1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
3PZDA 4EZLA 1RRPB 3PVLA 2YS1A 1WG7A 5LXHA 5CLLB 2MRPA 4HXDA 3SUZA 3TCAA 2KN5A 3L16A 2EC1A 1XODA 4IW0A 2BYFA 1X1FA 3PEGA 3VQIA 3R7QA 1X86A 2M17A 3TJPA 2DFKA 1GJZA 3PHWB 2D11A 2DYOA 2AL3A 2MP2B 1P1AA 1EF5A 2KXJA 3MDBC 2M38A 2YS5A 5J17A 2LBBA 4BBKA 5D3VA 2ZCBA 2J0JA 1Z87A 2A4ZA 1CMXB 2XK5B 2L76A 3EFUA 3M1IB 1P3RA 2REXA 4F7ZA 3TW1A 2BKRB 1U27A 1WM3A 2PE9A 3ZUNA 4DHJB 1LXDA 2KMAA 1WI0A 3PRPB 3K9PB 1KI1B 2WX0A 1NTIA 3GYOA 5J3QA 1TQZA 2WWZA 1OQNA 4EZKA 4HHVA 3KRXA 1ZW7A 3RT3B 2N23A 3KY9A 1KM7A 5CX3A 2ZZPB 1WGHA 3ONSA 4GPTB 4HVBA 4F8CB 4PS8A 4LDTD 2DX5B 2XK5A 3VDZA 3IFWB 1L7YA 2WDTB 3CSTA 1WF9A 2YT1A 1V5TA 4MGYE 3HM6X 1C1YB 3V6EB 4L6EA 2L2IA 1GUAB 2Z0EB 3KH0A 4MY6A 4DBBA 3V6CB 4Z2MB 1Q5WB 2GBRA 5GMVA 1BTNA 3PV1A 2G45B 2L8JA 5HE1A 5KQ4A 3QARA 3M3JA 2KKCA 3V60A 2DYBA 5JH5C 5LOPB 2RVBB 3DXDA 1RLFA 2DX5A 2QKMA 1WJMA 3RZWC 1S1QB 2LOXA 2YSZA 2D2QA 1H4RA 4XWXA 4NNJB 2C7NB 1EVHA 2DZKA 3APFA 4CHKA 5DPTA 2J7QB 5FI0A 2LRWA 2XQNM 1YIWA 5CHWA 3HM3A 1V80A 2M0XA 3NZUA 2K6DB 4ZDVA 4EZJA 3TL5A 4BOZB 1RFAA 2LG1A 1MK7B 4HJKA 2COPA 3PP2A 3QBVB 4PQ0A 2ZEQA 1HB6A 1NVLA 3VIAA 4TYZA 1V81A 2Y5BB 1M94A 1KOTA 3DVGX 1UPRA 1KZGA 1BWNA 3QCAA 2W2XD 3FSSA 2LXCA 5JHBA 3C0RB 5DCNA 2Q13A 3A33B 1WMHB 4MGZE 3VUYA 1TGZB 2KHWB 4HAZB 3KYCD 2N7DA 2M14A 1WR1A 2C7MB 4EKUA 2JP2A 4PYZA 5E6PA 2RGNB 3WIMA 4NQKE 2L0FA 2VRRB 4DHZE 3L54A 5E6NA 1V5MA 3QK0A 3KSYA 3BJIA 2WYQA 2YF0A 3X23A 5CTRC 1SGHA 1GNUA 4FJVB 1XQQA 4HAXB 3W1SA 1WMHA 3V62A 4KAXB 2LGYA 2B3AA 2DYMA 3O96A 2ROVA 4GN1A 1WXAA 1P5TA 5AZFA 1SE9A 2JVCA 2M1MA 3DXEA 4P7IA 2N9EB 1WM2A 3FM8C 4Y94A 3VUXA 5J18A 1MG8A 2RGFA 2MX2A 1ZM0A 3ZNZB 1ZC3B 1U5FA 2N1VA 4GDKB 4EEWA 3ENEA 4IM2A 1V2YA 3ZLZA 4HPLB 2IO1B 2YS3A 4W9KA 2KC1A 2L00B 3MTNB 2GBJA 2UZSA 2EJ8A 2NBVB 4CO7A 1UH6A 4GB9A 4F7HA 5D94A 2R09A 4BVUC 4CYEA 1IRSA 1BAKA 1WVHA 2P8VA 3JSVB 2C5LC 3APDA 2PE6B 1FGYA 3SO6A 2PEAA 1NI2A 1V9JA 4M8NA 4ZRJA 2CHXA 4MGIE 2HRJA 3N7CA 1K8RB 4GDLB 3D32A 3PSCA 4ICUA 4W9EA 2LGXA 5LLIA 4JL9A 5D3YA 2PZ1A 1YX6B 3Q3JA 4AWJA 5G55A 4HATB 1WZ3A 2KFJA 2LUEA 1DROA 1EF1A 1WGGA 1E90A 2V3SA 3JSVA 3W1SC 4AJYB 4MT7A 3W1YA 4RM8A 3HIZA 1L2NA 3D8DA 2G4SA 2MFQA 2CS4A 3N30A 1YD8U 1OMWA 3U30A 1E8YA 1M7RA 2GJYA 3A9KA 1E5WA 5DI9B 3VFKA 2LKOA 3NSUA 1SIFA 1WH3A 3Q3FA 4JQWC 2YLMA 2BWES 4DBGA 2MLBA 2O2VB 4MJSB 3VOQA 3A8QA 1U5GA 4DK5A 1V86A 2UYZB 2DLWA 2RR9A 1AWEA 2D9ZA 2KTRA 2IYBA 5IJMA 2KLCA 4A3OA 4PYUA 4HB4B 1OEYJ 3QX1A 2CR5A 1NTYA 2FIDA 2D9VA 2HTHB 1WGUA 2DN6A 3UIOB 1NTVA 2LOZA 4GZUA 3K9OB 4A6KA 1T0YA 4JGHB 3OLMD 4WAAA 2O2VA 5C23A 3HW2B 3H9DA 3CSFA 4F1SA 3MPXA 5GOWB 1WRDB 3DBRI 1IPGA 2KX3A 3U7DA 4A5KA 1Q0WB 3ZRCA 4ANVA 2AWTA 4TUUA 2K25A 3QIJA 2CY5A 5BO4B 3ZNHB 1BT0A 1LFDA 2LZ6A 1E7VA 2D9WA 1MK9B 3TFMA 1V5OA 3X0WA 4LDTB 2O6VD 3KUDB 2IO3B 2K1FA 1I35A 1J19A 3M95A 4HAVB 2C9WB 3CF6E 2MQJA 4LJOB 4B6WA 3KVFB 4IG7B 3VAWA 2DAJA 3ML4A 4RM9A 2ZNVB 4WSFA 3AJ4A 3ULCA 2C60A 3IBEA 2Y8FA 5CHFA 4NSWA 1VD2A 4G50A 3EHVA 3D8EA 2FCMA 2R2QA 2ZPNA 4N9F4 2KTFA 4HAWB 2L05A 1M7EA 3MHSD 2L0TA 1OEYA 2CU1A 4KSLC 1RAXA 2MA9B 2UWQA 5KHOA 4IFSA 5TR5A 3HK0A 1UNPA 1WZ0A 3LDZE 2KMCA 3SDLC 3V61A 5HE0A 2K6QA 4GU2A 2JZZA 4WWOA 2N7EA 2M8SA 2ZPYA 2CRFA 3N32A 5HKHA 1WXVA 1I7AA 5JZEB 5D27A 2YT0A 2D07B 4ANWA 2LGDA 2D9XA 2RSGA 2FCQA 2HD5B 2KDIA 2LULA 3QC8B 4ASWC 1FHWA 3DBHI 4FULA 1HE8A 2JUOA 4K7WA 1Y19B 3RUIB 1H8CA 2IO2B 4MSQB 2KGXB 4K1RB 1MKEA 5IA7A 3A4RA 1P3QU 2KDBA 3DBLI 4TV3A 1WGDA 3A8PA 1UGMA 1KLVA 1NDDA 3QQ8B 1WXMA 3EECA 2DHKA 1V49A 1UBIA 1P0RA 3SD5A 3VXWA 1EAZA 2JF5A 2VSZA 3VH3B 2GS0A 4PS7A 1MIZB 2RSUA 3VTVA 3NZSA 1ST7A 4BKGA 5C79A 5JP4A 2Z0QA 5AZHA 4KZ0A 4E3CA 1J0GA 5L95C 2KFKB 1W1GA 2EMTA 3ZDMC 2CODA 3L08A 2DKQA 1BTKA 3KZ1A 3HQCA 3ZNGC 4W9LA 3ULBA 3PLVA 2MBQA 3VTUA 5J3YA 3JW0X 2Y7BA 4KVGB 3KW5B 2L3ZA 2JPHA 4I6PA 2GBKA 2DX1A 3T9LA 3KYDD 5D6JB 2RLOA 3RYTA 4W9HA 2FUHB 2J0MA 2K00A 1XX0A 3CMMB 5L81A 1PLSA 4FJZA 1PFJA 3HHMA 2KFKA 2QKLA 2P0FA 4NY0A 2BYVE 1KZ7A 1UNQA 3DXCA 4BBNF 1G6JA 4ANXA 3JYUA 2MWSB 4CHMA 4LCDE 4DHJD 1W1DA 2DZJA 5C16A 4IWQA 1GC7A 3OANA 3AULA 4K17A 2KWVB 4ZRIA 4AJWA 2P0HA 5DH9B 3PPAA 1WY8A 5DPWA 2DHIA 2DZMA 3RULA 1Y5OA 3DCGA 2KWCA 2DTCA 1XKEA 3G9WA 3UZTA 1EUVB 3WA0A 2ASQA 4ZYNA 4G11A 4YL8A 2KC2A 2W2XC 2VRWB 1X11A 3ML8A 1Q67A 1OGWA 3ALBA 2I5CA 4HWIB 2PPHA 1XR0B 4K81A 4X57B 2FAZA 5HE3A 2JRHA 2JWZA 1U5DA 3LJ3A 4ANUA 4HK2A 2KDEB 3VVWB 2UVMA 2K2UA 1P98A 2D9YA 1HB8A 3UIPB 3UGBB 1WX8A 4KV2A 4MDKE 2LVQA 1LB1A 2BWFA 1AQCA 2L1CA 2MWNB 4BKSD 3FP5A 4GXBA 3V5WA 3RD2A 1Q1OA 4I6LB 1U29A 2MKRA 3IG3A 2Z0OA 3WAOA 3IVFA 3KRWA 2ABDA 3AU4A 3L13A 1UZXB 1B55A 3M62B 4II2B 1F9JA 3A9JA 2N4FA 5FI1A 1C3TA 5DIFB 2K2JA 2BGFA 2DHJA 2EMSA 1WIAA 2KANA 5EDSA 1RRBA 4IOYX 4MSMB 3CIKA 4II3B 4K7UA 1JRUA 3A9KB 4IWPA 3GOEA 2KJHB 4KDLB 1RJ2A 3F0WA 3PSEB 3ZRFA 2KUPA 4HPMB 1UD7A 4HB2B 2KQ7A 4BKTA 2JY6A 3ML9A 4WVFB 2IBIB 2DYQA 4NAWB 2NPTB 2BKFA 4HAYB 1X1GA 2K8HA 2ZVNA 3ODWA 1WGQA 1PMSA 2KTRB 2PJHA 5G2NA 3ZIMA 2BF8B 2E2XA 1WYWB 2O6VB 3ECIA 1U5EA 4E71A 1WJ4A 4AP4C 5LONB 2CHWA 1FXTB 2NCNA 1WJNA 2NR2A 1AARA 2R0DA 3AU5A 2LASA 2KX0A 4FADA 4AOFA 2IY1B 5D2MB 2DHZA 4NAWA 2NPTA 3O65B 5JHAA 4FHKA 4XX5A 2KJRA 1I2HA 2JXXA 2O6VA 3NHEB 3SNHA 3P6AA 2YVCA 3UINB 3PGEA 2ADZA 1E8XA 4KHOA 4W9IA 1EGXA 1TTNA 3BINA 3R7RA 4BOSC 2FJ9A 5DHFB 1R4MI 2JRIB 2BPSA 4DX90 2NS5A 3L10B 3PRMB 3DVGY 3ZDTA 2GCJA 4D0NB 4IUMB 3H7PA 1WGRA 4DDGD 2X18A 3B08A 1WFYA 3WYFB 2A5UA 2MBBB 1ISNA 4A3PA 3PRZA 3VTWA 1QQGA 2KJ6A 3NS8A 3UF8A 3U8ZA 4NPNA 2LXAA 1VCBA 3L0WB 2I1JA 5HE2A 1OQYA 3GZNI 1D3ZA 4DXAB 4HAUB 3ZTDA 1GC6A 2K8CA 2LD9A 1ACAA 4DX8A 2W2WA 1P9DU 4HDQA 4TKNA 2G35A 3QWMA 3B0AA 4GMXB 4FLHA 3H6NA 3D8FA 4W9CA 1XD4A 2P0DA 4KZCA 4WJQA 4HDOA 2AL6A 3AXCA 4NQLB 2DYNA 4XZ4A 4MEMA 2DENB 1V5UA 3I3TB 2DAFA 2LVPA 3IHPC 4MK0A 2N1WA 3H7SA 2HE7A 2OOBB 2GMIC 5D3XA 2UZRA 4HCNB 3PHXB 2V1YA 4NJ6A 2FNJB 2N0YA 2KD0A 4NJ7A 2MBEA 2RUKB 4A6HA 3PT2B 2VKIA 4WJNA 1X1MA 3TBLD 1DDWA 1YQBA 3P7ZA 5E6OA 2KLGA 2XEWA 2ZVOA 3VUWA 3OJ3A 2FCSA 4WJPA 4TQ0A 3A98B 4WJOA 1WGYA 1J0WA 2N9PC 1IYFA 3H1UA 4M8MA 1ZKHA 1K5DB 3DDCB 2V76A 2QHOA 1IP9A 3KUZA 4HCPB 2KO3A 3A1QB 1WE7A 3PG7A 2V4LA 3MJWA 4K7SA 4W9JA 2MDXA 5JLJB 2LJ5A 1QZEA 1WE6A 1K5GB 3UQBA 2OTXA 3ZNID 2MP2A 3P2BA 4B9KA 2K39A 2H7EA 4URKA 2D4QA 2DKPA 5FR6A 3AI5A 2J0KA 1FOEA 1FGZA 1QC6A 4KIKB 1TZ1A 1GG3A 2FCNA 2Z0PA 4PS3A 2N9XA 5DHAB 1Z2MA 4BFRA 1ZVRA 4GIVA 5AEKB 3NOBA 4C0AA 3A1QA 2RQ1A 2I1KA 3SHQA 4PNKA 2H7DA 2Y8GA 2NBUA 1MPHA 2DZIA 4EOYA 2ZNVC 3FEHA 3VH4B 3LJUX 2L7RA 4KIKA 1UNRA 3RZFA 3PTFC 2BCJA 1DBHA 2MBOA 2NMBA 4HB0B 2GBMA 2MCNB 4OVUA 3JVZX 3PVUA 2J59M 3OJ4B 2Z59B 5J3TA 1P6SA 2GBNA 1SHCA 4KHAA 5DPRA 2IFSA 3SU8X 1UPQA 2KQSA 4FN2A 2CKHB 4LJPB 1UEFA 1XCGA 4WJ7A 2KOXA 4KSKC 3PS6A 1OY2A 1XT9B 2R2OA 3ZVVA 2WX1A 3F5RA 1WXSA 5L83A 3TIXA 2IYDB 3PVWA 2K8BA 1TBEA 3VHTC 4RMAA 5EFXA 1EO6A 2W9NA 4CHJA 1UELA 4GOCA 3DVNV 3KUCB 3SV1A 3OAWA 3ZTCA 1H10A 4AUQC 4YONA 5C5BB 4J6IA 4B95A 1YX5B 3ZO5B 4BKSA 4F7UP 4FHJA 1V6EA 2MW5A 3PLUA 4ICVA 2KZRA 2LI5A 1WJ6A 4IM3A 1KJTA 3CXBB 5D3WA 2FDQA 2LVOA 4GMVA 4K2OA 1E8ZA 1XD3B 4I6NB 4W9DA 3ZVRA 1HBKA 3ZKJC 3EPYA 2BYEA 3R66C 3S2AA 4W9FA 1FAOA 3M63B 2WH5A 4DWFA 3T8MA 2COCA 4B6HA 3R3MA 1PQSA 1UBQA 3WAPA 1LW3A 4MH0E 5C5BA 3QAQA 2IZVB 3A9JB 3PREA 4HB3B 2GCLA 4F7GA 2EKEC 2HJ8A 4W9GA 1E8WA 3DOWA 5AZGA 2JZ3B 2ROZB 2IO0B 4KDIC 1N3HA 2KCJA 3TMPB 1OTRB 2Z0DB 4MM3A 4WWPA 1A5RA 2KWUB 4H8SA 3WALA 2NBWB 1WJ1A 4DDID 1DDVA 3QA8A 5KCVA 5KHQA 1ZGUB 4BBNC 4DHZB 2MSED 2RNRB 4A20A 1FHXA 1V61A 5C6RA 1WX7A 4KHBB 2RPQA 2MBHA 2FIFA 1MIXA 1Z5SB 5IAAC 4E74A 4FA6A 2COAA 4FBJB 4MELA 2AEHA 3ZW3A 1U2BA 1TXDA 1WR6E 3QWZB 3FLVA 2NZ8B 2IY0B 1V88A 4GSWA 2DA0A 2G3QB 4ZRKA 4GDKA 1WJUA 3NY5A 2FJLA 1I42A 2G4DB 1DYNA 4HLEA 3EC8A 3GYPA 2ELAA 3WANA 3RCZA 1ZSQA 4JLCA 3QJZA 3TVVA 1DDMA 5CHVC 2I5FA 4A6FB 5JHGA 3A4SC 3APCA 1S3SG 1Y8RC 4FJYA 1V5PA 3DPDA 1LM8B 4G3XB 2KNBA 4G0NB 2COFA 5C1ZA 3L17A 1V89A 3ODOA 2RD0A 1ZC4B 2YRYA 2D10A 5CLQB 2KDFB 4GDLA 2CAYA 2OQBA 2ZJDA 3ODXA 5JHHA 4WWNA 4Z2NA 1J8CA 3H7PB 1TJ6A 1E7UA 4XC2A 1WX9A 1NBFC 2CY4A 4TQ1A 3T06A 1WI1A 4IC7B 4GGQA 3B1LX 4A6FA 1W1HA 1FB8A 5LXIB 3RCPA 3UQAA 2CQUA 4IM0A 2LYDA 3DVNU 4M0WB 4EJNA 4EFOA 1X05A 2LWPA 4JIOU 3WAMA 2C7HA 3N3KB 2OJRA 1YJ1A 4MGKE 5J2RA 1MAIA 2GOWA 4MJSA 4EUTA 1FHOA 3QHTA 1R4NI 2XBBC 2LRUA 3TO1A 3SYXA 1U4AA 2ELBA 1LQBA 4IWOA 3DQVA 2ZCCA 4K2PA 2M4NA 2KK8A 4WQOB 2KVRA 4OVVA 2CHZA 3BY4B 2JT4B 2AYOB 2D3GA 2HTHA 5D7GA 5DPSA 2CB8A 1NU2A 4EMOA 5KQ1A 2NVUI 4IAPA 3DBSA
chains in the Genus database with same CATH superfamily
