2LBBA

Solution structure of acyl coa binding protein from babesia bovis t2bo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
b'MSADDFDAAVKYVSNTTTMMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRGMSTESAKEAYVKLLDTLAPSWRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl CoA binding protein
molecule tags Protein binding
source organism Babesia bovis
publication title Solution structure of acyl CoA binding protein from Babesia bovis T2Bo
rcsb
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2lbbA00
2HRJA 1GC7A 1HBKA 2EMTA 1GG3A 2FJ9A 2WH5A 3EPYA 2CB8A 2LBBA 4NY0A 2I1JA 4P7IA 3X23A 4F7GA 5IJMA 1HB8A 1MK9B 3WA0A 1E5WA 1ST7A 2AL6A 2J0JA 2D11A 3ZDTA 2RQ1A 2EMSA 1Y19B 1ACAA 1MIZB 2CQUA 1SGHA 1J19A 2YVCA 3BINA 2ZPYA 3FP5A 3AU4A 4HDOA 4ZRIA 3U7DA 3U8ZA 1MIXA 2AEHA 2COPA 2ABDA 1ISNA 1H4RA 3AU5A 3QIJA 1NVLA 4YL8A 1EF1A 1HB6A 2J0KA 3PVLA 1MK7B 3PZDA 2J0MA 4HDQA 4DXAB 1GC6A 1NI2A 2FDQA 3G9WA 2D2QA 3IVFA 2D10A 4ZRJA 4CYEA 1NTIA 2HE7A 2I1KA 4EKUA 4ZRKA 3FLVA
chains in the Genus database with same CATH superfamily
2HRJA 3E9LA 4JK7A 2WH5A 3EPYA 2CB8A 5IJMA 3WA0A 1ST7A 4TKNA 3E9PA 3E9OA 1ACAA 1SGHA 1VBGA 3U8ZA 4JK8A 3QIJA 1NVLA 1EF1A 3PZDA 1GC6A 1NI2A 2DIKA 2R82A 2D10A 4CYEA 1GGOA 1NTIA 2HE7A 2I1KA 1VBHA 1GG3A 4P7IA 1JDEA 3X23A 1HB8A 1E5WA 2J0JA 4JKHA 3U7DA 3FP5A 3AU4A 1MIXA 2AEHA 2ABDA 3PVLA 4GXBA 2J0MA 4JKGA 3SBTA 4EKUA 3FLVA 1HBKA 2EMTA 1DIKA 3ENBA 2X0SA 1MK9B 2RQ1A 2EMSA 2YVCA 1J19A 2ZPYA 4ZRIA 5JVLA 1H4RA 3AU5A 2J0KA 4JKCA 4HDQA 1KC7A 3E66A 4JKFA 4JKBA 3IVFA 4ZRKA 1GC7A 4JK9A 2FJ9A 4ILJA 4NY0A 2LBBA 2I1JA 4F7GA 4ILGB 3ZDTA 2AL6A 2D11A 3SBGA 1Y19B 1MIZB 2CQUA 1KBLA 4JKDA 4DXAB 3BINA 4HDOA 2COPA 4JKAA 1ISNA 4JKGB 4YL8A 1HB6A 4JKEA 1MK7B 2FDQA 3G9WA 4ZRJA 2D2QA 4ILHA
chains in the Genus database with same CATH topology
2HRJA 3E9LA 4JK7A 2WH5A 3EPYA 2CB8A 5IJMA 3WA0A 1ST7A 4TKNA 3E9PA 3E9OA 1ACAA 1SGHA 1VBGA 3U8ZA 4JK8A 3QIJA 1NVLA 1EF1A 3PZDA 1GC6A 1NI2A 2DIKA 2R82A 2D10A 4CYEA 1GGOA 1NTIA 2HE7A 2I1KA 1VBHA 1GG3A 4P7IA 1JDEA 3X23A 1HB8A 1E5WA 2J0JA 4JKHA 3U7DA 3FP5A 3AU4A 1MIXA 2AEHA 2ABDA 3PVLA 4GXBA 2J0MA 4JKGA 3SBTA 4EKUA 3FLVA 1HBKA 2EMTA 1DIKA 3ENBA 2X0SA 1MK9B 2RQ1A 2EMSA 2YVCA 1J19A 2ZPYA 4ZRIA 5JVLA 1H4RA 3AU5A 2J0KA 4JKCA 4HDQA 1KC7A 3E66A 4JKFA 4JKBA 3IVFA 4ZRKA 1GC7A 4JK9A 2FJ9A 4ILJA 4NY0A 2LBBA 2I1JA 4F7GA 4ILGB 3ZDTA 2AL6A 2D11A 3SBGA 1Y19B 1MIZB 2CQUA 1KBLA 4JKDA 4DXAB 3BINA 4HDOA 2COPA 4JKAA 1ISNA 4JKGB 4YL8A 1HB6A 4JKEA 1MK7B 2FDQA 3G9WA 4ZRJA 2D2QA 4ILHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRJ A;  1GC7 A;  1HBK A;  2EMT A;  1GG3 A;  2FJ9 A;  2WH5 A;  3EPY A;  2CB8 A;  2LBB A;  4NY0 A;  2I1J A;  4P7I A;  3X23 A;  4F7G A;  5IJM A;  1HB8 A;  1MK9 B;  3WA0 A;  1E5W A;  1ST7 A;  