2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
1ZGUB 1AARA 2X18A 2JZ3B 1IRSA 3TO1A 2FCMA 4HAVB 3MTNB 4A6FA 4WJOA 2N4FA 3CSTA 2BYFA 2L0TA 4BKSD 1XQQA 1LFDA 1M7EA 1SE9A 1WR1A 1W1GA 4IM2A 2RVBB 1WI0A 1WH3A 2HJ8A 3SV1A 1KM7A 2Y8GA 1UBIA 1NVLA 2BCJA 2DZIA 3L16A 5D3WA 2MP2B 2N7EA 1WX7A 1DDMA 2O6VB 3W1SC 2I5FA 4K7UA 1V5OA 2LWPA 1WVHA 4BVUC 2NS5A 3G9WA 2RLOA 3HM6X 4GB9A 3ZDMC 4KSKC 2WYQA 3DBHI 2YSZA 2COAA 3AU5A 3H7SA 3A98B 1WE6A 1P9DU 5D2MB 4FADA 2LVQA 3DDCB 5HKHA 2ELAA 2GS0A 3H7PB 2L2IA 2HE7A 1WG7A 3HQCA 4KZ0A 1WJ6A 3K9PB 1X1FA 4WSFA 1WJ4A 2ADZA 3QK0A 3T06A 5C16A 4PNKA 5IAAC 4EMOA 4LJPB 4BFRA 2DYOA 2JT4B 3MDBC 3V5WA 4HHVA 4H8SA 2JRHA 1HBKA 3KRXA 2KWUB 5L81A 3RYTA 1WXVA 2REXA 5CTRC 4ICVA 3T8MA 3IVFA 2L3ZA 2J7QB 1EF5A 3ZNGC 1V88A 2MKRA 2ZJDA 2M38A 2L05A 1Q1OA 1MIXA 5C79A 3H6NA 1WZ0A 3LJ3A 5AZHA 3AXCA 4DXAB 2YLMA 3PHXB 4ANVA 1DYNA 4TQ0A 2L1CA 1LQBA 3DXDA 3VHTC 2HTHA 2N9PC 3TFMA 2DYBA 4II3B 4NAWA 2C60A 4KHOA 3APCA 2ZPYA 3ZTCA 1I7AA 1UPRA 3RD2A 5D27A 3IFWB 3UGBB 1KOTA 2MCNB 3DBRI 3CF6E 4FBJB 3N30A 3ZDTA 4EFOA 4NY0A 3DXCA 4W9HA 4P7IA 3DVNV 2LOXA 2CS4A 2NCNA 3TMPB 3NOBA 1BWNA 2LI5A 1K8RB 2KO3A 2NBVB 3UQAA 5HE0A 1WX9A 2DKQA 2ZCCA 4BBKA 2CQUA 3FSSA 2UZSA 4HK2A 4CHKA 3RCZA 3UF8A 4I6LB 4GPTB 4HB2B 1R4MI 1V80A 2A4ZA 2GMIC 4F7HA 1UGMA 4W9JA 1RFAA 1OGWA 4AJWA 4ZDVA 4DHZB 2JY6A 2LUEA 4EUTA 2MRPA 2QKMA 3ZUNA 4DX90 4HWIB 2KLCA 2KQSA 2YRYA 3A4SC 1P1AA 1WJ1A 2LRWA 4W9GA 3TBLD 3ULBA 2KKCA 5CLLB 2I1KA 5IA7A 2CHXA 3V6CB 2GCJA 1Q0WB 2DENB 2KANA 3A9JA 1LXDA 3V6EB 1W1HA 1NDDA 2MBOA 2CY5A 3KUCB 5JLJB 2XQNM 2N9EB 4PYZA 1U2BA 2DZKA 3NHEB 5KHQA 3D8FA 2Z0QA 4E3CA 4KAXB 3VVWB 2ROZB 3W1YA 2JZZA 2DHZA 4IW0A 3QCAA 2LYDA 3A8QA 2OOBB 3ENEA 3TIXA 4AP4C 4XX5A 5CHVC 3WYFB 4DDID 1UPQA 3NSUA 3KH0A 1K5GB 1V89A 1KJTA 3VQIA 1EO6A 3NZSA 5D6JB 5C1ZA 4LCDE 4GN1A 1TGZB 3TJPA 1EVHA 2DX5B 4XZ4A 3FLVA 4M8MA 5D3VA 1RAXA 3QAQA 3SYXA 2P0DA 3M95A 1OTRB 2IZVB 4KIKA 3WA0A 2NBUA 2RUKB 1M7RA 2CKHB 3VFKA 1WGDA 4MH0E 1Y8RC 2IBIB 4K7SA 4G50A 3R7QA 4WJQA 5AZFA 4HB3B 3DVGX 1MG8A 3QA8A 3PGEA 4WJ7A 2J0JA 3JVZX 3L17A 5J3QA 2LULA 3W1SA 1H10A 2GBRA 3ZRFA 1FB8A 3ALBA 2MQJA 3QC8B 4TYZA 2G35A 2HRJA 5FR6A 1M94A 2JF5A 5KQ1A 4HCPB 1ISNA 3WAMA 2MSED 3ZNZB 3A8PA 1WIAA 1FGYA 1I2HA 2NR2A 2COFA 2KZRA 4BOSC 3SO6A 1NU2A 4KVGB 5EFXA 2K2JA 3ZW3A 2W2WA 1X05A 2K1FA 4BBNC 2KUPA 4NNJB 2K8BA 4ANWA 4WQOB 4KDIC 3PZDA 2WWZA 1B55A 4OVVA 4W9IA 1ZM0A 3UIOB 3VUWA 4E71A 3VDZA 3L13A 4MSQB 4MJSA 4DBGA 2BF8B 1L7YA 3U8ZA 4EZJA 3JSVB 4PS7A 4ZRKA 3DPDA 2K00A 2OTXA 3DVGY 2DHJA 4PS3A 2FCNA 1U4AA 2LOZA 1EAZA 1YQBA 3SD5A 1Z5SB 3EC8A 4C0AA 3D8DA 4MGYE 5LXHA 3DBSA 2VKIA 2C7HA 4W9DA 2OQBA 3RZWC 4CHMA 5KQ4A 1WE7A 4BKTA 1YX6B 2KDIA 3B0AA 2QHOA 3JYUA 4TKNA 3TCAA 3DQVA 4IM0A 3PRZA 4CO7A 1P3QU 1ACAA 2KFJA 2ZZPB 1G6JA 1C1YB 3KUZA 1QC6A 3AJ4A 1WXAA 2JVCA 1C3TA 4J6IA 1XKEA 3KRWA 2GBMA 4WJPA 2D07B 4KHAA 2FNJB 3TW1A 2RGFA 2KMAA 4B95A 3X23A 3QJZA 4IM3A 3RT3B 2Z0PA 1SHCA 2KFKA 1WJNA 3ZNID 3M63B 2ELBA 1TBEA 3WAPA 3KYDD 3BINA 2FJLA 2C5LC 2PE9A 2FIDA 5C5BA 1U29A 3B1LX 5DPSA 4I6PA 2DAFA 1V81A 2LD9A 1PQSA 3ZNHB 4WVFB 3C0RB 1CMXB 3PLVA 4JQWC 3UZTA 5GOWB 1UNPA 1ZC4B 3ONSA 2MP2A 4ZRJA 2PE6B 2LRUA 2RNRB 2J59M 1WGHA 3LDZE 3AULA 2KJ6A 2RGNB 4FJZA 4Y94A 4K1RB 1P5TA 2I5CA 2CU1A 4F7UP 2MBEA 4GSWA 1V9JA 2DYMA 2Y5BB 1J8CA 4GXBA 2B3AA 4G11A 4IOYX 2ROVA 4NSWA 5J3TA 2CR5A 4IWQA 4NAWB 1AQCA 1J0WA 3H7PA 3UQBA 3ML9A 3WAOA 1WFYA 4M8NA 2IYDB 2I1JA 1XCGA 3N32A 3HK0A 4HJKA 2N1WA 1FHOA 3PT2B 3L10B 4W9EA 3S2AA 4KZCA 4GDLA 3OJ4B 5HE1A 2JRIB 4MEMA 2YVCA 3K9OB 3VTWA 4KDLB 2MBQA 1L2NA 5AEKB 2CHZA 3QIJA 2YT1A 3L0WB 2KVRA 2KWCA 1U5FA 2ZVNA 1IPGA 1HB8A 1EF1A 2ZNVC 3DXEA 3Q3JA 1MK7B 4W9KA 3QARA 1AWEA 5KCVA 2VRWB 4G3XB 2K6QA 2O6VD 4JGHB 1E7UA 1YIWA 3PEGA 1UD7A 1UH6A 2KMCA 2Y8FA 4HAWB 3R7RA 2AL3A 4A5KA 1RJ2A 1FXTB 5E6PA 2YS1A 1TJ6A 2AWTA 1U5EA 2MDXA 3OANA 3VUYA 2O2VB 3RULA 1GJZA 5DHFB 3PS6A 1NBFC 3QHTA 2DTCA 4HATB 1NTVA 3A1QB 3ZVRA 3SDLC 2LASA 3EHVA 1DBHA 3HIZA 2LZ6A 1NTIA 1F9JA 2D4QA 1QZEA 1WGQA 2Z0OA 3UIPB 3PHWB 3VH4B 2KTRB 2BWFA 2MBHA 1V86A 1GG3A 2BPSA 4HAUB 3VH3B 1V49A 2BYVE 3A9JB 2NPTB 3APFA 2DAJA 2J0KA 2K8CA 4GDKB 2D11A 3ZO5B 4A3OA 2KWVB 2HD5B 4AOFA 3QWMA 4D0NB 3RZFA 2PJHA 4HPLB 4I6NB 2JUOA 2BKFA 3P7ZA 1WMHB 2L76A 3H1UA 2LXAA 4URKA 1X1MA 4WWPA 2P0HA 3CMMB 1V5UA 1W1DA 4B9KA 1K5DB 2W9NA 4EOYA 4WAAA 3VIAA 2YF0A 2D3GA 2V4LA 2MA9B 1NI2A 1J19A 2L0FA 3PRMB 4EKUA 4W9CA 5C23A 3PREA 1D3ZA 4IWOA 4NJ6A 3D32A 3EFUA 2R0DA 2LGYA 1P3RA 1H4RA 2KQ7A 1WJUA 5CHFA 2KHWB 3PRPB 3F0WA 1A5RA 1V5MA 2KJRA 2D10A 1BAKA 2D9ZA 2LGXA 5FI1A 2JWZA 5D3YA 3I3TB 3ZKJC 5DIFB 4WWOA 3IBEA 4TUUA 1UBQA 2FIFA 1TQZA 2EMTA 2IY0B 2ZCBA 2KXJA 4EZKA 3GOEA 2BGFA 4IUMB 3VTUA 2KGXB 2NMBA 1WGUA 2R2OA 1QQGA 1UEFA 3KY9A 2D2QA 1T0YA 3IHPC 3WALA 4Z2MB 2IYBA 2JPHA 3ZTDA 3HM3A 1GC6A 5E6OA 1U27A 1ZC3B 2LKOA 2DX5A 5JHAA 2C9WB 4OVUA 1P0RA 2FCQA 1WXSA 2XK5A 1KZGA 4HCNB 4FJYA 2DN6A 2KDFB 4GOCA 1FGZA 2MX2A 4ZRIA 2CHWA 2VSZA 2MBBB 1V61A 1U5DA 3NS8A 3ODWA 1I35A 4FHJA 3SUZA 1LM8B 2FCSA 4MJSB 4PYUA 4IAPA 2GOWA 5J2RA 1IP9A 2GJYA 1V5PA 2Q13A 2LBBA 4DWFA 3N7CA 5L95C 2P8VA 1Q67A 3ML8A 3PLUA 1SGHA 5KHOA 4BKSA 3PP2A 4MGKE 4HAXB 1N3HA 5TR5A 3B08A 2E2XA 2G4DB 2K39A 1VD2A 2D9XA 3DVNU 3LJUX 1Q5WB 4RM9A 1TZ1A 4A20A 2MLBA 1RLFA 2Z59B 3X0WA 1PLSA 1E8ZA 3VXWA 5EDSA 3IG3A 4AUQC 3ZLZA 1FHWA 3KSYA 4DK5A 2IO3B 2N23A 4A6FB 4NPNA 5J3YA 3PTFC 3L54A 5AZGA 5D94A 2ABDA 2DFKA 4L6EA 5HE3A 3QX1A 2M8SA 2BYEA 1S3SG 2G4SA 2FJ9A 1WRDB 2MFQA 1NTYA 3AU4A 1FOEA 3M3JA 1XX0A 2XEWA 2OJRA 2CAYA 4KV2A 2MWNB 2VRRB 3Q3FA 2IY1B 1Z2MA 5BO4B 1WYWB 3R66C 4ZYNA 1WGGA 2JXXA 4TV3A 4K7WA 2COPA 2C7NB 1XR0B 1E7VA 1OY2A 2ASQA 3VUXA 2LVPA 2EKEC 1TTNA 2KDBA 4DHZE 1YJ1A 5C5BB 3N3KB 5JZEB 2KNBA 2UZRA 5HE2A 3L08A 2DZJA 2M1MA 2WX1A 1UELA 3A9KA 2YS5A 3PVUA 4NQKE 2YT0A 5CHWA 3ZIMA 4GZUA 4TQ1A 1RRBA 2K25A 5JHBA 1WZ3A 1OEYA 2AYOB 2KJHB 3MJWA 4RMAA 3A4RA 1XODA 1MK9B 2DYNA 2BWES 3OLMD 3O96A 4WWNA 1E90A 1V5TA 3QBVB 4F1SA 3KZ1A 4K17A 2DHKA 3V61A 1DDVA 3TVVA 3BY4B 1V6EA 2DHIA 1OEYJ 2RQ1A 4MM3A 3P2BA 1ZKHA 1WGRA 3SU8X 2YS3A 3OAWA 3ULCA 4FULA 2K6DB 2EC1A 4IFSA 1XT9B 2RSGA 3GYOA 2O6VA 1FAOA 3PVWA 2PEAA 1DDWA 1GNUA 5DPRA 1E8YA 3FM8C 2PZ1A 1MPHA 2RR9A 4GDLB 2L8JA 4MT7A 1E8WA 4NJ7A 4YL8A 3RCPA 4PS8A 5JP4A 2HTHB 2GBKA 5IJMA 4AWJA 4EJNA 1U5GA 1Z87A 4YONA 3ZVVA 4HLEA 5DH9B 4MK0A 3NZUA 2KCJA 2AL6A 2M14A 4MGIE 1RRPB 1KLVA 4E74A 5C6RA 1X11A 2N7DA 1J0GA 3DOWA 2CB8A 3ODOA 3M62B 3R3MA 2IO2B 1WY8A 4LJOB 2KX0A 4ASWC 2W2XD 4MELA 2ZVOA 1GUAB 