1GC7A

Crystal structure of the radixin ferm domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 80
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc7A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc7A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc7A01
4TKNA 3DVNV 3TO1A 5KHQA 1E7UA 3QQ8B 2WWZA 2XEWA 4KZCA 1WJNA 5E6OA 5JHBA 3AI5A 2DZJA 2O6VB 4LCDE 3U7DA 3F5RA 3CSTA 1YX5B 2ASQA 5D94A 1TJ6A 3KYDD 4AJWA 4ANWA 4A6HA 4CHKA 1WY8A 3D32A 3Q3FA 3ZIMA 1V9JA 1B55A 1P0RA 1EF1A 2P0DA 3M62B 4W9GA 3SHQA 5DHAB 2UZSA 3LJ3A 2WX0A 1TGZB 4II3B 3IHPC 2BYFA 1ZVRA 3IBEA 3R7RA 4RMAA 2AYOB 2HTHA 3NOBA 2CS4A 1V5TA 1NDDA 2GJYA 3WYFB 3DVGX 3ZRCA 1YJ1A 2NS5A 1NBFC 4MJSB 1SHCA 4ZRJA 2KDBA 2KX0A 2K1FA 4MM3A 2G45B 4IG7B 1MK7B 2D9WA 2KMCA 2KN5A 2M4NA 1P98A 1WH3A 3HIZA 4G50A 4F7HA 1QC6A 2C60A 1NTIA 2HJ8A 2LXAA 2KDFB 4MEMA 5LLIA 2FIFA 1RLFA 1F9JA 3KUCB 5E6PA 4OVVA 2KMAA 3X0WA 3WALA 2DX5B 2L05A 3SUZA 2P8VA 5J18A 1GC6A 3EC8A 1HBKA 2AEHA 1WRDB 4EZJA 2FCQA 5EFXA 2NVUI 2GMIC 5D3XA 4A6KA 4HPLB 4KHBB 2CAYA 2Y5BB 2L1CA 1X86A 4B6HA 1P3QU 1FAOA 1TQZA 2LUEA 1UNQA 4A5KA 1OEYA 3AU4A 2IBIB 4EFOA 4K7WA 1YQBA 4A3OA 3KRWA 1U2BA 3UZTA 3DVNU 5KQ4A 3WAMA 2KD0A 5IA7A 3H9DA 3SNHA 2J7QB 4DDGD 4N9F4 5EDSA 2K25A 1K8RB 3MTNB 2GCJA 4EOYA 1E8XA 1V49A 3VVWB 4KIKB 2OQBA 1EO6A 2AL6A 2YS5A 2V76A 4BBNF 2NCNA 2QKMA 3ECIA 2FCNA 3EHVA 3PV1A 2MA9B 2IO1B 2D9XA 1ZC4B 2D9VA 2KQ7A 1U29A 2JRIB 4MH0E 1V5OA 1NTVA 3ULBA 1TXDA 4K2PA 2KQSA 2GBJA 3NY5A 1E8ZA 4HAWB 1RRBA 1V5PA 5DH9B 2GBRA 2DYBA 2VSZA 2CKHB 2NBWB 3H1UA 1WX9A 2DHZA 3WA0A 4FJYA 2W2WA 1CMXB 4DHZB 4K17A 4LDTD 1N3HA 1WM3A 1WX8A 2ZPYA 2JVCA 1EVHA 2KZRA 1V89A 3CIKA 5D6JB 4B6WA 2M38A 1WE6A 4HAZB 2KC1A 1IRSA 3ZLZA 4BKGA 1IP9A 2KANA 1I7AA 2RSGA 2GOWA 4LJOB 3M1IB 2NBUA 4HJKA 3R66C 2LASA 3UQBA 4TYZA 3PVWA 3HM3A 3ZTCA 1Y5OA 1J0GA 4NPNA 4HATB 2L76A 1WI0A 1V80A 2N1WA 3QWMA 2JY6A 3HM6X 2A4ZA 2K39A 2FNJB 3ODWA 3I3TB 2ZVOA 1ZKHA 4KAXB 2RGFA 4BBNC 2MP2A 5AZHA 5LXHA 1Y19B 2MDXA 3KUZA 4MGZE 1X1FA 5KCVA 3MDBC 1DBHA 3ML4A 1LB1A 1XQQA 2RPQA 4HAVB 4MJSA 4ZYNA 3ZO5B 2KWUB 4HAXB 2W2XD 3T9LA 2LJ5A 2EC1A 2Q13A 4HLEA 3MHSD 3FLVA 1WMHA 2KFKA 1KLVA 1WR1A 2DA0A 1WG7A 2MX2A 1MIZB 1WJ4A 4M0WB 3KYCD 3OANA 2ZNVC 1U5FA 2J0MA 2UVMA 5C79A 4M8MA 4DWFA 1G6JA 1WR6E 2DFKA 2Z0DB 2KNBA 2O2VA 1LW3A 4XWXA 3R3MA 1YX6B 4H8SA 3MPXA 3SU8X 2UYZB 4FHJA 4C0AA 3BINA 2A5UA 1U4AA 5C16A 3APDA 2YSZA 1FXTB 3FM8C 2KLGA 2HTHB 4HWIB 4YL8A 5DPSA 1L2NA 2KTFA 2P0HA 1GG3A 4E74A 1R4MI 3P2BA 2MBHA 4NY0A 2Z59B 2KK8A 4F7UP 3IG3A 1WF9A 2YF0A 4A3PA 1PLSA 3VOQA 4K7SA 3ML8A 2XK5A 2NR2A 5JHAA 3A33B 3D8FA 2VRWB 1WGUA 4MGYE 4GXBA 3V61A 2DLWA 1SIFA 5JZEB 4TQ1A 1DYNA 1FOEA 1GNUA 1WJMA 1A5RA 2ZJDA 2KWCA 3KRXA 2KLCA 2LOZA 3V62A 3IVFA 2LVQA 4KZ0A 2KXJA 3PG7A 4EZLA 1XD4A 4KHOA 1UD7A 4XC2A 2PJHA 2KO3A 2L8JA 5DCNA 1FGYA 4WJPA 4I6PA 2KC2A 2MLBA 3PREA 1YIWA 3QCAA 4BKSA 1EUVB 4FADA 4EMOA 3OLMD 1FGZA 1HB8A 3UIOB 3PVLA 4IOYX 5CHFA 3ZVRA 2D11A 2MKRA 1EF5A 4WWOA 1OQNA 2FUHB 1RJ2A 1XT9B 2LZ6A 1PFJA 3TMPB 2D9YA 1TBEA 2L2IA 1W1DA 5DHFB 2YT1A 1WXAA 2KKCA 1AARA 1UNPA 5CLLB 3SV1A 4BOSC 1XODA 4B9KA 1WM2A 2HD5B 1W1GA 4NAWA 1BAKA 4HCPB 2Z0EB 1NU2A 3DCGA 1WGGA 2LULA 1E8YA 2C7MB 3APCA 5HE3A 3OAWA 3ODXA 3PEGA 1IPGA 3APFA 5L95C 1WJ6A 3CF6E 2D07B 1D3ZA 3L0WB 3P7ZA 1UPRA 2DZIA 3ZDMC 4ZRIA 5J3TA 2BKRB 2REXA 1WJUA 2GCLA 1Z5SB 4AJYB 1JRUA 3ZRFA 1VCBA 5AZGA 2BYVE 2DTCA 2LYDA 2MP2B 1T0YA 2K8BA 3H7SA 3HK0A 3ULCA 3QAQA 3WAOA 4W9HA 4ICVA 2BKFA 1WI1A 1XCGA 2DAJA 1FHWA 1J8CA 1SGHA 1E90A 3AJ4A 2MFQA 1PMSA 4DHJD 1P6SA 4PYZA 4HB0B 1M7EA 3H6NA 1WMHB 2KDIA 2BGFA 2KFKB 1WXSA 4GSWA 2DN6A 4F7ZA 1UBQA 2EJ8A 2X18A 3TFMA 2CY4A 1V88A 1MK9B 3SO6A 2O2VB 2OJRA 4DX8A 3PHXB 4IWPA 2Y7BA 2GBKA 4IAPA 1WXVA 2MCNB 2N1VA 3DXCA 2V1YA 4WJNA 2YLMA 1H4RA 4KVGB 5J2RA 1KZ7A 1U5EA 3DBRI 2C7NB 1AQCA 1C3TA 4L6EA 2ROVA 4CHJA 4WWNA 3PGEA 3ZNHB 1KZGA 3QHTA 3NZUA 4W9LA 2MBBB 1MIXA 1V61A 4OVUA 1XR0B 3W1YA 2W2XC 1AWEA 1WGYA 4D0NB 2O6VD 4NJ7A 2RQ1A 2FJ9A 3PSEB 4IM3A 1XKEA 2B3AA 3D8EA 4FA6A 1FB8A 2OOBB 2XK5B 2CR5A 3CXBB 2YT0A 1TZ1A 2DYQA 2BF8B 3AXCA 1WYWB 2EMSA 1C1YB 4G0NB 2N0YA 4Y94A 1E5WA 1MKEA 1W1HA 4KHAA 1Z87A 2I5FA 3ALBA 4CYEA 3MJWA 4PS3A 2CHWA 1BTKA 4ANXA 1L7YA 1H8CA 2IYDB 2M0XA 4YONA 4HK2A 2J0KA 1WXMA 2WYQA 1OMWA 2L7RA 3VTVA 4WQOB 2HRJA 5FI0A 5C5BA 1OEYJ 2P0FA 1SE9A 2JZZA 1WGRA 2RGNB 4GIVA 3TVVA 2EMTA 4WJOA 5JHGA 2GBMA 4I6NB 4PYUA 2MSED 1P5TA 2R2OA 5L83A 2MRPA 1ISNA 3QK0A 4K81A 4PQ0A 2LVPA 4MDKE 3PP2A 3A4SC 2Z0QA 5TR5A 3UIPB 4W9FA 3VXWA 3ODOA 5DPWA 4DHZE 2MWNB 3QWZB 3PLUA 2ELBA 3UGBB 3VFKA 2LG1A 2XQNM 1MG8A 1PQSA 2C5LC 5FR6A 2VKIA 3UF8A 4HVBA 2YRYA 2RUKB 2IYBA 2ZCCA 5AZFA 2FIDA 4IWOA 2G35A 3PS6A 3V6EB 2G3QB 1RAXA 5CX3A 2BWES 2ZZPB 1DDMA 3QX1A 4F7GA 3M3JA 4NAWB 2KCJA 4DBBA 2LGDA 4JGHB 3RCPA 1OY2A 4GU2A 2DKQA 1WVHA 3K9PB 1Q67A 1NI2A 3ZNGC 4MK0A 4CHMA 1BT0A 4FLHA 2PEAA 3ZTDA 1X1MA 3ZW3A 2K00A 2FAZA 2CODA 4DDID 4DXAB 2DYOA 3RD2A 4ANUA 2COPA 4WSFA 4HHVA 3VQIA 3WAPA 3W1SC 4IM2A 1Q1OA 4K7UA 3GYOA 2NPTA 2CHXA 3T8MA 4XX5A 3HW2B 2Y8GA 2MBOA 1HE8A 3ENEA 4FN2A 5CTRC 5J3QA 3AULA 5C23A 3CSFA 4P7IA 2VRRB 3O65B 4II2B 4URKA 2ZNVB 1WX7A 1WGQA 1Q5WB 1ZGUB 2N9XA 3BY4B 4HAYB 2LGXA 2LRUA 4E3CA 1I35A 3VAWA 2FDQA 4G3XB 3VUXA 5D3WA 4B95A 2K2UA 4WWPA 2DYNA 4NQLB 1LQBA 3PHWB 3VHTC 4F8CB 3A9KA 5D2MB 2KTRA 4X57B 3A8PA 2XBBC 4BVUC 5HE0A 4KDIC 5DPTA 3QBVB 1GJZA 1FHOA 3JW0X 3T06A 1WFYA 2K2JA 3JSVA 3ZDTA 2DKPA 4GOCA 3PRZA 2AL3A 3HHMA 5CLQB 3N3KB 3HQCA 1Z2MA 2E2XA 3A9JA 4CO7A 2IY1B 3TIXA 3N30A 2DX1A 2L3ZA 4ZDVA 2R0DA 2KOXA 5KHOA 1S1QB 4IFSA 3N7CA 2PPHA 4MY6A 3F0WA 3B08A 4JLCA 5JLJB 1NTYA 1V81A 2RVBB 2R09A 2PZ1A 2N4FA 3KY9A 3NS8A 5HE2A 2WH5A 1NVLA 1WZ0A 1ZC3B 2N9EB 4JQWC 2LXCA 1V5UA 2DHJA 1HB6A 3KW5B 3CMMB 1QQGA 4KSKC 3IFWB 2FCMA 3VH4B 2KVRA 4NJ6A 4F1SA 2JP2A 4FJZA 4EZKA 1LFDA 4W9CA 1R4NI 3U30A 3A1QA 4HXDA 1VD2A 2IO3B 4TQ0A 4BBKA 5C5BB 1U27A 4GZUA 2G4DB 4NNJB 3M95A 1LXDA 1UEFA 1WGDA 1J0WA 2Z0OA 3V60A 3PSCA 1E7VA 1I42A 2QKLA 1Q0WB 3DVGY 5LOPB 2DHKA 4A6FA 2WX1A 2I1JA 5DPRA 2IO2B 4GMVA 3TCAA 2BPSA 5IAAC 3JVZX 1XX0A 3AU5A 3EECA 4W9EA 2KJ6A 4EUTA 2EKEC 4WJ7A 3V5WA 2N7EA 4AP4C 4EJNA 1DDWA 1ZSQA 4AWJA 4EEWA 3ZNZB 1BTNA 4K2OA 4FJVB 2UZRA 2IZVB 4ANVA 4BFRA 2DHIA 3PT2B 3W1SA 4DK5A 3NSUA 3UINB 2DZKA 4XZ4A 4A20A 2LD9A 1IYFA 2ZPNA 5LXIB 4JIOU 4GDLA 2DYMA 4IM0A 4W9DA 2MBEA 2KJRA 2NZ8B 1UZXB 2LKOA 1I2HA 2ZCBA 4MSQB 3DDCB 4EKUA 2MBQA 2CY5A 4LDTB 4IUMB 2ADZA 1V6EA 2LRWA 2R2QA 3SYXA 2JPHA 2L00B 1OGWA 2PE9A 2D10A 2NPTB 1K5GB 5J17A 3P6AA 2JUOA 2CHZA 5E6NA 3ML9A 3QIJA 5JHHA 3PVUA 3K9OB 1WJ1A 1S3SG 1ACAA 1V2YA 2LBBA 4GDKA 2COAA 2UWQA 3L13A 1ZM0A 3RT3B 1UNRA 2H7EA 3H7PA 3KSYA 2IY0B 3OJ4B 4HB3B 2K8CA 1LM8B 3VUYA 1UPQA 3RULA 3DBLI 2OTXA 2JZ3B 5KQ1A 4AOFA 5JH5C 1OTRB 5AEKB 5D7GA 2V4LA 4GB9A 3RYTA 1KM7A 1Y8RC 4IWQA 3O96A 5G2NA 3A9KB 4Z2NA 2MQJA 2KWVB 2KTRB 4DX90 1FHXA 3WANA 3NHEB 3S2AA 1ST7A 3M63B 4PS7A 1U5DA 2C7HA 3VTUA 3JSVB 5L81A 3L17A 2RR9A 1X05A 3DPDA 2Z0PA 5LONB 1WZ3A 2PE6B 1UBIA 4IW0A 3A9JB 2D4QA 1WE7A 1X11A 5HKHA 3L08A 3VIAA 3FP5A 2JT4B 3LDZE 4TUUA 3DXDA 3RCZA 1RRPB 2M14A 1H10A 4NSWA 5D3VA 3PLVA 4HB4B 3PTFC 2DAFA 1M94A 1ZW7A 2KX3A 3DQVA 2BCJA 3QA8A 4J6IA 2ROZB 4HB2B 4GPTB 3KZ1A 1TTNA 2K6QA 5J3YA 4G11A 2V3SA 1RFAA 4MGIE 1J19A 2JXXA 3KH0A 3B0AA 2M8SA 3LJUX 3UQAA 2O6VA 2JWZA 3QJZA 2NMBA 5IJMA 2L0FA 1V5MA 1QZEA 3EPYA 2MW5A 5CHWA 2DZMA 3A1QB 2DENB 2CU1A 2KHWB 3C0RB 3N32A 3TJPA 3BJIA 1XD3B 3RZWC 2GS0A 2KJHB 3NZSA 3GZNI 5G55A 3ZKJC 4MT7A 3VDZA 4KDLB 1KI1B 3VUWA 1E8WA 3TL5A 4FULA 5D27A 3GOEA 2BWFA 3DBSA 1MAIA 2ZEQA 1GUAB 2J0JA 2L0TA 4A6FB 2J59M 2RLOA 2GBNA 2LOXA 3ONSA 3L10B 2K6DB 3KVFB 1UELA 4LJPB 4M8NA 4MGKE 4KV2A 2K8HA 4KSLC 4HPMB 3ZVVA 2ELAA 3ZNID 2DX5A 4DBGA 3V6CB 2G4SA 1X1GA 2YVCA 1YD8U 2BYEA 1UH6A 2FCSA 2C9WB 2RSUA 3KUDB 2COFA 2W9NA 2D2QA 2IO0B 4W9KA 2YS1A 2KGXB 2HE7A 1UGMA 3B1LX 4MSMB 2RNRB 2N23A 3RZFA 3QARA 2LVOA 4HCNB 4BKSD 4GDLB 5FI1A 3PRMB 4Z2MB 2CRFA 2JF5A 5DI9B 1OQYA 3FEHA 4JL9A 4GMXB 1U5GA 3U8ZA 1P9DU 1P1AA 4W9JA 2ABDA 5C1ZA 2FJLA 3WIMA 5JP4A 1MPHA 3D8DA 3X23A 4MELA 3RUIB 4TV3A 1DROA 3R7QA 3PPAA 1WGHA 2LI5A 2KUPA 2YS3A 3PZDA 2N7DA 2H7DA 4KIKA 2M1MA 4WVFB 2WDTB 3L54A 5DIFB 2IFSA 4FHKA 5GMVA 4GN1A 1EGXA 2KDEB 2KFJA 4GDKB 4WAAA 4NQKE 2N9PC 3DBHI 4ASWC 1KOTA 3H7PB 1EAZA 2Y8FA 2D3GA 4FBJB 1V86A 3OJ3A 4RM8A 5C6RA 3TW1A 1WIAA 4K1RB 2AWTA 4I6LB 1P3RA 5D3YA 5CHVC 3SDLC 2M17A 2MWSB 1BWNA 3SD5A 3VH3B 4HAUB 2LGYA 4IC7B 3PRPB 3EFUA 3VTWA 3GYPA 2I5CA 2ZVNA 4RM9A 4HDOA 2RD0A 4DHJB 3DXEA 4HDQA 2CQUA 3A8QA 4AUQC 2I1KA 2D9ZA 3FSSA 3QC8B 4PNKA 1DDVA 3DOWA 4W9IA 3A98B 3ZUNA 1KJTA 1M7RA 4E71A 2CB8A 2NBVB 4WJQA 3TBLD 4ICUA 5GOWB 4BOZB 2JRHA 5HE1A 1K5DB 2LWPA 4BKTA 2QHOA 2COCA 3JYUA 4ZRKA 3L16A 1GC7A 3G9WA 3A4RA 4PS8A 4GGQA 5BO4B 3Q3JA
chains in the Genus database with same CATH superfamily
