4ZRKA

Merlin-ferm and lats1 complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrkA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrkA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrkA01
1Z5SB 4HAYB 4AUQC 4KSKC 4MSQB 3Q3JA 2EMSA 4GIVA 4DDID 4URKA 1WJ1A 1ZGUB 2KJ6A 4EOYA 2FCNA 2JPHA 1XD3B 3PS6A 1WJNA 2X18A 2IO0B 5C5BB 2VRRB 1S1QB 3K9PB 1V49A 4C0AA 3VH4B 2BPSA 1XCGA 3JW0X 2DX5A 1AARA 1XT9B 1V2YA 3NHEB 1SGHA 2Z0DB 5E6PA 1C3TA 2YS5A 2FAZA 2Y5BB 5AEKB 2MFQA 2DZIA 4HAUB 3T9LA 2ZCCA 2IO1B 4HDQA 3P6AA 4FN2A 2JWZA 3IHPC 3PRPB 4HHVA 2N9XA 4BKGA 2G4DB 4E74A 2NMBA 1WR1A 2COAA 3EECA 3R66C 4A6HA 5JZEB 2KZRA 2MKRA 1E8WA 1X1GA 2RLOA 2EKEC 1Y5OA 2D2QA 1KZ7A 2HRJA 1UPQA 1J8CA 3BINA 1Q5WB 1DYNA 2LYDA 2ZPYA 1ZSQA 3M1IB 4WJQA 3WA0A 2M17A 3PG7A 1WMHA 3EPYA 1E8XA 1H4RA 2RGNB 1FHWA 4HLEA 4GDKB 4ANXA 3KUDB 3ZNZB 1DDMA 2IFSA 2FCMA 1XX0A 4I6LB 3PRMB 2O2VB 1J0GA 2ZVOA 1U5DA 4NQLB 2JY6A 5EDSA 5IA7A 2N23A 3L54A 4K2OA 3ZVRA 3KYDD 2V4LA 5L95C 2JRHA 3D8FA 2DKQA 4A6FB 2MQJA 1IPGA 3VXWA 5EFXA 5KQ1A 3RZFA 3NS8A 3KZ1A 1U5FA 3PVWA 3QHTA 3DVNU 2L05A 4AP4C 2JT4B 4BFRA 3ULBA 1WI1A 1WE6A 1S3SG 1LB1A 3A9JB 2IYBA 3OJ3A 4F7GA 3RUIB 3APDA 2MRPA 1Y19B 2KCJA 2LD9A 1MIZB 1UBQA 1XR0B 1EF5A 1J0WA 1TXDA 1U5EA 2UYZB 2KD0A 3GZNI 1V86A 2DN6A 3PLUA 2R2OA 3HM3A 2KJHB 2RGFA 3V6EB 4RM8A 3A33B 2KTRA 3PGEA 2K8BA 2CHZA 2N0YA 5G2NA 4TUUA 2DHIA 5DI9B 3IVFA 5HE1A 4HAZB 2LVQA 3V6CB 2ZNVB 3KY9A 2J7QB 4OVVA 1V9JA 1TTNA 1UNPA 3H7SA 2IO3B 2KDFB 2L3ZA 2REXA 2I5CA 3N7CA 1NTVA 1WJ6A 1K8RB 2JZZA 3D8EA 2HTHA 4JL9A 1YIWA 5GMVA 3QCAA 1KZGA 5J2RA 2RSUA 1T0YA 4JIOU 4MT7A 3QAQA 4KAXB 3FM8C 3QWMA 2GCLA 4IM2A 2DENB 2RVBB 2DA0A 2HJ8A 2M4NA 5D3XA 4GDLA 5C6RA 2MBQA 5D3WA 4KZ0A 2BKFA 4EZKA 1WZ3A 2K8CA 1I2HA 2C7HA 1MIXA 2NR2A 1PFJA 4EZLA 2LXAA 1WX8A 1Y8RC 3BJIA 1WZ0A 4MGKE 3L10B 4B6WA 1UPRA 2GCJA 1YJ1A 3VDZA 2W2XD 2P8VA 4HB4B 3R7QA 1Z2MA 3MTNB 4BVUC 5HE0A 3KVFB 3DDCB 1QQGA 1ZW7A 5LXHA 1Q1OA 4XX5A 2L8JA 4KIKB 2PE6B 2RNRB 3SDLC 4BOZB 1P9DU 4HB0B 3RCZA 1X1MA 5JH5C 2FCSA 2LG1A 2FUHB 2GOWA 1ZC4B 3APCA 3N30A 4ZYNA 1PLSA 2L00B 4IUMB 4PYUA 5DCNA 4K81A 2R0DA 2K25A 5HE2A 2P0DA 1I35A 2LBBA 1WGQA 3RCPA 4M8NA 4EMOA 1SIFA 3LDZE 4CHJA 2R09A 1ZM0A 2J0MA 2CAYA 2DX1A 4IG7B 4M0WB 4F7UP 3V61A 4HXDA 1NVLA 4G3XB 2LKOA 3TMPB 4ANWA 2RD0A 1WYWB 5LOPB 4MGIE 2MDXA 3ZLZA 2D11A 1XKEA 2BYEA 2MW5A 2N1VA 3QARA 1XQQA 2RUKB 3TJPA 4AJYB 3DCGA 4WWOA 1G6JA 2M14A 1DBHA 1YD8U 3KRXA 2K39A 1HBKA 2BCJA 2LOZA 2MP2A 4ANVA 2JZ3B 5DIFB 3WAOA 4HJKA 2GBMA 3NSUA 3CIKA 1WGHA 2K00A 3M3JA 3TW1A 1YQBA 1H10A 2I1JA 2K6DB 2LI5A 1KM7A 4MH0E 1WM3A 1U5GA 4HCPB 5DPSA 3V62A 3ONSA 2QKLA 4FJZA 3H6NA 1V5PA 2KQ7A 2GBNA 4DHZB 2KN5A 1FGYA 3ML9A 1UEFA 3DVGX 3ENEA 3OLMD 4CO7A 2DLWA 4HK2A 1RLFA 2C7MB 4I6NB 3ZNGC 4ZDVA 3DBSA 5D6JB 1WRDB 2K2UA 2MWSB 5KHQA 3PREA 3WAMA 1IYFA 5LONB 3L0WB 4NAWB 3EFUA 4HCNB 5TR5A 3TBLD 1E5WA 2NZ8B 3F0WA 3WIMA 2FIFA 4DX8A 2KANA 1ZKHA 2KC1A 3KW5B 3OAWA 3DBLI 5J3YA 5DHAB 1WX7A 3ZDTA 2KDIA 4DXAB 2D9ZA 2XEWA 1TJ6A 3DOWA 4CHMA 3C0RB 2KX3A 4M8MA 3ZVVA 5C1ZA 3SNHA 2AEHA 5C23A 4NY0A 2CODA 4FADA 4X57B 4RMAA 2ELAA 3PZDA 5FI1A 5D3VA 3BY4B 3SYXA 2B3AA 3AI5A 2MBEA 1PMSA 4XWXA 2COPA 4IWPA 4IM3A 4Z2MB 3AXCA 4KHOA 1WG7A 1UH6A 1J19A 2L76A 2N7DA 1RRPB 2L7RA 2Z0EB 3PHXB 3QQ8B 1KJTA 3ULCA 3F5RA 3DBRI 1P3QU 2IZVB 4GGQA 3PVLA 1P5TA 1M7EA 2JRIB 4FHJA 4W9GA 2V1YA 3RD2A 1LFDA 4W9HA 4FULA 3TCAA 2DZMA 2M38A 2MBOA 3PPAA 4KDIC 2RR9A 3A4RA 3A98B 4KHBB 3VUYA 4HVBA 2DKPA 4ZRJA 3DXEA 3DPDA 1FAOA 1B55A 3T8MA 3KH0A 1DDVA 1YX6B 4L6EA 5FR6A 4MM3A 2XK5A 2DZKA 1GJZA 3A9KA 3MDBC 3IG3A 2N7EA 4GOCA 1WI0A 3RULA 3VQIA 2GBKA 3UINB 1IP9A 4TQ1A 4EJNA 2JUOA 1U4AA 3ODXA 1E7VA 3KUCB 2LOXA 1HB8A 1OQYA 2JXXA 1NTIA 1RJ2A 1W1GA 2ZEQA 3ML8A 3G9WA 2BYFA 3PTFC 3OANA 3FLVA 3ZKJC 4FJVB 1N3HA 2KMAA 1UBIA 2MBBB 4FBJB 2KO3A 4WAAA 4B6HA 3DVNV 4W9EA 3GYPA 4DHZE 4DHJD 1Q67A 2D9YA 4K2PA 4PQ0A 4MJSB 1NU2A 5C5BA 3CSFA 3S2AA 1QC6A 4CYEA 4IAPA 1X05A 1UNRA 3WAPA 4GMVA 4EKUA 2BWFA 4PS8A 1XODA 2UWQA 1V5TA 1WJ4A 4GZUA 1LQBA 2DZJA 2YS1A 1VD2A 2CR5A 5HKHA 3A1QB 2VSZA 4DBBA 1WF9A 4CHKA 3FSSA 2KDEB 2LGDA 4NJ6A 3JSVB 3VUXA 2P0HA 1EGXA 2LXCA 1V88A 3ZNHB 3AU4A 3RYTA 2Q13A 3ODWA 3ZTDA 1WH3A 2PEAA 1GUAB 2LGYA 3VTUA 3VTWA 2HE7A 4KV2A 4MY6A 5D94A 2FDQA 3LJUX 5KCVA 1OTRB 2JP2A 2DHKA 2K6QA 2GS0A 5C79A 4LJOB 5KHOA 5JHHA 3O65B 5CX3A 3N32A 4EEWA 3QWZB 4EUTA 3ALBA 1WJUA 2M1MA 2G4SA 4K7SA 3H7PB 4TKNA 4NJ7A 1MKEA 2E2XA 4GDKA 2YT1A 5JHBA 4K7UA 1FGZA 2J0JA 3HHMA 4MELA 1VCBA 2O2VA 1V89A 2KHWB 2IO2B 2P0FA 3SU8X 3HM6X 1CMXB 2KFKB 2NPTB 4K1RB 2R2QA 2WDTB 2MBHA 2D9WA 4JGHB 3DXDA 4B9KA 1LXDA 3PSCA 3W1YA 4BKSA 1WXSA 5CHFA 2MSED 4A6FA 3IBEA 3L16A 2CB8A 1MAIA 5DPTA 4PYZA 4W9IA 3AJ4A 3MJWA 2V3SA 2ROVA 3UGBB 3DQVA 4IW0A 4GMXB 4XZ4A 1GC6A 2O6VA 4W9KA 4YL8A 4WWPA 4II3B 3PRZA 4JQWC 3ZDMC 4DBGA 3Q3FA 1BTKA 4A6KA 4MSMB 3QA8A 2IBIB 5D7GA 3QK0A 2LJ5A 3A9JA 2DYQA 1IRSA 3KUZA 3R3MA 1E8YA 2COCA 3DXCA 3L08A 2L1CA 2KC2A 4HPLB 3SV1A 4A20A 4GU2A 1ACAA 3TVVA 3VVWB 2MA9B 4HB3B 2KTFA 1FHOA 2A5UA 1D3ZA 2DYBA 2XBBC 4EFOA 2DYNA 1M94A 3ZIMA 3VOQA 4ICVA 1MG8A 4DWFA 3UIPB 2DTCA 2WX1A 4A3PA 5CTRC 2YSZA 2D4QA 2DX5B 3M62B 2ASQA 3B0AA 4FA6A 1WGYA 2DHJA 2DYOA 4NNJB 5IAAC 3KSYA 4WVFB 4MGYE 5JHGA 3B08A 4AWJA 4FLHA 1W1HA 1P98A 2KDBA 2NBVB 1ZVRA 4HAXB 2AL6A 2OQBA 2GBRA 1WR6E 4GSWA 1V61A 2COFA 2D9XA 3WANA 2DHZA 1KLVA 1MK9B 4N9F4 5GOWB 1WXAA 1V5MA 2FIDA 3HQCA 4DDGD 3UF8A 3PT2B 1DROA 3SD5A 1WX9A 1WMHB 2KUPA 2BKRB 3B1LX 3EHVA 2W2WA 3ZRFA 2LWPA 2CY5A 1BAKA 1RFAA 2XQNM 4IWQA 3ZW3A 2CHWA 2LZ6A 3MPXA 1FOEA 2KWCA 1BWNA 2YF0A 5J3QA 3O96A 4MDKE 2C60A 5CLQB 1LW3A 3VTVA 4DHJB 1UGMA 2MX2A 1NI2A 4KIKA 3R7RA 4RM9A 5BO4B 5AZHA 2ZZPB 3PLVA 1V6EA 2NBUA 3L17A 1HB6A 3TFMA 4OVUA 3PVUA 2LULA 4TYZA 3W1SA 2YT0A 5J3TA 2WX0A 4BBKA 1U27A 3CF6E 2ELBA 3JVZX 1GNUA 3M63B 5KQ4A 1GC7A 1P1AA 1WGUA 1K5DB 4IWOA 1AWEA 1WXMA 4GXBA 4G11A 1WE7A 4E71A 1GG3A 2PE9A 2D9VA 4ZRKA 1EUVB 3D8DA 4HAVB 4W9JA 4G0NB 4AOFA 2BYVE 3NZSA 2Z0QA 2JF5A 4MEMA 4DX90 3P7ZA 2BGFA 3PHWB 3SUZA 5C16A 2KTRB 1ISNA 1EVHA 1P0RA 3FP5A 4DK5A 2UZSA 4EZJA 1NTYA 2VRWB 2GJYA 2YRYA 4WQOB 2KX0A 2RPQA 2Z0OA 2G35A 1K5GB 1SE9A 1UD7A 3HK0A 4D0NB 2C9WB 2KXJA 5J18A 4F7HA 3UQAA 3K9OB 2I1KA 2UZRA 2DAJA 4HDOA 2J0KA 1UELA 2HTHB 2YVCA 2QHOA 1V5OA 2K1FA 2JVCA 2G3QB 3IFWB 4WWNA 4NSWA 3VFKA 2QKMA 2EJ8A 1U29A 4GN1A 4II2B 1P3RA 4F8CB 1E7UA 2M0XA 1UNQA 3VH3B 4LDTD 3PEGA 5D2MB 2FJ9A 2Y8FA 2CRFA 1OEYA 4KZCA 5J17A 2CY4A 4HAWB 4GDLB 2L2IA 4IFSA 3TIXA 4YONA 2HD5B 2LVPA 5E6NA 4BOSC 1V5UA 3TL5A 4A3OA 1YX5B 4JLCA 1BTNA 4HPMB 3KRWA 3ZRCA 1OEYJ 3QJZA 3AULA 3A8PA 2L0TA 2WH5A 3ML4A 1Z87A 1X1FA 3JYUA 2CU1A 2FCQA 5FI0A 3ZTCA 1KOTA 2KKCA 3VIAA 2ADZA 3QIJA 4PNKA 2ZJDA 3DBHI 1OQNA 3A8QA 2EMTA 3ECIA 3NZUA 2BWES 2KGXB 2AWTA 4K17A 1DDWA 1PQSA 3X0WA 2O6VB 4NAWA 4W9CA 3NY5A 3ZO5B 2L0FA 1WGDA 4HB2B 3X23A 1R4NI 1JRUA 2N1WA 3D32A 4WJPA 3DVGY 4W9FA 4GPTB 4G50A 3TO1A 1C1YB 4KDLB 1FHXA 3M95A 1QZEA 2NBWB 4PS7A 3WALA 2I5FA 4K7WA 4MGZE 1V81A 5JP4A 3APFA 2OOBB 3OJ4B 5JHAA 2DAFA 1I7AA 2NVUI 3ZNID 4IM0A 2KQSA 1FXTB 1V80A 5AZGA 3CXBB 1HE8A 1E8ZA 1MPHA 4E3CA 3N3KB 2Z59B 2KLCA 1WGGA 1RAXA 2W2XC 4FJYA 3UIOB 1U2BA 4J6IA 4ZRIA 2J59M 2D3GA 1NBFC 3MHSD 2N9EB 3FEHA 1ZC3B 4I6PA 2H7DA 3ZUNA 1OY2A 5D3YA 5L83A 5LXIB 4Y94A 4WJOA 3P2BA 4B95A 3AU5A 4ICUA 4LCDE 2C7NB 2VKIA 1EF1A 3U8ZA 3HW2B 2FNJB 3LJ3A 3ODOA 3KYCD 2Y7BA 1X86A 3EC8A 1WIAA 2D10A 1KI1B 2MP2B 4W9LA 4HWIB 2LRWA 2WWZA 3RT3B 3V5WA 2LUEA 2NCNA 2K8HA 3PV1A 4IC7B 4XC2A 2ZPNA 4F1SA 1L2NA 5HE3A 2ROZB 2G45B 2N4FA 1RRBA 5L81A 2KWUB 1SHCA 3L13A 2KK8A 1LM8B 3GYOA 2KLGA 3GOEA 3SHQA 5DPRA 5AZFA 1WY8A 3UZTA 2LVOA 2D07B 2OTXA 5G55A 3CMMB 4TQ0A 4H8SA 3CSTA 5E6OA 4W9DA 5CHVC 2M8SA 2LRUA 1A5RA 1L7YA 1P6SA 3I3TB 2KWVB 1FB8A 4WJ7A 2CQUA 5CLLB 4BKSD 2RSGA 4MJSA 3PSEB 4KHAA 4HATB 2V76A 2YS3A 3U7DA 2KOXA 1WVHA 1MK7B 2KJRA 4BBNC 2CS4A 3QX1A 4MK0A 1UZXB 4PS3A 2ZNVC 2ABDA 1TGZB 4WJNA 2EC1A 2O6VD 1NDDA 3A4SC 3QBVB 3U30A 4FHKA 2Z0PA 3A1QA 1TQZA 3VUWA 3PP2A 2GBJA 4BBNF 2KVRA 4ANUA 4LDTB 3SO6A 2IY1B 3JSVA 1WXVA 2KMCA 1M7RA 4BKTA 2IY0B 2KFJA 1I42A 4WSFA 1R4MI 2ZVNA 5JLJB 2IYDB 3RZWC 3VAWA 2ZCBA 2N9PC 1XD4A 1WM2A 3H1UA 4LJPB 2PPHA 2BF8B 1WFYA 3V60A 2Y8GA 5IJMA 1WGRA 3H7PA 1EAZA 4TV3A 4F7ZA 5LLIA 2RQ1A 1WJMA 1E90A 2W9NA 3UQBA 1AQCA 5CHWA 3QC8B 2NS5A 1TBEA 1H8CA 2LASA 4ASWC 2KFKA 2NPTA 2H7EA 2FJLA 3H9DA 4IOYX 2OJRA 2K2JA 2PZ1A 1BT0A 1W1DA 5DPWA 2CKHB 2C5LC 1Q0WB 3T06A 2YLMA 2AYOB 2DFKA 2XK5B 3W1SC 1OMWA 3A9KB 1EO6A 1TZ1A 4NPNA 4KVGB 4KSLC 1X11A 2CHXA 3VHTC 2PJHA 2UVMA 5DH9B 2WYQA 4Z2NA 3HIZA 2DYMA 4NQKE 1ST7A 4P7IA 3NOBA 2GMIC 2KNBA 2MWNB 3WYFB 2MLBA 5DHFB 1OGWA 2MCNB 4AJWA 5D27A 1F9JA 4A5KA 2AL3A 4GB9A 2LGXA 2A4ZA
chains in the Genus database with same CATH superfamily