3D8EA 1UNRA 2N1VA 5CX3A 4JIOU 3PV1A 1EUVB 3ODXA 2KD0A 5LLIA 4IG7B 2FDQA 4W9FA 3KW5B 2NVUI 1YX5B 4BBNF 3KYCD 4M0WB 2R2QA 2AEHA 1UNQA 2QKLA 1WM3A 1XD3B 3M1IB 1WGYA 2Z0EB 4X57B 2FAZA 1KZ7A 4F7ZA 1X1GA 2RSUA 4EZLA 1TXDA 1FHXA 1PFJA 1HE8A 4HPMB 1Y5OA 3RUIB 2Z0DB 3A33B 3HW2B 1E5WA 1LB1A 5CLQB 1BTNA 3U7DA 1LW3A 4MDKE 2GBNA 1IYFA 2KLGA 4KHBB 2KN5A 5LOPB 4HVBA 2W2XC 3HHMA 1WR6E 1PMSA 5J18A 3NY5A 2RD0A 4ANUA 2V3SA 2K8HA 2KTFA 4PQ0A 3V60A 4DHJB 2V76A 2DLWA 2O2VA 1SIFA 4HAYB 1MIZB 4MY6A 2COCA 1WM2A 4GMVA 3PSCA 1OQNA 3A1QA 2EJ8A 1BTKA 5JH5C 4F7GA 1MAIA 2GBJA 3CSFA 3TL5A 1YD8U 4MGZE 2RPQA 4KSLC 2DZMA 4MSMB 2KK8A 2KTRA 2R09A 3AI5A 3PPAA 2NPTA 3DCGA 2G45B 3O65B 3MPXA 4HAZB 4IC7B 2NBWB 5GMVA 2IFSA 2L00B 4FHKA 4GDKA 1I42A 2H7DA 2D9YA 4JL9A 4NQLB 1HB6A 1P98A 3H9DA 2D9VA 4KIKB 2A5UA 3OJ3A 1WJMA 3VAWA 2IO0B 3BJIA 5FI0A 1WMHA 4AJYB 2PPHA 4A6KA 3PSEB 4HDOA 2MWSB 1WX8A 3UINB 2J0MA 5LXIB 4BKGA 4HB0B 3CXBB 2JP2A 2M17A 2ZPNA 3P6AA 5DPTA 4F8CB 2UWQA 4WJNA 4B6WA 1R4NI 3GZNI 2CY4A 1Y19B 3DBLI 2M4NA 2CODA 2XBBC 3VOQA 1OMWA 1GC7A 5D7GA 5J17A 2LGDA 4IWPA 4HB4B 2XK5B 4HXDA 4CYEA 5L83A 3ML4A 4XC2A 4LDTB 1EGXA 1H8CA 5JHHA 2G3QB 1ZSQA 1ZW7A 4DDGD 4EEWA 2DA0A 2UVMA 5DI9B 2LG1A 1WXMA 4A6HA 3SHQA 5LONB 3U30A 4GIVA 5G55A 3T9LA 1ST7A 1VCBA 1JRUA 2KC2A 4DHJD 1DROA 3QQ8B 4ICUA 4CHJA 2LVOA 5DPWA 4DBBA 4JLCA 3FEHA 5E6NA 2MW5A 3KUDB 3SNHA 2KDEB 2L7RA 2WDTB 3EECA 2UYZB 2DYQA 4GMXB 2Y7BA 4FA6A 3PG7A 1OQYA 1WF9A 2K2UA 1KI1B 3PVLA 2C7MB 4FLHA 4GGQA 2ZEQA 1P6SA 2KC1A 1E8XA 1ZVRA 2GCLA 2DKPA 1XD4A 1MKEA 4GU2A 5DHAB 2FUHB 4BOZB 2WX0A 3JW0X 5D3XA 2KOXA 4N9F4 4B6HA 1BT0A 4XWXA 2NZ8B 2BKRB 4K2OA 2P0FA 2LXCA 3ECIA 2ZNVB 2V1YA 2LJ5A 3EPYA 4DX8A 5JHGA 1S1QB 4FN2A 2M0XA 4II2B 5G2NA 1WI1A 1X86A 2DX1A 2N0YA 1UZXB 4G0NB 1V2YA 2H7EA 2D9WA 3WIMA 4HDQA 4FJVB 3ZRCA 3VTVA 5DCNA 4W9LA 2N9XA 3FP5A 4K81A 3MHSD 3KVFB 3A9KB 4K2PA 4LDTD 3QWZB 2EMSA 4Z2NA 3APDA 3JSVA 2IO1B 3GYPA 2KFKB 2CRFA 4ANXA 3WANA 3V62A 2WH5A 2KX3A 4RM8A 3F5RA 4A3PA 3CIKA
chains in the Genus database with same CATH superfamily
1ZGUB 1AARA 2WU5B 2X18A 1XCTL 2JZ3B 1XLQA 1IRSA 1GB1A 3TO1A 2FCMA 3ZXVA 4HAVB 3MTNB 2BYTA 3FILA 5IO9A 4A6FA 5BMIA 4WJOA 2N4FA 3H8HA 3E66A 3CSTA 1KH0A 2BYFA 2L0TA 2RDGA 1EM7A 1JDEA 4BKSD 5HFYA 1XQQA 2OJWA 1C76A 1WRIA 4C7YA 1FXAA 1LFDA 5I2MA 1M7EA 2R82A 1SE9A 3NVZA 1L0YB 1WR1A 5BYSA 1W1GA 4IM2A 1JQ4A 2RVBB 2I38A 1WI0A 1WH3A 3FC4A 2HJ8A 1YQ3B 3AE3B 4KKJA 3SV1A 1KM7A 2Y8GA 1UBIA 3PZ8A 1NVLA 2BCJA 2DZIA 3L16A 5D3WA 2MP2B 2N7EA 1RWSA 1WX7A 1DDMA 2K9XA 2O6VB 3RNAC 3W1SC 2I5FA 4K7UA 1V5OA 2LWPA 2FE8A 1WVHA 4BVUC 4LNNA 1QLBB 2W54A 2NS5A 3VR9B 3G9WA 2RLOA 3HM6X 4GB9A 3ZDMC 4KSKC 2WYQA 3NW8A 1T0SC 1QKZA 3DBHI 2YSZA 2COAA 3AU5A 3H7SA 3A98B 1WE6A 1P9DU 5D2MB 1TY2A 4FADA 2LVQA 3DDCB 5HKHA 2ELAA 2GS0A 3EUB2 2L2IA 2HE7A 2Y5CA 3H7PB 1WG7A 3HQCA 4KZ0A 1WJ6A 1TKGA 2INCC 3K9PB 3N1ZC 1X1FA 4WSFA 2L32A 1WJ4A 4A9AA 1V1OA 2ADZA 3QK0A 1RFKA 3T06A 5C16A 4PNKA 1TJEA 2QIEB 5IAAC 4EMOA 3B2FA 4JX1C 4EE2A 4LJPB 4BFRA 1DOYA 2DYOA 3AEEB 1CZPA 2JT4B 1UF0A 3MDBC 3V5WA 1AYFA 2D3AA 2D3CA 4C4VB 4HHVA 4H8SA 2JRHA 1HBKA 3W9CB 4L23A 3KRXA 2KWUB 3AE7B 4DQOC 5L81A 3RYTA 4HKQA 1WXVA 2REXA 5CTRC 4ICVA 1XO3A 3T8MA 3ZJVA 3IVFA 2L3ZA 2J7QB 1EF5A 1CQVA 3ZNGC 5HI1A 2YT2A 1J7BA 1V88A 5BMGA 3AEAB 4FXCA 3AE9B 3ZYYX 1QOFA 4JE3B 4YTNB 1FO4A 1E10A 2MKRA 1PGBA 2ZJDA 2M38A 3NUHB 2L05A 1Q1OA 1BUIC 1MIXA 1KRHA 1C78A 1CK1A 5C79A 2K5PA 3H6NA 1WZ0A 4JKDA 1L4ZB 3LJ3A 2LMCA 5AZHA 3AXCA 4DXAB 2YLMA 4RFBA 3PHXB 4ANVA 2GLSA 1C4AA 1DYNA 3IAS1 4TQ0A 3NRZA 2L1CA 4OVZA 1LQBA 3DXDA 3VHTC 2HTHA 2N9PC 2KMMA 3TFMA 2DYBA 4II3B 4NAWA 2C60A 3N1XC 4KHOA 3U12A 3NWFA 1V1PA 3APCA 2NMQA 2V3PA 2ZPYA 3ZTCA 4ILHA 1I7AA 1UPRA 3B9JA 3RD2A 3RNEC 4XYCA 5D27A 3IFWB 2V9HA 2BW2A 5EE1A 3UGBB 1KOTA 1ZXHA 3BIID 1I4HA 3FAHA 2MCNB 3OG5A 3DBRI 2IPKD 3CF6E 4FBJB 3N30A 3ZDTA 2K3UA 4EFOA 1L6VA 2HDEA 2INNE 4NY0A 3DXCA 4W9HA 4P7IA 3DVNV 4P1CC 2LOXA 2CS4A 2NCNA 3B2GA 3P1MA 3TMPB 3NOBA 1BWNA 2QILA 2WXJA 3AB5A 2LI5A 1TKEA 1TS3A 1K8RB 1QOGA 2KO3A 2NBVB 5HE0A 1WX9A 2DKQA 3UQAA 2ZCCA 4H2AA 4BBKA 2CQUA 1HZ5A 3FSSA 2QMTA 3Q14C 2UZSA 4HK2A 4D2KA 4CHKA 3RCZA 3I57A 2PMVA 3UF8A 1XLOA 4I6LB 5JVLA 4GPTB 4HB2B 1R4MI 1V80A 1NVID 4ILJA 2A4ZA 2GMIC 4F7HA 1UGMA 1RFAA 4W9JA 4DXGA 2WXGA 1OGWA 4BZAA 4AJWA 3E56A 4ZDVA 1DOIA 2JY6A 2LUEA 2AX5A 2MRPA 4DHZB 4EUTA 1N61A 2INPE 2QKMA 1VLBA 3ZUNA 4DX90 4HWIB 3WCQA 3A58A 2KLCA 1SXTA 2KQSA 2YRYA 3A4SC 4QXAB 5TSSA 1P1AA 1WJ1A 2LRWA 4W9GA 3TBLD 1B9RA 3BVMA 1UWMA 2BT6A 3GE8C 3ULBA 2KKCA 1V97A 5CLLB 2I1KA 5IA7A 1PGAA 3ZGZA 2CHXA 1KFYB 1YOVB 5D3IB 3V6CB 2GCJA 4KHBA 1Q0WB 3AE6B 1ZP0B 4JK9A 2DENB 2KANA 3A9JA 1LXDA 1EWCA 3V6EB 1W1HA 1NDDA 1SBBB 1YN4A 2CY5A 2MBOA 4XWTA 1ROEA 2IGDA 3KUCB 5JLJB 3ZXRA 2XQNM 2N9EB 4N6EB 4PYZA 1U2BA 2DZKA 3NHEB 5KHQA 3D8FA 3HVDA 2Z0QA 3U52E 3EFCA 3HSAA 4US9A 4KKIA 4E3CA 4KAXB 3VVWB 2ROZB 3W1YA 2JZZA 4A90A 4ZHPA 2DHZA 2WDVB 4IW0A 1PFDA 3QCAA 2LYDA 3A8QA 2OOBB 3ENEA 4CQNA 3I63C 1XLPA 3TIXA 5EE3A 4AP4C 1N5XA 4XX5A 2ZKMX 5CHVC 2OHFA 2WXQA 4KX6B 3WYFB 2PVOD 4DDID 1UPQA 3NSUA 2J52A 3KH0A 2RDHA 1K5GB 1V89A 1KJTA 4RCOA 1FNWA 3VQIA 1EO6A 3NZSA 5D6JB 5C1ZA 4LCDE 4WAFA 1FPYA 4YSZB 2INDC 4GN1A 1NENB 1IGDA 2MEKA 3N1YC 3P4QB 4O1NA 1TGZB 4LNIA 3TJPA 1EVHA 2DX5B 4XZ4A 4HRSA 3FLVA 4M8MA 5D3VA 1SE2A 1N6ZA 1RAXA 3QAQA 2BTEA 3SYXA 1T77A 2P0DA 3M95A 1KF6B 5T8IA 1OTRB 2IZVB 4KIKA 4JKGB 3WA0A 2NBUA 2RUKB 1T5XD 1M7RA 2CKHB 5IKCM 3VFKA 1WGDA 4MH0E 1Y8RC 2IBIB 4K7SA 3IAM1 4G50A 3R7QA 1WYGA 4WJQA 5G5HA 5AZFA 2QDFA 4HB3B 3DVGX 1K50A 1MG8A 3QA8A 3PGEA 4WJ7A 3P4PB 2J0JA 3AN1A 3JVZX 1MG4A 3L17A 5J3QA 2LULA 1ENFA 3W1SA 1H10A 1OFFA 3E9PA 1ZUD2 1E6EB 2GBRA 3ZRFA 1E9MA 4LNFA 1FB8A 3ALBA 5BYRA 3ABVB 2MQJA 3QC8B 4TYZA 2G35A 2HRJA 5FR6A 1UNSA 2K8EA 1M94A 3AMZA 2JF5A 5KQ1A 4HCPB 1STEA 1ISNA 3P63A 2MSED 3WAMA 3ZNZB 1GOZA 3A8PA 1WIAA 1YN5A 1FGYA 1I2HA 3AE1B 1NEKB 4OZCA 2NR2A 2COFA 2KVZA 2KZRA 4BOSC 3SO6A 3BVGA 4P16A 1NU2A 4KVGB 5EFXA 2Z13A 4D6WA 2K2JA 1FIQA 1HEZE 3ZW3A 3DWMA 2W2WA 1X05A 2K1FA 2EKIA 2J4XA 3FKYA 3C8YA 4BBNC 3LXFA 4JWSC 4PT5A 2KUPA 4NNJB 2K8BA 4ANWA 4WQOB 4KDIC 3PZDA 4LTUA 2WWZA 3KLSX 1B55A 4OVVA 4W9IA 1ZM0A 3UIOB 3RN9C 3VUWA 4E71A 3VDZA 3L13A 4MSQB 4MJSA 4DBGA 2BF8B 1L7YA 1TS5A 3U8ZA 2JQRB 4EZJA 1WSPA 3JSVB 4PS7A 1FRDA 3AEBB 4ZRKA 3DPDA 2K00A 2OTXA 3DVGY 2DHJA 1E7PB 3HRDD 4PS3A 2AQ3B 4HKZE 2FCNA 1U4AA 2M19A 2LOZA 1EAZA 1YQBA 3SD5A 1Z5SB 3EC8A 4C0AA 3HIEA 1N62A 3EA6A 4YSXB 3D8DA 5M4YB 1KLUD 3NWDA 2JSVX 4MGYE 5LXHA 