2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
b'PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
3Q3JA 4AWJA 5KQ1A 3ZNGC 2CAYA 4GGQA 3NS8A 3B0AA 2PEAA 2L2IA 4GB9A 1HB6A 1FAOA 2RLOA 5JLJB 4GDKA 3A4SC 2FJ9A 4I6NB 2AL6A 1SGHA 3APCA 2Z0EB 4WWOA 1OQYA 3ZDTA 3PRPB 4MGZE 4FHKA 2ZNVB 2LXAA 2LULA 1XD4A 1XCGA 4DBGA 4JGHB 2V1YA 3ZW3A 2HTHB 2DX1A 1WJMA 1U5GA 2XK5A 2D07B 3ML9A 2LVQA 1UD7A 2UZRA 1WH3A 1WXSA 5JHBA 2D9XA 4XX5A 3WANA 3A9JA 2RQ1A 1WJ1A 4A6KA 2L05A 1U4AA 3G9WA 3KRXA 1V5TA 4EZKA 2DAFA 5IAAC 3DQVA 2YF0A 5DIFB 1Z2MA 1E5WA 1DDWA 2KFKA 5DPSA 5JHAA 4ANWA 1U5DA 4IWOA 2A4ZA 3PEGA 1WR1A 3SV1A 2X18A 4MELA 3OJ4B 1XR0B 1EF1A 2ZCCA 4GSWA 1FOEA 3S2AA 2EMTA 2V4LA 4DHJB 2MKRA 4KDLB 2MSED 2WYQA 3V6CB 3DVNV 4DWFA 4DHZE 1Y19B 2KVRA 4HATB 1E8YA 2KJRA 3Q3FA 3A9KB 5CLLB 1AARA 4KSKC 2QKLA 5HE0A 3D8DA 4DX90 2ZPYA 2D11A 4JQWC 1VCBA 1YX5B 3KYDD 4CHJA 3ZVRA 3A1QA 1DROA 4ANXA 3NY5A 3PHXB 4AJYB 2MA9B 4A3PA 1XKEA 4HWIB 4ZDVA 4EJNA 4AJWA 1V81A 1BTNA 1OTRB 1WXVA 5CLQB 2GCLA 2CB8A 4II3B 3VUXA 5J3TA 2L1CA 1AWEA 2DZIA 2IFSA 5CHWA 1BAKA 4A6FB 1RFAA 3V5WA 3QA8A 2I1KA 3ZDMC 1U29A 2LD9A 2WX1A 4KZ0A 3HIZA 4HK2A 1FHXA 3HW2B 5C16A 1WGGA 3PHWB 4KHOA 4HXDA 3CXBB 3RYTA 2DYMA 4FLHA 3L17A 1GJZA 4CHKA 3A9KA 2KN5A 3SU8X 2IO0B 2Y8FA 2BYVE 3L13A 3DCGA 1RRPB 1WVHA 1ZC3B 4HCPB 4OVUA 2M14A 5E6NA 2M0XA 1F9JA 4KHBB 4GN1A 2ZEQA 2DENB 4EFOA 3VVWB 1V89A 2W2XC 1Q0WB 5DPRA 2R2OA 1A5RA 2DTCA 2KJHB 4PQ0A 3AU5A 3X23A 4NAWB 4X57B 2DZMA 2RD0A 4B95A 4B6WA 4E3CA 2J0MA 2COAA 5L95C 4BKGA 4GMVA 2N1VA 3WA0A 1WFYA 3WAPA 3HQCA 2UZSA 2KHWB 1LB1A 3ODXA 3W1SA 2UVMA 3RULA 3U8ZA 3DXDA 3O65B 4AOFA 1X05A 3K9PB 3ULBA 1R4NI 1ZW7A 2WH5A 3QIJA 5KQ4A 2KK8A 3DDCB 2J59M 2K8HA 3P6AA 2PJHA 3T9LA 1V5OA 5J3QA 2IO1B 2KANA 3SDLC 2LRWA 2Z59B 4GZUA 4PS8A 3VQIA 2VRWB 3DBHI 2LASA 3BY4B 4W9KA 4HDOA 1MPHA 1E8ZA 2A5UA 3CMMB 5LXHA 3PRMB 3L54A 1V86A 1LFDA 1DYNA 4NJ6A 2BKFA 2N7DA 2ASQA 2K2UA 1FHWA 2RSGA 1GNUA 1W1HA 1UZXB 2NBWB 3DVGX 4NPNA 4W9CA 4F1SA 1T0YA 1MKEA 2I5FA 3EFUA 2JF5A 2BWES 2O2VB 1UNRA 1M94A 1PMSA 4BVUC 3AJ4A 2L3ZA 2DX5A 4IG7B 4WQOB 4MK0A 1YIWA 1QC6A 1S1QB 1E7UA 4WWNA 1V5PA 3M63B 4FULA 3HM6X 3IBEA 3RZWC 4EUTA 3VUYA 2Z0PA 2Z0OA 4NSWA 3I3TB 4RM9A 4W9FA 3JYUA 4B9KA 2ZCBA 2C7MB 2CODA 1KZ7A 2D2QA 2KC2A 4EEWA 1U27A 4E74A 3M1IB 5L81A 2JZ3B 1Y5OA 2AEHA 3ODWA 3H7PA 4ICUA 2UWQA 2C5LC 3ML4A 2DYQA 2DFKA 1SE9A 3KYCD 1OQNA 3PS6A 1Q5WB 2BWFA 3R7QA 2JUOA 3LDZE 2NPTA 3QQ8B 1M7RA 2CHXA 1GC7A 1MK7B 1TJ6A 2OQBA 4WVFB 4TYZA 1E90A 2FCNA 2O6VA 1Z5SB 1H4RA 2Z0DB 2KDIA 1TTNA 4C0AA 5J17A 2P8VA 2RR9A 4JIOU 4HAZB 3FM8C 4H8SA 3A8PA 2MBHA 1BTKA 2WDTB 1V9JA 3ZTCA 2L0TA 2V76A 5G55A 1EUVB 4J6IA 3IFWB 3KUDB 2NS5A 5IA7A 1K5DB 3PG7A 3N7CA 1B55A 2GJYA 2CRFA 2L7RA 2MWSB 4MGYE 3VFKA 2R0DA 1NBFC 2M8SA 4NQKE 2I1JA 1DBHA 2YLMA 1UNPA 3K9OB 1P3RA 1WXMA 3GYPA 4MSQB 2IO3B 4JL9A 3W1YA 1WIAA 1WGQA 2COPA 1U5EA 4ANVA 2BCJA 1P1AA 3ZO5B 1ZGUB 2PE9A 3QX1A 3UQBA 2ROZB 2RUKB 1D3ZA 1WI0A 1MIZB 1PFJA 2EC1A 2L0FA 2J0JA 3GZNI 2W2WA 1XQQA 1WX7A 2NR2A 1VD2A 1WG7A 1YJ1A 2FIDA 4KDIC 1RRBA 3SO6A 4GIVA 4HB4B 3PLVA 3VXWA 3WALA 3V6EB 4F7UP 3APFA 2RGNB 3N30A 4A6HA 1HBKA 3ML8A 4JLCA 5DPWA 4K7WA 3U7DA 2KJ6A 2ZVOA 3V61A 3VH3B 2DYNA 3PV1A 3RT3B 2ADZA 3OAWA 2MDXA 4YL8A 5KHOA 4HPLB 3KZ1A 2W9NA 4P7IA 2ELBA 3OJ3A 4TQ0A 3VIAA 2KDFB 2P0FA 3L16A 1WX8A 2RSUA 3NHEB 2GMIC 2YS3A 2DHJA 2NVUI 3WIMA 3PSCA 3OLMD 1E8XA 3VAWA 3PZDA 4F8CB 2KTRB 4G50A 4M0WB 3ZKJC 1CMXB 2YT0A 1WRDB 3N3KB 5CHVC 4IW0A 5JHGA 4KZCA 4GDLB 4E71A 1DDMA 4HLEA 2DAJA 1C1YB 2W2XD 4MEMA 4GPTB 3VH4B 1ST7A 1L7YA 2DKQA 4IUMB 3TO1A 4WJ7A 1EF5A 2HTHA 1OEYA 1XT9B 1NU2A 1GG3A 2CKHB 2DA0A 3QARA 2N1WA 3QC8B 4F7GA 1V80A 2P0HA 1P98A 4EZLA 2LI5A 2YVCA 5C5BB 2WWZA 3HM3A 4HCNB 3A4RA 1LXDA 2K39A 3LJ3A 2M4NA 2OJRA 2N7EA 4DDID 5LONB 1X1FA 2GBNA 4MJSB 2COCA 4CO7A 4EOYA 1IRSA 2KQSA 3UINB 4ZRIA 2BKRB 2M38A 1UEFA 3UZTA 1OMWA 2R2QA 1WZ3A 3QJZA 1UNQA 5E6OA 5J2RA 2GBRA 4W9DA 3HHMA 4A3OA 4W9JA 4B6HA 3B1LX 3TJPA 3QWZB 1PQSA 1P9DU 5DPTA 5KHQA 1NTVA 2VKIA 1RLFA 5JZEB 3UF8A 2JRHA 1FGYA 3WAMA 2G45B 3UIPB 4HHVA 2GOWA 3UGBB 1SHCA 4I6PA 4PS7A 1OGWA 1LM8B 1V88A 3ZIMA 2KC1A 3PVLA 2XBBC 4FADA 2BYFA 3T06A 4DBBA 2CU1A 4F7ZA 2JZZA 4HB2B 4ZRKA 2EKEC 2KX3A 1WJNA 2QHOA 3H1UA 4AUQC 1WGUA 4KV2A 3AULA 3PVWA 4AP4C 4GU2A 2IYDB 1X1MA 4GMXB 3ZNZB 3IVFA 2GBMA 4A6FA 2WX0A 1BWNA 2DZJA 2KLCA 1FHOA 4MM3A 2BYEA 4DDGD 2KFJA 1ZSQA 1X1GA 3FSSA 4Z2MB 2N9XA 2C7NB 1E8WA 2L8JA 1KZGA 4L6EA 4HPMB 1W1GA 5DCNA 2D9VA 2G35A 2KLGA 4NNJB 4HAUB 4HAXB 1J8CA 2NBUA 1UBQA 1V5MA 1WJ4A 2M1MA 4K2PA 2ZVNA 4WWPA 2KUPA 4RM8A 4HB3B 2JP2A 1WMHB 4IWPA 2C7HA 2LOXA 4II2B 5JHHA 5KCVA 4W9IA 4HAVB 4D0NB 2D9WA 2V3SA 3JSVB 1WGRA 5C79A 3D32A 1KM7A 4ANUA 3H6NA 1I2HA 4NAWA 1NI2A 4K1RB 3DBRI 3UQAA 2MP2B 1RAXA 5AEKB 2DN6A 1QQGA 3WYFB 3QBVB 1XD3B 3CSFA 4WJQA 4A20A 2JT4B 4ICVA 2JPHA 5GOWB 4IWQA 1XX0A 2CQUA 2KO3A 2FCQA 3AI5A 3KVFB 3TIXA 1V5UA 3NZSA 4IFSA 4K17A 1H10A 2EMSA 4FA6A 2FAZA 2AWTA 1KLVA 3ALBA 3FLVA 3A8QA 2K8CA 2BPSA 5FI1A 5TR5A 4BBKA 3A33B 1XODA 3DOWA 3KW5B 4BKSD 1I7AA 1V61A 2C60A 2D4QA 4KVGB 4WSFA 4K7SA 1MK9B 2OOBB 4BOZB 2DKPA 3H9DA 2MX2A 1EVHA 2K6QA 1QZEA 3ODOA 2COFA 2FIFA 2H7DA 2NMBA 4FN2A 4K2OA 2KMAA 1J0GA 2N4FA 3N32A 2HJ8A 4LCDE 3W1SC 3PPAA 2IYBA 4PNKA 3D8EA 3PP2A 1G6JA 1YX6B 1LQBA 1HE8A 4G11A 3TL5A 3DBLI 3M62B 2KQ7A 2AYOB 4GDKB 3RCZA 1MG8A 3QHTA 4IM2A 3R7RA 4DHZB 1TGZB 5J18A 2KGXB 2O2VA 1I42A 3MTNB 1AQCA 4EZJA 2HE7A 2VSZA 2HRJA 1WGHA 2FUHB 1WJUA 3V62A 2B3AA 5C1ZA 3DVNU 2PPHA 1KI1B 5L83A 2ABDA 3RCPA 3PRZA 4LJOB 2XK5B 3TMPB 4DK5A 3NZUA 4OVVA 2N0YA 4EKUA 1IYFA 1L2NA 1K8RB 2LZ6A 3A9JB 1WXAA 3F0WA 2IY1B 1FGZA 2IO2B 3UIOB 2KTFA 3OANA 2KWUB 2RNRB 1R4MI 4MGKE 2DHIA 2KFKB 3VHTC 4M8MA 3EECA 3H7SA 4A5KA 5EFXA 3IHPC 3VTVA 4BOSC 3C0RB 5HE3A 2KOXA 1WY8A 1ISNA 2K25A 2MRPA 1TXDA 4PYUA 1LW3A 5LXIB 3T8MA 2D9ZA 2YT1A 3RD2A 4BKTA 2Q13A 5HE1A 4XWXA 1WM2A 1HB8A 2H7EA 1X86A 3P2BA 3PVUA 4FHJA 4MT7A 3VUWA 4CHMA 5AZFA 3P7ZA 1S3SG 2KXJA 4GOCA 2BGFA 3KUCB 3WAOA 2LKOA 2G4DB 2L00B 2LGDA 4TV3A 1RJ2A 1V2YA 4ZYNA 3A98B 2FCSA 2NCNA 2PE6B 2KNBA 3A1QB 2ZPNA 3EPYA 2MFQA 1J19A 3SUZA 1WE6A 2DZKA 1I35A 3BJIA 1WE7A 5DH9B 4HDQA 2JY6A 1UH6A 2KD0A 1WZ0A 2YS5A 5J3YA 3ONSA 3O96A 3AXCA 1Q1OA 1UPRA 1FXTB 2FCMA 4N9F4 3KSYA 2LXCA 1WR6E 2C9WB 4TKNA 1FB8A 1UBIA 3L08A 3RUIB 2OTXA 3PLUA 5DI9B 4KIKB 5AZHA 2RGFA 1NDDA 2JXXA 1KOTA 1DDVA 2CY5A 2K2JA 5D3VA 2KKCA 4XC2A 5FR6A 3GOEA 3SYXA 2CHZA 3PGEA 1IPGA 3JW0X 2N9PC 2ZZPB 4FJZA 4F7HA 4WJNA 4FJVB 3B08A 3R66C 3X0WA 5AZGA 2LG1A 1TQZA 4HJKA 2Z0QA 3GYOA 1P3QU 2MBEA 4W9GA 1E7VA 2LGYA 5FI0A 5DHAB 1UGMA 5JP4A 4URKA 2REXA 2HD5B 2J7QB 1ACAA 2FJLA 5D3WA 3EC8A 3VDZA 1MIXA 2ROVA 5BO4B 2IBIB 3AU4A 4K7UA 2Y5BB 2RPQA 2KDBA 5C23A 2KTRA 5E6PA 3PREA 2ZJDA 1YD8U 5D6JB 4LDTB 4G0NB 2BF8B 1OY2A 4GDLA 3QAQA 1NTYA 3MHSD 3JVZX 1TZ1A 2M17A 3KRWA 1EGXA 4KAXB 4MY6A 4G3XB 4KIKA 4MDKE 4DHJD 4W9HA 3QK0A 3CIKA 2P0DA 3ZUNA 2KWVB 3QWMA 5HKHA 5C5BA 4IAPA 2CS4A 2JVCA 3ZTDA 4W9LA 2YSZA 2MBOA 5JH5C 5LLIA 2FNJB 2LUEA 5D2MB 1EO6A 4MJSA 2MWNB 5GMVA 4HVBA 3PT2B 2RVBB 3DBSA 4KHAA 1X11A 2CHWA 1PLSA 3V60A 3TCAA 3ENEA 5C6RA 4MGIE 5CTRC 3TW1A 1WGDA 2LJ5A 2N23A 2ZNVC 1WJ6A 3L10B 3ULCA 1C3TA 1KJTA 1Y8RC 3BINA 3HK0A 3TFMA 1M7EA 4BBNF 2LOZA 1ZC4B 4MSMB 5DHFB 2KDEB 3CSTA 2MCNB 2LYDA 4IM0A 2LWPA 3DPDA 1N3HA 2MBQA 4LDTD 4FJYA 1Z87A 5G2NA 3KH0A 2YS1A 2IZVB 4TUUA 4IM3A 4NJ7A 2R09A 3SNHA 2DX5B 2DYOA 3FP5A 2LBBA 2LVOA 2DLWA 1ZM0A 2D3GA 4NY0A 3VTUA 1ZVRA 2D9YA 4ASWC 3DXEA 2CR5A 2GCJA 2I5CA 3NOBA 1H8CA 1OEYJ 2GBKA 3SHQA 4NQLB 3MJWA 4HAYB 2Y7BA 5D3XA 4RMAA 3VTWA 3H7PB 4CYEA 3R3MA 4W9EA 2J0KA 2QKMA 2JRIB 1IP9A 1WM3A 2G4SA 2L76A 4BBNC 5IJMA 1ZKHA 2K6DB 4GXBA 2K8BA 3ECIA 2N9EB 5D3YA 5CHFA 2NPTB 2VRRB 5D27A 3IG3A 1V6EA 2XEWA 2JWZA 2DHKA 3SD5A 2KX0A 5D7GA 3DVGY 1Q67A 4IC7B 2MQJA 2O6VB 1YQBA 2GBJA 5EDSA 4BKSA 3F5RA 3U30A 1V49A 2AL3A 2MBBB 1NTIA 5D94A 2KWCA 1J0WA 1GC6A 4MH0E 3ZLZA 2LRUA 1WYWB 1EAZA 1WMHA 1U2BA 3PTFC 1MAIA 3MDBC 1WF9A 4XZ4A 2YRYA 3ZRCA 2NBVB 4PYZA 3ZNHB 1TBEA 3JSVA 3KUZA 2PZ1A 2LVPA 2KZRA 1WI1A 2E2XA 2EJ8A 2DYBA 1W1DA 3ZNID 4ZRJA 2Y8GA 2K00A 4M8NA 3PSEB 4Z2NA 4Y94A 1BT0A 3TBLD 1U5FA 2MP2A 1WX9A 3KY9A 4DX8A 3D8FA 2KCJA 2XQNM 3M3JA 4I6LB 3LJUX 4FBJB 5CX3A 1P5TA 2ELAA 3EHVA 4IOYX 3DXCA 2CY4A 1SIFA 3RZFA 2GS0A 1UPQA 1NVLA 1UELA 3QCAA 1JRUA 2NZ8B 4WAAA 3ZVVA 3M95A 2IY0B 2FDQA 2MLBA 4EMOA 3MPXA 2O6VD 5HE2A 4TQ1A 3CF6E 3APDA 4BFRA 4K81A 1P0RA 4YONA 4LJPB 2D10A 1K5GB 1P6SA 4KSLC 1GUAB 2UYZB 3TVVA 3L0WB 4HB0B 3NSUA 2K1FA 5LOPB 3FEHA 2KMCA 2LGXA 4PS3A 2MW5A 1WGYA 2DHZA 3VOQA 4HAWB 2G3QB 4WJOA 3ZRFA 4WJPA 4DXAB
chains in the Genus database with same CATH superfamily
