3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
molecule keywords Myosin-X
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
2LBBA 4GZUA 2ZVOA 3V6CB 4K2OA 1YX5B 4AJWA 3VH3B 5LONB 3QA8A 4KDIC 4HB2B 1YD8U 3PV1A 1FHOA 3ZTDA 3PVUA 2BYFA 3R66C 4MJSA 2FJLA 2GOWA 3JSVA 2UVMA 4NAWA 2ZEQA 5D94A 4G0NB 3R7RA 5J2RA 4XZ4A 2YS1A 2BCJA 4HAUB 2KJHB 2XBBC 1VD2A 1UD7A 2LGDA 3SD5A 1DDWA 1I7AA 2RVBB 1WGUA 2G4DB 3ALBA 2J0KA 1S1QB 4BBNC 2LGXA 3KRXA 2I5CA 3A8QA 4BKSD 4WJOA 4CO7A 4LDTB 5L83A 3OAWA 2L00B 4FLHA 5IJMA 3IHPC 1C3TA 3H9DA 1FB8A 5D27A 3JW0X 2CU1A 2FUHB 2MWNB 2KTFA 1UBQA 2KTRA 1MK9B 2RPQA 3M62B 4PS8A 5HE0A 1QZEA 5IAAC 1FAOA 1UPRA 2MRPA 2BWES 2L1CA 3DCGA 3ZW3A 3O96A 1YJ1A 4HXDA 5CHWA 2KJ6A 4M8MA 1JRUA 4AUQC 2DZKA 5L95C 3CMMB 2LOZA 1P6SA 1OEYA 5JHGA 1U5EA 1GNUA 1RRBA 4MH0E 3KY9A 2WYQA 3TO1A 3AU4A 4W9KA 5CTRC 1IP9A 1RRPB 2IO3B 2Y5BB 4IC7B 1MKEA 1J0GA 2DX5B 3KUDB 2D11A 1OTRB 3VUXA 1TBEA 2YF0A 1V49A 2KLCA 3A33B 2UZRA 3PSEB 5G55A 1S3SG 3TJPA 4ZRKA 2DHJA 5DH9B 4KIKA 4TV3A 3NZUA 4HJKA 1KI1B 3D8FA 2O6VA 4NY0A 2K2JA 2JF5A 2MBQA 3ENEA 4GGQA 4RM8A 2COPA 1K5DB 4F7HA 2RGNB 1KZ7A 1BT0A 3ZRFA 4HCNB 2LWPA 2Z0EB 3WA0A 1GG3A 1U4AA 1XODA 2DKQA 3DXCA 1Y19B 4NQKE 3TFMA 5BO4B 3GYOA 2C5LC 2COCA 5AZGA 2BPSA 2KQ7A 2CQUA 2ELAA 3VTUA 1EUVB 1WE6A 2LGYA 5CX3A 4W9GA 2DYQA 3N7CA 4WAAA 1K5GB 1FXTB 3QX1A 3WAMA 3GZNI 4K7SA 4P7IA 3RCZA 2H7DA 1E8WA 1R4NI 4ASWC 4HB0B 2DZIA 2I5FA 2KC1A 2HTHB 4XX5A 3PS6A 2PPHA 5TR5A 5E6OA 1E90A 1Z2MA 4OVUA 5DPTA 3HK0A 2BYEA 4GXBA 1FHXA 2UYZB 4IWOA 4W9CA 2GBKA 1Q5WB 4W9LA 1U5GA 1OGWA 4K7WA 2FJ9A 2EJ8A 4URKA 4LDTD 4HAZB 2K1FA 1TQZA 2MCNB 1KZGA 4IAPA 1PMSA 2DN6A 3PSCA 3SYXA 2FCMA 3ZNZB 4MK0A 2MBEA 2NR2A 1NTYA 4RMAA 5JP4A 5DI9B 2Z0DB 1UELA 3O65B 3LJUX 2A5UA 1Q67A 4EJNA 2OOBB 5D3XA 2ZCCA 3R3MA 4MJSB 4X57B 1WR1A 2V3SA 3P6AA 3UINB 3PRPB 1X05A 1ZKHA 1L2NA 4GSWA 3A9KB 1AARA 1WJUA 2DAJA 3D8DA 2QKLA 2KDIA 4HAXB 4MGIE 4LJPB 3PRZA 4D0NB 2ZNVC 1L7YA 2Z0QA 2BF8B 2M0XA 1WXMA 4MGYE 1PLSA 1P1AA 1XQQA 1U29A 2JPHA 1NTVA 3FSSA 1UH6A 2M14A 1DBHA 2Z0PA 2CRFA 2KDFB 4A6HA 2RSGA 2L05A 2HD5B 3DQVA 3IBEA 4KAXB 3L16A 3M63B 3NHEB 3ML4A 2R0DA 3ZUNA 1AWEA 4ANXA 3UQAA 2LG1A 2IYDB 2ZPNA 3ZRCA 5JZEB 3VOQA 1P3QU 1Z5SB 5CLLB 2BGFA 2JUOA 4PNKA 1OY2A 2AWTA 4ANUA 3N32A 4W9JA 2L3ZA 4DBBA 2KZRA 5D7GA 4B9KA 2LULA 3PLVA 3RULA 4CHMA 2LVOA 3L13A 3KVFB 1Y8RC 3KUCB 4GIVA 1RJ2A 1FOEA 2DTCA 2H7EA 4HB3B 2KFKB 2ROZB 2RUKB 3F5RA 2MP2B 2N1VA 2RGFA 2WWZA 3AXCA 4M0WB 4I6PA 4AOFA 1WZ3A 1QC6A 1E8YA 1WM2A 2HRJA 3IG3A 3RD2A 1EAZA 4MEMA 2I1KA 3M1IB 1C1YB 4DHZE 1M7RA 2CHXA 1TJ6A 2WX0A 2Q13A 1LXDA 2A4ZA 3NSUA 4HATB 4CHJA 2DENB 2MWSB 3C0RB 3RUIB 3L54A 1TGZB 2KWVB 3L0WB 2Y8GA 1KOTA 2DX5A 3P2BA 2R09A 5D3WA 1J8CA 3S2AA 5GOWB 3QHTA 2AYOB 2FCNA 3VH4B 4IW0A 4MSMB 3ULBA 2MDXA 2K25A 2YSZA 4AWJA 2C7MB 4HDOA 2CS4A 2O6VB 1XKEA 4ICUA 2ASQA 3N30A 4F7GA 4KZCA 2IO2B 4WJNA 5G2NA 1GUAB 2MW5A 3ML8A 3UF8A 2IY1B 5C5BB 1WM3A 1ZM0A 4K2PA 2KVRA 2ZZPB 5C23A 4ANWA 4HLEA 3QBVB 2KQSA 4NPNA 1FGZA 4HHVA 3DVGX 1W1HA 5D2MB 5AZFA 2COFA 5FR6A 3VHTC 3W1SC 3WANA 3A4SC 4GDKB 2DYMA 3HIZA 5GMVA 3CIKA 1J19A 2G4SA 1IPGA 2LRUA 4I6NB 1FHWA 2FCQA 2KD0A 3WAPA 3DDCB 5JHBA 1H4RA 1CMXB 2MSED 4EZJA 2Y8FA 1P98A 2LD9A 2CHZA 1ZSQA 3TCAA 3A1QA 4TQ0A 1QQGA 2HTHA 2RD0A 4ICVA 3WYFB 4DDID 5HKHA 3Q3FA 1WVHA 4BFRA 4JLCA 4H8SA 2NZ8B 1WJ6A 3BY4B 4TUUA 2KNBA 4B6WA 4KSLC 4EKUA 1EO6A 1LW3A 4IWPA 5LOPB 1NBFC 2R2QA 4GDLA 2AEHA 3PHXB 4LCDE 1U5DA 5DHAB 4Z2MB 4IOYX 5J3YA 2E2XA 4KHAA 2YS3A 2KLGA 4HB4B 2YLMA 4ZDVA 4NQLB 1RLFA 2I1JA 4KHOA 2J7QB 4KSKC 3UZTA 2D4QA 4XWXA 3QAQA 1UNPA 2DLWA 1MIXA 1X1FA 2ROVA 3ZVRA 3V62A 4WVFB 2M17A 2K39A 2DKPA 1OQNA 4C0AA 4DX90 5J3TA 2O2VB 3PPAA 4KZ0A 4DBGA 4E74A 2CB8A 2AL6A 4EZLA 1UNQA 5C5BA 2N23A 3T8MA 4DX8A 3M3JA 2MKRA 2YT0A 3BJIA 3MDBC 2C7HA 1V88A 2D3GA 2GBRA 2R2OA 3B1LX 5LLIA 5LXIB 1P3RA 2KANA 3CXBB 1NDDA 2DZMA 1B55A 2L0TA 3SU8X 2L76A 3MHSD 2KDEB 3V60A 3KH0A 1NI2A 4WJPA 5J18A 3ECIA 1LFDA 2NS5A 4PS7A 5DPRA 1V5OA 1WJ1A 1K8RB 2ZJDA 4BBNF 3VFKA 1F9JA 3X23A 3LDZE 2CY4A 3ODOA 3HW2B 3M95A 2JXXA 1EGXA 2JRIB 1BWNA 4WJ7A 3QK0A 2LYDA 2REXA 1WZ0A 4A3PA 1ISNA 2EMSA 3QIJA 3ZVVA 4EZKA 2L0FA 3IFWB 5IA7A 1AQCA 3MPXA 4FADA 1WF9A 3OLMD 2V76A 2P8VA 2V4LA 2D07B 3UQBA 1BTKA 1WJ4A 4YONA 4TQ1A 1WI1A 1PQSA 1RFAA 4AJYB 2MP2A 3ONSA 3D8EA 3EECA 1HE8A 3V5WA 1E8ZA 1V2YA 1XX0A 4Y94A 4PQ0A 2OJRA 5JHHA 1WI0A 2KX3A 1YIWA 1X11A 2CKHB 1EF1A 2KUPA 1RAXA 5JH5C 4FHJA 2RSUA 1P9DU 2L7RA 1DROA 2GBNA 5DHFB 1KLVA 4NSWA 1ZGUB 2C7NB 2CR5A 2DHZA 3QWZB 3UIOB 2M1MA 3WIMA 3OJ4B 2WDTB 1E8XA 3SUZA 1V5MA 3W1SA 1U27A 3GYPA 1LQBA 2CAYA 2OTXA 1TTNA 2K2UA 3SO6A 1XT9B 2K6DB 3KRWA 5D6JB 3PZDA 2DHIA 3QQ8B 4K1RB 3RT3B 3ZKJC 4DHJB 3H6NA 3RZFA 2CHWA 5HE3A 3QC8B 1ZW7A 3AI5A 3A98B 2KDBA 1Q0WB 2V1YA 3DVNV 2N9EB 2KN5A 3VVWB 1SGHA 4HDQA 2MA9B 4HK2A 4GDLB 4IWQA 4GMVA 3RCPA 2CODA 2YVCA 2IBIB 5KQ1A 2KMCA 3HQCA 4GDKA 3ZDMC 4TKNA 1MAIA 2MX2A 4WWPA 2FNJB 5J3QA 3JSVB 4IUMB 5KHQA 2PZ1A 2ZNVB 2BYVE 4KIKB 1P5TA 1UPQA 1UBIA 3WAOA 1DYNA 3CSTA 2GS0A 3NZSA 4PYZA 1MK7B 2K6QA 