1Z5SB 4HAYB 3NVWA 4AUQC 4KSKC 4MSQB 2OJWA 2K8EA 3Q3JA 2EMSA 2L1AA 4KX6B 2R82A 4GIVA 4DDID 3RNGC 4URKA 1WJ1A 1ZGUB 2KJ6A 4EOYA 2FCNA 1K53A 1SSNA 2JPHA 1XD3B 3PS6A 1WJNA 1WYGA 2X18A 2IO0B 5IKCM 3I63C 5C5BB 2PTLA 2VRRB 1MHHE 1PDXA 1S1QB 3K9PB 1V49A 4C0AA 2L52A 3VH4B 1K52A 1N5XA 3P4QB 1CK1A 2BPSA 1XCGA 3JW0X 3AEEB 2DX5A 1AARA 1XT9B 1TS5A 1V2YA 1Y56A 2LGIA 3NUHB 3NHEB 1SGHA 2Z0DB 5E6PA 1C3TA 2YS5A 2FAZA 2Y5BB 5AEKB 4LNNA 2MFQA 2DZIA 4HAUB 3T9LA 2ZCCA 5BMGA 2IO1B 4BZAA 1JRPA 4HDQA 5FR3A 3P6AA 1F1HA 1C4PA 3Q3NC 4FN2A 2JWZA 3IT6B 1RM6C 3IHPC 3PRPB 4HHVA 4YTPB 2N9XA 4BKGA 2G4DB 2NBVA 4E74A 2NMBA 1WR1A 2COAA 4WIPA 4AS1A 3EECA 3R66C 1ET6A 4A6HA 5JZEB 2KZRA 2MKRA 3BYTB 1E8WA 1OFFA 1X1GA 2RLOA 2FBWB 2EKEC 1DGJA 3ZXRA 1F2RC 1KF6B 1Y5OA 1MHXA 2D2QA 1KZ7A 1SIJA 3ZXVA 2HRJA 1UPQA 1J8CA 3BINA 1Q5WB 1V1OA 1FM0D 1DYNA 4JKBA 2LYDA 2ZPYA 1ZSQA 3M1IB 4WJQA 3WA0A 2M17A 2K49A 3PG7A 1WMHA 3EPYA 1N62A 1I4QA 1E8XA 3IAM1 2UU7A 1TYGB 5AUIA 1H4RA 5H8YE 2RGNB 1FHWA 1AW7A 1EWYC 3OG5A 4HLEA 1ZYIA 4GDKB 2D3AA 4ANXA 3KUDB 3ZNZB 1DDMA 1EU4A 3NZ3A 2IFSA 5AUKA 2FCMA 1XX0A 4I6LB 3PRMB 2O2VB 3FILB 1J0GA 3SBTA 5EE0A 2ZVOA 1JMLA 1U5DA 4USAA 1B1ZA 5D3DA 4NQLB 2JY6A 5EDSA 1VBHA 5IA7A 2N23A 3L54A 4K2OA 3ZVRA 3KYDD 2RPVA 2V4LA 5L95C 2JRHA 3Q3OC 3D8FA 2DKQA 4A6FB 3TUOA 2MQJA 1IPGA 3VXWA 2PVOD 4DIXA 3BVGA 5EFXA 3VR9B 5KQ1A 3RZFA 3NS8A 3ZJUA 4RFBA 3KZ1A 1KBLA 1U5FA 1ET9A 2WXHA 3PVWA 3QHTA 2ZKMX 3DVNU 5JXVA 2L05A 2VZKD 3IXSA 2AQ3B 2SEBD 4AP4C 1HXYD 2JT4B 1JCKB 4BFRA 3ULBA 1WI1A 1WE6A 1S3SG 3WCQA 3ZJVA 1WWTA 4L23A 1KC7A 1LB1A 3A9JB 1TS4A 1A70A 2IYBA 1I4XA 1FRRA 3FVCA 3OJ3A 4F7GA 3RUIB 4JK8A 3APDA 2J4XA 1E7PB 2MRPA 1Y19B 2WXQA 2KCJA 2LD9A 1V1PB 1MIZB 1UBQA 1XR0B 1EF5A 1WRIA 1J0WA 4C00A 1TXDA 1U5EA 2UYZB 4YSYB 2KD0A 3P4RB 3AN1A 3GZNI 1V86A 2DN6A 3ZYYX 5EE9A 2YT2A 3PLUA 1TY0A 2R2OA 3HM3A 2KJHB 1FO4A 3L4PA 2RGFA 3V6EB 4RM8A 2N9KA 3A33B 2KTRA 3PGEA 4JWSC 2K8BA 2CHZA 2N0YA 5G2NA 1ZE3D 4TUUA 4P6VF 4C4VB 2K22A 2DHIA 1JWBD 5DI9B 3IVFA 5HE1A 4HAZB 2LVQA 1TS2A 3V6CB 1D5MC 2ZNVB 3KY9A 2J7QB 2QDFA 3LXFA 4OVVA 2KYWA 1I4GA 2JSVX 1FCCC 2JU6X 1V9JA 1TTNA 4LLGM 1UNPA 3H7SA 4JKFA 2IO3B 3R2IA 1NENB 2KDFB 2L3ZA 2REXA 5BMIA 2I5CA 3N7CA 1NTVA 1WJ6A 1K8RB 2JZZA 3D8EA 4QJ4B 2HTHA 4JL9A 4UDUC 2ON8A 2BB6A 1YIWA 5E6JA 2LMCA 5GMVA 1HTOA 3QCAA 1KZGA 5J2RA 2RSUA 1T0YA 2OEDA 4JIOU 4MT7A 1FNUA 2RRFA 3Q3MC 3QAQA 4KAXB 3FM8C 3QWMA 2WXRA 2WXLA 2GCLA 1B9RA 4IM2A 1TKYA 2DENB 2RVBB 3N20C 5C2TB 1YJIA 3I5JC 2DA0A 3KLSX 2HJ8A 2M4NA 5D3XA 2QCZA 2Z14A 4GDLA 2W3SA 5C6RA 2MBQA 3Q8CA 5D3WA 4KZ0A 2BKFA 4EZKA 1WZ3A 2K8CA 1I2HA 1FNVA 1FEHA 2C7HA 1MIXA 2NR2A 1PFJA 4EZLA 2LXAA 4OZBA 1WX8A 1Y8RC 4MT5A 3BJIA 2FE8A 1WZ0A 4MGKE 3L10B 1F52A 4B6WA 1UPRA 2GCJA 1YJ1A 3VDZA 2IJ0A 2W2XD 2P8VA 4HB4B 4DXFA 1XCQL 4WH4A 3R7QA 1Z2MA 3MTNB 4BVUC 5HE0A 3KVFB 3DDCB 4IOIE 1QQGA 1ZW7A 5LXHA 4ZYSA 1HZ6A 1I4HA 1Q1OA 3HVDA 5EE1A 5IP4D 4XX5A 4DXGA 2L8JA 4KIKB 2PE6B 1L0VB 2RNRB 1ZPSA 3SDLC 4ITKA 4BOZB 1SXTA 1P9DU 3ZQ4A 4HB0B 1TIFA 2ONQA 3RCZA 1MJDA 1X1MA 4L2YA 5JH5C 2FCSA 2LG1A 3MJ5A 2WLBA 2FUHB 2GOWA 1ZC4B 2QEJC 2W55A 3APCA 3N30A 4ZYNA 1PLSA 2K5PA 2L00B 4IUMB 4ARIA 4PYUA 2MEKA 1ROEA 2H88B 2E3TA 1L4DB 2QSDA 5DCNA 4K81A 2R0DA 3EGRA 4HSIA 2K25A 3E66A 5HE2A 2P0DA 1TY2A 5BYQA 3AE7B 1I35A 2LBBA 3CIRB 5HFYA 1WGQA 3RCPA 4M8NA 2RMMA 4EMOA 1SIFA 3NWFA 3LDZE 1UWMA 4CHJA 4RGTA 2R09A 1ZM0A 2J0MA 2CAYA 1KRHA 2DX1A 1YN5A 1C78A 2X0SA 1ZDXA 4IG7B 4M0WB 4F7UP 3T3OA 3V61A 2VH1A 4HXDA 4D2KA 1P7EA 1NVLA 4G3XB 2Z59A 4C7ZA 2LKOA 3TMPB 3DHHC 2WXGA 4ANWA 1SE3A 2CJNA 2RD0A 1WYWB 1WXQA 5LOPB 4N59A 4MGIE 2MDXA 4LNFA 3ZLZA 2D11A 1XKEA 2BYEA 2WXJA 2MW5A 2N1VA 3QARA 1XQQA 2RUKB 3TJPA 4ZOHC 4BAXA 2L32A 4AJYB 2J42A 3DCGA 4WWOA 1G6JA 2M14A 1DBHA 2L83A 1XLPA 1Q10A 1YD8U 2R2YA 3KRXA 2K39A 1HBKA 2IDYA 2BCJA 4PK1A 1VZ6A 2LOZA 2MP2A 3RNBC 4ANVA 4ACFA 2JZ3B 1VDVA 5DIFB 3WAOA 4HJKA 1ZOYB 2GBMA 2IGGA 4KKIA 3NSUA 3CIKA 1WGHA 2K00A 3M3JA 3TW1A 2VZKB 1YQBA 2K9XA 1H10A 2I1JA 2K6DB 2LI5A 1KM7A 1T77A 1SE4A 4MH0E 1WM3A 1U5GA 2LHDA 3BK2A 1E10A 4HCPB 1D4BA 5DPSA 4TSSA 1JQ4A 1FFVA 3V62A 4YT0B 3ONSA 1MVKA 2QKLA 4FJZA 3DBHB 3H6NA 1V5PA 2KQ7A 4N58A 2GBNA 4DHZB 2KN5A 1FGYA 1QQRA 3ML9A 1UEFA 3RN9C 5BYSA 4YSZB 3DVGX 4H2AA 3VR8B 3ENEA 2EKIA 4ILGB 4HEA1 3OLMD 3N1ZC 4CO7A 2DLWA 4N6EB 4HK2A 1N5WA 1RLFA 2C7MB 1FCLA 4I6NB 1L6VA 3ZNGC 3R2TA 4ZDVA 1PUTA 3SBGA 3AMZA 2G9HD 3DBSA 5D6JB 1QOFA 1WRDB 3VRBB 2K2UA 2MWSB 5KHQA 3PREA 1FPYA 2AX5A 1C9FA 3WAMA 1HA5A 1IYFA 1OQRA 1T3QA 5LONB 3L0WB 2V4IB 4NAWB 3EFUA 4NJCA 4HCNB 5TR5A 3TBLD 1E5WA 3Q8BA 1P7FA 2FUG1 2NZ8B 3EA6A 3F0WA 3WIMA 3AE4B 2FIFA 4DX8A 2KANA 3HSAA 1ZKHA 2KC1A 3KW5B 3OAWA 3DBLI 5J3YA 1NVID 5DHAB 1WX7A 3ZDTA 2KDIA 3I57A 1QOGA 4DXAB 2D9ZA 2XEWA 1TJ6A 4REZA 3V3XA 3DOWA 1XLOA 4CHMA 3C0RB 2LUMA 1JALA 2KX3A 1YJJA 4ILHA 4M8MA 3ZVVA 2NTTA 3DHGC 5C1ZA 3SNHA 2AEHA 5C23A 4NY0A 1IBXA 3VRAB 2CODA 4EE2A 4FADA 2D3CA 4X57B 2Y3AA 4RMAA 2ELAA 3PZDA 5FI1A 4IKGA 3AEFB 5D3VA 5I2MA 3BY4B 4Q2JA 2J53A 4XDCA 1TS3A 4OVZA 3SYXA 2B3AA 3AI5A 2MBEA 4ZHOA 1PMSA 1CJEA 4XWXA 2COPA 4IWPA 3ZJTA 4IM3A 4WQMA 4ILJA 2DIKA 1PYWD 3UI3A 4Z2MB 3AXCA 1MG4A 1E9MA 4KHOA 5GXGB 1WG7A 3CWIA 1UH6A 1J19A 2L76A 2N7DA 1RRPB 2L7RA 2Z0EB 2W3RA 3PHXB 3QQ8B 1KJTA 3ULCA 3F5RA 3DBRI 2LFIA 1P3QU 2IZVB 4GGQA 5JVLA 3PVLA 1P5TA 1M7EA 5IN7A 2JRIB 4FHJA 1KTKA 5TSSA 4W9GA 2V1YA 2WP9B 3RD2A 1LFDA 4W9HA 4JWUC 4FULA 3TCAA 2DZMA 1DYQA 2M38A 1GAQB 4KGTA 2AQ2B 2MBOA 3PPAA 4KDIC 1ZUD2 4GLSC 1L0XB 2RR9A 3A4RA 3A98B 4KHBB 2GLSA 3VUYA 4HVBA 3TEYA 2DKPA 4ZRJA 2MJEA 3AH7A 3DXEA 3DPDA 1FAOA 1B55A 3T8MA 3E9PA 3KH0A 1DDVA 5MPOA 1YX6B 4L6EA 5FR6A 4MM3A 1UNSA 5IOIA 1NEKB 4P16A 2XK5A 2DZKA 1GJZA 3A9KA 2BS3B 3MDBC 1C4AA 3IG3A 2N7EA 4GOCA 1WI0A 3RULA 3VQIA 2GBKA 4JKAA 1FD6A 3KQ4A 3LB8C 3E9OA 3I9V1 3UINB 1LGRA 2KDMA 1IP9A 4TQ1A 4EJNA 2JUOA 1U4AA 3ODXA 1E7VA 3KUCB 2LOXA 1HB8A 1OQYA 2JXXA 1NTIA 1J7AA 1RFKA 1RJ2A 4ZRPA 4LK0M 4J3OD 2GRIA 1W1GA 2ZEQA 1FXIA 3ML8A 3ABVB 3DWGC 3G9WA 2BYFA 3PTFC 3R8BA 3OANA 2KT7A 3FLVA 5LNK1 3ZKJC 4FJVB 2LGSA 3HRDD 2KR0A 3AV8A 4RNAA 1N3HA 2KMAA 2LHEA 1UBIA 1QILA 2MBBB 4FBJB 2KO3A 4WAAA 4B6HA 3DVNV 4W9EA 3GYPA 2WU5B 4OZAA 4DHZE 1ZXHA 2BTEA 4DHJD 1Q67A 2D9YA 1EU3A 4K2PA 3TEWA 4PQ0A 4MJSB 1NU2A 5C5BA 3CSFA 4HRSA 3S2AA 3H8HA 3TEXA 1QC6A 3NVVA 2GUMA 4CYEA 4IAPA 1VZ8A 1X05A 1UNRA 3WAPA 4GMVA 4EKUA 2BWFA 2H89B 4PS8A 1XODA 2UWQA 1V5TA 1WJ4A 4GZUA 1LQBA 2DZJA 1R4MB 3EUB2 2YS1A 1VD2A 4HROA 2CR5A 1GGOA 5HKHA 2PW9A 4L1BA 3BWUD 3A1QB 2VSZA 4DBBA 4XE0A 1WSPA 1WF9A 4CHKA 3FC4A 3FSSA 2KDEB 2LGDA 2IGDA 4NJ6A 3LYYA 3JSVB 1DOXA 3A58A 3VUXA 2QMTA 2P0HA 3NWDA 3P42A 1EGXA 2KACA 2LXCA 1V88A 3ZNHB 3AU4A 3RYTA 2Q13A 3ODWA 3ZTDA 1WH3A 3PZ7A 2PEAA 1XF5L 1GUAB 2LGYA 2PVGC 1VRAB 5HG2A 3VTUA 3VTWA 2HE7A 4KV2A 4MY6A 4GNKB 5D94A 2BS2B 2FDQA 3LJUX 5KCVA 1OTRB 2JP2A 4A90A 2DHKA 2K6QA 2GS0A 5C79A 1BUIC 4LJOB 2M56B 4NAMA 5KHOA 5JHHA 3O65B 5CX3A 3N32A 4EEWA 4RCOA 4S0RA 3QWZB 4EUTA 3ALBA 1WJUA 2M1MA 4PT5A 2G4SA 2NTSA 4K7SA 3H7PB 3E56A 4TKNA 4NJ7A 2KQ4X 1MKEA 2N0SB 2E2XA 4GDKA 2YT1A 5T8IA 5JHBA 4TMAB 4K7UA 4XYCA 1FGZA 2V0GA 2J0JA 3HHMA 4MELA 1VCBA 2O2VA 1V89A 2KHWB 2IO2B 3FILA 4JK9A 2P0FA 1YOVB 3SU8X 1EWCA 2MHJA 3HM6X 1CMXB 2KFKB 4L1RA 2NPTB 2RDHA 4K1RB 2R2QA 3Q8AA 2WDTB 3J9CA 2MBHA 2D9WA 4JGHB 3DXDA 1L6UA 4B9KA 1LXDA 1MI1A 3PSCA 3W1YA 4BKSA 3NVZA 1VZ7A 2X38A 2ICIA 3MP9A 1WXSA 5CHFA 2MSED 4A6FA 3IBEA 3L16A 2CB8A 4CQNA 3NWAA 1MAIA 5DPTA 4PYZA 4W9IA 3AJ4A 2DBYA 3MJWA 2V3SA 2ROVA 3UGBB 3DQVA 1ZP0B 4IW0A 4GMXB 3V05A 1STEA 1T0RC 4XZ4A 1GC6A 2O6VA 4W9KA 4YL8A 4WWPA 4II3B 3PRZA 1EM7A 4JQWC 3ZDMC 4DBGA 3Q3FA 2HJ1A 2K3UA 2INNE 5I4DA 5M4YB 2G1EA 1BTKA 4A6KA 4NZLB 4MSMB 1FMAD 4JX1C 1T6BX 3QA8A 2IBIB 5D7GA 2WXMA 3QK0A 1JWUD 2LJ5A 3A9JA 2DYQA 1IRSA 3KUZA 3R3MA 1YN4A 4QJ5B 3P4SB 1E8YA 2COCA 1K50A 3DXCA 3L08A 1D5ZC 2L1CA 3OWEB 2KC2A 1V1PA 3SV1A 1JWAD 4HPLB 4A20A 4GU2A 3U2SC 1ACAA 3TVVA 1UF0A 3VVWB 2MA9B 4HB3B 2KTFA 1JW9D 4D6WA 4M01A 1FHOA 3BVZA 4RF0A 3E9LA 2NMQA 1QF6A 2A5UA 1D3ZA 2DYBA 5G5GA 1XEEA 2XBBC 4EFOA 2DYNA 1M94A 3ZIMA 3VOQA 1I4RA 4ICVA 1MG8A 4DWFA 2RDBC 3UIPB 3N1YC 4US8A 2DTCA 2M0AA 2WX1A 4A3PA 4A8XC 5I2SA 5CTRC 2YSZA 4C4VA 2D4QA 2DX5B 3M62B 4XGAB 1YNTE 1L4ZB 2ASQA 3B0AA 4FA6A 1WGYA 2DHJA 2DYOA 4K3BA 3AM9A 4NNJB 5IAAC 4A55A 3KSYA 4WVFB 4MGYE 4A9AA 5JHGA 1PGXA 3B08A 4AWJA 4FLHA 1W1HA 1P98A 1JWMD 2KDBA 2NBVB 1FFUA 1ZVRA 4ARCA 5LG4B 4HAXB 4K3CA 2AL6A 2OQBA 4QAYA 2GBRA 1WR6E 2KWDA 4GSWA 1V61A 2COFA 2D9XA 3WANA 2DHZA 1KLVA 2PMVA 1MK9B 4N9F4 5GOWB 1L5PA 2WS3B 2BB5A 4YTMB 1WXAA 1JDEA 1V5MA 2FIDA 3HQCA 1TKGA 4DDGD 3UF8A 3PT2B 4OW0A 1DROA 3RNFC 3SD5A 1WX9A 1WMHB 2KUPA 2BKRB 1AWDA 3B1LX 3EHVA 2W2WA 3ZRFA 3BIID 2LWPA 2CY5A 1DOIA 3MC8A 4RGNA 1BAKA 1RFAA 2XQNM 4IWQA 3ZW3A 4YSXB 2CHWA 2INCC 2LZ6A 2Q5WD 2R61A 5HI1A 2N9LA 3MPXA 4ZHPA 1FOEA 2KWCA 2Y5CA 1BWNA 4OZCA 2YF0A 5J3QA 1YN3A 3O96A 4MDKE 2C60A 5CLQB 1LW3A 3VTVA 3GP7A 1AN8A 1R4NB 2BQQA 2Y5PA 4DHJB 4CSQA 1UGMA 2MX2A 1NI2A 1PGAA 4KIKA 1D6EC 3R7RA 2WGSA 3P4PB 4RM9A 5BO4B 5AZHA 2ZZPB 4KGSA 3PLVA 1V6EA 2NBUA 3L17A 1E0ZA 1HB6A 3TFMA 4OVUA 3PVUA 2LULA 4TYZA 1L0YB 3W1SA 2YT0A 5J3TA 3NRZA 2WX0A 4AQ7A 4BBKA 4JKGA 2WHIA 3NVYA 1U27A 2DLBA 3CF6E 2ELBA 1QLBB 2JZPA 3JVZX 2GI9A 4B0EA 1ZXIA 2INDC 2Z8LA 1C4CA 4YTNB 4US9A 1GNUA 3M63B 3ZGZA 5KQ4A 2V3PA 1HZ5A 1GC7A 1P1AA 4OHJA 1WGUA 1K5DB 4IWOA 1HTQA 1AWEA 1WXMA 4GXBA 4G11A 1WE7A 4E71A 2JWUA 1GG3A 3P1MA 1JROA 2PE9A 2D9VA 3OHMB 4ZRKA 3C19A 3HUIA 1EUVB 2WQYB 3D8DA 4HAVB 4W9JA 3RMKC 4G0NB 4AOFA 3HIEA 2BYVE 2WXFA 2PKOA 4M0WA 3NZSA 1GB1A 2Z0QA 2JF5A 4MEMA 2KIEA 4DX90 3P7ZA 2BGFA 3PHWB 3SUZA 5C16A 2CU3A 3MC9A 2I2YA 2KTRB 3BVMA 1ISNA 4WWMA 1EVHA 1P0RA 3FP5A 3Q69A 4WURA 4DK5A 2UZSA 4EZJA 2MJDA 1SB3C 1NTYA 3EFCA 2D3BA 4KKJA 2VRWB 2GJYA 2YRYA 4WQOB 3AEAB 2KX0A 2RPQA 2Z0OA 3AB5A 2G35A 3W5UB 1K5GB 1SE9A 1UD7A 3HK0A 4D0NB 3IAS1 1SJHD 2C9WB 3BYYB 1XLNA 2KXJA 1N60A 4C80A 5J18A 4F7HA 3UQAA 3K9OB 2I1KA 2UZRA 2DAJA 1FIQA 4HDOA 2J0KA 2V9HA 1UELA 2W54A 2HTHB 2YEPF 3U7ZA 1VLBA 2FJUB 1GB4A 2YVCA 2QHOA 1V5OA 1BMLC 2K1FA 2JVCA 4XWTA 2G3QB 3IFWB 4WWNA 4NSWA 3VFKA 3NW8A 2QKMA 2EJ8A 1U29A 4GN1A 4II2B 3C8YA 1P3RA 4F8CB 1E7UA 2M0XA 1UNQA 3VH3B 4LDTD 3PEGA 5D2MB 3Q2AC 2FJ9A 2Y8FA 2DWQA 2CRFA 1OEYA 1VJKA 4KZCA 2QJLA 5J17A 2CY4A 3KWLA 2BVCA 4HAWB 4GDLB 2L2IA 4IFSA 2QIEB 2LEKA 3TIXA 3RFZB 3O13A 4YONA 3AE8B 5IO9A 2HD5B 2LVPA 5E6NA 2JXTA 4BOSC 1DOYA 1V5UA 2KMMA 3TL5A 4A3OA 1IGCA 4O1NA 1T5XD 1YX5B 4JLCA 4MH8A 4HKZE 1BTNA 2MH7A 4HPMB 3MHZA 3KRWA 2WXNA 4WAFA 3ZRCA 5D3IB 1OEYJ 1XCTL 5IRSA 1SBBB 3QJZA 3AULA 3A8PA 1F2RI 2L0TA 2WH5A 3ML4A 1Z87A 1UWXA 4P1CC 1GPXA 4C56C 3B9JA 4JKEA 1X1FA 3ETRA 3JYUA 2CU1A 2FCQA 2KUQA 2IPKD 3AE2B 2WXOA 5FI0A 1N6ZA 2TSSA 3ZTCA 1KOTA 2KKCA 3VIAA 2ADZA 3QIJA 4PNKA 3AE5B 1N61A 2ZJDA 1D5XC 3DBHI 1OQNA 3A8QA 2EMTA 3ECIA 5HHDG 3NZUA 2BWES 2KGXB 2VH2A 2AWTA 4K17A 1GOZA 1DDWA 1PQSA 3X0WA 2O6VB 4NAWA 4W9CA 3NY5A 3ZO5B 4YXDB 3P63A 5BMHA 1XLQA 2L0FA 1FRDA 1WGDA 4HB2B 3X23A 1R4NI 3RNCC 1JRUA 2D5GA 2N1WA 2BYTA 1QOBA 1RYJA 3D32A 4WJPA 3DVGY 1ACCA 3DWMA 4W9FA 3Q6BA 2KAJA 3SR6A 4GPTB 3KWVA 4G50A 3TO1A 