1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
molecule keywords RADIXIN
molecule tags Cell adhesion
source organism Mus musculus
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
4HPLB 1MG8A 2M17A 1D3ZA 2J0KA 2ASQA 4KHOA 1ZM0A 2LUEA 2CHWA 2EMTA 3LDZE 4ZRKA 4GPTB 4WWPA 1WGQA 5FR6A 1FB8A 4HVBA 4A6HA 1SHCA 2MWSB 4X57B 2MBQA 4HCPB 3PRMB 1RJ2A 3ZLZA 3M95A 1TGZB 4GOCA 3EECA 3KYDD 4BBNC 4B6WA 3ULCA 1XODA 1FHWA 3UIPB 5EDSA 3N7CA 1P6SA 4W9GA 2M4NA 2N9EB 4F7GA 5IA7A 3LJUX 4HATB 1Y5OA 3QCAA 4LDTB 4DK5A 3D8EA 3QWZB 1V88A 3ZW3A 4XWXA 4A6FB 2KC1A 2ZZPB 2KDBA 1P3QU 2MBHA 4IM2A 2CHXA 2DHZA 3HK0A 2RLOA 3PV1A 2RD0A 2IYDB 5DPWA 2ZCBA 2KLGA 3NZUA 2BPSA 4MGKE 3N30A 2IFSA 1HB8A 3DBHI 4WJOA 4PS8A 3CSTA 2V76A 3M1IB 4FN2A 2ELBA 1ZC3B 1X86A 2XQNM 3M3JA 1V2YA 4HB4B 1KZ7A 1M7RA 4KZCA 4NJ7A 4GXBA 4EZJA 5J3QA 5D3YA 4KHBB 3TVVA 3MPXA 2J7QB 4A6KA 4G11A 3VQIA 1BWNA 4W9EA 4G50A 5DPRA 1P3RA 1QC6A 3HHMA 5BO4B 2IO0B 1NTYA 2C7NB 3PRPB 1U29A 4NY0A 1WI0A 2MW5A 3CSFA 3CXBB 2JP2A 2L1CA 4LDTD 1EF5A 3NSUA 3A9KB 3RCPA 4URKA 3JSVB 2KOXA 3IVFA 1V6EA 5JHAA 1U5FA 2RPQA 3RUIB 1Q67A 2LD9A 4IWPA 4W9CA 2ELAA 2L0FA 2CRFA 2X18A 4PS7A 5J3YA 5JHHA 3ZTCA 1YQBA 3RT3B 3PVUA 4HK2A 1R4NI 3QC8B 2ROZB 1J0WA 4EUTA 3HW2B 2DZMA 1WJ6A 2UVMA 2BCJA 3H7PB 2G45B 1YX5B 2G4DB 1WGRA 1E8ZA 4HDOA 3M62B 2H7DA 2KDEB 2UZSA 2JF5A 4HB3B 2C5LC 3DVGX 2RNRB 2NPTB 2QHOA 4CHJA 3WYFB 1WRDB 1X11A 2COAA 2DLWA 3H1UA 2P0HA 2LJ5A 4NPNA 3IHPC 4BKSA 2HJ8A 4B95A 4DDGD 1RRPB 3MTNB 3VXWA 3A9KA 4HAYB 2BGFA 2LXAA 3UINB 1Y19B 3ALBA 2DYNA 2RQ1A 1V5OA 2Y7BA 1DDWA 4ANXA 2MP2A 3APCA 3PSEB 2GBNA 3TCAA 1NVLA 3V6EB 4YONA 2CODA 1WH3A 4WVFB 4PS3A 4NSWA 2WYQA 2LBBA 2YS3A 3B08A 2BKFA 3PRZA 4HLEA 3ZTDA 1X1FA 1FGYA 2YF0A 5LXIB 2K8CA 1WE7A 2Z0EB 2MKRA 3L54A 4TQ1A 2AL3A 1G6JA 2RGFA 1EO6A 2VSZA 2GCLA 4II3B 2MLBA 1RLFA 4IG7B 3W1SA 1WGYA 2C9WB 3OANA 2LOZA 3VVWB 4DHZB 1KZGA 5C16A 1GNUA 1GC7A 2HD5B 1BT0A 4G3XB 3RCZA 2KMCA 2G4SA 1E8XA 2D9ZA 4IOYX 5EFXA 1MPHA 1P5TA 4ANUA 4MGYE 2KX3A 5KQ1A 3WA0A 2CQUA 1IPGA 3UZTA 2BKRB 1GC6A 3KVFB 5CHWA 4GZUA 3FP5A 1XKEA 2RR9A 2KCJA 2LVPA 2AYOB 4AOFA 3L17A 1SIFA 2GBMA 3IG3A 1W1DA 3UGBB 2ZNVB 1ZVRA 3KH0A 1LB1A 3A9JB 5CTRC 4M0WB 3LJ3A 2KUPA 2MWNB 3PLVA 1WR1A 5D2MB 5GMVA 2N0YA 2KKCA 4D0NB 2LVQA 4JQWC 4DX8A 2FJLA 2N7DA 2IYBA 2KJRA 2RGNB 4WJ7A 3T8MA 3QX1A 2HRJA 3VFKA 4BBKA 2W2WA 2O6VB 3R66C 4OVVA 3O65B 4H8SA 3VTVA 1L2NA 2ZNVC 1HBKA 2DYMA 4A3OA 2MBOA 5JLJB 3S2AA 4F8CB 4IAPA 2J0JA 1WF9A 4K17A 1EUVB 5D6JB 4NQKE 2BWFA 2DZJA 4OVUA 3V5WA 4CO7A 2KX0A 3M63B 2OOBB 2ZCCA 3ZVRA 2PE6B 2NZ8B 1V61A 1RAXA 5D94A 4MELA 4KIKA 2BF8B 2NBVB 5LONB 4G0NB 3A9JA 4AP4C 2K39A 2JRIB 5J17A 4RM9A 2BWES 3UIOB 4FJVB 3SU8X 2KO3A 2FJ9A 1E7VA 3VH3B 1T0YA 3KUZA 1UH6A 2R2OA 1GJZA 4FJZA 1I7AA 2LG1A 3AU5A 2FCMA 1WJ1A 4MEMA 1PFJA 4A3PA 1E8WA 4NNJB 4WWNA 3A4SC 2O6VA 2O6VD 1RRBA 3BJIA 4GIVA 2LRUA 2UYZB 3WAPA 1FOEA 2I5CA 4FULA 5J18A 2M14A 2GBRA 3PSCA 3JW0X 3T06A 2CKHB 3NZSA 3PGEA 5JP4A 2K00A 2KZRA 1KM7A 2FNJB 2P0FA 1J8CA 2ABDA 2FCNA 2L00B 3FEHA 4GDKA 2KGXB 2PPHA 2L8JA 2Z0PA 4MJSA 1WXVA 1E7UA 4B6HA 3C0RB 2DENB 3QHTA 3D8FA 3DBLI 3VH4B 2OQBA 3PS6A 1VCBA 4TYZA 2LGYA 1UBIA 2NCNA 2REXA 2NMBA 4K7WA 2BYEA 3X23A 1YX6B 3UF8A 2PE9A 1C3TA 4DHJB 2KWVB 3NY5A 1OQYA 3PZDA 1XQQA 3ZRCA 4GDLB 2Z0DB 1UELA 5KHOA 2YT1A 2KMAA 1WM2A 3H9DA 5HE0A 2KFJA 2O2VA 1YIWA 4WSFA 3NOBA 2WX0A 4HPMB 2C7HA 3X0WA 2KD0A 4HXDA 1DDMA 3NHEB 1V5UA 2D3GA 3P7ZA 3OAWA 2IBIB 4BOSC 4RMAA 4MSQB 2L2IA 5JHBA 3G9WA 4KAXB 1P9DU 1UZXB 3DPDA 2RSGA 5L83A 2DZIA 3DXEA 4AJYB 1Q0WB 2MA9B 3ODOA 4KV2A 2MCNB 4PYZA 4FA6A 3F0WA 4Z2NA 2IZVB 2N9PC 2LOXA 1WJMA 1U4AA 4HAWB 3DXDA 2WWZA 5CLQB 5LXHA 3MJWA 4DHJD 1WYWB 2G3QB 1QZEA 2IO3B 2K2UA 4ZRJA 2H7EA 1I2HA 1MAIA 4GDLA 3QJZA 2MP2B 1AWEA 3CF6E 1EAZA 5LOPB 2IY1B 4DHZE 2AL6A 1V86A 4IM0A 1DDVA 2DTCA 4BBNF 2EJ8A 1V89A 4XZ4A 2L7RA 1LM8B 2CR5A 3V60A 3APDA 3SDLC 4GB9A 2Y5BB 2YVCA 3PG7A 2KWUB 3AXCA 2I1KA 2R09A 3P2BA 3ZDMC 4GMVA 2FUHB 4PQ0A 2JVCA 1OY2A 4ICVA 5DIFB 2D4QA 2YT0A 2K6QA 4HAUB 4GMXB 2DAJA 2KQ7A 4KSKC 5DH9B 3V6CB 4W9DA 1FGZA 2D9XA 3TO1A 3DVNV 1ISNA 4BKSD 3DOWA 1V9JA 2JXXA 1V5PA 4WJPA 3DDCB 4E74A 2DA0A 2RUKB 3ZNZB 3D8DA 1NTIA 1DROA 2ZJDA 5HE3A 3AU4A 3W1SC 4ANVA 5AZHA 3MHSD 4WWOA 4BOZB 2CU1A 5L95C 3VUWA 5C23A 5J2RA 4I6NB 2M38A 5C6RA 3IFWB 4DBGA 3FM8C 4HAVB 2KTFA 3SHQA 3HM3A 5JZEB 4K2PA 2KXJA 1PQSA 1HB6A 3F5RA 1WY8A 3UQAA 5L81A 4MGZE 1FHOA 5DPSA 2XK5A 2YRYA 2JUOA 4E71A 3EPYA 4MSMB 3QIJA 4KDIC 2Z0QA 4ASWC 2Q13A 4XC2A 4BKGA 2VRRB 2BYVE 1WJUA 1WGDA 1WR6E 1OEYA 1XX0A 3EHVA 4NJ6A 3FLVA 3GZNI 4K1RB 2KFKB 2LWPA 3FSSA 1MK7B 2MBEA 5C5BA 3ZUNA 2ZPYA 3PP2A 4K7SA 4W9HA 2Y8FA 1WG7A 1WJNA 1X1MA 4MT7A 2K1FA 4WAAA 4KDLB 4DBBA 2CY5A 5FI1A 1M94A 5DPTA 2RVBB 4KIKB 2KJ6A 3PHXB 2LXCA 3SYXA 3ENEA 2M1MA 1ZW7A 3A8PA 2CS4A 4AWJA 2A5UA 4Y94A 1UNPA 3VHTC 3DQVA 2M0XA 1OGWA 2R2QA 1UNRA 2G35A 3JVZX 1MIXA 4YL8A 2KHWB 2FAZA 3DBRI 3JYUA 1Q5WB 3WIMA 3ECIA 4BFRA 4A5KA 2DYQA 5JHGA 4EKUA 1UPQA 4CHMA 1WMHA 1OQNA 1LFDA 5E6OA 3UQBA 2Y8GA 3RYTA 1F9JA 2C7MB 3TL5A 2V1YA 2KFKA 2N1VA 1ST7A 1UD7A 3KRWA 2PZ1A 1WXMA 1NI2A 4DXAB 4EEWA 4HHVA 2QKMA 1OMWA 3KY9A 3ZNGC 3A1QB 2JY6A 3KUCB 2LYDA 1BTNA 2VRWB 3V62A 2N23A 4HCNB 1J0GA 3VIAA 2JT4B 2K2JA 4PYUA 2XEWA 2W9NA 3QAQA 3QK0A 1FHXA 5E6PA 4GDKB 3EC8A 3AULA 3VDZA 4M8MA 1XT9B 4ICUA 1FAOA 4MJSB 1GG3A 4FADA 4W9FA 3ZRFA 2KLCA 3ODXA 4NQLB 3PEGA 1WM3A 1TXDA 5DCNA 1W1GA 3KUDB 4JL9A 3U30A 3TIXA 2ROVA 2COPA 2HTHA 2DHIA 5FI0A 5E6NA 4TV3A 2L0TA 3V61A 1DBHA 2UZRA 2FCSA 1R4MI 2CHZA 4TQ0A 3OJ3A 1GUAB 2DZKA 2K6DB 4ZRIA 3KSYA 2CB8A 3SO6A 3CMMB 5HE1A 4BKTA 1AARA 2LGXA 4F7ZA 1WVHA 4F1SA 1UPRA 2M8SA 1UEFA 3R7RA 4LCDE 1WX8A 2AWTA 4MGIE 2O2VB 4DDID 3A1QA 1WI1A 2J59M 2YS5A 3PLUA 1Z5SB 4JLCA 1TBEA 3SD5A 2OJRA 3RZWC 3BINA 3TFMA 4EOYA 1OEYJ 2ZVOA 1WZ0A 1J19A 5D3VA 3CIKA 5CHVC 3GYPA 1WIAA 3TBLD 1TJ6A 2P8VA 2GS0A 2EC1A 1K5DB 1QQGA 2AEHA 4II2B 4KVGB 2NVUI 2ZEQA 1Q1OA 2NBUA 4LJOB 2J0MA 3PVWA 5DHAB 5AZGA 3K9OB 2D9YA 2R0DA 3VUYA 5D3XA 1P98A 1E8YA 3ZO5B 2N9XA 2DHJA 3K9PB 1WGGA 2B3AA 1A5RA 3PTFC 3B0AA 1TQZA 1I42A 2LULA 5AEKB 1Y8RC 4FLHA 4GU2A 3SV1A 3QA8A 4GSWA 4GN1A 2FCQA 1V49A 3WANA 1ZC4B 2JPHA 3WAOA 3I3TB 1ACAA 3ML9A 1WGUA 2LZ6A 5AZFA 2MSED 4PNKA 2LKOA 4GGQA 2MBBB 5CLLB 1WX9A 2DN6A 2GCJA 1Z2MA 1WZ3A 4MK0A 4JIOU 2COCA 2KJHB 1L7YA 1UBQA 1WE6A 4EMOA 3TMPB 1OTRB 2JZZA 4IW0A 1TTNA 3MDBC 3ULBA 2KK8A 2CAYA 3R7QA 4RM8A 1S1QB 2A4ZA 2UWQA 3WAMA 1P0RA 3KZ1A 2DKPA 5G55A 3U7DA 3VAWA 3OLMD 1E5WA 2CY4A 1JRUA 2D11A 2WDTB 2MQJA 3L0WB 2MFQA 1V81A 1YD8U 1AQCA 2IO2B 4LJPB 3IBEA 5HKHA 1X05A 4EFOA 4W9JA 3L16A 3A4RA 5IAAC 4ZDVA 3QBVB 3ZIMA 1KOTA 3VTWA 4E3CA 3N32A 4ANWA 4EZKA 1SGHA 3EFUA 2OTXA 2EKEC 1VD2A 2EMSA 1WGHA 4EZLA 4AJWA 3ONSA 4K2OA 5TR5A 3ODWA 4IWQA 4A6FA 3PT2B 3ZDTA 3D32A 3PPAA 3P6AA 2BYFA 3DBSA 3ZKJC 1H10A 2GJYA 1K8RB 2XK5B 3DVNU 2D07B 3PHWB 2WX1A 3RZFA 1UNQA 3DXCA 1U5DA 4FJYA 3U8ZA 1RFAA 3ZVVA 1WX7A 4HB2B 5KCVA 2K8BA 4DX90 4HJKA 2LI5A 1FXTB 2KWCA 4WJNA 5C79A 4W9IA 5D27A 2D2QA 1WFYA 1MK9B 2KDIA 1H4RA 1MKEA 1DYNA 1EGXA 4IUMB 2W2XC 1P1AA 3T9LA 1M7EA 1ZGUB 1U27A 5C5BB 2KN5A 1V5TA 3RD2A 4J6IA 4B9KA 1LW3A 4WQOB 2IY0B 2D9WA 3L13A 4IM3A 1X1GA 1IP9A 2LASA 3B1LX 1KJTA 2LVOA 5GOWB 4Z2MB 2Z0OA 3L10B 4XX5A 4MH0E 3R3MA 4NAWB 4MDKE 5G2NA 2HE7A 3PREA 2MDXA 3JSVA 2V3SA 4FHJA 2NR2A 4IFSA 2PEAA 2K25A 2D9VA 4MY6A 1SE9A 1LQBA 4KHAA 4TKNA 2W2XD 2DYOA 1XD4A 1KI1B 3N3KB 4M8NA 5KHQA 2D10A 3Q3JA 3AI5A 5KQ4A 3DCGA 2XBBC 3NS8A 3OJ4B 2E2XA 1PMSA 3HM6X 3TJPA 4HAXB 4W9LA 4I6PA 3L08A 1B55A 2N7EA 1WMHB 2C60A 3A8QA 2GBJA 1U5EA 2KTRB 4F7UP 2N4FA 2KDFB 5IJMA 3DVGY 2P0DA 4L6EA 2FIDA 5CX3A 3H7PA 2DX5B 1U5GA 3VUXA 1MIZB 1KLVA 2DFKA 3KYCD 2KANA 3A33B 1U2BA 2DAFA 2K8HA 3APFA 2GOWA 4K7UA 3GOEA 3RULA 2NPTA 2GBKA 1BTKA 4EJNA 1V5MA 1LXDA 1ZKHA 1E90A 1XR0B 2COFA 1ZSQA 3SUZA 2MRPA 4K81A 2VKIA 4IWOA 4BVUC 3HQCA 4KZ0A 3TW1A 2V4LA 4NAWA 2ZVNA 1NDDA 2DKQA 1WXSA 3W1YA 4P7IA 1N3HA 2DYBA 2JWZA 3Q3FA 1H8CA 1WJ4A 3WALA 2JRHA 1PLSA 3QWMA 2L3ZA 2NS5A 1HE8A 1S3SG 4FHKA 2KNBA 3SNHA 3ML8A 3HIZA 2HTHB 5DI9B 1TZ1A 2KTRA 1YJ1A 5C1ZA 1V80A 1CMXB 2QKLA 2ADZA 3KW5B 2DX5A 2NBWB 2GMIC 1EF1A 3BY4B 3O96A 2I5FA 2JZ3B 2Z59B 4IC7B 4C0AA 2LRWA 3ZNHB 2WH5A 4HB0B 1EVHA 2YLMA 2KVRA 1WXAA 1NU2A 4I6LB 4HWIB 3QQ8B 4HAZB 1K5GB 5HE2A 2PJHA 5LLIA 2IO1B 3H6NA 2KC2A 4HDQA 1BAKA 1NTVA 2YSZA 3VOQA 1NBFC 4F7HA 5J3TA 1Z87A 3ZNID 4TUUA 1W1HA 2I1JA 5JH5C 3GYOA 5D3WA 3QARA 5D7GA 4DWFA 2LGDA 2ZPNA 3PVLA 2L05A 2KQSA 2RSUA 3AJ4A 2DX1A 3A98B 1XCGA 1UGMA 4WJQA 2L76A 4N9F4 1IYFA 2DHKA 3KRXA 5DHFB 4MM3A 4FBJB 3VTUA 2N1WA 4W9KA 1IRSA 2FIFA 4ZYNA 4KSLC 1XD3B 2MX2A 2FDQA 4AUQC 3ML4A 5CHFA 4A20A 1I35A 4JGHB 4CYEA 1C1YB 4CHKA 2YS1A 3H7SA
chains in the Genus database with same CATH superfamily