4TKNA 3DVNV 3TO1A 5TSSA 2M56B 5KHQA 1JMLA 5BMIA 1E7UA 3QQ8B 2H89B 4IKGA 2WWZA 1FIQA 2XEWA 1QOBA 4KZCA 1R7SA 2FUG1 2RDGA 1VZ6A 1WJNA 1PGBA 5E6OA 5JHBA 2J4XA 1FO4A 3AI5A 2DZJA 2O6VB 2YEPB 4LCDE 4M0WA 1ET9A 3U7DA 3F5RA 3CSTA 1STEA 1YX5B 2ASQA 5D94A 1TJ6A 3KYDD 4AJWA 3AEEB 4ANWA 4A6HA 4CHKA 3B9JA 1WY8A 4IDIA 3I63C 3D32A 4P1BC 3Q3FA 5GXGB 3RMKC 3ZIMA 2W3RA 1FRRA 1V9JA 1B55A 1P0RA 1EF1A 2K9XA 2Z4DA 2P0DA 3M62B 4W9GA 3SHQA 4XWTA 4L1BA 5DHAB 2UZSA 4P1CC 1I4GA 3LJ3A 2WX0A 1TGZB 4OVZA 4XGAB 3Q6BA 2PIAA 4II3B 2GB1A 3IHPC 2SAKA 2BYFA 1KFYB 1ZVRA 3MJ5A 1NEKB 3B2GA 3IBEA 3R7RA 1SJHD 3AH7A 2LGSA 4RMAA 1QKZA 2AYOB 2HTHA 3NOBA 2V3PA 3SBGA 4YT0B 2CS4A 2J53A 1V5TA 1NDDA 2GJYA 3WYFB 3T3OA 4OT1A 1ZYIA 1N62A 3RNEC 3DVGX 3ZRCA 2Z59A 1YJ1A 2BW2A 2NS5A 2K5PA 1NBFC 4MJSB 1SHCA 2PKOA 4ZRJA 2KDBA 2KX0A 2K1FA 4MM3A 3ZGZA 1NENB 2G45B 4IG7B 2MHJA 1MK7B 2D9WA 2KMCA 2KN5A 2M4NA 2K0PA 1P98A 1WH3A 3HIZA 4G50A 2W3SA 4F7HA 1QC6A 2C60A 4ZYSA 1NTIA 2TSSA 2HJ8A 2LXAA 3N20C 2WXQA 2KDFB 4MEMA 5LLIA 2FIFA 1ET6A 1WRIA 1RLFA 3FC4A 1F9JA 3KUCB 5E6PA 2N9LA 4OVVA 2KMAA 3X0WA 3WALA 3ZXRA 2DX5B 2L05A 3SUZA 2P8VA 5J18A 1GC6A 5G5HA 4JPSA 3TEXA 3EC8A 2OJWA 1HBKA 2AEHA 1WRDB 4R3DA 4EZJA 1QILA 2FCQA 2PMVA 5EFXA 3MC9A 2WS3B 4LNFA 2NVUI 2GMIC 5D3XA 4A6KA 4HPLB 3E9OA 4KHBB 2CAYA 2Y5BB 1GOZA 4FXCA 4HJGE 2L1CA 5C2TB 1X86A 3TSSA 4B6HA 1P3QU 1FAOA 2WXRA 1TQZA 2LUEA 3AE6B 1UNQA 4A5KA 1OEYA 3AU4A 2IBIB 1VJKA 4EFOA 5FR3A 4K7WA 2IDYA 1YQBA 4A3OA 3KRWA 1U2BA 2AQ2B 3UZTA 2WP9B 3DVNU 5KQ4A 3WAMA 4A9AA 1PUTA 2KD0A 4GOUA 2WXLA 5IA7A 3H9DA 3SNHA 2J7QB 1SBBB 3P42A 4DDGD 1TS5A 4N9F4 1T77A 5EDSA 3IXSA 2K25A 2BT6A 1K8RB 4JWUC 3MTNB 3P4QB 2GCJA 1V1PA 4EOYA 1E8XA 1V49A 3VVWB 1SE2A 1L4DB 4KIKB 2OQBA 1EO6A 2AL6A 2L52A 2YS5A 2V76A 4BBNF 2NCNA 2QKMA 1F2RC 3ECIA 2FCNA 3EHVA 3PV1A 2MA9B 3BWUD 2WXKA 1TS3A 2IO1B 2D9XA 2WDVB 1JALA 1ZC4B 2D9VA 2KQ7A 2E3TA 3N1ZC 1U29A 2JRIB 4MH0E 1V5OA 1NTVA 3ULBA 1TXDA 2N9KA 4K2PA 2KQSA 1CK1A 2GBJA 3IT4B 3NY5A 1E8ZA 4HAWB 1RRBA 4C80A 1V5PA 5DH9B 1YJJA 3R8BA 2GBRA 2DYBA 2VSZA 1JWAD 1DIKA 2CKHB 2INDC 3J9CA 2NBWB 3H1UA 1DOIA 1WX9A 2DHZA 3WA0A 4FJYA 2W2WA 1CMXB 4DHZB 4K17A 4LDTD 1N3HA 2JX5A 1WM3A 1WX8A 2AQ3B 1KF6B 3HVZA 4N6EB 2ZPYA 2JVCA 2KIGA 1EVHA 2KZRA 1V89A 3CIKA 5D6JB 4YTNB 1L0XB 4B6WA 2M38A 1WE6A 4HAZB 2KC1A 1IRSA 2LHEA 3ZLZA 4B0MA 4BKGA 1XLQA 3AE5B 1IP9A 2KANA 1I7AA 5JVLA 2RSGA 1KLUD 2GOWA 4LJOB 3M1IB 2NBUA 4HJKA 3R66C 2LASA 3UQBA 4TYZA 1MHHE 3PVWA 3HM3A 1FNWA 4ARCA 3ZTCA 1Y5OA 3CIRB 1J0GA 4NPNA 2ACZB 4HATB 1FXIA 1FPYA 2L76A 1WI0A 1V80A 2N1WA 3QWMA 2JY6A 3HM6X 2A4ZA 4QAYA 2K39A 1SE4A 4JKFA 2FNJB 3ODWA 1E9MA 1LGRA 3I3TB 3Q8AA 2ZVOA 3B2FA 1T5XD 1ZKHA 1RM6C 4KAXB 4LNNA 2RGFA 4BBNC 1T3QA 2MP2A 3NUHB 5AZHA 5LXHA 1Y19B 2MDXA 4KGRA 3KUZA 3AECB 2LHDA 1TJEA 4MGZE 3TEWA 3OG5A 1X1FA 5KCVA 2G1EA 3MDBC 1DBHA 4M01A 3ML4A 1LB1A 1XQQA 1NI3A 2RPQA 4HAVB 1F52A 4MJSA 2W82A 2X0SA 2QSDA 4ZYNA 1BUIC 4NJCA 3ZO5B 2IGGA 1TZOA 1PFDA 2KWUB 4HAXB 3BIID 2W2XD 3NW8A 3T9LA 2LJ5A 2EC1A 4LTUA 2Q13A 4HLEA 3MHSD 3VR9B 3FLVA 1WMHA 2KFKA 1KLVA 1WR1A 2DA0A 1WG7A 2MX2A 1MIZB 3RFZB 1WJ4A 4M0WB 3KYCD 3OANA 2ZNVC 2ONQA 2RDBC 1U5FA 4KKIA 2J0MA 2UVMA 5C79A 4M8MA 4DWFA 2KR0A 4QJ5B 4BAXA 1G6JA 1WR6E 2DFKA 1I4XA 2Z0DB 2JU6X 2W54A 2KNBA 2O2VA 1LW3A 3R2IA 4XWXA 3KQ4A 3R3MA 1YX6B 3SR6A 4H8SA 3MPXA 4JWSC 3SU8X 2UYZB 1UNSA 1YQ4B 4C0AA 4FHJA 3BINA 2A5UA 1U4AA 3VRAB 1A70A 1N5WA 1XF5L 3NVWA 5C16A 3APDA 3Q69A 5BYSA 1MHXA 2YSZA 1FXTB 3FM8C 2KLGA 2HTHB 2LFIA 4HWIB 4YL8A 5DPSA 1L2NA 2KTFA 2P0HA 4ZOHC 3IAM1 1GG3A 4E74A 1TIFA 1R4MI 3P2BA 2MBHA 4NY0A 4OZAA 3C19A 1XCTL 2Z59B 2KK8A 4F7UP 3IG3A 1WF9A 2YF0A 3GP7A 2W55A 4YTMB 4JK9A 4MM3B 2JZPA 4A3PA 4JK7A 1PLSA 3VOQA 4K7SA 3ML8A 3U12A 3HVDA 4OHJA 2ON8A 2XK5A 2NR2A 5JHAA 5BYQA 5I2SA 4C56C 3ABVB 2ICIA 2PVGC 3A33B 3D8FA 1AWDA 2VRWB 1WGUA 1PDXA 4MGYE 4GXBA 3V61A 2DLWA 4LNOA 3NWAA 1TS2A 2LEKA 1SIFA 5JZEB 4TQ1A 1DYNA 1FOEA 1GNUA 1WJMA 3EFCA 1A5RA 2ZJDA 1YN4A 2KWCA 1FNVA 3KRXA 5IRSA 2PLPA 2KLCA 2LOZA 3V62A 3IVFA 2LVQA 4KZ0A 1PGAA 2KXJA 1VBHA 1N63A 3PG7A 4EZLA 1XD4A 4KHOA 1TY0A 3NWFA 1NYRA 1UD7A 4ZHPA 1DOXA 4XC2A 2PJHA 2KO3A 1DYQA 4KGTA 3AV8A 2KAJA 2L8JA 5DCNA 1FGYA 4WJPA 4I6PA 2KC2A 5FK9C 2MLBA 3PREA 1YIWA 2D3BA 1L0VB 1EU3A 3QCAA 4BKSA 1EUVB 4FADA 3P63A 4EMOA 3OLMD 3TEZA 1FGZA 1E7PB 5M4YB 1HB8A 3UIOB 3PVLA 4NZLB 4IOYX 5CHFA 3C8YA 3MFGA 3ZVRA 1V1PB 2D11A 2MKRA 1EF5A 4XDDA 4RF1A 1EWYC 1SE3A 4WAFA 3AE9B 2K3UA 3TEYA 2VZKB 3I5JC 4WWOA 3BZDB 1OQNA 2FUHB 3AE4B 1ZDVA 1KTKA 2JYTA 3BVZA 2DIKA 1RJ2A 3AE2B 1HTQA 1XT9B 2LZ6A 4JKGA 1PFJA 1K51A 3Q8FA 3TMPB 1FEHA 2D9YA 1TBEA 5IN7A 2L2IA 1W1DA 5DHFB 2YT1A 2NMQA 1WXAA 1RYJA 3NVZA 2KKCA 1AARA 1UNPA 5CLLB 3SV1A 3P4PB 3W5VB 5AUIA 4BOSC 4XWWA 5D3DA 1XODA 4B9KA 1WM2A 2HD5B 1W1GA 3DHHC 4NAWA 1BAKA 3V05A 4HCPB 1I4QA 1PGXA 2Z0EB 2JSVX 1NU2A 3DCGA 1WGGA 2LULA 1JRPA 1E8YA 2C7MB 3APCA 1MG4A 2WXOA 5HE3A 3OAWA 2QDFA 4ZRPA 1YN5A 3ODXA 3DWGC 3PEGA 1VDVA 1IPGA 3VRBB 3APFA 5L95C 1WJ6A 3CF6E 2D07B 1D3ZA 1SEBD 5HFYA 3L0WB 3P7ZA 2JYEA 1UPRA 1RWSA 3AE8B 4P16A 3OHMB 2Z14A 2DZIA 3ZDMC 4ZRIA 5J3TA 1FNUA 2BKRB 2REXA 1WJUA 2GCLA 4DQOC 1Z5SB 3IT6B 4AJYB 1JRUA 4L1RA 3ZRFA 4LK0M 1VCBA 1F1HA 5AZGA 1SIJA 2BYVE 2DTCA 2EELA 2LYDA 2MP2B 3AB5A 1T0YA 1P7FA 2WXMA 4MT5A 4HSIA 2K8BA 4LNKA 2WU2B 3H7SA 3HK0A 3ULCA 3QAQA 3WAOA 4W9HA 4ICVA 2BKFA 1WI1A 1XCGA 2DAJA 4JE3B 1FHWA 1J8CA 1UUPA 4Q2JA 1SGHA 1E90A 3AJ4A 2MFQA 1PMSA 3LXFA 4DHJD 1P6SA 4PYZA 1SF0A 4HB0B 1M7EA 1QQRA 3NVVA 4WIPA 4PK1A 3H6NA 1WMHB 2KDIA 2BGFA 2KFKB 1L6UA 1WXSA 4GSWA 5HG2A 3W2DA 2WXJA 2E6XA 2R61A 2DN6A 4F7ZA 3KWVA 1UBQA 2EJ8A 1RFKA 2WNMA 2X18A 3TFMA 1YMHE 4OZCA 2CY4A 1V88A 1ZE3D 1MK9B 1TKEA 3SO6A 2IPKD 2O2VB 2OJRA 3RN9C 4DX8A 3PHXB 4IWPA 2Y7BA 4ARIA 1J7AA 1LO5D 2GBKA 1N5XA 1AYFA 4IAPA 1WXVA 2BS3B 1E0ZA 2MCNB 1PYWD 2N1VA 2X38A 3DXCA 2V1YA 2Z8LA 4YSYB 4WJNA 3SFEB 1SXTA 2YLMA 1FFVA 1H4RA 4KVGB 5J2RA 1KZ7A 2I2YA 3R2TA 1U5EA 5LNK1 3DBRI 2C7NB 1AQCA 3E56A 3AE3B 1C3TA 4L6EA 2ROVA 4CHJA 4WWNA 1ZP0B 3PGEA 3ZNHB 1KZGA 4HKQA 3QHTA 3NZUA 3ZJTA 4W9LA 2MBBB 4UDUC 1T0RC 2NTTA 1T0SC 4C4VA 2GUMA 1MIXA 2Y3AA 1V61A 4OVUA 1TY2A 1XR0B 3W1YA 2WGSA 2W2XC 1AWEA 1V8CA 1WGYA 4D0NB 2O6VD 4NJ7A 3RNCC 4BZAA 2RQ1A 2FJ9A 3PSEB 4IM3A 1XKEA 2B3AA 3D8EA 4FA6A 1FB8A 2OOBB 2XK5B 2CR5A 3CXBB 3ZXVA 2YT0A 1TZ1A 2DYQA 2BF8B 3AXCA 1WYWB 2EMSA 1C1YB 1ACCA 3PZ8A 3RNGC 4G0NB 4L2YA 4JKAA 2N0YA 4Y94A 3NJTA 1E5WA 1MKEA 1W1HA 4KHAA 1Z87A 2I5FA 3ALBA 4CYEA 1WSPA 3OWEB 1ROEA 2QMTA 4LLGM 3MJWA 4PS3A 2CHWA 1BTKA 4ANXA 1D5ZC 4OZBA 1L7YA 1H8CA 3KLSX 2IYDB 2M0XA 3HIEA 2DWQA 1SSNA 4YONA 3TUOA 4HK2A 2KUQA 2J0KA 1WXMA 2WYQA 1OMWA 4C7YA 2L7RA 1XO3A 3VTVA 3DHGC 4ACFA 3Q2AC 4WQOB 1NYQA 4N58A 2HRJA 5FI0A 5C5BA 2L83A 1L6VA 1OEYJ 2P0FA 1SE9A 2JZZA 1WGRA 2RGNB 4GIVA 3B77A 3DBRB 3TVVA 3P4RB 1EM7A 2EMTA 4WJOA 5JHGA 2GBMA 1GB1A 4I6NB 4PYUA 1XEEA 2MSED 1QOFA 3NS1A 1P5TA 2R2OA 5L83A 2MRPA 1ISNA 3QK0A 2RMMA 4K81A 2R82A 1D5XC 3LYYA 4PQ0A 2LVPA 3DBLB 4MDKE 3PP2A 3A4SC 1AW7A 2Z0QA 5TR5A 3DCXA 3FILA 3UIPB 4W9FA 3VXWA 3ODOA 2V4IB 5DPWA 2WXNA 1XLPA 4DHZE 1XLOA 2MWNB 1IGCA 3QWZB 3PLUA 2ELBA 3UGBB 2LGIA 3VFKA 2LG1A 4RNAA 2XQNM 1MG8A 1PQSA 4XYCA 3AM9A 2I38A 4USAA 2C5LC 5FR6A 2VKIA 3UF8A 4HKZE 4HVBA 4JKGB 2YRYA 1L5PA 2G9HD 2RUKB 2IYBA 2ZCCA 4US8A 5AZFA 2FIDA 4IWOA 2WDRB 2G35A 3PS6A 3V6EB 2G3QB 3ZJVA 1RAXA 5CX3A 1WXQA 2BWES 2D3AA 2ZZPB 1DDMA 3QX1A 4F7GA 3M3JA 2MH7A 1C79A 4NAWB 2XNAC 2KCJA 1QOGA 1K52A 2MEKA 3ZYYX 4DBBA 2LGDA 4JGHB 3RCPA 3DWMA 1QOAA 3NZ3A 4ZRQA 1JWSD 1OY2A 4GU2A 1F0ZA 1MVKA 2DKQA 1WVHA 3K9PB 5BYRA 2V3NA 1Q67A 1NI2A 3ZNGC 4MK0A 4CHMA 1MI1A 1BT0A 4FLHA 2PEAA 3ZTDA 1X1MA 3ZW3A 2K00A 2FAZA 1C9FA 2SEBD 3BVMA 2CODA 2VH2A 3Q3NC 4DDID 4DXAB 2DYOA 3RD2A 4M02A 4ANUA 2COPA 1QF6A 4WSFA 4HHVA 2DBYA 3VQIA 3WAPA 3W1SC 2WQYB 2WXHA 2VH1A 4IM2A 1Q1OA 4MH8A 2PVOD 4K7UA 2N0SB 3RPFC 3EUB2 4TMAB 5EE3A 3GYOA 2NPTA 2CHXA 3T8MA 4XX5A 3HW2B 2Y8GA 2MBOA 1HE8A 3ENEA 4FN2A 5CTRC 5J3QA 3AULA 5C23A 4CQNA 3CSFA 4P7IA 3WCQA 5MPOA 2VRRB 2LJIA 3O65B 4II2B 1IUEA 4URKA 2ZNVB 1WX7A 1WGQA 1Q5WB 4ILJA 1ZGUB 4HPPA 3UI3A 2N9XA 3P1MA 3NWDA 2BS4B 3BY4B 4HAYB 2LGXA 2LRUA 4E3CA 2QC8A 1TT5B 3URYA 1I35A 2BS2B 3VAWA 2FDQA 3GZNB 2M0AA 4A8XC 4A55A 4G3XB 3VUXA 5D3WA 4B95A 2K2UA 4WWPA 1OFFA 2QEJC 4WURA 2DYNA 4NQLB 2J42A 3EA6A 3BVGA 3RNBC 3U7ZA 1LQBA 3PHWB 3VHTC 4F8CB 2JXTA 2BYTA 4OW0A 3A9KA 5D2MB 2KTRA 4X57B 3A8PA 2XBBC 1JWBD 4BVUC 3NRZA 5HE0A 1KLGD 1V97A 1E6EB 5H92C 3I57A 4KDIC 5DPTA 3QBVB 4S17A 1GJZA 1FHOA 4RGOS 3NG0A 3JW0X 3T06A 1WFYA 2WXFA 2K2JA 2K49A 2OEDA 3FAHA 3JSVA 3ZDTA 2DKPA 4L23A 4GOCA 2Q5WD 3PRZA 2AL3A 4JX1C 3HHMA 5CLQB 5IKCM 3FKYA 3N3KB 2YEPF 1HA5A 3AEFB 1KH0A 3HQCA 1Z2MA 1N61A 1EWCA 1HXYD 4XDCA 1K53A 2E2XA 4H2AA 3A9JA 1IBXB 2L32A 1ZDXA 4CO7A 2IY1B 1QT9A 3TIXA 3N30A 2DX1A 2L3ZA 4ZDVA 2R0DA 2RRFA 1T6BX 4RCOA 2KOXA 5KHOA 2WDQB 1S1QB 1ZPSA 1YJIA 4IFSA 3KWLA 3AEGB 4C4VB 3N7CA 2PPHA 2KMMA 4MY6A 3F0WA 2GRIA 3B08A 3E9SA 4JLCA 5JLJB 1B1ZA 4NAMA 1NTYA 4AQ7A 1V81A 1B9RA 1L4ZB 2RVBB 2R09A 2PZ1A 2MJEA 1J7BA 2N4FA 3KY9A 3NS8A 5HE2A 2WH5A 2IGHA 1NVLA 1WZ0A 1ZC3B 2N9EB 4JQWC 1GGOA 4KX6B 1I4HA 1XXGA 2LXCA 1V5UA 2DHJA 1HB6A 3KW5B 4N59A 3CMMB 1QQGA 4KSKC 1C4AA 3IFWB 2FCMA 3VH4B 2KVRA 4NJ6A 2OHFA 4F1SA 2JP2A 4FJZA 4QXAB 4EZKA 1LFDA 4W9CA 4RFBA 3MHZA 2BVCA 1R4NI 3U30A 3A1QA 4MACA 2L1AA 3HUIA 4HXDA 1VD2A 2IO3B 4CSQA 4TQ0A 3N1YC 4BBKA 5C5BB 1U27A 5IOIA 1CZPA 4GZUA 2G4DB 4NNJB 3U52E 2GLSA 2AQ1B 1D4BA 4C00A 3M95A 1CQVA 2Z13A 3E9PA 1ESFA 1UEFA 1LXDA 1WGDA 2BTEA 2WU5B 1I4PA 1J0WA 2Z0OA 1HZ5A 3DBHB 2IGDA 3V60A 1TYGB 3PSCA 1E7VA 2QILA 3BYYB 1I42A 2QKLA 1Q0WB 3DVGY 3Q3MC 4RGMA 2DLBA 4XE0A 1D6EC 5LOPB 4J3OD 2DHKA 4A6FA 2WX1A 2I1JA 2CJOA 2R2YA 5DPRA 2IO2B 3FILB 4GMVA 1KC7A 3TCAA 4JKDA 2BPSA 3GE8C 1D5MC 5IAAC 3JVZX 1XX0A 3AU5A 4YTPB 1TKYA 3EECA 4W9EA 2KJ6A 4D6WA 4EUTA 1JWUD 2NTSA 1DOYA 2EKEC 4WJ7A 3V5WA 2N7EA 4AP4C 3IAS1 4EJNA 4GLSC 1DDWA 1ZSQA 4AWJA 1N6ZA 4EEWA 3GE3C 3ZNZB 1BTNA 4S0RA 4K2OA 4FJVB 5IP4D 2UZRA 5G5GA 2IZVB 5BMGA 4ANVA 4BFRA 2DHIA 1HZ6A 1JDEA 2FBWB 3PT2B 4P6VF 4ILHA 1R4NB 1F77A 2WHIA 3W1SA 4DK5A 3NSUA 1P7EA 3UINB 2EKIA 2DZKA 4XZ4A 2V0GA 4A20A 3Q8EA 5AUKA 2B76B 2LD9A 1SJED 3CWIA 1MI0A 2ZPNA 1QLBB 2CU3A 1UWMA 1IYFA 5LXIB 4O1NA 4JIOU 4IOIE 1VLBA 4GDLA 2HDEA 1UGJA 2KT7A 2DYMA 4IM0A 4W9DA 2MBEA 2KJRA 2NZ8B 1UZXB 2LKOA 1I2HA 2ZCBA 2VZKD 4MSQB 1SB3C 1V1OA 1TKGA 3DDCB 4EKUA 2MBQA 4JK8A 2CY5A 1FCCC 4LDTB 4IUMB 3AE1B 2ADZA 2FJUB 1V6EA 2KDMA 3RI7C 2LRWA 1YN3A 4QJ3B 1BXTA 2R2QA 3SYXA 4HRSA 1CJEA 2JPHA 2L00B 1OGWA 2PE9A 4K3CA 4WH4A 2D10A 1VZ7A 2NPTB 1XCQL 1K5GB 5J17A 3P6AA 2JUOA 2K8EA 2CHZA 5E6NA 3ML9A 1F2RI 3QIJA 1YQ3B 1DGJA 5JHHA 3PVUA 3K9OB 1WJ1A 1S3SG 2BQQA 2ZW0A 1ACAA 1V2YA 1IBXA 5E6JA 3V3XA 1GPXA 2LBBA 4GDKA 1NVID 1BMLC 1ZUD2 2COAA 4TSSA 2UWQA 4QJ4B 3L13A 1UWXA 1ZM0A 3RT3B 3T3NA 3N1XC 1UNRA 2H7EA 3Q14C 3H7PA 3KSYA 2IY0B 3OJ4B 4HB3B 1MPEA 2K8CA 1VZ8A 1LM8B 3VUYA 1UPQA 3RULA 3ENBA 3DBLI 2OTXA 4ITKA 1WGKA 2K22A 1UF0A 2JZ3B 5FKAC 3DHIC 5KQ1A 3LB8C 4AOFA 2HJ1A 5JH5C 3H8HA 