3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
molecule keywords Myosin-X
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
2LGXA 4HPLB 4MT7A 2YRYA 1LXDA 2CHXA 4ZRKA 2GOWA 2W2XD 1WGRA 1HB8A 3A9KB 3DVGY 3UIOB 2M38A 3FEHA 2BF8B 2KD0A 2KJHB 2L0TA 2XBBC 3B08A 3HM3A 4FHJA 3WIMA 4EZJA 3M63B 2LKOA 2ZNVC 1V49A 2DX5A 3PVWA 3KRWA 2WDTB 3ENEA 3DBRI 3RULA 4NJ7A 4DDGD 3D8EA 3FSSA 4H8SA 1XT9B 2RNRB 3HHMA 2MSED 4HJKA 4BKSA 1J0GA 4HDQA 5DHAB 1CMXB 3UF8A 2K2JA 3ZVVA 4W9HA 4HB2B 1NU2A 1FGYA 2YS3A 2JT4B 2J0MA 2PJHA 3IFWB 3NS8A 5JP4A 2Q13A 4F7UP 2K6QA 2MLBA 5D94A 3VVWB 4IUMB 4F7ZA 3OJ4B 4KDIC 1TZ1A 2J59M 4K2OA 2RD0A 3CSFA 4A6KA 3T9LA 2C7NB 4GSWA 1K8RB 5EDSA 5JHBA 1V88A 3QIJA 3PS6A 2NR2A 4BOZB 2D9WA 4IM0A 2DHZA 2Z0OA 4BVUC 5DPSA 1VCBA 1U27A 4MSQB 3I3TB 3V61A 4EMOA 4HAZB 3K9PB 2L76A 4BBNF 1XX0A 4HB4B 4NAWB 2B3AA 2C7HA 2NPTB 1W1GA 4NY0A 1RRPB 2KUPA 3DBHI 3O65B 1TGZB 4G0NB 5D3VA 1MPHA 1DDMA 1AARA 4HXDA 2V1YA 3ZTCA 3ZDTA 3KYCD 4DBGA 3RZWC 2N1VA 3L13A 4XX5A 3VUYA 3RCPA 1WVHA 1MG8A 1WMHA 4B95A 5L95C 3A9JB 1WX9A 2KLGA 3VXWA 4HAWB 4F7HA 1XQQA 2YLMA 2KMAA 2O2VA 1RAXA 3NZUA 2LOZA 4N9F4 4HAXB 1SGHA 1UZXB 2HTHB 1XD4A 1K5GB 1P3RA 1UNRA 1KZ7A 3V5WA 4AWJA 2FUHB 3TBLD 1Q0WB 4EUTA 1T0YA 4W9GA 2IBIB 1PMSA 2CRFA 4C0AA 2Z0DB 3ML8A 1MIXA 1QZEA 4TV3A 2MRPA 4NAWA 5D6JB 3ZIMA 2LYDA 4HATB 4K2PA 3N7CA 3M62B 5KCVA 1GG3A 2MFQA 1U5FA 1WM3A 4XWXA 1HB6A 2J0KA 3KVFB 2OQBA 4W9IA 4WJNA 4DDID 2KQ7A 4FADA 2MBEA 3A33B 5LOPB 1I42A 2C5LC 1E8YA 2R0DA 2GCJA 3QQ8B 1X11A 4KIKB 1X1FA 2N4FA 3A9KA 2KFJA 2LGDA 2DYNA 2I1JA 4KV2A 1UPQA 2XK5A 3QCAA 3ZNGC 2IO3B 1DDVA 2H7DA 2D11A 1WE7A 1WRDB 2CHZA 2LJ5A 4B6HA 5JZEB 2JZ3B 2HE7A 5J3TA 3T8MA 3AI5A 2ZEQA 3A4SC 3PHWB 3H7PB 2CB8A 3IHPC 3WANA 3ZO5B 3A98B 3L10B 2FAZA 3SD5A 4ZRJA 1Q5WB 2ZJDA 3VUXA 4TQ0A 3AU4A 1PLSA 2IFSA 2RSGA 4K17A 2JWZA 2REXA 4ICUA 5DPTA 4PNKA 3TMPB 3VAWA 2MP2A 2DX1A 4YONA 1Z87A 2MBQA 2WX1A 4EFOA 3EPYA 2ZVOA 2LWPA 2M8SA 3PRPB 4LJOB 2JZZA 3ZLZA 4F1SA 1S1QB 2RVBB 2M4NA 4BBNC 2YS1A 1WXSA 3TW1A 1UD7A 2AYOB 3VTUA 2QKLA 2XQNM 2RGNB 1RRBA 2N1WA 2D9YA 2LBBA 1NTYA 4BKSD 1UNQA 3QBVB 2I5CA 4Z2NA 2PE6B 2ABDA 3UINB 3KY9A 2D10A 1U29A 1MK7B 1ST7A 2KDEB 3H1UA 3UGBB 1J0WA 2GS0A 3APCA 2LRUA 1TJ6A 3N32A 3WALA 5J17A 3D8DA 4FJZA 1FGZA 2LGYA 4M8MA 4CHKA 5C5BA 3ZTDA 4AP4C 2IYBA 1UELA 3V62A 3JW0X 1TBEA 4BKGA 5LXIB 1GNUA 3OANA 3PTFC 1EF5A 2CR5A 4FJYA 1MKEA 1FB8A 3PRMB 1WGUA 3A9JA 2KFKA 4KSLC 5DHFB 4WWOA 1LW3A 4MGKE 3ZNID 2IY0B 2DN6A 2JF5A 3GYPA 2KWCA 3JVZX 3OLMD 4DK5A 4YL8A 1WJNA 4WJ7A 1WZ0A 2N7EA 1R4NI 1FXTB 2GBMA 1FHXA 4JQWC 4OVVA 3V6EB 4E74A 1IRSA 2DTCA 1P0RA 4WWNA 5JHAA 1I7AA 2DYMA 1TQZA 2MKRA 2YT0A 4M0WB 2I1KA 5GMVA 2KTFA 3AULA 3PT2B 4LDTD 2G3QB 4IC7B 2NBUA 3VFKA 2KOXA 2CAYA 4JLCA 4W9CA 1YX6B 1ZKHA 1N3HA 4FJVB 4B9KA 5IA7A 4BBKA 3WAMA 3ODXA 5JH5C 2LZ6A 3L17A 3QAQA 2IO1B 3SNHA 4BFRA 1NTIA 4HAUB 2L00B 1OQNA 1A5RA 3P2BA 4ASWC 2Z0QA 4OVUA 4LDTB 2NBWB 5DCNA 4DHJD 1SHCA 3VUWA 4NSWA 2UZRA 3NZSA 2DAFA 2KO3A 4WJPA 1V5MA 4A6FB 4G50A 4LCDE 4MGIE 5BO4B 2KJRA 2LG1A 4I6NB 1WH3A 4KZ0A 4CHMA 1OMWA 4RM8A 3A8QA 3H6NA 4F7GA 1V86A 5LONB 3DOWA 5AZGA 1V89A 2A5UA 1RFAA 4HCPB 2FCQA 1I35A 3ZNZB 2RUKB 3F5RA 2KJ6A 3PGEA 2O6VB 3TJPA 4TKNA 4ANWA 2VSZA 4ANUA 4A5KA 2PEAA 1QQGA 1YJ1A 1WGYA 2FJLA 2Y7BA 2RGFA 1RLFA 4CO7A 4GGQA 2GCLA 2K8CA 1U2BA 2WYQA 4W9JA 3ZUNA 2D4QA 2NBVB 1EF1A 2COCA 2Y5BB 3QK0A 1DBHA 3HQCA 2DYQA 4WVFB 2K25A 1QC6A 2KTRB 2L05A 3ULCA 2ZCBA 2J7QB 2WWZA 3B1LX 3RZFA 2BYVE 1MAIA 3FLVA 2KC2A 3W1SA 1V5UA 5LXHA 2V4LA 1SE9A 3CF6E 2N9XA 3APDA 4PS7A 3SDLC 2BYFA 2C7MB 2QHOA 5C1ZA 3AU5A 4HAYB 4KHBB 5D7GA 2BKFA 4HAVB 4FBJB 1Q67A 3DQVA 3VOQA 2LVOA 5KHOA 3P6AA 2DAJA 4GMVA 4MGZE 1PFJA 3BY4B 3VIAA 2J0JA 1UBQA 1WIAA 1WM2A 1X86A 2XEWA 4PS3A 3MHSD 1V5PA 1C1YB 4FLHA 3DVNV 5CHFA 3ALBA 3GZNI 3V60A 2K2UA 3DDCB 5J3QA 4GDLA 2MQJA 2DX5B 4KHOA 4XZ4A 1WGHA 2L0FA 3KUZA 5E6PA 1KOTA 3JSVA 4G11A 2KWUB 3KUDB 3R3MA 5J3YA 4DXAB 3IBEA 2K8HA 1E7VA 2KK8A 3VH3B 2GBRA 1V2YA 1NTVA 2MBBB 1OY2A 1X1GA 5HE2A 1BAKA 2X18A 2KWVB 3PHXB 4GDKA 3T06A 4I6LB 2IYDB 1WR6E 1XR0B 2Z59B 2MCNB 3W1YA 4K7WA 1U5EA 2AWTA 4ZYNA 1LM8B 2D9XA 3UQAA 2D2QA 1WX7A 3ML9A 4ZRIA 5C23A 4GMXB 2CQUA 2GBNA 4IFSA 2H7EA 3NOBA 4RM9A 4J6IA 2L8JA 2N9PC 2KMCA 4GIVA 4FULA 1P6SA 2HD5B 4G3XB 3SHQA 1IP9A 5D3YA 3DVGX 2MW5A 2PZ1A 4IW0A 2G45B 1ZW7A 3R66C 1TTNA 2Y8GA 2CS4A 3BJIA 2NS5A 2L3ZA 4DWFA 1Q1OA 2GBJA 2BWES 3ML4A 5FI1A 5AZHA 3JYUA 1WJ4A 3QARA 4IWOA 3KZ1A 5D3XA 1WY8A 3X0WA 5D2MB 3KH0A 5DH9B 4XC2A 1ZVRA 2L1CA 5HE1A 3VTWA 2PE9A 3M1IB 2ASQA 3KUCB 1GJZA 3Q3JA 1XKEA 2C60A 3G9WA 3TCAA 2FIDA 4URKA 2ELAA 3B0AA 1V81A 4DHZE 2KZRA 1MIZB 2CU1A 1PQSA 2LRWA 3VHTC 3DCGA 5D3WA 2L7RA 3LDZE 4ANXA 3APFA 1MK9B 3ECIA 2EC1A 2K8BA 1LQBA 1YX5B 2HJ8A 4K7SA 2D9VA 2N0YA 4DX90 1Y8RC 3W1SC 4KAXB 4MK0A 3ODOA 1IPGA 2KX3A 1BT0A 2KN5A 1Y19B 4P7IA 1H10A 2M14A 4PQ0A 3IG3A 4LJPB 2JRHA 2KC1A 4II3B 2MBHA 2IO2B 1EO6A 1WE6A 2JY6A 1OGWA 4IM3A 5LLIA 1OQYA 3VH4B 2KQSA 3WAOA 1WI0A 5E6OA 3TO1A 1RJ2A 5DPRA 1WXVA 1Z5SB 2Z0PA 5CHVC 4BOSC 1H8CA 1FAOA 2EJ8A 