3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein/apoptosis
molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
2EJ8A 3T9LA 2EMSA 4IUMB 3N32A 2K6DB 1ZC4B 1P5TA 4K1RB 2I1KA 4X57B 4HDOA 5J3TA 5KQ1A 1WY8A 1K5GB 2COAA 3FLVA 1EO6A 2KJHB 2O6VA 2LUEA 3B08A 2NBUA 4ANVA 1OQYA 4HPMB 1UPQA 5J3QA 4HJKA 3KUDB 1ST7A 5CLQB 2J0KA 2GS0A 2C7NB 4L6EA 2KLCA 3O65B 3JW0X 1I42A 1LXDA 2JXXA 4F7UP 1Z5SB 3SD5A 2I5CA 2HD5B 1P3RA 3H6NA 2FCNA 3VUYA 3R66C 1Q0WB 3ZDMC 2DYQA 1VD2A 3DBRI 3A8PA 1BTNA 2GMIC 4LJPB 4HHVA 2GCLA 4HB0B 2COCA 3JYUA 2JRIB 2KXJA 1MAIA 5BO4B 1V80A 2D9WA 3GYPA 4MELA 1J8CA 2M0XA 4GZUA 2ZCCA 4CHKA 4K81A 2MKRA 3KYDD 2DZKA 2GBRA 2O2VA 3W1SA 2NVUI 2GJYA 3PHXB 3FEHA 1QC6A 4D0NB 2D2QA 3PLVA 2J0JA 3DVGX 2IO2B 3MHSD 3RZWC 4NY0A 4AUQC 2MBOA 1ZGUB 1Y8RC 1WIAA 5EDSA 4K7WA 4WJ7A 3QQ8B 3N3KB 2BWES 1WI0A 3HM3A 2Y8FA 4HK2A 2N1VA 1IYFA 1IPGA 4FN2A 2JY6A 1ACAA 1YX5B 3VQIA 2A4ZA 1WG7A 3D8FA 1R4NI 1P1AA 2LD9A 2K8HA 1WJ6A 3QARA 3ODWA 1Q5WB 2KGXB 5JZEB 5JH5C 2KFKB 1S3SG 2N7EA 2FJLA 2KC1A 1U29A 1QZEA 3WAPA 1QQGA 4FHKA 2KTRA 4HXDA 4B6WA 3V61A 3PVWA 1MIZB 2IFSA 2MLBA 3CSFA 3PRPB 4ANXA 4ZRIA 2ELAA 4PS7A 3ML4A 1KI1B 5D3YA 2KTFA 2ZNVC 5DPTA 3RUIB 1UZXB 2JPHA 4BFRA 3VVWB 3DXCA 1X11A 1WGYA 4HB4B 2AL3A 1RRBA 4DX8A 3VHTC 5C5BB 1WX9A 3W1YA 4CHMA 3GYOA 5CLLB 4IWOA 1WGUA 2GBMA 4EZLA 3P7ZA 1OGWA 3H1UA 4KZCA 2DAJA 2KDFB 3TIXA 1L2NA 3ULBA 5IJMA 2LVQA 4W9KA 3SDLC 2YS5A 5E6PA 3H7PA 2KKCA 4WSFA 2L00B 4KV2A 3X0WA 2N9EB 2BKFA 2EKEC 5JLJB 4A6FB 2RPQA 4EKUA 3KW5B 1UPRA 3WAOA 3UIOB 2LGXA 1BWNA 4DHJD 4FJYA 1TZ1A 3RT3B 4I6NB 2G35A 1E8XA 2L7RA 3ML8A 2YRYA 4GB9A 1XODA 2YVCA 3DQVA 1CMXB 2ZEQA 3SYXA 1WZ0A 5AZHA 4ASWC 2BCJA 3HM6X 4AJWA 2RR9A 2L0TA 1V5OA 2QHOA 3QCAA 2D10A 1WX8A 4DHZE 3R7RA 1ZW7A 2KJRA 2OTXA 3DBSA 4AOFA 3DBLI 3A9JB 4IM0A 1B55A 2Z59B 2AEHA 1IRSA 1LFDA 4RMAA 2MWSB 5LLIA 5G2NA 1FAOA 3CXBB 5FR6A 3QWMA 4K2OA 3DBHI 3U30A 1RLFA 3VH3B 4NPNA 2BWFA 2KCJA 5L95C 3ECIA 3VDZA 2MDXA 1KJTA 2MSED 2Z0OA 4W9GA 3DPDA 3ZVRA 1NU2A 3B0AA 3SU8X 1H4RA 2P8VA 4NSWA 3PZDA 4W9HA 2LKOA 2KZRA 3PPAA 2WYQA 4TKNA 1Q1OA 2WDTB 1X1MA 4M0WB 2PJHA 2Q13A 3LJ3A 4WWOA 3IFWB 1WGGA 2HTHB 5D7GA 2N23A 2FNJB 2D9ZA 3V5WA 2AYOB 1ZVRA 3SHQA 3QBVB 5JHBA 3ENEA 3PGEA 4HATB 3P6AA 5DPSA 4AP4C 2X18A 1V86A 4ZYNA 2Y8GA 2ELBA 2CHWA 2LRUA 5D3VA 3PTFC 2G45B 4ANWA 3RYTA 2DZMA 2MQJA 3VXWA 2FCMA 2LI5A 3FP5A 5E6NA 5IA7A 5AEKB 2DYBA 2KC2A 3WIMA 5LXHA 3HIZA 3AULA 4DBBA 3QJZA 2BPSA 3ODOA 2RGFA 3SV1A 1P0RA 1HB6A 5C1ZA 3FM8C 2KK8A 1W1HA 4GU2A 2D07B 2DAFA 3PS6A 4KDLB 3U8ZA 2M4NA 1C3TA 2UVMA 4MGIE 1AARA 2MW5A 2LXAA 4IM2A 4DBGA 3L08A 2QKLA 4GMXB 3UINB 3QA8A 2KN5A 2FAZA 4HCPB 4P7IA 2H7EA 4A3PA 4A3OA 4DWFA 4M8NA 4ICVA 3SNHA 1H10A 2GBKA 4WJQA 3WAMA 2D4QA 3M3JA 5G55A 4I6LB 2RUKB 5CHFA 3BJIA 1WE6A 3AU4A 1WGDA 3IVFA 2ZVOA 4K7SA 4GDLB 4ZRJA 1GNUA 1V5UA 3L10B 2JVCA 4XWXA 3V6CB 3RCZA 2M14A 3X23A 3H9DA 2R2OA 3ZTDA 3KVFB 4AWJA 1E5WA 1ZKHA 3A4SC 2RQ1A 2FCSA 4KVGB 2K25A 4GPTB 2LRWA 2NPTA 2IO0B 1X05A 4HCNB 4MGKE 2ZCBA 3ZO5B 5C79A 2UYZB 3N7CA 2VSZA 2DZJA 4G0NB 5DPWA 4LDTD 2P0DA 1BAKA 1WF9A 4K7UA 2N1WA 3ZLZA 3VIAA 2BYVE 1J0WA 3JSVB 4Z2NA 2LOZA 4DXAB 1WVHA 2KD0A 2XQNM 2WX0A 3PRMB 2KWVB 5D3XA 1OMWA 5DCNA 1BTKA 3NY5A 4KDIC 2KFJA 4KHAA 1XD4A 1YQBA 2C9WB 1YX6B 3MTNB 1MK7B 4CYEA 3L17A 2LG1A 1XD3B 3RD2A 2VRWB 2J59M 1WJ4A 2N9PC 3PG7A 2OJRA 2D9YA 4F8CB 3ZRFA 1WXAA 3F5RA 1YJ1A 1TJ6A 1WR1A 5CTRC 5JHAA 1TXDA 1WXSA 1ZC3B 4A5KA 3TCAA 3PSCA 3DVNV 4ANUA 4HB2B 4KAXB 1UGMA 5D94A 2MRPA 1WM3A 4JQWC 1UH6A 4NAWA 4WWPA 5DHAB 2C7MB 1W1GA 1WH3A 1M7EA 1ZSQA 4AJYB 4A6KA 4F7HA 2WWZA 3AU5A 2N7DA 1C1YB 2FCQA 3VUXA 1NDDA 2DKQA 2KMCA 2KDBA 3UQAA 2YT0A 5JHHA 2O6VB 3I3TB 2D9VA 2WH5A 3UZTA 1KLVA 2FJ9A 3VTUA 1U5DA 4XC2A 4A20A 2K8CA 1EF5A 3UIPB 3KRXA 1J19A 1X1GA 2NPTB 2AWTA 3A33B 3GOEA 3KUCB 5CHVC 1HB8A 3FSSA 3QX1A 3NHEB 3ZUNA 2IY1B 2HRJA 1UELA 3A4RA 1WZ3A 1YD8U 4PS3A 2CHXA 5LONB 1WXMA 4JL9A 3QIJA 1MPHA 1VCBA 5J18A 2KANA 1XR0B 3A9KA 4WJOA 1NI2A 2K1FA 2I5FA 4IM3A 4TQ1A 4KSKC 1EAZA 4MT7A 2LYDA 4NQLB 2LWPA 2N9XA 4FADA 1DDWA 1WMHA 4WWNA 1WX7A 4FHJA 1UBIA 1E8ZA 2V1YA 2YF0A 1DDVA 1LM8B 4C0AA 1XQQA 1V61A 4W9CA 2DYMA 4ICUA 2DN6A 1RAXA 4MM3A 3VH4B 4BKTA 1WJ1A 4GDKA 3HHMA 1BT0A 3TW1A 2O2VB 2KUPA 2MP2A 1P9DU 2XK5A 1FB8A 1I2HA 1V5TA 4BKSD 2CAYA 2QKMA 3V60A 1WGQA 1NBFC 4RM8A 4EZJA 2JF5A 3T06A 5JP4A 2YS1A 3ALBA 5J17A 5HE0A 2AL6A 2RVBB 3M62B 2GBNA 2LGYA 2R0DA 2OQBA 5JHGA 2V3SA 2COPA 4ZDVA 2FIDA 1G6JA 4KIKA 2KDIA 2M17A 3DOWA 5DIFB 3OLMD 2KWCA 2JUOA 3PV1A 3DXDA 2KJ6A 3DVGY 3PRZA 1DBHA 1X1FA 1WM2A 5L83A 2FUHB 2JWZA 3P2BA 3S2AA 2R09A 3OANA 3EFUA 4BBNC 2LZ6A 2KTRB 2DYOA 3EC8A 4MH0E 1K5DB 2N0YA 1EF1A 2PE6B 1V2YA 1E90A 5J3YA 2ZJDA 2RNRB 3JVZX 4GGQA 2L05A 2O6VD 3RZFA 3A1QA 2DA0A 4TQ0A 1LB1A 2CU1A 2LVOA 2DX5A 4G3XB 1WMHB 2KQSA 2ROVA 2NZ8B 1UD7A 2LJ5A 2CY4A 2YT1A 2JP2A 2L2IA 5HE1A 4EMOA 1X86A 4IFSA 2CS4A 2LASA 1D3ZA 2J7QB 2L76A 2ZPYA 3PHWB 2XBBC 1V49A 3VTVA 2LVPA 4MJSA 2IO1B 3PT2B 2CHZA 5D2MB 1UNPA 4GMVA 4GIVA 3IHPC 2MA9B 1U4AA 5DI9B 3H7PB 2DTCA 5DPRA 3D32A 3M63B 