3Q3JA 1FIQA 4AWJA 5KQ1A 4P16A 2M19A 3ZNGC 1D4BA 1TKYA 4JK7A 2CAYA 4GGQA 3NS8A 4QAYA 3B0AA 2PEAA 1XXGA 2L2IA 4GB9A 1HB6A 1FAOA 2RLOA 1QQRA 5JLJB 3MC0B 4GDKA 3LXFA 4A9AA 3A4SC 2FJ9A 4I6NB 2AL6A 1SGHA 3APCA 1YQ3B 2Z0EB 1D6EC 4WWOA 1OQYA 1FMAD 2INPE 4HSIA 3ZDTA 1VDVA 2L83A 3PRPB 4MGZE 4FHKA 2ZNVB 4JKBA 2LXAA 2LULA 1XD4A 1XCGA 1BXTA 2M56B 4DBGA 2H89B 2CJOA 4JGHB 2V1YA 1FNWA 3P63A 3SBGA 3ZW3A 2HTHB 2GRIA 1JWMD 2DX1A 2SEBD 2V0GA 1WJMA 1GAQB 1U5GA 2XK5A 2D07B 3SEBA 2BW2A 2PVOD 3ML9A 4LNNA 5IO9A 4C80A 2LVQA 2DLBA 1UD7A 3HUIA 3B2GA 2UZRA 1WH3A 1WXSA 4S17A 5JHBA 1F1HA 1ZPSA 2LFIA 2D9XA 4XX5A 3WANA 3A9JA 2RQ1A 1WJ1A 4A6KA 2L05A 1U4AA 3G9WA 3KRXA 1V5TA 4EZKA 2DAFA 5IAAC 3DQVA 5JXVA 2QC8A 3W9CB 2YF0A 1ENFA 5DIFB 1Z2MA 1E5WA 1QT9A 3CIRB 3DBHB 1DDWA 3HVZA 2KFKA 3BVZA 5BYSA 1HEZE 5DPSA 5JHAA 4ANWA 1I4RA 2LHDA 2KN4A 3NWFA 3AB5A 2GLSA 1U5DA 2GB1A 2V3NA 2J52A 4IWOA 2A4ZA 3PEGA 1MI0A 3N1ZC 1WR1A 3SV1A 2X18A 4MELA 1N63A 3OJ4B 3AE3B 4C56C 1XR0B 1L6UA 1EF1A 2ZCCA 1C4AA 4GSWA 3BZDB 1FOEA 4LK0M 4XYCA 1DIKA 2EMTA 1PGXA 3S2AA 2V4LA 4DHJB 3NWAA 2MKRA 4KDLB 2MSED 2WYQA 4M00A 3L4PA 3V6CB 3DVNV 4WURA 3EGRA 4DWFA 2WNMA 4KX6B 4DHZE 1Y19B 5M4YB 1IUEA 2KVRA 5HG2A 1RFKA 3P4SB 4DQOC 4HATB 1E8YA 1C4PA 2KJRA 3Q3FA 3A9KB 5CLLB 1AARA 3EUB2 4KSKC 2QKLA 3URYA 2JXTA 5LG4B 5HE0A 3NVZA 3D8DA 4DX90 2ZPYA 2D11A 4JKGB 4JQWC 1VCBA 1YX5B 1PYWD 3KYDD 4CHJA 2WXFA 3ZVRA 3A1QA 3AE7B 1DROA 4ANXA 4USAA 3NY5A 3PHXB 4AJYB 2MA9B 2DBYA 5BMGA 4A3PA 1XKEA 4HWIB 4ZDVA 1JWSD 4EJNA 4AJWA 1RYJA 1BTNA 1OTRB 1V81A 3OG5A 1WXVA 1QOAA 1NI3A 4BZAA 5CLQB 2GCLA 2CB8A 4II3B 3VUXA 5G5GA 3HIEA 5J3TA 2L1CA 1AWEA 2DZIA 3ZJVA 2IFSA 5CHWA 1BAKA 1TKGA 4A6FB 1RFAA 3V5WA 3QA8A 4MM3B 2BYTA 2SAKA 2I1KA 1CK1A 1MVKA 4GNKB 3ZDMC 2DIKA 1U29A 2FE8A 2LD9A 2DNFA 1V1PB 2WX1A 4KZ0A 3PO0A 1N5WA 3P4QB 4HKZE 1ZP0B 3HIZA 3MC8A 4HK2A 3I9V1 3ETRA 1FHXA 2L1AA 3HW2B 5C16A 4HPPA 1WGGA 1I4XA 3P4PB 1VJKA 5I2SA 2X8XX 3PHWB 4KHOA 4HXDA 3CXBB 3RYTA 2DYMA 2KT7A 1FM0D 1UWMA 4FLHA 3L17A 1GJZA 1TZOA 3TEWA 1JDEA 4CHKA 3A9KA 1KFYB 2KN5A 3SU8X 1N62A 2IO0B 5EE9A 2Y8FA 2BYVE 3L13A 5I4DA 3DCGA 1RRPB 1WVHA 1ZC3B 4HCPB 1FO4A 4OVUA 4JKGA 2M14A 2MH7A 5E6NA 3IAS1 2M0XA 1F9JA 3I5JC 4KHBB 3VRAB 1DYQA 5EE3A 3ZXRA 4GN1A 3MJ5A 4WQMA 2ZEQA 2DENB 4EFOA 1Q0WB 1V89A 2W2XC 3VVWB 5DPRA 3TSSA 2R2OA 1A5RA 2DTCA 2KJHB 4PQ0A 2J53A 3AU5A 1EU4A 3N1XC 3X23A 4NAWB 4L23A 1SJED 4LNFA 4X57B 2DZMA 2RD0A 2I2YA 4B95A 2W55A 4B6WA 4E3CA 2J0MA 2COAA 5L95C 1IGCA 4BKGA 4GMVA 1B1ZA 2N1VA 3WA0A 1WFYA 4JKFA 3WAPA 3HQCA 2UZSA 2KHWB 1LB1A 1JWAD 3AEAB 3ODXA 3NS1A 3W1SA 2UVMA 2PTLA 3RULA 1XLQA 1J7AA 3U8ZA 3DXDA 3O65B 4AOFA 2FJUB 1I4QA 1X05A 3K9PB 1RM6C 3ULBA 1R4NI 1ZW7A 2WH5A 3QIJA 5KQ4A 2KK8A 2INDC 1YOVB 1NENB 3DDCB 3GZNB 2J59M 2K8HA 3P6AA 1IGDA 2PJHA 3T9LA 4D2KA 1V5OA 5J3QA 2IO1B 2KANA 3SDLC 2LRWA 2Z59B 4GZUA 4PS8A 3VQIA 2NMQA 2VRWB 3DBHI 1AN8A 2LASA 1VR9A 1KTKA 4B0MA 2N9KA 1VBGA 3BY4B 4B0EA 4W9KA 4HDOA 1MPHA 1E8ZA 1I4PA 2A5UA 3CMMB 4YTNB 5LXHA 3PRMB 1JCKB 3L54A 1V86A 2IDYA 3A58A 1LFDA 1DYNA 3E66A 1VRAB 4NJ6A 2BKFA 4JKHA 3P42A 3SFEB 4KGTA 2N7DA 2ASQA 2WXNA 4S0RA 2K2UA 1FHWA 1C9FA 2RSGA 3V3XA 1GNUA 1W1HA 1SB3C 1UZXB 2NBWB 3DVGX 4NPNA 4W9CA 1DOXA 4F1SA 1T0YA 1MKEA 2E3TA 1MPEA 2I5FA 3Q3MC 1TY0A 4P1CC 3EFUA 2JF5A 2BWES 2O2VB 1UNRA 1M94A 1PMSA 4BVUC 3AJ4A 2L3ZA 2DX5A 4IG7B 4XGAB 1QOGA 4WQOB 2WDVB 4MK0A 1KRHA 4BAXA 1MJDA 1YIWA 2HDEA 4OHJA 1QC6A 1S1QB 1E7UA 4WWNA 1V5PA 1FFUA 2Z14A 3M63B 4FULA 4OZAA 3HM6X 2IGDA 3IBEA 1Q10A 3RZWC 4EUTA 3VUYA 2Z0PA 2K8EA 2Z0OA 4NSWA 4OT1A 2K0PA 3I3TB 4RM9A 4W9FA 4LNOA 3JYUA 1I4HA 4B9KA 2N7JA 4JE3B 2QCZA 2ZCBA 2C7MB 2CODA 1KZ7A 2D2QA 2KC2A 4EEWA 1U27A 4HKQA 4E74A 3M1IB 5L81A 2JZ3B 3MP9A 1Y5OA 1F52A 2RDGA 2AEHA 3ODWA 3H7PA 4MH8A 3E9LA 1TT5B 4ICUA 2UWQA 2C5LC 1L5PA 3ML4A 1HTQA 1V97A 2DYQA 2DFKA 1SE9A 3KYCD 3Q69A 4IKGA 1OQNA 3PS6A 1Q5WB 3Q2AC 4RF0A 2BWFA 3R7QA 2BS2B 2KDMA 2ONQA 2JUOA 3LDZE 2NPTA 3QQ8B 1M7RA 4FXCA 2CHXA 1GC7A 1MK7B 2WXHA 1TJ6A 2OQBA 4WVFB 1FCCC 4RGOS 1JW9D 4TYZA 2Y3AA 1E90A 2FCNA 2O6VA 1JROA 3TEZA 1Z5SB 1H4RA 2Z0DB 2KDIA 1TTNA 4C0AA 5J17A 2P8VA 2RR9A 5MPOA 4JIOU 4HAZB 3FM8C 4H8SA 3A8PA 2MBHA 1BTKA 2KIGA 2WDTB 1V9JA 4A6QA 3ZTCA 4QXAB 4ILHA 2LHEA 2L0TA 2V76A 5G55A 1EUVB 1ZDVA 4J6IA 2K3UA 3IFWB 3KUDB 2NS5A 5IA7A 3EFCA 1K5DB 3PG7A 2JYTA 3N7CA 1B55A 1TJEA 5G5HA 4H2AA 2GJYA 2CRFA 2L7RA 2MWSB 4MGYE 3VFKA 2R0DA 1NBFC 2M8SA 2D3AA 4NQKE 2NBVA 2I1JA 1DBHA 2YLMA 1UNPA 3K9OB 1P3RA 2KIEA 1WXMA 3GYPA 3AE8B 4XWTA 4MSQB 2V4IB 2E6XA 2IO3B 4RCOA 1MHHE 4JL9A 3W1YA 4JX1C 1WIAA 1WGQA 2COPA 1U5EA 4C00A 2WXOA 1NYQA 1KF6B 2PVGC 4ANVA 3RN9C 2BCJA 1P1AA 4MACA 1ZGUB 3ZO5B 4OZCA 2PE9A 3QX1A 3UQBA 1IBXA 1PUTA 2ROZB 2RUKB 1D3ZA 1WI0A 3CWIA 1MIZB 2ZKMX 1PFJA 3NZ3A 4A90A 2EC1A 1N60A 2L0FA 3H8HA 2J0JA 2WXKA 3GZNI 2W2WA 1XQQA 1WX7A 2NR2A 1VD2A 1FNUA 1F2RC 1WG7A 1YJ1A 2FIDA 4KDIC 1RRBA 3SO6A 1VZ6A 2Z8LA 1UWXA 1VBHA 4GIVA 4HB4B 1AYFA 1K51A 3PLVA 3VXWA 3WALA 3V6EB 3AE5B 4F7UP 3APFA 2KMMA 2RGNB 3N30A 3NVVA 4A6HA 1HBKA 1E10A 3ML8A 1R4NB 4OVZA 4JLCA 1OQQA 5DPWA 4JKDA 3U7DA 2KJ6A 2ZVOA 3EA6A 4K7WA 3V61A 3VH3B 2DYNA 3PV1A 3RT3B 2ADZA 3OAWA 1SBBB 2MDXA 3NRZA 2BTEA 4YL8A 3N1YC 3Q3OC 1HTOA 5KHOA 4HPLB 1WXQA 3KZ1A 1XO3A 2W9NA 4P7IA 5TSSA 3AEFB 3V05A 2YEPB 2TSSA 2ELBA 3OJ3A 2AX5A 1TS2A 4TQ0A 4C4VB 3VIAA 2KDFB 2WU5B 2P0FA 3L16A 1WX8A 2RSUA 2OHFA 2GMIC 3NHEB 2YS3A 2DHJA 2NVUI 4MT5A 3WIMA 3PSCA 3OLMD 1CQVA 1E8XA 1YN5A 3VAWA 3PZDA 4F8CB 1YN4A 2KTRB 3HVDA 4G50A 4M0WB 3ZKJC 5T8IA 1CMXB 3KWVA 2YT0A 1WRDB 3N3KB 5CHVC 2MJEA 4IW0A 5JHGA 1SE3A 4KZCA 2WDRB 2XN9C 4GDLB 4E71A 1L0YB 4YSYB 4JK8A 1DDMA 2INCC 4HLEA 1YN3A 3RNCC 3RNAC 2DAJA 2JQRB 1C1YB 4JWUC 2KQ4X 2W2XD 4MEMA 4GPTB 3R8BA 1ST7A 3VH4B 1L7YA 2X38A 1TYGB 2DKQA 4IUMB 3TO1A 4WJ7A 1EF5A 2HTHA 1OEYA 1XT9B 1NU2A 1GG3A 1TS5A 3DWMA 2CKHB 2DA0A 3QARA 2N1WA 3QC8B 4DXGA 4F7GA 1VZ8A 1EWYC 1V80A 1QOFA 5C3JB 2P0HA 1P98A 3RFZB 2PKOA 4EZLA 3E9OA 2YVCA 2LI5A 3Q8EA 5C5BB 2WWZA 3HM3A 2L32A 4HCNB 4NJCA 3A4RA 1LXDA 2K39A 3LJ3A 2M4NA 2OJRA 2N7EA 4DDID 5LONB 1X1FA 2KWDA 1N5XA 2QEJC 2GBNA 4J3OD 4MJSB 5IRSA 2COCA 3U4EG 3ZQ4A 1B9RA 4K3BA 1YQ4B 4CO7A 4EOYA 1IRSA 2KQSA 2N9LA 3UINB 2B76B 4ZRIA 2BKRB 3W5UB 5C2TB 4AS1A 2M38A 1DOYA 1UEFA 1F77A 3UZTA 5D3IB 3GB1A 2VH2A 5EE1A 1Y56A 1OMWA 2R2QA 1WZ3A 3QJZA 1UNQA 4PT5A 5E6OA 5I2MA 3RI7C 5J2RA 2GBRA 2LGIA 4W9DA 3HHMA 4A3OA 4W9JA 4B6HA 3BVGA 3B1LX 4WAFA 3TJPA 3QWZB 1PQSA 3FILB 3PZ8A 1C78A 1BMLC 1P9DU 2M0AA 3U52E 1YMHE 5DPTA 4RFBA 4M0WA 5KHQA 1NTVA 2QSDA 2VKIA 1RLFA 5JZEB 2YEPF 1MG4A 3UF8A 1XCTL 2FUG1 2JRHA 5IKCM 2ACZB 3RNFC 1FGYA 3WAMA 2G45B 3UIPB 1TS3A 2BVCA 1L0VB 3DBLB 4HHVA 2GOWA 3UGBB 1SHCA 2IJ0A 4I6PA 4IOIE 2VH1A 4PS7A 1ROEA 1SXTA 1ZE3D 1OGWA 1KLUD 1LM8B 1V88A 1M4VA 2QJLA 2MJDA 3ZIMA 2KC1A 3PVLA 1T5XD 4JK9A 4XE0A 2WXJA 4ZYSA 2DWQA 2XBBC 2Y5PA 2R2YA 4HRSA 2KR0A 4FADA 2BYFA 2LJIA 3T06A 4DBBA 2CU1A 4ZOHC 4F7ZA 2JZZA 3AH7A 4HB2B 4ZRKA 2EKEC 2KX3A 2J4XA 3Q8BA 1WJNA 2QHOA 3H1UA 4OZBA 1J7CA 2D3BA 4AUQC 1WGUA 1NYRA 1D5XC 4KV2A 3AULA 1FEHA 3PVWA 2NTSA 1OQRA 4AP4C 4GU2A 4YT0B 2LUMA 2IYDB 1X1MA 4GMXB 2ZW0A 3ZNZB 3IVFA 2GBMA 4A6FA 5EE0A 1PDXA 2WX0A 1BWNA 2DZJA 2KLCA 1FHOA 1P7FA 3E9SA 4MM3A 2BYEA 4DDGD 2KFJA 4HROA 1ZSQA 1X1GA 4K3CA 2WXQA 1R4MB 1DGJA 3U12A 3FSSA 4Z2MB 2N9XA 2MHJA 1V1PA 2C7NB 1WGKA 1E8WA 2L8JA 1KZGA 3KLSX 4L6EA 4HPMB 1W1GA 3I63C 5DCNA 3U7ZA 2D9VA 2G35A 3IXSA 2KLGA 4NNJB 4JKEA 4HAUB 1GB4A 4HAXB 1J8CA 2W3SA 3R2IA 2V3PA 2NBUA 1UBQA 1SSNA 2KVZA 1V1OA 1V5MA 1WJ4A 3VR8B 2M1MA 4K2PA 1STEA 3AE4B 2ZVNA 4WWPA 4YTMB 2KUPA 4N59A 4RM8A 4HB3B 2AQ3B 2JP2A 1WMHB 4IWPA 1HZ6A 2C7HA 1SIJA 2LOXA 4II2B 4RF1A 5JHHA 5KCVA 4W9IA 5HFYA 2QMTA 3BYTB 4KHBA 4HAVB 1HXYD 4A8XC 4D0NB 3AEGB 2D9WA 2V3SA 3JSVB 2ICIA 1WGRA 5C79A 1EWCA 1KLGD 3D32A 1KM7A 5IOIA 4ANUA 1L4DB 1ZXIA 3OWEB 3AE9B 3H6NA 4KGSA 1I2HA 4LTUA 1BUIC 4RGTA 4NAWA 1NI2A 1TIFA 4K1RB 2WXPA 3DBRI 3UQAA 4M02A 3FAHA 4TSSA 1FPYA 1RAXA 2MP2B 5AEKB 4LLGM 2K22A 1JWUD 2RDBC 4ARCA 2DN6A 1QQGA 3WYFB 3QBVB 1XD3B 3CSFA 4WJQA 4A20A 1HZ5A 2JT4B 4JPSA 4ICVA 1XLNA 2JPHA 5GOWB 4HJGE 4IWQA 4C7YA 1XX0A 3LYYA 2CQUA 4QJ5B 2KO3A 2GI9A 5IN7A 2FCQA 2WXMA 3AI5A 3KVFB 3TIXA 1V5UA 3AEDB 4IFSA 1PGBA 3NZSA 4K17A 4XDDA 1H10A 3AEBB 2EMSA 5HHDG 4FA6A 1C76A 1PFDA 3NWDA 2FAZA 4GOUA 2AWTA 1KLVA 5LNK1 3ALBA 3FLVA 3A8QA 2K8CA 3SR6A 2BPSA 1D5MC 5FI1A 5TR5A 4BBKA 3A33B 1XODA 3DOWA 3KW5B 3NJTA 4BKSD 1SE4A 1I7AA 1V61A 4WWMA 1ZOYB 1OFFA 2C60A 2D4QA 4KVGB 1HQRD 1KBLA 3Q8FA 2Z59A 4WSFA 4K7SA 1MK9B 4N6EB 2OOBB 2NTTA 4BOZB 3KQ4A 2CJNA 2DKPA 3H9DA 2MX2A 1EVHA 2K6QA 1QZEA 1SEBD 3ODOA 3R2TA 2COFA 3FC4A 4M01A 2FIFA 2H7DA 2NMBA 4FN2A 4K2OA 5E6JA 2KMAA 1J0GA 2N4FA 3N32A 1NEKB 2HJ8A 4LCDE 2HTME 3W1SC 3PPAA 2MEKA 2IYBA 2LGSA 1UF0A 4PNKA 1XF5L 2EELA 3D8EA 1V8CA 3PP2A 1G6JA 4CQNA 1YX6B 3T3NA 1QLBB 1LQBA 3AE1B 1HE8A 4G11A 3TL5A 3DBLI 3M62B 2KQ7A 4NAMA 2AYOB 4GDKB 3RCZA 1MG8A 3QHTA 2WXIA 1CJEA 4IM2A 3R7RA 5H92C 4DHZB 1TGZB 5J18A 2KGXB 2O2VA 1I42A 2KYWA 5D3DA 3U2SC 2L52A 3MTNB 1AQCA 4EZJA 1VZ7A 2HE7A 1GPXA 2VSZA 2HRJA 1DOIA 1WGHA 2FUHB 1MHXA 4JKCA 1WJUA 3V62A 2AQ2B 2B3AA 5C1ZA 4PK1A 4CSQA 1CZPA 2WGSA 3DVNU 4R3DA 2PPHA 1KI1B 5L83A 2ABDA 3RCPA 3PRZA 4LJOB 2XK5B 3TMPB 4DK5A 3ZXVA 4JKAA 2JU6X 3MHZA 3NZUA 3ZJUA 1D5ZC 4OVVA 3GP7A 1AWDA 2N0YA 3O13A 4EKUA 2V9HA 1IYFA 4L2YA 3FKYA 1L2NA 1K8RB 2LZ6A 3A9JB 1WXAA 3F0WA 2IY1B 1FGZA 4P1BC 2IO2B 2X0SA 2JYEA 3UIOB 4HEA1 1QILA 2KTFA 3OANA 2KWUB 2RNRB 1R4MI 2G9HD 1FRRA 1YJJA 4MGKE 3NVYA 3N9YC 1A70A 2DHIA 1C77A 2KFKB 3VHTC 4M8MA 1GGOA 3EECA 1WWTA 3H7SA 1LO5D 4A5KA 1QF6A 5EFXA 3IHPC 2Z13A 1ZUD2 3VTVA 3RMKC 4BOSC 1TKEA 3C0RB 5HE3A 2KOXA 1WY8A 1ET9A 3N20C 1ISNA 2K25A 3GS2A 2MRPA 1F0ZA 1TXDA 4PYUA 1LW3A 5LXIB 1JWBD 1WSPA 3T8MA 1E6EB 2D9ZA 2AQ1B 2YT1A 2RPVA 3RD2A 4BKTA 2XNAC 2Y5CA 2Q13A 5HE1A 2Q5WD 4XWXA 3NW8A 1WM2A 1HB8A 2H7EA 1X86A 1XLPA 1NVID 3P2BA 3PVUA 2BBCA 4FHJA 3HSAA 1E7PB 4MT7A 2QILA 1ZXHA 3VUWA 5H8YE 4CHMA 2QIEB 2J42A 3AV8A 1F2RI 4RGNA 5AZFA 3P7ZA 1S3SG 3WCQA 4ACFA 2KXJA 4GOCA 4YSXB 2BGFA 4KKIA 3KUCB 2BB6A 4ZRQA 3RNEC 3WAOA 1EM7A 2LKOA 1KH0A 2G4DB 2L00B 4N58A 2D5GA 2LGDA 4TV3A 1RJ2A 1V2YA 4ZYNA 3A98B 2FCSA 2NCNA 1MFWA 2PE6B 2WS3B 2KNBA 3A1QB 2ZPNA 3EPYA 2MFQA 1J19A 3SUZA 1WE6A 1E0ZA 2DZKA 1I35A 4WH4A 1QOBA 1ZYIA 4TMAB 1SE2A 4YTPB 2K49A 1T6BX 3Q14C 2WXLA 3BJIA 4O1NA 4C7ZA 1WE7A 5DH9B 4HDQA 3GE3C 2JY6A 1UH6A 2KD0A 1TS4A 4OW0A 1ZDXA 1WZ0A 2YS5A 5J3YA 3ONSA 3O96A 1E9MA 3AXCA 4XDCA 3HRDD 1Q1OA 1UPRA 2BQQA 1FXTB 1GB1A 2FCMA 3ZGZA 4ITKA 4RNAA 2KUQA 3B77A 3DBRB 1L4ZB 2G1EA 3KSYA 1FXAA 4N9F4 2LXCA 1WR6E 2C9WB 2IGGA 4TKNA 2PLPA 1FB8A 2JWUA 1UBIA 2R82A 3L08A 3RUIB 2OTXA 3PLUA 5DI9B 4KIKB 5AZHA 2RGFA 3GE8C 4REZA 5BMHA 1NDDA 2W54A 1WRIA 1UGJA 2JXXA 1KOTA 1DDVA 2CY5A 2K2JA 5D3VA 2KKCA 3ABVB 4XC2A 5FR6A 1K53A 3GOEA 3SYXA 3ZYYX 2CHZA 1SJHD 3PGEA 1IPGA 3JW0X 2N9PC 2ZZPB 4FJZA 4F7HA 1ET6A 4WJNA 5FK9C 4FJVB 3B08A 1L0XB 2W3RA 3R66C 3X0WA 2R61A 5AZGA 1ACCA 2LG1A 1KC7A 1TQZA 4HJKA 2Z0QA 2QDFA 3GYOA 3E56A 2WDQB 1P3QU 2MBEA 3DHHC 3NUHB 4W9GA 1RWSA 1T3QA 1E7VA 1WYGA 2LGYA 5FI0A 5DHAB 1UGMA 5JP4A 3IAM1 4URKA 2REXA 2HD5B 2J7QB 3AEEB 1EU3A 1ACAA 2FJLA 5D3WA 3EC8A 2KAJA 