DPWA 1I35A 5HE0A 2WX1A 4CO7A 4WJNA 3VOQA 3CSFA 2GMIC 2Y8FA 3HW2B 5D27A 1WJ1A 3NY5A 5C79A 5JHAA 1FHXA 3DDCB 3RZFA 1U27A 2COCA 2IBIB 3F0WA 4W9KA 5E6OA 4URKA 3VAWA 1R4NI 5KCVA 2ZPYA 2XQNM 1Z5SB 3LJUX 2D3GA 2KWCA 5HE1A 2BKFA 1MAIA 4CYEA 1WJ4A 1SE9A 3A4RA 3ZNGC 4BKTA 4EZKA 4AP4C 2KCJA 2KUPA 3M62B 3ZNHB 2M1MA 2KDBA 2UYZB 1ZGUB 3IBEA 1MIZB 1B55A 3EPYA 1GUAB 2CKHB 4W9LA 1NTYA 1NDDA 4IM2A 4GDKA 1V81A 3B0AA 4FHJA 4JLCA 2IZVB 3WA0A 5LOPB 2JZZA 2RR9A 2ZNVB 3KW5B 1P1AA 4LDTB 4AUQC 1SGHA 2KXJA 4IW0A 3V6EB 3APFA 1V88A 2XK5B 3ZKJC 5G55A 2N7EA 4Z2NA 2KGXB 2Y5BB 2AEHA 3JSVA 4KZ0A 1XCGA 2I5CA 2RGFA 3PP2A 4DXAB 2JUOA 2LI5A 5C23A 3SV1A 1TXDA 3SD5A 2G4DB 3AXCA 2K39A 1HB6A 4IM0A 2MBBB 2ABDA 2C60A 2LRWA 4DHJB 2BGFA 3PRMB 3TJPA 4EZLA 1ZC3B 3ALBA 1BTNA 2GOWA 2REXA 2EMTA 4EKUA 1WFYA 3IFWB 1ISNA 1FHWA 1H10A 1V5UA 2PE6B 2FCMA 3TBLD 2QKLA 1LB1A 4WWOA 2PE9A 4HAUB 2AWTA 3APDA 4HAWB 3H7PB 2JXXA 4I6NB 4W9EA 4A3OA 4RM8A 1D3ZA 2LUEA 3RULA 3KY9A 3V60A 5DI9B 1TJ6A 5KQ1A 2BYVE 3HK0A 1WX7A 2KTRA 3DXCA 1S1QB 2LJ5A 2NCNA 4P7IA 1Q1OA 1XD3B 3UINB 2YS1A 4ANWA 1I7AA 2MP2A 1KJTA 2LVPA 3SHQA 2FUHB 1OQYA 2D9ZA 2LULA 2MWNB 1WR6E 3KYCD 3H9DA 2HE7A 3GZNI 5DH9B 4FJYA 1M94A 1OEYJ 5KHOA 2GBRA 4FJVB 3IHPC 1UH6A 3VFKA 2R09A 2GCJA 2JWZA 2H7EA 3MJWA 5D3YA 3MPXA 2L8JA 4NQKE 4BFRA 2RD0A 2M38A 4WAAA 2LBBA 2LGDA 2N23A 4OVVA 4DDGD 1J0WA 2KKCA 3DBSA 4ICVA 3H1UA 2R0DA 5D3XA 1TZ1A 1V89A 2VRWB 1X11A 2B3AA 2L3ZA 4MGIE 3ZTDA 1NTIA 3N3KB 1OEYA 3PRZA 4M8MA 4DWFA 1V2YA 3U30A 4FBJB 2YT1A 2GBMA 3BY4B 4IM3A 1XKEA 2V3SA 4ANUA 3CXBB 1V86A 2DZIA 4JL9A 4W9DA 4FN2A 3EECA 2DX5A 4DX8A 5D2MB 1LXDA 3O65B 1FGZA 2MBEA 3ZNZB 1H4RA 1S3SG 3A1QA 3D8FA 4G11A 5AZGA 4GMXB 2FIDA 1GJZA 3K9PB 3SDLC 3CSTA 4NJ7A 3NZUA 3VXWA 2NVUI 1DROA 4M0WB 2JRHA 4DDID 1WGYA 4KHBB 2G45B 2BCJA 1X86A 2CY4A 2JT4B 4TQ1A 1C3TA 3U8ZA 2KX3A 3ZIMA 2K8HA 2MP2B 2LG1A 4K2PA 2KD0A 3ODOA 4FLHA 3ZDTA 4TUUA 1AWEA 1KOTA 2DTCA 3A4SC 1I2HA 3QHTA 2DHJA 1FOEA 3DVNV 2MCNB 2OTXA 5LONB 1QC6A 1TGZB 2LYDA 1OY2A 3H7PA 2OJRA 3PHXB 1K5GB 4GGQA 1W1DA 4HWIB 5CHFA 3RT3B 3ZDMC 4EFOA 4WQOB 2DX5B 1J8CA 1MKEA 1OQNA 4HDQA 3ML4A 1V5OA 4NNJB 3QWMA 1L7YA 1SIFA 2BYEA 1BWNA 1PQSA 2IO1B 3L13A 4MGYE 1E8WA 2KDFB 3JVZX 2MKRA 3OANA 1WX9A 1WMHB 2FJLA 1WY8A 2ASQA 2MBHA 2J0KA 4WJOA 2KK8A 2Z0QA 5FI0A 3UIPB 2JVCA 1MPHA 1X1FA 2QKMA 4A6FA 2Q13A 2EKEC 2Z0EB 3QC8B 3WYFB 3X23A 1UNQA 2K8CA 2JP2A 4C0AA 2XK5A 1WI0A 5JH5C 2IYBA 4X57B 2IYDB 2LRUA 5IA7A 5D3VA 2L2IA 2ROVA 4DHZE 3APCA 4KSLC 3KUDB 2CU1A 1WGUA 5L81A 3I3TB 3SYXA 1GG3A 2MWSB 2KANA 4KIKB 4MGKE 5CX3A 2PZ1A 1X1MA 4A5KA 3Q3JA 3N30A 3JYUA 3PS6A 4I6PA 4KV2A 2HTHA 2D4QA 2X18A 1ZW7A 2MA9B 1SHCA 1DYNA 4IWQA 4BBNF 2NS5A 3ZNID 1Q67A 1DDWA 1LQBA 3ODWA 2N1WA 2CHWA 3ZW3A 1GC6A 1UD7A 1U5FA 2M17A 3PVLA 4DHZB 3UQBA 3T8MA 3TW1A 4JGHB 2CY5A 1UGMA 3B08A 3VH4B 2IY0B 3NZSA 1WIAA 1UPRA 1DBHA 3F5RA 4HJKA 2DYQA 3RZWC 4A6KA 3M95A 2M8SA 2MX2A 5IJMA 2DN6A 5EFXA 1Y5OA 1WZ3A 4E71A 1FGYA 2D10A 3EFUA 1WJMA 4CHJA 2Z59B 3L16A 4IWOA 1ZSQA 3JSVB 2J59M 2DAFA 1QZEA 2KX0A 3PSCA 2IO3B 2HJ8A 1Z87A 2ZVNA 3WANA 1ZM0A 2NPTA 1PFJA 2V76A 3V62A 2MRPA 3KVFB 4NPNA 5LLIA 2LXCA 3CIKA 3DOWA 2HRJA 2L0TA 5DCNA 4BKGA 4IWPA 3QIJA 2I1KA 2GCLA 2D9WA 4HB4B 2FCNA 2MBQA 1IPGA 2QHOA 3L10B 3PSEB 4E74A 1Y8RC 2J7QB 3KRXA 2ZCBA 4PYZA 2L0FA 2N4FA 3JW0X 4PS7A 4ASWC 4KDIC 2K2JA 5L95C 2COPA 3N7CA 2Z0DB 2BWES 3GOEA 3N32A 4RM9A 2KWVB 3S2AA 3SU8X 4EZJA 2LXAA 3DQVA 4NAWB 1WXAA 3UGBB 3WAMA 3KUZA 1CMXB 2VKIA 4MEMA 2K00A 4WJ7A 3FP5A 2L00B 2KJHB 2P0DA 2IO0B 4ZDVA 4JQWC 4K81A 2CODA 1FAOA 3SNHA 3ZUNA 1IP9A 1V6EA 3L17A 3P2BA 2M14A 3RYTA 3ZO5B 5DHAB 1P9DU 4W9HA 3DBLI 4MM3A 5G2NA 4EOYA 5AEKB 2KMAA 3PLUA 1E8ZA 1UELA 1GNUA 4HAZB 2O6VB 5J3TA 3HM3A 2L05A 1UBIA 2BWFA 1E7UA 3AULA 3C0RB 3QCAA 4B6WA 1P5TA 3FM8C 3DBRI 3QBVB 2FJ9A 2D9VA 1UNPA 1R4MI 3ZVRA 4NSWA 3PVUA 2J0JA 2ZPNA 4F7UP 3OJ4B 4MK0A 1T0YA 1WRDB 2JRIB 2MW5A 2LKOA 1YIWA 1Z2MA 2LGYA 2JF5A 4AJYB 4BKSD 5DIFB 1AARA 2RPQA 3QAQA 2RUKB 2KC1A 2XBBC 3X0WA 5FI1A 2KJRA 4XC2A 5GOWB 3AI5A 2MSED 1GC7A 2A4ZA 4FULA 4LCDE 5D6JB 3NOBA 1WXMA 1V49A 2KFKB 4LJPB 5IAAC 5TR5A 2K6DB 2KLCA 1P98A 3WAPA 3PG7A 1ZKHA 4BOZB 1RJ2A 1UZXB 4KHOA 2DKPA 5C5BB 4W9IA 1TTNA 2RSGA 3K9OB 2XEWA 3Q3FA 4IAPA 4DBBA 4GPTB 5CLQB 4PNKA 4AJWA 2KNBA 4BKSA 1YJ1A 2D9XA 1OMWA 2Y8GA 1W1GA 3QWZB 4GDLB 2KVRA 2UWQA 3WAOA 2DZMA 3HIZA 2O6VD 4GOCA 3VVWB 4K7SA 1PLSA 2I5FA 1K8RB 4YONA 1WGDA 2G4SA 2JPHA 2LD9A 3KH0A 4KIKA 1XR0B 4M8NA 4ANXA 1V5MA 1MK9B 3PGEA 2D2QA 4W9GA 2WDTB 4HPMB 2NR2A 1X05A 3VDZA 2DA0A 4IOYX 2OOBB 1UPQA 3PLVA 1U4AA 4NQLB 3ECIA 4MELA 3A33B 3FEHA 4HHVA 2ZVOA 1MK7B 2PEAA 3KYDD 1H8CA 2KMCA 3DVGY 3HQCA 1EUVB 2N1VA 1WGRA 2CQUA 1F9JA 1WMHA 1N3HA 4GMVA 1EAZA 2NMBA 3D8EA 3R7QA 1HE8A 2JY6A 2RQ1A 2HD5B 3LDZE 4Z2MB 3PPAA 5D3WA 2M4NA 3OLMD 4PS8A 4K7UA 3RD2A 3PTFC 4A3PA 1I42A 4L6EA 1VCBA 1XQQA 1IYFA 1P3QU 4K2OA 3DCGA 4F8CB 2WX0A 5E6NA 4NJ6A 1RFAA 3IVFA 3ONSA 1C1YB 1NU2A 1EF1A 2FDQA 2BKRB 2BYFA 2RSUA 4MJSA 5GMVA 5LXIB 3VH3B 1K5DB 2ELAA 3O96A 4HAVB 3G9WA 4HAXB 3PREA 4IFSA 5AZHA 3M3JA 4KHAA 2R2OA 3WALA 5CLLB 5KQ4A 1WGGA 2W2WA 1E7VA 1VD2A 2YF0A 2DYMA 4WSFA 3SUZA 4GIVA 3VUXA 2RGNB 1KM7A 1UBQA 4E3CA 3A8PA 2P0FA 4KZCA 1EO6A 2ZNVC 5D94A 2KLGA 3ZRCA 1NVLA 4BBKA 2DYOA 2KN5A 4WJPA 2FAZA 1V5PA 3PHWB 1Y19B 4F7ZA 3PZDA 2EJ8A 1P0RA 3B1LX 1BTKA 2N9PC 3U7DA 4MH0E 2KFJA 3TIXA 3H6NA 3KUCB 4II3B 4J6IA 5JLJB 2CHXA 4DHJD 4WJQA 2UZRA 1ACAA 2P0HA 1E90A 2K1FA 3OAWA 1M7RA 5J2RA 4PQ0A 3QK0A 4GN1A 4KDLB 4LDTD 3A9JB 4HCPB 3VUWA 1EGXA 3ZVVA 4CHKA 4EEWA 3TVVA 2KQ7A 1LM8B 4FHKA 4ICUA 2R2QA 2LGXA 4MT7A 2LOXA 2OQBA 2EMSA 2ZCCA 4DX90 3H7SA 4WVFB 4PS3A 4WWNA 2N7DA 3ML8A 2W9NA 1P3RA 2GBJA 5CHWA 1E8YA 3SO6A 1WGQA 1NI2A 3TL5A 2LVQA 1V5TA 2GBNA 2JZ3B 2PJHA 4GXBA 2UVMA 2DENB 3RUIB 3GYPA 3PT2B 2K25A 4RMAA 5J3QA 2Z0OA 4KSKC 1RRBA 1WF9A 2RVBB 1YX5B 5CHVC 5J18A 4A6FB 1WYWB 2O6VA 3FLVA 3MTNB 3UZTA 4A6HA 2FCQA 3QQ8B 1FXTB 1Q5WB 3A1QB 3VTVA 3PVWA 1UEFA 3TCAA 2KO3A 2KZRA 4N9F4 3AU4A 1WG7A 4GDLA 4MJSB 2I1JA 4XZ4A 1RLFA 4ZRKA 5L83A 5E6PA 5EDSA 2D07B 2MBOA 1HB8A 4BBNC 4ANVA 4DBGA 3A9JA 3EC8A 5JHBA 2L76A 1OGWA 3A8QA 3P6AA 3ML9A 4MSQB 5LXHA 2EC1A 2H7DA 5C16A 3VHTC 2V4LA 4G3XB 3V6CB 3EHVA 1J0GA 2G3QB 4MSMB 4A20A 2BPSA 1YQBA 1WZ0A 2LZ6A 3T9LA 2CB8A 3FSSA 1TQZA 2L1CA 3TFMA 3OJ3A 3W1YA 3ZLZA 4BVUC 1V61A 4D0NB 1U5EA 1LFDA 5HKHA 3QARA 4MGZE 4GU2A 4DK5A 1KI1B 4HVBA 4B6HA 5J17A 2CR5A 2C9WB 3KZ1A 2K8BA 3KSYA 5HE2A 3DBHI 2NZ8B 1XX0A 2DHIA 4GZUA 4Y94A 4GSWA 3UQAA 1RRPB 4ZRIA 1NBFC 4IUMB 2YT0A 1W1HA 5DPRA 1YX6B 2LWPA 1X1GA 3R66C 3T06A 2KJ6A 4CHMA 2AYOB 2O2VB 2KOXA 4LJOB 2YS3A 2LVOA 4MDKE 2M0XA 1WM2A 3W1SA 2KC2A 1KZ7A 5KHQA 3D32A 4TV3A 1XODA 2DYBA 4IG7B 3P7ZA 5C5BA 1WXSA 2DAJA 3PV1A 2D11A 3L54A 2C7MB 1AQCA 3HM6X 2YS5A 4W9JA 3VUYA 3BINA 1JRUA 3GYOA 1U2BA 3LJ3A 4II2B 1DDMA 2GJYA 1G6JA 1FHOA 2N9EB 5DPTA 3VTUA 1ZC4B 1KLVA 4XX5A 3DXEA 2ZZPB 2C7HA 2YRYA 2GBKA 2V1YA 4ZYNA 5HE3A 5JP4A 1XD4A 4HAYB 2K2UA 1MIXA 2DX1A 2VRRB 4XWXA 4K1RB 2NBWB 1IRSA 2N9XA 4WWPA 1FB8A 3NSUA 4HXDA 2W2XC 1WE6A 3DVGX 3ZTCA 1TBEA 2DZKA 3ENEA 2IO2B 2CRFA 3WIMA 2KWUB 2DHZA 5JHHA 2O2VA 4HK2A 2CS4A 3VIAA 3QX1A 3RCPA 2AL3A 2MQJA 4GDKB 4GB9A 1EVHA 2CAYA 3M1IB 2YLMA 2MLBA 1NTVA 5C6RA 3DXDA 2RLOA 1PMSA 2KTRB 3NS8A 2A5UA 3D8DA 4G50A 3R7RA 1U29A 1ZVRA 2NBVB 1DDVA 2C5LC 4HCNB 4W9CA 3RCZA 2DLWA 1P6SA 1ST7A 2IFSA 2YSZA 4HATB 3KRWA 4K17A 3AU5A 1XT9B 1YD8U 3AJ4A 2FNJB 4YL8A
chains in the Genus database with same CATH superfamily
3EUB2 3V61A 4HB2B 1GGOA 1E8XA 1FIQA 1VRAB 4TYZA 2BB5A 1JWAD 3SFDB 3TO1A 4JIOU 1QOAA 2E2XA 4AWJA 1WR1A 1D5MC 2R82A 2OJWA 4RF0A 2EKIA 2PVGC 3AE3B 4KAXB 3R2IA 4KVGB 4EUTA 1BAKA 3L0WB 4HEA1 3U52E 5LXHA 1OTRB 1WXQA 2L52A 3L08A 5FR6A 4G0NB 4NY0A 2UZSA 4TKNA 3TL5A 2PMVA 2IY1B 3BWUD 4F7HA 3DPDA 3IXSA 3PO0A 3P4QB 4HDOA 2AL6A 1UNRA 2WU2B 2BBCA 3OG5A 4JWSC 5FKAC 3ULCA 4K7WA 5D7GA 3IAM1 4ILJA 1L2NA 2WWZA 1U5DA 1M7EA 2M0AA 1VZ8A 5DPWA 4EJNA 3ZRFA 1KZGA 4WJNA 2Y8FA 1KF6B 5JHAA 3DDCB 1U27A 2COCA 4W9KA 2ZPYA 3I9V1 1NVID 2KIEA 3A4RA 4BKTA 4AP4C 2KUPA 2NBVA 2M1MA 2KDBA 2UYZB 1ZGUB 3EA6A 3NVWA 1MIZB 1TKYA 2AQ3B 1IGDA 1XXGA 1MPEA 2RR9A 3KW5B 4AUQC 5BYQA 3V6EB 2LJIA 5G55A 2B76B 4Z2NA 1I7HA 4USAA 3E9PA 1RYJA 3VR9B 4DQOC 2JUOA 3SV1A 4OVZA 3SD5A 4OZAA 4YSXB 2G4DB 3UI3A 4IM0A 2ABDA 3PRMB 4FXCA 2WXFA 1GPXA 2QJLA 2GOWA 2REXA 2EMTA 4KKJA 3AN1A 1LB1A 4LNIA 4C00A 2PE9A 4W9EA 1D3ZA 3NWDA 3MC8A 1DOIA 1T5XD 3RULA 5DI9B 1TJ6A 5KQ1A 2BYVE 4JLCA 4ANWA 1XD3B 2YS1A 3SHQA 2FUHB 2MWNB 1JCKB 2JX5A 4FJYA 1M94A 1OEYJ 5KHOA 3IHPC 1UH6A 3ZXRA 4C56C 2H7EA 3MJWA 2L8JA 3MPXA 1YJIA 2Y5CA 4WAAA 1J0WA 1TT5B 1TZ1A 5D3XA 4MGIE 1NTIA 4DWFA 3U30A 2GBMA 3MC9A 4ANUA 1JALA 3T3NA 4FN2A 2DX5A 2IDYA 3A1QA 3D8FA 4G11A 4JKCA 2NMQA 2FIDA 4H2AA 3CSTA 3NZUA 3VXWA 2NVUI 1DROA 4M0WB 1FXIA 2WHIA 3MHZA 4J3OD 3ODOA 4TUUA 3ZDTA 1HQRD 3QHTA 2NTTA 1FOEA 3DVNV 4GGQA 1EWCA 2KAJA 1MKEA 1OQNA 2L1AA 3ML4A 2DLBA 2SAKA 1L7YA 1SIFA 2BYEA 2RDGA 3ZGZA 4MGYE 1E8WA 2KDFB 3BK2A 1C4CA 1WMHB 2J0KA 3UIPB 2LUMA 4HJGE 4TMAB 1MPHA 4A6FA 3X23A 2JP2A 5HI1A 5JH5C 1WI0A 1JQ4A 1C4AA 4RGMA 5D3VA 2L2IA 3URYA 4KSLC 2YEPF 3I3TB 2MWSB 4MGKE 1X1MA 3PS6A 4I6PA 2HTHA 3AEEB 1SHCA 1HZ5A 3AE7B 4BBNF 2NS5A 1DDWA 3Q3NC 1GC6A 2M17A 4DHZB 3UQBA 2MJ3A 3T8MA 2MEKA 3B2GA 3E9LA 1WIAA 3NJTA 1R7SA 1F1HA 4HJKA 3RZWC 5IJMA 1Y5OA 1FGYA 4N59A 4CHJA 1ZSQA 2DAFA 1QZEA 2DBYA 3PSCA 3WANA 2HJ8A 1Z87A 2ZVNA 2K22A 2NPTA 2VH2A 4NPNA 4BAXA 2GCLA 1YNTE 2FBWB 4BZAA 2WDRB 1FRRA 3BIID 1TS4A 3N1ZC 1ROEA 3SU8X 1FNVA 1FMAD 2KWVB 1BUIC 1QILA 1WXAA 3WAMA 2VKIA 4MEMA 2IO0B 1FAOA 3RYTA 5DHAB 4EOYA 3DBLI 3H8HA 3PLUA 1E8ZA 1UELA 2O6VB 3SEBA 1UBIA 3AULA 3C0RB 2D3AA 3EGRA 3DBRI 3OJ4B 3PZ8A 3PVUA 1OFFA 1T0YA 2CJNA 2JRIB 2LKOA 1C77A 4AJYB 1AARA 3QAQA 3V05A 3RNCC 2KJRA 4XC2A 5IAAC 