2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Radixin
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
3MPXA 4PYZA 5DHAB 2P0FA 4D0NB 1LW3A 2KLGA 2KWVB 2DZJA 4EJNA 1K5DB 1E8XA 3NHEB 2MSED 3PZDA 2CB8A 5JZEB 4MY6A 2KFKA 4OVUA 2ZVNA 3H7SA 4L6EA 3W1SA 1KOTA 1P6SA 3W1YA 2Z0QA 1WGUA 1WY8A 2KDIA 3D8FA 2EJ8A 2DN6A 1SGHA 3AJ4A 4RM8A 2JUOA 2RUKB 4W9EA 1WI1A 2GCLA 1EF1A 4P7IA 3QIJA 2K8BA 3ZNZB 4DHZE 1DDWA 3EPYA 2AL3A 4ZRKA 2BCJA 2Q13A 4Z2MB 3LJUX 2YVCA 2NBUA 1IYFA 3TCAA 2WX0A 3NSUA 4NQKE 4B95A 4PYUA 4AJWA 3L17A 1Q1OA 1GG3A 2KD0A 4B9KA 3B08A 4TQ0A 4NAWA 4IFSA 1WGGA 3CSTA 1FGYA 2D9VA 5HE1A 3H6NA 1U27A 3WYFB 4GDLB 4AOFA 2GCJA 1S1QB 2GBKA 2BWFA 4JIOU 3BJIA 3ZNGC 1NDDA 3PLVA 1V88A 2LGYA 3OLMD 2IFSA 4ZRJA 3U30A 4EZKA 3PSCA 2DYMA 3OAWA 5D3XA 1X1MA 3BINA 1TJ6A 3N32A 3DPDA 2CHZA 3DQVA 4ZYNA 4EUTA 2KTRB 4W9KA 4HAXB 2NR2A 5CHVC 1ACAA 5HE2A 1TBEA 2ADZA 3TW1A 1EUVB 1E5WA 5TR5A 4G11A 2ZZPB 1K8RB 1WMHB 2K2JA 1WJUA 2LBBA 4PS7A 4MK0A 3KRXA 1A5RA 1ZW7A 3VDZA 5E6OA 4GDLA 1WR6E 5E6PA 3M95A 2BYEA 1Q67A 4G0NB 4JLCA 2MBEA 4MSMB 2RNRB 3TO1A 5DIFB 1WE6A 3R7QA 4WJNA 5KHOA 5FI0A 2YRYA 1RJ2A 3ML9A 3B0AA 4WAAA 5LOPB 2FCQA 5CTRC 4W9GA 1ZSQA 2KQ7A 2LWPA 2KC2A 3Q3FA 2V3SA 2FNJB 3I3TB 1EGXA 5JH5C 1PLSA 2ZJDA 2AYOB 2Y8GA 4KZCA 5DPWA 1DROA 4RMAA 4MH0E 1P3QU 3PRMB 3L10B 3DVNU 4HK2A 4MJSB 4MGIE 1PMSA 4GU2A 1U5FA 2J0JA 1WZ0A 4E74A 2LRUA 2MFQA 3IVFA 5J3YA 3QJZA 2RPQA 2R2OA 1B55A 2WH5A 2OQBA 2YS1A 1XT9B 1WGYA 2CHWA 5CLLB 2LOXA 4EMOA 1YJ1A 1UEFA 1NTYA 2O6VD 1GC6A 1E7UA 2NPTA 2KDFB 2VSZA 4I6LB 2XK5B 1P1AA 1Z2MA 3IFWB 4A6KA 4FLHA 2J59M 1WX8A 3ZTDA 1VCBA 1V61A 1KJTA 2COPA 2ABDA 4K7UA 2JRIB 3NY5A 4MJSA 5J18A 3DBHI 3NZSA 2DYNA 2MWSB 4K81A 2EKEC 1XQQA 2W2WA 1GNUA 1E7VA 2HRJA 2Z0DB 2K8CA 3T8MA 2KJRA 3ZNHB 3ODOA 4A6FA 1UNPA 1ZC3B 1TQZA 5JHGA 2NVUI 3VQIA 4HCPB 2KKCA 3F0WA 4J6IA 2XK5A 2H7EA 3ZNID 2DHZA 1TXDA 2UWQA 3Q3JA 1V80A 3PS6A 1SIFA 1I7AA 1IPGA 2IO0B 5C1ZA 3APDA 3HQCA 2MWNB 5J2RA 3GZNI 4MGKE 2KX0A 2GOWA 3UQAA 5C5BA 3SUZA 3ZDMC 3QQ8B 1WR1A 3MTNB 2H7DA 1NTVA 2DFKA 2KCJA 2RR9A 4GDKB 1EAZA 5D7GA 2FCSA 2MKRA 2FUHB 2M17A 3SD5A 5EDSA 2W9NA 2COCA 3G9WA 4GIVA 3DBLI 1J0GA 5LXHA 2LYDA 2ASQA 2K1FA 4JQWC 4HAVB 4X57B 2VRWB 4MSQB 3L08A 3NS8A 2PE9A 1RLFA 4B6HA 3V6EB 3A4RA 4WJ7A 3ZVVA 3PLUA 4Y94A 3CXBB 3PP2A 1HBKA 1W1HA 2J0MA 2IY0B 4WSFA 3PVLA 5KHQA 5D3VA 2G4DB 2N4FA 3ODXA 4BKSD 2C7HA 5G2NA 4WJPA 3EFUA 3VUWA 4BBKA 1WGRA 3O65B 3WA0A 1L7YA 3A9JA 2QKLA 1TGZB 3K9PB 1P3RA 5L95C 2K6DB 2YS5A 2K39A 4BOSC 1X1GA 1EVHA 1ZM0A 4ANXA 2L0TA 2DAJA 2AWTA 2FAZA 1OQYA 4N9F4 1C3TA 2GJYA 2ZEQA 3HHMA 3AULA 2RSUA 1H4RA 2FCMA 2E2XA 3WANA 3UF8A 2P8VA 1ZGUB 1BAKA 4JL9A 5DHFB 1UZXB 1WXMA 3JW0X 1X05A 4IM0A 5JHBA 4BFRA 1KM7A 4FJVB 1LQBA 2XQNM 3VH4B 4MGYE 1AQCA 5D3WA 2P0HA 3V60A 3ML8A 3TIXA 1SHCA 1WGDA 4I6PA 3X0WA 3H7PB 2BGFA 2NS5A 1WG7A 3F5RA 1W1GA 3MDBC 2RD0A 1MIZB 4BBNC 2KDBA 2KUPA 3AI5A 3PT2B 5IA7A 4NAWB 2GBRA 3DVGY 4HAYB 3VOQA 1V81A 3PRZA 4ANUA 2P0DA 3DCGA 2LOZA 5GMVA 1U4AA 2BYVE 2D07B 2KXJA 3ONSA 1ISNA 1WH3A 3RZFA 1ZKHA 2A5UA 4MT7A 4HHVA 1U5EA 1WJMA 2Y8FA 5KQ4A 2LASA 2ZVOA 2FIFA 2JZ3B 2NCNA 3H9DA 4TKNA 4JGHB 4DHJB 2DKQA 2N1VA 3H7PA 3VAWA 1FAOA 2FJ9A 3KYCD 4GB9A 4AWJA 4WJOA 2MBQA 5KQ1A 3R3MA 3W1SC 2Y7BA 2V4LA 2MLBA 3M62B 4HCNB 3UINB 2LKOA 4KVGB 4TYZA 2Y5BB 1V5TA 2CU1A 2J7QB 1AWEA 4HPLB 4HXDA 1Y19B 3JSVA 4XWXA 2RGNB 2WDTB 1NTIA 3KW5B 4IUMB 2VKIA 5JP4A 3D8EA 3HK0A 1WJ6A 3PHWB 3R66C 5BO4B 2LUEA 2DZMA 5IAAC 1HE8A 4DBGA 2JY6A 4M0WB 2KK8A 4IOYX 1U5DA 3ODWA 1YX6B 3UIPB 5FI1A 3L0WB 1QQGA 3M3JA 4HVBA 2DHJA 5E6NA 1V5OA 2HE7A 2LXCA 2X18A 1H8CA 2R2QA 1NI2A 3PEGA 2BKRB 2L05A 1UNRA 3UQBA 3A8QA 2PE6B 2MBOA 1L2NA 1P5TA 2BKFA 4HAWB 1V5UA 4LDTD 4F7ZA 4TV3A 2BF8B 2GMIC 2K25A 2KOXA 3L16A 2PJHA 2MP2B 3H1UA 1WGHA 1MAIA 3L54A 2L2IA 2CQUA 1E90A 1XD3B 2KN5A 2ZCBA 3PVUA 2NBWB 3UIOB 1WXAA 2N9PC 3KSYA 3SV1A 4W9CA 3A98B 4GMXB 4XX5A 1R4NI 1G6JA 3MJWA 2NPTB 4FN2A 2JPHA 4W9DA 4CHMA 3TBLD 3V62A 4AUQC 1KI1B 4GZUA 1D3ZA 4C0AA 3DOWA 1N3HA 4II2B 4URKA 1V9JA 3GOEA 2DAFA 3QWZB 2AEHA 4FHKA 1DDMA 2PEAA 3VUYA 2IYBA 3PG7A 1LB1A 2CR5A 2KNBA 2MP2A 3B1LX 2MW5A 2CY4A 2YF0A 4GPTB 1T0YA 3ALBA 4DWFA 4ZDVA 1FXTB 5D6JB 1WJNA 1UELA 3SDLC 4GXBA 1WF9A 2R09A 4EEWA 2BYFA 1SE9A 4A6FB 1WJ4A 1EO6A 4DDID 2I1KA 3PV1A 4EZJA 1NBFC 1WFYA 4HDQA 3QHTA 2CRFA 1V6EA 4DBBA 2V1YA 2ZPYA 2NMBA 2LI5A 3P7ZA 4G50A 4FADA 2L8JA 2DX1A 2UZRA 5HE0A 3UZTA 2V76A 1DBHA 3PREA 3VTUA 2MDXA 2D2QA 5C5BB 4BKTA 1FHXA 3DBSA 4IAPA 3CIKA 1FOEA 2N9EB 2KVRA 2JVCA 2UZSA 1UGMA 5DPSA 2KQSA 3PHXB 2FJLA 5HKHA 4KHBB 4WQOB 1YIWA 4DK5A 1FHWA 5FR6A 5D3YA 2A4ZA 2DZKA 4HDOA 1UD7A 3HM6X 2KJHB 3ZLZA 2HD5B 2KDEB 1YX5B 2M8SA 1MK9B 2Z0OA 3FP5A 2ZPNA 1WXVA 4II3B 4K2PA 2LGDA 2CODA 1I35A 2DHKA 2D3GA 3N7CA 2MQJA 1MK7B 2G35A 1X1FA 3VUXA 4F7HA 5GOWB 2IO3B 3LJ3A 2O2VB 2YS3A 3DDCB 4BVUC 4IWPA 3ZRFA 2RGFA 3ULCA 1OEYJ 2LG1A 4BKSA 2G3QB 2ZCCA 3BY4B 4B6WA 4KSKC 1XCGA 3O96A 3ZTCA 1M7EA 3ZVRA 2AL6A 4W9HA 3HW2B 1VD2A 1IP9A 3RCPA 3FM8C 3A9JB 2KGXB 1Y8RC 4FHJA 2N0YA 4MEMA 5L81A 3ULBA 4G3XB 4IWOA 4NJ6A 2LRWA 2KLCA 1V2YA 2YLMA 2PPHA 3SYXA 4A3PA 3WALA 2JXXA 1RRPB 1M7RA 3K9OB 2D9ZA 2YT0A 2FCNA 2O2VA 1P98A 2YT1A 4A6HA 3TMPB 2M0XA 5KCVA 4KZ0A 4NQLB 1P9DU 2HTHB 1WZ3A 2QHOA 3AU4A 1GJZA 2Z59B 2N7EA 4E71A 1WVHA 2WWZA 4AJYB 4EKUA 2VRRB 3VFKA 4M8MA 2IZVB 3QCAA 1BTNA 3CF6E 2K8HA 3ZDTA 1WGQA 1WRDB 3QBVB 4HJKA 3PPAA 2KMAA 3X23A 3OJ4B 4CHKA 1GUAB 2COAA 1P0RA 1QZEA 3ZIMA 1U2BA 4HB3B 4MM3A 5J3TA 3PRPB 1I2HA 4GGQA 2LULA 2WYQA 1XODA 4FJZA 1TZ1A 2KC1A 2KMCA 3RD2A 4KV2A 1AARA 2JRHA 4F7GA 2MA9B 4HAUB 4HATB 5AZFA 4PNKA 2HTHA 4YL8A 2GS0A 3HIZA 4MDKE 3DXEA 1OEYA 1IRSA 1YD8U 1WI0A 4RM9A 2CKHB 4KSLC 3IBEA 1C1YB 3KYDD 2M4NA 2W2XC 2KFJA 4GN1A 5CX3A 1R4MI 1V86A 1V49A 2RVBB 1Q5WB 2KWUB 2KO3A 3KRWA 3KZ1A 3QAQA 3P6AA 4HPMB 3GYOA 5HE3A 4A3OA 4EOYA 3RYTA 3APCA 2OOBB 1TTNA 2MRPA 3QARA 2CAYA 3R7RA 5J17A 2IY1B 4ANVA 3KUCB 4GMVA 4WJQA 2Z0EB 2IYDB 2RQ1A 1WM3A 3JSVB 4LDTB 5C79A 1GC7A 2D9XA 3IG3A 2EMTA 1UH6A 3ZUNA 2DENB 2IO1B 2EC1A 5JLJB 5DH9B 4K7SA 3VXWA 2KZRA 2MBBB 1MPHA 4DX8A 5LLIA 4NY0A 1WM2A 5CLQB 2DYOA 2GBNA 2MCNB 2QKMA 4CHJA 2REXA 4KIKB 4HB2B 1NVLA 4W9LA 4I6NB 3VTWA 3KY9A 2ROVA 5CHFA 3M63B 1J8CA 3GYPA 3OJ3A 5D2MB 2L76A 4DHZB 2I1JA 4PS3A 2NZ8B 1OY2A 3SU8X 2KX3A 3ZW3A 3QA8A 3ZRCA 3DVGX 2N1WA 2C7NB 3JVZX 2I5FA 2R0DA 3QC8B 1U29A 1OMWA 4KHOA 4K1RB 1RAXA 4FBJB 5JHAA 3JYUA 1QC6A 3C0RB 1NU2A 2M1MA 2DHIA 1CMXB 3U8ZA 4IW0A 3WAMA 3QWMA 2OJRA 3EC8A 5DPRA 1H10A 4Z2NA 2IBIB 3EECA 1PFJA 2C7MB 4CO7A 2O6VB 4MGZE 1MG8A 1XR0B 3NOBA 4W9FA 4KIKA 4NSWA 2M14A 1FB8A 2COFA 3ENEA 5LONB 3PSEB 2D4QA 4ANWA 2YSZA 5D27A 2CY5A 4LJOB 1PQSA 3A33B 2LD9A 1F9JA 2DX5B 1FGZA 3A8PA 4ZRIA 2G4SA 2CS4A 2LGXA 1ZC4B 2K6QA 1S3SG 3FEHA 4LJPB 3TJPA 3DBRI 2N9XA 4EZLA 4E3CA 1RRBA 2D9YA 3L13A 3RT3B 4NNJB 5G55A 3FLVA 2RLOA 2O6VA 1WE7A 1UBIA 1MKEA 3RUIB 4DHJD 2KTRA 3M1IB 3VVWB 3RULA 2D9WA 2JZZA 3A9KB 3WIMA 1WYWB 2DX5A 4KDIC 1WMHA 2N7DA 3T06A 4OVVA 4BOZB 3APFA 3TFMA 5JHHA 4ASWC 4GOCA 1WX7A 3FSSA 4MELA 4ICVA 3NZUA 2KHWB 2GBJA 1K5GB 4K7WA 4WWOA 4WWNA 2KTFA 2EMSA 3V6CB 2MBHA 4HWIB 2M38A 2RSGA 3P2BA 4PS8A 3OANA 4K2OA 5AZHA 1EF5A 3SHQA 4WVFB 1KLVA 1WIAA 1E8ZA 3DXCA 3KVFB 3IHPC 3PGEA 2OTXA 3CSFA 3DXDA 3A9KA 3ML4A 3QX1A 4H8SA 3A4SC 3PVWA 4DDGD 3EHVA 1Z5SB 1V89A 3D32A 1ST7A 3UGBB 4IG7B 2UVMA 3TVVA 5CHWA 4NPNA 1UPQA 5EFXA 3CMMB 1Y5OA 1UPRA 2J0KA 5D94A 2C9WB 1HB8A 3WAPA 3V5WA 3KUZA 2LZ6A 4A20A 2L0FA 1FHOA 1V5PA 5IJMA 4FA6A 4PQ0A 3HM3A 3MHSD 3VIAA 2D11A 4HAZB 3U7DA 5LXIB 1KZGA 3T9LA 2KJ6A 2L1CA 4YONA 1E8WA 4DX90 3RZWC 4KDLB 1BWNA 2B3AA 2HJ8A 1M94A 2ELAA 1E8YA 2XBBC 4XZ4A 1MIXA 2WX1A 1OTRB 5DPTA 2L7RA 3A1QB 4DXAB 1WX9A 2DYQA 3SNHA 5C6RA 1Q0WB 2ZNVB 1LXDA 5C23A 2Z0PA 1LM8B 2I5CA 2DYBA 4CYEA 4WWPA 4BBNF 3KH0A 1RFAA 1OGWA 2CHXA 3PTFC 2LVOA 3DVNV 2ROZB 2XEWA 1DDVA 1U5GA 4KHAA 5DCNA 5AZGA 4BKGA 2JWZA 2MX2A 4HB0B 1BT0A 2KWCA 1XD4A 2D10A 1W1DA 2K2UA 1XX0A 3VHTC 4F1SA 4EFOA 4ICUA 4A5KA 2NBVB 2LJ5A 3A1QA 4TQ1A 4NJ7A 1V5MA 2DKPA 1X11A 3LDZE 2L3ZA 2JP2A 2BWES 4M8NA 1J0WA 1BTKA 3VTVA 3S2AA 2G45B 2FDQA 2LVPA 5C16A 4W9IA 2K00A 1KZ7A 4IM3A 1WJ1A 2UYZB 4GDKA 2C60A 3SO6A 1HB6A 4KAXB 4AP4C 3ZO5B 3QK0A 1XKEA 1I42A 2IO2B 1X86A 2DZIA 4HB4B 2PZ1A 3V61A 3ZKJC 2LXAA 3RCZA 4IWQA 4LCDE 5DI9B 2C5LC 1Z87A 1UNQA 2BPSA 2ZNVC 2N23A 4K17A 4GSWA 3WAOA 1JRUA 3N30A 1OQNA 2KANA 2DLWA 1LFDA 3KUDB 1YQBA 3AXCA 3VH3B 4FULA 4TUUA 5AEKB 4IM2A 2KFKB 3D8DA 1UBQA 4F7UP 2JT4B 1J19A 1DYNA 3N3KB 3AU5A 5J3QA 4W9JA 2ELBA 2GBMA 2DTCA 5L83A 2DA0A 2FIDA 1ZVRA 3TL5A 2L00B 2LVQA 4FJYA 2JF5A 4XC2A 4IC7B 2W2XD 3ECIA 4HLEA 4F8CB 1WXSA
chains in the Genus database with same CATH superfamily