2AL6 A;  2J0J A;  2D11 A;  3ZDT A;  2RQ1 A;  2EMS A;  1Y19 B;  1ACA A;  1MIZ B;  2CQU A;  1SGH A;  1J19 A;  2YVC A;  3BIN A;  2ZPY A;  3FP5 A;  3AU4 A;  4HDO A;  4ZRI A;  3U7D A;  3U8Z A;  1MIX A;  2AEH A;  2COP A;  2ABD A;  1ISN A;  1H4R A;  3AU5 A;  3QIJ A;  1NVL A;  4YL8 A;  1EF1 A;  1HB6 A;  2J0K A;  3PVL A;  1MK7 B;  3PZD A;  2J0M A;  4HDQ A;  4DXA B;  1GC6 A;  1NI2 A;  2FDQ A;  3G9W A;  2D2Q A;  3IVF A;  2D10 A;  4ZRJ A;  4CYE A;  1NTI A;  2HE7 A;  2I1K A;  4EKU A;  4ZRK A;  3FLV A; 
#chains in the Genus database with same CATH topology
 2HRJ A;  3E9L A;  4JK7 A;  2WH5 A;  3EPY A;  2CB8 A;  5IJM A;  3WA0 A;  1ST7 A;  4TKN A;  3E9P A;  3E9O A;  1ACA A;  1SGH A;  1VBG A;  3U8Z A;  4JK8 A;  3QIJ A;  1NVL A;  1EF1 A;  3PZD A;  1GC6 A;  1NI2 A;  2DIK A;  2R82 A;  2D10 A;  4CYE A;  1GGO A;  1NTI A;  2HE7 A;  2I1K A;  1VBH A;  1GG3 A;  4P7I A;  1JDE A;  3X23 A;  1HB8 A;  1E5W A;  2J0J A;  4JKH A;  3U7D A;  3FP5 A;  3AU4 A;  1MIX A;  2AEH A;  2ABD A;  3PVL A;  4GXB A;  2J0M A;  4JKG A;  3SBT A;  4EKU A;  3FLV A;  1HBK A;  2EMT A;  1DIK A;  3ENB A;  2X0S A;  1MK9 B;  2RQ1 A;  2EMS A;  2YVC A;  1J19 A;  2ZPY A;  4ZRI A;  5JVL A;  1H4R A;  3AU5 A;  2J0K A;  4JKC A;  4HDQ A;  1KC7 A;  3E66 A;  4JKF A;  4JKB A;  3IVF A;  4ZRK A;  1GC7 A;  4JK9 A;  2FJ9 A;  4ILJ A;  4NY0 A;  2LBB A;  2I1J A;  4F7G A;  4ILG B;  3ZDT A;  2AL6 A;  2D11 A;  3SBG A;  1Y19 B;  1MIZ B;  2CQU A;  1KBL A;  4JKD A;  4DXA B;  3BIN A;  4HDO A;  2COP A;  4JKA A;  1ISN A;  4JKG B;  4YL8 A;  1HB6 A;  4JKE A;  1MK7 B;  2FDQ A;  3G9W A;  4ZRJ A;  2D2Q A;  4ILH A; 
#chains in the Genus database with same CATH homology
 2HRJ A;  3E9L A;  4JK7 A;  2WH5 A;  3EPY A;  2CB8 A;  5IJM A;  3WA0 A;  1ST7 A;  4TKN A;  3E9P A;  3E9O A;  1ACA A;  1SGH A;  1VBG A;  3U8Z A;  4JK8 A;  3QIJ A;  1NVL A;  1EF1 A;  3PZD A;  1GC6 A;  1NI2 A;  2DIK A;  2R82 A;  2D10 A;  4CYE A;  1GGO A;  1NTI A;  2HE7 A;  2I1K A;  1VBH A;  1GG3 A;  4P7I A;  1JDE A;  3X23 A;  1HB8 A;  1E5W A;  2J0J A;  4JKH A;  3U7D A;  3FP5 A;  3AU4 A;  1MIX A;  2AEH A;  2ABD A;  3PVL A;  4GXB A;  2J0M A;  4JKG A;  3SBT A;  4EKU A;  3FLV A;  1HBK A;  2EMT A;  1DIK A;  3ENB A;  2X0S A;  1MK9 B;  2RQ1 A;  2EMS A;  2YVC A;  1J19 A;  2ZPY A;  4ZRI A;  5JVL A;  1H4R A;  3AU5 A;  2J0K A;  4JKC A;  4HDQ A;  1KC7 A;  3E66 A;  4JKF A;  4JKB A;  3IVF A;  4ZRK A;  1GC7 A;  4JK9 A;  2FJ9 A;  4ILJ A;  4NY0 A;  2LBB A;  2I1J A;  4F7G A;  4ILG B;  3ZDT A;  2AL6 A;  2D11 A;  3SBG A;  1Y19 B;  1MIZ B;  2CQU A;  1KBL A;  4JKD A;  4DXA B;  3BIN A;  4HDO A;  2COP A;  4JKA A;  1ISN A;  4JKG B;  4YL8 A;  1HB6 A;  4JKE A;  1MK7 B;  2FDQ A;  3G9W A;  4ZRJ A;  2D2Q A;  4ILH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...