3VDZA 2K9XA 4C4VA 4DXFA 5IP4D 1MIXA 2ROVA 5BO4B 2IBIB 3AU4A 1TY2A 4K7UA 2Z4DA 2Y5BB 2RPQA 1L6VA 2KDBA 3Q8AA 5C23A 2H88B 4US8A 2KTRA 3ENBA 2IGHA 5E6PA 1AW7A 2ZW1A 3VR9B 3PREA 2ZJDA 1YD8U 3NG0A 5D6JB 4LDTB 4G0NB 3RNBC 2PW9A 2BF8B 3SBTA 1OY2A 4GDLA 1UNSA 3QAQA 1NTYA 4JWSC 3MHSD 2I38A 4NZLB 3JVZX 1TZ1A 2M17A 4YSZB 1N6ZA 2PMVA 5GXGB 3KRWA 1EGXA 3BVMA 4KAXB 2LMCA 4MY6A 4G3XB 4KIKA 4MDKE 4RGMA 4DHJD 4W9HA 4ZRPA 3QK0A 3CIKA 1T77A 2P0DA 4XWWA 2WXRA 2OJWA 3ZUNA 2KWVB 4D6WA 3QWMA 5HKHA 5C5BA 4IAPA 2GUMA 1K52A 2CS4A 2JVCA 3ZTDA 4W9LA 2YSZA 2MBOA 5JH5C 3IT4B 3ZJTA 5LLIA 2FNJB 4ZHPA 2LUEA 1J7BA 5D2MB 1EO6A 3I57A 4MJSA 2MWNB 2LEKA 5GMVA 4HVBA 3PT2B 2MJ3A 2RVBB 2UU7A 3DBSA 2CU3A 4KHAA 1X11A 2CHWA 1PLSA 3V60A 3TCAA 3ENEA 5C6RA 4MGIE 5CTRC 1VLBA 3TW1A 1K50A 1WGDA 2LJ5A 1JRPA 3BWUD 2N23A 2WLBA 2ZNVC 4L1BA 1WJ6A 3L10B 2K5PA 3ULCA 1C3TA 1KJTA 1Y8RC 3BINA 3HK0A 3FVCA 3BK2A 3TFMA 1M7EA 4BBNF 2LOZA 1ZC4B 2BS3B 2JZPA 3AN1A 4MSMB 4ILJA 3W2DA 2D3CA 3FILA 5DHFB 2KDEB 3CSTA 3PZ7A 2MCNB 3E9PA 4IDIA 4DIXA 2LYDA 4IM0A 2LWPA 3DPDA 4OSNA 1ESFA 1I7HA 3RPFC 5BYQA 1N3HA 2MBQA 4LDTD 4US9A 2OEDA 3MFGA 4FJYA 1Z87A 5G2NA 4P6VF 3KH0A 2YS1A 5FKAC 2IZVB 4ARIA 2VZKB 4TUUA 1GOZA 4IM3A 3IT6B 4NJ7A 2R09A 2BB5A 3SNHA 2DX5B 3DCXA 2DYOA 5BMIA 3FP5A 2LBBA 2LVOA 1FNVA 2DLWA 1FCLA 3VRBB 5AUIA 1ZM0A 2D3GA 1HA5A 4NY0A 3VTUA 1ZVRA 2IPKD 2D9YA 4ASWC 3DXEA 2CR5A 4QJ4B 3BYYB 2GCJA 2I5CA 3NOBA 1H8CA 5JVLA 1OEYJ 2GBKA 3DWGC 3SHQA 4NQLB 3MJWA 4RH6A 4HAYB 2Y7BA 4YWGG 5D3XA 4RMAA 3VTWA 3H7PB 3DHIC 4CYEA 3R3MA 3UI3A 3C8YA 4W9EA 1XEEA 2J0KA 2QKMA 2RRFA 2JRIB 1IP9A 4ZHOA 1WM3A 2G4SA 2L76A 4BBNC 5IJMA 1JQ4A 1T0QC 4QJ3B 1ZKHA 4L1RA 2K6DB 1XCQL 4GXBA 2K8BA 3ECIA 4EE2A 3TEXA 2N9EB 2RMMA 5D3YA 5CHFA 2NPTB 2VRRB 3C19A 5D27A 3IG3A 1V6EA 5BYRA 2XEWA 2JWZA 4YXDB 2DHKA 3SD5A 2KX0A 5D7GA 3DVGY 1Q67A 4WIPA 4IC7B 2VZKD 2MQJA 2O6VB 3Q8CA 4UDUC 1YQBA 2GBJA 2KACA 2HJ1A 3Q3NC 5EDSA 2JX5A 4BKSA 3F5RA 3U30A 4AQ7A 1V49A 2AL3A 2YT2A 2WU2B 2MBBB 1NTIA 5D94A 2KWCA 1YJIA 1J0WA 1GC6A 1YNTE 4MH0E 3ZLZA 3AECB 2LRUA 1WYWB 3W5VB 1EAZA 1LGRA 1WMHA 1U2BA 3PTFC 1MAIA 1T0RC 2N0SB 3MDBC 1WF9A 4XZ4A 4Q2JA 2YRYA 3ZRCA 3DHGC 2FBWB 2NBVB 4PYZA 3ZNHB 1TBEA 1FRDA 3B9JA 3BK1A 3JSVA 2PZ1A 3KUZA 3RNGC 2LVPA 2KZRA 2JSVX 1WI1A 2E2XA 3J9CA 1C79A 2EJ8A 1I4GA 2ON8A 2DYBA 3AE2B 4A55A 1W1DA 3ZNID 4ZRJA 2Y8GA 2K00A 4M8NA 3PSEB 2EKIA 4Z2NA 4Y94A 1BT0A 3AMZA 1XLOA 3TBLD 4ILGB 1U5FA 2RDHA 2MP2A 1WX9A 3KY9A 4DX8A 2WP9B 3D8FA 4LNIA 3B2FA 2KCJA 2XQNM 3BIID 3P1MA 5HI1A 3M3JA 1IBXB 3NVWA 4LNKA 2INNE 4I6LB 3LJUX 4FBJB 1T0SC 5CX3A 2ELAA 1P5TA 3EHVA 4IOYX 3DXCA 2CY4A 1SIFA 4GLSC 3RZFA 1N61A 2GS0A 3SFDB 1UPQA 1NVLA 1UELA 1QKZA 3QCAA 1JRUA 1FFVA 2NZ8B 4WAAA 1UUPA 3ZVVA 3M95A 2BS4B 3LB8C 3AM9A 2IY0B 3Q6BA 3TEYA 2FDQA 2MLBA 4EMOA 3MPXA 2O6VD 5HE2A 1PGAA 4TQ1A 1R7SA 2WQYB 3AE6B 3APDA 3CF6E 2WHIA 2W82A 3MC9A 4BFRA 4K81A 1C4CA 3KWLA 1P0RA 4YONA 1SF0A 1P7EA 4LJPB 2D10A 1K5GB 1JALA 1P6SA 1FD6A 4KSLC 1GUAB 5AUKA 2UYZB 3TVVA 3L0WB 2BT6A 3P4RB 3OHMB 4HB0B 3NSUA 2K1FA 3TUOA 5LOPB 3FEHA 2KMCA 2WXGA 5FR3A 4KGRA 2LGXA 4PS3A 2MW5A 1JMLA 1WGYA 2DHZA 3VOQA 4KKJA 1MI1A 3T3OA 4HAWB 2G3QB 4WJOA 3ZRFA 1FXIA 4WJPA 4DXAB 2PIAA
chains in the Genus database with same CATH topology
3Q3JA 4AWJA 5KQ1A 3ZNGC 4JK7A 2CAYA 4GGQA 3NS8A 3B0AA 2PEAA 2L2IA 4GB9A 1HB6A 1FAOA 2RLOA 5JLJB 4GDKA 3A4SC 2FJ9A 4I6NB 2AL6A 1SGHA 3APCA 2Z0EB 4WWOA 1OQYA 3ZDTA 3PRPB 4MGZE 4FHKA 2ZNVB 4JKBA 2LXAA 2LULA 1XD4A 1XCGA 4DBGA 4JGHB 2V1YA 3SBGA 3ZW3A 2HTHB 2DX1A 1WJMA 1U5GA 2XK5A 2D07B 3ML9A 2LVQA 1UD7A 2UZRA 1WH3A 1WXSA 5JHBA 2D9XA 4XX5A 3WANA 3A9JA 2RQ1A 1WJ1A 4A6KA 2L05A 1U4AA 3G9WA 3KRXA 1V5TA 4EZKA 2DAFA 5IAAC 3DQVA 2YF0A 5DIFB 1Z2MA 1E5WA 1DDWA 2KFKA 5DPSA 5JHAA 4ANWA 1U5DA 4IWOA 2A4ZA 3PEGA 1WR1A 3SV1A 2X18A 4MELA 3OJ4B 1XR0B 1EF1A 2ZCCA 4GSWA 1FOEA 1DIKA 2EMTA 3S2AA 2V4LA 4DHJB 2MKRA 4KDLB 2MSED 2WYQA 3V6CB 3DVNV 4DWFA 4DHZE 1Y19B 2KVRA 4HATB 1E8YA 2KJRA 3Q3FA 3A9KB 5CLLB 1AARA 4KSKC 2QKLA 5HE0A 3D8DA 4DX90 2ZPYA 2D11A 4JKGB 4JQWC 1VCBA 1YX5B 3KYDD 4CHJA 3ZVRA 3A1QA 1DROA 4ANXA 3NY5A 3PHXB 4AJYB 2MA9B 4A3PA 1XKEA 4HWIB 4ZDVA 4EJNA 4AJWA 1V81A 1BTNA 1OTRB 1WXVA 5CLQB 2GCLA 2CB8A 4II3B 3VUXA 5J3TA 2L1CA 1AWEA 2DZIA 2IFSA 5CHWA 1BAKA 4A6FB 1RFAA 3V5WA 3QA8A 2I1KA 3ZDMC 2DIKA 1U29A 2LD9A 2WX1A 4KZ0A 3HIZA 4HK2A 1FHXA 3HW2B 5C16A 1WGGA 3PHWB 4KHOA 4HXDA 3CXBB 3RYTA 2DYMA 4FLHA 3L17A 1GJZA 1JDEA 4CHKA 3A9KA 2KN5A 3SU8X 2IO0B 2Y8FA 2BYVE 3L13A 3DCGA 1RRPB 1WVHA 1ZC3B 4HCPB 4OVUA 4JKGA 2M14A 5E6NA 2M0XA 1F9JA 4KHBB 4GN1A 2ZEQA 2DENB 4EFOA 1Q0WB 1V89A 2W2XC 3VVWB 5DPRA 2R2OA 1A5RA 2DTCA 2KJHB 4PQ0A 3AU5A 3X23A 4NAWB 4X57B 2DZMA 2RD0A 4B95A 4B6WA 4E3CA 2J0MA 2COAA 5L95C 4BKGA 4GMVA 2N1VA 3WA0A 1WFYA 4JKFA 3WAPA 3HQCA 2UZSA 2KHWB 1LB1A 3ODXA 3W1SA 2UVMA 3RULA 3U8ZA 3DXDA 3O65B 4AOFA 1X05A 3K9PB 3ULBA 1R4NI 1ZW7A 2WH5A 3QIJA 5KQ4A 2KK8A 3DDCB 2J59M 2K8HA 3P6AA 2PJHA 3T9LA 1V5OA 5J3QA 2IO1B 2KANA 3SDLC 2LRWA 2Z59B 4GZUA 4PS8A 3VQIA 2VRWB 3DBHI 2LASA 3BY4B 1VBGA 4W9KA 4HDOA 1MPHA 1E8ZA 2A5UA 3CMMB 5LXHA 3PRMB 3L54A 1V86A 1LFDA 1DYNA 3E66A 4NJ6A 2BKFA 4JKHA 2N7DA 2ASQA 2K2UA 1FHWA 2RSGA 1GNUA 1W1HA 1UZXB 2NBWB 3DVGX 4NPNA 4W9CA 4F1SA 1T0YA 1MKEA 2I5FA 3EFUA 2JF5A 2BWES 2O2VB 1UNRA 1M94A 1PMSA 4BVUC 3AJ4A 2L3ZA 2DX5A 4IG7B 4WQOB 4MK0A 1YIWA 1QC6A 1S1QB 1E7UA 4WWNA 1V5PA 3M63B 4FULA 3HM6X 3IBEA 3RZWC 4EUTA 3VUYA 2Z0PA 2Z0OA 4NSWA 3I3TB 4RM9A 4W9FA 3JYUA 4B9KA 2ZCBA 2C7MB 2CODA 1KZ7A 2D2QA 2KC2A 4EEWA 1U27A 4E74A 3M1IB 5L81A 2JZ3B 1Y5OA 2AEHA 3ODWA 3H7PA 3E9LA 4ICUA 2UWQA 2C5LC 3ML4A 2DYQA 2DFKA 1SE9A 3KYCD 1OQNA 3PS6A 1Q5WB 2BWFA 3R7QA 2JUOA 3LDZE 2NPTA 3QQ8B 1M7RA 2CHXA 1GC7A 1MK7B 1TJ6A 2OQBA 4WVFB 4TYZA 1E90A 2FCNA 2O6VA 1Z5SB 1H4RA 2Z0DB 2KDIA 1TTNA 4C0AA 5J17A 2P8VA 2RR9A 4JIOU 4HAZB 3FM8C 4H8SA 3A8PA 2MBHA 1BTKA 2WDTB 1V9JA 3ZTCA 4ILHA 2L0TA 2V76A 5G55A 1EUVB 4J6IA 3IFWB 3KUDB 2NS5A 5IA7A 1K5DB 3PG7A 3N7CA 1B55A 2GJYA 2CRFA 2L7RA 2MWSB 4MGYE 3VFKA 2R0DA 1NBFC 2M8SA 4NQKE 2I1JA 1DBHA 2YLMA 1UNPA 3K9OB 1P3RA 1WXMA 3GYPA 4MSQB 2IO3B 4JL9A 3W1YA 1WIAA 1WGQA 2COPA 1U5EA 4ANVA 2BCJA 1P1AA 3ZO5B 1ZGUB 2PE9A 3QX1A 3UQBA 2ROZB 2RUKB 1D3ZA 1WI0A 1MIZB 1PFJA 2EC1A 2L0FA 2J0JA 3GZNI 2W2WA 1XQQA 1WX7A 2NR2A 1VD2A 1WG7A 1YJ1A 2FIDA 4KDIC 1RRBA 3SO6A 1VBHA 4GIVA 4HB4B 3PLVA 3VXWA 3WALA 3V6EB 4F7UP 3APFA 2RGNB 3N30A 4A6HA 1HBKA 3ML8A 4JLCA 5DPWA 4JKDA 3U7DA 2KJ6A 2ZVOA 4K7WA 3V61A 3VH3B 2DYNA 3PV1A 3RT3B 2ADZA 3OAWA 2MDXA 4YL8A 5KHOA 4HPLB 3KZ1A 2W9NA 4P7IA 2ELBA 3OJ3A 4TQ0A 3VIAA 2KDFB 2P0FA 3L16A 1WX8A 2RSUA 3NHEB 2GMIC 2YS3A 2DHJA 2NVUI 3WIMA 3PSCA 3OLMD 1E8XA 3VAWA 3PZDA 4F8CB 2KTRB 4G50A 4M0WB 3ZKJC 1CMXB 2YT0A 1WRDB 3N3KB 5CHVC 4IW0A 5JHGA 4KZCA 4GDLB 4E71A 4JK8A 1DDMA 4HLEA 2DAJA 1C1YB 2W2XD 4MEMA 4GPTB 3VH4B 1ST7A 1L7YA 2DKQA 4IUMB 3TO1A 4WJ7A 1EF5A 2HTHA 1OEYA 1XT9B 1NU2A 1GG3A 2CKHB 2DA0A 3QARA 2N1WA 3QC8B 4F7GA 1V80A 2P0HA 1P98A 4EZLA 3E9OA 2YVCA 2LI5A 5C5BB 2WWZA 3HM3A 4HCNB 3A4RA 1LXDA 2K39A 3LJ3A 2M4NA 2OJRA 2N7EA 4DDID 5LONB 1X1FA 2GBNA 4MJSB 2COCA 4CO7A 4EOYA 1IRSA 2KQSA 3UINB 4ZRIA 2BKRB 2M38A 1UEFA 3UZTA 1OMWA 2R2QA 1WZ3A 3QJZA 1UNQA 5E6OA 5J2RA 2GBRA 4W9DA 3HHMA 4A3OA 4W9JA 4B6HA 3B1LX 3TJPA 3QWZB 1PQSA 1P9DU 5DPTA 5KHQA 1NTVA 2VKIA 1RLFA 5JZEB 3UF8A 2JRHA 1FGYA 3WAMA 2G45B 3UIPB 4HHVA 2GOWA 3UGBB 1SHCA 4I6PA 4PS7A 1OGWA 1LM8B 1V88A 3ZIMA 2KC1A 3PVLA 4JK9A 2XBBC 4FADA 2BYFA 3T06A 4DBBA 2CU1A 4F7ZA 2JZZA 4HB2B 4ZRKA 2EKEC 2KX3A 1WJNA 2QHOA 3H1UA 4AUQC 1WGUA 4KV2A 3AULA 3PVWA 4AP4C 4GU2A 2IYDB 1X1MA 4GMXB 3ZNZB 3IVFA 2GBMA 4A6FA 2WX0A 1BWNA 2DZJA 2KLCA 1FHOA 4MM3A 2BYEA 4DDGD 2KFJA 1ZSQA 1X1GA 3FSSA 4Z2MB 2N9XA 2C7NB 1E8WA 2L8JA 1KZGA 4L6EA 4HPMB 1W1GA 5DCNA 2D9VA 2G35A 2KLGA 4NNJB 4JKEA 4HAUB 4HAXB 1J8CA 2NBUA 1UBQA 1V5MA 1WJ4A 2M1MA 4K2PA 2ZVNA 4WWPA 2KUPA 4RM8A 4HB3B 2JP2A 1WMHB 4IWPA 2C7HA 2LOXA 4II2B 5JHHA 5KCVA 4W9IA 4HAVB 4D0NB 2D9WA 2V3SA 3JSVB 1WGRA 5C79A 3D32A 1KM7A 4ANUA 3H6NA 1I2HA 4NAWA 1NI2A 4K1RB 3DBRI 3UQAA 2MP2B 1RAXA 5AEKB 2DN6A 1QQGA 3WYFB 3QBVB 1XD3B 3CSFA 4WJQA 4A20A 2JT4B 4ICVA 2JPHA 5GOWB 4IWQA 1XX0A 2CQUA 2KO3A 2FCQA 3AI5A 3KVFB 3TIXA 1V5UA 3NZSA 4IFSA 4K17A 1H10A 2EMSA 4FA6A 2FAZA 2AWTA 1KLVA 3ALBA 3FLVA 3A8QA 2K8CA 2BPSA 5FI1A 5TR5A 4BBKA 3A33B 1XODA 3DOWA 3KW5B 4BKSD 1I7AA 1V61A 2C60A 2D4QA 4KVGB 1KBLA 4WSFA 4K7SA 1MK9B 2OOBB 4BOZB 2DKPA 3H9DA 2MX2A 1EVHA 2K6QA 1QZEA 3ODOA 2COFA 2FIFA 2H7DA 2NMBA 4FN2A 4K2OA 2KMAA 1J0GA 2N4FA 3N32A 2HJ8A 4LCDE 3W1SC 3PPAA 2IYBA 4PNKA 3D8EA 3PP2A 1G6JA 1YX6B 1LQBA 1HE8A 4G11A 3TL5A 3DBLI 3M62B 2KQ7A 2AYOB 4GDKB 3RCZA 1MG8A 3QHTA 4IM2A 3R7RA 4DHZB 1TGZB 5J18A 2KGXB 2O2VA 1I42A 3MTNB 1AQCA 4EZJA 2HE7A 2VSZA 2HRJA 1WGHA 2FUHB 4JKCA 1WJUA 3V62A 2B3AA 5C1ZA 3DVNU 2PPHA 1KI1B 5L83A 2ABDA 3RCPA 3PRZA 4LJOB 2XK5B 3TMPB 4DK5A 4JKAA 3NZUA 4OVVA 2N0YA 4EKUA 1IYFA 1L2NA 1K8RB 2LZ6A 3A9JB 1WXAA 3F0WA 2IY1B 1FGZA 2IO2B 2X0SA 3UIOB 2KTFA 3OANA 2KWUB 2RNRB 1R4MI 4MGKE 2DHIA 2KFKB 3VHTC 4M8MA 1GGOA 3EECA 3H7SA 4A5KA 5EFXA 3IHPC 3VTVA 4BOSC 3C0RB 5HE3A 2KOXA 1WY8A 1ISNA 2K25A 2MRPA 1TXDA 4PYUA 1LW3A 5LXIB 3T8MA 2D9ZA 2YT1A 3RD2A 4BKTA 2Q13A 5HE1A 4XWXA 1WM2A 1HB8A 2H7EA 1X86A 3P2BA 3PVUA 4FHJA 4MT7A 3VUWA 4CHMA 5AZFA 3P7ZA 1S3SG 2KXJA 4GOCA 2BGFA 3KUCB 3WAOA 2LKOA 2G4DB 2L00B 2LGDA 4TV3A 1RJ2A 1V2YA 4ZYNA 3A98B 2FCSA 2NCNA 2PE6B 2KNBA 3A1QB 2ZPNA 3EPYA 2MFQA 1J19A 3SUZA 1WE6A 2DZKA 1I35A 3BJIA 1WE7A 5DH9B 4HDQA 2JY6A 1UH6A 2KD0A 1WZ0A 2YS5A 5J3YA 3ONSA 3O96A 3AXCA 1Q1OA 1UPRA 1FXTB 2FCMA 4N9F4 3KSYA 2LXCA 1WR6E 2C9WB 4TKNA 1FB8A 1UBIA 2R82A 3L08A 3RUIB 2OTXA 3PLUA 5DI9B 4KIKB 5AZHA 2RGFA 1NDDA 2JXXA 1KOTA 1DDVA 2CY5A 2K2JA 5D3VA 2KKCA 4XC2A 5FR6A 3GOEA 3SYXA 2CHZA 3PGEA 1IPGA 3JW0X 2N9PC 2ZZPB 4FJZA 4F7HA 4WJNA 4FJVB 3B08A 3R66C 3X0WA 5AZGA 2LG1A 1KC7A 1TQZA 4HJKA 2Z0QA 3GYOA 1P3QU 2MBEA 4W9GA 1E7VA 2LGYA 5FI0A 5DHAB 1UGMA 