1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords RADIXIN
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
3N7CA 3KRWA 4IWQA 3VH3B 2V1YA 5KCVA 1YX5B 4FJZA 3AU5A 4MY6A 4IWOA 3RCZA 2DZJA 4EEWA 1RJ2A 2LGYA 5AZHA 4CHMA 2CHXA 3TVVA 3DBHI 4C0AA 1UZXB 5DCNA 5GMVA 5TR5A 3RYTA 3TBLD 2N9EB 4LCDE 3P6AA 4Z2NA 2HRJA 4M0WB 2E2XA 1DDWA 1P1AA 2D3GA 1UPRA 2WYQA 4TQ1A 1V86A 3JYUA 4K2OA 4NAWB 2KK8A 3L0WB 2LGDA 3GYOA 1JRUA 2LASA 2M0XA 4WWNA 3PRZA 3F5RA 4URKA 4CYEA 2ELAA 3OJ3A 3D32A 1WXSA 1WYWB 1MIXA 1Z2MA 1FAOA 2M8SA 3PLUA 3AXCA 3M3JA 1H4RA 2UZSA 3PVWA 1XCGA 1V2YA 3QJZA 4II3B 3VAWA 2JF5A 1ZVRA 3VVWB 1NDDA 4GDKA 4GDLB 4MJSA 3PSCA 1KJTA 1HE8A 4JL9A 4EUTA 4DHZE 2NS5A 4PQ0A 2YF0A 1X1MA 2KQ7A 4YONA 3MHSD 1X86A 1I2HA 4GSWA 4RMAA 1ISNA 2JWZA 5IAAC 2KFKB 4BKGA 3U30A 1QQGA 1TZ1A 3DQVA 3MJWA 1UEFA 4IAPA 3IG3A 2IO0B 1WGQA 5G2NA 4DWFA 5BO4B 3T9LA 2MBBB 4HAYB 4ZRKA 2J0MA 3IVFA 4FHJA 3CXBB 4NAWA 2L8JA 4A6FB 4DDID 4E3CA 1U4AA 1D3ZA 5J3YA 2YVCA 3L08A 3PV1A 2WDTB 2GBKA 3ZTCA 3AU4A 2KUPA 3ZRFA 4MSQB 1Y19B 4HB0B 3F0WA 5CX3A 2MRPA 2QHOA 2ZEQA 3UQAA 3CSTA 1G6JA 3RCPA 1WMHA 3QAQA 4CHJA 4KIKA 1I42A 2Z0QA 4CHKA 3SYXA 1WIAA 1WXAA 3ZVRA 1J0WA 1WFYA 2DENB 1XX0A 3NZUA 4G11A 2V4LA 2LVOA 4GXBA 4KDLB 4PYZA 2N7EA 2RD0A 3FSSA 1E7VA 3WAMA 3VIAA 2VRWB 3K9PB 3D8EA 4PYUA 2LOZA 3PLVA 1DYNA 1GJZA 5C5BB 2LRWA 2LXCA 4NQLB 4BBNC 3HM3A 4FULA 1WVHA 1HB8A 2LOXA 1WH3A 3PHXB 4EZKA 2KWCA 2KWVB 3HIZA 1H8CA 1V49A 1HB6A 1E8YA 2MSED 3KUCB 2JRHA 3N30A 2M38A 5KHOA 2CQUA 5IA7A 3UQBA 2J0KA 3A9JA 4HDQA 1Q67A 3VH4B 2DHZA 4DX8A 3QWMA 4I6LB 2NR2A 3L13A 3VTVA 3RZFA 4B9KA 1R4NI 2RSGA 2W2XD 1WJ4A 2FCNA 3N3KB 3NS8A 3W1SA 2D9ZA 4JIOU 2KFKA 4JQWC 2Q13A 3H1UA 4G0NB 4NJ7A 2EC1A 4RM8A 2Z0DB 5IJMA 3M62B 3PT2B 1TBEA 5C79A 4KHOA 4Z2MB 5LOPB 4GZUA 1YJ1A 2FUHB 3PRPB 3CF6E 1M7EA 3ECIA 3P2BA 4GIVA 3PVLA 5CHWA 3L16A 4GU2A 3VTUA 5DPWA 3G9WA 2NZ8B 2GMIC 3KRXA 5GOWB 1RAXA 2DAJA 3PEGA 4DBBA 1C1YB 2KC2A 2P0FA 3QK0A 4FJYA 4PS7A 3TJPA 3SHQA 2D9YA 1IPGA 2DLWA 4MDKE 3WA0A 4HPMB 4EOYA 4MJSB 2O2VB 1V5OA 2D9XA 5D27A 2ASQA 3A9KA 4HJKA 3VUWA 2LGXA 2MLBA 2G35A 2MW5A 3VFKA 5AEKB 2WWZA 5FI1A 4A3PA 4MT7A 2CR5A 2HD5B 1WR6E 2N7DA 2LVPA 2IO3B 2GBMA 5DPRA 1WGHA 2NBWB 3DDCB 1L2NA 4B95A 4A6KA 2NBUA 2DX1A 4BKSA 3RULA 5EDSA 1IYFA 3TL5A 2DKPA 2ZCCA 4FN2A 4GOCA 2COCA 4W9JA 4BVUC 3A8PA 4NSWA 4D0NB 1OEYJ 4HB2B 1X05A 3B1LX 4JGHB 1BAKA 4K7UA 3H6NA 3V6EB 1C3TA 4GDLA 4K17A 3MTNB 2L0FA 5JLJB 1T0YA 3HM6X 2KTRB 2MBEA 1DBHA 3DXDA 3A9JB 2DX5A 1WE7A 2RPQA 3MPXA 5J3QA 2BWFA 1WXVA 2MBQA 3ZDMC 2KVRA 3AI5A 3ZNID 4ANVA 2R09A 2BWES 2UYZB 4EZLA 4IM0A 3KUDB 2L1CA 4FJVB 1ZKHA 4WWPA 1EUVB 4OVVA 2WX1A 3RUIB 4AJYB 1Z5SB 3PREA 4MH0E 3ZIMA 4EKUA 2VSZA 1P3QU 4LJOB 3V5WA 3X23A 3LJUX 2DZMA 2DYNA 2LUEA 2LVQA 2ZNVC 2GBRA 3HHMA 2NCNA 3NZSA 3WAOA 2MWNB 2KX0A 2OQBA 4EJNA 3HK0A 5D3XA 1XD4A 4ZYNA 3BINA 5J2RA 1FHXA 2L0TA 2ZVNA 3OJ4B 1E7UA 4II2B 4YL8A 2GBNA 1SHCA 5LONB 4F7UP 4MGZE 4DHJD 4NY0A 4DHZB 5JHBA 4HAXB 4F8CB 3ZUNA 2KJ6A 3DVGX 2BCJA 3BJIA 4WJ7A 1XKEA 2Z0PA 1X1FA 1WE6A 1WGRA 1WX9A 4HWIB 1SIFA 1WGDA 3D8DA 2FCSA 2CY5A 4M8MA 3NSUA 2X18A 3H7PA 2CY4A 2Y8FA 5C6RA 1WJNA 4FHKA 3VDZA 4HXDA 1KM7A 2ADZA 2K8CA 3FP5A 1V5MA 2IFSA 3MDBC 4KAXB 4KHAA 5D3YA 4NNJB 3VQIA 1WI1A 1RRBA 2L7RA 2YSZA 4HAZB 3ZLZA 1KI1B 2DHJA 3X0WA 4TKNA 3HW2B 4ICUA 1P5TA 3DXCA 2V76A 4W9EA 4W9IA 3H7SA 3PGEA 1U2BA 3H7PB 2AYOB 2N1WA 4GDKB 2I5FA 1LFDA 1K8RB 1RLFA 3H9DA 1WX8A 3ZRCA 4BFRA 4KSKC 2P0HA 3PZDA 2JUOA 2IYBA 2LXAA 2FIDA 5D94A 3ONSA 1KOTA 1Q1OA 5LLIA 2L2IA 1YD8U 2DHIA 4B6WA 5D3VA 1WJUA 4E71A 1OTRB 2D4QA 1MIZB 4GMVA 2KKCA 2ZCBA 5JH5C 3RZWC 3U8ZA 3IFWB 4PS8A 4MELA 2YRYA 2W9NA 1W1HA 3O96A 4HAWB 2FCMA 3S2AA 5JZEB 1LQBA 1XQQA 2O2VA 3A9KB 3PRMB 1NVLA 5JHHA 1OY2A 2IO1B 4W9DA 5CHFA 4KV2A 4X57B 2M4NA 1SGHA 4BKTA 1W1GA 2B3AA 2J59M 4AWJA 2R0DA 1NBFC 2K00A 2MKRA 2KDBA 3QHTA 3PP2A 3R7QA 1BT0A 2R2QA 4W9LA 2EJ8A 3GZNI 3PVUA 1EO6A 1UBIA 2R2OA 1GC6A 1RFAA 2JRIB 2A5UA 2ZZPB 5D7GA 5DHFB 3WYFB 2DYBA 1U27A 4NJ6A 2KD0A 3EECA 5AZFA 3TIXA 2G3QB 1A5RA 2MDXA 2FAZA 3WALA 1KLVA 2ZPYA 4ASWC 3GYPA 4GN1A 1UNQA 2CRFA 5JHGA 2JZ3B 2LZ6A 2N1VA 3OAWA 1WX7A 2DA0A 2KDIA 4G50A 3DOWA 4CO7A 3R66C 2XQNM 2NMBA 5FR6A 3CMMB 3ZO5B 4F7HA 4P7IA 4DDGD 2RVBB 1OMWA 4GMXB 4K7SA 3VHTC 2D11A 2CS4A 2KMAA 2Y8GA 3UGBB 2PJHA 3M63B 4FBJB 4K2PA 1Y5OA 4KHBB 1P6SA 2Y5BB 2ABDA 3M95A 5J17A 3SUZA 4HATB 2DZIA 3NHEB 3KVFB 4G3XB 4MEMA 2O6VA 1FXTB 3A1QA 4E74A 2CHWA 2BYFA 2MP2A 2N9XA 2FIFA 3NY5A 4TV3A 2G45B 1E8ZA 1X11A 2J7QB 1V5PA 3KZ1A 2LG1A 1MK9B 4PNKA 2D9WA 1S3SG 4IFSA 3PS6A 3D8FA 2REXA 2YT1A 4IUMB 1WZ0A 1U5EA 2EKEC 2ZJDA 4KSLC 1QZEA 2KNBA 1L7YA 2N23A 2ZVOA 4GGQA 1V89A 3GOEA 2DFKA 5HE1A 1IRSA 1GUAB 4TYZA 1WR1A 3KY9A 4DXAB 3DVNV 2KLCA 4IG7B 5DIFB 4JLCA 2UZRA 2K8HA 2PPHA 2COFA 4IOYX 3ML8A 1B55A 4MGKE 4N9F4 1X1GA 1UD7A 2MWSB 2IBIB 5KHQA 3ULBA 3U7DA 2BGFA 4F7ZA 4IM2A 2OTXA 1FGZA 3PG7A 2C60A 3W1YA 2W2XC 4L6EA 3ODOA 2M14A 1N3HA 3DVGY 2A4ZA 2KC1A 2KDFB 3R7RA 1I35A 3ZNZB 4ZRJA 3O65B 1OQYA 5L81A 1WJ6A 1V5TA 2KFJA 2HE7A 3ALBA 3CIKA 3M1IB 2WH5A 3A8QA 2XBBC 3TO1A 3FLVA 1Z87A 5DPTA 2NBVB 2PE6B 2KGXB 2PZ1A 2G4DB 3TW1A 5C16A 2J0JA 4WJQA 3V60A 1Q5WB 3ZKJC 3QQ8B 3B08A 1V81A 2VRRB 4BBKA 3KYCD 2PEAA 2K2UA 1WM3A 3KSYA 1MG8A 2ROZB 2IZVB 3SNHA 1SE9A 2H7EA 4XX5A 3WAPA 4DBGA 1WJMA 3Q3JA 3V61A 1W1DA 2N9PC 2BPSA 1WY8A 5HE0A 3EFUA 1TXDA 2RR9A 2XEWA 3UIOB 3KW5B 2HTHB 1YX6B 2IY0B 3EHVA 3SV1A 3ZW3A 1GC7A 3AJ4A 2JXXA 3DPDA 3QA8A 2N4FA 3VUYA 4HLEA 1DDVA 1BTNA 1GG3A 1AQCA 3I3TB 4A5KA 2L76A 2MCNB 4ANXA 4W9CA 4WVFB 1Q0WB 3L54A 2C9WB 3EPYA 3SO6A 2GBJA 1NI2A 1DROA 3PHWB 1FOEA 1U5FA 4HB4B 4DX90 3A33B 3QX1A 5J3TA 2VKIA 3ZVVA 3ZNHB 1M94A 1ZC3B 2P0DA 2KX3A 1QC6A 1ZGUB 3SD5A 1UNRA 4W9FA 2FDQA 3SU8X 1WRDB 3OANA 2CU1A 2KMCA 2RGNB 3IHPC 1K5DB 3WANA 2XK5A 3B0AA 3VXWA 1V61A 1WJ1A 3ODXA 2IYDB 4PS3A 5J18A 2YT0A 4FA6A 1LM8B 2I5CA 3DCGA 2C7HA 4W9HA 1UELA 1VD2A 2BKFA 3C0RB 2KCJA 1Y8RC 5HE2A 4M8NA 2D2QA 5DH9B 2H7DA 2C7NB 2CKHB 4EFOA 3SDLC 3ZDTA 4BOSC 2RQ1A 2LWPA 1PMSA 2DN6A 1AWEA 5C5BA 4B6HA 2AL6A 1K5GB 2CHZA 2HJ8A 2KXJA 2MBHA 1U5DA 4XWXA 1V88A 1E8WA 3NOBA 2N0YA 3V62A 3KH0A 2KLGA 5EFXA 2WX0A 1WMHB 1KZ7A 2AEHA 2NVUI 1J19A 1KZGA 4HAUB 1CMXB 1XT9B 2MBOA 3PSEB 3PTFC 2KN5A 4HPLB 4MM3A 1OEYA 3DBRI 4ICVA 4XC2A 3OLMD 3V6CB 2CB8A 1EAZA 1ZW7A 4K1RB 4HVBA 1YQBA 3QWZB 3APFA 2V3SA 3UZTA 3ULCA 1P98A 1XR0B 5L95C 2L3ZA 3QCAA 3A4RA 5DPSA 1TJ6A 4MSMB 3WIMA 3APCA 4GPTB 1LB1A 4H8SA 3ML4A 4TQ0A 1P3RA 3A1QB 4LDTB 1FB8A 4MGIE 2ROVA 4LJPB 5C23A 5HKHA 3Q3FA 4WJPA 1NTVA 1NU2A 5FI0A 4FLHA 2K6QA 2DHKA 1EGXA 3UINB 4RM9A 4DK5A 4HCNB 4KVGB 2O6VB 3RD2A 3TMPB 2M1MA 3ENEA 1MPHA 2FJLA 4Y94A 2RGFA 1LW3A 2JP2A 2FJ9A 1MAIA 2OOBB 3HQCA 3IBEA 1J0GA 3ZNGC 5E6NA 3APDA 3LJ3A 2XK5B 5E6PA 2GOWA 2DYQA 2MA9B 4OVUA 3PPAA 1E8XA 4A6HA 2KOXA 4HK2A 3QC8B 4HHVA 4MGYE 1RRPB 2BKRB 1WG7A 4AUQC 3VUXA 2YS1A 4BKSD 1FHOA 4F1SA 2GS0A 2FCQA 1UH6A 2PE9A 3UIPB 4A6FA 2FNJB 3DBSA 2LI5A 3K9OB 1YIWA 5JHAA 2DX5B 1ZC4B 2DKQA 1ZM0A 4HB3B 1UPQA 3A98B 4F7GA 5KQ1A 2M17A 4WQOB 3DXEA 1WGUA 2GJYA 4KZCA 1GNUA 4W9KA 5C1ZA 2KTFA 1U29A 5D6JB 5CHVC 2GCLA 1V6EA 2COPA 2MX2A 1H10A 1IP9A 2W2WA 4ANWA 2L00B 2ZPNA 4A3OA 3A4SC 1UNPA 1WXMA 4KDIC 4XZ4A 2EMSA 1WGYA 5DHAB 1E5WA 2KHWB 1HBKA 3ODWA 2ZNVB 3UF8A 3VOQA 2JZZA 3W1SC 1WZ3A 3ZTDA 2MFQA 4K81A 2KO3A 2CAYA 1F9JA 1WM2A 1M7RA 3EC8A 4NQKE 1PQSA 2CODA 1BTKA 2IO2B 1ST7A 1XODA 1P9DU 1ACAA 2C5LC 2DAFA 2RNRB 3DBLI 2LULA 4W9GA 4WJOA 5G55A 1NTIA 2GCJA 2D9VA 1V80A 5CLQB 2JT4B 4GB9A 4AOFA 4BOZB 4ZDVA 1MK7B 2K1FA 5D2MB 2AL3A 3CSFA 1FHWA 4WWOA 2I1JA 1WF9A 2AWTA 4HCPB 2HTHA 3LDZE 1TTNA 4AP4C 1DDMA 3VTWA 5LXIB 5L83A 1MKEA 2D10A 2EMTA 2P8VA 5E6OA 5LXHA 4HDOA 3BY4B 4I6PA 1EF1A 1OQNA 2Y7BA 4TUUA 3AULA 2LYDA 3RT3B 4AJWA 1E90A 2IY1B 2L05A 2NPTA 3JSVA 1ZSQA 4EZJA 3FEHA 2Z0OA 4IW0A 1U5GA 3TFMA 5DI9B 1AARA 2K2JA 1TQZA 1UGMA 4J6IA 2D07B 3QARA 4LDTD 1V5UA 4KIKB 2MQJA 2JY6A 4WAAA 1VCBA 2YLMA 2G4SA 4NPNA 1NTYA 2O6VD 4FADA 3QIJA 4ANUA 5D3WA 2ELBA 3T06A 4EMOA 1I7AA 1S1QB 2DZKA 4I6NB 4HAVB 1EF5A 2OJRA 1OGWA 5CLLB 3TCAA 2KANA 4IM3A 1V9JA 3QBVB 2QKLA 2BYVE 2KTRA 3L17A 1BWNA 2Z59B 5HE3A 3N32A 3R3MA 2LD9A 5AZGA 5CTRC 2RSUA 3KYDD 2COAA 2BYEA 3JSVB 1XD3B 2UWQA 1R4MI 2K39A 1P0RA 2K25A 2JVCA 2MP2B 3KUZA 1LXDA 4IWPA 1J8CA 1EVHA 2K6DB 3JVZX 4K7WA 2YS5A 2LKOA 1WGGA 3DVNU 3JW0X 5KQ4A 2KDEB 2QKMA 2JPHA 2KJRA 2KQSA 4BBNF 1PFJA 1UBQA 1WI0A 2DYOA 2LBBA 2C7MB 2KZRA 2Z0EB 1FGYA 2YS3A 3L10B 3ML9A 4KZ0A 2UVMA 3T8MA 4DHJB 2DTCA 3FM8C 1PLSA 4WJNA 2BF8B 4A20A 4MK0A 2LRUA 5JP4A 2LJ5A 2RUKB 4WSFA 2DYMA 2RLOA 2K8BA 2KWUB 4ZRIA 1TGZB 4IC7B 2I1KA 2NPTB 3P7ZA 2KJHB
chains in the Genus database with same CATH superfamily