4HPLB 1MG8A 2M17A 1D3ZA 2J0KA 2ASQA 4A55A 4KHOA 1ZM0A 2LUEA 2CHWA 1ZXHA 2EMTA 3AE1B 4YTPB 3LDZE 4ZRKA 3P4SB 4GPTB 1I4XA 2YEPB 4WWPA 1WGQA 5FR6A 1QF6A 1FB8A 4HVBA 4A6HA 1SHCA 2MWSB 4X57B 2MBQA 2NBVA 2KAJA 4HCPB 2INCC 3PRMB 1RJ2A 2KWDA 4D6WA 1I4RA 3ZLZA 3M95A 1TGZB 4GOCA 3EECA 3KYDD 4BBNC 4B6WA 1XLOA 3ULCA 2WDRB 1XODA 3FILB 1HZ5A 1FHWA 3UIPB 1B9RA 5EDSA 3N7CA 3SBGA 3TUOA 1P6SA 1TS4A 4W9GA 1WXQA 2M4NA 2N9EB 4F7GA 4JX1C 5IA7A 1TT5B 3LJUX 4NJCA 4HATB 1Y5OA 3QCAA 2ICIA 2V0GA 4LDTB 3AECB 1D5XC 4DK5A 3D8EA 2MJDA 2MJ3A 3QWZB 1F1HA 4JK7A 1V88A 1WRIA 1XO3A 3IXSA 1VBGA 3ZW3A 4XWXA 4A6FB 2KC1A 2ZZPB 2KDBA 1P3QU 2MBHA 4IM2A 1IGDA 2CHXA 2QMTA 2RRFA 2DHZA 3HK0A 4C4VB 3KQ4A 4WAFA 2KIEA 2RLOA 2RD0A 3PV1A 3RFZB 3NG0A 2IYDB 5DPWA 2ZCBA 2KLGA 3NZUA 2BPSA 4KX6B 4MGKE 3N30A 2IFSA 1HB8A 1VBHA 3DBHI 1CJEA 1T0QC 4WJOA 4PS8A 3NZ3A 3CSTA 2V76A 4DXFA 1YN3A 3M1IB 4FN2A 2LHEA 3Q8FA 2ELBA 3I9V1 1QT9A 2UU7A 1ZC3B 1X86A 2XQNM 1Y56A 1V8CA 4LNOA 1C77A 3M3JA 1V2YA 4HB4B 1KZ7A 2VH2A 3GE3C 1M7RA 2WXFA 4KZCA 3NWDA 1MI0A 3AEDB 4NJ7A 1FMAD 4GXBA 4EZJA 5IKCM 4JKFA 4C7ZA 1DOXA 3IAS1 4LNKA 5J3QA 5D3YA 1EM7A 4KHBB 1L6VA 3TVVA 3MPXA 2J7QB 2GI9A 4A6KA 4P6VF 4G11A 3GB1A 3VQIA 1BWNA 1I4HA 1T5XD 1DOYA 4W9EA 2WXLA 4G50A 4M01A 1P3RA 1QC6A 3HHMA 5DPRA 5BO4B 2IO0B 1NTYA 2C7NB 3PRPB 1U29A 1K50A 4NY0A 1WI0A 4XYCA 2GLSA 2MW5A 3CSFA 1ZDVA 2INDC 3CXBB 2JP2A 2L1CA 4LDTD 1EF5A 3NSUA 3A9KB 3RCPA 4URKA 3JSVB 2KOXA 1VDVA 3IVFA 4OSNA 1V6EA 4XDCA 1FEHA 5JHAA 1V97A 1U5FA 2RPQA 1DOIA 3RUIB 3E9LA 1Q67A 2W54A 2ZW0A 3NS1A 5AUKA 3Q8EA 2LD9A 4A8XC 1EWYC 4IWPA 4QJ5B 4W9CA 3Q69A 2ELAA 2L0FA 2CRFA 2WLBA 3URYA 2X18A 4PS7A 5J3YA 5JHHA 3ZTCA 1J7AA 1FPYA 3VR8B 1YQBA 3I63C 3RT3B 4RGTA 4DXGA 1IUEA 3PVUA 4HK2A 1SE3A 2K3UA 1R4NI 4P1CC 3QC8B 3HVDA 4JWSC 2ROZB 3AEFB 1LGRA 1J0WA 2GB1A 1XLQA 4EUTA 3HW2B 1MVKA 1YJJA 3Q2AC 2DZMA 1WJ6A 2UVMA 2BCJA 2PLPA 3H7PB 2G45B 2KACA 5I2SA 1BUIC 1YX5B 2G4DB 1WGRA 3W5UB 1E8ZA 4HDOA 3M62B 2H7DA 2V9HA 2KDEB 2UZSA 2JF5A 4HB3B 2C5LC 3DVGX 2RNRB 1FIQA 2NPTB 2QHOA 4CHJA 3WYFB 1WRDB 4DQOC 1X11A 2COAA 2VZKD 2WXIA 2DLWA 3H1UA 2P0HA 2LJ5A 1VR9A 4NPNA 3IHPC 4BKSA 4B0EA 2HJ8A 4B95A 4DDGD 1L5PA 1V1OA 5EE0A 1RRPB 3MTNB 3VXWA 3HIEA 4DIXA 1F0ZA 3A9KA 4HAYB 2BGFA 1KRHA 2LXAA 3UINB 1Y19B 1PYWD 3DBHB 3ALBA 2DYNA 2RQ1A 2R61A 1V5OA 2EELA 2Y7BA 3DWMA 1DDWA 3GE8C 3RNEC 4ANXA 2MP2A 3APCA 3PSEB 2GBNA 3TCAA 1NVLA 3V6EB 4YONA 2CODA 1WH3A 4WVFB 4OZAA 4PS3A 4NSWA 2WYQA 2LBBA 2YS3A 3B08A 2BKFA 2PW9A 3PRZA 2WS3B 2JYTA 3EA6A 3N1XC 4HLEA 3ZTDA 1X1FA 1FGYA 4JKEA 2YF0A 3E9SA 1ZOYB 5LXIB 2K8CA 4LNNA 1WE7A 2Z0EB 2MKRA 3L54A 4TQ1A 2AL3A 1G6JA 1FRDA 2RGFA 2BB6A 1RM6C 1EO6A 2VSZA 2RDGA 2GCLA 4II3B 2MLBA 1RLFA 1FCLA 4IG7B 3W1SA 1D4BA 1WGYA 2C9WB 3OANA 2PMVA 4YXDB 2LOZA 3OG5A 3VVWB 4JPSA 5IRSA 4DHZB 1KZGA 5C16A 4RGOS 2QSDA 1V1PB 2ZKMX 2LFIA 5C3JB 1ZYIA 1GNUA 1GC7A 4MH8A 4ZHOA 2LEKA 2HD5B 5C2TB 1BT0A 4G3XB 3AM9A 3H8HA 3RCZA 2KMCA 2QEJC 1GOZA 2G4SA 1E8XA 2D9ZA 4IOYX 4LNFA 1TS3A 5EFXA 3U4EG 1MPHA 2PVGC 1P5TA 4ANUA 1KH0A 4MGYE 2KX3A 5KQ1A 3WA0A 4RNAA 3ZXRA 2CQUA 3B9JA 1IPGA 3UZTA 2BKRB 1GC6A 3KVFB 5H8YE 4ARCA 5CHWA 1FM0D 3Q8AA 4GZUA 3FP5A 1XKEA 1R4NB 1UF0A 2RR9A 2BTEA 2Z4DA 2KCJA 2IGHA 1ZE3D 2LVPA 2AYOB 2K22A 4AOFA 3L17A 1SIFA 2GBMA 3IG3A 2BQQA 1HXYD 1W1DA 5JXVA 3FVCA 3UGBB 2ZNVB 1C78A 1ZVRA 1N63A 1LB1A 3A9JB 3KH0A 4L1BA 5CTRC 3VR9B 4M0WB 1KTKA 3LJ3A 2KUPA 2MWNB 1NYRA 3PLVA 1WR1A 2SEBD 5D2MB 5GMVA 2N0YA 2KKCA 4D0NB 2LVQA 4JQWC 3W2DA 3MFGA 4DX8A 2FJLA 4MM3B 3Q8CA 4TSSA 1K51A 1EU3A 1UWXA 2IYBA 2N7DA 2KJRA 2RGNB 3P1MA 1QOGA 4WJ7A 3T8MA 3QX1A 2HRJA 3VFKA 4BBKA 2W2WA 5LG4B 2O6VB 3R66C 4OVVA 3O65B 4H8SA 3VTVA 1L2NA 2ZNVC 3ZQ4A 1HBKA 5FKAC 2FBWB 2QCZA 2DYMA 4A3OA 2MBOA 1N6ZA 3BYYB 5JLJB 3SFEB 3S2AA 4F8CB 4IAPA 2J0JA 1FO4A 1AW7A 2KMMA 1WF9A 1ET9A 4K17A 1EUVB 2DBYA 5D6JB 3LXFA 3AE7B 4NQKE 2BWFA 2DZJA 4OVUA 3V5WA 4CO7A 1KBLA 2KX0A 2W55A 1XCQL 1F77A 3M63B 2OOBB 5IP4D 2ZCCA 2IJ0A 3ZVRA 4JE3B 2PE6B 2NZ8B 1OQRA 2L32A 1ET6A 1V61A 1RAXA 5D94A 4MELA 4KIKA 2BF8B 5BMIA 2G1EA 2NBVB 3DWGC 5LONB 1HQRD 1YN5A 4G0NB 2DIKA 4HKZE 3A9JA 4AP4C 2K39A 4WURA 1ZUD2 4ZRPA 2JRIB 2KDMA 5J17A 2WXJA 4RM9A 4C56C 2BWES 3UIOB 4FJVB 3SU8X 1A70A 1C79A 1ACCA 2KO3A 2FJ9A 1E7VA 3VH3B 1T0YA 5HFYA 3KUZA 1UH6A 2R2OA 1TS2A 1GJZA 4FJZA 1PGAA 2ONQA 1I7AA 2LG1A 2PVOD 2WXKA 3AU5A 2FCMA 2KQ4X 3BWUD 1WJ1A 4MEMA 1PFJA 4A3PA 1E8WA 4KGRA 4NNJB 4WWNA 2XN9C 2JU6X 3A4SC 1I4PA 2O6VA 1TY0A 1N5XA 2O6VD 1RRBA 4C7YA 2B76B 3BJIA 4GIVA 2Y3AA 2LRUA 4B0MA 2UYZB 1VRAB 3WAPA 1FOEA 2GUMA 3TEXA 2I5CA 1DGJA 4FULA 4GOUA 5IOIA 3AEBB 2W82A 5J18A 2QC8A 2M14A 3B2GA 2GBRA 3PSCA 3JW0X 3Q8BA 3T06A 2CKHB 3NZSA 3PGEA 1OQQA 5JP4A 2K00A 1I4QA 2KZRA 5IN7A 1KM7A 3RNBC 5EE1A 2FNJB 3NVYA 2P0FA 3TEWA 4XWTA 1J8CA 4IDIA 4JKBA 5BYSA 2ABDA 2FCNA 4USAA 2L00B 3FEHA 4GDKA 2KGXB 2PPHA 2L8JA 2Z0PA 1C4CA 4MJSA 4IKGA 4AQ7A 1WXVA 1E7UA 4B6HA 3C0RB 1AN8A 2DENB 2DWQA 1QKZA 3QHTA 3D8FA 2X8XX 3DBLI 4ILJA 3VH4B 3W5VB 2K49A 2OQBA 1PGBA 3PS6A 1VCBA 4TYZA 4OZBA 2LGYA 3N20C 5LNK1 1YQ3B 1N62A 5E6JA 1UBIA 2NCNA 2REXA 2NMBA 4K7WA 4JKDA 2BYEA 3CWIA 3X23A 1YX6B 3UF8A 2PE9A 1C3TA 4DHJB 2KVZA 2KWVB 3NY5A 1XCTL 3AE4B 2WDQB 1OQYA 3PZDA 3BYTB 1F52A 1T0SC 1YQ4B 1XQQA 3ZRCA 4GDLB 4HSIA 2Z0DB 1UELA 5KHOA 2JSVX 1SJHD 2YT1A 2KMAA 1WM2A 3H9DA 5HE0A 3AMZA 4ILGB 2KFJA 2O2VA 4LK0M 3DHGC 1YIWA 1JWMD 2V3NA 4WSFA 3NOBA 2WX0A 4HPMB 2C7HA 3X0WA 2KD0A 1YMHE 4HXDA 1DDMA 3NHEB 1V5UA 3E66A 2D3GA 3P7ZA 3OAWA 1PGXA 2IBIB 4BOSC 2I2YA 4RMAA 1SB3C 2QJLA 1F2RC 4MSQB 2L2IA 5JHBA 3G9WA 4KAXB 3P63A 4H2AA 1JWAD 1P9DU 1UZXB 3DPDA 2RSGA 5L83A 2LJIA 2DZIA 3DXEA 2LGIA 4AJYB 2MA9B 1Q0WB 3HSAA 3ODOA 3V3XA 4KV2A 2MCNB 1PFDA 2K9XA 4PYZA 4QAYA 4FA6A 3F0WA 4Z2NA 1EWCA 2IZVB 2N9PC 3T3OA 5GXGB 4C80A 2LOXA 1FNWA 1WJMA 3ENBA 1U4AA 4HAWB 3DXDA 2WWZA 2Y5PA 2LMCA 5CLQB 5LXHA 3MJWA 4HROA 5BYRA 4DHJD 1WYWB 2G3QB 1QZEA 2IO3B 1SSNA 1MHXA 2K2UA 1LO5D 4ZRJA 2H7EA 1I2HA 4REZA 1JMLA 1MAIA 4GDLA 3QJZA 2MP2B 1SEBD 1NVID 1AWEA 3CF6E 1C76A 1GPXA 1EAZA 4YSYB 5LOPB 1ROEA 2IY1B 4RGMA 4DHZE 2AL6A 1V86A 1VZ7A 4ILHA 2W3RA 4IM0A 1QOBA 1DDVA 2DTCA 4BBNF 2EJ8A 3MP9A 2KIGA 4XGAB 1V89A 4XZ4A 5IO9A 2L7RA 2J52A 1JW9D 1LM8B 2CR5A 3V60A 3APDA 3SDLC 4GB9A 2Y5BB 1KLGD 5D3DA 2N9KA 2YVCA 3PG7A 3V05A 2KWUB 3AXCA 2I1KA 2R09A 1RWSA 3P2BA 1D6EC 1D5ZC 2YEPF 3ZDMC 4GMVA 2FUHB 4YSZB 4PQ0A 1J7BA 1YNTE 1FRRA 2RDBC 3C19A 2JVCA 3DHHC 1OY2A 2J53A 4ICVA 5DIFB 2D4QA 2YT0A 2K6QA 3SBTA 4HAUB 4FXCA 4GMXB 2DAJA 1MPEA 2KQ7A 3AE8B 4TMAB 1CQVA 1GB1A 4KSKC 5DH9B 3V6CB 4W9DA 2WXNA 1FGZA 3RN9C 2D9XA 3ZJTA 3TO1A 2FJUB 3DVNV 1VZ6A 1D5MC 1PUTA 1ISNA 4BKSD 1FCCC 3DOWA 1V9JA 2JXXA 1V5PA 1J7CA 1P7FA 4WJPA 3DDCB 3I57A 4E74A 2DA0A 2RUKB 1JWUD 3ZNZB 3D8DA 1NTIA 2KYWA 1DROA 2ZJDA 2X38A 5HE3A 1UNSA 1ZXIA 3AU4A 1JQ4A 3W1SC 4ANVA 5AZHA 3U12A 3MHSD 4WWOA 4BOZB 1FFUA 1E7PB 3HUIA 2CU1A 5L95C 4YT0B 3VUWA 5C23A 4NAMA 5J2RA 4I6NB 3RNAC 2M38A 5C6RA 2BS4B 3IFWB 4RH6A 1M4VA 3B2FA 4PT5A 4DBGA 1DIKA 3FM8C 2N0SB 4O1NA 4HAVB 2KTFA 3SHQA 3HM3A 5G5GA 3P4PB 3R2IA 5JZEB 4K2PA 2KXJA 1PQSA 1HB6A 3U52E 3F5RA 1WY8A 3UQAA 2WNMA 5L81A 4MGZE 4OZCA 3RNCC 2INNE 1FHOA 5DPSA 2JX5A 2R2YA 2KUQA 2XK5A 1YJIA 4RFBA 2KT7A 1SE4A 3AV8A 2YRYA 2JUOA 4E71A 3Q14C 3EPYA 4MSMB 3QIJA 4KDIC 5G5HA 2Z0QA 4HPPA 3E56A 1MJDA 3PZ8A 1FFVA 4ASWC 2Q13A 4XC2A 4BKGA 2VRRB 1WYGA 2BYVE 3N1ZC 1XLPA 1WJUA 1KC7A 1WGDA 1WR6E 1E0ZA 1OEYA 1XX0A 1TY2A 2XNAC 2AQ3B 4YSXB 2OJWA 4CQNA 3EHVA 4NJ6A 3FLVA 3GZNI 4K1RB 2KFKB 2LWPA 4HKQA 3FSSA 1XF5L 3ZJVA 4A6QA 1MK7B 4ZYSA 1SF0A 2MBEA 5C5BA 2IDYA 3ZUNA 2ZPYA 3PP2A 4K7SA 4W9HA 4YTMB 2Y8FA 1WG7A 1EU4A 1WJNA 3FC4A 1X1MA 4MT7A 2K1FA 4WAAA 2H88B 4KDLB 4DBBA 3TSSA 2CY5A 1B1ZA 1TKEA 5FI1A 2QILA 4L23A 4LLGM 1M94A 5DPTA 2RVBB 5BMGA 3KWLA 4ARIA 4KIKB 2ACZB 2KJ6A 3PHXB 2LXCA 3ZYYX 3SYXA 3ENEA 4EE2A 2SAKA 4UDUC 4OT1A 2M1MA 1ZW7A 3A8PA 2CS4A 4AWJA 5HI1A 2A5UA 2G9HD 4Y94A 1UNPA 3VHTC 3DQVA 2M0XA 1OGWA 1TYGB 4ACFA 2R2QA 1UNRA 2G35A 3TEYA 4L1RA 3JVZX 1MIXA 4YL8A 2KHWB 3VRAB 1TKGA 2FAZA 3DBRI 3JYUA 1Q5WB 3WIMA 3ECIA 4BFRA 4A5KA 3VRBB 2DYQA 3BK2A 5JHGA 4EKUA 5AUIA 1UPQA 4CHMA 1WMHA 2JZPA 3TEZA 1OQNA 4K3CA 1KFYB 1LFDA 2WXRA 4XWWA 5E6OA 3UQBA 2AQ2B 1N61A 3NWAA 2MHJA 2Y8GA 4HRSA 3RYTA 1F9JA 2C7MB 3TL5A 4RGNA 1WWTA 1GB4A 2V1YA 2KFKA 2N1VA 1ST7A 1UD7A 1YN4A 3R2TA 3KRWA 2Z14A 1L6UA 2PZ1A 1NI3A 1FXAA 4ZRQA 1WXMA 1NI2A 3RI7C 4DXAB 4EEWA 3GP7A 4HHVA 4JKGA 4JKCA 2QKMA 1OMWA 2R82A 3KY9A 3ZNGC 3A1QB 2JY6A 3KUCB 1L0VB 2LYDA 1BTNA 2VRWB 3V62A 4WQMA 2N23A 4HCNB 1J0GA 3VIAA 2JT4B 2K2JA 4PYUA 2XEWA 2W9NA 3QAQA 2E3TA 3QK0A 1FHXA 5E6PA 4GDKB 3EC8A 3AULA 3VDZA 4M8MA 2BW2A 2FUG1 2OEDA 1XT9B 3NWFA 4ICUA 1FAOA 4MJSB 4C00A 1GG3A 1TIFA 4FADA 4W9FA 3ZRFA 2KLCA 5D3IB 5HHDG 3ODXA 3EUB2 4NQLB 3PEGA 1WM3A 3SR6A 1TXDA 3T3NA 3NW8A 5DCNA 2EKIA 1W1GA 2D3AA 3KUDB 3AEGB 4XE0A 4JL9A 3U30A 3TIXA 2ROVA 1WSPA 2COPA 2WXGA 3BK1A 3Q3MC 3GZNB 2HTHA 2DHIA 5FI0A 5E6NA 4TV3A 2L0TA 5M4YB 3V61A 1TS5A 1DBHA 2UZRA 2FCSA 1R4MI 2CHZA 4TQ0A 3OJ3A 4A9AA 1GUAB 1BMLC 2DZKA 2K6DB 3CIRB 4ZRIA 1HA5A 4HEA1 3KSYA 2CB8A 3SO6A 2LHDA 3CMMB 5HE1A 4BKTA 4YTNB 1AARA 2LGXA 4F7ZA 1WVHA 4F1SA 1UPRA 2K8EA 2M8SA 1UEFA 3R7RA 4LCDE 2LUMA 2Z59A 3N1YC 2WXPA 1WX8A 4RCOA 2AWTA 1AYFA 3AEEB 3KWVA 4HJGE 4MGIE 1JDEA 2MH7A 2O2VB 4DDID 3A1QA 1WI1A 2J59M 2YS5A 3PLUA 2L83A 1Z5SB 4JLCA 1ESFA 1TBEA 3SD5A 2OJRA 1T6BX 3RZWC 3AB5A 2Z13A 3BINA 3TFMA 4EOYA 1OEYJ 2ZVOA 1WZ0A 1J19A 5D3VA 3CIKA 4WH4A 5FR3A 1E9MA 3DBRB 5CHVC 3PZ7A 1JCKB 3GYPA 1WIAA 3TBLD 1TJ6A 2P8VA 4GLSC 2GS0A 2EC1A 3IT4B 1K5DB 1QQGA 3DCXA 2AEHA 1T77A 3LB8C 4II2B 4KVGB 2M0AA 3ABVB 2NVUI 2ZEQA 1Q1OA 2NBUA 1I7HA 4LJOB 3AE5B 2J0MA 3PVWA 1IBXA 3MC9A 5DHAB 1VZ8A 5AZGA 3K9OB 2D9YA 2D3CA 2R0DA 3AE9B 4ZHPA 2KN4A 4K3BA 2JYEA 3VUYA 1FNVA 5D3XA 1P98A 1E8YA 3ZO5B 2N9XA 2DHJA 3K9PB 3MC8A 1WGGA 2B3AA 3RPFC 2PTLA 1A5RA 3PTFC 3B0AA 1TQZA 1FNUA 2LULA 5AEKB 1I42A 1Y8RC 4FLHA 4GU2A 3SV1A 3QA8A 4GSWA 1NENB 2K5PA 4GN1A 2FCQA 2PIAA 1VLBA 4A90A 1JROA 2NTTA 1V49A 3SFDB 3WANA 1ZC4B 2JPHA 2DNFA 3WAOA 3I3TB 1ACAA 1KLUD 2OHFA 3ML9A 1WGUA 2CJNA 2BS3B 2LZ6A 1PDXA 1XXGA 4OW0A 2MSED 5AZFA 3E9OA 1UUPA 1SBBB 4PNKA 2LKOA 4GGQA 2MBBB 3FKYA 5CLLB 1WX9A 2DN6A 2BS2B 2GCJA 1Z2MA 1WZ3A 4KKIA 3Q6BA 2ON8A 3C8YA 3B77A 4MK0A 4JIOU 2H89B 2COCA 2KJHB 1L7YA 3NJTA 1UBQA 1WE6A 4EMOA 3TMPB 1OTRB 1VJKA 2JZZA 2I38A 4IW0A 4GNKB 1TTNA 3MDBC 3ULBA 2KK8A 2CAYA 3R7QA 4RM8A 1S1QB 1UWMA 1MG4A 3ZJUA 3RMKC 3W9CB 1R4MB 2A4ZA 5MPOA 2UWQA 1QLBB 3WAMA 1P0RA 3KZ1A 2DKPA 3DHIC 5G55A 2QIEB 3U7DA 3VAWA 3OLMD 1E5WA 2CY4A 1JRUA 2D11A 1NYQA 2WDTB 3O13A 2MQJA 2M19A 2X0SA 3L0WB 2MFQA 3SEBA 1V81A 2RMMA 1WGKA 1YD8U 1AQCA 2IO2B 4LJPB 3KLSX 1NEKB 3FILA 1E10A 3IBEA 2JWUA 5HKHA 1X05A 1K53A 3BVZA 4EFOA 2VZKB 4W9JA 1C9FA 3L16A 3A4RA 5IAAC 2WQYB 4ZDVA 3QBVB 3N9YC 3MJ5A 3ZIMA 4N59A 1KOTA 3VTWA 1P7EA 3AN1A 4E3CA 3N32A 4ANWA 1MI1A 1L0XB 4EZKA 1SGHA 1QILA 4N6EB 4BZAA 4JK9A 4KKJA 2BYTA 3EFUA 3ETRA 2OTXA 1T3QA 2EKEC 1VD2A 2EMSA 3ZGZA 1WGHA 4EZLA 4AJWA 3ONSA 4K2OA 5TR5A 3ODWA 4IWQA 2J4XA 4A6FA 3E9PA 4CSQA 3PT2B 3ZDTA 3D32A 3PPAA 2W3SA 3P6AA 2BYFA 5BMHA 3AE2B 1C4PA 4M02A 2ZW1A 