5JP4A 4URKA 2REXA 2HD5B 2J7QB 1ACAA 2FJLA 5D3WA 3EC8A 3VDZA 1MIXA 2ROVA 5BO4B 2IBIB 3AU4A 4K7UA 2Y5BB 2RPQA 2KDBA 5C23A 2KTRA 3ENBA 5E6PA 3PREA 2ZJDA 1YD8U 5D6JB 4LDTB 4G0NB 2BF8B 3SBTA 1OY2A 4GDLA 3QAQA 1NTYA 3MHSD 3JVZX 1TZ1A 2M17A 3KRWA 1EGXA 4KAXB 4MY6A 4G3XB 4KIKA 4MDKE 4DHJD 4W9HA 3QK0A 3CIKA 2P0DA 3ZUNA 2KWVB 3QWMA 5HKHA 5C5BA 4IAPA 2CS4A 2JVCA 3ZTDA 4W9LA 2YSZA 2MBOA 5JH5C 5LLIA 2FNJB 2LUEA 5D2MB 1EO6A 4MJSA 2MWNB 5GMVA 4HVBA 3PT2B 2RVBB 3DBSA 4KHAA 1X11A 2CHWA 1PLSA 3V60A 3TCAA 3ENEA 5C6RA 4MGIE 5CTRC 3TW1A 1WGDA 2LJ5A 2N23A 2ZNVC 1WJ6A 3L10B 3ULCA 1C3TA 1KJTA 1Y8RC 3BINA 3HK0A 3TFMA 1M7EA 4BBNF 2LOZA 1ZC4B 4MSMB 4ILJA 5DHFB 2KDEB 3CSTA 2MCNB 3E9PA 2LYDA 4IM0A 2LWPA 3DPDA 1N3HA 2MBQA 4LDTD 4FJYA 1Z87A 5G2NA 3KH0A 2YS1A 2IZVB 4TUUA 4IM3A 4NJ7A 2R09A 3SNHA 2DX5B 2DYOA 3FP5A 2LBBA 2LVOA 2DLWA 1ZM0A 2D3GA 4NY0A 3VTUA 1ZVRA 2D9YA 4ASWC 3DXEA 2CR5A 2GCJA 2I5CA 3NOBA 1H8CA 5JVLA 1OEYJ 2GBKA 3SHQA 4NQLB 3MJWA 4HAYB 2Y7BA 5D3XA 4RMAA 3VTWA 3H7PB 4CYEA 3R3MA 4W9EA 2J0KA 2QKMA 2JRIB 1IP9A 1WM3A 2G4SA 2L76A 4BBNC 5IJMA 1ZKHA 2K6DB 4GXBA 2K8BA 3ECIA 2N9EB 5D3YA 5CHFA 2NPTB 2VRRB 5D27A 3IG3A 1V6EA 2XEWA 2JWZA 2DHKA 3SD5A 2KX0A 5D7GA 3DVGY 1Q67A 4IC7B 2MQJA 2O6VB 1YQBA 2GBJA 5EDSA 4BKSA 3F5RA 3U30A 1V49A 2AL3A 2MBBB 1NTIA 5D94A 2KWCA 1J0WA 1GC6A 4MH0E 3ZLZA 2LRUA 1WYWB 1EAZA 1WMHA 1U2BA 3PTFC 1MAIA 3MDBC 1WF9A 4XZ4A 2YRYA 3ZRCA 2NBVB 4PYZA 3ZNHB 1TBEA 3JSVA 3KUZA 2PZ1A 2LVPA 2KZRA 1WI1A 2E2XA 2EJ8A 2DYBA 1W1DA 3ZNID 4ZRJA 2Y8GA 2K00A 4M8NA 3PSEB 4Z2NA 4Y94A 1BT0A 3TBLD 4ILGB 1U5FA 2MP2A 1WX9A 3KY9A 4DX8A 3D8FA 2KCJA 2XQNM 3M3JA 4I6LB 3LJUX 4FBJB 5CX3A 2ELAA 1P5TA 3EHVA 4IOYX 3DXCA 2CY4A 1SIFA 3RZFA 2GS0A 1UPQA 1NVLA 1UELA 3QCAA 1JRUA 2NZ8B 4WAAA 3ZVVA 3M95A 2IY0B 2FDQA 2MLBA 4EMOA 3MPXA 2O6VD 5HE2A 4TQ1A 3CF6E 3APDA 4BFRA 4K81A 1P0RA 4YONA 4LJPB 2D10A 1K5GB 1P6SA 4KSLC 1GUAB 2UYZB 3TVVA 3L0WB 4HB0B 3NSUA 2K1FA 5LOPB 3FEHA 2KMCA 2LGXA 4PS3A 2MW5A 1WGYA 2DHZA 3VOQA 4HAWB 2G3QB 4WJOA 3ZRFA 4WJPA 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3J A;  4AWJ A;  5KQ1 A;  3ZNG C;  2CAY A;  4GGQ A;  3NS8 A;  3B0A A;  2PEA A;  2L2I A;  4GB9 A;  1HB6 A;  1FAO A;  2RLO A;  5JLJ B;  4GDK A;  3A4S C;  2FJ9 A;  4I6N B;  2AL6 A;  1SGH A;  3APC A;  2Z0E B;  4WWO A;  1OQY A;  3ZDT A;  3PRP B;  4MGZ E;  4FHK A;  2ZNV B;  2LXA A;  2LUL A;  1XD4 A;  1XCG A;  4DBG A;  4JGH B;  2V1Y A;  3ZW3 A;  2HTH B;  2DX1 A;  1WJM A;  1U5G A;  2XK5 A;  2D07 B;  3ML9 A;  2LVQ A;  1UD7 A;  2UZR A;  1WH3 A;  1WXS A;  5JHB A;  2D9X A;  4XX5 A;  3WAN A;  3A9J A;  2RQ1 A;  1WJ1 A;  4A6K A;  2L05 A;  1U4A A;  3G9W A;  3KRX A;  1V5T A;  4EZK A;  2DAF A;  5IAA C;  3DQV A;  2YF0 A;  5DIF B;  1Z2M A;  1E5W A;  1DDW A;  2KFK A;  5DPS A;  5JHA A;  4ANW A;  1U5D A;  4IWO A;  2A4Z A;  3PEG A;  1WR1 A;  3SV1 A;  2X18 A;  4MEL A;  3OJ4 B;  1XR0 B;  1EF1 A;  2ZCC A;  4GSW A;  1FOE A;  3S2A A;  2EMT A;  2V4L A;  4DHJ B;  2MKR A;  4KDL B;  2MSE D;  2WYQ A;  3V6C B;  3DVN V;  4DWF A;  4DHZ E;  1Y19 B;  2KVR A;  4HAT B;  1E8Y A;  2KJR A;  3Q3F A;  3A9K B;  5CLL B;  1AAR A;  4KSK C;  2QKL A;  5HE0 A;  3D8D A;  4DX9 0;  2ZPY A;  2D11 A;  4JQW C;  1VCB A;  1YX5 B;  3KYD D;  4CHJ A;  3ZVR A;  3A1Q A;  1DRO A;  4ANX A;  3NY5 A;  3PHX B;  4AJY B;  2MA9 B;  4A3P A;  1XKE A;  4HWI B;  4ZDV A;  4EJN A;  4AJW A;  1V81 A;  1BTN A;  1OTR B;  1WXV A;  5CLQ B;  2GCL A;  2CB8 A;  4II3 B;  3VUX A;  5J3T A;  2L1C A;  1AWE A;  2DZI A;  2IFS A;  5CHW A;  1BAK A;  4A6F B;  1RFA A;  3V5W A;  3QA8 A;  2I1K A;  3ZDM C;  1U29 A;  2LD9 A;  2WX1 A;  4KZ0 A;  3HIZ A;  4HK2 A;  1FHX A;  3HW2 B;  5C16 A;  1WGG A;  3PHW B;  4KHO A;  4HXD A;  3CXB B;  3RYT A;  2DYM A;  4FLH A;  3L17 A;  1GJZ A;  4CHK A;  3A9K A;  2KN5 A;  3SU8 X;  2IO0 B;  2Y8F A;  2BYV E;  3L13 A;  3DCG A;  1RRP B;  1WVH A;  1ZC3 B;  4HCP B;  4OVU A;  2M14 A;  5E6N A;  2M0X A;  1F9J A;  4KHB B;  4GN1 A;  2ZEQ A;  2DEN B;  4EFO A;  3VVW B;  1V89 A;  2W2X C;  1Q0W B;  5DPR A;  2R2O A;  1A5R A;  2DTC A;  2KJH B;  4PQ0 A;  3AU5 A;  3X23 A;  4NAW B;  4X57 B;  2DZM A;  2RD0 A;  4B95 A;  4B6W A;  4E3C A;  2J0M A;  2COA A;  5L95 C;  4BKG A;  4GMV A;  2N1V A;  3WA0 A;  1WFY A;  3WAP A;  3HQC A;  2UZS A;  2KHW B;  1LB1 A;  3ODX A;  3W1S A;  2UVM A;  3RUL A;  3U8Z A;  3DXD A;  3O65 B;  4AOF A;  1X05 A;  3K9P B;  3ULB A;  1R4N I;  1ZW7 A;  2WH5 A;  3QIJ A;  5KQ4 A;  2KK8 A;  3DDC B;  2J59 M;  2K8H A;  3P6A A;  2PJH A;  3T9L A;  1V5O A;  5J3Q A;  2IO1 B;  2KAN A;  3SDL C;  2LRW A;  2Z59 B;  4GZU A;  4PS8 A;  3VQI A;  2VRW B;  3DBH I;  2LAS A;  3BY4 B;  4W9K A;  4HDO A;  1MPH A;  1E8Z A;  2A5U A;  3CMM B;  5LXH A;  3PRM B;  3L54 A;  1V86 A;  1LFD A;  1DYN A;  4NJ6 A;  2BKF A;  2N7D A;  2ASQ A;  2K2U A;  1FHW A;  2RSG A;  1GNU A;  1W1H A;  1UZX B;  2NBW B;  3DVG X;  4NPN A;  4W9C A;  4F1S A;  1T0Y A;  1MKE A;  2I5F A;  3EFU A;  2JF5 A;  2BWE S;  2O2V B;  1UNR A;  1M94 A;  1PMS A;  4BVU C;  3AJ4 A;  2L3Z A;  2DX5 A;  4IG7 B;  4WQO B;  4MK0 A;  1YIW A;  1QC6 A;  1S1Q B;  1E7U A;  4WWN A;  1V5P A;  3M63 B;  4FUL A;  3HM6 X;  3IBE A;  3RZW C;  4EUT A;  3VUY A;  2Z0P A;  2Z0O A;  4NSW A;  3I3T B;  4RM9 A;  4W9F A;  3JYU A;  4B9K A;  2ZCB A;  2C7M B;  2COD A;  1KZ7 A;  2D2Q A;  2KC2 A;  4EEW A;  1U27 A;  4E74 A;  3M1I B;  5L81 A;  2JZ3 B;  1Y5O A;  2AEH A;  3ODW A;  3H7P A;  4ICU A;  2UWQ A;  2C5L C;  3ML4 A;  2DYQ A;  2DFK A;  1SE9 A;  3KYC D;  1OQN A;  3PS6 A;  1Q5W B;  2BWF A;  3R7Q A;  2JUO A;  3LDZ E;  2NPT A;  3QQ8 B;  1M7R A;  2CHX A;  1GC7 A;  1MK7 B;  1TJ6 A;  2OQB A;  4WVF B;  4TYZ A;  1E90 A;  2FCN A;  2O6V A;  1Z5S B;  1H4R A;  2Z0D B;  2KDI A;  1TTN A;  4C0A A;  5J17 A;  2P8V A;  2RR9 A;  4JIO U;  4HAZ B;  3FM8 C;  4H8S A;  3A8P A;  2MBH A;  1BTK A;  2WDT B;  1V9J A;  3ZTC A;  2L0T A;  2V76 A;  5G55 A;  1EUV B;  4J6I A;  3IFW B;  3KUD B;  2NS5 A;  5IA7 A;  1K5D B;  3PG7 A;  3N7C A;  1B55 A;  2GJY A;  2CRF A;  2L7R A;  2MWS B;  4MGY E;  3VFK A;  2R0D A;  1NBF C;  2M8S A;  4NQK E;  2I1J A;  1DBH A;  2YLM A;  1UNP A;  3K9O B;  1P3R A;  1WXM A;  3GYP A;  4MSQ B;  2IO3 B;  4JL9 A;  3W1Y A;  1WIA A;  1WGQ A;  2COP A;  1U5E A;  4ANV A;  2BCJ A;  1P1A A;  3ZO5 B;  1ZGU B;  2PE9 A;  3QX1 A;  3UQB A;  2ROZ B;  2RUK B;  1D3Z A;  1WI0 A;  1MIZ B;  1PFJ A;  2EC1 A;  2L0F A;  2J0J A;  3GZN I;  2W2W A;  1XQQ A;  1WX7 A;  2NR2 A;  1VD2 A;  1WG7 A;  1YJ1 A;  2FID A;  4KDI C;  1RRB A;  3SO6 A;  4GIV A;  4HB4 B;  3PLV A;  3VXW A;  3WAL A;  3V6E B;  4F7U P;  3APF A;  2RGN B;  3N30 A;  4A6H A;  1HBK A;  3ML8 A;  4JLC A;  5DPW A;  4K7W A;  3U7D A;  2KJ6 A;  2ZVO A;  3V61 A;  3VH3 B;  2DYN A;  3PV1 A;  3RT3 B;  2ADZ A;  3OAW A;  2MDX A;  4YL8 A;  5KHO A;  4HPL B;  3KZ1 A;  2W9N A;  4P7I A;  2ELB A;  3OJ3 A;  4TQ0 A;  3VIA A;  2KDF B;  2P0F A;  3L16 A;  1WX8 A;  2RSU A;  3NHE B;  2GMI C;  2YS3 A;  2DHJ A;  2NVU I;  3WIM A;  3PSC A;  3OLM D;  1E8X A;  3VAW A;  3PZD A;  4F8C B;  2KTR B;  4G50 A;  4M0W B;  3ZKJ C;  1CMX B;  2YT0 A;  1WRD B;  3N3K B;  5CHV C;  4IW0 A;  5JHG A;  4KZC A;  4GDL B;  4E71 A;  1DDM A;  4HLE A;  2DAJ A;  1C1Y B;  2W2X D;  4MEM A;  4GPT B;  3VH4 B;  1ST7 A;  1L7Y A;  2DKQ A;  4IUM B;  3TO1 A;  4WJ7 A;  1EF5 A;  2HTH A;  1OEY A;  1XT9 B;  1NU2 A;  1GG3 A;  2CKH B;  2DA0 A;  3QAR A;  2N1W A;  3QC8 B;  4F7G A;  1V80 A;  2P0H A;  1P98 A;  4EZL A;  2LI5 A;  2YVC A;  5C5B B;  2WWZ A;  3HM3 A;  4HCN B;  3A4R A;  1LXD A;  2K39 A;  3LJ3 A;  2M4N A;  2OJR A;  2N7E A;  4DDI D;  5LON B;  1X1F A;  2GBN A;  4MJS B;  2COC A;  4CO7 A;  4EOY A;  1IRS A;  2KQS A;  3UIN B;  4ZRI A;  2BKR B;  2M38 A;  1UEF A;  3UZT A;  1OMW A;  2R2Q A;  1WZ3 A;  3QJZ A;  1UNQ A;  5E6O A;  5J2R A;  2GBR A;  4W9D A;  3HHM A;  4A3O A;  4W9J A;  4B6H A;  3B1L X;  3TJP A;  3QWZ B;  1PQS A;  1P9D U;  5DPT A;  5KHQ A;  1NTV A;  2VKI A;  1RLF A;  5JZE B;  3UF8 A;  2JRH A;  1FGY A;  3WAM A;  2G45 B;  3UIP B;  4HHV A;  2GOW A;  3UGB B;  1SHC A;  4I6P A;  4PS7 A;  1OGW A;  1LM8 B;  1V88 A;  3ZIM A;  2KC1 A;  3PVL A;  2XBB C;  4FAD A;  2BYF A;  3T06 A;  4DBB A;  2CU1 A;  4F7Z A;  2JZZ A;  4HB2 B;  4ZRK A;  2EKE C;  2KX3 A;  1WJN A;  2QHO A;  3H1U A;  4AUQ C;  1WGU A;  4KV2 A;  3AUL A;  3PVW A;  4AP4 C;  4GU2 A;  2IYD B;  1X1M A;  4GMX B;  3ZNZ B;  3IVF A;  2GBM A;  4A6F A;  2WX0 A;  1BWN A;  2DZJ A;  2KLC A;  1FHO A;  4MM3 A;  2BYE A;  4DDG D;  2KFJ A;  1ZSQ A;  1X1G A;  3FSS A;  4Z2M B;  2N9X A;  2C7N B;  1E8W A;  2L8J A;  1KZG A;  4L6E A;  4HPM B;  1W1G A;  5DCN A;  2D9V A;  2G35 A;  2KLG A;  4NNJ B;  4HAU B;  4HAX B;  1J8C A;  2NBU A;  1UBQ A;  1V5M A;  1WJ4 A;  2M1M A;  4K2P A;  2ZVN A;  4WWP A;  2KUP A;  4RM8 A;  4HB3 B;  2JP2 A;  1WMH B;  4IWP A;  2C7H A;  2LOX A;  4II2 B;  5JHH A;  5KCV A;  4W9I A;  4HAV B;  4D0N B;  2D9W A;  2V3S A;  3JSV B;  1WGR A;  5C79 A;  3D32 A;  1KM7 A;  4ANU A;  3H6N A;  1I2H A;  4NAW A;  1NI2 A;  4K1R B;  3DBR I;  3UQA A;  2MP2 B;  1RAX A;  5AEK B;  2DN6 A;  1QQG A;  3WYF B;  3QBV B;  1XD3 B;  3CSF A;  4WJQ A;  4A20 A;  2JT4 B;  4ICV A;  2JPH A;  5GOW B;  4IWQ A;  1XX0 A;  2CQU A;  2KO3 A;  2FCQ A;  3AI5 A;  3KVF B;  3TIX A;  1V5U A;  3NZS A;  4IFS A;  4K17 A;  1H10 A;  2EMS A;  4FA6 A;  2FAZ A;  2AWT A;  1KLV A;  3ALB A;  3FLV A;  3A8Q A;  2K8C A;  2BPS A;  5FI1 A;  5TR5 A;  4BBK A;  3A33 B;  1XOD A;  3DOW A;  3KW5 B;  4BKS D;  1I7A A;  1V61 A;  2C60 A;  2D4Q A;  4KVG B;  4WSF A;  4K7S A;  1MK9 B;  2OOB B;  4BOZ B;  2DKP A;  3H9D A;  2MX2 A;  1EVH A;  2K6Q A;  1QZE A;  3ODO A;  2COF A;  2FIF A;  2H7D A;  2NMB A;  4FN2 A;  4K2O A;  2KMA A;  1J0G A;  2N4F A;  3N32 A;  2HJ8 A;  4LCD E;  3W1S C;  3PPA A;  2IYB A;  4PNK A;  3D8E A;  3PP2 A;  1G6J A;  1YX6 B;  1LQB A;  1HE8 A;  4G11 A;  3TL5 A;  3DBL I;  3M62 B;  2KQ7 A;  2AYO B;  