4XC2A 4NAWB 1SE9A 1P0RA 1WG7A 1ACAA 3DBLI 4EEWA 3FP5A 3Q3JA 4ZRIA 1GJZA 3AULA 2GCJA 3ZDTA 1WMHA 2OQBA 3AJ4A 2COAA 2RQ1A 1U5FA 4GN1A 5CLQB 2D2QA 3U8ZA 4DXAB 3EHVA 2LVPA 4DHJD 1NTIA 2CY5A 2IFSA 3VXWA 1HB8A 1LB1A 3WALA 4MDKE 1LM8B 2N7EA 1V61A 1WGRA 3VTVA 1XD4A 5KHOA 3ZTCA 2IO0B 2LVQA 3DBRI 4JQWC 4LJOB 4EMOA 1TXDA 3VDZA 4II2B 5DPSA 3U7DA 2DAFA 4IG7B 2KKCA 2KX0A 2LUEA 4JL9A 3ZNGC 3NY5A 1OQYA 2G35A 2YT1A 5D3VA 2K8CA 1OEYJ 1V5UA 4M8NA 2M4NA 1HB6A 3PVLA 2NVUI 4HVBA 2XEWA 2Z0OA 4A6KA 2JT4B 3EFUA 2VSZA 2JRHA 2NBUA 2X18A 2LZ6A 2ZPYA 3DVNU 3A9KA 3A9JA 2NMBA 2GBMA 3SHQA 3TBLD 1W1GA 5DPWA 1WJNA 2MQJA 3APFA 1ST7A 1U2BA 2YS5A 5KCVA 1T0YA 2M38A 2IYBA 3G9WA 3PEGA 3VUWA 3X0WA 1I42A 1KM7A 2QKMA 1Y5OA 3PVWA 2KJRA 3L08A 1EF5A 3UGBB 5EFXA 4WWNA 4II3B 2N9XA 2HE7A 2DHKA 3IVFA 2G45B 5JLJB 4WJQA 3T06A 1EVHA 2C9WB 1NU2A 2EKEC 2PE6B 2N4FA 3I3TB 2IY0B 3K9PB 1X86A 4G50A 3KW5B 2LJ5A 2KWUB 5C1ZA 1IRSA 2HJ8A 1BAKA 4GMXB 3TIXA 2DYBA 2WH5A 1M7EA 1UNRA 4NJ6A 4K7UA 3SV1A 3JVZX 1IYFA 3DBSA 3UIPB 2XK5A 4JGHB 4HAVB 3P7ZA 1X1MA 2ELBA 2P0FA 1FGYA 2LASA 3PHWB 3QCAA 4KDLB 4RM9A 4ZRJA 2GCLA 4BBKA 1M94A 1SHCA 4A3OA 5LXHA 2NBWB 2D9XA 4F8CB 1V9JA 3CF6E 1ZVRA 4GB9A 1VCBA 4MM3A 1XR0B 4HAYB 4MGKE 3HM3A 2DX1A 4L6EA 1WXAA 3CSFA 1ZC3B 2IO1B 2MBBB 1MPHA 1SIFA 1WR6E 2ZCBA 4BOSC 5L81A 2N7DA 4Z2NA 4DK5A 2Y7BA 4A20A 1Z87A 4IM0A 5HE1A 1WH3A 1V81A 2C60A 3PRMB 5EDSA 3ODXA 1OMWA 2DA0A 4WSFA 1WX8A 4E71A 1DDVA 2VRWB 2FDQA 5C6RA 4OVVA 5JHAA 3PT2B 2D9VA 3NOBA 2KTRB 4DHZB 2PJHA 4NNJB 1WMHB 3DXDA 1XCGA 1WGDA 3BINA 3A8PA 1MG8A 2QHOA 3FM8C 4W9DA 4YL8A 3JYUA 3AU5A 3ULCA 2RLOA 4FHKA 1BTNA 1YQBA 3PTFC 3ZO5B 2D9ZA 1V86A 3H7SA 1H8CA 3B0AA 2KGXB 2RNRB 5AEKB 1ZC4B 4J6IA 3VQIA 4FJZA 2B3AA 3H1UA 1WGYA 5E6NA 2KXJA 2BKRB 1WXSA 4DDGD 1GC7A 5J17A 3PG7A 4A6FA 4TYZA 1WE7A 3APDA 2K00A 3K9OB 4HAWB 1UEFA 3TVVA 4F7UP 2FIFA 4HCPB 2O6VD 5CHVC 2W2XC 2FIDA 2NBVB 1GC6A 5C16A 1E7VA 1WYWB 1WGGA 1WIAA 3A1QB 4EUTA 2FCSA 2KFKA 2LI5A 5HE2A 3N3KB 4F7ZA 1MIZB 2VKIA 2MLBA 4PS3A 4FJVB 3TL5A 4FBJB 1V5TA 4FN2A 4MSQB 4WQOB 1UZXB 4BKSA 4CHKA 3A9JB 1I2HA 2PEAA 2EC1A 4E3CA 2UWQA 2LOXA 1WX9A 1HBKA 2KFJA 3KYCD 2MBOA 3L10B 4GOCA 2W2WA 3GOEA 2KO3A 3DOWA 1PFJA 3ZLZA 4KVGB 3TW1A 3APCA 2ADZA 2FAZA 5DCNA 4G11A 2XQNM 3F0WA 3LJ3A 2JY6A 5DIFB 3QJZA 2O2VA 2L8JA 4BKTA 3EC8A 4K17A 2LXCA 2W9NA 2EMTA 1E7UA 3PP2A 3R7QA 4GU2A 4MELA 4ANVA 4B95A 1DDMA 2GBJA 3KYDD 3RYTA 2GJYA 4KHBB 5D3YA 1R4MI 4W9IA 3VAWA 4DWFA 4A6FB 1WFYA 4KV2A 4FJYA 1V80A 3B08A 2KWCA 4IM3A 1X1GA 3DXEA 1WX7A 2XK5B 1Q1OA 2N1WA 4WWOA 1V6EA 2N9PC 1WXVA 1YX6B 4HPMB 3ZNID 1UGMA 4CYEA 2UZSA 2MFQA 4EFOA 3OANA 2M8SA 3HHMA 2NPTA 1TZ1A 1V5PA 1XD3B 2KMAA 3FLVA 4W9FA 5CHFA 2D9WA 2ZVNA 2DYNA 4IM2A 3RZWC 3KSYA 5FI0A 4W9HA 4FULA 3L17A 3H7PA 5E6PA 3PLUA 4HWIB 2D9YA 4N9F4 4JIOU 2JWZA 2K8HA 2LXAA 1W1DA 3OJ3A 3QWMA 1WJMA 2BWFA 4A5KA 1WGHA 3D32A 3V6EB 4BVUC 4GPTB 4I6LB 5AZHA 2PE9A 2VRRB 3NS8A 2LRWA 3VTWA 2ABDA 4FA6A 4MY6A 2RR9A 2Z59B 1N3HA 3U30A 2KHWB 2MBHA 2AL3A 2DYOA 5C79A 4F1SA 3DVGY 3T9LA 3W1YA 2KOXA 2J59M 1A5RA 1WRDB 2JZ3B 2K8BA 3MTNB 4K81A 1I35A 3ODWA 2NCNA 4B6HA 3MJWA 3TMPB 2IZVB 3VUYA 2GMIC 2WX1A 3A4RA 2P0DA 5FI1A 3EPYA 2J0MA 4AP4C 1WY8A 2DZJA 3FEHA 3ZIMA 1KJTA 4NJ7A 4G3XB 3SDLC 2L2IA 3ZNHB 2KC2A 2JZZA 2P0HA 3SNHA 2LKOA 2BKFA 2NPTB 3DPDA 4W9EA 2D10A 3VIAA 4BKGA 3DBHI 2KK8A 2JP2A 2YRYA 2KCJA 3KZ1A 3PGEA 3PREA 4BOZB 4ZYNA 1J0WA 2J0JA 5KQ4A 3KUZA 3QARA 1NVLA 1WGQA 3ML9A 4EOYA 3HM6X 2JVCA 1D3ZA 3V61A 1G6JA 4MT7A 3H7PB 4PYUA 4HPLB 1E5WA 1H10A 2G3QB 1V89A 2DFKA 4MGZE 2W2XD 2N0YA 4IFSA
chains in the Genus database with same CATH superfamily
2X6IA 4GZUA 4K2OA 1YX5B 3Q8FA 3CWIA 4WNGA 3ZQ4A 5LONB 2B76B 4YDEA 3PV1A 3PE4A 3SFEB 4GOUA 1FHOA 3ZTDA 3PVUA 2BYFA 4MJSA 3R7RA 3JSVA 5D94A 2UVMA 4EE2A 3ZFWA 2GLSA 1TS2A 2XBBC 2XENA 3SD5A 2LGDA 3ABVB 1DDWA 2RVBB 3EIQC 3U4EG 1WGUA 2FBWB 3Q6BA 4KHBA 1K53A 5BV1A 4LDTB 4JKGA 4FLHA 5H8YE 3JW0X 2KTFA 3FUJA 4U8VD 1KBLA 4PS8A 2RPQA 4XIFA 5IAAC 2MRPA 3DWMA 5BNWA 4HXDA 4S0RA 4AUQC 2DZKA 2LNIA 1T0SC 2LOZA 1P6SA 1AN8A 3CMMB 3IXSA 2P9UG 3UX4A 4MH0E 4WQMA 2WYQA 3PZ2A 3AU4A 3HUIA 3DBLB 1FEHA 1RRPB 4UQXA 1IP9A 4RLYA 1MKEA 1TKGA 4U0ZA 2QEJC 3CHSA 3NZ3A 2VSYA 2UZRA 4ZRKA 4ZFHA 2DHJA 4U04A 1SE3A 4Z68A 3W5UB 2KQ4X 1TIFA 4EUTA 4C0MA 3H8HA 4WWMA 1BT0A 4L9PA 3AE8B 3VTXA 5T4YA 2LWPA 3V2XA 3WA0A 1GG3A 5BO4B 4D2KA 5BYSA 2COCA 1XEEA 2CQUA 2ELAA 1EUVB 2LGYA 4LNGA 1TNBA 2PM6A 2JLBA 3AE1B 4GTRA 3UI3A 1K5GB 1FXTB 4F3VA 2LEKA 3ULEG 2H7DA 2R5SA 4XX5A 5E6OA 1E90A 3U12A 3G2WA 4OVUA 4JKFA 2YT2A 1J7CA 1Z2MA 3MHZA 4IWOA 2BVCA 1ZP0B 3CKCA 4U63A 2EJ8A 1YJIA 4K03A 1TQZA 2MCNB 5CEAA 2YHEA 1UNSA 4IAPA 2GUMA 2W55A 4K3CA 1PMSA 4P1CC 2LSVA 4HKQA 2NR2A 1DYQA 2Z0DB 1UELA 2A5UA 1K51A 3E9PA 4X57B 5BUZA 4HNAD 5LP0A 2ZU6B 3EUB2 5D3IB 1L2NA 4GSWA 3A9KB 4I9EA 2KDIA 1HZ5A 5BXOA 4C7YA 4GA2A 4DX1A 3DSVA 1J7AA 2BF8B 2M0XA 2XCCA 4NNJB 2M14A 1DBHA 1TY2A 3QQ8B 2KDFB 3DQVA 2RSGA 2DCPA 2INDC 5FWQA 5EIDA 3T8KA 4ILJA 1IUEA 4EQFA 5CLLB 2W54A 2AWTA 3BVGA 3TWXA 4ZRPA 4W9JA 4L7TA 3R9AB 4B9KA 5A23A 