1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords RADIXIN
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
1RAXA 2KWUB 4IWPA 1UNRA 5CLLB 4FN2A 3ML4A 4A6KA 3IHPC 3NZUA 2MP2A 2NBWB 4ANUA 5J2RA 3M1IB 4M8MA 3DVNU 4PYZA 3W1SC 2KZRA 3MHSD 3SHQA 3CSFA 4YL8A 2LVQA 2P0HA 5EFXA 2M17A 2A5UA 3OJ3A 2VRWB 3VTUA 3ZDMC 1PLSA 4FJVB 3DVGX 4II2B 3N32A 2ZNVB 2CHXA 5D3YA 3PV1A 3X23A 2KFJA 2LXAA 2FIFA 4HAUB 1Z5SB 2DX5A 2IYDB 1WI1A 3UIPB 1IYFA 3FM8C 4IM2A 2YS3A 4F7GA 2LI5A 3RZWC 1NVLA 3IFWB 3QWZB 3UINB 1I2HA 3UF8A 2DYMA 1M7RA 2COAA 3PPAA 5AZGA 1WGQA 2DTCA 3PVWA 3HM3A 4GB9A 3SD5A 1X86A 5E6OA 3ZLZA 3N7CA 2IY1B 3PHXB 2BWES 4LDTB 4B6WA 2KWCA 4BOZB 3HIZA 3VVWB 2N9XA 4CYEA 4FJYA 3OANA 3A8PA 2V1YA 2LZ6A 2W2WA 3R7QA 3VTVA 2D3GA 3A9KA 3DDCB 5IJMA 2A4ZA 5D2MB 2K39A 4IW0A 3PZDA 4HDQA 2JWZA 4AUQC 2JPHA 3T06A 2LGDA 1HB6A 2KANA 3DBLI 4GMVA 2PE6B 4MJSB 4K2OA 4K17A 5KQ4A 1P1AA 3KYDD 4IM0A 2N7DA 4PS8A 4MT7A 1GJZA 4WVFB 4HATB 1YQBA 1Y8RC 2AL3A 2LXCA 2Y5BB 5CX3A 3L13A 5CHWA 3SDLC 3X0WA 5G55A 2JXXA 1WJUA 2ASQA 2XBBC 4G3XB 4JGHB 1J0GA 4JL9A 3KH0A 1E90A 1ZC3B 2W2XD 2COPA 2GCLA 1E8ZA 4MGKE 4Y94A 4L6EA 1G6JA 5AZFA 2DHIA 1V5UA 1XT9B 2DHJA 4DBBA 2KWVB 4HDOA 2LRUA 3R3MA 1WXAA 4HCNB 4HB2B 1WMHB 4HWIB 2KJRA 2DLWA 4FADA 2HJ8A 2C7NB 1SHCA 3G9WA 1WR1A 2MFQA 5FI0A 3T9LA 2RPQA 4FHJA 4ICVA 3MDBC 2IYBA 4K1RB 1S3SG 3W1YA 4X57B 5DI9B 3JYUA 4A6FA 4F7HA 2L0TA 3NSUA 2BGFA 3IG3A 1BTNA 3PVLA 1WXMA 1OQYA 3N30A 3R66C 1ZGUB 3TJPA 2Z0PA 3SO6A 4GOCA 1TZ1A 2J7QB 4EOYA 2M4NA 2KDIA 4EZKA 5HE2A 2D07B 4F7UP 2XK5B 3A1QA 1TBEA 2AEHA 1WMHA 2CQUA 3PHWB 4NPNA 3SUZA 4WJPA 3T8MA 4BKGA 4W9DA 2K1FA 1EAZA 4AWJA 4URKA 1KZGA 1RLFA 4EZJA 1PMSA 3PVUA 2W9NA 3VUYA 3HW2B 2O6VA 4KDIC 2NZ8B 3A4RA 2DFKA 3TO1A 4EMOA 2N1VA 2MWNB 3B08A 1K8RB 3H1UA 4KZ0A 1WZ3A 1TTNA 3VIAA 4MELA 1QZEA 1SIFA 4W9HA 2CODA 2ELBA 1UH6A 2ZNVC 1UEFA 4MGYE 1XD4A 3UGBB 3WIMA 1RRPB 4A5KA 3M62B 2MCNB 5DPWA 1OMWA 1GC7A 2EKEC 3U30A 1M94A 2FCQA 2Y8FA 1K5DB 2JZ3B 1OEYA 5JHGA 2KO3A 2R2OA 2H7EA 2LYDA 3GYOA 1TQZA 2WX0A 4OVUA 4DHJB 2YT0A 2J0JA 2KDFB 3D32A 3B1LX 2J0KA 4TYZA 2P8VA 3V5WA 1UZXB 2B3AA 3DCGA 3ZO5B 1MAIA 4MDKE 1ISNA 2L05A 4GIVA 3JSVB 4G0NB 5JZEB 2KHWB 4KV2A 2DYNA 2IO2B 2PJHA 5BO4B 3WAPA 4WWPA 1PFJA 1X1MA 3B0AA 5C1ZA 1BT0A 1ZM0A 3VUWA 2ZPYA 3AXCA 5IA7A 2WH5A 1Y19B 2JRHA 3ZNID 3FLVA 2H7DA 1GG3A 3N3KB 3QWMA 4MM3A 1XCGA 4W9KA 4HAXB 2DYBA 4GPTB 2N4FA 2KTFA 4GDKA 1E7VA 2M8SA 3RT3B 3DXEA 3WAMA 4BKSA 4ANWA 4M8NA 4WJOA 1TXDA 2BYFA 1Q1OA 3NHEB 1IRSA 1WJ1A 4KHAA 3KRWA 2W2XC 4D0NB 1WM3A 5LXIB 1KZ7A 2K2UA 2GBJA 1X11A 3TW1A 4KAXB 2K8HA 3SYXA 3NY5A 3DXCA 2G3QB 4GDLB 3ULCA 1P5TA 4NY0A 4ZRJA 2YRYA 3FSSA 3SV1A 4IAPA 1WY8A 2BKFA 2K6QA 2Z59B 3H6NA 3M95A 4W9GA 3Q3JA 4XX5A 4ZRIA 2AYOB 1FOEA 4HPMB 1U27A 2RVBB 3KSYA 2MBEA 3KVFB 3EHVA 2FNJB 2L8JA 2YS5A 1WG7A 1UBQA 2JRIB 2NR2A 3PRPB 4I6NB 3CMMB 2N0YA 1H8CA 3NOBA 3ZVVA 2EC1A 3C0RB 2DKPA 1DROA 4RM9A 1DDWA 4CHMA 1OTRB 3L16A 4LJOB 3A9JB 2DAJA 2KFKB 5JHHA 2YSZA 1WFYA 4DK5A 2Y8GA 1Z2MA 2QHOA 2LULA 3JVZX 3NZSA 3QJZA 4K7WA 4MGIE 3VTWA 1LM8B 1WI0A 1X05A 2HRJA 4IFSA 5C5BA 1XR0B 2BYVE 3KYCD 2ABDA 2BF8B 4N9F4 2ZVOA 3BJIA 4TKNA 2KK8A 2GCJA 2J0MA 2NMBA 4MEMA 5FI1A 3QX1A 1EF5A 2COCA 4KZCA 2Z0QA 4KIKA 4NNJB 4FLHA 2MBHA 3WAOA 4AJWA 4MSQB 2MWSB 2PE9A 1V49A 4A3PA 2L76A 2IFSA 3KW5B 4ANVA 4EUTA 5JHAA 5L83A 4P7IA 1WX7A 5D3VA 1MG8A 2P0DA 4H8SA 2CHZA 2XEWA 2LVPA 2MLBA 5E6PA 3H7SA 3RYTA 3A9JA 5KHQA 2C60A 2UZSA 3ZTCA 4DX90 3HK0A 5CHVC 3UIOB 4EZLA 1CMXB 2WWZA 3DBHI 5DH9B 1IP9A 1MIZB 5C6RA 3KY9A 5CHFA 1FGYA 3U8ZA 2DA0A 2E2XA 2VKIA 1LW3A 4GN1A 1WGDA 1WXSA 2JUOA 2Z0OA 2MBOA 3DPDA 1UNQA 2LOZA 3D8EA 1SE9A 3VHTC 1GUAB 5L81A 2LASA 2MBQA 4ICUA 4KIKB 5J3QA 4WAAA 2PPHA 4BVUC 1K5GB 2LBBA 1FGZA 1ZW7A 2L0FA 2CR5A 4EKUA 2BCJA 2KKCA 2MSED 2PEAA 1H4RA 2CS4A 2JT4B 3ULBA 3M63B 4II3B 3I3TB 4E71A 2D9YA 1UPRA 1P6SA 1ZC4B 2D9VA 2FCSA 1U5FA 3L54A 1E5WA 1V61A 3PREA 1U2BA 3QC8B 5JHBA 3AULA 3ZRCA 4IUMB 2CB8A 3GZNI 3OLMD 1AARA 4DBGA 1LB1A 1V9JA 2MW5A 3A9KB 4ANXA 4HB3B 2RGNB 2K2JA 1HE8A 1R4MI 3PRZA 2ELAA 4W9CA 5G2NA 3ZUNA 2LGYA 2YS1A 1OQNA 1U29A 1GNUA 3LDZE 2FUHB 3ZTDA 3AU5A 1SGHA 2Z0EB 4I6LB 2ZCCA 1BTKA 2DYOA 3HQCA 3U7DA 3NS8A 3QQ8B 4NJ7A 5DCNA 2HD5B 1ACAA 3D8FA 1E7UA 4B6HA 2ZZPB 5TR5A 4E74A 4A6HA 1MPHA 1NDDA 3VXWA 2LKOA 3ZKJC 5KHOA 2DX1A 4DHJD 1P3QU 1DDMA 3KZ1A 2GBNA 1P0RA 3V6EB 1C3TA 5CTRC 5LLIA 2DZIA 4I6PA 1I42A 4A20A 4NQKE 2ZJDA 4BBNF 3SU8X 2YVCA 1V80A 1HB8A 3KUCB 2L00B 4MSMB 2GBRA 1FHWA 2KUPA 2KLCA 2NCNA 3ALBA 5DIFB 4LCDE 4TV3A 3AU4A 1WVHA 1E8YA 1EO6A 1VCBA 2N23A 2KTRB 2JZZA 1TGZB 3APFA 3RD2A 5CLQB 1R4NI 1DBHA 4KSLC 1V81A 3PP2A 3VH3B 4TQ0A 3ZDTA 2KJHB 3WA0A 1LXDA 2KX0A 2KOXA 5D6JB 1VD2A 3VH4B 1H10A 3TFMA 2KX3A 4JLCA 2FAZA 2UYZB 2L3ZA 3FP5A 1I35A 3L17A 2G4SA 3KUZA 2O2VA 4HAZB 4DXAB 1OGWA 4IG7B 1WE6A 5GOWB 3ZW3A 2KDEB 3UQBA 1NU2A 3F5RA 3AJ4A 2K8CA 3QCAA 4WJNA 1NBFC 5E6NA 4F1SA 2GBKA 3O65B 4AOFA 2G35A 4XZ4A 2Y7BA 2HE7A 1NTIA 3RZFA 1FB8A 2ZPNA 4A6FB 3ZVRA 3Q3FA 2AL6A 1NTVA 2MP2B 3LJUX 2G4DB 2JY6A 3HHMA 3QA8A 2WYQA 4GSWA 4HB4B 4MK0A 3APCA 4NQLB 4WWNA 2YF0A 2KXJA 5J17A 3H7PA 3ZNHB 1WR6E 2KMCA 2VSZA 4BBNC 1KI1B 3K9OB 3PRMB 2V76A 1BAKA 1N3HA 5LONB 2D2QA 3H7PB 5D3XA 5DHFB 1PQSA 1WIAA 1YJ1A 2CU1A 2GMIC 3ODXA 1TJ6A 1MK7B 2CAYA 2DYQA 1OEYJ 2DHZA 1WGYA 2REXA 4W9LA 3ZIMA 4NAWB 2EMSA 2D11A 1KM7A 4RM8A 2GJYA 5DPTA 2VRRB 2HTHB 3F0WA 2KNBA 2KMAA 3IBEA 4DDGD 3DBRI 4Z2MB 1F9JA 3VOQA 1V5PA 2MA9B 4CO7A 3CXBB 1YX6B 5EDSA 2C5LC 2QKLA 2N7EA 4KDLB 1WJNA 2HTHA 1WE7A 2IBIB 2RQ1A 3EECA 2QKMA 2IO0B 3EC8A 2EJ8A 4FULA 4LJPB 2ADZA 4DHZE 5L95C 4Z2NA 1W1HA 1OY2A 3DVGY 2M1MA 2C7MB 3PGEA 5D7GA 2I1JA 3W1SA 1X1GA 1UPQA 1U5GA 2G45B 2KVRA 3DVNV 1L7YA 3ENEA 3KUDB 2DHKA 2D9WA 1RFAA 1WJ4A 1XQQA 2LWPA 2YLMA 1ZKHA 3ONSA 3RULA 5JH5C 2PZ1A 3QAQA 1B55A 3QARA 4BKSD 4NJ6A 3UZTA 3JSVA 4FJZA 2K25A 3PEGA 4MJSA 2L2IA 3PS6A 4NSWA 1WGRA 2KN5A 3ML8A 2C7HA 5DPSA 4B95A 1QC6A 2ROZB 2KCJA 3V6CB 3H9DA 4WWOA 3VAWA 1MKEA 2K6DB 4GDLA 2BPSA 1EF1A 3PSCA 3P6AA 4HAVB 4HHVA 2BKRB 4PYUA 2FCMA 4W9FA 4ZYNA 3V62A 4W9EA 4IOYX 4F7ZA 2RD0A 1WGHA 3M3JA 1V5MA 4GGQA 2GS0A 1V5TA 1WX9A 1WRDB 2V3SA 1GC6A 1HBKA 1Y5OA 2CKHB 2OJRA 4KSKC 4PS3A 3FEHA 1YIWA 3CF6E 3BINA 2YT1A 5J3YA 1IPGA 4WJ7A 1E8XA 2K00A 2WDTB 2MRPA 2JVCA 4W9JA 2FCNA 5KQ1A 2NPTA 2MDXA 5LXHA 4B9KA 2KD0A 3TMPB 4K7UA 5D3WA 1Z87A 1WJMA 1UELA 1RJ2A 2LVOA 1A5RA 3EPYA 2NS5A 3A98B 2KC1A 3VQIA 1J19A 5C5BB 2ZVNA 3PSEB 5JP4A 3DBSA 4HK2A 5GMVA 1WGUA 4K2PA 3DOWA 2RR9A 1WJ6A 2KFKA 2CHWA 3ODOA 2R09A 1ZSQA 2I1KA 5C79A 1MK9B 2LUEA 4JIOU 4TQ1A 4C0AA 2I5CA 1AWEA 2N1WA 2NBUA 4EFOA 5IAAC 4PNKA 2D4QA 4HB0B 1JRUA 2M0XA 4W9IA 1NI2A 1E8WA 3QIJA 3D8DA 1BWNA 2D9XA 3P2BA 1WM2A 4HXDA 2KGXB 3IVFA 4CHKA 2LRWA 1WGGA 1P3RA 2FDQA 2UWQA 3BY4B 2OQBA 5HE1A 3QHTA 3WYFB 1WH3A 1P98A 1ST7A 2CY5A 3SNHA 4WJQA 3VFKA 1UD7A 4IM3A 1EGXA 2L1CA 3PTFC 4K7SA 2R2QA 1M7EA 2IO1B 2O2VB 3O96A 1QQGA 3OAWA 2IY0B 3ODWA 3EFUA 4EJNA 1ZVRA 2LJ5A 3ECIA 3L0WB 2L7RA 1U5EA 3UQAA 4ZRKA 2DKQA 2Z0DB 5HKHA 2RUKB 2ZCBA 1V2YA 2DENB 2FJ9A 3L08A 4BFRA 1KLVA 3JW0X 2KDBA 2KLGA 2R0DA 2NBVB 5DPRA 1EVHA 2LD9A 5J3TA 4PQ0A 4GZUA 2MBBB 3ZRFA 2GBMA 2UVMA 4A3OA 3WALA 2DN6A 2DZJA 1I7AA 4RMAA 1V88A 2AWTA 3L10B 3TIXA 1J8CA 4J6IA 1XX0A 2RSGA 5KCVA 2ROVA 1LFDA 2K8BA 1XODA 4IWOA 4F8CB 2M14A 2O6VD 1FAOA 1U5DA 4FA6A 2ZEQA 3KRXA 4NAWA 2V4LA 3A33B 4DWFA 1UGMA 2KJ6A 3DQVA 3PT2B 2C9WB 1T0YA 2M38A 4M0WB 4WSFA 2IO3B 5J18A 1KJTA 5D94A 3ZNZB 2D10A 4HPLB 2BWFA 2N9PC 1V86A 3S2AA 4XWXA 2EMTA 2XQNM 1WYWB 2DX5B 1WXVA 1UNPA 4BKTA 2CY4A 2KQSA 2DZKA 2KQ7A 1AQCA 4K81A 5JLJB 2LOXA 4IC7B 3P7ZA 4KHOA 3CSTA 3ML9A 4E3CA 4KHBB 2JF5A 5HE3A 5LOPB 1V5OA 1XKEA 2BYEA 2RNRB 4BBKA 2N9EB 4G50A 3HM6X 4ZDVA 3VDZA 2JP2A 2X18A 3ZNGC 4HJKA 2OTXA 4DX8A 4DDID 1RRBA 1DDVA 1FHXA 4GMXB 1XD3B 2RGFA 1LQBA 3OJ4B 1J0WA 1NTYA 3PLUA 4G11A 4PS7A 4HCPB 1X1FA 2OOBB 4TUUA 5AZHA 4AJYB 3R7RA 1KOTA 3QK0A 1Q5WB 2I5FA 3K9PB 4GDKB 5D27A 2COFA 1FHOA 1YD8U 4LDTD 4GXBA 1D3ZA 3TL5A 4CHJA 3A4SC 5DHAB 1YX5B 2NPTB 4OVVA 2RLOA 4JQWC 3A8QA 4MY6A 4YONA 2DZMA 4GU2A 5C23A 4BOSC 2FIDA 4MGZE 2IZVB 2GOWA 1MIXA 4ASWC 1WF9A 1WZ0A 3MTNB 4IWQA 3LJ3A 1Q0WB 1UBIA 3GYPA 5C16A 2DAFA 3AI5A 2MKRA 3V60A 1S1QB 4EEWA 1W1DA 2MQJA 3CIKA 4MH0E 4HVBA 4FHKA 4DHZB 3A1QB 4KVGB 2MX2A 2FJLA 2J59M 2Q13A 2UZRA 2P0FA 3V61A 1L2NA 5HE0A 3MJWA 3TCAA 2KC2A 5AEKB 1V89A 2KTRA 2RSUA 3MPXA 1WX8A 2LGXA 2CRFA 4HAYB 3TBLD 3TVVA 1V6EA 4AP4C 3RCPA 1Q67A 3GOEA 5FR6A 4XC2A 2D9ZA 3PLVA 1FXTB 2WX1A 3WANA 2XK5A 4HLEA 3VUXA 1DYNA 3RCZA 3PG7A 4WQOB 2LG1A 4FBJB 4HAWB 3RUIB 2NVUI 3QBVB 1W1GA 1EUVB 1C1YB 3DXDA 1U4AA 2O6VB 1P9DU 3APDA
chains in the Genus database with same CATH superfamily