1WXMA 1KOTA 5TR5A 2K6DB 2KLCA 3PG7A 5JVLA 1FCCC 2LHEA 1IUEA 3Q3FA 5CLQB 2D9XA 2V0GA 4JKGA 2UWQA 5BYSA 2K49A 4GOCA 1PLSA 4ANXA 3KH0A 4KIKA 1MK9B 4WAFA 1F0ZA 2WDTB 5C3JB 3O13A 1ZDVA 2WXRA 4CQNA 1C78A 4HHVA 1MK7B 1PDXA 2QDFA 2RRFA 1UF0A 1F9JA 1YQ3B 2FJUB 4BVUC 2BW2A 4L6EA 2HTME 4K2OA 4YWGG 5E6NA 4NJ6A 1C1YB 1NU2A 1R4NB 2JU6X 2RSUA 1K5DB 3O96A 4WWMA 5AZHA 2WXQA 4KHAA 2R2OA 3M3JA 5CLLB 5E6JA 3WALA 2W2WA 1E7VA 4E3CA 2P0FA 2BVCA 3GE3C 2DYOA 3DBRB 3B1LX 4MH0E 2KFJA 1ACAA 3P4PB 4CHKA 3P4SB 4EEWA 4M00A 3TVVA 4ICUA 1C9FA 2WDQB 2EMSA 4DX90 1J7CA 2W9NA 3SO6A 4MT5A 2M19A 1V5TA 4GXBA 2K9XA 2PVOD 3GYPA 3HVZA 5J3QA 1RRBA 5J18A 1WYWB 2O6VA 3FLVA 1UEFA 3J9CA 3E66A 1WSPA 4CSQA 4ZRKA 5E6PA 5HG2A 2WXMA 3EC8A 5JHBA 3A8QA 1J0GA 4A20A 3P42A 2Z8LA 5TSSA 3T9LA 3FSSA 3W5UB 3OJ3A 3ZLZA 2VH1A 4US8A 1SIJA 2JXTA 3FC4A 2C9WB 4P1BC 4GZUA 4Y94A 1UWMA 4NZLB 2LWPA 3AE5B 3R66C 2O2VB 3IT4B 4CHMA 3AH7A 4LJOB 1WM2A 4QAYA 5KHQA 1DGJA 1L5PA 3KLSX 4HKZE 4TV3A 4D6WA 5LNK1 4XYCA 4LTUA 2C7MB 2G9HD 3LJ3A 2GB1A 1DDMA 2GJYA 1G6JA 1ZC4B 5JP4A 2VRRB 2K2UA 1IRSA 2N9XA 2PKOA 2YEPB 3DVGX 1PGBA 1N63A 1TBEA 3W9CB 2IO2B 2KWUB 2DHZA 3VIAA 3I5JC 3QX1A 2MQJA 1QQRA 1XF5L 5G5GA 1ZP0B 1XLNA 1P6SA 1ST7A 3AI5A 3RCZA 3KRWA 1JWUD 1XLQA 4HRSA 4RFBA 3MC0B 3Q3MC 1WI1A 1ZXIA 3A9KA 3A9KB 5AZFA 1E10A 2KDIA 3KWVA 4ARCA 1VZ7A 5JHGA 2LEKA 3RFZB 2G35A 2W2XD 1J19A 3E9OA 1QT9A 3SR6A 4OW0A 2Y5PA 3V5WA 1EF5A 1FFUA 2J0MA 2WXJA 3PZ7A 1YQ4B 3QJZA 5C1ZA 1WXVA 2WYQA 3NVYA 2BF8B 1WVHA 1QLBB 2KYWA 1GB4A 2YVCA 1T0QC 1E0ZA 2KHWB 2KFKA 2COFA 2TSSA 3AECB 1GOZA 3NWFA 4F7GA 2HTHB 2V3NA 2UU7A 3CF6E 3NHEB 5DPSA 1WH3A 3M63B 2KWDA 2FIFA 2BT6A 3BJIA 2ADZA 5J3YA 4OZCA 1IGCA 2ELBA 2Y7BA 2E6XA 1BT0A 2DZJA 1I35A 1XCQL 5HE0A 4JK7A 5D27A 3DBLB 2J42A 5G5HA 1SJHD 2WNMA 5E6OA 1R4NI 5KCVA 1Z5SB 2KWCA 3ZNGC 4EZKA 1FD6A 1WJ4A 2CJOA 3EPYA 1B55A 2CKHB 4W9LA 4HPPA 3B0AA 1R4MB 1K53A 2IZVB 4LDTB 1K50A 4ZHOA 1SGHA 2KXJA 4IW0A 3APFA 1LGRA 3ZKJC 1F2RC 2N7EA 3JSVA 2AEHA 2RGFA 1JROA 4DXAB 4ZRPA 2WDVB 2OHFA 3AXCA 4DHJB 2WQYB 5D3DA 1BTNA 4EKUA 1V5UA 2AWTA 4I6NB 2CU3A 4HAWB 3APDA 3H7PB 4A3OA 4RM8A 1SE3A 2LJ5A 1WX7A 3DXCA 1Q1OA 4JWUC 2JYTA 2LVPA 4ZOHC 1OQYA 2D9ZA 1WR6E 1F52A 3GZNI 2GBRA 3V3XA 2GCJA 2JWZA 5D3YA 3DHIC 4NQKE 4BFRA 2RD0A 2M38A 4DDGD 3AEDB 1T0RC 1X11A 2L3ZA 3ZTDA 2PIAA 5I2MA 1V2YA 5FR3A 2YT1A 3BY4B 1IBXA 2V3SA 3CXBB 1V86A 3N20C 3U2SC 2W3RA 1QF6A 3O65B 1N60A 2MBEA 1S3SG 4GMXB 1UGJA 3HRDD 1XLOA 3TEWA 2JRHA 4RCOA 4YTMB 2BCJA 1SJED 2LGSA 3I63C 1D5XC 1L0XB 1T6BX 3NG0A 2KD0A 4JKGB 2RDBC 2DHJA 1I4HA 1CZPA 2OTXA 2J4XA 3GZNB 3H7PA 3PHXB 2HDEA 2OJRA 1K5GB 1W1DA 5CHFA 4EFOA 5IO9A 4HDQA 3RNEC 3IAS1 3QWMA 1ET9A 1BWNA 3L13A 3SBGA 2MKRA 1WX9A 2Z0QA 1KFYB 2QKMA 2Z0EB 2Q13A 1J7AA 2K8CA 4C0AA 2WXHA 4RF1A 2LRUA 3FILA 3FILB 2ROVA 4DHZE 1WGUA 5L81A 1GG3A 4KIKB 2KANA 3N30A 3JYUA 1AYFA 2NTSA 1WGKA 2D4QA 4L1BA 1DYNA 1LQBA 1UD7A 4A8XC 1U5FA 2QEJC 1ACCA 2IY0B 2MH7A 2KVZA 3AB5A 2KR0A 1WJMA 3C19A 1KRHA 2PW9A 4IWOA 2KX0A 1CK1A 1OQQA 1PFJA 2V76A 1FPYA 2MRPA 3KVFB 2RDHA 5EE9A 1ZUD2 2L0TA 4BKGA 2I1KA 4HB4B 2D9WA 5T8IA 1IPGA 4E74A 4JKHA 3PSEB 2Z59A 3KRXA 2ZCBA 1A70A 4PS7A 4ASWC 4JKEA 1NEKB 2COPA 2Z0DB 3N32A 4RM9A 1E6EB 4YSYB 2LXAA 4NAWB 3KUZA 1CMXB 4YXDB 2K00A 3FP5A 2L00B 3R8BA 4ZHPA 2P0DA 4JQWC 4RH6A 1IP9A 3L17A 4MM3A 2DWQA 1GNUA 4HAZB 3Q8EA 5J3TA 2W3SA 2L05A 2BWFA 2M56B 4OZBA 3FM8C 4XDCA 1UNPA 4NSWA 2J0JA 1Q10A 2BQQA 4OSNA 1Z2MA 2JF5A 4IDIA 5DIFB 1EM7A 3CIRB 4C7YA 2XBBC 3ZRCA 1JDEA 1GC7A 4FULA 3B2FA 4L23A 3NOBA 1V49A 4LLGM 3WAPA 2D3CA 4KHOA 2DKPA 5C5BB 1L0VB 1TTNA 2RSGA 2XEWA 4DBBA 4AJWA 2KNBA 4GDLB 4P6VF 4WURA 2DZMA 3HIZA 2O6VD 3SFEB 4M8NA 1V5MA 2NR2A 3DWGC 1X05A 1UPQA 3ECIA 3A33B 3FEHA 3KYDD 2KMCA 3HQCA 1EUVB 3BVZA 3GS2A 2CQUA 1WMHA 1N3HA 1EAZA 2NMBA 3R7QA 3PPAA 1I42A 2M4NA 4PS8A 3PTFC 1P3QU 2WX0A 1RFAA 4MJSA 1EF1A 2FDQA 5LXIB 4ILGB 3RZFA 3PREA 5KQ4A 2ZKMX 1WGGA 2DYMA 3VUXA 4WSFA 2WXGA 2FUG1 2I38A 1K51A 4M02A 2KLGA 4BBKA 4WJPA 2KN5A 1L6VA 1V5PA 3PZDA 2K3UA 2WXPA 2N9PC 3TIXA 4J6IA 4ARIA 2V4IB 4WJQA 1E90A 2K1FA 5J2RA 1VDVA 2PTLA 3RNFC 1EGXA 4FHKA 2R2QA 2LOXA 3H7SA 2ZCCA 4WVFB 3BYTB 1WGQA 1NI2A 3GE8C 2PJHA 2INCC 2DENB 3RUIB 2Z0OA 4A6FB 3UZTA 2G1EA 3A1QB 3TCAA 2KO3A 2DIKA 3WCQA 1WG7A 3RNAC 2MBOA 4ANVA 3P6AA 1FXAA 4O1NA 4LNOA 2IGHA 4XGAB 3AMZA 4M01A 3FVCA 2L1CA 4IOIE 3VR8B 1U5EA 1LFDA 3QARA 2AX5A 4MGZE 4GU2A 1ZE3D 1KI1B 4WQMA 4HVBA 5J17A 4K3BA 4UDUC 3KZ1A 3KSYA 1L0YB 2DHIA 3DBHB 3UQAA 2XN9C 1W1HA 2K0PA 4S0RA 2KJ6A 4MDKE 2M0XA 3D32A 3P7ZA 2D3BA 1MG4A 4W9JA 3BINA 1U2BA 2QC8A 3U12A 2N9EB 5DPTA 1KLVA 4XX5A 2ZZPB 2GBKA 1E7PB 1XD4A 4HAYB 1HZ6A 1C76A 4XWXA 2NBWB 3RI7C 1YN5A 3NSUA 3C8YA 1WE6A 2DZKA 1KTKA 2WU5B 4QJ4B 3RNBC 3NRZA 2CS4A 2YT2A 2ZW1A 1VJKA 1EVHA 2CAYA 3M1IB 1JMLA 2N7JA 2YLMA 4A9AA 5C6RA 2RLOA 1PMSA 1XO3A 3NS8A 2A5UA 4G50A 1TY0A 1U29A 1ZVRA 4XE0A 2NBVB 4HATB 4K17A 2FNJB 3Q8AA 3AU5A 1XT9B 1YD8U 3AJ4A 2D11A 4YL8A 4OVVA 4XWTA 4ZRQA 2VSZA 2WP9B 2Y3AA 1DIKA 4MACA 3R3MA 1WJUA 2KTFA 2P8VA 4TQ0A 1FNUA 5JZEB 1WE7A 4FADA 1WX8A 3HUIA 2COAA 1HBKA 2K6QA 4HB3B 2PPHA 3AEFB 4WH4A 3ULBA 1V80A 3BK1A 1I4PA 4HPLB 1E5WA 1WJ6A 2CHZA 4I6LB 4C4VA 3BVGA 3A98B 2KDEB 3FKYA 3VTWA 2WH5A 1ESFA 2LOZA 2W54A 5IA7A 3ALBA 2L7RA 3NS1A 4B95A 2NBUA 4KGSA 4H8SA 2GS0A 1L4DB 2J53A 3PEGA 4B6WA 2ZEQA 4Q2JA 4P1CC 5BO4B 4JKBA 3DVNU 1A5RA 4F1SA 2NPTB 2IGGA 3ODXA 2KQ4X 1PFDA 2KQSA 3IT6B 4N58A 1JW9D 3VOQA 2GMIC 5C79A 1FHXA 2GRIA 2IBIB 4URKA 3LJUX 4REZA 2KCJA 3M62B 3IBEA 1GUAB 4GDKA 3Q8FA 2JZZA 5LOPB 5IP4D 1P1AA 1GAQB 1V88A 1V1PA 1OQRA 2QCZA 2WXIA 3SBTA 2IGDA 4KZ0A 1XCGA 2I5CA 4AS1A 2K39A 1HB6A 1I4GA 2MBBB 2C60A 1D5ZC 3TJPA 4GOUA 3VRBB 1ZC3B 4EZLA 3IFWB 1EWYC 1ISNA 1FHWA 2FCMA 2QKLA 4QJ3B 3LB8C 5BMHA 2JXXA 1MJDA 2LUEA 3KY9A 3N1XC 5H92C 3KWLA 2NCNA 4P7IA 2MP2A 1KJTA 1N6ZA 1VR9A 3AE9B 3H9DA 4ILHA 1XEEA 3LYYA 2LGDA 2KKCA 2ONQA 3DBSA 4ICVA 2R0DA 2B3AA 3MP9A 1OEYA 4OT1A 1EU4A 1DOXA 4DXGA 3AEAB 4JL9A 4W9DA 1SBBB 3EECA 3TEZA 1LXDA 4N6EB 1H4RA 5D3IB 1GJZA 2X8XX 3K9PB 3SDLC 4NJ7A 2RPVA 1HTQA 1WGYA 4KHBB 2G45B 2CY4A 2JT4B 2KX3A 3ZIMA 3KQ4A 3A4SC 5I2SA 1SXTA 5LONB 1QC6A 4HWIB 3RT3B 1P7FA 1I4QA 2INNE 1V5OA 4NNJB 1ET6A 2KN4A 2JQRB 2IO1B 2LMCA 2JSVX 3JVZX 3OANA 2WXOA 2ASQA 4WJOA 1WY8A 2MBHA 4WIPA 1TJEA 2KK8A 2BS2B 1X1FA 5GXGB 2EKEC 3WYFB 2VZKB 1PGXA 2IYBA 3APCA 1BMLC 5CX3A 3SYXA 3Q3JA 4A5KA 3Q8CA 1C4PA 2X18A 1ZW7A 4US9A 3ZNID 2L83A 2N1WA 3ZW3A 3PVLA 1YN3A 1XCTL 1ZPSA 3NZSA 3VH4B 1UPRA 1DBHA 2DYQA 4A6KA 3M95A 1WZ3A 4E71A 3NW8A 2D10A 3EFUA 1VBHA 3JSVB 3Q69A 1EU3A 3DCXA 4JKFA 5LLIA 2LXCA 3CIKA 3DOWA 3MFGA 5DCNA 4IWPA 3QIJA 3L10B 2FCNA 2QHOA 2MBQA 1B1ZA 1Y8RC 2N4FA 3JW0X 4QXAB 3B9JA 3DHHC 4C7ZA 3RPFC 5L95C 1FM0D 2XNAC 2Q5WD 3S2AA 4EZJA 2AQ1B 3UGBB 3P1MA 4C80A 4WJ7A 2KJHB 4YSZB 3HVDA 3ZUNA 1V6EA 4GNKB 1ENFA 2M14A 3ZO5B 1P9DU 4W9HA 5G2NA 2KMAA 2WXKA 2ZW0A 1E7UA 3NZ3A 3QBVB 2ZPNA 4WQOB 3ZVRA 1MVKA 5IN7A 5EE1A 2MW5A 5HHDG 2KT7A 4BKSD 2RPQA 1N5XA 2RUKB 2EELA 2KC1A 3X0WA 2INPE 5GOWB 3VUWA 5D6JB 2KFKB 4LJPB 3ZYYX 1P98A 2QMTA 4IAPA 4BKSA 4GPTB 4PNKA 1UNSA 1YJ1A 1W1GA 5IKCM 2KVRA 4K7SA 4JK9A 2I5FA 1K8RB 2LD9A 1TYGB 3ABVB 2Z4DA 2GLSA 2D2QA 3PGEA 4HPMB 4W9GA 3VDZA 2DA0A 4IOYX 2OOBB 3PLVA 1U4AA 4NQLB 2ZVOA 4QJ5B 2WXNA 2N1VA 1WGRA 4GMVA 2JY6A 2HD5B 4Z2MB 3RD2A 5D3WA 3AE8B 4K7UA 4A3PA 5BMGA 1VCBA 1JWSD 1V97A 3IVFA 4GLSC 1TS2A 2JZPA 2BKRB 3VH3B 1SB3C 2ELAA 4HAVB 3DHGC 2YF0A 3SUZA 4GIVA 2H88B 2RGNB 1KM7A 1UBQA 3A8PA 2Z14A 2ON8A 3I57A 4KZCA 2ZNVC 1VBGA 5D94A 1QKZA 3B77A 2FAZA 1Y19B 1P0RA 3U7DA 3KUCB 2LHDA 5JLJB 3L4PA 2HJ1A 3OAWA 2V3PA 4B0EA 1M7RA 4PQ0A 3QK0A 4GN1A 4KDLB 3ZVVA 2LGXA 4MT7A 1ZXHA 4WWNA 3ML8A 2GBJA 5CHWA 1E8YA 3CWIA 3RMKC 2GBNA 1UWXA 2JZ3B 2INDC 2J52A 4LK0M 1JWBD 2K25A 1YX5B 2RVBB 1NENB 1VLBA 2GI9A 3E56A 4A6HA 4MJSB 2I1JA 5L83A 4KKIA 4DBGA 1HB8A 3A9JA 1TY2A 1V8CA 5JXVA 5C16A 3VHTC 1STEA 4G3XB 1DOYA 1Y56A 4DXFA 2G3QB 4MSMB 2BPSA 2LZ6A 1FEHA 1KLGD 1WZ0A 1TQZA 3TFMA 2SEBD 2KACA 5HKHA 3ZJVA 4ITKA 3NVZA 3BZDB 4B6HA 1T3QA 3DBHI 3Q3OC 5I4DA 1KBLA 2QILA 1VZ6A 1RRPB 1NBFC 5DPRA 1YX6B 3T06A 1PGAA 4P16A 2KOXA 2YS3A 1XODA 2DYBA 5C5BA 2IPKD 3PV1A 2DAJA 3L54A 2BYTA 1AQCA 2YS5A 1JRUA 2LGIA 4II2B 2K5PA 3VTUA 3DXEA 2V9HA 4RNAA 2C7HA 2YRYA 2V1YA 3Q14C 4ZYNA 4C4VB 5HE3A 3E9SA 4K1RB 2DX1A 1NYRA 1GB1A 4DIXA 4WWPA 1FB8A 1T77A 3ZTCA 3NWAA 3HIEA 2CRFA 1SSNA 3TEYA 1C79A 1NTVA 3R7RA 4OHJA 3D8DA 4PK1A 4HCNB 1DDVA 2YSZA 1CQVA 5IOIA 4K3CA 4HSIA 5DHFB 3TMPB 4PYUA 2ROZB 3NVVA 4NAWA 3QA8A 5AUKA 2D9YA 4FJZA 4JPSA 4BOSC 4ZRJA 1WGHA 2D5GA 4ACFA 2RNRB 4LNKA 2KDMA 2OEDA 1E9MA 5CTRC 1RFKA 3PRPB 3MDBC 4HLEA 1WJNA 1I4RA 2C7NB 3AM9A 1WRIA 1AW7A 1QQGA 4AQ7A 3UF8A 1WWTA 2W55A 3UIOB 4OVUA 3W1SC 4MY6A 1WM3A 4RGNA 1LW3A 4EMOA 3VQIA 2N0YA 3W2DA 4R3DA 1RAXA 2DFKA 5BMIA 3MHSD 4FA6A 2K8EA 4HB0B 2DHKA 4PYZA 1V9JA 2LASA 2Z0PA 3N1YC 4W9FA 3IG3A 1Q0WB 1HA5A 2DKQA 2ZJDA 1MG8A 2WLBA 1TKGA 3CMMB 2FCSA 4AOFA 4NJCA 4B9KA 2I2YA 4IC7B 2DYNA 2MFQA 3HHMA 2MDXA 1U5GA 3HSAA 5HFYA 2WX1A 4CO7A 3CSFA 1LO5D 1NYQA 3HW2B 1WJ1A 3NY5A 5EE3A 2E3TA 2KIGA 3F0WA 1QOBA 3U7ZA 3VAWA 2XQNM 2D3GA 5HE1A 2BKFA 1MAIA 4CYEA 1SE9A 3VRAB 4LNNA 3ZNHB 3AE2B 1T0SC 2N0SB 1NTYA 1NDDA 4IM2A 1V81A 4FHJA 3WA0A 2ZNVB 4KHBA 4B0MA 1HTOA 2XK5B 1UUPA 2KGXB 2Y5BB 3PP2A 2LI5A 5C23A 2GUMA 1TXDA 4YT0B 2MHJA 1FO4A 2LRWA 2BGFA 1AN8A 1IYFA 1WFYA 3RN9C 1H10A 3TBLD 3OHMB 1F2RI 1RWSA 2PE6B 4WWOA 4HAUB 4EE2A 3T3OA 3V60A 1TS5A 2KTRA 3HK0A 3FAHA 1S1QB 3UINB 1I7AA 2Z13A 2LULA 3KYCD 1JRPA 2HE7A 5AUIA 5DH9B 3TUOA 1MI0A 4FJVB 3VFKA 2R09A 1KC7A 4JKDA 3ZJUA 2LBBA 2N23A 3H1UA 1V89A 2VRWB 4RGOS 4XDDA 3N3KB 3PRZA 4M8MA 1FFVA 4FBJB 4IM3A 1XKEA 2DZIA 3OWEB 3ETRA 4DX8A 5D2MB 2L32A 1FGZA 3ZNZB 2KUQA 3NUHB 2R2YA 5AZGA 4A6QA 1K52A 2ACZB 2R61A 4DDID 4A90A 1X86A 1C3TA 4TQ1A 5BYRA 3U8ZA 