1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
b'MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
1ZVRA 2KWUB 1WR6E 2P8VA 4W9FA 4IM0A 5IJMA 4HB2B 2YLMA 2LGDA 2L76A 4KSLC 2C7MB 4F1SA 2W2XD 4BOSC 2KTRA 1MKEA 4W9DA 5CHWA 3BINA 2RGFA 2WWZA 3DBSA 3H7SA 2YS3A 3RULA 1NI2A 1WGGA 1V5PA 3PVWA 1EVHA 3I3TB 4FJZA 3KUZA 2N7DA 3H6NA 3PTFC 3RZWC 2D9WA 1GG3A 1WGDA 2DAJA 2BPSA 2V76A 3M3JA 2L00B 1UELA 3EC8A 2DX1A 2ZVOA 1FXTB 2MFQA 1TXDA 1YX6B 3AXCA 4B6HA 2N9PC 2O2VB 1M7RA 1FAOA 2MWNB 2LD9A 4BVUC 3UF8A 2KTFA 1ST7A 2MBOA 3VOQA 2GBKA 4B6WA 4BBNF 2JUOA 1ISNA 3ZW3A 4K81A 3Q3JA 2C9WB 4I6NB 1W1GA 3TFMA 2FCNA 3PP2A 2RGNB 2KFKB 2GBJA 4HAXB 3H1UA 2RUKB 3LJUX 2W2WA 1MPHA 4K17A 1UPQA 2I1KA 4IW0A 3KYCD 1RFAA 2ELBA 3ZNZB 4IFSA 2FCSA 2Z0PA 4HB3B 4EUTA 2MP2A 1UBQA 3KRXA 3AI5A 3WALA 3L13A 4MGZE 2W2XC 4HHVA 3ZRCA 1I35A 1FHWA 3TW1A 1QQGA 2KFJA 1DDVA 1U27A 5D3YA 1SGHA 3QHTA 2BWES 1WH3A 3PGEA 4PS8A 4LDTB 3SD5A 2LUEA 3T06A 1U5DA 1XR0B 4IG7B 1WRDB 3TBLD 4M0WB 4E71A 4W9KA 3VUXA 2LOXA 1TJ6A 4DDGD 1WMHB 3V6EB 4E3CA 1YD8U 3H7PA 4MT7A 1PFJA 5L95C 1LQBA 3NS8A 1PQSA 2BGFA 1KJTA 3SNHA 2ASQA 4K2OA 4MDKE 3HK0A 2L8JA 3PVUA 2NCNA 2W9NA 3KYDD 3A9JA 2K00A 2KDFB 5G2NA 4MH0E 3B0AA 5GMVA 1XCGA 3O96A 2N0YA 2CR5A 2IY0B 3TCAA 2PZ1A 1P9DU 2IO2B 1V86A 3DVGY 1OTRB 2Q13A 2UZSA 2NPTA 3DPDA 2EC1A 4GZUA 2JRHA 1MIXA 2MKRA 2RNRB 4JLCA 3ZTDA 3VQIA 5DHFB 5LONB 5E6PA 3U30A 5E6OA 1IP9A 3TJPA 1NU2A 5FI0A 1WYWB 4F7ZA 2MQJA 2RVBB 3R7RA 4NSWA 5KQ1A 2XK5B 3UGBB 2M8SA 4I6PA 2N9XA 2KOXA 1UEFA 1L7YA 4W9HA 4KVGB 3PREA 1RRBA 3SUZA 3PVLA 5EFXA 1WI0A 1UPRA 3ZNHB 1GC6A 3FLVA 3P7ZA 2Y5BB 3SU8X 4LDTD 1Q67A 1WXAA 3V61A 3MPXA 3ECIA 4IAPA 1A5RA 1L2NA 5HKHA 1EUVB 3IVFA 3IHPC 3JSVA 1HE8A 5CHFA 3CSFA 4GU2A 3A9KA 2PE6B 4BBKA 4JL9A 4TKNA 1X05A 1N3HA 4FLHA 1PLSA 5JHBA 2IYDB 2D11A 1XQQA 4IWPA 4GSWA 2JRIB 1WJMA 3OLMD 1AARA 3WAOA 3ZIMA 4W9GA 2R0DA 4ZRJA 2COAA 1GUAB 1MK9B 2KZRA 2ABDA 2Y8FA 4K7UA 4URKA 4KZ0A 2BWFA 4TQ0A 2N9EB 2VSZA 1V5TA 2MSED 3D8DA 2KCJA 1WZ0A 4DBGA 3NSUA 3TL5A 2JWZA 2UYZB 3WYFB 2HRJA 4IWOA 4KDIC 2L05A 3PV1A 4HWIB 2MRPA 1OY2A 3QIJA 4EZKA 2LVPA 3OAWA 5LXHA 1TBEA 3MTNB 2M0XA 3KUCB 2L0FA 3M1IB 3NHEB 4NJ6A 3R3MA 4BFRA 3A4RA 1P1AA 3VH3B 1ZGUB 5C5BB 1OEYA 3NY5A 1D3ZA 4ICVA 4PS7A 2KX3A 3DVNU 3V6CB 2JF5A 1T0YA 1E8WA 1V6EA 3ZVRA 3DDCB 4HCPB 3EPYA 2COFA 4ANUA 1U29A 5IA7A 5DPRA 3V62A 3W1SA 4GN1A 1WGUA 3AU4A 5CLQB 3HW2B 3W1YA 3QQ8B 3PRPB 1WJ4A 1K8RB 4EZLA 4ANWA 5KHOA 2K2UA 4DHZB 4WWNA 3BJIA 2LI5A 3FEHA 2CKHB 1E8XA 3ML9A 5D6JB 3DCGA 4DHZE 4WSFA 2ELAA 1TTNA 1XX0A 2LYDA 5CLLB 1KI1B 3ULCA 3C0RB 2KJ6A 2DYBA 3ODWA 3B08A 4KSKC 1VCBA 2G3QB 2YT0A 3QAQA 2PJHA 5LLIA 1E7UA 4BKSD 3TVVA 5CTRC 2KDEB 2CHZA 3WANA 3DXDA 1K5GB 3LDZE 3KUDB 4G3XB 2LVOA 3K9OB 1I42A 1MK7B 2KTRB 2A5UA 4MEMA 2G35A 2AYOB 3GYPA 4NNJB 1MG8A 2FDQA 2FNJB 4MM3A 3N32A 5D7GA 4GPTB 5AZHA 2G4DB 3PSCA 2DX5A 2NBWB 3ZUNA 1E8ZA 2LJ5A 4Z2NA 1XODA 2K8HA 3VTUA 3TIXA 3R66C 3ZNGC 3ZLZA 5DI9B 3TMPB 2A4ZA 1V80A 1UNQA 2LXAA 1OMWA 4F7GA 3HHMA 2J0KA 1B55A 1V61A 1ZC4B 2B3AA 3ONSA 2LOZA 2LKOA 2I1JA 1S3SG 4TQ1A 1OEYJ 5AEKB 2O6VD 2BF8B 1R4NI 2N7EA 4WWPA 1E8YA 2DYOA 2KGXB 3OJ3A 1LW3A 1WI1A 3RCZA 2IZVB 2M1MA 2OJRA 2MP2B 1BTKA 3SV1A 3QWMA 3ALBA 3QWZB 2GCLA 2FJLA 1R4MI 2LGYA 3JYUA 4A5KA 3BY4B 4EEWA 4HAZB 3DBHI 5L81A 2CS4A 4ZDVA 2HTHA 2KUPA 1WVHA 1LM8B 2J0MA 1TQZA 2KMCA 2KMAA 1V9JA 3PRZA 3ULBA 4B9KA 2YVCA 2M14A 3UQBA 2Y8GA 3A98B 4W9JA 3ODXA 4BKGA 2D9ZA 1QC6A 3R7QA 3H7PB 4M8MA 2BYFA 2N4FA 1WGHA 3SDLC 2V3SA 2QKMA 2XEWA 3S2AA 5DPTA 1IPGA 2DYMA 2PEAA 4HLEA 3WAPA 4II3B 3FM8C 3L54A 2WH5A 3A9JB 1WG7A 4YL8A 3F0WA 2KDIA 3L17A 2C7NB 3ZDTA 2KFKA 1UD7A 3KRWA 4JIOU 3MDBC 2OQBA 3VUWA 2JY6A 4AOFA 4CHKA 2D2QA 3DVNV 4HB0B 3D8FA 2AWTA 2MBBB 1H4RA 3ODOA 1V49A 4IWQA 4F8CB 4GB9A 3V5WA 2MLBA 4NQLB 2D9VA 2H7EA 2NPTB 2KC1A 2CQUA 5C79A 1NBFC 2XQNM 2LULA 4IOYX 3KH0A 1DYNA 4HAUB 2CB8A 4G50A 3TO1A 4MGIE 1WGRA 1NTVA 1J8CA 3U8ZA 5JLJB 1JRUA 5J18A 3VH4B 2J59M 2UWQA 5CHVC 2GOWA 5DIFB 2DYNA 2CY5A 4TYZA 5JHGA 2ROVA 5D27A 4HAWB 2IY1B 3MHSD 1YX5B 4F7UP 2WX0A 2L3ZA 3FP5A 2ADZA 4GDKA 1M94A 2P0HA 2DLWA 2LWPA 2DZIA 1IYFA 1AWEA 4GDLA 4MY6A 3JSVB 4A6FA 3HM6X 3A9KB 2REXA 4FN2A 1KZGA 1QZEA 2DZJA 3EECA 2CY4A 1UNPA 3A1QA 4NAWA 2FCQA 2FCMA 2D10A 5CX3A 2KHWB 1TZ1A 4A3PA 4HJKA 3M63B 2CHXA 1WX7A 4WJ7A 4B95A 2CHWA 1P3RA 1FOEA 4AWJA 5L83A 4MK0A 2ZVNA 1SHCA 3PSEB 4EFOA 2H7DA 1WE6A 3N3KB 1EF1A 1Y19B 1WJUA 2DFKA 1P98A 2MBEA 1WJ6A 1MAIA 4PYZA 5C6RA 1E7VA 1XD4A 3SHQA 3AJ4A 3H9DA 4KHBB 4NY0A 2AL6A 3L0WB 4BBNC 3CXBB 2G4SA 2ZZPB 4GMVA 4GXBA 1Q1OA 2ZCCA 1U4AA 2JT4B 3KVFB 4EKUA 2JPHA 3F5RA 3NOBA 4EZJA 3UQAA 4GIVA 3PHWB 2GS0A 4K2PA 2K1FA 1Z5SB 2C60A 3QA8A 5DH9B 3A4SC 3CIKA 3RD2A 2KWCA 5JP4A 1KZ7A 2FUHB 1RJ2A 1KOTA 1J0WA 1YIWA 4N9F4 2LBBA 3VUYA 2GJYA 4EJNA 1WXMA 2WX1A 5J3QA 4RMAA 1U5EA 1V88A 1OQNA 4XC2A 2KDBA 1HBKA 4GGQA 3VTVA 2NR2A 3APCA 1H10A 2LXCA 4KHOA 3APDA 2DYQA 3IG3A 4KIKA 1GC7A 3VVWB 1W1HA 4G11A 2KLCA 5D2MB 4HAYB 3OANA 4DBBA 3RUIB 2YS5A 2GMIC 1EAZA 1I2HA 1ZW7A 1LB1A 4FHJA 4II2B 2ZPNA 1P3QU 2NVUI 2RQ1A 5JHAA 5C23A 3APFA 3L10B 2Z0QA 3GYOA 2DHKA 2LRUA 2Z0EB 2R09A 1NTYA 5TR5A 1LFDA 2LASA 2QKLA 4X57B 4A6KA 2VRRB 2KX0A 4KHAA 4A6HA 4MELA 3KW5B 1X1GA 2MDXA 3P6AA 4HK2A 4L6EA 2O6VB 2K25A 4NJ7A 1K5DB 1U5FA 1ACAA 2RSGA 4K7SA 4J6IA 5J3YA 3UZTA 2HE7A 3QBVB 2EMSA 3KY9A 1DDMA 1WIAA 1FGYA 2BYVE 4BKTA 2GBNA 2YF0A 3A8QA 4K7WA 4GMXB 3L16A 1IRSA 2D9YA 2MX2A 4E74A 2ZCBA 3T8MA 4KDLB 4W9IA 3ML4A 4KAXB 3N30A 5D3XA 2LVQA 2FAZA 1S1QB 2MA9B 2MBHA 2DX5B 2YRYA 3EFUA 2I5FA 3GOEA 3DQVA 4YONA 2IO3B 4MJSA 3EHVA 5DPSA 4MGKE 4MSMB 2Z59B 2KN5A 3IBEA 4NQKE 1E5WA 3ZKJC 1WJ1A 2MBQA 3ZTCA 3DXCA 4ANXA 1E90A 1P5TA 3RZFA 5JHHA 3PRMB 1SIFA 1KM7A 1SE9A 3ZDMC 3T9LA 5LXIB 3DOWA 1RLFA 4F7HA 4IUMB 2WDTB 3HM3A 4LCDE 4CYEA 1WXSA 3QJZA 1WX9A 2KO3A 3ZRFA 1AQCA 4AJYB 1YJ1A 3M62B 2UVMA 1UZXB 1U5GA 2KQSA 1C3TA 2LZ6A 1NVLA 4KZCA 2KXJA 2YSZA 3CMMB 5C16A 3MJWA 1GNUA 3ENEA 2P0FA 5C1ZA 4HDOA 1HB6A 1V5MA 2R2QA 5JH5C 4RM8A 1NTIA 3SO6A 5FR6A 2HTHB 2DAFA 3D8EA 4FADA 3PLUA 2RLOA 1XT9B 4HDQA 2MWSB 4PQ0A 3WA0A 2QHOA 2RD0A 4BOZB 4DXAB 2DA0A 2K8BA 2JP2A 3B1LX 4WWOA 1U2BA 4LJOB 3VHTC 2KNBA 1DBHA 2HD5B 3QX1A 5HE0A 2IO0B 3W1SC 1ZC3B 2GCJA 1BTNA 4WJOA 4HATB 2OOBB 4AUQC 4P7IA 2CODA 5J2RA 1ZSQA 1P0RA 1UBIA 2CU1A 3PS6A 1Z2MA 2OTXA 1RAXA 2O2VA 2DN6A 2KLGA 5D3WA 2NMBA 4HVBA 1XKEA 2V4LA 4HXDA 3KZ1A 2FIFA 1H8CA 1FHOA 5J3TA 2PE9A 2X18A 4Y94A 2YS1A 4XWXA 3ZVVA 1DROA 1BT0A 4HPLB 1Q5WB 1WF9A 2CAYA 3HIZA 3O65B 3UIPB 2DHJA 2KKCA 4Z2MB 1UH6A 2C5LC 4LJPB 1EGXA 2KJHB 3X23A 4W9CA 1OQYA 2D4QA 3NZUA 4FULA 1WJNA 2NS5A 2Y7BA 2L1CA 2FJ9A 3V60A 2BCJA 3KSYA 4GOCA 2DHZA 3P2BA 4FHKA 3ZO5B 1C1YB 1EO6A 4GDKB 2PPHA 1TGZB 1WY8A 2K39A 1WGYA 2RPQA 5KHQA 2L7RA 3WIMA 1CMXB 2IYBA 3D32A 2D9XA 2D3GA 1G6JA 4GDLB 4A6FB 2RSUA 2UZRA 2AEHA 2COPA 2COCA 3PG7A 2XBBC 2GBMA 4WQOB 2KVRA 1WMHA 3A1QB 4IM3A 2KC2A 4NAWB 4DHJB 2Z0DB 4KV2A 2KJRA 5LOPB 3DBRI 4WJPA 3FSSA 2ZEQA 3L08A 3DXEA 2M38A 5JZEB 2ZNVB 4D0NB 2NBUA 3PPAA 2N1VA 5G55A 3QCAA 1Y8RC 2KK8A 5DCNA 4WJNA 2DENB 3PZDA 2LG1A 4OVVA 1WE7A 2KD0A 5D94A 3IFWB 2D07B 4W9EA 4WJQA 1DDWA 1WM2A 4JGHB 1J0GA 3VDZA 2JZ3B 1V89A 5HE2A 2V1YA 2BKFA 3NZSA 1VD2A 2DKQA 5DHAB 1OGWA 3K9PB 2L2IA 2IBIB 3GZNI 2KQ7A 4H8SA 4K1RB 2WYQA 3WAMA 3ML8A 2YT1A 4HAVB 1V81A 5D3VA 5IAAC 4DX90 4PYUA 3JVZX 3HQCA 1KLVA 2VRWB 2J0JA 1V5OA 4XX5A 1P6SA 2KWVB 2I5CA 4CHMA 3X0WA 2XK5A 3RCPA 2K2JA 2IFSA 3VXWA 3DBLI 3RYTA 2Z0OA 3AULA 4A3OA 4KIKB 3VFKA 4FBJB 4C0AA 2GBRA 1WZ3A 1BAKA 1HB8A 1FGZA 5J17A 3QARA 1WGQA 1WXVA 2J7QB 1MIZB 1X86A 4ASWC 2C7HA 3JW0X 3AU5A 3OJ4B 2E2XA 5FI1A 3M95A 4HCNB 3A8PA 2DTCA 4DHJD 5HE1A 2JVCA 5KCVA 4FJVB 2N1WA 2EKEC 2R2OA 4HB4B 2IO1B 3CF6E 1WM3A 4ZYNA 4EMOA 5HE3A 1W1DA 3CSTA 2G45B 4RM9A 3U7DA 4ICUA 2DZMA 1J19A 4M8NA 2BYEA 3A33B 3G9WA 1Q0WB 2HJ8A 3ZNID 2RR9A 4BKSA 2FIDA 4TV3A 3PLVA 2CRFA 3LJ3A 4TUUA 4PNKA 1ZKHA 2L0TA 2ZPYA 5BO4B 1BWNA 4IC7B 2M17A 2P0DA 2JZZA 4DDID 1PMSA 1RRPB 3VAWA 4FA6A 2M4NA 2EJ8A 2ROZB 1NDDA 1GJZA 2NZ8B 3UINB 5EDSA 1EF5A 3QK0A 4DX8A 4JQWC 2BKRB 1WX8A 2DZKA 4FJYA 3N7CA 3PT2B 4MJSB 4OVUA 4CO7A 5DPWA 5C5BA 1XD3B 2LRWA 4I6LB 4NPNA 2K6QA 3DVGX 1X1FA 4G0NB 4IM2A 3VTWA 4MGYE 4CHJA 4A20A 2AL3A 1F9JA 4XZ4A 1V5UA 4ZRIA 4PS3A 5KQ4A 1FHXA 2K8CA 3RT3B 2NBVB 2N23A 4AJWA 3PHXB 5AZGA 4HPMB 2KANA 2ZNVC 1UNRA 1I7AA 2O6VA 4EOYA 5E6NA 2ZJDA 1WFYA 4DWFA 4WAAA 1X11A 1LXDA 2MCNB 2VKIA 3UIOB 1Z87A 1WR1A 3SYXA 1UGMA 1YQBA 4MSQB 1V2YA 1ZM0A 1Y5OA 4AP4C 4W9LA 3QC8B 5GOWB 2JXXA 2K6DB 1FB8A 2EMTA 2DKPA 1X1MA 4DK5A 2MW5A 1M7EA 3VIAA 3Q3FA 4WVFB 4ANVA 2DHIA 2LGXA 3PEGA 4ZRKA 5AZFA
chains in the Genus database with same CATH superfamily