4MJSA 3CSTA 2W2XC 2YSZA 3GYOA 3LJ3A 1DYNA 2YS5A 4GN1A 2IY1B 2NCNA 4DX8A 4TQ1A 5DPWA 4Z2MB 1J19A 1D3ZA 2G4SA 4BKTA 2MX2A 5J18A 2OOBB 2RQ1A 4I6PA 3TIXA 2EMTA 2N7DA 3MTNB 3KW5B 3MDBC 3WA0A 1FHWA 3AXCA 3H7PA 3VDZA 1UNPA 3L16A 2UZSA 1E7UA 2R2QA 3A8PA 2CODA 1W1DA 2KLCA 1ZM0A 1KZGA 1K5DB 5HE3A 1WF9A 2KXJA 4TYZA 1P1AA 2FIFA 2RR9A 3MPXA 4W9EA 3HK0A 4DBBA 1NBFC 1G6JA 2ZCCA 1E5WA 2GBKA 4PYUA 4DHZB 3Q3FA 3DXCA 2UVMA 1WXMA 5GOWB 2CHWA 1WX8A 3H7SA 3PRZA 4F8CB 2KVRA 5JHHA 2ZPYA 1UPRA 5JHGA 1SIFA 1W1HA 4MM3A 2KDFB 3X23A 3OJ3A 4NPNA 2BCJA 3VQIA 4W9LA 1YQBA 2M1MA 3WAPA 5AZFA 3WYFB 2UWQA 1U5DA 1ZC3B 1VD2A 2G4DB 2JXXA 4E71A 3PZDA 4EJNA 1AWEA 4ICVA 2DHIA 1M94A 2KDBA 4HHVA 4JGHB 3C0RB 4MEMA 2CY5A 4E3CA 5DI9B 2YT1A 2IZVB 3ZKJC 5KQ1A 1NI2A 3DXDA 2FDQA 3A4RA 3DBLI 5FR6A 2QKMA 4MELA 5L83A 4EKUA 4IOYX 2LD9A 4L6EA 3KRXA 2Y8FA 4HB3B 2ZNVB 2GMIC 1KI1B 3CIKA 1XD3B 2FCNA 2RPQA 4A6FA 3CMMB 3QC8B 4FA6A 3LJUX 1YD8U 5G55A 2OJRA 5TR5A 2JVCA 5JLJB 2WX0A 3QHTA 4A20A 2V3SA 4NQKE 3U8ZA 2MBOA 3UQBA 1DDWA 1WYWB 3ZVRA 1WMHB 2DKQA 2LXCA 2ZPNA 4W9FA 1P3QU 2ROVA 5J2RA 1E8WA 3DBSA 2ADZA 4WSFA 3QA8A 2IO0B 1V61A 3ZDMC 3ZRCA 2I5FA 4WJQA 2P0FA 2K6DB 1UBIA 5HKHA 5C79A 3DXEA 5E6NA 1J8CA 3PSCA 3PG7A 2KKCA 2NPTA 2VKIA 4NNJB 5CHWA 3KSYA 2N9EB 3EECA 4W9KA 1WJ6A 3N30A 3KYDD 4HK2A 2LULA 1U5GA 1U4AA 4JL9A 2DENB 2DZMA 4A3OA 1IYFA 2COPA 3SUZA 4EOYA 3FM8C 4KVGB 4WQOB 5HE0A 2RSUA 3A1QA 2JPHA 3PV1A 1WGQA 2G35A 3IVFA 2O6VD 1ZGUB 3HM6X 2DYOA 2Z0EB 3U7DA 3R7RA 5L81A 4DHJB 1KLVA 4GPTB 1V5TA 2LI5A 4GU2A 3RCZA 1GC6A 1X05A 2P0DA 2P0HA 3PEGA 2O2VB 3DVNU 2EMSA 3CXBB 2R09A 3A1QB 5C16A 3NY5A 2HTHA 3OAWA 4IWPA 1HE8A 1WGGA 3PPAA 2DHJA 1WGDA 4AUQC 2DHKA 2MWSB 1E8ZA 3M3JA 3PLUA 4HLEA 3AJ4A 3PVLA 5IJMA 4CHJA 2DYBA 4FHKA 4IG7B 2LVPA 2ZZPB 1UH6A 2BWFA 4KDLB 1BTNA 2XK5B 4W9DA 5CX3A 1EVHA 2JRIB 1X1MA 4TUUA 2FCSA 1FHOA 3RT3B 2FJ9A 3F0WA 3TFMA 4EEWA 1LB1A 3N3KB 5G2NA 4B6WA 2M17A 3JSVB 5KHQA 1BWNA 3DPDA 3RD2A 3U30A 2DLWA 4HDOA 2ELBA 2A4ZA 5AEKB 2LVQA 1AQCA 2NVUI 1EAZA 2DFKA 2DKPA 3P7ZA 2D9ZA 2KANA 3ZRFA 4EZKA 1E8XA 2LOXA 4KIKA 3MJWA 3QX1A 4WJOA 4A6HA 1V5OA 3RYTA 2NZ8B 2FCMA 2AL6A 2KDIA 3ZW3A 2CY4A 5CLLB 1HBKA 2PPHA 1KJTA 4GDLB 1P9DU 2AL3A 4NJ6A 5CLQB 3PLVA 1V80A 3PREA 2JP2A 1E90A 5DIFB 3L54A 5C5BB 2COAA 1L7YA 3HIZA 4Y94A 4HCNB 1M7EA 3QWZB 4GOCA 4GB9A 1NVLA 1WXAA 4NQLB 3ODWA 3QWMA 1OEYA 3SV1A 2ZVNA 4KZCA 2DZKA 4HB0B 1NDDA 2KFKB 5KQ4A 4MGYE 3UIPB 1UEFA 3PP2A 4IAPA 2LUEA 2MP2B 2MWNB 4AJYB 1M7RA 2DZIA 1WZ3A 4K7UA 2FNJB 4MH0E 4PYZA 2YF0A 1L2NA 1WR1A 3D8FA 2DZJA 4ZDVA 1V6EA 4GDKB 2AEHA 4K81A 2R2OA 3ONSA 4FN2A 3FP5A 1V9JA 2WH5A 1Z2MA 5CTRC 2UYZB 4ANVA 1C3TA 1R4MI 3TL5A 4HWIB 3SO6A 1P5TA 2GJYA 3NHEB 4X57B 2D07B 1H4RA 4CYEA 2OTXA 4EZLA 1GUAB 2BPSA 1LFDA 2C9WB 2VRRB 4IWQA 4K1RB 2W9NA 2MDXA 2D3GA 2K39A 2COFA 3QJZA 5IAAC 5D27A 2BKRB 2HRJA 1B55A 4GXBA 4HPMB 3L0WB 1S3SG 3TVVA 1DROA 3GOEA 1WJUA 3PSEB 3BINA 2JUOA 1BTKA 3EHVA 3ZNHB 3SYXA 2KX0A 1XODA 1YIWA 3RUIB 4WAAA 1WJ1A 1UGMA 3O96A 4A3PA 4HVBA 2RLOA 1ZC4B 3UZTA 1TXDA 2NMBA 3NSUA 2DA0A 1WJMA 2L2IA 1EUVB 1JRUA 2BGFA 2BYEA 2LASA 2LXAA 1Y5OA 2KCJA 1WI1A 2M0XA 4II2B 4JIOU 4RMAA 3R7QA 1ISNA 2N23A 1XCGA 5EFXA 2O6VA 1FOEA 2KGXB 1I2HA 3SU8X 4GZUA 3S2AA 2K00A 4AOFA 2V76A 1KM7A 1ZSQA 1OTRB 2KHWB 3ULBA 3HW2B 2VRWB 2KNBA 3EC8A 3EFUA 3L08A 2ROZB 4MSMB 1P98A 2E2XA 2CKHB 4PS8A 4MY6A 4AJWA 5FI0A 1F9JA 3PVUA 3K9OB 4MDKE 4KHAA 4KSKC 2EKEC 3M95A 4IM2A 4WWPA 3V6CB 2W2WA 5C6RA 3VTVA 3H9DA 2K1FA 4D0NB 2YVCA 3D32A 4M8NA 4MJSB 1GC7A 1OEYJ 1WFYA 1WG7A 1ACAA 1EGXA 2KTRA 2P8VA 2MA9B
chains in the Genus database with same CATH superfamily
2YRYA 2W2XD 3A9KB 1HB8A 1KT1A 3Q7AA 4EZJA 2IO3C 3HM3A 1PYWD 3WCQA 5EX3A 3ABME 1V49A 2DX5A 4ZHPA 3FUHA 1SJED 3C3QA 2KN4A 5FJYA 5EN5D 3RULA 4NJ7A 4LG6A 3D8EA 4DDGD 3FY4A 4H8SA 1ZP0B 3QB2A 2RNRB 1YQ4B 2MSED 4HDQA 3UF8A 5AJDA 4CZ2D 4W9HA 5BMHA 1E9MA 1NU2A 1VZ6A 1N0QA 1Y8MA 4GZ6A 5JP4A 1AN8A 2BF0X 3ZYLA 1KLGD 2WXLA 4N3CA 4K2OA 3CIRB 3HVEB 4A6KA 5HS0A 2C7NB 2BS3B 5JHBA 4C80A 3Q2AC 3NRZA 4K5CA 2GGFA 5M4YB 5ANLA 5G04C 3RKVA 1VCBA 3I3TB 3V61A 1D8DA 2L76A 1XX0A 4RVBA 3NJTA 2B0OE 4NIKA 2E3TA 3W5UB 1DCQA 4NAWB 4N5CA 3AH7A 2LGIA 4U95D 5C3JB 3ZDTA 3R9AB 3L13A 5L95C 2OEWA 1VZ7A 3HIEA 3QOUA 3A9JB 1QOAA 2L1AA 1TJEA 4HAWB 3VXWA 2DWZA 4U8VD 1SA5A 1DYQA 1QYMA 3NWAA 3SGHA 3EUVA 2P9PG 3NZUA 2O2VA 2XS1A 1SZ9A 4HRMB 1NI1A 3FU5A 4WWMA 3V5WA 4ACFA 1M4VA 4GPMA 1KH0A 4J0UA 1L0YB 3TBLD 1OWMA 4ILHB 2E0IA 2BKGA 2MRPA 5D6JB 1N61A 3TG5A 4TRQA 4K2PA 1QILA 3AM9A 2WXKA 3RMKC 2MFQA 2KXPC 4HQDA 5ARGA 4W9IA 4DDID 2OQBA 5LFAA 4N59A 5H92C 3A33B 3Q47B 1ZUD2 1E8YA 2ON8A 3FEYA 4IN3B 2GRRB 2N4FA 1GGOA 2KFJA 2LGDA 3A9KA 5G5GA 4RG6A 3ZPJA 4ME2A 4OSNA 2XK5A 4N39A 2IO3B 3RI7C 3ZNGC 1SW6A 2CHZA 3EHQA 4JA9A 4B6HA 3Q75A 1XLQA 2HE7A 2V3PA 4LTUA 3Q8CA 3WANA 2FAZA 3AG3E 1AYFA 2IFSA 2JWZA 2REXA 3TMPB 3ZNGA 5DPTA 4EFOA 1BI7B 2C0MA 3LB8C 2ETAA 4LJOB 2LSUA 1S1QB 2M4NA 1T77A 2YS1A 1Q2ZA 1PUTA 1WXSA 3ZQ4A 3ABKE 3MX3A 3VTUA 3P1MA 1ET9A 4BKSD 4Z2NA 4JKGA 1U29A 4ZRQA 3H1UA 5J17A 3APCA 4I1OB 2LRUA 1TJ6A 3N32A 2OVFA 3D8DA 4LLGM 1I4RA 1FGZA 2LGYA 3OANA 2IONA 1EF5A 2A5EA 4FJYA 2VZKB 4F8CB 3A9JA 4GTSA 2QYJA 3UKUG 3PE3A 1L0VB 2DN6A 2BYTA 3GYPA 5HRYA 3OLMD 4WJ7A 3FTXA 2FJUB 2PVGC 2DTCA 3D9OA 1I7AA 5BV0A 1I4QA 4MM3B 1TQZA 2H6GA 2R2YA 5ENQD 5GMVA 2KTFA 3PT2B 2WQYB 2CG3A 4G2VA 1IHBA 2CAYA 4W9CA 2X6JA 4ARCA 1TN7A 3DHHC 3EIJA 3L17A 3QAQA 2IO1B 1NTIA 3SFXA 4HAUB 2L00B 3ASOE 3P2BA 3R8BA 1JRPA 3ZXVA 1TY2A 4OVUA 1F52A 1T5XD 4DHJD 5BMIA 3RFZB 3D9MA 1OWNA 2Z13A 1H2VC 3S7FA 2UZRA 4A6FB 5BO4B 2ACZB 2OCCE 2LG1A 4D2KA 2IY0C 3AG2E 3B7RL 1HF8A 3IXEA 3A8QA 1Y6IA 3ZYKA 4F7GA 2YHEA 1N5WA 1RFAA 4U0SA 2HDEA 2FE8A 3PNLB 2RUKB 3F5RA 2K0PA 2KJ6A 3PGEA 5HHDG 4ANWA 2QEJC 1UJKA 1YJ1A 2L9BA 2DIWA 2FJLA 4HLLA 1QOGA 2RGFA 1ZDVA 1S70B 2WYQA 3V05A 4W9JA 1V1PB 1KC7A 4XKBA 2KWDA 4ICUA 3CVUA 1DBHA 4WVFB 2ZCBA 1FRDA 2LHDA 1W3BA 3HSAA 3UI2A 3ULCA 2WWZA 3RZFA 2BYVE 2KC2A 4WIPA 2LXLA 1V5UA 3IV0A 2N9XA 3APDA 2QHOA 3AU5A 1D5ZC 3MV2B 1ZOYB 1SXTA 3GZNB 3DQVA 3VOQA 1TS4A 2LVOA 2XPIA 3Q5MA 2P58C 4S17A 1WIAA 2VSYA 1V5PA 3DVNV 2GROB 2K2UA 5J3QA 2GI9A 1YMHE 1WGHA 3KUZA 2LAHA 4EECA 3JSVA 3TSSA 3IBEA 3AAAC 2K8HA 2HYZA 3KSQA 2GBRA 1V2YA 3VH3B 1OY2A 1BAKA 4GTMA 2AXZA 2IYDB 2MCNB 3W1YA 4L9PA 4K7WA 4TXRA 2KR0A 2D2QA 4BWRA 4ILJA 4GMXB 2CQUA 1IGDA 4IFSA 2I2OA 5FWQA 4RM9A 2WVIA 2L8JA 2QYUA 1EF1C 4G3XB 4DLOA 3SBSA 1SJHD 1IP9A 4R3DA 2KIEA 2MW5A 2PM7A 2WXFA 3P4SB 4IW0A 2CS4A 1B89A 3RPFC 3FTVA 2NS5A 2YNQA 2L3ZA 1Q1OA 1UJJA 4CQNA 4ABNA 1BLXB 3ML4A 5FI1A 4ATGA 3ULYA 2PIAA 2EIKE 3UM2A 5DH9B 1K52A 2L1CA 3LEWA 3VTWA 4HRNA 1SE4A 3M1IB 2PE9A 4YSYB 3PEUB 3P1UA 5JJ7A 4LNUD 2LRWA 5D3WA 2L7RA 2IFUA 4L1BA 3AB5A 3APFA 3ECIA 1Z6TA 2RRFA 4REZA 2UWJG 3FULA 3W1SC 1IPGA 3K9OB 4LJPB 1BT0A 3FUNA 4P7IA 4PQ0A 2WDVB 2JY6A 1WE6A 1E7PB 5LLIA 1PGBA 4RQIA 4JPSA 1JCRA 2GRMA 4IYPA 3QWVA 1VLBA 3N1YC 4I17A 1H8CA 1EPUA 3SF4A 3TG4A 5BYSA 2EJ8A 1U3DA 3CSTA 1P5QA 4IULA 2W2XC 3LJ3A 3GYOA 1I4GA 3UKRG 5DPWA 2IY1B 1HZ4A 4DRXE 5BV1A 3QDNA 2G4SA 1BI8B 2MX2A 3KW5B 2GUMA 3MDBC 4KVMA 2BQQA 3RO3A 1E7UA 2YHCA 3FTZA 4UQXA 2LAIA 1QOBA 2BKKB 1XLOA 2KLCA 4XWTA 3CHSA 5EIBE 2PZIA 4TYZA 2R03A 1NBFC 4ACLA 1G6JA 5D0OD 2D5GA 1Y56A 2CFZA 2GBKA 1MJDA 3DXCA 3WXXA 2UVMA 1WXMA 4GPKA 5JHHA 5JHGA 3U4TA 1Q10A 2M1MA 3L9TA 2KUQA 1U5DA 3DBRB 2L6BA 2B76B 4ICVA 5CCMA 3OWEB 3NF1A 4LK0M 4HEA1 1OWPA 1M94A 2KDBA 4RCOA 1C4AA 3UT4A 3ZKJC 1VBGA 2DZOA 2J4DA 3TWRA 5CEAA 3P4QB 4GMRA 3BK1A 4EKUA 4IOYX 1RM6C 3T3NA 3EHNA 4H7XA 5HKPA 4IRUA 1AP7A 3LYAA 3CVYA 4HB3B 2GMIC 2ZNVB 3MC8A 3QC8B 5G55A 3JXIA 4XI9A 3QHTA 2QIEB 3Q9UC 5ENNA 2DKQA 1WMHB 3MV3B 1P3QU 1K51A 4WJQA 2K6DB 1UBIA 5E6NA 3PSCA 5DBKA 2K22A 2CG2A 2P9NG 4W9KA 4HK2A 2LULA 4HPPA 1U4AA 4JL9A 2DENB 2Q7FA 2COPA 5ANRA 4U07A 3SUZA 4APOA 3HG0D 1GB1A 2LSVA 3HM6X 4US9A 1UF0A 1T6BX 1WRIA 3FVCA 1KLVA 4GPTB 1V5TA 3DSVA 1GC6A 2VSNA 1X05A 4QJ3B 4WURA 3NY5A 4JXTA 3N1XC 1YNTE 1HE8A 2DHJA 2I9CA 2Z8LA 5AQ7A 5AQAA 4HLEA 4CHJA 3PLUA 2RFMA 2ZZPB 1N63A 4W9DA 1UOHA 2XK5B 2R82A 4ILIA 2FCSA 1FHOA 4AQ7A 1LB1A 4MACA 3JSVB 3DPDA 3RD2A 2RKKA 5G05C 4KX6B 4EBAG 4F3VA 1TS5A 2LVQA 3ZRFA 2KANA 4ILGA 2IOSA 4O60A 3P7ZA 1E8XA 5EX0A 4I1MA 3MJWA 3QX1A 5HI7A 1V8CA 4WJOA 3EJNA 3ASDA 2FCMA 2MHKA 1K1BA 3TWWA 2JZPA 3UT7A 4G24A 1HX8A 2M56B 3PLVA 3PZ4A 2NSZA 2KYWA 3L54A 3Q49B 5I2SA 4O1OA 1C78A 3EA6A 1PDXA 4GB9A 2XRZA 3PZ1A 3TWVA 1FVFA 1WXAA 4NQLB 4L2YA 2DZKA 4LEUA 2L83A 3PP2A 2QMTA 3FUKA 3LJNA 5FKAC 2DZIA 2FNJB 4PYZA 2H6IA 4L23A 2J4BA 1L2NA 2KM4A 4FC8A 4CEMA 2R2OA 3MP9A 2W55A 1C3TA 1FIQA 1V9JA 4JA7A 1I4HA 1VRAB 1Z2MA 2UYZB 1HS6A 4YVOA 4JKGB 4HWIB 5JVLA 1BUIC 1E96B 3T3OA 4CYEA 4EZLA 2BPSA 1LFDA 4U0UA 2W9NA 2D3GA 2BKRB 2HRJA 3ZRHA 4JKCA 1B55A 2J07A 3TVVA 3FH7A 3GOEA 3NUHB 4LNBA 4J8EA 4B89A 3EHVA 3BQOA 4HVBA 4A3PA 1RFKA 1ZC4B 4GLSC 4YDYA 4J8SA 4ATZD 3ZU7B 2XCBA 4RMAA 5AQ9A 3URYA 3SEBA 2KCJA 2M0XA 2WXGA 5LX8A 1VBHA 3MEKA 4JKDA 3P4RB 3ESKA 2AVPA 3S2AA 4DJAA 1ZSQA 4MSMB 3ULBA 2Y4TA 1HG5A 3L08A 3HW2B 2INNE 3FKYA 3VRBB 3EU5A 4OT1A 1L4ZB 4KHAA 2X8XX 4QJ5B 3V6CB 1JPLA 3LYYA 3ENBA 4D0NB 2C2LA 3ZYMA 4KHBA 2NBVA 1FVHA 1ACAA 2LGSA 2KTRA 2P8VA 2KZTA 1Z3XA 3UX4A 1B1ZA 2MA9B 5CHEE 4MT7A 2GW1A 2CHXA 3QKYA 2GOWA 1MHHE 2PMVA 1WGRA 2MRIA 3LXUX 3FTSA 3E32A 3DVGY 2KD0A 2BF8B 3NG0A 3WIMA 5E76A 3I57A 1JMLA 1IQUA 1IYGA 5CERB 3EU9A 4EBAA 3KRWA 3ENEA 2WDTB 2XGMA 4XWWA 3AEAB 3BG1B 4L2LA 4BKSA 1NFIE 2ZGGA 4LNKA 3EIQC 3JUEA 4HORA 1JWFA 1C4PA 4HB2B 2YS3A 2JT4B 2J0MA 2WLBA 4UWGA 2XZDG 1OCCE 3NQPA 3UXGA 3OJ4B 5KJMA 1TZ1A 1O1SA 2RD0A 1JWBD 2KT7A 3BIID 4KKJA 4NAMA 3ONKA 5BYRA 4HKQA 3IXSA 2MOWA 4BOZB 2D9WA 2DHZA 4GZ3A 2Z0OA 1N54A 4NURA 4HAZB 4XKCA 2IGHA 2BTDA 3K9PB 1FO4A 4XE0A 1BPOA 4NY0A 4G0NB 3TEWA 2H89B 4U7EB 1AARA 3BYTB 4HXDA 2V1YA 3FILA 3Q8AA 4DBGA 4XX5A 3RCPA 1WVHA 1NI3A 3BU8A 5FTPA 2WDRB 1XQQA 1E0ZA 4B0MA 3D9KA 1RAXA 2JQRB 2LOZA 2J53A 5AUKA 1SGHA 4MS6A 1UZXB 3G2TA 1P3RA 2KC7A 1Q0WB 4LNOA 1T0YA 4W9GA 3F6QA 2YT2A 1PMSA 2CRFA 3ML8A 4C0AA 4C7YA 3GZ2A 1HA5A 4I1AA 1PY1A 1U5FA 2P9LG 4WJNA 1HB6A 5IKCM 1SB3C 1EM7A 2KQ7A 1XLNA 2L52A 3AG1E 1UGJA 