3FILB 1DVPA 3L13A 2XCBA 2I2OA 2LVOA 4BETA 4I9CA 4GIVA 1X81A 2Y3AA 2DTCA 2H7EA 4HB3B 1FFUA 3CEQA 3F5RA 1HTOA 3AXCA 4KVOA 3ZGZA 1E10A 5FKAC 5T3RA 4J3OD 4JK7A 5EE0A 2H6FA 4MEMA 1C1YB 2CHXA 3DBSA 3CVLA 1TJ6A 3B7UX 2A4ZA 2Q13A 2XGMA 4CHJA 3GE3C 4K3BA 1KTKA 2XZDG 1TGZB 2G9HD 1FXIA 3L0WB 2MEKA 5LG4B 3BWUD 5G5HA 1YN4A 2D3BA 4ZYSA 3SHFA 4MSMB 2K25A 2YSZA 2WMNA 4ATGA 4ICUA 1V1PB 4UQZA 1GUAB 2KR0A 3Q4AB 4WIPA 1NYRA 5LFAA 3BG0B 2KVRA 3C8YA 4ANWA 3ZGQA 5HI1A 3QBVB 3FUHA 4A3TA 1WWTA 3DVGX 1W1HA 5D2MB 4OAVB 1KZOA 2COFA 2IFUA 1EPUA 2QCZA 3VDZA 2DYMA 3UKRG 1M4VA 2G4SA 5AYWD 2LRUA 4I6NB 3BYYB 4TSSA 5FZSA 2KD0A 2L0TB 1KPSB 3HIEA 3TCAA 4CEMA 1RM6C 1TNYA 1DC2A 2HTHA 4GMLA 2OEDA 1D5MC 2ETCA 1EWYC 3P42A 3NOGD 5CERB 3LJNA 2NZ8B 1N95A 4JLCA 3HXCA 4GYWA 2KNBA 4EKUA 2IONA 1LW3A 3TWTA 2AEHA 2GRPB 4Z2MB 1QKZA 4HB4B 1HH8A 1RLFA 4L23A 3O13A 3UZTA 1HEZE 4AY5A 3KD7A 3JQ0A 2ROVA 4RGOS 2VGEA 4JXTA 2IF4A 1IHBA 4WVFB 1ZXHA 2M17A 4C4VA 4B8AA 3PPAA 3C19A 2EKIA 2WXHA 2CB8A 4YDWA 1UNQA 4HI8A 4JKBA 2J52A 4DX8A 3CHOA 5G05C 2MKRA 3MDBC 1S64A 2C7HA 2C0MA 3PDNA 3DSWA 2GBRA 4F6RD 1P3RA 1PYWD 5FT9A 2L0TA 1B55A 2L76A 3S7FA 2KDEB 4GTSA 3ZNGA 4NZLB 1QOFA 2NS5A 3ESKA 1V5OA 3VRBB 4M3OA 3RNCC 3DBHB 1XF5L 4ILIA 2JRIB 1BWNA 3QK0A 1DGJA 1WZ0A 4G8LA 2LJIA 1UJKA 2DIKA 1H19A 1H6KA 2DIWA 3MPXA 1GAQB 5KBAA 2P8VA 3BVZA 3V05A 2D07B 1WRIA 2VSOE 1WJ4A 3LB8C 2L0IA 4M7CA 4RG6A 4AJYB 2MP2A 3ONSA 1IYGA 1B9RA 4QFVA 5C3JB 1JUQA 3LVQE 5JHHA 3CV0A 3FUIA 2LHEA 3ZYQA 2CKHB 1RAXA 5JVLA 2W82A 3KWLA 2F8YA 1DROA 5DHFB 2I9CA 3KEZA 5HHDG 3Q69A 2R61A 3ZJTA 2WXFA 2C7NB 1ROEA 2DHZA 3AJIA 3D9IA 3L9TA 2M1MA 1Z6TA 1C4AA 1XT9B 1WAO1 1LQBA 4AXHA 3SO6A 3KRWA 2BUGA 3CK8A 4S17A 3HYMB 1H6PA 1B1ZA 1FCHA 3CHMA 1OCZE 4DI3A 3TSSA 2NXPA 2RDGA 3W9CB 4HDQA 1TN6A 4IWQA 3UINC 2CODA 2YVCA 2IBIB 4QQIA 1DCQA 1FD6A 3AAAC 4WWPA 2FNJB 3ZJUA 1UF0A 3MC0B 1L4ZB 2TSSA 3VR8B 2ZNVB 4HRMB 3WAOA 1UBIA 5KHQA 3D9LA 2Q7FA 3CQCB 3B7TA 3DPYA 4Q94A 3FDHA 4JZYA 4J7WA 3DBLI 4EEWA 1ACCA 3FP5A 4ZHOA 3AEBB 1EDUA 2OQBA 1WF9A 4GN1A 1WMHA 1X1MA 5CLQB 3EHVA 5EYLA 2CY5A 2E6XA 3UT7A 4HRLA 4MRUA 2WXKA 1LM8B 2N7EA 2J4DA 1WGRA 3ZYMA 2IO0B 3DBRI 4C00A 2IGDA 3R8BA 5DPSA 2DAFA 4IG7B 2MH7A 2LUEA 1XO3A 3NY5A 2G35A 4M8NA 2K8CA 2WQYB 2NVUI 4C7ZA 3B2GA 2JT4B 2NBUA 3MC8A 3Q8AA 4G1TA 1OCCE 2ON8A 3DVNU 3A9KA 3TBLD 2GBMA 4C9BB 2QYJA 3APFA 3EFCA 1JQ4A 1ST7A 4UWFA 4K5AB 4BX9A 1I7HA 1T0YA 2W3RA 5AARA 3W5VB 4NIKA 1K1AA 2DZOA 1BXTA 1U3CA 1WG0A 2WPVA 2IGHA 1I42A 4TUMA 1EF5A 1SA5A 3UGBB 3T3OA 4G26A 4DRXE 3D9NA 2OHFA 2HE7A 3IVFA 5JLJB 2WDQB 5HFYA 2IY0B 1YA0A 1X86A 3AH7A 2IO2C 2LJ5A 2KWUB 5AQAA 5I4DA 1ET6A 4DLQA 4GZ5A 2DYBA 2XPZA 3ULYA 3JVZX 2HDEA 5B3SE 3S7BA 4JGHB 5A6CA 2FO1E 4IULA 1TNOA 3CVPA 1FGYA 3P7ZA 4KDLB 1N4RA 1OT8A 3VXWA 4ZRJA 2GCLA 4BBKA 3KWVA 4A3OA 2KIGA 3C5RA 1JPLA 2MRIA 4L6EA 3LPZA 1WXAA 1SSNA 4KGRA 4F53A 2IO1B 4BTAA 2Y7BA 1TS4A 2PMVA 4CQNA 5EDSA 4WSFA 4E71A 2Y0BG 5JHAA 4OVVA 4CRWA 5C6RA 3I57A 2V9HA 1SBBB 3URYA 3FU6A 2D9VA 3NOBA 4IKGA 1VZ8A 4BTBA 2MHKA 1WMHB 2L83A 2QHOA 3FM8C 5HQ8A 4OT1A 3Q75A 4RGNA 2RG8A 4P1BC 3AU5A 4UWLA 3UM0A 2D9ZA 3H7SA 4EHMA 5AEKB 4G24A 3QWPA 2RDHA 2B3AA 4Y6CA 4MLPA 2WXGA 1FMAD 3CVYA 3TAXA 2X3MA 4RVBA 3APDA 4TYZA 3K9OB 2K00A 1HO8A 2H88B 2OCCE 2O6VD 4YSYB 5H92C 3HXFA 2W2XC 1EU3A 1GC6A 2FIDA 2NBVB 3A1QB 4N39A 5ANLA 2LI5A 2PW9A 3G2UA 5HE2A 4F7ZA 3CLJA 4FBJB 1SE4A 2CFZA 1UZXB 4RSYA 2MOWA 3AE5B 4CZ2D 4E3CA 2WS3B 3ASOE 4HEA1 3L10B 4GOCA 2W2WA 4UI9J 1NP7A 3DOWA 2KVZA 1YQ3B 3ZLZA 3I9V1 2RPVA 1NZNA 3RMKC 2JY6A 5DIFB 2J42A 4YT0B 1E7UA 1WM5A 3PP2A 4GNKB 4HORA 1D4BA 2GBJA 3VAWA 3R2IA 4DWFA 4I17A 5CBOA 4US9A 4UDUC 3Q9UC 3HRDD 2KWCA 4IM3A 3T3NA 1WX7A 2XK5B 4WWOA 1D5ZC 4RFBA 2DWQA 1V6EA 4TXRA 2M0AA 1YX6B 1FVHA 4HPMB 2OV8A 1QQEA 4BESA 4N6EB 3HHMA 3BZDB 2K22A 1XD3B 4W9FA 4GPMA 2DYNA 4FULA 5E6PA 4L2YA 2MJ3A 4JIOU 3TXNA 2KYWA 2JQRB 3NVWA 4GTMA 1W1DA 3QWMA 4BVUC 3V6EB 1EF1C 3EGRA 4ZHPA 3DSTA 1UGJA 1HF8A 3KSQA 3NS8A 2N9KA 1QOAA 3CQGB 3Q3MC 2SEBD 1JCSA 3DEOA 4J8YA 2Z59B 3U30A 3B77A 2AL3A 3FULA 3DVGY 2BW2A 1FNVA 2KOXA 5CRVA 1SQMA 2J59M 3W1YA 1WRDB 3FTYA 1NENB 1XLNA 2JZ3B 2IY0C 1KC7A 3SBTA 3ZKJA 3VUYA 2GMIC 4B0ZA 3FFLA 2DZJA 3IHVA 3FH8A 2NMQA 5EE3A 4GTQA 4F1PA 3E30A 3FH5A 2WXIA 1KJTA 1YJJA 4G3XB 4NJ7A 3SDLC 3FEXA 3ASGA 3Q49B 4CDMA 2JZZA 2P0HA 2EINE 2KC2A 2WQ6A 2NPTB 4ZOHC 2D10A 3TUOA 3I63C 2JP2A 2H89B 4LNOA 1C4PA 2KCJA 3RNGC 2J0JA 2BF0X 2X8XX 1NVLA 5AQBA 1WGQA 4EOYA 3HM6X 1D3ZA 1PGXA 4EECA 4HB5A 4JEUA 4MT5A 3RNBC 2EIME 2W2XD 3PTFC 2ZVOA 1KLUD 1L0YB 1O1TA 3KSLA 3SFDB 3QA8A 3K9IA 3ONLA 2E0IA 2NBVA 3R66C 4FU3A 2GOWA 2XGOA 5BT1A 2BTDA 1GW6A 4GCNA 2YS1A 3AEDB 4HAUB 3ZHEB 4N2QA 1UD7A 2BEDA 2P58C 3QB2A 2RFAA 3ALBA 4KX6B 4RH6A 3E56A 2LGXA 4BKSD 2I5CA 2IQCA 2PQRA 4YTNB 4CO7A 1VLBA 2L00B 3AG4E 4N3AA 1L6VA 1TJEA 1NFIE 3IHPC 2CU1A 2MWNB 4I1MA 2D3AA 1MK9B 4LEUA 1D9SA 1FAOA 2V5FA 3JCKC 3ZW3A 2L1CA 2BWES 1YCSB 3CVQA 3O96A 1YJ1A 2VH2A 3MC9A 4M8MA 5CHWA 5L95C 3VLDA 2XZTG 5JHGA 2GGFA 3TO1A 5EILA 2IO3B 4M00A 2Y5BB 1F77A 2DX5B 4XWWA 3CVUA 5LCWC 