3DBSA 4C4VA 3ZKJC 1H10A 2GJYA 1K8RB 2XK5B 3DVNU 3HRDD 2D07B 2IGDA 3DBLB 5FK9C 1L4DB 2E6XA 3BIID 3PHWB 2WX1A 3RZFA 1UNQA 1OFFA 3DXCA 1U5DA 4FJYA 2WU5B 3U8ZA 3A58A 1RFAA 3RNGC 3ZVVA 3IAM1 1WX7A 2BT6A 2V4IB 3AE3B 4US8A 2IPKD 4HB2B 4ITKA 5KCVA 2K8BA 4DX90 4HJKA 2LI5A 2V3PA 3R8BA 1N60A 1FXTB 1XLNA 2KWCA 4WJNA 2IGGA 5C79A 4W9IA 1N5WA 5D27A 2D2QA 1WFYA 1MK9B 2KDIA 5HG2A 1H4RA 1MKEA 2KR0A 1DYNA 5H92C 3NVWA 1EGXA 4IUMB 2W2XC 1P1AA 1GGOA 3T9LA 1M7EA 1ZGUB 1U27A 5C5BB 2KN5A 4KHBA 1V5TA 3RD2A 4J6IA 3P4RB 4B9KA 1LW3A 2NTSA 4WQOB 4LTUA 2IY0B 3BVMA 2D9WA 3L13A 4IM3A 1STEA 1X1GA 1CK1A 4JWUC 1IP9A 1JRPA 2LASA 3AE6B 3B1LX 1KJTA 2LVOA 4S0RA 1YOVB 5GOWB 4Z2MB 4MT5A 2Z0OA 3L10B 4XX5A 1FXIA 3R3MA 4MH0E 4IOIE 4NAWB 4MDKE 5G2NA 2HE7A 2BBCA 3PREA 2MDXA 3JSVA 2V3SA 4FHJA 2NR2A 4IFSA 1ZP0B 4US9A 2PEAA 2K25A 2MJEA 2D9VA 4MY6A 2D5GA 1SE9A 1LQBA 4KHAA 4TKNA 2AQ1B 2W2XD 2DYOA 1XD4A 1KI1B 2CU3A 3N3KB 4M8NA 5KHQA 2D10A 4QJ4B 3Q3JA 3AI5A 2AX5A 5KQ4A 3L4PA 1CZPA 2M56B 2WDVB 3DCGA 4OVZA 3P42A 4R3DA 2XBBC 4MACA 2HDEA 1BXTA 3NS8A 3OJ4B 2WXMA 2E2XA 1PMSA 3HM6X 3TJPA 4HAXB 4I6PA 4W9LA 3L08A 1B55A 2N7EA 4S17A 1WMHB 2C60A 3A8QA 1MFWA 2GBJA 2Z8LA 1U5EA 2INPE 2KTRB 4F7UP 2N4FA 4M00A 4AS1A 4JKAA 2KDFB 3MC0B 1K52A 5IJMA 3DVGY 2P0DA 4L6EA 4RF1A 2FIDA 2N7JA 4JKHA 5CX3A 1T0RC 3H7PA 1UGJA 2DX5B 1U5GA 1I4GA 4QXAB 3VUXA 1MIZB 1KLVA 2DFKA 3KYCD 2KANA 4OHJA 2Q5WD 3A33B 2WU2B 1U2BA 2DAFA 2K8HA 3APFA 1HZ6A 2GOWA 1SE2A 4K7UA 3GOEA 3RULA 1KF6B 2NPTA 3UI3A 2GBKA 2JXTA 1BTKA 4EJNA 4JKGB 4L2YA 1V5MA 2RDHA 3Q3NC 1LXDA 2LGSA 1ZKHA 1E90A 4WIPA 1XR0B 2COFA 4ZOHC 3J9CA 1ZSQA 4XDDA 3SUZA 5I2MA 1DYQA 2MRPA 5T8IA 4K81A 2VKIA 4IWOA 4BVUC 3HQCA 4KZ0A 3TW1A 2V4LA 4NAWA 2ZVNA 2J42A 1NDDA 1QOFA 2DKQA 3ZXVA 3NRZA 1WXSA 3W1YA 2WGSA 4P7IA 1N3HA 2DYBA 2JWZA 1E6EB 3Q3FA 3HVZA 3PO0A 1H8CA 1WJ4A 1FD6A 3WALA 3LYYA 1SXTA 2JRHA 4D2KA 1PLSA 2WXOA 4RF0A 2WP9B 3QWMA 2GRIA 2L3ZA 2VH1A 2NS5A 1L4ZB 4P16A 3RNFC 1HE8A 1R7SA 2WHIA 1S3SG 4PK1A 4FHKA 2KNBA 3SNHA 1TJEA 3ML8A 4WWMA 3AH7A 3HIZA 2HTHB 5DI9B 1TZ1A 3NVVA 3MHZA 1HEZE 3EFCA 2KTRA 3U2SC 1YJ1A 2FE8A 4YWGG 5C1ZA 1V80A 1SJED 2L1AA 1CMXB 2QKLA 2ADZA 3KW5B 3NVZA 1RFKA 1RYJA 1AWDA 2DX5A 1IGCA 4LNIA 2NBWB 1JWBD 2GMIC 1EF1A 1HTOA 5EE9A 3BY4B 3O96A 2RPVA 2I5FA 2JZ3B 2Z59B 4IC7B 2BVCA 4C0AA 3NUHB 1C4AA 3BZDB 1V1PA 2HTME 2LRWA 4Q2JA 3GS2A 3ZNHB 1JALA 2WH5A 4HB0B 1EVHA 1QOAA 2YLMA 2KVRA 1WXAA 3U7ZA 1QQRA 1NU2A 4I6LB 4HWIB 3QQ8B 4HAZB 5TSSA 1F2RI 1K5GB 5HE2A 2CJOA 2PJHA 4J3OD 3OWEB 4QJ3B 5LLIA 1ZPSA 2IO1B 5I4DA 1L0YB 4KGTA 3H6NA 2KC2A 4N58A 4HDQA 1BAKA 4JK8A 1NTVA 2YSZA 3VOQA 2JQRB 1NBFC 4P1BC 4F7HA 4NZLB 5J3TA 1Z87A 3ZNID 4TUUA 1W1HA 1ENFA 2WXHA 3Q3OC 2I1JA 5JH5C 3GYOA 5D3WA 3QARA 1IBXB 5D7GA 4DWFA 2LGDA 5BYQA 4BAXA 2PKOA 2ZPNA 3PVLA 3IT6B 2L05A 2KQSA 1ZDXA 2RSUA 2DLBA 4KGSA 3AJ4A 2DX1A 3A98B 1XCGA 1UGMA 2L76A 4M0WA 4WJQA 4N9F4 1TKYA 1IYFA 3OHMB 2DHKA 3KRXA 5DHFB 2BB5A 1Q10A 3P4QB 4MM3A 5JVLA 5EE3A 4FBJB 3FAHA 3WCQA 3I5JC 3VTUA 2N1WA 1MHHE 2L52A 1GAQB 2HJ1A 3AEAB 4W9KA 2WXQA 1HTQA 1XEEA 1TZOA 1IRSA 2TSSA 2N9LA 1SIJA 2FIFA 2MEKA 4ZYNA 4KSLC 1XD3B 2MX2A 2YT2A 2FDQA 4AUQC 2K0PA 1JWSD 2QDFA 3ML4A 5CHFA 4A20A 1I35A 2Y5CA 4CYEA 4JGHB 1C1YB 3BVGA 2D3BA 4CHKA 2YS1A 3EGRA 2NMQA 3H7SA
chains in the Genus database with same CATH topology
4HPLB 1MG8A 2M17A 1D3ZA 2J0KA 2ASQA 4KHOA 1ZM0A 2LUEA 2CHWA 2EMTA 3LDZE 4ZRKA 4GPTB 4WWPA 1WGQA 5FR6A 1FB8A 4HVBA 4A6HA 1SHCA 2MWSB 4X57B 2MBQA 4HCPB 3PRMB 1RJ2A 3ZLZA 3M95A 1TGZB 4GOCA 3EECA 3KYDD 4BBNC 4B6WA 3ULCA 1XODA 1FHWA 3UIPB 5EDSA 3N7CA 3SBGA 1P6SA 4W9GA 2M4NA 2N9EB 4F7GA 5IA7A 3LJUX 4HATB 1Y5OA 3QCAA 4LDTB 4DK5A 3D8EA 3QWZB 4JK7A 1V88A 1VBGA 3ZW3A 4XWXA 4A6FB 2KC1A 2ZZPB 2KDBA 1P3QU 2MBHA 4IM2A 2CHXA 2DHZA 3HK0A 2RLOA 3PV1A 2RD0A 2IYDB 5DPWA 2ZCBA 2KLGA 3NZUA 2BPSA 4MGKE 3N30A 2IFSA 1HB8A 1VBHA 3DBHI 4WJOA 4PS8A 3CSTA 2V76A 3M1IB 4FN2A 2ELBA 1ZC3B 1X86A 2XQNM 3M3JA 1V2YA 4HB4B 1KZ7A 1M7RA 4KZCA 4NJ7A 4GXBA 4EZJA 4JKFA 5J3QA 5D3YA 4KHBB 3TVVA 3MPXA 2J7QB 4A6KA 4G11A 3VQIA 1BWNA 4W9EA 4G50A 5DPRA 1P3RA 1QC6A 3HHMA 5BO4B 2IO0B 1NTYA 2C7NB 3PRPB 1U29A 4NY0A 1WI0A 2MW5A 3CSFA 3CXBB 2JP2A 2L1CA 4LDTD 1EF5A 3NSUA 3A9KB 3RCPA 4URKA 3JSVB 2KOXA 3IVFA 1V6EA 5JHAA 1U5FA 2RPQA 3RUIB 3E9LA 1Q67A 2LD9A 4IWPA 4W9CA 2ELAA 2L0FA 2CRFA 2X18A 4PS7A 5J3YA 5JHHA 3ZTCA 1YQBA 3RT3B 3PVUA 4HK2A 1R4NI 3QC8B 2ROZB 1J0WA 4EUTA 3HW2B 2DZMA 1WJ6A 2UVMA 2BCJA 3H7PB 2G45B 1YX5B 2G4DB 1WGRA 1E8ZA 4HDOA 3M62B 2H7DA 2KDEB 2UZSA 2JF5A 4HB3B 2C5LC 3DVGX 2RNRB 2NPTB 2QHOA 4CHJA 3WYFB 1WRDB 1X11A 2COAA 2DLWA 3H1UA 2P0HA 2LJ5A 4NPNA 3IHPC 4BKSA 2HJ8A 4B95A 4DDGD 1RRPB 3MTNB 3VXWA 3A9KA 4HAYB 2BGFA 2LXAA 3UINB 1Y19B 3ALBA 2DYNA 2RQ1A 1V5OA 2Y7BA 1DDWA 4ANXA 2MP2A 3APCA 3PSEB 2GBNA 3TCAA 1NVLA 3V6EB 4YONA 2CODA 1WH3A 4WVFB 4PS3A 4NSWA 2WYQA 2LBBA 2YS3A 3B08A 2BKFA 3PRZA 4HLEA 3ZTDA 1X1FA 1FGYA 4JKEA 2YF0A 5LXIB 2K8CA 1WE7A 2Z0EB 2MKRA 3L54A 4TQ1A 2AL3A 1G6JA 2RGFA 1EO6A 2VSZA 2GCLA 4II3B 2MLBA 1RLFA 4IG7B 3W1SA 1WGYA 2C9WB 3OANA 2LOZA 3VVWB 4DHZB 1KZGA 5C16A 1GNUA 1GC7A 2HD5B 1BT0A 4G3XB 3RCZA 2KMCA 2G4SA 1E8XA 2D9ZA 4IOYX 5EFXA 1MPHA 1P5TA 4ANUA 4MGYE 2KX3A 5KQ1A 3WA0A 2CQUA 1IPGA 3UZTA 2BKRB 1GC6A 3KVFB 5CHWA 4GZUA 3FP5A 1XKEA 2RR9A 2KCJA 2LVPA 2AYOB 4AOFA 3L17A 1SIFA 2GBMA 3IG3A 1W1DA 3UGBB 2ZNVB 1ZVRA 3KH0A 1LB1A 3A9JB 5CTRC 4M0WB 3LJ3A 2KUPA 2MWNB 3PLVA 1WR1A 5D2MB 5GMVA 2N0YA 2KKCA 4D0NB 2LVQA 4JQWC 4DX8A 2FJLA 2N7DA 2IYBA 2KJRA 2RGNB 4WJ7A 3T8MA 3QX1A 2HRJA 3VFKA 4BBKA 2W2WA 2O6VB 3R66C 4OVVA 3O65B 4H8SA 3VTVA 1L2NA 2ZNVC 1HBKA 2DYMA 4A3OA 2MBOA 5JLJB 3S2AA 4F8CB 4IAPA 2J0JA 1WF9A 4K17A 1EUVB 5D6JB 4NQKE 2BWFA 2DZJA 4OVUA 3V5WA 4CO7A 1KBLA 2KX0A 3M63B 2OOBB 2ZCCA 3ZVRA 2PE6B 2NZ8B 1V61A 1RAXA 5D94A 4MELA 4KIKA 2BF8B 2NBVB 5LONB 4G0NB 2DIKA 3A9JA 4AP4C 2K39A 2JRIB 5J17A 4RM9A 2BWES 3UIOB 4FJVB 3SU8X 2KO3A 2FJ9A 1E7VA 3VH3B 1T0YA 3KUZA 1UH6A 2R2OA 1GJZA 4FJZA 1I7AA 2LG1A 3AU5A 2FCMA 1WJ1A 4MEMA 1PFJA 4A3PA 1E8WA 4NNJB 4WWNA 3A4SC 2O6VA 2O6VD 1RRBA 3BJIA 4GIVA 2LRUA 2UYZB 3WAPA 1FOEA 2I5CA 4FULA 5J18A 2M14A 2GBRA 3PSCA 3JW0X 3T06A 2CKHB 3NZSA 3PGEA 5JP4A 2K00A 2KZRA 1KM7A 2FNJB 2P0FA 1J8CA 4JKBA 2ABDA 2FCNA 2L00B 3FEHA 4GDKA 2KGXB 2PPHA 2L8JA 2Z0PA 4MJSA 1WXVA 1E7UA 4B6HA 3C0RB 2DENB 3QHTA 3D8FA 3DBLI 4ILJA 3VH4B 2OQBA 3PS6A 1VCBA 4TYZA 2LGYA 1UBIA 2NCNA 2REXA 2NMBA 4K7WA 4JKDA 2BYEA 3X23A 1YX6B 3UF8A 2PE9A 1C3TA 4DHJB 2KWVB 3NY5A 1OQYA 3PZDA 1XQQA 3ZRCA 4GDLB 2Z0DB 1UELA 5KHOA 2YT1A 2KMAA 1WM2A 3H9DA 5HE0A 4ILGB 2KFJA 2O2VA 1YIWA 4WSFA 3NOBA 2WX0A 4HPMB 2C7HA 3X0WA 2KD0A 4HXDA 1DDMA 3NHEB 1V5UA 3E66A 2D3GA 3P7ZA 3OAWA 2IBIB 4BOSC 4RMAA 4MSQB 2L2IA 5JHBA 3G9WA 4KAXB 1P9DU 1UZXB 3DPDA 2RSGA 5L83A 2DZIA 3DXEA 4AJYB 1Q0WB 2MA9B 3ODOA 4KV2A 2MCNB 4PYZA 4FA6A 3F0WA 4Z2NA 2IZVB 2N9PC 2LOXA 1WJMA 3ENBA 1U4AA 4HAWB 3DXDA 2WWZA 5CLQB 5LXHA 3MJWA 4DHJD 1WYWB 2G3QB 1QZEA 2IO3B 2K2UA 4ZRJA 2H7EA 1I2HA 1MAIA 4GDLA 3QJZA 2MP2B 1AWEA 3CF6E 1EAZA 5LOPB 2IY1B 4DHZE 2AL6A 1V86A 4ILHA 4IM0A 1DDVA 2DTCA 4BBNF 2EJ8A 1V89A 4XZ4A 2L7RA 1LM8B 2CR5A 3V60A 3APDA 3SDLC 4GB9A 2Y5BB 2YVCA 3PG7A 2KWUB 3AXCA 2I1KA 2R09A 3P2BA 3ZDMC 4GMVA 2FUHB 4PQ0A 2JVCA 1OY2A 4ICVA 5DIFB 2D4QA 2YT0A 2K6QA 3SBTA 4HAUB 4GMXB 2DAJA 2KQ7A 4KSKC 5DH9B 3V6CB 4W9DA 1FGZA 2D9XA 3TO1A 3DVNV 1ISNA 4BKSD 3DOWA 1V9JA 2JXXA 1V5PA 4WJPA 3DDCB 4E74A 2DA0A 2RUKB 3ZNZB 3D8DA 1NTIA 1DROA 2ZJDA 5HE3A 3AU4A 3W1SC 4ANVA 5AZHA 3MHSD 4WWOA 4BOZB 2CU1A 5L95C 3VUWA 5C23A 5J2RA 4I6NB 2M38A 5C6RA 3IFWB 4DBGA 1DIKA 3FM8C 4HAVB 2KTFA 3SHQA 3HM3A 5JZEB 4K2PA 2KXJA 1PQSA 1HB6A 3F5RA 1WY8A 3UQAA 5L81A 4MGZE 1FHOA 5DPSA 2XK5A 2YRYA 2JUOA 4E71A 3EPYA 4MSMB 3QIJA 4KDIC 2Z0QA 4ASWC 2Q13A 4XC2A 4BKGA 2VRRB 2BYVE 1WJUA 1KC7A 1WGDA 1WR6E 1OEYA 1XX0A 3EHVA 4NJ6A 3FLVA 3GZNI 4K1RB 2KFKB 2LWPA 3FSSA 1MK7B 2MBEA 5C5BA 3ZUNA 2ZPYA 3PP2A 4K7SA 4W9HA 2Y8FA 1WG7A 1WJNA 1X1MA 4MT7A 2K1FA 4WAAA 4KDLB 4DBBA 2CY5A 5FI1A 1M94A 5DPTA 2RVBB 4KIKB 2KJ6A 3PHXB 2LXCA 3SYXA 3ENEA 2M1MA 1ZW7A 3A8PA 2CS4A 4AWJA 2A5UA 4Y94A 1UNPA 3VHTC 3DQVA 2M0XA 1OGWA 2R2QA 1UNRA 2G35A 3JVZX 1MIXA 4YL8A 2KHWB 2FAZA 3DBRI 3JYUA 1Q5WB 3WIMA 3ECIA 4BFRA 4A5KA 2DYQA 5JHGA 4EKUA 1UPQA 4CHMA 1WMHA 1OQNA 1LFDA 5E6OA 3UQBA 2Y8GA 3RYTA 1F9JA 2C7MB 3TL5A 2V1YA 2KFKA 2N1VA 1ST7A 1UD7A 3KRWA 2PZ1A 1WXMA 1NI2A 4DXAB 4EEWA 4HHVA 4JKGA 4JKCA 2QKMA 1OMWA 2R82A 3KY9A 3ZNGC 3A1QB 2JY6A 3KUCB 2LYDA 1BTNA 2VRWB 3V62A 2N23A 4HCNB 1J0GA 3VIAA 2JT4B 2K2JA 4PYUA 2XEWA 2W9NA 3QAQA 3QK0A 1FHXA 5E6PA 4GDKB 3EC8A 3AULA 3VDZA 4M8MA 1XT9B 4ICUA 1FAOA 4MJSB 1GG3A 4FADA 4W9FA 3ZRFA 2KLCA 3ODXA 4NQLB 3PEGA 1WM3A 1TXDA 5DCNA 1W1GA 3KUDB 4JL9A 3U30A 3TIXA 2ROVA 2COPA 2HTHA 2DHIA 5FI0A 5E6NA 4TV3A 2L0TA 3V61A 1DBHA 2UZRA 2FCSA 1R4MI 2CHZA 4TQ0A 3OJ3A 1GUAB 2DZKA 2K6DB 4ZRIA 3KSYA 2CB8A 3SO6A 3CMMB 5HE1A 4BKTA 1AARA 2LGXA 4F7ZA 1WVHA 4F1SA 1UPRA 2M8SA 1UEFA 3R7RA 4LCDE 1WX8A 2AWTA 4MGIE 1JDEA 2O2VB 4DDID 3A1QA 1WI1A 2J59M 2YS5A 3PLUA 1Z5SB 4JLCA 1TBEA 3SD5A 2OJRA 3RZWC 3BINA 3TFMA 4EOYA 1OEYJ 2ZVOA 1WZ0A 1J19A 5D3VA 3CIKA 5CHVC 3GYPA 1WIAA 3TBLD 1TJ6A 2P8VA 2GS0A 2EC1A 1K5DB 1QQGA 2AEHA 4II2B 4KVGB 2NVUI 2ZEQA 1Q1OA 2NBUA 4LJOB 2J0MA 3PVWA 5DHAB 5AZGA 3K9OB 2D9YA 2R0DA 3VUYA 5D3XA 1P98A 1E8YA 3ZO5B 2N9XA 2DHJA 3K9PB 1WGGA 2B3AA 1A5RA 3PTFC 3B0AA 1TQZA 1I42A 2LULA 5AEKB 1Y8RC 4FLHA 4GU2A 3SV1A 3QA8A 4GSWA 4GN1A 2FCQA 1V49A 3WANA 1ZC4B 2JPHA 3WAOA 3I3TB 1ACAA 3ML9A 1WGUA 2LZ6A 5AZFA 2MSED 3E9OA 4PNKA 2LKOA 4GGQA 2MBBB 5CLLB 1WX9A 2DN6A 2GCJA 1Z2MA 1WZ3A 4MK0A 4JIOU 2COCA 2KJHB 1L7YA 1UBQA 1WE6A 4EMOA 3TMPB 1OTRB 2JZZA 4IW0A 1TTNA 3MDBC 3ULBA 2KK8A 2CAYA 3R7QA 4RM8A 1S1QB 2A4ZA 2UWQA 3WAMA 1P0RA 3KZ1A 2DKPA 5G55A 3U7DA 3VAWA 3OLMD 1E5WA 2CY4A 1JRUA 2D11A 2WDTB 2MQJA 2X0SA 3L0WB 2MFQA 1V81A 1YD8U 1AQCA 2IO2B 4LJPB 3IBEA 5HKHA 1X05A 4EFOA 4W9JA 3L16A 3A4RA 5IAAC 4ZDVA 3QBVB 3ZIMA 1KOTA 3VTWA 4E3CA 