4ZRKA

Merlin-ferm and lats1 complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
b'KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/transferase
total genus 83
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrkA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrkA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrkA01
3CMMB 1WXAA 2ZNVC 2N7EA 4JIOU 1ACAA 3VUXA 1I2HA 3PT2B 2CHWA 4K1RB 4EUTA 2DX1A 2MBEA 4A6FB 2O6VD 2LASA 4DK5A 4W9CA 1JRUA 3KRXA 2RR9A 2PEAA 3UIPB 2JT4B 2IYBA 1WGGA 3PP2A 3Q3JA 2COPA 4OVUA 2BKRB 3MHSD 2DYOA 3N3KB 4WJQA 3HM6X 5AZFA 4Z2MB 4IC7B 3DCGA 5FI1A 1BAKA 4GZUA 4Y94A 4G0NB 4N9F4 2D11A 2RSUA 4FULA 3L54A 4W9JA 1AWEA 2CAYA 4FJVB 2RSGA 1UELA 4A6FA 3RZWC 4IM2A 2K2UA 1X11A 4PS7A 3UQBA 4KDLB 1M7RA 4WSFA 1WE6A 5C1ZA 1TXDA 3EPYA 1BWNA 2DFKA 3ZDTA 4XZ4A 4B95A 4BKTA 2BCJA 3RUIB 2AWTA 5AZHA 1WZ3A 4FJZA 2DHIA 1P0RA 1LFDA 4P7IA 2KTRA 4BKGA 3VTWA 4G11A 1QC6A 2BWFA 4BKSA 5JH5C 4BBNF 3DBHI 4TV3A 1FHOA 3NY5A 1YX5B 3A9KB 3VQIA 3ONSA 3KSYA 4FLHA 1FXTB 1V6EA 2Q13A 1WI0A 1E8YA 1TQZA 3PEGA 1WJNA 3A8PA 4D0NB 4JQWC 1R4MI 3PLVA 1BTKA 2RPQA 3PVWA 4HVBA 4OVVA 2W2XD 1PLSA 1J0WA 2HTHB 3WANA 2D4QA 3A4SC 4GGQA 3KW5B 4AUQC 2MKRA 2Y5BB 2WDTB 4A6HA 4PNKA 2PE9A 2YS3A 4K7UA 4MM3A 4MK0A 4EZLA 2YSZA 5AZGA 2KC1A 2MBHA 2DA0A 1WJ1A 4DDGD 5C16A 2KN5A 1X1GA 2JZZA 2L00B 3L17A 4HK2A 1U27A 4HDOA 4GU2A 3SHQA 4NNJB 1Z5SB 2HTHA 2W2WA 2C9WB 4AJYB 2GBNA 1G6JA 3P2BA 2XK5A 3PVUA 5D7GA 2DX5B 5LXHA 2WYQA 4DX8A 1QQGA 2KUPA 3DVGX 2LGYA 3DBLI 1WGDA 3QX1A 2FJ9A 3NS8A 1UNPA 4IW0A 4HCNB 3VH4B 4URKA 4EOYA 1SGHA 3ZKJC 1SIFA 5D2MB 2VSZA 3PSEB 2KCJA 2JXXA 3O96A 4BBNC 2UYZB 2DX5A 2ZVNA 2ZPNA 3BY4B 3CSTA 1ZM0A 2CU1A 2MWSB 4M8MA 3L0WB 3TIXA 2LZ6A 3DXEA 5C6RA 1IRSA 4GIVA 3KH0A 2MWNB 2A5UA 2P0HA 3SO6A 5LLIA 1WGHA 1MAIA 1MK7B 3F0WA 1LW3A 3QBVB 4II2B 3OAWA 4GMXB 3MJWA 1YQBA 2K8HA 1RRBA 3O65B 2NZ8B 4RM8A 1OGWA 5D94A 1EF1A 5G55A 4HJKA 3A1QA 2PE6B 4I6NB 1PFJA 3PGEA 2MW5A 2KFKB 1K8RB 1DBHA 2UZSA 1E7UA 3IFWB 1P5TA 4W9IA 1NBFC 1XQQA 3RCPA 4NQKE 2GMIC 2KMCA 4FA6A 3VTVA 2OOBB 1WMHB 4HB4B 2LUEA 3UGBB 1WIAA 1J0GA 5E6OA 2JF5A 3B1LX 4LJOB 2L0FA 2COFA 3RD2A 2K2JA 4MGZE 1TZ1A 3SU8X 2R0DA 3HHMA 2DYBA 3JVZX 2WWZA 3JW0X 5JZEB 2DYMA 4FJYA 4ZRJA 2KLCA 2Z0EB 1TBEA 4NY0A 1RAXA 4DHJB 2G4DB 2DENB 3PRPB 1H8CA 4MDKE 1K5DB 1DROA 1WI1A 4GDLB 2YVCA 1WJ4A 1ST7A 3D8FA 1WY8A 3ML4A 1UH6A 2COCA 2AL3A 2KQ7A 4ANVA 1KZGA 3R3MA 5IAAC 3D8EA 1RFAA 2ZCCA 2D3GA 3WIMA 3PZDA 3IVFA 1YX6B 2NVUI 1I7AA 2V1YA 1NTYA 4LCDE 2LVPA 2D9XA 4NJ7A 1OTRB 3C0RB 2UVMA 1U2BA 2OJRA 4ANUA 2W2XC 2OQBA 1WX8A 4C0AA 4HAXB 4Z2NA 1WGUA 1OEYA 4BBKA 3CF6E 1UNRA 2DYQA 2FAZA 4HCPB 5D3VA 2I1KA 2NBUA 1HE8A 1FB8A 1R4NI 4F7ZA 2IFSA 1P98A 2MX2A 3NHEB 4GXBA 4HPMB 1DDVA 2ZJDA 3ZIMA 1TTNA 2YLMA 2LYDA 3ENEA 4DX90 4DBGA 5DCNA 4B6WA 2PJHA 1ZKHA 2H7EA 3UQAA 1EGXA 4WJNA 5C79A 1GG3A 2GBMA 4CHKA 1HB8A 4KSKC 2KK8A 1UBIA 2VRWB 1PQSA 3CIKA 1Q0WB 1XX0A 3PG7A 5DIFB 4MY6A 1GC7A 2QHOA 1WXMA 2GBRA 2ZCBA 4DDID 5KHOA 1H10A 2I5FA 4HLEA 2L76A 4X57B 2C5LC 4ICUA 3WYFB 2UZRA 2I1JA 3P6AA 3FSSA 3VAWA 5D3WA 2FUHB 3CSFA 4EKUA 2M14A 2FCNA 4L6EA 5KHQA 4RM9A 2MCNB 1W1DA 1E5WA 1WXVA 2J0KA 3DVNU 5JP4A 4WWPA 2GJYA 3X0WA 2D10A 1F9JA 2EC1A 3NZSA 2R09A 3D32A 4G50A 1M94A 4A5KA 2IO0B 4F7GA 2DYNA 4TUUA 2FIFA 2V4LA 4TYZA 3U30A 2KTRB 1U5FA 5J3TA 4YONA 2CY5A 3AXCA 3APCA 4FHJA 5EFXA 1V5PA 2KXJA 2WH5A 1SHCA 3MTNB 4CHJA 4GMVA 4PQ0A 2NPTA 2J0JA 2P0FA 2ZNVB 1RRPB 1XD4A 5KQ4A 4GB9A 4HAWB 5HE3A 3DQVA 1Y19B 1WX9A 2DZJA 2HRJA 3AJ4A 3FP5A 4IG7B 2JPHA 2XEWA 4W9HA 4KAXB 4W9DA 4EZKA 5J3YA 4J6IA 3PLUA 3LDZE 2KFJA 4WAAA 3L08A 1FHWA 1YD8U 2DLWA 1WJ6A 1V49A 4EEWA 4ICVA 1KOTA 1Z2MA 1GJZA 5JHAA 2LKOA 4HHVA 3EC8A 3ZRFA 3GYPA 2ROVA 2JUOA 2M1MA 4A6KA 3IG3A 1UEFA 4MGKE 1NI2A 3BINA 5DH9B 2A4ZA 4BOZB 2L7RA 3AU4A 4ZRIA 1WFYA 2KC2A 2KQSA 3W1SC 2N1WA 2IY0B 2XK5B 3PV1A 4W9LA 4HB3B 3ULCA 3U8ZA 5LONB 4KV2A 1V88A 3EHVA 1EVHA 3VDZA 4E74A 2LOXA 2J59M 2KDEB 3GZNI 2J7QB 1C1YB 2N9EB 3G9WA 1WYWB 3PHXB 4HB2B 3H1UA 2D9WA 2MDXA 5D3XA 2CS4A 2CY4A 2KWCA 2N9XA 1BT0A 3TO1A 3ZUNA 2LBBA 1Q67A 3ZO5B 3LJ3A 3APDA 2D9ZA 2KVRA 4IOYX 1L7YA 4WQOB 3DOWA 2FCSA 2FNJB 3PHWB 4IM0A 3TW1A 3KYDD 4BKSD 2NCNA 3SD5A 1LQBA 3GOEA 2EJ8A 4H8SA 1OQNA 3HK0A 3HW2B 4MGYE 1V86A 2KX3A 2X18A 4HAVB 4IFSA 1S1QB 2DAFA 1WM2A 4DHZB 4NQLB 3VOQA 4EMOA 2EKEC 3OLMD 3NSUA 2LULA 1B55A 4HAUB 4WVFB 2Z0DB 2K8BA 4DWFA 2V76A 2MLBA 2N4FA 2Z59B 2GCLA 3A9JA 3ZW3A 4EZJA 4K2PA 3A1QB 2COAA 2KJ6A 3DVNV 2YF0A 4PS8A 1V81A 2BPSA 2KANA 3MPXA 4XC2A 5JHHA 2Y7BA 2GS0A 1P1AA 2JWZA 3VHTC 5J2RA 2J0MA 3X23A 4BVUC 5J3QA 1LB1A 2BF8B 2LVQA 4MEMA 4IM3A 2CHZA 2RD0A 3RYTA 2ZZPB 3W1SA 2NBWB 2RUKB 3M3JA 2W9NA 3AI5A 2L05A 3UF8A 1MG8A 2YRYA 3TBLD 2L8JA 1X1MA 4MGIE 3ZNZB 1SE9A 2N9PC 3ZLZA 2RGFA 3VFKA 1GC6A 2KDFB 2ELBA 1VD2A 2DHKA 2G35A 1NTIA 2WX1A 4BFRA 3SDLC 1RLFA 1QZEA 1E7VA 2KJHB 1WX7A 1UPQA 1X86A 2ELAA 1UPRA 1XD3B 2QKLA 3VUYA 3DBRI 3OJ4B 2NMBA 1U5DA 4F1SA 2Y8FA 4I6LB 3ZTDA 2REXA 2KGXB 3DVGY 1WR1A 4ZYNA 5FI0A 5L83A 1L2NA 2O2VA 2C60A 1WF9A 5C5BB 2NBVB 4ZRKA 2K00A 2DZKA 1W1HA 4M0WB 2I5CA 1LXDA 1FGZA 4AP4C 4W9EA 4TQ1A 1J19A 2AL6A 2CODA 2MP2A 1XCGA 1TGZB 3TL5A 2CHXA 1Z87A 3N32A 5DPTA 4IUMB 2KDBA 1WXSA 2KO3A 2YT1A 4FBJB 4PS3A 1D3ZA 3QQ8B 3PRZA 5D27A 1UZXB 2IYDB 2M17A 1TJ6A 3TCAA 4IWQA 2RQ1A 2DTCA 3JSVA 1V80A 2LWPA 2KZRA 1WZ0A 5C5BA 2KKCA 3FLVA 2IO1B 3IHPC 2MFQA 1MIXA 5HE0A 2ASQA 2JRHA 2H7DA 3SNHA 4HXDA 2EMTA 5LXIB 1V5TA 4LJPB 1A5RA 4WWOA 5CHFA 4GPTB 3HIZA 1KZ7A 1UGMA 4KZ0A 4E71A 1E8ZA 3TMPB 2L2IA 1RJ2A 4HWIB 1KJTA 2R2OA 4K7SA 1HB6A 1V2YA 3OANA 2UWQA 2Z0QA 2DN6A 2XQNM 3QWMA 2O6VA 3TFMA 2JRIB 1MIZB 2OTXA 3KRWA 2G4SA 1WVHA 1EAZA 2GBJA 4NPNA 4AJWA 1FGYA 2KD0A 1W1GA 3S2AA 3MDBC 2RLOA 4KZCA 3PVLA 5CLQB 2LRWA 2JP2A 3QCAA 2XBBC 4B9KA 3B0AA 3L13A 1ZGUB 4DBBA 2LOZA 1ZC3B 4CO7A 3WALA 2BYEA 2ROZB 5DPRA 1WJMA 4JL9A 5DPWA 3DXCA 1U4AA 1FOEA 3H7SA 2IO2B 3ZTCA 2ABDA 1YJ1A 2MRPA 3Q3FA 2DAJA 2GCJA 3PSCA 3PTFC 2MQJA 4DHJD 2KDIA 1WRDB 2YT0A 1UD7A 4HATB 5E6NA 4K7WA 5KCVA 4W9KA 2N23A 4KVGB 3HM3A 4ASWC 2MA9B 3OJ3A 1KLVA 2LXAA 1OQYA 2NPTB 1KM7A 1IP9A 2BYFA 1GNUA 3APFA 3EFUA 1EO6A 1KI1B 2D9YA 3ZNID 2Z0OA 3ZRCA 2K6QA 5L95C 4HAYB 2D9VA 5CHVC 5CX3A 1WGYA 2RGNB 3FEHA 4B6HA 4KHBB 1MKEA 2BKFA 1OEYJ 2BGFA 3P7ZA 5L81A 2MSED 2K6DB 1C3TA 2M0XA 4DXAB 1ZW7A 4A20A 4ANWA 2CQUA 3WAMA 3DBSA 4FHKA 2E2XA 4I6PA 2C7NB 2KTFA 5CTRC 3ZDMC 4MJSB 5C23A 5DHAB 4HDQA 2LGDA 3K9OB 3JYUA 3RCZA 3F5RA 3M1IB 2KHWB 2KLGA 2FIDA 5HE1A 1WR6E 3ODXA 1BTNA 3DXDA 4XX5A 1I35A 2Z0PA 1WG7A 4HAZB 3ZNHB 5HE2A 2KX0A 1NDDA 2N0YA 3VTUA 3ULBA 4MJSA 3GYOA 4WJ7A 4WJOA 4KSLC 3UINB 2KOXA 3V6EB 2M4NA 1DDWA 1U29A 1LM8B 4KIKB 2KWVB 2DKQA 4M8NA 4WJPA 4GOCA 3QWZB 2K25A 3SYXA 5G2NA 1MPHA 4K2OA 3KY9A 1UBQA 3RULA 3A33B 4WWNA 4XWXA 3K9PB 1UNQA 5CLLB 3LJUX 1XODA 5FR6A 1H4RA 4LDTB 5BO4B 2MBBB 1V5MA 4MELA 4MSQB 3A9KA 5KQ1A 2LD9A 4KDIC 3AULA 4PYUA 2K8CA 1XKEA 3QC8B 4W9GA 3UIOB 2K1FA 3U7DA 3H6NA 1AARA 4PYZA 5E6PA 1E8WA 3IBEA 5CHWA 1NTVA 4NSWA 1Q5WB 3KZ1A 1N3HA 2DKPA 2KJRA 1V5UA 4KIKA 2WX0A 2PPHA 3WA0A 2YS1A 4KHAA 3R7QA 2HD5B 3QIJA 3TVVA 3VXWA 3A9JB 5DI9B 1NVLA 2CR5A 2R2QA 2JY6A 3PREA 2JVCA 3D8DA 1WJUA 3RZFA 3VVWB 4MT7A 1MK9B 2CB8A 2LXCA 3WAPA 1S3SG 3M63B 5DHFB 3PPAA 1V89A 3ZVVA 2P0DA 2HJ8A 1FHXA 4BOSC 3R66C 1Q1OA 1OY2A 2NR2A 3V6CB 5IJMA 5LOPB 2LRUA 3HQCA 2D07B 2L3ZA 5TR5A 5JLJB 1WGRA 2CRFA 1YIWA 2D2QA 2VKIA 1AQCA 2NS5A 2EMSA 2C7HA 5GOWB 4F7UP 2LI5A 1XR0B 2QKMA 3N7CA 2KWUB 2VRRB 2FCQA 1V9JA 1ZSQA 4YL8A 5IA7A 3ML9A 3KUCB 3FM8C 3QAQA 2IBIB 3V61A 2ADZA 4AOFA 2G3QB 3L10B 4E3CA 1WE7A 3SUZA 2PZ1A 3DDCB 3NZUA 4JLCA 1V5OA 2DZIA 3KVFB 4RMAA 3ZNGC 3QA8A 5HKHA 3A8QA 2N7DA 1P3RA 3R7RA 4KHOA 3QJZA 4F8CB 1X1FA 3AU5A 2ZEQA 3T06A 4K17A 4NAWB 2LJ5A 3PRMB 2HE7A 4A3PA 3M95A 2O2VB 3ML8A 1PMSA 1Y5OA 2KNBA 4TQ0A 1ZVRA 2M8SA 2FDQA 3H7PB 1E8XA 3B08A 4LDTD 2IY1B 2L0TA 2MBOA 1OMWA 3QK0A 2K39A 3T9LA 2MP2B 2IO3B 5J18A 1U5GA 3KYCD 5D6JB 2YS5A 4NAWA 3BJIA 3V5WA 4MSMB 4IWOA 3JSVB 3M62B 2P8VA 4CYEA 4K81A 1WM3A 2FJLA 5AEKB 3H7PA 2N1VA 2RVBB 1DDMA 4EFOA 3QHTA 2FCMA 1EUVB 3PS6A 2KFKA 3EECA 1IYFA 4JGHB 1XT9B 1P6SA 2DZMA 2GBKA 4A3OA 2KMAA 4MH0E 1P3QU 4ANXA 2BWES 5EDSA 1WMHA 4AWJA 4HB0B 4F7HA 2M38A 3I3TB 3RT3B 2O6VB 1Y8RC 3KUDB 2ZVOA 1X05A 2ZPYA 4HPLB 2G45B 2JZ3B 3WAOA 2IZVB 2LGXA 4TKNA 2RNRB 3CXBB 2Y8GA 5D3YA 4IAPA 3UZTA 1I42A 1ZC4B 2BYVE 5DPSA 1U5EA 3A98B 3QARA 3V60A 1IPGA 3H9DA 4GDLA 2CKHB 1P9DU 3W1YA 4ZDVA 2LG1A 1WGQA 3NOBA 2GOWA 3SV1A 2DHJA 1VCBA 2LVOA 3VUWA 3VIAA 4EJNA 4GSWA 1V61A 3KUZA 3ODWA 1J8CA 1WH3A 1FAOA 3N30A 3ZVRA 4CHMA 3VH3B 2MBQA 1E90A 3TJPA 5J17A 5JHBA 1DYNA 4GDKB 3ECIA 4GN1A 3A4RA 4IWPA 1HBKA 4DHZE 4G3XB 1M7EA 2B3AA 4II3B 2DHZA 2C7MB 4FN2A 4NJ6A 2AYOB 3T8MA 5GMVA 4W9FA 3V62A 1K5GB 3ODOA 3L16A 2AEHA 1T0YA 1ISNA 2V3SA 1NU2A 5JHGA 3ALBA 1CMXB 3DPDA 2L1CA 4GDKA 4FADA 1GUAB 1EF5A
chains in the Genus database with same CATH superfamily