2H88B 1OTRB 1IGDA 5AEKB 4M00A 1KBLA 5D7GA 2V4LA 4KKJA 4GB9A 3RYTA 1KM7A 1OQRA 1Y8RC 4IWQA 3O96A 5G2NA 3A9KB 4Z2NA 3U2SC 2MQJA 2KWVB 2KTRB 4DX90 1FHXA 2KQ4X 4JKEA 3WANA 3NHEB 3S2AA 4HEA1 1ST7A 3M63B 1FM0D 4PS7A 1U5DA 2C7HA 2INPE 1ZXIA 2KIEA 3VTUA 4JKHA 2CJNA 4PT5A 3U4EG 3JSVB 5L81A 4A6QA 4JKCA 3L17A 4DXFA 2RR9A 1X05A 3DPDA 2NBVA 2BBCA 2Z0PA 5LONB 1WZ3A 1TS4A 2PE6B 4GNKB 1UBIA 1MFWA 4IW0A 2D5GA 3A9JB 2D4QA 4DXGA 1AN8A 1WE7A 1X11A 1J7CA 5HKHA 3L08A 3VIAA 3FP5A 1JQ4A 5HHDG 2JT4B 3LDZE 1N60A 3DXDA 4TUUA 1C4CA 3RCZA 1MJDA 1RRPB 2M14A 1H10A 4NSWA 5D3VA 1OQQA 3PLVA 4HB4B 3PTFC 2DAFA 4LNIA 1M94A 2KVZA 1ZW7A 2KX3A 1Y56A 3DQVA 2BCJA 3QA8A 4J6IA 1EU4A 2ROZB 4HB2B 3GS2A 4GPTB 2BB6A 3Q8CA 3KZ1A 1TTNA 2K6QA 4ILGB 5J3YA 4G11A 2V3SA 1RFAA 4MGIE 2JWUA 1J19A 2JXXA 1YOVB 3KH0A 1GAQB 3B0AA 2M8SA 3LJUX 3UQAA 2O6VA 2JWZA 3QJZA 1ZXHA 2NMBA 5IJMA 2L0FA 1V5MA 1QZEA 4WQMA 3EPYA 2MW5A 5CHWA 2RDHA 2DZMA 3A1QB 2DENB 2CU1A 3ZJUA 2KHWB 3C0RB 2IJ0A 5JXVA 3N32A 3TJPA 3BJIA 1XD3B 1E10A 3RZWC 2GS0A 2KJHB 3NZSA 5I2MA 4YXDB 4JKBA 3L4PA 3GZNI 4A90A 5G55A 1I4RA 2RPVA 3ZKJC 4MT7A 3VDZA 1JWMD 2WXPA 3AE7B 4KDLB 2WXIA 4YWGG 1KI1B 3VUWA 1E8WA 3TL5A 4FULA 5D27A 3HSAA 3AEDB 3GOEA 2BWFA 3GB1A 3DBSA 1MAIA 2ZEQA 4B0EA 1GUAB 2J0JA 2L0TA 2GI9A 2Y5CA 4A6FB 3BK1A 3Q3OC 5EE9A 2J59M 2RLOA 1M4VA 1JCKB 2XN9C 2FE8A 5IO9A 2GBNA 2LOXA 2J52A 3ONSA 3L10B 2K6DB 2D3CA 5EE0A 5C3JB 3KVFB 1UELA 4LJPB 4M8NA 4MGKE 2WLBA 4KV2A 2K8HA 4KGSA 1Q10A 3MP9A 4KSLC 1JW9D 4HPMB 3ZVVA 2ELAA 3ZNID 1KRHA 2DX5A 4DBGA 3V6CB 3NVYA 2G4SA 3HRDD 1X1GA 2YVCA 1YD8U 2BYEA 1FFUA 1UH6A 2X8XX 2FCSA 2C9WB 2RSUA 3KUDB 2COFA 2W9NA 2UU7A 4WWMA 1FRDA 2PW9A 5D3IB 2D2QA 2IO0B 4W9KA 3N9YC 2YS1A 2KGXB 2HE7A 1UGMA 3B1LX 1ENFA 1YNTE 4YSXB 4MSMB 2RNRB 4KHBA 2N23A 3A58A 2KACA 3RZFA 3QARA 2LVOA 4HCNB 4BKSD 4GDLB 5FI1A 1K50A 3PRMB 4AS1A 4Z2MB 4RH6A 3ETRA 2CRFA 2JF5A 2LMCA 5DI9B 2BB5A 3EGRA 1T0QC 1OQYA 3FEHA 2QCZA 4JL9A 4GMXB 1U5GA 3U8ZA 1P9DU 2AX5A 4K3BA 3RNFC 1P1AA 2WXGA 4REZA 2LUMA 1WYGA 4W9JA 2ABDA 5C1ZA 5EE1A 2FJLA 3WIMA 1FCLA 5JP4A 1MPHA 3D8DA 3X23A 4MELA 3RUIB 3AN1A 2KYWA 2MJDA 4TV3A 3VR8B 2N7JA 1DROA 3R7QA 2QIEB 3PPAA 1WGHA 2LI5A 2KUPA 3MC0B 2YS3A 4DIXA 3PZDA 1C77A 3BYTB 2N7DA 1JROA 2H7DA 1VR9A 4KIKA 3AMZA 2M1MA 4WVFB 3E9LA 2WDTB 3L54A 2Y5PA 5DIFB 5LG4B 2IFSA 4FHKA 1VRAB 2ZKMX 5GMVA 4C7ZA 4GN1A 3MC8A 1EGXA 2KDEB 2DNFA 2KFJA 3I9V1 4GDKB 2INNE 4WAAA 3SEBA 4NQKE 2N9PC 3DBHI 4ASWC 5BMHA 1C4PA 4HROA 4RGNA 1KOTA 1C78A 3W5UB 2ZW1A 4RF0A 3H7PB 1EAZA 5HI1A 2Y8FA 2KN4A 2D3GA 3O13A 3RNAC 4FBJB 2HTME 1C76A 1HEZE 1V86A 3OJ3A 4RM8A 5C6RA 3TW1A 4OSNA 1WIAA 4K1RB 2AWTA 4I6LB 3Q8BA 1P3RA 5D3YA 4RGTA 5CHVC 3SDLC 2M17A 2MWSB 1BWNA 3SD5A 2JQRB 3P4SB 3VH3B 4HAUB 2LGYA 4IC7B 1FXAA 2YT2A 3FVCA 3PRPB 1R4MB 2PTLA 3EFUA 3VTWA 2MJ3A 3GYPA 2I5CA 2ZVNA 5H8YE 4RM9A 3AEBB 4HDOA 2RD0A 1HQRD 4DHJB 2V9HA 3DXEA 3PO0A 4HDQA 2CQUA 3A8QA 3SBTA 4AUQC 2I1KA 2D9ZA 3FSSA 3QC8B 4PNKA 1WWTA 1DDVA 3DOWA 1XLNA 4W9IA 1GB4A 4ZHOA 3A98B 3ZUNA 3W9CB 1KJTA 1ZOYB 3BK2A 1M7RA 4E71A 2CB8A 4YSZB 4EE2A 1VBGA 3ZQ4A 2NBVB 4WJQA 3TBLD 1I7HA 3AEAB 5GOWB 4ICUA 2M19A 4BOZB 1L0YB 2JRHA 5HE1A 1K5DB 2LWPA 1FMAD 2KWDA 1HTOA 4BKTA 2QHOA 4D2KA 2COCA 2INCC 3JYUA 4ZRKA 3L16A 3PZ7A 1GC7A 1FD6A 5I4DA 3G9WA 5T8IA 3SFDB 3A4RA 4PS8A 4GGQA 4US9A 5BO4B 2QJLA 3Q3JA 3E66A
chains in the Genus database with same CATH topology
4TKNA 3DVNV 3TO1A 5KHQA 1E7UA 3QQ8B 2WWZA 2XEWA 4KZCA 1WJNA 5E6OA 5JHBA 3AI5A 2DZJA 2O6VB 4LCDE 3U7DA 3F5RA 3CSTA 1YX5B 2ASQA 5D94A 1TJ6A 3KYDD 4AJWA 4ANWA 4A6HA 4CHKA 1WY8A 3D32A 3Q3FA 3ZIMA 1V9JA 1B55A 1P0RA 1EF1A 2P0DA 3M62B 4W9GA 3SHQA 5DHAB 2UZSA 3LJ3A 2WX0A 1TGZB 4II3B 3IHPC 2BYFA 1ZVRA 3IBEA 3R7RA 4RMAA 2AYOB 2HTHA 3NOBA 3SBGA 2CS4A 1V5TA 1NDDA 2GJYA 3WYFB 3DVGX 3ZRCA 1YJ1A 2NS5A 1NBFC 4MJSB 1SHCA 4ZRJA 2KDBA 2KX0A 2K1FA 4MM3A 2G45B 4IG7B 1MK7B 2D9WA 2KMCA 2KN5A 2M4NA 1P98A 1WH3A 3HIZA 4G50A 4F7HA 1QC6A 2C60A 1NTIA 2HJ8A 2LXAA 2KDFB 4MEMA 5LLIA 2FIFA 1RLFA 1F9JA 3KUCB 5E6PA 4OVVA 2KMAA 3X0WA 3WALA 2DX5B 2L05A 3SUZA 2P8VA 5J18A 1GC6A 3EC8A 1HBKA 2AEHA 1WRDB 4EZJA 2FCQA 5EFXA 2NVUI 2GMIC 5D3XA 4A6KA 4HPLB 3E9OA 4KHBB 2CAYA 2Y5BB 2L1CA 1X86A 4B6HA 1P3QU 1FAOA 1TQZA 2LUEA 1UNQA 4A5KA 1OEYA 3AU4A 2IBIB 4EFOA 4K7WA 1YQBA 4A3OA 3KRWA 1U2BA 3UZTA 3DVNU 5KQ4A 3WAMA 2KD0A 5IA7A 3H9DA 3SNHA 2J7QB 4DDGD 4N9F4 5EDSA 2K25A 1K8RB 3MTNB 2GCJA 4EOYA 1E8XA 1V49A 3VVWB 4KIKB 2OQBA 1EO6A 2AL6A 2YS5A 2V76A 4BBNF 2NCNA 2QKMA 3ECIA 2FCNA 3EHVA 3PV1A 2MA9B 2IO1B 2D9XA 1ZC4B 2D9VA 2KQ7A 1U29A 2JRIB 4MH0E 1V5OA 1NTVA 3ULBA 1TXDA 4K2PA 2KQSA 2GBJA 3NY5A 1E8ZA 4HAWB 1RRBA 1V5PA 5DH9B 2GBRA 2DYBA 2VSZA 1DIKA 2CKHB 2NBWB 3H1UA 1WX9A 2DHZA 3WA0A 4FJYA 2W2WA 1CMXB 4DHZB 4K17A 4LDTD 1N3HA 1WM3A 1WX8A 2ZPYA 2JVCA 1EVHA 2KZRA 1V89A 3CIKA 5D6JB 4B6WA 2M38A 1WE6A 4HAZB 2KC1A 1IRSA 3ZLZA 4BKGA 1IP9A 2KANA 1I7AA 5JVLA 2RSGA 2GOWA 4LJOB 3M1IB 2NBUA 4HJKA 3R66C 2LASA 3UQBA 4TYZA 3PVWA 3HM3A 3ZTCA 1Y5OA 1J0GA 4NPNA 4HATB 2L76A 1WI0A 1V80A 2N1WA 3QWMA 2JY6A 3HM6X 2A4ZA 2K39A 4JKFA 2FNJB 3ODWA 3I3TB 2ZVOA 1ZKHA 4KAXB 2RGFA 4BBNC 2MP2A 5AZHA 5LXHA 1Y19B 2MDXA 3KUZA 4MGZE 1X1FA 5KCVA 3MDBC 1DBHA 3ML4A 1LB1A 1XQQA 2RPQA 4HAVB 4MJSA 2X0SA 4ZYNA 3ZO5B 2KWUB 4HAXB 2W2XD 3T9LA 2LJ5A 2EC1A 2Q13A 4HLEA 3MHSD 3FLVA 1WMHA 2KFKA 1KLVA 1WR1A 2DA0A 1WG7A 2MX2A 1MIZB 1WJ4A 4M0WB 3KYCD 3OANA 2ZNVC 1U5FA 2J0MA 2UVMA 5C79A 4M8MA 4DWFA 1G6JA 1WR6E 2DFKA 2Z0DB 2KNBA 2O2VA 1LW3A 4XWXA 3R3MA 1YX6B 4H8SA 3MPXA 3SU8X 2UYZB 4FHJA 4C0AA 3BINA 2A5UA 1U4AA 5C16A 3APDA 2YSZA 1FXTB 3FM8C 2KLGA 2HTHB 4HWIB 4YL8A 5DPSA 1L2NA 2KTFA 2P0HA 1GG3A 4E74A 1R4MI 3P2BA 2MBHA 4NY0A 2Z59B 2KK8A 4F7UP 3IG3A 1WF9A 2YF0A 4JK9A 4A3PA 4JK7A 1PLSA 3VOQA 4K7SA 3ML8A 2XK5A 2NR2A 5JHAA 3A33B 3D8FA 2VRWB 1WGUA 4MGYE 4GXBA 3V61A 2DLWA 1SIFA 5JZEB 4TQ1A 1DYNA 1FOEA 1GNUA 1WJMA 1A5RA 2ZJDA 2KWCA 3KRXA 2KLCA 2LOZA 3V62A 3IVFA 2LVQA 4KZ0A 2KXJA 1VBHA 3PG7A 4EZLA 1XD4A 4KHOA 1UD7A 4XC2A 2PJHA 2KO3A 2L8JA 5DCNA 1FGYA 4WJPA 4I6PA 2KC2A 2MLBA 3PREA 1YIWA 3QCAA 4BKSA 1EUVB 4FADA 4EMOA 3OLMD 1FGZA 1HB8A 3UIOB 3PVLA 4IOYX 5CHFA 3ZVRA 2D11A 2MKRA 1EF5A 4WWOA 1OQNA 2FUHB 2DIKA 1RJ2A 1XT9B 2LZ6A 4JKGA 1PFJA 3TMPB 2D9YA 1TBEA 2L2IA 1W1DA 5DHFB 2YT1A 1WXAA 2KKCA 1AARA 1UNPA 5CLLB 3SV1A 4BOSC 1XODA 4B9KA 1WM2A 2HD5B 1W1GA 4NAWA 1BAKA 4HCPB 2Z0EB 1NU2A 3DCGA 1WGGA 2LULA 1E8YA 2C7MB 3APCA 5HE3A 3OAWA 3ODXA 3PEGA 1IPGA 3APFA 5L95C 1WJ6A 3CF6E 2D07B 1D3ZA 3L0WB 3P7ZA 1UPRA 2DZIA 3ZDMC 4ZRIA 5J3TA 2BKRB 2REXA 1WJUA 2GCLA 1Z5SB 4AJYB 1JRUA 3ZRFA 1VCBA 5AZGA 2BYVE 2DTCA 2LYDA 2MP2B 1T0YA 2K8BA 3H7SA 3HK0A 3ULCA 3QAQA 3WAOA 4W9HA 4ICVA 2BKFA 1WI1A 1XCGA 2DAJA 1FHWA 1J8CA 1SGHA 1E90A 3AJ4A 2MFQA 1PMSA 4DHJD 1P6SA 4PYZA 4HB0B 1M7EA 3H6NA 1WMHB 2KDIA 2BGFA 2KFKB 1WXSA 4GSWA 2DN6A 4F7ZA 1UBQA 2EJ8A 2X18A 3TFMA 2CY4A 1V88A 1MK9B 3SO6A 2O2VB 2OJRA 4DX8A 3PHXB 4IWPA 2Y7BA 2GBKA 4IAPA 1WXVA 2MCNB 2N1VA 3DXCA 2V1YA 4WJNA 2YLMA 1H4RA 4KVGB 5J2RA 1KZ7A 1U5EA 3DBRI 2C7NB 1AQCA 1C3TA 4L6EA 2ROVA 4CHJA 4WWNA 3PGEA 3ZNHB 1KZGA 3QHTA 3NZUA 4W9LA 2MBBB 1MIXA 1V61A 4OVUA 1XR0B 3W1YA 2W2XC 1AWEA 1WGYA 4D0NB 2O6VD 4NJ7A 2RQ1A 2FJ9A 3PSEB 4IM3A 1XKEA 2B3AA 3D8EA 4FA6A 1FB8A 2OOBB 2XK5B 2CR5A 3CXBB 2YT0A 1TZ1A 2DYQA 2BF8B 3AXCA 1WYWB 2EMSA 1C1YB 4G0NB 4JKAA 2N0YA 4Y94A 1E5WA 1MKEA 1W1HA 4KHAA 1Z87A 2I5FA 3ALBA 4CYEA 3MJWA 4PS3A 2CHWA 1BTKA 4ANXA 1L7YA 1H8CA 2IYDB 2M0XA 4YONA 4HK2A 2J0KA 1WXMA 2WYQA 1OMWA 2L7RA 3VTVA 4WQOB 2HRJA 5FI0A 5C5BA 1OEYJ 2P0FA 1SE9A 2JZZA 1WGRA 2RGNB 4GIVA 3TVVA 2EMTA 4WJOA 5JHGA 2GBMA 4I6NB 4PYUA 2MSED 1P5TA 2R2OA 5L83A 2MRPA 1ISNA 3QK0A 4K81A 2R82A 4PQ0A 2LVPA 4MDKE 3PP2A 3A4SC 2Z0QA 5TR5A 3UIPB 4W9FA 3VXWA 3ODOA 5DPWA 4DHZE 2MWNB 3QWZB 3PLUA 2ELBA 3UGBB 3VFKA 2LG1A 2XQNM 1MG8A 1PQSA 2C5LC 5FR6A 2VKIA 3UF8A 4HVBA 4JKGB 2YRYA 2RUKB 2IYBA 2ZCCA 5AZFA 2FIDA 4IWOA 2G35A 3PS6A 3V6EB 2G3QB 1RAXA 5CX3A 2BWES 2ZZPB 1DDMA 3QX1A 4F7GA 3M3JA 4NAWB 2KCJA 4DBBA 2LGDA 4JGHB 3RCPA 1OY2A 4GU2A 2DKQA 1WVHA 3K9PB 1Q67A 1NI2A 3ZNGC 4MK0A 4CHMA 1BT0A 4FLHA 2PEAA 3ZTDA 1X1MA 3ZW3A 2K00A 2FAZA 2CODA 4DDID 4DXAB 2DYOA 3RD2A 4ANUA 2COPA 4WSFA 4HHVA 3VQIA 3WAPA 3W1SC 4IM2A 1Q1OA 4K7UA 3GYOA 2NPTA 2CHXA 3T8MA 4XX5A 3HW2B 2Y8GA 2MBOA 1HE8A 3ENEA 4FN2A 5CTRC 5J3QA 3AULA 5C23A 3CSFA 4P7IA 2VRRB 3O65B 4II2B 4URKA 2ZNVB 1WX7A 1WGQA 1Q5WB 4ILJA 1ZGUB 2N9XA 3BY4B 4HAYB 2LGXA 2LRUA 4E3CA 1I35A 3VAWA 2FDQA 4G3XB 3VUXA 5D3WA 4B95A 2K2UA 4WWPA 2DYNA 4NQLB 1LQBA 3PHWB 3VHTC 4F8CB 3A9KA 5D2MB 2KTRA 4X57B 3A8PA 2XBBC 4BVUC 5HE0A 4KDIC 5DPTA 3QBVB 1GJZA 1FHOA 3JW0X 3T06A 1WFYA 2K2JA 3JSVA 3ZDTA 2DKPA 4GOCA 3PRZA 2AL3A 3HHMA 5CLQB 3N3KB 3HQCA 1Z2MA 2E2XA 3A9JA 4CO7A 2IY1B 3TIXA 3N30A 2DX1A 2L3ZA 4ZDVA 2R0DA 2KOXA 5KHOA 1S1QB 4IFSA 3N7CA 2PPHA 4MY6A 3F0WA 3B08A 4JLCA 5JLJB 1NTYA 1V81A 2RVBB 2R09A 2PZ1A 2N4FA 3KY9A 3NS8A 5HE2A 2WH5A 1NVLA 1WZ0A 1ZC3B 2N9EB 4JQWC 1GGOA 2LXCA 1V5UA 2DHJA 1HB6A 3KW5B 3CMMB 1QQGA 4KSKC 3IFWB 2FCMA 3VH4B 2KVRA 4NJ6A 4F1SA 2JP2A 4FJZA 4EZKA 1LFDA 4W9CA 1R4NI 3U30A 3A1QA 4HXDA 1VD2A 2IO3B 4TQ0A 4BBKA 5C5BB 1U27A 4GZUA 2G4DB 4NNJB 3M95A 3E9PA 1LXDA 1UEFA 1WGDA 1J0WA 2Z0OA 3V60A 3PSCA 1E7VA 1I42A 2QKLA 1Q0WB 3DVGY 5LOPB 2DHKA 4A6FA 2WX1A 2I1JA 5DPRA 2IO2B 4GMVA 1KC7A 3TCAA 4JKDA 2BPSA 5IAAC 3JVZX 1XX0A 3AU5A 3EECA 4W9EA 2KJ6A 4EUTA 2EKEC 4WJ7A 3V5WA 2N7EA 4AP4C 4EJNA 1DDWA 1ZSQA 4AWJA 4EEWA 3ZNZB 1BTNA 4K2OA 4FJVB 2UZRA 2IZVB 4ANVA 4BFRA 2DHIA 1JDEA 3PT2B 4ILHA 3W1SA 4DK5A 3NSUA 3UINB 2DZKA 4XZ4A 4A20A 2LD9A 1IYFA 2ZPNA 5LXIB 4JIOU 4GDLA 2DYMA 4IM0A 4W9DA 2MBEA 2KJRA 2NZ8B 1UZXB 2LKOA 1I2HA 2ZCBA 4MSQB 3DDCB 4EKUA 2MBQA 4JK8A 2CY5A 4LDTB 4IUMB 2ADZA 1V6EA 2LRWA 2R2QA 3SYXA 2JPHA 2L00B 1OGWA 2PE9A 2D10A 2NPTB 1K5GB 5J17A 3P6AA 2JUOA 2CHZA 5E6NA 3ML9A 3QIJA 5JHHA 3K9OB 3PVUA 1WJ1A 1S3SG 1ACAA 1V2YA 2LBBA 4GDKA 2COAA 2UWQA 3L13A 1ZM0A 3RT3B 1UNRA 2H7EA 3H7PA 3KSYA 2IY0B 3OJ4B 4HB3B 2K8CA 1LM8B 