1JCKB 2SEBD 2V1YA 4FJZA 2VZKD 4IWOA 4NAMA 3RCZA 5AZHA 3RYTA 4MH8A 1DDWA 1P1AA 2WYQA 4TQ1A 1KLUD 1EM7A 1PDXA 2BQQA 5MPOA 1JRUA 2OHFA 2N9LA 2ELAA 4TMAB 1Z2MA 1MIXA 2QC8A 2IPKD 3Q8AA 2UZSA 4AQ7A 1AW7A 4ACFA 1T0SC 1NDDA 4GDKA 4GDLB 4HKQA 4DHZE 1RFKA 1X1MA 1X86A 3E9LA 2KFKB 4LNNA 4BKGA 4YTPB 1UEFA 1STEA 4HPPA 2RPVA 4HAYB 3IVFA 4NAWA 1V97A 4E3CA 3IXSA 3L08A 3ZRFA 1KC7A 3AU4A 2MJ3A 4HB0B 2MH7A 3GP7A 5CX3A 3KWLA 2XNAC 3QAQA 3RNBC 1TT5B 3AE6B 3SYXA 3WCQA 3VTWA 1IYFA 1KLVA 1TYGB 3Q6BA 5HKHA 4BAXA 2V4LA 1QQRA 2RD0A 3P4SB 3N1ZC 1GJZA 4OVZA 4L23A 2LRWA 1HB8A 4REZA 1WH3A 2KWVB 3GS2A 3HIZA 1HB6A 5IA7A 5EE9A 1TY2A 3QWMA 4DXFA 3VTVA 4B9KA 1R4NI 3RNEC 1XLOA 1YN5A 2EC1A 3PT2B 3ZYYX 3NWAA 4N6EB 5LNK1 1M7EA 4GU2A 3FVCA 2X0SA 3G9WA 2AQ2B 2WDVB 3IAM1 4DQOC 1RAXA 1C1YB 2KC2A 2P0FA 4PS7A 3SHQA 2D9YA 1C4AA 3WA0A 3U4EG 2ASQA 2D9XA 5D27A 1NI3A 2G35A 5FI1A 4A3PA 4HEA1 2CR5A 4QAYA 2N7DA 2LVPA 1ZE3D 2GBMA 4A6KA 3RULA 1FMAD 3TSSA 1ZP0B 3TL5A 1NVID 1JALA 4D0NB 1OEYJ 1BAKA 1C3TA 4GDLA 4K17A 1QOFA 4R3DA 2JYEA 2DX5A 3ABVB 1DYQA 2MBQA 3DHHC 3T3NA 4IM0A 1Z5SB 3PREA 1JWBD 3V5WA 3X23A 3LJUX 2DYNA 2LUEA 3EFCA 3Q8FA 4YSZB 2GBRA 2NCNA 4JK7A 5IRSA 1EU3A 3HK0A 1UUPA 1ENFA 1FHXA 4II2B 4YL8A 4H2AA 2KVZA 5JHBA 4HAXB 4ITKA 3NVZA 4F8CB 3ZUNA 2KJ6A 2E3TA 3DVGX 2BCJA 1ET9A 2KYWA 2LHEA 4CQNA 1WGRA 1WX9A 4JPSA 1SIFA 4K3BA 1ZYIA 2AQ1B 3H7PA 2CY4A 1WJNA 3VDZA 1KM7A 2K8EA 1V5MA 2IFSA 1L0XB 2L7RA 2YSZA 4HAZB 3P4QB 3A58A 2V76A 4XGAB 4W9IA 3H7SA 3PGEA 2J53A 2AYOB 1LFDA 1K8RB 1RLFA 1WX8A 1I4XA 4KSKC 2JUOA 2RDHA 2FIDA 3ONSA 1Q1OA 5LLIA 1YD8U 1F0ZA 4B6WA 1WJUA 1MIZB 4GMVA 2G1EA 1R7SA 4AOFA 3U8ZA 4GOUA 4A6QA 2YRYA 1N6ZA 1YN3A 3PRMB 4W9DA 2M4NA 4BKTA 2VH2A 1FCCC 2PLPA 3PVUA 1EO6A 1JWUD 5D7GA 1GC6A 1RFAA 3SFDB 1XEEA 3WALA 2K22A 2ZPYA 3GYPA 5JHGA 2GI9A 1D3ZA 3OAWA 3E9PA 2DA0A 2KDIA 3R66C 3ZO5B 4P7IA 1TIFA 2RVBB 3VHTC 2Y8GA 2PJHA 2ABDA 3M95A 2O6VA 3A1QA 1MFWA 2N9XA 2KMMA 1TKGA 1VR9A 3PS6A 2WP9B 3ZQ4A 2D9WA 1WZ0A 4KSLC 2D3CA 2KIEA 1L7YA 1IGDA 3GOEA 2DFKA 1IRSA 1MHXA 1WR1A 4DXAB 3J9CA 4PT5A 5DIFB 2UZRA 2K8HA 3ZNHB 1B55A 1K52A 1UD7A 3TUOA 2IBIB 5KHQA 4KKJA 1RM6C 3ULBA 1R4NB 1SE4A 2NTTA 3PG7A 1PYWD 1K51A 1SJED 5EE3A 1N3HA 3ZNZB 3TO1A 1Z87A 5AZFA 2NBVB 2PZ1A 3HRDD 1YMHE 3ZKJC 3B08A 1VLBA 4QJ5B 2PEAA 2JX5A 2IZVB 2JSVX 1MVKA 1YQ3B 3R8BA 1WY8A 3SEBA 3EFUA 2RR9A 3UIOB 2XEWA 3C8YA 1YX6B 3ZW3A 3SV1A 3DPDA 2N4FA 4HLEA 2JYTA 1BTNA 1AQCA 2MCNB 4W9CA 1FNUA 3AE8B 5IN7A 4HB4B 1LGRA 4UDUC 5J3TA 2NMQA 1C78A 1SF0A 3RI7C 1ZGUB 1NYRA 1TS5A 2FDQA 4ZHOA 2KMCA 3IHPC 1N5WA 2XK5A 1C79A 2IYDB 5J18A 3AE9B 2I5CA 4W9HA 4OHJA 2L1AA 1KBLA 2H7DA 2WXQA 1Q10A 2KXJA 2CHZA 3ZXVA 2MBHA 3V62A 3NOBA 2N0YA 3KH0A 1WMHB 3AECB 1XT9B 3PSEB 4RGOS 1OQQA 3V6CB 1EAZA 3ULCA 2BS3B 2L3ZA 5DPSA 3GE3C 3W5VB 3WIMA 2BB6A 3APCA 2W82A 4LDTB 1FB8A 4MGIE 1JW9D 5J2RA 2K6QA 1T5XD 3KLSX 4RM9A 3RNFC 2WXMA 2BVCA 2GOWA 3MP9A 4OVUA 1E8XA 1KH0A 4HHVA 4F1SA 3VUXA 2GS0A 2PE9A 4C56C 4A6FA 3DBSA 3K9OB 1JQ4A 1YIWA 3A98B 1GB1A 2KTFA 3NG0A 2COPA 2LHDA 1IP9A 4JX1C 4A3OA 3A4SC 4KDIC 2ZNVB 3UF8A 3ODWA 1WZ3A 1WM2A 1M7RA 4NQKE 3E66A 1PQSA 1SJHD 1JROA 1XODA 1D5ZC 3FILB 2FUG1 2C5LC 4WJOA 2LULA 4W9GA 5G55A 3VR8B 1NTIA 2D3BA 3P4RB 4GB9A 3AB5A 2BB5A 2AL3A 3CSFA 1FHWA 2AWTA 2HTHA 1TTNA 4XDCA 2D10A 5E6OA 5LXHA 2EELA 2RMMA 4I6PA 1OQNA 1E90A 2FBWB 1ZSQA 1AARA 2K2JA 2OJWA 4LDTD 4WAAA 4NPNA 3QIJA 3BVGA 5D3WA 2ELBA 3T06A 4HAVB 4NJCA 5CLLB 3TCAA 2KUQA 1V9JA 5BO4B 3L17A 1BWNA 5HE3A 3FC4A 3R3MA 2LD9A 5AZGA 1MHHE 2W3RA 3KYDD 2COAA 3JSVB 1XD3B 2K39A 1LXDA 1J8CA 1EVHA 3JVZX 2YS5A 3JW0X 3I9V1 1PFJA 2DYOA 1FGYA 2YS3A 3T8MA 2V0GA 2DTCA 5EE0A 4WJNA 4A20A 4MK0A 2ICIA 3V3XA 4WH4A 1QOBA 2K8BA 4ZRIA 4JKEA 3BZDB 2NPTB 3P7ZA 2Y5PA 1VZ8A 2HDEA 3OWEB 4MY6A 2DZJA 3ZIMA 4CHMA 3TVVA 1UZXB 5TR5A 4GLSC 3ENBA 5T8IA 1UWXA 2KK8A 3L0WB 1D5MC 4JKGA 3GYOA 1WGKA 4CYEA 3PLUA 3OJ3A 4P16A 2INPE 4JKBA 3QJZA 1V2YA 1MJDA 3B77A 1C76A 4MJSA 4PQ0A 2YF0A 2WXGA 1JMLA 3GZNB 4GSWA 1HTQA 4KGRA 2HTME 1UF0A 1QQGA 3MJWA 4IAPA 3P1MA 1WGQA 2MBBB 5IOIA 2J0MA 2KQ4X 5J3YA 3PV1A 3SFEB 1Y19B 3UQAA 2ZEQA 1G6JA 1E10A 3RCPA 1VJKA 4CHJA 2KDMA 3LYYA 1N62A 3NZUA 2DENB 1SB3C 2LVOA 4KDLB 4RGMA 3D8EA 2LOZA 2W3SA 4B0EA 5FKAC 3DHGC 4ILHA 4BBNC 4FULA 2LOXA 1Y56A 2KWCA 2CU3A 5HI1A 3N30A 3UQBA 2M38A 1PGAA 3R2IA 1FRDA 3VRBB 1WJ4A 1XLPA 4L1BA 3N3KB 3NS8A 2KWDA 4JIOU 2WXHA 1N63A 4RM8A 5HHDG 1YJ1A 5C79A 4KHOA 2FUHB 2IGDA 3H8HA 3NWDA 3L16A 2NZ8B 5GOWB 3U52E 2K9XA 2VZKB 1IPGA 3B2GA 2O2VB 1V5OA 3VUWA 3FAHA 4MT7A 4XE0A 5DPRA 1WGHA 2NBWB 4LLGM 2DKPA 4FN2A 1BUIC 2COCA 4W9JA 1F52A 3TEZA 4JGHB 3V6EB 1TZOA 2L0FA 5JLJB 4ILGB 2KTRB 1DOXA 3DXDA 4CSQA 2WXKA 2WXPA 5H92C 2BWFA 1WXVA 3ZDMC 2KVRA 3AI5A 2UYZB 4BZAA 2VH1A 4FJVB 1ZKHA 1EUVB 4OVVA 4MM3B 3RUIB 1T3QA 2VSZA 2LVQA 3NZSA 1ACCA 2MWNB 4EJNA 5D3XA 3NVYA 1E7UA 1ZXIA 2LUMA 4D6WA 3MC9A 4F7UP 3HUIA 4DHZB 1FM0D 1J7AA 4RF1A 2N0SB 4WJ7A 5E6JA 1MG4A 3PZ7A 1X1FA 1EWYC 3D8DA 4M8MA 3NSUA 2QJLA 4JKDA 2Y8FA 5C6RA 2IGHA 3FP5A 1C4CA 3RPFC 4KHAA 5D3YA 1WI1A 1KI1B 2DHJA 3HW2B 4ICUA 2CJNA 2INNE 2D3AA 2JWUA 2N1WA 4GDKB 5BMIA 2I5FA 3H9DA 4S0RA 3Q8EA 5D3DA 4C4VA 2P0HA 3PZDA 2IYBA 2LXAA 1KOTA 1F77A 1OTRB 2D4QA 2KKCA 1D4BA 3RZWC 3IFWB 4PS8A 1KLGD 5JZEB 3U12A 1XQQA 1MI1A 1NVLA 4KV2A 4X57B 1SGHA 2L32A 2B3AA 4AWJA 4HKZE 1NBFC 2MKRA 2KDBA 1TKEA 4LTUA 2EJ8A 5BYSA 2R2OA 2A5UA 3E9SA 5DHFB 3WYFB 2DYBA 1U27A 4NJ6A 2KD0A 3EECA 3TIXA 4JKGB 2M0AA 4YXDB 2FAZA 3V05A 4GN1A 3AEAB 1UNQA 2CRFA 1ZDVA 2N1VA 4M8NA 5AUKA 3DOWA 4DDGD 4ARCA 1ROEA 5M4YB 2R61A 4K7SA 2CS4A 1TS2A 3M63B 1DGJA 1P6SA 2Y5BB 2MJDA 4MEMA 4HATB 3NHEB 2J52A 4B0MA 2BYFA 4RFBA 1QOGA 2FIFA 3SBGA 1ZUD2 1AYFA 1S3SG 1XF5L 2WDQB 3D8FA 2K5PA 2YT1A 2REXA 3R7RA 2ZJDA 2D5GA 3TEXA 1QZEA 2KNBA 1XCQL 2KACA 2PMVA 3DVNV 2COFA 4IOYX 1X1GA 1YN4A 2MWSB 3BK1A 2JZPA 2C60A 2ON8A 2W2XC 1I35A 3DVGY 1JWSD 2A4ZA 2KC1A 5L81A 3ALBA 3CIKA 2XBBC 3FLVA 2KGXB 5C16A 4WJQA 1V81A 2VRRB 4BBKA 3KYCD 4JK8A 2K2UA 2KR0A 1SE9A 3FILA 3WAPA 4DBGA 4YSYB 1WJMA 1WWTA 2L52A 2N9PC 2BPSA 3AEDB 5HE0A 4XWWA 1TXDA 1M4VA 1HA5A 3KW5B 2IY0B 1GC7A 3BVMA 5D3IB 4A5KA 2DLBA 4IOIE 3L54A 3EPYA 2GBJA 1NI2A 4DX90 4WAFA 3SBTA 4JE3B 3DCXA 4N59A 2VKIA 1M94A 2WU2B 2WXRA 3SD5A 1UNRA 4O1NA 5FR3A 2W55A 1WJ1A 2Z14A 2BKFA 3AE2B 5HE2A 1HTOA 4M01A 3KWVA 1LO5D 3SDLC 4J3OD 2AL6A 1U5DA 1V88A 1HEZE 3MC8A 1P7EA 1TKYA 1KZ7A 3C19A 2AEHA 3PTFC 3P63A 2KN5A 5FK9C 3W1YA 1OEYA 2J4XA 2CB8A 2WDRB 3AE4B 3GB1A 2GB1A 1LB1A 3ML4A 1UNSA 4TQ0A 5C23A 2IDYA 3Q3FA 2RRFA 4FLHA 1B9RA 2BT6A 4HCNB 2M1MA 3KQ4A 2FJLA 3RNCC 2FJ9A 3IBEA 3ZNGC 5E6NA 3LJ3A 4ZYSA 2XK5B 1UGJA 2MA9B 3PPAA 3EA6A 4HK2A 3QC8B 1PFDA 1CJEA 4BKSD 2YS1A 1XO3A 1FHOA 3DBRB 5JHAA 2DX5B 1ZC4B 4XWTA 2M17A 4WQOB 4YSXB 2GJYA 4KZCA 1GNUA 3IT4B 1H10A 4ANWA 1UNPA 4XZ4A 3HVDA 4AP4C 5I4DA 2KN4A 1SXTA 1L6VA 4YT0B 2CODA 1ST7A 1ACAA 3BIID 4JKHA 2ZW0A 1MK7B 2K1FA 1WRIA 4WWOA 3LDZE 1DDMA 1MKEA 2EMTA 3CWIA 5I2MA 3AULA 2LYDA 3NW8A 2N7JA 2NPTA 1EU4A 2L05A 3JSVA 2BS2B 2IGGA 4AJWA 4EZJA 4YTMB 1U5GA 3TFMA 5LG4B 3EGRA 2D07B 2WGSA 4JKFA 1F2RC 2Z59A 1OQRA 1VCBA 4M0WA 3CIRB 4FADA 4ANUA 1FXIA 1E0ZA 1S1QB 3AH7A 2OJRA 3RN9C 4PK1A 3QBVB 2KTRA 1I42A 1NYQA 2R82A 1L0YB 2BYEA 2UWQA 1R4MI 3MHZA 4IWPA 2MP2B 3NZ3A 2LKOA 4BBNF 2KDEB 3RFZB 3VUYA 2KZRA 2SAKA 3GE8C 3L10B 3UI3A 1FFVA 1FO4A 1SE2A 1B1ZA 2BF8B 3P4PB 2LRUA 1TS3A 2RUKB 2YEPF 2PIAA 1L5PA 3N7CA 3VH3B 5KCVA 1YX5B 1SE3A 3IT6B 3AU5A 2BW2A 4LK0M 4NZLB 2LGYA 4FBJB 2WXJA 3TBLD 5DCNA 1I7HA 5GMVA 2MHJA 2N9EB 3P6AA 4Z2NA 2HRJA 1QT9A 1UPRA 4K2OA 1RYJA 4URKA 3D32A 1HZ6A 2M8SA 1WYWB 1FAOA 3AXCA 1H4RA 3PVWA 3P42A 4II3B 2JF5A 4ILJA 1ZVRA 5C3JB 3PSCA 1AN8A 2Z13A 2JU6X 2NS5A 1YQ4B 2WNMA 4YONA 1I2HA 5IAAC 3U30A 1TZ1A 5IO9A 3IG3A 1RWSA 4JKAA 2IO0B 1WSPA 3T9LA 4EEWA 4ZRKA 3I57A 3R2TA 4FHJA 4OW0A 4DDID 1U4AA 5C2TB 4C4VB 2YVCA 2GBKA 2KUPA 2PVGC 4MSQB 2PW9A 1I4PA 3CSTA 1WMHA 4KIKA 2LFIA 4MACA 1WXAA 1WFYA 4F7ZA 1XX0A 3PZ8A 2N7EA 2R2YA 3VIAA 2VRWB 3PLVA 1DYNA 3Q69A 5C5BB 4NQLB 1V8CA 1FXAA 3HM3A 3PHXB 4EZKA 4OZBA 1ESFA 1V49A 1E8YA 3KUCB 5KHOA 2JRHA 2CQUA 2J0KA 3A9JA 4HDQA 1Q67A 2X38A 1QOAA 3ETRA 3VH4B 2DHZA 4DX8A 4I6LB 3URYA 3VRAB 2FCNA 2RSGA 2W2XD 1KTKA 4JQWC 3H1UA 4D2KA 3M62B 4KKIA 3PO0A 4GZUA 4XYCA 3P2BA 3PRPB 3CF6E 3ECIA 4GIVA 5CHWA 5DPWA 2DIKA 3KRXA 4HJGE 1ZXHA 2DLWA 4EOYA 1VRAB 3A9KA 5AEKB 2LGXA 1C4PA 2WWZA 2HD5B 2ZW1A 2IO3B 2E6XA 4B95A 2NBUA 4TSSA 4BKSA 5EDSA 4GOCA 4BVUC 3A8PA 4OT1A 1X05A 4K7UA 1GAQB 2FE8A 3MTNB 2QCZA 3HM6X 2DWQA 1CQVA 3ZNID 4ANVA 4US8A 2BTEA 2Z4DA 2BWES 1SSNA 4M02A 3KUDB 2L1CA 3E56A 4AJYB 4QJ3B 4EKUA 1P3QU 4LJOB 1NENB 2DZMA 1J7CA 3WAOA 2W54A 2ZNVC 3HHMA 5HG2A 2OQBA 1FCLA 4C7YA 1XD4A 3BINA 2L0TA 1WYGA 2GBNA 1SHCA 2WXLA 4DHJD 1YJJA 4AS1A 2V3NA 1XKEA 3NVWA 1WE6A 4HWIB 2FCSA 2CY5A 2X18A 5EE1A 4FHKA 2ADZA 4E74A 4NNJB 3MDBC 3VQIA 1WXQA 4A9AA 2IJ0A 2KAJA 4TKNA 4WURA 3DXCA 3Q3NC 1U2BA 5I2SA 3H7PB 4KGSA 3ZRCA 5BYQA 5D94A 4EE2A 1L4DB 2NTSA 2DHIA 4E71A 3RMKC 5JH5C 4L1RA 2ZCBA 4MELA 3A9KB 4JWUC 5JHHA 2IO1B 3LB8C 3N9YC 2ACZB 3L4PA 3QHTA 3R7QA 1BT0A 2R2QA 3I5JC 2LGIA 2PTLA 4W9LA 2ZZPB 5AUIA 4USAA 2QIEB 3NRZA 2WLBA 4ASWC 3TEWA 4G50A 1WX7A 4CO7A 1PUTA 2NMBA 5FR6A 4OZCA 4P1BC 1OMWA 4GMXB 2D11A 3UGBB 4K2PA 1Y5OA 1ET6A 4GNKB 1T0QC 5J17A 3SUZA 4G3XB 3KVFB 3B2FA 3B9JA 1FXTB 2CHWA 3BYYB 3EUB2 1SIJA 4JKCA 1X11A 2J7QB 4PNKA 2NBVA 4IFSA 1FIQA 2QMTA 1CK1A 2M56B 2EKEC 2N23A 2ZVOA 1V89A 3HIEA 1I4QA 5HE1A 4TYZA 3KY9A 1FNVA 4JLCA 2PPHA 4MGKE 3ML8A 3ZGZA 2YEPB 2BGFA 1CZPA 2RDBC 4JK9A 2HJ1A 1N60A 3T3OA 3ODOA 2M14A 2KDFB 4ZRJA 1OQYA 1V5TA 2KFJA 2HE7A 3BWUD 2WH5A 2PE6B 2G4DB 3V60A 2J0JA 3QQ8B 1WM3A 1MG8A 2ROZB 3OHMB 4XX5A 1FRRA 3W9CB 3RNGC 2HTHB 2Z8LA 3EHVA 3AJ4A 2JXXA 3ZJTA 1DDVA 4A55A 1GG3A 3I3TB 4ANXA 1DOIA 2BYTA 3Q8CA 2LEKA 1DROA 3PHWB 2KX3A 4W9FA 3SU8X 2CU1A 2RGNB 3VR9B 1LM8B 1VD2A 3C0RB 2KCJA 3Q3OC 2D2QA 2V9HA 2C7NB 2CKHB 1PMSA 2HJ8A 2MRPA 2QHOA 4B6HA 4HXDA 4QJ4B 1BXTA 4S17A 2KLGA 4KX6B 1L6UA 2WX0A 1V1PA 1KZGA 1CMXB 2MBOA 5G5HA 4ICVA 3DBRI 4XC2A 4HVBA 3NUHB 2JXTA 1ZW7A 4K1RB 4YTNB 3QWZB 3AEGB 1XR0B 3QCAA 3I63C 2BBCA 4LNOA 1V1PB 1TJ6A 4MSMB 4H8SA 4LJPB 1NTVA 1NU2A 1EGXA 3UINB 4DK5A 2O6VB 2Y5CA 3RD2A 3TMPB 1MPHA 4M00A 4Y94A 2LMCA 2EKIA 2JP2A 1MAIA 1N61A 3HQCA 2V4IB 5G5GA 2DYQA 4A6HA 4AUQC 1WG7A 4IDIA 3NJTA 3MC0B 1N5XA 4C7ZA 1KF6B 1SBBB 2DKQA 4HB3B 1C77A 5KQ1A 1I4RA 3DXEA 4W9KA 5C1ZA 1DOYA 1U29A 2K49A 5CHVC 1V6EA 3AEFB 2W2WA 2L00B 2ZPNA 5H8YE 2EMSA 1T77A 5DHAB 1E5WA 1HBKA 2KO3A 2MFQA 4K81A 2CAYA 4DIXA 2H89B 1BTKA 2IO2B 2DAFA 4OZAA 4ZDVA 2AQ3B 2MJEA 1XLNA 5IP4D 2FJUB 2M19A 1EWCA 1P7FA 5L83A 4HDOA 4TUUA 1GOZA 3AE3B 3RNAC 3RT3B 2IY1B 4IW0A 1TQZA 4J6IA 3ZXRA 1V5UA 4KIKB 2MQJA 2JY6A 1T6BX 4K3CA 1NTYA 1PGBA 2O6VD 1L0VB 2G9HD 4EMOA 4QXAB 2QKLA 2BYVE 2PVOD 3N32A 5CTRC 2RSUA 1IBXB 1P0RA 4A8XC 3KUZA 1FPYA 2WU5B 2K6DB 2I2YA 1WGGA 2KT7A 3DVNU 2KQSA 3DBLB 2LBBA 2C7MB 3HVZA 4ZHPA 4KZ0A 3FM8C 2I38A 2DYMA 4WSFA 2RLOA 4IC7B 2Q5WD 1TGZB 2B76B 1IUEA 3KRWA 4IWQA 1XLQA 5TSSA 1RJ2A 2CHXA 3DBHI 4C0AA 4LCDE 4M0WB 2E2XA 2D3GA 1R4MB 1V86A 3JYUA 4NAWB 1ZPSA 2LGDA 3N20C 2LASA 2M0XA 4WWNA 3PRZA 3F5RA 1XCTL 1WXSA 3M3JA 1XCGA 3VVWB 1TY0A 1KRHA 1KJTA 1HE8A 3ZJUA 4JL9A 4EUTA 