2K8HA 2MP2B 3U4EG 2LG1A 4K2PA 5EE0A 4FLHA 1AWEA 3AE1B 2DTCA 1I2HA 1HXYD 2MCNB 1TGZB 2LYDA 1OY2A 1XLPA 3ZDMC 4KGRA 2DX5B 1J8CA 1V1OA 4IKGA 1PQSA 1L4ZB 1M4VA 2FJLA 2N9LA 3P4RB 1YOVB 5FI0A 2JVCA 4MH8A 2BTEA 1MI1A 3QC8B 1UNQA 2XK5A 4HROA 4X57B 2IYDB 1P7EA 1CJEA 2BS4B 3KUDB 2CU1A 2PZ1A 4M0WA 3P63A 4KV2A 3EFCA 4L2YA 2MA9B 1TS3A 2IJ0A 4IWQA 1Q67A 3ODWA 2CHWA 1AWDA 3TW1A 4JGHB 2CY5A 1UGMA 3B08A 3F5RA 3ENBA 1L6UA 2M8SA 2MX2A 2DN6A 5EFXA 3LXFA 1WYGA 1ZDXA 3Q8BA 2Z59B 3L16A 2J59M 2IO3B 1ZM0A 3V62A 1RM6C 4JK8A 2HRJA 3Q2AC 3AE6B 1I4XA 4YTNB 2J7QB 2L0FA 4KDIC 2K2JA 1PYWD 2AQ2B 3N7CA 2PLPA 2BWES 3GOEA 2RMMA 5MPOA 3DQVA 3GB1A 1QOGA 4ZDVA 4K81A 4KGTA 2CODA 3SNHA 1TZOA 4S17A 3P2BA 4KX6B 1KLUD 5AEKB 4JE3B 2QSDA 1ZYIA 1QOFA 3HM3A 3QCAA 5FK9C 1P5TA 1R4MI 2FJ9A 2D9VA 4HKQA 1SE4A 4F7UP 4MK0A 1WRDB 4MM3B 1YIWA 2LGYA 2BS3B 5FI1A 2MSED 4YTPB 2A4ZA 2X0SA 4LCDE 4BOZB 3MJ5A 1ZKHA 1IBXB 1MFWA 1FNWA 1RJ2A 1UZXB 3BVMA 1JWMD 4W9IA 4L1RA 3K9OB 5LG4B 3TSSA 1OMWA 2Y8GA 3QWZB 4JKAA 3WAOA 1MHXA 3VVWB 4YONA 1WGDA 2G4SA 2JPHA 1XR0B 2JYEA 4D2KA 3W5VB 1MHHE 2KMMA 4MELA 1H8CA 3DWMA 2PEAA 3DVGY 2ICIA 1YJJA 2WS3B 1FCLA 4NAMA 3AEGB 3D8EA 3A58A 1FRDA 2RQ1A 1HE8A 2QIEB 3LDZE 4XWWA 3OLMD 3ZXVA 1F77A 1XQQA 3DCGA 1TKEA 4F8CB 3ONSA 5GMVA 2BYFA 3RNGC 3ZQ4A 3G9WA 4HAXB 4IFSA 1VD2A 2MJEA 3AV8A 5C2TB 1D6EC 1EO6A 2DNFA 3BYYB 1NVLA 4JX1C 2LFIA 3PHWB 4A55A 4F7ZA 2EJ8A 4ZYSA 1SF0A 1YMHE 1BTKA 3H6NA 4II3B 2CHXA 1B9RA 4DHJD 2UZRA 2P0HA 2MJDA 1TIFA 2WGSA 1PUTA 4LDTD 3A9JB 2WXLA 4HCPB 2BB6A 2KQ7A 1LM8B 2OQBA 4PS3A 4TSSA 2H89B 1HEZE 2N7DA 1P3RA 1N62A 2VZKD 2LVQA 3AEBB 2UVMA 3PT2B 1SE2A 4KSKC 4RMAA 1WF9A 5CHVC 3MTNB 1J7BA 2FCQA 3QQ8B 3VTVA 1FXTB 1Q5WB 3R2TA 3PVWA 2KZRA 4N9F4 3AU4A 4GDLA 4XZ4A 1BXTA 1RLFA 5EDSA 2D07B 4BBNC 3GP7A 2L76A 2W82A 1OGWA 3ML9A 4MSQB 2EC1A 2H7DA 2V4LA 3V6CB 3EHVA 1YQBA 2CB8A 4RGTA 3W1YA 1V61A 4D0NB 2X38A 4DK5A 2CR5A 1ZOYB 2K8BA 5HE2A 3N9YC 2NZ8B 1XX0A 1V1PB 4GSWA 4ZRIA 4IUMB 2YT0A 2JWUA 1X1GA 2AYOB 2LVOA 3W1SA 2KC2A 1KZ7A 4IG7B 3Q6BA 1WXSA 3HM6X 3VUYA 3GYOA 1FHOA 5IRSA 1KH0A 1MIXA 2N9KA 1NI3A 1SEBD 4HXDA 2W2XC 3ENEA 5H8YE 2FE8A 3TEXA 3WIMA 1DYQA 4HK2A 5JHHA 2O2VA 3RCPA 2AL3A 4GDKB 4GB9A 2MLBA 3DXDA 3ZJTA 2KTRB 5M4YB 1YN4A 1N61A 4LNFA 2C5LC 4W9CA 3AE4B 2DLWA 2IFSA 1D4BA 1N5WA 4PT5A
chains in the Genus database with same CATH topology
3V61A 4HB2B 1GGOA 1E8XA 4TYZA 3TO1A 4JIOU 2E2XA 4AWJA 1WR1A 2R82A 4KAXB 4KVGB 4EUTA 1BAKA 3L0WB 5LXHA 1OTRB 3L08A 5FR6A 4G0NB 4NY0A 2UZSA 4TKNA 3TL5A 2IY1B 4F7HA 3DPDA 4HDOA 2AL6A 1UNRA 3ULCA 4K7WA 5D7GA 4ILJA 1L2NA 2WWZA 1U5DA 1M7EA 5DPWA 4EJNA 3ZRFA 1KZGA 4WJNA 2Y8FA 5JHAA 3DDCB 1U27A 2COCA 4W9KA 2ZPYA 3A4RA 4BKTA 4AP4C 2KUPA 2M1MA 2KDBA 2UYZB 1ZGUB 1MIZB 2RR9A 3KW5B 4AUQC 3V6EB 5G55A 4Z2NA 3E9PA 2JUOA 3SV1A 3SD5A 2G4DB 4IM0A 2ABDA 3PRMB 2GOWA 2REXA 2EMTA 1LB1A 2PE9A 4W9EA 1D3ZA 3RULA 5DI9B 1TJ6A 5KQ1A 2BYVE 4JLCA 4ANWA 1XD3B 2YS1A 3SHQA 2FUHB 2MWNB 4FJYA 1M94A 1OEYJ 5KHOA 3IHPC 1UH6A 2H7EA 3MJWA 2L8JA 3MPXA 4WAAA 1J0WA 1TZ1A 5D3XA 4MGIE 1NTIA 4DWFA 3U30A 2GBMA 4ANUA 4FN2A 2DX5A 3A1QA 3D8FA 4G11A 4JKCA 2FIDA 3CSTA 3NZUA 3VXWA 2NVUI 1DROA 4M0WB 3ODOA 4TUUA 3ZDTA 3QHTA 1FOEA 3DVNV 4GGQA 1MKEA 1OQNA 3ML4A 1L7YA 1SIFA 2BYEA 4MGYE 1E8WA 2KDFB 1WMHB 2J0KA 3UIPB 1MPHA 4A6FA 3X23A 2JP2A 5JH5C 1WI0A 5D3VA 2L2IA 4KSLC 3I3TB 2MWSB 4MGKE 1X1MA 3PS6A 4I6PA 2HTHA 1SHCA 4BBNF 2NS5A 1DDWA 1GC6A 2M17A 4DHZB 3UQBA 3T8MA 3E9LA 1WIAA 4HJKA 3RZWC 5IJMA 1Y5OA 1FGYA 4CHJA 1ZSQA 2DAFA 1QZEA 3PSCA 3WANA 2HJ8A 1Z87A 2ZVNA 2NPTA 4NPNA 2GCLA 3SU8X 2KWVB 1WXAA 3WAMA 2VKIA 4MEMA 2IO0B 1FAOA 3RYTA 5DHAB 4EOYA 3DBLI 3PLUA 1E8ZA 1UELA 2O6VB 1UBIA 3AULA 3C0RB 3DBRI 3OJ4B 3PVUA 1T0YA 2JRIB 2LKOA 4AJYB 1AARA 3QAQA 2KJRA 4XC2A 5IAAC 1WXMA 1KOTA 5TR5A 2K6DB 2KLCA 3PG7A 5JVLA 3Q3FA 5CLQB 2D9XA 4JKGA 2UWQA 4GOCA 1PLSA 4ANXA 3KH0A 4KIKA 1MK9B 2WDTB 4HHVA 1MK7B 1F9JA 4BVUC 4L6EA 4K2OA 5E6NA 4NJ6A 1C1YB 1NU2A 2RSUA 1K5DB 3O96A 5AZHA 3M3JA 4KHAA 2R2OA 3WALA 5CLLB 2W2WA 1E7VA 4E3CA 2P0FA 2DYOA 3B1LX 4MH0E 2KFJA 1ACAA 4CHKA 4EEWA 3TVVA 4ICUA 2EMSA 4DX90 2W9NA 3SO6A 1V5TA 4GXBA 3GYPA 5J3QA 1RRBA 5J18A 1WYWB 2O6VA 3FLVA 1UEFA 3E66A 4ZRKA 5E6PA 3EC8A 5JHBA 3A8QA 1J0GA 4A20A 3T9LA 3FSSA 3OJ3A 3ZLZA 2C9WB 4GZUA 4Y94A 2LWPA 3R66C 2O2VB 4CHMA 4LJOB 1WM2A 5KHQA 4TV3A 2C7MB 3LJ3A 1DDMA 2GJYA 1G6JA 1ZC4B 5JP4A 2VRRB 2K2UA 1IRSA 2N9XA 3DVGX 1TBEA 2IO2B 2KWUB 2DHZA 3VIAA 3QX1A 2MQJA 3RCZA 1P6SA 3AI5A 1ST7A 3KRWA 1WI1A 3A9KA 3A9KB 5AZFA 2KDIA 5JHGA 2G35A 2W2XD 1J19A 3E9OA 3V5WA 1EF5A 2J0MA 3QJZA 5C1ZA 1WXVA 2WYQA 2BF8B 1WVHA 2YVCA 2KHWB 2KFKA 2COFA 4F7GA 2HTHB 3NHEB 3CF6E 5DPSA 1WH3A 3M63B 2FIFA 3BJIA 2ADZA 5J3YA 2ELBA 2Y7BA 1BT0A 2DZJA 1I35A 5HE0A 4JK7A 5D27A 5E6OA 1R4NI 5KCVA 1Z5SB 2KWCA 3ZNGC 4EZKA 1WJ4A 3EPYA 1B55A 2CKHB 4W9LA 3B0AA 2IZVB 4LDTB 1SGHA 2KXJA 4IW0A 3APFA 3ZKJC 2N7EA 3JSVA 2AEHA 2RGFA 4DXAB 3AXCA 4DHJB 1BTNA 4EKUA 1V5UA 2AWTA 4I6NB 3APDA 4HAWB 3H7PB 4A3OA 4RM8A 2LJ5A 1WX7A 3DXCA 1Q1OA 2LVPA 1OQYA 2D9ZA 1WR6E 3GZNI 2GBRA 2GCJA 2JWZA 5D3YA 4NQKE 4BFRA 2RD0A 2M38A 4DDGD 1X11A 2L3ZA 3ZTDA 1V2YA 2YT1A 3BY4B 2V3SA 3CXBB 1V86A 3O65B 2MBEA 1S3SG 4GMXB 2JRHA 2BCJA 2KD0A 4JKGB 2DHJA 2OTXA 3H7PA 3PHXB 2OJRA 1K5GB 1W1DA 5CHFA 4EFOA 4HDQA 3QWMA 1BWNA 3L13A 3SBGA 2MKRA 1WX9A 2Z0QA 2QKMA 2Z0EB 2Q13A 2K8CA 4C0AA 2LRUA 2ROVA 4DHZE 1WGUA 5L81A 1GG3A 4KIKB 2KANA 3N30A 3JYUA 2D4QA 1DYNA 1LQBA 1UD7A 1U5FA 2IY0B 1WJMA 4IWOA 2KX0A 1PFJA 2V76A 2MRPA 3KVFB 2L0TA 4BKGA 2I1KA 4HB4B 2D9WA 1IPGA 4E74A 4JKHA 3PSEB 3KRXA 2ZCBA 4PS7A 4ASWC 4JKEA 2COPA 2Z0DB 3N32A 4RM9A 2LXAA 4NAWB 3KUZA 1CMXB 2K00A 3FP5A 2L00B 2P0DA 4JQWC 1IP9A 3L17A 4MM3A 1GNUA 4HAZB 5J3TA 2L05A 2BWFA 3FM8C 1UNPA 4NSWA 2J0JA 1Z2MA 2JF5A 5DIFB 2XBBC 3ZRCA 1JDEA 1GC7A 4FULA 3NOBA 1V49A 3WAPA 4KHOA 2DKPA 5C5BB 1TTNA 2RSGA 2XEWA 4DBBA 4AJWA 2KNBA 4GDLB 2DZMA 3HIZA 2O6VD 4M8NA 1V5MA 2NR2A 1X05A 1UPQA 3ECIA 3A33B 3FEHA 3KYDD 2KMCA 3HQCA 1EUVB 2CQUA 1WMHA 1N3HA 1EAZA 2NMBA 3R7QA 3PPAA 1I42A 2M4NA 4PS8A 3PTFC 1P3QU 2WX0A 1RFAA 4MJSA 1EF1A 2FDQA 5LXIB 4ILGB 3RZFA 3PREA 5KQ4A 1WGGA 2DYMA 3VUXA 4WSFA 2KLGA 4BBKA 4WJPA 2KN5A 1V5PA 3PZDA 2N9PC 3TIXA 4J6IA 4WJQA 1E90A 2K1FA 5J2RA 1EGXA 4FHKA 2R2QA 2LOXA 3H7SA 2ZCCA 4WVFB 1WGQA 1NI2A 2PJHA 2DENB 3RUIB 2Z0OA 4A6FB 3UZTA 3A1QB 3TCAA 2KO3A 2DIKA 1WG7A 2MBOA 4ANVA 3P6AA 2L1CA 1U5EA 1LFDA 3QARA 4MGZE 4GU2A 1KI1B 4HVBA 5J17A 3KZ1A 3KSYA 2DHIA 3UQAA 1W1HA 2KJ6A 4MDKE 2M0XA 3D32A 3P7ZA 4W9JA 3BINA 1U2BA 2N9EB 5DPTA 1KLVA 4XX5A 2ZZPB 2GBKA 1XD4A 4HAYB 4XWXA 2NBWB 3NSUA 1WE6A 2DZKA 2CS4A 1EVHA 2CAYA 3M1IB 2YLMA 5C6RA 2RLOA 1PMSA 3NS8A 4G50A 2A5UA 1U29A 1ZVRA 2NBVB 4HATB 4K17A 2FNJB 3AU5A 1XT9B 1YD8U 4OVVA 2D11A 3AJ4A 4YL8A 2VSZA 1DIKA 3R3MA 1WJUA 2KTFA 2P8VA 4TQ0A 5JZEB 1WE7A 4FADA 1WX8A 2COAA 1HBKA 2K6QA 4HB3B 2PPHA 3ULBA 1V80A 4HPLB 1E5WA 1WJ6A 2CHZA 4I6LB 3A98B 2KDEB 3VTWA 2WH5A 2LOZA 5IA7A 3ALBA 2L7RA 4B95A 2NBUA 4H8SA 2GS0A 3PEGA 4B6WA 2ZEQA 5BO4B 4JKBA 3DVNU 1A5RA 4F1SA 2NPTB 3ODXA 2KQSA 3VOQA 2GMIC 5C79A 1FHXA 2IBIB 4URKA 3LJUX 2KCJA 3M62B 3IBEA 1GUAB 4GDKA 2JZZA 5LOPB 1P1AA 1V88A 3SBTA 4KZ0A 1XCGA 2I5CA 2K39A 1HB6A 2MBBB 2C60A 3TJPA 4EZLA 1ZC3B 3IFWB 1ISNA 1FHWA 2FCMA 2QKLA 2JXXA 2LUEA 3KY9A 2NCNA 4P7IA 2MP2A 1KJTA 3H9DA 4ILHA 2LGDA 2KKCA 3DBSA 4ICVA 2R0DA 2B3AA 1OEYA 4JL9A 4W9DA 3EECA 1LXDA 1H4RA 1GJZA 3K9PB 3SDLC 4NJ7A 1WGYA 4KHBB 2G45B 2CY4A 2JT4B 2KX3A 3ZIMA 3A4SC 5LONB 1QC6A 4HWIB 3RT3B 1V5OA 4NNJB 2IO1B 3JVZX 3OANA 2ASQA 4WJOA 1WY8A 2MBHA 2KK8A 1X1FA 2EKEC 3WYFB 2IYBA 3APCA 5CX3A 3SYXA 3Q3JA 4A5KA 2X18A 1ZW7A 3ZNID 2N1WA 3ZW3A 3PVLA 3VH4B 3NZSA 1UPRA 1DBHA 2DYQA 4A6KA 3M95A 1WZ3A 4E71A 2D10A 3EFUA 1VBHA 3JSVB 4JKFA 5LLIA 2LXCA 3CIKA 3DOWA 5DCNA 4IWPA 3QIJA 3L10B 2FCNA 2QHOA 2MBQA 1Y8RC 2N4FA 3JW0X 5L95C 3S2AA 4EZJA 3UGBB 4WJ7A 2KJHB 3ZUNA 1V6EA 3ZO5B 2M14A 1P9DU 4W9HA 5G2NA 2KMAA 1E7UA 4WQOB 3QBVB 2ZPNA 3ZVRA 2MW5A 4BKSD 2RPQA 2RUKB 2KC1A 3X0WA 5GOWB 3VUWA 5D6JB 2KFKB 4LJPB 1P98A 4IAPA 4BKSA 4GPTB 4PNKA 1YJ1A 1W1GA 2KVRA 4K7SA 4JK9A 2I5FA 1K8RB 2LD9A 3PGEA 2D2QA 4W9GA 4HPMB 3VDZA 2DA0A 4IOYX 2OOBB 3PLVA 1U4AA 4NQLB 2ZVOA 2N1VA 1WGRA 4GMVA 2JY6A 2HD5B 4Z2MB 3RD2A 5D3WA 4K7UA 4A3PA 1VCBA 3IVFA 2BKRB 3VH3B 2ELAA 4HAVB 2YF0A 3SUZA 4GIVA 2RGNB 1KM7A 1UBQA 3A8PA 4KZCA 2ZNVC 1VBGA 5D94A 2FAZA 1Y19B 1P0RA 3U7DA 3KUCB 5JLJB 3OAWA 1M7RA 4PQ0A 3QK0A 4GN1A 4KDLB 3ZVVA 2LGXA 4MT7A 4WWNA 3ML8A 2GBJA 5CHWA 1E8YA 2GBNA 2JZ3B 2K25A 1YX5B 2RVBB 4A6HA 4MJSB 2I1JA 5L83A 4DBGA 1HB8A 3A9JA 5C16A 3VHTC 4G3XB 2G3QB 4MSMB 2BPSA 2LZ6A 1WZ0A 1TQZA 3TFMA 5HKHA 4B6HA 3DBHI 1KBLA 1RRPB 1NBFC 5DPRA 1YX6B 3T06A 2KOXA 2YS3A 1XODA 2DYBA 5C5BA 3PV1A 2DAJA 3L54A 1AQCA 2YS5A 1JRUA 4II2B 3VTUA 3DXEA 2C7HA 2YRYA 2V1YA 4ZYNA 5HE3A 4K1RB 2DX1A 4WWPA 1FB8A 3ZTCA 2CRFA 1NTVA 3R7RA 3D8DA 4HCNB 1DDVA 2YSZA 5DHFB 3TMPB 4PYUA 2ROZB 4NAWA 3QA8A 2D9YA 4FJZA 4BOSC 4ZRJA 1WGHA 2RNRB 5CTRC 3PRPB 3MDBC 4HLEA 1WJNA 2C7NB 1QQGA 3UF8A 3UIOB 4OVUA 3W1SC 4MY6A 1WM3A 1LW3A 4EMOA 3VQIA 2N0YA 1RAXA 2DFKA 3MHSD 4FA6A 4HB0B 2DHKA 4PYZA 1V9JA 2LASA 2Z0PA 4W9FA 3IG3A 1Q0WB 2DKQA 2ZJDA 1MG8A 3CMMB 2FCSA 4AOFA 4B9KA 4IC7B 2DYNA 2MFQA 3HHMA 2MDXA 1U5GA 2WX1A 4CO7A 3CSFA 3HW2B 1WJ1A 3NY5A 3F0WA 3VAWA 2XQNM 2D3GA 5HE1A 2BKFA 1MAIA 4CYEA 1SE9A 3ZNHB 1NTYA 1NDDA 4IM2A 1V81A 4FHJA 3WA0A 2ZNVB 2XK5B 2KGXB 2Y5BB 3PP2A 2LI5A 5C23A 1TXDA 2LRWA 2BGFA 1IYFA 1WFYA 3TBLD 1H10A 2PE6B 4WWOA 4HAUB 3V60A 2KTRA 3HK0A 1S1QB 3UINB 1I7AA 2LULA 3KYCD 2HE7A 5DH9B 4FJVB 3VFKA 2R09A 1KC7A 4JKDA 2LBBA 2N23A 3H1UA 1V89A 2VRWB 3N3KB 3PRZA 4M8MA 4FBJB 4IM3A 1XKEA 2DZIA 4DX8A 5D2MB 1FGZA 3ZNZB 5AZGA 4DDID 1X86A 1C3TA 4TQ1A 3U8ZA 2K8HA 2MP2B 2LG1A 4K2PA 4FLHA 1AWEA 2DTCA 1I2HA 2MCNB 1TGZB 2LYDA 1OY2A 3ZDMC 1J8CA 