2LBBA

Solution structure of acyl coa binding protein from babesia bovis t2bo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
MSADDFDAAVKYVSNTTTMMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRGMSTESAKEAYVKLLDTLAPSWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of acyl CoA binding protein from Babesia bovis T2Bo
rcsb
source organism Babesia bovis
molecule tags Protein binding
molecule keywords Acyl CoA binding protein
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2lbbA00
3X23A 1ISNA 1HB8A 1NVLA 2EMSA 2FJ9A 2J0KA 3G9WA 3PVLA 4YL8A 4ZRIA 2D10A 2D2QA 1GC7A 3AU5A 3FP5A 1ACAA 3PZDA 1EF1A 1ST7A 1H4RA 3ZDTA 1MIXA 2FDQA 2J0JA 2CB8A 2HRJA 2CQUA 2RQ1A 3FLVA 4HDOA 4EKUA 1SGHA 1Y19B 1HB6A 2J0MA 3U7DA 3IVFA 2D11A 3EPYA 1E5WA 3U8ZA 4ZRJA 1GC6A 4ZRKA 2COPA 1GG3A 1MIZB 2LBBA 1J19A 1MK9B 1HBKA 2AL6A 2HE7A 2I1JA 3BINA 4F7GA 4NY0A 1NTIA 4CYEA 2WH5A 4HDQA 5IJMA 1MK7B 3WA0A 3QIJA 1NI2A 2I1KA 2AEHA 2EMTA 4P7IA 3AU4A 2YVCA 2ZPYA 4DXAB 2ABDA
chains in the Genus database with same CATH superfamily
4JKDA 4JKCA 3PVLA 2X0SA 3AU5A 1VBHA 1EF1A 3ZDTA 2CQUA 1JDEA 2D11A 1GC6A 1GG3A 3E9LA 4CYEA 2DIKA 3AU4A 2YVCA 3E9OA 4JKAA 4ZRIA 2J0KA 2D10A 1GC7A 3FP5A 1H4RA 4JK8A 1MIXA 2FDQA 2J0JA 4JK9A 2R82A 2HRJA 3E9PA 3FLVA 4JKFA 2J0MA 3U7DA 3SBTA 3U8ZA 2HE7A 4F7GA 2AL6A 1VBGA 2WH5A 4P7IA 2ZPYA 2ABDA 4JKGB 1ISNA 2EMSA 4ILJA 4EKUA 4YL8A 2D2QA 3PZDA 1ST7A 2CB8A 4HDOA 1SGHA 1Y19B 1HB6A 1KC7A 1GGOA 1E5WA 4ZRJA 1DIKA 4ZRKA 4JK7A 1MIZB 4TKNA 3BINA 4JKGA 1NTIA 5IJMA 3WA0A 2I1KA 2AEHA 3ENBA 3X23A 1HB8A 1NVLA 2FJ9A 3G9WA 4GXBA 4JKHA 1ACAA 4ILHA 4ILGB 2RQ1A 3E66A 5JVLA 4JKEA 3IVFA 3EPYA 3SBGA 2COPA 4JKBA 2LBBA 1J19A 1MK9B 1HBKA 2I1JA 4NY0A 4HDQA 1MK7B 3QIJA 1NI2A 2EMTA 1KBLA 4DXAB
chains in the Genus database with same CATH topology
4JKDA 4JKCA 3PVLA 2X0SA 3AU5A 1VBHA 1EF1A 3ZDTA 2CQUA 1JDEA 2D11A 1GC6A 1GG3A 3E9LA 4CYEA 2DIKA 3AU4A 2YVCA 3E9OA 4JKAA 4ZRIA 2J0KA 2D10A 1GC7A 3FP5A 1H4RA 4JK8A 1MIXA 2FDQA 2J0JA 4JK9A 2R82A 2HRJA 3E9PA 3FLVA 4JKFA 2J0MA 3U7DA 3SBTA 3U8ZA 2HE7A 4F7GA 2AL6A 1VBGA 2WH5A 4P7IA 2ZPYA 2ABDA 4JKGB 1ISNA 2EMSA 4ILJA 4EKUA 4YL8A 2D2QA 3PZDA 1ST7A 2CB8A 4HDOA 1SGHA 1Y19B 1HB6A 1KC7A 1GGOA 1E5WA 4ZRJA 1DIKA 4ZRKA 4JK7A 1MIZB 4TKNA 3BINA 4JKGA 1NTIA 5IJMA 3WA0A 2I1KA 2AEHA 3ENBA 3X23A 1HB8A 1NVLA 2FJ9A 3G9WA 4GXBA 4JKHA 1ACAA 4ILHA 4ILGB 2RQ1A 3E66A 5JVLA 4JKEA 3IVFA 3EPYA 3SBGA 2COPA 4JKBA 2LBBA 1J19A 1MK9B 1HBKA 2I1JA 4NY0A 4HDQA 1MK7B 3QIJA 1NI2A 2EMTA 1KBLA 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  1ISN A;  1HB8 A;  1NVL A;  2EMS A;  2FJ9 A;  2J0K A;  3G9W A;  3PVL A;  4YL8 A;  4ZRI A;  2D10 A;  2D2Q A;  1GC7 A;  3AU5 A;  3FP5 A;  1ACA A;  3PZD A;  1EF1 A;  1ST7 A;  1H4R A;  3ZDT A;  