2HRJA

Nmr solution structure of the f2 subdomain of talin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
ETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Talin-1
publication title Structural characterization of the talin F2 FERM subdomain with Coenzyme A and PI(4,5)P2
rcsb
source organism Gallus gallus
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2hrjA01
2I1KA 1GC6A 1MK9B 2D10A 4EKUA 4F7GA 1ISNA 1NI2A 1MIXA 2ABDA 1GG3A 1HB8A 3AU4A 2CQUA 3QIJA 1H4RA 1GC7A 2ZPYA 4DXAB 1MK7B 3AU5A 5IJMA 4P7IA 1ACAA 2EMSA 2FJ9A 2J0KA 3FLVA 3ZDTA 3WA0A 4CYEA 3X23A 2YVCA 3EPYA 3BINA 1SGHA 2CB8A 4YL8A 1EF1A 2D11A 2FDQA 2HRJA 1NVLA 1HBKA 1Y19B 2I1JA 4HDOA 4NY0A 4ZRKA 1MIZB 3U8ZA 2AEHA 3PVLA 2WH5A 3U7DA 4ZRJA 1E5WA 4ZRIA 3IVFA 1HB6A 1NTIA 2RQ1A 2J0JA 2HE7A 3G9WA 2D2QA 2LBBA 3PZDA 2COPA 2J0MA 1ST7A 2EMTA 2AL6A 1J19A 3FP5A 4HDQA
chains in the Genus database with same CATH superfamily
2X0SA 1KC7A 1MK7B 3AU5A 2J0KA 3X23A 2FDQA 4JKDA 4NY0A 3SBTA 1MIZB 1E5WA 4ZRIA 1NTIA 4ILJA 2LBBA 2J0MA 4GXBA 2AL6A 3FP5A 3E9PA 3ENBA 1MK9B 2D10A 4EKUA 1NI2A 2ABDA 1GC7A 4P7IA 2FJ9A 2YVCA 3EPYA 3BINA 4JKHA 1GGOA 2D11A 2HRJA 3U8ZA 1Y19B 1HBKA 4ILHA 4JKCA 2RQ1A 3G9WA 2D2QA 3E66A 1J19A 1ACAA 4HDQA 3AU4A 1MIXA 4ILGB 1GG3A 1HB8A 4DXAB 5IJMA 1KBLA 3FLVA 1VBHA 3WA0A 1SGHA 2CB8A 1EF1A 1NVLA 4HDOA 4ZRKA 3PVLA 1DIKA 4JK9A 3SBGA 1JDEA 3U7DA 1HB6A 2HE7A 2DIKA 3E9LA 3PZDA 1ST7A 2EMTA 4YL8A 2I1KA 4JKEA 1GC6A 4F7GA 1ISNA 3QIJA 4JKGB 2CQUA 1H4RA 2ZPYA 4JKGA 4TKNA 2EMSA 3ZDTA 2R82A 4CYEA 4JKFA 4JK7A 2I1JA 4JK8A 2AEHA 2WH5A 4ZRJA 1VBGA 3IVFA 4JKAA 2J0JA 3E9OA 4JKBA 2COPA 5JVLA
chains in the Genus database with same CATH topology
2X0SA 1KC7A 1MK7B 3AU5A 2J0KA 3X23A 2FDQA 4JKDA 4NY0A 3SBTA 1MIZB 1E5WA 4ZRIA 1NTIA 4ILJA 2LBBA 2J0MA 4GXBA 2AL6A 3FP5A 3E9PA 3ENBA 1MK9B 2D10A 4EKUA 1NI2A 2ABDA 1GC7A 4P7IA 2FJ9A 2YVCA 3EPYA 3BINA 4JKHA 1GGOA 2D11A 2HRJA 3U8ZA 1Y19B 1HBKA 4ILHA 4JKCA 2RQ1A 3G9WA 2D2QA 3E66A 1J19A 1ACAA 4HDQA 3AU4A 1MIXA 4ILGB 1GG3A 1HB8A 4DXAB 5IJMA 1KBLA 3FLVA 1VBHA 3WA0A 1SGHA 2CB8A 1EF1A 1NVLA 4HDOA 4ZRKA 3PVLA 1DIKA 4JK9A 3SBGA 1JDEA 3U7DA 1HB6A 2HE7A 2DIKA 3E9LA 3PZDA 1ST7A 2EMTA 4YL8A 2I1KA 4JKEA 1GC6A 4F7GA 1ISNA 3QIJA 4JKGB 2CQUA 1H4RA 2ZPYA 4JKGA 4TKNA 2EMSA 3ZDTA 2R82A 4CYEA 4JKFA 4JK7A 2I1JA 4JK8A 2AEHA 2WH5A 4ZRJA 1VBGA 3IVFA 4JKAA 2J0JA 3E9OA 4JKBA 2COPA 5JVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1K A;  1GC6 A;  1MK9 B;  2D10 A;  4EKU A;  4F7G A;  1ISN A;  1NI2 A;  1MIX A;  2ABD A;  1GG3 A;  1HB8 A;  3AU4 A;  2CQU A;  3QIJ A;  1H4R A;  1GC7 A;  2ZPY A;  4DXA B;  1MK7 B;  3AU5 A;  5IJM A;  4P7I A;  1ACA A;  2EMS A;  2FJ9 A;  2J0K A;  3FLV A;  3ZDT A;  