1C1YB 2K0PA 4KDLB 1FHXA 3M95A 1QZEA 2NBWB 1FNWA 3N1XC 4PS7A 3WALA 1TT5B 2I5FA 1FXAA 4K7WA 4QJ3B 1M4VA 4MGZE 3SFEB 1V81A 5JP4A 2HDEA 2QILA 2OHFA 2JQRB 3APFA 1XXGA 2OOBB 3OJ4B 5JHAA 1I4PA 2DAFA 1C76A 1MPEA 1KLGD 1J7BA 3URYA 1I7AA 2NVUI 3U12A 3ZNID 3AE1B 4IM0A 2KQSA 1NI3A 2BW2A 1FXTB 3MC0B 2JYTA 3Q8FA 1V80A 5AZGA 3TSSA 2WXPA 3CXBB 4HJGE 5C3JB 1HE8A 1E8ZA 4JK7A 1QT9A 1MPHA 4E3CA 3N3KB 2Z13A 3B2FA 2Z59B 2KLCA 1MFWA 1WGGA 1R7SA 2BS4B 3GE8C 1RAXA 2W2XC 4FJYA 3UIOB 1U2BA 3FAHA 4J6IA 2RDGA 4ZRIA 2J59M 2D3GA 1NBFC 3MHSD 1KLUD 3RNEC 2N9EB 1PGBA 1SEBD 3FEHA 1ZC3B 3PZ8A 4I6PA 2WU2B 2H7DA 4LTUA 3ZUNA 1OY2A 5D3YA 5L83A 5LXIB 4LNOA 4Y94A 1KH0A 4WJOA 1TJEA 3P2BA 4B95A 4B0MA 3AU5A 4ICUA 1TKEA 3NJTA 4LCDE 4KGRA 3RNAC 1HQRD 2C7NB 2VKIA 1E6EB 1V8CA 1EF1A 1CQVA 3U8ZA 4KHBA 4RGOS 3HW2B 2BBCA 1C77A 2FNJB 3LJ3A 3ODOA 3KYCD 2Y7BA 1X86A 3EC8A 1WIAA 1XO3A 2D10A 1KI1B 2MP2B 1T0QC 5FK9C 3ENBA 4W9LA 4HWIB 2LRWA 1F0ZA 2WWZA 3RT3B 2GB1A 3V5WA 2LUEA 2NCNA 2K8HA 3IT4B 3PV1A 4M02A 4IC7B 2JYEA 2WNMA 3Q14C 3AEGB 4HKQA 1YMHE 4XC2A 2ZPNA 5G5HA 4F1SA 3TEZA 1L2NA 1ZDVA 5HE3A 2ROZB 2G45B 2N4FA 4RF1A 1RRBA 5L81A 2CJOA 2KWUB 2WDVB 2DNFA 1SHCA 3SFDB 3GB1A 1I7HA 3L13A 2KK8A 2SAKA 1LM8B 3GYOA 2KLGA 4HPPA 3GOEA 3SHQA 4JPSA 5DPRA 5AZFA 1WY8A 2N7JA 3UZTA 3DBLB 2LVOA 2D07B 2KN4A 1ESFA 2OTXA 2WDRB 1ENFA 5G55A 3GE3C 4A6QA 3CMMB 4ZRQA 4TQ0A 3MFGA 4H8SA 3CSTA 5E6OA 4W9DA 5CHVC 2M8SA 4XDDA 2LRUA 4QXAB 2AQ1B 2ZW0A 1A5RA 3NS1A 1J7CA 1L7YA 1P6SA 1NYQA 3AE9B 3I3TB 2KWVB 5FKAC 4JKGB 1FB8A 2WXIA 1YQ4B 4WJ7A 2CQUA 1HEZE 1QOAA 4JKHA 5CLLB 4IDIA 4JE3B 4BKSD 2RSGA 4MJSA 3PSEB 4KHAA 4HATB 2V76A 2YS3A 3U7DA 2KOXA 4R3DA 1BXTA 1WVHA 3AEDB 3T3NA 1MK7B 3Q8EA 2KJRA 3AECB 4BBNC 2CS4A 1C79A 3QX1A 2PLPA 4MK0A 1UZXB 4PS3A 2INPE 2WDQB 3RPFC 4LNKA 2ZNVC 2ABDA 1TGZB 1V97A 4WJNA 2EC1A 4RH6A 2O6VD 1NDDA 3A4SC 1JWSD 3QBVB 3U30A 1OQQA 1IBXB 4FHKA 2Z0PA 3W2DA 3AE6B 3A1QA 1PFDA 2ZW1A 4M00A 1TQZA 3VUWA 3PP2A 2GBJA 4BBNF 4P1BC 1TZOA 4C7YA 2KVRA 4ANUA 4LDTB 3SO6A 2IY1B 3DBRB 3JSVA 1WXVA 2KMCA 1M7RA 3HVZA 2JX5A 4BKTA 2WXKA 4S17A 2IY0B 2KFJA 1I42A 3DCXA 3AE3B 4WSFA 1R4MI 4GOUA 2ZVNA 4MACA 2LJIA 5JLJB 1AYFA 2M19A 4OT1A 2IYDB 3BZDB 3RZWC 2BT6A 3VAWA 3GS2A 2ZCBA 1KFYB 2N9PC 5BYRA 4RGMA 1XD4A 4JKCA 1DIKA 1WM2A 2W82A 1IGDA 3H1UA 4OSNA 4LJPB 3B77A 5H92C 1VR9A 2PPHA 2BF8B 1WFYA 3V60A 2Y8GA 4XWWA 5IJMA 2YEPB 1N63A 3N9YC 2MJ3A 1WGRA 2ACZB 3E9SA 3H7PA 1EAZA 4DQOC 4TV3A 3AEBB 4F7ZA 1WGKA 2KVZA 1MI0A 5LLIA 4FXCA 2RQ1A 1WJMA 1LO5D 1E90A 2W9NA 3UQBA 1AQCA 5CHWA 2EELA 3QC8B 2NS5A 5EE3A 3FKYA 1TBEA 2B76B 1H8CA 2PIAA 3W9CB 2LASA 3DHIC 2KFKA 2I38A 2NPTA 1CZPA 1UGJA 4ASWC 2H7EA 1YQ3B 1SF0A 3BK1A 2FJLA 3H9DA 4IOYX 2OJRA 1QKZA 2K2JA 2XNAC 2J52A 1F77A 2PZ1A 2E6XA 2V3NA 1BT0A 1W1DA 4MM3B 3B2GA 5DPWA 1IUEA 2CKHB 2C5LC 2Z4DA 1Q0WB 3T06A 2YLMA 2AYOB 4JKDA 2DFKA 4YWGG 2XK5B 3W1SC 4LNIA 1OMWA 3A9KB 1EO6A 1UUPA 2HTME 1TZ1A 4KVGB 4NPNA 1T0SC 1X11A 2IGHA 4KSLC 2CHXA 3SEBA 3VHTC 2PJHA 1K51A 2UVMA 5DH9B 2WYQA 4Z2NA 3HIZA 2DYMA 4NQKE 2QC8A 1SE2A 1ST7A 4P7IA 1VBGA 3NOBA 2KIGA 1RWSA 2GMIC 2KNBA 2MWNB 3WYFB 2XN9C 1NYRA 2MLBA 5DHFB 1OGWA 2MCNB 4AJWA 3W5VB 5D27A 3U52E 3PO0A 1F9JA 4A5KA 2AL3A 1SJED 4GB9A 2LGXA 2A4ZA 3RI7C 3U4EG 3NG0A 3GZNB 2X8XX
chains in the Genus database with same CATH topology
1Z5SB 4HAYB 4AUQC 4KSKC 4MSQB 3Q3JA 2EMSA 2R82A 4GIVA 4DDID 4URKA 1WJ1A 1ZGUB 2KJ6A 4EOYA 2FCNA 2JPHA 1XD3B 3PS6A 1WJNA 2X18A 2IO0B 5C5BB 2VRRB 1S1QB 3K9PB 1V49A 4C0AA 3VH4B 2BPSA 1XCGA 3JW0X 2DX5A 1AARA 1XT9B 1V2YA 3NHEB 1SGHA 2Z0DB 5E6PA 1C3TA 2YS5A 2FAZA 2Y5BB 5AEKB 2MFQA 2DZIA 4HAUB 3T9LA 2ZCCA 2IO1B 4HDQA 3P6AA 4FN2A 2JWZA 3IHPC 3PRPB 4HHVA 2N9XA 4BKGA 2G4DB 4E74A 2NMBA 1WR1A 2COAA 3EECA 3R66C 4A6HA 5JZEB 2KZRA 2MKRA 1E8WA 1X1GA 2RLOA 2EKEC 1Y5OA 2D2QA 1KZ7A 2HRJA 1UPQA 1J8CA 3BINA 1Q5WB 1DYNA 4JKBA 2LYDA 2ZPYA 1ZSQA 3M1IB 4WJQA 3WA0A 2M17A 3PG7A 1WMHA 3EPYA 1E8XA 1H4RA 2RGNB 1FHWA 4HLEA 4GDKB 4ANXA 3KUDB 3ZNZB 1DDMA 2IFSA 2FCMA 1XX0A 4I6LB 3PRMB 2O2VB 1J0GA 3SBTA 2ZVOA 1U5DA 4NQLB 2JY6A 5EDSA 1VBHA 5IA7A 2N23A 3L54A 4K2OA 3ZVRA 3KYDD 2V4LA 5L95C 2JRHA 3D8FA 2DKQA 4A6FB 2MQJA 1IPGA 3VXWA 5EFXA 5KQ1A 3RZFA 3NS8A 3KZ1A 1KBLA 1U5FA 3PVWA 3QHTA 3DVNU 2L05A 4AP4C 2JT4B 4BFRA 3ULBA 1WI1A 1WE6A 1S3SG 1KC7A 1LB1A 3A9JB 2IYBA 3OJ3A 4F7GA 3RUIB 4JK8A 3APDA 2MRPA 1Y19B 2KCJA 2LD9A 1MIZB 1UBQA 1XR0B 1EF5A 1J0WA 1TXDA 1U5EA 2UYZB 2KD0A 3GZNI 1V86A 2DN6A 3PLUA 2R2OA 3HM3A 2KJHB 2RGFA 3V6EB 4RM8A 3A33B 2KTRA 3PGEA 2K8BA 2CHZA 2N0YA 5G2NA 4TUUA 2DHIA 5DI9B 3IVFA 5HE1A 4HAZB 2LVQA 3V6CB 2ZNVB 3KY9A 2J7QB 4OVVA 1V9JA 1TTNA 1UNPA 3H7SA 4JKFA 2IO3B 2KDFB 2L3ZA 2REXA 2I5CA 3N7CA 1NTVA 1WJ6A 1K8RB 2JZZA 3D8EA 2HTHA 4JL9A 1YIWA 5GMVA 3QCAA 1KZGA 5J2RA 2RSUA 1T0YA 4JIOU 4MT7A 3QAQA 4KAXB 3FM8C 3QWMA 2GCLA 4IM2A 2DENB 2RVBB 2DA0A 2HJ8A 2M4NA 5D3XA 4GDLA 5C6RA 2MBQA 5D3WA 4KZ0A 2BKFA 4EZKA 1WZ3A 2K8CA 1I2HA 2C7HA 1MIXA 2NR2A 1PFJA 4EZLA 2LXAA 1WX8A 1Y8RC 3BJIA 1WZ0A 4MGKE 3L10B 4B6WA 1UPRA 2GCJA 1YJ1A 3VDZA 2W2XD 2P8VA 4HB4B 3R7QA 1Z2MA 3MTNB 4BVUC 5HE0A 3KVFB 3DDCB 1QQGA 1ZW7A 5LXHA 1Q1OA 4XX5A 2L8JA 4KIKB 2PE6B 2RNRB 3SDLC 4BOZB 1P9DU 4HB0B 3RCZA 1X1MA 5JH5C 2FCSA 2LG1A 2FUHB 2GOWA 1ZC4B 3APCA 3N30A 4ZYNA 1PLSA 2L00B 4IUMB 4PYUA 5DCNA 4K81A 2R0DA 2K25A 3E66A 5HE2A 2P0DA 1I35A 2LBBA 1WGQA 3RCPA 4M8NA 4EMOA 1SIFA 3LDZE 4CHJA 2R09A 1ZM0A 2J0MA 2CAYA 2DX1A 2X0SA 4IG7B 4M0WB 4F7UP 3V61A 4HXDA 1NVLA 4G3XB 2LKOA 3TMPB 4ANWA 2RD0A 1WYWB 5LOPB 4MGIE 2MDXA 3ZLZA 2D11A 1XKEA 2BYEA 2MW5A 2N1VA 3QARA 1XQQA 2RUKB 3TJPA 4AJYB 3DCGA 4WWOA 1G6JA 2M14A 1DBHA 1YD8U 3KRXA 2K39A 1HBKA 2BCJA 2LOZA 2MP2A 4ANVA 2JZ3B 5DIFB 3WAOA 4HJKA 2GBMA 3NSUA 3CIKA 1WGHA 2K00A 3M3JA 3TW1A 1YQBA 1H10A 2I1JA 2K6DB 2LI5A 1KM7A 4MH0E 1WM3A 1U5GA 4HCPB 5DPSA 3V62A 3ONSA 2QKLA 4FJZA 3H6NA 1V5PA 2KQ7A 2GBNA 4DHZB 2KN5A 1FGYA 3ML9A 1UEFA 3DVGX 3ENEA 4ILGB 3OLMD 4CO7A 2DLWA 4HK2A 1RLFA 2C7MB 4I6NB 3ZNGC 4ZDVA 3SBGA 3DBSA 5D6JB 1WRDB 2K2UA 2MWSB 5KHQA 3PREA 3WAMA 1IYFA 5LONB 3L0WB 4NAWB 3EFUA 4HCNB 5TR5A 3TBLD 1E5WA 2NZ8B 3F0WA 3WIMA 2FIFA 4DX8A 2KANA 1ZKHA 2KC1A 3KW5B 3OAWA 3DBLI 5J3YA 5DHAB 1WX7A 3ZDTA 2KDIA 4DXAB 2D9ZA 2XEWA 1TJ6A 3DOWA 4CHMA 3C0RB 2KX3A 4ILHA 4M8MA 3ZVVA 5C1ZA 3SNHA 2AEHA 5C23A 4NY0A 2CODA 4FADA 4X57B 4RMAA 2ELAA 3PZDA 5FI1A 5D3VA 3BY4B 3SYXA 2B3AA 3AI5A 2MBEA 1PMSA 4XWXA 2COPA 4IWPA 4IM3A 4ILJA 2DIKA 4Z2MB 3AXCA 4KHOA 1WG7A 1UH6A 1J19A 2L76A 2N7DA 1RRPB 2L7RA 2Z0EB 3PHXB 3QQ8B 1KJTA 3ULCA 3F5RA 3DBRI 1P3QU 2IZVB 4GGQA 5JVLA 3PVLA 1P5TA 1M7EA 2JRIB 4FHJA 4W9GA 2V1YA 3RD2A 1LFDA 4W9HA 4FULA 3TCAA 2DZMA 2M38A 2MBOA 3PPAA 4KDIC 2RR9A 3A4RA 3A98B 4KHBB 3VUYA 4HVBA 2DKPA 4ZRJA 3DXEA 3DPDA 1FAOA 1B55A 3T8MA 3E9PA 3KH0A 1DDVA 1YX6B 4L6EA 5FR6A 4MM3A 2XK5A 2DZKA 1GJZA 3A9KA 3MDBC 3IG3A 2N7EA 4GOCA 1WI0A 3RULA 3VQIA 2GBKA 4JKAA 3E9OA 3UINB 1IP9A 4TQ1A 4EJNA 2JUOA 1U4AA 3ODXA 1E7VA 3KUCB 2LOXA 1HB8A 1OQYA 2JXXA 1NTIA 1RJ2A 1W1GA 2ZEQA 3ML8A 3G9WA 2BYFA 3PTFC 3OANA 3FLVA 3ZKJC 4FJVB 1N3HA 2KMAA 1UBIA 2MBBB 4FBJB 2KO3A 4WAAA 4B6HA 3DVNV 4W9EA 3GYPA 4DHZE 4DHJD 1Q67A 2D9YA 4K2PA 4PQ0A 4MJSB 1NU2A 5C5BA 3CSFA 3S2AA 1QC6A 4CYEA 4IAPA 1X05A 1UNRA 3WAPA 4GMVA 4EKUA 2BWFA 4PS8A 1XODA 2UWQA 1V5TA 1WJ4A 4GZUA 1LQBA 2DZJA 2YS1A 1VD2A 2CR5A 1GGOA 5HKHA 3A1QB 2VSZA 4DBBA 1WF9A 4CHKA 3FSSA 2KDEB 2LGDA 4NJ6A 3JSVB 3VUXA 2P0HA 1EGXA 2LXCA 1V88A 3ZNHB 3AU4A 3RYTA 2Q13A 3ODWA 3ZTDA 1WH3A 2PEAA 1GUAB 2LGYA 3VTUA 3VTWA 2HE7A 4KV2A 4MY6A 5D94A 2FDQA 3LJUX 5KCVA 1OTRB 2JP2A 2DHKA 2K6QA 2GS0A 5C79A 4LJOB 5KHOA 5JHHA 3O65B 5CX3A 3N32A 4EEWA 3QWZB 4EUTA 3ALBA 1WJUA 2M1MA 2G4SA 4K7SA 3H7PB 4TKNA 4NJ7A 1MKEA 2E2XA 4GDKA 2YT1A 5JHBA 4K7UA 1FGZA 2J0JA 3HHMA 4MELA 1VCBA 2O2VA 1V89A 2KHWB 2IO2B 4JK9A 2P0FA 3SU8X 3HM6X 1CMXB 2KFKB 2NPTB 4K1RB 2R2QA 2WDTB 2MBHA 2D9WA 4JGHB 3DXDA 4B9KA 1LXDA 3PSCA 3W1YA 4BKSA 1WXSA 5CHFA 2MSED 4A6FA 3IBEA 3L16A 2CB8A 1MAIA 5DPTA 4PYZA 4W9IA 3AJ4A 3MJWA 2V3SA 2ROVA 3UGBB 3DQVA 4IW0A 4GMXB 4XZ4A 1GC6A 2O6VA 4W9KA 4YL8A 4WWPA 4II3B 3PRZA 4JQWC 3ZDMC 4DBGA 3Q3FA 1BTKA 4A6KA 4MSMB 3QA8A 2IBIB 5D7GA 3QK0A 2LJ5A 3A9JA 2DYQA 1IRSA 3KUZA 3R3MA 1E8YA 2COCA 3DXCA 3L08A 2L1CA 2KC2A 4HPLB 3SV1A 4A20A 4GU2A 1ACAA 3TVVA 3VVWB 2MA9B 4HB3B 2KTFA 1FHOA 3E9LA 2A5UA 1D3ZA 2DYBA 2XBBC 4EFOA 2DYNA 1M94A 3ZIMA 3VOQA 4ICVA 1MG8A 4DWFA 3UIPB 2DTCA 2WX1A 4A3PA 5CTRC 2YSZA 2D4QA 2DX5B 3M62B 2ASQA 3B0AA 4FA6A 1WGYA 2DHJA 2DYOA 4NNJB 5IAAC 3KSYA 4WVFB 4MGYE 5JHGA 3B08A 4AWJA 4FLHA 1W1HA 1P98A 2KDBA 2NBVB 1ZVRA 4HAXB 2AL6A 2OQBA 2GBRA 1WR6E 4GSWA 1V61A 2COFA 2D9XA 3WANA 2DHZA 1KLVA 1MK9B 4N9F4 5GOWB 1WXAA 1JDEA 1V5MA 2FIDA 3HQCA 4DDGD 3UF8A 3PT2B 1DROA 3SD5A 1WX9A 1WMHB 2KUPA 2BKRB 3B1LX 3EHVA 2W2WA 3ZRFA 2LWPA 2CY5A 1BAKA 1RFAA 2XQNM 4IWQA 3ZW3A 2CHWA 2LZ6A 3MPXA 1FOEA 2KWCA 1BWNA 2YF0A 5J3QA 3O96A 4MDKE 2C60A 5CLQB 1LW3A 3VTVA 4DHJB 1UGMA 2MX2A 1NI2A 4KIKA 3R7RA 4RM9A 5BO4B 5AZHA 2ZZPB 3PLVA 1V6EA 2NBUA 3L17A 1HB6A 3TFMA 4OVUA 3PVUA 2LULA 4TYZA 3W1SA 2YT0A 5J3TA 2WX0A 4BBKA 4JKGA 1U27A 3CF6E 2ELBA 3JVZX 1GNUA 3M63B 5KQ4A 1GC7A 1P1AA 1WGUA 1K5DB 4IWOA 1AWEA 1WXMA 4GXBA 4G11A 1WE7A 4E71A 1GG3A 2PE9A 2D9VA 4ZRKA 1EUVB 3D8DA 4HAVB 4W9JA 4G0NB 4AOFA 2BYVE 3NZSA 2Z0QA 2JF5A 4MEMA 4DX90 3P7ZA 2BGFA 3PHWB 3SUZA 5C16A 2KTRB 1ISNA 1EVHA 1P0RA 3FP5A 4DK5A 2UZSA 4EZJA 1NTYA 2VRWB 2GJYA 2YRYA 4WQOB 2KX0A 2RPQA 2Z0OA 2G35A 1K5GB 1SE9A 1UD7A 3HK0A 4D0NB 2C9WB 2KXJA 5J18A 4F7HA 3UQAA 3K9OB 2I1KA 2UZRA 2DAJA 4HDOA 2J0KA 1UELA 2HTHB 2YVCA 2QHOA 1V5OA 2K1FA 2JVCA 2G3QB 3IFWB 4WWNA 4NSWA 3VFKA 2QKMA 2EJ8A 1U29A 4GN1A 4II2B 1P3RA 4F8CB 1E7UA 2M0XA 1UNQA 3VH3B 4LDTD 3PEGA 5D2MB 2FJ9A 2Y8FA 2CRFA 1OEYA 4KZCA 5J17A 2CY4A 4HAWB 4GDLB 2L2IA 4IFSA 3TIXA 4YONA 2HD5B 2LVPA 5E6NA 4BOSC 1V5UA 3TL5A 4A3OA 1YX5B 4JLCA 1BTNA 4HPMB 3KRWA 3ZRCA 1OEYJ 3QJZA 3AULA 3A8PA 2L0TA 2WH5A 3ML4A 1Z87A 4JKEA 1X1FA 3JYUA 2CU1A 2FCQA 5FI0A 3ZTCA 1KOTA 2KKCA 3VIAA 2ADZA 