1ZVRA 2WQYB 3IAS1 2KWUB 1WR6E 2P8VA 4W9FA 4NJCA 2RDGA 4IM0A 5IJMA 4HB2B 2YLMA 4JK7A 2LGDA 2L76A 4KSLC 2NTSA 2C7MB 2Z4DA 4F1SA 2W2XD 3AE7B 2X38A 2JYTA 1JWBD 4BOSC 2OEDA 2KTRA 1MKEA 1F1HA 1DIKA 2K8EA 4W9DA 5CHWA 3BINA 2FBWB 2RGFA 2WWZA 2LJIA 3DBSA 3H7SA 1TKGA 2YS3A 3RULA 4RCOA 1NI2A 1WGGA 2BS4B 3SFEB 1V5PA 2DIKA 3PVWA 1N63A 1EVHA 1ZPSA 3I3TB 4FJZA 2ZW1A 1PYWD 3AB5A 3KUZA 2N7DA 3H6NA 3PTFC 4MT5A 3RZWC 2D9WA 1GG3A 1WGDA 2DAJA 3BIID 2BPSA 2V76A 3M3JA 2L00B 1UELA 3EC8A 2DX1A 4N58A 1ZDVA 3AEFB 5D3DA 2ZVOA 2KVZA 1XCQL 1FXTB 2MFQA 5BYRA 1TXDA 1YX6B 2KN4A 4B6HA 2N9PC 3AXCA 2O2VB 1M7RA 1FAOA 2MWNB 1RFKA 2LD9A 4BVUC 3Q6BA 1N62A 3OWEB 5C3JB 3UF8A 2KTFA 1YQ4B 3MJ5A 1ST7A 4JKFA 2MBOA 3VOQA 2GBKA 4B6WA 4BBNF 2JUOA 1ISNA 3ZW3A 1WYGA 3KWLA 3VRAB 2WHIA 4K81A 3Q3JA 2C9WB 4I6NB 1W1GA 3TFMA 4RH6A 5BYSA 2FCNA 3PP2A 4P16A 2RGNB 3IXSA 3EA6A 1KF6B 2KFKB 2GBJA 3P63A 1B9RA 4HAXB 3H1UA 2RUKB 2PMVA 3LJUX 2W2WA 4QJ3B 1MPHA 3EUB2 4K3BA 1XLPA 4K17A 3SR6A 1UPQA 2I1KA 1AWDA 1C77A 4IW0A 3E9OA 3HRDD 3KYCD 1VBGA 1RFAA 2ELBA 3AE9B 3ZNZB 4RGOS 2QSDA 4IFSA 2FCSA 2Z0PA 4HB3B 4WAFA 4EUTA 2MP2A 1UBQA 3KRXA 3AI5A 1JWAD 4AS1A 2M19A 3WALA 3L13A 4MGZE 4ITKA 1GB4A 2W2XC 4HHVA 3ZRCA 1I35A 2WDRB 1FHWA 3TW1A 1QQGA 2KFJA 4YTMB 1DDVA 5IKCM 1U27A 4HSIA 5D3YA 2W54A 3CIRB 1SGHA 3W5VB 2N7JA 5IP4D 5H8YE 3QHTA 2BWES 1WH3A 1FRRA 2Z8LA 3PGEA 4PS8A 4LDTB 3SD5A 3MHZA 2LUEA 3NZ3A 3T06A 4JKCA 1U5DA 4JKHA 1XR0B 1IGDA 1SF0A 4IG7B 1WRDB 3TBLD 4M0WB 4DQOC 4FXCA 2BTEA 4LNFA 5G5GA 4E71A 1HTOA 4W9KA 4OZAA 3RNGC 3VUXA 2LOXA 2WDQB 1TJ6A 1SE3A 1K51A 4ILHA 1JWMD 2WU5B 3GP7A 4DDGD 1WMHB 3V6EB 4E3CA 1YD8U 1PDXA 3H7PA 1FIQA 1TZOA 4MT7A 4JWUC 1PFJA 2BYTA 5L95C 4ZHPA 1LQBA 4XDDA 3NS8A 1YN4A 3GE8C 3NVVA 1PQSA 3NRZA 2BGFA 4RF1A 2D3CA 2XNAC 1KJTA 1R7SA 3NS1A 3SNHA 2ASQA 4K2OA 4MDKE 1VR9A 3Q3NC 3HK0A 2L8JA 4OT1A 3PVUA 4PK1A 2NCNA 2W9NA 3KYDD 3A9JA 2K00A 2KDFB 5G2NA 1WWTA 3DWGC 3B0AA 4MH0E 3AE6B 2D5GA 5GMVA 4M01A 1XCGA 3O96A 1NENB 2N0YA 2CR5A 2IY0B 3TCAA 2PZ1A 2ACZB 3C19A 3ZQ4A 1P9DU 2IO2B 1RYJA 2QCZA 1V86A 3DVGY 2J42A 4A9AA 1OTRB 2Q13A 1YOVB 2UZSA 2BQQA 2NPTA 3DPDA 2EC1A 3I63C 2H88B 4N6EB 1SJED 2I38A 4GZUA 1L0VB 2JRHA 1MIXA 2MKRA 2RNRB 2V3NA 2L83A 4JLCA 2WXNA 3ZTDA 4USAA 3VQIA 2DWQA 5DHFB 5LONB 5E6PA 2WXQA 3U30A 5E6OA 2NTTA 2IGGA 3R2TA 1IP9A 3TJPA 1SE4A 1NU2A 5FI0A 3FKYA 1WYWB 4F7ZA 2MQJA 2RVBB 3R7RA 4NSWA 5KQ1A 2XK5B 2V9HA 3UGBB 2MJ3A 3FVCA 2M8SA 4I6PA 2N9XA 2KOXA 1UEFA 1L7YA 2IPKD 4W9HA 4KVGB 3PREA 1RRBA 3SUZA 1I7HA 3HVZA 4J3OD 3P4SB 3PVLA 1NYRA 5EFXA 1MG4A 4IOIE 3ENBA 1WI0A 1UPRA 3ZNHB 1GC6A 3FLVA 3P7ZA 2Y5BB 3SU8X 1VLBA 4LDTD 1Q67A 4D2KA 4RGMA 2JX5A 1R4MB 2KMMA 1FFUA 1WXAA 2SEBD 3V61A 3MPXA 3ECIA 4K3CA 4IAPA 1A5RA 3GS2A 1NVID 1L2NA 5HKHA 3SEBA 1EUVB 2W3RA 5H92C 3IVFA 2BT6A 4LNIA 5C2TB 3IHPC 3JSVA 1HE8A 5CHFA 3CSFA 1DOXA 4GU2A 3A9KA 2PE6B 4B0MA 2LHEA 1JW9D 4BBKA 4JL9A 4TKNA 1X05A 2HJ1A 3B9JA 1N3HA 4FLHA 4A90A 1PLSA 1FPYA 5JHBA 2IYDB 3I5JC 1VDVA 2D11A 1A70A 1XQQA 4IWPA 3HUIA 4GSWA 2JRIB 4JKBA 1WJMA 1T3QA 3OLMD 2ICIA 4IDIA 1AARA 4UDUC 3WAOA 1Q10A 4WH4A 5EE9A 3ZIMA 4W9GA 3AH7A 1QOBA 4RGNA 3Q3OC 4PT5A 2R0DA 4ZRJA 2COAA 1GUAB 1MK9B 2KZRA 2ABDA 2Y8FA 1IBXB 4K7UA 4URKA 1C4AA 2VH1A 4KZ0A 1LGRA 2BWFA 1LO5D 4TQ0A 2N9EB 2VSZA 1V5TA 2MSED 4C7ZA 3Q8EA 3D8DA 2KCJA 1WZ0A 4DBGA 3NSUA 4KHBA 3TL5A 1V1PB 4OZBA 2JWZA 1I4XA 2UYZB 4YSXB 1MPEA 1ZOYB 1ET6A 3NVYA 3WYFB 3W5UB 2HRJA 4JKAA 4IWOA 4KDIC 2L05A 3PV1A 1DYQA 2HTME 4HWIB 3ZXVA 3N1ZC 2Z13A 2MRPA 1OY2A 3QIJA 4EZKA 2LVPA 2WP9B 2E6XA 1I4QA 3OAWA 4LNOA 5LXHA 1TBEA 3MTNB 4QAYA 2KIEA 2M0XA 1EU4A 2ZW0A 3KUCB 4OHJA 2L0FA 3M1IB 2K3UA 1YN3A 3NHEB 4NJ6A 3R3MA 4KGTA 1F0ZA 4BFRA 2KDMA 3A4RA 1P1AA 3VH3B 1GGOA 1ZGUB 5C5BB 1OEYA 3NY5A 1D3ZA 4ICVA 4PS7A 2KX3A 3NJTA 4HPPA 3DVNU 2Y5CA 2VZKB 3V6CB 2JF5A 2KIGA 1SB3C 1T0YA 3AEBB 1J7AA 1E8WA 5EE0A 1V6EA 3ZVRA 3DDCB 5IRSA 4HCPB 3EPYA 2COFA 4ANUA 1U29A 5IA7A 4GOUA 5DPRA 4JKGA 2K49A 3V62A 5I4DA 3W1SA 1EU3A 4GN1A 1WGUA 3AU4A 2R2YA 2J52A 5CLQB 3HW2B 3W1YA 3QQ8B 1MHXA 3PRPB 1WJ4A 1K8RB 1L6UA 3R8BA 4EZLA 4NZLB 4ANWA 5KHOA 2K2UA 2QMTA 2INCC 1FMAD 2BS2B 4DHZB 4QJ4B 4WWNA 3RNFC 3BJIA 5HG2A 5IN7A 2LI5A 3FEHA 2CKHB 1E8XA 1D4BA 3ML9A 3RFZB 5D6JB 3DCGA 4DHZE 2VH2A 4WSFA 4KKJA 2WNMA 2ELAA 1ZXIA 1TTNA 1XX0A 2LYDA 5CLLB 2INPE 1KI1B 1MFWA 3ULCA 3C0RB 2KJ6A 2DYBA 3ODWA 3B08A 4KSKC 1VCBA 2G3QB 3B2FA 2YT0A 4JKDA 3QAQA 2PJHA 4TMAB 1NEKB 3AMZA 5LLIA 1E7UA 1OQQA 1T5XD 4BKSD 3TVVA 3AEAB 5CTRC 2KDEB 2CHZA 3WANA 3DXDA 1VJKA 1EWCA 1K5GB 3LDZE 5GXGB 3KUDB 4G3XB 4RNAA 2LVOA 3K9OB 1I42A 1MK7B 2KTRB 2A5UA 1GOZA 4MEMA 2G35A 2AYOB 4ZYSA 3GYPA 4NNJB 1L4DB 1MG8A 2FDQA 2JXTA 2FNJB 4MM3A 3N32A 5JXVA 5D7GA 4GPTB 1E7PB 5AZHA 2G4DB 4YSYB 3PSCA 2DX5A 2NBWB 2WXPA 3ZUNA 1QLBB 3TUOA 1FEHA 1E8ZA 2LJ5A 4Z2NA 1XODA 1D5XC 3TEWA 2K8HA 3VTUA 2VZKD 3TIXA 3R66C 3ZNGC 2Z59A 3ZLZA 3FAHA 4YSZB 5DI9B 2WXFA 3TMPB 2A4ZA 2CJNA 3E9LA 1V80A 1UNQA 2LXAA 5AUIA 2IJ0A 3KQ4A 1OMWA 4F7GA 3HHMA 2J0KA 1B55A 1V61A 1ZC4B 1I4PA 2B3AA 3ONSA 2LOZA 1IGCA 2LKOA 3E66A 2I1JA 1S3SG 4TQ1A 3ZJVA 1OEYJ 5AEKB 2O6VD 5G5HA 1AN8A 2BF8B 1R4NI 2N7EA 1SIJA 5BYQA 1QT9A 4WWPA 5E6JA 3W9CB 1E8YA 2DYOA 2YT2A 2KGXB 3OJ3A 1L5PA 1UGJA 1LW3A 1WI1A 4EE2A 3RCZA 2IZVB 1TS3A 2M1MA 4YT0B 2OJRA 3LB8C 2MP2B 3HVDA 3U2SC 1QOGA 3BK1A 1BTKA 4QXAB 2L1AA 3SV1A 2W82A 3QWMA 3ALBA 2WXKA 2AQ3B 2PLPA 3QWZB 2GCLA 2FUG1 3OG5A 2FJLA 1KC7A 1R4MI 2LGYA 3JYUA 4A5KA 3BY4B 4EEWA 4HAZB 2M56B 1ESFA 5LNK1 3DBHI 5L81A 2CS4A 3RNBC 5BMHA 4LNNA 4ZDVA 4HEA1 5BMIA 2HTHA 2KUPA 3NWAA 4OZCA 1WVHA 1F52A 4A55A 2PW9A 1LM8B 2J0MA 1TQZA 2KMCA 2KMAA 1V9JA 3PRZA 3ULBA 4XWWA 3Q2AC 4B9KA 2YVCA 3AEEB 2M14A 3UQBA 2Y8GA 3AN1A 3A98B 4W9JA 3ODXA 1IUEA 1FNUA 1AW7A 4BKGA 2D9ZA 2RRFA 3RI7C 1QC6A 1CK1A 3R7QA 2PVOD 3H7PB 4M8MA 2BYFA 2N4FA 1WGHA 3SDLC 1ZE3D 1TS2A 2V3SA 4DXGA 2QKMA 2XEWA 3S2AA 5DPTA 1IPGA 1C9FA 1FCCC 2DYMA 2PEAA 3VR8B 4HLEA 4IKGA 3WAPA 4II3B 3FM8C 3L54A 2DLBA 2WH5A 3A9JB 1WG7A 2INNE 3NVZA 4YL8A 3Q8BA 3F0WA 2XN9C 4ILGB 1JRPA 2KDIA 3L17A 2C7NB 3ZDTA 2KFKA 2L52A 1UD7A 4HRSA 2L32A 2Y3AA 3KRWA 4JIOU 1CZPA 3MDBC 2OQBA 3VUWA 3AE4B 2JY6A 4AOFA 4CHKA 2D2QA 3DVNV 3ZYYX 4HB0B 3D8FA 2AWTA 2MBBB 1H4RA 3ODOA 1V49A 4JKEA 4IWQA 4F8CB 4GB9A 3V5WA 2MLBA 4NQLB 1QF6A 2D9VA 2H7EA 2NPTB 1JWSD 2KC1A 2CQUA 3ABVB 3A58A 3BYYB 4LK0M 5C79A 1KLGD 1NBFC 3MC9A 1XO3A 2XQNM 2LULA 4IOYX 3KH0A 1OQRA 3KLSX 3BVZA 3IT6B 1DYNA 4HAUB 2CB8A 4G50A 3TO1A 4P1BC 4MGIE 1WGRA 1NTVA 1J8CA 3U8ZA 5JLJB 1JRUA 4XGAB 1GB1A 3BWUD 3V3XA 5J18A 4ZRQA 3VH4B 2J59M 3NUHB 4M0WA 2UWQA 3I9V1 3FILB 4JWSC 1ZXHA 5CHVC 1XLQA 3TEXA 4US8A 2GOWA 5DIFB 1SJHD 2DYNA 2CY5A 4TYZA 5JHGA 4ZRPA 2SAKA 2ROVA 5D27A 3SFDB 4HAWB 2IY1B 5EE3A 3AE5B 1UWMA 3MHSD 1N6ZA 1YX5B 3O13A 4F7UP 1J7CA 1C78A 1F2RC 2L3ZA 2WX0A 1ZP0B 3FP5A 2ADZA 3MC8A 4GDKA 1M94A 3TEYA 4L1RA 2P0HA 1VZ6A 2DLWA 5IOIA 2LWPA 1TY0A 2DZIA 2K9XA 3NVWA 1R4NB 2EKIA 4S17A 1JQ4A 1IYFA 1PFDA 1AWEA 4GDLA 4MY6A 3N9YC 3JSVB 4A6FA 1FRDA 5BMGA 1KTKA 3RPFC 2WU2B 3HM6X 3A9KB 2REXA 4FN2A 1KZGA 1QZEA 3NWDA 2DZJA 3EECA 1PGAA 2CY4A 4XYCA 1UNPA 2LGIA 1Y56A 3A1QA 4NAWA 2FCQA 2FCMA 2D10A 5CX3A 1GAQB 2KHWB 2DNFA 2UU7A 1TZ1A 4A3PA 3SBTA 3M63B 4HJKA 2CHXA 1WX7A 4WJ7A 4B95A 4ARIA 2CHWA 1P3RA 1N5XA 1FOEA 4AWJA 5L83A 4JK9A 4MK0A 3RMKC 2ZVNA 1SHCA 5FKAC 4L2YA 3PSEB 4EFOA 2H7DA 3DBHB 1WE6A 3N3KB 1FO4A 1EF1A 1Y19B 4CSQA 1WJUA 2DFKA 1P98A 2MBEA 1WJ6A 1MAIA 1YJJA 1WRIA 2YEPF 5C6RA 4PYZA 1E7VA 1XD4A 3U52E 3T3OA 3SHQA 3AJ4A 2J53A 3H9DA 4KHBB 4NY0A 2AL6A 3L0WB 2MH7A 4BBNC 3CXBB 1F2RI 2G4SA 2BW2A 2ZZPB 4GMVA 3IT4B 4GXBA 5I2MA 1Q1OA 1FD6A 2ZCCA 1U4AA 2JT4B 3KVFB 4EKUA 2WXIA 3P42A 2JPHA 3R2IA 3F5RA 3NOBA 4EZJA 3UQAA 4GIVA 3URYA 1JCKB 3PHWB 2GS0A 4K2PA 2K1FA 1Z5SB 2C60A 3QA8A 3DHGC 5DH9B 3A4SC 3CIKA 3RD2A 2KWCA 5TSSA 5JP4A 1KZ7A 3N1YC 2FUHB 3PO0A 1RJ2A 1KOTA 1J0WA 1YIWA 3EFCA 4N9F4 2LBBA 3VUYA 2GJYA 4EJNA 1WXMA 2WX1A 5J3QA 4RMAA 4US9A 1U5EA 1AYFA 1V88A 1OQNA 2Z14A 2J4XA 4XC2A 2KDBA 1HBKA 4RF0A 4GGQA 3VTVA 2NR2A 2QILA 3APCA 1H10A 2LXCA 4KHOA 1ET9A 3APDA 4L1BA 2DYQA 3IG3A 4KIKA 1GC7A 3VVWB 2MJDA 4JKGB 1W1HA 3RNAC 4G11A 3VRBB 2KLCA 4MACA 5D2MB 4HAYB 4GLSC 3OANA 4DBBA 3FC4A 3RUIB 1C4PA 2YS5A 2GMIC 1EAZA 4C4VA 1I2HA 1ZW7A 1LB1A 1TS5A 1YMHE 4C00A 4FHJA 4HKZE 3RNCC 4II2B 2ZPNA 1P3QU 1CJEA 2TSSA 2NVUI 2V3PA 2AQ2B 1SXTA 2KACA 2RQ1A 1XF5L 1IBXA 5JHAA 3T3NA 5C23A 3APFA 3MFGA 3L10B 2Z0QA 3P4PB 3GYOA 2DHKA 2LRUA 2Z0EB 3DHIC 2RDHA 2MJEA 2R09A 1NTYA 5TR5A 1LFDA 2LASA 2FJUB 2QKLA 1WSPA 2W3SA 4X57B 4A6KA 4H2AA 2VRRB 2KX0A 2LGSA 3TSSA 4XE0A 1ZYIA 4KHAA 2WDVB 2X8XX 3DBRB 4A6HA 3Q3MC 4GNKB 4MELA 4HJGE 3KW5B 1X1GA 2MDXA 3AECB 3P6AA 1MI0A 5LG4B 4HK2A 4L6EA 2O6VB 2K25A 4JX1C 4NJ7A 1K5DB 1U5FA 4ARCA 3Q8CA 1ACAA 4WURA 2RSGA 5HI1A 4K7SA 3N20C 4J6IA 5J3YA 5D3IB 4OSNA 3UZTA 2QEJC 2HE7A 3LXFA 3QBVB 2EMSA 2JYEA 3KY9A 1WGKA 1DDMA 1WIAA 3ETRA 1FGYA 2BYVE 4BKTA 2OHFA 2GBNA 2YF0A 3A8QA 4K7WA 4GMXB 3L16A 1IRSA 2OJWA 3U4EG 2D9YA 2MX2A 4E74A 2ZCBA 3AEDB 2Q5WD 3T8MA 4KDLB 2WXOA 2IDYA 4S0RA 4W9IA 3ML4A 4KAXB 3N30A 4MM3B 5D3XA 2LHDA 2LVQA 2FAZA 1S1QB 2MA9B 2MBHA 1UF0A 3GZNB 2DX5B 2YRYA 3EFUA 1EWYC 2I5FA 3GOEA 5IO9A 3DCXA 4C7YA 3DQVA 4YONA 3RN9C 2IO3B 4MJSA 3EHVA 2K22A 5DPSA 4MGKE 4MSMB 1N5WA 1GPXA 3HSAA 1XXGA 2Z59B 2KN5A 3GE3C 3IBEA 2LFIA 4NQKE 1E5WA 4MH8A 5AUKA 4AQ7A 1OFFA 1XEEA 3ZKJC 1WJ1A 2MBQA 4LTUA 3ZTCA 3DXCA 4ANXA 1E90A 4C80A 1P5TA 3RZFA 2NBVA 5JHHA 3U7ZA 3PRMB 3UI3A 1SIFA 1KM7A 1SE9A 3VR9B 3ZDMC 1TJEA 3T9LA 5LXIB 3DOWA 1RLFA 1L0YB 2WXJA 4F7HA 1QKZA 4IUMB 3AEGB 2WDTB 1I4RA 3HM3A 4LCDE 4CYEA 1C79A 1WXSA 3QJZA 4KGRA 1WX9A 4TSSA 1RM6C 2KO3A 3ZJUA 3ZRFA 1QILA 1AQCA 1BUIC 4AJYB 1K50A 1YJ1A 3M62B 4C56C 2UVMA 1UZXB 1U5GA 1VZ8A 4O1NA 1HXYD 1STEA 2KQSA 1C3TA 2LZ6A 1NVLA 1HA5A 4KZCA 2KXJA 5FR3A 2YSZA 3CMMB 5C16A 3MJWA 1GNUA 1MI1A 1KBLA 3ENEA 3Q8AA 2P0FA 5C1ZA 4HDOA 1HB6A 3TEZA 1V5MA 4N59A 1KLUD 2R2QA 5JH5C 3P4RB 4XWTA 1B1ZA 4RM8A 1NTIA 3SO6A 2HTHB 5FR6A 1L6VA 2DAFA 3D8EA 4FADA 1F77A 1TYGB 3PLUA 2KUQA 2KAJA 2R61A 2RLOA 1XT9B 4HDQA 2MWSB 4PQ0A 1MJDA 3WA0A 4KKIA 1YQ3B 2QHOA 1SBBB 2RD0A 4BOZB 4DXAB 2DA0A 2K8BA 2JP2A 3B1LX 1UNSA 1V97A 4WWOA 1U2BA 4LJOB 3AE8B 3E9SA 3VHTC 2KNBA 1DBHA 2HD5B 3QX1A 3AE2B 5HE0A 2IO0B 3W1SC 2K0PA 1ZC3B 2GCJA 2Y5PA 1BTNA 4WJOA 4HATB 2OOBB 1L4ZB 2AX5A 4A6QA 4AUQC 4P7IA 2B76B 2X0SA 2CODA 4D6WA 5J2RA 1ZSQA 1P0RA 4ACFA 1ZDXA 1UBIA 2CU1A 2WXMA 2R82A 4ZOHC 3W2DA 3PS6A 1Z2MA 4P1CC 1HQRD 2OTXA 1RAXA 2O2VA 4YTPB 5MPOA 2DN6A 2GUMA 2KLGA 1FCLA 1PGBA 2PIAA 5D3WA 2NMBA 4HVBA 1XKEA 2LEKA 2QJLA 2QDFA 2V4LA 4HXDA 3KZ1A 2BVCA 2FIFA 1H8CA 1HZ6A 2KWDA 3BVMA 1FHOA 5J3TA 3J9CA 2PE9A 2X18A 4Y94A 2YS1A 2V4IB 3AV8A 2KYWA 4XWXA 3ZVVA 4Q2JA 1DROA 4XDCA 1MVKA 1BT0A 4HPLB 2PVGC 1Q5WB 1FNWA 2FE8A 2WS3B 1YJIA 1WF9A 3DWMA 2CAYA 1EM7A 3HIZA 3ZXRA 3AE1B 1UWXA 3O65B 2KT7A 2DHJA 3UIPB 2KKCA 4Z2MB 1HZ5A 1UH6A 2C5LC 4LJPB 1EGXA 1VRAB 3X23A 2KJHB 1E10A 4W9CA 3LYYA 1OQYA 2D4QA 3NZUA 4CQNA 4FULA 1WJNA 4M00A 2JU6X 4QJ5B 2NS5A 2Y7BA 2RMMA 2L1CA 5JVLA 2FJ9A 3V60A 3IAM1 2H89B 1MHHE 2BCJA 3KSYA 4GOCA 2GB1A 2DHZA 1TY2A 3P2BA 4FHKA 3ZO5B 1C1YB 1EO6A 2PPHA 4GDKB 2G1EA 1TGZB 1WY8A 2LMCA 2K39A 1NYQA 1WGYA 2RPQA 2WXRA 4P6VF 5KHQA 1YNTE 