3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
3AJ4A 5D3WA 3A9KA 3PS6A 1S3SG 3MDBC 4ANVA 4EZKA 3O65B 3CF6E 1WIAA 4RM9A 4GXBA 3UGBB 1R4NI 2YF0A 1WRDB 2VRRB 5CTRC 1NU2A 3VFKA 1EAZA 1UNQA 3WYFB 1RJ2A 2VKIA 4DDID 1ZC4B 3W1SC 2FIDA 2REXA 2KWVB 1SIFA 1RAXA 1V6EA 4GB9A 4K7UA 4HLEA 4K7SA 3M63B 2RVBB 1N3HA 1I7AA 2CRFA 4AJWA 2BPSA 3KUDB 2QKLA 2ASQA 4KDLB 2COPA 3DOWA 4BKSA 3ZIMA 4AWJA 4KDIC 2M14A 3QX1A 4PYZA 3ALBA 4KIKA 3NS8A 1WXMA 4OVVA 1UH6A 2D9XA 2LASA 3C0RB 1WFYA 2PJHA 2VRWB 2LRWA 2NBVB 5LLIA 1IPGA 4IM2A 1XR0B 1KZ7A 3ZVRA 2ZPYA 2AEHA 1WM2A 5KHOA 3DXCA 3ULCA 2MW5A 3OJ4B 2LVQA 2M8SA 1V5PA 1E5WA 4DHJD 5JP4A 3NY5A 1QZEA 2HRJA 4W9IA 2KTRB 1IRSA 2G45B 2I5CA 3FSSA 3KYDD 1X05A 1ZGUB 2YS1A 3DBLI 1HB8A 3DVNU 3A33B 4H8SA 4TKNA 4JIOU 5D7GA 2PE9A 1Q5WB 1WGRA 2BCJA 1WJNA 2DYNA 5J3TA 3H1UA 3FEHA 3QARA 3WALA 4MJSB 2Y8FA 1E8YA 3VH4B 1FB8A 2PZ1A 5JHGA 2N0YA 2KUPA 4GDKA 4HPMB 4LDTD 4WJOA 4OVUA 2V76A 1Y19B 3AI5A 3K9OB 1GC7A 3A9JB 2FJLA 2BKRB 4JL9A 2CAYA 4E71A 5DHFB 3BJIA 5E6OA 4HAZB 2KD0A 3IHPC 3JVZX 5JHAA 2CU1A 4A6KA 3VQIA 4DBGA 4HAYB 4KHBB 4MSQB 2DENB 1X86A 2BGFA 3HQCA 2GOWA 3KSYA 4ZRJA 3KW5B 2MBEA 2P8VA 2O6VD 1V49A 2LRUA 3IG3A 3AXCA 1S1QB 2CS4A 2P0FA 2L0TA 2Y5BB 5L83A 1V2YA 4FN2A 3R7RA 4IM3A 3UF8A 2UZSA 2K6QA 2RSUA 1P3RA 1MG8A 5HE2A 1WI1A 2CKHB 1MIZB 3CXBB 1FOEA 4BBKA 1Z87A 3DBHI 1NBFC 2JP2A 1UBIA 3PZDA 4IWPA 4Z2MB 2KANA 2MBOA 2ZVOA 4NJ7A 3KRWA 4MGZE 3BINA 3ODXA 3W1SA 5AZFA 2X18A 1YQBA 2DKPA 5D27A 4NQLB 3DDCB 1WXVA 4MGIE 3P2BA 2DKQA 2A5UA 1Q67A 1WM3A 2LOZA 3PHWB 3QA8A 3GYPA 5IA7A 1LXDA 2LULA 3M62B 4WWPA 4KIKB 1HBKA 1F9JA 2RPQA 1EO6A 2L3ZA 1SHCA 2IO3B 2K6DB 5BO4B 2GS0A 1Z2MA 2YRYA 1TZ1A 5HE3A 3WAOA 3EECA 2N7DA 4EEWA 3ZNID 1WGDA 1L7YA 2XEWA 2M17A 3V6EB 1FXTB 4XZ4A 1XD3B 3EFUA 3UQAA 1U5DA 2O2VB 3ZKJC 2FCQA 2L2IA 5LOPB 2MWSB 4ANWA 3L08A 1TXDA 4F7UP 5D2MB 3IFWB 2NMBA 2JRIB 1FHOA 4FULA 2QKMA 4C0AA 1H4RA 1NDDA 2RQ1A 4FLHA 5G2NA 2DFKA 2KOXA 1U29A 3V62A 5EFXA 3IBEA 1WY8A 1M7RA 1U27A 2RUKB 2IFSA 4RM8A 5KHQA 1I2HA 2DHZA 2UZRA 4KAXB 1D3ZA 1V5TA 2D3GA 3UIPB 4DHJB 5GOWB 5DPSA 2GBNA 5DPRA 4IUMB 3D32A 4ZYNA 3HM3A 4KSKC 4GDKB 4KV2A 1SGHA 1WGQA 2NBUA 3ZNZB 2D11A 3L16A 1XD4A 4MELA 3PG7A 3PREA 2YS3A 3O96A 4GMVA 1KJTA 3VDZA 4I6PA 3OJ3A 4K1RB 3QBVB 2N9PC 3JSVB 3A1QB 3W1YA 2XK5A 1V5OA 1P5TA 3VTVA 2KTRA 3ZVVA 3APFA 2G4DB 1H8CA 4LDTB 5J3QA 2ZJDA 1W1DA 3VAWA 1P6SA 5DHAB 2KDEB 3B1LX 2JRHA 4G0NB 2DAJA 2LD9A 1V81A 2ELBA 1I42A 4D0NB 2V3SA 3HK0A 2IBIB 2NCNA 3H7PB 5CLLB 2LVOA 3PVLA 3KRXA 3CMMB 3APDA 3EC8A 1NI2A 2ABDA 4HWIB 2AL3A 4AP4C 4P7IA 4GMXB 4G50A 3RCZA 3PLVA 2DAFA 4DK5A 2LYDA 1WJMA 2OQBA 3B08A 4PS3A 2O6VB 1XT9B 3VTWA 2JPHA 3HIZA 2KWCA 5C5BB 2JUOA 3PRZA 3GZNI 3KH0A 3H7SA 2MP2B 3QCAA 2UYZB 3DCGA 5DI9B 2EMTA 4IWOA 1YJ1A 4XX5A 3KZ1A 2WX1A 2FNJB 1GUAB 1MIXA 4HB3B 3ZDMC 3SO6A 1V86A 4B6HA 2Z0PA 3PV1A 4DXAB 2YT1A 2KGXB 5C16A 2MBBB 1LW3A 3G9WA 2KXJA 5C23A 1LB1A 1RRPB 5KCVA 2BYFA 2DTCA 2Z0EB 5J3YA 4GSWA 4WJ7A 3MJWA 4HDOA 2KZRA 5FR6A 3WA0A 3EHVA 1J0GA 3ZRFA 3A98B 2KWUB 3PRMB 1R4MI 2C7HA 1FHWA 2LI5A 3ZDTA 1PFJA 3AU4A 2PE6B 1WZ3A 3DXDA 4YL8A 4MGYE 3RUIB 4ZDVA 4IOYX 4FBJB 3KY9A 4TQ0A 3P7ZA 3JW0X 1E7UA 1V9JA 3DQVA 3RYTA 1EF1A 3S2AA 1XODA 3MPXA 3ZLZA 5DPWA 3RULA 2KQSA 4Y94A 1ZKHA 2ROVA 3L13A 1U5EA 2MKRA 4EOYA 4HATB 4HDQA 3R3MA 2GJYA 4MSMB 5C1ZA 4WJNA 2WWZA 1DROA 2ZPNA 4GDLB 1J0WA 3ZO5B 2Z0DB 2DZMA 3SD5A 2BF8B 2XK5B 5CHWA 5D6JB 3MHSD 1IP9A 2O2VA 2ZCCA 2PPHA 3QQ8B 2KK8A 2N4FA 2IYBA 2IYDB 3U8ZA 4MK0A 1G6JA 4W9GA 4F1SA 1WX7A 1NTIA 5J18A 4IC7B 2KDBA 2K1FA 4HHVA 4TUUA 2IO2B 1XCGA 2GCLA 4WWNA 1UEFA 1X1GA 3UINB 1ZW7A 4WJPA 3PEGA 1OMWA 5LXHA 2Y7BA 3K9PB 1WJ6A 3B0AA 2NPTA 2IY1B 4I6LB 4PYUA 3DVNV 4HJKA 2KX3A 4LJPB 4DX90 4AJYB 4HB2B 3VOQA 2KLCA 2RD0A 2DA0A 4GGQA 4MT7A 4HK2A 1LFDA 1QQGA 1FAOA 2D9VA 2KCJA 4ANUA 4IG7B 5CLQB 5AEKB 2ZZPB 4B95A 1YIWA 3R7QA 5CHFA 2JT4B 2DYMA 1TTNA 3JSVA 3A1QA 1UD7A 1DDMA 3OAWA 4HPLB 2J0JA 4AOFA 2FDQA 3D8DA 2K8BA 2N7EA 1WJUA 2JVCA 2J0KA 2G4SA 1V5MA 1VD2A 4CO7A 1AQCA 2N1WA 3D8EA 3SYXA 2DYOA 2HTHB 1T0YA 2LGYA 4M8NA 2LOXA 4HXDA 2K8CA 3ZUNA 4TQ1A 1TQZA 4HAXB 2KHWB 4NAWB 3H7PA 3ONSA 2WDTB 1EF5A 2J0MA 2MDXA 2AL6A 1BTNA 3ULBA 3Q3JA 2NS5A 2D4QA 3D8FA 3VH3B 4W9FA 3A8PA 1KZGA 5C6RA 2C60A 4LCDE 1TGZB 1Y8RC 2O6VA 2D9ZA 2CHWA 3SNHA 3LJ3A 5C5BA 4CYEA 1C1YB 1UELA 2DX5B 4YONA 5LONB 2MP2A 1NVLA 3T8MA 4KZ0A 1E90A 1KOTA 2Q13A 2MBHA 2KQ7A 2PEAA 1V80A 3PP2A 3OLMD 3SHQA 5E6PA 2R0DA 2MFQA 1P98A 2RGFA 1DDVA 5DIFB 4W9LA 2MCNB 1HE8A 4BKTA 1FHXA 2ZNVB 3L54A 2DX1A 1ZVRA 3OANA 3PVWA 5E6NA 2ELAA 2Z0QA 1TJ6A 3SDLC 3VUYA 2K2JA 2DHIA 3X0WA 4MDKE 4F7GA 4DX8A 2DHJA 3AULA 1M94A 1V89A 5JHHA 1ZSQA 3MTNB 3TJPA 4RMAA 4CHMA 3I3TB 2JY6A 1AARA 4G3XB 2CY5A 5JZEB 2BKFA 4GPTB 1Q1OA 2V4LA 2COAA 3WAMA 5JLJB 2KMCA 3ODOA 1RLFA 2NPTB 2OTXA 1UNRA 1EUVB 1E8XA 2IO0B 1C3TA 1XX0A 1DBHA 2C9WB 2HJ8A 2D9WA 2ZNVC 4HAVB 1LQBA 5LXIB 3T06A 4W9KA 1NTVA 1UNPA 3SUZA 2KJHB 2WYQA 3AU5A 3ML8A 1OGWA 4GDLA 2ADZA 1K8RB 2K8HA 1DDWA 3F0WA 2CB8A 1WR1A 3FLVA 4FJZA 4DWFA 1M7EA 4HCNB 1TBEA 1J8CA 