3AU4A

Structure of the human myosin-x myth4-ferm cassette bound to its specific cargo, dcc
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
524
Chain Sequence
b'PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein/apoptosis
total genus 178
structure length 524
sequence length 526
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au4A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au4A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au4A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au4A02
2AEHA 1I2HA 1X86A 1T0YA 4HB3B 4WVFB 1K5GB 1P0RA 3CF6E 4NY0A 2ZZPB 1KZGA 4MT7A 3H6NA 3W1SC 4A3OA 2YSZA 1U5EA 4GZUA 1I35A 2K00A 2BYEA 2L3ZA 4DWFA 1R4MI 4ANUA 1Z5SB 4GIVA 3A4SC 1V88A 3SHQA 2Z0QA 3MJWA 4HJKA 3PHXB 2I5FA 2IYBA 2CHXA 2KFKB 2KLGA 2KDFB 2WX0A 2OOBB 1V5MA 1WXAA 5DPWA 1W1HA 2HRJA 2DA0A 4MY6A 1V5TA 2N7DA 1YX6B 3ZNHB 1OQYA 2KMCA 1P1AA 3PTFC 3QC8B 4ZRIA 5AZFA 5D7GA 2BWFA 3A1QA 5DCNA 2DAFA 2B3AA 2K6QA 5DI9B 4PYUA 2XEWA 2RGFA 4HCNB 3VIAA 1V2YA 4KZCA 4DDGD 3X23A 1LM8B 1TGZB 3K9OB 4CHJA 5E6PA 4OVUA 3DXEA 4DHZE 4II2B 1NBFC 1E8WA 3ZTDA 2CY5A 2HTHA 4M8MA 3WIMA 3UIOB 5LXHA 1XQQA 4K81A 3ZUNA 3AXCA 1Z2MA 2JWZA 5IAAC 3ZNGC 3UQBA 5AEKB 1RJ2A 2ADZA 2LRUA 4AOFA 1BWNA 4KHBB 2IY1B 1IPGA 1UH6A 4NAWA 3VH3B 3D8FA 2LOXA 3RZFA 1UZXB 2DAJA 3VDZA 2IYDB 1V80A 4MDKE 5KQ4A 2BKRB 5D3VA 4H8SA 2DENB 1CMXB 3NSUA 4W9EA 4ANWA 5KHOA 3TFMA 3MPXA 4E74A 2CS4A 4GU2A 3ZTCA 4BKTA 2LD9A 4YL8A 4KHOA 1H4RA 3U7DA 2RD0A 5JHBA 3T8MA 3ZIMA 2D9VA 2N1WA 4HB2B 5LXIB 4E3CA 1WM3A 3I3TB 5C5BB 2RVBB 2NBVB 5DPTA 5C23A 3PLUA 3D8EA 2YS1A 1MIZB 2CKHB 3FP5A 4XX5A 1WRDB 3V5WA 2KDBA 2DKQA 3VTWA 1WZ0A 2LXCA 2K8HA 2MP2B 1WX8A 1V49A 3IBEA 2FIFA 2CODA 4EZJA 4GPTB 3PS6A 4MGZE 1SGHA 2GJYA 4CHMA 3KZ1A 1X05A 3BINA 5D3YA 2QHOA 3B1LX 1ZVRA 3M63B 3QWZB 1WJNA 3Q3JA 4WJNA 3PVLA 2JY6A 3A9JB 2NS5A 3OANA 4AJYB 3L10B 3L08A 2DHKA 2RUKB 2BPSA 2M8SA 3PVUA 1WYWB 3P7ZA 2REXA 4DHJD 5J3YA 2ABDA 3RULA 2M1MA 1MK9B 4DXAB 1RLFA 1LXDA 3TL5A 3NY5A 4GB9A 2MBBB 2WX1A 2GBRA 2ASQA 5L95C 3DBSA 1J19A 3QIJA 2JVCA 3T9LA 4HCPB 1UNQA 2GBKA 5C1ZA 4L6EA 4LDTD 2P0FA 2LBBA 1WY8A 1V5OA 1VCBA 4F8CB 4HDOA 3N30A 2DHIA 2BGFA 3RT3B 4KSLC 1B55A 4HAUB 2MWSB 3SYXA 1ST7A 1FHOA 1GJZA 2GBJA 4DBGA 4NJ7A 4HWIB 3DPDA 4J6IA 3IG3A 5FR6A 3A98B 4HB4B 1EF5A 2LGYA 3NOBA 2L1CA 2M0XA 4ZYNA 2CQUA 1MK7B 4FLHA 3B08A 2N9EB 1FB8A 2J0KA 3V61A 3QHTA 1ZGUB 2FDQA 2KNBA 4IM0A 3DVGX 3KYDD 2UVMA 4MGKE 2GCLA 1V5PA 1Q1OA 1XKEA 2GOWA 3KUDB 2EJ8A 3ULBA 2CAYA 4K1RB 3VUWA 4GMXB 5DHFB 2G35A 4FJYA 1I42A 4K7UA 2M4NA 2KXJA 2KKCA 3R3MA 5JLJB 2D10A 3KUCB 2NCNA 2V4LA 2BWES 1V86A 1XCGA 3EHVA 2L8JA 1UD7A 4BFRA 2NPTB 2WYQA 2K6DB 1QQGA 2ZVOA 3VHTC 4HDQA 2FCSA 1U5DA 3QCAA 1E5WA 3PLVA 5L83A 5J17A 1A5RA 2M38A 5D3WA 2DHZA 2MBOA 4ANXA 1WJ6A 2CR5A 3NS8A 2L05A 1HE8A 5D3XA 2AL3A 3TMPB 5DH9B 4TQ0A 4A5KA 1AQCA 2EC1A 2K8BA 4MELA 3DBRI 2KGXB 2PE9A 1SHCA 1XD4A 2LULA 2LG1A 3HQCA 2Z0PA 3TO1A 5DPRA 5E6OA 1X1GA 4D0NB 4ZRKA 2KTRA 4WJOA 5HE1A 3H9DA 2Z0DB 2L76A 2J0JA 4KHAA 4IUMB 1GUAB 3ECIA 2JXXA 4PS8A 5CTRC 2FCMA 4BBNC 3APCA 5JP4A 4F7GA 4EKUA 4KAXB 2YVCA 1E7UA 5G2NA 3ZRFA 2COFA 4BOZB 3KVFB 2LUEA 1Y19B 2K2JA 2Y7BA 5CX3A 1RAXA 2IY0B 2ROVA 1WI1A 2P0DA 1WX7A 3V6EB 2D9YA 5J3TA 1WE6A 2XBBC 1R4NI 5C5BA 5HE3A 3KYCD 2PE6B 2L7RA 3D8DA 1PLSA 5HE2A 1FXTB 1KM7A 3QWMA 4K17A 4A3PA 3LDZE 4EUTA 4KSKC 5HKHA 4URKA 1GNUA 4IM3A 4NSWA 2Z0OA 3QK0A 5FI0A 2VSZA 3HK0A 4FULA 3BY4B 2KO3A 1WGUA 3KUZA 2RSUA 5DHAB 3SV1A 3WAPA 4MEMA 5C79A 2LGDA 2DHJA 1VD2A 2EMTA 3M1IB 1TTNA 4M0WB 3WANA 2MW5A 1UPRA 2N23A 5EFXA 4F1SA 3A9JA 3V6CB 4GDLB 1WJ4A 2COCA 2KJHB 2N7EA 1Y5OA 2VRRB 3EECA 1YD8U 1WZ3A 3WAOA 1KJTA 1LQBA 2K39A 2V1YA 2RGNB 3LJ3A 1OEYJ 3DVGY 4NQKE 4XC2A 1H10A 5DIFB 2AL6A 3ML9A 1DROA 4DDID 2KOXA 2N1VA 2LWPA 3SO6A 3KH0A 4GSWA 1FAOA 2KJ6A 3B0AA 4W9HA 4ICVA 1BTNA 1WE7A 3W1SA 4IW0A 1UNRA 5C6RA 2FIDA 3U8ZA 5JZEB 3A33B 2KTFA 4WJ7A 2LVOA 4HPLB 1J0WA 3TJPA 4X57B 2CHWA 2CRFA 4PNKA 3TW1A 1ZC4B 1V89A 3ZO5B 1WGDA 4EMOA 2RLOA 1KOTA 3H1UA 2LVPA 2LJ5A 2WH5A 3DDCB 3S2AA 3SUZA 5CLQB 2XK5B 4MGYE 3R7QA 1V5UA 4ASWC 3U30A 1ZW7A 4W9JA 4CO7A 4HAXB 4MK0A 3JSVB 1OQNA 2FUHB 3ZRCA 3KW5B 1EUVB 1OEYA 1ZC3B 1EVHA 2OTXA 2KMAA 3QX1A 5HE0A 2KANA 3L17A 3PEGA 2UWQA 4KIKB 2C7MB 4W9DA 2N4FA 4LJPB 4HAZB 4YONA 4K7SA 2PEAA 4IWPA 4Z2MB 4DK5A 3LJUX 3N32A 1WGRA 2DKPA 1E8XA 2COAA 2G4SA 1MPHA 3ULCA 1MAIA 2J59M 3DCGA 1X1FA 3PRPB 1WVHA 4MSMB 4WWNA 4RM8A 4DHJB 2ROZB 4TV3A 3O96A 5LOPB 2KHWB 1FGZA 3ZVVA 1U29A 3SDLC 4DX90 2DN6A 4W9FA 4WSFA 2KDEB 2M17A 5D94A 1OY2A 3VUYA 4PQ0A 2R09A 3DVNV 2FJLA 5DPSA 1HBKA 3TVVA 4I6PA 4GGQA 2QKMA 1NU2A 1D3ZA 1HB8A 2UYZB 5AZHA 1LB1A 3OAWA 1Q67A 1GG3A 2MQJA 2YS5A 2MA9B 4PS3A 4LDTB 2MFQA 3PV1A 1U5GA 2K25A 1IP9A 1FOEA 1IYFA 2BKFA 2ZPNA 3QJZA 1RRBA 1Y8RC 1PQSA 4EZKA 2O6VA 1E8ZA 3GYOA 1UBIA 3UIPB 3ODXA 2MRPA 4EFOA 2CB8A 4HHVA 3AU4A 2O2VA 2YS3A 3PREA 2MDXA 1WR6E 2NVUI 2HJ8A 2KX3A 4HXDA 3SD5A 4HAYB 3QQ8B 1EO6A 1AWEA 1E90A 2C9WB 3FEHA 2G45B 5D27A 1WXVA 3DBHI 3ODWA 1WXMA 2RSGA 2PPHA 1WGQA 4ICUA 2IO1B 2K1FA 2J0MA 1RRPB 5LONB 1WIAA 2HTHB 4FHJA 1WJMA 