4FN2A 4IDIA 3DVNU 1HEZE 1CK1A 4YSXB 2JZPA 3RFZB 5EFXA 3OJ3A 2A5UA 2MEKA 3W9CB 3ZDMC 1PLSA 4II2B 3P4RB 3N32A 2ZNVB 1HA5A 1IYFA 4L1RA 3FM8C 4XWTA 1NVLA 3QWZB 1VJKA 1M7RA 3VH4B 2GRIA 3HM3A 5C3JB 3R2IA 4YWGG 1I4PA 1N62A 1KF6B 4KKJA 3N7CA 2D3BA 2IY1B 3PHXB 2BWES 4LDTB 1I4XA 3VVWB 2W2WA 3T3OA 1TY0A 1YJIA 3PZDA 2RPVA 2JWZA 2NMQA 3KYDD 2N7DA 4WVFB 4HATB 2LXCA 3SDLC 4S0RA 1OQRA 3MFGA 3KH0A 1VR9A 1XT9B 2LRUA 2DHJA 4DBBA 3AH7A 2BQQA 2KJRA 3ENBA 2DLWA 2H88B 1SHCA 4OHJA 2X0SA 1D5MC 3MDBC 1IGDA 5DI9B 3WCQA 4XWWA 2EKIA 1BTNA 3PVLA 4C7YA 3N30A 2BBCA 1ZGUB 2Z0PA 1TZ1A 4EZKA 4WJPA 2NBVA 3AM9A 2CQUA 2K1FA 2L1AA 4EZJA 1ZP0B 2KIGA 1E6EB 4KDIC 1F2RC 2WXGA 4EMOA 1FXAA 3H1UA 1A5RA 3VIAA 2CODA 1FPYA 3ZYYX 1XD4A 3UGBB 1RRPB 2MCNB 2L32A 1GC7A 4JKEA 2EKEC 3ZRCA 2FCQA 2JZ3B 4KX6B 5JHGA 1QQRA 2R2OA 2H7EA 1N60A 1TQZA 2YT0A 3B1LX 1SE4A 1ISNA 4GIVA 5BMGA 4G0NB 2R2YA 5BO4B 2IO2B 4IOIE 1PFJA 1BT0A 3AXCA 2MJ3A 3NVWA 1RWSA 3FLVA 1TYGB 1GG3A 3NVYA 1E7VA 3DXEA 3I9V1 3NHEB 1IRSA 2ZW0A 4LLGM 5J2RA 2W2XC 2GBJA 1M4VA 3AEBB 2FBWB 4GDLB 2YRYA 3SV1A 4W9GA 4XX5A 1JWBD 2RVBB 3KVFB 4YSYB 2L8JA 1WG7A 2NR2A 4I6NB 1EM7A 1H8CA 3KQ4A 3NOBA 1C76A 2DKPA 5E6NA 4AOFA 1OTRB 3L16A 4LJOB 3A9JB 1FRRA 2QHOA 4MGIE 3VTWA 1KFYB 1WI0A 1ZE3D 2KK8A 1KH0A 4MEMA 2PKOA 5G5HA 2MBHA 3NVZA 1YN4A 2ACZB 2WNMA 4A3PA 4P7IA 1WX7A 1ESFA 2LVPA 2MLBA 5KHQA 2UZSA 3NWDA 4WQMA 3EGRA 3DBHI 1MIZB 1L6VA 5C6RA 4XDDA 2E2XA 1FCCC 2Z0OA 5HHDG 3ETRA 3N1XC 5L81A 2LASA 3FILB 2CR5A 1B9RA 1WGKA 1SJED 2JT4B 3M63B 2D9YA 3L54A 3PREA 5JHBA 3KWLA 3GZNI 3OLMD 1AARA 4ANXA 4HB3B 2R61A 2BYTA 1VBGA 3U52E 1Q10A 3B9JA 2Z0EB 2ZCCA 2DYOA 3HQCA 3U7DA 1ACAA 1E7UA 4A6HA 1NDDA 2QCZA 1BMLC 1FXIA 4DHJD 3KZ1A 1IGCA 3P4SB 2V4IB 4C80A 1C3TA 5LLIA 4I6PA 3MC8A 1I42A 4NQKE 3SU8X 3ZQ4A 1V80A 1HB8A 4QAYA 3KUCB 2L00B 1BUIC 2KUPA 3ALBA 1PFDA 4WIPA 3AU4A 1CQVA 1FMAD 1VCBA 4TSSA 5CLQB 1R4NI 2PVOD 1H10A 4JLCA 2KX3A 2UYZB 2L3ZA 1I35A 3L17A 4WAFA 3KUZA 4NJCA 5EE1A 3ZW3A 3F5RA 3AJ4A 2K8CA 2N7JA 2BS4B 2ZW1A 2JY6A 1PDXA 4WWNA 2Z4DA 2YF0A 4D2KA 1KRHA 1WR6E 4BBNC 2VSZA 2QSDA 3AE4B 3R8BA 3K9OB 3OG5A 4HPPA 1GB4A 2D3CA 1MK7B 3ZIMA 1OEYJ 4W9LA 1CZPA 1SE2A 1N63A 4EOYA 1OQQA 1F9JA 4JKHA 4EE2A 3VOQA 1V5PA 5H92C 1WJNA 2LFIA 2HTHA 2IBIB 2RQ1A 3EECA 2EJ8A 4DHZE 4M01A 3RNCC 3DVGY 3HIEA 5D7GA 3Q8CA 4HKZE 3GP7A 3KUDB 2INCC 2DHKA 1RFAA 3IT6B 2PZ1A 4NJ6A 3UZTA 1QOBA 3P1MA 2K25A 3N1YC 3SFDB 3ML8A 4B95A 1ZPSA 1QC6A 2V0GA 2ROZB 1TS5A 1MKEA 2ICIA 4F7ZA 2FCMA 5D3IB 1GC6A 1HBKA 1Y5OA 1NYRA 4PS3A 2DNFA 2FE8A 3BINA 2YT1A 5J3YA 2WDTB 2NPTA 4K7UA 2KC1A 1MHXA 1VZ8A 3VQIA 1FEHA 1J19A 3PSEB 3DBSA 4K2PA 2CHWA 5C79A 2I5CA 2N1WA 5IAAC 4PNKA 4W9IA 3QIJA 1WM2A 4HXDA 3LB8C 3IVFA 1QOFA 1D4BA 3WYFB 1P98A 2WXHA 1EGXA 1R7SA 1YNTE 1C79A 4XYCA 1M7EA 1C4PA 1QQGA 3IXSA 3EFUA 5LNK1 4YXDB 3ECIA 2L7RA 2QEJC 2DKQA 2Z0DB 5HKHA 2RUKB 2ZCBA 1JCKB 4BFRA 2FJ9A 4K3BA 1EVHA 2MBBB 4PQ0A 2UVMA 5AUKA 3WALA 4CQNA 2DN6A 1MI1A 4J6IA 2WXJA 4ZHOA 1XODA 4IWOA 2M14A 1K52A 2O6VD 3NJTA 4NAWA 2BVCA 3DQVA 3V3XA 1KJTA 3ZNZB 1ZXIA 2N9PC 1V86A 3Q3MC 2KACA 1I4HA 2XQNM 2WXOA 4KHBA 2KQSA 2DZKA 4C00A 1AQCA 5JLJB 3CSTA 3B77A 1XKEA 2J53A 4DX8A 4GMXB 1XD3B 2RGFA 4TUUA 1NTYA 3PLUA 4P1CC 1X1FA 3BVGA 3ZJUA 4GDKB 3DWGC 5D27A 1YD8U 1D3ZA 4GXBA 3TL5A 3PO0A 3BYYB 4MY6A 2DZMA 4JWSC 4MT5A 2PTLA 3AEDB 2KMMA 3O13A 4IWQA 3GYPA 5C16A 1S1QB 4MH0E 3AECB 4KVGB 4JX1C 2FJLA 3V61A 1HZ5A 4JKGA 4HAYB 2WHIA 4PK1A 3RCPA 3PLVA 2WX1A 4L1BA 2XK5A 3MC9A 1EUVB 1U4AA 2O6VB 1P9DU 1RAXA 2J52A 1UNRA 5CLLB 2PVGC 3IHPC 4A6KA 4ANUA 4LNOA 3OHMB 2CJNA 2KZRA 3MHSD 3CSFA 1TS4A 4YL8A 2M17A 3DVGX 2YEPF 5BYSA 3PV1A 5D3YA 4DXGA 2LXAA 4HAUB 2DX5A 4IM2A 1MI0A 4F7GA 2LI5A 3PPAA 5AZGA 1WGQA 2DTCA 3SD5A 4A8XC 5E6OA 2MH7A 3FKYA 1L0XB 2E6XA 1MVKA 3EUB2 1HQRD 1HZ6A 2LZ6A 3R7QA 5IJMA 2WU2B 2K39A 5E6PA 2KANA 2PE6B 5KQ4A 4MT7A 2WDQB 1Y8RC 3X0WA 2WDVB 3L13A 5CHWA 3BIID 5G55A 1XCTL 4JGHB 4MH8A 3W2DA 1E90A 1E8ZA 4ILJA 4MGKE 2Q5WD 5AZFA 3Q14C 2KWVB 3R3MA 4HCNB 1WXAA 1EWYC 2JQRB 3G9WA 2CU3A 2MFQA 5FI0A 2OJWA 2RPQA 4HROA 1ET9A 3RNAC 4X57B 3JYUA 1FNVA 2BGFA 4MM3B 2LGIA 1WXMA 3IG3A 1TT5B 3Q69A 3TJPA 3SBGA 2M4NA 5HE2A 4F7UP 1WMHA 3PHWB 3SUZA 3GE3C 4LTUA 4AWJA 4URKA 1PMSA 3DHIC 3PVUA 3VUYA 3A4RA 3TO1A 5TSSA 1K8RB 1WZ3A 1QZEA 1SIFA 3SEBA 2ELBA 1UH6A 2ZNVC 4PT5A 1OMWA 3U30A 2KO3A 2Y8FA 3VXWA 1OEYA 2LYDA 5FKAC 2J0JA 3D32A 4G11A 3ZO5B 2B3AA 4GOUA 3V5WA 1UZXB 4OZCA 1MAIA 3ABVB 2L05A 3DBHB 1X1MA 2ZPYA 1Y19B 2H7DA 4JK7A 3AV8A 3H8HA 1DIKA 4HAXB 4ANWA 2BYFA 1Q1OA 1VLBA 1WM3A 4KHAA 3KRWA 5LXIB 4D0NB 1X11A 4FXCA 3SYXA 3NY5A 2LGSA 4ZRJA 1WY8A 2Z59B 1VBHA 3Q3JA 3NS1A 1FOEA 3EFCA 2MBEA 3VH3B 4ILGB 4WJOA 2FNJB 3PRPB 2YS5A 1UBQA 1RYJA 2JRIB 1I4GA 3CMMB 3L4PA 2EC1A 1BXTA 3C0RB 4F8CB 4DK5A 2DAJA 2YSZA 4LK0M 2Y8GA 3QJZA 2W82A 1X05A 5C5BA 3KYCD 2BF8B 4N9F4 2WU5B 1JDEA 4TKNA 4LNNA 2GCJA 2J0MA 2M19A 3TUOA 5JXVA 2COCA 2Z0QA 4FLHA 3BK1A 4AJWA 1L0YB 4C7ZA 4EUTA 2RDGA 2IPKD 5D3VA 1MG8A 2ON8A 3Q8BA 4H8SA 1AWDA 2XEWA 4YTNB 3H7SA 3RYTA 3NRZA 2K8EA 4EZLA 5CHVC 1J7AA 3E9OA 1GAQB 1FFVA 3KY9A 5CHFA 2N9XA 1WGDA 2MBOA 3VHTC 2LOZA 1SE9A 3D8EA 1SBBB 4KIKB 2K9XA 4BVUC 1K5GB 2LBBA 1ET6A 1FGZA 1JWUD 4HJGE 2MSED 2PEAA 2WLBA 4II3B 2M56B 4E71A 2J42A 1V61A 3UI3A 4RGMA 2CB8A 1LB1A 1HE8A 1R4MI 1F2RI 1FD6A 1TY2A 3LDZE 2YS1A 1OQNA 3ZTDA 2V3NA 3QQ8B 2QMTA 3NS8A 3B2GA 2HD5B 2QILA 1C78A 3BK2A 1UUPA 3ZKJC 3AE8B 1P3QU 3DHHC 2GBNA 2DZIA 3IAS1 4KKIA 4A20A 4BBNF 2YVCA 1DOIA 3Q3NC 2KLCA 4LCDE 2JSVX 4JKGB 1TGZB 2OHFA 3RD2A 1YN3A 1ZDXA 1VRAB 2KJHB 1LXDA 2KX0A 2KOXA 4ZOHC 3BVMA 2VH1A 1OGWA 1WE6A 3UQBA 2JXTA 1OFFA 1NBFC 4F1SA 2SAKA 3LYYA 2Y7BA 2HE7A 4A6FB 3FAHA 3HHMA 3DWMA 3DBLB 5J17A 3ZJVA 2I38A 4OZBA 2V76A 1N3HA 2XNAC 3H7PB 5D3XA 5DHFB 2CU1A 2GMIC 4YTMB 1IBXB 3KLSX 2CAYA 2DHZA 3AMZA 4RM8A 4C4VB 2HTHB 1QLBB 3IBEA 4DDGD 2IJ0A 2KR0A 4H2AA 2MA9B 4CO7A 3W5UB 1WE7A 4M02A 2IO0B 2PLPA 3AEFB 1W1HA 2X8XX 3PGEA 2I1JA 3W1SA 1X1GA 3ENEA 1WJ4A 2TSSA 3QAQA 3JSVA 3PEGA 4MJSA 2DWQA 3A58A 5LG4B 5DPSA 3RPFC 3H9DA 3TSSA 5G5GA 3P6AA 4HHVA 3NZ3A 1LGRA 5IOIA 3MC0B 1KBLA 1WGHA 3M3JA 2GS0A 1V5TA 3AE5B 2CKHB 2D5GA 4KSKC 3FEHA 5E6JA 4WJ7A 1D5ZC 2K00A 5KQ1A 1FNUA 2KD0A 3TMPB 4WURA 3U4EG 1UELA 1RJ2A 2QIEB 1FCLA 3J9CA 2NS5A 1WGUA 2IGHA 1RM6C 3DOWA 5BMHA 2I1KA 4C0AA 1AWEA 2NBUA 4HB0B 1NI2A 1E8WA 2KWDA 3P2BA 1C4CA 2WXPA 4LNFA 3P4QB 1P3RA 4DIXA 3QHTA 2KN4A 4RGTA 1AYFA 3VFKA 3ZXVA 4K7SA 2R2QA 2IO1B 4YTPB 2IY0B 3ODWA 1TKGA 4EJNA 1FO4A 1DGJA 2FUG1 1XXGA 2WXIA 2W55A 2W3SA 2DENB 2KDBA 1NYQA 4REZA 3ZRFA 4A3OA 1XX0A 1YOVB 1F1HA 5KCVA 1UWMA 2ROVA 3W5VB 2PMVA 4FA6A 5H8YE 1UGMA 2KJ6A 5MPOA 2C9WB 1T0YA 1J7CA 2V3PA 1JWMD 5D94A 1N5XA 4HPLB 3RN9C 3E9LA 2WS3B 4XWXA 2EMTA 2BB6A 1UNPA 4BKTA 2CY4A 1EU4A 1C9FA 1ZUD2 2LOXA 5HE3A 2N9EB 1TKYA 4BZAA 4DXFA 2JP2A 4HJKA 1KOTA 1RRBA 1LQBA 4PS7A 4XDCA 3R7RA 2MJEA 3K9PB 4LDTD 2INDC 1I4RA 2FIDA 2IZVB 1WF9A 3RNGC 3CIKA 3A1QB 2IDYA 2IGGA 2J59M 2Q13A 4AS1A 3TCAA 2KC2A 5AEKB 2RSUA 3MPXA 2BB5A 2LGXA 3TVVA 2WXFA 4AP4C 2Y5PA 4KGSA 2KYWA 5FR6A 3PZ7A 4HLEA 3RCZA 4WQOB 2LG1A 3BVZA 4HAWB 2IGDA 3RUIB 3ZXRA 2L52A 2HTME 3NUHB 1YJJA 3T3NA 1C1YB 3DXDA 2JYTA 3APDA 4QJ5B 4IWPA 3ML4A 4A90A 2MP2A 1YMHE 4M8MA 1SJHD 4PYZA 2G9HD 1PYWD 3SHQA 1UF0A 2LVQA 2P0HA 2VRWB 3MJ5A 1JWAD 3RNEC 2KFJA 1E7PB 2FIFA 4YT0B 1JROA 3UIPB 2YS3A 3IFWB 5HG2A 3UINB 1I2HA 3FILA 1KLGD 2I2YA 2DYMA 2COAA 3PVWA 3HVDA 4A55A 1VDVA 4S17A 1ROEA 4BOZB 3HIZA 3SFEB 3AEAB 4CYEA 4FJYA 2V1YA 3A9KA 1HTOA 1N5WA 4O1NA 1XLOA 4HDQA 2K3UA 1T77A 3Q3OC 2JPHA 3T06A 2LGDA 3DBLI 4K2OA 1P1AA 4JKCA 1GJZA 2KIEA 1MG4A 1KLUD 1ZC3B 2GCLA 5IP4D 4L6EA 2DHIA 1V5UA 2INPE 2QJLA 4HB2B 2YT2A 2HJ8A 1WR1A 3T9LA 4FHJA 1S3SG 3W1YA 1AN8A 4B0MA 3NSUA 4QJ4B 3AEGB 2RDBC 3SO6A 3ZJTA 1TJEA 1F77A 2J7QB 2KDIA 2D07B 3A1QA 4NPNA 1TBEA 2AEHA 3T8MA 4W9DA 1EAZA 5GXGB 1KZGA 1T3QA 2W9NA 1PGXA 3I63C 1R4MB 2N1VA 4KZ0A 4CHKA 4MELA 2OEDA 1TTNA 4W9HA 4MGYE 3SR6A 1SE3A 3NW8A 4LNIA 4OVZA 4GNKB 1M94A 1K5DB 2WX0A 3TEXA 3GYOA 4OVUA 2KDFB 2J0KA 4TYZA 1FIQA 1QILA 3DCGA 2KHWB 4KV2A 2DYNA 4WWPA 5C1ZA 1ZM0A 1TS3A 3ZNID 3N3KB 3QWMA 4W9KA 1JALA 4J3OD 2DYBA 4GPTB 2GI9A 2M8SA 3NWAA 1XLQA 2K0PA 2XN9C 1WJ1A 2K2UA 4KAXB 4RGOS 3DXCA 3ULCA 4NY0A 2BKFA 1XLNA 4IAPA 1L0VB 2K6QA 3M95A 4ZRIA 2AYOB 1KLVA 1U27A 3V60A 3KSYA 4L2YA 3VRBB 4RNAA 4RM9A 1DROA 4DHJB 4CHMA 1E9MA 4USAA 2KFKB 3NZSA 4IFSA 2BYVE 2ABDA 2ZVOA 3BWUD 3BJIA 3P4PB 2NMBA 5FI1A 4XGAB 3DBRB 1EF5A 4KZCA 3WAOA 1WSPA 2KT7A 2MWSB 2PE9A 2L76A 3KW5B 4ANVA 5JHAA 5EE9A 2CHZA 3A9JA 1NVID 2C60A 3TEZA 3UIOB 2WWZA 4OT1A 2ZKMX 2DA0A 4GN1A 2VKIA 3DPDA 1WXSA 1UNQA 2LJIA 4OW0A 4ICUA 5J3QA 1SSNA 2PPHA 4IKGA 1DOYA 2L0FA 2R82A 1L4DB 1H4RA 2CS4A 3ULBA 1UPRA 1ZC4B 2D9VA 1U5FA 1E5WA 2KUQA 1U2BA 3QC8B 3AULA 3E66A 1T0QC 2WXKA 3CIRB 4DBGA 3KWVA 3A9KB 5J18A 2RGNB 2K2JA 1VZ6A 5G2NA 4W9CA 2ELAA 3ZUNA 5JZEB 2LGYA 1GNUA 1U29A 2FUHB 1EWCA 3AU5A 1ZYIA 1BTKA 4NJ7A 5DCNA 1V8CA 3D8FA 5TR5A 4B6HA 3Q8EA 1DDMA 5CTRC 4ZYSA 2ZJDA 1MPEA 4MSMB 2GBRA 4ILHA 1FHWA 1WVHA 1E8YA 1EO6A 1XLPA 2N23A 2KTRB 3IT4B 1FNWA 1SXTA 4KSLC 3ZDTA 1F0ZA 3WA0A 2WQYB 1VD2A 3FP5A 2G4SA 2O2VA 4HAZB 4DXAB 4IG7B 2KDEB 1IUEA 3QCAA 4WJNA 2GBKA 2G35A 1B1ZA 1STEA 2ZPNA 3VR8B 3ZVRA 1WYGA 2AL6A 1NTVA 2MP2B 3LJUX 3Q3FA 4GSWA 1UNSA 4HB4B 4MK0A 4NQLB 2KXJA 3H7PA 2KMCA 3AB5A 5LONB 2D2QA 1T0SC 1YJ1A 1KTKA 1TJ6A 2REXA 4HSIA 3NG0A 4NAWB 5DPTA 2D11A 2GJYA 1CJEA 2VRRB 3CXBB 1YX6B 4XE0A 2C5LC 2N7EA 4C4VA 2E3TA 2QKMA 3EC8A 4LJPB 2ADZA 1HTQA 2M1MA 2INNE 2KVRA 1UPQA 2G45B 3RZWC 1L7YA 1MJDA 3ONSA 2YLMA 4ZHPA 1XQQA 3RULA 3P42A 1L6UA 1B55A 4BKSD 4FJZA 2L2IA 3PS6A 1WGRA 2KN5A 3URYA 4RGNA 3VRAB 3V6CB 4WWOA 4GDLA 2BPSA 1EF1A 4PYUA 5D3DA 4W9FA 3V62A 4IOYX 2DLBA 2RD0A 2V3SA 3TEWA 1YIWA 1IPGA 1E8XA 2JVCA 4B9KA 1ENFA 5D3WA 1JRPA 1WJMA 2LVOA 2VH2A 3EPYA 3EA6A 2LUMA 5JP4A 4HK2A 2J4XA 3AEEB 1QT9A 2KFKA 4BKSA 3ODOA 1ZSQA 2LUEA 1MK9B 4AQ7A 2JU6X 3R2TA 2D4QA 1BWNA 5BYQA 3AE9B 4YSZB 1WGGA 2UWQA 3BY4B 2OQBA 4US9A 1WH3A 2CY5A 3SNHA 4IM3A 2L1CA 1YQ4B 1TZOA 3PTFC 4K3CA 4P6VF 2O2VB 3OAWA 2WXMA 2LJ5A 2SEBD 3L0WB 1U5EA 3UQAA 3L08A 4UDUC 2WXQA 1GB1A 5IN7A 2H89B 3MP9A 1QOAA 3Q6BA 5DPRA 5J3TA 1MFWA 4RMAA 1V88A 2AWTA 3L10B 3TIXA 5FK9C 5JVLA 3SBTA 1TKEA 2AQ1B 2RSGA 2DIKA 4R3DA 1U5DA 2ZEQA 3KRXA 4QXAB 3PT2B 1V1PA 2M38A 4M0WB 4WSFA 2IO3B 1QOGA 2D10A 4MACA 2Z13A 2BWFA 3HVZA 3S2AA 1WXVA 4A6QA 2WXLA 4K81A 3OWEB 3P7ZA 4KHOA 1UWXA 3ML9A 3Q2AC 1PUTA 1V5OA 2LHEA 5LOPB 1R4NB 2BYEA 2RNRB 2N0SB 4ZDVA 3VDZA 2X18A 3ZNGC 4DDID 1DDVA 1FHXA 4RF0A 1J8CA 3OJ4B 1J0WA 4OSNA 5AZHA 4JPSA 4LNKA 3QK0A 2I5FA 4ARCA 1E10A 3FVCA 1FHOA 2NPTB 4OVVA 5C23A 2RLOA 4JQWC 3A8QA 4YONA 4WH4A 4GU2A 4BOSC 1MIXA 3MTNB 5IRSA 2DAFA 1UBIA 1WRIA 1ZDVA 4EEWA 5FR3A 1WXQA 2MQJA 4HVBA 4FHKA 4DHZB 2UZRA 1L2NA 5HE0A 1V89A 2WGSA 4RH6A 3RNFC 1WX8A 1SIJA 4Q2JA 1V6EA 2Z8LA 2D9ZA 2NVUI 3QBVB 1W1GA 1SB3C 1JQ4A 3N9YC 1P7EA 1UGJA 2KWUB 3MHZA 2KAJA 3NZUA 2NBWB 3M1IB 3W1SC 2FJUB 4HKQA 3IAM1 3RNBC 3VTUA 4FJVB 4WWMA 4ACFA 4ZRPA 2CHXA 3X23A 3N1ZC 1Z5SB 2IYDB 1WI1A 2N9KA 1NEKB 3UF8A 4GB9A 1X86A 2L83A 1V1PB 3ZLZA 4RF1A 2KWCA 4B6WA 3Q8AA 5EE0A 4M00A 2KVZA 2AQ3B 3HRDD 3OANA 3A8PA 3VTVA 2D3GA 3DDCB 2A4ZA 5D2MB 4IW0A 3PZ8A 2VZKB 1KC7A 3CWIA 