3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
molecule keywords Myosin-X
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
4IWQA 1KOTA 1PFJA 3KRWA 2FIFA 2RPQA 3PSCA 5LXIB 1P98A 1M94A 4CYEA 1WJUA 3G9WA 2GJYA 2N7EA 1S3SG 3MHSD 3VUYA 1BTNA 1Y5OA 2JVCA 5L83A 4DDID 4IWPA 2JP2A 4KSLC 2O2VB 3OJ3A 2OOBB 1V49A 5LONB 4RM8A 2FNJB 5CLLB 4MSMB 1WX7A 3OAWA 2YLMA 3JVZX 2GBJA 1UBIA 2ZNVB 2RD0A 3N3KB 4IWOA 1TBEA 1C3TA 1N3HA 4MSQB 2LRUA 2L00B 4IUMB 2IO2B 3DBRI 3BINA 4IAPA 3QA8A 4FHJA 1HB8A 2KGXB 3NSUA 4HB2B 1FHWA 1YX6B 3M3JA 3QC8B 2D10A 4HPMB 4CO7A 2KUPA 1LQBA 1YJ1A 1WX9A 3VTVA 4OVUA 3ZIMA 2GBKA 2KZRA 3F5RA 2YS3A 2JWZA 3NZUA 4Z2MB 5IJMA 1Z87A 4HB0B 4GB9A 4HJKA 2KFJA 4WJ7A 2R09A 3L16A 1L2NA 4ANWA 1KJTA 2UVMA 4HWIB 2COPA 3PLUA 4WWPA 2CQUA 2P0HA 2WYQA 5CHWA 4FADA 4MY6A 2DYQA 3K9PB 1RAXA 3APDA 1NBFC 1WYWB 2C60A 5KHOA 3SDLC 2JXXA 1WZ3A 4DBGA 5JHAA 1OEYJ 2MQJA 1I7AA 1W1GA 4MH0E 2EC1A 5KQ1A 3NS8A 3ML4A 5CX3A 1ZGUB 4E74A 2CU1A 2JUOA 3RYTA 3WALA 2RLOA 2KLCA 5DIFB 4W9HA 4W9CA 1KZGA 1V5UA 2LG1A 4MK0A 5DPSA 2K2JA 2KTFA 4F7UP 3EC8A 3V62A 1AWEA 2Z0OA 1NDDA 1UGMA 1UNPA 5GOWB 4WVFB 2JZ3B 1XT9B 2KDBA 1WXVA 2M8SA 3DOWA 3IHPC 4KZ0A 1XR0B 1BT0A 4LJPB 4W9FA 2AEHA 2IZVB 2N23A 3ML8A 4W9JA 4RM9A 3ZDMC 1HBKA 3CIKA 5LXHA 3VVWB 4KDLB 4DXAB 4TQ1A 1MK9B 1WGUA 4K17A 4LDTB 3ZKJC 4BOSC 2Z0QA 3B08A 3A9JA 3HW2B 2KDEB 2W2WA 3L54A 2LJ5A 3NY5A 3F0WA 4DX90 5D94A 3VHTC 4BKGA 1U4AA 1RLFA 2QKMA 2MW5A 3A1QB 2ELBA 3C0RB 3CXBB 3FEHA 3OANA 3WYFB 2KQSA 1AARA 3ENEA 1P6SA 3IBEA 2RQ1A 1NTVA 1M7EA 1NTYA 3QWMA 2BKRB 3KW5B 2D07B 2I1JA 3PS6A 2LXCA 3QJZA 2KMCA 4W9GA 3SD5A 2DTCA 4G3XB 2AL3A 3N7CA 4M0WB 3KUDB 3IG3A 1FHXA 4HDOA 4NY0A 2COAA 1R4MI 5FI0A 2IO0B 2J7QB 3SHQA 2LYDA 1XKEA 1ACAA 3ZO5B 3SV1A 2GBMA 3P7ZA 1Q5WB 2DHZA 2MBBB 3O65B 3QX1A 5L95C 4ANVA 3WA0A 1WJ1A 2K2UA 1JRUA 2KX0A 4PQ0A 3BY4B 3PRMB 1XX0A 4HVBA 4YONA 3QHTA 5AZGA 1UH6A 2KD0A 2DN6A 1UZXB 3FM8C 1S1QB 1RFAA 3A98B 2KFKB 1YIWA 2JPHA 3OJ4B 1E8XA 4KZCA 4AOFA 4DHJD 3T06A 2FJLA 2EMTA 4ZRKA 1MPHA 3QCAA 4HK2A 1MAIA 5DHFB 1WM2A 3ECIA 3DXDA 5LLIA 3TCAA 1MIXA 3APFA 4WWOA 5E6PA 3RUIB 2ZPYA 3S2AA 2MWSB 3Q3JA 4DHJB 2G4DB 2O6VA 1DYNA 1V2YA 5E6NA 2Q13A 2GS0A 4I6PA 3ZW3A 4EOYA 1UEFA 3AXCA 5DH9B 1Z5SB 2IY0B 4K1RB 4GMXB 1ZW7A 4WAAA 3RT3B 4BVUC 2N7DA 1WGGA 4PS3A 3PLVA 4HAVB 1YQBA 4K81A 3JSVA 4I6LB 4EJNA 3H9DA 1UBQA 5IAAC 2PZ1A 4B6HA 1OEYA 2BYVE 2KDFB 3DBLI 2KWCA 5FR6A 2CY4A 2R0DA 2D9VA 4ANXA 5DI9B 4M8MA 3KSYA 1GUAB 2A4ZA 4F7HA 1QQGA 1MK7B 2IO1B 3TMPB 4BKSD 3HIZA 5C79A 2HE7A 1KM7A 4K7UA 1SHCA 1LB1A 2D9ZA 2I5CA 1E8YA 3A4SC 4EUTA 5KHQA 5GMVA 4KSKC 2E2XA 2XK5B 4KHBB 1EO6A 2MA9B 4I6NB 5C5BB 4MEMA 4WJQA 1W1HA 3WAPA 2KWUB 4A3OA 1X1GA 4FJYA 2D11A 2FCQA 2KLGA 4FULA 2P0DA 4K2OA 3VFKA 4HAZB 2L8JA 2LUEA 1TGZB 4Z2NA 3TW1A 1WMHA 3AU4A 2QHOA 4JGHB 2YT0A 1X1FA 3NZSA 3UIOB 2KFKA 3SNHA 3AI5A 4EZKA 1FB8A 2WH5A 1C1YB 2KXJA 2LRWA 4G11A 1UPQA 1WG7A 3RCPA 4II2B 2G45B 3RZWC 2K00A 2L1CA 4HCNB 4EZJA 5BO4B 1OQYA 2KCJA 2DX5A 3FP5A 5CLQB 3TVVA 3ZVVA 2DA0A 2KJ6A 2DHKA 1I2HA 3QAQA 2JZZA 1A5RA 2C7MB 4EFOA 3WAOA 4BBKA 3UIPB 1MKEA 4GN1A 4IM3A 3HQCA 2YS5A 3PV1A 2G4SA 1SGHA 3SYXA 2D9WA 1H8CA 3AU5A 2L05A 2ZCCA 2K39A 1H10A 4C0AA 2WX0A 3A1QA 3IFWB 4IM0A 4E3CA 3L0WB 1E90A 2FUHB 1UPRA 3NHEB 3U7DA 2JT4B 1OQNA 3SO6A 1V89A 1KI1B 2DYMA 4MGZE 4W9KA 4ZRJA 2DZJA 2W2XD 3TO1A 2ZNVC 5D2MB 2M4NA 3CMMB 1V5PA 4NJ7A 4AUQC 1J8CA 2CHWA 4BBNF 1ISNA 2MBOA 2Z0DB 3TBLD 5DPWA 2KKCA 4GMVA 4HAXB 1V86A 4NSWA 1DDMA 3H6NA 4FN2A 4NJ6A 2N4FA 3P6AA 5AZFA 3DQVA 4AWJA 2DX1A 5D3XA 3DPDA 4NNJB 5CHVC 2H7EA 2MDXA 2DZIA 2KNBA 3PRZA 2FJ9A 2MLBA 3TFMA 4PNKA 1V9JA 3D8FA 1E8WA 3L13A 3PHXB 1TXDA 3ZRFA 4F1SA 4ZDVA 2PPHA 1SIFA 1HB6A 2MP2B 2CRFA 4KHAA 2CHXA 3R3MA 2DKPA 5HE3A 1E7UA 2R2OA 3A9KB 4FHKA 2RNRB 1EUVB 4W9IA 2GMIC 4A20A 5JH5C 2DZKA 3KH0A 1WY8A 2UWQA 2MKRA 3N32A 3OLMD 3VAWA 3M1IB 5J3QA 5HE0A 2NCNA 2K6QA 3N30A 3CF6E 2DHJA 2DYOA 2MSED 4PYUA 4PS7A 3PREA 1WZ0A 1K5GB 2FCMA 2N9EB 2WX1A 3A4RA 1NU2A 2BYEA 2KC1A 2JRIB 4WJNA 3V61A 3W1SA 1V5OA 4A5KA 4X57B 1XCGA 1YX5B 3HM3A 4CHKA 2BPSA 2RSGA 3HHMA 4PS8A 5TR5A 3DVGX 2L3ZA 1ZC4B 2BKFA 3T8MA 4W9LA 2BF8B 1LFDA 1WGDA 2Y8FA 3D32A 4NAWB 2JY6A 2MX2A 5J18A 3UZTA 5G55A 1RRBA 2RVBB 3VXWA 2CR5A 2LGYA 2D2QA 4A6HA 1W1DA 1XODA 2ASQA 3VUWA 1DROA 2UYZB 3MTNB 2Z0PA 3PSEB 4II3B 3PGEA 1J19A 5CHFA 4LJOB 2V4LA 5C1ZA 1FGZA 2Y5BB 3GYPA 1L7YA 2KDIA 1GC6A 1Q1OA 2XEWA 1VD2A 1FAOA 4GOCA 2FAZA 1NI2A 4NQKE 2L7RA 3AJ4A 1WE7A 1WF9A 3SU8X 3UINB 3ZRCA 2BCJA 4HHVA 2M0XA 4RMAA 1Y8RC 1OTRB 4L6EA 1WXMA 2Z0EB 3JYUA 2KOXA 1IYFA 1P0RA 1X86A 4G0NB 2GBNA 4KDIC 2UZRA 3ZNID 2Z59B 3DCGA 2L76A 2G3QB 2KJHB 3WANA 3D8DA 3ZNHB 5IA7A 5JZEB 1MIZB 3VTWA 1DBHA 1J0WA 2B3AA 1FXTB 3PVUA 1QC6A 3AULA 4GSWA 3PT2B 2ABDA 2J0JA 4W9DA 3KYCD 1LXDA 2OTXA 4TUUA 2GCLA 4GGQA 1X11A 3O96A 1MG8A 2FIDA 4MJSA 5J3TA 3VOQA 1BAKA 1FHOA 4ICVA 4TV3A 2BGFA 2JF5A 4PYZA 2NPTA 2OJRA 2CY5A 4JQWC 3LDZE 4XZ4A 2Y7BA 2KWVB 4MGIE 4IC7B 2XQNM 2RR9A 3HM6X 3ZVRA 5DPRA 2LGDA 3W1YA 4P7IA 3IVFA 4A3PA 1D3ZA 4F7GA 2ZPNA 1TTNA 2D9YA 3QQ8B 