2VSZA 2J7QB 4XWXA 3PTFC 4WQOB 2LBBA 2L7RA 2FJ9A 1LM8B 3DVGY 3FM8C 3WIMA 2YLMA 2YVCA 2JZZA 4PQ0A 1B55A 4G11A 3PLUA 4II3B 1WGGA 1WMHA 2BWFA 4IAPA 2IZVB 1WE6A 2R2QA 3QHTA 2AWTA 2XQNM 3M95A 4JLCA 2Z59B 2M4NA 4NY0A 2ZEQA 1I35A 2DYQA 2Y8GA 1OY2A 2CODA 2KLGA 3VUWA 5HE0A 2H7DA 2B3AA 3NOBA 1WVHA 3L17A 2EMSA 3M3JA 4IWQA 3BY4B 5JHBA 2JF5A 3PPAA 1JRUA 1P9DU 4M8MA 5EDSA 1PQSA 2M1MA 4Z2NA 3L0WB 1QC6A 2D2QA 2RGNB 5CX3A 2BYVE 2LUEA 5DCNA 2IY0B 2N23A 3ZW3A 1ISNA 2KFJA 2HTHA 3UIOB 2L8JA 2EJ8A 3U7DA 4EZJA 1BAKA 4XC2A 2FCMA 5D3VA 2KJ6A 3T9LA 2C7NB 4JGHB 3CSTA 4BKSD 3PT2B 4NAWA 3QWMA 2EKEC 4IFSA 2DZKA 1WE7A 4NSWA 2KTFA 4E74A 2V1YA 3APCA 3N32A 1YX6B 3PRPB 2KMAA 2I5FA 2LJ5A 3A4RA 2KJRA 2LWPA 2HD5B 2RSGA 4L6EA 5L95C 5TR5A 3V61A 2MLBA 2FAZA 2E2XA 5L81A 2K39A 2C7MB 1MK7B 2RLOA 1UPRA 3RZWC 2DX5A 4WVFB 4W9CA 1WX9A 2COCA 4NQKE 1GJZA 4BVUC 2CR5A 1HB6A 2GCJA 1WI0A 2P0HA 1MAIA 1W1GA 3TMPB 2M38A 4KZCA 5G55A 3ZTDA 4F7ZA 2W2WA 1CMXB 3EPYA 1X1MA 2Z0OA 2GBRA 1P3QU 3VVWB 4A20A 2KC2A 1XQQA 2DZIA 4GU2A 3KYCD 3V60A 4A3PA 5HE1A 1P0RA 4GZUA 1WGYA 4DHZB 2COFA 3Q3FA 1WJ1A 2FCNA 3VTUA 3JYUA 2MSED 2DZJA 2H7EA 2MWNB 2K2UA 2OJRA 3UQBA 2UWQA 4KHOA 1UGMA 4EUTA 1RFAA 1UZXB 2KNBA 4MH0E 4KHAA 4A5KA 3L10B 1KM7A 3WAPA 3KUCB 3NZSA 1MKEA 2BYEA 4CHJA 2J59M 3PSCA 4NNJB 1WGUA 2KDIA 3H9DA 2EC1A 2YSZA 4A6FA 1E8WA 1ST7A 4W9EA 4KSLC 5D3YA 2D9YA 4HAWB 4URKA 1AWEA 1UPQA 4F8CB 2W9NA 4HB0B 5GMVA 1WMHB 3RZFA 3ML9A 1WYWB 4EFOA 4ZRKA 5DH9B 4FHKA 2MBQA 5D3XA 2G35A 1EVHA 4K7WA 3NSUA 2JZ3B 2GBJA 3N3KB 3DBSA 1X11A 2N9XA 3QC8B 2DLWA 3A4SC 4M0WB 1ZC3B 3TW1A 4EJNA 1WG7A 1K5GB 4ANXA 2DN6A 4N9F4 4K2OA 2WX0A 3LJUX 2MQJA 2K25A 1BT0A 2LGXA 1H10A 2KX0A 4W9DA 4HVBA 2NBWB 3ODWA 5KQ4A 2G3QB 3IVFA 1PLSA 1U5GA 3VXWA 3A9KB 1OEYA 4NPNA 4TV3A 2FIFA 4ICVA 1L2NA 1P1AA 2LGDA 1GG3A 1OEYJ 2KVRA 3PGEA 2ROZB 4GOCA 3TBLD 4A6HA 2W2XC 2NZ8B 2MA9B 1A5RA 1OQNA 2CQUA 5KQ1A 1NTYA 4JQWC 2K00A 5D94A 2JWZA 1V88A 3R66C 3QK0A 4PS7A 1XKEA 3VUXA 5C79A 2LVPA 3ENEA 4IW0A 1WXSA 1BWNA 4CHKA 2FCSA 4WSFA 1MPHA 1V5UA 3PVUA 1WZ0A 2MX2A 2GMIC 2JXXA 4FADA 4FJVB 3HW2B 4X57B 3LDZE 4K2PA 2KO3A 3ZNGC 4K81A 4W9HA 2RNRB 2DYBA 4ZRIA 2L76A 1SE9A 1EGXA 4GN1A 2LKOA 5DPTA 3TL5A 3QAQA 4II2B 4E3CA 4ASWC 3QJZA 2KKCA 2LXCA 1RRBA 1Z5SB 4MY6A 3KVFB 1WGHA 3WANA 2MRPA 3A8QA 2ZCBA 1Y5OA 2C5LC 3KUZA 1KI1B 1ZM0A 4WAAA 2KFKA 2AYOB 1U4AA 5IJMA 3DBRI 2ZVNA 3CSFA 2RR9A 1FGZA 2FUHB 4K17A 1WF9A 3HHMA 1WX8A 3GYOA 4HB4B 2KC1A 3UZTA 5J2RA 2WH5A 1U5FA 5HKHA 2N1VA 2YS5A 4LJOB 1K5DB 4DHZE 1MK9B 2BWES 2P0DA 1W1HA 4FHJA 2LXAA 3VIAA 2I1JA 1WXAA 1OTRB 3SV1A 3FP5A 3TO1A 4A6FB 2HE7A 4KVGB 4HCPB 5CHVC 1IYFA 3HM6X 4MEMA 2R09A 3PHXB 4TYZA 2CHZA 4MM3A 1BTKA 4HAUB 3ML4A 3DXEA 1ACAA 2L0FA 4IM0A 1FGYA 1YX5B 1DYNA 4B6WA 3NZUA 2LZ6A 3NHEB 3CIKA 4PNKA 3TFMA 2KDFB 2L1CA 1WR6E 4W9JA 1X1FA 2IO1B 2L00B 2UVMA 1VCBA 3ECIA 4EKUA 3N7CA 4F7HA 3QWZB 4EZLA 4BFRA 3ZNHB 3V5WA 4I6NB 2GBKA 2YT0A 3V6CB 1GNUA 4J6IA 4BBNF 3SU8X 2W2XD 2CHXA 5J17A 1V61A 1GC6A 1U2BA 2CY4A 2N9EB 3DVGX 4FA6A 3M1IB 5IAAC 3ZRCA 3TVVA 5JH5C 3QIJA 2D07B 3DPDA 2KN5A 2NR2A 4BKGA 4NJ6A 1J19A 2DHKA 1YD8U 3RCPA 4DDGD 1UBQA 4EMOA 1E7VA 4BBNC 5FI1A 2L05A 4A3OA 3X23A 4B9KA 3RT3B 5AZHA 2GBMA 1PMSA 3ZTCA 2QHOA 2D10A 1OQYA 1KLVA 3TCAA 4MGKE 4MJSA 2A4ZA 3GOEA 1Q0WB 4GIVA 2R2OA 3PSEB 3F5RA 2NVUI 3VHTC 4FJYA 1WJ4A 4BOSC 1E8ZA 3A9JA 4DBBA 3N30A 1WH3A 4WWOA 2I1KA 4ICUA 2XBBC 3RD2A 2OOBB 3TIXA 2LG1A 3U30A 2KFKB 4AUQC 3P6AA 3H6NA 4BOZB 4PS8A 4WJQA 2M0XA 5FI0A 5AZGA
chains in the Genus database with same CATH superfamily
3AJ4A 5D3WA 5HFYA 3PZ8A 1MX4A 2IGHA 2FO7A 3A9KA 3PS6A 2QYUA 4BT9A 3MDBC 1S3SG 3KEZA 3BUAA 3Q5MA 5JA4D 4ANVA 2WHIA 1RWSA 4X8QA 4EZKA 5J08A 3CF6E 4GU5A 3O65B 4TXRA 1WIAA 4IRUA 4HRNA 4KMOA 4RM9A 4GXBA 1SA4A 3UGBB 3T3NA 1R4NI 1S0PA 5EN5D 3AE3B 3B2GA 2MRIA 1PGAA 3DWMA 5CERB 2YF0A 1WRDB 3NOGD 4ILGA 3LKUA 2VRRB 4IDIA 4YVQC 4DX6D 3DHGC 5CTRC 4DIXA 1NU2A 3VFKA 4IYPA 1EAZA 1UNQA 3WYFB 1RJ2A 3ZJUA 3B13A 3AEFB 3AE9B 3P1MA 3AEGB 2VKIA 3P1UA 4DDID 3D9KA 1ZC4B 3TG5A 3W1SC 1Q10A 2ZISA 3BEEA 3RNEC 4Q96A 2FIDA 3BVZA 2REXA 2SAKA 1LF8A 5BMGA 1UJJA 4GZ3A 2KWVB 4G23A 3DBRB 1L4ZB 3I57A 1SIFA 3G2TA 1RAXA 1AP7A 1V6EA 3SZ7A 1ELRA 4GB9A 4XI9A 3TAXA 3N9YC 2Y5CA 4HLEA 1XNFA 3ZHEA 4K7UA 1K53A 1A70A 4JPSA 4K7SA 2VGYA 1FNVA 3M63B 3NUHB 4ABNA 1WAO1 2E3TA 2I38A 3AAAC 3AE6B 1TR4A 2IEJA 3EJNA 3UUXA 2KT7A 2RVBB 5G5HA 4U8HA 2GUMA 1N3HA 1I7AA 4R3DA 2CRFA 4AJWA 1T3QA 2BPSA 4UQXA 3TWQA 2HDEA 5IKCM 1TY2A 5FK9C 3TEWA 3KUDB 3RNFC 5JVLA 2QKLA 2ASQA 4MACA 4KDLB 2COPA 2WQHA 4F53A 4HQDA 4WNDA 2I2OA 3OXFA 2DNFA 3DOWA 3HIEA 2N9LA 2RPVA 3AE7B 4WNEA 2XN9C 4BKSA 2BKKB 1LGRA 3ZIMA 2K8EA 2WVIA 1JQ4A 4AWJA 3TWSA 4KDIC 3FUKA 2M14A 3GP7A 1F2RI 1IHBA 2BUGA 1E9MA 2OVBA 3JXJA 4O6FA 3QX1A 5ITZF 4PYZA 1YMHE 4F7AA 3ALBA 1N5XA 3AV8A 4KIKA 3NS8A 2INPE 1JW9D 4OAUC 1FPPA 3NBNB 4OVVA 1WXMA 4XYCA 2F37A 1UH6A 2VSNA 2D9XA 2FF4A 2ILRA 2DYRE 4A55A 2LASA 1ZU2A 2V9HA 2F8XK 2W54A 4HROA 3C0RB 2VSXE 1WFYA 5CCMA 2PJHA 2PW9A 2VRWB 1OUVA 2LRWA 2NBVB 2Y3AA 4K3BA 1XF5L 