1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords RADIXIN
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
4B6WA 2KJ6A 3UGBB 1V61A 3DXEA 1J19A 5J3TA 3PHXB 2M38A 4NJ7A 4BBNF 1SGHA 2LG1A 2DYOA 1Q67A 2IO2B 4RM9A 1WJMA 2DA0A 1NTYA 2PEAA 3ALBA 1EF1A 3FEHA 2WYQA 4IWOA 1KZ7A 1FAOA 2IO3B 1V80A 1X1FA 1J0GA 1UNRA 3VUXA 2EKEC 5DPRA 4AUQC 1E90A 4JIOU 3H7SA 2J0KA 4GDKB 2DZJA 2C5LC 2LVQA 1IRSA 3SNHA 5DPSA 3W1YA 3WAMA 3T8MA 5AZFA 4FADA 3ZNZB 2BWFA 1WZ0A 4B95A 3K9PB 3HW2B 1VCBA 2ZPNA 1M7EA 3ZIMA 3VHTC 4MEMA 2GCLA 1Z5SB 2DHZA 3KW5B 2UYZB 5G55A 5C5BA 1UZXB 2DYQA 3WANA 1XD3B 4I6NB 3VH4B 2L1CA 3VIAA 2W2XC 2D9YA 1DDMA 2K6DB 4GDLB 4K7UA 3TO1A 4NAWA 2KX3A 1WR1A 1WY8A 2LRUA 1Q0WB 1SHCA 3ZVRA 1OQYA 3GOEA 2KNBA 4GDKA 3V61A 1J8CA 3DCGA 4K2OA 3AU5A 1J0WA 2FCSA 4WVFB 3A98B 5JP4A 3NSUA 2C7HA 4E3CA 5LXIB 2P0FA 2YT1A 4MJSA 3RZWC 1SE9A 2K6QA 1YJ1A 2KX0A 2N7DA 4AJWA 5J3YA 2YRYA 4H8SA 1BT0A 2DZMA 3L16A 2N4FA 4KZ0A 1YD8U 1X05A 4MELA 4GN1A 3VFKA 2MSED 4KSLC 4BFRA 2KXJA 1DDVA 1OEYA 2LXCA 3AI5A 3DVGY 3GZNI 3R66C 1T0YA 2CU1A 3DBRI 1QC6A 2M14A 1ACAA 1ISNA 5D3VA 1P9DU 4G50A 1H4RA 2COAA 4A5KA 1K8RB 5JHGA 3C0RB 2LI5A 2RLOA 2MBOA 4KVGB 3PRZA 1WJ6A 1WZ3A 4K1RB 4LJOB 2MDXA 4IG7B 4B9KA 4BVUC 5AEKB 3K9OB 4ANWA 3EC8A 3UZTA 1WX9A 3A9JA 4PS8A 3QK0A 3BINA 4GZUA 2HJ8A 2FCQA 2MBQA 4XWXA 1TBEA 3PRMB 4IAPA 1U2BA 4WAAA 4WJNA 3H9DA 3V5WA 1H8CA 3MTNB 2O6VD 1LW3A 3CXBB 3DVNU 4K7SA 1I42A 2KK8A 1ST7A 2CODA 3QIJA 2MRPA 3VTUA 3P2BA 3UIOB 2CS4A 3DXDA 2ZZPB 4HLEA 2HRJA 1X1GA 4G3XB 1Q1OA 2MBEA 4W9EA 4BKTA 3OLMD 3R7QA 3PLUA 1OMWA 2CY5A 1YIWA 2I5FA 1Z2MA 1WIAA 1WGHA 4CHMA 5DIFB 1EUVB 1WX7A 1FHOA 1YX6B 4II2B 4IWPA 1V9JA 5CTRC 3OANA 1E7VA 1EVHA 4HDOA 3L17A 4MGIE 3HQCA 2C60A 2OOBB 2ASQA 1MAIA 2BF8B 2K39A 2KFKA 3LJ3A 2GBRA 3F5RA 3U8ZA 1NTVA 4ZRIA 1XX0A 2LKOA 4YL8A 2COCA 3X23A 2KCJA 1Q5WB 4WWPA 2FJLA 3PG7A 1V5OA 1WF9A 3DBHI 2CY4A 3NZSA 2D07B 3L0WB 4NNJB 3TBLD 3APDA 1U27A 3HM6X 2O2VA 2KMCA 4JLCA 1K5DB 2DAFA 1AQCA 3ZNID 2N9PC 4E74A 3TIXA 2RSGA 1V2YA 1ZW7A 4W9IA 1ZM0A 5D3YA 5C16A 1F9JA 3IG3A 1V5TA 3MJWA 3WAPA 4AWJA 2J0MA 4PNKA 2AWTA 2DX1A 5DI9B 5J2RA 3IFWB 4IM0A 2ZVOA 1RFAA 3SD5A 1DROA 3RT3B 1C1YB 2C7MB 3HIZA 3V62A 4HAXB 5HE3A 4DDGD 5HKHA 2MWSB 3DVNV 4KHBB 3ML9A 2ELAA 3UIPB 2KDEB 1NI2A 3NOBA 3M95A 1WI0A 2EMSA 3SHQA 3AJ4A 1ZVRA 2R2QA 1KI1B 3VQIA 2PJHA 2ZPYA 1FB8A 5FR6A 1YQBA 4NQLB 2CKHB 2D9XA 1NTIA 2N23A 3NZUA 1UNPA 1E8YA 2Q13A 3B08A 2KHWB 2YS1A 4DDID 3TVVA 4E71A 2MQJA 1KZGA 3JW0X 2FIDA 1I35A 1U29A 3VAWA 4OVVA 2IYDB 2BPSA 3APCA 4ZYNA 3ZO5B 2W2WA 1P3QU 2COPA 1FGYA 4CHJA 3A4SC 1M7RA 2CHWA 2KLGA 3QHTA 2LBBA 3ML8A 2V76A 4MSMB 2DYBA 4HXDA 3ZW3A 4HB3B 1A5RA 1I7AA 2Y5BB 4MSQB 2Z0DB 2L05A 5LOPB 2GBKA 1MIXA 3AULA 4GPTB 3VOQA 2ZVNA 2J59M 3RCPA 2ZJDA 4FJVB 3P6AA 2V1YA 3FP5A 2LOZA 3D8EA 1UBIA 3ONSA 1WGUA 4HWIB 5DPTA 4IC7B 3ZDMC 3OJ3A 3FLVA 5J18A 1WGGA 2QHOA 4NJ6A 4XZ4A 3RCZA 3VUWA 3EHVA 2NBVB 3A8QA 1FXTB 3VUYA 5E6OA 2L0FA 1JRUA 3CSTA 3DXCA 2LULA 1M94A 4X57B 2Y8FA 5LLIA 2JZ3B 4ICVA 1H10A 3F0WA 4MJSB 4F7HA 2JZZA 2LUEA 2L7RA 2MP2A 2MW5A 3ECIA 1BAKA 3X0WA 3ZKJC 1L2NA 3ZRCA 2K8HA 1OTRB 2KANA 2KLCA 3JYUA 2YF0A 3Q3FA 1GC7A 2KJHB 2LGYA 1XQQA 3EPYA 2AYOB 4W9JA 1E8XA 4W9DA 4KZCA 3PREA 4HDQA 2ZCCA 3KUCB 2C7NB 4TQ0A 1HE8A 3PZDA 2DHJA 2ZNVC 4W9CA 1MKEA 2RVBB 5JH5C 3KUDB 4FA6A 3D8FA 4GOCA 2KN5A 1KJTA 3DOWA 5C79A 4HAYB 1GNUA 3RYTA 2JF5A 1WJ1A 4J6IA 2WDTB 4ANVA 5CHWA 5G2NA 3RUIB 2OJRA 1SIFA 3QX1A 5D7GA 3ULBA 5KHQA 1C3TA 2ROZB 1KM7A 1UBQA 3ODXA 2D9VA 2REXA 4I6PA 3SDLC 1XCGA 1UEFA 2HTHA 2M8SA 4GXBA 2JPHA 3NY5A 4HPLB 5DCNA 2JUOA 2I1KA 5FI1A 4Y94A 2DLWA 2LVOA 2NVUI 2DYMA 3A4RA 2L2IA 3H7PB 5AZGA 2DAJA 1TJ6A 1EO6A 5HE0A 2D9WA 2HTHB 4A20A 5IAAC 4WWOA 2KMAA 2D4QA 1X1MA 2XEWA 1U5DA 2K8CA 1ZKHA 4KHAA 1TTNA 2XK5A 3MHSD 1BTKA 4C0AA 1WXMA 3ODOA 1MK7B 3SUZA 4IM3A 2VRRB 4WWNA 2C9WB 1WGYA 4I6LB 5TR5A 3W1SA 3D32A 2K2UA 3L13A 3KH0A 3AXCA 3PVLA 3ZTCA 2JWZA 4WJPA 3QBVB 4HVBA 3CIKA 3WA0A 2X18A 1WFYA 1DBHA 2KJRA 2LZ6A 4W9KA 3WIMA 4Z2NA 1G6JA 2V3SA 3HM3A 4YONA 1ZSQA 2JP2A 3DDCB 1RAXA 4MM3A 3AU4A 1X11A 1PQSA 2BKRB 2G3QB 2MP2B 3A9KA 5IJMA 3QCAA 4II3B 3VTWA 5JZEB 2DKPA 1WE6A 2D10A 2OQBA 2DENB 2KTRB 2KC1A 2NCNA 3DPDA 4LCDE 4A3PA 1MIZB 2R09A 4G0NB 2LVPA 4BOZB 3NHEB 5D27A 3TL5A 4EJNA 2P8VA 4WJ7A 5J3QA 1V88A 2L3ZA 2XK5B 2ZEQA 2H7DA 5JHHA 4TUUA 2EJ8A 3SYXA 4XC2A 3IHPC 1WMHA 4NY0A 3VXWA 2BCJA 4BKSD 4GB9A 2LWPA 2KFJA 1WXVA 3PRPB 3PHWB 4JGHB 2NR2A 2MCNB 3PVUA 1V5MA 5JLJB 2JT4B 2K8BA 2YLMA 3A1QB 4MH0E 4PYZA 2N1WA 4TV3A 3ZNHB 2LOXA 3KVFB 3KRXA 3PS6A 1WM2A 5DHAB 2Z0EB 1U4AA 2KWCA 3DBLI 3M63B 4HCNB 4EZKA 2KZRA 1WX8A 2ABDA 3I3TB 1WGDA 3T9LA 2L0TA 2L8JA 2GS0A 4DX8A 2MBBB 3OAWA 5E6PA 4PS7A 4K2PA 5D94A 1Y19B 1VD2A 2AL6A 3KUZA 1V86A 2AL3A 1NVLA 2DYNA 1E8WA 5L95C 2BGFA 2Y7BA 5CLQB 2KTRA 2RQ1A 2P0DA 2WX0A 4EUTA 1XD4A 3LJUX 2EC1A 2KD0A 4MY6A 5J17A 5JHAA 1P3RA 4WQOB 3M3JA 3QA8A 2DN6A 2G4SA 2GCJA 2ZNVB 3OJ4B 2QKMA 2MFQA 1IPGA 5DH9B 3O65B 4IOYX 3EFUA 4FULA 2MWNB 2QKLA 1E5WA 1UNQA 3ULCA 2R0DA 3ODWA 2KQSA 4A6FA 2KWVB 2W2XD 3QWMA 1V6EA 2D3GA 1ZC3B 2IYBA 2LGXA 3LDZE 4FN2A 4G11A 4CO7A 4NSWA 1FGZA 3KSYA 4KAXB 4KDLB 4TQ1A 1L7YA 5D2MB 2GBNA 4ICUA 3ZDTA 3CF6E 1I2HA 2B3AA 4F7UP 1GJZA 1K5GB 4IUMB 3MPXA 1XODA 4HAZB 2KDIA 3QC8B 3GYPA 4EMOA 4CHKA 1V5PA 1UD7A 3PPAA 4K17A 2CAYA 1V81A 4HCPB 4JQWC 4M8NA 3U30A 2Z59B 3H7PA 4BOSC 2IO0B 3PT2B 2DHIA 3A8PA 4EOYA 2IY1B 2AEHA 5CX3A 3V6CB 2D2QA 1WRDB 3CSFA 1PMSA 3M1IB 1UGMA 2RSUA 4KHOA 3B1LX 4AOFA 1E8ZA 4KIKB 5LONB 2BYFA 3JSVA 4IWQA 4EKUA 5EFXA 1S1QB 4MGZE 2LYDA 4HAUB 4GU2A 4PS3A 1ZC4B 3P7ZA 2YVCA 2NS5A 3JSVB 5D3WA 3RZFA 2VRWB 1NU2A 5KQ4A 4M0WB 3BY4B 3H6NA 3KY9A 2YSZA 4K81A 2RGNB 2DTCA 4HAVB 1Y5OA 2MX2A 2RUKB 4DBGA 4F7ZA 2GBMA 3ENEA 3WALA 1P0RA 1IYFA 5FI0A 2CB8A 2N1VA 2FAZA 3KRWA 3QARA 2N9EB 3ML4A 3IBEA 2ELBA 2CRFA 3PLVA 5C6RA 2YT0A 2GJYA 2J7QB 3WAOA 4LDTD 3QWZB 5CHVC 1WH3A 3S2AA 5C5BB 1FHWA 3R3MA 3T06A 1PFJA 3UINB 3PTFC 2K00A 1WJUA 4B6HA 1WM3A 4RM8A 1RJ2A 2I5CA 3QQ8B 1WYWB 1EGXA 4TYZA 5CLLB 2NBUA 4W9LA 5KHOA 3L10B 1MK9B 2LXAA 4W9FA 4DXAB 2HD5B 2KGXB 3V6EB 3N7CA 1W1HA 3A9JB 5EDSA 1EAZA 2H7EA 1OY2A 3ZRFA 4K7WA 3SU8X 2UVMA 2PE9A 2Y8GA 3G9WA 3UQAA 3KYCD 2YS3A 2BWES 1WJ4A 1WXSA 2O2VB 4EZJA 2RD0A 3PSEB 1LXDA 2FUHB 2L76A 1V5UA 5HE1A 4DHJB 2JXXA 3V60A 4ASWC 1D3ZA 3N3KB 2PPHA 4FHJA 1V89A 1UELA 2G4DB 2LD9A 1OEYJ 2KFKB 2NBWB 4DWFA 2R2OA 4DX90 2KDFB 2JRHA 2RR9A 2I1JA 2K25A 3U7DA 3N32A 2RPQA 2DX5A 2DKQA 2CHXA 3N30A 3TCAA 3PV1A 2A5UA 2LJ5A 2GOWA 1WR6E 3TFMA 2RGFA 2DZKA 3A1QA 2NPTA 4PQ0A 4HJKA 2Z0OA 2PZ1A 1CMXB 2WX1A 4GGQA 4IW0A 3CMMB 3UF8A 1WMHB 2MA9B 2WWZA 4XX5A 4NAWB 2E2XA 3VVWB 2FCNA 4F1SA 1GC6A 1KLVA 2KDBA 5L83A 3H1UA 2W9NA 4F8CB 3KZ1A 3Q3JA 2M0XA 3DBSA 4MDKE 5C1ZA 2D11A 4M8MA 1OGWA 4GMXB 3SV1A 4A6FB 2L00B 2VSZA 4HB2B 4OVUA 2IZVB 1NDDA 4WJOA 3UQBA 4WSFA 1P5TA 1WVHA 1P1AA 2JRIB 2V4LA 3JVZX 4LJPB 3VH3B 1LFDA 2DX5B 3WYFB 2CHZA 2MBHA 1TGZB 4FHKA 4RMAA 1B55A 2WH5A 4CYEA 1XR0B 1X86A 3TW1A 1V49A 2XBBC 2DHKA 4BKSA 2FDQA 1RRBA 2O6VB 5L81A 1BTNA 4W9GA 1AWEA 4HHVA 4HK2A 4GSWA 2UZRA 2HE7A 2FIFA 2ROVA 1WG7A 3ZLZA 3L08A 4DHZE 2KC2A 1UPQA 2YS5A 2N0YA 5CHFA 3ZTDA 1Z87A 2VKIA 4DBBA 1P98A 2G45B 4FJZA 5GOWB 1U5GA 5HE2A 1HB8A 2XQNM 5GMVA 2NMBA 4P7IA 1N3HA 2MLBA 3HHMA 4EEWA 1WGRA 2OTXA 4EFOA 1DDWA 2IO1B 4FBJB 2BYEA 3HK0A 3TJPA 2D9ZA 4HB0B 3NS8A 4EZLA 2BYVE 3EECA 4KV2A 1PLSA 2KOXA 4AJYB 4ANUA 4BBNC 1R4MI 5D6JB 1NBFC 1FOEA 3PSCA 4AP4C 4Z2MB 2LRWA 2CQUA 1RRPB 3GYOA 1WXAA 3FM8C 4MT7A 2FJ9A 1ZGUB 3PVWA 1S3SG 3M62B 3ZNGC 5DPWA 1U5EA 2G35A 1E7UA 2A4ZA 3A9KB 2J0JA 2K2JA 4L6EA 4MGYE 1TZ1A 1WE7A 1W1DA 4IFSA 4GMVA 4HAWB 2Z0QA 2KO3A 4FJYA 2KKCA 4BKGA 1WGQA 3W1SC 4DHZB 2M17A 3TMPB 2RNRB 2KVRA 1P6SA 1XT9B 2KQ7A 2MKRA 3BJIA 5KCVA 5BO4B 2NZ8B 4WJQA 4N9F4 4DK5A 2IBIB 1QQGA 4HPMB 2KTFA 2CR5A 4LDTB 2BKFA 1BWNA 5LXHA 4IM2A 2M4NA 4ZRKA 2FNJB 1WI1A 2ZCBA 1XKEA 2O6VA 3ZUNA 1QZEA 2N9XA 2PE6B 3MDBC 3L54A 4A6KA 3PGEA 3A33B 4KIKA 4ZRJA 2ADZA 3DVGX 2LGDA 1MPHA 3D8DA 2JVCA 4D0NB 3VTVA 2P0HA 4F7GA 3FSSA 4HB4B 4MK0A 1RLFA 2M1MA 3APFA 3VDZA 4A3OA 2KUPA 3QAQA 4JL9A 1UPRA 2IFSA 2N7EA 1GG3A 1HB6A 1LB1A 4BBKA 1U5FA 2GBJA 4HATB 4GDLA 1TQZA 5KQ1A 1R4NI 3KYDD 3QJZA 1UH6A 3O96A 2JY6A 3RULA 2UWQA 1GUAB 1IP9A 1W1GA 4DHJD 3PEGA 1FHXA 2LASA 2FCMA 2IY0B 5D3XA 1LQBA 1HBKA 5JHBA 4URKA 2UZSA 4ZDVA 1WJNA 1OQNA 3B0AA 2K1FA 2DZIA 1Y8RC 5C23A 2EMTA 4NPNA 1LM8B 1EF5A 2COFA 3R7RA 3SO6A 2NPTB 1TXDA 1MG8A 4NQKE 4MGKE 1DYNA 2DFKA 4FLHA 5E6NA 3IVFA 3ZVVA 5IA7A 4PYUA 3PP2A 4TKNA 4KSKC 4KDIC 3RD2A 4ANXA 4A6HA 3DQVA 2Z0PA 4W9HA 1KOTA 4GIVA 2GMIC 5AZHA 2KWUB 5DHFB 1AARA 1YX5B
chains in the Genus database with same CATH superfamily