2L7RA 1E9MA 3WIMA 1CMXB 2IYBA 3D32A 2D9XA 1C4CA 2D3GA 3Q14C 3V05A 1G6JA 2V0GA 4JK8A 2BBCA 2W55A 4GDLB 3BYTB 5HFYA 4A6FB 1ACCA 1SSNA 2KQ4X 2RSUA 2AEHA 2COPA 2COCA 2UZRA 3PG7A 1VZ7A 2XBBC 2G9HD 2GBMA 4WQOB 1FXAA 2KVRA 2GLSA 1WMHA 3KWVA 4HKQA 3A1QB 4IM3A 2KC2A 4NAWB 4DHJB 2Z0DB 4KV2A 2KJRA 5LOPB 3DBRI 1XLNA 4WJPA 3L4PA 3FSSA 1I4GA 2ZEQA 3L08A 5M4YB 1HEZE 3DXEA 1E6EB 2M38A 2M0AA 2WGSA 3N1XC 5JZEB 1DOYA 2ZNVB 1CQVA 3SBGA 3AE3B 4D0NB 1TKEA 2KR0A 1DOIA 2BB6A 2NBUA 3Q8FA 3PPAA 2N1VA 5I2SA 3QCAA 5G55A 1E0ZA 3NG0A 4YTNB 1Y8RC 2KK8A 5DCNA 4WJNA 2DENB 3PZDA 1PGXA 2LG1A 2AQ1B 3BVGA 4OVVA 1JDEA 1WE7A 2KD0A 3GB1A 5D94A 3IFWB 2D07B 4W9EA 4WJQA 1DDWA 1WM2A 4JGHB 4KX6B 1D5ZC 2IGHA 1J0GA 1PUTA 1V1OA 3VDZA 2JZ3B 1TT5B 1V89A 5HE2A 2V1YA 2BKFA 3NZSA 5EE1A 3FILA 1VD2A 1T0QC 5HHDG 2DKQA 4OW0A 2YEPB 1P7FA 2QC8A 5DHAB 1OGWA 3K9PB 2L2IA 1N61A 2IBIB 3GZNI 2KQ7A 4H8SA 4K1RB 4RGTA 2BS3B 3PZ7A 2WYQA 3WAMA 4B0EA 4WIPA 1JALA 3ML8A 5T8IA 2YT1A 4HAVB 1V81A 2INDC 4L23A 5D3VA 1FXIA 5IAAC 4DX90 4PYUA 3JVZX 1DGJA 3HQCA 1KLVA 4ILJA 2VRWB 2J0JA 1V5OA 4XX5A 1P6SA 2KWVB 2I5CA 4WQMA 4CHMA 2CJOA 3X0WA 2XK5A 3RCPA 2K2JA 3E56A 4NAMA 2IFSA 3VXWA 3DBLI 3RYTA 2Z0OA 3AULA 4A3OA 1XLOA 3MP9A 4KIKB 2WLBA 3VFKA 4FBJB 4C0AA 1FNVA 3U12A 2GBRA 1WZ3A 1BAKA 1TIFA 1HB8A 1FGZA 5J17A 3QARA 2MEKA 4C4VB 1WGQA 1WXVA 4YWGG 4DXFA 1K53A 2J7QB 3P1MA 1MIZB 1X86A 3Q69A 4ASWC 4LLGM 4REZA 2N9LA 2C7HA 2E3TA 3JW0X 3AU5A 3OJ4B 2E2XA 5FI1A 2GRIA 2ON8A 3M95A 4HCNB 2IGDA 3A8PA 3EGRA 2DTCA 4DHJD 5HE1A 1QOAA 2DBYA 2JVCA 1TS4A 5KCVA 1VBHA 2I2YA 4FJVB 1NI3A 2BB5A 2N1WA 1QOFA 2EKEC 2R2OA 4HB4B 2IO1B 3BK2A 3P4QB 3CF6E 1WM3A 5FK9C 4ZYNA 4EMOA 1QQRA 5HE3A 1W1DA 1KRHA 3CSTA 2G45B 1TKYA 1SE2A 4OVZA 4RM9A 2LUMA 3U7DA 1ENFA 4ICUA 2DZMA 1J19A 1JMLA 4M8NA 2BYEA 3A33B 1KH0A 2ONQA 3G9WA 1Q0WB 1XCTL 2HJ8A 2K5PA 1ZUD2 2JQRB 3ZNID 1BMLC 2RR9A 2D3BA 1D6EC 3OHMB 4BKSA 2FIDA 4TV3A 3PLVA 2CRFA 1JROA 2NMQA 3LJ3A 2CU3A 4RFBA 4TUUA 2JWUA 4PNKA 1V1PA 4LNKA 4BZAA 1HTQA 1ZKHA 2WXHA 3MC0B 2L0TA 2ZPYA 3H8HA 5BO4B 1BWNA 4IC7B 2M17A 2P0DA 1FFVA 2JZZA 4DDID 1PMSA 1RRPB 3VAWA 4M02A 3DHHC 1SEBD 2M4NA 4FA6A 2QIEB 2RDBC 2EJ8A 2ROZB 1NDDA 1GJZA 1BXTA 2NZ8B 1P7EA 1T0SC 3UINB 5EDSA 1T0RC 1EF5A 4YXDB 3QK0A 1M4VA 2EELA 1C76A 4HROA 2WXLA 4DX8A 4JQWC 1WXQA 4WWMA 2BKRB 3WCQA 3CWIA 1UUPA 1WX8A 2DZKA 4FJYA 3N7CA 4R3DA 3PT2B 4MJSB 4OVUA 4CO7A 5DPWA 5C5BA 1XD3B 2LRWA 4I6LB 4NPNA 2K6QA 4ZHOA 3DVGX 1X1FA 4G0NB 1N60A 4IM2A 3VTWA 4MGYE 4CHJA 4A20A 2AL3A 4KGSA 1F9JA 4XZ4A 1V5UA 3E9PA 1L0XB 4ZRIA 4A8XC 4PS3A 5KQ4A 1FHXA 2K8CA 4JE3B 1FM0D 3RT3B 4BAXA 2NBVB 2N23A 1ROEA 4AJWA 2ZKMX 3PHXB 5AZGA 4HPMB 2GI9A 3PZ8A 2KANA 1JWUD 2JZPA 2ZNVC 1UNRA 1KFYB 1I7AA 2PTLA 3NW8A 3I57A 1J7BA 1T6BX 2N0SB 2WXGA 2O6VA 2JSVX 4EOYA 5E6NA 4DIXA 1D5MC 2ZJDA 1WFYA 4DWFA 4WAAA 1X11A 1LXDA 2MCNB 2VKIA 3RNEC 2MHJA 3UIOB 1Z87A 1WR1A 3SYXA 1UGMA 1YQBA 4MSQB 1K52A 1V2YA 1ZM0A 1Y5OA 4AP4C 3ZJTA 4W9LA 2N9KA 2D3AA 4JPSA 1T77A 3QC8B 3ZGZA 5GOWB 1RWSA 3DBLB 2JXXA 3BZDB 2K6DB 3B77A 1FB8A 1I4HA 2EMTA 2DKPA 1X1MA 4DK5A 2MW5A 3B2GA 1M7EA 3VIAA 2HDEA 3Q3FA 3C8YA 4WVFB 1YN5A 4ANVA 3AM9A 2DHIA 3NWFA 2RPVA 2LGXA 1V8CA 3PEGA 4ZRKA 3HIEA 5AZFA 2PKOA
chains in the Genus database with same CATH topology
1ZVRA 2KWUB 1WR6E 2P8VA 4W9FA 4IM0A 5IJMA 4HB2B 2YLMA 4JK7A 2LGDA 2L76A 4KSLC 2C7MB 4F1SA 2W2XD 4BOSC 2KTRA 1MKEA 1DIKA 4W9DA 5CHWA 3BINA 2RGFA 2WWZA 3DBSA 3H7SA 2YS3A 3RULA 1NI2A 1WGGA 1V5PA 2DIKA 3PVWA 1EVHA 3I3TB 4FJZA 3KUZA 2N7DA 3H6NA 3PTFC 3RZWC 2D9WA 1GG3A 1WGDA 2DAJA 2BPSA 2V76A 3M3JA 2L00B 1UELA 3EC8A 2DX1A 2ZVOA 1FXTB 2MFQA 1TXDA 1YX6B 3AXCA 4B6HA 2N9PC 2O2VB 1M7RA 1FAOA 2MWNB 2LD9A 4BVUC 3UF8A 2KTFA 1ST7A 4JKFA 2MBOA 3VOQA 2GBKA 4B6WA 4BBNF 2JUOA 1ISNA 3ZW3A 4K81A 3Q3JA 2C9WB 4I6NB 1W1GA 3TFMA 2FCNA 3PP2A 2RGNB 2KFKB 2GBJA 4HAXB 3H1UA 2RUKB 3LJUX 2W2WA 1MPHA 4K17A 1UPQA 2I1KA 4IW0A 3E9OA 3KYCD 1VBGA 1RFAA 2ELBA 3ZNZB 4IFSA 2FCSA 2Z0PA 4HB3B 4EUTA 2MP2A 1UBQA 3KRXA 3AI5A 3WALA 3L13A 4MGZE 2W2XC 4HHVA 3ZRCA 1I35A 1FHWA 3TW1A 1QQGA 2KFJA 1DDVA 1U27A 5D3YA 1SGHA 3QHTA 2BWES 1WH3A 3PGEA 4PS8A 4LDTB 3SD5A 2LUEA 3T06A 4JKCA 1U5DA 4JKHA 1XR0B 4IG7B 1WRDB 3TBLD 4M0WB 4E71A 4W9KA 3VUXA 2LOXA 1TJ6A 4ILHA 4DDGD 1WMHB 3V6EB 4E3CA 1YD8U 3H7PA 4MT7A 1PFJA 5L95C 1LQBA 3NS8A 1PQSA 2BGFA 1KJTA 3SNHA 2ASQA 4K2OA 4MDKE 3HK0A 2L8JA 3PVUA 2NCNA 2W9NA 3KYDD 3A9JA 2K00A 2KDFB 5G2NA 4MH0E 3B0AA 5GMVA 1XCGA 3O96A 2N0YA 2CR5A 2IY0B 3TCAA 2PZ1A 1P9DU 2IO2B 1V86A 3DVGY 1OTRB 2Q13A 2UZSA 2NPTA 3DPDA 2EC1A 4GZUA 2JRHA 1MIXA 2MKRA 2RNRB 4JLCA 3ZTDA 3VQIA 5DHFB 5LONB 5E6PA 3U30A 5E6OA 1IP9A 3TJPA 1NU2A 5FI0A 1WYWB 4F7ZA 2MQJA 2RVBB 3R7RA 4NSWA 5KQ1A 2XK5B 3UGBB 2M8SA 4I6PA 2N9XA 2KOXA 1UEFA 1L7YA 4W9HA 4KVGB 3PREA 1RRBA 3SUZA 3PVLA 5EFXA 3ENBA 1WI0A 1UPRA 3ZNHB 1GC6A 3FLVA 3P7ZA 2Y5BB 3SU8X 4LDTD 1Q67A 1WXAA 3V61A 3MPXA 3ECIA 4IAPA 1A5RA 1L2NA 5HKHA 1EUVB 3IVFA 3IHPC 3JSVA 1HE8A 5CHFA 3CSFA 4GU2A 3A9KA 2PE6B 4BBKA 4JL9A 4TKNA 1X05A 1N3HA 4FLHA 1PLSA 5JHBA 2IYDB 2D11A 1XQQA 4IWPA 4GSWA 2JRIB 4JKBA 1WJMA 3OLMD 1AARA 3WAOA 3ZIMA 4W9GA 2R0DA 4ZRJA 2COAA 1GUAB 1MK9B 2KZRA 2ABDA 2Y8FA 4K7UA 4URKA 4KZ0A 2BWFA 4TQ0A 2N9EB 2VSZA 1V5TA 2MSED 3D8DA 2KCJA 1WZ0A 4DBGA 3NSUA 3TL5A 2JWZA 2UYZB 3WYFB 2HRJA 4JKAA 4IWOA 4KDIC 2L05A 3PV1A 4HWIB 2MRPA 1OY2A 3QIJA 4EZKA 2LVPA 3OAWA 5LXHA 1TBEA 3MTNB 2M0XA 3KUCB 2L0FA 3M1IB 3NHEB 4NJ6A 3R3MA 4BFRA 3A4RA 1P1AA 3VH3B 1GGOA 1ZGUB 5C5BB 1OEYA 3NY5A 1D3ZA 4ICVA 4PS7A 2KX3A 3DVNU 3V6CB 2JF5A 1T0YA 1E8WA 1V6EA 3ZVRA 3DDCB 4HCPB 3EPYA 2COFA 4ANUA 1U29A 5IA7A 5DPRA 4JKGA 3V62A 3W1SA 4GN1A 1WGUA 3AU4A 5CLQB 3HW2B 3W1YA 3QQ8B 3PRPB 1WJ4A 1K8RB 4EZLA 4ANWA 5KHOA 2K2UA 4DHZB 4WWNA 3BJIA 2LI5A 3FEHA 2CKHB 1E8XA 3ML9A 5D6JB 3DCGA 4DHZE 4WSFA 2ELAA 1TTNA 1XX0A 2LYDA 5CLLB 1KI1B 3ULCA 3C0RB 2KJ6A 2DYBA 3ODWA 3B08A 4KSKC 1VCBA 2G3QB 2YT0A 4JKDA 3QAQA 2PJHA 5LLIA 1E7UA 4BKSD 3TVVA 5CTRC 2KDEB 2CHZA 3WANA 3DXDA 1K5GB 3LDZE 3KUDB 4G3XB 2LVOA 3K9OB 1I42A 1MK7B 2KTRB 2A5UA 4MEMA 2G35A 2AYOB 3GYPA 4NNJB 1MG8A 2FDQA 2FNJB 4MM3A 3N32A 5D7GA 4GPTB 5AZHA 2G4DB 3PSCA 2DX5A 2NBWB 3ZUNA 1E8ZA 2LJ5A 4Z2NA 1XODA 2K8HA 3VTUA 3TIXA 3R66C 3ZNGC 3ZLZA 5DI9B 3TMPB 2A4ZA 3E9LA 1V80A 1UNQA 2LXAA 1OMWA 4F7GA 3HHMA 2J0KA 1B55A 1V61A 1ZC4B 2B3AA 3ONSA 2LOZA 2LKOA 3E66A 2I1JA 1S3SG 4TQ1A 1OEYJ 5AEKB 2O6VD 2BF8B 1R4NI 2N7EA 4WWPA 1E8YA 2DYOA 2KGXB 3OJ3A 1LW3A 1WI1A 3RCZA 2IZVB 2M1MA 2OJRA 2MP2B 1BTKA 3SV1A 3QWMA 3ALBA 3QWZB 2GCLA 2FJLA 1KC7A 1R4MI 2LGYA 3JYUA 4A5KA 3BY4B 4EEWA 4HAZB 3DBHI 5L81A 2CS4A 4ZDVA 2HTHA 2KUPA 1WVHA 1LM8B 2J0MA 1TQZA 2KMCA 2KMAA 1V9JA 3PRZA 3ULBA 4B9KA 2YVCA 2M14A 3UQBA 2Y8GA 3A98B 4W9JA 3ODXA 4BKGA 2D9ZA 1QC6A 3R7QA 3H7PB 4M8MA 2BYFA 2N4FA 1WGHA 3SDLC 2V3SA 2QKMA 2XEWA 3S2AA 5DPTA 1IPGA 2DYMA 2PEAA 4HLEA 3WAPA 4II3B 3FM8C 3L54A 2WH5A 3A9JB 1WG7A 4YL8A 3F0WA 4ILGB 2KDIA 3L17A 2C7NB 3ZDTA 2KFKA 1UD7A 3KRWA 4JIOU 3MDBC 2OQBA 3VUWA 2JY6A 4AOFA 4CHKA 2D2QA 3DVNV 4HB0B 3D8FA 2AWTA 2MBBB 1H4RA 3ODOA 1V49A 4JKEA 4IWQA 4F8CB 4GB9A 3V5WA 2MLBA 4NQLB 2D9VA 2H7EA 2NPTB 2KC1A 2CQUA 5C79A 1NBFC 2XQNM 2LULA 4IOYX 3KH0A 1DYNA 4HAUB 2CB8A 4G50A 3TO1A 4MGIE 1WGRA 1NTVA 1J8CA 3U8ZA 5JLJB 1JRUA 5J18A 3VH4B 2J59M 2UWQA 5CHVC 2GOWA 5DIFB 2DYNA 2CY5A 4TYZA 5JHGA 2ROVA 5D27A 4HAWB 2IY1B 3MHSD 1YX5B 4F7UP 2WX0A 2L3ZA 3FP5A 2ADZA 4GDKA 1M94A 2P0HA 2DLWA 2LWPA 2DZIA 1IYFA 1AWEA 4GDLA 4MY6A 3JSVB 4A6FA 3HM6X 3A9KB 2REXA 4FN2A 1KZGA 1QZEA 2DZJA 3EECA 2CY4A 1UNPA 3A1QA 4NAWA 2FCQA 2FCMA 2D10A 5CX3A 2KHWB 1TZ1A 4A3PA 3SBTA 3M63B 4HJKA 2CHXA 1WX7A 4WJ7A 4B95A 2CHWA 1P3RA 1FOEA 4AWJA 5L83A 4JK9A 4MK0A 2ZVNA 1SHCA 3PSEB 4EFOA 2H7DA 1WE6A 3N3KB 1EF1A 1Y19B 1WJUA 2DFKA 1P98A 2MBEA 1WJ6A 1MAIA 4PYZA 5C6RA 1E7VA 1XD4A 3SHQA 3AJ4A 3H9DA 4KHBB 4NY0A 2AL6A 3L0WB 4BBNC 3CXBB 2G4SA 2ZZPB 4GMVA 4GXBA 1Q1OA 2ZCCA 1U4AA 2JT4B 3KVFB 4EKUA 2JPHA 3F5RA 3NOBA 4EZJA 3UQAA 4GIVA 3PHWB 2GS0A 4K2PA 2K1FA 1Z5SB 2C60A 3QA8A 5DH9B 3A4SC 3CIKA 3RD2A 2KWCA 5JP4A 1KZ7A 2FUHB 1RJ2A 1KOTA 1J0WA 1YIWA 4N9F4 2LBBA 3VUYA 2GJYA 4EJNA 1WXMA 2WX1A 5J3QA 4RMAA 1U5EA 1V88A 1OQNA 4XC2A 2KDBA 1HBKA 4GGQA 3VTVA 2NR2A 3APCA 1H10A 2LXCA 4KHOA 3APDA 2DYQA 3IG3A 4KIKA 1GC7A 3VVWB 4JKGB 1W1HA 4G11A 2KLCA 5D2MB 4HAYB 3OANA 4DBBA 3RUIB 2YS5A 2GMIC 1EAZA 1I2HA 1ZW7A 1LB1A 4FHJA 4II2B 2ZPNA 1P3QU 2NVUI 2RQ1A 5JHAA 5C23A 3APFA 3L10B 2Z0QA 3GYOA 2DHKA 2LRUA 2Z0EB 2R09A 1NTYA 5TR5A 1LFDA 2LASA 2QKLA 4X57B 4A6KA 2VRRB 2KX0A 4KHAA 4A6HA 4MELA 3KW5B 1X1GA 2MDXA 3P6AA 4HK2A 4L6EA 2O6VB 2K25A 4NJ7A 1K5DB 1U5FA 1ACAA 2RSGA 4K7SA 4J6IA 5J3YA 3UZTA 2HE7A 3QBVB 2EMSA 3KY9A 1DDMA 1WIAA 1FGYA 2BYVE 4BKTA 2GBNA 2YF0A 3A8QA 4K7WA 4GMXB 3L16A 1IRSA 2D9YA 2MX2A 4E74A 2ZCBA 3T8MA 4KDLB 4W9IA 3ML4A 4KAXB 3N30A 5D3XA 2LVQA 2FAZA 1S1QB 2MA9B 2MBHA 2DX5B 2YRYA 3EFUA 2I5FA 3GOEA 3DQVA 4YONA 2IO3B 4MJSA 3EHVA 5DPSA 4MGKE 4MSMB 2Z59B 2KN5A 3IBEA 4NQKE 1E5WA 3ZKJC 1WJ1A 2MBQA 3ZTCA 3DXCA 4ANXA 1E90A 1P5TA 3RZFA 5JHHA 3PRMB 1SIFA 1KM7A 1SE9A 3ZDMC 3T9LA 5LXIB 3DOWA 1RLFA 4F7HA 4IUMB 2WDTB 3HM3A 4LCDE 4CYEA 1WXSA 3QJZA 1WX9A 2KO3A 3ZRFA 1AQCA 4AJYB 1YJ1A 3M62B 2UVMA 1UZXB 1U5GA 2KQSA 1C3TA 2LZ6A 1NVLA 4KZCA 2KXJA 2YSZA 3CMMB 5C16A 3MJWA 1GNUA 1KBLA 3ENEA 2P0FA 5C1ZA 4HDOA 1HB6A 1V5MA 2R2QA 5JH5C 4RM8A 1NTIA 3SO6A 5FR6A 2HTHB 2DAFA 3D8EA 4FADA 3PLUA 2RLOA 1XT9B 4HDQA 2MWSB 4PQ0A 3WA0A 2QHOA 2RD0A 4BOZB 4DXAB 2DA0A 2K8BA 2JP2A 3B1LX 4WWOA 1U2BA 4LJOB 3VHTC 2KNBA 1DBHA 2HD5B 3QX1A 5HE0A 2IO0B 3W1SC 1ZC3B 2GCJA 1BTNA 4WJOA 4HATB 2OOBB 4AUQC 4P7IA 2X0SA 2CODA 5J2RA 1ZSQA 1P0RA 1UBIA 2CU1A 2R82A 3PS6A 1Z2MA 2OTXA 1RAXA 2O2VA 2DN6A 2KLGA 5D3WA 2NMBA 4HVBA 1XKEA 2V4LA 4HXDA 3KZ1A 2FIFA 1H8CA 1FHOA 5J3TA 2PE9A 2X18A 4Y94A 2YS1A 4XWXA 3ZVVA 1DROA 1BT0A 4HPLB 1Q5WB 1WF9A 2CAYA 3HIZA 3O65B 3UIPB 2DHJA 2KKCA 4Z2MB 1UH6A 2C5LC 4LJPB 1EGXA 2KJHB 3X23A 4W9CA 1OQYA 2D4QA 3NZUA 4FULA 1WJNA 2NS5A 2Y7BA 