2DX5B 1PQSA 2FJLA 5FI0A 2JVCA 3QC8B 1UNQA 2XK5A 4X57B 2IYDB 3KUDB 2CU1A 2PZ1A 4KV2A 2MA9B 4IWQA 1Q67A 3ODWA 2CHWA 3TW1A 4JGHB 2CY5A 1UGMA 3B08A 3F5RA 3ENBA 2M8SA 2MX2A 2DN6A 5EFXA 2Z59B 3L16A 2J59M 2IO3B 1ZM0A 3V62A 4JK8A 2HRJA 2J7QB 2L0FA 4KDIC 2K2JA 3N7CA 2BWES 3GOEA 3DQVA 4ZDVA 4K81A 2CODA 3SNHA 3P2BA 5AEKB 3HM3A 3QCAA 1P5TA 1R4MI 2FJ9A 2D9VA 4F7UP 4MK0A 1WRDB 1YIWA 2LGYA 5FI1A 2MSED 2A4ZA 2X0SA 4LCDE 4BOZB 1ZKHA 1RJ2A 1UZXB 4W9IA 3K9OB 1OMWA 2Y8GA 3QWZB 4JKAA 3WAOA 3VVWB 4YONA 1WGDA 2G4SA 2JPHA 1XR0B 4MELA 1H8CA 2PEAA 3DVGY 3D8EA 1HE8A 2RQ1A 3LDZE 3OLMD 1XQQA 3DCGA 4F8CB 3ONSA 5GMVA 2BYFA 3G9WA 4HAXB 4IFSA 1VD2A 1EO6A 1NVLA 3PHWB 4F7ZA 2EJ8A 1BTKA 3H6NA 4II3B 2CHXA 4DHJD 2UZRA 2P0HA 4LDTD 3A9JB 4HCPB 2KQ7A 1LM8B 2OQBA 4PS3A 2N7DA 1P3RA 2LVQA 2UVMA 3PT2B 4RMAA 4KSKC 1WF9A 5CHVC 3MTNB 2FCQA 3QQ8B 3VTVA 1FXTB 1Q5WB 3PVWA 2KZRA 4N9F4 3AU4A 4GDLA 4XZ4A 1RLFA 5EDSA 2D07B 4BBNC 2L76A 1OGWA 3ML9A 4MSQB 2EC1A 2H7DA 2V4LA 3V6CB 3EHVA 1YQBA 2CB8A 3W1YA 1V61A 4D0NB 4DK5A 2CR5A 2K8BA 5HE2A 2NZ8B 1XX0A 4GSWA 4ZRIA 4IUMB 2YT0A 1X1GA 2AYOB 2LVOA 3W1SA 2KC2A 1KZ7A 4IG7B 1WXSA 3HM6X 3VUYA 3GYOA 1FHOA 1MIXA 4HXDA 2W2XC 3ENEA 3WIMA 4HK2A 5JHHA 2O2VA 3RCPA 2AL3A 4GDKB 4GB9A 2MLBA 3DXDA 2KTRB 2C5LC 4W9CA 2DLWA 2IFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHF B;  2VSZ A;  3TMP B;  4PYU A;  1WI1 A;  2ROZ B;  3A9K A;  3R3M A;  4NAW A;  3A9K B;  3QA8 A;  3V61 A;  5AZF A;  4HB2 B;  2KDI A;  2D9Y A;  4FJZ A;  5JHG A;  1WJU A;  2KTF A;  4BOS C;  4ZRJ A;  2G35 A;  2W2X D;  1E8X A;  4TYZ A;  1J19 A;  1WGH A;  2P8V A;  4TQ0 A;  2RNR B;  5JZE B;  1WE7 A;  4FAD A;  3TO1 A;  4JIO U;  1WX8 A;  2E2X A;  4AWJ A;  1WR1 A;  2COA A;  5CTR C;  1HBK A;  2K6Q A;  3PRP B;  4HB3 B;  3MDB C;  2PPH A;  4HLE A;  3V5W A;  1EF5 A;  1WJN A;  2J0M A;  3QJZ A;  5C1Z A;  2C7N B;  1WXV A;  4KAX B;  2WYQ A;  1QQG A;  3UF8 A;  4KVG B;  3UIO B;  1BAK A;  4OVU A;  4EUT A;  3ULB A;  1V80 A;  3W1S C;  2BF8 B;  4HPL B;  3L0W B;  4MY6 A;  1E5W A;  1WJ6 A;  1LW3 A;  1WM3 A;  1OTR B;  2CHZ A;  1WVH A;  4EMO A;  2N0Y A;  4I6L B;  3VQI A;  3A98 B;  2KDE B;  1RAX A;  3L08 A;  2WH5 A;  3VTW A;  2DFK A;  2YVC A;  3MHS D;  4FA6 A;  2LOZ A;  5FR6 A;  4G0N B;  4NY0 A;  2UZS A;  4HB0 B;  2DHK A;  4TKN A;  1V9J A;  2KHW B;  2IY1 B;  2L7R A;  2LAS A;  2Z0P A;  2KFK A;  2NBU A;  4B95 A;  2COF A;  4H8S A;  2GS0 A;  4F7H A;  4W9F A;  3DPD A;  3IG3 A;  1Q0W B;  3PEG A;  4F7G A;  2DKQ A;  2ZJD A;  2HTH B;  1MG8 A;  3NHE B;  2ZEQ A;  3CF6 E;  4HDO A;  5DPS A;  2AL6 A;  1UNR A;  1WH3 A;  3CMM B;  2FCS A;  3M63 B;  4AOF A;  3ULC A;  4K7W A;  4B9K A;  2FIF A;  5D7G A;  4IC7 B;  3BJI A;  2ADZ A;  2DYN A;  5J3Y A;  2MFQ A;  5BO4 B;  1L2N A;  3DVN U;  1A5R A;  4F1S A;  2NPT B;  2WWZ A;  3HHM A;  2ELB A;  2Y7B A;  1U5D A;  1BT0 A;  1M7E A;  3ODX A;  2DZJ A;  2KQS A;  2MDX A;  4EJN A;  3ZRF A;  1KZG A;  1U5G A;  5DPW A;  1I35 A;  5HE0 A;  2WX1 A;  4CO7 A;  4WJN A;  3VOQ A;  3CSF A;  2GMI C;  2Y8F A;  3HW2 B;  5D27 A;  1WJ1 A;  3NY5 A;  5C79 A;  5JHA A;  1FHX A;  3DDC B;  3RZF A;  1U27 A;  2COC A;  2IBI B;  3F0W A;  4W9K A;  5E6O A;  4URK A;  3VAW A;  1R4N I;  5KCV A;  2ZPY A;  2XQN M;  1Z5S B;  3LJU X;  2D3G A;  2KWC A;  5HE1 A;  2BKF A;  1MAI A;  4CYE A;  1WJ4 A;  1SE9 A;  3A4R A;  3ZNG C;  4BKT A;  4EZK A;  4AP4 C;  2KCJ A;  2KUP A;  3M62 B;  3ZNH B;  2M1M A;  2KDB A;  2UYZ B;  1ZGU B;  3IBE A;  1MIZ B;  1B55 A;  3EPY A;  1GUA B;  2CKH B;  4W9L A;  1NTY A;  1NDD A;  4IM2 A;  4GDK A;  1V81 A;  3B0A A;  4FHJ A;  4JLC A;  2IZV B;  3WA0 A;  5LOP B;  2JZZ A;  2RR9 A;  2ZNV B;  3KW5 B;  1P1A A;  4LDT B;  4AUQ C;  1SGH A;  2KXJ A;  4IW0 A;  3V6E B;  3APF A;  1V88 A;  2XK5 B;  3ZKJ C;  5G55 A;  2N7E A;  4Z2N A;  2KGX B;  2Y5B B;  2AEH A;  3JSV A;  4KZ0 A;  1XCG A;  2I5C A;  2RGF A;  3PP2 A;  4DXA B;  2JUO A;  2LI5 A;  5C23 A;  3SV1 A;  1TXD A;  3SD5 A;  2G4D B;  3AXC A;  2K39 A;  1HB6 A;  4IM0 A;  2MBB B;  2ABD A;  2C60 A;  2LRW A;  4DHJ B;  2BGF A;  3PRM B;  3TJP A;  4EZL A;  1ZC3 B;  3ALB A;  1BTN A;  2GOW A;  2REX A;  2EMT A;  4EKU A;  1WFY A;  3IFW B;  1ISN A;  1FHW A;  1H10 A;  1V5U A;  2PE6 B;  2FCM A;  3TBL D;  2QKL A;  1LB1 A;  4WWO A;  2PE9 A;  4HAU B;  2AWT A;  3APD A;  4HAW B;  3H7P B;  2JXX A;  4I6N B;  4W9E A;  4A3O A;  4RM8 A;  1D3Z A;  2LUE A;  3RUL A;  3KY9 A;  3V60 A;  5DI9 B;  1TJ6 A;  5KQ1 A;  2BYV E;  3HK0 A;  1WX7 A;  2KTR A;  3DXC A;  1S1Q B;  2LJ5 A;  2NCN A;  4P7I A;  1Q1O A;  1XD3 B;  3UIN B;  2YS1 A;  4ANW A;  1I7A A;  2MP2 A;  1KJT A;  2LVP A;  3SHQ A;  2FUH B;  1OQY A;  2D9Z A;  2LUL A;  2MWN B;  1WR6 E;  3KYC D;  3H9D A;  2HE7 A;  3GZN I;  5DH9 B;  4FJY A;  1M94 A;  1OEY J;  5KHO A;  2GBR A;  4FJV B;  3IHP C;  1UH6 A;  3VFK A;  2R09 A;  2GCJ A;  2JWZ A;  2H7E A;  3MJW A;  5D3Y A;  3MPX A;  2L8J A;  4NQK E;  4BFR A;  2RD0 A;  2M38 A;  4WAA A;  2LBB A;  2LGD A;  2N23 A;  4OVV A;  4DDG D;  1J0W A;  2KKC A;  3DBS A;  4ICV A;  3H1U A;  2R0D A;  5D3X A;  1TZ1 A;  1V89 A;  2VRW B;  1X11 A;  2B3A A;  2L3Z A;  4MGI E;  3ZTD A;  1NTI A;  3N3K B;  1OEY A;  3PRZ A;  4M8M A;  4DWF A;  1V2Y A;  3U30 A;  4FBJ B;  2YT1 A;  2GBM A;  3BY4 B;  4IM3 A;  1XKE A;  2V3S A;  4ANU A;  3CXB B;  1V86 A;  2DZI A;  4JL9 A;  4W9D A;  4FN2 A;  3EEC A;  2DX5 A;  4DX8 A;  5D2M B;  1LXD A;  3O65 B;  1FGZ A;  2MBE A;  3ZNZ B;  1H4R A;  1S3S G;  3A1Q A;  3D8F A;  4G11 A;  5AZG A;  4GMX B;  2FID A;  1GJZ A;  3K9P B;  3SDL C;  3CST A;  4NJ7 A;  3NZU A;  3VXW A;  2NVU I;  1DRO A;  4M0W B;  2JRH A;  4DDI D;  1WGY A;  4KHB B;  2G45 B;  2BCJ A;  1X86 A;  2CY4 A;  2JT4 B;  4TQ1 A;  1C3T A;  3U8Z A;  2KX3 A;  3ZIM A;  2K8H A;  2MP2 B;  2LG1 A;  4K2P A;  2KD0 A;  3ODO A;  4FLH A;  3ZDT A;  4TUU A;  1AWE A;  1KOT A;  2DTC A;  3A4S C;  1I2H A;  3QHT A;  2DHJ A;  1FOE A;  3DVN V;  2MCN B;  2OTX A;  5LON B;  1QC6 A;  1TGZ B;  2LYD A;  1OY2 A;  3H7P A;  2OJR A;  3PHX B;  1K5G B;  4GGQ A;  1W1D A;  4HWI B;  5CHF A;  3RT3 B;  3ZDM C;  4EFO A;  4WQO B;  2DX5 B;  1J8C A;  1MKE A;  1OQN A;  4HDQ A;  3ML4 A;  1V5O A;  4NNJ B;  3QWM A;  1L7Y A;  1SIF A;  2BYE A;  1BWN A;  1PQS A;  2IO1 B;  3L13 A;  4MGY E;  1E8W A;  2KDF B;  3JVZ X;  2MKR A;  3OAN A;  1WX9 A;  1WMH B;  2FJL A;  1WY8 A;  2ASQ A;  2MBH A;  2J0K A;  4WJO A;  2KK8 A;  2Z0Q A;  5FI0 A;  3UIP B;  2JVC A;  1MPH A;  1X1F A;  2QKM A;  4A6F A;  2Q13 A;  2EKE C;  2Z0E B;  3QC8 B;  3WYF B;  3X23 A;  1UNQ A;  2K8C A;  2JP2 A;  4C0A A;  2XK5 A;  1WI0 A;  5JH5 C;  2IYB A;  4X57 B;  2IYD B;  2LRU A;  5IA7 A;  5D3V A;  2L2I A;  2ROV A;  4DHZ E;  3APC A;  4KSL C;  3KUD B;  2CU1 A;  1WGU A;  5L81 A;  3I3T B;  3SYX A;  1GG3 A;  2MWS B;  2KAN A;  4KIK B;  4MGK E;  5CX3 A;  2PZ1 A;  1X1M A;  4A5K A;  3Q3J A;  3N30 A;  3JYU A;  3PS6 A;  4I6P A;  4KV2 A;  2HTH A;  2D4Q A;  2X18 A;  1ZW7 A;  2MA9 B;  1SHC A;  1DYN A;  4IWQ A;  4BBN F;  2NS5 A;  3ZNI D;  1Q67 A;  1DDW A;  1LQB A;  3ODW A;  2N1W A;  2CHW A;  3ZW3 A;  1GC6 A;  1UD7 A;  1U5F A;  2M17 A;  3PVL A;  4DHZ B;  3UQB A;  3T8M A;  3TW1 A;  4JGH B;  2CY5 A;  1UGM A;  3B08 A;  3VH4 B;  2IY0 B;  3NZS A;  1WIA A;  1UPR A;  1DBH A;  3F5R A;  4HJK A;  2DYQ A;  3RZW C;  4A6K A;  3M95 A;  2M8S A;  2MX2 A;  5IJM A;  2DN6 A;  5EFX A;  1Y5O A;  1WZ3 A;  4E71 A;  1FGY A;  2D10 A;  3EFU A;  1WJM A;  4CHJ A;  2Z59 B;  3L16 A;  4IWO A;  1ZSQ A;  3JSV B;  2J59 M;  2DAF A;  1QZE A;  2KX0 A;  3PSC A;  2IO3 B;  2HJ8 A;  1Z87 A;  2ZVN A;  3WAN A;  1ZM0 A;  2NPT A;  1PFJ A;  2V76 A;  3V62 A;  2MRP A;  3KVF B;  4NPN A;  5LLI A;  2LXC A;  3CIK A;  3DOW A;  2HRJ A;  2L0T A;  5DCN A;  4BKG A;  4IWP A;  3QIJ A;  2I1K A;  2GCL A;  2D9W A;  4HB4 B;  2FCN A;  2MBQ A;  1IPG A;  2QHO A;  3L10 B;  3PSE B;  4E74 A;  1Y8R C;  2J7Q B;  3KRX A;  2ZCB A;  4PYZ A;  2L0F A;  2N4F A;  3JW0 X;  4PS7 A;  4ASW C;  4KDI C;  2K2J A;  5L95 C;  2COP A;  3N7C A;  2Z0D B;  2BWE S;  3GOE A;  3N32 A;  4RM9 A;  2KWV B;  3S2A A;  3SU8 X;  4EZJ A;  2LXA A;  3DQV A;  4NAW B;  1WXA A;  3UGB B;  3WAM A;  3KUZ A;  1CMX B;  2VKI A;  4MEM A;  2K00 A;  4WJ7 A;  3FP5 A;  2L00 B;  2KJH B;  2P0D A;  2IO0 B;  4ZDV A;  4JQW C;  4K81 A;  2COD A;  1FAO A;  3SNH A;  3ZUN A;  1IP9 A;  1V6E A;  3L17 A;  3P2B A;  2M14 A;  3RYT A;  3ZO5 B;  5DHA B;  1P9D U;  4W9H A;  3DBL I;  4MM3 A;  5G2N A;  4EOY A;  5AEK B;  2KMA A;  3PLU A;  1E8Z A;  1UEL A;  1GNU A;  4HAZ B;  2O6V B;  5J3T A;  3HM3 A;  2L05 A;  1UBI A;  2BWF A;  1E7U A;  3AUL A;  3C0R B;  3QCA A;  4B6W A;  1P5T A;  3FM8 C;  3DBR I;  3QBV B;  2FJ9 A;  2D9V A;  1UNP A;  1R4M I;  3ZVR A;  4NSW A;  3PVU A;  2J0J A;  2ZPN A;  4F7U P;  3OJ4 B;  4MK0 A;  1T0Y A;  1WRD B;  2JRI B;  2MW5 A;  2LKO A;  1YIW A;  1Z2M A;  2LGY A;  2JF5 A;  4AJY B;  4BKS D;  5DIF B;  1AAR A;  2RPQ A;  3QAQ A;  2RUK B;  2KC1 A;  2XBB C;  3X0W A;  5FI1 A;  2KJR A;  4XC2 A;  5GOW B;  3AI5 A;  2MSE D;  1GC7 A;  2A4Z A;  4FUL A;  4LCD E;  5D6J B;  3NOB A;  1WXM A;  1V49 A;  2KFK B;  4LJP B;  5IAA C;  5TR5 A;  2K6D B;  2KLC A;  1P98 A;  3WAP A;  3PG7 A;  1ZKH A;  4BOZ B;  1RJ2 A;  1UZX B;  4KHO A;  2DKP A;  5C5B B;  4W9I A;  1TTN A;  2RSG A;  3K9O B;  2XEW A;  3Q3F A;  4IAP A;  4DBB A;  4GPT B;  5CLQ B;  4PNK A;  4AJW A;  2KNB A;  4BKS A;  1YJ1 A;  2D9X A;  1OMW A;  2Y8G A;  1W1G A;  3QWZ B;  4GDL B;  2KVR A;  2UWQ A;  3WAO A;  2DZM A;  3HIZ A;  2O6V D;  4GOC A;  3VVW B;  4K7S A;  1PLS A;  2I5F A;  1K8R B;  4YON A;  1WGD A;  2G4S A;  2JPH A;  2LD9 A;  3KH0 A;  4KIK A;  1XR0 B;  4M8N A;  4ANX A;  1V5M A;  1MK9 B;  3PGE A;  2D2Q A;  4W9G A;  2WDT B;  4HPM B;  2NR2 A;  1X05 A;  3VDZ A;  2DA0 A;  4IOY X;  2OOB