3CMMB 1WXAA 2ZNVC 2N7EA 4JIOU 1QKZA 1ACAA 3VUXA 1I2HA 1DOXA 1HZ6A 3PT2B 3MP9A 2CHWA 4K1RB 4EUTA 2GLSA 2DX1A 1VZ8A 1T6BX 2MBEA 4A6FB 2O6VD 1TY2A 2LASA 4DK5A 1JRUA 4W9CA 3KRXA 4MH8A 3DHGC 1SBBB 2RR9A 4OW0A 2PEAA 3NJTA 3UIPB 5HG2A 2JT4B 1ZUD2 2IYBA 2BYTA 1WGGA 3PP2A 4O1NA 3Q3JA 2COPA 1AN8A 2WGSA 4OVUA 3RI7C 2BKRB 3MHSD 2DYOA 5FKAC 1M4VA 3N3KB 4JKDA 4HPPA 4WJQA 1KH0A 3HM6X 5AZFA 3WCQA 1K51A 4Z2MB 4IC7B 1SF0A 1JDEA 3DCGA 5FI1A 1BAKA 4GZUA 4Y94A 4G0NB 4N9F4 3P4QB 1MI1A 2D11A 2RSUA 4FULA 3L54A 4W9JA 2MJDA 2X8XX 1AWEA 2CAYA 4FJVB 3ZYYX 2RSGA 1UELA 4A6FA 1KRHA 3RZWC 2Q5WD 4IM2A 2K2UA 3BIID 1X11A 2K22A 3N9YC 4PS7A 3UQBA 3AE6B 4KDLB 3AMZA 2RDGA 1M7RA 4WSFA 1LO5D 1WE6A 5C1ZA 1GB4A 1TXDA 3EPYA 1BWNA 1F2RI 2DFKA 3ZDTA 4XZ4A 1UWXA 4B95A 4BKTA 3SBTA 1FFUA 2BCJA 3BK1A 3RUIB 2AWTA 2LEKA 4ZHOA 5AZHA 4IKGA 3FC4A 1WZ3A 3O13A 5G5HA 4FJZA 2DHIA 1P0RA 1LFDA 4P7IA 2KTRA 4BKGA 3VTWA 4G11A 1QC6A 2BWFA 4BKSA 2GRIA 5JH5C 4BBNF 3DBHI 3GE3C 1SE3A 2FBWB 4TV3A 3IAS1 1FHOA 1FCCC 3NY5A 1L4ZB 1YX5B 3A9KB 3VQIA 3ONSA 2G9HD 2K3UA 2R61A 3KSYA 4FLHA 1FXTB 1V6EA 2D5GA 2FE8A 2Q13A 4LNNA 1WI0A 1E8YA 1TQZA 3PEGA 1WJNA 3A8PA 4HSIA 3DCXA 3E56A 4A8XC 4D0NB 4JQWC 1HQRD 1R4MI 3PLVA 1BTKA 5FR3A 2RPQA 3PVWA 5LNK1 4HVBA 4OVVA 2W2XD 1N6ZA 1PLSA 1J0WA 2JYEA 2HTHB 4NAMA 3WANA 2D4QA 3A4SC 4GGQA 3KW5B 4AUQC 2HJ1A 2MKRA 1MFWA 5JXVA 2Y5BB 4C80A 2WDTB 4JKCA 4TMAB 1NEKB 2UU7A 3Q8BA 4A6HA 4PNKA 2NTTA 2PE9A 2YS3A 3U12A 4K7UA 1DGJA 4C7ZA 4MM3A 4MK0A 4EZLA 4ILGB 2YSZA 1JWBD 5AZGA 2KC1A 3U7ZA 3URYA 1WWTA 2YT2A 1FPYA 2DA0A 5IRSA 2MBHA 1WJ1A 4DDGD 5C16A 1YNTE 3IAM1 2KN5A 1X1GA 2JZZA 2L00B 3L17A 3NWDA 3A58A 2LHEA 4RF1A 4HK2A 1U27A 4HDOA 1SJED 4K3CA 1TIFA 4GU2A 2RMMA 3SHQA 2BBCA 1WXQA 3MC0B 4NNJB 1Z5SB 2HTHA 2W2WA 2C9WB 1TYGB 4AJYB 2GBNA 3AECB 1F52A 4N59A 1YN4A 1G6JA 3P2BA 1FNUA 2XK5A 3PVUA 5D7GA 2NTSA 2DX5B 1J7AA 4RGOS 2YEPB 5LXHA 1E7PB 2WYQA 4BAXA 4DX8A 1QQGA 2KUPA 3DVGX 2LJIA 2LGYA 3DBLI 1WGDA 3U2SC 3QX1A 2FJ9A 1D5MC 3NS8A 1UNPA 3HIEA 4IW0A 1AYFA 1BMLC 4HCNB 2MH7A 3AEBB 3VH4B 2LGSA 3AH7A 4URKA 1AWDA 3DWMA 4EOYA 1SGHA 4JWUC 3ZKJC 2PTLA 1SXTA 3R8BA 2LGIA 1V8CA 1SIFA 5D2MB 4L2YA 1ET9A 2VSZA 3PSEB 3SBGA 2LMCA 2KCJA 2KT7A 2JXXA 3O96A 4BBNC 3IT6B 1L0XB 2UYZB 2AX5A 5D3DA 2E6XA 1L6UA 2DX5A 1ZP0B 1WYGA 2ZVNA 2ZPNA 3BY4B 3CSTA 1ZM0A 3PO0A 1QOAA 2CU1A 3DHHC 1T0QC 1NYQA 2MWSB 4M8MA 5GXGB 1XEEA 1ZPSA 2QDFA 3L0WB 1R4MB 2G1EA 3TIXA 1T3QA 3GS2A 1SJHD 1SSNA 3L4PA 2LZ6A 3DXEA 5C6RA 1IRSA 2MEKA 4GIVA 3N1XC 4JKGA 1T77A 3KH0A 2MWNB 2JX5A 4OZCA 1D4BA 2A5UA 3DWGC 2P0HA 1V1PB 3Q8CA 3SO6A 5LLIA 1WGHA 1MAIA 1MK7B 2WP9B 2WS3B 3F0WA 1LW3A 3TEZA 3QBVB 1QF6A 4II2B 3OAWA 4GMXB 4PK1A 3MJWA 1YQBA 2KVZA 2K8HA 1RRBA 3O65B 2NZ8B 2Z59A 4RM8A 2CU3A 1OGWA 5D94A 3AE1B 1EF1A 5G55A 3P63A 4WAFA 4B0MA 4HJKA 3A1QA 2WXOA 2PE6B 3N1ZC 2ICIA 4I6NB 1PFJA 1VZ7A 3PGEA 2MW5A 2KFKB 1K8RB 1DBHA 2UZSA 1E7UA 1L0VB 1ZXIA 3IFWB 1XCQL 1AW7A 4YWGG 1KLUD 1P5TA 2QCZA 4W9IA 1NBFC 1V1PA 1XQQA 3RCPA 4NQKE 2GMIC 5HFYA 2KMCA 4FA6A 4R3DA 3VTVA 2OOBB 3NWFA 1WMHB 4HB4B 3R2IA 1C79A 2LUEA 2IPKD 3UGBB 1L4DB 1WIAA 4XYCA 1ZXHA 2N9KA 1J0GA 5E6OA 2JF5A 3B1LX 4LJOB 1L0YB 2NMQA 2L0FA 1DOYA 2COFA 3RD2A 2K2JA 1PGAA 4MGZE 1TZ1A 3SU8X 2QILA 2IGDA 4C56C 4JPSA 2R0DA 4PT5A 3GB1A 1ZYIA 5LG4B 3HHMA 3RNCC 5C2TB 4KX6B 2DYBA 2JQRB 1I7HA 3JVZX 2WWZA 3JW0X 2Y5CA 5JZEB 2DYMA 4FJYA 4ZRJA 2KLCA 2MJ3A 2Z0EB 1TBEA 2K5PA 4NY0A 5I2MA 1RAXA 4DHJB 2R2YA 2G4DB 3NUHB 2DENB 3PRPB 1H8CA 3Q8EA 3E9PA 4MDKE 3ZXVA 1K5DB 1CJEA 1DROA 1WI1A 2L83A 4H2AA 1VLBA 4GDLB 2YVCA 4RFBA 1WJ4A 1ST7A 3D8FA 1WY8A 2CJOA 1J7BA 3ML4A 3MC8A 3EUB2 1UH6A 2COCA 1HTQA 2AL3A 2KQ7A 4ANVA 4OVZA 1KZGA 3R3MA 4L23A 2ZW0A 2EELA 5IAAC 2WXLA 3D8EA 1DYQA 1RFAA 2ZCCA 1STEA 2D3GA 3SFDB 1PFDA 3WIMA 5JVLA 3NG0A 3PZDA 3IVFA 1YX6B 2LFIA 2NVUI 1I7AA 2SEBD 1NTYA 2V1YA 5G5GA 4LCDE 2CJNA 5IO9A 5E6JA 2LVPA 2D9XA 3B77A 4KGSA 4NJ7A 5BMIA 1OTRB 3C0RB 1EM7A 2K49A 2UVMA 1U2BA 2OJRA 4ANUA 3FILB 2W2XC 1TS2A 2OQBA 1T0RC 3AEGB 2H88B 2B76B 1WX8A 4C0AA 4HAXB 4Z2NA 2KIEA 1JCKB 5HHDG 1WGUA 1OEYA 4BBKA 3CF6E 1UNRA 2DYQA 2TSSA 2IGHA 1MG4A 4D6WA 2FAZA 4HCPB 1ET6A 4FXCA 5D3VA 2I2YA 2I1KA 2NBUA 1HE8A 3HVDA 1FB8A 1R4NI 4HRSA 4F7ZA 2IFSA 1P98A 3NWAA 2MX2A 3NHEB 4GXBA 2KIGA 4HPMB 1DDVA 3DBRB 3RMKC 2ZJDA 3ZIMA 5TSSA 1TTNA 1GGOA 2YLMA 2LYDA 3ENEA 4DX90 1IBXA 4JKFA 4DBGA 5DCNA 4B6WA 2PJHA 3FILA 4A55A 1ZKHA 2H7EA 3ZJUA 3UQAA 1EGXA 4WJNA 5C79A 1GG3A 4KKIA 4OSNA 4S0RA 3HSAA 2GBMA 1T5XD 4CHKA 1FXAA 1HB8A 4KSKC 2KK8A 1UBIA 2VRWB 3W5UB 1K53A 3RPFC 2J53A 4YSXB 1PQSA 4N6EB 3CIKA 3C19A 1Q0WB 1XX0A 2ONQA 3PG7A 4YT0B 5DIFB 4MY6A 2D3AA 1GC7A 2QHOA 1WXMA 2GBRA 1T0SC 2ZCBA 3ZJVA 4DDID 3P42A 4CSQA 3AEAB 2E3TA 3AE2B 5KHOA 1E0ZA 1H10A 4NZLB 2I5FA 2DNFA 4A90A 4HLEA 2L76A 4X57B 2C5LC 1HA5A 4ICUA 1OQRA 3WYFB 2UZRA 2I1JA 2WNMA 3P6AA 3FSSA 3VAWA 5D3WA 2FUHB 3Q2AC 2WXIA 3CSFA 4EKUA 2M14A 1HTOA 2FCNA 5EE1A 4L6EA 5KHQA 4RM9A 2MCNB 1W1DA 1TKYA 1E5WA 1FRRA 1SIJA 3ZXRA 1WXVA 2J0KA 3DVNU 2W3SA 5JP4A 3ZGZA 4WWPA 1FCLA 3NVZA 2GJYA 3X0WA 2D10A 1F9JA 4USAA 2EC1A 3NZSA 2R09A 3D32A 4G50A 1C78A 1M94A 4A5KA 1GAQB 2IO0B 3NRZA 3ABVB 1PYWD 4F7GA 1YQ3B 2DYNA 4REZA 4TUUA 4JWSC 2FIFA 2PIAA 2V4LA 4TYZA 3U30A 5BMGA 2KTRB 1U5FA 5J3TA 4YONA 3Q8AA 2CY5A 3AXCA 4A6QA 3APCA 4FHJA 5EFXA 2ZW1A 1V5PA 2ON8A 1R4NB 1FNWA 2KXJA 4AQ7A 2D3CA 2WH5A 1SHCA 3MTNB 4CHJA 2WLBA 3OG5A 4WQMA 4GMVA 4PQ0A 4M00A 2NPTA 2PMVA 3V3XA 3B2FA 2J0JA 3VR8B 5I4DA 2P0FA 2ZNVB 1RRPB 4YTPB 1XD4A 5KQ4A 3FKYA 4GB9A 4HAWB 5HE3A 3DQVA 1TJEA 5IKCM 2WXQA 1Y19B 1WX9A 2DZJA 2FUG1 3MJ5A 3U4EG 2HRJA 4P16A 1NI3A 3AJ4A 3FP5A 4IG7B 1C4CA 1MI0A 2OEDA 2JPHA 2XEWA 4W9HA 4KAXB 4W9DA 3KWVA 1UNSA 4EZKA 5J3YA 4MM3B 4J6IA 3W2DA 4KKJA 3PLUA 1P7EA 3LDZE 2DBYA 1JQ4A 2KFJA 1LGRA 4WAAA 3L08A 3V05A 4ARCA 1FHWA 1YD8U 1VJKA 4ZHPA 2DLWA 2DWQA 1XLPA 1WJ6A 1V49A 4EEWA 4ICVA 1F77A 1Z2MA 1KOTA 1GJZA 5JHAA 2LKOA 4HHVA 3RN9C 3EC8A 3ZRFA 3GYPA 2ROVA 2JUOA 2M1MA 4A6KA 1K52A 1UEFA 1JWAD 3IG3A 4MGKE 1NI2A 3BINA 1VBHA 5DH9B 2A4ZA 4BOZB 2L7RA 5BMHA 3AU4A 4ZRIA 1WFYA 2KC2A 2KQSA 1ZDVA 3W1SC 2BB5A 2N1WA 2IY0B 4OT1A 2XK5B 4OZBA 3PV1A 4W9LA 4US8A 4HB3B 2L52A 3ULCA 3U8ZA 5LONB 1EU4A 4KV2A 3BK2A 1V88A 3EHVA 1EVHA 3VDZA 4E74A 2LOXA 2J59M 2KDEB 3AE4B 3GZNI 2BS4B 2RDHA 2J7QB 1C1YB 2N9EB 1FO4A 4HROA 3G9WA 1WYWB 3U52E 2Y5PA 3PHXB 4HB2B 3H1UA 2D9WA 2MDXA 5D3XA 1L5PA 2CS4A 1CZPA 2CY4A 4LTUA 2KWCA 2N9XA 1BT0A 3TO1A 3ZUNA 2LBBA 1Q67A 3ZO5B 4XGAB 3UI3A 1JMLA 3LJ3A 3APDA 2QC8A 2D9ZA 4M02A 2KVRA 3EFCA 4IOYX 3BZDB 4LK0M 1L7YA 4WQOB 3DOWA 2FCSA 2FNJB 3SEBA 3PHWB 2L1AA 2JU6X 1E10A 1MPEA 4IM0A 3BYYB 3TW1A 3T3NA 2V9HA 3KYDD 4BKSD 2NCNA 2KDMA 1TZOA 2PVOD 2XNAC 3SD5A 1LQBA 3GOEA 2EJ8A 4H8SA 1OQNA 3HK0A 3HW2B 4MGYE 1V86A 2KX3A 2X18A 4JKGB 2M0AA 3P4RB 4HAVB 4IFSA 1S1QB 2DAFA 1SE2A 1ZOYB 1WM2A 4DHZB 2WQYB 4NQLB 3VOQA 4EMOA 2EKEC 3OLMD 1MVKA 3NSUA 3RNBC 2LULA 1B55A 4HAUB 4WVFB 3BVZA 3I63C 1VR9A 2BW2A 5HI1A 2WXFA 2Z0DB 2W55A 2K8BA 4DWFA 2V76A 2MLBA 2N4FA 2Z59B 3B2GA 2GCLA 3A9JA 3LYYA 4JKEA 1B1ZA 1PGXA 3ZW3A 4EZJA 2W3RA 1NENB 4K2PA 3A1QB 2COAA 2KJ6A 3DVNV 2YF0A 2WXRA 3AE9B 4PS8A 1V81A 2BQQA 1KFYB 2BT6A 2BPSA 2INPE 2KANA 3MPXA 1YQ4B 5IOIA 4XC2A 5JHHA 2Y7BA 2GS0A 1P1AA 2JWZA 3VHTC 5J2RA 2J0MA 1SB3C 3X23A 4BVUC 5J3QA 1LB1A 2BF8B 2LVQA 4MEMA 4IM3A 1DIKA 1UF0A 2CHZA 2RD0A 2WXPA 3RYTA 2ZZPB 3W1SA 2NBWB 4HEA1 2RUKB 2SAKA 3M3JA 1N63A 2W9NA 1C4AA 2L05A 3AI5A 3GZNB 4JKAA 3UF8A 1MG8A 2YRYA 3TBLD 2WXJA 2INDC 2L8JA 1X1MA 4MGIE 1KF6B 2KACA 3ZNZB 1SE9A 2N9PC 3ZLZA 2DIKA 3HUIA 1JROA 1PDXA 2RGFA 3VFKA 1JWMD 1GC6A 2KDFB 2ELBA 2IJ0A 3SR6A 4S17A 1VD2A 2DHKA 2G35A 1NTIA 2WX1A 4BFRA 4LNIA 3SDLC 1RLFA 5H92C 2V0GA 1QZEA 4XDDA 1E7VA 4K3BA 5I2SA 2KJHB 1WX7A 1UPQA 1X86A 3IT4B 1JWUD 4KGTA 2ELAA 3E9SA 3FAHA 1XLNA 1UPRA 1XLQA 1XD3B 1WGKA 2QKLA 3VUYA 1C4PA 3DBRI 3OJ4B 2KMMA 4L1BA 4JKBA 2NMBA 1U5DA 4F1SA 4DXGA 2Y8FA 2WDQB 1XO3A 4I6LB 4MT5A 2D3BA 1MHXA 2REXA 3AV8A 3ZTDA 2KGXB 5AUIA 3AE8B 3DVGY 1WR1A 2J52A 1P7FA 4ZYNA 5FI0A 5L83A 1L2NA 2O2VA 2C60A 1WF9A 5C5BB 2NBVB 4ZRKA 4XWWA 2K00A 1ACCA 2DZKA 1W1HA 4M0WB 2PKOA 2I5CA 1LXDA 1FGZA 4AP4C 3BVMA 4W9EA 4TQ1A 1J19A 2AL6A 2Z14A 2CODA 2MP2A 1XCGA 1TGZB 3TL5A 2CHXA 1Z87A 3N32A 3BWUD 4IUMB 5DPTA 2KDBA 1WXSA 2KO3A 2YT1A 2OJWA 4PS3A 4FBJB 2N0SB 1D3ZA 3QQ8B 3PRZA 5D27A 1UZXB 2IYDB 2M17A 4C4VB 1TJ6A 3TCAA 4IWQA 5H8YE 3N1YC 2RQ1A 2DTCA 3JSVA 1MJDA 1IGCA 1V80A 2LWPA 2KZRA 2INCC 1WZ0A 2NBVA 5C5BA 2KKCA 3FLVA 1UGJA 2IO1B 3IHPC 2MFQA 1MIXA 2RRFA 5HE0A 2ASQA 4LLGM 2JRHA 2H7DA 3SNHA 4HXDA 3MHZA 4M0WA 2EMTA 5LXIB 1V5TA 4RCOA 3TSSA 4TSSA 2WXKA 4LJPB 1A5RA 4WWOA 5CHFA 4GPTB 3P4PB 3HIZA 2RDBC 1KZ7A 1UGMA 4KZ0A 4E71A 3NVYA 1IBXB 1VBGA 1E8ZA 3TMPB 2L2IA 4WURA 1RJ2A 4HWIB 1KJTA 2R2OA 1ZDXA 4K7SA 1TS4A 1HB6A 2WXNA 1V2YA 1BXTA 3OANA 3Q14C 1TKGA 4C4VA 2UWQA 4QJ5B 4DXFA 3I57A 2Z0QA 4ILHA 2DN6A 1EWCA 2XQNM 3QWMA 2O6VA 4YXDB 3TFMA 2JRIB 5IP4D 1MIZB 2OTXA 3KRWA 2G4SA 2N9LA 2MHJA 3AE5B 1WVHA 3NW8A 1EAZA 2GBJA 3NVWA 4NPNA 4RF0A 5BYQA 4AJWA 1FGYA 1YN3A 4QAYA 2KD0A 1W1GA 1JALA 3S2AA 1RFKA 3MDBC 2RLOA 4KZCA 3PVLA 5CLQB 2LRWA 4YTMB 2EKIA 2JP2A 2BVCA 2GUMA 1FNVA 3QCAA 2XBBC 4CQNA 4B9KA 3N20C 3B0AA 4WH4A 1CQVA 3L13A 1ZGUB 4DBBA 2LOZA 2LUMA 5FK9C 3DHIC 1TKEA 1ZC3B 4CO7A 3WALA 2BYEA 2MJEA 1YOVB 1QQRA 3NVVA 2ROZB 3RNAC 5DPRA 1WJMA 4JL9A 5DPWA 3DXCA 1U4AA 1FOEA 1QOFA 2PLPA 2IO2B 3H7SA 2X0SA 3ZTCA 2ACZB 3AEFB 2ABDA 1K50A 1YJ1A 3T3OA 2YEPF 2MRPA 3Q3FA 2DAJA 2GCJA 1RM6C 3PSCA 3VRAB 1FRDA 3RFZB 3PTFC 1KLGD 1JW9D 1QLBB 2MQJA 4DHJD 2KQ4X 2KDIA 1E9MA 1WRDB 3NZ3A 3RNFC 2YT0A 4YSYB 2WU5B 1UD7A 4P1CC 3EA6A 1F0ZA 4HATB 5E6NA 4K7WA 5KCVA 2KAJA 4W9KA 2N23A 1SEBD 4KVGB 3HM3A 4ASWC 5MPOA 2MA9B 3OJ3A 1KLVA 2LXAA 1OQYA 2NPTB 1KM7A 1IP9A 2BYFA 1GNUA 3APFA 3EFUA 1EO6A 4OHJA 1KC7A 4YSZB 1KI1B 2D9YA 1I4HA 3ZNID 2Z13A 1V1OA 5EE0A 2Z0OA 3ZRCA 2DLBA 1NVID 2K6QA 5L95C 4HAYB 1TS3A 2D9VA 1C76A 1N62A 1TY0A 5CHVC 5CX3A 2QIEB 1WGYA 2RGNB 3FEHA 4B6HA 3PZ8A 4KHBB 1MKEA 4ZOHC 2BKFA 3H8HA 1OEYJ 2BGFA 1VRAB 3P7ZA 5L81A 2MSED 2K6DB 2V3NA 1C3TA 4YTNB 2M56B 2M0XA 1I4RA 1PUTA 4DXAB 1ZW7A 4A20A 4ANWA 1QOBA 2CQUA 3WAMA 3ETRA 2KWDA 3DBSA 4FHKA 2WU2B 2IGGA 2E2XA 2VH1A 2W82A 4I6PA 2WXGA 2RPVA 2C7NB 2KTFA 1VDVA 3IXSA 5CTRC 2J4XA 3ENBA 3ZDMC 4MJSB 2QSDA 3MC9A 2V4IB 2AQ2B 2WXMA 5DHAB 5C23A 4HDQA 2M19A 1BUIC 2LGDA 2JSVX 2KUQA 3K9OB 2BTEA 3JYUA 4KHBA 3AE3B 1ENFA 1IGDA 3RCZA 3F5RA 3M1IB 3KLSX 5EE9A 2KHWB 2KLGA 3B9JA 3MFGA 3W5VB 2FIDA 4M01A 5HE1A 1WR6E 2LHDA 3ODXA 1BTNA 1C77A 3P4SB 3DXDA 1GB1A 4XX5A 1I35A 2Z0PA 1WG7A 4HAZB 3BVGA 3ZNHB 1WRIA 5HE2A 2KX0A 1NDDA 2N0YA 1EU3A 4LNKA 2N7JA 2BB6A 3VTUA 4JK7A 3ULBA 4MJSA 3GYOA 4WJ7A 4WJOA 4KSLC 3UINB 2KOXA 3V6EB 1A70A 1F2RC 2M4NA 1DDWA 2R82A 1U29A 2JXTA 1LM8B 1YN5A 4KIKB 2KWVB 2DKQA 4M8NA 4WJPA 5T8IA 4GOCA 4N58A 4XWTA 3QWZB 3C8YA 2K25A 3SYXA 4GLSC 5G2NA 1MPHA 4QXAB 4P1BC 4K2OA 3KY9A 4US9A 1UBQA 2AQ1B 3RULA 1YMHE 3A33B 1GPXA 4WWNA 2OHFA 4XWXA 2Z4DA 3K9PB 1UNQA 5CLLB 3LJUX 1XODA 5FR6A 1H4RA 4LDTB 5BO4B 2MBBB 1V5MA 