4BOSC 3ZKJC 2EMTA 4OVVA 2LULA 4NNJB 2ZVNA 3O96A 2CODA 2Z0DB 1XKEA 1SGHA 1V5MA 4DDGD 3CIKA 2LBBA 3QK0A 4M8MA 1OTRB 3IG3A 4MY6A 3N30A 3VFKA 2LGDA 1UBQA 1PQSA 3A98B 3DDCB 3ZVVA 3AXCA 3M95A 1N3HA 1FGYA 1H8CA 1UNQA 3D8EA 3NOBA 1WE7A 1Q67A 1V88A 3RULA 3UF8A 2BKRB 2IO3B 3KUZA 4HVBA 1PFJA 4W9EA 4GOCA 1Z2MA 1V6EA 3Q3FA 2DFKA 2V76A 4G11A 3QWZB 4WJPA 3EPYA 4XZ4A 4F1SA 1JRUA 2ABDA 1LQBA 3PREA 3KRWA 3DCGA 2M8SA 3R7QA 2D11A 2V4LA 4BKSA 3PSEB 4Z2MB 1UNRA 2DHIA 1J0GA 3L0WB 5GMVA 2YSZA 1P6SA 1KZ7A 2N4FA 1MG8A 3DVNU 1FHOA 2G4SA 3D8DA 4PS8A 3HK0A 3MPXA 1GUAB 3ULCA 1ZM0A 2MX2A 2W2WA 4MSMB 3A8QA 1U27A 4DK5A 4B9KA 3T8MA 1WGRA 1NTIA 4W9DA 2VKIA 2KDEB 3KH0A 1XT9B 1V81A 2Y5BB 2DKPA 1WFYA 1LW3A 2D9XA 3SUZA 2CQUA 2W9NA 3M1IB 5AZGA 4HAYB 2WX1A 4IC7B 4IWPA 4MGYE 1FOEA 3NZSA 4IWQA 2IZVB 1U5FA 2JZZA 2NMBA 2KNBA 2RGNB 1SE9A 5TR5A 1W1DA 3PEGA 1ISNA 4PYUA 2PEAA 2GBJA 4BBKA 1WJNA 3APCA 4HB3B 5HE2A 2NCNA 3UQBA 4URKA 3U7DA 2VRRB 3V62A 2REXA 4WQOB 4GN1A 1DDMA 1TGZB 3ZNZB 4RM9A 2H7DA 2BYEA 2K6QA 1V9JA 2KFKA 2DZIA 2PPHA 4FJZA 2DHZA 5KHQA 2NR2A 5J2RA 3WANA 4FLHA 4IG7B 4G50A 4W9LA 1WJMA 2RD0A 2MBEA 4HDQA 2K2UA 1E7UA 3C0RB 4H8SA 1WGHA 2G4DB 4W9FA 2Z0PA 1XCGA 4B6HA 4GXBA 4DHZB 3AJ4A 1OEYJ 3PVLA 2A5UA 2OOBB 1M7RA 5GOWB 4YONA 1EGXA 3NS8A 1NTYA 5DHFB 4DHJB 1K8RB 4E71A 2CY5A 4J6IA 2I1JA 2M1MA 5C5BA 4PQ0A 2K00A 1A5RA 5EFXA 2JT4B 1NTVA 2ZPNA 2ADZA 4PYZA 1KOTA 2G3QB 4NJ6A 4JIOU 1WRDB 1PLSA 2K39A 1MK9B 3WALA 4BKGA 1PMSA 4TUUA 3ONSA 2MBBB 2PZ1A 3G9WA 4A6FA 4HAXB 3V6EB 3UGBB 5D3WA 2J0MA 3MDBC 1FHWA 3PP2A 2CR5A 3TJPA 4E74A 1WXVA 2KOXA 3LJUX 1GC7A 4GSWA 1MKEA 4W9JA 5C16A 2KO3A 4JLCA 2DHJA 5D6JB 1DROA 2LXCA 2IYBA 3OAWA 1OY2A 2R2QA 1OEYA 4DX90 4MEMA 4HAZB 4HPLB 3VTWA 4MDKE 4KHOA 1IP9A 2Z0QA 1SHCA 1I7AA 3VAWA 4I6PA 4FBJB 3HW2B 2GCJA 2L3ZA 5FI0A 2L1CA 4LCDE 3W1SC 3L54A 2L8JA 1KZGA 3QC8B 4NJ7A 2KX0A 3R3MA 2DLWA 2JRHA 3A9JA 3IBEA 1V89A 3VUWA 4K17A 2W2XC 5E6OA 1GG3A 1T0YA 4KZ0A 4B95A 1TQZA 2MCNB 2RSGA 2ZNVB 4NAWB 4XX5A 2UWQA 2YS3A 4LJOB 2E2XA 2GOWA 2P0HA 2CB8A 2KMAA 5AZFA 4CHJA 5KQ4A 4II2B 1HE8A 5LXIB 3F0WA 2MBQA 3APDA 1Z87A 2K2JA 3AI5A 2COFA 4NQKE 3KYCD 2MWNB 1L7YA 1FHXA 1GJZA 2PE9A 1U2BA 3ZNHB 2D3GA 1TTNA 1S1QB 3TFMA 4WVFB 2HTHA 3ZIMA 4EFOA 3ZNID 4TV3A 2M38A 1FXTB 3NSUA 4HAWB 3RCPA 2HJ8A 3APFA 3ZRCA 5L81A 3WA0A 4WJNA 4DDID 3A9KB 5FI1A 5IAAC 4HLEA 4FA6A 3DXEA 2EC1A 1FGZA 1XX0A 2DYNA 3TL5A 4JGHB 3EECA 3PLUA 3BY4B 1KM7A 4IW0A 2FIFA 4ZRKA 4W9IA 2ASQA 2K8BA 2LOXA 2MBHA 5KHOA 2IBIB 4YL8A 2KWUB 4PNKA 4F7GA 1TBEA 5CX3A 4GDKB 1EVHA 3EHVA 2KVRA 4MSQB 2RLOA 2MP2B 1WR6E 1AWEA 2HE7A 4K2PA 2XK5B 4N9F4 1DYNA 2KQ7A 1Y5OA 4F7ZA 3KY9A 4EEWA 3OJ4B 4HWIB 4HAUB 2DX1A 2RSUA 1HBKA 1YIWA 3QAQA 5DH9B 5C6RA 2ZZPB 1E8YA 1U5GA 3NZUA 1NVLA 1EUVB 2P0FA 4MGZE 2KLGA 3KSYA 3QHTA 1WJUA 2FDQA 3SO6A 2C7HA 4KIKB 1WYWB 2CKHB 1RFAA 4WAAA 3ZTCA 3TVVA 2UZRA 4LDTB 3BINA 2C60A 2NBVB 4GDLA 4KHBB 3TMPB 2YLMA 3TBLD 2W2XD 3HQCA 3B1LX 1RJ2A 3ODXA 4EJNA 4EZKA 2DENB 2UZSA 4BOZB 2Y7BA 2BYFA 2L0FA 3KZ1A 3K9PB 4Y94A 5HE3A 5KCVA 3OJ3A 1F9JA 2BF8B 3A1QB 2IY0B 5LOPB 2IYDB 3L13A 1P98A 2DX5B 1MIXA 3ZW3A 1I35A 4IOYX 4CO7A 1M94A 1P3QU 3ML9A 4HAVB 2MFQA 2DHKA 4II3B 3CMMB 1Y19B 1RRPB 4TYZA 2Z0EB 4MK0A 3JSVA 1E7VA 1OQNA 3CSTA 4BBNF 2KHWB 4KSLC 4MJSB 4OVUA 4E3CA 4A6HA 3K9OB 4FULA 3Q3JA 5D27A 1V5PA 2JZ3B 5C23A 2B3AA 1E8WA 1SIFA 2C5LC 4EOYA 4BVUC 3WYFB 2XEWA 2ROZB 4EUTA 2BGFA 1U5EA 3LDZE 5CHWA 3ZNGC 5HKHA 2KX3A 4FJVB 3ZDTA 1WI1A 3VOQA 2NS5A 3MJWA 1AQCA 3CF6E 3TO1A 4IAPA 1R4MI 3GZNI 2NBWB 3H7SA 3PVUA 2CRFA 3L16A 1GC6A 1UEFA
chains in the Genus database with same CATH superfamily
3ZYQA 1WG0A 1PYWD 4DI3A 2EJ8A 2EMSA 2X6KA 1TS3A 3T9LA 4IUMB 4YXDB 2K22A 3N32A 2K6DB 4IOIE 1ZC4B 3OWEB 5C3JB 1JDEA 3AS8A 1C4PA 4LNOA 4ILJA 4F7AA 5CEAA 5FQ6A 1P5TA 4K1RB 2QDFA 1QOFA 1QILA 2I1KA 2KACA 3UT8A 4X57B 4HDOA 5J3TA 5KQ1A 1WY8A 4XE0A 5IKCM 5H8YE 1K5GB 1QKZA 2COAA 3HVEA 3FLVA 4GTVA 5A6CA 1DYQA 1EO6A 2KJHB 1FXAA 2O6VA 3DPYA 2LHDA 2LUEA 3V30A 5JXVA 3AG1E 3B08A 1RYJA 4CCAA 4DX1A 2NBUA 1TKGA 3D9NA 4ANVA 1KRHA 1OQYA 4HPMB 1UPQA 3U3WA 4HRNA 1D5XC 4ZHOA 2J53A 4JD2G 5J3QA 4G8KA 4O1PA 3MFGA 5LP0A 4EBAA 1ENFA 3ULQA 3FC4A 1C4CA 4HJKA 1R7SA 1ST7A 3DSTA 3KUDB 2XQ0A 4JKGA 4N5CA 4TXQA 5CLQB 1KH0A 2J0KA 2BF0X 2UY1B 2GS0A 2C7NB 3V05A 3RK6A 4GTTA 4GOUA 4L6EA 2KZTB 3TWWA 2KLCA 2V9HA 2HM8A 2J49A 2MJEA 3O65B 3EHNA 3TEXA 3DEPA 3JW0X 1I42A 1LXDA 2JXXA 1IBXB 4CZ2D 2YHEA 2LMCA 4F7UP 2CFZA 2K9XA 1HTOA 1Q2ZA 3SD5A 1Z5SB 2I5CA 1B9RA 1JQ4A 1H2UA 2HD5B 1P3RA 3H6NA 4DXFA 3TUOA 3FUEA 2QYUA 2FCNA 3VUYA 3ZJVA 4KX6B 4ME2A 5ENRD 1YJJA 3AE1B 3CHMA 3R66C 3ONLA 1Q0WB 2RDBC 4X8QA 3ZDMC 3BYYB 3VR8B 1HQRD 2DYQA 1VD2A 2XPZA 3ISMC 3DBRI 2FO1E 3A8PA 1BTNA 3AEGB 2GMIC 4LJPB 3IAM1 2LXLA 4HHVA 2GCLA 5IP4D 4MRUA 5IN7A 1YJIA 4WNFA 1E9MA 1MQSA 4N3BA 3TWSA 2OOEA 3ABVB 2OEDA 1SA5A 4HB0B 2COCA 3RNBC 3JYUA 3AEAB 3MC8A 4JKHA 2JRIB 2KXJA 1MAIA 2OVFA 5BO4B 2DCPA 1V80A 2D9WA 2IOLA 1NA3A 4GPKA 3GYPA 4MELA 3E30A 1WGKA 3K9IA 4IN3B 3Q8CA 1J8CA 5HFYA 2M0XA 4GZUA 3CVWA 2DYRE 2INNE 4O6FA 2ZCCA 