3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
3A8QA 5CLLB 4A6KA 1V5PA 2IYBA 2DX1A 4IAPA 3M95A 2YLMA 3PGEA 1I7AA 1WH3A 2WX0A 2D07B 4WWOA 3TBLD 5HE0A 2LKOA 5LXIB 2HTHA 4HPLB 2R09A 3M1IB 1RFAA 2JPHA 4XC2A 3EECA 4HAUB 4KHOA 3MTNB 5D3WA 3ML8A 2FNJB 2K6DB 2IBIB 2L76A 3TCAA 2KOXA 3PP2A 5DH9B 1B55A 2N9XA 4HHVA 3SYXA 3P2BA 2R2OA 2W2XD 4GZUA 4DX90 1GNUA 4II2B 3PRMB 1EVHA 1FHOA 4AWJA 2P0HA 4B6HA 2N7EA 1V5TA 2WH5A 4PNKA 2N9PC 1I35A 4TV3A 1D3ZA 1EF5A 2GBKA 1GJZA 5KHQA 3CIKA 2NBUA 3PG7A 3I3TB 3WALA 2RSGA 5C6RA 1MKEA 5HKHA 2DHIA 4KHBB 1J8CA 1WMHA 1XD3B 2K00A 3A8PA 2M1MA 4XZ4A 1TXDA 2CU1A 3F5RA 4GPTB 2L1CA 2YT0A 2K8BA 1P6SA 1XKEA 2A5UA 3ODOA 3N32A 1X1FA 2V3SA 3HM3A 1L2NA 1FXTB 2ELAA 1E7UA 1P0RA 1OQNA 2ELBA 2ADZA 3ZNID 3GYPA 1P3QU 3P6AA 1FOEA 4F7HA 5D7GA 3QJZA 2IO0B 1DDWA 2OJRA 2KFKA 4BKSD 1W1GA 1RJ2A 3ZDMC 4MM3A 3PSCA 5DPTA 3DXEA 4IWOA 3A9KB 1VD2A 1UD7A 1KZGA 1WMHB 5D2MB 3HQCA 3UINB 2J59M 2RGNB 2D9ZA 1W1HA 5DCNA 3ZW3A 2C60A 3CMMB 2OTXA 2N4FA 4GXBA 4F8CB 1BAKA 1EAZA 2YT1A 1WGUA 3D32A 3U30A 4MT7A 4BBNF 2C9WB 4DHZE 1SGHA 5DPSA 4IFSA 4NJ7A 2DAFA 5J17A 4GIVA 1VCBA 1LFDA 3L13A 3DDCB 3V60A 1UNRA 5IAAC 4WSFA 2PEAA 1YD8U 4JIOU 2V4LA 3OLMD 2MX2A 4MSMB 2A4ZA 5D27A 4IWPA 3ZTCA 2K8HA 3ZNHB 4W9EA 1GC6A 3VIAA 2D10A 2COAA 3KUDB 3A33B 2MBHA 2LOZA 2DKQA 5LONB 3RULA 1Y19B 2EJ8A 2NBWB 4LJPB 2DX5A 4ZRKA 2ROVA 1PQSA 3BINA 4N9F4 3IFWB 3T8MA 4GDKA 4HPMB 2D4QA 4PS3A 4BOZB 2E2XA 1EO6A 3ULBA 5KQ4A 4IUMB 3WIMA 1NTYA 4WAAA 2QHOA 5LOPB 2Z59B 2O6VB 2M0XA 2RQ1A 2BPSA 2IO1B 3WYFB 4H8SA 4ZYNA 3PV1A 4KV2A 4HDOA 4CHMA 2D2QA 3LJ3A 1TGZB 1EGXA 1M7EA 3DBHI 2LXAA 1Y5OA 1LB1A 3MJWA 1ZVRA 4NAWA 2DKPA 2P0DA 2LRWA 2GCLA 3AU5A 3KUCB 2DLWA 3P7ZA 2NMBA 4ICUA 4HAZB 2DX5B 4W9DA 2BGFA 3QA8A 2G35A 4ANXA 4CYEA 4MSQB 1I2HA 3DBRI 4GDKB 3KVFB 2I1JA 4A6FA 4C0AA 2G45B 2UVMA 3VTUA 2LZ6A 3ZIMA 4NQLB 5D3VA 1ZKHA 4EEWA 5DPWA 1G6JA 1M94A 4MDKE 2K8CA 1UNPA 1U5GA 3TFMA 2CY4A 2Y7BA 2EMSA 1QZEA 2M14A 4FJVB 2MW5A 3V61A 2RLOA 3VOQA 2LG1A 3H7SA 1AWEA 2DENB 4NAWB 3PPAA 4NSWA 2XBBC 2KDEB 4URKA 4IM0A 2MBOA 1GG3A 2JP2A 2XK5A 4DX8A 4EKUA 3VH4B 4A6FB 4GMXB 1X86A 4Z2NA 1WF9A 3SU8X 1R4MI 4HB2B 3PS6A 2BYEA 3LDZE 4F7GA 3L16A 3R7RA 3L0WB 3DPDA 1V61A 1TZ1A 2BKFA 2L0TA 4I6LB 2ZPNA 2K39A 3EPYA 3V6EB 4EOYA 1DDMA 2DTCA 2RUKB 3O96A 3DXDA 2YS3A 1A5RA 1H4RA 1UH6A 1WYWB 2LGXA 3JW0X 4IM2A 3KW5B 3SO6A 3SUZA 1U29A 5CTRC 4JQWC 3PZDA 5KCVA 1WE6A 4W9KA 4YL8A 3H9DA 5DIFB 5BO4B 2NPTA 2RPQA 2DYQA 1Q5WB 3KYCD 2FDQA 4KSLC 3JSVA 3TIXA 2L3ZA 4BBNC 1NDDA 3NHEB 5D6JB 2ASQA 3ML9A 2LD9A 1FAOA 3WAMA 3V6CB 2KKCA 5GOWB 1NTVA 1P98A 2JRIB 3EHVA 1IRSA 1FGYA 2EC1A 4PYUA 4CHKA 2COPA 3RT3B 4JL9A 4I6PA 5AEKB 3PVLA 2DA0A 2Z0QA 4PS8A 1TBEA 4W9LA 2LI5A 1KOTA 3FM8C 3F0WA 3M63B 1MIXA 2BYFA 3DCGA 2FAZA 2N1WA 2G4SA 3T06A 2LRUA 2CHWA 2KWVB 3OANA 5KQ1A 4WWPA 3ODWA 3PREA 3TW1A 4TUUA 2JT4B 2DZIA 2YS1A 2FJLA 2NPTB 4WJQA 3MDBC 5L95C 3VQIA 1F9JA 4LCDE 2RD0A 4K81A 2LGDA 4IW0A 2JUOA 4HB0B 3BY4B 4A6HA 1XQQA 2GBRA 1CMXB 1K8RB 3HIZA 3FP5A 1WJMA 1U5FA 3VTVA 2KC2A 4F7ZA 2NVUI 2IYDB 5C79A 1MK7B 4NPNA 1WJ1A 2M8SA 1LM8B 2NS5A 1UEFA 2H7EA 3HHMA 3DVNU 1IP9A 4CHJA 2AWTA 2D11A 2ZCBA 5C23A 1LQBA 1XODA 2O6VD 2IO2B 4BOSC 1ZM0A 5DI9B 4ZDVA 5JHAA 2RSUA 4XWXA 3AI5A 4BKGA 3OJ4B 4KSKC 3RUIB 3U8ZA 3VDZA 2W2XC 2PJHA 1WJ4A 4DBGA 3B1LX 4HXDA 4M8NA 5JLJB 1ZW7A 1UBIA 3W1SC 4BVUC 2Y5BB 4EZKA 4TQ0A 3WANA 3SDLC 3N3KB 3Q3FA 1BTNA 4MY6A 2FIFA 3DXCA 4K7SA 1BTKA 4G3XB 1EF1A 2L05A 5C1ZA 1M7RA 3G9WA 3ULCA 3DVNV 3BJIA 3QBVB 3ECIA 3PHWB 1YIWA 2H7DA 2JRHA 3Q3JA 1DBHA 3QIJA 3B0AA 2HTHB 1WM3A 1OY2A 4LDTD 3ZNGC 4HAYB 4HATB 2VSZA 1N3HA 2LGYA 2C5LC 2LYDA 3APCA 2MBBB 4DDID 3MHSD 4Y94A 2J7QB 1E90A 2FCQA 4BKTA 4HJKA 3DBSA 4G0NB 2XQNM 5JHBA 1WG7A 2V76A 3VVWB 3X23A 1WXMA 4DHJD 2N7DA 2I1KA 3IVFA 2MP2A 4HDQA 1KLVA 1KI1B 4DDGD 1BT0A 3KRWA 3QARA 3RZFA 3ZO5B 1J0GA 4K2OA 1WZ3A 2LXCA 3L54A 2UYZB 5C5BA 4KDLB 3NY5A 4HVBA 4AOFA 2RNRB 2LWPA 2ZEQA 4ICVA 2KQSA 2L0FA 4HLEA 1WR1A 2KJHB 2ZNVB 2LVQA 1OGWA 4PS7A 5KHOA 2CHXA 2GBJA 3NZUA 1WJUA 2MQJA 3GOEA 1WGGA 2N0YA 3PHXB 2IFSA 3U7DA 2KDIA 2Y8FA 4KZCA 3T9LA 4K1RB 4F7UP 2VRRB 4WJNA 2KUPA 5CLQB 1NBFC 2CQUA 2KLCA 2X18A 3MPXA 4FA6A 1DYNA 1DDVA 4ZRJA 1PMSA 1YX6B 1WZ0A 1KJTA 2KWUB 3NOBA 1JRUA 4FJYA 5C5BB 4WJPA 2KFJA 2KFKB 1V81A 2LOXA 4DK5A 3TL5A 1V5MA 1HBKA 2RR9A 3N30A 1RLFA 2DZMA 5JHGA 3QK0A 2CB8A 2IO3B 4HWIB 4W9HA 4A3PA 4P7IA 3RD2A 1KM7A 4WJ7A 3W1SA 4W9FA 3HM6X 2RGFA 2C7HA 4PQ0A 2GJYA 2ZVOA 4NY0A 3H1UA 4PYZA 4W9CA 3KUZA 4DXAB 5DPRA 1C1YB 3CSFA 1NTIA 4I6NB 3UIPB 1E7VA 1V86A 1WX7A 1MAIA 2MLBA 4IM3A 2L7RA 4B95A 2PZ1A 1C3TA 2N23A 2CRFA 3WA0A 4EFOA 2J0JA 3R7QA 4FADA 1P5TA 1Q0WB 2MCNB 1OEYJ 4B6WA 4HK2A 4ANVA 5TR5A 2DYOA 1V80A 3AJ4A 1NU2A 1TJ6A 2BWFA 3VXWA 2W2WA 4FHKA 3CF6E 5LXHA 2EMTA 4KVGB 2GOWA 2MWNB 2FUHB 2ZVNA 4ANWA 2YS5A 1GC7A 1MIZB 5DHAB 3OAWA 4MGKE 1V2YA 1V5UA 3VUYA 1X11A 1MK9B 4BKSA 1S1QB 2UZRA 1V49A 1ZSQA 2GS0A 2KNBA 3HK0A 3SV1A 1WFYA 2PE9A 2PE6B 1XT9B 4M8MA 2VKIA 5HE2A 1S3SG 4LJOB 3UIOB 2KJ6A 3TVVA 2YF0A 3WAPA 3ENEA 2KXJA 1UBQA 