4IDIA 1ZUD2 1Q67A 2JSVX 1WRIA 1ZP0B 3ALBA 1EF1A 2WYQA 4IWOA 1KZ7A 1FAOA 1SJHD 2IO3B 2JWUA 1E90A 2MJ3A 2J0KA 2DZJA 4J3OD 2C5LC 2LVQA 3W1YA 2Z14A 3ZNZB 3HW2B 2DHZA 3RNAC 4JKBA 1UZXB 2DYQA 4I6NB 2L1CA 5LXHA 4NAWA 1D5MC 2KX3A 3AE2B 1WR1A 2WXFA 3ZVRA 1OQYA 1VR9A 3A98B 5C2TB 5LXIB 3L4PA 2MH7A 3HIEA 2BW2A 4OSNA 3VFKA 3L16A 4KZ0A 1YD8U 4KSLC 5DPRA 2R2YA 2PVGC 3GZNI 3R66C 1P9DU 1H4RA 1K8RB 5JHGA 2LFIA 3PRZA 2MBOA 4HVBA 1JCKB 2INCC 3P1MA 1TYGB 1WX9A 2K0PA 2HJ8A 4XWXA 1TBEA 1M4VA 2KK8A 1ST7A 4K3BA 3QIJA 3DXDA 3C8YA 2GUMA 1Q1OA 2MBEA 1ROEA 1ZOYB 2N0SB 4EE2A 3Q69A 1V9JA 3OANA 1FXIA 2PMVA 2K39A 3ETRA 1ZPSA 3NVYA 4ZRIA 1XX0A 1TS5A 3PG7A 4NAMA 1U27A 2BS2B 2O2VA 4ACFA 1K5DB 1YNTE 2J42A 1EU3A 4W9IA 1N5WA 1ZM0A 2E6XA 2J0MA 4PNKA 5J2RA 1C77A 2ZVOA 1RFAA 3RT3B 2KVZA 3EUB2 3HIZA 3V62A 2MWSB 2MJEA 1NI2A 4ZRPA 1D5ZC 5IRSA 3I63C 1FB8A 3NWAA 1NTIA 1EU4A 2MQJA 3JW0X 4YSXB 2OEDA 5TSSA 1P3QU 2COPA 1M7RA 2CHWA 3QHTA 2LBBA 2V76A 4MSMB 2DYBA 1TS4A 2BTEA 1PGXA 1N62A 1FNUA 3AULA 4GPTB 1FRRA 2RMMA 3VOQA 2ZVNA 1TIFA 1XLQA 1TS3A 2LOZA 5DPTA 1WGUA 1GOZA 3OJ3A 5J18A 1WGGA 4PK1A 3RCZA 1CQVA 2KR0A 2L0FA 4X57B 3DXCA 1H10A 4MJSB 1L0VB 2J4XA 2MP2A 1L2NA 3ZRCA 1E9MA 3AEEB 1GC7A 1E6EB 2KJHB 1XQQA 4KZCA 3PREA 4HDQA 3KUCB 4JK8A 2C7NB 2QJLA 2K9XA 2KN5A 1KJTA 1GNUA 1RM6C 2WDQB 3RYTA 2WDTB 1C3TA 1UBQA 1N5XA 1XCGA 1UEFA 2HTHA 4HPLB 3NY5A 4JKEA 2NVUI 2L32A 2JU6X 3NVVA 3T3NA 3BZDB 1U5DA 3D32A 3NJTA 1VZ8A 3NG0A 3PO0A 4WJPA 2LZ6A 2WHIA 4W9KA 1G6JA 2HTME 4YONA 2JP2A 4US9A 1K51A 1ZXHA 1X11A 4II3B 2BKRB 2D10A 2DENB 2IGGA 2KTRB 2NCNA 2JQRB 4G0NB 5D27A 1A5RA 5G55A 2XK5B 2ZEQA 1WSPA 4NY0A 2Y5PA 4IKGA 4C4VA 1NYQA 2M0AA 5JLJB 4PYZA 2N1WA 1NI3A 4YXDB 2LOXA 5I4DA 3B77A 3T9LA 2L0TA 1VDVA 2PTLA 4DX8A 2MBBB 4PS7A 3SFDB 4P6VF 1VD2A 1L4DB 1NVLA 2DYNA 2Y7BA 4JKCA 2Q5WD 3MFGA 1HQRD 2WX0A 3LJUX 5JHAA 1P3RA 2G4SA 3O65B 4NJCA 4FULA 4YT0B 2QKLA 1UNQA 3ULCA 3VRAB 2KQSA 3QWMA 2D3GA 2LGXA 4CO7A 4NSWA 5D2MB 1L7YA 2GBNA 2B3AA 4HAZB 2KDIA 2Z8LA 3Q8FA 4WIPA 1V81A 4C7YA 3BK2A 4AQ7A 3V6CB 4US8A 1MG4A 3GE3C 4OZBA 4KIKB 4JKGA 4IWQA 4EKUA 5EFXA 1AW7A 2QILA 4MGZE 4PS3A 3GB1A 3RZFA 4C00A 5D3WA 1QILA 2VRWB 4ZHOA 2Z13A 4M0WB 2DTCA 4AS1A 4HAVB 1Y5OA 2RUKB 4ILGB 1IYFA 4CSQA 2N9EB 2KN4A 5C6RA 2KIEA 2QSDA 2ICIA 4YTMB 3RFZB 1I4GA 1WH3A 1WJUA 4RM8A 1EGXA 5CLLB 1J7BA 3A9JB 1EAZA 3W5VB 2R82A 4JK7A 2YS3A 3KYCD 1V97A 2O2VB 4JPSA 5EE3A 3NVZA 3PSEB 2L76A 4FHJA 1V89A 2G4DB 2LD9A 1QKZA 2KDFB 3KWLA 2RR9A 2I1JA 2QEJC 2K8EA 2DX5A 2RPQA 1FMAD 1WR6E 3A1QA 4JWUC 4D6WA 4GGQA 1WMHB 4XX5A 2FCNA 2W9NA 4MDKE 5C1ZA 3TEXA 4GMXB 3SV1A 2L00B 2QDFA 3DBRB 1PYWD 2K3UA 4OW0A 3UQBA 3HUIA 1LFDA 2MBHA 1ZXIA 1FIQA 3I5JC 1B55A 4CYEA 1RRBA 3DHIC 4W9GA 4HHVA 2UZRA 2JYEA 2FIFA 2WLBA 3NVWA 4HPPA 5HHDG 1DOIA 3IAS1 1RWSA 5AUIA 5H8YE 1Z87A 4DBBA 4LTUA 1U5GA 5GMVA 2XQNM 3LXFA 4P7IA 3LB8C 4O1NA 1WGRA 1UUPA 2QMTA 4FBJB 2D9ZA 2BYVE 4AJYB 2MJDA 5D6JB 5LG4B 4AP4C 4Z2MB 2JZPA 2LRWA 3N1YC 2H88B 3N1XC 1W1DA 4HAWB 2FBWB 2Z0QA 1R4NB 3NZ3A 1VRAB 3W1SC 2M17A 1XT9B 3BJIA 1RFKA 4WJQA 2PIAA 2GB1A 1JDEA 4REZA 3OWEB 2BKFA 1V1PA 1ACCA 4HROA 3N9YC 3ZUNA 2O6VA 3MDBC 1YJIA 4A6KA 3PGEA 2LGDA 3D8DA 4D0NB 3VTVA 2P0HA 4F7GA 2KUPA 3QAQA 4JL9A 2IFSA 1F77A 1GG3A 4GDLA 3KYDD 5D3IB 3O96A 5EE9A 1IP9A 3DHGC 2LASA 4XGAB 1LQBA 3WCQA 2UZSA 1WJNA 1Y8RC 5C23A 1LM8B 2NPTB 1TXDA 5HI1A 4ZOHC 2EKIA 1DYNA 2DFKA 3IVFA 4PYUA 3PP2A 4KSKC 1L4ZB 4A6HA 1KOTA 5DHFB 2WXJA 3N20C 3J9CA 1SGHA 2LG1A 2IO2B 2PEAA 4KGSA 1X1FA 1UNRA 4AUQC 3K9PB 1SXTA 4MEMA 1Z5SB 2UYZB 1XLOA 3VIAA 1DDMA 1TZOA 2K6DB 3TO1A 3OG5A 3MHZA 3ZGZA 1J8CA 1ENFA 2WU5B 1DOXA 4M0WA 4WVFB 4M00A 4WWMA 4YWGG 4AJWA 3RZWC 2K6QA 1YJ1A 1BUIC 4MACA 4H8SA 3OHMB 4RGOS 1X05A 1I4RA 4ZHPA 2MSED 1OEYA 4GNKB 3DVGY 4HRSA 1T0YA 4HWIB 1QC6A 4G50A 1ACAA 4DIXA 4A5KA 3R7RA 4OVZA 2BB5A 1JWAD 2MDXA 5AEKB 1ESFA 2WXMA 3A9JA 3AEFB 1FCLA 4GZUA 3TJPA 2FCQA 2UU7A 1BMLC 1U2BA 1OQRA 1H8CA 3UI3A 1D4BA 4KGTA 3VTUA 2ZZPB 3R7QA 3PLUA 4ILJA 2I38A 4OVVA 1WIAA 1WX7A 4CHMA 2J52A 4II2B 2L52A 3NRZA 3L17A 2SAKA 3HQCA 2C60A 2ASQA 1MAIA 2BF8B 2KFKA 2Y3AA 2GBRA 3U8ZA 1NTVA 1Q5WB 3APDA 3HM6X 1FFVA 1RYJA 2JYTA 5C16A 1V5TA 4A8XC 2AWTA 2DX1A 5DI9B 3IFWB 3E9LA 1C1YB 5HKHA 1YN4A 5HE3A 3DVNV 1L6VA 4KHBB 2ELAA 3UIPB 2KDEB 3NOBA 1SBBB 3M95A 1WI0A 2EMSA 3U2SC 2R2QA 1ZVRA 1L0YB 1DYQA 4C7ZA 2V3NA 1YQBA 4NQLB 2D9XA 2KHWB 2YS1A 1AWDA 4H2AA 3VAWA 1YN5A 3APCA 1PGBA 4ARIA 1FGYA 4CHJA 4HB3B 1I7AA 4MSQB 2WXRA 1UWXA 2ZJDA 3P6AA 1HZ5A 4IC7B 3ZDMC 4OZCA 4C80A 4GLSC 2QHOA 3VUWA 3KQ4A 3NW8A 2V9HA 1VBHA 3A8QA 3CSTA 1M94A 4RH6A 2Y8FA 2JZ3B 3F0WA 4XWTA 4RGMA 2LHDA 2LUEA 2M56B 3ECIA 1BAKA 1JW9D 2TSSA 2K8HA 1OTRB 2KANA 2KLCA 5I2SA 3R2TA 4RGNA 2LGYA 2AYOB 1ZDVA 4PT5A 4QJ5B 1WGKA 1MKEA 1F0ZA 3ABVB 3D8FA 1I7HA 1IGCA 1WJ1A 1FCCC 4J6IA 1PGAA 3RUIB 2OJRA 1SIFA 5KHQA 2ROZB 1KM7A 3B2GA 3ODXA 3SDLC 4LNOA 2M8SA 2JPHA 2JUOA 2DLWA 2DYMA 2E3TA 2L2IA 3H7PB 2DAJA 4KX6B 4RCOA 5IAAC 2KMAA 2D4QA 1ZDXA 4C0AA 3ODOA 1MK7B 3SUZA 1WGYA 3L13A 3IAM1 3KH0A 2VH2A 3ZTCA 2OHFA 3ZJUA 2DBYA 3RNGC 5IP4D 4N58A 2MP2B 5IJMA 1WE6A 1UGJA 4XDDA 2KC1A 4LCDE 1MIZB 2R09A 2BS4B 1GB1A 2P8VA 3UQAA 3FVCA 1C79A 2IDYA 5JHHA 3EGRA 1WMHA 3VXWA 3Q2AC 4GB9A 2LWPA 4HJGE 1WXVA 3PRPB 3PHWB 2K8BA 1YN3A 4HKQA 3KVFB 2XN9C 4WQMA 2Z0EB 3AEDB 1U4AA 4EZKA 1OFFA 2BVCA 3M63B 2KZRA 4CQNA 1WX8A 2ABDA 3I3TB 1WGDA 3I9V1 4KKIA 5M4YB 3OAWA 3RNEC 3ZYYX 2BGFA 5E6JA 2KTRA 3DHHC 2RQ1A 3FC4A 5J17A 2ZNVB 2QKMA 5DH9B 3ZJTA 2MWNB 2WXLA 3ODWA 1XO3A 2KWVB 4A6FA 3N32A 3KSYA 4TQ1A 1SB3C 3Q3MC 4ICUA 4M02A 3CF6E 4F7UP 1K5GB 4IUMB 3MPXA 3QC8B 4EMOA 2K49A 4RFBA 3PPAA 1FFUA 4K17A 2Z59B 2IO0B 2DHIA 3A8PA 2FE8A 2IY1B 5CX3A 2D2QA 1K52A 3Q8BA 4QAYA 3M1IB 2WQYB 2INDC 2LYDA 4HAUB 4GU2A 1ZC4B 1T5XD 3JSVB 2RRFA 5KQ4A 2KUQA 2YSZA 2Z4DA 4K81A 2AX5A 1JWUD 3GS2A 2MX2A 3TSSA 4DBGA 3PZ7A 2GBMA 3AE7B 3ENEA 1JALA 2FAZA 1WXQA 3ML4A 2CRFA 4WAFA 1FHWA 1PFJA 1V1OA 4B6HA 2NBVA 1RJ2A 2I5CA 3P4PB 4W9LA 4LNKA 5KHOA 1QOFA 1FO4A 4DXAB 2HD5B 2KGXB 2LGSA 1HA5A 2UVMA 2PE9A 2Y8GA 1WXSA 2WS3B 1F2RC 3MC0B 1V5UA 4L2YA 4S0RA 3TEWA 1TJEA 3N3KB 2PPHA 3CWIA 2JXTA 3AE1B 4QXAB 1MHXA 1JWSD 3V3XA 2KWDA 1I4QA 3U7DA 2DKQA 2CHXA 3PV1A 3TCAA 3AEAB 3TFMA 1SF0A 2DZKA 2YEPB 2NPTA 3Q14C 2Z0OA 2WX1A 3HVZA 4IW0A 3UF8A 3VVWB 2V4IB 4XE0A 1GC6A 3CIRB 3H1UA 3MC9A 1KLUD 1R7SA 3Q6BA 2JRIB 1L6UA 3VH3B 5JVLA 1MHHE 3WYFB 1FEHA 1TGZB 1XR0B 3TW1A 1X86A 4BKSA 1JWMD 1F52A 2FDQA 5L81A 1BTNA 2W82A 5BYSA 1AWEA 5H92C 2KC2A 4HKZE 2DLBA 3AN1A 1SEBD 2YS5A 3ZTDA 4FJZA 5FKAC 2PLPA 4EFOA 1DDWA 2IO1B 3AMZA 2BYEA 3HK0A 3AB5A 2R61A 4KV2A 1KLGD 2KOXA 2KT7A 1FOEA 3ZNGC 2WXKA 5DPWA 3PVWA 1S3SG 5G5GA 1E7UA 2A4ZA 3A9KB 2K2JA 1TZ1A 3U4EG 4GMVA 4BKGA 4DHZB 1WGQA 2KVRA 5BO4B 1P6SA 2H89B 1L5PA 1LGRA 5KCVA 1VLBA 4HPMB 1D6EC 4IM2A 1WI1A 5MPOA 2PE6B 1NVID 2KYWA 2WXQA 3L54A 4KIKA 3A33B 1B9RA 1C76A 1JROA 3KWVA 1MPHA 2JVCA 1RLFA 4A3OA 2G9HD 1UPRA 1LB1A 4BBKA 1MFWA 2D3BA 2GBJA 3RULA 2UWQA 1GUAB 1KRHA 1NEKB 3DWGC 3EFCA 2IY0B 4URKA 1HTQA 4MM3B 4A90A 4XYCA 3SO6A 3TUOA 1QQRA 3BIID 2KAJA 5E6NA 5IA7A 3MP9A 1P7FA 4KDIC 3DQVA 4W9HA 2Z0PA 2KWUB 2LXAA 4B6WA 2KJ6A 5J3TA 3Q8EA 4NJ7A 2DYOA 1KFYB 4RM9A 1WJMA 2DA0A 1NTYA 1EWCA 3O13A 4R3DA 1V80A 4JIOU 3H7SA 3WAMA 1IRSA 3T8MA 4FADA 3AE6B 2BWFA 1VCBA 1XCQL 1M7EA 3BVGA 3ZIMA 2GCLA 3AECB 4P1CC 1XD3B 1GPXA 1Y56A 2D9YA 2EELA 4K7UA 5IO9A 1WY8A 1Q0WB 4GDKA 2YT2A 3A58A 1DGJA 2FCSA 2WXHA 5JP4A 1SJED 2LJIA 3NSUA 4E3CA 1N61A 2WNMA 1TKGA 2YT1A 4MJSA 2KX0A 3E9SA 2WXGA 1NYRA 4ARCA 1HZ6A 4MELA 2D5GA 4BFRA 2KXJA 3Q8AA 3AI5A 2CU1A 2M14A 5D3VA 1ISNA 2DWQA 4YSZB 5FK9C 2RLOA 3FILA 1WJ6A 4LJOB 4BVUC 4IG7B 2I2YA 3K9OB 4ANWA 2IJ0A 1IUEA 3BINA 4WAAA 2MBQA 1TT5B 4WJNA 3EA6A 3MTNB 3CXBB 4K7SA 1I42A 3UIOB 2CS4A 1MVKA 3BVMA 3URYA 5C3JB 2HRJA 1X1GA 3IXSA 1QOGA 4W9EA 4BKTA 3MC8A 1QOBA 2CY5A 1YIWA 2I5FA 1Z2MA 3L08A 1WGHA 1EUVB 4JX1C 3AH7A 5CTRC 1EVHA 3AM9A 1C4AA 2OOBB 1V8CA 1OQQA 1UF0A 3GZNB 4WWPA 1V5OA 3DBHI 4NNJB 2D07B 3TBLD 4A3PA 4JLCA 1AQCA 4ZYSA 2W54A 3TIXA 1ZW7A 1V2YA 4L1RA 5D3YA 1F9JA 3IG3A 3MJWA 3V05A 4C4VB 4QJ3B 3AE5B 4IM0A 4YTPB 2W55A 4HAXB 4OT1A 5LNK1 2HJ1A 2X8XX 3E66A 3AJ4A 2PVOD 2ZPYA 4LNNA 2CKHB 2N23A 3NZUA 1UNPA 1E8YA 4RGTA 3B08A 4E71A 1FNWA 4DDID 1HEZE 5FR3A 1C4CA 3P4SB 2BPSA 4ZYNA 3A4SC 3NWFA 3ENBA 2KLGA 1E0ZA 2RDGA 3ZW3A 2HDEA 1KBLA 4A55A 2L05A 5LOPB 2GBKA 2IGDA 2V1YA 3FP5A 3D8EA 1UBIA 3ONSA 5HFYA 3BYYB 4XZ4A 3VUYA 2NBVB 4XWWA 1JRUA 5LLIA 1I4PA 2LMCA 4ICVA 2BS3B 4K3CA 4F7HA 2MW5A 3X0WA 2L7RA 3ZKJC 3RPFC 3JYUA 2FUG1 3SFEB 4HEA1 4W9DA 4RNAA 3EPYA 2ZCCA 1VZ6A 4W9CA 3PZDA 5JH5C 3KUDB 4D2KA 5HG2A 3BK1A 5C79A 4HAYB 4JKFA 3BYTB 1KF6B 1I4XA 3QX1A 2D9VA 4YSYB 1SSNA 2I1KA 5FI1A 4Y94A 1MJDA 1TJ6A 1C78A 2D9WA 4JK9A 4A20A 1SE4A 1N6ZA 1X1MA 2XEWA 1TY0A 3AE3B 1ZKHA 4KHAA 1TTNA 1V1PB 2XK5A 4IM3A 1BTKA 4Q2JA 5TR5A 2C9WB 4I6LB 2WGSA 1T77A 4YTNB 3PVLA 2JWZA 3CIKA 2KJRA 1WFYA 1DBHA 3WIMA 3W5UB 2V3SA 3HSAA 1J7CA 1ZSQA 3DDCB 1RAXA 4MM3A 3AU4A 2WXIA 3VTWA 1GB4A 2DKPA 3DPDA 2OQBA 4WH4A 2LVPA 4BOZB 3NHEB 4ZRQA 2WXOA 4JKGB 4EZLA 4WJ7A 1V88A 1XEEA 2H7DA 2EJ8A 5BMIA 4BKSD 2KFJA 5AUKA 3PVUA 1V5MA 2YLMA 4TV3A 4MH0E 2Y5CA 3VR9B 1WM2A 2KWCA 3FAHA 2V0GA 5D3DA 4JKDA 1T0QC 2L8JA 2GS0A 2L83A 2J53A 5E6PA 3W1SA 4K2PA 5D94A 2AL3A 5L95C 4OHJA 2G1EA 2K5PA 1PUTA 4IOIE 1XD4A 2KD0A 4N59A 4WQOB 3M3JA 1FD6A 2GCJA 4DXFA 3OJ4B 3H8HA 3EFUA 2R0DA 2W2XD 1YOVB 1V6EA 1ZC3B 2IYBA 3LDZE 4KAXB 4KDLB 4MT5A 3SBTA 1XODA 3GYPA 4CHKA 2BQQA 3U12A 4JQWC 2CAYA 3H7PA 3GE8C 2RDHA 2BBCA 3PT2B 1T6BX 4EOYA 2AEHA 1WRDB 3FILB 3CSFA 1PMSA 1XCTL 4KHOA 5LONB 3JSVA 3R8BA 3SEBA 2NS5A 2YVCA 1NU2A 4M01A 3BY4B 2WDRB 2ZKMX 3KY9A 2WXPA 1LO5D 2RGNB 1VZ7A 3NS1A 1HTOA 1SIJA 1P0RA 5FI0A 2CB8A 2N1VA 3QARA 4L1BA 2ELBA 3PLVA 2YT0A 2PW9A 4JE3B 4LDTD 2INPE 5C5BB 1CK1A 2K00A 1WM3A 2ZW0A 3N7CA 4JKAA 5EDSA 1OY2A 2B76B 4K7WA 3ZRFA 1VBGA 2NMQA 3G9WA 4UDUC 2BWES 1WJ4A 4EZJA 2RD0A 2FUHB 5HE1A 4DHJB 1OEYJ 2LHEA 4DWFA 2R2OA 4DX90 3VR8B 2KDMA 2K25A 4B9KA 3N30A 4TMAB 2LJ5A 2GOWA 2RGFA 4HJKA 1C4PA 1T0RC 2PZ1A 1CMXB 1IGDA 3AE4B 1T0SC 2E2XA 3P4QB 4F1SA 1KLVA 2KDBA 5L83A 4F8CB 2M0XA 1GAQB 2D11A 2QCZA 1OGWA 4HB2B 3RNBC 1NDDA 4WJOA 2PKOA 2GRIA 4WSFA 1QT9A 1P5TA 1P1AA 5IKCM 3JVZX 4LJPB 1ET9A 2DX5B 3U7ZA 2CHZA 4FHKA 4RMAA 2WH5A 1V49A 1CJEA 2DHKA 3C19A 1FRDA 3W9CB 2HE7A 4DHZE 1WG7A 1UPQA 3W2DA 1P7EA 1TY2A 2N0YA 5CHFA 2VKIA 2G45B 2IPKD 5HE2A 2CJNA 2LUMA 2Z59A 1FM0D 2MLBA 3HHMA 4EEWA 2OTXA 4TSSA 4HB0B 2ONQA 2WDVB 5BYQA 1YJJA 4ANUA 1R4MI 2BT6A 1NBFC 2CQUA 1RRPB 3GYOA 3FM8C 2FJ9A 1ZGUB 1U5EA 2G35A 2K22A 2J0JA 4MGYE 1CZPA 1WE7A 1F1HA 2KO3A 4FJYA 3E9OA 2MKRA 3TEZA 1HXYD 1QQGA 1TKEA 2KTFA 2NTTA 4LDTB 5T8IA 2M4NA 4ZRKA 2FNJB 2ZCBA 1XKEA 1QZEA 2N9XA 4ZRJA 2VZKD 2M1MA 3U52E 4HB4B 4F7ZA 5BMGA 4HATB 1TQZA 5KQ1A 1JRPA 1R4NI 2DIKA 4C56C 1W1GA 1FHXA 1HBKA 1VJKA 1XF5L 4ZDVA 1OQNA 3B0AA 2K1FA 2DZIA 3FKYA 5G5HA 1N63A 1R4MB 1EF5A 2COFA 4NQKE 1MG8A 3RD2A 1AN8A 4LNFA 4P16A 4GIVA 2GMIC 5AZHA 1AARA 1YX5B 3AE9B 2ZW1A 3UGBB 4BBNF 1V61A 3DXEA 1J19A 3RN9C 3PHXB 2M38A 4FXCA 4RF0A 1E10A 4KGRA 3FEHA 1J0GA 3VUXA 2EKEC 3ZQ4A 2W3RA 4GDKB 5DPSA 3SNHA 4ILHA 5AZFA 1WZ0A 4B95A 2ZPNA 3VHTC 3KW5B 3BWUD 5C5BA 3WANA 3VH4B 4GDLB 4LLGM 2W2XC 