3TEYA 4CHKA 3C3RA 3MA5A 4A1SA 2XEHA 4K81A 2MKRA 3KYDD 3RN9C 5CMWA 2DZKA 1WY6A 3J5QB 4CYMD 2B76B 2GBRA 2O2VA 5LCWJ 3W1SA 1N63A 2NVUI 1Q10A 3MGBA 4GYOA 2GJYA 2W55A 3AEEB 3PHXB 1WM5A 5E6JA 4N5QA 5CMYA 3FEHA 1QC6A 1TY0A 2P9LG 4D0NB 2D2QA 3PLVA 1D5ZC 4HBDA 1FNVA 4XDCA 2J0JA 2I38A 3DVGX 1F1HA 5HI1A 2G9HD 3MHZA 3FTUA 4GTPA 3GS2A 1B89A 2IO2B 3RNFC 4EHMA 4A1GA 3MHSD 3RZWC 3ETRA 4NY0A 3ZPJA 4GTMA 4BSXA 4AUQC 5KJMA 2MBOA 3B7SA 1ZGUB 1Y8RC 1WIAA 5EDSA 4UQXA 3AECB 1ZPSA 4K7WA 5BMGA 5CERB 3SFEB 4WJ7A 2CFUA 3DWGC 1OWPA 4DX5D 2HYZA 3N3KB 3QQ8B 3SBGA 2BWES 4G25A 1WI0A 2LHEA 3HM3A 2Y8FA 2F37A 3B7RL 2N1VA 4HK2A 1IYFA 2DNFA 5G04J 2PM7A 5AN8A 1IPGA 4FN2A 2JY6A 1ACAA 3PNLB 1LTXA 1YX5B 5AUIA 3VQIA 2OVBA 3UT4A 4C56C 2FE8A 2LEKA 2A4ZA 5G5HA 2ON8A 4LNUD 1TNBA 1U3CA 2WP9B 1WG7A 3D8FA 4ZRPA 3OTNA 5KNGA 2BTEA 1R4NI 1P1AA 2LD9A 2K8HA 1WJ6A 3QARA 2M19A 4TRQA 3Q7AA 1BD8A 3CIRB 3ODWA 1Q5WB 2WXIA 4LEUA 2KGXB 1OY3D 5JZEB 2WB2A 5CBNA 2KVZA 5JH5C 1R4MB 4G2VA 4D10C 1S3SG 2KFKB 3GZNB 2N7EA 2FJLA 2WNMA 5FTPA 1HG2A 3DWMA 2LFIA 2KC1A 5LOZA 3CHRA 1U29A 1QZEA 3AN1A 4HSIA 3WAPA 5BW8C 4NIKA 4RG6A 3WXXA 1QQGA 4FHKA 2KTRA 4HXDA 4B6WA 3VLEA 3VLDA 4HOSA 3V61A 1HZ4A 1N11A 3HXDA 5FZRA 3PVWA 1MIZB 2IFSA 3NRZA 1H6KA 4AV7A 3JQ1A 2M0AA 3BK2A 2GRMA 2MLBA 3IHYA 4NRHB 3PO0A 3MZLB 3Q3NC 2V4HC 3CSFA 3CVQA 5KBAA 4QJ5B 1I4QA 2OV8A 3PRPB 4ANXA 4ZRIA 5EIBE 3AE9B 2ELAA 4PS7A 3IKOB 3LJNA 3ML4A 5FK9C 3GZSA 1D8EA 3BYTB 5ENSD 1KI1B 5D3YA 2KTFA 3RO3A 2ZNVC 3E56A 5DPTA 3RUIB 2QJLA 1UZXB 4LNKA 2L6JA 2JPHA 4I6GA 4KGSA 3FDHA 4N2SA 1PFDA 4B0EA 4BFRA 4OAUC 4CGWA 5ARFA 1YOVB 1L4DB 3LPZA 1C77A 3VVWB 3G2UA 3DXCA 3AEBB 1X11A 5T3RA 2D5GA 1WGYA 1XNFA 2Y3AA 4HB4B 2AL3A 1L4ZB 1RRBA 3C72A 3G2SA 3MX3A 3QDNA 4YDYA 1SBBB 3QKYA 3Q8AA 4DX8A 4F1PA 3VHTC 3ZUVB 5C5BB 3I9V1 1JRPA 3Q78A 5A23A 1WX9A 3ZJTA 1B1ZA 2FBNA 3W1YA 4CHMA 3GYOA 4B94A 4GA2A 5CLLB 4IWOA 4L9PA 4EZLA 1WGUA 1UWMA 3P7ZA 2GBMA 2Y1LE 1OGWA 2PQNA 1WSPA 4LNFA 1N60A 3RIBA 1L0VB 4KZCA 2AQ3B 3H1UA 1FPPA 2DAJA 2KDFB 1V1PB 2GROB 3TIXA 3E34A 1L2NA 3ULBA 5IJMA 3R2TA 3BU8A 2LVQA 2F8YA 3CVXA 4W9KA 2K8EA 1D8DA 3Q8BA 3SDLC 2YS5A 3ABME 1T3QA 5E6PA 1UN9A 3H7PA 2KKCA 3DBRB 4WSFA 1F2RC 3NOCD 4L1BA 2L00B 3UI3A 3D9OA 4KV2A 2QZAA 1C4AA 3X0WA 1GAQB 3LVQE 2N9EB 3NB2A 2BKFA 2EKEC 5JLJB 1O1TA 1GW6A 4CDNA 4A6FB 2RPQA 4EKUA 3KW5B 3MKQA 1UPRA 2RRFA 2YINA 3WAOA 1IHGA 1DVPA 3UIOB 2QFCA 3EHRA 2LGXA 5M72A 1BWNA 4DHJD 3JUIA 1HG5A 3FHEA 3JUEA 3CK7A 3ABKE 3IAS1 2WM9A 4M0WA 4FJYA 4GCNA 1TZ1A 4U96D 3X2QE 4F3VA 1OCZE 3RT3B 5KCMA 2IONA 2BTDA 1YN4A 4I6NB 2G35A 2K5PA 2PMVA 1E8XA 2L7RA 3ML8A 2YRYA 4GB9A 2ACZB 4JK8A 1XODA 2QC8A 3AB5A 5C2TB 2YVCA 2WXOA 2XRZA 1TJCA 1RZ4A 2KCLA 3DQVA 1BU9A 2DWQA 1CMXB 3RNEC 2ZEQA 3SYXA 3FKYA 3EIQC 1WZ0A 2FUG1 5IOIA 1IQUA 1TN8A 3FY4A 2WGSA 4HKQA 3VRBB 2Y4UA 5AZHA 4ASWC 2BCJA 3HM6X 2R5SA 4AJWA 2RR9A 2L0TA 3SNXA 1WXQA 4S17A 1V5OA 2QHOA 4GA1A 5C2YA 3QCAA 4C7YA 2D10A 2VZKD 1WX8A 1O1RA 2VTBA 2W82A 4DHZE 3R7RA 3L82A 1SE4A 1SSNA 2UWJG 1NI1A 3W5UB 3Q8FA 3I57A 1TEZA 1ZW7A 2R02A 2KJRA 4LLGM 4K5AB 2Y4TA 2P9NG 4USAA 2C2LA 2QSDA 4ARCA 2OTXA 2ZW1A 4P1CC 3DBSA 3UI2A 2P9PG 3NS1A 1ZDXA 4AOFA 1KPSB 3T5VA 3DEOA 4R3DA 3RAUA 3DBLI 4PT5A 4L23A 1R4NB 3JCKC 3A9JB 2X6HA 4IM0A 4KVOA 1B55A 4JB8P 3R9AB 4EECA 2DIWA 4BSZB 2Z59B 2GRNB 4Y6CA 4PH4B 2AEHA 2WVIA 3BZDB 3GE8C 1IRSA 1ZYIA 1LFDA 3UX4A 2MWSB 4RMAA 5LLIA 4XWWA 2VSNA 4HS2A 1ZXHA 1FT2A 5G2NA 3TXMA 2IOSA 1FAOA 4RGTA 3CXBB 3TSSA 5FR6A 4CT0A 3GZ1A 4YTPB 1DCEA 2GW1A 1YYHA 3QWMA 4K2OA 3MJ5A 1K1BA 1YN5A 2IEJA 3DBHI 3UMVA 3U30A 3HRAA 1ZDVA 4XKBA 1RLFA 3VH3B 4NPNA 2BWFA 4J7WA 4JKDA 2KCJA 3TWRA 3CWIA 4K0RA 5L95C 3ECIA 3VDZA 1I4GA 2AVPA 2MDXA 1JCSA 1KJTA 3E9PA 3KEAA 2MSED 2MHKA 3EIJA 3TG5A 3BVMA 4BT9A 2Z0OA 4ATGA 3CV0A 3QB2A 3SGHA 4W9GA 4ARIA 2XRYA 3HIEA 3DPDA 3W9FA 5HQ8A 3ZVRA 1NU2A 3B0AA 1O1SA 1SQMA 1JWBD 1ELKA 3SU8X 3FTZA 2DBAA 1Z6TA 2BKKB 1H4RA 2FJUB 3L9TA 2P8VA 4NSWA 2BUGA 3VTYA 1VZ8A 1GGOA 4K5BA 4IRUA 3PZDA 4W9HA 2LKOA 4U95D 3ASNE 4AVXA 2KZRA 4CRWA 3LY7A 3PPAA 2V8SE 4A3TA 1JW9D 2WYQA 5IRSA 4HOUA 4TKNA 4HLLA 1Q1OA 4AY6A 1K8KG 3FFLA 2J4BA 3AG2E 3UM0A 1V8CA 2PVOD 2DLBA 2IJ0A 2H89B 3L4PA 1MI1A 2WDTB 3NZ3A 1MFWA 4KKJA 1X1MA 1FNWA 3AE6B 4M0WB 4UWKA 2Q13A 1XGWA 3LJ3A 2PJHA 3NW8A 5DBKA 4WWOA 3IFWB 5ANRA 2Z8LA 1EF1C 3GYZA 2JYEA 1E96B 1WGGA 4N3AA 4C80A 2HTHB 1SA4A 5D7GA 3CHOA 2N23A 2FNJB 5AQBA 2X6FA 5LFAA 3O4ZA 2D9ZA 5BV1A 4DQOC 3V5WA 3NG0A 3BQOA 1U3DA 4GZDA 3FUFA 3ZNGA 2AYOB 3TWUA 1ZVRA 3SHQA 5JHBA 3QBVB 1H6OA 3D9LA 3ENEA 3PGEA 4HATB 2XZDG 5EE9A 3P6AA 2IY0C 3RJVA 1N4RA 4WWMA 5DPSA 4A6QA 4AP4C 2JX5A 2X18A 3NAWA 1V86A 2VGXA 3AE8B 4YDOA 4ZYNA 2Y8GA 2J09A 2ZW0A 2WMOA 2ELBA 2CHWA 2LRUA 1LF8A 1V55E 2WDRB 5D3VA 1HXYD 3AEFB 2AXUA 3O48A 5HHDG 3HG0D 3PTFC 2G45B 3ZYLA 4ANWA 3HSAA 1FCHA 3RYTA 4Q94A 3P1MA 2DZMA 4JA9A 2MQJA 2WQ7A 3VXWA 2C0LA 1L5PA 3U66A 2BB6A 1YQ3B 2FCMA 1NZNA 2LI5A 2F8XK 3FP5A 4MBGA 2JSVX 1HF8A 4NAMA 5E6NA 3RKVA 5IA7A 1U2VG 5AEKB 3IEGA 1A5EA 1S70B 1K52A 2DYBA 4GZ3A 2GI9A 2KC2A 4I9EA 3QWVA 3WIMA 1WYGA 5LXHA 