B;  1UPQ A;  3PLV A;  1U4A A;  4NQL B;  3ECI A;  4MEL A;  3A33 B;  3FEH A;  4HHV A;  2ZVO A;  1MK7 B;  2PEA A;  3KYD D;  1H8C A;  2KMC A;  3DVG Y;  3HQC A;  1EUV B;  2N1V A;  1WGR A;  2CQU A;  1F9J A;  1WMH A;  1N3H A;  4GMV A;  1EAZ A;  2NMB A;  3D8E A;  3R7Q A;  1HE8 A;  2JY6 A;  2RQ1 A;  2HD5 B;  3LDZ E;  4Z2M B;  3PPA A;  5D3W A;  2M4N A;  3OLM D;  4PS8 A;  4K7U A;  3RD2 A;  3PTF C;  4A3P A;  1I42 A;  4L6E A;  1VCB A;  1XQQ A;  1IYF A;  1P3Q U;  4K2O A;  3DCG A;  4F8C B;  2WX0 A;  5E6N A;  4NJ6 A;  1RFA A;  3IVF A;  3ONS A;  1C1Y B;  1NU2 A;  1EF1 A;  2FDQ A;  2BKR B;  2BYF A;  2RSU A;  4MJS A;  5GMV A;  5LXI B;  3VH3 B;  1K5D B;  2ELA A;  3O96 A;  4HAV B;  3G9W A;  4HAX B;  3PRE A;  4IFS A;  5AZH A;  3M3J A;  4KHA A;  2R2O A;  3WAL A;  5CLL B;  5KQ4 A;  1WGG A;  2W2W A;  1E7V A;  1VD2 A;  2YF0 A;  2DYM A;  4WSF A;  3SUZ A;  4GIV A;  3VUX A;  2RGN B;  1KM7 A;  1UBQ A;  4E3C A;  3A8P A;  2P0F A;  4KZC A;  1EO6 A;  2ZNV C;  5D94 A;  2KLG A;  3ZRC A;  1NVL A;  4BBK A;  2DYO A;  2KN5 A;  4WJP A;  2FAZ A;  1V5P A;  3PHW B;  1Y19 B;  4F7Z A;  3PZD A;  2EJ8 A;  1P0R A;  3B1L X;  1BTK A;  2N9P C;  3U7D A;  4MH0 E;  2KFJ A;  3TIX A;  3H6N A;  3KUC B;  4II3 B;  4J6I A;  5JLJ B;  2CHX A;  4DHJ D;  4WJQ A;  2UZR A;  1ACA A;  2P0H A;  1E90 A;  2K1F A;  3OAW A;  1M7R A;  5J2R A;  4PQ0 A;  3QK0 A;  4GN1 A;  4KDL B;  4LDT D;  3A9J B;  4HCP B;  3VUW A;  1EGX A;  3ZVV A;  4CHK A;  4EEW A;  3TVV A;  2KQ7 A;  1LM8 B;  4FHK A;  4ICU A;  2R2Q A;  2LGX A;  4MT7 A;  2LOX A;  2OQB A;  2EMS A;  2ZCC A;  4DX9 0;  3H7S A;  4WVF B;  4PS3 A;  4WWN A;  2N7D A;  3ML8 A;  2W9N A;  1P3R A;  2GBJ A;  5CHW A;  1E8Y A;  3SO6 A;  1WGQ A;  1NI2 A;  3TL5 A;  2LVQ A;  1V5T A;  2GBN A;  2JZ3 B;  2PJH A;  4GXB A;  2UVM A;  2DEN B;  3RUI B;  3GYP A;  3PT2 B;  2K25 A;  4RMA A;  5J3Q A;  2Z0O A;  4KSK C;  1RRB A;  1WF9 A;  2RVB B;  1YX5 B;  5CHV C;  5J18 A;  4A6F B;  1WYW B;  2O6V A;  3FLV A;  3MTN B;  3UZT A;  4A6H A;  2FCQ A;  3QQ8 B;  1FXT B;  1Q5W B;  3A1Q B;  3VTV A;  3PVW A;  1UEF A;  3TCA A;  2KO3 A;  2KZR A;  4N9F 4;  3AU4 A;  1WG7 A;  4GDL A;  4MJS B;  2I1J A;  4XZ4 A;  1RLF A;  4ZRK A;  5L83 A;  5E6P A;  5EDS A;  2D07 B;  2MBO A;  1HB8 A;  4BBN C;  4ANV A;  4DBG A;  3A9J A;  3EC8 A;  5JHB A;  2L76 A;  1OGW A;  3A8Q A;  3P6A A;  3ML9 A;  4MSQ B;  5LXH A;  2EC1 A;  2H7D A;  5C16 A;  3VHT C;  2V4L A;  4G3X B;  3V6C B;  3EHV A;  1J0G A;  2G3Q B;  4MSM B;  4A20 A;  2BPS A;  1YQB A;  1WZ0 A;  2LZ6 A;  3T9L A;  2CB8 A;  3FSS A;  1TQZ A;  2L1C A;  3TFM A;  3OJ3 A;  3W1Y A;  3ZLZ A;  4BVU C;  1V61 A;  4D0N B;  1U5E A;  1LFD A;  5HKH A;  3QAR A;  4MGZ E;  4GU2 A;  4DK5 A;  1KI1 B;  4HVB A;  4B6H A;  5J17 A;  2CR5 A;  2C9W B;  3KZ1 A;  2K8B A;  3KSY A;  5HE2 A;  3DBH I;  2NZ8 B;  1XX0 A;  2DHI A;  4GZU A;  4Y94 A;  4GSW A;  3UQA A;  1RRP B;  4ZRI A;  1NBF C;  4IUM B;  2YT0 A;  1W1H A;  5DPR A;  1YX6 B;  2LWP A;  1X1G A;  3R66 C;  3T06 A;  2KJ6 A;  4CHM A;  2AYO B;  2O2V B;  2KOX A;  4LJO B;  2YS3 A;  2LVO A;  4MDK E;  2M0X A;  1WM2 A;  3W1S A;  2KC2 A;  1KZ7 A;  5KHQ A;  3D32 A;  4TV3 A;  1XOD A;  2DYB A;  4IG7 B;  3P7Z A;  5C5B A;  1WXS A;  2DAJ A;  3PV1 A;  2D11 A;  3L54 A;  2C7M B;  1AQC A;  3HM6 X;  2YS5 A;  4W9J A;  3VUY A;  3BIN A;  1JRU A;  3GYO A;  1U2B A;  3LJ3 A;  4II2 B;  1DDM A;  2GJY A;  1G6J A;  1FHO A;  2N9E B;  5DPT A;  3VTU A;  1ZC4 B;  1KLV A;  4XX5 A;  3DXE A;  2ZZP B;  2C7H A;  2YRY A;  2GBK A;  2V1Y A;  4ZYN A;  5HE3 A;  5JP4 A;  1XD4 A;  4HAY B;  2K2U A;  1MIX A;  2DX1 A;  2VRR B;  4XWX A;  4K1R B;  2NBW B;  1IRS A;  2N9X A;  4WWP A;  1FB8 A;  3NSU A;  4HXD A;  2W2X C;  1WE6 A;  3DVG X;  3ZTC A;  1TBE A;  2DZK A;  3ENE A;  2IO2 B;  2CRF A;  3WIM A;  2KWU B;  2DHZ A;  5JHH A;  2O2V A;  4HK2 A;  2CS4 A;  3VIA A;  3QX1 A;  3RCP A;  2AL3 A;  2MQJ A;  4GDK B;  4GB9 A;  1EVH A;  2CAY A;  3M1I B;  2YLM A;  2MLB A;  1NTV A;  5C6R A;  3DXD A;  2RLO A;  1PMS A;  2KTR B;  3NS8 A;  2A5U A;  3D8D A;  4G50 A;  3R7R A;  1U29 A;  1ZVR A;  2NBV B;  1DDV A;  2C5L C;  4HCN B;  4W9C A;  3RCZ A;  2DLW A;  1P6S A;  1ST7 A;  2IFS A;  2YSZ A;  4HAT B;  3KRW A;  4K17 A;  3AU5 A;  1XT9 B;  1YD8 U;  3AJ4 A;  2FNJ B;  4YL8 A; 
#chains in the Genus database with same CATH topology
 3EUB 2;  3V61 A;  4HB2 B;  1GGO A;  1E8X A;  1FIQ A;  1VRA B;  4TYZ A;  2BB5 A;  1JWA D;  3SFD B;  3TO1 A;  4JIO U;  1QOA A;  2E2X A;  4AWJ A;  1WR1 A;  1D5M C;  2R82 A;  2OJW A;  4RF0 A;  2EKI A;  2PVG C;  3AE3 B;  4KAX B;  3R2I A;  4KVG B;  4EUT A;  1BAK A;  3L0W B;  4HEA 1;  3U52 E;  5LXH A;  1OTR B;  1WXQ A;  2L52 A;  3L08 A;  5FR6 A;  4G0N B;  4NY0 A;  2UZS A;  4TKN A;  3TL5 A;  2PMV A;  2IY1 B;  3BWU D;  4F7H A;  3DPD A;  3IXS A;  3PO0 A;  3P4Q B;  4HDO A;  2AL6 A;  1UNR A;  2WU2 B;  2BBC A;  3OG5 A;  4JWS C;  5FKA C;  3ULC A;  4K7W A;  5D7G A;  3IAM 1;  4ILJ A;  1L2N A;  2WWZ A;  1U5D A;  1M7E A;  2M0A A;  1VZ8 A;  5DPW A;  4EJN A;  3ZRF A;  1KZG A;  4WJN A;  2Y8F A;  1KF6 B;  5JHA A;  3DDC B;  1U27 A;  2COC A;  4W9K A;  2ZPY A;  3I9V 1;  1NVI D;  2KIE A;  3A4R A;  4BKT A;  4AP4 C;  2KUP A;  2NBV A;  2M1M A;  2KDB A;  2UYZ B;  1ZGU B;  3EA6 A;  3NVW A;  1MIZ B;  1TKY A;  2AQ3 B;  1IGD A;  1XXG A;  1MPE A;  2RR9 A;  3KW5 B;  4AUQ C;  5BYQ A;  3V6E B;  2LJI A;  5G55 A;  2B76 B;  4Z2N A;  1I7H A;  4USA A;  3E9P A;  1RYJ A;  3VR9 B;  4DQO C;  2JUO A;  3SV1 A;  4OVZ A;  3SD5 A;  4OZA A;  4YSX B;  2G4D B;  3UI3 A;  4IM0 A;  2ABD A;  3PRM B;  4FXC A;  2WXF A;  1GPX A;  2QJL A;  2GOW A;  2REX A;  2EMT A;  4KKJ A;  3AN1 A;  1LB1 A;  4LNI A;  4C00 A;  2PE9 A;  4W9E A;  1D3Z A;  3NWD A;  3MC8 A;  1DOI A;  1T5X D;  3RUL A;  5DI9 B;  1TJ6 A;  5KQ1 A;  2BYV E;  4JLC A;  4ANW A;  1XD3 B;  2YS1 A;  3SHQ A;  2FUH B;  2MWN B;  1JCK B;  2JX5 A;  4FJY A;  1M94 A;  1OEY J;  5KHO A;  3IHP C;  1UH6 A;  3ZXR A;  4C56 C;  2H7E A;  3MJW A;  2L8J A;  3MPX A;  1YJI A;  2Y5C A;  4WAA A;  1J0W A;  1TT5 B;  1TZ1 A;  5D3X A;  4MGI E;  1NTI A;  4DWF A;  3U30 A;  2GBM A;  3MC9 A;  4ANU A;  1JAL A;  3T3N A;  4FN2 A;  2DX5 A;  2IDY A;  3A1Q A;  3D8F A;  4G11 A;  4JKC A;  2NMQ A;  2FID A;  4H2A A;  3CST A;  3NZU A;  3VXW A;  2NVU I;  1DRO A;  4M0W B;  1FXI A;  2WHI A;  3MHZ A;  4J3O D;  3ODO A;  4TUU A;  3ZDT A;  1HQR D;  3QHT A;  2NTT A;  1FOE A;  3DVN V;  4GGQ A;  1EWC A;  2KAJ A;  1MKE A;  1OQN A;  2L1A A;  3ML4 A;  2DLB A;  2SAK A;  1L7Y A;  1SIF A;  2BYE A;  2RDG A;  3ZGZ A;  4MGY E;  1E8W A;  2KDF B;  3BK2 A;  1C4C A;  1WMH B;  2J0K A;  3UIP B;  2LUM A;  4HJG E;  4TMA B;  1MPH A;  4A6F A;  3X23 A;  2JP2 A;  5HI1 A;  5JH5 C;  1WI0 A;  1JQ4 A;  1C4A A;  4RGM A;  5D3V A;  2L2I A;  3URY A;  4KSL C;  2YEP F;  3I3T B;  2MWS B;  4MGK E;  1X1M A;  3PS6 A;  4I6P A;  2HTH A;  3AEE B;  1SHC A;  1HZ5 A;  3AE7 B;  4BBN F;  2NS5 A;  1DDW A;  3Q3N C;  1GC6 A;  2M17 A;  4DHZ B;  3UQB A;  2MJ3 A;  3T8M A;  2MEK A;  3B2G A;  3E9L A;  1WIA A;  3NJT A;  1R7S A;  1F1H A;  4HJK A;  3RZW C;  5IJM A;  1Y5O A;  1FGY A;  4N59 A;  4CHJ A;  1ZSQ A;  2DAF A;  1QZE A;  2DBY A;  3PSC A;  3WAN A;  2HJ8 A;  1Z87 A;  2ZVN A;  2K22 A;  2NPT A;  2VH2 A;  4NPN A;  4BAX A;  2GCL A;  1YNT E;  2FBW B;  4BZA A;  2WDR B;  1FRR A;  3BII D;  1TS4 A;  3N1Z C;  1ROE A;  3SU8 X;  1FNV A;  1FMA D;  2KWV B;  1BUI C;  1QIL A;  1WXA A;  3WAM A;  2VKI A;  4MEM A;  2IO0 B;  1FAO A;  3RYT A;  5DHA B;  4EOY A;  3DBL I;  3H8H A;  3PLU A;  1E8Z A;  1UEL A;  2O6V B;  3SEB A;  1UBI A;  3AUL A;  3C0R B;  2D3A A;  3EGR A;  3DBR I;  3OJ4 B;  3PZ8 A;  3PVU A;  1OFF A;  1T0Y A;  2CJN A;  2JRI B;  2LKO A;  1C77 A;  4AJY B;  1AAR A;  3QAQ A;  3V05 A;  3RNC C;  2KJR A;  4XC2 A;  5IAA C;  1WXM A;  1KOT A;  5TR5 A;  2K6D B;  2KLC A;  3PG7 A;  5JVL A;  1FCC C;  2LHE A;  1IUE A;  3Q3F A;  5CLQ B;  2D9X A;  2V0G A;  4JKG A;  2UWQ A;  5BYS A;  2K49 A;  4GOC A;  1PLS A;  4ANX A;  3KH0 A;  4KIK A;  1MK9 B;  4WAF A;  1F0Z A;  2WDT B;  5C3J B;  3O13 A;  1ZDV A;  2WXR A;  4CQN A;  1C78 A;  4HHV A;  1MK7 B;  1PDX A;  2QDF A;  2RRF A;  1UF0 A;  1F9J A;  1YQ3 B;  2FJU B;  4BVU C;  2BW2 A;  4L6E A;  2HTM E;  4K2O A;  4YWG G;  5E6N A;  4NJ6 A;  1C1Y B;  1NU2 A;  1R4N B;  2JU6 X;  2RSU A;  1K5D B;  3O96 A;  4WWM A;  5AZH A;  2WXQ A;  4KHA A;  2R2O A;  3M3J A;  5CLL B;  5E6J A;  3WAL A;  2W2W A;  1E7V A;  4E3C A;  2P0F A;  2BVC A;  3GE3 C;  2DYO A;  3DBR B;  3B1L X;  4MH0 E;  2KFJ A;  1ACA A;  3P4P B;  4CHK A;  3P4S B;  4EEW A;  4M00 A;  3TVV A;  4ICU A;  1C9F A;  2WDQ B;  2EMS A;  4DX9 0;  1J7C A;  2W9N A;  3SO6 A;  4MT5 A;  2M19 A;  1V5T A;  4GXB A;  2K9X A;  2PVO D;  3GYP A;  3HVZ A;  5J3Q A;  1RRB A;  5J18 A;  1WYW B;  2O6V A;  3FLV A;  1UEF A;  3J9C A;  3E66 A;  1WSP A;  4CSQ A;  4ZRK A;  5E6P A;  5HG2 A;  2WXM A;  3EC8 A;  5JHB A;  3A8Q A;  1J0G A;  4A20 A;  3P42 A;  2Z8L A;  5TSS A;  3T9L A;  3FSS A;  3W5U B;  3OJ3 A;  3ZLZ A;  2VH1 A;  4US8 A;  1SIJ A;  2JXT A;  3FC4 A;  2C9W B;  4P1B C;  4GZU A;  4Y94 A;  1UWM A;  4NZL B;  2LWP A;  3AE5 B;  3R66 C;  2O2V B;  3IT4 B;  4CHM A;  3AH7 A;  4LJO B;  1WM2 A;  4QAY A;  5KHQ A;  1DGJ A;  1L5P A;  3KLS X;  4HKZ E;  4TV3 A;  4D6W A;  5LNK 1;  4XYC A;  4LTU A;  2C7M B;  2G9H D;  3LJ3 A;  2GB1 A;  1DDM A;  2GJY A;  1G6J A;  1ZC4 B;  5JP4 A;  2VRR B;  2K2U A;  1IRS A;  2N9X A;  2PKO A;  2YEP B;  3DVG X;  1PGB A;  1N63 A;  1TBE A;  3W9C B;  2IO2 B;  2KWU B;  2DHZ A;  3VIA A;  3I5J C;  3QX1 A;  2MQJ A;  1QQR A;  1XF5 L;  5G5G A;  1ZP0 B;  1XLN A;  1P6S A;  1ST7 A;  3AI5 A;  3RCZ A;  3KRW A;  1JWU D;  1XLQ A;  4HRS A;  4RFB A;  3MC0 B;  3Q3M C;  1WI1 A;  1ZXI A;  3A9K A;  3A9K B;  