2L1CA 5JVLA 2FJ9A 3V60A 2BCJA 3KSYA 4GOCA 2DHZA 3P2BA 4FHKA 3ZO5B 1C1YB 1EO6A 4GDKB 2PPHA 1TGZB 1WY8A 2K39A 1WGYA 2RPQA 5KHQA 2L7RA 3WIMA 1CMXB 2IYBA 3D32A 2D9XA 2D3GA 1G6JA 4JK8A 4GDLB 4A6FB 2RSUA 2AEHA 2COPA 2COCA 2UZRA 3PG7A 2XBBC 2GBMA 4WQOB 2KVRA 1WMHA 3A1QB 4IM3A 2KC2A 4NAWB 4DHJB 2Z0DB 4KV2A 2KJRA 5LOPB 3DBRI 4WJPA 3FSSA 2ZEQA 3L08A 3DXEA 2M38A 5JZEB 2ZNVB 3SBGA 4D0NB 2NBUA 3PPAA 2N1VA 5G55A 3QCAA 1Y8RC 2KK8A 5DCNA 4WJNA 2DENB 3PZDA 2LG1A 4OVVA 1JDEA 1WE7A 2KD0A 5D94A 3IFWB 2D07B 4W9EA 4WJQA 1DDWA 1WM2A 4JGHB 1J0GA 3VDZA 2JZ3B 1V89A 5HE2A 2V1YA 2BKFA 3NZSA 1VD2A 2DKQA 5DHAB 1OGWA 3K9PB 2L2IA 2IBIB 3GZNI 2KQ7A 4H8SA 4K1RB 2WYQA 3WAMA 3ML8A 2YT1A 4HAVB 1V81A 5D3VA 5IAAC 4DX90 4PYUA 3JVZX 3HQCA 1KLVA 4ILJA 2VRWB 2J0JA 1V5OA 4XX5A 1P6SA 2KWVB 2I5CA 4CHMA 3X0WA 2XK5A 3RCPA 2K2JA 2IFSA 3VXWA 3DBLI 3RYTA 2Z0OA 3AULA 4A3OA 4KIKB 3VFKA 4FBJB 4C0AA 2GBRA 1WZ3A 1BAKA 1HB8A 1FGZA 5J17A 3QARA 1WGQA 1WXVA 2J7QB 1MIZB 1X86A 4ASWC 2C7HA 3JW0X 3AU5A 3OJ4B 2E2XA 5FI1A 3M95A 4HCNB 3A8PA 2DTCA 4DHJD 5HE1A 2JVCA 5KCVA 1VBHA 4FJVB 2N1WA 2EKEC 2R2OA 4HB4B 2IO1B 3CF6E 1WM3A 4ZYNA 4EMOA 5HE3A 1W1DA 3CSTA 2G45B 4RM9A 3U7DA 4ICUA 2DZMA 1J19A 4M8NA 2BYEA 3A33B 3G9WA 1Q0WB 2HJ8A 3ZNID 2RR9A 4BKSA 2FIDA 4TV3A 3PLVA 2CRFA 3LJ3A 4TUUA 4PNKA 1ZKHA 2L0TA 2ZPYA 5BO4B 1BWNA 4IC7B 2M17A 2P0DA 2JZZA 4DDID 1PMSA 1RRPB 3VAWA 4FA6A 2M4NA 2EJ8A 2ROZB 1NDDA 1GJZA 2NZ8B 3UINB 5EDSA 1EF5A 3QK0A 4DX8A 4JQWC 2BKRB 1WX8A 2DZKA 4FJYA 3N7CA 3PT2B 4MJSB 4OVUA 4CO7A 5DPWA 5C5BA 1XD3B 2LRWA 4I6LB 4NPNA 2K6QA 3DVGX 1X1FA 4G0NB 4IM2A 3VTWA 4MGYE 4CHJA 4A20A 2AL3A 1F9JA 4XZ4A 1V5UA 3E9PA 4ZRIA 4PS3A 5KQ4A 1FHXA 2K8CA 3RT3B 2NBVB 2N23A 4AJWA 3PHXB 5AZGA 4HPMB 2KANA 2ZNVC 1UNRA 1I7AA 2O6VA 4EOYA 5E6NA 2ZJDA 1WFYA 4DWFA 4WAAA 1X11A 1LXDA 2MCNB 2VKIA 3UIOB 1Z87A 1WR1A 3SYXA 1UGMA 1YQBA 4MSQB 1V2YA 1ZM0A 1Y5OA 4AP4C 4W9LA 3QC8B 5GOWB 2JXXA 2K6DB 1FB8A 2EMTA 2DKPA 1X1MA 4DK5A 2MW5A 1M7EA 3VIAA 3Q3FA 4WVFB 4ANVA 2DHIA 2LGXA 3PEGA 4ZRKA 5AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVR A;  2KWU B;  1WR6 E;  2P8V A;  4W9F A;  4IM0 A;  5IJM A;  4HB2 B;  2YLM A;  2LGD A;  2L76 A;  4KSL C;  2C7M B;  4F1S A;  2W2X D;  4BOS C;  2KTR A;  1MKE A;  4W9D A;  5CHW A;  3BIN A;  2RGF A;  2WWZ A;  3DBS A;  3H7S A;  2YS3 A;  3RUL A;  1NI2 A;  1WGG A;  1V5P A;  3PVW A;  1EVH A;  3I3T B;  4FJZ A;  3KUZ A;  2N7D A;  3H6N A;  3PTF C;  3RZW C;  2D9W A;  1GG3 A;  1WGD A;  2DAJ A;  2BPS A;  2V76 A;  3M3J A;  2L00 B;  1UEL A;  3EC8 A;  2DX1 A;  2ZVO A;  1FXT B;  2MFQ A;  1TXD A;  1YX6 B;  3AXC A;  4B6H A;  2N9P C;  2O2V B;  1M7R A;  1FAO A;  2MWN B;  2LD9 A;  4BVU C;  3UF8 A;  2KTF A;  1ST7 A;  2MBO A;  3VOQ A;  2GBK A;  4B6W A;  4BBN F;  2JUO A;  1ISN A;  3ZW3 A;  4K81 A;  3Q3J A;  2C9W B;  4I6N B;  1W1G A;  3TFM A;  2FCN A;  3PP2 A;  2RGN B;  2KFK B;  2GBJ A;  4HAX B;  3H1U A;  2RUK B;  3LJU X;  2W2W A;  1MPH A;  4K17 A;  1UPQ A;  2I1K A;  4IW0 A;  3KYC D;  1RFA A;  2ELB A;  3ZNZ B;  4IFS A;  2FCS A;  2Z0P A;  4HB3 B;  4EUT A;  2MP2 A;  1UBQ A;  3KRX A;  3AI5 A;  3WAL A;  3L13 A;  4MGZ E;  2W2X C;  4HHV A;  3ZRC A;  1I35 A;  1FHW A;  3TW1 A;  1QQG A;  2KFJ A;  1DDV A;  1U27 A;  5D3Y A;  1SGH A;  3QHT A;  2BWE S;  1WH3 A;  3PGE A;  4PS8 A;  4LDT B;  3SD5 A;  2LUE A;  3T06 A;  1U5D A;  1XR0 B;  4IG7 B;  1WRD B;  3TBL D;  4M0W B;  4E71 A;  4W9K A;  3VUX A;  2LOX A;  1TJ6 A;  4DDG D;  1WMH B;  3V6E B;  4E3C A;  1YD8 U;  3H7P A;  4MT7 A;  1PFJ A;  5L95 C;  1LQB A;  3NS8 A;  1PQS A;  2BGF A;  1KJT A;  3SNH A;  2ASQ A;  4K2O A;  4MDK E;  3HK0 A;  2L8J A;  3PVU A;  2NCN A;  2W9N A;  3KYD D;  3A9J A;  2K00 A;  2KDF B;  5G2N A;  4MH0 E;  3B0A A;  5GMV A;  1XCG A;  3O96 A;  2N0Y A;  2CR5 A;  2IY0 B;  3TCA A;  2PZ1 A;  1P9D U;  2IO2 B;  1V86 A;  3DVG Y;  1OTR B;  2Q13 A;  2UZS A;  2NPT A;  3DPD A;  2EC1 A;  4GZU A;  2JRH A;  1MIX A;  2MKR A;  2RNR B;  4JLC A;  3ZTD A;  3VQI A;  5DHF B;  5LON B;  5E6P A;  3U30 A;  5E6O A;  1IP9 A;  3TJP A;  1NU2 A;  5FI0 A;  1WYW B;  4F7Z A;  2MQJ A;  2RVB B;  3R7R A;  4NSW A;  5KQ1 A;  2XK5 B;  3UGB B;  2M8S A;  4I6P A;  2N9X A;  2KOX A;  1UEF A;  1L7Y A;  4W9H A;  4KVG B;  3PRE A;  1RRB A;  3SUZ A;  3PVL A;  5EFX A;  1WI0 A;  1UPR A;  3ZNH B;  1GC6 A;  3FLV A;  3P7Z A;  2Y5B B;  3SU8 X;  4LDT D;  1Q67 A;  1WXA A;  3V61 A;  3MPX A;  3ECI A;  4IAP A;  1A5R A;  1L2N A;  5HKH A;  1EUV B;  3IVF A;  3IHP C;  3JSV A;  1HE8 A;  5CHF A;  3CSF A;  4GU2 A;  3A9K A;  2PE6 B;  4BBK A;  4JL9 A;  4TKN A;  1X05 A;  1N3H A;  4FLH A;  1PLS A;  5JHB A;  2IYD B;  2D11 A;  1XQQ A;  4IWP A;  4GSW A;  2JRI B;  1WJM A;  3OLM D;  1AAR A;  3WAO A;  3ZIM A;  4W9G A;  2R0D A;  4ZRJ A;  2COA A;  1GUA B;  1MK9 B;  2KZR A;  2ABD A;  2Y8F A;  4K7U A;  4URK A;  4KZ0 A;  2BWF A;  4TQ0 A;  2N9E B;  2VSZ A;  1V5T A;  2MSE D;  3D8D A;  2KCJ A;  1WZ0 A;  4DBG A;  3NSU A;  3TL5 A;  2JWZ A;  2UYZ B;  3WYF B;  2HRJ A;  4IWO A;  4KDI C;  2L05 A;  3PV1 A;  4HWI B;  2MRP A;  1OY2 A;  3QIJ A;  4EZK A;  2LVP A;  3OAW A;  5LXH A;  1TBE A;  3MTN B;  2M0X A;  3KUC B;  2L0F A;  3M1I B;  3NHE B;  4NJ6 A;  3R3M A;  4BFR A;  3A4R A;  1P1A A;  3VH3 B;  1ZGU B;  5C5B B;  1OEY A;  3NY5 A;  1D3Z A;  4ICV A;  4PS7 A;  2KX3 A;  3DVN U;  3V6C B;  2JF5 A;  1T0Y A;  1E8W A;  1V6E A;  3ZVR A;  3DDC B;  4HCP B;  3EPY A;  2COF A;  4ANU A;  1U29 A;  5IA7 A;  5DPR A;  3V62 A;  3W1S A;  4GN1 A;  1WGU A;  3AU4 A;  5CLQ B;  3HW2 B;  3W1Y A;  3QQ8 B;  3PRP B;  1WJ4 A;  1K8R B;  4EZL A;  4ANW A;  5KHO A;  2K2U A;  4DHZ B;  4WWN A;  3BJI A;  2LI5 A;  3FEH A;  2CKH B;  1E8X A;  3ML9 A;  5D6J B;  3DCG A;  4DHZ E;  4WSF A;  2ELA A;  1TTN A;  1XX0 A;  2LYD A;  5CLL B;  1KI1 B;  3ULC A;  3C0R B;  2KJ6 A;  2DYB A;  3ODW A;  3B08 A;  4KSK C;  1VCB A;  2G3Q B;  2YT0 A;  3QAQ A;  2PJH A;  5LLI A;  1E7U A;  4BKS D;  3TVV A;  5CTR C;  2KDE B;  2CHZ A;  3WAN A;  3DXD A;  1K5G B;  3LDZ E;  3KUD B;  4G3X B;  2LVO A;  3K9O B;  1I42 A;  1MK7 B;  2KTR B;  2A5U A;  4MEM A;  2G35 A;  2AYO B;  3GYP A;  4NNJ B;  1MG8 A;  2FDQ A;  2FNJ B;  4MM3 A;  3N32 A;  5D7G A;  4GPT B;  5AZH A;  2G4D B;  3PSC A;  2DX5 A;  2NBW B;  3ZUN A;  1E8Z A;  2LJ5 A;  4Z2N A;  1XOD A;  2K8H A;  3VTU A;  3TIX A;  3R66 C;  3ZNG C;  3ZLZ A;  5DI9 B;  3TMP B;  2A4Z A;  1V80 A;  1UNQ A;  2LXA A;  1OMW A;  4F7G A;  3HHM A;  2J0K A;  1B55 A;  1V61 A;  1ZC4 B;  2B3A A;  3ONS A;  2LOZ A;  2LKO A;  2I1J A;  1S3S G;  4TQ1 A;  1OEY J;  5AEK B;  2O6V D;  2BF8 B;  1R4N I;  2N7E A;  4WWP A;  1E8Y A;  2DYO A;  2KGX B;  3OJ3 A;  1LW3 A;  1WI1 A;  3RCZ A;  2IZV B;  2M1M A;  2OJR A;  2MP2 B;  1BTK A;  3SV1 A;  3QWM A;  3ALB A;  3QWZ B;  2GCL A;  2FJL A;  1R4M I;  2LGY A;  3JYU A;  4A5K A;  3BY4 B;  4EEW A;  4HAZ B;  3DBH I;  5L81 A;  2CS4 A;  4ZDV A;  2HTH A;  2KUP A;  1WVH A;  1LM8 B;  2J0M A;  1TQZ A;  2KMC A;  2KMA A;  1V9J A;  3PRZ A;  3ULB A;  4B9K A;  2YVC A;  2M14 A;  3UQB A;  2Y8G A;  3A98 B;  4W9J A;  3ODX A;  4BKG A;  2D9Z A;  1QC6 A;  3R7Q A;  3H7P B;  4M8M A;  2BYF A;  2N4F A;  1WGH A;  3SDL C;  2V3S A;  2QKM A;  2XEW A;  3S2A A;  5DPT A;  1IPG A;  2DYM A;  2PEA A;  4HLE A;  3WAP A;  4II3 B;  3FM8 C;  3L54 A;  2WH5 A;  3A9J B;  1WG7 A;  4YL8 A;  3F0W A;  2KDI A;  3L17 A;  2C7N B;  3ZDT A;  2KFK A;  1UD7 A;  3KRW A;  4JIO U;  3MDB C;  2OQB A;  3VUW A;  2JY6 A;  4AOF A;  4CHK A;  2D2Q A;  3DVN V;  4HB0 B;  3D8F A;  2AWT A;  2MBB B;  1H4R A;  3ODO A;  1V49 A;  4IWQ A;  4F8C B;  4GB9 A;  3V5W A;  2MLB A;  4NQL B;  2D9V A;  2H7E A;  2NPT B;  2KC1 A;  2CQU A;  5C79 A;  1NBF C;  2XQN M;  2LUL A;  4IOY X;  3KH0 A;  1DYN A;  4HAU B;  2CB8 A;  4G50 A;  3TO1 A;  4MGI E;  1WGR A;  1NTV A;  1J8C A;  3U8Z A;  5JLJ B;  1JRU A;  5J18 A;  3VH4 B;  2J59 M;  2UWQ A;  5CHV C;  2GOW A;  5DIF B;  2DYN A;  2CY5 A;  4TYZ A;  5JHG A;  2ROV A;  5D27 A;  4HAW B;  2IY1 B;  3MHS D;  1YX5 B;  4F7U P;  2WX0 A;  2L3Z A;  3FP5 A;  2ADZ A;  4GDK A;  1M94 A;  2P0H A;  2DLW A;  2LWP A;  2DZI A;  1IYF A;  1AWE A;  4GDL A;  4MY6 A;  3JSV B;  4A6F A;  3HM6 X;  3A9K B;  2REX A;  4FN2 A;  1KZG A;  1QZE A;  2DZJ A;  3EEC A;  2CY4 A;  1UNP A;  3A1Q A;  4NAW A;  2FCQ A;  2FCM A;  2D10 A;  5CX3 A;  2KHW B;  1TZ1 A;  4A3P A;  4HJK A;  3M63 B;  2CHX A;  1WX7 A;  4WJ7 A;  4B95 A;  2CHW A;  1P3R A;  1FOE A;  4AWJ A;  5L83 A;  4MK0 A;  2ZVN A;  1SHC A;  3PSE B;  4EFO A;  2H7D A;  1WE6 A;  3N3K B;  1EF1 A;  1Y19 B;  1WJU A;  2DFK A;  1P98 A;  2MBE A;  1WJ6 A;  1MAI A;  4PYZ A;  5C6R A;  1E7V A;  1XD4 A;  3SHQ A;  3AJ4 A;  3H9D A;  4KHB B;  4NY0 A;  2AL6 A;  3L0W B;  4BBN C;  3CXB B;  2G4S A;  2ZZP B;  4GMV A;  4GXB A;  1Q1O A;  2ZCC A;  1U4A A;  2JT4 B;  3KVF B;  4EKU A;  2JPH A;  3F5R A;  3NOB A;  4EZJ A;  3UQA A;  4GIV A;  3PHW B;  2GS0 A;  4K2P A;  2K1F A;  1Z5S B;  2C60 A;  3QA8 A;  5DH9 B;  3A4S C;  3CIK A;  3RD2 A;  2KWC A;  5JP4 A;  1KZ7 A;  2FUH B;  1RJ2 A;  1KOT A;  1J0W A;  1YIW A;  4N9F 4;  2LBB A;  3VUY A;  2GJY A;  4EJN A;  1WXM A;  2WX1 A;  5J3Q A;  4RMA A;  1U5E A;  1V88 A;  1OQN A;  4XC2 A;  2KDB A;  1HBK A;  4GGQ A;  3VTV A;  2NR2 A;  3APC A;  1H10 A;  2LXC A;  4KHO A;  3APD A;  2DYQ A;  3IG3 A;  4KIK A;  1GC7 A;  3VVW B;  1W1H A;  4G11 A;  2KLC A;  5D2M B;  4HAY B;  3OAN A;  4DBB A;  3RUI B;  2YS5 A;  2GMI C;  1EAZ A;  1I2H A;  1ZW7 A;  1LB1 A;  4FHJ A;  4II2 B;  2ZPN A;  1P3Q U;  2NVU I;  2RQ1 A;  5JHA A;  5C23 A;  3APF A;  3L10 B;  2Z0Q A;  3GYO A;  2DHK A;  2LRU A;  2Z0E B;  2R09 A;  1NTY A;  5TR5 A;  1LFD A;  2LAS A;  2QKL A;  4X57 B;  4A6K A;  2VRR B;  2KX0 A;  4KHA A;  4A6H A;  4MEL A;  3KW5 B;  1X1G A;  2MDX A;  3P6A A;  4HK2 A;  4L6E A;  2O6V B;  2K25 A;  4NJ7 A;  1K5D B;  1U5F A;  1ACA A;  2RSG A;  4K7S A;  4J6I A;  5J3Y A;  3UZT A;  2HE7 A;  3QBV B;  2EMS A;  3KY9 A;  