3KYDD 1YJ1A 1UNQA 1J19A 3QWMA 2KWCA 4WQOB 3L08A 4MK0A 1SHCA 3DQVA 1TQZA 4MELA 1FGZA 2KC1A 5G55A 1WIAA 3W1YA 3K9OB 3LJUX 1BWNA 1ST7A 1FHWA 2O2VA 3ZRFA 2HRJA 2DN6A 3TMPB 1NI2A 2KCJA 2RVBB 4E74A 1WGYA 2M17A 2G3QB 2Z0EB 2MBEA 4A5KA 5L81A 5HE3A 3FLVA 2KTFA 4GDLA 1RAXA 1P3RA 2Z0PA 2KGXB 2J0KA 5J18A 3D8EA 1ISNA 2MSED 3QWZB 1X05A 3KY9A 1LW3A 2GBNA 2CKHB 3EFUA 3ZTDA 1AQCA 2P0FA 2DZJA 4IC7B 4BFRA 3PVUA 5LLIA 4RMAA 2KTRA 2N9EB 1OEYA 2XK5B 1Q67A 2Q13A 2KX3A 2DYBA 4EUTA 3IG3A 1Y8RC 4W9JA 2DFKA 2K6QA 5CX3A 2O2VB 3QCAA 1WM2A 1RRBA 3L10B 4MJSA 4EMOA 1WGQA 5FR6A 5HE1A 1UGMA 4GSWA 1DROA 2KZRA 5DHFB 1WE7A 1X1GA 3ALBA 1V88A 1WI0A 3RYTA 2JZ3B 2KQ7A 3H7PA 2CR5A 1WVHA 3ZDTA 2ZPYA 4WJOA 4GDLB 3VAWA 5J3YA 2KMAA 4A3OA 3AU4A 1WGRA 4FN2A 1RRPB 1SIFA 1WJNA 1L7YA 2QKLA 4G50A 2FCSA 3VFKA 4A20A 4DWFA 3JSVB 1UPRA 3PVWA 5IA7A 3AULA 2KTRB 2QKMA 3RCZA 4GB9A 4NQKE 2MKRA 2FCMA 1E8XA 1QC6A 2LBBA 2KX0A 5CHVC 1V5OA 4DHZB 4ANUA 3D8FA 4EJNA 5C16A 3KH0A 4MJSB 2KD0A 4E71A 2NZ8B 1P9DU 3NZSA 4YONA 1E5WA 1WGHA 4GN1A 2MWSB 2DZKA 1WRDB 3ZUNA 3H7PB 2KVRA 2AEHA 4XX5A 5E6PA 3DBLI 1FHXA 2L00B 2WYQA 1X1MA 1XX0A 2K2UA 2YSZA 4KAXB 3PRZA 1WXVA 2K1FA 2NR2A 1TTNA 1ZGUB 3M62B 2CY5A 3IHPC 2MFQA 2C7MB 2BF8B 4FJZA 4CO7A 2L8JA 4NJ6A 1OMWA 3ODXA 4FLHA 4KDIC 2DHJA 2W9NA 1V6EA 3AXCA 2GMIC 2LJ5A 3APFA 2I5CA 3VUWA 1QQGA 2M38A 2JY6A 4JLCA 3CSTA 1K5GB 4HCPB 1I42A 3A9KA 2VRWB 2GCJA 4KIKA 2HD5B 3H6NA 3A1QA 5EDSA 3JYUA 3TO1A 5AZFA 5J3TA 3A9JA 3FEHA 4WVFB 5J3QA 4AJYB 4Z2MB 4AP4C 1HE8A 3IBEA 1NVLA 1Z2MA 2BWES 4K7UA 3M3JA 4MH0E 2OQBA 3K9PB 4K2PA 4TQ1A 3O65B 1U27A 4K17A 5D3YA 4K7WA 2UWQA 2AYOB 1HB8A 2ROZB 3UQAA 2BCJA 3QX1A 2JWZA 2KJRA 1UPQA 2BKRB 2WX1A 3R66C 5CHWA 2YRYA 2LUEA 1WJ6A 2DYNA 1MPHA 4HB3B 2D9YA 1E8YA 2FCNA 3ML4A 4KIKB 2CHZA 5JHHA 3A1QB 2FJ9A 1T0YA 4G11A 1KZ7A 3V62A 3A9JB 1GUAB 4E3CA 2MP2B 1ZC4B 2Y8GA 4IG7B 2DHKA 4MGYE 2LVPA 5EFXA 2JF5A 4KZ0A 4W9GA 2O6VA 1J0WA 3SHQA 4M0WB 4NNJB 3SD5A 2WWZA 5FI0A 1AARA 3KRXA 3JVZX 2WDTB 1Z87A 3VHTC 5JH5C 1R4NI 3ZRCA 1XCGA 1IPGA 4OVVA 1V9JA 2DAJA 1PFJA 2N1VA 3VTWA 4HAWB 2COCA 2LVOA 2REXA 2BYVE 5L83A 3GYOA 2EKEC 4X57B 1U4AA 5J2RA 5D94A 5G2NA 1E8WA 3RZWC 1EUVB 3S2AA 2KN5A 4J6IA 1MG8A 4IWQA 5GMVA 4RM9A 2PPHA 4GMVA 2K25A 2KDBA 3X0WA 1XD4A 3ZVRA 4DBBA 2MDXA 4TYZA 4HB4B 3DVGY 4B9KA 3UGBB 2MBQA 2IY1B 1H8CA 2C7NB 1WXAA 3UQBA 3ONSA 2JVCA 1OQYA 3PEGA 5AZHA 4ZRIA 3R3MA 1ACAA 3TJPA 3QHTA 1V89A 2KHWB 3OJ3A 2FIDA 2NBVB 1U5DA 3C0RB 1WX9A 2ZJDA 3A4RA 3VH3B 3GZNI 4AUQC 4GOCA 3KZ1A 3DVGX 2IZVB 5FI1A 2KLGA 3A4SC 4HCNB 2KK8A 4MGZE 4OVUA 4AJWA 2UZSA 4LDTB 3SNHA 2R0DA 3ZNZB 4ASWC 2KMCA 1ZC3B 2I5FA 1WR6E 2ZCCA 2OOBB 3CXBB 2GBMA 1WY8A 5CHFA 2CODA 1P1AA 4F1SA 3V5WA 4GU2A 3HW2B 2JXXA 2MRPA 3ZKJC 5D3XA 2Z0DB 1U2BA 2B3AA 4MGIE 3PTFC 4DHJB 3NSUA 3PLVA 5E6NA 2COFA 3ZVVA 2P8VA 3PT2B 2D3GA 2M4NA 3PRPB 4EZJA 3WAOA 1YX5B 2JZZA 2KDFB 2CAYA 3DOWA 1H10A 1FB8A 4II3B 3FSSA 3D8DA 1K5DB 3EC8A 4GGQA 4BBKA 2LASA 4L6EA 2DHZA 4FHJA 3UZTA 4HAVB 2HJ8A 3VUXA 2KO3A 3L17A 1XR0B 1WX8A 2D9XA 4RM8A 4W9IA 3APDA 2YVCA 4TKNA 1YQBA 2XEWA 2R2QA 3QAQA 4HAXB 2HE7A 5IJMA 4IOYX 2V1YA 2IY0B 2ZNVC 4MEMA 1U5EA 1Z5SB 1WXSA 1Q1OA 1HB6A 2ABDA 3PLUA 2LULA 3A98B 3N7CA 3NS8A 2Z0OA 4D0NB 3UF8A 3QQ8B 1UZXB 1W1DA 2G4DB 1WGDA 3QC8B 4EZLA 2CS4A 2ZZPB 5AZGA 2D9WA 1OTRB 5JP4A 3PSEB 2KANA 4KHAA 5JZEB 2K2JA 1WI1A 1E8ZA 1LXDA 3KSYA 2AL6A 2AL3A 1SE9A 3RCPA 5E6OA 2L2IA 2NCNA 3B08A 4JGHB 2J0MA 1IYFA 2D9VA 1PLSA 4FBJB 2DYMA 3ZLZA 4FULA 2MA9B 1UELA 4WWNA
chains in the Genus database with same CATH superfamily
2ETBA 3C98A 2Z13A 5AQBA 3A8QA 5CLLB 4A6KA 5LP0A 1V5PA 3SFXA 2IYBA 4HFGA 3SI5A 3EUVA 3AJIA 3KAEA 4EQFA 3Q14C 2DX1A 4IAPA 1Z3YA 3RAUA 4K3BA 1U3DA 5BV0A 1MVKA 4JE3B 3M95A 2YLMA 3PGEA 3DEPA 2ZGDA 3ONKA 1I7AA 1WH3A 2D3CA 1QQEA 5G5HA 2WX0A 3TXNA 3DBLB 2D07B 4WWOA 3ZKJA 4RGTA 3TBLD 5HE0A 2LKOA 4HOUA 5LXIB 2H6GA 1UJKA 3CVXA 3JXIA 3B7SA 3BUAA 2R09A 2HTHA 4HPLB 4HORA 2PQNA 1FFUA 3M1IB 1RFAA 2YT2A 2DCPA 2JPHA 4XC2A 1Z6TA 1OWPA 1BI8B 4KHBA 1QZ2A 1INZA 3EECA 4HAUB 4KHOA 5BW8C 3MTNB 3VR9B 5D3WA 3ML8A 5I2MA 2FNJB 2K6DB 1KPSB 2IBIB 2L76A 3AEDB 1K51A 3TCAA 3W9FA 1TNBA 5HG2A 4KYOB 3QB2A 1V1OA 1N4PA 2KOXA 1HA5A 3PP2A 5JVLA 2UY1B 3EHQA 1FPPA 5EE0A 2UWJG 2OV8A 5DH9B 5BXOA 3MGBA 4ILGA 5CEDB 1V1PB 5ENQD 1FCHA 1B55A 2CJNA 2N9XA 4CCAA 4MS6A 4HHVA 4JHRA 3SYXA 2W82A 3IXSA 4XWWA 3P2BA 4G8LA 3P4RB 3MJ5A 1E9MA 2R2OA 1N5XA 2W2XD 5ITZF 2R02A 4L9PA 3AE1B 2RMMA 4GZUA 4DX90 4CT0A 1GNUA 2DWQA 4II2B 5AYWD 1UNSA 4JEHA 3PRMB 1EVHA 2I9CA 1FHOA 3U7ZA 1FT1A 5BXUA 4RSYA 4AWJA 1FNWA 2P0HA 4B6HA 4HOQA 2N7EA 5HQ8A 2WXOA 4YTPB 5ENSD 3ZXRA 4GMJA 1V5TA 4C48B 2WH5A 3SFYA 2Y69E 4PNKA 4CGWA 2P9KG 2N9PC 3C3QA 1QQRA 2OOEA 1I35A 1C4CA 4TV3A 1D3ZA 2DZOA 1I4GA 1EF5A 2GBKA 1GJZA 5KHQA 1TJEA 1B9RA 3CIKA 2NBUA 3V2XA 2FE8A 2FJUB 3PG7A 3AS4A 2BB6A 4EECA 1HZ5A 3I3TB 2QEJC 1ZP0B 3GE3C 2HJ1A 2C0LA 1KRHA 3WALA 2RSGA 3ABLE 4RG6A 1EU3A 5C6RA 2VGEA 1MKEA 5HKHA 1UF0A 4MH8A 4B8CB 3CKBA 2DHIA 4KHBB 1OXJA 2WXMA 4NJCA 1J8CA 1WMHA 4B94A 2PTLA 1XD3B 2K00A 3A8PA 