5AZF A;  1E10 A;  2KDI A;  3KWV A;  4ARC A;  1VZ7 A;  5JHG A;  2LEK A;  3RFZ B;  2G35 A;  2W2X D;  1J19 A;  3E9O A;  1QT9 A;  3SR6 A;  4OW0 A;  2Y5P A;  3V5W A;  1EF5 A;  1FFU A;  2J0M A;  2WXJ A;  3PZ7 A;  1YQ4 B;  3QJZ A;  5C1Z A;  1WXV A;  2WYQ A;  3NVY A;  2BF8 B;  1WVH A;  1QLB B;  2KYW A;  1GB4 A;  2YVC A;  1T0Q C;  1E0Z A;  2KHW B;  2KFK A;  2COF A;  2TSS A;  3AEC B;  1GOZ A;  3NWF A;  4F7G A;  2HTH B;  2V3N A;  2UU7 A;  3CF6 E;  3NHE B;  5DPS A;  1WH3 A;  3M63 B;  2KWD A;  2FIF A;  2BT6 A;  3BJI A;  2ADZ A;  5J3Y A;  4OZC A;  1IGC A;  2ELB A;  2Y7B A;  2E6X A;  1BT0 A;  2DZJ A;  1I35 A;  1XCQ L;  5HE0 A;  4JK7 A;  5D27 A;  3DBL B;  2J42 A;  5G5H A;  1SJH D;  2WNM A;  5E6O A;  1R4N I;  5KCV A;  1Z5S B;  2KWC A;  3ZNG C;  4EZK A;  1FD6 A;  1WJ4 A;  2CJO A;  3EPY A;  1B55 A;  2CKH B;  4W9L A;  4HPP A;  3B0A A;  1R4M B;  1K53 A;  2IZV B;  4LDT B;  1K50 A;  4ZHO A;  1SGH A;  2KXJ A;  4IW0 A;  3APF A;  1LGR A;  3ZKJ C;  1F2R C;  2N7E A;  3JSV A;  2AEH A;  2RGF A;  1JRO A;  4DXA B;  4ZRP A;  2WDV B;  2OHF A;  3AXC A;  4DHJ B;  2WQY B;  5D3D A;  1BTN A;  4EKU A;  1V5U A;  2AWT A;  4I6N B;  2CU3 A;  4HAW B;  3APD A;  3H7P B;  4A3O A;  4RM8 A;  1SE3 A;  2LJ5 A;  1WX7 A;  3DXC A;  1Q1O A;  4JWU C;  2JYT A;  2LVP A;  4ZOH C;  1OQY A;  2D9Z A;  1WR6 E;  1F52 A;  3GZN I;  2GBR A;  3V3X A;  2GCJ A;  2JWZ A;  5D3Y A;  3DHI C;  4NQK E;  4BFR A;  2RD0 A;  2M38 A;  4DDG D;  3AED B;  1T0R C;  1X11 A;  2L3Z A;  3ZTD A;  2PIA A;  5I2M A;  1V2Y A;  5FR3 A;  2YT1 A;  3BY4 B;  1IBX A;  2V3S A;  3CXB B;  1V86 A;  3N20 C;  3U2S C;  2W3R A;  1QF6 A;  3O65 B;  1N60 A;  2MBE A;  1S3S G;  4GMX B;  1UGJ A;  3HRD D;  1XLO A;  3TEW A;  2JRH A;  4RCO A;  4YTM B;  2BCJ A;  1SJE D;  2LGS A;  3I63 C;  1D5X C;  1L0X B;  1T6B X;  3NG0 A;  2KD0 A;  4JKG B;  2RDB C;  2DHJ A;  1I4H A;  1CZP A;  2OTX A;  2J4X A;  3GZN B;  3H7P A;  3PHX B;  2HDE A;  2OJR A;  1K5G B;  1W1D A;  5CHF A;  4EFO A;  5IO9 A;  4HDQ A;  3RNE C;  3IAS 1;  3QWM A;  1ET9 A;  1BWN A;  3L13 A;  3SBG A;  2MKR A;  1WX9 A;  2Z0Q A;  1KFY B;  2QKM A;  2Z0E B;  2Q13 A;  1J7A A;  2K8C A;  4C0A A;  2WXH A;  4RF1 A;  2LRU A;  3FIL A;  3FIL B;  2ROV A;  4DHZ E;  1WGU A;  5L81 A;  1GG3 A;  4KIK B;  2KAN A;  3N30 A;  3JYU A;  1AYF A;  2NTS A;  1WGK A;  2D4Q A;  4L1B A;  1DYN A;  1LQB A;  1UD7 A;  4A8X C;  1U5F A;  2QEJ C;  1ACC A;  2IY0 B;  2MH7 A;  2KVZ A;  3AB5 A;  2KR0 A;  1WJM A;  3C19 A;  1KRH A;  2PW9 A;  4IWO A;  2KX0 A;  1CK1 A;  1OQQ A;  1PFJ A;  2V76 A;  1FPY A;  2MRP A;  3KVF B;  2RDH A;  5EE9 A;  1ZUD 2;  2L0T A;  4BKG A;  2I1K A;  4HB4 B;  2D9W A;  5T8I A;  1IPG A;  4E74 A;  4JKH A;  3PSE B;  2Z59 A;  3KRX A;  2ZCB A;  1A70 A;  4PS7 A;  4ASW C;  4JKE A;  1NEK B;  2COP A;  2Z0D B;  3N32 A;  4RM9 A;  1E6E B;  4YSY B;  2LXA A;  4NAW B;  3KUZ A;  1CMX B;  4YXD B;  2K00 A;  3FP5 A;  2L00 B;  3R8B A;  4ZHP A;  2P0D A;  4JQW C;  4RH6 A;  1IP9 A;  3L17 A;  4MM3 A;  2DWQ A;  1GNU A;  4HAZ B;  3Q8E A;  5J3T A;  2W3S A;  2L05 A;  2BWF A;  2M56 B;  4OZB A;  3FM8 C;  4XDC A;  1UNP A;  4NSW A;  2J0J A;  1Q10 A;  2BQQ A;  4OSN A;  1Z2M A;  2JF5 A;  4IDI A;  5DIF B;  1EM7 A;  3CIR B;  4C7Y A;  2XBB C;  3ZRC A;  1JDE A;  1GC7 A;  4FUL A;  3B2F A;  4L23 A;  3NOB A;  1V49 A;  4LLG M;  3WAP A;  2D3C A;  4KHO A;  2DKP A;  5C5B B;  1L0V B;  1TTN A;  2RSG A;  2XEW A;  4DBB A;  4AJW A;  2KNB A;  4GDL B;  4P6V F;  4WUR A;  2DZM A;  3HIZ A;  2O6V D;  3SFE B;  4M8N A;  1V5M A;  2NR2 A;  3DWG C;  1X05 A;  1UPQ A;  3ECI A;  3A33 B;  3FEH A;  3KYD D;  2KMC A;  3HQC A;  1EUV B;  3BVZ A;  3GS2 A;  2CQU A;  1WMH A;  1N3H A;  1EAZ A;  2NMB A;  3R7Q A;  3PPA A;  1I42 A;  2M4N A;  4PS8 A;  3PTF C;  1P3Q U;  2WX0 A;  1RFA A;  4MJS A;  1EF1 A;  2FDQ A;  5LXI B;  4ILG B;  3RZF A;  3PRE A;  5KQ4 A;  2ZKM X;  1WGG A;  2DYM A;  3VUX A;  4WSF A;  2WXG A;  2FUG 1;  2I38 A;  1K51 A;  4M02 A;  2KLG A;  4BBK A;  4WJP A;  2KN5 A;  1L6V A;  1V5P A;  3PZD A;  2K3U A;  2WXP A;  2N9P C;  3TIX A;  4J6I A;  4ARI A;  2V4I B;  4WJQ A;  1E90 A;  2K1F A;  5J2R A;  1VDV A;  2PTL A;  3RNF C;  1EGX A;  4FHK A;  2R2Q A;  2LOX A;  3H7S A;  2ZCC A;  4WVF B;  3BYT B;  1WGQ A;  1NI2 A;  3GE8 C;  2PJH A;  2INC C;  2DEN B;  3RUI B;  2Z0O A;  4A6F B;  3UZT A;  2G1E A;  3A1Q B;  3TCA A;  2KO3 A;  2DIK A;  3WCQ A;  1WG7 A;  3RNA C;  2MBO A;  4ANV A;  3P6A A;  1FXA A;  4O1N A;  4LNO A;  2IGH A;  4XGA B;  3AMZ A;  4M01 A;  3FVC A;  2L1C A;  4IOI E;  3VR8 B;  1U5E A;  1LFD A;  3QAR A;  2AX5 A;  4MGZ E;  4GU2 A;  1ZE3 D;  1KI1 B;  4WQM A;  4HVB A;  5J17 A;  4K3B A;  4UDU C;  3KZ1 A;  3KSY A;  1L0Y B;  2DHI A;  3DBH B;  3UQA A;  2XN9 C;  1W1H A;  2K0P A;  4S0R A;  2KJ6 A;  4MDK E;  2M0X A;  3D32 A;  3P7Z A;  2D3B A;  1MG4 A;  4W9J A;  3BIN A;  1U2B A;  2QC8 A;  3U12 A;  2N9E B;  5DPT A;  1KLV A;  4XX5 A;  2ZZP B;  2GBK A;  1E7P B;  1XD4 A;  4HAY B;  1HZ6 A;  1C76 A;  4XWX A;  2NBW B;  3RI7 C;  1YN5 A;  3NSU A;  3C8Y A;  1WE6 A;  2DZK A;  1KTK A;  2WU5 B;  4QJ4 B;  3RNB C;  3NRZ A;  2CS4 A;  2YT2 A;  2ZW1 A;  1VJK A;  1EVH A;  2CAY A;  3M1I B;  1JML A;  2N7J A;  2YLM A;  4A9A A;  5C6R A;  2RLO A;  1PMS A;  1XO3 A;  3NS8 A;  2A5U A;  4G50 A;  1TY0 A;  1U29 A;  1ZVR A;  4XE0 A;  2NBV B;  4HAT B;  4K17 A;  2FNJ B;  3Q8A A;  3AU5 A;  1XT9 B;  1YD8 U;  3AJ4 A;  2D11 A;  4YL8 A;  4OVV A;  4XWT A;  4ZRQ A;  2VSZ A;  2WP9 B;  2Y3A A;  1DIK A;  4MAC A;  3R3M A;  1WJU A;  2KTF A;  2P8V A;  4TQ0 A;  1FNU A;  5JZE B;  1WE7 A;  4FAD A;  1WX8 A;  3HUI A;  2COA A;  1HBK A;  2K6Q A;  4HB3 B;  2PPH A;  3AEF B;  4WH4 A;  3ULB A;  1V80 A;  3BK1 A;  1I4P A;  4HPL B;  1E5W A;  1WJ6 A;  2CHZ A;  4I6L B;  4C4V A;  3BVG A;  3A98 B;  2KDE B;  3FKY A;  3VTW A;  2WH5 A;  1ESF A;  2LOZ A;  2W54 A;  5IA7 A;  3ALB A;  2L7R A;  3NS1 A;  4B95 A;  2NBU A;  4KGS A;  4H8S A;  2GS0 A;  1L4D B;  2J53 A;  3PEG A;  4B6W A;  2ZEQ A;  4Q2J A;  4P1C C;  5BO4 B;  4JKB A;  3DVN U;  1A5R A;  4F1S A;  2NPT B;  2IGG A;  3ODX A;  2KQ4 X;  1PFD A;  2KQS A;  3IT6 B;  4N58 A;  1JW9 D;  3VOQ A;  2GMI C;  5C79 A;  1FHX A;  2GRI A;  2IBI B;  4URK A;  3LJU X;  4REZ A;  2KCJ A;  3M62 B;  3IBE A;  1GUA B;  4GDK A;  3Q8F A;  2JZZ A;  5LOP B;  5IP4 D;  1P1A A;  1GAQ B;  1V88 A;  1V1P A;  1OQR A;  2QCZ A;  2WXI A;  3SBT A;  2IGD A;  4KZ0 A;  1XCG A;  2I5C A;  4AS1 A;  2K39 A;  1HB6 A;  1I4G A;  2MBB B;  2C60 A;  1D5Z C;  3TJP A;  4GOU A;  3VRB B;  1ZC3 B;  4EZL A;  3IFW B;  1EWY C;  1ISN A;  1FHW A;  2FCM A;  2QKL A;  4QJ3 B;  3LB8 C;  5BMH A;  2JXX A;  1MJD A;  2LUE A;  3KY9 A;  3N1X C;  5H92 C;  3KWL A;  2NCN A;  4P7I A;  2MP2 A;  1KJT A;  1N6Z A;  1VR9 A;  3AE9 B;  3H9D A;  4ILH A;  1XEE A;  3LYY A;  2LGD A;  2KKC A;  2ONQ A;  3DBS A;  4ICV A;  2R0D A;  2B3A A;  3MP9 A;  1OEY A;  4OT1 A;  1EU4 A;  1DOX A;  4DXG A;  3AEA B;  4JL9 A;  4W9D A;  1SBB B;  3EEC A;  3TEZ A;  1LXD A;  4N6E B;  1H4R A;  5D3I B;  1GJZ A;  2X8X X;  3K9P B;  3SDL C;  4NJ7 A;  2RPV A;  1HTQ A;  1WGY A;  4KHB B;  2G45 B;  2CY4 A;  2JT4 B;  2KX3 A;  3ZIM A;  3KQ4 A;  3A4S C;  5I2S A;  1SXT A;  5LON B;  1QC6 A;  4HWI B;  3RT3 B;  1P7F A;  1I4Q A;  2INN E;  1V5O A;  4NNJ B;  1ET6 A;  2KN4 A;  2JQR B;  2IO1 B;  2LMC A;  2JSV X;  3JVZ X;  3OAN A;  2WXO A;  2ASQ A;  4WJO A;  1WY8 A;  2MBH A;  4WIP A;  1TJE A;  2KK8 A;  2BS2 B;  1X1F A;  5GXG B;  2EKE C;  3WYF B;  2VZK B;  1PGX A;  2IYB A;  3APC A;  1BML C;  5CX3 A;  3SYX A;  3Q3J A;  4A5K A;  3Q8C A;  1C4P A;  2X18 A;  1ZW7 A;  4US9 A;  3ZNI D;  2L83 A;  2N1W A;  3ZW3 A;  3PVL A;  1YN3 A;  1XCT L;  1ZPS A;  3NZS A;  3VH4 B;  1UPR A;  1DBH A;  2DYQ A;  4A6K A;  3M95 A;  1WZ3 A;  4E71 A;  3NW8 A;  2D10 A;  3EFU A;  1VBH A;  3JSV B;  3Q69 A;  1EU3 A;  3DCX A;  4JKF A;  5LLI A;  2LXC A;  3CIK A;  3DOW A;  3MFG A;  5DCN A;  4IWP A;  3QIJ A;  3L10 B;  2FCN A;  2QHO A;  2MBQ A;  1B1Z A;  1Y8R C;  2N4F A;  3JW0 X;  4QXA B;  3B9J A;  3DHH C;  4C7Z A;  3RPF C;  5L95 C;  1FM0 D;  2XNA C;  2Q5W D;  3S2A A;  4EZJ A;  2AQ1 B;  3UGB B;  3P1M A;  4C80 A;  4WJ7 A;  2KJH B;  4YSZ B;  3HVD A;  3ZUN A;  1V6E A;  4GNK B;  1ENF A;  2M14 A;  3ZO5 B;  1P9D U;  4W9H A;  5G2N A;  2KMA A;  2WXK A;  2ZW0 A;  1E7U A;  3NZ3 A;  3QBV B;  2ZPN A;  4WQO B;  3ZVR A;  1MVK A;  5IN7 A;  5EE1 A;  2MW5 A;  5HHD G;  2KT7 A;  4BKS D;  2RPQ A;  1N5X A;  2RUK B;  2EEL A;  2KC1 A;  3X0W A;  2INP E;  5GOW B;  3VUW A;  5D6J B;  2KFK B;  4LJP B;  3ZYY X;  1P98 A;  2QMT A;  4IAP A;  4BKS A;  4GPT B;  4PNK A;  1UNS A;  1YJ1 A;  1W1G A;  5IKC M;  2KVR A;  4K7S A;  4JK9 A;  2I5F A;  1K8R B;  2LD9 A;  1TYG B;  3ABV B;  2Z4D A;  2GLS A;  2D2Q A;  3PGE A;  4HPM B;  4W9G A;  3VDZ A;  2DA0 A;  4IOY X;  2OOB B;  3PLV A;  1U4A A;  4NQL B;  2ZVO A;  4QJ5 B;  2WXN A;  2N1V A;  1WGR A;  4GMV A;  2JY6 A;  2HD5 B;  4Z2M B;  3RD2 A;  5D3W A;  3AE8 B;  4K7U A;  4A3P A;  5BMG A;  1VCB A;  1JWS D;  1V97 A;  3IVF A;  4GLS C;  1TS2 A;  2JZP A;  2BKR B;  3VH3 B;  1SB3 C;  2ELA A;  4HAV B;  3DHG C;  2YF0 A;  3SUZ A;  4GIV A;  2H88 B;  2RGN B;  1KM7 A;  1UBQ A;  3A8P A;  2Z14 A;  2ON8 A;  3I57 A;  4KZC A;  2ZNV C;  1VBG A;  5D94 A;  1QKZ A;  3B77 A;  2FAZ A;  1Y19 B;  1P0R A;  3U7D A;  3KUC B;  2LHD A;  5JLJ B;  3L4P A;  2HJ1 A;  3OAW A;  2V3P A;  4B0E A;  1M7R A;  4PQ0 A;  3QK0 A;  4GN1 A;  4KDL B;  3ZVV A;  2LGX A;  4MT7 A;  1ZXH A;  4WWN A;  3ML8 A;  2GBJ A;  5CHW A;  1E8Y A;  3CWI A;  3RMK C;  2GBN A;  1UWX A;  2JZ3 B;  2IND C;  2J52 A;  4LK0 M;  1JWB D;  2K25 A;  1YX5 B;  2RVB B;  1NEN B;  1VLB A;  2GI9 A;  3E56 A;  4A6H A;  4MJS B;  2I1J A;  5L83 A;  4KKI A;  4DBG A;  1HB8 A;  3A9J A;  