4DWFA 4CHJA 2FCNA 2HJ8A 4KAXB 2D3GA 2KK8A 2KTRB 3RD2A 1WX8A 1BTKA 4OVVA 2NBUA 5EFXA 2ZVNA 3EPYA 4BBNC 4WJOA 4URKA 1WGYA 2OQBA 5D27A 3VIAA 4D0NB 3V6EB 3FLVA 3UQAA 4WSFA 1WI0A 3Q3FA 3WIMA 1WR1A 1ZSQA 3QWZB 2K25A 4BKSA 1WRDB 1OGWA 5LOPB 2N9XA 4JL9A 5G2NA 3R7QA 4E71A 4KV2A 1WGHA 2K8BA 2LGXA 2ROZB 1ZC3B 1FOEA 3LJUX 3PEGA 2P0FA 4WQOB 2LZ6A 3CSTA 5FI1A 1U2BA 1R4NI 1ZKHA 3B1LX 3ODWA 3ML9A 4GDKA 2ZJDA 3ZTDA 3QIJA 3BJIA 1E7VA 2L0TA 2C9WB 4GPTB 4BOZB 5JP4A 5DPTA 1TJ6A 1WR6E 4TYZA 4NPNA 4FA6A 1EF5A 2BYFA 2M14A 1V80A 2IY1B 3GYOA 1F9JA 2KVRA 2MBEA 2MBHA 2DLWA 1K5DB 1M7RA 2DYNA 3B0AA 3T9LA 2KANA 4GDLB 2NZ8B 5J2RA 2W9NA 2MWNB 1RJ2A 3PG7A 4KHOA 3ULBA 4A6FA 1WH3A 2RUKB 3JSVB 4HLEA 4MGKE 1U29A 4MT7A 2DAFA 1X1MA 2WDTB 3M63B 2LASA 3ZUNA 2K6DB 4IOYX 4KVGB 3H7PA 1UNRA 2NPTB 2XBBC 3W1SC 4DX8A 4MGYE 2LVPA 4ZYNA 1WJ4A 4AJWA 1EF1A 5C23A 4TQ0A 2O6VD 1Q67A 4DHZE 1V61A 1CMXB 1U5DA 4K7SA 2ZCBA 4NAWA 4DHZB 1TZ1A 2XK5A 2KHWB 3EECA 4ICUA 2LXAA 3VH4B 4AJYB 2ZVOA 1H4RA 3A8QA 3TL5A 2D9XA 2EJ8A 1P3QU 2MCNB 3ONSA 3PZDA 1GG3A 2P8VA 1T0YA 2LVOA 3P2BA 2FCSA 2KN5A 2YT1A 5J3YA 3R66C 4KIKB 4MELA 4HDQA 3U30A 2L0FA 1WXAA 1EGXA 2BWES 3KUZA 2C5LC 2CB8A 1FGYA 2LBBA 2A5UA 1K8RB 2IBIB 2MP2A 2N1WA 2W2XC 5AZHA 5C6RA 3X0WA 2ADZA 3RULA 4NQLB 1NTIA 2N9PC 2K8CA 3ODXA 2DX5B 4FBJB 3UGBB 1U5GA 3A33B 3DDCB 2CS4A 2M1MA 2O2VA 2MFQA 5D3YA 2V1YA 3ZNZB 2UZSA 2AWTA 2DYBA 2PJHA 1WJNA 4MM3A 2H7DA 1V88A 2FDQA 2COFA 2DKQA 2ROVA 5C16A 2LWPA 5D3WA 4G50A 5L81A 4GDLA 1XQQA 4HPLB 4IM2A 1WM3A 4J6IA 3GZNI 4EEWA 5HKHA 1B55A 2J0MA 4EMOA 2YS1A 1Q0WB 2R2QA 1PMSA 2NBVB 1WIAA 5JHHA 3A9JB 3JW0X 3V60A 2PE9A 2RGFA 4B9KA 4KIKA 4FJVB 1EAZA 2AYOB 2JRHA 4XX5A 4W9EA 3EFUA 3H7PB 2DHIA 2M17A 1WJMA 3PTFC 3TJPA 3PP2A 3VH3B 1WFYA 1V81A 4AP4C 1RRPB 1UELA 1OY2A 3V5WA 2NR2A 3VTUA 3R7RA 4BKTA 2GBRA 4FJZA 4K7WA 5D6JB 3DXEA 4HCPB 3V6CB 3X23A 1DDVA 2KC2A 2C7HA 2KQ7A 2DAJA 2DENB 5D3VA 2NVUI 3A9KA 3MJWA 3VUXA 5CTRC 2I5FA 1V5MA 5D7GA 4IW0A 2V3SA 2N0YA 1P3RA 3FSSA 2N1VA 3GOEA 2LOZA 3ZLZA 2VSZA 4HB4B 2LI5A 2PEAA 3DBSA 4EZLA 1XD4A 2ZZPB 2L2IA 2K1FA 3M95A 3UF8A 3L17A 1E8ZA 1P5TA 4XC2A 4DK5A 1I35A 4LDTD 3ALBA 2J0KA 3KUCB 3DVNV 1PLSA 3M62B 2VRRB 4BFRA 5JHGA 3PRPB 4MJSB 2GCJA 2RGNB 1SE9A 2DFKA 2IYDB 2NBWB 4F7ZA 2O6VB 4B95A 4CHMA 3QARA 3PPAA 3DBHI 2C7NB 4HAYB 1G6JA 1WGQA 5KCVA 2HTHA 3U8ZA 2HRJA 1GJZA 3APCA 2CHZA 3ULCA 5JLJB 2V76A 2YSZA 3DVGY 2VRWB 3RZFA 2KTRA 3TIXA 3ZTCA 4HAUB 1V6EA 3D8EA 4H8SA 4HAWB 3KRXA 1WJ6A 3WAMA 2CODA 3H7SA 2GOWA 3UQBA 2LOXA 1TQZA 2CAYA 4LCDE 1KZ7A 1UNQA 1LW3A 4IFSA 1QZEA 2MBQA 2M38A 1V5TA 3L10B 2HD5B 3PHWB 1AQCA 1BWNA 2KJRA 3HK0A 1UD7A 2IO3B 2LULA 3DXCA 4K2PA 2K8HA 2WWZA 5AEKB 1I42A 1E5WA 3NOBA 2NMBA 4WJPA 4GDKB 1Y19B 4F8CB 4HB3B 3KYDD 3RCZA 2ELAA 5HE2A 4GIVA 1X05A 1WMHB 2CKHB 4ASWC 3SUZA 4YL8A 2Y8GA 4GU2A 4JIOU 4N9F4 4ANUA 2I1KA 4IG7B 2LKOA 2X18A 3H1UA 2KMAA 5J17A 3CSFA 2KX3A 3K9OB 3QBVB 1HE8A 4ZRIA 3KZ1A 2KO3A 1P9DU 2DZMA 1EVHA 3L08A 1VCBA 3VQIA 4B6WA 3ZDTA 5KQ4A 1ZM0A 1WGRA 1XD3B 4A6FB 1WXSA 2YF0A 1Z2MA 2ZEQA 3I3TB 3QK0A 3LJ3A 1GC7A 2LD9A 2QKLA 1DDWA 3MPXA 1GNUA 4JLCA 1IPGA 1WE6A 1LM8B 2NS5A 5E6OA 2YRYA 4WWNA 2IFSA 3KY9A 1PQSA 4HXDA 4DBBA 2EKEC 3EHVA 2EMSA 2G35A 2HTHB 5HE1A 4HATB 2AL6A 2RSUA 5DCNA 4M8NA 2IYBA 2J59M 5DHAB 4EKUA 4DDGD 2VKIA 1U27A 1ST7A 4A6KA 1WI1A 3DVNU 1IP9A 1KLVA 1WVHA 5JHBA 1NVLA 1ZVRA 1J0GA 2PE6B 4TKNA 3ZNGC 2D4QA 2MRPA 1P1AA 3VDZA 3MDBC 4GXBA 3PVLA 4Y94A 1U5FA 4GZUA 2COCA 2REXA 3A8PA 4FLHA 5C5BA 1YD8U 3ODOA 2BWFA 1OMWA 2LVQA 1U5EA 4XWXA 3PVWA 3KVFB 4MDKE 1IRSA 5EDSA 2YVCA
chains in the Genus database with same CATH superfamily
1PFJA 2FIFA 1V54E 1M94A 3S7DA 1WJUA 2GJYA 4NIKA 1BTNA 4HPPA 3VUYA 2OEWA 2J09A 3WG7E 3DCXA 1QOFA 2HE0A 5CLLB 3O4ZA 1WX7A 3U9WA 5EKQD 4Q69A 1X81A 4A1GA 1L0VB 1P7EA 1TBEA 3DBRB 2WVIA 2LRUA 4U8YD 3DBRI 3UINC 4BX8A 3QA8A 2DIKA 2WQHA 2ZU6B 1HB8A 1YX6B 1HTQA 1XD3B 2D10A 2QIEB 3AM9A 3F6QA 4F53A 1WX9A 3SGHA 4JKGB 1JW9D 3NZUA 5LP0A 4GB9A 3FTSA 4LNKA 2FF4A 1ELKA 2AXVA 3DSUA 1L2NA 1YNTE 3PLUA 2CQUA 2P0HA 2WYQA 4MY6A 5LCWC 1ELWA 4CYMD 3NRZA 4RVBA 3TWXA 3EUVA 3NOCD 3SDLC 1RYJA 4DBGA 4F1PA 1KOTA 4MH0E 3MV2B 3ML4A 4E74A 3SBTB 1N4RA 2ILRA 2CU1A 2I9CA 2OVFA 4EPZA 1KZGA 4YXDB 2KTFA 4F7UP 3U4TA 2RKKA 1I4PA 1UGMA 5GOWB 2M8SA 3ZXRA 1WXVA 1EU4A 3PUJA 3IHPC 5C3JB 1BT0A 4LJPB 3D3MA 2AEHA 5ARFA 3GE3C 1HBKA 3ZYQA 1MK9B 2RG8A 2N9KA 3SF4A 1WG0A 2KCKA 3LXUX 2CFZA 3LVQE 4UDUC 4HS2A 3L54A 4DX2A 1SJHD 2KDEB 3VHTC 3TEYA 5M4YB 1U4AA 4UUCA 3UQBA 3A1QB 5JZEB 3FEHA 3WYFB 1OFFA 4IWOA 5I2MA 2D07B 2LXCA 3IHVA 3DBLB 1MHQA 4M0WB 1QQEA 1YOVB 3DXKG 2XEHA 1JRPA 2QFCA 2FEZA 2IO0B 2J7QB 3Q6BA 1UW4B 5EE9A 2LYDA 2ICIA 3SHQA 3QC1A 1Q5WB 2DHZA 2KR0A 3O65B 4YVOA 3WA0A 4S0RA 2OOEA 4JEHA 3QHTA 4CZ2D 4BEPA 2DN6A 1OQRA 2YT2A 4PH4B 3FM8C 2KFKB 2J07A 1YIWA 4AOFA 4KZCA 2JPHA 1K3ZD 4ACFA 1HH8A 2IO2C 4JA7A 3ASHA 2GUMA 4HK2A 4HSIA 3AE6B 4P16A 2ZW1A 5C1DA 3URYA 5LLIA 4FC8A 1MIXA 2KQ4X 3Q3JA 3SY2A 4LNBA 5D0OD 2G4DB 2O6VA 4O1PA 1JCQA 4EOYA 1IQUA 1ENFA 2ACZB 4K1RB 2X3MA 3E37A 2LXLA 3NF1A 1PAQA 