4ZRKA

Merlin-ferm and lats1 complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/transferase
total genus 83
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrkA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrkA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrkA01
2LGYA 2N7EA 4ANWA 3P2BA 3PZDA 2MW5A 1TBEA 3NSUA 1Y8RC 3ZNID 2MX2A 4G0NB 2FCMA 5J3QA 2ZCBA 5D3YA 3RUIB 2DX5B 5JH5C 1XR0B 3PPAA 3CSTA 1EF5A 5DHFB 1XD3B 1N3HA 4HAVB 2VRWB 2NZ8B 1H10A 1UNQA 4A5KA 4E71A 4ZRKA 5L81A 5EFXA 3KRXA 3Q3FA 5D6JB 2M17A 4WWNA 3IHPC 2J59M 4WWPA 4KIKB 3CMMB 1LM8B 2K2UA 3RULA 3TBLD 4E74A 2VRRB 2ELBA 2CHXA 4NPNA 4EFOA 2KCJA 1FGZA 4FHJA 4MGIE 3A4SC 2NCNA 2LJ5A 2CQUA 4K81A 4CO7A 4BKSD 1U27A 4DBGA 1GUAB 2LVOA 4B95A 1E7VA 4MK0A 2KZRA 1I7AA 5HE1A 2CRFA 3JW0X 3VH4B 3ML9A 1HE8A 4I6NB 3RT3B 5FR6A 1MK9B 4IFSA 4B9KA 1NTIA 4FHKA 1U4AA 1WE7A 3QCAA 4PQ0A 3A98B 2NBVB 2K00A 3H7PB 3PT2B 4EUTA 4A6HA 3EHVA 2PE6B 1Z5SB 3QBVB 1MAIA 2YS3A 1EUVB 2LYDA 4ANVA 2MP2A 3MDBC 3RYTA 1UNRA 2COAA 2K1FA 2K6DB 1S1QB 2EMTA 4FBJB 3PRMB 1WGDA 4NAWB 4HAUB 4HAYB 2KTRB 2W2WA 3CF6E 2M38A 3GOEA 4NSWA 1XODA 1MIXA 2N1VA 5C23A 5C6RA 4W9FA 3IG3A 3WAPA 3WAOA 2K2JA 2IO2B 2XK5B 3KZ1A 3CXBB 2VSZA 1XT9B 4CHJA 5HE3A 5TR5A 1C3TA 3DBRI 3VVWB 4PS7A 3QJZA 3APCA 5JHGA 4WVFB 2WX1A 3NZUA 3H7SA 1WJUA 4F1SA 2G3QB 2JF5A 2ZVNA 1WFYA 4FJYA 4YL8A 4HB4B 5GOWB 1BWNA 2DKQA 5JZEB 2LG1A 4HCPB 1WI1A 4GXBA 2N23A 2L2IA 3DVGY 1OY2A 4URKA 2L00B 2C7MB 2GJYA 3KRWA 2QKLA 2LI5A 3M95A 2O2VA 2A5UA 4A3PA 3HK0A 3UQBA 1MG8A 4IOYX 1TGZB 1WJMA 3RCZA 3MHSD 2LWPA 3HQCA 4II3B 4EZLA 1XX0A 3KW5B 1MKEA 3SV1A 2P0DA 4F7HA 1VCBA 2KC1A 2KWVB 5J3TA 2CS4A 2MRPA 1LQBA 1WXSA 4HHVA 1WR6E 4G50A 2UYZB 1UELA 2LXCA 3BY4B 2D9YA 4DHJD 3TVVA 1I35A 3HW2B 1UBIA 3PHXB 4DHJB 4MJSB 4CYEA 1K5GB 3ZTCA 3L13A 3SHQA 4G3XB 1Q0WB 4LCDE 5FI1A 2VKIA 3SUZA 2RR9A 3ENEA 4W9IA 3P7ZA 4MT7A 1WYWB 4BKGA 3DXCA 4GU2A 3TMPB 3N30A 1WGUA 4MM3A 2DN6A 4HB0B 1UGMA 2KDIA 2Z0OA 2QHOA 5L95C 2A4ZA 4WJPA 3NY5A 4IM2A 2LD9A 2IFSA 1PLSA 3PVUA 4HCNB 1FXTB 4ANXA 2IYDB 2IBIB 2HTHA 1V89A 2DENB 2JRIB 3A4RA 1MK7B 3VDZA 2YLMA 3FM8C 1LB1A 3C0RB 2J0KA 2JWZA 1RLFA 1J19A 2AWTA 4IW0A 2O6VD 3A1QB 4MELA 3APFA 3PRZA 4W9JA 2KQ7A 2O6VB 2FIDA 4WJQA 4FJZA 1E8WA 4F8CB 4GDLA 2BKRB 5JP4A 4II2B 3RD2A 3D8FA 4B6WA 1LXDA 1FHXA 1JRUA 1F9JA 1HB8A 2PJHA 4M8MA 3SO6A 2KVRA 4J6IA 3MJWA 3UF8A 1EF1A 5D3XA 1U29A 4NNJB 4E3CA 2R0DA 1WE6A 4D0NB 1WR1A 2DYNA 4HDOA 2JPHA 4WJOA 4GB9A 1V6EA 4ZYNA 1FB8A 2UZSA 2D4QA 4AP4C 5LXIB 3ZDTA 4NQLB 1V81A 2GBRA 2G4SA 2B3AA 1WX7A 4WWOA 4I6LB 4L6EA 3KY9A 3R3MA 2JUOA 2KJ6A 3BINA 4A6FB 4EJNA 1WMHB 1UH6A 1WZ0A 4IWPA 2DX5A 1WGHA 4EZJA 5G2NA 3DDCB 5J18A 1ISNA 3HM6X 3DXDA 1UPQA 5AEKB 4AWJA 2KO3A 4HJKA 4KIKA 3T9LA 3OANA 2LOXA 2H7DA 2R2OA 3X0WA 3O96A 5JHAA 4GMXB 5LLIA 4K2OA 1OQYA 3R7RA 5JHHA 2LZ6A 3AJ4A 2D9ZA 1TZ1A 2YT1A 1X86A 1PFJA 3DBHI 3ZW3A 2M1MA 2C7HA 1DDVA 3HIZA 3VOQA 2YT0A 3QIJA 2IY1B 2JZZA 4BKSA 5HKHA 4DX8A 2KOXA 4PS3A 1W1HA 4HK2A 1WZ3A 2Z0EB 3ZTDA 3ODXA 1Z2MA 3N32A 1BAKA 2EKEC 4A20A 1FHOA 2N9XA 2XBBC 3H6NA 3ZRFA 4Z2MB 3PLUA 2L0FA 5J17A 3H7PA 4DXAB 1V61A 2KTFA 4PYZA 2QKMA 4KZCA 2W9NA 2NBUA 3UIOB 2IO1B 1V49A 4XWXA 4KSLC 2D10A 4BBNF 2DX1A 3OLMD 3EC8A 3ONSA 1RRPB 2KFKB 3EECA 2EMSA 1V5OA 1FOEA 1M7RA 5D3VA 2OJRA 1EAZA 3NOBA 4NAWA 2NMBA 4ZRJA 2MWNB 2KTRA 2N1WA 4BOZB 3VAWA 4HDQA 1P98A 5J3YA 4NQKE 5DPRA 3ZO5B 2FCNA 2K8BA 1YIWA 4FULA 1NVLA 1J0WA 4OVVA 3R7QA 2XK5A 4MSMB 2XQNM 2PE9A 4A6KA 1TXDA 2Z0QA 4HB2B 1W1DA 3AXCA 3Q3JA 1QZEA 4FA6A 3NS8A 1ZC4B 3KSYA 1X1MA 2KXJA 3F5RA 4DX90 2KJRA 1V5UA 1V2YA 1C1YB 3T8MA 4GDKB 4OVUA 5D3WA 1VD2A 4K2PA 2NPTB 3TIXA 2GBJA 4M0WB 5DIFB 1H8CA 4X57B 3UZTA 4KHBB 2DYOA 2GBKA 3DPDA 2DTCA 2ROVA 2KX0A 3VHTC 1E5WA 3WIMA 4GSWA 1UEFA 3WANA 1P6SA 2ASQA 2ZNVB 2D3GA 2X18A 2Y8GA 2MBHA 4JQWC 4EOYA 2LBBA 1XD4A 2V3SA 3WAMA 2K8HA 5G55A 2MBQA 1PMSA 1AQCA 2MSED 3U8ZA 2BCJA 2K8CA 1H4RA 2LRUA 3PVWA 2GCJA 1X1GA 2DAFA 4MJSA 1EO6A 3KUCB 2MA9B 3PGEA 2FNJB 3B0AA 4K7WA 2COCA 3TL5A 3KYDD 4IWOA 1GC7A 1HBKA 2L0TA 2L76A 4HXDA 2L7RA 4EMOA 3PHWB 3AULA 1BTNA 5KQ4A 3DBLI 3WALA 4HVBA 2KMCA 3UINB 1R4MI 1V5PA 1AARA 1WI0A 2ZVOA 1X05A 1DDWA 5CTRC 2P8VA 1KJTA 4HAWB 3MPXA 4NJ7A 2RLOA 2KK8A 3ZNZB 1E8XA 2KQSA 4W9KA 2AL3A 4F7ZA 3V6EB 4HLEA 2LXAA 3U30A 2MP2B 2DHZA 3QARA 4HWIB 5C16A 2N0YA 3EFUA 3VFKA 2MLBA 2PPHA 5AZFA 2MWSB 1WJ4A 5LONB 3H9DA 3CSFA 1I42A 2KWCA 5E6NA 1V80A 2BWES 2DLWA 5EDSA 4G11A 3SD5A 3ZDMC 2KDBA 3H1UA 2BWFA 4TV3A 4BFRA 3QK0A 5CHWA 1B55A 1WXAA 1W1GA 3ZIMA 2Z0DB 1OTRB 2DYBA 2JRHA 3A1QA 4ASWC 4K1RB 2Y5BB 5JHBA 4PS8A 3QC8B 2O6VA 1XQQA 2K6QA 4Z2NA 4M8NA 5DPTA 4KSKC 4K7UA 2PZ1A 2ZJDA 1IP9A 5E6OA 1FAOA 3V60A 3PLVA 5DH9B 4NJ6A 3HM3A 3ZNHB 4ICUA 2PEAA 5CLQB 5D94A 5HE2A 2DZKA 2ZEQA 2L3ZA 3ZUNA 3RCPA 1UD7A 3QWZB 4TQ1A 2BYEA 3A8PA 2JP2A 4I6PA 5DPSA 3K9PB 3TW1A 2I5CA 4FADA 1BT0A 3OJ3A 2RSUA 2COPA 2IYBA 3PREA 4H8SA 1BTKA 4KDLB 2CHZA 4HAXB 2KLCA 2MDXA 3DVGX 1UPRA 5IJMA 1OEYJ 2C7NB 2FIFA 3KYCD 4GN1A 3KUDB 3A33B 4GZUA 2D11A 4W9LA 1Q1OA 2ROZB 3FEHA 2UWQA 4MH0E 4YONA 4A6FA 4MGZE 5D7GA 1YQBA 4KHAA 1WMHA 1WGRA 2MBBB 2RNRB 2DYMA 4DBBA 4XZ4A 2D07B 4MSQB 3AU5A 3D8DA 2WDTB 4JLCA 2KC2A 1WF9A 2EC1A 1LFDA 2P0HA 2K25A 2P0FA 1WX8A 5GMVA 4BKTA 2YVCA 5CHFA 1T0YA 4GPTB 5LOPB 1ZSQA 3M62B 3SYXA 4W9EA 1ZGUB 2GBMA 2FCSA 2GMIC 1OEYA 2R2QA 1FGYA 2YSZA 3O65B 4FN2A 1U5DA 3VUYA 1Y19B 1LW3A 3X23A 3L10B 1V86A 4AUQC 2CHWA 4MDKE 1UZXB 1G6JA 2DZJA 1X1FA 5C1ZA 1ZC3B 3A9KB 2OTXA 2MBOA 3NHEB 5LXHA 4TQ0A 3V61A 4IWQA 3A9JB 2RGFA 3L54A 3QQ8B 3DVNU 1RJ2A 2V1YA 3WA0A 2MBEA 4HB3B 4MGKE 2KGXB 3PTFC 2MFQA 4JIOU 4KV2A 5AZGA 2NVUI 1GC6A 4KVGB 5CX3A 1R4NI 2KMAA 2RGNB 2KFKA 2KD0A 1EGXA 2IO3B 1WIAA 4WJ7A 3NZSA 4F7UP 2REXA 2KUPA 2JVCA 1ZKHA 3RZFA 1M94A 4MGYE 1KLVA 4LDTD 1V5MA 4PNKA 2H7EA 4LDTB 1PQSA 1WJ6A 1WXVA 2C60A 1DYNA 3DQVA 2RVBB 3QX1A 2KDEB 5KHOA 3VXWA 3ZRCA 3LJ3A 2Z0PA 2V76A 1U5FA 4NY0A 1IPGA 2JXXA 3QAQA 2KN5A 4GDKA 2BF8B 1IRSA 1P3RA 4WJNA 2I5FA 3ZNGC 2YS5A 5KHQA 5FI0A 3PSEB 3PSCA 2NPTA 1KI1B 2LVPA 3VIAA 2DA0A 2LGDA 2J0JA 4A3OA 2ZPYA 4IC7B 4JGHB 3EPYA 1P1AA 5C5BB 5KQ1A 4W9GA 2DHKA 2KJHB 3JSVB 2CY4A 2CU1A 3GYOA 4PYUA 2KFJA 4MEMA 1AWEA 3DVNV 1SHCA 3P6AA 2JY6A 2WWZA 1A5RA 2GCLA 3FP5A 1WM2A 2R09A 1QC6A 2KHWB 4K17A 2G35A 1L7YA 2IY0B 2RSGA 1Q67A 2AYOB 2ZPNA 4CHKA 4DDGD 5HE0A 2NBWB 2CKHB 4IM3A 2IO0B 4KZ0A 3MTNB 2DYQA 1DROA 5D27A 3ZKJC 1WG7A 3QA8A 1WY8A 1SIFA 4GOCA 4WAAA 3LJUX 1RRBA 1NU2A 3ODWA 3WYFB 4DHZB 4RM8A 3V5WA 3UGBB 4BBKA 3VTVA 2GBNA 1M7EA 2I1JA 3U7DA 2LULA 1NTYA 4ZRIA 4GGQA 1WGQA 2CY5A 5IA7A 3W1SA 4TKNA 1J8CA 2Q13A 2FCQA 1Y5OA 3VUXA 4IUMB 1YJ1A 4AJWA 3HHMA 5IAAC 2RUKB 2CB8A 1RFAA 3TJPA 2LUEA 3W1YA 4LJPB 2GOWA 1D3ZA 3CIKA 2C9WB 2BYFA 2C5LC 3I3TB 4BVUC 1OGWA 3M1IB 2D9VA 3AU4A 2WH5A 1K5DB 4P7IA 3OJ4B 1E90A 5DHAB 1ACAA 3FSSA 5J2RA 1P9DU 2IZVB 1ZVRA 2Z59B 2BKFA 1E7UA 2N9PC 3PG7A 3T06A 1WRDB 1ZW7A 2Y8FA 2MCNB 1SGHA 3K9OB 3IVFA 3OAWA 4W9CA 3VH3B 3R66C 2GS0A 1V5TA 1X11A 3JYUA 1KZ7A 1SE9A 1WVHA 3TCAA 2AEHA 1Q5WB 2G4DB 3PV1A 4DK5A 4IM0A 3ALBA 3ML4A 3RZWC 5DI9B 2RQ1A 3F0WA 4JL9A 4MY6A 1UBQA 2M0XA 1YD8U 2DAJA 5AZHA 1WXMA 5D2MB 4F7GA 3TO1A 1MIZB 2Y7BA 3SNHA 4XC2A 1WGGA 2J7QB 3KH0A 1KM7A 2OOBB 3JVZX 1TJ6A 5KCVA 1TTNA 2RD0A 4DHZE 2FJ9A 3L17A 3DOWA 1S3SG 1HB6A 1L2NA 4HPLB 1DDMA 3M63B 2BGFA 1P0RA 2UVMA 2ZZPB 2NR2A 2CAYA 5L83A 1V9JA 1GG3A 3PEGA 1MPHA 4WQOB 2LOZA 3PRPB 4ANUA 4C0AA 4ZDVA 2LKOA 4AJYB 4BBNC 2I1KA 2KKCA 2W2XD 3N7CA 3SDLC 2DKPA 3BJIA 2FAZA 3DCGA 2ELAA 3KUZA 4W9HA 4EKUA 4GIVA 1WJNA 1KOTA 2BPSA 2ZNVC 4TYZA 2FUHB 2FJLA 3ZLZA 3L16A 2O2VB 4WSFA 3PP2A 4HAZB 1IYFA 4AOFA 2LRWA 4IG7B 2COFA 3B08A 3UIPB 3D8EA 2JT4B 1GNUA 5JLJB 3AI5A 4CHMA 2KDFB 5CHVC 3S2AA 1GJZA 1U5EA 4DWFA 3DXEA 3A9KA 1WX9A 2YS1A 2EJ8A 3D32A 1OMWA 1V88A 2N4FA 4KAXB 4RM9A 3A9JA 5DCNA 1Z87A 2LGXA 5BO4B 1FHWA 3UQAA 4ICVA 2K39A 4XX5A 2L1CA 1XKEA 3APDA 2NS5A 1WM3A 2ADZA 1WGYA 1NI2A 3VTWA 4LJOB 1NBFC 3W1SC 2XEWA 4KHOA 1DBHA 4EZKA 2YF0A 1XCGA 4FLHA 2N9EB 2MKRA 2KX3A 2JZ3B 3IFWB 2BYVE 2DFKA 2E2XA 3IBEA 3ULBA 2D9WA 3ODOA 1RAXA 2ZCCA 2DZMA 3PS6A 2G45B 2V4LA 2L05A 4HPMB 2D2QA 4N9F4 2KNBA 3KVFB 4IAPA 2HD5B 2J0MA 2M14A 3B1LX 3L08A 2HE7A 4FJVB 2LASA 3TFMA 2HJ8A 2KWUB 4GMVA 2HTHB 1ST7A 2HRJA 3ZVVA 2DHIA 1WH3A 1NTVA 4EEWA 1K8RB 2N7DA 5E6PA 1U5GA 3ECIA 2DZIA 3ML8A 3GZNI 4RMAA 2W2XC 3ZVRA 1J0GA 3ULCA 1OQNA 2LVQA 3V6CB 2MQJA 5C5BA 1E8ZA 4HATB 1YX6B 2UZRA 2ABDA 4GDLB 3JSVA 1KZGA 3GYPA 3DBSA 2CR5A 1E8YA 2FDQA 1ZM0A 1WJ1A 1I2HA 4Y94A 2KLGA 1CMXB 3LDZE 4KDIC 2CODA 2YRYA 4W9DA 3A8QA 4DDID 5CLLB 3QWMA 2WYQA 1EVHA 2D9XA 3FLVA 2M4NA 2RPQA 1UNPA 2WX0A 1P5TA 2KANA 3QHTA 4BOSC 1U2BA 3VUWA 1QQGA 3VQIA 3L0WB 3G9WA 1NDDA 1TQZA 3V62A 3M3JA 3VTUA 1YX5B 5C79A 3SU8X 4K7SA 3N3KB 5DPWA 2DHJA 3PVLA 2OQBA 4B6HA 2M8SA 2AL6A 1P3QU 4TUUA 2L8JA
chains in the Genus database with same CATH superfamily