2CJOA 3AG3E 4OYSA 3HIZA 4J8FA 4DPRA 3AULA 5JJ6A 5AAOA 4DBBA 2XPIA 3QJZA 2BPSA 5HI7A 4XGAB 3UPVA 3R9MA 3ODOA 2RGFA 4YT0B 3CQCB 3SV1A 1FMAD 1SVXA 5J08A 2QILA 2PQRA 1NEKB 2LSVA 4HRLA 1ET6A 5FJYA 1P0RA 3A58A 1HB6A 3FH5A 3D9IA 2EIJE 3C5RA 5C1ZA 3FM8C 2ZIRA 2KK8A 3IXSA 3FUJA 1FPYA 2NMQA 1W1HA 4GU2A 2DYSE 4GPMA 2D07B 4RF1A 3FILB 2DAFA 4UWLA 1EPUA 2OCCE 3D9KA 1I4RA 3PS6A 4KDLB 2JLBA 1XLPA 1GB4A 3U8ZA 2M4NA 4J3OD 2JEKA 1C3TA 1QBQA 2UVMA 4MGIE 1JCQA 1AARA 1E6EB 2MW5A 2LXAA 4IM2A 5FIOA 4DBGA 1H6PA 1TKYA 3Q14C 3NJTA 4TMAB 1M4VA 2VQ2A 1LD8A 3L08A 3MCXA 3RRNB 4HI8A 2QKLA 4GMXB 2R82A 1UUPA 3UINB 3RI7C 4H2AA 1TR4A 3QA8A 3ABLE 2KN5A 5E75A 5D3DA 2FAZA 4HCPB 4P7IA 2WPVA 1MX4A 2H7EA 4A3PA 3T5XA 2OEVA 3AH7A 1PY1A 4A3OA 4BT8A 4DWFA 4M8NA 5AJLA 2PLPA 2WXLA 3I5PA 4LERA 3DBLB 3SNHA 4ICVA 3FUNA 1AW7A 3EFCA 1H10A 2GBKA 5IO9A 4WJQA 3NF1A 2IQCA 3B13A 2D4QA 3M3JA 3WAMA 4W9RA 5G55A 4I6LB 3V79K 2RUKB 5CHFA 3BJIA 1WE6A 4BESA 3AU4A 5FT9A 3RNCC 1JWGA 1XLNA 3S7DA 3W9CB 1LD7A 4Q69A 1IXVA 2XGMA 3L6AA 1FFVA 4J8YA 3IVFA 1N54A 4NACA 1WGDA 3TGOA 3PUJA 3URZA 2ZVOA 4ZRJA 3LY9A 4HI9A 1GNUA 2MEKA 4GDLB 1V5UA 3L10B 2XCBA 2JVCA 3UXGA 4XWXA 3V6CB 3RCZA 3N71A 1JUQA 3DBHB 4LNNA 4PUCA 3O13A 2M14A 2BS3B 4PDXA 3X23A 5E76A 1CZPA 5EE1A 4RFBA 4N6EB 1I4PA 1MHHE 2YHCA 2QYJA 1WRIA 2WXMA 3H9DA 2MRIA 2R2OA 3RNAC 5IY5E 2R2YA 3TWVA 3NVVA 2VSXE 3LB8C 5BMIA 4B0ZA 3ZTDA 3KVFB 4AWJA 1I4HA 1E5WA 1ZKHA 3A4SC 4GTSA 5TSSA 2RQ1A 3PE3A 1KT0A 4MH8A 2FCSA 4KVGB 1Z5SC 4GPTB 2K25A 2LRWA 3DSSA 2BBCA 2NPTA 2IO0B 1X05A 2VH1A 4HCNB 4MGKE 4ACKA 2ZCBA 2E6XA 4I1OB 3ZO5B 1N0RA 4ILGA 5C79A 3TEZA 4XI0A 4KKIA 4ZYSA 2UYZB 5EKQD 3AE2B 3N7CA 2VSZA 2PM6A 2J9QA 3RO2A 4AY5A 4NQ0A 2DZJA 4G0NB 5M4YB 4LK0M 1IYGA 5DPWA 4LDTD 3MP9A 3EUB2 2P0DA 1DGJA 2KUQA 1BAKA 2N7JA 3PH0C 2VSYA 1WF9A 4U7EB 4K7UA 1RW2A 2N1WA 1TKEA 5CCMA 1V97A 1NA0A 3TWXA 3CVUA 4KGTA 2GGFA 1FVHA 4ZRQA 3D9JA 3ZLZA 2K3UA 3VIAA 2BYVE 4C0EA 1BXTA 5ITZF 1J0WA 3PZ4A 1TZOA 4V3IA 2X8XX 3JSVB 4Z2NA 2LOZA 3EUVA 4DXAB 5FZSA 3T9KA 1TYGB 1WVHA 2KD0A 2RPVA 4XKCA 1S64A 2XQNM 3ESKA 1SF0A 2WX0A 3PRMB 2KWVB 5D3XA 1OMWA 3ASDA 4GZ5A 5DCNA 1BTKA 4BETA 3NY5A 3MEKA 4KDIC 1UW4B 1V54E 2KFJA 3ULYA 4IDIA 4KHAA 1XD4A 1YQBA 1BUIC 2C9WB 4UWHA 2JABA 1YX6B 4P1BC 3MTNB 1MK7B 2KYWA 3C98A 4CYEA 3L17A 3ZGQA 5BNWA 2LNIA 2LG1A 4L1RA 1XD3B 3ASHA 4GA0A 2ZISA 2VRWB 3RD2A 1HTQA 2J59M 1WJ4A 2N9PC 3PG7A 2OJRA 4ZHBA 1D6EC 4BZAA 2D9YA 3JXIA 2IO2C 1RWSA 3ZRFA 4F8CB 3FTVA 1WXAA 3F5RA 5J90A 2HTME 1YJ1A 4YDEA 3ZU7B 5JHAA 1TJ6A 1WR1A 5CTRC 1TXDA 1WXSA 4GMJA 1ZC3B 1RFKA 2NSZA 4A5KA 1F2RI 3WG7E 3CK8A 3TCAA 1GB1A 3PSCA 3DVNV 5ENPD 4ANUA 4HB2B 4KAXB 1UGMA 5D94A 2MRPA 3SBTA 1WM3A 4G23A 1UH6A 4JQWC 4NAWA 3AE4B 4H7XA 4H7YA 5FZQA 4WWPA 4NZLB 5DHAB 4DX6D 1SE3A 2C7MB 3ONKA 3MV3B 1W1GA 1N4SA 2YT2A 1E7PB 1WH3A 1M7EA 1OCRE 2KCKA 4JW1A 4LNBA 3NVZA 4JEHA 4JK7A 4O1OA 4QJ4B 1ZSQA 5JMND 4KBQA 4AJYB 4A6KA 4ZHPA 4F7HA 2WWZA 5AUKA 3Q15A 1T77A 3AU5A 2N7DA 1EU3A 1TJFA 1N61A 2Z13A 1C1YB 2FCQA 1J7BA 3VUXA 1NDDA 3LCAA 4FLBA 2DKQA 1AP7A 2KMCA 2KDBA 1OWMA 3MC9A 2W54A 3HVEB 3UQAA 5ENOD 4JKEA 4I1MA 2YT0A 4G1TA 5JHHA 2O6VB 3E9SA 5BYQA 3I3TB 2D9VA 2WH5A 3BVZA 3UZTA 1KLVA 3PZ2A 2FJ9A 1ROEA 3RNGC 4B8CB 2IU1A 1IKND 1ZB1A 3VTUA 3CHPA 1U5DA 4XC2A 4A20A 2Y0BG 2I2YA 2DVWA 2K8CA 4HJGE 1EF5A 3UIPB 3KRXA 4BEPA 3U7ZA 1J19A 2VYIA 1X1GA 3ASGA 1PGAA 1UNSA 3RRUA 2H6IA 2NPTB 3IXEA 2F0YA 2AWTA 2LUHA 4JKGB 1IGDA 5BXOA 3A33B 3GOEA 1ZU2A 4ACFA 3KUCB 5CHVC 1HB8A 4Q2JA 2XS8A 3IHVA 3KS2A 2CJNA 3FSSA 4JEUA 3KWVA 3PZ7A 1ZE3D 3B9JA 5FKAC 3QX1A 4P16A 2ETCA 1L0XB 2ZKMX 5AIJA 3NHEB 2Z14A 2XEEA 4DX2A 3ZUNA 2IY1B 3NWDA 2KCVA 1LO5D 2WHIA 2HRJA 1UELA 3N20C 3A4RA 4PS3A 1WZ3A 1YD8U 2HDEA 2CHXA 5FINA 4HORA 1VZ6A 5LONB 3ZFWA 1WXMA 4JL9A 3TG4A 2GLSA 3QIJA 1MPHA 3RU0A 1VCBA 5J18A 1JCRA 2KANA 4YTNB 2KAJA 1XR0B 2BT6A 2V3PA 3A9KA 4WJOA 2HO1A 1NI2A 3DSXA 2IGGA 2K1FA 2I5FA 4JC8A 3FUDA 5B1AE 4IM3A 4TQ1A 4KSKC 2XNAC 1FRRA 4U8HA 1N6ZA 4N59A 3D9MA 1EAZA 4MT7A 4MT5A 2L0IA 1I7HA 4LSZE 2LYDA 3FUIA 2J42A 4NQLB 2LWPA 2N9XA 1H0AA 4FADA 1DDWA 3EGRA 3OXFA 1QT9A 1WMHA 4GCOA 1MZCA 4WWNA 1WX7A 4FHJA 3J9CA 4I2ZA 1UBIA 4N58A 4EQFA 3EJNA 1E8ZA 2V1YA 2MJ3A 4MACA 2YF0A 3NWFA 2L52A 5HKPA 1DDVA 3BEEA 1LM8B 3DHIC 4C0AA 1XQQA 1V61A 4W9CA 2GRPB 2DYMA 4ICUA 3G2TA 1VDYA 2DN6A 1QQRA 1RAXA 4MM3A 3VH4B 2IPKD 2IJGX 1WJ1A 4BKTA 4GDKA 3HHMA 3OHMB 1BT0A 3TW1A 2WXPA 2O2VB 2KUPA 4JE3B 2MP2A 3SFYA 1P9DU 3E9OA 3Q75A 3Q3OC 5EIDA 1DOYA 4HRMB 2WDVB 4YNDA 1NYQA 3N1YC 3DSWA 2XK5A 1FB8A 1I2HA 1V5TA 3JYSA 1ELWA 2Y69E 4BKSD 2CAYA 3KQ4A 1VJKA 3UIOC 2P9UG 3ESLA 2QKMA 3V60A 3HXFA 1D9SA 4RVBA 3LEWA 4U0UA 2DWZA 1WGQA 3Q2AC 3P1UA 4UWGA 1NBFC 4EZJA 4RM8A 1NL4A 4CEMA 2JF5A 2KXPC 3T06A 2YS1A 5JP4A 3ALBA 4I1AA 1JWAD 4HKZE 5HE0A 5J17A 1YA0A 2AL6A 2RVBB 3M62B 2GBNA 5BMHA 2LGYA 5ARGA 3HXCA 4KYOB 3DSUA 1JWUD 2EILE 2D3AA 2R0DA 4M02A 4RGMA 2OQBA 3FU0A 5JHGA 1UF0A 2V3SA 1ZUD2 2COPA 3CVVA 4ZDVA 2FIDA 1G6JA 1NYRA 4KIKA 2KDIA 3CIAA 2M17A 5AJDA 4I43A 2V0PA 3QC1A 3RSEG 1VR9A 3DOWA 5DIFB 5EILA 2KWCA 2JUOA 