3PZDA 2KACA 4EZLA 1RRPB 1QF6A 2OEDA 4JKAA 3PVLA 2YS1A 1WG7A 2JSVX 5LXHA 1C4CA 5GXGB 5CLLB 1I4RA 2MRPA 4HXDA 1WRIA 3SUZA 3TCAA 3NJTA 2KN5A 3L16A 4ZHOA 2EC1A 1FNUA 1XODA 4IW0A 2BYFA 1X1FA 1VZ7A 3PEGA 3Q8EA 3VQIA 1YNTE 3R7QA 1X86A 1WWTA 2M17A 1TZOA 3TJPA 2DFKA 2GLSA 2J4XA 1FMAD 1GJZA 3PHWB 2D11A 2DYOA 5FK9C 2AL3A 4C4VA 3SBGA 2MP2B 1E10A 1P1AA 2IGGA 4WH4A 1EF5A 2KXJA 3MDBC 2LGSA 2M38A 2YS5A 5J17A 2LBBA 4ZHPA 4BBKA 5D3VA 3OG5A 1VJKA 5I2SA 4JKBA 2ZCBA 2J0JA 1Z87A 2A4ZA 3R2TA 3W5VB 1JCKB 2V4IB 1CMXB 2XK5B 2L76A 4C7YA 3EFUA 3M1IB 1QQRA 1P3RA 1FXAA 2QIEB 2REXA 3N9YC 4F7ZA 3TW1A 2BKRB 1U27A 1NVID 1WM3A 2PE9A 3ZUNA 4DHJB 1LXDA 4NZLB 2KMAA 1WI0A 3SBTA 3PRPB 4RF0A 3K9PB 1KI1B 2WX0A 2RDHA 1NTIA 3GYOA 1KF6B 5J3QA 1TQZA 3RNBC 2WWZA 5IP4D 1N5XA 1OQNA 4EZKA 4HHVA 2WXQA 2V3NA 3KRXA 2LJIA 2MJ3A 1TT5B 3NS1A 5M4YB 1ZW7A 5EE9A 3RT3B 2M56B 3BWUD 2N23A 1CZPA 3KY9A 1KM7A 3EFCA 4HROA 2ZZPB 1WSPA 1WGHA 5CX3A 2UU7A 1JWMD 4L23A 2X8XX 4PT5A 2D3CA 3ONSA 4GPTB 4HVBA 4F8CB 4PS8A 2DIKA 2ON8A 1V1OA 1TS2A 4LDTD 2DX5B 4QAYA 3AE8B 2XK5A 1E9MA 3VDZA 3IFWB 1L7YA 2WDTB 3CSTA 1C78A 1C4AA 2EELA 2HDEA 1T0SC 4OSNA 1WF9A 2YEPF 2YT1A 1V5TA 2D3AA 3HM6X 4MGYE 1C1YB 3V6EB 1AN8A 2LHEA 4BZAA 4L6EA 2L2IA 1GUAB 2Z0EB 1SJED 2VZKD 3KH0A 2WP9B 4MY6A 4DBBA 3V6CB 3NVVA 3RI7C 3P63A 4Z2MB 1Q5WB 2GBRA 5GMVA 1BTNA 5IO9A 3BVGA 3PV1A 2G45B 4KKJA 4B0MA 2L8JA 3GB1A 1HA5A 5HE1A 5KQ4A 3TUOA 3QARA 3M3JA 2KKCA 3V60A 2DYBA 2WU2B 5JH5C 5LOPB 2RVBB 2RDGA 3DXDA 1RLFA 2DX5A 3AE7B 2QKMA 1WJMA 2WXPA 1D6EC 3RZWC 1S1QB 3SFDB 2X38A 2LOXA 2YSZA 2D2QA 1H4RA 4XWXA 3NWFA 4MACA 5AUKA 4NNJB 3VRAB 4HRSA 2C7NB 1BMLC 1EVHA 2DZKA 3APFA 5G5GA 5DPTA 4CHKA 1B9RA 2J7QB 5FI0A 2LRWA 1R4NB 2D5GA 2XQNM 1YIWA 5CHWA 1V1PA 3HM3A 2WU5B 1V80A 2M0XA 3NZUA 4HKQA 2K6DB 4ZDVA 4EZJA 3TL5A 2XN9C 4OVZA 1SB3C 4BOZB 1RFAA 2LG1A 1MK7B 4HJKA 2COPA 3PP2A 3QBVB 4PQ0A 2ZEQA 1HB6A 3AN1A 2H88B 1NVLA 3VIAA 1V8CA 2Z4DA 4TYZA 4KGTA 1V81A 1QOBA 2K8EA 2Y5BB 4FXCA 1M94A 1KOTA 3DVGX 1UPRA 1KZGA 3IAS1 1C9FA 1BWNA 3QCAA 5FR3A 1D5MC 2W2XD 2V9HA 2JX5A 3FSSA 1JW9D 2LXCA 5JHBA 3BVZA 3C0RB 5MPOA 5DCNA 2Q13A 3GE3C 3A33B 1N5WA 1SSNA 1WMHB 4MGZE 4JK9A 3VUYA 1TGZB 4ILJA 4HJGE 3ZJVA 3VRBB 3Q14C 1F2RI 2KHWB 4HAZB 3Q8BA 3KYCD 2N7DA 2M14A 1GGOA 2KN4A 1WR1A 2R61A 2Z8LA 4RNAA 2C7MB 4EKUA 2JP2A 1SEBD 4PYZA 2EKIA 4XYCA 1DOYA 3IT6B 5E6PA 5IOIA 2RGNB 5EE3A 3WIMA 1LO5D 1FM0D 4NQKE 2L0FA 2VRRB 4DHZE 3L54A 4NAMA 5E6NA 1V5MA 1JWSD 3QK0A 3KSYA 3BJIA 2WYQA 2YF0A 3RN9C 1F77A 4L1BA 3P1MA 1T77A 3X23A 5CTRC 1SGHA 3VR9B 1GNUA 4IOIE 4FJVB 4OHJA 4LNFA 1XQQA 4WWMA 4HAXB 3W1SA 2WXJA 1WMHA 3V62A 4KAXB 2LGYA 2B3AA 3BYTB 2DYMA 3O96A 2ROVA 4RH6A 4GN1A 1WXAA 1P5TA 5AZFA 1SE9A 2WXNA 2JVCA 2M1MA 3DXEA 1HTQA 4P7IA 2N9EB 1NI3A 1FCLA 4CQNA 1ZXHA 2YT2A 1WM2A 3FM8C 4Y94A 3VUXA 5J18A 1MG8A 1EWYC 2RGFA 2MX2A 1ZM0A 1ZC3B 1U5FA 3ZNZB 2N1VA 3HSAA 2W3SA 1QT9A 1HQRD 4GDKB 4EEWA 3ENEA 4IM2A 1V2YA 3ZLZA 3U12A 4HPLB 1IGCA 2IO1B 2YS3A 4W9KA 2JQRB 1NYRA 2KC1A 2L00B 3DBHB 2GBJA 3MTNB 4JE3B 2UZSA 2EJ8A 1C76A 2NBVB 3SR6A 4CO7A 1UH6A 4GB9A 4F7HA 5D94A 2R09A 4BVUC 4CYEA 1IRSA 2FBWB 1BAKA 1WVHA 2INNE 2PMVA 2DLBA 4H2AA 2BBCA 2P8VA 5C2TB 2J52A 3AEFB 4UDUC 4ARCA 2K9XA 3JSVB 4RGOS 5BMHA 2C5LC 3U2SC 2WLBA 3PZ8A 3APDA 1ENFA 2PE6B 1FGYA 3SO6A 2PEAA 1UF0A 1NENB 1NI2A 1V9JA 4M8NA 4ZRJA 2CHXA 1K50A 4MGIE 2HRJA 3N7CA 1K8RB 4GDLB 3D32A 3WCQA 3PSCA 4ICUA 2K22A 1FO4A 4W9EA 2LGXA 5LLIA 4JL9A 3MJ5A 5D3YA 2NBVA 1UWMA 2PZ1A 3MC0B 1YX6B 3Q3JA 4AWJA 5G55A 4HATB 1WYGA 4QJ5B 1XO3A 1WZ3A 4JKGA 2KFJA 3FC4A 3AV8A 2LUEA 2BQQA 1DROA 1EF1A 1WGGA 1E90A 1JWBD 2V3SA 5HI1A 1K52A 3JSVA 3FAHA 3W1SC 4AJYB 4GNKB 4MT7A 1QOGA 3W1YA 3PZ7A 4RM8A 1FCCC 4WQMA 1XLOA 4XDDA 3HIZA 1L2NA 3D8DA 5HG2A 2I38A 3KLSX 1ZP0B 1VBHA 1L6UA 2G4SA 2MFQA 2CS4A 3N30A 1YD8U 1OMWA 2RRFA 3U30A 1E8YA 1M7RA 2GJYA 2X0SA 3A9KA 1GPXA 3J9CA 1SF0A 2BT6A 1E5WA 5DI9B 2IJ0A 1FRRA 2LHDA 3KQ4A 3VFKA 4QJ4B 1ET9A 2LKOA 1SJHD 3NSUA 1SIFA 4KKIA 1WH3A 3Q3FA 4JQWC 2YLMA 2BWES 4DBGA 4ZYSA 1I4GA 2MLBA 2O2VB 4MJSB 3AH7A 3VOQA 3A8QA 1U5GA 3RMKC 4DK5A 3B2FA 2W55A 1V86A 3BVMA 1SXTA 2UYZB 4XWTA 2DLWA 2RR9A 3BK2A 4JKEA 4XDCA 3SEBA 1AWEA 2KWDA 3I57A 2D9ZA 2KTRA 2IYBA 5IJMA 2KLCA 4A3OA 5EE1A 4PYUA 3TEYA 4HB4B 1OEYJ 4DQOC 3QX1A 2IGDA 2CR5A 1NTYA 2FIDA 2D9VA 2HTHB 2G9HD 1WGUA 2DN6A 2QMTA 3UIOB 1AWDA 2HTME 3E9LA 1NTVA 2LOZA 4GZUA 3IT4B 3K9OB 1LGRA 4A6KA 1T0YA 3P4PB 4JGHB 3OLMD 4WAAA 2O2VA 1N63A 5C23A 3HW2B 3H9DA 3CSFA 4CSQA 3MPXA 4F1SA 5GOWB 1WRDB 2MJEA 3DBRI 1IPGA 2KX3A 3U7DA 4A5KA 1Q0WB 3ZRCA 1CK1A 4ANVA 3KWLA 1TKYA 2AWTA 4TUUA 1L6VA 2K25A 4A90A 3QIJA 2CY5A 5BO4B 3ZNHB 1M4VA 5I4DA 1BT0A 1XXGA 1LFDA 2LZ6A 4LNKA 5C3JB 5HFYA 3FKYA 1FD6A 4OZBA 3AEGB 1E7VA 1EU3A 1P7FA 4XE0A 3Q8CA 4L1RA 1ROEA 2D9WA 3Q8AA 2KAJA 1MK9B 3TFMA 1E0ZA 1V5OA 3X0WA 1MG4A 4LDTB 3LXFA 2O6VD 3KUDB 1MI0A 2IO3B 1GOZA 2K1FA 2ZKMX 1I35A 1ZOYB 1J19A 3M95A 3LB8C 4HAVB 2RPVA 2C9WB 3CF6E 2JZPA 2HJ1A 5IKCM 2MQJA 4WURA 1I4HA 4LJOB 4B6WA 4JKHA 3KVFB 4IG7B 4O1NA 4LLGM 1OFFA 3VAWA 1RYJA 1OQRA 2MHJA 2DAJA 1B1ZA 2IDYA 3ML4A 3NVWA 2MH7A 4RM9A 1TS4A 2SEBD 2ZNVB 2VZKB 4WSFA 3AJ4A 3ULCA 2C60A 3IBEA 2Y8FA 5CHFA 3FVCA 4DXFA 4NSWA 1VD2A 4G50A 3EHVA 3O13A 3D8EA 2FCMA 2R2QA 2ZPNA 3TEWA 4N9F4 3MFGA 2KTFA 4HAWB 4ILGB 1GAQB 2L05A 1M7EA 3NG0A 3MHSD 2L0TA 1OEYA 2CU1A 4KSLC 1RAXA 2MA9B 2UWQA 5KHOA 2K0PA 4IFSA 5TR5A 4JK8A 3HK0A 1UNPA 1K53A 2INCC 1L0YB 1WZ0A 3LDZE 1UGJA 2KMCA 3SDLC 4OT1A 3V61A 5HE0A 4PK1A 2K6QA 1ZPSA 4GU2A 3MP9A 2JZZA 5H92C 4TSSA 4WWOA 3AEDB 4N59A 2LGIA 2E6XA 2N7EA 2M8SA 2BS2B 2ZPYA 2CRFA 3N32A 1XCQL 5HKHA 1WXVA 1I7AA 3I63C 5JZEB 4AS1A 5D27A 2YT0A 2D07B 4ANWA 2LGDA 2D9XA 2RSGA 2FCQA 2HD5B 2KDIA 3AE2B 1EWCA 2LULA 3QC8B 4ASWC 2LUMA 1FHWA 1F2RC 3DBHI 2YEPB 4FULA 1HE8A 2JUOA 5E6JA 2PTLA 1PGXA 1L5PA 4K7WA 3RNGC 1Y19B 3RUIB 1H8CA 2IO2B 4MSQB 2KGXB 1ET6A 4K1RB 1MKEA 2L83A 5IA7A 3A4RA 1P3QU 2KDBA 3DBLI 4TV3A 1WGDA 3A8PA 2JYTA 1UGMA 1KLVA 5IRSA 1NDDA 3QQ8B 1I4PA 1F1HA 1T0RC 3AM9A 2BVCA 1WXMA 3EECA 2DHKA 1V49A 1SE4A 1UBIA 1P0RA 4US8A 1XLNA 2WXFA 3SD5A 3VXWA 3U7ZA 3KWVA 1EAZA 4EE2A 2JF5A 1V1PB 1E6EB 2VSZA 3VH3B 5BYQA 2GS0A 4PS7A 1MIZB 1MI1A 2RSUA 3VTVA 1KLUD 3NZSA 1ST7A 1UWXA 4BKGA 5C79A 5JP4A 2V3PA 2Z0QA 5AZHA 4KZ0A 4E3CA 1J0GA 2INPE 5L95C 2KFKB 1W1GA 2QDFA 2EMTA 3ZDMC 5HHDG 3CWIA 2CODA 4Q2JA 3L08A 2DKQA 1BTKA 1R7SA 3EA6A 4ITKA 2WXOA 3E9OA 3EUB2 3KZ1A 1JRPA 1NYQA 2KYWA 1I4QA 3HQCA 1ACCA 3ZNGC 4W9LA 3ULBA 3PLVA 1R4MB 2MBQA 1TY2A 3VTUA 5J3YA 3JW0X 2Y7BA 4KVGB 3KW5B 2L3ZA 2JPHA 4I6PA 4BAXA 3V05A 3DBRB 2GBKA 2DX1A 4B0EA 4LNIA 3T9LA 3KYDD 5D6JB 2M19A 3FILB 2RLOA 3RYTA 4W9HA 4LK0M 3B77A 5EE0A 2FUHB 2J0MA 2K00A 1XX0A 2Y3AA 3CMMB 5L81A 1PLSA 1HZ5A 1SIJA 1MHHE 2N0SB 3NZ3A 4FJZA 1PFJA 3HHMA 2KFKA 4NJCA 2QKLA 3BK1A 2P0FA 3BYYB 4NY0A 2BYVE 1KZ7A 1UNQA 3DXCA 3IXSA 4BBNF 1G6JA 4ANXA 3JYUA 2MWSB 4CHMA 2L32A 4LCDE 4DHJD 1W1DA 2DZJA 3B9JA 2G1EA 3DHHC 5C16A 4JKFA 4IWQA 1GC7A 3OANA 3AULA 4K17A 2KWVB 3UI3A 3N1YC 4ZRIA 4AJWA 1ZDVA 2P0HA 2GB1A 5DH9B 3PPAA 1WY8A 5DPWA 2DHIA 3FILA 2DZMA 3RULA 1Y5OA 1TIFA 3AE6B 3DCGA 1VDVA 3HUIA 2KWCA 2DTCA 1XKEA 1FRDA 2Z59A 1C77A 3V3XA 3G9WA 1YJJA 3UZTA 4HPPA 1NEKB 3VR8B 2WHIA 2BS4B 1EUVB 3WA0A 2ASQA 1N6ZA 4ZYNA 4G11A 4YL8A 2KC2A 2W2XC 1MVKA 2VRWB 1X11A 4WAFA 3ENBA 2SAKA 3ML8A 1Q67A 1OGWA 3AMZA 3ALBA 3W9CB 2I5CA 1JWAD 2PPHA 4HWIB 1XR0B 4K81A 4X57B 2FAZA 2QEJC 5HE3A 2JRHA 2JWZA 3T3NA 1U5DA 3LJ3A 4ANUA 4HK2A 2KDEB 3VVWB 2UVMA 2K2UA 4YWGG 1P98A 2D9YA 1HB8A 3UIPB 5D3IB 2VH1A 3UGBB 1WX8A 4KV2A 4MDKE 4M02A 4JKDA 1LB1A 2LVQA 3GE8C 2BWFA 1AQCA 2L1CA 2MWNB 2Z13A 4BKSD 3E9SA 1D4BA 3FP5A 4GXBA 3V5WA 3RD2A 1Q1OA 4I6LB 1U29A 2MKRA 3IG3A 2Z0OA 3WAOA 3IVFA 2PW9A 1HZ6A 3AE9B 4JKGB 3KRWA 3ZGZA 4REZA 2ABDA 1WGKA 2M0AA 1KTKA 2AQ1B 3AU4A 3L13A 1UZXB 3DBLB 1B55A 4L2YA 4A6QA 2Y5PA 3M62B 4II2B 1GB4A 1F9JA 1L4ZB 3A9JA 2N4FA 1DGJA 4DXGA 2ACZB 5FI1A 1C3TA 1TYGB 5DIFB 4A55A 1L0XB 2K2JA 1T5XD 2BGFA 4JPSA 2DHJA 2EMSA 3BIID 1WIAA 1KFYB 2KANA 1XF5L 4C80A 2KIEA 1RRBA 1VLBA 5EDSA 4IOYX 2WQYB 1KRHA 5IN7A 4MSMB 3CIKA 4II3B 1YJIA 4K7UA 3AE3B 1JRUA 3A9KB 4IWPA 4RGTA 2WXLA 3GOEA 2KJHB 4KDLB 2FE8A 3N1XC 4D2KA 1RJ2A 3F0WA 3P4RB 3PSEB 1ESFA 3ZRFA 2KUPA 4HPMB 1RM6C 1UD7A 4HB2B 2KQ7A 4BKTA 2JY6A 3RNFC 3ML9A 4WVFB 2IBIB 2DYQA 2WXMA 4JWSC 1IGDA 4NAWB 2NPTB 2BKFA 4HAYB 1X1GA 2DBYA 2GI9A 3DHGC 2K8HA 2ZVNA 3ODWA 1WGQA 1PMSA 2AQ2B 2KIGA 1J7BA 2KTRB 2PJHA 4ARIA 1GB1A 5G2NA 1KLGD 3ZIMA 1L4DB 2BF8B 2E2XA 1WYWB 2O6VB 2BB6A 3ECIA 1U5EA 4E71A 1WJ4A 2WXGA 4A8XC 4AP4C 2LMCA 2GUMA 5LONB 2CHWA 4KGSA 2K3UA 1FXTB 1C79A 2NCNA 1WJNA 2WGSA 2NR2A 1AARA 2R0DA 3T3OA 3AU5A 4IKGA 2LASA 2KX0A 4FADA 4AOFA 3MHZA 2IY1B 5D2MB 3P42A 2DHZA 5BYSA 1JDEA 4NAWA 2NPTA 3Q3NC 1JROA 2QSDA 3O65B 1UUPA 3SFEB 5JHAA 1KH0A 4FHKA 1YOVB 3AEAB 4XX5A 2KJRA 1I2HA 1J7AA 2PKOA 2JXXA 2O6VA 3NHEB 3SNHA 3P6AA 4RCOA 2YVCA 3UINB 4ILHA 2OHFA 1I4XA 3PGEA 3R8BA 2ADZA 3HVZA 4AQ7A 1E8XA 3AECB 4KHOA 3DCXA 4W9IA 1EGXA 1FPYA 1TKEA 1TTNA 3BINA 4P1BC 3R7RA 3I5JC 2MEKA 1YN3A 4BOSC 1EU4A 2FJ9A 3AEEB 5DHFB 1R4MI 3H8HA 5JVLA 1DYQA 2JRIB 2BPSA 2PVOD 4DX90 2NS5A 3L10B 3PRMB 3P4SB 3DVGY 1TY0A 1JQ4A 3ZDTA 2GCJA 4D0NB 4IUMB 3H7PA 1WGRA 4YSYB 2X18A 4DDGD 3B08A 2BYTA 1WFYA 1YN5A 3WYFB 2A5UA 2MBBB 1ISNA 4A3PA 3PRZA 3VTWA 3C19A 1QQGA 2KJ6A 3NS8A 1JALA 4C7ZA 3UF8A 4N6EB 3U8ZA 4NPNA 2LXAA 1IUEA 1VCBA 5BYRA 1IBXB 3L0WB 2I1JA 5HE2A 1OQYA 3GZNI 1D3ZA 4DXAB 2KQ4X 4HAUB 3ZTDA 1GC6A 4M01A 2K8CA 2LD9A 3P4QB 1ACAA 4A9AA 4DX8A 2W2WA 1P9DU 2L52A 4HDQA 4TKNA 2G35A 3QWMA 3B0AA 1FNVA 4GMXB 4FLHA 3H6NA 3D8FA 4W9CA 1XD4A 2P0DA 4KZCA 2W82A 4WJQA 4HDOA 2AL6A 1ZE3D 2WXKA 3AXCA 4NQLB 2DYNA 4XZ4A 4MEMA 2DENB 1V5UA 3I3TB 3ZJUA 2DAFA 1ZYIA 3ABVB 3L4PA 2LVPA 1AYFA 3IHPC 3TEZA 4KX6B 4MK0A 2N1WA 1PFDA 1Y56A 2HE7A 3H7SA 2IPKD 2OOBB 2GMIC 1IBXA 5D3XA 2UZRA 2J42A 3RPFC 2QC8A 3AB5A 4HCNB 3PHXB 2LFIA 2V1YA 4C00A 4NJ6A 2FNJB 3W2DA 2N0YA 2KD0A 4NJ7A 2PIAA 2MBEA 2R82A 2AQ3B 2RUKB 2Z14A 1VR9A 2QCZA 3Q8FA 4A6HA 3PT2B 1RWSA 2VKIA 1RFKA 4WJNA 2JYEA 1MJDA 2CJOA 1X1MA 3TBLD 4S0RA 2E3TA 4JX1C 1DDWA 1YQBA 3P7ZA 5E6OA 2KLGA 1J7CA 2XEWA 1K51A 2ZVOA 3VUWA 3OJ3A 2FCSA 4R3DA 4WJPA 4TQ0A 3A98B 4WJOA 3ZXRA 1WGYA 1J0WA 2N9PC 1IYFA 1T6BX 3H1UA 4M8MA 1ZKHA 1K5DB 1XEEA 3DDCB 2V76A 2QHOA 1IP9A 3KUZA 4HCPB 1T0QC 2KO3A 3A1QB 1WE7A 3PG7A 2V4LA 4US9A 3MJWA 4K7SA 4W9JA 2MDXA 5JLJB 3B2GA 3U52E 2LJ5A 1QZEA 2DNFA 1WE6A 2KDMA 1K5GB 2WXHA 3UQBA 2OTXA 2RDBC 3ZNID 2MP2A 3P2BA 4B9KA 2K39A 2H7EA 4URKA 2D4QA 2DKPA 3A58A 5FR6A 3AI5A 2J0KA 1F0ZA 1FOEA 1FGZA 1QC6A 3NW8A 4KIKB 2VH2A 1CQVA 1TZ1A 4KGRA 1EM7A 2CJNA 1GG3A 2FCNA 2Z0PA 1VZ8A 3URYA 4PS3A 2N9XA 1SE2A 5DHAB 4ZRPA 1Z2MA 4BFRA 1ZVRA 4LNNA 5LG4B 4GIVA 2FJUB 5AEKB 4C0AA 3NOBA 1ZXIA 3A1QA 4J3OD 3ZQ4A 2RQ1A 2KMMA 2I1KA 2ZW0A 2BS3B 3SHQA 2OJWA 4PNKA 3RFZB 2H7DA 2Y8GA 4XGAB 2NBUA 4WIPA 4QJ3B 1MPHA 2DZIA 4EOYA 4LNOA 3ZJTA 4YSXB 1N60A 3E9PA 3C8YA 2N9LA 2ONQA 3HVDA 2ZNVC 4OZCA 3FEHA 3VH4B 3LJUX 2L7RA 4KIKA 1UNRA 2JU6X 4K3CA 5AUIA 3RZFA 3PTFC 2BCJA 1DBHA 2MBOA 2NMBA 3HIEA 4HB0B 2GBMA 1VBGA 1L0VB 3N1ZC 1TS3A 2MCNB 2GRIA 2D3BA 4OVUA 3JVZX 3ZXVA 4HKZE 3PVUA 2FUG1 2KR0A 1QOFA 2J59M 3OJ4B 2Z59B 5J3TA 1P6SA 1FFVA 1DOXA 2GBNA 5H8YE 1SHCA 4KHAA 3RNCC 5DPRA 4YXDB 1KC7A 2IFSA 