2LGYA 3LB8C 2LEKA 1VBGA 2N7EA 4ANWA 1MJDA 3P2BA 3PZDA 2MW5A 1TBEA 3NSUA 1E0ZA 3IT4B 1GAQB 1Y8RC 4LK0M 3ZNID 2MX2A 4G0NB 2MHJA 5JVLA 2WXMA 2FCMA 5J3QA 2ZCBA 1HZ6A 5D3YA 3RUIB 2DX5B 1QOFA 5JH5C 1XR0B 3PPAA 3CSTA 1N5WA 1EF5A 2AQ3B 4GNKB 5DHFB 1XD3B 1N3HA 4HAVB 2VRWB 2NZ8B 1H10A 1UNQA 4A5KA 3U52E 4E71A 1KFYB 4ZRKA 2UU7A 3B2GA 5L81A 5EFXA 3DWMA 3KRXA 1RWSA 2BTEA 3Q3FA 5D6JB 1VZ7A 2M17A 4WWNA 3IHPC 2J59M 2IGHA 3TEXA 4DQOC 4WWPA 4KIKB 3CMMB 1LM8B 2K2UA 3RULA 1XCTL 2WXHA 3TBLD 4E74A 4R3DA 2VRRB 2ELBA 1UUPA 4C4VA 2WXIA 2CHXA 1STEA 4NPNA 4EFOA 2KCJA 5BMIA 1FGZA 4CSQA 3E9LA 4FHJA 1VBHA 4MGIE 3A4SC 3BK1A 2NCNA 2LJ5A 2CQUA 4K81A 4CO7A 4BKSD 1U27A 2Z59A 1GUAB 4DBGA 2LVOA 3LYYA 4B95A 3ZJTA 1VLBA 1DOIA 1E7VA 4MK0A 2KZRA 3URYA 1I7AA 5HE1A 1TS4A 3MC8A 5FKAC 2CRFA 3JW0X 3VH4B 3ML9A 1HE8A 4I6NB 4S17A 1OFFA 2BT6A 3RT3B 1I4RA 5FR6A 1MK9B 3VR9B 2N9KA 4IFSA 4B9KA 1NTIA 4FHKA 1KLGD 1U4AA 3NG0A 1WE7A 3DCXA 3ZQ4A 2Z13A 3QCAA 4PQ0A 1HXYD 1VJKA 3A98B 4ZRQA 2NBVB 2K00A 3H7PB 2KIEA 3PT2B 4EUTA 4A6HA 3EHVA 5BYRA 4RGMA 2AX5A 2PE6B 1Z5SB 3QBVB 1PYWD 1MAIA 2YS3A 1EUVB 3N20C 2LYDA 1KF6B 4ANVA 2MP2A 3MDBC 3RYTA 1UNRA 2COAA 2J4XA 2K1FA 3EA6A 1KC7A 3BVZA 2K6DB 2D3BA 3GS2A 1S1QB 2EMTA 3R8BA 2Q5WD 4FBJB 3PRMB 3PO0A 1WGDA 4NAWB 3N1ZC 4HAUB 4HAYB 2KTRB 3ZXRA 2W2WA 3CF6E 5BMGA 3AE6B 3HUIA 1JWSD 3AE8B 2M38A 3GOEA 4NSWA 4XWTA 1XODA 2W3SA 5EE0A 1MIXA 1UGJA 4DXFA 2N1VA 5C23A 5C6RA 4W9FA 3IG3A 3WAPA 3EGRA 3WAOA 3Q3OC 2K2JA 3W2DA 2IO2B 2XK5B 3KZ1A 3AV8A 4XDCA 3CXBB 2VSZA 1XT9B 4CHJA 5HE3A 5TR5A 1C3TA 3DBRI 1N61A 5AUIA 2RDBC 3VVWB 4PS7A 3QJZA 3APCA 3RFZB 5JHGA 4WVFB 2WX1A 3NZUA 4M00A 2INCC 1KLUD 3H7SA 1IBXB 1WJUA 4F1SA 2G3QB 2JF5A 1SSNA 2ZVNA 2QC8A 3GE8C 1WFYA 4ZYSA 4FJYA 3ZJUA 2E6XA 4XWWA 4YL8A 4JKCA 4HB4B 4LNOA 5GOWB 1BWNA 2DKQA 2X38A 5JZEB 2LG1A 4HCPB 1WI1A 4GXBA 2N23A 2L2IA 2BB5A 1OY2A 3DVGY 4P6VF 4C00A 4URKA 2L00B 1EU3A 2C7MB 2GJYA 3KRWA 2QKLA 2LI5A 3M95A 4WWMA 1EU4A 2O2VA 3RNCC 2A5UA 4A3PA 3HK0A 3UQBA 1MG8A 2RDHA 4IOYX 1TGZB 2JYEA 1WJMA 3RCZA 2MJDA 1B1ZA 4JWUC 3MHSD 5BYSA 2LWPA 3HQCA 4II3B 4EZLA 1XX0A 3KW5B 1MKEA 3SV1A 2P0DA 4F7HA 1HZ5A 1VCBA 3AE4B 2KC1A 1R4NB 2WXLA 2KWVB 3AE1B 5J3TA 2CS4A 2MRPA 4GOUA 3U2SC 1LQBA 1WXSA 2QMTA 5EE9A 4HHVA 1WR6E 3EUB2 4G50A 2UYZB 3HRDD 3MFGA 1UELA 2YT2A 2LXCA 1JRPA 3BY4B 2D9YA 2BVCA 2KAJA 4DHJD 2BW2A 5HHDG 3TVVA 1I35A 3HW2B 1UBIA 2JWUA 3PHXB 4DHJB 4MJSB 1HTQA 4CYEA 1K5GB 4XDDA 4ZHOA 3ZTCA 4YSYB 3L13A 2E3TA 3SHQA 4G3XB 3BK2A 1Q0WB 1SBBB 3Q2AC 2RRFA 4LCDE 5FI1A 3VRAB 1TS3A 2VKIA 3SUZA 2RR9A 2W82A 1IGDA 3ENEA 4B0EA 4C7ZA 4W9IA 3P7ZA 4MT7A 1WYWB 1OQQA 4BKGA 2ICIA 1KTKA 3DXCA 1JWUD 4K3BA 4GU2A 3TMPB 3N30A 1R7SA 3KWVA 1WGUA 4MM3A 2DN6A 3BYYB 4KGSA 4HB0B 4P1BC 1UGMA 1MHHE 2KDIA 2Z0OA 4WIPA 4N6EB 3HVDA 2QHOA 5L95C 2QILA 1B9RA 2A4ZA 2INPE 2VZKD 1ZOYB 4WJPA 3AH7A 3NY5A 4IM2A 2KIGA 2IFSA 2LD9A 5I2MA 1PLSA 3AEGB 3PVUA 4HCNB 2VZKB 3RNEC 1FXTB 1BXTA 4ANXA 1ZYIA 2IYDB 2IBIB 2VH2A 2HTHA 2FJUB 1NVID 3U7ZA 1V89A 2AQ2B 1Q10A 1YN4A 2DENB 2JRIB 3A4RA 1MK7B 1XLPA 2YLMA 3FM8C 3VDZA 1FMAD 1LB1A 3H8HA 3C0RB 2J0KA 2JWZA 1RLFA 1J19A 2AWTA 4IW0A 3FILB 2ZW0A 2X8XX 2O6VD 3A1QB 3BIID 4MELA 5H92C 3APFA 3PRZA 4W9JA 4WURA 2KQ7A 2O6VB 2FUG1 2MH7A 2FIDA 2YEPF 4WJQA 4JKFA 4FJZA 1E8WA 3E9PA 4F8CB 1RYJA 4GDLA 4OSNA 2BKRB 5JP4A 1I4HA 4II2B 3RD2A 3D8FA 4B6WA 1LXDA 1FHXA 1V1PB 1JRUA 1F9JA 1HB8A 2PJHA 2R61A 4M8MA 3VRBB 3SO6A 2KVRA 3B2FA 4J6IA 1FEHA 2WS3B 3MJWA 3UF8A 3V05A 1EF1A 3IAM1 1CQVA 5D3XA 1CZPA 1U29A 4NNJB 4MT5A 1M4VA 4E3CA 2R0DA 1WE6A 3U4EG 4D0NB 1WR1A 4JKBA 3RPFC 2DYNA 4HDOA 1KH0A 2JPHA 4WQMA 4WJOA 4GB9A 1V6EA 2N7JA 4ZYNA 3I63C 1FB8A 2UZSA 1TS5A 2D4QA 4AP4C 5LXIB 3ZDTA 4NQLB 4QJ4B 1V81A 3PZ8A 3RNBC 1P7FA 4NZLB 1YJIA 4O1NA 2GBRA 2G4SA 2B3AA 1WX7A 2M19A 4WWOA 4I6LB 2WXJA 2KWDA 4YT0B 1MPEA 4L6EA 3AECB 3KY9A 1NYQA 3R3MA 5GXGB 2JUOA 3SFEB 2KJ6A 3BINA 4A6FB 4EJNA 3P63A 1WMHB 1UH6A 2KYWA 1WZ0A 4IWPA 2DX5A 3ZGZA 1WGHA 2K0PA 1YNTE 1FFUA 4EZJA 1D6EC 1SXTA 5G2NA 1FO4A 3DDCB 5J18A 1ISNA 3HM6X 4US9A 3DXDA 1N62A 3C19A 1EM7A 1UPQA 3I5JC 2NMQA 4IKGA 2WGSA 5AEKB 4AWJA 4JWSC 2KO3A 4HJKA 3DHIC 3Q8FA 3AE9B 4KIKA 3T9LA 3OANA 2LOXA 5G5GA 2H7DA 2HTME 5FK9C 2R2OA 3O96A 3X0WA 5JHAA 1NI3A 5I4DA 4GMXB 3E56A 4ZOHC 4IOIE 5LLIA 4K2OA 1OQYA 3R7RA 5JHHA 5LG4B 2LZ6A 3AJ4A 2D9ZA 1TZ1A 2YT1A 2WXGA 1X86A 1ZUD2 4GLSC 1PFJA 4LLGM 3DBHI 3ZW3A 2M1MA 2C7HA 1DDVA 2N0SB 3HIZA 2LJIA 3VOQA 2YT0A 2Z8LA 3QIJA 2IY1B 2JZZA 4BKSA 5HKHA 2JSVX 4DX8A 1JQ4A 2KOXA 3NZ3A 1T77A 4PS3A 2IJ0A 1W1HA 2J52A 4HK2A 1WZ3A 1MI1A 3KQ4A 1JMLA 2Z0EB 3ZTDA 1QKZA 1ACCA 2WXFA 3ODXA 1Z2MA 3N32A 1BAKA 1LGRA 2PKOA 4HSIA 2EKEC 4A20A 1AN8A 4OZBA 3CWIA 1FHOA 5E6JA 2N9XA 2XBBC 3H6NA 1J7BA 3ZRFA 4Z2MB 4J3OD 1C79A 3MC0B 3PLUA 2L0FA 2NBVA 5I2SA 5J17A 3H7PA 4DXAB 1V61A 4LNIA 2KTFA 3E66A 4OW0A 4TSSA 4PYZA 2QKMA 3Q6BA 2KR0A 1MVKA 1D5ZC 2BS2B 1N63A 4ARCA 3DHGC 4KZCA 2W9NA 2NBUA 4WH4A 3UIOB 2IO1B 1V49A 4XWXA 2V3NA 4KSLC 4BZAA 2D10A 4BBNF 2DX1A 3ENBA 3OLMD 1JWMD 4KGTA 3EC8A 1DOXA 3ONSA 1RRPB 2KFKB 3AMZA 3EECA 1N6ZA 2AQ1B 2EMSA 1ZDVA 1V5OA 1FOEA 1FPYA 2RDGA 4US8A 1M7RA 5D3VA 1L0YB 3RNAC 1ET9A 2OJRA 1EAZA 3NOBA 1L0XB 3AE3B 2NMBA 2QDFA 4NAWA 3TUOA 4ZRJA 2MWNB 2KTRA 2N1WA 4BOZB 3VAWA 4HDQA 4QJ3B 1P98A 5J3YA 2EELA 1MI0A 2W55A 4NQKE 5DPRA 3Q69A 1SE3A 3ZO5B 2FCNA 3SBTA 2LGIA 1I4PA 2K8BA 1YIWA 4FULA 2DLBA 1NVLA 1J0WA 4OVVA 3R7QA 2I38A 2XK5A 1C77A 1TKGA 4MSMB 2XQNM 2PE9A 3HSAA 4A6KA 1TXDA 5T8IA 2Z0QA 1BMLC 4HB2B 1W1DA 2I2YA 3AXCA 3Q3JA 1QZEA 4FA6A 3NS8A 1ZC4B 3KSYA 1X1MA 2KXJA 3F5RA 4DX90 2KJRA 1J7AA 1V5UA 5C3JB 1V2YA 1IBXA 4RF1A 3Q8CA 1C1YB 3T8MA 4A6QA 4GDKB 4OVUA 4RNAA 5D3WA 2J53A 1HA5A 4ITKA 1VD2A 4K2PA 2NPTB 3P1MA 3TIXA 2GBJA 4M0WB 5DIFB 2Y5CA 1H8CA 1JDEA 4KKIA 4X57B 5G5HA 3NWFA 3UZTA 4KHBB 4HKZE 2DYOA 2GBKA 3DPDA 2DTCA 2ROVA 2KX0A 1FRRA 1XEEA 4OZAA 3VHTC 1E5WA 3Q3NC 3WIMA 4GSWA 1UEFA 3WANA 2WDQB 1L6VA 1P6SA 3BVGA 2ASQA 1FXIA 2ZNVB 2D3GA 2X18A 2Y8GA 2MBHA 1GPXA 4JQWC 4EOYA 2LBBA 1XD4A 1FNWA 2JQRB 2V3SA 1FCCC 3WAMA 2K8HA 5G55A 2MBQA 1TYGB 2KN4A 4HPPA 4L2YA 1PMSA 4RGNA 5IN7A 4YTMB 1AQCA 2MSED 3U8ZA 2BCJA 2V0GA 2V4IB 3ABVB 2K8CA 1H4RA 2WDRB 2LRUA 3I9V1 4B0MA 3PVWA 2GCJA 1X1GA 2DAFA 3TEWA 4MJSA 1EO6A 3KUCB 2MA9B 1C76A 3PGEA 2FNJB 3B0AA 1DIKA 4K7WA 2COCA 3TL5A 3KYDD 4A90A 4IWOA 2WXPA 1GC7A 1HBKA 2L0TA 1SE2A 2L76A 4HXDA 2L7RA 2BBCA 2G9HD 4EMOA 3PHWB 3KLSX 1XCQL 3AULA 1BTNA 1ENFA 4RFBA 1K50A 5KQ4A 3DBLI 5MPOA 3WALA 4HVBA 2D3AA 3GE3C 3NVZA 5EE1A 2KMCA 3UINB 5LNK1 1R4MI 1PDXA 2XNAC 1V5PA 1AARA 4NJCA 1WI0A 1L5PA 2ZVOA 1X05A 4ACFA 1DDWA 5CTRC 2P8VA 4USAA 1KJTA 1GOZA 3AEAB 4HAWB 3BZDB 2CJOA 3MPXA 1MG4A 4NJ7A 2RLOA 3N1YC 4C80A 2KK8A 1T0RC 3ZNZB 1E8XA 3GZNB 2KQSA 2V3PA 4W9KA 1ESFA 2AL3A 4S0RA 3AE7B 3V6EB 4F7ZA 2MEKA 4HLEA 2LXAA 3U30A 2MP2B 2DHZA 3QARA 4HWIB 5C16A 2N0YA 1XF5L 4YXDB 1V1OA 3EFUA 3B77A 4DIXA 4A9AA 3VFKA 2MLBA 2PPHA 5AZFA 3HIEA 3E9OA 1WJ4A 5LONB 2JX5A 2MWSB 3H9DA 3CSFA 1I42A 2KWCA 4OZCA 5E6NA 1TS2A 1V80A 4ZHPA 2BWES 2DLWA 5EDSA 4G11A 3SD5A 3ZDMC 4HROA 2KDBA 1L6UA 1GB1A 3H1UA 3RNFC 2BWFA 4TV3A 4BFRA 3QK0A 5CHWA 1B55A 1WXAA 1W1GA 1F52A 3ZIMA 2Z0DB 1OTRB 1K52A 2DYBA 2JRHA 3FILA 3C8YA 3A1QA 4JKEA 4ASWC 4K1RB 1ZPSA 2TSSA 2Y5BB 5JHBA 4PS8A 4ILGB 3QC8B 2O6VA 1XQQA 2K6QA 4Z2NA 4M8NA 5DPTA 3OG5A 3FVCA 4KSKC 4K7UA 2H88B 2L52A 2PZ1A 1QF6A 2ZJDA 1IP9A 5E6OA 1FAOA 5BYQA 1V1PA 3V60A 1XLNA 3PLVA 4L1BA 5DH9B 4NJ6A 2K9XA 3HM3A 4YWGG 3ZNHB 5IO9A 4ICUA 2PEAA 1C9FA 5CLQB 5D94A 4RCOA 5HE2A 1HQRD 2DZKA 1J7CA 2WXOA 1E6EB 4K3CA 1WSPA 2ZEQA 2L3ZA 3ZUNA 3RCPA 1K51A 1UD7A 3QWZB 4TQ1A 1F1HA 1FNUA 3BYTB 2BYEA 4NAMA 3A8PA 2K49A 2LFIA 2JP2A 4I6PA 5DPSA 3K9PB 3TW1A 2I5CA 5HG2A 4FADA 1BT0A 3BWUD 3OJ3A 2RSUA 5FR3A 1FRDA 2COPA 2IYBA 1MFWA 3I57A 1T0QC 1I4QA 1VZ8A 4QAYA 3PREA 4H8SA 1BTKA 2WXQA 4KDLB 2CHZA 2BYTA 1GGOA 4HAXB 4QXAB 2KLCA 2MDXA 3DVGX 1UPRA 4ILHA 4UDUC 4XYCA 5IJMA 1OEYJ 2C7NB 2FIFA 3KYCD 2L1AA 4GN1A 3KUDB 3A33B 1AW7A 4YSZB 3NS1A 4GZUA 2D11A 1E9MA 4W9LA 1Q1OA 2ON8A 2ROZB 3FEHA 1TY0A 2UWQA 4MH0E 4YONA 4A6FA 4MGZE 5D7GA 1YQBA 4KHAA 2L32A 1WMHA 2R2YA 1WGRA 2MBBB 2RNRB 2DYMA 4JX1C 4N59A 4DBBA 4XZ4A 3SEBA 2D07B 2LUMA 2BS4B 4MSQB 3AU5A 3D8DA 2ONQA 2WDTB 4JLCA 2KC2A 1AWDA 1WF9A 2EC1A 1LFDA 2P0HA 3KWLA 3N9YC 3P42A 3W9CB 4MH8A 2K25A 2P0FA 1UWXA 3RN9C 2GB1A 1F77A 1WX8A 5GMVA 4BKTA 3P4RB 3OHMB 2YVCA 2LMCA 5AUKA 5CHFA 1T0YA 4KX6B 1A70A 4GPTB 4PT5A 5LOPB 1ZSQA 3M62B 3SYXA 4W9EA 2GI9A 2WLBA 1ZGUB 2GBMA 2FCSA 2GMIC 4ARIA 2IGGA 1OEYA 2R2QA 1F0ZA 1FGYA 3AE5B 5IKCM 3Q14C 2KT7A 2YSZA 3O65B 1BUIC 4FN2A 1U5DA 3VUYA 1Y19B 1LW3A 1PFDA 2LGSA 3X23A 1FIQA 2WXRA 3NJTA 3L10B 1TJEA 1V86A 1YMHE 4AUQC 2CHWA 4MDKE 1UZXB 5EE3A 1FFVA 2Z14A 1RFKA 2PTLA 5IOIA 1G6JA 1QQRA 2DZJA 3O13A 1X1FA 5C1ZA 1ZC3B 3A9KB 2OTXA 2MBOA 3P4PB 3NHEB 5LXHA 4TQ0A 3V61A 2JU6X 2KACA 4IWQA 1JW9D 3U12A 1YJJA 4MACA 3A9JB 2RGFA 3L54A 3QQ8B 3DVNU 1RJ2A 2V1YA 3WA0A 2MBEA 5IP4D 5HFYA 1WGKA 1N60A 4D6WA 4HB3B 1L4DB 4MGKE 4RGOS 2KGXB 1I4XA 3PTFC 2MFQA 4JIOU 4KV2A 3SR6A 3BVMA 5AZGA 2NVUI 1GC6A 4KVGB 5CX3A 1R4NI 2WU2B 3DBRB 1XXGA 2KMAA 4JE3B 3L4PA 2RGNB 2KFKA 2KD0A 1EGXA 2HJ1A 3AEEB 1C4CA 2IO3B 3AM9A 1KRHA 2IPKD 1WIAA 4WJ7A 3NZSA 1ZE3D 4F7UP 2REXA 2KUPA 4LTUA 1FD6A 2JVCA 1ZKHA 3RZFA 1M94A 4MGYE 1KLVA 1LO5D 4KGRA 3HVZA 3R2IA 4LDTD 1V5MA 4PNKA 2H7EA 2SAKA 4LDTB 1PQSA 2MJEA 3AEFB 3DBLB 4P1CC 1WJ6A 2V9HA 3AB5A 1WXVA 2C60A 4RF0A 1DYNA 1JCKB 2D5GA 3DQVA 3SBGA 2RVBB 3QX1A 2W54A 3NVYA 1TIFA 2KDEB 1EWYC 5KHOA 2DWQA 3VXWA 3ZRCA 3LJ3A 2Z0PA 2V76A 5M4YB 1U5FA 4NY0A 1IPGA 1TZOA 1F2RC 2JXXA 3P4SB 1T5XD 2KN5A 3QAQA 2X0SA 4GDKA 2BF8B 1IRSA 1P3RA 4WJNA 4EE2A 2I5FA 3ZNGC 2YS5A 3MHZA 5KHQA 5FI0A 3PSEB 4JKGB 3PSCA 1D5MC 1SE4A 2NPTA 1KI1B 2BQQA 2LVPA 4M0WA 2INNE 1ZXIA 3FC4A 3VIAA 2DA0A 2LGDA 2J0JA 1T3QA 4A3OA 2ZPYA 4KHBA 1C4PA 4IC7B 3FAHA 4JGHB 3EPYA 1P1AA 3R2TA 2RMMA 5C5BB 4ZRPA 2IDYA 5KQ1A 4W9GA 2KDMA 2DHKA 2KJHB 3AE2B 3JSVB 2CY4A 2WXKA 3DHHC 2CU1A 3GYOA 4PYUA 2QEJC 2KFJA 4MEMA 1AWEA 1I7HA 3DVNV 1SHCA 3P6AA 2JY6A 2WWZA 1A5RA 2GCLA 1VR9A 3FP5A 1WM2A 1YN5A 2R09A 1D4BA 3LXFA 4A8XC 1QC6A 2KHWB 3GP7A 1QILA 4K17A 2G35A 1FCLA 1L7YA 2IY0B 2WXNA 4RGTA 1F2RI 2RSGA 1Q67A 2WQYB 2AYOB 2EKIA 2ZPNA 4CHKA 4DDGD 5HE0A 2NBWB 1WXQA 2CKHB 4IM3A 2IO0B 4KZ0A 2JYTA 3MTNB 1IGCA 2DYQA 2PW9A 1DROA 5D27A 3ZKJC 1WG7A 2INDC 2MJ3A 3QA8A 1WY8A 4AS1A 3A58A 2OJWA 2KMMA 4P16A 3N1XC 1SIFA 1ZXHA 3TSSA 2K8EA 1K53A 4GOCA 4CQNA 1CK1A 4WAAA 3LJUX 1RRBA 3W5VB 2K5PA 2BS3B 1NU2A 3ODWA 1FM0D 3WYFB 4YTNB 2WDVB 3ETRA 4DHZB 4RM8A 1XLOA 3V5WA 3UGBB 3IT6B 4BBKA 3VTVA 2GBNA 4YTPB 1V8CA 1M7EA 2I1JA 2ZKMX 3U7DA 2LULA 1YQ4B 1NTYA 4ZRIA 4GGQA 1IUEA 1WGQA 1PUTA 4XGAB 1OQRA 2CY5A 2PLPA 5IA7A 3W1SA 4TKNA 3ZJVA 1J8CA 2Q13A 2J42A 2FCQA 1Y5OA 3VUXA 4LNKA 4IUMB 1YJ1A 1UNSA 4AJWA 4H2AA 3HHMA 5IAAC 2CB8A 2RUKB 1RFAA 2B76B 1VDVA 1I4GA 3RMKC 1N5XA 3TJPA 2LUEA 1CJEA 3W1YA 1V97A 4LJPB 2GOWA 1VZ6A 3J9CA 1D3ZA 1YQ3B 3Q8EA 3CIKA 2PVOD 2C9WB 3EFCA 1E7PB 2L83A 2BYFA 1XLQA 1D5XC 2WNMA 2C5LC 4C4VB 4HJGE 3I3TB 4BVUC 2CJNA 2ZW1A 1OGWA 2PMVA 3M1IB 