3IEGA 4NJCA 3I5PA 4WNFA 1TKEA 2GRNB 4I6EA 5BMGA 4XI0A 3U3WA 1X11A 3TUOA 3HXBA 3OXFA 1UPQA 1HZ5A 3QCAA 2BB6A 4I9EA 2H7DA 2D11A 2KATA 2MHJA 3BVZA 3E56A 3FTWA 4CRWA 5J3TA 3W5VB 4MKTA 3A4SC 4XYCA 1D4BA 3H7PB 1JWMD 2XN9C 3CQCB 4TQ0A 2PQNA 4JEHA 3D9HA 2WXQA 3AU4A 4HNAD 2JU6X 3W9FA 3IAS1 3NS1A 5GXGB 4BBNC 3HYMB 4PNKA 3HXFA 1FD6A 3LY9A 4OZBA 3D3MA 4YDOA 2MP2A 4K5BA 2BS4B 3EPYA 4B93B 2LWPA 2Y0BG 3FUMA 3CHPA 3WG7E 2IU1A 3TW1A 1UD7A 2V8SE 2AYOB 3ASNE 3Q79A 3Q73A 4KT6B 3SO8A 4G23A 5E75A 3URZA 2ABDA 3UINB 3KY9A 2D3CA 4LNIA 1A17A 1UWXA 3WALA 2GRPB 2TSSA 1N0RA 4CHKA 4AP4C 2AXVA 1A70A 1UELA 1GNUA 3PTFC 5T4YA 2CR5A 1WYGA 3PRMB 1FB8A 4WWOA 2R5SA 4GMJA 2DNFA 3EGRA 4MGKE 1PAQA 5CBNA 3PO0A 4KGTA 1NENB 1R4NI 2GBMA 1FHXA 2PKOA 5JHAA 5FK9C 2MKRA 4M0WB 4OHJA 2I1KA 2XEHA 3AULA 1LO5D 2F0YA 4LDTD 1R4NB 4BT9A 1Z3YA 4IC7B 4LNGA 4GYWA 4B9KA 4FJVB 3VR8B 2X3MA 3WAMA 2FO7A 4HOTA 2LZ6A 3DWLG 3SNHA 4BFRA 1T3QA 2YINA 1OQNA 2NBWB 3NVVA 3VUWA 1GAQB 1TKGA 2VH1A 4WJPA 4G50A 4GYOA 2KVZA 2KJRA 2KCLA 1F1HA 2P9UG 3RNAC 2KBXA 3H6NA 2Y4UA 2LNIA 2WGSA 1I35A 4HCPB 4U96D 3ZEFA 2PLPA 4KVOA 5BXUA 1S64A 2VSZA 1T0RC 3RNGC 5KBAA 3DHIC 3HVDA 2Y7BA 4AY6A 2J52A 1QZ2A 2ZW1A 4GGQA 3V3XA 2K8CA 1U2BA 4HRSA 2JEKA 1HXIA 4RH6A 1EF1A 3HQCA 3UIOC 2J7QB 2Z4DA 1OWOA 2K8EA 1SE9A 2BW2A 1QKZA 4RFBA 5CECB 4A63B 5C1ZA 4KHBB 3EUB2 5JJTA 3B77A 2K9XA 3VTXA 4C9BB 4B8CB 3ETRA 2FEZA 4IKGA 3T5VA 4GMVA 4MGZE 3BY4B 1SE2A 1UBQA 2WQHA 1KZOA 1X86A 4PS3A 2XEWA 4RNAA 1OCOE 4C00A 3V60A 1AWDA 4GZCA 4KBQA 5J90A 1TNOA 1ACCA 4JHKA 4LRZA 4GTPA 4LCTA 1E7VA 5KJKA 5CMWA 2KK8A 3Q3MC 3T5XA 1NTVA 4LCDE 5HE2A 2XS8A 4GDKA 3E66A 3VTVA 4B95A 4DLQA 1QNFA 3T06A 3RRMB 1YA0A 4YSXB 1LM8B 3RO2A 2HJ1A 2ZISA 3ML9A 1CK1A 4ZRIA 1WG0A 5JXVA 4J6IA 4FULA 4DI3A 4GIVA 1JQ4A 5FZQA 4EE2A 2IPKD 3SHQA 5D3YA 1N95A 4GYYA 3SQVA 3DVGX 2FBNA 3HUIA 5LG4B 3R66C 2R02A 3AECB 3KLSX 2EILE 2Y8GA 5H7PA 3FEXA 4DWFA 1V97A 3PZ2A 2BWES 4W9RA 3V30A 5AZHA 2HE0A 3W2DA 1WJ4A 3QARA 3LCAA 1LF8A 1TNUA 3FUIA 4JC8A 3KZ1A 1YJJA 1ZB1A 3KH0A 3Q6BA 1ZVRA 5HE1A 4GAAA 1GJZA 2B6CA 2ASQA 3FTUA 4AXHA 2F8XK 1XKEA 4GA1A 3O4ZA 3TCAA 2FIDA 4URKA 1GB4A 1TZOA 3BEEA 1PGAA 3LDZE 2M19A 2EC1A 2OEVA 2N0YA 5FQ6A 4BESA 4G25A 4KAXB 4CDNA 2J8SD 4B8AA 1H6KA 1DIKA 3IG3A 1Y19B 1H10A 2JRHA 2KC1A 5FQ8A 2MBHA 2IO2B 1EO6A 4UDUC 1OGWA 3FUDA 3AS5A 4HS2A 3WAOA 2KQ4X 4WAFA 5HQ8A 3TO1A 4MBGA 1WXVA 4TSSA 2WXRA 3G2UA 5CHVC 1FAOA 3I3NA 3FUJA 4XIFA 3X2QE 4MJSA 4DXGA 4UQYA 4WNEA 4GN1A 4DPRA 2HR2A 2AWIA 3B7SA 2WQ6A 4Z2MB 1GPXA 4GTTA 4BKTA 4GTVA 3TXNA 1TT5B 2OOBB 4I6PA 2N7DA 3MTNB 3WA0A 2J08A 3VDZA 1UNPA 2H6FA 1YJIA 3A8PA 5HI1A 4BTAA 1FCLA 3L82A 1ZM0A 1K5DB 1JCQA 4UI9K 2DIKA 4UWKA 1FEHA 1WF9A 2FIFA 2RR9A 4W9EA 5CMYA 4P1BC 1K50A 4DHZB 5E6JA 5GOWB 2CHWA 3D9LA 1E10A 2ZPYA 1UPRA 1E6EB 1SIFA 1KZPA 3X23A 3FAHA 2YEPF 3Q7FA 1WWTA 1VD2A 2ONDA 4HHVA 4V3IA 1N11A 3MA5A 2IZVB 1H0AA 3DXDA 3A4RA 3DBLI 4L1RA 3TEYA 2LD9A 2HTME 3I5JC 4NAWA 2Y8FA 2ZNVC 3CIKA 1VR9A 1XD3B 4FA6A 2FCNA 1U3CA 1YD8U 4QAYA 3SBGA 3HVEA 1F2RC 3DWGC 3B13A 3GYZA 1PGXA 2RDGA 3UQBA 3FH5A 1NEKB 1NA3A 1SEBD 1WYWB 2MH7A 2ZPNA 5KJLA 5J2RA 4OYSA 2VGYA 3B2GA 4BY6A 3E4BA 3SFZA 2IO0B 3LKUA 2I5FA 1JDEA 2ZU6B 3B2FA 2NPTA 3KS2A 2N9EB 3VLDA 1XLPA 1V1PA 1YOVB 4A3OA 1IYFA 3HXEA 4EOYA 4KVGB 1V1OA 4WQOB 5HE0A 3PV1A 3ASHA 1WGQA 2G35A 3IVFA 2FO1E 3U7DA 4BSZB 5L81A 1TNBA 4GU2A 2O2VB 3DVNU 3JW0X 4E85A 2EMSA 3CXBB 2XGOA 2HTHA 5AUIA 5EILA 5D66A 5AAOA 3PPAA 4WH4A 2DHKA 4GNKB 5M72A 3M3JA 3PVLA 4IG7B 2LVPA 2V4IB 2X6FA 1UH6A 5CX3A 1RW2A 4G1TA 1EVHA 3AE8B 4F6RD 3E37A 1ZPSA 1IBXB 4P16A 3RT3B 1FT2A 2FJ9A 3F0WA 4EEWA 3N3KB 1QF6A 1BWNA 2WXMA 3D9PA 3U30A 2DLWA 5T8IA 2ELBA 4A90A 1L4DB 3E9PA 2RPVA 5D3IB 5AEKB 3AE3B 2NVUI 1NVID 4KIKA 1C76A 3AJIA 4BT8A 4A6QA 1HBKA 1KJTA 3LXFA 4ZYSA 2X0SA 2JP2A 3OXLA 1UNSA 4C7ZA 1NL4A 1X5BA 3V2OA 4HCNB 3QWZB 4ZHOA 1HH8A 1CZPA 3SV1A 1CJEA 4WQMA 5AJLA 2KFKB 4MGYE 2V0GA 3UIPB 2LUEA 2XPZA 2I6HA 2MWNB 1JW9D 4AJYB 3SHFA 1M7RA 3U2SC 1WZ3A 4XGAB 1HZ6A 1TIFA 3SBTB 5HG2A 1V6EA 4J8YA 2AEHA 4K81A 2QCZA 3FP5A 3S7BA 2WH5A 4DX1A 3AE9B 3C3RA 3LPZA 3TL5A 4O6FA 1BU9A 3SO6A 3D9NA 1P5TA 2GJYA 3NHEB 1H6PA 1GUAB 3KWLA 3UTMA 2MDXA 4YSZB 3QJZA 3HRAA 4M0WA 3UUXA 3HXDA 1MZCA 5D27A 4DIXA 1I4PA 1L6UA 1DOYA 3PZ8A 1DROA 3PSEB 2P9IG 2M63A 2WXJA 3CHMA 2G9HD 1UGMA 3ASGA 2RLOA 3U9WA 1DC2A 3A1QA 2NMBA 2L2IA 3NSUA 2FULA 1EUVB 2LXAA 2O6VD 4JB8P 2W54A 3R7QA 4LNNA 3HXCA 1ISNA 2N23A 1XCGA 4QXAB 2IJ0A 1I2HA 3N9YC 4NQ0A 3Q14C 4B0EA 2K00A 2VTBB 1OUVA 2KHWB 2VRWB 3EFUA 2PNNA 5A7DB 3ZKJA 4AJWA 1HG2A 4BX8A 4PS8A 2ROZB 4GZDA 4ZHBA 1MFWA 4HI9A 5FI0A 2CKHB 3PVUA 4RF0A 4MDKE 4WWPA 4CCAA 5C6RA 1TEZA 4GCNA 4GCOA 3CGHA 2OVBA 4UQZA 2WMOA 1GC7A 1FMAD 4M8NA 1MHXA 4RGNA 3PNTB 2I38A 2LGXA 4HPLB 2HM8A 3GZ1A 1LXDA 4ZRKA 5EYPF 2BS2B 2HO1A 1YN3A 2IJGX 3FEHA 3B95A 2L0TA 5EE1A 1XCTL 2XEEA 4GA0A 2LKOA 3L22A 4AVXA 3SZ7A 3PVWA 3DBRI 4LNFA 1V55E 1CMXB 5DHAB 4UWHA 2K2JA 3ZVVA 3NS8A 2PJHA 5IO9A 2Z59A 3NAWA 2MLBA 5D94A 3VVWB 5T3RA 4IUMB 4Q2JA 4L7TA 2MEKA 3BG0B 3Q15A 2ILRA 2UY1A 5JA4D 5G05J 