3DBSA 2VKIA 2C7HA 4W9DA 1VDVA 2WLBA 1FNUA 3TUOA 2OQBA 3RZWC 4CHMA 2Z59A 5KQ4A 1WE7A 4BKTA 1YX6B 2KDIA 3B0AA 2QHOA 3JYUA 4TKNA 3TCAA 1JRPA 3DQVA 4IM0A 5D3DA 1MI0A 3PRZA 1PYWD 5IOIA 3OWEB 4CO7A 4QJ3B 3Q8AA 3MFGA 1P3QU 1ACAA 1JROA 2WHIA 3ZJTA 2WP9B 2RRFA 1IBXB 2KFJA 4P6VF 2ZZPB 1AN8A 3BYTB 1ET6A 1G6JA 2L83A 1C1YB 3KUZA 1QC6A 3AJ4A 1WXAA 2JVCA 1C3TA 1HQRD 4J6IA 4MM3B 1XKEA 3KRWA 2GBMA 4WJPA 2D07B 5LG4B 4KHAA 1OQQA 4LK0M 1ET9A 2FNJB 4REZA 3TW1A 2RGFA 2KMAA 4B95A 3BVZA 3X23A 5FK9C 3TEZA 2BB5A 1GGOA 3QJZA 1QT9A 2WXOA 4IM3A 3RT3B 4RNAA 1EU4A 2Z0PA 2WXFA 1SHCA 1FRRA 1HZ6A 1SEBD 2KFKA 2VZKB 1VBGA 1WJNA 3ZNID 3M63B 2ELBA 1TBEA 2MJDA 3WAPA 1YQ4B 3KYDD 3BINA 2FJLA 2C5LC 4L2YA 1N63A 2PE9A 2FIDA 5C5BA 1U29A 3B1LX 2NTSA 5DPSA 5GXGB 5IRSA 4JK8A 1NYQA 1JWSD 4I6PA 1UWXA 2DAFA 1V81A 2LD9A 1PQSA 3ZNHB 4WVFB 4RGMA 3C0RB 3SBTA 1CMXB 1F0ZA 3PLVA 5FKAC 3NVVA 4JQWC 3UZTA 5GOWB 4N58A 1UNPA 1BMLC 1ZC4B 3ONSA 2MP2A 4ZRJA 2KIGA 3Q6BA 1HA5A 2KAJA 2PE6B 1AWDA 2LRUA 2RNRB 2J59M 1WGHA 3LDZE 3Q3OC 3AULA 4OZAA 2KJ6A 3DBLB 2RGNB 4FJZA 4Y94A 4K1RB 1P5TA 2I5CA 1UUPA 2CU1A 4F7UP 1ZXIA 2MBEA 5AUIA 2JX5A 4GSWA 1V9JA 2DYMA 2Y5BB 1J8CA 4GXBA 2B3AA 4GLSC 2G9HD 4IOYX 2LHDA 4G11A 2ROVA 1FMAD 1SE3A 4NSWA 2KT7A 1C9FA 5J3TA 2CR5A 1MPEA 4IWQA 4NAWB 1AQCA 1J0WA 3H7PA 1V1PB 3UQBA 3ML9A 3WAOA 1WFYA 4M8NA 2IYDB 2I1JA 2IJ0A 4C00A 1XCGA 3N32A 3HK0A 4HJKA 2N1WA 1FHOA 3PT2B 3L10B 4W9EA 3S2AA 4KZCA 1YNTE 4GDLA 3OJ4B 5HE1A 2JRIB 3E9SA 4MEMA 2YVCA 1VZ6A 3HVZA 3K9OB 3VTWA 1JCKB 3RNBC 4KDLB 2MBQA 1L2NA 5AEKB 2CHZA 1F52A 4ITKA 4L1BA 3QIJA 2YT1A 3L0WB 2KVRA 2KWCA 3C19A 2Q5WD 1U5FA 2ZVNA 1JMLA 1IPGA 1PGXA 2IGGA 3RFZB 1HB8A 2JZPA 5G5GA 1EF1A 2ICIA 1MFWA 2ZNVC 3DXEA 1MJDA 2LFIA 3Q3JA 3P42A 3NJTA 3AEFB 1MK7B 4W9KA 3QARA 4ZYSA 1ZDXA 1AWEA 5KCVA 2VRWB 4G3XB 2K6QA 2O6VD 2Y3AA 4JGHB 4AS1A 1E7UA 1YIWA 3PEGA 5C2TB 1UD7A 1UH6A 2KMCA 2Y8FA 3Q3MC 2VZKD 1MVKA 4HAWB 3R7RA 4J3OD 3MC8A 2KDMA 3ZJUA 1QILA 2AL3A 2CJNA 4A5KA 1PUTA 1RM6C 1RJ2A 2BS4B 5H8YE 1FXTB 5E6PA 2YS1A 1TJ6A 3BZDB 2AWTA 1U5EA 2MDXA 3OANA 3VUYA 2O2VB 1IGCA 3RULA 1GJZA 5DHFB 3PS6A 1NBFC 3QHTA 2BB6A 2DTCA 1JALA 2R61A 4HATB 4M0WA 1NTVA 1E0ZA 4JWUC 3A1QB 3ZVRA 3SR6A 4MT5A 3SDLC 2LASA 2KR0A 3EHVA 1DBHA 3HIZA 2LZ6A 3FVCA 1NTIA 1F9JA 2D4QA 3GS2A 1QZEA 3UI3A 4LLGM 1WGQA 3DHIC 2Z0OA 1F1HA 1TS2A 3UIPB 4C56C 3PHWB 4JKBA 2KTRB 2X38A 3VH4B 2BWFA 2MBHA 1V86A 1GG3A 2BPSA 2FBWB 4HAUB 3VH3B 1V49A 2BYVE 3A9JB 2NPTB 4WIPA 2I2YA 3APFA 2DAJA 2BS3B 2WDQB 1JWAD 4S17A 2J0KA 2K8CA 1Y56A 4GDKB 4KGRA 3URYA 3Q69A 2D11A 2WXRA 2WXPA 3ZO5B 4A3OA 1ESFA 2NBVA 2KWVB 2HD5B 4AOFA 3QWMA 4D0NB 3RZFA 1SJED 3U7ZA 2PJHA 4HPLB 4I6NB 2JUOA 2IGHA 2BKFA 3P7ZA 2ZW0A 1WMHB 2L76A 2L52A 3H1UA 4C80A 2LXAA 4MACA 4URKA 5FR3A 1X1MA 1HTOA 3AECB 4WWPA 1VBHA 2MHJA 2P0HA 3CIRB 4B0MA 3CMMB 2HTME 3AM9A 1V5UA 4OW0A 1W1DA 2KWDA 3RNCC 3MP9A 1VR9A 4N59A 2PLPA 3SEBA 4B9KA 3V3XA 1K5DB 2W9NA 4EOYA 4WAAA 3VIAA 1DGJA 5H92C 2YF0A 2D3GA 2V4LA 2WQYB 2MA9B 4A55A 1NI2A 1J19A 1NI3A 2L0FA 3PRMB 4EKUA 4W9CA 5C23A 3PREA 1D3ZA 3GP7A 4IWOA 4NJ6A 3D32A 4WURA 3EFUA 2R0DA 2LGYA 2MJEA 1P3RA 1H4RA 2EELA 2KQ7A 1WJUA 3KWLA 2DLBA 3MC9A 3OHMB 5CHFA 5EE0A 2KHWB 3PRPB 1I4XA 3F0WA 4IDIA 1A5RA 2V3NA 3AH7A 4YXDB 1V5MA 2KJRA 2D10A 1BAKA 2D9ZA 2LGXA 5FI1A 2JWZA 2W82A 5D3YA 3I3TB 3ZKJC 5DIFB 2G1EA 4WWOA 3IBEA 4TUUA 1EU3A 2CJOA 2DWQA 1UBQA 2FIFA 1T6BX 1TQZA 2W3SA 2EMTA 2IY0B 2ZCBA 3Q8BA 2KXJA 4EZKA 3DBHB 5C3JB 2ONQA 3GOEA 5LNK1 2BGFA 2X8XX 4IUMB 3VTUA 2KGXB 2E6XA 1EWYC 2NMBA 3AEGB 1TS4A 1WGUA 1L0XB 4YWGG 2R2OA 1MHHE 1QQGA 1XCQL 3TEYA 1MI1A 2N0SB 1TIFA 1UEFA 3KY9A 2D2QA 2PKOA 1T0YA 3IHPC 3WALA 4Z2MB 2IYBA 1KC7A 2D3BA 2JPHA 3ZTDA 1WXQA 3HM3A 1GC6A 1OQRA 5E6OA 1U27A 1ZC3B 2LKOA 2DX5A 3IT6B 3AE4B 4Q2JA 2N9KA 5JHAA 2J42A 2C9WB 2GRIA 4OVUA 1P0RA 3RPFC 2FCQA 1WXSA 2XK5A 4ARCA 1KZGA 4B0EA 4HCNB 4KGTA 4FJYA 2DN6A 2KDFB 4GOCA 1JW9D 1FGZA 2MX2A 5BYQA 4ZRIA 1NYRA 3LB8C 2CHWA 2VSZA 2MBBB 1HXYD 1YMHE 1ZE3D 1V61A 1U5DA 1L0VB 3NS8A 3ODWA 2KYWA 1I35A 4FHJA 3SUZA 1LM8B 2FCSA 2OEDA 4ACFA 4MJSB 4PYUA 4IAPA 2GOWA 5J2RA 1IP9A 2GJYA 1L6UA 4JKAA 4JPSA 1V5PA 2Q13A 2BQQA 2LBBA 4DWFA 3N7CA 1AW7A 5L95C 2PTLA 4UDUC 2P8VA 1Q67A 3ML8A 3PLUA 1SGHA 5KHOA 4BKSA 4YTMB 1PDXA 3PP2A 4MGKE 4HAXB 1N3HA 5TR5A 1SSNA 3B08A 1FD6A 2E2XA 2G4DB 2K39A 4HEA1 2J53A 4RGNA 1VD2A 2D9XA 3DVNU 3LJUX 1Q5WB 4RM9A 1TZ1A 4A20A 3TEXA 3DBRB 1XF5L 2DNFA 2MLBA 1RLFA 2Z59B 5EE9A 3X0WA 1GB4A 1PLSA 1E8ZA 3VXWA 2V4IB 5EDSA 3IG3A 4AUQC 1GAQB 3ZLZA 3Q8CA 1FHWA 3IXSA 4S0RA 3KSYA 4DK5A 4ZHOA 2IO3B 1RYJA 2N23A 3FILB 4A6FB 4NPNA 5J3YA 3PTFC 1FFVA 4K3CA 3L54A 5AZGA 5D94A 2ABDA 3AE8B 2DFKA 4L6EA 4KGSA 5HE3A 3QX1A 2M8SA 2GUMA 4GOUA 2BYEA 4A8XC 1S3SG 3DHGC 1T0QC 2G4SA 2YEPF 2FJ9A 1KTKA 1WRDB 2MFQA 4P1BC 1V8CA 1NTYA 2UU7A 5IN7A 3AU4A 1I4PA 1FOEA 3M3JA 1XX0A 2XEWA 1VRAB 2OJRA 2CAYA 4KV2A 4WH4A 2MWNB 1FFUA 1R4MB 1FM0D 2VRRB 3Q3FA 2IY1B 1Z2MA 5BO4B 3T3OA 1WYWB 4TSSA 4JKEA 3R66C 3RNFC 4ZYNA 3RI7C 1WGGA 2JXXA 4TV3A 5HHDG 4K7WA 3B77A 4C7ZA 2Z14A 5AUKA 2COPA 2C7NB 1XR0B 1F77A 4M00A 1E7VA 4IOIE 1T3QA 1OY2A 1P7FA 2ASQA 2QJLA 1T0RC 2JYEA 2LVPA 3VUXA 4XWWA 2EKEC 1TTNA 2KDBA 3ETRA 4DHZE 1YJ1A 5C5BB 3N3KB 5JZEB 2KNBA 2Z8LA 2UZRA 1IUEA 4HROA 5HE2A 3N20C 3L08A 2DZJA 1N60A 2M1MA 2YEPB 3L4PA 2WX1A 4QJ4B 1UELA 2NTTA 3A9KA 2YS5A 2XNAC 3PVUA 1LGRA 4NQKE 2YT0A 2HJ1A 3DCXA 5CHWA 3ZIMA 4GZUA 3AV8A 4HPPA 4ARIA 3MHZA 4TQ1A 1RRBA 2IDYA 2K25A 5JHBA 1WZ3A 1OEYA 2AYOB 2KJHB 3MJWA 3VR8B 4RMAA 3A4RA 4US8A 1XODA 1MK9B 2DYNA 3NVWA 2LGSA 2BWES 2KIEA 1P7EA 3OLMD 4ZRQA 3O96A 4WWNA 3MC0B 1IBXA 1E90A 2WXHA 1V5TA 3QBVB 1VJKA 2ACZB 2VH1A 4A6QA 4F1SA 3KZ1A 2PVGC 4K17A 1B1ZA 2DHKA 3V61A 1DDVA 3TVVA 3BY4B 3NVYA 1V6EA 2DHIA 1OEYJ 3Q2AC 2RQ1A 4OZBA 4MM3A 3VRBB 3P2BA 1ZKHA 1WGRA 1YJIA 4USAA 4NAMA 3SU8X 1D5MC 2YS3A 3OAWA 1D5ZC 3ULCA 4FULA 2K6DB 4WWMA 2EC1A 1I4RA 4NZLB 4PK1A 1QOAA 2H89B 4IFSA 1XT9B 1JWMD 2RSGA 1C77A 3GYOA 2DIKA 2KQ4X 4JKCA 2CU3A 2O6VA 4CSQA 1Q10A 1FAOA 3PVWA 3NZ3A 2PEAA 1R4NB 4JK7A 1DDWA 2Z4DA 3GZNB 2ON8A 1GNUA 2LHEA 5DPRA 1E8YA 3FM8C 2PZ1A 1MPHA 4WQMA 2RR9A 4GDLB 2WXMA 2WDRB 2L8JA 2W3RA 4MT7A 1E8WA 4NJ7A 4YL8A 1ZDVA 3RCPA 3NS1A 4PS8A 5JP4A 2L1AA 2FJUB 2HTHB 2GBKA 4QAYA 5IJMA 4AWJA 4EJNA 1U5GA 2ZW1A 1D4BA 1Z87A 4YONA 4RGOS 3ZVVA 4HLEA 5DH9B 3P4RB 3Q8EA 4MK0A 3NZUA 2KCJA 2AL6A 2JYTA 1J7AA 2GI9A 3E9OA 2M14A 4MGIE 1RRPB 1KLVA 3U4EG 4E74A 5C6RA 1X11A 2N7DA 3P4SB 1J0GA 1YJJA 4DXFA 2AQ1B 3DOWA 2CB8A 3ODOA 2SEBD 3M62B 2K0PA 2IO2B 1WY8A 3R3MA 4C4VA 2DBYA 4LJOB 2KX0A 