1OTRB 4ILGB 2Y1LE 5ENPD 4AY6A 2YF0A 2KLCA 3PSEB 2WNMA 5JJ7A 5DH9B 4KIKA 1VR9A 1NA3A 5LCWJ 1E0ZA 3NZUA 4W9KA 2MBQA 3CHPA 3U64A 4GGQA 4RM8A 3ZRFA 3RJVA 1TN7A 2RGNB 3NUHB 3AEAB 1U4AA 3FUKA 1XODA 3PO0A 1HFAA 4NQKE 5G5GA 3TFMA 2V4HC 1VRAB 3QNKA 3UUXA 3VTUA 2IEJA 1L5PA 4WUYA 3AMZA 1T77A 4DXGA 3NVYA 1BI8B 4YDOA 3GZNI 2UU7A 4P7IA 4K7SA 2B6CA 3CK7A 3TWVA 4OW0A 2I5FA 3EHRA 2X6KA 1LF8A 3PS6A 1OY3D 3D9JA 1FHXA 1Q5WB 3CKBA 1U5GA 1LO5D 1OGWA 3AS8A 3EU5A 2FJ9A 4CT4A 2Y4TA 5HI7A 1NI3A 4XYCA 2K1FA 1N61A 2K49A 2QILA 3N20C 4A90A 2DZNA 3DXMG 1HX8A 3PSCA 3ZNZB 2K8EA 2EELA 1BUIC 3O65B 1FXAA 1Q67A 2ZCCA 2F8XK 5D3XA 2V3SA 2WQHA 4AEZC 1X05A 1ZKHA 1AARA 4GYOA 2DAJA 3Q8CA 3D8DA 4HAXB 3ZXPA 1U2VG 2ZNVC 1UG3A 4B94A 1L7YA 2AXZA 4MGYE 3W9FA 1XQQA 1U29A 3SI5A 1UH6A 4LDTD 2XRYA 3B7SA 1V54E 3L16A 1OXJA 2L05A 3IBEA 3M63B 3ML4A 2R0DA 3J5PA 4G8KA 2LG1A 2IYDB 2ZPNA 3NVZA 3TWRA 3ZRCA 1Z5SB 3I4RB 4PNKA 4I2WA 1OY2A 3P4PB 2L3ZA 4DBBA 2KZRA 3X2QE 3SO8A 3DCXA 4CHMA 4OZBA 1GPXA 3UMVA 1O5MA 1T5XD 4GZDA 2Z8LA 2MP2B 2KFKB 3MYVA 2N1VA 2RUKB 1ZXIA 4I1AA 1V1OA 1QC6A 1WZ3A 5FQ4A 3IG3A 4KGSA 3RD2A 3Q7AA 1EAZA 3M1IB 4DHZE 3JXIA 2MWSB 1HTQA 2VH1A 2DENB 3DHHC 2WGSA 3E33A 4FP7A 4REZA 5D3WA 3SFZA 3S2AA 3QHTA 2FCNA 2OEVA 4L1RA 4IW0A 3ULBA 4HQDA 2DNFA 2HTME 3MKQA 5FK9C 1QBQA 2ASQA 3N30A 5D3DA 3ML8A 4XKCA 5C5BB 4U7EB 3JQ1A 1QILA 2KQSA 4UWGA 4NAMA 3UT4A 3ZU7B 3WANA 1TS5A 2P9IG 4A63B 3A4SC 4GDKB 3J9CA 3V62A 1J19A 1FIQA 2FCQA 3QKYA 5JHBA 2JYEA 1ZUD2 2MSED 4LRZA 1P98A 1N60A 4BEPA 2RD0A 5BV0A 3OHMB 4ICVA 3TEXA 5HKHA 1IGDA 1TNZA 1INZA 1WVHA 3AECB 4JHRA 4H8SA 2QC8A 1K52A 4KSLC 5FQ8A 5KNGA 1EO6A 1HZ6A 4IWPA 3I5PA 4LG6A 2R2QA 3DSSA 1U5DA 2KLGA 4F8CB 3P63A 2E2XA 4MS6A 2YS3A 2KUQA 4NQLB 1N6ZA 2J7QB 3ISMC 1HZ4A 1MJ0A 4XWXA 2QMTA 3ASHA 1UNPA 1MIXA 3PEVB 2XEEA 1X1FA 4XI9A 3ZVRA 2O2VB 3U7ZA 4DBGA 3IHYA 2LAIA 1OQNA 4C0AA 5J3TA 4LLGM 4Q2JA 5CMWA 2N23A 2PVOD 5HKPA 2XEVA 3N1YC 3VLEA 3V79K 2R2OA 5LLIA 3SU8X 3W1SA 4OVZA 3KH0A 1NI2A 3BG1B 4NJCA 4WJPA 1LFDA 4JE3B 1MZCA 4BBNF 3VFKA 3G2SA 2CY4A 5H7PA 3HW2B 3ODOA 2JXXA 4RGMA 3NF1A 4IN3B 1LTXA 2W3SA 1GGOA 5D0OD 4U96D 2EMSA 3QIJA 1E7PB 1SJED 3IFWB 2X6JA 3EU9A 1SIJA 3FTZA 3OLMD 2V4LA 4LNBA 2GRLA 3AG3E 1MX2A 4YONA 4JKDA 2CU3A 2PNNA 2BYTA 1R7SA 1JRPA 2VGYA 1V2YA 4J8EA 2FO7A 3AE7B 2OJRA 3BUAA 3MGBA 4JW1A 1PC2A 3WXXA 2KX3A 3S7DA 2WVIA 4IRUA 4AS1A 5BMHA 1P9DU 3NOCD 4NSWA 3PZ7A 3IXEA 1ZGUB 2CR5A 3OXGA 5FINA 4JPSA 3SUZA 3SNXA 2K6DB 4HRNA 2CAYA 1HA5A 5D6JB 3RT3B 4DHJB 4OZCA 4GTVA 5CECB 4K1RB 3DEPA 3H6NA 3RZFA 2CHWA 4HOQA 1ZW7A 3NWFA 3AI5A 3SEBA 4KKIA 4G2VA 3FEYA 5KCMA 3ZPJA 4A9AA 2XN9C 4HK2A 4P29A 5BYRA 2KMCA 5HS0A 4GDKA 4TKNA 1BLXB 2C2LA 4GMJA 2RKKA 2KDMA 3FP3A 5J3QA 4HLLA 1OWLA 4IYPA 2BYVE 1P5TA 1DYNA 1IBXA 2GS0A 1MK7B 1IHGA 2I2YA 3QWVA 1WG7A 1ACAA 4PH4B 1JWSD 4ZRIA 2D5GA 2GCJA 3ZDTA 3AJ4A 3PRMB 1U5FA 2D2QA 3DWGC 2LVPA 4WURA 1QOGA 3BEEA 4HKZE 2R02A 3L82A 4OSNA 1YMPA 2GRQB 1MI1A 1N63A 3N1ZC 2J4XA 5AQ9A 1V61A 3PZ1A 4JWSC 2QFCA 4JQWC 1YN5A 4LJOB 4EMOA 3EJNA 4Q96A 3E9OA 1KLXA 1TXDA 3AV8A 3LCAA 3U7DA 2FBNA 2KX0A 4JL9A 2WXJA 2OOEA 1DNPA 1OQYA 4U8HA 2YT1A 3RPFC 1OEYJ 1V5UA 1JWUD 1HB6A 3PVLA 1XCTL 4JX1C 4ABNA 1MHQA 4A6KA 3E66A 1EU4A 1NYQA 2D3CA 2P9KG 2X18A 4YVOA 2WP9B 2N9LA 3RRMB 5J90A 1W1GA 1CJEA 1WJNA 3CR3A 2M38A 5B1BE 5LNK1 2C0LA 1TT5B 3VUWA 2QKMA 1Y5OA 2KJRA 1ZDXA 2H6IA 5EFXA 2WMOA 4WWNA 4II3B 3UTMA 3I4GA 1EVHA 4U0UA 3GE8C 3K9PB 2N4FA 1S70B 2DWZA 3I3TB 3KW5B 3LS8A 3FTVA 1DOYA 1TEZA 4BT8A 2BKGA 1M7EA 1IYFA 5T8IA 4YXDB 3R9MA 5CMYA 4W9IA 1RZ4A 1FT2A 3QCAA 1M94A 1PUTA 1JDEA 2J09A 1N4SA 1V9JA 4GB9A 3CF6E 1VCBA 4BT9A 3CVWA 3E4BA 5BPPA 4NRHB 2DX1A 3CSFA 1D8EA 1MPHA 1SIFA 1WR6E 3QWWA 2N7DA 3SFXA 4A20A 1Z87A 1WH3A 2C60A 1DOIA 5KJLA 3ODXA 1C78A 2DA0A 3G2TA 3Q8EA 4HJGE 1JWFA 2FDQA 1MI0A 1GB1A 1F2RI 3LDZA 2HYZA 3OXLA 3PZ3A 2PJHA 4LSZE 2JZPA 4U07A 4YDYA 5EIBE 2V5QC 1FNUA 2L1AA 4YL8A 4W9DA 4FHKA 2WHIA 3ZO5B 5IKCM 1V86A 3Q73A 2QZAA 3ABME 4TRQA 1H8CA 2ZIRA 2KGXB 3PUKA 3B7BA 2GRIA 2BKRB 2DLBA 4DDGD 1GC7A 1WE7A 2J49A 4HAWB 3UT8A 5BW8C 2DVWA 1E7VA 1WGGA 4X8QA 1WIAA 3FU0A 2XHEA 2FCSA 4DX2A 5B1AE 2WXRA 2VKIA 2MLBA 3TL5A 4MSQB 4FN2A 1AP7A 4WQOB 4BKSA 3RAUA 3A9JB 1I2HA 4C56C 2EC1A 3GZNB 2UWQA 2LOXA 2R59A 1HBKA 2KFJA 3ASNE 3AB5A 3KYCD 4JKEA 2NYJA 3NJTA 3GOEA 2KO3A 3ESLA 1I4RA 4C0EA 2XRZA 4JKGB 3WG7E 3LJ3A 1NA0A 3F0WA 3T5VA 3EC8A 3U66A 2M19A 2W9NA 3UQ3A 4I2ZA 3ZUVB 3CIRB 2EQXA 2RRFA 3OTNA 2Y4UA 2P2CP 4YTPB 1UUPA 3RU0A 4CT0A 3TWSA 4A6FB 1R4MB 1IBXB 4FJYA 1V80A 1ET9A 2VGXA 1X1GA 1Q1OA 3URZA 4QJ4B 2L32A 3ZNID 1F0ZA 2H6HA 2MFQA 3TWQA 2BS3B 3JUEA 1T0RC 5JJ6A 3RZWC 3KSYA 2KM4A 3H7PA 4N9F4 2JWZA 3QDNA 4N59A 2BWFA 3D32A 3FUNA 3BQOA 3VTWA 3B13A 4FA6A 5C2YA 1FCLA 1H2VC 5CCLA 4YWGG 2X6HA 1A5RA 2K8BA 3Q47B 3MJWA 1N5XA 3ZHEA 3LKUA 1MHXA 1VZ7A 3MJ5A 2P0DA 3EPYA 4O1OA 3NWDA 5M4YB 1WY8A 2BQQA 2L2IA 1QLBB 1K1BA 3SNHA 2LKOA 3DPDA 3VIAA 4IOIE 3DBHI 3ASDA 2KK8A 4WNFA 2YRYA 3FAHA 4JC8A 2KACA 1J0WA 2Q5WD 3KUZA 3PNTB 1G6JA 4K0RA 1C79A 3E34A 2FJUB 4HPLB 2G3QB 1JCKB 2XNAC 4HOTA 