3Q78A 5EDSA 3MJ5A 1L6VA 2VGXB 4GSWA 1V88A 3GB1A 2J49A 1ENFA 3QIJA 3CR3A 2EQXA 4IM0A 2N9KA 3MC0B 3QNKA 1JWSD 4BBNF 3AN1A 4TUMA 3TXMA 3LVRE 3VTYA 4Q94A 1KLUD 2KAJA 4HB4B 2OOEA 3DSTA 2NPTB 4BTBA 1W1GA 2L6JA 1DOIA 3O65B 4KXKB 5D3VA 3ZTCA 2IGGA 1H2UA 2QJLA 1FRRA 2DBYA 3CIAA 4X8QA 2SAKA 1WX9A 2KLGA 4O1NA 2YLMA 4Y6WA 1YMPA 4N9F4 1BMLC 4F7AA 4AWJA 1XD4A 1FNVA 1UNRA 1UWMA 1FXIA 2FUHB 3RIBA 2IBIB 2V3NA 4TV3A 4AY5A 3ZHEA 2Z0DB 3H8HA 3ZIMA 3C3OA 3N7CA 3AE5B 1GG3A 3KVFB 4XWXA 1FCHA 2KACA 1UN9A 3HRDD 4RGMA 4FADA 3P42A 4J8FA 2MBEA 2QILA 1I42A 4KKIA 2LMCA 2XGSA 4JKAA 4KIKB 1HTQA 2Y5PA 4KV2A 2DYNA 3DWMA 4JL0A 4JWSC 2L0TB 4HJGE 2FF4A 3E34A 4RSYA 3RNFC 5JZEB 2JZ3B 2XZTG 1SA4A 1P7FA 1B9RA 3T9KA 4O1PA 1HTOA 3IHPC 3ESLA 2Y5CA 3L10B 1Q5WB 4KYOB 2RSGA 4K17A 4GTQA 2VJ8A 4FU3A 4BETA 2CFUA 1BXTA 4RG9A 2QY7A 2DX1A 4YONA 1Z87A 2MJ3A 3BK2A 2XEVA 2DYSE 1MG4A 2M8SA 3PRPB 3ZLZA 1LD7A 3FWVA 1IQRA 4I43A 4CGVA 3Q3NC 1ZBPA 1K3ZD 1X81A 1L0XB 5LCWJ 2J09A 1OFFA 1KRHA 2QKLA 1MQSA 2D9YA 2JYEA 2I5CA 3B7TA 2PE6B 3IAM1 2D10A 5EKQD 1S0PA 2Y1LE 5IY5E 3UGBB 1J0WA 2GS0A 1SBBB 4UI9C 3ZXPA 2L32A 3AEFB 2ZXWE 2IYBA 4CT4A 4BKGA 1YN5A 3JQ1A 2YQ8A 2ETCA 1NZNA 1TNYA 1H2TC 3QC1A 1MKEA 1WGUA 2IDYA 4KSLC 5DHFB 4YTPB 2WPVA 1LW3A 3ZNID 2IY0B 4DK5A 2JF5A 2KWCA 4I2WA 1WJNA 4E74A 2LHEA 1FXTB 4OVVA 4JQWC 3V6EB 5ENTD 1IRSA 1P0RA 2PM6A 2DYMA 3DSWA 1F2RI 3HVZA 2YT0A 3MFGA 3AE4B 2V9HA 2G3QB 3ISMC 3VFKA 2KOXA 4JLCA 1YX6B 1FCCC 1N3HA 1OQQA 1ZKHA 3FUFA 1XCQL 5FIOA 3ODXA 4N6EB 1QBQA 4YTNB 1A5RA 1N94A 5DCNA 4LDTB 4I2ZA 1MI1A 3ZXSA 1SHCA 3C8YA 4ZFHA 3V2XA 5AARA 2KO3A 2GB1A 2VQ2A 1V5MA 4MGIE 1V54E 5EYLA 4I6NB 1WH3A 2IGDA 1XO3A 3JUIA 3FFLA 4CHMA 3R9MA 4DUIA 2P2CP 5AZGA 4E6HA 1RWSA 1V89A 1TJFA 2A5UA 4PUCA 3SY2A 2FCQA 3ZNZB 4JKHA 5AIJA 2O6VB 2PEAA 1RLFA 3CQGB 1TN6A 4PH4B 4YNDA 2NTTA 3ZUNA 2D4QA 3QK0A 2ZKMX 2CJOA 2K25A 3B1LX 2WMNA 1QC6A 1FFUA 3JVZX 3RAUA 3KWVA 3ZJUA 1JWGA 1MAIA 4NRHB 5LXHA 1IBXA 2V4LA 3CF6E 2WDQB 2I2YA 3SDLC 2BYFA 2NXPA 4GA2A 5D7GA 2LEKA 2BKFA 4K0RA 2WXIA 3FC4A 1FT1A 4FBJB 5KHOA 1N6ZA 5D3DA 1WGKA 2PTLA 3GZSA 2JX5A 1PFJA 4M3OA 3UM0A 1WM2A 3MHSD 2WNMA 1C1YB 5CHFA 4ZDVA 3GZNI 1L5JA 1J7CA 4Z68A 3DDCB 2DLBA 4GDLA 2GRLA 4GU5A 4A1SA 4C0EA 3DCXA 2DX5B 1XGWA 3RK6A 5A23A 1KOTA 4G11A 3KUDB 5J3YA 4DXAB 4IDIA 3AMZA 2BEDA 4N3AA 3J5PA 3SBTA 4K03A 1OT8A 1X1GA 3BVMA 2X18A 4I6LB 4M8MA 3UIOB 2PVOD 4FXCA 2DCPA 4DI4A 3RNCC 3ZFWA 1WX7A 2GBNA 4BSXA 3C72A 2HD5B 2XNAC 2WXOA 5KWDA 4PDXA 3G2VA 5FR3A 2M0AA 1MX4A 2G45B 1ZW7A 2WM9A 1TTNA 2R59A 4ZRPA 5KCMA 1O5MA 1MPEA 3BJIA 5FINA 1YCSB 4RGOS 3DSUA 5TSSA 1IKND 3CVQA 4AIFA 3NBNB 2KDMA 3E9LA 5D3XA 1WM5A 5D2MB 4XC2A 4TXPA 3KUCB 3E9OA 4ILHA 1JROA 5D0QD 1TN8A 2C60A 3G9WA 2ELAA 3B0AA 3ABVB 4DHZE 3VHTC 1PQSA 3MYVA 3DCGA 2K8BA 1LQBA 4ITKA 4MT5A 1IHGA 3DBLB 3VR9B 4K7SA 3NW8A 1Y8RC 4P29A 1OCRE 4U0ZA 3ODOA 2VTBA 4B94A 4MK0A 1KFYB 2M14A 3R2IA 1D6EC 4II3B 5JH5C 3FUEA 1WAO1 3VH4B 1QT9A 2INDC 3CVNA 5ENPD 4JKFA 4S0RA 1WI0A 4N58A 4HOUA 5E6OA 3CVPA 3K9IA 3BWUD 2XRYA 1WXQA 1Z5SB 5DPRA 4BOSC 2WB2A 2OJWA 2NCNA 4TQ1A 4K3BA 3TGOA 2GRIA 3PUJA 2G1EA 5J18A 3UI3A 2EMTA 1NA0A 1FHWA 3H7PA 3L16A 3B7UX 2N0SB 4J3OD 2CODA 1W1DA 2KCKA 5HE3A 3FHEA 2XPYA 2KXJA 1P1AA 4UWLA 2LUHA 1TYQG 3ZYQA 4PK1A 4DBBA 1O1RA 4MLPA 3CEQA 1E5WA 4PYUA 4G8LA 4JD2G 3Q3FA 1SSNA 4APFA 3W9GA 4HOSA 1J7AA 4M01A 3UM1A 3O48A 1I4XA 2KDFB 3VQIA 1SVXA 2H6HA 2BCJA 4W9LA 2L0IA 1SZAA 3WYFB 2G4DB 4N2SA 4E71A 3CVWA 1ZDXA 1AWEA 3KEZA 4JGHB 3RRUA 3C0RB 1UW4B 4MEMA 4AV7A 2CY5A 3NWDA 5DI9B 3Q8EA 4JW1A 2JXTA 5KQ1A 4C4VA 5LCWC 1NP7A 5L83A 3CVVA 3S7DA 3KRXA 4AM9A 4CDRA 4KMOA 2RPQA 3LJUX 5JLJB 2WX0A 4JWUC 1HO8A 1UN8A 4JZYA 2MBOA 2KCVA 2NMQA 3RN9C 3W9CB 3L6AA 3RNEC 4A9AA 3NVWA 3DBSA 4WSFA 3QA8A 5HKHA 2P0FA 5C79A 1J8CA 1LD8A 3PG7A 1MJ0A 3SR6A 2VKIA 4NNJB 3KSYA 3EECA 3KYDD 4U8YD 2ZGDA 3BVGA 3AE7B 2DZMA 4OAUC 2BUGA 1HXYD 1N62A 1EDUA 4Y6CA 2RSUA 5CEDB 3SFYA 2RDHA 2Z0EB 1WDYA 3R7RA 1FM0D 4FP7A 1LGRA 2DBAA 2P0DA 2P0HA 3A1QB 1IGCA 2R09A 3UQ3A 5C16A 3AEGB 2H88B 4IWPA 3ZUVB 2IEJA 1STEA 1WGGA 1WGDA 2MWSB 2VH2A 4HOQA 4C48B 5IJMA 4G26A 3NOCD 3DHGC 2INPE 2BWFA 2WHIA 1SE3A 3FU6A 4KDLB 2QFCA 2JRIB 4HFGA 4DQOC 5LOZA 4TUUA 1YYHA 5ENSD 1FXAA 3NWFA 3TFMA 3VLEA 5G2NA 5KHQA 2M17A 3DRAA 1KTKA 4HDOA 2A4ZA 2XCCA 3TEXA 5BYQA 3CHOA 2DKPA 2P9KG 2D9ZA 2VSOE 1MHQA 5C2YA 3ZW3A 2NZ8B 1V5OA 4YVQC 2KDIA 3PDNA 2CY4A 2AW6A 3EDTB 5CLLB 2AJAA 2PPHA 4NJ6A 1P9DU 2AL3A 1BD8A 3CKBA 3E30A 5CLQB 4DXFA 1JWAD 3AV8A 4TMAB 3ZYYX 3PREA 1E90A 2QZAA 3HIZA 2COAA 5C5BB 1D8EA 1M7EA 2JSVX 4GOCA 3CK8A 1FNUA 4NACA 3P63A 1NVLA 1N9AA 3QWMA 1HEZE 2ZVNA 3MZLB 4HB0B 1NDDA 4NZLB 3CKCA 3T8KA 1U2VG 4IAPA 2MP2B 5I2MA 2JYTA 3O13A 2YF0A 3DEOA 3D8FA 2DZJA 4GDKB 3E33A 4EPZA 4CDMA 5CTRC 1SIJA 5LNK1 4BZAA 4P6VF 1H4RA 3JYSA 2OTXA 2EINE 3L4PA 2C9WB 2VRRB 4IWQA 5CBOA 2K39A 2COFA 5IAAC 3ZGQA 2MYOA 4GXBA 3KQ4A 2LFIA 3L0WB 1S3SG 2X6IA 5MPOA 4RLYA 2NC9A 1WJUA 4FLBA 4I9CA 3PE4A 4XDDA 1SQMA 4YWGG 3BINA 1BTKA 3ZNHB 3AS4A 3Q9NC 4UUCA 1XODA 3SYXA 1YIWA 1IXVA 1YN4A 3AEEB 2DA0A 1JRUA 1WJMA 2J9QA 