4AUQC 2GUMA 2UU7A 2LEKA 1HB6A 3ZGZA 4GMVA 4MJSB 4K17A 4IM0A 4PS8A 1YQBA 2BW2A 2AL3A 2Y5BB 5CX3A 2JXXA 1WJUA 2ASQA 4ITKA 2XBBC 4G3XB 1J0GA 4JL9A 1AW7A 2W2XD 1K50A 2COPA 4Y94A 1XO3A 1G6JA 3NWFA 2X38A 2W54A 2Y5CA 3E9SA 4HDOA 3V05A 4HWIB 1WMHB 1N61A 4HEA1 2C7NB 4ICVA 4NZLB 2IYBA 4K1RB 1L4ZB 4A6FA 4F7HA 2L0TA 1FM0D 2PIAA 1OQYA 3R66C 4QJ3B 1NENB 4GOCA 2XK5B 4JWUC 4BKGA 2RDHA 1RLFA 3N20C 3HW2B 1NI3A 2O6VA 2NZ8B 4P1BC 2DFKA 2K49A 2MWNB 3B08A 2HJ1A 4RFBA 3AE2B 1XCQL 5I2MA 1UEFA 1J7BA 1C4AA 1IBXA 4A5KA 1T6BX 2K22A 3M62B 4A9AA 5DPWA 1GPXA 2Z14A 2VZKD 3E56A 3AE6B 2YEPB 2P8VA 4P16A 4M0WA 4MDKE 3JSVB 1XEEA 2Z59A 2PJHA 3WAPA 3C19A 3B0AA 5IA7A 2W3RA 2WH5A 2JRHA 1XCGA 1QKZA 2JX5A 1JMLA 2N4FA 2KTFA 2AX5A 4GDKA 3WAMA 3RT3B 4M8NA 1TXDA 1N6ZA 1GOZA 1KZ7A 2K8HA 3TW1A 2BTEA 1DOXA 2G3QB 1P5TA 3FSSA 1C77A 2V9HA 3H6NA 4KDLB 3P63A 1FFUA 2G1EA 4HPMB 1XF5L 3EHVA 2KQ4X 2QDFA 2N0YA 1ACCA 1PGBA 5IO9A 3ZVVA 4HRSA 1DDWA 2NTTA 2MHJA 5JHHA 1WFYA 3RMKC 1Z2MA 5M4YB 2LULA 3JVZX 4K7WA 1LM8B 4L23A 2HRJA 1XR0B 1P7FA 3AE3B 1K51A 1MHHE 2BS2B 3QX1A 4NNJB 4ARIA 3BYTB 4KIKA 2GLSA 2M0AA 4MSQB 1V49A 2JYEA 2IFSA 5L83A 3AE7B 2P0DA 3C8YA 1E0ZA 3ZTCA 4DX90 3HK0A 1CMXB 5DH9B 1IP9A 3NVVA 2QC8A 1FGYA 2JUOA 3U8ZA 1LW3A 4MM3A 1GUAB 2MBQA 4WAAA 1V97A 1ZW7A 4BAXA 4EKUA 2BCJA 2KKCA 2NTSA 2RMMA 1T0RC 3I3TB 3HSAA 3BZDB 1VZ7A 2EELA 1P6SA 2FCSA 4IUMB 3I5JC 2MW5A 1V9JA 1T5XD 4FADA 4JKFA 3PRZA 2JWUA 4I6LB 1SGHA 4US8A 3AN1A 4E74A 2ZZPB 1MPHA 1ZOYB 2LKOA 1TS2A 2DX1A 1GGOA 2DBYA 1P0RA 2WXNA 3V6EB 2WP9B 1JW9D 2WDRB 3U12A 1Y56A 2NCNA 5T8IA 5DIFB 4TV3A 4C56C 2JZZA 2KDMA 3APFA 1DBHA 4TQ0A 1V81A 3PP2A 4N58A 5D6JB 3TFMA 3LXFA 3GS2A 2FAZA 5GOWB 1NU2A 4D6WA 1EU3A 1I4QA 3O65B 4XZ4A 3RZFA 1NTIA 1FB8A 3QA8A 2G4DB 2WYQA 3APCA 3ZNHB 2CJOA 2PW9A 3Q8FA 4CSQA 4OZAA 1KI1B 3PRMB 1BAKA 1PQSA 1WIAA 5KHOA 3ODXA 2DYQA 2Y3AA 3DCXA 1WGYA 2EMSA 1KM7A 2KNBA 3F0WA 2KMAA 3DBRI 4Z2MB 5C2TB 5EDSA 2QKLA 2B76B 2GB1A 4FULA 1WWTA 5L95C 4Z2NA 1OY2A 2C7MB 1SF0A 1U5GA 3DVNV 1YN5A 2D9WA 1D5XC 2LWPA 5JH5C 1ZKHA 3QARA 4B0EA 4NSWA 1LO5D 2C7HA 2MJDA 2KCJA 4ZRQA 4JK8A 3VAWA 2K6DB 3PSCA 1PGAA 4HAVB 2BKRB 4ZYNA 5EE3A 3GE8C 4W9EA 1V5MA 4GGQA 3B2FA 1WX9A 5HFYA 1WRDB 5HI1A 2OJRA 3E9PA 3CF6E 4W9JA 3VUWA 3WIMA 5LXHA 2MRPA 2FCNA 2MDXA 1Z87A 1A70A 4JKAA 3A98B 3GB1A 5C5BB 2ZVNA 5AUIA 5GMVA 2BT6A 1K53A 2N9LA 2RR9A 1WJ6A 2R09A 5I4DA 4TQ1A 4JIOU 1RFKA 5BMIA 4EFOA 2RRFA 1JRUA 4NAMA 2M0XA 5BYRA 3D8DA 2D9XA 2KGXB 2LRWA 2HDEA 2FDQA 5HE1A 1ST7A 3GZNB 4WJQA 1UD7A 4RCOA 4KGTA 3O96A 3I57A 2LMCA 1ZVRA 4JKDA 1QF6A 4ZRKA 1V2YA 1L5PA 2D3AA 3JW0X 2KLGA 2R0DA 2NBVB 2LD9A 4GZUA 2GBMA 2DZJA 1I7AA 1F52A 1ZXHA 1LFDA 2K8BA 1FAOA 4GLSC 2V4LA 1FRDA 3A33B 4DWFA 3AE1B 3VR9B 1JWSD 1WYWB 2LHDA 2DX5B 4JKBA 2AQ2B 2KQ7A 1HXYD 4IC7B 5IKCM 4E3CA 4KHBB 2JF5A 1TIFA 4BBKA 4KGRA 4G50A 3HM6X 4DQOC 2OTXA 4JE3B 4HCPB 2OOBB 4AJYB 2ONQA 3HUIA 1Q5WB 2COFA 5I2SA 4CHJA 3A4SC 5DHAB 1YX5B 3RI7C 1I7HA 4MGZE 1YQ3B 2GOWA 4ASWC 1WZ0A 1SEBD 4N59A 2K5PA 3LJ3A 1Q0WB 3AI5A 2MKRA 3TEYA 1W1DA 2MX2A 2P0FA 3MJWA 3U2SC 2KTRA 3FC4A 2CRFA 3TBLD 1Q67A 3GOEA 4N6EB 1D6EC 4XC2A 2WXRA 1FXTB 3WANA 2BS3B 1V1OA 3VUXA 1DYNA 4FBJB 3PG7A 3DHGC 4JK9A 1DYQA 4TMAB 3U7ZA
chains in the Genus database with same CATH topology
4FN2A 3DVNU 5EFXA 3OJ3A 2A5UA 3ZDMC 1PLSA 4II2B 3N32A 2ZNVB 1IYFA 3FM8C 1NVLA 3QWZB 1M7RA 3VH4B 3HM3A 3N7CA 2IY1B 3PHXB 2BWES 4LDTB 3VVWB 2W2WA 3PZDA 2JWZA 3KYDD 2N7DA 4WVFB 4HATB 2LXCA 3SDLC 3KH0A 1XT9B 2LRUA 2DHJA 4DBBA 2KJRA 3ENBA 2DLWA 1SHCA 2X0SA 3MDBC 5DI9B 1BTNA 3PVLA 3N30A 1ZGUB 2Z0PA 1TZ1A 4EZKA 4WJPA 2CQUA 2K1FA 4EZJA 4KDIC 4EMOA 3H1UA 1A5RA 3VIAA 2CODA 1XD4A 3UGBB 1RRPB 2MCNB 1GC7A 4JKEA 2EKEC 3ZRCA 2FCQA 2JZ3B 5JHGA 2R2OA 2H7EA 1TQZA 2YT0A 3B1LX 1ISNA 4GIVA 4G0NB 5BO4B 2IO2B 1PFJA 1BT0A 3AXCA 3FLVA 1GG3A 1E7VA 3DXEA 3NHEB 1IRSA 5J2RA 2W2XC 2GBJA 4GDLB 2YRYA 3SV1A 4W9GA 4XX5A 2RVBB 3KVFB 2L8JA 1WG7A 2NR2A 4I6NB 1H8CA 3NOBA 5E6NA 2DKPA 4AOFA 1OTRB 3L16A 4LJOB 3A9JB 2QHOA 4MGIE 3VTWA 1WI0A 2KK8A 4MEMA 2MBHA 4A3PA 4P7IA 1WX7A 2LVPA 2MLBA 5KHQA 2UZSA 3DBHI 1MIZB 5C6RA 2E2XA 2Z0OA 5L81A 2LASA 2CR5A 2JT4B 3M63B 2D9YA 3L54A 3PREA 5JHBA 3GZNI 3OLMD 1AARA 4ANXA 4HB3B 1VBGA 2Z0EB 2ZCCA 2DYOA 3HQCA 3U7DA 1ACAA 1E7UA 4A6HA 1NDDA 4DHJD 3KZ1A 1C3TA 5LLIA 4I6PA 1I42A 4NQKE 3SU8X 1V80A 1HB8A 3KUCB 2L00B 2KUPA 3ALBA 3AU4A 1VCBA 5CLQB 1R4NI 1H10A 4JLCA 2KX3A 2UYZB 2L3ZA 1I35A 3L17A 3KUZA 3ZW3A 3F5RA 3AJ4A 2K8CA 2JY6A 4WWNA 2YF0A 1WR6E 4BBNC 2VSZA 3K9OB 1MK7B 3ZIMA 1OEYJ 4W9LA 4EOYA 1F9JA 4JKHA 3VOQA 1V5PA 1WJNA 2HTHA 2IBIB 2RQ1A 3EECA 2EJ8A 4DHZE 3DVGY 5D7GA 3KUDB 2DHKA 1RFAA 2PZ1A 4NJ6A 3UZTA 2K25A 3ML8A 4B95A 1QC6A 2ROZB 1MKEA 4F7ZA 2FCMA 1GC6A 1HBKA 1Y5OA 4PS3A 3BINA 2YT1A 5J3YA 2WDTB 2NPTA 4K7UA 2KC1A 3VQIA 1J19A 3PSEB 3DBSA 4K2PA 2CHWA 5C79A 2I5CA 2N1WA 5IAAC 4PNKA 4W9IA 3QIJA 1WM2A 4HXDA 3IVFA 3WYFB 1P98A 1EGXA 1M7EA 1QQGA 3EFUA 3ECIA 2L7RA 2DKQA 2Z0DB 5HKHA 2RUKB 2ZCBA 4BFRA 2FJ9A 1EVHA 2MBBB 4PQ0A 2UVMA 3WALA 2DN6A 4J6IA 1XODA 4IWOA 2M14A 2O6VD 4NAWA 3DQVA 1KJTA 3ZNZB 2N9PC 1V86A 2XQNM 2KQSA 2DZKA 1AQCA 5JLJB 3CSTA 1XKEA 4DX8A 4GMXB 1XD3B 2RGFA 4TUUA 1NTYA 3PLUA 1X1FA 4GDKB 5D27A 1YD8U 1D3ZA 4GXBA 3TL5A 4MY6A 2DZMA 4IWQA 3GYPA 5C16A 1S1QB 4MH0E 4KVGB 2FJLA 3V61A 4JKGA 4HAYB 3RCPA 3PLVA 2WX1A 2XK5A 1EUVB 1U4AA 2O6VB 1P9DU 1RAXA 1UNRA 5CLLB 3IHPC 4A6KA 4ANUA 2KZRA 3MHSD 3CSFA 4YL8A 2M17A 3DVGX 3PV1A 5D3YA 2LXAA 4HAUB 2DX5A 4IM2A 4F7GA 2LI5A 3PPAA 5AZGA 1WGQA 2DTCA 3SD5A 5E6OA 2LZ6A 3R7QA 5IJMA 2K39A 5E6PA 2KANA 2PE6B 5KQ4A 4MT7A 1Y8RC 3X0WA 3L13A 5CHWA 5G55A 4JGHB 1E90A 1E8ZA 4ILJA 4MGKE 5AZFA 2KWVB 3R3MA 4HCNB 1WXAA 3G9WA 2MFQA 5FI0A 2RPQA 4X57B 3JYUA 2BGFA 3IG3A 1WXMA 3TJPA 3SBGA 2M4NA 5HE2A 4F7UP 1WMHA 3PHWB 3SUZA 4AWJA 4URKA 1PMSA 3PVUA 3VUYA 3A4RA 3TO1A 1K8RB 1WZ3A 1QZEA 1SIFA 2ELBA 1UH6A 2ZNVC 1OMWA 3U30A 2KO3A 2Y8FA 3VXWA 1OEYA 2LYDA 2J0JA 3D32A 3ZO5B 4G11A 3V5WA 2B3AA 1UZXB 1MAIA 2L05A 1X1MA 2ZPYA 1Y19B 2H7DA 4JK7A 1DIKA 4HAXB 4ANWA 2BYFA 1Q1OA 1WM3A 4KHAA 3KRWA 5LXIB 4D0NB 1X11A 3SYXA 3NY5A 4ZRJA 1WY8A 2Z59B 1VBHA 3Q3JA 1FOEA 2MBEA 3VH3B 4ILGB 4WJOA 2FNJB 3PRPB 2YS5A 1UBQA 2JRIB 3CMMB 2EC1A 3C0RB 4F8CB 4DK5A 2DAJA 2YSZA 2Y8GA 3QJZA 1X05A 5C5BA 3KYCD 2BF8B 4N9F4 1JDEA 4TKNA 2GCJA 2J0MA 2COCA 2Z0QA 4FLHA 4AJWA 4EUTA 5D3VA 1MG8A 4H8SA 2XEWA 3H7SA 3RYTA 4EZLA 5CHVC 3E9OA 3KY9A 5CHFA 2N9XA 1WGDA 2MBOA 3VHTC 2LOZA 1SE9A 3D8EA 4KIKB 4BVUC 1K5GB 2LBBA 1FGZA 2MSED 2PEAA 4II3B 4E71A 1V61A 2CB8A 1LB1A 1HE8A 1R4MI 3LDZE 2YS1A 1OQNA 3ZTDA 3QQ8B 3NS8A 2HD5B 3ZKJC 1P3QU 2GBNA 2DZIA 4A20A 4BBNF 2YVCA 2KLCA 4LCDE 4JKGB 1TGZB 3RD2A 2KJHB 1LXDA 2KX0A 2KOXA 1OGWA 1WE6A 3UQBA 1NBFC 4F1SA 2Y7BA 2HE7A 4A6FB 3HHMA 5J17A 2V76A 1N3HA 3H7PB 5D3XA 5DHFB 2CU1A 2GMIC 2CAYA 2DHZA 4RM8A 2HTHB 3IBEA 4DDGD 2MA9B 4CO7A 1WE7A 2IO0B 1W1HA 3PGEA 2I1JA 3W1SA 1X1GA 3ENEA 1WJ4A 3QAQA 3JSVA 3PEGA 4MJSA 5DPSA 3H9DA 3P6AA 4HHVA 1KBLA 1WGHA 3M3JA 2GS0A 1V5TA 2CKHB 4KSKC 3FEHA 4WJ7A 2K00A 5KQ1A 2KD0A 3TMPB 1UELA 1RJ2A 2NS5A 1WGUA 3DOWA 2I1KA 4C0AA 1AWEA 2NBUA 4HB0B 1NI2A 1E8WA 3P2BA 1P3RA 3QHTA 3VFKA 4K7SA 2R2QA 2IO1B 2IY0B 3ODWA 4EJNA 2DENB 2KDBA 3ZRFA 4A3OA 1XX0A 5KCVA 2ROVA 4FA6A 1UGMA 2KJ6A 2C9WB 1T0YA 5D94A 4HPLB 3E9LA 4XWXA 2EMTA 1UNPA 4BKTA 2CY4A 2LOXA 5HE3A 2N9EB 2JP2A 4HJKA 1KOTA 1RRBA 1LQBA 4PS7A 3R7RA 3K9PB 4LDTD 2FIDA 2IZVB 1WF9A 3CIKA 3A1QB 2J59M 2Q13A 3TCAA 2KC2A 5AEKB 2RSUA 3MPXA 2LGXA 3TVVA 4AP4C 5FR6A 4HLEA 3RCZA 4WQOB 2LG1A 4HAWB 3RUIB 1C1YB 3DXDA 3APDA 4IWPA 3ML4A 2MP2A 4M8MA 4PYZA 3SHQA 2LVQA 2P0HA 2VRWB 2KFJA 2FIFA 3UIPB 2YS3A 3IFWB 3UINB 1I2HA 2DYMA 2COAA 3PVWA 4BOZB 3HIZA 4CYEA 4FJYA 2V1YA 3A9KA 4HDQA 2JPHA 3T06A 2LGDA 3DBLI 4K2OA 1P1AA 4JKCA 1GJZA 1ZC3B 2GCLA 4L6EA 2DHIA 1V5UA 4HB2B 2HJ8A 1WR1A 3T9LA 4FHJA 1S3SG 3W1YA 3NSUA 3SO6A 2J7QB 2KDIA 2D07B 3A1QA 4NPNA 1TBEA 2AEHA 3T8MA 4W9DA 1EAZA 1KZGA 2W9NA 2N1VA 4KZ0A 4CHKA 4MELA 1TTNA 4W9HA 4MGYE 1M94A 1K5DB 2WX0A 3GYOA 4OVUA 2KDFB 2J0KA 4TYZA 3DCGA 2KHWB 4KV2A 2DYNA 4WWPA 5C1ZA 1ZM0A 3ZNID 3N3KB 3QWMA 4W9KA 2DYBA 4GPTB 2M8SA 1WJ1A 2K2UA 4KAXB 3DXCA 3ULCA 4NY0A 2BKFA 3M95A 4IAPA 2K6QA 4ZRIA 2AYOB 1KLVA 1U27A 3V60A 3KSYA 4RM9A 4DHJB 1DROA 4CHMA 2KFKB 3NZSA 4IFSA 2BYVE 2ABDA 2ZVOA 3BJIA 2NMBA 5FI1A 1EF5A 4KZCA 3WAOA 2MWSB 2PE9A 2L76A 3KW5B 4ANVA 5JHAA 2CHZA 3A9JA 2C60A 3UIOB 2WWZA 2DA0A 4GN1A 2VKIA 3DPDA 1WXSA 1UNQA 4ICUA 5J3QA 2PPHA 2L0FA 2R82A 1H4RA 2CS4A 3ULBA 1UPRA 1ZC4B 2D9VA 1U5FA 1E5WA 1U2BA 3QC8B 3AULA 3E66A 4DBGA 3A9KB 5J18A 2RGNB 2K2JA 3ZUNA 5G2NA 5JZEB 2ELAA 4W9CA 2LGYA 1GNUA 1U29A 2FUHB 3AU5A 1BTKA 4NJ7A 5DCNA 3D8FA 5TR5A 4B6HA 1DDMA 5CTRC 2ZJDA 4MSMB 2GBRA 4ILHA 1FHWA 1WVHA 1E8YA 1EO6A 2N23A 2KTRB 4KSLC 3ZDTA 3WA0A 1VD2A 3FP5A 2G4SA 2O2VA 4HAZB 4DXAB 4IG7B 2KDEB 3QCAA 4WJNA 2GBKA 2G35A 2ZPNA 3ZVRA 3Q3FA 2AL6A 1NTVA 2MP2B 3LJUX 4GSWA 4HB4B 4MK0A 4NQLB 2KXJA 3H7PA 2KMCA 5LONB 2D2QA 1YJ1A 1TJ6A 2REXA 4NAWB 5DPTA 2D11A 2GJYA 2VRRB 3CXBB 1YX6B 2C5LC 2N7EA 2QKMA 3EC8A 4LJPB 2ADZA 2M1MA 2KVRA 1UPQA 2G45B 3RZWC 1L7YA 3ONSA 2YLMA 1XQQA 3RULA 1B55A 4BKSD 4FJZA 2L2IA 3PS6A 1WGRA 2KN5A 3V6CB 4WWOA 4GDLA 2BPSA 1EF1A 4PYUA 3V62A 4W9FA 4IOYX 2RD0A 2V3SA 1YIWA 1IPGA 1E8XA 2JVCA 4B9KA 5D3WA 1WJMA 2LVOA 3EPYA 5JP4A 4HK2A 2KFKA 4BKSA 3ODOA 1ZSQA 2LUEA 1MK9B 2D4QA 1BWNA 1WGGA 2UWQA 3BY4B 2OQBA 1WH3A 2CY5A 3SNHA 4IM3A 2L1CA 3PTFC 2O2VB 3OAWA 2LJ5A 3L0WB 1U5EA 3UQAA 3L08A 5DPRA 5J3TA 4RMAA 1V88A 2AWTA 3L10B 3TIXA 5JVLA 3SBTA 2RSGA 2DIKA 1U5DA 2ZEQA 3KRXA 3PT2B 2M38A 4M0WB 4WSFA 2IO3B 2D10A 2BWFA 3S2AA 1WXVA 4K81A 3P7ZA 4KHOA 3ML9A 1V5OA 5LOPB 2BYEA 4ZDVA 2RNRB 3VDZA 2X18A 3ZNGC 4DDID 1DDVA 1J8CA 1FHXA 3OJ4B 1J0WA 5AZHA 3QK0A 2I5FA 1FHOA 2NPTB 4OVVA 5C23A 2RLOA 4JQWC 3A8QA 4YONA 4BOSC 4GU2A 1MIXA 3MTNB 2DAFA 1UBIA 4EEWA 2MQJA 4HVBA 4FHKA 4DHZB 2UZRA 1L2NA 5HE0A 1V89A 1WX8A 1V6EA 2D9ZA 2NVUI 3QBVB 1W1GA 2KWUB 3NZUA 2NBWB 3M1IB 3W1SC 3VTUA 