4LK0M 1SE2A 2LRUA 3GOEA 1SHCA 4HSIA 1YMHE 2ACZB 2KNBA 3V61A 3DCGA 1KH0A 2QIEB 4K2OA 3AU5A 1J0WA 3ZXRA 2C7HA 2P0FA 1SE9A 2N7DA 5J3YA 2YRYA 1BT0A 2DZMA 2KQ4X 2AQ3B 2N4FA 4GN1A 1DDVA 2LXCA 2RDBC 3DBRI 2COAA 3C0RB 4WWOA 2LI5A 4K1RB 4KVGB 1WZ3A 1QF6A 3RMKC 3P42A 5BMHA 3AEBB 3Q3NC 1STEA 3EC8A 3UZTA 2X38A 4PS8A 3QK0A 2X0SA 3PRMB 4IAPA 2V3PA 3H9DA 3V5WA 3ZJVA 3IT6B 2O6VD 1LW3A 3DVNU 3T3OA 2CODA 2MRPA 3P2BA 4BAXA 4DQOC 4HLEA 5JXVA 4G3XB 1MPEA 2FJUB 3OLMD 1OMWA 1YX6B 5DIFB 3ZVVA 4IWPA 1FHOA 1ET6A 4KHBA 1E7VA 2WU2B 4HDOA 4MGIE 1FXAA 3LJ3A 5IN7A 3F5RA 2LKOA 4YL8A 2COCA 3X23A 2KCJA 2FJLA 1WF9A 3MJ5A 2CY4A 3NZSA 3L0WB 2KMCA 2DAFA 2CJOA 3ZNID 2N9PC 4E74A 2RSGA 3SBGA 4JKHA 3WAPA 4AWJA 4A9AA 1EWYC 3SD5A 1DROA 2C7MB 4DDGD 1MI0A 3ML9A 3HVDA 3SHQA 1QLBB 1KI1B 3VQIA 2PJHA 4N6EB 5FR6A 2Q13A 2VZKB 4P1BC 3TVVA 1KZGA 2FIDA 1C9FA 1U29A 1I35A 3TEYA 2IYDB 3ZO5B 2W2WA 2SEBD 3ML8A 4HXDA 2Y5BB 3NUHB 2Z0DB 3B2FA 3IT4B 4MH8A 3AE8B 3Q3OC 1MIXA 2J59M 3LYYA 3RCPA 4FJVB 2W3SA 1ZYIA 4WURA 3FLVA 4NJ6A 3EHVA 3P63A 1FXTB 5E6OA 1K53A 1WWTA 2LULA 1L0XB 2JZZA 3Q3FA 2D3AA 2BYTA 2YF0A 4W9JA 1E8XA 4TQ0A 1HE8A 2DHJA 2ZNVC 4XDCA 2RVBB 4FA6A 4GOCA 5IOIA 3DOWA 2JF5A 4ANVA 5CHWA 3GP7A 5G2NA 5D7GA 3ULBA 2REXA 4I6PA 5DCNA 4GXBA 3E56A 2WXNA 2LVOA 3A4RA 5AZGA 1EO6A 5HE0A 2HTHB 5EE0A 2K8CA 3MHSD 1WXMA 4WWNA 2JX5A 2VRRB 1GGOA 2K2UA 3AXCA 2QC8A 3AV8A 3QBVB 5JZEB 2X18A 3WA0A 4Z2NA 3HM3A 1JWBD 1PQSA 5I2MA 2G3QB 3A9KA 3QCAA 3TL5A 4EJNA 5J3QA 2L3ZA 2LEKA 1F2RI 4XC2A 4TUUA 3SYXA 3B9JA 3IHPC 1JQ4A 2BCJA 2DNFA 2MCNB 2NR2A 2JT4B 3A1QB 3ZNHB 3KRXA 2KMMA 2ON8A 3PS6A 5DHAB 3DBLI 4HCNB 4A6QA 1ZE3D 1Y19B 2AL6A 3KUZA 1V86A 1E8WA 1SE3A 5CLQB 5GXGB 2KIGA 2P0DA 1Q10A 4EUTA 2EC1A 3AEGB 4MY6A 1T3QA 3QA8A 2DN6A 1IBXB 2MFQA 1IPGA 1K50A 4IOYX 2LGIA 1E5WA 2N9KA 4FN2A 4G11A 1FGZA 4NZLB 4B0EA 3ZDTA 1I2HA 1GJZA 1JMLA 3P4RB 1V5PA 1UD7A 4HCPB 4M8NA 3U30A 4BOSC 1KTKA 1UGMA 1BXTA 2RSUA 3B1LX 4AOFA 1E8ZA 1FNVA 2BYFA 1WYGA 1S1QB 1UWMA 2L1AA 3P7ZA 1XLNA 3DBHB 3H6NA 2BB6A 1D5XC 3WALA 2INNE 3KRWA 3IBEA 2GJYA 2GLSA 2J7QB 3WAOA 3QWZB 5CHVC 3S2AA 3R3MA 3T06A 3UINB 3PTFC 3QQ8B 1WYWB 4TYZA 2NBUA 3VRBB 3L10B 1MK9B 4W9FA 3SR6A 3V6EB 3DCXA 4ITKA 1W1HA 3RNCC 3DWMA 2H7EA 3SU8X 4LNIA 2N9LA 3E9PA 1LXDA 2JXXA 3V60A 4ASWC 2XNAC 3RI7C 1D3ZA 1FPYA 1UELA 2KFKB 2NBWB 2AQ2B 5BYRA 1I4HA 2JRHA 3RNFC 2YEPF 2A5UA 1DOYA 3N1ZC 4PQ0A 3NWDA 3CMMB 2MA9B 4RF1A 2WWZA 3BVZA 4NAWB 1PFDA 3I57A 4JWSC 3KZ1A 3Q3JA 2AQ1B 3DBSA 4M8MA 4A6FB 2WP9B 2VSZA 4OVUA 2IZVB 2MEKA 1WVHA 2V4LA 1IBXA 2IGHA 1KC7A 2XBBC 1B1ZA 4GOUA 4USAA 2O6VB 4DXGA 3ZXVA 4HK2A 4GSWA 2RPVA 2ROVA 3ZLZA 4S17A 3KLSX 1YQ4B 1P98A 2CU3A 1PDXA 5GOWB 5EE1A 1HB8A 1QOAA 1XLPA 2NMBA 1N3HA 1EM7A 1UNSA 3Q8CA 3NS8A 3EECA 1PLSA 4BBNC 3PSCA 2OJWA 1WXAA 4MT7A 3R2IA 3M62B 2NTSA 4L6EA 3PZ8A 1N60A 4IFSA 1AYFA 2KKCA 3TMPB 2RNRB 2KQ7A 2NZ8B 2GI9A 4N9F4 4DK5A 2IBIB 2CR5A 2M19A 1NENB 4BZAA 1BWNA 1DIKA 2ADZA 3DVGX 1A70A 4MK0A 3FSSA 3APFA 4OZAA 2N7JA 3VDZA 1XXGA 2N7EA 1HB6A 1TS2A 1U5FA 4B0MA 3DBLB 3QJZA 1UH6A 2JY6A 1J7AA 1MI1A 3PEGA 4DHJD 2FCMA 5JHBA 5D3XA 2MHJA 2VH1A 4QJ4B 2EMTA 4NPNA 2KACA 2D3CA 4MGKE 4FLHA 3HRDD 1E7PB 4TKNA 4ANXA 1YQ3B 4L23A 1TKYA 4KKJA 4JGHB
chains in the Genus database with same CATH topology
1Q67A 3ALBA 1EF1A 2WYQA 4IWOA 1KZ7A 1FAOA 2IO3B 1E90A 2J0KA 2DZJA 2C5LC 2LVQA 3W1YA 3ZNZB 3HW2B 2DHZA 4JKBA 1UZXB 2DYQA 4I6NB 2L1CA 5LXHA 4NAWA 2KX3A 1WR1A 3ZVRA 1OQYA 3A98B 5LXIB 3VFKA 3L16A 4KZ0A 1YD8U 4KSLC 5DPRA 3GZNI 3R66C 1P9DU 1H4RA 1K8RB 5JHGA 4HVBA 3PRZA 2MBOA 1WX9A 2HJ8A 4XWXA 1TBEA 2KK8A 1ST7A 3QIJA 3DXDA 1Q1OA 2MBEA 1V9JA 3OANA 2K39A 4ZRIA 1XX0A 3PG7A 1U27A 2O2VA 1K5DB 4W9IA 1ZM0A 2J0MA 4PNKA 5J2RA 2ZVOA 1RFAA 3RT3B 3HIZA 3V62A 2MWSB 1NI2A 1FB8A 1NTIA 2MQJA 3JW0X 1P3QU 2COPA 1M7RA 2CHWA 3QHTA 2LBBA 2V76A 4MSMB 2DYBA 3AULA 4GPTB 3VOQA 2ZVNA 2LOZA 5DPTA 1WGUA 3OJ3A 5J18A 1WGGA 3RCZA 2L0FA 4X57B 3DXCA 1H10A 4MJSB 2MP2A 1L2NA 3ZRCA 1GC7A 2KJHB 1XQQA 4KZCA 3PREA 4HDQA 3KUCB 4JK8A 2C7NB 2KN5A 1KJTA 1GNUA 3RYTA 2WDTB 1C3TA 1UBQA 1XCGA 1UEFA 2HTHA 4HPLB 3NY5A 4JKEA 2NVUI 1U5DA 3D32A 4WJPA 2LZ6A 4W9KA 1G6JA 4YONA 2JP2A 1X11A 4II3B 2BKRB 2D10A 2DENB 2KTRB 2NCNA 4G0NB 5D27A 1A5RA 5G55A 2XK5B 2ZEQA 4NY0A 5JLJB 4PYZA 2N1WA 2LOXA 3T9LA 2L0TA 4DX8A 2MBBB 4PS7A 1VD2A 1NVLA 2DYNA 2Y7BA 4JKCA 2WX0A 3LJUX 5JHAA 1P3RA 2G4SA 3O65B 4FULA 2QKLA 1UNQA 3ULCA 2KQSA 3QWMA 2D3GA 2LGXA 4CO7A 4NSWA 5D2MB 1L7YA 2GBNA 2B3AA 4HAZB 2KDIA 1V81A 3V6CB 4KIKB 4JKGA 4IWQA 4EKUA 5EFXA 4MGZE 4PS3A 3RZFA 5D3WA 2VRWB 4M0WB 2DTCA 4HAVB 1Y5OA 2RUKB 4ILGB 1IYFA 2N9EB 5C6RA 1WH3A 1WJUA 4RM8A 1EGXA 5CLLB 3A9JB 1EAZA 2R82A 4JK7A 2YS3A 3KYCD 2O2VB 3PSEB 2L76A 4FHJA 1V89A 2G4DB 2LD9A 2KDFB 2RR9A 2I1JA 2RPQA 2DX5A 1WR6E 3A1QA 4GGQA 1WMHB 4XX5A 2FCNA 2W9NA 4MDKE 5C1ZA 4GMXB 3SV1A 2L00B 3UQBA 1LFDA 2MBHA 1B55A 4CYEA 1RRBA 4W9GA 4HHVA 2UZRA 2FIFA 1Z87A 4DBBA 1U5GA 5GMVA 2XQNM 4P7IA 1WGRA 4FBJB 2D9ZA 2BYVE 4AJYB 5D6JB 4AP4C 4Z2MB 2LRWA 1W1DA 4HAWB 2Z0QA 3W1SC 2M17A 1XT9B 3BJIA 4WJQA 1JDEA 2BKFA 3ZUNA 2O6VA 3MDBC 3PGEA 4A6KA 2LGDA 3D8DA 4D0NB 3VTVA 2P0HA 4F7GA 2KUPA 3QAQA 4JL9A 2IFSA 1GG3A 4GDLA 3KYDD 3O96A 1IP9A 2LASA 1LQBA 2UZSA 1WJNA 1Y8RC 5C23A 1LM8B 2NPTB 1TXDA 1DYNA 2DFKA 3IVFA 4PYUA 3PP2A 4KSKC 4A6HA 1KOTA 5DHFB 1SGHA 2LG1A 2IO2B 2PEAA 1X1FA 1UNRA 4AUQC 3K9PB 4MEMA 1Z5SB 2UYZB 3VIAA 1DDMA 2K6DB 3TO1A 1J8CA 4WVFB 4AJWA 3RZWC 2K6QA 1YJ1A 4H8SA 1X05A 2MSED 1OEYA 3DVGY 1T0YA 4HWIB 1QC6A 4G50A 1ACAA 4A5KA 3R7RA 2MDXA 5AEKB 3A9JA 4GZUA 3TJPA 2FCQA 1U2BA 1H8CA 3VTUA 2ZZPB 3R7QA 3PLUA 4ILJA 4OVVA 1WIAA 1WX7A 4CHMA 4II2B 3L17A 3HQCA 2C60A 2ASQA 1MAIA 2BF8B 2KFKA 2GBRA 3U8ZA 1NTVA 1Q5WB 3APDA 3HM6X 5C16A 1V5TA 2AWTA 2DX1A 5DI9B 3IFWB 3E9LA 1C1YB 5HKHA 5HE3A 3DVNV 4KHBB 2ELAA 3UIPB 2KDEB 3NOBA 3M95A 1WI0A 2EMSA 2R2QA 1ZVRA 1YQBA 4NQLB 2D9XA 2KHWB 2YS1A 3VAWA 3APCA 1FGYA 4CHJA 4HB3B 1I7AA 4MSQB 2ZJDA 3P6AA 4IC7B 3ZDMC 2QHOA 3VUWA 1VBHA 3A8QA 3CSTA 1M94A 2Y8FA 2JZ3B 3F0WA 2LUEA 3ECIA 1BAKA 2K8HA 1OTRB 2KANA 2KLCA 2LGYA 2AYOB 1MKEA 3D8FA 1WJ1A 4J6IA 3RUIB 2OJRA 1SIFA 5KHQA 2ROZB 1KM7A 3SDLC 3ODXA 2M8SA 2JPHA 2JUOA 2DLWA 2DYMA 2L2IA 3H7PB 2DAJA 5IAAC 2KMAA 2D4QA 4C0AA 3ODOA 1MK7B 3SUZA 1WGYA 3L13A 3KH0A 3ZTCA 2MP2B 5IJMA 1WE6A 2KC1A 4LCDE 1MIZB 2R09A 2P8VA 3UQAA 5JHHA 1WMHA 3VXWA 4GB9A 2LWPA 1WXVA 3PRPB 3PHWB 2K8BA 3KVFB 2Z0EB 4EZKA 1U4AA 3M63B 2KZRA 1WX8A 2ABDA 3I3TB 1WGDA 3OAWA 2BGFA 2KTRA 2RQ1A 5J17A 2ZNVB 2QKMA 5DH9B 2MWNB 3ODWA 3N32A 2KWVB 4A6FA 3KSYA 4TQ1A 4ICUA 3CF6E 4F7UP 1K5GB 4IUMB 3MPXA 3QC8B 4EMOA 3PPAA 4K17A 2Z59B 2IO0B 2DHIA 3A8PA 2IY1B 5CX3A 2D2QA 3M1IB 2LYDA 4HAUB 4GU2A 1ZC4B 3JSVB 5KQ4A 2YSZA 4K81A 2MX2A 4DBGA 2GBMA 3ENEA 2FAZA 3ML4A 2CRFA 1FHWA 1PFJA 4B6HA 1RJ2A 2I5CA 4W9LA 5KHOA 4DXAB 2HD5B 2KGXB 2UVMA 2PE9A 2Y8GA 1WXSA 1V5UA 3N3KB 2PPHA 3U7DA 2DKQA 2CHXA 3PV1A 3TCAA 3TFMA 2DZKA 2NPTA 2Z0OA 2WX1A 4IW0A 3UF8A 3VVWB 1GC6A 3H1UA 2JRIB 3VH3B 5JVLA 3WYFB 1TGZB 1XR0B 3TW1A 1X86A 4BKSA 2FDQA 5L81A 1BTNA 1AWEA 2KC2A 2YS5A 3ZTDA 4FJZA 4EFOA 1DDWA 2IO1B 2BYEA 3HK0A 4KV2A 2KOXA 1FOEA 3ZNGC 5DPWA 3PVWA 1S3SG 1E7UA 2A4ZA 3A9KB 2K2JA 1TZ1A 4GMVA 4BKGA 4DHZB 1WGQA 5BO4B 2KVRA 1P6SA 5KCVA 4HPMB 4IM2A 1WI1A 2PE6B 3L54A 4KIKA 3A33B 1MPHA 2JVCA 1RLFA 4A3OA 1UPRA 1LB1A 4BBKA 2GBJA 3RULA 2UWQA 1GUAB 2IY0B 4URKA 3SO6A 5E6NA 5IA7A 4KDIC 3DQVA 4W9HA 2Z0PA 2KWUB 2LXAA 4B6WA 2KJ6A 5J3TA 4NJ7A 2DYOA 4RM9A 1WJMA 2DA0A 1NTYA 1V80A 4JIOU 3H7SA 3WAMA 1IRSA 3T8MA 4FADA 2BWFA 1VCBA 3ZIMA 1M7EA 2GCLA 1XD3B 2D9YA 4K7UA 1WY8A 1Q0WB 4GDKA 2FCSA 5JP4A 3NSUA 4E3CA 2YT1A 4MJSA 2KX0A 4MELA 4BFRA 2KXJA 3AI5A 2CU1A 2M14A 5D3VA 1ISNA 2RLOA 1WJ6A 4LJOB 4BVUC 4IG7B 3K9OB 4ANWA 3BINA 4WAAA 2MBQA 4WJNA 3MTNB 3CXBB 4K7SA 1I42A 3UIOB 2CS4A 2HRJA 1X1GA 4W9EA 4BKTA 2CY5A 1YIWA 2I5FA 1Z2MA 3L08A 1WGHA 1EUVB 5CTRC 1EVHA 2OOBB 4WWPA 1V5OA 3DBHI 4NNJB 2D07B 3TBLD 4A3PA 4JLCA 1AQCA 3TIXA 1ZW7A 1V2YA 5D3YA 1F9JA 3IG3A 3MJWA 4IM0A 4HAXB 3E66A 3AJ4A 2ZPYA 2CKHB 2N23A 3NZUA 1UNPA 1E8YA 3B08A 4E71A 4DDID 2BPSA 4ZYNA 3A4SC 3ENBA 2KLGA 3ZW3A 1KBLA 2L05A 5LOPB 2GBKA 2V1YA 3FP5A 3D8EA 1UBIA 3ONSA 4XZ4A 3VUYA 2NBVB 1JRUA 5LLIA 4ICVA 4F7HA 2MW5A 3X0WA 2L7RA 3ZKJC 3JYUA 4W9DA 3EPYA 2ZCCA 4W9CA 3PZDA 5JH5C 3KUDB 5C79A 4HAYB 4JKFA 3QX1A 2D9VA 2I1KA 5FI1A 4Y94A 1TJ6A 2D9WA 4JK9A 4A20A 1X1MA 2XEWA 1ZKHA 4KHAA 1TTNA 2XK5A 4IM3A 1BTKA 5TR5A 2C9WB 4I6LB 3PVLA 2JWZA 3CIKA 2KJRA 1WFYA 1DBHA 3WIMA 2V3SA 1ZSQA 3DDCB 1RAXA 4MM3A 3AU4A 3VTWA 2DKPA 3DPDA 2OQBA 2LVPA 4BOZB 3NHEB 4JKGB 4EZLA 4WJ7A 1V88A 2H7DA 2EJ8A 4BKSD 2KFJA 3PVUA 1V5MA 2YLMA 4TV3A 4MH0E 1WM2A 2KWCA 4JKDA 2L8JA 2GS0A 5E6PA 3W1SA 4K2PA 5D94A 2AL3A 5L95C 1XD4A 2KD0A 4WQOB 3M3JA 2GCJA 3OJ4B 3EFUA 2R0DA 2W2XD 1V6EA 1ZC3B 2IYBA 3LDZE 4KAXB 4KDLB 3SBTA 1XODA 3GYPA 4CHKA 4JQWC 2CAYA 3H7PA 3PT2B 4EOYA 2AEHA 1WRDB 3CSFA 1PMSA 4KHOA 5LONB 3JSVA 2NS5A 2YVCA 1NU2A 3BY4B 3KY9A 2RGNB 1P0RA 5FI0A 2CB8A 2N1VA 3QARA 2ELBA 3PLVA 2YT0A 4LDTD 5C5BB 2K00A 1WM3A 3N7CA 4JKAA 5EDSA 1OY2A 3ZRFA 4K7WA 1VBGA 3G9WA 2BWES 1WJ4A 4EZJA 2RD0A 2FUHB 5HE1A 4DHJB 1OEYJ 4DWFA 2R2OA 4DX90 4B9KA 2K25A 3N30A 2LJ5A 2GOWA 2RGFA 4HJKA 2PZ1A 1CMXB 2E2XA 4F1SA 1KLVA 2KDBA 5L83A 4F8CB 2M0XA 2D11A 1OGWA 4HB2B 1NDDA 4WJOA 4WSFA 1P5TA 1P1AA 3JVZX 4LJPB 2DX5B 2CHZA 4FHKA 4RMAA 2WH5A 1V49A 2DHKA 2HE7A 4DHZE 1WG7A 1UPQA 2N0YA 5CHFA 2VKIA 2G45B 5HE2A 2MLBA 3HHMA 4EEWA 2OTXA 4HB0B 4ANUA 1R4MI 1NBFC 2CQUA 1RRPB 3GYOA 3FM8C 2FJ9A 1ZGUB 1U5EA 2G35A 2J0JA 4MGYE 1WE7A 2KO3A 4FJYA 3E9OA 2MKRA 1QQGA 2KTFA 4LDTB 2M4NA 4ZRKA 2FNJB 2ZCBA 1XKEA 1QZEA 2N9XA 4ZRJA 2M1MA 4HB4B 4F7ZA 4HATB 1TQZA 5KQ1A 1R4NI 2DIKA 1W1GA 1FHXA 1HBKA 4ZDVA 1OQNA 3B0AA 2K1FA 2DZIA 1EF5A 2COFA 4NQKE 1MG8A 3RD2A 4GIVA 2GMIC 5AZHA 1AARA 1YX5B 3UGBB 4BBNF 1V61A 3DXEA 1J19A 3PHXB 2M38A 3FEHA 1J0GA 3VUXA 2EKEC 4GDKB 5DPSA 3SNHA 4ILHA 5AZFA 1WZ0A 4B95A 2ZPNA 3VHTC 3KW5B 5C5BA 3WANA 3VH4B 4GDLB 2W2XC 