2M56B 3MPXA 1QT9A 4JKHA 1E9MA 5HFYA 4PYZA 5DHAB 2P0FA 1XLPA 4D0NB 1LW3A 3VR9B 2KLGA 4N59A 3TEYA 2KWVB 5IP4D 4JKBA 2DZJA 1K51A 2BVCA 4EJNA 1K5DB 1L5PA 1E8XA 4N58A 1YJJA 3NHEB 2MSED 4P6VF 3PZDA 2CB8A 5JZEB 3NW8A 4MY6A 1HA5A 2KFKA 4OVUA 4H2AA 1QILA 2BBCA 2ZVNA 3H7SA 3GE3C 4L6EA 3W1SA 4M01A 1KOTA 1P6SA 1MVKA 3W1YA 2PKOA 2KDMA 2J52A 2LFIA 5FKAC 1GOZA 4LNNA 2Z0QA 1WGUA 1WY8A 4LTUA 3W5VB 2KDIA 3D8FA 2EJ8A 2DN6A 1SGHA 3AJ4A 1AYFA 4RM8A 2JUOA 2RUKB 4W9EA 1WI1A 2GCLA 1D5MC 1EF1A 2UU7A 2IPKD 2YT2A 4P7IA 3QIJA 2K8BA 3ZNZB 4DHZE 1DDWA 3EPYA 2AL3A 2WXGA 4ZRKA 1BXTA 2BCJA 2Q13A 4JE3B 4Z2MB 3LJUX 2QCZA 1V1PB 2YVCA 3DHGC 3RNCC 2NBUA 1IYFA 3TCAA 1R4MB 2WX0A 3NSUA 4NQKE 2LUMA 3LB8C 4B95A 2JYTA 4QAYA 4PYUA 5HI1A 4AJWA 4LNOA 3L17A 4RGNA 1Q1OA 1GG3A 2KD0A 4B9KA 3B08A 1HXYD 4TQ0A 4NAWA 4IFSA 1WGGA 3CSTA 1FGYA 2D9VA 2QEJC 5HE1A 3H6NA 1U27A 4L1RA 3WYFB 4GDLB 4AOFA 2RDHA 2GCJA 2WXRA 1S1QB 1F2RC 1KLUD 2GBKA 2BWFA 2WDRB 4JIOU 3BJIA 3ZNGC 1NDDA 3PLVA 1V88A 1XEEA 2LGYA 1SE3A 3P4SB 3OLMD 2IFSA 1YNTE 4ZRJA 3U30A 4EZKA 3PSCA 5T8IA 2DYMA 2RDBC 2WXIA 3OAWA 5D3XA 1X1MA 3BINA 1TJ6A 3N32A 2WNMA 3DPDA 3DHIC 2CHZA 3AEFB 3DQVA 4ZYNA 4JKGB 4US9A 3CIRB 4EUTA 2KTRB 4W9KA 4HAXB 1KF6B 2NR2A 4R3DA 5CHVC 1ACAA 5HE2A 1TBEA 2ADZA 1JROA 3TW1A 1RWSA 1V1OA 1XF5L 1EUVB 2KN4A 1E5WA 1SIJA 5TR5A 1L0VB 2Z4DA 3P1MA 4G11A 2ZZPB 1K8RB 1WMHB 4M00A 1YN3A 2K2JA 1WJUA 2LBBA 4PS7A 4MK0A 2BQQA 1MJDA 1AWDA 3KRXA 1A5RA 1ZW7A 3VDZA 5E6OA 4GDLA 1WR6E 5E6PA 3M95A 2BYEA 3AEBB 1Q67A 4FXCA 2QJLA 4G0NB 4JLCA 1I4PA 2MBEA 3HRDD 4MSMB 2RNRB 3TO1A 2K0PA 5DIFB 1WE6A 3BVMA 3R7QA 4WJNA 5KHOA 5FI0A 3SFDB 2YRYA 3ENBA 1RJ2A 3ML9A 1FD6A 2K9XA 3B0AA 4WAAA 5LOPB 3E9LA 2FCQA 3NVZA 4K3CA 5CTRC 2J42A 3GB1A 2M19A 4W9GA 1ZSQA 2KQ7A 4ACFA 2GI9A 2WQYB 1WRIA 2LWPA 2KC2A 3Q3FA 4XDDA 2V3SA 2FNJB 3I3TB 1P7EA 4MACA 4A90A 1EGXA 3R8BA 5JH5C 1PLSA 3MHZA 2ZJDA 2AYOB 1VZ8A 2Y8GA 3Q8EA 2JU6X 4KZCA 5DPWA 1FNWA 5BMGA 3IAS1 1DROA 4RMAA 2JZPA 4MH0E 1ZE3D 3RNGC 3ZXRA 1P3QU 3PRMB 4ARIA 2GUMA 5LG4B 3L10B 3U4EG 2BS2B 3GS2A 2WXMA 3DVNU 4HK2A 4MJSB 4L23A 4J3OD 4LNFA 1PMSA 4MGIE 1IBXA 4GU2A 1U5FA 3W9CB 2J0JA 4A55A 2Y3AA 4DXFA 1WZ0A 4E74A 2WP9B 3N9YC 2LRUA 3T3OA 4JWUC 2MFQA 3IVFA 5J3YA 3QJZA 2RPQA 2R2OA 2IJ0A 1B55A 2NTSA 2WH5A 2OQBA 2YS1A 1XT9B 2IGGA 1YN5A 1WGYA 1V97A 2CHWA 5CLLB 2LOXA 4EMOA 1YJ1A 3SFEB 1UEFA 1NTYA 3DBRB 4LLGM 2O6VD 1GC6A 1E7UA 2NPTA 2KDFB 2VSZA 2QILA 4I6LB 2XK5B 1P1AA 1XCQL 1Z2MA 4C4VB 3RN9C 2PIAA 3HUIA 1ZYIA 3IFWB 4A6KA 2L32A 4N6EB 4FLHA 2J59M 1WX8A 3ZTDA 1VCBA 4NZLB 1V61A 1E0ZA 3MC8A 1KJTA 4UDUC 3E66A 1SXTA 2RRFA 2COPA 2PMVA 2ABDA 1VR9A 4K7UA 2JRIB 3NY5A 4MJSA 5J18A 1YMHE 2M0AA 1E7PB 3DBHI 3NZSA 2DYNA 2MWSB 4K81A 3L4PA 2EKEC 1XQQA 3MFGA 2W2WA 1GNUA 1E7VA 4YT0B 2HRJA 2Z0DB 1J7AA 2K8CA 1F52A 4XE0A 5H8YE 3T8MA 2KJRA 1JWSD 1MFWA 2R61A 1VJKA 4JX1C 2WLBA 1QLBB 3ZNHB 3NWAA 3ODOA 4NJCA 3BVGA 4PK1A 5E6JA 4A6FA 1UNPA 1P7FA 1L6VA 1ZC3B 2FBWB 1TQZA 5JHGA 5BMHA 2NVUI 3VQIA 4HCPB 2KKCA 1SF0A 3F0WA 4J6IA 2XK5A 1SBBB 3BYTB 3IXSA 2H7EA 3ZNID 2DHZA 1TXDA 2R2YA 2UWQA 3Q3JA 1V80A 3E9SA 3PS6A 4C7YA 5TSSA 1SIFA 3EUB2 3SBTA 1I7AA 1IPGA 2IO0B 5C1ZA 3APDA 3HQCA 2MWNB 4WAFA 5J2RA 3GZNI 4MGKE 2KX0A 4P1BC 2GOWA 1EM7A 3UQAA 5C5BA 3SUZA 4XWWA 3ZDMC 3QQ8B 1WR1A 3AE9B 3MTNB 2D3BA 2H7DA 2N9LA 1NTVA 2DFKA 2KCJA 4KGTA 2Q5WD 3AM9A 2RR9A 3AE1B 4GDKB 4JWSC 2W3SA 4NAMA 1EAZA 5D7GA 3P4QB 1BUIC 2FCSA 2MKRA 2FUHB 2M17A 3SD5A 5EDSA 2RMMA 2W9NA 4ITKA 4KHBA 1TJEA 2COCA 3G9WA 4GIVA 3DBLI 1J0GA 1B9RA 1GB4A 5LXHA 3UI3A 2DIKA 2LYDA 2ASQA 2K1FA 2QMTA 4JQWC 4HAVB 3NJTA 4X57B 3AEEB 2VRWB 4MSQB 3P4RB 1GAQB 3L08A 3NS8A 2PE9A 1RLFA 5EE9A 4B6HA 3V6EB 4WJ7A 3A4RA 3ZVVA 1PYWD 3PLUA 4Y94A 3CXBB 2WXQA 3PP2A 2WXPA 1HBKA 1W1HA 2J0MA 1VZ6A 2IY0B 4WSFA 3PVLA 5KHQA 5D3VA 3TEXA 2G4DB 3T3NA 4ZYSA 2N4FA 3ODXA 3AE6B 4BKSD 3B9JA 2C7HA 2WU5B 1QOFA 4WJPA 5G2NA 1F2RI 3EFUA 4CSQA 4TSSA 1I7HA 3AB5A 2G9HD 3VUWA 4BBKA 3IT6B 3NG0A 4JKCA 1FXAA 1ZDXA 1WGRA 3O65B 3WA0A 1L7YA 3A9JA 2QKLA 1TGZB 4OVZA 3K9PB 1P3RA 5L95C 2K6DB 2YS5A 2K39A 4BOSC 3NWFA 1X1GA 1EVHA 1ZM0A 2D5GA 1IGDA 1N5XA 4IOIE 3C19A 4ANXA 1FPYA 2L0TA 2DAJA 2AWTA 1GB1A 2FAZA 1FFVA 1OQYA 3ZJTA 4N9F4 1C3TA 2E3TA 2LEKA 2W82A 2GJYA 1EU3A 2ZEQA 1C4PA 2D3CA 3HHMA 3AULA 1DYQA 3BYYB 2RSUA 3R2IA 1H4RA 4USAA 3AN1A 2FCMA 2E2XA 1VRAB 1PGBA 1XCTL 3WANA 1JALA 3UF8A 2P8VA 2KR0A 1K52A 1ZGUB 1BAKA 4JL9A 5DHFB 3Q69A 1FNVA 1UZXB 1WXMA 3JW0X 3R2TA 1X05A 4IM0A 5JHBA 3PO0A 2MJ3A 3P42A 4BFRA 2W54A 2Z59A 1KM7A 1ZPSA 4FJVB 1LQBA 1D6EC 2IDYA 3RNFC 3U7ZA 1C77A 2XQNM 3O13A 3AMZA 4LK0M 1FEHA 1N62A 4RNAA 4GOUA 3V3XA 3VH4B 1VZ7A 1F77A 4MGYE 3EGRA 1AQCA 1JWUD 1JCKB 5D3WA 2P0HA 3V60A 1ACCA 2G1EA 4B0EA 3FVCA 2QSDA 3ML8A 3TIXA 4C00A 3B2FA 1YOVB 1SHCA 1WGDA 1JWMD 4A8XC 4I6PA 3X0WA 1WSPA 3H7PB 2BGFA 2NS5A 1WG7A 3F5RA 2JSVX 1W1GA 1EWCA 4P1CC 3MDBC 2RD0A 4K3BA 1MIZB 4BBNC 2KDBA 1YJIA 2KUPA 3AI5A 2FE8A 3PT2B 5IA7A 4NAWB 2GBRA 2HJ1A 4PT5A 3DVGY 2WS3B 4HAYB 3IAM1 3VOQA 1V81A 3PRZA 4ANUA 2P0DA 3DCGA 2LOZA 5GMVA 2OHFA 5I4DA 1U4AA 2BYVE 2D07B 2KXJA 3ONSA 1ISNA 1WH3A 3RZFA 2Z13A 1ZKHA 2A5UA 1ZDVA 4MT7A 4HHVA 1U5EA 4YSYB 1WJMA 2ZKMX 4XDCA 1CK1A 2Y8FA 5KQ4A 2LASA 2ZVOA 4YXDB 2FIFA 2JZ3B 2NCNA 3H9DA 4TKNA 2MHJA 4JGHB 3HVZA 4DHJB 2DKQA 2YEPF 4ILHA 2N1VA 3H7PA 4XGAB 4YSXB 3E9PA 3VAWA 1IUEA 1FAOA 2FJ9A 1SE2A 3KYCD 4GB9A 4AWJA 1VBHA 1DGJA 2KAJA 4WJOA 5I2MA 2MBQA 3NVWA 3RNAC 5KQ1A 3R3MA 1GPXA 3W1SC 2Y7BA 2V4LA 1FRRA 2MLBA 3M62B 3TEZA 2WXOA 4HCNB 3UINB 5HG2A 2E6XA 2LKOA 1QOBA 1KLGD 3EFCA 2Z8LA 4KVGB 1NENB 4TYZA 2Y5BB 1JQ4A 1V5TA 1C9FA 2CU1A 2J7QB 1AWEA 2PTLA 3Q8AA 4HPLB 4HXDA 1EU4A 2BYTA 1JW9D 1Y19B 3JSVA 5JXVA 4XWXA 2RGNB 4JKDA 2WDTB 1NTIA 3KW5B 3OWEB 3CWIA 2VKIA 4IUMB 5JP4A 3D8EA 1YQ4B 4YTNB 3HK0A 1C78A 3H8HA 1WJ6A 3PHWB 3R66C 4RGOS 5BO4B 2LUEA 2DZMA 5IAAC 1HE8A 2YEPB 1I4RA 4OZBA 2X38A 4DBGA 2AQ1B 2JY6A 2OJWA 4M0WB 5M4YB 2KK8A 1JDEA 2PVOD 4IOYX 4JKFA 1U5DA 3ODWA 1YX6B 3UIPB 5FI1A 3L0WB 1QQGA 2QIEB 3M3JA 4HVBA 2DHJA 5E6NA 1V5OA 2HE7A 4ARCA 2LXCA 1SJED 5BMIA 1LGRA 2X18A 2H89B 1H8CA 4WQMA 4YSZB 2MJDA 1FXIA 4Q2JA 2R2QA 4AQ7A 1NI2A 3PEGA 2BKRB 2L05A 1KFYB 2INPE 1FCCC 1UNRA 3A58A 2KQ4X 2CJOA 3UQBA 1AN8A 3A8QA 2PE6B 2VZKB 2EKIA 2MBOA 1L2NA 1P5TA 5BYQA 1DOXA 2BKFA 4HAWB 1IBXB 1V5UA 4LDTD 4F7ZA 4TV3A 3OG5A 2BF8B 2IGDA 2GMIC 2K25A 2KOXA 2I2YA 3L16A 2PJHA 5G5GA 4C7ZA 4JK9A 2MP2B 2R82A 2BB5A 3H1UA 1WGHA 1WXQA 3P4PB 5LNK1 1MAIA 3L54A 4RH6A 2L2IA 2CQUA 1E90A 1XD3B 2KN5A 2ZCBA 3KWLA 3PVUA 1R7SA 2NBWB 3UIOB 1WXAA 2N9PC 3KSYA 1N63A 2PVGC 1I4QA 3SV1A 4ILGB 4D2KA 4W9CA 3A98B 4M0WA 1CZPA 2K5PA 4GMXB 4XX5A 4DXGA 1R4NI 1G6JA 3MJWA 2NPTB 4FN2A 2JPHA 4MT5A 4W9DA 4YTMB 4CHMA 3VR8B 4IKGA 3TBLD 3V62A 4AUQC 1KI1B 4GZUA 1D3ZA 4C0AA 3DOWA 1N3HA 1PDXA 1WWTA 4II2B 4RGMA 4URKA 2GB1A 1V9JA 3GOEA 1T0RC 2DAFA 2KYWA 3QWZB 1TS2A 2AEHA 4FHKA 1I4GA 1DDMA 2PEAA 4BAXA 3VUYA 1FIQA 4LNKA 2IYBA 2JQRB 2OEDA 3NUHB 3PG7A 1LB1A 4JK8A 2CR5A 2SAKA 2KNBA 3NZ3A 2MP2A 3B1LX 2MW5A 2INDC 2CY4A 2YF0A 4GPTB 1T0YA 3ALBA 4DWFA 4ZDVA 1FXTB 1TKEA 5D6JB 1WJNA 1UELA 3SDLC 4LNIA 4GXBA 1WF9A 2R09A 4EEWA 3RI7C 2BYFA 1SE9A 2HDEA 2Y5CA 2W55A 4A6FB 1WJ4A 1EO6A 4DDID 1QOAA 2I1KA 2KIEA 1TS4A 3PV1A 4EZJA 1F1HA 1NBFC 1WFYA 4HDQA 1HTQA 3QHTA 2SEBD 2CRFA 1NYRA 2AQ3B 1V6EA 4DBBA 2ZPYA 2V1YA 2NMBA 2LI5A 3P7ZA 4G50A 4FADA 2L8JA 2DX1A 2UZRA 5HE0A 3UZTA 3Q2AC 2JYEA 3N20C 4KX6B 2V76A 1DBHA 3PREA 2WDQB 3VTUA 3AV8A 1OFFA 2DBYA 2MDXA 2D2QA 5C5BB 4BKTA 1FHXA 3DBSA 4IAPA 3CIKA 1FOEA 2N9EB 2KVRA 2JVCA 2UZSA 5FR3A 1XXGA 1SEBD 1BMLC 1UGMA 5DPSA 2KQSA 3PHXB 3BK1A 2FJLA 1QOGA 2IGHA 5HKHA 3BK2A 2KWDA 1L0YB 4KHBB 2X8XX 1PFDA 4WQOB 1YIWA 3RNBC 4DK5A 1FHWA 4RGTA 5FR6A 5MPOA 5D3YA 2A4ZA 2DZKA 3VRBB 1KBLA 4HDOA 4KKIA 4YTPB 1UD7A 3HM6X 2KJHB 3ZLZA 4BZAA 2HD5B 3B2GA 1SJHD 2KDEB 4RF0A 2V3NA 1YX5B 2M8SA 4HROA 1MPEA 1MK9B 2HTME 2Z0OA 2WGSA 3FP5A 1JMLA 2ZPNA 4ZHOA 1WXVA 4II3B 4S0RA 4K2PA 1TIFA 1YN4A 2LGDA 3ZGZA 3N1XC 2CODA 2N9KA 1T5XD 1I35A 2WHIA 1SSNA 3ETRA 5IKCM 2DHKA 2D3GA 3N7CA 1KTKA 2MQJA 1MK7B 2G35A 1X1FA 3VUXA 4F7HA 2X0SA 5GOWB 2IO3B 3LJ3A 2O2VB 2YS3A 4C80A 3DDCB 4BVUC 4ZRQA 4IWPA 1FCLA 3ZRFA 2RGFA 3RFZB 3ULCA 1OEYJ 1PGXA 2LG1A 4BKSA 2G3QB 2ZCCA 3BY4B 4B6WA 4KSKC 1XCGA 3O96A 4JK7A 2WXHA 1M7EA 3ZVRA 3ZTCA 1TKGA 3W5UB 2AL6A 4W9HA 3HW2B 1VD2A 1IP9A 3RCPA 2V9HA 3FM8C 3A9JB 1OQQA 2ICIA 2KGXB 4GLSC 1Y8RC 3AE4B 4FHJA 2N0YA 2H88B 4RFBA 4MEMA 3DBHB 5L81A 5IOIA 3ULBA 1JWBD 5JVLA 1E10A 4G3XB 4IWOA 4NJ6A 2W3RA 2LRWA 2KLCA 1V2YA 2YLMA 1KC7A 2JX5A 2PPHA 3SYXA 4A3PA 3ZXVA 3WALA 2JXXA 3EA6A 3U12A 1RRPB 1M7RA 2ONQA 3SEBA 1J7CA 4WH4A 3K9OB 2D9ZA 3GP7A 2YT0A 2FCNA 2O2VA 1P98A 3NWDA 2YT1A 4A6HA 3TMPB 5IRSA 2M0XA 5KCVA 2MJEA 4KZ0A 4NQLB 5IN7A 1P9DU 2HTHB 2AQ2B 1WZ3A 2QHOA 3AU4A 1GJZA 2Z59B 2N7EA 4E71A 1WVHA 2WWZA 4AJYB 4EKUA 3HSAA 4MH8A 3ZJUA 2VRRB 3VFKA 4M8MA 1CQVA 3RMKC 1ZXIA 2K22A 1TYGB 2IZVB 3GZNB 3QCAA 1BTNA 3CF6E 2K8HA 3ZDTA 3DWGC 5EE3A 1HZ6A 4KGSA 3E9OA 1WGKA 4JKAA 1WGQA 1WRDB 4DQOC 3QBVB 4HJKA 3PPAA 2LMCA 1T3QA 2KMAA 3X23A 3OJ4B 4CHKA 1GUAB 2COAA 1P0RA 1QZEA 1DIKA 3ZIMA 1U2BA 4HB3B 4MM3A 1ENFA 1HTOA 4WIPA 3DBLB 5J3TA 1NI3A 5D3IB 3PRPB 1I2HA 4GGQA 1TS5A 1FO4A 2LULA 2WYQA 1XODA 1DOIA 4FJZA 1V8CA 1A70A 1TZ1A 2KC1A 2KMCA 3RD2A 2K49A 4KV2A 3KLSX 1AARA 2JRHA 4F7GA 1RYJA 2MA9B 4HAUB 4HATB 2LHEA 4PNKA 5AZFA 2HTHA 2NMQA 4D6WA 1CJEA 5D3DA 1FM0D 3DHHC 4YL8A 2WXJA 2GS0A 1J7BA 3HIZA 4MDKE 3DXEA 1Y56A 1OEYA 1IRSA 4L2YA 1YD8U 1WI0A 4RM9A 2PLPA 1VBGA 2CKHB 4KSLC 3IBEA 1C1YB 3KYDD 2M4NA 2W2XC 2KFJA 3I9V1 2CU3A 4ILJA 3NVYA 4GN1A 2VH1A 5CX3A 1R4MI 4AS1A 4S17A 2Z14A 2AX5A 1ET9A 1V86A 1V49A 2RVBB 1Q5WB 2GRIA 2KWUB 4HEA1 4KGRA 2KO3A 3KRWA 3KZ1A 3QAQA 3P6AA 4HPMB 3IT4B 4EE2A 3GYOA 5HE3A 4JPSA 4A3OA 1AW7A 1DOYA 4EOYA 3RYTA 1MHXA 3APCA 1TY0A 1OQRA 2OOBB 5EE1A 1D4BA 1TTNA 2MRPA 3QARA 2CAYA 3R7RA 3BZDB 3BIID 5J17A 2IY1B 4ANVA 3NRZA 3VRAB 2WXKA 3KUCB 1IGCA 4GMVA 3LXFA 4WJQA 1XO3A 2Z0EB 2IYDB 2RQ1A 2MEKA 2RPVA 1WM3A 1QKZA 1RM6C 3JSVB 4LDTB 3Q3NC 5C79A 1GC7A 1I4XA 2D9XA 3IG3A 1JRPA 2EMTA 3BWUD 4HJGE 2TSSA 1UH6A 3ZUNA 3E56A 2WDVB 2DENB 2IO1B 1SB3C 2EC1A 5JLJB 2PW9A 5DH9B 4K7SA 3VXWA 2KZRA 2BS4B 2MBBB 1MPHA 4DX8A 5LLIA 3FILB 4NY0A 2BTEA 4DIXA 1WM2A 5CLQB 3GE8C 4O1NA 2DYOA 2GBNA 2MCNB 1K53A 2V4IB 2QKMA 5IO9A 1GGOA 4CHJA 2REXA 2BW2A 4A6QA 5BYSA 1XLQA 4KIKB 4HB2B 1ZUD2 1NVLA 4W9LA 4I6NB 3C8YA 3VTWA 3KY9A 3MJ5A 2ROVA 5CHFA 2XN9C 5GXGB 3M63B 1MI1A 1J8CA 3GYPA 3OJ3A 5D2MB 2N7JA 2L76A 3SR6A 2LHDA 4DHZB 2I1JA 3Q8BA 4PS3A 2NZ8B 1OY2A 3SU8X 2KX3A 3ZW3A 3QA8A 3ZRCA 3DVGX 3ZJVA 2N1WA 2C7NB 3JVZX 3RPFC 2I5FA 2R0DA 3QC8B 1U29A 2VH2A 1OMWA 4KHOA 1C4AA 2WXFA 4K1RB 4HKQA 1RAXA 4FBJB 1UF0A 1FFUA 5HHDG 4US8A 5JHAA 2J4XA 3JYUA 1QC6A 3C0RB 1NU2A 2M1MA 2DHIA 4OZAA 1CMXB 3U8ZA 4IW0A 3KQ4A 3WAMA 3QWMA 2OJRA 2WU2B 3EC8A 2FJUB 3FILA 5DPRA 3AE8B 1H10A 4Z2NA 2IBIB 2XNAC 3EECA 1PFJA 2C7MB 4CO7A 2O6VB 4MGZE 1MG8A 1XR0B 3NOBA 4CQNA 1HEZE 4W9FA 4IDIA 4KIKA 2MH7A 1E6EB 4NSWA 2M14A 1STEA 1FB8A 4RF1A 2COFA 1V1PA 3ENEA 5LONB 3PSEB 2D4QA 4GNKB 4ANWA 1L0XB 1XLOA 2YSZA 5D27A 2INNE 2QDFA 2CY5A 4LJOB 1PQSA 3A33B 2LD9A 1F9JA 3DWMA 2DX5B 4HKZE 3PZ8A 1FGZA 3A8PA 2RDGA 4ZRIA 4YWGG 3TUOA 2G4SA 