3QIJA 4PNKA 2ZJDA 3DBHI 1OQNA 3A8QA 2EMTA 3ECIA 3NZUA 2BWES 2KGXB 2AWTA 4K17A 1DDWA 1PQSA 3X0WA 2O6VB 4NAWA 4W9CA 3NY5A 3ZO5B 2L0FA 1WGDA 4HB2B 3X23A 1R4NI 1JRUA 2N1WA 3D32A 4WJPA 3DVGY 4W9FA 4GPTB 4G50A 3TO1A 1C1YB 4KDLB 1FHXA 3M95A 1QZEA 2NBWB 4PS7A 3WALA 2I5FA 4K7WA 4MGZE 1V81A 5JP4A 3APFA 2OOBB 3OJ4B 5JHAA 2DAFA 1I7AA 2NVUI 3ZNID 4IM0A 2KQSA 1FXTB 1V80A 5AZGA 3CXBB 1HE8A 1E8ZA 4JK7A 1MPHA 4E3CA 3N3KB 2Z59B 2KLCA 1WGGA 1RAXA 2W2XC 4FJYA 3UIOB 1U2BA 4J6IA 4ZRIA 2J59M 2D3GA 1NBFC 3MHSD 2N9EB 3FEHA 1ZC3B 4I6PA 2H7DA 3ZUNA 1OY2A 5D3YA 5L83A 5LXIB 4Y94A 4WJOA 3P2BA 4B95A 3AU5A 4ICUA 4LCDE 2C7NB 2VKIA 1EF1A 3U8ZA 3HW2B 2FNJB 3LJ3A 3ODOA 3KYCD 2Y7BA 1X86A 3EC8A 1WIAA 2D10A 1KI1B 2MP2B 3ENBA 4W9LA 4HWIB 2LRWA 2WWZA 3RT3B 3V5WA 2LUEA 2NCNA 2K8HA 3PV1A 4IC7B 4XC2A 2ZPNA 4F1SA 1L2NA 5HE3A 2ROZB 2G45B 2N4FA 1RRBA 5L81A 2KWUB 1SHCA 3L13A 2KK8A 1LM8B 3GYOA 2KLGA 3GOEA 3SHQA 5DPRA 5AZFA 1WY8A 3UZTA 2LVOA 2D07B 2OTXA 5G55A 3CMMB 4TQ0A 4H8SA 3CSTA 5E6OA 4W9DA 5CHVC 2M8SA 2LRUA 1A5RA 1L7YA 1P6SA 3I3TB 2KWVB 4JKGB 1FB8A 4WJ7A 2CQUA 4JKHA 5CLLB 4BKSD 2RSGA 4MJSA 3PSEB 4KHAA 4HATB 2V76A 2YS3A 3U7DA 2KOXA 1WVHA 1MK7B 2KJRA 4BBNC 2CS4A 3QX1A 4MK0A 1UZXB 4PS3A 2ZNVC 2ABDA 1TGZB 4WJNA 2EC1A 2O6VD 1NDDA 3A4SC 3QBVB 3U30A 4FHKA 2Z0PA 3A1QA 1TQZA 3VUWA 3PP2A 2GBJA 4BBNF 2KVRA 4ANUA 4LDTB 3SO6A 2IY1B 3JSVA 1WXVA 2KMCA 1M7RA 4BKTA 2IY0B 2KFJA 1I42A 4WSFA 1R4MI 2ZVNA 5JLJB 2IYDB 3RZWC 3VAWA 2ZCBA 2N9PC 1XD4A 4JKCA 1DIKA 1WM2A 3H1UA 4LJPB 2PPHA 2BF8B 1WFYA 3V60A 2Y8GA 5IJMA 1WGRA 3H7PA 1EAZA 4TV3A 4F7ZA 5LLIA 2RQ1A 1WJMA 1E90A 2W9NA 3UQBA 1AQCA 5CHWA 3QC8B 2NS5A 1TBEA 1H8CA 2LASA 4ASWC 2KFKA 2NPTA 2H7EA 2FJLA 3H9DA 4IOYX 2OJRA 2K2JA 2PZ1A 1BT0A 1W1DA 5DPWA 2CKHB 2C5LC 1Q0WB 3T06A 2YLMA 2AYOB 4JKDA 2DFKA 2XK5B 3W1SC 1OMWA 3A9KB 1EO6A 1TZ1A 4NPNA 4KVGB 4KSLC 1X11A 2CHXA 3VHTC 2PJHA 2UVMA 5DH9B 2WYQA 4Z2NA 3HIZA 2DYMA 4NQKE 1ST7A 4P7IA 1VBGA 3NOBA 2GMIC 2KNBA 2MWNB 3WYFB 2MLBA 5DHFB 1OGWA 2MCNB 4AJWA 5D27A 1F9JA 4A5KA 2AL3A 4GB9A 2LGXA 2A4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S B;  4HAY B;  4AUQ C;  4KSK C;  4MSQ B;  3Q3J A;  2EMS A;  4GIV A;  4DDI D;  4URK A;  1WJ1 A;  1ZGU B;  2KJ6 A;  4EOY A;  2FCN A;  2JPH A;  1XD3 B;  3PS6 A;  1WJN A;  2X18 A;  2IO0 B;  5C5B B;  2VRR B;  1S1Q B;  3K9P B;  1V49 A;  4C0A A;  3VH4 B;  2BPS A;  1XCG A;  3JW0 X;  2DX5 A;  1AAR A;  1XT9 B;  1V2Y A;  3NHE B;  1SGH A;  2Z0D B;  5E6P A;  1C3T A;  2YS5 A;  2FAZ A;  2Y5B B;  5AEK B;  2MFQ A;  2DZI A;  4HAU B;  3T9L A;  2ZCC A;  2IO1 B;  4HDQ A;  3P6A A;  4FN2 A;  2JWZ A;  3IHP C;  3PRP B;  4HHV A;  2N9X A;  4BKG A;  2G4D B;  4E74 A;  2NMB A;  1WR1 A;  2COA A;  3EEC A;  3R66 C;  4A6H A;  5JZE B;  2KZR A;  2MKR A;  1E8W A;  1X1G A;  2RLO A;  2EKE C;  1Y5O A;  2D2Q A;  1KZ7 A;  2HRJ A;  1UPQ A;  1J8C A;  3BIN A;  1Q5W B;  1DYN A;  2LYD A;  2ZPY A;  1ZSQ A;  3M1I B;  4WJQ A;  3WA0 A;  2M17 A;  3PG7 A;  1WMH A;  3EPY A;  1E8X A;  1H4R A;  2RGN B;  1FHW A;  4HLE A;  4GDK B;  4ANX A;  3KUD B;  3ZNZ B;  1DDM A;  2IFS A;  2FCM A;  1XX0 A;  4I6L B;  3PRM B;  2O2V B;  1J0G A;  2ZVO A;  1U5D A;  4NQL B;  2JY6 A;  5EDS A;  5IA7 A;  2N23 A;  3L54 A;  4K2O A;  3ZVR A;  3KYD D;  2V4L A;  5L95 C;  2JRH A;  3D8F A;  2DKQ A;  4A6F B;  2MQJ A;  1IPG A;  3VXW A;  5EFX A;  5KQ1 A;  3RZF A;  3NS8 A;  3KZ1 A;  1U5F A;  3PVW A;  3QHT A;  3DVN U;  2L05 A;  4AP4 C;  2JT4 B;  4BFR A;  3ULB A;  1WI1 A;  1WE6 A;  1S3S G;  1LB1 A;  3A9J B;  2IYB A;  3OJ3 A;  4F7G A;  3RUI B;  3APD A;  2MRP A;  1Y19 B;  2KCJ A;  2LD9 A;  1MIZ B;  1UBQ A;  1XR0 B;  1EF5 A;  1J0W A;  1TXD A;  1U5E A;  2UYZ B;  2KD0 A;  3GZN I;  1V86 A;  2DN6 A;  3PLU A;  2R2O A;  3HM3 A;  2KJH B;  2RGF A;  3V6E B;  4RM8 A;  3A33 B;  2KTR A;  3PGE A;  2K8B A;  2CHZ A;  2N0Y A;  5G2N A;  4TUU A;  2DHI A;  5DI9 B;  3IVF A;  5HE1 A;  4HAZ B;  2LVQ A;  3V6C B;  2ZNV B;  3KY9 A;  2J7Q B;  4OVV A;  1V9J A;  1TTN A;  1UNP A;  3H7S A;  2IO3 B;  2KDF B;  2L3Z A;  2REX A;  2I5C A;  3N7C A;  1NTV A;  1WJ6 A;  1K8R B;  2JZZ A;  3D8E A;  2HTH A;  4JL9 A;  1YIW A;  5GMV A;  3QCA A;  1KZG A;  5J2R A;  2RSU A;  1T0Y A;  4JIO U;  4MT7 A;  3QAQ A;  4KAX B;  3FM8 C;  3QWM A;  2GCL A;  4IM2 A;  2DEN B;  2RVB B;  2DA0 A;  2HJ8 A;  2M4N A;  5D3X A;  4GDL A;  5C6R A;  2MBQ A;  5D3W A;  4KZ0 A;  2BKF A;  4EZK A;  1WZ3 A;  2K8C A;  1I2H A;  2C7H A;  1MIX A;  2NR2 A;  1PFJ A;  4EZL A;  2LXA A;  1WX8 A;  1Y8R C;  3BJI A;  1WZ0 A;  4MGK E;  3L10 B;  4B6W A;  1UPR A;  2GCJ A;  1YJ1 A;  3VDZ A;  2W2X D;  2P8V A;  4HB4 B;  3R7Q A;  1Z2M A;  3MTN B;  4BVU C;  5HE0 A;  3KVF B;  3DDC B;  1QQG A;  1ZW7 A;  5LXH A;  1Q1O A;  4XX5 A;  2L8J A;  4KIK B;  2PE6 B;  2RNR B;  3SDL C;  4BOZ B;  1P9D U;  4HB0 B;  3RCZ A;  1X1M A;  5JH5 C;  2FCS A;  2LG1 A;  2FUH B;  2GOW A;  1ZC4 B;  3APC A;  3N30 A;  4ZYN A;  1PLS A;  2L00 B;  4IUM B;  4PYU A;  5DCN A;  4K81 A;  2R0D A;  2K25 A;  5HE2 A;  2P0D A;  1I35 A;  2LBB A;  1WGQ A;  3RCP A;  4M8N A;  4EMO A;  1SIF A;  3LDZ E;  4CHJ A;  2R09 A;  1ZM0 A;  2J0M A;  2CAY A;  2DX1 A;  4IG7 B;  4M0W B;  4F7U P;  3V61 A;  4HXD A;  1NVL A;  4G3X B;  2LKO A;  3TMP B;  4ANW A;  2RD0 A;  1WYW B;  5LOP B;  4MGI E;  2MDX A;  3ZLZ A;  2D11 A;  1XKE A;  2BYE A;  2MW5 A;  2N1V A;  3QAR A;  1XQQ A;  2RUK B;  3TJP A;  4AJY B;  3DCG A;  4WWO A;  1G6J A;  2M14 A;  1DBH A;  1YD8 U;  3KRX A;  2K39 A;  1HBK A;  2BCJ A;  2LOZ A;  2MP2 A;  4ANV A;  2JZ3 B;  5DIF B;  3WAO A;  4HJK A;  2GBM A;  3NSU A;  3CIK A;  1WGH A;  2K00 A;  3M3J A;  3TW1 A;  1YQB A;  1H10 A;  2I1J A;  2K6D B;  2LI5 A;  1KM7 A;  4MH0 E;  1WM3 A;  1U5G A;  4HCP B;  5DPS A;  3V62 A;  3ONS A;  2QKL A;  4FJZ A;  3H6N A;  1V5P A;  2KQ7 A;  2GBN A;  4DHZ B;  2KN5 A;  1FGY A;  3ML9 A;  1UEF A;  3DVG X;  3ENE A;  3OLM D;  4CO7 A;  2DLW A;  4HK2 A;  1RLF A;  2C7M B;  4I6N B;  3ZNG C;  4ZDV A;  3DBS A;  5D6J B;  1WRD B;  2K2U A;  2MWS B;  5KHQ A;  3PRE A;  3WAM A;  1IYF A;  5LON B;  3L0W B;  4NAW B;  3EFU A;  4HCN B;  5TR5 A;  3TBL D;  1E5W A;  2NZ8 B;  3F0W A;  3WIM A;  2FIF A;  4DX8 A;  2KAN A;  1ZKH A;  2KC1 A;  3KW5 B;  3OAW A;  3DBL I;  5J3Y A;  5DHA B;  1WX7 A;  3ZDT A;  2KDI A;  4DXA B;  2D9Z A;  2XEW A;  1TJ6 A;  3DOW A;  4CHM A;  3C0R B;  2KX3 A;  4M8M A;  3ZVV A;  5C1Z A;  3SNH A;  2AEH A;  5C23 A;  4NY0 A;  2COD A;  4FAD A;  4X57 B;  4RMA A;  2ELA A;  3PZD A;  5FI1 A;  5D3V A;  3BY4 B;  3SYX A;  2B3A A;  3AI5 A;  2MBE A;  1PMS A;  4XWX A;  2COP A;  4IWP A;  4IM3 A;  4Z2M B;  3AXC A;  4KHO A;  1WG7 A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  1RRP B;  2L7R A;  2Z0E B;  3PHX B;  3QQ8 B;  1KJT A;  3ULC A;  3F5R A;  3DBR I;  1P3Q U;  2IZV B;  4GGQ A;  3PVL A;  1P5T A;  1M7E A;  2JRI B;  4FHJ A;  4W9G A;  2V1Y A;  3RD2 A;  1LFD A;  4W9H A;  4FUL A;  3TCA A;  2DZM A;  2M38 A;  2MBO A;  3PPA A;  4KDI C;  2RR9 A;  3A4R A;  3A98 B;  4KHB B;  3VUY A;  4HVB A;  2DKP A;  4ZRJ A;  3DXE A;  3DPD A;  1FAO A;  1B55 A;  3T8M A;  3KH0 A;  1DDV A;  1YX6 B;  4L6E A;  5FR6 A;  4MM3 A;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  3MDB C;  3IG3 A;  2N7E A;  4GOC A;  1WI0 A;  3RUL A;  3VQI A;  2GBK A;  3UIN B;  1IP9 A;  4TQ1 A;  4EJN A;  2JUO A;  1U4A A;  3ODX A;  1E7V A;  3KUC B;  2LOX A;  1HB8 A;  1OQY A;  2JXX A;  1NTI A;  1RJ2 A;  1W1G A;  2ZEQ A;  3ML8 A;  3G9W A;  2BYF A;  3PTF C;  3OAN A;  3FLV A;  3ZKJ C;  4FJV B;  1N3H A;  2KMA A;  1UBI A;  2MBB B;  4FBJ B;  2KO3 A;  4WAA A;  4B6H A;  3DVN V;  4W9E A;  3GYP A;  4DHZ E;  4DHJ D;  1Q67 A;  2D9Y A;  4K2P A;  4PQ0 A;  4MJS B;  1NU2 A;  5C5B A;  3CSF A;  3S2A A;  1QC6 A;  4CYE A;  4IAP A;  1X05 A;  1UNR A;  3WAP A;  4GMV A;  4EKU A;  2BWF A;  4PS8 A;  1XOD A;  2UWQ A;  1V5T A;  1WJ4 A;  4GZU A;  1LQB A;  2DZJ A;  2YS1 A;  1VD2 A;  2CR5 A;  5HKH A;  3A1Q B;  2VSZ A;  4DBB A;  1WF9 A;  4CHK A;  3FSS A;  2KDE B;  2LGD A;  4NJ6 A;  3JSV B;  3VUX A;  2P0H A;  1EGX A;  2LXC A;  1V88 A;  3ZNH B;  3AU4 A;  3RYT A;  2Q13 A;  3ODW A;  3ZTD A;  1WH3 A;  2PEA A;  1GUA B;  2LGY A;  3VTU A;  3VTW A;  2HE7 A;  4KV2 A;  4MY6 A;  5D94 A;  2FDQ A;  3LJU X;  5KCV A;  1OTR B;  2JP2 A;  2DHK A;  2K6Q A;  2GS0 A;  5C79 A;  4LJO B;  5KHO A;  5JHH A;  3O65 B;  5CX3 A;  3N32 A;  4EEW A;  3QWZ B;  4EUT A;  3ALB A;  1WJU A;  2M1M A;  2G4S A;  4K7S A;  3H7P B;  4TKN A;  4NJ7 A;  1MKE A;  2E2X A;  4GDK A;  2YT1 A;  5JHB A;  4K7U A;  1FGZ A;  2J0J A;  3HHM A;  4MEL A;  1VCB A;  2O2V A;  1V89 A;  2KHW B;  2IO2 B;  2P0F A;  3SU8 X;  3HM6 X;  1CMX B;  2KFK B;  2NPT B;  4K1R B;  2R2Q A;  2WDT B;  2MBH A;  2D9W A;  4JGH B;  3DXD A;  4B9K A;  1LXD A;  3PSC A;  3W1Y A;  4BKS A;  1WXS A;  5CHF A;  2MSE D;  4A6F A;  3IBE A;  3L16 A;  2CB8 A;  1MAI A;  5DPT A;  4PYZ A;  4W9I A;  3AJ4 A;  3MJW A;  2V3S A;  2ROV A;  3UGB B;  3DQV A;  4IW0 A;  4GMX B;  4XZ4 A;  1GC6 A;  2O6V A;  4W9K A;  4YL8 A;  4WWP A;  4II3 B;  3PRZ A;  4JQW C;  3ZDM C;  4DBG A;  3Q3F A;  1BTK A;  4A6K A;  4MSM B;  3QA8 A;  2IBI B;  5D7G A;  3QK0 A;  2LJ5 A;  3A9J A;  2DYQ A;  1IRS A;  3KUZ A;  3R3M A;  1E8Y A;  2COC A;  3DXC A;  3L08 A;  2L1C A;  2KC2 A;  4HPL B;  3SV1 A;  4A20 A;  4GU2 A;  1ACA A;  3TVV A;  3VVW B;  2MA9 B;  4HB3 B;  2KTF A;  1FHO A;  2A5U A;  1D3Z A;  2DYB A;  2XBB C;  4EFO A;  2DYN A;  1M94 A;  3ZIM A;  3VOQ A;  4ICV A;  1MG8 A;  4DWF A;  3UIP B;  2DTC A;  2WX1 A;  4A3P A;  5CTR C;  2YSZ A;  2D4Q A;  2DX5 B;  3M62 B;  2ASQ A;  3B0A A;  4FA6 A;  1WGY A;  2DHJ A;  2DYO A;  4NNJ B;  5IAA C;  3KSY A;  4WVF B;  4MGY E;  5JHG A;  3B08 A;  4AWJ A;  4FLH A;  1W1H A;  1P98 A;  2KDB A;  2NBV B;  1ZVR A;  4HAX B;  2AL6 A;  2OQB A;  2GBR A;  1WR6 E;  4GSW A;  1V61 A;  2COF A;  2D9X A;  3WAN A;  2DHZ A;  1KLV A;  1MK9 B;  4N9F 4;  5GOW B;  1WXA A;  1V5M A;  2FID A;  3HQC A;  4DDG D;  