4FJVB 3AJ4A 3BJIA 3ODOA 2H7DA 2KWCA 4RMAA 3VTUA 5J3QA 4NAWB 3PG7A 4GDLA 3PP2A 2W2WA 2QKLA 3APDA 1KLVA 4AWJA 1OTRB 2BYFA 2KFKA 3VXWA 2M14A 4K7WA 5JHAA 1I7AA 2LOZA 3VVWB 2KQSA 2MSED 1WJUA 2C7HA 1WGHA 1V6EA 2KN5A 1YX5B 2ZEQA 1NTYA 3VUXA 2VRWB 1YJ1A 2DLWA 4JLCA 3DXCA 2JT4B 4HAVB 2FCNA 2PJHA 4EEWA 1GC7A 3RCZA 1PFJA 3A9KB 3HW2B 1PMSA 4HK2A 4Z2NA 3W1YA 3PGEA 2NZ8B 2D9WA 5IA7A 2XK5A 2DZMA 4FJZA 1EF1A 2JZZA 1QC6A 3R7RA 2CU1A 4PS7A 1UPQA 2V3SA 3NZUA 3JSVA 1WH3A 1P5TA 5E6NA 1QZEA 3Q3FA 1U2BA 2KUPA 3L0WB 1H8CA 3UINB 1XODA 4BKSA 3PVWA 1UNPA 4W9GA 1W1GA 4IAPA 3X0WA 1TBEA 2FJ9A 4G0NB 2D07B 5JH5C 4BKGA 5JHHA 1Q5WB 4MJSB 2L0TA 3H7PB 4DHZB 2Y8FA 3VOQA 2KX0A 3PT2B 4ZRJA 4WWPA 2V76A 2L2IA 5CHFA 2RPQA 2KD0A 4GN1A 1J0GA 3FLVA 3UQAA 1S1QB 2I1JA 3UF8A 2Q13A 3KRXA 3D32A 1WFYA 1E7VA 2KWUB 1W1DA 5IJMA 2MP2A 1MKEA 4HAWB 1JRUA 2COPA 4JL9A 1MG8A 3PSCA 1BTKA 2O6VD 3OJ4B 3ZKJC 2NMBA 4Y94A 3ZNZB 2GCJA 1U4AA 2MX2A 4NNJB 2LKOA 3RCPA 4NQLB 4A6KA 4W9IA 4IOYX 4E71A 1NVLA 1J8CA 1OMWA 5J2RA 2G3QB 4KV2A 3PRZA 2KJRA 4II3B 1WMHB 1KI1B 5KCVA 2UZSA 1L2NA 4IC7B 1UBQA 4CHKA 3RD2A 4NPNA 1EAZA 3UZTA 1DDMA 4A6HA 1F9JA 1S3SG 2KCJA 2OJRA 2HE7A 2R2OA 2N9XA 3IFWB 2D2QA 2DFKA 2CY4A 3EC8A 4HB0B 1WG7A 3CIKA 3JW0X 3PHWB 1IRSA 5LLIA 3PSEB 3IHPC 3M62B 3PRMB 4GDKB 1YQBA 3IVFA 4I6LB 2L0FA 5KHQA 1TJ6A 2VKIA 2A4ZA 1M7EA 3R66C 2JZ3B 1TZ1A 1P9DU 4TUUA 1NI2A 3SNHA 3CMMB 2KK8A 3QAQA 2LRWA 4B9KA 1FHWA 1FGYA 2NBWB 2IFSA 2ELAA 4GMVA 3PPAA 4F7UP 5KQ1A 1P98A 1WX9A 1L7YA 4WAAA 3TIXA 2KWVB 1N3HA 2DZKA 2JRIB 3HM3A 2W2XD 1ZM0A 2YRYA 2XQNM 4WQOB 4G11A 2IO3B 1UELA 2LZ6A 3V60A 2PZ1A 4HATB 2EKEC 1BT0A 1ZSQA 4ANVA 4AJWA 3EFUA 5D6JB 1C3TA 4A6FB 3HIZA 1WXSA 4I6NB 2LYDA 3HM6X 4EZLA 2K2UA 4JGHB 4MSQB 2KTRB 3O65B 3F5RA 2ZNVB 4K2PA 1U27A 2DX5B 1GC6A 2K8CA 1M7RA 3H7SA 2E2XA 2ZPYA 1DYNA 2LVQA 1P6SA 5GMVA 2Z0EB 4CYEA 3WALA 3PZDA 2I1KA 3MTNB 3EPYA 4AUQC 2NPTA 2KC1A 1NDDA 2C5LC 1P3RA 3ZDTA 3UGBB 2C7NB 4TYZA 2I5CA 1P3QU 3L13A 2MBHA 4IWOA 1Z87A 3ZLZA 2MBEA 2YF0A 2IBIB 1WJ1A 2KLCA 4BKSD 3ZDMC 4A20A 4HLEA 2LI5A 2YLMA 5D2MB 3A9KA 4PYZA 4W9KA 3P2BA 2OQBA 5BO4B 1WGYA 3FSSA 3TCAA 1E8YA 2MWNB 3AI5A 1TQZA 5FI1A 3ML8A 3RYTA 2H7EA 1ACAA 2ZCBA 3MDBC 1FHXA 2R0DA 5EDSA 4MH0E 3KRWA 1MIXA 1LW3A 4KVGB 1KZ7A 3GOEA 3QARA 2JP2A 4KDIC 2G4DB 4B95A 2GS0A 4DX8A 4BOSC 2KQ7A 4IM2A 3CSFA 4ZDVA 3N7CA 1M94A 2DZJA 3C0RB 2D3GA 3ZW3A 1NTIA 2ZJDA 3MHSD 3T06A 4JIOU 4B6HA 2RR9A 2C60A 2IO2B 1V9JA 1LFDA 1K5DB 3L54A 5G55A 4MJSA 3A8PA 3H7PA 2W9NA 2Z59B 1ISNA 2WDTB 1X1MA 2GBMA 2MKRA 5CLLB 2DYOA 2KFJA 2R2QA 2DYQA 3NZSA 4IWQA 1WGGA 1RFAA 2N9PC 3A1QB 2IO0B 2JPHA 1U5FA 4IFSA 4TQ1A 3ONSA 3AU5A 1NTVA 3N3KB 2N0YA 3DOWA 3FM8C 2BCJA 2D9XA 2J7QB 2DTCA 2YT1A 4NJ6A 3OJ3A 4W9CA 4C0AA 2DX1A 3ML4A 3K9PB 2GBNA 4KZ0A 3CXBB 2DYNA 4AP4C 2RNRB 4MM3A 4FN2A 1UEFA 2HD5B 2FAZA 3ZNID 2MLBA 4B6WA 2W2XC 5GOWB 2YT0A 3KSYA 1WMHA 3VFKA 3QA8A 4FHKA 3A4RA 2UZRA 1YIWA 2D4QA 1EGXA 4W9LA 1WF9A 2ZVNA 4XWXA 3TBLD 3SU8X 3CSTA 3JYUA 2Y8GA 1DDWA 1WR1A 2P8VA 4BBKA 2DYMA 5J18A 1XT9B 2DYBA 1V61A 3JVZX 1ZKHA 5CHVC 3DQVA 2ZCCA 4KDLB 4WWOA 3G9WA 1DBHA 4GDKA 4EOYA 1G6JA 1XX0A 5AZGA 4GXBA 3DBLI 3NHEB 2KVRA 2MBQA 1C1YB 2LASA 3F0WA 4F7ZA 2JUOA 1OGWA 4LCDE 2ZNVC 1SE9A 2MCNB 5JHGA 4EJNA 3KY9A 4GOCA 3VQIA 4HVBA 1WM2A 3DXDA 3WA0A 2D9ZA 3RUIB 2AYOB 4JQWC 3DVNU 3ENEA 3HHMA 2AWTA 1WI0A 2CHZA 4M8NA 4MGIE 3GZNI 3M95A 1V81A 3APFA 4FA6A 3GYPA 4BVUC 4HPMB 4A6FA 2FNJB 4LJOB 4G3XB 2BYVE 4G50A 5CHWA 1Q0WB 2D11A 3L16A 1TXDA 4BBNF 2X18A 4IG7B 3VH4B 2RQ1A 4KIKA 1AARA 4TKNA 2NBUA 3M3JA 1K8RB 4OVVA 2DX5A 2DZIA 5C16A 3WYFB 2KZRA 2KDIA 2P0HA 4WJPA 2O6VB 4P7IA 4FADA 1SIFA 1BAKA 3P6AA 2A5UA 1UGMA 2JF5A 2O2VB 3V62A 2BF8B 5TR5A 1XD3B 3QBVB 5L81A 4RM9A 1XR0B 2FCQA 4F7HA 2LGXA 3AULA 4XZ4A 1X11A 3WAMA 2Y5BB 2GMIC 3ALBA 4FBJB 4WJQA 2L00B 1HB6A 2JRHA 3A8QA 2KC2A 2LXAA 2ELBA 2WWZA 2EMSA 2NR2A 4DBBA 3VAWA 2IZVB 4N9F4 4K2OA 1DDVA 3VTVA 3RZWC 3ZVRA 3OLMD
chains in the Genus database with same CATH superfamily
3FTUA 3PE3A 3UPVA 3BIID 2AEHA 3UTMA 1UNSA 1SBBB 1HG2A 1I2HA 4F1PA 1X86A 4ILGB 3EHMA 1T0YA 2WM9A 2K5PA 2JZPA 2YINA 2WMNA 2DWQA 3CVLA 4HB3B 2VGYA 4WVFB 3AE4B 1ZDVA 1OCOE 1K5GB 1P0RA 3SF4A 2AQ2B 3CF6E 2LXMA 3Q8FA 4NY0A 2ZZPB 4BT8A 2CJOA 1MQSA 3AG4E 1KZGA 4MT7A 3H6NA 3W1SC 2WXMA 1B1ZA 4A3OA 2YSZA 4N39A 3KEZA 3ULEG 1U5EA 1K52A 4DLOA 4GZUA 2FO1E 2V8SE 4N3AA 3TGOA 1I35A 1DCEA 5FINA 3L22A 1WRIA 2K00A 1KLUD 2BYEA 3RRNB 1R4MI 2L3ZA 4ANUA 1UW4B 1Z5SB 4GIVA 2OCCE 1WGKA 3A4SC 1V88A 2KZTA 4NAMA 2Z0QA 4UDUC 4BETA 3SHQA 3EIJA 4GPKA 3Q8EA 1Z3XA 4GZDA 4OAVB 3MJWA 4HJKA 3PHXB 2I5FA 4GMRA 1WG0A 3ZKJA 4LTUA 1FRDA 2IYBA 2CHXA 4OZCA 4ACKA 2KFKB 2KLGA 3LB8C 2KDFB 1OXJA 2WX0A 2OOBB 1V5MA 3URYA 1JRPA 1WXAA 5DPWA 4DXGA 1HX8A 1W1HA 4G24A 3MX3A 2HRJA 4C0MA 1T6BX 2YEPB 3AECB 4DX5D 5KCMA 3AJIA 2DZNA 2DA0A 3C19A 2YNQA 4MY6A 1V5TA 2N7DA 1FXIA 3SFEB 1YX6B 3ZNHB 1N4SA 4L2LA 1OQYA 2KMCA 2LSVA 4HNAD 4YVQC 1IHBA 1P1AA 1S0PA 3PTFC 4H7YA 3QC8B 5D3IB 5A7DB 4ZRIA 1IBXA 2BT6A 3QDNA 4G23A 4G26A 2Z59A 1NI3A 5AZFA 1YMPA 3ZRHA 1SXTA 2IJ0A 2PVOD 2Z8LA 5D7GA 3E33A 2BWFA 1HS6A 5FZQA 1FEHA 