3N32A 4ANWA 4EZKA 1SGHA 4JK9A 3EFUA 2OTXA 2EKEC 1VD2A 2EMSA 1WGHA 4EZLA 4AJWA 3ONSA 4K2OA 5TR5A 3ODWA 4IWQA 4A6FA 3E9PA 3PT2B 3ZDTA 3D32A 3PPAA 3P6AA 2BYFA 3DBSA 3ZKJC 1H10A 2GJYA 1K8RB 2XK5B 3DVNU 2D07B 3PHWB 2WX1A 3RZFA 1UNQA 3DXCA 1U5DA 4FJYA 3U8ZA 1RFAA 3ZVVA 1WX7A 4HB2B 5KCVA 2K8BA 4DX90 4HJKA 2LI5A 1FXTB 2KWCA 4WJNA 5C79A 4W9IA 5D27A 2D2QA 1WFYA 1MK9B 2KDIA 1H4RA 1MKEA 1DYNA 1EGXA 4IUMB 2W2XC 1P1AA 1GGOA 3T9LA 1M7EA 1ZGUB 1U27A 5C5BB 2KN5A 1V5TA 3RD2A 4J6IA 4B9KA 1LW3A 4WQOB 2IY0B 2D9WA 3L13A 4IM3A 1X1GA 1IP9A 2LASA 3B1LX 1KJTA 2LVOA 5GOWB 4Z2MB 2Z0OA 3L10B 4XX5A 4MH0E 3R3MA 4NAWB 4MDKE 5G2NA 2HE7A 3PREA 2MDXA 3JSVA 2V3SA 4FHJA 2NR2A 4IFSA 2PEAA 2K25A 2D9VA 4MY6A 1SE9A 1LQBA 4KHAA 4TKNA 2W2XD 2DYOA 1XD4A 1KI1B 3N3KB 4M8NA 5KHQA 2D10A 3Q3JA 3AI5A 5KQ4A 3DCGA 2XBBC 3NS8A 3OJ4B 2E2XA 1PMSA 3HM6X 3TJPA 4HAXB 4W9LA 4I6PA 3L08A 1B55A 2N7EA 1WMHB 2C60A 3A8QA 2GBJA 1U5EA 2KTRB 4F7UP 2N4FA 4JKAA 2KDFB 5IJMA 3DVGY 2P0DA 4L6EA 2FIDA 4JKHA 5CX3A 3H7PA 2DX5B 1U5GA 3VUXA 1MIZB 1KLVA 2DFKA 3KYCD 2KANA 3A33B 1U2BA 2DAFA 2K8HA 3APFA 2GOWA 4K7UA 3GOEA 3RULA 2NPTA 2GBKA 1BTKA 4EJNA 4JKGB 1V5MA 1LXDA 1ZKHA 1E90A 1XR0B 2COFA 1ZSQA 3SUZA 2MRPA 4K81A 2VKIA 4IWOA 4BVUC 3HQCA 4KZ0A 3TW1A 2V4LA 4NAWA 2ZVNA 1NDDA 2DKQA 1WXSA 3W1YA 4P7IA 1N3HA 2DYBA 2JWZA 3Q3FA 1H8CA 1WJ4A 3WALA 2JRHA 1PLSA 3QWMA 2L3ZA 2NS5A 1HE8A 1S3SG 4FHKA 2KNBA 3SNHA 3ML8A 3HIZA 2HTHB 5DI9B 1TZ1A 2KTRA 1YJ1A 5C1ZA 1V80A 1CMXB 2QKLA 2ADZA 3KW5B 2DX5A 2NBWB 2GMIC 1EF1A 3BY4B 3O96A 2I5FA 2JZ3B 2Z59B 4IC7B 4C0AA 2LRWA 3ZNHB 2WH5A 4HB0B 1EVHA 2YLMA 2KVRA 1WXAA 1NU2A 4I6LB 4HWIB 3QQ8B 4HAZB 1K5GB 5HE2A 2PJHA 5LLIA 2IO1B 3H6NA 2KC2A 4HDQA 1BAKA 4JK8A 1NTVA 2YSZA 3VOQA 1NBFC 4F7HA 5J3TA 1Z87A 3ZNID 4TUUA 1W1HA 2I1JA 5JH5C 3GYOA 5D3WA 3QARA 5D7GA 4DWFA 2LGDA 2ZPNA 3PVLA 2L05A 2KQSA 2RSUA 3AJ4A 2DX1A 3A98B 1XCGA 1UGMA 4WJQA 2L76A 4N9F4 1IYFA 2DHKA 3KRXA 5DHFB 4MM3A 5JVLA 4FBJB 3VTUA 2N1WA 4W9KA 1IRSA 2FIFA 4ZYNA 4KSLC 1XD3B 2MX2A 2FDQA 4AUQC 3ML4A 5CHFA 4A20A 1I35A 4JGHB 4CYEA 1C1YB 4CHKA 2YS1A 3H7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPL B;  1MG8 A;  2M17 A;  1D3Z A;  2J0K A;  2ASQ A;  4KHO A;  1ZM0 A;  2LUE A;  2CHW A;  2EMT A;  3LDZ E;  4ZRK A;  4GPT B;  4WWP A;  1WGQ A;  5FR6 A;  1FB8 A;  4HVB A;  4A6H A;  1SHC A;  2MWS B;  4X57 B;  2MBQ A;  4HCP B;  3PRM B;  1RJ2 A;  3ZLZ A;  3M95 A;  1TGZ B;  4GOC A;  3EEC A;  3KYD D;  4BBN C;  4B6W A;  3ULC A;  1XOD A;  1FHW A;  3UIP B;  5EDS A;  3N7C A;  1P6S A;  4W9G A;  2M4N A;  2N9E B;  4F7G A;  5IA7 A;  3LJU X;  4HAT B;  1Y5O A;  3QCA A;  4LDT B;  4DK5 A;  3D8E A;  3QWZ B;  1V88 A;  3ZW3 A;  4XWX A;  4A6F B;  2KC1 A;  2ZZP B;  2KDB A;  1P3Q U;  2MBH A;  4IM2 A;  2CHX A;  2DHZ A;  3HK0 A;  2RLO A;  3PV1 A;  2RD0 A;  2IYD B;  5DPW A;  2ZCB A;  2KLG A;  3NZU A;  2BPS A;  4MGK E;  3N30 A;  2IFS A;  1HB8 A;  3DBH I;  4WJO A;  4PS8 A;  3CST A;  2V76 A;  3M1I B;  4FN2 A;  2ELB A;  1ZC3 B;  1X86 A;  2XQN M;  3M3J A;  1V2Y A;  4HB4 B;  1KZ7 A;  1M7R A;  4KZC A;  4NJ7 A;  4GXB A;  4EZJ A;  5J3Q A;  5D3Y A;  4KHB B;  3TVV A;  3MPX A;  2J7Q B;  4A6K A;  4G11 A;  3VQI A;  1BWN A;  4W9E A;  4G50 A;  5DPR A;  1P3R A;  1QC6 A;  3HHM A;  5BO4 B;  2IO0 B;  1NTY A;  2C7N B;  3PRP B;  1U29 A;  4NY0 A;  1WI0 A;  2MW5 A;  3CSF A;  3CXB B;  2JP2 A;  2L1C A;  4LDT D;  1EF5 A;  3NSU A;  3A9K B;  3RCP A;  4URK A;  3JSV B;  2KOX A;  3IVF A;  1V6E A;  5JHA A;  1U5F A;  2RPQ A;  3RUI B;  1Q67 A;  2LD9 A;  4IWP A;  4W9C A;  2ELA A;  2L0F A;  2CRF A;  2X18 A;  4PS7 A;  5J3Y A;  5JHH A;  3ZTC A;  1YQB A;  3RT3 B;  3PVU A;  4HK2 A;  1R4N I;  3QC8 B;  2ROZ B;  1J0W A;  4EUT A;  3HW2 B;  2DZM A;  1WJ6 A;  2UVM A;  2BCJ A;  3H7P B;  2G45 B;  1YX5 B;  2G4D B;  1WGR A;  1E8Z A;  4HDO A;  3M62 B;  2H7D A;  2KDE B;  2UZS A;  2JF5 A;  4HB3 B;  2C5L C;  3DVG X;  2RNR B;  2NPT B;  2QHO A;  4CHJ A;  3WYF B;  1WRD B;  1X11 A;  2COA A;  2DLW A;  3H1U A;  2P0H A;  2LJ5 A;  4NPN A;  3IHP C;  4BKS A;  2HJ8 A;  4B95 A;  4DDG D;  1RRP B;  3MTN B;  3VXW A;  3A9K A;  4HAY B;  2BGF A;  2LXA A;  3UIN B;  1Y19 B;  3ALB A;  2DYN A;  2RQ1 A;  1V5O A;  2Y7B A;  1DDW A;  4ANX A;  2MP2 A;  3APC A;  3PSE B;  2GBN A;  3TCA A;  1NVL A;  3V6E B;  4YON A;  2COD A;  1WH3 A;  4WVF B;  4PS3 A;  4NSW A;  2WYQ A;  2LBB A;  2YS3 A;  3B08 A;  2BKF A;  3PRZ A;  4HLE A;  3ZTD A;  1X1F A;  1FGY A;  2YF0 A;  5LXI B;  2K8C A;  1WE7 A;  2Z0E B;  2MKR A;  3L54 A;  4TQ1 A;  2AL3 A;  1G6J A;  2RGF A;  1EO6 A;  2VSZ A;  2GCL A;  4II3 B;  2MLB A;  1RLF A;  4IG7 B;  3W1S A;  1WGY A;  2C9W B;  3OAN A;  2LOZ A;  3VVW B;  4DHZ B;  1KZG A;  5C16 A;  1GNU A;  1GC7 A;  2HD5 B;  1BT0 A;  4G3X B;  3RCZ A;  2KMC A;  2G4S A;  1E8X A;  2D9Z A;  4IOY X;  5EFX A;  1MPH A;  1P5T A;  4ANU A;  4MGY E;  2KX3 A;  5KQ1 A;  3WA0 A;  2CQU A;  1IPG A;  3UZT A;  2BKR B;  1GC6 A;  3KVF B;  5CHW A;  4GZU A;  3FP5 A;  1XKE A;  2RR9 A;  2KCJ A;  2LVP A;  2AYO B;  4AOF A;  3L17 A;  1SIF A;  2GBM A;  3IG3 A;  1W1D A;  3UGB B;  2ZNV B;  1ZVR A;  3KH0 A;  1LB1 A;  3A9J B;  5CTR C;  4M0W B;  3LJ3 A;  2KUP A;  2MWN B;  3PLV A;  1WR1 A;  5D2M B;  5GMV A;  2N0Y A;  2KKC A;  4D0N B;  2LVQ A;  4JQW C;  4DX8 A;  2FJL A;  2N7D A;  2IYB A;  2KJR A;  2RGN B;  4WJ7 A;  3T8M A;  3QX1 A;  2HRJ A;  3VFK A;  4BBK A;  2W2W A;  2O6V B;  3R66 C;  4OVV A;  3O65 B;  4H8S A;  3VTV A;  1L2N A;  2ZNV C;  1HBK A;  2DYM A;  4A3O A;  2MBO A;  5JLJ B;  3S2A A;  4F8C B;  4IAP A;  2J0J A;  1WF9 A;  4K17 A;  1EUV B;  5D6J B;  4NQK E;  2BWF A;  2DZJ A;  4OVU A;  3V5W A;  4CO7 A;  2KX0 A;  3M63 B;  2OOB B;  2ZCC A;  3ZVR A;  2PE6 B;  2NZ8 B;  1V61 A;  1RAX A;  5D94 A;  4MEL A;  4KIK A;  2BF8 B;  2NBV B;  5LON B;  4G0N B;  3A9J A;  4AP4 C;  2K39 A;  2JRI B;  5J17 A;  4RM9 A;  2BWE S;  3UIO B;  4FJV B;  3SU8 X;  2KO3 A;  2FJ9 A;  1E7V A;  3VH3 B;  1T0Y A;  3KUZ A;  1UH6 A;  2R2O A;  1GJZ A;  4FJZ A;  1I7A A;  2LG1 A;  3AU5 A;  2FCM A;  1WJ1 A;  4MEM A;  1PFJ A;  4A3P A;  1E8W A;  4NNJ B;  4WWN A;  3A4S C;  2O6V A;  2O6V D;  1RRB A;  3BJI A;  4GIV A;  2LRU A;  2UYZ B;  3WAP A;  1FOE A;  2I5C A;  4FUL A;  5J18 A;  2M14 A;  2GBR A;  3PSC A;  3JW0 X;  3T06 A;  2CKH B;  3NZS A;  3PGE A;  5JP4 A;  2K00 A;  2KZR A;  1KM7 A;  2FNJ B;  2P0F A;  1J8C A;  2ABD A;  2FCN A;  2L00 B;  3FEH A;  4GDK A;  2KGX B;  2PPH A;  2L8J A;  2Z0P A;  4MJS A;  1WXV A;  1E7U A;  4B6H A;  3C0R B;  2DEN B;  3QHT A;  3D8F A;  3DBL I;  3VH4 B;  2OQB A;  3PS6 A;  1VCB A;  4TYZ A;  2LGY A;  1UBI A;  2NCN A;  2REX A;  2NMB A;  4K7W A;  2BYE A;  3X23 A;  1YX6 B;  3UF8 A;  2PE9 A;  1C3T A;  4DHJ B;  2KWV B;  3NY5 A;  1OQY A;  3PZD A;  1XQQ A;  3ZRC A;  4GDL B;  2Z0D B;  1UEL A;  5KHO A;  2YT1 A;  2KMA A;  1WM2 A;  3H9D A;  5HE0 A;  2KFJ A;  2O2V A;  1YIW A;  4WSF A;  3NOB A;  2WX0 A;  4HPM B;  2C7H A;  3X0W A;  2KD0 A;  4HXD A;  1DDM A;  3NHE B;  1V5U A;  2D3G A;  3P7Z A;  3OAW A;  2IBI B;  4BOS C;  4RMA A;  4MSQ B;  2L2I A;  5JHB A;  3G9W A;  4KAX B;  1P9D U;  1UZX B;  3DPD A;  2RSG A;  5L83 A;  2DZI A;  3DXE A;  4AJY B;  1Q0W B;  2MA9 B;  3ODO A;  4KV2 A;  2MCN B;  4PYZ A;  4FA6 A;  3F0W A;  4Z2N A;  2IZV B;  2N9P C;  2LOX A;  1WJM A;  1U4A A;  4HAW B;  3DXD A;  2WWZ A;  5CLQ B;  5LXH A;  3MJW A;  4DHJ D;  1WYW B;  2G3Q B;  1QZE A;  2IO3 B;  2K2U A;  4ZRJ A;  2H7E A;  1I2H A;  1MAI A;  4GDL A;  3QJZ A;  2MP2 B;  1AWE A;  3CF6 E;  1EAZ A;  5LOP B;  2IY1 B;  4DHZ E;  2AL6 A;  1V86 A;  4IM0 A;  1DDV A;  2DTC A;  4BBN F;  2EJ8 A;  1V89 A;  4XZ4 A;  2L7R A;  1LM8 B;  2CR5 A;  3V60 A;  3APD A;  3SDL C;  4GB9 A;  2Y5B B;  2YVC A;  3PG7 A;  2KWU B;  3AXC A;  2I1K A;  2R09 A;  3P2B A;  3ZDM C;  4GMV A;  2FUH B;  4PQ0 A;  2JVC A;  1OY2 A;  4ICV A;  5DIF B;  2D4Q A;  2YT0 A;  2K6Q A;  4HAU B;  4GMX B;  2DAJ A;  2KQ7 A;  4KSK C;  5DH9 B;  3V6C B;  4W9D A;  1FGZ A;  2D9X A;  3TO1 A;  3DVN V;  1ISN A;  4BKS D;  3DOW A;  1V9J A;  2JXX A;  1V5P A;  4WJP A;  3DDC B;  4E74 A;  2DA0 A;  2RUK B;  3ZNZ B;  3D8D A;  1NTI A;  1DRO A;  2ZJD A;  5HE3 A;  3AU4 A;  3W1S C;  4ANV A;  5AZH A;  3MHS D;  4WWO A;  4BOZ B;  2CU1 A;  5L95 C;  3VUW A;  5C23 A;  5J2R A;  4I6N B;  2M38 A;  5C6R A;  3IFW B;  4DBG A;  3FM8 C;  4HAV B;  2KTF A;  3SHQ A;  3HM3 A;  5JZE B;  4K2P A;  2KXJ A;  1PQS A;  1HB6 A;  3F5R A;  1WY8 A;  3UQA A;  5L81 A;  4MGZ E;  1FHO A;  5DPS A;  2XK5 A;  2YRY A;  2JUO A;  4E71 A;  3EPY A;  4MSM B;  3QIJ A;  4KDI C;  2Z0Q A;  4ASW C;  2Q13 A;  4XC2 A;  4BKG A;  2VRR B;  2BYV E;  1WJU A;  1WGD A;  1WR6 E;  1OEY A;  1XX0 A;  3EHV A;  4NJ6 A;  3FLV A;  3GZN I;  4K1R B;  2KFK B;  2LWP A;  3FSS A;  1MK7 B;  2MBE A;  5C5B A;  3ZUN A;  2ZPY A;  3PP2 A;  4K7S A;  4W9H A;  2Y8F A;  1WG7 A;  1WJN A;  1X1M A;  4MT7 A;  2K1F A;  4WAA A;  4KDL B;  4DBB A;  2CY5 A;  5FI1 A;  1M94 A;  5DPT A;  2RVB B;  4KIK B;  2KJ6 A;  3PHX B;  2LXC A;  3SYX A;  3ENE A;  2M1M A;  1ZW7 A;  3A8P A;  2CS4 A;  4AWJ A;  2A5U A;  4Y94 A;  1UNP A;  3VHT C;  3DQV A;  2M0X A;  1OGW A;  2R2Q A;  1UNR A;  2G35 A;  3JVZ X;  1MIX A;  4YL8 A;  2KHW B;  2FAZ A;  3DBR I;  3JYU A;  1Q5W B;  3WIM A;  3ECI A;  4BFR A;  4A5K A;  2DYQ A;  5JHG A;  4EKU A;  1UPQ A;  4CHM A;  1WMH A;  1OQN A;  1LFD A;  5E6O A;  3UQB A;  2Y8G A;  3RYT A;  1F9J A;  2C7M B;  3TL5 A;  2V1Y A;  2KFK A;  2N1V A;  1ST7 A;  1UD7 A;  3KRW A;  2PZ1 A;  1WXM A;  1NI2 A;  4DXA B;  4EEW A;  4HHV A;  2QKM A;  1OMW A;  3KY9 A;  3ZNG C;  3A1Q B;  2JY6 A;  3KUC B;  2LYD A;  1BTN A;  2VRW B;  3V62 A;  2N23 A;  4HCN B;  1J0G A;  3VIA A;  2JT4 B;  2K2J A;  4PYU A;  2XEW A;  2W9N A;  3QAQ A;  3QK0 A;  1FHX A;  5E6P A;  4GDK B;  3EC8 A;  3AUL A;  3VDZ A;  4M8M A;  1XT9 B;  4ICU A;  1FAO A;  4MJS B;  1GG3 A;  4FAD A;  4W9F A;  3ZRF A;  2KLC A;  3ODX A;  4NQL B;  3PEG A;  1WM3 A;  1TXD