4MELA 4MSQB 3A9KA 5KQ1A 2LD9A 4KDIC 3AULA 4PYUA 2K8CA 5BYRA 1XKEA 2JWUA 3QC8B 4W9GA 3UIOB 2K1FA 3U7DA 3H6NA 1AARA 4PYZA 5E6PA 1E8WA 2WDRB 3IBEA 1JRPA 5CHWA 4EE2A 1EWYC 1QILA 2QEJC 3Q8FA 2WHIA 1NTVA 4NSWA 1Q5WB 3KZ1A 1N3HA 3P1MA 2DKPA 2KJRA 1V5UA 1ESFA 4KIKA 2WX0A 3AE7B 2PPHA 3WA0A 2YS1A 1FFVA 4KHAA 1N61A 1R7SA 3R7QA 2HD5B 3QIJA 3TVVA 1XF5L 3R2TA 3VXWA 4D2KA 3A9JB 5DI9B 3HVZA 1NVLA 3Q69A 2CR5A 2R2QA 2JY6A 1HEZE 3PREA 2JVCA 3D8DA 3FVCA 1WJUA 4WIPA 1VZ6A 4ZRPA 5D3IB 3RZFA 2HTME 4P6VF 3VVWB 4MT7A 1RWSA 1MK9B 2CB8A 2LXCA 3WAPA 1S3SG 3M63B 5DHFB 1QT9A 4RGTA 3PPAA 1V89A 4DIXA 3ZVVA 2I38A 3EGRA 2P0DA 2HJ8A 2L32A 1FHXA 1TS5A 4ITKA 4BOSC 3R66C 4ZYSA 3ZQ4A 1XLOA 1Q1OA 1OY2A 2NR2A 2PVGC 5IJMA 5LOPB 2LRUA 3HQCA 2D07B 2L3ZA 2PW9A 3V6CB 5TR5A 5JLJB 2VZKB 1WGRA 2Y3AA 2CRFA 1YIWA 4MACA 2D2QA 4WWMA 1FMAD 1I4PA 1PGBA 2VKIA 1AQCA 2NS5A 2EMSA 1FEHA 2C7HA 5C3JB 5GOWB 4F7UP 3DBHB 2LI5A 4JX1C 1ZE3D 1XR0B 4JKHA 2QKMA 3N7CA 2KWUB 4J3OD 3AEDB 2VRRB 3Q6BA 2FCQA 1I4GA 1V9JA 1ZSQA 4YL8A 2KYWA 2V3PA 2JZPA 5IA7A 3ML9A 3KUCB 3FM8C 3QAQA 4XE0A 2IBIB 3V61A 1UWMA 2ADZA 4AOFA 2G3QB 3L10B 4E3CA 1WE7A 1YJJA 1XCTL 3SUZA 2PZ1A 1TT5B 3DDCB 1FD6A 3NZUA 3VRBB 4JLCA 1V5OA 2DZIA 3KVFB 4RMAA 3ZNGC 3QA8A 5HKHA 1FIQA 3A8QA 2N7DA 4QJ3B 1P3RA 3R7RA 3SFEB 4KHOA 3TEWA 3QJZA 4F8CB 1X1FA 3AU5A 2ZEQA 3T06A 3Q3MC 2HDEA 4GOUA 4K17A 3RNGC 4NAWB 2LJ5A 3PRMB 2HE7A 4B0EA 4A3PA 4OZAA 3M95A 2O2VB 3AB5A 3ML8A 1IUEA 1D5XC 2WXHA 1PMSA 4XDCA 1Y5OA 2KNBA 5BYSA 4TQ0A 4LNOA 1ZVRA 2XN9C 2M8SA 2Z8LA 2FDQA 3H7PB 2GI9A 1E8XA 3B08A 4LDTD 2IY1B 2L0TA 2MBOA 1OMWA 3QK0A 2K39A 3T9LA 1F1HA 2MP2B 2K9XA 1I4XA 2IO3B 3KQ4A 5J18A 4ACFA 3AM9A 1HXYD 1U5GA 5M4YB 4QJ4B 1Y56A 3VR9B 3KYCD 2BS2B 5D6JB 3KWLA 1OFFA 2YS5A 4NAWA 3BJIA 3V5WA 4MSMB 4IWOA 3E9LA 3JSVB 3M62B 2P8VA 3DBLB 4CYEA 5AUKA 2QJLA 4K81A 1RYJA 1WM3A 5IN7A 4IDIA 1WSPA 2FJLA 3OHMB 5AEKB 1Q10A 2N1VA 3H7PA 2RVBB 1DDMA 3RNEC 4EFOA 1B9RA 3QHTA 2FCMA 3AEEB 4HKQA 3HRDD 1EUVB 3PS6A 2KFKA 3EECA 3Q3OC 1IYFA 4JGHB 1JWSD 1XT9B 3GP7A 1P6SA 2DZMA 2ZKMX 1N5XA 2GBKA 3Q3NC 4A3OA 2KMAA 4MH0E 1P3QU 2AQ3B 2J42A 4ANXA 2BWES 5EDSA 3TEYA 1WMHA 4AWJA 4HB0B 4F7HA 2WDVB 2M38A 3I3TB 2K0PA 2VZKD 2X38A 3RT3B 2O6VB 1Y8RC 2H89B 2QMTA 1FM0D 3KUDB 4JE3B 1DOIA 2ZVOA 1X05A 2ZPYA 4HPLB 1C9FA 1I4QA 1KTKA 2G45B 2JZ3B 1OQQA 3WAOA 2IZVB 2LGXA 4TKNA 2RNRB 4KGRA 2IDYA 4LNFA 1N60A 1KBLA 3CXBB 3ZJTA 2Y8GA 5D3YA 4IAPA 3UZTA 4RGMA 1UUPA 3TUOA 4NJCA 4DQOC 1SE4A 2JYTA 4JK9A 2KN4A 1J7CA 1I42A 1ZC4B 2BYVE 5DPSA 1V97A 1U5EA 3A98B 4L1RA 3QARA 1NYRA 3V60A 1HZ5A 3E9OA 2W54A 3PZ7A 1IPGA 4C7YA 3H9DA 4GDLA 2CKHB 1P9DU 3W1YA 2VH2A 3GE8C 4ZDVA 2LG1A 3CIRB 1WGQA 3NOBA 3TEXA 2KR0A 1D5ZC 3NS1A 4HJGE 2GB1A 3LB8C 2GOWA 3SV1A 3W9CB 2DHJA 1VCBA 4ILJA 2LVOA 3VUWA 3VIAA 1MHHE 4EJNA 3LXFA 4GSWA 1V61A 2INNE 3KUZA 3ODWA 1J8CA 1WH3A 1GOZA 1FAOA 3N30A 3ZVRA 3CWIA 4BZAA 4A9AA 4CHMA 4Q2JA 4GNKB 5EE3A 2MBQA 1E90A 3OWEB 3VH3B 4HKZE 3TJPA 5J17A 5JHBA 1DYNA 1XXGA 4GDKB 3ECIA 1CK1A 4GN1A 3A4RA 4IWPA 1HBKA 4DHZE 2FJUB 3AN1A 4G3XB 1M7EA 1E6EB 2B3AA 4II3B 2DHZA 1YJIA 2C7MB 4FN2A 4NJ6A 2AYOB 3T8MA 1FXIA 4ZRQA 5GMVA 1N5WA 1ROEA 3J9CA 1QOGA 4UDUC 3BYTB 2BS3B 4W9FA 3V62A 1K5GB 4AS1A 3I9V1 4JK8A 3ODOA 2AEHA 1T0YA 2K8EA 3L16A 1ISNA 2V3SA 4RNAA 4RGNA 1NU2A 5JHGA 3ALBA 4C00A 1CMXB 1D6EC 4RH6A 3DPDA 3I5JC 3E66A 4ARIA 2L1CA 4GDKA 4FADA 1L6VA 1GUAB 1EF5A 4IOIE
chains in the Genus database with same CATH topology
3CMMB 1WXAA 2ZNVC 2N7EA 4JIOU 1ACAA 3VUXA 1I2HA 3PT2B 2CHWA 4K1RB 4EUTA 2DX1A 2MBEA 4A6FB 2O6VD 2LASA 4DK5A 4W9CA 1JRUA 3KRXA 2RR9A 2PEAA 3UIPB 2JT4B 2IYBA 1WGGA 3PP2A 3Q3JA 2COPA 4OVUA 2BKRB 3MHSD 2DYOA 3N3KB 4JKDA 4WJQA 3HM6X 5AZFA 4Z2MB 4IC7B 1JDEA 3DCGA 5FI1A 1BAKA 4GZUA 4Y94A 4G0NB 4N9F4 2D11A 2RSUA 4FULA 3L54A 4W9JA 1AWEA 2CAYA 4FJVB 2RSGA 1UELA 4A6FA 3RZWC 4IM2A 2K2UA 1X11A 4PS7A 3UQBA 4KDLB 1M7RA 4WSFA 1WE6A 5C1ZA 1TXDA 3EPYA 1BWNA 2DFKA 3ZDTA 4XZ4A 4B95A 4BKTA 3SBTA 2BCJA 3RUIB 2AWTA 5AZHA 1WZ3A 4FJZA 2DHIA 1P0RA 1LFDA 4P7IA 2KTRA 4BKGA 3VTWA 4G11A 1QC6A 2BWFA 4BKSA 5JH5C 4BBNF 3DBHI 4TV3A 1FHOA 3NY5A 1YX5B 3A9KB 3VQIA 3ONSA 3KSYA 4FLHA 1FXTB 1V6EA 2Q13A 1WI0A 1E8YA 1TQZA 3PEGA 1WJNA 3A8PA 4D0NB 4JQWC 1R4MI 3PLVA 1BTKA 2RPQA 3PVWA 4HVBA 4OVVA 2W2XD 1PLSA 1J0WA 2HTHB 3WANA 2D4QA 3A4SC 4GGQA 3KW5B 4AUQC 2MKRA 2Y5BB 2WDTB 4JKCA 4A6HA 4PNKA 2PE9A 2YS3A 4K7UA 4MM3A 4MK0A 4EZLA 4ILGB 2YSZA 5AZGA 2KC1A 2MBHA 2DA0A 1WJ1A 4DDGD 5C16A 2KN5A 1X1GA 2JZZA 2L00B 3L17A 4HK2A 1U27A 4HDOA 4GU2A 3SHQA 4NNJB 1Z5SB 2HTHA 2W2WA 2C9WB 4AJYB 2GBNA 1G6JA 3P2BA 2XK5A 3PVUA 5D7GA 2DX5B 5LXHA 2WYQA 4DX8A 1QQGA 2KUPA 3DVGX 2LGYA 3DBLI 1WGDA 3QX1A 2FJ9A 3NS8A 1UNPA 4IW0A 4HCNB 3VH4B 4URKA 4EOYA 1SGHA 3ZKJC 1SIFA 5D2MB 2VSZA 3PSEB 3SBGA 2KCJA 2JXXA 3O96A 4BBNC 2UYZB 2DX5A 2ZVNA 2ZPNA 3BY4B 3CSTA 1ZM0A 2CU1A 2MWSB 4M8MA 3L0WB 3TIXA 2LZ6A 3DXEA 5C6RA 1IRSA 4GIVA 4JKGA 3KH0A 2MWNB 2A5UA 2P0HA 3SO6A 5LLIA 1WGHA 1MAIA 1MK7B 3F0WA 1LW3A 3QBVB 4II2B 3OAWA 4GMXB 3MJWA 1YQBA 2K8HA 1RRBA 3O65B 2NZ8B 4RM8A 1OGWA 5D94A 1EF1A 5G55A 4HJKA 3A1QA 2PE6B 4I6NB 1PFJA 3PGEA 2MW5A 2KFKB 1K8RB 1DBHA 2UZSA 1E7UA 3IFWB 1P5TA 4W9IA 1NBFC 1XQQA 3RCPA 4NQKE 2GMIC 2KMCA 4FA6A 3VTVA 2OOBB 1WMHB 4HB4B 2LUEA 3UGBB 1WIAA 1J0GA 5E6OA 2JF5A 3B1LX 4LJOB 2L0FA 2COFA 3RD2A 2K2JA 4MGZE 1TZ1A 3SU8X 2R0DA 3HHMA 2DYBA 3JVZX 2WWZA 3JW0X 5JZEB 2DYMA 4FJYA 4ZRJA 2KLCA 2Z0EB 1TBEA 4NY0A 1RAXA 4DHJB 2G4DB 2DENB 3PRPB 1H8CA 3E9PA 4MDKE 1K5DB 1DROA 1WI1A 4GDLB 2YVCA 1WJ4A 1ST7A 3D8FA 1WY8A 3ML4A 1UH6A 2COCA 2AL3A 2KQ7A 4ANVA 1KZGA 3R3MA 5IAAC 3D8EA 1RFAA 2ZCCA 2D3GA 3WIMA 5JVLA 3PZDA 3IVFA 1YX6B 2NVUI 1I7AA 2V1YA 1NTYA 4LCDE 2LVPA 2D9XA 4NJ7A 1OTRB 3C0RB 2UVMA 1U2BA 2OJRA 4ANUA 2W2XC 2OQBA 1WX8A 4C0AA 4HAXB 4Z2NA 1WGUA 1OEYA 4BBKA 3CF6E 1UNRA 2DYQA 2FAZA 4HCPB 5D3VA 2I1KA 2NBUA 1HE8A 1FB8A 1R4NI 4F7ZA 2IFSA 1P98A 2MX2A 3NHEB 4GXBA 4HPMB 1DDVA 2ZJDA 3ZIMA 1TTNA 1GGOA 2YLMA 2LYDA 3ENEA 4DX90 4JKFA 4DBGA 5DCNA 4B6WA 2PJHA 1ZKHA 2H7EA 3UQAA 1EGXA 4WJNA 5C79A 1GG3A 2GBMA 4CHKA 1HB8A 4KSKC 2KK8A 1UBIA 2VRWB 1PQSA 3CIKA 1Q0WB 1XX0A 3PG7A 5DIFB 4MY6A 1GC7A 2QHOA 1WXMA 2GBRA 2ZCBA 4DDID 5KHOA 1H10A 2I5FA 4HLEA 2L76A 4X57B 2C5LC 4ICUA 3WYFB 2UZRA 2I1JA 3P6AA 3FSSA 3VAWA 5D3WA 2FUHB 3CSFA 4EKUA 2M14A 2FCNA 4L6EA 5KHQA 4RM9A 2MCNB 1W1DA 1E5WA 1WXVA 2J0KA 3DVNU 5JP4A 4WWPA 2GJYA 3X0WA 2D10A 1F9JA 2EC1A 3NZSA 2R09A 3D32A 4G50A 1M94A 4A5KA 2IO0B 4F7GA 2DYNA 4TUUA 2FIFA 2V4LA 4TYZA 3U30A 2KTRB 1U5FA 5J3TA 4YONA 2CY5A 3AXCA 3APCA 4FHJA 5EFXA 1V5PA 2KXJA 2WH5A 1SHCA 3MTNB 4CHJA 4GMVA 4PQ0A 2NPTA 2J0JA 2P0FA 2ZNVB 1RRPB 1XD4A 5KQ4A 4GB9A 4HAWB 5HE3A 3DQVA 1Y19B 1WX9A 2DZJA 2HRJA 3AJ4A 3FP5A 4IG7B 2JPHA 2XEWA 4W9HA 4KAXB 4W9DA 4EZKA 5J3YA 4J6IA 3PLUA 3LDZE 2KFJA 4WAAA 3L08A 1FHWA 1YD8U 2DLWA 1WJ6A 1V49A 4EEWA 4ICVA 1KOTA 1Z2MA 1GJZA 5JHAA 2LKOA 4HHVA 3EC8A 3ZRFA 3GYPA 2ROVA 2JUOA 2M1MA 4A6KA 3IG3A 1UEFA 4MGKE 1NI2A 3BINA 1VBHA 5DH9B 2A4ZA 4BOZB 2L7RA 3AU4A 4ZRIA 1WFYA 2KC2A 2KQSA 3W1SC 2N1WA 2IY0B 2XK5B 3PV1A 4W9LA 4HB3B 3ULCA 3U8ZA 5LONB 4KV2A 1V88A 3EHVA 1EVHA 3VDZA 4E74A 2LOXA 2J59M 2KDEB 3GZNI 2J7QB 1C1YB 2N9EB 3G9WA 1WYWB 3PHXB 4HB2B 3H1UA 2D9WA 2MDXA 5D3XA 2CS4A 2CY4A 2KWCA 2N9XA 1BT0A 3TO1A 3ZUNA 2LBBA 1Q67A 3ZO5B 3LJ3A 3APDA 2D9ZA 2KVRA 4IOYX 1L7YA 4WQOB 3DOWA 2FCSA 2FNJB 3PHWB 4IM0A 3TW1A 3KYDD 4BKSD 2NCNA 3SD5A 1LQBA 3GOEA 2EJ8A 4H8SA 1OQNA 3HK0A 3HW2B 4MGYE 1V86A 2KX3A 2X18A 4JKGB 4HAVB 4IFSA 1S1QB 2DAFA 1WM2A 4DHZB 4NQLB 3VOQA 4EMOA 2EKEC 3OLMD 3NSUA 2LULA 1B55A 4HAUB 4WVFB 2Z0DB 2K8BA 4DWFA 2V76A 2MLBA 2N4FA 2Z59B 2GCLA 3A9JA 4JKEA 3ZW3A 4EZJA 4K2PA 3A1QB 2COAA 2KJ6A 3DVNV 2YF0A 4PS8A 1V81A 2BPSA 2KANA 3MPXA 4XC2A 5JHHA 2Y7BA 2GS0A 1P1AA 2JWZA 3VHTC 5J2RA 2J0MA 3X23A 4BVUC 5J3QA 1LB1A 2BF8B 2LVQA 4MEMA 4IM3A 1DIKA 2CHZA 2RD0A 3RYTA 2ZZPB 3W1SA 2NBWB 2RUKB 3M3JA 2W9NA 3AI5A 2L05A 4JKAA 3UF8A 1MG8A 2YRYA 3TBLD 2L8JA 1X1MA 4MGIE 3ZNZB 1SE9A 2N9PC 3ZLZA 2DIKA 2RGFA 3VFKA 1GC6A 2KDFB 2ELBA 1VD2A 2DHKA 2G35A 1NTIA 2WX1A 4BFRA 3SDLC 1RLFA 1QZEA 1E7VA 2KJHB 1WX7A 1UPQA 1X86A 2ELAA 1UPRA 1XD3B 2QKLA 3VUYA 3DBRI 3OJ4B 4JKBA 2NMBA 1U5DA 4F1SA 2Y8FA 4I6LB 3ZTDA 2REXA 2KGXB 3DVGY 1WR1A 4ZYNA 5FI0A 5L83A 1L2NA 2O2VA 2C60A 1WF9A 5C5BB 2NBVB 4ZRKA 2K00A 2DZKA 1W1HA 4M0WB 2I5CA 1LXDA 1FGZA 4AP4C 4W9EA 4TQ1A 1J19A 2AL6A 2CODA 2MP2A 1XCGA 1TGZB 3TL5A 2CHXA 1Z87A 3N32A 5DPTA 4IUMB 2KDBA 1WXSA 2KO3A 2YT1A 4FBJB 4PS3A 1D3ZA 3QQ8B 3PRZA 5D27A 1UZXB 2IYDB 2M17A 1TJ6A 3TCAA 4IWQA 2RQ1A 2DTCA 3JSVA 1V80A 2LWPA 2KZRA 1WZ0A 5C5BA 2KKCA 3FLVA 2IO1B 3IHPC 2MFQA 1MIXA 5HE0A 2ASQA 2JRHA 2H7DA 3SNHA 4HXDA 2EMTA 5LXIB 1V5TA 4LJPB 1A5RA 4WWOA 5CHFA 4GPTB 3HIZA 1KZ7A 1UGMA 4KZ0A 4E71A 1VBGA 1E8ZA 3TMPB 2L2IA 1RJ2A 4HWIB 1KJTA 2R2OA 4K7SA 1HB6A 1V2YA 3OANA 2UWQA 2Z0QA 4ILHA 2DN6A 2XQNM 3QWMA 2O6VA 3TFMA 2JRIB 1MIZB 2OTXA 3KRWA 2G4SA 1WVHA 1EAZA 2GBJA 4NPNA 4AJWA 1FGYA 2KD0A 1W1GA 3S2AA 3MDBC 2RLOA 4KZCA 3PVLA 5CLQB 2LRWA 2JP2A 3QCAA 2XBBC 4B9KA 3B0AA 3L13A 1ZGUB 4DBBA 2LOZA 1ZC3B 4CO7A 3WALA 2BYEA 2ROZB 5DPRA 1WJMA 4JL9A 5DPWA 3DXCA 1U4AA 1FOEA 3H7SA 2IO2B 3ZTCA 2X0SA 2ABDA 1YJ1A 2MRPA 3Q3FA 2DAJA 2GCJA 3PSCA 3PTFC 2MQJA 4DHJD 2KDIA 1WRDB 2YT0A 1UD7A 4HATB 5E6NA 4K7WA 5KCVA 4W9KA 2N23A 4KVGB 3HM3A 4ASWC 2MA9B 3OJ3A 1KLVA 2LXAA 1OQYA 2NPTB 1KM7A 1IP9A 2BYFA 1GNUA 3APFA 3EFUA 1EO6A 1KC7A 1KI1B 2D9YA 3ZNID 2Z0OA 3ZRCA 2K6QA 5L95C 4HAYB 2D9VA 5CHVC 5CX3A 1WGYA 2RGNB 3FEHA 4B6HA 4KHBB 1MKEA 2BKFA 1OEYJ 2BGFA 3P7ZA 5L81A 2MSED 2K6DB 1C3TA 2M0XA 4DXAB 1ZW7A 4A20A 4ANWA 2CQUA 3WAMA 3DBSA 4FHKA 2E2XA 4I6PA 2C7NB 2KTFA 5CTRC 3ENBA 3ZDMC 4MJSB 5C23A 5DHAB 4HDQA 2LGDA 3K9OB 3JYUA 3RCZA 3F5RA 3M1IB 2KHWB 2KLGA 2FIDA 5HE1A 1WR6E 3ODXA 1BTNA 3DXDA 4XX5A 1I35A 2Z0PA 1WG7A 4HAZB 3ZNHB 5HE2A 2KX0A 1NDDA 2N0YA 3VTUA 4JK7A 3ULBA 4MJSA 3GYOA 4WJ7A 4WJOA 4KSLC 3UINB 2KOXA 3V6EB 2M4NA 1DDWA 2R82A 1U29A 1LM8B 4KIKB 2KWVB 2DKQA 4M8NA 4WJPA 4GOCA 3QWZB 2K25A 