1TYGB 3A1QA 2DAFA 2B3AA 5DCNA 2K6QA 1C9FA 1QQEA 4JHRA 3CLJA 4JEHA 2XNAC 3V30A 1B89A 5DI9B 4PYUA 4XYCA 5JMND 1ZP0B 4U95D 1YJJA 3BVGA 1H6PA 2ON8A 4G8KA 3RJVA 2RGFA 2XEWA 4HCNB 2NTSA 3NS1A 2FEZA 1FT2A 3VIAA 5FQ7A 2J52A 4HOTA 5LCWJ 1N4PA 4KZCA 1V2YA 4DDGD 3X23A 2JEKA 1LM8B 3P4QB 2WNMA 3ZHEA 1TGZB 3K9OB 3FC4A 1DNPA 4JKGB 4CHJA 5A23A 4OVUA 5E6PA 3L82A 1LTXA 1XCTL 4ITKA 3DXEA 4DHZE 2BF0X 4QJ4B 2WGSA 4II2B 1NBFC 4HQDA 1E8WA 3ZTDA 2CY5A 1A70A 2HTHA 1D6EC 4M8MA 1UUPA 2GGFA 3WIMA 2AVPA 1FIQA 3AM9A 3UIOB 5AUIA 3B77A 1XQQA 3DHIC 5LXHA 4K81A 3ZUNA 1DYQA 4A6QA 2KWDA 1Z2MA 2JWZA 3AXCA 2BW2A 5IAAC 3ZNGC 5T3RA 2BS4B 3UQBA 5AEKB 1PDXA 1RJ2A 2ADZA 3AS5A 2LRUA 4GCOA 3LYAA 4AOFA 5JJTA 1O1RA 1BWNA 4JKFA 1J7BA 3I5JC 3MC8A 4KHBB 2IY1B 1IPGA 1UH6A 4NAWA 3VH3B 2VZKB 1VBGA 1I4HA 1PGAA 3D8FA 4GTVA 2LOXA 3B7BA 3FEYA 4JWUC 3TWRA 1MI0A 2WMOA 1UZXB 3RZFA 2AXUA 2DAJA 4M00A 3VDZA 2GRNB 2IYDB 1V80A 3OHMB 1Y8MA 4MDKE 3GS2A 5KQ4A 2BKRB 1FCCC 3J9CA 4EECA 4YSZB 5D3VA 4H8SA 2ZKMX 4YVOA 4J8SA 2I6HA 2DENB 4YSYB 1XF5L 2IONA 1CMXB 3RMKC 3NSUA 4W9EA 4XWWA 4ANWA 1BLXB 1R7SA 3TFMA 5KHOA 1F52A 2LAIA 3UUXA 3MPXA 4E74A 4ZOHC 4YDOA 3HXDA 2INPE 1TEZA 1HQRD 2CS4A 2QCZA 4GU2A 3ZTCA 4BKTA 3MKQA 3P4PB 1TJFA 3CV0A 1IXVA 4JC8A 3Q69A 2LD9A 4YL8A 2ZGDA 3PNLB 1H4RA 1BPOA 3U7DA 2RD0A 3SBGA 4C0EA 5JHBA 4KHOA 1SE3A 3T8MA 2GRIA 4KBQA 4HB5A 3ZIMA 1ESFA 3C3QA 4DWFA 2D9VA 2N1WA 2WQHA 4HB2B 4UWLA 3FTVA 5H7PA 5LXIB 1T5XD 4JEUA 4E3CA 2KN4A 4L2YA 1N63A 4M7CA 1VJKA 4DX6D 1C79A 2ACZB 1WM3A 3B95A 4XI9A 3DRAA 3I3TB 5C5BB 2RVBB 2NBVB 1H2VC 5DPTA 1BMLC 1AN8A 5C23A 1LGRA 4RGMA 1N52A 3AS4A 1JWMD 2J08A 3PLUA 1JCRA 2E2EA 3D8EA 1MX6A 1MIZB 3D9PA 2YS1A 1QILA 2CKHB 2IGDA 3FP5A 5IRSA 4XX5A 3NOGD 1WRDB 3V5WA 1QYMA 2KDBA 2DKQA 3VTWA 2AJAA 1WZ0A 2LXCA 2K8HA 2MP2B 1UF0A 3B13A 4GU5A 1WX8A 4O1PA 3IBEA 2X0SA 5ENNA 3EU9A 1V49A 2JX5A 2LJIA 2FIFA 2VSXE 1YN3A 2XCCA 1AWCB 2CODA 4EZJA 4JKDA 3SBSA 1FPPA 2EELA 1TNZA 4GPTB 3PS6A 3SHFA 4MGZE 4CGVA 2D3BA 2R5SA 5CEAA 1SGHA 2H6HA 4C7ZA 2GJYA 4CHMA 2D5GA 2OEWA 2SAKA 4LNFA 3DWGC 4HXIA 3KZ1A 3KWVA 1X05A 3BINA 1HTOA 5D3YA 3LYYA 2F8YA 2J42A 1H2TC 2QHOA 4QXAB 3B1LX 3G2SA 1VLBA 1ZVRA 2Y1LE 2K9XA 3M63B 3PUJA 2YHCA 4YTMB 3QWZB 1WJNA 5I4DA 2DNFA 3Q3JA 4WJNA 3PVLA 2JY6A 1PAQA 2OV8A 4RVBA 1JWBD 3CIRB 3A9JB 2NS5A 3OANA 4CDMA 2IY0C 2KDMA 5FQ8A 2LEKA 3L10B 3L08A 4GA0A 4TMAB 4AJYB 2DHKA 3K9IA 1LO5D 3I4GA 4C4VA 2RUKB 2BPSA 2M8SA 3PVUA 1WYWB 3AE3B 3P7ZA 1YN5A 2REXA 4DHJD 4B8AA 5J3YA 4RH6A 5JVLA 2ABDA 3SNXA 5CMWA 3RULA 2EIJE 4I1AA 5LG4B 2M1MA 1MK9B 4DXAB 2FI7A 1RLFA 1H2UA 3Q47B 1LXDA 3TL5A 1Z3YA 2YHEA 3FTXA 3NY5A 4NQ0A 2D3AA 2UU7A 5FTPA 4GB9A 2MBBB 3FH5A 1KF6B 2WX1A 2GBRA 3U9WA 4ACLA 2ASQA 4TSSA 4WH4A 5L95C 1AYFA 3DBSA 1J19A 1O5MA 1NL4A 2GRLA 3HG0D 2BB6A 1SVXA 4LNKA 3QIJA 1XLNA 2WXIA 4GA1A 3FU6A 2WHIA 5BV0A 2JVCA 3T9LA 3W9CB 3U7ZA 2YT2A 4UI9J 3J5PA 2XEEA 4DQOC 5EE1A 1OWPA 1H0AA 3NW8A 2Y5PA 1FVFA 1FD6A 1LD8A 4XIFA 2X3MA 3ZJUA 4JKHA 4E85A 4HCPB 2H6FA 1UNQA 3UMVA 3JCKC 3UT7A 3X2QE 2R17C 4GA2A 1UWMA 4ZRQA 4GYWA 2GBKA 1OT8A 3ZYKA 3AEBB 3TSSA 5C1ZA 4I2ZA 2XGOA 1TNBA 2YQ8A 4L6EA 3E9OA 2LGIA 2P9LG 2Z14A 4LDTD 2P0FA 2WQ6A 3SI5A 2LBBA 3N20C 3G2UA 1ZU2A 3ZU7B 1WY8A 1JQ4A 2WXFA 4I6GA 1V5OA 1X5BA 1VCBA 4F8CB 4HDOA 3N30A 2DHIA 2BGFA 4GTMA 3RT3B 5M72A 3DBHB 4KSLC 5J08A 1B55A 4HAUB 1N61A 1QOFA 2MWSB 3AE9B 4O1NA 3FVCA 5D3DA 3SYXA 1ST7A 2FBNA 1ELWA 1KZOA 2N9LA 1FHOA 4LRZA 1GJZA 2GBJA 4DBGA 4NJ7A 3ZYQA 4HWIB 5FIOA 1UG3A 3DPDA 4AV7A 2RMMA 3AEGB 4J6IA 3IG3A 3AE2B 4IYPA 5FR6A 3A98B 4HKZE 2X38A 5FWQA 4HB4B 5HS0A 1C4AA 1EF5A 1YMHE 4EPZA 2LGYA 3NOBA 2WXJA 2YEPF 2L1CA 5EIDA 2C2LA 3D9KA 4FC8A 1WXQA 3PDNA 1ET6A 2M0XA 2LHDA 1ZUD2 2QMTA 2L6JA 4UWFA 4ZYNA 3SZ7A 4ILGA 2CQUA 3V3XA 1MK7B 1XEEA 4FLHA 4AS1A 3B08A 2MRIA 2DYRE 2PKOA 3EHRA 1FB8A 2J0KA 2N9EB 3L9TA 1STEA 3V61A 3Q2AC 2LMCA 2H6GA 3QHTA 1OUVA 1ZGUB 2FDQA 2KNBA 1VBHA 4IM0A 3DVGX 2XN9C 3KYDD 3R2TA 3TG5A 2UVMA 2E6XA 4MGKE 2J4BA 5BW8C 4YTNB 1FO4A 1Q10A 2GCLA 1V5PA 1HTQA 4LNGA 3Q8AA 2KIEA 1Q1OA 1XKEA 3ULYA 1OCCE 2C0MA 4C9BB 3SEBA 2RDGA 2GOWA 3KUDB 2EJ8A 3CEQA 1NA3A 3ULBA 2EQXA 2OHFA 2NC9A 2NTTA 2Y69E 4H2AA 4BX8A 3FUNA 2CAYA 3QWVA 2Z4DA 3HXEA 4K1RB 3VUWA 4U96D 2GRQB 4GMXB 4YDYA 5DHFB 2Y4TA 4U8HA 4FJYA 2G35A 3DHGC 3RSEG 2RDHA 2ZIRA 3FTWA 1I42A 3AS8A 4K7UA 5ANRA 5C2YA 3TWQA 2M4NA 1U3CA 3DSWA 1GPXA 2KXJA 3AEDB 2KKCA 3R3MA 4CDNA 5JLJB 1JCQA 2D10A 1HEZE 3KUCB 1XGWA 2NCNA 1EF1C 2V4LA 2BWES 5BYRA 1V86A 1XCGA 2ZW1A 3EHVA 2L8JA 4NURA 1FXAA 4BFRA 5JA4D 1UD7A 2NPTB 5FZRA 3E56A 4M3OA 2WYQA 4KKIA 2K6DB 3FILB 3UT4A 4DX1A 1QQGA 2ZVOA 2AXVA 4HOUA 2EILE 4HRMB 3Q7AA 3VHTC 4HDQA 2FCSA 1U5DA 3QCAA 3P1MA 1E5WA 3KSLA 3PLVA 5L83A 4DJAA 5J17A 4BSZB 4RF1A 1A5RA 4AIFA 5IO9A 3H8HA 2M38A 4US9A 5EIBE 2KXPC 2XZTG 3Q7FA 3CHQA 5D3WA 3ZQ4A 3TXNA 2R2LA 3Q9UC 1TJEA 4UQXA 2DHZA 1GB4A 3SFDB 2QC8A 1DOYA 4QAYA 2MBOA 4ANXA 4O60A 1SQMA 1WJ6A 2CR5A 4KGSA 4YTPB 4DI3A 5DIZA 3NS8A 2L05A 1HE8A 4JKGA 1NYRA 5D3XA 1FFUA 2AL3A 3EFCA 3TMPB 2ZISA 5DH9B 4TQ0A 2G9HD 4A5KA 1AQCA 5M4YB 2LFIA 3KEAA 4GZ6A 2EC1A 2K8BA 4LK0M 3DBRI 4MELA 2KGXB 2PE9A 