3W2DA 1BMLC 3MHSD 2KQ7A 1QILA 4RMAA 1ISNA 2JWZA 3BK2A 5JXVA 3DQVA 4WIPA 3AE5B 5G2NA 4DWFA 3DWMA 4LNIA 2JQRB 3CXBB 2L8JA 4A6FB 3ZTCA 2XN9C 2WDTB 3AMZA 4LNFA 4LNKA 3F0WA 2ZKMX 1IBXA 2Z0QA 2ONQA 4CHKA 1WIAA 3ZVRA 1J0WA 4G11A 4PYZA 3WAMA 4GXBA 4JWSC 3FSSA 1E7VA 3K9PB 4PYUA 4RNAA 2LXCA 1WVHA 3U7ZA 1H8CA 2MSED 3N1XC 2NR2A 3L13A 3RZFA 3W1SA 3Q8BA 2D9ZA 2KFKA 2Q13A 4G0NB 3MJ5A 4NJ7A 2Z0DB 5IJMA 1TBEA 4Z2MB 3FKYA 5LOPB 3U2SC 5HFYA 3PVLA 3VTUA 3LXFA 2GMIC 2DAJA 3PEGA 4DBBA 3QK0A 4FJYA 3TJPA 1NEKB 4MDKE 4HPMB 4MJSB 1T0RC 4HJKA 2MLBA 2MW5A 3VFKA 1WR6E 4MT5A 1E9MA 1JDEA 1L2NA 3DDCB 2DX1A 4RGTA 2ZCCA 1A70A 2J42A 4NSWA 4HB2B 3B1LX 4N58A 3H6NA 2INDC 2DBYA 1T0YA 2MBEA 1DBHA 4WWMA 3A9JB 1WE7A 2RPQA 3MPXA 5J3QA 4ZRPA 2R09A 4EZLA 4WWPA 2WX1A 4FXCA 4MH0E 3AM9A 1HQRD 1JWAD 4OSNA 1UWMA 2KX0A 2N9KA 3E9OA 4ZYNA 2ZVNA 3OJ4B 1E7PB 5LONB 4RCOA 4MGZE 4NY0A 3BJIA 3Q3MC 2Z0PA 1WGDA 2V3PA 4RGNA 1GB4A 2K8CA 1VDVA 4KAXB 1F2RI 4ZRQA 1RRBA 2INCC 1VZ6A 3ZLZA 3DHIC 3X0WA 1P5TA 4W9EA 1HZ5A 2WXFA 1PGXA 4BFRA 1QKZA 5BMGA 2L2IA 1AWDA 5D3VA 5IKCM 1OFFA 2W9NA 1W1HA 3O96A 4HAWB 2BS4B 2DNFA 2KIGA 2FCMA 1LQBA 1QF6A 2O2VA 1OY2A 5CHFA 1W1GA 2J59M 3Q14C 2R0DA 2K00A 3PP2A 3GZNI 1UBIA 2JRIB 4US9A 2WXNA 1A5RA 2G3QB 2MDXA 2TSSA 3DWGC 4RF0A 2JZ3B 2LZ6A 2XQNM 3CMMB 4F7HA 2LJIA 2KMAA 1K53A 4KHBB 1ZDXA 2DZIA 3AEBB 2MP2A 4Q2JA 3NY5A 1DIKA 4P1CC 4TV3A 2G45B 1E8ZA 1V5PA 3KZ1A 2LG1A 1MK9B 5D2MB 1GGOA 4IUMB 2WXIA 1U5EA 1SEBD 4GGQA 1GUAB 4P6VF 4HRSA 2KLCA 4IG7B 1FNWA 4N9F4 3U7DA 4IM2A 2OTXA 1FGZA 4L6EA 1E6EB 1D5XC 3BVZA 3O65B 1MPEA 1WJ6A 1I4GA 2OEDA 3M1IB 3A8QA 5DPTA 3UIPB 4EFOA 3TW1A 1Q5WB 1HXYD 4ZOHC 4HROA 1JRPA 3Q2AC 3KSYA 3SNHA 2H7EA 1I4HA 3Q3JA 3V61A 1W1DA 2Y3AA 2WQYB 2RDGA 2WHIA 3MFGA 3QA8A 3NWFA 2L76A 1JWMD 3AV8A 1QLBB 4WVFB 1Q0WB 2C9WB 3SO6A 1VBGA 1FOEA 1U5FA 3A33B 3QX1A 3ZVVA 3BYTB 1ZC3B 2P0DA 1QC6A 1F1HA 3NVVA 1WRDB 3OANA 1K5DB 3WANA 3B0AA 4A90A 3VXWA 1V61A 3ODXA 3AN1A 1GPXA 4PS3A 4L2YA 2YT0A 3DCGA 1D6EC 2C7HA 1UELA 2K3UA 1Y8RC 5DH9B 2MEKA 3ZDTA 3AE7B 4BOSC 2RQ1A 2LWPA 3AE1B 2DN6A 1AWEA 5C5BA 1K5GB 4XWXA 1E8WA 2AX5A 1TJEA 1YJIA 5EFXA 1YNTE 1V1OA 5BYRA 5JVLA 2NVUI 1J19A 4HAUB 3O13A 4HPLB 4MM3A 2GLSA 3OLMD 1YQBA 3APFA 2V3SA 3UZTA 1P98A 3IAS1 5L95C 1IGCA 3A4RA 4GPTB 3N1YC 4WQMA 1P3RA 2YT2A 3A1QB 2ROVA 4WJPA 3VAWA 4FA6A 5FI0A 2DHKA 4KVGB 3ENEA 2RGFA 1LW3A 2OOBB 4KGTA 1J0GA 3APDA 5E6PA 1FD6A 2KOXA 4MGYE 1RRPB 2BKRB 1TS4A 2FCQA 1UH6A 2K0PA 2FNJB 1FFUA 2LI5A 1C9FA 2QDFA 1ZM0A 1UPQA 4F7GA 4DXGA 4RH6A 1WGUA 1L4ZB 2GRIA 5D6JB 2GCLA 2MX2A 3TEYA 4HSIA 3AEEB 1WXMA 1WGYA 2KHWB 1VZ7A 3VOQA 2JZZA 3OG5A 3W1SC 2PKOA 1J7BA 2GUMA 3EC8A 1F9JA 3ZTDA 2WS3B 3W5UB 1P9DU 3DBLI 2RNRB 1K50A 2GCJA 2D9VA 1MI0A 5CLQB 1V80A 2JT4B 4BOZB 2I1JA 1WF9A 4HCPB 5LXIB 2P8VA 1FEHA 4C80A 3SR6A 3BY4B 4ARIA 1EF1A 2Y7BA 3FEHA 2Z0OA 1KFYB 5DI9B 1XXGA 2H88B 2QEJC 1UGMA 3QARA 4C00A 4XDDA 2UU7A 2YLMA 2G4SA 2LGSA 2L83A 1I7AA 1ZOYB 2DZKA 4I6NB 3NS1A 1EF5A 1OGWA 2QILA 2KANA 4IM3A 3S2AA 2Z59B 3DBHB 2WXOA 2K25A 2JVCA 2X8XX 4YWGG 4K7WA 1YOVB 5KQ4A 2KJRA 2QKMA 2CJOA 2JPHA 1UBQA 1WI0A 2Z0EB 4DHJB 3ML9A 2UVMA 1PLSA 4IKGA 2LJ5A 2QSDA 4KHBA 5GXGB 3ZJVA 2KWUB 1VBHA 5BMHA 3HSAA 2I1KA 5JP4A 2KJHB
chains in the Genus database with same CATH topology
2V1YA 4FJZA 4IWOA 3RCZA 5AZHA 3RYTA 1DDWA 1P1AA 2WYQA 4TQ1A 1JRUA 2ELAA 1Z2MA 1MIXA 2UZSA 1NDDA 4GDKA 4GDLB 4DHZE 1X1MA 1X86A 3E9LA 2KFKB 4BKGA 1UEFA 4HAYB 3IVFA 4NAWA 4E3CA 3L08A 3ZRFA 1KC7A 3AU4A 4HB0B 5CX3A 3QAQA 3SYXA 1IYFA 3VTWA 1KLVA 5HKHA 2V4LA 2RD0A 1GJZA 2LRWA 1HB8A 1WH3A 2KWVB 3HIZA 1HB6A 5IA7A 3QWMA 3VTVA 4B9KA 1R4NI 2EC1A 3PT2B 1M7EA 4GU2A 2X0SA 3G9WA 1RAXA 1C1YB 2KC2A 2P0FA 4PS7A 3SHQA 2D9YA 3WA0A 2ASQA 2D9XA 5D27A 2G35A 5FI1A 4A3PA 2CR5A 2N7DA 2LVPA 2GBMA 4A6KA 3RULA 3TL5A 4D0NB 1OEYJ 1BAKA 1C3TA 4GDLA 4K17A 2DX5A 2MBQA 4IM0A 1Z5SB 3PREA 3V5WA 3X23A 3LJUX 2DYNA 2LUEA 2GBRA 2NCNA 4JK7A 3HK0A 1FHXA 4II2B 4YL8A 5JHBA 4HAXB 4F8CB 3ZUNA 2KJ6A 3DVGX 2BCJA 1WGRA 1WX9A 1SIFA 3H7PA 2CY4A 1WJNA 3VDZA 1KM7A 1V5MA 2IFSA 2L7RA 2YSZA 4HAZB 2V76A 4W9IA 3H7SA 3PGEA 2AYOB 1LFDA 1K8RB 1RLFA 1WX8A 4KSKC 2JUOA 2FIDA 3ONSA 1Q1OA 5LLIA 1YD8U 4B6WA 1WJUA 1MIZB 4GMVA 4AOFA 3U8ZA 2YRYA 3PRMB 4W9DA 2M4NA 4BKTA 3PVUA 1EO6A 5D7GA 1GC6A 1RFAA 3WALA 2ZPYA 3GYPA 1D3ZA 5JHGA 3OAWA 3E9PA 2DA0A 2KDIA 3R66C 3ZO5B 4P7IA 2RVBB 3VHTC 2Y8GA 2PJHA 2ABDA 3M95A 2O6VA 3A1QA 2N9XA 3PS6A 2D9WA 1WZ0A 4KSLC 1L7YA 3GOEA 2DFKA 1IRSA 1WR1A 4DXAB 5DIFB 2UZRA 2K8HA 3ZNHB 1B55A 1UD7A 2IBIB 5KHQA 3ULBA 3PG7A 1N3HA 3ZNZB 3TO1A 1Z87A 5AZFA 2NBVB 2PZ1A 3ZKJC 3B08A 2PEAA 2IZVB 1WY8A 3EFUA 2RR9A 3UIOB 2XEWA 1YX6B 3ZW3A 3SV1A 3DPDA 2N4FA 4HLEA 1BTNA 1AQCA 2MCNB 4W9CA 4HB4B 5J3TA 1ZGUB 2FDQA 2KMCA 3IHPC 2XK5A 2IYDB 5J18A 2I5CA 4W9HA 1KBLA 2H7DA 2KXJA 2CHZA 2MBHA 3V62A 3NOBA 2N0YA 3KH0A 1WMHB 1XT9B 3PSEB 3V6CB 1EAZA 3ULCA 2L3ZA 5DPSA 3WIMA 3APCA 4LDTB 1FB8A 5J2RA 4MGIE 2K6QA 4RM9A 2GOWA 4OVUA 1E8XA 4HHVA 4F1SA 3VUXA 2GS0A 2PE9A 4A6FA 3DBSA 3K9OB 1YIWA 3A98B 2KTFA 2COPA 1IP9A 4A3OA 3A4SC 4KDIC 2ZNVB 3UF8A 3ODWA 1WZ3A 1WM2A 1M7RA 4NQKE 3E66A 1PQSA 1XODA 4WJOA 2C5LC 2LULA 4W9GA 5G55A 1NTIA 4GB9A 2AL3A 3CSFA 1FHWA 2AWTA 2HTHA 1TTNA 2D10A 5E6OA 5LXHA 4I6PA 1OQNA 1E90A 1ZSQA 1AARA 2K2JA 4LDTD 4WAAA 4NPNA 3QIJA 5D3WA 2ELBA 3T06A 4HAVB 5CLLB 3TCAA 1V9JA 5BO4B 3L17A 1BWNA 5HE3A 3R3MA 2LD9A 5AZGA 3KYDD 2COAA 3JSVB 1XD3B 2K39A 1LXDA 1J8CA 1EVHA 3JVZX 2YS5A 3JW0X 1PFJA 2DYOA 1FGYA 2YS3A 3T8MA 2DTCA 4WJNA 4A20A 4MK0A 2K8BA 4ZRIA 4JKEA 2NPTB 3P7ZA 4MY6A 2DZJA 3ZIMA 4CHMA 3TVVA 1UZXB 5TR5A 3ENBA 2KK8A 3L0WB 4JKGA 3GYOA 4CYEA 3PLUA 3OJ3A 4JKBA 3QJZA 1V2YA 4MJSA 4PQ0A 2YF0A 4GSWA 1QQGA 3MJWA 4IAPA 1WGQA 2MBBB 2J0MA 5J3YA 3PV1A 1Y19B 3UQAA 2ZEQA 1G6JA 3RCPA 4CHJA 3NZUA 2DENB 2LVOA 4KDLB 3D8EA 2LOZA 4ILHA 4BBNC 4FULA 2LOXA 2KWCA 3N30A 3UQBA 2M38A 1WJ4A 3N3KB 3NS8A 4JIOU 4RM8A 1YJ1A 5C79A 4KHOA 2FUHB 3L16A 2NZ8B 5GOWB 1IPGA 2O2VB 1V5OA 3VUWA 4MT7A 5DPRA 1WGHA 2NBWB 2DKPA 4FN2A 2COCA 4W9JA 4JGHB 3V6EB 2L0FA 5JLJB 4ILGB 2KTRB 3DXDA 2BWFA 1WXVA 3ZDMC 2KVRA 3AI5A 2UYZB 4FJVB 1ZKHA 1EUVB 4OVVA 3RUIB 2VSZA 2LVQA 3NZSA 2MWNB 4EJNA 5D3XA 1E7UA 4F7UP 4DHZB 4WJ7A 1X1FA 3D8DA 4M8MA 3NSUA 4JKDA 2Y8FA 5C6RA 3FP5A 4KHAA 5D3YA 1WI1A 1KI1B 2DHJA 3HW2B 4ICUA 2N1WA 4GDKB 2I5FA 3H9DA 2P0HA 3PZDA 2IYBA 2LXAA 1KOTA 1OTRB 2D4QA 2KKCA 3RZWC 3IFWB 4PS8A 5JZEB 1XQQA 1NVLA 4KV2A 4X57B 1SGHA 2B3AA 4AWJA 1NBFC 2MKRA 2KDBA 2EJ8A 2R2OA 2A5UA 5DHFB 3WYFB 2DYBA 1U27A 4NJ6A 2KD0A 3EECA 3TIXA 4JKGB 2FAZA 4GN1A 1UNQA 2CRFA 2N1VA 4M8NA 3DOWA 4DDGD 4K7SA 2CS4A 3M63B 1P6SA 2Y5BB 4MEMA 4HATB 3NHEB 2BYFA 2FIFA 3SBGA 1S3SG 3D8FA 2REXA 2YT1A 3R7RA 2ZJDA 1QZEA 2KNBA 3DVNV 2COFA 4IOYX 1X1GA 2MWSB 2C60A 2W2XC 1I35A 3DVGY 2A4ZA 2KC1A 5L81A 3ALBA 3CIKA 2XBBC 3FLVA 2KGXB 5C16A 4WJQA 1V81A 2VRRB 4BBKA 3KYCD 4JK8A 2K2UA 1SE9A 3WAPA 4DBGA 1WJMA 2N9PC 2BPSA 5HE0A 1TXDA 3KW5B 2IY0B 1GC7A 4A5KA 3L54A 3EPYA 2GBJA 1NI2A 4DX90 3SBTA 2VKIA 1M94A 3SD5A 1UNRA 1WJ1A 2BKFA 5HE2A 3SDLC 2AL6A 1U5DA 1V88A 1KZ7A 2AEHA 3PTFC 3W1YA 2KN5A 1OEYA 2CB8A 1LB1A 3ML4A 4TQ0A 5C23A 3Q3FA 4FLHA 4HCNB 2M1MA 2FJLA 2FJ9A 3IBEA 3ZNGC 5E6NA 3LJ3A 2XK5B 2MA9B 3PPAA 4HK2A 3QC8B 4BKSD 2YS1A 1FHOA 5JHAA 2DX5B 1ZC4B 2M17A 4WQOB 2GJYA 4KZCA 1GNUA 1H10A 4ANWA 1UNPA 4XZ4A 4AP4C 2CODA 1ST7A 1ACAA 4JKHA 1MK7B 2K1FA 4WWOA 3LDZE 1DDMA 1MKEA 2EMTA 3AULA 2LYDA 4AJWA 2NPTA 3JSVA 2L05A 4EZJA 1U5GA 3TFMA 2D07B 4JKFA 1VCBA 4FADA 4ANUA 1S1QB 2OJRA 3QBVB 2KTRA 1I42A 2R82A 2BYEA 2UWQA 1R4MI 4IWPA 2MP2B 2LKOA 4BBNF 2KDEB 3VUYA 2KZRA 3L10B 2BF8B 2LRUA 2RUKB 3N7CA 3VH3B 5KCVA 1YX5B 3AU5A 2LGYA 4FBJB 3TBLD 5DCNA 5GMVA 2N9EB 3P6AA 4Z2NA 2HRJA 1UPRA 4K2OA 4URKA 3D32A 1WYWB 2M8SA 1FAOA 3AXCA 1H4RA 3PVWA 4II3B 2JF5A 4ILJA 1ZVRA 3PSCA 2NS5A 4YONA 1I2HA 5IAAC 3U30A 1TZ1A 3IG3A 4JKAA 2IO0B 3T9LA 4EEWA 4ZRKA 4FHJA 4DDID 1U4AA 2YVCA 2GBKA 2KUPA 4MSQB 3CSTA 1WMHA 4KIKA 1WXAA 1WFYA 4F7ZA 1XX0A 2N7EA 3VIAA 2VRWB 3PLVA 1DYNA 5C5BB 4NQLB 3HM3A 3PHXB 4EZKA 1V49A 1E8YA 3KUCB 5KHOA 2JRHA 2CQUA 2J0KA 3A9JA 4HDQA 1Q67A 3VH4B 2DHZA 4DX8A 4I6LB 2FCNA 2RSGA 2W2XD 4JQWC 3H1UA 3M62B 4GZUA 3P2BA 3PRPB 3CF6E 3ECIA 4GIVA 5CHWA 5DPWA 2DIKA 3KRXA 2DLWA 4EOYA 3A9KA 5AEKB 2LGXA 2WWZA 2HD5B 2IO3B 4B95A 2NBUA 4BKSA 5EDSA 4GOCA 4BVUC 3A8PA 1X05A 4K7UA 3MTNB 3HM6X 3ZNID 4ANVA 2BWES 3KUDB 2L1CA 4AJYB 4EKUA 1P3QU 4LJOB 2DZMA 3WAOA 2ZNVC 3HHMA 2OQBA 1XD4A 3BINA 2L0TA 2GBNA 1SHCA 4DHJD 1XKEA 1WE6A 4HWIB 2FCSA 2CY5A 2X18A 4FHKA 2ADZA 4E74A 4NNJB 3MDBC 3VQIA 4TKNA 3DXCA 1U2BA 3H7PB 3ZRCA 5D94A 2DHIA 4E71A 5JH5C 2ZCBA 4MELA 3A9KB 5JHHA 2IO1B 3QHTA 3R7QA 1BT0A 2R2QA 4W9LA 2ZZPB 4ASWC 4G50A 1WX7A 4CO7A 2NMBA 5FR6A 1OMWA 4GMXB 2D11A 3UGBB 4K2PA 1Y5OA 5J17A 3SUZA 4G3XB 3KVFB 1FXTB 2CHWA 4JKCA 1X11A 2J7QB 4PNKA 4IFSA 2EKEC 2N23A 2ZVOA 1V89A 5HE1A 4TYZA 3KY9A 4JLCA 2PPHA 4MGKE 3ML8A 2BGFA 4JK9A 3ODOA 2M14A 2KDFB 4ZRJA 1OQYA 1V5TA 2KFJA 2HE7A 2WH5A 2PE6B 2G4DB 3V60A 2J0JA 3QQ8B 1WM3A 1MG8A 2ROZB 4XX5A 2HTHB 3EHVA 3AJ4A 2JXXA 1DDVA 1GG3A 3I3TB 4ANXA 1DROA 3PHWB 2KX3A 4W9FA 3SU8X 2CU1A 2RGNB 1LM8B 1VD2A 3C0RB 2KCJA 2D2QA 2C7NB 2CKHB 1PMSA 2HJ8A 2MRPA 2QHOA 4HXDA 4B6HA 2KLGA 2WX0A 1KZGA 1CMXB 2MBOA 4ICVA 3DBRI 4XC2A 4HVBA 4K1RB 1ZW7A 3QWZB 1XR0B 3QCAA 1TJ6A 4MSMB 4H8SA 4LJPB 1NTVA 1NU2A 1EGXA 3UINB 4DK5A 2O6VB 3RD2A 3TMPB 1MPHA 4Y94A 2JP2A 1MAIA 3HQCA 2DYQA 4A6HA 4AUQC 1WG7A 2DKQA 4HB3B 5KQ1A 3DXEA 4W9KA 5C1ZA 1U29A 5CHVC 1V6EA 2W2WA 2L00B 2ZPNA 2EMSA 5DHAB 1E5WA 1HBKA 2MFQA 4K81A 2KO3A 2CAYA 1BTKA 2IO2B 2DAFA 4ZDVA 5L83A 4HDOA 4TUUA 3RT3B 2IY1B 4IW0A 1TQZA 4J6IA 1V5UA 4KIKB 2MQJA 2JY6A 1NTYA 2O6VD 4EMOA 2QKLA 2BYVE 3N32A 5CTRC 2RSUA 1P0RA 3KUZA 2K6DB 1WGGA 3DVNU 2KQSA 2LBBA 2C7MB 4KZ0A 3FM8C 2DYMA 4WSFA 2RLOA 4IC7B 1TGZB 3KRWA 4IWQA 1RJ2A 2CHXA 3DBHI 4C0AA 4LCDE 4M0WB 2E2XA 2D3GA 1V86A 3JYUA 4NAWB 2LGDA 2LASA 2M0XA 4WWNA 3PRZA 3F5RA 1WXSA 3M3JA 1XCGA 3VVWB 1KJTA 1HE8A 4JL9A 4EUTA 