3VUYA 1UPQA 3RULA 3ENBA 3DBLI 2OTXA 2JZ3B 5KQ1A 4AOFA 5JH5C 1OTRB 5AEKB 1KBLA 5D7GA 2V4LA 4GB9A 3RYTA 1KM7A 1Y8RC 4IWQA 3O96A 5G2NA 3A9KB 4Z2NA 2MQJA 2KWVB 2KTRB 4DX90 1FHXA 4JKEA 3WANA 3NHEB 3S2AA 1ST7A 3M63B 4PS7A 1U5DA 2C7HA 3VTUA 4JKHA 3JSVB 5L81A 4JKCA 3L17A 2RR9A 1X05A 3DPDA 2Z0PA 5LONB 1WZ3A 2PE6B 1UBIA 4IW0A 3A9JB 2D4QA 1WE7A 1X11A 5HKHA 3L08A 3VIAA 3FP5A 2JT4B 3LDZE 4TUUA 3DXDA 3RCZA 1RRPB 2M14A 1H10A 4NSWA 5D3VA 3PLVA 4HB4B 3PTFC 2DAFA 1M94A 1ZW7A 2KX3A 3DQVA 2BCJA 3QA8A 4J6IA 2ROZB 4HB2B 4GPTB 3KZ1A 1TTNA 2K6QA 4ILGB 5J3YA 4G11A 2V3SA 1RFAA 4MGIE 1J19A 2JXXA 3KH0A 3B0AA 2M8SA 3LJUX 3UQAA 2O6VA 2JWZA 3QJZA 2NMBA 5IJMA 2L0FA 1V5MA 1QZEA 3EPYA 2MW5A 5CHWA 2DZMA 3A1QB 2DENB 2CU1A 2KHWB 3C0RB 3N32A 3TJPA 3BJIA 1XD3B 3RZWC 2GS0A 2KJHB 3NZSA 4JKBA 3GZNI 5G55A 3ZKJC 4MT7A 3VDZA 4KDLB 1KI1B 3VUWA 1E8WA 3TL5A 4FULA 5D27A 3GOEA 2BWFA 3DBSA 1MAIA 2ZEQA 1GUAB 2J0JA 2L0TA 4A6FB 2J59M 2RLOA 2GBNA 2LOXA 3ONSA 3L10B 2K6DB 3KVFB 1UELA 4LJPB 4M8NA 4MGKE 4KV2A 2K8HA 4KSLC 4HPMB 3ZVVA 2ELAA 3ZNID 2DX5A 4DBGA 3V6CB 2G4SA 1X1GA 2YVCA 1YD8U 2BYEA 1UH6A 2FCSA 2C9WB 2RSUA 3KUDB 2COFA 2W9NA 2D2QA 2IO0B 4W9KA 2YS1A 2KGXB 2HE7A 1UGMA 3B1LX 4MSMB 2RNRB 2N23A 3RZFA 3QARA 2LVOA 4HCNB 4BKSD 4GDLB 5FI1A 3PRMB 4Z2MB 2CRFA 2JF5A 5DI9B 1OQYA 3FEHA 4JL9A 4GMXB 1U5GA 3U8ZA 1P9DU 1P1AA 4W9JA 2ABDA 5C1ZA 2FJLA 3WIMA 5JP4A 1MPHA 3D8DA 3X23A 4MELA 3RUIB 4TV3A 1DROA 3R7QA 3PPAA 1WGHA 2LI5A 2KUPA 2YS3A 3PZDA 2N7DA 2H7DA 4KIKA 2M1MA 4WVFB 3E9LA 2WDTB 3L54A 5DIFB 2IFSA 4FHKA 5GMVA 4GN1A 1EGXA 2KDEB 2KFJA 4GDKB 4WAAA 4NQKE 2N9PC 3DBHI 4ASWC 1KOTA 3H7PB 1EAZA 2Y8FA 2D3GA 4FBJB 1V86A 3OJ3A 4RM8A 5C6RA 3TW1A 1WIAA 4K1RB 2AWTA 4I6LB 1P3RA 5D3YA 5CHVC 3SDLC 2M17A 2MWSB 1BWNA 3SD5A 3VH3B 4HAUB 2LGYA 4IC7B 3PRPB 3EFUA 3VTWA 3GYPA 2I5CA 2ZVNA 4RM9A 4HDOA 2RD0A 4DHJB 3DXEA 4HDQA 2CQUA 3A8QA 3SBTA 4AUQC 2I1KA 2D9ZA 3FSSA 3QC8B 4PNKA 1DDVA 3DOWA 4W9IA 3A98B 3ZUNA 1KJTA 1M7RA 4E71A 2CB8A 1VBGA 2NBVB 4WJQA 3TBLD 4ICUA 5GOWB 4BOZB 2JRHA 5HE1A 1K5DB 2LWPA 4BKTA 2QHOA 2COCA 3JYUA 4ZRKA 3L16A 1GC7A 3G9WA 3A4RA 4PS8A 4GGQA 5BO4B 3Q3JA 3E66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  3DVN V;  3TO1 A;  5KHQ A;  1E7U A;  3QQ8 B;  2WWZ A;  2XEW A;  4KZC A;  1WJN A;  5E6O A;  5JHB A;  3AI5 A;  2DZJ A;  2O6V B;  4LCD E;  3U7D A;  3F5R A;  3CST A;  1YX5 B;  2ASQ A;  5D94 A;  1TJ6 A;  3KYD D;  4AJW A;  4ANW A;  4A6H A;  4CHK A;  1WY8 A;  3D32 A;  3Q3F A;  3ZIM A;  1V9J A;  1B55 A;  1P0R A;  1EF1 A;  2P0D A;  3M62 B;  4W9G A;  3SHQ A;  5DHA B;  2UZS A;  3LJ3 A;  2WX0 A;  1TGZ B;  4II3 B;  3IHP C;  2BYF A;  1ZVR A;  3IBE A;  3R7R A;  4RMA A;  2AYO B;  2HTH A;  3NOB A;  2CS4 A;  1V5T A;  1NDD A;  2GJY A;  3WYF B;  3DVG X;  3ZRC A;  1YJ1 A;  2NS5 A;  1NBF C;  4MJS B;  1SHC A;  4ZRJ A;  2KDB A;  2KX0 A;  2K1F A;  4MM3 A;  2G45 B;  4IG7 B;  1MK7 B;  2D9W A;  2KMC A;  2KN5 A;  2M4N A;  1P98 A;  1WH3 A;  3HIZ A;  4G50 A;  4F7H A;  1QC6 A;  2C60 A;  1NTI A;  2HJ8 A;  2LXA A;  2KDF B;  4MEM A;  5LLI A;  2FIF A;  1RLF A;  1F9J A;  3KUC B;  5E6P A;  4OVV A;  2KMA A;  3X0W A;  3WAL A;  2DX5 B;  2L05 A;  3SUZ A;  2P8V A;  5J18 A;  1GC6 A;  3EC8 A;  1HBK A;  2AEH A;  1WRD B;  4EZJ A;  2FCQ A;  5EFX A;  2NVU I;  2GMI C;  5D3X A;  4A6K A;  4HPL B;  4KHB B;  2CAY A;  2Y5B B;  2L1C A;  1X86 A;  4B6H A;  1P3Q U;  1FAO A;  1TQZ A;  2LUE A;  1UNQ A;  4A5K A;  1OEY A;  3AU4 A;  2IBI B;  4EFO A;  4K7W A;  1YQB A;  4A3O A;  3KRW A;  1U2B A;  3UZT A;  3DVN U;  5KQ4 A;  3WAM A;  2KD0 A;  5IA7 A;  3H9D A;  3SNH A;  2J7Q B;  4DDG D;  4N9F 4;  5EDS A;  2K25 A;  1K8R B;  3MTN B;  2GCJ A;  4EOY A;  1E8X A;  1V49 A;  3VVW B;  4KIK B;  2OQB A;  1EO6 A;  2AL6 A;  2YS5 A;  2V76 A;  4BBN F;  2NCN A;  2QKM A;  3ECI A;  2FCN A;  3EHV A;  3PV1 A;  2MA9 B;  2IO1 B;  2D9X A;  1ZC4 B;  2D9V A;  2KQ7 A;  1U29 A;  2JRI B;  4MH0 E;  1V5O A;  1NTV A;  3ULB A;  1TXD A;  4K2P A;  2KQS A;  2GBJ A;  3NY5 A;  1E8Z A;  4HAW B;  1RRB A;  1V5P A;  5DH9 B;  2GBR A;  2DYB A;  2VSZ A;  2CKH B;  2NBW B;  3H1U A;  1WX9 A;  2DHZ A;  3WA0 A;  4FJY A;  2W2W A;  1CMX B;  4DHZ B;  4K17 A;  4LDT D;  1N3H A;  1WM3 A;  1WX8 A;  2ZPY A;  2JVC A;  1EVH A;  2KZR A;  1V89 A;  3CIK A;  5D6J B;  4B6W A;  2M38 A;  1WE6 A;  4HAZ B;  2KC1 A;  1IRS A;  3ZLZ A;  4BKG A;  1IP9 A;  2KAN A;  1I7A A;  2RSG A;  2GOW A;  4LJO B;  3M1I B;  2NBU A;  4HJK A;  3R66 C;  2LAS A;  3UQB A;  4TYZ A;  3PVW A;  3HM3 A;  3ZTC A;  1Y5O A;  1J0G A;  4NPN A;  4HAT B;  2L76 A;  1WI0 A;  1V80 A;  2N1W A;  3QWM A;  2JY6 A;  3HM6 X;  2A4Z A;  2K39 A;  2FNJ B;  3ODW A;  3I3T B;  2ZVO A;  1ZKH A;  4KAX B;  2RGF A;  4BBN C;  2MP2 A;  5AZH A;  5LXH A;  1Y19 B;  2MDX A;  3KUZ A;  4MGZ E;  1X1F A;  5KCV A;  3MDB C;  1DBH A;  3ML4 A;  1LB1 A;  1XQQ A;  2RPQ A;  4HAV B;  4MJS A;  4ZYN A;  3ZO5 B;  2KWU B;  4HAX B;  2W2X D;  3T9L A;  2LJ5 A;  2EC1 A;  2Q13 A;  4HLE A;  3MHS D;  3FLV A;  1WMH A;  2KFK A;  1KLV A;  1WR1 A;  2DA0 A;  1WG7 A;  2MX2 A;  1MIZ B;  1WJ4 A;  4M0W B;  3KYC D;  3OAN A;  2ZNV C;  1U5F A;  2J0M A;  2UVM A;  5C79 A;  4M8M A;  4DWF A;  1G6J A;  1WR6 E;  2DFK A;  2Z0D B;  2KNB A;  2O2V A;  1LW3 A;  4XWX A;  3R3M A;  1YX6 B;  4H8S A;  3MPX A;  3SU8 X;  2UYZ B;  4FHJ A;  4C0A A;  3BIN A;  2A5U A;  1U4A A;  5C16 A;  3APD A;  2YSZ A;  1FXT B;  3FM8 C;  2KLG A;  2HTH B;  4HWI B;  4YL8 A;  5DPS A;  1L2N A;  2KTF A;  2P0H A;  1GG3 A;  4E74 A;  1R4M I;  3P2B A;  2MBH A;  4NY0 A;  2Z59 B;  2KK8 A;  4F7U P;  3IG3 A;  1WF9 A;  2YF0 A;  4A3P A;  1PLS A;  3VOQ A;  4K7S A;  3ML8 A;  2XK5 A;  2NR2 A;  5JHA A;  3A33 B;  3D8F A;  2VRW B;  1WGU A;  4MGY E;  4GXB A;  3V61 A;  2DLW A;  1SIF A;  5JZE B;  4TQ1 A;  1DYN A;  1FOE A;  1GNU A;  1WJM A;  1A5R A;  2ZJD A;  2KWC A;  3KRX A;  2KLC A;  2LOZ A;  3V62 A;  3IVF A;  2LVQ A;  4KZ0 A;  2KXJ A;  3PG7 A;  4EZL A;  1XD4 A;  4KHO A;  1UD7 A;  4XC2 A;  2PJH A;  2KO3 A;  2L8J A;  5DCN A;  1FGY A;  4WJP A;  4I6P A;  2KC2 A;  2MLB A;  3PRE A;  1YIW A;  3QCA A;  4BKS A;  1EUV B;  4FAD A;  4EMO A;  3OLM D;  1FGZ A;  1HB8 A;  3UIO B;  3PVL A;  4IOY X;  5CHF A;  3ZVR A;  2D11 A;  2MKR A;  1EF5 A;  4WWO A;  1OQN A;  2FUH B;  1RJ2 A;  1XT9 B;  2LZ6 A;  1PFJ A;  3TMP B;  2D9Y A;  1TBE A;  2L2I A;  1W1D A;  5DHF B;  2YT1 A;  1WXA A;  2KKC A;  1AAR A;  1UNP A;  5CLL B;  3SV1 A;  4BOS C;  1XOD A;  4B9K A;  1WM2 A;  2HD5 B;  1W1G A;  4NAW A;  1BAK A;  4HCP B;  2Z0E B;  1NU2 A;  3DCG A;  1WGG A;  2LUL A;  1E8Y A;  2C7M B;  3APC A;  5HE3 A;  3OAW A;  3ODX A;  3PEG A;  1IPG A;  3APF A;  5L95 C;  1WJ6 A;  3CF6 E;  2D07 B;  1D3Z A;  3L0W B;  3P7Z A;  1UPR A;  2DZI A;  3ZDM C;  4ZRI A;  5J3T A;  2BKR B;  2REX A;  1WJU A;  2GCL A;  1Z5S B;  4AJY B;  1JRU A;  3ZRF A;  1VCB A;  5AZG A;  2BYV E;  2DTC A;  2LYD A;  2MP2 B;  1T0Y A;  2K8B A;  3H7S A;  3HK0 A;  3ULC A;  3QAQ A;  3WAO A;  4W9H A;  4ICV A;  2BKF A;  1WI1 A;  1XCG A;  2DAJ A;  1FHW A;  1J8C A;  1SGH A;  1E90 A;  3AJ4 A;  2MFQ A;  1PMS A;  4DHJ D;  1P6S A;  4PYZ A;  4HB0 B;  1M7E A;  3H6N A;  1WMH B;  2KDI A;  2BGF A;  2KFK B;  1WXS A;  4GSW A;  2DN6 A;  4F7Z A;  1UBQ A;  2EJ8 A;  2X18 A;  3TFM A;  2CY4 A;  1V88 A;  1MK9 B;  3SO6 A;  2O2V B;  2OJR A;  4DX8 A;  3PHX B;  4IWP A;  2Y7B A;  2GBK A;  4IAP A;  1WXV A;  2MCN B;  2N1V A;  3DXC A;  2V1Y A;  4WJN A;  2YLM A;  1H4R A;  4KVG B;  5J2R A;  1KZ7 A;  1U5E A;  3DBR I;  2C7N B;  1AQC A;  1C3T A;  4L6E A;  2ROV A;  4CHJ A;  4WWN A;  3PGE A;  3ZNH B;  1KZG A;  3QHT A;  3NZU A;  4W9L A;  2MBB B;  1MIX A;  1V61 A;  4OVU A;  1XR0 B;  3W1Y A;  2W2X C;  1AWE A;  1WGY A;  4D0N B;  2O6V D;  4NJ7 A;  2RQ1 A;  2FJ9 A;  3PSE B;  4IM3 A;  1XKE A;  2B3A A;  3D8E A;  4FA6 A;  1FB8 A;  2OOB B;  2XK5 B;  2CR5 A;  3CXB B;  2YT0 A;  1TZ1 A;  2DYQ A;  2BF8 B;  3AXC A;  1WYW B;  2EMS A;  1C1Y B;  4G0N B;  2N0Y A;  4Y94 A;  1E5W A;  1MKE A;  1W1H A;  4KHA A;  1Z87 A;  2I5F A;  3ALB A;  4CYE A;  3MJW A;  4PS3 A;  2CHW A;  1BTK A;  4ANX A;  1L7Y A;  1H8C A;  2IYD B;  2M0X A;  4YON A;  4HK2 A;  2J0K A;  1WXM A;  2WYQ A;  1OMW A;  2L7R A;  3VTV A;  4WQO B;  2HRJ A;  5FI0 A;  5C5B A;  1OEY J;  2P0F A;  1SE9 A;  2JZZ A;  1WGR A;  2RGN B;  4GIV A;  3TVV A;  2EMT A;  4WJO A;  5JHG A;  2GBM A;  4I6N B;  4PYU A;  2MSE D;  1P5T A;  2R2O A;  5L83 A;  2MRP A;  1ISN A;  3QK0 A;  4K81 A;  4PQ0 A;  2LVP A;  4MDK E;  3PP2 A;  3A4S C;  2Z0Q A;  5TR5 A;  3UIP B;  4W9F A;  3VXW A;  3ODO A;  5DPW A;  4DHZ E;  2MWN B;  3QWZ B;  3PLU A;  2ELB A;  3UGB B;  3VFK A;  2LG1 A;  2XQN M;  1MG8 A;  1PQS A;  2C5L C;  5FR6 A;  2VKI A;  3UF8 A;  4HVB A;  2YRY A;  2RUK B;  2IYB A;  2ZCC A;  5AZF A;  2FID A;  4IWO A;  2G35 A;  3PS6 A;  3V6E B;  2G3Q B;  1RAX A;  5CX3 A;  2BWE S;  2ZZP B;  1DDM A;  3QX1 A;  4F7G A;  3M3J A;  4NAW B;  2KCJ A;  4DBB A;  2LGD A;  4JGH B;  3RCP A;  1OY2 A;  4GU2 A;  2DKQ A;  1WVH A;  3K9P B;  1Q67 A;  1NI2 A;  3ZNG C;  4MK0 A;  4CHM A;  1BT0 A;  4FLH A;  2PEA A;  3ZTD A;  1X1M A;  3ZW3 A;  2K00 A;  2FAZ A;  2COD A;  4DDI D;  4DXA B;  2DYO A;  3RD2 A;  4ANU A;  2COP A;  4WSF A;  4HHV A;  3VQI A;  3WAP A;  3W1S C;  4IM2 A;  1Q1O A;  4K7U A;  3GYO A;  2NPT A;  2CHX A;  3T8M A;  4XX5 A;  3HW2 B;  2Y8G A;  2MBO A;  1HE8 A;  3ENE A;  4FN2 A;  5CTR C;  5J3Q A;  3AUL A;  5C23 A;  3CSF A;  4P7I A;  2VRR B;  3O65 B;  4II2 B;  4URK A;  2ZNV B;  1WX7 A;  1WGQ A;  1Q5W B;  1ZGU B;  2N9X A;  3BY4 B;  4HAY B;  2LGX A;  2LRU A;  4E3C A;  1I35 A;  3VAW A;  2FDQ A;  4G3X B;  3VUX A;  5D3W A;  4B95 A;  2K2U A;  4WWP A;  2DYN A;  4NQL B;  1LQB A;  3PHW B;  3VHT C;  4F8C B;  3A9K A;  5D2M B;  2KTR A;  4X57 B;  3A8P A;  2XBB C;  4BVU C;  5HE0 A;  4KDI C;  5DPT A;  3QBV B;  1GJZ A;  1FHO A;  3JW0 X;  3T06 A;  1WFY A;  2K2J A;  3JSV A;  3ZDT A;  2DKP A;  4GOC A;  3PRZ A;  2AL3 A;  