4B6HA 2BYVE 2KDFB 3AH7A 2YNQA 5DI9B 3KSYA 1NVID 1QQGA 1MK7B 2AQ3B 2WQ6A 5C79A 2HE7A 2H89B 2JU6X 2QCZA 3A4SC 5KHQA 5A7DB 3ONLA 3AEEB 1N0QA 2KIGA 4IRUA 2B76B 3WAPA 1W1HA 1FVHA 4TXPA 2KZTA 2L9BA 3FTXA 3GP7A 3BZDB 3HUIA 3PZ8A 3VFKA 4HAZB 4J8FA 2LUEA 1WAO1 2QHOA 4JGHB 5G05J 4BY6A 5JJ7A 2Z59A 3FU0A 1FFVA 2VGXA 1FB8A 2LRWA 4GA2A 3RCPA 3RZWC 2G45B 1OQYA 1K8KG 3ZVVA 2AJAA 1E96B 2WXNA 3IEGA 2DA0A 3TVVA 3CWIA 1T0SC 4N59A 3WXXA 3QAQA 1I2HA 2JZZA 4ACLA 4L1BA 4EFOA 4BBKA 3UIPB 3B7TA 4G8KA 1MKEA 3N71A 4UQZA 2XRYA 1SGHA 3TWTA 5EIBE 3AU5A 3U64A 3N1XC 4IM0A 1GGOA 4C0AA 1JROA 1UPRA 4IKGA 1V89A 4ZRJA 2W2XD 4AUQC 4NURA 3I63C 4NJ7A 4DLOA 2KMMA 3QWWA 4A55A 4GNKB 1XF5L 1L6UA 1DDMA 1Z3YA 3DHHC 3CR3A 5DIZA 2H7EA 2MDXA 1TEZA 3HXCA 1V9JA 1E8WA 3FU6A 3ZRFA 3MGBA 1MG4A 1SIFA 2MP2B 2CRFA 2CHXA 1SZAA 1E7UA 4GU5A 3A9KB 3V2OA 1WGKA 4A20A 2GMIC 1YJJA 3TG5A 3GZ2A 4ILGA 2MKRA 1N52A 2VGXB 5J3QA 5ENNA 2MSED 3ZHEB 1K5GB 2XEVA 3IHYA 2M19A 4X57B 3HM3A 4RSYA 1ZC4B 3AEFB 4W9LA 2K49A 2MHJA 1LFDA 1WGDA 4NAWB 3UZTA 2XZDG 2RVBB 1YMPA 3W9FA 2PNNA 2OEDA 1HO8A 2J49A 1XODA 4M01A 3IT6B 3MTNB 3V31A 2I38A 4EE2A 5CHFA 2V4LA 2KDIA 1V8CA 4WUYA 3CVWA 4NQKE 4CGVA 2FAZA 3AJ4A 4RLYA 1WE7A 2G1EA 1FM0D 5H92C 2BCJA 3BK1A 3J5PA 2KN4A 1HF8A 3AE9B 3JYUA 1NI3A 4L1RA 1IYFA 2XCCA 2L52A 3HXDA 3DCGA 3PZ2A 1LO5D 1MPEA 5IA7A 1DOIA 2R5SA 2WXLA 4GTMA 1J0WA 1HQRD 1FXTB 3PVUA 2B3AA 4W9DA 1TY2A 3PT2B 2J0JA 2XS1A 4JE3B 2K0PA 3MKRA 4WNGA 2FIDA 3EA6A 1ZP0B 2NTTA 1L4DB 2GRPB 2JF5A 2RDBC 2NPTA 2WDRB 1RM6C 1FT2A 4BX9A 3ASNE 1FCCC 1TS4A 3HM6X 2VSXE 3W1YA 1H6OA 4I9CA 4DWFA 2FCNA 2KK8A 2V0PA 5CRVA 4G2VA 4KX6B 3FUHA 2AQ2B 2V5FA 2ZVNA 4URKA 1ELRA 3UKRG 5D27A 4D0NB 3V6EB 3FLVA 3Q3NC 4U0SA 3Q3FA 1HXYD 5FWQA 4G25A 3HVDA 5LOPB 5G2NA 4E71A 1IXVA 1FNUA 1ZOYB 1KF6B 3LJUX 3I5JC 4K0RA 2Z14A 4TSSA 5FI1A 3RNGC 3ZTDA 4HOSA 2L0TA 1K50A 3E56A 4NPNA 2YHEA 4ILGB 5JA4D 1V80A 2IY1B 2F8XK 2HO1A 3T9LA 1GAQB 4GDLB 2NZ8B 5J2RA 3IAS1 4A6FA 3JSVB 1JPLA 4MT7A 4BESA 1X1MA 1UN8A 4C0EA 3ZUNA 3T3OA 2K6DB 3LKUA 4IOYX 3DSTA 1UNRA 4HQDA 2XBBC 3C19A 3SFXA 3RJVA 2LVPA 4AJWA 1KLGD 1EF1A 4MLPA 2J53A 2VQ2A 1V61A 2QEJC 1U5DA 4K7SA 1LTXA 3UIPC 3V3XA 1H19A 3CHPA 2H6IA 2D5GA 3TL5A 2FE8A 3E9SA 4KGSA 1C9FA 2H6GA 1JCRA 4TUMA 3R66C 4HDQA 3CLJA 2VZKD 1WXAA 1EGXA 3KUZA 3EU9A 2C5LC 3DSWA 1FGYA 2YQ8A 2IBIB 1D4BA 3AE1B 5AZHA 2DWQA 4C7ZA 3RULA 2AXUA 3AJIA 4NQLB 1MHXA 4GTSA 3ZJTA 1RFKA 2K8CA 3QNKA 3UGBB 2CS4A 1KC7A 2PQRA 1E7PB 1I4HA 1JMLA 4HPLB 3E66A 1QZ2A 3RU0A 1UG3A 5D3WA 5L81A 4GDLA 1Q10A 3D9LA 5HKHA 3GZNI 1TN7A 3SFZA 5HQ8A 3EUB2 2J0MA 1PMSA 1WIAA 5JHHA 4XDDA 4B9KA 1Y8MA 2WPVA 4JL0A 3RRUA 2DHIA 4HRSA 2YEPB 1WJMA 4G8LA 1H2VC 5KWDA 3TJPA 2BW2A 1OY2A 2BS2B 3KQ4A 3DHIC 2ZKMX 3NVZA 4F7AA 1HFAA 3AG1E 5IOIA 3MA5A 3IV0A 1DDVA 2KC2A 3C5RA 1C78A 5J08A 4U96D 1TNBA 2I5FA 4QAYA 1DOXA 4DI4A 1P3RA 1SEBD 4EZLA 3E33A 2J4XA 2XPYA 2L2IA 3FH8A 3UF8A 2FBNA 2PL2A 3ASOE 1AWCB 3DVNV 3CK8A 2VRRB 1L0YB 3NW8A 1N4QA 3MC0B 3B9JA 3OHMB 1MYOA 2MJEA 4X8QA 1WWTA 2L32A 4U8HA 5D3IB 3TEWA 3DHGC 4US8A 1WGQA 2R82A 3LXFA 2WXQA 2GRRB 2V76A 1IHBA 4CSQA 3D8EA 2QDFA 3WAMA 4ARIA 3H7SA 1EF1C 2P9PG 5CERB 1E10A 2HD5B 2WWZA 1E5WA 1TT5B 2WXOA 4U0UA 1QQRA 2K22A 3G2TA 2V9HA 3HSAA 2SAKA 4GU2A 1EYHA 2I1KA 2AWIA 2KMAA 5J17A 2KX3A 3KZ1A 2KO3A 3W9GA 2ZEQA 3WCQA 2RFMA 3LJ3A 5AN8A 1FCHA 1GNUA 1LM8B 5BV1A 2YRYA 4CEMA 3EHVA 2EMSA 2RSUA 4RF1A 3RSEG 4N39A 1FXIA 1WSPA 2J59M 1ZXHA 4M0WA 4EKUA 4DDGD 1KLVA 1ST7A 1IP9A 2EILE 4XDCA 4B8AA 3JUEA 3VDZA 4GXBA 4I6JA 2CG3A 2ZGDA 1U5FA 4FLHA 2UY1B 2C0MA 3VLFA 4ILHB 1OMWA 1SW6A 5AQ7A 5B1BE 3LYAA 4UI9K 4V3IA 3BQOA 3R9MA 2RPQA 1U2VG 4CQNA 5AAOA 1VZ6A 3LY9A 1P98A 1C76A 3G9WA 2PW9A 4RH6A 4DXGA 5L83A 1Y5OA 1L5JA 2IFUA 4L2YA 4L9PA 2WXHA 3PZ7A 3AEGB 1FIQA 5LONB 2NMQA 2VTBA 1N54A 2FNJB 3B95A 4ILJA 2PLPA 4C80A 2YLMA 3LJNA 1UNSA 1YN4A 4BTBA 2GW1A 1UBIA 1C3TA 4MSQB 4K5CA 1BI8B 2LSVA 4ATGA 1NEKB 1OCCE 5ENTD 3NSUA 4HB2B 3OWEB 5EE1A 4JKCA 2DCPA 2RDGA 3CVLA 1YJ1A 3ZIMA 2Y5PA 2KZRA 3PNLB 2WXKA 5IJMA 1Z87A 3FTWA 4HB0B 4Z2MB 2IGGA 1SIJA 3UIOC 2X0SA 2WNMA 3P63A 4WJ7A 2R09A 3L16A 1XLPA 2V4HC 1K51A 1SB3C 3ESKA 3VRAB 3VLDA 2DYQA 3APDA 3ISMC 3NWAA 4JK9A 3MFGA 3FHEA 5JHAA 1OEYJ 4M02A 3NB2A 2MQJA 1BPOA 4Y6CA 1W1GA 3DWGC 4XI0A 3T8KA 2JUOA 4OZAA 3IXEA 2RLOA 5DIFB 2J4DA 4FU3A 4W9HA 1N11A 2LG1A 2QYJA 3Q47B 5HI7A 5H7PA 3B77A 4UWKA 2KDBA 1UNPA 4ZHOA 1XT9B 4W9RA 4W9FA 4W9JA 2W54A 2JYEA 2IO3C 3CIKA 1MX4A 4K17A 1WGUA 4LDTB 4JKDA 2WM9A 4BOSC 3T3NA 2NBVA 3A9JA 2TSSA 3HW2B 3Q73A 2D3AA 4DX90 3FDHA 1RLFA 3RN9C 4A8XC 1K1AA 3CXBB 3VTVA 3IBEA 4EZJA 2K8EA 1P6SA 1CJEA 2DVWA 3KW5B 3QJZA 4W9GA 3SD5A 2HM8A 2W82A 1R4MB 3N7CA 4KHBA 1HA5A 2X6FA 3ZYLA 1FO4A 1C79A 3MJ5A 1ACAA 3ZO5B 2LAHA 3SV1A 4HI8A 2GBMA 2MBBB 5CEAA 1R7SA 1BMLC 4ANVA 5L95C 2KX0A 3U2SC 4YONA 5AZGA 1UH6A 3MC8A 3BIID 4LNGA 5FIOA 4YSZB 3HVEB 3A98B 1E8XA 4WNEA 3OG5A 5IRSA 1FRRA 3W9CB 2EMTA 2IJ0A 1WM2A 1J7BA 4UQYA 4DHJB 3APFA 3S2AA 5E6PA 3RUIB 2ZPYA 4XWTA 4I6PA 3ZYKA 3S7JA 1HS6A 4UWHA 3DSVA 3B2FA 1ZW7A 3JYSA 1V97A 4WAAA 2N7DA 3PLVA 