4NURA 3OLMD 3DXDA 3PV1A 2KJ6A 2WLBA 4K03A 1KLXA 2NTTA 3DVGY 5BXUA 3PRZA 4S0RA 1DBHA 3ZXSA 1X1FA 1WM2A 2EIKE 3LS8A 5FQ8A 2NBVA 2FUHB 2JWZA 2KDMA 1TJEA 4UDUC 5L83A 3P2BA 4KHBA 2PW9A 4G26A 4KGRA 3AV8A 3LKUA 1ZXIA 2CG2A 1HFAA 2FULA 3S2AA 3UT7A 2WU2B 1T0QC 2R09A 4A63B 3OANA 1NENB 3EFUA 1STEA 4BBNC 2LZ6A 2KTRB 4D2KA 2BVCA 4XEIG 4HB5A 2DYOA 1MX6A 1KTKA 3UM1A 3EC8A 1SE2A 2YEPB 4MH0E 4C4VA 5HS0A 3HVZA 3ZEFA 1K5DB 3LYAA 1JALA 1HXIA 4F53A 1HH8A 1EF1A 3DXMG 2N0YA 1ESFA 1V2YA 2IDYA 2PE6B 3W2DA 1E90A 1AWCB 4BX8A 4APFA 5J3YA 1SJED 2ZJDA 4RLYA 1OXJA 4XWTA 2WXKA 3OXGA 2QEJC 2RNRB 3JVZX 1OFFA 4GGQA 5EX3A 1KT1A 3CEQA 2L05A 4KMOA 3Q4AB 2O6VD 3S7BA 3RZFA 1Z3YA 3A1QA 4UI9J 2AQ2B 4U8VD 4LCTA 3I5JC 2DA0A 2XGSA 4WIPA 3E9LA 1TY2A 1LB1A 1UG3A 2CU1A 2LVOA 4TQ0A 2DX5A 4WUYA 4U04A 4OW0A 4G3XB 4GTOA 1WMHB 5DIZA 1C9FA 2KQSA 4RF0A 1PC2A 3QNKA 4LUNU 2ROVA 2NZ8B 1UD7A 2LJ5A 2CY4A 3ZRHA 2JP2A 2YT1A 2L2IA 4US8A 3DRAA 4EBAG 5HE1A 2BKGA 4RH6A 4EMOA 5EE0A 1DCQA 1N4QA 1X86A 4IFSA 2CS4A 3CVLA 3SO8A 2H88B 2G1EA 5I4DA 2LASA 1D3ZA 4UQZA 2J7QB 2L76A 2IGDA 2ZPYA 1J7CA 4N2QA 1XLOA 3PHWB 1FXIA 5AARA 2XBBC 2PVGC 2JU6X 1V49A 3VTVA 2LVPA 4K7SA 3EDTB 2IF4A 4MJSA 4LTUA 2IO1B 3PT2B 4I17A 3UQ3A 2CHZA 5D2MB 2FI7A 3ASFA 1UNPA 5LG4B 3V3XA 5BYSA 4GMVA 4GIVA 3IHPC 2MA9B 1UGJA 5BUZA 2KN4A 1U4AA 1WWTA 3R2IA 5DI9B 3H7PB 4J8DA 4CSQA 4R7LA 2DTCA 3ZHEA 1MJ0A 5DPRA 3D32A 3M63B 2V3NA 4BOSC 4UI9K 3ZKJC 3V2XA 3MKQB 2EMTA 1VLBA 4JWSC 4OVVA 2E0IA 1TNOA 3BG1B 2LULA 2J52A 4NNJB 2ZVNA 2ONDA 3KD7A 3O96A 3CHSA 3KAEA 5CCLA 2PKOA 1T0RC 2CODA 2Z0DB 1XCTL 2X3MA 3I63C 1PDXA 1XKEA 1SGHA 2ZGDA 4JHRA 4M01A 1C78A 1YMPA 1V5MA 4B0MA 3FU5A 4DDGD 3CIKA 3DCXA 2LBBA 2ONQA 3QK0A 4M8MA 4BERA 4C48B 4EPZA 1OTRB 1TT5B 4G8LA 4K3BA 3MKRA 3IG3A 4MY6A 1DNPA 5FQ4A 3N30A 3VFKA 3I4RB 1NFIE 4AP2A 1NVID 5A7DB 2LGDA 4N3CA 1UBQA 1PQSA 3A98B 3ZVVA 3DDCB 4OSNA 3AXCA 2HR2A 3P4SB 3M95A 1AWDA 3G2WA 4IULA 1N3HA 1FGYA 3FTXA 1H8CA 1A17A 2DZNA 2L0TB 2VGEA 2PZIA 1UNQA 3D8EA 1WE7A 3NOBA 2KIEA 4DIXA 4U63A 1FFUA 1Q67A 5JJ7A 1V88A 3RULA 3UF8A 2IGHA 2JQRB 2BKRB 2IO3B 3KUZA 4HVBA 1RM6C 1PFJA 2E3TA 4W9EA 2VTBB 3FUMA 3W9GA 1SJHD 4JKAA 3AMZA 4JL0A 2RFMA 1XCQL 1TNUA 4GOCA 4GAAA 1Z2MA 1J7AA 4A9AA 1V6EA 3Q3FA 1TS4A 5BPPA 2DFKA 3URYA 2X38A 4XDDA 2LJIA 3CVNA 2KQ4X 1BMLC 3CGHA 4OZCA 2V76A 1XXGA 1N95A 2YEPF 3HXBA 4G11A 2UY1A 3B7UX 3LXUX 3QWZB 2CG3A 5FWQA 4WJPA 1QF6A 2KZTA 3IT6B 3EPYA 2DBYA 4XYCA 4XZ4A 1HEZE 4F1SA 1UOHA 3OG5A 4HXIA 3P4RB 2LXMA 1JRUA 4FXCA 3V31A 2H6GA 3WCQA 1IBXA 2RMMA 2ABDA 1LQBA 1MX2A 2PL2A 3ZYYX 3TWQA 1F77A 3ZN3A 3PREA 2J4DA 3KRWA 5B3SE 2M8SA 3DCGA 3U2SC 2AWIA 4YSYB 1TIFA 4YVOA 3R7QA 5G05C 1TS2A 4Z68A 2D11A 2V4LA 5CRUA 4OZAA 3RRMB 3MC0B 3MV2B 4F6RD 4CQNA 4BKSA 3U12A 3RPFC 3PSEB 4Z2MB 3ZYMA 2VH2A 2XCCA 3D3MA 1UNRA 2DHIA 1DIKA 3L0WB 3SR6A 1J0GA 3BVGA 4RG9A 3V2OA 3KSQA 5KJLA 2GUMA 1AN8A 2LGIA 2YSZA 2WQYB 5GMVA 5AENA 1P6SA 1KZ7A 1XF5L 2N4FA 2XGOA 3B95A 4WNDA 3SFXA 2WQ6A 1CQVA 1MG8A 2LO6A 1L5JA 1INZA 3DVNU 3BUAA 2R59A 1FHOA 2ZU6B 3N1ZC 1JMLA 2G4SA 2GRLA 1H19A 2PNNA 1BPOA 4PK1A 3D8DA 4A3VA 4PS8A 4FU3A 3HK0A 2X6JA 3MPXA 3FUKA 2AW6A 5D3IB 4G24A 4UI9C 1MHXA 1GUAB 5KJKA 2KATA 3GE3C 3ULCA 1ZM0A 1KF6B 1K53A 3SQVA 2W2WA 1QOGA 1SXTA 3A8QA 1U27A 2MX2A 4DK5A 4MSMB 4I2WA 3U52E 4B9KA 3T8MA 2I2OA 1WGRA 2H6FA 5EX0A 1NTIA 1G3NB 2WDQB 3Q79A 4W9DA 2VKIA 2KDEB 2Y5PA 3SEBA 5AQAA 5B1BE 5ENQD 3KH0A 1XT9B 1V81A 4K5CA 2Y5BB 4JZYA 1PUTA 2DKPA 3PUKA 1WFYA 1N0QA 3B2GA 1KZPA 2FO7A 1LW3A 2D9XA 4MS6A 4GU5A 3VLFA 3SUZA 2CQUA 2I9CA 4HFGA 5GXGB 2W9NA 4QXAB 3J5PA 2FEZA 4REZA 2N0SB 3M1IB 3NBNB 2JYTA 2NC9A 2VGYA 1BI8B 5AZGA 4WNEA 4HAYB 4D6WA 2WX1A 3ZQ4A 4IC7B 1X5BA 3R8BA 4IWPA 4MGYE 1EM7A 2WS3B 2AJAA 2ICIA 3NZSA 1FOEA 4IWQA 4BTAA 2Y5CA 2IZVB 1U5FA 2JZZA 1QZ2A 2QCZA 2J8SD 2NMBA 2VGXB 1XLQA 1EU4A 3QWWA 2KNBA 1K1AA 3SFDB 1OQRA 1YCSB 3LY8A 2RGNB 1SE9A 5TR5A 3C19A 1W1DA 4ATZD 2D3CA 4AS1A 3PEGA 2WXGA 1ISNA 4PYUA 5EYPF 1UN8A 5H7PA 2PEAA 1N5WA 3JQ0A 1YMHE 2GBJA 3CR3A 4BBKA 3UM3A 1WJNA 3APCA 4HB3B 5HE2A 4C9BB 3RMKC 3AE5B 1E10A 1K50A 2MH7A 2NCNA 2RG8A 3KWLA 4GZCA 1FIQA 4URKA 2WXRA 4DLQA 3UQBA 4MKTA 3T3OA 3U7DA 1P5QA 2VRRB 1ZOYB 3V62A 1QNFA 2REXA 4WQOB 4GN1A 1DDMA 2WXFA 3CK9A 5HRYA 1TGZB 3ZNZB 1O5MA 1FRDA 4RM9A 2H7DA 2BYEA 2NTSA 2K6QA 1V9JA 2BYTA 2KFKA 4ILHA 2DZIA 2PPHA 4YSZB 1VBGA 4FJZA 2DIKA 3IV0A 2WQHA 2MHJA 3PZ1A 4JXTA 4AEZC 2DHZA 5KHQA 4GLSC 2NR2A 1YNTE 4E85A 5J2RA 4RSYA 3MYVA 4JWUC 3WANA 4FLHA 5G5GA 4IG7B 3Q69A 4G50A 4W9LA 1WJMA 1SB3C 2RD0A 1HX8A 2MBEA 4HDQA 4M7CA 4JPSA 3W5VB 2K2UA 1E7UA 3C0RB 2JWUA 4H8SA 1WGHA 4L2YA 1NI3A 2G4DB 3BWUD 4L7TA 5D66A 1KBLA 4W9FA 2EKIA 3AM9A 2K49A 4JX1C 1JWFA 3DSVA 2Z0PA 4HQDA 5KJNA 3C3OA 1XCGA 3QOUA 2JXTA 4B6HA 3AE7B 4YWGG 4RCOA 4GXBA 5AQ9A 4DHZB 1S0PA 4KT6B 3AJ4A 1OEYJ 2XS1A 3PVLA 2A5UA 4B93B 4IKGA 2OOBB 1M7RA 2X0SA 5GOWB 4YONA 4J8EA 1EGXA 4TSSA 4GTRA 3NS8A 2L6BA 1NTYA 1VZ7A 5DHFB 1OUVA 4DHJB 4JHJA 1FD6A 1XEEA 2D3BA 2TSSA 1K8RB 4P6VF 3F6QA 1YQ4B 4E71A 2CY5A 3SHFA 4J6IA 2LUMA 1N94A 4ILIA 2I1JA 2M1MA 5C5BA 4PQ0A 