1XNFA 3AM9A 2M1MA 2PVOD 4XZ4A 1TXDA 2P9LG 2CU1A 3NOGD 1IQUA 4GZ3A 2EINE 4O1NA 3PUJA 1TN7A 4HRSA 3VLDA 1A5EA 3F5RA 1XCTL 5BNWA 4GPTB 2P9PG 3FULA 4NACA 2L1CA 2YT0A 2OEWA 4ILGB 2K8BA 1P6SA 1L4DB 2A5UA 4BT9A 1XKEA 3ODOA 4TUMA 3WCQA 3N32A 1X1FA 1YJJA 2V3SA 3HM3A 3DSXA 3VRBB 4EE2A 1L2NA 1HO8A 2LFIA 3KEZA 2INDC 1HXYD 4B93B 5AIJA 1FXTB 3BVZA 2ELAA 2Y4TA 4A3VA 4XEIG 1E7UA 5FQ4A 3SZ7A 4N3CA 1P0RA 3JQ0A 4LUNU 2XRZA 4Q2JA 2WQYB 1OQNA 2ELBA 4C80A 1XEEA 4Q69A 3ZGZA 3CVNA 3PZ2A 2ADZA 1CK1A 3QNKA 3ZNID 4BAXA 3GYPA 2AQ3B 1T3QA 2PM7A 4NRHB 1P3QU 2BEDA 1YQ3B 2Y5PA 3P6AA 3FUFA 3NVVA 1WM5A 1FOEA 1CQVA 3LYAA 3HYMB 4F7HA 1ZDXA 2J4XA 5D7GA 3QJZA 4RQIA 2IO0B 1DDWA 1NVID 3I5JC 4YNDA 3MC8A 2OJRA 2KFKA 4BKSD 2V5FA 4AV7A 1W1GA 3MP9A 3W2DA 1RJ2A 4OT1A 1WXQA 4MM3A 3PSCA 3ZDMC 3D9OA 5DPTA 1T0QC 2V4IB 3DXEA 4IWOA 1ZYIA 1KZPA 3A9KB 3TWSA 1H19A 1TY0A 1UGJA 1VD2A 1UD7A 4OHJA 3P42A 5LCWC 1KZGA 4U95D 3DEOA 1JWFA 3I63C 5B1AE 5FR3A 1H2UA 1WMHB 5D2MB 3D9IA 3HQCA 2KDMA 3UINB 2J59M 4YSXB 2RGNB 4LERA 2D9ZA 1W1HA 5DCNA 4YSYB 3PZ3A 3ZW3A 2KVZA 1JCRA 4LNOA 2ICIA 4WH4A 3AECB 4HI8A 2C60A 3CMMB 3Q47B 4RF1A 2LXMA 5AQ9A 2OTXA 3JUEA 3O13A 3FTUA 2N4FA 4GXBA 4XIFA 5EX0A 1BAKA 4F8CB 1EAZA 2YT1A 1WGUA 5LCWJ 3RIBA 3D32A 4R3DA 3U30A 1R4NB 2Z59A 4MT7A 2ZXWE 4BBNF 4PUCA 2C9WB 4DHZE 1SGHA 5CRVA 5DPSA 2ILRA 4IFSA 5FZSA 2DAFA 5E76A 4NJ7A 3Q3MC 5J17A 4GIVA 1DC2A 4N58A 1VCBA 3RPFC 1LFDA 3L13A 5A7DB 1NYQA 3DDCB 4LNFA 4IN3B 5IAAC 1ELKA 4JPSA 1UNRA 2XEVA 3X2QE 5C2TB 3V60A 1RWSA 4WSFA 5CHEE 1N5WA 3CHQA 2PEAA 5FK9C 1YD8U 4JIOU 2V4LA 4N39A 3AE7B 4BERA 2MX2A 3OLMD 4MSMB 5IOIA 2A4ZA 1M4VA 3TG5A 4GTMA 2LNIA 3BZDB 3V79K 5D27A 4IWPA 1PYWD 4BZAA 3ZTCA 2K8HA 3ZNHB 2J09A 4BTAA 3E37A 4AVXA 4W9EA 1K3ZD 1GC6A 3VIAA 2D10A 2COAA 2J4DA 3MHZA 3QWVA 4MM3B 4DI3A 3KUDB 4C7ZA 3A33B 4QJ5B 3SHFA 2MBHA 3DSTA 2L9BA 1FXAA 4AS1A 2LOZA 2DKQA 3EU5A 5BYSA 5LONB 1IXVA 3RULA 4HS2A 3CHOA 1Y19B 3LS8A 3O4ZA 2EJ8A 1TNZA 2MJEA 2NBWB 4LJPB 3TWVA 2DX5A 4ZRKA 1MHQA 2ROVA 3DSSA 2DYRE 4M01A 1PQSA 4M3OA 4OW0A 3BINA 4BY6A 1LGRA 4N9F4 3G2VA 2KIGA 3IFWB 3TWWA 4I2ZA 3T8MA 2XCCA 2YINA 4GDKA 4HPMB 2D4QA 4PS3A 2HTME 3LY9A 2E2XA 4BOZB 2IJGX 3ULBA 1EO6A 3L22A 1EPUA 5KQ4A 4RGOS 1BUIC 1KTKA 4ZHOA 2AXUA 1YA0A 4IUMB 1KLUD 2PVGC 3WIMA 2LGIA 1NTYA 1I7HA 2K5PA 4WAAA 2AXVA 2QHOA 5LOPB 2Z59B 4DQOC 2O6VB 2M0XA 1T0SC 2RQ1A 5BYRA 2BPSA 1JCKB 1QOGA 3R2IA 2IO1B 2OEVA 5J90A 3AH7A 5HKPA 3WYFB 2XZTG 1TIFA 2NXPA 4O1PA 5I2SA 3FU0A 3RRUA 1UG3A 4APOA 4H8SA 4ZYNA 4LCTA 3PV1A 4KV2A 4HDOA 5JJ7A 3ZUVB 1AW7A 5JJTA 5T4YA 4RCOA 5CERB 5CCMA 1WDYA 4CHMA 2D2QA 2KCLA 1FPYA 4A8XC 3BVMA 3LJ3A 2A5EA 3UQAA 1DOXA 2IGHA 3SEBA 4XI0A 3EDTB 1L5PA 1DOIA 4CZ2D 3A58A 3NWDA 1JROA 1TGZB 2SEBD 4U8YD 5ARFA 3RK6A 3AAAC 3O48A 4G1TA 4WURA 1D4BA 1EGXA 1JWAD 1M7EA 3DBHI 2LXAA 1Y5OA 1N62A 1IHBA 2KCVA 1D5ZC 1LB1A 2L32A 1TR4A 4ZHBA 3KSQA 2Y3AA 3MJWA 1ZVRA 4NAWA 4ARIA 2IO2C 5DIZA 1HU3A 2DKPA 2NTSA 2P0DA 2LRWA 2E0IA 3T3OA 3DBRB 1VDYA 3DHGC 2GCLA 1JWSD 3FDHA 3AU5A 3KUCB 2QY7A 2YEPF 2DLWA 2BS4B 3P7ZA 2NMBA 3BK2A 4ICUA 2Q5WD 4ILJA 4WNEA 4V3IA 4HAZB 1DVPA 1VRAB 2DX5B 4W9DA 3I4GA 2BGFA 4ANXA 2G35A 3QA8A 4UI9K 4CYEA 4MSQB 1I2HA 3DBRI 1WGKA 5IP4D 4GDKB 1LD8A 1VR9A 2I1JA 4UI9C 3KVFB 4A6FA 3L82A 4C0AA 2G45B 5AUKA 4Y6WA 2E6XA 4MLPA 3U9WA 2UVMA 3VTUA 3AG1E 3ZIMA 3BQOA 1N11A 2LZ6A 2PM6A 4HRNA 3D9MA 3DXMG 2QILA 5D3VA 4NQLB 1ZKHA 3G2TA 2WDRB 4EEWA 5BYQA 4EHMA 5DPWA 1G6JA 3SGHA 4OVZA 1M94A 3NVZA 2W54A 1TS4A 2F8XK 4IDIA 4MDKE 2K8CA 1XGWA 1U5GA 1UNPA 3GZ2A 3TFMA 3EFCA 3B7BA 2CY4A 3FUDA 2WPVA 3ASDA 2Y7BA 2EMSA 4UI9J 5ANRA 1QZEA 2P9SG 2J8SD 1DCQA 3GYZA 2M14A 1F2RC 2XPYA 4BT8A 4FJVB 4ME2A 1SVXA 3HRAA 2MW5A 4LNIA 2XNAC 1L6UA 3V61A 2PL2A 1HXIA 5B3SE 2RLOA 3VOQA 1E96B 2LG1A 4GAAA 3H7SA 1AWEA 1MHXA 2DENB 3DSUA 2Y4UA 4NAWB 2DIWA 2BTDA 3PPAA 2KR0A 4YTNB 5EIBE 1BLXB 4NSWA 2WB2A 2XBBC 5CEAA 2WGSA 3OG5A 2KDEB 5HHDG 4URKA 4ZRPA 1G3NB 4W9RA 1D5XC 1W3BA 2VSOE 1KLGD 4JKDA 3W9GA 1QKZA 1R4MB 4IM0A 3LVQE 5ENOD 3B7UX 4DX1A 3FFLA 3ZYYX 2MBOA 4GCNA 3UQ3A 2KIEA 1GG3A 3FUMA 2JP2A 3TWRA 5BPPA 4P16A 3R8BA 2XK5A 4DX8A 3ASHA 3NW8A 4EKUA 3VH4B 4A6FB 4GTOA 4GMXB 1X86A 4Z2NA 1WF9A 5EE9A 3SU8X 1N61A 1R4MI 4HB2B 1GB4A 2ZW1A 3PS6A 1N52A 2IU1A 2BYEA 3LDZE 3HXDA 4F7GA 3L16A 4LLGM 3R7RA 5EKQD 3SFDB 3P1UA 2FBWB 2CJOA 3L0WB 3DPDA 3LY8A 3OXGA 4XKCA 1V61A 1TZ1A 2BKFA 2L0TA 4DLOA 5LG4B 4I6LB 1ZE3D 2XZDG 2ZPNA 2K39A 3EPYA 1K53A 3V6EB 1NP7A 3ULEG 4EOYA 3ZJVA 5AARA 1DDMA 4FC8A 5EYLA 2DTCA 2H6FA 2RUKB 3O96A 3J5PA 3DXDA 1HEZE 2YS3A 1A5RA 1H4RA 3BYTB 5IN7A 4I1AA 1UH6A 2PW9A 1WYWB 5KJNA 2LGXA 3JW0X 4IM2A 3KW5B 3SO6A 4TXQA 3SUZA 5AN8A 1OUVA 4UQXA 3FU3A 4JW1A 1L6VA 1VZ6A 2VGYA 1U29A 2G1EA 2INPE 3QC1A 1D8DA 3UXGA 5CTRC 2JEKA 2B0OE 3ZYLA 3PZDA 4JQWC 5KCVA 2ONQA 1WE6A 2Z8LA 4W9KA 3PUKA 4YL8A 4WWNA 3H9DA 2KYWA 3Q6BA 5DIFB 2W3SA 5BO4B 4F53A 2GRQB 1QNFA 4QJ4B 2L0IA 2NPTA 2B76B 4HEA1 3B7TA 1HZ6A 4A3TA 2RPQA 1B89A 1SZAA 3FUJA 4ARCA 2DYQA 1Q5WB 3KYCD 3NUHB 2FDQA 4KSLC 4GMLA 3JSVA 2X3MA 3TIXA 3URYA 4DXFA 2K9XA 5ANLA 2L3ZA 4BBNC 