4GPKA 4K81A 5E6JA 4I6LB 5IAAC 4EJNA 3H9DA 1UBQA 4RGMA 1SE3A 3OXLA 2KWCA 5CECB 3I5PA 4IULA 3AB5A 4YWGG 3AMZA 1IYGA 2RDHA 4A1SA 2IO1B 4EBAG 1DC2A 3TMPB 3P4PB 4K7UA 3UUXA 4N5QA 2D9ZA 2UU7A 3HG0D 1TIFA 4JWUC 4KSKC 2EKIA 2XK5B 4JD2G 4KHBB 2LHEA 2X8XX 2MA9B 2OCCE 3AS8A 5C5BB 3NUHB 4MEMA 3ZXVA 1X1GA 2UWJG 2FCQA 2KLGA 4WWMA 2P9KG 2FI7A 4K2OA 4Q94A 4BAXA 2L8JA 3TW1A 1WMHA 1TS5A 5EILA 2YT0A 1X1FA 5AARA 1TNOA 5BW8C 1FVFA 1N62A 1NI1A 2KXPC 1UOHA 3SNHA 2KFKA 3AI5A 2EQXA 4G11A 1QOBA 1F2RC 3HXEA 2MOWA 4ITKA 2KCJA 2DX5A 2KYWA 5BO4B 3V05A 1GOZA 2V5QC 2E3TA 1Y6IA 1SE2A 2DHKA 1PUTA 5LFAA 5C2YA 3T5XA 2YHCA 2LFIA 4IM3A 3HQCA 3LB8C 1UUPA 3G2VA 3Q3OC 2D9WA 5HHDG 2ZCCA 4E3CA 2K39A 1ZU2A 1H10A 3L22A 3ZJUA 3FVCA 4QJ4B 3Q7AA 2DYMA 2WXRA 3BEEA 2XQ0A 2DZJA 3P42A 5D2MB 3QDNA 2AX5A 2KDMA 1V5PA 2M4NA 3CMMB 3C3QA 2CHWA 1J8CA 2MBOA 3TBLD 3LS8A 3RNBC 2AVPA 5AYWD 4GMVA 4HAXB 4NSWA 2KKCA 3H6NA 4FN2A 5DPWA 4LERA 5T4YA 1DCEA 3NWDA 3DQVA 3DPDA 3ZFWA 2EIKE 5AJLA 3PRZA 1TJCA 1SE4A 2FJ9A 2PZIA 2MLBA 1EPUA 3TFMA 3L13A 2R2YA 1Z3XA 4PNKA 4F1SA 4XYCA 4B0MA 4ZDVA 3R8BA 1HB6A 3SNXA 1SA4A 4ZYSA 5E75A 5HE3A 3J5QB 2IEJA 3ULQA 1EUVB 2K9XA 2YEPF 3KH0A 4U8VD 2N7JA 5CMWA 1QF6A 4PYUA 3SHFA 1YMHE 2CJNA 3Q7FA 1PDXA 5LCWJ 2PM7A 3V61A 4AV7A 2OJWA 2BPSA 2W3RA 2BS4B 2P9NG 4XEIG 5BUZA 3FILB 3ASDA 4NACA 1SJED 2IOLA 2PVGC 3PZ4A 1Y56A 1HZ5A 2MX2A 2BEDA 4CDNA 1GW6A 4U7EB 2R2LA 2MH7A 4KYOB 3VUWA 2ETBA 2VSYA 3CHRA 4OZCA 4ZRPA 3HXBA 4KGRA 3UKUG 2X6HA 1Q1OA 2XEWA 2F0YA 1VD2A 4DX5D 1EWCA 5LXHA 2L7RA 2MYOA 3ZRCA 1YYHA 1HZ4A 1E6EB 4HHVA 2IGHA 2M0XA 3CK7A 3V79K 4A3VA 2R17C 1WXMA 3S7FA 1KT0A 2Z0EB 3Q8FA 1P0RA 1X86A 2GBNA 3MV3B 3ABKE 3CVXA 2L76A 1TNUA 3CQGB 2IGDA 4KMOA 1L5PA 4C0MA 1DBHA 3PDNA 4GSWA 4LNNA 2ABDA 1RWSA 3CVPA 2P2CP 4TUUA 2GCLA 1KT1A 4GGQA 1X11A 3E34A 1OQQA 3P1MA 2XZTG 2D3CA 3VOQA 2HDEA 3FULA 2XS8A 3W5UB 4HNAD 5TSSA 2L0IA 2OJRA 2CY5A 3RMKC 1KZOA 4CRWA 4IC7B 2MHKA 4R7LA 4A3PA 2ZPNA 3EJNA 4CDMA 4YT0B 2B6CA 3UT8A 1A17A 2Y5CA 5LNK1 2P58C 1L6VA 1F77A 1WX8A 2NBUA 5EFXA 4OZBA 3EPYA 4WJOA 3UQAA 2OQBA 1WI0A 1WR1A 1ZYIA 3ZGQA 3I3NA 2VZKB 2K25A 3CVVA 2BS3B 2WP9B 1D5XC 1OGWA 1ESFA 3ONKA 1XLNA 3FFLA 1WGHA 1PC2A 4QQIA 4ATZD 4I43A 4WQOB 5HFYA 5AQ9A 1DOYA 4GDKA 3ZNGA 1VZ7A 3FTZA 2C9WB 5FR3A 1TJ6A 3X2QE 2Z13A 3B13A 2DZOA 4NZLB 3GYOA 2MBEA 1N61A 2DYNA 3JXJA 3FUFA 4KXKB 2XGMA 2X6JA 1MX6A 1RJ2A 1WDYA 1QLBB 1M4VA 1U29A 1TJEA 3FKYA 3EHNA 5ENRD 2WQYB 4KVGB 1VBHA 5ENSD 3FUJA 1CK1A 1X5BA 2NPTB 4TQ0A 2C2LA 1CMXB 1TZ1A 5T3RA 3U52E 1ZXIA 3GS2A 2AXZA 2WMNA 2XCBA 1JUQA 1P3QU 3ONSA 3IAM1 1GG3A 2V3NA 2KN5A 4RQIA 2XNAC 4MELA 3TEZA 3FWVA 2BWES 3LY7A 3ZKJA 2A5EA 5D2MC 4JKFA 2PTLA 3MP9A 5C6RA 4MRUA 4JVSA 5EYLA 2N9PC 3CKCA 2WXIA 1TYQG 5BXOA 3A33B 2M1MA 1JWUD 5D3YA 3B7SA 3OTNA 2UZSA 3FY4A 1KZPA 4HOQA 2VYIA 2LHDA 3U3WA 1ZDXA 2WU2B 5ENPD 5C2TB 5CBNA 1V88A 2FDQA 2COFA 3MC9A 5C16A 2LWPA 2XPIA 4G50A 2XHEA 4NRHB 1N5XA 1IKND 1TS3A 4ZHBA 3QKYA 4I2ZA 2AYOB 4FJVB 4W9EA 1N94A 5GXGB 3TXMA 3V2XA 3VH3B 1RRPB 3ABLE 1KLXA 1UELA 1HG2A 2NR2A 1WY6A 4JXTA 1OUVA 2GBRA 4RG6A 3MHZA 5D6JB 3ZXPA 4HCPB 4UQXA 3X23A 1ROEA 2C7HA 2DENB 3VUXA 3MJWA 4AEZC 3BYTB 4OT1A 4IW0A 4GYWA 2Y4UA 4ZFHA 2N1VA 3ZLZA 1O5MA 4M00A 2LI5A 1SXTA 3DBSA 2OHFA 3QWPA 3CK9A 4N3CA 2QMTA 1E8ZA 1P5TA 2W55A 4LDTD 1PGAA 1GB4A 2J0KA 2WGSA 1E0ZA 3M62B 3FH7A 5JHGA 1BXTA 3PRPB 2WLBA 5EN5D 2GCJA 1SE9A 2WXJA 4GA1A 2IYDB 2NBWB 4F7ZA 3PPAA 3DBHI 3AEBB 4KVMA 2HTHA 3U8ZA 2ZISA 3UTMA 3APCA 2WDVB 5JLJB 3RZFA 2VRWB 5FT9A 1V6EA 3Q3MC 4HAWB 4LCTA 4DX7D 1BU9A 1WJ6A 1XCTL 3BVMA 3R2IA 3V30A 4YSYB 2CODA 2GOWA 1TQZA 1N60A 4LUNU 1QZEA 1UNQA 1LW3A 4A6QA 1AW7A 3TAXA 2M38A 2JZPA 1V5TA 1QOGA 2INDC 1AQCA 1KTKA 3HYMB 4MH8A 1N6ZA 3DXCA 2SEBD 5AQBA 3A58A 1TKEA 1VR9A 5FK9C 4RGNA 1PFDA 1Y19B 2C0LA 3L6AA 3RCZA 3E32A 4A9AA 5HE2A 1X05A 4AP2A 3BU8A 2J8SD 3SUZA 4C9BB 2NSZA 1FFUA 2CKHB 2PIAA 4IG7B 2K3UA 3P4RB 2DBAA 3H1UA 2J52A 3NG0A 4KKIA 3QBVB 1HE8A 4ZRIA 3L08A 1S70B 1EVHA 5EIDA 1VCBA 2AQ1B 4B6WA 4XI9A 5E76A 3PNTB 3NS1A 1Z2MA 1DNPA 1OWNA 4AIFA 1GC7A 2KATA 2LD9A 1O1RA 1DDWA 4JLCA 3RNCC 1WE6A 3BUAA 2Z8LA 2FO7A 4GTVA 3J9CA 1OCRE 3RRNB 1BI7B 4JC8A 1PQSA 4DBBA 3HXFA 2G35A 2HTHB 5HE1A 2AL6A 3PZ3A 2D3BA 2IYBA 4WAFA 1UF0A 2NC9A 1WI1A 1R4NB 5JHBA 1NVLA 1V1PA 1J0GA 2PE6B 3ZNGC 4JHJA 2R02A 3B2GA 1D5ZC 1YJIA 4Y94A 3RIBA 3P4QB 4GZUA 2XRZA 4OYSA 4KIKA 4AWJA 4HLEA 5C5BA 1YD8U 5KBAA 1B1ZA 5KJMA 2KZTB 1U5EA 3SZ7A 3Q9NC 4XWXA 2RRFA 1FMAD 2YVCA 4PUCA 3LEWA 3AAAC 4N3AA 3FTYA 2RFAA 3HVEA 3KRWA 5LXIB 3VTYA 4C4VA 2N7EA 3Q49B 1S3SG 1S63A 1U3DA 5EX3A 2JVCA 5IP4D 4JHKA 5LX8A 2JP2A 4KSLC 4DXFA 4M3OA 2R59A 3LVRE 2OOBB 1V49A 4E6HA 1SBBB 4RM8A 2JXTA 5BT1A 3OAWA 3BG1B 4CGWA 1C4CA 2BVCA 1N3HA 4OAVB 2HR2A 2Q5WD 2L00B 4IUMB 4H7YA 5FQ4A 3ZPJA 3BINA 4IAPA 3W2DA 4GMRA 2KGXB 4F6RD 3M3JA 3ZUVB 4CO7A 1VDYA 2KUPA 4OVUA 2GBKA 1SA5A 3F5RA 1ZB1A 2CG2A 4HJKA 4ANWA 1KJTA 1D8EA 5CHWA 4WWPA 4APOA 4FADA 4ARCA 4EHMA 2VSOE 2F8YA 1RAXA 1ET6A 1NBFC 1V1PB 2C60A 3K9PB 3EHRA 5KHOA 3Q5MA 2DYSE 4CT0A 1RZ4A 2QJLA 3JXIA 2KAJA 2EC1A 5KQ1A 5CX3A 3UT4A 2PMVA 4LEUA 3RYTA 1KH0A 3WALA 2KLCA 2BT6A 4W9CA 3DRAA 4MK0A 3I57A 4H2AA 1D6EC 3EC8A 4C4VB 3DOWA 2GGFA 4KZ0A 3L82A 3SO8A 4RNAA 1XR0B 2JX5A 3ML8A 5EE0A 4RM9A 3CHOA 3VVWB 4KDLB 4TRQA 2QSDA 1QBQA 4AS1A 3MKQA 3B08A 3Q79A 2BUGA 2MRIA 4M7CA 2W2WA 2XN9C 5JVLA 3QWVA 2LJ5A 1CQVA 4RGTA 5JJTA 3KEZA 2QKMA 3VRBB 2ELBA 3OANA 4B95A 2KQSA 5CMYA 4Q96A 2RQ1A 5FZRA 1NTVA 3QWMA 2BKRB 1TR4A 2I1JA 3PS6A 3CVQA 4YNDA 2DTCA 2AL3A 2JABA 1FHXA 4HDOA 1MHHE 1R4MI 4IDIA 3Q75A 4ZOHC 1TN6A 4JW1A 1YQ3B 1XKEA 4G1TA 3EGRA 4I1MA 3AE3B 2K2UA 3BY4B 1JQ4A 1XX0A 2E0IA 2KD0A 1UZXB 1RFAA 4ME2A 4I9EA 5G04J 2N9LA 3ENBA 2BKGA 4AY6A 4LG6A 4C00A 5DHFB 3ECIA 2L0TB 1QOAA 3TCAA 3RI7C 1Z5SC 1XNFA 4J0UA 2MWSB 2LUMA 1V2YA 4L23A 5ARGA 5E6NA 3ZW3A 2Q13A 2KT7A 2LUHA 1G3NB 1P5QA 1UEFA 3CIRB 4AM9A 1Z5SB 4NQ0A 4GMXB 4BVUC 1IHGA 4NJCA 2QILA 4GMLA 3E9OA 2J9QA 2WXMA 4GCOA 4O1OA 4PS3A 4HAVB 1YQBA 2WXGA 1YN5A 5FR6A 2VGEA 4ANXA 2CY4A 1XEEA 2WU5B 2A4ZA 1GUAB 5AUKA 3EHQA 3SFYA 3PUKA 3HIZA 1GB1A 1LB1A 4EUTA 3TG4A 1UN9A 3ZJVA 2E2XA 1EO6A 4I6NB 4WJQA 2KWUB 4A3TA 5H8YE 4FJYA 2D11A 2P0DA 4UWGA 4Z2NA 3AU4A 3KWVA 5EX0A 3NZSA 2EIME 3UIOB 2RMMA 2KXJA 1V1OA 3TWRA 1VZ8A 2L83A 1UPQA 1HXIA 2L1CA 2WB2A 2PKOA 5FINA 5CLQB 3KEAA 2NYJA 3DWMA 1TNZA 1Z6TA 2KJ6A 1T6BX 2C7MB 3ZGZA 2X38A 3E4BA 2IY0C 2G4SA 2I2OA 2IQCA 3SYXA 4GTOA 2L05A 3IFWB 1XLQA 2GRLA 5HI1A 3NHEB 1E90A 2FUHB 2JT4B 2NTSA 4W9KA 5CEDB 2BKKB 1JALA 3TGOA 2FULA 1L0XB 2EELA 1ISNA 4HJGE 4YTNB 4BBNF 4NJ6A 2UY1A 2VH2A 1QYMA 3GZ1A 1HZ6A 2N4FA 3P6AA 5AZFA 2DX1A 4GZ6A 5D3XA 2DZIA 4G23A 1O1SA 4P29A 3GYZA 3IKOB 3PHXB 3RNEC 4I6GA 2NXPA 1TXDA 4KHAA 4HXIA 3GW4A 2DKPA 2R2OA 3R3MA 1YCSB 3OXGA 3SBGA 2IF4A 1SVXA 4YVQC 2KIEA 2RNRB 3SEBA 3PEVB 3N1ZC 2UWQA 3N32A 1J7AA 3EU5A 4AY5A 3M1IB 4PDXA 2NCNA 2K6QA 3PE4A 3NZ3A 2DYOA 2ONDA 2WX1A 5JMND 5ANLA 3Q78A 2FCMA 2IDYA 1NU2A 4HKQA 2KC1A 2JRIB 4WJNA 5IKCM 5CCLA 1V5OA 4A5KA 1XCGA 1YX5B 4RGOS 2ZW0A 2RSGA 3HHMA 4JKEA 2WXPA 2BKFA 4PT5A 4HRLA 3ABME 4APFA 4O60A 2BF8B 4B0EA 4D6WA 1HX8A 2Y8FA 2QY7A 5J18A 3VXWA 1MQSA 4HRNA 4J7WA 1OY3D 3FTUA 3B7UX 1KBLA 2LGYA 4A6HA 4PK1A 1DROA 1TY0A 2UYZB 2IOSA 3PO0A 3CV0A 1A70A 4N3BA 3PGEA 1J19A 4LJOB 5C1ZA 3RK6A 4P6VF 1AYFA 1FAOA 5JH5C 1FD6A 3ZXSA 3SBTA 1WF9A 4D2KA 4RMAA 2DZNA 1Y8RC 1OTRB 5AUIA 4L6EA 2MJDA 2WDQB 1I4RA 3FUIA 3D9IA 5KJLA 2INNE 3WANA 3ZNHB 2KJHB 3AEAB 5HS0A 3D8DA 1KFYB 1F1HA 3EFCA 3VTWA 4B89A 2OV8A 3PEUB 1QC6A 3CEQA 1LXDA 2OTXA 5B1AE 2IJGX 1ZE3D 3O96A 5J3TA 2AW6A 3NVVA 5AJDA 3QOUA 1FHOA 4ICVA 3NOGD 3RPFC 4XZ4A 4JQWC 2GRIA 4N58A 1WM5A 2KWVB 1UJJA 2P9SG 1IQRA 2XQNM 2RR9A 3SFEB 1J7CA 3L9TA 3IVFA 1D3ZA 4ILIA 4F7GA 3QQ8B 5HKPA 2LMCA 4HOUA 4CHJA 4KAXB 3TSSA 3Q8EA 4BBNC 5FTPA 3PH0C 4QXAB 3FH5A 1WGYA 3VIAA 1BLXB 3C98A 3RKVA 3RO3A 2M0AA 4GTPA 3ZEFA 1ZSQA 1DIKA 3RO2A 2WS3B 1JWGA 3QWZB 3ZYMA 4BKSA 3R9AB 3R7QA 3EDTB 1NL4A 5ITZF 3SR6A 4U04A 3CSTA 4QJ5B 2LZ6A 3LPZA 1U2BA 5G04C 3DPYA 4HROA 3B1LX 2BTEA 1H6KA 4OAUC 3ODWA 2ZJDA 3BJIA 1E7VA 1VRAB 4GPTB 5DPTA 4FA6A 4I1OB 1EF5A 1H2TC 2MBHA 1QKZA 2KVRA 4JWSC 1D5MC 3U7ZA 1DCQA 4HBDA 3B0AA 1KRHA 3NAWA 2DLBA 2ONQA 4GLSC 2LJIA 2W9NA 4I17A 2MWNB 4H7XA 3PG7A 3ULBA 3Q4AB 4MGKE 2DIWA 3SBSA 5AIJA 4AQ7A 3PE3A 3GB1A 3M63B 2QC9A 4KKJA 2LASA 3CHSA 1UJKA 4JB8P 3KS2A 4BETA 1WJ4A 2QYUA 1WYGA 2O6VD 1PYWD 3N9YC 3I4RB 3JQ1A 2ZCBA 2EINE 4Q2JA 4JKGA 2KHWB 3VH4B 4ICUA 2KC7A 4AJYB 2LO6A 1K1BA 4ZRQA 2EJ8A 2MCNB 1VBGA 3FU3A 1T0YA 4J8YA 3NJTA 1N63A 2LGIA 4N2SA 2H88B 2YT1A 5G05C 5BMIA 2Y1LE 1EU3A 3ETRA 2CB8A 2FO1E 2LBBA 2A5UA 4GYYA 3R2TA 4U95D 4KBQA 1K53A 2ADZA 3NVWA 2ON8A 3ODXA 1HEZE 1U5GA 3DDCB 3LY8A 2KACA 2MFQA 2V1YA 3MZLB 1SSNA 2GLSA 3BVZA 2AWTA 2VTBB 1XGWA 2IU1A 2DYBA 3TUOA 2PJHA 1WJNA 2R05A 4MM3A 1I7HA 3JUIA 2H7DA 2H6HA 4O6FA 2JYTA 3GZNB 2DKQA 2ROVA 3HDXA 1WM3A 4UWLA 4TMAB 2BTDA 3AE2B 3FUKA 2YS1A 1ACCA 4YSXB 3P1UA 2NBVB 3A9JB 3C72A 3KWLA 4GMJA 2Y3AA 1EAZA 4XX5A 3Q8CA 2GRQB 3UPVA 3HIEA 4KT6B 1JWAD 4AP4C 3VTUA 3VR8B 1FCLA 2V0GA 3G2SA 4YDOA 3CKBA 4K7WA 3RRMB 5BV0A 2KQ7A 4UWFA 2BF0X 4MS6A 2NVUI 3A9KA 3ASGA 5CTRC 3JCKC 2Z4DA 2INCC 1LD8A 3NVYA 4P1CC 3FSSA 3GOEA 2J42A 2VSZA 4HB4B 2PEAA 4RCOA 1KLUD 2ZZPB 1Q2ZA 1T0RC 1LD7A 4FLBA 4ABNA 4XC2A 3E9PA 2WQ7A 1TYGB 1PLSA 1H0AA 5I2SA 4MJSB 2RGNB 2G9HD 2DFKA 2O6VB 1RW2A 2HTME 4CHMA 3QARA 2QC8A 4N2QA 2C7NB 1G6JA 4GOUA 5KCVA 5FQ7A 1MJDA 4LTUA 2CHZA 2YSZA 3DVGY 2KTRA 3ZTCA 3VTXA 1ET9A 5CBOA 2M56B 3UI3A 2GROB 1S64A 1SQMA 2ZIRA 5FKAC 4JPSA 5A6CA 4DUIA 5G5GA 4XKBA 4IFSA 1V55E 3L10B 3Q15A 1IGCA 3PHWB 3D9KA 5D66A 1UD7A 2K8HA 5AEKB 2LULA 4C56C 3NOBA 1JCSA 2NMBA 4WJPA 1F52A 4F8CB 4HB3B 4USAA 2ELAA 2LXMA 4GIVA 1WMHB 3ESLA 4HEA1 4ASWC 4ANUA 4JIOU 1FRDA 1YA0A 4WNFA 3ZU7B 2LKOA 5HRYA 3K9OB 2Q7FA 1C4AA 1P9DU 2CFUA 2X6IA 1ZM0A 1XCQL 1WXSA 3I3TB 2QKLA 3D9MA 2X6KA 3MPXA 2W3SA 1IPGA 2HJ1A 5E6OA 2NS5A 1FXAA 2IFSA 3KY9A 5BPPA 4HXDA 4A90A 4XGAB 5DCNA 4XKCA 5DHAB 2VKIA 4A6KA 2JQRB 3DVNU 1KPSB 1WVHA 4JX1C 4TKNA 3KLSX 2MRPA 4K03A 1MX2A 1P1AA 3UQ3A 5BYQA 3PVLA 1OXJA 4KVOA 1ZUD2 2R61A 2LVQA 4MDKE 2QZAA 3PVWA 2DWZA 4HORA 5FZQA 