1OCCE 5LLIA 1IPGA 4IM2A 4HRMB 1XR0B 3K9IA 1KZ7A 2K49A 2L83A 5A7DB 4DUIA 3ZVRA 1KZOA 2LNIA 2E0IA 3LXFA 1B1ZA 2ZPYA 2AEHA 3ENBA 1WM2A 1JCSA 5KHOA 1Y6IA 3DXCA 3ULCA 2MW5A 3OJ4B 2Y4UA 4JK7A 2LVQA 2M8SA 1OXJA 5G04C 3NWDA 1V5PA 1E5WA 4DHJD 5JP4A 4F3VA 3Q8CA 3W5UB 3NY5A 1QZEA 2HRJA 3D9PA 3HXEA 4M3OA 3S7BA 2EQXA 4GYOA 4W9IA 4L1RA 4A8XC 2KTRB 3RNCC 4AV7A 1FT2A 3C3OA 5KJKA 1IRSA 4REZA 3MV3B 2G45B 2I5CA 3FSSA 3KYDD 4O1OA 1X05A 4LERA 1YMPA 4U8VD 4LNKA 2BTDA 1ZGUB 2YS1A 2J9QA 4U7EB 3VLDA 1C4PA 3DBLI 1UGJA 4LNUD 5LG4B 1G3NB 1HB8A 2XEHA 3DVNU 1V1PB 3ZXVA 4EECA 3A33B 2PM7A 1T0RC 4TKNA 4H8SA 2WDRB 4JIOU 3V30A 5D7GA 5HHDG 3BG1B 2PE9A 3E37A 1Q5WB 4BTAA 5FQ4A 4C80A 1WGRA 1JPLA 4ARIA 3ZJTA 1ZXIA 2KC7A 2BCJA 1OWPA 2PL2A 1WJNA 2DYNA 3ZN3A 2UY1B 1BPOA 3FFLA 2WXFA 5J3TA 3H1UA 1ROEA 2PVOD 1IBXB 3FH8A 3FEHA 5ENRD 3QARA 3WALA 4MJSB 3PZ1A 1N0RA 2H6GA 3Q7AA 1E8YA 2Y8FA 3CKCA 3VH4B 3DSXA 1FB8A 2PZ1A 2DZOA 5JHGA 2N0YA 2KUPA 4XE0A 4GDKA 2QIEB 4HPMB 4LDTD 4OZBA 4WJOA 4OVUA 2V76A 1Y19B 4KX6B 3AI5A 3K9OB 1GC7A 4QAYA 5HG2A 2VGXA 4UI9C 2FO1E 3A9JB 2LXLA 1JRPA 5I4DA 2FJLA 2BKRB 4JL9A 3KS2A 3SNXA 2CAYA 4E71A 5DHFB 1NI3A 3BJIA 5E6OA 3QOUA 4HAZB 3D9MA 2WXLA 4AY5A 2KD0A 3IHPC 3JVZX 5JHAA 4V3IA 2WXJA 1FMAD 2CU1A 3UI3A 3Q9NC 3B2FA 3RMKC 4OHJA 1EU3A 5JJTA 3KD7A 4A6KA 5D0OD 1HZ5A 3VQIA 4MBGA 4DBGA 4HAYB 4KHBB 1F77A 4MSQB 2X6HA 5MPOA 2DENB 2MJEA 1X86A 3O4ZA 2BGFA 3HQCA 2Z8LA 4AVXA 2UU7A 1DCEA 4C9BB 2GOWA 4N2SA 3KSYA 3CLJA 3BVGA 4OW0A 2WNMA 4ZRJA 2XS8A 1ET9A 3KW5B 2MBEA 2P8VA 4J8EA 2O6VD 4EBAA 1V49A 3SY2A 4OAVB 2LRUA 3IG3A 2I2YA 1A17A 4L9PA 4JEHA 1LD7A 2V4IB 3AXCA 4MRUA 2INDC 1S1QB 3O13A 1QBQA 2X6JA 3HG0D 1K1AA 2P0FA 2CS4A 2L0TA 2Y5BB 5BYRA 1TKGA 3GZNB 5L83A 1V2YA 4JEUA 1EM7A 4FN2A 4DLQA 3R7RA 1YQ4B 4XKBA 2MOWA 5BMIA 3RO3A 2K9XA 4IM3A 3LPZA 3UF8A 2UZSA 1MJ0A 2K6QA 2RSUA 4DX2A 2BB5A 1P3RA 1VDVA 3I3NA 1MG8A 5HE2A 2OJWA 4LCTA 1WI1A 4U07A 1MIZB 3CXBB 2CKHB 5FINA 1FOEA 2LFIA 4BBKA 1Z87A 3MCXA 4CDNA 2Z14A 3DBHI 1NL4A 1NBFC 2JP2A 1UBIA 1WM5A 3PZDA 5LOZA 3G2VA 4GOUA 4IWPA 3URYA 2PIAA 4YTPB 4Z2MB 3GZ2A 2KANA 2MBOA 2ZVOA 4E85A 4NJ7A 2H88B 4LG6A 4HOSA 3KRWA 4MGZE 4A9AA 1WDYA 2KUQA 3FUEA 1EYHA 2Y0BG 4JKCA 2J52A 3ESLA 1FRDA 3BINA 1V97A 3ODXA 3AMZA 3W1SA 4ZYSA 5E75A 1EWYC 5AZFA 2X18A 1YQBA 3DWGC 2DKPA 1LD8A 4JD2G 5D27A 2LGIA 4NQLB 3DDCB 1WXVA 1C4CA 4MGIE 3C5RA 1UWXA 2P9LG 4NZLB 3CHRA 3P2BA 2DKQA 2A5UA 2Y1LE 1Q67A 4KGRA 4I2ZA 5HRYA 4CGWA 4CQNA 1WM3A 2BQQA 3LCAA 2LOZA 5AARA 3PHWB 3QA8A 3GYPA 5IA7A 1K51A 3OXLA 3E32A 1OCOE 1KLGD 2LULA 1LXDA 1ZPSA 3M62B 4XEIG 4A1SA 4WWPA 1T6BX 1N52A 4EQFA 4KIKB 1HBKA 5EX0A 1F9JA 2RPQA 1OQRA 1VBHA 3Q49B 5ANLA 3E9PA 4DLOA 1EO6A 2GB1A 2L3ZA 1R4MB 1S63A 1SHCA 1TY0A 2IO3B 1HF8A 4I43A 2K6DB 4GMJA 3D9OA 2NTTA 5E76A 2WXKA 5BO4B 4XKCA 4XDCA 3AM9A 2GS0A 4I6JA 2R17C 4EE2A 3FILA 1W3BA 1TYQG 1Z2MA 2PQNA 1N63A 3E9LA 3CWIA 5LFAA 2YRYA 1TZ1A 5HE3A 3Q8BA 4LTUA 3WAOA 3LS8A 3EECA 2YT2A 2N7DA 1RW2A 4EEWA 4LUNU 2KDMA 2BS2B 2QJLA 3E56A 4B0ZA 4K5BA 1WGDA 3ZNID 1O1SA 2CFUA 1L7YA 4JW1A 1YQ3B 3LY8A 2XEWA 4GA1A 3MA5A 4P29A 2M17A 3VTYA 1JWMD 2X38A 1NEKB 3V6EB 1FXTB 4XZ4A 1XD3B 3EFUA 1N4SA 3S7DA 4IKGA 3UQAA 1U5DA 2O2VB 1GAQB 3GE3C 3HVDA 1JWUD 3ZKJC 3Q79A 1DCQA 2FCQA 2L2IA 3RAUA 5LOPB 1PGBA 2MWSB 4ANWA 1TNZA 4I6GA 2M0AA 1VDYA 5AAOA 3H8HA 2K3UA 3I63C 1OCZE 3L08A 4CSQA 3EU5A 1TXDA 5FWQA 4F7UP 3AG3E 5D2MB 1O5MA 3IFWB 2NMBA 3R2IA 2JRIB 1FHOA 3ULEG 4FULA 3JUIA 2QKMA 4C0AA 1H4RA 3UM2A 4E6HA 4RNAA 3HVEB 1QZ2A 1NDDA 5G04J 2WXIA 2RQ1A 4FLHA 1VZ8A 4GTOA 5G2NA 1EF1C 2LAHA 2DFKA 5C1DA 4RSYA 4AIFA 2H6FA 5HKPA 2J09A 1TZOA 2KOXA 1L0XB 1U29A 1YA0A 3V62A 5EFXA 3IBEA 2WXMA 3RPFC 3MV2B 2P2CP 4OVZA 5CEAA 1WY8A 2IO3C 1M7RA 4C56C 1U27A 1K1BA 2RUKB 4DJAA 2IFSA 4CDRA 4RM8A 5KHQA 1I2HA 3N71A 3UI2A 2DHZA 2UZRA 4O1NA 4KAXB 1D3ZA 3JUEA 4FC8A 3TSSA 4GTSA 1V5TA 2D3GA 3UIPB 4DHJB 4XWWA 5GOWB 5CBOA 1K3ZD 5DPSA 1HEZE 3RNAC 1N4QA 1GB1A 4I9CA 2XPZA 2GBNA 4P16A 5DPRA 5ENOD 4EPZA 2AVPA 4IUMB 4YDWA 3DBLB 3D32A 4ZYNA 3HM3A 4KSKC 4GDKB 2BS4B 3C19A 4KV2A 2JLBA 1SGHA 2I6HA 1NENB 2P9UG 1WGQA 5EYLA 4CRWA 2JSVX 2NBUA 2R59A 1X81A 3AE5B 3ZNZB 2D11A 4HRSA 3L16A 2AXUA 3KWVA 1XD4A 1UNSA 4MELA 3PG7A 1EPUA 3PREA 3U9WA 3X2QE 2YS3A 3O96A 4WURA 3U4EG 4GMVA 1K50A 1KJTA 2IGDA 3VDZA 5B3SE 4I6PA 3V3XA 3Q47B 2ZU6B 3OJ3A 2FBWB 3R8BA 5D2MC 4K1RB 3QBVB 2Q5WD 2EIME 4J0UA 2N9PC 3C3QA 5AQAA 3P4PB 1N0QA 2NC9A 3NW8A 3JSVB 3A1QB 2XK5A 3W1YA 4OYSA 1V5OA 1P5TA 3VTVA 1UF0A 3SFZA 3U66A 2K0PA 3L82A 1UJKA 3ULQA 2KTRA 2RKKA 3D9NA 3ZUVB 3ZVVA 5AYWD 4UI9J 3FTUA 1O1RA 3APFA 2G4DB 1RM6C 5I2SA 3VRBB 2XGMA 2H6HA 3DHIC 2LSUA 2YNQA 1N94A 1HA5A 1H8CA 3UIPC 4LDTB 3J5PA 5J3QA 2ZJDA 4HOUA 1W1DA 1V1PA 1ESFA 2R03A 3VAWA 2ICIA 1P6SA 5DHAB 2KDEB 3B1LX 3Q3MC 1SA5A 1U2VG 3RFZB 4C7ZA 5EX3A 2JRHA 4G0NB 4JC8A 4C00A 2DAJA 2LD9A 3DWLG 1N95A 1V81A 1KF6B 2ELBA 1I42A 4D0NB 2L32A 2V3SA 3HK0A 4RLYA 4UWLA 5HI7A 4WIPA 2IBIB 3NRZA 2NCNA 3H7PB 4JKEA 5CLLB 3LJNA 4DX1A 2LVOA 3PVLA 2N7JA 3KRXA 1PFDA 4GPKA 2UY1A 3CVQA 3CMMB 3APDA 2RDGA 3EC8A 2OVFA 