2MHKA 4JXTA 4UWGA 1NDDA 1OWLA 3NHEB 2XGSA 3FTWA 2F37A 4N2QA 5D6JB 4RF0A 2ASQA 5IKCM 4B0ZA 3ML9A 2WQHA 2LD9A 1N4QA 1FAOA 3WAMA 3Q73A 2R2YA 3FC4A 3V6CB 4GOUA 3SBSA 3AB5A 2KKCA 5GOWB 1NTVA 1P98A 2JRIB 3EHVA 2JYEA 1IRSA 3RSEG 1FGYA 1S0PA 2EC1A 5E6JA 4PYUA 1OWOA 3NBNB 4CHKA 4FXCA 2VJ8A 4K5BA 2COPA 3RT3B 2ZU6B 4JL9A 4I6PA 3Q8BA 5AEKB 1H2VC 3PVLA 1XCQL 3Q8EA 1MG4A 4C4VA 2DA0A 2Z0QA 4PS8A 1TBEA 2L0TB 3MC9A 2QFCA 3N1ZC 4W9LA 1I4HA 4GTTA 3SR6A 2LI5A 1YMHE 4JA7A 2WXIA 1KOTA 3MX3A 3FM8C 3TWTA 3F0WA 3M63B 5A23A 3AE3B 1V55E 1I4QA 5BT1A 1MIXA 3MKQA 2H88B 1N4RA 3ENBA 1SE4A 2EELA 2BYFA 3DCGA 3IEGA 2FAZA 2VSNA 3AE8B 1IUEA 3N9YC 3U2SC 3EHMA 2N1WA 3CVUA 3MFGA 3D9NA 2G4SA 2WXLA 1AWCB 3T06A 2LRUA 4XKBA 2CHWA 1ET6A 5ENPD 2KWVB 2FO7A 2IO3C 3OANA 5KQ1A 2XHEA 4WWPA 4YTMB 3ODWA 4KMOA 3PREA 4TUUA 3TW1A 2JT4B 2DZIA 3HXFA 2LHEA 1UW4B 2YS1A 1SJHD 4I1MA 2VSYA 2V0PA 2FJLA 2NPTB 4WJQA 1SSNA 2QIEB 4TXRA 3LVRE 4ZOHC 4P1CC 3MDBC 5FZQA 4YT0B 3C8YA 5L95C 3VQIA 1F9JA 2WS3B 4K5AB 4LCDE 2RD0A 4GZ5A 4K81A 3RNBC 4JKGA 2LGDA 4IW0A 1BU9A 4M7CA 2JUOA 1TNYA 3P4PB 4HB0B 1Q2ZA 2PMVA 2C0MA 1D6EC 3BY4B 4L2YA 2XPZA 4A6HA 2J52A 3OWEB 1XQQA 2QDFA 2DNFA 2GBRA 3AEBB 1UN8A 2QC9A 1CMXB 1K8RB 3HIZA 2ETAA 3FP5A 3B9JA 2KWDA 1S63A 4HB5A 3L6AA 4ATZD 4P1BC 3UIPC 1WJMA 1U5FA 1DYQA 4A9AA 4ZHPA 3VTVA 2KC2A 4F7ZA 5HS0A 2IYDB 2NVUI 5C79A 1MK7B 1C79A 4NPNA 4I6EA 1WJ1A 2M8SA 1LM8B 2NS5A 3VLEA 4C4VB 1UEFA 2KATA 2H7EA 1V8CA 2WU2B 3CHMA 3HHMA 1YN4A 1MFWA 4FU3A 3DVNU 1IP9A 4CHJA 4L1BA 3N20C 4C0EA 2AWTA 1JQ4A 2D11A 2ZCBA 5C23A 1LQBA 1XODA 3MKQB 2IO2B 2O6VD 3BWUD 2RFMA 3R9MA 4BOSC 4UWKA 1ZM0A 2DBAA 2I2OA 5DI9B 1QOFA 2E2EA 1FXIA 1SE3A 4DPRA 3DHIC 4ZDVA 5JHAA 1AYFA 2LO6A 2RSUA 3JYSA 5KNHD 4XWXA 3AI5A 2LJIA 4BKGA 4YXDB 3CHPA 2WU5B 3OJ4B 3CQCB 1N0RA 4KSKC 3RUIB 5D0QD 3UKUG 1XLNA 3U8ZA 4RFBA 2R82A 5FQ7A 3VDZA 1PDXA 2WHIA 1HZ4A 2W2XC 2AXZA 1TKEA 2PJHA 4ZYSA 2WM9A 3EHNA 3UPVA 5KWDA 1WJ4A 1HS6A 4DBGA 1UJJA 3B1LX 4CDMA 3FU5A 5KJKA 4HXDA 1NYRA 5KJLA 4M8NA 5JLJB 1ZW7A 1UBIA 3W1SC 4BVUC 2Y5BB 4DX2A 2LAIA 4EZKA 2JWUA 1WWTA 3WANA 4TQ0A 3SDLC 4U04A 4N5CA 3N3KB 5E75A 3Q3FA 4JKGB 3CVWA 2ACZB 1BTNA 4MY6A 2XPIA 4BX9A 2FIFA 3DXCA 4K7SA 4AEZC 1BTKA 4G3XB 2X6HA 1H0AA 1JUQA 1EF1A 4OZCA 2L05A 4GTQA 5C1ZA 1M7RA 3D3MA 3N71A 1NI1A 3G9WA 3ULCA 3DVNV 4OAVB 3BJIA 3QBVB 3FUIA 3ECIA 1GW6A 4HXIA 2LGSA 3PHWB 4F7AA 1TS2A 1YIWA 3Q5MA 2H7DA 1IBXA 2JRHA 3AMZA 3Q3JA 1R7SA 2JU6X 4GTRA 3QIJA 1DBHA 3B0AA 2M63A 2HTHB 3Q75A 3CKCA 1WM3A 3TWXA 2PNNA 3TG4A 1OY3D 1OY2A 4LDTD 1JCQA 2LUHA 5FIOA 3ZNGC 1NEKB 4HAYB 1L0VB 2GRMA 4HATB 1FRRA 2Y0BG 2VSZA 1I4RA 1N3HA 3B7RL 2KT7A 2LGYA 3NRZA 4G8KA 2FULA 2WVIA 1BD8A 2C5LC 4NIKA 4C00A 2LYDA 3IAM1 3APCA 2MBBB 1FO4A 4DDID 2BVCA 1F77A 1VZ7A 3MHSD 1F2RI 2W55A 1RM6C 1YYHA 1FRDA 4Y94A 3FH8A 2H6HA 1LTXA 5HRYA 3UIOC 2J7QB 1E90A 3PEUB 2FCQA 1N4SA 4U63A 2AVPA 4BKTA 4HJKA 4GZCA 3D9PA 3AV8A 1HTOA 1EYHA 3DBSA 3AE9B 4G0NB 3TGOA 2CFZA 4C56C 2INCC 2XQNM 1ELRA 1OT8A 3CVVA 3FEXA 1TS5A 5JHBA 1JWBD 1V54E 3ZYKA 1WG7A 2V76A 3VVWB 3X23A 1WXMA 4DHJD 5CCLA 4HQDA 2WXRA 4AP2A 2N7DA 2I1KA 1WAO1 3IVFA 2MP2A 4HDQA 5TSSA 1S64A 3E9LA 1KLVA 1KI1B 4DDGD 2EQXA 3DCXA 1QOBA 4CDRA 2GRLA 1BT0A 1QILA 3PZ4A 3KRWA 3QARA 3RZFA 1NFIE 4KKIA 1PUTA 2XN9C 3ZO5B 1J0GA 4K2OA 1WZ3A 1TNOA 3G2UA 1FEHA 1GOZA 4ACKA 1GGOA 2LXCA 1MZCA 1PGXA 2VYIA 3L54A 4JKAA 2UYZB 3Q15A 5C5BA 1J7CA 4KDLB 2PQRA 3C3RA 3NY5A 2X8XX 2QJLA 1VJKA 4MKTA 4HVBA 4AOFA 1IBXB 1OCCE 3UMVA 2RNRB 4QJ3B 3RO2A 2LWPA 3LDZA 2ZEQA 4ICVA 2KQSA 2L0FA 2M19A 5J08A 4HLEA 2D3AA 3U4TA 1WR1A 3SBGA 2KUQA 2R5SA 2R17C 3MZLB 2OCCE 3RJVA 2GROB 2KJHB 2J4BA 2ZNVB 2FEZA 2GRRB 3UKRG 2LVQA 2MHJA 1OGWA 4PS7A 5HI7A 3FUKA 5KHOA 2CHXA 2GBJA 3NZUA 1WJUA 2MQJA 2WXKA 3MEKA 4OSNA 2BKKB 3GOEA 3VR8B 1WGGA 4CT4A 4EBAA 1SIJA 2N0YA 2C2LA 3FEYA 3PHXB 1A17A 4CSQA 1FNUA 2IFSA 3U7DA 2KDIA 4MRUA 3IHYA 2Y8FA 1YJIA 2VH2A 2WXGA 4KZCA 4CEMA 3KD7A 2WLBA 2OVBA 1MI0A 5GXGB 3T9LA 5FKAC 4K1RB 2R03A 2VH1A 2XQ0A 4F7UP 2VRRB 3HVZA 3ZEFA 4TXPA 1H6OA 5CRUA 2KUPA 5CLQB 4WJNA 1NBFC 2WQ7A 1KLXA 3Q8CA 2CQUA 1TEZA 2KLCA 4JHKA 2X18A 2EIJE 4J8DA 3MPXA 2IJ0A 2ON8A 4FA6A 4TSSA 1DYNA 1DDVA 1FVFA 4ZRJA 1OCZE 2WXJA 3SBTA 1N60A 1PMSA 4YDEA 1YX6B 3NVYA 2JSVX 1WZ0A 3CVPA 1KJTA 3S7FA 2KWUB 1TZOA 2BYTA 4BESA 1WRIA 2QYUA 3UUXA 3NOBA 4HRLA 1KBLA 1FVHA 1K8KG 4FJYA 1JRUA 1TKYA 5C5BB 2KFJA 4WJPA 3JXJA 3U3WA 3ZJTA 4LK0M 3FWVA 2KFKB 5KCMA 4DX6D 4DK5A 2LOXA 3TL5A 1C4PA 1V81A 4M00A 5AQAA 3D9HA 3CVYA 1V5MA 1I4XA 1HBKA 1O5MA 5G04C 4K5CA 1NA0A 2GI9A 2RR9A 2LXLA 3Q8AA 3KEAA 3N30A 4WQMA 4GNKB 4EBAG 1RLFA 3ULYA 2DZMA 5JHGA 1C78A 2R61A 3QK0A 2CB8A 1FD6A 2IO3B 4FP7A 4KT6B 4UWHA 3T3NA 4HWIB 4W9HA 3KWVA 4A3PA 4P7IA 1MX6A 5JA4D 4FLBA 4DLQA 1V97A 3Q3OC 3RD2A 4YDYA 2VSXE 1N95A 1KM7A 1TT5B 4WJ7A 3P4QB 3FUEA 3W1SA 4W9FA 3HM6X 3DWGC 2RGFA 4IYPA 2C7HA 4PQ0A 3KWLA 2H6IA 2FF4A 5G04J 2GJYA 4ABNA 3CEQA 4JB8P 2ZVOA 4NY0A 4HJGE 3H1UA 4GTSA 4PYZA 4W9CA 4WWMA 2MEKA 4PH4B 3KUZA 1JMLA 4DXAB 5DPRA 3UM0A 1C1YB 3CSFA 2K3UA 4I9EA 4ACFA 3E9OA 1NTIA 2LAHA 