4ASWC 2W2XD 4MELA 2ZVOA 1GUAB 3D8EA 1UNRA 2N1VA 5CX3A 2SAKA 4JIOU 4JKHA 3PV1A 1EUVB 3ODXA 3W2DA 4QJ5B 2KD0A 5LLIA 1SF0A 4IG7B 2FDQA 4W9FA 5MPOA 3NG0A 2RPVA 3KW5B 4IKGA 3U2SC 2WNMA 2NVUI 3PO0A 4RGTA 1YX5B 4BBNF 3KYCD 4M0WB 4LNOA 3PZ7A 3BYYB 2R2QA 2AEHA 1UNQA 2QKLA 1WM3A 1XD3B 1I4QA 3M1IB 4NJCA 1WGYA 2Z0EB 3SFDB 3IT4B 4X57B 2FAZA 1TKYA 1KZ7A 4F7ZA 1X1GA 2WS3B 2R2YA 4JKFA 4ILGB 2RSUA 3AE5B 3ZQ4A 4EZLA 1TXDA 1FHXA 1PFJA 1HE8A 4HPMB 1Y5OA 3RUIB 2Z0DB 3A33B 3HW2B 2RDBC 1E5WA 4OT1A 1L4DB 1LB1A 2QCZA 5CLQB 2JXTA 2MH7A 4R3DA 1C79A 1XEEA 1QQRA 2QEJC 4LNKA 1BTNA 3U7DA 1CJEA 1LW3A 5BMHA 4MDKE 2GBNA 1IYFA 4XGAB 2KLGA 1TZOA 4KHBB 2KN5A 5LOPB 1GPXA 4HVBA 2W2XC 3HHMA 1WR6E 4RF1A 1PMSA 3Q8FA 2BBCA 5J18A 3NY5A 5I2SA 2RD0A 1TYGB 2K22A 4ANUA 2V3SA 1DYQA 2K8HA 2KTFA 2FUG1 1XLNA 1FEHA 4PQ0A 3V60A 1KBLA 3Q3NC 4DHJB 3E9LA 2V76A 2DLWA 1M4VA 1SIFA 4HAYB 2O2VA 1MIZB 4MY6A 2COCA 1VZ7A 1WM2A 4GMVA 3PSCA 2M0AA 1OQNA 1SB3C 3A1QA 2N9LA 2EJ8A 1BTKA 3BK2A 5JH5C 4F7GA 1MAIA 2WXNA 5HG2A 2GBJA 3CSFA 3TL5A 1YD8U 1FXIA 4MGZE 4OSNA 1KLGD 2RPQA 2WXLA 2GB1A 4KSLC 2DZMA 1I4GA 4MSMB 2KK8A 1N5WA 2KTRA 4AQ7A 3NWAA 2D5GA 2R09A 3AI5A 3I9V1 2KUQA 3PPAA 3MJ5A 1D6EC 2Y5PA 4K3BA 2NPTA 5JXVA 4GNKB 3DCGA 1ZOYB 2G45B 3O65B 3MPXA 4HAZB 4IC7B 2NBWB 5GMVA 2IFSA 2L00B 2LUMA 4FHKA 4GDKA 1I42A 2H7DA 2D9YA 4JL9A 4NQLB 4BAXA 2RMMA 2BS2B 3R2IA 4TMAB 1HB6A 2M56B 1P98A 3H9DA 2D9VA 4KIKB 2W55A 3CWIA 4YSYB 2A5UA 3OJ3A 1WJMA 3VAWA 2IO0B 3BJIA 5FI0A 1WMHA 2LJIA 2PIAA 1FCCC 2WU2B 3N9YC 4HJGE 2AQ2B 4AJYB 2PPHA 4XE0A 4A6KA 1JWBD 3PSEB 4HDOA 2MWSB 1WX8A 3AE2B 4ZOHC 3UINB 2J0MA 1FCLA 5LXIB 4BKGA 1BXTA 4HB0B 1SE4A 3CXBB 3HUIA 2JP2A 3O13A 3KWVA 2M17A 2ZPNA 3P6AA 5DPTA 4F8CB 4XDCA 3V05A 1TY0A 2UWQA 4WJNA 4B6WA 4L1RA 1R4NI 3GZNI 1JWUD 2LEKA 1C4PA 2CY4A 1Y19B 3DBLI 2M4NA 2CODA 2XBBC 3VOQA 5I4DA 1OMWA 1WWTA 3BWUD 1GC7A 2KACA 5D7GA 1SJHD 5J17A 2LGDA 2N7JA 4IWPA 4HB4B 2XK5B 4HXDA 4RF0A 4CYEA 5L83A 3ML4A 4XC2A 4LDTB 2XN9C 3KQ4A 1EGXA 2VH2A 1H8CA 5JHHA 2G3QB 1ZSQA 1ZW7A 3RMKC 3R8BA 4DDGD 3RNGC 2H88B 2DA0A 4EEWA 3CIKA 1WGKA 2UVMA 5DI9B 2LG1A 3SBGA 1WXMA 1K51A 4A6HA 1VZ8A 2JWUA 3SHQA 5LONB 4HSIA 5IP4D 3U30A 4GIVA 2E3TA 5G55A 2BVCA 3T9LA 2V0GA 1ST7A 2LGIA 3VRAB 1VCBA 1JRUA 3AEDB 2WXIA 3EGRA 1K52A 1LO5D 1K53A 2KC2A 3DHHC 4RH6A 4XDDA 4DHJD 3W5UB 1DROA 1ZPSA 3QQ8B 4ICUA 4CHJA 2LVOA 3TSSA 4JKGA 5DPWA 1MHXA 5E6JA 4DBBA 4JLCA 3FEHA 2MJ3A 3LYYA 5E6NA 2MW5A 3KUDB 2TSSA 3SNHA 2KDEB 2L7RA 2WDTB 3EECA 2UYZB 2DYQA 4GMXB 2Y7BA 4FA6A 3ENBA 2K49A 3PG7A 1OQYA 1WF9A 2K2UA 1KI1B 3TEWA 3GE3C 3PVLA 4YT0B 2C7MB 4FLHA 3W5VB 4GGQA 2ZEQA 4YTPB 1P6SA 2KC1A 1E8XA 1R7SA 3J9CA 1ZVRA 4M01A 2GCLA 2DKPA 1XXGA 1XD4A 1MKEA 4GU2A 5DHAB 3R2TA 2FUHB 4BOZB 1A70A 2WX0A 3JW0X 5D3XA 2KOXA 4N9F4 4B6HA 3DWGC 1BT0A 4XWXA 1ACCA 2JU6X 4MH8A 2NZ8B 2BKRB 4K2OA 2P0FA 1DOXA 2LXCA 1UGJA 3ECIA 1ZYIA 4ZRPA 2ZNVB 4DIXA 2V1YA 2LJ5A 3EPYA 4DX8A 1TT5B 1YN3A 4OHJA 5JHGA 1S1QB 4FN2A 1FNVA 2X0SA 2M0XA 4II2B 5G2NA 1WI1A 1X86A 1J7CA 1QOBA 2DX1A 2N0YA 2QSDA 1UZXB 1QF6A 4G0NB 1F2RC 1V2YA 2H7EA 2QC8A 2D9WA 1C4CA 3WIMA 2B76B 4HDQA 4FJVB 1DIKA 2WGSA 2WXKA 3T3NA 1D5XC 3ZRCA 3VTVA 5DCNA 4W9LA 2N9XA 3FP5A 4K81A 1I7HA 1HTQA 3MHSD 3KVFB 3A9KB 4K2PA 4LDTD 3QWZB 2EMSA 1SIJA 3I5JC 1L5PA 3GB1A 4Z2NA 3APDA 3JSVA 2IO1B 4M02A 3GYPA 3BK1A 2KFKB 2CRFA 1F2RI 4ANXA 3WANA 2PW9A 3SFEB 3V62A 2WH5A 2KX3A 4RM8A 3F5RA 4A3PA 2KN4A
chains in the Genus database with same CATH topology
1ZGUB 1AARA 2X18A 2JZ3B 1IRSA 3TO1A 2FCMA 4HAVB 3MTNB 4A6FA 4WJOA 2N4FA 3E66A 3CSTA 2BYFA 2L0TA 1JDEA 4BKSD 1XQQA 1LFDA 1M7EA 2R82A 1SE9A 1WR1A 1W1GA 4IM2A 2RVBB 1WI0A 1WH3A 2HJ8A 3SV1A 1KM7A 2Y8GA 1UBIA 1NVLA 2BCJA 2DZIA 3L16A 5D3WA 2MP2B 2N7EA 1WX7A 1DDMA 2O6VB 3W1SC 2I5FA 4K7UA 1V5OA 2LWPA 1WVHA 4BVUC 2NS5A 3G9WA 2RLOA 3HM6X 4GB9A 3ZDMC 4KSKC 2WYQA 3DBHI 2YSZA 2COAA 3AU5A 3H7SA 3A98B 1WE6A 1P9DU 5D2MB 4FADA 2LVQA 3DDCB 5HKHA 2ELAA 2GS0A 3H7PB 2L2IA 2HE7A 1WG7A 3HQCA 4KZ0A 1WJ6A 3K9PB 1X1FA 4WSFA 1WJ4A 2ADZA 3QK0A 3T06A 5C16A 4PNKA 5IAAC 4EMOA 4LJPB 4BFRA 2DYOA 2JT4B 3MDBC 3V5WA 4HHVA 4H8SA 2JRHA 1HBKA 3KRXA 2KWUB 5L81A 3RYTA 1WXVA 2REXA 5CTRC 4ICVA 3T8MA 3IVFA 2L3ZA 2J7QB 1EF5A 3ZNGC 1V88A 2MKRA 2ZJDA 2M38A 2L05A 1Q1OA 1MIXA 5C79A 3H6NA 1WZ0A 4JKDA 3LJ3A 5AZHA 3AXCA 4DXAB 2YLMA 3PHXB 4ANVA 1DYNA 4TQ0A 2L1CA 1LQBA 3DXDA 3VHTC 2HTHA 2N9PC 3TFMA 2DYBA 4II3B 4NAWA 2C60A 4KHOA 3APCA 2ZPYA 3ZTCA 4ILHA 1I7AA 1UPRA 3RD2A 5D27A 3IFWB 3UGBB 1KOTA 2MCNB 3DBRI 3CF6E 4FBJB 3N30A 3ZDTA 4EFOA 4NY0A 3DXCA 4W9HA 4P7IA 3DVNV 2LOXA 2CS4A 2NCNA 3TMPB 3NOBA 1BWNA 2LI5A 1K8RB 2KO3A 2NBVB 3UQAA 5HE0A 1WX9A 2DKQA 2ZCCA 4BBKA 2CQUA 3FSSA 2UZSA 4HK2A 4CHKA 3RCZA 3UF8A 4I6LB 5JVLA 4GPTB 4HB2B 1R4MI 1V80A 4ILJA 2A4ZA 2GMIC 4F7HA 1UGMA 4W9JA 1RFAA 1OGWA 4AJWA 4ZDVA 4DHZB 2JY6A 2LUEA 4EUTA 2MRPA 2QKMA 3ZUNA 4DX90 4HWIB 2KLCA 2KQSA 2YRYA 3A4SC 1P1AA 1WJ1A 2LRWA 4W9GA 3TBLD 3ULBA 2KKCA 5CLLB 2I1KA 5IA7A 2CHXA 3V6CB 2GCJA 1Q0WB 4JK9A 2DENB 2KANA 3A9JA 1LXDA 3V6EB 1W1HA 1NDDA 2MBOA 2CY5A 3KUCB 5JLJB 2XQNM 2N9EB 4PYZA 1U2BA 2DZKA 3NHEB 5KHQA 3D8FA 2Z0QA 4E3CA 4KAXB 3VVWB 2ROZB 3W1YA 2JZZA 2DHZA 4IW0A 3QCAA 2LYDA 3A8QA 2OOBB 3ENEA 3TIXA 4AP4C 4XX5A 5CHVC 3WYFB 4DDID 1UPQA 3NSUA 3KH0A 1K5GB 1V89A 1KJTA 3VQIA 1EO6A 3NZSA 5D6JB 5C1ZA 4LCDE 4GN1A 1TGZB 3TJPA 1EVHA 2DX5B 4XZ4A 3FLVA 4M8MA 5D3VA 1RAXA 3QAQA 3SYXA 2P0DA 3M95A 1OTRB 2IZVB 4KIKA 4JKGB 3WA0A 2NBUA 2RUKB 1M7RA 2CKHB 3VFKA 1WGDA 4MH0E 1Y8RC 2IBIB 4K7SA 4G50A 3R7QA 4WJQA 5AZFA 4HB3B 3DVGX 1MG8A 3QA8A 3PGEA 4WJ7A 2J0JA 3JVZX 3L17A 5J3QA 2LULA 3W1SA 1H10A 3E9PA 2GBRA 3ZRFA 1FB8A 3ALBA 2MQJA 3QC8B 4TYZA 2G35A 2HRJA 5FR6A 1M94A 2JF5A 5KQ1A 4HCPB 1ISNA 3WAMA 2MSED 3ZNZB 3A8PA 1WIAA 1FGYA 1I2HA 2NR2A 2COFA 2KZRA 4BOSC 3SO6A 1NU2A 4KVGB 5EFXA 2K2JA 3ZW3A 2W2WA 1X05A 2K1FA 4BBNC 2KUPA 4NNJB 2K8BA 4ANWA 4WQOB 4KDIC 3PZDA 2WWZA 1B55A 4OVVA 4W9IA 1ZM0A 3UIOB 3VUWA 4E71A 3VDZA 3L13A 4MSQB 4MJSA 4DBGA 2BF8B 1L7YA 3U8ZA 4EZJA 3JSVB 4PS7A 4ZRKA 3DPDA 2K00A 2OTXA 3DVGY 2DHJA 4PS3A 2FCNA 1U4AA 2LOZA 1EAZA 1YQBA 3SD5A 1Z5SB 3EC8A 4C0AA 3D8DA 4MGYE 5LXHA 3DBSA 2VKIA 2C7HA 4W9DA 2OQBA 3RZWC 4CHMA 5KQ4A 1WE7A 4BKTA 1YX6B 2KDIA 3B0AA 2QHOA 3JYUA 4TKNA 3TCAA 3DQVA 4IM0A 3PRZA 4CO7A 1P3QU 1ACAA 2KFJA 2ZZPB 1G6JA 1C1YB 3KUZA 1QC6A 3AJ4A 1WXAA 2JVCA 1C3TA 4J6IA 1XKEA 3KRWA 2GBMA 4WJPA 2D07B 4KHAA 2FNJB 3TW1A 2RGFA 2KMAA 4B95A 3X23A 1GGOA 3QJZA 4IM3A 3RT3B 2Z0PA 1SHCA 2KFKA 1VBGA 1WJNA 3ZNID 3M63B 2ELBA 1TBEA 3WAPA 3KYDD 3BINA 2FJLA 2C5LC 2PE9A 2FIDA 5C5BA 1U29A 3B1LX 5DPSA 4JK8A 4I6PA 2DAFA 1V81A 2LD9A 1PQSA 3ZNHB 4WVFB 3C0RB 3SBTA 1CMXB 3PLVA 4JQWC 3UZTA 5GOWB 1UNPA 1ZC4B 3ONSA 2MP2A 4ZRJA 2PE6B 2LRUA 2RNRB 2J59M 1WGHA 3LDZE 3AULA 2KJ6A 2RGNB 4FJZA 4Y94A 4K1RB 1P5TA 2I5CA 2CU1A 4F7UP 2MBEA 4GSWA 1V9JA 2DYMA 2Y5BB 1J8CA 4GXBA 2B3AA 4G11A 4IOYX 2ROVA 4NSWA 5J3TA 2CR5A 4IWQA 4NAWB 1AQCA 1J0WA 3H7PA 3UQBA 3ML9A 3WAOA 1WFYA 4M8NA 2IYDB 2I1JA 1XCGA 3N32A 3HK0A 4HJKA 2N1WA 1FHOA 3PT2B 3L10B 4W9EA 3S2AA 4KZCA 4GDLA 3OJ4B 5HE1A 2JRIB 4MEMA 2YVCA 3K9OB 3VTWA 4KDLB 2MBQA 1L2NA 5AEKB 2CHZA 3QIJA 2YT1A 3L0WB 2KVRA 2KWCA 1U5FA 2ZVNA 1IPGA 1HB8A 1EF1A 2ZNVC 3DXEA 3Q3JA 1MK7B 4W9KA 3QARA 1AWEA 5KCVA 2VRWB 4G3XB 2K6QA 2O6VD 4JGHB 1E7UA 1YIWA 3PEGA 1UD7A 1UH6A 2KMCA 2Y8FA 4HAWB 3R7RA 2AL3A 4A5KA 1RJ2A 1FXTB 5E6PA 2YS1A 1TJ6A 2AWTA 1U5EA 2MDXA 3OANA 3VUYA 2O2VB 3RULA 1GJZA 5DHFB 3PS6A 1NBFC 3QHTA 2DTCA 4HATB 1NTVA 3A1QB 3ZVRA 3SDLC 2LASA 3EHVA 1DBHA 3HIZA 2LZ6A 1NTIA 1F9JA 2D4QA 1QZEA 1WGQA 2Z0OA 3UIPB 3PHWB 4JKBA 2KTRB 3VH4B 2BWFA 2MBHA 1V86A 1GG3A 2BPSA 4HAUB 3VH3B 1V49A 2BYVE 3A9JB 2NPTB 3APFA 2DAJA 2J0KA 2K8CA 4GDKB 2D11A 3ZO5B 4A3OA 2KWVB 2HD5B 4AOFA 3QWMA 4D0NB 3RZFA 2PJHA 4HPLB 4I6NB 2JUOA 2BKFA 3P7ZA 1WMHB 2L76A 3H1UA 2LXAA 4URKA 1X1MA 4WWPA 1VBHA 2P0HA 3CMMB 1V5UA 1W1DA 4B9KA 1K5DB 2W9NA 4EOYA 4WAAA 3VIAA 2YF0A 2D3GA 2V4LA 2MA9B 1NI2A 1J19A 2L0FA 3PRMB 4EKUA 4W9CA 5C23A 3PREA 1D3ZA 4IWOA 4NJ6A 3D32A 3EFUA 2R0DA 2LGYA 1P3RA 1H4RA 2KQ7A 1WJUA 5CHFA 2KHWB 3PRPB 3F0WA 1A5RA 1V5MA 2KJRA 2D10A 1BAKA 2D9ZA 2LGXA 5FI1A 2JWZA 5D3YA 3I3TB 3ZKJC 5DIFB 4WWOA 3IBEA 4TUUA 1UBQA 2FIFA 1TQZA 2EMTA 2IY0B 2ZCBA 2KXJA 4EZKA 3GOEA 2BGFA 4IUMB 3VTUA 2KGXB 2NMBA 1WGUA 2R2OA 1QQGA 1UEFA 3KY9A 2D2QA 1T0YA 3IHPC 3WALA 4Z2MB 2IYBA 1KC7A 2JPHA 3ZTDA 3HM3A 1GC6A 5E6OA 1U27A 1ZC3B 2LKOA 2DX5A 5JHAA 2C9WB 4OVUA 1P0RA 2FCQA 1WXSA 2XK5A 1KZGA 4HCNB 4FJYA 2DN6A 2KDFB 4GOCA 1FGZA 2MX2A 4ZRIA 2CHWA 2VSZA 2MBBB 1V61A 1U5DA 3NS8A 3ODWA 1I35A 4FHJA 3SUZA 1LM8B 2FCSA 4MJSB 4PYUA 4IAPA 2GOWA 5J2RA 1IP9A 2GJYA 4JKAA 1V5PA 2Q13A 2LBBA 4DWFA 3N7CA 5L95C 2P8VA 1Q67A 3ML8A 3PLUA 1SGHA 5KHOA 4BKSA 3PP2A 4MGKE 4HAXB 1N3HA 5TR5A 3B08A 2E2XA 2G4DB 2K39A 1VD2A 2D9XA 3DVNU 3LJUX 1Q5WB 4RM9A 1TZ1A 4A20A 2MLBA 1RLFA 2Z59B 3X0WA 1PLSA 1E8ZA 3VXWA 5EDSA 3IG3A 4AUQC 3ZLZA 1FHWA 3KSYA 4DK5A 2IO3B 2N23A 4A6FB 4NPNA 5J3YA 3PTFC 3L54A 5AZGA 5D94A 2ABDA 2DFKA 4L6EA 5HE3A 3QX1A 2M8SA 2BYEA 1S3SG 2G4SA 2FJ9A 1WRDB 2MFQA 1NTYA 3AU4A 1FOEA 3M3JA 1XX0A 2XEWA 2OJRA 2CAYA 4KV2A 2MWNB 2VRRB 3Q3FA 2IY1B 1Z2MA 5BO4B 1WYWB 4JKEA 3R66C 4ZYNA 1WGGA 2JXXA 4TV3A 4K7WA 2COPA 2C7NB 1XR0B 1E7VA 1OY2A 2ASQA 2LVPA 3VUXA 2EKEC 1TTNA 2KDBA 4DHZE 1YJ1A 5C5BB 3N3KB 5JZEB 2KNBA 2UZRA 5HE2A 3L08A 2DZJA 2M1MA 2WX1A 1UELA 3A9KA 2YS5A 3PVUA 4NQKE 2YT0A 5CHWA 3ZIMA 4GZUA 4TQ1A 1RRBA 2K25A 5JHBA 1WZ3A 1OEYA 2AYOB 2KJHB 3MJWA 4RMAA 3A4RA 1XODA 1MK9B 2DYNA 2BWES 3OLMD 3O96A 4WWNA 1E90A 1V5TA 3QBVB 4F1SA 3KZ1A 4K17A 2DHKA 3V61A 1DDVA 3TVVA 3BY4B 1V6EA 2DHIA 1OEYJ 2RQ1A 4MM3A 3P2BA 1ZKHA 1WGRA 3SU8X 2YS3A 3OAWA 3ULCA 4FULA 2K6DB 2EC1A 4IFSA 1XT9B 2RSGA 3GYOA 2DIKA 2O6VA 4JKCA 1FAOA 3PVWA 2PEAA 4JK7A 1DDWA 1GNUA 5DPRA 1E8YA 3FM8C 2PZ1A 1MPHA 2RR9A 4GDLB 2L8JA 4MT7A 1E8WA 4NJ7A 4YL8A 3RCPA 4PS8A 5JP4A 2HTHB 2GBKA 5IJMA 4AWJA 4EJNA 1U5GA 1Z87A 4YONA 3ZVVA 4HLEA 5DH9B 4MK0A 3NZUA 2KCJA 2AL6A 3E9OA 2M14A 4MGIE 1RRPB 1KLVA 4E74A 5C6RA 1X11A 2N7DA 1J0GA 3DOWA 2CB8A 3ODOA 3M62B 3R3MA 2IO2B 1WY8A 4LJOB 2KX0A 4ASWC 2W2XD 4MELA 2ZVOA 1GUAB 3D8EA 1UNRA 2N1VA 5CX3A 4JIOU 4JKHA 3PV1A 1EUVB 3ODXA 2KD0A 5LLIA 4IG7B 2FDQA 4W9FA 3KW5B 2NVUI 1YX5B 4BBNF 3KYCD 4M0WB 2R2QA 2AEHA 1UNQA 2QKLA 1WM3A 1XD3B 3M1IB 1WGYA 2Z0EB 4X57B 2FAZA 1KZ7A 4F7ZA 1X1GA 4JKFA 4ILGB 2RSUA 4EZLA 1TXDA 1FHXA 1PFJA 1HE8A 4HPMB 1Y5OA 3RUIB 2Z0DB 3A33B 3HW2B 1E5WA 1LB1A 5CLQB 1BTNA 3U7DA 1LW3A 4MDKE 2GBNA 1IYFA 2KLGA 4KHBB 2KN5A 5LOPB 4HVBA 2W2XC 3HHMA 1WR6E 1PMSA 5J18A 3NY5A 2RD0A 4ANUA 2V3SA 2K8HA 2KTFA 4PQ0A 3V60A 1KBLA 4DHJB 3E9LA 2V76A 2DLWA 2O2VA 1SIFA 4HAYB 1MIZB 4MY6A 2COCA 1WM2A 4GMVA 3PSCA 1OQNA 3A1QA 2EJ8A 1BTKA 5JH5C 4F7GA 1MAIA 2GBJA 3CSFA 3TL5A 1YD8U 4MGZE 2RPQA 4KSLC 2DZMA 4MSMB 2KK8A 2KTRA 2R09A 3AI5A 3PPAA 2NPTA 3DCGA 2G45B 3O65B 3MPXA 4HAZB 4IC7B 2NBWB 5GMVA 2IFSA 2L00B 4FHKA 4GDKA 1I42A 2H7DA 2D9YA 4JL9A 4NQLB 1HB6A 1P98A 3H9DA 2D9VA 4KIKB 2A5UA 3OJ3A 1WJMA 3VAWA 2IO0B 3BJIA 5FI0A 1WMHA 4AJYB 2PPHA 4A6KA 3PSEB 4HDOA 2MWSB 1WX8A 3UINB 2J0MA 5LXIB 4BKGA 4HB0B 3CXBB 2JP2A 2M17A 2ZPNA 3P6AA 5DPTA 4F8CB 2UWQA 4WJNA 4B6WA 1R4NI 3GZNI 2CY4A 1Y19B 3DBLI 2M4NA 2CODA 2XBBC 3VOQA 1OMWA 1GC7A 5D7GA 5J17A 2LGDA 4IWPA 4HB4B 2XK5B 4HXDA 4CYEA 5L83A 3ML4A 4XC2A 4LDTB 1EGXA 1H8CA 5JHHA 2G3QB 1ZSQA 1ZW7A 4DDGD 4EEWA 2DA0A 2UVMA 5DI9B 2LG1A 3SBGA 1WXMA 4A6HA 3SHQA 5LONB 3U30A 4GIVA 5G55A 3T9LA 1ST7A 1VCBA 1JRUA 2KC2A 4DHJD 1DROA 3QQ8B 4ICUA 4CHJA 2LVOA 4JKGA 5DPWA 4DBBA 4JLCA 3FEHA 5E6NA 2MW5A 3KUDB 3SNHA 2KDEB 2L7RA 2WDTB 3EECA 2UYZB 2DYQA 4GMXB 2Y7BA 4FA6A 3ENBA 3PG7A 1OQYA 1WF9A 2K2UA 1KI1B 3PVLA 2C7MB 4FLHA 4GGQA 2ZEQA 1P6SA 2KC1A 1E8XA 1ZVRA 2GCLA 2DKPA 1XD4A 1MKEA 4GU2A 5DHAB 2FUHB 4BOZB 2WX0A 3JW0X 5D3XA 2KOXA 4N9F4 4B6HA 1BT0A 4XWXA 2NZ8B 2BKRB 4K2OA 2P0FA 2LXCA 3ECIA 2ZNVB 2V1YA 2LJ5A 3EPYA 4DX8A 5JHGA 1S1QB 4FN2A 2X0SA 2M0XA 4II2B 5G2NA 1WI1A 1X86A 2DX1A 2N0YA 1UZXB 4G0NB 1V2YA 2H7EA 2D9WA 3WIMA 4HDQA 4FJVB 1DIKA 3ZRCA 3VTVA 5DCNA 4W9LA 2N9XA 3FP5A 4K81A 3MHSD 3KVFB 3A9KB 4K2PA 4LDTD 3QWZB 2EMSA 4Z2NA 3APDA 3JSVA 2IO1B 3GYPA 2KFKB 2CRFA 4ANXA 3WANA 3V62A 2WH5A 2KX3A 4RM8A 3F5RA 4A3PA 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGU B;  1AAR A;  2X18 A;  2JZ3 B;  1IRS A;  3TO1 A;  2FCM A;  4HAV B;  3MTN B;  4A6F A;  4WJO A;  2N4F A;  3CST A;  2BYF A;  2L0T A;  4BKS D;  1XQQ A;  1LFD A;  1M7E A;  1SE9 A;  1WR1 A;  1W1G A;  4IM2 A;  2RVB B;  1WI0 A;  1WH3 A;  2HJ8 A;  3SV1 A;  1KM7 A;  2Y8G A;  1UBI A;  1NVL A;  2BCJ A;  2DZI A;  3L16 A;  5D3W A;  2MP2 B;  2N7E A;  1WX7 A;  1DDM A;  2O6V B;  3W1S C;  2I5F A;  4K7U A;  1V5O A;  2LWP A;  1WVH A;  4BVU C;  2NS5 A;  3G9W A;  2RLO A;  3HM6 X;  4GB9 A;  3ZDM C;  4KSK C;  2WYQ A;  3DBH I;  2YSZ A;  2COA A;  3AU5 A;  3H7S A;  3A98 B;  1WE6 A;  1P9D U;  5D2M B;  4FAD A;  2LVQ A;  3DDC B;  5HKH A;  2ELA A;  2GS0 A;  3H7P B;  2L2I A;  2HE7 A;  1WG7 A;  3HQC A;  4KZ0 A;  1WJ6 A;  3K9P B;  1X1F A;  4WSF A;  1WJ4 A;  2ADZ A;  3QK0 A;  3T06 A;  5C16 A;  4PNK A;  5IAA C;  