3L4PA 4GZCA 1SHCA 4MACA 1XD4A 2LULA 4PK1A 4C56C 2LG1A 3HQCA 2Z0PA 4NACA 3TO1A 5DPRA 3Q75A 5E6OA 3ASDA 1X1GA 2VYIA 5KJNA 1YQ4B 1FMAD 4KHBA 2KT7A 4D0NB 5DBKA 3TEYA 2WXNA 3HVZA 3S7JA 3E34A 4UI9K 4ZRKA 2KTRA 4PT5A 1SE4A 4WJOA 1TN7A 5HE1A 3H9DA 3LXUX 2Z0DB 2L76A 1AW7A 5AN8A 2J0JA 3LCAA 1QZ2A 1T0RC 1N5XA 1KZPA 1TYQG 4KHAA 2I2YA 2J4DA 4IUMB 1GUAB 2MYOA 5T4YA 4F53A 2M63A 3ECIA 3VLEA 2JXXA 4PS8A 4HBDA 2EIKE 5CTRC 4GAAA 4B8CB 3VR8B 2DWZA 2FCMA 2VJ8A 3P1UA 4BBNC 3ESLA 4WWMA 3APCA 5JP4A 1FT1A 3G2VA 4F7GA 1IKND 2N9KA 3Q78A 4EKUA 4KAXB 3DWMA 2YVCA 1E7UA 1UOHA 3UQ3A 5G2NA 3SR6A 3HUIA 2FO7A 2KVZA 3ZRFA 2COFA 3C8YA 4BOZB 3KVFB 1N54A 2LUEA 1Y19B 3TEXA 5KNHD 4JA9A 2LNIA 1IUEA 2K2JA 4HPPA 2Y7BA 3D9MA 5CX3A 1RAXA 4DUIA 2IY0B 2ROVA 4XEIG 1WI1A 2P0DA 1WX7A 1U2VG 2E3TA 2W55A 2D9YA 2BBCA 3RNEC 2DZOA 5J3TA 1WE6A 2X6HA 2XBBC 3IXEA 1R4NI 4JKAA 3B7SA 3U64A 5HE3A 5C5BA 2KYWA 1CJEA 5HQ8A 1RW2A 1ZOYB 1SIJA 3KYCD 2PE6B 1PYWD 2L7RA 3D8DA 2RG8A 1PLSA 2BQQA 2KACA 3IEGA 1VDVA 2GW1A 3CVUA 5HE2A 3DSXA 1EPUA 1FXTB 4S0RA 3WCQA 1KM7A 3QWMA 4K17A 3DXKG 4A3PA 3LDZE 4EUTA 1GOZA 5JJ6A 3DWLG 2PMVA 4ZFHA 4KSKC 5HKHA 4URKA 3PUKA 4QJ5B 1GNUA 4C7YA 4IM3A 4NSWA 5E6JA 1F77A 1EWCA 2Z0OA 1ZBPA 2OEDA 2X6IA 1X81A 3QK0A 5FI0A 2VSZA 1BI7B 3HK0A 5AUKA 3MA5A 3MGBA 1EM7A 4FULA 5ARFA 3ASNE 2X8XX 1MG4A 3BY4B 2KO3A 1WGUA 3Q3MC 3KUZA 2R2YA 2RSUA 3C98A 5DHAB 3SV1A 3WAPA 5BT1A 3WG7E 4MEMA 5C79A 1SE2A 1ZXHA 4FXCA 3CVPA 2LGDA 3GW4A 4YT0B 2DHJA 3C5RA 2P9UG 3GP7A 1VD2A 2EMTA 1DVPA 3FTSA 2F0YA 2H88B 2KC7A 1A17A 3JXJA 1IQRA 1K50A 3M1IB 1NA0A 1JPLA 1TTNA 5FR3A 3UIPC 4UQZA 4M0WB 3WANA 3ONKA 5AYWD 2MW5A 2Y0BG 1UJJA 1UPRA 3AE8B 1S70B 2JXTA 1ZDXA 4D6WA 2N23A 5EFXA 1WSPA 4F1SA 1KBLA 2EKIA 2V4IB 3A9JA 3V6CB 4GDLB 3AE7B 4WNFA 4L23A 1WJ4A 2COCA 3FU0A 5AENA 3LXFA 2KJHB 4K3CA 2KMMA 3LY9A 2INDC 2N7EA 1K1BA 2W54A 3ZXRA 1Y5OA 2VRRB 4B89A 3EECA 1YD8U 1WZ3A 3WAOA 1KJTA 1LQBA 2K39A 2V1YA 3CKCA 2ILRA 4ILHB 1WYGA 3KLSX 1KRHA 5FZSA 2RGNB 5EE9A 3LY8A 3GE3C 1ACCA 3HSAA 3LJ3A 4F3VA 3MZLB 1OEYJ 3DVGY 1Q2ZA 3QNKA 4NQKE 4XC2A 1H10A 4P1BC 5DIFB 2AL6A 3ML9A 3Q15A 1K53A 1DROA 4IOIE 4DDID 3AEAB 3F6QA 2KOXA 1GGOA 2J49A 4CT4A 2N1VA 1FVHA 4A8XC 2LWPA 3SO6A 3KH0A 4IKGA 3BUAA 4JE3B 3RNBC 4GSWA 2KCKA 1FAOA 2KJ6A 2QSDA 3B0AA 5HKPA 4ICVA 1ZYIA 4W9HA 3D9HA 1BTNA 3V2OA 4XE0A 2BS2B 3ZJTA 1WE7A 4EQFA 3ZEFA 3QOUA 3P42A 3D3MA 3W1SA 4IW0A 1UNRA 5C6RA 4GTOA 1CZPA 2FIDA 3U8ZA 2WXGA 1HFAA 5JZEB 1BI8B 4YWGG 3A33B 3PEVB 1PGXA 5KBAA 3FHEA 2KTFA 1OWLA 4WJ7A 2LVOA 1FNVA 5LFAA 4HPLB 1WAO1 1J0WA 2QY7A 1HZ6A 3KQ4A 3TJPA 4L7TA 4X57B 2CHWA 3E30A 4NRHB 4J3OD 2VGXB 3OTNA 4FLBA 4N59A 2CRFA 4PNKA 3B7TA 3MEKA 3TW1A 1ZC4B 4HEA1 4CT0A 1V89A 1LF8A 4RG6A 3ZO5B 3FUEA 1WGDA 4EMOA 3ENBA 2RLOA 2LO6A 4LEUA 4EBAG 4JW1A 1C78A 4ZYSA 1KOTA 3H1UA 4G8LA 3NZ3A 2LVPA 1HF8A 2LJ5A 2WH5A 5HHDG 2IEJA 5FJYA 3S2AA 3DDCB 1SJED 4WNGA 3SUZA 2WLBA 5CLQB 2DCPA 2XK5B 2XS8A 4MGYE 3R7QA 4ATZD 2VH2A 1SB3C 2GI9A 4R3DA 1SZ9A 4K5AB 1M4VA 4IULA 1OQRA 5BMIA 4REZA 4XKBA 4G1TA 1L6VA 4AVXA 3W5VB 1V5UA 4GTRA 2N7JA 1S64A 1XLOA 3TEZA 5AARA 4ASWC 3CVNA 4KXKB 3U30A 3O13A 1ZW7A 2ZU6B 2L9BA 2QZAA 2LUMA 4W9JA 3LVQE 4F7AA 4CO7A 4APFA 4HAXB 5BYQA 1N9AA 4MK0A 1UWXA 1UN8A 4LERA 1OQNA 3JSVB 3AG2E 2FUHB 5TSSA 3OG5A 3ZRCA 1U3DA 3KW5B 4HKQA 2XCBA 2LGSA 1EUVB 5FKAC 3CGHA 3V6EB 1OEYA 3GYZA 1FM0D 1ZC3B 2R03A 1EVHA 2OTXA 1OWOA 1DIKA 2J9QA 1EU3A 2KMAA 3QX1A 2VSNA 4UQYA 5HE0A 5LOZA 1BD8A 2KANA 3G2TA 1HZ4A 3CHOA 3P63A 3L17A 2K8EA 5ARGA 3LDZA 3BU8A 1N11A 4PDXA 3PEGA 2IF4A 2LSUA 2GRPB 3U4EG 1VZ8A 1TY0A 2UWQA 4RGNA 4KIKB 3R9AB 5KWDA 5AQBA 4DX2A 3MV3B 1XNFA 2C7MB 2HE0A 3B7UX 3HVEB 4W9DA 3W9GA 2N4FA 4U8VD 4GMJA 4LNOA 4LJPB 1V54E 4HAZB 5H92C 2ICIA 4JKEA 3MFGA 1N0QA 2L0TB 2IFUA 4U8YD 2KUQA 3ZYYX 4YONA 4K7SA 5HI7A 5GXGB 5CRUA 2PEAA 4IWPA 4TRQA 3SFYA 2DBYA 3D9OA 4Z2MB 4DK5A 5CCMA 3LJUX 3ASHA 3N32A 3ABLE 2AQ3B 2P9SG 4WNEA 1YN4A 1ROEA 1WGRA 1MHQA 4HRNA 2DKPA 2MEKA 3CQCB 2BS3B 3LJNA 3GE8C 1ZXIA 3AAAC 1E8XA 3ZFWA 5IY5E 4I1MA 2COAA 1MJDA 3N1YC 3HRDD 2UY1B 2G4SA 1MPHA 4DIXA 2R02A 3ULCA 3T5VA 3IAS1 1MAIA 2ETAA 3RAUA 2J59M 3A58A 3DCGA 4DX7D 2AX5A 2GRMA 4BY6A 1X1FA 3PRPB 3BQOA 1WVHA 2XPYA 3RFZB 4MSMB 2MHKA 4U0UA 3EUVA 4K3BA 4WWNA 4RM8A 1K1AA 3W5UB 4J8DA 3CK8A 4DHJB 3FUIA 2NXPA 4WUYA 2ROZB 2XEVA 3ABKE 4TV3A 3DSTA 2F37A 3O96A 5LOPB 5KJKA 2BKKB 2KHWB 4Q2JA 3FUHA 3KS2A 4YXDB 3ASFA 1FGZA 3ZVVA 3RI7C 1QF6A 2IGGA 3UINC 1U29A 2FE8A 4C00A 3PZ8A 2PL2A 2ZXWE 3SDLC 4DX90 2DN6A 4W9FA 4A9AA 2X6FA 4WSFA 1J7AA 2KDEB 2M17A 2NSZA 4U0ZA 3T8KA 5D94A 1OY2A 3VUYA 1Z6TA 4PQ0A 2R09A 3DVNV 4MRUA 1MFWA 4GTTA 2FJLA 3TG4A 5DPSA 3AH7A 1HBKA 4I6EA 3S7BA 3TVVA 1F2RI 2EIME 2VSOE 2NMQA 1KLXA 3DHHC 2IOLA 2X6KA 3I4RB 4I6PA 2PNNA 3PZ2A 1YOVB 2ETCA 1C4PA 4V3IA 3UXGA 4GGQA 2DVWA 2QKMA 1XLQA 5A6CA 2K49A 3JUIA 3FUFA 4B0ZA 1NU2A 1D3ZA 1MZCA 3HXFA 1HB8A 4HI9A 4KKJA 1TN6A 2UYZB 5AZHA 1PGBA 3AMZA 4WAFA 3OAWA 3VLFA 2P58C 1LB1A 1GAQB 1Q67A 4LNUD 1GG3A 3AG1E 4B0EA 2MQJA 2YS5A 4PS3A 1TY2A 2MA9B 4LDTB 2MFQA 4ZHBA 3PV1A 2NYJA 1U5GA 2K25A 1IP9A 5EYPF 1H6OA 1FOEA 1IYFA 4OVZA 2W82A 3MJ5A 4QFVA 