3MHSD 2KQ7A 4RMAA 1ISNA 2JWZA 3DQVA 5G2NA 4DWFA 3CXBB 2L8JA 4A6FB 3ZTCA 2WDTB 3F0WA 2Z0QA 4CHKA 1WIAA 3ZVRA 1J0WA 4G11A 4PYZA 3WAMA 4GXBA 3FSSA 1E7VA 3K9PB 4PYUA 2LXCA 1WVHA 1H8CA 2MSED 2NR2A 3L13A 3RZFA 3W1SA 2D9ZA 2KFKA 2Q13A 4G0NB 4NJ7A 2Z0DB 5IJMA 1TBEA 4Z2MB 5LOPB 3PVLA 3VTUA 2GMIC 2DAJA 3PEGA 4DBBA 3QK0A 4FJYA 3TJPA 4MDKE 4HPMB 4MJSB 4HJKA 2MLBA 2MW5A 3VFKA 1WR6E 1JDEA 1L2NA 3DDCB 2DX1A 2ZCCA 4NSWA 4HB2B 3B1LX 3H6NA 1T0YA 2MBEA 1DBHA 3A9JB 1WE7A 2RPQA 3MPXA 5J3QA 2R09A 4EZLA 4WWPA 2WX1A 4MH0E 2KX0A 3E9OA 4ZYNA 2ZVNA 3OJ4B 5LONB 4MGZE 4NY0A 3BJIA 2Z0PA 1WGDA 2K8CA 4KAXB 1RRBA 3ZLZA 3X0WA 1P5TA 4W9EA 4BFRA 2L2IA 5D3VA 2W9NA 1W1HA 3O96A 4HAWB 2FCMA 1LQBA 2O2VA 1OY2A 5CHFA 1W1GA 2J59M 2R0DA 2K00A 3PP2A 3GZNI 1UBIA 2JRIB 1A5RA 2G3QB 2MDXA 2JZ3B 2LZ6A 2XQNM 3CMMB 4F7HA 2KMAA 4KHBB 2DZIA 2MP2A 3NY5A 1DIKA 4TV3A 2G45B 1E8ZA 1V5PA 3KZ1A 2LG1A 1MK9B 5D2MB 1GGOA 4IUMB 1U5EA 4GGQA 1GUAB 2KLCA 4IG7B 4N9F4 3U7DA 4IM2A 2OTXA 1FGZA 4L6EA 3O65B 1WJ6A 3M1IB 3A8QA 5DPTA 3UIPB 4EFOA 3TW1A 1Q5WB 3KSYA 3SNHA 2H7EA 3Q3JA 3V61A 1W1DA 3QA8A 2L76A 4WVFB 1Q0WB 2C9WB 3SO6A 1VBGA 1FOEA 1U5FA 3A33B 3QX1A 3ZVVA 1ZC3B 2P0DA 1QC6A 1WRDB 3OANA 1K5DB 3WANA 3B0AA 3VXWA 1V61A 3ODXA 4PS3A 2YT0A 3DCGA 2C7HA 1UELA 1Y8RC 5DH9B 3ZDTA 4BOSC 2RQ1A 2LWPA 2DN6A 1AWEA 5C5BA 1K5GB 4XWXA 1E8WA 5EFXA 5JVLA 2NVUI 1J19A 4HAUB 4HPLB 4MM3A 3OLMD 1YQBA 3APFA 2V3SA 3UZTA 1P98A 5L95C 3A4RA 4GPTB 1P3RA 3A1QB 2ROVA 3VAWA 4WJPA 4FA6A 5FI0A 2DHKA 4KVGB 3ENEA 2RGFA 1LW3A 2OOBB 1J0GA 3APDA 5E6PA 2KOXA 4MGYE 1RRPB 2BKRB 2FCQA 1UH6A 2FNJB 2LI5A 1ZM0A 1UPQA 4F7GA 1WGUA 5D6JB 2GCLA 2MX2A 1WXMA 1WGYA 2KHWB 3VOQA 2JZZA 3W1SC 3ZTDA 3EC8A 1F9JA 1P9DU 3DBLI 2RNRB 2GCJA 2D9VA 1V80A 5CLQB 2JT4B 4BOZB 2I1JA 1WF9A 4HCPB 5LXIB 2P8VA 3BY4B 1EF1A 2Y7BA 3FEHA 2Z0OA 5DI9B 1UGMA 3QARA 2YLMA 2G4SA 1I7AA 2DZKA 4I6NB 1EF5A 1OGWA 2KANA 4IM3A 3S2AA 2Z59B 2K25A 2JVCA 4K7WA 5KQ4A 2KJRA 2QKMA 2JPHA 1UBQA 1WI0A 2Z0EB 4DHJB 3ML9A 2UVMA 1PLSA 2LJ5A 1VBHA 2KWUB 2I1KA 5JP4A 2KJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  3KRW A;  4IWQ A;  3VH3 B;  2V1Y A;  5KCV A;  1YX5 B;  4FJZ A;  3AU5 A;  4MY6 A;  4IWO A;  3RCZ A;  2DZJ A;  4EEW A;  1RJ2 A;  2LGY A;  5AZH A;  4CHM A;  2CHX A;  3TVV A;  3DBH I;  4C0A A;  1UZX B;  5DCN A;  5GMV A;  5TR5 A;  3RYT A;  3TBL D;  2N9E B;  4LCD E;  3P6A A;  4Z2N A;  2HRJ A;  4M0W B;  2E2X A;  1DDW A;  1P1A A;  2D3G A;  1UPR A;  2WYQ A;  4TQ1 A;  1V86 A;  3JYU A;  4K2O A;  4NAW B;  2KK8 A;  3L0W B;  2LGD A;  3GYO A;  1JRU A;  2LAS A;  2M0X A;  4WWN A;  3PRZ A;  3F5R A;  4URK A;  4CYE A;  2ELA A;  3OJ3 A;  3D32 A;  1WXS A;  1WYW B;  1MIX A;  1Z2M A;  1FAO A;  2M8S A;  3PLU A;  3AXC A;  3M3J A;  1H4R A;  2UZS A;  3PVW A;  1XCG A;  1V2Y A;  3QJZ A;  4II3 B;  3VAW A;  2JF5 A;  1ZVR A;  3VVW B;  1NDD A;  4GDK A;  4GDL B;  4MJS A;  3PSC A;  1KJT A;  1HE8 A;  4JL9 A;  4EUT A;  4DHZ E;  2NS5 A;  4PQ0 A;  2YF0 A;  1X1M A;  2KQ7 A;  4YON A;  3MHS D;  1X86 A;  1I2H A;  4GSW A;  4RMA A;  1ISN A;  2JWZ A;  5IAA C;  2KFK B;  4BKG A;  3U30 A;  1QQG A;  1TZ1 A;  3DQV A;  3MJW A;  1UEF A;  4IAP A;  3IG3 A;  2IO0 B;  1WGQ A;  5G2N A;  4DWF A;  5BO4 B;  3T9L A;  2MBB B;  4HAY B;  4ZRK A;  2J0M A;  3IVF A;  4FHJ A;  3CXB B;  4NAW A;  2L8J A;  4A6F B;  4DDI D;  4E3C A;  1U4A A;  1D3Z A;  5J3Y A;  2YVC A;  3L08 A;  3PV1 A;  2WDT B;  2GBK A;  3ZTC A;  3AU4 A;  2KUP A;  3ZRF A;  4MSQ B;  1Y19 B;  4HB0 B;  3F0W A;  5CX3 A;  2MRP A;  2QHO A;  2ZEQ A;  3UQA A;  3CST A;  1G6J A;  3RCP A;  1WMH A;  3QAQ A;  4CHJ A;  4KIK A;  1I42 A;  2Z0Q A;  4CHK A;  3SYX A;  1WIA A;  1WXA A;  3ZVR A;  1J0W A;  1WFY A;  2DEN B;  1XX0 A;  3NZU A;  4G11 A;  2V4L A;  2LVO A;  4GXB A;  4KDL B;  4PYZ A;  2N7E A;  2RD0 A;  3FSS A;  1E7V A;  3WAM A;  3VIA A;  2VRW B;  3K9P B;  3D8E A;  4PYU A;  2LOZ A;  3PLV A;  1DYN A;  1GJZ A;  5C5B B;  2LRW A;  2LXC A;  4NQL B;  4BBN C;  3HM3 A;  4FUL A;  1WVH A;  1HB8 A;  2LOX A;  1WH3 A;  3PHX B;  4EZK A;  2KWC A;  2KWV B;  3HIZ A;  1H8C A;  1V49 A;  1HB6 A;  1E8Y A;  2MSE D;  3KUC B;  2JRH A;  3N30 A;  2M38 A;  5KHO A;  2CQU A;  5IA7 A;  3UQB A;  2J0K A;  3A9J A;  4HDQ A;  1Q67 A;  3VH4 B;  2DHZ A;  4DX8 A;  3QWM A;  4I6L B;  2NR2 A;  3L13 A;  3VTV A;  3RZF A;  4B9K A;  1R4N I;  2RSG A;  2W2X D;  1WJ4 A;  2FCN A;  3N3K B;  3NS8 A;  3W1S A;  2D9Z A;  4JIO U;  2KFK A;  4JQW C;  2Q13 A;  3H1U A;  4G0N B;  4NJ7 A;  2EC1 A;  4RM8 A;  2Z0D B;  5IJM A;  3M62 B;  3PT2 B;  1TBE A;  5C79 A;  4KHO A;  4Z2M B;  5LOP B;  4GZU A;  1YJ1 A;  2FUH B;  3PRP B;  3CF6 E;  1M7E A;  3ECI A;  3P2B A;  4GIV A;  3PVL A;  5CHW A;  3L16 A;  4GU2 A;  3VTU A;  5DPW A;  3G9W A;  2NZ8 B;  2GMI C;  3KRX A;  5GOW B;  1RAX A;  2DAJ A;  3PEG A;  4DBB A;  1C1Y B;  2KC2 A;  2P0F A;  3QK0 A;  4FJY A;  4PS7 A;  3TJP A;  3SHQ A;  2D9Y A;  1IPG A;  2DLW A;  4MDK E;  3WA0 A;  4HPM B;  4EOY A;  4MJS B;  2O2V B;  1V5O A;  2D9X A;  5D27 A;  2ASQ A;  3A9K A;  4HJK A;  3VUW A;  2LGX A;  2MLB A;  2G35 A;  2MW5 A;  3VFK A;  5AEK B;  2WWZ A;  5FI1 A;  4A3P A;  4MT7 A;  2CR5 A;  2HD5 B;  1WR6 E;  2N7D A;  2LVP A;  2IO3 B;  2GBM A;  5DPR A;  1WGH A;  2NBW B;  3DDC B;  1L2N A;  4B95 A;  4A6K A;  2NBU A;  2DX1 A;  4BKS A;  3RUL A;  5EDS A;  1IYF A;  3TL5 A;  2DKP A;  2ZCC A;  4FN2 A;  4GOC A;  2COC A;  4W9J A;  4BVU C;  3A8P A;  4NSW A;  4D0N B;  1OEY J;  4HB2 B;  1X05 A;  3B1L X;  4JGH B;  1BAK A;  4K7U A;  3H6N A;  3V6E B;  1C3T A;  4GDL A;  4K17 A;  3MTN B;  2L0F A;  5JLJ B;  1T0Y A;  3HM6 X;  2KTR B;  2MBE A;  1DBH A;  3DXD A;  3A9J B;  2DX5 A;  1WE7 A;  2RPQ A;  3MPX A;  5J3Q A;  2BWF A;  1WXV A;  2MBQ A;  3ZDM C;  2KVR A;  3AI5 A;  3ZNI D;  4ANV A;  2R09 A;  2BWE S;  2UYZ B;  4EZL A;  4IM0 A;  3KUD B;  2L1C A;  4FJV B;  1ZKH A;  4WWP A;  1EUV B;  4OVV A;  2WX1 A;  3RUI B;  4AJY B;  1Z5S B;  3PRE A;  4MH0 E;  3ZIM A;  4EKU A;  2VSZ A;  1P3Q U;  4LJO B;  3V5W A;  3X23 A;  3LJU X;  2DZM A;  2DYN A;  2LUE A;  2LVQ A;  2ZNV C;  2GBR A;  3HHM A;  2NCN A;  3NZS A;  3WAO A;  2MWN B;  2KX0 A;  2OQB A;  4EJN A;  3HK0 A;  5D3X A;  1XD4 A;  4ZYN A;  3BIN A;  5J2R A;  1FHX A;  2L0T A;  2ZVN A;  3OJ4 B;  1E7U A;  4II2 B;  4YL8 A;  2GBN A;  1SHC A;  5LON B;  4F7U P;  4MGZ E;  4DHJ D;  4NY0 A;  4DHZ B;  5JHB A;  4HAX B;  4F8C B;  3ZUN A;  2KJ6 A;  3DVG X;  2BCJ A;  3BJI A;  4WJ7 A;  1XKE A;  2Z0P A;  1X1F A;  1WE6 A;  1WGR A;  1WX9 A;  4HWI B;  1SIF A;  1WGD A;  3D8D A;  2FCS A;  2CY5 A;  4M8M A;  3NSU A;  2X18 A;  3H7P A;  2CY4 A;  2Y8F A;  5C6R A;  1WJN A;  4FHK A;  3VDZ A;  4HXD A;  1KM7 A;  2ADZ A;  2K8C A;  3FP5 A;  1V5M A;  2IFS A;  3MDB C;  4KAX B;  4KHA A;  5D3Y A;  4NNJ B;  3VQI A;  1WI1 A;  1RRB A;  2L7R A;  2YSZ A;  4HAZ B;  3ZLZ A;  1KI1 B;  2DHJ A;  3X0W A;  4TKN A;  3HW2 B;  4ICU A;  1P5T A;  3DXC A;  2V76 A;  4W9E A;  4W9I A;  3H7S A;  3PGE A;  1U2B A;  3H7P B;  2AYO B;  2N1W A;  4GDK B;  2I5F A;  1LFD A;  1K8R B;  1RLF A;  3H9D A;  1WX8 A;  3ZRC A;  4BFR A;  4KSK C;  2P0H A;  3PZD A;  2JUO A;  2IYB A;  2LXA A;  2FID A;  5D94 A;  3ONS A;  1KOT A;  1Q1O A;  5LLI A;  2L2I A;  1YD8 U;  2DHI A;  4B6W A;  5D3V A;  1WJU A;  4E71 A;  1OTR B;  2D4Q A;  1MIZ B;  4GMV A;  2KKC A;  2ZCB A;  5JH5 C;  3RZW C;  3U8Z A;  3IFW B;  4PS8 A;  4MEL A;  2YRY A;  2W9N A;  1W1H A;  3O96 A;  4HAW B;  2FCM A;  3S2A A;  5JZE B;  1LQB A;  1XQQ A;  2O2V A;  3A9K B;  3PRM B;  1NVL A;  5JHH A;  1OY2 A;  2IO1 B;  4W9D A;  5CHF A;  4KV2 A;  4X57 B;  2M4N A;  1SGH A;  4BKT A;  1W1G A;  2B3A A;  2J59 M;  4AWJ A;  2R0D A;  1NBF C;  2K00 A;  2MKR A;  2KDB A;  3QHT A;  3PP2 A;  3R7Q A;  1BT0 A;  2R2Q A;  4W9L A;  2EJ8 A;  3GZN I;  3PVU A;  1EO6 A;  1UBI A;  2R2O A;  1GC6 A;  1RFA A;  2JRI B;  2A5U A;  2ZZP B;  5D7G A;  5DHF B;  3WYF B;  2DYB A;  1U27 A;  4NJ6 A;  2KD0 A;  3EEC A;  5AZF A;  3TIX A;  2G3Q B;  1A5R A;  2MDX A;  2FAZ A;  3WAL A;  1KLV A;  2ZPY A;  4ASW C;  3GYP A;  4GN1 A;  1UNQ A;  2CRF A;  5JHG A;  2JZ3 B;  2LZ6 A;  2N1V A;  3OAW A;  1WX7 A;  2DA0 A;  2KDI A;  4G50 A;  3DOW A;  4CO7 A;  3R66 C;  2XQN M;  2NMB A;  5FR6 A;  3CMM B;  3ZO5 B;  4F7H A;  4P7I A;  4DDG D;  2RVB B;  1OMW A;  4GMX B;  4K7S A;  3VHT C;  2D11 A;  2CS4 A;  2KMA A;  2Y8G A;  3UGB B;  2PJH A;  3M63 B;  4FBJ B;  4K2P A;  1Y5O A;  4KHB B;  1P6S A;  2Y5B B;  2ABD A;  3M95 A;  5J17 A;  3SUZ A;  4HAT B;  2DZI A;  3NHE B;  3KVF B;  4G3X B;  4MEM A;  2O6V A;  1FXT B;  3A1Q A;  4E74 A;  2CHW A;  2BYF A;  2MP2 A;  2N9X A;  2FIF A;  3NY5 A;  4TV3 A;  2G45 B;  1E8Z A;  1X11 A;  2J7Q B;  1V5P A;  3KZ1 A;  2LG1 A;  1MK9 B;  4PNK A;  2D9W A;  1S3S G;  4IFS A;  3PS6 A;  3D8F A;  2REX A;  2YT1 A;  4IUM B;  1WZ0 A;  1U5E A;  2EKE C;  2ZJD A;  4KSL C;  1QZE A;  2KNB A;  1L7Y A;  2N23 A;  2ZVO A;  4GGQ A;  1V89 A;  3GOE A;  2DFK A;  5HE1 A;  1IRS A;  1GUA B;  4TYZ A;  1WR1 A;  3KY9 A;  4DXA B;  3DVN V;  2KLC A;  4IG7 B;  5DIF B;  4JLC A;  2UZR A;  2K8H A;  2PPH A;  2COF A;  4IOY X;  3ML8 A;  1B55 A;  4MGK E;  4N9F 4;  1X1G A;  1UD7 A;  2MWS B;  2IBI B;  5KHQ A;  3ULB A;  3U7D A;  2BGF A;  4F7Z A;  4IM2 A;  2OTX A;  1FGZ A;  3PG7 A;  2C60 A;  3W1Y A;  2W2X C;  4L6E A;  3ODO A;  2M14 A;  1N3H A;  3DVG Y;  2A4Z A;  2KC1 A;  2KDF B;  3R7R A;  1I35 A;  3ZNZ B;  4ZRJ A;  3O65 B;  1OQY A;  5L81 A;  1WJ6 A;  1V5T A;  2KFJ A;  2HE7 A;  3ALB A;  3CIK A;  3M1I B;  2WH5 A;  3A8Q A;  2XBB C;  3TO1 A;  3FLV A;  1Z87 A;  5DPT A;  2NBV B;  2PE6 B;  2KGX B;  2PZ1 A;  2G4D B;  3TW1 A;  5C16 A;  2J0J A;  4WJQ A;  3V60 A;  1Q5W B;  3ZKJ C;  3QQ8 B;  3B08 A;  1V81 A;  2VRR B;  4BBK A;  3KYC D;  2PEA A;  2K2U A;  1WM3 A;  3KSY A;  1MG8 A;  2ROZ B;  2IZV B;  3SNH A;  1SE9 A;  2H7E A;  4XX5 A;  3WAP A;  4DBG A;  1WJM A;  3Q3J A;  3V61 A;  1W1D A;  2N9P C;  2BPS A;  1WY8 A;  5HE0 A;  