3UF8 A;  3PT2 B;  1DRO A;  3SD5 A;  1WX9 A;  1WMH B;  2KUP A;  2BKR B;  3B1L X;  3EHV A;  2W2W A;  3ZRF A;  2LWP A;  2CY5 A;  1BAK A;  1RFA A;  2XQN M;  4IWQ A;  3ZW3 A;  2CHW A;  2LZ6 A;  3MPX A;  1FOE A;  2KWC A;  1BWN A;  2YF0 A;  5J3Q A;  3O96 A;  4MDK E;  2C60 A;  5CLQ B;  1LW3 A;  3VTV A;  4DHJ B;  1UGM A;  2MX2 A;  1NI2 A;  4KIK A;  3R7R A;  4RM9 A;  5BO4 B;  5AZH A;  2ZZP B;  3PLV A;  1V6E A;  2NBU A;  3L17 A;  1HB6 A;  3TFM A;  4OVU A;  3PVU A;  2LUL A;  4TYZ A;  3W1S A;  2YT0 A;  5J3T A;  2WX0 A;  4BBK A;  1U27 A;  3CF6 E;  2ELB A;  3JVZ X;  1GNU A;  3M63 B;  5KQ4 A;  1GC7 A;  1P1A A;  1WGU A;  1K5D B;  4IWO A;  1AWE A;  1WXM A;  4GXB A;  4G11 A;  1WE7 A;  4E71 A;  1GG3 A;  2PE9 A;  2D9V A;  4ZRK A;  1EUV B;  3D8D A;  4HAV B;  4W9J A;  4G0N B;  4AOF A;  2BYV E;  3NZS A;  2Z0Q A;  2JF5 A;  4MEM A;  4DX9 0;  3P7Z A;  2BGF A;  3PHW B;  3SUZ A;  5C16 A;  2KTR B;  1ISN A;  1EVH A;  1P0R A;  3FP5 A;  4DK5 A;  2UZS A;  4EZJ A;  1NTY A;  2VRW B;  2GJY A;  2YRY A;  4WQO B;  2KX0 A;  2RPQ A;  2Z0O A;  2G35 A;  1K5G B;  1SE9 A;  1UD7 A;  3HK0 A;  4D0N B;  2C9W B;  2KXJ A;  5J18 A;  4F7H A;  3UQA A;  3K9O B;  2I1K A;  2UZR A;  2DAJ A;  4HDO A;  2J0K A;  1UEL A;  2HTH B;  2YVC A;  2QHO A;  1V5O A;  2K1F A;  2JVC A;  2G3Q B;  3IFW B;  4WWN A;  4NSW A;  3VFK A;  2QKM A;  2EJ8 A;  1U29 A;  4GN1 A;  4II2 B;  1P3R A;  4F8C B;  1E7U A;  2M0X A;  1UNQ A;  3VH3 B;  4LDT D;  3PEG A;  5D2M B;  2FJ9 A;  2Y8F A;  2CRF A;  1OEY A;  4KZC A;  5J17 A;  2CY4 A;  4HAW B;  4GDL B;  2L2I A;  4IFS A;  3TIX A;  4YON A;  2HD5 B;  2LVP A;  5E6N A;  4BOS C;  1V5U A;  3TL5 A;  4A3O A;  1YX5 B;  4JLC A;  1BTN A;  4HPM B;  3KRW A;  3ZRC A;  1OEY J;  3QJZ A;  3AUL A;  3A8P A;  2L0T A;  2WH5 A;  3ML4 A;  1Z87 A;  1X1F A;  3JYU A;  2CU1 A;  2FCQ A;  5FI0 A;  3ZTC A;  1KOT A;  2KKC A;  3VIA A;  2ADZ A;  3QIJ A;  4PNK A;  2ZJD A;  3DBH I;  1OQN A;  3A8Q A;  2EMT A;  3ECI A;  3NZU A;  2BWE S;  2KGX B;  2AWT A;  4K17 A;  1DDW A;  1PQS A;  3X0W A;  2O6V B;  4NAW A;  4W9C A;  3NY5 A;  3ZO5 B;  2L0F A;  1WGD A;  4HB2 B;  3X23 A;  1R4N I;  1JRU A;  2N1W A;  3D32 A;  4WJP A;  3DVG Y;  4W9F A;  4GPT B;  4G50 A;  3TO1 A;  1C1Y B;  4KDL B;  1FHX A;  3M95 A;  1QZE A;  2NBW B;  4PS7 A;  3WAL A;  2I5F A;  4K7W A;  4MGZ E;  1V81 A;  5JP4 A;  3APF A;  2OOB B;  3OJ4 B;  5JHA A;  2DAF A;  1I7A A;  2NVU I;  3ZNI D;  4IM0 A;  2KQS A;  1FXT B;  1V80 A;  5AZG A;  3CXB B;  1HE8 A;  1E8Z A;  1MPH A;  4E3C A;  3N3K B;  2Z59 B;  2KLC A;  1WGG A;  1RAX A;  2W2X C;  4FJY A;  3UIO B;  1U2B A;  4J6I A;  4ZRI A;  2J59 M;  2D3G A;  1NBF C;  3MHS D;  2N9E B;  3FEH A;  1ZC3 B;  4I6P A;  2H7D A;  3ZUN A;  1OY2 A;  5D3Y A;  5L83 A;  5LXI B;  4Y94 A;  4WJO A;  3P2B A;  4B95 A;  3AU5 A;  4ICU A;  4LCD E;  2C7N B;  2VKI A;  1EF1 A;  3U8Z A;  3HW2 B;  2FNJ B;  3LJ3 A;  3ODO A;  3KYC D;  2Y7B A;  1X86 A;  3EC8 A;  1WIA A;  2D10 A;  1KI1 B;  2MP2 B;  4W9L A;  4HWI B;  2LRW A;  2WWZ A;  3RT3 B;  3V5W A;  2LUE A;  2NCN A;  2K8H A;  3PV1 A;  4IC7 B;  4XC2 A;  2ZPN A;  4F1S A;  1L2N A;  5HE3 A;  2ROZ B;  2G45 B;  2N4F A;  1RRB A;  5L81 A;  2KWU B;  1SHC A;  3L13 A;  2KK8 A;  1LM8 B;  3GYO A;  2KLG A;  3GOE A;  3SHQ A;  5DPR A;  5AZF A;  1WY8 A;  3UZT A;  2LVO A;  2D07 B;  2OTX A;  5G55 A;  3CMM B;  4TQ0 A;  4H8S A;  3CST A;  5E6O A;  4W9D A;  5CHV C;  2M8S A;  2LRU A;  1A5R A;  1L7Y A;  1P6S A;  3I3T B;  2KWV B;  1FB8 A;  4WJ7 A;  2CQU A;  5CLL B;  4BKS D;  2RSG A;  4MJS A;  3PSE B;  4KHA A;  4HAT B;  2V76 A;  2YS3 A;  3U7D A;  2KOX A;  1WVH A;  1MK7 B;  2KJR A;  4BBN C;  2CS4 A;  3QX1 A;  4MK0 A;  1UZX B;  4PS3 A;  2ZNV C;  2ABD A;  1TGZ B;  4WJN A;  2EC1 A;  2O6V D;  1NDD A;  3A4S C;  3QBV B;  3U30 A;  4FHK A;  2Z0P A;  3A1Q A;  1TQZ A;  3VUW A;  3PP2 A;  2GBJ A;  4BBN F;  2KVR A;  4ANU A;  4LDT B;  3SO6 A;  2IY1 B;  3JSV A;  1WXV A;  2KMC A;  1M7R A;  4BKT A;  2IY0 B;  2KFJ A;  1I42 A;  4WSF A;  1R4M I;  2ZVN A;  5JLJ B;  2IYD B;  3RZW C;  3VAW A;  2ZCB A;  2N9P C;  1XD4 A;  1WM2 A;  3H1U A;  4LJP B;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  2Y8G A;  5IJM A;  1WGR A;  3H7P A;  1EAZ A;  4TV3 A;  4F7Z A;  5LLI A;  2RQ1 A;  1WJM A;  1E90 A;  2W9N A;  3UQB A;  1AQC A;  5CHW A;  3QC8 B;  2NS5 A;  1TBE A;  1H8C A;  2LAS A;  4ASW C;  2KFK A;  2NPT A;  2H7E A;  2FJL A;  3H9D A;  4IOY X;  2OJR A;  2K2J A;  2PZ1 A;  1BT0 A;  1W1D A;  5DPW A;  2CKH B;  2C5L C;  1Q0W B;  3T06 A;  2YLM A;  2AYO B;  2DFK A;  2XK5 B;  3W1S C;  1OMW A;  3A9K B;  1EO6 A;  1TZ1 A;  4NPN A;  4KVG B;  4KSL C;  1X11 A;  2CHX A;  3VHT C;  2PJH A;  2UVM A;  5DH9 B;  2WYQ A;  4Z2N A;  3HIZ A;  2DYM A;  4NQK E;  1ST7 A;  4P7I A;  3NOB A;  2GMI C;  2KNB A;  2MWN B;  3WYF B;  2MLB A;  5DHF B;  1OGW A;  2MCN B;  4AJW A;  5D27 A;  1F9J A;  4A5K A;  2AL3 A;  4GB9 A;  2LGX A;  2A4Z A; 
#chains in the Genus database with same CATH topology
 1Z5S B;  4HAY B;  3NVW A;  4AUQ C;  4KSK C;  4MSQ B;  2OJW A;  2K8E A;  3Q3J A;  2EMS A;  2L1A A;  4KX6 B;  2R82 A;  4GIV A;  4DDI D;  3RNG C;  4URK A;  1WJ1 A;  1ZGU B;  2KJ6 A;  4EOY A;  2FCN A;  1K53 A;  1SSN A;  2JPH A;  1XD3 B;  3PS6 A;  1WJN A;  1WYG A;  2X18 A;  2IO0 B;  5IKC M;  3I63 C;  5C5B B;  2PTL A;  2VRR B;  1MHH E;  1PDX A;  1S1Q B;  3K9P B;  1V49 A;  4C0A A;  2L52 A;  3VH4 B;  1K52 A;  1N5X A;  3P4Q B;  1CK1 A;  2BPS A;  1XCG A;  3JW0 X;  3AEE B;  2DX5 A;  1AAR A;  1XT9 B;  1TS5 A;  1V2Y A;  1Y56 A;  2LGI A;  3NUH B;  3NHE B;  1SGH A;  2Z0D B;  5E6P A;  1C3T A;  2YS5 A;  2FAZ A;  2Y5B B;  5AEK B;  4LNN A;  2MFQ A;  2DZI A;  4HAU B;  3T9L A;  2ZCC A;  5BMG A;  2IO1 B;  4BZA A;  1JRP A;  4HDQ A;  5FR3 A;  3P6A A;  1F1H A;  1C4P A;  3Q3N C;  4FN2 A;  2JWZ A;  3IT6 B;  1RM6 C;  3IHP C;  3PRP B;  4HHV A;  4YTP B;  2N9X A;  4BKG A;  2G4D B;  2NBV A;  4E74 A;  2NMB A;  1WR1 A;  2COA A;  4WIP A;  4AS1 A;  3EEC A;  3R66 C;  1ET6 A;  4A6H A;  5JZE B;  2KZR A;  2MKR A;  3BYT B;  1E8W A;  1OFF A;  1X1G A;  2RLO A;  2FBW B;  2EKE C;  1DGJ A;  3ZXR A;  1F2R C;  1KF6 B;  1Y5O A;  1MHX A;  2D2Q A;  1KZ7 A;  1SIJ A;  3ZXV A;  2HRJ A;  1UPQ A;  1J8C A;  3BIN A;  1Q5W B;  1V1O A;  1FM0 D;  1DYN A;  4JKB A;  2LYD A;  2ZPY A;  1ZSQ A;  3M1I B;  4WJQ A;  3WA0 A;  2M17 A;  2K49 A;  3PG7 A;  1WMH A;  3EPY A;  1N62 A;  1I4Q A;  1E8X A;  3IAM 1;  2UU7 A;  1TYG B;  5AUI A;  1H4R A;  5H8Y E;  2RGN B;  1FHW A;  1AW7 A;  1EWY C;  3OG5 A;  4HLE A;  1ZYI A;  4GDK B;  2D3A A;  4ANX A;  3KUD B;  3ZNZ B;  1DDM A;  1EU4 A;  3NZ3 A;  2IFS A;  5AUK A;  2FCM A;  1XX0 A;  4I6L B;  3PRM B;  2O2V B;  3FIL B;  1J0G A;  3SBT A;  5EE0 A;  2ZVO A;  1JML A;  1U5D A;  4USA A;  1B1Z A;  5D3D A;  4NQL B;  2JY6 A;  5EDS A;  1VBH A;  5IA7 A;  2N23 A;  3L54 A;  4K2O A;  3ZVR A;  3KYD D;  2RPV A;  2V4L A;  5L95 C;  2JRH A;  3Q3O C;  3D8F A;  2DKQ A;  4A6F B;  3TUO A;  2MQJ A;  1IPG A;  3VXW A;  2PVO D;  4DIX A;  3BVG A;  5EFX A;  3VR9 B;  5KQ1 A;  3RZF A;  3NS8 A;  3ZJU A;  4RFB A;  3KZ1 A;  1KBL A;  1U5F A;  1ET9 A;  2WXH A;  3PVW A;  3QHT A;  2ZKM X;  3DVN U;  5JXV A;  2L05 A;  2VZK D;  3IXS A;  2AQ3 B;  2SEB D;  4AP4 C;  1HXY D;  2JT4 B;  1JCK B;  4BFR A;  3ULB A;  1WI1 A;  1WE6 A;  1S3S G;  3WCQ A;  3ZJV A;  1WWT A;  4L23 A;  1KC7 A;  1LB1 A;  3A9J B;  1TS4 A;  1A70 A;  2IYB A;  1I4X A;  1FRR A;  3FVC A;  3OJ3 A;  4F7G A;  3RUI B;  4JK8 A;  3APD A;  2J4X A;  1E7P B;  2MRP A;  1Y19 B;  2WXQ A;  2KCJ A;  2LD9 A;  1V1P B;  1MIZ B;  1UBQ A;  1XR0 B;  1EF5 A;  1WRI A;  1J0W A;  4C00 A;  1TXD A;  1U5E A;  2UYZ B;  4YSY B;  2KD0 A;  3P4R B;  3AN1 A;  3GZN I;  1V86 A;  2DN6 A;  3ZYY X;  5EE9 A;  2YT2 A;  3PLU A;  1TY0 A;  2R2O A;  3HM3 A;  2KJH B;  1FO4 A;  3L4P A;  2RGF A;  3V6E B;  4RM8 A;  2N9K A;  3A33 B;  2KTR A;  3PGE A;  4JWS C;  2K8B A;  2CHZ A;  2N0Y A;  5G2N A;  1ZE3 D;  4TUU A;  4P6V F;  4C4V B;  2K22 A;  2DHI A;  1JWB D;  5DI9 B;  3IVF A;  5HE1 A;  4HAZ B;  2LVQ A;  1TS2 A;  3V6C B;  1D5M C;  2ZNV B;  3KY9 A;  2J7Q B;  2QDF A;  3LXF A;  4OVV A;  2KYW A;  1I4G A;  2JSV X;  1FCC C;  2JU6 X;  1V9J A;  1TTN A;  4LLG M;  1UNP A;  3H7S A;  4JKF A;  2IO3 B;  3R2I A;  1NEN B;  2KDF B;  2L3Z A;  2REX A;  5BMI A;  2I5C A;  3N7C A;  1NTV A;  1WJ6 A;  1K8R B;  2JZZ A;  3D8E A;  4QJ4 B;  2HTH A;  4JL9 A;  4UDU C;  2ON8 A;  2BB6 A;  1YIW A;  5E6J A;  2LMC A;  5GMV A;  1HTO A;  3QCA A;  1KZG A;  5J2R A;  2RSU A;  1T0Y A;  2OED A;  4JIO U;  4MT7 A;  1FNU A;  2RRF A;  3Q3M C;  3QAQ A;  4KAX B;  3FM8 C;  3QWM A;  2WXR A;  2WXL A;  2GCL A;  1B9R A;  4IM2 A;  1TKY A;  2DEN B;  2RVB B;  3N20 C;  5C2T B;  1YJI A;  3I5J C;  2DA0 A;  3KLS X;  2HJ8 A;  2M4N A;  5D3X A;  2QCZ A;  2Z14 A;  4GDL A;  2W3S A;  5C6R A;  2MBQ A;  3Q8C A;  5D3W A;  4KZ0 A;  2BKF A;  4EZK A;  1WZ3 A;  2K8C A;  1I2H A;  1FNV A;  1FEH A;  2C7H A;  1MIX A;  2NR2 A;  1PFJ A;  4EZL A;  2LXA A;  4OZB A;  1WX8 A;  1Y8R C;  4MT5 A;  3BJI A;  2FE8 A;  1WZ0 A;  4MGK E;  3L10 B;  1F52 A;  4B6W A;  1UPR A;  2GCJ A;  1YJ1 A;  3VDZ A;  2IJ0 A;  2W2X D;  2P8V A;  4HB4 B;  4DXF A;  1XCQ L;  4WH4 A;  3R7Q A;  1Z2M A;  3MTN B;  4BVU C;  5HE0 A;  3KVF B;  3DDC B;  4IOI E;  1QQG A;  1ZW7 A;  5LXH A;  4ZYS A;  1HZ6 A;  1I4H A;  1Q1O A;  3HVD A;  5EE1 A;  5IP4 D;  4XX5 A;  4DXG A;  2L8J A;  4KIK B;  2PE6 B;  1L0V B;  2RNR B;  1ZPS A;  3SDL C;  4ITK A;  4BOZ B;  1SXT A;  1P9D U;  3ZQ4 A;  4HB0 B;  1TIF A;  2ONQ A;  3RCZ A;  1MJD A;  1X1M A;  4L2Y A;  5JH5 C;  2FCS A;  2LG1 A;  3MJ5 A;  2WLB A;  2FUH B;  2GOW A;  1ZC4 B;  2QEJ C;  2W55 A;  3APC A;  3N30 A;  4ZYN A;  1PLS A;  2K5P A;  2L00 B;  4IUM B;  4ARI A;  4PYU A;  2MEK A;  1ROE A;  2H88 B;  2E3T A;  1L4D B;  2QSD A;  5DCN A;  4K81 A;  2R0D A;  3EGR A;  4HSI A;  2K25 A;  3E66 A;  5HE2 A;  2P0D A;  1TY2 A;  5BYQ A;  3AE7 B;  1I35 