1STEA 3SU8X 2XNAC 2WDVB 1A70A 1UPQA 2KQSA 4FN2A 4P1CC 2CKHB 2H89B 1MHXA 2IGHA 4LJPB 1UEFA 1XCGA 2BW2A 3GZNB 4WJ7A 2KOXA 4GOUA 4KSKC 3PS6A 1OY2A 1XT9B 2R2OA 1E7PB 2WX1A 3F5RA 1WXSA 3Q6BA 3ZVVA 3TIXA 2IYDB 5L83A 5FKAC 4YSZB 3PVWA 2K8BA 1TBEA 3VHTC 1WXQA 4RMAA 5EFXA 4RGNA 1EO6A 2B76B 2W9NA 3ZYYX 1KBLA 4CHJA 4ZRQA 1UELA 1MPEA 3CIRB 3DVNV 4GOCA 3KUCB 3DHIC 3SV1A 3OAWA 3ZTCA 1H10A 2W3RA 4AUQC 4YONA 5C5BB 4J6IA 3HRDD 1YX5B 3ZO5B 4B95A 1PGAA 4BKSA 1MFWA 3NVYA 4F7UP 4FHJA 1V6EA 1JMLA 2MW5A 3PLUA 4ICVA 2W54A 2KZRA 1FXIA 1BUIC 2LI5A 1WJ6A 4IM3A 1KJTA 3CXBB 3R2IA 5D3WA 1C4PA 2FDQA 2LVOA 2V0GA 4GMVA 4K2OA 1N62A 1E8ZA 1XD3B 4I6NB 4W9DA 2WXIA 3ZVRA 4MM3B 1HBKA 3ZKJC 3EPYA 4QXAB 1XCTL 3TSSA 4DIXA 2ICIA 4GLSC 1T3QA 2BYEA 3R66C 1HXYD 3Q2AC 3S2AA 4W9FA 2KUQA 3RNAC 1FAOA 3M63B 2I2YA 2WH5A 4DWFA 1XLPA 3T8MA 2COCA 4B6HA 3R3MA 1PQSA 1UBQA 3WAPA 1LW3A 4IDIA 2Q5WD 4MH0E 2WDRB 5C5BA 4D6WA 3QAQA 2IZVB 1QOAA 3A9JB 1PUTA 3PREA 3NUHB 4HB3B 2GCLA 4YTNB 4F7GA 2EKEC 1AW7A 2HJ8A 4W9GA 2INDC 1E8WA 3DOWA 5AZGA 2JZ3B 2ROZB 2IO0B 4KDIC 1N3HA 2KCJA 3TMPB 1OTRB 2Z0DB 4YTMB 4MM3A 2KT7A 4WWPA 1A5RA 2KWUB 1XLQA 4LTUA 4H8SA 3WALA 4C56C 1FNWA 2NBWB 1WJ1A 4DDID 3ETRA 1DDVA 3QA8A 5TSSA 5I2MA 5KCVA 1PGBA 5KHQA 3Q3MC 1ZGUB 4BBNC 1TS5A 3GP7A 4DHZB 3E56A 2BTEA 2MSED 1QILA 3AE4B 2RNRB 4A20A 1FHXA 1V61A 2NMQA 5C6RA 2DWQA 1WX7A 4KHBB 4OW0A 1FFUA 1FEHA 2RPQA 2LEKA 1YMHE 2MBHA 2WS3B 3MC8A 3EGRA 1HEZE 2FIFA 1MIXA 1YN4A 1Z5SB 5IAAC 2WXRA 3IAM1 4E74A 2COAA 4FA6A 4FBJB 4MELA 4RF1A 4MT5A 5T8IA 2AEHA 3ZW3A 1U2BA 5D3DA 2TSSA 4M00A 2NTSA 1TXDA 1WR6E 3QWZB 4YT0B 2ZW1A 3FLVA 2NZ8B 2IY0B 1FIQA 1V88A 3GS2A 4GSWA 2DA0A 5JXVA 3I9V1 1N61A 2G3QB 4RFBA 4USAA 2NTTA 4ZRKA 4GDKA 2QILA 1WJUA 1BXTA 3NY5A 2FJLA 2WNMA 1I42A 1TJEA 2G4DB 1DYNA 4HLEA 3AEBB 3EC8A 1D5ZC 1HTOA 3GYPA 1QLBB 4YTPB 2ELAA 3WANA 3AE1B 3RCZA 4KHBA 1ZSQA 4JLCA 3QJZA 3TVVA 1DDMA 1ZDXA 3NVZA 5CHVC 2I5FA 4A6FB 5JHGA 3A4SC 1I7HA 3APCA 4MH8A 1S3SG 3DWGC 1Y8RC 3NRZA 4FJYA 2MJDA 1V5PA 1CJEA 3DPDA 1LM8B 4G3XB 1ZUD2 3OWEB 4N58A 2KNBA 3NWDA 1PYWD 4G0NB 2CU3A 2COFA 5C1ZA 3L17A 1V89A 1UNSA 1PDXA 5BMIA 3W5UB 3ODOA 2N9KA 1YQ4B 2RD0A 2QJLA 3E66A 1ZC4B 2YRYA 2D10A 5CLQB 2KDFB 4GDLA 2K5PA 4JK7A 2CAYA 2OQBA 2ZJDA 3ODXA 3N20C 3AE5B 3DWMA 5JHHA 3PO0A 4WWNA 2PVGC 5LNK1 4XWWA 3Q3OC 4Z2NA 1J8CA 3NWAA 3H7PB 1D5XC 1TJ6A 1E7UA 4XC2A 2J53A 1VZ6A 1WX9A 1NBFC 3U4EG 2CY4A 4TQ1A 3T06A 1WI1A 4IC7B 4GGQA 3B1LX 4A6FA 1W1HA 1OQQA 1FB8A 1DOIA 5LXIB 3RCPA 3TEXA 3UQAA 3MC9A 2CQUA 1VRAB 4IM0A 2LYDA 3DVNU 2AX5A 4M0WB 1QKZA 4EJNA 2L1AA 4OZAA 4EFOA 1Q10A 1X05A 2R2YA 2LWPA 4JIOU 3WAMA 2C7HA 2N7JA 3N3KB 5G5HA 2K49A 2BB5A 2OJRA 4JWUC 1YJ1A 1SBBB 4MGKE 1YQ3B 5J2RA 1MAIA 2GOWA 1DIKA 2RMMA 4MJSA 1F52A 3BZDB 4EUTA 1FHOA 2JWUA 3QHTA 1R4NI 2XBBC 4ZOHC 2LRUA 3TO1A 2KVZA 3Q69A 3SYXA 1JWUD 1U4AA 5BMGA 1SE3A 2ELBA 3RNEC 1LQBA 4P6VF 2JXTA 2PLPA 4RGMA 4ACFA 4IWOA 3DQVA 4M0WA 2Y5CA 1TKGA 2ZCCA 1V97A 1P7EA 4K2PA 2M4NA 2KK8A 4WQOB 2WDQB 2KVRA 4JKCA 4OVVA 2CHZA 4K3BA 3BY4B 2JT4B 4P16A 2AYOB 2D3GA 2HTHA 5D7GA 4C4VB 4HEA1 5DPSA 2CB8A 1NU2A 4HSIA 3LYYA 4EMOA 4TMAB 5KQ1A 3OHMB 4IAPA 2NVUI 3DBSA 4S17A
chains in the Genus database with same CATH topology
3PZDA 4EZLA 1RRPB 4JKAA 3PVLA 2YS1A 1WG7A 5LXHA 5CLLB 2MRPA 4HXDA 3SUZA 3TCAA 2KN5A 3L16A 2EC1A 1XODA 4IW0A 2BYFA 1X1FA 3PEGA 3VQIA 3R7QA 1X86A 2M17A 3TJPA 2DFKA 1GJZA 3PHWB 2D11A 2DYOA 2AL3A 3SBGA 2MP2B 1P1AA 1EF5A 2KXJA 3MDBC 2M38A 2YS5A 5J17A 2LBBA 4BBKA 5D3VA 4JKBA 2ZCBA 2J0JA 1Z87A 2A4ZA 1CMXB 2XK5B 2L76A 3EFUA 3M1IB 1P3RA 2REXA 4F7ZA 3TW1A 2BKRB 1U27A 1WM3A 2PE9A 3ZUNA 4DHJB 1LXDA 2KMAA 1WI0A 3SBTA 3PRPB 3K9PB 1KI1B 2WX0A 1NTIA 3GYOA 5J3QA 1TQZA 2WWZA 1OQNA 4EZKA 4HHVA 3KRXA 1ZW7A 3RT3B 2N23A 3KY9A 1KM7A 5CX3A 2ZZPB 1WGHA 3ONSA 4GPTB 4HVBA 4F8CB 4PS8A 2DIKA 4LDTD 2DX5B 2XK5A 3VDZA 3IFWB 1L7YA 2WDTB 3CSTA 1WF9A 2YT1A 1V5TA 4MGYE 3HM6X 1C1YB 3V6EB 4L6EA 2L2IA 1GUAB 2Z0EB 3KH0A 4MY6A 4DBBA 3V6CB 4Z2MB 1Q5WB 2GBRA 5GMVA 1BTNA 3PV1A 2G45B 2L8JA 5HE1A 5KQ4A 3QARA 3M3JA 2KKCA 3V60A 2DYBA 5JH5C 5LOPB 2RVBB 3DXDA 1RLFA 2DX5A 2QKMA 1WJMA 3RZWC 1S1QB 2LOXA 2YSZA 2D2QA 1H4RA 4XWXA 4NNJB 2C7NB 1EVHA 2DZKA 3APFA 4CHKA 5DPTA 2J7QB 5FI0A 2LRWA 2XQNM 1YIWA 5CHWA 3HM3A 1V80A 2M0XA 3NZUA 2K6DB 4ZDVA 4EZJA 3TL5A 4BOZB 1RFAA 2LG1A 1MK7B 4HJKA 2COPA 3PP2A 3QBVB 4PQ0A 2ZEQA 1HB6A 1NVLA 3VIAA 4TYZA 1V81A 2Y5BB 1M94A 1KOTA 3DVGX 1UPRA 1KZGA 1BWNA 3QCAA 2W2XD 3FSSA 2LXCA 5JHBA 3C0RB 5DCNA 2Q13A 3A33B 1WMHB 4MGZE 4JK9A 3VUYA 1TGZB 4ILJA 2KHWB 4HAZB 3KYCD 2N7DA 2M14A 1GGOA 1WR1A 2C7MB 4EKUA 2JP2A 4PYZA 5E6PA 2RGNB 3WIMA 4NQKE 2L0FA 2VRRB 4DHZE 3L54A 5E6NA 1V5MA 3QK0A 3KSYA 3BJIA 2WYQA 2YF0A 3X23A 5CTRC 1SGHA 1GNUA 4FJVB 1XQQA 4HAXB 3W1SA 1WMHA 3V62A 4KAXB 2LGYA 2B3AA 2DYMA 3O96A 2ROVA 4GN1A 1WXAA 1P5TA 5AZFA 1SE9A 2JVCA 2M1MA 3DXEA 4P7IA 2N9EB 1WM2A 3FM8C 4Y94A 3VUXA 5J18A 1MG8A 2RGFA 2MX2A 1ZM0A 1ZC3B 1U5FA 3ZNZB 2N1VA 4GDKB 4EEWA 3ENEA 4IM2A 1V2YA 3ZLZA 4HPLB 2IO1B 2YS3A 4W9KA 2KC1A 2L00B 3MTNB 2GBJA 2UZSA 2EJ8A 2NBVB 4CO7A 1UH6A 4GB9A 4F7HA 5D94A 2R09A 4BVUC 4CYEA 1IRSA 1BAKA 1WVHA 2P8VA 3JSVB 2C5LC 3APDA 2PE6B 1FGYA 3SO6A 2PEAA 1NI2A 1V9JA 4M8NA 4ZRJA 2CHXA 4MGIE 2HRJA 3N7CA 1K8RB 4GDLB 3D32A 3PSCA 4ICUA 4W9EA 2LGXA 5LLIA 4JL9A 5D3YA 2PZ1A 1YX6B 3Q3JA 4AWJA 5G55A 4HATB 1WZ3A 4JKGA 2KFJA 2LUEA 1DROA 1EF1A 1WGGA 1E90A 2V3SA 3JSVA 3W1SC 4AJYB 4MT7A 3W1YA 4RM8A 3HIZA 1L2NA 3D8DA 1VBHA 2G4SA 2MFQA 2CS4A 3N30A 1YD8U 1OMWA 3U30A 1E8YA 1M7RA 2GJYA 2X0SA 3A9KA 1E5WA 5DI9B 3VFKA 2LKOA 3NSUA 1SIFA 1WH3A 3Q3FA 4JQWC 2YLMA 2BWES 4DBGA 2MLBA 2O2VB 4MJSB 3VOQA 3A8QA 1U5GA 4DK5A 1V86A 2UYZB 2DLWA 2RR9A 4JKEA 1AWEA 2D9ZA 2KTRA 2IYBA 5IJMA 2KLCA 4A3OA 4PYUA 4HB4B 1OEYJ 3QX1A 2CR5A 1NTYA 2FIDA 2D9VA 2HTHB 1WGUA 2DN6A 3UIOB 3E9LA 1NTVA 2LOZA 4GZUA 3K9OB 4A6KA 1T0YA 4JGHB 3OLMD 4WAAA 2O2VA 5C23A 3HW2B 3H9DA 3CSFA 4F1SA 3MPXA 5GOWB 1WRDB 3DBRI 1IPGA 2KX3A 3U7DA 4A5KA 1Q0WB 3ZRCA 4ANVA 2AWTA 4TUUA 2K25A 3QIJA 2CY5A 5BO4B 3ZNHB 1BT0A 1LFDA 2LZ6A 1E7VA 2D9WA 1MK9B 3TFMA 1V5OA 3X0WA 4LDTB 2O6VD 3KUDB 2IO3B 2K1FA 1I35A 1J19A 3M95A 4HAVB 2C9WB 3CF6E 2MQJA 4LJOB 4B6WA 4JKHA 3KVFB 4IG7B 3VAWA 2DAJA 3ML4A 4RM9A 2ZNVB 4WSFA 3AJ4A 3ULCA 2C60A 3IBEA 2Y8FA 5CHFA 4NSWA 1VD2A 4G50A 3EHVA 3D8EA 2FCMA 2R2QA 2ZPNA 4N9F4 2KTFA 4HAWB 4ILGB 2L05A 1M7EA 3MHSD 2L0TA 1OEYA 2CU1A 4KSLC 1RAXA 2MA9B 2UWQA 5KHOA 4IFSA 5TR5A 4JK8A 3HK0A 1UNPA 1WZ0A 3LDZE 2KMCA 3SDLC 3V61A 5HE0A 2K6QA 4GU2A 2JZZA 4WWOA 2N7EA 2M8SA 2ZPYA 2CRFA 3N32A 5HKHA 1WXVA 1I7AA 5JZEB 5D27A 2YT0A 2D07B 4ANWA 2LGDA 2D9XA 2RSGA 2FCQA 2HD5B 2KDIA 2LULA 3QC8B 4ASWC 1FHWA 3DBHI 4FULA 1HE8A 2JUOA 4K7WA 1Y19B 3RUIB 1H8CA 2IO2B 4MSQB 2KGXB 4K1RB 1MKEA 5IA7A 3A4RA 1P3QU 2KDBA 3DBLI 4TV3A 1WGDA 3A8PA 1UGMA 1KLVA 1NDDA 3QQ8B 1WXMA 3EECA 2DHKA 1V49A 1UBIA 1P0RA 3SD5A 3VXWA 1EAZA 2JF5A 2VSZA 3VH3B 2GS0A 4PS7A 1MIZB 2RSUA 3VTVA 3NZSA 1ST7A 4BKGA 5C79A 5JP4A 2Z0QA 5AZHA 4KZ0A 4E3CA 1J0GA 5L95C 2KFKB 1W1GA 2EMTA 3ZDMC 2CODA 3L08A 2DKQA 1BTKA 3E9OA 3KZ1A 3HQCA 3ZNGC 4W9LA 3ULBA 3PLVA 2MBQA 3VTUA 5J3YA 3JW0X 2Y7BA 4KVGB 3KW5B 2L3ZA 2JPHA 4I6PA 2GBKA 2DX1A 3T9LA 3KYDD 5D6JB 2RLOA 3RYTA 4W9HA 2FUHB 2J0MA 2K00A 1XX0A 3CMMB 5L81A 1PLSA 4FJZA 1PFJA 3HHMA 2KFKA 2QKLA 2P0FA 4NY0A 2BYVE 1KZ7A 1UNQA 3DXCA 4BBNF 1G6JA 4ANXA 3JYUA 2MWSB 4CHMA 4LCDE 4DHJD 1W1DA 2DZJA 5C16A 4JKFA 4IWQA 1GC7A 3OANA 3AULA 4K17A 2KWVB 4ZRIA 4AJWA 2P0HA 5DH9B 3PPAA 1WY8A 5DPWA 2DHIA 2DZMA 3RULA 1Y5OA 3DCGA 2KWCA 2DTCA 1XKEA 3G9WA 3UZTA 1EUVB 3WA0A 2ASQA 4ZYNA 4G11A 4YL8A 2KC2A 2W2XC 2VRWB 1X11A 3ENBA 3ML8A 1Q67A 1OGWA 3ALBA 2I5CA 4HWIB 2PPHA 1XR0B 4K81A 4X57B 2FAZA 5HE3A 2JRHA 2JWZA 1U5DA 3LJ3A 4ANUA 4HK2A 2KDEB 3VVWB 2UVMA 2K2UA 1P98A 2D9YA 1HB8A 3UIPB 3UGBB 1WX8A 4KV2A 4MDKE 4JKDA 1LB1A 2LVQA 2BWFA 1AQCA 2L1CA 2MWNB 4BKSD 3FP5A 4GXBA 3V5WA 3RD2A 1Q1OA 4I6LB 1U29A 2MKRA 3IG3A 2Z0OA 3WAOA 3IVFA 4JKGB 3KRWA 2ABDA 3AU4A 3L13A 1UZXB 1B55A 3M62B 4II2B 1F9JA 3A9JA 2N4FA 5FI1A 1C3TA 5DIFB 2K2JA 2BGFA 2DHJA 2EMSA 1WIAA 2KANA 5EDSA 1RRBA 4IOYX 4MSMB 3CIKA 4II3B 4K7UA 1JRUA 3A9KB 4IWPA 3GOEA 2KJHB 4KDLB 1RJ2A 3F0WA 3PSEB 3ZRFA 2KUPA 4HPMB 1UD7A 4HB2B 2KQ7A 4BKTA 2JY6A 3ML9A 4WVFB 2IBIB 2DYQA 4NAWB 2NPTB 2BKFA 4HAYB 1X1GA 2K8HA 2ZVNA 3ODWA 1WGQA 1PMSA 2KTRB 2PJHA 5G2NA 3ZIMA 2BF8B 2E2XA 1WYWB 2O6VB 3ECIA 1U5EA 4E71A 1WJ4A 4AP4C 5LONB 2CHWA 1FXTB 2NCNA 1WJNA 2NR2A 1AARA 2R0DA 3AU5A 2LASA 2KX0A 4FADA 4AOFA 2IY1B 5D2MB 2DHZA 1JDEA 4NAWA 2NPTA 3O65B 5JHAA 4FHKA 4XX5A 2KJRA 1I2HA 2JXXA 2O6VA 3NHEB 3SNHA 3P6AA 2YVCA 3UINB 4ILHA 3PGEA 2ADZA 1E8XA 4KHOA 4W9IA 1EGXA 1TTNA 3BINA 3R7RA 4BOSC 2FJ9A 5DHFB 1R4MI 5JVLA 2JRIB 2BPSA 4DX90 2NS5A 3L10B 3PRMB 3DVGY 3ZDTA 2GCJA 4D0NB 4IUMB 3H7PA 1WGRA 4DDGD 2X18A 3B08A 1WFYA 3WYFB 2A5UA 2MBBB 1ISNA 4A3PA 3PRZA 3VTWA 1QQGA 2KJ6A 3NS8A 3UF8A 3U8ZA 4NPNA 2LXAA 1VCBA 3L0WB 2I1JA 5HE2A 1OQYA 3GZNI 1D3ZA 4DXAB 4HAUB 3ZTDA 1GC6A 2K8CA 2LD9A 1ACAA 4DX8A 2W2WA 1P9DU 4HDQA 4TKNA 2G35A 3QWMA 3B0AA 4GMXB 4FLHA 3H6NA 3D8FA 4W9CA 1XD4A 2P0DA 4KZCA 4WJQA 4HDOA 2AL6A 3AXCA 4NQLB 2DYNA 4XZ4A 4MEMA 2DENB 1V5UA 3I3TB 2DAFA 2LVPA 3IHPC 4MK0A 2N1WA 3H7SA 2HE7A 2OOBB 2GMIC 5D3XA 2UZRA 4HCNB 3PHXB 2V1YA 4NJ6A 2FNJB 2N0YA 2KD0A 4NJ7A 2MBEA 2R82A 2RUKB 4A6HA 3PT2B 2VKIA 4WJNA 1X1MA 3TBLD 1DDWA 1YQBA 3P7ZA 5E6OA 2KLGA 2XEWA 2ZVOA 3VUWA 3OJ3A 2FCSA 4WJPA 4TQ0A 3A98B 4WJOA 1WGYA 1J0WA 2N9PC 1IYFA 3H1UA 4M8MA 1ZKHA 1K5DB 3DDCB 2V76A 2QHOA 1IP9A 3KUZA 4HCPB 2KO3A 3A1QB 1WE7A 3PG7A 2V4LA 3MJWA 4K7SA 4W9JA 2MDXA 5JLJB 2LJ5A 1QZEA 1WE6A 1K5GB 3UQBA 2OTXA 3ZNID 2MP2A 3P2BA 4B9KA 2K39A 2H7EA 4URKA 2D4QA 2DKPA 5FR6A 3AI5A 2J0KA 1FOEA 1FGZA 1QC6A 4KIKB 1TZ1A 1GG3A 2FCNA 2Z0PA 4PS3A 2N9XA 5DHAB 1Z2MA 4BFRA 1ZVRA 4GIVA 5AEKB 3NOBA 4C0AA 3A1QA 2RQ1A 2I1KA 3SHQA 4PNKA 2H7DA 2Y8GA 2NBUA 1MPHA 2DZIA 4EOYA 3E9PA 2ZNVC 3FEHA 3VH4B 3LJUX 2L7RA 4KIKA 1UNRA 3RZFA 3PTFC 