3EFU A;  1TXD A;  2RR9 A;  2XEW A;  3UIO B;  3KW5 B;  2HTH B;  1YX6 B;  2IY0 B;  3EHV A;  3SV1 A;  3ZW3 A;  1GC7 A;  3AJ4 A;  2JXX A;  3DPD A;  3QA8 A;  2N4F A;  3VUY A;  4HLE A;  1DDV A;  1BTN A;  1GG3 A;  1AQC A;  3I3T B;  4A5K A;  2L76 A;  2MCN B;  4ANX A;  4W9C A;  4WVF B;  1Q0W B;  3L54 A;  2C9W B;  3EPY A;  3SO6 A;  2GBJ A;  1NI2 A;  1DRO A;  3PHW B;  1FOE A;  1U5F A;  4HB4 B;  4DX9 0;  3A33 B;  3QX1 A;  5J3T A;  2VKI A;  3ZVV A;  3ZNH B;  1M94 A;  1ZC3 B;  2P0D A;  2KX3 A;  1QC6 A;  1ZGU B;  3SD5 A;  1UNR A;  4W9F A;  2FDQ A;  3SU8 X;  1WRD B;  3OAN A;  2CU1 A;  2KMC A;  2RGN B;  3IHP C;  1K5D B;  3WAN A;  2XK5 A;  3B0A A;  3VXW A;  1V61 A;  1WJ1 A;  3ODX A;  2IYD B;  4PS3 A;  5J18 A;  2YT0 A;  4FA6 A;  1LM8 B;  2I5C A;  3DCG A;  2C7H A;  4W9H A;  1UEL A;  1VD2 A;  2BKF A;  3C0R B;  2KCJ A;  1Y8R C;  5HE2 A;  4M8N A;  2D2Q A;  5DH9 B;  2H7D A;  2C7N B;  2CKH B;  4EFO A;  3SDL C;  3ZDT A;  4BOS C;  2RQ1 A;  2LWP A;  1PMS A;  2DN6 A;  1AWE A;  5C5B A;  4B6H A;  2AL6 A;  1K5G B;  2CHZ A;  2HJ8 A;  2KXJ A;  2MBH A;  1U5D A;  4XWX A;  1V88 A;  1E8W A;  3NOB A;  2N0Y A;  3V62 A;  3KH0 A;  2KLG A;  5EFX A;  2WX0 A;  1WMH B;  1KZ7 A;  2AEH A;  2NVU I;  1J19 A;  1KZG A;  4HAU B;  1CMX B;  1XT9 B;  2MBO A;  3PSE B;  3PTF C;  2KN5 A;  4HPL B;  4MM3 A;  1OEY A;  3DBR I;  4ICV A;  4XC2 A;  3OLM D;  3V6C B;  2CB8 A;  1EAZ A;  1ZW7 A;  4K1R B;  4HVB A;  1YQB A;  3QWZ B;  3APF A;  2V3S A;  3UZT A;  3ULC A;  1P98 A;  1XR0 B;  5L95 C;  2L3Z A;  3QCA A;  3A4R A;  5DPS A;  1TJ6 A;  4MSM B;  3WIM A;  3APC A;  4GPT B;  1LB1 A;  4H8S A;  3ML4 A;  4TQ0 A;  1P3R A;  3A1Q B;  4LDT B;  1FB8 A;  4MGI E;  2ROV A;  4LJP B;  5C23 A;  5HKH A;  3Q3F A;  4WJP A;  1NTV A;  1NU2 A;  5FI0 A;  4FLH A;  2K6Q A;  2DHK A;  1EGX A;  3UIN B;  4RM9 A;  4DK5 A;  4HCN B;  4KVG B;  2O6V B;  3RD2 A;  3TMP B;  2M1M A;  3ENE A;  1MPH A;  2FJL A;  4Y94 A;  2RGF A;  1LW3 A;  2JP2 A;  2FJ9 A;  1MAI A;  2OOB B;  3HQC A;  3IBE A;  1J0G A;  3ZNG C;  5E6N A;  3APD A;  3LJ3 A;  2XK5 B;  5E6P A;  2GOW A;  2DYQ A;  2MA9 B;  4OVU A;  3PPA A;  1E8X A;  4A6H A;  2KOX A;  4HK2 A;  3QC8 B;  4HHV A;  4MGY E;  1RRP B;  2BKR B;  1WG7 A;  4AUQ C;  3VUX A;  2YS1 A;  4BKS D;  1FHO A;  4F1S A;  2GS0 A;  2FCQ A;  1UH6 A;  2PE9 A;  3UIP B;  4A6F A;  2FNJ B;  3DBS A;  2LI5 A;  3K9O B;  1YIW A;  5JHA A;  2DX5 B;  1ZC4 B;  2DKQ A;  1ZM0 A;  4HB3 B;  1UPQ A;  3A98 B;  4F7G A;  5KQ1 A;  2M17 A;  4WQO B;  3DXE A;  1WGU A;  2GJY A;  4KZC A;  1GNU A;  4W9K A;  5C1Z A;  2KTF A;  1U29 A;  5D6J B;  5CHV C;  2GCL A;  1V6E A;  2COP A;  2MX2 A;  1H10 A;  1IP9 A;  2W2W A;  4ANW A;  2L00 B;  2ZPN A;  4A3O A;  3A4S C;  1UNP A;  1WXM A;  4KDI C;  4XZ4 A;  2EMS A;  1WGY A;  5DHA B;  1E5W A;  2KHW B;  1HBK A;  3ODW A;  2ZNV B;  3UF8 A;  3VOQ A;  2JZZ A;  3W1S C;  1WZ3 A;  3ZTD A;  2MFQ A;  4K81 A;  2KO3 A;  2CAY A;  1F9J A;  1WM2 A;  1M7R A;  3EC8 A;  4NQK E;  1PQS A;  2COD A;  1BTK A;  2IO2 B;  1ST7 A;  1XOD A;  1P9D U;  1ACA A;  2C5L C;  2DAF A;  2RNR B;  3DBL I;  2LUL A;  4W9G A;  4WJO A;  5G55 A;  1NTI A;  2GCJ A;  2D9V A;  1V80 A;  5CLQ B;  2JT4 B;  4GB9 A;  4AOF A;  4BOZ B;  4ZDV A;  1MK7 B;  2K1F A;  5D2M B;  2AL3 A;  3CSF A;  1FHW A;  4WWO A;  2I1J A;  1WF9 A;  2AWT A;  4HCP B;  2HTH A;  3LDZ E;  1TTN A;  4AP4 C;  1DDM A;  3VTW A;  5LXI B;  5L83 A;  1MKE A;  2D10 A;  2EMT A;  2P8V A;  5E6O A;  5LXH A;  4HDO A;  3BY4 B;  4I6P A;  1EF1 A;  1OQN A;  2Y7B A;  4TUU A;  3AUL A;  2LYD A;  3RT3 B;  4AJW A;  1E90 A;  2IY1 B;  2L05 A;  2NPT A;  3JSV A;  1ZSQ A;  4EZJ A;  3FEH A;  2Z0O A;  4IW0 A;  1U5G A;  3TFM A;  5DI9 B;  1AAR A;  2K2J A;  1TQZ A;  1UGM A;  4J6I A;  2D07 B;  3QAR A;  4LDT D;  1V5U A;  4KIK B;  2MQJ A;  2JY6 A;  4WAA A;  1VCB A;  2YLM A;  2G4S A;  4NPN A;  1NTY A;  2O6V D;  4FAD A;  3QIJ A;  4ANU A;  5D3W A;  2ELB A;  3T06 A;  4EMO A;  1I7A A;  1S1Q B;  2DZK A;  4I6N B;  4HAV B;  1EF5 A;  2OJR A;  1OGW A;  5CLL B;  3TCA A;  2KAN A;  4IM3 A;  1V9J A;  3QBV B;  2QKL A;  2BYV E;  2KTR A;  3L17 A;  1BWN A;  2Z59 B;  5HE3 A;  3N32 A;  3R3M A;  2LD9 A;  5AZG A;  5CTR C;  2RSU A;  3KYD D;  2COA A;  2BYE A;  3JSV B;  1XD3 B;  2UWQ A;  1R4M I;  2K39 A;  1P0R A;  2K25 A;  2JVC A;  2MP2 B;  3KUZ A;  1LXD A;  4IWP A;  1J8C A;  1EVH A;  2K6D B;  3JVZ X;  4K7W A;  2YS5 A;  2LKO A;  1WGG A;  3DVN U;  3JW0 X;  5KQ4 A;  2KDE B;  2QKM A;  2JPH A;  2KJR A;  2KQS A;  4BBN F;  1PFJ A;  1UBQ A;  1WI0 A;  2DYO A;  2LBB A;  2C7M B;  2KZR A;  2Z0E B;  1FGY A;  2YS3 A;  3L10 B;  3ML9 A;  4KZ0 A;  2UVM A;  3T8M A;  4DHJ B;  2DTC A;  3FM8 C;  1PLS A;  4WJN A;  2BF8 B;  4A20 A;  4MK0 A;  2LRU A;  5JP4 A;  2LJ5 A;  2RUK B;  4WSF A;  2DYM A;  2RLO A;  2K8B A;  2KWU B;  4ZRI A;  1TGZ B;  4IC7 B;  2I1K A;  2NPT B;  3P7Z A;  2KJH B; 
#chains in the Genus database with same CATH topology
 1JCK B;  2SEB D;  2V1Y A;  4FJZ A;  2VZK D;  4IWO A;  4NAM A;  3RCZ A;  5AZH A;  3RYT A;  4MH8 A;  1DDW A;  1P1A A;  2WYQ A;  4TQ1 A;  1KLU D;  1EM7 A;  1PDX A;  2BQQ A;  5MPO A;  1JRU A;  2OHF A;  2N9L A;  2ELA A;  4TMA B;  1Z2M A;  1MIX A;  2QC8 A;  2IPK D;  3Q8A A;  2UZS A;  4AQ7 A;  1AW7 A;  4ACF A;  1T0S C;  1NDD A;  4GDK A;  4GDL B;  4HKQ A;  4DHZ E;  1RFK A;  1X1M A;  1X86 A;  3E9L A;  2KFK B;  4LNN A;  4BKG A;  4YTP B;  1UEF A;  1STE A;  4HPP A;  2RPV A;  4HAY B;  3IVF A;  4NAW A;  1V97 A;  4E3C A;  3IXS A;  3L08 A;  3ZRF A;  1KC7 A;  3AU4 A;  2MJ3 A;  4HB0 B;  2MH7 A;  3GP7 A;  5CX3 A;  3KWL A;  2XNA C;  3QAQ A;  3RNB C;  1TT5 B;  3AE6 B;  3SYX A;  3WCQ A;  3VTW A;  1IYF A;  1KLV A;  1TYG B;  3Q6B A;  5HKH A;  4BAX A;  2V4L A;  1QQR A;  2RD0 A;  3P4S B;  3N1Z C;  1GJZ A;  4OVZ A;  4L23 A;  2LRW A;  1HB8 A;  4REZ A;  1WH3 A;  2KWV B;  3GS2 A;  3HIZ A;  1HB6 A;  5IA7 A;  5EE9 A;  1TY2 A;  3QWM A;  4DXF A;  3VTV A;  4B9K A;  1R4N I;  3RNE C;  1XLO A;  1YN5 A;  2EC1 A;  3PT2 B;  3ZYY X;  3NWA A;  4N6E B;  5LNK 1;  1M7E A;  4GU2 A;  3FVC A;  2X0S A;  3G9W A;  2AQ2 B;  2WDV B;  3IAM 1;  4DQO C;  1RAX A;  1C1Y B;  2KC2 A;  2P0F A;  4PS7 A;  3SHQ A;  2D9Y A;  1C4A A;  3WA0 A;  3U4E G;  2ASQ A;  2D9X A;  5D27 A;  1NI3 A;  2G35 A;  5FI1 A;  4A3P A;  4HEA 1;  2CR5 A;  4QAY A;  2N7D A;  2LVP A;  1ZE3 D;  2GBM A;  4A6K A;  3RUL A;  1FMA D;  3TSS A;  1ZP0 B;  3TL5 A;  1NVI D;  1JAL A;  4D0N B;  1OEY J;  1BAK A;  1C3T A;  4GDL A;  4K17 A;  1QOF A;  4R3D A;  2JYE A;  2DX5 A;  3ABV B;  1DYQ A;  2MBQ A;  3DHH C;  3T3N A;  4IM0 A;  1Z5S B;  3PRE A;  1JWB D;  3V5W A;  3X23 A;  3LJU X;  2DYN A;  2LUE A;  3EFC A;  3Q8F A;  4YSZ B;  2GBR A;  2NCN A;  4JK7 A;  5IRS A;  1EU3 A;  3HK0 A;  1UUP A;  1ENF A;  1FHX A;  4II2 B;  4YL8 A;  4H2A A;  2KVZ A;  5JHB A;  4HAX B;  4ITK A;  3NVZ A;  4F8C B;  3ZUN A;  2KJ6 A;  2E3T A;  3DVG X;  2BCJ A;  1ET9 A;  2KYW A;  2LHE A;  4CQN A;  1WGR A;  1WX9 A;  4JPS A;  1SIF A;  4K3B A;  1ZYI A;  2AQ1 B;  3H7P A;  2CY4 A;  1WJN A;  3VDZ A;  1KM7 A;  2K8E A;  1V5M A;  2IFS A;  1L0X B;  2L7R A;  2YSZ A;  4HAZ B;  3P4Q B;  3A58 A;  2V76 A;  4XGA B;  4W9I A;  3H7S A;  3PGE A;  2J53 A;  2AYO B;  1LFD A;  1K8R B;  1RLF A;  1WX8 A;  1I4X A;  4KSK C;  2JUO A;  2RDH A;  2FID A;  3ONS A;  1Q1O A;  5LLI A;  1YD8 U;  1F0Z A;  4B6W A;  1WJU A;  1MIZ B;  4GMV A;  2G1E A;  1R7S A;  4AOF A;  3U8Z A;  4GOU A;  4A6Q A;  2YRY A;  1N6Z A;  1YN3 A;  3PRM B;  4W9D A;  2M4N A;  4BKT A;  2VH2 A;  1FCC C;  2PLP A;  3PVU A;  1EO6 A;  1JWU D;  5D7G A;  1GC6 A;  1RFA A;  3SFD B;  1XEE A;  3WAL A;  2K22 A;  2ZPY A;  3GYP A;  5JHG A;  2GI9 A;  1D3Z A;  3OAW A;  3E9P A;  2DA0 A;  2KDI A;  3R66 C;  3ZO5 B;  4P7I A;  1TIF A;  2RVB B;  3VHT C;  2Y8G A;  2PJH A;  2ABD A;  3M95 A;  2O6V A;  3A1Q A;  1MFW A;  2N9X A;  2KMM A;  1TKG A;  1VR9 A;  3PS6 A;  2WP9 B;  3ZQ4 A;  2D9W A;  1WZ0 A;  4KSL C;  2D3C A;  2KIE A;  1L7Y A;  1IGD A;  3GOE A;  2DFK A;  1IRS A;  1MHX A;  1WR1 A;  4DXA B;  3J9C A;  4PT5 A;  5DIF B;  2UZR A;  2K8H A;  3ZNH B;  1B55 A;  1K52 A;  1UD7 A;  3TUO A;  2IBI B;  5KHQ A;  4KKJ A;  1RM6 C;  3ULB A;  1R4N B;  1SE4 A;  2NTT A;  3PG7 A;  1PYW D;  1K51 A;  1SJE D;  5EE3 A;  1N3H A;  3ZNZ B;  3TO1 A;  1Z87 A;  5AZF A;  2NBV B;  2PZ1 A;  3HRD D;  1YMH E;  3ZKJ C;  3B08 A;  1VLB A;  4QJ5 B;  2PEA A;  2JX5 A;  2IZV B;  2JSV X;  1MVK A;  1YQ3 B;  3R8B A;  1WY8 A;  3SEB A;  3EFU A;  2RR9 A;  3UIO B;  2XEW A;  3C8Y A;  1YX6 B;  3ZW3 A;  3SV1 A;  3DPD A;  2N4F A;  4HLE A;  2JYT A;  1BTN A;  1AQC A;  2MCN B;  4W9C A;  1FNU A;  3AE8 B;  5IN7 A;  4HB4 B;  1LGR A;  4UDU C;  5J3T A;  2NMQ A;  1C78 A;  1SF0 A;  3RI7 C;  1ZGU B;  1NYR A;  1TS5 A;  2FDQ A;  4ZHO A;  2KMC A;  3IHP C;  1N5W A;  2XK5 A;  1C79 A;  2IYD B;  5J18 A;  3AE9 B;  2I5C A;  4W9H A;  4OHJ A;  2L1A A;  1KBL A;  2H7D A;  2WXQ A;  1Q10 A;  2KXJ A;  2CHZ A;  3ZXV A;  2MBH A;  3V62 A;  3NOB A;  2N0Y A;  3KH0 A;  1WMH B;  3AEC B;  1XT9 B;  3PSE B;  4RGO S;  1OQQ A;  3V6C B;  1EAZ A;  3ULC A;  2BS3 B;  2L3Z A;  5DPS A;  3GE3 C;  3W5V B;  3WIM A;  2BB6 A;  3APC A;  2W82 A;  4LDT B;  1FB8 A;  4MGI E;  1JW9 D;  5J2R A;  2K6Q A;  1T5X D;  3KLS X;  4RM9 A;  3RNF C;  2WXM A;  2BVC A;  2GOW A;  3MP9 A;  4OVU A;  1E8X A;  1KH0 A;  4HHV A;  4F1S A;  3VUX A;  2GS0 A;  2PE9 A;  4C56 C;  4A6F A;  3DBS A;  3K9O B;  1JQ4 A;  1YIW A;  3A98 B;  1GB1 A;  2KTF A;  3NG0 A;  2COP A;  2LHD A;  1IP9 A;  4JX1 C;  4A3O A;  3A4S C;  4KDI C;  2ZNV B;  3UF8 A;  3ODW A;  1WZ3 A;  1WM2 A;  1M7R A;  4NQK E;  3E66 A;  1PQS A;  1SJH D;  1JRO A;  1XOD A;  1D5Z C;  3FIL B;  2FUG 1;  2C5L C;  4WJO A;  2LUL A;  4W9G A;  5G55 A;  3VR8 B;  1NTI A;  2D3B A;  3P4R B;  4GB9 A;  3AB5 A;  2BB5 A;  2AL3 A;  3CSF A;  1FHW A;  2AWT A;  2HTH A;  1TTN A;  4XDC A;  2D10 A;  5E6O A;  5LXH A;  2EEL A;  2RMM