3HHM A;  5CLQ B;  3N3K B;  3HQC A;  1Z2M A;  2E2X A;  3A9J A;  4CO7 A;  2IY1 B;  3TIX A;  3N30 A;  2DX1 A;  2L3Z A;  4ZDV A;  2R0D A;  2KOX A;  5KHO A;  1S1Q B;  4IFS A;  3N7C A;  2PPH A;  4MY6 A;  3F0W A;  3B08 A;  4JLC A;  5JLJ B;  1NTY A;  1V81 A;  2RVB B;  2R09 A;  2PZ1 A;  2N4F A;  3KY9 A;  3NS8 A;  5HE2 A;  2WH5 A;  1NVL A;  1WZ0 A;  1ZC3 B;  2N9E B;  4JQW C;  2LXC A;  1V5U A;  2DHJ A;  1HB6 A;  3KW5 B;  3CMM B;  1QQG A;  4KSK C;  3IFW B;  2FCM A;  3VH4 B;  2KVR A;  4NJ6 A;  4F1S A;  2JP2 A;  4FJZ A;  4EZK A;  1LFD A;  4W9C A;  1R4N I;  3U30 A;  3A1Q A;  4HXD A;  1VD2 A;  2IO3 B;  4TQ0 A;  4BBK A;  5C5B B;  1U27 A;  4GZU A;  2G4D B;  4NNJ B;  3M95 A;  1LXD A;  1UEF A;  1WGD A;  1J0W A;  2Z0O A;  3V60 A;  3PSC A;  1E7V A;  1I42 A;  2QKL A;  1Q0W B;  3DVG Y;  5LOP B;  2DHK A;  4A6F A;  2WX1 A;  2I1J A;  5DPR A;  2IO2 B;  4GMV A;  3TCA A;  2BPS A;  5IAA C;  3JVZ X;  1XX0 A;  3AU5 A;  3EEC A;  4W9E A;  2KJ6 A;  4EUT A;  2EKE C;  4WJ7 A;  3V5W A;  2N7E A;  4AP4 C;  4EJN A;  1DDW A;  1ZSQ A;  4AWJ A;  4EEW A;  3ZNZ B;  1BTN A;  4K2O A;  4FJV B;  2UZR A;  2IZV B;  4ANV A;  4BFR A;  2DHI A;  3PT2 B;  3W1S A;  4DK5 A;  3NSU A;  3UIN B;  2DZK A;  4XZ4 A;  4A20 A;  2LD9 A;  1IYF A;  2ZPN A;  5LXI B;  4JIO U;  4GDL A;  2DYM A;  4IM0 A;  4W9D A;  2MBE A;  2KJR A;  2NZ8 B;  1UZX B;  2LKO A;  1I2H A;  2ZCB A;  4MSQ B;  3DDC B;  4EKU A;  2MBQ A;  2CY5 A;  4LDT B;  4IUM B;  2ADZ A;  1V6E A;  2LRW A;  2R2Q A;  3SYX A;  2JPH A;  2L00 B;  1OGW A;  2PE9 A;  2D10 A;  2NPT B;  1K5G B;  5J17 A;  3P6A A;  2JUO A;  2CHZ A;  5E6N A;  3ML9 A;  3QIJ A;  5JHH A;  3PVU A;  3K9O B;  1WJ1 A;  1S3S G;  1ACA A;  1V2Y A;  2LBB A;  4GDK A;  2COA A;  2UWQ A;  3L13 A;  1ZM0 A;  3RT3 B;  1UNR A;  2H7E A;  3H7P A;  3KSY A;  2IY0 B;  3OJ4 B;  4HB3 B;  2K8C A;  1LM8 B;  3VUY A;  1UPQ A;  3RUL A;  3DBL I;  2OTX A;  2JZ3 B;  5KQ1 A;  4AOF A;  5JH5 C;  1OTR B;  5AEK B;  5D7G A;  2V4L A;  4GB9 A;  3RYT A;  1KM7 A;  1Y8R C;  4IWQ A;  3O96 A;  5G2N A;  3A9K B;  4Z2N A;  2MQJ A;  2KWV B;  2KTR B;  4DX9 0;  1FHX A;  3WAN A;  3NHE B;  3S2A A;  1ST7 A;  3M63 B;  4PS7 A;  1U5D A;  2C7H A;  3VTU A;  3JSV B;  5L81 A;  3L17 A;  2RR9 A;  1X05 A;  3DPD A;  2Z0P A;  5LON B;  1WZ3 A;  2PE6 B;  1UBI A;  4IW0 A;  3A9J B;  2D4Q A;  1WE7 A;  1X11 A;  5HKH A;  3L08 A;  3VIA A;  3FP5 A;  2JT4 B;  3LDZ E;  4TUU A;  3DXD A;  3RCZ A;  1RRP B;  2M14 A;  1H10 A;  4NSW A;  5D3V A;  3PLV A;  4HB4 B;  3PTF C;  2DAF A;  1M94 A;  1ZW7 A;  2KX3 A;  3DQV A;  2BCJ A;  3QA8 A;  4J6I A;  2ROZ B;  4HB2 B;  4GPT B;  3KZ1 A;  1TTN A;  2K6Q A;  5J3Y A;  4G11 A;  2V3S A;  1RFA A;  4MGI E;  1J19 A;  2JXX A;  3KH0 A;  3B0A A;  2M8S A;  3LJU X;  3UQA A;  2O6V A;  2JWZ A;  3QJZ A;  2NMB A;  5IJM A;  2L0F A;  1V5M A;  1QZE A;  3EPY A;  2MW5 A;  5CHW A;  2DZM A;  3A1Q B;  2DEN B;  2CU1 A;  2KHW B;  3C0R B;  3N32 A;  3TJP A;  3BJI A;  1XD3 B;  3RZW C;  2GS0 A;  2KJH B;  3NZS A;  3GZN I;  5G55 A;  3ZKJ C;  4MT7 A;  3VDZ A;  4KDL B;  1KI1 B;  3VUW A;  1E8W A;  3TL5 A;  4FUL A;  5D27 A;  3GOE A;  2BWF A;  3DBS A;  1MAI A;  2ZEQ A;  1GUA B;  2J0J A;  2L0T A;  4A6F B;  2J59 M;  2RLO A;  2GBN A;  2LOX A;  3ONS A;  3L10 B;  2K6D B;  3KVF B;  1UEL A;  4LJP B;  4M8N A;  4MGK E;  4KV2 A;  2K8H A;  4KSL C;  4HPM B;  3ZVV A;  2ELA A;  3ZNI D;  2DX5 A;  4DBG A;  3V6C B;  2G4S A;  1X1G A;  2YVC A;  1YD8 U;  2BYE A;  1UH6 A;  2FCS A;  2C9W B;  2RSU A;  3KUD B;  2COF A;  2W9N A;  2D2Q A;  2IO0 B;  4W9K A;  2YS1 A;  2KGX B;  2HE7 A;  1UGM A;  3B1L X;  4MSM B;  2RNR B;  2N23 A;  3RZF A;  3QAR A;  2LVO A;  4HCN B;  4BKS D;  4GDL B;  5FI1 A;  3PRM B;  4Z2M B;  2CRF A;  2JF5 A;  5DI9 B;  1OQY A;  3FEH A;  4JL9 A;  4GMX B;  1U5G A;  3U8Z A;  1P9D U;  1P1A A;  4W9J A;  2ABD A;  5C1Z A;  2FJL A;  3WIM A;  5JP4 A;  1MPH A;  3D8D A;  3X23 A;  4MEL A;  3RUI B;  4TV3 A;  1DRO A;  3R7Q A;  3PPA A;  1WGH A;  2LI5 A;  2KUP A;  2YS3 A;  3PZD A;  2N7D A;  2H7D A;  4KIK A;  2M1M A;  4WVF B;  2WDT B;  3L54 A;  5DIF B;  2IFS A;  4FHK A;  5GMV A;  4GN1 A;  1EGX A;  2KDE B;  2KFJ A;  4GDK B;  4WAA A;  4NQK E;  2N9P C;  3DBH I;  4ASW C;  1KOT A;  3H7P B;  1EAZ A;  2Y8F A;  2D3G A;  4FBJ B;  1V86 A;  3OJ3 A;  4RM8 A;  5C6R A;  3TW1 A;  1WIA A;  4K1R B;  2AWT A;  4I6L B;  1P3R A;  5D3Y A;  5CHV C;  3SDL C;  2M17 A;  2MWS B;  1BWN A;  3SD5 A;  3VH3 B;  4HAU B;  2LGY A;  4IC7 B;  3PRP B;  3EFU A;  3VTW A;  3GYP A;  2I5C A;  2ZVN A;  4RM9 A;  4HDO A;  2RD0 A;  4DHJ B;  3DXE A;  4HDQ A;  2CQU A;  3A8Q A;  4AUQ C;  2I1K A;  2D9Z A;  3FSS A;  3QC8 B;  4PNK A;  1DDV A;  3DOW A;  4W9I A;  3A98 B;  3ZUN A;  1KJT A;  1M7R A;  4E71 A;  2CB8 A;  2NBV B;  4WJQ A;  3TBL D;  4ICU A;  5GOW B;  4BOZ B;  2JRH A;  5HE1 A;  1K5D B;  2LWP A;  4BKT A;  2QHO A;  2COC A;  3JYU A;  4ZRK A;  3L16 A;  1GC7 A;  3G9W A;  3A4R A;  4PS8 A;  4GGQ A;  5BO4 B;  3Q3J A; 
#chains in the Genus database with same CATH topology
 4TKN A;  3DVN V;  3TO1 A;  5TSS A;  2M56 B;  5KHQ A;  1JML A;  5BMI A;  1E7U A;  3QQ8 B;  2H89 B;  4IKG A;  2WWZ A;  1FIQ A;  2XEW A;  1QOB A;  4KZC A;  1R7S A;  2FUG 1;  2RDG A;  1VZ6 A;  1WJN A;  1PGB A;  5E6O A;  5JHB A;  2J4X A;  1FO4 A;  3AI5 A;  2DZJ A;  2O6V B;  2YEP B;  4LCD E;  4M0W A;  1ET9 A;  3U7D A;  3F5R A;  3CST A;  1STE A;  1YX5 B;  2ASQ A;  5D94 A;  1TJ6 A;  3KYD D;  4AJW A;  3AEE B;  4ANW A;  4A6H A;  4CHK A;  3B9J A;  1WY8 A;  4IDI A;  3I63 C;  3D32 A;  4P1B C;  3Q3F A;  5GXG B;  3RMK C;  3ZIM A;  2W3R A;  1FRR A;  1V9J A;  1B55 A;  1P0R A;  1EF1 A;  2K9X A;  2Z4D A;  2P0D A;  3M62 B;  4W9G A;  3SHQ A;  4XWT A;  4L1B A;  5DHA B;  2UZS A;  4P1C C;  1I4G A;  3LJ3 A;  2WX0 A;  1TGZ B;  4OVZ A;  4XGA B;  3Q6B A;  2PIA A;  4II3 B;  2GB1 A;  3IHP C;  2SAK A;  2BYF A;  1KFY B;  1ZVR A;  3MJ5 A;  1NEK B;  3B2G A;  3IBE A;  3R7R A;  1SJH D;  3AH7 A;  2LGS A;  4RMA A;  1QKZ A;  2AYO B;  2HTH A;  3NOB A;  2V3P A;  3SBG A;  4YT0 B;  2CS4 A;  2J53 A;  1V5T A;  1NDD A;  2GJY A;  3WYF B;  3T3O A;  4OT1 A;  1ZYI A;  1N62 A;  3RNE C;  3DVG X;  3ZRC A;  2Z59 A;  1YJ1 A;  2BW2 A;  2NS5 A;  2K5P A;  1NBF C;  4MJS B;  1SHC A;  2PKO A;  4ZRJ A;  2KDB A;  2KX0 A;  2K1F A;  4MM3 A;  3ZGZ A;  1NEN B;  2G45 B;  4IG7 B;  2MHJ A;  1MK7 B;  2D9W A;  2KMC A;  2KN5 A;  2M4N A;  2K0P A;  1P98 A;  1WH3 A;  3HIZ A;  4G50 A;  2W3S A;  4F7H A;  1QC6 A;  2C60 A;  4ZYS A;  1NTI A;  2TSS A;  2HJ8 A;  2LXA A;  3N20 C;  2WXQ A;  2KDF B;  4MEM A;  5LLI A;  2FIF A;  1ET6 A;  1WRI A;  1RLF A;  3FC4 A;  1F9J A;  3KUC B;  5E6P A;  2N9L A;  4OVV A;  2KMA A;  3X0W A;  3WAL A;  3ZXR A;  2DX5 B;  2L05 A;  3SUZ A;  2P8V A;  5J18 A;  1GC6 A;  5G5H A;  4JPS A;  3TEX A;  3EC8 A;  2OJW A;  1HBK A;  2AEH A;  1WRD B;  4R3D A;  4EZJ A;  1QIL A;  2FCQ A;  2PMV A;  5EFX A;  3MC9 A;  2WS3 B;  4LNF A;  2NVU I;  2GMI C;  5D3X A;  4A6K A;  4HPL B;  3E9O A;  4KHB B;  2CAY A;  2Y5B B;  1GOZ A;  4FXC A;  4HJG E;  2L1C A;  5C2T B;  1X86 A;  3TSS A;  4B6H A;  1P3Q U;  1FAO A;  2WXR A;  1TQZ A;  2LUE A;  3AE6 B;  1UNQ A;  4A5K A;  1OEY A;  3AU4 A;  2IBI B;  1VJK A;  4EFO A;  5FR3 A;  4K7W A;  2IDY A;  1YQB A;  4A3O A;  3KRW A;  1U2B A;  2AQ2 B;  3UZT A;  2WP9 B;  3DVN U;  5KQ4 A;  3WAM A;  4A9A A;  1PUT A;  2KD0 A;  4GOU A;  2WXL A;  5IA7 A;  3H9D A;  3SNH A;  2J7Q B;  1SBB B;  3P42 A;  4DDG D;  1TS5 A;  4N9F 4;  1T77 A;  5EDS A;  3IXS A;  2K25 A;  2BT6 A;  1K8R B;  4JWU C;  3MTN B;  3P4Q B;  2GCJ A;  1V1P A;  4EOY A;  1E8X A;  1V49 A;  3VVW B;  1SE2 A;  1L4D B;  4KIK B;  2OQB A;  1EO6 A;  2AL6 A;  2L52 A;  2YS5 A;  2V76 A;  4BBN F;  2NCN A;  2QKM A;  1F2R C;  3ECI A;  2FCN A;  3EHV A;  3PV1 A;  2MA9 B;  3BWU D;  2WXK A;  1TS3 A;  2IO1 B;  2D9X A;  2WDV B;  1JAL A;  1ZC4 B;  2D9V A;  2KQ7 A;  2E3T A;  3N1Z C;  1U29 A;  2JRI B;  4MH0 E;  1V5O A;  1NTV A;  3ULB A;  1TXD A;  2N9K A;  4K2P A;  2KQS A;  1CK1 A;  2GBJ A;  3IT4 B;  3NY5 A;  1E8Z A;  4HAW B;  1RRB A;  4C80 A;  1V5P A;  5DH9 B;  1YJJ A;  3R8B A;  2GBR A;  2DYB A;  2VSZ A;  1JWA D;  1DIK A;  2CKH B;  2IND C;  3J9C A;  2NBW B;  3H1U A;  1DOI A;  1WX9 A;  2DHZ A;  3WA0 A;  4FJY A;  2W2W A;  1CMX B;  4DHZ B;  4K17 A;  4LDT D;  1N3H A;  2JX5 A;  1WM3 A;  1WX8 A;  2AQ3 B;  1KF6 B;  3HVZ A;  4N6E B;  2ZPY A;  2JVC A;  2KIG A;  1EVH A;  2KZR A;  1V89 A;  3CIK A;  5D6J B;  4YTN B;  1L0X B;  4B6W A;  2M38 A;  1WE6 A;  4HAZ B;  2KC1 A;  1IRS A;  2LHE A;  3ZLZ A;  4B0M A;  4BKG A;  1XLQ A;  3AE5 B;  1IP9 A;  2KAN A;  1I7A A;  5JVL A;  2RSG A;  1KLU D;  2GOW A;  4LJO B;  3M1I B;  2NBU A;  4HJK A;  3R66 C;  2LAS A;  3UQB A;  4TYZ A;  1MHH E;  3PVW A;  3HM3 A;  1FNW A;  4ARC A;  3ZTC A;  1Y5O A;  3CIR B;  1J0G A;  4NPN A;  2ACZ B;  4HAT B;  1FXI A;  1FPY A;  2L76 A;  1WI0 A;  1V80 A;  2N1W A;  3QWM A;  2JY6 A;  3HM6 X;  2A4Z A;  4QAY A;  2K39 A;  1SE4 A;  4JKF A;  2FNJ B;  3ODW A;  1E9M A;  1LGR A;  3I3T B;  3Q8A A;  2ZVO A;  3B2F A;  1T5X D;  1ZKH A;  1RM6 C;  4KAX B;  4LNN A;  2RGF A;  4BBN C;  1T3Q A;  2MP2 A;  3NUH B;  5AZH A;  5LXH A;  1Y19 B;  2MDX A;  4KGR A;  3KUZ A;  3AEC B;  2LHD A;  1TJE A;  4MGZ E;  3TEW A;  3OG5 A;  1X1F A;  5KCV A;  2G1E A;  3MDB C;  1DBH A;  4M01 A;  3ML4 A;  1LB1 A;  1XQQ A;  1NI3 A;  2RPQ A;  4HAV B;  1F52 A;  4MJS A;  2W82 A;  2X0S A;  2QSD A;  4ZYN A;  1BUI C;  4NJC A;  3ZO5 B;  2IGG A;  1TZO A;  1PFD A;  2KWU B;  4HAX B;  3BII D;  2W2X D;  3NW8 A;  3T9L A;  2LJ5 A;  2EC1 A;  4LTU A;  2Q13 A;  4HLE A;  3MHS D;  3VR9 B;  3FLV A;  1WMH A;  2KFK A;  1KLV A;  1WR1 A;  2DA0 A;  1WG7 A;  2MX2 A;  1MIZ B;  3RFZ B;  1WJ4 A;  4M0W B;  3KYC D;  3OAN A;  2ZNV C;  2ONQ A;  2RDB C;  1U5F A;  4KKI A;  2J0M A;  2UVM A;  5C79 A;  4M8M A;  4DWF A;  2KR0 A;  4QJ5 B;  4BAX A;  1G6J A;  1WR6 E;  2DFK A;  1I4X A;  2Z0D B;  2JU6 X;  2W54 