5AUKA 2CS4A 2LGXA 1N61A 1ZC4B 2K6QA 1S3SG 4RCOA 3FEHA 4LJPB 4TMAB 3AH7A 3TJPA 2ZW1A 1D5XC 3DBRI 2N9XA 4EZLA 2J53A 4E3CA 1T0QC 2LGIA 3N1ZC 1RRBA 2D9YA 3L13A 1UWMA 3RT3B 4NNJB 5G55A 2GLSA 3AEAB 1M4VA 2L83A 3FLVA 2RLOA 1LO5D 2O6VA 1ROEA 1WE7A 1UBIA 1MKEA 3RUIB 4DHJD 2DWQA 4JKGA 1I4HA 1L4DB 2KTRA 4QJ5B 3P63A 3M1IB 2D3AA 3VVWB 2K8EA 3RULA 1K50A 2D9WA 2JZZA 4OSNA 3A9KB 2ON8A 3WIMA 1WYWB 3AECB 2DX5A 4KDIC 1C79A 1WMHA 2N7DA 4OT1A 3ZQ4A 3T06A 4OVVA 3AE5B 3APFA 3TFMA 1T0SC 3AE2B 4BOZB 1UWXA 5JHHA 4ASWC 4GOCA 1WX7A 3FSSA 4MELA 3BVZA 4WURA 2I38A 4ICVA 3NZUA 2KHWB 2L52A 2GBJA 1K5GB 4K7WA 4WWOA 2ZW0A 2KT7A 4WWNA 2KTFA 2EMSA 3V6CB 3FKYA 4HRSA 2MBHA 4HWIB 2M38A 2RSGA 3P2BA 2LJIA 1Q10A 4PS8A 3OANA 4K2OA 5AZHA 4A9AA 3HVDA 3FC4A 1EF5A 3SHQA 4WVFB 1KLVA 3RNEC 4ZHPA 1WIAA 1E8ZA 3DXCA 3KVFB 3IHPC 3PGEA 1L6UA 5C3JB 1MI0A 2OTXA 3CSFA 3DXDA 5AUIA 3A9KA 3ML4A 1NEKB 3QX1A 1VLBA 4H8SA 3NVVA 4L1BA 3MC0B 3A4SC 3PVWA 4DDGD 3EHVA 1Z5SB 1V89A 1EWYC 1R4NB 2CJNA 3D32A 1ST7A 3UGBB 4IG7B 2UVMA 3TVVA 1FNUA 5CHWA 4NPNA 1UPQA 5EFXA 1ESFA 3CMMB 1Y5OA 3AEDB 1UPRA 2J0KA 2VZKD 2C9WB 5D94A 1HB8A 1ZOYB 1C4CA 3WAPA 3U2SC 3V5WA 1KH0A 3KUZA 2NTTA 2LZ6A 4A20A 2L0FA 1FHOA 4M02A 1V5PA 5H92C 5IJMA 3AEGB 4FA6A 4PQ0A 3HM3A 1PGAA 3MHSD 1RFKA 1N60A 1TZOA 3VIAA 2D11A 4HAZB 3U7DA 5LXIB 1KZGA 4OZCA 3T9LA 2KJ6A 3I57A 3AE3B 2L1CA 4YONA 1E8WA 3U52E 4XYCA 1TKYA 4DX90 2JWUA 3RZWC 1BWNA 2KIGA 1HZ5A 4KDLB 2B3AA 2HJ8A 1M94A 1L4ZB 2ELAA 3SBGA 1E8YA 1T77A 2XBBC 2BB6A 3LYYA 4XZ4A 3NS1A 1MIXA 4QJ3B 2WX1A 3URYA 4JKEA 1OTRB 5DPTA 2L7RA 4C4VA 3Q3MC 3A1QB 4DXAB 1WX9A 5EE0A 2DYQA 4KKJA 1JWAD 3ABVB 3SNHA 5C6RA 2KUQA 2BT6A 1Q0WB 4OW0A 2LGSA 5G5HA 2ZNVB 1D5ZC 4WWMA 1LXDA 5C23A 3WCQA 4ZOHC 2Z0PA 1LM8B 1UUPA 2I5CA 2DYBA 4CYEA 4WWPA 4BBNF 3KH0A 1RFAA 1OGWA 3B77A 2KMMA 2CHXA 3PTFC 2LVOA 3DVNV 2ROZB 2XEWA 1DDVA 1U5GA 4KHAA 2QC8A 3KWVA 1TY2A 5DCNA 5AZGA 1XLNA 4BKGA 2JWZA 2MX2A 4HB0B 1FRDA 1BT0A 2KWCA 1B1ZA 1C76A 2DNFA 5BYRA 1XD4A 2D10A 1W1DA 1PUTA 2K2UA 4MM3B 1XX0A 1QF6A 3VHTC 4F1SA 1NYQA 4EFOA 4ICUA 3N1YC 2KVZA 2WXLA 3TSSA 4REZA 2Y5PA 4A5KA 2NBVB 2INCC 3I63C 4HSIA 2JXTA 2V3PA 2LJ5A 2WXNA 3A1QA 4TQ1A 4NJ7A 1V5MA 2DKPA 1X11A 5I2SA 1KRHA 3LDZE 2L3ZA 2JP2A 2BWES 4M8NA 3Q8CA 3Q14C 1ET6A 1J0WA 1QQRA 1VDVA 1BTKA 3VTVA 3S2AA 2G45B 4HPPA 2FDQA 2LVPA 5C16A 3OHMB 2K3UA 4W9IA 2FUG1 3Q6BA 2K00A 1KZ7A 4IM3A 1WJ1A 1MG4A 2UYZB 4GDKA 3J9CA 2C60A 3SO6A 1HB6A 4KAXB 1WYGA 4AP4C 3ZO5B 3Q8FA 3QK0A 1XKEA 1I42A 1ZXHA 1YQ3B 2IO2B 1X86A 1HQRD 4XWTA 2DZIA 4HB4B 2PZ1A 3V61A 3ZKJC 2LXAA 1TT5B 3RCZA 4OHJA 4IWQA 3W2DA 4LCDE 3PZ7A 5DI9B 2NBVA 3ZYYX 1NVID 1Z87A 2C5LC 1UGJA 2V0GA 1UNQA 2BPSA 2L1AA 2ZNVC 4QJ4B 2N23A 3TEWA 1FMAD 4K17A 2B76B 4GSWA 3WAOA 1JRUA 1T6BX 3N30A 5FK9C 1OQNA 2BS3B 1UNSA 4P16A 2KANA 3Q3OC 2DLWA 1LFDA 3KUDB 1TS3A 1YQBA 3AXCA 3VH3B 4FULA 3I5JC 3DCXA 4TUUA 4C56C 5AEKB 4IM2A 2KFKB 1ZP0B 3V05A 1N5WA 3D8DA 2KACA 1UBQA 4F7UP 2JT4B 1J19A 1DYNA 3N3KB 3AU5A 2DLBA 2EELA 5J3QA 4W9JA 2ELBA 3AE7B 3MP9A 2GBMA 2DTCA 1MHHE 5C2TB 5L83A 2DA0A 1F0ZA 2FIDA 1N6ZA 4QXAB 1ZVRA 3FAHA 3MC9A 3TL5A 2L00B 2LVQA 3HIEA 4B0MA 2N0SB 4FJYA 1SE4A 2JF5A 2ACZB 4XC2A 4IC7B 2W2XD 3ECIA 4HLEA 4ZRPA 4F8CB 1WXSA
chains in the Genus database with same CATH topology
3MPXA 4JKHA 4PYZA 5DHAB 2P0FA 4D0NB 1LW3A 2KLGA 2KWVB 4JKBA 2DZJA 4EJNA 1K5DB 1E8XA 3NHEB 2MSED 3PZDA 2CB8A 5JZEB 4MY6A 2KFKA 4OVUA 2ZVNA 3H7SA 4L6EA 3W1SA 1KOTA 1P6SA 3W1YA 2Z0QA 1WGUA 1WY8A 2KDIA 3D8FA 2EJ8A 2DN6A 1SGHA 3AJ4A 4RM8A 2JUOA 2RUKB 4W9EA 1WI1A 2GCLA 1EF1A 4P7IA 3QIJA 2K8BA 3ZNZB 4DHZE 1DDWA 3EPYA 2AL3A 4ZRKA 2BCJA 2Q13A 4Z2MB 3LJUX 2YVCA 2NBUA 1IYFA 3TCAA 2WX0A 3NSUA 4NQKE 4B95A 4PYUA 4AJWA 3L17A 1Q1OA 1GG3A 2KD0A 4B9KA 3B08A 4TQ0A 4NAWA 4IFSA 1WGGA 3CSTA 1FGYA 2D9VA 5HE1A 3H6NA 1U27A 3WYFB 4GDLB 4AOFA 2GCJA 1S1QB 2GBKA 2BWFA 4JIOU 3BJIA 3ZNGC 1NDDA 3PLVA 1V88A 2LGYA 3OLMD 2IFSA 4ZRJA 3U30A 4EZKA 3PSCA 2DYMA 3OAWA 5D3XA 1X1MA 3BINA 1TJ6A 3N32A 3DPDA 2CHZA 3DQVA 4ZYNA 4JKGB 4EUTA 2KTRB 4W9KA 4HAXB 2NR2A 5CHVC 1ACAA 5HE2A 1TBEA 2ADZA 3TW1A 1EUVB 1E5WA 5TR5A 4G11A 2ZZPB 1K8RB 1WMHB 2K2JA 1WJUA 2LBBA 4PS7A 4MK0A 3KRXA 1A5RA 1ZW7A 3VDZA 5E6OA 4GDLA 1WR6E 5E6PA 3M95A 2BYEA 1Q67A 4G0NB 4JLCA 2MBEA 4MSMB 2RNRB 3TO1A 5DIFB 1WE6A 3R7QA 4WJNA 5KHOA 5FI0A 2YRYA 3ENBA 1RJ2A 3ML9A 3B0AA 4WAAA 5LOPB 3E9LA 2FCQA 5CTRC 4W9GA 1ZSQA 2KQ7A 2LWPA 2KC2A 3Q3FA 2V3SA 2FNJB 3I3TB 1EGXA 5JH5C 1PLSA 2ZJDA 2AYOB 2Y8GA 4KZCA 5DPWA 1DROA 4RMAA 4MH0E 1P3QU 3PRMB 3L10B 3DVNU 4HK2A 4MJSB 4MGIE 1PMSA 4GU2A 1U5FA 2J0JA 1WZ0A 4E74A 2LRUA 2MFQA 3IVFA 5J3YA 3QJZA 2RPQA 2R2OA 1B55A 2WH5A 2OQBA 2YS1A 1XT9B 1WGYA 2CHWA 5CLLB 2LOXA 4EMOA 1YJ1A 1UEFA 1NTYA 2O6VD 1GC6A 1E7UA 2NPTA 2KDFB 2VSZA 4I6LB 2XK5B 1P1AA 1Z2MA 3IFWB 4A6KA 4FLHA 2J59M 1WX8A 3ZTDA 1VCBA 1V61A 1KJTA 3E66A 2COPA 2ABDA 4K7UA 2JRIB 3NY5A 4MJSA 5J18A 3DBHI 3NZSA 2DYNA 2MWSB 4K81A 2EKEC 1XQQA 2W2WA 1GNUA 1E7VA 2HRJA 2Z0DB 2K8CA 3T8MA 2KJRA 3ZNHB 3ODOA 4A6FA 1UNPA 1ZC3B 1TQZA 5JHGA 2NVUI 3VQIA 4HCPB 2KKCA 3F0WA 4J6IA 2XK5A 2H7EA 3ZNID 2DHZA 1TXDA 2UWQA 3Q3JA 1V80A 3PS6A 1SIFA 3SBTA 1I7AA 1IPGA 2IO0B 5C1ZA 3APDA 3HQCA 2MWNB 5J2RA 3GZNI 4MGKE 2KX0A 2GOWA 3UQAA 5C5BA 3SUZA 3ZDMC 3QQ8B 1WR1A 3MTNB 2H7DA 1NTVA 2DFKA 2KCJA 2RR9A 4GDKB 1EAZA 5D7GA 2FCSA 2MKRA 2FUHB 2M17A 3SD5A 5EDSA 2W9NA 2COCA 3G9WA 4GIVA 3DBLI 1J0GA 5LXHA 2DIKA 2LYDA 2ASQA 2K1FA 4JQWC 4HAVB 4X57B 2VRWB 4MSQB 3L08A 3NS8A 2PE9A 1RLFA 4B6HA 3V6EB 3A4RA 4WJ7A 3ZVVA 3PLUA 4Y94A 3CXBB 3PP2A 1HBKA 1W1HA 2J0MA 2IY0B 4WSFA 3PVLA 5KHQA 5D3VA 2G4DB 2N4FA 3ODXA 4BKSD 2C7HA 5G2NA 4WJPA 3EFUA 3VUWA 4BBKA 4JKCA 1WGRA 3O65B 3WA0A 1L7YA 3A9JA 2QKLA 1TGZB 3K9PB 1P3RA 5L95C 2K6DB 2YS5A 2K39A 4BOSC 1X1GA 1EVHA 1ZM0A 4ANXA 2L0TA 2DAJA 2AWTA 2FAZA 1OQYA 4N9F4 1C3TA 2GJYA 2ZEQA 3HHMA 3AULA 2RSUA 1H4RA 2FCMA 2E2XA 3WANA 3UF8A 2P8VA 1ZGUB 1BAKA 4JL9A 5DHFB 1UZXB 1WXMA 3JW0X 1X05A 4IM0A 5JHBA 4BFRA 1KM7A 4FJVB 1LQBA 2XQNM 3VH4B 4MGYE 1AQCA 5D3WA 2P0HA 3V60A 3ML8A 3TIXA 1SHCA 1WGDA 4I6PA 3X0WA 3H7PB 2BGFA 2NS5A 1WG7A 3F5RA 1W1GA 3MDBC 2RD0A 1MIZB 4BBNC 2KDBA 2KUPA 3AI5A 3PT2B 5IA7A 4NAWB 2GBRA 3DVGY 4HAYB 3VOQA 1V81A 3PRZA 4ANUA 2P0DA 3DCGA 2LOZA 5GMVA 1U4AA 2BYVE 2D07B 2KXJA 3ONSA 1ISNA 1WH3A 3RZFA 1ZKHA 2A5UA 4MT7A 4HHVA 1U5EA 1WJMA 2Y8FA 5KQ4A 2LASA 2ZVOA 2FIFA 2JZ3B 2NCNA 3H9DA 4TKNA 4JGHB 4DHJB 2DKQA 4ILHA 2N1VA 3H7PA 3E9PA 3VAWA 1FAOA 2FJ9A 3KYCD 4GB9A 4AWJA 1VBHA 4WJOA 2MBQA 5KQ1A 3R3MA 3W1SC 2Y7BA 2V4LA 2MLBA 3M62B 4HCNB 3UINB 2LKOA 4KVGB 4TYZA 2Y5BB 1V5TA 2CU1A 2J7QB 1AWEA 4HPLB 4HXDA 1Y19B 3JSVA 4XWXA 2RGNB 4JKDA 2WDTB 1NTIA 3KW5B 4IUMB 2VKIA 5JP4A 3D8EA 3HK0A 1WJ6A 3PHWB 3R66C 5BO4B 2LUEA 2DZMA 5IAAC 1HE8A 4DBGA 2JY6A 4M0WB 2KK8A 1JDEA 4IOYX 4JKFA 1U5DA 3ODWA 1YX6B 3UIPB 5FI1A 3L0WB 1QQGA 3M3JA 4HVBA 2DHJA 5E6NA 1V5OA 2HE7A 2LXCA 2X18A 1H8CA 2R2QA 1NI2A 3PEGA 2BKRB 2L05A 1UNRA 3UQBA 3A8QA 2PE6B 2MBOA 1L2NA 1P5TA 2BKFA 4HAWB 1V5UA 4LDTD 4F7ZA 4TV3A 2BF8B 2GMIC 2K25A 2KOXA 3L16A 2PJHA 4JK9A 2MP2B 2R82A 3H1UA 1WGHA 1MAIA 3L54A 2L2IA 2CQUA 1E90A 1XD3B 2KN5A 2ZCBA 3PVUA 2NBWB 3UIOB 1WXAA 2N9PC 3KSYA 3SV1A 4ILGB 4W9CA 3A98B 4GMXB 4XX5A 1R4NI 1G6JA 3MJWA 2NPTB 4FN2A 2JPHA 4W9DA 4CHMA 3TBLD 3V62A 4AUQC 1KI1B 4GZUA 1D3ZA 4C0AA 3DOWA 1N3HA 4II2B 4URKA 1V9JA 3GOEA 2DAFA 3QWZB 2AEHA 4FHKA 1DDMA 2PEAA 3VUYA 2IYBA 3PG7A 1LB1A 4JK8A 2CR5A 2KNBA 2MP2A 3B1LX 2MW5A 2CY4A 2YF0A 4GPTB 1T0YA 3ALBA 4DWFA 4ZDVA 1FXTB 5D6JB 1WJNA 1UELA 3SDLC 4GXBA 1WF9A 2R09A 4EEWA 2BYFA 1SE9A 4A6FB 1WJ4A 1EO6A 4DDID 2I1KA 3PV1A 4EZJA 1NBFC 1WFYA 4HDQA 3QHTA 2CRFA 1V6EA 4DBBA 2V1YA 2ZPYA 2NMBA 2LI5A 3P7ZA 4G50A 4FADA 2L8JA 2DX1A 2UZRA 5HE0A 3UZTA 2V76A 1DBHA 3PREA 3VTUA 2MDXA 2D2QA 5C5BB 4BKTA 1FHXA 3DBSA 4IAPA 3CIKA 1FOEA 2N9EB 2KVRA 2JVCA 2UZSA 1UGMA 5DPSA 2KQSA 3PHXB 2FJLA 5HKHA 4KHBB 4WQOB 1YIWA 4DK5A 1FHWA 5FR6A 5D3YA 2A4ZA 2DZKA 1KBLA 4HDOA 1UD7A 3HM6X 2KJHB 3ZLZA 2HD5B 2KDEB 1YX5B 2M8SA 1MK9B 2Z0OA 3FP5A 2ZPNA 1WXVA 4II3B 4K2PA 2LGDA 2CODA 1I35A 2DHKA 2D3GA 3N7CA 2MQJA 1MK7B 2G35A 1X1FA 3VUXA 4F7HA 2X0SA 5GOWB 2IO3B 3LJ3A 2O2VB 2YS3A 3DDCB 4BVUC 4IWPA 3ZRFA 2RGFA 3ULCA 1OEYJ 2LG1A 4BKSA 2G3QB 2ZCCA 3BY4B 4B6WA 4KSKC 1XCGA 3O96A 4JK7A 3ZTCA 1M7EA 3ZVRA 2AL6A 4W9HA 3HW2B 1VD2A 1IP9A 3RCPA 3FM8C 3A9JB 2KGXB 1Y8RC 4FHJA 2N0YA 4MEMA 5L81A 3ULBA 5JVLA 4G3XB 4IWOA 4NJ6A 2LRWA 2KLCA 1V2YA 2YLMA 1KC7A 2PPHA 3SYXA 4A3PA 3WALA 2JXXA 1RRPB 1M7RA 3K9OB 2D9ZA 2YT0A 2FCNA 2O2VA 1P98A 2YT1A 4A6HA 3TMPB 2M0XA 5KCVA 4KZ0A 4NQLB 1P9DU 2HTHB 1WZ3A 2QHOA 3AU4A 1GJZA 2Z59B 2N7EA 4E71A 1WVHA 2WWZA 4AJYB 4EKUA 2VRRB 3VFKA 4M8MA 2IZVB 3QCAA 1BTNA 3CF6E 2K8HA 3ZDTA 3E9OA 4JKAA 1WGQA 1WRDB 3QBVB 4HJKA 3PPAA 2KMAA 3X23A 3OJ4B 4CHKA 1GUAB 2COAA 1P0RA 1QZEA 1DIKA 3ZIMA 1U2BA 4HB3B 4MM3A 5J3TA 3PRPB 1I2HA 4GGQA 2LULA 2WYQA 1XODA 4FJZA 1TZ1A 2KC1A 2KMCA 3RD2A 4KV2A 1AARA 2JRHA 4F7GA 2MA9B 4HAUB 4HATB 5AZFA 4PNKA 2HTHA 4YL8A 2GS0A 3HIZA 4MDKE 3DXEA 1OEYA 1IRSA 1YD8U 1WI0A 4RM9A 1VBGA 2CKHB 4KSLC 3IBEA 1C1YB 3KYDD 2M4NA 2W2XC 2KFJA 4ILJA 4GN1A 5CX3A 1R4MI 1V86A 1V49A 2RVBB 1Q5WB 2KWUB 2KO3A 3KRWA 3KZ1A 3QAQA 3P6AA 4HPMB 3GYOA 5HE3A 4A3OA 4EOYA 3RYTA 3APCA 2OOBB 1TTNA 2MRPA 3QARA 2CAYA 3R7RA 5J17A 2IY1B 4ANVA 3KUCB 4GMVA 4WJQA 2Z0EB 2IYDB 2RQ1A 1WM3A 3JSVB 4LDTB 5C79A 1GC7A 2D9XA 3IG3A 2EMTA 1UH6A 3ZUNA 2DENB 2IO1B 2EC1A 5JLJB 5DH9B 4K7SA 3VXWA 2KZRA 2MBBB 1MPHA 4DX8A 5LLIA 4NY0A 1WM2A 5CLQB 2DYOA 2GBNA 2MCNB 2QKMA 1GGOA 4CHJA 2REXA 4KIKB 4HB2B 1NVLA 4W9LA 4I6NB 3VTWA 3KY9A 2ROVA 5CHFA 3M63B 1J8CA 3GYPA 3OJ3A 5D2MB 2L76A 4DHZB 2I1JA 4PS3A 2NZ8B 1OY2A 3SU8X 2KX3A 3ZW3A 3QA8A 3ZRCA 3DVGX 2N1WA 2C7NB 3JVZX 2I5FA 2R0DA 3QC8B 1U29A 1OMWA 4KHOA 4K1RB 1RAXA 4FBJB 5JHAA 3JYUA 1QC6A 3C0RB 1NU2A 2M1MA 2DHIA 1CMXB 3U8ZA 4IW0A 3WAMA 3QWMA 2OJRA 3EC8A 5DPRA 1H10A 4Z2NA 2IBIB 3EECA 1PFJA 2C7MB 4CO7A 2O6VB 4MGZE 1MG8A 1XR0B 3NOBA 4W9FA 4KIKA 4NSWA 2M14A 1FB8A 