A;  5DCN A;  1W1G A;  3KUD B;  4JL9 A;  3U30 A;  3TIX A;  2ROV A;  2COP A;  2HTH A;  2DHI A;  5FI0 A;  5E6N A;  4TV3 A;  2L0T A;  3V61 A;  1DBH A;  2UZR A;  2FCS A;  1R4M I;  2CHZ A;  4TQ0 A;  3OJ3 A;  1GUA B;  2DZK A;  2K6D B;  4ZRI A;  3KSY A;  2CB8 A;  3SO6 A;  3CMM B;  5HE1 A;  4BKT A;  1AAR A;  2LGX A;  4F7Z A;  1WVH A;  4F1S A;  1UPR A;  2M8S A;  1UEF A;  3R7R A;  4LCD E;  1WX8 A;  2AWT A;  4MGI E;  2O2V B;  4DDI D;  3A1Q A;  1WI1 A;  2J59 M;  2YS5 A;  3PLU A;  1Z5S B;  4JLC A;  1TBE A;  3SD5 A;  2OJR A;  3RZW C;  3BIN A;  3TFM A;  4EOY A;  1OEY J;  2ZVO A;  1WZ0 A;  1J19 A;  5D3V A;  3CIK A;  5CHV C;  3GYP A;  1WIA A;  3TBL D;  1TJ6 A;  2P8V A;  2GS0 A;  2EC1 A;  1K5D B;  1QQG A;  2AEH A;  4II2 B;  4KVG B;  2NVU I;  2ZEQ A;  1Q1O A;  2NBU A;  4LJO B;  2J0M A;  3PVW A;  5DHA B;  5AZG A;  3K9O B;  2D9Y A;  2R0D A;  3VUY A;  5D3X A;  1P98 A;  1E8Y A;  3ZO5 B;  2N9X A;  2DHJ A;  3K9P B;  1WGG A;  2B3A A;  1A5R A;  3PTF C;  3B0A A;  1TQZ A;  1I42 A;  2LUL A;  5AEK B;  1Y8R C;  4FLH A;  4GU2 A;  3SV1 A;  3QA8 A;  4GSW A;  4GN1 A;  2FCQ A;  1V49 A;  3WAN A;  1ZC4 B;  2JPH A;  3WAO A;  3I3T B;  1ACA A;  3ML9 A;  1WGU A;  2LZ6 A;  5AZF A;  2MSE D;  4PNK A;  2LKO A;  4GGQ A;  2MBB B;  5CLL B;  1WX9 A;  2DN6 A;  2GCJ A;  1Z2M A;  1WZ3 A;  4MK0 A;  4JIO U;  2COC A;  2KJH B;  1L7Y A;  1UBQ A;  1WE6 A;  4EMO A;  3TMP B;  1OTR B;  2JZZ A;  4IW0 A;  1TTN A;  3MDB C;  3ULB A;  2KK8 A;  2CAY A;  3R7Q A;  4RM8 A;  1S1Q B;  2A4Z A;  2UWQ A;  3WAM A;  1P0R A;  3KZ1 A;  2DKP A;  5G55 A;  3U7D A;  3VAW A;  3OLM D;  1E5W A;  2CY4 A;  1JRU A;  2D11 A;  2WDT B;  2MQJ A;  3L0W B;  2MFQ A;  1V81 A;  1YD8 U;  1AQC A;  2IO2 B;  4LJP B;  3IBE A;  5HKH A;  1X05 A;  4EFO A;  4W9J A;  3L16 A;  3A4R A;  5IAA C;  4ZDV A;  3QBV B;  3ZIM A;  1KOT A;  3VTW A;  4E3C A;  3N32 A;  4ANW A;  4EZK A;  1SGH A;  3EFU A;  2OTX A;  2EKE C;  1VD2 A;  2EMS A;  1WGH A;  4EZL A;  4AJW A;  3ONS A;  4K2O A;  5TR5 A;  3ODW A;  4IWQ A;  4A6F A;  3PT2 B;  3ZDT A;  3D32 A;  3PPA A;  3P6A A;  2BYF A;  3DBS A;  3ZKJ C;  1H10 A;  2GJY A;  1K8R B;  2XK5 B;  3DVN U;  2D07 B;  3PHW B;  2WX1 A;  3RZF A;  1UNQ A;  3DXC A;  1U5D A;  4FJY A;  3U8Z A;  1RFA A;  3ZVV A;  1WX7 A;  4HB2 B;  5KCV A;  2K8B A;  4DX9 0;  4HJK A;  2LI5 A;  1FXT B;  2KWC A;  4WJN A;  5C79 A;  4W9I A;  5D27 A;  2D2Q A;  1WFY A;  1MK9 B;  2KDI A;  1H4R A;  1MKE A;  1DYN A;  1EGX A;  4IUM B;  2W2X C;  1P1A A;  3T9L A;  1M7E A;  1ZGU B;  1U27 A;  5C5B B;  2KN5 A;  1V5T A;  3RD2 A;  4J6I A;  4B9K A;  1LW3 A;  4WQO B;  2IY0 B;  2D9W A;  3L13 A;  4IM3 A;  1X1G A;  1IP9 A;  2LAS A;  3B1L X;  1KJT A;  2LVO A;  5GOW B;  4Z2M B;  2Z0O A;  3L10 B;  4XX5 A;  4MH0 E;  3R3M A;  4NAW B;  4MDK E;  5G2N A;  2HE7 A;  3PRE A;  2MDX A;  3JSV A;  2V3S A;  4FHJ A;  2NR2 A;  4IFS A;  2PEA A;  2K25 A;  2D9V A;  4MY6 A;  1SE9 A;  1LQB A;  4KHA A;  4TKN A;  2W2X D;  2DYO A;  1XD4 A;  1KI1 B;  3N3K B;  4M8N A;  5KHQ A;  2D10 A;  3Q3J A;  3AI5 A;  5KQ4 A;  3DCG A;  2XBB C;  3NS8 A;  3OJ4 B;  2E2X A;  1PMS A;  3HM6 X;  3TJP A;  4HAX B;  4W9L A;  4I6P A;  3L08 A;  1B55 A;  2N7E A;  1WMH B;  2C60 A;  3A8Q A;  2GBJ A;  1U5E A;  2KTR B;  4F7U P;  2N4F A;  2KDF B;  5IJM A;  3DVG Y;  2P0D A;  4L6E A;  2FID A;  5CX3 A;  3H7P A;  2DX5 B;  1U5G A;  3VUX A;  1MIZ B;  1KLV A;  2DFK A;  3KYC D;  2KAN A;  3A33 B;  1U2B A;  2DAF A;  2K8H A;  3APF A;  2GOW A;  4K7U A;  3GOE A;  3RUL A;  2NPT A;  2GBK A;  1BTK A;  4EJN A;  1V5M A;  1LXD A;  1ZKH A;  1E90 A;  1XR0 B;  2COF A;  1ZSQ A;  3SUZ A;  2MRP A;  4K81 A;  2VKI A;  4IWO A;  4BVU C;  3HQC A;  4KZ0 A;  3TW1 A;  2V4L A;  4NAW A;  2ZVN A;  1NDD A;  2DKQ A;  1WXS A;  3W1Y A;  4P7I A;  1N3H A;  2DYB A;  2JWZ A;  3Q3F A;  1H8C A;  1WJ4 A;  3WAL A;  2JRH A;  1PLS A;  3QWM A;  2L3Z A;  2NS5 A;  1HE8 A;  1S3S G;  4FHK A;  2KNB A;  3SNH A;  3ML8 A;  3HIZ A;  2HTH B;  5DI9 B;  1TZ1 A;  2KTR A;  1YJ1 A;  5C1Z A;  1V80 A;  1CMX B;  2QKL A;  2ADZ A;  3KW5 B;  2DX5 A;  2NBW B;  2GMI C;  1EF1 A;  3BY4 B;  3O96 A;  2I5F A;  2JZ3 B;  2Z59 B;  4IC7 B;  4C0A A;  2LRW A;  3ZNH B;  2WH5 A;  4HB0 B;  1EVH A;  2YLM A;  2KVR A;  1WXA A;  1NU2 A;  4I6L B;  4HWI B;  3QQ8 B;  4HAZ B;  1K5G B;  5HE2 A;  2PJH A;  5LLI A;  2IO1 B;  3H6N A;  2KC2 A;  4HDQ A;  1BAK A;  1NTV A;  2YSZ A;  3VOQ A;  1NBF C;  4F7H A;  5J3T A;  1Z87 A;  3ZNI D;  4TUU A;  1W1H A;  2I1J A;  5JH5 C;  3GYO A;  5D3W A;  3QAR A;  5D7G A;  4DWF A;  2LGD A;  2ZPN A;  3PVL A;  2L05 A;  2KQS A;  2RSU A;  3AJ4 A;  2DX1 A;  3A98 B;  1XCG A;  1UGM A;  4WJQ A;  2L76 A;  4N9F 4;  1IYF A;  2DHK A;  3KRX A;  5DHF B;  4MM3 A;  4FBJ B;  3VTU A;  2N1W A;  4W9K A;  1IRS A;  2FIF A;  4ZYN A;  4KSL C;  1XD3 B;  2MX2 A;  2FDQ A;  4AUQ C;  3ML4 A;  5CHF A;  4A20 A;  1I35 A;  4JGH B;  4CYE A;  1C1Y B;  4CHK A;  2YS1 A;  3H7S A; 
#chains in the Genus database with same CATH topology
 4HPL B;  1MG8 A;  2M17 A;  1D3Z A;  2J0K A;  2ASQ A;  4A55 A;  4KHO A;  1ZM0 A;  2LUE A;  2CHW A;  1ZXH A;  2EMT A;  3AE1 B;  4YTP B;  3LDZ E;  4ZRK A;  3P4S B;  4GPT B;  1I4X A;  2YEP B;  4WWP A;  1WGQ A;  5FR6 A;  1QF6 A;  1FB8 A;  4HVB A;  4A6H A;  1SHC A;  2MWS B;  4X57 B;  2MBQ A;  2NBV A;  2KAJ A;  4HCP B;  2INC C;  3PRM B;  1RJ2 A;  2KWD A;  4D6W A;  1I4R A;  3ZLZ A;  3M95 A;  1TGZ B;  4GOC A;  3EEC A;  3KYD D;  4BBN C;  4B6W A;  1XLO A;  3ULC A;  2WDR B;  1XOD A;  3FIL B;  1HZ5 A;  1FHW A;  3UIP B;  1B9R A;  5EDS A;  3N7C A;  3SBG A;  3TUO A;  1P6S A;  1TS4 A;  4W9G A;  1WXQ A;  2M4N A;  2N9E B;  4F7G A;  4JX1 C;  5IA7 A;  1TT5 B;  3LJU X;  4NJC A;  4HAT B;  1Y5O A;  3QCA A;  2ICI A;  2V0G A;  4LDT B;  3AEC B;  1D5X C;  4DK5 A;  3D8E A;  2MJD A;  2MJ3 A;  3QWZ B;  1F1H A;  4JK7 A;  1V88 A;  1WRI A;  1XO3 A;  3IXS A;  1VBG A;  3ZW3 A;  4XWX A;  4A6F B;  2KC1 A;  2ZZP B;  2KDB A;  1P3Q U;  2MBH A;  4IM2 A;  1IGD A;  2CHX A;  2QMT A;  2RRF A;  2DHZ A;  3HK0 A;  4C4V B;  3KQ4 A;  4WAF A;  2KIE A;  2RLO A;  2RD0 A;  3PV1 A;  3RFZ B;  3NG0 A;  2IYD B;  5DPW A;  2ZCB A;  2KLG A;  3NZU A;  2BPS A;  4KX6 B;  4MGK E;  3N30 A;  2IFS A;  1HB8 A;  1VBH A;  3DBH I;  1CJE A;  1T0Q C;  4WJO A;  4PS8 A;  3NZ3 A;  3CST A;  2V76 A;  4DXF A;  1YN3 A;  3M1I B;  4FN2 A;  2LHE A;  3Q8F A;  2ELB A;  3I9V 1;  1QT9 A;  2UU7 A;  1ZC3 B;  1X86 A;  2XQN M;  1Y56 A;  1V8C A;  4LNO A;  1C77 A;  3M3J A;  1V2Y A;  4HB4 B;  1KZ7 A;  2VH2 A;  3GE3 C;  1M7R A;  2WXF A;  4KZC A;  3NWD A;  1MI0 A;  3AED B;  4NJ7 A;  1FMA D;  4GXB A;  4EZJ A;  5IKC M;  4JKF A;  4C7Z A;  1DOX A;  3IAS 1;  4LNK A;  5J3Q A;  5D3Y A;  1EM7 A;  4KHB B;  1L6V A;  3TVV A;  3MPX A;  2J7Q B;  2GI9 A;  4A6K A;  4P6V F;  4G11 A;  3GB1 A;  3VQI A;  1BWN A;  1I4H A;  1T5X D;  1DOY A;  4W9E A;  2WXL A;  4G50 A;  4M01 A;  1P3R A;  1QC6 A;  3HHM A;  5DPR A;  5BO4 B;  2IO0 B;  1NTY A;  2C7N B;  3PRP B;  1U29 A;  1K50 A;  4NY0 A;  1WI0 A;  4XYC A;  2GLS A;  2MW5 A;  3CSF A;  1ZDV A;  2IND C;  3CXB B;  2JP2 A;  2L1C A;  4LDT D;  1EF5 A;  3NSU A;  3A9K B;  3RCP A;  4URK A;  3JSV B;  2KOX A;  1VDV A;  3IVF A;  4OSN A;  1V6E A;  4XDC A;  1FEH A;  5JHA A;  1V97 A;  1U5F A;  2RPQ A;  1DOI A;  3RUI B;  3E9L A;  1Q67 A;  2W54 A;  2ZW0 A;  3NS1 A;  5AUK A;  3Q8E A;  2LD9 A;  4A8X C;  1EWY C;  4IWP A;  4QJ5 B;  4W9C A;  3Q69 A;  2ELA A;  2L0F A;  2CRF A;  2WLB A;  3URY A;  2X18 A;  4PS7 A;  5J3Y A;  5JHH A;  3ZTC A;  1J7A A;  1FPY A;  3VR8 B;  1YQB A;  3I63 C;  3RT3 B;  4RGT A;  4DXG A;  1IUE A;  3PVU A;  4HK2 A;  1SE3 A;  2K3U A;  1R4N I;  4P1C C;  3QC8 B;  3HVD A;  4JWS C;  2ROZ B;  3AEF B;  1LGR A;  1J0W A;  2GB1 A;  1XLQ A;  4EUT A;  3HW2 B;  1MVK A;  1YJJ A;  3Q2A C;  2DZM A;  1WJ6 A;  2UVM A;  2BCJ A;  2PLP A;  3H7P B;  2G45 B;  2KAC A;  5I2S A;  1BUI C;  1YX5 B;  2G4D B;  1WGR A;  3W5U B;  1E8Z A;  4HDO A;  3M62 B;  2H7D A;  2V9H A;  2KDE B;  2UZS A;  2JF5 A;  4HB3 B;  2C5L C;  3DVG X;  2RNR B;  1FIQ A;  2NPT B;  2QHO A;  4CHJ A;  3WYF B;  1WRD B;  4DQO C;  1X11 A;  2COA A;  2VZK D;  2WXI A;  2DLW A;  3H1U A;  2P0H A;  2LJ5 A;  1VR9 A;  4NPN A;  3IHP C;  4BKS A;  4B0E A;  2HJ8 A;  4B95 A;  4DDG D;  1L5P A;  1V1O A;  5EE0 A;  1RRP B;  3MTN B;  3VXW A;  3HIE A;  4DIX A;  1F0Z A;  3A9K A;  4HAY B;  2BGF A;  1KRH A;  2LXA A;  3UIN B;  1Y19 B;  1PYW D;  3DBH B;  3ALB A;  2DYN A;  2RQ1 A;  2R61 A;  1V5O A;  2EEL A;  2Y7B A;  3DWM A;  1DDW A;  3GE8 C;  3RNE C;  4ANX A;  2MP2 A;  3APC A;  3PSE B;  2GBN A;  3TCA A;  1NVL A;  3V6E B;  4YON A;  2COD A;  1WH3 A;  4WVF B;  4OZA A;  4PS3 A;  4NSW A;  2WYQ A;  2LBB A;  2YS3 A;  3B08 A;  2BKF A;  2PW9 A;  3PRZ A;  2WS3 B;  2JYT A;  3EA6 A;  3N1X C;  4HLE A;  3ZTD A;  1X1F A;  1FGY A;  4JKE A;  2YF0 A;  3E9S A;  1ZOY B;  5LXI B;  2K8C A;  4LNN A;  1WE7 A;  2Z0E B;  2MKR A;  3L54 A;  4TQ1 A;  2AL3 A;  1G6J A;  1FRD A;  2RGF A;  2BB6 A;  1RM6 C;  1EO6 A;  2VSZ A;  2RDG A;  2GCL A;  4II3 B;  2MLB A;  1RLF A;  1FCL A;  4IG7 B;  3W1S A;  1D4B A;  1WGY A;  2C9W B;  3OAN A;  2PMV A;  4YXD B;  2LOZ A;  3OG5 A;  3VVW B;  4JPS A;  5IRS A;  4DHZ B;  1KZG A;  5C16 A;  4RGO S;  2QSD A;  1V1P B;  2ZKM X;  2LFI A;  5C3J B;  1ZYI A;  1GNU A;  1GC7 A;  4MH8 A;  4ZHO A;  2LEK A;  2HD5 B;  5C2T B;  1BT0 A;  4G3X B;  3AM9 A;  3H8H A;  3RCZ A;  2KMC A;  2QEJ C;  1GOZ A;  2G4S A;  1E8X A;  2D9Z A;  4IOY X;  4LNF A;  1TS3 A;  5EFX A;  3U4E G;  1MPH A;  2PVG C;  1P5T A;  4ANU A;  1KH0 A;  4MGY E;  2KX3 A;  5KQ1 A;  3WA0 A;  4RNA A;  3ZXR A;  2CQU A;  3B9J A;  1IPG A;  3UZT A;  2BKR B;  1GC6 A;  3KVF B;  5H8Y E;  4ARC A;  5CHW A;  1FM0 D;  3Q8A A;  4GZU A;  3FP5 A;  1XKE A;  1R4N B;  1UF0 A;  2RR9 A;  2BTE A;  2Z4D A;  2KCJ A;  2IGH A;  1ZE3 D;  2LVP A;  2AYO B;  2K22 A;  4AOF A;  3L17 A;  1SIF A;  2GBM A;  3IG3 A;  2BQQ A;  1HXY