2HRJA

Nmr solution structure of the f2 subdomain of talin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
ETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title Structural characterization of the talin F2 FERM subdomain with Coenzyme A and PI(4,5)P2
rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2hrjA01
2I1JA 2RQ1A 3EPYA 4HDQA 1GG3A 2J0KA 4P7IA 3AU4A 2HRJA 2YVCA 3U8ZA 2COPA 2D10A 2EMSA 3G9WA 3WA0A 2LBBA 2WH5A 3QIJA 2EMTA 2AEHA 1J19A 2ABDA 4YL8A 4ZRIA 1MK9B 1Y19B 3PZDA 4EKUA 3BINA 4F7GA 1MK7B 1MIXA 2D2QA 3U7DA 2HE7A 3AU5A 2I1KA 2AL6A 1NVLA 1SGHA 1E5WA 1HB8A 3PVLA 2J0JA 4CYEA 4DXAB 1ST7A 2CB8A 1NI2A 1H4RA 3FLVA 1ACAA 1ISNA 1GC7A 3IVFA 2D11A 3ZDTA 5IJMA 2J0MA 3X23A 2CQUA 4NY0A 4ZRJA 2ZPYA 1GC6A 3FP5A 1NTIA 4HDOA 4ZRKA 1HB6A 2FJ9A 2FDQA 1MIZB 1HBKA 1EF1A
chains in the Genus database with same CATH superfamily
2RQ1A 2J0KA 4P7IA 4TKNA 2HRJA 3G9WA 2WH5A 2EMTA 3E9PA 3PZDA 4EKUA 4JKCA 1MIXA 2X0SA 4CYEA 1ST7A 1ACAA 3ZDTA 5IJMA 4NY0A 4ZRJA 4ZRKA 4JKDA 4JKGA 3EPYA 3E9LA 4ILHA 2LBBA 1VBHA 1Y19B 4JKBA 4F7GA 2D2QA 2I1KA 1SGHA 3PVLA 2J0JA 4DXAB 3E9OA 4ILJA 3FLVA 3SBTA 1ISNA 3IVFA 2CQUA 4JKHA 1GC6A 2FDQA 1MIZB 1EF1A 2R82A 1GG3A 3AU4A 3E66A 2COPA 2EMSA 1JDEA 3SBGA 3QIJA 4YL8A 2ABDA 4ZRIA 1MK9B 3ENBA 5JVLA 3U7DA 3AU5A 2AL6A 1NVLA 2CB8A 1GGOA 4GXBA 4JKFA 2ZPYA 2DIKA 1NTIA 2FJ9A 2AEHA 2I1JA 4HDQA 2YVCA 3U8ZA 1DIKA 2D10A 3WA0A 1J19A 3BINA 1MK7B 4JK9A 2HE7A 4JK7A 1E5WA 1HB8A 4JKGB 4JK8A 1KBLA 1NI2A 1H4RA 1GC7A 4JKEA 2D11A 2J0MA 3X23A 1VBGA 3FP5A 4HDOA 4JKAA 1HB6A 4ILGB 1HBKA 1KC7A
chains in the Genus database with same CATH topology
2RQ1A 2J0KA 4P7IA 4TKNA 2HRJA 3G9WA 2WH5A 2EMTA 3E9PA 3PZDA 4EKUA 4JKCA 1MIXA 2X0SA 4CYEA 1ST7A 1ACAA 3ZDTA 5IJMA 4NY0A 4ZRJA 4ZRKA 4JKDA 4JKGA 3EPYA 3E9LA 4ILHA 2LBBA 1VBHA 1Y19B 4JKBA 4F7GA 2D2QA 2I1KA 1SGHA 3PVLA 2J0JA 4DXAB 3E9OA 4ILJA 3FLVA 3SBTA 1ISNA 3IVFA 2CQUA 4JKHA 1GC6A 2FDQA 1MIZB 1EF1A 2R82A 1GG3A 3AU4A 3E66A 2COPA 2EMSA 1JDEA 3SBGA 3QIJA 4YL8A 2ABDA 4ZRIA 1MK9B 3ENBA 5JVLA 3U7DA 3AU5A 2AL6A 1NVLA 2CB8A 1GGOA 4GXBA 4JKFA 2ZPYA 2DIKA 1NTIA 2FJ9A 2AEHA 2I1JA 4HDQA 2YVCA 3U8ZA 1DIKA 2D10A 3WA0A 1J19A 3BINA 1MK7B 4JK9A 2HE7A 4JK7A 1E5WA 1HB8A 4JKGB 4JK8A 1KBLA 1NI2A 1H4RA 1GC7A 4JKEA 2D11A 2J0MA 3X23A 1VBGA 3FP5A 4HDOA 4JKAA 1HB6A 4ILGB 1HBKA 1KC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  2RQ1 A;  3EPY A;  4HDQ A;  1GG3 A;  2J0K A;  4P7I A;  3AU4 A;  2HRJ A;  2YVC A;  3U8Z A;  2COP A;  2D10 A;  2EMS A;  3G9W A;  3WA0 A;  2LBB A;  2WH5 A;  3QIJ A;  2EMT A;  2AEH A;  1J19 A;  2ABD A;  4YL8 A;  4ZRI A;  1MK9 B;  1Y19 B;  3PZD A;  4EKU A;  3BIN A;  4F7G A;  1MK7 B;  