2COFA 3ENEA 5LONB 3PSEB 2D4QA 4ANWA 2YSZA 5D27A 2CY5A 4LJOB 1PQSA 3A33B 2LD9A 1F9JA 2DX5B 1FGZA 3A8PA 4ZRIA 2G4SA 2CS4A 2LGXA 1ZC4B 2K6QA 1S3SG 3FEHA 4LJPB 3TJPA 3DBRI 2N9XA 4EZLA 4E3CA 1RRBA 2D9YA 3L13A 3RT3B 4NNJB 5G55A 3FLVA 2RLOA 2O6VA 1WE7A 1UBIA 1MKEA 3RUIB 4DHJD 4JKGA 2KTRA 3M1IB 3VVWB 3RULA 2D9WA 2JZZA 3A9KB 3WIMA 1WYWB 2DX5A 4KDIC 1WMHA 2N7DA 3T06A 4OVVA 4BOZB 3APFA 3TFMA 5JHHA 4ASWC 4GOCA 1WX7A 3FSSA 4MELA 4ICVA 3NZUA 2KHWB 2GBJA 1K5GB 4K7WA 4WWOA 4WWNA 2KTFA 2EMSA 3V6CB 2MBHA 4HWIB 2M38A 2RSGA 3P2BA 4PS8A 3OANA 4K2OA 5AZHA 1EF5A 3SHQA 4WVFB 1KLVA 1WIAA 1E8ZA 3DXCA 3KVFB 3IHPC 3PGEA 2OTXA 3CSFA 3DXDA 3A9KA 3ML4A 3QX1A 4H8SA 3A4SC 3PVWA 4DDGD 3EHVA 1Z5SB 1V89A 3D32A 1ST7A 3UGBB 4IG7B 2UVMA 3TVVA 5CHWA 4NPNA 1UPQA 5EFXA 3CMMB 1Y5OA 1UPRA 2J0KA 5D94A 2C9WB 1HB8A 3WAPA 3V5WA 3KUZA 2LZ6A 4A20A 2L0FA 1FHOA 1V5PA 5IJMA 4FA6A 4PQ0A 3HM3A 3MHSD 3VIAA 2D11A 4HAZB 3U7DA 5LXIB 1KZGA 3T9LA 2KJ6A 2L1CA 4YONA 1E8WA 4DX90 3RZWC 4KDLB 1BWNA 2B3AA 2HJ8A 1M94A 2ELAA 3SBGA 1E8YA 2XBBC 4XZ4A 1MIXA 2WX1A 4JKEA 1OTRB 5DPTA 2L7RA 3A1QB 4DXAB 1WX9A 2DYQA 3SNHA 5C6RA 1Q0WB 2ZNVB 1LXDA 5C23A 2Z0PA 1LM8B 2I5CA 2DYBA 4CYEA 4WWPA 4BBNF 3KH0A 1RFAA 1OGWA 2CHXA 3PTFC 2LVOA 3DVNV 2ROZB 2XEWA 1DDVA 1U5GA 4KHAA 5DCNA 5AZGA 4BKGA 2JWZA 2MX2A 4HB0B 1BT0A 2KWCA 1XD4A 2D10A 1W1DA 2K2UA 1XX0A 3VHTC 4F1SA 4EFOA 4ICUA 4A5KA 2NBVB 2LJ5A 3A1QA 4TQ1A 4NJ7A 1V5MA 2DKPA 1X11A 3LDZE 2L3ZA 2JP2A 2BWES 4M8NA 1J0WA 1BTKA 3VTVA 3S2AA 2G45B 2FDQA 2LVPA 5C16A 4W9IA 2K00A 1KZ7A 4IM3A 1WJ1A 2UYZB 4GDKA 2C60A 3SO6A 1HB6A 4KAXB 4AP4C 3ZO5B 3QK0A 1XKEA 1I42A 2IO2B 1X86A 2DZIA 4HB4B 2PZ1A 3V61A 3ZKJC 2LXAA 3RCZA 4IWQA 4LCDE 5DI9B 2C5LC 1Z87A 1UNQA 2BPSA 2ZNVC 2N23A 4K17A 4GSWA 3WAOA 1JRUA 3N30A 1OQNA 2KANA 2DLWA 1LFDA 3KUDB 1YQBA 3AXCA 3VH3B 4FULA 4TUUA 5AEKB 4IM2A 2KFKB 3D8DA 1UBQA 4F7UP 2JT4B 1J19A 1DYNA 3N3KB 3AU5A 5J3QA 4W9JA 2ELBA 2GBMA 2DTCA 5L83A 2DA0A 2FIDA 1ZVRA 3TL5A 2L00B 2LVQA 4FJYA 2JF5A 4XC2A 4IC7B 2W2XD 3ECIA 4HLEA 4F8CB 1WXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPX A;  4PYZ A;  5DHA B;  2P0F A;  4D0N B;  1LW3 A;  2KLG A;  2KWV B;  2DZJ A;  4EJN A;  1K5D B;  1E8X A;  3NHE B;  2MSE D;  3PZD A;  2CB8 A;  5JZE B;  4MY6 A;  2KFK A;  4OVU A;  2ZVN A;  3H7S A;  4L6E A;  3W1S A;  1KOT A;  1P6S A;  3W1Y A;  2Z0Q A;  1WGU A;  1WY8 A;  2KDI A;  3D8F A;  2EJ8 A;  2DN6 A;  1SGH A;  3AJ4 A;  4RM8 A;  2JUO A;  2RUK B;  4W9E A;  1WI1 A;  2GCL A;  1EF1 A;  4P7I A;  3QIJ A;  2K8B A;  3ZNZ B;  4DHZ E;  1DDW A;  3EPY A;  2AL3 A;  4ZRK A;  2BCJ A;  2Q13 A;  4Z2M B;  3LJU X;  2YVC A;  2NBU A;  1IYF A;  3TCA A;  2WX0 A;  3NSU A;  4NQK E;  4B95 A;  4PYU A;  4AJW A;  3L17 A;  1Q1O A;  1GG3 A;  2KD0 A;  4B9K A;  3B08 A;  4TQ0 A;  4NAW A;  4IFS A;  1WGG A;  3CST A;  1FGY A;  2D9V A;  5HE1 A;  3H6N A;  1U27 A;  3WYF B;  4GDL B;  4AOF A;  2GCJ A;  1S1Q B;  2GBK A;  2BWF A;  4JIO U;  3BJI A;  3ZNG C;  1NDD A;  3PLV A;  1V88 A;  2LGY A;  3OLM D;  2IFS A;  4ZRJ A;  3U30 A;  4EZK A;  3PSC A;  2DYM A;  3OAW A;  5D3X A;  1X1M A;  3BIN A;  1TJ6 A;  3N32 A;  3DPD A;  2CHZ A;  3DQV A;  4ZYN A;  4EUT A;  2KTR B;  4W9K A;  4HAX B;  2NR2 A;  5CHV C;  1ACA A;  5HE2 A;  1TBE A;  2ADZ A;  3TW1 A;  1EUV B;  1E5W A;  5TR5 A;  4G11 A;  2ZZP B;  1K8R B;  1WMH B;  2K2J A;  1WJU A;  2LBB A;  4PS7 A;  4MK0 A;  3KRX A;  1A5R A;  1ZW7 A;  3VDZ A;  5E6O A;  4GDL A;  1WR6 E;  5E6P A;  3M95 A;  2BYE A;  1Q67 A;  4G0N B;  4JLC A;  2MBE A;  4MSM B;  2RNR B;  3TO1 A;  5DIF B;  1WE6 A;  3R7Q A;  4WJN A;  5KHO A;  5FI0 A;  2YRY A;  1RJ2 A;  3ML9 A;  3B0A A;  4WAA A;  5LOP B;  2FCQ A;  5CTR C;  4W9G A;  1ZSQ A;  2KQ7 A;  2LWP A;  2KC2 A;  3Q3F A;  2V3S A;  2FNJ B;  3I3T B;  1EGX A;  5JH5 C;  1PLS A;  2ZJD A;  2AYO B;  2Y8G A;  4KZC A;  5DPW A;  1DRO A;  4RMA A;  4MH0 E;  1P3Q U;  3PRM B;  3L10 B;  3DVN U;  4HK2 A;  4MJS B;  4MGI E;  1PMS A;  4GU2 A;  1U5F A;  2J0J A;  1WZ0 A;  4E74 A;  2LRU A;  2MFQ A;  3IVF A;  5J3Y A;  3QJZ A;  2RPQ A;  2R2O A;  1B55 A;  2WH5 A;  2OQB A;  2YS1 A;  1XT9 B;  1WGY A;  2CHW A;  5CLL B;  2LOX A;  4EMO A;  1YJ1 A;  1UEF A;  1NTY A;  2O6V D;  1GC6 A;  1E7U A;  2NPT A;  2KDF B;  2VSZ A;  4I6L B;  2XK5 B;  1P1A A;  1Z2M A;  3IFW B;  4A6K A;  4FLH A;  2J59 M;  1WX8 A;  3ZTD A;  1VCB A;  1V61 A;  1KJT A;  2COP A;  2ABD A;  4K7U A;  2JRI B;  3NY5 A;  4MJS A;  5J18 A;  3DBH I;  3NZS A;  2DYN A;  2MWS B;  4K81 A;  2EKE C;  1XQQ A;  2W2W A;  1GNU A;  1E7V A;  2HRJ A;  2Z0D B;  2K8C A;  3T8M A;  2KJR A;  3ZNH B;  3ODO A;  4A6F A;  1UNP A;  1ZC3 B;  1TQZ A;  5JHG A;  2NVU I;  3VQI A;  4HCP B;  2KKC A;  3F0W A;  4J6I A;  2XK5 A;  2H7E A;  3ZNI D;  2DHZ A;  1TXD A;  2UWQ A;  3Q3J A;  1V80 A;  3PS6 A;  1SIF A;  1I7A A;  1IPG A;  2IO0 B;  5C1Z A;  3APD A;  3HQC A;  2MWN B;  5J2R A;  3GZN I;  4MGK E;  2KX0 A;  2GOW A;  3UQA A;  5C5B A;  3SUZ A;  3ZDM C;  3QQ8 B;  1WR1 A;  3MTN B;  2H7D A;  1NTV A;  2DFK A;  2KCJ A;  2RR9 A;  4GDK B;  1EAZ A;  5D7G A;  2FCS A;  2MKR A;  2FUH B;  2M17 A;  3SD5 A;  5EDS A;  2W9N A;  2COC A;  3G9W A;  4GIV A;  3DBL I;  1J0G A;  5LXH A;  2LYD A;  2ASQ A;  2K1F A;  4JQW C;  4HAV B;  4X57 B;  2VRW B;  4MSQ B;  3L08 A;  3NS8 A;  2PE9 A;  1RLF A;  4B6H A;  3V6E B;  3A4R A;  4WJ7 A;  3ZVV A;  3PLU A;  4Y94 A;  3CXB B;  3PP2 A;  1HBK A;  1W1H A;  2J0M A;  2IY0 B;  4WSF A;  3PVL A;  5KHQ A;  5D3V A;  2G4D B;  2N4F A;  3ODX A;  4BKS D;  2C7H A;  5G2N A;  4WJP A;  3EFU A;  3VUW A;  4BBK A;  1WGR A;  3O65 B;  3WA0 A;  1L7Y A;  3A9J A;  2QKL A;  1TGZ B;  3K9P B;  1P3R A;  5L95 C;  2K6D B;  2YS5 A;  2K39 A;  4BOS C;  1X1G A;  1EVH A;  1ZM0 A;  4ANX A;  2L0T A;  2DAJ A;  2AWT A;  2FAZ A;  1OQY A;  4N9F 4;  1C3T A;  2GJY A;  2ZEQ A;  3HHM A;  3AUL A;  2RSU A;  1H4R A;  2FCM A;  2E2X A;  3WAN A;  3UF8 A;  2P8V A;  1ZGU B;  1BAK A;  4JL9 A;  5DHF B;  1UZX B;  1WXM A;  3JW0 X;  1X05 A;  4IM0 A;  5JHB A;  4BFR A;  1KM7 A;  4FJV B;  1LQB A;  2XQN M;  3VH4 B;  4MGY E;  1AQC A;  5D3W A;  2P0H A;  3V60 A;  3ML8 A;  3TIX A;  1SHC A;  1WGD A;  4I6P A;  3X0W A;  3H7P B;  2BGF A;  2NS5 A;  1WG7 A;  3F5R A;  1W1G A;  3MDB C;  2RD0 A;  1MIZ B;  4BBN C;  2KDB A;  2KUP A;  3AI5 A;  3PT2 B;  5IA7 A;  4NAW B;  2GBR A;  3DVG Y;  4HAY B;  3VOQ A;  1V81 A;  3PRZ A;  4ANU A;  2P0D A;  3DCG A;  2LOZ A;  5GMV A;  1U4A A;  2BYV E;  2D07 B;  2KXJ A;  3ONS A;  1ISN A;  1WH3 A;  3RZF A;  1ZKH A;  2A5U A;  4MT7 A;  4HHV A;  1U5E A;  1WJM A;  2Y8F A;  5KQ4 A;  2LAS A;  2ZVO A;  2FIF A;  2JZ3 B;  2NCN A;  3H9D A;  4TKN A;  4JGH B;  4DHJ B;  2DKQ A;  2N1V A;  3H7P A;  3VAW A;  1FAO A;  2FJ9 A;  3KYC D;  4GB9 A;  4AWJ A;  4WJO A;  2MBQ A;  5KQ1 A;  3R3M A;  3W1S C;  2Y7B A;  2V4L A;  2MLB A;  3M62 B;  4HCN B;  3UIN B;  2LKO A;  4KVG B;  4TYZ A;  2Y5B B;  1V5T A;  2CU1 A;  2J7Q B;  1AWE A;  4HPL B;  4HXD A;  1Y19 B;  3JSV A;  4XWX A;  2RGN B;  2WDT B;  1NTI A;  3KW5 B;  4IUM B;  2VKI A;  5JP4 A;  3D8E A;  3HK0 A;  1WJ6 A;  3PHW B;  3R66 C;  5BO4 B;  2LUE A;  2DZM A;  5IAA C;  1HE8 A;  4DBG A;  2JY6 A;  4M0W B;  2KK8 A;  4IOY X;  1U5D A;  3ODW A;  1YX6 B;  3UIP B;  5FI1 A;  3L0W B;  1QQG A;  3M3J A;  4HVB A;  2DHJ A;  5E6N A;  1V5O A;  2HE7 A;  2LXC A;  2X18 A;  1H8C A;  2R2Q A;  1NI2 A;  3PEG A;  2BKR B;  2L05 A;  1UNR A;  3UQB A;  3A8Q A;  2PE6 B;  2MBO A;  1L2N A;  1P5T A;  2BKF A;  4HAW B;  1V5U A;  4LDT D;  4F7Z A;  4TV3 A;  2BF8 B;  2GMI C;  2K25 A;  2KOX A;  3L16 A;  2PJH A;  2MP2 B;  3H1U A;  1WGH A;  1MAI A;  3L54 A;  2L2I A;  2CQU A;  1E90 A;  1XD3 B;  2KN5 A;  2ZCB A;  3PVU A;  2NBW B;  3UIO B;  1WXA A;  2N9P C;  3KSY A;  3SV1 A;  4W9C A;  3A98 B;  4GMX B;  4XX5 A;  1R4N I;  1G6J A;  3MJW A;  2NPT B;  4FN2 A;  2JPH A;  4W9D A;  4CHM A;  3TBL D;  3V62 A;  4AUQ C;  1KI1 B;  4GZU A;  1D3Z A;  4C0A A;  3DOW A;  1N3H A;  4II2 B;  4URK A;  1V9J A;  3GOE A;  2DAF A;  3QWZ B;  2AEH A;  4FHK A;  1DDM A;  2PEA A;  3VUY A;  2IYB A;  3PG7 A;  1LB1 A;  2CR5 A;  2KNB A;  2MP2 A;  3B1L X;  2MW5 A;  2CY4 A;  2YF0 A;  4GPT B;  1T0Y A;  3ALB A;  4DWF A;  4ZDV A;  1FXT B;  5D6J B;  1WJN A;  1UEL A;  3SDL C;  4GXB A;  1WF9 A;  2R09 A;  4EEW A;  2BYF A;  1SE9 A;  4A6F B;  1WJ4 A;  1EO6 A;  4DDI D;  2I1K A;  3PV1 A;  4EZJ A;  1NBF C;  1WFY A;  4HDQ A;  3QHT A;  2CRF A;  1V6E A;  4DBB A;  2V1Y A;  2ZPY A;  2NMB A;  2LI5 A;  3P7Z A;  4G50 A;  4FAD A;  2L8J A;  2DX1 A;  2UZR A;  5HE0 A;  3UZT A;  2V76 A;  1DBH A;  3PRE A;  3VTU A;  2MDX A;  2D2Q A;  5C5B B;  4BKT A;  1FHX A;  3DBS A;  4IAP A;  3CIK A;  1FOE A;  2N9E B;  2KVR A;  2JVC A;  2UZS A;  1UGM A;  5DPS A;  2KQS A;  3PHX B;  2FJL A;  5HKH A;  4KHB B;  4WQO B;  1YIW A;  4DK5 A;  1FHW A;  5FR6 A;  5D3Y A;  2A4Z A;  2DZK A;  4HDO A;  1UD7 A;  3HM6 X;  2KJH B;  3ZLZ A;  2HD5 B;  2KDE B;  1YX5 B;  2M8S A;  1MK9 B;  2Z0O A;  3FP5 A;  2ZPN A;  1WXV A;  4II3 B;  4K2P A;  2LGD A;  2COD A;  1I35 A;  2DHK A;  2D3G A;  3N7C A;  2MQJ A;  1MK7 B;  2G35 A;  1X1F A;  3VUX A;  4F7H A;  5GOW B;  2IO3 B;  3LJ3 A;  2O2V B;  2YS3 A;  3DDC B;  4BVU C;  4IWP A;  3ZRF A;  2RGF A;  3ULC A;  1OEY J;  2LG1 A;  4BKS A;  2G3Q B;  2ZCC A;  3BY4 B;  4B6W A;  4KSK C;  1XCG A;  3O96 A;  3ZTC A;  1M7E A;  3ZVR A;  2AL6 A;  4W9H A;  3HW2 B;  1VD2 A;  1IP9 A;  3RCP A;  3FM8 C;  3A9J B;  2KGX B;  1Y8R C;  4FHJ A;  2N0Y A;  4MEM A;  5L81 A;  3ULB A;  4G3X B;  4IWO A;  4NJ6 A;  2LRW A;  2KLC A;  1V2Y A;  2YLM A;  2PPH A;  3SYX A;  4A3P A;  3WAL A;  2JXX A;  1RRP B;  1M7R A;  3K9O B;  2D9Z A;  2YT0 A;  2FCN A;  2O2V A;  1P98 A;  2YT1 A;  4A6H A;  3TMP B;  2M0X A;  5KCV A;  4KZ0 A;  4NQL B;  1P9D U;  2HTH B;  1WZ3 A;  2QHO A;  3AU4 A;  1GJZ A;  2Z59 B;  2N7E A;  4E71 A;  1WVH A;  2WWZ A;  4AJY B;  4EKU A;  2VRR B;  3VFK A;  4M8M A;  2IZV B;  3QCA A;  1BTN A;  3CF6 E;  