2LRUA 3GOEA 1SHCA 2KNBA 3V61A 3DCGA 4K2OA 3AU5A 1J0WA 2C7HA 2P0FA 1SE9A 2N7DA 5J3YA 2YRYA 1BT0A 2DZMA 2N4FA 4GN1A 1DDVA 2LXCA 3DBRI 2COAA 3C0RB 4WWOA 2LI5A 4K1RB 4KVGB 1WZ3A 3EC8A 3UZTA 4PS8A 3QK0A 2X0SA 3PRMB 4IAPA 3H9DA 3V5WA 2O6VD 1LW3A 3DVNU 2CODA 2MRPA 3P2BA 4HLEA 4G3XB 3OLMD 1OMWA 1YX6B 5DIFB 3ZVVA 4IWPA 1FHOA 1E7VA 4HDOA 4MGIE 3LJ3A 3F5RA 2LKOA 4YL8A 2COCA 3X23A 2KCJA 2FJLA 1WF9A 2CY4A 3NZSA 3L0WB 2KMCA 2DAFA 3ZNID 2N9PC 4E74A 2RSGA 3SBGA 4JKHA 3WAPA 4AWJA 3SD5A 1DROA 2C7MB 4DDGD 3ML9A 3SHQA 1KI1B 3VQIA 2PJHA 5FR6A 2Q13A 3TVVA 1KZGA 2FIDA 1I35A 1U29A 2IYDB 3ZO5B 2W2WA 3ML8A 4HXDA 2Y5BB 2Z0DB 1MIXA 2J59M 3RCPA 4FJVB 3FLVA 4NJ6A 3EHVA 1FXTB 5E6OA 2LULA 2JZZA 3Q3FA 2YF0A 4W9JA 4TQ0A 1E8XA 1HE8A 2DHJA 2ZNVC 2RVBB 4FA6A 4GOCA 3DOWA 2JF5A 4ANVA 5CHWA 5G2NA 5D7GA 3ULBA 2REXA 4I6PA 5DCNA 4GXBA 5AZGA 2LVOA 3A4RA 1EO6A 5HE0A 2HTHB 2K8CA 3MHSD 1WXMA 4WWNA 2VRRB 1GGOA 2K2UA 3AXCA 3QBVB 5JZEB 2X18A 3WA0A 4Z2NA 3HM3A 1PQSA 2G3QB 3A9KA 3QCAA 3TL5A 4EJNA 5J3QA 2L3ZA 4XC2A 4TUUA 3SYXA 3IHPC 2BCJA 2MCNB 2NR2A 2JT4B 3A1QB 3ZNHB 3KRXA 3PS6A 5DHAB 3DBLI 4HCNB 1Y19B 2AL6A 3KUZA 1V86A 1E8WA 5CLQB 2P0DA 4EUTA 2EC1A 4MY6A 3QA8A 2DN6A 2MFQA 1IPGA 4IOYX 1E5WA 4FN2A 4G11A 1FGZA 3ZDTA 1I2HA 1GJZA 1V5PA 1UD7A 4HCPB 4M8NA 3U30A 4BOSC 1UGMA 2RSUA 3B1LX 4AOFA 1E8ZA 2BYFA 1S1QB 3P7ZA 3H6NA 3WALA 3KRWA 3IBEA 2GJYA 2J7QB 3WAOA 3QWZB 5CHVC 3S2AA 3R3MA 3T06A 3UINB 3PTFC 3QQ8B 1WYWB 4TYZA 2NBUA 3L10B 1MK9B 4W9FA 3V6EB 1W1HA 2H7EA 3SU8X 3E9PA 1LXDA 2JXXA 3V60A 4ASWC 1D3ZA 1UELA 2KFKB 2NBWB 2JRHA 2A5UA 4PQ0A 3CMMB 2MA9B 2WWZA 4NAWB 3KZ1A 3Q3JA 3DBSA 4M8MA 4A6FB 2VSZA 4OVUA 2IZVB 1WVHA 2V4LA 1KC7A 2XBBC 2O6VB 4HK2A 4GSWA 2ROVA 3ZLZA 1P98A 5GOWB 1HB8A 2NMBA 1N3HA 3NS8A 3EECA 1PLSA 4BBNC 3PSCA 1WXAA 4MT7A 3M62B 4L6EA 4IFSA 2KKCA 3TMPB 2RNRB 2KQ7A 2NZ8B 4N9F4 4DK5A 2IBIB 2CR5A 1BWNA 1DIKA 2ADZA 3DVGX 4MK0A 3FSSA 3APFA 3VDZA 2N7EA 1HB6A 1U5FA 3QJZA 1UH6A 2JY6A 4DHJD 3PEGA 2FCMA 5JHBA 5D3XA 2EMTA 4NPNA 4MGKE 4FLHA 4TKNA 4ANXA 4JGHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6W A;  2KJ6 A;  3UGB B;  1V61 A;  3DXE A;  1J19 A;  5J3T A;  3PHX B;  2M38 A;  4NJ7 A;  4BBN F;  1SGH A;  2LG1 A;  2DYO A;  1Q67 A;  2IO2 B;  4RM9 A;  1WJM A;  2DA0 A;  1NTY A;  2PEA A;  3ALB A;  1EF1 A;  3FEH A;  2WYQ A;  4IWO A;  1KZ7 A;  1FAO A;  2IO3 B;  1V80 A;  1X1F A;  1J0G A;  1UNR A;  3VUX A;  2EKE C;  5DPR A;  4AUQ C;  1E90 A;  4JIO U;  3H7S A;  2J0K A;  4GDK B;  2DZJ A;  2C5L C;  2LVQ A;  1IRS A;  3SNH A;  5DPS A;  3W1Y A;  3WAM A;  3T8M A;  5AZF A;  4FAD A;  3ZNZ B;  2BWF A;  1WZ0 A;  4B95 A;  3K9P B;  3HW2 B;  1VCB A;  2ZPN A;  1M7E A;  3ZIM A;  3VHT C;  4MEM A;  2GCL A;  1Z5S B;  2DHZ A;  3KW5 B;  2UYZ B;  5G55 A;  5C5B A;  1UZX B;  2DYQ A;  3WAN A;  1XD3 B;  4I6N B;  3VH4 B;  2L1C A;  3VIA A;  2W2X C;  2D9Y A;  1DDM A;  2K6D B;  4GDL B;  4K7U A;  3TO1 A;  4NAW A;  2KX3 A;  1WR1 A;  1WY8 A;  2LRU A;  1Q0W B;  1SHC A;  3ZVR A;  1OQY A;  3GOE A;  2KNB A;  4GDK A;  3V61 A;  1J8C A;  3DCG A;  4K2O A;  3AU5 A;  1J0W A;  2FCS A;  4WVF B;  3A98 B;  5JP4 A;  3NSU A;  2C7H A;  4E3C A;  5LXI B;  2P0F A;  2YT1 A;  4MJS A;  3RZW C;  1SE9 A;  2K6Q A;  1YJ1 A;  2KX0 A;  2N7D A;  4AJW A;  5J3Y A;  2YRY A;  4H8S A;  1BT0 A;  2DZM A;  3L16 A;  2N4F A;  4KZ0 A;  1YD8 U;  1X05 A;  4MEL A;  4GN1 A;  3VFK A;  2MSE D;  4KSL C;  4BFR A;  2KXJ A;  1DDV A;  1OEY A;  2LXC A;  3AI5 A;  3DVG Y;  3GZN I;  3R66 C;  1T0Y A;  2CU1 A;  3DBR I;  1QC6 A;  2M14 A;  1ACA A;  1ISN A;  5D3V A;  1P9D U;  4G50 A;  1H4R A;  2COA A;  4A5K A;  1K8R B;  5JHG A;  3C0R B;  2LI5 A;  2RLO A;  2MBO A;  4KVG B;  3PRZ A;  1WJ6 A;  1WZ3 A;  4K1R B;  4LJO B;  2MDX A;  4IG7 B;  4B9K A;  4BVU C;  5AEK B;  3K9O B;  4ANW A;  3EC8 A;  3UZT A;  1WX9 A;  3A9J A;  4PS8 A;  3QK0 A;  3BIN A;  4GZU A;  2HJ8 A;  2FCQ A;  2MBQ A;  4XWX A;  1TBE A;  3PRM B;  4IAP A;  1U2B A;  4WAA A;  4WJN A;  3H9D A;  3V5W A;  1H8C A;  3MTN B;  2O6V D;  1LW3 A;  3CXB B;  3DVN U;  4K7S A;  1I42 A;  2KK8 A;  1ST7 A;  2COD A;  3QIJ A;  2MRP A;  3VTU A;  3P2B A;  3UIO B;  2CS4 A;  3DXD A;  2ZZP B;  4HLE A;  2HRJ A;  1X1G A;  4G3X B;  1Q1O A;  2MBE A;  4W9E A;  4BKT A;  3OLM D;  3R7Q A;  3PLU A;  1OMW A;  2CY5 A;  1YIW A;  2I5F A;  1Z2M A;  1WIA A;  1WGH A;  4CHM A;  5DIF B;  1EUV B;  1WX7 A;  1FHO A;  1YX6 B;  4II2 B;  4IWP A;  1V9J A;  5CTR C;  3OAN A;  1E7V A;  1EVH A;  4HDO A;  3L17 A;  4MGI E;  3HQC A;  2C60 A;  2OOB B;  2ASQ A;  1MAI A;  2BF8 B;  2K39 A;  2KFK A;  3LJ3 A;  2GBR A;  3F5R A;  3U8Z A;  1NTV A;  4ZRI A;  1XX0 A;  2LKO A;  4YL8 A;  2COC A;  3X23 A;  2KCJ A;  1Q5W B;  4WWP A;  2FJL A;  3PG7 A;  1V5O A;  1WF9 A;  3DBH I;  2CY4 A;  3NZS A;  2D07 B;  3L0W B;  4NNJ B;  3TBL D;  3APD A;  1U27 A;  3HM6 X;  2O2V A;  2KMC A;  4JLC A;  1K5D B;  2DAF A;  1AQC A;  3ZNI D;  2N9P C;  4E74 A;  3TIX A;  2RSG A;  1V2Y A;  1ZW7 A;  4W9I A;  1ZM0 A;  5D3Y A;  5C16 A;  1F9J A;  3IG3 A;  1V5T A;  3MJW A;  3WAP A;  4AWJ A;  2J0M A;  4PNK A;  2AWT A;  2DX1 A;  5DI9 B;  5J2R A;  3IFW B;  4IM0 A;  2ZVO A;  1RFA A;  3SD5 A;  1DRO A;  3RT3 B;  1C1Y B;  2C7M B;  3HIZ A;  3V62 A;  4HAX B;  5HE3 A;  4DDG D;  5HKH A;  2MWS B;  3DVN V;  4KHB B;  3ML9 A;  2ELA A;  3UIP B;  2KDE B;  1NI2 A;  3NOB A;  3M95 A;  1WI0 A;  2EMS A;  3SHQ A;  3AJ4 A;  1ZVR A;  2R2Q A;  1KI1 B;  3VQI A;  2PJH A;  2ZPY A;  1FB8 A;  5FR6 A;  1YQB A;  4NQL B;  2CKH B;  2D9X A;  1NTI A;  2N23 A;  3NZU A;  1UNP A;  1E8Y A;  2Q13 A;  3B08 A;  2KHW B;  2YS1 A;  4DDI D;  3TVV A;  4E71 A;  2MQJ A;  1KZG A;  3JW0 X;  2FID A;  1I35 A;  1U29 A;  3VAW A;  4OVV A;  2IYD B;  2BPS A;  3APC A;  4ZYN A;  3ZO5 B;  2W2W A;  1P3Q U;  2COP A;  1FGY A;  4CHJ A;  3A4S C;  1M7R A;  2CHW A;  2KLG A;  3QHT A;  2LBB A;  3ML8 A;  2V76 A;  4MSM B;  2DYB A;  4HXD A;  3ZW3 A;  4HB3 B;  1A5R A;  1I7A A;  2Y5B B;  4MSQ B;  2Z0D B;  2L05 A;  5LOP B;  2GBK A;  1MIX A;  3AUL A;  4GPT B;  3VOQ A;  2ZVN A;  2J59 M;  3RCP A;  2ZJD A;  4FJV B;  3P6A A;  2V1Y A;  3FP5 A;  2LOZ A;  3D8E A;  1UBI A;  3ONS A;  1WGU A;  4HWI B;  5DPT A;  4IC7 B;  3ZDM C;  3OJ3 A;  3FLV A;  5J18 A;  1WGG A;  2QHO A;  4NJ6 A;  4XZ4 A;  3RCZ A;  3VUW A;  3EHV A;  2NBV B;  3A8Q A;  1FXT B;  3VUY A;  5E6O A;  2L0F A;  1JRU A;  3CST A;  3DXC A;  2LUL A;  1M94 A;  4X57 B;  2Y8F A;  5LLI A;  2JZ3 B;  4ICV A;  1H10 A;  3F0W A;  4MJS B;  4F7H A;  2JZZ A;  2LUE A;  2L7R A;  2MP2 A;  2MW5 A;  3ECI A;  1BAK A;  3X0W A;  3ZKJ C;  1L2N A;  3ZRC A;  2K8H A;  1OTR B;  2KAN A;  2KLC A;  3JYU A;  2YF0 A;  3Q3F A;  1GC7 A;  2KJH B;  2LGY A;  1XQQ A;  3EPY A;  2AYO B;  4W9J A;  1E8X A;  4W9D A;  4KZC A;  3PRE A;  4HDQ A;  2ZCC A;  3KUC B;  2C7N B;  4TQ0 A;  1HE8 A;  3PZD A;  2DHJ A;  2ZNV C;  4W9C A;  1MKE A;  2RVB B;  5JH5 C;  3KUD B;  4FA6 A;  3D8F A;  4GOC A;  2KN5 A;  1KJT A;  3DOW A;  5C79 A;  4HAY B;  1GNU A;  3RYT A;  2JF5 A;  1WJ1 A;  4J6I A;  2WDT B;  4ANV A;  5CHW A;  5G2N A;  3RUI B;  2OJR A;  1SIF A;  3QX1 A;  5D7G A;  3ULB A;  5KHQ A;  1C3T A;  2ROZ B;  1KM7 A;  1UBQ A;  3ODX A;  2D9V A;  2REX A;  4I6P A;  3SDL C;  1XCG A;  1UEF A;  2HTH A;  2M8S A;  4GXB A;  2JPH A;  3NY5 A;  4HPL B;  5DCN A;  2JUO A;  2I1K A;  5FI1 A;  4Y94 A;  2DLW A;  2LVO A;  2NVU I;  2DYM A;  3A4R A;  2L2I A;  3H7P B;  5AZG A;  2DAJ A;  1TJ6 A;  1EO6 A;  5HE0 A;  2D9W A;  2HTH B;  4A20 A;  5IAA C;  4WWO A;  2KMA A;  2D4Q A;  1X1M A;  2XEW A;  1U5D A;  2K8C A;  1ZKH A;  4KHA A;  1TTN A;  2XK5 A;  3MHS D;  1BTK A;  4C0A A;  1WXM A;  3ODO A;  1MK7 B;  3SUZ A;  4IM3 A;  2VRR B;  4WWN A;  2C9W B;  1WGY A;  4I6L B;  5TR5 A;  3W1S A;  3D32 A;  2K2U A;  3L13 A;  3KH0 A;  3AXC A;  3PVL A;  3ZTC A;  2JWZ A;  4WJP A;  3QBV B;  4HVB A;  3CIK A;  3WA0 A;  2X18 A;  1WFY A;  1DBH A;  2KJR A;  2LZ6 A;  4W9K A;  3WIM A;  4Z2N A;  1G6J A;  2V3S A;  3HM3 A;  4YON A;  1ZSQ A;  2JP2 A;  3DDC B;  1RAX A;  4MM3 A;  3AU4 A;  1X11 A;  1PQS A;  2BKR B;  2G3Q B;  2MP2 B;  3A9K A;  5IJM A;  3QCA A;  4II3 B;  3VTW A;  5JZE B;  2DKP A;  1WE6 A;  2D10 A;  2OQB A;  2DEN B;  2KTR B;  2KC1 A;  2NCN A;  3DPD A;  4LCD E;  4A3P A;  1MIZ B;  2R09 A;  4G0N B;  2LVP A;  4BOZ B;  3NHE B;  5D27 A;  3TL5 A;  4EJN A;  2P8V A;  4WJ7 A;  5J3Q A;  1V88 A;  2L3Z A;  2XK5 B;  2ZEQ A;  2H7D A;  5JHH A;  4TUU A;  2EJ8 A;  3SYX A;  4XC2 A;  3IHP C;  1WMH A;  4NY0 A;  3VXW A;  2BCJ A;  4BKS D;  4GB9 A;  2LWP A;  2KFJ A;  1WXV A;  3PRP B;  3PHW B;  4JGH B;  2NR2 A;  2MCN B;  3PVU A;  1V5M A;  5JLJ B;  2JT4 B;  2K8B A;  2YLM A;  3A1Q B;  4MH0 E;  4PYZ A;  2N1W A;  4TV3 A;  3ZNH B;  2LOX A;  3KVF B;  3KRX A;  3PS6 A;  1WM2 A;  5DHA B;  2Z0E B;  1U4A A;  2KWC A;  3DBL I;  3M63 B;  4HCN B;  4EZK A;  2KZR A;  1WX8 A;  2ABD A;  3I3T B;  1WGD A;  3T9L A;  2L0T A;  2L8J A;  2GS0 A;  4DX8 A;  2MBB B;  3OAW A;  5E6P A;  4PS7 A;  4K2P A;  5D94 A;  1Y19 B;  1VD2 A;  2AL6 A;  3KUZ A;  1V86 A;  2AL3 A;  1NVL A;  2DYN A;  1E8W A;  5L95 C;  2BGF A;  2Y7B A;  5CLQ B;  2KTR A;  2RQ1 A;  2P0D A;  2WX0 A;  4EUT A;  1XD4 A;  3LJU X;  2EC1 A;  2KD0 A;  4MY6 A;  5J17 A;  5JHA A;  1P3R A;  4WQO B;  3M3J A;  3QA8 A;  2DN6 A;  2G4S A;  2GCJ A;  2ZNV B;  3OJ4 B;  2QKM A;  2MFQ A;  1IPG A;  5DH9 B;  3O65 B;  4IOY X;  3EFU A;  4FUL A;  2MWN B;  2QKL A;  1E5W A;  1UNQ A;  3ULC A;  2R0D A;  3ODW A;  2KQS A;  4A6F A;  2KWV B;  2W2X D;  3QWM A;  1V6E A;  2D3G A;  1ZC3 B;  2IYB A;  2LGX A;  3LDZ E;  4FN2 A;  4G11 A;  4CO7 A;  4NSW A;  1FGZ A;  3KSY A;  4KAX B;  4KDL B;  4TQ1 A;  1L7Y A;  5D2M B;  2GBN A;  4ICU A;  3ZDT A;  3CF6 E;  1I2H A;  2B3A A;  4F7U P;  1GJZ A;  1K5G B;  4IUM B;  3MPX A;  1XOD A;  4HAZ B;  2KDI A;  3QC8 B;  3GYP A;  4EMO A;  4CHK A;  1V5P A;  1UD7 A;  3PPA A;  4K17 A;  2CAY A;  1V81 A;  4HCP B;  4JQW C;  4M8N A;  3U30 