1MIX A;  2FDQ A;  2J0J A;  2CB8 A;  2HRJ A;  2CQU A;  2RQ1 A;  3FLV A;  4HDO A;  4EKU A;  1SGH A;  1Y19 B;  1HB6 A;  2J0M A;  3U7D A;  3IVF A;  2D11 A;  3EPY A;  1E5W A;  3U8Z A;  4ZRJ A;  1GC6 A;  4ZRK A;  2COP A;  1GG3 A;  1MIZ B;  2LBB A;  1J19 A;  1MK9 B;  1HBK A;  2AL6 A;  2HE7 A;  2I1J A;  3BIN A;  4F7G A;  4NY0 A;  1NTI A;  4CYE A;  2WH5 A;  4HDQ A;  5IJM A;  1MK7 B;  3WA0 A;  3QIJ A;  1NI2 A;  2I1K A;  2AEH A;  2EMT A;  4P7I A;  3AU4 A;  2YVC A;  2ZPY A;  4DXA B;  2ABD A; 
#chains in the Genus database with same CATH topology
 4JKD A;  4JKC A;  3PVL A;  2X0S A;  3AU5 A;  1VBH A;  1EF1 A;  3ZDT A;  2CQU A;  1JDE A;  2D11 A;  1GC6 A;  1GG3 A;  3E9L A;  4CYE A;  2DIK A;  3AU4 A;  2YVC A;  3E9O A;  4JKA A;  4ZRI A;  2J0K A;  2D10 A;  1GC7 A;  3FP5 A;  1H4R A;  4JK8 A;  1MIX A;  2FDQ A;  2J0J A;  4JK9 A;  2R82 A;  2HRJ A;  3E9P A;  3FLV A;  4JKF A;  2J0M A;  3U7D A;  3SBT A;  3U8Z A;  2HE7 A;  4F7G A;  2AL6 A;  1VBG A;  2WH5 A;  4P7I A;  2ZPY A;  2ABD A;  4JKG B;  1ISN A;  2EMS A;  4ILJ A;  4EKU A;  4YL8 A;  2D2Q A;  3PZD A;  1ST7 A;  2CB8 A;  4HDO A;  1SGH A;  1Y19 B;  1HB6 A;  1KC7 A;  1GGO A;  1E5W A;  4ZRJ A;  1DIK A;  4ZRK A;  4JK7 A;  1MIZ B;  4TKN A;  3BIN A;  4JKG A;  1NTI A;  5IJM A;  3WA0 A;  2I1K A;  2AEH A;  3ENB A;  3X23 A;  1HB8 A;  1NVL A;  2FJ9 A;  3G9W A;  4GXB A;  4JKH A;  1ACA A;  4ILH A;  4ILG B;  2RQ1 A;  3E66 A;  5JVL A;  4JKE A;  3IVF A;  3EPY A;  3SBG A;  2COP A;  4JKB A;  2LBB A;  1J19 A;  1MK9 B;  1HBK A;  2I1J A;  4NY0 A;  4HDQ A;  1MK7 B;  3QIJ A;  1NI2 A;  2EMT A;  1KBL A;  4DXA B; 
#chains in the Genus database with same CATH homology
 4JKD A;  4JKC A;  3PVL A;  2X0S A;  3AU5 A;  1VBH A;  1EF1 A;  3ZDT A;  2CQU A;  1JDE A;  2D11 A;  1GC6 A;  1GG3 A;  3E9L A;  4CYE A;  2DIK A;  3AU4 A;  2YVC A;  3E9O A;  4JKA A;  4ZRI A;  2J0K A;  2D10 A;  1GC7 A;  3FP5 A;  1H4R A;  4JK8 A;  1MIX A;  2FDQ A;  2J0J A;  4JK9 A;  2R82 A;  2HRJ A;  3E9P A;  3FLV A;  4JKF A;  2J0M A;  3U7D A;  3SBT A;  3U8Z A;  2HE7 A;  4F7G A;  2AL6 A;  1VBG A;  2WH5 A;  4P7I A;  2ZPY A;  2ABD A;  4JKG B;  1ISN A;  2EMS A;  4ILJ A;  4EKU A;  4YL8 A;  2D2Q A;  3PZD A;  1ST7 A;  2CB8 A;  4HDO A;  1SGH A;  1Y19 B;  1HB6 A;  1KC7 A;  1GGO A;  1E5W A;  4ZRJ A;  1DIK A;  4ZRK A;  4JK7 A;  1MIZ B;  4TKN A;  3BIN A;  4JKG A;  1NTI A;  5IJM A;  3WA0 A;  2I1K A;  2AEH A;  3ENB A;  3X23 A;  1HB8 A;  1NVL A;  2FJ9 A;  3G9W A;  4GXB A;  4JKH A;  1ACA A;  4ILH A;  4ILG B;  2RQ1 A;  3E66 A;  5JVL A;  4JKE A;  3IVF A;  3EPY A;  3SBG A;  2COP A;  4JKB A;  2LBB A;  1J19 A;  1MK9 B;  1HBK A;  2I1J A;  4NY0 A;  4HDQ A;  1MK7 B;  3QIJ A;  1NI2 A;  2EMT A;  1KBL A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...