4I6NB 5EYPF 4JHJA 2WQ6A 4BSZB 3UIPB 3MCXA 1UN9A 1E7VA 3Q4AB 1V86A 1WX7A 1KC7A 3DBHB 5C2YA 1MAIA 2MLBA 2BF0X 3SBTB 3KLSX 2KM4A 4IM3A 3SY2A 2L7RA 4B95A 2PZ1A 2LUMA 3ZNGA 1XLPA 1C3TA 1C77A 1SXTA 1J7BA 5B1BE 3HDXA 2N23A 2CRFA 1E7PB 3ZHEA 3WA0A 2FO1E 4EFOA 2NSZA 2J0JA 4DRXE 1JDEA 3R7QA 4UQYA 1ZUD2 4FADA 1P5TA 3L9TA 1Q0WB 2MCNB 1OEYJ 3DWMA 4B6WA 1MI1A 4HK2A 3RN9C 4ANVA 5TR5A 1MJ0A 2DYOA 2BS3B 2TSSA 1V80A 3AJ4A 2BQQA 1NU2A 1HFAA 2BKGA 3EHRA 1TJ6A 2BWFA 3AG3E 2NTTA 3VXWA 2W2WA 4FHKA 2R05A 2N9KA 1LF8A 4NURA 4ILHA 3VLFA 2HE0A 2HR2A 1HH8A 3FTYA 4QXAB 3CF6E 5LXHA 3D9LA 3EJNA 3EA6A 2FUG1 1K1AA 3CK9A 4JK7A 3LEWA 3J5QB 2EMTA 5CMWA 4KVGB 3EUB2 2GOWA 2MWNB 2FUHB 4GPKA 2ZVNA 4ANWA 2YS5A 3FILA 1GC7A 3AG4E 1MIZB 5DHAB 4DIXA 3OAWA 4MGKE 1Q10A 1KT1A 1V2YA 3Q9NC 1V5UA 3VUYA 2KC7A 1X11A 4ITKA 3GZ1A 1MK9B 1TN6A 4BKSA 3B95A 2J49A 2RDBC 1S1QB 2UZRA 4UQZA 2DWZA 5A6CA 1V49A 3UTMA 2N7JA 1ZSQA 2E3TA 4C0MA 2OEDA 2LSVA 3Q7FA 4HRMB 4E6HA 3IV0A 2GS0A 2KNBA 4KGTA 2F0YA 2QZAA 3HK0A 1KF6B 5FTPA 3MC0B 3SV1A 1WFYA 1J7AA 2PE9A 4K3CA 5IO9A 1PAQA 4F3VA 2PE6B 2BB5A 3TSSA 3ESLA 1YOVB 1XT9B 4M8MA 3BEEA 4KXKB 5FWQA 3ZHEB 2VKIA 3NB2A 4WNGA 3E56A 5HE2A 3JUIA 1S3SG 3T5XA 3PEVB 5FZRA 4LJOB 1TKGA 3UIOB 5FQ6A 2DYSE 2KJ6A 1JPLA 4I17A 3TVVA 3OXLA 2J07A 1LO5D 4RNAA 4UWLA 4HROA 2YF0A 2EIKE 1EWCA 4GZ6A 1SQMA 2KN4A 3WAPA 2WXFA 3ENEA 4K03A 2N9LA 2KXJA 1UBQA 3GW4A 3SFZA 3KYDD 1YJ1A 1UNQA 2GGFA 1J19A 2VQ2A 3QWMA 1C4AA 2KWCA 4WQOB 3L08A 4D10C 4LNNA 4MK0A 4Q94A 1DGJA 1SHCA 3DQVA 1P5QA 3CIRB 3MA5A 1TQZA 3I5PA 3BYYB 5HFYA 2IF4A 5JMND 4LSZE 4YVOA 3FILB 4KKJA 4MELA 2IQCA 1FGZA 1TJFA 5G55A 2KC1A 1WIAA 3W1YA 3K9OB 3LJUX 1BWNA 5FT9A 4F1PA 4U0ZA 1ST7A 1FHWA 2O2VA 2WMNA 3ZRFA 4U96D 2HRJA 2DN6A 1F0ZA 3TMPB 5JJ6A 1XLOA 1T0RC 2WXPA 2WDVB 1NI2A 3S7JA 4N3AA 2KCJA 2RVBB 3OHMB 3C19A 4E74A 3Q69A 1ZB1A 1WGYA 3CLJA 4N2SA 2M17A 2PZIA 4HI9A 2G3QB 3Q8FA 1WG0A 4YDOA 2Z0EB 5DBKA 2MBEA 1KZOA 4A5KA 2QYJA 2CFUA 1UOHA 3BG1B 5L81A 4XDCA 2WXQA 1IGCA 5HE3A 3FLVA 3UM3A 5LOZA 2KTFA 1ELWA 4L23A 3T5VA 3ETRA 3G2WA 4GDLA 1RAXA 3TEWA 4Q96A 1P3RA 4L2LA 1UUPA 2Z0PA 3ISMC 2J0KA 3HG0D 2KGXB 2GB1A 5J18A 3D8EA 1ISNA 2MSED 3AEEB 5FJYA 3QWZB 2X38A 2YHCA 4RLYA 4NQ0A 3PE4A 1X05A 3UI3A 3KY9A 5CBNA 1LW3A 3QKYA 2GBNA 2PIAA 1OWNA 3ZXSA 3ABKE 2CKHB 2M0AA 3EFUA 2D5GA 3ZTDA 4JX1C 4R7LA 2IFUA 2ETCA 1CJEA 1AQCA 2P0FA 2DZJA 4HLLA 2QSDA 4BFRA 4JK9A 4IC7B 1GB1A 2XS8A 4MACA 3HVDA 1RZ4A 4KBQA 1LD7A 2RKKA 3PVUA 3AG2E 4N6EB 5LLIA 5M4YB 4RMAA 2KTRA 3J9CA 1DIKA 4AXHA 2N9EB 1OEYA 2XK5B 3I57A 1Q67A 2AJAA 2Q13A 2KX3A 4IOIE 2MJDA 5CMYA 4XWTA 4O60A 2CG3A 3AEGB 2DYBA 4O6FA 3IG3A 3UI2A 4EUTA 4BX8A 1Y8RC 2K22A 2ZKMX 4W9JA 3ZFWA 3HXBA 4G23A 2DFKA 1ET9A 1ROEA 2NMQA 2K6QA 2W3RA 1GPXA 5CX3A 1X81A 2O2VB 3QCAA 4K0RA 2P9UG 5C1DA 4QFVA 3RI7C 1WM2A 2X6FA 1Z3XA 4XDDA 1HTQA 1RRBA 3L10B 3ZXVA 2XENA 4MJSA 4EMOA 1WGQA 1N63A 1GAQB 1BXTA 5FR6A 5HE1A 4S17A 2L83A 2BBCA 1UGMA 4GSWA 1FFVA 3FKYA 1DROA 1FCLA 3DSVA 2KZRA 5DHFB 1WE7A 1ZOYB 1X1GA 2GW1A 3ALBA 1QLBB 1V88A 3MYVA 1NA3A 2XCBA 1WI0A 3RYTA 2JZ3B 2KQ7A 3FTVA 3H7PA 2CR5A 1WVHA 3ZDTA 2X0SA 1YN5A 2ZPYA 4WJOA 2ONDA 1Y56A 2I2YA 4GDLB 3CVQA 3VAWA 3OTNA 3LCAA 4F6RD 5J3YA 3R9AB 1D5MC 1STEA 2KMAA 1FT2A 4A3OA 3AU4A 4CYMD 4DX7D 1WGRA 4B0MA 2VGXA 1RRPB 4FN2A 1SIFA 1WJNA 1OCOE 1L7YA 2QKLA 5LX8A 4G50A 3W5VB 1SEBD 2FCSA 4PDXA 1YMPA 4G25A 3VFKA 4A20A 4DWFA 1VZ8A 3JSVB 4J7WA 1U3CA 1T5XD 1O1TA 1UPRA 4JK8A 2XEEA 2VZKB 1PC2A 3AS8A 3PDNA 4LNKA 3NS1A 3PVWA 1SF0A 2MH7A 5IA7A 3AULA 5EIDA 4G2VA 3TWQA 3FU6A 4GZDA 2KTRB 2QKMA 3RCZA 3P4SB 4GB9A 3P63A 3ESKA 5AENA 4NQKE 1WY6A 3ULQA 4N3BA 4GYOA 5H8YE 1OWMA 2OVFA 3RFZB 2MKRA 2FCMA 1OQRA 1E8XA 1CZPA 1QC6A 2LBBA 2KX0A 5CHVC 1V5OA 3MKRA 4DHZB 5CECB 4ANUA 3D8FA 3F6QA 4EJNA 5C16A 3KH0A 4MJSB 3JQ1A 2KD0A 4E71A 2NZ8B 1P9DU 3TUOA 3NZSA 4DXGA 4U07A 4YONA 2AX5A 2SAKA 1E5WA 4G26A 2WDQB 2GLSA 3B2FA 4BSXA 2PKOA 1WGHA 2MYOA 1A70A 4GN1A 2MWSB 4WAFA 5BMGA 4JKHA 1Y6IA 3WXXA 3CVLA 2DZKA 3BG0B 3ZPJA 2V0GA 1WRDB 3PZ8A 3ZUNA 4AQ7A 2WXHA 1YQ4B 1RFKA 5FINA 3KS2A 1WYGA 3H7PB 2DVWA 2KVRA 2AEHA 3I3NA 4XX5A 1L5JA 3VRAB 3LXUX 1EWYC 3FTZA 4C9BB 4DUIA 3E66A 3DBLI 5E6PA 3E34A 1FHXA 2L00B 2GRPB 2WYQA 2VGXB 1X1MA 1XX0A 5T8IA 2K2UA 3FUHA 5KNGA 2HO1A 2YSZA 3TWUA 4KAXB 3ZXPA 3R2TA 3PRZA 4P29A 3LY7A 1QOAA 3B2GA 4CQNA 1E10A 3UM2A 3Q2AC 1WXVA 2K1FA 1H6KA 2Y1LE 3LKUA 4KGSA 2NR2A 1TTNA 3HVEA 1ZGUB 1SW6A 3M62B 3HSAA 1NENB 3SNXA 3NZ3A 4OAUC 1HG5A 5BUZA 1EM7A 2QCZA 1FIQA 3Q3NC 1ZXIA 2CY5A 2GUMA 3IHPC 2J9QA 2RDGA 2MFQA 4A63B 4GMRA 5IY5E 2BF8B 4I2WA 2C7MB 4J8FA 1UWXA 4FJZA 4CO7A 2L8JA 1E0ZA 3SO8A 4NJ6A 1OMWA 4JD2G 3DHHC 1FM0D 3ODXA 4FLHA 4KDIC 3IT6B 1O1SA 2DHJA 2W9NA 1V6EA 3DPYA 3AXCA 2IEJA 2GMIC 3SFEB 1QYMA 4RVBA 2KAJA 3RO3A 2LJ5A 4G24A 3APFA 3PNTB 4KVMA 3B77A 2I5CA 3VUWA 4HSIA 1AWDA 1QQGA 2M38A 1Y8MA 2JY6A 1TN8A 2IOSA 2HDEA 4JLCA 2GRNB 3CSTA 3CGHA 3RRMB 2J53A 3B13A 3CHSA 1K5GB 1N0QA 4HCPB 2L6JA 2L52A 3E33A 2PLPA 1I42A 5EX3A 4J3OD 2MJ3A 3A9KA 2VRWB 1HX8A 1TNUA 5H7PA 2XEHA 3T8KA 2GCJA 2ZGGA 4KIKA 2HD5B 