4FJVB 2CHXA 3X23A 1Z5SB 2IYDB 1WI1A 3UF8A 4GB9A 1X86A 3ZLZA 4B6WA 2KWCA 3OANA 3A8PA 3VTVA 2D3GA 3DDCB 2A4ZA 5D2MB 4IW0A 1KC7A 4AUQC 1HB6A 4GMVA 4MJSB 4K17A 4IM0A 4PS8A 1YQBA 2AL3A 2Y5BB 5CX3A 2JXXA 1WJUA 2ASQA 2XBBC 4G3XB 1J0GA 4JL9A 2W2XD 2COPA 4Y94A 1G6JA 4HDOA 4HWIB 1WMHB 2C7NB 4ICVA 2IYBA 4K1RB 4A6FA 4F7HA 2L0TA 1OQYA 3R66C 4GOCA 2XK5B 4BKGA 1RLFA 3HW2B 2O6VA 2NZ8B 2DFKA 2MWNB 3B08A 1UEFA 4A5KA 3M62B 5DPWA 2P8VA 4MDKE 3JSVB 2PJHA 3WAPA 3B0AA 5IA7A 2WH5A 2JRHA 1XCGA 2N4FA 2KTFA 4GDKA 3WAMA 3RT3B 4M8NA 1TXDA 1KZ7A 2K8HA 3TW1A 2G3QB 1P5TA 3FSSA 3H6NA 4KDLB 4HPMB 3EHVA 2N0YA 3ZVVA 1DDWA 5JHHA 1WFYA 1Z2MA 2LULA 3JVZX 4K7WA 1LM8B 2HRJA 1XR0B 3QX1A 4NNJB 4KIKA 4MSQB 1V49A 2IFSA 5L83A 2P0DA 3ZTCA 4DX90 3HK0A 1CMXB 5DH9B 1IP9A 1FGYA 3U8ZA 2JUOA 1LW3A 4MM3A 1GUAB 2MBQA 4WAAA 1ZW7A 4EKUA 2BCJA 2KKCA 3I3TB 1P6SA 2FCSA 4IUMB 2MW5A 1V9JA 4FADA 4JKFA 3PRZA 4I6LB 1SGHA 4E74A 2ZZPB 1MPHA 2LKOA 2DX1A 1GGOA 1P0RA 3V6EB 2NCNA 5DIFB 4TV3A 2JZZA 3APFA 1DBHA 4TQ0A 1V81A 3PP2A 5D6JB 3TFMA 2FAZA 5GOWB 1NU2A 3O65B 4XZ4A 3RZFA 1NTIA 1FB8A 3QA8A 2G4DB 2WYQA 3APCA 3ZNHB 1KI1B 3PRMB 1BAKA 1PQSA 1WIAA 5KHOA 3ODXA 2DYQA 1WGYA 2EMSA 1KM7A 2KNBA 3F0WA 2KMAA 3DBRI 4Z2MB 5EDSA 2QKLA 4FULA 5L95C 4Z2NA 1OY2A 2C7MB 1U5GA 3DVNV 2D9WA 2LWPA 5JH5C 1ZKHA 3QARA 4NSWA 2C7HA 2KCJA 4JK8A 3VAWA 2K6DB 3PSCA 4HAVB 2BKRB 4ZYNA 4W9EA 1V5MA 4GGQA 1WX9A 1WRDB 2OJRA 3E9PA 3CF6E 4W9JA 3VUWA 3WIMA 5LXHA 2MRPA 2FCNA 2MDXA 1Z87A 4JKAA 3A98B 5C5BB 2ZVNA 5GMVA 2RR9A 1WJ6A 2R09A 4TQ1A 4JIOU 4EFOA 1JRUA 2M0XA 3D8DA 2D9XA 2KGXB 2LRWA 2FDQA 5HE1A 1ST7A 4WJQA 1UD7A 3O96A 1ZVRA 4JKDA 4ZRKA 1V2YA 3JW0X 2KLGA 2R0DA 2NBVB 2LD9A 4GZUA 2GBMA 2DZJA 1I7AA 1LFDA 2K8BA 1FAOA 2V4LA 3A33B 4DWFA 1WYWB 2DX5B 4JKBA 2KQ7A 4IC7B 4E3CA 4KHBB 2JF5A 4BBKA 4G50A 3HM6X 2OTXA 4HCPB 2OOBB 4AJYB 1Q5WB 2COFA 4CHJA 3A4SC 5DHAB 1YX5B 4MGZE 2GOWA 4ASWC 1WZ0A 3LJ3A 1Q0WB 3AI5A 2MKRA 1W1DA 2MX2A 2P0FA 3MJWA 2KTRA 2CRFA 3TBLD 1Q67A 3GOEA 4XC2A 1FXTB 3WANA 3VUXA 1DYNA 4FBJB 3PG7A 4JK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAX A;  2KWU B;  4IWP A;  1UNR A;  5CLL B;  4FN2 A;  3ML4 A;  4A6K A;  3IHP C;  3NZU A;  2MP2 A;  2NBW B;  4ANU A;  5J2R A;  3M1I B;  4M8M A;  3DVN U;  4PYZ A;  3W1S C;  2KZR A;  3MHS D;  3SHQ A;  3CSF A;  4YL8 A;  2LVQ A;  2P0H A;  5EFX A;  2M17 A;  2A5U A;  3OJ3 A;  2VRW B;  3VTU A;  3ZDM C;  1PLS A;  4FJV B;  3DVG X;  4II2 B;  3N32 A;  2ZNV B;  2CHX A;  5D3Y A;  3PV1 A;  3X23 A;  2KFJ A;  2LXA A;  2FIF A;  4HAU B;  1Z5S B;  2DX5 A;  2IYD B;  1WI1 A;  3UIP B;  1IYF A;  3FM8 C;  4IM2 A;  2YS3 A;  4F7G A;  2LI5 A;  3RZW C;  1NVL A;  3IFW B;  3QWZ B;  3UIN B;  1I2H A;  3UF8 A;  2DYM A;  1M7R A;  2COA A;  3PPA A;  5AZG A;  1WGQ A;  2DTC A;  3PVW A;  3HM3 A;  4GB9 A;  3SD5 A;  1X86 A;  5E6O A;  3ZLZ A;  3N7C A;  2IY1 B;  3PHX B;  2BWE S;  4LDT B;  4B6W A;  2KWC A;  4BOZ B;  3HIZ A;  3VVW B;  2N9X A;  4CYE A;  4FJY A;  3OAN A;  3A8P A;  2V1Y A;  2LZ6 A;  2W2W A;  3R7Q A;  3VTV A;  2D3G A;  3A9K A;  3DDC B;  5IJM A;  2A4Z A;  5D2M B;  2K39 A;  4IW0 A;  3PZD A;  4HDQ A;  2JWZ A;  4AUQ C;  2JPH A;  3T06 A;  2LGD A;  1HB6 A;  2KAN A;  3DBL I;  4GMV A;  2PE6 B;  4MJS B;  4K2O A;  4K17 A;  5KQ4 A;  1P1A A;  3KYD D;  4IM0 A;  2N7D A;  4PS8 A;  4MT7 A;  1GJZ A;  4WVF B;  4HAT B;  1YQB A;  1Y8R C;  2AL3 A;  2LXC A;  2Y5B B;  5CX3 A;  3L13 A;  5CHW A;  3SDL C;  3X0W A;  5G55 A;  2JXX A;  1WJU A;  2ASQ A;  2XBB C;  4G3X B;  4JGH B;  1J0G A;  4JL9 A;  3KH0 A;  1E90 A;  1ZC3 B;  2W2X D;  2COP A;  2GCL A;  1E8Z A;  4MGK E;  4Y94 A;  4L6E A;  1G6J A;  5AZF A;  2DHI A;  1V5U A;  1XT9 B;  2DHJ A;  4DBB A;  2KWV B;  4HDO A;  2LRU A;  3R3M A;  1WXA A;  4HCN B;  4HB2 B;  1WMH B;  4HWI B;  2KJR A;  2DLW A;  4FAD A;  2HJ8 A;  2C7N B;  1SHC A;  3G9W A;  1WR1 A;  2MFQ A;  5FI0 A;  3T9L A;  2RPQ A;  4FHJ A;  4ICV A;  3MDB C;  2IYB A;  4K1R B;  1S3S G;  3W1Y A;  4X57 B;  5DI9 B;  3JYU A;  4A6F A;  4F7H A;  2L0T A;  3NSU A;  2BGF A;  3IG3 A;  1BTN A;  3PVL A;  1WXM A;  1OQY A;  3N30 A;  3R66 C;  1ZGU B;  3TJP A;  2Z0P A;  3SO6 A;  4GOC A;  1TZ1 A;  2J7Q B;  4EOY A;  2M4N A;  2KDI A;  4EZK A;  5HE2 A;  2D07 B;  4F7U P;  2XK5 B;  3A1Q A;  1TBE A;  2AEH A;  1WMH A;  2CQU A;  3PHW B;  4NPN A;  3SUZ A;  4WJP A;  3T8M A;  4BKG A;  4W9D A;  2K1F A;  1EAZ A;  4AWJ A;  4URK A;  1KZG A;  1RLF A;  4EZJ A;  1PMS A;  3PVU A;  2W9N A;  3VUY A;  3HW2 B;  2O6V A;  4KDI C;  2NZ8 B;  3A4R A;  2DFK A;  3TO1 A;  4EMO A;  2N1V A;  2MWN B;  3B08 A;  1K8R B;  3H1U A;  4KZ0 A;  1WZ3 A;  1TTN A;  3VIA A;  4MEL A;  1QZE A;  1SIF A;  4W9H A;  2COD A;  2ELB A;  1UH6 A;  2ZNV C;  1UEF A;  4MGY E;  1XD4 A;  3UGB B;  3WIM A;  1RRP B;  4A5K A;  3M62 B;  2MCN B;  5DPW A;  1OMW A;  1GC7 A;  2EKE C;  3U30 A;  1M94 A;  2FCQ A;  2Y8F A;  1K5D B;  2JZ3 B;  1OEY A;  5JHG A;  2KO3 A;  2R2O A;  2H7E A;  2LYD A;  3GYO A;  1TQZ A;  2WX0 A;  4OVU A;  4DHJ B;  2YT0 A;  2J0J A;  2KDF B;  3D32 A;  3B1L X;  2J0K A;  4TYZ A;  2P8V A;  3V5W A;  1UZX B;  2B3A A;  3DCG A;  3ZO5 B;  1MAI A;  4MDK E;  1ISN A;  2L05 A;  4GIV A;  3JSV B;  4G0N B;  5JZE B;  2KHW B;  4KV2 A;  2DYN A;  2IO2 B;  2PJH A;  5BO4 B;  3WAP A;  4WWP A;  1PFJ A;  1X1M A;  3B0A A;  5C1Z A;  1BT0 A;  1ZM0 A;  3VUW A;  2ZPY A;  3AXC A;  5IA7 A;  2WH5 A;  1Y19 B;  2JRH A;  3ZNI D;  3FLV A;  2H7D A;  1GG3 A;  3N3K B;  3QWM A;  4MM3 A;  1XCG A;  4W9K A;  4HAX B;  2DYB A;  4GPT B;  2N4F A;  2KTF A;  4GDK A;  1E7V A;  2M8S A;  3RT3 B;  3DXE A;  3WAM A;  4BKS A;  4ANW A;  4M8N A;  4WJO A;  1TXD A;  2BYF A;  1Q1O A;  3NHE B;  1IRS A;  1WJ1 A;  4KHA A;  3KRW A;  2W2X C;  4D0N B;  1WM3 A;  5LXI B;  1KZ7 A;  2K2U A;  2GBJ A;  1X11 A;  3TW1 A;  4KAX B;  2K8H A;  3SYX A;  3NY5 A;  3DXC A;  2G3Q B;  4GDL B;  3ULC A;  1P5T A;  4NY0 A;  4ZRJ A;  2YRY A;  3FSS A;  3SV1 A;  4IAP A;  1WY8 A;  2BKF A;  2K6Q A;  2Z59 B;  3H6N A;  3M95 A;  4W9G A;  3Q3J A;  4XX5 A;  4ZRI A;  2AYO B;  1FOE A;  4HPM B;  1U27 A;  2RVB B;  3KSY A;  2MBE A;  3KVF B;  3EHV A;  2FNJ B;  2L8J A;  2YS5 A;  1WG7 A;  1UBQ A;  2JRI B;  2NR2 A;  3PRP B;  4I6N B;  3CMM B;  2N0Y A;  1H8C A;  3NOB A;  3ZVV A;  2EC1 A;  3C0R B;  2DKP A;  1DRO A;  4RM9 A;  1DDW A;  4CHM A;  1OTR B;  3L16 A;  4LJO B;  3A9J B;  2DAJ A;  2KFK B;  5JHH A;  2YSZ A;  1WFY A;  4DK5 A;  2Y8G A;  1Z2M A;  2QHO A;  2LUL A;  3JVZ X;  3NZS A;  3QJZ A;  4K7W A;  4MGI E;  3VTW A;  1LM8 B;  1WI0 A;  1X05 A;  2HRJ A;  4IFS A;  5C5B A;  1XR0 B;  2BYV E;  3KYC D;  2ABD A;  2BF8 B;  4N9F 4;  2ZVO A;  3BJI A;  4TKN A;  2KK8 A;  2GCJ A;  2J0M A;  2NMB A;  4MEM A;  5FI1 A;  3QX1 A;  1EF5 A;  2COC A;  4KZC A;  2Z0Q A;  4KIK A;  4NNJ B;  4FLH A;  2MBH A;  3WAO A;  4AJW A;  4MSQ B;  2MWS B;  2PE9 A;  1V49 A;  4A3P A;  2L76 A;  2IFS A;  3KW5 B;  4ANV A;  4EUT A;  5JHA A;  5L83 A;  4P7I A;  1WX7 A;  5D3V A;  1MG8 A;  2P0D A;  4H8S A;  2CHZ A;  2XEW A;  2LVP A;  2MLB A;  5E6P A;  3H7S A;  3RYT A;  3A9J A;  5KHQ A;  2C60 A;  2UZS A;  3ZTC A;  4DX9 0;  3HK0 A;  5CHV C;  3UIO B;  4EZL A;  1CMX B;  2WWZ A;  3DBH I;  5DH9 B;  1IP9 A;  1MIZ B;  5C6R A;  3KY9 A;  5CHF A;  1FGY A;  3U8Z A;  2DA0 A;  2E2X A;  2VKI A;  1LW3 A;  4GN1 A;  1WGD A;  1WXS A;  2JUO A;  2Z0O A;  2MBO A;  3DPD A;  1UNQ A;  2LOZ A;  3D8E A;  1SE9 A;  3VHT C;  1GUA B;  5L81 A;  2LAS A;  2MBQ A;  4ICU A;  4KIK B;  5J3Q A;  4WAA A;  2PPH A;  4BVU C;  1K5G B;  2LBB A;  1FGZ A;  1ZW7 A;  2L0F A;  2CR5 A;  4EKU A;  2BCJ A;  2KKC A;  2MSE D;  2PEA A;  1H4R A;  2CS4 A;  2JT4 B;  3ULB A;  3M63 B;  4II3 B;  3I3T B;  4E71 A;  2D9Y A;  1UPR A;  1P6S A;  1ZC4 B;  2D9V A;  2FCS A;  1U5F A;  3L54 A;  1E5W A;  1V61 A;  3PRE A;  1U2B A;  3QC8 B;  5JHB A;  3AUL A;  3ZRC A;  4IUM B;  2CB8 A;  3GZN I;  3OLM D;  1AAR A;  4DBG A;  1LB1 A;  1V9J A;  2MW5 A;  3A9K B;  4ANX A;  4HB3 B;  2RGN B;  2K2J A;  1HE8 A;  1R4M I;  3PRZ A;  2ELA A;  4W9C A;  5G2N A;  3ZUN A;  2LGY A;  2YS1 A;  1OQN A;  1U29 A;  1GNU A;  3LDZ E;  2FUH B;  3ZTD A;  3AU5 A;  1SGH A;  2Z0E B;  4I6L B;  2ZCC A;  1BTK A;  2DYO A;  3HQC A;  3U7D A;  3NS8 A;  3QQ8 B;  4NJ7 A;  5DCN A;  2HD5 B;  1ACA A;  3D8F A;  1E7U A;  4B6H A;  2ZZP B;  5TR5 A;  4E74 A;  4A6H A;  1MPH A;  1NDD A;  3VXW A;  2LKO A;  3ZKJ C;  5KHO A;  2DX1 A;  4DHJ D;  1P3Q U;  1DDM A;  3KZ1 A;  2GBN A;  1P0R A;  3V6E B;  1C3T A;  5CTR C;  5LLI A;  2DZI A;  4I6P A;  1I42 A;  4A20 A;  4NQK E;  2ZJD A;  4BBN F;  3SU8 X;  2YVC A;  1V80 A;  1HB8 A;  3KUC B;  2L00 B;  4MSM B;  2GBR A;  1FHW A;  2KUP A;  2KLC A;  2NCN A;  3ALB A;  5DIF B;  4LCD E;  4TV3 A;  3AU4 A;  1WVH A;  1E8Y A;  1EO6 A;  1VCB A;  2N23 A;  2KTR B;  2JZZ A;  1TGZ B;  3APF A;  3RD2 A;  5CLQ B;  1R4N I;  1DBH A;  4KSL C;  1V81 A;  3PP2 A;  3VH3 B;  4TQ0 A;  3ZDT A;  2KJH B;  3WA0 A;  1LXD A;  2KX0 A;  2KOX A;  5D6J B;  1VD2 A;  3VH4 B;  1H10 A;  3TFM A;  2KX3 A;  4JLC A;  2FAZ A;  2UYZ B;  2L3Z A;  3FP5 A;  1I35 A;  3L17 A;  2G4S A;  3KUZ A;  2O2V A;  4HAZ B;  4DXA B;  1OGW A;  4IG7 B;  1WE6 A;  5GOW B;  3ZW3 A;  2KDE B;  3UQB A;  1NU2 A;  3F5R A;  3AJ4 A;  2K8C A;  3QCA A;  4WJN A;  1NBF C;  5E6N A;  4F1S A;  2GBK A;  3O65 B;  4AOF A;  2G35 A;  4XZ4 A;  2Y7B A;  2HE7 A;  1NTI A;  3RZF A;  1FB8 A;  2ZPN A;  4A6F B;  3ZVR A;  3Q3F A;  2AL6 A;  1NTV A;  2MP2 B;  3LJU X;  2G4D B;  2JY6 A;  3HHM A;  3QA8 A;  2WYQ A;  4GSW A;  4HB4 B;  4MK0 A;  3APC A;  4NQL B;  4WWN A;  2YF0 A;  2KXJ A;  5J17 A;  3H7P A;  3ZNH B;  1WR6 E;  2KMC A;  2VSZ A;  4BBN C;  1KI1 B;  3K9O B;  3PRM B;  2V76 A;  1BAK A;  1N3H A;  5LON B;  2D2Q A;  3H7P B;  5D3X A;  5DHF B;  1PQS A;  1WIA A;  1YJ1 A;  2CU1 A;  2GMI C;  3ODX A;  1TJ6 A;  1MK7 B;  2CAY A;  2DYQ A;  1OEY J;  2DHZ A;  1WGY A;  2REX A;  4W9L A;  3ZIM A;  4NAW B;  2EMS A;  2D11 A;  1KM7 A;  4RM8 