D;  1W1D A;  5JXV A;  3FVC A;  3UGB B;  2ZNV B;  1C78 A;  1ZVR A;  1N63 A;  1LB1 A;  3A9J B;  3KH0 A;  4L1B A;  5CTR C;  3VR9 B;  4M0W B;  1KTK A;  3LJ3 A;  2KUP A;  2MWN B;  1NYR A;  3PLV A;  1WR1 A;  2SEB D;  5D2M B;  5GMV A;  2N0Y A;  2KKC A;  4D0N B;  2LVQ A;  4JQW C;  3W2D A;  3MFG A;  4DX8 A;  2FJL A;  4MM3 B;  3Q8C A;  4TSS A;  1K51 A;  1EU3 A;  1UWX A;  2IYB A;  2N7D A;  2KJR A;  2RGN B;  3P1M A;  1QOG A;  4WJ7 A;  3T8M A;  3QX1 A;  2HRJ A;  3VFK A;  4BBK A;  2W2W A;  5LG4 B;  2O6V B;  3R66 C;  4OVV A;  3O65 B;  4H8S A;  3VTV A;  1L2N A;  2ZNV C;  3ZQ4 A;  1HBK A;  5FKA C;  2FBW B;  2QCZ A;  2DYM A;  4A3O A;  2MBO A;  1N6Z A;  3BYY B;  5JLJ B;  3SFE B;  3S2A A;  4F8C B;  4IAP A;  2J0J A;  1FO4 A;  1AW7 A;  2KMM A;  1WF9 A;  1ET9 A;  4K17 A;  1EUV B;  2DBY A;  5D6J B;  3LXF A;  3AE7 B;  4NQK E;  2BWF A;  2DZJ A;  4OVU A;  3V5W A;  4CO7 A;  1KBL A;  2KX0 A;  2W55 A;  1XCQ L;  1F77 A;  3M63 B;  2OOB B;  5IP4 D;  2ZCC A;  2IJ0 A;  3ZVR A;  4JE3 B;  2PE6 B;  2NZ8 B;  1OQR A;  2L32 A;  1ET6 A;  1V61 A;  1RAX A;  5D94 A;  4MEL A;  4KIK A;  2BF8 B;  5BMI A;  2G1E A;  2NBV B;  3DWG C;  5LON B;  1HQR D;  1YN5 A;  4G0N B;  2DIK A;  4HKZ E;  3A9J A;  4AP4 C;  2K39 A;  4WUR A;  1ZUD 2;  4ZRP A;  2JRI B;  2KDM A;  5J17 A;  2WXJ A;  4RM9 A;  4C56 C;  2BWE S;  3UIO B;  4FJV B;  3SU8 X;  1A70 A;  1C79 A;  1ACC A;  2KO3 A;  2FJ9 A;  1E7V A;  3VH3 B;  1T0Y A;  5HFY A;  3KUZ A;  1UH6 A;  2R2O A;  1TS2 A;  1GJZ A;  4FJZ A;  1PGA A;  2ONQ A;  1I7A A;  2LG1 A;  2PVO D;  2WXK A;  3AU5 A;  2FCM A;  2KQ4 X;  3BWU D;  1WJ1 A;  4MEM A;  1PFJ A;  4A3P A;  1E8W A;  4KGR A;  4NNJ B;  4WWN A;  2XN9 C;  2JU6 X;  3A4S C;  1I4P A;  2O6V A;  1TY0 A;  1N5X A;  2O6V D;  1RRB A;  4C7Y A;  2B76 B;  3BJI A;  4GIV A;  2Y3A A;  2LRU A;  4B0M A;  2UYZ B;  1VRA B;  3WAP A;  1FOE A;  2GUM A;  3TEX A;  2I5C A;  1DGJ A;  4FUL A;  4GOU A;  5IOI A;  3AEB B;  2W82 A;  5J18 A;  2QC8 A;  2M14 A;  3B2G A;  2GBR A;  3PSC A;  3JW0 X;  3Q8B A;  3T06 A;  2CKH B;  3NZS A;  3PGE A;  1OQQ A;  5JP4 A;  2K00 A;  1I4Q A;  2KZR A;  5IN7 A;  1KM7 A;  3RNB C;  5EE1 A;  2FNJ B;  3NVY A;  2P0F A;  3TEW A;  4XWT A;  1J8C A;  4IDI A;  4JKB A;  5BYS A;  2ABD A;  2FCN A;  4USA A;  2L00 B;  3FEH A;  4GDK A;  2KGX B;  2PPH A;  2L8J A;  2Z0P A;  1C4C A;  4MJS A;  4IKG A;  4AQ7 A;  1WXV A;  1E7U A;  4B6H A;  3C0R B;  1AN8 A;  2DEN B;  2DWQ A;  1QKZ A;  3QHT A;  3D8F A;  2X8X X;  3DBL I;  4ILJ A;  3VH4 B;  3W5V B;  2K49 A;  2OQB A;  1PGB A;  3PS6 A;  1VCB A;  4TYZ A;  4OZB A;  2LGY A;  3N20 C;  5LNK 1;  1YQ3 B;  1N62 A;  5E6J A;  1UBI A;  2NCN A;  2REX A;  2NMB A;  4K7W A;  4JKD A;  2BYE A;  3CWI A;  3X23 A;  1YX6 B;  3UF8 A;  2PE9 A;  1C3T A;  4DHJ B;  2KVZ A;  2KWV B;  3NY5 A;  1XCT L;  3AE4 B;  2WDQ B;  1OQY A;  3PZD A;  3BYT B;  1F52 A;  1T0S C;  1YQ4 B;  1XQQ A;  3ZRC A;  4GDL B;  4HSI A;  2Z0D B;  1UEL A;  5KHO A;  2JSV X;  1SJH D;  2YT1 A;  2KMA A;  1WM2 A;  3H9D A;  5HE0 A;  3AMZ A;  4ILG B;  2KFJ A;  2O2V A;  4LK0 M;  3DHG C;  1YIW A;  1JWM D;  2V3N A;  4WSF A;  3NOB A;  2WX0 A;  4HPM B;  2C7H A;  3X0W A;  2KD0 A;  1YMH E;  4HXD A;  1DDM A;  3NHE B;  1V5U A;  3E66 A;  2D3G A;  3P7Z A;  3OAW A;  1PGX A;  2IBI B;  4BOS C;  2I2Y A;  4RMA A;  1SB3 C;  2QJL A;  1F2R C;  4MSQ B;  2L2I A;  5JHB A;  3G9W A;  4KAX B;  3P63 A;  4H2A A;  1JWA D;  1P9D U;  1UZX B;  3DPD A;  2RSG A;  5L83 A;  2LJI A;  2DZI A;  3DXE A;  2LGI A;  4AJY B;  2MA9 B;  1Q0W B;  3HSA A;  3ODO A;  3V3X A;  4KV2 A;  2MCN B;  1PFD A;  2K9X A;  4PYZ A;  4QAY A;  4FA6 A;  3F0W A;  4Z2N A;  1EWC A;  2IZV B;  2N9P C;  3T3O A;  5GXG B;  4C80 A;  2LOX A;  1FNW A;  1WJM A;  3ENB A;  1U4A A;  4HAW B;  3DXD A;  2WWZ A;  2Y5P A;  2LMC A;  5CLQ B;  5LXH A;  3MJW A;  4HRO A;  5BYR A;  4DHJ D;  1WYW B;  2G3Q B;  1QZE A;  2IO3 B;  1SSN A;  1MHX A;  2K2U A;  1LO5 D;  4ZRJ A;  2H7E A;  1I2H A;  4REZ A;  1JML A;  1MAI A;  4GDL A;  3QJZ A;  2MP2 B;  1SEB D;  1NVI D;  1AWE A;  3CF6 E;  1C76 A;  1GPX A;  1EAZ A;  4YSY B;  5LOP B;  1ROE A;  2IY1 B;  4RGM A;  4DHZ E;  2AL6 A;  1V86 A;  1VZ7 A;  4ILH A;  2W3R A;  4IM0 A;  1QOB A;  1DDV A;  2DTC A;  4BBN F;  2EJ8 A;  3MP9 A;  2KIG A;  4XGA B;  1V89 A;  4XZ4 A;  5IO9 A;  2L7R A;  2J52 A;  1JW9 D;  1LM8 B;  2CR5 A;  3V60 A;  3APD A;  3SDL C;  4GB9 A;  2Y5B B;  1KLG D;  5D3D A;  2N9K A;  2YVC A;  3PG7 A;  3V05 A;  2KWU B;  3AXC A;  2I1K A;  2R09 A;  1RWS A;  3P2B A;  1D6E C;  1D5Z C;  2YEP F;  3ZDM C;  4GMV A;  2FUH B;  4YSZ B;  4PQ0 A;  1J7B A;  1YNT E;  1FRR A;  2RDB C;  3C19 A;  2JVC A;  3DHH C;  1OY2 A;  2J53 A;  4ICV A;  5DIF B;  2D4Q A;  2YT0 A;  2K6Q A;  3SBT A;  4HAU B;  4FXC A;  4GMX B;  2DAJ A;  1MPE A;  2KQ7 A;  3AE8 B;  4TMA B;  1CQV A;  1GB1 A;  4KSK C;  5DH9 B;  3V6C B;  4W9D A;  2WXN A;  1FGZ A;  3RN9 C;  2D9X A;  3ZJT A;  3TO1 A;  2FJU B;  3DVN V;  1VZ6 A;  1D5M C;  1PUT A;  1ISN A;  4BKS D;  1FCC C;  3DOW A;  1V9J A;  2JXX A;  1V5P A;  1J7C A;  1P7F A;  4WJP A;  3DDC B;  3I57 A;  4E74 A;  2DA0 A;  2RUK B;  1JWU D;  3ZNZ B;  3D8D A;  1NTI A;  2KYW A;  1DRO A;  2ZJD A;  2X38 A;  5HE3 A;  1UNS A;  1ZXI A;  3AU4 A;  1JQ4 A;  3W1S C;  4ANV A;  5AZH A;  3U12 A;  3MHS D;  4WWO A;  4BOZ B;  1FFU A;  1E7P B;  3HUI A;  2CU1 A;  5L95 C;  4YT0 B;  3VUW A;  5C23 A;  4NAM A;  5J2R A;  4I6N B;  3RNA C;  2M38 A;  5C6R A;  2BS4 B;  3IFW B;  4RH6 A;  1M4V A;  3B2F A;  4PT5 A;  4DBG A;  1DIK A;  3FM8 C;  2N0S B;  4O1N A;  4HAV B;  2KTF A;  3SHQ A;  3HM3 A;  5G5G A;  3P4P B;  3R2I A;  5JZE B;  4K2P A;  2KXJ A;  1PQS A;  1HB6 A;  3U52 E;  3F5R A;  1WY8 A;  3UQA A;  2WNM A;  5L81 A;  4MGZ E;  4OZC A;  3RNC C;  2INN E;  1FHO A;  5DPS A;  2JX5 A;  2R2Y A;  2KUQ A;  2XK5 A;  1YJI A;  4RFB A;  2KT7 A;  1SE4 A;  3AV8 A;  2YRY A;  2JUO A;  4E71 A;  3Q14 C;  3EPY A;  4MSM B;  3QIJ A;  4KDI C;  5G5H A;  2Z0Q A;  4HPP A;  3E56 A;  1MJD A;  3PZ8 A;  1FFV A;  4ASW C;  2Q13 A;  4XC2 A;  4BKG A;  2VRR B;  1WYG A;  2BYV E;  3N1Z C;  1XLP A;  1WJU A;  1KC7 A;  1WGD A;  1WR6 E;  1E0Z A;  1OEY A;  1XX0 A;  1TY2 A;  2XNA C;  2AQ3 B;  4YSX B;  2OJW A;  4CQN A;  3EHV A;  4NJ6 A;  3FLV A;  3GZN I;  4K1R B;  2KFK B;  2LWP A;  4HKQ A;  3FSS A;  1XF5 L;  3ZJV A;  4A6Q A;  1MK7 B;  4ZYS A;  1SF0 A;  2MBE A;  5C5B A;  2IDY A;  3ZUN A;  2ZPY A;  3PP2 A;  4K7S A;  4W9H A;  4YTM B;  2Y8F A;  1WG7 A;  1EU4 A;  1WJN A;  3FC4 A;  1X1M A;  4MT7 A;  2K1F A;  4WAA A;  2H88 B;  4KDL B;  4DBB A;  3TSS A;  2CY5 A;  1B1Z A;  1TKE A;  5FI1 A;  2QIL A;  4L23 A;  4LLG M;  1M94 A;  5DPT A;  2RVB B;  5BMG A;  3KWL A;  4ARI A;  4KIK B;  2ACZ B;  2KJ6 A;  3PHX B;  2LXC A;  3ZYY X;  3SYX A;  3ENE A;  4EE2 A;  2SAK A;  4UDU C;  4OT1 A;  2M1M A;  1ZW7 A;  3A8P A;  2CS4 A;  4AWJ A;  5HI1 A;  2A5U A;  2G9H D;  4Y94 A;  1UNP A;  3VHT C;  3DQV A;  2M0X A;  1OGW A;  1TYG B;  4ACF A;  2R2Q A;  1UNR A;  2G35 A;  3TEY A;  4L1R A;  3JVZ X;  1MIX A;  4YL8 A;  2KHW B;  3VRA B;  1TKG A;  2FAZ A;  3DBR I;  3JYU A;  1Q5W B;  3WIM A;  3ECI A;  4BFR A;  4A5K A;  3VRB B;  2DYQ A;  3BK2 A;  5JHG A;  4EKU A;  5AUI A;  1UPQ A;  4CHM A;  1WMH A;  2JZP A;  3TEZ A;  1OQN A;  4K3C A;  1KFY B;  1LFD A;  2WXR A;  4XWW A;  5E6O A;  3UQB A;  2AQ2 B;  1N61 A;  3NWA A;  2MHJ A;  2Y8G A;  4HRS A;  3RYT A;  1F9J A;  2C7M B;  3TL5 A;  4RGN A;  1WWT A;  1GB4 A;  2V1Y A;  2KFK A;  2N1V A;  1ST7 A;  1UD7 A;  1YN4 A;  3R2T A;  3KRW A;  2Z14 A;  1L6U A;  2PZ1 A;  1NI3 A;  1FXA A;  4ZRQ A;  1WXM A;  1NI2 A;  3RI7 C;  4DXA B;  4EEW A;  3GP7 A;  4HHV A;  4JKG A;  4JKC A;  2QKM A;  1OMW A;  2R82 A;  3KY9 A;  3ZNG C;  3A1Q B;  2JY6 A;  3KUC B;  1L0V B;  2LYD A;  1BTN A;  2VRW B;  3V62 A;  4WQM A;  2N23 A;  4HCN B;  1J0G A;  3VIA A;  2JT4 B;  2K2J A;  4PYU A;  2XEW A;  2W9N A;  3QAQ A;  2E3T A;  3QK0 A;  1FHX A;  5E6P A;  4GDK B;  3EC8 A;  3AUL A;  3VDZ A;  4M8M A;  2BW2 A;  2FUG 1;  2OED A;  1XT9 B;  3NWF A;  4ICU A;  1FAO A;  4MJS B;  4C00 A;  1GG3 A;  1TIF A;  4FAD A;  4W9F A;  3ZRF A;  2KLC A;  5D3I B;  5HHD G;  3ODX A;  3EUB 2;  4NQL B;  3PEG A;  1WM3 A;  3SR6 A;  1TXD A;  3T3N A;  3NW8 A;  5DCN A;  2EKI A;  1W1G A;  2D3A A;  3KUD B;  3AEG B;  4XE0 A;  4JL9 A;  3U30 A;  3TIX A;  2ROV A;  1WSP A;  2COP A;  2WXG A;  3BK1 A;  3Q3M C;  3GZN B;  2HTH A;  2DHI A;  5FI0 A;  5E6N A;  4TV3 A;  2L0T A;  5M4Y B;  3V61 A;  1TS5 A;  1DBH A;  2UZR A;  2FCS A;  1R4M I;  2CHZ A;  4TQ0 A;  3OJ3 A;  4A9A A;  1GUA B;  1BML C;  2DZK A;  2K6D B;  3CIR B;  4ZRI A;  1HA5 A;  4HEA 1;  3KSY A;  2CB8 A;  3SO6 A;  2LHD A;  3CMM B;  5HE1 A;  4BKT A;  4YTN B;  1AAR A;  2LGX A;  4F7Z A;  1WVH A;  4F1S A;  1UPR A;  2K8E A;  2M8S A;  1UEF A;  3R7R A;  4LCD E;  2LUM A;  2Z59 A;  3N1Y C;  2WXP A;  1WX8 A;  4RCO A;  2AWT A;  1AYF A;  3AEE B;  3KWV A;  4HJG E;  4MGI E;  1JDE A;  2MH7 A;  2O2V B;  4DDI D;  3A1Q A;  1WI1 A;  2J59 M;  2YS5 A;  3PLU A;  2L83 A;  1Z5S B;  4JLC A;  1ESF A;  1TBE A;  3SD5 A;  2OJR A;  1T6B X;  3RZW C;  3AB5 A;  2Z13 A;  3BIN A;  3TFM A;  4EOY A;  1OEY J;  2ZVO A;  1WZ0 A;  1J19 A;  5D3V A;  3CIK A;  4WH4 A;  5FR3 A;  1E9M A;  3DBR B;  5CHV C;  3PZ7 A;  1JCK B;  3GYP A;  1WIA A;  3TBL D;  1TJ6 A;  2P8V A;  4GLS C;  2GS0 A;  2EC1 A;  3IT4 B;  1K5D B;  1QQG A;  3DCX A;  2AEH A;  1T77 A;  3LB8 C;  4II2 B;  4KVG B;  2M0A A;  3ABV B;  2NVU I;  2ZEQ A;  1Q1O A;  2NBU A;  1I7H A;  4LJO B;  3AE5 B;  2J0M A;  3PVW A;  1IBX A;  3MC9 A;  5DHA B;  1VZ8 A;  5AZG A;  3K9O B;  2D9Y A;  2D3C A;  2R0D A;  3AE9 B;  4ZHP A;  2KN4 A;  4K3B A;  2JYE A;  3VUY A;  1FNV A;  5D3X A;  1P98 A;  1E8Y A;  3ZO5 B;  2N9X A;  2DHJ A;  3K9P B;  3MC8 A;  1WGG A;  2B3A A;  3RPF C;  2PTL A;  1A5R A;  3PTF C;  3B0A A;  1TQZ A;  1FNU A;  2LUL A;  5AEK B;  1I42 A;  1Y8R C;  4FLH A;  4GU2 A;  3SV1 A;  3QA8 