2F8XK 4KVOA 2BKFA 2ZPNA 3QJZA 1RRBA 2A5EA 1Y8RC 4BX9A 1PQSA 3TAXA 3DXMG 4FP7A 4EZKA 4MBGA 2O6VA 3MC9A 4JZYA 3HIEA 1E8ZA 1NVID 3GYOA 5G5GA 4AP2A 1UBIA 3UIPB 3UKUG 3ODXA 1FRRA 1WY6A 5EN5D 2MRPA 4EFOA 2DIKA 4RGTA 2CB8A 4NIKA 4HHVA 2JU6X 3AU4A 2XENA 2O2VA 1TN8A 2YS3A 3PREA 2W3SA 1KLGD 1D4BA 5CBOA 2MDXA 1WR6E 2NVUI 2QJLA 3R2IA 4IDIA 4RG9A 2HJ8A 3CVYA 2KX3A 4P6VF 4USAA 3EDTB 3AE5B 4HXDA 3SD5A 4HAYB 4BZAA 4EE2A 3QQ8B 4OW0A 2ONDA 3B7RL 1I4RA 4A63B 1G3NB 3DEOA 1EO6A 1AWEA 1E90A 3JQ1A 2VH1A 4DLQA 2MJ3A 5FQ6A 4JL0A 2XRYA 5HRYA 2C9WB 1SW6A 3FEHA 2XS1A 1OWNA 2VGEA 2G45B 1FNWA 5D27A 1WXVA 1D9SA 1JW9D 3C72A 3DBHI 1T0QC 3RKVA 3E9SA 3ODWA 1VR9A 1IGCA 4FU3A 1MHXA 3EU5A 1N5WA 4ZHOA 1WXMA 2GUMA 3FH8A 1DC2A 3V79K 1E7PB 2RSGA 2PPHA 1WGQA 2WB2A 2IO1B 4ICUA 3NF1A 2V9HA 2K1FA 1TR4A 5E75A 4CYMD 3BK2A 1A5EA 4N2SA 3O48A 1HXYD 2J0MA 3Q79A 1C76A 1RRPB 3C3OA 5LONB 1WIAA 2HTHB 1FNUA 1I4XA 4FHJA 1WJMA 4FJVB 4BESA 2V3PA 3AJ4A 4K0RA 1D5XC 3B2GA 1UJKA 5CBNA 1PUTA 1TS4A 3EA6A 3BJIA 3ODOA 3RO3A 2H7DA 2KWCA 4M0WA 4RMAA 5LX8A 3FUKA 2BB5A 3FU3A 3VTUA 3UM1A 5J3QA 3TWUA 4NAWB 3NWFA 1DCQA 3Q6BA 2DBAA 1TNOA 3CVWA 3PG7A 4OSNA 4GDLA 1HXIA 3PP2A 2W2WA 3Q14C 1JWGA 2MOWA 4I9EA 2QKLA 5ITZF 4HORA 2XRZA 3TWSA 3APDA 1KFYB 4XWTA 3AEEB 3NQPA 2Q7FA 4DI4A 4B93B 2SEBD 4KGRA 3NG0A 3S7DA 2HM8A 4X8QA 4KGTA 4LLGM 3HXCA 4MT5A 3RNFC 1KLVA 4AWJA 2DLBA 1OTRB 4ILHA 2BYFA 2KFKA 3VXWA 1OY3D 2M14A 4K7WA 4J8YA 1MHHE 4JK9A 5G04J 5JHAA 1I7AA 5BMHA 1IYGA 2RFAA 2LOZA 3VVWB 5AQAA 3AN1A 2KQSA 2WU5B 4ILJA 1V8CA 4U0SA 2WXLA 4US8A 3Q5MA 3QWPA 2AW6A 2MSED 1L5JA 1WJUA 2C7HA 5CERB 2GB1A 1WGHA 2MHJA 4RGOS 1V6EA 2KN5A 3BEEA 1YX5B 2ZEQA 1QOBA 2P9KG 4I17A 1KTKA 5CEDB 1NTYA 3VUXA 2VRWB 3ZYLA 2HYZA 1YJ1A 1DGJA 3DBLB 2IO3C 2PVGC 4HOSA 4DRXE 2C0LA 4K5BA 3HVDA 5C2TB 3CIAA 3D9IA 2JABA 2DLWA 1ET9A 4JLCA 3DXCA 2WXPA 4DPRA 2G1EA 2JT4B 3LVRE 4JD2G 4TXPA 2L32A 4RQIA 1JCKB 4HAVB 1JDEA 4U04A 5KNGA 4YNDA 3C3RA 2FCNA 4IRUA 2IQCA 2K0PA 1NENB 5ENPD 2PJHA 4EEWA 1GC7A 3RCZA 1PFJA 3A9KB 3HW2B 3BK1A 5G5HA 3SFXA 4CCAA 1YNTE 1PMSA 4JB8P 3N1XC 4HK2A 1OCZE 4Z2NA 3T3NA 2H89B 3W1YA 3ZGQA 3EGRA 3PGEA 2FUG1 2INNE 3DPYA 4RLYA 4ACFA 1D8DA 3VTYA 2NZ8B 2D9WA 1UGJA 4AY5A 1RFKA 1FPYA 4GPMA 2XK5A 3AV8A 5IA7A 2DZMA 1D5ZC 4FJZA 4GTQA 1EF1A 1N0RA 4E6HA 4AQ7A 2JZZA 2IU1A 3N9YC 3IAM1 3FWVA 1QC6A 3R7RA 4HS2A 2XGSA 2CU1A 3GZNB 2L6BA 2WS3B 4PS7A 3RPFC 3P4RB 2RFMA 3ONLA 1UPQA 1QKZA 3R8BA 3MC0B 2V3SA 4Y6WA 3RNCC 3NZUA 2CG3A 3JSVA 1QOAA 1WH3A 1P5TA 5E6NA 4P1CC 2JSVX 1YJIA 1QZEA 3Q3FA 1U2BA 2KUPA 3L0WB 1FFVA 2KCVA 4EHMA 1H8CA 2CG2A 3EHQA 3SFZA 1YQ3B 3NVZA 4N3BA 2Q5WD 4RF0A 3UINB 4ARIA 1SA5A 3AE1B 1VRAB 4U63A 1XODA 4OAUC 4BKSA 2R59A 4GZ5A 3PVWA 1UNPA 1V1PB 4W9GA 1W1GA 1XCQL 2JWUA 4HSIA 2PLPA 4IAPA 4LNNA 4BAXA 4ME2A 4N3CA 2W3RA 3X0WA 4HI8A 4RNAA 3HVEA 1TBEA 4JWSC 3CHMA 3FEXA 5D2MC 2QEJC 2FJ9A 3AEFB 4G0NB 2QYJA 2D07B 5JJ7A 4BKGA 1SF0A 1V55E 5E76A 5JH5C 5JHHA 1B9RA 1Q5WB 4N6EB 1JALA 4Q69A 3T9KA 4MJSB 2L0TA 3H7PB 4BEPA 4DHZB 2Y8FA 3VOQA 3DEPA 2KX0A 3PT2B 4ZRJA 2NBVA 4WWPA 2V76A 5C1DA 2L2IA 3IV0A 5CHFA 2RPQA 4MH8A 2QYUA 2FULA 2OEVA 2KD0A 4GN1A 4HLLA 1J0GA 3FLVA 3UQAA 3O4ZA 3FH7A 1S1QB 2PZIA 2I1JA 3BG1B 1BUIC 2KR0A 3UF8A 2Q13A 2PQRA 3KRXA 3TEWA 3D32A 5H8YE 2UY1A 1WFYA 1E7VA 3TWXA 1W1DA 2KWUB 3E9PA 4ILIA 5IJMA 5G05C 2MP2A 1H19A 3LKUA 1MKEA 4HAWB 3FUJA 2OVBA 3NRZA 1JRUA 4G25A 1PFDA 1N4RA 2VTBB 1ELKA 2COPA 4GLSC 4GCNA 3IT4B 2RPVA 4JL9A 1HG5A 3LY7A 2QILA 1S63A 4U7EB 3DSUA 1MG8A 3PSCA 1BTKA 2O6VD 4JHKA 2DYSE 3OJ4B 2NMBA 3ZKJC 4Y94A 3ZNZB 4JA7A 2GCJA 2Y3AA 1P5QA 4MM3B 2ZGGA 3SBTB 1U4AA 3PH0C 1N60A 2WXRA 1GB1A 3GZ1A 5KJLA 2MX2A 4TUMA 3ZXSA 2LKOA 4NNJB 3RCPA 4NQLB 1IGDA 4A6KA 4W9IA 3UKRG 3RN9C 5BXUA 1AWDA 2WXHA 1JCSA 2LHEA 3MP9A 1K8KG 2IO2C 3HYMB 5T8IA 4IOYX 2Z13A 1UN9A 4E71A 1NVLA 2XGMA 4BTAA 2WDQB 1J8CA 1OMWA 1J7CA 4JVSA 5C3JB 3GB1A 3NUHB 5J2RA 1QOGA 4OYSA 1C77A 2G3QB 4KV2A 3FTZA 3PRZA 2BTEA 2KJRA 4II3B 2HTME 2IOSA 3ULQA 1WMHB 1KI1B 2RRFA 4HRLA 5KCVA 4N5QA 1E10A 3BYTB 2UZSA 4HJGE 1L2NA 1R4MB 1JWUD 1LD7A 4A1GA 4IC7B 1UBQA 1KT1A 2VQ2A 2M56B 1CK1A 1P7EA 3PE4A 3ETRA 3I5PA 4CHKA 3RD2A 1HA5A 1XO3A 4NPNA 1ELRA 1EAZA 1AP7A 2MJDA 3LEWA 3UZTA 1RZ4A 3IXSA 1DDMA 2RKKA 3VRAB 2QC9A 4UWKA 4A6HA 1IQUA 1F9JA 1S3SG 2KCJA 2OJRA 2HE7A 4YSXB 2QDFA 2R2OA 2M19A 3EUB2 2V4HC 3BG0B 3Q73A 2N9XA 5D0OD 3IFWB 2D2QA 3ASGA 2DFKA 1E6EB 2KCLA 2CY4A 3EC8A 4HB0B 3WXXA 2P9IG 4Z68A 3UI2A 2R82A 2BEDA 1WG7A 3CIKA 4Q96A 3JW0X 3RU0A 3CKBA 3ZYMA 2B0OE 3PHWB 1IRSA 5HI1A 5LLIA 1Y56A 2V0PA 3PSEB 1NFIE 5ENRD 5CHEE 3IHPC 3NWDA 3M62B 3PRMB 4GOUA 4GDKB 1MJ0A 4QJ3B 4U07A 3IVFA 1YQBA 2WQYB 3QB2A 4I6LB 2L0FA 2KBXA 5EX3A 5KHQA 3I57A 3MKRA 1TJ6A 2EINE 5AQ9A 2VKIA 4GMLA 2A4ZA 3KD7A 1M7EA 3D9NA 2JZ3B 1QNFA 3R66C 3RO2A 2PW9A 1TZ1A 1P9DU 2XQ0A 4TUUA 3TWTA 1NI2A 3SNHA 3CMMB 3E32A 1INZA 1E96B 4L1RA 2KK8A 3VLDA 4XDCA 2BYTA 3QAQA 4L9PA 2OVFA 2LRWA 3EJNA 4B9KA 1FHWA 1FGYA 1RWSA 3KWLA 4LNBA 2NBWB 2IFSA 2ELAA 4O1OA 3SGHA 4MKTA 3NOCD 1N94A 4RFBA 4OZAA 2WDVB 3RNGC 4GMVA 3BVZA 2OJWA 3PPAA 4JKCA 2HO1A 4F7UP 5KQ1A 1P98A 1WX9A 1L7YA 4WAAA 3DCXA 