A;  2GJY A;  5DPT A;  2VRR B;  2HTH B;  3F0W A;  2KNB A;  2KMA A;  3IBE A;  4DDG D;  3DBR I;  4Z2M B;  1F9J A;  3VOQ A;  1V5P A;  2MA9 B;  4CO7 A;  3CXB B;  1YX6 B;  5EDS A;  2C5L C;  2QKL A;  2N7E A;  4KDL B;  1WJN A;  2HTH A;  1WE7 A;  2IBI B;  2RQ1 A;  3EEC A;  2QKM A;  2IO0 B;  3EC8 A;  2EJ8 A;  4FUL A;  4LJP B;  2ADZ A;  4DHZ E;  5L95 C;  4Z2N A;  1W1H A;  1OY2 A;  3DVG Y;  2M1M A;  2C7M B;  3PGE A;  5D7G A;  2I1J A;  3W1S A;  1X1G A;  1UPQ A;  1U5G A;  2G45 B;  2KVR A;  3DVN V;  1L7Y A;  3ENE A;  3KUD B;  2DHK A;  2D9W A;  1RFA A;  1WJ4 A;  1XQQ A;  2LWP A;  2YLM A;  1ZKH A;  3ONS A;  3RUL A;  5JH5 C;  2PZ1 A;  3QAQ A;  1B55 A;  3QAR A;  4BKS D;  4NJ6 A;  3UZT A;  3JSV A;  4FJZ A;  2K25 A;  3PEG A;  4MJS A;  2L2I A;  3PS6 A;  4NSW A;  1WGR A;  2KN5 A;  3ML8 A;  2C7H A;  5DPS A;  4B95 A;  1QC6 A;  2ROZ B;  2KCJ A;  3V6C B;  3H9D A;  4WWO A;  3VAW A;  1MKE A;  2K6D B;  4GDL A;  2BPS A;  1EF1 A;  3PSC A;  3P6A A;  4HAV B;  4HHV A;  2BKR B;  4PYU A;  2FCM A;  4W9F A;  4ZYN A;  3V62 A;  4W9E A;  4IOY X;  4F7Z A;  2RD0 A;  1WGH A;  3M3J A;  1V5M A;  4GGQ A;  2GS0 A;  1V5T A;  1WX9 A;  1WRD B;  2V3S A;  1GC6 A;  1HBK A;  1Y5O A;  2CKH B;  2OJR A;  4KSK C;  4PS3 A;  3FEH A;  1YIW A;  3CF6 E;  3BIN A;  2YT1 A;  5J3Y A;  1IPG A;  4WJ7 A;  1E8X A;  2K00 A;  2WDT B;  2MRP A;  2JVC A;  4W9J A;  2FCN A;  5KQ1 A;  2NPT A;  2MDX A;  5LXH A;  4B9K A;  2KD0 A;  3TMP B;  4K7U A;  5D3W A;  1Z87 A;  1WJM A;  1UEL A;  1RJ2 A;  2LVO A;  1A5R A;  3EPY A;  2NS5 A;  3A98 B;  2KC1 A;  3VQI A;  1J19 A;  5C5B B;  2ZVN A;  3PSE B;  5JP4 A;  3DBS A;  4HK2 A;  5GMV A;  1WGU A;  4K2P A;  3DOW A;  2RR9 A;  1WJ6 A;  2KFK A;  2CHW A;  3ODO A;  2R09 A;  1ZSQ A;  2I1K A;  5C79 A;  1MK9 B;  2LUE A;  4JIO U;  4TQ1 A;  4C0A A;  2I5C A;  1AWE A;  2N1W A;  2NBU A;  4EFO A;  5IAA C;  4PNK A;  2D4Q A;  4HB0 B;  1JRU A;  2M0X A;  4W9I A;  1NI2 A;  1E8W A;  3QIJ A;  3D8D A;  1BWN A;  2D9X A;  3P2B A;  1WM2 A;  4HXD A;  2KGX B;  3IVF A;  4CHK A;  2LRW A;  1WGG A;  1P3R A;  2FDQ A;  2UWQ A;  3BY4 B;  2OQB A;  5HE1 A;  3QHT A;  3WYF B;  1WH3 A;  1P98 A;  1ST7 A;  2CY5 A;  3SNH A;  4WJQ A;  3VFK A;  1UD7 A;  4IM3 A;  1EGX A;  2L1C A;  3PTF C;  4K7S A;  2R2Q A;  1M7E A;  2IO1 B;  2O2V B;  3O96 A;  1QQG A;  3OAW A;  2IY0 B;  3ODW A;  3EFU A;  4EJN A;  1ZVR A;  2LJ5 A;  3ECI A;  3L0W B;  2L7R A;  1U5E A;  3UQA A;  4ZRK A;  2DKQ A;  2Z0D B;  5HKH A;  2RUK B;  2ZCB A;  1V2Y A;  2DEN B;  2FJ9 A;  3L08 A;  4BFR A;  1KLV A;  3JW0 X;  2KDB A;  2KLG A;  2R0D A;  2NBV B;  5DPR A;  1EVH A;  2LD9 A;  5J3T A;  4PQ0 A;  4GZU A;  2MBB B;  3ZRF A;  2GBM A;  2UVM A;  4A3O A;  3WAL A;  2DN6 A;  2DZJ A;  1I7A A;  4RMA A;  1V88 A;  2AWT A;  3L10 B;  3TIX A;  1J8C A;  4J6I A;  1XX0 A;  2RSG A;  5KCV A;  2ROV A;  1LFD A;  2K8B A;  1XOD A;  4IWO A;  4F8C B;  2M14 A;  2O6V D;  1FAO A;  1U5D A;  4FA6 A;  2ZEQ A;  3KRX A;  4NAW A;  2V4L A;  3A33 B;  4DWF A;  1UGM A;  2KJ6 A;  3DQV A;  3PT2 B;  2C9W B;  1T0Y A;  2M38 A;  4M0W B;  4WSF A;  2IO3 B;  5J18 A;  1KJT A;  5D94 A;  3ZNZ B;  2D10 A;  4HPL B;  2BWF A;  2N9P C;  1V86 A;  3S2A A;  4XWX A;  2EMT A;  2XQN M;  1WYW B;  2DX5 B;  1WXV A;  1UNP A;  4BKT A;  2CY4 A;  2KQS A;  2DZK A;  2KQ7 A;  1AQC A;  4K81 A;  5JLJ B;  2LOX A;  4IC7 B;  3P7Z A;  4KHO A;  3CST A;  3ML9 A;  4E3C A;  4KHB B;  2JF5 A;  5HE3 A;  5LOP B;  1V5O A;  1XKE A;  2BYE A;  2RNR B;  4BBK A;  2N9E B;  4G50 A;  3HM6 X;  4ZDV A;  3VDZ A;  2JP2 A;  2X18 A;  3ZNG C;  4HJK A;  2OTX A;  4DX8 A;  4DDI D;  1RRB A;  1DDV A;  1FHX A;  4GMX B;  1XD3 B;  2RGF A;  1LQB A;  3OJ4 B;  1J0W A;  1NTY A;  3PLU A;  4G11 A;  4PS7 A;  4HCP B;  1X1F A;  2OOB B;  4TUU A;  5AZH A;  4AJY B;  3R7R A;  1KOT A;  3QK0 A;  1Q5W B;  2I5F A;  3K9P B;  4GDK B;  5D27 A;  2COF A;  1FHO A;  1YD8 U;  4LDT D;  4GXB A;  1D3Z A;  3TL5 A;  4CHJ A;  3A4S C;  5DHA B;  1YX5 B;  2NPT B;  4OVV A;  2RLO A;  4JQW C;  3A8Q A;  4MY6 A;  4YON A;  2DZM A;  4GU2 A;  5C23 A;  4BOS C;  2FID A;  4MGZ E;  2IZV B;  2GOW A;  1MIX A;  4ASW C;  1WF9 A;  1WZ0 A;  3MTN B;  4IWQ A;  3LJ3 A;  1Q0W B;  1UBI A;  3GYP A;  5C16 A;  2DAF A;  3AI5 A;  2MKR A;  3V60 A;  1S1Q B;  4EEW A;  1W1D A;  2MQJ A;  3CIK A;  4MH0 E;  4HVB A;  4FHK A;  4DHZ B;  3A1Q B;  4KVG B;  2MX2 A;  2FJL A;  2J59 M;  2Q13 A;  2UZR A;  2P0F A;  3V61 A;  1L2N A;  5HE0 A;  3MJW A;  3TCA A;  2KC2 A;  5AEK B;  1V89 A;  2KTR A;  2RSU A;  3MPX A;  1WX8 A;  2LGX A;  2CRF A;  4HAY B;  3TBL D;  3TVV A;  1V6E A;  4AP4 C;  3RCP A;  1Q67 A;  3GOE A;  5FR6 A;  4XC2 A;  2D9Z A;  3PLV A;  1FXT B;  2WX1 A;  3WAN A;  2XK5 A;  4HLE A;  3VUX A;  1DYN A;  3RCZ A;  3PG7 A;  4WQO B;  2LG1 A;  4FBJ B;  4HAW B;  3RUI B;  2NVU I;  3QBV B;  1W1G A;  1EUV B;  1C1Y B;  3DXD A;  1U4A A;  2O6V B;  1P9D U;  3APD A; 
#chains in the Genus database with same CATH topology
 4FN2 A;  4IDI A;  3DVN U;  1HEZ E;  1CK1 A;  4YSX B;  2JZP A;  3RFZ B;  5EFX A;  3OJ3 A;  2A5U A;  2MEK A;  3W9C B;  3ZDM C;  1PLS A;  4II2 B;  3P4R B;  3N32 A;  2ZNV B;  1HA5 A;  1IYF A;  4L1R A;  3FM8 C;  4XWT A;  1NVL A;  3QWZ B;  1VJK A;  1M7R A;  3VH4 B;  2GRI A;  3HM3 A;  5C3J B;  3R2I A;  4YWG G;  1I4P A;  1N62 A;  1KF6 B;  4KKJ A;  3N7C A;  2D3B A;  2IY1 B;  3PHX B;  2BWE S;  4LDT B;  1I4X A;  3VVW B;  2W2W A;  3T3O A;  1TY0 A;  1YJI A;  3PZD A;  2RPV A;  2JWZ A;  2NMQ A;  3KYD D;  2N7D A;  4WVF B;  4HAT B;  2LXC A;  3SDL C;  4S0R A;  1OQR A;  3MFG A;  3KH0 A;  1VR9 A;  1XT9 B;  2LRU A;  2DHJ A;  4DBB A;  3AH7 A;  2BQQ A;  2KJR A;  3ENB A;  2DLW A;  2H88 B;  1SHC A;  4OHJ A;  2X0S A;  1D5M C;  3MDB C;  1IGD A;  5DI9 B;  3WCQ A;  4XWW A;  2EKI A;  1BTN A;  3PVL A;  4C7Y A;  3N30 A;  2BBC A;  1ZGU B;  2Z0P A;  1TZ1 A;  4EZK A;  4WJP A;  2NBV A;  3AM9 A;  2CQU A;  2K1F A;  2L1A A;  4EZJ A;  1ZP0 B;  2KIG A;  1E6E B;  4KDI C;  1F2R C;  2WXG A;  4EMO A;  1FXA A;  3H1U A;  1A5R A;  3VIA A;  2COD A;  1FPY A;  3ZYY X;  1XD4 A;  3UGB B;  1RRP B;  2MCN B;  2L32 A;  1GC7 A;  4JKE A;  2EKE C;  3ZRC A;  2FCQ A;  2JZ3 B;  4KX6 B;  5JHG A;  1QQR A;  2R2O A;  2H7E A;  1N60 A;  1TQZ A;  2YT0 A;  3B1L X;  1SE4 A;  1ISN A;  4GIV A;  5BMG A;  4G0N B;  2R2Y A;  5BO4 B;  2IO2 B;  4IOI E;  1PFJ A;  1BT0 A;  3AXC A;  2MJ3 A;  3NVW A;  1RWS A;  3FLV A;  1TYG B;  1GG3 A;  3NVY A;  1E7V A;  3DXE A;  3I9V 1;  3NHE B;  1IRS A;  2ZW0 A;  4LLG M;  5J2R A;  2W2X C;  2GBJ A;  1M4V A;  3AEB B;  2FBW B;  4GDL B;  2YRY A;  3SV1 A;  4W9G A;  4XX5 A;  1JWB D;  2RVB B;  3KVF B;  4YSY B;  2L8J A;  1WG7 A;  2NR2 A;  4I6N B;  1EM7 A;  1H8C A;  3KQ4 A;  3NOB A;  1C76 A;  2DKP A;  5E6N A;  4AOF A;  1OTR B;  3L16 A;  4LJO B;  3A9J B;  1FRR A;  2QHO A;  4MGI E;  3VTW A;  1KFY B;  1WI0 A;  1ZE3 D;  2KK8 A;  1KH0 A;  4MEM A;  2PKO A;  5G5H A;  2MBH A;  3NVZ A;  1YN4 A;  2ACZ B;  2WNM A;  4A3P A;  4P7I A;  1WX7 A;  1ESF A;  2LVP A;  2MLB A;  5KHQ A;  2UZS A;  3NWD A;  4WQM A;  3EGR A;  3DBH I;  1MIZ B;  1L6V A;  5C6R A;  4XDD A;  2E2X A;  1FCC C;  2Z0O A;  5HHD G;  3ETR A;  3N1X C;  5L81 A;  2LAS A;  3FIL B;  2CR5 A;  1B9R A;  1WGK A;  1SJE D;  2JT4 B;  3M63 B;  2D9Y A;  3L54 A;  3PRE A;  5JHB A;  3KWL A;  3GZN I;  3OLM D;  1AAR A;  4ANX A;  4HB3 B;  2R61 A;  2BYT A;  1VBG A;  3U52 E;  1Q10 A;  3B9J A;  2Z0E B;  2ZCC A;  2DYO A;  3HQC A;  3U7D A;  1ACA A;  1E7U A;  4A6H A;  1NDD A;  2QCZ A;  1BML C;  1FXI A;  4DHJ D;  3KZ1 A;  1IGC A;  3P4S B;  2V4I B;  4C80 A;  1C3T A;  5LLI A;  4I6P A;  3MC8 A;  1I42 A;  4NQK E;  3SU8 X;  3ZQ4 A;  1V80 A;  1HB8 A;  4QAY A;  3KUC B;  2L00 B;  1BUI C;  2KUP A;  3ALB A;  1PFD A;  4WIP A;  3AU4 A;  1CQV A;  1FMA D;  1VCB A;  4TSS A;  5CLQ B;  1R4N I;  2PVO D;  1H10 A;  4JLC A;  2KX3 A;  2UYZ B;  2L3Z A;  1I35 A;  3L17 A;  4WAF A;  3KUZ A;  4NJC A;  5EE1 A;  3ZW3 A;  3F5R A;  3AJ4 A;  2K8C A;  2N7J A;  2BS4 B;  2ZW1 A;  2JY6 A;  1PDX A;  4WWN A;  2Z4D A;  2YF0 A;  4D2K A;  1KRH A;  1WR6 E;  4BBN C;  2VSZ A;  2QSD A;  3AE4 B;  3R8B A;  3K9O B;  3OG5 A;  4HPP A;  1GB4 A;  2D3C A;  1MK7 B;  3ZIM A;  1OEY J;  4W9L A;  1CZP A;  1SE2 A;  1N63 A;  4EOY A;  1OQQ A;  1F9J A;  4JKH A;  4EE2 A;  3VOQ A;  1V5P A;  5H92 C;  1WJN A;  2LFI A;  2HTH A;  2IBI B;  2RQ1 A;  3EEC A;  2EJ8 A;  4DHZ E;  4M01 A;  3RNC C;  3DVG Y;  3HIE A;  5D7G A;  3Q8C A;  4HKZ E;  3GP7 A;  3KUD B;  2INC C;  2DHK A;  1RFA A;  3IT6 B;  2PZ1 A;  4NJ6 A;  3UZT A;  1QOB A;  3P1M A;  2K25 A;  3N1Y C;  3SFD B;  3ML8 A;  4B95 A;  1ZPS A;  1QC6 A;  2V0G A;  2ROZ B;  1TS5 A;  1MKE A;  2ICI A;  4F7Z A;  2FCM A;  5D3I B;  1GC6 A;  1HBK A;  1Y5O A;  1NYR A;  4PS3 A;  2DNF A;  2FE8 A;  3BIN A;  2YT1 A;  5J3Y A;  2WDT B;  2NPT A;  4K7U A;  2KC1 A;  1MHX A;  1VZ8 A;  3VQI A;  1FEH A;  1J19 A;  3PSE B;  3DBS A;  4K2P A;  2CHW A;  5C79 A;  2I5C A;  2N1W A;  5IAA C;  4PNK A;  4W9I A;  3QIJ A;  1WM2 A;  4HXD A;  3LB8 C;  3IVF A;  1QOF A;  1D4B A;  3WYF B;  1P98 A;  2WXH A;  1EGX A;  1R7S A;  1YNT E;  1C79 A;  4XYC A;  1M7E A;  1C4P A;  1QQG A;  3IXS A;  3EFU A;  5LNK 1;  4YXD B;  3ECI A;  2L7R A;  2QEJ C;  2DKQ A;  2Z0D B;  5HKH A;  2RUK B;  2ZCB A;  1JCK B;  4BFR A;  2FJ9 A;  4K3B A;  1EVH A;  2MBB B;  4PQ0 A;  2UVM A;  5AUK A;  3WAL A;  4CQN A;  2DN6 A;  1MI1 A;  4J6I A;  2WXJ A;  4ZHO A;  1XOD A;  4IWO A;  2M14 A;  1K52 A;  2O6V D;  3NJT A;  4NAW A;  2BVC A;  3DQV A;  3V3X A;  1KJT A;  3ZNZ B;  1ZXI A;  2N9P C;  1V86 A;  3Q3M C;  2KAC A;  1I4H A;  2XQN M;  2WXO A;  4KHB A;  2KQS A;  2DZK A;  4C00 A;  1AQC A;  5JLJ B;  3CST A;  3B77 A;  1XKE A;  2J53 A;  4DX8 A;  4GMX B;  1XD3 B;  2RGF A;  4TUU A;  1NTY A;  3PLU A;  4P1C C;  1X1F A;  3BVG A;  3ZJU A;  4GDK B;  3DWG C;  5D27 A;  1YD8 U;  1D3Z A;  4GXB A;  3TL5 A;  3PO0 A;  3BYY B;  4MY6 A;  2DZM A;  4JWS C;  4MT5 