A;  4I6P A;  1OQN A;  1E90 A;  2FBW B;  1ZSQ A;  1AAR A;  2K2J A;  2OJW A;  4LDT D;  4WAA A;  4NPN A;  3QIJ A;  3BVG A;  5D3W A;  2ELB A;  3T06 A;  4HAV B;  4NJC A;  5CLL B;  3TCA A;  2KUQ A;  1V9J A;  5BO4 B;  3L17 A;  1BWN A;  5HE3 A;  3FC4 A;  3R3M A;  2LD9 A;  5AZG A;  1MHH E;  2W3R A;  3KYD D;  2COA A;  3JSV B;  1XD3 B;  2K39 A;  1LXD A;  1J8C A;  1EVH A;  3JVZ X;  2YS5 A;  3JW0 X;  3I9V 1;  1PFJ A;  2DYO A;  1FGY A;  2YS3 A;  3T8M A;  2V0G A;  2DTC A;  5EE0 A;  4WJN A;  4A20 A;  4MK0 A;  2ICI A;  3V3X A;  4WH4 A;  1QOB A;  2K8B A;  4ZRI A;  4JKE A;  3BZD B;  2NPT B;  3P7Z A;  2Y5P A;  1VZ8 A;  2HDE A;  3OWE B;  4MY6 A;  2DZJ A;  3ZIM A;  4CHM A;  3TVV A;  1UZX B;  5TR5 A;  4GLS C;  3ENB A;  5T8I A;  1UWX A;  2KK8 A;  3L0W B;  1D5M C;  4JKG A;  3GYO A;  1WGK A;  4CYE A;  3PLU A;  3OJ3 A;  4P16 A;  2INP E;  4JKB A;  3QJZ A;  1V2Y A;  1MJD A;  3B77 A;  1C76 A;  4MJS A;  4PQ0 A;  2YF0 A;  2WXG A;  1JML A;  3GZN B;  4GSW A;  1HTQ A;  4KGR A;  2HTM E;  1UF0 A;  1QQG A;  3MJW A;  4IAP A;  3P1M A;  1WGQ A;  2MBB B;  5IOI A;  2J0M A;  2KQ4 X;  5J3Y A;  3PV1 A;  3SFE B;  1Y19 B;  3UQA A;  2ZEQ A;  1G6J A;  1E10 A;  3RCP A;  1VJK A;  4CHJ A;  2KDM A;  3LYY A;  1N62 A;  3NZU A;  2DEN B;  1SB3 C;  2LVO A;  4KDL B;  4RGM A;  3D8E A;  2LOZ A;  2W3S A;  4B0E A;  5FKA C;  3DHG C;  4ILH A;  4BBN C;  4FUL A;  2LOX A;  1Y56 A;  2KWC A;  2CU3 A;  5HI1 A;  3N30 A;  3UQB A;  2M38 A;  1PGA A;  3R2I A;  1FRD A;  3VRB B;  1WJ4 A;  1XLP A;  4L1B A;  3N3K B;  3NS8 A;  2KWD A;  4JIO U;  2WXH A;  1N63 A;  4RM8 A;  5HHD G;  1YJ1 A;  5C79 A;  4KHO A;  2FUH B;  2IGD A;  3H8H A;  3NWD A;  3L16 A;  2NZ8 B;  5GOW B;  3U52 E;  2K9X A;  2VZK B;  1IPG A;  3B2G A;  2O2V B;  1V5O A;  3VUW A;  3FAH A;  4MT7 A;  4XE0 A;  5DPR A;  1WGH A;  2NBW B;  4LLG M;  2DKP A;  4FN2 A;  1BUI C;  2COC A;  4W9J A;  1F52 A;  3TEZ A;  4JGH B;  3V6E B;  1TZO A;  2L0F A;  5JLJ B;  4ILG B;  2KTR B;  1DOX A;  3DXD A;  4CSQ A;  2WXK A;  2WXP A;  5H92 C;  2BWF A;  1WXV A;  3ZDM C;  2KVR A;  3AI5 A;  2UYZ B;  4BZA A;  2VH1 A;  4FJV B;  1ZKH A;  1EUV B;  4OVV A;  4MM3 B;  3RUI B;  1T3Q A;  2VSZ A;  2LVQ A;  3NZS A;  1ACC A;  2MWN B;  4EJN A;  5D3X A;  3NVY A;  1E7U A;  1ZXI A;  2LUM A;  4D6W A;  3MC9 A;  4F7U P;  3HUI A;  4DHZ B;  1FM0 D;  1J7A A;  4RF1 A;  2N0S B;  4WJ7 A;  5E6J A;  1MG4 A;  3PZ7 A;  1X1F A;  1EWY C;  3D8D A;  4M8M A;  3NSU A;  2QJL A;  4JKD A;  2Y8F A;  5C6R A;  2IGH A;  3FP5 A;  1C4C A;  3RPF C;  4KHA A;  5D3Y A;  1WI1 A;  1KI1 B;  2DHJ A;  3HW2 B;  4ICU A;  2CJN A;  2INN E;  2D3A A;  2JWU A;  2N1W A;  4GDK B;  5BMI A;  2I5F A;  3H9D A;  4S0R A;  3Q8E A;  5D3D A;  4C4V A;  2P0H A;  3PZD A;  2IYB A;  2LXA A;  1KOT A;  1F77 A;  1OTR B;  2D4Q A;  2KKC A;  1D4B A;  3RZW C;  3IFW B;  4PS8 A;  1KLG D;  5JZE B;  3U12 A;  1XQQ A;  1MI1 A;  1NVL A;  4KV2 A;  4X57 B;  1SGH A;  2L32 A;  2B3A A;  4AWJ A;  4HKZ E;  1NBF C;  2MKR A;  2KDB A;  1TKE A;  4LTU A;  2EJ8 A;  5BYS A;  2R2O A;  2A5U A;  3E9S A;  5DHF B;  3WYF B;  2DYB A;  1U27 A;  4NJ6 A;  2KD0 A;  3EEC A;  3TIX A;  4JKG B;  2M0A A;  4YXD B;  2FAZ A;  3V05 A;  4GN1 A;  3AEA B;  1UNQ A;  2CRF A;  1ZDV A;  2N1V A;  4M8N A;  5AUK A;  3DOW A;  4DDG D;  4ARC A;  1ROE A;  5M4Y B;  2R61 A;  4K7S A;  2CS4 A;  1TS2 A;  3M63 B;  1DGJ A;  1P6S A;  2Y5B B;  2MJD A;  4MEM A;  4HAT B;  3NHE B;  2J52 A;  4B0M A;  2BYF A;  4RFB A;  1QOG A;  2FIF A;  3SBG A;  1ZUD 2;  1AYF A;  1S3S G;  1XF5 L;  2WDQ B;  3D8F A;  2K5P A;  2YT1 A;  2REX A;  3R7R A;  2ZJD A;  2D5G A;  3TEX A;  1QZE A;  2KNB A;  1XCQ L;  2KAC A;  2PMV A;  3DVN V;  2COF A;  4IOY X;  1X1G A;  1YN4 A;  2MWS B;  3BK1 A;  2JZP A;  2C60 A;  2ON8 A;  2W2X C;  1I35 A;  3DVG Y;  1JWS D;  2A4Z A;  2KC1 A;  5L81 A;  3ALB A;  3CIK A;  2XBB C;  3FLV A;  2KGX B;  5C16 A;  4WJQ A;  1V81 A;  2VRR B;  4BBK A;  3KYC D;  4JK8 A;  2K2U A;  2KR0 A;  1SE9 A;  3FIL A;  3WAP A;  4DBG A;  4YSY B;  1WJM A;  1WWT A;  2L52 A;  2N9P C;  2BPS A;  3AED B;  5HE0 A;  4XWW A;  1TXD A;  1M4V A;  1HA5 A;  3KW5 B;  2IY0 B;  1GC7 A;  3BVM A;  5D3I B;  4A5K A;  2DLB A;  4IOI E;  3L54 A;  3EPY A;  2GBJ A;  1NI2 A;  4DX9 0;  4WAF A;  3SBT A;  4JE3 B;  3DCX A;  4N59 A;  2VKI A;  1M94 A;  2WU2 B;  2WXR A;  3SD5 A;  1UNR A;  4O1N A;  5FR3 A;  2W55 A;  1WJ1 A;  2Z14 A;  2BKF A;  3AE2 B;  5HE2 A;  1HTO A;  4M01 A;  3KWV A;  1LO5 D;  3SDL C;  4J3O D;  2AL6 A;  1U5D A;  1V88 A;  1HEZ E;  3MC8 A;  1P7E A;  1TKY A;  1KZ7 A;  3C19 A;  2AEH A;  3PTF C;  3P63 A;  2KN5 A;  5FK9 C;  3W1Y A;  1OEY A;  2J4X A;  2CB8 A;  2WDR B;  3AE4 B;  3GB1 A;  2GB1 A;  1LB1 A;  3ML4 A;  1UNS A;  4TQ0 A;  5C23 A;  2IDY A;  3Q3F A;  2RRF A;  4FLH A;  1B9R A;  2BT6 A;  4HCN B;  2M1M A;  3KQ4 A;  2FJL A;  3RNC C;  2FJ9 A;  3IBE A;  3ZNG C;  5E6N A;  3LJ3 A;  4ZYS A;  2XK5 B;  1UGJ A;  2MA9 B;  3PPA A;  3EA6 A;  4HK2 A;  3QC8 B;  1PFD A;  1CJE A;  4BKS D;  2YS1 A;  1XO3 A;  1FHO A;  3DBR B;  5JHA A;  2DX5 B;  1ZC4 B;  4XWT A;  2M17 A;  4WQO B;  4YSX B;  2GJY A;  4KZC A;  1GNU A;  3IT4 B;  1H10 A;  4ANW A;  1UNP A;  4XZ4 A;  3HVD A;  4AP4 C;  5I4D A;  2KN4 A;  1SXT A;  1L6V A;  4YT0 B;  2COD A;  1ST7 A;  1ACA A;  3BII D;  4JKH A;  2ZW0 A;  1MK7 B;  2K1F A;  1WRI A;  4WWO A;  3LDZ E;  1DDM A;  1MKE A;  2EMT A;  3CWI A;  5I2M A;  3AUL A;  2LYD A;  3NW8 A;  2N7J A;  2NPT A;  1EU4 A;  2L05 A;  3JSV A;  2BS2 B;  2IGG A;  4AJW A;  4EZJ A;  4YTM B;  1U5G A;  3TFM A;  5LG4 B;  3EGR A;  2D07 B;  2WGS A;  4JKF A;  1F2R C;  2Z59 A;  1OQR A;  1VCB A;  4M0W A;  3CIR B;  4FAD A;  4ANU A;  1FXI A;  1E0Z A;  1S1Q B;  3AH7 A;  2OJR A;  3RN9 C;  4PK1 A;  3QBV B;  2KTR A;  1I42 A;  1NYQ A;  2R82 A;  1L0Y B;  2BYE A;  2UWQ A;  1R4M I;  3MHZ A;  4IWP A;  2MP2 B;  3NZ3 A;  2LKO A;  4BBN F;  2KDE B;  3RFZ B;  3VUY A;  2KZR A;  2SAK A;  3GE8 C;  3L10 B;  3UI3 A;  1FFV A;  1FO4 A;  1SE2 A;  1B1Z A;  2BF8 B;  3P4P B;  2LRU A;  1TS3 A;  2RUK B;  2YEP F;  2PIA A;  1L5P A;  3N7C A;  3VH3 B;  5KCV A;  1YX5 B;  1SE3 A;  3IT6 B;  3AU5 A;  2BW2 A;  4LK0 M;  4NZL B;  2LGY A;  4FBJ B;  2WXJ A;  3TBL D;  5DCN A;  1I7H A;  5GMV A;  2MHJ A;  2N9E B;  3P6A A;  4Z2N A;  2HRJ A;  1QT9 A;  1UPR A;  4K2O A;  1RYJ A;  4URK A;  3D32 A;  1HZ6 A;  2M8S A;  1WYW B;  1FAO A;  3AXC A;  1H4R A;  3PVW A;  3P42 A;  4II3 B;  2JF5 A;  4ILJ A;  1ZVR A;  5C3J B;  3PSC A;  1AN8 A;  2Z13 A;  2JU6 X;  2NS5 A;  1YQ4 B;  2WNM A;  4YON A;  1I2H A;  5IAA C;  3U30 A;  1TZ1 A;  5IO9 A;  3IG3 A;  1RWS A;  4JKA A;  2IO0 B;  1WSP A;  3T9L A;  4EEW A;  4ZRK A;  3I57 A;  3R2T A;  4FHJ A;  4OW0 A;  4DDI D;  1U4A A;  5C2T B;  4C4V B;  2YVC A;  2GBK A;  2KUP A;  2PVG C;  4MSQ B;  2PW9 A;  1I4P A;  3CST A;  1WMH A;  4KIK A;  2LFI A;  4MAC A;  1WXA A;  1WFY A;  4F7Z A;  1XX0 A;  3PZ8 A;  2N7E A;  2R2Y A;  3VIA A;  2VRW B;  3PLV A;  1DYN A;  3Q69 A;  5C5B B;  4NQL B;  1V8C A;  1FXA A;  3HM3 A;  3PHX B;  4EZK A;  4OZB A;  1ESF A;  1V49 A;  1E8Y A;  3KUC B;  5KHO A;  2JRH A;  2CQU A;  2J0K A;  3A9J A;  4HDQ A;  1Q67 A;  2X38 A;  1QOA A;  3ETR A;  3VH4 B;  2DHZ A;  4DX8 A;  4I6L B;  3URY A;  3VRA B;  2FCN A;  2RSG A;  2W2X D;  1KTK A;  4JQW C;  3H1U A;  4D2K A;  3M62 B;  4KKI A;  3PO0 A;  4GZU A;  4XYC A;  3P2B A;  3PRP B;  3CF6 E;  3ECI A;  4GIV A;  5CHW A;  5DPW A;  2DIK A;  3KRX A;  4HJG E;  1ZXH A;  2DLW A;  4EOY A;  1VRA B;  3A9K A;  5AEK B;  2LGX A;  1C4P A;  2WWZ A;  2HD5 B;  2ZW1 A;  2IO3 B;  2E6X A;  4B95 A;  2NBU A;  4TSS A;  4BKS A;  5EDS A;  4GOC A;  4BVU C;  3A8P A;  4OT1 A;  1X05 A;  4K7U A;  1GAQ B;  2FE8 A;  3MTN B;  2QCZ A;  3HM6 X;  2DWQ A;  1CQV A;  3ZNI D;  4ANV A;  4US8 A;  2BTE A;  2Z4D A;  2BWE S;  1SSN A;  4M02 A;  3KUD B;  2L1C A;  3E56 A;  4AJY B;  4QJ3 B;  4EKU A;  1P3Q U;  4LJO B;  1NEN B;  2DZM A;  1J7C A;  3WAO A;  2W54 A;  2ZNV C;  3HHM A;  5HG2 A;  2OQB A;  1FCL A;  4C7Y A;  1XD4 A;  3BIN A;  2L0T A;  1WYG A;  2GBN A;  1SHC A;  2WXL A;  4DHJ D;  1YJJ A;  4AS1 A;  2V3N A;  1XKE A;  3NVW A;  1WE6 A;  4HWI B;  2FCS A;  2CY5 A;  2X18 A;  5EE1 A;  4FHK A;  2ADZ A;  4E74 A;  4NNJ B;  3MDB C;  3VQI A;  1WXQ A;  4A9A A;  2IJ0 A;  2KAJ A;  4TKN A;  4WUR A;  3DXC A;  3Q3N C;  1U2B A;  5I2S A;  3H7P B;  4KGS A;  3ZRC A;  5BYQ A;  5D94 A;  4EE2 A;  1L4D B;  2NTS A;  2DHI A;  4E71 A;  3RMK C;  5JH5 C;  4L1R A;  2ZCB A;  4MEL A;  3A9K B;  4JWU C;  5JHH A;  2IO1 B;  3LB8 C;  3N9Y C;  2ACZ B;  3L4P A;  3QHT A;  3R7Q A;  1BT0 A;  2R2Q A;  3I5J C;  2LGI A;  2PTL A;  4W9L A;  2ZZP B;  5AUI A;  4USA A;  2QIE B;  3NRZ A;  2WLB A;  4ASW C;  3TEW A;  4G50 A;  1WX7 A;  4CO7 A;  1PUT A;  2NMB A;  5FR6 A;  4OZC A;  4P1B C;  1OMW A;  4GMX B;  2D11 A;  3UGB B;  4K2P A;  1Y5O A;  1ET6 A;  4GNK B;  1T0Q C;  5J17 A;  3SUZ A;  4G3X B;  3KVF B;  3B2F A;  3B9J A;  1FXT B;  2CHW A;  3BYY B;  3EUB 2;  1SIJ A;  4JKC A;  1X11 A;  2J7Q B;  4PNK A;  2NBV A;  4IFS A;  1FIQ A;  2QMT A;  1CK1 A;  2M56 B;  2EKE C;  2N23 A;  2ZVO A;  1V89 A;  3HIE A;  1I4Q A;  5HE1 A;  4TYZ A;  3KY9 A;  1FNV A;  4JLC A;  2PPH A;  4MGK E;  3ML8 A;  3ZGZ A;  2YEP B;  2BGF A;  1CZP A;  2RDB C;  4JK9 A;  2HJ1 A;  1N60 A;  3T3O A;  3ODO A;  2M14 A;  2KDF B;  4ZRJ A;  1OQY A;  1V5T A;  2KFJ A;  2HE7 A;  3BWU D;  2WH5 A;  2PE6 B;  2G4D B;  3V60 A;  2J0J A;  3QQ8 B;  1WM3 A;  1MG8 A;  2ROZ B;  3OHM B;  4XX5 A;  1FRR A;  3W9C B;  3RNG C;  2HTH B;  2Z8L A;  3EHV A;  3AJ4 A;  2JXX A;  3ZJT A;  1DDV A;  4A55 A;  1GG3 A;  3I3T B;  4ANX A;  1DOI A;  2BYT A;  3Q8C A;  2LEK A;  1DRO A;  3PHW B;  2KX3 A;  4W9F A;  3SU8 X;  2CU1 A;  2RGN B;  3VR9 B;  1LM8 B;  1VD2 A;  3C0R B;  2KCJ A;  3Q3O C;  2D2Q A;  2V9H A;  2C7N B;  2CKH B;  1PMS A;  2HJ8 A;  2MRP A;  2QHO A;  4B6H A;  4HXD A;  4QJ4 B;  1BXT A;  4S17 A;  2KLG A;  4KX6 B;  1L6U