A;  2LBB A;  3CIR B;  5HFY A;  1WGQ A;  3RCP A;  4M8N A;  2RMM A;  4EMO A;  1SIF A;  3NWF A;  3LDZ E;  1UWM A;  4CHJ A;  4RGT A;  2R09 A;  1ZM0 A;  2J0M A;  2CAY A;  1KRH A;  2DX1 A;  1YN5 A;  1C78 A;  2X0S A;  1ZDX A;  4IG7 B;  4M0W B;  4F7U P;  3T3O A;  3V61 A;  2VH1 A;  4HXD A;  4D2K A;  1P7E A;  1NVL A;  4G3X B;  2Z59 A;  4C7Z A;  2LKO A;  3TMP B;  3DHH C;  2WXG A;  4ANW A;  1SE3 A;  2CJN A;  2RD0 A;  1WYW B;  1WXQ A;  5LOP B;  4N59 A;  4MGI E;  2MDX A;  4LNF A;  3ZLZ A;  2D11 A;  1XKE A;  2BYE A;  2WXJ A;  2MW5 A;  2N1V A;  3QAR A;  1XQQ A;  2RUK B;  3TJP A;  4ZOH C;  4BAX A;  2L32 A;  4AJY B;  2J42 A;  3DCG A;  4WWO A;  1G6J A;  2M14 A;  1DBH A;  2L83 A;  1XLP A;  1Q10 A;  1YD8 U;  2R2Y A;  3KRX A;  2K39 A;  1HBK A;  2IDY A;  2BCJ A;  4PK1 A;  1VZ6 A;  2LOZ A;  2MP2 A;  3RNB C;  4ANV A;  4ACF A;  2JZ3 B;  1VDV A;  5DIF B;  3WAO A;  4HJK A;  1ZOY B;  2GBM A;  2IGG A;  4KKI A;  3NSU A;  3CIK A;  1WGH A;  2K00 A;  3M3J A;  3TW1 A;  2VZK B;  1YQB A;  2K9X A;  1H10 A;  2I1J A;  2K6D B;  2LI5 A;  1KM7 A;  1T77 A;  1SE4 A;  4MH0 E;  1WM3 A;  1U5G A;  2LHD A;  3BK2 A;  1E10 A;  4HCP B;  1D4B A;  5DPS A;  4TSS A;  1JQ4 A;  1FFV A;  3V62 A;  4YT0 B;  3ONS A;  1MVK A;  2QKL A;  4FJZ A;  3DBH B;  3H6N A;  1V5P A;  2KQ7 A;  4N58 A;  2GBN A;  4DHZ B;  2KN5 A;  1FGY A;  1QQR A;  3ML9 A;  1UEF A;  3RN9 C;  5BYS A;  4YSZ B;  3DVG X;  4H2A A;  3VR8 B;  3ENE A;  2EKI A;  4ILG B;  4HEA 1;  3OLM D;  3N1Z C;  4CO7 A;  2DLW A;  4N6E B;  4HK2 A;  1N5W A;  1RLF A;  2C7M B;  1FCL A;  4I6N B;  1L6V A;  3ZNG C;  3R2T A;  4ZDV A;  1PUT A;  3SBG A;  3AMZ A;  2G9H D;  3DBS A;  5D6J B;  1QOF A;  1WRD B;  3VRB B;  2K2U A;  2MWS B;  5KHQ A;  3PRE A;  1FPY A;  2AX5 A;  1C9F A;  3WAM A;  1HA5 A;  1IYF A;  1OQR A;  1T3Q A;  5LON B;  3L0W B;  2V4I B;  4NAW B;  3EFU A;  4NJC A;  4HCN B;  5TR5 A;  3TBL D;  1E5W A;  3Q8B A;  1P7F A;  2FUG 1;  2NZ8 B;  3EA6 A;  3F0W A;  3WIM A;  3AE4 B;  2FIF A;  4DX8 A;  2KAN A;  3HSA A;  1ZKH A;  2KC1 A;  3KW5 B;  3OAW A;  3DBL I;  5J3Y A;  1NVI D;  5DHA B;  1WX7 A;  3ZDT A;  2KDI A;  3I57 A;  1QOG A;  4DXA B;  2D9Z A;  2XEW A;  1TJ6 A;  4REZ A;  3V3X A;  3DOW A;  1XLO A;  4CHM A;  3C0R B;  2LUM A;  1JAL A;  2KX3 A;  1YJJ A;  4ILH A;  4M8M A;  3ZVV A;  2NTT A;  3DHG C;  5C1Z A;  3SNH A;  2AEH A;  5C23 A;  4NY0 A;  1IBX A;  3VRA B;  2COD A;  4EE2 A;  4FAD A;  2D3C A;  4X57 B;  2Y3A A;  4RMA A;  2ELA A;  3PZD A;  5FI1 A;  4IKG A;  3AEF B;  5D3V A;  5I2M A;  3BY4 B;  4Q2J A;  2J53 A;  4XDC A;  1TS3 A;  4OVZ A;  3SYX A;  2B3A A;  3AI5 A;  2MBE A;  4ZHO A;  1PMS A;  1CJE A;  4XWX A;  2COP A;  4IWP A;  3ZJT A;  4IM3 A;  4WQM A;  4ILJ A;  2DIK A;  1PYW D;  3UI3 A;  4Z2M B;  3AXC A;  1MG4 A;  1E9M A;  4KHO A;  5GXG B;  1WG7 A;  3CWI A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  1RRP B;  2L7R A;  2Z0E B;  2W3R A;  3PHX B;  3QQ8 B;  1KJT A;  3ULC A;  3F5R A;  3DBR I;  2LFI A;  1P3Q U;  2IZV B;  4GGQ A;  5JVL A;  3PVL A;  1P5T A;  1M7E A;  5IN7 A;  2JRI B;  4FHJ A;  1KTK A;  5TSS A;  4W9G A;  2V1Y A;  2WP9 B;  3RD2 A;  1LFD A;  4W9H A;  4JWU C;  4FUL A;  3TCA A;  2DZM A;  1DYQ A;  2M38 A;  1GAQ B;  4KGT A;  2AQ2 B;  2MBO A;  3PPA A;  4KDI C;  1ZUD 2;  4GLS C;  1L0X B;  2RR9 A;  3A4R A;  3A98 B;  4KHB B;  2GLS A;  3VUY A;  4HVB A;  3TEY A;  2DKP A;  4ZRJ A;  2MJE A;  3AH7 A;  3DXE A;  3DPD A;  1FAO A;  1B55 A;  3T8M A;  3E9P A;  3KH0 A;  1DDV A;  5MPO A;  1YX6 B;  4L6E A;  5FR6 A;  4MM3 A;  1UNS A;  5IOI A;  1NEK B;  4P16 A;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  2BS3 B;  3MDB C;  1C4A A;  3IG3 A;  2N7E A;  4GOC A;  1WI0 A;  3RUL A;  3VQI A;  2GBK A;  4JKA A;  1FD6 A;  3KQ4 A;  3LB8 C;  3E9O A;  3I9V 1;  3UIN B;  1LGR A;  2KDM A;  1IP9 A;  4TQ1 A;  4EJN A;  2JUO A;  1U4A A;  3ODX A;  1E7V A;  3KUC B;  2LOX A;  1HB8 A;  1OQY A;  2JXX A;  1NTI A;  1J7A A;  1RFK A;  1RJ2 A;  4ZRP A;  4LK0 M;  4J3O D;  2GRI A;  1W1G A;  2ZEQ A;  1FXI A;  3ML8 A;  3ABV B;  3DWG C;  3G9W A;  2BYF A;  3PTF C;  3R8B A;  3OAN A;  2KT7 A;  3FLV A;  5LNK 1;  3ZKJ C;  4FJV B;  2LGS A;  3HRD D;  2KR0 A;  3AV8 A;  4RNA A;  1N3H A;  2KMA A;  2LHE A;  1UBI A;  1QIL A;  2MBB B;  4FBJ B;  2KO3 A;  4WAA A;  4B6H A;  3DVN V;  4W9E A;  3GYP A;  2WU5 B;  4OZA A;  4DHZ E;  1ZXH A;  2BTE A;  4DHJ D;  1Q67 A;  2D9Y A;  1EU3 A;  4K2P A;  3TEW A;  4PQ0 A;  4MJS B;  1NU2 A;  5C5B A;  3CSF A;  4HRS A;  3S2A A;  3H8H A;  3TEX A;  1QC6 A;  3NVV A;  2GUM A;  4CYE A;  4IAP A;  1VZ8 A;  1X05 A;  1UNR A;  3WAP A;  4GMV A;  4EKU A;  2BWF A;  2H89 B;  4PS8 A;  1XOD A;  2UWQ A;  1V5T A;  1WJ4 A;  4GZU A;  1LQB A;  2DZJ A;  1R4M B;  3EUB 2;  2YS1 A;  1VD2 A;  4HRO A;  2CR5 A;  1GGO A;  5HKH A;  2PW9 A;  4L1B A;  3BWU D;  3A1Q B;  2VSZ A;  4DBB A;  4XE0 A;  1WSP A;  1WF9 A;  4CHK A;  3FC4 A;  3FSS A;  2KDE B;  2LGD A;  2IGD A;  4NJ6 A;  3LYY A;  3JSV B;  1DOX A;  3A58 A;  3VUX A;  2QMT A;  2P0H A;  3NWD A;  3P42 A;  1EGX A;  2KAC A;  2LXC A;  1V88 A;  3ZNH B;  3AU4 A;  3RYT A;  2Q13 A;  3ODW A;  3ZTD A;  1WH3 A;  3PZ7 A;  2PEA A;  1XF5 L;  1GUA B;  2LGY A;  2PVG C;  1VRA B;  5HG2 A;  3VTU A;  3VTW A;  2HE7 A;  4KV2 A;  4MY6 A;  4GNK B;  5D94 A;  2BS2 B;  2FDQ A;  3LJU X;  5KCV A;  1OTR B;  2JP2 A;  4A90 A;  2DHK A;  2K6Q A;  2GS0 A;  5C79 A;  1BUI C;  4LJO B;  2M56 B;  4NAM A;  5KHO A;  5JHH A;  3O65 B;  5CX3 A;  3N32 A;  4EEW A;  4RCO A;  4S0R A;  3QWZ B;  4EUT A;  3ALB A;  1WJU A;  2M1M A;  4PT5 A;  2G4S A;  2NTS A;  4K7S A;  3H7P B;  3E56 A;  4TKN A;  4NJ7 A;  2KQ4 X;  1MKE A;  2N0S B;  2E2X A;  4GDK A;  2YT1 A;  5T8I A;  5JHB A;  4TMA B;  4K7U A;  4XYC A;  1FGZ A;  2V0G A;  2J0J A;  3HHM A;  4MEL A;  1VCB A;  2O2V A;  1V89 A;  2KHW B;  2IO2 B;  3FIL A;  4JK9 A;  2P0F A;  1YOV B;  3SU8 X;  1EWC A;  2MHJ A;  3HM6 X;  1CMX B;  2KFK B;  4L1R A;  2NPT B;  2RDH A;  4K1R B;  2R2Q A;  3Q8A A;  2WDT B;  3J9C A;  2MBH A;  2D9W A;  4JGH B;  3DXD A;  1L6U A;  4B9K A;  1LXD A;  1MI1 A;  3PSC A;  3W1Y A;  4BKS A;  3NVZ A;  1VZ7 A;  2X38 A;  2ICI A;  3MP9 A;  1WXS A;  5CHF A;  2MSE D;  4A6F A;  3IBE A;  3L16 A;  2CB8 A;  4CQN A;  3NWA A;  1MAI A;  5DPT A;  4PYZ A;  4W9I A;  3AJ4 A;  2DBY A;  3MJW A;  2V3S A;  2ROV A;  3UGB B;  3DQV A;  1ZP0 B;  4IW0 A;  4GMX B;  3V05 A;  1STE A;  1T0R C;  4XZ4 A;  1GC6 A;  2O6V A;  4W9K A;  4YL8 A;  4WWP A;  4II3 B;  3PRZ A;  1EM7 A;  4JQW C;  3ZDM C;  4DBG A;  3Q3F A;  2HJ1 A;  2K3U A;  2INN E;  5I4D A;  5M4Y B;  2G1E A;  1BTK A;  4A6K A;  4NZL B;  4MSM B;  1FMA D;  4JX1 C;  1T6B X;  3QA8 A;  2IBI B;  5D7G A;  2WXM A;  3QK0 A;  1JWU D;  2LJ5 A;  3A9J A;  2DYQ A;  1IRS A;  3KUZ A;  3R3M A;  1YN4 A;  4QJ5 B;  3P4S B;  1E8Y A;  2COC A;  1K50 A;  3DXC A;  3L08 A;  1D5Z C;  2L1C A;  3OWE B;  2KC2 A;  1V1P A;  3SV1 A;  1JWA D;  4HPL B;  4A20 A;  4GU2 A;  3U2S C;  1ACA A;  3TVV A;  1UF0 A;  3VVW B;  2MA9 B;  4HB3 B;  2KTF A;  1JW9 D;  4D6W A;  4M01 A;  1FHO A;  3BVZ A;  4RF0 A;  3E9L A;  2NMQ A;  1QF6 A;  2A5U A;  1D3Z A;  2DYB A;  5G5G A;  1XEE A;  2XBB C;  4EFO A;  2DYN A;  1M94 A;  3ZIM A;  3VOQ A;  1I4R A;  4ICV A;  1MG8 A;  4DWF A;  2RDB C;  3UIP B;  3N1Y C;  4US8 A;  2DTC A;  2M0A A;  2WX1 A;  4A3P A;  4A8X C;  5I2S A;  5CTR C;  2YSZ A;  4C4V A;  2D4Q A;  2DX5 B;  3M62 B;  4XGA B;  1YNT E;  1L4Z B;  2ASQ A;  3B0A A;  4FA6 A;  1WGY A;  2DHJ A;  2DYO A;  4K3B A;  3AM9 A;  4NNJ B;  5IAA C;  4A55 A;  3KSY A;  4WVF B;  4MGY E;  4A9A A;  5JHG A;  1PGX A;  3B08 A;  4AWJ A;  4FLH A;  1W1H A;  1P98 A;  1JWM D;  2KDB A;  2NBV B;  1FFU A;  1ZVR A;  4ARC A;  5LG4 B;  4HAX B;  4K3C A;  2AL6 A;  2OQB A;  4QAY A;  2GBR A;  1WR6 E;  2KWD A;  4GSW A;  1V61 A;  2COF A;  2D9X A;  3WAN A;  2DHZ A;  1KLV A;  2PMV A;  1MK9 B;  4N9F 4;  5GOW B;  1L5P A;  2WS3 B;  2BB5 A;  4YTM B;  1WXA A;  1JDE A;  1V5M A;  2FID A;  3HQC A;  1TKG A;  4DDG D;  3UF8 A;  3PT2 B;  4OW0 A;  1DRO A;  3RNF C;  3SD5 A;  1WX9 A;  1WMH B;  2KUP A;  2BKR B;  1AWD A;  3B1L X;  3EHV A;  2W2W A;  3ZRF A;  3BII D;  2LWP A;  2CY5 A;  1DOI A;  3MC8 A;  4RGN A;  1BAK A;  1RFA A;  2XQN M;  4IWQ A;  3ZW3 A;  4YSX B;  2CHW A;  2INC C;  2LZ6 A;  2Q5W D;  2R61 A;  5HI1 A;  2N9L A;  3MPX A;  4ZHP A;  1FOE A;  2KWC A;  2Y5C A;  1BWN A;  4OZC A;  2YF0 A;  5J3Q A;  1YN3 A;  3O96 A;  4MDK E;  2C60 A;  5CLQ B;  1LW3 A;  3VTV A;  3GP7 A;  1AN8 A;  1R4N B;  2BQQ A;  2Y5P A;  4DHJ B;  4CSQ A;  1UGM A;  2MX2 A;  1NI2 A;  1PGA A;  4KIK A;  1D6E C;  3R7R A;  2WGS A;  3P4P B;  4RM9 A;  5BO4 B;  5AZH A;  2ZZP B;  4KGS A;  3PLV A;  1V6E A;  2NBU A;  3L17 A;  1E0Z A;  1HB6 A;  3TFM A;  4OVU A;  3PVU A;  2LUL A;  4TYZ A;  1L0Y B;  3W1S A;  2YT0 A;  5J3T A;  3NRZ A;  2WX0 A;  4AQ7 A;  4BBK A;  4JKG A;  2WHI A;  3NVY A;  1U27 A;  2DLB A;  3CF6 E;  2ELB A;  1QLB B;  2JZP A;  3JVZ X;  2GI9 A;  4B0E A;  1ZXI A;  2IND C;  2Z8L A;  1C4C A;  4YTN B;  4US9 A;  1GNU A;  3M63 B;  3ZGZ A;  5KQ4 A;  2V3P A;  1HZ5 A;  1GC7 A;  1P1A A;  4OHJ A;  1WGU A;  1K5D B;  4IWO A;  1HTQ A;  1AWE A;  1WXM A;  4GXB A;  4G11 A;  1WE7 A;  4E71 A;  2JWU A;  1GG3 A;  3P1M A;  1JRO A;  2PE9 A;  2D9V A;  3OHM B;  4ZRK A;  3C19 A;  3HUI A;  1EUV B;  2WQY B;  3D8D A;  4HAV B;  4W9J A;  3RMK C;  4G0N B;  4AOF A;  3HIE A;  2BYV E;  2WXF A;  2PKO A;  4M0W A;  3NZS A;  1GB1 A;  2Z0Q A;  2JF5 A;  4MEM A;  2KIE A;  4DX9 0;  3P7Z A;  2BGF A;  3PHW B;  3SUZ A;  5C16 A;  2CU3 A;  3MC9 A;  2I2Y A;  2KTR B;  3BVM A;  1ISN A;  4WWM A;  1EVH A;  1P0R A;  3FP5 A;  3Q69 A;  4WUR A;  4DK5 A;  2UZS A;  4EZJ A;  2MJD A;  1SB3 C;  1NTY A;  3EFC A;  2D3B A;  4KKJ A;  2VRW B;  2GJY A;  2YRY A;  4WQO B;  3AEA B;  2KX0 A;  2RPQ A;  2Z0O A;  3AB5 A;  2G35 A;  3W5U B;  1K5G B;  1SE9 A;  1UD7 A;  3HK0 A;  4D0N B;  3IAS 1;  1SJH D;  2C9W B;  3BYY B;  1XLN A;  2KXJ A;  1N60 A;  4C80 A;  5J18 A;  4F7H A;  3UQA A;  3K9O B;  2I1K A;  2UZR A;  2DAJ A;  1FIQ A;  4HDO A;  2J0K A;  2V9H A;  1UEL A;  2W54 A;  2HTH B;  2YEP F;  3U7Z A;  1VLB A;  2FJU B;  1GB4 A;  2YVC A;  2QHO A;  1V5O A;  1BML C;  2K1F A;  2JVC A;  4XWT A;  2G3Q B;  3IFW B;  4WWN A;  4NSW A;  3VFK A;  3NW8 A;  2QKM A;  2EJ8 A;  1U29 A;  4GN1 A;  4II2 B;  3C8Y A;  1P3R A;  4F8C B;  1E7U A;  2M0X A;  1UNQ A;  3VH3 B;  4LDT D;  3PEG A;  5D2M B;  3Q2A C;  2FJ9 A;  2Y8F A;  2DWQ A;  2CRF A;  1OEY A;  1VJK A;  4KZC A;  2QJL A;  5J17 A;  2CY4 A;  3KWL A;  2BVC A;  4HAW B;  4GDL B;  2L2I A;  4IFS A;  2QIE B;  2LEK A;  3TIX A;  3RFZ B;  3O13 A;  4YON A;  3AE8 B;  5IO9 A;  2HD5 B;  2LVP A;  5E6N A;  2JXT A;  4BOS C;  1DOY A;  1V5U A;  2KMM A;  3TL5 A;  4A3O A;  1IGC A;  4O1N A;  1T5X D;  1YX5 B;  4JLC A;  4MH8 A;  4HKZ E;  1BTN A;  2MH7 A;  4HPM B;  3MHZ A;  3KRW A;  2WXN A;  4WAF A;  3ZRC A;  5D3I B;  1OEY J;  1XCT L;  5IRS A;  1SBB B;  3QJZ A;  3AUL A;  3A8P A;  1F2R I;  2L0T A;  2WH5 A;  3ML4 A;  1Z87 A;  1UWX A;  4P1C C;  1GPX A;  4C56 C;  3B9J A;  4JKE A;  1X1F A;  3ETR A;  3JYU A;  2CU1 A;  2FCQ A;  2KUQ A;  2IPK D;  3AE2 B;  2WXO A;  5FI0 A;  1N6Z A;  2TSS A;  3ZTC A;  1KOT A;  2KKC A;  3VIA A;  2ADZ A;  3QIJ A;  4PNK A;  3AE5 B;  1N61 A;  2ZJD A;  1D5X C;  3DBH I;  1OQN A;  3A8Q A;  2EMT A;  3ECI A;  5HHD G;  3NZU A;  2BWE S;  2KGX B;  2VH2 A;  2AWT A;  4K17 A;  1GOZ A;  1DDW A;  1PQS A;  3X0W A;  2O6V B;  4NAW A;  4W9C A;  3NY5 A;  3ZO5 B;  4YXD B;  3P63 A;  5BMH A;  1XLQ A;  2L0F A;  1FRD A;  1WGD A;  4HB2 B;  3X23 A;  1R4N I;  3RNC C;  1JRU A;  2D5G A;  2N1W A;  2BYT A;  1QOB A;  1RYJ A;  3D32 A;  4WJP A;  3DVG Y;  1ACC A;  3DWM A;  4W9F A;  3Q6B A;  2KAJ A;  3SR6 A;  4GPT B;  3KWV A;  4G50 A;  3TO1 A;  1C1Y B;  2K0P A;  4KDL B;  1FHX A;  3M95 A;  1QZE A;  2NBW B;  1FNW A;  3N1X C;  4PS7 A;  3WAL A;  1TT5 B;  2I5F A;  1FXA A;  4K7W A;  4QJ3 B;  1M4V A;  4MGZ E;  3SFE B;  1V81 A;  5JP4 A;  2HDE A;  2QIL A;  2OHF A;  2JQR B;  3APF A;  1XXG A;  2OOB B;  3OJ4 B;  5JHA A;  1I4P A;  2DAF A;  1C76 A;  1MPE A;  1KLG D;  1J7B A;  3URY A;  1I7A A;  2NVU I;  3U12 A;  3ZNI D;  3AE1 B;  4IM0 A;  2KQS A;  1NI3 A;  2BW2 A;  1FXT B;  3MC0 B;  2JYT A;  3Q8F A;  1V80 A;  5AZG A;  3TSS A;  2WXP A;  3CXB B;  4HJG E;  5C3J B;  1HE8 A;  1E8Z A;  4JK7 A;  1QT9 A;  1MPH A;  4E3C A;  3N3K B;  2Z13 A;  3B2F A;  2Z59 B;  2KLC A;  1MFW A;  1WGG A;  1R7S A;  2BS4 B;  3GE8 C;  1RAX A;  2W2X C;  4FJY A;  3UIO B;  1U2B A;  3FAH A;  4J6I A;  2RDG A;  4ZRI A;  2J59 M;  2D3G A;  1NBF C;  3MHS D;  1KLU D;  3RNE C;  2N9E B;  1PGB A;  1SEB D;  3FEH A;  1ZC3 B;  3PZ8 A;  4I6P A;  2WU2 B;  2H7D A;  4LTU A;  3ZUN A;  1OY2 A;  5D3Y A;  5L83 A;  5LXI B;  4LNO A;  4Y94 A;  1KH0 A;  4WJO A;  1TJE A;  3P2B A;  4B95 A;  4B0M A;  3AU5 A;  4ICU A;  1TKE A;  3NJT A;  4LCD E;  4KGR A;  3RNA C;  1HQR D;  2C7N B;  2VKI A;  1E6E B;  1V8C A;  1EF1 A;  1CQV A;  3U8Z A;  4KHB A;  4RGO S;  3HW2 B;  2BBC A;  1C77 A;  2FNJ B;  3LJ3 A;  3ODO A;  3KYC D;  2Y7B A;  1X86 A;  3EC8 A;  1WIA A;  1XO3 A;  2D10 A;  1KI1 B;  2MP2 B;  1T0Q C;  5FK9 C;  3ENB A;  4W9L A;  4HWI B;  2LRW A;  1F0Z A;  2WWZ A;  3RT3 B;  2GB1 A;  3V5W A;  2LUE A;  2NCN A;  2K8H A;  3IT4 B;  3PV1 A;  4M02 A;  4IC7 B;  2JYE A;  2WNM A;  3Q14 C;  3AEG B;  4HKQ A;  1YMH E;  4XC2 A;  2ZPN A;  5G5H A;  4F1S A;  3TEZ A;  1L2N A;  1ZDV A;  5HE3 A;  2ROZ B;  2G45 B;  2N4F A;  4RF1 A;  1RRB A;  5L81 A;  2CJO A;  2KWU B;  2WDV B;  2DNF A;  1SHC A;  3SFD B;  3GB1 A;  1I7H A;  3L13 A;  2KK8 A;  2SAK A;  1LM8 B;  3GYO A;  2KLG A;  4HPP A;  3GOE A;  3SHQ A;  4JPS A;  5DPR A;  5AZF A;  1WY8 A;  2N7J A;  3UZT A;  3DBL B;  2LVO A;  2D07 B;  2KN4 A;  1ESF A;  2OTX A;  2WDR B;  1ENF A;  5G55 A;  3GE3 C;  4A6Q A;  3CMM B;  4ZRQ A;  4TQ0 A;  3MFG A;  4H8S A;  3CST A;  5E6O A;  4W9D A;  5CHV C;  2M8S A;  4XDD A;  2LRU A;  4QXA B;  2AQ1 B;  2ZW0 A;  1A5R A;  3NS1 A;  1J7C A;  1L7Y A;  1P6S A;  1NYQ A;  3AE9 B;  3I3T B;  2KWV B;  5FKA C;  4JKG B;  1FB8 A;  2WXI A;  1YQ4 B;  4WJ7 A;  2CQU A;  1HEZ E;  1QOA A;  4JKH A;  5CLL B;  4IDI A;  4JE3 B;  4BKS D;  2RSG A;  4MJS A;  3PSE B;  4KHA A;  4HAT B;  2V76 A;  2YS3 A;  3U7D A;  2KOX A;  4R3D A;  1BXT A;  1WVH A;  3AED B;  3T3N A;  1MK7 B;  3Q8E A;  2KJR A;  3AEC B;  4BBN C;  2CS4 A;  1C79 A;  3QX1 A;  2PLP A;  4MK0 A;  1UZX B;  4PS3 A;  2INP E;  2WDQ B;  3RPF C;  4LNK A;  2ZNV C;  2ABD A;  1TGZ B;  1V97 A;  4WJN A;  2EC1 A;  4RH6 A;  2O6V D;  1NDD A;  3A4S C;  1JWS D;  3QBV B;  3U30 A;  1OQQ A;  1IBX B;  4FHK A;  2Z0P A;  3W2D A;  3AE6 B;  3A1Q A;  1PFD A;  2ZW1 A;  4M00 A;  1TQZ A;  3VUW A;  3PP2 A;  2GBJ A;  4BBN F;  4P1B C;  1TZO A;  4C7Y A;  2KVR A;  4ANU A;  4LDT B;  3SO6 A;  2IY1 B;  3DBR B;  3JSV A;  1WXV A;  2KMC A;  1M7R A;  3HVZ A;  2JX5 A;  4BKT A;  2WXK A;  4S17 A;  2IY0 B;  2KFJ A;  1I42 A;  3DCX A;  3AE3 B;  4WSF A;  1R4M I;  4GOU A;  2ZVN A;  4MAC A;  2LJI A;  5JLJ B;  1AYF A;  2M19 A;  4OT1 A;  2IYD B;  3BZD B;  3RZW C;  2BT6 A;  3VAW A;  3GS2 A;  2ZCB A;  1KFY B;  2N9P C;  5BYR A;  4RGM A;  1XD4 A;  4JKC A;  1DIK A;  1WM2 A;  2W82 A;  1IGD A;  3H1U A;  4OSN A;  4LJP B;  3B77 A;  5H92 C;  1VR9 A;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  2Y8G A;  4XWW A;  5IJM A;  2YEP B;  1N63 A;  3N9Y C;  2MJ3 A;  1WGR A;  2ACZ B;  3E9S A;  3H7P A;  1EAZ A;  4DQO C;  4TV3 A;  3AEB B;  4F7Z A;  1WGK A;  2KVZ A;  1MI0 A;  5LLI A;  4FXC A;  2RQ1 A;  1WJM A;  1LO5 D;  1E90 A;  2W9N A;  3UQB A;  1AQC A;  5CHW A;  2EEL A;  3QC8 B;  2NS5 A;  5EE3 A;  3FKY A;  1TBE A;  2B76 B;  1H8C A;  2PIA A;  3W9C B;  2LAS A;  3DHI C;  2KFK A;  2I38 A;  2NPT A;  1CZP A;  1UGJ A;  4ASW C;  2H7E A;  1YQ3 B;  1SF0 A;  3BK1 A;  2FJL A;  3H9D A;  4IOY X;  2OJR A;  1QKZ A;  2K2J A;  2XNA C;  2J52 A;  1F77 A;  2PZ1 A;  2E6X A;  2V3N A;  1BT0 A;  1W1D A;  4MM3 B;  3B2G A;  5DPW A;  1IUE A;  2CKH B;  2C5L C;  2Z4D A;  1Q0W B;  3T06 A;  2YLM A;  2AYO B;  4JKD A;  2DFK A;  4YWG G;  2XK5 B;  3W1S C;  4LNI A;  1OMW A;  3A9K B;  1EO6 A;  1UUP A;  2HTM E;  1TZ1 A;  4KVG B;  4NPN A;  1T0S C;  1X11 A;  2IGH A;  4KSL C;  2CHX A;  3SEB A;  3VHT C;  2PJH A;  1K51 A;  2UVM A;  5DH9 B;  2WYQ A;  4Z2N A;  3HIZ A;  2DYM A;  4NQK E;  2QC8 A;  1SE2 A;  1ST7 A;  4P7I A;  1VBG A;  3NOB A;  2KIG A;  1RWS A;  2GMI C;  2KNB A;  2MWN B;  3WYF B;  2XN9 C;  1NYR A;  2MLB A;  5DHF B;  1OGW A;  2MCN B;  4AJW A;  3W5V B;  5D27 A;  3U52 E;  3PO0 A;  1F9J A;  4A5K A;  2AL3 A;  1SJE D;  4GB9 A;  2LGX A;  2A4Z A;  3RI7 C;  3U4E G;  3NG0 A;  3GZN B;  2X8X X; 
#chains in the Genus database with same CATH homology
 1Z5S B;  4HAY B;  4AUQ C;  4KSK C;  4MSQ B;  3Q3J A;  2EMS A;  2R82 A;  4GIV A;  4DDI D;  4URK A;  1WJ1 A;  1ZGU B;  2KJ6 A;  4EOY A;  2FCN A;  2JPH A;  1XD3 B;  3PS6 A;  1WJN A;  2X18 A;  2IO0 B;  5C5B B;  2VRR B;  1S1Q B;  3K9P B;  1V49 A;  4C0A A;  3VH4 B;  2BPS A;  1XCG A;  3JW0 X;  2DX5 A;  1AAR A;  1XT9 B;  1V2Y A;  3NHE B;  1SGH A;  2Z0D B;  5E6P A;  1C3T A;  2YS5 A;  2FAZ A;  2Y5B B;  5AEK B;  2MFQ A;  2DZI A;  4HAU B;  3T9L A;  2ZCC A;  2IO1 B;  4HDQ A;  3P6A A;  4FN2 A;  2JWZ A;  3IHP C;  3PRP B;  4HHV A;  2N9X A;  4BKG A;  2G4D B;  4E74 A;  2NMB A;  1WR1 A;  2COA A;  3EEC A;  3R66 C;  4A6H A;  5JZE B;  2KZR A;  2MKR A;  1E8W A;  1X1G A;  2RLO A;  2EKE C;  1Y5O A;  2D2Q A;  1KZ7 A;  2HRJ A;  1UPQ A;  1J8C A;  3BIN A;  1Q5W B;  1DYN A;  4JKB A;  2LYD A;  2ZPY A;  1ZSQ A;  3M1I B;  4WJQ A;  3WA0 A;  2M17 A;  3PG7 A;  1WMH A;  3EPY A;  1E8X A;  1H4R A;  2RGN B;  1FHW A;  4HLE A;  4GDK B;  4ANX A;  3KUD B;  3ZNZ B;  1DDM A;  2IFS A;  2FCM A;  1XX0 A;  4I6L B;  3PRM B;  2O2V B;  1J0G A;  3SBT A;  2ZVO A;  1U5D A;  4NQL B;  2JY6 A;  5EDS A;  1VBH A;  5IA7 A;  2N23 A;  3L54 A;  4K2O A;  3ZVR A;  3KYD D;  2V4L A;  5L95 C;  2JRH A;  3D8F A;  2DKQ A;  4A6F B;  2MQJ A;  1IPG A;  3VXW A;  5EFX A;  5KQ1 A;  3RZF A;  3NS8 A;  3KZ1 A;  1KBL A;  1U5F A;  3PVW A;  3QHT A;  3DVN U;  2L05 A;  4AP4 C;  2JT4 B;  4BFR A;  3ULB A;  1WI1 A;  1WE6 A;  1S3S G;  1KC7 A;  1LB1 A;  3A9J B;  2IYB A;  3OJ3 A;  4F7G A;  3RUI B;  4JK8 A;  3APD A;  2MRP A;  1Y19 B;  2KCJ A;  2LD9 A;  1MIZ B;  1UBQ A;  1XR0 B;  1EF5 A;  1J0W A;  1TXD A;  1U5E A;  2UYZ B;  2KD0 A;  3GZN I;  1V86 A;  2DN6 A;  3PLU A;  2R2O A;  3HM3 A;  2KJH B;  2RGF A;  3V6E B;  4RM8 A;  3A33 B;  2KTR A;  3PGE A;  2K8B A;  2CHZ A;  2N0Y A;  5G2N A;  4TUU A;  2DHI A;  5DI9 B;  3IVF A;  5HE1 A;  4HAZ B;  2LVQ A;  3V6C B;  2ZNV B;  3KY9 A;  2J7Q B;  4OVV A;  1V9J A;  1TTN A;  1UNP A;  3H7S A;  4JKF A;  2IO3 B;  2KDF B;  2L3Z A;  2REX A;  2I5C A;  3N7C A;  1NTV A;  1WJ6 A;  1K8R B;  2JZZ A;  3D8E A;  2HTH A;  4JL9 A;  1YIW A;  5GMV A;  3QCA A;  1KZG A;  5J2R A;  2RSU A;  1T0Y A;  4JIO U;  4MT7 A;  3QAQ A;  4KAX B;  3FM8 C;  3QWM A;  2GCL A;  4IM2 A;  2DEN B;  2RVB B;  2DA0 A;  2HJ8 A;  2M4N A;  5D3X A;  4GDL A;  5C6R A;  2MBQ A;  5D3W A;  4KZ0 A;  2BKF A;  4EZK A;  1WZ3 A;  2K8C A;  1I2H A;  2C7H A;  1MIX A;  2NR2 A;  1PFJ A;  4EZL A;  2LXA A;  1WX8 A;  1Y8R C;  3BJI A;  1WZ0 A;  4MGK E;  3L10 B;  4B6W A;  1UPR A;  2GCJ A;  1YJ1 A;  3VDZ A;  2W2X D;  2P8V A;  4HB4 B;  3R7Q A;  1Z2M A;  3MTN B;  4BVU C;  5HE0 A;  3KVF B;  3DDC B;  1QQG A;  1ZW7 A;  5LXH A;  1Q1O A;  4XX5 A;  2L8J A;  4KIK B;  2PE6 B;  2RNR B;  3SDL C;  4BOZ B;  1P9D U;  4HB0 B;  3RCZ A;  1X1M A;  5JH5 C;  2FCS A;  2LG1 A;  2FUH B;  2GOW A;  1ZC4 B;  3APC A;  3N30 A;  4ZYN A;  1PLS A;  2L00 B;  4IUM B;  4PYU A;  5DCN A;  4K81 A;  2R0D A;  2K25 A;  3E66 A;  5HE2 A;  2P0D A;  1I35 A;  2LBB A;  1WGQ A;  3RCP A;  4M8N A;  4EMO A;  1SIF A;  3LDZ E;  4CHJ A;  2R09 A;  1ZM0 A;  2J0M A;  2CAY A;  2DX1 A;  2X0S A;  4IG7 B;  