1YYHA 1FT1A 1KFYB 1NI2A 2ABDA 3WXXA 4HWIB 4FLBA 2ZGDA 3RK6A 5BXUA 2WS3B 1IBXA 2AL3A 4AP4C 4P7IA 1L4DB 3GE8C 5BNWA 4GMXB 4G50A 2ACZB 3RCZA 3PDNA 3PLVA 1NZNA 3E9OA 2DAFA 3HRDD 2NXPA 1WRIA 2DBYA 1FCHA 3FWVA 4DK5A 4F1PA 2LYDA 1WJMA 1MJDA 1HXIA 2MHKA 2OQBA 2VTBB 1SE2A 2LUMA 4PS3A 3B08A 2O6VB 4C0EA 1XT9B 4N3CA 1MI0A 1ZDXA 4B8CB 5EE0A 3VTWA 2VGEA 2OEWA 2JPHA 3HIZA 3KSLA 2KWCA 3NVZA 3T5XA 5C5BB 2JUOA 3QC1A 3PRZA 2IDYA 4HLLA 3GZNI 3KH0A 2IOSA 3H7SA 4JKGB 4CCAA 2MP2B 2J53A 2DIKA 2BF0X 3SBTB 1N62A 5EE9A 3QCAA 1GOZA 1N9AA 4LNNA 4K0RA 4HPPA 4B0EA 4TXQA 2UYZB 3T9KA 3DCGA 2VH2A 4Z68A 1OWLA 3ZGZA 3LYYA 5ENTD 5DI9B 2OV8A 1D8EA 2EMTA 1KH0A 4KHBA 4IWOA 1YJ1A 4IOIE 4XX5A 3KZ1A 2WX1A 2FNJB 3CVXA 1GUAB 2VZKB 1MIXA 2MJ3A 3FILB 4HB3B 3CK9A 3ZDMC 3SO6A 1V86A 4B6HA 3I4GA 2Z0PA 3PV1A 3NWAA 4DXAB 3FC4A 4PDXA 4HSIA 3EHQA 2YT1A 4N59A 5ARGA 1J7AA 3ZPJA 2KGXB 3ABLE 5C16A 1L6UA 3FH7A 2MBBB 3BZDB 1LW3A 3FKYA 3J9CA 3HXBA 2W3SA 3G9WA 2R5SA 3CQCB 1MHHE 2KXJA 2KMMA 5C23A 3CR3A 2KIEA 1LB1A 1RRPB 4HORA 5KCVA 2BYFA 1M4VA 4Y6CA 4NURA 5FQ6A 2DTCA 3TEZA 3VLEA 2Z0EB 2BBCA 5J3YA 3D9IA 4GSWA 1I4XA 4WJ7A 3MJWA 4HDOA 1YJIA 2KZRA 1HG5A 4GYYA 2XNAC 5FR6A 3WA0A 2WMOA 3EHVA 1J0GA 3FTVA 4JXTA 3A98B 3ZRFA 1UN9A 1P7FA 2KWUB 2X0SA 4N3AA 3PRMB 2V0GA 1GPXA 3SQVA 1R4MI 1FD6A 3UQ3A 3P4QB 4UQYA 1WWTA 2C7HA 2AW6A 4ZHOA 4G8KA 1FHWA 2G9HD 4AEZC 1SJHD 2LI5A 4LNBA 1D8DA 1Z3YA 2Y4TA 2P9KG 2PQRA 3ZJVA 1OCRE 3FULA 3ZDTA 2L6JA 3N20C 4WNGA 2VYIA 3F6QA 2J4XA 3ZKJA 3ASDA 1PFJA 3VR9B 3AU4A 3B77A 1TS3A 1WZ3A 2PE6B 3IXSA 3DXDA 4YL8A 4MGYE 3MZLB 2J8SD 1JCKB 5D3DA 3RUIB 2VJ8A 3I9V1 4ZDVA 4IOYX 4FBJB 2WXPA 2DWZA 1FVHA 3KY9A 2DBAA 4ILHA 4TQ0A 2DLBA 3ONLA 3P7ZA 3JW0X 4WH4A 4CYMD 1S70B 4AQ7A 3B7SA 1E7UA 1FFVA 5E6JA 3HVZA 1V9JA 2WDQB 1K8KG 3DQVA 3RYTA 1EF1A 1JROA 3QKYA 3S2AA 3VRAB 4R7LA 2M19A 1XODA 3UXGA 1EDUA 5KNHD 2L1AA 4GMLA 3MPXA 3ZLZA 2DWQA 5DPWA 2J49A 2QC9A 3QNKA 3RULA 2KQSA 4Y94A 1ZKHA 3DCXA 2ROVA 3L13A 1U5EA 3HDXA 4H7YA 3FTWA 2LO6A 2MKRA 2WM9A 1BXTA 3L4PA 1D9SA 3QDNA 3CQGB 4I2WA 4EOYA 5LCWC 4HATB 4PT5A 3E33A 4RG9A 4HDQA 2QSDA 3P42A 3R3MA 3CVUA 3AE8B 3ASOE 2GJYA 4NJCA 3V05A 4MSMB 3TWVA 1TKYA 2D3BA 5C1ZA 4WJNA 2WWZA 3JYSA 4QJ3B 1DROA 1HQRD 5HI1A 1N4PA 3AECB 4NACA 2ZPNA 4GDLB 1J0WA 3ZO5B 2Z0DB 2WXGA 3SD5A 2DZMA 2BF8B 2XK5B 5CHWA 1JUQA 5D6JB 3MHSD 4K5CA 1UUPA 1IP9A 2O2VA 5IOIA 1V1OA 5IY5E 1SW6A 1TS5A 1V54E 2PPHA 2ZCCA 3MKRA 3CV0A 2LHDA 2KK8A 3QQ8B 1AYFA 2Y69E 1NA0A 1MPEA 2N4FA 1BI8B 1N11A 3EGRA 4S17A 2IYBA 2IYDB 2DYSE 3U8ZA 4MK0A 1C4AA 1G6JA 3IT6B 4HFGA 4W9GA 4F1SA 2PZIA 2XHEA 1NTIA 1WX7A 3FVCA 5J18A 4IC7B 1MX2A 2KDBA 2IU1A 3ZQ4A 2K1FA 4HHVA 4TUUA 2KQ4X 3IT4B 3HVEA 4Q69A 2IQCA 1NYQA 1S64A 5FQ7A 2IO2B 1XCGA 2GCLA 3UKRG 4S0RA 4WWNA 1XLQA 4IULA 4UUCA 4K3CA 1TS4A 4JHRA 3BWUD 3PZ3A 4GYWA 3L9TA 1UEFA 3W9CB 1X1GA 5D66A 3UINB 1ZW7A 4WJPA 5FZSA 2R2LA 3PEGA 4I1AA 4KYOB 5FIOA 1OMWA 5LXHA 4JKFA 1HU3A 1P7EA 4I1OB 1UWMA 2Y7BA 3K9PB 4RGTA 1HTQA 1WJ6A 3B0AA 2NPTA 1B9RA 3EIJA 4XGAB 3FHEA 3FU0A 4M7CA 4UDUC 2PVGC 2IY1B 1N54A 4I6LB 4HJGE 4ZFHA 3ASNE 3TWXA 3DVNV 2EIKE 4HJKA 2LXMA 4P6VF 1EU4A 4PYUA 2KX3A 5H8YE 3FU6A 4LJPB 4DX90 1BUIC 5FR3A 4AJYB 1PC2A 4KT6B 4HB2B 5BYQA 1KBLA 3VOQA 2RD0A 4GAAA 2KLCA 5IRSA 2MYOA 2DA0A 4GGQA 4MT7A 4HKQA 5M72A 4HK2A 4TRQA 3KSQA 1GB4A 1L5JA 3ZYQA 1LFDA 1QQGA 2GRPB 1ZE3D 5FT9A 4PK1A 1FAOA 2YHEA 2KACA 1TKEA 2D9VA 2KCJA 1EWCA 4ANUA 4IG7B 5CLQB 3IKOB 3SBGA 1JWSD 3BQOA 5AEKB 2ZZPB 4WUYA 3TEXA 4RH6A 2F8YA 4B95A 3CVVA 1YIWA 3R7QA 5CHFA 4DRXE 2JT4B 2DYMA 1TTNA 4HEA1 3ZYYX 2DZNA 1FVFA 3CVLA 3I5PA 3OHMB 4GZDA 4LSZE 3AG4E 5M4YB 3JSVA 1JMLA 3A1QA 2IO2C 1UD7A 3OAWA 1DDMA 3CVYA 3HSAA 4HPLB 1IGCA 4N5QA 4OSNA 1DC2A 2J0JA 4N6EB 4AOFA 2YEPB 2FDQA 3AJIA 1H6KA 2YINA 3D8DA 2K8BA 2N7EA 3TXMA 4ZHPA 1QOGA 3UINC 4MT5A 1OFFA 2MH7A 1WJUA 2P9PG 2QDFA 2JVCA 2J0KA 4KKIA 2G4SA 1V5MA 1VD2A 4CO7A 1DOYA 2J07A 1AQCA 2N1WA 3D8EA 2AWIA 3SYXA 2DYOA 2WXOA 2WQYB 4JKHA 2WU2B 3RIBA 3Q78A 2WXRA 3DEPA 4EBAG 2HTHB 1T0YA 2IJGX 2LGYA 2V5FA 4M8NA 2IFUA 2LOXA 3KLSX 2YEPF 4HXDA 2K8CA 3ZUNA 4TQ1A 1F52A 2B6CA 4YT0B 4LK0M 1NI1A 4J7WA 3KWLA 1TQZA 4HAXB 4LNOA 2KHWB 2DVWA 2INNE 5HS0A 1TN6A 1VRAB 4NAWB 3NVWA 3H7PA 2R61A 3ONSA 2WDTB 3NOCD 1EF5A 2VQ2A 2J0MA 4GTQA 2MDXA 2AL6A 4ATGA 3GZ1A 1CZPA 2VZKD 2JZPA 1BTNA 3ULBA 2KCLA 4XI0A 3Q3JA 1C76A 2NS5A 1U3DA 2D4QA 2IONA 3CVNA 5ENNA 3D8FA 4GTRA 4JL0A 4HKZE 4W9FA 3VH3B 3A8PA 4MLPA 1ZBPA 1KZGA 2GROB 3EUVA 1H6OA 4NAMA 3JCKC 5C6RA 4JWUC 2C60A 4LCDE 4QXAB 5CCLA 1SB3C 1TGZB 2VTBA 1SSNA 1TS2A 4FU3A 3Q75A 1CK1A 1Y8RC 2O6VA 2VH1A 4JK8A 2D9ZA 1JCRA 4BERA 3U12A 2V5QC 2CHWA 3NS1A 2ETBA 3SNHA 3LJ3A 4ILHB 5C5BA 4CYEA 1MHXA 1C1YB 1UELA 2DX5B 3Q8FA 3AS8A 3MP9A 4YONA 5LONB 2N0SB 3E66A 4I9EA 3SGHA 3Q14C 2B0OE 5IN7A 1QOAA 4JKGA 4BSXA 2MP2A 5KJMA 1NVLA 3T8MA 4KZ0A 3SBTA 3BG0B 1ELWA 1E90A 1F1HA 1KOTA 2Q13A 3QWPA 3ABKE 2MBHA 4LRZA 2KM4A 3T8KA 2KQ7A 1D5XC 4CGVA 2VSOE 4GZ6A 1PGXA 4WAFA 3IXEA 1NA3A 1V80A 2PEAA 3MC0B 3MYVA 3PP2A 4ILJA 1MX6A 1MI1A 3OLMD 3ABVB 4OZCA 5FKAC 3SHQA 5E6PA 