A;  2WX0 A;  1V1P A;  1KZG A;  1CMX B;  2MBO A;  5G5H A;  4ICV A;  3DBR I;  4XC2 A;  4HVB A;  3NUH B;  2JXT A;  1ZW7 A;  4K1R B;  4YTN B;  3QWZ B;  3AEG B;  1XR0 B;  3QCA A;  3I63 C;  2BBC A;  4LNO A;  1V1P B;  1TJ6 A;  4MSM B;  4H8S A;  4LJP B;  1NTV A;  1NU2 A;  1EGX A;  3UIN B;  4DK5 A;  2O6V B;  2Y5C A;  3RD2 A;  3TMP B;  1MPH A;  4M00 A;  4Y94 A;  2LMC A;  2EKI A;  2JP2 A;  1MAI A;  1N61 A;  3HQC A;  2V4I B;  5G5G A;  2DYQ A;  4A6H A;  4AUQ C;  1WG7 A;  4IDI A;  3NJT A;  3MC0 B;  1N5X A;  4C7Z A;  1KF6 B;  1SBB B;  2DKQ A;  4HB3 B;  1C77 A;  5KQ1 A;  1I4R A;  3DXE A;  4W9K A;  5C1Z A;  1DOY A;  1U29 A;  2K49 A;  5CHV C;  1V6E A;  3AEF B;  2W2W A;  2L00 B;  2ZPN A;  5H8Y E;  2EMS A;  1T77 A;  5DHA B;  1E5W A;  1HBK A;  2KO3 A;  2MFQ A;  4K81 A;  2CAY A;  4DIX A;  2H89 B;  1BTK A;  2IO2 B;  2DAF A;  4OZA A;  4ZDV A;  2AQ3 B;  2MJE A;  1XLN A;  5IP4 D;  2FJU B;  2M19 A;  1EWC A;  1P7F A;  5L83 A;  4HDO A;  4TUU A;  1GOZ A;  3AE3 B;  3RNA C;  3RT3 B;  2IY1 B;  4IW0 A;  1TQZ A;  4J6I A;  3ZXR A;  1V5U A;  4KIK B;  2MQJ A;  2JY6 A;  1T6B X;  4K3C A;  1NTY A;  1PGB A;  2O6V D;  1L0V B;  2G9H D;  4EMO A;  4QXA B;  2QKL A;  2BYV E;  2PVO D;  3N32 A;  5CTR C;  2RSU A;  1IBX B;  1P0R A;  4A8X C;  3KUZ A;  1FPY A;  2WU5 B;  2K6D B;  2I2Y A;  1WGG A;  2KT7 A;  3DVN U;  2KQS A;  3DBL B;  2LBB A;  2C7M B;  3HVZ A;  4ZHP A;  4KZ0 A;  3FM8 C;  2I38 A;  2DYM A;  4WSF A;  2RLO A;  4IC7 B;  2Q5W D;  1TGZ B;  2B76 B;  1IUE A;  3KRW A;  4IWQ A;  1XLQ A;  5TSS A;  1RJ2 A;  2CHX A;  3DBH I;  4C0A A;  4LCD E;  4M0W B;  2E2X A;  2D3G A;  1R4M B;  1V86 A;  3JYU A;  4NAW B;  1ZPS A;  2LGD A;  3N20 C;  2LAS A;  2M0X A;  4WWN A;  3PRZ A;  3F5R A;  1XCT L;  1WXS A;  3M3J A;  1XCG A;  3VVW B;  1TY0 A;  1KRH A;  1KJT A;  1HE8 A;  3ZJU A;  4JL9 A;  4EUT A;  3W2D A;  1BML C;  3MHS D;  2KQ7 A;  1QIL A;  4RMA A;  1ISN A;  2JWZ A;  3BK2 A;  5JXV A;  3DQV A;  4WIP A;  3AE5 B;  5G2N A;  4DWF A;  3DWM A;  4LNI A;  2JQR B;  3CXB B;  2L8J A;  4A6F B;  3ZTC A;  2XN9 C;  2WDT B;  3AMZ A;  4LNF A;  4LNK A;  3F0W A;  2ZKM X;  1IBX A;  2Z0Q A;  2ONQ A;  4CHK A;  1WIA A;  3ZVR A;  1J0W A;  4G11 A;  4PYZ A;  3WAM A;  4GXB A;  4JWS C;  3FSS A;  1E7V A;  3K9P B;  4PYU A;  4RNA A;  2LXC A;  1WVH A;  3U7Z A;  1H8C A;  2MSE D;  3N1X C;  2NR2 A;  3L13 A;  3RZF A;  3W1S A;  3Q8B A;  2D9Z A;  2KFK A;  2Q13 A;  4G0N B;  3MJ5 A;  4NJ7 A;  2Z0D B;  5IJM A;  1TBE A;  4Z2M B;  3FKY A;  5LOP B;  3U2S C;  5HFY A;  3PVL A;  3VTU A;  3LXF A;  2GMI C;  2DAJ A;  3PEG A;  4DBB A;  3QK0 A;  4FJY A;  3TJP A;  1NEK B;  4MDK E;  4HPM B;  4MJS B;  1T0R C;  4HJK A;  2MLB A;  2MW5 A;  3VFK A;  1WR6 E;  4MT5 A;  1E9M A;  1JDE A;  1L2N A;  3DDC B;  2DX1 A;  4RGT A;  2ZCC A;  1A70 A;  2J42 A;  4NSW A;  4HB2 B;  3B1L X;  4N58 A;  3H6N A;  2IND C;  2DBY A;  1T0Y A;  2MBE A;  1DBH A;  4WWM A;  3A9J B;  1WE7 A;  2RPQ A;  3MPX A;  5J3Q A;  4ZRP A;  2R09 A;  4EZL A;  4WWP A;  2WX1 A;  4FXC A;  4MH0 E;  3AM9 A;  1HQR D;  1JWA D;  4OSN A;  1UWM A;  2KX0 A;  2N9K A;  3E9O A;  4ZYN A;  2ZVN A;  3OJ4 B;  1E7P B;  5LON B;  4RCO A;  4MGZ E;  4NY0 A;  3BJI A;  3Q3M C;  2Z0P A;  1WGD A;  2V3P A;  4RGN A;  1GB4 A;  2K8C A;  1VDV A;  4KAX B;  1F2R I;  4ZRQ A;  1RRB A;  2INC C;  1VZ6 A;  3ZLZ A;  3DHI C;  3X0W A;  1P5T A;  4W9E A;  1HZ5 A;  2WXF A;  1PGX A;  4BFR A;  1QKZ A;  5BMG A;  2L2I A;  1AWD A;  5D3V A;  5IKC M;  1OFF A;  2W9N A;  1W1H A;  3O96 A;  4HAW B;  2BS4 B;  2DNF A;  2KIG A;  2FCM A;  1LQB A;  1QF6 A;  2O2V A;  1OY2 A;  5CHF A;  1W1G A;  2J59 M;  3Q14 C;  2R0D A;  2K00 A;  3PP2 A;  3GZN I;  1UBI A;  2JRI B;  4US9 A;  2WXN A;  1A5R A;  2G3Q B;  2MDX A;  2TSS A;  3DWG C;  4RF0 A;  2JZ3 B;  2LZ6 A;  2XQN M;  3CMM B;  4F7H A;  2LJI A;  2KMA A;  1K53 A;  4KHB B;  1ZDX A;  2DZI A;  3AEB B;  2MP2 A;  4Q2J A;  3NY5 A;  1DIK A;  4P1C C;  4TV3 A;  2G45 B;  1E8Z A;  1V5P A;  3KZ1 A;  2LG1 A;  1MK9 B;  5D2M B;  1GGO A;  4IUM B;  2WXI A;  1U5E A;  1SEB D;  4GGQ A;  1GUA B;  4P6V F;  4HRS A;  2KLC A;  4IG7 B;  1FNW A;  4N9F 4;  3U7D A;  4IM2 A;  2OTX A;  1FGZ A;  4L6E A;  1E6E B;  1D5X C;  3BVZ A;  3O65 B;  1MPE A;  1WJ6 A;  1I4G A;  2OED A;  3M1I B;  3A8Q A;  5DPT A;  3UIP B;  4EFO A;  3TW1 A;  1Q5W B;  1HXY D;  4ZOH C;  4HRO A;  1JRP A;  3Q2A C;  3KSY A;  3SNH A;  2H7E A;  1I4H A;  3Q3J A;  3V61 A;  1W1D A;  2Y3A A;  2WQY B;  2RDG A;  2WHI A;  3MFG A;  3QA8 A;  3NWF A;  2L76 A;  1JWM D;  3AV8 A;  1QLB B;  4WVF B;  1Q0W B;  2C9W B;  3SO6 A;  1VBG A;  1FOE A;  1U5F A;  3A33 B;  3QX1 A;  3ZVV A;  3BYT B;  1ZC3 B;  2P0D A;  1QC6 A;  1F1H A;  3NVV A;  1WRD B;  3OAN A;  1K5D B;  3WAN A;  3B0A A;  4A90 A;  3VXW A;  1V61 A;  3ODX A;  3AN1 A;  1GPX A;  4PS3 A;  4L2Y A;  2YT0 A;  3DCG A;  1D6E C;  2C7H A;  1UEL A;  2K3U A;  1Y8R C;  5DH9 B;  2MEK A;  3ZDT A;  3AE7 B;  4BOS C;  2RQ1 A;  2LWP A;  3AE1 B;  2DN6 A;  1AWE A;  5C5B A;  1K5G B;  4XWX A;  1E8W A;  2AX5 A;  1TJE A;  1YJI A;  5EFX A;  1YNT E;  1V1O A;  5BYR A;  5JVL A;  2NVU I;  1J19 A;  4HAU B;  3O13 A;  4HPL B;  4MM3 A;  2GLS A;  3OLM D;  1YQB A;  3APF A;  2V3S A;  3UZT A;  1P98 A;  3IAS 1;  5L95 C;  1IGC A;  3A4R A;  4GPT B;  3N1Y C;  4WQM A;  1P3R A;  2YT2 A;  3A1Q B;  2ROV A;  4WJP A;  3VAW A;  4FA6 A;  5FI0 A;  2DHK A;  4KVG B;  3ENE A;  2RGF A;  1LW3 A;  2OOB B;  4KGT A;  1J0G A;  3APD A;  5E6P A;  1FD6 A;  2KOX A;  4MGY E;  1RRP B;  2BKR B;  1TS4 A;  2FCQ A;  1UH6 A;  2K0P A;  2FNJ B;  1FFU A;  2LI5 A;  1C9F A;  2QDF A;  1ZM0 A;  1UPQ A;  4F7G A;  4DXG A;  4RH6 A;  1WGU A;  1L4Z B;  2GRI A;  5D6J B;  2GCL A;  2MX2 A;  3TEY A;  4HSI A;  3AEE B;  1WXM A;  1WGY A;  2KHW B;  1VZ7 A;  3VOQ A;  2JZZ A;  3OG5 A;  3W1S C;  2PKO A;  1J7B A;  2GUM A;  3EC8 A;  1F9J A;  3ZTD A;  2WS3 B;  3W5U B;  1P9D U;  3DBL I;  2RNR B;  1K50 A;  2GCJ A;  2D9V A;  1MI0 A;  5CLQ B;  1V80 A;  2JT4 B;  4BOZ B;  2I1J A;  1WF9 A;  4HCP B;  5LXI B;  2P8V A;  1FEH A;  4C80 A;  3SR6 A;  3BY4 B;  4ARI A;  1EF1 A;  2Y7B A;  3FEH A;  2Z0O A;  1KFY B;  5DI9 B;  1XXG A;  2H88 B;  2QEJ C;  1UGM A;  3QAR A;  4C00 A;  4XDD A;  2UU7 A;  2YLM A;  2G4S A;  2LGS A;  2L83 A;  1I7A A;  1ZOY B;  2DZK A;  4I6N B;  3NS1 A;  1EF5 A;  1OGW A;  2QIL A;  2KAN A;  4IM3 A;  3S2A A;  2Z59 B;  3DBH B;  2WXO A;  2K25 A;  2JVC A;  2X8X X;  4YWG G;  4K7W A;  1YOV B;  5KQ4 A;  2KJR A;  2QKM A;  2CJO A;  2JPH A;  1UBQ A;  1WI0 A;  2Z0E B;  4DHJ B;  3ML9 A;  2UVM A;  1PLS A;  4IKG A;  2LJ5 A;  2QSD A;  4KHB A;  5GXG B;  3ZJV A;  2KWU B;  1VBH A;  5BMH A;  3HSA A;  2I1K A;  5JP4 A;  2KJH B; 
#chains in the Genus database with same CATH homology
 2V1Y A;  4FJZ A;  4IWO A;  3RCZ A;  5AZH A;  3RYT A;  1DDW A;  1P1A A;  2WYQ A;  4TQ1 A;  1JRU A;  2ELA A;  1Z2M A;  1MIX A;  2UZS A;  1NDD A;  4GDK A;  4GDL B;  4DHZ E;  1X1M A;  1X86 A;  3E9L A;  2KFK B;  4BKG A;  1UEF A;  4HAY B;  3IVF A;  4NAW A;  4E3C A;  3L08 A;  3ZRF A;  1KC7 A;  3AU4 A;  4HB0 B;  5CX3 A;  3QAQ A;  3SYX A;  1IYF A;  3VTW A;  1KLV A;  5HKH A;  2V4L A;  2RD0 A;  1GJZ A;  2LRW A;  1HB8 A;  1WH3 A;  2KWV B;  3HIZ A;  1HB6 A;  5IA7 A;  3QWM A;  3VTV A;  4B9K A;  1R4N I;  2EC1 A;  3PT2 B;  1M7E A;  4GU2 A;  2X0S A;  3G9W A;  1RAX A;  1C1Y B;  2KC2 A;  2P0F A;  4PS7 A;  3SHQ A;  2D9Y A;  3WA0 A;  2ASQ A;  2D9X A;  5D27 A;  2G35 A;  5FI1 A;  4A3P A;  2CR5 A;  2N7D A;  2LVP A;  2GBM A;  4A6K A;  3RUL A;  3TL5 A;  4D0N B;  1OEY J;  1BAK A;  1C3T A;  4GDL A;  4K17 A;  2DX5 A;  2MBQ A;  4IM0 A;  1Z5S B;  3PRE A;  3V5W A;  3X23 A;  3LJU X;  2DYN A;  2LUE A;  2GBR A;  2NCN A;  4JK7 A;  3HK0 A;  1FHX A;  4II2 B;  4YL8 A;  5JHB A;  4HAX B;  4F8C B;  3ZUN A;  2KJ6 A;  3DVG X;  2BCJ A;  1WGR A;  1WX9 A;  1SIF A;  3H7P A;  2CY4 A;  1WJN A;  3VDZ A;  1KM7 A;  1V5M A;  2IFS A;  2L7R A;  2YSZ A;  4HAZ B;  2V76 A;  4W9I A;  3H7S A;  3PGE A;  2AYO B;  1LFD A;  1K8R B;  1RLF A;  1WX8 A;  4KSK C;  2JUO A;  2FID A;  3ONS A;  1Q1O A;  5LLI A;  1YD8 U;  4B6W A;  1WJU A;  1MIZ B;  4GMV A;  4AOF A;  3U8Z A;  2YRY A;  3PRM B;  4W9D A;  2M4N A;  4BKT A;  3PVU A;  1EO6 A;  5D7G A;  1GC6 A;  1RFA A;  3WAL A;  2ZPY A;  3GYP A;  1D3Z A;  5JHG A;  3OAW A;  3E9P A;  2DA0 A;  2KDI A;  3R66 C;  3ZO5 B;  4P7I A;  2RVB B;  3VHT C;  2Y8G A;  2PJH A;  2ABD A;  3M95 A;  2O6V A;  3A1Q A;  2N9X A;  3PS6 A;  2D9W A;  1WZ0 A;  4KSL C;  1L7Y A;  3GOE A;  2DFK A;  1IRS A;  1WR1 A;  4DXA B;  5DIF B;  2UZR A;  2K8H A;  3ZNH B;  1B55 A;  1UD7 A;  2IBI B;  5KHQ A;  3ULB A;  3PG7 A;  1N3H A;  3ZNZ B;  3TO1 A;  1Z87 A;  5AZF A;  2NBV B;  2PZ1 A;  3ZKJ C;  3B08 A;  2PEA A;  2IZV B;  1WY8 A;  3EFU A;  2RR9 A;  3UIO B;  2XEW A;  1YX6 B;  3ZW3 A;  3SV1 A;  3DPD A;  2N4F A;  4HLE A;  1BTN A;  1AQC A;  2MCN B;  4W9C A;  4HB4 B;  5J3T A;  1ZGU B;  2FDQ A;  2KMC A;  3IHP C;  2XK5 A;  2IYD B;  5J18 A;  2I5C A;  4W9H A;  1KBL A;  2H7D A;  2KXJ A;  2CHZ A;  2MBH A;  3V62 A;  3NOB A;  2N0Y A;  3KH0 A;  1WMH B;  1XT9 B;  3PSE B;  3V6C B;  1EAZ A;  3ULC A;  2L3Z A;  5DPS A;  3WIM A;  3APC A;  4LDT B;  1FB8 A;  5J2R A;  4MGI E;  2K6Q A;  4RM9 A;  2GOW A;  4OVU A;  1E8X A;  4HHV A;  4F1S A;  3VUX A;  2GS0 A;  2PE9 A;  4A6F A;  3DBS A;  3K9O B;  1YIW A;  3A98 B;  2KTF A;  2COP A;  1IP9 A;  4A3O A;  3A4S C;  4KDI C;  2ZNV B;  3UF8 A;  3ODW A;  1WZ3 A;  1WM2 A;  1M7R A;  4NQK E;  3E66 A;  1PQS A;  1XOD A;  4WJO A;  2C5L C;  2LUL A;  4W9G A;  5G55 A;  1NTI A;  4GB9 A;  2AL3 A;  3CSF A;  1FHW A;  2AWT A;  2HTH A;  1TTN A;  2D10 A;  5E6O A;  5LXH A;  4I6P A;  1OQN A;  1E90 A;  1ZSQ A;  1AAR A;  2K2J A;  4LDT D;  4WAA A;  4NPN A;  3QIJ A;  5D3W A;  2ELB A;  3T06 A;  4HAV B;  5CLL B;  3TCA A;  1V9J A;  5BO4 B;  3L17 A;  1BWN A;  5HE3 A;  3R3M A;  2LD9 A;  5AZG A;  3KYD D;  2COA A;  3JSV B;  1XD3 