3SYXA 5G2NA 1MPHA 4K2OA 3KY9A 1UBQA 3RULA 3A33B 4WWNA 4XWXA 3K9PB 1UNQA 5CLLB 3LJUX 1XODA 5FR6A 1H4RA 4LDTB 5BO4B 2MBBB 1V5MA 4MELA 4MSQB 3A9KA 5KQ1A 2LD9A 4KDIC 3AULA 4PYUA 2K8CA 1XKEA 3QC8B 4W9GA 3UIOB 2K1FA 3U7DA 3H6NA 1AARA 4PYZA 5E6PA 1E8WA 3IBEA 5CHWA 1NTVA 4NSWA 1Q5WB 3KZ1A 1N3HA 2DKPA 2KJRA 1V5UA 4KIKA 2WX0A 2PPHA 3WA0A 2YS1A 4KHAA 3R7QA 2HD5B 3QIJA 3TVVA 3VXWA 3A9JB 5DI9B 1NVLA 2CR5A 2R2QA 2JY6A 3PREA 2JVCA 3D8DA 1WJUA 3RZFA 3VVWB 4MT7A 1MK9B 2CB8A 2LXCA 3WAPA 1S3SG 3M63B 5DHFB 3PPAA 1V89A 3ZVVA 2P0DA 2HJ8A 1FHXA 4BOSC 3R66C 1Q1OA 1OY2A 2NR2A 3V6CB 5IJMA 5LOPB 2LRUA 3HQCA 2D07B 2L3ZA 5TR5A 5JLJB 1WGRA 2CRFA 1YIWA 2D2QA 2VKIA 1AQCA 2NS5A 2EMSA 2C7HA 5GOWB 4F7UP 2LI5A 1XR0B 4JKHA 2QKMA 3N7CA 2KWUB 2VRRB 2FCQA 1V9JA 1ZSQA 4YL8A 5IA7A 3ML9A 3KUCB 3FM8C 3QAQA 2IBIB 3V61A 2ADZA 4AOFA 2G3QB 3L10B 4E3CA 1WE7A 3SUZA 2PZ1A 3DDCB 3NZUA 4JLCA 1V5OA 2DZIA 3KVFB 4RMAA 3ZNGC 3QA8A 5HKHA 3A8QA 2N7DA 1P3RA 3R7RA 4KHOA 3QJZA 4F8CB 1X1FA 3AU5A 2ZEQA 3T06A 4K17A 4NAWB 2LJ5A 3PRMB 2HE7A 4A3PA 3M95A 2O2VB 3ML8A 1PMSA 1Y5OA 2KNBA 4TQ0A 1ZVRA 2M8SA 2FDQA 3H7PB 1E8XA 3B08A 4LDTD 2IY1B 2L0TA 2MBOA 1OMWA 3QK0A 2K39A 3T9LA 2MP2B 2IO3B 5J18A 1U5GA 3KYCD 5D6JB 2YS5A 4NAWA 3BJIA 3V5WA 4MSMB 4IWOA 3E9LA 3JSVB 3M62B 2P8VA 4CYEA 4K81A 1WM3A 2FJLA 5AEKB 3H7PA 2N1VA 2RVBB 1DDMA 4EFOA 3QHTA 2FCMA 1EUVB 3PS6A 2KFKA 3EECA 1IYFA 4JGHB 1XT9B 1P6SA 2DZMA 2GBKA 4A3OA 2KMAA 4MH0E 1P3QU 4ANXA 2BWES 5EDSA 1WMHA 4AWJA 4HB0B 4F7HA 2M38A 3I3TB 3RT3B 2O6VB 1Y8RC 3KUDB 2ZVOA 1X05A 2ZPYA 4HPLB 2G45B 2JZ3B 3WAOA 2IZVB 2LGXA 4TKNA 2RNRB 1KBLA 3CXBB 2Y8GA 5D3YA 4IAPA 3UZTA 4JK9A 1I42A 1ZC4B 2BYVE 5DPSA 1U5EA 3A98B 3QARA 3V60A 3E9OA 1IPGA 3H9DA 4GDLA 2CKHB 1P9DU 3W1YA 4ZDVA 2LG1A 1WGQA 3NOBA 2GOWA 3SV1A 2DHJA 1VCBA 4ILJA 2LVOA 3VUWA 3VIAA 4EJNA 4GSWA 1V61A 3KUZA 3ODWA 1J8CA 1WH3A 1FAOA 3N30A 3ZVRA 4CHMA 3VH3B 2MBQA 1E90A 3TJPA 5J17A 5JHBA 1DYNA 4GDKB 3ECIA 4GN1A 3A4RA 4IWPA 1HBKA 4DHZE 4G3XB 1M7EA 2B3AA 4II3B 2DHZA 2C7MB 4FN2A 4NJ6A 2AYOB 3T8MA 5GMVA 4W9FA 3V62A 1K5GB 4JK8A 3ODOA 2AEHA 1T0YA 3L16A 1ISNA 2V3SA 1NU2A 5JHGA 3ALBA 1CMXB 3DPDA 3E66A 2L1CA 4GDKA 4FADA 1GUAB 1EF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMM B;  1WXA A;  2ZNV C;  2N7E A;  4JIO U;  1ACA A;  3VUX A;  1I2H A;  3PT2 B;  2CHW A;  4K1R B;  4EUT A;  2DX1 A;  2MBE A;  4A6F B;  2O6V D;  2LAS A;  4DK5 A;  4W9C A;  1JRU A;  3KRX A;  2RR9 A;  2PEA A;  3UIP B;  2JT4 B;  2IYB A;  1WGG A;  3PP2 A;  3Q3J A;  2COP A;  4OVU A;  2BKR B;  3MHS D;  2DYO A;  3N3K B;  4WJQ A;  3HM6 X;  5AZF A;  4Z2M B;  4IC7 B;  3DCG A;  5FI1 A;  1BAK A;  4GZU A;  4Y94 A;  4G0N B;  4N9F 4;  2D11 A;  2RSU A;  4FUL A;  3L54 A;  4W9J A;  1AWE A;  2CAY A;  4FJV B;  2RSG A;  1UEL A;  4A6F A;  3RZW C;  4IM2 A;  2K2U A;  1X11 A;  4PS7 A;  3UQB A;  4KDL B;  1M7R A;  4WSF A;  1WE6 A;  5C1Z A;  1TXD A;  3EPY A;  1BWN A;  2DFK A;  3ZDT A;  4XZ4 A;  4B95 A;  4BKT A;  2BCJ A;  3RUI B;  2AWT A;  5AZH A;  1WZ3 A;  4FJZ A;  2DHI A;  1P0R A;  1LFD A;  4P7I A;  2KTR A;  4BKG A;  3VTW A;  4G11 A;  1QC6 A;  2BWF A;  4BKS A;  5JH5 C;  4BBN F;  3DBH I;  4TV3 A;  1FHO A;  3NY5 A;  1YX5 B;  3A9K B;  3VQI A;  3ONS A;  3KSY A;  4FLH A;  1FXT B;  1V6E A;  2Q13 A;  1WI0 A;  1E8Y A;  1TQZ A;  3PEG A;  1WJN A;  3A8P A;  4D0N B;  4JQW C;  1R4M I;  3PLV A;  1BTK A;  2RPQ A;  3PVW A;  4HVB A;  4OVV A;  2W2X D;  1PLS A;  1J0W A;  2HTH B;  3WAN A;  2D4Q A;  3A4S C;  4GGQ A;  3KW5 B;  4AUQ C;  2MKR A;  2Y5B B;  2WDT B;  4A6H A;  4PNK A;  2PE9 A;  2YS3 A;  4K7U A;  4MM3 A;  4MK0 A;  4EZL A;  2YSZ A;  5AZG A;  2KC1 A;  2MBH A;  2DA0 A;  1WJ1 A;  4DDG D;  5C16 A;  2KN5 A;  1X1G A;  2JZZ A;  2L00 B;  3L17 A;  4HK2 A;  1U27 A;  4HDO A;  4GU2 A;  3SHQ A;  4NNJ B;  1Z5S B;  2HTH A;  2W2W A;  2C9W B;  4AJY B;  2GBN A;  1G6J A;  3P2B A;  2XK5 A;  3PVU A;  5D7G A;  2DX5 B;  5LXH A;  2WYQ A;  4DX8 A;  1QQG A;  2KUP A;  3DVG X;  2LGY A;  3DBL I;  1WGD A;  3QX1 A;  2FJ9 A;  3NS8 A;  1UNP A;  4IW0 A;  4HCN B;  3VH4 B;  4URK A;  4EOY A;  1SGH A;  3ZKJ C;  1SIF A;  5D2M B;  2VSZ A;  3PSE B;  2KCJ A;  2JXX A;  3O96 A;  4BBN C;  2UYZ B;  2DX5 A;  2ZVN A;  2ZPN A;  3BY4 B;  3CST A;  1ZM0 A;  2CU1 A;  2MWS B;  4M8M A;  3L0W B;  3TIX A;  2LZ6 A;  3DXE A;  5C6R A;  1IRS A;  4GIV A;  3KH0 A;  2MWN B;  2A5U A;  2P0H A;  3SO6 A;  5LLI A;  1WGH A;  1MAI A;  1MK7 B;  3F0W A;  1LW3 A;  3QBV B;  4II2 B;  3OAW A;  4GMX B;  3MJW A;  1YQB A;  2K8H A;  1RRB A;  3O65 B;  2NZ8 B;  4RM8 A;  1OGW A;  5D94 A;  1EF1 A;  5G55 A;  4HJK A;  3A1Q A;  2PE6 B;  4I6N B;  1PFJ A;  3PGE A;  2MW5 A;  2KFK B;  1K8R B;  1DBH A;  2UZS A;  1E7U A;  3IFW B;  1P5T A;  4W9I A;  1NBF C;  1XQQ A;  3RCP A;  4NQK E;  2GMI C;  2KMC A;  4FA6 A;  3VTV A;  2OOB B;  1WMH B;  4HB4 B;  2LUE A;  3UGB B;  1WIA A;  1J0G A;  5E6O A;  2JF5 A;  3B1L X;  4LJO B;  2L0F A;  2COF A;  3RD2 A;  2K2J A;  4MGZ E;  1TZ1 A;  3SU8 X;  2R0D A;  3HHM A;  2DYB A;  3JVZ X;  2WWZ A;  3JW0 X;  5JZE B;  2DYM A;  4FJY A;  4ZRJ A;  2KLC A;  2Z0E B;  1TBE A;  4NY0 A;  1RAX A;  4DHJ B;  2G4D B;  2DEN B;  3PRP B;  1H8C A;  4MDK E;  1K5D B;  1DRO A;  1WI1 A;  4GDL B;  2YVC A;  1WJ4 A;  1ST7 A;  3D8F A;  1WY8 A;  3ML4 A;  1UH6 A;  2COC A;  2AL3 A;  2KQ7 A;  4ANV A;  1KZG A;  3R3M A;  5IAA C;  3D8E A;  1RFA A;  2ZCC A;  2D3G A;  3WIM A;  3PZD A;  3IVF A;  1YX6 B;  2NVU I;  1I7A A;  2V1Y A;  1NTY A;  4LCD E;  2LVP A;  2D9X A;  4NJ7 A;  1OTR B;  3C0R B;  2UVM A;  1U2B A;  2OJR A;  4ANU A;  2W2X C;  2OQB A;  1WX8 A;  4C0A A;  4HAX B;  4Z2N A;  1WGU A;  1OEY A;  4BBK A;  3CF6 E;  1UNR A;  2DYQ A;  2FAZ A;  4HCP B;  5D3V A;  2I1K A;  2NBU A;  1HE8 A;  1FB8 A;  1R4N I;  4F7Z A;  2IFS A;  1P98 A;  2MX2 A;  3NHE B;  4GXB A;  4HPM B;  1DDV A;  2ZJD A;  3ZIM A;  1TTN A;  2YLM A;  2LYD A;  3ENE A;  4DX9 0;  4DBG A;  5DCN A;  4B6W A;  2PJH A;  1ZKH A;  2H7E A;  3UQA A;  1EGX A;  4WJN A;  5C79 A;  1GG3 A;  2GBM A;  4CHK A;  1HB8 A;  4KSK C;  2KK8 A;  1UBI A;  2VRW B;  1PQS A;  3CIK A;  1Q0W B;  1XX0 A;  3PG7 A;  5DIF B;  4MY6 A;  1GC7 A;  2QHO A;  1WXM A;  2GBR A;  2ZCB A;  4DDI D;  5KHO A;  1H10 A;  2I5F A;  4HLE A;  2L76 A;  4X57 B;  2C5L C;  4ICU A;  3WYF B;  2UZR A;  2I1J A;  3P6A A;  3FSS A;  3VAW A;  5D3W A;  2FUH B;  3CSF A;  4EKU A;  2M14 A;  2FCN A;  4L6E A;  5KHQ A;  4RM9 A;  2MCN B;  1W1D A;  1E5W A;  1WXV A;  2J0K A;  3DVN U;  5JP4 A;  4WWP A;  2GJY A;  3X0W A;  2D10 A;  1F9J A;  2EC1 A;  3NZS A;  2R09 A;  3D32 A;  4G50 A;  1M94 A;  4A5K A;  2IO0 B;  4F7G A;  2DYN A;  4TUU A;  2FIF A;  2V4L A;  4TYZ A;  3U30 A;  2KTR B;  1U5F A;  5J3T A;  4YON A;  2CY5 A;  3AXC A;  3APC A;  4FHJ A;  5EFX A;  1V5P A;  2KXJ A;  2WH5 A;  1SHC A;  3MTN B;  4CHJ A;  4GMV A;  4PQ0 A;  2NPT A;  2J0J A;  2P0F A;  2ZNV B;  1RRP B;  1XD4 A;  5KQ4 A;  4GB9 A;  4HAW B;  5HE3 A;  3DQV A;  1Y19 B;  1WX9 A;  2DZJ A;  2HRJ A;  3AJ4 A;  3FP5 A;  4IG7 B;  2JPH A;  2XEW A;  4W9H A;  4KAX B;  4W9D A;  4EZK A;  5J3Y A;  4J6I A;  3PLU A;  3LDZ E;  2KFJ A;  4WAA A;  3L08 A;  1FHW A;  1YD8 U;  2DLW A;  1WJ6 A;  1V49 A;  4EEW A;  4ICV A;  1KOT A;  1Z2M A;  1GJZ A;  5JHA A;  2LKO A;  4HHV A;  3EC8 A;  3ZRF A;  3GYP A;  2ROV A;  2JUO A;  2M1M A;  4A6K A;  3IG3 A;  1UEF A;  4MGK E;  1NI2 A;  3BIN A;  5DH9 B;  2A4Z A;  4BOZ B;  2L7R A;  3AU4 A;  4ZRI A;  1WFY A;  2KC2 A;  2KQS A;  3W1S C;  2N1W A;  2IY0 B;  2XK5 B;  3PV1 A;  4W9L A;  4HB3 B;  3ULC A;  3U8Z A;  5LON B;  4KV2 A;  1V88 A;  3EHV A;  1EVH A;  3VDZ A;  4E74 A;  2LOX A;  2J59 M;  2KDE B;  3GZN I;  2J7Q B;  1C1Y B;  2N9E B;  3G9W A;  1WYW B;  3PHX B;  4HB2 B;  3H1U A;  2D9W A;  2MDX A;  5D3X A;  2CS4 A;  2CY4 A;  2KWC A;  2N9X A;  1BT0 A;  3TO1 A;  3ZUN A;  2LBB A;  1Q67 A;  3ZO5 B;  3LJ3 A;  3APD A;  2D9Z A;  2KVR A;  4IOY X;  1L7Y A;  4WQO B;  3DOW A;  2FCS A;  2FNJ B;  3PHW B;  4IM0 A;  3TW1 A;  3KYD D;  4BKS D;  2NCN A;  3SD5 A;  1LQB A;  3GOE A;  2EJ8 A;  4H8S A;  1OQN A;  3HK0 A;  3HW2 B;  4MGY E;  1V86 A;  2KX3 A;  2X18 A;  4HAV B;  4IFS A;  1S1Q B;  2DAF A;  1WM2 A;  4DHZ B;  4NQL B;  3VOQ A;  4EMO A;  2EKE C;  3OLM D;  3NSU A;  2LUL A;  1B55 A;  4HAU B;  4WVF B;  2Z0D B;  2K8B A;  4DWF A;  2V76 A;  2MLB A;  2N4F A;  2Z59 B;  2GCL A;  3A9J A;  3ZW3 A;  4EZJ A;  4K2P A;  3A1Q B;  2COA A;  2KJ6 A;  3DVN V;  2YF0 A;  4PS8 A;  1V81 A;  2BPS A;  2KAN A;  3MPX A;  4XC2 A;  5JHH A;  2Y7B A;  2GS0 A;  1P1A A;  2JWZ A;  3VHT C;  5J2R A;  2J0M A;  3X23 A;  4BVU C;  5J3Q A;  1LB1 A;  2BF8 B;  2LVQ A;  4MEM A;  4IM3 A;  2CHZ A;  2RD0 A;  3RYT A;  2ZZP B;  3W1S A;  2NBW B;  2RUK B;  3M3J A;  2W9N A;  3AI5 A;  2L05 A;  3UF8 A;  1MG8 A;  2YRY A;  3TBL D;  2L8J A;  1X1M A;  4MGI E;  3ZNZ B;  1SE9 A;  2N9P C;  3ZLZ A;  2RGF A;  3VFK A;  1GC6 A;  2KDF B;  2ELB A;  1VD2 A;  2DHK A;  2G35 A;  1NTI A;  2WX1 A;  4BFR A;  3SDL C;  1RLF A;  1QZE A;  1E7V A;  2KJH B;  1WX7 A;  1UPQ A;  1X86 A;  2ELA A;  1UPR A;  1XD3 B;  2QKL A;  3VUY A;  3DBR I;  3OJ4 B;  2NMB A;  1U5D A;  4F1S A;  2Y8F A;  4I6L B;  3ZTD A;  2REX A;  2KGX B;  3DVG Y;  1WR1 A;  4ZYN A;  5FI0 A;  5L83 A;  1L2N A;  2O2V A;  2C60 A;  1WF9 A;  5C5B B;  2NBV B;  4ZRK A;  2K00 A;  2DZK A;  1W1H A;  4M0W B;  2I5C A;  1LXD A;  1FGZ A;  4AP4 C;  4W9E A;  4TQ1 A;  1J19 A;  2AL6 A;  2COD A;  2MP2 A;  1XCG A;  1TGZ B;  3TL5 A;  2CHX A;  1Z87 A;  3N32 A;  5DPT A;  4IUM B;  2KDB A;  1WXS A;  2KO3 A;  2YT1 A;  4FBJ B;  4PS3 A;  1D3Z A;  3QQ8 B;  3PRZ A;  5D27 A;  1UZX B;  2IYD B;  2M17 A;  1TJ6 A;  3TCA A;  4IWQ A;  2RQ1 A;  2DTC A;  3JSV A;  1V80 A;  2LWP A;  2KZR A;  1WZ0 A;  5C5B A;  2KKC A;  3FLV A;  2IO1 B;  3IHP C;  2MFQ A;  1MIX A;  5HE0 A;  2ASQ A;  2JRH A;  2H7D A;  3SNH A;  4HXD A;  2EMT A;  5LXI B;  1V5T A;  4LJP B;  1A5R A;  4WWO A;  5CHF A;  4GPT B;  3HIZ A;  1KZ7 A;  1UGM A;  