1DDM A;  1WIA A;  1FGY A;  2BYV E;  4BKT A;  2GBN A;  2YF0 A;  3A8Q A;  4K7W A;  4GMX B;  3L16 A;  1IRS A;  2D9Y A;  2MX2 A;  4E74 A;  2ZCB A;  3T8M A;  4KDL B;  4W9I A;  3ML4 A;  4KAX B;  3N30 A;  5D3X A;  2LVQ A;  2FAZ A;  1S1Q B;  2MA9 B;  2MBH A;  2DX5 B;  2YRY A;  3EFU A;  2I5F A;  3GOE A;  3DQV A;  4YON A;  2IO3 B;  4MJS A;  3EHV A;  5DPS A;  4MGK E;  4MSM B;  2Z59 B;  2KN5 A;  3IBE A;  4NQK E;  1E5W A;  3ZKJ C;  1WJ1 A;  2MBQ A;  3ZTC A;  3DXC A;  4ANX A;  1E90 A;  1P5T A;  3RZF A;  5JHH A;  3PRM B;  1SIF A;  1KM7 A;  1SE9 A;  3ZDM C;  3T9L A;  5LXI B;  3DOW A;  1RLF A;  4F7H A;  4IUM B;  2WDT B;  3HM3 A;  4LCD E;  4CYE A;  1WXS A;  3QJZ A;  1WX9 A;  2KO3 A;  3ZRF A;  1AQC A;  4AJY B;  1YJ1 A;  3M62 B;  2UVM A;  1UZX B;  1U5G A;  2KQS A;  1C3T A;  2LZ6 A;  1NVL A;  4KZC A;  2KXJ A;  2YSZ A;  3CMM B;  5C16 A;  3MJW A;  1GNU A;  3ENE A;  2P0F A;  5C1Z A;  4HDO A;  1HB6 A;  1V5M A;  2R2Q A;  5JH5 C;  4RM8 A;  1NTI A;  3SO6 A;  5FR6 A;  2HTH B;  2DAF A;  3D8E A;  4FAD A;  3PLU A;  2RLO A;  1XT9 B;  4HDQ A;  2MWS B;  4PQ0 A;  3WA0 A;  2QHO A;  2RD0 A;  4BOZ B;  4DXA B;  2DA0 A;  2K8B A;  2JP2 A;  3B1L X;  4WWO A;  1U2B A;  4LJO B;  3VHT C;  2KNB A;  1DBH A;  2HD5 B;  3QX1 A;  5HE0 A;  2IO0 B;  3W1S C;  1ZC3 B;  2GCJ A;  1BTN A;  4WJO A;  4HAT B;  2OOB B;  4AUQ C;  4P7I A;  2COD A;  5J2R A;  1ZSQ A;  1P0R A;  1UBI A;  2CU1 A;  3PS6 A;  1Z2M A;  2OTX A;  1RAX A;  2O2V A;  2DN6 A;  2KLG A;  5D3W A;  2NMB A;  4HVB A;  1XKE A;  2V4L A;  4HXD A;  3KZ1 A;  2FIF A;  1H8C A;  1FHO A;  5J3T A;  2PE9 A;  2X18 A;  4Y94 A;  2YS1 A;  4XWX A;  3ZVV A;  1DRO A;  1BT0 A;  4HPL B;  1Q5W B;  1WF9 A;  2CAY A;  3HIZ A;  3O65 B;  3UIP B;  2DHJ A;  2KKC A;  4Z2M B;  1UH6 A;  2C5L C;  4LJP B;  1EGX A;  2KJH B;  3X23 A;  4W9C A;  1OQY A;  2D4Q A;  3NZU A;  4FUL A;  1WJN A;  2NS5 A;  2Y7B A;  2L1C A;  2FJ9 A;  3V60 A;  2BCJ A;  3KSY A;  4GOC A;  2DHZ A;  3P2B A;  4FHK A;  3ZO5 B;  1C1Y B;  1EO6 A;  4GDK B;  2PPH A;  1TGZ B;  1WY8 A;  2K39 A;  1WGY A;  2RPQ A;  5KHQ A;  2L7R A;  3WIM A;  1CMX B;  2IYB A;  3D32 A;  2D9X A;  2D3G A;  1G6J A;  4GDL B;  4A6F B;  2RSU A;  2UZR A;  2AEH A;  2COP A;  2COC A;  3PG7 A;  2XBB C;  2GBM A;  4WQO B;  2KVR A;  1WMH A;  3A1Q B;  4IM3 A;  2KC2 A;  4NAW B;  4DHJ B;  2Z0D B;  4KV2 A;  2KJR A;  5LOP B;  3DBR I;  4WJP A;  3FSS A;  2ZEQ A;  3L08 A;  3DXE A;  2M38 A;  5JZE B;  2ZNV B;  4D0N B;  2NBU A;  3PPA A;  2N1V A;  5G55 A;  3QCA A;  1Y8R C;  2KK8 A;  5DCN A;  4WJN A;  2DEN B;  3PZD A;  2LG1 A;  4OVV A;  1WE7 A;  2KD0 A;  5D94 A;  3IFW B;  2D07 B;  4W9E A;  4WJQ A;  1DDW A;  1WM2 A;  4JGH B;  1J0G A;  3VDZ A;  2JZ3 B;  1V89 A;  5HE2 A;  2V1Y A;  2BKF A;  3NZS A;  1VD2 A;  2DKQ A;  5DHA B;  1OGW A;  3K9P B;  2L2I A;  2IBI B;  3GZN I;  2KQ7 A;  4H8S A;  4K1R B;  2WYQ A;  3WAM A;  3ML8 A;  2YT1 A;  4HAV B;  1V81 A;  5D3V A;  5IAA C;  4DX9 0;  4PYU A;  3JVZ X;  3HQC A;  1KLV A;  2VRW B;  2J0J A;  1V5O A;  4XX5 A;  1P6S A;  2KWV B;  2I5C A;  4CHM A;  3X0W A;  2XK5 A;  3RCP A;  2K2J A;  2IFS A;  3VXW A;  3DBL I;  3RYT A;  2Z0O A;  3AUL A;  4A3O A;  4KIK B;  3VFK A;  4FBJ B;  4C0A A;  2GBR A;  1WZ3 A;  1BAK A;  1HB8 A;  1FGZ A;  5J17 A;  3QAR A;  1WGQ A;  1WXV A;  2J7Q B;  1MIZ B;  1X86 A;  4ASW C;  2C7H A;  3JW0 X;  3AU5 A;  3OJ4 B;  2E2X A;  5FI1 A;  3M95 A;  4HCN B;  3A8P A;  2DTC A;  4DHJ D;  5HE1 A;  2JVC A;  5KCV A;  4FJV B;  2N1W A;  2EKE C;  2R2O A;  4HB4 B;  2IO1 B;  3CF6 E;  1WM3 A;  4ZYN A;  4EMO A;  5HE3 A;  1W1D A;  3CST A;  2G45 B;  4RM9 A;  3U7D A;  4ICU A;  2DZM A;  1J19 A;  4M8N A;  2BYE A;  3A33 B;  3G9W A;  1Q0W B;  2HJ8 A;  3ZNI D;  2RR9 A;  4BKS A;  2FID A;  4TV3 A;  3PLV A;  2CRF A;  3LJ3 A;  4TUU A;  4PNK A;  1ZKH A;  2L0T A;  2ZPY A;  5BO4 B;  1BWN A;  4IC7 B;  2M17 A;  2P0D A;  2JZZ A;  4DDI D;  1PMS A;  1RRP B;  3VAW A;  4FA6 A;  2M4N A;  2EJ8 A;  2ROZ B;  1NDD A;  1GJZ A;  2NZ8 B;  3UIN B;  5EDS A;  1EF5 A;  3QK0 A;  4DX8 A;  4JQW C;  2BKR B;  1WX8 A;  2DZK A;  4FJY A;  3N7C A;  3PT2 B;  4MJS B;  4OVU A;  4CO7 A;  5DPW A;  5C5B A;  1XD3 B;  2LRW A;  4I6L B;  4NPN A;  2K6Q A;  3DVG X;  1X1F A;  4G0N B;  4IM2 A;  3VTW A;  4MGY E;  4CHJ A;  4A20 A;  2AL3 A;  1F9J A;  4XZ4 A;  1V5U A;  4ZRI A;  4PS3 A;  5KQ4 A;  1FHX A;  2K8C A;  3RT3 B;  2NBV B;  2N23 A;  4AJW A;  3PHX B;  5AZG A;  4HPM B;  2KAN A;  2ZNV C;  1UNR A;  1I7A A;  2O6V A;  4EOY A;  5E6N A;  2ZJD A;  1WFY A;  4DWF A;  4WAA A;  1X11 A;  1LXD A;  2MCN B;  2VKI A;  3UIO B;  1Z87 A;  1WR1 A;  3SYX A;  1UGM A;  1YQB A;  4MSQ B;  1V2Y A;  1ZM0 A;  1Y5O A;  4AP4 C;  4W9L A;  3QC8 B;  5GOW B;  2JXX A;  2K6D B;  1FB8 A;  2EMT A;  2DKP A;  1X1M A;  4DK5 A;  2MW5 A;  1M7E A;  3VIA A;  3Q3F A;  4WVF B;  4ANV A;  2DHI A;  2LGX A;  3PEG A;  4ZRK A;  5AZF A; 
#chains in the Genus database with same CATH topology
 1ZVR A;  2WQY B;  3IAS 1;  2KWU B;  1WR6 E;  2P8V A;  4W9F A;  4NJC A;  2RDG A;  4IM0 A;  5IJM A;  4HB2 B;  2YLM A;  4JK7 A;  2LGD A;  2L76 A;  4KSL C;  2NTS A;  2C7M B;  2Z4D A;  4F1S A;  2W2X D;  3AE7 B;  2X38 A;  2JYT A;  1JWB D;  4BOS C;  2OED A;  2KTR A;  1MKE A;  1F1H A;  1DIK A;  2K8E A;  4W9D A;  5CHW A;  3BIN A;  2FBW B;  2RGF A;  2WWZ A;  2LJI A;  3DBS A;  3H7S A;  1TKG A;  2YS3 A;  3RUL A;  4RCO A;  1NI2 A;  1WGG A;  2BS4 B;  3SFE B;  1V5P A;  2DIK A;  3PVW A;  1N63 A;  1EVH A;  1ZPS A;  3I3T B;  4FJZ A;  2ZW1 A;  1PYW D;  3AB5 A;  3KUZ A;  2N7D A;  3H6N A;  3PTF C;  4MT5 A;  3RZW C;  2D9W A;  1GG3 A;  1WGD A;  2DAJ A;  3BII D;  2BPS A;  2V76 A;  3M3J A;  2L00 B;  1UEL A;  3EC8 A;  2DX1 A;  4N58 A;  1ZDV A;  3AEF B;  5D3D A;  2ZVO A;  2KVZ A;  1XCQ L;  1FXT B;  2MFQ A;  5BYR A;  1TXD A;  1YX6 B;  2KN4 A;  4B6H A;  2N9P C;  3AXC A;  2O2V B;  1M7R A;  1FAO A;  2MWN B;  1RFK A;  2LD9 A;  4BVU C;  3Q6B A;  1N62 A;  3OWE B;  5C3J B;  3UF8 A;  2KTF A;  1YQ4 B;  3MJ5 A;  1ST7 A;  4JKF A;  2MBO A;  3VOQ A;  2GBK A;  4B6W A;  4BBN F;  2JUO A;  1ISN A;  3ZW3 A;  1WYG A;  3KWL A;  3VRA B;  2WHI A;  4K81 A;  3Q3J A;  2C9W B;  4I6N B;  1W1G A;  3TFM A;  4RH6 A;  5BYS A;  2FCN A;  3PP2 A;  4P16 A;  2RGN B;  3IXS A;  3EA6 A;  1KF6 B;  2KFK B;  2GBJ A;  3P63 A;  1B9R A;  4HAX B;  3H1U A;  2RUK B;  2PMV A;  3LJU X;  2W2W A;  4QJ3 B;  1MPH A;  3EUB 2;  4K3B A;  1XLP A;  4K17 A;  3SR6 A;  1UPQ A;  2I1K A;  1AWD A;  1C77 A;  4IW0 A;  3E9O A;  3HRD D;  3KYC D;  1VBG A;  1RFA A;  2ELB A;  3AE9 B;  3ZNZ B;  4RGO S;  2QSD A;  4IFS A;  2FCS A;  2Z0P A;  4HB3 B;  4WAF A;  4EUT A;  2MP2 A;  1UBQ A;  3KRX A;  3AI5 A;  1JWA D;  4AS1 A;  2M19 A;  3WAL A;  3L13 A;  4MGZ E;  4ITK A;  1GB4 A;  2W2X C;  4HHV A;  3ZRC A;  1I35 A;  2WDR B;  1FHW A;  3TW1 A;  1QQG A;  2KFJ A;  4YTM B;  1DDV A;  5IKC M;  1U27 A;  4HSI A;  5D3Y A;  2W54 A;  3CIR B;  1SGH A;  3W5V B;  2N7J A;  5IP4 D;  5H8Y E;  3QHT A;  2BWE S;  1WH3 A;  1FRR A;  2Z8L A;  3PGE A;  4PS8 A;  4LDT B;  3SD5 A;  3MHZ A;  2LUE A;  3NZ3 A;  3T06 A;  4JKC A;  1U5D A;  4JKH A;  1XR0 B;  1IGD A;  1SF0 A;  4IG7 B;  1WRD B;  3TBL D;  4M0W B;  4DQO C;  4FXC A;  2BTE A;  4LNF A;  5G5G A;  4E71 A;  1HTO A;  4W9K A;  4OZA A;  3RNG C;  3VUX A;  2LOX A;  2WDQ B;  1TJ6 A;  1SE3 A;  1K51 A;  4ILH A;  1JWM D;  2WU5 B;  3GP7 A;  4DDG D;  1WMH B;  3V6E B;  4E3C A;  1YD8 U;  1PDX A;  3H7P A;  1FIQ A;  1TZO A;  4MT7 A;  4JWU C;  1PFJ A;  2BYT A;  5L95 C;  4ZHP A;  1LQB A;  4XDD A;  3NS8 A;  1YN4 A;  3GE8 C;  3NVV A;  1PQS A;  3NRZ A;  2BGF A;  4RF1 A;  2D3C A;  2XNA C;  1KJT A;  1R7S A;  3NS1 A;  3SNH A;  2ASQ A;  4K2O A;  4MDK E;  1VR9 A;  3Q3N C;  3HK0 A;  2L8J A;  4OT1 A;  3PVU A;  4PK1 A;  2NCN A;  2W9N A;  3KYD D;  3A9J A;  2K00 A;  2KDF B;  5G2N A;  1WWT A;  3DWG C;  3B0A A;  4MH0 E;  3AE6 B;  2D5G A;  5GMV A;  4M01 A;  1XCG A;  3O96 A;  1NEN B;  2N0Y A;  2CR5 A;  2IY0 B;  3TCA A;  2PZ1 A;  2ACZ B;  3C19 A;  3ZQ4 A;  1P9D U;  2IO2 B;  1RYJ A;  2QCZ A;  1V86 A;  3DVG Y;  2J42 A;  4A9A A;  1OTR B;  2Q13 A;  1YOV B;  2UZS A;  2BQQ A;  2NPT A;  3DPD A;  2EC1 A;  3I63 C;  2H88 B;  4N6E B;  1SJE D;  2I38 A;  4GZU A;  1L0V B;  2JRH A;  1MIX A;  2MKR A;  2RNR B;  2V3N A;  2L83 A;  4JLC A;  2WXN A;  3ZTD A;  4USA A;  3VQI A;  2DWQ A;  5DHF B;  5LON B;  5E6P A;  2WXQ A;  3U30 A;  5E6O A;  2NTT A;  2IGG A;  3R2T A;  1IP9 A;  3TJP A;  1SE4 A;  1NU2 A;  5FI0 A;  3FKY A;  1WYW B;  4F7Z A;  2MQJ A;  2RVB B;  3R7R A;  4NSW A;  5KQ1 A;  2XK5 B;  2V9H A;  3UGB B;  2MJ3 A;  3FVC A;  2M8S A;  4I6P A;  2N9X A;  2KOX A;  1UEF A;  1L7Y A;  2IPK D;  4W9H A;  4KVG B;  3PRE A;  1RRB A;  3SUZ A;  1I7H A;  3HVZ A;  4J3O D;  3P4S B;  3PVL A;  1NYR A;  5EFX A;  1MG4 A;  4IOI E;  3ENB A;  1WI0 A;  1UPR A;  3ZNH B;  1GC6 A;  3FLV A;  3P7Z A;  2Y5B B;  3SU8 X;  1VLB A;  4LDT D;  1Q67 A;  4D2K A;  4RGM A;  2JX5 A;  1R4M B;  2KMM A;  1FFU A;  1WXA A;  2SEB D;  3V61 A;  3MPX A;  3ECI A;  4K3C A;  4IAP A;  1A5R A;  3GS2 A;  1NVI D;  1L2N A;  5HKH A;  3SEB A;  1EUV B;  2W3R A;  5H92 C;  3IVF A;  2BT6 A;  4LNI A;  5C2T B;  3IHP C;  3JSV A;  1HE8 A;  5CHF A;  3CSF A;  1DOX A;  4GU2 A;  3A9K A;  2PE6 B;  4B0M A;  2LHE A;  1JW9 D;  4BBK A;  4JL9 A;  4TKN A;  1X05 A;  2HJ1 A;  3B9J A;  1N3H A;  4FLH A;  4A90 A;  1PLS A;  1FPY A;  5JHB A;  2IYD B;  3I5J C;  1VDV A;  2D11 A;  1A70 A;  1XQQ A;  4IWP A;  3HUI A;  4GSW A;  2JRI B;  4JKB A;  1WJM A;  1T3Q A;  3OLM D;  2ICI A;  4IDI A;  1AAR A;  4UDU C;  3WAO A;  1Q10 A;  4WH4 A;  5EE9 A;  3ZIM A;  4W9G A;  3AH7 A;  1QOB A;  4RGN A;  3Q3O C;  4PT5 A;  2R0D A;  4ZRJ A;  2COA A;  1GUA B;  1MK9 B;  2KZR A;  2ABD A;  2Y8F A;  1IBX B;  4K7U A;  4URK A;  1C4A A;  2VH1 A;  4KZ0 A;  1LGR A;  2BWF A;  1LO5 D;  4TQ0 A;  2N9E B;  2VSZ A;  1V5T A;  2MSE D;  4C7Z A;  3Q8E A;  3D8D A;  2KCJ A;  