A;  4GSW A;  1NEN B;  2K5P A;  4GN1 A;  2FCQ A;  2PIA A;  1VLB A;  4A90 A;  1JRO A;  2NTT A;  1V49 A;  3SFD B;  3WAN A;  1ZC4 B;  2JPH A;  2DNF A;  3WAO A;  3I3T B;  1ACA A;  1KLU D;  2OHF A;  3ML9 A;  1WGU A;  2CJN A;  2BS3 B;  2LZ6 A;  1PDX A;  1XXG A;  4OW0 A;  2MSE D;  5AZF A;  3E9O A;  1UUP A;  1SBB B;  4PNK A;  2LKO A;  4GGQ A;  2MBB B;  3FKY A;  5CLL B;  1WX9 A;  2DN6 A;  2BS2 B;  2GCJ A;  1Z2M A;  1WZ3 A;  4KKI A;  3Q6B A;  2ON8 A;  3C8Y A;  3B77 A;  4MK0 A;  4JIO U;  2H89 B;  2COC A;  2KJH B;  1L7Y A;  3NJT A;  1UBQ A;  1WE6 A;  4EMO A;  3TMP B;  1OTR B;  1VJK A;  2JZZ A;  2I38 A;  4IW0 A;  4GNK B;  1TTN A;  3MDB C;  3ULB A;  2KK8 A;  2CAY A;  3R7Q A;  4RM8 A;  1S1Q B;  1UWM A;  1MG4 A;  3ZJU A;  3RMK C;  3W9C B;  1R4M B;  2A4Z A;  5MPO A;  2UWQ A;  1QLB B;  3WAM A;  1P0R A;  3KZ1 A;  2DKP A;  3DHI C;  5G55 A;  2QIE B;  3U7D A;  3VAW A;  3OLM D;  1E5W A;  2CY4 A;  1JRU A;  2D11 A;  1NYQ A;  2WDT B;  3O13 A;  2MQJ A;  2M19 A;  2X0S A;  3L0W B;  2MFQ A;  3SEB A;  1V81 A;  2RMM A;  1WGK A;  1YD8 U;  1AQC A;  2IO2 B;  4LJP B;  3KLS X;  1NEK B;  3FIL A;  1E10 A;  3IBE A;  2JWU A;  5HKH A;  1X05 A;  1K53 A;  3BVZ A;  4EFO A;  2VZK B;  4W9J A;  1C9F A;  3L16 A;  3A4R A;  5IAA C;  2WQY B;  4ZDV A;  3QBV B;  3N9Y C;  3MJ5 A;  3ZIM A;  4N59 A;  1KOT A;  3VTW A;  1P7E A;  3AN1 A;  4E3C A;  3N32 A;  4ANW A;  1MI1 A;  1L0X B;  4EZK A;  1SGH A;  1QIL A;  4N6E B;  4BZA A;  4JK9 A;  4KKJ A;  2BYT A;  3EFU A;  3ETR A;  2OTX A;  1T3Q A;  2EKE C;  1VD2 A;  2EMS A;  3ZGZ A;  1WGH A;  4EZL A;  4AJW A;  3ONS A;  4K2O A;  5TR5 A;  3ODW A;  4IWQ A;  2J4X A;  4A6F A;  3E9P A;  4CSQ A;  3PT2 B;  3ZDT A;  3D32 A;  3PPA A;  2W3S A;  3P6A A;  2BYF A;  5BMH A;  3AE2 B;  1C4P A;  4M02 A;  2ZW1 A;  3DBS A;  4C4V A;  3ZKJ C;  1H10 A;  2GJY A;  1K8R B;  2XK5 B;  3DVN U;  3HRD D;  2D07 B;  2IGD A;  3DBL B;  5FK9 C;  1L4D B;  2E6X A;  3BII D;  3PHW B;  2WX1 A;  3RZF A;  1UNQ A;  1OFF A;  3DXC A;  1U5D A;  4FJY A;  2WU5 B;  3U8Z A;  3A58 A;  1RFA A;  3RNG C;  3ZVV A;  3IAM 1;  1WX7 A;  2BT6 A;  2V4I B;  3AE3 B;  4US8 A;  2IPK D;  4HB2 B;  4ITK A;  5KCV A;  2K8B A;  4DX9 0;  4HJK A;  2LI5 A;  2V3P A;  3R8B A;  1N60 A;  1FXT B;  1XLN A;  2KWC A;  4WJN A;  2IGG A;  5C79 A;  4W9I A;  1N5W A;  5D27 A;  2D2Q A;  1WFY A;  1MK9 B;  2KDI A;  5HG2 A;  1H4R A;  1MKE A;  2KR0 A;  1DYN A;  5H92 C;  3NVW A;  1EGX A;  4IUM B;  2W2X C;  1P1A A;  1GGO A;  3T9L A;  1M7E A;  1ZGU B;  1U27 A;  5C5B B;  2KN5 A;  4KHB A;  1V5T A;  3RD2 A;  4J6I A;  3P4R B;  4B9K A;  1LW3 A;  2NTS A;  4WQO B;  4LTU A;  2IY0 B;  3BVM A;  2D9W A;  3L13 A;  4IM3 A;  1STE A;  1X1G A;  1CK1 A;  4JWU C;  1IP9 A;  1JRP A;  2LAS A;  3AE6 B;  3B1L X;  1KJT A;  2LVO A;  4S0R A;  1YOV B;  5GOW B;  4Z2M B;  4MT5 A;  2Z0O A;  3L10 B;  4XX5 A;  1FXI A;  3R3M A;  4MH0 E;  4IOI E;  4NAW B;  4MDK E;  5G2N A;  2HE7 A;  2BBC A;  3PRE A;  2MDX A;  3JSV A;  2V3S A;  4FHJ A;  2NR2 A;  4IFS A;  1ZP0 B;  4US9 A;  2PEA A;  2K25 A;  2MJE A;  2D9V A;  4MY6 A;  2D5G A;  1SE9 A;  1LQB A;  4KHA A;  4TKN A;  2AQ1 B;  2W2X D;  2DYO A;  1XD4 A;  1KI1 B;  2CU3 A;  3N3K B;  4M8N A;  5KHQ A;  2D10 A;  4QJ4 B;  3Q3J A;  3AI5 A;  2AX5 A;  5KQ4 A;  3L4P A;  1CZP A;  2M56 B;  2WDV B;  3DCG A;  4OVZ A;  3P42 A;  4R3D A;  2XBB C;  4MAC A;  2HDE A;  1BXT A;  3NS8 A;  3OJ4 B;  2WXM A;  2E2X A;  1PMS A;  3HM6 X;  3TJP A;  4HAX B;  4I6P A;  4W9L A;  3L08 A;  1B55 A;  2N7E A;  4S17 A;  1WMH B;  2C60 A;  3A8Q A;  1MFW A;  2GBJ A;  2Z8L A;  1U5E A;  2INP E;  2KTR B;  4F7U P;  2N4F A;  4M00 A;  4AS1 A;  4JKA A;  2KDF B;  3MC0 B;  1K52 A;  5IJM A;  3DVG Y;  2P0D A;  4L6E A;  4RF1 A;  2FID A;  2N7J A;  4JKH A;  5CX3 A;  1T0R C;  3H7P A;  1UGJ A;  2DX5 B;  1U5G A;  1I4G A;  4QXA B;  3VUX A;  1MIZ B;  1KLV A;  2DFK A;  3KYC D;  2KAN A;  4OHJ A;  2Q5W D;  3A33 B;  2WU2 B;  1U2B A;  2DAF A;  2K8H A;  3APF A;  1HZ6 A;  2GOW A;  1SE2 A;  4K7U A;  3GOE A;  3RUL A;  1KF6 B;  2NPT A;  3UI3 A;  2GBK A;  2JXT A;  1BTK A;  4EJN A;  4JKG B;  4L2Y A;  1V5M A;  2RDH A;  3Q3N C;  1LXD A;  2LGS A;  1ZKH A;  1E90 A;  4WIP A;  1XR0 B;  2COF A;  4ZOH C;  3J9C A;  1ZSQ A;  4XDD A;  3SUZ A;  5I2M A;  1DYQ A;  2MRP A;  5T8I A;  4K81 A;  2VKI A;  4IWO A;  4BVU C;  3HQC A;  4KZ0 A;  3TW1 A;  2V4L A;  4NAW A;  2ZVN A;  2J42 A;  1NDD A;  1QOF A;  2DKQ A;  3ZXV A;  3NRZ A;  1WXS A;  3W1Y A;  2WGS A;  4P7I A;  1N3H A;  2DYB A;  2JWZ A;  1E6E B;  3Q3F A;  3HVZ A;  3PO0 A;  1H8C A;  1WJ4 A;  1FD6 A;  3WAL A;  3LYY A;  1SXT A;  2JRH A;  4D2K A;  1PLS A;  2WXO A;  4RF0 A;  2WP9 B;  3QWM A;  2GRI A;  2L3Z A;  2VH1 A;  2NS5 A;  1L4Z B;  4P16 A;  3RNF C;  1HE8 A;  1R7S A;  2WHI A;  1S3S G;  4PK1 A;  4FHK A;  2KNB A;  3SNH A;  1TJE A;  3ML8 A;  4WWM A;  3AH7 A;  3HIZ A;  2HTH B;  5DI9 B;  1TZ1 A;  3NVV A;  3MHZ A;  1HEZ E;  3EFC A;  2KTR A;  3U2S C;  1YJ1 A;  2FE8 A;  4YWG G;  5C1Z A;  1V80 A;  1SJE D;  2L1A A;  1CMX B;  2QKL A;  2ADZ A;  3KW5 B;  3NVZ A;  1RFK A;  1RYJ A;  1AWD A;  2DX5 A;  1IGC A;  4LNI A;  2NBW B;  1JWB D;  2GMI C;  1EF1 A;  1HTO A;  5EE9 A;  3BY4 B;  3O96 A;  2RPV A;  2I5F A;  2JZ3 B;  2Z59 B;  4IC7 B;  2BVC A;  4C0A A;  3NUH B;  1C4A A;  3BZD B;  1V1P A;  2HTM E;  2LRW A;  4Q2J A;  3GS2 A;  3ZNH B;  1JAL A;  2WH5 A;  4HB0 B;  1EVH A;  1QOA A;  2YLM A;  2KVR A;  1WXA A;  3U7Z A;  1QQR A;  1NU2 A;  4I6L B;  4HWI B;  3QQ8 B;  4HAZ B;  5TSS A;  1F2R I;  1K5G B;  5HE2 A;  2CJO A;  2PJH A;  4J3O D;  3OWE B;  4QJ3 B;  5LLI A;  1ZPS A;  2IO1 B;  5I4D A;  1L0Y B;  4KGT A;  3H6N A;  2KC2 A;  4N58 A;  4HDQ A;  1BAK A;  4JK8 A;  1NTV A;  2YSZ A;  3VOQ A;  2JQR B;  1NBF C;  4P1B C;  4F7H A;  4NZL B;  5J3T A;  1Z87 A;  3ZNI D;  4TUU A;  1W1H A;  1ENF A;  2WXH A;  3Q3O C;  2I1J A;  5JH5 C;  3GYO A;  5D3W A;  3QAR A;  1IBX B;  5D7G A;  4DWF A;  2LGD A;  5BYQ A;  4BAX A;  2PKO A;  2ZPN A;  3PVL A;  3IT6 B;  2L05 A;  2KQS A;  1ZDX A;  2RSU A;  2DLB A;  4KGS A;  3AJ4 A;  2DX1 A;  3A98 B;  1XCG A;  1UGM A;  2L76 A;  4M0W A;  4WJQ A;  4N9F 4;  1TKY A;  1IYF A;  3OHM B;  2DHK A;  3KRX A;  5DHF B;  2BB5 A;  1Q10 A;  3P4Q B;  4MM3 A;  5JVL A;  5EE3 A;  4FBJ B;  3FAH A;  3WCQ A;  3I5J C;  3VTU A;  2N1W A;  1MHH E;  2L52 A;  1GAQ B;  2HJ1 A;  3AEA B;  4W9K A;  2WXQ A;  1HTQ A;  1XEE A;  1TZO A;  1IRS A;  2TSS A;  2N9L A;  1SIJ A;  2FIF A;  2MEK A;  4ZYN A;  4KSL C;  1XD3 B;  2MX2 A;  2YT2 A;  2FDQ A;  4AUQ C;  2K0P A;  1JWS D;  2QDF A;  3ML4 A;  5CHF A;  4A20 A;  1I35 A;  2Y5C A;  4CYE A;  4JGH B;  1C1Y B;  3BVG A;  2D3B A;  4CHK A;  2YS1 A;  3EGR A;  2NMQ A;  3H7S A; 
#chains in the Genus database with same CATH homology
 4HPL B;  1MG8 A;  2M17 A;  1D3Z A;  2J0K A;  2ASQ A;  4KHO A;  1ZM0 A;  2LUE A;  2CHW A;  2EMT A;  3LDZ E;  4ZRK A;  4GPT B;  4WWP A;  1WGQ A;  5FR6 A;  1FB8 A;  4HVB A;  4A6H A;  1SHC A;  2MWS B;  4X57 B;  2MBQ A;  4HCP B;  3PRM B;  1RJ2 A;  3ZLZ A;  3M95 A;  1TGZ B;  4GOC A;  3EEC A;  3KYD D;  4BBN C;  4B6W A;  3ULC A;  1XOD A;  1FHW A;  3UIP B;  5EDS A;  3N7C A;  3SBG A;  1P6S A;  4W9G A;  2M4N A;  2N9E B;  4F7G A;  5IA7 A;  3LJU X;  4HAT B;  1Y5O A;  3QCA A;  4LDT B;  4DK5 A;  3D8E A;  3QWZ B;  4JK7 A;  1V88 A;  1VBG A;  3ZW3 A;  4XWX A;  4A6F B;  2KC1 A;  2ZZP B;  2KDB A;  1P3Q U;  2MBH A;  4IM2 A;  2CHX A;  2DHZ A;  3HK0 A;  2RLO A;  3PV1 A;  2RD0 A;  2IYD B;  5DPW A;  2ZCB A;  2KLG A;  3NZU A;  2BPS A;  4MGK E;  3N30 A;  2IFS A;  1HB8 A;  1VBH A;  3DBH I;  4WJO A;  4PS8 A;  3CST A;  2V76 A;  3M1I B;  4FN2 A;  2ELB A;  1ZC3 B;  1X86 A;  2XQN M;  3M3J A;  1V2Y A;  4HB4 B;  1KZ7 A;  1M7R A;  4KZC A;  4NJ7 A;  4GXB A;  4EZJ A;  4JKF A;  5J3Q A;  5D3Y A;  4KHB B;  3TVV A;  3MPX A;  2J7Q B;  4A6K A;  4G11 A;  3VQI A;  1BWN A;  4W9E A;  4G50 A;  5DPR A;  1P3R A;  1QC6 A;  3HHM A;  5BO4 B;  2IO0 B;  1NTY A;  2C7N B;  3PRP B;  1U29 A;  4NY0 A;  1WI0 A;  2MW5 A;  3CSF A;  3CXB B;  2JP2 A;  2L1C A;  4LDT D;  1EF5 A;  3NSU A;  3A9K B;  3RCP A;  4URK A;  3JSV B;  2KOX A;  3IVF A;  1V6E A;  5JHA A;  1U5F A;  2RPQ A;  3RUI B;  3E9L A;  1Q67 A;  2LD9 A;  4IWP A;  4W9C A;  2ELA A;  2L0F A;  2CRF A;  2X18 A;  4PS7 A;  5J3Y A;  5JHH A;  3ZTC A;  1YQB A;  3RT3 B;  3PVU A;  4HK2 A;  1R4N I;  3QC8 B;  2ROZ B;  1J0W A;  4EUT A;  3HW2 B;  2DZM A;  1WJ6 A;  2UVM A;  2BCJ A;  3H7P B;  2G45 B;  1YX5 B;  2G4D B;  1WGR A;  1E8Z A;  4HDO A;  3M62 B;  2H7D A;  2KDE B;  2UZS A;  2JF5 A;  4HB3 B;  2C5L C;  3DVG X;  2RNR B;  2NPT B;  2QHO A;  4CHJ A;  3WYF B;  1WRD B;  1X11 A;  2COA A;  2DLW A;  3H1U A;  2P0H A;  2LJ5 A;  4NPN A;  3IHP C;  4BKS A;  2HJ8 A;  4B95 A;  4DDG D;  1RRP B;  3MTN B;  3VXW A;  3A9K A;  4HAY B;  2BGF A;  2LXA A;  3UIN B;  1Y19 B;  3ALB A;  2DYN A;  2RQ1 A;  1V5O A;  2Y7B A;  1DDW A;  4ANX A;  2MP2 A;  3APC A;  3PSE B;  2GBN A;  3TCA A;  1NVL A;  3V6E B;  4YON A;  2COD A;  1WH3 A;  4WVF B;  4PS3 A;  4NSW A;  2WYQ A;  2LBB A;  2YS3 A;  3B08 A;  2BKF A;  3PRZ A;  4HLE A;  3ZTD A;  1X1F A;  1FGY A;  4JKE A;  2YF0 A;  5LXI B;  2K8C A;  1WE7 A;  2Z0E B;  2MKR A;  3L54 A;  4TQ1 A;  2AL3 A;  1G6J A;  2RGF A;  1EO6 A;  2VSZ A;  2GCL A;  4II3 B;  2MLB A;  1RLF A;  4IG7 B;  3W1S A;  1WGY A;  2C9W B;  3OAN A;  2LOZ A;  3VVW B;  4DHZ B;  1KZG A;  5C16 A;  1GNU A;  1GC7 A;  2HD5 B;  1BT0 A;  4G3X B;  3RCZ A;  2KMC A;  2G4S A;  1E8X A;  2D9Z A;  4IOY X;  5EFX A;  1MPH A;  1P5T A;  4ANU A;  4MGY E;  2KX3 A;  5KQ1 A;  3WA0 A;  2CQU A;  1IPG A;  3UZT A;  2BKR B;  1GC6 A;  3KVF B;  5CHW A;  4GZU A;  3FP5 A;  1XKE A;  2RR9 A;  2KCJ A;  2LVP A;  2AYO B;  4AOF A;  3L17 A;  1SIF A;  2GBM A;  3IG3 A;  1W1D A;  3UGB B;  2ZNV B;  1ZVR A;  3KH0 A;  1LB1 A;  3A9J B;  5CTR C;  4M0W B;  3LJ3 A;  2KUP A;  2MWN B;  3PLV A;  1WR1 A;  5D2M B;  5GMV A;  2N0Y A;  2KKC