4GDK B;  3RCZ A;  1MG8 A;  3QHT A;  4IM2 A;  3R7R A;  4DHZ B;  1TGZ B;  5J18 A;  2KGX B;  2O2V A;  1I42 A;  3MTN B;  1AQC A;  4EZJ A;  2HE7 A;  2VSZ A;  2HRJ A;  1WGH A;  2FUH B;  1WJU A;  3V62 A;  2B3A A;  5C1Z A;  3DVN U;  2PPH A;  1KI1 B;  5L83 A;  2ABD A;  3RCP A;  3PRZ A;  4LJO B;  2XK5 B;  3TMP B;  4DK5 A;  3NZU A;  4OVV A;  2N0Y A;  4EKU A;  1IYF A;  1L2N A;  1K8R B;  2LZ6 A;  3A9J B;  1WXA A;  3F0W A;  2IY1 B;  1FGZ A;  2IO2 B;  3UIO B;  2KTF A;  3OAN A;  2KWU B;  2RNR B;  1R4M I;  4MGK E;  2DHI A;  2KFK B;  3VHT C;  4M8M A;  3EEC A;  3H7S A;  4A5K A;  5EFX A;  3IHP C;  3VTV A;  4BOS C;  3C0R B;  5HE3 A;  2KOX A;  1WY8 A;  1ISN A;  2K25 A;  2MRP A;  1TXD A;  4PYU A;  1LW3 A;  5LXI B;  3T8M A;  2D9Z A;  2YT1 A;  3RD2 A;  4BKT A;  2Q13 A;  5HE1 A;  4XWX A;  1WM2 A;  1HB8 A;  2H7E A;  1X86 A;  3P2B A;  3PVU A;  4FHJ A;  4MT7 A;  3VUW A;  4CHM A;  5AZF A;  3P7Z A;  1S3S G;  2KXJ A;  4GOC A;  2BGF A;  3KUC B;  3WAO A;  2LKO A;  2G4D B;  2L00 B;  2LGD A;  4TV3 A;  1RJ2 A;  1V2Y A;  4ZYN A;  3A98 B;  2FCS A;  2NCN A;  2PE6 B;  2KNB A;  3A1Q B;  2ZPN A;  3EPY A;  2MFQ A;  1J19 A;  3SUZ A;  1WE6 A;  2DZK A;  1I35 A;  3BJI A;  1WE7 A;  5DH9 B;  4HDQ A;  2JY6 A;  1UH6 A;  2KD0 A;  1WZ0 A;  2YS5 A;  5J3Y A;  3ONS A;  3O96 A;  3AXC A;  1Q1O A;  1UPR A;  1FXT B;  2FCM A;  4N9F 4;  3KSY A;  2LXC A;  1WR6 E;  2C9W B;  4TKN A;  1FB8 A;  1UBI A;  3L08 A;  3RUI B;  2OTX A;  3PLU A;  5DI9 B;  4KIK B;  5AZH A;  2RGF A;  1NDD A;  2JXX A;  1KOT A;  1DDV A;  2CY5 A;  2K2J A;  5D3V A;  2KKC A;  4XC2 A;  5FR6 A;  3GOE A;  3SYX A;  2CHZ A;  3PGE A;  1IPG A;  3JW0 X;  2N9P C;  2ZZP B;  4FJZ A;  4F7H A;  4WJN A;  4FJV B;  3B08 A;  3R66 C;  3X0W A;  5AZG A;  2LG1 A;  1TQZ A;  4HJK A;  2Z0Q A;  3GYO A;  1P3Q U;  2MBE A;  4W9G A;  1E7V A;  2LGY A;  5FI0 A;  5DHA B;  1UGM A;  5JP4 A;  4URK A;  2REX A;  2HD5 B;  2J7Q B;  1ACA A;  2FJL A;  5D3W A;  3EC8 A;  3VDZ A;  1MIX A;  2ROV A;  5BO4 B;  2IBI B;  3AU4 A;  4K7U A;  2Y5B B;  2RPQ A;  2KDB A;  5C23 A;  2KTR A;  5E6P A;  3PRE A;  2ZJD A;  1YD8 U;  5D6J B;  4LDT B;  4G0N B;  2BF8 B;  1OY2 A;  4GDL A;  3QAQ A;  1NTY A;  3MHS D;  3JVZ X;  1TZ1 A;  2M17 A;  3KRW A;  1EGX A;  4KAX B;  4MY6 A;  4G3X B;  4KIK A;  4MDK E;  4DHJ D;  4W9H A;  3QK0 A;  3CIK A;  2P0D A;  3ZUN A;  2KWV B;  3QWM A;  5HKH A;  5C5B A;  4IAP A;  2CS4 A;  2JVC A;  3ZTD A;  4W9L A;  2YSZ A;  2MBO A;  5JH5 C;  5LLI A;  2FNJ B;  2LUE A;  5D2M B;  1EO6 A;  4MJS A;  2MWN B;  5GMV A;  4HVB A;  3PT2 B;  2RVB B;  3DBS A;  4KHA A;  1X11 A;  2CHW A;  1PLS A;  3V60 A;  3TCA A;  3ENE A;  5C6R A;  4MGI E;  5CTR C;  3TW1 A;  1WGD A;  2LJ5 A;  2N23 A;  2ZNV C;  1WJ6 A;  3L10 B;  3ULC A;  1C3T A;  1KJT A;  1Y8R C;  3BIN A;  3HK0 A;  3TFM A;  1M7E A;  4BBN F;  2LOZ A;  1ZC4 B;  4MSM B;  5DHF B;  2KDE B;  3CST A;  2MCN B;  2LYD A;  4IM0 A;  2LWP A;  3DPD A;  1N3H A;  2MBQ A;  4LDT D;  4FJY A;  1Z87 A;  5G2N A;  3KH0 A;  2YS1 A;  2IZV B;  4TUU A;  4IM3 A;  4NJ7 A;  2R09 A;  3SNH A;  2DX5 B;  2DYO A;  3FP5 A;  2LBB A;  2LVO A;  2DLW A;  1ZM0 A;  2D3G A;  4NY0 A;  3VTU A;  1ZVR A;  2D9Y A;  4ASW C;  3DXE A;  2CR5 A;  2GCJ A;  2I5C A;  3NOB A;  1H8C A;  1OEY J;  2GBK A;  3SHQ A;  4NQL B;  3MJW A;  4HAY B;  2Y7B A;  5D3X A;  4RMA A;  3VTW A;  3H7P B;  4CYE A;  3R3M A;  4W9E A;  2J0K A;  2QKM A;  2JRI B;  1IP9 A;  1WM3 A;  2G4S A;  2L76 A;  4BBN C;  5IJM A;  1ZKH A;  2K6D B;  4GXB A;  2K8B A;  3ECI A;  2N9E B;  5D3Y A;  5CHF A;  2NPT B;  2VRR B;  5D27 A;  3IG3 A;  1V6E A;  2XEW A;  2JWZ A;  2DHK A;  3SD5 A;  2KX0 A;  5D7G A;  3DVG Y;  1Q67 A;  4IC7 B;  2MQJ A;  2O6V B;  1YQB A;  2GBJ A;  5EDS A;  4BKS A;  3F5R A;  3U30 A;  1V49 A;  2AL3 A;  2MBB B;  1NTI A;  5D94 A;  2KWC A;  1J0W A;  1GC6 A;  4MH0 E;  3ZLZ A;  2LRU A;  1WYW B;  1EAZ A;  1WMH A;  1U2B A;  3PTF C;  1MAI A;  3MDB C;  1WF9 A;  4XZ4 A;  2YRY A;  3ZRC A;  2NBV B;  4PYZ A;  3ZNH B;  1TBE A;  3JSV A;  3KUZ A;  2PZ1 A;  2LVP A;  2KZR A;  1WI1 A;  2E2X A;  2EJ8 A;  2DYB A;  1W1D A;  3ZNI D;  4ZRJ A;  2Y8G A;  2K00 A;  4M8N A;  3PSE B;  4Z2N A;  4Y94 A;  1BT0 A;  3TBL D;  1U5F A;  2MP2 A;  1WX9 A;  3KY9 A;  4DX8 A;  3D8F A;  2KCJ A;  2XQN M;  3M3J A;  4I6L B;  3LJU X;  4FBJ B;  5CX3 A;  1P5T A;  2ELA A;  3EHV A;  4IOY X;  3DXC A;  2CY4 A;  1SIF A;  3RZF A;  2GS0 A;  1UPQ A;  1NVL A;  1UEL A;  3QCA A;  1JRU A;  2NZ8 B;  4WAA A;  3ZVV A;  3M95 A;  2IY0 B;  2FDQ A;  2MLB A;  4EMO A;  3MPX A;  2O6V D;  5HE2 A;  4TQ1 A;  3CF6 E;  3APD A;  4BFR A;  4K81 A;  1P0R A;  4YON A;  4LJP B;  2D10 A;  1K5G B;  1P6S A;  4KSL C;  1GUA B;  2UYZ B;  3TVV A;  3L0W B;  4HB0 B;  3NSU A;  2K1F A;  5LOP B;  3FEH A;  2KMC A;  2LGX A;  4PS3 A;  2MW5 A;  1WGY A;  2DHZ A;  3VOQ A;  4HAW B;  2G3Q B;  4WJO A;  3ZRF A;  4WJP A;  4DXA B; 
#chains in the Genus database with same CATH topology
 3Q3J A;  1FIQ A;  4AWJ A;  5KQ1 A;  4P16 A;  2M19 A;  3ZNG C;  1D4B A;  1TKY A;  4JK7 A;  2CAY A;  4GGQ A;  3NS8 A;  4QAY A;  3B0A A;  2PEA A;  1XXG A;  2L2I A;  4GB9 A;  1HB6 A;  1FAO A;  2RLO A;  1QQR A;  5JLJ B;  3MC0 B;  4GDK A;  3LXF A;  4A9A A;  3A4S C;  2FJ9 A;  4I6N B;  2AL6 A;  1SGH A;  3APC A;  1YQ3 B;  2Z0E B;  1D6E C;  4WWO A;  1OQY A;  1FMA D;  2INP E;  4HSI A;  3ZDT A;  1VDV A;  2L83 A;  3PRP B;  4MGZ E;  4FHK A;  2ZNV B;  4JKB A;  2LXA A;  2LUL A;  1XD4 A;  1XCG A;  1BXT A;  2M56 B;  4DBG A;  2H89 B;  2CJO A;  4JGH B;  2V1Y A;  1FNW A;  3P63 A;  3SBG A;  3ZW3 A;  2HTH B;  2GRI A;  1JWM D;  2DX1 A;  2SEB D;  2V0G A;  1WJM A;  1GAQ B;  1U5G A;  2XK5 A;  2D07 B;  3SEB A;  2BW2 A;  2PVO D;  3ML9 A;  4LNN A;  5IO9 A;  4C80 A;  2LVQ A;  2DLB A;  1UD7 A;  3HUI A;  3B2G A;  2UZR A;  1WH3 A;  1WXS A;  4S17 A;  5JHB A;  1F1H A;  1ZPS A;  2LFI A;  2D9X A;  4XX5 A;  3WAN A;  3A9J A;  2RQ1 A;  1WJ1 A;  4A6K A;  2L05 A;  1U4A A;  3G9W A;  3KRX A;  1V5T A;  4EZK A;  2DAF A;  5IAA C;  3DQV A;  5JXV A;  2QC8 A;  3W9C B;  2YF0 A;  1ENF A;  5DIF B;  1Z2M A;  1E5W A;  1QT9 A;  3CIR B;  3DBH B;  1DDW A;  3HVZ A;  2KFK A;  3BVZ A;  5BYS A;  1HEZ E;  5DPS A;  5JHA A;  4ANW A;  1I4R A;  2LHD A;  2KN4 A;  3NWF A;  3AB5 A;  2GLS A;  1U5D A;  2GB1 A;  2V3N A;  2J52 A;  4IWO A;  2A4Z A;  3PEG A;  1MI0 A;  3N1Z C;  1WR1 A;  3SV1 A;  2X18 A;  4MEL A;  1N63 A;  3OJ4 B;  3AE3 B;  4C56 C;  1XR0 B;  1L6U A;  1EF1 A;  2ZCC A;  1C4A A;  4GSW A;  3BZD B;  1FOE A;  4LK0 M;  4XYC A;  1DIK A;  2EMT A;  1PGX A;  3S2A A;  2V4L A;  4DHJ B;  3NWA A;  2MKR A;  4KDL B;  2MSE D;  2WYQ A;  4M00 A;  3L4P A;  3V6C B;  3DVN V;  4WUR A;  3EGR A;  4DWF A;  2WNM A;  4KX6 B;  4DHZ E;  1Y19 B;  5M4Y B;  1IUE A;  2KVR A;  5HG2 A;  1RFK A;  3P4S B;  4DQO C;  4HAT B;  1E8Y A;  1C4P A;  2KJR A;  3Q3F A;  3A9K B;  5CLL B;  1AAR A;  3EUB 2;  4KSK C;  2QKL A;  3URY A;  2JXT A;  5LG4 B;  5HE0 A;  3NVZ A;  3D8D A;  4DX9 0;  2ZPY A;  2D11 A;  4JKG B;  4JQW C;  1VCB A;  1YX5 B;  1PYW D;  3KYD D;  4CHJ A;  2WXF A;  3ZVR A;  3A1Q A;  3AE7 B;  1DRO A;  4ANX A;  4USA A;  3NY5 A;  3PHX B;  4AJY B;  2MA9 B;  2DBY A;  5BMG A;  4A3P A;  1XKE A;  4HWI B;  4ZDV A;  1JWS D;  4EJN A;  4AJW A;  1RYJ A;  1BTN A;  1OTR B;  1V81 A;  3OG5 A;  1WXV A;  1QOA A;  1NI3 A;  4BZA A;  5CLQ B;  2GCL A;  2CB8 A;  4II3 B;  3VUX A;  5G5G A;  3HIE A;  5J3T A;  2L1C A;  1AWE A;  2DZI A;  3ZJV A;  2IFS A;  5CHW A;  1BAK A;  1TKG A;  4A6F B;  1RFA A;  3V5W A;  3QA8 A;  4MM3 B;  2BYT A;  2SAK A;  2I1K A;  1CK1 A;  1MVK A;  4GNK B;  3ZDM C;  2DIK A;  1U29 A;  2FE8 A;  2LD9 A;  2DNF A;  1V1P B;  2WX1 A;  4KZ0 A;  3PO0 A;  1N5W A;  3P4Q B;  4HKZ E;  1ZP0 B;  3HIZ A;  3MC8 A;  4HK2 A;  3I9V 1;  3ETR A;  1FHX A;  2L1A A;  3HW2 B;  5C16 A;  4HPP A;  1WGG A;  1I4X A;  3P4P B;  1VJK A;  5I2S A;  2X8X X;  3PHW B;  4KHO A;  4HXD A;  3CXB B;  3RYT A;  2DYM A;  2KT7 A;  1FM0 D;  1UWM A;  4FLH A;  3L17 A;  1GJZ A;  1TZO A;  3TEW A;  1JDE A;  4CHK A;  3A9K A;  1KFY B;  2KN5 A;  3SU8 X;  1N62 A;  2IO0 B;  5EE9 A;  2Y8F A;  2BYV E;  3L13 A;  5I4D A;  3DCG A;  1RRP B;  1WVH A;  1ZC3 B;  4HCP B;  1FO4 A;  4OVU A;  4JKG A;  2M14 A;  2MH7 A;  5E6N A;  3IAS 1;  2M0X A;  1F9J A;  3I5J C;  4KHB B;  3VRA B;  1DYQ A;  5EE3 A;  3ZXR A;  4GN1 A;  3MJ5 A;  4WQM A;  2ZEQ A;  2DEN B;  4EFO A;  1Q0W B;  1V89 A;  2W2X C;  3VVW B;  5DPR A;  3TSS A;  2R2O A;  1A5R A;  2DTC A;  2KJH B;  4PQ0 A;  2J53 A;  3AU5 A;  1EU4 A;  3N1X C;  3X23 A;  4NAW B;  4L23 A;  1SJE D;  4LNF A;  4X57 B;  2DZM A;  2RD0 A;  2I2Y A;  4B95 A;  2W55 A;  4B6W A;  4E3C A;  2J0M A;  2COA A;  5L95 C;  1IGC A;  4BKG A;  4GMV A;  1B1Z A;  2N1V A;  3WA0 A;  1WFY A;  4JKF A;  3WAP A;  3HQC A;  2UZS A;  2KHW B;  1LB1 A;  1JWA D;  3AEA B;  3ODX A;  3NS1 A;  3W1S A;  2UVM A;  2PTL A;  3RUL A;  1XLQ A;  1J7A A;  3U8Z A;  3DXD A;  3O65 B;  4AOF A;  2FJU B;  1I4Q A;  1X05 A;  3K9P B;  1RM6 C;  3ULB A;  1R4N I;  1ZW7 A;  2WH5 A;  3QIJ A;  5KQ4 A;  2KK8 A;  2IND C;  1YOV B;  1NEN B;  3DDC B;  3GZN B;  2J59 M;  2K8H A;  3P6A A;  1IGD A;  2PJH A;  3T9L A;  4D2K A;  1V5O A;  5J3Q A;  2IO1 B;  2KAN A;  3SDL C;  2LRW A;  2Z59 B;  4GZU A;  4PS8 A;  3VQI A;  2NMQ A;  2VRW B;  3DBH I;  1AN8 A;  2LAS A;  1VR9 A;  1KTK A;  4B0M A;  2N9K A;  1VBG A;  3BY4 B;  4B0E A;  4W9K A;  4HDO A;  1MPH A;  1E8Z A;  1I4P A;  2A5U A;  3CMM B;  4YTN B;  5LXH A;  3PRM B;  1JCK B;  3L54 A;  1V86 A;  2IDY A;  3A58 A;  1LFD A;  1DYN A;  3E66 A;  1VRA B;  4NJ6 A;  2BKF A;  4JKH A;  3P42 A;  3SFE B;  4KGT A;  2N7D A;  2ASQ A;  2WXN A;  4S0R A;  2K2U A;  1FHW A;  1C9F A;  2RSG A;  3V3X A;  1GNU A;  1W1H A;  1SB3 C;  1UZX B;  2NBW B;  3DVG X;  4NPN A;  4W9C A;  1DOX A;  4F1S A;  1T0Y A;  1MKE A;  2E3T A;  1MPE A;  2I5F A;  3Q3M C;  1TY0 A;  4P1C C;  3EFU A;  2JF5 A;  2BWE S;  2O2V B;  1UNR