2K00A 1GPXA 1A5RA 3ZXPA 5EFXA 1A70A 4NJCA 2JT4B 3EU9A 3Q49B 1NTVA 3FEXA 2ZPNA 2Q7FA 5CEDB 2ADZA 5FR3A 4PYZA 4XI9A 3B7TA 1KOTA 2G3QB 2RDHA 4JIOU 4NJ6A 4K3CA 1KFYB 2WXJA 3FWVA 1WRDB 1PLSA 2K39A 1MK9B 4APOA 1OCCE 1UJJA 3WALA 1V1PA 4BKGA 5EE3A 1PMSA 1PGXA 2L1AA 4KXKB 4TUUA 4O60A 1N52A 4L2LA 2R17C 3CLJA 3S7JA 3C3QA 1DC2A 4XIFA 4GZ6A 3UIPC 5ANLA 3ONSA 2MBBB 3PE4A 4U8YD 2PZ1A 2J4XA 3NWAA 3SY2A 5H92C 3FU6A 1OQQA 2BS2B 3G9WA 1TN6A 4A6FA 2VZKB 4HAXB 4DUIA 1HZ5A 3V6EB 3UGBB 1TNYA 5D3WA 2JZPA 2LGSA 2M56B 2J0MA 3MDBC 4UWFA 1FHWA 3PP2A 4LNGA 2CR5A 3LDZA 4ILGB 1Y56A 4C7ZA 3TJPA 3CQGB 2KT7A 4E74A 3FAHA 1WAO1 4UQYA 3BK1A 1WXVA 2KOXA 4TXPA 4HNAD 3LJUX 1ELRA 5D0OD 1GC7A 2J07A 1L6UA 3GP7A 2AQ1B 4GSWA 3FU3A 1MKEA 4W9JA 2I6HA 3VTXA 2AXVA 4OAVB 3Q47B 5C16A 4O1NA 1SEBD 2KO3A 1YN3A 4JLCA 4Y6WA 2DZOA 2DHJA 1X81A 1V1OA 5D6JB 1QLBB 2X6IA 3S7FA 4YTMB 5CHEE 1DROA 3LVRE 4TXRA 2LXCA 3H8HA 2IYBA 4QJ3B 1D4BA 3EU5A 4MLPA 4ILHB 3AS4A 1N5XA 3OAWA 1OY2A 1DOXA 2R2QA 1OEYA 1FNUA 4DX90 4HEA1 2WXQA 3NVYA 4MEMA 4HAZB 4HPLB 2XENA 4WNGA 3FTSA 3VTWA 4MDKE 4FC8A 3P42A 4KHOA 1IP9A 2L9BA 2WU5B 2Z0QA 2EELA 3ENBA 3N9YC 5EN5D 5CRVA 1SHCA 1WDYA 2Z4DA 2VSOE 1I7AA 2P58C 3HYMB 3VAWA 4I6PA 4FBJB 4U07A 3HW2B 2GCJA 3ZYKA 2L3ZA 5FI0A 2L1CA 4LCDE 3W1SC 3L54A 2L8JA 1FVFA 5LX8A 1KZGA 3QC8B 4NJ7A 2BQQA 3AAAC 2Q5WD 4HRSA 2UU7A 3ZXVA 4GNKB 2KX0A 2XPYA 4QAYA 1E0ZA 1T0SC 3KSLA 1MVKA 2R61A 3R3MA 1F0ZA 2DLWA 5JJTA 1BLXB 2JRHA 1ZP0B 3A9JA 3IBEA 1V89A 3VUWA 4K17A 2FBWB 4QFVA 1IHBA 2W2XC 2Z59A 3PZ3A 2PIAA 3Q8EA 5E6OA 2BW2A 2MJDA 3DHHC 3Q5MA 5BV0A 3DHGC 1GG3A 3HVDA 1T0YA 4KZ0A 4CDRA 2V0GA 1IGCA 3AG4E 4B95A 1HA5A 4JKBA 4QQIA 1TS5A 1TQZA 2MCNB 4HOTA 3SBTB 2QY7A 4CT4A 2RSGA 2ZNVB 4M00A 4NAWB 4C00A 4XX5A 1EDUA 5JVLA 2UWQA 2INPE 4IYPA 2E2EA 3SI5A 2YS3A 4LJOB 2XEVA 4N39A 1TYQG 2E2XA 2GOWA 2P0HA 1PGBA 2KM4A 3NQPA 4DXGA 2CB8A 1HU3A 3P4PB 2KMAA 1VDVA 5AZFA 4CHJA 5KQ4A 2YNQA 2NXPA 4U0SA 4II2B 2J08A 4JHKA 1HE8A 5AQ7A 3U64A 5LXIB 3F0WA 3HRDD 4AM9A 1JWSD 1N62A 1IUEA 2MBQA 4RGOS 3APDA 1Z87A 3FEYA 4BTBA 3E4BA 2V4IB 2K2JA 2OHFA 4E6HA 4TUMA 1K51A 3Q7FA 3AI5A 3LYYA 2L83A 4OHJA 4JK9A 1FCCC 1W3BA 3T8KA 2COFA 3B2FA 3KYCD 4NQKE 4WQMA 3CKCA 2MWNB 1L7YA 1FHXA 4A90A 4DRXE 1SZ9A 2AXZA 3HXEA 1GJZA 2C0MA 1D5MC 2PE9A 3NUHB 1U2BA 2LAIA 2KC7A 1I4XA 3ZNHB 2QIEB 1JPLA 3GB1A 2D3GA 2WXNA 1TTNA 1S1QB 2AX5A 2BB5A 5G05J 2ETAA 4DLOA 3TFMA 4WVFB 1F52A 1SIJA 2HTHA 3ZIMA 4EFOA 1SW6A 3ZNID 2M63A 3ZKJA 1Y8MA 3SFZA 4TV3A 2KMMA 2M38A 1MYOA 1EYHA 2R2LA 1FXTB 5MPOA 1AYFA 2GB1A 1HO8A 3LXFA 3AE3B 1S63A 4LRZA 1MG4A 3NSUA 4HAWB 3RCPA 4HROA 3U4TA 5LCWC 2HJ8A 1Y6IA 3APFA 3VR9B 1FCLA 3ZRCA 2INCC 5L81A 3WA0A 4WJNA 1OWOA 4DDID 2NYJA 1PAQA 3PEVB 1ET9A 2HE0A 3JXJA 3A9KB 5FI1A 5IAAC 4HLEA 4FA6A 3DXEA 4A8XC 5T4YA 2EC1A 1FGZA 4WURA 3PDNA 1XX0A 2DYNA 3TL5A 2V5FA 5EYLA 4JGHB 1H2VC 5JA4D 3D9PA 3EECA 1MI0A 3PLUA 2IFUA 4YSXB 3C8YA 3BY4B 3KEZA 1KM7A 2W3SA 4IW0A 2FIFA 4ZRKA 3EHMA 4BAXA 4WH4A 4GTQA 4W9IA 3DWLG 2ASQA 3TAXA 4FP7A 2K8BA 2MOWA 2LOXA 4I6JA 1MHQA 2MBHA 4JKFA 3ULEG 2W3RA 1T6BX 4OT1A 4HOQA 5KHOA 5G04C 3CHQA 2IBIB 4YL8A 2KWUB 1VRAB 1OWLA 5D2MC 4PNKA 1TN7A 4F7GA 1TBEA 1KZOA 1QOBA 4MM3B 4A55A 5CX3A 4J8SA 4OVZA 4AIFA 4GDKB 3Q73A 1EVHA 3U4EG 3EHVA 3ZXRA 2KVRA 4MSQB 2RLOA 2MP2B 1BI7B 2RDGA 2GRQB 1WR6E 3AS5A 1HZ6A 3PZ8A 1AWEA 2HE7A 4GYWA 1OCOE 2H6HA 4K2PA 2XK5B 3FILA 1DYNA 2KQ7A 1Y5OA 4N9F4 4F7ZA 2OEWA 4GYYA 2KIGA 3KY9A 2CU3A 3OJ4B 4EEWA 5BT1A 3FVCA 1T5XD 3NVWA 3I4GA 4U0ZA 4HWIB 2INDC 2K0PA 2FF4A 3TXNA 4HAUB 2DX1A 5FQ7A 4M3OA 4AXHA 3UKUG 1C79A 2GRIA 2RSUA 1HBKA 1YIWA 3QAQA 3FP3A 5DH9B 1KLUD 1L6VA 5C6RA 3Q9UC 2ZZPB 3CVPA 1E8YA 1DOIA 2HJ1A 2QMTA 4YDWA 1U5GA 4BY6A 3NZUA 5LNK1 3KLSX 1NVLA 2ZGGA 1EUVB 3HDXA 2P0FA 4MGZE 2KLGA 3KSYA 3CKBA 4BX9A 3L22A 1FEHA 1P7FA 4US9A 3QHTA 1WJUA 5T8IA 2N9KA 5CECB 3UM2A 3P63A 2FDQA 3SO6A 2C7HA 5ENNA 2GRRB 4KIKB 4LNIA 2P9KG 1C76A 1WYWB 1UWXA 1P7EA 4YVQC 2CKHB 3ZGZA 3DXKG 5D0QD 3TEWA 2EIME 2ETBA 2YQ8A 4WAFA 3N1XC 2MYOA 1RFAA 4WAAA 3ZTCA 3TVVA 3SZ7A 2WXHA 2EQXA 2UZRA 1IQRA 4LDTB 3BINA 2B0OE 2IO3C 2LAHA 2RFAA 2C60A 3I3NA 2NBVB 4GDLA 2P9IG 1FM0D 4RGNA 1MJDA 2P2CP 2SAKA 2ILRA 1N4PA 2KWDA 4KHBB 3CVYA 5BYRA 4JA7A 2P9SG 3TMPB 2YLMA 3IT4B 3TBLD 3GZ2A 2KR0A 4J0UA 4LG6A 2W2XD 1ACCA 3HQCA 3B1LX 1RJ2A 4B8AA 3ODXA 1GOZA 4BWRA 3PEUB 4EJNA 3E32A 3Q9NC 4EZKA 3FH7A 2DENB 1QQEA 1JROA 3TWTA 4C4VB 3FUHA 3VRAB 2UZSA 2L32A 4B89A 4BOZB 3UTMA 2Y7BA 2BYFA 2WMNA 2L0FA 1N9AA 3KZ1A 4ZFHA 3K9PB 3UKRG 1CK1A 4ITKA 3QWPA 4Y94A 5HE3A 5KCVA 3T3NA 1OT8A 3SBSA 1FO4A 4C0MA 2LSUA 4GMRA 3OJ3A 4RQIA 1Z3XA 1F9JA 3FTWA 5C1DA 1QOAA 2BF8B 1K3ZD 3A1QB 4HPPA 1TNZA 4JVSA 3NOGD 3AJIA 2IY0B 5LOPB 3RFZB 2IYDB 1OWNA 3L13A 1XO3A 3D9HA 5CBOA 1P98A 3OXLA 4CDMA 3Q3MC 2DX5B 2EINE 1CJEA 1MIXA 3ZW3A 1I35A 2OJWA 4I9CA 4IOYX 1EWYC 4CO7A 1M94A 1P3QU 1FT1A 5ENTD 4ZOHC 1HS6A 3ML9A 2R05A 4KVMA 1KC7A 4GMLA 2RKKA 2MFQA 4HAVB 2DHKA 2BEDA 3BIID 4II3B 5HG2A 1JWMD 1L0YB 1QYMA 5I2SA 4DI4A 3UINC 3CMMB 3ASOE 2N9LA 1Y19B 4AQ7A 3UUXA 1RRPB 4TYZA 2Z0EB 3E33A 1NP7A 4MK0A 3JSVA 1E7VA 3G2VA 3FH8A 1H2TC 1LGRA 3CSTA 1OQNA 4BBNF 1UJKA 2KHWB 4OZBA 4CGVA 5KNHD 4KSLC 4P29A 4MJSB 4EE2A 4OVUA 4E3CA 4A6HA 3K9OB 3ZJUA 4FULA 3Q3JA 4UUCA 5D27A 2XHEA 1V5PA 1MPEA 3U9WA 3B7BA 2SEBD 2VJ8A 2JZ3B 1JCKB 1EWCA 3P4QB 2B3AA 5C23A 1E8WA 2BS4B 1SIFA 2KBXA 2C5LC 5KWDA 3GW4A 4EOYA 4BVUC 4ACLA 3EA6A 2R03A 3WYFB 1SZAA 3BG0B 2XEWA 3B77A 3E37A 3ZHEB 4RNAA 2ROZB 4EUTA 2BGFA 4ABNA 4DX7D 1U5EA 3LDZE 5I2MA 5CHWA 1ZBPA 3PNTB 2B6CA 2PTLA 1VBHA 4JKCA 4Q96A 3ZNGC 2V5QC 4DJAA 5HKHA 2KX3A 1KLGD 4FJVB 3ZDTA 1WI1A 3VOQA 2NS5A 3E66A 3MJWA 3FULA 5AYWD 2QC9A 1AQCA 3HUIA 2XZTG 3SF4A 2A5EA 3TO1A 4IAPA 1R4MI 3AEDB 3CF6E 2NBWB 3GZNI 3H7SA 3FTYA 3PVUA 2CRFA 3L16A 1GC6A 2ZXWE 4I6EA 2XN9C 1UEFA 3Q6BA 3EHQA