2R0DA 4JB8P 5GXGB 1FXAA 2MFQA 1TJCA 3BK2A 1V8CA 1P98A 1E7PB 2RGFA 3WCQA 3LYAA 1DDVA 2XENA 4J8FA 5ENSD 1KLXA 2H6IA 1RZ4A 1E96B 4OZAA 2RFMA 4B89A 1N61A 4A63B 5DIFB 3BIID 4W9LA 2MCNB 1HE8A 4BKTA 3O48A 3Q3NC 4ITKA 4J8YA 3B95A 2LMCA 1FHXA 2ZNVB 3L54A 4AY6A 3EHNA 2DX1A 2W82A 1ZVRA 1T0QC 3OANA 3T3OA 3PVWA 5E6NA 3TGOA 3TEYA 2KVZA 5AIJA 2X6KA 2XGSA 3TWUA 1E6EB 1QILA 2XGOA 2ELAA 3JXIA 3EHRA 1Z3XA 2VSYA 2FBNA 2GRLA 1SVXA 2Z0QA 1QNFA 2XZDG 3LDZA 5LCWJ 1TJ6A 3SDLC 4KXKB 3DXMG 3B7UX 3VUYA 3FEYA 3PE4A 2K2JA 2DHIA 2WDVB 4MDKE 4F7GA 3X0WA 4DX8A 2DHJA 3AULA 1M94A 1V89A 5JHHA 1ZSQA 1OY3D 1HZ4A 4NQ0A 3TJPA 3MTNB 4CHMA 4RMAA 3I3TB 2JY6A 1AARA 5BV0A 4JA7A 2C2LA 4G3XB 2CY5A 5JZEB 1JCQA 2BKFA 4N2QA 1NP7A 4GPTB 4WQMA 2QYJA 1STEA 1Q1OA 3ETRA 2FI7A 2V4LA 2COAA 4LNFA 3WAMA 5JLJB 2ETAA 2KMCA 3VTXA 3ODOA 2HTME 2BEDA 3RSEG 1C79A 1RLFA 3UTMA 3Q15A 2RDBC 2NPTB 3AEEB 3FUDA 1BLXB 3ONKA 2OTXA 5BT1A 2XPIA 1UNRA 2W55A 1EUVB 1E8XA 2IO0B 2QC8A 1XX0A 1WSPA 1C3TA 3JQ0A 3ZXSA 4PH4B 1DBHA 4ACLA 2C9WB 4JWSC 4JHJA 5EE1A 1H2TC 3ISMC 2XQ0A 2HJ8A 2D9WA 2MHJA 2ZNVC 4HAVB 1T5XD 4BT8A 1LQBA 2TSSA 4C4VA 3C8YA 2F0YA 1UW4B 1IHGA 3IAS1 2M63A 5LXIB 3I4RB 3T06A 4W9KA 1NTVA 1YNTE 3TWTA 3EUB2 1FCLA 4HOTA 4U95D 2WB2A 3PNTB 1V55E 3GS2A 1UNPA 4JVSA 4K5AB 4IN3B 3SUZA 1I4GA 3G2SA 4Q94A 2LEKA 1XXGA 5G05J 4G25A 4HBDA 3SFYA 3ZYLA 4P1BC 3DSUA 3TUOA 2KJHB 2WYQA 3AU5A 2QY7A 2RFAA 3ML8A 4PUCA 1OGWA 4GDLA 1XGWA 2ADZA 2DCPA 1K8RB 2K8HA 2J4BA 1DDWA 3F0WA 2D3CA 3EHMA 2CB8A 1WR1A 1P5QA 2AJAA 3MHZA 3FLVA 2BTEA 2JEKA 3IEGA 2CJNA 4FJZA 1J7BA 3FTYA 2WMNA 3NB2A 3SFXA 3AEBB 1HH8A 4KGTA 2JYTA 3HXDA 1TNUA 4DWFA 3Q9UC 4BY6A 1M7EA 4HCNB 4J8DA 1TBEA 1J8CA 1FFUA 2VSZA 5CEDB 3NZ3A 3U4TA 1Y56A 3FUMA 2J7QB 1N5WA 2XCCA 1AWCB 4XWXA 3PTFC 5H7PA 4WQOB 5AUKA 2FJUB 1MQSA 3AE2B 2CG2A 2LHEA 5DIZA 2LBBA 2L7RA 2GGFA 3C72A 4HS2A 1QF6A 2FJ9A 2QFCA 1MG4A 1LM8B 5LP0A 3AE1B 5T8IA 4RCOA 1D5MC 3PNLB 3ZRHA 3KEAA 3B7RL 3DVGY 3FM8C 3WIMA 4Y6WA 4A3TA 2YLMA 3U3WA 1OQQA 3WG7E 2QCZA 2X3MA 5JJ7A 3ASHA 2YVCA 2WXNA 2WGSA 1KC7A 1VZ6A 1GGOA 4BAXA 2JZZA 4PQ0A 1B55A 1QQEA 4G11A 2FULA 3CHMA 2R02A 3NAWA 1R7SA 3PLUA 4II3B 1WGGA 1WMHA 1Z6TA 4YVOA 3W5VB 2BWFA 1OWMA 4HOQA 3FTZA 4IAPA 2IZVB 2KYWA 2J42A 4O60A 4DXGA 4JKBA 1WE6A 2R2QA 3QHTA 1TJFA 2EILE 2KCKA 2ZXWE 2AWTA 2XQNM 4YDEA 1QLBB 4DQOC 3HYMB 3M95A 4JLCA 3J5QB 1C9FA 2JU6X 2Z59B 2M4NA 4NY0A 4USAA 3FEXA 2ZEQA 3AG1E 1I35A 3L6AA 2DYQA 1BI7B 1PYWD 2Y8GA 5CHEE 1OY2A 2AQ3B 2M56B 3KQ4A 5JMND 1IUEA 4CT0A 2WXHA 1FPYA 2CODA 2KLGA 3VUWA 4AS1A 4GNKB 5HE0A 4CDMA 2H7DA 5FI0A 2HJ1A 4YWGG 2B3AA 4JA9A 3FU5A 3L17A 1WVHA 3NOBA 2EMSA 2A5EA 3M3JA 3R9AB 4IWQA 1RFKA 1MVKA 4DX5D 2Z13A 3BY4B 5JHBA 3SFDB 2XEVA 2OEDA 5CECB 2RRFA 2JF5A 1KZPA 3PPAA 3EIQC 1JRUA 1P9DU 4UWFA 3A58A 2DIWA 2BT6A 3QB2A 1TT5B 4M8MA 5C2TB 1TN8A 5EDSA 2E6XA 1PQSA 3OG5A 2SEBD 4G26A 2IGGA 2M1MA 2N9KA 4DPRA 3Q73A 3D3MA 5AJDA 2C0LA 5FJYA 1IXVA 4B93B 4Z2NA 3L0WB 1QC6A 4QQIA 2D2QA 1BD8A 5ENPD 2RGNB 2ZW1A 5FQ8A 5CX3A 2BYVE 2LUEA 5DCNA 2KZTB 2HR2A 2IY0B 1MFWA 1GW6A 2N23A 3UM0A 4N58A 3FUFA 2CFZA 1PDXA 3ZW3A 5FZQA 2LGSA 1ISNA 5ENQD 3LVRE 2KFJA 1TNYA 4TSSA 1INZA 2HTHA 3LXUX 1YN4A 2L8JA 3UIOB 2EJ8A 1LO5D 1FIQA 3U7DA 4JK9A 3MKQB 5T3RA 4EZJA 1BAKA 2LJIA 4XC2A 2FCMA 5D3VA 5EIDA 2KJ6A 3T9LA 5B1AE 3ZYMA 2XS1A 2C7NB 3RKVA 2NTSA 4GCOA 4JGHB 3CSTA 1OWNA 4TXPA 5FTPA 5KCMA 3PT2B 4BKSD 4NAWA 1IKND 3QWMA 4GZ5A 3CHOA 2EKEC 4IFSA 2DZKA 2Q7FA 1WE7A 4NSWA 2KTFA 1SE3A 4E74A 2P9NG 3APCA 2V1YA 4YXDB 4A3VA 3N32A 1YX6B 5C3JB 3UT7A 4HB5A 1H2VC 4FXCA 1SF0A 1FNUA 5BV1A 3PRPB 2LUHA 5HQ8A 3E9SA 2RDHA 2KMAA 2I5FA 1I4RA 2LJ5A 3P4RB 1WYGA 3A4RA 3FTXA 4JKDA 4EHMA 1NFIE 2NSZA 4AM9A 3V79K 1VZ7A 2YHCA 2KJRA 2HD5B 2LWPA 2WLBA 3RN9C 3BYYB 4WNFA 2RSGA 3RRUA 2GRNB 4L6EA 5L95C 5EIBE 3CK8A 5TR5A 3V61A 2AXZA 3FP3A 4BESA 2MLBA 2FAZA 2J08A 2NYJA 3PEUB 2E2XA 3MEKA 4RVBA 5L81A 2EIJE 3UPVA 4ARCA 2K39A 2C7MB 1MK7B 1HFAA 3AH7A 2RLOA 3GYZA 3ZYKA 3LB8C 1UPRA 4RGOS 1YOVB 2R82A 2XRZA 2KN4A 2ONDA 4ZRPA 3RZWC 3FH5A 4ZRQA 1SEBD 1JWFA 4O1PA 2DX5A 4WVFB 3ASGA 1B89A 3CK7A 4W9CA 1VBGA 2V0PA 3DRAA 4NIKA 3SBSA 2COCA 1WX9A 4NQKE 1GJZA 4BVUC 4APOA 2IY0C 1TYGB 2CR5A 3DSWA 1HB6A 3CHSA 2GCJA 1C77A 1WI0A 4MM3B 1XLNA 1BU9A 2JABA 5CRUA 1MAIA 2P0HA 4D2KA 1W1GA 4BEPA 2V4HC 3VLFA 3TMPB 4XDDA 2EELA 5A6CA 2M38A 4KZCA 5G55A 1XEEA 3IV0A 3UIOC 5G5GA 5B1BE 4M02A 4C4VB 1XCTL 3GB1A 2H89B 1DGJA 3NQPA 1CQVA 3ZTDA 1ZDVA 4GTPA 4F7ZA 3B7BA 1X5BA 4TUMA 2P9IG 2W2WA 1CMXB 3EPYA 1X1MA 3Q3OC 2Z0OA 3ZEFA 1ZP0B 2GBRA 1WGKA 5BYSA 1P3QU 4W9RA 4DXFA 4B0MA 3VVWB 4A20A 3OXGA 2KC2A 1XQQA 2DZIA 4GU2A 3KYCD 4C7YA 3V60A 4A3PA 5HE1A 1P0RA 4GZUA 1WGYA 2AX5A 4DHZB 2COFA 3Q3FA 2WPVA 1WJ1A 2FCNA 3VTUA 1H19A 3JYUA 2MSED 2HO1A 2DZJA 2H7EA 2PKOA 5EE3A 2MWNB 2K2UA 2PMVA 1PY1A 2OJRA 4YTNB 4RGMA 3UQBA 4GCNA 2V3PA 3U2SC 3S7FA 4BX8A 2UWQA 1JWBD 4KHOA 1UGMA 4EUTA 3LY7A 1RFAA 1UZXB 2V8SE 3G2WA 3Q7FA 2L52A 2KNBA 4MH0E 3FTSA 4KHAA 4A5KA 3L10B 4L7TA 4CT4A 1FM0D 1HO8A 3BU8A 1KM7A 3UM3A 4N3BA 3W9GA 1C78A 3NVYA 3IHVA 3C98A 2LSVA 3LY9A 