4KZ0 A;  4E71 A;  1E8Z A;  3TMP B;  2L2I A;  1RJ2 A;  4HWI B;  1KJT A;  2R2O A;  4K7S A;  1HB6 A;  1V2Y A;  3OAN A;  2UWQ A;  2Z0Q A;  2DN6 A;  2XQN M;  3QWM A;  2O6V A;  3TFM A;  2JRI B;  1MIZ B;  2OTX A;  3KRW A;  2G4S A;  1WVH A;  1EAZ A;  2GBJ A;  4NPN A;  4AJW A;  1FGY A;  2KD0 A;  1W1G A;  3S2A A;  3MDB C;  2RLO A;  4KZC A;  3PVL A;  5CLQ B;  2LRW A;  2JP2 A;  3QCA A;  2XBB C;  4B9K A;  3B0A A;  3L13 A;  1ZGU B;  4DBB A;  2LOZ A;  1ZC3 B;  4CO7 A;  3WAL A;  2BYE A;  2ROZ B;  5DPR A;  1WJM A;  4JL9 A;  5DPW A;  3DXC A;  1U4A A;  1FOE A;  3H7S A;  2IO2 B;  3ZTC A;  2ABD A;  1YJ1 A;  2MRP A;  3Q3F A;  2DAJ A;  2GCJ A;  3PSC A;  3PTF C;  2MQJ A;  4DHJ D;  2KDI A;  1WRD B;  2YT0 A;  1UD7 A;  4HAT B;  5E6N A;  4K7W A;  5KCV A;  4W9K A;  2N23 A;  4KVG B;  3HM3 A;  4ASW C;  2MA9 B;  3OJ3 A;  1KLV A;  2LXA A;  1OQY A;  2NPT B;  1KM7 A;  1IP9 A;  2BYF A;  1GNU A;  3APF A;  3EFU A;  1EO6 A;  1KI1 B;  2D9Y A;  3ZNI D;  2Z0O A;  3ZRC A;  2K6Q A;  5L95 C;  4HAY B;  2D9V A;  5CHV C;  5CX3 A;  1WGY A;  2RGN B;  3FEH A;  4B6H A;  4KHB B;  1MKE A;  2BKF A;  1OEY J;  2BGF A;  3P7Z A;  5L81 A;  2MSE D;  2K6D B;  1C3T A;  2M0X A;  4DXA B;  1ZW7 A;  4A20 A;  4ANW A;  2CQU A;  3WAM A;  3DBS A;  4FHK A;  2E2X A;  4I6P A;  2C7N B;  2KTF A;  5CTR C;  3ZDM C;  4MJS B;  5C23 A;  5DHA B;  4HDQ A;  2LGD A;  3K9O B;  3JYU A;  3RCZ A;  3F5R A;  3M1I B;  2KHW B;  2KLG A;  2FID A;  5HE1 A;  1WR6 E;  3ODX A;  1BTN A;  3DXD A;  4XX5 A;  1I35 A;  2Z0P A;  1WG7 A;  4HAZ B;  3ZNH B;  5HE2 A;  2KX0 A;  1NDD A;  2N0Y A;  3VTU A;  3ULB A;  4MJS A;  3GYO A;  4WJ7 A;  4WJO A;  4KSL C;  3UIN B;  2KOX A;  3V6E B;  2M4N A;  1DDW A;  1U29 A;  1LM8 B;  4KIK B;  2KWV B;  2DKQ A;  4M8N A;  4WJP A;  4GOC A;  3QWZ B;  2K25 A;  3SYX A;  5G2N A;  1MPH A;  4K2O A;  3KY9 A;  1UBQ A;  3RUL A;  3A33 B;  4WWN A;  4XWX A;  3K9P B;  1UNQ A;  5CLL B;  3LJU X;  1XOD A;  5FR6 A;  1H4R A;  4LDT B;  5BO4 B;  2MBB B;  1V5M A;  4MEL A;  4MSQ B;  3A9K A;  5KQ1 A;  2LD9 A;  4KDI C;  3AUL A;  4PYU A;  2K8C A;  1XKE A;  3QC8 B;  4W9G A;  3UIO B;  2K1F A;  3U7D A;  3H6N A;  1AAR A;  4PYZ A;  5E6P A;  1E8W A;  3IBE A;  5CHW A;  1NTV A;  4NSW A;  1Q5W B;  3KZ1 A;  1N3H A;  2DKP A;  2KJR A;  1V5U A;  4KIK A;  2WX0 A;  2PPH A;  3WA0 A;  2YS1 A;  4KHA A;  3R7Q A;  2HD5 B;  3QIJ A;  3TVV A;  3VXW A;  3A9J B;  5DI9 B;  1NVL A;  2CR5 A;  2R2Q A;  2JY6 A;  3PRE A;  2JVC A;  3D8D A;  1WJU A;  3RZF A;  3VVW B;  4MT7 A;  1MK9 B;  2CB8 A;  2LXC A;  3WAP A;  1S3S G;  3M63 B;  5DHF B;  3PPA A;  1V89 A;  3ZVV A;  2P0D A;  2HJ8 A;  1FHX A;  4BOS C;  3R66 C;  1Q1O A;  1OY2 A;  2NR2 A;  3V6C B;  5IJM A;  5LOP B;  2LRU A;  3HQC A;  2D07 B;  2L3Z A;  5TR5 A;  5JLJ B;  1WGR A;  2CRF A;  1YIW A;  2D2Q A;  2VKI A;  1AQC A;  2NS5 A;  2EMS A;  2C7H A;  5GOW B;  4F7U P;  2LI5 A;  1XR0 B;  2QKM A;  3N7C A;  2KWU B;  2VRR B;  2FCQ A;  1V9J A;  1ZSQ A;  4YL8 A;  5IA7 A;  3ML9 A;  3KUC B;  3FM8 C;  3QAQ A;  2IBI B;  3V61 A;  2ADZ A;  4AOF A;  2G3Q B;  3L10 B;  4E3C A;  1WE7 A;  3SUZ A;  2PZ1 A;  3DDC B;  3NZU A;  4JLC A;  1V5O A;  2DZI A;  3KVF B;  4RMA A;  3ZNG C;  3QA8 A;  5HKH A;  3A8Q A;  2N7D A;  1P3R A;  3R7R A;  4KHO A;  3QJZ A;  4F8C B;  1X1F A;  3AU5 A;  2ZEQ A;  3T06 A;  4K17 A;  4NAW B;  2LJ5 A;  3PRM B;  2HE7 A;  4A3P A;  3M95 A;  2O2V B;  3ML8 A;  1PMS A;  1Y5O A;  2KNB A;  4TQ0 A;  1ZVR A;  2M8S A;  2FDQ A;  3H7P B;  1E8X A;  3B08 A;  4LDT D;  2IY1 B;  2L0T A;  2MBO A;  1OMW A;  3QK0 A;  2K39 A;  3T9L A;  2MP2 B;  2IO3 B;  5J18 A;  1U5G A;  3KYC D;  5D6J B;  2YS5 A;  4NAW A;  3BJI A;  3V5W A;  4MSM B;  4IWO A;  3JSV B;  3M62 B;  2P8V A;  4CYE A;  4K81 A;  1WM3 A;  2FJL A;  5AEK B;  3H7P A;  2N1V A;  2RVB B;  1DDM A;  4EFO A;  3QHT A;  2FCM A;  1EUV B;  3PS6 A;  2KFK A;  3EEC A;  1IYF A;  4JGH B;  1XT9 B;  1P6S A;  2DZM A;  2GBK A;  4A3O A;  2KMA A;  4MH0 E;  1P3Q U;  4ANX A;  2BWE S;  5EDS A;  1WMH A;  4AWJ A;  4HB0 B;  4F7H A;  2M38 A;  3I3T B;  3RT3 B;  2O6V B;  1Y8R C;  3KUD B;  2ZVO A;  1X05 A;  2ZPY A;  4HPL B;  2G45 B;  2JZ3 B;  3WAO A;  2IZV B;  2LGX A;  4TKN A;  2RNR B;  3CXB B;  2Y8G A;  5D3Y A;  4IAP A;  3UZT A;  1I42 A;  1ZC4 B;  2BYV E;  5DPS A;  1U5E A;  3A98 B;  3QAR A;  3V60 A;  1IPG A;  3H9D A;  4GDL A;  2CKH B;  1P9D U;  3W1Y A;  4ZDV A;  2LG1 A;  1WGQ A;  3NOB A;  2GOW A;  3SV1 A;  2DHJ A;  1VCB A;  2LVO A;  3VUW A;  3VIA A;  4EJN A;  4GSW A;  1V61 A;  3KUZ A;  3ODW A;  1J8C A;  1WH3 A;  1FAO A;  3N30 A;  3ZVR A;  4CHM A;  3VH3 B;  2MBQ A;  1E90 A;  3TJP A;  5J17 A;  5JHB A;  1DYN A;  4GDK B;  3ECI A;  4GN1 A;  3A4R A;  4IWP A;  1HBK A;  4DHZ E;  4G3X B;  1M7E A;  2B3A A;  4II3 B;  2DHZ A;  2C7M B;  4FN2 A;  4NJ6 A;  2AYO B;  3T8M A;  5GMV A;  4W9F A;  3V62 A;  1K5G B;  3ODO A;  3L16 A;  2AEH A;  1T0Y A;  1ISN A;  2V3S A;  1NU2 A;  5JHG A;  3ALB A;  1CMX B;  3DPD A;  2L1C A;  4GDK A;  4FAD A;  1GUA B;  1EF5 A; 
#chains in the Genus database with same CATH topology
 3CMM B;  1WXA A;  2ZNV C;  2N7E A;  4JIO U;  1QKZ A;  1ACA A;  3VUX A;  1I2H A;  1DOX A;  1HZ6 A;  3PT2 B;  3MP9 A;  2CHW A;  4K1R B;  4EUT A;  2GLS A;  2DX1 A;  1VZ8 A;  1T6B X;  2MBE A;  4A6F B;  2O6V D;  1TY2 A;  2LAS A;  4DK5 A;  1JRU A;  4W9C A;  3KRX A;  4MH8 A;  3DHG C;  1SBB B;  2RR9 A;  4OW0 A;  2PEA A;  3NJT A;  3UIP B;  5HG2 A;  2JT4 B;  1ZUD 2;  2IYB A;  2BYT A;  1WGG A;  3PP2 A;  4O1N A;  3Q3J A;  2COP A;  1AN8 A;  2WGS A;  4OVU A;  3RI7 C;  2BKR B;  3MHS D;  2DYO A;  5FKA C;  1M4V A;  3N3K B;  4JKD A;  4HPP A;  4WJQ A;  1KH0 A;  3HM6 X;  5AZF A;  3WCQ A;  1K51 A;  4Z2M B;  4IC7 B;  1SF0 A;  1JDE A;  3DCG A;  5FI1 A;  1BAK A;  4GZU A;  4Y94 A;  4G0N B;  4N9F 4;  3P4Q B;  1MI1 A;  2D11 A;  2RSU A;  4FUL A;  3L54 A;  4W9J A;  2MJD A;  2X8X X;  1AWE A;  2CAY A;  4FJV B;  3ZYY X;  2RSG A;  1UEL A;  4A6F A;  1KRH A;  3RZW C;  2Q5W D;  4IM2 A;  2K2U A;  3BII D;  1X11 A;  2K22 A;  3N9Y C;  4PS7 A;  3UQB A;  3AE6 B;  4KDL B;  3AMZ A;  2RDG A;  1M7R A;  4WSF A;  1LO5 D;  1WE6 A;  5C1Z A;  1GB4 A;  1TXD A;  3EPY A;  1BWN A;  1F2R I;  2DFK A;  3ZDT A;  4XZ4 A;  1UWX A;  4B95 A;  4BKT A;  3SBT A;  1FFU A;  2BCJ A;  3BK1 A;  3RUI B;  2AWT A;  2LEK A;  4ZHO A;  5AZH A;  4IKG A;  3FC4 A;  1WZ3 A;  3O13 A;  5G5H A;  4FJZ A;  2DHI A;  1P0R A;  1LFD A;  4P7I A;  2KTR A;  4BKG A;  3VTW A;  4G11 A;  1QC6 A;  2BWF A;  4BKS A;  2GRI A;  5JH5 C;  4BBN F;  3DBH I;  3GE3 C;  1SE3 A;  2FBW B;  4TV3 A;  3IAS 1;  1FHO A;  1FCC C;  3NY5 A;  1L4Z B;  1YX5 B;  3A9K B;  3VQI A;  3ONS A;  2G9H D;  2K3U A;  2R61 A;  3KSY A;  4FLH A;  1FXT B;  1V6E A;  2D5G A;  2FE8 A;  2Q13 A;  4LNN A;  1WI0 A;  1E8Y A;  1TQZ A;  3PEG A;  1WJN A;  3A8P A;  4HSI A;  3DCX A;  3E56 A;  4A8X C;  4D0N B;  4JQW C;  1HQR D;  1R4M I;  3PLV A;  1BTK A;  5FR3 A;  2RPQ A;  3PVW A;  5LNK 1;  4HVB A;  4OVV A;  2W2X D;  1N6Z A;  1PLS A;  1J0W A;  2JYE A;  2HTH B;  4NAM A;  3WAN A;  2D4Q A;  3A4S C;  4GGQ A;  3KW5 B;  4AUQ C;  2HJ1 A;  2MKR A;  1MFW A;  5JXV A;  2Y5B B;  4C80 A;  2WDT B;  4JKC A;  4TMA B;  1NEK B;  2UU7 A;  3Q8B A;  4A6H A;  4PNK A;  2NTT A;  2PE9 A;  2YS3 A;  3U12 A;  4K7U A;  1DGJ A;  4C7Z A;  4MM3 A;  4MK0 A;  4EZL A;  4ILG B;  2YSZ A;  1JWB D;  5AZG A;  2KC1 A;  3U7Z A;  3URY A;  1WWT A;  2YT2 A;  1FPY A;  2DA0 A;  5IRS A;  2MBH A;  1WJ1 A;  4DDG D;  5C16 A;  1YNT E;  3IAM 1;  2KN5 A;  1X1G A;  2JZZ A;  2L00 B;  3L17 A;  3NWD A;  3A58 A;  2LHE A;  4RF1 A;  4HK2 A;  1U27 A;  4HDO A;  1SJE D;  4K3C A;  1TIF A;  4GU2 A;  2RMM A;  3SHQ A;  2BBC A;  1WXQ A;  3MC0 B;  4NNJ B;  1Z5S B;  2HTH A;  2W2W A;  2C9W B;  1TYG B;  4AJY B;  2GBN A;  3AEC B;  1F52 A;  4N59 A;  1YN4 A;  1G6J A;  3P2B A;  1FNU A;  2XK5 A;  3PVU A;  5D7G A;  2NTS A;  2DX5 B;  1J7A A;  4RGO S;  2YEP B;  5LXH A;  1E7P B;  2WYQ A;  4BAX A;  4DX8 A;  1QQG A;  2KUP A;  3DVG X;  2LJI A;  2LGY A;  3DBL I;  1WGD A;  3U2S C;  3QX1 A;  2FJ9 A;  1D5M C;  3NS8 A;  1UNP A;  3HIE A;  4IW0 A;  1AYF A;  1BML C;  4HCN B;  2MH7 A;  3AEB B;  3VH4 B;  2LGS A;  3AH7 A;  4URK A;  1AWD A;  3DWM A;  4EOY A;  1SGH A;  4JWU C;  3ZKJ C;  2PTL A;  1SXT A;  3R8B A;  2LGI A;  1V8C A;  1SIF A;  5D2M B;  4L2Y A;  1ET9 A;  2VSZ A;  3PSE B;  3SBG A;  2LMC A;  2KCJ A;  2KT7 A;  2JXX A;  3O96 A;  4BBN C;  3IT6 B;  1L0X B;  2UYZ B;  2AX5 A;  5D3D A;  2E6X A;  1L6U A;  2DX5 A;  1ZP0 B;  1WYG A;  2ZVN A;  2ZPN A;  3BY4 B;  3CST A;  1ZM0 A;  3PO0 A;  1QOA A;  2CU1 A;  3DHH C;  1T0Q C;  1NYQ A;  2MWS B;  4M8M A;  5GXG B;  1XEE A;  1ZPS A;  2QDF A;  3L0W B;  1R4M B;  2G1E A;  3TIX A;  1T3Q A;  3GS2 A;  1SJH D;  1SSN A;  3L4P A;  2LZ6 A;  3DXE A;  5C6R A;  1IRS A;  2MEK A;  4GIV A;  3N1X C;  4JKG A;  1T77 A;  3KH0 A;  2MWN B;  2JX5 A;  4OZC A;  1D4B A;  2A5U A;  3DWG C;  2P0H A;  1V1P B;  3Q8C A;  3SO6 A;  5LLI A;  1WGH A;  1MAI A;  1MK7 B;  2WP9 B;  2WS3 B;  3F0W A;  1LW3 A;  3TEZ A;  3QBV B;  1QF6 A;  4II2 B;  3OAW A;  4GMX B;  4PK1 A;  3MJW A;  1YQB A;  2KVZ A;  2K8H A;  1RRB A;  3O65 B;  2NZ8 B;  2Z59 A;  4RM8 A;  2CU3 A;  1OGW A;  5D94 A;  3AE1 B;  1EF1 A;  5G55 A;  3P63 A;  4WAF A;  4B0M A;  4HJK A;  3A1Q A;  2WXO A;  2PE6 B;  3N1Z C;  2ICI A;  4I6N B;  1PFJ A;  1VZ7 A;  3PGE A;  2MW5 A;  2KFK B;  1K8R B;  1DBH A;  2UZS A;  1E7U A;  1L0V B;  1ZXI A;  3IFW B;  1XCQ L;  1AW7 A;  4YWG G;  1KLU D;  1P5T A;  2QCZ A;  4W9I A;  1NBF C;  1V1P A;  1XQQ A;  3RCP A;  4NQK E;  2GMI C;  5HFY A;  2KMC A;  4FA6 A;  4R3D A;  3VTV A;  2OOB B;  3NWF A;  1WMH B;  4HB4 B;  3R2I A;  1C79 A;  2LUE A;  2IPK D;  3UGB B;  1L4D B;  1WIA A;  4XYC A;  1ZXH A;  2N9K A;  1J0G A;  5E6O A;  2JF5 A;  3B1L X;  4LJO B;  1L0Y B;  2NMQ A;  2L0F A;  1DOY A;  2COF A;  3RD2 A;  2K2J A;  1PGA A;  4MGZ E;  1TZ1 A;  3SU8 X;  2QIL A;  2IGD A;  4C56 C;  4JPS A;  2R0D