1WZ0 A;  4DBG A;  3NSU A;  4KHB A;  3TL5 A;  1V1P B;  4OZB A;  2JWZ A;  1I4X A;  2UYZ B;  4YSX B;  1MPE A;  1ZOY B;  1ET6 A;  3NVY A;  3WYF B;  3W5U B;  2HRJ A;  4JKA A;  4IWO A;  4KDI C;  2L05 A;  3PV1 A;  1DYQ A;  2HTM E;  4HWI B;  3ZXV A;  3N1Z C;  2Z13 A;  2MRP A;  1OY2 A;  3QIJ A;  4EZK A;  2LVP A;  2WP9 B;  2E6X A;  1I4Q A;  3OAW A;  4LNO A;  5LXH A;  1TBE A;  3MTN B;  4QAY A;  2KIE A;  2M0X A;  1EU4 A;  2ZW0 A;  3KUC B;  4OHJ A;  2L0F A;  3M1I B;  2K3U A;  1YN3 A;  3NHE B;  4NJ6 A;  3R3M A;  4KGT A;  1F0Z A;  4BFR A;  2KDM A;  3A4R A;  1P1A A;  3VH3 B;  1GGO A;  1ZGU B;  5C5B B;  1OEY A;  3NY5 A;  1D3Z A;  4ICV A;  4PS7 A;  2KX3 A;  3NJT A;  4HPP A;  3DVN U;  2Y5C A;  2VZK B;  3V6C B;  2JF5 A;  2KIG A;  1SB3 C;  1T0Y A;  3AEB B;  1J7A A;  1E8W A;  5EE0 A;  1V6E A;  3ZVR A;  3DDC B;  5IRS A;  4HCP B;  3EPY A;  2COF A;  4ANU A;  1U29 A;  5IA7 A;  4GOU A;  5DPR A;  4JKG A;  2K49 A;  3V62 A;  5I4D A;  3W1S A;  1EU3 A;  4GN1 A;  1WGU A;  3AU4 A;  2R2Y A;  2J52 A;  5CLQ B;  3HW2 B;  3W1Y A;  3QQ8 B;  1MHX A;  3PRP B;  1WJ4 A;  1K8R B;  1L6U A;  3R8B A;  4EZL A;  4NZL B;  4ANW A;  5KHO A;  2K2U A;  2QMT A;  2INC C;  1FMA D;  2BS2 B;  4DHZ B;  4QJ4 B;  4WWN A;  3RNF C;  3BJI A;  5HG2 A;  5IN7 A;  2LI5 A;  3FEH A;  2CKH B;  1E8X A;  1D4B A;  3ML9 A;  3RFZ B;  5D6J B;  3DCG A;  4DHZ E;  2VH2 A;  4WSF A;  4KKJ A;  2WNM A;  2ELA A;  1ZXI A;  1TTN A;  1XX0 A;  2LYD A;  5CLL B;  2INP E;  1KI1 B;  1MFW A;  3ULC A;  3C0R B;  2KJ6 A;  2DYB A;  3ODW A;  3B08 A;  4KSK C;  1VCB A;  2G3Q B;  3B2F A;  2YT0 A;  4JKD A;  3QAQ A;  2PJH A;  4TMA B;  1NEK B;  3AMZ A;  5LLI A;  1E7U A;  1OQQ A;  1T5X D;  4BKS D;  3TVV A;  3AEA B;  5CTR C;  2KDE B;  2CHZ A;  3WAN A;  3DXD A;  1VJK A;  1EWC A;  1K5G B;  3LDZ E;  5GXG B;  3KUD B;  4G3X B;  4RNA A;  2LVO A;  3K9O B;  1I42 A;  1MK7 B;  2KTR B;  2A5U A;  1GOZ A;  4MEM A;  2G35 A;  2AYO B;  4ZYS A;  3GYP A;  4NNJ B;  1L4D B;  1MG8 A;  2FDQ A;  2JXT A;  2FNJ B;  4MM3 A;  3N32 A;  5JXV A;  5D7G A;  4GPT B;  1E7P B;  5AZH A;  2G4D B;  4YSY B;  3PSC A;  2DX5 A;  2NBW B;  2WXP A;  3ZUN A;  1QLB B;  3TUO A;  1FEH A;  1E8Z A;  2LJ5 A;  4Z2N A;  1XOD A;  1D5X C;  3TEW A;  2K8H A;  3VTU A;  2VZK D;  3TIX A;  3R66 C;  3ZNG C;  2Z59 A;  3ZLZ A;  3FAH A;  4YSZ B;  5DI9 B;  2WXF A;  3TMP B;  2A4Z A;  2CJN A;  3E9L A;  1V80 A;  1UNQ A;  2LXA A;  5AUI A;  2IJ0 A;  3KQ4 A;  1OMW A;  4F7G A;  3HHM A;  2J0K A;  1B55 A;  1V61 A;  1ZC4 B;  1I4P A;  2B3A A;  3ONS A;  2LOZ A;  1IGC A;  2LKO A;  3E66 A;  2I1J A;  1S3S G;  4TQ1 A;  3ZJV A;  1OEY J;  5AEK B;  2O6V D;  5G5H A;  1AN8 A;  2BF8 B;  1R4N I;  2N7E A;  1SIJ A;  5BYQ A;  1QT9 A;  4WWP A;  5E6J A;  3W9C B;  1E8Y A;  2DYO A;  2YT2 A;  2KGX B;  3OJ3 A;  1L5P A;  1UGJ A;  1LW3 A;  1WI1 A;  4EE2 A;  3RCZ A;  2IZV B;  1TS3 A;  2M1M A;  4YT0 B;  2OJR A;  3LB8 C;  2MP2 B;  3HVD A;  3U2S C;  1QOG A;  3BK1 A;  1BTK A;  4QXA B;  2L1A A;  3SV1 A;  2W82 A;  3QWM A;  3ALB A;  2WXK A;  2AQ3 B;  2PLP A;  3QWZ B;  2GCL A;  2FUG 1;  3OG5 A;  2FJL A;  1KC7 A;  1R4M I;  2LGY A;  3JYU A;  4A5K A;  3BY4 B;  4EEW A;  4HAZ B;  2M56 B;  1ESF A;  5LNK 1;  3DBH I;  5L81 A;  2CS4 A;  3RNB C;  5BMH A;  4LNN A;  4ZDV A;  4HEA 1;  5BMI A;  2HTH A;  2KUP A;  3NWA A;  4OZC A;  1WVH A;  1F52 A;  4A55 A;  2PW9 A;  1LM8 B;  2J0M A;  1TQZ A;  2KMC A;  2KMA A;  1V9J A;  3PRZ A;  3ULB A;  4XWW A;  3Q2A C;  4B9K A;  2YVC A;  3AEE B;  2M14 A;  3UQB A;  2Y8G A;  3AN1 A;  3A98 B;  4W9J A;  3ODX A;  1IUE A;  1FNU A;  1AW7 A;  4BKG A;  2D9Z A;  2RRF A;  3RI7 C;  1QC6 A;  1CK1 A;  3R7Q A;  2PVO D;  3H7P B;  4M8M A;  2BYF A;  2N4F A;  1WGH A;  3SDL C;  1ZE3 D;  1TS2 A;  2V3S A;  4DXG A;  2QKM A;  2XEW A;  3S2A A;  5DPT A;  1IPG A;  1C9F A;  1FCC C;  2DYM A;  2PEA A;  3VR8 B;  4HLE A;  4IKG A;  3WAP A;  4II3 B;  3FM8 C;  3L54 A;  2DLB A;  2WH5 A;  3A9J B;  1WG7 A;  2INN E;  3NVZ A;  4YL8 A;  3Q8B A;  3F0W A;  2XN9 C;  4ILG B;  1JRP A;  2KDI A;  3L17 A;  2C7N B;  3ZDT A;  2KFK A;  2L52 A;  1UD7 A;  4HRS A;  2L32 A;  2Y3A A;  3KRW A;  4JIO U;  1CZP A;  3MDB C;  2OQB A;  3VUW A;  3AE4 B;  2JY6 A;  4AOF A;  4CHK A;  2D2Q A;  3DVN V;  3ZYY X;  4HB0 B;  3D8F A;  2AWT A;  2MBB B;  1H4R A;  3ODO A;  1V49 A;  4JKE A;  4IWQ A;  4F8C B;  4GB9 A;  3V5W A;  2MLB A;  4NQL B;  1QF6 A;  2D9V A;  2H7E A;  2NPT B;  1JWS D;  2KC1 A;  2CQU A;  3ABV B;  3A58 A;  3BYY B;  4LK0 M;  5C79 A;  1KLG D;  1NBF C;  3MC9 A;  1XO3 A;  2XQN M;  2LUL A;  4IOY X;  3KH0 A;  1OQR A;  3KLS X;  3BVZ A;  3IT6 B;  1DYN A;  4HAU B;  2CB8 A;  4G50 A;  3TO1 A;  4P1B C;  4MGI E;  1WGR A;  1NTV A;  1J8C A;  3U8Z A;  5JLJ B;  1JRU A;  4XGA B;  1GB1 A;  3BWU D;  3V3X A;  5J18 A;  4ZRQ A;  3VH4 B;  2J59 M;  3NUH B;  4M0W A;  2UWQ A;  3I9V 1;  3FIL B;  4JWS C;  1ZXH A;  5CHV C;  1XLQ A;  3TEX A;  4US8 A;  2GOW A;  5DIF B;  1SJH D;  2DYN A;  2CY5 A;  4TYZ A;  5JHG A;  4ZRP A;  2SAK A;  2ROV A;  5D27 A;  3SFD B;  4HAW B;  2IY1 B;  5EE3 A;  3AE5 B;  1UWM A;  3MHS D;  1N6Z A;  1YX5 B;  3O13 A;  4F7U P;  1J7C A;  1C78 A;  1F2R C;  2L3Z A;  2WX0 A;  1ZP0 B;  3FP5 A;  2ADZ A;  3MC8 A;  4GDK A;  1M94 A;  3TEY A;  4L1R A;  2P0H A;  1VZ6 A;  2DLW A;  5IOI A;  2LWP A;  1TY0 A;  2DZI A;  2K9X A;  3NVW A;  1R4N B;  2EKI A;  4S17 A;  1JQ4 A;  1IYF A;  1PFD A;  1AWE A;  4GDL A;  4MY6 A;  3N9Y C;  3JSV B;  4A6F A;  1FRD A;  5BMG A;  1KTK A;  3RPF C;  2WU2 B;  3HM6 X;  3A9K B;  2REX A;  4FN2 A;  1KZG A;  1QZE A;  3NWD A;  2DZJ A;  3EEC A;  1PGA A;  2CY4 A;  4XYC A;  1UNP A;  2LGI A;  1Y56 A;  3A1Q A;  4NAW A;  2FCQ A;  2FCM A;  2D10 A;  5CX3 A;  1GAQ B;  2KHW B;  2DNF A;  2UU7 A;  1TZ1 A;  4A3P A;  3SBT A;  3M63 B;  4HJK A;  2CHX A;  1WX7 A;  4WJ7 A;  4B95 A;  4ARI A;  2CHW A;  1P3R A;  1N5X A;  1FOE A;  4AWJ A;  5L83 A;  4JK9 A;  4MK0 A;  3RMK C;  2ZVN A;  1SHC A;  5FKA C;  4L2Y A;  3PSE B;  4EFO A;  2H7D A;  3DBH B;  1WE6 A;  3N3K B;  1FO4 A;  1EF1 A;  1Y19 B;  4CSQ A;  1WJU A;  2DFK A;  1P98 A;  2MBE A;  1WJ6 A;  1MAI A;  1YJJ A;  1WRI A;  2YEP F;  5C6R A;  4PYZ A;  1E7V A;  1XD4 A;  3U52 E;  3T3O A;  3SHQ A;  3AJ4 A;  2J53 A;  3H9D A;  4KHB B;  4NY0 A;  2AL6 A;  3L0W B;  2MH7 A;  4BBN C;  3CXB B;  1F2R I;  2G4S A;  2BW2 A;  2ZZP B;  4GMV A;  3IT4 B;  4GXB A;  5I2M A;  1Q1O A;  1FD6 A;  2ZCC A;  1U4A A;  2JT4 B;  3KVF B;  4EKU A;  2WXI A;  3P42 A;  2JPH A;  3R2I A;  3F5R A;  3NOB A;  4EZJ A;  3UQA A;  4GIV A;  3URY A;  1JCK B;  3PHW B;  2GS0 A;  4K2P A;  2K1F A;  1Z5S B;  2C60 A;  3QA8 A;  3DHG C;  5DH9 B;  3A4S C;  3CIK A;  3RD2 A;  2KWC A;  5TSS A;  5JP4 A;  1KZ7 A;  3N1Y C;  2FUH B;  3PO0 A;  1RJ2 A;  1KOT A;  1J0W A;  1YIW A;  3EFC A;  4N9F 4;  2LBB A;  3VUY A;  2GJY A;  4EJN A;  1WXM A;  2WX1 A;  5J3Q A;  4RMA A;  4US9 A;  1U5E A;  1AYF A;  1V88 A;  1OQN A;  2Z14 A;  2J4X A;  4XC2 A;  2KDB A;  1HBK A;  4RF0 A;  4GGQ A;  3VTV A;  2NR2 A;  2QIL A;  3APC A;  1H10 A;  2LXC A;  4KHO A;  1ET9 A;  3APD A;  4L1B A;  2DYQ A;  3IG3 A;  4KIK A;  1GC7 A;  3VVW B;  2MJD A;  4JKG B;  1W1H A;  3RNA C;  4G11 A;  3VRB B;  2KLC A;  4MAC A;  5D2M B;  4HAY B;  4GLS C;  3OAN A;  4DBB A;  3FC4 A;  3RUI B;  1C4P A;  2YS5 A;  2GMI C;  1EAZ A;  4C4V A;  1I2H A;  1ZW7 A;  1LB1 A;  1TS5 A;  1YMH E;  4C00 A;  4FHJ A;  4HKZ E;  3RNC C;  4II2 B;  2ZPN A;  1P3Q U;  1CJE A;  2TSS A;  2NVU I;  2V3P A;  2AQ2 B;  1SXT A;  2KAC A;  2RQ1 A;  1XF5 L;  1IBX A;  5JHA A;  3T3N A;  5C23 A;  3APF A;  3MFG A;  3L10 B;  2Z0Q A;  3P4P B;  3GYO A;  2DHK A;  2LRU A;  2Z0E B;  3DHI C;  2RDH A;  2MJE A;  2R09 A;  1NTY A;  5TR5 A;  1LFD A;  2LAS A;  2FJU B;  2QKL A;  1WSP A;  2W3S A;  4X57 B;  4A6K A;  4H2A A;  2VRR B;  2KX0 A;  2LGS A;  3TSS A;  4XE0 A;  1ZYI A;  4KHA A;  2WDV B;  2X8X X;  3DBR B;  4A6H A;  3Q3M C;  4GNK B;  4MEL A;  4HJG E;  3KW5 B;  1X1G A;  2MDX A;  3AEC B;  3P6A A;  1MI0 A;  5LG4 B;  4HK2 A;  4L6E A;  2O6V B;  2K25 A;  4JX1 C;  4NJ7 A;  1K5D B;  1U5F A;  4ARC A;  3Q8C A;  1ACA A;  4WUR A;  2RSG A;  5HI1 A;  4K7S A;  3N20 C;  4J6I A;  5J3Y A;  5D3I B;  4OSN A;  3UZT A;  2QEJ C;  2HE7 A;  3LXF A;  3QBV B;  2EMS A;  2JYE A;  3KY9 A;  1WGK A;  1DDM A;  1WIA A;  3ETR A;  1FGY A;  2BYV E;  4BKT A;  2OHF A;  2GBN A;  2YF0 A;  3A8Q A;  4K7W A;  4GMX B;  3L16 A;  1IRS A;  2OJW A;  3U4E G;  2D9Y A;  2MX2 A;  4E74 A;  2ZCB A;  3AED B;  2Q5W D;  3T8M A;  4KDL B;  2WXO A;  2IDY A;  4S0R A;  4W9I A;  3ML4 A;  4KAX B;  3N30 A;  4MM3 B;  5D3X A;  2LHD A;  2LVQ A;  2FAZ A;  1S1Q B;  2MA9 B;  2MBH A;  1UF0 A;  3GZN B;  2DX5 B;  2YRY A;  3EFU A;  1EWY C;  2I5F A;  3GOE A;  5IO9 A;  3DCX A;  4C7Y A;  3DQV A;  4YON A;  3RN9 C;  2IO3 B;  4MJS A;  3EHV A;  2K22 A;  5DPS A;  4MGK E;  4MSM B;  1N5W A;  1GPX A;  3HSA A;  1XXG A;  2Z59 B;  2KN5 A;  3GE3 C;  3IBE A;  2LFI A;  4NQK E;  1E5W A;  4MH8 A;  5AUK A;  4AQ7 A;  1OFF A;  1XEE A;  3ZKJ C;  1WJ1 A;  2MBQ A;  4LTU A;  3ZTC A;  3DXC A;  4ANX A;  1E90 A;  4C80 A;  1P5T A;  3RZF A;  2NBV A;  5JHH A;  3U7Z A;  3PRM B;  3UI3 A;  1SIF A;  1KM7 A;  1SE9 A;  3VR9 B;  3ZDM C;  1TJE A;  3T9L A;  5LXI B;  3DOW A;  1RLF A;  1L0Y B;  2WXJ A;  4F7H A;  1QKZ A;  4IUM B;  3AEG B;  2WDT B;  1I4R A;  3HM3 A;  4LCD E;  4CYE A;  1C79 A;  1WXS A;  3QJZ A;  4KGR A;  1WX9 A;  4TSS A;  1RM6 C;  2KO3 A;  3ZJU A;  3ZRF A;  1QIL A;  1AQC A;  1BUI C;  4AJY B;  1K50 A;  1YJ1 A;  3M62 B;  4C56 C;  2UVM A;  1UZX B;  1U5G A;  1VZ8 A;  4O1N A;  1HXY D;  1STE A;  2KQS A;  1C3T A;  2LZ6 A;  1NVL A;  1HA5 A;  4KZC A;  2KXJ A;  5FR3 A;  2YSZ A;  3CMM B;  5C16 A;  3MJW A;  1GNU A;  1MI1 A;  1KBL A;  3ENE A;  3Q8A A;  2P0F A;  5C1Z A;  4HDO A;  1HB6 A;  3TEZ A;  1V5M A;  4N59 A;  1KLU D;  2R2Q A;  5JH5 C;  3P4R B;  4XWT A;  1B1Z A;  4RM8 A;  1NTI A;  3SO6 A;  2HTH