3QWWA 3ZGQA 1A5EA 4KGSA 2YQ8A 3WAPA 3KUCB 3NZSA 3FU3A 1MKEA 1TJEA 5ARFA 2BYEA 2XPYA 4YNDA 4KBQA 3CEQA 4G24A 4CHJA 1SJED 5IO9A 5CMWA 2J59M 1HX8A 3Q8EA 3PSCA 3Q6BA 4NNJB 1WGUA 2KDIA 3H9DA 2EC1A 3OWEB 4U96D 3LEWA 2YSZA 4P1CC 4MH8A 2XRYA 4B8AA 2KR0A 1E8WA 4A6FA 1ST7A 3EFCA 2GRQB 4W9EA 4KSLC 1H6PA 2KAJA 2CG3A 5D3YA 2D9YA 4A6QA 3SHFA 2WQ7A 3SI5A 2OHFA 4HAWB 1UG3A 2LAIA 3CVPA 4URKA 5D3IB 1AWEA 3DHHC 1UPQA 4F8CB 4OT1A 2W9NA 4HB0B 5GMVA 5DBKA 3KAEA 5G05C 1WMHB 3RZFA 3ML9A 3D9HA 3PEVB 1WYWB 3N1YC 4EFOA 4ZRKA 3D9JA 5DH9B 4FHKA 4US8A 2MBQA 5KNGA 5D3XA 2G35A 3ZXRA 1JDEA 1EVHA 1N6ZA 1AWDA 1FXIA 3UMVA 3RU0A 4K7WA 1XO3A 3VR8B 3NSUA 5KBAA 1ET6A 3LVQE 4GTVA 4C48B 3CIAA 4BSZB 2JZ3B 2GBJA 3N3KB 1VJKA 5IP4D 3DBSA 4G2VA 1QT9A 1WG0A 1I4PA 1N60A 1X11A 2OEVA 4UWGA 1TNBA 5ANRA 3I5JC 1KT1A 3PUKA 4XIFA 1XLPA 3BVMA 2N9XA 4RFBA 3E34A 3Q4AB 2KWDA 4H7XA 2XZTG 3QC8B 4L23A 2DLWA 3A4SC 4M0WB 1ZC3B 4LEUA 1HS6A 3TW1A 2GI9A 1E0ZA 4EJNA 1LTXA 1WG7A 1K5GB 1XLOA 4GPMA 3DSSA 4ANXA 2DN6A 3MC9A 4K2OA 4N9F4 2WX0A 4HI9A 3LJUX 2MQJA 2K25A 2MJDA 1BT0A 4A1GA 3RRMB 4YDYA 2LGXA 2JQRB 1H10A 3E4BA 2KX0A 1HXYD 5H92C 3HXCA 4GLSC 4W9DA 4HVBA 2KCVA 1JWAD 2NMQA 2NBWB 2BVCA 3C3RA 3ODWA 1IGDA 3GZSA 5KQ4A 1RYJA 2G3QB 3IVFA 3ESKA 1PLSA 1U5GA 1ACCA 3IHYA 1VR9A 3A9KB 1OEYA 4NPNA 3VXWA 4TV3A 2UWJG 2FIFA 5AQBA 5EILA 4ICVA 1L2NA 2WP9B 1P1AA 4U04A 4L2YA 2LGDA 1WXQA 1GG3A 1OEYJ 3L22A 2KVRA 3PO0A 3PGEA 2ROZB 4B94A 1L0VB 3AN1A 4GOCA 3TBLD 4U0SA 4A6HA 1DVPA 1VLBA 2W2XC 3HXFA 4UI9K 2NZ8B 3PZ2A 2MA9B 4YTMB 3P4SB 1A5RA 1OQNA 2CQUA 4NRHB 4GA0A 1NTYA 5KQ1A 3MJ5A 4ILGB 1DOXA 4JQWC 2K00A 5D94A 3PUJA 2JWZA 3SO8A 4QFVA 1V88A 5T4YA 2X8XX 3QK0A 3R66C 4PS7A 1XKEA 3U52E 2L0IA 3VUXA 4YSYB 5C79A 3AE4B 2LVPA 4C0MA 3ENEA 4GA2A 4JHKA 4IW0A 1WXSA 1BWNA 1FEHA 4CHKA 4I17A 2R2YA 2FCSA 4WSFA 3R9MA 2AQ1B 2EKIA 4RQIA 1MPHA 2PNNA 3FUHA 1V5UA 4ME2A 3PVUA 4UWHA 2ZGGA 1WZ0A 2MX2A 2GMIC 3DXKG 4FADA 2JXXA 5AQ7A 2Z59A 4AXHA 3ZHEB 2INCC 1ZYIA 4GZCA 3DEOA 4RF1A 4FJVB 3HW2B 4KVMA 4TMAB 4X57B 3LDZE 5A23A 3TG4A 4K2PA 2KO3A 1L5PA 3ZNGC 4K81A 1F0ZA 4W9HA 2IOLA 2RNRB 4APFA 5LNK1 2QZAA 4DI3A 2R05A 4ZRIA 1R4NB 2DYBA 2L76A 1SE9A 1DIKA 1EGXA 4GN1A 5BW8C 4BWRA 2LKOA 5AUIA 3ASFA 4BX9A 5DPTA 3TL5A 3QAQA 4II2B 1K52A 3HRAA 1UOHA 4E3CA 2FUG1 4ASWC 3U7ZA 3FUIA 3QJZA 2KKCA 3MX3A 1L6VA 1QQRA 3TWRA 2AQ2B 2CU3A 3FAHA 1D5ZC 2LXCA 1RRBA 1Z5SB 4ACFA 1OWOA 4MY6A 3RNBC 3KVFB 1WGHA 5AQ9A 3WANA 2MRPA 3MC8A 3A8QA 2W3RA 1O1TA 2FE8A 2ZCBA 3EDTB 1SE4A 3DSVA 1Y5OA 4Q2JA 2C5LC 1ZXHA 3KUZA 1IQUA 1IYGA 1KI1B 1ZM0A 1SIJA 3DSTA 2XEEA 5KWDA 4WAAA 2KFKA 5FZRA 2AYOB 3RRNB 4JKAA 2KBXA 5BUZA 5TSSA 1NVID 2QEJC 3ZXPA 1U4AA 3B7TA 3CHPA 4AP2A 5I2MA 2KZTA 2BB6A 5D0QD 2BKGA 5IJMA 3FUJA 1JALA 2IJ0A 2L6BA 3DBRI 4U0ZA 4ZHBA 4H2AA 2ZVNA 4M00A 3CSFA 5CBNA 2RR9A 1FGZA 1FRRA 2X6IA 2XCBA 3W9FA 1U3CA 2FUHB 3NWFA 2JWUA 4GTMA 4K17A 1TNOA 3PZ4A 2KIGA 1L0YB 1WF9A 3HHMA 3OTNA 3FDHA 4U0UA 1WX8A 3GYOA 4HB4B 2P58C 3MKQA 2KC1A 3UZTA 5J2RA 4JE3B 2OCCE 2WH5A 3RNGC 1U5FA 3AG2E 4ZOHC 4D10C 4HXIA 3AEDB 5HKHA 2N1VA 1SQMA 4QJ4B 2YS5A 2D3AA 4YSXB 4G1TA 3AEAB 4ILIA 1TEZA 3P63A 4LJOB 1K5DB 2J4DA 2HYZA 4DHZE 4UQZA 4GTTA 4FP7A 3RJVA 4N5CA 1MK9B 2K22A 2BWES 2P0DA 1CJEA 2E2EA 3G2UA 1W1HA 5BMHA 1ELKA 4FHJA 4I1MA 1ZUD2 2QILA 1SXTA 2JX5A 2LXAA 3Q2AC 5BPPA 4XWTA 3VIAA 2PM6A 3SFEB 4YSZB 3NG0A 2I1JA 2L9BA 1Z5SC 1WXAA 1OTRB 1FNWA 3SV1A 4G8LA 3FP5A 1YN5A 1IQRA 3TO1A 4A6FB 2CJOA 3CIRB 4JX1C 2D5GA 3T5VA 4ATZD 1ZB1A 2HE7A 5CMYA 4KVGB 4HCPB 5CHVC 1IYFA 3HM6X 2P9SG 3SF4A 2GLSA 1PUTA 4MEMA 4D6WA 2R09A 4RF0A 2GRMA 4BZAA 3PHXB 4BTBA 2RG8A 4TYZA 1JWGA 2GRIA 1HG2A 3R2TA 2EINE 3NF1A 2CHZA 3V2OA 4MM3A 4HI8A 1BTKA 4HAUB 3ML4A 2OOEA 5AN8A 1YCSB 2KATA 2JXTA 3DXEA 4A90A 1ACAA 2L0FA 4IM0A 1FGYA 1YX5B 1DYNA 2ONQA 3N1XC 1J7CA 3ZFWA 1ENFA 4WWMA 4B6WA 2WXQA 3NZUA 3W2DA 2LZ6A 3V31A 3NHEB 5KJNA 3CIKA 4PNKA 3TFMA 2KDFB 2BYTA 3HUIA 4J3OD 5C2YA 1KPSB 4CEMA 2ZKMX 3EU9A 4KKJA 3TWWA 2L1CA 1WR6E 2V3NA 4QJ5B 4W9JA 1F2RC 1X1FA 2IO1B 2L00B 2UVMA 3U64A 1VCBA 3ECIA 4EKUA 1SBBB 1TN7A 4ACKA 3N7CA 4F7HA 3QWZB 4YDOA 5JJ6A 2IF4A 2ON8A 4EZLA 2VGXB 3CVWA 2NBVA 3BK1A 4BFRA 3GW4A 4L1BA 3MGBA 5J90A 3V5WA 1UN8A 4I6NB 3ZNHB 2GBKA 2ETCA 2YT0A 2WU5B 4US9A 2WQ6A 3D9LA 3V6CB 3N1ZC 1GNUA 4J6IA 3ABME 4BBNF 3SU8X 2W2XD 4CZ2D 2ZW0A 3URZA 2CHXA 1T77A 1MYOA 3ULYA 3UX4A 5J17A 3UT8A 1HTOA 2AXVA 2ZIRA 1V61A 1GC6A 1NYRA 1U2BA 2CY4A 2N9EB 3DVGX 1FO4A 3QWVA 3FY4A 4FA6A 2K5PA 3M1IB 4GMRA 1KRHA 5CRVA 3UT4A 2IPKD 1Q2ZA 1YN3A 5IAAC 3ZRCA 3TVVA 3CGHA 1D6EC 3SR6A 5JH5C 3QIJA 2D07B 3DPDA 4M01A 1QKZA 1WY6A 1PAQA 2KN5A 5AJLA 4RGNA 1DOIA 2Y5PA 3RI7C 2NR2A 4U8YD 2PLPA 2GRRB 3Q8AA 3PH0C 4BKGA 4NJ6A 1AN8A 2I9CA 5EYPF 2C0MA 4MKTA 5EKQD 3S7JA 1J19A 1I7HA 2DHKA 1YD8U 2PTLA 4LNIA 2X6FA 3RCPA 4K03A 4UWKA 4DDGD 1HZ6A 2B76B 3ZU7B 5JXVA 4U63A 1DYQA 2L0TB 2Z4DA 1UBQA 4RG6A 1ZOYB 4EMOA 1E7VA 4HNAD 3AS5A 4MS6A 4BBNC 3AS4A 4I6EA 4DX7D 5LX8A 5FI1A 2BS3B 2QMTA 5BXOA 3DPYA 1FCCC 3V2XA 2GW1A 3CKBA 2L05A 2JYEA 4LNGA 4F6RD 4A3OA 3SEBA 1OT8A 3NJTA 4HRLA 3X23A 4L2LA 1KTKA 4B9KA 3CHQA 4KVOA 4LLGM 3RT3B 3IAM1 4N39A 5AZHA 2MEKA 3PE3A 2GBMA 3TXNA 1KLUD 1PMSA 3ZTCA 3BYTB 1N4RA 3JQ1A 3B9JA 1Y8MA 3MFGA 4BETA 2QHOA 2D10A 2HM8A 1OQYA 1KLVA 2FEZA 3TCAA 3Q69A 4MGKE 3EA6A 4JZYA 1QYMA 4MJSA 1H0AA 3UM1A 2A4ZA 3GOEA 3NVVA 1BMLC 1Q0WB 2R2OA 1QOFA 4GIVA 3PSEB 5KJLA 3F5RA 2G1EA 2NVUI 2BW2A 4M0WA 3VHTC 4FJYA 1I4HA 1DNPA 2KXPC 1WJ4A 4BOSC 1YJJA 1E8ZA 3AB5A 3A9JA 4DBBA 1E10A 3E30A 1WH3A 3N30A 2I1KA 4WWOA 3PZ7A 1T0SC 5AENA 4ICUA 2RMMA 2XBBC 3RD2A 3ZNGA 2OOBB 1MZCA 1MHQA 1H2UA 4DI4A 1SZAA 3TIXA 1D4BA 2LG1A 3U30A 4J8SA 2KFKB 3DBHB 3P6AA 3H6NA 4AUQC 4PS8A 4BOZB 1KT0A 1I4QA 3FUNA 1QOBA 1SZ9A 4WJQA 2HE0A 3UKUG 1TIFA 1XCQL 2M0XA 3RO2A 5AZGA 1AW7A
chains in the Genus database with same CATH topology
3AJ4A 5D3WA 2FO7A 3A9KA 3PS6A 4BT9A 3MDBC 1S3SG 3KEZA 3Q5MA 4ANVA 4EZKA 5J08A 3CF6E 4GU5A 3O65B 1WIAA 4IRUA 4KMOA 4RM9A 4GXBA 3UGBB 1R4NI 1S0PA 2MRIA 2YF0A 1WRDB 4ILGA 3LKUA 2VRRB 4YVQC 5CTRC 1NU2A 3VFKA 4IYPA 1EAZA 1UNQA 3WYFB 1RJ2A 3B13A 2VKIA 3P1UA 4DDID 3D9KA 1ZC4B 3TG5A 3W1SC 3BEEA 4Q96A 2FIDA 2REXA 1LF8A 1UJJA 4GZ3A 2KWVB 4G23A 1SIFA 3G2TA 1RAXA 1V6EA 3SZ7A 1ELRA 4GB9A 4XI9A 3TAXA 4K7UA 4HLEA 1XNFA 3ZHEA 4JPSA 4K7SA 2VGYA 3M63B 4ABNA 1WAO1 3UUXA 3EJNA 2RVBB 4U8HA 1N3HA 1I7AA 2CRFA 4AJWA 2BPSA 4UQXA 3KUDB 5JVLA 2QKLA 2ASQA 4KDLB 2COPA 2WQHA 4F53A 4WNDA 2I2OA 3OXFA 3DOWA 4WNEA 4BKSA 3ZIMA 2WVIA 4AWJA 4KDIC 3FUKA 2M14A 2BUGA 2OVBA 4O6FA 3QX1A 4PYZA 4F7AA 3ALBA 4KIKA 3NS8A 1WXMA 4OVVA 1UH6A 2VSNA 2D9XA 2FF4A 2ILRA 4A55A 2LASA 1ZU2A 3C0RB 2VSXE 1WFYA 5CCMA 2PJHA 2VRWB 1OUVA 2LRWA 2NBVB 2Y3AA 5LLIA 1IPGA 4IM2A 1XR0B 3K9IA 1KZ7A 5A7DB 3ZVRA 2LNIA 2E0IA 2ZPYA 2AEHA 3ENBA 1WM2A 5KHOA 1Y6IA 3DXCA 3ULCA 2MW5A 3OJ4B 2Y4UA 4JK7A 2LVQA 2M8SA 5G04C 1V5PA 1E5WA 4DHJD 5JP4A 4F3VA 3NY5A 1QZEA 2HRJA 3D9PA 4M3OA 3S7BA 2EQXA 4GYOA 4W9IA 2KTRB 4AV7A 5KJKA 1IRSA 3MV3B 2G45B 2I5CA 3FSSA 3KYDD 1X05A 4LERA 2BTDA 1ZGUB 2YS1A 2J9QA 3VLDA 3DBLI 1HB8A 3DVNU 4EECA 3A33B 2PM7A 4TKNA 4H8SA 4JIOU 5D7GA 3BG1B 2PE9A 1Q5WB 4BTAA 5FQ4A 1WGRA 1JPLA 2KC7A 2BCJA 1OWPA 2PL2A 1WJNA 2DYNA 3ZN3A 2UY1B 1BPOA 3FFLA 2WXFA 5J3TA 3H1UA 3FH8A 3FEHA 3QARA 3WALA 4MJSB 2Y8FA 1E8YA 3VH4B 3CKCA 1FB8A 2PZ1A 5JHGA 2N0YA 2KUPA 4XE0A 4GDKA 4HPMB 4LDTD 4WJOA 4OVUA 2V76A 1Y19B 3AI5A 3K9OB 1GC7A 2VGXA 4UI9C 3A9JB 2FJLA 2BKRB 4JL9A 3KS2A 3SNXA 2CAYA 4E71A 5DHFB 3BJIA 5E6OA 3QOUA 4HAZB 3D9MA 2WXLA 4AY5A 2KD0A 3IHPC 3JVZX 5JHAA 4V3IA 2WXJA 2CU1A 5JJTA 3KD7A 4A6KA 5D0OD 3VQIA 4DBGA 4HAYB 4KHBB 4MSQB 2X6HA 2DENB 1X86A 3O4ZA 2BGFA 3HQCA 4AVXA 4C9BB 2GOWA 4N2SA 3KSYA 3CLJA 4ZRJA 3KW5B 2MBEA 2P8VA 4J8EA 2O6VD 4EBAA 1V49A 2LRUA 3IG3A 1A17A 4JEHA 3AXCA 4MRUA 1S1QB 2X6JA 2CS4A 2P0FA 2L0TA 2Y5BB 5L83A 1V2YA 4JEUA 4FN2A 4DLQA 3R7RA 4XKBA 2MOWA 3RO3A 4IM3A 3LPZA 3UF8A 2UZSA 2K6QA 2RSUA 1P3RA 3I3NA 1MG8A 5HE2A 4LCTA 1WI1A 4U07A 1MIZB 3CXBB 2CKHB 1FOEA 4BBKA 1Z87A 3MCXA 4CDNA 3DBHI 1NBFC 2JP2A 1UBIA 1WM5A 3PZDA 5LOZA 3G2VA 4IWPA 4Z2MB 3GZ2A 2KANA 2MBOA 2ZVOA 4E85A 4NJ7A 3KRWA 4HOSA 4MGZE 3FUEA 1EYHA 4JKCA 3ESLA 3BINA 3ODXA 3W1SA 5E75A 5AZFA 2X18A 1YQBA 2DKPA 5D27A 4NQLB 3DDCB 1WXVA 4MGIE 3CHRA 3P2BA 2DKQA 2A5UA 1Q67A 4I2ZA 4CGWA 1WM3A 3LCAA 2LOZA 3PHWB 3QA8A 3GYPA 5IA7A 3OXLA 1LXDA 2LULA 3M62B 4A1SA 4WWPA 1N52A 4EQFA 4KIKB 1HBKA 5EX0A 1F9JA 2RPQA 1VBHA 3Q49B 5ANLA 3E9PA 4DLOA 1EO6A 2L3ZA 1SHCA 2IO3B 1HF8A 4I43A 2K6DB 4GMJA 3D9OA 5E76A 2WXKA 5BO4B 4XKCA 2GS0A 4I6JA 2R17C 1W3BA 1Z2MA 2PQNA 3E9LA 5LFAA 2YRYA 1TZ1A 5HE3A 3WAOA 3LS8A 3EECA 2N7DA 4EEWA 4LUNU 4B0ZA 1WGDA 3ZNID 2CFUA 1L7YA 4JW1A 3LY8A 2XEWA 4GA1A 3MA5A 4P29A 2M17A 3VTYA 2X38A 3V6EB 1FXTB 4XZ4A 1XD3B 3EFUA 3UQAA 3S7DA 1U5DA 2O2VB 3ZKJC 2FCQA 2L2IA 5LOPB 2MWSB 4ANWA 4I6GA 1VDYA 3L08A 1TXDA 5FWQA 4F7UP 5D2MB 3IFWB 2NMBA 2JRIB 1FHOA 4FULA 3JUIA 2QKMA 4C0AA 1H4RA 4E6HA 3HVEB 1QZ2A 1NDDA 5G04J 2WXIA 2RQ1A 4FLHA 5G2NA 1EF1C 2DFKA 2LAHA 5C1DA 4RSYA 4AIFA 2KOXA 2J09A 1U29A 1YA0A 3V62A 5EFXA 3IBEA 2WXMA 3MV2B 1WY8A 1M7RA 1U27A 2RUKB 4DJAA 2IFSA 4CDRA 4RM8A 5KHQA 1I2HA 3N71A 2DHZA 2UZRA 4KAXB 1D3ZA 4FC8A 1V5TA 2D3GA 3UIPB 4DHJB 5GOWB 5DPSA 4I9CA 2XPZA 2GBNA 5DPRA 4EPZA 4IUMB 2AVPA 3D32A 4ZYNA 3HM3A 4KSKC 4GDKB 4KV2A 2JLBA 1SGHA 2I6HA 1WGQA 4CRWA 2NBUA 2R59A 3ZNZB 2D11A 3L16A 2AXUA 1XD4A 4MELA 3PG7A 1EPUA 3PREA 3U9WA 2YS3A 3O96A 4GMVA 1KJTA 3VDZA 4I6PA 3Q47B 2ZU6B 3OJ3A 4K1RB 3QBVB 4J0UA 2N9PC 2NC9A 3JSVB 3A1QB 2XK5A 3W1YA 4OYSA 1V5OA 1P5TA 3VTVA 3SFZA 3U66A 1UJKA 3ULQA 2KTRA 3D9NA 3ZVVA 5AYWD 4UI9J 3FTUA 3APFA 2G4DB 2XGMA 2LSUA 2YNQA 1H8CA 4LDTB 5J3QA 2ZJDA 4HOUA 1W1DA 3VAWA 1P6SA 5DHAB 2KDEB 3B1LX 5EX3A 2JRHA 4G0NB 4JC8A 2DAJA 2LD9A 1V81A 2ELBA 1I42A 4D0NB 2V3SA 3HK0A 4UWLA 5HI7A 2IBIB 2NCNA 3H7PB 4JKEA 5CLLB 2LVOA 3PVLA 3KRXA 4GPKA 2UY1A 3CVQA 3CMMB 3APDA 3EC8A 2OVFA 1NI2A 2ABDA 3WXXA 4HWIB 4FLBA 3RK6A 2AL3A 4AP4C 4P7IA 5BNWA 4GMXB 4G50A 3RCZA 3PDNA 3PLVA 1NZNA 3E9OA 2DAFA 2NXPA 1FCHA 3FWVA 4DK5A 2LYDA 1WJMA 1HXIA 2MHKA 2OQBA 2VTBB 4PS3A 3B08A 2O6VB 4C0EA 1XT9B 4N3CA 4B8CB 3VTWA 