3V31A 2RDBC 4JIOU 3RNBC 1Y5OA 1OWLA 4II2B 4OZAA 1O1TA 5EFXA 1WSPA 1FOEA 2O6VA 2R61A 2MJDA 3SU8X 3N1ZC 4AOFA 2V76A 2ICIA 1KM7A 2QC8A 3KSLA 2KNBA 1NYQA 3EC8A 1RYJA 1TNZA 4JHJA 3RJVA 1JCKB 1XEEA 2QSDA 1K1AA 5G5HA 1KT0A 4DX7D 1WY6A 2WU5B 3M95A 4IM2A 4K3CA 5EE9A 2GRQB 2WXPA 4CT0A 5A6CA 2V0PA 3U64A 1OEYJ 1QQEA 1WG7A 1EGXA 4A20A 4G8KA 2WS3B 3GE3C 2BBCA 5J08A 5DIZA 4UWFA 3J5QB 2Z14A 2M38A 3C19A 2XBBC 2KJHB 3B08A 4FHJA 3M63B 1YQ3B 1EU4A 3AEBB 1L5PA 2OEDA 1HQRD 4C56C 1KLXA 3GW4A 5KJNA 3FSSA 1XT9B 3HHMA 3GP7A 4HJKA 1J0GA 4HXIA 1N4PA 1ELWA 3IFWB 1FGYA 4M00A 2Q13A 4F7UP 2K6QA 2R05A 3IKOB 1TS3A 4KDIC 4A3VA 2J59M 1EWYC 4F7ZA 1LTXA 3CSFA 3T9LA 1K8RB 3NOGD 1EYHA 3S7JA 4A3TA 3PS6A 2NR2A 1I7HA 2ONQA 3U66A 3FDHA 3ZGZA 4BVUC 2P9SG 1DOXA 1U27A 4C4VB 4EMOA 1CQVA 2EKIA 3NB2A 5BNWA 2B3AA 2C7HA 2D3AA 1RRPB 2KUPA 3DBHI 3DEPA 1TGZB 1MPHA 1HFAA 1DDMA 1C77A 3IT4B 4KGRA 1P7EA 1D5XC 3KYCD 4AS1A 3RZWC 2N1VA 3VUYA 1WMHA 1MG8A 5CCLA 3MGBA 4F7HA 4RGTA 4LSZE 1MX2A 3EHRA 3CHQA 2KMAA 3MKRA 2WXNA 4WNGA 4HAXB 1XXGA 2HTHB 1K5GB 1KZ7A 4J8DA 1T0QC 4EUTA 3OTNA 3MCXA 1RZ4A 5BT1A 3MKQA 3FTYA 1MIXA 1QZEA 1KBLA 2LYDA 4HATB 3I9V1 1S63A 3M62B 5KCVA 3AEDB 1WM3A 2J0KA 2K5PA 4J7WA 1D5MC 2QDFA 5G04J 5LOPB 1VDYA 2C5LC 2R0DA 4HKZE 2GCJA 1QQRA 3QQ8B 1X1FA 5C2TB 3P4PB 2I1JA 3G2SA 4P1CC 1TJCA 5EIDA 1TR4A 2GLSA 4M7CA 1XNFA 1DDVA 5LP0A 5BPPA 1WE7A 1WRDB 2LJ5A 2XENA 3ABLE 3T8MA 3AI5A 2ZEQA 2VSXE 3PZ7A 3CK7A 3ONLA 3PHWB 1Z5SC 2CB8A 3LDZA 3TWUA 3ZO5B 3AE6B 3A98B 3SD5A 4ZRJA 2ZJDA 3VUXA 3RU0A 1PLSA 2C0LA 2IOLA 3VAWA 1XF5L 5FQ4A 5FZSA 1C4CA 4F53A 2MBQA 2WX1A 4N3BA 3U52E 2ZVOA 1ELRA 1UUPA 5BUZA 2JZZA 1OXJA 4F1SA 2VGXA 2RVBB 1TY0A 2XQNM 2N1WA 2RGNB 1RRBA 1FFVA 2LBBA 1NTYA 2V4HC 1ZYIA 1UNQA 3QBVB 5ENOD 1ZXHA 2KDEB 1N52A 1MK7B 1ST7A 4AEZC 4FJZA 1MVKA 1VJKA 5C5BA 3U12A 2VYIA 3I4RB 3ZTDA 2LO6A 3V62A 2RMMA 1TBEA 3ZXRA 5LXIB 5D2MC 4KGSA 2Y3AA 2KFKA 3BZDB 2E2EA 1K53A 3G2WA 4YL8A 3FP3A 1WZ0A 2N7EA 3CWIA 3E9SA 1AWCB 4DX2A 4WWNA 2AQ2B 4JK7A 3MKQB 4YXDB 2NBUA 2DWQA 3V79K 4CSQA 4M02A 3U4EG 4BBKA 1HU3A 3LS8A 3A58A 4H2AA 1FNWA 4EHMA 4YTMB 4ASWC 2Z0QA 2E6XA 4OW0A 1N4SA 4NSWA 3NZSA 1NYRA 2DAFA 3DXMG 1J7BA 3D9IA 2NYJA 5B1AE 4CGWA 2XHEA 4HBDA 3CVXA 1FPYA 1QOFA 4KZ0A 3UPVA 1D9SA 1OMWA 4RM8A 1EU3A 2ZIRA 3CK9A 3DOWA 1V86A 5LONB 2WP9B 1ELKA 2EIJE 3IT6B 2LUMA 3MC9A 2EIME 3TJPA 3EHMA 4TKNA 4H7YA 5B3SE 4ANUA 4A5KA 5C1DA 1QQGA 1G3NB 1WGYA 4N5QA 4CO7A 2R17C 3AS8A 3BUAA 4QQIA 5FZRA 4GMLA 2GCLA 3EFCA 3FH8A 3JQ0A 1EWCA 2NBVB 2COCA 1ROEA 2Y5BB 4USAA 2D3BA 2DYQA 2KTRB 2L05A 4I6JA 5B1BE 3W1SA 1ET6A 3FLVA 4ILGB 2ETBA 3B9JA 4PS7A 3UT8A 2C7MB 2VGEA 1UG3A 3PUKA 4HAYB 4ARIA 1KPSB 2KZTB 4HAVB 1Q67A 4LUNU 5IRSA 3D9JA 3P6AA 2W3RA 3Q4AB 1JALA 2DAJA 2W3SA 3OXGA 2XQ0A 3VIAA 2J0JA 2PW9A 4FLHA 1JUQA 1T0SC 2BVCA 3ALBA 3AG4E 3Q8BA 3GE8C 2ZW0A 4XZ4A 2MQJA 4KHOA 2R2LA 3OHMB 2L0FA 5E6PA 2BB5A 2KWUB 3R3MA 2OV8A 5BW8C 4WNDA 3CLJA 5HFYA 2IF4A 2MBBB 3PHXB 2KWVB 4CYMD 5FT9A 3ULQA 1XR0B 1WR6E 2CU3A 4QJ4B 2Z59B 1U5EA 2AWTA 3DSSA 4D10C 4GZ5A 2WQ7A 2D9XA 4IOIE 4ZYNA 3UQAA 1ZXIA 5C23A 4GTOA 1MYOA 2PL2A 3TWQA 2INCC 2H7EA 2DZNA 3NOBA 4BX9A 2KMCA 2N9PC 1P6SA 2PZ1A 4RF1A 1VDVA 2QC9A 4R7LA 3ZJVA 2GBJA 3IHVA 4UI9J 3JYUA 4IWOA 1WY8A 3X0WA 2V5QC 3SNXA 2AX5A 4PT5A 3ZJTA 2F8YA 1TYGB 3Q3JA 3TEZA 3KEAA 3ZHEB 3KAEA 2BTEA 5BXOA 1C9FA 1V81A 4YDEA 2KZRA 1MIZB 4ANXA 2CU1A 4A55A 1MK9B 2MJEA 2FI7A 1YX5B 2HJ8A 2FUG1 1N4RA 2X6KA 2D9VA 4DX90 2IO2C 4BEPA 2K3UA 2KX3A 5FR6A 2KN5A 1F77A 1K8KG 1ZE3D 4U63A 4IM3A 2V5FA 1DGJA 1N60A 1OQYA 4DX5D 4OAVB 2KQSA 1DVPA 4JEUA 1DCEA 3CV0A 5IN7A 1RJ2A 4B0ZA 3I4GA 2Z0PA 2AQ3B 3N20C 2YSZA 5CRUA 3JCKC 1DYNA 2YS5A 1MI0A 4WUYA 1AW7A 4DX8A 1VZ8A 1J19A 1D3ZA 2WXHA 3NVZA 3TIXA 2RQ1A 2X38A 3AXCA 3ZN3A 2NTSA 2UZSA 2BT6A 2R2QA 2J42A 2VZKD 1KZGA 1JCSA 4U04A 3MPXA 3HK0A 3UINC 2ZCCA 3MHZA 1A5EA 2AXUA 2PQRA 3H7SA 2X6HA 3PRZA 1WX8A 2KVRA 1W1HA 4MM3A 4NPNA 3OJ3A 2EELA 4JHRA 3TWSA 1YQBA 3WAPA 5AZFA 2UWQA 2JWUA 1ZC3B 3TWXA 1ESFA 2JXXA 3PZDA 4EJNA 1INZA 3LVQE 3CVLA 5IOIA 2DHIA 4HRLA 4YDWA 5ITZF 4E3CA 2YT1A 3PH0C 1NI2A 3SI5A 2FDQA 1IUEA 3Q69A 1F0ZA 2QKMA 4HSIA 4MELA 4L6EA 4ZOHC 4D6WA 1KI1B 5H8YE 4A6FA 3CMMB 4JE3B 2OJRA 5AQBA 2UY1B 1N5XA 2JVCA 2Q5WD 1QLBB 3I63C 5TR5A 2KIGA 2V3SA 3FILB 4NQKE 3LY8A 3U8ZA 4DX6D 3U7ZA 4ACKA 1DDWA 3ZVRA 3FU0A 2LXCA 4W9FA 1GW6A 2ROVA 4JX1C 1E8WA 1DNPA 2F37A 2ADZA 4EQFA 1V61A 4U8HA 3BYYB 1PC2A 1GOZA 3J9CA 3DBHB 3ZDMC 3ZRCA 3DXEA 5JMND 5IP4D 3C98A 2KKCA 5CHWA 2KMMA 1WJ6A 3N30A 4HB5A 1U5GA 1H6OA 3FM8C 4LERA 5KNGA 2JPHA 4AP2A 1ZGUB 3DPYA 2DYOA 4MH8A 1R7SA 4DHJB 3QWWA 3RCZA 2LI5A 3IHYA 2JLBA 4MSQB 3PEGA 1MX6A 1JWUD 3OAWA 4AUQC 1FPPA 3VRAB 1E8ZA 4FHKA 3AJ4A 2DYBA 3NZ3A 2J4XA 4BERA 1BTNA 4US8A 3ASFA 2CJNA 1X1MA 2LXMA 4HI8A 4N2QA 4B6WA 5I4DA 2IQCA 1KF6B 4HROA 1OY3D 1H19A 1AQCA 4QFVA 1N4QA 1EAZA 2DFKA 4EZKA 5AENA 2RFAA 2LOXA 3HDXA 4A6HA 3RYTA 4XDCA 4OVZA 4JK8A 2AL6A 3AE1B 3Q8FA 4F1PA 4GDLB 3LY7A 3SFDB 4C0MA 5AN8A 1OQRA 5ENRD 2LJIA 3QWPA 2JABA 1V80A 3OG5A 5DIFB 1L7YA 5KNHD 4Y94A 3Q3OC 3VLFA 3ULEG 2N7JA 2K49A 4KZCA 3ODWA 2RG8A 1OEYA 2Y69E 4K5AB 4Q69A 5KQ4A 3GS2A 1UEFA 3RSEG 4GOUA 4JKEA 3AE2B 1R4MB 4K7UA 4MH0E 3C5RA 4A8XC 3B7BA 3DXKG 1WR1A 3N71A 4BAXA 3ONSA 4FN2A 4ANVA 1R4MI 5JJ6A 4JK9A 2UU7A 4GTRA 4TXQA 4X57B 2D07B 2W82A 3PZ3A 2OHFA 3KD7A 5ARFA 3SFEB 4K1RB 1TS2A 1SF0A 2YEPB 2N9LA 2AQ1B 3JXJA 4JKBA 5EE0A 1OCZE 4A1GA 4HPMB 2SEBD 5CRVA 3R2TA 4I6GA 3DSXA 2JUOA 2KX0A 4OZCA 3UIPC 3RUIB 4WAAA 1WJ1A 3O96A 4Q96A 3CHRA 3UZTA 3TWTA 5FQ7A 1TXDA 1ZU2A 3UMVA 1C79A 2BYEA 5DPSA 5IA7A 2BGFA 2LASA 2DYRE 1WI1A 3PEVB 4YT0B 4JVSA 2KGXB 4XEIG 3RRNB 4GZUA 5EE3A 3UM3A 1OTRB 3TAXA 1P98A 2E2XA 4MY6A 3NVYA 1F9JA 4MRUA 2DVWA 4KSKC 2EKEC 2WU2B 2W2WA 3H9DA 2K1FA 1PFDA 2YVCA 3FU3A 5AYWD 3D32A 1TKYA 4MJSB 1WFYA 2FBWB