A;  1M94 A;  1PMS A;  4BVU C;  3AJ4 A;  2L3Z A;  2DX5 A;  4IG7 B;  4XGA B;  1QOG A;  4WQO B;  2WDV B;  4MK0 A;  1KRH A;  4BAX A;  1MJD A;  1YIW A;  2HDE A;  4OHJ A;  1QC6 A;  1S1Q B;  1E7U A;  4WWN A;  1V5P A;  1FFU A;  2Z14 A;  3M63 B;  4FUL A;  4OZA A;  3HM6 X;  2IGD A;  3IBE A;  1Q10 A;  3RZW C;  4EUT A;  3VUY A;  2Z0P A;  2K8E A;  2Z0O A;  4NSW A;  4OT1 A;  2K0P A;  3I3T B;  4RM9 A;  4W9F A;  4LNO A;  3JYU A;  1I4H A;  4B9K A;  2N7J A;  4JE3 B;  2QCZ A;  2ZCB A;  2C7M B;  2COD A;  1KZ7 A;  2D2Q A;  2KC2 A;  4EEW A;  1U27 A;  4HKQ A;  4E74 A;  3M1I B;  5L81 A;  2JZ3 B;  3MP9 A;  1Y5O A;  1F52 A;  2RDG A;  2AEH A;  3ODW A;  3H7P A;  4MH8 A;  3E9L A;  1TT5 B;  4ICU A;  2UWQ A;  2C5L C;  1L5P A;  3ML4 A;  1HTQ A;  1V97 A;  2DYQ A;  2DFK A;  1SE9 A;  3KYC D;  3Q69 A;  4IKG A;  1OQN A;  3PS6 A;  1Q5W B;  3Q2A C;  4RF0 A;  2BWF A;  3R7Q A;  2BS2 B;  2KDM A;  2ONQ A;  2JUO A;  3LDZ E;  2NPT A;  3QQ8 B;  1M7R A;  4FXC A;  2CHX A;  1GC7 A;  1MK7 B;  2WXH A;  1TJ6 A;  2OQB A;  4WVF B;  1FCC C;  4RGO S;  1JW9 D;  4TYZ A;  2Y3A A;  1E90 A;  2FCN A;  2O6V A;  1JRO A;  3TEZ A;  1Z5S B;  1H4R A;  2Z0D B;  2KDI A;  1TTN A;  4C0A A;  5J17 A;  2P8V A;  2RR9 A;  5MPO A;  4JIO U;  4HAZ B;  3FM8 C;  4H8S A;  3A8P A;  2MBH A;  1BTK A;  2KIG A;  2WDT B;  1V9J A;  4A6Q A;  3ZTC A;  4QXA B;  4ILH A;  2LHE A;  2L0T A;  2V76 A;  5G55 A;  1EUV B;  1ZDV A;  4J6I A;  2K3U A;  3IFW B;  3KUD B;  2NS5 A;  5IA7 A;  3EFC A;  1K5D B;  3PG7 A;  2JYT A;  3N7C A;  1B55 A;  1TJE A;  5G5H A;  4H2A A;  2GJY A;  2CRF A;  2L7R A;  2MWS B;  4MGY E;  3VFK A;  2R0D A;  1NBF C;  2M8S A;  2D3A A;  4NQK E;  2NBV A;  2I1J A;  1DBH A;  2YLM A;  1UNP A;  3K9O B;  1P3R A;  2KIE A;  1WXM A;  3GYP A;  3AE8 B;  4XWT A;  4MSQ B;  2V4I B;  2E6X A;  2IO3 B;  4RCO A;  1MHH E;  4JL9 A;  3W1Y A;  4JX1 C;  1WIA A;  1WGQ A;  2COP A;  1U5E A;  4C00 A;  2WXO A;  1NYQ A;  1KF6 B;  2PVG C;  4ANV A;  3RN9 C;  2BCJ A;  1P1A A;  4MAC A;  1ZGU B;  3ZO5 B;  4OZC A;  2PE9 A;  3QX1 A;  3UQB A;  1IBX A;  1PUT A;  2ROZ B;  2RUK B;  1D3Z A;  1WI0 A;  3CWI A;  1MIZ B;  2ZKM X;  1PFJ A;  3NZ3 A;  4A90 A;  2EC1 A;  1N60 A;  2L0F A;  3H8H A;  2J0J A;  2WXK A;  3GZN I;  2W2W A;  1XQQ A;  1WX7 A;  2NR2 A;  1VD2 A;  1FNU A;  1F2R C;  1WG7 A;  1YJ1 A;  2FID A;  4KDI C;  1RRB A;  3SO6 A;  1VZ6 A;  2Z8L A;  1UWX A;  1VBH A;  4GIV A;  4HB4 B;  1AYF A;  1K51 A;  3PLV A;  3VXW A;  3WAL A;  3V6E B;  3AE5 B;  4F7U P;  3APF A;  2KMM A;  2RGN B;  3N30 A;  3NVV A;  4A6H A;  1HBK A;  1E10 A;  3ML8 A;  1R4N B;  4OVZ A;  4JLC A;  1OQQ A;  5DPW A;  4JKD A;  3U7D A;  2KJ6 A;  2ZVO A;  3EA6 A;  4K7W A;  3V61 A;  3VH3 B;  2DYN A;  3PV1 A;  3RT3 B;  2ADZ A;  3OAW A;  1SBB B;  2MDX A;  3NRZ A;  2BTE A;  4YL8 A;  3N1Y C;  3Q3O C;  1HTO A;  5KHO A;  4HPL B;  1WXQ A;  3KZ1 A;  1XO3 A;  2W9N A;  4P7I A;  5TSS A;  3AEF B;  3V05 A;  2YEP B;  2TSS A;  2ELB A;  3OJ3 A;  2AX5 A;  1TS2 A;  4TQ0 A;  4C4V B;  3VIA A;  2KDF B;  2WU5 B;  2P0F A;  3L16 A;  1WX8 A;  2RSU A;  2OHF A;  2GMI C;  3NHE B;  2YS3 A;  2DHJ A;  2NVU I;  4MT5 A;  3WIM A;  3PSC A;  3OLM D;  1CQV A;  1E8X A;  1YN5 A;  3VAW A;  3PZD A;  4F8C B;  1YN4 A;  2KTR B;  3HVD A;  4G50 A;  4M0W B;  3ZKJ C;  5T8I A;  1CMX B;  3KWV A;  2YT0 A;  1WRD B;  3N3K B;  5CHV C;  2MJE A;  4IW0 A;  5JHG A;  1SE3 A;  4KZC A;  2WDR B;  2XN9 C;  4GDL B;  4E71 A;  1L0Y B;  4YSY B;  4JK8 A;  1DDM A;  2INC C;  4HLE A;  1YN3 A;  3RNC C;  3RNA C;  2DAJ A;  2JQR B;  1C1Y B;  4JWU C;  2KQ4 X;  2W2X D;  4MEM A;  4GPT B;  3R8B A;  1ST7 A;  3VH4 B;  1L7Y A;  2X38 A;  1TYG B;  2DKQ A;  4IUM B;  3TO1 A;  4WJ7 A;  1EF5 A;  2HTH A;  1OEY A;  1XT9 B;  1NU2 A;  1GG3 A;  1TS5 A;  3DWM A;  2CKH B;  2DA0 A;  3QAR A;  2N1W A;  3QC8 B;  4DXG A;  4F7G A;  1VZ8 A;  1EWY C;  1V80 A;  1QOF A;  5C3J B;  2P0H A;  1P98 A;  3RFZ B;  2PKO A;  4EZL A;  3E9O A;  2YVC A;  2LI5 A;  3Q8E A;  5C5B B;  2WWZ A;  3HM3 A;  2L32 A;  4HCN B;  4NJC A;  3A4R A;  1LXD A;  2K39 A;  3LJ3 A;  2M4N A;  2OJR A;  2N7E A;  4DDI D;  5LON B;  1X1F A;  2KWD A;  1N5X A;  2QEJ C;  2GBN A;  4J3O D;  4MJS B;  5IRS A;  2COC A;  3U4E G;  3ZQ4 A;  1B9R A;  4K3B A;  1YQ4 B;  4CO7 A;  4EOY A;  1IRS A;  2KQS A;  2N9L A;  3UIN B;  2B76 B;  4ZRI A;  2BKR B;  3W5U B;  5C2T B;  4AS1 A;  2M38 A;  1DOY A;  1UEF A;  1F77 A;  3UZT A;  5D3I B;  3GB1 A;  2VH2 A;  5EE1 A;  1Y56 A;  1OMW A;  2R2Q A;  1WZ3 A;  3QJZ A;  1UNQ A;  4PT5 A;  5E6O A;  5I2M A;  3RI7 C;  5J2R A;  2GBR A;  2LGI A;  4W9D A;  3HHM A;  4A3O A;  4W9J A;  4B6H A;  3BVG A;  3B1L X;  4WAF A;  3TJP A;  3QWZ B;  1PQS A;  3FIL B;  3PZ8 A;  1C78 A;  1BML C;  1P9D U;  2M0A A;  3U52 E;  1YMH E;  5DPT A;  4RFB A;  4M0W A;  5KHQ A;  1NTV A;  2QSD A;  2VKI A;  1RLF A;  5JZE B;  2YEP F;  1MG4 A;  3UF8 A;  1XCT L;  2FUG 1;  2JRH A;  5IKC M;  2ACZ B;  3RNF C;  1FGY A;  3WAM A;  2G45 B;  3UIP B;  1TS3 A;  2BVC A;  1L0V B;  3DBL B;  4HHV A;  2GOW A;  3UGB B;  1SHC A;  2IJ0 A;  4I6P A;  4IOI E;  2VH1 A;  4PS7 A;  1ROE A;  1SXT A;  1ZE3 D;  1OGW A;  1KLU D;  1LM8 B;  1V88 A;  1M4V A;  2QJL A;  2MJD A;  3ZIM A;  2KC1 A;  3PVL A;  1T5X D;  4JK9 A;  4XE0 A;  2WXJ A;  4ZYS A;  2DWQ A;  2XBB C;  2Y5P A;  2R2Y A;  4HRS A;  2KR0 A;  4FAD A;  2BYF A;  2LJI A;  3T06 A;  4DBB A;  2CU1 A;  4ZOH C;  4F7Z A;  2JZZ A;  3AH7 A;  4HB2 B;  4ZRK A;  2EKE C;  2KX3 A;  2J4X A;  3Q8B A;  1WJN A;  2QHO A;  3H1U A;  4OZB A;  1J7C A;  2D3B A;  4AUQ C;  1WGU A;  1NYR A;  1D5X C;  4KV2 A;  3AUL A;  1FEH A;  3PVW A;  2NTS A;  1OQR A;  4AP4 C;  4GU2 A;  4YT0 B;  2LUM A;  2IYD B;  1X1M A;  4GMX B;  2ZW0 A;  3ZNZ B;  3IVF A;  2GBM A;  4A6F A;  5EE0 A;  1PDX A;  2WX0 A;  1BWN A;  2DZJ A;  2KLC A;  1FHO A;  1P7F A;  3E9S A;  4MM3 A;  2BYE A;  4DDG D;  2KFJ A;  4HRO A;  1ZSQ A;  1X1G A;  4K3C A;  2WXQ A;  1R4M B;  1DGJ A;  3U12 A;  3FSS A;  4Z2M B;  2N9X A;  2MHJ A;  1V1P A;  2C7N B;  1WGK A;  1E8W A;  2L8J A;  1KZG A;  3KLS X;  4L6E A;  4HPM B;  1W1G A;  3I63 C;  5DCN A;  3U7Z A;  2D9V A;  2G35 A;  3IXS A;  2KLG A;  4NNJ B;  4JKE A;  4HAU B;  1GB4 A;  4HAX B;  1J8C A;  2W3S A;  3R2I A;  2V3P A;  2NBU A;  1UBQ A;  1SSN A;  2KVZ A;  1V1O A;  1V5M A;  1WJ4 A;  3VR8 B;  2M1M A;  4K2P A;  1STE A;  3AE4 B;  2ZVN A;  4WWP A;  4YTM B;  2KUP A;  4N59 A;  4RM8 A;  4HB3 B;  2AQ3 B;  2JP2 A;  1WMH B;  4IWP A;  1HZ6 A;  2C7H A;  1SIJ A;  2LOX A;  4II2 B;  4RF1 A;  5JHH A;  5KCV A;  4W9I A;  5HFY A;  2QMT A;  3BYT B;  4KHB A;  4HAV B;  1HXY D;  4A8X C;  4D0N B;  3AEG B;  2D9W A;  2V3S A;  3JSV B;  2ICI A;  1WGR A;  5C79 A;  1EWC A;  1KLG D;  3D32 A;  1KM7 A;  5IOI A;  4ANU A;  1L4D B;  1ZXI A;  3OWE B;  3AE9 B;  3H6N A;  4KGS A;  1I2H A;  4LTU A;  1BUI C;  4RGT A;  4NAW A;  1NI2 A;  1TIF A;  4K1R B;  2WXP A;  3DBR I;  3UQA A;  4M02 A;  3FAH A;  4TSS A;  1FPY A;  1RAX A;  2MP2 B;  5AEK B;  4LLG M;  2K22 A;  1JWU D;  2RDB C;  4ARC A;  2DN6 A;  1QQG A;  3WYF B;  3QBV B;  1XD3 B;  3CSF A;  4WJQ A;  4A20 A;  1HZ5 A;  2JT4 B;  4JPS A;  4ICV A;  1XLN A;  2JPH A;  5GOW B;  4HJG E;  4IWQ A;  4C7Y A;  1XX0 A;  3LYY A;  2CQU A;  4QJ5 B;  2KO3 A;  2GI9 A;  5IN7 A;  2FCQ A;  2WXM A;  3AI5 A;  3KVF B;  3TIX A;  1V5U A;  3AED B;  4IFS A;  1PGB A;  3NZS A;  4K17 A;  4XDD A;  1H10 A;  3AEB B;  2EMS A;  5HHD G;  4FA6 A;  1C76 A;  1PFD A;  3NWD A;  2FAZ A;  4GOU A;  2AWT A;  1KLV A;  5LNK 1;  3ALB A;  3FLV A;  3A8Q A;  2K8C A;  3SR6 A;  2BPS A;  1D5M C;  5FI1 A;  5TR5 A;  4BBK A;  3A33 B;  1XOD A;  3DOW A;  3KW5 B;  3NJT A;  4BKS D;  1SE4 A;  1I7A A;  1V61 A;  4WWM A;  1ZOY B;  1OFF A;  2C60 A;  2D4Q A;  4KVG B;  1HQR D;  1KBL A;  3Q8F A;  2Z59 A;  4WSF A;  4K7S A;  1MK9 B;  4N6E B;  2OOB B;  2NTT A;  4BOZ B;  3KQ4 A;  2CJN A;  2DKP A;  3H9D A;  2MX2 A;  1EVH A;  2K6Q A;  1QZE A;  1SEB D;  3ODO A;  3R2T A;  2COF A;  3FC4 A;  4M01 A;  2FIF A;  2H7D A;  2NMB A;  4FN2 A;  4K2O A;  5E6J A;  2KMA A;  1J0G A;  2N4F A;  3N32 A;  1NEK B;  2HJ8 A;  4LCD E;  2HTM E;  3W1S C;  3PPA A;  2MEK A;  2IYB A;  2LGS A;  1UF0 A;  4PNK A;  1XF5 L;  2EEL A;  3D8E A;  1V8C A;  3PP2 A;  1G6J A;  4CQN A;  1YX6 B;  3T3N A;  1QLB B;  1LQB A;  3AE1 B;  1HE8 A;  4G11 A;  3TL5 A;  3DBL I;  3M62 B;  2KQ7 A;  4NAM A;  2AYO B;  4GDK B;  3RCZ A;  1MG8 A;  3QHT A;  2WXI A;  1CJE A;  4IM2 A;  3R7R A;  5H92 C;  4DHZ B;  1TGZ B;  5J18 A;  2KGX B;  2O2V A;  1I42 A;  2KYW A;  5D3D A;  3U2S C;  2L52 A;  3MTN B;  1AQC A;  4EZJ A;  1VZ7 A;  2HE7 A;  1GPX A;  2VSZ A;  2HRJ A;  1DOI A;  1WGH A;  2FUH B;  1MHX A;  4JKC A;  1WJU A;  3V62 A;  2AQ2 B;  2B3A A;  5C1Z A;  4PK1 A;  4CSQ A;  1CZP A;  2WGS A;  3DVN U;  4R3D A;  2PPH A;  1KI1 B;  5L83 A;  2ABD A;  3RCP A;  3PRZ A;  4LJO B;  2XK5 B;  3TMP B;  4DK5 A;  3ZXV A;  4JKA A;  2JU6 X;  3MHZ A;  3NZU A;  3ZJU A;  1D5Z C;  4OVV A;  3GP7 A;  1AWD A;  2N0Y A;  3O13 A;  4EKU A;  2V9H A;  1IYF A;  4L2Y A;  3FKY A;  1L2N A;  1K8R B;  2LZ6 A;  3A9J B;  1WXA A;  3F0W A;  2IY1 B;  1FGZ A;  4P1B C;  2IO2 B;  2X0S A;  2JYE A;  3UIO B;  4HEA 1;  1QIL A;  2KTF A;  3OAN A;  2KWU B;  2RNR B;  1R4M I;  2G9H D;  1FRR A;  1YJJ A;  4MGK E;  3NVY A;  3N9Y C;  1A70 A;  2DHI A;  1C77 A;  2KFK B;  3VHT C;  4M8M A;  1GGO A;  3EEC A;  1WWT A;  3H7S A;  1LO5 D;  4A5K A;  1QF6 A;  5EFX A;  3IHP C;  2Z13 A;  1ZUD 2;  3VTV A;  3RMK C;  4BOS C;  1TKE A;  3C0R B;  5HE3 A;  2KOX A;  1WY8 A;  1ET9 A;  3N20 C;  1ISN A;  2K25 A;  3GS2 A;  2MRP A;  1F0Z A;  1TXD A;  4PYU A;  1LW3 A;  5LXI B;  1JWB D;  1WSP A;  3T8M A;  1E6E B;  2D9Z A;  2AQ1 B;  2YT1 A;  2RPV A;  3RD2 A;  4BKT A;  2XNA C;  2Y5C A;  2Q13 A;  5HE1 A;  2Q5W D;  4XWX A;  3NW8 A;  1WM2 A;  1HB8 A;  2H7E A;  1X86 A;  1XLP A;  1NVI D;  3P2B A;  3PVU A;  2BBC A;  4FHJ A;  3HSA A;  1E7P B;  4MT7 A;  2QIL A;  1ZXH A;  3VUW A;  5H8Y E;  4CHM A;  2QIE B;  2J42 A;  3AV8 A;  1F2R I;  4RGN A;  5AZF A;  3P7Z A;  1S3S G;  3WCQ A;  4ACF A;  2KXJ A;  4GOC A;  4YSX B;  2BGF A;  4KKI A;  3KUC B;  2BB6 A;  4ZRQ A;  3RNE C;  3WAO A;  1EM7 A;  2LKO A;  1KH0 A;  2G4D B;  2L00 B;  4N58 A;  2D5G A;  2LGD A;  4TV3 A;  1RJ2 A;  1V2Y A;  4ZYN A;  3A98 B;  2FCS A;  2NCN A;  1MFW A;  2PE6 B;  2WS3 B;  2KNB A;  3A1Q B;  2ZPN A;  3EPY A;  2MFQ A;  1J19 A;  3SUZ A;  1WE6 A;  1E0Z A;  2DZK A;  1I35 A;  4WH4 A;  1QOB A;  1ZYI A;  4TMA B;  1SE2 A;  4YTP B;  2K49 A;  1T6B X;  3Q14 C;  2WXL A;  3BJI A;  4O1N A;  4C7Z A;  1WE7 A;  5DH9 B;  4HDQ A;  3GE3 C;  2JY6 A;  1UH6 A;  2KD0 A;  1TS4 A;  4OW0 A;  1ZDX A;  1WZ0 A;  2YS5 A;  5J3Y A;  3ONS A;  3O96 A;  1E9M A;  3AXC A;  4XDC A;  3HRD D;  1Q1O A;  1UPR A;  2BQQ A;  1FXT B;  1GB1 A;  2FCM A;  3ZGZ A;  4ITK A;  4RNA A;  2KUQ A;  3B77 A;  3DBR B;  1L4Z B;  2G1E A;  3KSY A;  1FXA A;  4N9F 4;  2LXC A;  1WR6 E;  2C9W B;  2IGG A;  4TKN A;  2PLP A;  1FB8 A;  2JWU A;  1UBI A;  2R82 A;  3L08 A;  3RUI B;  2OTX A;  3PLU A;  5DI9 B;  4KIK B;  5AZH A;  2RGF A;  3GE8 C;  4REZ A;  5BMH A;  1NDD A;  2W54 A;  1WRI A;  1UGJ A;  2JXX A;  1KOT A;  1DDV A;  2CY5 A;  2K2J A;  5D3V A;  2KKC A;  3ABV B;  4XC2 A;  5FR6 A;  1K53 A;  3GOE A;  3SYX A;  3ZYY X;  2CHZ A;  1SJH D;  3PGE A;  1IPG A;  3JW0 X;  2N9P C;  2ZZP B;  4FJZ A;  4F7H A;  1ET6 A;  4WJN A;  5FK9 C;  4FJV B;  3B08 A;  1L0X B;  2W3R A;  3R66 C;  3X0W A;  2R61 A;  5AZG A;  1ACC A;  2LG1 A;  1KC7 A;  1TQZ A;  4HJK A;  2Z0Q A;  2QDF A;  3GYO A;  3E56 A;  2WDQ B;  1P3Q U;  2MBE A;  3DHH C;  3NUH B;  4W9G A;  1RWS A;  1T3Q A;  1E7V A;  1WYG A;  2LGY A;  5FI0 A;  5DHA B;  1UGM A;  5JP4 A;  3IAM 1;  4URK A;  2REX A;  2HD5 B;  2J7Q B;  3AEE B;  1EU3 A;  1ACA A;  2FJL A;  5D3W A;  3EC8 A;  2KAJ A;  3VDZ A;  2K9X A;  4C4V A;  4DXF A;  5IP4 D;  1MIX A;  2ROV A;  5BO4 B;  2IBI B;  3AU4 A;  1TY2 A;  4K7U A;  2Z4D A;  2Y5B B;  2RPQ A;  1L6V A;  2KDB A;  3Q8A A;  5C23 A;  2H88 B;  4US8 A;  2KTR A;  3ENB A;  2IGH A;  5E6P A;  1AW7 A;  2ZW1 A;  3VR9 B;  3PRE A;  2ZJD A;  1YD8 U;  3NG0 A;  5D6J B;  4LDT B;  4G0N B;  3RNB C;  2PW9 A;  2BF8 B;  3SBT A;  1OY2 A;  4GDL A;  1UNS A;  3QAQ A;  1NTY A;  4JWS C;  3MHS D;  2I38 A;  4NZL B;  3JVZ X;  1TZ1 A;  2M17 A;  4YSZ B;  1N6Z A;  2PMV A;  5GXG B;  3KRW A;  1EGX A;  3BVM A;  4KAX B;  2LMC A;  4MY6 A;  4G3X B;  4KIK A;  4MDK E;  4RGM A;  4DHJ D;  4W9H A;  4ZRP A;  3QK0 A;  3CIK A;  1T77 A;  2P0D A;  4XWW A;  2WXR A;  2OJW A;  3ZUN A;  2KWV B;  4D6W A;  3QWM A;  5HKH A;  5C5B A;  4IAP A;  2GUM A;  1K52 A;  2CS4 A;  2JVC A;  3ZTD A;  4W9L A;  2YSZ A;  2MBO A;  5JH5 C;  3IT4 B;  3ZJT A;  5LLI A;  2FNJ B;  4ZHP A;  2LUE A;  1J7B A;  5D2M B;  1EO6 A;  3I57 A;  4MJS A;  2MWN B;  2LEK A;  5GMV A;  4HVB A;  3PT2 B;  2MJ3 A;  2RVB B;  2UU7 A;  3DBS A;  2CU3 A;  4KHA A;  1X11 A;  2CHW A;  1PLS A;  3V60 A;  3TCA A;  3ENE A;  5C6R A;  4MGI E;  5CTR C;  1VLB A;  3TW1 A;  1K50 A;  1WGD A;  2LJ5 A;  1JRP A;  3BWU D;  2N23 A;  2WLB A;  2ZNV C;  4L1B A;  1WJ6 A;  3L10 B;  2K5P A;  3ULC A;  1C3T A;  1KJT A;  1Y8R C;  3BIN A;  3HK0 A;  3FVC A;  3BK2 A;  3TFM A;  1M7E A;  4BBN F;  2LOZ A;  1ZC4 B;  2BS3 B;  2JZP A;  3AN1 A;  4MSM B;  4ILJ A;  3W2D A;  2D3C A;  3FIL A;  5DHF B;  2KDE B;  3CST A;  3PZ7 A;  2MCN B;  3E9P A;  4IDI A;  4DIX A;  2LYD A;  4IM0 A;  2LWP A;  3DPD A;  4OSN A;  1ESF A;  1I7H A;  3RPF C;  5BYQ A;  1N3H A;  2MBQ A;  4LDT D;  4US9 A;  2OED A;  3MFG A;  4FJY A;  1Z87 A;  5G2N A;  4P6V F;  3KH0 A;  2YS1 A;  5FKA C;  2IZV B;  4ARI A;  2VZK B;  4TUU A;  1GOZ A;  4IM3 A;  3IT6 B;  4NJ7 A;  2R09 A;  2BB5 A;  3SNH A;  2DX5 B;  3DCX A;  2DYO A;  5BMI A;  3FP5 A;  2LBB A;  2LVO A;  1FNV A;  2DLW A;  1FCL A;  3VRB B;  5AUI A;  1ZM0 A;  2D3G A;  1HA5 A;  4NY0 A;  3VTU A;  1ZVR A;  2IPK D;  2D9Y A;  4ASW C;  3DXE A;  2CR5 A;  4QJ4 B;  3BYY B;  2GCJ A;  2I5C A;  3NOB A;  1H8C A;  5JVL A;  1OEY J;  2GBK A;  3DWG C;  3SHQ A;  4NQL B;  3MJW A;  4RH6 A;  4HAY B;  2Y7B A;  4YWG G;  5D3X A;  4RMA A;  3VTW A;  3H7P B;  3DHI C;  4CYE A;  3R3M A;  3UI3 A;  3C8Y A;  4W9E A;  1XEE A;  2J0K A;  2QKM A;  2RRF A;  2JRI B;  1IP9 A;  4ZHO A;  1WM3 A;  2G4S A;  2L76 A;  4BBN C;  5IJM A;  1JQ4 A;  1T0Q C;  4QJ3 B;  1ZKH A;  4L1R A;  2K6D B;  1XCQ L;  4GXB A;  2K8B A;  3ECI A;  4EE2 A;  3TEX A;  2N9E B;  2RMM A;  5D3Y A;  5CHF A;  2NPT B;  2VRR B;  3C19 A;  5D27 A;  3IG3 A;  1V6E A;  5BYR A;  2XEW A;  2JWZ A;  4YXD B;  2DHK A;  3SD5 A;  2KX0 A;  5D7G A;  3DVG Y;  1Q67 A;  4WIP A;  4IC7 B;  2VZK D;  2MQJ A;  2O6V B;  3Q8C A;  4UDU C;  1YQB A;  2GBJ A;  2KAC A;  2HJ1 A;  3Q3N C;  5EDS A;  2JX5 A;  4BKS A;  3F5R A;  3U30 A;  4AQ7 A;  1V49 A;  2AL3 A;  2YT2 A;  2WU2 B;  2MBB B;  1NTI A;  5D94 A;  2KWC A;  1YJI A;  1J0W A;  1GC6 A;  1YNT E;  4MH0 E;  3ZLZ A;  3AEC B;  2LRU A;  1WYW B;  3W5V B;  1EAZ A;  1LGR A;  1WMH A;  1U2B A;  3PTF C;  1MAI A;  1T0R C;  2N0S B;  3MDB C;  1WF9 A;  4XZ4 A;  4Q2J A;  2YRY A;  3ZRC A;  3DHG C;  2FBW B;  2NBV B;  4PYZ A;  3ZNH B;  1TBE A;  1FRD A;  3B9J A;  3BK1 A;  3JSV A;  2PZ1 A;  3KUZ A;  3RNG C;  2LVP A;  2KZR A;  2JSV X;  1WI1 A;  2E2X A;  3J9C A;  1C79 A;  2EJ8 A;  1I4G A;  2ON8 A;  2DYB A;  3AE2 B;  4A55 A;  1W1D A;  3ZNI D;  4ZRJ A;  2Y8G A;  2K00 A;  4M8N A;  3PSE B;  2EKI A;  4Z2N A;  4Y94 A;  1BT0 A;  3AMZ A;  1XLO A;  3TBL D;  4ILG B;  1U5F A;  2RDH A;  2MP2 A;  1WX9 A;  3KY9 A;  4DX8 A;  2WP9 B;  3D8F A;  4LNI A;  3B2F A;  2KCJ A;  2XQN M;  3BII D;  3P1M A;  5HI1 A;  3M3J A;  1IBX B;  3NVW A;  4LNK A;  2INN E;  4I6L B;  3LJU X;  4FBJ B;  1T0S C;  5CX3 A;  2ELA A;  1P5T A;  3EHV A;  4IOY X;  3DXC A;  2CY4 A;  1SIF A;  4GLS C;  3RZF A;  1N61 A;  2GS0 A;  3SFD B;  1UPQ A;  1NVL A;  1UEL A;  1QKZ A;  3QCA A;  1JRU A;  1FFV A;  2NZ8 B;  4WAA A;  1UUP A;  3ZVV A;  3M95 A;  2BS4 B;  3LB8 C;  3AM9 A;  2IY0 B;  3Q6B A;  3TEY A;  2FDQ A;  2MLB A;  4EMO A;  3MPX A;  2O6V D;  5HE2 A;  1PGA A;  4TQ1 A;  1R7S A;  2WQY B;  3AE6 B;  3APD A;  3CF6 E;  2WHI A;  2W82 A;  3MC9 A;  4BFR A;  4K81 A;  1C4C A;  3KWL A;  1P0R A;  4YON A;  1SF0 A;  1P7E A;  4LJP B;  2D10 A;  1K5G B;  1JAL A;  1P6S A;  1FD6 A;  4KSL C;  1GUA B;  5AUK A;  2UYZ B;  3TVV A;  3L0W B;  2BT6 A;  3P4R B;  3OHM B;  4HB0 B;  3NSU A;  2K1F A;  3TUO A;  5LOP B;  3FEH A;  2KMC A;  2WXG A;  5FR3 A;  4KGR A;  2LGX A;  4PS3 A;  2MW5 A;  1JML A;  1WGY A;  2DHZ A;  3VOQ A;  4KKJ A;  1MI1 A;  3T3O A;  4HAW B;  2G3Q B;  4WJO A;  3ZRF A;  1FXI A;  4WJP A;  4DXA B;  2PIA A; 
#chains in the Genus database with same CATH homology
 3Q3J A;  4AWJ A;  5KQ1 A;  3ZNG C;  4JK7 A;  2CAY A;  4GGQ A;  3NS8 A;  3B0A A;  2PEA A;  2L2I A;  4GB9 A;  1HB6 A;  1FAO A;  2RLO A;  5JLJ B;  4GDK A;  3A4S C;  2FJ9 A;  4I6N B;  2AL6 A;  1SGH A;  3APC A;  2Z0E B;  4WWO A;  1OQY A;  3ZDT A;  3PRP B;  4MGZ E;  4FHK A;  2ZNV B;  4JKB A;  2LXA A;  2LUL A;  1XD4 A;  1XCG A;  4DBG A;  4JGH B;  2V1Y A;  3SBG A;  3ZW3 A;  2HTH B;  2DX1 A;  1WJM A;  1U5G A;  2XK5 A;  2D07 B;  3ML9 A;  2LVQ A;  1UD7 A;  2UZR A;  1WH3 A;  1WXS A;  5JHB A;  2D9X A;  4XX5 A;  3WAN A;  3A9J A;  2RQ1 A;  1WJ1 A;  4A6K A;  2L05 A;  1U4A A;  3G9W A;  3KRX A;  1V5T A;  4EZK A;  2DAF A;  5IAA C;  3DQV A;  2YF0 A;  5DIF B;  1Z2M A;  1E5W A;  1DDW A;  2KFK A;  5DPS A;  5JHA A;  4ANW A;  1U5D A;  4IWO A;  2A4Z A;  3PEG A;  1WR1 A;  3SV1 A;  2X18 A;  4MEL A;  3OJ4 B;  1XR0 B;  1EF1 A;  2ZCC A;  4GSW A;  1FOE A;  1DIK A;  2EMT A;  3S2A A;  2V4L A;  4DHJ B;  2MKR A;  4KDL B;  2MSE D;  2WYQ A;  3V6C B;  3DVN V;  4DWF A;  4DHZ E;  1Y19 B;  2KVR A;  4HAT B;  1E8Y A;  2KJR A;  3Q3F A;  3A9K B;  5CLL B;  1AAR A;  4KSK C;  2QKL A;  5HE0 A;  3D8D A;  4DX9 0;  2ZPY A;  2D11 A;  4JKG B;  4JQW C;  1VCB A;  1YX5 B;  3KYD D;  4CHJ A;  3ZVR A;  3A1Q A;  1DRO A;  4ANX A;  3NY5 A;  3PHX B;  4AJY B;  2MA9 B;  4A3P A;  1XKE A;  4HWI B;  4ZDV A;  4EJN A;  4AJW A;  1V81 A;  1BTN A;  1OTR B;  1WXV A;  5CLQ B;  2GCL A;  2CB8 A;  4II3 B;  3VUX A;  5J3T A;  2L1C A;  1AWE A;  2DZI A;  2IFS A;  5CHW A;  1BAK A;  4A6F B;  1RFA A;  3V5W A;  3QA8 A;  2I1K A;  3ZDM C;  2DIK A;  1U29 A;  2LD9 A;  2WX1 A;  4KZ0 A;  3HIZ A;  4HK2 A;  1FHX A;  3HW2 B;  5C16 A;  1WGG A;  3PHW B;  4KHO A;  4HXD A;  3CXB B;  3RYT A;  2DYM A;  4FLH A;  3L17 A;  1GJZ A;  1JDE A;  4CHK A;  3A9K A;  2KN5 A;  3SU8 X;  2IO0 B;  2Y8F A;  2BYV E;  3L13 A;  3DCG A;  1RRP B;  1WVH A;  1ZC3 B;  4HCP B;  4OVU A;  4JKG A;  2M14 A;  5E6N A;  2M0X A;  1F9J A;  4KHB B;  4GN1 A;  2ZEQ A;  2DEN B;  4EFO A;  1Q0W B;  1V89 A;  2W2X C;  3VVW B;  5DPR A;  2R2O A;  1A5R A;  2DTC A;  2KJH B;  4PQ0 A;  3AU5 A;  3X23 A;  4NAW B;  4X57 B;  2DZM A;  2RD0 A;  4B95 A;  4B6W A;  4E3C A;  2J0M A;  2COA A;  5L95 C;  4BKG A;  4GMV A;  2N1V A;  3WA0 A;  1WFY A;  4JKF A;  3WAP A;  3HQC A;  2UZS A;  2KHW B;  1LB1 A;  3ODX A;  3W1S A;  2UVM A;  3RUL A;  3U8Z A;  3DXD A;  3O65 B;  4AOF A;  1X05 A;  3K9P B;  3ULB A;  1R4N I;  1ZW7 A;  2WH5 A;  3QIJ A;  5KQ4 A;  2KK8 A;  3DDC B;  2J59 M;  2K8H A;  3P6A A;  2PJH A;  3T9L A;  1V5O A;  5J3Q A;  2IO1 B;  2KAN A;  3SDL C;  2LRW A;  2Z59 B;  4GZU A;  4PS8 A;  3VQI A;  2VRW B;  3DBH I;  2LAS A;  3BY4 B;  1VBG A;  4W9K A;  4HDO A;  1MPH A;  1E8Z A;  2A5U A;  3CMM B;  5LXH A;  3PRM B;  3L54 A;  1V86 A;  1LFD A;  1DYN A;  3E66 A;  4NJ6 A;  2BKF A;  4JKH A;  2N7D A;  2ASQ A;  2K2U A;  1FHW A;  2RSG A;  1GNU A;  1W1H A;  1UZX B;  2NBW B;  3DVG X;  4NPN A;  4W9C A;  4F1S A;  1T0Y A;  1MKE A;  2I5F A;  3EFU A;  2JF5 A;  2BWE S;  2O2V B;  1UNR A;  1M94 A;  1PMS A;  4BVU C;  3AJ4 A;  2L3Z A;  2DX5 A;  4IG7 B;  4WQO B;  4MK0 A;  1YIW A;  1QC6 A;  1S1Q B;  1E7U A;  4WWN A;  1V5P A;  