3TIXA 2KWVB 1N3HA 4AXHA 2CU3A 5IKCM 1D8EA 4PUCA 2DZKA 5CRVA 2FF4A 2JRIB 4A1SA 2W2XD 3HM3A 2IJGX 1ZM0A 2ZW0A 5BUZA 2YRYA 2XQNM 1MX2A 4WQOB 4G11A 2IO3B 1UELA 4ZHPA 2LZ6A 3V60A 2PZ1A 4HATB 3L6AA 2EKEC 4XDDA 1TZOA 1BT0A 4WQMA 1ZSQA 2LUHA 4LSZE 1L4ZB 4ANVA 4AJWA 3EFUA 5D6JB 1JUQA 3RK6A 1C3TA 4RSYA 5ANLA 2UWJG 4A6FB 3HIZA 1XLPA 3NB2A 2L83A 1WXSA 4I6NB 2LYDA 3HM6X 3V31A 2D3CA 4EZLA 2Y4UA 2K2UA 2L1AA 4JGHB 4MSQB 2KTRB 4WIPA 4KYOB 3O65B 1TS2A 2GLSA 5LCWC 3W2DA 3F5RA 1ZPSA 1RM6C 2ZNVB 3IT6B 1K51A 3OXFA 5EX0A 1IHGA 1WWTA 3OXLA 4CZ2D 3UM2A 4K2PA 2CJNA 1U27A 2DX5B 3E9LA 2LXLA 5KJMA 1KH0A 2WXQA 5B1AE 4RCOA 1GC6A 2K8CA 4IN3B 1M7RA 3H7SA 2E2XA 2ZPYA 5AJDA 1F0ZA 5ENSD 1FCHA 3ZNGA 2V3NA 2KATA 4JXTA 5CMYA 1OCRE 1DYNA 1P6SA 2LVQA 5GMVA 2Z0EB 4UUCA 3T5XA 2Y5CA 4O6FA 4CYEA 3WALA 2KIGA 3I63C 1TJCA 4AEZC 3NVWA 3JXIA 4HRSA 2R05A 1QBQA 3UM0A 3EHNA 3PZDA 3KAEA 4CRWA 4XI0A 2I1KA 1L0XB 3NJTA 2V5QC 2VZKD 3MTNB 5BMGA 3EPYA 4AUQC 1TKYA 2NPTA 4OHJA 1I4GA 4KMOA 1I4PA 1L0YB 2KC1A 3FILA 1ENFA 4K03A 4CQNA 1HH8A 2FBWB 1NDDA 2C5LC 1P3RA 3CK7A 4WURA 3ZDTA 3UGBB 1GW6A 2C7NB 5BYSA 4OZBA 3RRMB 4TYZA 1TNYA 2I38A 2P9NG 3L13A 2I5CA 1P3QU 2MBHA 4IWOA 1Z87A 4N5CA 3ZLZA 2MBEA 2YF0A 2MH7A 1PC2A 1WJ1A 2IBIB 5EILA 4W9RA 2KLCA 3PZ1A 3FTYA 4BKSD 1E0ZA 3P4SB 3ZDMC 4A20A 3CQGB 4HLEA 2LI5A 2YLMA 2CFZA 5D2MB 4CEMA 3A9KA 4PYZA 2WPVA 1ZB1A 4W9KA 3P2BA 2OQBA 1N6ZA 3ABVB 2QFCA 4I6JA 5BO4B 1WGYA 5BV1A 4PH4B 3AG3E 3FSSA 1TKGA 2PIAA 3TCAA 1E8YA 1HO8A 3U12A 2MWNB 1N62A 3FUMA 3AI5A 5HFYA 2GRRB 1TQZA 1CQVA 2FJUB 5FI1A 3ISMC 3ML8A 3Q4AB 4F6RD 1SSNA 3RYTA 3QKYA 2H7EA 1OWMA 1ACAA 3ZXPA 2ZCBA 4GTPA 3CVXA 3MDBC 5AJLA 1FHXA 1P7FA 2R0DA 3FUDA 5EDSA 4MH0E 5EE3A 3D9LA 3S7FA 3KRWA 1MIXA 3IKOB 4ABNA 1JWSD 2B76B 5FQ4A 3NAWA 1LW3A 3BVMA 3NVVA 4KVGB 1KZ7A 2HJ1A 3GOEA 3FY4A 3QARA 3ZUVB 3U66A 1KC7A 2JP2A 1T0SC 2PTLA 4KDIC 4WNDA 5AAOA 4I2WA 2G4DB 1K3ZD 4B94A 1TT5B 3BZDB 4B95A 3MV2B 2GS0A 3D9JA 4DX8A 4BOSC 2KQ7A 4IM2A 3DSSA 2H6IA 2KZTB 3CSFA 4ZDVA 4LG6A 3N7CA 3HRAA 1T3QA 1EYHA 3T3OA 3CVVA 4YDWA 1M94A 2P2CP 3U3WA 3ZXVA 2DZJA 1O1SA 4D2KA 3C0RB 2D3GA 3ZW3A 1NTIA 2ZJDA 3MHSD 4GYOA 3T06A 3U2SC 2WXOA 5HG2A 5BNWA 4JIOU 4J7WA 3UM3A 2ETBA 3SY2A 1TNUA 4Q94A 5D66A 4B6HA 1V1PA 2RR9A 2C60A 3ZPJA 2L52A 3FFLA 2IO2B 4Y6CA 1V9JA 3TWWA 4MS6A 4K5CA 1LFDA 4KT6B 1N4QA 1W3BA 3E4BA 1K5DB 3L54A 5G55A 1VZ7A 4JK8A 1EU4A 4MJSA 5IOIA 3A8PA 3H7PA 3ASOE 1IBXB 4HROA 2W9NA 2WQ7A 2Z59B 1ISNA 2WDTB 4D10C 2BUGA 4JPSA 2J09A 2WVIA 1X1MA 2GBMA 2I9CA 2MKRA 5CLLB 2DYOA 3LPZA 2KFJA 2R2QA 2DYQA 1DOXA 2BVCA 3NZSA 4IWQA 1WGGA 3PNTB 1RFAA 2N9PC 3Q9NC 3DSVA 2BKGA 2IO0B 3A1QB 3UI3A 4A3TA 2K3UA 2JPHA 1U5FA 4IFSA 4TQ1A 3SQVA 3ONSA 3AU5A 2J07A 2XPIA 4H7XA 2J53A 4GZ3A 1NTVA 3N3KB 5BXOA 2N0YA 1L4DB 3DOWA 3VRBB 3JQ0A 4ZRPA 1Y6IA 3FM8C 2BCJA 2D9XA 2J7QB 3RIBA 2DTCA 3TWVA 1YCSB 3ZHEB 4A3VA 2VTBA 2YT1A 1SA4A 1JROA 3GZSA 1Z5SC 2JYEA 3B2FA 4NJ6A 3OJ3A 4W9CA 5MPOA 4C0AA 2DX1A 3ML4A 3K9PB 3FU5A 2N0SB 2GBNA 4KZ0A 4J0UA 3EIQC 4XGAB 4G2VA 5CCLA 3CXBB 5I2SA 4UI9C 1NEKB 2KM4A 2DYNA 4AP4C 1SJHD 1XXGA 4MLPA 2RNRB 4MM3A 4YDEA 4I1OB 3SBTA 3FAHA 5EE0A 3ZJVA 4FN2A 1UEFA 3PO0A 2B6CA 2HD5B 4ATGA 1RYJA 5ENTD 5FT9A 2FAZA 4EBAA 3ZNID 1WDYA 2HR2A 1NYQA 5LP0A 2MLBA 1SEBD 4B6WA 2AXZA 4APOA 2PM6A 1I4QA 3G2WA 3AE6B 2W2XC 5GOWB 4N2QA 1T77A 2YT0A 3KSYA 1WMHA 3VFKA 1L6UA 1HZ5A 4KX6B 3QA8A 4FHKA 3A4RA 4LUNU 2UZRA 4M01A 5EYLA 1YIWA 4HFGA 3CHSA 2D4QA 1YYHA 3PZ3A 3QC1A 1EGXA 4W9LA 1WF9A 2CFUA 2XZDG 2ZVNA 3CWIA 4J8EA 4XWXA 1JWAD 3TBLD 4OT1A 4KVMA 4I43A 3MKQB 4ARCA 5LNK1 2WP9B 3SU8X 3BWUD 3QWWA 3CSTA 3JYUA 2Y8GA 3RNAC 3IHVA 1DDWA 1D5MC 2XHEA 1WR1A 5CECB 2P8VA 4HOQA 2V0GA 4BBKA 2DYMA 5J18A 3JUEA 3ABME 1XT9B 3MCXA 5D0QD 1OFFA 2DYBA 1V61A 1JMLA 3JVZX 5AQ7A 1YA0A 1ZKHA 1V1OA 5CHVC 3DQVA 3FP3A 3AB5A 2ZCCA 1BU9A 4JX1C 3I3NA 4UWHA 4KDLB 4C80A 4WWOA 2MJEA 3G9WA 1DBHA 4GDKA 3UIOC 3W9FA 4EOYA 1G6JA 3ZN3A 2KAJA 3TXMA 4BTBA 1XX0A 2QIEB 3N1ZC 2AWIA 1VZ6A 5AZGA 4GXBA 3DBLI 4DXFA 3NHEB 2KVRA 3ZGZA 2WDRB 3FKYA 3OWEB 2MBQA 3TUOA 4TXRA 3Q49B 4BT9A 1C1YB 2VGXA 3CVQA 3E37A 2LASA 3F0WA 4CSQA 4F7ZA 3Q8CA 1KT0A 2JUOA 1OGWA 4LCDE 1MVKA 2M0AA 2IDYA 2ZNVC 5B3SE 1SE9A 2L0IA 5JHGA 2MCNB 3JYSA 3PZ7A 4EJNA 2GROB 3KY9A 1V97A 4J8FA 4GOCA 4HVBA 5G04C 1TS3A 2BTDA 1WM2A 3VQIA 2X6JA 4A55A 3IHYA 3URZA 3DXDA 3Q3OC 4NJCA 3WA0A 2JQRB 1EDUA 1NI1A 2D9ZA 3RUIB 3CR3A 4LNIA 3DBRB 3V2XA 4GNKB 3J5QB 2JYTA 2AYOB 4JQWC 3CHPA 3DVNU 3ENEA 3PEUB 3LS8A 3OXGA 4BWRA 5I2MA 3UX4A 1OQQA 1PY1A 3HHMA 1QLBB 2IPKD 2RDBC 2AWTA 4GTSA 1WI0A 5J90A 2CHZA 2PM7A 4M8NA 1JWFA 4MGIE 2ONQA 3GZNI 3M95A 1V81A 3RRUA 4M02A 4GYYA 1TIFA 3APFA 4FA6A 4NZLB 3GYPA 3I9V1 4BVUC 3HXBA 1WM5A 4C4VB 1C4CA 4HPMB 2V5FA 4A6FA 2FNJB 4S17A 4LJOB 4G3XB 2BYVE 4G50A 5CHWA 3ESKA 4BSXA 1Q0WB 2D11A 1MYOA 3U52E 3L16A 3FULA 4QQIA 1TXDA 4UWGA 1H6KA 4JHJA 4BBNF 5IP4D 1BXTA 1TKEA 2X18A 2J4XA 4IG7B 3KSQA 1HU3A 3U4TA 3VH4B 2RQ1A 1DOIA 1L0VB 4KIKA 4TXQA 1AARA 5G05J 3BYYB 4TKNA 2NBUA 2PQNA 2KQ4X 3M3JA 1K8RB 4OVVA 4L1BA 2DX5A 2DZIA 2J8SD 5C16A 4BERA 3WYFB 4I9CA 2KZRA 1NZNA 3CHRA 4P29A 3VTXA 3R9MA 2KDIA 2P0HA 1KPSB 