2D9VA 5BMHA 4JPSA 3AU4A 2Y3AA 2WH5A 1K5DB 4P7IA 3OJ4B 1E90A 5IRSA 5DHAB 1TT5B 1GB4A 1ACAA 3FSSA 2Y5PA 5J2RA 1P9DU 2IZVB 2GLSA 1ZVRA 3WCQA 2Z59B 2BKFA 1E7UA 2N9PC 3PG7A 2QCZA 3T06A 1WRDB 1ZW7A 2Y8FA 3TEYA 2MCNB 4JK8A 1TKYA 1SGHA 3K9OB 3VR8B 4YSXB 3GB1A 3SFDB 3IVFA 3OAWA 4W9CA 2OEDA 3VH3B 3R66C 2GS0A 1V5TA 1X11A 1L0VB 3JYUA 1KZ7A 2WU5B 3MJ5A 4JKHA 1SE9A 1WVHA 3TCAA 2AEHA 5D3IB 1Q5WB 2G4DB 3PV1A 4DK5A 4IM0A 2JXTA 3ALBA 3ML4A 3RZWC 5DI9B 2RQ1A 1WYGA 1JALA 3F0WA 4JL9A 4MY6A 1UBQA 1QOBA 1XO3A 1C78A 1YOVB 2DNFA 2W3RA 2M0XA 4L23A 2QIEB 1YD8U 2DAJA 5AZHA 1WXMA 5D2MB 4F7GA 3TO1A 1MIZB 2Y7BA 4C7YA 3SNHA 4XC2A 1WGGA 2J7QB 3KH0A 1KM7A 2OOBB 3JVZX 1TJ6A 5KCVA 1TTNA 2RD0A 4DHZE 3NWAA 2FJ9A 4D2KA 2HDEA 3L17A 3Q3MC 1QOAA 3NVWA 2ACZB 2KVZA 3DOWA 3MP9A 2DIKA 1S3SG 3Q8BA 2WP9B 1HB6A 1L2NA 4HPLB 1UWMA 3ZYYX 5H8YE 1DDMA 2CU3A 3W5UB 1SJED 3M63B 2BGFA 1JROA 1P0RA 2PVGC 2UVMA 2ZZPB 2NR2A 1QLBB 3OWEB 4REZA 1SJHD 1TY2A 1PGBA 2CAYA 5L83A 1V9JA 1GG3A 3PEGA 2KUQA 1MPHA 4RH6A 4WQOB 2LOZA 3PRPB 4ANUA 4C0AA 2FE8A 4ZDVA 1ZP0B 2LKOA 3IAS1 4AJYB 4BBNC 2I1KA 1T6BX 3DBHB 2KKCA 3NRZA 2W2XD 3N7CA 3SDLC 4JKAA 2DKPA 3BJIA 2FAZA 1DYQA 3DCGA 4M01A 2ELAA 1VRAB 3KUZA 4W9HA 4AQ7A 4EKUA 1T0SC 4GIVA 1WJNA 3RI7C 2LHDA 1KOTA 5TSSA 2M0AA 2BPSA 3FKYA 3UI3A 1EWCA 1NYRA 2ZNVC 4JK9A 4TYZA 2FUHB 2FJLA 1NEKB 3ZLZA 3L16A 1QOGA 2QJLA 2O2VB 3E9SA 4WSFA 3PP2A 4HAZB 1IYFA 4AOFA 3AEDB 4DXGA 2LRWA 4IG7B 4KKJA 1FNVA 2COFA 3B08A 1RM6C 3UIPB 3D8EA 3NWDA 2JT4B 2D3CA 1GNUA 5JLJB 3AI5A 3PZ7A 4CHMA 2KDFB 1HTOA 1HEZE 5CHVC 3S2AA 1KBLA 2VH1A 1DOYA 1GJZA 1U5EA 1WWTA 4DWFA 3DXEA 3A9KA 2R82A 1WX9A 2YS1A 2EJ8A 3D32A 1OMWA 1V88A 1ROEA 4FXCA 2N4FA 2WHIA 1Y56A 4KAXB 4RM9A 3A9JA 1UF0A 5DCNA 1Z87A 2LGXA 5BO4B 1FHWA 1L4ZB 2GRIA 1YN3A 3UQAA 4ICVA 2FBWB 4HKQA 2K39A 5HI1A 1SF0A 2BB6A 4XX5A 3MC9A 2L1CA 1XKEA 3APDA 3IXSA 2NS5A 4A55A 1WM3A 2ADZA 1WGYA 2NTTA 1NI2A 3VTWA 1SB3C 4LJOB 2K3UA 1NBFC 1TKEA 3W1SC 2XEWA 4KHOA 1FXAA 1DBHA 1ZDXA 4EZKA 2GUMA 2RPVA 3T3NA 2YF0A 3ZXVA 1XCGA 2G1EA 4FLHA 3DWGC 2N9EB 2MKRA 2SEBD 2KX3A 2JZ3B 4HRSA 3IFWB 2BYVE 2DFKA 5JXVA 2E2XA 3IBEA 3ULBA 2D9WA 4MM3B 3ODOA 1RAXA 2ZCCA 2DZMA 3PS6A 1JWAD 2G45B 2V4LA 2L05A 4JKDA 4HPMB 2D2QA 4JK7A 4N9F4 2JZPA 2KNBA 3KVFB 1DGJA 1PGAA 2M56B 4IAPA 2NTSA 2HD5B 1WRIA 2J0MA 2M14A 4OHJA 1PGXA 3B1LX 3L08A 2HE7A 4FJVB 2LASA 3TFMA 3NW8A 2HJ8A 2KWUB 2KQ4X 4GMVA 2HTHB 1ET6A 1ST7A 1P7EA 2HRJA 3RNGC 3ZVVA 2DBYA 1AYFA 2DHIA 1WH3A 1NTVA 4JKGA 4EEWA 1K8RB 4M02A 2N7DA 3CIRB 1U5GA 3ECIA 5E6PA 3NVVA 4BAXA 2DZIA 4HEA1 4PK1A 2YEPB 3ML8A 2K22A 3GZNI 4RMAA 2W2XC 4IDIA 4C56C 4OVZA 4N58A 3ZVRA 4XE0A 1J0GA 3ULCA 3AN1A 1OQNA 2LVQA 2XN9C 3V6CB 2MQJA 5C5BA 1E8ZA 4HATB 4Q2JA 1YX6B 4OT1A 2UZRA 2ABDA 3AEBB 4GDLB 3JSVA 1KZGA 2QSDA 1E10A 4TMAB 3GYPA 5C2TB 3DBSA 4ILJA 2CR5A 1E8YA 4LNFA 3TEZA 2FDQA 2PIAA 1QT9A 1SIJA 1ZM0A 2H89B 1WJ1A 1I2HA 4QJ5B 4Y94A 2KLGA 3V3XA 1CMXB 3LDZE 4KDIC 2CODA 1C4AA 1MHXA 2YRYA 4W9DA 3A8QA 4DDID 5CLLB 3QWMA 5D3DA 2WYQA 1EVHA 2D9XA 2LHEA 3P4QB 1R4MB 3FLVA 2M4NA 2RPQA 1UNPA 2Z4DA 2WX0A 1P5TA 3B9JA 4LNNA 3T3OA 2N9LA 2KANA 3QHTA 4BOSC 1U2BA 3L0WB 1QQGA 3VQIA 3VUWA 3G9WA 1NDDA 1TQZA 3V62A 3M3JA 2IGDA 4WAFA 1JWBD 3VTUA 3NUHB 3Q8AA 1YX5B 5C79A 3SU8X 1NENB 4K7SA 3N3KB 5DPWA 2DHJA 3PVLA 2OQBA 4B6HA 2OHFA 2M8SA 4L1RA 2AL6A 1P3QU 1SEBD 4TUUA 2L8JA
chains in the Genus database with same CATH topology
2LGYA 1VBGA 2N7EA 4ANWA 3P2BA 3PZDA 2MW5A 1TBEA 3NSUA 1Y8RC 3ZNID 2MX2A 4G0NB 5JVLA 2FCMA 5J3QA 2ZCBA 5D3YA 3RUIB 2DX5B 5JH5C 1XR0B 3PPAA 3CSTA 1EF5A 5DHFB 1XD3B 1N3HA 4HAVB 2VRWB 2NZ8B 1H10A 1UNQA 4A5KA 4E71A 4ZRKA 5L81A 5EFXA 3KRXA 3Q3FA 5D6JB 2M17A 4WWNA 3IHPC 2J59M 4WWPA 4KIKB 3CMMB 1LM8B 2K2UA 3RULA 3TBLD 4E74A 2VRRB 2ELBA 2CHXA 4NPNA 4EFOA 2KCJA 1FGZA 3E9LA 4FHJA 1VBHA 4MGIE 3A4SC 2NCNA 2LJ5A 2CQUA 4K81A 4CO7A 4BKSD 1U27A 4DBGA 1GUAB 2LVOA 4B95A 1E7VA 4MK0A 2KZRA 1I7AA 5HE1A 2CRFA 3JW0X 3VH4B 3ML9A 1HE8A 4I6NB 3RT3B 5FR6A 1MK9B 4IFSA 4B9KA 1NTIA 4FHKA 1U4AA 1WE7A 3QCAA 4PQ0A 3A98B 2NBVB 2K00A 3H7PB 3PT2B 4EUTA 4A6HA 3EHVA 2PE6B 1Z5SB 3QBVB 1MAIA 2YS3A 1EUVB 2LYDA 4ANVA 2MP2A 3MDBC 3RYTA 1UNRA 2COAA 2K1FA 1KC7A 2K6DB 1S1QB 2EMTA 4FBJB 3PRMB 1WGDA 4NAWB 4HAUB 4HAYB 2KTRB 2W2WA 3CF6E 2M38A 3GOEA 4NSWA 1XODA 1MIXA 2N1VA 5C23A 5C6RA 4W9FA 3IG3A 3WAPA 3WAOA 2K2JA 2IO2B 2XK5B 3KZ1A 3CXBB 2VSZA 1XT9B 4CHJA 5HE3A 5TR5A 1C3TA 3DBRI 3VVWB 4PS7A 3QJZA 3APCA 5JHGA 4WVFB 2WX1A 3NZUA 3H7SA 1WJUA 4F1SA 2G3QB 2JF5A 2ZVNA 1WFYA 4FJYA 4YL8A 4JKCA 4HB4B 5GOWB 1BWNA 2DKQA 5JZEB 2LG1A 4HCPB 1WI1A 4GXBA 2N23A 2L2IA 3DVGY 1OY2A 4URKA 2L00B 2C7MB 2GJYA 3KRWA 2QKLA 2LI5A 3M95A 2O2VA 2A5UA 4A3PA 3HK0A 3UQBA 1MG8A 4IOYX 1TGZB 1WJMA 3RCZA 3MHSD 2LWPA 3HQCA 4II3B 4EZLA 1XX0A 3KW5B 1MKEA 3SV1A 2P0DA 4F7HA 1VCBA 2KC1A 2KWVB 5J3TA 2CS4A 2MRPA 1LQBA 1WXSA 4HHVA 1WR6E 4G50A 2UYZB 1UELA 2LXCA 3BY4B 2D9YA 4DHJD 3TVVA 1I35A 3HW2B 1UBIA 3PHXB 4DHJB 4MJSB 4CYEA 1K5GB 3ZTCA 3L13A 3SHQA 4G3XB 1Q0WB 4LCDE 5FI1A 2VKIA 3SUZA 2RR9A 3ENEA 4W9IA 3P7ZA 4MT7A 1WYWB 4BKGA 3DXCA 4GU2A 3TMPB 3N30A 1WGUA 4MM3A 2DN6A 4HB0B 1UGMA 2KDIA 2Z0OA 2QHOA 5L95C 2A4ZA 4WJPA 3NY5A 4IM2A 2LD9A 2IFSA 1PLSA 3PVUA 4HCNB 1FXTB 4ANXA 2IYDB 2IBIB 2HTHA 1V89A 2DENB 2JRIB 3A4RA 1MK7B 3VDZA 2YLMA 3FM8C 1LB1A 3C0RB 2J0KA 2JWZA 1RLFA 1J19A 2AWTA 4IW0A 2O6VD 3A1QB 4MELA 3APFA 3PRZA 4W9JA 2KQ7A 2O6VB 2FIDA 4WJQA 4JKFA 4FJZA 1E8WA 3E9PA 4F8CB 4GDLA 2BKRB 5JP4A 4II2B 3RD2A 3D8FA 4B6WA 1LXDA 1FHXA 1JRUA 1F9JA 1HB8A 2PJHA 4M8MA 3SO6A 2KVRA 4J6IA 3MJWA 3UF8A 1EF1A 5D3XA 1U29A 4NNJB 4E3CA 2R0DA 1WE6A 4D0NB 1WR1A 4JKBA 2DYNA 4HDOA 2JPHA 4WJOA 4GB9A 1V6EA 4ZYNA 1FB8A 2UZSA 2D4QA 4AP4C 5LXIB 3ZDTA 4NQLB 1V81A 2GBRA 2G4SA 2B3AA 1WX7A 4WWOA 4I6LB 4L6EA 3KY9A 3R3MA 2JUOA 2KJ6A 3BINA 4A6FB 4EJNA 1WMHB 1UH6A 1WZ0A 4IWPA 2DX5A 1WGHA 4EZJA 5G2NA 3DDCB 5J18A 1ISNA 3HM6X 3DXDA 1UPQA 5AEKB 4AWJA 2KO3A 4HJKA 4KIKA 3T9LA 3OANA 2LOXA 2H7DA 2R2OA 3O96A 3X0WA 5JHAA 4GMXB 5LLIA 4K2OA 1OQYA 3R7RA 5JHHA 2LZ6A 3AJ4A 2D9ZA 1TZ1A 2YT1A 1X86A 1PFJA 3DBHI 3ZW3A 2M1MA 2C7HA 1DDVA 3HIZA 3VOQA 2YT0A 3QIJA 2IY1B 2JZZA 4BKSA 5HKHA 4DX8A 2KOXA 4PS3A 1W1HA 4HK2A 1WZ3A 2Z0EB 3ZTDA 3ODXA 1Z2MA 3N32A 1BAKA 2EKEC 4A20A 1FHOA 2N9XA 2XBBC 3H6NA 3ZRFA 4Z2MB 3PLUA 2L0FA 5J17A 3H7PA 4DXAB 1V61A 2KTFA 3E66A 4PYZA 2QKMA 4KZCA 2W9NA 2NBUA 3UIOB 2IO1B 1V49A 4XWXA 4KSLC 2D10A 4BBNF 2DX1A 3ENBA 3OLMD 3EC8A 3ONSA 1RRPB 2KFKB 3EECA 2EMSA 1V5OA 1FOEA 1M7RA 5D3VA 2OJRA 1EAZA 3NOBA 4NAWA 2NMBA 4ZRJA 2MWNB 2KTRA 2N1WA 4BOZB 3VAWA 4HDQA 1P98A 5J3YA 4NQKE 5DPRA 3ZO5B 2FCNA 3SBTA 2K8BA 1YIWA 4FULA 3R7QA 1NVLA 1J0WA 4OVVA 2XK5A 4MSMB 2XQNM 2PE9A 4A6KA 1TXDA 2Z0QA 4HB2B 1W1DA 3AXCA 3Q3JA 1QZEA 4FA6A 3NS8A 1ZC4B 3KSYA 1X1MA 2KXJA 3F5RA 4DX90 2KJRA 1V5UA 1V2YA 1C1YB 3T8MA 4GDKB 4OVUA 5D3WA 1VD2A 4K2PA 2NPTB 3TIXA 2GBJA 4M0WB 5DIFB 1H8CA 1JDEA 4X57B 3UZTA 4KHBB 2DYOA 2GBKA 3DPDA 2DTCA 2ROVA 2KX0A 3VHTC 1E5WA 3WIMA 4GSWA 1UEFA 3WANA 1P6SA 2ASQA 2ZNVB 2D3GA 2X18A 2Y8GA 2MBHA 4JQWC 4EOYA 2LBBA 1XD4A 2V3SA 3WAMA 2K8HA 5G55A 2MBQA 1PMSA 1AQCA 2MSED 3U8ZA 2BCJA 2K8CA 1H4RA 2LRUA 3PVWA 2GCJA 1X1GA 2DAFA 4MJSA 1EO6A 3KUCB 2MA9B 3PGEA 2FNJB 3B0AA 1DIKA 4K7WA 2COCA 3TL5A 3KYDD 4IWOA 1GC7A 1HBKA 2L0TA 2L76A 4HXDA 2L7RA 4EMOA 3PHWB 3AULA 1BTNA 5KQ4A 3DBLI 3WALA 4HVBA 2KMCA 3UINB 1R4MI 1V5PA 1AARA 1WI0A 2ZVOA 1X05A 1DDWA 5CTRC 2P8VA 1KJTA 4HAWB 3MPXA 4NJ7A 2RLOA 2KK8A 3ZNZB 1E8XA 2KQSA 4W9KA 2AL3A 4F7ZA 3V6EB 4HLEA 2LXAA 3U30A 2MP2B 2DHZA 3QARA 4HWIB 5C16A 2N0YA 3EFUA 3VFKA 2MLBA 2PPHA 5AZFA 3E9OA 1WJ4A 5LONB 2MWSB 3H9DA 3CSFA 1I42A 2KWCA 5E6NA 1V80A 2BWES 2DLWA 5EDSA 4G11A 3SD5A 3ZDMC 2KDBA 3H1UA 2BWFA 4TV3A 4BFRA 3QK0A 5CHWA 1B55A 1WXAA 1W1GA 3ZIMA 2Z0DB 1OTRB 2DYBA 2JRHA 3A1QA 4JKEA 4ASWC 4K1RB 2Y5BB 5JHBA 4PS8A 4ILGB 3QC8B 2O6VA 1XQQA 2K6QA 4Z2NA 4M8NA 5DPTA 4KSKC 4K7UA 2PZ1A 2ZJDA 1IP9A 5E6OA 1FAOA 3V60A 3PLVA 5DH9B 4NJ6A 3HM3A 3ZNHB 4ICUA 2PEAA 5CLQB 5D94A 5HE2A 2DZKA 2ZEQA 2L3ZA 3ZUNA 3RCPA 1UD7A 3QWZB 4TQ1A 2BYEA 3A8PA 2JP2A 4I6PA 5DPSA 3K9PB 3TW1A 2I5CA 4FADA 1BT0A 3OJ3A 2RSUA 2COPA 2IYBA 3PREA 4H8SA 1BTKA 4KDLB 2CHZA 1GGOA 4HAXB 2KLCA 2MDXA 3DVGX 1UPRA 4ILHA 5IJMA 1OEYJ 2C7NB 2FIFA 3KYCD 4GN1A 3KUDB 3A33B 4GZUA 2D11A 4W9LA 1Q1OA 2ROZB 3FEHA 2UWQA 4MH0E 4YONA 4A6FA 4MGZE 5D7GA 1YQBA 4KHAA 1WMHA 1WGRA 2MBBB 2RNRB 2DYMA 4DBBA 4XZ4A 2D07B 4MSQB 3AU5A 3D8DA 2WDTB 4JLCA 2KC2A 1WF9A 2EC1A 1LFDA 2P0HA 2K25A 2P0FA 1WX8A 5GMVA 4BKTA 2YVCA 5CHFA 1T0YA 4GPTB 5LOPB 1ZSQA 3M62B 3SYXA 4W9EA 1ZGUB 2GBMA 2FCSA 2GMIC 1OEYA 2R2QA 1FGYA 2YSZA 3O65B 4FN2A 1U5DA 3VUYA 1Y19B 1LW3A 3X23A 3L10B 1V86A 4AUQC 2CHWA 4MDKE 1UZXB 1G6JA 2DZJA 1X1FA 5C1ZA 1ZC3B 3A9KB 2OTXA 2MBOA 3NHEB 5LXHA 4TQ0A 3V61A 4IWQA 3A9JB 2RGFA 3L54A 3QQ8B 3DVNU 1RJ2A 2V1YA 3WA0A 2MBEA 4HB3B 4MGKE 2KGXB 3PTFC 2MFQA 4JIOU 4KV2A 5AZGA 2NVUI 1GC6A 4KVGB 5CX3A 1R4NI 2KMAA 2RGNB 2KFKA 2KD0A 1EGXA 2IO3B 1WIAA 4WJ7A 3NZSA 4F7UP 2REXA 2KUPA 2JVCA 1ZKHA 3RZFA 1M94A 4MGYE 1KLVA 4LDTD 1V5MA 4PNKA 2H7EA 4LDTB 1PQSA 1WJ6A 1WXVA 2C60A 1DYNA 3DQVA 3SBGA 2RVBB 3QX1A 2KDEB 5KHOA 3VXWA 3ZRCA 3LJ3A 2Z0PA 2V76A 1U5FA 4NY0A 1IPGA 2JXXA 3QAQA 2KN5A 2X0SA 4GDKA 2BF8B 1IRSA 1P3RA 4WJNA 2I5FA 3ZNGC 2YS5A 5KHQA 5FI0A 3PSEB 4JKGB 3PSCA 2NPTA 1KI1B 2LVPA 3VIAA 2DA0A 2LGDA 2J0JA 4A3OA 2ZPYA 4IC7B 4JGHB 3EPYA 1P1AA 5C5BB 5KQ1A 4W9GA 2DHKA 2KJHB 3JSVB 2CY4A 2CU1A 3GYOA 4PYUA 2KFJA 4MEMA 1AWEA 3DVNV 1SHCA 3P6AA 2JY6A 2WWZA 1A5RA 2GCLA 3FP5A 1WM2A 2R09A 1QC6A 2KHWB 4K17A 2G35A 1L7YA 2IY0B 2RSGA 1Q67A 2AYOB 2ZPNA 4CHKA 4DDGD 5HE0A 2NBWB 2CKHB 4IM3A 2IO0B 4KZ0A 3MTNB 2DYQA 1DROA 5D27A 3ZKJC 1WG7A 3QA8A 1WY8A 1SIFA 4GOCA 4WAAA 3LJUX 1RRBA 1NU2A 3ODWA 3WYFB 4DHZB 4RM8A 3V5WA 3UGBB 4BBKA 3VTVA 2GBNA 1M7EA 2I1JA 3U7DA 2LULA 1NTYA 4ZRIA 4GGQA 1WGQA 2CY5A 5IA7A 3W1SA 4TKNA 1J8CA 2Q13A 2FCQA 1Y5OA 3VUXA 4IUMB 1YJ1A 4AJWA 3HHMA 5IAAC 2CB8A 2RUKB 1RFAA 3TJPA 2LUEA 3W1YA 4LJPB 2GOWA 1D3ZA 3CIKA 2C9WB 