1SZ9A 4LSZE 2JWUA 4IWQA 5AENA 3PSCA 4CYEA 2VGYA 4MT5A 3MHSD 4MBGA 2ETAA 4DDID 4IWPA 2O2VB 3CIAA 3OJ3A 3SFDB 4GZ3A 3RFZB 3AECB 3Q2AC 2XGSA 4MSMB 4CT4A 1EM7A 3JVZX 2GBJA 3Q9UC 2ZNVB 2RD0A 3N3KB 2E6XA 4JKAA 4O1NA 1NYQA 4BT8A 2IO2B 4HOTA 4UI9J 4FHJA 3QC8B 4HPMB 1LGRA 4BTAA 1N95A 4J8DA 1FHWA 4R3DA 4EQFA 4QJ3B 1LQBA 4REZA 3E9LA 2YS3A 5ENQD 5LOZA 5ANRA 2JWZA 2L6JA 5CHEE 1HTOA 1WRIA 3OXFA 2KFJA 4G24A 1DYQA 2UVMA 4HWIB 2COPA 4IN3B 2RPVA 1TS2A 4LLGM 4GYOA 3UI2A 4GCNA 4JHRA 1WYWB 1OWMA 2JXXA 3TWUA 4YDYA 1WZ3A 3HRDD 5G5HA 1OT8A 5BMHA 1FNWA 1I4GA 1I7AA 3NS8A 1NENB 1ZGUB 3KD7A 1JDEA 5FQ6A 3NQPA 3URZA 5FJYA 4US9A 1MJ0A 1V5UA 3FAHA 5DPSA 3CVNA 2K2JA 2FUG1 1D9SA 1XLOA 3V62A 1AWEA 1FPYA 2Z0OA 5KJNA 1NDDA 2JZ3B 4WVFB 3VR9B 1CZPA 2IZVB 2N23A 2FBWB 2KWDA 3ZDMC 1IBXB 4TQ1A 4DXAB 3ZKJC 2Z0QA 1STEA 3NY5A 3F0WA 5D94A 4BKGA 2MW5A 3ENEA 4WURA 3C0RB 3UINB 1AARA 2EIJE 3AV8A 1TNYA 3UXGA 1M7EA 1NTYA 4WQMA 4N5CA 2HYZA 5D3DA 2KMCA 3U4EG 4G3XB 4GZDA 5KCMA 1TKGA 2CU3A 1MVKA 3IG3A 3KUDB 4NY0A 2COAA 1F2RI 4RFBA 5FI0A 1LF8A 4FP7A 2WHIA 3P7ZA 5BYSA 3QX1A 5T8IA 4B8CB 3G2UA 1WJ1A 1JRUA 4PQ0A 3BWUD 4HVBA 3PRMB 2GB1A 4DRXE 2N0SB 4LNFA 1S1QB 4J8EA 3C3OA 3OJ4B 4DHJD 1ZPSA 3T06A 2FJLA 4ZRKA 3UMVA 1MPHA 3QCAA 1MAIA 3W5VB 4BSXA 2PVOD 1I4XA 4WIPA 5DBKA 3DXDA 1B9RA 4WWOA 1T0QC 3ASFA 1TZOA 1DYNA 4BSZB 2GS0A 5LG4B 3AXCA 5DH9B 2IY0B 3RT3B 4C48B 3Q69A 1WGGA 2MEKA 3TWVA 5FQ8A 2INPE 4CCAA 3FTVA 1AWDA 3JSVA 2PZ1A 4U63A 1OEYA 3AG2E 3DBLI 2I6HA 3FUMA 2R0DA 4DJAA 2D9VA 3AN1A 3P4SB 3LCAA 4M8MA 2LAIA 2BYTA 4F7HA 3D9HA 5BYRA 2J4BA 4LNOA 2OEVA 4BKSD 2XENA 1KM7A 5J90A 1SHCA 2I5CA 1E8YA 4J8SA 4OW0A 1S0PA 2IPKD 5GMVA 3AE4B 2GRNB 2YINA 3DSXA 4JA9A 3C3RA 4A3OA 4FULA 4I2WA 5KJKA 3EIQC 3MYVA 1TGZB 1VJKA 2IONA 1HU3A 3ZYYX 4MKTA 1PY1A 4GTTA 2JLBA 2XPZA 1E9MA 2LGSA 4G26A 5EYPF 2WH5A 3ULYA 1C1YB 1WG7A 4II2B 3ZHEA 4IYPA 4LRZA 4Y6WA 2K00A 4HCNB 3FP5A 4JZYA 2R03A 3IT4B 1A5RA 1UGJA 3WAOA 4GZCA 4GN1A 3RAUA 3CGHA 2YS5A 3TXNA 3PV1A 1H8CA 1L4ZB 3SQVA 4JK7A 2WX0A 3A1QA 2XGOA 3MCXA 3O48A 3L0WB 2P9IG 2GI9A 3U7DA 4MGZE 1OQNA 3SO6A 1KI1B 3FUNA 4BT9A 3CVYA 3TO1A 3MEKA 2ZNVC 1C77A 4HKZE 4B94A 2Z0DB 2WMOA 4A63B 3D9NA 1GPXA 2KCLA 4EBAA 1V86A 3DEOA 4S17A 1PGXA 3Q8AA 3DBHB 5CHVC 4NNJB 2KNBA 1OWPA 1UWXA 3D8FA 2PPHA 4BWRA 1AN8A 3AS4A 4ZHPA 3UX4A 3AS5A 4FHKA 4W9IA 4DQOC 1INZA 3JQ0A 2DZKA 4ACKA 1JWSD 1WY8A 3OLMD 1DVPA 3TWWA 3VAWA 4GTQA 5BXUA 5HE0A 3N30A 4PS7A 3CF6E 5BNWA 2DHJA 3AE8B 4K3BA 3PREA 1WZ0A 2N9EB 3A4RA 2P9LG 2BYEA 2FJUB 4K5AB 4OSNA 3W1SA 2VSNA 4CHKA 1B89A 1FPPA 4PS8A 2ZGGA 5TR5A 3DVGX 2L3ZA 3T8MA 4E85A 1EWYC 1YN3A 3G2WA 1OCOE 3T9KA 1T3QA 3U12A 3D32A 3CHMA 2JY6A 4TXQA 5G55A 2L6BA 5M72A 1RRBA 3DXMG 4AXHA 2CR5A 2D2QA 3PZ1A 1W1DA 3KAEA 2ASQA 2Z0PA 3PSEB 4II3B 2BQQA 4F3VA 1FGZA 2Y5BB 3CHQA 3GYPA 1C4PA 1GC6A 1L7YA 2V3PA 3K9IA 4GOCA 3SU8X 1NI2A 2BBCA 5A23A 1NZNA 1MI0A 3AG4E 2KOXA 2B0OE 3ZN3A 3I9V1 3Q8BA 4G0NB 4L7TA 1K52A 4KDIC 2UZRA 3ZNID 2Z59B 1OCZE 2G3QB 3BK2A 4DI3A 1MIZB 3IXSA 3AULA 3D9PA 3KYCD 1N4PA 3MKQB 1BUIC 1MG8A 4MJSA 1NFIE 1BAKA 5BMGA 4TV3A 2OVBA 2BGFA 3HVZA 4L2LA 4GTRA 4PYZA 3LDZE 2Y7BA 2L1AA 1ZDVA 4MGIE 3ZVRA 5DPRA 2LGDA 4P7IA 4JKBA 2D9YA 1TTNA 3LDZA 3ZQ4A 2HJ8A 2KTRB 2D3GA 3SI5A 3RD2A 4BZAA 2J08A 2PM6A 4I1AA 4OVVA 1BTKA 1N5WA 1IGDA 5IO9A 2LEKA 4WSFA 1VDVA 3WIMA 1MFWA 1WRDB 3TEXA 5IN7A 4HI9A 2N9XA 2VH1A 4JL9A 1VLBA 1O1TA 3D9JA 2KVZA 2K8BA 4KV2A 2LGXA 2ROZB 1ZC3B 3N1YC 4ILHA 1FOEA 3PEGA 2P0FA 3AE7B 4GPMA 1T5XD 3FUEA 1R4NI 1ZKHA 3ML9A 3QIJA 3D9OA 2LSUA 4BOZB 5JP4A 3E30A 1WR6E 4TYZA 2BYFA 1QILA 2M14A 1F9JA 1SF0A 2DLWA 1K5DB 1M7RA 5MPOA 2I2YA 2KANA 2ETCA 3VLEA 3KSLA 4KHOA 1BD8A 1WH3A 4U07A 2RUKB 1N4SA 3FEYA 3KSQA 4HB5A 1UWMA 3RNAC 2DAFA 2WDTB 1JCKB 3CQCB 3Q14C 3H7PA 3B7BA 5KNHD 3W1SC 2Y4TA 4DX8A 4MGYE 4ZYNA 5C23A 2JSVX 3ULEG 1Q67A 3N20C 4NAWA 4DHZE 4DHZB 4YTPB 1MI1A 2XK5A 3EECA 2LXAA 2DBYA 4EECA 2ZVOA 1H4RA 3FUDA 3A8QA 4LK0M 1NA0A 2D9XA 1PGBA 5IY5E 4U0ZA 4KGTA 3PZDA 2P8VA 2LVOA 3C8YA 2MJ3A 3P2BA 2FCSA 5J3YA 3FEXA 3U30A 4KIKB 2L0FA 3B7RL 1TJFA 4C7YA 1U3CA 1K8RB 2MP2A 1WXQA 2N1WA 2W2XC 3AG3E 1NP7A 3X0WA 2V4IB 1NTIA 2DYRE 3UM3A 3GE8C 3BG0B 2DX5B 4FBJB 2GRMA 2Y69E 5EE3A 4B0ZA 2O2VA 3I4GA 1XO3A 3ZNZB 5D0QD 3DWLG 1FEHA 4RF0A 1QNFA 4JK8A 5KNGA 1IUEA 3UM1A 3FC4A 4IM2A 1XQQA 4EEWA 4J6IA 1B55A 4EMOA 1Q0WB 2WXFA 2R2QA 3FILA 3RNFC 4FXCA 3JW0X 3V60A 4BERA 2PE9A 2KCVA 2RGFA 5CCMA 5JJ6A 2JRHA 3EFUA 3ABVB 3H7PB 4UI9C 3L4PA 2M17A 2P9UG 3PTFC 4MACA 4LNUD 3PP2A 1AP7A 1V81A 1WFYA 5ENOD 1F0ZA 3V5WA 3R7RA 4BKTA 3AE5B 4FJZA 2H6FA 3DXEA 5CRUA 1NYRA 3V6CB 4OVZA 2KUQA 2DAJA 3UM0A 5D3VA 2CJOA 4K5BA 1V5MA 4DLQA 3QB2A 4HLLA 2V3SA 5D7GA 2N0YA 1W3BA 2LOZA 1N9AA 3FU5A 4AVXA 2JEKA 2K5PA 1XD4A 4RG9A 2K1FA 3M95A 3L17A 4DK5A 1I35A 3ALBA 3KUCB 2ZXWE 4WNDA 4BFRA 1N0RA 1T77A 4Z68A 4MM3B 4OHJA 4HRMB 4HAYB 4CDRA 1OWLA 2BB5A 4B93B 2HRJA 1GJZA 1TN8A 3ULCA 1D8DA 1NA3A 1FT1A 3TIXA 2E2EA 4HAUB 3HRAA 4DPRA 3T5VA 1H2UA 3H8HA 4H8SA 3KRXA 3O13A 3TWSA 2VJ8A 1XXGA 4JKHA 3S7BA 2LOXA 2CAYA 4LCDE 1KZ7A 5JXVA 2MBQA 4N6EB 3FP3A 4I6EA 4TXRA 1BWNA 2KJRA 3HK0A 2IO3B 4K3CA 1I42A 4GZ5A 4K2PA 3UM2A 2BB6A 4GDKB 1HG5A 3KYDD 1ZBPA 3U66A 4EZKA 4DIXA 1I4QA 4YL8A 2Y8GA 4N9F4 4J3OD 1OWOA 2X18A 1DGJA 4JEUA 1MZCA 3CSFA 3EIJA 2M63A 3UT7A 1QT9A 3DSSA 1YQ4B 1TKYA 4XWWA 4XIFA 2DZMA 2V8SE 3EHMA 3VQIA 1IBXA 3ZDTA 4DX1A 5KQ4A 3QK0A 1WGRA 4A6FB 4QFVA 3TWQA 5B3SE 2YF0A 3NWFA 3AEDB 3CVUA 2KM4A 4HFGA 3ZRHA 1P7FA 1JWFA 2LNIA 4YTMB 4D10C 4NAMA 2F37A 4DX6D 3GZSA 3DEPA 4WWNA 3NBNB 4YDEA 5AQAA 1JWBD 3LYYA 4GA0A 1JWMD 2EKEC 4IOIE 4YDWA 4HATB 4M8NA 5I4DA 3MX3A 4XE0A 2Y0BG 1U27A 1H6PA 4GAAA 3BYYB 3BVGA 1EDUA 2PQNA 1ZVRA 5FZSA 2D4QA 1FNVA 2XEEA 3MDBC 5HG2A 2COCA 2REXA 3A8PA 3ODOA 5EDSA 2BWFA 3KVFB 1A5EA 2DNFA 2KBXA 4WH4A 4LNIA 1IRSA 4P1BC