2BCJA 1DBHA 2MBOA 2NMBA 4HB0B 2GBMA 1VBGA 2MCNB 4OVUA 3JVZX 3PVUA 2J59M 3OJ4B 2Z59B 5J3TA 1P6SA 2GBNA 1SHCA 4KHAA 5DPRA 1KC7A 2IFSA 3SU8X 1UPQA 2KQSA 4FN2A 2CKHB 4LJPB 1UEFA 1XCGA 4WJ7A 2KOXA 4KSKC 3PS6A 1OY2A 1XT9B 2R2OA 3ZVVA 2WX1A 3F5RA 1WXSA 5L83A 3TIXA 2IYDB 3PVWA 2K8BA 1TBEA 3VHTC 4RMAA 5EFXA 1EO6A 2W9NA 1KBLA 4CHJA 1UELA 4GOCA 3DVNV 3KUCB 3SV1A 3OAWA 3ZTCA 1H10A 4AUQC 4YONA 5C5BB 4J6IA 4B95A 1YX5B 3ZO5B 4BKSA 4F7UP 4FHJA 1V6EA 2MW5A 3PLUA 4ICVA 2KZRA 2LI5A 1WJ6A 4IM3A 1KJTA 3CXBB 5D3WA 2FDQA 2LVOA 4GMVA 4K2OA 1E8ZA 1XD3B 4I6NB 4W9DA 3ZVRA 1HBKA 3ZKJC 3EPYA 2BYEA 3R66C 3S2AA 4W9FA 1FAOA 3M63B 2WH5A 4DWFA 3T8MA 2COCA 4B6HA 3R3MA 1PQSA 1UBQA 3WAPA 1LW3A 4MH0E 5C5BA 3QAQA 2IZVB 3A9JB 3PREA 4HB3B 2GCLA 4F7GA 2EKEC 2HJ8A 4W9GA 1E8WA 3DOWA 5AZGA 2JZ3B 2ROZB 2IO0B 4KDIC 1N3HA 2KCJA 3TMPB 1OTRB 2Z0DB 4MM3A 4WWPA 1A5RA 2KWUB 4H8SA 3WALA 2NBWB 1WJ1A 4DDID 1DDVA 3QA8A 5KCVA 5KHQA 1ZGUB 4BBNC 4DHZB 2MSED 2RNRB 4A20A 1FHXA 1V61A 5C6RA 1WX7A 4KHBB 2RPQA 2MBHA 2FIFA 1MIXA 1Z5SB 5IAAC 4E74A 4FA6A 2COAA 4FBJB 4MELA 2AEHA 3ZW3A 1U2BA 1TXDA 1WR6E 3QWZB 3FLVA 2NZ8B 2IY0B 1V88A 4GSWA 2DA0A 2G3QB 4ZRKA 4GDKA 1WJUA 3NY5A 2FJLA 1I42A 2G4DB 1DYNA 4HLEA 3EC8A 3GYPA 2ELAA 3WANA 3RCZA 1ZSQA 4JLCA 3QJZA 3TVVA 1DDMA 5CHVC 2I5FA 4A6FB 5JHGA 3A4SC 3APCA 1S3SG 1Y8RC 4FJYA 1V5PA 3DPDA 1LM8B 4G3XB 2KNBA 4G0NB 2COFA 5C1ZA 3L17A 1V89A 3ODOA 2RD0A 3E66A 1ZC4B 2YRYA 2D10A 5CLQB 2KDFB 4GDLA 4JK7A 2CAYA 2OQBA 2ZJDA 3ODXA 5JHHA 4WWNA 4Z2NA 1J8CA 3H7PB 1TJ6A 1E7UA 4XC2A 1WX9A 1NBFC 2CY4A 4TQ1A 3T06A 1WI1A 4IC7B 4GGQA 3B1LX 4A6FA 1W1HA 1FB8A 5LXIB 3RCPA 3UQAA 2CQUA 4IM0A 2LYDA 3DVNU 4M0WB 4EJNA 4EFOA 1X05A 2LWPA 4JIOU 3WAMA 2C7HA 3N3KB 2OJRA 1YJ1A 4MGKE 5J2RA 1MAIA 2GOWA 1DIKA 4MJSA 4EUTA 1FHOA 3QHTA 1R4NI 2XBBC 2LRUA 3TO1A 3SYXA 1U4AA 2ELBA 1LQBA 4IWOA 3DQVA 2ZCCA 4K2PA 2M4NA 2KK8A 4WQOB 2KVRA 4JKCA 4OVVA 2CHZA 3BY4B 2JT4B 2AYOB 2D3GA 2HTHA 5D7GA 5DPSA 2CB8A 1NU2A 4EMOA 5KQ1A 2NVUI 4IAPA 3DBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  4EZL A;  1RRP B;  3PVL A;  2YS1 A;  1WG7 A;  5LXH A;  5CLL B;  2MRP A;  4HXD A;  3SUZ A;  3TCA A;  2KN5 A;  3L16 A;  2EC1 A;  1XOD A;  4IW0 A;  2BYF A;  1X1F A;  3PEG A;  3VQI A;  3R7Q A;  1X86 A;  2M17 A;  3TJP A;  2DFK A;  1GJZ A;  3PHW B;  2D11 A;  2DYO A;  2AL3 A;  2MP2 B;  1P1A A;  1EF5 A;  2KXJ A;  3MDB C;  2M38 A;  2YS5 A;  5J17 A;  2LBB A;  4BBK A;  5D3V A;  2ZCB A;  2J0J A;  1Z87 A;  2A4Z A;  1CMX B;  2XK5 B;  2L76 A;  3EFU A;  3M1I B;  1P3R A;  2REX A;  4F7Z A;  3TW1 A;  2BKR B;  1U27 A;  1WM3 A;  2PE9 A;  3ZUN A;  4DHJ B;  1LXD A;  2KMA A;  1WI0 A;  3PRP B;  3K9P B;  1KI1 B;  2WX0 A;  1NTI A;  3GYO A;  5J3Q A;  1TQZ A;  2WWZ A;  1OQN A;  4EZK A;  4HHV A;  3KRX A;  1ZW7 A;  3RT3 B;  2N23 A;  3KY9 A;  1KM7 A;  5CX3 A;  2ZZP B;  1WGH A;  3ONS A;  4GPT B;  4HVB A;  4F8C B;  4PS8 A;  4LDT D;  2DX5 B;  2XK5 A;  3VDZ A;  3IFW B;  1L7Y A;  2WDT B;  3CST A;  1WF9 A;  2YT1 A;  1V5T A;  4MGY E;  3HM6 X;  1C1Y B;  3V6E B;  4L6E A;  2L2I A;  1GUA B;  2Z0E B;  3KH0 A;  4MY6 A;  4DBB A;  3V6C B;  4Z2M B;  1Q5W B;  2GBR A;  5GMV A;  1BTN A;  3PV1 A;  2G45 B;  2L8J A;  5HE1 A;  5KQ4 A;  3QAR A;  3M3J A;  2KKC A;  3V60 A;  2DYB A;  5JH5 C;  5LOP B;  2RVB B;  3DXD A;  1RLF A;  2DX5 A;  2QKM A;  1WJM A;  3RZW C;  1S1Q B;  2LOX A;  2YSZ A;  2D2Q A;  1H4R A;  4XWX A;  4NNJ B;  2C7N B;  1EVH A;  2DZK A;  3APF A;  4CHK A;  5DPT A;  2J7Q B;  5FI0 A;  2LRW A;  2XQN M;  1YIW A;  5CHW A;  3HM3 A;  1V80 A;  2M0X A;  3NZU A;  2K6D B;  4ZDV A;  4EZJ A;  3TL5 A;  4BOZ B;  1RFA A;  2LG1 A;  1MK7 B;  4HJK A;  2COP A;  3PP2 A;  3QBV B;  4PQ0 A;  2ZEQ A;  1HB6 A;  1NVL A;  3VIA A;  4TYZ A;  1V81 A;  2Y5B B;  1M94 A;  1KOT A;  3DVG X;  1UPR A;  1KZG A;  1BWN A;  3QCA A;  2W2X D;  3FSS A;  2LXC A;  5JHB A;  3C0R B;  5DCN A;  2Q13 A;  3A33 B;  1WMH B;  4MGZ E;  3VUY A;  1TGZ B;  2KHW B;  4HAZ B;  3KYC D;  2N7D A;  2M14 A;  1WR1 A;  2C7M B;  4EKU A;  2JP2 A;  4PYZ A;  5E6P A;  2RGN B;  3WIM A;  4NQK E;  2L0F A;  2VRR B;  4DHZ E;  3L54 A;  5E6N A;  1V5M A;  3QK0 A;  3KSY A;  3BJI A;  2WYQ A;  2YF0 A;  3X23 A;  5CTR C;  1SGH A;  1GNU A;  4FJV B;  1XQQ A;  4HAX B;  3W1S A;  1WMH A;  3V62 A;  4KAX B;  2LGY A;  2B3A A;  2DYM A;  3O96 A;  2ROV A;  4GN1 A;  1WXA A;  1P5T A;  5AZF A;  1SE9 A;  2JVC A;  2M1M A;  3DXE A;  4P7I A;  2N9E B;  1WM2 A;  3FM8 C;  4Y94 A;  3VUX A;  5J18 A;  1MG8 A;  2RGF A;  2MX2 A;  1ZM0 A;  3ZNZ B;  1ZC3 B;  1U5F A;  2N1V A;  4GDK B;  4EEW A;  3ENE A;  4IM2 A;  1V2Y A;  3ZLZ A;  4HPL B;  2IO1 B;  2YS3 A;  4W9K A;  2KC1 A;  2L00 B;  3MTN B;  2GBJ A;  2UZS A;  2EJ8 A;  2NBV B;  4CO7 A;  1UH6 A;  4GB9 A;  4F7H A;  5D94 A;  2R09 A;  4BVU C;  4CYE A;  1IRS A;  1BAK A;  1WVH A;  2P8V A;  3JSV B;  2C5L C;  3APD A;  2PE6 B;  1FGY A;  3SO6 A;  2PEA A;  1NI2 A;  1V9J A;  4M8N A;  4ZRJ A;  2CHX A;  4MGI E;  2HRJ A;  3N7C A;  1K8R B;  4GDL B;  3D32 A;  3PSC A;  4ICU A;  4W9E A;  2LGX A;  5LLI A;  4JL9 A;  5D3Y A;  2PZ1 A;  1YX6 B;  3Q3J A;  4AWJ A;  5G55 A;  4HAT B;  1WZ3 A;  2KFJ A;  2LUE A;  1DRO A;  1EF1 A;  1WGG A;  1E90 A;  2V3S A;  3JSV A;  3W1S C;  4AJY B;  4MT7 A;  3W1Y A;  4RM8 A;  3HIZ A;  1L2N A;  3D8D A;  2G4S A;  2MFQ A;  2CS4 A;  3N30 A;  1YD8 U;  1OMW A;  3U30 A;  1E8Y A;  1M7R A;  2GJY A;  3A9K A;  1E5W A;  5DI9 B;  3VFK A;  2LKO A;  3NSU A;  1SIF A;  1WH3 A;  3Q3F A;  4JQW C;  2YLM A;  2BWE S;  4DBG A;  2MLB A;  2O2V B;  4MJS B;  3VOQ A;  3A8Q A;  1U5G A;  4DK5 A;  1V86 A;  2UYZ B;  2DLW A;  2RR9 A;  1AWE A;  2D9Z A;  2KTR A;  2IYB A;  5IJM A;  2KLC A;  4A3O A;  4PYU A;  4HB4 B;  1OEY J;  3QX1 A;  2CR5 A;  1NTY A;  2FID A;  2D9V A;  2HTH B;  1WGU A;  2DN6 A;  3UIO B;  1NTV A;  2LOZ A;  4GZU A;  3K9O B;  4A6K A;  1T0Y A;  4JGH B;  3OLM D;  4WAA A;  2O2V A;  5C23 A;  3HW2 B;  3H9D A;  3CSF A;  4F1S A;  3MPX A;  5GOW B;  1WRD B;  3DBR I;  1IPG A;  2KX3 A;  3U7D A;  4A5K A;  1Q0W B;  3ZRC A;  4ANV A;  2AWT A;  4TUU A;  2K25 A;  3QIJ A;  2CY5 A;  5BO4 B;  3ZNH B;  1BT0 A;  1LFD A;  2LZ6 A;  1E7V A;  2D9W A;  1MK9 B;  3TFM A;  1V5O A;  3X0W A;  4LDT B;  2O6V D;  3KUD B;  2IO3 B;  2K1F A;  1I35 A;  1J19 A;  3M95 A;  4HAV B;  2C9W B;  3CF6 E;  2MQJ A;  4LJO B;  4B6W A;  3KVF B;  4IG7 B;  3VAW A;  2DAJ A;  3ML4 A;  4RM9 A;  2ZNV B;  4WSF A;  3AJ4 A;  3ULC A;  2C60 A;  3IBE A;  2Y8F A;  5CHF A;  4NSW A;  1VD2 A;  4G50 A;  3EHV A;  3D8E A;  2FCM A;  2R2Q A;  2ZPN A;  4N9F 4;  2KTF A;  4HAW B;  2L05 A;  1M7E A;  3MHS D;  2L0T A;  1OEY A;  2CU1 A;  4KSL C;  1RAX A;  2MA9 B;  2UWQ A;  5KHO A;  4IFS A;  5TR5 A;  3HK0 A;  1UNP A;  1WZ0 A;  3LDZ E;  2KMC A;  3SDL C;  3V61 A;  5HE0 A;  2K6Q A;  4GU2 A;  2JZZ A;  4WWO A;  2N7E A;  2M8S A;  2ZPY A;  2CRF A;  3N32 A;  5HKH A;  1WXV A;  1I7A A;  5JZE B;  5D27 A;  2YT0 A;  2D07 B;  4ANW A;  2LGD A;  2D9X A;  2RSG A;  2FCQ A;  2HD5 B;  2KDI A;  2LUL A;  3QC8 B;  4ASW C;  1FHW A;  3DBH I;  4FUL A;  1HE8 A;  2JUO A;  4K7W A;  1Y19 B;  3RUI B;  1H8C A;  2IO2 B;  4MSQ B;  2KGX B;  4K1R B;  1MKE A;  5IA7 A;  3A4R A;  1P3Q U;  2KDB A;  3DBL I;  4TV3 A;  1WGD A;  3A8P A;  1UGM A;  1KLV A;  1NDD A;  3QQ8 B;  1WXM A;  3EEC A;  2DHK A;  1V49 A;  1UBI A;  1P0R A;  3SD5 A;  3VXW A;  1EAZ A;  2JF5 A;  2VSZ A;  3VH3 B;  2GS0 A;  4PS7 A;  1MIZ B;  2RSU A;  3VTV A;  3NZS A;  1ST7 A;  4BKG A;  5C79 A;  5JP4 A;  2Z0Q A;  5AZH A;  4KZ0 A;  4E3C A;  1J0G A;  5L95 C;  2KFK B;  1W1G A;  2EMT A;  3ZDM C;  2COD A;  3L08 A;  2DKQ A;  1BTK A;  3KZ1 A;  3HQC A;  3ZNG C;  4W9L A;  3ULB A;  3PLV A;  2MBQ A;  3VTU A;  5J3Y A;  3JW0 X;  2Y7B A;  4KVG B;  3KW5 B;  2L3Z A;  2JPH A;  4I6P A;  2GBK A;  2DX1 A;  3T9L A;  3KYD D;  5D6J B;  2RLO A;  3RYT A;  4W9H A;  2FUH B;  2J0M A;  2K00 A;  1XX0 A;  3CMM B;  5L81 A;  1PLS A;  4FJZ A;  1PFJ A;  3HHM A;  2KFK A;  2QKL A;  2P0F A;  4NY0 A;  2BYV E;  1KZ7 A;  1UNQ A;  3DXC A;  4BBN F;  1G6J A;  4ANX A;  3JYU A;  2MWS B;  4CHM A;  4LCD E;  4DHJ D;  1W1D A;  2DZJ A;  5C16 A;  4IWQ A;  1GC7 A;  3OAN A;  3AUL A;  4K17 A;  2KWV B;  4ZRI A;  4AJW A;  2P0H A;  5DH9 B;  3PPA A;  1WY8 A;  5DPW A;  2DHI A;  2DZM A;  3RUL A;  1Y5O A;  3DCG A;  2KWC A;  2DTC A;  1XKE A;  3G9W A;  3UZT A;  1EUV B;  3WA0 A;  2ASQ A;  4ZYN A;  4G11 A;  4YL8 A;  2KC2 A;  2W2X C;  2VRW B;  1X11 A;  3ML8 A;  1Q67 A;  1OGW A;  3ALB A;  2I5C A;  4HWI B;  2PPH A;  1XR0 B;  4K81 A;  4X57 B;  2FAZ A;  5HE3 A;  2JRH A;  2JWZ A;  1U5D A;  3LJ3 A;  4ANU A;  4HK2 A;  2KDE B;  3VVW B;  2UVM A;  2K2U A;  1P98 A;  2D9Y A;  1HB8 A;  3UIP B;  3UGB B;  1WX8 A;  4KV2 A;  4MDK E;  2LVQ A;  1LB1 A;  2BWF A;  1AQC A;  2L1C A;  2MWN B;  4BKS D;  3FP5 A;  4GXB A;  3V5W A;  3RD2 A;  1Q1O A;  4I6L B;  1U29 A;  2MKR A;  3IG3 A;  2Z0O A;  3WAO A;  3IVF A;  3KRW A;  2ABD A;  3AU4 A;  3L13 A;  1UZX B;  1B55 A;  3M62 B;  4II2 B;  1F9J A;  3A9J A;  2N4F A;  5FI1 A;  1C3T A;  5DIF B;  2K2J A;  2BGF A;  2DHJ A;  2EMS A;  1WIA A;  2KAN A;  5EDS A;  1RRB A;  4IOY X;  4MSM B;  3CIK A;  4II3 B;  4K7U A;  1JRU A;  3A9K B;  4IWP A;  3GOE A;  2KJH B;  4KDL B;  1RJ2 A;  3F0W A;  3PSE B;  3ZRF A;  2KUP A;  4HPM B;  1UD7 A;  4HB2 B;  2KQ7 A;  4BKT A;  2JY6 A;  3ML9 A;  4WVF B;  2IBI B;  2DYQ A;  4NAW B;  2NPT B;  2BKF A;  4HAY B;  1X1G A;  2K8H A;  2ZVN A;  3ODW A;  1WGQ A;  1PMS A;  2KTR B;  2PJH A;  5G2N A;  3ZIM A;  2BF8 B;  2E2X A;  1WYW B;  2O6V B;  3ECI A;  1U5E A;  4E71 A;  1WJ4 A;  4AP4 C;  5LON B;  2CHW A;  1FXT B;  2NCN A;  1WJN A;  2NR2 A;  1AAR A;  2R0D A;  3AU5 A;  2LAS A;  2KX0 A;  4FAD A;  4AOF A;  2IY1 B;  5D2M B;  2DHZ A;  4NAW A;  2NPT A;  3O65 B;  5JHA A;  4FHK A;  4XX5 A;  2KJR A;  1I2H A;  2JXX A;  2O6V A;  3NHE B;  3SNH A;  3P6A A;  2YVC A;  3UIN B;  3PGE A;  2ADZ A;  1E8X A;  4KHO A;  4W9I