2BYFA 2C5LC 3I3TB 4BVUC 1OGWA 3M1IB 2D9VA 3AU4A 2WH5A 1K5DB 4P7IA 3OJ4B 1E90A 5DHAB 1ACAA 3FSSA 5J2RA 1P9DU 2IZVB 1ZVRA 2Z59B 2BKFA 1E7UA 2N9PC 3PG7A 3T06A 1WRDB 1ZW7A 2Y8FA 2MCNB 4JK8A 1SGHA 3K9OB 3IVFA 3OAWA 4W9CA 3VH3B 3R66C 2GS0A 1V5TA 1X11A 3JYUA 1KZ7A 4JKHA 1SE9A 1WVHA 3TCAA 2AEHA 1Q5WB 2G4DB 3PV1A 4DK5A 4IM0A 3ALBA 3ML4A 3RZWC 5DI9B 2RQ1A 3F0WA 4JL9A 4MY6A 1UBQA 2M0XA 1YD8U 2DAJA 5AZHA 1WXMA 5D2MB 4F7GA 3TO1A 1MIZB 2Y7BA 3SNHA 4XC2A 1WGGA 2J7QB 3KH0A 1KM7A 2OOBB 3JVZX 1TJ6A 5KCVA 1TTNA 2RD0A 4DHZE 2FJ9A 3L17A 3DOWA 2DIKA 1S3SG 1HB6A 1L2NA 4HPLB 1DDMA 3M63B 2BGFA 1P0RA 2UVMA 2ZZPB 2NR2A 2CAYA 5L83A 1V9JA 1GG3A 3PEGA 1MPHA 4WQOB 2LOZA 3PRPB 4ANUA 4C0AA 4ZDVA 2LKOA 4AJYB 4BBNC 2I1KA 2KKCA 2W2XD 3N7CA 3SDLC 4JKAA 2DKPA 3BJIA 2FAZA 3DCGA 2ELAA 3KUZA 4W9HA 4EKUA 4GIVA 1WJNA 1KOTA 2BPSA 2ZNVC 4JK9A 4TYZA 2FUHB 2FJLA 3ZLZA 3L16A 2O2VB 4WSFA 3PP2A 4HAZB 1IYFA 4AOFA 2LRWA 4IG7B 2COFA 3B08A 3UIPB 3D8EA 2JT4B 1GNUA 5JLJB 3AI5A 4CHMA 2KDFB 5CHVC 3S2AA 1KBLA 1GJZA 1U5EA 4DWFA 3DXEA 3A9KA 2R82A 1WX9A 2YS1A 2EJ8A 3D32A 1OMWA 1V88A 2N4FA 4KAXB 4RM9A 3A9JA 5DCNA 1Z87A 2LGXA 5BO4B 1FHWA 3UQAA 4ICVA 2K39A 4XX5A 2L1CA 1XKEA 3APDA 2NS5A 1WM3A 2ADZA 1WGYA 1NI2A 3VTWA 4LJOB 1NBFC 3W1SC 2XEWA 4KHOA 1DBHA 4EZKA 2YF0A 1XCGA 4FLHA 2N9EB 2MKRA 2KX3A 2JZ3B 3IFWB 2BYVE 2DFKA 2E2XA 3IBEA 3ULBA 2D9WA 3ODOA 1RAXA 2ZCCA 2DZMA 3PS6A 2G45B 2V4LA 2L05A 4JKDA 4HPMB 2D2QA 4JK7A 4N9F4 2KNBA 3KVFB 4IAPA 2HD5B 2J0MA 2M14A 3B1LX 3L08A 2HE7A 4FJVB 2LASA 3TFMA 2HJ8A 2KWUB 4GMVA 2HTHB 1ST7A 2HRJA 3ZVVA 2DHIA 1WH3A 1NTVA 4JKGA 4EEWA 1K8RB 2N7DA 5E6PA 1U5GA 3ECIA 2DZIA 3ML8A 3GZNI 4RMAA 2W2XC 3ZVRA 1J0GA 3ULCA 1OQNA 2LVQA 3V6CB 2MQJA 5C5BA 1E8ZA 4HATB 1YX6B 2UZRA 2ABDA 4GDLB 3JSVA 1KZGA 3GYPA 3DBSA 4ILJA 2CR5A 1E8YA 2FDQA 1ZM0A 1WJ1A 1I2HA 4Y94A 2KLGA 1CMXB 3LDZE 4KDIC 2CODA 2YRYA 4W9DA 3A8QA 4DDID 5CLLB 3QWMA 2WYQA 1EVHA 2D9XA 3FLVA 2M4NA 2RPQA 1UNPA 2WX0A 1P5TA 2KANA 3QHTA 4BOSC 1U2BA 3L0WB 1QQGA 3VQIA 3VUWA 3G9WA 1NDDA 1TQZA 3V62A 3M3JA 3VTUA 1YX5B 5C79A 3SU8X 4K7SA 3N3KB 5DPWA 2DHJA 3PVLA 2OQBA 4B6HA 2M8SA 2AL6A 1P3QU 4TUUA 2L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGY A;  2N7E A;  4ANW A;  3P2B A;  3PZD A;  2MW5 A;  1TBE A;  3NSU A;  1Y8R C;  3ZNI D;  2MX2 A;  4G0N B;  2FCM A;  5J3Q A;  2ZCB A;  5D3Y A;  3RUI B;  2DX5 B;  5JH5 C;  1XR0 B;  3PPA A;  3CST A;  1EF5 A;  5DHF B;  1XD3 B;  1N3H A;  4HAV B;  2VRW B;  2NZ8 B;  1H10 A;  1UNQ A;  4A5K A;  4E71 A;  4ZRK A;  5L81 A;  5EFX A;  3KRX A;  3Q3F A;  5D6J B;  2M17 A;  4WWN A;  3IHP C;  2J59 M;  4WWP A;  4KIK B;  3CMM B;  1LM8 B;  2K2U A;  3RUL A;  3TBL D;  4E74 A;  2VRR B;  2ELB A;  2CHX A;  4NPN A;  4EFO A;  2KCJ A;  1FGZ A;  4FHJ A;  4MGI E;  3A4S C;  2NCN A;  2LJ5 A;  2CQU A;  4K81 A;  4CO7 A;  4BKS D;  1U27 A;  4DBG A;  1GUA B;  2LVO A;  4B95 A;  1E7V A;  4MK0 A;  2KZR A;  1I7A A;  5HE1 A;  2CRF A;  3JW0 X;  3VH4 B;  3ML9 A;  1HE8 A;  4I6N B;  3RT3 B;  5FR6 A;  1MK9 B;  4IFS A;  4B9K A;  1NTI A;  4FHK A;  1U4A A;  1WE7 A;  3QCA A;  4PQ0 A;  3A98 B;  2NBV B;  2K00 A;  3H7P B;  3PT2 B;  4EUT A;  4A6H A;  3EHV A;  2PE6 B;  1Z5S B;  3QBV B;  1MAI A;  2YS3 A;  1EUV B;  2LYD A;  4ANV A;  2MP2 A;  3MDB C;  3RYT A;  1UNR A;  2COA A;  2K1F A;  2K6D B;  1S1Q B;  2EMT A;  4FBJ B;  3PRM B;  1WGD A;  4NAW B;  4HAU B;  4HAY B;  2KTR B;  2W2W A;  3CF6 E;  2M38 A;  3GOE A;  4NSW A;  1XOD A;  1MIX A;  2N1V A;  5C23 A;  5C6R A;  4W9F A;  3IG3 A;  3WAP A;  3WAO A;  2K2J A;  2IO2 B;  2XK5 B;  3KZ1 A;  3CXB B;  2VSZ A;  1XT9 B;  4CHJ A;  5HE3 A;  5TR5 A;  1C3T A;  3DBR I;  3VVW B;  4PS7 A;  3QJZ A;  3APC A;  5JHG A;  4WVF B;  2WX1 A;  3NZU A;  3H7S A;  1WJU A;  4F1S A;  2G3Q B;  2JF5 A;  2ZVN A;  1WFY A;  4FJY A;  4YL8 A;  4HB4 B;  5GOW B;  1BWN A;  2DKQ A;  5JZE B;  2LG1 A;  4HCP B;  1WI1 A;  4GXB A;  2N23 A;  2L2I A;  3DVG Y;  1OY2 A;  4URK A;  2L00 B;  2C7M B;  2GJY A;  3KRW A;  2QKL A;  2LI5 A;  3M95 A;  2O2V A;  2A5U A;  4A3P A;  3HK0 A;  3UQB A;  1MG8 A;  4IOY X;  1TGZ B;  1WJM A;  3RCZ A;  3MHS D;  2LWP A;  3HQC A;  4II3 B;  4EZL A;  1XX0 A;  3KW5 B;  1MKE A;  3SV1 A;  2P0D A;  4F7H A;  1VCB A;  2KC1 A;  2KWV B;  5J3T A;  2CS4 A;  2MRP A;  1LQB A;  1WXS A;  4HHV A;  1WR6 E;  4G50 A;  2UYZ B;  1UEL A;  2LXC A;  3BY4 B;  2D9Y A;  4DHJ D;  3TVV A;  1I35 A;  3HW2 B;  1UBI A;  3PHX B;  4DHJ B;  4MJS B;  4CYE A;  1K5G B;  3ZTC A;  3L13 A;  3SHQ A;  4G3X B;  1Q0W B;  4LCD E;  5FI1 A;  2VKI A;  3SUZ A;  2RR9 A;  3ENE A;  4W9I A;  3P7Z A;  4MT7 A;  1WYW B;  4BKG A;  3DXC A;  4GU2 A;  3TMP B;  3N30 A;  1WGU A;  4MM3 A;  2DN6 A;  4HB0 B;  1UGM A;  2KDI A;  2Z0O A;  2QHO A;  5L95 C;  2A4Z A;  4WJP A;  3NY5 A;  4IM2 A;  2LD9 A;  2IFS A;  1PLS A;  3PVU A;  4HCN B;  1FXT B;  4ANX A;  2IYD B;  2IBI B;  2HTH A;  1V89 A;  2DEN B;  2JRI B;  3A4R A;  1MK7 B;  3VDZ A;  2YLM A;  3FM8 C;  1LB1 A;  3C0R B;  2J0K A;  2JWZ A;  1RLF A;  1J19 A;  2AWT A;  4IW0 A;  2O6V D;  3A1Q B;  4MEL A;  3APF A;  3PRZ A;  4W9J A;  2KQ7 A;  2O6V B;  2FID A;  4WJQ A;  4FJZ A;  1E8W A;  4F8C B;  4GDL A;  2BKR B;  5JP4 A;  4II2 B;  3RD2 A;  3D8F A;  4B6W A;  1LXD A;  1FHX A;  1JRU A;  1F9J A;  1HB8 A;  2PJH A;  4M8M A;  3SO6 A;  2KVR A;  4J6I A;  3MJW A;  3UF8 A;  1EF1 A;  5D3X A;  1U29 A;  4NNJ B;  4E3C A;  2R0D A;  1WE6 A;  4D0N B;  1WR1 A;  2DYN A;  4HDO A;  2JPH A;  4WJO A;  4GB9 A;  1V6E A;  4ZYN A;  1FB8 A;  2UZS A;  2D4Q A;  4AP4 C;  5LXI B;  3ZDT A;  4NQL B;  1V81 A;  2GBR A;  2G4S A;  2B3A A;  1WX7 A;  4WWO A;  4I6L B;  4L6E A;  3KY9 A;  3R3M A;  2JUO A;  2KJ6 A;  3BIN A;  4A6F B;  4EJN A;  1WMH B;  1UH6 A;  1WZ0 A;  4IWP A;  2DX5 A;  1WGH A;  4EZJ A;  5G2N A;  3DDC B;  5J18 A;  1ISN A;  3HM6 X;  3DXD A;  1UPQ A;  5AEK B;  4AWJ A;  2KO3 A;  4HJK A;  4KIK A;  3T9L A;  3OAN A;  2LOX A;  2H7D A;  2R2O A;  3X0W A;  3O96 A;  5JHA A;  4GMX B;  5LLI A;  4K2O A;  1OQY A;  3R7R A;  5JHH A;  2LZ6 A;  3AJ4 A;  2D9Z A;  1TZ1 A;  2YT1 A;  1X86 A;  1PFJ A;  3DBH I;  3ZW3 A;  2M1M A;  2C7H A;  1DDV A;  3HIZ A;  3VOQ A;  2YT0 A;  3QIJ A;  2IY1 B;  2JZZ A;  4BKS A;  5HKH A;  4DX8 A;  2KOX A;  4PS3 A;  1W1H A;  4HK2 A;  1WZ3 A;  2Z0E B;  3ZTD A;  3ODX A;  1Z2M A;  3N32 A;  1BAK A;  2EKE C;  4A20 A;  1FHO A;  2N9X A;  2XBB C;  3H6N A;  3ZRF A;  4Z2M B;  3PLU A;  2L0F A;  5J17 A;  3H7P A;  4DXA B;  1V61 A;  2KTF A;  4PYZ A;  2QKM A;  4KZC A;  2W9N A;  2NBU A;  3UIO B;  2IO1 B;  1V49 A;  4XWX A;  4KSL C;  2D10 A;  4BBN F;  2DX1 A;  3OLM D;  3EC8 A;  3ONS A;  1RRP B;  2KFK B;  3EEC A;  2EMS A;  1V5O A;  1FOE A;  1M7R A;  5D3V A;  2OJR A;  1EAZ A;  3NOB A;  4NAW A;  2NMB A;  4ZRJ A;  2MWN B;  2KTR A;  2N1W A;  4BOZ B;  3VAW A;  4HDQ A;  1P98 A;  5J3Y A;  4NQK E;  5DPR A;  3ZO5 B;  2FCN A;  2K8B A;  1YIW A;  4FUL A;  1NVL A;  1J0W A;  4OVV A;  3R7Q A;  2XK5 A;  4MSM B;  2XQN M;  2PE9 A;  4A6K A;  1TXD A;  2Z0Q A;  4HB2 B;  1W1D A;  3AXC A;  3Q3J A;  1QZE A;  4FA6 A;  3NS8 A;  1ZC4 B;  3KSY A;  1X1M A;  2KXJ A;  3F5R A;  4DX9 0;  2KJR A;  1V5U A;  1V2Y A;  1C1Y B;  3T8M A;  4GDK B;  4OVU A;  5D3W A;  1VD2 A;  4K2P A;  2NPT B;  3TIX A;  2GBJ A;  4M0W B;  5DIF B;  1H8C A;  4X57 B;  3UZT A;  4KHB B;  2DYO A;  2GBK A;  3DPD A;  2DTC A;  2ROV A;  2KX0 A;  3VHT C;  1E5W A;  3WIM A;  4GSW A;  1UEF A;  3WAN A;  1P6S A;  2ASQ A;  2ZNV B;  2D3G A;  2X18 A;  2Y8G A;  2MBH A;  4JQW C;  4EOY A;  2LBB A;  1XD4 A;  2V3S A;  3WAM A;  2K8H A;  5G55 A;  2MBQ A;  1PMS A;  1AQC A;  2MSE D;  3U8Z A;  2BCJ A;  2K8C A;  1H4R A;  2LRU A;  3PVW A;  2GCJ A;  1X1G A;  2DAF A;  4MJS A;  1EO6 A;  3KUC B;  2MA9 B;  3PGE A;  2FNJ B;  3B0A A;  4K7W A;  2COC A;  3TL5 A;  3KYD D;  4IWO A;  1GC7 A;  1HBK A;  2L0T A;  2L76 A;  4HXD A;  2L7R A;  4EMO A;  3PHW B;  3AUL A;  1BTN A;  5KQ4 A;  3DBL I;  3WAL A;  4HVB A;  2KMC A;  3UIN B;  1R4M I;  1V5P A;  1AAR A;  1WI0 A;  2ZVO A;  1X05 A;  1DDW A;  5CTR C;  2P8V A;  1KJT A;  4HAW B;  3MPX A;  4NJ7 A;  2RLO A;  2KK8 A;  3ZNZ B;  1E8X A;  2KQS A;  4W9K A;  2AL3 A;  4F7Z A;  3V6E B;  4HLE A;  2LXA A;  3U30 A;  2MP2 B;  2DHZ A;  3QAR A;  4HWI B;  5C16 A;  2N0Y A;  3EFU A;  3VFK A;  2MLB A;  2PPH A;  5AZF A;  2MWS B;  1WJ4 A;  5LON B;  3H9D A;  3CSF A;  1I42 A;  2KWC A;  5E6N A;  1V80 A;  2BWE S;  2DLW A;  5EDS A;  4G11 A;  3SD5 A;  3ZDM C;  2KDB A;  3H1U A;  2BWF A;  4TV3 A;  4BFR A;  3QK0 A;  5CHW A;  1B55 A;  1WXA A;  1W1G A;  3ZIM A;  2Z0D B;  1OTR B;  2DYB A;  2JRH A;  3A1Q A;  4ASW C;  4K1R B;  2Y5B B;  5JHB A;  4PS8 A;  3QC8 B;  2O6V A;  1XQQ A;  2K6Q A;  4Z2N A;  4M8N A;  5DPT A;  4KSK C;  4K7U A;  2PZ1 A;  2ZJD A;  1IP9 A;  5E6O A;  1FAO A;  3V60 A;  3PLV A;  5DH9 B;  4NJ6 A;  3HM3 A;  3ZNH B;  4ICU A;  2PEA A;  5CLQ B;  5D94 A;  5HE2 A;  2DZK A;  2ZEQ A;  2L3Z A;  3ZUN A;  3RCP A;  1UD7 A;  3QWZ B;  4TQ1 A;  2BYE A;  3A8P A;  2JP2 A;  4I6P A;  5DPS A;  3K9P B;  3TW1 A;  2I5C A;  4FAD A;  1BT0 A;  3OJ3 A;  2RSU A;  2COP A;  2IYB A;  3PRE A;  4H8S A;  1BTK A;  4KDL B;  2CHZ A;  4HAX B;  2KLC A;  2MDX A;  3DVG X;  1UPR A;  5IJM A;  1OEY J;  2C7N B;  2FIF A;  3KYC D;  4GN1 A;  3KUD B;  3A33 B;  4GZU A;  2D11 A;  4W9L A;  1Q1O A;  2ROZ B;  3FEH A;  2UWQ A;  4MH0 E;  4YON A;  4A6F A;  4MGZ E;  5D7G A;  1YQB A;  4KHA A;  1WMH A;  1WGR A;  2MBB B;  2RNR B;  2DYM A;  4DBB A;  4XZ4 A;  2D07 B;  4MSQ B;  3AU5 A;  3D8D A;  2WDT B;  4JLC A;  2KC2 A;  1WF9 A;  2EC1 A;  1LFD A;  2P0H A;  2K25 A;  2P0F A;  1WX8 A;  5GMV A;  4BKT A;  2YVC A;  5CHF A;  1T0Y A;  4GPT B;  5LOP B;  1ZSQ A;  3M62 B;  3SYX A;  4W9E A;  1ZGU B;  2GBM A;  2FCS A;  2GMI C;  1OEY A;  2R2Q A;  1FGY A;  2YSZ A;  3O65 B;  4FN2 A;  1U5D A;  3VUY A;  1Y19 B;  1LW3 A;  3X23 A;  3L10 B;  1V86 A;  4AUQ C;  2CHW A;  4MDK E;  1UZX B;  1G6J A;  2DZJ A;  1X1F A;  5C1Z A;  1ZC3 B;  3A9K