2JYTA 4LTUA 4XE0A 1YN3A 4AJWA 1P7FA 3VH3B 4GU5A 4ILHA 4JVSA 4HB2B 3EHMA 1W3BA 1MVKA 2FJLA 5J2RA 3EHNA 4NAWA 2ZEQA 4PDXA 4BSZB 1TYGB 1MJDA 4G0NB 3SQVA 3C98A 2BCJA 2KJHB 3SBTB 1VD2A 3UM3A 4J8FA 2XS8A 4GCOA 2GRMA 4BBNC 2CJOA 4LNKA 5L83A 3IAS1 3IV0A 4LUNU 3H9DA 2A5EA 1TJCA 3ZXVA 1Y6IA 3PZ8A 2KTRA 1V55E 3M62B 1WSPA 5HE0A 1QZEA 1XLQA 4LNIA 3UI2A 4JK8A 1UPRA 3DCGA 4YNDA 3FUFA 4DPRA 2YINA 2VSXE 4ITKA 1U5EA 2HJ1A 1QQRA 2J08A 2D11A 5JJTA 3GZ2A 3KS2A 3A33B 2LUHA 2MHJA 2Y5CA 1S3SG 4TV3A 3FKYA 3SBSA 4HJKA 2O6VA 1H2UA 3ENEA 2K2JA 2JF5A 1ENFA 1V1PA 1K5DB 3QOUA 2AW6A 2PQNA 4HCNB 2ZKMX 1R4NB 3DBRB 1RFKA 2R2YA 5ARFA 3DXCA 1ZPSA 3GYOA 4BERA 5AZGA 2INCC 2R05A 2KQ7A 1CQVA 5CX3A 1FO4A 3AS5A 3V3XA 3WAMA 4DLOA 3FU5A 3RCZA 4JHKA 4UWHA 4P16A 3RRUA 4ASWC 1O1SA 3MV2B 5E75A 4MKTA 2AQ3B 2K0PA 3L6AA 5CHEE 3AE3B 5CRUA 2UYZB 4O60A 4ARCA 4W9CA 1XCQL 2VTBB 4B8CB 3FILA 4HAZB 1N0RA 5AENA 1HXYD 2R82A 3OXFA 2KATA 3Q79A 4UWKA 5TSSA 2HR2A 3U52E 2F0YA 5DBKA 2DN6A 3SYXA 2MBEA 5JP4A 5DI9B 2OVBA 4MJSB 3FY4A 4HROA 2OOBB 3R3MA 3P6AA 4HOSA 3PRPB 1N0QA 1WJUA 4BSXA 3C3QA 4MGIE 4LJPB 4D0NB 5EE9A 2Z0QA 5AUIA 1WXMA 1P1AA 2JPHA 4UI9C 3NHEB 4L1BA 4APFA 4KAXB 3ZUNA 3ULQA 2NC9A 1D5XC 3BK1A 1ZOYB 3EA6A 2IJGX 3VOQA 2BGFA 2LGIA 2JUOA 4H2AA 3RKVA 3N32A 5J08A 4ME2A 1AWDA 3FUEA 2LULA 3PLVA 4KKJA 4FC8A 1T6BX 3KUCB 1MHHE 1RJ2A 1FOEA 2WWZA 2ROZB 4M0WB 1HG5A 1VBHA 1QZ2A 3Q3OC 4WH4A 1E8YA 1WM2A 2I1KA 2FI7A 2WX0A 2JEKA 4HATB 4JKAA 3ZYKA 3RUIB 3L54A 2KWVB 3P2BA 2NTTA 4JK9A 3D9HA 5E6JA 3DSUA 1J7BA 4WNDA 3UPVA 2JU6X 2K3UA 4GMRA 2AWIA 3CIAA 4KZCA 4F7GA 3VLFA 5C1DA 2JSVX 2ZW0A 2MW5A 4WJNA 3UF8A 2IY1B 1ZU2A 1Q2ZA 4US8A 3JXJA 1ZM0A 4K2PA 2WXQA 2ZZPB 4LNFA 3MEKA 3D3MA 4NPNA 2EIJE 1FGZA 3W1SC 5D66A 5AZFA 2FEZA 3VHTC 3ABLE 3HVZA 4JB8P 4M0WA 5ENOD 4AV7A 2INPE 3I5JC 4XEIG 3V31A 5GMVA 3W2DA 1FHWA 3WAPA 4LCTA 1UWXA 4EZJA 2Y8FA 5BMGA 2CHZA 3A1QA 1G3NB 3WYFB 4R3DA 2WB2A 5AN8A 4CGVA 4V3IA 1WJ6A 3ZEFA 4B0EA 5LOPB 4LCDE 4J8SA 1N54A 4GTPA 5DHAB 4N3BA 4ZDVA 4KHAA 3MKQB 3MV3B 4KHOA 1MX4A 2D4QA 3TEWA 4C80A 3ZRHA 2DLWA 4R7LA 2WXPA 2JXTA 3NG0A 5AAOA 2K39A 3GB1A 2AL6A 3BK2A 3AEFB 1TKEA 3F6QA 3RNFC 4E85A 2BT6A 2NTSA 5EYPF 3M3JA 4BX8A 2YT0A 3B1LX 4L2LA 4Q69A 3CXBB 2WXOA 3PEUB 1Y8MA 2XEHA 5J18A 3SGHA 3ECIA 1D6EC 1WJ1A 1K8RB 2ZJDA 4DX7D 3X23A 3Q5MA 2K9XA 3KAEA 1I4GA 3LDZE 3Q78A 3FU3A 4A3PA 2PKOA 1HG2A 2L0FA 1AQCA 4FADA 2OEWA 1SA4A 4MH8A 3RIBA 1DCEA 2V76A 3CVNA 3SY2A 3UQBA 3DRAA 4RG9A 3J5QB 4KYOB 1WI1A 1MFWA 1PQSA 5ENQD 1RFAA 3L22A 3D8EA 1KRHA 3B9JA 4ACFA 3KEAA 3EECA 1HE8A 2DBAA 3V5WA 5FR3A 4Y94A 4H7YA 2LO6A 3SFYA 1YIWA 5G04C 1EF1A 4IDIA 5JH5C 2RSUA 1VDVA 2KBXA 1KLVA 2GBNA 3N71A 3MCXA 3RN9C 5EKQD 3Q15A 5ENRD 1JWBD 1U27A 3GYPA 1TTNA 2BS4B 2OTXA 3NQPA 2ETAA 1RW2A 2K2UA 3DHIC 3ZKJC 1GJZA 3PZDA 5I2SA 2KT7A 4NURA 2PLPA 5HE3A 1E96B 2FULA 3W9GA 3A98B 2KDBA 1Q0WB 3DVNV 2N9EB 2KN5A 2MA9B 1YOVB 3V2OA 3P4RB 1JCRA 2AQ1B 2ONQA 3MZLB 3ZDMC 1KZPA 1YNTE 3JSVB 4IUMB 2PZ1A 4JD2G 2GB1A 1UPQA 1H2TC 3D9KA 4AM9A 5IRSA 3L4PA 4PYZA 1B89A 2K6QA 3NBNB 4NAWB 2JABA 1P0RA 3DSXA 2I38A 3AULA 1K50A 4GTTA 1ZE3D 4PK1A 4DXAB 1V97A 2DBYA 3WALA 2QY7A 1EM7A 2YEPB 1ELRA 4J0UA 3HSAA 2VTBA 2HM8A 2IU1A 3ZNGC 2M4NA 3UXGA 1ELWA 2Z0OA 3RNEC 4A55A 4DUIA 4KT6B 4A1SA 2JRHA 1OCRE 3AG2E 4U0SA 3A9JA 2NMBA 4JWUC 4B0MA 3E9LA 5DPWA 4JA7A 2MQJA 3N9YC 3LY8A 1U2BA 5KCVA 2IYBA 3G9WA 3PEGA 1SZAA 2KWDA 1KM7A 3U2SC 2DHKA 4DXFA 2VSNA 2G45B 3AM9A 2GI9A 3Q3NC 4WJQA 2C9WB 2AVPA 1K3ZD 1NU2A 1HS6A 2J9QA 2PE6B 2LXLA 4G50A 3S7JA 2WXLA 2VYIA 1IRSA 1BAKA 4GMXB 3TIXA 1PGAA 1N94A 2X0SA 5BMIA 3UIPB 3T5XA 2XK5A 2V0PA 4DI4A 2BBCA 4XDDA 4RM9A 4BY6A 2KZTB 2V4IB 1NEKB 3Q7FA 5AIJA 3AE9B 5KJKA 1KLGD 2PL2A 1ZVRA 2J8SD 4HAYB 4MGKE 4OHJA 1ZC3B 1N62A 4JEHA 5EX0A 5L81A 4DK5A 4IM0A 5HE1A 1HXIA 4GZ3A 3PUJA 1JWAD 2LHDA 1DDVA 4K5BA 2VRWB 3TXMA 4RCOA 1JWMD 4DHZB 2FUG1 2DYSE 3OG5A 3SBGA 1ZYIA 1XCGA 1FM0D 4O6FA 1KT1A 4DJAA 2RLOA 4AIFA 2BS2B 2RNRB 2H6GA 2G1EA 1ZC4B 4FJZA 3H1UA 5E6NA 1T0QC 1L4DB 3GW4A 3Q14C 5J17A 4A6FA 3E32A 4HCPB 1QOBA 4F7UP 2UWJG 2FIFA 4D6WA 2KAJA 1N4QA 4QJ3B 1QF6A 5C16A 2KFKA 3N3KB 3RI7C 3D9MA 4PS3A 4FJVB 1V5TA 2XQ0A 3CVVA 4CHKA 2LFIA 1MG4A 2LMCA 1C9FA 2AXVA 2ZXWE 4XDCA 2INNE 1TZOA 5GXGB 1PFJA 4KVGB 3TW1A 1D8DA 2ADZA 1UW4B 2AJAA 4G11A 2XQNM 2GROB 4KMOA 4BKTA 3UM2A 4K17A 3AEEB 3UIOC 3PH0C 4JKCA 4ANVA 2GW1A 4B95A 3KYDD 2R03A 3RYTA 4CDRA 3SR6A 4LNNA 1WFYA 4HFGA 1A5EA 4JKHA 3DXEA 4BAXA 1I4XA 4DX6D 2N9PC 1FPPA 1LD8A 4CYEA 1BI7B 3BU8A 4HS2A 2Z13A 4EFOA 4HSIA 2M8SA 5FQ7A 1TZ1A 5DIZA 1I4PA 3FLVA 1N5WA 1WDYA 5FI0A 1JWGA 3L17A 5ENTD 3PLUA 2KMMA 2K8HA 2LXAA 3OJ3A 4M01A 1WGHA 4NQ0A 4CDNA 1Y56A 4I6LB 4YSXB 2VRRB 3LEWA 2ABDA 2VQ2A 2YHCA 1LD7A 5FTPA 4MY6A 1OWOA 1TN8A 2KHWB 3B95A 2MBHA 4ILHB 4F1SA 1F2RC 5KJMA 4NACA 1L6UA 1A17A 2MJEA 3QC1A 2NCNA 2IZVB 4W9RA 2BB6A 2J0MA 4AP4C 3FEHA 1C4CA 1OQQA 3N1XC 1HU3A 4OYSA 3ZNHB 2N7JA 3RK6A 4W9EA 4O1PA 2GRRB 3HDXA 3RRNB 5AUKA 3KZ1A 1NI1A 1WXQA 3UKUG 3AE4B 1DIKA 2JVCA 3V61A 2RFMA 2J4BA 3PNLB 3UIPC 4A1GA 4PYUA 4MGZE 2E3TA 2DFKA 2X38A 3VTYA 