A;  2Z59 B;  3H7P A;  4BOS C;  2IO0 B;  3PT2 B;  2DHI A;  3A8P A;  4EOY A;  2IY1 B;  2AEH A;  5CX3 A;  3V6C B;  2D2Q A;  1WRD B;  3CSF A;  1PMS A;  3M1I B;  1UGM A;  2RSU A;  4KHO A;  3B1L X;  4AOF A;  1E8Z A;  4KIK B;  5LON B;  2BYF A;  3JSV A;  4IWQ A;  4EKU A;  5EFX A;  1S1Q B;  4MGZ E;  2LYD A;  4HAU B;  4GU2 A;  4PS3 A;  1ZC4 B;  3P7Z A;  2YVC A;  2NS5 A;  3JSV B;  5D3W A;  3RZF A;  2VRW B;  1NU2 A;  5KQ4 A;  4M0W B;  3BY4 B;  3H6N A;  3KY9 A;  2YSZ A;  4K81 A;  2RGN B;  2DTC A;  4HAV B;  1Y5O A;  2MX2 A;  2RUK B;  4DBG A;  4F7Z A;  2GBM A;  3ENE A;  3WAL A;  1P0R A;  1IYF A;  5FI0 A;  2CB8 A;  2N1V A;  2FAZ A;  3KRW A;  3QAR A;  2N9E B;  3ML4 A;  3IBE A;  2ELB A;  2CRF A;  3PLV A;  5C6R A;  2YT0 A;  2GJY A;  2J7Q B;  3WAO A;  4LDT D;  3QWZ B;  5CHV C;  1WH3 A;  3S2A A;  5C5B B;  1FHW A;  3R3M A;  3T06 A;  1PFJ A;  3UIN B;  3PTF C;  2K00 A;  1WJU A;  4B6H A;  1WM3 A;  4RM8 A;  1RJ2 A;  2I5C A;  3QQ8 B;  1WYW B;  1EGX A;  4TYZ A;  5CLL B;  2NBU A;  4W9L A;  5KHO A;  3L10 B;  1MK9 B;  2LXA A;  4W9F A;  4DXA B;  2HD5 B;  2KGX B;  3V6E B;  3N7C A;  1W1H A;  3A9J B;  5EDS A;  1EAZ A;  2H7E A;  1OY2 A;  3ZRF A;  4K7W A;  3SU8 X;  2UVM A;  2PE9 A;  2Y8G A;  3G9W A;  3UQA A;  3KYC D;  2YS3 A;  2BWE S;  1WJ4 A;  1WXS A;  2O2V B;  4EZJ A;  2RD0 A;  3PSE B;  1LXD A;  2FUH B;  2L76 A;  1V5U A;  5HE1 A;  4DHJ B;  2JXX A;  3V60 A;  4ASW C;  1D3Z A;  3N3K B;  2PPH A;  4FHJ A;  1V89 A;  1UEL A;  2G4D B;  2LD9 A;  1OEY J;  2KFK B;  2NBW B;  4DWF A;  2R2O A;  4DX9 0;  2KDF B;  2JRH A;  2RR9 A;  2I1J A;  2K25 A;  3U7D A;  3N32 A;  2RPQ A;  2DX5 A;  2DKQ A;  2CHX A;  3N30 A;  3TCA A;  3PV1 A;  2A5U A;  2LJ5 A;  2GOW A;  1WR6 E;  3TFM A;  2RGF A;  2DZK A;  3A1Q A;  2NPT A;  4PQ0 A;  4HJK A;  2Z0O A;  2PZ1 A;  1CMX B;  2WX1 A;  4GGQ A;  4IW0 A;  3CMM B;  3UF8 A;  1WMH B;  2MA9 B;  2WWZ A;  4XX5 A;  4NAW B;  2E2X A;  3VVW B;  2FCN A;  4F1S A;  1GC6 A;  1KLV A;  2KDB A;  5L83 A;  3H1U A;  2W9N A;  4F8C B;  3KZ1 A;  3Q3J A;  2M0X A;  3DBS A;  4MDK E;  5C1Z A;  2D11 A;  4M8M A;  1OGW A;  4GMX B;  3SV1 A;  4A6F B;  2L00 B;  2VSZ A;  4HB2 B;  4OVU A;  2IZV B;  1NDD A;  4WJO A;  3UQB A;  4WSF A;  1P5T A;  1WVH A;  1P1A A;  2JRI B;  2V4L A;  3JVZ X;  4LJP B;  3VH3 B;  1LFD A;  2DX5 B;  3WYF B;  2CHZ A;  2MBH A;  1TGZ B;  4FHK A;  4RMA A;  1B55 A;  2WH5 A;  4CYE A;  1XR0 B;  1X86 A;  3TW1 A;  1V49 A;  2XBB C;  2DHK A;  4BKS A;  2FDQ A;  1RRB A;  2O6V B;  5L81 A;  1BTN A;  4W9G A;  1AWE A;  4HHV A;  4HK2 A;  4GSW A;  2UZR A;  2HE7 A;  2FIF A;  2ROV A;  1WG7 A;  3ZLZ A;  3L08 A;  4DHZ E;  2KC2 A;  1UPQ A;  2YS5 A;  2N0Y A;  5CHF A;  3ZTD A;  1Z87 A;  2VKI A;  4DBB A;  1P98 A;  2G45 B;  4FJZ A;  5GOW B;  1U5G A;  5HE2 A;  1HB8 A;  2XQN M;  5GMV A;  2NMB A;  4P7I A;  1N3H A;  2MLB A;  3HHM A;  4EEW A;  1WGR A;  2OTX A;  4EFO A;  1DDW A;  2IO1 B;  4FBJ B;  2BYE A;  3HK0 A;  3TJP A;  2D9Z A;  4HB0 B;  3NS8 A;  4EZL A;  2BYV E;  3EEC A;  4KV2 A;  1PLS A;  2KOX A;  4AJY B;  4ANU A;  4BBN C;  1R4M I;  5D6J B;  1NBF C;  1FOE A;  3PSC A;  4AP4 C;  4Z2M B;  2LRW A;  2CQU A;  1RRP B;  3GYO A;  1WXA A;  3FM8 C;  4MT7 A;  2FJ9 A;  1ZGU B;  3PVW A;  1S3S G;  3M62 B;  3ZNG C;  5DPW A;  1U5E A;  2G35 A;  1E7U A;  2A4Z A;  3A9K B;  2J0J A;  2K2J A;  4L6E A;  4MGY E;  1TZ1 A;  1WE7 A;  1W1D A;  4IFS A;  4GMV A;  4HAW B;  2Z0Q A;  2KO3 A;  4FJY A;  2KKC A;  4BKG A;  1WGQ A;  3W1S C;  4DHZ B;  2M17 A;  3TMP B;  2RNR B;  2KVR A;  1P6S A;  1XT9 B;  2KQ7 A;  2MKR A;  3BJI A;  5KCV A;  5BO4 B;  2NZ8 B;  4WJQ A;  4N9F 4;  4DK5 A;  2IBI B;  1QQG A;  4HPM B;  2KTF A;  2CR5 A;  4LDT B;  2BKF A;  1BWN A;  5LXH A;  4IM2 A;  2M4N A;  4ZRK A;  2FNJ B;  1WI1 A;  2ZCB A;  1XKE A;  2O6V A;  3ZUN A;  1QZE A;  2N9X A;  2PE6 B;  3MDB C;  3L54 A;  4A6K A;  3PGE A;  3A33 B;  4KIK A;  4ZRJ A;  2ADZ A;  3DVG X;  2LGD A;  1MPH A;  3D8D A;  2JVC A;  4D0N B;  3VTV A;  2P0H A;  4F7G A;  3FSS A;  4HB4 B;  4MK0 A;  1RLF A;  2M1M A;  3APF A;  3VDZ A;  4A3O A;  2KUP A;  3QAQ A;  4JL9 A;  1UPR A;  2IFS A;  2N7E A;  1GG3 A;  1HB6 A;  1LB1 A;  4BBK A;  1U5F A;  2GBJ A;  4HAT B;  4GDL A;  1TQZ A;  5KQ1 A;  1R4N I;  3KYD D;  3QJZ A;  1UH6 A;  3O96 A;  2JY6 A;  3RUL A;  2UWQ A;  1GUA B;  1IP9 A;  1W1G A;  4DHJ D;  3PEG A;  1FHX A;  2LAS A;  2FCM A;  2IY0 B;  5D3X A;  1LQB A;  1HBK A;  5JHB A;  4URK A;  2UZS A;  4ZDV A;  1WJN A;  1OQN A;  3B0A A;  2K1F A;  2DZI A;  1Y8R C;  5C23 A;  2EMT A;  4NPN A;  1LM8 B;  1EF5 A;  2COF A;  3R7R A;  3SO6 A;  2NPT B;  1TXD A;  1MG8 A;  4NQK E;  4MGK E;  1DYN A;  2DFK A;  4FLH A;  5E6N A;  3IVF A;  3ZVV A;  5IA7 A;  4PYU A;  3PP2 A;  4TKN A;  4KSK C;  4KDI C;  3RD2 A;  4ANX A;  4A6H A;  3DQV A;  2Z0P A;  4W9H A;  1KOT A;  4GIV A;  2GMI C;  5AZH A;  2KWU B;  5DHF B;  1AAR A;  1YX5 B; 
#chains in the Genus database with same CATH topology
 4IDI A;  1ZUD 2;  1Q67 A;  2JSV X;  1WRI A;  1ZP0 B;  3ALB A;  1EF1 A;  2WYQ A;  4IWO A;  1KZ7 A;  1FAO A;  1SJH D;  2IO3 B;  2JWU A;  1E90 A;  2MJ3 A;  2J0K A;  2DZJ A;  4J3O D;  2C5L C;  2LVQ A;  3W1Y A;  2Z14 A;  3ZNZ B;  3HW2 B;  2DHZ A;  3RNA C;  4JKB A;  1UZX B;  2DYQ A;  4I6N B;  2L1C A;  5LXH A;  4NAW A;  1D5M C;  2KX3 A;  3AE2 B;  1WR1 A;  2WXF A;  3ZVR A;  1OQY A;  1VR9 A;  3A98 B;  5C2T B;  5LXI B;  3L4P A;  2MH7 A;  3HIE A;  2BW2 A;  4OSN A;  3VFK A;  3L16 A;  4KZ0 A;  1YD8 U;  4KSL C;  5DPR A;  2R2Y A;  2PVG C;  3GZN I;  3R66 C;  1P9D U;  1H4R A;  1K8R B;  5JHG A;  2LFI A;  3PRZ A;  2MBO A;  4HVB A;  1JCK B;  2INC C;  3P1M A;  1TYG B;  1WX9 A;  2K0P A;  2HJ8 A;  4XWX A;  1TBE A;  1M4V A;  2KK8 A;  1ST7 A;  4K3B A;  3QIJ A;  3DXD A;  3C8Y A;  2GUM A;  1Q1O A;  2MBE A;  1ROE A;  1ZOY B;  2N0S B;  4EE2 A;  3Q69 A;  1V9J A;  3OAN A;  1FXI A;  2PMV A;  2K39 A;  3ETR A;  1ZPS A;  3NVY A;  4ZRI A;  1XX0 A;  1TS5 A;  3PG7 A;  4NAM A;  1U27 A;  2BS2 B;  2O2V A;  4ACF A;  1K5D B;  1YNT E;  2J42 A;  1EU3 A;  4W9I A;  1N5W A;  1ZM0 A;  2E6X A;  2J0M A;  4PNK A;  5J2R A;  1C77 A;  2ZVO A;  1RFA A;  3RT3 B;  2KVZ A;  3EUB 2;  3HIZ A;  3V62 A;  2MWS B;  2MJE A;  1NI2 A;  4ZRP A;  1D5Z C;  5IRS A;  3I63 C;  1FB8 A;  3NWA A;  1NTI A;  1EU4 A;  2MQJ A;  3JW0 X;  4YSX B;  2OED A;  5TSS A;  1P3Q U;  2COP A;  1M7R A;  2CHW A;  3QHT A;  2LBB A;  2V76 A;  4MSM B;  2DYB A;  1TS4 A;  2BTE A;  1PGX A;  1N62 A;  1FNU A;  3AUL A;  4GPT B;  1FRR A;  2RMM A;  3VOQ A;  2ZVN A;  1TIF A;  1XLQ A;  1TS3 A;  2LOZ A;  5DPT A;  1WGU A;  1GOZ A;  3OJ3 A;  5J18 A;  1WGG A;  4PK1 A;  3RCZ A;  1CQV A;  2KR0 A;  2L0F A;  4X57 B;  3DXC A;  1H10 A;  4MJS B;  1L0V B;  2J4X A;  2MP2 A;  1L2N A;  3ZRC A;  1E9M A;  3AEE B;  1GC7 A;  1E6E B;  2KJH B;  1XQQ A;  4KZC A;  3PRE A;  4HDQ A;  3KUC B;  4JK8 A;  2C7N B;  2QJL A;  2K9X A;  2KN5 A;  1KJT A;  1GNU A;  1RM6 C;  2WDQ B;  3RYT A;  2WDT B;  1C3T A;  1UBQ A;  1N5X A;  1XCG A;  1UEF A;  2HTH A;  4HPL B;  3NY5 A;  4JKE A;  2NVU I;  2L32 A;  2JU6 X;  3NVV A;  3T3N A;  3BZD B;  1U5D A;  3D32 A;  3NJT A;  1VZ8 A;  3NG0 A;  3PO0 A;  4WJP A;  2LZ6 A;  2WHI A;  4W9K A;  1G6J A;  2HTM E;  4YON A;  2JP2 A;  4US9 A;  1K51 A;  1ZXH A;  1X11 A;  4II3 B;  2BKR B;  2D10 A;  2DEN B;  2IGG A;  2KTR B;  2NCN A;  2JQR B;  4G0N B;  5D27 A;  1A5R A;  5G55 A;  2XK5 B;  2ZEQ A;  1WSP A;  4NY0 A;  2Y5P A;  4IKG A;  4C4V A;  1NYQ A;  2M0A A;  5JLJ B;  4PYZ A;  2N1W A;  1NI3 A;  4YXD B;  2LOX A;  5I4D A;  3B77 A;  3T9L A;  2L0T A;  1VDV A;  2PTL A;  4DX8 A;  2MBB B;  4PS7 A;  3SFD B;  4P6V F;  1VD2 A;  1L4D B;  1NVL A;  2DYN A;  2Y7B A;  4JKC A;  2Q5W D;  3MFG A;  1HQR D;  2WX0 A;  3LJU X;  5JHA A;  1P3R A;  2G4S A;  3O65 B;  4NJC A;  4FUL A;  4YT0 B;  2QKL A;  1UNQ A;  3ULC A;  3VRA B;  2KQS A;  3QWM A;  2D3G A;  2LGX A;  4CO7 A;  4NSW A;  5D2M B;  1L7Y A;  2GBN A;  2B3A A;  4HAZ B;  2KDI A;  2Z8L A;  3Q8F A;  4WIP A;  1V81 A;  4C7Y A;  3BK2 A;  4AQ7 A;  3V6C B;  4US8 A;  1MG4 A;  3GE3 C;  4OZB A;  4KIK B;  4JKG A;  4IWQ A;  4EKU A;  5EFX A;  1AW7 A;  2QIL A;  4MGZ E;  4PS3 A;  3GB1 A;  3RZF A;  4C00 A;  5D3W A;  1QIL A;  2VRW B;  4ZHO A;  2Z13 A;  4M0W B;  2DTC A;  4AS1 A;  4HAV B;  1Y5O A;  2RUK B;  4ILG B;  1IYF A;  4CSQ A;  2N9E B;  2KN4 A;  5C6R A;  2KIE A;  2QSD A;  2ICI A;  4YTM B;  3RFZ B;  1I4G A;  1WH3 A;  1WJU A;  4RM8 A;  1EGX A;  5CLL B;  1J7B A;  3A9J B;  1EAZ A;  3W5V B;  2R82 A;  4JK7 A;  2YS3 A;  3KYC D;  1V97 A;  2O2V B;  4JPS A;  5EE3 A;  3NVZ A;  3PSE B;  2L76 A;  4FHJ A;  1V89 A;  2G4D B;  2LD9 A;  1QKZ A;  2KDF B;  3KWL A;  2RR9 A;  2I1J A;  2QEJ C;  2K8E A;  2DX5 A;  2RPQ A;  1FMA D;  1WR6 E;  3A1Q A;  4JWU C;  4D6W A;  4GGQ A;  1WMH B;  4XX5 A;  2FCN A;  2W9N A;  4MDK E;  5C1Z A;  3TEX A;  4GMX B;  3SV1 A;  2L00 B;  2QDF A;  3DBR B;  1PYW D;  2K3U A;  4OW0 A;  3UQB A;  3HUI A;  1LFD A;  2MBH A;  1ZXI A;  1FIQ A;  3I5J C;  1B55 A;  4CYE A;  1RRB A;  3DHI C;  4W9G A;  4HHV A;  2UZR A;  2JYE A;  2FIF A;  2WLB A;  3NVW A;  4HPP A;  5HHD G;  1DOI A;  3IAS 1;  1RWS A;  5AUI A;  5H8Y E;  1Z87 A;  4DBB A;  4LTU A;  1U5G A;  5GMV A;  2XQN M;  3LXF A;  4P7I A;  3LB8 C;  4O1N A;  1WGR A;  1UUP A;  2QMT A;  4FBJ B;  2D9Z A;  2BYV E;  4AJY B;  2MJD A;  5D6J B;  5LG4 B;  4AP4 C;  4Z2M B;  2JZP A;  2LRW A;  3N1Y C;  2H88 B;  3N1X C;  1W1D A;  4HAW B;  2FBW B;  2Z0Q A;  1R4N B;  3NZ3 A;  1VRA B;  3W1S C;  2M17 A;  1XT9 B;  3BJI A;  1RFK A;  4WJQ A;  2PIA A;  2GB1 A;  1JDE A;  4REZ A;  3OWE B;  2BKF A;  1V1P A;  1ACC A;  4HRO A;  3N9Y C;  3ZUN A;  2O6V A;  3MDB C;  1YJI A;  4A6K A;  3PGE A;  2LGD A;  3D8D A;  4D0N B;  3VTV A;  2P0H A;  4F7G A;  2KUP A;  3QAQ A;  4JL9 A;  2IFS A;  1F77 A;  1GG3 A;  4GDL A;  3KYD D;  5D3I B;  3O96 A;  5EE9 A;  1IP9 A;  3DHG C;  2LAS A;  4XGA B;  1LQB A;  3WCQ A;  2UZS