A;  2KNB A;  2O2V A;  1LW3 A;  3R2I A;  4XWX A;  3KQ4 A;  3R3M A;  1YX6 B;  3SR6 A;  4H8S A;  3MPX A;  4JWS C;  3SU8 X;  2UYZ B;  1UNS A;  1YQ4 B;  4C0A A;  4FHJ A;  3BIN A;  2A5U A;  1U4A A;  3VRA B;  1A70 A;  1N5W A;  1XF5 L;  3NVW A;  5C16 A;  3APD A;  3Q69 A;  5BYS A;  1MHX A;  2YSZ A;  1FXT B;  3FM8 C;  2KLG A;  2HTH B;  2LFI A;  4HWI B;  4YL8 A;  5DPS A;  1L2N A;  2KTF A;  2P0H A;  4ZOH C;  3IAM 1;  1GG3 A;  4E74 A;  1TIF A;  1R4M I;  3P2B A;  2MBH A;  4NY0 A;  4OZA A;  3C19 A;  1XCT L;  2Z59 B;  2KK8 A;  4F7U P;  3IG3 A;  1WF9 A;  2YF0 A;  3GP7 A;  2W55 A;  4YTM B;  4JK9 A;  4MM3 B;  2JZP A;  4A3P A;  4JK7 A;  1PLS A;  3VOQ A;  4K7S A;  3ML8 A;  3U12 A;  3HVD A;  4OHJ A;  2ON8 A;  2XK5 A;  2NR2 A;  5JHA A;  5BYQ A;  5I2S A;  4C56 C;  3ABV B;  2ICI A;  2PVG C;  3A33 B;  3D8F A;  1AWD A;  2VRW B;  1WGU A;  1PDX A;  4MGY E;  4GXB A;  3V61 A;  2DLW A;  4LNO A;  3NWA A;  1TS2 A;  2LEK A;  1SIF A;  5JZE B;  4TQ1 A;  1DYN A;  1FOE A;  1GNU A;  1WJM A;  3EFC A;  1A5R A;  2ZJD A;  1YN4 A;  2KWC A;  1FNV A;  3KRX A;  5IRS A;  2PLP A;  2KLC A;  2LOZ A;  3V62 A;  3IVF A;  2LVQ A;  4KZ0 A;  1PGA A;  2KXJ A;  1VBH A;  1N63 A;  3PG7 A;  4EZL A;  1XD4 A;  4KHO A;  1TY0 A;  3NWF A;  1NYR A;  1UD7 A;  4ZHP A;  1DOX A;  4XC2 A;  2PJH A;  2KO3 A;  1DYQ A;  4KGT A;  3AV8 A;  2KAJ A;  2L8J A;  5DCN A;  1FGY A;  4WJP A;  4I6P A;  2KC2 A;  5FK9 C;  2MLB A;  3PRE A;  1YIW A;  2D3B A;  1L0V B;  1EU3 A;  3QCA A;  4BKS A;  1EUV B;  4FAD A;  3P63 A;  4EMO A;  3OLM D;  3TEZ A;  1FGZ A;  1E7P B;  5M4Y B;  1HB8 A;  3UIO B;  3PVL A;  4NZL B;  4IOY X;  5CHF A;  3C8Y A;  3MFG A;  3ZVR A;  1V1P B;  2D11 A;  2MKR A;  1EF5 A;  4XDD A;  4RF1 A;  1EWY C;  1SE3 A;  4WAF A;  3AE9 B;  2K3U A;  3TEY A;  2VZK B;  3I5J C;  4WWO A;  3BZD B;  1OQN A;  2FUH B;  3AE4 B;  1ZDV A;  1KTK A;  2JYT A;  3BVZ A;  2DIK A;  1RJ2 A;  3AE2 B;  1HTQ A;  1XT9 B;  2LZ6 A;  4JKG A;  1PFJ A;  1K51 A;  3Q8F A;  3TMP B;  1FEH A;  2D9Y A;  1TBE A;  5IN7 A;  2L2I A;  1W1D A;  5DHF B;  2YT1 A;  2NMQ A;  1WXA A;  1RYJ A;  3NVZ A;  2KKC A;  1AAR A;  1UNP A;  5CLL B;  3SV1 A;  3P4P B;  3W5V B;  5AUI A;  4BOS C;  4XWW A;  5D3D A;  1XOD A;  4B9K A;  1WM2 A;  2HD5 B;  1W1G A;  3DHH C;  4NAW A;  1BAK A;  3V05 A;  4HCP B;  1I4Q A;  1PGX A;  2Z0E B;  2JSV X;  1NU2 A;  3DCG A;  1WGG A;  2LUL A;  1JRP A;  1E8Y A;  2C7M B;  3APC A;  1MG4 A;  2WXO A;  5HE3 A;  3OAW A;  2QDF A;  4ZRP A;  1YN5 A;  3ODX A;  3DWG C;  3PEG A;  1VDV A;  1IPG A;  3VRB B;  3APF A;  5L95 C;  1WJ6 A;  3CF6 E;  2D07 B;  1D3Z A;  1SEB D;  5HFY A;  3L0W B;  3P7Z A;  2JYE A;  1UPR A;  1RWS A;  3AE8 B;  4P16 A;  3OHM B;  2Z14 A;  2DZI A;  3ZDM C;  4ZRI A;  5J3T A;  1FNU A;  2BKR B;  2REX A;  1WJU A;  2GCL A;  4DQO C;  1Z5S B;  3IT6 B;  4AJY B;  1JRU A;  4L1R A;  3ZRF A;  4LK0 M;  1VCB A;  1F1H A;  5AZG A;  1SIJ A;  2BYV E;  2DTC A;  2EEL A;  2LYD A;  2MP2 B;  3AB5 A;  1T0Y A;  1P7F A;  2WXM A;  4MT5 A;  4HSI A;  2K8B A;  4LNK A;  2WU2 B;  3H7S A;  3HK0 A;  3ULC A;  3QAQ A;  3WAO A;  4W9H A;  4ICV A;  2BKF A;  1WI1 A;  1XCG A;  2DAJ A;  4JE3 B;  1FHW A;  1J8C A;  1UUP A;  4Q2J A;  1SGH A;  1E90 A;  3AJ4 A;  2MFQ A;  1PMS A;  3LXF A;  4DHJ D;  1P6S A;  4PYZ A;  1SF0 A;  4HB0 B;  1M7E A;  1QQR A;  3NVV A;  4WIP A;  4PK1 A;  3H6N A;  1WMH B;  2KDI A;  2BGF A;  2KFK B;  1L6U A;  1WXS A;  4GSW A;  5HG2 A;  3W2D A;  2WXJ A;  2E6X A;  2R61 A;  2DN6 A;  4F7Z A;  3KWV A;  1UBQ A;  2EJ8 A;  1RFK A;  2WNM A;  2X18 A;  3TFM A;  1YMH E;  4OZC A;  2CY4 A;  1V88 A;  1ZE3 D;  1MK9 B;  1TKE A;  3SO6 A;  2IPK D;  2O2V B;  2OJR A;  3RN9 C;  4DX8 A;  3PHX B;  4IWP A;  2Y7B A;  4ARI A;  1J7A A;  1LO5 D;  2GBK A;  1N5X A;  1AYF A;  4IAP A;  1WXV A;  2BS3 B;  1E0Z A;  2MCN B;  1PYW D;  2N1V A;  2X38 A;  3DXC A;  2V1Y A;  2Z8L A;  4YSY B;  4WJN A;  3SFE B;  1SXT A;  2YLM A;  1FFV A;  1H4R A;  4KVG B;  5J2R A;  1KZ7 A;  2I2Y A;  3R2T A;  1U5E A;  5LNK 1;  3DBR I;  2C7N B;  1AQC A;  3E56 A;  3AE3 B;  1C3T A;  4L6E A;  2ROV A;  4CHJ A;  4WWN A;  1ZP0 B;  3PGE A;  3ZNH B;  1KZG A;  4HKQ A;  3QHT A;  3NZU A;  3ZJT A;  4W9L A;  2MBB B;  4UDU C;  1T0R C;  2NTT A;  1T0S C;  4C4V A;  2GUM A;  1MIX A;  2Y3A A;  1V61 A;  4OVU A;  1TY2 A;  1XR0 B;  3W1Y A;  2WGS A;  2W2X C;  1AWE A;  1V8C A;  1WGY A;  4D0N B;  2O6V D;  4NJ7 A;  3RNC C;  4BZA A;  2RQ1 A;  2FJ9 A;  3PSE B;  4IM3 A;  1XKE A;  2B3A A;  3D8E A;  4FA6 A;  1FB8 A;  2OOB B;  2XK5 B;  2CR5 A;  3CXB B;  3ZXV A;  2YT0 A;  1TZ1 A;  2DYQ A;  2BF8 B;  3AXC A;  1WYW B;  2EMS A;  1C1Y B;  1ACC A;  3PZ8 A;  3RNG C;  4G0N B;  4L2Y A;  4JKA A;  2N0Y A;  4Y94 A;  3NJT A;  1E5W A;  1MKE A;  1W1H A;  4KHA A;  1Z87 A;  2I5F A;  3ALB A;  4CYE A;  1WSP A;  3OWE B;  1ROE A;  2QMT A;  4LLG M;  3MJW A;  4PS3 A;  2CHW A;  1BTK A;  4ANX A;  1D5Z C;  4OZB A;  1L7Y A;  1H8C A;  3KLS X;  2IYD B;  2M0X A;  3HIE A;  2DWQ A;  1SSN A;  4YON A;  3TUO A;  4HK2 A;  2KUQ A;  2J0K A;  1WXM A;  2WYQ A;  1OMW A;  4C7Y A;  2L7R A;  1XO3 A;  3VTV A;  3DHG C;  4ACF A;  3Q2A C;  4WQO B;  1NYQ A;  4N58 A;  2HRJ A;  5FI0 A;  5C5B A;  2L83 A;  1L6V A;  1OEY J;  2P0F A;  1SE9 A;  2JZZ A;  1WGR A;  2RGN B;  4GIV A;  3B77 A;  3DBR B;  3TVV A;  3P4R B;  1EM7 A;  2EMT A;  4WJO A;  5JHG A;  2GBM A;  1GB1 A;  4I6N B;  4PYU A;  1XEE A;  2MSE D;  1QOF A;  3NS1 A;  1P5T A;  2R2O A;  5L83 A;  2MRP A;  1ISN A;  3QK0 A;  2RMM A;  4K81 A;  2R82 A;  1D5X C;  3LYY A;  4PQ0 A;  2LVP A;  3DBL B;  4MDK E;  3PP2 A;  3A4S C;  1AW7 A;  2Z0Q A;  5TR5 A;  3DCX A;  3FIL A;  3UIP B;  4W9F A;  3VXW A;  3ODO A;  2V4I B;  5DPW A;  2WXN A;  1XLP A;  4DHZ E;  1XLO A;  2MWN B;  1IGC A;  3QWZ B;  3PLU A;  2ELB A;  3UGB B;  2LGI A;  3VFK A;  2LG1 A;  4RNA A;  2XQN M;  1MG8 A;  1PQS A;  4XYC A;  3AM9 A;  2I38 A;  4USA A;  2C5L C;  5FR6 A;  2VKI A;  3UF8 A;  4HKZ E;  4HVB A;  4JKG B;  2YRY A;  1L5P A;  2G9H D;  2RUK B;  2IYB A;  2ZCC A;  4US8 A;  5AZF A;  2FID A;  4IWO A;  2WDR B;  2G35 A;  3PS6 A;  3V6E B;  2G3Q B;  3ZJV A;  1RAX A;  5CX3 A;  1WXQ A;  2BWE S;  2D3A A;  2ZZP B;  1DDM A;  3QX1 A;  4F7G A;  3M3J A;  2MH7 A;  1C79 A;  4NAW B;  2XNA C;  2KCJ A;  1QOG A;  1K52 A;  2MEK A;  3ZYY X;  4DBB A;  2LGD A;  4JGH B;  3RCP A;  3DWM A;  1QOA A;  3NZ3 A;  4ZRQ A;  1JWS D;  1OY2 A;  4GU2 A;  1F0Z A;  1MVK A;  2DKQ A;  1WVH A;  3K9P B;  5BYR A;  2V3N A;  1Q67 A;  1NI2 A;  3ZNG C;  4MK0 A;  4CHM A;  1MI1 A;  1BT0 A;  4FLH A;  2PEA A;  3ZTD A;  1X1M A;  3ZW3 A;  2K00 A;  2FAZ A;  1C9F A;  2SEB D;  3BVM A;  2COD A;  2VH2 A;  3Q3N C;  4DDI D;  4DXA B;  2DYO A;  3RD2 A;  4M02 A;  4ANU A;  2COP A;  1QF6 A;  4WSF A;  4HHV A;  2DBY A;  3VQI A;  3WAP A;  3W1S C;  2WQY B;  2WXH A;  2VH1 A;  4IM2 A;  1Q1O A;  4MH8 A;  2PVO D;  4K7U A;  2N0S B;  3RPF C;  3EUB 2;  4TMA B;  5EE3 A;  3GYO A;  2NPT A;  2CHX A;  3T8M A;  4XX5 A;  3HW2 B;  2Y8G A;  2MBO A;  1HE8 A;  3ENE A;  4FN2 A;  5CTR C;  5J3Q A;  3AUL A;  5C23 A;  4CQN A;  3CSF A;  4P7I A;  3WCQ A;  5MPO A;  2VRR B;  2LJI A;  3O65 B;  4II2 B;  1IUE A;  4URK A;  2ZNV B;  1WX7 A;  1WGQ A;  1Q5W B;  4ILJ A;  1ZGU B;  4HPP A;  3UI3 A;  2N9X A;  3P1M A;  3NWD A;  2BS4 B;  3BY4 B;  4HAY B;  2LGX A;  2LRU A;  4E3C A;  2QC8 A;  1TT5 B;  3URY A;  1I35 A;  2BS2 B;  3VAW A;  2FDQ A;  3GZN B;  2M0A A;  4A8X C;  4A55 A;  4G3X B;  3VUX A;  5D3W A;  4B95 A;  2K2U A;  4WWP A;  1OFF A;  2QEJ C;  4WUR A;  2DYN A;  4NQL B;  2J42 A;  3EA6 A;  3BVG A;  3RNB C;  3U7Z A;  1LQB A;  3PHW B;  3VHT C;  4F8C B;  2JXT A;  2BYT A;  4OW0 A;  3A9K A;  5D2M B;  2KTR A;  4X57 B;  3A8P A;  2XBB C;  1JWB D;  4BVU C;  3NRZ A;  5HE0 A;  1KLG D;  1V97 A;  1E6E B;  5H92 C;  3I57 A;  4KDI C;  5DPT A;  3QBV B;  4S17 A;  1GJZ A;  1FHO A;  4RGO S;  3NG0 A;  3JW0 X;  3T06 A;  1WFY A;  2WXF A;  2K2J A;  2K49 A;  2OED A;  3FAH A;  3JSV A;  3ZDT A;  2DKP A;  4L23 A;  4GOC A;  2Q5W D;  3PRZ A;  2AL3 A;  4JX1 C;  3HHM A;  5CLQ B;  5IKC M;  3FKY A;  3N3K B;  2YEP F;  1HA5 A;  3AEF B;  1KH0 A;  3HQC A;  1Z2M A;  1N61 A;  1EWC A;  1HXY D;  4XDC A;  1K53 A;  2E2X A;  4H2A A;  3A9J A;  1IBX B;  2L32 A;  1ZDX A;  4CO7 A;  2IY1 B;  1QT9 A;  3TIX A;  3N30 A;  2DX1 A;  2L3Z A;  4ZDV A;  2R0D A;  2RRF A;  1T6B X;  4RCO A;  2KOX A;  5KHO A;  2WDQ B;  1S1Q B;  1ZPS A;  1YJI A;  4IFS A;  3KWL A;  3AEG B;  4C4V B;  3N7C A;  2PPH A;  2KMM A;  4MY6 A;  3F0W A;  2GRI A;  3B08 A;  3E9S A;  4JLC A;  5JLJ B;  1B1Z A;  4NAM A;  1NTY A;  4AQ7 A;  1V81 A;  1B9R A;  1L4Z B;  2RVB B;  2R09 A;  2PZ1 A;  2MJE A;  1J7B A;  2N4F A;  3KY9 A;  3NS8 A;  5HE2 A;  2WH5 A;  2IGH A;  1NVL A;  1WZ0 A;  1ZC3 B;  2N9E B;  4JQW C;  1GGO A;  4KX6 B;  1I4H A;  1XXG A;  2LXC A;  1V5U A;  2DHJ A;  1HB6 A;  3KW5 B;  4N59 A;  3CMM B;  1QQG A;  4KSK C;  1C4A A;  3IFW B;  2FCM A;  3VH4 B;  2KVR A;  4NJ6 A;  2OHF A;  4F1S A;  2JP2 A;  4FJZ A;  4QXA B;  4EZK A;  1LFD A;  4W9C A;  4RFB A;  3MHZ A;  2BVC A;  1R4N I;  3U30 A;  3A1Q A;  4MAC A;  2L1A A;  3HUI A;  4HXD A;  1VD2 A;  2IO3 B;  4CSQ A;  4TQ0 A;  3N1Y C;  4BBK A;  5C5B B;  1U27 A;  5IOI A;  1CZP A;  4GZU A;  2G4D B;  4NNJ B;  3U52 E;  2GLS A;  2AQ1 B;  1D4B A;  4C00 A;  3M95 A;  1CQV A;  2Z13 A;  3E9P A;  1ESF A;  1UEF A;  1LXD A;  1WGD A;  2BTE A;  2WU5 B;  1I4P A;  1J0W A;  2Z0O A;  1HZ5 A;  3DBH B;  2IGD A;  3V60 A;  1TYG B;  3PSC A;  1E7V A;  2QIL A;  3BYY B;  1I42 A;  2QKL A;  1Q0W B;  3DVG Y;  3Q3M C;  4RGM A;  2DLB A;  4XE0 A;  1D6E C;  5LOP B;  4J3O D;  2DHK A;  4A6F A;  2WX1 A;  2I1J A;  2CJO A;  2R2Y A;  5DPR A;  2IO2 B;  3FIL B;  4GMV A;  1KC7 A;  3TCA A;  4JKD A;  2BPS A;  3GE8 C;  1D5M C;  5IAA C;  3JVZ X;  1XX0 A;  3AU5 A;  4YTP B;  1TKY A;  3EEC A;  4W9E A;  2KJ6 A;  4D6W A;  4EUT A;  1JWU D;  2NTS A;  1DOY A;  2EKE C;  4WJ7 A;  3V5W A;  2N7E A;  4AP4 