A;  4PT5 A;  3GB1 A;  1ZYI A;  5LG4 B;  3HHM A;  3RNC C;  5C2T B;  4KX6 B;  2DYB A;  2JQR B;  1I7H A;  3JVZ X;  2WWZ A;  3JW0 X;  2Y5C A;  5JZE B;  2DYM A;  4FJY A;  4ZRJ A;  2KLC A;  2MJ3 A;  2Z0E B;  1TBE A;  2K5P A;  4NY0 A;  5I2M A;  1RAX A;  4DHJ B;  2R2Y A;  2G4D B;  3NUH B;  2DEN B;  3PRP B;  1H8C A;  3Q8E A;  3E9P A;  4MDK E;  3ZXV A;  1K5D B;  1CJE A;  1DRO A;  1WI1 A;  2L83 A;  4H2A A;  1VLB A;  4GDL B;  2YVC A;  4RFB A;  1WJ4 A;  1ST7 A;  3D8F A;  1WY8 A;  2CJO A;  1J7B A;  3ML4 A;  3MC8 A;  3EUB 2;  1UH6 A;  2COC A;  1HTQ A;  2AL3 A;  2KQ7 A;  4ANV A;  4OVZ A;  1KZG A;  3R3M A;  4L23 A;  2ZW0 A;  2EEL A;  5IAA C;  2WXL A;  3D8E A;  1DYQ A;  1RFA A;  2ZCC A;  1STE A;  2D3G A;  3SFD B;  1PFD A;  3WIM A;  5JVL A;  3NG0 A;  3PZD A;  3IVF A;  1YX6 B;  2LFI A;  2NVU I;  1I7A A;  2SEB D;  1NTY A;  2V1Y A;  5G5G A;  4LCD E;  2CJN A;  5IO9 A;  5E6J A;  2LVP A;  2D9X A;  3B77 A;  4KGS A;  4NJ7 A;  5BMI A;  1OTR B;  3C0R B;  1EM7 A;  2K49 A;  2UVM A;  1U2B A;  2OJR A;  4ANU A;  3FIL B;  2W2X C;  1TS2 A;  2OQB A;  1T0R C;  3AEG B;  2H88 B;  2B76 B;  1WX8 A;  4C0A A;  4HAX B;  4Z2N A;  2KIE A;  1JCK B;  5HHD G;  1WGU A;  1OEY A;  4BBK A;  3CF6 E;  1UNR A;  2DYQ A;  2TSS A;  2IGH A;  1MG4 A;  4D6W A;  2FAZ A;  4HCP B;  1ET6 A;  4FXC A;  5D3V A;  2I2Y A;  2I1K A;  2NBU A;  1HE8 A;  3HVD A;  1FB8 A;  1R4N I;  4HRS A;  4F7Z A;  2IFS A;  1P98 A;  3NWA A;  2MX2 A;  3NHE B;  4GXB A;  2KIG A;  4HPM B;  1DDV A;  3DBR B;  3RMK C;  2ZJD A;  3ZIM A;  5TSS A;  1TTN A;  1GGO A;  2YLM A;  2LYD A;  3ENE A;  4DX9 0;  1IBX A;  4JKF A;  4DBG A;  5DCN A;  4B6W A;  2PJH A;  3FIL A;  4A55 A;  1ZKH A;  2H7E A;  3ZJU A;  3UQA A;  1EGX A;  4WJN A;  5C79 A;  1GG3 A;  4KKI A;  4OSN A;  4S0R A;  3HSA A;  2GBM A;  1T5X D;  4CHK A;  1FXA A;  1HB8 A;  4KSK C;  2KK8 A;  1UBI A;  2VRW B;  3W5U B;  1K53 A;  3RPF C;  2J53 A;  4YSX B;  1PQS A;  4N6E B;  3CIK A;  3C19 A;  1Q0W B;  1XX0 A;  2ONQ A;  3PG7 A;  4YT0 B;  5DIF B;  4MY6 A;  2D3A A;  1GC7 A;  2QHO A;  1WXM A;  2GBR A;  1T0S C;  2ZCB A;  3ZJV A;  4DDI D;  3P42 A;  4CSQ A;  3AEA B;  2E3T A;  3AE2 B;  5KHO A;  1E0Z A;  1H10 A;  4NZL B;  2I5F A;  2DNF A;  4A90 A;  4HLE A;  2L76 A;  4X57 B;  2C5L C;  1HA5 A;  4ICU A;  1OQR A;  3WYF B;  2UZR A;  2I1J A;  2WNM A;  3P6A A;  3FSS A;  3VAW A;  5D3W A;  2FUH B;  3Q2A C;  2WXI A;  3CSF A;  4EKU A;  2M14 A;  1HTO A;  2FCN A;  5EE1 A;  4L6E A;  5KHQ A;  4RM9 A;  2MCN B;  1W1D A;  1TKY A;  1E5W A;  1FRR A;  1SIJ A;  3ZXR A;  1WXV A;  2J0K A;  3DVN U;  2W3S A;  5JP4 A;  3ZGZ A;  4WWP A;  1FCL A;  3NVZ A;  2GJY A;  3X0W A;  2D10 A;  1F9J A;  4USA A;  2EC1 A;  3NZS A;  2R09 A;  3D32 A;  4G50 A;  1C78 A;  1M94 A;  4A5K A;  1GAQ B;  2IO0 B;  3NRZ A;  3ABV B;  1PYW D;  4F7G A;  1YQ3 B;  2DYN A;  4REZ A;  4TUU A;  4JWS C;  2FIF A;  2PIA A;  2V4L A;  4TYZ A;  3U30 A;  5BMG A;  2KTR B;  1U5F A;  5J3T A;  4YON A;  3Q8A A;  2CY5 A;  3AXC A;  4A6Q A;  3APC A;  4FHJ A;  5EFX A;  2ZW1 A;  1V5P A;  2ON8 A;  1R4N B;  1FNW A;  2KXJ A;  4AQ7 A;  2D3C A;  2WH5 A;  1SHC A;  3MTN B;  4CHJ A;  2WLB A;  3OG5 A;  4WQM A;  4GMV A;  4PQ0 A;  4M00 A;  2NPT A;  2PMV A;  3V3X A;  3B2F A;  2J0J A;  3VR8 B;  5I4D A;  2P0F A;  2ZNV B;  1RRP B;  4YTP B;  1XD4 A;  5KQ4 A;  3FKY A;  4GB9 A;  4HAW B;  5HE3 A;  3DQV A;  1TJE A;  5IKC M;  2WXQ A;  1Y19 B;  1WX9 A;  2DZJ A;  2FUG 1;  3MJ5 A;  3U4E G;  2HRJ A;  4P16 A;  1NI3 A;  3AJ4 A;  3FP5 A;  4IG7 B;  1C4C A;  1MI0 A;  2OED A;  2JPH A;  2XEW A;  4W9H A;  4KAX B;  4W9D A;  3KWV A;  1UNS A;  4EZK A;  5J3Y A;  4MM3 B;  4J6I A;  3W2D A;  4KKJ A;  3PLU A;  1P7E A;  3LDZ E;  2DBY A;  1JQ4 A;  2KFJ A;  1LGR A;  4WAA A;  3L08 A;  3V05 A;  4ARC A;  1FHW A;  1YD8 U;  1VJK A;  4ZHP A;  2DLW A;  2DWQ A;  1XLP A;  1WJ6 A;  1V49 A;  4EEW A;  4ICV A;  1F77 A;  1Z2M A;  1KOT A;  1GJZ A;  5JHA A;  2LKO A;  4HHV A;  3RN9 C;  3EC8 A;  3ZRF A;  3GYP A;  2ROV A;  2JUO A;  2M1M A;  4A6K A;  1K52 A;  1UEF A;  1JWA D;  3IG3 A;  4MGK E;  1NI2 A;  3BIN A;  1VBH A;  5DH9 B;  2A4Z A;  4BOZ B;  2L7R A;  5BMH A;  3AU4 A;  4ZRI A;  1WFY A;  2KC2 A;  2KQS A;  1ZDV A;  3W1S C;  2BB5 A;  2N1W A;  2IY0 B;  4OT1 A;  2XK5 B;  4OZB A;  3PV1 A;  4W9L A;  4US8 A;  4HB3 B;  2L52 A;  3ULC A;  3U8Z A;  5LON B;  1EU4 A;  4KV2 A;  3BK2 A;  1V88 A;  3EHV A;  1EVH A;  3VDZ A;  4E74 A;  2LOX A;  2J59 M;  2KDE B;  3AE4 B;  3GZN I;  2BS4 B;  2RDH A;  2J7Q B;  1C1Y B;  2N9E B;  1FO4 A;  4HRO A;  3G9W A;  1WYW B;  3U52 E;  2Y5P A;  3PHX B;  4HB2 B;  3H1U A;  2D9W A;  2MDX A;  5D3X A;  1L5P A;  2CS4 A;  1CZP A;  2CY4 A;  4LTU A;  2KWC A;  2N9X A;  1BT0 A;  3TO1 A;  3ZUN A;  2LBB A;  1Q67 A;  3ZO5 B;  4XGA B;  3UI3 A;  1JML A;  3LJ3 A;  3APD A;  2QC8 A;  2D9Z A;  4M02 A;  2KVR A;  3EFC A;  4IOY X;  3BZD B;  4LK0 M;  1L7Y A;  4WQO B;  3DOW A;  2FCS A;  2FNJ B;  3SEB A;  3PHW B;  2L1A A;  2JU6 X;  1E10 A;  1MPE A;  4IM0 A;  3BYY B;  3TW1 A;  3T3N A;  2V9H A;  3KYD D;  4BKS D;  2NCN A;  2KDM A;  1TZO A;  2PVO D;  2XNA C;  3SD5 A;  1LQB A;  3GOE A;  2EJ8 A;  4H8S A;  1OQN A;  3HK0 A;  3HW2 B;  4MGY E;  1V86 A;  2KX3 A;  2X18 A;  4JKG B;  2M0A A;  3P4R B;  4HAV B;  4IFS A;  1S1Q B;  2DAF A;  1SE2 A;  1ZOY B;  1WM2 A;  4DHZ B;  2WQY B;  4NQL B;  3VOQ A;  4EMO A;  2EKE C;  3OLM D;  1MVK A;  3NSU A;  3RNB C;  2LUL A;  1B55 A;  4HAU B;  4WVF B;  3BVZ A;  3I63 C;  1VR9 A;  2BW2 A;  5HI1 A;  2WXF A;  2Z0D B;  2W55 A;  2K8B A;  4DWF A;  2V76 A;  2MLB A;  2N4F A;  2Z59 B;  3B2G A;  2GCL A;  3A9J A;  3LYY A;  4JKE A;  1B1Z A;  1PGX A;  3ZW3 A;  4EZJ A;  2W3R A;  1NEN B;  4K2P A;  3A1Q B;  2COA A;  2KJ6 A;  3DVN V;  2YF0 A;  2WXR A;  3AE9 B;  4PS8 A;  1V81 A;  2BQQ A;  1KFY B;  2BT6 A;  2BPS A;  2INP E;  2KAN A;  3MPX A;  1YQ4 B;  5IOI A;  4XC2 A;  5JHH A;  2Y7B A;  2GS0 A;  1P1A A;  2JWZ A;  3VHT C;  5J2R A;  2J0M A;  1SB3 C;  3X23 A;  4BVU C;  5J3Q A;  1LB1 A;  2BF8 B;  2LVQ A;  4MEM A;  4IM3 A;  1DIK A;  1UF0 A;  2CHZ A;  2RD0 A;  2WXP A;  3RYT A;  2ZZP B;  3W1S A;  2NBW B;  4HEA 1;  2RUK B;  2SAK A;  3M3J A;  1N63 A;  2W9N A;  1C4A A;  2L05 A;  3AI5 A;  3GZN B;  4JKA A;  3UF8 A;  1MG8 A;  2YRY A;  3TBL D;  2WXJ A;  2IND C;  2L8J A;  1X1M A;  4MGI E;  1KF6 B;  2KAC A;  3ZNZ B;  1SE9 A;  2N9P C;  3ZLZ A;  2DIK A;  3HUI A;  1JRO A;  1PDX A;  2RGF A;  3VFK A;  1JWM D;  1GC6 A;  2KDF B;  2ELB A;  2IJ0 A;  3SR6 A;  4S17 A;  1VD2 A;  2DHK A;  2G35 A;  1NTI A;  2WX1 A;  4BFR A;  4LNI A;  3SDL C;  1RLF A;  5H92 C;  2V0G A;  1QZE A;  4XDD A;  1E7V A;  4K3B A;  5I2S A;  2KJH B;  1WX7 A;  1UPQ A;  1X86 A;  3IT4 B;  1JWU D;  4KGT A;  2ELA A;  3E9S A;  3FAH A;  1XLN A;  1UPR A;  1XLQ A;  1XD3 B;  1WGK A;  2QKL A;  3VUY A;  1C4P A;  3DBR I;  3OJ4 B;  2KMM A;  4L1B A;  4JKB A;  2NMB A;  1U5D A;  4F1S A;  4DXG A;  2Y8F A;  2WDQ B;  1XO3 A;  4I6L B;  4MT5 A;  2D3B A;  1MHX A;  2REX A;  3AV8 A;  3ZTD A;  2KGX B;  5AUI A;  3AE8 B;  3DVG Y;  1WR1 A;  2J52 A;  1P7F A;  4ZYN A;  5FI0 A;  5L83 A;  1L2N A;  2O2V A;  2C60 A;  1WF9 A;  5C5B B;  2NBV B;  4ZRK A;  4XWW A;  2K00 A;  1ACC A;  2DZK A;  1W1H A;  4M0W B;  2PKO A;  2I5C A;  1LXD A;  1FGZ A;  4AP4 C;  3BVM A;  4W9E A;  4TQ1 A;  1J19 A;  2AL6 A;  2Z14 A;  2COD A;  2MP2 A;  1XCG A;  1TGZ B;  3TL5 A;  2CHX A;  1Z87 A;  3N32 A;  3BWU D;  4IUM B;  5DPT A;  2KDB A;  1WXS A;  2KO3 A;  2YT1 A;  2OJW A;  4PS3 A;  4FBJ B;  2N0S B;  1D3Z A;  3QQ8 B;  3PRZ A;  5D27 A;  1UZX B;  2IYD B;  2M17 A;  4C4V B;  1TJ6 A;  3TCA A;  4IWQ A;  5H8Y E;  3N1Y C;  2RQ1 A;  2DTC A;  3JSV A;  1MJD A;  1IGC A;  1V80 A;  2LWP A;  2KZR A;  2INC C;  1WZ0 A;  2NBV A;  5C5B A;  2KKC A;  3FLV A;  1UGJ A;  2IO1 B;  3IHP C;  2MFQ A;  1MIX A;  2RRF A;  5HE0 A;  2ASQ A;  4LLG M;  2JRH A;  2H7D A;  3SNH A;  4HXD A;  3MHZ A;  4M0W A;  2EMT A;  5LXI B;  1V5T A;  4RCO A;  3TSS A;  4TSS A;  2WXK A;  4LJP B;  1A5R A;  4WWO A;  5CHF A;  4GPT B;  3P4P B;  3HIZ A;  2RDB C;  1KZ7 A;  1UGM A;  4KZ0 A;  4E71 A;  3NVY A;  1IBX B;  1VBG A;  1E8Z A;  3TMP B;  2L2I A;  4WUR A;  1RJ2 A;  4HWI B;  1KJT A;  2R2O A;  1ZDX A;  4K7S A;  1TS4 A;  1HB6 A;  2WXN A;  1V2Y A;  1BXT A;  3OAN A;  3Q14 C;  1TKG A;  4C4V A;  2UWQ A;  4QJ5 B;  4DXF A;  3I57 A;  2Z0Q A;  4ILH A;  2DN6 A;  1EWC A;  2XQN M;  3QWM A;  2O6V A;  4YXD B;  3TFM A;  2JRI B;  5IP4 D;  1MIZ B;  2OTX A;  3KRW A;  2G4S A;  2N9L A;  2MHJ A;  3AE5 B;  1WVH A;  3NW8 A;  1EAZ A;  2GBJ A;  3NVW A;  4NPN A;  4RF0 A;  5BYQ A;  4AJW A;  1FGY A;  1YN3 A;  4QAY A;  2KD0 A;  1W1G A;  1JAL A;  3S2A A;  1RFK A;  3MDB C;  2RLO A;  4KZC A;  3PVL A;  5CLQ B;  2LRW A;  4YTM B;  2EKI A;  2JP2 A;  2BVC A;  2GUM A;  1FNV A;  3QCA A;  2XBB C;  4CQN A;  4B9K A;  3N20 C;  3B0A A;  4WH4 A;  1CQV A;  3L13 A;  1ZGU B;  4DBB A;  2LOZ A;  2LUM A;  5FK9 C;  3DHI C;  1TKE A;  1ZC3 B;  4CO7 A;  3WAL A;  2BYE A;  2MJE A;  1YOV B;  1QQR A;  3NVV A;  2ROZ B;  3RNA C;  5DPR A;  1WJM A;  4JL9 A;  5DPW A;  3DXC A;  1U4A A;  1FOE A;  1QOF A;  2PLP A;  2IO2 B;  3H7S A;  2X0S A;  3ZTC A;  2ACZ B;  3AEF B;  2ABD A;  1K50 A;  1YJ1 A;  3T3O A;  2YEP F;  2MRP A;  3Q3F A;  2DAJ A;  2GCJ A;  1RM6 C;  3PSC A;  3VRA B;  1FRD A;  3RFZ B;  3PTF C;  1KLG D;  1JW9 D;  1QLB B;  2MQJ A;  4DHJ D;  2KQ4 X;  2KDI A;  1E9M A;  1WRD B;  3NZ3 A;  3RNF C;  2YT0 A;  4YSY B;  2WU5 B;  1UD7 A;  4P1C C;  3EA6 A;  1F0Z A;  4HAT B;  5E6N A;  4K7W A;  5KCV A;  2KAJ A;  4W9K A;  2N23 A;  1SEB D;  4KVG B;  3HM3 A;  4ASW C;  5MPO A;  2MA9 B;  3OJ3 A;  1KLV A;  2LXA A;  1OQY A;  2NPT B;  1KM7 A;  1IP9 A;  2BYF A;  1GNU A;  3APF A;  3EFU A;  1EO6 A;  4OHJ A;  1KC7 A;  4YSZ B;  1KI1 B;  2D9Y A;  1I4H A;  3ZNI D;  2Z13 A;  1V1O A;  5EE0 A;  2Z0O A;  3ZRC A;  2DLB A;  1NVI D;  2K6Q A;  5L95 C;  4HAY B;  1TS3 A;  2D9V A;  1C76 A;  1N62 A;  1TY0 