2LBBA 3EIJA 3V6CB 2EILE 5A7DB 5IN7A 1H0AA 3CK9A 4KDIC 1YD8U 3TGOA 2WQ7A 3EDTB 4XGAB 5JMND 3HXEA 5ENSD 3ZJVA 4XZ4A 2P9LG 4MM3B 1I7AA 3C3OA 3RO3A 4I1OB 1XLPA 2G4DB 2BKKB 2CFUA 2J0KA 1S1QB 1FNWA 3KRXA 3A8QA 4WJOA 3OAWA 1FRDA 5IJMA 3LY7A 4N5QA 3HXBA 4C48B 1FB8A 5D27A 4GA0A 4EBAA 2FUHB 1UBQA 1IXVA 4BWRA 5HRYA 3TEYA 2KJ6A 3PE3A 1JRUA 1OEYA 1PGBA 1RRBA 1GNUA 5FZQA 3KY9A 5CTRC 4GZCA 4IC7B 1J0GA 3DHGC 3JUIA 5IOIA 4AQ7A 1SEBD 4N5CA 3VUXA 1TBEA 1V49A 2QDFA 5G55A 3TJPA 3P1MA 4HVBA 1KI1B 3D8FA 3IEGA 4NY0A 2ACZB 2IOSA 2QJLA 2COPA 4F7AA 4F7HA 1KZ7A 1S63A 1IKND 3IKOB 2Z0EB 4ZHBA 2DKQA 4XI0A 1Y19B 2RMMA 2C5LC 3NB2A 2BPSA 1BMLC 1WE6A 4W9GA 2L6JA 1NVID 2DYQA 2BB5A 4LNUD 3FTUA 3N7CA 4WAAA 4WNEA 2DYRE 4GAAA 3QX1A 3ZXRA 3WCQA 1OFFA 1R4NI 1E8WA 1MPEA 4HB0B 1N4PA 2DZIA 2KC1A 2HTHB 3EHQA 3MX3A 5FQ6A 2PPHA 5TR5A 2L6BA 3SZ7A 5DPTA 3HK0A 2BYEA 4GXBA 4W9LA 3U9WA 2GBKA 2VJ8A 5HG2A 4K7WA 2Y5PA 3GZ1A 4URKA 2WXMA 2V8SE 3FTSA 1KZGA 4YSZB 2LSUA 2FCMA 4MK0A 1KH0A 1NTYA 4RMAA 1KF6B 5IP4D 2ONDA 3LJUX 4EJNA 4I6GA 4CSQA 3UINB 1WR1A 2WLBA 4B93B 1JW9D 4U95D 2PZIA 4H7XA 5ARGA 2QKLA 1E6EB 2WDVB 3PRZA 5IY5E 5AJLA 4I6JA 2KC7A 2ETBA 1X5BA 1PLSA 1NTVA 3FSSA 4OZAA 4C4VB 2Z0PA 2CRFA 4ZRQA 4A6HA 3HXDA 2HD5B 3ZYYX 2QYUA 4ANXA 1TR4A 1AWEA 2YEPF 3UQAA 2XPYA 1U3DA 2LAHA 1XXGA 3Q8BA 5JZEB 1AWCB 1P3QU 4ANUA 4RGTA 3LXFA 3JYSA 1TKYA 5D7GA 5KNHD 4RF0A 4YTMB 3RULA 2ZGGA 3KVFB 1Y8RC 3FWVA 3V30A 2FE8A 3C72A 1VDYA 3UM1A 2FF4A 3HVEA 2RGFA 5JXVA 4RNAA 4I6PA 4AOFA 4EPZA 2HRJA 1QT9A 2ILRA 4RF1A 1M7RA 1C3TA 3B7RL 1LXDA 3C0RB 3NSUA 3AS4A 1KOTA 2Y8GA 4A8XC 2DX5A 2R09A 1J8CA 4ILGA 5GOWB 2AYOB 3VH4B 3MFGA 1N52A 4AWJA 2MDXA 5MPOA 1BD8A 2C7MB 4HDOA 1H6OA 1SXTA 2CS4A 2KXPC 1XKEA 2O6VB 5KWDA 2IO2B 1MQSA 5G2NA 1Z3XA 1SE2A 3RSEG 2KCLA 3BYTB 3KQ4A 1WM3A 4B89A 1WGKA 2RDBC 1S0PA 4HLEA 3IT6B 5C23A 3VR9B 4QJ5B 4HOUA 5FZRA 4HHVA 1ESFA 5FR6A 1GOZA 5IO9A 5IA7A 1QNFA 3HIZA 3CIKA 1IPGA 2NSZA 2SAKA 1IQRA 1VJKA 3DDCB 3NS1A 1H4RA 2ZGDA 1CMXB 1VBGA 3CHQA 3O4ZA 1EWCA 2LD9A 2GRNB 1ZSQA 1OWPA 4TQ0A 1QQGA 4HBDA 4DDID 4ARIA 4KXKB 3Q3FA 4FLBA 1SF0A 5ENNA 2QIEB 1LGRA 4BFRA 1CZPA 4TUUA 3BY4B 4B6WA 2E2EA 1C77A 1FPYA 3ONKA 1F52A 1NBFC 5LOZA 4GDLA 1P5QA 1UWMA 3PHXB 4IOYX 5J3YA 4XWTA 2YLMA 1L5JA 5LX8A 2MJDA 2I1JA 4KSKC 5CBNA 3BIID 3QAQA 2JX5A 2ZISA 3C3RA 2PTLA 4HXIA 4A6QA 4KZ0A 5G05J 2DKPA 4DX90 4E74A 2HO1A 2KCVA 4E6HA 4EZLA 5C5BA 5G04J 3T8MA 4A3VA 4LERA 2Z4DA 4LK0M 2R2LA 3BJIA 1OWMA 4UQYA 1V88A 1V8CA 2D3GA 3NW8A 5LXIB 2KANA 1NDDA 3LYAA 2DZMA 4APOA 1L0VB 3MHSD 1XGWA 3V60A 2CG3A 3TG4A 4PS7A 3CHRA 2M56B 5DPRA 4D10C 2ZW1A 1EYHA 1QYMA 1TYQG 4G25A 1F9JA 3M95A 1UN8A 1EGXA 2WXNA 4ACLA 4WJ7A 1C76A 2ICIA 2LYDA 3NAWA 2REXA 4ATZD 1ISNA 4GA1A 2YQ8A 1JMLA 3ZVVA 3P1UA 2I6HA 4EZKA 2QSDA 2IDYA 1BTKA 4PT5A 2XGSA 1TS3A 4JL0A 4TQ1A 1RWSA 1PY1A 3FUMA 3GYZA 4U8YD 2OJWA 1E8ZA 3RO2A 1XX0A 2XS1A 4PQ0A 4FXCA 1WI0A 3EUVA 1X11A 3FUDA 2KUPA 4FHJA 2L7RA 4ACKA 1PFDA 3UIOB 3QWZB 3AEGB 1CK1A 4TXPA 3WIMA 2VZKD 2WDTB 1E8XA 4I43A 5ANRA 3OJ4B 2AQ2B 1V5MA 4GPKA 3KUDB 1ZB1A 1N11A 2V0GA 2DHIA 4I6EA 1SVXA 5D0QD 5AQ7A 5AJDA 3QC8B 4GZ6A 4TMAB 3DXKG 3CVXA 2X6FA 2V1YA 1ELKA 3B2FA 2IJ0A 4HI9A 3VVWB 1SGHA 4GDLB 4GMVA 1I4QA 3RCPA 1N9AA 2WDRB 2LXMA 3E9SA 3Q2AC 4G23A 5KQ1A 3HQCA 5M72A 3NVVA 2BTEA 1MAIA 2MX2A 1XNFA 3U3WA 4KIKB 1OUVA 4O1NA 1ZBPA 3CSTA 4AP2A 3NZSA 4XC2A 1SE9A 3FTWA 1FRRA 2EIKE 4UI9K 3Q3JA 3GS2A 3TEZA 3KLSX 1HQRD 2COAA 2RQ1A 5JA4D 3U8ZA 4N3CA 2IOLA 3A58A 4DHJD 1NTIA 5EN5D 2IFSA 1HB8A 1LB1A 1STEA 4MDKE 3T9KA 3VRAB 3VTVA 1XD4A 5KHOA 3ZTCA 1KFYB 2LVQA 4P6VF 4OAUC 1YQ4B 4II2B 4CGWA 2KKCA 4DQOC 5D3VA 4CYMD 4UUCA 3BVMA 2XEWA 3EFUA 2KZTA 2PVGC 4XKBA 2KCKA 4JA9A 2VSZA 1TNUA 3NWAA 5I2MA 3CGHA 2LZ6A 2ZPYA 1UJJA 3SHQA 1OQRA 1DOXA 3FVCA 3O48A 3ENBA 2YS5A 2B0OE 5FIOA 2LUMA 2UY1A 3FH7A 4YVQC 3LYYA 2WM9A 3X0WA 3FC4A 5EX3A 3D9OA 3PVWA 3L08A 1FVFA 1MYOA 4KBQA 2N9XA 1I4HA 2IO3C 3T06A 2EKEC 1NL4A 4AVXA 4Y6WA 5C1ZA 3AN1A 2HJ8A 2WH5A 1BU9A 1UNRA 4NJ6A 2CG2A 4K7UA 3SV1A 3LY9A 4EBAG 4HAVB 4GLSC 2ELBA 2P0FA 2LASA 3PHWB 4GTOA 5LXHA 4WAFA 1SHCA 2NBWB 2D9XA 4GYYA 4MM3A 3RFZB 4MACA 1XR0B 3HM3A 1OCOE 4N2SA 4DIXA 2MBBB 1SJHD 2ZCBA 1T3QA 4BOSC 4USAA 5BXUA 3GZSA 2Z14A 4Z2NA 1FFVA 2L52A 5D2MC 4M02A 2N0SB 2LGSA 1V81A 1XLOA 3TWWA 1OMWA 1WX8A 3U4TA 2WU2B 3E37A 3PT2B 2KTRB 1IQUA 2IGGA 3DWLG 4TXQA 1AW7A 2PIAA 3DXDA 3OWEB 1WGDA 3BINA 3A8PA 1MG8A 3HVDA 3SF4A 2WU5B 3JYUA 2P9NG 3ULCA 2Y69E 3ASFA 1BTNA 1YQBA 1TY0A 4KVMA 1TJFA 1BPOA 4HPPA 5BYQA 3B0AA 5CEDB 4J6IA 3VQIA 3TG5A 1WGYA 2KXJA 1WXSA 2V3NA 3LXUX 1FT1A 3PG7A 3RNAC 2CJNA 4BZAA 4QXAB 3TVVA 1UEFA 5CHVC 1WYWB 1JROA 3R2TA 1A70A 3GP7A 1JALA 1MIZB 1KT0A 1SZ9A 1RYJA 3AE6B 2XPIA 1PDXA 1YYHA 2PEAA 3ETRA 1WX9A 4RQIA 2MBOA 3PZ4A 1OWNA 3AE2B 3P4QB 3APCA 3IT4B 2FAZA 5DCNA 3NRZA 3ZYLA 2MYOA 3QJZA 3LVRE 3HG0D 3MA5A 2L8JA 2O2VA 3P4SB 2LXCA 2J53A 1K8KG 2EMTA 2Z59A 3R7QA 3IAM1 4GU2A 2M63A 2JWUA 4MELA 1Q10A 1DDMA 1YMHE 2GJYA 4KHBB 5FJYA 3ZXSA 5D3YA 1R4MI 2QC9A 2F37A 3MKRA 4KV2A 3B08A 1Z5SC 1Z3YA 3HRAA 3FTXA 2N1WA 1F1HA 1FCCC 5EE1A 3I3NA 1AYFA 3ZN3A 1WXVA 2K5PA 3FHEA 1UGMA 1VZ6A 2AX5A 2UZSA 1WY6A 1SW6A 3OANA 2NPTA 1UN9A 4QAYA 2J07A 1V5PA 2KMAA 1IGCA 5CHFA 2D9WA 2ZVNA 4IM2A 4W9HA 2V3PA 1PAQA 1UOHA 3G2VA 2D9YA 1E9MA 4HWIB 5KJNA 5C2TB 2YNQA 1WJMA 4A5KA 3AG1E 4PUCA 4GPTB 1O1RA 2VZKB 2HE0A 2PE9A 5AZHA 4JHJA 2LRWA 1JCQA 2P9PG 4K5CA 4J8DA 2RR9A 1N3HA 1P7EA 1ZDVA 2PM7A 2DYOA 5C79A 3T9LA 2R17C 1WYGA 1I35A 3MTNB 4K81A 2OVFA 3ODWA 4B6HA 1L0XB 3TMPB 2VGXB 3D9PA 4HRSA 2WX1A 3A4RA 5FI1A 3TWUA 4N58A 4CCAA 2L9BA 5E76A 3ZIMA 1SB3C 3MP9A 1MX6A 2KIEA 2BKFA 5CCMA 2UY1B 3HVEB 4BKGA 4KGTA 1GB4A 3Q9NC 3PREA 3PGEA 4BOZB 2IPKD 4ZYNA 5KQ4A 3QARA 3ABKE 3ML9A 4DX5D 2AXUA 2P9SG 4MT7A 4MBGA 3H7PB 1E5WA 1H10A 1V89A 2KN4A 5ITZF 2N0YA 4IFSA