4EMO A;  4LJP B;  4BFR A;  2DYO A;  2JT4 B;  3MDB C;  3V5W A;  4HHV A;  4H8S A;  2JRH A;  1HBK A;  3KRX A;  2KWU B;  5L81 A;  3RYT A;  1WXV A;  2REX A;  5CTR C;  4ICV A;  3T8M A;  3IVF A;  2L3Z A;  2J7Q B;  1EF5 A;  3ZNG C;  1V88 A;  2MKR A;  2ZJD A;  2M38 A;  2L05 A;  1Q1O A;  1MIX A;  5C79 A;  3H6N A;  1WZ0 A;  3LJ3 A;  5AZH A;  3AXC A;  4DXA B;  2YLM A;  3PHX B;  4ANV A;  1DYN A;  4TQ0 A;  2L1C A;  1LQB A;  3DXD A;  3VHT C;  2HTH A;  2N9P C;  3TFM A;  2DYB A;  4II3 B;  4NAW A;  2C60 A;  4KHO A;  3APC A;  2ZPY A;  3ZTC A;  1I7A A;  1UPR A;  3RD2 A;  5D27 A;  3IFW B;  3UGB B;  1KOT A;  2MCN B;  3DBR I;  3CF6 E;  4FBJ B;  3N30 A;  3ZDT A;  4EFO A;  4NY0 A;  3DXC A;  4W9H A;  4P7I A;  3DVN V;  2LOX A;  2CS4 A;  2NCN A;  3TMP B;  3NOB A;  1BWN A;  2LI5 A;  1K8R B;  2KO3 A;  2NBV B;  3UQA A;  5HE0 A;  1WX9 A;  2DKQ A;  2ZCC A;  4BBK A;  2CQU A;  3FSS A;  2UZS A;  4HK2 A;  4CHK A;  3RCZ A;  3UF8 A;  4I6L B;  4GPT B;  4HB2 B;  1R4M I;  1V80 A;  2A4Z A;  2GMI C;  4F7H A;  1UGM A;  4W9J A;  1RFA A;  1OGW A;  4AJW A;  4ZDV A;  4DHZ B;  2JY6 A;  2LUE A;  4EUT A;  2MRP A;  2QKM A;  3ZUN A;  4DX9 0;  4HWI B;  2KLC A;  2KQS A;  2YRY A;  3A4S C;  1P1A A;  1WJ1 A;  2LRW A;  4W9G A;  3TBL D;  3ULB A;  2KKC A;  5CLL B;  2I1K A;  5IA7 A;  2CHX A;  3V6C B;  2GCJ A;  1Q0W B;  2DEN B;  2KAN A;  3A9J A;  1LXD A;  3V6E B;  1W1H A;  1NDD A;  2MBO A;  2CY5 A;  3KUC B;  5JLJ B;  2XQN M;  2N9E B;  4PYZ A;  1U2B A;  2DZK A;  3NHE B;  5KHQ A;  3D8F A;  2Z0Q A;  4E3C A;  4KAX B;  3VVW B;  2ROZ B;  3W1Y A;  2JZZ A;  2DHZ A;  4IW0 A;  3QCA A;  2LYD A;  3A8Q A;  2OOB B;  3ENE A;  3TIX A;  4AP4 C;  4XX5 A;  5CHV C;  3WYF B;  4DDI D;  1UPQ A;  3NSU A;  3KH0 A;  1K5G B;  1V89 A;  1KJT A;  3VQI A;  1EO6 A;  3NZS A;  5D6J B;  5C1Z A;  4LCD E;  4GN1 A;  1TGZ B;  3TJP A;  1EVH A;  2DX5 B;  4XZ4 A;  3FLV A;  4M8M A;  5D3V A;  1RAX A;  3QAQ A;  3SYX A;  2P0D A;  3M95 A;  1OTR B;  2IZV B;  4KIK A;  3WA0 A;  2NBU A;  2RUK B;  1M7R A;  2CKH B;  3VFK A;  1WGD A;  4MH0 E;  1Y8R C;  2IBI B;  4K7S A;  4G50 A;  3R7Q A;  4WJQ A;  5AZF A;  4HB3 B;  3DVG X;  1MG8 A;  3QA8 A;  3PGE A;  4WJ7 A;  2J0J A;  3JVZ X;  3L17 A;  5J3Q A;  2LUL A;  3W1S A;  1H10 A;  2GBR A;  3ZRF A;  1FB8 A;  3ALB A;  2MQJ A;  3QC8 B;  4TYZ A;  2G35 A;  2HRJ A;  5FR6 A;  1M94 A;  2JF5 A;  5KQ1 A;  4HCP B;  1ISN A;  3WAM A;  2MSE D;  3ZNZ B;  3A8P A;  1WIA A;  1FGY A;  1I2H A;  2NR2 A;  2COF A;  2KZR A;  4BOS C;  3SO6 A;  1NU2 A;  4KVG B;  5EFX A;  2K2J A;  3ZW3 A;  2W2W A;  1X05 A;  2K1F A;  4BBN C;  2KUP A;  4NNJ B;  2K8B A;  4ANW A;  4WQO B;  4KDI C;  3PZD A;  2WWZ A;  1B55 A;  4OVV A;  4W9I A;  1ZM0 A;  3UIO B;  3VUW A;  4E71 A;  3VDZ A;  3L13 A;  4MSQ B;  4MJS A;  4DBG A;  2BF8 B;  1L7Y A;  3U8Z A;  4EZJ A;  3JSV B;  4PS7 A;  4ZRK A;  3DPD A;  2K00 A;  2OTX A;  3DVG Y;  2DHJ A;  4PS3 A;  2FCN A;  1U4A A;  2LOZ A;  1EAZ A;  1YQB A;  3SD5 A;  1Z5S B;  3EC8 A;  4C0A A;  3D8D A;  4MGY E;  5LXH A;  3DBS A;  2VKI A;  2C7H A;  4W9D A;  2OQB A;  3RZW C;  4CHM A;  5KQ4 A;  1WE7 A;  4BKT A;  1YX6 B;  2KDI A;  3B0A A;  2QHO A;  3JYU A;  4TKN A;  3TCA A;  3DQV A;  4IM0 A;  3PRZ A;  4CO7 A;  1P3Q U;  1ACA A;  2KFJ A;  2ZZP B;  1G6J A;  1C1Y B;  3KUZ A;  1QC6 A;  3AJ4 A;  1WXA A;  2JVC A;  1C3T A;  4J6I A;  1XKE A;  3KRW A;  2GBM A;  4WJP A;  2D07 B;  4KHA A;  2FNJ B;  3TW1 A;  2RGF A;  2KMA A;  4B95 A;  3X23 A;  3QJZ A;  4IM3 A;  3RT3 B;  2Z0P A;  1SHC A;  2KFK A;  1WJN A;  3ZNI D;  3M63 B;  2ELB A;  1TBE A;  3WAP A;  3KYD D;  3BIN A;  2FJL A;  2C5L C;  2PE9 A;  2FID A;  5C5B A;  1U29 A;  3B1L X;  5DPS A;  4I6P A;  2DAF A;  1V81 A;  2LD9 A;  1PQS A;  3ZNH B;  4WVF B;  3C0R B;  1CMX B;  3PLV A;  4JQW C;  3UZT A;  5GOW B;  1UNP A;  1ZC4 B;  3ONS A;  2MP2 A;  4ZRJ A;  2PE6 B;  2LRU A;  2RNR B;  2J59 M;  1WGH A;  3LDZ E;  3AUL A;  2KJ6 A;  2RGN B;  4FJZ A;  4Y94 A;  4K1R B;  1P5T A;  2I5C A;  2CU1 A;  4F7U P;  2MBE A;  4GSW A;  1V9J A;  2DYM A;  2Y5B B;  1J8C A;  4GXB A;  2B3A A;  4G11 A;  4IOY X;  2ROV A;  4NSW A;  5J3T A;  2CR5 A;  4IWQ A;  4NAW B;  1AQC A;  1J0W A;  3H7P A;  3UQB A;  3ML9 A;  3WAO A;  1WFY A;  4M8N A;  2IYD B;  2I1J A;  1XCG A;  3N32 A;  3HK0 A;  4HJK A;  2N1W A;  1FHO A;  3PT2 B;  3L10 B;  4W9E A;  3S2A A;  4KZC A;  4GDL A;  3OJ4 B;  5HE1 A;  2JRI B;  4MEM A;  2YVC A;  3K9O B;  3VTW A;  4KDL B;  2MBQ A;  1L2N A;  5AEK B;  2CHZ A;  3QIJ A;  2YT1 A;  3L0W B;  2KVR A;  2KWC A;  1U5F A;  2ZVN A;  1IPG A;  1HB8 A;  1EF1 A;  2ZNV C;  3DXE A;  3Q3J A;  1MK7 B;  4W9K A;  3QAR A;  1AWE A;  5KCV A;  2VRW B;  4G3X B;  2K6Q A;  2O6V D;  4JGH B;  1E7U A;  1YIW A;  3PEG A;  1UD7 A;  1UH6 A;  2KMC A;  2Y8F A;  4HAW B;  3R7R A;  2AL3 A;  4A5K A;  1RJ2 A;  1FXT B;  5E6P A;  2YS1 A;  1TJ6 A;  2AWT A;  1U5E A;  2MDX A;  3OAN A;  3VUY A;  2O2V B;  3RUL A;  1GJZ A;  5DHF B;  3PS6 A;  1NBF C;  3QHT A;  2DTC A;  4HAT B;  1NTV A;  3A1Q B;  3ZVR A;  3SDL C;  2LAS A;  3EHV A;  1DBH A;  3HIZ A;  2LZ6 A;  1NTI A;  1F9J A;  2D4Q A;  1QZE A;  1WGQ A;  2Z0O A;  3UIP B;  3PHW B;  3VH4 B;  2KTR B;  2BWF A;  2MBH A;  1V86 A;  1GG3 A;  2BPS A;  4HAU B;  3VH3 B;  1V49 A;  2BYV E;  3A9J B;  2NPT B;  3APF A;  2DAJ A;  2J0K A;  2K8C A;  4GDK B;  2D11 A;  3ZO5 B;  4A3O A;  2KWV B;  2HD5 B;  4AOF A;  3QWM A;  4D0N B;  3RZF A;  2PJH A;  4HPL B;  4I6N B;  2JUO A;  2BKF A;  3P7Z A;  1WMH B;  2L76 A;  3H1U A;  2LXA A;  4URK A;  1X1M A;  4WWP A;  2P0H A;  3CMM B;  1V5U A;  1W1D A;  4B9K A;  1K5D B;  2W9N A;  4EOY A;  4WAA A;  3VIA A;  2YF0 A;  2D3G A;  2V4L A;  2MA9 B;  1NI2 A;  1J19 A;  2L0F A;  3PRM B;  4EKU A;  4W9C A;  5C23 A;  3PRE A;  1D3Z A;  4IWO A;  4NJ6 A;  3D32 A;  3EFU A;  2R0D A;  2LGY A;  1P3R A;  1H4R A;  2KQ7 A;  1WJU A;  5CHF A;  2KHW B;  3PRP B;  3F0W A;  1A5R A;  1V5M A;  2KJR A;  2D10 A;  1BAK A;  2D9Z A;  2LGX A;  5FI1 A;  2JWZ A;  5D3Y A;  3I3T B;  3ZKJ C;  5DIF B;  4WWO A;  3IBE A;  4TUU A;  1UBQ A;  2FIF A;  1TQZ A;  2EMT A;  2IY0 B;  2ZCB A;  2KXJ A;  4EZK A;  3GOE A;  2BGF A;  4IUM B;  3VTU A;  2KGX B;  2NMB A;  1WGU A;  2R2O A;  1QQG A;  1UEF A;  3KY9 A;  2D2Q A;  1T0Y A;  3IHP C;  3WAL A;  4Z2M B;  2IYB A;  2JPH A;  3ZTD A;  3HM3 A;  1GC6 A;  5E6O A;  1U27 A;  1ZC3 B;  2LKO A;  2DX5 A;  5JHA A;  2C9W B;  4OVU A;  1P0R A;  2FCQ A;  1WXS A;  2XK5 A;  1KZG A;  4HCN B;  4FJY A;  2DN6 A;  2KDF B;  4GOC A;  1FGZ A;  2MX2 A;  4ZRI A;  