4I6GA 2IONA 3H6NA 2X6JA 3FY4A 3A1QA 4O1OA 3AN1A 5EDSA 1PFDA 4YDWA 2AQ1B 4PT5A 5CBOA 5EE1A 2IGDA 3JYUA 2P58C 2AW6A 4XI9A 2JQRB 1PY1A 3TO1A 5AZFA 5J3TA 2OJWA 3RNAC 3A9JA 3QWWA 4YVQC 3FEHA 4WVFB 3AEAB 1L0YB 5HI1A 1RYJA 4N5QA 5J3QA 1SJED 3LXFA 4AJYB 4Z2MB 4AP4C 1HE8A 2K8EA 2CG2A 3IBEA 1VLBA 3HVEB 1NVLA 3Q78A 3LPZA 1Z2MA 2BWES 4K7UA 3M3JA 4APFA 5FQ8A 4MH0E 2OQBA 4GA1A 1ESFA 2K0PA 2EKIA 3GE8C 3K9PB 4GYYA 3HIEA 1PGAA 3FH7A 2KQ4X 5KJMA 4M0WA 4K2PA 2BTEA 4HOTA 4TQ1A 3O65B 1U27A 3P1MA 4K17A 5D3YA 4K7WA 1P7FA 1T6BX 2UWQA 1MYOA 1OCRE 4U7EB 2AYOB 2BW2A 2QMTA 1HB8A 1EDUA 2V5QC 1IKND 3CK7A 4MBGA 3V30A 2BCJA 2ROZB 5AQ7A 3GZSA 1K50A 4IKGA 5EE3A 3QX1A 4AM9A 2K49A 4OZBA 2JWZA 2UU7A 2WMOA 2LMCA 3I9V1 2KJRA 5M72A 1UPQA 2BKRB 2NC9A 3E32A 2WX1A 1ZBPA 3BIID 3R66C 5CHWA 1N6ZA 5MPOA 1BPOA 1TJCA 3CV0A 2YRYA 3AE2B 1FNVA 2AQ2B 1WJ6A 2LUEA 2V3PA 2DYNA 3NF1A 1MPHA 1WSPA 1HG2A 4GPMA 2FBNA 4HB3B 3KQ4A 1XXGA 4GLSC 1SE2A 2MRIA 3V3XA 2EILE 2DZNA 1E8YA 3LJNA 4A1SA 2D9YA 1MHHE 3FVCA 4D2KA 5D66A 5C3JB 2FCNA 3ML4A 4LNGA 1JRPA 4KIKB 2CHZA 3CQGB 1C76A 4WIPA 5JHHA 2CU3A 3A1QB 3UM1A 2FJ9A 5AUIA 1U2VG 2MOWA 4I43A 2IY0C 2BUGA 3U64A 3Q49B 4L1RA 1T0YA 1ZU2A 3FHEA 4I6JA 4G11A 4U0SA 1ZPSA 3VTYA 1KZ7A 2EIME 3A9JB 1GUAB 3V62A 4E3CA 4B0EA 1Z5SC 2MP2B 3ASOE 1ZC4B 3I4RB 3K9IA 4GU5A 2Y8GA 2V3NA 3UT4A 4JKCA 4LG6A 5ENTD 4IG7B 2DHKA 1C9FA 2JLBA 2KCKA 3IT4B 4MGYE 2LVPA 5EFXA 2JF5A 4KZ0A 4MT5A 4ATGA 4W9GA 2O6VA 4CGVA 4U8HA 1J0WA 1QBQA 3SHQA 3KSLA 4I9CA 5JXVA 3SD5A 4M0WB 4NNJB 1L0XB 1H2TC 1AN8A 4DI4A 3HXCA 4REZA 4ZRQA 1T77A 4HKQA 2WWZA 5FI0A 3RRNB 1AARA 4HOSA 5D3DA 3KRXA 4US9A 3JVZX 3FH5A 2M56B 2WDTB 1Z87A 4USAA 4AIFA 3VHTC 2VTBA 4GA2A 3CHRA 5JH5C 1R4NI 3ZRCA 1VDVA 4J8SA 1XCGA 4PK1A 2DBYA 3HUIA 4Z68A 2INNE 1NZNA 1TY2A 3PZ7A 1ACCA 1IPGA 4OVVA 4Y6CA 1K1BA 2Z14A 1JW9D 1V9JA 2DAJA 2OHFA 1PFJA 2KMMA 4HPPA 4H7XA 2N1VA 3VTWA 4HAWB 2COCA 2NBVA 3C3OA 2LVOA 2REXA 2BYVE 1YNTE 1MX4A 3NQPA 3IXEA 2J42A 5L83A 3GYOA 2ZIRA 2EKEC 1JWGA 1DCEA 4X57B 1U4AA 3PH0C 5J2RA 4GTPA 5D94A 5G2NA 1E8WA 3RZWC 3G2SA 4KGRA 4RG9A 3DXKG 4TMAB 4YSZB 2L1AA 3E30A 3S2AA 1EUVB 1QT9A 5LNK1 2D3BA 4J6IA 2KN5A 4IRUA 3LB8C 1B1ZA 1IQRA 4ZFHA 1KH0A 1MG8A 4U0UA 3Q9UC 1P7EA 4IWQA 5GMVA 4J8YA 4LNUD 3AS5A 4RM9A 2PPHA 3RNGC 4GMVA 2K25A 2YHEA 2KDBA 3X0WA 1XD4A 3ZVRA 4DBBA 4KX6B 2MDXA 4TYZA 4WNDA 3ZYQA 4J8EA 4HB4B 3UX4A 4P6VF 3ZGQA 3DVGY 4B9KA 3EIJA 3UGBB 2MBQA 1QF6A 4A6QA 2VZKD 2LSUA 2AWIA 5D3IB 2IY1B 4JWUC 4US8A 1PGBA 2C7NB 1H8CA 1MX2A 3L4PA 1WXAA 1O1RA 1SBBB 2X6KA 4JC8A 1VBHA 2JX5A 3UQBA 2YEPB 4JWSC 3ONSA 2JVCA 1OQYA 2VTBB 3PEGA 5AZHA 3RNCC 4ZRIA 3R3MA 1ACAA 3C72A 3SQVA 3TJPA 3QHTA 4LNBA 2JABA 4OYSA 3GZNB 1V89A 1JWUD 1H6PA 4RH6A 2V8SE 3RNFC 2KHWB 1ZXHA 1EU4A 3OJ3A 2FIDA 5D0OD 2NBVB 2FI7A 3DSWA 4GA0A 1U5DA 3C0RB 1JALA 1WX9A 3W9CB 2RFAA 2ZJDA 1F52A 3A4RA 3U52E 4LRZA 4XGAB 3VH3B 1N94A 3GZNI 4AUQC 3PNLB 4BEPA 1TYQG 3GS2A 4GOCA 3D9KA 3W5UB 4NAMA 3FP3A 3KZ1A 3RKVA 4DJAA 2XRYA 2KACA 3BK1A 2IZVB 4JKFA 3UT8A 3NWAA 3DVGX 1ZDVA 1SA4A 5AJDA 5FI1A 2V9HA 2BT6A 3NOCD 2KLGA 3PO0A 4I1OB 3A4SC 3PE3A 3CR3A 2KK8A 4HCNB 4MGZE 4JZYA 4OVUA 4AJWA 2UZSA 1FMAD 2RPVA 3OXFA 3AE5B 5LFAA 4LDTB 1NL4A 3SNHA 2R0DA 3ZNZB 4ASWC 2KMCA 1ZC3B 3AE6B 2I5FA 3IHVA 3QWPA 3U12A 3NG0A 1WR6E 2ZCCA 3ZJUA 5EILA 5AAOA 3S7DA 2OOBB 2KXPC 3TEXA 3CXBB 2GBMA 1WY8A 2F8YA 1FCCC 3ZRHA 4NZLB 3FUNA 5CHFA 2N0SB 2CODA 1L4ZB 1P1AA 3CIAA 1JWMD 1TYGB 4F1SA 3NVWA 4CRWA 4RGMA 3V5WA 4GU2A 3HW2B 2WXNA 2IDYA 4WNFA 2JXXA 2MRPA 1UWMA 3ZKJC 5D3XA 2Z0DB 5T3RA 4E85A 3E9PA 2Y5CA 1U2BA 3WG7E 2B3AA 4MGIE 4X8QA 3PTFC 2XS1A 4JVSA 4DHJB 3FTSA 2Q7FA 3NSUA 1N9AA 3PLVA 4GCOA 3ZU7B 4ILHB 5E6NA 1OQQA 3ASNE 3ZVVA 2COFA 3NAWA 3Q7AA 3V05A 1ENFA 3ASGA 4H7YA 2V4HC 2P8VA 3CWIA 3PT2B 4EZJA 2D3GA 2M4NA 3PRPB 3WAOA 1XLQA 1RW2A 5IRSA 2RDHA 1YX5B 3TAXA 2JZZA 3DWLG 2KDFB 2CAYA 3DOWA 4RGNA 1XF5L 1H10A 1FB8A 1YCSB 3RNEC 4II3B 1IHGA 2ZISA 4U8VD 2WP9B 3BU8A 1D9SA 4B8AA 3EU9A 3FSSA 3AEFB 3D8DA 2JZPA 5BV1A 1K5DB 3EC8A 3NWFA 4GGQA 4HKZE 2H89B 2RRFA 2LEKA 3UT7A 4BETA 1KFYB 3MV2B 2HYZA 4BBKA 2I38A 4M02A 2LASA 3LYYA 3GB1A 4N59A 3RMKC 1E6EB 4WUYA 1DNPA 3U4EG 1VBGA 4A55A 4L6EA 2DHZA 4FHJA 4JA9A 3FAHA 1S70B 3UZTA 4HAVB 2QC8A 2ZW0A 2HJ8A 3VUXA 1EF1C 5G05C 2KO3A 3L17A 1K52A 1XR0B 1AP7A 1WX8A 4A90A 2D9XA 5ARGA 3TXMA 4RM8A 4W9IA 4BWRA 5G5GA 3QOUA 4JEUA 1IGDA 2G9HD 4YWGG 2B6CA 3APDA 1OFFA 2R2LA 3URZA 4UDUC 2I6HA 4HNAD 4D6WA 2IPKD 2YVCA 2XGOA 4TKNA 4DX5D 1YQBA 3D9JA 5KBAA 2XEWA 3SF4A 3MV3B 2R2QA 2IGGA 1X5BA 3U66A 2XGMA 5ENNA 5BMIA 3QAQA 2NYJA 4QQIA 4HAXB 4B89A 2IOLA 1DOYA 2HE7A 3GP7A 5IJMA 4IOYX 1MJDA 2J08A 2IY0B 2V1YA 3QDNA 2ZNVC 4MEMA 5G05J 5D2MC 1XO3A 3ONLA 2P9NG 1U5EA 2YNQA 3UINC 4J0UA 3EIQC 1Z5SB 3FTXA 4JKBA 3H8HA 3ABVB 2KZTA 2JYTA 1WXSA 4L7TA 1Q1OA 5H92C 1HB6A 2ABDA 3PLUA 2Z4DA 5I4DA 1I4PA 3TEZA 2LULA 3A98B 4UUCA 3N7CA 3NS8A 3S7BA 4XE0A 5EN5D 3V2OA 4XYCA 4AY6A 1BI7B 2P2CP 2Z0OA 2X6IA 1IYGA 3N1YC 1YN3A 2KBXA 4D0NB 3HRDD 3UF8A 3QQ8B 1UZXB 3AE4B 3ZN3A 1W1DA 1F1HA 3PZ1A 2G4DB 1WGDA 1HF8A 5AJLA 2R59A 2RG8A 3JCKC 3IAS1 1MQSA 2DLBA 1BMLC 4TRQA 3QC8B 3EGRA 3ASFA 3TEYA 2L6BA 4EZLA 4HBDA 2CS4A 2ZZPB 4QAYA 1D8EA 4JKEA 5AZGA 3ZQ4A 2YQ8A 2P9IG 3CK8A 1SA5A 3ABME 2D9WA 1OTRB 4GYWA 4BTBA 3ZYMA 5JP4A 1KT0A 4KVOA 3PSEB 4EPZA 3VTXA 2KANA 4KHAA 3NJTA 1HQRD 5JZEB 2GRIA 3IKOB 1SZ9A 3T9KA 2K2JA 1SB3C 4JL0A 1E8ZA 1WI1A 1LXDA 3KSYA 3BVGA 4IULA 4LTUA 3V31A 2HM8A 4ACLA 4AY5A 4H2AA 2AL6A 2AL3A 2UY1A 4A1GA 1SE9A 2JXTA 2WNMA 1N54A 3N1XC 4C7YA 3RCPA 3DRAA 3E4BA 3HXEA 3Q79A 3RU0A 1V1PA 1JCSA 5E6OA 2L2IA 2NCNA 4UWFA 4GTVA 3B08A 2DIKA 4JGHB 4OZAA 2J0MA 1MPEA 1IYFA 3E9SA 1NI3A 2BS2B 5BMHA 2D9VA 2LHDA 2KZTB 1PLSA 4FBJB 1TS3A 2DYMA 3ZLZA 4FULA 4CDNA 3C5RA 2MA9B 4S0RA 4ILIA 1UELA 5ENRD 4LEUA