2K8H A;  3ZDT A;  1WGQ A;  1WRD B;  3QBV B;  4HJK A;  3PPA A;  2KMA A;  3X23 A;  3OJ4 B;  4CHK A;  1GUA B;  2COA A;  1P0R A;  1QZE A;  3ZIM A;  1U2B A;  4HB3 B;  4MM3 A;  5J3T A;  3PRP B;  1I2H A;  4GGQ A;  2LUL A;  2WYQ A;  1XOD A;  4FJZ A;  1TZ1 A;  2KC1 A;  2KMC A;  3RD2 A;  4KV2 A;  1AAR A;  2JRH A;  4F7G A;  2MA9 B;  4HAU B;  4HAT B;  5AZF A;  4PNK A;  2HTH A;  4YL8 A;  2GS0 A;  3HIZ A;  4MDK E;  3DXE A;  1OEY A;  1IRS A;  1YD8 U;  1WI0 A;  4RM9 A;  2CKH B;  4KSL C;  3IBE A;  1C1Y B;  3KYD D;  2M4N A;  2W2X C;  2KFJ A;  4GN1 A;  5CX3 A;  1R4M I;  1V86 A;  1V49 A;  2RVB B;  1Q5W B;  2KWU B;  2KO3 A;  3KRW A;  3KZ1 A;  3QAQ A;  3P6A A;  4HPM B;  3GYO A;  5HE3 A;  4A3O A;  4EOY A;  3RYT A;  3APC A;  2OOB B;  1TTN A;  2MRP A;  3QAR A;  2CAY A;  3R7R A;  5J17 A;  2IY1 B;  4ANV A;  3KUC B;  4GMV A;  4WJQ A;  2Z0E B;  2IYD B;  2RQ1 A;  1WM3 A;  3JSV B;  4LDT B;  5C79 A;  1GC7 A;  2D9X A;  3IG3 A;  2EMT A;  1UH6 A;  3ZUN A;  2DEN B;  2IO1 B;  2EC1 A;  5JLJ B;  5DH9 B;  4K7S A;  3VXW A;  2KZR A;  2MBB B;  1MPH A;  4DX8 A;  5LLI A;  4NY0 A;  1WM2 A;  5CLQ B;  2DYO A;  2GBN A;  2MCN B;  2QKM A;  4CHJ A;  2REX A;  4KIK B;  4HB2 B;  1NVL A;  4W9L A;  4I6N B;  3VTW A;  3KY9 A;  2ROV A;  5CHF A;  3M63 B;  1J8C A;  3GYP A;  3OJ3 A;  5D2M B;  2L76 A;  4DHZ B;  2I1J A;  4PS3 A;  2NZ8 B;  1OY2 A;  3SU8 X;  2KX3 A;  3ZW3 A;  3QA8 A;  3ZRC A;  3DVG X;  2N1W A;  2C7N B;  3JVZ X;  2I5F A;  2R0D A;  3QC8 B;  1U29 A;  1OMW A;  4KHO A;  4K1R B;  1RAX A;  4FBJ B;  5JHA A;  3JYU A;  1QC6 A;  3C0R B;  1NU2 A;  2M1M A;  2DHI A;  1CMX B;  3U8Z A;  4IW0 A;  3WAM A;  3QWM A;  2OJR A;  3EC8 A;  5DPR A;  1H10 A;  4Z2N A;  2IBI B;  3EEC A;  1PFJ A;  2C7M B;  4CO7 A;  2O6V B;  4MGZ E;  1MG8 A;  1XR0 B;  3NOB A;  4W9F A;  4KIK A;  4NSW A;  2M14 A;  1FB8 A;  2COF A;  3ENE A;  5LON B;  3PSE B;  2D4Q A;  4ANW A;  2YSZ A;  5D27 A;  2CY5 A;  4LJO B;  1PQS A;  3A33 B;  2LD9 A;  1F9J A;  2DX5 B;  1FGZ A;  3A8P A;  4ZRI A;  2G4S A;  2CS4 A;  2LGX A;  1ZC4 B;  2K6Q A;  1S3S G;  3FEH A;  4LJP B;  3TJP A;  3DBR I;  2N9X A;  4EZL A;  4E3C A;  1RRB A;  2D9Y A;  3L13 A;  3RT3 B;  4NNJ B;  5G55 A;  3FLV A;  2RLO A;  2O6V A;  1WE7 A;  1UBI A;  1MKE A;  3RUI B;  4DHJ D;  2KTR A;  3M1I B;  3VVW B;  3RUL A;  2D9W A;  2JZZ A;  3A9K B;  3WIM A;  1WYW B;  2DX5 A;  4KDI C;  1WMH A;  2N7D A;  3T06 A;  4OVV A;  4BOZ B;  3APF A;  3TFM A;  5JHH A;  4ASW C;  4GOC A;  1WX7 A;  3FSS A;  4MEL A;  4ICV A;  3NZU A;  2KHW B;  2GBJ A;  1K5G B;  4K7W A;  4WWO A;  4WWN A;  2KTF A;  2EMS A;  3V6C B;  2MBH A;  4HWI B;  2M38 A;  2RSG A;  3P2B A;  4PS8 A;  3OAN A;  4K2O A;  5AZH A;  1EF5 A;  3SHQ A;  4WVF B;  1KLV A;  1WIA A;  1E8Z A;  3DXC A;  3KVF B;  3IHP C;  3PGE A;  2OTX A;  3CSF A;  3DXD A;  3A9K A;  3ML4 A;  3QX1 A;  4H8S A;  3A4S C;  3PVW A;  4DDG D;  3EHV A;  1Z5S B;  1V89 A;  3D32 A;  1ST7 A;  3UGB B;  4IG7 B;  2UVM A;  3TVV A;  5CHW A;  4NPN A;  1UPQ A;  5EFX A;  3CMM B;  1Y5O A;  1UPR A;  2J0K A;  5D94 A;  2C9W B;  1HB8 A;  3WAP A;  3V5W A;  3KUZ A;  2LZ6 A;  4A20 A;  2L0F A;  1FHO A;  1V5P A;  5IJM A;  4FA6 A;  4PQ0 A;  3HM3 A;  3MHS D;  3VIA A;  2D11 A;  4HAZ B;  3U7D A;  5LXI B;  1KZG A;  3T9L A;  2KJ6 A;  2L1C A;  4YON A;  1E8W A;  4DX9 0;  3RZW C;  4KDL B;  1BWN A;  2B3A A;  2HJ8 A;  1M94 A;  2ELA A;  1E8Y A;  2XBB C;  4XZ4 A;  1MIX A;  2WX1 A;  1OTR B;  5DPT A;  2L7R A;  3A1Q B;  4DXA B;  1WX9 A;  2DYQ A;  3SNH A;  5C6R A;  1Q0W B;  2ZNV B;  1LXD A;  5C23 A;  2Z0P A;  1LM8 B;  2I5C A;  2DYB A;  4CYE A;  4WWP A;  4BBN F;  3KH0 A;  1RFA A;  1OGW A;  2CHX A;  3PTF C;  2LVO A;  3DVN V;  2ROZ B;  2XEW A;  1DDV A;  1U5G A;  4KHA A;  5DCN A;  5AZG A;  4BKG A;  2JWZ A;  2MX2 A;  4HB0 B;  1BT0 A;  2KWC A;  1XD4 A;  2D10 A;  1W1D A;  2K2U A;  1XX0 A;  3VHT C;  4F1S A;  4EFO A;  4ICU A;  4A5K A;  2NBV B;  2LJ5 A;  3A1Q A;  4TQ1 A;  4NJ7 A;  1V5M A;  2DKP A;  1X11 A;  3LDZ E;  2L3Z A;  2JP2 A;  2BWE S;  4M8N A;  1J0W A;  1BTK A;  3VTV A;  3S2A A;  2G45 B;  2FDQ A;  2LVP A;  5C16 A;  4W9I A;  2K00 A;  1KZ7 A;  4IM3 A;  1WJ1 A;  2UYZ B;  4GDK A;  2C60 A;  3SO6 A;  1HB6 A;  4KAX B;  4AP4 C;  3ZO5 B;  3QK0 A;  1XKE A;  1I42 A;  2IO2 B;  1X86 A;  2DZI A;  4HB4 B;  2PZ1 A;  3V61 A;  3ZKJ C;  2LXA A;  3RCZ A;  4IWQ A;  4LCD E;  5DI9 B;  2C5L C;  1Z87 A;  1UNQ A;  2BPS A;  2ZNV C;  2N23 A;  4K17 A;  4GSW A;  3WAO A;  1JRU A;  3N30 A;  1OQN A;  2KAN A;  2DLW A;  1LFD A;  3KUD B;  1YQB A;  3AXC A;  3VH3 B;  4FUL A;  4TUU A;  5AEK B;  4IM2 A;  2KFK B;  3D8D A;  1UBQ A;  4F7U P;  2JT4 B;  1J19 A;  1DYN A;  3N3K B;  3AU5 A;  5J3Q A;  4W9J A;  2ELB A;  2GBM A;  2DTC A;  5L83 A;  2DA0 A;  2FID A;  1ZVR A;  3TL5 A;  2L00 B;  2LVQ A;  4FJY A;  2JF5 A;  4XC2 A;  4IC7 B;  2W2X D;  3ECI A;  4HLE A;  4F8C B;  1WXS A; 
#chains in the Genus database with same CATH topology
 2M56 B;  3MPX A;  1QT9 A;  4JKH A;  1E9M A;  5HFY A;  4PYZ A;  5DHA B;  2P0F A;  1XLP A;  4D0N B;  1LW3 A;  3VR9 B;  2KLG A;  4N59 A;  3TEY A;  2KWV B;  5IP4 D;  4JKB A;  2DZJ A;  1K51 A;  2BVC A;  4EJN A;  1K5D B;  1L5P A;  1E8X A;  4N58 A;  1YJJ A;  3NHE B;  2MSE D;  4P6V F;  3PZD A;  2CB8 A;  5JZE B;  3NW8 A;  4MY6 A;  1HA5 A;  2KFK A;  4OVU A;  4H2A A;  1QIL A;  2BBC A;  2ZVN A;  3H7S A;  3GE3 C;  4L6E A;  3W1S A;  4M01 A;  1KOT A;  1P6S A;  1MVK A;  3W1Y A;  2PKO A;  2KDM A;  2J52 A;  2LFI A;  5FKA C;  1GOZ A;  4LNN A;  2Z0Q A;  1WGU A;  1WY8 A;  4LTU A;  3W5V B;  2KDI A;  3D8F A;  2EJ8 A;  2DN6 A;  1SGH A;  3AJ4 A;  1AYF A;  4RM8 A;  2JUO A;  2RUK B;  4W9E A;  1WI1 A;  2GCL A;  1D5M C;  1EF1 A;  2UU7 A;  2IPK D;  2YT2 A;  4P7I A;  3QIJ A;  2K8B A;  3ZNZ B;  4DHZ E;  1DDW A;  3EPY A;  2AL3 A;  2WXG A;  4ZRK A;  1BXT A;  2BCJ A;  2Q13 A;  4JE3 B;  4Z2M B;  3LJU X;  2QCZ A;  1V1P B;  2YVC A;  3DHG C;  3RNC C;  2NBU A;  1IYF A;  3TCA A;  1R4M B;  2WX0 A;  3NSU A;  4NQK E;  2LUM A;  3LB8 C;  4B95 A;  2JYT A;  4QAY A;  4PYU A;  5HI1 A;  4AJW A;  4LNO A;  3L17 A;  4RGN A;  1Q1O A;  1GG3 A;  2KD0 A;  4B9K A;  3B08 A;  1HXY D;  4TQ0 A;  4NAW A;  4IFS A;  1WGG A;  3CST A;  1FGY A;  2D9V A;  2QEJ C;  5HE1 A;  3H6N A;  1U27 A;  4L1R A;  3WYF B;  4GDL B;  4AOF A;  2RDH A;  2GCJ A;  2WXR A;  1S1Q B;  1F2R C;  1KLU D;  2GBK A;  2BWF A;  2WDR B;  4JIO U;  3BJI A;  3ZNG C;  1NDD A;  3PLV A;  1V88 A;  1XEE A;  2LGY A;  1SE3 A;  3P4S B;  3OLM D;  2IFS A;  1YNT E;  4ZRJ A;  3U30 A;  4EZK A;  3PSC A;  5T8I A;  2DYM A;  2RDB C;  2WXI A;  3OAW A;  5D3X A;  1X1M A;  3BIN A;  1TJ6 A;  3N32 A;  2WNM A;  3DPD A;  3DHI C;  2CHZ A;  3AEF B;  3DQV A;  4ZYN A;  4JKG B;  4US9 A;  3CIR B;  4EUT A;  2KTR B;  4W9K A;  4HAX B;  1KF6 B;  2NR2 A;  4R3D A;  5CHV C;  1ACA A;  5HE2 A;  1TBE A;  2ADZ A;  1JRO A;  3TW1 A;  1RWS A;  1V1O A;  1XF5 L;  1EUV B;  2KN4 A;  1E5W A;  1SIJ A;  5TR5 A;  1L0V B;  2Z4D A;  3P1M A;  4G11 A;  2ZZP B;  1K8R B;  1WMH B;  4M00 A;  1YN3 A;  2K2J A;  1WJU A;  2LBB A;  4PS7 A;  4MK0 A;  2BQQ A;  1MJD A;  1AWD A;  3KRX A;  1A5R A;  1ZW7 A;  3VDZ A;  5E6O A;  4GDL A;  1WR6 E;  5E6P A;  3M95 A;  2BYE A;  3AEB B;  1Q67 A;  4FXC A;  2QJL A;  4G0N B;  4JLC A;  1I4P A;  2MBE A;  3HRD D;  4MSM B;  2RNR B;  3TO1 A;  2K0P A;  5DIF B;  1WE6 A;  3BVM A;  3R7Q A;  4WJN A;  5KHO A;  5FI0 A;  3SFD B;  2YRY A;  3ENB A;  1RJ2 A;  3ML9 A;  1FD6 A;  2K9X A;  3B0A A;  4WAA A;  5LOP B;  3E9L A;  2FCQ A;  3NVZ A;  4K3C A;  5CTR C;  2J42 A;  3GB1 A;  2M19 A;  4W9G A;  1ZSQ A;  2KQ7 A;  4ACF A;  2GI9 A;  2WQY B;  1WRI A;  2LWP A;  2KC2 A;  3Q3F A;  4XDD A;  2V3S A;  2FNJ B;  3I3T B;  1P7E A;  4MAC A;  4A90 A;  1EGX A;  3R8B A;  5JH5 C;  1PLS A;  3MHZ A;  2ZJD A;  2AYO B;  1VZ8 A;  2Y8G A;  3Q8E A;  2JU6 X;  4KZC A;  5DPW A;  1FNW A;  5BMG A;  3IAS 1;  1DRO A;  4RMA A;  2JZP A;  4MH0 E;  1ZE3 D;  3RNG C;  3ZXR A;  1P3Q U;  3PRM B;  4ARI A;  2GUM A;  5LG4 B;  3L10 B;  3U4E G;  2BS2 B;  3GS2 A;  2WXM A;  3DVN U;  4HK2 A;  4MJS B;  4L23 A;  4J3O D;  4LNF A;  1PMS A;  4MGI E;  1IBX A;  4GU2 A;  1U5F A;  3W9C B;  2J0J A;  4A55 A;  2Y3A A;  4DXF A;  1WZ0 A;  4E74 A;  2WP9 B;  3N9Y C;  2LRU A;  3T3O A;  4JWU C;  2MFQ A;  3IVF A;  5J3Y A;  3QJZ A;  2RPQ A;  2R2O A;  2IJ0 A;  1B55 A;  2NTS A;  2WH5 A;  2OQB A;  2YS1 A;  1XT9 B;  2IGG A;  1YN5 A;  1WGY A;  1V97 A;  2CHW A;  5CLL B;  2LOX A;  4EMO A;  1YJ1 A;  3SFE B;  1UEF A;  1NTY A;  3DBR B;  4LLG M;  2O6V D;  1GC6 A;  1E7U A;  2NPT A;  2KDF B;  2VSZ A;  2QIL A;  4I6L B;  2XK5 B;  1P1A A;  1XCQ L;  1Z2M A;  4C4V B;  3RN9 C;  2PIA A;  3HUI A;  1ZYI A;  3IFW B;  4A6K A;  2L32 A;  4N6E B;  4FLH A;  2J59 M;  1WX8 A;  3ZTD A;  1VCB A;  4NZL B;  1V61 A;  1E0Z A;  3MC8 A;  1KJT A;  4UDU C;  3E66 A;  1SXT A;  2RRF A;  2COP A;  2PMV A;  2ABD A;  1VR9 A;  4K7U A;  2JRI B;  3NY5 A;  4MJS A;  5J18 A;  1YMH E;  2M0A A;  1E7P B;  3DBH I;  3NZS A;  2DYN A;  2MWS B;  4K81 A;  3L4P A;  2EKE C;  1XQQ A;  3MFG A;  2W2W A;  1GNU A;  1E7V A;  4YT0 B;  2HRJ A;  2Z0D B;  1J7A A;  2K8C A;  1F52 A;  4XE0 A;  5H8Y E;  3T8M A;  2KJR A;  1JWS D;  1MFW A;  2R61 A;  1VJK A;  4JX1 C;  2WLB A;  1QLB B;  3ZNH B;  3NWA A;  3ODO A;  4NJC A;  3BVG A;  4PK1 A;  5E6J A;  4A6F A;  1UNP A;  1P7F A;  1L6V A;  1ZC3 B;  2FBW B;  1TQZ A;  5JHG A;  5BMH A;  2NVU I;  3VQI A;  4HCP B;  2KKC A;  1SF0 A;  3F0W A;  4J6I A;  2XK5 A;  1SBB B;  3BYT B;  3IXS A;  2H7E A;  3ZNI D;  2DHZ A;  1TXD A;  2R2Y A;  2UWQ A;  3Q3J A;  1V80 A;  3E9S A;  3PS6 A;  4C7Y A;  5TSS A;  1SIF A;  3EUB 2;  3SBT A;  1I7A A;  1IPG A;  2IO0 B;  5C1Z A;  3APD A;  3HQC A;  2MWN B;  4WAF A;  5J2R A;  3GZN I;  4MGK E;  2KX0 A;  4P1B C;  2GOW A;  1EM7 A;  3UQA A;  5C5B A;  3SUZ A;  4XWW A;  3ZDM C;  3QQ8 B;  1WR1 A;  3AE9 B;  3MTN B;  2D3B A;  2H7D A;  2N9L A;  1NTV