3WA0 A;  4CYE A;  3X23 A;  2YVC A;  3EPY A;  3BIN A;  1SGH A;  2CB8 A;  4YL8 A;  1EF1 A;  2D11 A;  2FDQ A;  2HRJ A;  1NVL A;  1HBK A;  1Y19 B;  2I1J A;  4HDO A;  4NY0 A;  4ZRK A;  1MIZ B;  3U8Z A;  2AEH A;  3PVL A;  2WH5 A;  3U7D A;  4ZRJ A;  1E5W A;  4ZRI A;  3IVF A;  1HB6 A;  1NTI A;  2RQ1 A;  2J0J A;  2HE7 A;  3G9W A;  2D2Q A;  2LBB A;  3PZD A;  2COP A;  2J0M A;  1ST7 A;  2EMT A;  2AL6 A;  1J19 A;  3FP5 A;  4HDQ A; 
#chains in the Genus database with same CATH topology
 2X0S A;  1KC7 A;  1MK7 B;  3AU5 A;  2J0K A;  3X23 A;  2FDQ A;  4JKD A;  4NY0 A;  3SBT A;  1MIZ B;  1E5W A;  4ZRI A;  1NTI A;  4ILJ A;  2LBB A;  2J0M A;  4GXB A;  2AL6 A;  3FP5 A;  3E9P A;  3ENB A;  1MK9 B;  2D10 A;  4EKU A;  1NI2 A;  2ABD A;  1GC7 A;  4P7I A;  2FJ9 A;  2YVC A;  3EPY A;  3BIN A;  4JKH A;  1GGO A;  2D11 A;  2HRJ A;  3U8Z A;  1Y19 B;  1HBK A;  4ILH A;  4JKC A;  2RQ1 A;  3G9W A;  2D2Q A;  3E66 A;  1J19 A;  1ACA A;  4HDQ A;  3AU4 A;  1MIX A;  4ILG B;  1GG3 A;  1HB8 A;  4DXA B;  5IJM A;  1KBL A;  3FLV A;  1VBH A;  3WA0 A;  1SGH A;  2CB8 A;  1EF1 A;  1NVL A;  4HDO A;  4ZRK A;  3PVL A;  1DIK A;  4JK9 A;  3SBG A;  1JDE A;  3U7D A;  1HB6 A;  2HE7 A;  2DIK A;  3E9L A;  3PZD A;  1ST7 A;  2EMT A;  4YL8 A;  2I1K A;  4JKE A;  1GC6 A;  4F7G A;  1ISN A;  3QIJ A;  4JKG B;  2CQU A;  1H4R A;  2ZPY A;  4JKG A;  4TKN A;  2EMS A;  3ZDT A;  2R82 A;  4CYE A;  4JKF A;  4JK7 A;  2I1J A;  4JK8 A;  2AEH A;  2WH5 A;  4ZRJ A;  1VBG A;  3IVF A;  4JKA A;  2J0J A;  3E9O A;  4JKB A;  2COP A;  5JVL A; 
#chains in the Genus database with same CATH homology
 2X0S A;  1KC7 A;  1MK7 B;  3AU5 A;  2J0K A;  3X23 A;  2FDQ A;  4JKD A;  4NY0 A;  3SBT A;  1MIZ B;  1E5W A;  4ZRI A;  1NTI A;  4ILJ A;  2LBB A;  2J0M A;  4GXB A;  2AL6 A;  3FP5 A;  3E9P A;  3ENB A;  1MK9 B;  2D10 A;  4EKU A;  1NI2 A;  2ABD A;  1GC7 A;  4P7I A;  2FJ9 A;  2YVC A;  3EPY A;  3BIN A;  4JKH A;  1GGO A;  2D11 A;  2HRJ A;  3U8Z A;  1Y19 B;  1HBK A;  4ILH A;  4JKC A;  2RQ1 A;  3G9W A;  2D2Q A;  3E66 A;  1J19 A;  1ACA A;  4HDQ A;  3AU4 A;  1MIX A;  4ILG B;  1GG3 A;  1HB8 A;  4DXA B;  5IJM A;  1KBL A;  3FLV A;  1VBH A;  3WA0 A;  1SGH A;  2CB8 A;  1EF1 A;  1NVL A;  4HDO A;  4ZRK A;  3PVL A;  1DIK A;  4JK9 A;  3SBG A;  1JDE A;  3U7D A;  1HB6 A;  2HE7 A;  2DIK A;  3E9L A;  3PZD A;  1ST7 A;  2EMT A;  4YL8 A;  2I1K A;  4JKE A;  1GC6 A;  4F7G A;  1ISN A;  3QIJ A;  4JKG B;  2CQU A;  1H4R A;  2ZPY A;  4JKG A;  4TKN A;  2EMS A;  3ZDT A;  2R82 A;  4CYE A;  4JKF A;  4JK7 A;  2I1J A;  4JK8 A;  2AEH A;  2WH5 A;  4ZRJ A;  1VBG A;  3IVF A;  4JKA A;  2J0J A;  3E9O A;  4JKB A;  2COP A;  5JVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...