1TY2 A;  1V8C A;  5JXV A;  5C16 A;  3VHT C;  1STE A;  4G3X B;  1DOY A;  1Y56 A;  4DXF A;  2G3Q B;  4MSM B;  2BPS A;  2LZ6 A;  1FEH A;  1KLG D;  1WZ0 A;  1TQZ A;  3TFM A;  2SEB D;  2KAC A;  5HKH A;  3ZJV A;  4ITK A;  3NVZ A;  3BZD B;  4B6H A;  1T3Q A;  3DBH I;  3Q3O C;  5I4D A;  1KBL A;  2QIL A;  1VZ6 A;  1RRP B;  1NBF C;  5DPR A;  1YX6 B;  3T06 A;  1PGA A;  4P16 A;  2KOX A;  2YS3 A;  1XOD A;  2DYB A;  5C5B A;  2IPK D;  3PV1 A;  2DAJ A;  3L54 A;  2BYT A;  1AQC A;  2YS5 A;  1JRU A;  2LGI A;  4II2 B;  2K5P A;  3VTU A;  3DXE A;  2V9H A;  4RNA A;  2C7H A;  2YRY A;  2V1Y A;  3Q14 C;  4ZYN A;  4C4V B;  5HE3 A;  3E9S A;  4K1R B;  2DX1 A;  1NYR A;  1GB1 A;  4DIX A;  4WWP A;  1FB8 A;  1T77 A;  3ZTC A;  3NWA A;  3HIE A;  2CRF A;  1SSN A;  3TEY A;  1C79 A;  1NTV A;  3R7R A;  4OHJ A;  3D8D A;  4PK1 A;  4HCN B;  1DDV A;  2YSZ A;  1CQV A;  5IOI A;  4K3C A;  4HSI A;  5DHF B;  3TMP B;  4PYU A;  2ROZ B;  3NVV A;  4NAW A;  3QA8 A;  5AUK A;  2D9Y A;  4FJZ A;  4JPS A;  4BOS C;  4ZRJ A;  1WGH A;  2D5G A;  4ACF A;  2RNR B;  4LNK A;  2KDM A;  2OED A;  1E9M A;  5CTR C;  1RFK A;  3PRP B;  3MDB C;  4HLE A;  1WJN A;  1I4R A;  2C7N B;  3AM9 A;  1WRI A;  1AW7 A;  1QQG A;  4AQ7 A;  3UF8 A;  1WWT A;  2W55 A;  3UIO B;  4OVU A;  3W1S C;  4MY6 A;  1WM3 A;  4RGN A;  1LW3 A;  4EMO A;  3VQI A;  2N0Y A;  3W2D A;  4R3D A;  1RAX A;  2DFK A;  5BMI A;  3MHS D;  4FA6 A;  2K8E A;  4HB0 B;  2DHK A;  4PYZ A;  1V9J A;  2LAS A;  2Z0P A;  3N1Y C;  4W9F A;  3IG3 A;  1Q0W B;  1HA5 A;  2DKQ A;  2ZJD A;  1MG8 A;  2WLB A;  1TKG A;  3CMM B;  2FCS A;  4AOF A;  4NJC A;  4B9K A;  2I2Y A;  4IC7 B;  2DYN A;  2MFQ A;  3HHM A;  2MDX A;  1U5G A;  3HSA A;  5HFY A;  2WX1 A;  4CO7 A;  3CSF A;  1LO5 D;  1NYQ A;  3HW2 B;  1WJ1 A;  3NY5 A;  5EE3 A;  2E3T A;  2KIG A;  3F0W A;  1QOB A;  3U7Z A;  3VAW A;  2XQN M;  2D3G A;  5HE1 A;  2BKF A;  1MAI A;  4CYE A;  1SE9 A;  3VRA B;  4LNN A;  3ZNH B;  3AE2 B;  1T0S C;  2N0S B;  1NTY A;  1NDD A;  4IM2 A;  1V81 A;  4FHJ A;  3WA0 A;  2ZNV B;  4KHB A;  4B0M A;  1HTO A;  2XK5 B;  1UUP A;  2KGX B;  2Y5B B;  3PP2 A;  2LI5 A;  5C23 A;  2GUM A;  1TXD A;  4YT0 B;  2MHJ A;  1FO4 A;  2LRW A;  2BGF A;  1AN8 A;  1IYF A;  1WFY A;  3RN9 C;  1H10 A;  3TBL D;  3OHM B;  1F2R I;  1RWS A;  2PE6 B;  4WWO A;  4HAU B;  4EE2 A;  3T3O A;  3V60 A;  1TS5 A;  2KTR A;  3HK0 A;  3FAH A;  1S1Q B;  3UIN B;  1I7A A;  2Z13 A;  2LUL A;  3KYC D;  1JRP A;  2HE7 A;  5AUI A;  5DH9 B;  3TUO A;  1MI0 A;  4FJV B;  3VFK A;  2R09 A;  1KC7 A;  4JKD A;  3ZJU A;  2LBB A;  2N23 A;  3H1U A;  1V89 A;  2VRW B;  4RGO S;  4XDD A;  3N3K B;  3PRZ A;  4M8M A;  1FFV A;  4FBJ B;  4IM3 A;  1XKE A;  2DZI A;  3OWE B;  3ETR A;  4DX8 A;  5D2M B;  2L32 A;  1FGZ A;  3ZNZ B;  2KUQ A;  3NUH B;  2R2Y A;  5AZG A;  4A6Q A;  1K52 A;  2ACZ B;  2R61 A;  4DDI D;  4A90 A;  1X86 A;  1C3T A;  4TQ1 A;  5BYR A;  3U8Z A;  2K8H A;  2MP2 B;  3U4E G;  2LG1 A;  4K2P A;  5EE0 A;  4FLH A;  1AWE A;  3AE1 B;  2DTC A;  1I2H A;  1HXY D;  2MCN B;  1TGZ B;  2LYD A;  1OY2 A;  1XLP A;  3ZDM C;  4KGR A;  2DX5 B;  1J8C A;  1V1O A;  4IKG A;  1PQS A;  1L4Z B;  1M4V A;  2FJL A;  2N9L A;  3P4R B;  1YOV B;  5FI0 A;  2JVC A;  4MH8 A;  2BTE A;  1MI1 A;  3QC8 B;  1UNQ A;  2XK5 A;  4HRO A;  4X57 B;  2IYD B;  1P7E A;  1CJE A;  2BS4 B;  3KUD B;  2CU1 A;  2PZ1 A;  4M0W A;  3P63 A;  4KV2 A;  3EFC A;  4L2Y A;  2MA9 B;  1TS3 A;  2IJ0 A;  4IWQ A;  1Q67 A;  3ODW A;  2CHW A;  1AWD A;  3TW1 A;  4JGH B;  2CY5 A;  1UGM A;  3B08 A;  3F5R A;  3ENB A;  1L6U A;  2M8S A;  2MX2 A;  2DN6 A;  5EFX A;  3LXF A;  1WYG A;  1ZDX A;  3Q8B A;  2Z59 B;  3L16 A;  2J59 M;  2IO3 B;  1ZM0 A;  3V62 A;  1RM6 C;  4JK8 A;  2HRJ A;  3Q2A C;  3AE6 B;  1I4X A;  4YTN B;  2J7Q B;  2L0F A;  4KDI C;  2K2J A;  1PYW D;  2AQ2 B;  3N7C A;  2PLP A;  2BWE S;  3GOE A;  2RMM A;  5MPO A;  3DQV A;  3GB1 A;  1QOG A;  4ZDV A;  4K81 A;  4KGT A;  2COD A;  3SNH A;  1TZO A;  4S17 A;  3P2B A;  4KX6 B;  1KLU D;  5AEK B;  4JE3 B;  2QSD A;  1ZYI A;  1QOF A;  3HM3 A;  3QCA A;  5FK9 C;  1P5T A;  1R4M I;  2FJ9 A;  2D9V A;  4HKQ A;  1SE4 A;  4F7U P;  4MK0 A;  1WRD B;  4MM3 B;  1YIW A;  2LGY A;  2BS3 B;  5FI1 A;  2MSE D;  4YTP B;  2A4Z A;  2X0S A;  4LCD E;  4BOZ B;  3MJ5 A;  1ZKH A;  1IBX B;  1MFW A;  1FNW A;  1RJ2 A;  1UZX B;  3BVM A;  1JWM D;  4W9I A;  4L1R A;  3K9O B;  5LG4 B;  3TSS A;  1OMW A;  2Y8G A;  3QWZ B;  4JKA A;  3WAO A;  1MHX A;  3VVW B;  4YON A;  1WGD A;  2G4S A;  2JPH A;  1XR0 B;  2JYE A;  4D2K A;  3W5V B;  1MHH E;  2KMM A;  4MEL A;  1H8C A;  3DWM A;  2PEA A;  3DVG Y;  2ICI A;  1YJJ A;  2WS3 B;  1FCL A;  4NAM A;  3AEG B;  3D8E A;  3A58 A;  1FRD A;  2RQ1 A;  1HE8 A;  2QIE B;  3LDZ E;  4XWW A;  3OLM D;  3ZXV A;  1F77 A;  1XQQ A;  3DCG A;  1TKE A;  4F8C B;  3ONS A;  5GMV A;  2BYF A;  3RNG C;  3ZQ4 A;  3G9W A;  4HAX B;  4IFS A;  1VD2 A;  2MJE A;  3AV8 A;  5C2T B;  1D6E C;  1EO6 A;  2DNF A;  3BYY B;  1NVL A;  4JX1 C;  2LFI A;  3PHW B;  4A55 A;  4F7Z A;  2EJ8 A;  4ZYS A;  1SF0 A;  1YMH E;  1BTK A;  3H6N A;  4II3 B;  2CHX A;  1B9R A;  4DHJ D;  2UZR A;  2P0H A;  2MJD A;  1TIF A;  2WGS A;  1PUT A;  4LDT D;  3A9J B;  2WXL A;  4HCP B;  2BB6 A;  2KQ7 A;  1LM8 B;  2OQB A;  4PS3 A;  4TSS A;  2H89 B;  1HEZ E;  2N7D A;  1P3R A;  1N62 A;  2VZK D;  2LVQ A;  3AEB B;  2UVM A;  3PT2 B;  1SE2 A;  4KSK C;  4RMA A;  1WF9 A;  5CHV C;  3MTN B;  1J7B A;  2FCQ A;  3QQ8 B;  3VTV A;  1FXT B;  1Q5W B;  3R2T A;  3PVW A;  2KZR A;  4N9F 4;  3AU4 A;  4GDL A;  4XZ4 A;  1BXT A;  1RLF A;  5EDS A;  2D07 B;  4BBN C;  3GP7 A;  2L76 A;  2W82 A;  1OGW A;  3ML9 A;  4MSQ B;  2EC1 A;  2H7D A;  2V4L A;  3V6C B;  3EHV A;  1YQB A;  2CB8 A;  4RGT A;  3W1Y A;  1V61 A;  4D0N B;  2X38 A;  4DK5 A;  2CR5 A;  1ZOY B;  2K8B A;  5HE2 A;  3N9Y C;  2NZ8 B;  1XX0 A;  1V1P B;  4GSW A;  4ZRI A;  4IUM B;  2YT0 A;  2JWU A;  1X1G A;  2AYO B;  2LVO A;  3W1S A;  2KC2 A;  1KZ7 A;  4IG7 B;  3Q6B A;  1WXS A;  3HM6 X;  3VUY A;  3GYO A;  1FHO A;  5IRS A;  1KH0 A;  1MIX A;  2N9K A;  1NI3 A;  1SEB D;  4HXD A;  2W2X C;  3ENE A;  5H8Y E;  2FE8 A;  3TEX A;  3WIM A;  1DYQ A;  4HK2 A;  5JHH A;  2O2V A;  3RCP A;  2AL3 A;  4GDK B;  4GB9 A;  2MLB A;  3DXD A;  3ZJT A;  2KTR B;  5M4Y B;  1YN4 A;  1N61 A;  4LNF A;  2C5L C;  4W9C A;  3AE4 B;  2DLW A;  2IFS A;  1D4B A;  1N5W A;  4PT5 A; 
#chains in the Genus database with same CATH homology
 3V61 A;  4HB2 B;  1GGO A;  1E8X A;  4TYZ A;  3TO1 A;  4JIO U;  2E2X A;  4AWJ A;  1WR1 A;  2R82 A;  4KAX B;  4KVG B;  4EUT A;  1BAK A;  3L0W B;  5LXH A;  1OTR B;  3L08 A;  5FR6 A;  4G0N B;  4NY0 A;  2UZS A;  4TKN A;  3TL5 A;  2IY1 B;  4F7H A;  3DPD A;  4HDO A;  2AL6 A;  1UNR A;  3ULC A;  4K7W A;  5D7G A;  4ILJ A;  1L2N A;  2WWZ A;  1U5D A;  1M7E A;  5DPW A;  4EJN A;  3ZRF A;  1KZG A;  4WJN A;  2Y8F A;  5JHA A;  3DDC B;  1U27 A;  2COC A;  4W9K A;  2ZPY A;  3A4R A;  4BKT A;  4AP4 C;  2KUP A;  2M1M A;  2KDB A;  2UYZ B;  1ZGU B;  1MIZ B;  2RR9 A;  3KW5 B;  4AUQ C;  3V6E B;  5G55 A;  4Z2N A;  3E9P A;  2JUO A;  3SV1 A;  3SD5 A;  2G4D B;  4IM0 A;  2ABD A;  3PRM B;  2GOW A;  2REX A;  2EMT A;  1LB1 A;  2PE9 A;  4W9E A;  1D3Z A;  3RUL A;  5DI9 B;  1TJ6 A;  5KQ1 A;  2BYV E;  4JLC A;  4ANW A;  1XD3 B;  2YS1 A;  3SHQ A;  2FUH B;  2MWN B;  4FJY A;  1M94 A;  1OEY J;  5KHO A;  3IHP C;  1UH6 A;  2H7E A;  3MJW A;  2L8J A;  3MPX A;  4WAA A;  1J0W A;  1TZ1 A;  5D3X A;  4MGI E;  1NTI A;  4DWF A;  3U30 A;  2GBM A;  4ANU A;  4FN2 A;  2DX5 A;  3A1Q A;  3D8F A;  4G11 A;  4JKC A;  2FID A;  3CST A;  3NZU A;  3VXW A;  2NVU I;  1DRO A;  4M0W B;  3ODO A;  4TUU A;  3ZDT A;  3QHT A;  1FOE A;  3DVN V;  4GGQ A;  1MKE A;  1OQN A;  3ML4 A;  1L7Y A;  1SIF A;  2BYE A;  4MGY E;  1E8W A;  2KDF B;  1WMH B;  2J0K A;  3UIP B;  1MPH A;  4A6F A;  3X23 A;  2JP2 A;  5JH5 C;  1WI0 A;  5D3V A;  2L2I A;  4KSL C;  3I3T B;  2MWS B;  4MGK E;  1X1M A;  3PS6 A;  4I6P A;  2HTH A;  1SHC A;  4BBN F;  2NS5 A;  1DDW A;  1GC6 A;  2M17 A;  4DHZ B;  3UQB A;  3T8M A;  3E9L A;  1WIA A;  4HJK A;  3RZW C;  5IJM A;  1Y5O A;  1FGY A;  4CHJ A;  1ZSQ A;  2DAF A;  1QZE A;  3PSC A;  3WAN A;  2HJ8 A;  1Z87 A;  2ZVN A;  2NPT A;  4NPN A;  2GCL A;  3SU8 X;  2KWV B;  1WXA A;  3WAM A;  2VKI A;  4MEM A;  2IO0 B;  1FAO A;  3RYT A;  5DHA B;  4EOY A;  3DBL I;  3PLU A;  1E8Z A;  1UEL A;  2O6V B;  1UBI A;  3AUL A;  3C0R B;  3DBR I;  3OJ4 B;  3PVU A;  1T0Y A;  2JRI B;  2LKO A;  4AJY B;  1AAR A;  3QAQ A;  2KJR A;  4XC2 A;  5IAA C;  1WXM A;  1KOT A;  5TR5 A;  2K6D B;  2KLC A;  3PG7 A;  5JVL A;  3Q3F A;  5CLQ B;  2D9X A;  4JKG A;  2UWQ A;  4GOC A;  1PLS A;  4ANX A;  3KH0 A;  4KIK A;  1MK9 B;  2WDT B;  4HHV A;  1MK7 B;  1F9J A;  4BVU C;  4L6E A;  4K2O A;  5E6N A;  4NJ6 A;  1C1Y B;  1NU2 A;  2RSU A;  1K5D B;  3O96 A;  5AZH A;  3M3J A;  4KHA A;  2R2O A;  3WAL A;  5CLL B;  2W2W A;  1E7V A;  4E3C A;  2P0F A;  2DYO A;  3B1L X;  4MH0 E;  2KFJ A;  1ACA A;  4CHK A;  4EEW A;  3TVV A;  4ICU A;  2EMS A;  4DX9 0;  2W9N A;  3SO6 A;  1V5T A;  4GXB A;  3GYP A;  5J3Q A;  1RRB A;  5J18 A;  1WYW B;  2O6V A;  3FLV A;  1UEF A;  3E66 A;  4ZRK A;  5E6P A;  3EC8 A;  5JHB A;  3A8Q A;  1J0G A;  4A20 A;  3T9L A;  3FSS A;  3OJ3 A;  3ZLZ A;  2C9W B;  4GZU A;  4Y94 A;  2LWP A;  3R66 C;  2O2V B;  4CHM A;  4LJO B;  1WM2 A;  5KHQ A;  4TV3 A;  2C7M B;  3LJ3 A;  1DDM A;  2GJY A;  1G6J A;  1ZC4 B;  5JP4 A;  2VRR B;  2K2U A;  1IRS A;  2N9X A;  3DVG X;  1TBE A;  2IO2 B;  2KWU B;  2DHZ A;  3VIA A;  3QX1 A;  2MQJ A;  3RCZ A;  1P6S A;  3AI5 A;  1ST7 A;  3KRW A;  1WI1 A;  3A9K A;  3A9K B;  5AZF A;  2KDI A;  5JHG A;  2G35 A;  2W2X D;  1J19 A;  3E9O A;  3V5W A;  1EF5 A;  2J0M A;  3QJZ A;  5C1Z A;  1WXV A;  2WYQ A;  2BF8 B;  1WVH A;  2YVC A;  2KHW B;  2KFK A;  2COF A;  4F7G A;  2HTH B;  3NHE B;  3CF6 E;  5DPS A;  1WH3 A;  3M63 B;  2FIF A;  3BJI A;  2ADZ A;  5J3Y A;  2ELB A;  2Y7B A;  1BT0 A;  2DZJ A;  1I35 A;  5HE0 A;  4JK7 A;  5D27 A;  5E6O A;  1R4N I;  5KCV A;  1Z5S B;  2KWC A;  3ZNG C;  4EZK A;  1WJ4 A;  3EPY A;  1B55 A;  2CKH B;  4W9L A;  3B0A A;  2IZV B;  4LDT B;  1SGH A;  2KXJ A;  4IW0 A;  3APF A;  3ZKJ C;  2N7E A;  3JSV A;  2AEH A;  2RGF A;  4DXA B;  3AXC A;  4DHJ B;  1BTN A;  4EKU A;  1V5U A;  2AWT A;  4I6N B;  3APD A;  4HAW B;  3H7P B;  4A3O A;  4RM8 A;  2LJ5 A;  1WX7 A;  3DXC A;  1Q1O A;  2LVP A;  1OQY A;  2D9Z A;  1WR6 E;  3GZN I;  2GBR A;  2GCJ A;  2JWZ A;  5D3Y A;  4NQK E;  4BFR A;  2RD0 A;  2M38 A;  4DDG D;  1X11 A;  2L3Z A;  3ZTD A;  1V2Y A;  2YT1 A;  3BY4 B;  2V3S A;  3CXB B;  1V86 A;  3O65 B;  2MBE A;  1S3S G;  4GMX B;  2JRH A;  2BCJ A;  2KD0 A;  4JKG B;  2DHJ A;  2OTX A;  3H7P A;  3PHX B;  2OJR A;  1K5G B;  1W1D A;  5CHF A;  4EFO A;  4HDQ A;  3QWM A;  1BWN A;  3L13 A;  3SBG A;  2MKR A;  1WX9 A;  2Z0Q A;  2QKM A;  2Z0E B;  2Q13 A;  2K8C A;  4C0A A;  2LRU A;  2ROV A;  4DHZ E;  1WGU A;  5L81 A;  1GG3 A;  4KIK B;  2KAN A;  3N30 A;  3JYU A;  2D4Q A;  1DYN A;  1LQB A;  1UD7 A;  1U5F A;  2IY0 B;  1WJM A;  4IWO A;  2KX0 A;  1PFJ A;  2V76 A;  2MRP A;  3KVF B;  2L0T A;  4BKG A;  2I1K A;  4HB4 B;  2D9W A;  1IPG A;  4E74 A;  4JKH A;  3PSE B;  3KRX A;  2ZCB A;  4PS7 A;  4ASW C;  4JKE A;  2COP A;  2Z0D B;  3N32 A;  4RM9 A;  2LXA A;  4NAW B;  3KUZ A;  1CMX B;  2K00 A;  3FP5 A;  2L00 B;  2P0D A;  4JQW C;  1IP9 A;  3L17 A;  4MM3 A;  1GNU A;  4HAZ B;  5J3T A;  2L05 A;  2BWF A;  3FM8 C;  1UNP A;  4NSW A;  2J0J A;  1Z2M A;  2JF5 A;  5DIF B;  2XBB C;  3ZRC A;  1JDE A;  1GC7 A;  4FUL A;  3NOB A;  1V49 A;  3WAP A;  4KHO A;  2DKP A;  5C5B B;  1TTN A;  2RSG A;  2XEW A;  4DBB A;  4AJW A;  2KNB A;  4GDL B;  2DZM A;  3HIZ A;  2O6V D;  4M8N A;  1V5M A;  2NR2 A;  1X05 A;  1UPQ A;  3ECI A;  3A33 B;  3FEH A;  3KYD D;  2KMC A;  3HQC A;  1EUV B;  2CQU A;  1WMH A;  1N3H A;  1EAZ A;  2NMB A;  3R7Q A;  3PPA A;  1I42 A;  2M4N A;  4PS8 A;  3PTF C;  1P3Q U;  2WX0 A;  1RFA A;  4MJS A;  1EF1 A;  2FDQ A;  5LXI B;  4ILG B;  3RZF A;  3PRE A;  5KQ4 A;  1WGG A;  2DYM A;  3VUX A;  4WSF A;  2KLG A;  4BBK A;  4WJP A;  2KN5 A;  1V5P A;  3PZD A;  2N9P C;  3TIX A;  4J6I A;  4WJQ A;  1E90 A;  2K1F A;  5J2R A;  1EGX A;  4FHK A;  2R2Q A;  2LOX A;  3H7S A;  2ZCC A;  4WVF B;  1WGQ A;  1NI2 A;  2PJH A;  2DEN B;  3RUI B;  2Z0O A;  4A6F B;  3UZT A;  3A1Q B;  3TCA A;  2KO3 A;  2DIK A;  1WG7 A;  2MBO A;  4ANV A;  3P6A A;  2L1C A;  1U5E A;  1LFD A;  3QAR A;  4MGZ E;  4GU2 A;  1KI1 B;  4HVB A;  5J17 A;  3KZ1 A;  3KSY A;  2DHI A;  3UQA A;  1W1H A;  2KJ6 A;  4MDK E;  2M0X A;  3D32 A;  3P7Z A;  4W9J A;  3BIN A;  1U2B A;  2N9E B;  5DPT A;  1KLV A;  4XX5 A;  2ZZP B;  2GBK A;  1XD4 A;  4HAY B;  4XWX A;  2NBW B;  3NSU A;  1WE6 A;  2DZK A;  2CS4 A;  1EVH A;  2CAY A;  3M1I B;  2YLM A;  5C6R A;  2RLO A;  1PMS A;  3NS8 A;  4G50 A;  2A5U A;  1U29 A;  1ZVR A;  2NBV B;  4HAT B;  4K17 A;  2FNJ B;  3AU5 A;  1XT9 B;  1YD8 U;  4OVV A;  2D11 A;  3AJ4 A;  4YL8 A;  2VSZ A;  1DIK A;  3R3M A;  1WJU A;  2KTF A;  2P8V A;  4TQ0 A;  5JZE B;  1WE7 A;  4FAD A;  1WX8 A;  2COA A;  1HBK A;  2K6Q A;  4HB3 B;  2PPH A;  3ULB A;  1V80 A;  4HPL B;  1E5W A;  1WJ6 A;  2CHZ A;  4I6L B;  3A98 B;  2KDE B;  3VTW A;  2WH5 A;  2LOZ A;  5IA7 A;  3ALB A;  2L7R A;  4B95 A;  2NBU A;  4H8S A;  2GS0 A;  3PEG A;  4B6W A;  2ZEQ A;  5BO4 B;  4JKB A;  3DVN U;  1A5R A;  4F1S A;  2NPT B;  3ODX A;  2KQS A;  3VOQ A;  2GMI C;  5C79 A;  1FHX A;  2IBI B;  4URK A;  3LJU X;  2KCJ A;  3M62 B;  3IBE A;  1GUA B;  4GDK A;  2JZZ A;  5LOP B;  1P1A A;  1V88 A;  3SBT A;  4KZ0 A;  1XCG A;  2I5C A;  2K39 A;  1HB6 A;  2MBB B;  2C60 A;  3TJP A;  4EZL A;  1ZC3 B;  3IFW B;  1ISN A;  1FHW A;  2FCM A;  2QKL A;  2JXX A;  2LUE A;  3KY9 A;  2NCN A;  4P7I A;  2MP2 A;  1KJT A;  3H9D A;  4ILH A;  2LGD A;  2KKC A;  3DBS A;  4ICV A;  2R0D A;  2B3A A;  1OEY A;  4JL9 A;  4W9D A;  3EEC A;  1LXD A;  1H4R A;  1GJZ A;  3K9P B;  3SDL C;  4NJ7 A;  1WGY A;  4KHB B;  2G45 B;  2CY4 A;  2JT4 B;  2KX3 A;  3ZIM A;  3A4S C;  5LON B;  1QC6 A;  4HWI B;  3RT3 B;  1V5O A;  4NNJ B;  2IO1 B;  3JVZ X;  3OAN A;  2ASQ A;  4WJO A;  1WY8 A;  2MBH A;  2KK8 A;  1X1F A;  2EKE C;  3WYF B;  2IYB A;  3APC A;  5CX3 A;  3SYX A;  3Q3J A;  4A5K A;  2X18 A;  1ZW7 A;  3ZNI D;  2N1W A;  3ZW3 A;  3PVL A;  3VH4 B;  3NZS A;  1UPR A;  1DBH A;  2DYQ A;  4A6K A;  3M95 A;  1WZ3 A;  4E71 A;  2D10 A;  3EFU A;  1VBH A;  3JSV B;  4JKF A;  5LLI A;  2LXC A;  3CIK A;  3DOW A;  5DCN A;  4IWP A;  3QIJ A;  3L10 B;  2FCN A;  2QHO A;  2MBQ A;  1Y8R C;  2N4F A;  3JW0 X;  5L95 C;  3S2A A;  4EZJ A;  3UGB B;  4WJ7 A;  2KJH B;  3ZUN A;  1V6E A;  3ZO5 B;  2M14 A;  1P9D U;  4W9H A;  5G2N A;  2KMA A;  1E7U A;  4WQO B;  3QBV B;  2ZPN A;  3ZVR A;  2MW5 A;  4BKS D;  2RPQ A;  2RUK B;  2KC1 A;  3X0W A;  5GOW B;  3VUW A;  5D6J B;  2KFK B;  4LJP B;  1P98 A;  4IAP A;  4BKS A;  4GPT B;  4PNK A;  1YJ1 A;  1W1G A;  2KVR A;  4K7S A;  4JK9 A;  2I5F A;  1K8R B;  2LD9 A;  3PGE A;  2D2Q A;  4W9G A;  4HPM B;  3VDZ A;  2DA0 A;  4IOY X;  2OOB B;  3PLV A;  1U4A A;  4NQL B;  2ZVO A;  2N1V A;  1WGR A;  4GMV A;  2JY6 A;  2HD5 B;  4Z2M B;  3RD2 A;  5D3W A;  4K7U A;  4A3P A;  1VCB A;  3IVF A;  2BKR B;  3VH3 B;  2ELA A;  4HAV B;  2YF0 A;  3SUZ A;  4GIV A;  2RGN B;  1KM7 A;  1UBQ A;  3A8P A;  4KZC A;  2ZNV C;  1VBG A;  5D94 A;  2FAZ A;  1Y19 B;  1P0R A;  3U7D A;  3KUC B;  5JLJ B;  3OAW A;  1M7R A;  4PQ0 A;  3QK0 A;  4GN1 A;  4KDL B;  3ZVV A;  2LGX A;  4MT7 A;  4WWN A;  3ML8 A;  2GBJ A;  5CHW A;  1E8Y A;  2GBN A;  2JZ3 B;  2K25 A;  1YX5 B;  2RVB B;  4A6H A;  4MJS B;  2I1J A;  5L83 A;  4DBG A;  1HB8 A;  3A9J A;  5C16 A;  3VHT C;  4G3X B;  2G3Q B;  4MSM B;  2BPS A;  2LZ6 A;  1WZ0 A;  1TQZ A;  3TFM A;  5HKH A;  4B6H A;  3DBH I;  1KBL A;  1RRP B;  1NBF C;  5DPR A;  1YX6 B;  3T06 A;  2KOX A;  2YS3 A;  1XOD A;  2DYB A;  5C5B A;  3PV1 A;  2DAJ A;  3L54 A;  1AQC A;  2YS5 A;  1JRU A;  4II2 B;  3VTU A;  3DXE A;  2C7H A;  2YRY A;  2V1Y A;  4ZYN A;  5HE3 A;  4K1R B;  2DX1 A;  4WWP A;  1FB8 A;  3ZTC A;  2CRF A;  1NTV A;  3R7R A;  3D8D A;  4HCN B;  1DDV A;  2YSZ A;  5DHF B;  3TMP B;  4PYU A;  2ROZ B;  4NAW A;  3QA8 A;  2D9Y A;  4FJZ A;  4BOS C;  4ZRJ A;  1WGH A;  2RNR B;  5CTR C;  3PRP B;  3MDB C;  4HLE A;  1WJN A;  2C7N B;  1QQG A;  3UF8 A;  3UIO B;  4OVU A;  3W1S C;  4MY6 A;  1WM3 A;  1LW3 A;  4EMO A;  3VQI A;  2N0Y A;  1RAX A;  2DFK A;  3MHS D;  4FA6 A;  4HB0 B;  2DHK A;  4PYZ A;  1V9J A;  2LAS A;  2Z0P A;  4W9F A;  3IG3 A;  1Q0W B;  2DKQ A;  2ZJD A;  1MG8 A;  3CMM B;  2FCS A;  4AOF A;  4B9K A;  4IC7 B;  2DYN A;  2MFQ A;  3HHM A;  2MDX A;  1U5G A;  2WX1 A;  4CO7 A;  3CSF A;  3HW2 B;  1WJ1 A;  3NY5 A;  3F0W A;  3VAW A;  2XQN M;  2D3G A;  5HE1 A;  2BKF A;  1MAI A;  4CYE A;  1SE9 A;  3ZNH B;  1NTY A;  1NDD A;  4IM2 A;  1V81 A;  4FHJ A;  3WA0 A;  2ZNV B;  2XK5 B;  2KGX B;  2Y5B B;  3PP2 A;  2LI5 A;  5C23 A;  1TXD A;  2LRW A;  2BGF A;  1IYF A;  1WFY A;  3TBL D;  1H10 A;  2PE6 B;  4WWO A;  4HAU B;  3V60 A;  2KTR A;  3HK0 A;  1S1Q B;  3UIN B;  1I7A A;  2LUL A;  3KYC D;  2HE7 A;  5DH9 B;  4FJV B;  3VFK A;  2R09 A;  1KC7 A;  4JKD A;  2LBB A;  2N23 A;  3H1U A;  1V89 A;  2VRW B;  3N3K B;  3PRZ A;  4M8M A;  4FBJ B;  4IM3 A;  1XKE A;  2DZI A;  4DX8 A;  5D2M B;  1FGZ A;  3ZNZ B;  5AZG A;  4DDI D;  1X86 A;  1C3T A;  4TQ1 A;  3U8Z A;  2K8H A;  2MP2 B;  2LG1 A;  4K2P A;  4FLH A;  1AWE A;  2DTC A;  1I2H A;  2MCN B;  1TGZ B;  2LYD A;  1OY2 A;  3ZDM C;  1J8C A;  2DX5 B;  1PQS A;  2FJL A;  5FI0 A;  2JVC A;  3QC8 B;  1UNQ A;  2XK5 A;  4X57 B;  2IYD B;  3KUD B;  2CU1 A;  2PZ1 A;  4KV2 A;  2MA9 B;  4IWQ A;  1Q67 A;  3ODW A;  2CHW A;  3TW1 A;  4JGH B;  2CY5 A;  1UGM A;  3B08 A;  3F5R A;  3ENB A;  2M8S A;  2MX2 A;  2DN6 A;  5EFX A;  2Z59 B;  3L16 A;  2J59 M;  2IO3 B;  1ZM0 A;  3V62 A;  4JK8 A;  2HRJ A;  2J7Q B;  2L0F A;  4KDI C;  2K2J A;  3N7C A;  2BWE S;  3GOE A;  3DQV A;  4ZDV A;  4K81 A;  2COD A;  3SNH A;  3P2B A;  5AEK B;  3HM3 A;  3QCA A;  1P5T A;  1R4M I;  2FJ9 A;  2D9V A;  4F7U P;  4MK0 A;  1WRD B;  1YIW A;  2LGY A;  5FI1 A;  2MSE D;  2A4Z A;  2X0S A;  4LCD E;  4BOZ B;  1ZKH A;  1RJ2 A;  1UZX B;  4W9I A;  3K9O B;  1OMW A;  2Y8G A;  3QWZ B;  4JKA A;  3WAO A;  3VVW B;  4YON A;  1WGD A;  2G4S A;  2JPH A;  1XR0 B;  4MEL A;  1H8C A;  2PEA A;  3DVG Y;  3D8E A;  1HE8 A;  2RQ1 A;  3LDZ E;  3OLM D;  1XQQ A;  3DCG A;  4F8C B;  3ONS A;  5GMV A;  2BYF A;  3G9W A;  4HAX B;  4IFS A;  1VD2 A;  1EO6 A;  1NVL A;  3PHW B;  4F7Z A;  2EJ8 A;  1BTK A;  3H6N A;  4II3 B;  2CHX A;  4DHJ D;  2UZR A;  2P0H A;  4LDT D;  3A9J B;  4HCP B;  2KQ7 A;  1LM8 B;  2OQB A;  4PS3 A;  2N7D A;  1P3R A;  2LVQ A;  2UVM A;  3PT2 B;  4RMA A;  4KSK C;  1WF9 A;  5CHV C;  3MTN B;  2FCQ A;  3QQ8 B;  3VTV A;  1FXT B;  1Q5W B;  3PVW A;  2KZR A;  4N9F 4;  3AU4 A;  4GDL A;  4XZ4 A;  1RLF A;  5EDS A;  2D07 B;  4BBN C;  2L76 A;  1OGW A;  3ML9 A;  4MSQ B;  2EC1 A;  2H7D A;  2V4L A;  3V6C B;  3EHV A;  1YQB A;  2CB8 A;  3W1Y A;  1V61 A;  4D0N B;  4DK5 A;  2CR5 A;  2K8B A;  5HE2 A;  2NZ8 B;  1XX0 A;  4GSW A;  4ZRI A;  4IUM B;  2YT0 A;  1X1G A;  2AYO B;  2LVO A;  3W1S A;  2KC2 A;  1KZ7 A;  4IG7 B;  1WXS A;  3HM6 X;  3VUY A;  3GYO A;  1FHO A;  1MIX A;  4HXD A;  2W2X C;  3ENE A;  3WIM A;  4HK2 A;  5JHH A;  2O2V A;  3RCP A;  2AL3 A;  4GDK B;  4GB9 A;  2MLB A;  3DXD A;  2KTR B;  2C5L C;  4W9C A;  2DLW A;  2IFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...