C;  3IAS 1;  4EJN A;  4GLS C;  1DDW A;  1ZSQ A;  4AWJ A;  1N6Z A;  4EEW A;  3GE3 C;  3ZNZ B;  1BTN A;  4S0R A;  4K2O A;  4FJV B;  5IP4 D;  2UZR A;  5G5G A;  2IZV B;  5BMG A;  4ANV A;  4BFR A;  2DHI A;  1HZ6 A;  1JDE A;  2FBW B;  3PT2 B;  4P6V F;  4ILH A;  1R4N B;  1F77 A;  2WHI A;  3W1S A;  4DK5 A;  3NSU A;  1P7E A;  3UIN B;  2EKI A;  2DZK A;  4XZ4 A;  2V0G A;  4A20 A;  3Q8E A;  5AUK A;  2B76 B;  2LD9 A;  1SJE D;  3CWI A;  1MI0 A;  2ZPN A;  1QLB B;  2CU3 A;  1UWM A;  1IYF A;  5LXI B;  4O1N A;  4JIO U;  4IOI E;  1VLB A;  4GDL A;  2HDE A;  1UGJ A;  2KT7 A;  2DYM A;  4IM0 A;  4W9D A;  2MBE A;  2KJR A;  2NZ8 B;  1UZX B;  2LKO A;  1I2H A;  2ZCB A;  2VZK D;  4MSQ B;  1SB3 C;  1V1O A;  1TKG A;  3DDC B;  4EKU A;  2MBQ A;  4JK8 A;  2CY5 A;  1FCC C;  4LDT B;  4IUM B;  3AE1 B;  2ADZ A;  2FJU B;  1V6E A;  2KDM A;  3RI7 C;  2LRW A;  1YN3 A;  4QJ3 B;  1BXT A;  2R2Q A;  3SYX A;  4HRS A;  1CJE A;  2JPH A;  2L00 B;  1OGW A;  2PE9 A;  4K3C A;  4WH4 A;  2D10 A;  1VZ7 A;  2NPT B;  1XCQ L;  1K5G B;  5J17 A;  3P6A A;  2JUO A;  2K8E A;  2CHZ A;  5E6N A;  3ML9 A;  1F2R I;  3QIJ A;  1YQ3 B;  1DGJ A;  5JHH A;  3PVU A;  3K9O B;  1WJ1 A;  1S3S G;  2BQQ A;  2ZW0 A;  1ACA A;  1V2Y A;  1IBX A;  5E6J A;  3V3X A;  1GPX A;  2LBB A;  4GDK A;  1NVI D;  1BML C;  1ZUD 2;  2COA A;  4TSS A;  2UWQ A;  4QJ4 B;  3L13 A;  1UWX A;  1ZM0 A;  3RT3 B;  3T3N A;  3N1X C;  1UNR A;  2H7E A;  3Q14 C;  3H7P A;  3KSY A;  2IY0 B;  3OJ4 B;  4HB3 B;  1MPE A;  2K8C A;  1VZ8 A;  1LM8 B;  3VUY A;  1UPQ A;  3RUL A;  3ENB A;  3DBL I;  2OTX A;  4ITK A;  1WGK A;  2K22 A;  1UF0 A;  2JZ3 B;  5FKA C;  3DHI C;  5KQ1 A;  3LB8 C;  4AOF A;  2HJ1 A;  5JH5 C;  3H8H A;  2H88 B;  1OTR B;  1IGD A;  5AEK B;  4M00 A;  1KBL A;  5D7G A;  2V4L A;  4KKJ A;  4GB9 A;  3RYT A;  1KM7 A;  1OQR A;  1Y8R C;  4IWQ A;  3O96 A;  5G2N A;  3A9K B;  4Z2N A;  3U2S C;  2MQJ A;  2KWV B;  2KTR B;  4DX9 0;  1FHX A;  2KQ4 X;  4JKE A;  3WAN A;  3NHE B;  3S2A A;  4HEA 1;  1ST7 A;  3M63 B;  1FM0 D;  4PS7 A;  1U5D A;  2C7H A;  2INP E;  1ZXI A;  2KIE A;  3VTU A;  4JKH A;  2CJN A;  4PT5 A;  3U4E G;  3JSV B;  5L81 A;  4A6Q A;  4JKC A;  3L17 A;  4DXF A;  2RR9 A;  1X05 A;  3DPD A;  2NBV A;  2BBC A;  2Z0P A;  5LON B;  1WZ3 A;  1TS4 A;  2PE6 B;  4GNK B;  1UBI A;  1MFW A;  4IW0 A;  2D5G A;  3A9J B;  2D4Q A;  4DXG A;  1AN8 A;  1WE7 A;  1X11 A;  1J7C A;  5HKH A;  3L08 A;  3VIA A;  3FP5 A;  1JQ4 A;  5HHD G;  2JT4 B;  3LDZ E;  1N60 A;  3DXD A;  4TUU A;  1C4C A;  3RCZ A;  1MJD A;  1RRP B;  2M14 A;  1H10 A;  4NSW A;  5D3V A;  1OQQ A;  3PLV A;  4HB4 B;  3PTF C;  2DAF A;  4LNI A;  1M94 A;  2KVZ A;  1ZW7 A;  2KX3 A;  1Y56 A;  3DQV A;  2BCJ A;  3QA8 A;  4J6I A;  1EU4 A;  2ROZ B;  4HB2 B;  3GS2 A;  4GPT B;  2BB6 A;  3Q8C A;  3KZ1 A;  1TTN A;  2K6Q A;  4ILG B;  5J3Y A;  4G11 A;  2V3S A;  1RFA A;  4MGI E;  2JWU A;  1J19 A;  2JXX A;  1YOV B;  3KH0 A;  1GAQ B;  3B0A A;  2M8S A;  3LJU X;  3UQA A;  2O6V A;  2JWZ A;  3QJZ A;  1ZXH A;  2NMB A;  5IJM A;  2L0F A;  1V5M A;  1QZE A;  4WQM A;  3EPY A;  2MW5 A;  5CHW A;  2RDH A;  2DZM A;  3A1Q B;  2DEN B;  2CU1 A;  3ZJU A;  2KHW B;  3C0R B;  2IJ0 A;  5JXV A;  3N32 A;  3TJP A;  3BJI A;  1XD3 B;  1E10 A;  3RZW C;  2GS0 A;  2KJH B;  3NZS A;  5I2M A;  4YXD B;  4JKB A;  3L4P A;  3GZN I;  4A90 A;  5G55 A;  1I4R A;  2RPV A;  3ZKJ C;  4MT7 A;  3VDZ A;  1JWM D;  2WXP A;  3AE7 B;  4KDL B;  2WXI A;  4YWG G;  1KI1 B;  3VUW A;  1E8W A;  3TL5 A;  4FUL A;  5D27 A;  3HSA A;  3AED B;  3GOE A;  2BWF A;  3GB1 A;  3DBS A;  1MAI A;  2ZEQ A;  4B0E A;  1GUA B;  2J0J A;  2L0T A;  2GI9 A;  2Y5C A;  4A6F B;  3BK1 A;  3Q3O C;  5EE9 A;  2J59 M;  2RLO A;  1M4V A;  1JCK B;  2XN9 C;  2FE8 A;  5IO9 A;  2GBN A;  2LOX A;  2J52 A;  3ONS A;  3L10 B;  2K6D B;  2D3C A;  5EE0 A;  5C3J B;  3KVF B;  1UEL A;  4LJP B;  4M8N A;  4MGK E;  2WLB A;  4KV2 A;  2K8H A;  4KGS A;  1Q10 A;  3MP9 A;  4KSL C;  1JW9 D;  4HPM B;  3ZVV A;  2ELA A;  3ZNI D;  1KRH A;  2DX5 A;  4DBG A;  3V6C B;  3NVY A;  2G4S A;  3HRD D;  1X1G A;  2YVC A;  1YD8 U;  2BYE A;  1FFU A;  1UH6 A;  2X8X X;  2FCS A;  2C9W B;  2RSU A;  3KUD B;  2COF A;  2W9N A;  2UU7 A;  4WWM A;  1FRD A;  2PW9 A;  5D3I B;  2D2Q A;  2IO0 B;  4W9K A;  3N9Y C;  2YS1 A;  2KGX B;  2HE7 A;  1UGM A;  3B1L X;  1ENF A;  1YNT E;  4YSX B;  4MSM B;  2RNR B;  4KHB A;  2N23 A;  3A58 A;  2KAC A;  3RZF A;  3QAR A;  2LVO A;  4HCN B;  4BKS D;  4GDL B;  5FI1 A;  1K50 A;  3PRM B;  4AS1 A;  4Z2M B;  4RH6 A;  3ETR A;  2CRF A;  2JF5 A;  2LMC A;  5DI9 B;  2BB5 A;  3EGR A;  1T0Q C;  1OQY A;  3FEH A;  2QCZ A;  4JL9 A;  4GMX B;  1U5G A;  3U8Z A;  1P9D U;  2AX5 A;  4K3B A;  3RNF C;  1P1A A;  2WXG A;  4REZ A;  2LUM A;  1WYG A;  4W9J A;  2ABD A;  5C1Z A;  5EE1 A;  2FJL A;  3WIM A;  1FCL A;  5JP4 A;  1MPH A;  3D8D A;  3X23 A;  4MEL A;  3RUI B;  3AN1 A;  2KYW A;  2MJD A;  4TV3 A;  3VR8 B;  2N7J A;  1DRO A;  3R7Q A;  2QIE B;  3PPA A;  1WGH A;  2LI5 A;  2KUP A;  3MC0 B;  2YS3 A;  4DIX A;  3PZD A;  1C77 A;  3BYT B;  2N7D A;  1JRO A;  2H7D A;  1VR9 A;  4KIK A;  3AMZ A;  2M1M A;  4WVF B;  3E9L A;  2WDT B;  3L54 A;  2Y5P A;  5DIF B;  5LG4 B;  2IFS A;  4FHK A;  1VRA B;  2ZKM X;  5GMV A;  4C7Z A;  4GN1 A;  3MC8 A;  1EGX A;  2KDE B;  2DNF A;  2KFJ A;  3I9V 1;  4GDK B;  2INN E;  4WAA A;  3SEB A;  4NQK E;  2N9P C;  3DBH I;  4ASW C;  5BMH A;  1C4P A;  4HRO A;  4RGN A;  1KOT A;  1C78 A;  3W5U B;  2ZW1 A;  4RF0 A;  3H7P B;  1EAZ A;  5HI1 A;  2Y8F A;  2KN4 A;  2D3G A;  3O13 A;  3RNA C;  4FBJ B;  2HTM E;  1C76 A;  1HEZ E;  1V86 A;  3OJ3 A;  4RM8 A;  5C6R A;  3TW1 A;  4OSN A;  1WIA A;  4K1R B;  2AWT A;  4I6L B;  3Q8B A;  1P3R A;  5D3Y A;  4RGT A;  5CHV C;  3SDL C;  2M17 A;  2MWS B;  1BWN A;  3SD5 A;  2JQR B;  3P4S B;  3VH3 B;  4HAU B;  2LGY A;  4IC7 B;  1FXA A;  2YT2 A;  3FVC A;  3PRP B;  1R4M B;  2PTL A;  3EFU A;  3VTW A;  2MJ3 A;  3GYP A;  2I5C A;  2ZVN A;  5H8Y E;  4RM9 A;  3AEB B;  4HDO A;  2RD0 A;  1HQR D;  4DHJ B;  2V9H A;  3DXE A;  3PO0 A;  4HDQ A;  2CQU A;  3A8Q A;  3SBT A;  4AUQ C;  2I1K A;  2D9Z A;  3FSS A;  3QC8 B;  4PNK A;  1WWT A;  1DDV A;  3DOW A;  1XLN A;  4W9I A;  1GB4 A;  4ZHO A;  3A98 B;  3ZUN A;  3W9C B;  1KJT A;  1ZOY B;  3BK2 A;  1M7R A;  4E71 A;  2CB8 A;  4YSZ B;  4EE2 A;  1VBG A;  3ZQ4 A;  2NBV B;  4WJQ A;  3TBL D;  1I7H A;  3AEA B;  5GOW B;  4ICU A;  2M19 A;  4BOZ B;  1L0Y B;  2JRH A;  5HE1 A;  1K5D B;  2LWP A;  1FMA D;  2KWD A;  1HTO A;  4BKT A;  2QHO A;  4D2K A;  2COC A;  2INC C;  3JYU A;  4ZRK A;  3L16 A;  3PZ7 A;  1GC7 A;  1FD6 A;  5I4D A;  3G9W A;  5T8I A;  3SFD B;  3A4R A;  4PS8 A;  4GGQ A;  4US9 A;  5BO4 B;  2QJL A;  3Q3J A;  3E66 A; 
#chains in the Genus database with same CATH homology
 4TKN A;  3DVN V;  3TO1 A;  5KHQ A;  1E7U A;  3QQ8 B;  2WWZ A;  2XEW A;  4KZC A;  1WJN A;  5E6O A;  5JHB A;  3AI5 A;  2DZJ A;  2O6V B;  4LCD E;  3U7D A;  3F5R A;  3CST A;  1YX5 B;  2ASQ A;  5D94 A;  1TJ6 A;  3KYD D;  4AJW A;  4ANW A;  4A6H A;  4CHK A;  1WY8 A;  3D32 A;  3Q3F A;  3ZIM A;  1V9J A;  1B55 A;  1P0R A;  1EF1 A;  2P0D A;  3M62 B;  4W9G A;  3SHQ A;  5DHA B;  2UZS A;  3LJ3 A;  2WX0 A;  1TGZ B;  4II3 B;  3IHP C;  2BYF A;  1ZVR A;  3IBE A;  3R7R A;  4RMA A;  2AYO B;  2HTH A;  3NOB A;  3SBG A;  2CS4 A;  1V5T A;  1NDD A;  2GJY A;  3WYF B;  3DVG X;  3ZRC A;  1YJ1 A;  2NS5 A;  1NBF C;  4MJS B;  1SHC A;  4ZRJ A;  2KDB A;  2KX0 A;  2K1F A;  4MM3 A;  2G45 B;  4IG7 B;  1MK7 B;  2D9W A;  2KMC A;  2KN5 A;  2M4N A;  1P98 A;  1WH3 A;  3HIZ A;  4G50 A;  4F7H A;  1QC6 A;  2C60 A;  1NTI A;  2HJ8 A;  2LXA A;  2KDF B;  4MEM A;  5LLI A;  2FIF A;  1RLF A;  1F9J A;  3KUC B;  5E6P A;  4OVV A;  2KMA A;  3X0W A;  3WAL A;  2DX5 B;  2L05 A;  3SUZ A;  2P8V A;  5J18 A;  1GC6 A;  3EC8 A;  1HBK A;  2AEH A;  1WRD B;  4EZJ A;  2FCQ A;  5EFX A;  2NVU I;  2GMI C;  5D3X A;  4A6K A;  4HPL B;  3E9O A;  4KHB B;  2CAY A;  2Y5B B;  2L1C A;  1X86 A;  4B6H A;  1P3Q U;  1FAO A;  1TQZ A;  2LUE A;  1UNQ A;  4A5K A;  1OEY A;  3AU4 A;  2IBI B;  4EFO A;  4K7W A;  1YQB A;  4A3O A;  3KRW A;  1U2B A;  3UZT A;  3DVN U;  5KQ4 A;  3WAM A;  2KD0 A;  5IA7 A;  3H9D A;  3SNH A;  2J7Q B;  4DDG D;  4N9F 4;  5EDS A;  2K25 A;  1K8R B;  3MTN B;  2GCJ A;  4EOY A;  1E8X A;  1V49 A;  3VVW B;  4KIK B;  2OQB A;  1EO6 A;  2AL6 A;  2YS5 A;  2V76 A;  4BBN F;  2NCN A;  2QKM A;  3ECI A;  2FCN A;  3EHV A;  3PV1 A;  2MA9 B;  2IO1 B;  2D9X A;  1ZC4 B;  2D9V A;  2KQ7 A;  1U29 A;  2JRI B;  4MH0 E;  1V5O A;  1NTV A;  3ULB A;  1TXD A;  4K2P A;  2KQS A;  2GBJ A;  3NY5 A;  1E8Z A;  4HAW B;  1RRB A;  1V5P A;  5DH9 B;  2GBR A;  2DYB A;  2VSZ A;  1DIK A;  2CKH B;  2NBW B;  3H1U A;  1WX9 A;  2DHZ A;  3WA0 A;  4FJY A;  2W2W A;  1CMX B;  4DHZ B;  4K17 A;  4LDT D;  1N3H A;  1WM3 A;  1WX8 A;  2ZPY A;  2JVC A;  1EVH A;  2KZR A;  1V89 A;  3CIK A;  5D6J B;  4B6W A;  2M38 A;  1WE6 A;  4HAZ B;  2KC1 A;  1IRS A;  3ZLZ A;  4BKG A;  1IP9 A;  2KAN A;  1I7A A;  5JVL A;  2RSG A;  2GOW A;  4LJO B;  3M1I B;  2NBU A;  4HJK A;  3R66 C;  2LAS A;  3UQB A;  4TYZ A;  3PVW A;  3HM3 A;  3ZTC A;  1Y5O A;  1J0G A;  4NPN A;  4HAT B;  2L76 A;  1WI0 A;  1V80 A;  2N1W A;  3QWM A;  2JY6 A;  3HM6 X;  2A4Z A;  2K39 A;  4JKF A;  2FNJ B;  3ODW A;  3I3T B;  2ZVO A;  1ZKH A;  4KAX B;  2RGF A;  4BBN C;  2MP2 A;  5AZH A;  5LXH A;  1Y19 B;  2MDX A;  3KUZ A;  4MGZ E;  1X1F A;  5KCV A;  3MDB C;  1DBH A;  3ML4 A;  1LB1 A;  1XQQ A;  2RPQ A;  4HAV B;  4MJS A;  2X0S A;  4ZYN A;  3ZO5 B;  2KWU B;  4HAX B;  2W2X D;  3T9L A;  2LJ5 A;  2EC1 A;  2Q13 A;  4HLE A;  3MHS D;  3FLV A;  1WMH A;  2KFK A;  1KLV A;  1WR1 A;  2DA0 A;  1WG7 A;  2MX2 A;  1MIZ B;  1WJ4 A;  4M0W B;  3KYC D;  3OAN A;  2ZNV C;  1U5F A;  2J0M A;  2UVM A;  5C79 A;  4M8M A;  4DWF A;  1G6J A;  1WR6 E;  2DFK A;  2Z0D B;  2KNB A;  2O2V A;  1LW3 A;  4XWX A;  3R3M A;  1YX6 B;  4H8S A;  3MPX