chains in the Genus database with same CATH topology
3ZYQA 4DI3A 2EJ8A 2EMSA 2X6KA 3T9LA 4IUMB 3N32A 2K6DB 1ZC4B 1JDEA 3AS8A 4ILJA 4F7AA 5FQ6A 1P5TA 4K1RB 2I1KA 3UT8A 4X57B 4HDOA 5J3TA 5KQ1A 1WY8A 4XE0A 1K5GB 2COAA 3HVEA 3FLVA 5A6CA 1EO6A 2KJHB 2O6VA 2LUEA 3B08A 4CCAA 2NBUA 3D9NA 4ANVA 1OQYA 4HPMB 1UPQA 3U3WA 5J3QA 5LP0A 4EBAA 4HJKA 3ULQA 3KUDB 1ST7A 2XQ0A 4JKGA 4N5CA 5CLQB 2J0KA 2BF0X 2UY1B 2GS0A 2C7NB 3RK6A 4L6EA 2KZTB 2KLCA 2HM8A 2J49A 3O65B 3EHNA 3JW0X 1I42A 1LXDA 2JXXA 2YHEA 4F7UP 2CFZA 3SD5A 1Z5SB 2I5CA 1H2UA 2HD5B 1P3RA 3H6NA 3FUEA 2FCNA 3VUYA 4ME2A 3R66C 3CHMA 3ONLA 1Q0WB 3ZDMC 2DYQA 1VD2A 2XPZA 3DBRI 3A8PA 1BTNA 2GMIC 4LJPB 4HHVA 2GCLA 4MRUA 4WNFA 1MQSA 4N3BA 2OOEA 4HB0B 2COCA 3JYUA 4JKHA 2JRIB 2KXJA 1MAIA 2OVFA 5BO4B 2DCPA 1V80A 2D9WA 2IOLA 1NA3A 4GPKA 3GYPA 4MELA 3K9IA 4IN3B 1J8CA 2M0XA 4GZUA 3CVWA 4O6FA 2ZCCA 4CHKA 3MA5A 4A1SA 4K81A 2MKRA 3KYDD 5CMWA 2DZKA 1WY6A 2GBRA 2O2VA 5LCWJ 3W1SA 2NVUI 3MGBA 4GYOA 2GJYA 3PHXB 1WM5A 5CMYA 3FEHA 1QC6A 4D0NB 2D2QA 3PLVA 2J0JA 3DVGX 3FTUA 1B89A 2IO2B 4A1GA 3MHSD 3RZWC 4NY0A 3ZPJA 4BSXA 4AUQC 5KJMA 2MBOA 3B7SA 1ZGUB 1Y8RC 1WIAA 5EDSA 4UQXA 4K7WA 4WJ7A 2CFUA 1OWPA 3QQ8B 2HYZA 3N3KB 3SBGA 2BWES 4G25A 1WI0A 3HM3A 2Y8FA 3B7RL 2N1VA 4HK2A 1IYFA 5G04J 2PM7A 1IPGA 4FN2A 2JY6A 1ACAA 3PNLB 1YX5B 3VQIA 2OVBA 3UT4A 2A4ZA 1U3CA 1WG7A 3D8FA 3OTNA 1R4NI 1P1AA 2LD9A 2K8HA 1WJ6A 3QARA 4TRQA 3ODWA 1Q5WB 2WXIA 4LEUA 2KGXB 5JZEB 2WB2A 5JH5C 4G2VA 4D10C 1S3SG 2KFKB 2N7EA 2FJLA 5FTPA 1HG2A 2KC1A 5LOZA 3CHRA 1U29A 1QZEA 3WAPA 5BW8C 1QQGA 4RG6A 3WXXA 4FHKA 2KTRA 4HXDA 4B6WA 3VLEA 3VLDA 4HOSA 3V61A 1HZ4A 5FZRA 3PVWA 1MIZB 2IFSA 1H6KA 4AV7A 3JQ1A 2GRMA 2MLBA 3IHYA 4NRHB 3MZLB 3CSFA 3CVQA 2OV8A 3PRPB 4ANXA 4ZRIA 2ELAA 4PS7A 3IKOB 3ML4A 3GZSA 1KI1B 5D3YA 2KTFA 3RO3A 2ZNVC 5DPTA 3RUIB 1UZXB 2L6JA 2JPHA 4I6GA 3FDHA 4N2SA 4BFRA 4CGWA 5ARFA 3LPZA 3VVWB 3G2UA 3DXCA 1X11A 5T3RA 1WGYA 1XNFA 2Y3AA 4HB4B 2AL3A 1RRBA 3G2SA 3MX3A 3QDNA 3QKYA 4DX8A 3VHTC 5C5BB 5A23A 1WX9A 2FBNA 3W1YA 4CHMA 3GYOA 4B94A 4GA2A 5CLLB 4IWOA 4EZLA 1WGUA 2GBMA 3P7ZA 1OGWA 2PQNA 3RIBA 3H1UA 4KZCA 2DAJA 2KDFB 3TIXA 1L2NA 3ULBA 5IJMA 2LVQA 3CVXA 4W9KA 3SDLC 2YS5A 5E6PA 1UN9A 3H7PA 2KKCA 4WSFA 4L1BA 2L00B 3D9OA 4KV2A 3X0WA 3LVQE 2N9EB 2BKFA 2EKEC 5JLJB 4CDNA 1GW6A 4A6FB 2RPQA 4EKUA 3KW5B 3MKQA 1UPRA 2YINA 3WAOA 1IHGA 1DVPA 3UIOB 2QFCA 2LGXA 5M72A 1BWNA 4DHJD 3JUIA 1HG5A 3FHEA 3CK7A 2WM9A 4FJYA 4GCNA 1TZ1A 4F3VA 3RT3B 5KCMA 2IONA 2BTDA 4I6NB 2G35A 1E8XA 2L7RA 3ML8A 2YRYA 4GB9A 4JK8A 1XODA 2YVCA 2WXOA 2XRZA 1TJCA 2KCLA 3DQVA 1CMXB 2ZEQA 3SYXA 3EIQC 1WZ0A 1IQUA 3FY4A 2Y4UA 5AZHA 4ASWC 2BCJA 3HM6X 2R5SA 4AJWA 2RR9A 2L0TA 3SNXA 1V5OA 2QHOA 4GA1A 5C2YA 3QCAA 2D10A 1WX8A 2VTBA 4DHZE 3R7RA 2UWJG 1TEZA 1ZW7A 2KJRA 2Y4TA 2C2LA 2OTXA 3DBSA 4AOFA 3T5VA 3DBLI 4L23A 3JCKC 3A9JB 2X6HA 4IM0A 4KVOA 1B55A 3R9AB 4EECA 2DIWA 2Z59B 4PH4B 4Y6CA 2AEHA 2WVIA 1IRSA 1LFDA 4RMAA 3UX4A 2MWSB 5LLIA 2VSNA 4HS2A 3TXMA 5G2NA 1FAOA 2IOSA 3CXBB 5FR6A 4CT0A 3GZ1A 2GW1A 3QWMA 4K2OA 3DBHI 3UMVA 3U30A 4XKBA 1RLFA 3VH3B 4NPNA 2BWFA 4JKDA 2KCJA 4K0RA 5L95C 3ECIA 3VDZA 2AVPA 2MDXA 1KJTA 3E9PA 2MSED 2MHKA 3EIJA 3TG5A 4BT9A 2Z0OA 4ATGA 3CV0A 3QB2A 3SGHA 4W9GA 2XRYA 3DPDA 3ZVRA 5HQ8A 1NU2A 3B0AA 1SQMA 1ELKA 3SU8X 3FTZA 2DBAA 1Z6TA 1H4RA 2P8VA 4NSWA 2BUGA 3VTYA 1GGOA 4IRUA 3PZDA 4W9HA 2LKOA 4AVXA 2KZRA 4CRWA 3LY7A 3PPAA 2V8SE 4A3TA 2WYQA 4HOUA 4TKNA 1Q1OA 4AY6A 3FFLA 2J4BA 2WDTB 1X1MA 4M0WB 4UWKA 2Q13A 1XGWA 3LJ3A 2PJHA 5DBKA 4WWOA 3IFWB 5ANRA 1EF1C 3GYZA 1E96B 1WGGA 4N3AA 2HTHB 5D7GA 3CHOA 2N23A 2FNJB 2X6FA 5LFAA 3O4ZA 2D9ZA 5BV1A 3V5WA 1U3DA 4GZDA 3FUFA 2AYOB 1ZVRA 3SHQA 5JHBA 3QBVB 3D9LA 3ENEA 3PGEA 4HATB 3P6AA 3RJVA 5DPSA 4AP4C 2X18A 1V86A 2VGXA 4ZYNA 2Y8GA 2J09A 2WMOA 2ELBA 2CHWA 2LRUA 1LF8A 5D3VA 2AXUA 3O48A 3PTFC 2G45B 3ZYLA 4ANWA 3RYTA 1FCHA 4Q94A 2DZMA 4JA9A 2MQJA 2WQ7A 3VXWA 2C0LA 2FCMA 1NZNA 2LI5A 3FP5A 1HF8A 5E6NA 3RKVA 5IA7A 5AEKB 3IEGA 2DYBA 4GZ3A 2KC2A 4I9EA 3QWVA 3WIMA 5LXHA 4OYSA 3HIZA 4J8FA 4DPRA 3AULA 5JJ6A 4DBBA 2XPIA 3QJZA 2BPSA 5HI7A 3UPVA 3ODOA 2RGFA 3CQCB 3SV1A 5J08A 2PQRA 2LSVA 5FJYA 1P0RA 1HB6A 3FH5A 3D9IA 5C1ZA 3FM8C 2KK8A 3FUJA 1W1HA 4GU2A 2D07B 2DAFA 4UWLA 1EPUA 3D9KA 3PS6A 4KDLB 2JLBA 3U8ZA 2M4NA 2JEKA 1C3TA 2UVMA 4MGIE 1AARA 2MW5A 2LXAA 