A;  1EGX A;  1TTN A;  3BIN A;  3R7R A;  4BOS C;  2FJ9 A;  5DHF B;  1R4M I;  2JRI B;  2BPS A;  4DX9 0;  2NS5 A;  3L10 B;  3PRM B;  3DVG Y;  3ZDT A;  2GCJ A;  4D0N B;  4IUM B;  3H7P A;  1WGR A;  4DDG D;  2X18 A;  3B08 A;  1WFY A;  3WYF B;  2A5U A;  2MBB B;  1ISN A;  4A3P A;  3PRZ A;  3VTW A;  1QQG A;  2KJ6 A;  3NS8 A;  3UF8 A;  3U8Z A;  4NPN A;  2LXA A;  1VCB A;  3L0W B;  2I1J A;  5HE2 A;  1OQY A;  3GZN I;  1D3Z A;  4DXA B;  4HAU B;  3ZTD A;  1GC6 A;  2K8C A;  2LD9 A;  1ACA A;  4DX8 A;  2W2W A;  1P9D U;  4HDQ A;  4TKN A;  2G35 A;  3QWM A;  3B0A A;  4GMX B;  4FLH A;  3H6N A;  3D8F A;  4W9C A;  1XD4 A;  2P0D A;  4KZC A;  4WJQ A;  4HDO A;  2AL6 A;  3AXC A;  4NQL B;  2DYN A;  4XZ4 A;  4MEM A;  2DEN B;  1V5U A;  3I3T B;  2DAF A;  2LVP A;  3IHP C;  4MK0 A;  2N1W A;  3H7S A;  2HE7 A;  2OOB B;  2GMI C;  5D3X A;  2UZR A;  4HCN B;  3PHX B;  2V1Y A;  4NJ6 A;  2FNJ B;  2N0Y A;  2KD0 A;  4NJ7 A;  2MBE A;  2RUK B;  4A6H A;  3PT2 B;  2VKI A;  4WJN A;  1X1M A;  3TBL D;  1DDW A;  1YQB A;  3P7Z A;  5E6O A;  2KLG A;  2XEW A;  2ZVO A;  3VUW A;  3OJ3 A;  2FCS A;  4WJP A;  4TQ0 A;  3A98 B;  4WJO A;  1WGY A;  1J0W A;  2N9P C;  1IYF A;  3H1U A;  4M8M A;  1ZKH A;  1K5D B;  3DDC B;  2V76 A;  2QHO A;  1IP9 A;  3KUZ A;  4HCP B;  2KO3 A;  3A1Q B;  1WE7 A;  3PG7 A;  2V4L A;  3MJW A;  4K7S A;  4W9J A;  2MDX A;  5JLJ B;  2LJ5 A;  1QZE A;  1WE6 A;  1K5G B;  3UQB A;  2OTX A;  3ZNI D;  2MP2 A;  3P2B A;  4B9K A;  2K39 A;  2H7E A;  4URK A;  2D4Q A;  2DKP A;  5FR6 A;  3AI5 A;  2J0K A;  1FOE A;  1FGZ A;  1QC6 A;  4KIK B;  1TZ1 A;  1GG3 A;  2FCN A;  2Z0P A;  4PS3 A;  2N9X A;  5DHA B;  1Z2M A;  4BFR A;  1ZVR A;  4GIV A;  5AEK B;  3NOB A;  4C0A A;  3A1Q A;  2RQ1 A;  2I1K A;  3SHQ A;  4PNK A;  2H7D A;  2Y8G A;  2NBU A;  1MPH A;  2DZI A;  4EOY A;  2ZNV C;  3FEH A;  3VH4 B;  3LJU X;  2L7R A;  4KIK A;  1UNR A;  3RZF A;  3PTF C;  2BCJ A;  1DBH A;  2MBO A;  2NMB A;  4HB0 B;  2GBM A;  2MCN B;  4OVU A;  3JVZ X;  3PVU A;  2J59 M;  3OJ4 B;  2Z59 B;  5J3T A;  1P6S A;  2GBN A;  1SHC A;  4KHA A;  5DPR A;  2IFS A;  3SU8 X;  1UPQ A;  2KQS A;  4FN2 A;  2CKH B;  4LJP B;  1UEF A;  1XCG A;  4WJ7 A;  2KOX A;  4KSK C;  3PS6 A;  1OY2 A;  1XT9 B;  2R2O A;  3ZVV A;  2WX1 A;  3F5R A;  1WXS A;  5L83 A;  3TIX A;  2IYD B;  3PVW A;  2K8B A;  1TBE A;  3VHT C;  4RMA A;  5EFX A;  1EO6 A;  2W9N A;  4CHJ A;  1UEL A;  4GOC A;  3DVN V;  3KUC B;  3SV1 A;  3OAW A;  3ZTC A;  1H10 A;  4AUQ C;  4YON A;  5C5B B;  4J6I A;  4B95 A;  1YX5 B;  3ZO5 B;  4BKS A;  4F7U P;  4FHJ A;  1V6E A;  2MW5 A;  3PLU A;  4ICV A;  2KZR A;  2LI5 A;  1WJ6 A;  4IM3 A;  1KJT A;  3CXB B;  5D3W A;  2FDQ A;  2LVO A;  4GMV A;  4K2O A;  1E8Z A;  1XD3 B;  4I6N B;  4W9D A;  3ZVR A;  1HBK A;  3ZKJ C;  3EPY A;  2BYE A;  3R66 C;  3S2A A;  4W9F A;  1FAO A;  3M63 B;  2WH5 A;  4DWF A;  3T8M A;  2COC A;  4B6H A;  3R3M A;  1PQS A;  1UBQ A;  3WAP A;  1LW3 A;  4MH0 E;  5C5B A;  3QAQ A;  2IZV B;  3A9J B;  3PRE A;  4HB3 B;  2GCL A;  4F7G A;  2EKE C;  2HJ8 A;  4W9G A;  1E8W A;  3DOW A;  5AZG A;  2JZ3 B;  2ROZ B;  2IO0 B;  4KDI C;  1N3H A;  2KCJ A;  3TMP B;  1OTR B;  2Z0D B;  4MM3 A;  4WWP A;  1A5R A;  2KWU B;  4H8S A;  3WAL A;  2NBW B;  1WJ1 A;  4DDI D;  1DDV A;  3QA8 A;  5KCV A;  5KHQ A;  1ZGU B;  4BBN C;  4DHZ B;  2MSE D;  2RNR B;  4A20 A;  1FHX A;  1V61 A;  5C6R A;  1WX7 A;  4KHB B;  2RPQ A;  2MBH A;  2FIF A;  1MIX A;  1Z5S B;  5IAA C;  4E74 A;  4FA6 A;  2COA A;  4FBJ B;  4MEL A;  2AEH A;  3ZW3 A;  1U2B A;  1TXD A;  1WR6 E;  3QWZ B;  3FLV A;  2NZ8 B;  2IY0 B;  1V88 A;  4GSW A;  2DA0 A;  2G3Q B;  4ZRK A;  4GDK A;  1WJU A;  3NY5 A;  2FJL A;  1I42 A;  2G4D B;  1DYN A;  4HLE A;  3EC8 A;  3GYP A;  2ELA A;  3WAN A;  3RCZ A;  1ZSQ A;  4JLC A;  3QJZ A;  3TVV A;  1DDM A;  5CHV C;  2I5F A;  4A6F B;  5JHG A;  3A4S C;  3APC A;  1S3S G;  1Y8R C;  4FJY A;  1V5P A;  3DPD A;  1LM8 B;  4G3X B;  2KNB A;  4G0N B;  2COF A;  5C1Z A;  3L17 A;  1V89 A;  3ODO A;  2RD0 A;  1ZC4 B;  2YRY A;  2D10 A;  5CLQ B;  2KDF B;  4GDL A;  2CAY A;  2OQB A;  2ZJD A;  3ODX A;  5JHH A;  4WWN A;  4Z2N A;  1J8C A;  3H7P B;  1TJ6 A;  1E7U A;  4XC2 A;  1WX9 A;  1NBF C;  2CY4 A;  4TQ1 A;  3T06 A;  1WI1 A;  4IC7 B;  4GGQ A;  3B1L X;  4A6F A;  1W1H A;  1FB8 A;  5LXI B;  3RCP A;  3UQA A;  2CQU A;  4IM0 A;  2LYD A;  3DVN U;  4M0W B;  4EJN A;  4EFO A;  1X05 A;  2LWP A;  4JIO U;  3WAM A;  2C7H A;  3N3K B;  2OJR A;  1YJ1 A;  4MGK E;  5J2R A;  1MAI A;  2GOW A;  4MJS A;  4EUT A;  1FHO A;  3QHT A;  1R4N I;  2XBB C;  2LRU A;  3TO1 A;  3SYX A;  1U4A A;  2ELB A;  1LQB A;  4IWO A;  3DQV A;  2ZCC A;  4K2P A;  2M4N A;  2KK8 A;  4WQO B;  2KVR A;  4OVV A;  2CHZ A;  3BY4 B;  2JT4 B;  2AYO B;  2D3G A;  2HTH A;  5D7G A;  5DPS A;  2CB8 A;  1NU2 A;  4EMO A;  5KQ1 A;  2NVU I;  4IAP A;  3DBS A; 
#chains in the Genus database with same CATH topology
 3PZD A;  2KAC A;  4EZL A;  1RRP B;  1QF6 A;  2OED A;  4JKA A;  3PVL A;  2YS1 A;  1WG7 A;  2JSV X;  5LXH A;  1C4C A;  5GXG B;  5CLL B;  1I4R A;  2MRP A;  4HXD A;  1WRI A;  3SUZ A;  3TCA A;  3NJT A;  2KN5 A;  3L16 A;  4ZHO A;  2EC1 A;  1FNU A;  1XOD A;  4IW0 A;  2BYF A;  1X1F A;  1VZ7 A;  3PEG A;  3Q8E A;  3VQI A;  1YNT E;  3R7Q A;  1X86 A;  1WWT A;  2M17 A;  1TZO A;  3TJP A;  2DFK A;  2GLS A;  2J4X A;  1FMA D;  1GJZ A;  3PHW B;  2D11 A;  2DYO A;  5FK9 C;  2AL3 A;  4C4V A;  3SBG A;  2MP2 B;  1E10 A;  1P1A A;  2IGG A;  4WH4 A;  1EF5 A;  2KXJ A;  3MDB C;  2LGS A;  2M38 A;  2YS5 A;  5J17 A;  2LBB A;  4ZHP A;  4BBK A;  5D3V A;  3OG5 A;  1VJK A;  5I2S A;  4JKB A;  2ZCB A;  2J0J A;  1Z87 A;  2A4Z A;  3R2T A;  3W5V B;  1JCK B;  2V4I B;  1CMX B;  2XK5 B;  2L76 A;  4C7Y A;  3EFU A;  3M1I B;  1QQR A;  1P3R A;  1FXA A;  2QIE B;  2REX A;  3N9Y C;  4F7Z A;  3TW1 A;  2BKR B;  1U27 A;  1NVI D;  1WM3 A;  2PE9 A;  3ZUN A;  4DHJ B;  1LXD A;  4NZL B;  2KMA A;  1WI0 A;  3SBT A;  3PRP B;  4RF0 A;  3K9P B;  1KI1 B;  2WX0 A;  2RDH A;  1NTI A;  3GYO A;  1KF6 B;  5J3Q A;  1TQZ A;  3RNB C;  2WWZ A;  5IP4 D;  1N5X A;  1OQN A;  4EZK A;  4HHV A;  2WXQ A;  2V3N A;  3KRX A;  2LJI A;  2MJ3 A;  1TT5 B;  3NS1 A;  5M4Y B;  1ZW7 A;  5EE9 A;  3RT3 B;  2M56 B;  3BWU D;  2N23 A;  1CZP A;  3KY9 A;  1KM7 A;  3EFC A;  4HRO A;  2ZZP B;  1WSP A;  1WGH A;  5CX3 A;  2UU7 A;  1JWM D;  4L23 A;  2X8X X;  4PT5 A;  2D3C A;  3ONS A;  4GPT B;  4HVB A;  4F8C B;  4PS8 A;  2DIK A;  2ON8 A;  1V1O A;  1TS2 A;  4LDT D;  2DX5 B;  4QAY A;  3AE8 B;  2XK5 A;  1E9M A;  3VDZ A;  3IFW B;  1L7Y A;  2WDT B;  3CST A;  1C78 A;  1C4A A;  2EEL A;  2HDE A;  1T0S C;  4OSN A;  1WF9 A;  2YEP F;  2YT1 A;  1V5T A;  2D3A A;  3HM6 X;  4MGY E;  1C1Y B;  3V6E B;  1AN8 A;  2LHE A;  4BZA A;  4L6E A;  2L2I A;  1GUA B;  2Z0E B;  1SJE D;  2VZK D;  3KH0 A;  2WP9 B;  4MY6 A;  4DBB A;  3V6C B;  3NVV A;  3RI7 C;  3P63 A;  4Z2M B;  1Q5W B;  2GBR A;  5GMV A;  1BTN A;  5IO9 A;  3BVG A;  3PV1 A;  2G45 B;  4KKJ A;  4B0M A;  2L8J A;  3GB1 A;  1HA5 A;  5HE1 A;  5KQ4 A;  3TUO A;  3QAR A;  3M3J A;  2KKC A;  3V60 A;  2DYB A;  2WU2 B;  5JH5 C;  5LOP B;  2RVB B;  2RDG A;  3DXD A;  1RLF A;  2DX5 A;  3AE7 B;  2QKM A;  1WJM A;  2WXP A;  1D6E C;  3RZW C;  1S1Q B;  3SFD B;  2X38 A;  2LOX A;  2YSZ A;  2D2Q A;  1H4R A;  4XWX A;  3NWF A;  4MAC A;  5AUK A;  4NNJ B;  3VRA B;  4HRS A;  2C7N B;  1BML C;  1EVH A;  2DZK A;  3APF A;  5G5G A;  5DPT A;  4CHK A;  1B9R A;  2J7Q B;  5FI0 A;  2LRW A;  1R4N B;  2D5G A;  2XQN M;  1YIW A;  5CHW A;  1V1P A;  3HM3 A;  2WU5 B;  1V80 A;  2M0X A;  3NZU A;  4HKQ A;  2K6D B;  4ZDV A;  4EZJ A;  3TL5 A;  2XN9 C;  4OVZ A;  1SB3 C;  4BOZ B;  1RFA A;  2LG1 A;  1MK7 B;  4HJK A;  2COP A;  3PP2 A;  3QBV B;  4PQ0 A;  2ZEQ A;  1HB6 A;  3AN1 A;  2H88 B;  1NVL A;  3VIA A;  1V8C A;  2Z4D A;  4TYZ A;  4KGT A;  1V81 A;  1QOB A;  2K8E A;  2Y5B B;  4FXC A;  1M94 A;  1KOT A;  3DVG X;  1UPR A;  1KZG A;  3IAS 1;  1C9F A;  1BWN A;  3QCA A;  5FR3 A;  1D5M C;  2W2X D;  2V9H A;  2JX5 A;  3FSS A;  1JW9 D;  2LXC A;  5JHB A;  3BVZ A;  3C0R B;  5MPO A;  5DCN A;  2Q13 A;  3GE3 C;  3A33 B;  1N5W A;  1SSN A;  1WMH B;  4MGZ E;  4JK9 A;  3VUY A;  1TGZ B;  4ILJ A;  4HJG E;  3ZJV A;  3VRB B;  3Q14 C;  1F2R I;  2KHW B;  4HAZ B;  3Q8B A;  3KYC D;  2N7D A;  2M14 A;  1GGO A;  2KN4 A;  1WR1 A;  2R61 A;  2Z8L A;  4RNA A;  2C7M B;  4EKU A;  2JP2 A;  1SEB D;  4PYZ A;  2EKI A;  4XYC A;  1DOY A;  3IT6 B;  5E6P A;  5IOI A;  2RGN B;  5EE3 A;  3WIM A;  1LO5 D;  1FM0 D;  4NQK E;  2L0F A;  2VRR B;  4DHZ E;  3L54 A;  4NAM A;  5E6N A;  1V5M A;  1JWS D;  3QK0 A;  3KSY A;  3BJI A;  2WYQ A;  2YF0 A;  3RN9 C;  1F77 A;  4L1B A;  3P1M A;  1T77 A;  3X23 A;  5CTR C;  1SGH A;  3VR9 B;  1GNU A;  4IOI E;  4FJV B;  4OHJ A;  4LNF A;  1XQQ A;  4WWM A;  4HAX B;  3W1S A;  2WXJ A;  1WMH A;  3V62 A;  4KAX B;  2LGY A;  2B3A A;  3BYT B;  2DYM A;  3O96 A;  2ROV A;  4RH6 A;  4GN1 A;  1WXA A;  1P5T A;  5AZF A;  1SE9 A;  2WXN A;  2JVC A;  2M1M A;  3DXE A;  1HTQ A;  4P7I A;  2N9E B;  1NI3 A;  1FCL A;  4CQN A;  1ZXH A;  2YT2 A;  1WM2 A;  3FM8 C;  4Y94 A;  3VUX A;  5J18 A;  1MG8 A;  1EWY C;  2RGF A;  2MX2 A;  1ZM0 A;  1ZC3 B;  1U5F A;  3ZNZ B;  2N1V A;  3HSA A;  2W3S A;  1QT9 A;  1HQR D;  4GDK B;  4EEW A;  3ENE A;  4IM2 A;  1V2Y A;  3ZLZ A;  3U12 A;  4HPL B;  1IGC A;  2IO1 B;  2YS3 A;  4W9K A;  2JQR B;  1NYR A;  2KC1 A;  2L00 B;  3DBH B;  2GBJ A;  3MTN B;  4JE3 B;  2UZS A;  2EJ8 A;  1C76 A;  2NBV B;  3SR6 A;  4CO7 A;  1UH6 A;  4GB9 A;  4F7H A;  5D94 A;  2R09 A;  4BVU C;  4CYE A;  1IRS A;  2FBW B;  1BAK A;  1WVH A;  2INN E;  2PMV A;  2DLB A;  4H2A A;  2BBC A;  2P8V A;  5C2T B;  2J52 A;  3AEF B;  4UDU C;  4ARC A;  2K9X A;  3JSV B;  4RGO S;  5BMH A;  2C5L C;  3U2S C;  2WLB A;  3PZ8 A;  3APD A;  1ENF A;  2PE6 B;  1FGY A;  3SO6 A;  2PEA A;  1UF0 A;  1NEN B;  1NI2 A;  1V9J A;  4M8N A;  4ZRJ A;  2CHX A;  1K50 A;  4MGI E;  2HRJ A;  3N7C A;  1K8R B;  4GDL B;  3D32 A;  3WCQ A;  3PSC A;  4ICU A;  2K22 A;  1FO4 A;  4W9E A;  2LGX A;  5LLI A;  4JL9 A;  3MJ5 A;  5D3Y A;  2NBV A;  1UWM A;  2PZ1 A;  3MC0 B;  1YX6 B;  3Q3J A;  4AWJ A;  5G55 A;  4HAT B;  1WYG A;  4QJ5 B;  1XO3 A;  1WZ3 A;  4JKG A;  2KFJ A;  3FC4 A;  3AV8 A;  2LUE A;  2BQQ A;  1DRO A;  1EF1 A;  1WGG A;  1E90 A;  1JWB D;  2V3S A;  5HI1 A;  1K52 A;  3JSV A;  3FAH A;  3W1S C;  4AJY B;  4GNK B;  4MT7 A;  1QOG A;  3W1Y A;  3PZ7 A;  4RM8 A;  1FCC C;  4WQM A;  1XLO A;  4XDD A;  3HIZ A;  1L2N A;  3D8D A;  5HG2 A;  2I38 A;  3KLS X;  1ZP0 B;  1VBH A;  1L6U A;  2G4S A;  2MFQ A;  2CS4 A;  3N30 A;  1YD8 U;  1OMW A;  2RRF A;  3U30 A;  1E8Y A;  1M7R A;  2GJY A;  2X0S A;  3A9K A;  1GPX A;  3J9C A;  1SF0 A;  2BT6 A;  1E5W A;  5DI9 B;  2IJ0 A;  1FRR A;  2LHD A;  3KQ4 A;  3VFK A;  4QJ4 B;  1ET9 A;  2LKO A;  1SJH D;  3NSU A;  1SIF A;  4KKI A;  1WH3 A;  3Q3F A;  4JQW C;  2YLM A;  2BWE S;  4DBG A;  4ZYS A;  1I4G A;  2MLB A;  2O2V B;  4MJS B;  3AH7 A;  3VOQ A;  3A8Q A;  1U5G A;  3RMK C;  4DK5 A;  3B2F A;  2W55 A;  1V86 A;  3BVM A;  1SXT A;  2UYZ B;  4XWT A;  2DLW A;  2RR9 A;  3BK2 A;  4JKE A;  4XDC A;  3SEB A;  1AWE A;  2KWD A;  3I57 A;  2D9Z A;  2KTR A;  2IYB A;  5IJM A;  2KLC A;  4A3O A;  5EE1 A;  4PYU A;  3TEY A;  4HB4 B;  1OEY J;  4DQO C;  3QX1 A;  2IGD A;  2CR5 A;  1NTY A;  2FID A;  2D9V A;  2HTH B;  2G9H D;  1WGU A;  2DN6 A;  2QMT A;  3UIO B;  1AWD A;  2HTM E;  3E9L A;  1NTV A;  2LOZ A;  4GZU A;  3IT4 B;  3K9O B;  1LGR A;  4A6K A;  1T0Y A;  3P4P B;  4JGH B;  3OLM D;  4WAA A;  2O2V A;  1N63 A;  5C23 A;  3HW2 B;  3H9D A;  3CSF A;  4CSQ A;  3MPX A;  4F1S A;  5GOW B;  1WRD B;  2MJE A;  3DBR I;  1IPG A;  2KX3 A;  3U7D A;  4A5K A;  1Q0W B;  3ZRC A;  1CK1 A;  4ANV A;  3KWL A;  1TKY A;  2AWT A;  4TUU A;  1L6V A;  2K25 A;  4A90 A;  3QIJ A;  2CY5 A;  5BO4 B;  3ZNH B;  1M4V A;  5I4D A;  1BT0 A;  1XXG A;  1LFD A;  2LZ6 A;  4LNK A;  5C3J B;  5HFY A;  3FKY A;  1FD6 A;  4OZB A;  3AEG B;  1E7V A;  1EU3 A;  1P7F A;  4XE0 A;  3Q8C A;  4L1R A;  1ROE A;  2D9W A;  3Q8A A;  2KAJ A;  1MK9 B;  3TFM A;  1E0Z A;  1V5O A;  3X0W A;  1MG4 A;  4LDT B;  3LXF A;  2O6V D;  3KUD B;  1MI0 A;  2IO3 B;  1GOZ A;  2K1F A;  2ZKM X;  1I35 A;  1ZOY B;  1J19 A;  3M95 A;  3LB8 C;  4HAV B;  2RPV A;  2C9W B;  3CF6 E;  2JZP A;  2HJ1 A;  5IKC M;  2MQJ A;  4WUR A;  1I4H A;  4LJO B;  4B6W A;  4JKH A;  3KVF B;  4IG7 B;  4O1N A;  4LLG M;  1OFF A;  3VAW A;  1RYJ A;  1OQR A;  2MHJ A;  2DAJ A;  1B1Z A;  2IDY A;  3ML4 A;  3NVW A;  2MH7 A;  4RM9 A;  1TS4 A;  2SEB D;  2ZNV B;  2VZK B;  4WSF A;  3AJ4 A;  3ULC A;  2C60 A;  3IBE A;  2Y8F A;  5CHF A;  3FVC A;  4DXF A;  4NSW A;  1VD2 A;  4G50 A;  3EHV A;  3O13 A;  3D8E A;  2FCM A;  2R2Q A;  2ZPN A;  3TEW A;  4N9F 4;  3MFG A;  2KTF A;  4HAW B;  4ILG B;  1GAQ B;  2L05 A;  1M7E A;  3NG0 A;  3MHS D;  2L0T A;  1OEY A;  2CU1 A;  4KSL C;  1RAX A;  2MA9 B;  2UWQ A;  5KHO A;  2K0P A;  4IFS A;  5TR5 A;  4JK8 A;  3HK0 A;  1UNP A;  1K53 A;  2INC C;  1L0Y B;  1WZ0 A;  3LDZ E;  1UGJ A;  2KMC A;  3SDL C;  4OT1 A;  3V61 A;  5HE0 A;  4PK1 A;  2K6Q A;  1ZPS A;  4GU2 A;  3MP9 A;  2JZZ A;  5H92 C;  4TSS A;  4WWO A;  3AED B;  4N59 A;  2LGI A;  2E6X A;  2N7E A;  2M8S A;  2BS2 B;  2ZPY A;  2CRF A;  3N32 A;  1XCQ L;  5HKH A;  1WXV A;  1I7A A;  3I63 C;  5JZE B;  4AS1 A;  5D27 A;  2YT0 A;  2D07 B;  4ANW A;  2LGD A;  2D9X A;  2RSG A;  2FCQ A;  2HD5 B;  2KDI A;  3AE2 B;  1EWC A;  2LUL A;  3QC8 B;  4ASW C;  2LUM A;  1FHW A;  1F2R C;  3DBH I;  2YEP B;  4FUL A;  1HE8 A;  2JUO A;  5E6J A;  2PTL A;  1PGX A;  1L5P A;  4K7W A;  3RNG C;  1Y19 B;  3RUI B;  1H8C A;  2IO2 B;  4MSQ B;  2KGX B;  1ET6 A;  4K1R B;  1MKE A;  2L83 A;  5IA7 A;  3A4R A;  1P3Q U;  2KDB A;  3DBL I;  4TV3 A;  1WGD A;  3A8P A;  2JYT A;  1UGM A;  1KLV A;  5IRS A;  1NDD A;  3QQ8 B;  1I4P A;  1F1H A;  1T0R C;  3AM9 A;  2BVC A;  1WXM A;  3EEC A;  2DHK A;  1V49 A;  1SE4 A;  1UBI A;  1P0R A;  4US8 A;  1XLN A;  2WXF A;  3SD5 A;  3VXW A;  3U7Z A;  3KWV A;  1EAZ A;  4EE2 A;  2JF5 A;  1V1P B;  1E6E B;  2VSZ A;  3VH3 B;  5BYQ A;  2GS0 A;  4PS7 A;  1MIZ B;  1MI1 A;  2RSU A;  3VTV A;  1KLU D;  3NZS A;  1ST7 A;  1UWX A;  4BKG A;  5C79 A;  5JP4 A;  2V3P A;  2Z0Q A;  5AZH A;  4KZ0 A;  4E3C A;  1J0G A;  2INP E;  5L95 C;  2KFK B;  1W1G A;  2QDF A;  2EMT A;  3ZDM C;  5HHD G;  3CWI A;  2COD A;  4Q2J A;  3L08 A;  2DKQ A;  1BTK A;  1R7S A;  3EA6 A;  4ITK A;  2WXO A;  3E9O A;  3EUB 2;  3KZ1 A;  1JRP A;  1NYQ A;  2KYW A;  1I4Q A;  3HQC A;  1ACC A;  3ZNG C;  4W9L A;  3ULB A;  3PLV A;  1R4M B;  2MBQ A;  1TY2 A;  3VTU A;  5J3Y A;  3JW0 X;  2Y7B A;  4KVG B;  3KW5 B;  2L3Z A;  2JPH A;  4I6P A;  4BAX A;  3V05 A;  3DBR B;  2GBK A;  2DX1 A;  4B0E A;  4LNI A;  3T9L A;  3KYD D;  5D6J B;  2M19 A;  3FIL B;  2RLO A;  3RYT A;  4W9H A;  4LK0 M;  3B77 A;  5EE0 A;  2FUH B;  2J0M A;  2K00 A;  1XX0 A;  2Y3A A;  3CMM B;  5L81 A;  1PLS A;  1HZ5 A;  1SIJ A;  1MHH E;  2N0S B;  3NZ3 A;  4FJZ A;  1PFJ A;  3HHM A;  2KFK A;  4NJC A;  2QKL A;  3BK1 A;  2P0F A;  3BYY B;  4NY0 A;  2BYV E;  1KZ7 A;  1UNQ A;  3DXC A;  3IXS A;  4BBN F;  1G6J A;  4ANX A;  3JYU A;  2MWS B;  4CHM A;  2L32 A;  4LCD E;  4DHJ D;  1W1D A;  2DZJ A;  3B9J A;  2G1E A;  3DHH C;  5C16 A;  4JKF A;  4IWQ A;  1GC7 A;  3OAN A;  3AUL A;  4K17 A;  2KWV B;  3UI3 A;  3N1Y C;  4ZRI A;  4AJW A;  1ZDV A;  2P0H A;  2GB1 A;  5DH9 B;  3PPA A;  1WY8 A;  5DPW A;  2DHI A;  3FIL A;  2DZM A;  3RUL A;  1Y5O A;  1TIF A;  3AE6 B;  3DCG A;  1VDV A;  3HUI A;  2KWC A;  2DTC A;  1XKE A;  1FRD A;  2Z59 A;  1C77 A;  3V3X A;  3G9W A;  1YJJ A;  3UZT A;  4HPP A;  1NEK B;  3VR8 B;  2WHI A;  2BS4 B;  1EUV B;  3WA0 A;  2ASQ A;  1N6Z A;  4ZYN A;  4G11 A;  4YL8 A;  2KC2 A;  2W2X C;  1MVK A;  2VRW B;  1X11 A;  4WAF A;  3ENB A;  2SAK A;  3ML8 A;  1Q67 A;  1OGW A;  3AMZ A;  3ALB A;  3W9C B;  2I5C A;  1JWA D;  2PPH A;  4HWI B;  1XR0 B;  4K81 A;  4X57 B;  2FAZ A;  2QEJ C;  5HE3 A;  2JRH A;  2JWZ A;  3T3N A;  1U5D A;  3LJ3 A;  4ANU A;  4HK2 A;  2KDE B;  3VVW B;  2UVM A;  2K2U A;  4YWG G;  1P98 A;  2D9Y A;  1HB8 A;  3UIP B;  5D3I B;  2VH1 A;  3UGB B;  1WX8 A;  4KV2 A;  4MDK E;  4M02 A;  4JKD A;  1LB1 A;  2LVQ A;  3GE8 C;  2BWF A;  1AQC A;  2L1C A;  2MWN B;  2Z13 A;  4BKS D;  3E9S A;  1D4B A;  3FP5 A;  4GXB A;  3V5W A;  3RD2 A;  1Q1O A;  4I6L B;  1U29 A;  2MKR A;  3IG3 A;  2Z0O A;  3WAO A;  3IVF A;  2PW9 A;  1HZ6 A;  3AE9 B;  4JKG B;  3KRW A;  3ZGZ A;  4REZ A;  2ABD A;  1WGK A;  2M0A A;  1KTK A;  2AQ1 B;  3AU4 A;  3L13 A;  1UZX B;  3DBL B;  1B55 A;  4L2Y A;  4A6Q A;  2Y5P A;  3M62 B;  4II2 B;  1GB4 A;  1F9J A;  1L4Z B;  3A9J A;  2N4F A;  1DGJ A;  4DXG A;  2ACZ B;  5FI1 A;  1C3T A;  1TYG B;  5DIF B;  4A55 A;  1L0X B;  2K2J A;  1T5X D;  2BGF A;  4JPS A;  2DHJ A;  2EMS A;  3BII D;  1WIA A;  1KFY B;  2KAN A;  1XF5 L;  4C80 A;  2KIE A;  1RRB A;  1VLB A;  5EDS A;  4IOY X;  2WQY B;  1KRH A;  5IN7 A;  4MSM B;  3CIK A;  4II3 B;  1YJI A;  4K7U A;  3AE3 B;  1JRU A;  3A9K B;  4IWP A;  4RGT A;  2WXL A;  3GOE A;  2KJH B;  4KDL B;  2FE8 A;  3N1X C;  4D2K A;  1RJ2 A;  3F0W A;  3P4R B;  3PSE B;  1ESF A;  3ZRF A;  2KUP A;  4HPM B;  1RM6 C;  1UD7 A;  4HB2 B;  2KQ7 A;  4BKT A;  2JY6 A;  3RNF C;  3ML9 A;  4WVF B;  2IBI B;  2DYQ A;  2WXM A;  4JWS C;  1IGD A;  4NAW B;  2NPT B;  2BKF A;  4HAY B;  1X1G A;  2DBY A;  2GI9 A;  3DHG C;  2K8H A;  2ZVN A;  3ODW A;  1WGQ A;  1PMS A;  2AQ2 B;  2KIG A;  1J7B A;  2KTR B;  2PJH A;  4ARI A;  1GB1 A;  5G2N A;  1KLG D;  3ZIM A;  1L4D B;  2BF8 B;  2E2X A;  1WYW B;  2O6V B;  2BB6 A;  3ECI A;  1U5E A;  4E71 A;  1WJ4 A;  2WXG A;  4A8X C;  4AP4 C;  2LMC A;  2GUM A;  5LON B;  2CHW A;  4KGS A;  2K3U A;  1FXT B;  1C79 A;  2NCN A;  1WJN A;  2WGS A;  2NR2 A;  1AAR A;  2R0D A;  3T3O A;  3AU5 A;  4IKG A;  2LAS A;  2KX0 A;  4FAD A;  4AOF A;  3MHZ A;  2IY1 B;  5D2M B;  3P42 A;  2DHZ A;  5BYS A;  1JDE A;  4NAW A;  2NPT A;  3Q3N C;  1JRO A;  2QSD A;  3O65 B;  1UUP A;  3SFE B;  5JHA A;  1KH0 A;  4FHK A;  1YOV B;  3AEA B;  4XX5 A;  2KJR A;  1I2H A;  1J7A A;  2PKO A;  2JXX A;  2O6V A;  3NHE B;  3SNH A;  3P6A A;  4RCO A;  2YVC A;  3UIN B;  4ILH A;  2OHF A;  1I4X A;  3PGE A;  3R8B A;  2ADZ A;  3HVZ A;  4AQ7 A;  1E8X A;  3AEC B;  4KHO A;  3DCX A;  4W9I A;  1EGX A;  1FPY A;  1TKE A;  1TTN A;  3BIN A;  4P1B C;  3R7R A;  3I5J C;  2MEK A;  1YN3 A;  4BOS C;  1EU4 A;  2FJ9 A;  3AEE B;  5DHF B;  1R4M I;  3H8H A;  5JVL A;  1DYQ A;  2JRI B;  2BPS A;  2PVO D;  4DX9 0;  2NS5 A;  3L10 B;  3PRM B;  3P4S B;  3DVG Y;  1TY0 A;  1JQ4 A;  3ZDT A;  2GCJ A;  4D0N B;  4IUM B;  3H7P A;  1WGR A;  4YSY B;  2X18 A;  4DDG D;  3B08 A;  2BYT A;  1WFY A;  1YN5 A;  3WYF B;  2A5U A;  2MBB B;  1ISN A;  4A3P A;  3PRZ A;  3VTW A;  3C19 A;  1QQG A;  2KJ6 A;  3NS8 A;  1JAL A;  4C7Z A;  3UF8 A;  4N6E B;  3U8Z A;  4NPN A;  2LXA A;  1IUE A;  1VCB A;  5BYR A;  1IBX B;  3L0W B;  2I1J A;  5HE2 A;  1OQY A;  3GZN I;  1D3Z A;  4DXA B;  2KQ4 X;  4HAU B;  3ZTD A;  1GC6 A;  4M01 A;  2K8C A;  2LD9 A;  3P4Q B;  1ACA A;  4A9A A;  4DX8 A;  2W2W A;  1P9D U;  2L52 A;  4HDQ A;  4TKN A;  2G35 A;  3QWM A;  3B0A A;  1FNV A;  4GMX B;  4FLH A;  3H6N A;  3D8F A;  4W9C A;  1XD4 A;  2P0D A;  4KZC A;  2W82 A;  4WJQ A;  4HDO A;  2AL6 A;  1ZE3 D;  2WXK A;  3AXC A;  4NQL B;  2DYN A;  4XZ4 A;  4MEM A;  2DEN B;  1V5U A;  3I3T B;  3ZJU A;  2DAF A;  1ZYI A;  3ABV B;  3L4P A;  2LVP A;  1AYF A;  3IHP C;  3TEZ A;  4KX6 B;  4MK0 A;  2N1W A;  1PFD A;  1Y56 A;  2HE7 A;  3H7S A;  2IPK D;  2OOB B;  2GMI C;  1IBX A;  5D3X A;  2UZR A;  2J42 A;  3RPF C;  2QC8 A;  3AB5 A;  4HCN B;  3PHX B;  2LFI A;  2V1Y A;  4C00 A;  4NJ6 A;  2FNJ B;  3W2D A;  2N0Y A;  2KD0 A;  4NJ7 A;  2PIA A;  2MBE A;  2R82 A;  2AQ3 B;  2RUK B;  2Z14 