A;  2PTL A;  3AED B;  2KMM A;  3O13 A;  4IWQ A;  3GYP A;  5C16 A;  1S1Q B;  4MH0 E;  3AEC B;  4KVG B;  4JX1 C;  2FJL A;  3V61 A;  1HZ5 A;  4JKG A;  4HAY B;  2WHI A;  4PK1 A;  3RCP A;  3PLV A;  2WX1 A;  4L1B A;  2XK5 A;  3MC9 A;  1EUV B;  1U4A A;  2O6V B;  1P9D U;  1RAX A;  2J52 A;  1UNR A;  5CLL B;  2PVG C;  3IHP C;  4A6K A;  4ANU A;  4LNO A;  3OHM B;  2CJN A;  2KZR A;  3MHS D;  3CSF A;  1TS4 A;  4YL8 A;  2M17 A;  3DVG X;  2YEP F;  5BYS A;  3PV1 A;  5D3Y A;  4DXG A;  2LXA A;  4HAU B;  2DX5 A;  4IM2 A;  1MI0 A;  4F7G A;  2LI5 A;  3PPA A;  5AZG A;  1WGQ A;  2DTC A;  3SD5 A;  4A8X C;  5E6O A;  2MH7 A;  3FKY A;  1L0X B;  2E6X A;  1MVK A;  3EUB 2;  1HQR D;  1HZ6 A;  2LZ6 A;  3R7Q A;  5IJM A;  2WU2 B;  2K39 A;  5E6P A;  2KAN A;  2PE6 B;  5KQ4 A;  4MT7 A;  2WDQ B;  1Y8R C;  3X0W A;  2WDV B;  3L13 A;  5CHW A;  3BII D;  5G55 A;  1XCT L;  4JGH B;  4MH8 A;  3W2D A;  1E90 A;  1E8Z A;  4ILJ A;  4MGK E;  2Q5W D;  5AZF A;  3Q14 C;  2KWV B;  3R3M A;  4HCN B;  1WXA A;  1EWY C;  2JQR B;  3G9W A;  2CU3 A;  2MFQ A;  5FI0 A;  2OJW A;  2RPQ A;  4HRO A;  1ET9 A;  3RNA C;  4X57 B;  3JYU A;  1FNV A;  2BGF A;  4MM3 B;  2LGI A;  1WXM A;  3IG3 A;  1TT5 B;  3Q69 A;  3TJP A;  3SBG A;  2M4N A;  5HE2 A;  4F7U P;  1WMH A;  3PHW B;  3SUZ A;  3GE3 C;  4LTU A;  4AWJ A;  4URK A;  1PMS A;  3DHI C;  3PVU A;  3VUY A;  3A4R A;  3TO1 A;  5TSS A;  1K8R B;  1WZ3 A;  1QZE A;  1SIF A;  3SEB A;  2ELB A;  1UH6 A;  2ZNV C;  4PT5 A;  1OMW A;  3U30 A;  2KO3 A;  2Y8F A;  3VXW A;  1OEY A;  2LYD A;  5FKA C;  2J0J A;  3D32 A;  4G11 A;  3ZO5 B;  2B3A A;  4GOU A;  3V5W A;  1UZX B;  4OZC A;  1MAI A;  3ABV B;  2L05 A;  3DBH B;  1X1M A;  2ZPY A;  1Y19 B;  2H7D A;  4JK7 A;  3AV8 A;  3H8H A;  1DIK A;  4HAX B;  4ANW A;  2BYF A;  1Q1O A;  1VLB A;  1WM3 A;  4KHA A;  3KRW A;  5LXI B;  4D0N B;  1X11 A;  4FXC A;  3SYX A;  3NY5 A;  2LGS A;  4ZRJ A;  1WY8 A;  2Z59 B;  1VBH A;  3Q3J A;  3NS1 A;  1FOE A;  3EFC A;  2MBE A;  3VH3 B;  4ILG B;  4WJO A;  2FNJ B;  3PRP B;  2YS5 A;  1UBQ A;  1RYJ A;  2JRI B;  1I4G A;  3CMM B;  3L4P A;  2EC1 A;  1BXT A;  3C0R B;  4F8C B;  4DK5 A;  2DAJ A;  2YSZ A;  4LK0 M;  2Y8G A;  3QJZ A;  2W82 A;  1X05 A;  5C5B A;  3KYC D;  2BF8 B;  4N9F 4;  2WU5 B;  1JDE A;  4TKN A;  4LNN A;  2GCJ A;  2J0M A;  2M19 A;  3TUO A;  5JXV A;  2COC A;  2Z0Q A;  4FLH A;  3BK1 A;  4AJW A;  1L0Y B;  4C7Z A;  4EUT A;  2RDG A;  2IPK D;  5D3V A;  1MG8 A;  2ON8 A;  3Q8B A;  4H8S A;  1AWD A;  2XEW A;  4YTN B;  3H7S A;  3RYT A;  3NRZ A;  2K8E A;  4EZL A;  5CHV C;  1J7A A;  3E9O A;  1GAQ B;  1FFV A;  3KY9 A;  5CHF A;  2N9X A;  1WGD A;  2MBO A;  3VHT C;  2LOZ A;  1SE9 A;  3D8E A;  1SBB B;  4KIK B;  2K9X A;  4BVU C;  1K5G B;  2LBB A;  1ET6 A;  1FGZ A;  1JWU D;  4HJG E;  2MSE D;  2PEA A;  2WLB A;  4II3 B;  2M56 B;  4E71 A;  2J42 A;  1V61 A;  3UI3 A;  4RGM A;  2CB8 A;  1LB1 A;  1HE8 A;  1R4M I;  1F2R I;  1FD6 A;  1TY2 A;  3LDZ E;  2YS1 A;  1OQN A;  3ZTD A;  2V3N A;  3QQ8 B;  2QMT A;  3NS8 A;  3B2G A;  2HD5 B;  2QIL A;  1C78 A;  3BK2 A;  1UUP A;  3ZKJ C;  3AE8 B;  1P3Q U;  3DHH C;  2GBN A;  2DZI A;  3IAS 1;  4KKI A;  4A20 A;  4BBN F;  2YVC A;  1DOI A;  3Q3N C;  2KLC A;  4LCD E;  2JSV X;  4JKG B;  1TGZ B;  2OHF A;  3RD2 A;  1YN3 A;  1ZDX A;  1VRA B;  2KJH B;  1LXD A;  2KX0 A;  2KOX A;  4ZOH C;  3BVM A;  2VH1 A;  1OGW A;  1WE6 A;  3UQB A;  2JXT A;  1OFF A;  1NBF C;  4F1S A;  2SAK A;  3LYY A;  2Y7B A;  2HE7 A;  4A6F B;  3FAH A;  3HHM A;  3DWM A;  3DBL B;  5J17 A;  3ZJV A;  2I38 A;  4OZB A;  2V76 A;  1N3H A;  2XNA C;  3H7P B;  5D3X A;  5DHF B;  2CU1 A;  2GMI C;  4YTM B;  1IBX B;  3KLS X;  2CAY A;  2DHZ A;  3AMZ A;  4RM8 A;  4C4V B;  2HTH B;  1QLB B;  3IBE A;  4DDG D;  2IJ0 A;  2KR0 A;  4H2A A;  2MA9 B;  4CO7 A;  3W5U B;  1WE7 A;  4M02 A;  2IO0 B;  2PLP A;  3AEF B;  1W1H A;  2X8X X;  3PGE A;  2I1J A;  3W1S A;  1X1G A;  3ENE A;  1WJ4 A;  2TSS A;  3QAQ A;  3JSV A;  3PEG A;  4MJS A;  2DWQ A;  3A58 A;  5LG4 B;  5DPS A;  3RPF C;  3H9D A;  3TSS A;  5G5G A;  3P6A A;  4HHV A;  3NZ3 A;  1LGR A;  5IOI A;  3MC0 B;  1KBL A;  1WGH A;  3M3J A;  2GS0 A;  1V5T A;  3AE5 B;  2CKH B;  2D5G A;  4KSK C;  3FEH A;  5E6J A;  4WJ7 A;  1D5Z C;  2K00 A;  5KQ1 A;  1FNU A;  2KD0 A;  3TMP B;  4WUR A;  3U4E G;  1UEL A;  1RJ2 A;  2QIE B;  1FCL A;  3J9C A;  2NS5 A;  1WGU A;  2IGH A;  1RM6 C;  3DOW A;  5BMH A;  2I1K A;  4C0A A;  1AWE A;  2NBU A;  4HB0 B;  1NI2 A;  1E8W A;  2KWD A;  3P2B A;  1C4C A;  2WXP A;  4LNF A;  3P4Q B;  1P3R A;  4DIX A;  3QHT A;  2KN4 A;  4RGT A;  1AYF A;  3VFK A;  3ZXV A;  4K7S A;  2R2Q A;  2IO1 B;  4YTP B;  2IY0 B;  3ODW A;  1TKG A;  4EJN A;  1FO4 A;  1DGJ A;  2FUG 1;  1XXG A;  2WXI A;  2W55 A;  2W3S A;  2DEN B;  2KDB A;  1NYQ A;  4REZ A;  3ZRF A;  4A3O A;  1XX0 A;  1YOV B;  1F1H A;  5KCV A;  1UWM A;  2ROV A;  3W5V B;  2PMV A;  4FA6 A;  5H8Y E;  1UGM A;  2KJ6 A;  5MPO A;  2C9W B;  1T0Y A;  1J7C A;  2V3P A;  1JWM D;  5D94 A;  1N5X A;  4HPL B;  3RN9 C;  3E9L A;  2WS3 B;  4XWX A;  2EMT A;  2BB6 A;  1UNP A;  4BKT A;  2CY4 A;  1EU4 A;  1C9F A;  1ZUD 2;  2LOX A;  5HE3 A;  2N9E B;  1TKY A;  4BZA A;  4DXF A;  2JP2 A;  4HJK A;  1KOT A;  1RRB A;  1LQB A;  4PS7 A;  4XDC A;  3R7R A;  2MJE A;  3K9P B;  4LDT D;  2IND C;  1I4R A;  2FID A;  2IZV B;  1WF9 A;  3RNG C;  3CIK A;  3A1Q B;  2IDY A;  2IGG A;  2J59 M;  2Q13 A;  4AS1 A;  3TCA A;  2KC2 A;  5AEK B;  2RSU A;  3MPX A;  2BB5 A;  2LGX A;  3TVV A;  2WXF A;  4AP4 C;  2Y5P A;  4KGS A;  2KYW A;  5FR6 A;  3PZ7 A;  4HLE A;  3RCZ A;  4WQO B;  2LG1 A;  3BVZ A;  4HAW B;  2IGD A;  3RUI B;  3ZXR A;  2L52 A;  2HTM E;  3NUH B;  1YJJ A;  3T3N A;  1C1Y B;  3DXD A;  2JYT A;  3APD A;  4QJ5 B;  4IWP A;  3ML4 A;  4A90 A;  2MP2 A;  1YMH E;  4M8M A;  1SJH D;  4PYZ A;  2G9H D;  1PYW D;  3SHQ A;  1UF0 A;  2LVQ A;  2P0H A;  2VRW B;  3MJ5 A;  1JWA D;  3RNE C;  2KFJ A;  1E7P B;  2FIF A;  4YT0 B;  1JRO A;  3UIP B;  2YS3 A;  3IFW B;  5HG2 A;  3UIN B;  1I2H A;  3FIL A;  1KLG D;  2I2Y A;  2DYM A;  2COA A;  3PVW A;  3HVD A;  4A55 A;  1VDV A;  4S17 A;  1ROE A;  4BOZ B;  3HIZ A;  3SFE B;  3AEA B;  4CYE A;  4FJY A;  2V1Y A;  3A9K A;  1HTO A;  1N5W A;  4O1N A;  1XLO A;  4HDQ A;  2K3U A;  1T77 A;  3Q3O C;  2JPH A;  3T06 A;  2LGD A;  3DBL I;  4K2O A;  1P1A A;  4JKC A;  1GJZ A;  2KIE A;  1MG4 A;  1KLU D;  1ZC3 B;  2GCL A;  5IP4 D;  4L6E A;  2DHI A;  1V5U A;  2INP E;  2QJL A;  4HB2 B;  2YT2 A;  2HJ8 A;  1WR1 A;  3T9L A;  4FHJ A;  1S3S G;  3W1Y A;  1AN8 A;  4B0M A;  3NSU A;  4QJ4 B;  3AEG B;  2RDB C;  3SO6 A;  3ZJT A;  1TJE A;  1F77 A;  2J7Q B;  2KDI A;  2D07 B;  3A1Q A;  4NPN A;  1TBE A;  2AEH A;  3T8M A;  4W9D A;  1EAZ A;  5GXG B;  1KZG A;  1T3Q A;  2W9N A;  1PGX A;  3I63 C;  1R4M B;  2N1V A;  4KZ0 A;  4CHK A;  4MEL A;  2OED A;  1TTN A;  4W9H A;  4MGY E;  3SR6 A;  1SE3 A;  3NW8 A;  4LNI A;  4OVZ A;  4GNK B;  1M94 A;  1K5D B;  2WX0 A;  3TEX A;  3GYO A;  4OVU A;  2KDF B;  2J0K A;  4TYZ A;  1FIQ A;  1QIL A;  3DCG A;  2KHW B;  4KV2 A;  2DYN A;  4WWP A;  5C1Z A;  1ZM0 A;  1TS3 A;  3ZNI D;  3N3K B;  3QWM A;  4W9K A;  1JAL A;  4J3O D;  2DYB A;  4GPT B;  2GI9 A;  2M8S A;  3NWA A;  1XLQ A;  2K0P A;  2XN9 C;  1WJ1 A;  2K2U A;  4KAX B;  4RGO S;  3DXC A;  3ULC A;  4NY0 A;  2BKF A;  1XLN A;  4IAP A;  1L0V B;  2K6Q A;  3M95 A;  4ZRI A;  2AYO B;  1KLV A;  1U27 A;  3V60 A;  3KSY A;  4L2Y A;  3VRB B;  4RNA A;  4RM9 A;  1DRO A;  4DHJ B;  4CHM A;  1E9M A;  4USA A;  2KFK B;  3NZS A;  4IFS A;  2BYV E;  2ABD A;  2ZVO A;  3BWU D;  3BJI A;  3P4P B;  2NMB A;  5FI1 A;  4XGA B;  3DBR B;  1EF5 A;  4KZC A;  3WAO A;  1WSP A;  2KT7 A;  2MWS B;  2PE9 A;  2L76 A;  3KW5 B;  4ANV A;  5JHA A;  5EE9 A;  2CHZ A;  3A9J A;  1NVI D;  2C60 A;  3TEZ A;  3UIO B;  2WWZ A;  4OT1 A;  2ZKM X;  2DA0 A;  4GN1 A;  2VKI A;  3DPD A;  1WXS A;  1UNQ A;  2LJI A;  4OW0 A;  4ICU A;  5J3Q A;  1SSN A;  2PPH A;  4IKG A;  1DOY A;  2L0F A;  2R82 A;  1L4D B;  1H4R A;  2CS4 A;  3ULB A;  1UPR A;  1ZC4 B;  2D9V A;  1U5F A;  1E5W A;  2KUQ A;  1U2B A;  3QC8 B;  3AUL A;  3E66 A;  1T0Q C;  2WXK A;  3CIR B;  4DBG A;  3KWV A;  3A9K B;  5J18 A;  2RGN B;  2K2J A;  1VZ6 A;  5G2N A;  4W9C A;  2ELA A;  3ZUN A;  5JZE B;  2LGY A;  1GNU A;  1U29 A;  2FUH B;  1EWC A;  3AU5 A;  1ZYI A;  1BTK A;  4NJ7 A;  5DCN A;  1V8C A;  3D8F A;  5TR5 A;  4B6H A;  3Q8E A;  1DDM A;  5CTR C;  4ZYS A;  2ZJD A;  1MPE A;  4MSM B;  2GBR A;  4ILH A;  1FHW A;  1WVH A;  1E8Y A;  1EO6 A;  1XLP A;  2N23 A;  2KTR B;  3IT4 B;  1FNW A;  1SXT A;  4KSL C;  3ZDT A;  1F0Z A;  3WA0 A;  2WQY B;  1VD2 A;  3FP5 A;  2G4S A;  2O2V A;  4HAZ B;  4DXA B;  4IG7 B;  2KDE B;  1IUE A;  3QCA A;  4WJN A;  2GBK A;  2G35 A;  1B1Z A;  1STE A;  2ZPN A;  3VR8 B;  3ZVR A;  1WYG A;  2AL6 A;  1NTV A;  2MP2 B;  3LJU X;  3Q3F A;  4GSW A;  1UNS A;  4HB4 B;  4MK0 A;  4NQL B;  2KXJ A;  3H7P A;  2KMC A;  3AB5 A;  5LON B;  2D2Q A;  1T0S C;  1YJ1 A;  1KTK A;  1TJ6 A;  2REX A;  4HSI A;  3NG0 A;  4NAW B;  5DPT A;  2D11 A;  2GJY A;  1CJE A;  2VRR B;  3CXB B;  1YX6 B;  4XE0 A;  2C5L C;  2N7E A;  4C4V A;  2E3T A;  2QKM A;  3EC8 A;  4LJP B;  2ADZ A;  1HTQ A;  2M1M A;  2INN E;  2KVR A;  1UPQ A;  2G45 B;  3RZW C;  1L7Y A;  1MJD A;  3ONS A;  2YLM A;  4ZHP A;  1XQQ A;  3RUL A;  3P42 A;  1L6U A;  1B55 A;  4BKS D;  4FJZ A;  2L2I A;  3PS6 A;  1WGR A;  2KN5 A;  3URY A;  4RGN A;  3VRA B;  3V6C B;  4WWO A;  4GDL A;  2BPS A;  1EF1 A;  4PYU A;  5D3D A;  4W9F A;  3V62 A;  4IOY X;  2DLB A;  2RD0 A;  2V3S A;  3TEW A;  1YIW A;  1IPG A;  1E8X A;  2JVC A;  4B9K A;  1ENF A;  5D3W A;  1JRP A;  1WJM A;  2LVO A;  2VH2 A;  3EPY A;  3EA6 A;  2LUM A;  5JP4 A;  4HK2 A;  2J4X A;  3AEE B;  1QT9 A;  2KFK A;  4BKS A;  3ODO A;  1ZSQ A;  2LUE A;  1MK9 B;  4AQ7 A;  2JU6 X;  3R2T A;  2D4Q A;  1BWN A;  5BYQ A;  3AE9 B;  4YSZ B;  1WGG A;  2UWQ A;  3BY4 B;  2OQB