chains in the Genus database with same CATH topology
1PFJA 2FIFA 1M94A 3S7DA 1WJUA 2GJYA 3VUYA 1BTNA 2J09A 5CLLB 3O4ZA 1WX7A 3U9WA 5EKQD 4Q69A 4A1GA 1TBEA 2WVIA 2LRUA 3DBRI 4BX8A 3QA8A 2DIKA 2WQHA 2ZU6B 1HB8A 1YX6B 2D10A 4F53A 1WX9A 3SGHA 4JKGB 3NZUA 5LP0A 4GB9A 3FTSA 2FF4A 1ELKA 2AXVA 1L2NA 3PLUA 2CQUA 2P0HA 2WYQA 4MY6A 5LCWC 1ELWA 4RVBA 3SDLC 4DBGA 1KOTA 4MH0E 3MV2B 3ML4A 4E74A 3SBTB 2ILRA 2CU1A 2I9CA 2OVFA 4EPZA 1KZGA 2KTFA 4F7UP 3U4TA 1UGMA 5GOWB 2M8SA 1WXVA 3PUJA 3IHPC 1BT0A 4LJPB 3D3MA 2AEHA 5ARFA 1HBKA 3ZYQA 1MK9B 2RG8A 3SF4A 2KCKA 3LXUX 2CFZA 3LVQE 4HS2A 3L54A 2KDEB 3VHTC 3UQBA 1U4AA 3A1QB 5JZEB 3FEHA 3WYFB 4IWOA 2D07B 2LXCA 3IHVA 1MHQA 4M0WB 1QQEA 2QFCA 2FEZA 2IO0B 2J7QB 3SHQA 1UW4B 2LYDA 3QC1A 1Q5WB 2DHZA 3O65B 4YVOA 3WA0A 2OOEA 4JEHA 3QHTA 2DN6A 3FM8C 4PH4B 2KFKB 2J07A 1YIWA 4AOFA 4KZCA 2JPHA 1HH8A 4JA7A 3ASHA 4HK2A 5C1DA 5LLIA 4FC8A 1MIXA 3Q3JA 5D0OD 2G4DB 2O6VA 4EOYA 1IQUA 4K1RB 2X3MA 3NF1A 1PAQA 4B6HA 2BYVE 2KDFB 2YNQA 5DI9B 3KSYA 1QQGA 1MK7B 2WQ6A 5C79A 2HE7A 3A4SC 5KHQA 5A7DB 3ONLA 4IRUA 3WAPA 1W1HA 1FVHA 2KZTA 2L9BA 3FTXA 3VFKA 4HAZB 4J8FA 2LUEA 1WAO1 2QHOA 4JGHB 5G05J 4BY6A 5JJ7A 3FU0A 2VGXA 1FB8A 2LRWA 4GA2A 3RCPA 3RZWC 2G45B 1OQYA 3ZVVA 3TVVA 1E96B 2WXNA 3IEGA 2DA0A 3WXXA 3QAQA 1I2HA 2JZZA 4ACLA 4L1BA 4EFOA 4BBKA 3UIPB 3B7TA 1MKEA 3N71A 4UQZA 2XRYA 1SGHA 3AU5A 3U64A 4IM0A 1GGOA 4C0AA 1UPRA 1V89A 4ZRJA 2W2XD 4AUQC 4NURA 4NJ7A 4DLOA 3QWWA 4A55A 1DDMA 1Z3YA 3CR3A 5DIZA 2H7EA 2MDXA 1TEZA 1V9JA 1E8WA 3FU6A 3ZRFA 3MGBA 1SIFA 2MP2B 2CRFA 2CHXA 1SZAA 1E7UA 4GU5A 3A9KB 4A20A 2GMIC 3TG5A 3GZ2A 4ILGA 2MKRA 1N52A 2VGXB 5J3QA 5ENNA 2MSED 3ZHEB 1K5GB 2XEVA 3IHYA 4X57B 3HM3A 4RSYA 1ZC4B 4W9LA 1LFDA 1WGDA 4NAWB 3UZTA 2RVBB 1HO8A 2J49A 1XODA 3MTNB 5CHFA 2V4LA 2KDIA 4WUYA 3CVWA 4NQKE 4CGVA 2FAZA 3AJ4A 1WE7A 2BCJA 1HF8A 3JYUA 1IYFA 2XCCA 3DCGA 5IA7A 2R5SA 2WXLA 1J0WA 2B3AA 1FXTB 3PVUA 4W9DA 3PT2B 2J0JA 3MKRA 4WNGA 2FIDA 2JF5A 2NPTA 4BX9A 3HM6X 2VSXE 3W1YA 4I9CA 4DWFA 2FCNA 2KK8A 2V0PA 4G2VA 3FUHA 2V5FA 2ZVNA 4URKA 1ELRA 5D27A 4D0NB 3V6EB 3FLVA 4U0SA 3Q3FA 5FWQA 4G25A 5LOPB 5G2NA 4E71A 3LJUX 4K0RA 5FI1A 3ZTDA 4HOSA 2L0TA 4NPNA 2YHEA 4ILGB 1V80A 2IY1B 2HO1A 3T9LA 4GDLB 2NZ8B 5J2RA 4A6FA 3JSVB 1JPLA 4MT7A 1X1MA 1UN8A 4C0EA 3ZUNA 2K6DB 3LKUA 4IOYX 1UNRA 2XBBC 3RJVA 2LVPA 4AJWA 1EF1A 4MLPA 2VQ2A 1V61A 4K7SA 1U5DA 1H19A 3CHPA 3TL5A 3R66C 4HDQA 3CLJA 3KUZA 1WXAA 1EGXA 2C5LC 1FGYA 2YQ8A 2IBIB 5AZHA 3RULA 2AXUA 4NQLB 2K8CA 3QNKA 3UGBB 2CS4A 1KC7A 2PQRA 4HPLB 3E66A 1QZ2A 3RU0A 1UG3A 5D3WA 5L81A 4GDLA 3D9LA 5HKHA 3GZNI 3SFZA 5HQ8A 2J0MA 1PMSA 1WIAA 5JHHA 4B9KA 1Y8MA 2WPVA 4JL0A 3RRUA 2DHIA 1WJMA 1H2VC 3TJPA 1OY2A 4F7AA 1HFAA 3MA5A 3IV0A 1DDVA 2KC2A 5J08A 2I5FA 4DI4A 1P3RA 4EZLA 2XPYA 2L2IA 3FH8A 3UF8A 2FBNA 2PL2A 3DVNV 3CK8A 2VRRB 4U8HA 1WGQA 2R82A 2WXQA 2V76A 3D8EA 3WAMA 3H7SA 1EF1C 2HD5B 2WWZA 1E5WA 2WXOA 4U0UA 3G2TA 4GU2A 1EYHA 2I1KA 2AWIA 2KMAA 5J17A 2KX3A 3KZ1A 2KO3A 2ZEQA 3LJ3A 1FCHA 1GNUA 1LM8B 5BV1A 2YRYA 4CEMA 3EHVA 2EMSA 2RSUA 4N39A 2J59M 4EKUA 4DDGD 1KLVA 1ST7A 1IP9A 4B8AA 3VDZA 4GXBA 4I6JA 2CG3A 1U5FA 4FLHA 2UY1B 2C0MA 3VLFA 4ILHB 1OMWA 3LYAA 4UI9K 4V3IA 2RPQA 3LY9A 1P98A 3G9WA 5L83A 1Y5OA 1L5JA 2IFUA 4L2YA 2WXHA 5LONB 2VTBA 1N54A 2FNJB 4ILJA 2YLMA 4BTBA 2GW1A 1UBIA 1C3TA 4MSQB 2LSVA 4ATGA 3NSUA 4HB2B 4JKCA 2DCPA 3CVLA 1YJ1A 3ZIMA 2KZRA 3PNLB 2WXKA 5IJMA 1Z87A 3FTWA 4HB0B 4Z2MB 2X0SA 4WJ7A 2R09A 3L16A 3ESKA 3VLDA 2DYQA 3APDA 4JK9A 3FHEA 5JHAA 1OEYJ 2MQJA 1BPOA 4Y6CA 1W1GA 4XI0A 2JUOA 2RLOA 5DIFB 2J4DA 4FU3A 4W9HA 2LG1A 3Q47B 5HI7A 4UWKA 2KDBA 1UNPA 1XT9B 4W9RA 4W9FA 4W9JA 3CIKA 4K17A 1WGUA 4LDTB 4JKDA 2WM9A 4BOSC 3A9JA 3HW2B 4DX90 3FDHA 1RLFA 3CXBB 3VTVA 3IBEA 4EZJA 1P6SA 3KW5B 3QJZA 4W9GA 3SD5A 2HM8A 3N7CA 2X6FA 3ZYLA 1ACAA 3ZO5B 2LAHA 3SV1A 2GBMA 2MBBB 5L95C 4ANVA 2KX0A 4YONA 5AZGA 1UH6A 3HVEB 3A98B 1E8XA 4WNEA 2EMTA 1WM2A 4UQYA 4DHJB 3APFA 3S2AA 5E6PA 3RUIB 2ZPYA 4I6PA 3ZYKA 3S7JA 1HS6A 4UWHA 1ZW7A 3JYSA 4WAAA 2N7DA 3PLVA 4GPKA 4K81A 4I6LB 5IAAC 4EJNA 3H9DA 1UBQA 3OXLA 2KWCA 3I5PA 4IULA 1IYGA 4A1SA 2IO1B 4EBAG 3TMPB 4K7UA 3UUXA 2D9ZA 4KSKC 2XK5B 4KHBB 2MA9B 3AS8A 5C5BB 4MEMA 1X1GA 2UWJG 2FCQA 2KLGA 4K2OA 2FI7A 4Q94A 2L8JA 3TW1A 1WMHA 2YT0A 1X1FA 5BW8C 1FVFA 2KFKA 3SNHA 3AI5A 2EQXA 4G11A 2MOWA 