A;  5CHV C;  5CX3 A;  2QIE B;  1WGY A;  2RGN B;  3FEH A;  4B6H A;  3PZ8 A;  4KHB B;  1MKE A;  4ZOH C;  2BKF A;  3H8H A;  1OEY J;  2BGF A;  1VRA B;  3P7Z A;  5L81 A;  2MSE D;  2K6D B;  2V3N A;  1C3T A;  4YTN B;  2M56 B;  2M0X A;  1I4R A;  1PUT A;  4DXA B;  1ZW7 A;  4A20 A;  4ANW A;  1QOB A;  2CQU A;  3WAM A;  3ETR A;  2KWD A;  3DBS A;  4FHK A;  2WU2 B;  2IGG A;  2E2X A;  2VH1 A;  2W82 A;  4I6P A;  2WXG A;  2RPV A;  2C7N B;  2KTF A;  1VDV A;  3IXS A;  5CTR C;  2J4X A;  3ENB A;  3ZDM C;  4MJS B;  2QSD A;  3MC9 A;  2V4I B;  2AQ2 B;  2WXM A;  5DHA B;  5C23 A;  4HDQ A;  2M19 A;  1BUI C;  2LGD A;  2JSV X;  2KUQ A;  3K9O B;  2BTE A;  3JYU A;  4KHB A;  3AE3 B;  1ENF A;  1IGD A;  3RCZ A;  3F5R A;  3M1I B;  3KLS X;  5EE9 A;  2KHW B;  2KLG A;  3B9J A;  3MFG A;  3W5V B;  2FID A;  4M01 A;  5HE1 A;  1WR6 E;  2LHD A;  3ODX A;  1BTN A;  1C77 A;  3P4S B;  3DXD A;  1GB1 A;  4XX5 A;  1I35 A;  2Z0P A;  1WG7 A;  4HAZ B;  3BVG A;  3ZNH B;  1WRI A;  5HE2 A;  2KX0 A;  1NDD A;  2N0Y A;  1EU3 A;  4LNK A;  2N7J A;  2BB6 A;  3VTU A;  4JK7 A;  3ULB A;  4MJS A;  3GYO A;  4WJ7 A;  4WJO A;  4KSL C;  3UIN B;  2KOX A;  3V6E B;  1A70 A;  1F2R C;  2M4N A;  1DDW A;  2R82 A;  1U29 A;  2JXT A;  1LM8 B;  1YN5 A;  4KIK B;  2KWV B;  2DKQ A;  4M8N A;  4WJP A;  5T8I A;  4GOC A;  4N58 A;  4XWT A;  3QWZ B;  3C8Y A;  2K25 A;  3SYX A;  4GLS C;  5G2N A;  1MPH A;  4QXA B;  4P1B C;  4K2O A;  3KY9 A;  4US9 A;  1UBQ A;  2AQ1 B;  3RUL A;  1YMH E;  3A33 B;  1GPX A;  4WWN A;  2OHF A;  4XWX A;  2Z4D A;  3K9P B;  1UNQ A;  5CLL B;  3LJU X;  1XOD A;  5FR6 A;  1H4R A;  4LDT B;  5BO4 B;  2MBB B;  1V5M A;  4MEL A;  4MSQ B;  3A9K A;  5KQ1 A;  2LD9 A;  4KDI C;  3AUL A;  4PYU A;  2K8C A;  5BYR A;  1XKE A;  2JWU A;  3QC8 B;  4W9G A;  3UIO B;  2K1F A;  3U7D A;  3H6N A;  1AAR A;  4PYZ A;  5E6P A;  1E8W A;  2WDR B;  3IBE A;  1JRP A;  5CHW A;  4EE2 A;  1EWY C;  1QIL A;  2QEJ C;  3Q8F A;  2WHI A;  1NTV A;  4NSW A;  1Q5W B;  3KZ1 A;  1N3H A;  3P1M A;  2DKP A;  2KJR A;  1V5U A;  1ESF A;  4KIK A;  2WX0 A;  3AE7 B;  2PPH A;  3WA0 A;  2YS1 A;  1FFV A;  4KHA A;  1N61 A;  1R7S A;  3R7Q A;  2HD5 B;  3QIJ A;  3TVV A;  1XF5 L;  3R2T A;  3VXW A;  4D2K A;  3A9J B;  5DI9 B;  3HVZ A;  1NVL A;  3Q69 A;  2CR5 A;  2R2Q A;  2JY6 A;  1HEZ E;  3PRE A;  2JVC A;  3D8D A;  3FVC A;  1WJU A;  4WIP A;  1VZ6 A;  4ZRP A;  5D3I B;  3RZF A;  2HTM E;  4P6V F;  3VVW B;  4MT7 A;  1RWS A;  1MK9 B;  2CB8 A;  2LXC A;  3WAP A;  1S3S G;  3M63 B;  5DHF B;  1QT9 A;  4RGT A;  3PPA A;  1V89 A;  4DIX A;  3ZVV A;  2I38 A;  3EGR A;  2P0D A;  2HJ8 A;  2L32 A;  1FHX A;  1TS5 A;  4ITK A;  4BOS C;  3R66 C;  4ZYS A;  3ZQ4 A;  1XLO A;  1Q1O A;  1OY2 A;  2NR2 A;  2PVG C;  5IJM A;  5LOP B;  2LRU A;  3HQC A;  2D07 B;  2L3Z A;  2PW9 A;  3V6C B;  5TR5 A;  5JLJ B;  2VZK B;  1WGR A;  2Y3A A;  2CRF A;  1YIW A;  4MAC A;  2D2Q A;  4WWM A;  1FMA D;  1I4P A;  1PGB A;  2VKI A;  1AQC A;  2NS5 A;  2EMS A;  1FEH A;  2C7H A;  5C3J B;  5GOW B;  4F7U P;  3DBH B;  2LI5 A;  4JX1 C;  1ZE3 D;  1XR0 B;  4JKH A;  2QKM A;  3N7C A;  2KWU B;  4J3O D;  3AED B;  2VRR B;  3Q6B A;  2FCQ A;  1I4G A;  1V9J A;  1ZSQ A;  4YL8 A;  2KYW A;  2V3P A;  2JZP A;  5IA7 A;  3ML9 A;  3KUC B;  3FM8 C;  3QAQ A;  4XE0 A;  2IBI B;  3V61 A;  1UWM A;  2ADZ A;  4AOF A;  2G3Q B;  3L10 B;  4E3C A;  1WE7 A;  1YJJ A;  1XCT L;  3SUZ A;  2PZ1 A;  1TT5 B;  3DDC B;  1FD6 A;  3NZU A;  3VRB B;  4JLC A;  1V5O A;  2DZI A;  3KVF B;  4RMA A;  3ZNG C;  3QA8 A;  5HKH A;  1FIQ A;  3A8Q A;  2N7D A;  4QJ3 B;  1P3R A;  3R7R A;  3SFE B;  4KHO A;  3TEW A;  3QJZ A;  4F8C B;  1X1F A;  3AU5 A;  2ZEQ A;  3T06 A;  3Q3M C;  2HDE A;  4GOU A;  4K17 A;  3RNG C;  4NAW B;  2LJ5 A;  3PRM B;  2HE7 A;  4B0E A;  4A3P A;  4OZA A;  3M95 A;  2O2V B;  3AB5 A;  3ML8 A;  1IUE A;  1D5X C;  2WXH A;  1PMS A;  4XDC A;  1Y5O A;  2KNB A;  5BYS A;  4TQ0 A;  4LNO A;  1ZVR A;  2XN9 C;  2M8S A;  2Z8L A;  2FDQ A;  3H7P B;  2GI9 A;  1E8X A;  3B08 A;  4LDT D;  2IY1 B;  2L0T A;  2MBO A;  1OMW A;  3QK0 A;  2K39 A;  3T9L A;  1F1H A;  2MP2 B;  2K9X A;  1I4X A;  2IO3 B;  3KQ4 A;  5J18 A;  4ACF A;  3AM9 A;  1HXY D;  1U5G A;  5M4Y B;  4QJ4 B;  1Y56 A;  3VR9 B;  3KYC D;  2BS2 B;  5D6J B;  3KWL A;  1OFF A;  2YS5 A;  4NAW A;  3BJI A;  3V5W A;  4MSM B;  4IWO A;  3E9L A;  3JSV B;  3M62 B;  2P8V A;  3DBL B;  4CYE A;  5AUK A;  2QJL A;  4K81 A;  1RYJ A;  1WM3 A;  5IN7 A;  4IDI A;  1WSP A;  2FJL A;  3OHM B;  5AEK B;  1Q10 A;  2N1V A;  3H7P A;  2RVB B;  1DDM A;  3RNE C;  4EFO A;  1B9R A;  3QHT A;  2FCM A;  3AEE B;  4HKQ A;  3HRD D;  1EUV B;  3PS6 A;  2KFK A;  3EEC A;  3Q3O C;  1IYF A;  4JGH B;  1JWS D;  1XT9 B;  3GP7 A;  1P6S A;  2DZM A;  2ZKM X;  1N5X A;  2GBK A;  3Q3N C;  4A3O A;  2KMA A;  4MH0 E;  1P3Q U;  2AQ3 B;  2J42 A;  4ANX A;  2BWE S;  5EDS A;  3TEY A;  1WMH A;  4AWJ A;  4HB0 B;  4F7H A;  2WDV B;  2M38 A;  3I3T B;  2K0P A;  2VZK D;  2X38 A;  3RT3 B;  2O6V B;  1Y8R C;  2H89 B;  2QMT A;  1FM0 D;  3KUD B;  4JE3 B;  1DOI A;  2ZVO A;  1X05 A;  2ZPY A;  4HPL B;  1C9F A;  1I4Q A;  1KTK A;  2G45 B;  2JZ3 B;  1OQQ A;  3WAO A;  2IZV B;  2LGX A;  4TKN A;  2RNR B;  4KGR A;  2IDY A;  4LNF A;  1N60 A;  1KBL A;  3CXB B;  3ZJT A;  2Y8G A;  5D3Y A;  4IAP A;  3UZT A;  4RGM A;  1UUP A;  3TUO A;  4NJC A;  4DQO C;  1SE4 A;  2JYT A;  4JK9 A;  2KN4 A;  1J7C A;  1I42 A;  1ZC4 B;  2BYV E;  5DPS A;  1V97 A;  1U5E A;  3A98 B;  4L1R A;  3QAR A;  1NYR A;  3V60 A;  1HZ5 A;  3E9O A;  2W54 A;  3PZ7 A;  1IPG A;  4C7Y A;  3H9D A;  4GDL A;  2CKH B;  1P9D U;  3W1Y A;  2VH2 A;  3GE8 C;  4ZDV A;  2LG1 A;  3CIR B;  1WGQ A;  3NOB A;  3TEX A;  2KR0 A;  1D5Z C;  3NS1 A;  4HJG E;  2GB1 A;  3LB8 C;  2GOW A;  3SV1 A;  3W9C B;  2DHJ A;  1VCB A;  4ILJ A;  2LVO A;  3VUW A;  3VIA A;  1MHH E;  4EJN A;  3LXF A;  4GSW A;  1V61 A;  2INN E;  3KUZ A;  3ODW A;  1J8C A;  1WH3 A;  1GOZ A;  1FAO A;  3N30 A;  3ZVR A;  3CWI A;  4BZA A;  4A9A A;  4CHM A;  4Q2J A;  4GNK B;  5EE3 A;  2MBQ A;  1E90 A;  3OWE B;  3VH3 B;  4HKZ E;  3TJP A;  5J17 A;  5JHB A;  1DYN A;  1XXG A;  4GDK B;  3ECI A;  1CK1 A;  4GN1 A;  3A4R A;  4IWP A;  1HBK A;  4DHZ E;  2FJU B;  3AN1 A;  4G3X B;  1M7E A;  1E6E B;  2B3A A;  4II3 B;  2DHZ A;  1YJI A;  2C7M B;  4FN2 A;  4NJ6 A;  2AYO B;  3T8M A;  1FXI A;  4ZRQ A;  5GMV A;  1N5W A;  1ROE A;  3J9C A;  1QOG A;  4UDU C;  3BYT B;  2BS3 B;  4W9F A;  3V62 A;  1K5G B;  4AS1 A;  3I9V 1;  4JK8 A;  3ODO A;  2AEH A;  1T0Y A;  2K8E A;  3L16 A;  1ISN A;  2V3S A;  4RNA A;  4RGN A;  1NU2 A;  5JHG A;  3ALB A;  4C00 A;  1CMX B;  1D6E C;  4RH6 A;  3DPD A;  3I5J C;  3E66 A;  4ARI A;  2L1C A;  4GDK A;  4FAD A;  1L6V A;  1GUA B;  1EF5 A;  4IOI E; 
#chains in the Genus database with same CATH homology
 3CMM B;  1WXA A;  2ZNV C;  2N7E A;  4JIO U;  1ACA A;  3VUX A;  1I2H A;  3PT2 B;  2CHW A;  4K1R B;  4EUT A;  2DX1 A;  2MBE A;  4A6F B;  2O6V D;  2LAS A;  4DK5 A;  4W9C A;  1JRU A;  3KRX A;  2RR9 A;  2PEA A;  3UIP B;  2JT4 B;  2IYB A;  1WGG A;  3PP2 A;  3Q3J A;  2COP A;  4OVU A;  2BKR B;  3MHS D;  2DYO A;  3N3K B;  4JKD A;  4WJQ A;  3HM6 X;  5AZF A;  4Z2M B;  4IC7 B;  1JDE A;  3DCG A;  5FI1 A;  1BAK A;  4GZU A;  4Y94 A;  4G0N B;  4N9F 4;  2D11 A;  2RSU A;  4FUL A;  3L54 A;  4W9J A;  1AWE A;  2CAY A;  4FJV B;  2RSG A;  1UEL A;  4A6F A;  3RZW C;  4IM2 A;  2K2U A;  1X11 A;  4PS7 A;  3UQB A;  4KDL B;  1M7R A;  4WSF A;  1WE6 A;  5C1Z A;  1TXD A;  3EPY A;  1BWN A;  2DFK A;  3ZDT A;  4XZ4 A;  4B95 A;  4BKT A;  3SBT A;  2BCJ A;  3RUI B;  2AWT A;  5AZH A;  1WZ3 A;  4FJZ A;  2DHI A;  1P0R A;  1LFD A;  4P7I A;  2KTR A;  4BKG A;  3VTW A;  4G11 A;  1QC6 A;  2BWF A;  4BKS A;  5JH5 C;  4BBN F;  3DBH I;  4TV3 A;  1FHO A;  3NY5 A;  1YX5 B;  3A9K B;  3VQI A;  3ONS A;  3KSY A;  4FLH A;  1FXT B;  1V6E A;  2Q13 A;  1WI0 A;  1E8Y A;  1TQZ A;  3PEG A;  1WJN A;  3A8P A;  4D0N B;  4JQW C;  1R4M I;  3PLV A;  1BTK A;  2RPQ A;  3PVW A;  4HVB A;  4OVV A;  2W2X D;  1PLS A;  1J0W A;  2HTH B;  3WAN A;  2D4Q A;  3A4S C;  4GGQ A;  3KW5 B;  4AUQ C;  2MKR A;  2Y5B B;  2WDT B;  4JKC A;  4A6H A;  4PNK A;  2PE9 A;  2YS3 A;  4K7U A;  4MM3 A;  4MK0 A;  4EZL A;  4ILG B;  2YSZ A;  5AZG A;  2KC1 A;  2MBH A;  2DA0 A;  1WJ1 A;  4DDG D;  5C16 A;  2KN5 A;  1X1G A;  2JZZ A;  2L00 B;  3L17 A;  4HK2 A;  1U27 A;  4HDO A;  4GU2 A;  3SHQ A;  4NNJ B;  1Z5S B;  2HTH A;  2W2W A;  2C9W B;  4AJY B;  2GBN A;  1G6J A;  3P2B A;  2XK5 A;  3PVU A;  5D7G A;  2DX5 B;  5LXH A;  2WYQ A;  4DX8 A;  1QQG A;  2KUP A;  3DVG X;  2LGY A;  3DBL I;  1WGD A;  3QX1 A;  2FJ9 A;  3NS8 A;  1UNP A;  4IW0 A;  4HCN B;  3VH4 B;  4URK A;  4EOY A;  1SGH A;  3ZKJ C;  1SIF A;  5D2M B;  2VSZ A;  3PSE B;  3SBG A;  2KCJ A;  2JXX A;  3O96 A;  4BBN C;  2UYZ B;  2DX5 A;  2ZVN A;  2ZPN A;  3BY4 B;  3CST A;  1ZM0 A;  2CU1 A;  2MWS B;  4M8M A;  3L0W B;  3TIX A;  2LZ6 A;  3DXE A;  5C6R A;  1IRS A;  4GIV A;  4JKG A;  3KH0 A;  2MWN B;  2A5U A;  2P0H A;  3SO6 A;  5LLI A;  1WGH A;  1MAI A;  1MK7 B;  3F0W A;  1LW3 A;  3QBV B;  4II2 B;  3OAW A;  4GMX B;  3MJW A;  1YQB A;  2K8H A;  1RRB A;  3O65 B;  2NZ8 B;  4RM8 A;  1OGW A;  5D94 A;  1EF1 A;  5G55 A;  4HJK A;  3A1Q A;  2PE6 B;  4I6N B;  1PFJ A;  3PGE A;  2MW5 A;  2KFK B;  1K8R B;  1DBH A;  2UZS A;  1E7U A;  3IFW B;  1P5T A;  4W9I A;  1NBF C;  1XQQ A;  3RCP A;  4NQK E;  2GMI C;  2KMC A;  4FA6 A;  3VTV A;  2OOB B;  1WMH B;  4HB4 B;  2LUE A;  3UGB B;  1WIA A;  1J0G A;  5E6O A;  2JF5 A;  3B1L X;  4LJO B;  2L0F A;  2COF A;  3RD2 A;  2K2J A;  4MGZ E;  1TZ1 A;  3SU8 X;  2R0D A;  3HHM A;  2DYB A;  3JVZ X;  2WWZ A;  3JW0 X;  5JZE B;  2DYM A;  4FJY A;  4ZRJ A;  2KLC A;  2Z0E B;  1TBE A;  4NY0 A;  1RAX A;  4DHJ B;  2G4D B;  2DEN B;  3PRP B;  1H8C A;  3E9P A;  4MDK E;  1K5D B;  1DRO A;  1WI1 A;  4GDL B;  2YVC A;  1WJ4 A;  1ST7 A;  3D8F A;  1WY8 A;  3ML4 A;  1UH6 A;  2COC A;  2AL3 