chains in the Genus database with same CATH topology
2YRYA 2W2XD 3A9KB 1HB8A 1KT1A 4EZJA 3HM3A 5EX3A 1V49A 2DX5A 3FUHA 5FJYA 3RULA 4NJ7A 4DDGD 3D8EA 3FY4A 4H8SA 3QB2A 2RNRB 2MSED 4HDQA 3UF8A 5AJDA 4W9HA 1NU2A 1Y8MA 4GZ6A 5JP4A 2BF0X 3ZYLA 2WXLA 4N3CA 4K2OA 3HVEB 4A6KA 2C7NB 5JHBA 2GGFA 5ANLA 5G04C 3RKVA 1VCBA 3I3TB 3V61A 2L76A 1XX0A 4RVBA 4NAWB 4N5CA 3ZDTA 3R9AB 3L13A 5L95C 3QOUA 3A9JB 3VXWA 4HAWB 3SGHA 3NZUA 2O2VA 1SZ9A 3FU5A 3V5WA 4J0UA 3TBLD 1OWMA 4ILHB 2E0IA 2MRPA 5D6JB 3TG5A 4TRQA 4K2PA 2WXKA 2MFQA 5ARGA 4DDID 4W9IA 2OQBA 5LFAA 3A33B 3Q47B 1E8YA 3FEYA 4IN3B 2N4FA 3A9KA 1GGOA 2KFJA 2LGDA 4RG6A 3ZPJA 4ME2A 2XK5A 3ZNGC 4N39A 2IO3B 2CHZA 4JA9A 4B6HA 2HE7A 3WANA 2FAZA 2JWZA 2IFSA 2REXA 3TMPB 5DPTA 4EFOA 2C0MA 4LJOB 2LSUA 1S1QB 2M4NA 2YS1A 1WXSA 3MX3A 3VTUA 4BKSD 4Z2NA 4JKGA 1U29A 3H1UA 5J17A 3APCA 4I1OB 2LRUA 1TJ6A 3N32A 2OVFA 3D8DA 1FGZA 2LGYA 3OANA 2IONA 1EF5A 4FJYA 4F8CB 3A9JA 3PE3A 2DN6A 3GYPA 3OLMD 4WJ7A 3FTXA 2DTCA 3D9OA 1I7AA 5BV0A 1TQZA 5GMVA 2KTFA 3PT2B 2CG3A 4G2VA 2CAYA 4W9CA 2X6JA 3EIJA 3L17A 3QAQA 2IO1B 1NTIA 4HAUB 2L00B 3P2BA 4DHJD 4OVUA 3D9MA 1OWNA 1H2VC 3S7FA 2UZRA 4A6FB 5BO4B 2LG1A 3B7RL 1HF8A 3A8QA 1Y6IA 3ZYKA 4F7GA 2YHEA 1RFAA 4U0SA 3PNLB 2RUKB 3F5RA 2KJ6A 3PGEA 4ANWA 1UJKA 1YJ1A 2L9BA 2DIWA 2FJLA 2RGFA 2WYQA 4W9JA 1KC7A 4XKBA 4ICUA 3CVUA 1DBHA 4WVFB 2ZCBA 1W3BA 3ULCA 3RZFA 2WWZA 2BYVE 2KC2A 1V5UA 3IV0A 2N9XA 3APDA 2QHOA 3AU5A 3MV2B 3DQVA 3VOQA 2LVOA 2XPIA 3Q5MA 2P58C 1WIAA 2VSYA 1V5PA 3DVNV 2K2UA 5J3QA 1WGHA 3KUZA 2LAHA 4EECA 3JSVA 3IBEA 2K8HA 2HYZA 3VH3B 2GBRA 1V2YA 1OY2A 1BAKA 2AXZA 2IYDB 2MCNB 3W1YA 4K7WA 2D2QA 4ILJA 4BWRA 4GMXB 2CQUA 4IFSA 2I2OA 5FWQA 4RM9A 2WVIA 2L8JA 1EF1C 4G3XB 4DLOA 3SBSA 1IP9A 2MW5A 2PM7A 2WXFA 4IW0A 2CS4A 1B89A 3FTVA 2NS5A 2YNQA 2L3ZA 1Q1OA 1UJJA 4ABNA 3ML4A 5FI1A 4ATGA 5DH9B 2L1CA 3LEWA 3VTWA 2PE9A 3M1IB 3PEUB 3P1UA 5JJ7A 2LRWA 5D3WA 2L7RA 2IFUA 4L1BA 3APFA 3ECIA 1Z6TA 3W1SC 2UWJG 3FULA 1IPGA 3K9OB 4LJPB 1BT0A 3FUNA 4P7IA 4PQ0A 2JY6A 1WE6A 5LLIA 4JPSA 2GRMA 4IYPA 3QWVA 4I17A 1H8CA 1EPUA 3SF4A 3TG4A 2EJ8A 1U3DA 2W2XC 3CSTA 1P5QA 4IULA 3LJ3A 3GYOA 5DPWA 2IY1B 1HZ4A 5BV1A 3QDNA 2G4SA 2MX2A 3KW5B 3MDBC 4KVMA 3RO3A 1E7UA 2YHCA 3FTZA 4UQXA 2LAIA 2KLCA 3CHSA 4TYZA 2PZIA 1NBFC 4ACLA 1G6JA 5D0OD 2CFZA 2GBKA 3DXCA 3WXXA 2UVMA 1WXMA 4GPKA 5JHHA 5JHGA 3U4TA 2M1MA 1U5DA 4ICVA 5CCMA 3NF1A 1OWPA 1M94A 2KDBA 3UT4A 3ZKJC 1VBGA 2J4DA 4EKUA 4IOYX 3EHNA 4H7XA 4HB3B 4IRUA 3LYAA 3CVYA 2GMIC 2ZNVB 3QC8B 5G55A 4XI9A 3QHTA 5ENNA 2DKQA 1WMHB 3MV3B 1P3QU 4WJQA 2K6DB 1UBIA 5E6NA 3PSCA 5DBKA 2CG2A 4W9KA 4HK2A 2LULA 1U4AA 4JL9A 2DENB 2Q7FA 2COPA 5ANRA 4U07A 3SUZA 4APOA 2LSVA 3HM6X 1KLVA 4GPTB 1V5TA 1GC6A 2VSNA 1X05A 3NY5A 4JXTA 1HE8A 2DHJA 2I9CA 3PLUA 4HLEA 4CHJA 2ZZPB 4W9DA 2XK5B 2R82A 4ILIA 2FCSA 1FHOA 1LB1A 3JSVB 3DPDA 3RD2A 5G05C 4EBAG 4F3VA 2LVQA 3ZRFA 2KANA 3P7ZA 4ILGA 2IOSA 1E8XA 5EX0A 4I1MA 3MJWA 3QX1A 5HI7A 4WJOA 3EJNA 3ASDA 2FCMA 2MHKA 3UT7A 4G24A 1HX8A 3PLVA 2NSZA 3L54A 3Q49B 4GB9A 2XRZA 1FVFA 1WXAA 4NQLB 4L2YA 2DZKA 4LEUA 3PP2A 3FUKA 2DZIA 2FNJB 4PYZA 4L23A 2J4BA 1L2NA 2KM4A 4FC8A 4CEMA 2R2OA 1C3TA 1V9JA 4JA7A 1Z2MA 2UYZB 1HS6A 4YVOA 4JKGB 4HWIB 5JVLA 1E96B 4CYEA 4EZLA 2BPSA 1LFDA 4U0UA 2W9NA 2D3GA 2BKRB 2HRJA 3ZRHA 4JKCA 1B55A 2J07A 3TVVA 3FH7A 3GOEA 4J8EA 4B89A 3EHVA 4HVBA 4A3PA 1ZC4B 4J8SA 2XCBA 4RMAA 2KCJA 2M0XA 2WXGA 5LX8A 1VBHA 3MEKA 4JKDA 3ESKA 2AVPA 3S2AA 4DJAA 1ZSQA 4MSMB 3ULBA 3HW2B 2Y4TA 1HG5A 3L08A 4KHAA 3V6CB 1JPLA 3ENBA 4D0NB 2C2LA 3ZYMA 1FVHA 1ACAA 2KTRA 2P8VA 1Z3XA 2KZTA 3UX4A 2MA9B 5CHEE 4MT7A 2GW1A 2CHXA 3QKYA 2GOWA 1WGRA 2MRIA 3LXUX 3FTSA 3DVGY 2KD0A 2BF8B 3WIMA 5E76A 1IQUA 1IYGA 4EBAA 3KRWA 3ENEA 2WDTB 2XGMA 3BG1B 4L2LA 4BKSA 3EIQC 4HORA 1JWFA 4HB2B 2YS3A 2JT4B 2J0MA 4UWGA 3NQPA 3OJ4B 5KJMA 1TZ1A 2RD0A 3ONKA 2MOWA 4BOZB 2D9WA 2DHZA 4GZ3A 2Z0OA 1N54A 4NURA 4HAZB 4XKCA 3K9PB 2BTDA 4XE0A 1BPOA 4NY0A 4G0NB 1AARA 4HXDA 2V1YA 4DBGA 4XX5A 3RCPA 1WVHA 5FTPA 1XQQA 3D9KA 1RAXA 2LOZA 1SGHA 4MS6A 1UZXB 3G2TA 1P3RA 2KC7A 1Q0WB 1T0YA 4W9GA 1PMSA 2CRFA 3ML8A 4C0AA 3GZ2A 4I1AA 1PY1A 1U5FA 4WJNA 1HB6A 2KQ7A 3IEGA 3I5PA 4WNFA 4I6EA 4XI0A 3U3WA 1X11A 3OXFA 1UPQA 3QCAA 4I9EA 2H7DA 2D11A 2KATA 3FTWA 4CRWA 5J3TA 4MKTA 3A4SC 3H7PB 3CQCB 4TQ0A 2PQNA 4JEHA 2WXQA 3AU4A 4BBNC 