1MIX A;  2D2Q A;  3U7D A;  2HE7 A;  3AU5 A;  2I1K A;  2AL6 A;  1NVL A;  1SGH A;  1E5W A;  1HB8 A;  3PVL A;  2J0J A;  4CYE A;  4DXA B;  1ST7 A;  2CB8 A;  1NI2 A;  1H4R A;  3FLV A;  1ACA A;  1ISN A;  1GC7 A;  3IVF A;  2D11 A;  3ZDT A;  5IJM A;  2J0M A;  3X23 A;  2CQU A;  4NY0 A;  4ZRJ A;  2ZPY A;  1GC6 A;  3FP5 A;  1NTI A;  4HDO A;  4ZRK A;  1HB6 A;  2FJ9 A;  2FDQ A;  1MIZ B;  1HBK A;  1EF1 A; 
#chains in the Genus database with same CATH topology
 2RQ1 A;  2J0K A;  4P7I A;  4TKN A;  2HRJ A;  3G9W A;  2WH5 A;  2EMT A;  3E9P A;  3PZD A;  4EKU A;  4JKC A;  1MIX A;  2X0S A;  4CYE A;  1ST7 A;  1ACA A;  3ZDT A;  5IJM A;  4NY0 A;  4ZRJ A;  4ZRK A;  4JKD A;  4JKG A;  3EPY A;  3E9L A;  4ILH A;  2LBB A;  1VBH A;  1Y19 B;  4JKB A;  4F7G A;  2D2Q A;  2I1K A;  1SGH A;  3PVL A;  2J0J A;  4DXA B;  3E9O A;  4ILJ A;  3FLV A;  3SBT A;  1ISN A;  3IVF A;  2CQU A;  4JKH A;  1GC6 A;  2FDQ A;  1MIZ B;  1EF1 A;  2R82 A;  1GG3 A;  3AU4 A;  3E66 A;  2COP A;  2EMS A;  1JDE A;  3SBG A;  3QIJ A;  4YL8 A;  2ABD A;  4ZRI A;  1MK9 B;  3ENB A;  5JVL A;  3U7D A;  3AU5 A;  2AL6 A;  1NVL A;  2CB8 A;  1GGO A;  4GXB A;  4JKF A;  2ZPY A;  2DIK A;  1NTI A;  2FJ9 A;  2AEH A;  2I1J A;  4HDQ A;  2YVC A;  3U8Z A;  1DIK A;  2D10 A;  3WA0 A;  1J19 A;  3BIN A;  1MK7 B;  4JK9 A;  2HE7 A;  4JK7 A;  1E5W A;  1HB8 A;  4JKG B;  4JK8 A;  1KBL A;  1NI2 A;  1H4R A;  1GC7 A;  4JKE A;  2D11 A;  2J0M A;  3X23 A;  1VBG A;  3FP5 A;  4HDO A;  4JKA A;  1HB6 A;  4ILG B;  1HBK A;  1KC7 A; 
#chains in the Genus database with same CATH homology
 2RQ1 A;  2J0K A;  4P7I A;  4TKN A;  2HRJ A;  3G9W A;  2WH5 A;  2EMT A;  3E9P A;  3PZD A;  4EKU A;  4JKC A;  1MIX A;  2X0S A;  4CYE A;  1ST7 A;  1ACA A;  3ZDT A;  5IJM A;  4NY0 A;  4ZRJ A;  4ZRK A;  4JKD A;  4JKG A;  3EPY A;  3E9L A;  4ILH A;  2LBB A;  1VBH A;  1Y19 B;  4JKB A;  4F7G A;  2D2Q A;  2I1K A;  1SGH A;  3PVL A;  2J0J A;  4DXA B;  3E9O A;  4ILJ A;  3FLV A;  3SBT A;  1ISN A;  3IVF A;  2CQU A;  4JKH A;  1GC6 A;  2FDQ A;  1MIZ B;  1EF1 A;  2R82 A;  1GG3 A;  3AU4 A;  3E66 A;  2COP A;  2EMS A;  1JDE A;  3SBG A;  3QIJ A;  4YL8 A;  2ABD A;  4ZRI A;  1MK9 B;  3ENB A;  5JVL A;  3U7D A;  3AU5 A;  2AL6 A;  1NVL A;  2CB8 A;  1GGO A;  4GXB A;  4JKF A;  2ZPY A;  2DIK A;  1NTI A;  2FJ9 A;  2AEH A;  2I1J A;  4HDQ A;  2YVC A;  3U8Z A;  1DIK A;  2D10 A;  3WA0 A;  1J19 A;  3BIN A;  1MK7 B;  4JK9 A;  2HE7 A;  4JK7 A;  1E5W A;  1HB8 A;  4JKG B;  4JK8 A;  1KBL A;  1NI2 A;  1H4R A;  1GC7 A;  4JKE A;  2D11 A;  2J0M A;  3X23 A;  1VBG A;  3FP5 A;  4HDO A;  4JKA A;  1HB6 A;  4ILG B;  1HBK A;  1KC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...