2JPHA 3HIZA 2KWCA 3T5XA 5C5BB 2JUOA 3QC1A 3PRZA 3GZNI 3KH0A 2IOSA 3H7SA 4JKGB 4CCAA 2MP2B 2DIKA 2BF0X 3SBTB 3QCAA 4K0RA 2UYZB 3DCGA 1OWLA 5DI9B 2OV8A 2EMTA 4IWOA 1YJ1A 4XX5A 3KZ1A 2WX1A 2FNJB 3CVXA 1GUAB 1MIXA 4HB3B 3CK9A 3ZDMC 3SO6A 1V86A 4B6HA 3I4GA 2Z0PA 3PV1A 4DXAB 4PDXA 2YT1A 5ARGA 3ZPJA 2KGXB 5C16A 3FH7A 2MBBB 1LW3A 3G9WA 2R5SA 3CQCB 2KXJA 5C23A 3CR3A 1LB1A 1RRPB 4HORA 5KCVA 2BYFA 4Y6CA 4NURA 5FQ6A 2DTCA 3VLEA 2Z0EB 5J3YA 3D9IA 4GSWA 4WJ7A 3MJWA 4HDOA 2KZRA 1HG5A 4GYYA 5FR6A 3WA0A 2WMOA 3EHVA 1J0GA 3FTVA 4JXTA 3A98B 3ZRFA 1UN9A 2KWUB 2X0SA 4N3AA 3PRMB 1R4MI 3UQ3A 4UQYA 2C7HA 2AW6A 1FHWA 4AEZC 2LI5A 1Z3YA 2Y4TA 2PQRA 3FULA 3ZDTA 2L6JA 4WNGA 2VYIA 3ASDA 1PFJA 3AU4A 2PE6B 1WZ3A 3DXDA 4YL8A 4MGYE 3MZLB 3RUIB 2VJ8A 4ZDVA 4IOYX 4FBJB 2WXPA 1FVHA 3KY9A 2DBAA 4ILHA 4TQ0A 3ONLA 3P7ZA 3JW0X 3B7SA 1E7UA 1V9JA 3DQVA 3RYTA 1EF1A 3QKYA 3S2AA 4R7LA 1XODA 1EDUA 4GMLA 3MPXA 3ZLZA 5DPWA 2J49A 3QNKA 3RULA 2KQSA 4Y94A 1ZKHA 2ROVA 3L13A 1U5EA 3HDXA 4H7YA 3FTWA 2LO6A 2MKRA 2WM9A 3QDNA 3CQGB 4I2WA 4EOYA 5LCWC 4HATB 4RG9A 4HDQA 3R3MA 3CVUA 2GJYA 4MSMB 5C1ZA 4WJNA 2WWZA 3JYSA 1DROA 4NACA 2ZPNA 4GDLB 1J0WA 3ZO5B 2Z0DB 2WXGA 3SD5A 2DZMA 2BF8B 2XK5B 5CHWA 1JUQA 5D6JB 3MHSD 1IP9A 2O2VA 2ZCCA 2PPHA 3MKRA 3CV0A 3QQ8B 2KK8A 1NA0A 2N4FA 2IYBA 2IYDB 3U8ZA 4MK0A 1G6JA 4HFGA 4W9GA 4F1SA 2PZIA 2XHEA 1NTIA 1WX7A 5J18A 4IC7B 2KDBA 2IU1A 2K1FA 4HHVA 4TUUA 3HVEA 4Q69A 2IQCA 5FQ7A 2IO2B 1XCGA 2GCLA 4WWNA 4IULA 4JHRA 4GYWA 1UEFA 1X1GA 3UINB 1ZW7A 4WJPA 5FZSA 3PEGA 4I1AA 4KYOB 1OMWA 5LXHA 4JKFA 1HU3A 4I1OB 2Y7BA 3K9PB 1WJ6A 3B0AA 2NPTA 3EIJA 3FHEA 3FU0A 2IY1B 1N54A 4I6LB 4PYUA 3DVNV 4HJKA 2KX3A 3FU6A 4LJPB 4DX90 4AJYB 1PC2A 4KT6B 4HB2B 1KBLA 3VOQA 2RD0A 4GAAA 2KLCA 2DA0A 4GGQA 4MT7A 5M72A 4HK2A 4TRQA 1L5JA 3ZYQA 1LFDA 1QQGA 5FT9A 1FAOA 2YHEA 2D9VA 2KCJA 4ANUA 4IG7B 5CLQB 3IKOB 3SBGA 5AEKB 2ZZPB 4WUYA 4B95A 3CVVA 1YIWA 3R7QA 5CHFA 2JT4B 2DYMA 1TTNA 1FVFA 3CVLA 3I5PA 4GZDA 3JSVA 3A1QA 1UD7A 3OAWA 1DDMA 3CVYA 4HPLB 2J0JA 4AOFA 2FDQA 3D8DA 1H6KA 2YINA 2K8BA 2N7EA 3TXMA 1WJUA 2JVCA 2J0KA 2G4SA 1V5MA 1VD2A 4CO7A 2J07A 1AQCA 2N1WA 3D8EA 2AWIA 3SYXA 2DYOA 2WXOA 4JKHA 3RIBA 2WXRA 4EBAG 2HTHB 1T0YA 2IJGX 2LGYA 2V5FA 4M8NA 2IFUA 2LOXA 4HXDA 2K8CA 3ZUNA 4TQ1A 1TQZA 4HAXB 2KHWB 4NAWB 3H7PA 3ONSA 2WDTB 1EF5A 2VQ2A 2J0MA 2MDXA 2AL6A 4ATGA 3GZ1A 1BTNA 3ULBA 2KCLA 4XI0A 3Q3JA 2NS5A 1U3DA 2D4QA 2IONA 3CVNA 5ENNA 3D8FA 4JL0A 4W9FA 3VH3B 3A8PA 4MLPA 1ZBPA 1KZGA 3JCKC 5C6RA 2C60A 4LCDE 5CCLA 1TGZB 2VTBA 4FU3A 1Y8RC 2O6VA 4JK8A 2D9ZA 2CHWA 3SNHA 3LJ3A 4ILHB 5C5BA 4CYEA 1C1YB 1UELA 2DX5B 3AS8A 4YONA 5LONB 3E66A 4I9EA 3SGHA 4JKGA 4BSXA 2MP2A 5KJMA 1NVLA 3T8MA 4KZ0A 3SBTA 3BG0B 1ELWA 1E90A 1KOTA 2Q13A 3QWPA 2MBHA 4LRZA 2KM4A 2KQ7A 4CGVA 2VSOE 4GZ6A 4WAFA 1V80A 1NA3A 2PEAA 3MYVA 3PP2A 4ILJA 3OLMD 3SHQA 5E6PA 2R0DA 2MFQA 1TJCA 1P98A 2RGFA 3LYAA 1DDVA 4J8FA 1KLXA 1E96B 4B89A 5DIFB 4W9LA 2MCNB 1HE8A 4BKTA 3O48A 1FHXA 2ZNVB 3L54A 4AY6A 3EHNA 2DX1A 1ZVRA 3OANA 3PVWA 5E6NA 3TGOA 5AIJA 2X6KA 2XGSA 2XGOA 2ELAA 1Z3XA 2VSYA 2FBNA 2GRLA 2Z0QA 1QNFA 3LDZA 5LCWJ 1TJ6A 3SDLC 4KXKB 3B7UX 3VUYA 3FEYA 3PE4A 2K2JA 2DHIA 4MDKE 4F7GA 3X0WA 4DX8A 2DHJA 3AULA 1M94A 1V89A 5JHHA 1ZSQA 3MTNB 1HZ4A 4NQ0A 3TJPA 4RMAA 4CHMA 3I3TB 2JY6A 1AARA 5BV0A 4JA7A 2C2LA 4G3XB 2CY5A 5JZEB 2BKFA 4N2QA 1NP7A 4GPTB 1Q1OA 2FI7A 2V4LA 2COAA 3WAMA 5JLJB 2KMCA 3VTXA 3ODOA 1RLFA 3Q15A 2NPTB 3FUDA 3ONKA 2OTXA 5BT1A 2XPIA 1UNRA 1EUVB 1E8XA 2IO0B 1C3TA 1XX0A 3JQ0A 3ZXSA 4PH4B 1DBHA 4ACLA 2C9WB 4JHJA 1H2TC 2XQ0A 2HJ8A 2D9WA 2ZNVC 4HAVB 4BT8A 1LQBA 1UW4B 1IHGA 2M63A 5LXIB 3I4RB 3T06A 4W9KA 1NTVA 4HOTA 2WB2A 3PNTB 1UNPA 4JVSA 3SUZA 4IN3B 3G2SA 4Q94A 5G05J 4G25A 3ZYLA 2KJHB 2WYQA 3AU5A 2QY7A 3ML8A 4PUCA 1OGWA 4GDLA 1XGWA 2ADZA 2DCPA 1K8RB 2K8HA 2J4BA 1DDWA 3F0WA 3EHMA 2CB8A 1WR1A 1P5QA 3FLVA 2JEKA 3IEGA 4FJZA 3FTYA 2WMNA 1HH8A 4DWFA 4BY6A 1M7EA 4HCNB 4J8DA 1TBEA 1J8CA 2VSZA 3U4TA 3FUMA 2J7QB 2XCCA 4XWXA 3PTFC 4WQOB 1MQSA 2CG2A 5DIZA 2LBBA 2L7RA 2GGFA 4HS2A 2FJ9A 2QFCA 1LM8B 5LP0A 5T8IA 3PNLB 3ZRHA 3B7RL 3DVGY 3FM8C 3WIMA 4Y6WA 4A3TA 2YLMA 3U3WA 2X3MA 5JJ7A 3ASHA 2YVCA 2WXNA 1KC7A 1GGOA 2JZZA 4PQ0A 1B55A 1QQEA 4G11A 2FULA 3CHMA 3PLUA 4II3B 1WGGA 1WMHA 1Z6TA 4YVOA 2BWFA 1OWMA 4HOQA 3FTZA 4IAPA 2IZVB 4JKBA 1WE6A 2R2QA 3QHTA 1TJFA 2KCKA 2AWTA 2XQNM 3HYMB 3M95A 4JLCA 2Z59B 2M4NA 4NY0A 3FEXA 2ZEQA 1I35A 3L6AA 2DYQA 2Y8GA 5CHEE 1OY2A 4CT0A 2WXHA 2CODA 2KLGA 3VUWA 5HE0A 4CDMA 2H7DA 5FI0A 2B3AA 4JA9A 3FU5A 3L17A 1WVHA 3NOBA 2EMSA 3M3JA 3R9AB 4IWQA 3BY4B 5JHBA 2XEVA 2JF5A 3PPAA 3EIQC 1JRUA 1P9DU 4UWFA 2DIWA 4M8MA 3QB2A 5EDSA 1PQSA 4G26A 2M1MA 4DPRA 3D3MA 5AJDA 2C0LA 5FJYA 4Z2NA 3L0WB 1QC6A 2D2QA 2RGNB 5FQ8A 5CX3A 2BYVE 2LUEA 5DCNA 2KZTB 2HR2A 2IY0B 1GW6A 2N23A 3FUFA 2CFZA 3ZW3A 5FZQA 1ISNA 3LVRE 2KFJA 1INZA 2HTHA 3LXUX 3UIOB 2L8JA 2EJ8A 3U7DA 4JK9A 3MKQB 5T3RA 4EZJA 1BAKA 4XC2A 2FCMA 5D3VA 2KJ6A 3T9LA 3ZYMA 2C7NB 3RKVA 4JGHB 4GCOA 3CSTA 1OWNA 5FTPA 5KCMA 4BKSD 3PT2B 4NAWA 3QWMA 4GZ5A 3CHOA 2EKEC 4IFSA <