chains in the Genus database with same CATH topology
2X6IA 4GZUA 4K2OA 1YX5B 4WNGA 5LONB 3PV1A 3PE4A 1FHOA 3ZTDA 3PVUA 2BYFA 4MJSA 3R7RA 3JSVA 5D94A 2UVMA 3ZFWA 2XBBC 3SD5A 2LGDA 1DDWA 2RVBB 3EIQC 1WGUA 5BV1A 4LDTB 4JKGA 4FLHA 3JW0X 2KTFA 3FUJA 2RPQA 1KBLA 4PS8A 4XIFA 5IAAC 2MRPA 5BNWA 4HXDA 4AUQC 2DZKA 2LNIA 3CMMB 2LOZA 1P6SA 3UX4A 4MH0E 2WYQA 3AU4A 1IP9A 1RRPB 4UQXA 1MKEA 4U0ZA 3CHSA 2VSYA 2UZRA 4ZRKA 2DHJA 4U04A 4EUTA 4C0MA 1BT0A 3VTXA 5T4YA 2LWPA 3WA0A 1GG3A 5BO4B 2COCA 2CQUA 2ELAA 1EUVB 2LGYA 2PM6A 2JLBA 1K5GB 1FXTB 4F3VA 2H7DA 2R5SA 4XX5A 5E6OA 1E90A 3G2WA 4OVUA 4JKFA 1Z2MA 4IWOA 3CKCA 4U63A 2EJ8A 4K03A 1TQZA 2MCNB 2YHEA 4IAPA 1PMSA 2LSVA 2NR2A 2Z0DB 1UELA 2A5UA 3E9PA 4X57B 5BUZA 5LP0A 2ZU6B 1L2NA 4GSWA 3A9KB 4I9EA 2KDIA 4GA2A 2BF8B 2M0XA 2XCCA 4NNJB 2M14A 1DBHA 3QQ8B 2KDFB 3DQVA 2RSGA 2DCPA 5FWQA 4ILJA 4EQFA 5CLLB 2AWTA 4W9JA 4L7TA 3R9AB 4B9KA 5A23A 1DVPA 3L13A 2XCBA 2I2OA 2LVOA 4I9CA 4GIVA 2Y3AA 2DTCA 2H7EA 4HB3B 3AXCA 3CEQA 3F5RA 4KVOA 5T3RA 4JK7A 4MEMA 1C1YB 2CHXA 3DBSA 3CVLA 1TJ6A 3B7UX 2A4ZA 2Q13A 2XGMA 4CHJA 1TGZB 3L0WB 3SHFA 4MSMB 2K25A 2YSZA 2WMNA 4ATGA 4ICUA 4UQZA 1GUAB 3Q4AB 5LFAA 3BG0B 2KVRA 4ANWA 3ZGQA 3QBVB 3FUHA 4A3TA 3DVGX 1W1HA 5D2MB 2COFA 2IFUA 1EPUA 3VDZA 2DYMA 4I6NB 2G4SA 5AYWD 2LRUA 5FZSA 2KD0A 2L0TB 3TCAA 4CEMA 2HTHA 4GMLA 4JLCA 2NZ8B 4GYWA 2KNBA 4EKUA 2IONA 1LW3A 2AEHA 4Z2MB 4HB4B 1HH8A 1RLFA 4L23A 3UZTA 4AY5A 3KD7A 2ROVA 3JQ0A 4JXTA 4WVFB 2IF4A 2M17A 4B8AA 3PPAA 2WXHA 2CB8A 1UNQA 4JKBA 4DX8A 3CHOA 5G05C 2MKRA 3MDBC 2C7HA 2GBRA 2C0MA 3PDNA 1P3RA 5FT9A 2L0TA 1B55A 2L76A 3S7FA 2KDEB 2NS5A 3ESKA 1V5OA 4M3OA 4ILIA 2JRIB 1BWNA 3QK0A 1WZ0A 1UJKA 2DIKA 1H19A 1H6KA 2DIWA 3MPXA 2P8VA 2D07B 2VSOE 1WJ4A 2L0IA 4RG6A 4AJYB 2MP2A 3ONSA 1IYGA 4QFVA 1JUQA 3LVQE 5JHHA 3CV0A 3FUIA 3ZYQA 2CKHB 1RAXA 5JVLA 1DROA 5DHFB 2I9CA 3KEZA 2WXFA 2C7NB 2DHZA 3D9IA 2M1MA 1Z6TA 1XT9B 1WAO1 1LQBA 4AXHA 3SO6A 3KRWA 2BUGA 3CK8A 3HYMB 1FCHA 3CHMA 4DI3A 2NXPA 4HDQA 4IWQA 2CODA 2YVCA 2IBIB 4WWPA 2FNJB 5KHQA 3WAOA 2ZNVB 1UBIA 3D9LA 2Q7FA 3CQCB 3B7TA 4Q94A 3FDHA 4JZYA 3DBLI 4EEWA 3FP5A 1EDUA 2OQBA 1WF9A 4GN1A 1WMHA 1X1MA 5CLQB 3EHVA 2CY5A 3UT7A 4MRUA 2WXKA 1LM8B 2N7EA 2J4DA 1WGRA 3ZYMA 2IO0B 3DBRI 5DPSA 2DAFA 4IG7B 2LUEA 3NY5A 2G35A 4M8NA 2K8CA 2NVUI 2JT4B 2NBUA 4G1TA 3DVNU 3A9KA 3TBLD 2GBMA 4C9BB 3APFA 1ST7A 4UWFA 4BX9A 1T0YA 1U3CA 2WPVA 1I42A 1EF5A 3UGBB 4G26A 3D9NA 2HE7A 3IVFA 5JLJB 2IY0B 1YA0A 1X86A 2LJ5A 2KWUB 4DLQA 4GZ5A 2DYBA 2XPZA 3JVZX 3S7BA 4JGHB 5A6CA 3P7ZA 4IULA 3CVPA 3UIPB 1FGYA 4KDLB 3VXWA 3W1SC 4A3OA 4ZRJA 2GCLA 4BBKA 1JPLA 2MRIA 4L6EA 3LPZA 1WXAA 4F53A 2IO1B 4BTAA 2Y7BA 5EDSA 4WSFA 4E71A 5JHAA 4OVVA 4CRWA 5C6RA 3FU6A 2D9VA 3NOBA 4BTBA 2MHKA 1WMHB 2QHOA 3FM8C 5HQ8A 2RG8A 3AU5A 4UWLA 2D9ZA 3H7SA 5AEKB 4G24A 3QWPA 2B3AA 4Y6CA 4MLPA 2WXGA 3CVYA 3TAXA 2X3MA 4RVBA 3APDA 4TYZA 3K9OB 2K00A 1HO8A 2O6VD 2W2XC 2FIDA 2NBVB 1GC6A 3A1QB 4N39A 5ANLA 2LI5A 3G2UA 5HE2A 4F7ZA 3CLJA 4FBJB 2CFZA 1UZXB 4RSYA 2MOWA 4E3CA 3L10B 4GOCA 2W2WA 4UI9J 1NP7A 3DOWA 3ZLZA 1NZNA 2JY6A 5DIFB 1E7UA 1WM5A 3PP2A 4HORA 2GBJA 3VAWA 4DWFA 4I17A 2KWCA 4IM3A 1WX7A 2XK5B 4WWOA 1V6EA 1YX6B 1FVHA 4HPMB 2OV8A 1QQEA 3HHMA 1XD3B 4W9FA 2DYNA 4FULA 5E6PA 4L2YA 4JIOU 3TXNA 1W1DA 4BVUC 3QWMA 3V6EB 1EF1C 1HF8A 3NS8A 3CQGB 2Z59B 3U30A 2AL3A 3FULA 3DVGY 3W1YA 2KOXA 2J59M 1SQMA 1WRDB 3FTYA 2JZ3B 1KC7A 3SBTA 3VUYA 2GMIC 4B0ZA 3FFLA 2DZJA 3IHVA 3FH8A 1KJTA 3FH5A 2WXIA 4G3XB 4NJ7A 3SDLC 3FEXA 3ASGA 3Q49B 4CDMA 2JZZA 2P0HA 2KC2A 2NPTB 2WQ6A 2D10A 2JP2A 2KCJA 2J0JA 2BF0X 1NVLA 1WGQA 4EOYA 3HM6X 1D3ZA 4EECA 4JEUA 2W2XD 3PTFC 2ZVOA 3QA8A 3K9IA 3ONLA 2E0IA 3R66C 4FU3A 2GOWA 2XGOA 5BT1A 2BTDA 1GW6A 4GCNA 2YS1A 4HAUB 3ZHEB 4N2QA 1UD7A 2P58C 3QB2A 3ALBA 2LGXA 4BKSD 2I5CA 2IQCA 2PQRA 4CO7A 2L00B 4N3AA 3IHPC 2CU1A 2MWNB 4I1MA 1MK9B 4LEUA 1FAOA 2V5FA 3JCKC 3ZW3A 2L1CA 2BWES 3O96A 3CVQA 1YJ1A 5CHWA 4M8MA 5L95C 3VLDA 5JHGA 2GGFA 3TO1A 2IO3B 2Y5BB 2DX5B 3CVUA 5LCWC 1OTRB 4ILGB 4AY6A 2YF0A 2KLCA 3PSEB 5JJ7A 5DH9B 4KIKA 1NA3A 5LCWJ 3NZUA 4W9KA 2MBQA 3CHPA 3U64A 4GGQA 4RM8A 3ZRFA 3RJVA 2RGNB 1U4AA 3FUKA 1XODA 1HFAA 4NQKE 3TFMA 3QNKA 3UUXA 3VTUA 4WUYA 3GZNI 4K7SA 4P7IA 3CK7A 2I5FA 2X6KA 1LF8A 3PS6A 3D9JA 1FHXA 1Q5WB 3CKBA 1U5GA 1OGWA 3AS8A 2FJ9A 4CT4A 2Y4TA 5HI7A 2K1FA 