5JXVA 4CGWA 4WJPA 1FCLA 3MYVA 4B0MA 2O6VB 4P7IA 1NP7A 3N71A 2WU2B 3MHZA 3V05A 3E66A 3Q3NC 5FK9C 4FADA 1E9MA 2LAHA 3CK9A 1SIFA 1BAKA 3VR9B 2E0IA 3P6AA 2A5UA 1UGMA 2WXKA 2INCC 2JF5A 2O2VB 4R7LA 1R4NB 3NBNB 2AQ1B 3V62A 4A90A 1I7HA 2BF8B 4N58A 5TR5A 1XD3B 2P9PG 2R61A 2HDEA 2I2OA 5ENOD 3QBVB 1QQRA 5L81A 3B9JA 4RM9A 1XR0B 2FCQA 4F7HA 2JLBA 4XKCA 5B1BE 1MI1A 5ENQD 1F2RC 2LGXA 3AULA 1MX4A 4XZ4A 1X11A 3WAMA 2Y5BB 2GMIC 2XEHA 5BPPA 4AY6A 2IGHA 2OOEA 2XPZA 1QT9A 3ALBA 1L5PA 2K22A 1SZAA 1O1TA 4FBJB 2VSYA 4WJQA 4CDRA 2DIWA 1MPEA 3UT8A 4JKBA 2L00B 2TSSA 4JK7A 1N95A 1HB6A 2JRHA 3A8QA 3PZ4A 2KC2A 1F1HA 2LXAA 4LCTA 3HDXA 5IN7A 2ELBA 2WWZA 4P16A 5EKQD 2EMSA 4C48B 1VDYA 2NR2A 1TS5A 3Q8BA 4DBBA 3VAWA 4AM9A 3NVYA 2IZVB 4N9F4 1ZE3D 4K2OA 5AIJA 1DDVA 3GZ2A 3SO8A 1EWYC 3FDHA 3RZWC 3ZVRA 3VTVA 3OLMD 3NWAA
chains in the Genus database with same CATH topology
3FTUA 3PE3A 3UPVA 2AEHA 1HG2A 1I2HA 1X86A 4ILGB 3EHMA 1T0YA 2WM9A 2YINA 2WMNA 3CVLA 4HB3B 2VGYA 4WVFB 1K5GB 1P0RA 3SF4A 3CF6E 4NY0A 2ZZPB 4BT8A 1MQSA 1KZGA 4MT7A 3H6NA 3W1SC 2WXMA 4A3OA 2YSZA 4N39A 3KEZA 1U5EA 4DLOA 4GZUA 2V8SE 4N3AA 3TGOA 1I35A 3L22A 2K00A 2BYEA 2L3ZA 3RRNB 1R4MI 4DWFA 4ANUA 1UW4B 1Z5SB 4GIVA 3A4SC 1V88A 2KZTA 3SHQA 2Z0QA 3EIJA 4GPKA 1Z3XA 4GZDA 3MJWA 4HJKA 3PHXB 2I5FA 2IYBA 2CHXA 4ACKA 2KFKB 2KLGA 2KDFB 2WX0A 2OOBB 1V5MA 1WXAA 5DPWA 1HX8A 1W1HA 4G24A 3MX3A 2HRJA 4C0MA 5KCMA 2DA0A 2YNQA 4MY6A 1V5TA 2N7DA 1YX6B 3ZNHB 4L2LA 1OQYA 2KMCA 2LSVA 4YVQC 1P1AA 1S0PA 3PTFC 4H7YA 3QC8B 5A7DB 4ZRIA 3QDNA 4G23A 4G26A 5AZFA 3ZRHA 5D7GA 2BWFA 1HS6A 5FZQA 3A1QA 2DAFA 2B3AA 5DCNA 2K6QA 1QQEA 4JHRA 3CLJA 4JEHA 1B89A 5DI9B 4PYUA 3RJVA 2RGFA 2XEWA 4HCNB 2FEZA 3VIAA 5FQ7A 4HOTA 5LCWJ 1V2YA 4KZCA 4DDGD 3X23A 2JEKA 1LM8B 3ZHEA 1TGZB 3K9OB 1DNPA 4JKGB 4CHJA 5A23A 4OVUA 5E6PA 3DXEA 4DHZE 2BF0X 4II2B 1NBFC 1E8WA 3ZTDA 2CY5A 2HTHA 4M8MA 3WIMA 2GGFA 2AVPA 3UIOB 5LXHA 1XQQA 4K81A 3ZUNA 3AXCA 1Z2MA 2JWZA 5IAAC 3ZNGC 5T3RA 3UQBA 5AEKB 1RJ2A 2ADZA 3AS5A 2LRUA 4GCOA 3LYAA 4AOFA 5JJTA 1BWNA 4JKFA 4KHBB 2IY1B 1IPGA 1UH6A 4NAWA 3VH3B 1VBGA 3D8FA 2LOXA 3FEYA 2WMOA 1UZXB 3RZFA 2AXUA 2DAJA 3VDZA 2IYDB 1V80A 1Y8MA 4MDKE 5KQ4A 2BKRB 4EECA 5D3VA 4H8SA 4YVOA 4J8SA 2I6HA 2DENB 2IONA 1CMXB 3NSUA 4W9EA 4ANWA 5KHOA 3TFMA 2LAIA 3UUXA 3MPXA 4E74A 1TEZA 2CS4A 4GU2A 3ZTCA 4BKTA 3MKQA 1TJFA 3CV0A 4JC8A 2LD9A 4YL8A 3PNLB 4KHOA 1H4RA 1BPOA 3U7DA 2RD0A 3SBGA 4C0EA 5JHBA 3T8MA 4KBQA 3ZIMA 2D9VA 2N1WA 2WQHA 4HB2B 4UWLA 3FTVA 5LXIB 4JEUA 4E3CA 4L2YA 1WM3A 4XI9A 3I3TB 5C5BB 2RVBB 2NBVB 1H2VC 5DPTA 5C23A 1N52A 3AS4A 2J08A 3PLUA 2E2EA 3D8EA 2YS1A 1MIZB 3D9PA 2CKHB 3FP5A 4XX5A 1WRDB 3V5WA 2KDBA 2DKQA 3VTWA 1WZ0A 2LXCA 2K8HA 2MP2B 3B13A 4GU5A 1WX8A 1V49A 3IBEA 2X0SA 5ENNA 2FIFA 2VSXE 2XCCA 2CODA 4EZJA 4JKDA 3SBSA 4GPTB 3PS6A 3SHFA 4MGZE 4CGVA 2R5SA 1SGHA 2GJYA 4CHMA 4HXIA 3KZ1A 1X05A 3BINA 5D3YA 1H2TC 2QHOA 3B1LX 3G2SA 1ZVRA 3M63B 3PUJA 2YHCA 3QWZB 1WJNA 3Q3JA 4WJNA 3PVLA 2JY6A 1PAQA 2OV8A 4RVBA 3A9JB 2NS5A 3OANA 4CDMA 4AJYB 3L10B 5FQ8A 3L08A 4GA0A 2DHKA 3K9IA 3I4GA 2RUKB 2BPSA 2M8SA 3PVUA 1WYWB 3P7ZA 2REXA 4DHJD 4B8AA 5J3YA 5JVLA 2ABDA 3SNXA 5CMWA 3RULA 4I1AA 2M1MA 1MK9B 4DXAB 2FI7A 1RLFA 1H2UA 3Q47B 1LXDA 3TL5A 1Z3YA 2YHEA 3FTXA 3NY5A 4NQ0A 5FTPA 4GB9A 2MBBB 3FH5A 2WX1A 2GBRA 3U9WA 4ACLA 2ASQA 5L95C 3DBSA 1J19A 2GRLA 3QIJA 2WXIA 4GA1A 3FU6A 5BV0A 2JVCA 3T9LA 4UI9J 1OWPA 1H0AA 1FVFA 4XIFA 2X3MA 4JKHA 4E85A 4HCPB 1UNQA 3UMVA 3JCKC 3UT7A 2R17C 4GA2A 4GYWA 2GBKA 3ZYKA 5C1ZA 4I2ZA 2XGOA 2YQ8A 4L6EA 3E9OA 4LDTD 2P0FA 2WQ6A 3SI5A 2LBBA 3G2UA 1ZU2A 1WY8A 2WXFA 4I6GA 1V5OA 1X5BA 1VCBA 4F8CB 4HDOA 3N30A 2DHIA 2BGFA 3RT3B 5M72A 4KSLC 5J08A 1B55A 4HAUB 2MWSB 3SYXA 1ST7A 2FBNA 1ELWA 1FHOA 4LRZA 1GJZA 2GBJA 4DBGA 4NJ7A 3ZYQA 4HWIB 1UG3A 3DPDA 4AV7A 4J6IA 3IG3A 5FR6A 4IYPA 3A98B 2X38A 5FWQA 4HB4B 1EF5A 4EPZA 2LGYA 3NOBA 2WXJA 2L1CA 2C2LA 3D9KA 4FC8A 3PDNA 2M0XA 2L6JA 4UWFA 4ZYNA 3SZ7A 4ILGA 2CQUA 1MK7B 4FLHA 3B08A 2MRIA 2N9EB 1FB8A 2J0KA 3V61A 3QHTA 1OUVA 1ZGUB 2FDQA 2KNBA 1VBHA 4IM0A 3DVGX 3KYDD 3TG5A 2UVMA 4MGKE 2J4BA 5BW8C 2GCLA 1V5PA 1Q1OA 1XKEA 2C0MA 4C9BB 2GOWA 3KUDB 2EJ8A 3CEQA 1NA3A 3ULBA 2EQXA 2NC9A 4BX8A 3FUNA 2CAYA 3QWVA 4K1RB 3VUWA 4GMXB 5DHFB 2Y4TA 4U8HA 4FJYA 2G35A 3FTWA 1I42A 3AS8A 4K7UA 5ANRA 5C2YA 2M4NA 1U3CA 2KXJA 2KKCA 3R3MA 4CDNA 5JLJB 2D10A 3KUCB 1XGWA 2NCNA 1EF1C 2V4LA 2BWES 1V86A 1XCGA 3EHVA 2L8JA 4NURA 4BFRA 1UD7A 2NPTB 5FZRA 4M3OA 2WYQA 2K6DB 3UT4A 1QQGA 2ZVOA 2AXVA 4HOUA 3VHTC 4HDQA 2FCSA 1U5DA 3QCAA 1E5WA 3PLVA 5L83A 4DJAA 5J17A 1A5RA 4AIFA 2M38A 3CHQA 5D3WA 3TXNA 4UQXA 2DHZA 2MBOA 4ANXA 1SQMA 1WJ6A 2CR5A 4DI3A 5DIZA 3NS8A 2L05A 1HE8A 4JKGA 5D3XA 2AL3A 3TMPB 5DH9B 4TQ0A 4A5KA 1AQCA 4GZ6A 2EC1A 2K8BA 3DBRI 4MELA 2KGXB 2PE9A 4GZCA 1SHCA 1XD4A 2LULA 2LG1A 3HQCA 2Z0PA 4NACA 3TO1A 5DPRA 5E6OA 3ASDA 1X1GA 2VYIA 5KJNA 4D0NB 5DBKA 2WXNA 3S7JA 4UI9K 4ZRKA 2KTRA 4WJOA 5HE1A 3H9DA 3LXUX 2Z0DB 2L76A 2J0JA 3LCAA 1QZ2A 4KHAA 2J4DA 4IUMB 1GUAB 5T4YA 4F53A 2M63A 3ECIA 3VLEA 2JXXA 4PS8A 5CTRC 4GAAA 4B8CB 2FCMA 2VJ8A 3P1UA 4BBNC 3ESLA 3APCA 5JP4A 