5BO4B 2KCJA 2DX5A 1Y6IA 2DHKA 5LFAA 5C2YA 3T5XA 2YHCA 4IM3A 3HQCA 3G2VA 2D9WA 2ZCCA 4E3CA 2K39A 1ZU2A 1H10A 3L22A 2DYMA 2WXRA 3BEEA 2XQ0A 2DZJA 5D2MB 3QDNA 2M4NA 3CMMB 1V5PA 1J8CA 2CHWA 2MBOA 3TBLD 3LS8A 5DPWA 2AVPA 5AYWD 4GMVA 4HAXB 4NSWA 2KKCA 3H6NA 4FN2A 4LERA 5T4YA 3DQVA 3DPDA 3ZFWA 5AJLA 3PRZA 1TJCA 2FJ9A 2PZIA 2MLBA 1EPUA 3TFMA 3L13A 4PNKA 1Z3XA 4ZDVA 4F1SA 1HB6A 3SNXA 5E75A 5HE3A 3ULQA 1EUVB 3KH0A 5CMWA 4PYUA 3SHFA 5LCWJ 2PM7A 3V61A 4AV7A 2BPSA 5BUZA 3ASDA 4NACA 2IOLA 2MX2A 4CDNA 1GW6A 4KYOB 3VUWA 2VSYA 3CHRA 2X6HA 1Q1OA 2XEWA 1VD2A 5LXHA 2L7RA 3ZRCA 1HZ4A 4HHVA 2M0XA 3CK7A 1WXMA 4A3VA 2R17C 2Z0EB 3S7FA 1KT0A 1P0RA 1X86A 2GBNA 3MV3B 3CVXA 2L76A 3CQGB 4KMOA 4C0MA 1DBHA 3PDNA 4GSWA 2ABDA 3CVPA 4TUUA 2GCLA 1KT1A 4GGQA 1X11A 3VOQA 3FULA 2L0IA 2OJRA 2CY5A 4CRWA 4IC7B 2MHKA 4R7LA 4A3PA 2ZPNA 3EJNA 4CDMA 3UT8A 1A17A 2P58C 1WX8A 2NBUA 5EFXA 3EPYA 4WJOA 3UQAA 2OQBA 1WI0A 1WR1A 3ZGQA 3I3NA 2K25A 3CVVA 1OGWA 3ONKA 3FFLA 1WGHA 1PC2A 4I43A 4WQOB 4GDKA 3FTZA 2C9WB 1TJ6A 3B13A 3GYOA 2MBEA 2DYNA 3FUFA 4KXKB 2XGMA 2X6JA 1RJ2A 1U29A 3EHNA 4KVGB 1VBHA 3FUJA 2NPTB 1X5BA 4TQ0A 2C2LA 1CMXB 1TZ1A 5T3RA 2AXZA 2WMNA 2XCBA 1JUQA 1P3QU 3ONSA 1GG3A 2KN5A 4MELA 3FWVA 2BWES 3LY7A 4JKFA 5C6RA 4MRUA 4JVSA 2N9PC 3CKCA 2WXIA 3A33B 2M1MA 5D3YA 3B7SA 3OTNA 2UZSA 3FY4A 4HOQA 2VYIA 3U3WA 1V88A 2FDQA 2COFA 5C16A 2LWPA 2XPIA 4G50A 2XHEA 4NRHB 3QKYA 4I2ZA 2AYOB 4FJVB 4W9EA 3TXMA 3VH3B 1RRPB 1KLXA 1UELA 1HG2A 2NR2A 1WY6A 4JXTA 1OUVA 2GBRA 4RG6A 5D6JB 4HCPB 4UQXA 3X23A 2C7HA 2DENB 3VUXA 3MJWA 4AEZC 4IW0A 4GYWA 2Y4UA 2N1VA 3ZLZA 2LI5A 3DBSA 3QWPA 3CK9A 4N3CA 1E8ZA 1P5TA 4LDTD 2J0KA 3M62B 3FH7A 5JHGA 3PRPB 2GCJA 1SE9A 2WXJA 4GA1A 2IYDB 2NBWB 4F7ZA 3PPAA 3DBHI 4KVMA 2HTHA 3U8ZA 3APCA 5JLJB 3RZFA 2VRWB 5FT9A 1V6EA 4HAWB 4LCTA 1WJ6A 2CODA 2GOWA 1TQZA 4LUNU 1QZEA 1UNQA 1LW3A 3TAXA 2M38A 1V5TA 1AQCA 3HYMB 3DXCA 1Y19B 2C0LA 3L6AA 3RCZA 5HE2A 1X05A 4AP2A 2CKHB 3SUZA 4C9BB 2NSZA 4IG7B 2DBAA 3H1UA 3QBVB 1HE8A 4ZRIA 3L08A 1EVHA 1VCBA 4B6WA 4XI9A 5E76A 3PNTB 1Z2MA 1DNPA 1OWNA 4AIFA 1GC7A 2KATA 2LD9A 1DDWA 4JLCA 1WE6A 2FO7A 3RRNB 4JC8A 1PQSA 4DBBA 5HE1A 2G35A 2HTHB 2AL6A 2IYBA 4WAFA 2NC9A 1WI1A 5JHBA 1NVLA 1J0GA 2PE6B 3ZNGC 4JHJA 4Y94A 3RIBA 4GZUA 2XRZA 4OYSA 4KIKA 4AWJA 4HLEA 5C5BA 1YD8U 5KJMA 4XWXA 2KZTB 1U5EA 3SZ7A 2YVCA 4PUCA 3LEWA 3FTYA 4N3AA 3HVEA 5LXIB 3KRWA 3VTYA 2N7EA 3Q49B 1S3SG 5EX3A 1U3DA 2JVCA 4JHKA 5LX8A 2JP2A 4KSLC 4M3OA 2R59A 3LVRE 2OOBB 1V49A 4E6HA 4RM8A 5BT1A 3OAWA 3BG1B 4CGWA 1N3HA 2HR2A 2L00B 4IUMB 4H7YA 5FQ4A 3ZPJA 3BINA 4IAPA 2KGXB 3M3JA 4CO7A 1VDYA 2KUPA 4OVUA 2GBKA 3F5RA 2CG2A 4HJKA 4ANWA 1KJTA 5CHWA 4WWPA 4APOA 4FADA 2VSOE 1RAXA 3K9PB 1NBFC 2C60A 5KHOA 3Q5MA 4CT0A 2EC1A 5KQ1A 5CX3A 3UT4A 4LEUA 3RYTA 3WALA 2KLCA 4W9CA 4MK0A 3EC8A 3DOWA 2GGFA 4KZ0A 1XR0B 3ML8A 4RM9A 3CHOA 3VVWB 4KDLB 4TRQA 3MKQA 3B08A 2BUGA 2MRIA 2W2WA 5JVLA 3QWVA 2LJ5A 5JJTA 3KEZA 2QKMA 2ELBA 3OANA 4B95A 2KQSA 5CMYA 4Q96A 2RQ1A 5FZRA 1NTVA 3QWMA 2BKRB 2I1JA 3PS6A 3CVQA 4YNDA 2DTCA 2AL3A 1FHXA 4HDOA 1R4MI 4JW1A 1XKEA 4G1TA 4I1MA 2K2UA 3BY4B 1XX0A 2E0IA 2KD0A 1UZXB 1RFAA 4ME2A 4I9EA 5G04J 3ENBA 4AY6A 5DHFB 3ECIA 2L0TB 3TCAA 1XNFA 4J0UA 2MWSB 1V2YA 4L23A 5ARGA 5E6NA 3ZW3A 2Q13A 1UEFA 1P5QA 4AM9A 1Z5SB 4NQ0A 4GMXB 4BVUC 1IHGA 4GMLA 2J9QA 3E9OA 2WXMA 4GCOA 4PS3A 4HAVB 1YQBA 2WXGA 5FR6A 4ANXA 2CY4A 2A4ZA 1GUAB 3PUKA 3HIZA 1LB1A 4EUTA 3TG4A 1UN9A 2E2XA 1EO6A 4I6NB 4WJQA 2KWUB 4A3TA 4FJYA 2D11A 2P0DA 4UWGA 4Z2NA 3AU4A 5EX0A 3NZSA 3UIOB 2KXJA 1UPQA 1HXIA 2L1CA 2WB2A 5CLQB 1Z6TA 2KJ6A 2C7MB 2X38A 3E4BA 2G4SA 2I2OA 2IQCA 3SYXA 2L05A 3IFWB 2GRLA 3NHEB 1E90A 2FUHB 2JT4B 4W9KA 3TGOA 2FULA 4BBNF 1ISNA 4NJ6A 2UY1A 3GZ1A 2N4FA 3P6AA 5AZFA 5D3XA 4GZ6A 2DX1A 2DZIA 4G23A 4P29A 3GYZA 3IKOB 3PHXB 4I6GA 2NXPA 1TXDA 4KHAA 4HXIA 3GW4A 2DKPA 2R2OA 3R3MA 3OXGA 3SBGA 2IF4A 4YVQC 2RNRB 3PEVB 2UWQA 3N32A 4AY5A 3M1IB 4PDXA 2NCNA 2K6QA 3PE4A 2DYOA 2ONDA 2WX1A 5ANLA 2FCMA 1NU2A 2KC1A 2JRIB 4WJNA 5CCLA 1V5OA 4A5KA 1XCGA 1YX5B 2RSGA 3HHMA 4JKEA 2WXPA 2BKFA 4APFA 2BF8B 1HX8A 2Y8FA 2QY7A 5J18A 3VXWA 1MQSA 3FTUA 3B7UX 1KBLA 2LGYA 4A6HA 1DROA 2UYZB 2IOSA 3CV0A 4N3BA 3PGEA 1J19A 4LJOB 5C1ZA 3RK6A 1FAOA 5JH5C 3ZXSA 3SBTA 1WF9A 4RMAA 1Y8RC 1OTRB 4L6EA 3FUIA 3D9IA 5KJLA 3WANA 3ZNHB 2KJHB 3D8DA 3VTWA 4B89A 2OV8A 3PEUB 1QC6A 3CEQA 1LXDA 2OTXA 2IJGX 3O96A 5J3TA 2AW6A 5AJDA 3QOUA 1FHOA 4ICVA 4XZ4A 4JQWC 1WM5A 2KWVB 1UJJA 1IQRA 2XQNM 2RR9A 3IVFA 1D3ZA 4ILIA 4F7GA 3QQ8B 4HOUA 4CHJA 4KAXB 4BBNC 5FTPA 3PH0C 3FH5A 1WGYA 3VIAA 3RKVA 3C98A 3RO3A 1ZSQA 3ZEFA 1DIKA 3RO2A 3QWZB 1JWGA 4BKSA 3ZYMA 3R9AB 3R7QA 3EDTB 4U04A 3CSTA 2LZ6A 3LPZA 1U2BA 5G04C 3B1LX 1H6KA 3ODWA 2ZJDA 3BJIA 1E7VA 4GPTB 5DPTA 4FA6A 4I1OB 1EF5A 1H2TC 2MBHA 2KVRA 3B0AA 2W9NA 4I17A 2MWNB 4H7XA 3PG7A 3ULBA 3Q4AB 4MGKE 2DIWA 3SBSA 5AIJA 3PE3A 3M63B 2LASA 3CHSA 1UJKA 3KS2A 1WJ4A 2O6VD 3I4RB 3JQ1A 2ZCBA 4JKGA 2KHWB 3VH4B 4ICUA 2KC7A 4AJYB 2LO6A 2EJ8A 1VBGA 3FU3A 1T0YA 4N2SA 2YT1A 5G05C 2CB8A 2LBBA 2A5UA 4GYYA 4KBQA 2ADZA 3ODXA 1U5GA 3DDCB