2CHW A;  2VSZ A;  2MBB B;  1V61 A;  1U5D A;  3NS8 A;  3ODW A;  1I35 A;  4FHJ A;  3SUZ A;  1LM8 B;  2FCS A;  4MJS B;  4PYU A;  4IAP A;  2GOW A;  5J2R A;  1IP9 A;  2GJY A;  1V5P A;  2Q13 A;  2LBB A;  4DWF A;  3N7C A;  5L95 C;  2P8V A;  1Q67 A;  3ML8 A;  3PLU A;  1SGH A;  5KHO A;  4BKS A;  3PP2 A;  4MGK E;  4HAX B;  1N3H A;  5TR5 A;  3B08 A;  2E2X A;  2G4D B;  2K39 A;  1VD2 A;  2D9X A;  3DVN U;  3LJU X;  1Q5W B;  4RM9 A;  1TZ1 A;  4A20 A;  2MLB A;  1RLF A;  2Z59 B;  3X0W A;  1PLS A;  1E8Z A;  3VXW A;  5EDS A;  3IG3 A;  4AUQ C;  3ZLZ A;  1FHW A;  3KSY A;  4DK5 A;  2IO3 B;  2N23 A;  4A6F B;  4NPN A;  5J3Y A;  3PTF C;  3L54 A;  5AZG A;  5D94 A;  2ABD A;  2DFK A;  4L6E A;  5HE3 A;  3QX1 A;  2M8S A;  2BYE A;  1S3S G;  2G4S A;  2FJ9 A;  1WRD B;  2MFQ A;  1NTY A;  3AU4 A;  1FOE A;  3M3J A;  1XX0 A;  2XEW A;  2OJR A;  2CAY A;  4KV2 A;  2MWN B;  2VRR B;  3Q3F A;  2IY1 B;  1Z2M A;  5BO4 B;  1WYW B;  3R66 C;  4ZYN A;  1WGG A;  2JXX A;  4TV3 A;  4K7W A;  2COP A;  2C7N B;  1XR0 B;  1E7V A;  1OY2 A;  2ASQ A;  3VUX A;  2LVP A;  2EKE C;  1TTN A;  2KDB A;  4DHZ E;  1YJ1 A;  5C5B B;  3N3K B;  5JZE B;  2KNB A;  2UZR A;  5HE2 A;  3L08 A;  2DZJ A;  2M1M A;  2WX1 A;  1UEL A;  3A9K A;  2YS5 A;  3PVU A;  4NQK E;  2YT0 A;  5CHW A;  3ZIM A;  4GZU A;  4TQ1 A;  1RRB A;  2K25 A;  5JHB A;  1WZ3 A;  1OEY A;  2AYO B;  2KJH B;  3MJW A;  4RMA A;  3A4R A;  1XOD A;  1MK9 B;  2DYN A;  2BWE S;  3OLM D;  3O96 A;  4WWN A;  1E90 A;  1V5T A;  3QBV B;  4F1S A;  3KZ1 A;  4K17 A;  2DHK A;  3V61 A;  1DDV A;  3TVV A;  3BY4 B;  1V6E A;  2DHI A;  1OEY J;  2RQ1 A;  4MM3 A;  3P2B A;  1ZKH A;  1WGR A;  3SU8 X;  2YS3 A;  3OAW A;  3ULC A;  4FUL A;  2K6D B;  2EC1 A;  4IFS A;  1XT9 B;  2RSG A;  3GYO A;  2O6V A;  1FAO A;  3PVW A;  2PEA A;  1DDW A;  1GNU A;  5DPR A;  1E8Y A;  3FM8 C;  2PZ1 A;  1MPH A;  2RR9 A;  4GDL B;  2L8J A;  4MT7 A;  1E8W A;  4NJ7 A;  4YL8 A;  3RCP A;  4PS8 A;  5JP4 A;  2HTH B;  2GBK A;  5IJM A;  4AWJ A;  4EJN A;  1U5G A;  1Z87 A;  4YON A;  3ZVV A;  4HLE A;  5DH9 B;  4MK0 A;  3NZU A;  2KCJ A;  2AL6 A;  2M14 A;  4MGI E;  1RRP B;  1KLV A;  4E74 A;  5C6R A;  1X11 A;  2N7D A;  1J0G A;  3DOW A;  2CB8 A;  3ODO A;  3M62 B;  3R3M A;  2IO2 B;  1WY8 A;  4LJO B;  2KX0 A;  4ASW C;  2W2X D;  4MEL A;  2ZVO A;  1GUA B;  3D8E A;  1UNR A;  2N1V A;  5CX3 A;  4JIO U;  3PV1 A;  1EUV B;  3ODX A;  2KD0 A;  5LLI A;  4IG7 B;  2FDQ A;  4W9F A;  3KW5 B;  2NVU I;  1YX5 B;  4BBN F;  3KYC D;  4M0W B;  2R2Q A;  2AEH A;  1UNQ A;  2QKL A;  1WM3 A;  1XD3 B;  3M1I B;  1WGY A;  2Z0E B;  4X57 B;  2FAZ A;  1KZ7 A;  4F7Z A;  1X1G A;  2RSU A;  4EZL A;  1TXD A;  1FHX A;  1PFJ A;  1HE8 A;  4HPM B;  1Y5O A;  3RUI B;  2Z0D B;  3A33 B;  3HW2 B;  1E5W A;  1LB1 A;  5CLQ B;  1BTN A;  3U7D A;  1LW3 A;  4MDK E;  2GBN A;  1IYF A;  2KLG A;  4KHB B;  2KN5 A;  5LOP B;  4HVB A;  2W2X C;  3HHM A;  1WR6 E;  1PMS A;  5J18 A;  3NY5 A;  2RD0 A;  4ANU A;  2V3S A;  2K8H A;  2KTF A;  4PQ0 A;  3V60 A;  4DHJ B;  2V76 A;  2DLW A;  2O2V A;  1SIF A;  4HAY B;  1MIZ B;  4MY6 A;  2COC A;  1WM2 A;  4GMV A;  3PSC A;  1OQN A;  3A1Q A;  2EJ8 A;  1BTK A;  5JH5 C;  4F7G A;  1MAI A;  2GBJ A;  3CSF A;  3TL5 A;  1YD8 U;  4MGZ E;  2RPQ A;  4KSL C;  2DZM A;  4MSM B;  2KK8 A;  2KTR A;  2R09 A;  3AI5 A;  3PPA A;  2NPT A;  3DCG A;  2G45 B;  3O65 B;  3MPX A;  4HAZ B;  4IC7 B;  2NBW B;  5GMV A;  2IFS A;  2L00 B;  4FHK A;  4GDK A;  1I42 A;  2H7D A;  2D9Y A;  4JL9 A;  4NQL B;  1HB6 A;  1P98 A;  3H9D A;  2D9V A;  4KIK B;  2A5U A;  3OJ3 A;  1WJM A;  3VAW A;  2IO0 B;  3BJI A;  5FI0 A;  1WMH A;  4AJY B;  2PPH A;  4A6K A;  3PSE B;  4HDO A;  2MWS B;  1WX8 A;  3UIN B;  2J0M A;  5LXI B;  4BKG A;  4HB0 B;  3CXB B;  2JP2 A;  2M17 A;  2ZPN A;  3P6A A;  5DPT A;  4F8C B;  2UWQ A;  4WJN A;  4B6W A;  1R4N I;  3GZN I;  2CY4 A;  1Y19 B;  3DBL I;  2M4N A;  2COD A;  2XBB C;  3VOQ A;  1OMW A;  1GC7 A;  5D7G A;  5J17 A;  2LGD A;  4IWP A;  4HB4 B;  2XK5 B;  4HXD A;  4CYE A;  5L83 A;  3ML4 A;  4XC2 A;  4LDT B;  1EGX A;  1H8C A;  5JHH A;  2G3Q B;  1ZSQ A;  1ZW7 A;  4DDG D;  4EEW A;  2DA0 A;  2UVM A;  5DI9 B;  2LG1 A;  1WXM A;  4A6H A;  3SHQ A;  5LON B;  3U30 A;  4GIV A;  5G55 A;  3T9L A;  1ST7 A;  1VCB A;  1JRU A;  2KC2 A;  4DHJ D;  1DRO A;  3QQ8 B;  4ICU A;  4CHJ A;  2LVO A;  5DPW A;  4DBB A;  4JLC A;  3FEH A;  5E6N A;  2MW5 A;  3KUD B;  3SNH A;  2KDE B;  2L7R A;  2WDT B;  3EEC A;  2UYZ B;  2DYQ A;  4GMX B;  2Y7B A;  4FA6 A;  3PG7 A;  1OQY A;  1WF9 A;  2K2U A;  1KI1 B;  3PVL A;  2C7M B;  4FLH A;  4GGQ A;  2ZEQ A;  1P6S A;  2KC1 A;  1E8X A;  1ZVR A;  2GCL A;  2DKP A;  1XD4 A;  1MKE A;  4GU2 A;  5DHA B;  2FUH B;  4BOZ B;  2WX0 A;  3JW0 X;  5D3X A;  2KOX A;  4N9F 4;  4B6H A;  1BT0 A;  4XWX A;  2NZ8 B;  2BKR B;  4K2O A;  2P0F A;  2LXC A;  3ECI A;  2ZNV B;  2V1Y A;  2LJ5 A;  3EPY A;  4DX8 A;  5JHG A;  1S1Q B;  4FN2 A;  2M0X A;  4II2 B;  5G2N A;  1WI1 A;  1X86 A;  2DX1 A;  2N0Y A;  1UZX B;  4G0N B;  1V2Y A;  2H7E A;  2D9W A;  3WIM A;  4HDQ A;  4FJV B;  3ZRC A;  3VTV A;  5DCN A;  4W9L A;  2N9X A;  3FP5 A;  4K81 A;  3MHS D;  3KVF B;  3A9K B;  4K2P A;  4LDT D;  3QWZ B;  2EMS A;  4Z2N A;  3APD A;  3JSV A;  2IO1 B;  3GYP A;  2KFK B;  2CRF A;  4ANX A;  3WAN A;  3V62 A;  2WH5 A;  2KX3 A;  4RM8 A;  3F5R A;  4A3P A;  3CIK A; 
#chains in the Genus database with same CATH topology
 1ZGU B;  1AAR A;  2WU5 B;  2X18 A;  1XCT L;  2JZ3 B;  1XLQ A;  1IRS A;  1GB1 A;  3TO1 A;  2FCM A;  3ZXV A;  4HAV B;  3MTN B;  2BYT A;  3FIL A;  5IO9 A;  4A6F A;  5BMI A;  4WJO A;  2N4F A;  3H8H A;  3E66 A;  3CST A;  1KH0 A;  2BYF A;  2L0T A;  2RDG A;  1EM7 A;  1JDE A;  4BKS D;  5HFY A;  1XQQ A;  2OJW A;  1C76 A;  1WRI A;  4C7Y A;  1FXA A;  1LFD A;  5I2M A;  1M7E A;  2R82 A;  1SE9 A;  3NVZ A;  1L0Y B;  1WR1 A;  5BYS A;  1W1G A;  4IM2 A;  1JQ4 A;  2RVB B;  2I38 A;  1WI0 A;  1WH3 A;  3FC4 A;  2HJ8 A;  1YQ3 B;  3AE3 B;  4KKJ A;  3SV1 A;  1KM7 A;  2Y8G A;  1UBI A;  3PZ8 A;  1NVL A;  2BCJ A;  2DZI A;  3L16 A;  5D3W A;  2MP2 B;  2N7E A;  1RWS A;  1WX7 A;  1DDM A;  2K9X A;  2O6V B;  3RNA C;  3W1S C;  2I5F A;  4K7U A;  1V5O A;  2LWP A;  2FE8 A;  1WVH A;  4BVU C;  4LNN A;  1QLB B;  2W54 A;  2NS5 A;  3VR9 B;  3G9W A;  2RLO A;  3HM6 X;  4GB9 A;  3ZDM C;  4KSK C;  2WYQ A;  3NW8 A;  1T0S C;  1QKZ A;  3DBH I;  2YSZ A;  2COA A;  3AU5 A;  3H7S A;  3A98 B;  1WE6 A;  1P9D U;  5D2M B;  1TY2 A;  4FAD A;  2LVQ A;  3DDC B;  5HKH A;  2ELA A;  2GS0 A;  