3G2VA 4F7GA 4EKUA 4KAXB 2YVCA 1E7UA 3UQ3A 5G2NA 2FO7A 3ZRFA 2COFA 4BOZB 3KVFB 1N54A 2LUEA 1Y19B 4JA9A 2LNIA 2K2JA 2Y7BA 3D9MA 5CX3A 1RAXA 2IY0B 2ROVA 1WI1A 2P0DA 1WX7A 3V6EB 2D9YA 5J3TA 1WE6A 2X6HA 2XBBC 1R4NI 4JKAA 3B7SA 3U64A 5HE3A 5C5BA 5HQ8A 3KYCD 2PE6B 2L7RA 3D8DA 2RG8A 1PLSA 3IEGA 2GW1A 3CVUA 5HE2A 1EPUA 1FXTB 1KM7A 3QWMA 4K17A 4A3PA 3LDZE 4EUTA 5JJ6A 4KSKC 5HKHA 4URKA 3PUKA 1GNUA 4IM3A 4NSWA 2Z0OA 1ZBPA 2X6IA 3QK0A 5FI0A 2VSZA 3HK0A 3MA5A 3MGBA 4FULA 5ARFA 3BY4B 2KO3A 1WGUA 3KUZA 2RSUA 3C98A 5DHAB 3SV1A 3WAPA 5BT1A 4MEMA 5C79A 3CVPA 2LGDA 3GW4A 2DHJA 1VD2A 2EMTA 1DVPA 3FTSA 2KC7A 1A17A 1IQRA 3M1IB 1NA0A 1JPLA 1TTNA 4UQZA 4M0WB 3WANA 3ONKA 5AYWD 2MW5A 1UJJA 1UPRA 2N23A 5EFXA 4F1SA 1KBLA 3A9JA 3V6CB 4GDLB 4WNFA 4L23A 1WJ4A 2COCA 3FU0A 5AENA 2KJHB 3LY9A 2N7EA 1Y5OA 2VRRB 4B89A 3EECA 1YD8U 1WZ3A 3WAOA 1KJTA 1LQBA 2K39A 2V1YA 3CKCA 2ILRA 4ILHB 5FZSA 2RGNB 3LY8A 3LJ3A 4F3VA 3MZLB 1OEYJ 3DVGY 3QNKA 4NQKE 4XC2A 1H10A 5DIFB 2AL6A 3ML9A 3Q15A 1DROA 4DDID 2KOXA 1GGOA 2J49A 4CT4A 2N1VA 1FVHA 2LWPA 3SO6A 3KH0A 4GSWA 2KCKA 1FAOA 2KJ6A 3B0AA 4W9HA 4ICVA 1BTNA 4XE0A 1WE7A 4EQFA 3ZEFA 3QOUA 3D3MA 3W1SA 4IW0A 1UNRA 5C6RA 2FIDA 3U8ZA 2WXGA 1HFAA 5JZEB 3A33B 3PEVB 3FHEA 2KTFA 1OWLA 4WJ7A 2LVOA 5LFAA 4HPLB 1WAO1 1J0WA 2QY7A 3TJPA 4L7TA 4X57B 2CHWA 4NRHB 2VGXB 3OTNA 4FLBA 2CRFA 4PNKA 3B7TA 3MEKA 3TW1A 1ZC4B 4CT0A 1V89A 1LF8A 4RG6A 3ZO5B 3FUEA 1WGDA 4EMOA 3ENBA 2RLOA 2LO6A 4LEUA 4EBAG 4JW1A 1KOTA 3H1UA 2LVPA 1HF8A 2LJ5A 2WH5A 5FJYA 3S2AA 3DDCB 4WNGA 3SUZA 5CLQB 2DCPA 2XK5B 4MGYE 3R7QA 1SZ9A 4IULA 4XKBA 4G1TA 4AVXA 1V5UA 4ASWC 3CVNA 4KXKB 3U30A 1ZW7A 2ZU6B 2L9BA 4W9JA 3LVQE 4F7AA 4CO7A 4APFA 4HAXB 4MK0A 3JSVB 1UN8A 4LERA 1OQNA 2FUHB 3ZRCA 1U3DA 3KW5B 2XCBA 1EUVB 3CGHA 1OEYA 3GYZA 1ZC3B 1EVHA 2OTXA 1OWOA 1DIKA 2J9QA 2KMAA 3QX1A 2VSNA 4UQYA 5HE0A 5LOZA 2KANA 3G2TA 1HZ4A 3CHOA 3L17A 5ARGA 3LDZA 3PEGA 4PDXA 2IF4A 2LSUA 2UWQA 4KIKB 3R9AB 3MV3B 1XNFA 2C7MB 3B7UX 3HVEB 4W9DA 2N4FA 4GMJA 4LJPB 4HAZB 4JKEA 2L0TB 2IFUA 4YONA 4K7SA 5HI7A 2PEAA 4IWPA 4TRQA 3D9OA 4Z2MB 4DK5A 5CCMA 3LJUX 3ASHA 3N32A 4WNEA 1WGRA 1MHQA 2DKPA 3CQCB 1E8XA 3ZFWA 2COAA 4I1MA 2UY1B 2G4SA 1MPHA 3ULCA 3T5VA 1MAIA 2J59M 3DCGA 2GRMA 1X1FA 4BY6A 3PRPB 1WVHA 2XPYA 4MSMB 2MHKA 4U0UA 4WWNA 4RM8A 4J8DA 3CK8A 4DHJB 3FUIA 2NXPA 4WUYA 2ROZB 2XEVA 4TV3A 3O96A 5LOPB 5KJKA 2KHWB 3FUHA 3KS2A 3ASFA 1FGZA 3ZVVA 1U29A 2PL2A 3SDLC 4DX90 2DN6A 4W9FA 2X6FA 4WSFA 2KDEB 2M17A 2NSZA 4U0ZA 5D94A 1OY2A 3VUYA 1Z6TA 4PQ0A 2R09A 3DVNV 4MRUA 2FJLA 3TG4A 5DPSA 1HBKA 4I6EA 3S7BA 3TVVA 2VSOE 1KLXA 2IOLA 2X6KA 3I4RB 4I6PA 4V3IA 4GGQA 2QKMA 5A6CA 3JUIA 3FUFA 4B0ZA 1NU2A 1D3ZA 1HB8A 2UYZB 5AZHA 4WAFA 3OAWA 3VLFA 2P58C 1LB1A 1Q67A 1GG3A 2MQJA 2YS5A 4PS3A 2MA9B 4LDTB 2MFQA 3PV1A 1U5GA 2K25A 1IP9A 1FOEA 1IYFA 4QFVA 4KVOA 2BKFA 2ZPNA 3QJZA 1RRBA 1Y8RC 4BX9A 1PQSA 3TAXA 4FP7A 4EZKA 2O6VA 4JZYA 1E8ZA 3GYOA 4AP2A 1UBIA 3UIPB 3ODXA 1WY6A 2MRPA 4EFOA 2DIKA 2CB8A 4HHVA 3AU4A 2O2VA 2YS3A 3PREA 2MDXA 1WR6E 2NVUI 4RG9A 2HJ8A 3CVYA 2KX3A 3EDTB 4HXDA 3SD5A 4HAYB 3QQ8B 2ONDA 3B7RL 1EO6A 1AWEA 1E90A 3JQ1A 4DLQA 5FQ6A 4JL0A 2XRYA 2C9WB 3FEHA 1OWNA 2G45B 5D27A 1WXVA 3DBHI 3RKVA 3ODWA 4FU3A 1WXMA 3FH8A 2RSGA 2PPHA 1WGQA 2WB2A 2IO1B 4ICUA 3NF1A 2K1FA 5E75A 4N2SA 3O48A 2J0MA 1RRPB 5LONB 1WIAA 2HTHB 4FHJA 1WJMA 4FJVB 3AJ4A 4K0RA 1UJKA 3BJIA 3ODOA 3RO3A 2H7DA 2KWCA 4RMAA 5LX8A 3FUKA 3FU3A 3VTUA 5J3QA 4NAWB 2DBAA 3CVWA 3PG7A 4GDLA 1HXIA 3PP2A 2W2WA 1JWGA 2MOWA 4I9EA 2QKLA 4HORA 2XRZA 3APDA 3NQPA 2Q7FA 4DI4A 3S7DA 2HM8A 1KLVA 4AWJA 1OTRB 4ILHA 2BYFA 2KFKA 3VXWA 2M14A 4K7WA 4JK9A 5G04J 5JHAA 1I7AA 1IYGA 2LOZA 3VVWB 2KQSA 4ILJA 4U0SA 2WXLA 3Q5MA 3QWPA 2AW6A 2MSED 1L5JA 1WJUA 2C7HA 1WGHA 1V6EA 2KN5A 3BEEA 1YX5B 2ZEQA 4I17A 1NTYA 3VUXA 2VRWB 3ZYLA 2HYZA 1YJ1A 4HOSA 2C0LA 3CIAA 3D9IA 2DLWA 4JLCA 3DXCA 2WXPA 4DPRA 2JT4B 3LVRE 4HAVB 1JDEA 4U04A 4YNDA 2FCNA 4IRUA 2IQCA 2PJHA 4EEWA 1GC7A 3RCZA 1PFJA 3A9KB 3HW2B 4CCAA 1PMSA 4HK2A 4Z2NA 3W1YA 3ZGQA 3PGEA 3VTYA 2NZ8B 2D9WA 4AY5A 2XK5A 5IA7A 2DZMA 4FJZA 1EF1A 4E6HA 2JZZA 2IU1A 3FWVA 1QC6A 3R7RA 4HS2A 2XGSA 2CU1A 4PS7A 3ONLA 1UPQA 2V3SA 4Y6WA 3NZUA 2CG3A 3JSVA 1WH3A 1P5TA 5E6NA 1QZEA 3Q3FA 1U2BA 2KUPA 3L0WB 2KCVA 1H8CA 2CG2A 3SFZA 4N3BA 3UINB 4U63A 1XODA 4BKSA 2R59A 4GZ5A 3PVWA 1UNPA 4W9GA 1W1GA 4IAPA 4ME2A 4N3CA 3X0WA 3HVEA 1TBEA 3CHMA 3FEXA 2FJ9A 4G0NB 2D07B 5JJ7A 4BKGA 5JH5C 5E76A 5JHHA 1Q5WB 4MJSB 4Q69A 2L0TA 3H7PB 4DHZB 2Y8FA 3VOQA 2KX0A 3PT2B 4ZRJA 4WWPA 2V76A 5C1DA 2L2IA 3IV0A 5CHFA 2RPQA 2FULA 2KD0A 4GN1A 1J0GA 3FLVA 3UQAA 3O4ZA 3FH7A 1S1QB 2PZIA 2I1JA 3BG1B 3UF8A 2Q13A 2PQRA 3KRXA 3D32A 2UY1A 1WFYA 1E7VA 2KWUB 1W1DA 3E9PA 4ILIA 5IJMA 5G05C 2MP2A 1H19A 3LKUA 1MKEA 4HAWB 3FUJA 2OVBA 1JRUA 4G25A 2VTBB 1ELKA 2COPA 4GCNA 4JL9A 1HG5A 3LY7A 1MG8A 3PSCA 1BTKA 2O6VD 4JHKA 3OJ4B 3ZKJC 2NMBA 4Y94A 3ZNZB 4JA7A 2GCJA 2Y3AA 1P5QA 3SBTB 1U4AA 3PH0C 2WXRA 3GZ1A 5KJLA 2MX2A 4NNJB 3ZXSA 2LKOA 3RCPA 4NQLB 4A6KA 4W9IA 2WXHA 3HYMB 5T8IA 4IOYX 1UN9A 4E71A 1NVLA 2XGMA 4BTAA 1J8CA 1OMWA 4JVSA 5J2RA 4OYSA 2G3QB 4KV2A 3FTZA 3PRZA