A;  2DFK A;  2KCJ A;  4KGT A;  2Q5W D;  3AM9 A;  2RR9 A;  3AE1 B;  4GDK B;  4JWS C;  2W3S A;  4NAM A;  1EAZ A;  5D7G A;  3P4Q B;  1BUI C;  2FCS A;  2MKR A;  2FUH B;  2M17 A;  3SD5 A;  5EDS A;  2RMM A;  2W9N A;  4ITK A;  4KHB A;  1TJE A;  2COC A;  3G9W A;  4GIV A;  3DBL I;  1J0G A;  1B9R A;  1GB4 A;  5LXH A;  3UI3 A;  2DIK A;  2LYD A;  2ASQ A;  2K1F A;  2QMT A;  4JQW C;  4HAV B;  3NJT A;  4X57 B;  3AEE B;  2VRW B;  4MSQ B;  3P4R B;  1GAQ B;  3L08 A;  3NS8 A;  2PE9 A;  1RLF A;  5EE9 A;  4B6H A;  3V6E B;  4WJ7 A;  3A4R A;  3ZVV A;  1PYW D;  3PLU A;  4Y94 A;  3CXB B;  2WXQ A;  3PP2 A;  2WXP A;  1HBK A;  1W1H A;  2J0M A;  1VZ6 A;  2IY0 B;  4WSF A;  3PVL A;  5KHQ A;  5D3V A;  3TEX A;  2G4D B;  3T3N A;  4ZYS A;  2N4F A;  3ODX A;  3AE6 B;  4BKS D;  3B9J A;  2C7H A;  2WU5 B;  1QOF A;  4WJP A;  5G2N A;  1F2R I;  3EFU A;  4CSQ A;  4TSS A;  1I7H A;  3AB5 A;  2G9H D;  3VUW A;  4BBK A;  3IT6 B;  3NG0 A;  4JKC A;  1FXA A;  1ZDX A;  1WGR A;  3O65 B;  3WA0 A;  1L7Y A;  3A9J A;  2QKL A;  1TGZ B;  4OVZ A;  3K9P B;  1P3R A;  5L95 C;  2K6D B;  2YS5 A;  2K39 A;  4BOS C;  3NWF A;  1X1G A;  1EVH A;  1ZM0 A;  2D5G A;  1IGD A;  1N5X A;  4IOI E;  3C19 A;  4ANX A;  1FPY A;  2L0T A;  2DAJ A;  2AWT A;  1GB1 A;  2FAZ A;  1FFV A;  1OQY A;  3ZJT A;  4N9F 4;  1C3T A;  2E3T A;  2LEK A;  2W82 A;  2GJY A;  1EU3 A;  2ZEQ A;  1C4P A;  2D3C A;  3HHM A;  3AUL A;  1DYQ A;  3BYY B;  2RSU A;  3R2I A;  1H4R A;  4USA A;  3AN1 A;  2FCM A;  2E2X A;  1VRA B;  1PGB A;  1XCT L;  3WAN A;  1JAL A;  3UF8 A;  2P8V A;  2KR0 A;  1K52 A;  1ZGU B;  1BAK A;  4JL9 A;  5DHF B;  3Q69 A;  1FNV A;  1UZX B;  1WXM A;  3JW0 X;  3R2T A;  1X05 A;  4IM0 A;  5JHB A;  3PO0 A;  2MJ3 A;  3P42 A;  4BFR A;  2W54 A;  2Z59 A;  1KM7 A;  1ZPS A;  4FJV B;  1LQB A;  1D6E C;  2IDY A;  3RNF C;  3U7Z A;  1C77 A;  2XQN M;  3O13 A;  3AMZ A;  4LK0 M;  1FEH A;  1N62 A;  4RNA A;  4GOU A;  3V3X A;  3VH4 B;  1VZ7 A;  1F77 A;  4MGY E;  3EGR A;  1AQC A;  1JWU D;  1JCK B;  5D3W A;  2P0H A;  3V60 A;  1ACC A;  2G1E A;  4B0E A;  3FVC A;  2QSD A;  3ML8 A;  3TIX A;  4C00 A;  3B2F A;  1YOV B;  1SHC A;  1WGD A;  1JWM D;  4A8X C;  4I6P A;  3X0W A;  1WSP A;  3H7P B;  2BGF A;  2NS5 A;  1WG7 A;  3F5R A;  2JSV X;  1W1G A;  1EWC A;  4P1C C;  3MDB C;  2RD0 A;  4K3B A;  1MIZ B;  4BBN C;  2KDB A;  1YJI A;  2KUP A;  3AI5 A;  2FE8 A;  3PT2 B;  5IA7 A;  4NAW B;  2GBR A;  2HJ1 A;  4PT5 A;  3DVG Y;  2WS3 B;  4HAY B;  3IAM 1;  3VOQ A;  1V81 A;  3PRZ A;  4ANU A;  2P0D A;  3DCG A;  2LOZ A;  5GMV A;  2OHF A;  5I4D A;  1U4A A;  2BYV E;  2D07 B;  2KXJ A;  3ONS A;  1ISN A;  1WH3 A;  3RZF A;  2Z13 A;  1ZKH A;  2A5U A;  1ZDV A;  4MT7 A;  4HHV A;  1U5E A;  4YSY B;  1WJM A;  2ZKM X;  4XDC A;  1CK1 A;  2Y8F A;  5KQ4 A;  2LAS A;  2ZVO A;  4YXD B;  2FIF A;  2JZ3 B;  2NCN A;  3H9D A;  4TKN A;  2MHJ A;  4JGH B;  3HVZ A;  4DHJ B;  2DKQ A;  2YEP F;  4ILH A;  2N1V A;  3H7P A;  4XGA B;  4YSX B;  3E9P A;  3VAW A;  1IUE A;  1FAO A;  2FJ9 A;  1SE2 A;  3KYC D;  4GB9 A;  4AWJ A;  1VBH A;  1DGJ A;  2KAJ A;  4WJO A;  5I2M A;  2MBQ A;  3NVW A;  3RNA C;  5KQ1 A;  3R3M A;  1GPX A;  3W1S C;  2Y7B A;  2V4L A;  1FRR A;  2MLB A;  3M62 B;  3TEZ A;  2WXO A;  4HCN B;  3UIN B;  5HG2 A;  2E6X A;  2LKO A;  1QOB A;  1KLG D;  3EFC A;  2Z8L A;  4KVG B;  1NEN B;  4TYZ A;  2Y5B B;  1JQ4 A;  1V5T A;  1C9F A;  2CU1 A;  2J7Q B;  1AWE A;  2PTL A;  3Q8A A;  4HPL B;  4HXD A;  1EU4 A;  2BYT A;  1JW9 D;  1Y19 B;  3JSV A;  5JXV A;  4XWX A;  2RGN B;  4JKD A;  2WDT B;  1NTI A;  3KW5 B;  3OWE B;  3CWI A;  2VKI A;  4IUM B;  5JP4 A;  3D8E A;  1YQ4 B;  4YTN B;  3HK0 A;  1C78 A;  3H8H A;  1WJ6 A;  3PHW B;  3R66 C;  4RGO S;  5BO4 B;  2LUE A;  2DZM A;  5IAA C;  1HE8 A;  2YEP B;  1I4R A;  4OZB A;  2X38 A;  4DBG A;  2AQ1 B;  2JY6 A;  2OJW A;  4M0W B;  5M4Y B;  2KK8 A;  1JDE A;  2PVO D;  4IOY X;  4JKF A;  1U5D A;  3ODW A;  1YX6 B;  3UIP B;  5FI1 A;  3L0W B;  1QQG A;  2QIE B;  3M3J A;  4HVB A;  2DHJ A;  5E6N A;  1V5O A;  2HE7 A;  4ARC A;  2LXC A;  1SJE D;  5BMI A;  1LGR A;  2X18 A;  2H89 B;  1H8C A;  4WQM A;  4YSZ B;  2MJD A;  1FXI A;  4Q2J A;  2R2Q A;  4AQ7 A;  1NI2 A;  3PEG A;  2BKR B;  2L05 A;  1KFY B;  2INP E;  1FCC C;  1UNR A;  3A58 A;  2KQ4 X;  2CJO A;  3UQB A;  1AN8 A;  3A8Q A;  2PE6 B;  2VZK B;  2EKI A;  2MBO A;  1L2N A;  1P5T A;  5BYQ A;  1DOX A;  2BKF A;  4HAW B;  1IBX B;  1V5U A;  4LDT D;  4F7Z A;  4TV3 A;  3OG5 A;  2BF8 B;  2IGD A;  2GMI C;  2K25 A;  2KOX A;  2I2Y A;  3L16 A;  2PJH A;  5G5G A;  4C7Z A;  4JK9 A;  2MP2 B;  2R82 A;  2BB5 A;  3H1U A;  1WGH A;  1WXQ A;  3P4P B;  5LNK 1;  1MAI A;  3L54 A;  4RH6 A;  2L2I A;  2CQU A;  1E90 A;  1XD3 B;  2KN5 A;  2ZCB A;  3KWL A;  3PVU A;  1R7S A;  2NBW B;  3UIO B;  1WXA A;  2N9P C;  3KSY A;  1N63 A;  2PVG C;  1I4Q A;  3SV1 A;  4ILG B;  4D2K A;  4W9C A;  3A98 B;  4M0W A;  1CZP A;  2K5P A;  4GMX B;  4XX5 A;  4DXG A;  1R4N I;  1G6J A;  3MJW A;  2NPT B;  4FN2 A;  2JPH A;  4MT5 A;  4W9D A;  4YTM B;  4CHM A;  3VR8 B;  4IKG A;  3TBL D;  3V62 A;  4AUQ C;  1KI1 B;  4GZU A;  1D3Z A;  4C0A A;  3DOW A;  1N3H A;  1PDX A;  1WWT A;  4II2 B;  4RGM A;  4URK A;  2GB1 A;  1V9J A;  3GOE A;  1T0R C;  2DAF A;  2KYW A;  3QWZ B;  1TS2 A;  2AEH A;  4FHK A;  1I4G A;  1DDM A;  2PEA A;  4BAX A;  3VUY A;  1FIQ A;  4LNK A;  2IYB A;  2JQR B;  2OED A;  3NUH B;  3PG7 A;  1LB1 A;  4JK8 A;  2CR5 A;  2SAK A;  2KNB A;  3NZ3 A;  2MP2 A;  3B1L X;  2MW5 A;  2IND C;  2CY4 A;  2YF0 A;  4GPT B;  1T0Y A;  3ALB A;  4DWF A;  4ZDV A;  1FXT B;  1TKE A;  5D6J B;  1WJN A;  1UEL A;  3SDL C;  4LNI A;  4GXB A;  1WF9 A;  2R09 A;  4EEW A;  3RI7 C;  2BYF A;  1SE9 A;  2HDE A;  2Y5C A;  2W55 A;  4A6F B;  1WJ4 A;  1EO6 A;  4DDI D;  1QOA A;  2I1K A;  2KIE A;  1TS4 A;  3PV1 A;  4EZJ A;  1F1H A;  1NBF C;  1WFY A;  4HDQ A;  1HTQ A;  3QHT A;  2SEB D;  2CRF A;  1NYR A;  2AQ3 B;  1V6E A;  4DBB A;  2ZPY A;  2V1Y A;  2NMB A;  2LI5 A;  3P7Z A;  4G50 A;  4FAD A;  2L8J A;  2DX1 A;  2UZR A;  5HE0 A;  3UZT A;  3Q2A C;  2JYE A;  3N20 C;  4KX6 B;  2V76 A;  1DBH A;  3PRE A;  2WDQ B;  3VTU A;  3AV8 A;  1OFF A;  2DBY A;  2MDX A;  2D2Q A;  5C5B B;  4BKT A;  1FHX A;  3DBS A;  4IAP A;  3CIK A;  1FOE A;  2N9E B;  2KVR A;  2JVC A;  2UZS A;  5FR3 A;  1XXG A;  1SEB D;  1BML C;  1UGM A;  5DPS A;  2KQS A;  3PHX B;  3BK1 A;  2FJL A;  1QOG A;  2IGH A;  5HKH A;  3BK2 A;  2KWD A;  1L0Y B;  4KHB B;  2X8X X;  1PFD A;  4WQO B;  1YIW A;  3RNB C;  4DK5 A;  1FHW A;  4RGT A;  5FR6 A;  5MPO A;  5D3Y A;  2A4Z A;  2DZK A;  3VRB B;  1KBL A;  4HDO A;  4KKI A;  4YTP B;  1UD7 A;  3HM6 X;  2KJH B;  3ZLZ A;  4BZA A;  2HD5 B;  3B2G A;  1SJH D;  2KDE B;  4RF0 A;  2V3N A;  1YX5 B;  2M8S A;  4HRO A;  1MPE A;  1MK9 B;  2HTM E;  2Z0O A;  2WGS A;  3FP5 A;  1JML A;  2ZPN A;  4ZHO A;  1WXV A;  4II3 B;  4S0R A;  4K2P A;  1TIF A;  1YN4 A;  2LGD A;  3ZGZ A;  3N1X C;  2COD A;  2N9K A;  1T5X D;  1I35 A;  2WHI A;  1SSN A;  3ETR A;  5IKC M;  2DHK A;  2D3G A;  3N7C A;  1KTK A;  2MQJ A;  1MK7 B;  2G35 A;  1X1F A;  3VUX A;  4F7H A;  2X0S A;  5GOW B;  2IO3 B;  3LJ3 A;  2O2V B;  2YS3 A;  4C80 A;  3DDC B;  4BVU C;  4ZRQ A;  4IWP A;  1FCL A;  3ZRF A;  2RGF A;  3RFZ B;  3ULC A;  1OEY J;  1PGX A;  2LG1 A;  4BKS A;  2G3Q B;  2ZCC A;  3BY4 B;  4B6W A;  4KSK C;  1XCG A;  3O96 A;  4JK7 A;  2WXH A;  1M7E A;  3ZVR A;  3ZTC A;  1TKG A;  3W5U B;  2AL6 A;  4W9H A;  3HW2 B;  1VD2 A;  1IP9 A;  3RCP A;  2V9H A;  3FM8 C;  3A9J B;  1OQQ A;  2ICI A;  2KGX B;  4GLS C;  1Y8R C;  3AE4 B;  4FHJ A;  2N0Y A;  2H88 B;  4RFB A;  4MEM A;  3DBH B;  5L81 A;  5IOI A;  3ULB A;  1JWB D;  5JVL A;  1E10 A;  4G3X B;  4IWO A;  4NJ6 A;  2W3R A;  2LRW A;  2KLC A;  1V2Y A;  2YLM A;  1KC7 A;  2JX5 A;  2PPH A;  3SYX A;  4A3P A;  3ZXV A;  3WAL A;  2JXX A;  3EA6 A;  3U12 A;  1RRP B;  1M7R A;  2ONQ A;  3SEB A;  1J7C A;  4WH4 A;  3K9O B;  2D9Z A;  3GP7 A;  2YT0 A;  2FCN A;  2O2V A;  1P98 A;  3NWD A;  2YT1 A;  4A6H A;  3TMP B;  5IRS A;  2M0X A;  5KCV A;  2MJE A;  4KZ0 A;  4NQL B;  5IN7 A;  1P9D U;  2HTH B;  2AQ2 B;  1WZ3 A;  2QHO A;  3AU4 A;  1GJZ A;  2Z59 B;  2N7E A;  4E71 A;  1WVH A;  2WWZ A;  4AJY B;  4EKU A;  3HSA A;  4MH8 A;  3ZJU A;  2VRR B;  3VFK A;  4M8M A;  1CQV A;  3RMK C;  1ZXI A;  2K22 A;  1TYG B;  2IZV B;  3GZN B;  3QCA A;  1BTN A;  3CF6 E;  2K8H A;  3ZDT A;  3DWG C;  5EE3 A;  1HZ6 A;  4KGS A;  3E9O A;  1WGK A;  4JKA A;  1WGQ A;  1WRD B;  4DQO C;  3QBV B;  4HJK A;  3PPA A;  2LMC A;  1T3Q A;  2KMA A;  3X23 A;  3OJ4 B;  4CHK A;  1GUA B;  2COA A;  1P0R A;  1QZE A;  1DIK A;  3ZIM A;  1U2B A;  4HB3 B;  4MM3 A;  1ENF A;  1HTO A;  4WIP A;  3DBL B;  5J3T A;  1NI3 A;  5D3I B;  3PRP B;  1I2H A;  4GGQ A;  1TS5 A;  1FO4 A;  2LUL A;  2WYQ A;  1XOD A;  1DOI A;  4FJZ A;  1V8C A;  1A70 A;  1TZ1 A;  2KC1 A;  2KMC A;  3RD2 A;  2K49 A;  4KV2 A;  3KLS X;  1AAR A;  2JRH A;  4F7G A;  1RYJ A;  2MA9 B;  4HAU B;  4HAT B;  2LHE A;  4PNK A;  5AZF A;  2HTH A;  2NMQ A;  4D6W A;  1CJE A;  5D3D A;  1FM0 D;  3DHH C;  4YL8 A;  2WXJ A;  2GS0 A;  1J7B A;  3HIZ A;  4MDK E;  3DXE A;  1Y56 A;  1OEY A;  1IRS A;  4L2Y A;  1YD8 U;  1WI0 A;  4RM9 A;  2PLP A;  1VBG A;  2CKH B;  4KSL C;  3IBE A;  1C1Y B;  3KYD D;  2M4N A;  2W2X C;  2KFJ A;  3I9V 1;  2CU3 A;  4ILJ A;  3NVY A;  4GN1 A;  2VH1 A;  5CX3 A;  1R4M I;  4AS1 A;  4S17 A;  2Z14 A;  2AX5 A;  1ET9 A;  1V86 A;  1V49 A;  2RVB B;  1Q5W B;  2GRI A;  2KWU B;  4HEA 1;  4KGR A;  2KO3 A;  3KRW A;  3KZ1 A;  3QAQ A;  3P6A A;  4HPM B;  3IT4 B;  4EE2 A;  3GYO A;  5HE3 A;  4JPS A;  4A3O A;  1AW7 A;  1DOY A;  4EOY A;  3RYT A;  1MHX A;  3APC A;  1TY0 A;  1OQR A;  2OOB B;  5EE1 A;  1D4B A;  1TTN A;  2MRP A;  3QAR A;  2CAY A;  3R7R A;  3BZD B;  3BII D;  5J17 A;  2IY1 B;  4ANV A;  3NRZ A;  3VRA B;  2WXK A;  3KUC B;  1IGC A;  4GMV A;  3LXF A;  4WJQ A;  1XO3 A;  2Z0E B;  2IYD