4M0W B;  4F7U P;  3V61 A;  4HXD A;  1NVL A;  4G3X B;  2LKO A;  3TMP B;  4ANW A;  2RD0 A;  1WYW B;  5LOP B;  4MGI E;  2MDX A;  3ZLZ A;  2D11 A;  1XKE A;  2BYE A;  2MW5 A;  2N1V A;  3QAR A;  1XQQ A;  2RUK B;  3TJP A;  4AJY B;  3DCG A;  4WWO A;  1G6J A;  2M14 A;  1DBH A;  1YD8 U;  3KRX A;  2K39 A;  1HBK A;  2BCJ A;  2LOZ A;  2MP2 A;  4ANV A;  2JZ3 B;  5DIF B;  3WAO A;  4HJK A;  2GBM A;  3NSU A;  3CIK A;  1WGH A;  2K00 A;  3M3J A;  3TW1 A;  1YQB A;  1H10 A;  2I1J A;  2K6D B;  2LI5 A;  1KM7 A;  4MH0 E;  1WM3 A;  1U5G A;  4HCP B;  5DPS A;  3V62 A;  3ONS A;  2QKL A;  4FJZ A;  3H6N A;  1V5P A;  2KQ7 A;  2GBN A;  4DHZ B;  2KN5 A;  1FGY A;  3ML9 A;  1UEF A;  3DVG X;  3ENE A;  4ILG B;  3OLM D;  4CO7 A;  2DLW A;  4HK2 A;  1RLF A;  2C7M B;  4I6N B;  3ZNG C;  4ZDV A;  3SBG A;  3DBS A;  5D6J B;  1WRD B;  2K2U A;  2MWS B;  5KHQ A;  3PRE A;  3WAM A;  1IYF A;  5LON B;  3L0W B;  4NAW B;  3EFU A;  4HCN B;  5TR5 A;  3TBL D;  1E5W A;  2NZ8 B;  3F0W A;  3WIM A;  2FIF A;  4DX8 A;  2KAN A;  1ZKH A;  2KC1 A;  3KW5 B;  3OAW A;  3DBL I;  5J3Y A;  5DHA B;  1WX7 A;  3ZDT A;  2KDI A;  4DXA B;  2D9Z A;  2XEW A;  1TJ6 A;  3DOW A;  4CHM A;  3C0R B;  2KX3 A;  4ILH A;  4M8M A;  3ZVV A;  5C1Z A;  3SNH A;  2AEH A;  5C23 A;  4NY0 A;  2COD A;  4FAD A;  4X57 B;  4RMA A;  2ELA A;  3PZD A;  5FI1 A;  5D3V A;  3BY4 B;  3SYX A;  2B3A A;  3AI5 A;  2MBE A;  1PMS A;  4XWX A;  2COP A;  4IWP A;  4IM3 A;  4ILJ A;  2DIK A;  4Z2M B;  3AXC A;  4KHO A;  1WG7 A;  1UH6 A;  1J19 A;  2L76 A;  2N7D A;  1RRP B;  2L7R A;  2Z0E B;  3PHX B;  3QQ8 B;  1KJT A;  3ULC A;  3F5R A;  3DBR I;  1P3Q U;  2IZV B;  4GGQ A;  5JVL A;  3PVL A;  1P5T A;  1M7E A;  2JRI B;  4FHJ A;  4W9G A;  2V1Y A;  3RD2 A;  1LFD A;  4W9H A;  4FUL A;  3TCA A;  2DZM A;  2M38 A;  2MBO A;  3PPA A;  4KDI C;  2RR9 A;  3A4R A;  3A98 B;  4KHB B;  3VUY A;  4HVB A;  2DKP A;  4ZRJ A;  3DXE A;  3DPD A;  1FAO A;  1B55 A;  3T8M A;  3E9P A;  3KH0 A;  1DDV A;  1YX6 B;  4L6E A;  5FR6 A;  4MM3 A;  2XK5 A;  2DZK A;  1GJZ A;  3A9K A;  3MDB C;  3IG3 A;  2N7E A;  4GOC A;  1WI0 A;  3RUL A;  3VQI A;  2GBK A;  4JKA A;  3E9O A;  3UIN B;  1IP9 A;  4TQ1 A;  4EJN A;  2JUO A;  1U4A A;  3ODX A;  1E7V A;  3KUC B;  2LOX A;  1HB8 A;  1OQY A;  2JXX A;  1NTI A;  1RJ2 A;  1W1G A;  2ZEQ A;  3ML8 A;  3G9W A;  2BYF A;  3PTF C;  3OAN A;  3FLV A;  3ZKJ C;  4FJV B;  1N3H A;  2KMA A;  1UBI A;  2MBB B;  4FBJ B;  2KO3 A;  4WAA A;  4B6H A;  3DVN V;  4W9E A;  3GYP A;  4DHZ E;  4DHJ D;  1Q67 A;  2D9Y A;  4K2P A;  4PQ0 A;  4MJS B;  1NU2 A;  5C5B A;  3CSF A;  3S2A A;  1QC6 A;  4CYE A;  4IAP A;  1X05 A;  1UNR A;  3WAP A;  4GMV A;  4EKU A;  2BWF A;  4PS8 A;  1XOD A;  2UWQ A;  1V5T A;  1WJ4 A;  4GZU A;  1LQB A;  2DZJ A;  2YS1 A;  1VD2 A;  2CR5 A;  1GGO A;  5HKH A;  3A1Q B;  2VSZ A;  4DBB A;  1WF9 A;  4CHK A;  3FSS A;  2KDE B;  2LGD A;  4NJ6 A;  3JSV B;  3VUX A;  2P0H A;  1EGX A;  2LXC A;  1V88 A;  3ZNH B;  3AU4 A;  3RYT A;  2Q13 A;  3ODW A;  3ZTD A;  1WH3 A;  2PEA A;  1GUA B;  2LGY A;  3VTU A;  3VTW A;  2HE7 A;  4KV2 A;  4MY6 A;  5D94 A;  2FDQ A;  3LJU X;  5KCV A;  1OTR B;  2JP2 A;  2DHK A;  2K6Q A;  2GS0 A;  5C79 A;  4LJO B;  5KHO A;  5JHH A;  3O65 B;  5CX3 A;  3N32 A;  4EEW A;  3QWZ B;  4EUT A;  3ALB A;  1WJU A;  2M1M A;  2G4S A;  4K7S A;  3H7P B;  4TKN A;  4NJ7 A;  1MKE A;  2E2X A;  4GDK A;  2YT1 A;  5JHB A;  4K7U A;  1FGZ A;  2J0J A;  3HHM A;  4MEL A;  1VCB A;  2O2V A;  1V89 A;  2KHW B;  2IO2 B;  4JK9 A;  2P0F A;  3SU8 X;  3HM6 X;  1CMX B;  2KFK B;  2NPT B;  4K1R B;  2R2Q A;  2WDT B;  2MBH A;  2D9W A;  4JGH B;  3DXD A;  4B9K A;  1LXD A;  3PSC A;  3W1Y A;  4BKS A;  1WXS A;  5CHF A;  2MSE D;  4A6F A;  3IBE A;  3L16 A;  2CB8 A;  1MAI A;  5DPT A;  4PYZ A;  4W9I A;  3AJ4 A;  3MJW A;  2V3S A;  2ROV A;  3UGB B;  3DQV A;  4IW0 A;  4GMX B;  4XZ4 A;  1GC6 A;  2O6V A;  4W9K A;  4YL8 A;  4WWP A;  4II3 B;  3PRZ A;  4JQW C;  3ZDM C;  4DBG A;  3Q3F A;  1BTK A;  4A6K A;  4MSM B;  3QA8 A;  2IBI B;  5D7G A;  3QK0 A;  2LJ5 A;  3A9J A;  2DYQ A;  1IRS A;  3KUZ A;  3R3M A;  1E8Y A;  2COC A;  3DXC A;  3L08 A;  2L1C A;  2KC2 A;  4HPL B;  3SV1 A;  4A20 A;  4GU2 A;  1ACA A;  3TVV A;  3VVW B;  2MA9 B;  4HB3 B;  2KTF A;  1FHO A;  3E9L A;  2A5U A;  1D3Z A;  2DYB A;  2XBB C;  4EFO A;  2DYN A;  1M94 A;  3ZIM A;  3VOQ A;  4ICV A;  1MG8 A;  4DWF A;  3UIP B;  2DTC A;  2WX1 A;  4A3P A;  5CTR C;  2YSZ A;  2D4Q A;  2DX5 B;  3M62 B;  2ASQ A;  3B0A A;  4FA6 A;  1WGY A;  2DHJ A;  2DYO A;  4NNJ B;  5IAA C;  3KSY A;  4WVF B;  4MGY E;  5JHG A;  3B08 A;  4AWJ A;  4FLH A;  1W1H A;  1P98 A;  2KDB A;  2NBV B;  1ZVR A;  4HAX B;  2AL6 A;  2OQB A;  2GBR A;  1WR6 E;  4GSW A;  1V61 A;  2COF A;  2D9X A;  3WAN A;  2DHZ A;  1KLV A;  1MK9 B;  4N9F 4;  5GOW B;  1WXA A;  1JDE A;  1V5M A;  2FID A;  3HQC A;  4DDG D;  3UF8 A;  3PT2 B;  1DRO A;  3SD5 A;  1WX9 A;  1WMH B;  2KUP A;  2BKR B;  3B1L X;  3EHV A;  2W2W A;  3ZRF A;  2LWP A;  2CY5 A;  1BAK A;  1RFA A;  2XQN M;  4IWQ A;  3ZW3 A;  2CHW A;  2LZ6 A;  3MPX A;  1FOE A;  2KWC A;  1BWN A;  2YF0 A;  5J3Q A;  3O96 A;  4MDK E;  2C60 A;  5CLQ B;  1LW3 A;  3VTV A;  4DHJ B;  1UGM A;  2MX2 A;  1NI2 A;  4KIK A;  3R7R A;  4RM9 A;  5BO4 B;  5AZH A;  2ZZP B;  3PLV A;  1V6E A;  2NBU A;  3L17 A;  1HB6 A;  3TFM A;  4OVU A;  3PVU A;  2LUL A;  4TYZ A;  3W1S A;  2YT0 A;  5J3T A;  2WX0 A;  4BBK A;  4JKG A;  1U27 A;  3CF6 E;  2ELB A;  3JVZ X;  1GNU A;  3M63 B;  5KQ4 A;  1GC7 A;  1P1A A;  1WGU A;  1K5D B;  4IWO A;  1AWE A;  1WXM A;  4GXB A;  4G11 A;  1WE7 A;  4E71 A;  1GG3 A;  2PE9 A;  2D9V A;  4ZRK A;  1EUV B;  3D8D A;  4HAV B;  4W9J A;  4G0N B;  4AOF A;  2BYV E;  3NZS A;  2Z0Q A;  2JF5 A;  4MEM A;  4DX9 0;  3P7Z A;  2BGF A;  3PHW B;  3SUZ A;  5C16 A;  2KTR B;  1ISN A;  1EVH A;  1P0R A;  3FP5 A;  4DK5 A;  2UZS A;  4EZJ A;  1NTY A;  2VRW B;  2GJY A;  2YRY A;  4WQO B;  2KX0 A;  2RPQ A;  2Z0O A;  2G35 A;  1K5G B;  1SE9 A;  1UD7 A;  3HK0 A;  4D0N B;  2C9W B;  2KXJ A;  5J18 A;  4F7H A;  3UQA A;  3K9O B;  2I1K A;  2UZR A;  2DAJ A;  4HDO A;  2J0K A;  1UEL A;  2HTH B;  2YVC A;  2QHO A;  1V5O A;  2K1F A;  2JVC A;  2G3Q B;  3IFW B;  4WWN A;  4NSW A;  3VFK A;  2QKM A;  2EJ8 A;  1U29 A;  4GN1 A;  4II2 B;  1P3R A;  4F8C B;  1E7U A;  2M0X A;  1UNQ A;  3VH3 B;  4LDT D;  3PEG A;  5D2M B;  2FJ9 A;  2Y8F A;  2CRF A;  1OEY A;  4KZC A;  5J17 A;  2CY4 A;  4HAW B;  4GDL B;  2L2I A;  4IFS A;  3TIX A;  4YON A;  2HD5 B;  2LVP A;  5E6N A;  4BOS C;  1V5U A;  3TL5 A;  4A3O A;  1YX5 B;  4JLC A;  1BTN A;  4HPM B;  3KRW A;  3ZRC A;  1OEY J;  3QJZ A;  3AUL A;  3A8P A;  2L0T A;  2WH5 A;  3ML4 A;  1Z87 A;  4JKE A;  1X1F A;  3JYU A;  2CU1 A;  2FCQ A;  5FI0 A;  3ZTC A;  1KOT A;  2KKC A;  3VIA A;  2ADZ A;  3QIJ A;  4PNK A;  2ZJD A;  3DBH I;  1OQN A;  3A8Q A;  2EMT A;  3ECI A;  3NZU A;  2BWE S;  2KGX B;  2AWT A;  4K17 A;  1DDW A;  1PQS A;  3X0W A;  2O6V B;  4NAW A;  4W9C A;  3NY5 A;  3ZO5 B;  2L0F A;  1WGD A;  4HB2 B;  3X23 A;  1R4N I;  1JRU A;  2N1W A;  3D32 A;  4WJP A;  3DVG Y;  4W9F A;  4GPT B;  4G50 A;  3TO1 A;  1C1Y B;  4KDL B;  1FHX A;  3M95 A;  1QZE A;  2NBW B;  4PS7 A;  3WAL A;  2I5F A;  4K7W A;  4MGZ E;  1V81 A;  5JP4 A;  3APF A;  2OOB B;  3OJ4 B;  5JHA A;  2DAF A;  1I7A A;  2NVU I;  3ZNI D;  4IM0 A;  2KQS A;  1FXT B;  1V80 A;  5AZG A;  3CXB B;  1HE8 A;  1E8Z A;  4JK7 A;  1MPH A;  4E3C A;  3N3K B;  2Z59 B;  2KLC A;  1WGG A;  1RAX A;  2W2X C;  4FJY A;  3UIO B;  1U2B A;  4J6I A;  4ZRI A;  2J59 M;  2D3G A;  1NBF C;  3MHS D;  2N9E B;  3FEH A;  1ZC3 B;  4I6P A;  2H7D A;  3ZUN A;  1OY2 A;  5D3Y A;  5L83 A;  5LXI B;  4Y94 A;  4WJO A;  3P2B A;  4B95 A;  3AU5 A;  4ICU A;  4LCD E;  2C7N B;  2VKI A;  1EF1 A;  3U8Z A;  3HW2 B;  2FNJ B;  3LJ3 A;  3ODO A;  3KYC D;  2Y7B A;  1X86 A;  3EC8 A;  1WIA A;  2D10 A;  1KI1 B;  2MP2 B;  3ENB A;  4W9L A;  4HWI B;  2LRW A;  2WWZ A;  3RT3 B;  3V5W A;  2LUE A;  2NCN A;  2K8H A;  3PV1 A;  4IC7 B;  4XC2 A;  2ZPN A;  4F1S A;  1L2N A;  5HE3 A;  2ROZ B;  2G45 B;  2N4F A;  1RRB A;  5L81 A;  2KWU B;  1SHC A;  3L13 A;  2KK8 A;  1LM8 B;  3GYO A;  2KLG A;  3GOE A;  3SHQ A;  5DPR A;  5AZF A;  1WY8 A;  3UZT A;  2LVO A;  2D07 B;  2OTX A;  5G55 A;  3CMM B;  4TQ0 A;  4H8S A;  3CST A;  5E6O A;  4W9D A;  5CHV C;  2M8S A;  2LRU A;  1A5R A;  1L7Y A;  1P6S A;  3I3T B;  2KWV B;  4JKG B;  1FB8 A;  4WJ7 A;  2CQU A;  4JKH A;  5CLL B;  4BKS D;  2RSG A;  4MJS A;  3PSE B;  4KHA A;  4HAT B;  2V76 A;  2YS3 A;  3U7D A;  2KOX A;  1WVH A;  1MK7 B;  2KJR A;  4BBN C;  2CS4 A;  3QX1 A;  4MK0 A;  1UZX B;  4PS3 A;  2ZNV C;  2ABD A;  1TGZ B;  4WJN A;  2EC1 A;  2O6V D;  1NDD A;  3A4S C;  3QBV B;  3U30 A;  4FHK A;  2Z0P A;  3A1Q A;  1TQZ A;  3VUW A;  3PP2 A;  2GBJ A;  4BBN F;  2KVR A;  4ANU A;  4LDT B;  3SO6 A;  2IY1 B;  3JSV A;  1WXV A;  2KMC A;  1M7R A;  4BKT A;  2IY0 B;  2KFJ A;  1I42 A;  4WSF A;  1R4M I;  2ZVN A;  5JLJ B;  2IYD B;  3RZW C;  3VAW A;  2ZCB A;  2N9P C;  1XD4 A;  4JKC A;  1DIK A;  1WM2 A;  3H1U A;  4LJP B;  2PPH A;  2BF8 B;  1WFY A;  3V60 A;  2Y8G A;  5IJM A;  1WGR A;  3H7P A;  1EAZ A;  4TV3 A;  4F7Z A;  5LLI A;  2RQ1 A;  1WJM A;  1E90 A;  2W9N A;  3UQB A;  1AQC A;  5CHW A;  3QC8 B;  2NS5 A;  1TBE A;  1H8C A;  2LAS A;  4ASW C;  2KFK A;  2NPT A;  2H7E A;  2FJL A;  3H9D A;  4IOY X;  2OJR A;  2K2J A;  2PZ1 A;  1BT0 A;  1W1D A;  5DPW A;  2CKH B;  2C5L C;  1Q0W B;  3T06 A;  2YLM A;  2AYO B;  4JKD A;  2DFK A;  2XK5 B;  3W1S C;  1OMW A;  3A9K B;  1EO6 A;  1TZ1 A;  4NPN A;  4KVG B;  4KSL C;  1X11 A;  2CHX A;  3VHT C;  2PJH A;  2UVM A;  5DH9 B;  2WYQ A;  4Z2N A;  3HIZ A;  2DYM A;  4NQK E;  1ST7 A;  4P7I A;  1VBG A;  3NOB A;  2GMI C;  2KNB A;  2MWN B;  3WYF B;  2MLB A;  5DHF B;  1OGW A;  2MCN B;  4AJW A;  5D27 A;  1F9J A;  4A5K A;  2AL3 A;  4GB9 A;  2LGX A;  2A4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...