1HX8A 3PSCA 3ZNZB 3O65B 1Q67A 2ZCCA 5D3XA 2V3SA 2WQHA 4AEZC 1X05A 1ZKHA 1AARA 4GYOA 2DAJA 3D8DA 4HAXB 2ZNVC 1UG3A 4B94A 1L7YA 2AXZA 4MGYE 1XQQA 1U29A 3SI5A 1UH6A 4LDTD 2XRYA 3B7SA 2L05A 3L16A 3IBEA 3M63B 3ML4A 2R0DA 2LG1A 2IYDB 2ZPNA 3ZRCA 1Z5SB 3I4RB 4PNKA 4I2WA 1OY2A 2L3ZA 4DBBA 2KZRA 4CHMA 3UMVA 4GZDA 2MP2B 2KFKB 3MYVA 2N1VA 2RUKB 4I1AA 1WZ3A 1QC6A 3IG3A 5FQ4A 3RD2A 1EAZA 3M1IB 4DHZE 2MWSB 2DENB 4FP7A 5D3WA 3SFZA 3S2AA 3QHTA 2FCNA 4IW0A 3ULBA 3MKQA 2ASQA 3N30A 3ML8A 4XKCA 5C5BB 3JQ1A 2KQSA 4UWGA 3UT4A 3WANA 3A4SC 4GDKB 3V62A 1J19A 2FCQA 3QKYA 5JHBA 2MSED 4LRZA 1P98A 2RD0A 5BV0A 4ICVA 5HKHA 1INZA 1WVHA 4JHRA 4H8SA 4KSLC 5FQ8A 1EO6A 4IWPA 3I5PA 2R2QA 1U5DA 2KLGA 4F8CB 2E2XA 4MS6A 2YS3A 4NQLB 2J7QB 1HZ4A 4XWXA 1UNPA 3ASHA 1X1FA 1MIXA 3PEVB 3ZVRA 4XI9A 2O2VB 4DBGA 3IHYA 2LAIA 1OQNA 4C0AA 5J3TA 5CMWA 2N23A 2XEVA 3VLEA 2R2OA 5LLIA 3SU8X 3KH0A 1NI2A 3BG1B 4WJPA 1LFDA 4BBNF 3VFKA 3G2SA 2CY4A 3ODOA 3HW2B 2JXXA 3NF1A 4IN3B 1GGOA 5D0OD 2EMSA 3QIJA 3IFWB 2X6JA 3FTZA 3OLMD 2V4LA 2GRLA 4YONA 4JKDA 2VGYA 1V2YA 4J8EA 2FO7A 2OJRA 3MGBA 4JW1A 1PC2A 3WXXA 2KX3A 3S7DA 2WVIA 4IRUA 1P9DU 4NSWA 1ZGUB 2CR5A 3OXGA 4JPSA 3SUZA 3SNXA 2K6DB 2CAYA 5D6JB 3RT3B 4DHJB 4K1RB 3H6NA 3RZFA 2CHWA 4HOQA 1ZW7A 3AI5A 4G2VA 3FEYA 5KCMA 3ZPJA 4HK2A 4P29A 2KMCA 4GDKA 4TKNA 2C2LA 4GMJA 3FP3A 5J3QA 1OWLA 4IYPA 2BYVE 1P5TA 1DYNA 2GS0A 1MK7B 1IHGA 3QWVA 1WG7A 1ACAA 4PH4B 4ZRIA 2GCJA 3ZDTA 3AJ4A 3PRMB 1U5FA 2D2QA 2LVPA 3BEEA 1V61A 2QFCA 4JQWC 4LJOB 4EMOA 3EJNA 4Q96A 3E9OA 1KLXA 1TXDA 3LCAA 3U7DA 2FBNA 2KX0A 4JL9A 2WXJA 2OOEA 1DNPA 1OQYA 4U8HA 2YT1A 1OEYJ 1V5UA 1HB6A 3PVLA 4ABNA 1MHQA 4A6KA 3E66A 2X18A 4YVOA 3RRMB 5J90A 1W1GA 1WJNA 3CR3A 2M38A 2C0LA 3VUWA 2QKMA 1Y5OA 2KJRA 5EFXA 2WMOA 4WWNA 4II3B 3I4GA 1EVHA 4U0UA 3K9PB 2N4FA 3I3TB 3KW5B 3LS8A 3FTVA 1TEZA 4BT8A 1M7EA 1IYFA 5T8IA 4W9IA 5CMYA 3QCAA 1M94A 1JDEA 2J09A 1V9JA 4GB9A 3CF6E 1VCBA 4BT9A 3CVWA 3E4BA 5BPPA 4NRHB 2DX1A 3CSFA 1MPHA 1SIFA 1WR6E 3QWWA 2N7DA 4A20A 1Z87A 1WH3A 2C60A 5KJLA 3ODXA 2DA0A 3G2TA 1JWFA 2FDQA 3LDZA 2HYZA 3OXLA 2PJHA 4U07A 4W9DA 4YL8A 4FHKA 3ZO5B 1V86A 4TRQA 1H8CA 2KGXB 3PUKA 2BKRB 4DDGD 1GC7A 1WE7A 2J49A 4HAWB 3UT8A 5BW8C 1E7VA 1WGGA 1WIAA 3FU0A 2XHEA 2FCSA 2WXRA 2VKIA 2MLBA 3TL5A 4MSQB 4FN2A 4WQOB 4BKSA 3A9JB 1I2HA 2EC1A 2UWQA 2LOXA 2R59A 1HBKA 2KFJA 3KYCD 4JKEA 3GOEA 2KO3A 3ESLA 4C0EA 2XRZA 4JKGB 3LJ3A 1NA0A 3F0WA 3T5VA 3EC8A 3U66A 2W9NA 3UQ3A 4I2ZA 2EQXA 3OTNA 2Y4UA 3RU0A 4CT0A 4A6FB 4FJYA 1V80A 2VGXA 1X1GA 1Q1OA 3URZA 3ZNID 2MFQA 5JJ6A 3RZWC 3KSYA 2KM4A 3H7PA 4N9F4 2JWZA 3QDNA 2BWFA 3D32A 3FUNA 3VTWA 3B13A 4FA6A 5C2YA 1H2VC 5CCLA 2X6HA 1A5RA 2K8BA 3Q47B 3MJWA 3ZHEA 3LKUA 2P0DA 3EPYA 1WY8A 2L2IA 3SNHA 2LKOA 3DPDA 3VIAA 3DBHI 3ASDA 2KK8A 4WNFA 2YRYA 4JC8A 1J0WA 3KUZA 3PNTB 1G6JA 4K0RA 4HPLB 2G3QB 4HOTA 4XE0A 4AJWA 3VH3B 4GU5A 4ILHA 4JVSA 4HB2B 3EHMA 1W3BA 2FJLA 5J2RA 3EHNA 4NAWA 2ZEQA 4PDXA 4G0NB 3C98A 2BCJA 2KJHB 3SBTB 1VD2A 4J8FA 4GCOA 2GRMA 4BBNC 5L83A 3IV0A 4LUNU 3H9DA 1TJCA 1Y6IA 2KTRA 3M62B 5HE0A 1QZEA 1UPRA 4JK8A 3DCGA 4YNDA 3FUFA 4DPRA 2YINA 2VSXE 1U5EA 2J08A 2D11A 5JJTA 3GZ2A 3KS2A 3A33B 1S3SG 4TV3A 3SBSA 4HJKA 2O6VA 1H2UA 3ENEA 2K2JA 2JF5A 1K5DB 3QOUA 2AW6A 2PQNA 4HCNB 5ARFA 3DXCA 3GYOA 5AZGA 2KQ7A 5CX3A 3AS5A 3WAMA 4DLOA 3FU5A 3RCZA 4JHKA 4UWHA 4ASWC 3RRUA 3MV2B 5E75A 4MKTA 3L6AA 5CHEE 2UYZB 4W9CA 2VTBB 4B8CB 4HAZB 5AENA 2R82A 3OXFA 2KATA 4UWKA 2HR2A 5DBKA 3SYXA 2DN6A 2MBEA 5JP4A 5DI9B 2OVBA 4MJSB 3FY4A 2OOBB 3R3MA 3P6AA 4HOSA 3PRPB 1WJUA 4BSXA 4MGIE 4LJPB 4D0NB 2Z0QA 1WXMA 1P1AA 2JPHA 4UI9C 3NHEB 4L1BA 4APFA 4KAXB 3ZUNA 3ULQA 2NC9A 2IJGX 3VOQA 2BGFA 2JUOA 3RKVA 3N32A 5J08A 4ME2A 3FUEA 2LULA 3PLVA 4FC8A 3KUCB 1RJ2A 1FOEA 2WWZA 2ROZB 4M0WB 1HG5A 1VBHA 1QZ2A 1E8YA 1WM2A 2I1KA 2FI7A 2WX0A 2JEKA 4HATB 4JKAA 3ZYKA 3RUIB 3L54A 2KWVB 3P2BA 4JK9A 4WNDA 3UPVA 2AWIA 3CIAA 4KZCA 4F7GA 3VLFA 5C1DA 4WJNA 3UF8A 2MW5A 2IY1B 1ZU2A 1ZM0A 4K2PA 2WXQA 2ZZPB 3MEKA 3D3MA 4NPNA 1FGZA 5AZFA 2FEZA 3VHTC 5GMVA 4AV7A 3WAPA 1FHWA 4LCTA 4EZJA 2Y8FA 2CHZA 3A1QA 3WYFB 2WB2A 4CGVA 4V3IA 1WJ6A 3ZEFA 5LOPB 4LCDE 4J8SA 1N54A 5DHAB 4N3BA 4ZDVA 4KHAA 3MKQB 3MV3B 4KHOA 2D4QA 3ZRHA 2DLWA 2WXPA 4R7LA 2K39A 2AL6A 4E85A 3M3JA 4BX8A 2YT0A 3B1LX 4L2LA 4Q69A 3CXBB 2WXOA 3PEUB 1Y8MA 5J18A 3SGHA 3ECIA 1WJ1A 1K8RB 2ZJDA 3X23A 3Q5MA 3LDZE 3KAEA 3FU3A 4A3PA 1HG2A 2L0FA 1AQCA 4FADA 3RIBA 2V76A 3CVNA 3UQBA 4RG9A 4KYOB 1WI1A 1PQSA 1RFAA 3L22A 3D8EA 3EECA 1HE8A 2DBAA 3V5WA 4Y94A 4H7YA 2LO6A 1YIWA 5G04C 1EF1A 5JH5C 2RSUA 1KLVA 2GBNA 3N71A 3MCXA 5EKQD 3Q15A 3W1SA 1U27A 3GYPA 1TTNA 2OTXA 3NQPA 2K2UA 3ZKJC 1GJZA 3PZDA 4NURA 5HE3A 1E96B 2FULA 3A98B 2KDBA 1Q0WB 3DVNV 2N9EB 2KN5A 2MA9B 3MZLB 3ZDMC 3JSVB 4IUMB 2PZ1A 1UPQA 1H2TC 3D9KA 4AM9A 4PYZA 1B89A 2K6QA 4NAWB 1P0RA 3AULA 4DXAB 3WALA 2QY7A 1ELRA 4J0UA 2VTBA 2HM8A 2IU1A 3ZNGC 2M4NA 1ELWA 2Z0OA 4A55A 4KT6B 4A1SA 2JRHA 4U0SA 3A9JA 2NMBA 3E9LA 5DPWA 4JA7A 2MQJA 3LY8A 1U2BA 5KCVA 2IYBA 3G9WA 3PEGA 1SZAA 1KM7A 2DHKA 2VSNA 2G45B 4WJQA 2C9WB 2AVPA 1NU2A 2PE6B