chains in the Genus database with same CATH topology
3C98A 3A8QA 5CLLB 4A6KA 5LP0A 1V5PA 2IYBA 4HFGA 3SI5A 3KAEA 4EQFA 2DX1A 4IAPA 1Z3YA 1U3DA 5BV0A 3M95A 2YLMA 3PGEA 3ONKA 1I7AA 1WH3A 1QQEA 2WX0A 3TXNA 2D07B 4WWOA 3TBLD 5HE0A 2LKOA 4HOUA 5LXIB 1UJKA 3CVXA 2HTHA 3B7SA 2R09A 4HPLB 4HORA 2PQNA 3M1IB 1RFAA 2DCPA 2JPHA 4XC2A 1Z6TA 1OWPA 1QZ2A 1INZA 3EECA 4HAUB 4KHOA 5BW8C 3MTNB 5D3WA 3ML8A 2FNJB 2K6DB 2IBIB 2L76A 3TCAA 4KYOB 3QB2A 2KOXA 3PP2A 5JVLA 2UY1B 2UWJG 2OV8A 5DH9B 3MGBA 4ILGA 1FCHA 1B55A 2N9XA 4CCAA 4MS6A 4HHVA 4JHRA 3SYXA 3P2BA 2R2OA 2W2XD 4GZUA 4DX90 4CT0A 1GNUA 4II2B 5AYWD 4JEHA 3PRMB 1EVHA 2I9CA 1FHOA 4RSYA 4AWJA 2P0HA 4B6HA 4HOQA 2N7EA 5HQ8A 2WXOA 4GMJA 1V5TA 2WH5A 4PNKA 4CGWA 2N9PC 2OOEA 1I35A 4TV3A 1D3ZA 1EF5A 2GBKA 1GJZA 5KHQA 3CIKA 2NBUA 3PG7A 3AS4A 4EECA 3I3TB 2C0LA 3WALA 2RSGA 4RG6A 5C6RA 1MKEA 5HKHA 4B8CB 3CKBA 2DHIA 4KHBB 2WXMA 1J8CA 1WMHA 4B94A 1XD3B 2K00A 3A8PA 1XNFA 2M1MA 4XZ4A 1TXDA 2CU1A 1IQUA 4GZ3A 3PUJA 3VLDA 3F5RA 5BNWA 4GPTB 3FULA 4NACA 2L1CA 2YT0A 4ILGB 2K8BA 1P6SA 2A5UA 4BT9A 1XKEA 3ODOA 3N32A 1X1FA 2V3SA 3HM3A 1L2NA 1HO8A 3KEZA 5AIJA 1FXTB 2ELAA 2Y4TA 4A3VA 5FQ4A 1E7UA 3SZ7A 4N3CA 1P0RA 3JQ0A 4LUNU 2XRZA 1OQNA 2ELBA 4Q69A 3CVNA 2ADZA 3ZNID 3QNKA 3GYPA 2PM7A 4NRHB 1P3QU 3P6AA 3FUFA 1WM5A 1FOEA 3LYAA 3HYMB 4F7HA 5D7GA 3QJZA 2IO0B 1DDWA 4YNDA 2OJRA 2KFKA 4BKSD 2V5FA 4AV7A 1W1GA 1RJ2A 3ZDMC 4MM3A 3PSCA 3D9OA 5DPTA 3DXEA 4IWOA 3A9KB 1H19A 1VD2A 1UD7A 5LCWC 1KZGA 1JWFA 1H2UA 1WMHB 5D2MB 3D9IA 3HQCA 3UINB 2J59M 2RGNB 4LERA 2D9ZA 1W1HA 5DCNA 3ZW3A 2C60A 3CMMB 3Q47B 2OTXA 3FTUA 2N4FA 4GXBA 4XIFA 5EX0A 1BAKA 4F8CB 1EAZA 2YT1A 1WGUA 5LCWJ 3RIBA 3D32A 3U30A 4MT7A 4BBNF 4PUCA 2C9WB 4DHZE 1SGHA 5DPSA 2ILRA 4IFSA 5FZSA 2DAFA 5E76A 4NJ7A 5J17A 4GIVA 1VCBA 1LFDA 3L13A 5A7DB 3DDCB 4IN3B 5IAAC 1ELKA 4JPSA 1UNRA 2XEVA 3V60A 4WSFA 5CHEE 3CHQA 2PEAA 1YD8U 4JIOU 2V4LA 4N39A 3OLMD 2MX2A 4MSMB 2A4ZA 3TG5A 2LNIA 5D27A 4IWPA 3ZTCA 2K8HA 3ZNHB 2J09A 4BTAA 4AVXA 4W9EA 1GC6A 3VIAA 2D10A 2COAA 2J4DA 3QWVA 4DI3A 3KUDB 3A33B 3SHFA 2MBHA 2L9BA 2LOZA 2DKQA 5LONB 3RULA 4HS2A 3CHOA 1Y19B 3LS8A 3O4ZA 2EJ8A 2NBWB 4LJPB 2DX5A 4ZRKA 1MHQA 2ROVA 1PQSA 4M3OA 3BINA 4BY6A 4N9F4 3G2VA 3IFWB 4I2ZA 3T8MA 2XCCA 2YINA 4GDKA 4HPMB 2D4QA 4PS3A 3LY9A 2E2XA 4BOZB 2IJGX 3ULBA 1EO6A 3L22A 1EPUA 5KQ4A 2AXUA 1YA0A 4IUMB 3WIMA 1NTYA 4WAAA 2AXVA 2QHOA 5LOPB 2Z59B 2O6VB 2M0XA 2RQ1A 2BPSA 2IO1B 5J90A 3WYFB 2NXPA 3FU0A 3RRUA 1UG3A 4APOA 4H8SA 4ZYNA 4LCTA 3PV1A 4KV2A 4HDOA 5JJ7A 5JJTA 5T4YA 5CCMA 4CHMA 2D2QA 2KCLA 3LJ3A 4XI0A 3EDTB 1TGZB 5ARFA 3RK6A 3O48A 4G1TA 1EGXA 1M7EA 3DBHI 2LXAA 1Y5OA 2KCVA 1LB1A 2Y3AA 3MJWA 1ZVRA 4NAWA 2DKPA 5DIZA 1HU3A 2P0DA 2LRWA 2E0IA 1VDYA 2GCLA 3FDHA 3AU5A 3KUCB 2QY7A 2DLWA 3P7ZA 2NMBA 4ICUA 4ILJA 4WNEA 4V3IA 4HAZB 1DVPA 2DX5B 4W9DA 3I4GA 2BGFA 4ANXA 2G35A 3QA8A 4UI9K 4CYEA 4MSQB 1I2HA 3DBRI 4GDKB 3KVFB 2I1JA 4UI9C 4A6FA 4C0AA 2G45B 4Y6WA 4MLPA 3U9WA 2UVMA 3VTUA 2LZ6A 3ZIMA 2PM6A 3D9MA 4NQLB 5D3VA 1ZKHA 3G2TA 4EEWA 5DPWA 1G6JA 3SGHA 1M94A 4MDKE 2K8CA 1XGWA 1U5GA 1UNPA 3GZ2A 3TFMA 2CY4A 3FUDA 2WPVA 3ASDA 2Y7BA 2EMSA 4UI9J 5ANRA 1QZEA 3GYZA 2M14A 2XPYA 4BT8A 4FJVB 4ME2A 2MW5A 3V61A 2PL2A 1HXIA 2RLOA 3VOQA 1E96B 2LG1A 4GAAA 3H7SA 1AWEA 2DENB 4NAWB 2Y4UA 2DIWA 2BTDA 3PPAA 4NSWA 2WB2A 2XBBC 2KDEB 4URKA 4W9RA 1W3BA 2VSOE 4JKDA 4IM0A 3LVQE 3B7UX 3FFLA 2MBOA 4GCNA 3UQ3A 1GG3A 3FUMA 2JP2A 5BPPA 2XK5A 4DX8A 3ASHA 4EKUA 3VH4B 4A6FB 4GMXB 1X86A 4Z2NA 1WF9A 3SU8X 1R4MI 4HB2B 3PS6A 1N52A 2IU1A 2BYEA 3LDZE 4F7GA 3L16A 3R7RA 5EKQD 3P1UA 3L0WB 3DPDA 3LY8A 3OXGA 4XKCA 1V61A 1TZ1A 2BKFA 2L0TA 4DLOA 4I6LB 2ZPNA 2K39A 3EPYA 3V6EB 1NP7A 4EOYA 1DDMA 4FC8A 2DTCA 2RUKB 3O96A 3DXDA 2YS3A 1A5RA 1H4RA 4I1AA 1UH6A 1WYWB 5KJNA 2LGXA 3JW0X 4IM2A 3KW5B 3SO6A 3SUZA 1OUVA 4UQXA 3FU3A 4JW1A 2VGYA 1U29A 3QC1A 5CTRC 2JEKA 3ZYLA 4JQWC 3PZDA 5KCVA 1WE6A 4W9KA 3PUKA 4YL8A 3H9DA 5DIFB 5BO4B 4F53A 1QNFA 2L0IA 2NPTA 3B7TA 4A3TA 2RPQA 1B89A 1SZAA 3FUJA 2DYQA 1Q5WB 3KYCD 2FDQA 4KSLC 4GMLA 3JSVA 2X3MA 3TIXA 5ANLA 2L3ZA 4BBNC 2MHKA 4JXTA 4UWGA 1NDDA 1OWLA 3NHEB 2XGSA 3FTWA 4N2QA 5D6JB 2ASQA 4B0ZA 3ML9A 2WQHA 2LD9A 1FAOA 3WAMA 3V6CB 3SBSA 2KKCA 5GOWB 1NTVA 1P98A 2JRIB 3EHVA 1IRSA 1FGYA 1S0PA 2EC1A 4PYUA 1OWOA 4CHKA 2VJ8A 2COPA 3RT3B 2ZU6B 4JL9A 4I6PA 5AEKB 1H2VC 