B;  2OTX A;  2MBO A;  3NHE B;  5LXH A;  4TQ0 A;  3V61 A;  4IWQ A;  3A9J B;  2RGF A;  3L54 A;  3QQ8 B;  3DVN U;  1RJ2 A;  2V1Y A;  3WA0 A;  2MBE A;  4HB3 B;  4MGK E;  2KGX B;  3PTF C;  2MFQ A;  4JIO U;  4KV2 A;  5AZG A;  2NVU I;  1GC6 A;  4KVG B;  5CX3 A;  1R4N I;  2KMA A;  2RGN B;  2KFK A;  2KD0 A;  1EGX A;  2IO3 B;  1WIA A;  4WJ7 A;  3NZS A;  4F7U P;  2REX A;  2KUP A;  2JVC A;  1ZKH A;  3RZF A;  1M94 A;  4MGY E;  1KLV A;  4LDT D;  1V5M A;  4PNK A;  2H7E A;  4LDT B;  1PQS A;  1WJ6 A;  1WXV A;  2C60 A;  1DYN A;  3DQV A;  2RVB B;  3QX1 A;  2KDE B;  5KHO A;  3VXW A;  3ZRC A;  3LJ3 A;  2Z0P A;  2V76 A;  1U5F A;  4NY0 A;  1IPG A;  2JXX A;  3QAQ A;  2KN5 A;  4GDK A;  2BF8 B;  1IRS A;  1P3R A;  4WJN A;  2I5F A;  3ZNG C;  2YS5 A;  5KHQ A;  5FI0 A;  3PSE B;  3PSC A;  2NPT A;  1KI1 B;  2LVP A;  3VIA A;  2DA0 A;  2LGD A;  2J0J A;  4A3O A;  2ZPY A;  4IC7 B;  4JGH B;  3EPY A;  1P1A A;  5C5B B;  5KQ1 A;  4W9G A;  2DHK A;  2KJH B;  3JSV B;  2CY4 A;  2CU1 A;  3GYO A;  4PYU A;  2KFJ A;  4MEM A;  1AWE A;  3DVN V;  1SHC A;  3P6A A;  2JY6 A;  2WWZ A;  1A5R A;  2GCL A;  3FP5 A;  1WM2 A;  2R09 A;  1QC6 A;  2KHW B;  4K17 A;  2G35 A;  1L7Y A;  2IY0 B;  2RSG A;  1Q67 A;  2AYO B;  2ZPN A;  4CHK A;  4DDG D;  5HE0 A;  2NBW B;  2CKH B;  4IM3 A;  2IO0 B;  4KZ0 A;  3MTN B;  2DYQ A;  1DRO A;  5D27 A;  3ZKJ C;  1WG7 A;  3QA8 A;  1WY8 A;  1SIF A;  4GOC A;  4WAA A;  3LJU X;  1RRB A;  1NU2 A;  3ODW A;  3WYF B;  4DHZ B;  4RM8 A;  3V5W A;  3UGB B;  4BBK A;  3VTV A;  2GBN A;  1M7E A;  2I1J A;  3U7D A;  2LUL A;  1NTY A;  4ZRI A;  4GGQ A;  1WGQ A;  2CY5 A;  5IA7 A;  3W1S A;  4TKN A;  1J8C A;  2Q13 A;  2FCQ A;  1Y5O A;  3VUX A;  4IUM B;  1YJ1 A;  4AJW A;  3HHM A;  5IAA C;  2RUK B;  2CB8 A;  1RFA A;  3TJP A;  2LUE A;  3W1Y A;  4LJP B;  2GOW A;  1D3Z A;  3CIK A;  2C9W B;  2BYF A;  2C5L C;  3I3T B;  4BVU C;  1OGW A;  3M1I B;  2D9V A;  3AU4 A;  2WH5 A;  1K5D B;  4P7I A;  3OJ4 B;  1E90 A;  5DHA B;  1ACA A;  3FSS A;  5J2R A;  1P9D U;  2IZV B;  1ZVR A;  2Z59 B;  2BKF A;  1E7U A;  2N9P C;  3PG7 A;  3T06 A;  1WRD B;  1ZW7 A;  2Y8F A;  2MCN B;  1SGH A;  3K9O B;  3IVF A;  3OAW A;  4W9C A;  3VH3 B;  3R66 C;  2GS0 A;  1V5T A;  1X11 A;  3JYU A;  1KZ7 A;  1SE9 A;  1WVH A;  3TCA A;  2AEH A;  1Q5W B;  2G4D B;  3PV1 A;  4DK5 A;  4IM0 A;  3ALB A;  3ML4 A;  3RZW C;  5DI9 B;  2RQ1 A;  3F0W A;  4JL9 A;  4MY6 A;  1UBQ A;  2M0X A;  1YD8 U;  2DAJ A;  5AZH A;  1WXM A;  5D2M B;  4F7G A;  3TO1 A;  1MIZ B;  2Y7B A;  3SNH A;  4XC2 A;  1WGG A;  2J7Q B;  3KH0 A;  1KM7 A;  2OOB B;  3JVZ X;  1TJ6 A;  5KCV A;  1TTN A;  2RD0 A;  4DHZ E;  2FJ9 A;  3L17 A;  3DOW A;  1S3S G;  1HB6 A;  1L2N A;  4HPL B;  1DDM A;  3M63 B;  2BGF A;  1P0R A;  2UVM A;  2ZZP B;  2NR2 A;  2CAY A;  5L83 A;  1V9J A;  1GG3 A;  3PEG A;  1MPH A;  4WQO B;  2LOZ A;  3PRP B;  4ANU A;  4C0A A;  4ZDV A;  2LKO A;  4AJY B;  4BBN C;  2I1K A;  2KKC A;  2W2X D;  3N7C A;  3SDL C;  2DKP A;  3BJI A;  2FAZ A;  3DCG A;  2ELA A;  3KUZ A;  4W9H A;  4EKU A;  4GIV A;  1WJN A;  1KOT A;  2BPS A;  2ZNV C;  4TYZ A;  2FUH B;  2FJL A;  3ZLZ A;  3L16 A;  2O2V B;  4WSF A;  3PP2 A;  4HAZ B;  1IYF A;  4AOF A;  2LRW A;  4IG7 B;  2COF A;  3B08 A;  3UIP B;  3D8E A;  2JT4 B;  1GNU A;  5JLJ B;  3AI5 A;  4CHM A;  2KDF B;  5CHV C;  3S2A A;  1GJZ A;  1U5E A;  4DWF A;  3DXE A;  3A9K A;  1WX9 A;  2YS1 A;  2EJ8 A;  3D32 A;  1OMW A;  1V88 A;  2N4F A;  4KAX B;  4RM9 A;  3A9J A;  5DCN A;  1Z87 A;  2LGX A;  5BO4 B;  1FHW A;  3UQA A;  4ICV A;  2K39 A;  4XX5 A;  2L1C A;  1XKE A;  3APD A;  2NS5 A;  1WM3 A;  2ADZ A;  1WGY A;  1NI2 A;  3VTW A;  4LJO B;  1NBF C;  3W1S C;  2XEW A;  4KHO A;  1DBH A;  4EZK A;  2YF0 A;  1XCG A;  4FLH A;  2N9E B;  2MKR A;  2KX3 A;  2JZ3 B;  3IFW B;  2BYV E;  2DFK A;  2E2X A;  3IBE A;  3ULB A;  2D9W A;  3ODO A;  1RAX A;  2ZCC A;  2DZM A;  3PS6 A;  2G45 B;  2V4L A;  2L05 A;  4HPM B;  2D2Q A;  4N9F 4;  2KNB A;  3KVF B;  4IAP A;  2HD5 B;  2J0M A;  2M14 A;  3B1L X;  3L08 A;  2HE7 A;  4FJV B;  2LAS A;  3TFM A;  2HJ8 A;  2KWU B;  4GMV A;  2HTH B;  1ST7 A;  2HRJ A;  3ZVV A;  2DHI A;  1WH3 A;  1NTV A;  4EEW A;  1K8R B;  2N7D A;  5E6P A;  1U5G A;  3ECI A;  2DZI A;  3ML8 A;  3GZN I;  4RMA A;  2W2X C;  3ZVR A;  1J0G A;  3ULC A;  1OQN A;  2LVQ A;  3V6C B;  2MQJ A;  5C5B A;  1E8Z A;  4HAT B;  1YX6 B;  2UZR A;  2ABD A;  4GDL B;  3JSV A;  1KZG A;  3GYP A;  3DBS A;  2CR5 A;  1E8Y A;  2FDQ A;  1ZM0 A;  1WJ1 A;  1I2H A;  4Y94 A;  2KLG A;  1CMX B;  3LDZ E;  4KDI C;  2COD A;  2YRY A;  4W9D A;  3A8Q A;  4DDI D;  5CLL B;  3QWM A;  2WYQ A;  1EVH A;  2D9X A;  3FLV A;  2M4N A;  2RPQ A;  1UNP A;  2WX0 A;  1P5T A;  2KAN A;  3QHT A;  4BOS C;  1U2B A;  3VUW A;  1QQG A;  3VQI A;  3L0W B;  3G9W A;  1NDD A;  1TQZ A;  3V62 A;  3M3J A;  3VTU A;  1YX5 B;  5C79 A;  3SU8 X;  4K7S A;  3N3K B;  5DPW A;  2DHJ A;  3PVL A;  2OQB A;  4B6H A;  2M8S A;  2AL6 A;  1P3Q U;  4TUU A;  2L8J A; 
#chains in the Genus database with same CATH topology
 2LGY A;  3LB8 C;  2LEK A;  1VBG A;  2N7E A;  4ANW A;  1MJD A;  3P2B A;  3PZD A;  2MW5 A;  1TBE A;  3NSU A;  1E0Z A;  3IT4 B;  1GAQ B;  1Y8R C;  4LK0 M;  3ZNI D;  2MX2 A;  4G0N B;  2MHJ A;  5JVL A;  2WXM A;  2FCM A;  5J3Q A;  2ZCB A;  1HZ6 A;  5D3Y A;  3RUI B;  2DX5 B;  1QOF A;  5JH5 C;  1XR0 B;  3PPA A;  3CST A;  1N5W A;  1EF5 A;  2AQ3 B;  4GNK B;  5DHF B;  1XD3 B;  1N3H A;  4HAV B;  2VRW B;  2NZ8 B;  1H10 A;  1UNQ A;  4A5K A;  3U52 E;  4E71 A;  1KFY B;  4ZRK A;  2UU7 A;  3B2G A;  5L81 A;  5EFX A;  3DWM A;  3KRX A;  1RWS A;  2BTE A;  3Q3F A;  5D6J B;  1VZ7 A;  2M17 A;  4WWN A;  3IHP C;  2J59 M;  2IGH A;  3TEX A;  4DQO C;  4WWP A;  4KIK B;  3CMM B;  1LM8 B;  2K2U A;  3RUL A;  1XCT L;  2WXH A;  3TBL D;  4E74 A;  4R3D A;  2VRR B;  2ELB A;  1UUP A;  4C4V A;  2WXI A;  2CHX A;  1STE A;  4NPN A;  4EFO A;  2KCJ A;  5BMI A;  1FGZ A;  4CSQ A;  3E9L A;  4FHJ A;  1VBH A;  4MGI E;  3A4S C;  3BK1 A;  2NCN A;  2LJ5 A;  2CQU A;  4K81 A;  4CO7 A;  4BKS D;  1U27 A;  2Z59 A;  1GUA B;  4DBG A;  2LVO A;  3LYY A;  4B95 A;  3ZJT A;  1VLB A;  1DOI A;  1E7V A;  4MK0 A;  2KZR A;  3URY A;  1I7A A;  5HE1 A;  1TS4 A;  3MC8 A;  5FKA C;  2CRF A;  3JW0 X;  3VH4 B;  3ML9 A;  1HE8 A;  4I6N B;  4S17 A;  1OFF A;  2BT6 A;  3RT3 B;  1I4R A;  5FR6 A;  1MK9 B;  3VR9 B;  2N9K A;  4IFS A;  4B9K A;  1NTI A;  4FHK A;  1KLG D;  1U4A A;  3NG0 A;  1WE7 A;  3DCX A;  3ZQ4 A;  2Z13 A;  3QCA A;  4PQ0 A;  1HXY D;  1VJK A;  3A98 B;  4ZRQ A;  2NBV B;  2K00 A;  3H7P B;  2KIE A;  3PT2 B;  4EUT A;  4A6H A;  3EHV A;  5BYR A;  4RGM A;  2AX5 A;  2PE6 B;  1Z5S B;  3QBV B;  1PYW D;  1MAI A;  2YS3 A;  1EUV B;  3N20 C;  2LYD A;  1KF6 B;  4ANV A;  2MP2 A;  3MDB C;  3RYT A;  1UNR A;  2COA A;  2J4X A;  2K1F A;  3EA6 A;  1KC7 A;  3BVZ A;  2K6D B;  2D3B A;  3GS2 A;  1S1Q B;  2EMT A;  3R8B A;  2Q5W D;  4FBJ B;  3PRM B;  3PO0 A;  1WGD A;  4NAW B;  3N1Z C;  4HAU B;  4HAY B;  2KTR B;  3ZXR A;  2W2W A;  3CF6 E;  5BMG A;  3AE6 B;  3HUI A;  1JWS D;  3AE8 B;  2M38 A;  3GOE A;  4NSW A;  4XWT A;  1XOD A;  2W3S A;  5EE0 A;  1MIX A;  1UGJ A;  4DXF A;  2N1V A;  5C23 A;  5C6R A;  4W9F A;  3IG3 A;  3WAP A;  3EGR A;  3WAO A;  3Q3O C;  2K2J A;  3W2D A;  2IO2 B;  2XK5 B;  3KZ1 A;  3AV8 A;  4XDC A;  3CXB B;  2VSZ A;  1XT9 B;  4CHJ A;  5HE3 A;  5TR5 A;  1C3T A;  3DBR I;  1N61 A;  5AUI A;  2RDB C;  3VVW B;  4PS7 A;  3QJZ A;  3APC A;  3RFZ B;  5JHG A;  4WVF B;  2WX1 A;  3NZU A;  4M00 A;  2INC C;  1KLU D;  3H7S A;  1IBX B;  1WJU A;  4F1S A;  2G3Q B;  2JF5 A;  1SSN A;  2ZVN A;  2QC8 A;  3GE8 C;  1WFY A;  4ZYS A;  4FJY A;  3ZJU A;  2E6X A;  4XWW A;  4YL8 A;  4JKC A;  4HB4 B;  4LNO A;  5GOW B;  1BWN A;  2DKQ A;  2X38 A;  5JZE B;  2LG1 A;  4HCP B;  1WI1 A;  4GXB A;  2N23 A;  2L2I A;  2BB5 A;  1OY2 A;  3DVG Y;  4P6V F;  4C00 A;  4URK A;  2L00 B;  1EU3 A;  2C7M B;  2GJY A;  3KRW A;  2QKL A;  2LI5 A;  3M95 A;  4WWM A;  1EU4 A;  2O2V A;  3RNC C;  2A5U A;  4A3P A;  3HK0 A;  3UQB A;  1MG8 A;  2RDH A;  4IOY X;  1TGZ B;  2JYE A;  1WJM A;  3RCZ A;  2MJD A;  1B1Z A;  4JWU C;  3MHS D;  5BYS A;  2LWP A;  3HQC A;  4II3 B;  4EZL A;  1XX0 A;  3KW5 B;  1MKE A;  3SV1 A;  2P0D A;  4F7H A;  1HZ5 A;  1VCB A;  3AE4 B;  2KC1 A;  1R4N B;  2WXL A;  2KWV B;  3AE1 B;  5J3T A;  2CS4 A;  2MRP A;  4GOU A;  3U2S C;  1LQB A;  1WXS A;  2QMT A;  5EE9 A;  4HHV A;  1WR6 E;  3EUB 2;  4G50 A;  2UYZ B;  3HRD D;  3MFG A;  1UEL A;  2YT2 A;  2LXC A;  1JRP A;  3BY4 B;  2D9Y A;  2BVC A;  2KAJ A;  4DHJ D;  2BW2 A;  5HHD G;  3TVV A;  1I35 A;  3HW2 B;  1UBI A;  2JWU A;  3PHX B;  4DHJ B;  4MJS B;  1HTQ A;  4CYE A;  1K5G B;  4XDD A;  4ZHO A;  3ZTC A;  4YSY B;  3L13 A;  2E3T A;  3SHQ A;  4G3X B;  3BK2 A;  1Q0W B;  1SBB B;  3Q2A C;  2RRF A;  4LCD E;  5FI1 A;  3VRA B;  1TS3 A;  2VKI A;  3SUZ A;  2RR9 A;  2W82 A;  1IGD A;  3ENE A;  4B0E A;  4C7Z A;  4W9I A;  3P7Z A;  4MT7 A;  1WYW B;  1OQQ A;  4BKG A;  2ICI A;  1KTK A;  3DXC A;  1JWU D;  4K3B A;  4GU2 A;  3TMP B;  3N30 A;  1R7S A;  3KWV A;  1WGU A;  4MM3 A;  2DN6 A;  3BYY B;  4KGS A;  4HB0 B;  4P1B C;  1UGM A;  1MHH E;  2KDI A;  2Z0O A;  4WIP A;  4N6E B;  3HVD A;  2QHO A;  5L95 C;  2QIL A;  1B9R A;  2A4Z A;  2INP E;  2VZK D;  1ZOY B;  4WJP A;  3AH7 A;  3NY5 A;  4IM2 A;  2KIG A;  2IFS A;  2LD9 A;  5I2M A;  1PLS A;  3AEG B;  3PVU A;  4HCN B;  2VZK B;  3RNE C;  1FXT B;  1BXT A;  4ANX A;  1ZYI A;  2IYD B;  2IBI B;  2VH2 A;  2HTH A;  2FJU B;  1NVI D;  3U7Z A;  1V89 A;  2AQ2 B;  1Q10 A;  1YN4 A;  2DEN B;  2JRI B;  3A4R A;  1MK7 B;  1XLP A;  2YLM A;  3FM8 C;  3VDZ A;  1FMA D;  1LB1 A;  3H8H A;  3C0R B;  2J0K A;  2JWZ A;  1RLF A;  1J19 A;  2AWT A;  4IW0 A;  3FIL B;  2ZW0 A;  2X8X X;  2O6V D;  3A1Q B;  3BII D;  4MEL A;  5H92 C;  3APF A;  3PRZ A;  4W9J A;  4WUR A;  2KQ7 A;  2O6V B;  2FUG 1;  2MH7 A;  2FID A;  2YEP F;  4WJQ A;  4JKF A;  4FJZ A;  1E8W A;  3E9P A;  4F8C B;  1RYJ A;  4GDL A;  4OSN A;  2BKR B;  5JP4 A;  1I4H A;  4II2 B;  3RD2 A;  3D8F A;  4B6W A;  1LXD A;  1FHX A;  1V1P B;  1JRU A;  1F9J A;  1HB8 A;  2PJH A;  2R61 A;  4M8M A;  3VRB B;  3SO6 A;  2KVR A;  3B2F A;  4J6I A;  1FEH A;  2WS3 B;  3MJW A;  3UF8 A;  3V05 A;  1EF1 A;  3IAM 1;  1CQV A;  5D3X A;  1CZP A;  1U29 A;  4NNJ B;  4MT5 A;  1M4V A;  4E3C A;  2R0D A;  1WE6 A;  3U4E G;  4D0N B;  1WR1 A;  4JKB A;  3RPF C;  2DYN A;  4HDO A;  1KH0 A;  2JPH A;  4WQM A;  4WJO A;  4GB9 A;  1V6E A;  2N7J A;  4ZYN A;  3I63 C;  1FB8 A;  2UZS A;  1TS5 A;  2D4Q A;  4AP4 C;  5LXI B;  3ZDT A;  4NQL B;  4QJ4 B;  1V81 A;  3PZ8 A;  3RNB C;  1P7F A;  4NZL B;  1YJI A;  4O1N A;  2GBR A;  2G4S A;  2B3A A;  1WX7 A;  2M19 A;  4WWO A;  4I6L B;  2WXJ A;  2KWD A;  4YT0 B;  1MPE A;  4L6E A;  3AEC B;  3KY9 A;  1NYQ A;  3R3M A;  5GXG B;  2JUO A;  3SFE B;  2KJ6 A;  3BIN A;  4A6F B;  4EJN A;  3P63 A;  1WMH B;  1UH6 A;  2KYW A;  1WZ0 A;  4IWP A;  2DX5 A;  3ZGZ A;  1WGH A;  2K0P A;  1YNT E;  1FFU A;  4EZJ A;  1D6E C;  1SXT A;  5G2N A;  1FO4 A;  3DDC B;  5J18 A;  1ISN A;  3HM6 X;  4US9 A;  3DXD A;  1N62 A;  3C19 A;  1EM7 A;  1UPQ A;  3I5J C;  2NMQ A;  4IKG A;  2WGS A;  5AEK B;  4AWJ A;  4JWS C;  2KO3 A;  4HJK A;  3DHI C;  3Q8F A;  3AE9 B;  4KIK A;  3T9L A;  3OAN A;  2LOX A;  5G5G A;  2H7D A;  2HTM E;  5FK9 C;  2R2O A;  3O96 A;  3X0W A;  5JHA A;  1NI3 A;  5I4D A;  4GMX B;  3E56 A;  4ZOH C;  4IOI E;  5LLI A;  4K2O A;  1OQY A;  3R7R A;  5JHH A;  5LG4 B;  2LZ6 A;  3AJ4 A;  2D9Z A;  1TZ1 A;  2YT1 A;  2WXG A;  1X86 A;  1ZUD 2;  4GLS C;  1PFJ A;  4LLG M;  3DBH I;  3ZW3 A;  2M1M A;  2C7H A;  1DDV A;  2N0S B;  3HIZ A;  2LJI A;  3VOQ A;  2YT0 A;  2Z8L A;  3QIJ A;  2IY1 B;  2JZZ A;  4BKS A;  5HKH A;  2JSV X;  4DX8 A;  1JQ4 A;  2KOX A;  3NZ3 A;  1T77 A;  4PS3 A;  2IJ0 A;  1W1H A;  2J52 A;  4HK2 A;  1WZ3 A;  1MI1 A;  3KQ4 A;  1JML A;  2Z0E B;  3ZTD A;  1QKZ A;  1ACC A;  2WXF A;  3ODX A;  1Z2M A;  3N32 A;  1BAK A;  1LGR A;  2PKO A;  4HSI A;  2EKE C;  4A20 A;  1AN8 A;  4OZB A;  3CWI A;  1FHO A;  5E6J A;  2N9X A;  2XBB C;  3H6N A;  1J7B A;  3ZRF A;  4Z2M B;  4J3O D;  1C79 A;  3MC0 B;  3PLU A;  2L0F A;  2NBV A;  5I2S A;  5J17 A;  3H7P A;  4DXA B;  1V61 A;  4LNI A;  2KTF A;  3E66 A;  4OW0 A;  4TSS A;  4PYZ A;  2QKM A;  3Q6B A;  2KR0 A;  1MVK A;  1D5Z C;  2BS2 B;  1N63 A;  4ARC A;  3DHG C;  4KZC A;  2W9N A;  2NBU A;  4WH4 A;  3UIO B;  2IO1 B;  1V49 A;  4XWX A;  2V3N A;  4KSL C;  4BZA A;  2D10 A;  4BBN F;  2DX1 A;  3ENB A;  3OLM D;  1JWM D;  4KGT A;  3EC8 A;  1DOX A;  3ONS A;  1RRP B;  2KFK B;  3AMZ A;  3EEC A;  1N6Z A;  2AQ1 B;  2EMS A;  1ZDV A;  1V5O A;  1FOE A;  1FPY A;  2RDG A;  4US8 A;  1M7R A;  5D3V A;  1L0Y B;  3RNA C;  1ET9 A;  2OJR A;  1EAZ A;  3NOB A;  1L0X B;  3AE3 B;  2NMB A;  2QDF A;  4NAW A;  3TUO A;  4ZRJ A;  2MWN B;  2KTR A;  2N1W A;  4BOZ B;  3VAW A;  4HDQ A;  4QJ3 B;  1P98 A;  5J3Y A;  2EEL A;  1MI0 A;  2W55 A;  4NQK E;  5DPR A;  3Q69 A;  1SE3 A;  3ZO5 B;  2FCN A;  3SBT A;  2LGI A;  1I4P A;  2K8B A;  1YIW A;  4FUL A;  2DLB A;  1NVL A;  1J0W A;  4OVV A;  3R7Q A;  2I38 A;  2XK5 A;  1C77 A;  1TKG A;  4MSM B;  2XQN M;  2PE9 A;  3HSA A;  4A6K A;  1TXD A;  5T8I A;  2Z0Q A;  1BML C;  4HB2 B;  1W1D A;  2I2Y A;  3AXC A;  3Q3J A;  1QZE A;  4FA6 A;  3NS8 A;  1ZC4 B;  3KSY A;  1X1M A;  2KXJ A;  3F5R A;  4DX9 0;  2KJR A;  1J7A A;  1V5U A;  5C3J B;  1V2Y A;  1IBX A;  4RF1 A;  3Q8C A;  1C1Y B;  3T8M A;  4A6Q A;  4GDK B;  4OVU A;  4RNA A;  5D3W A;  2J53 A;  1HA5 A;  4ITK A;  1VD2 A;  4K2P A;  2NPT B;  3P1M A;  3TIX A;  2GBJ A;  4M0W B;  5DIF B;  2Y5C A;  1H8C A;  1JDE A;  4KKI A;  4X57 B;  5G5H A;  3NWF A;  3UZT A;  4KHB B;  4HKZ E;  2DYO A;  2GBK A;  3DPD A;  2DTC A;  2ROV A;  2KX0 A;  1FRR A;  1XEE A;  4OZA A;  3VHT C;  1E5W A;  3Q3N C;  3WIM A;  4GSW A;  1UEF A;  3WAN A;  2WDQ B;  1L6V A;  1P6S A;  3BVG A;  2ASQ A;  1FXI A;  2ZNV B;  2D3G A;  2X18 A;  2Y8G A;  2MBH A;  1GPX A;  4JQW C;  4EOY A;  2LBB A;  1XD4 A;  1FNW A;  2JQR B;  2V3S A;  1FCC C;  3WAM A;  2K8H A;  5G55 A;  2MBQ A;  1TYG B;  2KN4 A;  4HPP A;  4L2Y A;  1PMS A;  4RGN A;  5IN7 A;  4YTM B;  1AQC A;  2MSE D;  3U8Z A;  2BCJ A;  2V0G A;  2V4I B;  3ABV B;  2K8C A;  1H4R A;  2WDR B;  2LRU A;  3I9V 1;  4B0M A;  3PVW A;  2GCJ A;  1X1G A;  2DAF A;  3TEW A;  4MJS A;  1EO6 A;  3KUC B;  2MA9 B;  1C76 A;  3PGE A;  2FNJ B;  3B0A A;  1DIK A;  4K7W A;  2COC A;  3TL5 A;  3KYD D;  4A90 A;  4IWO A;  2WXP A;  1GC7 A;  1HBK A;  2L0T A;  1SE2 A;  2L76 A;  4HXD A;  2L7R A;  2BBC A;  2G9H D;  4EMO A;  3PHW B;  3KLS X;  1XCQ L;  3AUL A;  1BTN A;  1ENF A;  4RFB A;  1K50 A;  5KQ4 A;  3DBL I;  5MPO A;  3WAL A;  4HVB A;  2D3A A;  3GE3 C;  3NVZ A;  5EE1 A;  2KMC A;  3UIN B;  5LNK 1;  1R4M I;  1PDX A;  2XNA C;  1V5P A;  1AAR A;  4NJC A;  1WI0 A;  1L5P A;  2ZVO A;  1X05 A;  4ACF A;  1DDW A;  5CTR C;  2P8V A;  4USA A;  1KJT A;  1GOZ A;  3AEA B;  4HAW B;  3BZD B;  2CJO A;  3MPX A;  1MG4 A;  4NJ7 A;  2RLO A;  3N1Y C;  4C80 A;  2KK8 A;  1T0R C;  3ZNZ B;  1E8X A;  3GZN B;  2KQS A;  2V3P A;  4W9K A;  1ESF A;  2AL3 A;  4S0R A;  3AE7 B;  3V6E B;  4F7Z A;  2MEK A;  4HLE A;  2LXA A;  3U30 A;  2MP2 B;  2DHZ A;  3QAR A;  4HWI B;  5C16 A;  2N0Y A;  1XF5 L;  4YXD B;  1V1O A;  3EFU A;  3B77 A;  4DIX A;  4A9A A;  3VFK A;  2MLB A;  2PPH A;  5AZF A;  3HIE A;  3E9O A;  1WJ4 A;  5LON B;  2JX5 A;  2MWS B;  3H9D A;  3CSF A;  1I42 A;  2KWC A;  4OZC A;  5E6N A;  1TS2 A;  1V80 A;  4ZHP A;  2BWE S;  2DLW A;  5EDS A;  4G11 A;  3SD5 A;  3ZDM C;  4HRO A;  2KDB A;  1L6U A;  1GB1 A;  3H1U A;  3RNF C;  2BWF A;  4TV3 A;  4BFR A;  3QK0 A;  5CHW A;  1B55 A;  1WXA A;  1W1G A;  1F52 A;  3ZIM A;  2Z0D B;  1OTR B;  1K52 A;  2DYB A;  2JRH A;  3FIL A;  3C8Y A;  3A1Q A;  4JKE A;  4ASW C;  4K1R B;  1ZPS A;  2TSS A;  2Y5B B;  5JHB A;  4PS8 A;  4ILG B;  3QC8 B;  2O6V A;  1XQQ A;  2K6Q A;  4Z2N A;  4M8N A;  5DPT A;  3OG5 A;  3FVC A;  4KSK C;  4K7U A;  2H88 B;  2L52 A;  2PZ1 A;  1QF6 A;  2ZJD A;  1IP9 A;  5E6O A;  1FAO A;  5BYQ A;  1V1P A;  3V60 A;  1XLN A;  3PLV A;  4L1B A;  5DH9 B;  4NJ6 A;  2K9X A;  3HM3 A;  4YWG G;  3ZNH B;  5IO9 A;  4ICU A;  2PEA A;  1C9F A;  5CLQ B;  5D94 A;  4RCO A;  5HE2 A;  1HQR D;  2DZK A;  1J7C A;  2WXO A;  1E6E B;  4K3C A;  1WSP A;  2ZEQ A;  2L3Z A;  3ZUN A;  3RCP A;  1K51 A;  1UD7 A;  3QWZ B;  4TQ1 A;  1F1H A;  1FNU A;  3BYT B;  2BYE A;  4NAM A;  3A8P A;  2K49 A;  2LFI A;  2JP2 A;  4I6P A;  5DPS A;  3K9P B;  3TW1 A;  2I5C A;  5HG2 A;  4FAD A;  1BT0 A;  3BWU D;  3OJ3 A;  2RSU A;  5FR3 A;  1FRD A;  2COP A;  2IYB A;  1MFW A;  3I57 A;  1T0Q C;  1I4Q A;  1VZ8 A;  4QAY A;  3PRE A;  4H8S A;  1BTK A;  2WXQ A;  4KDL B;  2CHZ A;  2BYT A;  1GGO A;  4HAX B;  4QXA B;  2KLC A;  2MDX A;  3DVG X;  1UPR A;  4ILH A;  4UDU C;  4XYC A;  5IJM A;  1OEY J;  2C7N B;  2FIF A;  3KYC D;  2L1A A;  4GN1 A;  3KUD B;  3A33 B;  1AW7 A;  4YSZ B;  3NS1 A;  4GZU A;  2D11 A;  1E9M A;  4W9L A;  1Q1O A;  2ON8 A;  2ROZ B;  3FEH A;  1TY0 A;  2UWQ A;  4MH0 E;  4YON A;  4A6F A;  4MGZ E;  5D7G A;  1YQB A;  4KHA A;  2L32 A;  1WMH A;  2R2Y A;  1WGR A;  2MBB B;  2RNR B;  2DYM A;  4JX1 C;  4N59 A;  4DBB A;  4XZ4 A;  3SEB A;  2D07 B;  2LUM A;  2BS4 B;  4MSQ B;  3AU5 A;  3D8D A;  2ONQ A;  2WDT B;  4JLC A;  2KC2 A;  1AWD A;  1WF9 A;  2EC1 A;  1LFD A;  2P0H A;  3KWL A;  3N9Y C;  3P42 A;  3W9C B;  4MH8 A;  2K25 A;  2P0F A;  1UWX A;  3RN9 C;  2GB1 A;  1F77 A;  1WX8 A;  5GMV A;  4BKT A;  3P4R B;  3OHM B;  2YVC A;  2LMC A;  5AUK A;  5CHF A;  1T0Y A;  4KX6 B;  1A70 A;  4GPT B;  4PT5 A;  5LOP B;  1ZSQ A;  3M62 B;  3SYX A;  4W9E A;  2GI9 A;  2WLB A;  1ZGU B;  2GBM A;  2FCS A;  2GMI C;  4ARI A;  2IGG A;  1OEY A;  2R2Q A;  1F0Z A;  1FGY A;  3AE5 B;  5IKC M;  3Q14 C;  2KT7 A;  2YSZ A;  3O65 B;  1BUI C;  4FN2 A;  1U5D A;  3VUY A;  1Y19 B;  1LW3 A;  1PFD A;  2LGS A;  3X23 A;  1FIQ A;  2WXR A;  3NJT A;  3L10 B;  1TJE A;  1V86 A;  1YMH E;  4AUQ C;  2CHW A;  4MDK E;  1UZX B;  5EE3 A;  1FFV A;  2Z14 A;  1RFK A;  2PTL A;  5IOI A;  1G6J A;  1QQR A;  2DZJ A;  3O13 A;  1X1F A;  5C1Z A;  1ZC3 B;  3A9K B;  2OTX A;  2MBO A;  3P4P B;  3NHE B;  5LXH A;  4TQ0 A;  3V61 A;  2JU6 X;  2KAC A;  4IWQ A;  1JW9 D;  3U12 A;  1YJJ A;  4MAC A;  3A9J B;  2RGF A;  3L54 A;  3QQ8 B;  3DVN U;  1RJ2 A;  2V1Y A;  3WA0 A;  2MBE A;  5IP4 D;  5HFY A;  1WGK A;  1N60 A;  4D6W A;  4HB3 B;  1L4D B;  4MGK E;  4RGO S;  2KGX B;  1I4X A;  3PTF C;  2MFQ A;  4JIO U;  4KV2 A;  3SR6 A;  3BVM A;  5AZG A;  2NVU I;  1GC6 A;  4KVG B;  5CX3 A;  1R4N I;  2WU2 B;  3DBR B;  1XXG A;  2KMA A;  4JE3 B;  3L4P A;  2RGN B;  2KFK A;  2KD0 A;  1EGX A;  2HJ1 A;  3AEE B;  1C4C A;  2IO3 B;  3AM9 A;  1KRH A;  2IPK D;  1WIA A;  4WJ7 A;  3NZS A;  1ZE3 D;  4F7U P;  2REX A;  2KUP A;  4LTU A;  1FD6 A;  2JVC A;  1ZKH A;  3RZF A;  1M94 A;  4MGY E;  1KLV A;  1LO5 D;  4KGR A;  3HVZ A;  3R2I A;  4LDT D;  1V5M A;  4PNK A;  2H7E A;  2SAK A;  4LDT B;  1PQS A;  2MJE A;  3AEF B;  3DBL B;  4P1C C;  1WJ6 A;  2V9H A;  3AB5 A;  1WXV A;  2C60 A;  4RF0 A;  1DYN A;  1JCK B;  2D5G A;  3DQV A;  3SBG A;  2RVB B;  3QX1 A;  2W54 A;  3NVY A;  1TIF A;  2KDE B;  1EWY C;  5KHO A;  2DWQ A;  3VXW A;  3ZRC A;  3LJ3 A;  2Z0P A;  2V76 A;  5M4Y B;  1U5F A;  4NY0 A;  1IPG A;  1TZO A;  1F2R C;  2JXX A;  3P4S B;  1T5X D;  2KN5 A;  3QAQ A;  2X0S A;  4GDK A;  2BF8 B;  1IRS A;  1P3R A;  4WJN A;  4EE2 A;  2I5F A;  3ZNG C;  2YS5 A;  3MHZ A;  5KHQ A;  5FI0 A;  3PSE B;  4JKG B;  3PSC A;  1D5M C;  1SE4 A;  2NPT A;  1KI1 B;  2BQQ A;  2LVP A;  4M0W A;  2INN E;  1ZXI A;  3FC4 A;  3VIA A;  2DA0 A;  2LGD A;  2J0J A;  1T3Q A;  4A3O A;  2ZPY A;  4KHB A;  1C4P A;  4IC7 B;  3FAH A;  4JGH B;  3EPY A;  1P1A A;  3R2T A;  2RMM A;  5C5B B;  4ZRP A;  2IDY A;  5KQ1 A;  4W9G A;  2KDM A;  2DHK A;  2KJH B;  