4IM2A 4DBGA 2VQ2A 3L08A 3MCXA 3RRNB 2QKLA 4GMXB 2R82A 3UINB 3QA8A 2KN5A 5E75A 2FAZA 4HCPB 4P7IA 2WPVA 2H7EA 4A3PA 3T5XA 4A3OA 1PY1A 4BT8A 4DWFA 4M8NA 5AJLA 2WXLA 3I5PA 4LERA 4ICVA 3SNHA 3FUNA 1H10A 2GBKA 4WJQA 3NF1A 2IQCA 3B13A 2D4QA 3M3JA 3WAMA 4W9RA 5G55A 4I6LB 2RUKB 5CHFA 3BJIA 1WE6A 3AU4A 5FT9A 1JWGA 3S7DA 4Q69A 2XGMA 3L6AA 1WGDA 3IVFA 1N54A 4NACA 2ZVOA 3TGOA 3PUJA 3URZA 4GDLB 4ZRJA 3LY9A 1GNUA 4K7SA 1V5UA 3L10B 2XCBA 2JVCA 4XWXA 3V6CB 3RCZA 3N71A 1JUQA 4PUCA 2M14A 4PDXA 3X23A 5E76A 2YHCA 2WXMA 3H9DA 2MRIA 2R2OA 2VSXE 4B0ZA 3ZTDA 3KVFB 4AWJA 1E5WA 1ZKHA 3A4SC 2RQ1A 3PE3A 1KT0A 2FCSA 4KVGB 2K25A 4GPTB 2LRWA 2NPTA 2IO0B 1X05A 4HCNB 4MGKE 4ACKA 2ZCBA 3ZO5B 4I1OB 4ILGA 5C79A 4XI0A 2UYZB 5EKQD 3N7CA 2VSZA 2PM6A 2J9QA 3RO2A 4AY5A 4NQ0A 2DZJA 4G0NB 1IYGA 5DPWA 4LDTD 2P0DA 1BAKA 3PH0C 2VSYA 1WF9A 4K7UA 2N1WA 5CCMA 1NA0A 3CVUA 2GGFA 1FVHA 3D9JA 3ZLZA 3VIAA 2BYVE 4C0EA 1J0WA 4V3IA 3JSVB 4Z2NA 2LOZA 4DXAB 5FZSA 1WVHA 2KD0A 4XKCA 2XQNM 3ESKA 2WX0A 3PRMB 2KWVB 5D3XA 1OMWA 3ASDA 4GZ5A 5DCNA 1BTKA 3NY5A 3MEKA 4KDIC 1UW4B 2KFJA 4KHAA 1XD4A 1YQBA 2C9WB 4UWHA 1YX6B 3MTNB 1MK7B 3C98A 4CYEA 3L17A 2LG1A 3ZGQA 5BNWA 2LNIA 1XD3B 3ASHA 4GA0A 3RD2A 2VRWB 2J59M 1WJ4A 2N9PC 3PG7A 2OJRA 2D9YA 4F8CB 3ZRFA 3FTVA 1WXAA 3F5RA 5J90A 1YJ1A 5JHAA 1TJ6A 1WR1A 5CTRC 1TXDA 1WXSA 4GMJA 1ZC3B 2NSZA 4A5KA 3CK8A 3TCAA 3PSCA 3DVNV 4ANUA 4HB2B 4KAXB 1UGMA 5D94A 2MRPA 3SBTA 1WM3A 4G23A 1UH6A 4JQWC 4NAWA 4H7XA 4H7YA 5FZQA 4WWPA 5DHAB 2C7MB 3ONKA 3MV3B 1W1GA 1WH3A 1M7EA 2KCKA 4JW1A 4JEHA 4JK7A 1ZSQA 4KBQA 4AJYB 4A6KA 4F7HA 2WWZA 3Q15A 3AU5A 2N7DA 1TJFA 1C1YB 2FCQA 3VUXA 1NDDA 3LCAA 4FLBA 2DKQA 2KMCA 2KDBA 1OWMA 3HVEB 3UQAA 4JKEA 4I1MA 2YT0A 4G1TA 5JHHA 2O6VB 3I3TB 2D9VA 2WH5A 3UZTA 1KLVA 2FJ9A 4B8CB 2IU1A 3VTUA 3CHPA 1U5DA 4XC2A 4A20A 2K8CA 1EF5A 3UIPB 3KRXA 1J19A 2VYIA 1X1GA 3ASGA 3RRUA 2NPTB 2AWTA 3A33B 4JKGB 3GOEA 1ZU2A 3KUCB 5CHVC 1HB8A 3IHVA 3KS2A 3FSSA 4JEUA 3QX1A 5AIJA 3NHEB 3ZUNA 2IY1B 2KCVA 2HRJA 1UELA 3A4RA 4PS3A 1WZ3A 1YD8U 2CHXA 4HORA 5LONB 3ZFWA 1WXMA 4JL9A 3TG4A 3QIJA 1MPHA 3RU0A 1VCBA 5J18A 2KANA 1XR0B 3A9KA 4WJOA 2HO1A 1NI2A 2K1FA 2I5FA 4JC8A 3FUDA 4IM3A 4TQ1A 4KSKC 4U8HA 3D9MA 1EAZA 4MT7A 2L0IA 2LYDA 3FUIA 4NQLB 2LWPA 2N9XA 1H0AA 4FADA 1DDWA 3OXFA 1WMHA 4GCOA 4WWNA 1WX7A 4FHJA 4I2ZA 1UBIA 4EQFA 3EJNA 1E8ZA 2V1YA 2YF0A 1DDVA 3BEEA 1LM8B 4C0AA 1XQQA 1V61A 4W9CA 2DYMA 4ICUA 3G2TA 1VDYA 2DN6A 1RAXA 4MM3A 3VH4B 2IJGX 1WJ1A 4BKTA 4GDKA 3HHMA 1BT0A 3TW1A 2WXPA 2O2VB 2KUPA 2MP2A 1P9DU 3E9OA 4YNDA 2XK5A 1FB8A 1I2HA 1V5TA 3JYSA 1ELWA 4BKSD 2CAYA 3ESLA 2QKMA 3V60A 4RVBA 3LEWA 4U0UA 1WGQA 3P1UA 4UWGA 1NBFC 4EZJA 4RM8A 4CEMA 2JF5A 3T06A 5JP4A 2YS1A 3ALBA 4I1AA 5J17A 5HE0A 1YA0A 2AL6A 2RVBB 3M62B 2GBNA 2LGYA 5ARGA 4KYOB 2R0DA 2OQBA 3FU0A 5JHGA 2V3SA 2COPA 3CVVA 4ZDVA 2FIDA 1G6JA 4KIKA 2KDIA 3CIAA 2M17A 5AJDA 4I43A 2V0PA 3QC1A 3DOWA 5DIFB 3OLMD 2KWCA 2JUOA 4NURA 3PV1A 3DXDA 2KJ6A 4K03A 1KLXA 3DVGY 3PRZA 1DBHA 3ZXSA 1X1FA 1WM2A 3LS8A 5FQ8A 2FUHB 5L83A 2JWZA 3P2BA 4G26A 3LKUA 2CG2A 1HFAA 2FULA 3S2AA 3UT7A 2R09A 3OANA 3EFUA 4BBNC 2LZ6A 2KTRB 2DYOA 3EC8A 4MH0E 3ZEFA 1K5DB 3LYAA 1HXIA 4F53A 2N0YA 1HH8A 1EF1A 2PE6B 1V2YA 1E90A 4BX8A 4APFA 5J3YA 2ZJDA 2WXKA 3OXGA 2RNRB 3JVZX 4GGQA 5EX3A 1KT1A 3CEQA 2L05A 4KMOA 3Q4AB 2O6VD 3S7BA 3RZFA 1Z3YA 3A1QA 4UI9J 4LCTA 2DA0A 2XGSA 3E9LA 4TQ0A 1LB1A 1UG3A 2CU1A 2LVOA 2DX5A 4WUYA 4U04A 4G3XB 1WMHB 5DIZA 2KQSA 1PC2A 3QNKA 4LUNU 2ROVA 2NZ8B 1UD7A 2LJ5A 2CY4A 3ZRHA 2JP2A 2YT1A 2L2IA 4EBAG 5HE1A 4EMOA 1X86A 4IFSA 2CS4A 3CVLA 2LASA 1D3ZA 4UQZA 2J7QB 2L76A 2ZPYA 4N2QA 3PHWB 2XBBC 1V49A 3VTVA 2LVPA 3EDTB 2IF4A 4MJSA 2IO1B 3PT2B 4I17A 3UQ3A 2CHZA 5D2MB 2FI7A 3ASFA 1UNPA 4GMVA 4GIVA 3IHPC 2MA9B 5BUZA 1U4AA 5DI9B 3H7PB 4J8DA 4R7LA 2DTCA 3ZHEA 5DPRA 3D32A 3M63B 4BOSC 4UI9K 3ZKJC 3MKQB 2EMTA 4OVVA 2E0IA 3BG1B 2LULA 4NNJB 2ZVNA 2ONDA 3KD7A 3O96A 3CHSA 3KAEA 5CCLA 2CODA 2Z0DB 2X3MA 1XKEA 1SGHA 4JHRA 1V5MA 3FU5A 4DDGD 3CIKA 2LBBA 3QK0A 4M8MA 4EPZA 1OTRB 3MKRA 3IG3A 4MY6A 1DNPA 5FQ4A 3N30A 3VFKA 3I4RB 4AP2A 5A7DB 2LGDA 4N3CA 1UBQA 1PQSA 3A98B 3ZVVA 3DDCB 3AXCA 2HR2A 3M95A 3G2WA 4IULA 1N3HA 1FGYA 3FTXA 1H8CA 1A17A 2L0TB 1UNQA 2PZIA 3D8EA 3NOBA 1WE7A 4U63A 1Q67A 5JJ7A 1V88A 3RULA 3UF8A 2BKRB 2IO3B 3KUZA 4HVBA 1PFJA 4W9EA 2VTBB 3FUMA 4JKAA 4JL0A 4GOCA 4GAAA 1Z2MA 1V6EA 3Q3FA 5BPPA 2DFKA 2X38A 3CVNA 3CGHA 2V76A 4G11A 2UY1A 3B7UX 3LXUX 3QWZB 2CG3A 5FWQA 4WJPA 2KZTA 3EPYA 4XZ4A 4F1SA 4HXIA 1JRUA 2ABDA 1LQBA 2PL2A 3ZN3A 3PREA 2J4DA 3KRWA 3DCGA 2M8SA 2AWIA 4YVOA 3R7QA 5G05C 2D11A 2V4LA 3RRMB 3MV2B 4BKSA 3PSEB 4Z2MB 3ZYMA 2XCCA 3D3MA 1UNRA 2DHIA 1DIKA 3L0WB 1J0GA 4RG9A 5KJLA 5GMVA 2YSZA 5AENA 1P6SA 1KZ7A 2N4FA 2XGOA 4WNDA 2WQ6A 1MG8A 2LO6A 1L5JA 1INZA 3DVNU 2R59A 1FHOA 2ZU6B 2G4SA 2GRLA 1H19A 1BPOA 3D8DA 4A3VA 4PS8A 4FU3A 3HK0A 2X6JA 3MPXA 3FUKA 2AW6A 4G24A 4UI9C 1GUAB 5KJKA 2KATA 3ULCA 1ZM0A 2MX2A 2W2WA 4MSMB 3A8QA 1U27A 4DK5A 4I2WA 4B9KA 3T8MA 2I2OA 1WGRA 5EX0A 1NTIA 4W9DA 2VKIA 2KDEB 3KH0A 1XT9B 1V81A 2Y5BB 4JZYA