A;  1WJN A;  1Y8R C;  5C23 A;  1LM8 B;  2NPT B;  1TXD A;  5HI1 A;  4ZOH C;  2EKI A;  1DYN A;  2DFK A;  3IVF A;  4PYU A;  3PP2 A;  4KSK C;  1L4Z B;  4A6H A;  1KOT A;  5DHF B;  2WXJ A;  3N20 C;  3J9C A;  1SGH A;  2LG1 A;  2IO2 B;  2PEA A;  4KGS A;  1X1F A;  1UNR A;  4AUQ C;  3K9P B;  1SXT A;  4MEM A;  1Z5S B;  2UYZ B;  1XLO A;  3VIA A;  1DDM A;  1TZO A;  2K6D B;  3TO1 A;  3OG5 A;  3MHZ A;  3ZGZ A;  1J8C A;  1ENF A;  2WU5 B;  1DOX A;  4M0W A;  4WVF B;  4M00 A;  4WWM A;  4YWG G;  4AJW A;  3RZW C;  2K6Q A;  1YJ1 A;  1BUI C;  4MAC A;  4H8S A;  3OHM B;  4RGO S;  1X05 A;  1I4R A;  4ZHP A;  2MSE D;  1OEY A;  4GNK B;  3DVG Y;  4HRS A;  1T0Y A;  4HWI B;  1QC6 A;  4G50 A;  1ACA A;  4DIX A;  4A5K A;  3R7R A;  4OVZ A;  2BB5 A;  1JWA D;  2MDX A;  5AEK B;  1ESF A;  2WXM A;  3A9J A;  3AEF B;  1FCL A;  4GZU A;  3TJP A;  2FCQ A;  2UU7 A;  1BML C;  1U2B A;  1OQR A;  1H8C A;  3UI3 A;  1D4B A;  4KGT A;  3VTU A;  2ZZP B;  3R7Q A;  3PLU A;  4ILJ A;  2I38 A;  4OVV A;  1WIA A;  1WX7 A;  4CHM A;  2J52 A;  4II2 B;  2L52 A;  3NRZ A;  3L17 A;  2SAK A;  3HQC A;  2C60 A;  2ASQ A;  1MAI A;  2BF8 B;  2KFK A;  2Y3A A;  2GBR A;  3U8Z A;  1NTV A;  1Q5W B;  3APD A;  3HM6 X;  1FFV A;  1RYJ A;  2JYT A;  5C16 A;  1V5T A;  4A8X C;  2AWT A;  2DX1 A;  5DI9 B;  3IFW B;  3E9L A;  1C1Y B;  5HKH A;  1YN4 A;  5HE3 A;  3DVN V;  1L6V A;  4KHB B;  2ELA A;  3UIP B;  2KDE B;  3NOB A;  1SBB B;  3M95 A;  1WI0 A;  2EMS A;  3U2S C;  2R2Q A;  1ZVR A;  1L0Y B;  1DYQ A;  4C7Z A;  2V3N A;  1YQB A;  4NQL B;  2D9X A;  2KHW B;  2YS1 A;  1AWD A;  4H2A A;  3VAW A;  1YN5 A;  3APC A;  1PGB A;  4ARI A;  1FGY A;  4CHJ A;  4HB3 B;  1I7A A;  4MSQ B;  2WXR A;  1UWX A;  2ZJD A;  3P6A A;  1HZ5 A;  4IC7 B;  3ZDM C;  4OZC A;  4C80 A;  4GLS C;  2QHO A;  3VUW A;  3KQ4 A;  3NW8 A;  2V9H A;  1VBH A;  3A8Q A;  3CST A;  1M94 A;  4RH6 A;  2Y8F A;  2JZ3 B;  3F0W A;  4XWT A;  4RGM A;  2LHD A;  2LUE A;  2M56 B;  3ECI A;  1BAK A;  1JW9 D;  2TSS A;  2K8H A;  1OTR B;  2KAN A;  2KLC A;  5I2S A;  3R2T A;  4RGN A;  2LGY A;  2AYO B;  1ZDV A;  4PT5 A;  4QJ5 B;  1WGK A;  1MKE A;  1F0Z A;  3ABV B;  3D8F A;  1I7H A;  1IGC A;  1WJ1 A;  1FCC C;  4J6I A;  1PGA A;  3RUI B;  2OJR A;  1SIF A;  5KHQ A;  2ROZ B;  1KM7 A;  3B2G A;  3ODX A;  3SDL C;  4LNO A;  2M8S A;  2JPH A;  2JUO A;  2DLW A;  2DYM A;  2E3T A;  2L2I A;  3H7P B;  2DAJ A;  4KX6 B;  4RCO A;  5IAA C;  2KMA A;  2D4Q A;  1ZDX A;  4C0A A;  3ODO A;  1MK7 B;  3SUZ A;  1WGY A;  3L13 A;  3IAM 1;  3KH0 A;  2VH2 A;  3ZTC A;  2OHF A;  3ZJU A;  2DBY A;  3RNG C;  5IP4 D;  4N58 A;  2MP2 B;  5IJM A;  1WE6 A;  1UGJ A;  4XDD A;  2KC1 A;  4LCD E;  1MIZ B;  2R09 A;  2BS4 B;  1GB1 A;  2P8V A;  3UQA A;  3FVC A;  1C79 A;  2IDY A;  5JHH A;  3EGR A;  1WMH A;  3VXW A;  3Q2A C;  4GB9 A;  2LWP A;  4HJG E;  1WXV A;  3PRP B;  3PHW B;  2K8B A;  1YN3 A;  4HKQ A;  3KVF B;  2XN9 C;  4WQM A;  2Z0E B;  3AED B;  1U4A A;  4EZK A;  1OFF A;  2BVC A;  3M63 B;  2KZR A;  4CQN A;  1WX8 A;  2ABD A;  3I3T B;  1WGD A;  3I9V 1;  4KKI A;  5M4Y B;  3OAW A;  3RNE C;  3ZYY X;  2BGF A;  5E6J A;  2KTR A;  3DHH C;  2RQ1 A;  3FC4 A;  5J17 A;  2ZNV B;  2QKM A;  5DH9 B;  3ZJT A;  2MWN B;  2WXL A;  3ODW A;  1XO3 A;  2KWV B;  4A6F A;  3N32 A;  3KSY A;  4TQ1 A;  1SB3 C;  3Q3M C;  4ICU A;  4M02 A;  3CF6 E;  4F7U P;  1K5G B;  4IUM B;  3MPX A;  3QC8 B;  4EMO A;  2K49 A;  4RFB A;  3PPA A;  1FFU A;  4K17 A;  2Z59 B;  2IO0 B;  2DHI A;  3A8P A;  2FE8 A;  2IY1 B;  5CX3 A;  2D2Q A;  1K52 A;  3Q8B A;  4QAY A;  3M1I B;  2WQY B;  2IND C;  2LYD A;  4HAU B;  4GU2 A;  1ZC4 B;  1T5X D;  3JSV B;  2RRF A;  5KQ4 A;  2KUQ A;  2YSZ A;  2Z4D A;  4K81 A;  2AX5 A;  1JWU D;  3GS2 A;  2MX2 A;  3TSS A;  4DBG A;  3PZ7 A;  2GBM A;  3AE7 B;  3ENE A;  1JAL A;  2FAZ A;  1WXQ A;  3ML4 A;  2CRF A;  4WAF A;  1FHW A;  1PFJ A;  1V1O A;  4B6H A;  2NBV A;  1RJ2 A;  2I5C A;  3P4P B;  4W9L A;  4LNK A;  5KHO A;  1QOF A;  1FO4 A;  4DXA B;  2HD5 B;  2KGX B;  2LGS A;  1HA5 A;  2UVM A;  2PE9 A;  2Y8G A;  1WXS A;  2WS3 B;  1F2R C;  3MC0 B;  1V5U A;  4L2Y A;  4S0R A;  3TEW A;  1TJE A;  3N3K B;  2PPH A;  3CWI A;  2JXT A;  3AE1 B;  4QXA B;  1MHX A;  1JWS D;  3V3X A;  2KWD A;  1I4Q A;  3U7D A;  2DKQ A;  2CHX A;  3PV1 A;  3TCA A;  3AEA B;  3TFM A;  1SF0 A;  2DZK A;  2YEP B;  2NPT A;  3Q14 C;  2Z0O A;  2WX1 A;  3HVZ A;  4IW0 A;  3UF8 A;  3VVW B;  2V4I B;  4XE0 A;  1GC6 A;  3CIR B;  3H1U A;  3MC9 A;  1KLU D;  1R7S A;  3Q6B A;  2JRI B;  1L6U A;  3VH3 B;  5JVL A;  1MHH E;  3WYF B;  1FEH A;  1TGZ B;  1XR0 B;  3TW1 A;  1X86 A;  4BKS A;  1JWM D;  1F52 A;  2FDQ A;  5L81 A;  1BTN A;  2W82 A;  5BYS A;  1AWE A;  5H92 C;  2KC2 A;  4HKZ E;  2DLB A;  3AN1 A;  1SEB D;  2YS5 A;  3ZTD A;  4FJZ A;  5FKA C;  2PLP A;  4EFO A;  1DDW A;  2IO1 B;  3AMZ A;  2BYE A;  3HK0 A;  3AB5 A;  2R61 A;  4KV2 A;  1KLG D;  2KOX A;  2KT7 A;  1FOE A;  3ZNG C;  2WXK A;  5DPW A;  3PVW A;  1S3S G;  5G5G A;  1E7U A;  2A4Z A;  3A9K B;  2K2J A;  1TZ1 A;  3U4E G;  4GMV A;  4BKG A;  4DHZ B;  1WGQ A;  2KVR A;  5BO4 B;  1P6S A;  2H89 B;  1L5P A;  1LGR A;  5KCV A;  1VLB A;  4HPM B;  1D6E C;  4IM2 A;  1WI1 A;  5MPO A;  2PE6 B;  1NVI D;  2KYW A;  2WXQ A;  3L54 A;  4KIK A;  3A33 B;  1B9R A;  1C76 A;  1JRO A;  3KWV A;  1MPH A;  2JVC A;  1RLF A;  4A3O A;  2G9H D;  1UPR A;  1LB1 A;  4BBK A;  1MFW A;  2D3B A;  2GBJ A;  3RUL A;  2UWQ A;  1GUA B;  1KRH A;  1NEK B;  3DWG C;  3EFC A;  2IY0 B;  4URK A;  1HTQ A;  4MM3 B;  4A90 A;  4XYC A;  3SO6 A;  3TUO A;  1QQR A;  3BII D;  2KAJ A;  5E6N A;  5IA7 A;  3MP9 A;  1P7F A;  4KDI C;  3DQV A;  4W9H A;  2Z0P A;  2KWU B;  2LXA A;  4B6W A;  2KJ6 A;  5J3T A;  3Q8E A;  4NJ7 A;  2DYO A;  1KFY B;  4RM9 A;  1WJM A;  2DA0 A;  1NTY A;  1EWC A;  3O13 A;  4R3D A;  1V80 A;  4JIO U;  3H7S A;  3WAM A;  1IRS A;  3T8M A;  4FAD A;  3AE6 B;  2BWF A;  1VCB A;  1XCQ L;  1M7E A;  3BVG A;  3ZIM A;  2GCL A;  3AEC B;  4P1C C;  1XD3 B;  1GPX A;  1Y56 A;  2D9Y A;  2EEL A;  4K7U A;  5IO9 A;  1WY8 A;  1Q0W B;  4GDK A;  2YT2 A;  3A58 A;  1DGJ A;  2FCS A;  2WXH A;  5JP4 A;  1SJE D;  2LJI A;  3NSU A;  4E3C A;  1N61 A;  2WNM A;  1TKG A;  2YT1 A;  4MJS A;  2KX0 A;  3E9S A;  2WXG A;  1NYR A;  4ARC A;  1HZ6 A;  4MEL A;  2D5G A;  4BFR A;  2KXJ A;  3Q8A A;  3AI5 A;  2CU1 A;  2M14 A;  5D3V A;  1ISN A;  2DWQ A;  4YSZ B;  5FK9 C;  2RLO A;  3FIL A;  1WJ6 A;  4LJO B;  4BVU C;  4IG7 B;  2I2Y A;  3K9O B;  4ANW A;  2IJ0 A;  1IUE A;  3BIN A;  4WAA A;  2MBQ A;  1TT5 B;  4WJN A;  3EA6 A;  3MTN B;  3CXB B;  4K7S A;  1I42 A;  3UIO B;  2CS4 A;  1MVK A;  3BVM A;  3URY A;  5C3J B;  2HRJ A;  1X1G A;  3IXS A;  1QOG A;  4W9E A;  4BKT A;  3MC8 A;  1QOB A;  2CY5 A;  1YIW A;  2I5F A;  1Z2M A;  3L08 A;  1WGH A;  1EUV B;  4JX1 C;  3AH7 A;  5CTR C;  1EVH A;  3AM9 A;  1C4A A;  2OOB B;  1V8C A;  1OQQ A;  1UF0 A;  3GZN B;  4WWP A;  1V5O A;  3DBH I;  4NNJ B;  2D07 B;  3TBL D;  4A3P A;  4JLC A;  1AQC A;  4ZYS A;  2W54 A;  3TIX A;  1ZW7 A;  1V2Y A;  4L1R A;  5D3Y A;  1F9J A;  3IG3 A;  3MJW A;  3V05 A;  4C4V B;  4QJ3 B;  3AE5 B;  4IM0 A;  4YTP B;  2W55 A;  4HAX B;  4OT1 A;  5LNK 1;  2HJ1 A;  2X8X X;  3E66 A;  3AJ4 A;  2PVO D;  2ZPY A;  4LNN A;  2CKH B;  2N23 A;  3NZU A;  1UNP A;  1E8Y A;  4RGT A;  3B08 A;  4E71 A;  1FNW A;  4DDI D;  1HEZ E;  5FR3 A;  1C4C A;  3P4S B;  2BPS A;  4ZYN A;  3A4S C;  3NWF A;  3ENB A;  2KLG A;  1E0Z A;  2RDG A;  3ZW3 A;  2HDE A;  1KBL A;  4A55 A;  2L05 A;  5LOP B;  2GBK A;  2IGD A;  2V1Y A;  3FP5 A;  3D8E A;  1UBI A;  3ONS A;  5HFY A;  3BYY B;  4XZ4 A;  3VUY A;  2NBV B;  4XWW A;  1JRU A;  5LLI A;  1I4P A;  2LMC A;  4ICV A;  2BS3 B;  4K3C A;  4F7H A;  2MW5 A;  3X0W A;  2L7R A;  3ZKJ C;  3RPF C;  3JYU A;  2FUG 1;  3SFE B;  4HEA 1;  4W9D A;  4RNA A;  3EPY A;  2ZCC A;  1VZ6 A;  4W9C A;  3PZD A;  5JH5 C;  3KUD B;  4D2K A;  5HG2 A;  3BK1 A;  5C79 A;  4HAY B;  4JKF A;  3BYT B;  1KF6 B;  1I4X A;  3QX1 A;  2D9V A;  4YSY B;  1SSN A;  2I1K A;  5FI1 A;  4Y94 A;  1MJD A;  1TJ6 A;  1C78 A;  2D9W A;  4JK9 A;  4A20 A;  1SE4 A;  1N6Z A;  1X1M A;  2XEW A;  1TY0 A;  3AE3 B;  1ZKH A;  4KHA A;  1TTN A;  1V1P B;  2XK5 A;  4IM3 A;  1BTK A;  4Q2J A;  5TR5 A;  2C9W B;  4I6L B;  2WGS A;  1T77 A;  4YTN B;  3PVL A;  2JWZ A;  3CIK A;  2KJR A;  1WFY A;  1DBH A;  3WIM A;  3W5U B;  2V3S A;  3HSA A;  1J7C A;  1ZSQ A;  3DDC B;  1RAX A;  4MM3 A;  3AU4 A;  2WXI A;  3VTW A;  1GB4 A;  2DKP A;  3DPD A;  2OQB A;  4WH4 A;  2LVP A;  4BOZ B;  3NHE B;  4ZRQ A;  2WXO A;  4JKG B;  4EZL A;  4WJ7 A;  1V88 A;  1XEE A;  2H7D A;  2EJ8 A;  5BMI A;  4BKS D;  2KFJ A;  5AUK A;  3PVU A;  1V5M A;  2YLM A;  4TV3 A;  4MH0 E;  2Y5C A;  3VR9 B;  1WM2 A;  2KWC A;  3FAH A;  2V0G A;  5D3D A;  4JKD A;  1T0Q C;  2L8J A;  2GS0 A;  2L83 A;  2J53 A;  5E6P A;  3W1S A;  4K2P A;  5D94 A;  2AL3 A;  5L95 C;  4OHJ A;  2G1E A;  2K5P A;  1PUT A;  4IOI E;  1XD4 A;  2KD0 A;  4N59 A;  4WQO B;  3M3J A;  1FD6 A;  2GCJ A;  4DXF A;  3OJ4 B;  3H8H A;  3EFU A;  2R0D A;  2W2X D;  1YOV B;  1V6E A;  1ZC3 B;  2IYB A;  3LDZ E;  4KAX B;  4KDL B;  4MT5 A;  3SBT A;  1XOD A;  3GYP A;  4CHK A;  2BQQ A;  3U12 A;  4JQW C;  2CAY A;  3H7P A;  3GE8 C;  2RDH A;  2BBC A;  3PT2 B;  1T6B X;  4EOY A;  2AEH A;  1WRD B;  3FIL B;  3CSF A;  1PMS A;  1XCT L;  4KHO A;  5LON B;  3JSV A;  3R8B A;  3SEB A;  2NS5 A;  2YVC A;  1NU2 A;  4M01 A;  3BY4 B;  2WDR B;  2ZKM X;  3KY9 A;  2WXP A;  1LO5 D;  2RGN B;  1VZ7 A;  3NS1 A;  1HTO A;  1SIJ A;  1P0R A;  5FI0 A;  2CB8 A;  2N1V A;  3QAR A;  4L1B A;  2ELB A;  3PLV A;  2YT0 A;  2PW9 A;  4JE3 B;  4LDT D;  2INP E;  5C5B B;  1CK1 A;  2K00 A;  1WM3 A;  2ZW0 A;  3N7C A;  4JKA A;  5EDS A;  1OY2 A;  2B76 B;  4K7W A;  3ZRF A;  1VBG A;  2NMQ A;  3G9W A;  4UDU C;  2BWE S;  1WJ4 A;  4EZJ A;  2RD0 A;  2FUH B;  5HE1 A;  4DHJ B;  1OEY J;  2LHE A;  4DWF A;  2R2O A;  4DX9 0;  3VR8 