3HYMB 4PNKA 3LY9A 3D3MA 2MP2A 3EPYA 2LWPA 3FUMA 3CHPA 2IU1A 3TW1A 1UD7A 2V8SE 2AYOB 4KT6B 4G23A 5E75A 3URZA 2ABDA 3UINB 3KY9A 1A17A 3WALA 4CHKA 4AP4C 2AXVA 1UELA 1GNUA 3PTFC 5T4YA 2CR5A 3PRMB 1FB8A 4WWOA 2R5SA 4GMJA 4MGKE 1PAQA 1R4NI 2GBMA 1FHXA 5JHAA 2MKRA 4M0WB 2I1KA 3AULA 4LDTD 4BT9A 1Z3YA 4IC7B 4GYWA 4B9KA 4FJVB 2X3MA 3WAMA 2FO7A 4HOTA 2LZ6A 3SNHA 4BFRA 2YINA 1OQNA 2NBWB 3VUWA 4WJPA 4G50A 4GYOA 2KJRA 2KCLA 3H6NA 2Y4UA 2LNIA 1I35A 4HCPB 3ZEFA 4KVOA 2VSZA 2Y7BA 4AY6A 1QZ2A 4GGQA 2K8CA 1U2BA 2JEKA 1HXIA 1EF1A 3HQCA 2J7QB 1OWOA 1SE9A 5C1ZA 4KHBB 5JJTA 3VTXA 4C9BB 4B8CB 2FEZA 3T5VA 4GMVA 4MGZE 3BY4B 1UBQA 2WQHA 1X86A 4PS3A 2XEWA 3V60A 4GZCA 4KBQA 5J90A 4JHKA 4LRZA 4LCTA 1E7VA 5KJKA 5CMWA 2KK8A 3T5XA 1NTVA 4LCDE 5HE2A 4GDKA 3E66A 3VTVA 4B95A 4DLQA 1QNFA 3T06A 3RRMB 1YA0A 1LM8B 3RO2A 3ML9A 4ZRIA 4J6IA 4FULA 4DI3A 4GIVA 5FZQA 3SHQA 5D3YA 4GYYA 3DVGX 2FBNA 3R66C 2Y8GA 3FEXA 4DWFA 2BWES 4W9RA 5AZHA 1WJ4A 3QARA 3LCAA 1LF8A 4JC8A 3FUIA 3KZ1A 3KH0A 1ZVRA 5HE1A 4GAAA 1GJZA 2ASQA 3FTUA 4AXHA 1XKEA 4GA1A 3O4ZA 3TCAA 2FIDA 4URKA 3BEEA 3LDZE 2EC1A 2N0YA 5FQ6A 4G25A 4KAXB 4CDNA 4B8AA 1H6KA 1DIKA 3IG3A 1Y19B 1H10A 2JRHA 2KC1A 5FQ8A 2MBHA 2IO2B 1EO6A 1OGWA 3FUDA 3AS5A 4HS2A 3WAOA 4WAFA 5HQ8A 3TO1A 1WXVA 2WXRA 3G2UA 5CHVC 1FAOA 3I3NA 3FUJA 4XIFA 4MJSA 4UQYA 4WNEA 4GN1A 4DPRA 2HR2A 2AWIA 3B7SA 2WQ6A 4Z2MB 4BKTA 3TXNA 2OOBB 4I6PA 2N7DA 3MTNB 3WA0A 2J08A 3VDZA 1UNPA 3A8PA 4BTAA 1ZM0A 1WF9A 1K5DB 4UI9K 4UWKA 2DIKA 2RR9A 2FIFA 4W9EA 5CMYA 4DHZB 5GOWB 2CHWA 3D9LA 2ZPYA 1UPRA 1SIFA 3X23A 1VD2A 2ONDA 4HHVA 4V3IA 3MA5A 2IZVB 1H0AA 3DXDA 3A4RA 3DBLI 2LD9A 4NAWA 2Y8FA 2ZNVC 3CIKA 1XD3B 2FCNA 4FA6A 1U3CA 1YD8U 3SBGA 3HVEA 3B13A 3GYZA 3UQBA 3FH5A 1WYWB 1NA3A 2ZPNA 5KJLA 5J2RA 4OYSA 2VGYA 4BY6A 3E4BA 3SFZA 2IO0B 3LKUA 2I5FA 1JDEA 2ZU6B 2NPTA 3KS2A 2N9EB 3VLDA 4A3OA 1IYFA 4EOYA 4KVGB 4WQOB 5HE0A 3PV1A 3ASHA 1WGQA 2G35A 3IVFA 3U7DA 5L81A 4GU2A 2O2VB 3DVNU 3JW0X 4E85A 2EMSA 3CXBB 2XGOA 2HTHA 3PPAA 2DHKA 3M3JA 5M72A 3PVLA 4IG7B 2LVPA 2X6FA 1UH6A 5CX3A 4G1TA 1EVHA 3RT3B 2FJ9A 3F0WA 4EEWA 3N3KB 1BWNA 2WXMA 3D9PA 3U30A 2DLWA 5T8IA 2ELBA 3E9PA 5AEKB 2NVUI 4KIKA 4BT8A 1HBKA 1KJTA 2X0SA 2JP2A 3OXLA 1X5BA 4HCNB 3QWZB 1HH8A 3SV1A 5AJLA 2KFKB 4MGYE 3UIPB 2LUEA 2XPZA 2I6HA 2MWNB 4AJYB 3SHFA 1M7RA 1WZ3A 3SBTB 1V6EA 2AEHA 4K81A 3FP5A 3S7BA 2WH5A 3LPZA 3TL5A 4O6FA 3SO6A 3D9NA 1P5TA 2GJYA 3NHEB 1GUAB 2MDXA 3QJZA 3UUXA 5D27A 1DROA 3PSEB 2M63A 2WXJA 3CHMA 1UGMA 3ASGA 2RLOA 3U9WA 3A1QA 2NMBA 3NSUA 2L2IA 2FULA 1EUVB 2LXAA 2O6VD 3R7QA 1ISNA 2N23A 1XCGA 1I2HA 4NQ0A 2K00A 2VTBB 1OUVA 2KHWB 2VRWB 3EFUA 5A7DB 4AJWA 2ROZB 1HG2A 4BX8A 4PS8A 2CKHB 4GZDA 5FI0A 3PVUA 4MDKE 4WWPA 4CCAA 5C6RA 1TEZA 4GCNA 4GCOA 3CGHA 2OVBA 4UQZA 2WMOA 1GC7A 4M8NA 3PNTB 2LGXA 4HPLB 2HM8A 3GZ1A 1LXDA 4ZRKA 2HO1A 2IJGX 3FEHA 2L0TA 4GA0A 2LKOA 3L22A 4AVXA 3SZ7A 3PVWA 3DBRI 1CMXB 5DHAB 4UWHA 2K2JA 3ZVVA 3NS8A 2PJHA 5D94A 2MLBA 3VVWB 5T3RA 4IUMB 4L7TA 3BG0B 3Q15A 2ILRA 2UY1A 5G05J 5EDSA 4GSWA 2VGXB 1V88A 2J49A 3QIJA 3CR3A 2EQXA 4IM0A 3QNKA 4BBNF 3TXMA 3LVRE 3VTYA 4Q94A 4HB4B 2OOEA 2NPTB 4BTBA 1W1GA 2L6JA 3O65B 4KXKB 5D3VA 3ZTCA 1H2UA 3CIAA 1WX9A 2KLGA 2YLMA 4Y6WA 4N9F4 4F7AA 4AWJA 1XD4A 1UNRA 2FUHB 3RIBA 2IBIB 4TV3A 4AY5A 3ZHEA 2Z0DB 3ZIMA 3N7CA 1GG3A 3KVFB 4XWXA 1FCHA 1UN9A 4FADA 4J8FA 2MBEA 1I42A 2XGSA 4JKAA 4KIKB 4KV2A 2DYNA 4JL0A 2L0TB 2FF4A 4RSYA 5JZEB 2JZ3B 3IHPC 3ESLA 3L10B 1Q5WB 4KYOB 2RSGA 4K17A 2VJ8A 4FU3A 2CFUA 4RG9A 2QY7A 2DX1A 4YONA 1Z87A 2XEVA 2M8SA 3PRPB 3ZLZA 4I43A 3FWVA 1IQRA 4CGVA 1ZBPA 5LCWJ 2J09A 2QKLA 1MQSA 2D9YA 2I5CA 3B7TA 2PE6B 2D10A 5EKQD 1S0PA 3UGBB 1J0WA 2GS0A 4UI9C 2IYBA 4CT4A 4BKGA 3JQ1A 2YQ8A 1NZNA 3QC1A 1H2TC 1MKEA 1WGUA 4KSLC 5DHFB 2WPVA 1LW3A 3ZNID 2IY0B 4DK5A 2JF5A 2KWCA 4I2WA 1WJNA 4E74A 1FXTB 4OVVA 4JQWC 3V6EB 1IRSA 1P0RA 2PM6A 2DYMA 2YT0A 2G3QB 3VFKA 2KOXA 4JLCA 1YX6B 1ZKHA 1N3HA 3FUFA 3ODXA 1A5RA 5DCNA 4LDTB 4I2ZA 3ZXSA 1SHCA 2KO3A 2VQ2A 1V5MA 4MGIE 4I6NB 1WH3A 3JUIA 3FFLA 4CHMA 5AZGA 4E6HA 1V89A 1TJFA 2A5UA 4PUCA 2FCQA 3ZNZB 4JKHA 5AIJA 2O6VB 2PEAA 1RLFA 3CQGB 4PH4B 4YNDA 3ZUNA 2D4QA 3QK0A 3JVZX 2K25A 3B1LX 2WMNA 1QC6A 1JWGA 1MAIA 4NRHB 5LXHA 2V4LA 3CF6E 3SDLC 2BYFA 2NXPA 4GA2A 5D7GA 2BKFA 4K0RA 2WXIA 4FBJB 5KHOA 3GZSA 1PFJA 4M3OA 1WM2A 3MHSD 5CHFA 1C1YB 4ZDVA 3GZNI 1L5JA 3DDCB 4GDLA 2GRLA 4GU5A 4A1SA 4C0EA 2DX5B 1KOTA 1XGWA 3RK6A 5A23A 4G11A 3KUDB 5J3YA 4DXAB 4N3AA 3SBTA 4K03A 1X1GA 4I6LB 4M8MA 2X18A 3UIOB 2DCPA 4DI4A 3ZFWA 1WX7A 2GBNA 4BSXA 2HD5B 2WXOA 4PDXA 3G2VA 2G45B 1ZW7A 2WM9A 1TTNA 2R59A 5KCMA 3BJIA 3CVQA 4AIFA 3E9LA 5D3XA 1WM5A 5D2MB 4XC2A 3KUCB 3E9OA 4ILHA 5D0QD 2C60A 3G9WA 2ELAA 3B0AA 4DHZE 3VHTC 1PQSA 3MYVA 3DCGA 2K8BA 1LQBA 1IHGA 4K7SA 1Y8RC 4P29A 4MK0A 4U0ZA 3ODOA 2VTBA 4B94A 2M14A 4II3B 5JH5C 3FUEA 1WAO1 3VH4B 3CVNA 4JKFA 1WI0A 4HOUA 5E6OA 3CVPA 3K9IA 5DPRA 2XRYA 1Z5SB 4BOSC 2WB2A 2NCNA 4TQ1A 3TGOA 3PUJA 5J18A 2EMTA 1NA0A 1FHWA 3H7PA 3L16A 3B7UX 2CODA 1W1DA 2KCKA 5HE3A 3FHEA 2XPYA 2KXJA 1P1AA 4UWLA 3ZYQA 4DBBA 4MLPA 3CEQA