3PVLA 2DA0A 2Z0QA 4PS8A 1TBEA 2L0TB 2QFCA 4W9LA 2LI5A 4JA7A 2WXIA 1KOTA 3MX3A 3FM8C 3F0WA 3M63B 5A23A 5BT1A 1MIXA 3MKQA 3ENBA 2BYFA 3DCGA 3IEGA 2FAZA 2VSNA 3EHMA 2N1WA 3CVUA 3D9NA 2G4SA 2WXLA 3T06A 2LRUA 4XKBA 2CHWA 2KWVB 2FO7A 3OANA 5KQ1A 2XHEA 4WWPA 3ODWA 4KMOA 3PREA 4TUUA 3TW1A 2JT4B 2DZIA 1UW4B 2YS1A 4I1MA 2VSYA 2V0PA 2FJLA 2NPTB 4WJQA 3LVRE 3MDBC 5FZQA 5L95C 3VQIA 1F9JA 4LCDE 2RD0A 4GZ5A 4K81A 4JKGA 2LGDA 4IW0A 2JUOA 4HB0B 2C0MA 3BY4B 4L2YA 2XPZA 4A6HA 1XQQA 2GBRA 1UN8A 1CMXB 1K8RB 3HIZA 3FP5A 3L6AA 1WJMA 1U5FA 3VTVA 2KC2A 4F7ZA 2NVUI 2IYDB 5C79A 1MK7B 4NPNA 4I6EA 1WJ1A 2M8SA 1LM8B 2NS5A 3VLEA 1UEFA 2KATA 2H7EA 3CHMA 3HHMA 4FU3A 3DVNU 1IP9A 4CHJA 4L1BA 4C0EA 2AWTA 2D11A 2ZCBA 5C23A 1LQBA 1XODA 3MKQB 2IO2B 2O6VD 4BOSC 4UWKA 1ZM0A 2DBAA 2I2OA 5DI9B 2E2EA 4DPRA 4ZDVA 5JHAA 2LO6A 2RSUA 3JYSA 4XWXA 3AI5A 4BKGA 3CHPA 3OJ4B 3CQCB 4KSKC 3RUIB 5D0QD 3U8ZA 2R82A 5FQ7A 3VDZA 1HZ4A 2W2XC 2AXZA 2PJHA 2WM9A 3EHNA 3UPVA 1WJ4A 1HS6A 4DBGA 1UJJA 3B1LX 4CDMA 3FU5A 5KJKA 4HXDA 5KJLA 4M8NA 5JLJB 1ZW7A 1UBIA 3W1SC 4BVUC 2Y5BB 2LAIA 4EZKA 4TQ0A 3WANA 3SDLC 4U04A 4N5CA 3N3KB 5E75A 3Q3FA 4JKGB 3CVWA 1BTNA 4MY6A 2XPIA 4BX9A 2FIFA 3DXCA 4K7SA 4AEZC 1BTKA 4G3XB 2X6HA 1H0AA 1JUQA 1EF1A 2L05A 5C1ZA 1M7RA 3D3MA 3N71A 3G9WA 3ULCA 3DVNV 3BJIA 3QBVB 3ECIA 3FUIA 1GW6A 4HXIA 3PHWB 4F7AA 1YIWA 3Q5MA 2H7DA 2JRHA 3Q3JA 1DBHA 3QIJA 3B0AA 2M63A 2HTHB 3CKCA 1WM3A 3TG4A 1OY2A 4LDTD 3ZNGC 4HAYB 2GRMA 4HATB 2VSZA 1N3HA 3B7RL 2LGYA 2FULA 2WVIA 2C5LC 2LYDA 3APCA 2MBBB 4DDID 3MHSD 4Y94A 3FH8A 2J7QB 1E90A 3PEUB 2FCQA 4U63A 2AVPA 4BKTA 4HJKA 4GZCA 3D9PA 1EYHA 3DBSA 4G0NB 3TGOA 2CFZA 2XQNM 1ELRA 3CVVA 3FEXA 5JHBA 3ZYKA 1WG7A 2V76A 3VVWB 3X23A 1WXMA 4DHJD 5CCLA 2WXRA 4AP2A 2N7DA 2I1KA 1WAO1 3IVFA 2MP2A 4HDQA 3E9LA 1KLVA 1KI1B 4DDGD 2EQXA 4CDRA 2GRLA 1BT0A 3KRWA 3QARA 3RZFA 3ZO5B 1J0GA 4K2OA 1WZ3A 3G2UA 4ACKA 1GGOA 2LXCA 2VYIA 3L54A 4JKAA 2UYZB 3Q15A 5C5BA 4KDLB 2PQRA 3NY5A 4MKTA 4HVBA 4AOFA 3UMVA 2RNRB 3RO2A 2LWPA 3LDZA 2ZEQA 4ICVA 2KQSA 2L0FA 5J08A 4HLEA 3U4TA 1WR1A 3SBGA 2R5SA 2R17C 3MZLB 3RJVA 2KJHB 2J4BA 2ZNVB 2FEZA 2LVQA 1OGWA 4PS7A 5HI7A 3FUKA 5KHOA 2CHXA 2GBJA 3NZUA 1WJUA 2MQJA 2WXKA 3MEKA 3GOEA 1WGGA 4CT4A 4EBAA 2N0YA 2C2LA 3FEYA 3PHXB 1A17A 2IFSA 3U7DA 2KDIA 4MRUA 3IHYA 2Y8FA 2WXGA 4KZCA 4CEMA 3KD7A 2OVBA 3T9LA 4K1RB 2XQ0A 4F7UP 2VRRB 3ZEFA 2KUPA 5CLQB 4WJNA 1NBFC 2WQ7A 1KLXA 2CQUA 1TEZA 2KLCA 4JHKA 2X18A 4J8DA 3MPXA 4FA6A 1DYNA 1DDVA 1FVFA 4ZRJA 2WXJA 3SBTA 1PMSA 1YX6B 1WZ0A 3CVPA 1KJTA 3S7FA 2KWUB 3UUXA 3NOBA 1KBLA 1FVHA 1JRUA 4FJYA 5C5BB 2KFJA 4WJPA 3U3WA 3FWVA 2KFKB 5KCMA 4DK5A 2LOXA 1V81A 3TL5A 3CVYA 1V5MA 1HBKA 5G04C 1NA0A 2RR9A 3N30A 1RLFA 4EBAG 2DZMA 5JHGA 3QK0A 2CB8A 2IO3B 4FP7A 4KT6B 4UWHA 4HWIB 4W9HA 4A3PA 4P7IA 4FLBA 4DLQA 3RD2A 2VSXE 1KM7A 4WJ7A 3FUEA 3W1SA 4W9FA 3HM6X 2RGFA 4IYPA 2C7HA 4PQ0A 2FF4A 5G04J 2GJYA 4ABNA 3CEQA 2ZVOA 4NY0A 3H1UA 4PYZA 4W9CA 4PH4B 3KUZA 4DXAB 5DPRA 1C1YB 3CSFA 4I9EA 3E9OA 1NTIA 2LAHA 4I6NB 4JHJA 2WQ6A 3UIPB 3MCXA 1UN9A 1E7VA 3Q4AB 1V86A 1WX7A 1KC7A 5C2YA 1MAIA 2MLBA 2BF0X 3SBTB 2KM4A 4IM3A 2L7RA 4B95A 2PZ1A 1C3TA 3HDXA 2N23A 2CRFA 3ZHEA 3WA0A 4EFOA 2NSZA 2J0JA 1JDEA 3R7QA 4UQYA 4FADA 1P5TA 1Q0WB 2MCNB 1OEYJ 4B6WA 4HK2A 4ANVA 5TR5A 2DYOA 1V80A 3AJ4A 1NU2A 1HFAA 1TJ6A 2BWFA 3VXWA 2W2WA 4FHKA 1LF8A 4NURA 4ILHA 3VLFA 2HR2A 1HH8A 3FTYA 3CF6E 5LXHA 3D9LA 3EJNA 3CK9A 4JK7A 3LEWA 5CMWA 2EMTA 4KVGB 2GOWA 2MWNB 2FUHB 4GPKA 2ZVNA 4ANWA 2YS5A 1GC7A 1MIZB 5DHAB 3OAWA 4MGKE 1KT1A 1V2YA 1V5UA 3VUYA 2KC7A 1X11A 3GZ1A 1MK9B 4BKSA 2J49A 1S1QB 2UZRA 4UQZA 5A6CA 1V49A 1ZSQA 4C0MA 2LSVA 2GS0A 4E6HA 3IV0A 2KNBA 3HK0A 5FTPA 3SV1A 1WFYA 2PE9A 1PAQA 4F3VA 2PE6B 3ESLA 1XT9B 4M8MA 3BEEA 4KXKB 5FWQA 3ZHEB 2VKIA 4WNGA 5HE2A 3JUIA 1S3SG 3T5XA 3PEVB 5FZRA 4LJOB 3UIOB 5FQ6A 2KJ6A 1JPLA 4I17A 3TVVA 3OXLA 2J07A 4UWLA 2YF0A 4GZ6A 1SQMA 3WAPA 2WXFA 3ENEA 4K03A 2KXJA 1UBQA 3GW4A 3SFZA 3KYDD 1YJ1A 1UNQA 2GGFA 1J19A 2VQ2A 3QWMA 2KWCA 4WQOB 3L08A 4D10C 4MK0A 4Q94A 1SHCA 3DQVA 1P5QA 3MA5A 1TQZA 3I5PA 2IF4A 4MELA 4YVOA 2IQCA 1FGZA 1TJFA 5G55A 2KC1A 1WIAA 3W1YA 3K9OB 3LJUX 1BWNA 5FT9A 4U0ZA 1ST7A 1FHWA 2O2VA 2WMNA 3ZRFA 2HRJA 2DN6A 3TMPB 5JJ6A 2WXPA 1NI2A 3S7JA 4N3AA 2KCJA 2RVBB 4E74A 1WGYA 3CLJA 4N2SA 2M17A 2PZIA 2G3QB 2Z0EB 5DBKA 2MBEA 4A5KA 2CFUA 3BG1B 5L81A 2WXQA 5HE3A 3FLVA 5LOZA 2KTFA 1ELWA 4L23A 3T5VA 3G2WA 4GDLA 1RAXA 4Q96A 1P3RA 4L2LA 2Z0PA 2KGXB 2J0KA 5J18A 3D8EA 1ISNA 2MSED 5FJYA 3QWZB 2X38A 2YHCA 1X05A 4NQ0A 3PE4A 3KY9A 1LW3A 3QKYA 2GBNA 1OWNA 3ZXSA 2CKHB 3EFUA 3ZTDA 4R7LA 2IFUA 1AQCA 2P0FA 2DZJA 4IC7B 4BFRA 4JK9A 4KBQA 3PVUA 5LLIA 4RMAA 2KTRA 1DIKA 4AXHA 2N9EB 1OEYA 2XK5B 1Q67A 2Q13A 2KX3A 5CMYA 2CG3A 2DYBA 4O6FA 3IG3A 4EUTA 4BX8A 1Y8RC 4W9JA 3ZFWA 4G23A 2DFKA 2K6QA 5CX3A 2O2VB 3QCAA 4K0RA 5C1DA 4QFVA 1WM2A 2X6FA 1Z3XA 1RRBA 3L10B 4MJSA 4EMOA 1WGQA 5FR6A 5HE1A 1UGMA 4GSWA 1DROA 2KZRA 5DHFB 1WE7A 1X1GA 2GW1A 3ALBA 1V88A 3MYVA 1NA3A 2XCBA 1WI0A 3RYTA 2JZ3B 2KQ7A 3FTVA 3H7PA 2CR5A 1WVHA 3ZDTA 2X0SA 2ZPYA <