B;  2KDM A;  2K25 A;  4B9K A;  3N30 A;  4TMA B;  2LJ5 A;  2GOW A;  2RGF A;  4HJK A;  1C4P A;  1T0R C;  2PZ1 A;  1CMX B;  1IGD A;  3AE4 B;  1T0S C;  2E2X A;  3P4Q B;  4F1S A;  1KLV A;  2KDB A;  5L83 A;  4F8C B;  2M0X A;  1GAQ B;  2D11 A;  2QCZ A;  1OGW A;  4HB2 B;  3RNB C;  1NDD A;  4WJO A;  2PKO A;  2GRI A;  4WSF A;  1QT9 A;  1P5T A;  1P1A A;  5IKC M;  3JVZ X;  4LJP B;  1ET9 A;  2DX5 B;  3U7Z A;  2CHZ A;  4FHK A;  4RMA A;  2WH5 A;  1V49 A;  1CJE A;  2DHK A;  3C19 A;  1FRD A;  3W9C B;  2HE7 A;  4DHZ E;  1WG7 A;  1UPQ A;  3W2D A;  1P7E A;  1TY2 A;  2N0Y A;  5CHF A;  2VKI A;  2G45 B;  2IPK D;  5HE2 A;  2CJN A;  2LUM A;  2Z59 A;  1FM0 D;  2MLB A;  3HHM A;  4EEW A;  2OTX A;  4TSS A;  4HB0 B;  2ONQ A;  2WDV B;  5BYQ A;  1YJJ A;  4ANU A;  1R4M I;  2BT6 A;  1NBF C;  2CQU A;  1RRP B;  3GYO A;  3FM8 C;  2FJ9 A;  1ZGU B;  1U5E A;  2G35 A;  2K22 A;  2J0J A;  4MGY E;  1CZP A;  1WE7 A;  1F1H A;  2KO3 A;  4FJY A;  3E9O A;  2MKR A;  3TEZ A;  1HXY D;  1QQG A;  1TKE A;  2KTF A;  2NTT A;  4LDT B;  5T8I A;  2M4N A;  4ZRK A;  2FNJ B;  2ZCB A;  1XKE A;  1QZE A;  2N9X A;  4ZRJ A;  2VZK D;  2M1M A;  3U52 E;  4HB4 B;  4F7Z A;  5BMG A;  4HAT B;  1TQZ A;  5KQ1 A;  1JRP A;  1R4N I;  2DIK A;  4C56 C;  1W1G A;  1FHX A;  1HBK A;  1VJK A;  1XF5 L;  4ZDV A;  1OQN A;  3B0A A;  2K1F A;  2DZI A;  3FKY A;  5G5H A;  1N63 A;  1R4M B;  1EF5 A;  2COF A;  4NQK E;  1MG8 A;  3RD2 A;  1AN8 A;  4LNF A;  4P16 A;  4GIV A;  2GMI C;  5AZH A;  1AAR A;  1YX5 B;  3AE9 B;  2ZW1 A;  3UGB B;  4BBN F;  1V61 A;  3DXE A;  1J19 A;  3RN9 C;  3PHX B;  2M38 A;  4FXC A;  4RF0 A;  1E10 A;  4KGR A;  3FEH A;  1J0G A;  3VUX A;  2EKE C;  3ZQ4 A;  2W3R A;  4GDK B;  5DPS A;  3SNH A;  4ILH A;  5AZF A;  1WZ0 A;  4B95 A;  2ZPN A;  3VHT C;  3KW5 B;  3BWU D;  5C5B A;  3WAN A;  3VH4 B;  4GDL B;  4LLG M;  2W2X C;  4LK0 M;  1SE2 A;  2LRU A;  3GOE A;  1SHC A;  4HSI A;  1YMH E;  2ACZ B;  2KNB A;  3V61 A;  3DCG A;  1KH0 A;  2QIE B;  4K2O A;  3AU5 A;  1J0W A;  3ZXR A;  2C7H A;  2P0F A;  1SE9 A;  2N7D A;  5J3Y A;  2YRY A;  1BT0 A;  2DZM A;  2KQ4 X;  2AQ3 B;  2N4F A;  4GN1 A;  1DDV A;  2LXC A;  2RDB C;  3DBR I;  2COA A;  3C0R B;  4WWO A;  2LI5 A;  4K1R B;  4KVG B;  1WZ3 A;  1QF6 A;  3RMK C;  3P42 A;  5BMH A;  3AEB B;  3Q3N C;  1STE A;  3EC8 A;  3UZT A;  2X38 A;  4PS8 A;  3QK0 A;  2X0S A;  3PRM B;  4IAP A;  2V3P A;  3H9D A;  3V5W A;  3ZJV A;  3IT6 B;  2O6V D;  1LW3 A;  3DVN U;  3T3O A;  2COD A;  2MRP A;  3P2B A;  4BAX A;  4DQO C;  4HLE A;  5JXV A;  4G3X B;  1MPE A;  2FJU B;  3OLM D;  1OMW A;  1YX6 B;  5DIF B;  3ZVV A;  4IWP A;  1FHO A;  1ET6 A;  4KHB A;  1E7V A;  2WU2 B;  4HDO A;  4MGI E;  1FXA A;  3LJ3 A;  5IN7 A;  3F5R A;  2LKO A;  4YL8 A;  2COC A;  3X23 A;  2KCJ A;  2FJL A;  1WF9 A;  3MJ5 A;  2CY4 A;  3NZS A;  3L0W B;  2KMC A;  2DAF A;  2CJO A;  3ZNI D;  2N9P C;  4E74 A;  2RSG A;  3SBG A;  4JKH A;  3WAP A;  4AWJ A;  4A9A A;  1EWY C;  3SD5 A;  1DRO A;  2C7M B;  4DDG D;  1MI0 A;  3ML9 A;  3HVD A;  3SHQ A;  1QLB B;  1KI1 B;  3VQI A;  2PJH A;  4N6E B;  5FR6 A;  2Q13 A;  2VZK B;  4P1B C;  3TVV A;  1KZG A;  2FID A;  1C9F A;  1U29 A;  1I35 A;  3TEY A;  2IYD B;  3ZO5 B;  2W2W A;  2SEB D;  3ML8 A;  4HXD A;  2Y5B B;  3NUH B;  2Z0D B;  3B2F A;  3IT4 B;  4MH8 A;  3AE8 B;  3Q3O C;  1MIX A;  2J59 M;  3LYY A;  3RCP A;  4FJV B;  2W3S A;  1ZYI A;  4WUR A;  3FLV A;  4NJ6 A;  3EHV A;  3P63 A;  1FXT B;  5E6O A;  1K53 A;  1WWT A;  2LUL A;  1L0X B;  2JZZ A;  3Q3F A;  2D3A A;  2BYT A;  2YF0 A;  4W9J A;  1E8X A;  4TQ0 A;  1HE8 A;  2DHJ A;  2ZNV C;  4XDC A;  2RVB B;  4FA6 A;  4GOC A;  5IOI A;  3DOW A;  2JF5 A;  4ANV A;  5CHW A;  3GP7 A;  5G2N A;  5D7G A;  3ULB A;  2REX A;  4I6P A;  5DCN A;  4GXB A;  3E56 A;  2WXN A;  2LVO A;  3A4R A;  5AZG A;  1EO6 A;  5HE0 A;  2HTH B;  5EE0 A;  2K8C A;  3MHS D;  1WXM A;  4WWN A;  2JX5 A;  2VRR B;  1GGO A;  2K2U A;  3AXC A;  2QC8 A;  3AV8 A;  3QBV B;  5JZE B;  2X18 A;  3WA0 A;  4Z2N A;  3HM3 A;  1JWB D;  1PQS A;  5I2M A;  2G3Q B;  3A9K A;  3QCA A;  3TL5 A;  4EJN A;  5J3Q A;  2L3Z A;  2LEK A;  1F2R I;  4XC2 A;  4TUU A;  3SYX A;  3B9J A;  3IHP C;  1JQ4 A;  2BCJ A;  2DNF A;  2MCN B;  2NR2 A;  2JT4 B;  3A1Q B;  3ZNH B;  3KRX A;  2KMM A;  2ON8 A;  3PS6 A;  5DHA B;  3DBL I;  4HCN B;  4A6Q A;  1ZE3 D;  1Y19 B;  2AL6 A;  3KUZ A;  1V86 A;  1E8W A;  1SE3 A;  5CLQ B;  5GXG B;  2KIG A;  2P0D A;  1Q10 A;  4EUT A;  2EC1 A;  3AEG B;  4MY6 A;  1T3Q A;  3QA8 A;  2DN6 A;  1IBX B;  2MFQ A;  1IPG A;  1K50 A;  4IOY X;  2LGI A;  1E5W A;  2N9K A;  4FN2 A;  4G11 A;  1FGZ A;  4NZL B;  4B0E A;  3ZDT A;  1I2H A;  1GJZ A;  1JML A;  3P4R B;  1V5P A;  1UD7 A;  4HCP B;  4M8N A;  3U30 A;  4BOS C;  1KTK A;  1UGM A;  1BXT A;  2RSU A;  3B1L X;  4AOF A;  1E8Z A;  1FNV A;  2BYF A;  1WYG A;  1S1Q B;  1UWM A;  2L1A A;  3P7Z A;  1XLN A;  3DBH B;  3H6N A;  2BB6 A;  1D5X C;  3WAL A;  2INN E;  3KRW A;  3IBE A;  2GJY A;  2GLS A;  2J7Q B;  3WAO A;  3QWZ B;  5CHV C;  3S2A A;  3R3M A;  3T06 A;  3UIN B;  3PTF C;  3QQ8 B;  1WYW B;  4TYZ A;  2NBU A;  3VRB B;  3L10 B;  1MK9 B;  4W9F A;  3SR6 A;  3V6E B;  3DCX A;  4ITK A;  1W1H A;  3RNC C;  3DWM A;  2H7E A;  3SU8 X;  4LNI A;  2N9L A;  3E9P A;  1LXD A;  2JXX A;  3V60 A;  4ASW C;  2XNA C;  3RI7 C;  1D3Z A;  1FPY A;  1UEL A;  2KFK B;  2NBW B;  2AQ2 B;  5BYR A;  1I4H A;  2JRH A;  3RNF C;  2YEP F;  2A5U A;  1DOY A;  3N1Z C;  4PQ0 A;  3NWD A;  3CMM B;  2MA9 B;  4RF1 A;  2WWZ A;  3BVZ A;  4NAW B;  1PFD A;  3I57 A;  4JWS C;  3KZ1 A;  3Q3J A;  2AQ1 B;  3DBS A;  4M8M A;  4A6F B;  2WP9 B;  2VSZ A;  4OVU A;  2IZV B;  2MEK A;  1WVH A;  2V4L A;  1IBX A;  2IGH A;  1KC7 A;  2XBB C;  1B1Z A;  4GOU A;  4USA A;  2O6V B;  4DXG A;  3ZXV A;  4HK2 A;  4GSW A;  2RPV A;  2ROV A;  3ZLZ A;  4S17 A;  3KLS X;  1YQ4 B;  1P98 A;  2CU3 A;  1PDX A;  5GOW B;  5EE1 A;  1HB8 A;  1QOA A;  1XLP A;  2NMB A;  1N3H A;  1EM7 A;  1UNS A;  3Q8C A;  3NS8 A;  3EEC A;  1PLS A;  4BBN C;  3PSC A;  2OJW A;  1WXA A;  4MT7 A;  3R2I A;  3M62 B;  2NTS A;  4L6E A;  3PZ8 A;  1N60 A;  4IFS A;  1AYF A;  2KKC A;  3TMP B;  2RNR B;  2KQ7 A;  2NZ8 B;  2GI9 A;  4N9F 4;  4DK5 A;  2IBI B;  2CR5 A;  2M19 A;  1NEN B;  4BZA A;  1BWN A;  1DIK A;  2ADZ A;  3DVG X;  1A70 A;  4MK0 A;  3FSS A;  3APF A;  4OZA A;  2N7J A;  3VDZ A;  1XXG A;  2N7E A;  1HB6 A;  1TS2 A;  1U5F A;  4B0M A;  3DBL B;  3QJZ A;  1UH6 A;  2JY6 A;  1J7A A;  1MI1 A;  3PEG A;  4DHJ D;  2FCM A;  5JHB A;  5D3X A;  2MHJ A;  2VH1 A;  4QJ4 B;  2EMT A;  4NPN A;  2KAC A;  2D3C A;  4MGK E;  4FLH A;  3HRD D;  1E7P B;  4TKN A;  4ANX A;  1YQ3 B;  4L23 A;  1TKY A;  4KKJ A;  4JGH B; 
#chains in the Genus database with same CATH homology
 1Q67 A;  3ALB A;  1EF1 A;  2WYQ A;  4IWO A;  1KZ7 A;  1FAO A;  2IO3 B;  1E90 A;  2J0K A;  2DZJ A;  2C5L C;  2LVQ A;  3W1Y A;  3ZNZ B;  3HW2 B;  2DHZ A;  4JKB A;  1UZX B;  2DYQ A;  4I6N B;  2L1C A;  5LXH A;  4NAW A;  2KX3 A;  1WR1 A;  3ZVR A;  1OQY A;  3A98 B;  5LXI B;  3VFK A;  3L16 A;  4KZ0 A;  1YD8 U;  4KSL C;  5DPR A;  3GZN I;  3R66 C;  1P9D U;  1H4R A;  1K8R B;  5JHG A;  4HVB A;  3PRZ A;  2MBO A;  1WX9 A;  2HJ8 A;  4XWX A;  1TBE A;  2KK8 A;  1ST7 A;  3QIJ A;  3DXD A;  1Q1O A;  2MBE A;  1V9J A;  3OAN A;  2K39 A;  4ZRI A;  1XX0 A;  3PG7 A;  1U27 A;  2O2V A;  1K5D B;  4W9I A;  1ZM0 A;  2J0M A;  4PNK A;  5J2R A;  2ZVO A;  1RFA A;  3RT3 B;  3HIZ A;  3V62 A;  2MWS B;  1NI2 A;  1FB8 A;  1NTI A;  2MQJ A;  3JW0 X;  1P3Q U;  2COP A;  1M7R A;  2CHW A;  3QHT A;  2LBB A;  2V76 A;  4MSM B;  2DYB A;  3AUL A;  4GPT B;  3VOQ A;  2ZVN A;  2LOZ A;  5DPT A;  1WGU A;  3OJ3 A;  5J18 A;  1WGG A;  3RCZ A;  2L0F A;  4X57 B;  3DXC A;  1H10 A;  4MJS B;  2MP2 A;  1L2N A;  3ZRC A;  1GC7 A;  2KJH B;  1XQQ A;  4KZC A;  3PRE A;  4HDQ A;  3KUC B;  4JK8 A;  2C7N B;  2KN5 A;  1KJT A;  1GNU A;  3RYT A;  2WDT B;  1C3T A;  1UBQ A;  1XCG A;  1UEF A;  2HTH A;  4HPL B;  3NY5 A;  4JKE A;  2NVU I;  1U5D A;  3D32 A;  4WJP A;  2LZ6 A;  4W9K A;  1G6J A;  4YON A;  2JP2 A;  1X11 A;  4II3 B;  2BKR B;  2D10 A;  2DEN B;  2KTR B;  2NCN A;  4G0N B;  5D27 A;  1A5R A;  5G55 A;  2XK5 B;  2ZEQ A;  4NY0 A;  5JLJ B;  4PYZ A;  2N1W A;  2LOX A;  3T9L A;  2L0T A;  4DX8 A;  2MBB B;  4PS7 A;  1VD2 A;  1NVL A;  2DYN A;  2Y7B A;  4JKC A;  2WX0 A;  3LJU X;  5JHA A;  1P3R A;  2G4S A;  3O65 B;  4FUL A;  2QKL A;  1UNQ A;  3ULC A;  2KQS A;  3QWM A;  2D3G A;  2LGX A;  4CO7 A;  4NSW A;  5D2M B;  1L7Y A;  2GBN A;  2B3A A;  4HAZ B;  2KDI A;  1V81 A;  3V6C B;  4KIK B;  4JKG A;  4IWQ A;  4EKU A;  5EFX A;  4MGZ E;  4PS3 A;  3RZF A;  5D3W A;  2VRW B;  4M0W B;  2DTC A;  4HAV B;  1Y5O A;  2RUK B;  4ILG B;  1IYF A;  2N9E B;  5C6R A;  1WH3 A;  1WJU A;  4RM8 A;  1EGX A;  5CLL B;  3A9J B;  1EAZ A;  2R82 A;  4JK7 A;  2YS3 A;  3KYC D;  2O2V B;  3PSE B;  2L76 A;  4FHJ A;  1V89 A;  2G4D B;  2LD9 A;  2KDF B;  2RR9 A;  2I1J A;  2RPQ A;  2DX5 A;  1WR6 E;  3A1Q A;  4GGQ A;  1WMH B;  4XX5 A;  2FCN A;  2W9N A;  4MDK E;  5C1Z A;  4GMX B;  3SV1 A;  2L00 B;  3UQB A;  1LFD A;  2MBH A;  1B55 A;  4CYE A;  1RRB A;  4W9G A;  4HHV A;  2UZR A;  2FIF A;  1Z87 A;  4DBB A;  1U5G A;  5GMV A;  2XQN M;  4P7I A;  1WGR A;  4FBJ B;  2D9Z A;  2BYV E;  4AJY B;  5D6J B;  4AP4 C;  4Z2M B;  2LRW A;  1W1D A;  4HAW B;  2Z0Q A;  3W1S C;  2M17 A;  1XT9 B;  3BJI A;  4WJQ A;  1JDE A;  2BKF A;  3ZUN A;  2O6V A;  3MDB C;  3PGE A;  4A6K A;  2LGD A;  3D8D A;  4D0N B;  3VTV A;  2P0H A;  4F7G A;  2KUP A;  3QAQ A;  4JL9 A;  2IFS A;  1GG3 A;  4GDL A;  3KYD D;  3O96 A;  1IP9 A;  2LAS A;  1LQB A;  2UZS A;  1WJN A;  1Y8R C;  5C23 A;  1LM8 B;  2NPT B;  1TXD A;  1DYN A;  2DFK A;  3IVF A;  4PYU A;  3PP2 A;  4KSK C;  4A6H A;  1KOT A;  5DHF B;  1SGH A;  2LG1 A;  2IO2 B;  2PEA A;  1X1F A;  1UNR A;  4AUQ C;  3K9P B;  4MEM A;  1Z5S B;  2UYZ B;  3VIA A;  1DDM A;  2K6D B;  3TO1 