B;  2K39 A;  1LXD A;  1J8C A;  1EVH A;  3JVZ X;  2YS5 A;  3JW0 X;  1PFJ A;  2DYO A;  1FGY A;  2YS3 A;  3T8M A;  2DTC A;  4WJN A;  4A20 A;  4MK0 A;  2K8B A;  4ZRI A;  4JKE A;  2NPT B;  3P7Z A;  4MY6 A;  2DZJ A;  3ZIM A;  4CHM A;  3TVV A;  1UZX B;  5TR5 A;  3ENB A;  2KK8 A;  3L0W B;  4JKG A;  3GYO A;  4CYE A;  3PLU A;  3OJ3 A;  4JKB A;  3QJZ A;  1V2Y A;  4MJS A;  4PQ0 A;  2YF0 A;  4GSW A;  1QQG A;  3MJW A;  4IAP A;  1WGQ A;  2MBB B;  2J0M A;  5J3Y A;  3PV1 A;  1Y19 B;  3UQA A;  2ZEQ A;  1G6J A;  3RCP A;  4CHJ A;  3NZU A;  2DEN B;  2LVO A;  4KDL B;  3D8E A;  2LOZ A;  4ILH A;  4BBN C;  4FUL A;  2LOX A;  2KWC A;  3N30 A;  3UQB A;  2M38 A;  1WJ4 A;  3N3K B;  3NS8 A;  4JIO U;  4RM8 A;  1YJ1 A;  5C79 A;  4KHO A;  2FUH B;  3L16 A;  2NZ8 B;  5GOW B;  1IPG A;  2O2V B;  1V5O A;  3VUW A;  4MT7 A;  5DPR A;  1WGH A;  2NBW B;  2DKP A;  4FN2 A;  2COC A;  4W9J A;  4JGH B;  3V6E B;  2L0F A;  5JLJ B;  4ILG B;  2KTR B;  3DXD A;  2BWF A;  1WXV A;  3ZDM C;  2KVR A;  3AI5 A;  2UYZ B;  4FJV B;  1ZKH A;  1EUV B;  4OVV A;  3RUI B;  2VSZ A;  2LVQ A;  3NZS A;  2MWN B;  4EJN A;  5D3X A;  1E7U A;  4F7U P;  4DHZ B;  4WJ7 A;  1X1F A;  3D8D A;  4M8M A;  3NSU A;  4JKD A;  2Y8F A;  5C6R A;  3FP5 A;  4KHA A;  5D3Y A;  1WI1 A;  1KI1 B;  2DHJ A;  3HW2 B;  4ICU A;  2N1W A;  4GDK B;  2I5F A;  3H9D A;  2P0H A;  3PZD A;  2IYB A;  2LXA A;  1KOT A;  1OTR B;  2D4Q A;  2KKC A;  3RZW C;  3IFW B;  4PS8 A;  5JZE B;  1XQQ A;  1NVL A;  4KV2 A;  4X57 B;  1SGH A;  2B3A A;  4AWJ A;  1NBF C;  2MKR A;  2KDB A;  2EJ8 A;  2R2O A;  2A5U A;  5DHF B;  3WYF B;  2DYB A;  1U27 A;  4NJ6 A;  2KD0 A;  3EEC A;  3TIX A;  4JKG B;  2FAZ A;  4GN1 A;  1UNQ A;  2CRF A;  2N1V A;  4M8N A;  3DOW A;  4DDG D;  4K7S A;  2CS4 A;  3M63 B;  1P6S A;  2Y5B B;  4MEM A;  4HAT B;  3NHE B;  2BYF A;  2FIF A;  3SBG A;  1S3S G;  3D8F A;  2REX A;  2YT1 A;  3R7R A;  2ZJD A;  1QZE A;  2KNB A;  3DVN V;  2COF A;  4IOY X;  1X1G A;  2MWS B;  2C60 A;  2W2X C;  1I35 A;  3DVG Y;  2A4Z A;  2KC1 A;  5L81 A;  3ALB A;  3CIK A;  2XBB C;  3FLV A;  2KGX B;  5C16 A;  4WJQ A;  1V81 A;  2VRR B;  4BBK A;  3KYC D;  4JK8 A;  2K2U A;  1SE9 A;  3WAP A;  4DBG A;  1WJM A;  2N9P C;  2BPS A;  5HE0 A;  1TXD A;  3KW5 B;  2IY0 B;  1GC7 A;  4A5K A;  3L54 A;  3EPY A;  2GBJ A;  1NI2 A;  4DX9 0;  3SBT A;  2VKI A;  1M94 A;  3SD5 A;  1UNR A;  1WJ1 A;  2BKF A;  5HE2 A;  3SDL C;  2AL6 A;  1U5D A;  1V88 A;  1KZ7 A;  2AEH A;  3PTF C;  3W1Y A;  2KN5 A;  1OEY A;  2CB8 A;  1LB1 A;  3ML4 A;  4TQ0 A;  5C23 A;  3Q3F A;  4FLH A;  4HCN B;  2M1M A;  2FJL A;  2FJ9 A;  3IBE A;  3ZNG C;  5E6N A;  3LJ3 A;  2XK5 B;  2MA9 B;  3PPA A;  4HK2 A;  3QC8 B;  4BKS D;  2YS1 A;  1FHO A;  5JHA A;  2DX5 B;  1ZC4 B;  2M17 A;  4WQO B;  2GJY A;  4KZC A;  1GNU A;  1H10 A;  4ANW A;  1UNP A;  4XZ4 A;  4AP4 C;  2COD A;  1ST7 A;  1ACA A;  4JKH A;  1MK7 B;  2K1F A;  4WWO A;  3LDZ E;  1DDM A;  1MKE A;  2EMT A;  3AUL A;  2LYD A;  4AJW A;  2NPT A;  3JSV A;  2L05 A;  4EZJ A;  1U5G A;  3TFM A;  2D07 B;  4JKF A;  1VCB A;  4FAD A;  4ANU A;  1S1Q B;  2OJR A;  3QBV B;  2KTR A;  1I42 A;  2R82 A;  2BYE A;  2UWQ A;  1R4M I;  4IWP A;  2MP2 B;  2LKO A;  4BBN F;  2KDE B;  3VUY A;  2KZR A;  3L10 B;  2BF8 B;  2LRU A;  2RUK B;  3N7C A;  3VH3 B;  5KCV A;  1YX5 B;  3AU5 A;  2LGY A;  4FBJ B;  3TBL D;  5DCN A;  5GMV A;  2N9E B;  3P6A A;  4Z2N A;  2HRJ A;  1UPR A;  4K2O A;  4URK A;  3D32 A;  1WYW B;  2M8S A;  1FAO A;  3AXC A;  1H4R A;  3PVW A;  4II3 B;  2JF5 A;  4ILJ A;  1ZVR A;  3PSC A;  2NS5 A;  4YON A;  1I2H A;  5IAA C;  3U30 A;  1TZ1 A;  3IG3 A;  4JKA A;  2IO0 B;  3T9L A;  4EEW A;  4ZRK A;  4FHJ A;  4DDI D;  1U4A A;  2YVC A;  2GBK A;  2KUP A;  4MSQ B;  3CST A;  1WMH A;  4KIK A;  1WXA A;  1WFY A;  4F7Z A;  1XX0 A;  2N7E A;  3VIA A;  2VRW B;  3PLV A;  1DYN A;  5C5B B;  4NQL B;  3HM3 A;  3PHX B;  4EZK A;  1V49 A;  1E8Y A;  3KUC B;  5KHO A;  2JRH A;  2CQU A;  2J0K A;  3A9J A;  4HDQ A;  1Q67 A;  3VH4 B;  2DHZ A;  4DX8 A;  4I6L B;  2FCN A;  2RSG A;  2W2X D;  4JQW C;  3H1U A;  3M62 B;  4GZU A;  3P2B A;  3PRP B;  3CF6 E;  3ECI A;  4GIV A;  5CHW A;  5DPW A;  2DIK A;  3KRX A;  2DLW A;  4EOY A;  3A9K A;  5AEK B;  2LGX A;  2WWZ A;  2HD5 B;  2IO3 B;  4B95 A;  2NBU A;  4BKS A;  5EDS A;  4GOC A;  4BVU C;  3A8P A;  1X05 A;  4K7U A;  3MTN B;  3HM6 X;  3ZNI D;  4ANV A;  2BWE S;  3KUD B;  2L1C A;  4AJY B;  4EKU A;  1P3Q U;  4LJO B;  2DZM A;  3WAO A;  2ZNV C;  3HHM A;  2OQB A;  1XD4 A;  3BIN A;  2L0T A;  2GBN A;  1SHC A;  4DHJ D;  1XKE A;  1WE6 A;  4HWI B;  2FCS A;  2CY5 A;  2X18 A;  4FHK A;  2ADZ A;  4E74 A;  4NNJ B;  3MDB C;  3VQI A;  4TKN A;  3DXC A;  1U2B A;  3H7P B;  3ZRC A;  5D94 A;  2DHI A;  4E71 A;  5JH5 C;  2ZCB A;  4MEL A;  3A9K B;  5JHH A;  2IO1 B;  3QHT A;  3R7Q A;  1BT0 A;  2R2Q A;  4W9L A;  2ZZP B;  4ASW C;  4G50 A;  1WX7 A;  4CO7 A;  2NMB A;  5FR6 A;  1OMW A;  4GMX B;  2D11 A;  3UGB B;  4K2P A;  1Y5O A;  5J17 A;  3SUZ A;  4G3X B;  3KVF B;  1FXT B;  2CHW A;  4JKC A;  1X11 A;  2J7Q B;  4PNK A;  4IFS A;  2EKE C;  2N23 A;  2ZVO A;  1V89 A;  5HE1 A;  4TYZ A;  3KY9 A;  4JLC A;  2PPH A;  4MGK E;  3ML8 A;  2BGF A;  4JK9 A;  3ODO A;  2M14 A;  2KDF B;  4ZRJ A;  1OQY A;  1V5T A;  2KFJ A;  2HE7 A;  2WH5 A;  2PE6 B;  2G4D B;  3V60 A;  2J0J A;  3QQ8 B;  1WM3 A;  1MG8 A;  2ROZ B;  4XX5 A;  2HTH B;  3EHV A;  3AJ4 A;  2JXX A;  1DDV A;  1GG3 A;  3I3T B;  4ANX A;  1DRO A;  3PHW B;  2KX3 A;  4W9F A;  3SU8 X;  2CU1 A;  2RGN B;  1LM8 B;  1VD2 A;  3C0R B;  2KCJ A;  2D2Q A;  2C7N B;  2CKH B;  1PMS A;  2HJ8 A;  2MRP A;  2QHO A;  4HXD A;  4B6H A;  2KLG A;  2WX0 A;  1KZG A;  1CMX B;  2MBO A;  4ICV A;  3DBR I;  4XC2 A;  4HVB A;  4K1R B;  1ZW7 A;  3QWZ B;  1XR0 B;  3QCA A;  1TJ6 A;  4MSM B;  4H8S A;  4LJP B;  1NTV A;  1NU2 A;  1EGX A;  3UIN B;  4DK5 A;  2O6V B;  3RD2 A;  3TMP B;  1MPH A;  4Y94 A;  2JP2 A;  1MAI A;  3HQC A;  2DYQ A;  4A6H A;  4AUQ C;  1WG7 A;  2DKQ A;  4HB3 B;  5KQ1 A;  3DXE A;  4W9K A;  5C1Z A;  1U29 A;  5CHV C;  1V6E A;  2W2W A;  2L00 B;  2ZPN A;  2EMS A;  5DHA B;  1E5W A;  1HBK A;  2MFQ A;  4K81 A;  2KO3 A;  2CAY A;  1BTK A;  2IO2 B;  2DAF A;  4ZDV A;  5L83 A;  4HDO A;  4TUU A;  3RT3 B;  2IY1 B;  4IW0 A;  1TQZ A;  4J6I A;  1V5U A;  4KIK B;  2MQJ A;  2JY6 A;  1NTY A;  2O6V D;  4EMO A;  2QKL A;  2BYV E;  3N32 A;  5CTR C;  2RSU A;  1P0R A;  3KUZ A;  2K6D B;  1WGG A;  3DVN U;  2KQS A;  2LBB A;  2C7M B;  4KZ0 A;  3FM8 C;  2DYM A;  4WSF A;  2RLO A;  4IC7 B;  1TGZ B;  3KRW A;  4IWQ A;  1RJ2 A;  2CHX A;  3DBH I;  4C0A A;  4LCD E;  4M0W B;  2E2X A;  2D3G A;  1V86 A;  3JYU A;  4NAW B;  2LGD A;  2LAS A;  2M0X A;  4WWN A;  3PRZ A;  3F5R A;  1WXS A;  3M3J A;  1XCG A;  3VVW B;  1KJT A;  1HE8 A;  4JL9 A;  4EUT A;  3MHS D;  2KQ7 A;  4RMA A;  1ISN A;  2JWZ A;  3DQV A;  5G2N A;  4DWF A;  3CXB B;  2L8J A;  4A6F B;  3ZTC A;  2WDT B;  3F0W A;  2Z0Q A;  4CHK A;  1WIA A;  3ZVR A;  1J0W A;  4G11 A;  4PYZ A;  3WAM A;  4GXB A;  3FSS A;  1E7V A;  3K9P B;  4PYU A;  2LXC A;  1WVH A;  1H8C A;  2MSE D;  2NR2 A;  3L13 A;  3RZF A;  3W1S A;  2D9Z A;  2KFK A;  2Q13 A;  4G0N B;  4NJ7 A;  2Z0D B;  5IJM A;  1TBE A;  4Z2M B;  5LOP B;  3PVL A;  3VTU A;  2GMI C;  2DAJ A;  3PEG A;  4DBB A;  3QK0 A;  4FJY A;  3TJP A;  4MDK E;  4HPM B;  4MJS B;  4HJK A;  2MLB A;  2MW5 A;  3VFK A;  1WR6 E;  1JDE A;  1L2N A;  3DDC B;  2DX1 A;  2ZCC A;  4NSW A;  4HB2 B;  3B1L X;  3H6N A;  1T0Y A;  2MBE A;  1DBH A;  3A9J B;  1WE7 A;  2RPQ A;  3MPX A;  5J3Q A;  2R09 A;  4EZL A;  4WWP A;  2WX1 A;  4MH0 E;  2KX0 A;  3E9O A;  4ZYN A;  2ZVN A;  3OJ4 B;  5LON B;  4MGZ E;  4NY0 A;  3BJI A;  2Z0P A;  1WGD A;  2K8C A;  4KAX B;  1RRB A;  3ZLZ A;  3X0W A;  1P5T A;  4W9E A;  4BFR A;  2L2I A;  5D3V A;  2W9N A;  1W1H A;  3O96 A;  4HAW B;  2FCM A;  1LQB A;  2O2V A;  1OY2 A;  5CHF A;  1W1G A;  2J59 M;  2R0D A;  2K00 A;  3PP2 A;  3GZN I;  1UBI A;  2JRI B;  1A5R A;  2G3Q B;  2MDX A;  2JZ3 B;  2LZ6 A;  2XQN M;  3CMM B;  4F7H A;  2KMA A;  4KHB B;  2DZI A;  2MP2 A;  3NY5 A;  1DIK A;  4TV3 A;  2G45 B;  1E8Z A;  1V5P A;  3KZ1 A;  2LG1 A;  1MK9 B;  5D2M B;  1GGO A;  4IUM B;  1U5E A;  4GGQ A;  1GUA B;  2KLC A;  4IG7 B;  4N9F 4;  3U7D A;  4IM2 A;  2OTX A;  1FGZ A;  4L6E A;  3O65 B;  1WJ6 A;  3M1I B;  3A8Q A;  5DPT A;  3UIP B;  4EFO A;  3TW1 A;  1Q5W B;  3KSY A;  3SNH A;  2H7E A;  3Q3J A;  3V61 A;  1W1D A;  3QA8 A;  2L76 A;  4WVF B;  1Q0W B;  2C9W B;  3SO6 A;  1VBG A;  1FOE A;  1U5F A;  3A33 B;  3QX1 A;  3ZVV A;  1ZC3 B;  2P0D A;  1QC6 A;  1WRD B;  3OAN A;  1K5D B;  3WAN A;  3B0A A;  3VXW A;  1V61 A;  3ODX A;  4PS3 A;  2YT0 A;  3DCG A;  2C7H A;  1UEL A;  1Y8R C;  5DH9 B;  3ZDT A;  4BOS C;  2RQ1 A;  2LWP A;  2DN6 A;  1AWE A;  5C5B A;  1K5G B;  4XWX A;  1E8W A;  5EFX A;  5JVL A;  2NVU I;  1J19 A;  4HAU B;  4HPL B;  4MM3 A;  3OLM D;  1YQB A;  3APF A;  2V3S A;  3UZT A;  1P98 A;  5L95 C;  3A4R A;  4GPT B;  1P3R A;  3A1Q B;  2ROV A;  3VAW A;  4WJP A;  4FA6 A;  5FI0 A;  2DHK A;  4KVG B;  3ENE A;  2RGF A;  1LW3 A;  2OOB B;  1J0G A;  3APD A;  5E6P A;  2KOX A;  4MGY E;  1RRP B;  2BKR B;  2FCQ A;  1UH6 A;  2FNJ B;  2LI5 A;  1ZM0 A;  1UPQ A;  4F7G A;  1WGU A;  5D6J B;  2GCL A;  2MX2 A;  1WXM A;  1WGY A;  2KHW B;  3VOQ A;  2JZZ A;  3W1S C;  3ZTD A;  3EC8 A;  1F9J A;  1P9D U;  3DBL I;  2RNR B;  2GCJ A;  2D9V A;  1V80 A;  5CLQ B;  2JT4 B;  4BOZ B;  2I1J A;  1WF9 A;  4HCP B;  5LXI B;  2P8V A;  3BY4 B;  1EF1 A;  2Y7B A;  3FEH A;  2Z0O A;  5DI9 B;  1UGM A;  3QAR A;  2YLM A;  2G4S A;  1I7A A;  2DZK A;  4I6N B;  1EF5 A;  1OGW A;  2KAN A;  4IM3 A;  3S2A A;  2Z59 B;  2K25 A;  2JVC A;  4K7W A;  5KQ4 A;  2KJR A;  2QKM A;  2JPH A;  1UBQ A;  1WI0 A;  2Z0E B;  4DHJ B;  3ML9 A;  2UVM A;  1PLS A;  2LJ5 A;  1VBH A;  2KWU B;  2I1K A;  5JP4 A;  2KJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...