B;  5FR6 A;  1L6V A;  2DAF A;  3D8E A;  4FAD A;  1F77 A;  1TYG B;  3PLU A;  2KUQ A;  2KAJ A;  2R61 A;  2RLO A;  1XT9 B;  4HDQ A;  2MWS B;  4PQ0 A;  1MJD A;  3WA0 A;  4KKI A;  1YQ3 B;  2QHO A;  1SBB B;  2RD0 A;  4BOZ B;  4DXA B;  2DA0 A;  2K8B A;  2JP2 A;  3B1L X;  1UNS A;  1V97 A;  4WWO A;  1U2B A;  4LJO B;  3AE8 B;  3E9S A;  3VHT C;  2KNB A;  1DBH A;  2HD5 B;  3QX1 A;  3AE2 B;  5HE0 A;  2IO0 B;  3W1S C;  2K0P A;  1ZC3 B;  2GCJ A;  2Y5P A;  1BTN A;  4WJO A;  4HAT B;  2OOB B;  1L4Z B;  2AX5 A;  4A6Q A;  4AUQ C;  4P7I A;  2B76 B;  2X0S A;  2COD A;  4D6W A;  5J2R A;  1ZSQ A;  1P0R A;  4ACF A;  1ZDX A;  1UBI A;  2CU1 A;  2WXM A;  2R82 A;  4ZOH C;  3W2D A;  3PS6 A;  1Z2M A;  4P1C C;  1HQR D;  2OTX A;  1RAX A;  2O2V A;  4YTP B;  5MPO A;  2DN6 A;  2GUM A;  2KLG A;  1FCL A;  1PGB A;  2PIA A;  5D3W A;  2NMB A;  4HVB A;  1XKE A;  2LEK A;  2QJL A;  2QDF A;  2V4L A;  4HXD A;  3KZ1 A;  2BVC A;  2FIF A;  1H8C A;  1HZ6 A;  2KWD A;  3BVM A;  1FHO A;  5J3T A;  3J9C A;  2PE9 A;  2X18 A;  4Y94 A;  2YS1 A;  2V4I B;  3AV8 A;  2KYW A;  4XWX A;  3ZVV A;  4Q2J A;  1DRO A;  4XDC A;  1MVK A;  1BT0 A;  4HPL B;  2PVG C;  1Q5W B;  1FNW A;  2FE8 A;  2WS3 B;  1YJI A;  1WF9 A;  3DWM A;  2CAY A;  1EM7 A;  3HIZ A;  3ZXR A;  3AE1 B;  1UWX A;  3O65 B;  2KT7 A;  2DHJ A;  3UIP B;  2KKC A;  4Z2M B;  1HZ5 A;  1UH6 A;  2C5L C;  4LJP B;  1EGX A;  1VRA B;  3X23 A;  2KJH B;  1E10 A;  4W9C A;  3LYY A;  1OQY A;  2D4Q A;  3NZU A;  4CQN A;  4FUL A;  1WJN A;  4M00 A;  2JU6 X;  4QJ5 B;  2NS5 A;  2Y7B A;  2RMM A;  2L1C A;  5JVL A;  2FJ9 A;  3V60 A;  3IAM 1;  2H89 B;  1MHH E;  2BCJ A;  3KSY A;  4GOC A;  2GB1 A;  2DHZ A;  1TY2 A;  3P2B A;  4FHK A;  3ZO5 B;  1C1Y B;  1EO6 A;  2PPH A;  4GDK B;  2G1E A;  1TGZ B;  1WY8 A;  2LMC A;  2K39 A;  1NYQ A;  1WGY A;  2RPQ A;  2WXR A;  4P6V F;  5KHQ A;  1YNT E;  2L7R A;  1E9M A;  3WIM A;  1CMX B;  2IYB A;  3D32 A;  2D9X A;  1C4C A;  2D3G A;  3Q14 C;  3V05 A;  1G6J A;  2V0G A;  4JK8 A;  2BBC A;  2W55 A;  4GDL B;  3BYT B;  5HFY A;  4A6F B;  1ACC A;  1SSN A;  2KQ4 X;  2RSU A;  2AEH A;  2COP A;  2COC A;  2UZR A;  3PG7 A;  1VZ7 A;  2XBB C;  2G9H D;  2GBM A;  4WQO B;  1FXA A;  2KVR A;  2GLS A;  1WMH A;  3KWV A;  4HKQ A;  3A1Q B;  4IM3 A;  2KC2 A;  4NAW B;  4DHJ B;  2Z0D B;  4KV2 A;  2KJR A;  5LOP B;  3DBR I;  1XLN A;  4WJP A;  3L4P A;  3FSS A;  1I4G A;  2ZEQ A;  3L08 A;  5M4Y B;  1HEZ E;  3DXE A;  1E6E B;  2M38 A;  2M0A A;  2WGS A;  3N1X C;  5JZE B;  1DOY A;  2ZNV B;  1CQV A;  3SBG A;  3AE3 B;  4D0N B;  1TKE A;  2KR0 A;  1DOI A;  2BB6 A;  2NBU A;  3Q8F A;  3PPA A;  2N1V A;  5I2S A;  3QCA A;  5G55 A;  1E0Z A;  3NG0 A;  4YTN B;  1Y8R C;  2KK8 A;  5DCN A;  4WJN A;  2DEN B;  3PZD A;  1PGX A;  2LG1 A;  2AQ1 B;  3BVG A;  4OVV A;  1JDE A;  1WE7 A;  2KD0 A;  3GB1 A;  5D94 A;  3IFW B;  2D07 B;  4W9E A;  4WJQ A;  1DDW A;  1WM2 A;  4JGH B;  4KX6 B;  1D5Z C;  2IGH A;  1J0G A;  1PUT A;  1V1O A;  3VDZ A;  2JZ3 B;  1TT5 B;  1V89 A;  5HE2 A;  2V1Y A;  2BKF A;  3NZS A;  5EE1 A;  3FIL A;  1VD2 A;  1T0Q C;  5HHD G;  2DKQ A;  4OW0 A;  2YEP B;  1P7F A;  2QC8 A;  5DHA B;  1OGW A;  3K9P B;  2L2I A;  1N61 A;  2IBI B;  3GZN I;  2KQ7 A;  4H8S A;  4K1R B;  4RGT A;  2BS3 B;  3PZ7 A;  2WYQ A;  3WAM A;  4B0E A;  4WIP A;  1JAL A;  3ML8 A;  5T8I A;  2YT1 A;  4HAV B;  1V81 A;  2IND C;  4L23 A;  5D3V A;  1FXI A;  5IAA C;  4DX9 0;  4PYU A;  3JVZ X;  1DGJ A;  3HQC A;  1KLV A;  4ILJ A;  2VRW B;  2J0J A;  1V5O A;  4XX5 A;  1P6S A;  2KWV B;  2I5C A;  4WQM A;  4CHM A;  2CJO A;  3X0W A;  2XK5 A;  3RCP A;  2K2J A;  3E56 A;  4NAM A;  2IFS A;  3VXW A;  3DBL I;  3RYT A;  2Z0O A;  3AUL A;  4A3O A;  1XLO A;  3MP9 A;  4KIK B;  2WLB A;  3VFK A;  4FBJ B;  4C0A A;  1FNV A;  3U12 A;  2GBR A;  1WZ3 A;  1BAK A;  1TIF A;  1HB8 A;  1FGZ A;  5J17 A;  3QAR A;  2MEK A;  4C4V B;  1WGQ A;  1WXV A;  4YWG G;  4DXF A;  1K53 A;  2J7Q B;  3P1M A;  1MIZ B;  1X86 A;  3Q69 A;  4ASW C;  4LLG M;  4REZ A;  2N9L A;  2C7H A;  2E3T A;  3JW0 X;  3AU5 A;  3OJ4 B;  2E2X A;  5FI1 A;  2GRI A;  2ON8 A;  3M95 A;  4HCN B;  2IGD A;  3A8P A;  3EGR A;  2DTC A;  4DHJ D;  5HE1 A;  1QOA A;  2DBY A;  2JVC A;  1TS4 A;  5KCV A;  1VBH A;  2I2Y A;  4FJV B;  1NI3 A;  2BB5 A;  2N1W A;  1QOF A;  2EKE C;  2R2O A;  4HB4 B;  2IO1 B;  3BK2 A;  3P4Q B;  3CF6 E;  1WM3 A;  5FK9 C;  4ZYN A;  4EMO A;  1QQR A;  5HE3 A;  1W1D A;  1KRH A;  3CST A;  2G45 B;  1TKY A;  1SE2 A;  4OVZ A;  4RM9 A;  2LUM A;  3U7D A;  1ENF A;  4ICU A;  2DZM A;  1J19 A;  1JML A;  4M8N A;  2BYE A;  3A33 B;  1KH0 A;  2ONQ A;  3G9W A;  1Q0W B;  1XCT L;  2HJ8 A;  2K5P A;  1ZUD 2;  2JQR B;  3ZNI D;  1BML C;  2RR9 A;  2D3B A;  1D6E C;  3OHM B;  4BKS A;  2FID A;  4TV3 A;  3PLV A;  2CRF A;  1JRO A;  2NMQ A;  3LJ3 A;  2CU3 A;  4RFB A;  4TUU A;  2JWU A;  4PNK A;  1V1P A;  4LNK A;  4BZA A;  1HTQ A;  1ZKH A;  2WXH A;  3MC0 B;  2L0T A;  2ZPY A;  3H8H A;  5BO4 B;  1BWN A;  4IC7 B;  2M17 A;  2P0D A;  1FFV A;  2JZZ A;  4DDI D;  1PMS A;  1RRP B;  3VAW A;  4M02 A;  3DHH C;  1SEB D;  2M4N A;  4FA6 A;  2QIE B;  2RDB C;  2EJ8 A;  2ROZ B;  1NDD A;  1GJZ A;  1BXT A;  2NZ8 B;  1P7E A;  1T0S C;  3UIN B;  5EDS A;  1T0R C;  1EF5 A;  4YXD B;  3QK0 A;  1M4V A;  2EEL A;  1C76 A;  4HRO A;  2WXL A;  4DX8 A;  4JQW C;  1WXQ A;  4WWM A;  2BKR B;  3WCQ A;  3CWI A;  1UUP A;  1WX8 A;  2DZK A;  4FJY A;  3N7C A;  4R3D A;  3PT2 B;  4MJS B;  4OVU A;  4CO7 A;  5DPW A;  5C5B A;  1XD3 B;  2LRW A;  4I6L B;  4NPN A;  2K6Q A;  4ZHO A;  3DVG X;  1X1F A;  4G0N B;  1N60 A;  4IM2 A;  3VTW A;  4MGY E;  4CHJ A;  4A20 A;  2AL3 A;  4KGS A;  1F9J A;  4XZ4 A;  1V5U A;  3E9P A;  1L0X B;  4ZRI A;  4A8X C;  4PS3 A;  5KQ4 A;  1FHX A;  2K8C A;  4JE3 B;  1FM0 D;  3RT3 B;  4BAX A;  2NBV B;  2N23 A;  1ROE A;  4AJW A;  2ZKM X;  3PHX B;  5AZG A;  4HPM B;  2GI9 A;  3PZ8 A;  2KAN A;  1JWU D;  2JZP A;  2ZNV C;  1UNR A;  1KFY B;  1I7A A;  2PTL A;  3NW8 A;  3I57 A;  1J7B A;  1T6B X;  2N0S B;  2WXG A;  2O6V A;  2JSV X;  4EOY A;  5E6N A;  4DIX A;  1D5M C;  2ZJD A;  1WFY A;  4DWF A;  4WAA A;  1X11 A;  1LXD A;  2MCN B;  2VKI A;  3RNE C;  2MHJ A;  3UIO B;  1Z87 A;  1WR1 A;  3SYX A;  1UGM A;  1YQB A;  4MSQ B;  1K52 A;  1V2Y A;  1ZM0 A;  1Y5O A;  4AP4 C;  3ZJT A;  4W9L A;  2N9K A;  2D3A A;  4JPS A;  1T77 A;  3QC8 B;  3ZGZ A;  5GOW B;  1RWS A;  3DBL B;  2JXX A;  3BZD B;  2K6D B;  3B77 A;  1FB8 A;  1I4H A;  2EMT A;  2DKP A;  1X1M A;  4DK5 A;  2MW5 A;  3B2G A;  1M7E A;  3VIA A;  2HDE A;  3Q3F A;  3C8Y A;  4WVF B;  1YN5 A;  4ANV A;  3AM9 A;  2DHI A;  3NWF A;  2RPV A;  2LGX A;  1V8C A;  3PEG A;  4ZRK A;  3HIE A;  5AZF A;  2PKO A; 
#chains in the Genus database with same CATH homology
 1ZVR A;  2KWU B;  1WR6 E;  2P8V A;  4W9F A;  4IM0 A;  5IJM A;  4HB2 B;  2YLM A;  4JK7 A;  2LGD A;  2L76 A;  4KSL C;  2C7M B;  4F1S A;  2W2X D;  4BOS C;  2KTR A;  1MKE A;  1DIK A;  4W9D A;  5CHW A;  3BIN A;  2RGF A;  2WWZ A;  3DBS A;  3H7S A;  2YS3 A;  3RUL A;  1NI2 A;  1WGG A;  1V5P A;  2DIK A;  3PVW A;  1EVH A;  3I3T B;  4FJZ A;  3KUZ A;  2N7D A;  3H6N A;  3PTF C;  3RZW C;  2D9W A;  1GG3 A;  1WGD A;  2DAJ A;  2BPS A;  2V76 A;  3M3J A;  2L00 B;  1UEL A;  3EC8 A;  2DX1 A;  2ZVO A;  1FXT B;  2MFQ A;  1TXD A;  1YX6 B;  3AXC A;  4B6H A;  2N9P C;  2O2V B;  1M7R A;  1FAO A;  2MWN B;  2LD9 A;  4BVU C;  3UF8 A;  2KTF A;  1ST7 A;  4JKF A;  2MBO A;  3VOQ A;  2GBK A;  4B6W A;  4BBN F;  2JUO A;  1ISN A;  3ZW3 A;  4K81 A;  3Q3J A;  2C9W B;  4I6N B;  1W1G A;  3TFM A;  2FCN A;  3PP2 A;  2RGN B;  2KFK B;  2GBJ A;  4HAX B;  3H1U A;  2RUK B;  3LJU X;  2W2W A;  1MPH A;  4K17 A;  1UPQ A;  2I1K A;  4IW0 A;  3E9O A;  3KYC D;  1VBG A;  1RFA A;  2ELB A;  3ZNZ B;  4IFS A;  2FCS A;  2Z0P A;  4HB3 B;  4EUT A;  2MP2 A;  1UBQ A;  3KRX A;  3AI5 A;  3WAL A;  3L13 A;  4MGZ E;  2W2X C;  4HHV A;  3ZRC A;  1I35 A;  1FHW A;  3TW1 A;  1QQG A;  2KFJ A;  1DDV A;  1U27 A;  5D3Y A;  1SGH A;  3QHT A;  2BWE S;  1WH3 A;  3PGE A;  4PS8 A;  4LDT B;  3SD5 A;  2LUE A;  3T06 A;  4JKC A;  1U5D A;  4JKH A;  1XR0 B;  4IG7 B;  1WRD B;  3TBL D;  4M0W B;  4E71 A;  4W9K A;  3VUX A;  2LOX A;  1TJ6 A;  4ILH A;  4DDG D;  1WMH B;  3V6E B;  4E3C A;  1YD8 U;  3H7P A;  4MT7 A;  1PFJ A;  5L95 C;  1LQB A;  3NS8 A;  1PQS A;  2BGF A;  1KJT A;  3SNH A;  2ASQ A;  4K2O A;  4MDK E;  3HK0 A;  2L8J A;  3PVU A;  2NCN A;  2W9N A;  3KYD D;  3A9J A;  2K00 A;  2KDF B;  5G2N A;  4MH0 E;  3B0A A;  5GMV A;  1XCG A;  3O96 A;  2N0Y A;  2CR5 A;  2IY0 B;  3TCA A;  2PZ1 A;  1P9D U;  2IO2 B;  1V86 A;  3DVG Y;  1OTR B;  2Q13 A;  2UZS A;  2NPT A;  3DPD A;  2EC1 A;  4GZU A;  2JRH A;  1MIX A;  2MKR A;  2RNR B;  4JLC A;  3ZTD A;  3VQI A;  5DHF B;  5LON B;  5E6P A;  3U30 A;  5E6O A;  1IP9 A;  3TJP A;  1NU2 A;  5FI0 A;  1WYW B;  4F7Z A;  2MQJ A;  2RVB B;  3R7R A;  4NSW A;  5KQ1 A;  2XK5 B;  3UGB B;  2M8S A;  4I6P A;  2N9X A;  2KOX A;  1UEF A;  1L7Y A;  4W9H A;  4KVG B;  3PRE A;  1RRB A;  3SUZ A;  3PVL A;  5EFX A;  3ENB A;  1WI0 A;  1UPR A;  3ZNH B;  1GC6 A;  3FLV A;  3P7Z A;  2Y5B B;  3SU8 X;  4LDT D;  1Q67 A;  1WXA A;  3V61 A;  3MPX A;  3ECI A;  4IAP A;  1A5R A;  1L2N A;  5HKH A;  1EUV B;  3IVF A;  3IHP C;  3JSV A;  1HE8 A;  5CHF A;  3CSF A;  4GU2 A;  3A9K A;  2PE6 B;  4BBK A;  4JL9 A;  4TKN A;  1X05 A;  1N3H A;  4FLH A;  1PLS A;  5JHB A;  2IYD B;  2D11 A;  1XQQ A;  4IWP A;  4GSW A;  2JRI B;  4JKB A;  1WJM A;  3OLM D;  1AAR A;  3WAO A;  3ZIM A;  4W9G A;  2R0D A;  4ZRJ A;  2COA A;  1GUA B;  1MK9 B;  2KZR A;  2ABD A;  2Y8F A;  4K7U A;  4URK A;  4KZ0 A;  2BWF A;  4TQ0 A;  2N9E B;  2VSZ A;  1V5T A;  2MSE D;  3D8D A;  2KCJ A;  1WZ0 A;  4DBG A;  3NSU A;  3TL5 A;  2JWZ A;  2UYZ B;  3WYF B;  2HRJ A;  4JKA A;  4IWO A;  4KDI C;  2L05 A;  3PV1 A;  4HWI B;  2MRP A;  1OY2 A;  3QIJ A;  4EZK A;  2LVP A;  3OAW A;  5LXH A;  1TBE A;  3MTN B;  2M0X