A;  4US9 A;  1WH3 A;  2CY5 A;  3SNH A;  4IM3 A;  2L1C A;  1YQ4 B;  1TZO A;  3PTF C;  4K3C A;  4P6V F;  2O2V B;  3OAW A;  2WXM A;  2LJ5 A;  2SEB D;  3L0W B;  1U5E A;  3UQA A;  3L08 A;  4UDU C;  2WXQ A;  1GB1 A;  5IN7 A;  2H89 B;  3MP9 A;  1QOA A;  3Q6B A;  5DPR A;  5J3T A;  1MFW A;  4RMA A;  1V88 A;  2AWT A;  3L10 B;  3TIX A;  5FK9 C;  5JVL A;  3SBT A;  1TKE A;  2AQ1 B;  2RSG A;  2DIK A;  4R3D A;  1U5D A;  2ZEQ A;  3KRX A;  4QXA B;  3PT2 B;  1V1P A;  2M38 A;  4M0W B;  4WSF A;  2IO3 B;  1QOG A;  2D10 A;  4MAC A;  2Z13 A;  2BWF A;  3HVZ A;  3S2A A;  1WXV A;  4A6Q A;  2WXL A;  4K81 A;  3OWE B;  3P7Z A;  4KHO A;  1UWX A;  3ML9 A;  3Q2A C;  1PUT A;  1V5O A;  2LHE A;  5LOP B;  1R4N B;  2BYE A;  2RNR B;  2N0S B;  4ZDV A;  3VDZ A;  2X18 A;  3ZNG C;  4DDI D;  1DDV A;  1FHX A;  4RF0 A;  1J8C A;  3OJ4 B;  1J0W A;  4OSN A;  5AZH A;  4JPS A;  4LNK A;  3QK0 A;  2I5F A;  4ARC A;  1E10 A;  3FVC A;  1FHO A;  2NPT B;  4OVV A;  5C23 A;  2RLO A;  4JQW C;  3A8Q A;  4YON A;  4WH4 A;  4GU2 A;  4BOS C;  1MIX A;  3MTN B;  5IRS A;  2DAF A;  1UBI A;  1WRI A;  1ZDV A;  4EEW A;  5FR3 A;  1WXQ A;  2MQJ A;  4HVB A;  4FHK A;  4DHZ B;  2UZR A;  1L2N A;  5HE0 A;  1V89 A;  2WGS A;  4RH6 A;  3RNF C;  1WX8 A;  1SIJ A;  4Q2J A;  1V6E A;  2Z8L A;  2D9Z A;  2NVU I;  3QBV B;  1W1G A;  1SB3 C;  1JQ4 A;  3N9Y C;  1P7E A;  1UGJ A;  2KWU B;  3MHZ A;  2KAJ A;  3NZU A;  2NBW B;  3M1I B;  3W1S C;  2FJU B;  4HKQ A;  3IAM 1;  3RNB C;  3VTU A;  4FJV B;  4WWM A;  4ACF A;  4ZRP A;  2CHX A;  3X23 A;  3N1Z C;  1Z5S B;  2IYD B;  1WI1 A;  2N9K A;  1NEK B;  3UF8 A;  4GB9 A;  1X86 A;  2L83 A;  1V1P B;  3ZLZ A;  4RF1 A;  2KWC A;  4B6W A;  3Q8A A;  5EE0 A;  4M00 A;  2KVZ A;  2AQ3 B;  3HRD D;  3OAN A;  3A8P A;  3VTV A;  2D3G A;  3DDC B;  2A4Z A;  5D2M B;  4IW0 A;  3PZ8 A;  2VZK B;  1KC7 A;  3CWI A;  4AUQ C;  2GUM A;  2UU7 A;  2LEK A;  1HB6 A;  3ZGZ A;  4GMV A;  4MJS B;  4K17 A;  4IM0 A;  4PS8 A;  1YQB A;  2BW2 A;  2AL3 A;  2Y5B B;  5CX3 A;  2JXX A;  1WJU A;  2ASQ A;  4ITK A;  2XBB C;  4G3X B;  1J0G A;  4JL9 A;  1AW7 A;  2W2X D;  1K50 A;  2COP A;  4Y94 A;  1XO3 A;  1G6J A;  3NWF A;  2X38 A;  2W54 A;  2Y5C A;  3E9S A;  4HDO A;  3V05 A;  4HWI B;  1WMH B;  1N61 A;  4HEA 1;  2C7N B;  4ICV A;  4NZL B;  2IYB A;  4K1R B;  1L4Z B;  4A6F A;  4F7H A;  2L0T A;  1FM0 D;  2PIA A;  1OQY A;  3R66 C;  4QJ3 B;  1NEN B;  4GOC A;  2XK5 B;  4JWU C;  4BKG A;  2RDH A;  1RLF A;  3N20 C;  3HW2 B;  1NI3 A;  2O6V A;  2NZ8 B;  4P1B C;  2DFK A;  2K49 A;  2MWN B;  3B08 A;  2HJ1 A;  4RFB A;  3AE2 B;  1XCQ L;  5I2M A;  1UEF A;  1J7B A;  1C4A A;  1IBX A;  4A5K A;  1T6B X;  2K22 A;  3M62 B;  4A9A A;  5DPW A;  1GPX A;  2Z14 A;  2VZK D;  3E56 A;  3AE6 B;  2YEP B;  2P8V A;  4P16 A;  4M0W A;  4MDK E;  3JSV B;  1XEE A;  2Z59 A;  2PJH A;  3WAP A;  3C19 A;  3B0A A;  5IA7 A;  2W3R A;  2WH5 A;  2JRH A;  1XCG A;  1QKZ A;  2JX5 A;  1JML A;  2N4F A;  2KTF A;  2AX5 A;  4GDK A;  3WAM A;  3RT3 B;  4M8N A;  1TXD A;  1N6Z A;  1GOZ A;  1KZ7 A;  2K8H A;  3TW1 A;  2BTE A;  1DOX A;  2G3Q B;  1P5T A;  3FSS A;  1C77 A;  2V9H A;  3H6N A;  4KDL B;  3P63 A;  1FFU A;  2G1E A;  4HPM B;  1XF5 L;  3EHV A;  2KQ4 X;  2QDF A;  2N0Y A;  1ACC A;  1PGB A;  5IO9 A;  3ZVV A;  4HRS A;  1DDW A;  2NTT A;  2MHJ A;  5JHH A;  1WFY A;  3RMK C;  1Z2M A;  5M4Y B;  2LUL A;  3JVZ X;  4K7W A;  1LM8 B;  4L23 A;  2HRJ A;  1XR0 B;  1P7F A;  3AE3 B;  1K51 A;  1MHH E;  2BS2 B;  3QX1 A;  4NNJ B;  4ARI A;  3BYT B;  4KIK A;  2GLS A;  2M0A A;  4MSQ B;  1V49 A;  2JYE A;  2IFS A;  5L83 A;  3AE7 B;  2P0D A;  3C8Y A;  1E0Z A;  3ZTC A;  4DX9 0;  3HK0 A;  1CMX B;  5DH9 B;  1IP9 A;  3NVV A;  2QC8 A;  1FGY A;  2JUO A;  3U8Z A;  1LW3 A;  4MM3 A;  1GUA B;  2MBQ A;  4WAA A;  1V97 A;  1ZW7 A;  4BAX A;  4EKU A;  2BCJ A;  2KKC A;  2NTS A;  2RMM A;  1T0R C;  3I3T B;  3HSA A;  3BZD B;  1VZ7 A;  2EEL A;  1P6S A;  2FCS A;  4IUM B;  3I5J C;  2MW5 A;  1V9J A;  1T5X D;  4FAD A;  4JKF A;  3PRZ A;  2JWU A;  4I6L B;  1SGH A;  4US8 A;  3AN1 A;  4E74 A;  2ZZP B;  1MPH A;  1ZOY B;  2LKO A;  1TS2 A;  2DX1 A;  1GGO A;  2DBY A;  1P0R A;  2WXN A;  3V6E B;  2WP9 B;  1JW9 D;  2WDR B;  3U12 A;  1Y56 A;  2NCN A;  5T8I A;  5DIF B;  4TV3 A;  4C56 C;  2JZZ A;  2KDM A;  3APF A;  1DBH A;  4TQ0 A;  1V81 A;  3PP2 A;  4N58 A;  5D6J B;  3TFM A;  3LXF A;  3GS2 A;  2FAZ A;  5GOW B;  1NU2 A;  4D6W A;  1EU3 A;  1I4Q A;  3O65 B;  4XZ4 A;  3RZF A;  1NTI A;  1FB8 A;  3QA8 A;  2G4D B;  2WYQ A;  3APC A;  3ZNH B;  2CJO A;  2PW9 A;  3Q8F A;  4CSQ A;  4OZA A;  1KI1 B;  3PRM B;  1BAK A;  1PQS A;  1WIA A;  5KHO A;  3ODX A;  2DYQ A;  2Y3A A;  3DCX A;  1WGY A;  2EMS A;  1KM7 A;  2KNB A;  3F0W A;  2KMA A;  3DBR I;  4Z2M B;  5C2T B;  5EDS A;  2QKL A;  2B76 B;  2GB1 A;  4FUL A;  1WWT A;  5L95 C;  4Z2N A;  1OY2 A;  2C7M B;  1SF0 A;  1U5G A;  3DVN V;  1YN5 A;  2D9W A;  1D5X C;  2LWP A;  5JH5 C;  1ZKH A;  3QAR A;  4B0E A;  4NSW A;  1LO5 D;  2C7H A;  2MJD A;  2KCJ A;  4ZRQ A;  4JK8 A;  3VAW A;  2K6D B;  3PSC A;  1PGA A;  4HAV B;  2BKR B;  4ZYN A;  5EE3 A;  3GE8 C;  4W9E A;  1V5M A;  4GGQ A;  3B2F A;  1WX9 A;  5HFY A;  1WRD B;  5HI1 A;  2OJR A;  3E9P A;  3CF6 E;  4W9J A;  3VUW A;  3WIM A;  5LXH A;  2MRP A;  2FCN A;  2MDX A;  1Z87 A;  1A70 A;  4JKA A;  3A98 B;  3GB1 A;  5C5B B;  2ZVN A;  5AUI A;  5GMV A;  2BT6 A;  1K53 A;  2N9L A;  2RR9 A;  1WJ6 A;  2R09 A;  5I4D A;  4TQ1 A;  4JIO U;  1RFK A;  5BMI A;  4EFO A;  2RRF A;  1JRU A;  4NAM A;  2M0X A;  5BYR A;  3D8D A;  2D9X A;  2KGX B;  2LRW A;  2HDE A;  2FDQ A;  5HE1 A;  1ST7 A;  3GZN B;  4WJQ A;  1UD7 A;  4RCO A;  4KGT A;  3O96 A;  3I57 A;  2LMC A;  1ZVR A;  4JKD A;  1QF6 A;  4ZRK A;  1V2Y A;  1L5P A;  2D3A A;  3JW0 X;  2KLG A;  2R0D A;  2NBV B;  2LD9 A;  4GZU A;  2GBM A;  2DZJ A;  1I7A A;  1F52 A;  1ZXH A;  1LFD A;  2K8B A;  1FAO A;  4GLS C;  2V4L A;  1FRD A;  3A33 B;  4DWF A;  3AE1 B;  3VR9 B;  1JWS D;  1WYW B;  2LHD A;  2DX5 B;  4JKB A;  2AQ2 B;  2KQ7 A;  1HXY D;  4IC7 B;  5IKC M;  4E3C A;  4KHB B;  2JF5 A;  1TIF A;  4BBK A;  4KGR A;  4G50 A;  3HM6 X;  4DQO C;  2OTX A;  4JE3 B;  4HCP B;  2OOB B;  4AJY B;  2ONQ A;  3HUI A;  1Q5W B;  2COF A;  5I2S A;  4CHJ A;  3A4S C;  5DHA B;  1YX5 B;  3RI7 C;  1I7H A;  4MGZ E;  1YQ3 B;  2GOW A;  4ASW C;  1WZ0 A;  1SEB D;  4N59 A;  2K5P A;  3LJ3 A;  1Q0W B;  3AI5 A;  2MKR A;  3TEY A;  1W1D A;  2MX2 A;  2P0F A;  3MJW A;  3U2S C;  2KTR A;  3FC4 A;  2CRF A;  3TBL D;  1Q67 A;  3GOE A;  4N6E B;  1D6E C;  4XC2 A;  2WXR A;  1FXT B;  3WAN A;  2BS3 B;  1V1O A;  3VUX A;  1DYN A;  4FBJ B;  3PG7 A;  3DHG C;  4JK9 A;  1DYQ A;  4TMA B;  3U7Z A; 
#chains in the Genus database with same CATH homology
 4FN2 A;  3DVN U;  5EFX A;  3OJ3 A;  2A5U A;  3ZDM C;  1PLS A;  4II2 B;  3N32 A;  2ZNV B;  1IYF A;  3FM8 C;  1NVL A;  3QWZ B;  1M7R A;  3VH4 B;  3HM3 A;  3N7C A;  2IY1 B;  3PHX B;  2BWE S;  4LDT B;  3VVW B;  2W2W A;  3PZD A;  2JWZ A;  3KYD D;  2N7D A;  4WVF B;  4HAT B;  2LXC A;  3SDL C;  3KH0 A;  1XT9 B;  2LRU A;  2DHJ A;  4DBB A;  2KJR A;  3ENB A;  2DLW A;  1SHC A;  2X0S A;  3MDB C;  5DI9 B;  1BTN A;  3PVL A;  3N30 A;  1ZGU B;  2Z0P A;  1TZ1 A;  4EZK A;  4WJP A;  2CQU A;  2K1F A;  4EZJ A;  4KDI C;  4EMO A;  3H1U A;  1A5R A;  3VIA A;  2COD A;  1XD4 A;  3UGB B;  1RRP B;  2MCN B;  1GC7 A;  4JKE A;  2EKE C;  3ZRC A;  2FCQ A;  2JZ3 B;  5JHG A;  2R2O A;  2H7E A;  1TQZ A;  2YT0 A;  3B1L X;  1ISN A;  4GIV A;  4G0N B;  5BO4 B;  2IO2 B;  1PFJ A;  1BT0 A;  3AXC A;  3FLV A;  1GG3 A;  1E7V A;  3DXE A;  3NHE B;  1IRS A;  5J2R A;  2W2X C;  2GBJ A;  4GDL B;  2YRY A;  3SV1 A;  4W9G A;  4XX5 A;  2RVB B;  3KVF B;  2L8J A;  1WG7 A;  2NR2 A;  4I6N B;  1H8C A;  3NOB A;  5E6N A;  2DKP A;  4AOF A;  1OTR B;  3L16 A;  4LJO B;  3A9J B;  2QHO A;  4MGI E;  3VTW A;  1WI0 A;  2KK8 A;  4MEM A;  2MBH A;  4A3P A;  4P7I A;  1WX7 A;  2LVP A;  2MLB A;  5KHQ A;  2UZS A;  3DBH I;  1MIZ B;  5C6R A;  2E2X A;  2Z0O A;  5L81 A;  2LAS A;  2CR5 A;  2JT4 B;  3M63 B;  2D9Y A;  3L54 A;  3PRE A;  5JHB A;  3GZN I;  3OLM D;  1AAR A;  4ANX A;  4HB3 B;  1VBG A;  2Z0E B;  2ZCC A;  2DYO A;  3HQC A;  3U7D A;  1ACA A;  1E7U A;  4A6H A;  1NDD A;  4DHJ D;  3KZ1 A;  1C3T A;  5LLI A;  4I6P A;  1I42 A;  4NQK E;  3SU8 X;  1V80 A;  1HB8 A;  3KUC B;  2L00 B;  2KUP A;  3ALB A;  3AU4 A;  1VCB A;  5CLQ B;  1R4N I;  1H10 A;  4JLC A;  2KX3 A;  2UYZ B;  2L3Z A;  1I35 A;  3L17 A;  3KUZ A;  3ZW3 A;  3F5R A;  3AJ4 A;  2K8C A;  2JY6 A;  4WWN A;  2YF0 A;  1WR6 E;  4BBN C;  2VSZ A;  3K9O B;  1MK7 B;  3ZIM A;  1OEY J;  4W9L A;  4EOY A;  1F9J A;  4JKH A;  3VOQ A;  1V5P A;  1WJN A;  2HTH A;  2IBI B;  2RQ1 A;  3EEC A;  2EJ8 A;  4DHZ E;  3DVG Y;  5D7G A;  3KUD B;  2DHK A;  1RFA A;  2PZ1 A;  4NJ6 A;  3UZT A;  2K25 A;  3ML8 A;  4B95 A;  1QC6 A;  2ROZ B;  1MKE A;  4F7Z A;  2FCM A;  1GC6 A;  1HBK A;  1Y5O A;  4PS3 A;  3BIN A;  2YT1 A;  5J3Y A;  2WDT B;  2NPT A;  4K7U A;  2KC1 A;  3VQI A;  1J19 A;  3PSE B;  3DBS A;  4K2P A;  2CHW A;  5C79 A;  2I5C A;  2N1W A;  5IAA C;  4PNK A;  4W9I A;  3QIJ A;  1WM2 A;  4HXD A;  3IVF A;  3WYF B;  1P98 A;  1EGX A;  1M7E A;  1QQG A;  3EFU A;  3ECI A;  2L7R A;  2DKQ A;  2Z0D B;  5HKH A;  2RUK B;  2ZCB A;  4BFR A;  2FJ9 A;  1EVH A;  2MBB B;  4PQ0 A;  2UVM A;  3WAL A;  2DN6 A;  4J6I A;  1XOD A;  4IWO A;  2M14 A;  2O6V D;  4NAW A;  3DQV A;  1KJT A;  3ZNZ B;  2N9P C;  1V86 A;  2XQN M;  2KQS A;  2DZK A;  1AQC A;  5JLJ B;  3CST A;  1XKE A;  4DX8 A;  4GMX B;  1XD3 B;  2RGF A;  4TUU A;  1NTY A;  3PLU A;  1X1F A;  4GDK B;  5D27 A;  1YD8 U;  1D3Z A;  4GXB A;  3TL5 A;  4MY6 A;  2DZM A;  4IWQ A;  3GYP A;  5C16 A;  1S1Q B;  4MH0 E;  4KVG B;  2FJL A;  3V61 A;  4JKG A;  4HAY B;  3RCP A;  3PLV A;  2WX1 A;  2XK5 A;  1EUV B;  1U4A A;  2O6V B;  1P9D U;  1RAX A;  1UNR A;  5CLL B;  3IHP C;  4A6K A;  4ANU A;  2KZR