A;  3SU8 X;  2UYZ B;  4FHJ A;  4C0A A;  3BIN A;  2A5U A;  1U4A A;  5C16 A;  3APD A;  2YSZ A;  1FXT B;  3FM8 C;  2KLG A;  2HTH B;  4HWI B;  4YL8 A;  5DPS A;  1L2N A;  2KTF A;  2P0H A;  1GG3 A;  4E74 A;  1R4M I;  3P2B A;  2MBH A;  4NY0 A;  2Z59 B;  2KK8 A;  4F7U P;  3IG3 A;  1WF9 A;  2YF0 A;  4JK9 A;  4A3P A;  4JK7 A;  1PLS A;  3VOQ A;  4K7S A;  3ML8 A;  2XK5 A;  2NR2 A;  5JHA A;  3A33 B;  3D8F A;  2VRW B;  1WGU A;  4MGY E;  4GXB A;  3V61 A;  2DLW A;  1SIF A;  5JZE B;  4TQ1 A;  1DYN A;  1FOE A;  1GNU A;  1WJM A;  1A5R A;  2ZJD A;  2KWC A;  3KRX A;  2KLC A;  2LOZ A;  3V62 A;  3IVF A;  2LVQ A;  4KZ0 A;  2KXJ A;  1VBH A;  3PG7 A;  4EZL A;  1XD4 A;  4KHO A;  1UD7 A;  4XC2 A;  2PJH A;  2KO3 A;  2L8J A;  5DCN A;  1FGY A;  4WJP A;  4I6P A;  2KC2 A;  2MLB A;  3PRE A;  1YIW A;  3QCA A;  4BKS A;  1EUV B;  4FAD A;  4EMO A;  3OLM D;  1FGZ A;  1HB8 A;  3UIO B;  3PVL A;  4IOY X;  5CHF A;  3ZVR A;  2D11 A;  2MKR A;  1EF5 A;  4WWO A;  1OQN A;  2FUH B;  2DIK A;  1RJ2 A;  1XT9 B;  2LZ6 A;  4JKG A;  1PFJ A;  3TMP B;  2D9Y A;  1TBE A;  2L2I A;  1W1D A;  5DHF B;  2YT1 A;  1WXA A;  2KKC A;  1AAR A;  1UNP A;  5CLL B;  3SV1 A;  4BOS C;  1XOD A;  4B9K A;  1WM2 A;  2HD5 B;  1W1G A;  4NAW A;  1BAK A;  4HCP B;  2Z0E B;  1NU2 A;  3DCG A;  1WGG A;  2LUL A;  1E8Y A;  2C7M B;  3APC A;  5HE3 A;  3OAW A;  3ODX A;  3PEG A;  1IPG A;  3APF A;  5L95 C;  1WJ6 A;  3CF6 E;  2D07 B;  1D3Z A;  3L0W B;  3P7Z A;  1UPR A;  2DZI A;  3ZDM C;  4ZRI A;  5J3T A;  2BKR B;  2REX A;  1WJU A;  2GCL A;  1Z5S B;  4AJY B;  1JRU A;  3ZRF A;  1VCB A;  5AZG A;  2BYV E;  2DTC A;  2LYD A;  2MP2 B;  1T0Y A;  2K8B A;  3H7S A;  3HK0 A;  3ULC A;  3QAQ A;  3WAO A;  4W9H A;  4ICV A;  2BKF A;  1WI1 A;  1XCG A;  2DAJ A;  1FHW A;  1J8C A;  1SGH A;  1E90 A;  3AJ4 A;  2MFQ A;  1PMS A;  4DHJ D;  1P6S A;  4PYZ A;  4HB0 B;  1M7E A;  3H6N A;  1WMH B;  2KDI A;  2BGF A;  2KFK B;  1WXS A;  4GSW A;  2DN6 A;  4F7Z A;  1UBQ A;  2EJ8 A;  2X18 A;  3TFM A;  2CY4 A;  1V88 A;  1MK9 B;  3SO6 A;  2O2V B;  2OJR A;  4DX8 A;  3PHX B;  4IWP A;  2Y7B A;  2GBK A;  4IAP A;  1WXV A;  2MCN B;  2N1V A;  3DXC A;  2V1Y A;  4WJN A;  2YLM A;  1H4R A;  4KVG B;  5J2R A;  1KZ7 A;  1U5E A;  3DBR I;  2C7N B;  1AQC A;  1C3T A;  4L6E A;  2ROV A;  4CHJ A;  4WWN A;  3PGE A;  3ZNH B;  1KZG A;  3QHT A;  3NZU A;  4W9L A;  2MBB B;  1MIX A;  1V61 A;  4OVU A;  1XR0 B;  3W1Y A;  2W2X C;  1AWE A;  1WGY A;  4D0N B;  2O6V D;  4NJ7 A;  2RQ1 A;  2FJ9 A;  3PSE B;  4IM3 A;  1XKE A;  2B3A A;  3D8E A;  4FA6 A;  1FB8 A;  2OOB B;  2XK5 B;  2CR5 A;  3CXB B;  2YT0 A;  1TZ1 A;  2DYQ A;  2BF8 B;  3AXC A;  1WYW B;  2EMS A;  1C1Y B;  4G0N B;  4JKA A;  2N0Y A;  4Y94 A;  1E5W A;  1MKE A;  1W1H A;  4KHA A;  1Z87 A;  2I5F A;  3ALB A;  4CYE A;  3MJW A;  4PS3 A;  2CHW A;  1BTK A;  4ANX A;  1L7Y A;  1H8C A;  2IYD B;  2M0X A;  4YON A;  4HK2 A;  2J0K A;  1WXM A;  2WYQ A;  1OMW A;  2L7R A;  3VTV A;  4WQO B;  2HRJ A;  5FI0 A;  5C5B A;  1OEY J;  2P0F A;  1SE9 A;  2JZZ A;  1WGR A;  2RGN B;  4GIV A;  3TVV A;  2EMT A;  4WJO A;  5JHG A;  2GBM A;  4I6N B;  4PYU A;  2MSE D;  1P5T A;  2R2O A;  5L83 A;  2MRP A;  1ISN A;  3QK0 A;  4K81 A;  2R82 A;  4PQ0 A;  2LVP A;  4MDK E;  3PP2 A;  3A4S C;  2Z0Q A;  5TR5 A;  3UIP B;  4W9F A;  3VXW A;  3ODO A;  5DPW A;  4DHZ E;  2MWN B;  3QWZ B;  3PLU A;  2ELB A;  3UGB B;  3VFK A;  2LG1 A;  2XQN M;  1MG8 A;  1PQS A;  2C5L C;  5FR6 A;  2VKI A;  3UF8 A;  4HVB A;  4JKG B;  2YRY A;  2RUK B;  2IYB A;  2ZCC A;  5AZF A;  2FID A;  4IWO A;  2G35 A;  3PS6 A;  3V6E B;  2G3Q B;  1RAX A;  5CX3 A;  2BWE S;  2ZZP B;  1DDM A;  3QX1 A;  4F7G A;  3M3J A;  4NAW B;  2KCJ A;  4DBB A;  2LGD A;  4JGH B;  3RCP A;  1OY2 A;  4GU2 A;  2DKQ A;  1WVH A;  3K9P B;  1Q67 A;  1NI2 A;  3ZNG C;  4MK0 A;  4CHM A;  1BT0 A;  4FLH A;  2PEA A;  3ZTD A;  1X1M A;  3ZW3 A;  2K00 A;  2FAZ A;  2COD A;  4DDI D;  4DXA B;  2DYO A;  3RD2 A;  4ANU A;  2COP A;  4WSF A;  4HHV A;  3VQI A;  3WAP A;  3W1S C;  4IM2 A;  1Q1O A;  4K7U A;  3GYO A;  2NPT A;  2CHX A;  3T8M A;  4XX5 A;  3HW2 B;  2Y8G A;  2MBO A;  1HE8 A;  3ENE A;  4FN2 A;  5CTR C;  5J3Q A;  3AUL A;  5C23 A;  3CSF A;  4P7I A;  2VRR B;  3O65 B;  4II2 B;  4URK A;  2ZNV B;  1WX7 A;  1WGQ A;  1Q5W B;  4ILJ A;  1ZGU B;  2N9X A;  3BY4 B;  4HAY B;  2LGX A;  2LRU A;  4E3C A;  1I35 A;  3VAW A;  2FDQ A;  4G3X B;  3VUX A;  5D3W A;  4B95 A;  2K2U A;  4WWP A;  2DYN A;  4NQL B;  1LQB A;  3PHW B;  3VHT C;  4F8C B;  3A9K A;  5D2M B;  2KTR A;  4X57 B;  3A8P A;  2XBB C;  4BVU C;  5HE0 A;  4KDI C;  5DPT A;  3QBV B;  1GJZ A;  1FHO A;  3JW0 X;  3T06 A;  1WFY A;  2K2J A;  3JSV A;  3ZDT A;  2DKP A;  4GOC A;  3PRZ A;  2AL3 A;  3HHM A;  5CLQ B;  3N3K B;  3HQC A;  1Z2M A;  2E2X A;  3A9J A;  4CO7 A;  2IY1 B;  3TIX A;  3N30 A;  2DX1 A;  2L3Z A;  4ZDV A;  2R0D A;  2KOX A;  5KHO A;  1S1Q B;  4IFS A;  3N7C A;  2PPH A;  4MY6 A;  3F0W A;  3B08 A;  4JLC A;  5JLJ B;  1NTY A;  1V81 A;  2RVB B;  2R09 A;  2PZ1 A;  2N4F A;  3KY9 A;  3NS8 A;  5HE2 A;  2WH5 A;  1NVL A;  1WZ0 A;  1ZC3 B;  2N9E B;  4JQW C;  1GGO A;  2LXC A;  1V5U A;  2DHJ A;  1HB6 A;  3KW5 B;  3CMM B;  1QQG A;  4KSK C;  3IFW B;  2FCM A;  3VH4 B;  2KVR A;  4NJ6 A;  4F1S A;  2JP2 A;  4FJZ A;  4EZK A;  1LFD A;  4W9C A;  1R4N I;  3U30 A;  3A1Q A;  4HXD A;  1VD2 A;  2IO3 B;  4TQ0 A;  4BBK A;  5C5B B;  1U27 A;  4GZU A;  2G4D B;  4NNJ B;  3M95 A;  3E9P A;  1LXD A;  1UEF A;  1WGD A;  1J0W A;  2Z0O A;  3V60 A;  3PSC A;  1E7V A;  1I42 A;  2QKL A;  1Q0W B;  3DVG Y;  5LOP B;  2DHK A;  4A6F A;  2WX1 A;  2I1J A;  5DPR A;  2IO2 B;  4GMV A;  1KC7 A;  3TCA A;  4JKD A;  2BPS A;  5IAA C;  3JVZ X;  1XX0 A;  3AU5 A;  3EEC A;  4W9E A;  2KJ6 A;  4EUT A;  2EKE C;  4WJ7 A;  3V5W A;  2N7E A;  4AP4 C;  4EJN A;  1DDW A;  1ZSQ A;  4AWJ A;  4EEW A;  3ZNZ B;  1BTN A;  4K2O A;  4FJV B;  2UZR A;  2IZV B;  4ANV A;  4BFR A;  2DHI A;  1JDE A;  3PT2 B;  4ILH A;  3W1S A;  4DK5 A;  3NSU A;  3UIN B;  2DZK A;  4XZ4 A;  4A20 A;  2LD9 A;  1IYF A;  2ZPN A;  5LXI B;  4JIO U;  4GDL A;  2DYM A;  4IM0 A;  4W9D A;  2MBE A;  2KJR A;  2NZ8 B;  1UZX B;  2LKO A;  1I2H A;  2ZCB A;  4MSQ B;  3DDC B;  4EKU A;  2MBQ A;  4JK8 A;  2CY5 A;  4LDT B;  4IUM B;  2ADZ A;  1V6E A;  2LRW A;  2R2Q A;  3SYX A;  2JPH A;  2L00 B;  1OGW A;  2PE9 A;  2D10 A;  2NPT B;  1K5G B;  5J17 A;  3P6A A;  2JUO A;  2CHZ A;  5E6N A;  3ML9 A;  3QIJ A;  5JHH A;  3K9O B;  3PVU A;  1WJ1 A;  1S3S G;  1ACA A;  1V2Y A;  2LBB A;  4GDK A;  2COA A;  2UWQ A;  3L13 A;  1ZM0 A;  3RT3 B;  1UNR A;  2H7E A;  3H7P A;  3KSY A;  2IY0 B;  3OJ4 B;  4HB3 B;  2K8C A;  1LM8 B;  3VUY A;  1UPQ A;  3RUL A;  3ENB A;  3DBL I;  2OTX A;  2JZ3 B;  5KQ1 A;  4AOF A;  5JH5 C;  1OTR B;  5AEK B;  1KBL A;  5D7G A;  2V4L A;  4GB9 A;  3RYT A;  1KM7 A;  1Y8R C;  4IWQ A;  3O96 A;  5G2N A;  3A9K B;  4Z2N A;  2MQJ A;  2KWV B;  2KTR B;  4DX9 0;  1FHX A;  4JKE A;  3WAN A;  3NHE B;  3S2A A;  1ST7 A;  3M63 B;  4PS7 A;  1U5D A;  2C7H A;  3VTU A;  4JKH A;  3JSV B;  5L81 A;  4JKC A;  3L17 A;  2RR9 A;  1X05 A;  3DPD A;  2Z0P A;  5LON B;  1WZ3 A;  2PE6 B;  1UBI A;  4IW0 A;  3A9J B;  2D4Q A;  1WE7 A;  1X11 A;  5HKH A;  3L08 A;  3VIA A;  3FP5 A;  2JT4 B;  3LDZ E;  4TUU A;  3DXD A;  3RCZ A;  1RRP B;  2M14 A;  1H10 A;  4NSW A;  5D3V A;  3PLV A;  4HB4 B;  3PTF C;  2DAF A;  1M94 A;  1ZW7 A;  2KX3 A;  3DQV A;  2BCJ A;  3QA8 A;  4J6I A;  2ROZ B;  4HB2 B;  4GPT B;  3KZ1 A;  1TTN A;  2K6Q A;  4ILG B;  5J3Y A;  4G11 A;  2V3S A;  1RFA A;  4MGI E;  1J19 A;  2JXX A;  3KH0 A;  3B0A A;  2M8S A;  3LJU X;  3UQA A;  2O6V A;  2JWZ A;  3QJZ A;  2NMB A;  5IJM A;  2L0F A;  1V5M A;  1QZE A;  3EPY A;  2MW5 A;  5CHW A;  2DZM A;  3A1Q B;  2DEN B;  2CU1 A;  2KHW B;  3C0R B;  3N32 A;  3TJP A;  3BJI A;  1XD3 B;  3RZW C;  2GS0 A;  2KJH B;  3NZS A;  4JKB A;  3GZN I;  5G55 A;  3ZKJ C;  4MT7 A;  3VDZ A;  4KDL B;  1KI1 B;  3VUW A;  1E8W A;  3TL5 A;  4FUL A;  5D27 A;  3GOE A;  2BWF A;  3DBS A;  1MAI A;  2ZEQ A;  1GUA B;  2J0J A;  2L0T A;  4A6F B;  2J59 M;  2RLO A;  2GBN A;  2LOX A;  3ONS A;  3L10 B;  2K6D B;  3KVF B;  1UEL A;  4LJP B;  4M8N A;  4MGK E;  4KV2 A;  2K8H A;  4KSL C;  4HPM B;  3ZVV A;  2ELA A;  3ZNI D;  2DX5 A;  4DBG A;  3V6C B;  2G4S A;  1X1G A;  2YVC A;  1YD8 U;  2BYE A;  1UH6 A;  2FCS A;  2C9W B;  2RSU A;  3KUD B;  2COF A;  2W9N A;  2D2Q A;  2IO0 B;  4W9K A;  2YS1 A;  2KGX B;  2HE7 A;  1UGM A;  3B1L X;  4MSM B;  2RNR B;  2N23 A;  3RZF A;  3QAR A;  2LVO A;  4HCN B;  4BKS D;  4GDL B;  5FI1 A;  3PRM B;  4Z2M B;  2CRF A;  2JF5 A;  5DI9 B;  1OQY A;  3FEH A;  4JL9 A;  4GMX B;  1U5G A;  3U8Z A;  1P9D U;  1P1A A;  4W9J A;  2ABD A;  5C1Z A;  2FJL A;  3WIM A;  5JP4 A;  1MPH A;  3D8D A;  3X23 A;  4MEL A;  3RUI B;  4TV3 A;  1DRO A;  3R7Q A;  3PPA A;  1WGH A;  2LI5 A;  2KUP A;  2YS3 A;  3PZD A;  2N7D A;  2H7D A;  4KIK A;  2M1M A;  4WVF B;  3E9L A;  2WDT B;  3L54 A;  5DIF B;  2IFS A;  4FHK A;  5GMV A;  4GN1 A;  1EGX A;  2KDE B;  2KFJ A;  4GDK B;  4WAA A;  4NQK E;  2N9P C;  3DBH I;  4ASW C;  1KOT A;  3H7P B;  1EAZ A;  2Y8F A;  2D3G A;  4FBJ B;  1V86 A;  3OJ3 A;  4RM8 A;  5C6R A;  3TW1 A;  1WIA A;  4K1R B;  2AWT A;  4I6L B;  1P3R A;  5D3Y A;  5CHV C;  3SDL C;  2M17 A;  2MWS B;  1BWN A;  3SD5 A;  3VH3 B;  4HAU B;  2LGY A;  4IC7 B;  3PRP B;  3EFU A;  3VTW A;  3GYP A;  2I5C A;  2ZVN A;  4RM9 A;  4HDO A;  2RD0 A;  4DHJ B;  3DXE A;  4HDQ A;  2CQU A;  3A8Q A;  3SBT A;  4AUQ C;  2I1K A;  2D9Z A;  3FSS A;  3QC8 B;  4PNK A;  1DDV A;  3DOW A;  4W9I A;  3A98 B;  3ZUN A;  1KJT A;  1M7R A;  4E71 A;  2CB8 A;  1VBG A;  2NBV B;  4WJQ A;  3TBL D;  4ICU A;  5GOW B;  4BOZ B;  2JRH A;  5HE1 A;  1K5D B;  2LWP A;  4BKT A;  2QHO A;  2COC A;  3JYU A;  4ZRK A;  3L16 A;  1GC7 A;  3G9W A;  3A4R A;  4PS8 A;  4GGQ A;  5BO4 B;  3Q3J A;  3E66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...