3M63 B;  4FUL A;  3HM6 X;  3IBE A;  3RZW C;  4EUT A;  3VUY A;  2Z0P A;  2Z0O A;  4NSW A;  3I3T B;  4RM9 A;  4W9F A;  3JYU A;  4B9K A;  2ZCB A;  2C7M B;  2COD A;  1KZ7 A;  2D2Q A;  2KC2 A;  4EEW A;  1U27 A;  4E74 A;  3M1I B;  5L81 A;  2JZ3 B;  1Y5O A;  2AEH A;  3ODW A;  3H7P A;  3E9L A;  4ICU A;  2UWQ A;  2C5L C;  3ML4 A;  2DYQ A;  2DFK A;  1SE9 A;  3KYC D;  1OQN A;  3PS6 A;  1Q5W B;  2BWF A;  3R7Q A;  2JUO A;  3LDZ E;  2NPT A;  3QQ8 B;  1M7R A;  2CHX A;  1GC7 A;  1MK7 B;  1TJ6 A;  2OQB A;  4WVF B;  4TYZ A;  1E90 A;  2FCN A;  2O6V A;  1Z5S B;  1H4R A;  2Z0D B;  2KDI A;  1TTN A;  4C0A A;  5J17 A;  2P8V A;  2RR9 A;  4JIO U;  4HAZ B;  3FM8 C;  4H8S A;  3A8P A;  2MBH A;  1BTK A;  2WDT B;  1V9J A;  3ZTC A;  4ILH A;  2L0T A;  2V76 A;  5G55 A;  1EUV B;  4J6I A;  3IFW B;  3KUD B;  2NS5 A;  5IA7 A;  1K5D B;  3PG7 A;  3N7C A;  1B55 A;  2GJY A;  2CRF A;  2L7R A;  2MWS B;  4MGY E;  3VFK A;  2R0D A;  1NBF C;  2M8S A;  4NQK E;  2I1J A;  1DBH A;  2YLM A;  1UNP A;  3K9O B;  1P3R A;  1WXM A;  3GYP A;  4MSQ B;  2IO3 B;  4JL9 A;  3W1Y A;  1WIA A;  1WGQ A;  2COP A;  1U5E A;  4ANV A;  2BCJ A;  1P1A A;  3ZO5 B;  1ZGU B;  2PE9 A;  3QX1 A;  3UQB A;  2ROZ B;  2RUK B;  1D3Z A;  1WI0 A;  1MIZ B;  1PFJ A;  2EC1 A;  2L0F A;  2J0J A;  3GZN I;  2W2W A;  1XQQ A;  1WX7 A;  2NR2 A;  1VD2 A;  1WG7 A;  1YJ1 A;  2FID A;  4KDI C;  1RRB A;  3SO6 A;  1VBH A;  4GIV A;  4HB4 B;  3PLV A;  3VXW A;  3WAL A;  3V6E B;  4F7U P;  3APF A;  2RGN B;  3N30 A;  4A6H A;  1HBK A;  3ML8 A;  4JLC A;  5DPW A;  4JKD A;  3U7D A;  2KJ6 A;  2ZVO A;  4K7W A;  3V61 A;  3VH3 B;  2DYN A;  3PV1 A;  3RT3 B;  2ADZ A;  3OAW A;  2MDX A;  4YL8 A;  5KHO A;  4HPL B;  3KZ1 A;  2W9N A;  4P7I A;  2ELB A;  3OJ3 A;  4TQ0 A;  3VIA A;  2KDF B;  2P0F A;  3L16 A;  1WX8 A;  2RSU A;  3NHE B;  2GMI C;  2YS3 A;  2DHJ A;  2NVU I;  3WIM A;  3PSC A;  3OLM D;  1E8X A;  3VAW A;  3PZD A;  4F8C B;  2KTR B;  4G50 A;  4M0W B;  3ZKJ C;  1CMX B;  2YT0 A;  1WRD B;  3N3K B;  5CHV C;  4IW0 A;  5JHG A;  4KZC A;  4GDL B;  4E71 A;  4JK8 A;  1DDM A;  4HLE A;  2DAJ A;  1C1Y B;  2W2X D;  4MEM A;  4GPT B;  3VH4 B;  1ST7 A;  1L7Y A;  2DKQ A;  4IUM B;  3TO1 A;  4WJ7 A;  1EF5 A;  2HTH A;  1OEY A;  1XT9 B;  1NU2 A;  1GG3 A;  2CKH B;  2DA0 A;  3QAR A;  2N1W A;  3QC8 B;  4F7G A;  1V80 A;  2P0H A;  1P98 A;  4EZL A;  3E9O A;  2YVC A;  2LI5 A;  5C5B B;  2WWZ A;  3HM3 A;  4HCN B;  3A4R A;  1LXD A;  2K39 A;  3LJ3 A;  2M4N A;  2OJR A;  2N7E A;  4DDI D;  5LON B;  1X1F A;  2GBN A;  4MJS B;  2COC A;  4CO7 A;  4EOY A;  1IRS A;  2KQS A;  3UIN B;  4ZRI A;  2BKR B;  2M38 A;  1UEF A;  3UZT A;  1OMW A;  2R2Q A;  1WZ3 A;  3QJZ A;  1UNQ A;  5E6O A;  5J2R A;  2GBR A;  4W9D A;  3HHM A;  4A3O A;  4W9J A;  4B6H A;  3B1L X;  3TJP A;  3QWZ B;  1PQS A;  1P9D U;  5DPT A;  5KHQ A;  1NTV A;  2VKI A;  1RLF A;  5JZE B;  3UF8 A;  2JRH A;  1FGY A;  3WAM A;  2G45 B;  3UIP B;  4HHV A;  2GOW A;  3UGB B;  1SHC A;  4I6P A;  4PS7 A;  1OGW A;  1LM8 B;  1V88 A;  3ZIM A;  2KC1 A;  3PVL A;  4JK9 A;  2XBB C;  4FAD A;  2BYF A;  3T06 A;  4DBB A;  2CU1 A;  4F7Z A;  2JZZ A;  4HB2 B;  4ZRK A;  2EKE C;  2KX3 A;  1WJN A;  2QHO A;  3H1U A;  4AUQ C;  1WGU A;  4KV2 A;  3AUL A;  3PVW A;  4AP4 C;  4GU2 A;  2IYD B;  1X1M A;  4GMX B;  3ZNZ B;  3IVF A;  2GBM A;  4A6F A;  2WX0 A;  1BWN A;  2DZJ A;  2KLC A;  1FHO A;  4MM3 A;  2BYE A;  4DDG D;  2KFJ A;  1ZSQ A;  1X1G A;  3FSS A;  4Z2M B;  2N9X A;  2C7N B;  1E8W A;  2L8J A;  1KZG A;  4L6E A;  4HPM B;  1W1G A;  5DCN A;  2D9V A;  2G35 A;  2KLG A;  4NNJ B;  4JKE A;  4HAU B;  4HAX B;  1J8C A;  2NBU A;  1UBQ A;  1V5M A;  1WJ4 A;  2M1M A;  4K2P A;  2ZVN A;  4WWP A;  2KUP A;  4RM8 A;  4HB3 B;  2JP2 A;  1WMH B;  4IWP A;  2C7H A;  2LOX A;  4II2 B;  5JHH A;  5KCV A;  4W9I A;  4HAV B;  4D0N B;  2D9W A;  2V3S A;  3JSV B;  1WGR A;  5C79 A;  3D32 A;  1KM7 A;  4ANU A;  3H6N A;  1I2H A;  4NAW A;  1NI2 A;  4K1R B;  3DBR I;  3UQA A;  2MP2 B;  1RAX A;  5AEK B;  2DN6 A;  1QQG A;  3WYF B;  3QBV B;  1XD3 B;  3CSF A;  4WJQ A;  4A20 A;  2JT4 B;  4ICV A;  2JPH A;  5GOW B;  4IWQ A;  1XX0 A;  2CQU A;  2KO3 A;  2FCQ A;  3AI5 A;  3KVF B;  3TIX A;  1V5U A;  3NZS A;  4IFS A;  4K17 A;  1H10 A;  2EMS A;  4FA6 A;  2FAZ A;  2AWT A;  1KLV A;  3ALB A;  3FLV A;  3A8Q A;  2K8C A;  2BPS A;  5FI1 A;  5TR5 A;  4BBK A;  3A33 B;  1XOD A;  3DOW A;  3KW5 B;  4BKS D;  1I7A A;  1V61 A;  2C60 A;  2D4Q A;  4KVG B;  1KBL A;  4WSF A;  4K7S A;  1MK9 B;  2OOB B;  4BOZ B;  2DKP A;  3H9D A;  2MX2 A;  1EVH A;  2K6Q A;  1QZE A;  3ODO A;  2COF A;  2FIF A;  2H7D A;  2NMB A;  4FN2 A;  4K2O A;  2KMA A;  1J0G A;  2N4F A;  3N32 A;  2HJ8 A;  4LCD E;  3W1S C;  3PPA A;  2IYB A;  4PNK A;  3D8E A;  3PP2 A;  1G6J A;  1YX6 B;  1LQB A;  1HE8 A;  4G11 A;  3TL5 A;  3DBL I;  3M62 B;  2KQ7 A;  2AYO B;  4GDK B;  3RCZ A;  1MG8 A;  3QHT A;  4IM2 A;  3R7R A;  4DHZ B;  1TGZ B;  5J18 A;  2KGX B;  2O2V A;  1I42 A;  3MTN B;  1AQC A;  4EZJ A;  2HE7 A;  2VSZ A;  2HRJ A;  1WGH A;  2FUH B;  4JKC A;  1WJU A;  3V62 A;  2B3A A;  5C1Z A;  3DVN U;  2PPH A;  1KI1 B;  5L83 A;  2ABD A;  3RCP A;  3PRZ A;  4LJO B;  2XK5 B;  3TMP B;  4DK5 A;  4JKA A;  3NZU A;  4OVV A;  2N0Y A;  4EKU A;  1IYF A;  1L2N A;  1K8R B;  2LZ6 A;  3A9J B;  1WXA A;  3F0W A;  2IY1 B;  1FGZ A;  2IO2 B;  2X0S A;  3UIO B;  2KTF A;  3OAN A;  2KWU B;  2RNR B;  1R4M I;  4MGK E;  2DHI A;  2KFK B;  3VHT C;  4M8M A;  1GGO A;  3EEC A;  3H7S A;  4A5K A;  5EFX A;  3IHP C;  3VTV A;  4BOS C;  3C0R B;  5HE3 A;  2KOX A;  1WY8 A;  1ISN A;  2K25 A;  2MRP A;  1TXD A;  4PYU A;  1LW3 A;  5LXI B;  3T8M A;  2D9Z A;  2YT1 A;  3RD2 A;  4BKT A;  2Q13 A;  5HE1 A;  4XWX A;  1WM2 A;  1HB8 A;  2H7E A;  1X86 A;  3P2B A;  3PVU A;  4FHJ A;  4MT7 A;  3VUW A;  4CHM A;  5AZF A;  3P7Z A;  1S3S G;  2KXJ A;  4GOC A;  2BGF A;  3KUC B;  3WAO A;  2LKO A;  2G4D B;  2L00 B;  2LGD A;  4TV3 A;  1RJ2 A;  1V2Y A;  4ZYN A;  3A98 B;  2FCS A;  2NCN A;  2PE6 B;  2KNB A;  3A1Q B;  2ZPN A;  3EPY A;  2MFQ A;  1J19 A;  3SUZ A;  1WE6 A;  2DZK A;  1I35 A;  3BJI A;  1WE7 A;  5DH9 B;  4HDQ A;  2JY6 A;  1UH6 A;  2KD0 A;  1WZ0 A;  2YS5 A;  5J3Y A;  3ONS A;  3O96 A;  3AXC A;  1Q1O A;  1UPR A;  1FXT B;  2FCM A;  4N9F 4;  3KSY A;  2LXC A;  1WR6 E;  2C9W B;  4TKN A;  1FB8 A;  1UBI A;  2R82 A;  3L08 A;  3RUI B;  2OTX A;  3PLU A;  5DI9 B;  4KIK B;  5AZH A;  2RGF A;  1NDD A;  2JXX A;  1KOT A;  1DDV A;  2CY5 A;  2K2J A;  5D3V A;  2KKC A;  4XC2 A;  5FR6 A;  3GOE A;  3SYX A;  2CHZ A;  3PGE A;  1IPG A;  3JW0 X;  2N9P C;  2ZZP B;  4FJZ A;  4F7H A;  4WJN A;  4FJV B;  3B08 A;  3R66 C;  3X0W A;  5AZG A;  2LG1 A;  1KC7 A;  1TQZ A;  4HJK A;  2Z0Q A;  3GYO A;  1P3Q U;  2MBE A;  4W9G A;  1E7V A;  2LGY A;  5FI0 A;  5DHA B;  1UGM A;  5JP4 A;  4URK A;  2REX A;  2HD5 B;  2J7Q B;  1ACA A;  2FJL A;  5D3W A;  3EC8 A;  3VDZ A;  1MIX A;  2ROV A;  5BO4 B;  2IBI B;  3AU4 A;  4K7U A;  2Y5B B;  2RPQ A;  2KDB A;  5C23 A;  2KTR A;  3ENB A;  5E6P A;  3PRE A;  2ZJD A;  1YD8 U;  5D6J B;  4LDT B;  4G0N B;  2BF8 B;  3SBT A;  1OY2 A;  4GDL A;  3QAQ A;  1NTY A;  3MHS D;  3JVZ X;  1TZ1 A;  2M17 A;  3KRW A;  1EGX A;  4KAX B;  4MY6 A;  4G3X B;  4KIK A;  4MDK E;  4DHJ D;  4W9H A;  3QK0 A;  3CIK A;  2P0D A;  3ZUN A;  2KWV B;  3QWM A;  5HKH A;  5C5B A;  4IAP A;  2CS4 A;  2JVC A;  3ZTD A;  4W9L A;  2YSZ A;  2MBO A;  5JH5 C;  5LLI A;  2FNJ B;  2LUE A;  5D2M B;  1EO6 A;  4MJS A;  2MWN B;  5GMV A;  4HVB A;  3PT2 B;  2RVB B;  3DBS A;  4KHA A;  1X11 A;  2CHW A;  1PLS A;  3V60 A;  3TCA A;  3ENE A;  5C6R A;  4MGI E;  5CTR C;  3TW1 A;  1WGD A;  2LJ5 A;  2N23 A;  2ZNV C;  1WJ6 A;  3L10 B;  3ULC A;  1C3T A;  1KJT A;  1Y8R C;  3BIN A;  3HK0 A;  3TFM A;  1M7E A;  4BBN F;  2LOZ A;  1ZC4 B;  4MSM B;  4ILJ A;  5DHF B;  2KDE B;  3CST A;  2MCN B;  3E9P A;  2LYD A;  4IM0 A;  2LWP A;  3DPD A;  1N3H A;  2MBQ A;  4LDT D;  4FJY A;  1Z87 A;  5G2N A;  3KH0 A;  2YS1 A;  2IZV B;  4TUU A;  4IM3 A;  4NJ7 A;  2R09 A;  3SNH A;  2DX5 B;  2DYO A;  3FP5 A;  2LBB A;  2LVO A;  2DLW A;  1ZM0 A;  2D3G A;  4NY0 A;  3VTU A;  1ZVR A;  2D9Y A;  4ASW C;  3DXE A;  2CR5 A;  2GCJ A;  2I5C A;  3NOB A;  1H8C A;  5JVL A;  1OEY J;  2GBK A;  3SHQ A;  4NQL B;  3MJW A;  4HAY B;  2Y7B A;  5D3X A;  4RMA A;  3VTW A;  3H7P B;  4CYE A;  3R3M A;  4W9E A;  2J0K A;  2QKM A;  2JRI B;  1IP9 A;  1WM3 A;  2G4S A;  2L76 A;  4BBN C;  5IJM A;  1ZKH A;  2K6D B;  4GXB A;  2K8B A;  3ECI A;  2N9E B;  5D3Y A;  5CHF A;  2NPT B;  2VRR B;  5D27 A;  3IG3 A;  1V6E A;  2XEW A;  2JWZ A;  2DHK A;  3SD5 A;  2KX0 A;  5D7G A;  3DVG Y;  1Q67 A;  4IC7 B;  2MQJ A;  2O6V B;  1YQB A;  2GBJ A;  5EDS A;  4BKS A;  3F5R A;  3U30 A;  1V49 A;  2AL3 A;  2MBB B;  1NTI A;  5D94 A;  2KWC A;  1J0W A;  1GC6 A;  4MH0 E;  3ZLZ A;  2LRU A;  1WYW B;  1EAZ A;  1WMH A;  1U2B A;  3PTF C;  1MAI A;  3MDB C;  1WF9 A;  4XZ4 A;  2YRY A;  3ZRC A;  2NBV B;  4PYZ A;  3ZNH B;  1TBE A;  3JSV A;  3KUZ A;  2PZ1 A;  2LVP A;  2KZR A;  1WI1 A;  2E2X A;  2EJ8 A;  2DYB A;  1W1D A;  3ZNI D;  4ZRJ A;  2Y8G A;  2K00 A;  4M8N A;  3PSE B;  4Z2N A;  4Y94 A;  1BT0 A;  3TBL D;  4ILG B;  1U5F A;  2MP2 A;  1WX9 A;  3KY9 A;  4DX8 A;  3D8F A;  2KCJ A;  2XQN M;  3M3J A;  4I6L B;  3LJU X;  4FBJ B;  5CX3 A;  2ELA A;  1P5T A;  3EHV A;  4IOY X;  3DXC A;  2CY4 A;  1SIF A;  3RZF A;  2GS0 A;  1UPQ A;  1NVL A;  1UEL A;  3QCA A;  1JRU A;  2NZ8 B;  4WAA A;  3ZVV A;  3M95 A;  2IY0 B;  2FDQ A;  2MLB A;  4EMO A;  3MPX A;  2O6V D;  5HE2 A;  4TQ1 A;  3CF6 E;  3APD A;  4BFR A;  4K81 A;  1P0R A;  4YON A;  4LJP B;  2D10 A;  1K5G B;  1P6S A;  4KSL C;  1GUA B;  2UYZ B;  3TVV A;  3L0W B;  4HB0 B;  3NSU A;  2K1F A;  5LOP B;  3FEH A;  2KMC A;  2LGX A;  4PS3 A;  2MW5 A;  1WGY A;  2DHZ A;  3VOQ A;  4HAW B;  2G3Q B;  4WJO A;  3ZRF A;  4WJP A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...