A;  4D0N B;  2LVQ A;  4JQW C;  4DX8 A;  2FJL A;  2N7D A;  2IYB A;  2KJR A;  2RGN B;  4WJ7 A;  3T8M A;  3QX1 A;  2HRJ A;  3VFK A;  4BBK A;  2W2W A;  2O6V B;  3R66 C;  4OVV A;  3O65 B;  4H8S A;  3VTV A;  1L2N A;  2ZNV C;  1HBK A;  2DYM A;  4A3O A;  2MBO A;  5JLJ B;  3S2A A;  4F8C B;  4IAP A;  2J0J A;  1WF9 A;  4K17 A;  1EUV B;  5D6J B;  4NQK E;  2BWF A;  2DZJ A;  4OVU A;  3V5W A;  4CO7 A;  1KBL A;  2KX0 A;  3M63 B;  2OOB B;  2ZCC A;  3ZVR A;  2PE6 B;  2NZ8 B;  1V61 A;  1RAX A;  5D94 A;  4MEL A;  4KIK A;  2BF8 B;  2NBV B;  5LON B;  4G0N B;  2DIK A;  3A9J A;  4AP4 C;  2K39 A;  2JRI B;  5J17 A;  4RM9 A;  2BWE S;  3UIO B;  4FJV B;  3SU8 X;  2KO3 A;  2FJ9 A;  1E7V A;  3VH3 B;  1T0Y A;  3KUZ A;  1UH6 A;  2R2O A;  1GJZ A;  4FJZ A;  1I7A A;  2LG1 A;  3AU5 A;  2FCM A;  1WJ1 A;  4MEM A;  1PFJ A;  4A3P A;  1E8W A;  4NNJ B;  4WWN A;  3A4S C;  2O6V A;  2O6V D;  1RRB A;  3BJI A;  4GIV A;  2LRU A;  2UYZ B;  3WAP A;  1FOE A;  2I5C A;  4FUL A;  5J18 A;  2M14 A;  2GBR A;  3PSC A;  3JW0 X;  3T06 A;  2CKH B;  3NZS A;  3PGE A;  5JP4 A;  2K00 A;  2KZR A;  1KM7 A;  2FNJ B;  2P0F A;  1J8C A;  4JKB A;  2ABD A;  2FCN A;  2L00 B;  3FEH A;  4GDK A;  2KGX B;  2PPH A;  2L8J A;  2Z0P A;  4MJS A;  1WXV A;  1E7U A;  4B6H A;  3C0R B;  2DEN B;  3QHT A;  3D8F A;  3DBL I;  4ILJ A;  3VH4 B;  2OQB A;  3PS6 A;  1VCB A;  4TYZ A;  2LGY A;  1UBI A;  2NCN A;  2REX A;  2NMB A;  4K7W A;  4JKD A;  2BYE A;  3X23 A;  1YX6 B;  3UF8 A;  2PE9 A;  1C3T A;  4DHJ B;  2KWV B;  3NY5 A;  1OQY A;  3PZD A;  1XQQ A;  3ZRC A;  4GDL B;  2Z0D B;  1UEL A;  5KHO A;  2YT1 A;  2KMA A;  1WM2 A;  3H9D A;  5HE0 A;  4ILG B;  2KFJ A;  2O2V A;  1YIW A;  4WSF A;  3NOB A;  2WX0 A;  4HPM B;  2C7H A;  3X0W A;  2KD0 A;  4HXD A;  1DDM A;  3NHE B;  1V5U A;  3E66 A;  2D3G A;  3P7Z A;  3OAW A;  2IBI B;  4BOS C;  4RMA A;  4MSQ B;  2L2I A;  5JHB A;  3G9W A;  4KAX B;  1P9D U;  1UZX B;  3DPD A;  2RSG A;  5L83 A;  2DZI A;  3DXE A;  4AJY B;  1Q0W B;  2MA9 B;  3ODO A;  4KV2 A;  2MCN B;  4PYZ A;  4FA6 A;  3F0W A;  4Z2N A;  2IZV B;  2N9P C;  2LOX A;  1WJM A;  3ENB A;  1U4A A;  4HAW B;  3DXD A;  2WWZ A;  5CLQ B;  5LXH A;  3MJW A;  4DHJ D;  1WYW B;  2G3Q B;  1QZE A;  2IO3 B;  2K2U A;  4ZRJ A;  2H7E A;  1I2H A;  1MAI A;  4GDL A;  3QJZ A;  2MP2 B;  1AWE A;  3CF6 E;  1EAZ A;  5LOP B;  2IY1 B;  4DHZ E;  2AL6 A;  1V86 A;  4ILH A;  4IM0 A;  1DDV A;  2DTC A;  4BBN F;  2EJ8 A;  1V89 A;  4XZ4 A;  2L7R A;  1LM8 B;  2CR5 A;  3V60 A;  3APD A;  3SDL C;  4GB9 A;  2Y5B B;  2YVC A;  3PG7 A;  2KWU B;  3AXC A;  2I1K A;  2R09 A;  3P2B A;  3ZDM C;  4GMV A;  2FUH B;  4PQ0 A;  2JVC A;  1OY2 A;  4ICV A;  5DIF B;  2D4Q A;  2YT0 A;  2K6Q A;  3SBT A;  4HAU B;  4GMX B;  2DAJ A;  2KQ7 A;  4KSK C;  5DH9 B;  3V6C B;  4W9D A;  1FGZ A;  2D9X A;  3TO1 A;  3DVN V;  1ISN A;  4BKS D;  3DOW A;  1V9J A;  2JXX A;  1V5P A;  4WJP A;  3DDC B;  4E74 A;  2DA0 A;  2RUK B;  3ZNZ B;  3D8D A;  1NTI A;  1DRO A;  2ZJD A;  5HE3 A;  3AU4 A;  3W1S C;  4ANV A;  5AZH A;  3MHS D;  4WWO A;  4BOZ B;  2CU1 A;  5L95 C;  3VUW A;  5C23 A;  5J2R A;  4I6N B;  2M38 A;  5C6R A;  3IFW B;  4DBG A;  1DIK A;  3FM8 C;  4HAV B;  2KTF A;  3SHQ A;  3HM3 A;  5JZE B;  4K2P A;  2KXJ A;  1PQS A;  1HB6 A;  3F5R A;  1WY8 A;  3UQA A;  5L81 A;  4MGZ E;  1FHO A;  5DPS A;  2XK5 A;  2YRY A;  2JUO A;  4E71 A;  3EPY A;  4MSM B;  3QIJ A;  4KDI C;  2Z0Q A;  4ASW C;  2Q13 A;  4XC2 A;  4BKG A;  2VRR B;  2BYV E;  1WJU A;  1KC7 A;  1WGD A;  1WR6 E;  1OEY A;  1XX0 A;  3EHV A;  4NJ6 A;  3FLV A;  3GZN I;  4K1R B;  2KFK B;  2LWP A;  3FSS A;  1MK7 B;  2MBE A;  5C5B A;  3ZUN A;  2ZPY A;  3PP2 A;  4K7S A;  4W9H A;  2Y8F A;  1WG7 A;  1WJN A;  1X1M A;  4MT7 A;  2K1F A;  4WAA A;  4KDL B;  4DBB A;  2CY5 A;  5FI1 A;  1M94 A;  5DPT A;  2RVB B;  4KIK B;  2KJ6 A;  3PHX B;  2LXC A;  3SYX A;  3ENE A;  2M1M A;  1ZW7 A;  3A8P A;  2CS4 A;  4AWJ A;  2A5U A;  4Y94 A;  1UNP A;  3VHT C;  3DQV A;  2M0X A;  1OGW A;  2R2Q A;  1UNR A;  2G35 A;  3JVZ X;  1MIX A;  4YL8 A;  2KHW B;  2FAZ A;  3DBR I;  3JYU A;  1Q5W B;  3WIM A;  3ECI A;  4BFR A;  4A5K A;  2DYQ A;  5JHG A;  4EKU A;  1UPQ A;  4CHM A;  1WMH A;  1OQN A;  1LFD A;  5E6O A;  3UQB A;  2Y8G A;  3RYT A;  1F9J A;  2C7M B;  3TL5 A;  2V1Y A;  2KFK A;  2N1V A;  1ST7 A;  1UD7 A;  3KRW A;  2PZ1 A;  1WXM A;  1NI2 A;  4DXA B;  4EEW A;  4HHV A;  4JKG A;  4JKC A;  2QKM A;  1OMW A;  2R82 A;  3KY9 A;  3ZNG C;  3A1Q B;  2JY6 A;  3KUC B;  2LYD A;  1BTN A;  2VRW B;  3V62 A;  2N23 A;  4HCN B;  1J0G A;  3VIA A;  2JT4 B;  2K2J A;  4PYU A;  2XEW A;  2W9N A;  3QAQ A;  3QK0 A;  1FHX A;  5E6P A;  4GDK B;  3EC8 A;  3AUL A;  3VDZ A;  4M8M A;  1XT9 B;  4ICU A;  1FAO A;  4MJS B;  1GG3 A;  4FAD A;  4W9F A;  3ZRF A;  2KLC A;  3ODX A;  4NQL B;  3PEG A;  1WM3 A;  1TXD A;  5DCN A;  1W1G A;  3KUD B;  4JL9 A;  3U30 A;  3TIX A;  2ROV A;  2COP A;  2HTH A;  2DHI A;  5FI0 A;  5E6N A;  4TV3 A;  2L0T A;  3V61 A;  1DBH A;  2UZR A;  2FCS A;  1R4M I;  2CHZ A;  4TQ0 A;  3OJ3 A;  1GUA B;  2DZK A;  2K6D B;  4ZRI A;  3KSY A;  2CB8 A;  3SO6 A;  3CMM B;  5HE1 A;  4BKT A;  1AAR A;  2LGX A;  4F7Z A;  1WVH A;  4F1S A;  1UPR A;  2M8S A;  1UEF A;  3R7R A;  4LCD E;  1WX8 A;  2AWT A;  4MGI E;  1JDE A;  2O2V B;  4DDI D;  3A1Q A;  1WI1 A;  2J59 M;  2YS5 A;  3PLU A;  1Z5S B;  4JLC A;  1TBE A;  3SD5 A;  2OJR A;  3RZW C;  3BIN A;  3TFM A;  4EOY A;  1OEY J;  2ZVO A;  1WZ0 A;  1J19 A;  5D3V A;  3CIK A;  5CHV C;  3GYP A;  1WIA A;  3TBL D;  1TJ6 A;  2P8V A;  2GS0 A;  2EC1 A;  1K5D B;  1QQG A;  2AEH A;  4II2 B;  4KVG B;  2NVU I;  2ZEQ A;  1Q1O A;  2NBU A;  4LJO B;  2J0M A;  3PVW A;  5DHA B;  5AZG A;  3K9O B;  2D9Y A;  2R0D A;  3VUY A;  5D3X A;  1P98 A;  1E8Y A;  3ZO5 B;  2N9X A;  2DHJ A;  3K9P B;  1WGG A;  2B3A A;  1A5R A;  3PTF C;  3B0A A;  1TQZ A;  1I42 A;  2LUL A;  5AEK B;  1Y8R C;  4FLH A;  4GU2 A;  3SV1 A;  3QA8 A;  4GSW A;  4GN1 A;  2FCQ A;  1V49 A;  3WAN A;  1ZC4 B;  2JPH A;  3WAO A;  3I3T B;  1ACA A;  3ML9 A;  1WGU A;  2LZ6 A;  5AZF A;  2MSE D;  3E9O A;  4PNK A;  2LKO A;  4GGQ A;  2MBB B;  5CLL B;  1WX9 A;  2DN6 A;  2GCJ A;  1Z2M A;  1WZ3 A;  4MK0 A;  4JIO U;  2COC A;  2KJH B;  1L7Y A;  1UBQ A;  1WE6 A;  4EMO A;  3TMP B;  1OTR B;  2JZZ A;  4IW0 A;  1TTN A;  3MDB C;  3ULB A;  2KK8 A;  2CAY A;  3R7Q A;  4RM8 A;  1S1Q B;  2A4Z A;  2UWQ A;  3WAM A;  1P0R A;  3KZ1 A;  2DKP A;  5G55 A;  3U7D A;  3VAW A;  3OLM D;  1E5W A;  2CY4 A;  1JRU A;  2D11 A;  2WDT B;  2MQJ A;  2X0S A;  3L0W B;  2MFQ A;  1V81 A;  1YD8 U;  1AQC A;  2IO2 B;  4LJP B;  3IBE A;  5HKH A;  1X05 A;  4EFO A;  4W9J A;  3L16 A;  3A4R A;  5IAA C;  4ZDV A;  3QBV B;  3ZIM A;  1KOT A;  3VTW A;  4E3C A;  3N32 A;  4ANW A;  4EZK A;  1SGH A;  4JK9 A;  3EFU A;  2OTX A;  2EKE C;  1VD2 A;  2EMS A;  1WGH A;  4EZL A;  4AJW A;  3ONS A;  4K2O A;  5TR5 A;  3ODW A;  4IWQ A;  4A6F A;  3E9P A;  3PT2 B;  3ZDT A;  3D32 A;  3PPA A;  3P6A A;  2BYF A;  3DBS A;  3ZKJ C;  1H10 A;  2GJY A;  1K8R B;  2XK5 B;  3DVN U;  2D07 B;  3PHW B;  2WX1 A;  3RZF A;  1UNQ A;  3DXC A;  1U5D A;  4FJY A;  3U8Z A;  1RFA A;  3ZVV A;  1WX7 A;  4HB2 B;  5KCV A;  2K8B A;  4DX9 0;  4HJK A;  2LI5 A;  1FXT B;  2KWC A;  4WJN A;  5C79 A;  4W9I A;  5D27 A;  2D2Q A;  1WFY A;  1MK9 B;  2KDI A;  1H4R A;  1MKE A;  1DYN A;  1EGX A;  4IUM B;  2W2X C;  1P1A A;  1GGO A;  3T9L A;  1M7E A;  1ZGU B;  1U27 A;  5C5B B;  2KN5 A;  1V5T A;  3RD2 A;  4J6I A;  4B9K A;  1LW3 A;  4WQO B;  2IY0 B;  2D9W A;  3L13 A;  4IM3 A;  1X1G A;  1IP9 A;  2LAS A;  3B1L X;  1KJT A;  2LVO A;  5GOW B;  4Z2M B;  2Z0O A;  3L10 B;  4XX5 A;  4MH0 E;  3R3M A;  4NAW B;  4MDK E;  5G2N A;  2HE7 A;  3PRE A;  2MDX A;  3JSV A;  2V3S A;  4FHJ A;  2NR2 A;  4IFS A;  2PEA A;  2K25 A;  2D9V A;  4MY6 A;  1SE9 A;  1LQB A;  4KHA A;  4TKN A;  2W2X D;  2DYO A;  1XD4 A;  1KI1 B;  3N3K B;  4M8N A;  5KHQ A;  2D10 A;  3Q3J A;  3AI5 A;  5KQ4 A;  3DCG A;  2XBB C;  3NS8 A;  3OJ4 B;  2E2X A;  1PMS A;  3HM6 X;  3TJP A;  4HAX B;  4W9L A;  4I6P A;  3L08 A;  1B55 A;  2N7E A;  1WMH B;  2C60 A;  3A8Q A;  2GBJ A;  1U5E A;  2KTR B;  4F7U P;  2N4F A;  4JKA A;  2KDF B;  5IJM A;  3DVG Y;  2P0D A;  4L6E A;  2FID A;  4JKH A;  5CX3 A;  3H7P A;  2DX5 B;  1U5G A;  3VUX A;  1MIZ B;  1KLV A;  2DFK A;  3KYC D;  2KAN A;  3A33 B;  1U2B A;  2DAF A;  2K8H A;  3APF A;  2GOW A;  4K7U A;  3GOE A;  3RUL A;  2NPT A;  2GBK A;  1BTK A;  4EJN A;  4JKG B;  1V5M A;  1LXD A;  1ZKH A;  1E90 A;  1XR0 B;  2COF A;  1ZSQ A;  3SUZ A;  2MRP A;  4K81 A;  2VKI A;  4IWO A;  4BVU C;  3HQC A;  4KZ0 A;  3TW1 A;  2V4L A;  4NAW A;  2ZVN A;  1NDD A;  2DKQ A;  1WXS A;  3W1Y A;  4P7I A;  1N3H A;  2DYB A;  2JWZ A;  3Q3F A;  1H8C A;  1WJ4 A;  3WAL A;  2JRH A;  1PLS A;  3QWM A;  2L3Z A;  2NS5 A;  1HE8 A;  1S3S G;  4FHK A;  2KNB A;  3SNH A;  3ML8 A;  3HIZ A;  2HTH B;  5DI9 B;  1TZ1 A;  2KTR A;  1YJ1 A;  5C1Z A;  1V80 A;  1CMX B;  2QKL A;  2ADZ A;  3KW5 B;  2DX5 A;  2NBW B;  2GMI C;  1EF1 A;  3BY4 B;  3O96 A;  2I5F A;  2JZ3 B;  2Z59 B;  4IC7 B;  4C0A A;  2LRW A;  3ZNH B;  2WH5 A;  4HB0 B;  1EVH A;  2YLM A;  2KVR A;  1WXA A;  1NU2 A;  4I6L B;  4HWI B;  3QQ8 B;  4HAZ B;  1K5G B;  5HE2 A;  2PJH A;  5LLI A;  2IO1 B;  3H6N A;  2KC2 A;  4HDQ A;  1BAK A;  4JK8 A;  1NTV A;  2YSZ A;  3VOQ A;  1NBF C;  4F7H A;  5J3T A;  1Z87 A;  3ZNI D;  4TUU A;  1W1H A;  2I1J A;  5JH5 C;  3GYO A;  5D3W A;  3QAR A;  5D7G A;  4DWF A;  2LGD A;  2ZPN A;  3PVL A;  2L05 A;  2KQS A;  2RSU A;  3AJ4 A;  2DX1 A;  3A98 B;  1XCG A;  1UGM A;  4WJQ A;  2L76 A;  4N9F 4;  1IYF A;  2DHK A;  3KRX A;  5DHF B;  4MM3 A;  5JVL A;  4FBJ B;  3VTU A;  2N1W A;  4W9K A;  1IRS A;  2FIF A;  4ZYN A;  4KSL C;  1XD3 B;  2MX2 A;  2FDQ A;  4AUQ C;  3ML4 A;  5CHF A;  4A20 A;  1I35 A;  4JGH B;  4CYE A;  1C1Y B;  4CHK A;  2YS1 A;  3H7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...