A;  2KQ7 A;  4ANV A;  1KZG A;  3R3M A;  5IAA C;  3D8E A;  1RFA A;  2ZCC A;  2D3G A;  3WIM A;  5JVL A;  3PZD A;  3IVF A;  1YX6 B;  2NVU I;  1I7A A;  2V1Y A;  1NTY A;  4LCD E;  2LVP A;  2D9X A;  4NJ7 A;  1OTR B;  3C0R B;  2UVM A;  1U2B A;  2OJR A;  4ANU A;  2W2X C;  2OQB A;  1WX8 A;  4C0A A;  4HAX B;  4Z2N A;  1WGU A;  1OEY A;  4BBK A;  3CF6 E;  1UNR A;  2DYQ A;  2FAZ A;  4HCP B;  5D3V A;  2I1K A;  2NBU A;  1HE8 A;  1FB8 A;  1R4N I;  4F7Z A;  2IFS A;  1P98 A;  2MX2 A;  3NHE B;  4GXB A;  4HPM B;  1DDV A;  2ZJD A;  3ZIM A;  1TTN A;  1GGO A;  2YLM A;  2LYD A;  3ENE A;  4DX9 0;  4JKF A;  4DBG A;  5DCN A;  4B6W A;  2PJH A;  1ZKH A;  2H7E A;  3UQA A;  1EGX A;  4WJN A;  5C79 A;  1GG3 A;  2GBM A;  4CHK A;  1HB8 A;  4KSK C;  2KK8 A;  1UBI A;  2VRW B;  1PQS A;  3CIK A;  1Q0W B;  1XX0 A;  3PG7 A;  5DIF B;  4MY6 A;  1GC7 A;  2QHO A;  1WXM A;  2GBR A;  2ZCB A;  4DDI D;  5KHO A;  1H10 A;  2I5F A;  4HLE A;  2L76 A;  4X57 B;  2C5L C;  4ICU A;  3WYF B;  2UZR A;  2I1J A;  3P6A A;  3FSS A;  3VAW A;  5D3W A;  2FUH B;  3CSF A;  4EKU A;  2M14 A;  2FCN A;  4L6E A;  5KHQ A;  4RM9 A;  2MCN B;  1W1D A;  1E5W A;  1WXV A;  2J0K A;  3DVN U;  5JP4 A;  4WWP A;  2GJY A;  3X0W A;  2D10 A;  1F9J A;  2EC1 A;  3NZS A;  2R09 A;  3D32 A;  4G50 A;  1M94 A;  4A5K A;  2IO0 B;  4F7G A;  2DYN A;  4TUU A;  2FIF A;  2V4L A;  4TYZ A;  3U30 A;  2KTR B;  1U5F A;  5J3T A;  4YON A;  2CY5 A;  3AXC A;  3APC A;  4FHJ A;  5EFX A;  1V5P A;  2KXJ A;  2WH5 A;  1SHC A;  3MTN B;  4CHJ A;  4GMV A;  4PQ0 A;  2NPT A;  2J0J A;  2P0F A;  2ZNV B;  1RRP B;  1XD4 A;  5KQ4 A;  4GB9 A;  4HAW B;  5HE3 A;  3DQV A;  1Y19 B;  1WX9 A;  2DZJ A;  2HRJ A;  3AJ4 A;  3FP5 A;  4IG7 B;  2JPH A;  2XEW A;  4W9H A;  4KAX B;  4W9D A;  4EZK A;  5J3Y A;  4J6I A;  3PLU A;  3LDZ E;  2KFJ A;  4WAA A;  3L08 A;  1FHW A;  1YD8 U;  2DLW A;  1WJ6 A;  1V49 A;  4EEW A;  4ICV A;  1KOT A;  1Z2M A;  1GJZ A;  5JHA A;  2LKO A;  4HHV A;  3EC8 A;  3ZRF A;  3GYP A;  2ROV A;  2JUO A;  2M1M A;  4A6K A;  3IG3 A;  1UEF A;  4MGK E;  1NI2 A;  3BIN A;  1VBH A;  5DH9 B;  2A4Z A;  4BOZ B;  2L7R A;  3AU4 A;  4ZRI A;  1WFY A;  2KC2 A;  2KQS A;  3W1S C;  2N1W A;  2IY0 B;  2XK5 B;  3PV1 A;  4W9L A;  4HB3 B;  3ULC A;  3U8Z A;  5LON B;  4KV2 A;  1V88 A;  3EHV A;  1EVH A;  3VDZ A;  4E74 A;  2LOX A;  2J59 M;  2KDE B;  3GZN I;  2J7Q B;  1C1Y B;  2N9E B;  3G9W A;  1WYW B;  3PHX B;  4HB2 B;  3H1U A;  2D9W A;  2MDX A;  5D3X A;  2CS4 A;  2CY4 A;  2KWC A;  2N9X A;  1BT0 A;  3TO1 A;  3ZUN A;  2LBB A;  1Q67 A;  3ZO5 B;  3LJ3 A;  3APD A;  2D9Z A;  2KVR A;  4IOY X;  1L7Y A;  4WQO B;  3DOW A;  2FCS A;  2FNJ B;  3PHW B;  4IM0 A;  3TW1 A;  3KYD D;  4BKS D;  2NCN A;  3SD5 A;  1LQB A;  3GOE A;  2EJ8 A;  4H8S A;  1OQN A;  3HK0 A;  3HW2 B;  4MGY E;  1V86 A;  2KX3 A;  2X18 A;  4JKG B;  4HAV B;  4IFS A;  1S1Q B;  2DAF A;  1WM2 A;  4DHZ B;  4NQL B;  3VOQ A;  4EMO A;  2EKE C;  3OLM D;  3NSU A;  2LUL A;  1B55 A;  4HAU B;  4WVF B;  2Z0D B;  2K8B A;  4DWF A;  2V76 A;  2MLB A;  2N4F A;  2Z59 B;  2GCL A;  3A9J A;  4JKE A;  3ZW3 A;  4EZJ A;  4K2P A;  3A1Q B;  2COA A;  2KJ6 A;  3DVN V;  2YF0 A;  4PS8 A;  1V81 A;  2BPS A;  2KAN A;  3MPX A;  4XC2 A;  5JHH A;  2Y7B A;  2GS0 A;  1P1A A;  2JWZ A;  3VHT C;  5J2R A;  2J0M A;  3X23 A;  4BVU C;  5J3Q A;  1LB1 A;  2BF8 B;  2LVQ A;  4MEM A;  4IM3 A;  1DIK A;  2CHZ A;  2RD0 A;  3RYT A;  2ZZP B;  3W1S A;  2NBW B;  2RUK B;  3M3J A;  2W9N A;  3AI5 A;  2L05 A;  4JKA A;  3UF8 A;  1MG8 A;  2YRY A;  3TBL D;  2L8J A;  1X1M A;  4MGI E;  3ZNZ B;  1SE9 A;  2N9P C;  3ZLZ A;  2DIK A;  2RGF A;  3VFK A;  1GC6 A;  2KDF B;  2ELB A;  1VD2 A;  2DHK A;  2G35 A;  1NTI A;  2WX1 A;  4BFR A;  3SDL C;  1RLF A;  1QZE A;  1E7V A;  2KJH B;  1WX7 A;  1UPQ A;  1X86 A;  2ELA A;  1UPR A;  1XD3 B;  2QKL A;  3VUY A;  3DBR I;  3OJ4 B;  4JKB A;  2NMB A;  1U5D A;  4F1S A;  2Y8F A;  4I6L B;  3ZTD A;  2REX A;  2KGX B;  3DVG Y;  1WR1 A;  4ZYN A;  5FI0 A;  5L83 A;  1L2N A;  2O2V A;  2C60 A;  1WF9 A;  5C5B B;  2NBV B;  4ZRK A;  2K00 A;  2DZK A;  1W1H A;  4M0W B;  2I5C A;  1LXD A;  1FGZ A;  4AP4 C;  4W9E A;  4TQ1 A;  1J19 A;  2AL6 A;  2COD A;  2MP2 A;  1XCG A;  1TGZ B;  3TL5 A;  2CHX A;  1Z87 A;  3N32 A;  5DPT A;  4IUM B;  2KDB A;  1WXS A;  2KO3 A;  2YT1 A;  4FBJ B;  4PS3 A;  1D3Z A;  3QQ8 B;  3PRZ A;  5D27 A;  1UZX B;  2IYD B;  2M17 A;  1TJ6 A;  3TCA A;  4IWQ A;  2RQ1 A;  2DTC A;  3JSV A;  1V80 A;  2LWP A;  2KZR A;  1WZ0 A;  5C5B A;  2KKC A;  3FLV A;  2IO1 B;  3IHP C;  2MFQ A;  1MIX A;  5HE0 A;  2ASQ A;  2JRH A;  2H7D A;  3SNH A;  4HXD A;  2EMT A;  5LXI B;  1V5T A;  4LJP B;  1A5R A;  4WWO A;  5CHF A;  4GPT B;  3HIZ A;  1KZ7 A;  1UGM A;  4KZ0 A;  4E71 A;  1VBG A;  1E8Z A;  3TMP B;  2L2I A;  1RJ2 A;  4HWI B;  1KJT A;  2R2O A;  4K7S A;  1HB6 A;  1V2Y A;  3OAN A;  2UWQ A;  2Z0Q A;  4ILH A;  2DN6 A;  2XQN M;  3QWM A;  2O6V A;  3TFM A;  2JRI B;  1MIZ B;  2OTX A;  3KRW A;  2G4S A;  1WVH A;  1EAZ A;  2GBJ A;  4NPN A;  4AJW A;  1FGY A;  2KD0 A;  1W1G A;  3S2A A;  3MDB C;  2RLO A;  4KZC A;  3PVL A;  5CLQ B;  2LRW A;  2JP2 A;  3QCA A;  2XBB C;  4B9K A;  3B0A A;  3L13 A;  1ZGU B;  4DBB A;  2LOZ A;  1ZC3 B;  4CO7 A;  3WAL A;  2BYE A;  2ROZ B;  5DPR A;  1WJM A;  4JL9 A;  5DPW A;  3DXC A;  1U4A A;  1FOE A;  3H7S A;  2IO2 B;  3ZTC A;  2X0S A;  2ABD A;  1YJ1 A;  2MRP A;  3Q3F A;  2DAJ A;  2GCJ A;  3PSC A;  3PTF C;  2MQJ A;  4DHJ D;  2KDI A;  1WRD B;  2YT0 A;  1UD7 A;  4HAT B;  5E6N A;  4K7W A;  5KCV A;  4W9K A;  2N23 A;  4KVG B;  3HM3 A;  4ASW C;  2MA9 B;  3OJ3 A;  1KLV A;  2LXA A;  1OQY A;  2NPT B;  1KM7 A;  1IP9 A;  2BYF A;  1GNU A;  3APF A;  3EFU A;  1EO6 A;  1KC7 A;  1KI1 B;  2D9Y A;  3ZNI D;  2Z0O A;  3ZRC A;  2K6Q A;  5L95 C;  4HAY B;  2D9V A;  5CHV C;  5CX3 A;  1WGY A;  2RGN B;  3FEH A;  4B6H A;  4KHB B;  1MKE A;  2BKF A;  1OEY J;  2BGF A;  3P7Z A;  5L81 A;  2MSE D;  2K6D B;  1C3T A;  2M0X A;  4DXA B;  1ZW7 A;  4A20 A;  4ANW A;  2CQU A;  3WAM A;  3DBS A;  4FHK A;  2E2X A;  4I6P A;  2C7N B;  2KTF A;  5CTR C;  3ENB A;  3ZDM C;  4MJS B;  5C23 A;  5DHA B;  4HDQ A;  2LGD A;  3K9O B;  3JYU A;  3RCZ A;  3F5R A;  3M1I B;  2KHW B;  2KLG A;  2FID A;  5HE1 A;  1WR6 E;  3ODX A;  1BTN A;  3DXD A;  4XX5 A;  1I35 A;  2Z0P A;  1WG7 A;  4HAZ B;  3ZNH B;  5HE2 A;  2KX0 A;  1NDD A;  2N0Y A;  3VTU A;  4JK7 A;  3ULB A;  4MJS A;  3GYO A;  4WJ7 A;  4WJO A;  4KSL C;  3UIN B;  2KOX A;  3V6E B;  2M4N A;  1DDW A;  2R82 A;  1U29 A;  1LM8 B;  4KIK B;  2KWV B;  2DKQ A;  4M8N A;  4WJP A;  4GOC A;  3QWZ B;  2K25 A;  3SYX A;  5G2N A;  1MPH A;  4K2O A;  3KY9 A;  1UBQ A;  3RUL A;  3A33 B;  4WWN A;  4XWX A;  3K9P B;  1UNQ A;  5CLL B;  3LJU X;  1XOD A;  5FR6 A;  1H4R A;  4LDT B;  5BO4 B;  2MBB B;  1V5M A;  4MEL A;  4MSQ B;  3A9K A;  5KQ1 A;  2LD9 A;  4KDI C;  3AUL A;  4PYU A;  2K8C A;  1XKE A;  3QC8 B;  4W9G A;  3UIO B;  2K1F A;  3U7D A;  3H6N A;  1AAR A;  4PYZ A;  5E6P A;  1E8W A;  3IBE A;  5CHW A;  1NTV A;  4NSW A;  1Q5W B;  3KZ1 A;  1N3H A;  2DKP A;  2KJR A;  1V5U A;  4KIK A;  2WX0 A;  2PPH A;  3WA0 A;  2YS1 A;  4KHA A;  3R7Q A;  2HD5 B;  3QIJ A;  3TVV A;  3VXW A;  3A9J B;  5DI9 B;  1NVL A;  2CR5 A;  2R2Q A;  2JY6 A;  3PRE A;  2JVC A;  3D8D A;  1WJU A;  3RZF A;  3VVW B;  4MT7 A;  1MK9 B;  2CB8 A;  2LXC A;  3WAP A;  1S3S G;  3M63 B;  5DHF B;  3PPA A;  1V89 A;  3ZVV A;  2P0D A;  2HJ8 A;  1FHX A;  4BOS C;  3R66 C;  1Q1O A;  1OY2 A;  2NR2 A;  3V6C B;  5IJM A;  5LOP B;  2LRU A;  3HQC A;  2D07 B;  2L3Z A;  5TR5 A;  5JLJ B;  1WGR A;  2CRF A;  1YIW A;  2D2Q A;  2VKI A;  1AQC A;  2NS5 A;  2EMS A;  2C7H A;  5GOW B;  4F7U P;  2LI5 A;  1XR0 B;  4JKH A;  2QKM A;  3N7C A;  2KWU B;  2VRR B;  2FCQ A;  1V9J A;  1ZSQ A;  4YL8 A;  5IA7 A;  3ML9 A;  3KUC B;  3FM8 C;  3QAQ A;  2IBI B;  3V61 A;  2ADZ A;  4AOF A;  2G3Q B;  3L10 B;  4E3C A;  1WE7 A;  3SUZ A;  2PZ1 A;  3DDC B;  3NZU A;  4JLC A;  1V5O A;  2DZI A;  3KVF B;  4RMA A;  3ZNG C;  3QA8 A;  5HKH A;  3A8Q A;  2N7D A;  1P3R A;  3R7R A;  4KHO A;  3QJZ A;  4F8C B;  1X1F A;  3AU5 A;  2ZEQ A;  3T06 A;  4K17 A;  4NAW B;  2LJ5 A;  3PRM B;  2HE7 A;  4A3P A;  3M95 A;  2O2V B;  3ML8 A;  1PMS A;  1Y5O A;  2KNB A;  4TQ0 A;  1ZVR A;  2M8S A;  2FDQ A;  3H7P B;  1E8X A;  3B08 A;  4LDT D;  2IY1 B;  2L0T A;  2MBO A;  1OMW A;  3QK0 A;  2K39 A;  3T9L A;  2MP2 B;  2IO3 B;  5J18 A;  1U5G A;  3KYC D;  5D6J B;  2YS5 A;  4NAW A;  3BJI A;  3V5W A;  4MSM B;  4IWO A;  3E9L A;  3JSV B;  3M62 B;  2P8V A;  4CYE A;  4K81 A;  1WM3 A;  2FJL A;  5AEK B;  3H7P A;  2N1V A;  2RVB B;  1DDM A;  4EFO A;  3QHT A;  2FCM A;  1EUV B;  3PS6 A;  2KFK A;  3EEC A;  1IYF A;  4JGH B;  1XT9 B;  1P6S A;  2DZM A;  2GBK A;  4A3O A;  2KMA A;  4MH0 E;  1P3Q U;  4ANX A;  2BWE S;  5EDS A;  1WMH A;  4AWJ A;  4HB0 B;  4F7H A;  2M38 A;  3I3T B;  3RT3 B;  2O6V B;  1Y8R C;  3KUD B;  2ZVO A;  1X05 A;  2ZPY A;  4HPL B;  2G45 B;  2JZ3 B;  3WAO A;  2IZV B;  2LGX A;  4TKN A;  2RNR B;  1KBL A;  3CXB B;  2Y8G A;  5D3Y A;  4IAP A;  3UZT A;  4JK9 A;  1I42 A;  1ZC4 B;  2BYV E;  5DPS A;  1U5E A;  3A98 B;  3QAR A;  3V60 A;  3E9O A;  1IPG A;  3H9D A;  4GDL A;  2CKH B;  1P9D U;  3W1Y A;  4ZDV A;  2LG1 A;  1WGQ A;  3NOB A;  2GOW A;  3SV1 A;  2DHJ A;  1VCB A;  4ILJ A;  2LVO A;  3VUW A;  3VIA A;  4EJN A;  4GSW A;  1V61 A;  3KUZ A;  3ODW A;  1J8C A;  1WH3 A;  1FAO A;  3N30 A;  3ZVR A;  4CHM A;  3VH3 B;  2MBQ A;  1E90 A;  3TJP A;  5J17 A;  5JHB A;  1DYN A;  4GDK B;  3ECI A;  4GN1 A;  3A4R A;  4IWP A;  1HBK A;  4DHZ E;  4G3X B;  1M7E A;  2B3A A;  4II3 B;  2DHZ A;  2C7M B;  4FN2 A;  4NJ6 A;  2AYO B;  3T8M A;  5GMV A;  4W9F A;  3V62 A;  1K5G B;  4JK8 A;  3ODO A;  2AEH A;  1T0Y A;  3L16 A;  1ISN A;  2V3S A;  1NU2 A;  5JHG A;  3ALB A;  1CMX B;  3DPD A;  3E66 A;  2L1C A;  4GDK A;  4FAD A;  1GUA B;  1EF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...