A;  3KUC B;  2L0F A;  3M1I B;  3NHE B;  4NJ6 A;  3R3M A;  4BFR A;  3A4R A;  1P1A A;  3VH3 B;  1GGO A;  1ZGU B;  5C5B B;  1OEY A;  3NY5 A;  1D3Z A;  4ICV A;  4PS7 A;  2KX3 A;  3DVN U;  3V6C B;  2JF5 A;  1T0Y A;  1E8W A;  1V6E A;  3ZVR A;  3DDC B;  4HCP B;  3EPY A;  2COF A;  4ANU A;  1U29 A;  5IA7 A;  5DPR A;  4JKG A;  3V62 A;  3W1S A;  4GN1 A;  1WGU A;  3AU4 A;  5CLQ B;  3HW2 B;  3W1Y A;  3QQ8 B;  3PRP B;  1WJ4 A;  1K8R B;  4EZL A;  4ANW A;  5KHO A;  2K2U A;  4DHZ B;  4WWN A;  3BJI A;  2LI5 A;  3FEH A;  2CKH B;  1E8X A;  3ML9 A;  5D6J B;  3DCG A;  4DHZ E;  4WSF A;  2ELA A;  1TTN A;  1XX0 A;  2LYD A;  5CLL B;  1KI1 B;  3ULC A;  3C0R B;  2KJ6 A;  2DYB A;  3ODW A;  3B08 A;  4KSK C;  1VCB A;  2G3Q B;  2YT0 A;  4JKD A;  3QAQ A;  2PJH A;  5LLI A;  1E7U A;  4BKS D;  3TVV A;  5CTR C;  2KDE B;  2CHZ A;  3WAN A;  3DXD A;  1K5G B;  3LDZ E;  3KUD B;  4G3X B;  2LVO A;  3K9O B;  1I42 A;  1MK7 B;  2KTR B;  2A5U A;  4MEM A;  2G35 A;  2AYO B;  3GYP A;  4NNJ B;  1MG8 A;  2FDQ A;  2FNJ B;  4MM3 A;  3N32 A;  5D7G A;  4GPT B;  5AZH A;  2G4D B;  3PSC A;  2DX5 A;  2NBW B;  3ZUN A;  1E8Z A;  2LJ5 A;  4Z2N A;  1XOD A;  2K8H A;  3VTU A;  3TIX A;  3R66 C;  3ZNG C;  3ZLZ A;  5DI9 B;  3TMP B;  2A4Z A;  3E9L A;  1V80 A;  1UNQ A;  2LXA A;  1OMW A;  4F7G A;  3HHM A;  2J0K A;  1B55 A;  1V61 A;  1ZC4 B;  2B3A A;  3ONS A;  2LOZ A;  2LKO A;  3E66 A;  2I1J A;  1S3S G;  4TQ1 A;  1OEY J;  5AEK B;  2O6V D;  2BF8 B;  1R4N I;  2N7E A;  4WWP A;  1E8Y A;  2DYO A;  2KGX B;  3OJ3 A;  1LW3 A;  1WI1 A;  3RCZ A;  2IZV B;  2M1M A;  2OJR A;  2MP2 B;  1BTK A;  3SV1 A;  3QWM A;  3ALB A;  3QWZ B;  2GCL A;  2FJL A;  1KC7 A;  1R4M I;  2LGY A;  3JYU A;  4A5K A;  3BY4 B;  4EEW A;  4HAZ B;  3DBH I;  5L81 A;  2CS4 A;  4ZDV A;  2HTH A;  2KUP A;  1WVH A;  1LM8 B;  2J0M A;  1TQZ A;  2KMC A;  2KMA A;  1V9J A;  3PRZ A;  3ULB A;  4B9K A;  2YVC A;  2M14 A;  3UQB A;  2Y8G A;  3A98 B;  4W9J A;  3ODX A;  4BKG A;  2D9Z A;  1QC6 A;  3R7Q A;  3H7P B;  4M8M A;  2BYF A;  2N4F A;  1WGH A;  3SDL C;  2V3S A;  2QKM A;  2XEW A;  3S2A A;  5DPT A;  1IPG A;  2DYM A;  2PEA A;  4HLE A;  3WAP A;  4II3 B;  3FM8 C;  3L54 A;  2WH5 A;  3A9J B;  1WG7 A;  4YL8 A;  3F0W A;  4ILG B;  2KDI A;  3L17 A;  2C7N B;  3ZDT A;  2KFK A;  1UD7 A;  3KRW A;  4JIO U;  3MDB C;  2OQB A;  3VUW A;  2JY6 A;  4AOF A;  4CHK A;  2D2Q A;  3DVN V;  4HB0 B;  3D8F A;  2AWT A;  2MBB B;  1H4R A;  3ODO A;  1V49 A;  4JKE A;  4IWQ A;  4F8C B;  4GB9 A;  3V5W A;  2MLB A;  4NQL B;  2D9V A;  2H7E A;  2NPT B;  2KC1 A;  2CQU A;  5C79 A;  1NBF C;  2XQN M;  2LUL A;  4IOY X;  3KH0 A;  1DYN A;  4HAU B;  2CB8 A;  4G50 A;  3TO1 A;  4MGI E;  1WGR A;  1NTV A;  1J8C A;  3U8Z A;  5JLJ B;  1JRU A;  5J18 A;  3VH4 B;  2J59 M;  2UWQ A;  5CHV C;  2GOW A;  5DIF B;  2DYN A;  2CY5 A;  4TYZ A;  5JHG A;  2ROV A;  5D27 A;  4HAW B;  2IY1 B;  3MHS D;  1YX5 B;  4F7U P;  2WX0 A;  2L3Z A;  3FP5 A;  2ADZ A;  4GDK A;  1M94 A;  2P0H A;  2DLW A;  2LWP A;  2DZI A;  1IYF A;  1AWE A;  4GDL A;  4MY6 A;  3JSV B;  4A6F A;  3HM6 X;  3A9K B;  2REX A;  4FN2 A;  1KZG A;  1QZE A;  2DZJ A;  3EEC A;  2CY4 A;  1UNP A;  3A1Q A;  4NAW A;  2FCQ A;  2FCM A;  2D10 A;  5CX3 A;  2KHW B;  1TZ1 A;  4A3P A;  3SBT A;  3M63 B;  4HJK A;  2CHX A;  1WX7 A;  4WJ7 A;  4B95 A;  2CHW A;  1P3R A;  1FOE A;  4AWJ A;  5L83 A;  4JK9 A;  4MK0 A;  2ZVN A;  1SHC A;  3PSE B;  4EFO A;  2H7D A;  1WE6 A;  3N3K B;  1EF1 A;  1Y19 B;  1WJU A;  2DFK A;  1P98 A;  2MBE A;  1WJ6 A;  1MAI A;  4PYZ A;  5C6R A;  1E7V A;  1XD4 A;  3SHQ A;  3AJ4 A;  3H9D A;  4KHB B;  4NY0 A;  2AL6 A;  3L0W B;  4BBN C;  3CXB B;  2G4S A;  2ZZP B;  4GMV A;  4GXB A;  1Q1O A;  2ZCC A;  1U4A A;  2JT4 B;  3KVF B;  4EKU A;  2JPH A;  3F5R A;  3NOB A;  4EZJ A;  3UQA A;  4GIV A;  3PHW B;  2GS0 A;  4K2P A;  2K1F A;  1Z5S B;  2C60 A;  3QA8 A;  5DH9 B;  3A4S C;  3CIK A;  3RD2 A;  2KWC A;  5JP4 A;  1KZ7 A;  2FUH B;  1RJ2 A;  1KOT A;  1J0W A;  1YIW A;  4N9F 4;  2LBB A;  3VUY A;  2GJY A;  4EJN A;  1WXM A;  2WX1 A;  5J3Q A;  4RMA A;  1U5E A;  1V88 A;  1OQN A;  4XC2 A;  2KDB A;  1HBK A;  4GGQ A;  3VTV A;  2NR2 A;  3APC A;  1H10 A;  2LXC A;  4KHO A;  3APD A;  2DYQ A;  3IG3 A;  4KIK A;  1GC7 A;  3VVW B;  4JKG B;  1W1H A;  4G11 A;  2KLC A;  5D2M B;  4HAY B;  3OAN A;  4DBB A;  3RUI B;  2YS5 A;  2GMI C;  1EAZ A;  1I2H A;  1ZW7 A;  1LB1 A;  4FHJ A;  4II2 B;  2ZPN A;  1P3Q U;  2NVU I;  2RQ1 A;  5JHA A;  5C23 A;  3APF A;  3L10 B;  2Z0Q A;  3GYO A;  2DHK A;  2LRU A;  2Z0E B;  2R09 A;  1NTY A;  5TR5 A;  1LFD A;  2LAS A;  2QKL A;  4X57 B;  4A6K A;  2VRR B;  2KX0 A;  4KHA A;  4A6H A;  4MEL A;  3KW5 B;  1X1G A;  2MDX A;  3P6A A;  4HK2 A;  4L6E A;  2O6V B;  2K25 A;  4NJ7 A;  1K5D B;  1U5F A;  1ACA A;  2RSG A;  4K7S A;  4J6I A;  5J3Y A;  3UZT A;  2HE7 A;  3QBV B;  2EMS A;  3KY9 A;  1DDM A;  1WIA A;  1FGY A;  2BYV E;  4BKT A;  2GBN A;  2YF0 A;  3A8Q A;  4K7W A;  4GMX B;  3L16 A;  1IRS A;  2D9Y A;  2MX2 A;  4E74 A;  2ZCB A;  3T8M A;  4KDL B;  4W9I A;  3ML4 A;  4KAX B;  3N30 A;  5D3X A;  2LVQ A;  2FAZ A;  1S1Q B;  2MA9 B;  2MBH A;  2DX5 B;  2YRY A;  3EFU A;  2I5F A;  3GOE A;  3DQV A;  4YON A;  2IO3 B;  4MJS A;  3EHV A;  5DPS A;  4MGK E;  4MSM B;  2Z59 B;  2KN5 A;  3IBE A;  4NQK E;  1E5W A;  3ZKJ C;  1WJ1 A;  2MBQ A;  3ZTC A;  3DXC A;  4ANX A;  1E90 A;  1P5T A;  3RZF A;  5JHH A;  3PRM B;  1SIF A;  1KM7 A;  1SE9 A;  3ZDM C;  3T9L A;  5LXI B;  3DOW A;  1RLF A;  4F7H A;  4IUM B;  2WDT B;  3HM3 A;  4LCD E;  4CYE A;  1WXS A;  3QJZ A;  1WX9 A;  2KO3 A;  3ZRF A;  1AQC A;  4AJY B;  1YJ1 A;  3M62 B;  2UVM A;  1UZX B;  1U5G A;  2KQS A;  1C3T A;  2LZ6 A;  1NVL A;  4KZC A;  2KXJ A;  2YSZ A;  3CMM B;  5C16 A;  3MJW A;  1GNU A;  1KBL A;  3ENE A;  2P0F A;  5C1Z A;  4HDO A;  1HB6 A;  1V5M A;  2R2Q A;  5JH5 C;  4RM8 A;  1NTI A;  3SO6 A;  5FR6 A;  2HTH B;  2DAF A;  3D8E A;  4FAD A;  3PLU A;  2RLO A;  1XT9 B;  4HDQ A;  2MWS B;  4PQ0 A;  3WA0 A;  2QHO A;  2RD0 A;  4BOZ B;  4DXA B;  2DA0 A;  2K8B A;  2JP2 A;  3B1L X;  4WWO A;  1U2B A;  4LJO B;  3VHT C;  2KNB A;  1DBH A;  2HD5 B;  3QX1 A;  5HE0 A;  2IO0 B;  3W1S C;  1ZC3 B;  2GCJ A;  1BTN A;  4WJO A;  4HAT B;  2OOB B;  4AUQ C;  4P7I A;  2X0S A;  2COD A;  5J2R A;  1ZSQ A;  1P0R A;  1UBI A;  2CU1 A;  2R82 A;  3PS6 A;  1Z2M A;  2OTX A;  1RAX A;  2O2V A;  2DN6 A;  2KLG A;  5D3W A;  2NMB A;  4HVB A;  1XKE A;  2V4L A;  4HXD A;  3KZ1 A;  2FIF A;  1H8C A;  1FHO A;  5J3T A;  2PE9 A;  2X18 A;  4Y94 A;  2YS1 A;  4XWX A;  3ZVV A;  1DRO A;  1BT0 A;  4HPL B;  1Q5W B;  1WF9 A;  2CAY A;  3HIZ A;  3O65 B;  3UIP B;  2DHJ A;  2KKC A;  4Z2M B;  1UH6 A;  2C5L C;  4LJP B;  1EGX A;  2KJH B;  3X23 A;  4W9C A;  1OQY A;  2D4Q A;  3NZU A;  4FUL A;  1WJN A;  2NS5 A;  2Y7B A;  2L1C A;  5JVL A;  2FJ9 A;  3V60 A;  2BCJ A;  3KSY A;  4GOC A;  2DHZ A;  3P2B A;  4FHK A;  3ZO5 B;  1C1Y B;  1EO6 A;  4GDK B;  2PPH A;  1TGZ B;  1WY8 A;  2K39 A;  1WGY A;  2RPQ A;  5KHQ A;  2L7R A;  3WIM A;  1CMX B;  2IYB A;  3D32 A;  2D9X A;  2D3G A;  1G6J A;  4JK8 A;  4GDL B;  4A6F B;  2RSU A;  2AEH A;  2COP A;  2COC A;  2UZR A;  3PG7 A;  2XBB C;  2GBM A;  4WQO B;  2KVR A;  1WMH A;  3A1Q B;  4IM3 A;  2KC2 A;  4NAW B;  4DHJ B;  2Z0D B;  4KV2 A;  2KJR A;  5LOP B;  3DBR I;  4WJP A;  3FSS A;  2ZEQ A;  3L08 A;  3DXE A;  2M38 A;  5JZE B;  2ZNV B;  3SBG A;  4D0N B;  2NBU A;  3PPA A;  2N1V A;  5G55 A;  3QCA A;  1Y8R C;  2KK8 A;  5DCN A;  4WJN A;  2DEN B;  3PZD A;  2LG1 A;  4OVV A;  1JDE A;  1WE7 A;  2KD0 A;  5D94 A;  3IFW B;  2D07 B;  4W9E A;  4WJQ A;  1DDW A;  1WM2 A;  4JGH B;  1J0G A;  3VDZ A;  2JZ3 B;  1V89 A;  5HE2 A;  2V1Y A;  2BKF A;  3NZS A;  1VD2 A;  2DKQ A;  5DHA B;  1OGW A;  3K9P B;  2L2I A;  2IBI B;  3GZN I;  2KQ7 A;  4H8S A;  4K1R B;  2WYQ A;  3WAM A;  3ML8 A;  2YT1 A;  4HAV B;  1V81 A;  5D3V A;  5IAA C;  4DX9 0;  4PYU A;  3JVZ X;  3HQC A;  1KLV A;  4ILJ A;  2VRW B;  2J0J A;  1V5O A;  4XX5 A;  1P6S A;  2KWV B;  2I5C A;  4CHM A;  3X0W A;  2XK5 A;  3RCP A;  2K2J A;  2IFS A;  3VXW A;  3DBL I;  3RYT A;  2Z0O A;  3AUL A;  4A3O A;  4KIK B;  3VFK A;  4FBJ B;  4C0A A;  2GBR A;  1WZ3 A;  1BAK A;  1HB8 A;  1FGZ A;  5J17 A;  3QAR A;  1WGQ A;  1WXV A;  2J7Q B;  1MIZ B;  1X86 A;  4ASW C;  2C7H A;  3JW0 X;  3AU5 A;  3OJ4 B;  2E2X A;  5FI1 A;  3M95 A;  4HCN B;  3A8P A;  2DTC A;  4DHJ D;  5HE1 A;  2JVC A;  5KCV A;  1VBH A;  4FJV B;  2N1W A;  2EKE C;  2R2O A;  4HB4 B;  2IO1 B;  3CF6 E;  1WM3 A;  4ZYN A;  4EMO A;  5HE3 A;  1W1D A;  3CST A;  2G45 B;  4RM9 A;  3U7D A;  4ICU A;  2DZM A;  1J19 A;  4M8N A;  2BYE A;  3A33 B;  3G9W A;  1Q0W B;  2HJ8 A;  3ZNI D;  2RR9 A;  4BKS A;  2FID A;  4TV3 A;  3PLV A;  2CRF A;  3LJ3 A;  4TUU A;  4PNK A;  1ZKH A;  2L0T A;  2ZPY A;  5BO4 B;  1BWN A;  4IC7 B;  2M17 A;  2P0D A;  2JZZ A;  4DDI D;  1PMS A;  1RRP B;  3VAW A;  4FA6 A;  2M4N A;  2EJ8 A;  2ROZ B;  1NDD A;  1GJZ A;  2NZ8 B;  3UIN B;  5EDS A;  1EF5 A;  3QK0 A;  4DX8 A;  4JQW C;  2BKR B;  1WX8 A;  2DZK A;  4FJY A;  3N7C A;  3PT2 B;  4MJS B;  4OVU A;  4CO7 A;  5DPW A;  5C5B A;  1XD3 B;  2LRW A;  4I6L B;  4NPN A;  2K6Q A;  3DVG X;  1X1F A;  4G0N B;  4IM2 A;  3VTW A;  4MGY E;  4CHJ A;  4A20 A;  2AL3 A;  1F9J A;  4XZ4 A;  1V5U A;  3E9P A;  4ZRI A;  4PS3 A;  5KQ4 A;  1FHX A;  2K8C A;  3RT3 B;  2NBV B;  2N23 A;  4AJW A;  3PHX B;  5AZG A;  4HPM B;  2KAN A;  2ZNV C;  1UNR A;  1I7A A;  2O6V A;  4EOY A;  5E6N A;  2ZJD A;  1WFY A;  4DWF A;  4WAA A;  1X11 A;  1LXD A;  2MCN B;  2VKI A;  3UIO B;  1Z87 A;  1WR1 A;  3SYX A;  1UGM A;  1YQB A;  4MSQ B;  1V2Y A;  1ZM0 A;  1Y5O A;  4AP4 C;  4W9L A;  3QC8 B;  5GOW B;  2JXX A;  2K6D B;  1FB8 A;  2EMT A;  2DKP A;  1X1M A;  4DK5 A;  2MW5 A;  1M7E A;  3VIA A;  3Q3F A;  4WVF B;  4ANV A;  2DHI A;  2LGX A;  3PEG A;  4ZRK A;  5AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...