3AE2 B;  3JSV B;  2CY4 A;  2WXK A;  3DHH C;  2CU1 A;  3GYO A;  4PYU A;  2QEJ C;  2KFJ A;  4MEM A;  1AWE A;  1I7H A;  3DVN V;  1SHC A;  3P6A A;  2JY6 A;  2WWZ A;  1A5R A;  2GCL A;  1VR9 A;  3FP5 A;  1WM2 A;  1YN5 A;  2R09 A;  1D4B A;  3LXF A;  4A8X C;  1QC6 A;  2KHW B;  3GP7 A;  1QIL A;  4K17 A;  2G35 A;  1FCL A;  1L7Y A;  2IY0 B;  2WXN A;  4RGT A;  1F2R I;  2RSG A;  1Q67 A;  2WQY B;  2AYO B;  2EKI A;  2ZPN A;  4CHK A;  4DDG D;  5HE0 A;  2NBW B;  1WXQ A;  2CKH B;  4IM3 A;  2IO0 B;  4KZ0 A;  2JYT A;  3MTN B;  1IGC A;  2DYQ A;  2PW9 A;  1DRO A;  5D27 A;  3ZKJ C;  1WG7 A;  2IND C;  2MJ3 A;  3QA8 A;  1WY8 A;  4AS1 A;  3A58 A;  2OJW A;  2KMM A;  4P16 A;  3N1X C;  1SIF A;  1ZXH A;  3TSS A;  2K8E A;  1K53 A;  4GOC A;  4CQN A;  1CK1 A;  4WAA A;  3LJU X;  1RRB A;  3W5V B;  2K5P A;  2BS3 B;  1NU2 A;  3ODW A;  1FM0 D;  3WYF B;  4YTN B;  2WDV B;  3ETR A;  4DHZ B;  4RM8 A;  1XLO A;  3V5W A;  3UGB B;  3IT6 B;  4BBK A;  3VTV A;  2GBN A;  4YTP B;  1V8C A;  1M7E A;  2I1J A;  2ZKM X;  3U7D A;  2LUL A;  1YQ4 B;  1NTY A;  4ZRI A;  4GGQ A;  1IUE A;  1WGQ A;  1PUT A;  4XGA B;  1OQR A;  2CY5 A;  2PLP A;  5IA7 A;  3W1S A;  4TKN A;  3ZJV A;  1J8C A;  2Q13 A;  2J42 A;  2FCQ A;  1Y5O A;  3VUX A;  4LNK A;  4IUM B;  1YJ1 A;  1UNS A;  4AJW A;  4H2A A;  3HHM A;  5IAA C;  2CB8 A;  2RUK B;  1RFA A;  2B76 B;  1VDV A;  1I4G A;  3RMK C;  1N5X A;  3TJP A;  2LUE A;  1CJE A;  3W1Y A;  1V97 A;  4LJP B;  2GOW A;  1VZ6 A;  3J9C A;  1D3Z A;  1YQ3 B;  3Q8E A;  3CIK A;  2PVO D;  2C9W B;  3EFC A;  1E7P B;  2L83 A;  2BYF A;  1XLQ A;  1D5X C;  2WNM A;  2C5L C;  4C4V B;  4HJG E;  3I3T B;  4BVU C;  2CJN A;  2ZW1 A;  1OGW A;  2PMV A;  3M1I B;  2D9V A;  5BMH A;  4JPS A;  3AU4 A;  2Y3A A;  2WH5 A;  1K5D B;  4P7I A;  3OJ4 B;  1E90 A;  5IRS A;  5DHA B;  1TT5 B;  1GB4 A;  1ACA A;  3FSS A;  2Y5P A;  5J2R A;  1P9D U;  2IZV B;  2GLS A;  1ZVR A;  3WCQ A;  2Z59 B;  2BKF A;  1E7U A;  2N9P C;  3PG7 A;  2QCZ A;  3T06 A;  1WRD B;  1ZW7 A;  2Y8F A;  3TEY A;  2MCN B;  4JK8 A;  1TKY A;  1SGH A;  3K9O B;  3VR8 B;  4YSX B;  3GB1 A;  3SFD B;  3IVF A;  3OAW A;  4W9C A;  2OED A;  3VH3 B;  3R66 C;  2GS0 A;  1V5T A;  1X11 A;  1L0V B;  3JYU A;  1KZ7 A;  2WU5 B;  3MJ5 A;  4JKH A;  1SE9 A;  1WVH A;  3TCA A;  2AEH A;  5D3I B;  1Q5W B;  2G4D B;  3PV1 A;  4DK5 A;  4IM0 A;  2JXT A;  3ALB A;  3ML4 A;  3RZW C;  5DI9 B;  2RQ1 A;  1WYG A;  1JAL A;  3F0W A;  4JL9 A;  4MY6 A;  1UBQ A;  1QOB A;  1XO3 A;  1C78 A;  1YOV B;  2DNF A;  2W3R A;  2M0X A;  4L23 A;  2QIE B;  1YD8 U;  2DAJ A;  5AZH A;  1WXM A;  5D2M B;  4F7G A;  3TO1 A;  1MIZ B;  2Y7B A;  4C7Y A;  3SNH A;  4XC2 A;  1WGG A;  2J7Q B;  3KH0 A;  1KM7 A;  2OOB B;  3JVZ X;  1TJ6 A;  5KCV A;  1TTN A;  2RD0 A;  4DHZ E;  3NWA A;  2FJ9 A;  4D2K A;  2HDE A;  3L17 A;  3Q3M C;  1QOA A;  3NVW A;  2ACZ B;  2KVZ A;  3DOW A;  3MP9 A;  2DIK A;  1S3S G;  3Q8B A;  2WP9 B;  1HB6 A;  1L2N A;  4HPL B;  1UWM A;  3ZYY X;  5H8Y E;  1DDM A;  2CU3 A;  3W5U B;  1SJE D;  3M63 B;  2BGF A;  1JRO A;  1P0R A;  2PVG C;  2UVM A;  2ZZP B;  2NR2 A;  1QLB B;  3OWE B;  4REZ A;  1SJH D;  1TY2 A;  1PGB A;  2CAY A;  5L83 A;  1V9J A;  1GG3 A;  3PEG A;  2KUQ A;  1MPH A;  4RH6 A;  4WQO B;  2LOZ A;  3PRP B;  4ANU A;  4C0A A;  2FE8 A;  4ZDV A;  1ZP0 B;  2LKO A;  3IAS 1;  4AJY B;  4BBN C;  2I1K A;  1T6B X;  3DBH B;  2KKC A;  3NRZ A;  2W2X D;  3N7C A;  3SDL C;  4JKA A;  2DKP A;  3BJI A;  2FAZ A;  1DYQ A;  3DCG A;  4M01 A;  2ELA A;  1VRA B;  3KUZ A;  4W9H A;  4AQ7 A;  4EKU A;  1T0S C;  4GIV A;  1WJN A;  3RI7 C;  2LHD A;  1KOT A;  5TSS A;  2M0A A;  2BPS A;  3FKY A;  3UI3 A;  1EWC A;  1NYR A;  2ZNV C;  4JK9 A;  4TYZ A;  2FUH B;  2FJL A;  1NEK B;  3ZLZ A;  3L16 A;  1QOG A;  2QJL A;  2O2V B;  3E9S A;  4WSF A;  3PP2 A;  4HAZ B;  1IYF A;  4AOF A;  3AED B;  4DXG A;  2LRW A;  4IG7 B;  4KKJ A;  1FNV A;  2COF A;  3B08 A;  1RM6 C;  3UIP B;  3D8E A;  3NWD A;  2JT4 B;  2D3C A;  1GNU A;  5JLJ B;  3AI5 A;  3PZ7 A;  4CHM A;  2KDF B;  1HTO A;  1HEZ E;  5CHV C;  3S2A A;  1KBL A;  2VH1 A;  1DOY A;  1GJZ A;  1U5E A;  1WWT A;  4DWF A;  3DXE A;  3A9K A;  2R82 A;  1WX9 A;  2YS1 A;  2EJ8 A;  3D32 A;  1OMW A;  1V88 A;  1ROE A;  4FXC A;  2N4F A;  2WHI A;  1Y56 A;  4KAX B;  4RM9 A;  3A9J A;  1UF0 A;  5DCN A;  1Z87 A;  2LGX A;  5BO4 B;  1FHW A;  1L4Z B;  2GRI A;  1YN3 A;  3UQA A;  4ICV A;  2FBW B;  4HKQ A;  2K39 A;  5HI1 A;  1SF0 A;  2BB6 A;  4XX5 A;  3MC9 A;  2L1C A;  1XKE A;  3APD A;  3IXS A;  2NS5 A;  4A55 A;  1WM3 A;  2ADZ A;  1WGY A;  2NTT A;  1NI2 A;  3VTW A;  1SB3 C;  4LJO B;  2K3U A;  1NBF C;  1TKE A;  3W1S C;  2XEW A;  4KHO A;  1FXA A;  1DBH A;  1ZDX A;  4EZK A;  2GUM A;  2RPV A;  3T3N A;  2YF0 A;  3ZXV A;  1XCG A;  2G1E A;  4FLH A;  3DWG C;  2N9E B;  2MKR A;  2SEB D;  2KX3 A;  2JZ3 B;  4HRS A;  3IFW B;  2BYV E;  2DFK A;  5JXV A;  2E2X A;  3IBE A;  3ULB A;  2D9W A;  4MM3 B;  3ODO A;  1RAX A;  2ZCC A;  2DZM A;  3PS6 A;  1JWA D;  2G45 B;  2V4L A;  2L05 A;  4JKD A;  4HPM B;  2D2Q A;  4JK7 A;  4N9F 4;  2JZP A;  2KNB A;  3KVF B;  1DGJ A;  1PGA A;  2M56 B;  4IAP A;  2NTS A;  2HD5 B;  1WRI A;  2J0M A;  2M14 A;  4OHJ A;  1PGX A;  3B1L X;  3L08 A;  2HE7 A;  4FJV B;  2LAS A;  3TFM A;  3NW8 A;  2HJ8 A;  2KWU B;  2KQ4 X;  4GMV A;  2HTH B;  1ET6 A;  1ST7 A;  1P7E A;  2HRJ A;  3RNG C;  3ZVV A;  2DBY A;  1AYF A;  2DHI A;  1WH3 A;  1NTV A;  4JKG A;  4EEW A;  1K8R B;  4M02 A;  2N7D A;  3CIR B;  1U5G A;  3ECI A;  5E6P A;  3NVV A;  4BAX A;  2DZI A;  4HEA 1;  4PK1 A;  2YEP B;  3ML8 A;  2K22 A;  3GZN I;  4RMA A;  2W2X C;  4IDI A;  4C56 C;  4OVZ A;  4N58 A;  3ZVR A;  4XE0 A;  1J0G A;  3ULC A;  3AN1 A;  1OQN A;  2LVQ A;  2XN9 C;  3V6C B;  2MQJ A;  5C5B A;  1E8Z A;  4HAT B;  4Q2J A;  1YX6 B;  4OT1 A;  2UZR A;  2ABD A;  3AEB B;  4GDL B;  3JSV A;  1KZG A;  2QSD A;  1E10 A;  4TMA B;  3GYP A;  5C2T B;  3DBS A;  4ILJ A;  2CR5 A;  1E8Y A;  4LNF A;  3TEZ A;  2FDQ A;  2PIA A;  1QT9 A;  1SIJ A;  1ZM0 A;  2H89 B;  1WJ1 A;  1I2H A;  4QJ5 B;  4Y94 A;  2KLG A;  3V3X A;  1CMX B;  3LDZ E;  4KDI C;  2COD A;  1C4A A;  1MHX A;  2YRY A;  4W9D A;  3A8Q A;  4DDI D;  5CLL B;  3QWM A;  5D3D A;  2WYQ A;  1EVH A;  2D9X A;  2LHE A;  3P4Q B;  1R4M B;  3FLV A;  2M4N A;  2RPQ A;  1UNP A;  2Z4D A;  2WX0 A;  1P5T A;  3B9J A;  4LNN A;  3T3O A;  2N9L A;  2KAN A;  3QHT A;  4BOS C;  1U2B A;  3L0W B;  1QQG A;  3VQI A;  3VUW A;  3G9W A;  1NDD A;  1TQZ A;  3V62 A;  3M3J A;  2IGD A;  4WAF A;  1JWB D;  3VTU A;  3NUH B;  3Q8A A;  1YX5 B;  5C79 A;  3SU8 X;  1NEN B;  4K7S A;  3N3K B;  5DPW A;  2DHJ A;  3PVL A;  2OQB A;  4B6H A;  2OHF A;  2M8S A;  4L1R A;  2AL6 A;  1P3Q U;  1SEB D;  4TUU A;  2L8J A; 
#chains in the Genus database with same CATH homology
 2LGY A;  1VBG A;  2N7E A;  4ANW A;  3P2B A;  3PZD A;  2MW5 A;  1TBE A;  3NSU A;  1Y8R C;  3ZNI D;  2MX2 A;  4G0N B;  5JVL A;  2FCM A;  5J3Q A;  2ZCB A;  5D3Y A;  3RUI B;  2DX5 B;  5JH5 C;  1XR0 B;  3PPA A;  3CST A;  1EF5 A;  5DHF B;  1XD3 B;  1N3H A;  4HAV B;  2VRW B;  2NZ8 B;  1H10 A;  1UNQ A;  4A5K A;  4E71 A;  4ZRK A;  5L81 A;  5EFX A;  3KRX A;  3Q3F A;  5D6J B;  2M17 A;  4WWN A;  3IHP C;  2J59 M;  4WWP A;  4KIK B;  3CMM B;  1LM8 B;  2K2U A;  3RUL A;  3TBL D;  4E74 A;  2VRR B;  2ELB A;  2CHX A;  4NPN A;  4EFO A;  2KCJ A;  1FGZ A;  3E9L A;  4FHJ A;  1VBH A;  4MGI E;  3A4S C;  2NCN A;  2LJ5 A;  2CQU A;  4K81 A;  4CO7 A;  4BKS D;  1U27 A;  4DBG A;  1GUA B;  2LVO A;  4B95 A;  1E7V A;  4MK0 A;  2KZR A;  1I7A A;  5HE1 A;  2CRF A;  3JW0 X;  3VH4 B;  3ML9 A;  1HE8 A;  4I6N B;  3RT3 B;  5FR6 A;  1MK9 B;  4IFS A;  4B9K A;  1NTI A;  4FHK A;  1U4A A;  1WE7 A;  3QCA A;  4PQ0 A;  3A98 B;  2NBV B;  2K00 A;  3H7P B;  3PT2 B;  4EUT A;  4A6H A;  3EHV A;  2PE6 B;  1Z5S B;  3QBV B;  1MAI A;  2YS3 A;  1EUV B;  2LYD A;  4ANV A;  2MP2 A;  3MDB C;  3RYT A;  1UNR A;  2COA A;  2K1F A;  1KC7 A;  2K6D B;  1S1Q B;  2EMT A;  4FBJ B;  3PRM B;  1WGD A;  4NAW B;  4HAU B;  4HAY B;  2KTR B;  2W2W A;  3CF6 E;  2M38 A;  3GOE A;  4NSW A;  1XOD A;  1MIX A;  2N1V A;  5C23 A;  5C6R A;  4W9F A;  3IG3 A;  3WAP A;  3WAO A;  2K2J A;  2IO2 B;  2XK5 B;  3KZ1 A;  3CXB B;  2VSZ A;  1XT9 B;  4CHJ A;  5HE3 A;  5TR5 A;  1C3T A;  3DBR I;  3VVW B;  4PS7 A;  3QJZ A;  3APC A;  5JHG A;  4WVF B;  2WX1 A;  3NZU A;  3H7S A;  1WJU A;  4F1S A;  2G3Q B;  2JF5 A;  2ZVN A;  1WFY A;  4FJY A;  4YL8 A;  4JKC A;  4HB4 B;  5GOW B;  1BWN A;  2DKQ A;  5JZE B;  2LG1 A;  4HCP B;  1WI1 A;  4GXB A;  2N23 A;  2L2I A;  3DVG Y;  1OY2 A;  4URK A;  2L00 B;  2C7M B;  2GJY A;  3KRW A;  2QKL A;  2LI5 A;  3M95 A;  2O2V A;  2A5U A;  4A3P A;  3HK0 A;  3UQB A;  1MG8 A;  4IOY X;  1TGZ B;  1WJM A;  3RCZ A;  3MHS D;  2LWP A;  3HQC A;  4II3 B;  4EZL A;  1XX0 A;  3KW5 B;  1MKE A;  3SV1 A;  2P0D A;  4F7H A;  1VCB A;  2KC1 A;  2KWV B;  5J3T A;  2CS4 A;  2MRP A;  1LQB A;  1WXS A;  4HHV A;  1WR6 E;  4G50 A;  2UYZ B;  1UEL A;  2LXC A;  3BY4 B;  2D9Y A;  4DHJ D;  3TVV A;  1I35 A;  3HW2 B;  1UBI A;  3PHX B;  4DHJ B;  4MJS B;  4CYE A;  1K5G B;  3ZTC A;  3L13 A;  3SHQ A;  4G3X B;  1Q0W B;  4LCD E;  5FI1 A;  2VKI A;  3SUZ A;  2RR9 A;  3ENE A;  4W9I A;  3P7Z A;  4MT7 A;  1WYW B;  4BKG A;  3DXC A;  4GU2 A;  3TMP B;  3N30 A;  1WGU A;  4MM3 A;  2DN6 A;  4HB0 B;  1UGM A;  2KDI A;  2Z0O A;  2QHO A;  5L95 C;  2A4Z A;  4WJP A;  3NY5 A;  4IM2 A;  2LD9 A;  2IFS A;  1PLS A;  3PVU A;  4HCN B;  1FXT B;  4ANX A;  2IYD B;  2IBI B;  2HTH A;  1V89 A;  2DEN B;  2JRI B;  3A4R A;  1MK7 B;  3VDZ A;  2YLM A;  3FM8 C;  1LB1 A;  3C0R B;  2J0K A;  2JWZ A;  1RLF A;  1J19 A;  2AWT A;  4IW0 A;  2O6V D;  3A1Q B;  4MEL A;  3APF A;  3PRZ A;  4W9J A;  2KQ7 A;  2O6V B;  2FID A;  4WJQ A;  4JKF A;  4FJZ A;  1E8W A;  3E9P A;  4F8C B;  4GDL A;  2BKR B;  5JP4 A;  4II2 B;  3RD2 A;  3D8F A;  4B6W A;  1LXD A;  1FHX A;  1JRU A;  1F9J A;  1HB8 A;  2PJH A;  