A;  1J8C A;  4WVF B;  4AJW A;  3RZW C;  2K6Q A;  1YJ1 A;  4H8S A;  1X05 A;  2MSE D;  1OEY A;  3DVG Y;  1T0Y A;  4HWI B;  1QC6 A;  4G50 A;  1ACA A;  4A5K A;  3R7R A;  2MDX A;  5AEK B;  3A9J A;  4GZU A;  3TJP A;  2FCQ A;  1U2B A;  1H8C A;  3VTU A;  2ZZP B;  3R7Q A;  3PLU A;  4ILJ A;  4OVV A;  1WIA A;  1WX7 A;  4CHM A;  4II2 B;  3L17 A;  3HQC A;  2C60 A;  2ASQ A;  1MAI A;  2BF8 B;  2KFK A;  2GBR A;  3U8Z A;  1NTV A;  1Q5W B;  3APD A;  3HM6 X;  5C16 A;  1V5T A;  2AWT A;  2DX1 A;  5DI9 B;  3IFW B;  3E9L A;  1C1Y B;  5HKH A;  5HE3 A;  3DVN V;  4KHB B;  2ELA A;  3UIP B;  2KDE B;  3NOB A;  3M95 A;  1WI0 A;  2EMS A;  2R2Q A;  1ZVR A;  1YQB A;  4NQL B;  2D9X A;  2KHW B;  2YS1 A;  3VAW A;  3APC A;  1FGY A;  4CHJ A;  4HB3 B;  1I7A A;  4MSQ B;  2ZJD A;  3P6A A;  4IC7 B;  3ZDM C;  2QHO A;  3VUW A;  1VBH A;  3A8Q A;  3CST A;  1M94 A;  2Y8F A;  2JZ3 B;  3F0W A;  2LUE A;  3ECI A;  1BAK A;  2K8H A;  1OTR B;  2KAN A;  2KLC A;  2LGY A;  2AYO B;  1MKE A;  3D8F A;  1WJ1 A;  4J6I A;  3RUI B;  2OJR A;  1SIF A;  5KHQ A;  2ROZ B;  1KM7 A;  3SDL C;  3ODX A;  2M8S A;  2JPH A;  2JUO A;  2DLW A;  2DYM A;  2L2I A;  3H7P B;  2DAJ A;  5IAA C;  2KMA A;  2D4Q A;  4C0A A;  3ODO A;  1MK7 B;  3SUZ A;  1WGY A;  3L13 A;  3KH0 A;  3ZTC A;  2MP2 B;  5IJM A;  1WE6 A;  2KC1 A;  4LCD E;  1MIZ B;  2R09 A;  2P8V A;  3UQA A;  5JHH A;  1WMH A;  3VXW A;  4GB9 A;  2LWP A;  1WXV A;  3PRP B;  3PHW B;  2K8B A;  3KVF B;  2Z0E B;  4EZK A;  1U4A A;  3M63 B;  2KZR A;  1WX8 A;  2ABD A;  3I3T B;  1WGD A;  3OAW A;  2BGF A;  2KTR A;  2RQ1 A;  5J17 A;  2ZNV B;  2QKM A;  5DH9 B;  2MWN B;  3ODW A;  3N32 A;  2KWV B;  4A6F A;  3KSY A;  4TQ1 A;  4ICU A;  3CF6 E;  4F7U P;  1K5G B;  4IUM B;  3MPX A;  3QC8 B;  4EMO A;  3PPA A;  4K17 A;  2Z59 B;  2IO0 B;  2DHI A;  3A8P A;  2IY1 B;  5CX3 A;  2D2Q A;  3M1I B;  2LYD A;  4HAU B;  4GU2 A;  1ZC4 B;  3JSV B;  5KQ4 A;  2YSZ A;  4K81 A;  2MX2 A;  4DBG A;  2GBM A;  3ENE A;  2FAZ A;  3ML4 A;  2CRF A;  1FHW A;  1PFJ A;  4B6H A;  1RJ2 A;  2I5C A;  4W9L A;  5KHO A;  4DXA B;  2HD5 B;  2KGX B;  2UVM A;  2PE9 A;  2Y8G A;  1WXS A;  1V5U A;  3N3K B;  2PPH A;  3U7D A;  2DKQ A;  2CHX A;  3PV1 A;  3TCA A;  3TFM A;  2DZK A;  2NPT A;  2Z0O A;  2WX1 A;  4IW0 A;  3UF8 A;  3VVW B;  1GC6 A;  3H1U A;  2JRI B;  3VH3 B;  5JVL A;  3WYF B;  1TGZ B;  1XR0 B;  3TW1 A;  1X86 A;  4BKS A;  2FDQ A;  5L81 A;  1BTN A;  1AWE A;  2KC2 A;  2YS5 A;  3ZTD A;  4FJZ A;  4EFO A;  1DDW A;  2IO1 B;  2BYE A;  3HK0 A;  4KV2 A;  2KOX A;  1FOE A;  3ZNG C;  5DPW A;  3PVW A;  1S3S G;  1E7U A;  2A4Z A;  3A9K B;  2K2J A;  1TZ1 A;  4GMV A;  4BKG A;  4DHZ B;  1WGQ A;  5BO4 B;  2KVR A;  1P6S A;  5KCV A;  4HPM B;  4IM2 A;  1WI1 A;  2PE6 B;  3L54 A;  4KIK A;  3A33 B;  1MPH A;  2JVC A;  1RLF A;  4A3O A;  1UPR A;  1LB1 A;  4BBK A;  2GBJ A;  3RUL A;  2UWQ A;  1GUA B;  2IY0 B;  4URK A;  3SO6 A;  5E6N A;  5IA7 A;  4KDI C;  3DQV A;  4W9H A;  2Z0P A;  2KWU B;  2LXA A;  4B6W A;  2KJ6 A;  5J3T A;  4NJ7 A;  2DYO A;  4RM9 A;  1WJM A;  2DA0 A;  1NTY A;  1V80 A;  4JIO U;  3H7S A;  3WAM A;  1IRS A;  3T8M A;  4FAD A;  2BWF A;  1VCB A;  3ZIM A;  1M7E A;  2GCL A;  1XD3 B;  2D9Y A;  4K7U A;  1WY8 A;  1Q0W B;  4GDK A;  2FCS A;  5JP4 A;  3NSU A;  4E3C A;  2YT1 A;  4MJS A;  2KX0 A;  4MEL A;  4BFR A;  2KXJ A;  3AI5 A;  2CU1 A;  2M14 A;  5D3V A;  1ISN A;  2RLO A;  1WJ6 A;  4LJO B;  4BVU C;  4IG7 B;  3K9O B;  4ANW A;  3BIN A;  4WAA A;  2MBQ A;  4WJN A;  3MTN B;  3CXB B;  4K7S A;  1I42 A;  3UIO B;  2CS4 A;  2HRJ A;  1X1G A;  4W9E A;  4BKT A;  2CY5 A;  1YIW A;  2I5F A;  1Z2M A;  3L08 A;  1WGH A;  1EUV B;  5CTR C;  1EVH A;  2OOB B;  4WWP A;  1V5O A;  3DBH I;  4NNJ B;  2D07 B;  3TBL D;  4A3P A;  4JLC A;  1AQC A;  3TIX A;  1ZW7 A;  1V2Y A;  5D3Y A;  1F9J A;  3IG3 A;  3MJW A;  4IM0 A;  4HAX B;  3E66 A;  3AJ4 A;  2ZPY A;  2CKH B;  2N23 A;  3NZU A;  1UNP A;  1E8Y A;  3B08 A;  4E71 A;  4DDI D;  2BPS A;  4ZYN A;  3A4S C;  3ENB A;  2KLG A;  3ZW3 A;  1KBL A;  2L05 A;  5LOP B;  2GBK A;  2V1Y A;  3FP5 A;  3D8E A;  1UBI A;  3ONS A;  4XZ4 A;  3VUY A;  2NBV B;  1JRU A;  5LLI A;  4ICV A;  4F7H A;  2MW5 A;  3X0W A;  2L7R A;  3ZKJ C;  3JYU A;  4W9D A;  3EPY A;  2ZCC A;  4W9C A;  3PZD A;  5JH5 C;  3KUD B;  5C79 A;  4HAY B;  4JKF A;  3QX1 A;  2D9V A;  2I1K A;  5FI1 A;  4Y94 A;  1TJ6 A;  2D9W A;  4JK9 A;  4A20 A;  1X1M A;  2XEW A;  1ZKH A;  4KHA A;  1TTN A;  2XK5 A;  4IM3 A;  1BTK A;  5TR5 A;  2C9W B;  4I6L B;  3PVL A;  2JWZ A;  3CIK A;  2KJR A;  1WFY A;  1DBH A;  3WIM A;  2V3S A;  1ZSQ A;  3DDC B;  1RAX A;  4MM3 A;  3AU4 A;  3VTW A;  2DKP A;  3DPD A;  2OQB A;  2LVP A;  4BOZ B;  3NHE B;  4JKG B;  4EZL A;  4WJ7 A;  1V88 A;  2H7D A;  2EJ8 A;  4BKS D;  2KFJ A;  3PVU A;  1V5M A;  2YLM A;  4TV3 A;  4MH0 E;  1WM2 A;  2KWC A;  4JKD A;  2L8J A;  2GS0 A;  5E6P A;  3W1S A;  4K2P A;  5D94 A;  2AL3 A;  5L95 C;  1XD4 A;  2KD0 A;  4WQO B;  3M3J A;  2GCJ A;  3OJ4 B;  3EFU A;  2R0D A;  2W2X D;  1V6E A;  1ZC3 B;  2IYB A;  3LDZ E;  4KAX B;  4KDL B;  3SBT A;  1XOD A;  3GYP A;  4CHK A;  4JQW C;  2CAY A;  3H7P A;  3PT2 B;  4EOY A;  2AEH A;  1WRD B;  3CSF A;  1PMS A;  4KHO A;  5LON B;  3JSV A;  2NS5 A;  2YVC A;  1NU2 A;  3BY4 B;  3KY9 A;  2RGN B;  1P0R A;  5FI0 A;  2CB8 A;  2N1V A;  3QAR A;  2ELB A;  3PLV A;  2YT0 A;  4LDT D;  5C5B B;  2K00 A;  1WM3 A;  3N7C A;  4JKA A;  5EDS A;  1OY2 A;  3ZRF A;  4K7W A;  1VBG A;  3G9W A;  2BWE S;  1WJ4 A;  4EZJ A;  2RD0 A;  2FUH B;  5HE1 A;  4DHJ B;  1OEY J;  4DWF A;  2R2O A;  4DX9 0;  4B9K A;  2K25 A;  3N30 A;  2LJ5 A;  2GOW A;  2RGF A;  4HJK A;  2PZ1 A;  1CMX B;  2E2X A;  4F1S A;  1KLV A;  2KDB A;  5L83 A;  4F8C B;  2M0X A;  2D11 A;  1OGW A;  4HB2 B;  1NDD A;  4WJO A;  4WSF A;  1P5T A;  1P1A A;  3JVZ X;  4LJP B;  2DX5 B;  2CHZ A;  4FHK A;  4RMA A;  2WH5 A;  1V49 A;  2DHK A;  2HE7 A;  4DHZ E;  1WG7 A;  1UPQ A;  2N0Y A;  5CHF A;  2VKI A;  2G45 B;  5HE2 A;  2MLB A;  3HHM A;  4EEW A;  2OTX A;  4HB0 B;  4ANU A;  1R4M I;  1NBF C;  2CQU A;  1RRP B;  3GYO A;  3FM8 C;  2FJ9 A;  1ZGU B;  1U5E A;  2G35 A;  2J0J A;  4MGY E;  1WE7 A;  2KO3 A;  4FJY A;  3E9O A;  2MKR A;  1QQG A;  2KTF A;  4LDT B;  2M4N A;  4ZRK A;  2FNJ B;  2ZCB A;  1XKE A;  1QZE A;  2N9X A;  4ZRJ A;  2M1M A;  4HB4 B;  4F7Z A;  4HAT B;  1TQZ A;  5KQ1 A;  1R4N I;  2DIK A;  1W1G A;  1FHX A;  1HBK A;  4ZDV A;  1OQN A;  3B0A A;  2K1F A;  2DZI A;  1EF5 A;  2COF A;  4NQK E;  1MG8 A;  3RD2 A;  4GIV A;  2GMI C;  5AZH A;  1AAR A;  1YX5 B;  3UGB B;  4BBN F;  1V61 A;  3DXE A;  1J19 A;  3PHX B;  2M38 A;  3FEH A;  1J0G A;  3VUX A;  2EKE C;  4GDK B;  5DPS A;  3SNH A;  4ILH A;  5AZF A;  1WZ0 A;  4B95 A;  2ZPN A;  3VHT C;  3KW5 B;  5C5B A;  3WAN A;  3VH4 B;  4GDL B;  2W2X C;  2LRU A;  3GOE A;  1SHC A;  2KNB A;  3V61 A;  3DCG A;  4K2O A;  3AU5 A;  1J0W A;  2C7H A;  2P0F A;  1SE9 A;  2N7D A;  5J3Y A;  2YRY A;  1BT0 A;  2DZM A;  2N4F A;  4GN1 A;  1DDV A;  2LXC A;  3DBR I;  2COA A;  3C0R B;  4WWO A;  2LI5 A;  4K1R B;  4KVG B;  1WZ3 A;  3EC8 A;  3UZT A;  4PS8 A;  3QK0 A;  2X0S A;  3PRM B;  4IAP A;  3H9D A;  3V5W A;  2O6V D;  1LW3 A;  3DVN U;  2COD A;  2MRP A;  3P2B A;  4HLE A;  4G3X B;  3OLM D;  1OMW A;  1YX6 B;  5DIF B;  3ZVV A;  4IWP A;  1FHO A;  1E7V A;  4HDO A;  4MGI E;  3LJ3 A;  3F5R A;  2LKO A;  4YL8 A;  2COC A;  3X23 A;  2KCJ A;  2FJL A;  1WF9 A;  2CY4 A;  3NZS A;  3L0W B;  2KMC A;  2DAF A;  3ZNI D;  2N9P C;  4E74 A;  2RSG A;  3SBG A;  4JKH A;  3WAP A;  4AWJ A;  3SD5 A;  1DRO A;  2C7M B;  4DDG D;  3ML9 A;  3SHQ A;  1KI1 B;  3VQI A;  2PJH A;  5FR6 A;  2Q13 A;  3TVV A;  1KZG A;  2FID A;  1I35 A;  1U29 A;  2IYD B;  3ZO5 B;  2W2W A;  3ML8 A;  4HXD A;  2Y5B B;  2Z0D B;  1MIX A;  2J59 M;  3RCP A;  4FJV B;  3FLV A;  4NJ6 A;  3EHV A;  1FXT B;  5E6O A;  2LUL A;  2JZZ A;  3Q3F A;  2YF0 A;  4W9J A;  4TQ0 A;  1E8X A;  1HE8 A;  2DHJ A;  2ZNV C;  2RVB B;  4FA6 A;  4GOC A;  3DOW A;  2JF5 A;  4ANV A;  5CHW A;  5G2N A;  5D7G A;  3ULB A;  2REX A;  4I6P A;  5DCN A;  4GXB A;  5AZG A;  2LVO A;  3A4R A;  1EO6 A;  5HE0 A;  2HTH B;  2K8C A;  3MHS D;  1WXM A;  4WWN A;  2VRR B;  1GGO A;  2K2U A;  3AXC A;  3QBV B;  5JZE B;  2X18 A;  3WA0 A;  4Z2N A;  3HM3 A;  1PQS A;  2G3Q B;  3A9K A;  3QCA A;  3TL5 A;  4EJN A;  5J3Q A;  2L3Z A;  4XC2 A;  4TUU A;  3SYX A;  3IHP C;  2BCJ A;  2MCN B;  2NR2 A;  2JT4 B;  3A1Q B;  3ZNH B;  3KRX A;  3PS6 A;  5DHA B;  3DBL I;  4HCN B;  1Y19 B;  2AL6 A;  3KUZ A;  1V86 A;  1E8W A;  5CLQ B;  2P0D A;  4EUT A;  2EC1 A;  4MY6 A;  3QA8 A;  2DN6 A;  2MFQ A;  1IPG A;  4IOY X;  1E5W A;  4FN2 A;  4G11 A;  1FGZ A;  3ZDT A;  1I2H A;  1GJZ A;  1V5P A;  1UD7 A;  4HCP B;  4M8N A;  3U30 A;  4BOS C;  1UGM A;  2RSU A;  3B1L X;  4AOF A;  1E8Z A;  2BYF A;  1S1Q B;  3P7Z A;  3H6N A;  3WAL A;  3KRW A;  3IBE A;  2GJY A;  2J7Q B;  3WAO A;  3QWZ B;  5CHV C;  3S2A A;  3R3M A;  3T06 A;  3UIN B;  3PTF C;  3QQ8 B;  1WYW B;  4TYZ A;  2NBU A;  3L10 B;  1MK9 B;  4W9F A;  3V6E B;  1W1H A;  2H7E A;  3SU8 X;  3E9P A;  1LXD A;  2JXX A;  3V60 A;  4ASW C;  1D3Z A;  1UEL A;  2KFK B;  2NBW B;  2JRH A;  2A5U A;  4PQ0 A;  3CMM B;  2MA9 B;  2WWZ A;  4NAW B;  3KZ1 A;  3Q3J A;  3DBS A;  4M8M A;  4A6F B;  2VSZ A;  4OVU A;  2IZV B;  1WVH A;  2V4L A;  1KC7 A;  2XBB C;  2O6V B;  4HK2 A;  4GSW A;  2ROV A;  3ZLZ A;  1P98 A;  5GOW B;  1HB8 A;  2NMB A;  1N3H A;  3NS8 A;  3EEC A;  1PLS A;  4BBN C;  3PSC A;  1WXA A;  4MT7 A;  3M62 B;  4L6E A;  4IFS A;  2KKC A;  3TMP B;  2RNR B;  2KQ7 A;  2NZ8 B;  4N9F 4;  4DK5 A;  2IBI B;  2CR5 A;  1BWN A;  1DIK A;  2ADZ A;  3DVG X;  4MK0 A;  3FSS A;  3APF A;  3VDZ A;  2N7E A;  1HB6 A;  1U5F A;  3QJZ A;  1UH6 A;  2JY6 A;  4DHJ D;  3PEG A;  2FCM A;  5JHB A;  5D3X A;  2EMT A;  4NPN A;  4MGK E;  4FLH A;  4TKN A;  4ANX A;  4JGH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...