B;  2RQ1 A;  2MEK A;  2RPV A;  1WM3 A;  1QKZ A;  1RM6 C;  3JSV B;  4LDT B;  3Q3N C;  5C79 A;  1GC7 A;  1I4X A;  2D9X A;  3IG3 A;  1JRP A;  2EMT A;  3BWU D;  4HJG E;  2TSS A;  1UH6 A;  3ZUN A;  3E56 A;  2WDV B;  2DEN B;  2IO1 B;  1SB3 C;  2EC1 A;  5JLJ B;  2PW9 A;  5DH9 B;  4K7S A;  3VXW A;  2KZR A;  2BS4 B;  2MBB B;  1MPH A;  4DX8 A;  5LLI A;  3FIL B;  4NY0 A;  2BTE A;  4DIX A;  1WM2 A;  5CLQ B;  3GE8 C;  4O1N A;  2DYO A;  2GBN A;  2MCN B;  1K53 A;  2V4I B;  2QKM A;  5IO9 A;  1GGO A;  4CHJ A;  2REX A;  2BW2 A;  4A6Q A;  5BYS A;  1XLQ A;  4KIK B;  4HB2 B;  1ZUD 2;  1NVL A;  4W9L A;  4I6N B;  3C8Y A;  3VTW A;  3KY9 A;  3MJ5 A;  2ROV A;  5CHF A;  2XN9 C;  5GXG B;  3M63 B;  1MI1 A;  1J8C A;  3GYP A;  3OJ3 A;  5D2M B;  2N7J A;  2L76 A;  3SR6 A;  2LHD A;  4DHZ B;  2I1J A;  3Q8B A;  4PS3 A;  2NZ8 B;  1OY2 A;  3SU8 X;  2KX3 A;  3ZW3 A;  3QA8 A;  3ZRC A;  3DVG X;  3ZJV A;  2N1W A;  2C7N B;  3JVZ X;  3RPF C;  2I5F A;  2R0D A;  3QC8 B;  1U29 A;  2VH2 A;  1OMW A;  4KHO A;  1C4A A;  2WXF A;  4K1R B;  4HKQ A;  1RAX A;  4FBJ B;  1UF0 A;  1FFU A;  5HHD G;  4US8 A;  5JHA A;  2J4X A;  3JYU A;  1QC6 A;  3C0R B;  1NU2 A;  2M1M A;  2DHI A;  4OZA A;  1CMX B;  3U8Z A;  4IW0 A;  3KQ4 A;  3WAM A;  3QWM A;  2OJR A;  2WU2 B;  3EC8 A;  2FJU B;  3FIL A;  5DPR A;  3AE8 B;  1H10 A;  4Z2N A;  2IBI B;  2XNA C;  3EEC A;  1PFJ A;  2C7M B;  4CO7 A;  2O6V B;  4MGZ E;  1MG8 A;  1XR0 B;  3NOB A;  4CQN A;  1HEZ E;  4W9F A;  4IDI A;  4KIK A;  2MH7 A;  1E6E B;  4NSW A;  2M14 A;  1STE A;  1FB8 A;  4RF1 A;  2COF A;  1V1P A;  3ENE A;  5LON B;  3PSE B;  2D4Q A;  4GNK B;  4ANW A;  1L0X B;  1XLO A;  2YSZ A;  5D27 A;  2INN E;  2QDF A;  2CY5 A;  4LJO B;  1PQS A;  3A33 B;  2LD9 A;  1F9J A;  3DWM A;  2DX5 B;  4HKZ E;  3PZ8 A;  1FGZ A;  3A8P A;  2RDG A;  4ZRI A;  4YWG G;  3TUO A;  2G4S A;  5AUK A;  2CS4 A;  2LGX A;  1N61 A;  1ZC4 B;  2K6Q A;  1S3S G;  4RCO A;  3FEH A;  4LJP B;  4TMA B;  3AH7 A;  3TJP A;  2ZW1 A;  1D5X C;  3DBR I;  2N9X A;  4EZL A;  2J53 A;  4E3C A;  1T0Q C;  2LGI A;  3N1Z C;  1RRB A;  2D9Y A;  3L13 A;  1UWM A;  3RT3 B;  4NNJ B;  5G55 A;  2GLS A;  3AEA B;  1M4V A;  2L83 A;  3FLV A;  2RLO A;  1LO5 D;  2O6V A;  1ROE A;  1WE7 A;  1UBI A;  1MKE A;  3RUI B;  4DHJ D;  2DWQ A;  4JKG A;  1I4H A;  1L4D B;  2KTR A;  4QJ5 B;  3P63 A;  3M1I B;  2D3A A;  3VVW B;  2K8E A;  3RUL A;  1K50 A;  2D9W A;  2JZZ A;  4OSN A;  3A9K B;  2ON8 A;  3WIM A;  1WYW B;  3AEC B;  2DX5 A;  4KDI C;  1C79 A;  1WMH A;  2N7D A;  4OT1 A;  3ZQ4 A;  3T06 A;  4OVV A;  3AE5 B;  3APF A;  3TFM A;  1T0S C;  3AE2 B;  4BOZ B;  1UWX A;  5JHH A;  4ASW C;  4GOC A;  1WX7 A;  3FSS A;  4MEL A;  3BVZ A;  4WUR A;  2I38 A;  4ICV A;  3NZU A;  2KHW B;  2L52 A;  2GBJ A;  1K5G B;  4K7W A;  4WWO A;  2ZW0 A;  2KT7 A;  4WWN A;  2KTF A;  2EMS A;  3V6C B;  3FKY A;  4HRS A;  2MBH A;  4HWI B;  2M38 A;  2RSG A;  3P2B A;  2LJI A;  1Q10 A;  4PS8 A;  3OAN A;  4K2O A;  5AZH A;  4A9A A;  3HVD A;  3FC4 A;  1EF5 A;  3SHQ A;  4WVF B;  1KLV A;  3RNE C;  4ZHP A;  1WIA A;  1E8Z A;  3DXC A;  3KVF B;  3IHP C;  3PGE A;  1L6U A;  5C3J B;  1MI0 A;  2OTX A;  3CSF A;  3DXD A;  5AUI A;  3A9K A;  3ML4 A;  1NEK B;  3QX1 A;  1VLB A;  4H8S A;  3NVV A;  4L1B A;  3MC0 B;  3A4S C;  3PVW A;  4DDG D;  3EHV A;  1Z5S B;  1V89 A;  1EWY C;  1R4N B;  2CJN A;  3D32 A;  1ST7 A;  3UGB B;  4IG7 B;  2UVM A;  3TVV A;  1FNU A;  5CHW A;  4NPN A;  1UPQ A;  5EFX A;  1ESF A;  3CMM B;  1Y5O A;  3AED B;  1UPR A;  2J0K A;  2VZK D;  2C9W B;  5D94 A;  1HB8 A;  1ZOY B;  1C4C A;  3WAP A;  3U2S C;  3V5W A;  1KH0 A;  3KUZ A;  2NTT A;  2LZ6 A;  4A20 A;  2L0F A;  1FHO A;  4M02 A;  1V5P A;  5H92 C;  5IJM A;  3AEG B;  4FA6 A;  4PQ0 A;  3HM3 A;  1PGA A;  3MHS D;  1RFK A;  1N60 A;  1TZO A;  3VIA A;  2D11 A;  4HAZ B;  3U7D A;  5LXI B;  1KZG A;  4OZC A;  3T9L A;  2KJ6 A;  3I57 A;  3AE3 B;  2L1C A;  4YON A;  1E8W A;  3U52 E;  4XYC A;  1TKY A;  4DX9 0;  2JWU A;  3RZW C;  1BWN A;  2KIG A;  1HZ5 A;  4KDL B;  2B3A A;  2HJ8 A;  1M94 A;  1L4Z B;  2ELA A;  3SBG A;  1E8Y A;  1T77 A;  2XBB C;  2BB6 A;  3LYY A;  4XZ4 A;  3NS1 A;  1MIX A;  4QJ3 B;  2WX1 A;  3URY A;  4JKE A;  1OTR B;  5DPT A;  2L7R A;  4C4V A;  3Q3M C;  3A1Q B;  4DXA B;  1WX9 A;  5EE0 A;  2DYQ A;  4KKJ A;  1JWA D;  3ABV B;  3SNH A;  5C6R A;  2KUQ A;  2BT6 A;  1Q0W B;  4OW0 A;  2LGS A;  5G5H A;  2ZNV B;  1D5Z C;  4WWM A;  1LXD A;  5C23 A;  3WCQ A;  4ZOH C;  2Z0P A;  1LM8 B;  1UUP A;  2I5C A;  2DYB A;  4CYE A;  4WWP A;  4BBN F;  3KH0 A;  1RFA A;  1OGW A;  3B77 A;  2KMM A;  2CHX A;  3PTF C;  2LVO A;  3DVN V;  2ROZ B;  2XEW A;  1DDV A;  1U5G A;  4KHA A;  2QC8 A;  3KWV A;  1TY2 A;  5DCN A;  5AZG A;  1XLN A;  4BKG A;  2JWZ A;  2MX2 A;  4HB0 B;  1FRD A;  1BT0 A;  2KWC A;  1B1Z A;  1C76 A;  2DNF A;  5BYR A;  1XD4 A;  2D10 A;  1W1D A;  1PUT A;  2K2U A;  4MM3 B;  1XX0 A;  1QF6 A;  3VHT C;  4F1S A;  1NYQ A;  4EFO A;  4ICU A;  3N1Y C;  2KVZ A;  2WXL A;  3TSS A;  4REZ A;  2Y5P A;  4A5K A;  2NBV B;  2INC C;  3I63 C;  4HSI A;  2JXT A;  2V3P A;  2LJ5 A;  2WXN A;  3A1Q A;  4TQ1 A;  4NJ7 A;  1V5M A;  2DKP A;  1X11 A;  5I2S A;  1KRH A;  3LDZ E;  2L3Z A;  2JP2 A;  2BWE S;  4M8N A;  3Q8C A;  3Q14 C;  1ET6 A;  1J0W A;  1QQR A;  1VDV A;  1BTK A;  3VTV A;  3S2A A;  2G45 B;  4HPP A;  2FDQ A;  2LVP A;  5C16 A;  3OHM B;  2K3U A;  4W9I A;  2FUG 1;  3Q6B A;  2K00 A;  1KZ7 A;  4IM3 A;  1WJ1 A;  1MG4 A;  2UYZ B;  4GDK A;  3J9C A;  2C60 A;  3SO6 A;  1HB6 A;  4KAX B;  1WYG A;  4AP4 C;  3ZO5 B;  3Q8F A;  3QK0 A;  1XKE A;  1I42 A;  1ZXH A;  1YQ3 B;  2IO2 B;  1X86 A;  1HQR D;  4XWT A;  2DZI A;  4HB4 B;  2PZ1 A;  3V61 A;  3ZKJ C;  2LXA A;  1TT5 B;  3RCZ A;  4OHJ A;  4IWQ A;  3W2D A;  4LCD E;  3PZ7 A;  5DI9 B;  2NBV A;  3ZYY X;  1NVI D;  1Z87 A;  2C5L C;  1UGJ A;  2V0G A;  1UNQ A;  2BPS A;  2L1A A;  2ZNV C;  4QJ4 B;  2N23 A;  3TEW A;  1FMA D;  4K17 A;  2B76 B;  4GSW A;  3WAO A;  1JRU A;  1T6B X;  3N30 A;  5FK9 C;  1OQN A;  2BS3 B;  1UNS A;  4P16 A;  2KAN A;  3Q3O C;  2DLW A;  1LFD A;  3KUD B;  1TS3 A;  1YQB A;  3AXC A;  3VH3 B;  4FUL A;  3I5J C;  3DCX A;  4TUU A;  4C56 C;  5AEK B;  4IM2 A;  2KFK B;  1ZP0 B;  3V05 A;  1N5W A;  3D8D A;  2KAC A;  1UBQ A;  4F7U P;  2JT4 B;  1J19 A;  1DYN A;  3N3K B;  3AU5 A;  2DLB A;  2EEL A;  5J3Q A;  4W9J A;  2ELB A;  3AE7 B;  3MP9 A;  2GBM A;  2DTC A;  1MHH E;  5C2T B;  5L83 A;  2DA0 A;  1F0Z A;  2FID A;  1N6Z A;  4QXA B;  1ZVR A;  3FAH A;  3MC9 A;  3TL5 A;  2L00 B;  2LVQ A;  3HIE A;  4B0M A;  2N0S B;  4FJY A;  1SE4 A;  2JF5 A;  2ACZ B;  4XC2 A;  4IC7 B;  2W2X D;  3ECI A;  4HLE A;  4ZRP A;  4F8C B;  1WXS A; 
#chains in the Genus database with same CATH homology
 3MPX A;  4JKH A;  4PYZ A;  5DHA B;  2P0F A;  4D0N B;  1LW3 A;  2KLG A;  2KWV B;  4JKB A;  2DZJ A;  4EJN A;  1K5D B;  1E8X A;  3NHE B;  2MSE D;  3PZD A;  2CB8 A;  5JZE B;  4MY6 A;  2KFK A;  4OVU A;  2ZVN A;  3H7S A;  4L6E A;  3W1S A;  1KOT A;  1P6S A;  3W1Y A;  2Z0Q A;  1WGU A;  1WY8 A;  2KDI A;  3D8F A;  2EJ8 A;  2DN6 A;  1SGH A;  3AJ4 A;  4RM8 A;  2JUO A;  2RUK B;  4W9E A;  1WI1 A;  2GCL A;  1EF1 A;  4P7I A;  3QIJ A;  2K8B A;  3ZNZ B;  4DHZ E;  1DDW A;  3EPY A;  2AL3 A;  4ZRK A;  2BCJ A;  2Q13 A;  4Z2M B;  3LJU X;  2YVC A;  2NBU A;  1IYF A;  3TCA A;  2WX0 A;  3NSU A;  4NQK E;  4B95 A;  4PYU A;  4AJW A;  3L17 A;  1Q1O A;  1GG3 A;  2KD0 A;  4B9K A;  3B08 A;  4TQ0 A;  4NAW A;  4IFS A;  1WGG A;  3CST A;  1FGY A;  2D9V A;  5HE1 A;  3H6N A;  1U27 A;  3WYF B;  4GDL B;  4AOF A;  2GCJ A;  1S1Q B;  2GBK A;  2BWF A;  4JIO U;  3BJI A;  3ZNG C;  1NDD A;  3PLV A;  1V88 A;  2LGY A;  3OLM D;  2IFS A;  4ZRJ A;  3U30 A;  4EZK A;  3PSC A;  2DYM A;  3OAW A;  5D3X A;  1X1M A;  3BIN A;  1TJ6 A;  3N32 A;  3DPD A;  2CHZ A;  3DQV A;  4ZYN A;  4JKG B;  4EUT A;  2KTR B;  4W9K A;  4HAX B;  2NR2 A;  5CHV C;  1ACA A;  5HE2 A;  1TBE A;  2ADZ A;  3TW1 A;  1EUV B;  1E5W A;  5TR5 A;  4G11 A;  2ZZP B;  1K8R B;  1WMH B;  2K2J A;  1WJU A;  2LBB A;  4PS7 A;  4MK0 A;  3KRX A;  1A5R A;  1ZW7 A;  3VDZ A;  5E6O A;  4GDL A;  1WR6 E;  5E6P A;  3M95 A;  2BYE A;  1Q67 A;  4G0N B;  4JLC A;  2MBE A;  4MSM B;  2RNR B;  3TO1 A;  5DIF B;  1WE6 A;  3R7Q A;  4WJN A;  5KHO A;  5FI0 A;  2YRY A;  3ENB A;  1RJ2 A;  3ML9 A;  3B0A A;  4WAA A;  5LOP B;  3E9L A;  2FCQ A;  5CTR C;  4W9G A;  1ZSQ A;  2KQ7 A;  2LWP A;  2KC2 A;  3Q3F A;  2V3S A;  2FNJ B;  3I3T B;  1EGX A;  5JH5 C;  1PLS A;  2ZJD A;  2AYO B;  2Y8G A;  4KZC A;  5DPW A;  1DRO A;  4RMA A;  4MH0 E;  1P3Q U;  3PRM B;  3L10 B;  3DVN U;  4HK2 A;  4MJS B;  4MGI E;  1PMS A;  4GU2 A;  1U5F A;  2J0J A;  1WZ0 A;  4E74 A;  2LRU A;  2MFQ A;  3IVF A;  5J3Y A;  3QJZ A;  2RPQ A;  2R2O A;  1B55 A;  2WH5 A;  2OQB A;  2YS1 A;  1XT9 B;  1WGY A;  2CHW A;  5CLL B;  2LOX A;  4EMO A;  1YJ1 A;  1UEF A;  1NTY A;  2O6V D;  1GC6 A;  1E7U A;  2NPT A;  2KDF B;  2VSZ A;  4I6L B;  2XK5 B;  1P1A A;  1Z2M A;  3IFW B;  4A6K A;  4FLH A;  2J59 M;  1WX8 A;  3ZTD A;  1VCB A;  1V61 A;  1KJT A;  3E66 A;  2COP A;  2ABD A;  4K7U A;  2JRI B;  3NY5 A;  4MJS A;  5J18 A;  3DBH I;  3NZS A;  2DYN A;  2MWS B;  4K81 A;  2EKE C;  1XQQ A;  2W2W A;  1GNU A;  1E7V A;  2HRJ A;  2Z0D B;  2K8C A;  3T8M A;  2KJR A;  3ZNH B;  3ODO A;  4A6F A;  1UNP A;  1ZC3 B;  1TQZ A;  5JHG A;  2NVU I;  3VQI A;  4HCP B;  2KKC A;  3F0W A;  4J6I A;  2XK5 A;  2H7E A;  3ZNI D;  2DHZ A;  1TXD A;  2UWQ A;  3Q3J A;  1V80 A;  3PS6 A;  1SIF A;  3SBT A;  1I7A A;  1IPG A;  2IO0 B;  5C1Z A;  3APD A;  3HQC A;  2MWN B;  5J2R A;  3GZN I;  4MGK E;  2KX0 A;  2GOW A;  3UQA A;  5C5B A;  3SUZ A;  3ZDM C;  3QQ8 B;  1WR1 A;  3MTN B;  2H7D A;  1NTV A;  2DFK A;  2KCJ A;  2RR9 A;  4GDK B;  1EAZ A;  5D7G A;  2FCS A;  2MKR A;  2FUH B;  2M17 A;  3SD5 A;  5EDS A;  2W9N A;  2COC A;  3G9W A;  4GIV A;  3DBL I;  1J0G A;  5LXH A;  2DIK A;  2LYD