A;  1VR9 A;  2QCZ A;  3Q8F A;  4A6H A;  3PT2 B;  1RWS A;  2VKI A;  1RFK A;  4WJN A;  2JYE A;  1MJD A;  2CJO A;  1X1M A;  3TBL D;  4S0R A;  2E3T A;  4JX1 C;  1DDW A;  1YQB A;  3P7Z A;  5E6O A;  2KLG A;  1J7C A;  2XEW A;  1K51 A;  2ZVO A;  3VUW A;  3OJ3 A;  2FCS A;  4R3D A;  4WJP A;  4TQ0 A;  3A98 B;  4WJO A;  3ZXR A;  1WGY A;  1J0W A;  2N9P C;  1IYF A;  1T6B X;  3H1U A;  4M8M A;  1ZKH A;  1K5D B;  1XEE A;  3DDC B;  2V76 A;  2QHO A;  1IP9 A;  3KUZ A;  4HCP B;  1T0Q C;  2KO3 A;  3A1Q B;  1WE7 A;  3PG7 A;  2V4L A;  4US9 A;  3MJW A;  4K7S A;  4W9J A;  2MDX A;  5JLJ B;  3B2G A;  3U52 E;  2LJ5 A;  1QZE A;  2DNF A;  1WE6 A;  2KDM A;  1K5G B;  2WXH A;  3UQB A;  2OTX A;  2RDB C;  3ZNI D;  2MP2 A;  3P2B A;  4B9K A;  2K39 A;  2H7E A;  4URK A;  2D4Q A;  2DKP A;  3A58 A;  5FR6 A;  3AI5 A;  2J0K A;  1F0Z A;  1FOE A;  1FGZ A;  1QC6 A;  3NW8 A;  4KIK B;  2VH2 A;  1CQV A;  1TZ1 A;  4KGR A;  1EM7 A;  2CJN A;  1GG3 A;  2FCN A;  2Z0P A;  1VZ8 A;  3URY A;  4PS3 A;  2N9X A;  1SE2 A;  5DHA B;  4ZRP A;  1Z2M A;  4BFR A;  1ZVR A;  4LNN A;  5LG4 B;  4GIV A;  2FJU B;  5AEK B;  4C0A A;  3NOB A;  1ZXI A;  3A1Q A;  4J3O D;  3ZQ4 A;  2RQ1 A;  2KMM A;  2I1K A;  2ZW0 A;  2BS3 B;  3SHQ A;  2OJW A;  4PNK A;  3RFZ B;  2H7D A;  2Y8G A;  4XGA B;  2NBU A;  4WIP A;  4QJ3 B;  1MPH A;  2DZI A;  4EOY A;  4LNO A;  3ZJT A;  4YSX B;  1N60 A;  3E9P A;  3C8Y A;  2N9L A;  2ONQ A;  3HVD A;  2ZNV C;  4OZC A;  3FEH A;  3VH4 B;  3LJU X;  2L7R A;  4KIK A;  1UNR A;  2JU6 X;  4K3C A;  5AUI A;  3RZF A;  3PTF C;  2BCJ A;  1DBH A;  2MBO A;  2NMB A;  3HIE A;  4HB0 B;  2GBM A;  1VBG A;  1L0V B;  3N1Z C;  1TS3 A;  2MCN B;  2GRI A;  2D3B A;  4OVU A;  3JVZ X;  3ZXV A;  4HKZ E;  3PVU A;  2FUG 1;  2KR0 A;  1QOF A;  2J59 M;  3OJ4 B;  2Z59 B;  5J3T A;  1P6S A;  1FFV A;  1DOX A;  2GBN A;  5H8Y E;  1SHC A;  4KHA A;  3RNC C;  5DPR A;  4YXD B;  1KC7 A;  2IFS A;  1STE A;  3SU8 X;  2XNA C;  2WDV B;  1A70 A;  1UPQ A;  2KQS A;  4FN2 A;  4P1C C;  2CKH B;  2H89 B;  1MHX A;  2IGH A;  4LJP B;  1UEF A;  1XCG A;  2BW2 A;  3GZN B;  4WJ7 A;  2KOX A;  4GOU A;  4KSK C;  3PS6 A;  1OY2 A;  1XT9 B;  2R2O A;  1E7P B;  2WX1 A;  3F5R A;  1WXS A;  3Q6B A;  3ZVV A;  3TIX A;  2IYD B;  5L83 A;  5FKA C;  4YSZ B;  3PVW A;  2K8B A;  1TBE A;  3VHT C;  1WXQ A;  4RMA A;  5EFX A;  4RGN A;  1EO6 A;  2B76 B;  2W9N A;  3ZYY X;  1KBL A;  4CHJ A;  4ZRQ A;  1UEL A;  1MPE A;  3CIR B;  3DVN V;  4GOC A;  3KUC B;  3DHI C;  3SV1 A;  3OAW A;  3ZTC A;  1H10 A;  2W3R A;  4AUQ C;  4YON A;  5C5B B;  4J6I A;  3HRD D;  1YX5 B;  3ZO5 B;  4B95 A;  1PGA A;  4BKS A;  1MFW A;  3NVY A;  4F7U P;  4FHJ A;  1V6E A;  1JML A;  2MW5 A;  3PLU A;  4ICV A;  2W54 A;  2KZR A;  1FXI A;  1BUI C;  2LI5 A;  1WJ6 A;  4IM3 A;  1KJT A;  3CXB B;  3R2I A;  5D3W A;  1C4P A;  2FDQ A;  2LVO A;  2V0G A;  4GMV A;  4K2O A;  1N62 A;  1E8Z A;  1XD3 B;  4I6N B;  4W9D A;  2WXI A;  3ZVR A;  4MM3 B;  1HBK A;  3ZKJ C;  3EPY A;  4QXA B;  1XCT L;  3TSS A;  4DIX A;  2ICI A;  4GLS C;  1T3Q A;  2BYE A;  3R66 C;  1HXY D;  3Q2A C;  3S2A A;  4W9F A;  2KUQ A;  3RNA C;  1FAO A;  3M63 B;  2I2Y A;  2WH5 A;  4DWF A;  1XLP A;  3T8M A;  2COC A;  4B6H A;  3R3M A;  1PQS A;  1UBQ A;  3WAP A;  1LW3 A;  4IDI A;  2Q5W D;  4MH0 E;  2WDR B;  5C5B A;  4D6W A;  3QAQ A;  2IZV B;  1QOA A;  3A9J B;  1PUT A;  3PRE A;  3NUH B;  4HB3 B;  2GCL A;  4YTN B;  4F7G A;  2EKE C;  1AW7 A;  2HJ8 A;  4W9G A;  2IND C;  1E8W A;  3DOW A;  5AZG A;  2JZ3 B;  2ROZ B;  2IO0 B;  4KDI C;  1N3H A;  2KCJ A;  3TMP B;  1OTR B;  2Z0D B;  4YTM B;  4MM3 A;  2KT7 A;  4WWP A;  1A5R A;  2KWU B;  1XLQ A;  4LTU A;  4H8S A;  3WAL A;  4C56 C;  1FNW A;  2NBW B;  1WJ1 A;  4DDI D;  3ETR A;  1DDV A;  3QA8 A;  5TSS A;  5I2M A;  5KCV A;  1PGB A;  5KHQ A;  3Q3M C;  1ZGU B;  4BBN C;  1TS5 A;  3GP7 A;  4DHZ B;  3E56 A;  2BTE A;  2MSE D;  1QIL A;  3AE4 B;  2RNR B;  4A20 A;  1FHX A;  1V61 A;  2NMQ A;  5C6R A;  2DWQ A;  1WX7 A;  4KHB B;  4OW0 A;  1FFU A;  1FEH A;  2RPQ A;  2LEK A;  1YMH E;  2MBH A;  2WS3 B;  3MC8 A;  3EGR A;  1HEZ E;  2FIF A;  1MIX A;  1YN4 A;  1Z5S B;  5IAA C;  2WXR A;  3IAM 1;  4E74 A;  2COA A;  4FA6 A;  4FBJ B;  4MEL A;  4RF1 A;  4MT5 A;  5T8I A;  2AEH A;  3ZW3 A;  1U2B A;  5D3D A;  2TSS A;  4M00 A;  2NTS A;  1TXD A;  1WR6 E;  3QWZ B;  4YT0 B;  2ZW1 A;  3FLV A;  2NZ8 B;  2IY0 B;  1FIQ A;  1V88 A;  3GS2 A;  4GSW A;  2DA0 A;  5JXV A;  3I9V 1;  1N61 A;  2G3Q B;  4RFB A;  4USA A;  2NTT A;  4ZRK A;  4GDK A;  2QIL A;  1WJU A;  1BXT A;  3NY5 A;  2FJL A;  2WNM A;  1I42 A;  1TJE A;  2G4D B;  1DYN A;  4HLE A;  3AEB B;  3EC8 A;  1D5Z C;  1HTO A;  3GYP A;  1QLB B;  4YTP B;  2ELA A;  3WAN A;  3AE1 B;  3RCZ A;  4KHB A;  1ZSQ A;  4JLC A;  3QJZ A;  3TVV A;  1DDM A;  1ZDX A;  3NVZ A;  5CHV C;  2I5F A;  4A6F B;  5JHG A;  3A4S C;  1I7H A;  3APC A;  4MH8 A;  1S3S G;  3DWG C;  1Y8R C;  3NRZ A;  4FJY A;  2MJD A;  1V5P A;  1CJE A;  3DPD A;  1LM8 B;  4G3X B;  1ZUD 2;  3OWE B;  4N58 A;  2KNB A;  3NWD A;  1PYW D;  4G0N B;  2CU3 A;  2COF A;  5C1Z A;  3L17 A;  1V89 A;  1UNS A;  1PDX A;  5BMI A;  3W5U B;  3ODO A;  2N9K A;  1YQ4 B;  2RD0 A;  2QJL A;  3E66 A;  1ZC4 B;  2YRY A;  2D10 A;  5CLQ B;  2KDF B;  4GDL A;  2K5P A;  4JK7 A;  2CAY A;  2OQB A;  2ZJD A;  3ODX A;  3N20 C;  3AE5 B;  3DWM A;  5JHH A;  3PO0 A;  4WWN A;  2PVG C;  5LNK 1;  4XWW A;  3Q3O C;  4Z2N A;  1J8C A;  3NWA A;  3H7P B;  1D5X C;  1TJ6 A;  1E7U A;  4XC2 A;  2J53 A;  1VZ6 A;  1WX9 A;  1NBF C;  3U4E G;  2CY4 A;  4TQ1 A;  3T06 A;  1WI1 A;  4IC7 B;  4GGQ A;  3B1L X;  4A6F A;  1W1H A;  1OQQ A;  1FB8 A;  1DOI A;  5LXI B;  3RCP A;  3TEX A;  3UQA A;  3MC9 A;  2CQU A;  1VRA B;  4IM0 A;  2LYD A;  3DVN U;  2AX5 A;  4M0W B;  1QKZ A;  4EJN A;  2L1A A;  4OZA A;  4EFO A;  1Q10 A;  1X05 A;  2R2Y A;  2LWP A;  4JIO U;  3WAM A;  2C7H A;  2N7J A;  3N3K B;  5G5H A;  2K49 A;  2BB5 A;  2OJR A;  4JWU C;  1YJ1 A;  1SBB B;  4MGK E;  1YQ3 B;  5J2R A;  1MAI A;  2GOW A;  1DIK A;  2RMM A;  4MJS A;  1F52 A;  3BZD B;  4EUT A;  1FHO A;  2JWU A;  3QHT A;  1R4N I;  2XBB C;  4ZOH C;  2LRU A;  3TO1 A;  2KVZ A;  3Q69 A;  3SYX A;  1JWU D;  1U4A A;  5BMG A;  1SE3 A;  2ELB A;  3RNE C;  1LQB A;  4P6V F;  2JXT A;  2PLP A;  4RGM A;  4ACF A;  4IWO A;  3DQV A;  4M0W A;  2Y5C A;  1TKG A;  2ZCC A;  1V97 A;  1P7E A;  4K2P A;  2M4N A;  2KK8 A;  4WQO B;  2WDQ B;  2KVR A;  4JKC A;  4OVV A;  2CHZ A;  4K3B A;  3BY4 B;  2JT4 B;  4P16 A;  2AYO B;  2D3G A;  2HTH A;  5D7G A;  4C4V B;  4HEA 1;  5DPS A;  2CB8 A;  1NU2 A;  4HSI A;  3LYY A;  4EMO A;  4TMA B;  5KQ1 A;  3OHM B;  4IAP A;  2NVU I;  3DBS A;  4S17 A; 
#chains in the Genus database with same CATH homology
 3PZD A;  4EZL A;  1RRP B;  4JKA A;  3PVL A;  2YS1 A;  1WG7 A;  5LXH A;  5CLL B;  2MRP A;  4HXD A;  3SUZ A;  3TCA A;  2KN5 A;  3L16 A;  2EC1 A;  1XOD A;  4IW0 A;  2BYF A;  1X1F A;  3PEG A;  3VQI A;  3R7Q A;  1X86 A;  2M17 A;  3TJP A;  2DFK A;  1GJZ A;  3PHW B;  2D11 A;  2DYO A;  2AL3 A;  3SBG A;  2MP2 B;  1P1A A;  1EF5 A;  2KXJ A;  3MDB C;  2M38 A;  2YS5 A;  5J17 A;  2LBB A;  4BBK A;  5D3V A;  4JKB A;  2ZCB A;  2J0J A;  1Z87 A;  2A4Z A;  1CMX B;  2XK5 B;  2L76 A;  3EFU A;  3M1I B;  1P3R A;  2REX A;  4F7Z A;  3TW1 A;  2BKR B;  1U27 A;  1WM3 A;  2PE9 A;  3ZUN A;  4DHJ B;  1LXD A;  2KMA A;  1WI0 A;  3SBT A;  3PRP B;  3K9P B;  1KI1 B;  2WX0 A;  1NTI A;  3GYO A;  5J3Q A;  1TQZ A;  2WWZ A;  1OQN A;  4EZK A;  4HHV A;  3KRX A;  1ZW7 A;  3RT3 B;  2N23 A;  3KY9 A;  1KM7 A;  5CX3 A;  2ZZP B;  1WGH A;  3ONS A;  4GPT B;  4HVB A;  4F8C B;  4PS8 A;  2DIK A;  4LDT D;  2DX5 B;  2XK5 A;  3VDZ A;  3IFW B;  1L7Y A;  2WDT B;  3CST A;  1WF9 A;  2YT1 A;  1V5T A;  4MGY E;  3HM6 X;  1C1Y B;  3V6E B;  4L6E A;  2L2I A;  1GUA B;  2Z0E B;  3KH0 A;  4MY6 A;  4DBB A;  3V6C B;  4Z2M B;  1Q5W B;  2GBR A;  5GMV A;  1BTN A;  3PV1 A;  2G45 B;  2L8J A;  5HE1 A;  5KQ4 A;  3QAR A;  3M3J A;  2KKC A;  3V60 A;  2DYB A;  5JH5 C;  5LOP B;  2RVB B;  3DXD A;  1RLF A;  2DX5 A;  2QKM A;  1WJM A;  3RZW C;  1S1Q B;  2LOX A;  2YSZ A;  2D2Q A;  1H4R A;  4XWX A;  4NNJ B;  2C7N B;  1EVH A;  2DZK A;  3APF A;  4CHK A;  5DPT A;  2J7Q B;  5FI0 A;  2LRW A;  2XQN M;  1YIW A;  5CHW A;  3HM3 A;  1V80 A;  2M0X A;  3NZU A;  2K6D B;  4ZDV A;  4EZJ A;  3TL5 A;  4BOZ B;  1RFA A;  2LG1 A;  1MK7 B;  4HJK A;  2COP A;  3PP2 A;  3QBV B;  4PQ0 A;  2ZEQ A;  1HB6 A;  1NVL A;  3VIA A;  4TYZ A;  1V81 A;  2Y5B B;  1M94 A;  1KOT A;  3DVG X;  1UPR A;  1KZG A;  1BWN A;  3QCA A;  2W2X D;  3FSS A;  2LXC A;  5JHB A;  3C0R B;  5DCN A;  2Q13 A;  3A33 B;  1WMH B;  4MGZ E;  4JK9 A;  3VUY A;  1TGZ B;  4ILJ A;  2KHW B;  4HAZ B;  3KYC D;  2N7D A;  2M14 A;  1GGO A;  1WR1 A;  2C7M B;  4EKU A;  2JP2 A;  4PYZ A;  5E6P A;  2RGN B;  3WIM A;  4NQK E;  2L0F A;  2VRR B;  4DHZ E;  3L54 A;  5E6N A;  1V5M A;  3QK0 A;  3KSY A;  3BJI A;  2WYQ A;  2YF0 A;  3X23 A;  5CTR C;  1SGH A;  1GNU A;  4FJV B;  1XQQ A;  4HAX B;  3W1S A;  1WMH A;  3V62 A;  4KAX B;  2LGY A;  2B3A A;  2DYM A;  3O96 A;  2ROV A;  4GN1 A;  1WXA A;  1P5T A;  5AZF A;  1SE9 A;  2JVC A;  2M1M A;  3DXE A;  4P7I A;  2N9E B;  1WM2 A;  3FM8 C;  4Y94 A;  3VUX A;  5J18 A;  1MG8 A;  2RGF A;  2MX2 A;  1ZM0 A;  1ZC3 B;  1U5F A;  3ZNZ B;  2N1V A;  4GDK B;  4EEW A;  3ENE A;  4IM2 A;  1V2Y A;  3ZLZ A;  4HPL B;  2IO1 B;  2YS3 A;  4W9K A;  2KC1 A;  2L00 B;  3MTN B;  2GBJ A;  2UZS A;  2EJ8 A;  2NBV B;  4CO7 A;  1UH6 A;  4GB9 A;  4F7H A;  5D94 A;  2R09 A;  4BVU C;  4CYE A;  1IRS A;  1BAK A;  1WVH A;  2P8V A;  3JSV B;  2C5L C;  3APD A;  2PE6 B;  1FGY A;  3SO6 A;  2PEA A;  1NI2 A;  1V9J A;  4M8N A;  4ZRJ A;  2CHX A;  4MGI E;  2HRJ A;  3N7C A;  1K8R B;  4GDL B;  3D32 A;  3PSC A;  4ICU A;  4W9E A;  2LGX A;  5LLI A;  4JL9 A;  5D3Y A;  2PZ1 A;  1YX6 B;  3Q3J A;  4AWJ A;  5G55 A;  4HAT B;  1WZ3 A;  4JKG A;  2KFJ A;  2LUE A;  1DRO A;  1EF1 A;  1WGG A;  1E90 A;  2V3S A;  3JSV A;  3W1S C;  4AJY B;  4MT7 A;  3W1Y A;  4RM8 A;  3HIZ A;  1L2N A;  3D8D A;  1VBH A;  2G4S A;  2MFQ A;  2CS4 A;  3N30 A;  1YD8 U;  1OMW A;  3U30 A;  1E8Y A;  1M7R A;  2GJY A;  2X0S A;  3A9K A;  1E5W A;  5DI9 B;  3VFK A;  2LKO A;  3NSU A;  1SIF A;  1WH3 A;  3Q3F A;  4JQW C;  2YLM A;  2BWE S;  4DBG A;  2MLB A;  2O2V B;  4MJS B;  3VOQ A;  3A8Q A;  1U5G A;  4DK5 A;  1V86 A;  2UYZ B;  2DLW A;  2RR9 A;  4JKE A;  1AWE A;  2D9Z A;  2KTR A;  2IYB A;  5IJM A;  2KLC A;  4A3O A;  4PYU A;  4HB4 B;  1OEY J;  3QX1 A;  2CR5 A;  1NTY A;  2FID A;  2D9V A;  2HTH B;  1WGU A;  2DN6 A;  3UIO B;  3E9L A;  1NTV A;  2LOZ A;  4GZU A;  3K9O B;  4A6K A;  1T0Y A;  4JGH B;  3OLM D;  4WAA A;  2O2V A;  5C23 A;  3HW2 B;  3H9D A;  3CSF A;  4F1S A;  3MPX A;  5GOW B;  1WRD B;  3DBR I;  1IPG A;  2KX3 A;  3U7D A;  4A5K A;  1Q0W B;  3ZRC A;  4ANV A;  2AWT A;  4TUU A;  2K25 A;  3QIJ A;  2CY5 A;  5BO4 B;  3ZNH B;  1BT0 A;  1LFD A;  2LZ6 A;  1E7V A;  2D9W A;  1MK9 B;  3TFM A;  1V5O A;  3X0W A;  4LDT B;  2O6V D;  3KUD B;  2IO3 B;  2K1F A;  1I35 A;  1J19 A;  3M95 A;  4HAV B;  2C9W B;  3CF6 E;  2MQJ A;  4LJO B;  4B6W A;  4JKH A;  3KVF B;  4IG7 B;  3VAW A;  2DAJ A;  3ML4 A;  4RM9 A;  2ZNV B;  4WSF A;  3AJ4 A;  3ULC A;  2C60 A;  3IBE A;  2Y8F A;  5CHF A;  4NSW A;  1VD2 A;  4G50 A;  3EHV A;  3D8E A;  2FCM A;  2R2Q A;  2ZPN A;  4N9F 4;  2KTF A;  4HAW B;  4ILG B;  2L05 A;  1M7E A;  3MHS D;  2L0T A;  1OEY A;  2CU1 A;  4KSL C;  1RAX A;  2MA9 B;  2UWQ A;  5KHO A;  4IFS A;  5TR5 A;  4JK8 A;  3HK0 A;  1UNP A;  1WZ0 A;  3LDZ E;  2KMC A;  3SDL C;  3V61 A;  5HE0 A;  2K6Q A;  4GU2 A;  2JZZ A;  4WWO A;  2N7E A;  2M8S A;  2ZPY A;  2CRF A;  3N32 A;  5HKH A;  1WXV A;  1I7A A;  5JZE B;  5D27 A;  2YT0 A;  2D07 B;  4ANW A;  2LGD A;  2D9X A;  2RSG A;  2FCQ A;  2HD5 B;  2KDI A;  2LUL A;  3QC8 B;  4ASW C;  1FHW A;  3DBH I;  4FUL A;  1HE8 A;  2JUO A;  4K7W A;  1Y19 B;  3RUI B;  1H8C A;  2IO2 B;  4MSQ B;  2KGX B;  4K1R B;  1MKE A;  5IA7 A;  3A4R A;  1P3Q U;  2KDB A;  3DBL I;  4TV3 A;  1WGD A;  3A8P A;  1UGM A;  1KLV A;  1NDD A;  3QQ8 B;  1WXM A;  3EEC A;  2DHK A;  1V49 A;  1UBI A;  1P0R A;  3SD5 A;  3VXW A;  1EAZ A;  2JF5 A;  2VSZ A;  3VH3 B;  2GS0 A;  4PS7 A;  1MIZ B;  2RSU A;  3VTV A;  3NZS A;  1ST7 A;  4BKG A;  5C79 A;  5JP4 A;  2Z0Q A;  5AZH A;  4KZ0 A;  4E3C A;  1J0G A;  5L95 C;  2KFK B;  1W1G A;  2EMT A;  3ZDM C;  2COD A;  3L08 A;  2DKQ A;  1BTK A;  3E9O A;  3KZ1 A;  3HQC A;  3ZNG C;  4W9L A;  3ULB A;  3PLV A;  2MBQ A;  3VTU A;  5J3Y A;  3JW0 X;  2Y7B A;  4KVG B;  3KW5 B;  2L3Z A;  2JPH A;  4I6P A;  2GBK A;  2DX1 A;  3T9L A;  3KYD D;  5D6J B;  2RLO A;  3RYT A;  4W9H A;  2FUH B;  2J0M A;  2K00 A;  1XX0 A;  3CMM B;  5L81 A;  1PLS A;  4FJZ A;  1PFJ A;  3HHM A;  2KFK A;  2QKL A;  2P0F A;  4NY0 A;  2BYV E;  1KZ7 A;  1UNQ A;  3DXC A;  4BBN F;  1G6J A;  4ANX A;  3JYU A;  2MWS B;  4CHM A;  4LCD E;  4DHJ D;  1W1D A;  2DZJ A;  5C16 A;  4JKF A;  4IWQ A;  1GC7 A;  3OAN A;  3AUL A;  4K17 A;  2KWV B;  4ZRI A;  4AJW A;  2P0H A;  5DH9 B;  3PPA A;  1WY8 A;  5DPW A;  2DHI A;  2DZM A;  3RUL A;  1Y5O A;  3DCG A;  2KWC A;  2DTC A;  1XKE A;  3G9W A;  3UZT A;  1EUV B;  3WA0 A;  2ASQ A;  4ZYN A;  4G11 A;  4YL8 A;  2KC2 A;  2W2X C;  2VRW B;  1X11 A;  3ENB A;  3ML8 A;  1Q67 A;  1OGW A;  3ALB A;  2I5C A;  4HWI B;  2PPH A;  1XR0 B;  4K81 A;  4X57 B;  2FAZ A;  5HE3 A;  2JRH A;  2JWZ A;  1U5D A;  3LJ3 A;  4ANU A;  4HK2 A;  2KDE B;  3VVW B;  2UVM A;  2K2U A;  1P98 A;  2D9Y A;  1HB8 A;  3UIP B;  3UGB B;  1WX8 A;  4KV2 A;  4MDK E;  4JKD A;  1LB1 A;  2LVQ A;  2BWF A;  1AQC A;  2L1C A;  2MWN B;  4BKS D;  3FP5 A;  4GXB A;  3V5W A;  3RD2 A;  1Q1O A;  4I6L B;  1U29 A;  2MKR A;  3IG3 A;  2Z0O A;  3WAO A;  3IVF A;  4JKG B;  3KRW A;  2ABD A;  3AU4 A;  3L13 A;  1UZX B;  1B55 A;  3M62 B;  4II2 B;  1F9J A;  3A9J A;  2N4F A;  5FI1 A;  1C3T A;  5DIF B;  2K2J A;  2BGF A;  2DHJ A;  2EMS A;  1WIA A;  2KAN A;  5EDS A;  1RRB A;  4IOY X;  4MSM B;  3CIK A;  4II3 B;  4K7U A;  1JRU A;  3A9K B;  4IWP A;  3GOE A;  2KJH B;  4KDL B;  1RJ2 A;  3F0W A;  3PSE B;  3ZRF A;  2KUP A;  4HPM B;  1UD7 A;  4HB2 B;  2KQ7 A;  4BKT A;  2JY6 A;  3ML9 A;  4WVF B;  2IBI B;  2DYQ A;  4NAW B;  2NPT B;  2BKF A;  4HAY B;  1X1G A;  2K8H A;  2ZVN A;  3ODW A;  1WGQ A;  1PMS A;  2KTR B;  2PJH A;  5G2N A;  3ZIM A;  2BF8 B;  2E2X A;  1WYW B;  2O6V B;  3ECI A;  1U5E A;  4E71 A;  1WJ4 A;  4AP4 C;  5LON B;  2CHW A;  1FXT B;  2NCN A;  1WJN A;  2NR2 A;  1AAR A;  2R0D A;  3AU5 A;  2LAS A;  2KX0 A;  4FAD A;  4AOF A;  2IY1 B;  5D2M B;  2DHZ A;  1JDE A;  4NAW A;  2NPT A;  3O65 B;  5JHA A;  4FHK A;  4XX5 A;  2KJR A;  1I2H A;  2JXX A;  2O6V A;  3NHE B;  3SNH A;  3P6A A;  2YVC A;  3UIN B;  4ILH A;  3PGE A;  2ADZ A;  1E8X A;  4KHO A;  4W9I A;  1EGX A;  1TTN A;  3BIN A;  3R7R A;  4BOS C;  2FJ9 A;  5DHF B;  1R4M I;  5JVL A;  2JRI B;  2BPS A;  4DX9 0;  2NS5 A;  3L10 B;  3PRM B;  3DVG Y;  3ZDT A;  2GCJ A;  4D0N B;  4IUM B;  3H7P A;  1WGR A;  4DDG D;  2X18 A;  3B08 A;  1WFY A;  3WYF B;  2A5U A;  2MBB B;  1ISN A;  4A3P A;  3PRZ A;  3VTW A;  1QQG A;  2KJ6 A;  3NS8 A;  3UF8 A;  3U8Z A;  4NPN A;  2LXA A;  1VCB A;  3L0W B;  2I1J A;  5HE2 A;  1OQY A;  3GZN I;  1D3Z A;  4DXA B;  4HAU B;  3ZTD A;  1GC6 A;  2K8C A;  2LD9 A;  1ACA A;  4DX8 A;  2W2W A;  1P9D U;  4HDQ A;  4TKN A;  2G35 A;  3QWM A;  3B0A A;  4GMX B;  4FLH A;  3H6N A;  3D8F A;  4W9C A;  1XD4 A;  2P0D A;  4KZC A;  4WJQ A;  4HDO A;  2AL6 A;  3AXC A;  4NQL B;  2DYN A;  4XZ4 A;  4MEM A;  2DEN B;  1V5U A;  3I3T B;  2DAF A;  2LVP A;  3IHP C;  4MK0 A;  2N1W A;  3H7S A;  2HE7 A;  2OOB B;  2GMI C;  5D3X A;  2UZR A;  4HCN B;  3PHX B;  2V1Y A;  4NJ6 A;  2FNJ B;  2N0Y A;  2KD0 A;  4NJ7 A;  2MBE A;  2R82 A;  2RUK B;  4A6H A;  3PT2 B;  2VKI A;  4WJN A;  1X1M A;  3TBL D;  1DDW A;  1YQB A;  3P7Z A;  5E6O A;  2KLG A;  2XEW A;  2ZVO A;  3VUW A;  3OJ3 A;  2FCS A;  4WJP A;  4TQ0 A;  3A98 B;  4WJO A;  1WGY A;  1J0W A;  2N9P C;  1IYF A;  3H1U A;  4M8M A;  1ZKH A;  1K5D B;  3DDC B;  2V76 A;  2QHO A;  1IP9 A;  3KUZ A;  4HCP B;  2KO3 A;  3A1Q B;  1WE7 A;  3PG7 A;  2V4L A;  3MJW A;  4K7S A;  4W9J A;  2MDX A;  5JLJ B;  2LJ5 A;  1QZE A;  1WE6 A;  1K5G B;  3UQB A;  2OTX A;  3ZNI D;  2MP2 A;  3P2B A;  4B9K A;  2K39 A;  2H7E A;  4URK A;  2D4Q A;  2DKP A;  5FR6 A;  3AI5 A;  2J0K A;  1FOE A;  1FGZ A;  1QC6 A;  4KIK B;  1TZ1 A;  1GG3 A;  2FCN A;  2Z0P A;  4PS3 A;  2N9X A;  5DHA B;  1Z2M A;  4BFR A;  1ZVR A;  4GIV A;  5AEK B;  3NOB A;  4C0A A;  3A1Q A;  2RQ1 A;  2I1K A;  3SHQ A;  4PNK A;  2H7D A;  2Y8G A;  2NBU A;  1MPH A;  2DZI A;  4EOY A;  3E9P A;  2ZNV C;  3FEH A;  3VH4 B;  3LJU X;  2L7R A;  4KIK A;  1UNR A;  3RZF A;  3PTF C;  2BCJ A;  1DBH A;  2MBO A;  2NMB A;  4HB0 B;  2GBM A;  1VBG A;  2MCN B;  4OVU A;  3JVZ X;  3PVU A;  2J59 M;  3OJ4 B;  2Z59 B;  5J3T A;  1P6S A;  2GBN A;  1SHC A;  4KHA A;  5DPR A;  1KC7 A;  2IFS A;  3SU8 X;  1UPQ A;  2KQS A;  4FN2 A;  2CKH B;  4LJP B;  1UEF A;  1XCG A;  4WJ7 A;  2KOX A;  4KSK C;  3PS6 A;  1OY2 A;  1XT9 B;  2R2O A;  3ZVV A;  2WX1 A;  3F5R A;  1WXS A;  5L83 A;  3TIX A;  2IYD B;  3PVW A;  2K8B A;  1TBE A;  3VHT C;  4RMA A;  5EFX A;  1EO6 A;  2W9N A;  1KBL A;  4CHJ A;  1UEL A;  4GOC A;  3DVN V;  3KUC B;  3SV1 A;  3OAW A;  3ZTC A;  1H10 A;  4AUQ C;  4YON A;  5C5B B;  4J6I A;  4B95 A;  1YX5 B;  3ZO5 B;  4BKS A;  4F7U P;  4FHJ A;  1V6E A;  2MW5 A;  3PLU A;  4ICV A;  2KZR A;  2LI5 A;  1WJ6 A;  4IM3 A;  1KJT A;  3CXB B;  5D3W A;  2FDQ A;  2LVO A;  4GMV A;  4K2O A;  1E8Z A;  1XD3 B;  4I6N B;  4W9D A;  3ZVR A;  1HBK A;  3ZKJ C;  3EPY A;  2BYE A;  3R66 C;  3S2A A;  4W9F A;  1FAO A;  3M63 B;  2WH5 A;  4DWF A;  3T8M A;  2COC A;  4B6H A;  3R3M A;  1PQS A;  1UBQ A;  3WAP A;  1LW3 A;  4MH0 E;  5C5B A;  3QAQ A;  2IZV B;  3A9J B;  3PRE A;  4HB3 B;  2GCL A;  4F7G A;  2EKE C;  2HJ8 A;  4W9G A;  1E8W A;  3DOW A;  5AZG A;  2JZ3 B;  2ROZ B;  2IO0 B;  4KDI C;  1N3H A;  2KCJ A;  3TMP B;  1OTR B;  2Z0D B;  4MM3 A;  4WWP A;  1A5R A;  2KWU B;  4H8S A;  3WAL A;  2NBW B;  1WJ1 A;  4DDI D;  1DDV A;  3QA8 A;  5KCV A;  5KHQ A;  1ZGU B;  4BBN C;  4DHZ B;  2MSE D;  2RNR B;  4A20 A;  1FHX A;  1V61 A;  5C6R A;  1WX7 A;  4KHB B;  2RPQ A;  2MBH A;  2FIF A;  1MIX A;  1Z5S B;  5IAA C;  4E74 A;  4FA6 A;  2COA A;  4FBJ B;  4MEL A;  2AEH A;  3ZW3 A;  1U2B A;  1TXD A;  1WR6 E;  3QWZ B;  3FLV A;  2NZ8 B;  2IY0 B;  1V88 A;  4GSW A;  2DA0 A;  2G3Q B;  4ZRK A;  4GDK A;  1WJU A;  3NY5 A;  2FJL A;  1I42 A;  2G4D B;  1DYN A;  4HLE A;  3EC8 A;  3GYP A;  2ELA A;  3WAN A;  3RCZ A;  1ZSQ A;  4JLC A;  3QJZ A;  3TVV A;  1DDM A;  5CHV C;  2I5F A;  4A6F B;  5JHG A;  3A4S C;  3APC A;  1S3S G;  1Y8R C;  4FJY A;  1V5P A;  3DPD A;  1LM8 B;  4G3X B;  2KNB A;  4G0N B;  2COF A;  5C1Z A;  3L17 A;  1V89 A;  3ODO A;  2RD0 A;  3E66 A;  1ZC4 B;  2YRY A;  2D10 A;  5CLQ B;  2KDF B;  4GDL A;  4JK7 A;  2CAY A;  2OQB A;  2ZJD A;  3ODX A;  5JHH A;  4WWN A;  4Z2N A;  1J8C A;  3H7P B;  1TJ6 A;  1E7U A;  4XC2 A;  1WX9 A;  1NBF C;  2CY4 A;  4TQ1 A;  3T06 A;  1WI1 A;  4IC7 B;  4GGQ A;  3B1L X;  4A6F A;  1W1H A;  1FB8 A;  5LXI B;  3RCP A;  3UQA A;  2CQU A;  4IM0 A;  2LYD A;  3DVN U;  4M0W B;  4EJN A;  4EFO A;  1X05 A;  2LWP A;  4JIO U;  3WAM A;  2C7H A;  3N3K B;  2OJR A;  1YJ1 A;  4MGK E;  5J2R A;  1MAI A;  2GOW A;  1DIK A;  4MJS A;  4EUT A;  1FHO A;  3QHT A;  1R4N I;  2XBB C;  2LRU A;  3TO1 A;  3SYX A;  1U4A A;  2ELB A;  1LQB A;  4IWO A;  3DQV A;  2ZCC A;  4K2P A;  2M4N A;  2KK8 A;  4WQO B;  2KVR A;  4JKC A;  4OVV A;  2CHZ A;  3BY4 B;  2JT4 B;  2AYO B;  2D3G A;  2HTH A;  5D7G A;  5DPS A;  2CB8 A;  1NU2 A;  4EMO A;  5KQ1 A;  2NVU I;  4IAP A;  3DBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...