A;  3MHS D;  3CSF A;  4YL8 A;  2M17 A;  3DVG X;  3PV1 A;  5D3Y A;  2LXA A;  4HAU B;  2DX5 A;  4IM2 A;  4F7G A;  2LI5 A;  3PPA A;  5AZG A;  1WGQ A;  2DTC A;  3SD5 A;  5E6O A;  2LZ6 A;  3R7Q A;  5IJM A;  2K39 A;  5E6P A;  2KAN A;  2PE6 B;  5KQ4 A;  4MT7 A;  1Y8R C;  3X0W A;  3L13 A;  5CHW A;  5G55 A;  4JGH B;  1E90 A;  1E8Z A;  4ILJ A;  4MGK E;  5AZF A;  2KWV B;  3R3M A;  4HCN B;  1WXA A;  3G9W A;  2MFQ A;  5FI0 A;  2RPQ A;  4X57 B;  3JYU A;  2BGF A;  3IG3 A;  1WXM A;  3TJP A;  3SBG A;  2M4N A;  5HE2 A;  4F7U P;  1WMH A;  3PHW B;  3SUZ A;  4AWJ A;  4URK A;  1PMS A;  3PVU A;  3VUY A;  3A4R A;  3TO1 A;  1K8R B;  1WZ3 A;  1QZE A;  1SIF A;  2ELB A;  1UH6 A;  2ZNV C;  1OMW A;  3U30 A;  2KO3 A;  2Y8F A;  3VXW A;  1OEY A;  2LYD A;  2J0J A;  3D32 A;  3ZO5 B;  4G11 A;  3V5W A;  2B3A A;  1UZX B;  1MAI A;  2L05 A;  1X1M A;  2ZPY A;  1Y19 B;  2H7D A;  4JK7 A;  1DIK A;  4HAX B;  4ANW A;  2BYF A;  1Q1O A;  1WM3 A;  4KHA A;  3KRW A;  5LXI B;  4D0N B;  1X11 A;  3SYX A;  3NY5 A;  4ZRJ A;  1WY8 A;  2Z59 B;  1VBH A;  3Q3J A;  1FOE A;  2MBE A;  3VH3 B;  4ILG B;  4WJO A;  2FNJ B;  3PRP B;  2YS5 A;  1UBQ A;  2JRI B;  3CMM B;  2EC1 A;  3C0R B;  4F8C B;  4DK5 A;  2DAJ A;  2YSZ A;  2Y8G A;  3QJZ A;  1X05 A;  5C5B A;  3KYC D;  2BF8 B;  4N9F 4;  1JDE A;  4TKN A;  2GCJ A;  2J0M A;  2COC A;  2Z0Q A;  4FLH A;  4AJW A;  4EUT A;  5D3V A;  1MG8 A;  4H8S A;  2XEW A;  3H7S A;  3RYT A;  4EZL A;  5CHV C;  3E9O A;  3KY9 A;  5CHF A;  2N9X A;  1WGD A;  2MBO A;  3VHT C;  2LOZ A;  1SE9 A;  3D8E A;  4KIK B;  4BVU C;  1K5G B;  2LBB A;  1FGZ A;  2MSE D;  2PEA A;  4II3 B;  4E71 A;  1V61 A;  2CB8 A;  1LB1 A;  1HE8 A;  1R4M I;  3LDZ E;  2YS1 A;  1OQN A;  3ZTD A;  3QQ8 B;  3NS8 A;  2HD5 B;  3ZKJ C;  1P3Q U;  2GBN A;  2DZI A;  4A20 A;  4BBN F;  2YVC A;  2KLC A;  4LCD E;  4JKG B;  1TGZ B;  3RD2 A;  2KJH B;  1LXD A;  2KX0 A;  2KOX A;  1OGW A;  1WE6 A;  3UQB A;  1NBF C;  4F1S A;  2Y7B A;  2HE7 A;  4A6F B;  3HHM A;  5J17 A;  2V76 A;  1N3H A;  3H7P B;  5D3X A;  5DHF B;  2CU1 A;  2GMI C;  2CAY A;  2DHZ A;  4RM8 A;  2HTH B;  3IBE A;  4DDG D;  2MA9 B;  4CO7 A;  1WE7 A;  2IO0 B;  1W1H A;  3PGE A;  2I1J A;  3W1S A;  1X1G A;  3ENE A;  1WJ4 A;  3QAQ A;  3JSV A;  3PEG A;  4MJS A;  5DPS A;  3H9D A;  3P6A A;  4HHV A;  1KBL A;  1WGH A;  3M3J A;  2GS0 A;  1V5T A;  2CKH B;  4KSK C;  3FEH A;  4WJ7 A;  2K00 A;  5KQ1 A;  2KD0 A;  3TMP B;  1UEL A;  1RJ2 A;  2NS5 A;  1WGU A;  3DOW A;  2I1K A;  4C0A A;  1AWE A;  2NBU A;  4HB0 B;  1NI2 A;  1E8W A;  3P2B A;  1P3R A;  3QHT A;  3VFK A;  4K7S A;  2R2Q A;  2IO1 B;  2IY0 B;  3ODW A;  4EJN A;  2DEN B;  2KDB A;  3ZRF A;  4A3O A;  1XX0 A;  5KCV A;  2ROV A;  4FA6 A;  1UGM A;  2KJ6 A;  2C9W B;  1T0Y A;  5D94 A;  4HPL B;  3E9L A;  4XWX A;  2EMT A;  1UNP A;  4BKT A;  2CY4 A;  2LOX A;  5HE3 A;  2N9E B;  2JP2 A;  4HJK A;  1KOT A;  1RRB A;  1LQB A;  4PS7 A;  3R7R A;  3K9P B;  4LDT D;  2FID A;  2IZV B;  1WF9 A;  3CIK A;  3A1Q B;  2J59 M;  2Q13 A;  3TCA A;  2KC2 A;  5AEK B;  2RSU A;  3MPX A;  2LGX A;  3TVV A;  4AP4 C;  5FR6 A;  4HLE A;  3RCZ A;  4WQO B;  2LG1 A;  4HAW B;  3RUI B;  1C1Y B;  3DXD A;  3APD A;  4IWP A;  3ML4 A;  2MP2 A;  4M8M A;  4PYZ A;  3SHQ A;  2LVQ A;  2P0H A;  2VRW B;  2KFJ A;  2FIF A;  3UIP B;  2YS3 A;  3IFW B;  3UIN B;  1I2H A;  2DYM A;  2COA A;  3PVW A;  4BOZ B;  3HIZ A;  4CYE A;  4FJY A;  2V1Y A;  3A9K A;  4HDQ A;  2JPH A;  3T06 A;  2LGD A;  3DBL I;  4K2O A;  1P1A A;  4JKC A;  1GJZ A;  1ZC3 B;  2GCL A;  4L6E A;  2DHI A;  1V5U A;  4HB2 B;  2HJ8 A;  1WR1 A;  3T9L A;  4FHJ A;  1S3S G;  3W1Y A;  3NSU A;  3SO6 A;  2J7Q B;  2KDI A;  2D07 B;  3A1Q A;  4NPN A;  1TBE A;  2AEH A;  3T8M A;  4W9D A;  1EAZ A;  1KZG A;  2W9N A;  2N1V A;  4KZ0 A;  4CHK A;  4MEL A;  1TTN A;  4W9H A;  4MGY E;  1M94 A;  1K5D B;  2WX0 A;  3GYO A;  4OVU A;  2KDF B;  2J0K A;  4TYZ A;  3DCG A;  2KHW B;  4KV2 A;  2DYN A;  4WWP A;  5C1Z A;  1ZM0 A;  3ZNI D;  3N3K B;  3QWM A;  4W9K A;  2DYB A;  4GPT B;  2M8S A;  1WJ1 A;  2K2U A;  4KAX B;  3DXC A;  3ULC A;  4NY0 A;  2BKF A;  3M95 A;  4IAP A;  2K6Q A;  4ZRI A;  2AYO B;  1KLV A;  1U27 A;  3V60 A;  3KSY A;  4RM9 A;  4DHJ B;  1DRO A;  4CHM A;  2KFK B;  3NZS A;  4IFS A;  2BYV E;  2ABD A;  2ZVO A;  3BJI A;  2NMB A;  5FI1 A;  1EF5 A;  4KZC A;  3WAO A;  2MWS B;  2PE9 A;  2L76 A;  3KW5 B;  4ANV A;  5JHA A;  2CHZ A;  3A9J A;  2C60 A;  3UIO B;  2WWZ A;  2DA0 A;  4GN1 A;  2VKI A;  3DPD A;  1WXS A;  1UNQ A;  4ICU A;  5J3Q A;  2PPH A;  2L0F A;  2R82 A;  1H4R A;  2CS4 A;  3ULB A;  1UPR A;  1ZC4 B;  2D9V A;  1U5F A;  1E5W A;  1U2B A;  3QC8 B;  3AUL A;  3E66 A;  4DBG A;  3A9K B;  5J18 A;  2RGN B;  2K2J A;  3ZUN A;  5G2N A;  5JZE B;  2ELA A;  4W9C A;  2LGY A;  1GNU A;  1U29 A;  2FUH B;  3AU5 A;  1BTK A;  4NJ7 A;  5DCN A;  3D8F A;  5TR5 A;  4B6H A;  1DDM A;  5CTR C;  2ZJD A;  4MSM B;  2GBR A;  4ILH A;  1FHW A;  1WVH A;  1E8Y A;  1EO6 A;  2N23 A;  2KTR B;  4KSL C;  3ZDT A;  3WA0 A;  1VD2 A;  3FP5 A;  2G4S A;  2O2V A;  4HAZ B;  4DXA B;  4IG7 B;  2KDE B;  3QCA A;  4WJN A;  2GBK A;  2G35 A;  2ZPN A;  3ZVR A;  3Q3F A;  2AL6 A;  1NTV A;  2MP2 B;  3LJU X;  4GSW A;  4HB4 B;  4MK0 A;  4NQL B;  2KXJ A;  3H7P A;  2KMC A;  5LON B;  2D2Q A;  1YJ1 A;  1TJ6 A;  2REX A;  4NAW B;  5DPT A;  2D11 A;  2GJY A;  2VRR B;  3CXB B;  1YX6 B;  2C5L C;  2N7E A;  2QKM A;  3EC8 A;  4LJP B;  2ADZ A;  2M1M A;  2KVR A;  1UPQ A;  2G45 B;  3RZW C;  1L7Y A;  3ONS A;  2YLM A;  1XQQ A;  3RUL A;  1B55 A;  4BKS D;  4FJZ A;  2L2I A;  3PS6 A;  1WGR A;  2KN5 A;  3V6C B;  4WWO A;  4GDL A;  2BPS A;  1EF1 A;  4PYU A;  3V62 A;  4W9F A;  4IOY X;  2RD0 A;  2V3S A;  1YIW A;  1IPG A;  1E8X A;  2JVC A;  4B9K A;  5D3W A;  1WJM A;  2LVO A;  3EPY A;  5JP4 A;  4HK2 A;  2KFK A;  4BKS A;  3ODO A;  1ZSQ A;  2LUE A;  1MK9 B;  2D4Q A;  1BWN A;  1WGG A;  2UWQ A;  3BY4 B;  2OQB A;  1WH3 A;  2CY5 A;  3SNH A;  4IM3 A;  2L1C A;  3PTF C;  2O2V B;  3OAW A;  2LJ5 A;  3L0W B;  1U5E A;  3UQA A;  3L08 A;  5DPR A;  5J3T A;  4RMA A;  1V88 A;  2AWT A;  3L10 B;  3TIX A;  5JVL A;  3SBT A;  2RSG A;  2DIK A;  1U5D A;  2ZEQ A;  3KRX A;  3PT2 B;  2M38 A;  4M0W B;  4WSF A;  2IO3 B;  2D10 A;  2BWF A;  3S2A A;  1WXV A;  4K81 A;  3P7Z A;  4KHO A;  3ML9 A;  1V5O A;  5LOP B;  2BYE A;  4ZDV A;  2RNR B;  3VDZ A;  2X18 A;  3ZNG C;  4DDI D;  1DDV A;  1J8C A;  1FHX A;  3OJ4 B;  1J0W A;  5AZH A;  3QK0 A;  2I5F A;  1FHO A;  2NPT B;  4OVV A;  5C23 A;  2RLO A;  4JQW C;  3A8Q A;  4YON A;  4BOS C;  4GU2 A;  1MIX A;  3MTN B;  2DAF A;  1UBI A;  4EEW A;  2MQJ A;  4HVB A;  4FHK A;  4DHZ B;  2UZR A;  1L2N A;  5HE0 A;  1V89 A;  1WX8 A;  1V6E A;  2D9Z A;  2NVU I;  3QBV B;  1W1G A;  2KWU B;  3NZU A;  2NBW B;  3M1I B;  3W1S C;  3VTU A;  4FJV B;  2CHX A;  3X23 A;  1Z5S B;  2IYD B;  1WI1 A;  3UF8 A;  4GB9 A;  1X86 A;  3ZLZ A;  4B6W A;  2KWC A;  3OAN A;  3A8P A;  3VTV A;  2D3G A;  3DDC B;  2A4Z A;  5D2M B;  4IW0 A;  1KC7 A;  4AUQ C;  1HB6 A;  4GMV A;  4MJS B;  4K17 A;  4IM0 A;  4PS8 A;  1YQB A;  2AL3 A;  2Y5B B;  5CX3 A;  2JXX A;  1WJU A;  2ASQ A;  2XBB C;  4G3X B;  1J0G A;  4JL9 A;  2W2X D;  2COP A;  4Y94 A;  1G6J A;  4HDO A;  4HWI B;  1WMH B;  2C7N B;  4ICV A;  2IYB A;  4K1R B;  4A6F A;  4F7H A;  2L0T A;  1OQY A;  3R66 C;  4GOC A;  2XK5 B;  4BKG A;  1RLF A;  3HW2 B;  2O6V A;  2NZ8 B;  2DFK A;  2MWN B;  3B08 A;  1UEF A;  4A5K A;  3M62 B;  5DPW A;  2P8V A;  4MDK E;  3JSV B;  2PJH A;  3WAP A;  3B0A A;  5IA7 A;  2WH5 A;  2JRH A;  1XCG A;  2N4F A;  2KTF A;  4GDK A;  3WAM A;  3RT3 B;  4M8N A;  1TXD A;  1KZ7 A;  2K8H A;  3TW1 A;  2G3Q B;  1P5T A;  3FSS A;  3H6N A;  4KDL B;  4HPM B;  3EHV A;  2N0Y A;  3ZVV A;  1DDW A;  5JHH A;  1WFY A;  1Z2M A;  2LUL A;  3JVZ X;  4K7W A;  1LM8 B;  2HRJ A;  1XR0 B;  3QX1 A;  4NNJ B;  4KIK A;  4MSQ B;  1V49 A;  2IFS A;  5L83 A;  2P0D A;  3ZTC A;  4DX9 0;  3HK0 A;  1CMX B;  5DH9 B;  1IP9 A;  1FGY A;  3U8Z A;  2JUO A;  1LW3 A;  4MM3 A;  1GUA B;  2MBQ A;  4WAA A;  1ZW7 A;  4EKU A;  2BCJ A;  2KKC A;  3I3T B;  1P6S A;  2FCS A;  4IUM B;  2MW5 A;  1V9J A;  4FAD A;  4JKF A;  3PRZ A;  4I6L B;  1SGH A;  4E74 A;  2ZZP B;  1MPH A;  2LKO A;  2DX1 A;  1GGO A;  1P0R A;  3V6E B;  2NCN A;  5DIF B;  4TV3 A;  2JZZ A;  3APF A;  1DBH A;  4TQ0 A;  1V81 A;  3PP2 A;  5D6J B;  3TFM A;  2FAZ A;  5GOW B;  1NU2 A;  3O65 B;  4XZ4 A;  3RZF A;  1NTI A;  1FB8 A;  3QA8 A;  2G4D B;  2WYQ A;  3APC A;  3ZNH B;  1KI1 B;  3PRM B;  1BAK A;  1PQS A;  1WIA A;  5KHO A;  3ODX A;  2DYQ A;  1WGY A;  2EMS A;  1KM7 A;  2KNB A;  3F0W A;  2KMA A;  3DBR I;  4Z2M B;  5EDS A;  2QKL A;  4FUL A;  5L95 C;  4Z2N A;  1OY2 A;  2C7M B;  1U5G A;  3DVN V;  2D9W A;  2LWP A;  5JH5 C;  1ZKH A;  3QAR A;  4NSW A;  2C7H A;  2KCJ A;  4JK8 A;  3VAW A;  2K6D B;  3PSC A;  4HAV B;  2BKR B;  4ZYN A;  4W9E A;  1V5M A;  4GGQ A;  1WX9 A;  1WRD B;  2OJR A;  3E9P A;  3CF6 E;  4W9J A;  3VUW A;  3WIM A;  5LXH A;  2MRP A;  2FCN A;  2MDX A;  1Z87 A;  4JKA A;  3A98 B;  5C5B B;  2ZVN A;  5GMV A;  2RR9 A;  1WJ6 A;  2R09 A;  4TQ1 A;  4JIO U;  4EFO A;  1JRU A;  2M0X A;  3D8D A;  2D9X A;  2KGX B;  2LRW A;  2FDQ A;  5HE1 A;  1ST7 A;  4WJQ A;  1UD7 A;  3O96 A;  1ZVR A;  4JKD A;  4ZRK A;  1V2Y A;  3JW0 X;  2KLG A;  2R0D A;  2NBV B;  2LD9 A;  4GZU A;  2GBM A;  2DZJ A;  1I7A A;  1LFD A;  2K8B A;  1FAO A;  2V4L A;  3A33 B;  4DWF A;  1WYW B;  2DX5 B;  4JKB A;  2KQ7 A;  4IC7 B;  4E3C A;  4KHB B;  2JF5 A;  4BBK A;  4G50 A;  3HM6 X;  2OTX A;  4HCP B;  2OOB B;  4AJY B;  1Q5W B;  2COF A;  4CHJ A;  3A4S C;  5DHA B;  1YX5 B;  4MGZ E;  2GOW A;  4ASW C;  1WZ0 A;  3LJ3 A;  1Q0W B;  3AI5 A;  2MKR A;  1W1D A;  2MX2 A;  2P0F A;  3MJW A;  2KTR A;  2CRF A;  3TBL D;  1Q67 A;  3GOE A;  4XC2 A;  1FXT B;  3WAN A;  3VUX A;  1DYN A;  4FBJ B;  3PG7 A;  4JK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...