4M8M A;  3SO6 A;  2KVR A;  4J6I A;  3MJW A;  3UF8 A;  1EF1 A;  5D3X A;  1U29 A;  4NNJ B;  4E3C A;  2R0D A;  1WE6 A;  4D0N B;  1WR1 A;  4JKB A;  2DYN A;  4HDO A;  2JPH A;  4WJO A;  4GB9 A;  1V6E A;  4ZYN A;  1FB8 A;  2UZS A;  2D4Q A;  4AP4 C;  5LXI B;  3ZDT A;  4NQL B;  1V81 A;  2GBR A;  2G4S A;  2B3A A;  1WX7 A;  4WWO A;  4I6L B;  4L6E A;  3KY9 A;  3R3M A;  2JUO A;  2KJ6 A;  3BIN A;  4A6F B;  4EJN A;  1WMH B;  1UH6 A;  1WZ0 A;  4IWP A;  2DX5 A;  1WGH A;  4EZJ A;  5G2N A;  3DDC B;  5J18 A;  1ISN A;  3HM6 X;  3DXD A;  1UPQ A;  5AEK B;  4AWJ A;  2KO3 A;  4HJK A;  4KIK A;  3T9L A;  3OAN A;  2LOX A;  2H7D A;  2R2O A;  3O96 A;  3X0W A;  5JHA A;  4GMX B;  5LLI A;  4K2O A;  1OQY A;  3R7R A;  5JHH A;  2LZ6 A;  3AJ4 A;  2D9Z A;  1TZ1 A;  2YT1 A;  1X86 A;  1PFJ A;  3DBH I;  3ZW3 A;  2M1M A;  2C7H A;  1DDV A;  3HIZ A;  3VOQ A;  2YT0 A;  3QIJ A;  2IY1 B;  2JZZ A;  4BKS A;  5HKH A;  4DX8 A;  2KOX A;  4PS3 A;  1W1H A;  4HK2 A;  1WZ3 A;  2Z0E B;  3ZTD A;  3ODX A;  1Z2M A;  3N32 A;  1BAK A;  2EKE C;  4A20 A;  1FHO A;  2N9X A;  2XBB C;  3H6N A;  3ZRF A;  4Z2M B;  3PLU A;  2L0F A;  5J17 A;  3H7P A;  4DXA B;  1V61 A;  2KTF A;  3E66 A;  4PYZ A;  2QKM A;  4KZC A;  2W9N A;  2NBU A;  3UIO B;  2IO1 B;  1V49 A;  4XWX A;  4KSL C;  2D10 A;  4BBN F;  2DX1 A;  3ENB A;  3OLM D;  3EC8 A;  3ONS A;  1RRP B;  2KFK B;  3EEC A;  2EMS A;  1V5O A;  1FOE A;  1M7R A;  5D3V A;  2OJR A;  1EAZ A;  3NOB A;  4NAW A;  2NMB A;  4ZRJ A;  2MWN B;  2KTR A;  2N1W A;  4BOZ B;  3VAW A;  4HDQ A;  1P98 A;  5J3Y A;  4NQK E;  5DPR A;  3ZO5 B;  2FCN A;  3SBT A;  2K8B A;  1YIW A;  4FUL A;  3R7Q A;  1NVL A;  1J0W A;  4OVV A;  2XK5 A;  4MSM B;  2XQN M;  2PE9 A;  4A6K A;  1TXD A;  2Z0Q A;  4HB2 B;  1W1D A;  3AXC A;  3Q3J A;  1QZE A;  4FA6 A;  3NS8 A;  1ZC4 B;  3KSY A;  1X1M A;  2KXJ A;  3F5R A;  4DX9 0;  2KJR A;  1V5U A;  1V2Y A;  1C1Y B;  3T8M A;  4GDK B;  4OVU A;  5D3W A;  1VD2 A;  4K2P A;  2NPT B;  3TIX A;  2GBJ A;  4M0W B;  5DIF B;  1H8C A;  1JDE A;  4X57 B;  3UZT A;  4KHB B;  2DYO A;  2GBK A;  3DPD A;  2DTC A;  2ROV A;  2KX0 A;  3VHT C;  1E5W A;  3WIM A;  4GSW A;  1UEF A;  3WAN A;  1P6S A;  2ASQ A;  2ZNV B;  2D3G A;  2X18 A;  2Y8G A;  2MBH A;  4JQW C;  4EOY A;  2LBB A;  1XD4 A;  2V3S A;  3WAM A;  2K8H A;  5G55 A;  2MBQ A;  1PMS A;  1AQC A;  2MSE D;  3U8Z A;  2BCJ A;  2K8C A;  1H4R A;  2LRU A;  3PVW A;  2GCJ A;  1X1G A;  2DAF A;  4MJS A;  1EO6 A;  3KUC B;  2MA9 B;  3PGE A;  2FNJ B;  3B0A A;  1DIK A;  4K7W A;  2COC A;  3TL5 A;  3KYD D;  4IWO A;  1GC7 A;  1HBK A;  2L0T A;  2L76 A;  4HXD A;  2L7R A;  4EMO A;  3PHW B;  3AUL A;  1BTN A;  5KQ4 A;  3DBL I;  3WAL A;  4HVB A;  2KMC A;  3UIN B;  1R4M I;  1V5P A;  1AAR A;  1WI0 A;  2ZVO A;  1X05 A;  1DDW A;  5CTR C;  2P8V A;  1KJT A;  4HAW B;  3MPX A;  4NJ7 A;  2RLO A;  2KK8 A;  3ZNZ B;  1E8X A;  2KQS A;  4W9K A;  2AL3 A;  4F7Z A;  3V6E B;  4HLE A;  2LXA A;  3U30 A;  2MP2 B;  2DHZ A;  3QAR A;  4HWI B;  5C16 A;  2N0Y A;  3EFU A;  3VFK A;  2MLB A;  2PPH A;  5AZF A;  3E9O A;  1WJ4 A;  5LON B;  2MWS B;  3H9D A;  3CSF A;  1I42 A;  2KWC A;  5E6N A;  1V80 A;  2BWE S;  2DLW A;  5EDS A;  4G11 A;  3SD5 A;  3ZDM C;  2KDB A;  3H1U A;  2BWF A;  4TV3 A;  4BFR A;  3QK0 A;  5CHW A;  1B55 A;  1WXA A;  1W1G A;  3ZIM A;  2Z0D B;  1OTR B;  2DYB A;  2JRH A;  3A1Q A;  4JKE A;  4ASW C;  4K1R B;  2Y5B B;  5JHB A;  4PS8 A;  4ILG B;  3QC8 B;  2O6V A;  1XQQ A;  2K6Q A;  4Z2N A;  4M8N A;  5DPT A;  4KSK C;  4K7U A;  2PZ1 A;  2ZJD A;  1IP9 A;  5E6O A;  1FAO A;  3V60 A;  3PLV A;  5DH9 B;  4NJ6 A;  3HM3 A;  3ZNH B;  4ICU A;  2PEA A;  5CLQ B;  5D94 A;  5HE2 A;  2DZK A;  2ZEQ A;  2L3Z A;  3ZUN A;  3RCP A;  1UD7 A;  3QWZ B;  4TQ1 A;  2BYE A;  3A8P A;  2JP2 A;  4I6P A;  5DPS A;  3K9P B;  3TW1 A;  2I5C A;  4FAD A;  1BT0 A;  3OJ3 A;  2RSU A;  2COP A;  2IYB A;  3PRE A;  4H8S A;  1BTK A;  4KDL B;  2CHZ A;  1GGO A;  4HAX B;  2KLC A;  2MDX A;  3DVG X;  1UPR A;  4ILH A;  5IJM A;  1OEY J;  2C7N B;  2FIF A;  3KYC D;  4GN1 A;  3KUD B;  3A33 B;  4GZU A;  2D11 A;  4W9L A;  1Q1O A;  2ROZ B;  3FEH A;  2UWQ A;  4MH0 E;  4YON A;  4A6F A;  4MGZ E;  5D7G A;  1YQB A;  4KHA A;  1WMH A;  1WGR A;  2MBB B;  2RNR B;  2DYM A;  4DBB A;  4XZ4 A;  2D07 B;  4MSQ B;  3AU5 A;  3D8D A;  2WDT B;  4JLC A;  2KC2 A;  1WF9 A;  2EC1 A;  1LFD A;  2P0H A;  2K25 A;  2P0F A;  1WX8 A;  5GMV A;  4BKT A;  2YVC A;  5CHF A;  1T0Y A;  4GPT B;  5LOP B;  1ZSQ A;  3M62 B;  3SYX A;  4W9E A;  1ZGU B;  2GBM A;  2FCS A;  2GMI C;  1OEY A;  2R2Q A;  1FGY A;  2YSZ A;  3O65 B;  4FN2 A;  1U5D A;  3VUY A;  1Y19 B;  1LW3 A;  3X23 A;  3L10 B;  1V86 A;  4AUQ C;  2CHW A;  4MDK E;  1UZX B;  1G6J A;  2DZJ A;  1X1F A;  5C1Z A;  1ZC3 B;  3A9K B;  2OTX A;  2MBO A;  3NHE B;  5LXH A;  4TQ0 A;  3V61 A;  4IWQ A;  3A9J B;  2RGF A;  3L54 A;  3QQ8 B;  3DVN U;  1RJ2 A;  2V1Y A;  3WA0 A;  2MBE A;  4HB3 B;  4MGK E;  2KGX B;  3PTF C;  2MFQ A;  4JIO U;  4KV2 A;  5AZG A;  2NVU I;  1GC6 A;  4KVG B;  5CX3 A;  1R4N I;  2KMA A;  2RGN B;  2KFK A;  2KD0 A;  1EGX A;  2IO3 B;  1WIA A;  4WJ7 A;  3NZS A;  4F7U P;  2REX A;  2KUP A;  2JVC A;  1ZKH A;  3RZF A;  1M94 A;  4MGY E;  1KLV A;  4LDT D;  1V5M A;  4PNK A;  2H7E A;  4LDT B;  1PQS A;  1WJ6 A;  1WXV A;  2C60 A;  1DYN A;  3DQV A;  3SBG A;  2RVB B;  3QX1 A;  2KDE B;  5KHO A;  3VXW A;  3ZRC A;  3LJ3 A;  2Z0P A;  2V76 A;  1U5F A;  4NY0 A;  1IPG A;  2JXX A;  3QAQ A;  2KN5 A;  2X0S A;  4GDK A;  2BF8 B;  1IRS A;  1P3R A;  4WJN A;  2I5F A;  3ZNG C;  2YS5 A;  5KHQ A;  5FI0 A;  3PSE B;  4JKG B;  3PSC A;  2NPT A;  1KI1 B;  2LVP A;  3VIA A;  2DA0 A;  2LGD A;  2J0J A;  4A3O A;  2ZPY A;  4IC7 B;  4JGH B;  3EPY A;  1P1A A;  5C5B B;  5KQ1 A;  4W9G A;  2DHK A;  2KJH B;  3JSV B;  2CY4 A;  2CU1 A;  3GYO A;  4PYU A;  2KFJ A;  4MEM A;  1AWE A;  3DVN V;  1SHC A;  3P6A A;  2JY6 A;  2WWZ A;  1A5R A;  2GCL A;  3FP5 A;  1WM2 A;  2R09 A;  1QC6 A;  2KHW B;  4K17 A;  2G35 A;  1L7Y A;  2IY0 B;  2RSG A;  1Q67 A;  2AYO B;  2ZPN A;  4CHK A;  4DDG D;  5HE0 A;  2NBW B;  2CKH B;  4IM3 A;  2IO0 B;  4KZ0 A;  3MTN B;  2DYQ A;  1DRO A;  5D27 A;  3ZKJ C;  1WG7 A;  3QA8 A;  1WY8 A;  1SIF A;  4GOC A;  4WAA A;  3LJU X;  1RRB A;  1NU2 A;  3ODW A;  3WYF B;  4DHZ B;  4RM8 A;  3V5W A;  3UGB B;  4BBK A;  3VTV A;  2GBN A;  1M7E A;  2I1J A;  3U7D A;  2LUL A;  1NTY A;  4ZRI A;  4GGQ A;  1WGQ A;  2CY5 A;  5IA7 A;  3W1S A;  4TKN A;  1J8C A;  2Q13 A;  2FCQ A;  1Y5O A;  3VUX A;  4IUM B;  1YJ1 A;  4AJW A;  3HHM A;  5IAA C;  2CB8 A;  2RUK B;  1RFA A;  3TJP A;  2LUE A;  3W1Y A;  4LJP B;  2GOW A;  1D3Z A;  3CIK A;  2C9W B;  2BYF A;  2C5L C;  3I3T B;  4BVU C;  1OGW A;  3M1I B;  2D9V A;  3AU4 A;  2WH5 A;  1K5D B;  4P7I A;  3OJ4 B;  1E90 A;  5DHA B;  1ACA A;  3FSS A;  5J2R A;  1P9D U;  2IZV B;  1ZVR A;  2Z59 B;  2BKF A;  1E7U A;  2N9P C;  3PG7 A;  3T06 A;  1WRD B;  1ZW7 A;  2Y8F A;  2MCN B;  4JK8 A;  1SGH A;  3K9O B;  3IVF A;  3OAW A;  4W9C A;  3VH3 B;  3R66 C;  2GS0 A;  1V5T A;  1X11 A;  3JYU A;  1KZ7 A;  4JKH A;  1SE9 A;  1WVH A;  3TCA A;  2AEH A;  1Q5W B;  2G4D B;  3PV1 A;  4DK5 A;  4IM0 A;  3ALB A;  3ML4 A;  3RZW C;  5DI9 B;  2RQ1 A;  3F0W A;  4JL9 A;  4MY6 A;  1UBQ A;  2M0X A;  1YD8 U;  2DAJ A;  5AZH A;  1WXM A;  5D2M B;  4F7G A;  3TO1 A;  1MIZ B;  2Y7B A;  3SNH A;  4XC2 A;  1WGG A;  2J7Q B;  3KH0 A;  1KM7 A;  2OOB B;  3JVZ X;  1TJ6 A;  5KCV A;  1TTN A;  2RD0 A;  4DHZ E;  2FJ9 A;  3L17 A;  3DOW A;  2DIK A;  1S3S G;  1HB6 A;  1L2N A;  4HPL B;  1DDM A;  3M63 B;  2BGF A;  1P0R A;  2UVM A;  2ZZP B;  2NR2 A;  2CAY A;  5L83 A;  1V9J A;  1GG3 A;  3PEG A;  1MPH A;  4WQO B;  2LOZ A;  3PRP B;  4ANU A;  4C0A A;  4ZDV A;  2LKO A;  4AJY B;  4BBN C;  2I1K A;  2KKC A;  2W2X D;  3N7C A;  3SDL C;  4JKA A;  2DKP A;  3BJI A;  2FAZ A;  3DCG A;  2ELA A;  3KUZ A;  4W9H A;  4EKU A;  4GIV A;  1WJN A;  1KOT A;  2BPS A;  2ZNV C;  4JK9 A;  4TYZ A;  2FUH B;  2FJL A;  3ZLZ A;  3L16 A;  2O2V B;  4WSF A;  3PP2 A;  4HAZ B;  1IYF A;  4AOF A;  2LRW A;  4IG7 B;  2COF A;  3B08 A;  3UIP B;  3D8E A;  2JT4 B;  1GNU A;  5JLJ B;  3AI5 A;  4CHM A;  2KDF B;  5CHV C;  3S2A A;  1KBL A;  1GJZ A;  1U5E A;  4DWF A;  3DXE A;  3A9K A;  2R82 A;  1WX9 A;  2YS1 A;  2EJ8 A;  3D32 A;  1OMW A;  1V88 A;  2N4F A;  4KAX B;  4RM9 A;  3A9J A;  5DCN A;  1Z87 A;  2LGX A;  5BO4 B;  1FHW A;  3UQA A;  4ICV A;  2K39 A;  4XX5 A;  2L1C A;  1XKE A;  3APD A;  2NS5 A;  1WM3 A;  2ADZ A;  1WGY A;  1NI2 A;  3VTW A;  4LJO B;  1NBF C;  3W1S C;  2XEW A;  4KHO A;  1DBH A;  4EZK A;  2YF0 A;  1XCG A;  4FLH A;  2N9E B;  2MKR A;  2KX3 A;  2JZ3 B;  3IFW B;  2BYV E;  2DFK A;  2E2X A;  3IBE A;  3ULB A;  2D9W A;  3ODO A;  1RAX A;  2ZCC A;  2DZM A;  3PS6 A;  2G45 B;  2V4L A;  2L05 A;  4JKD A;  4HPM B;  2D2Q A;  4JK7 A;  4N9F 4;  2KNB A;  3KVF B;  4IAP A;  2HD5 B;  2J0M A;  2M14 A;  3B1L X;  3L08 A;  2HE7 A;  4FJV B;  2LAS A;  3TFM A;  2HJ8 A;  2KWU B;  4GMV A;  2HTH B;  1ST7 A;  2HRJ A;  3ZVV A;  2DHI A;  1WH3 A;  1NTV A;  4JKG A;  4EEW A;  1K8R B;  2N7D A;  5E6P A;  1U5G A;  3ECI A;  2DZI A;  3ML8 A;  3GZN I;  4RMA A;  2W2X C;  3ZVR A;  1J0G A;  3ULC A;  1OQN A;  2LVQ A;  3V6C B;  2MQJ A;  5C5B A;  1E8Z A;  4HAT B;  1YX6 B;  2UZR A;  2ABD A;  4GDL B;  3JSV A;  1KZG A;  3GYP A;  3DBS A;  4ILJ A;  2CR5 A;  1E8Y A;  2FDQ A;  1ZM0 A;  1WJ1 A;  1I2H A;  4Y94 A;  2KLG A;  1CMX B;  3LDZ E;  4KDI C;  2COD A;  2YRY A;  4W9D A;  3A8Q A;  4DDI D;  5CLL B;  3QWM A;  2WYQ A;  1EVH A;  2D9X A;  3FLV A;  2M4N A;  2RPQ A;  1UNP A;  2WX0 A;  1P5T A;  2KAN A;  3QHT A;  4BOS C;  1U2B A;  3L0W B;  1QQG A;  3VQI A;  3VUW A;  3G9W A;  1NDD A;  1TQZ A;  3V62 A;  3M3J A;  3VTU A;  1YX5 B;  5C79 A;  3SU8 X;  4K7S A;  3N3K B;  5DPW A;  2DHJ A;  3PVL A;  2OQB A;  4B6H A;  2M8S A;  2AL6 A;  1P3Q U;  4TUU A;  2L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...