A;  2ASQ A;  2K1F A;  4JQW C;  4HAV B;  4X57 B;  2VRW B;  4MSQ B;  3L08 A;  3NS8 A;  2PE9 A;  1RLF A;  4B6H A;  3V6E B;  3A4R A;  4WJ7 A;  3ZVV A;  3PLU A;  4Y94 A;  3CXB B;  3PP2 A;  1HBK A;  1W1H A;  2J0M A;  2IY0 B;  4WSF A;  3PVL A;  5KHQ A;  5D3V A;  2G4D B;  2N4F A;  3ODX A;  4BKS D;  2C7H A;  5G2N A;  4WJP A;  3EFU A;  3VUW A;  4BBK A;  4JKC A;  1WGR A;  3O65 B;  3WA0 A;  1L7Y A;  3A9J A;  2QKL A;  1TGZ B;  3K9P B;  1P3R A;  5L95 C;  2K6D B;  2YS5 A;  2K39 A;  4BOS C;  1X1G A;  1EVH A;  1ZM0 A;  4ANX A;  2L0T A;  2DAJ A;  2AWT A;  2FAZ A;  1OQY A;  4N9F 4;  1C3T A;  2GJY A;  2ZEQ A;  3HHM A;  3AUL A;  2RSU A;  1H4R A;  2FCM A;  2E2X A;  3WAN A;  3UF8 A;  2P8V A;  1ZGU B;  1BAK A;  4JL9 A;  5DHF B;  1UZX B;  1WXM A;  3JW0 X;  1X05 A;  4IM0 A;  5JHB A;  4BFR A;  1KM7 A;  4FJV B;  1LQB A;  2XQN M;  3VH4 B;  4MGY E;  1AQC A;  5D3W A;  2P0H A;  3V60 A;  3ML8 A;  3TIX A;  1SHC A;  1WGD A;  4I6P A;  3X0W A;  3H7P B;  2BGF A;  2NS5 A;  1WG7 A;  3F5R A;  1W1G A;  3MDB C;  2RD0 A;  1MIZ B;  4BBN C;  2KDB A;  2KUP A;  3AI5 A;  3PT2 B;  5IA7 A;  4NAW B;  2GBR A;  3DVG Y;  4HAY B;  3VOQ A;  1V81 A;  3PRZ A;  4ANU A;  2P0D A;  3DCG A;  2LOZ A;  5GMV A;  1U4A A;  2BYV E;  2D07 B;  2KXJ A;  3ONS A;  1ISN A;  1WH3 A;  3RZF A;  1ZKH A;  2A5U A;  4MT7 A;  4HHV A;  1U5E A;  1WJM A;  2Y8F A;  5KQ4 A;  2LAS A;  2ZVO A;  2FIF A;  2JZ3 B;  2NCN A;  3H9D A;  4TKN A;  4JGH B;  4DHJ B;  2DKQ A;  4ILH A;  2N1V A;  3H7P A;  3E9P A;  3VAW A;  1FAO A;  2FJ9 A;  3KYC D;  4GB9 A;  4AWJ A;  1VBH A;  4WJO A;  2MBQ A;  5KQ1 A;  3R3M A;  3W1S C;  2Y7B A;  2V4L A;  2MLB A;  3M62 B;  4HCN B;  3UIN B;  2LKO A;  4KVG B;  4TYZ A;  2Y5B B;  1V5T A;  2CU1 A;  2J7Q B;  1AWE A;  4HPL B;  4HXD A;  1Y19 B;  3JSV A;  4XWX A;  2RGN B;  4JKD A;  2WDT B;  1NTI A;  3KW5 B;  4IUM B;  2VKI A;  5JP4 A;  3D8E A;  3HK0 A;  1WJ6 A;  3PHW B;  3R66 C;  5BO4 B;  2LUE A;  2DZM A;  5IAA C;  1HE8 A;  4DBG A;  2JY6 A;  4M0W B;  2KK8 A;  1JDE A;  4IOY X;  4JKF A;  1U5D A;  3ODW A;  1YX6 B;  3UIP B;  5FI1 A;  3L0W B;  1QQG A;  3M3J A;  4HVB A;  2DHJ A;  5E6N A;  1V5O A;  2HE7 A;  2LXC A;  2X18 A;  1H8C A;  2R2Q A;  1NI2 A;  3PEG A;  2BKR B;  2L05 A;  1UNR A;  3UQB A;  3A8Q A;  2PE6 B;  2MBO A;  1L2N A;  1P5T A;  2BKF A;  4HAW B;  1V5U A;  4LDT D;  4F7Z A;  4TV3 A;  2BF8 B;  2GMI C;  2K25 A;  2KOX A;  3L16 A;  2PJH A;  4JK9 A;  2MP2 B;  2R82 A;  3H1U A;  1WGH A;  1MAI A;  3L54 A;  2L2I A;  2CQU A;  1E90 A;  1XD3 B;  2KN5 A;  2ZCB A;  3PVU A;  2NBW B;  3UIO B;  1WXA A;  2N9P C;  3KSY A;  3SV1 A;  4ILG B;  4W9C A;  3A98 B;  4GMX B;  4XX5 A;  1R4N I;  1G6J A;  3MJW A;  2NPT B;  4FN2 A;  2JPH A;  4W9D A;  4CHM A;  3TBL D;  3V62 A;  4AUQ C;  1KI1 B;  4GZU A;  1D3Z A;  4C0A A;  3DOW A;  1N3H A;  4II2 B;  4URK A;  1V9J A;  3GOE A;  2DAF A;  3QWZ B;  2AEH A;  4FHK A;  1DDM A;  2PEA A;  3VUY A;  2IYB A;  3PG7 A;  1LB1 A;  4JK8 A;  2CR5 A;  2KNB A;  2MP2 A;  3B1L X;  2MW5 A;  2CY4 A;  2YF0 A;  4GPT B;  1T0Y A;  3ALB A;  4DWF A;  4ZDV A;  1FXT B;  5D6J B;  1WJN A;  1UEL A;  3SDL C;  4GXB A;  1WF9 A;  2R09 A;  4EEW A;  2BYF A;  1SE9 A;  4A6F B;  1WJ4 A;  1EO6 A;  4DDI D;  2I1K A;  3PV1 A;  4EZJ A;  1NBF C;  1WFY A;  4HDQ A;  3QHT A;  2CRF A;  1V6E A;  4DBB A;  2V1Y A;  2ZPY A;  2NMB A;  2LI5 A;  3P7Z A;  4G50 A;  4FAD A;  2L8J A;  2DX1 A;  2UZR A;  5HE0 A;  3UZT A;  2V76 A;  1DBH A;  3PRE A;  3VTU A;  2MDX A;  2D2Q A;  5C5B B;  4BKT A;  1FHX A;  3DBS A;  4IAP A;  3CIK A;  1FOE A;  2N9E B;  2KVR A;  2JVC A;  2UZS A;  1UGM A;  5DPS A;  2KQS A;  3PHX B;  2FJL A;  5HKH A;  4KHB B;  4WQO B;  1YIW A;  4DK5 A;  1FHW A;  5FR6 A;  5D3Y A;  2A4Z A;  2DZK A;  1KBL A;  4HDO A;  1UD7 A;  3HM6 X;  2KJH B;  3ZLZ A;  2HD5 B;  2KDE B;  1YX5 B;  2M8S A;  1MK9 B;  2Z0O A;  3FP5 A;  2ZPN A;  1WXV A;  4II3 B;  4K2P A;  2LGD A;  2COD A;  1I35 A;  2DHK A;  2D3G A;  3N7C A;  2MQJ A;  1MK7 B;  2G35 A;  1X1F A;  3VUX A;  4F7H A;  2X0S A;  5GOW B;  2IO3 B;  3LJ3 A;  2O2V B;  2YS3 A;  3DDC B;  4BVU C;  4IWP A;  3ZRF A;  2RGF A;  3ULC A;  1OEY J;  2LG1 A;  4BKS A;  2G3Q B;  2ZCC A;  3BY4 B;  4B6W A;  4KSK C;  1XCG A;  3O96 A;  4JK7 A;  3ZTC A;  1M7E A;  3ZVR A;  2AL6 A;  4W9H A;  3HW2 B;  1VD2 A;  1IP9 A;  3RCP A;  3FM8 C;  3A9J B;  2KGX B;  1Y8R C;  4FHJ A;  2N0Y A;  4MEM A;  5L81 A;  3ULB A;  5JVL A;  4G3X B;  4IWO A;  4NJ6 A;  2LRW A;  2KLC A;  1V2Y A;  2YLM A;  1KC7 A;  2PPH A;  3SYX A;  4A3P A;  3WAL A;  2JXX A;  1RRP B;  1M7R A;  3K9O B;  2D9Z A;  2YT0 A;  2FCN A;  2O2V A;  1P98 A;  2YT1 A;  4A6H A;  3TMP B;  2M0X A;  5KCV A;  4KZ0 A;  4NQL B;  1P9D U;  2HTH B;  1WZ3 A;  2QHO A;  3AU4 A;  1GJZ A;  2Z59 B;  2N7E A;  4E71 A;  1WVH A;  2WWZ A;  4AJY B;  4EKU A;  2VRR B;  3VFK A;  4M8M A;  2IZV B;  3QCA A;  1BTN A;  3CF6 E;  2K8H A;  3ZDT A;  3E9O A;  4JKA A;  1WGQ A;  1WRD B;  3QBV B;  4HJK A;  3PPA A;  2KMA A;  3X23 A;  3OJ4 B;  4CHK A;  1GUA B;  2COA A;  1P0R A;  1QZE A;  1DIK A;  3ZIM A;  1U2B A;  4HB3 B;  4MM3 A;  5J3T A;  3PRP B;  1I2H A;  4GGQ A;  2LUL A;  2WYQ A;  1XOD A;  4FJZ A;  1TZ1 A;  2KC1 A;  2KMC A;  3RD2 A;  4KV2 A;  1AAR A;  2JRH A;  4F7G A;  2MA9 B;  4HAU B;  4HAT B;  5AZF A;  4PNK A;  2HTH A;  4YL8 A;  2GS0 A;  3HIZ A;  4MDK E;  3DXE A;  1OEY A;  1IRS A;  1YD8 U;  1WI0 A;  4RM9 A;  1VBG A;  2CKH B;  4KSL C;  3IBE A;  1C1Y B;  3KYD D;  2M4N A;  2W2X C;  2KFJ A;  4ILJ A;  4GN1 A;  5CX3 A;  1R4M I;  1V86 A;  1V49 A;  2RVB B;  1Q5W B;  2KWU B;  2KO3 A;  3KRW A;  3KZ1 A;  3QAQ A;  3P6A A;  4HPM B;  3GYO A;  5HE3 A;  4A3O A;  4EOY A;  3RYT A;  3APC A;  2OOB B;  1TTN A;  2MRP A;  3QAR A;  2CAY A;  3R7R A;  5J17 A;  2IY1 B;  4ANV A;  3KUC B;  4GMV A;  4WJQ A;  2Z0E B;  2IYD B;  2RQ1 A;  1WM3 A;  3JSV B;  4LDT B;  5C79 A;  1GC7 A;  2D9X A;  3IG3 A;  2EMT A;  1UH6 A;  3ZUN A;  2DEN B;  2IO1 B;  2EC1 A;  5JLJ B;  5DH9 B;  4K7S A;  3VXW A;  2KZR A;  2MBB B;  1MPH A;  4DX8 A;  5LLI A;  4NY0 A;  1WM2 A;  5CLQ B;  2DYO A;  2GBN A;  2MCN B;  2QKM A;  1GGO A;  4CHJ A;  2REX A;  4KIK B;  4HB2 B;  1NVL A;  4W9L A;  4I6N B;  3VTW A;  3KY9 A;  2ROV A;  5CHF A;  3M63 B;  1J8C A;  3GYP A;  3OJ3 A;  5D2M B;  2L76 A;  4DHZ B;  2I1J A;  4PS3 A;  2NZ8 B;  1OY2 A;  3SU8 X;  2KX3 A;  3ZW3 A;  3QA8 A;  3ZRC A;  3DVG X;  2N1W A;  2C7N B;  3JVZ X;  2I5F A;  2R0D A;  3QC8 B;  1U29 A;  1OMW A;  4KHO A;  4K1R B;  1RAX A;  4FBJ B;  5JHA A;  3JYU A;  1QC6 A;  3C0R B;  1NU2 A;  2M1M A;  2DHI A;  1CMX B;  3U8Z A;  4IW0 A;  3WAM A;  3QWM A;  2OJR A;  3EC8 A;  5DPR A;  1H10 A;  4Z2N A;  2IBI B;  3EEC A;  1PFJ A;  2C7M B;  4CO7 A;  2O6V B;  4MGZ E;  1MG8 A;  1XR0 B;  3NOB A;  4W9F A;  4KIK A;  4NSW A;  2M14 A;  1FB8 A;  2COF A;  3ENE A;  5LON B;  3PSE B;  2D4Q A;  4ANW A;  2YSZ A;  5D27 A;  2CY5 A;  4LJO B;  1PQS A;  3A33 B;  2LD9 A;  1F9J A;  2DX5 B;  1FGZ A;  3A8P A;  4ZRI A;  2G4S A;  2CS4 A;  2LGX A;  1ZC4 B;  2K6Q A;  1S3S G;  3FEH A;  4LJP B;  3TJP A;  3DBR I;  2N9X A;  4EZL A;  4E3C A;  1RRB A;  2D9Y A;  3L13 A;  3RT3 B;  4NNJ B;  5G55 A;  3FLV A;  2RLO A;  2O6V A;  1WE7 A;  1UBI A;  1MKE A;  3RUI B;  4DHJ D;  4JKG A;  2KTR A;  3M1I B;  3VVW B;  3RUL A;  2D9W A;  2JZZ A;  3A9K B;  3WIM A;  1WYW B;  2DX5 A;  4KDI C;  1WMH A;  2N7D A;  3T06 A;  4OVV A;  4BOZ B;  3APF A;  3TFM A;  5JHH A;  4ASW C;  4GOC A;  1WX7 A;  3FSS A;  4MEL A;  4ICV A;  3NZU A;  2KHW B;  2GBJ A;  1K5G B;  4K7W A;  4WWO A;  4WWN A;  2KTF A;  2EMS A;  3V6C B;  2MBH A;  4HWI B;  2M38 A;  2RSG A;  3P2B A;  4PS8 A;  3OAN A;  4K2O A;  5AZH A;  1EF5 A;  3SHQ A;  4WVF B;  1KLV A;  1WIA A;  1E8Z A;  3DXC A;  3KVF B;  3IHP C;  3PGE A;  2OTX A;  3CSF A;  3DXD A;  3A9K A;  3ML4 A;  3QX1 A;  4H8S A;  3A4S C;  3PVW A;  4DDG D;  3EHV A;  1Z5S B;  1V89 A;  3D32 A;  1ST7 A;  3UGB B;  4IG7 B;  2UVM A;  3TVV A;  5CHW A;  4NPN A;  1UPQ A;  5EFX A;  3CMM B;  1Y5O A;  1UPR A;  2J0K A;  5D94 A;  2C9W B;  1HB8 A;  3WAP A;  3V5W A;  3KUZ A;  2LZ6 A;  4A20 A;  2L0F A;  1FHO A;  1V5P A;  5IJM A;  4FA6 A;  4PQ0 A;  3HM3 A;  3MHS D;  3VIA A;  2D11 A;  4HAZ B;  3U7D A;  5LXI B;  1KZG A;  3T9L A;  2KJ6 A;  2L1C A;  4YON A;  1E8W A;  4DX9 0;  3RZW C;  4KDL B;  1BWN A;  2B3A A;  2HJ8 A;  1M94 A;  2ELA A;  3SBG A;  1E8Y A;  2XBB C;  4XZ4 A;  1MIX A;  2WX1 A;  4JKE A;  1OTR B;  5DPT A;  2L7R A;  3A1Q B;  4DXA B;  1WX9 A;  2DYQ A;  3SNH A;  5C6R A;  1Q0W B;  2ZNV B;  1LXD A;  5C23 A;  2Z0P A;  1LM8 B;  2I5C A;  2DYB A;  4CYE A;  4WWP A;  4BBN F;  3KH0 A;  1RFA A;  1OGW A;  2CHX A;  3PTF C;  2LVO A;  3DVN V;  2ROZ B;  2XEW A;  1DDV A;  1U5G A;  4KHA A;  5DCN A;  5AZG A;  4BKG A;  2JWZ A;  2MX2 A;  4HB0 B;  1BT0 A;  2KWC A;  1XD4 A;  2D10 A;  1W1D A;  2K2U A;  1XX0 A;  3VHT C;  4F1S A;  4EFO A;  4ICU A;  4A5K A;  2NBV B;  2LJ5 A;  3A1Q A;  4TQ1 A;  4NJ7 A;  1V5M A;  2DKP A;  1X11 A;  3LDZ E;  2L3Z A;  2JP2 A;  2BWE S;  4M8N A;  1J0W A;  1BTK A;  3VTV A;  3S2A A;  2G45 B;  2FDQ A;  2LVP A;  5C16 A;  4W9I A;  2K00 A;  1KZ7 A;  4IM3 A;  1WJ1 A;  2UYZ B;  4GDK A;  2C60 A;  3SO6 A;  1HB6 A;  4KAX B;  4AP4 C;  3ZO5 B;  3QK0 A;  1XKE A;  1I42 A;  2IO2 B;  1X86 A;  2DZI A;  4HB4 B;  2PZ1 A;  3V61 A;  3ZKJ C;  2LXA A;  3RCZ A;  4IWQ A;  4LCD E;  5DI9 B;  2C5L C;  1Z87 A;  1UNQ A;  2BPS A;  2ZNV C;  2N23 A;  4K17 A;  4GSW A;  3WAO A;  1JRU A;  3N30 A;  1OQN A;  2KAN A;  2DLW A;  1LFD A;  3KUD B;  1YQB A;  3AXC A;  3VH3 B;  4FUL A;  4TUU A;  5AEK B;  4IM2 A;  2KFK B;  3D8D A;  1UBQ A;  4F7U P;  2JT4 B;  1J19 A;  1DYN A;  3N3K B;  3AU5 A;  5J3Q A;  4W9J A;  2ELB A;  2GBM A;  2DTC A;  5L83 A;  2DA0 A;  2FID A;  1ZVR A;  3TL5 A;  2L00 B;  2LVQ A;  4FJY A;  2JF5 A;  4XC2 A;  4IC7 B;  2W2X D;  3ECI A;  4HLE A;  4F8C B;  1WXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...