3EUB 2;  2L2I A;  2HE7 A;  2Y5C A;  3H7P B;  1WG7 A;  3HQC A;  4KZ0 A;  1WJ6 A;  1TKG A;  2INC C;  3K9P B;  3N1Z C;  1X1F A;  4WSF A;  2L32 A;  1WJ4 A;  4A9A A;  1V1O A;  2ADZ A;  3QK0 A;  1RFK A;  3T06 A;  5C16 A;  4PNK A;  1TJE A;  2QIE B;  5IAA C;  4EMO A;  3B2F A;  4JX1 C;  4EE2 A;  4LJP B;  4BFR A;  1DOY A;  2DYO A;  3AEE B;  1CZP A;  2JT4 B;  1UF0 A;  3MDB C;  3V5W A;  1AYF A;  2D3A A;  2D3C A;  4C4V B;  4HHV A;  4H8S A;  2JRH A;  1HBK A;  3W9C B;  4L23 A;  3KRX A;  2KWU B;  3AE7 B;  4DQO C;  5L81 A;  3RYT A;  4HKQ A;  1WXV A;  2REX A;  5CTR C;  4ICV A;  1XO3 A;  3T8M A;  3ZJV A;  3IVF A;  2L3Z A;  2J7Q B;  1EF5 A;  1CQV A;  3ZNG C;  5HI1 A;  2YT2 A;  1J7B A;  1V88 A;  5BMG A;  3AEA B;  4FXC A;  3AE9 B;  3ZYY X;  1QOF A;  4JE3 B;  4YTN B;  1FO4 A;  1E10 A;  2MKR A;  1PGB A;  2ZJD A;  2M38 A;  3NUH B;  2L05 A;  1Q1O A;  1BUI C;  1MIX A;  1KRH A;  1C78 A;  1CK1 A;  5C79 A;  2K5P A;  3H6N A;  1WZ0 A;  4JKD A;  1L4Z B;  3LJ3 A;  2LMC A;  5AZH A;  3AXC A;  4DXA B;  2YLM A;  4RFB A;  3PHX B;  4ANV A;  2GLS A;  1C4A A;  1DYN A;  3IAS 1;  4TQ0 A;  3NRZ A;  2L1C A;  4OVZ A;  1LQB A;  3DXD A;  3VHT C;  2HTH A;  2N9P C;  2KMM A;  3TFM A;  2DYB A;  4II3 B;  4NAW A;  2C60 A;  3N1X C;  4KHO A;  3U12 A;  3NWF A;  1V1P A;  3APC A;  2NMQ A;  2V3P A;  2ZPY A;  3ZTC A;  4ILH A;  1I7A A;  1UPR A;  3B9J A;  3RD2 A;  3RNE C;  4XYC A;  5D27 A;  3IFW B;  2V9H A;  2BW2 A;  5EE1 A;  3UGB B;  1KOT A;  1ZXH A;  3BII D;  1I4H A;  3FAH A;  2MCN B;  3OG5 A;  3DBR I;  2IPK D;  3CF6 E;  4FBJ B;  3N30 A;  3ZDT A;  2K3U A;  4EFO A;  1L6V A;  2HDE A;  2INN E;  4NY0 A;  3DXC A;  4W9H A;  4P7I A;  3DVN V;  4P1C C;  2LOX A;  2CS4 A;  2NCN A;  3B2G A;  3P1M A;  3TMP B;  3NOB A;  1BWN A;  2QIL A;  2WXJ A;  3AB5 A;  2LI5 A;  1TKE A;  1TS3 A;  1K8R B;  1QOG A;  2KO3 A;  2NBV B;  5HE0 A;  1WX9 A;  2DKQ A;  3UQA A;  2ZCC A;  4H2A A;  4BBK A;  2CQU A;  1HZ5 A;  3FSS A;  2QMT A;  3Q14 C;  2UZS A;  4HK2 A;  4D2K A;  4CHK A;  3RCZ A;  3I57 A;  2PMV A;  3UF8 A;  1XLO A;  4I6L B;  5JVL A;  4GPT B;  4HB2 B;  1R4M I;  1V80 A;  1NVI D;  4ILJ A;  2A4Z A;  2GMI C;  4F7H A;  1UGM A;  1RFA A;  4W9J A;  4DXG A;  2WXG A;  1OGW A;  4BZA A;  4AJW A;  3E56 A;  4ZDV A;  1DOI A;  2JY6 A;  2LUE A;  2AX5 A;  2MRP A;  4DHZ B;  4EUT A;  1N61 A;  2INP E;  2QKM A;  1VLB A;  3ZUN A;  4DX9 0;  4HWI B;  3WCQ A;  3A58 A;  2KLC A;  1SXT A;  2KQS A;  2YRY A;  3A4S C;  4QXA B;  5TSS A;  1P1A A;  1WJ1 A;  2LRW A;  4W9G A;  3TBL D;  1B9R A;  3BVM A;  1UWM A;  2BT6 A;  3GE8 C;  3ULB A;  2KKC A;  1V97 A;  5CLL B;  2I1K A;  5IA7 A;  1PGA A;  3ZGZ A;  2CHX A;  1KFY B;  1YOV B;  5D3I B;  3V6C B;  2GCJ A;  4KHB A;  1Q0W B;  3AE6 B;  1ZP0 B;  4JK9 A;  2DEN B;  2KAN A;  3A9J A;  1LXD A;  1EWC A;  3V6E B;  1W1H A;  1NDD A;  1SBB B;  1YN4 A;  2CY5 A;  2MBO A;  4XWT A;  1ROE A;  2IGD A;  3KUC B;  5JLJ B;  3ZXR A;  2XQN M;  2N9E B;  4N6E B;  4PYZ A;  1U2B A;  2DZK A;  3NHE B;  5KHQ A;  3D8F A;  3HVD A;  2Z0Q A;  3U52 E;  3EFC A;  3HSA A;  4US9 A;  4KKI A;  4E3C A;  4KAX B;  3VVW B;  2ROZ B;  3W1Y A;  2JZZ A;  4A90 A;  4ZHP A;  2DHZ A;  2WDV B;  4IW0 A;  1PFD A;  3QCA A;  2LYD A;  3A8Q A;  2OOB B;  3ENE A;  4CQN A;  3I63 C;  1XLP A;  3TIX A;  5EE3 A;  4AP4 C;  1N5X A;  4XX5 A;  2ZKM X;  5CHV C;  2OHF A;  2WXQ A;  4KX6 B;  3WYF B;  2PVO D;  4DDI D;  1UPQ A;  3NSU A;  2J52 A;  3KH0 A;  2RDH A;  1K5G B;  1V89 A;  1KJT A;  4RCO A;  1FNW A;  3VQI A;  1EO6 A;  3NZS A;  5D6J B;  5C1Z A;  4LCD E;  4WAF A;  1FPY A;  4YSZ B;  2IND C;  4GN1 A;  1NEN B;  1IGD A;  2MEK A;  3N1Y C;  3P4Q B;  4O1N A;  1TGZ B;  4LNI A;  3TJP A;  1EVH A;  2DX5 B;  4XZ4 A;  4HRS A;  3FLV A;  4M8M A;  5D3V A;  1SE2 A;  1N6Z A;  1RAX A;  3QAQ A;  2BTE A;  3SYX A;  1T77 A;  2P0D A;  3M95 A;  1KF6 B;  5T8I A;  1OTR B;  2IZV B;  4KIK A;  4JKG B;  3WA0 A;  2NBU A;  2RUK B;  1T5X D;  1M7R A;  2CKH B;  5IKC M;  3VFK A;  1WGD A;  4MH0 E;  1Y8R C;  2IBI B;  4K7S A;  3IAM 1;  4G50 A;  3R7Q A;  1WYG A;  4WJQ A;  5G5H A;  5AZF A;  2QDF A;  4HB3 B;  3DVG X;  1K50 A;  1MG8 A;  3QA8 A;  3PGE A;  4WJ7 A;  3P4P B;  2J0J A;  3AN1 A;  3JVZ X;  1MG4 A;  3L17 A;  5J3Q A;  2LUL A;  1ENF A;  3W1S A;  1H10 A;  1OFF A;  3E9P A;  1ZUD 2;  1E6E B;  2GBR A;  3ZRF A;  1E9M A;  4LNF A;  1FB8 A;  3ALB A;  5BYR A;  3ABV B;  2MQJ A;  3QC8 B;  4TYZ A;  2G35 A;  2HRJ A;  5FR6 A;  1UNS A;  2K8E A;  1M94 A;  3AMZ A;  2JF5 A;  5KQ1 A;  4HCP B;  1STE A;  1ISN A;  3P63 A;  2MSE D;  3WAM A;  3ZNZ B;  1GOZ A;  3A8P A;  1WIA A;  1YN5 A;  1FGY A;  1I2H A;  3AE1 B;  1NEK B;  4OZC A;  2NR2 A;  2COF A;  2KVZ A;  2KZR A;  4BOS C;  3SO6 A;  3BVG A;  4P16 A;  1NU2 A;  4KVG B;  5EFX A;  2Z13 A;  4D6W A;  2K2J A;  1FIQ A;  1HEZ E;  3ZW3 A;  3DWM A;  2W2W A;  1X05 A;  2K1F A;  2EKI A;  2J4X A;  3FKY A;  3C8Y A;  4BBN C;  3LXF A;  4JWS C;  4PT5 A;  2KUP A;  4NNJ B;  2K8B A;  4ANW A;  4WQO B;  4KDI C;  3PZD A;  4LTU A;  2WWZ A;  3KLS X;  1B55 A;  4OVV A;  4W9I A;  1ZM0 A;  3UIO B;  3RN9 C;  3VUW A;  4E71 A;  3VDZ A;  3L13 A;  4MSQ B;  4MJS A;  4DBG A;  2BF8 B;  1L7Y A;  1TS5 A;  3U8Z A;  2JQR B;  4EZJ A;  1WSP A;  3JSV B;  4PS7 A;  1FRD A;  3AEB B;  4ZRK A;  3DPD A;  2K00 A;  2OTX A;  3DVG Y;  2DHJ A;  1E7P B;  3HRD D;  4PS3 A;  2AQ3 B;  4HKZ E;  2FCN A;  1U4A A;  2M19 A;  2LOZ A;  1EAZ A;  1YQB A;  3SD5 A;  1Z5S B;  3EC8 A;  4C0A A;  3HIE A;  1N62 A;  3EA6 A;  4YSX B;  3D8D A;  5M4Y B;  1KLU D;  3NWD A;  2JSV X;  4MGY E;  5LXH A;  3DBS A;  2VKI A;  2C7H A;  4W9D A;  1VDV A;  2WLB A;  1FNU A;  3TUO A;  2OQB A;  3RZW C;  4CHM A;  2Z59 A;  5KQ4 A;  1WE7 A;  4BKT A;  1YX6 B;  2KDI A;  3B0A A;  2QHO A;  3JYU A;  4TKN A;  3TCA A;  1JRP A;  3DQV A;  4IM0 A;  5D3D A;  1MI0 A;  3PRZ A;  1PYW D;  5IOI A;  3OWE B;  4CO7 A;  4QJ3 B;  3Q8A A;  3MFG A;  1P3Q U;  1ACA A;  1JRO A;  2WHI A;  3ZJT A;  2WP9 B;  2RRF A;  1IBX B;  2KFJ A;  4P6V F;  2ZZP B;  1AN8 A;  3BYT B;  1ET6 A;  1G6J A;  2L83 A;  1C1Y B;  3KUZ A;  1QC6 A;  3AJ4 A;  1WXA A;  2JVC A;  1C3T A;  1HQR D;  4J6I A;  4MM3 B;  1XKE A;  3KRW A;  2GBM A;  4WJP A;  2D07 B;  5LG4 B;  4KHA A;  1OQQ A;  4LK0 M;  1ET9 A;  2FNJ B;  4REZ A;  3TW1 A;  2RGF A;  2KMA A;  4B95 A;  3BVZ A;  3X23 A;  5FK9 C;  3TEZ A;  2BB5 A;  1GGO A;  3QJZ A;  1QT9 A;  2WXO A;  4IM3 A;  3RT3 B;  4RNA A;  1EU4 A;  2Z0P A;  2WXF A;  1SHC A;  1FRR A;  1HZ6 A;  1SEB D;  2KFK A;  2VZK B;  1VBG A;  1WJN A;  3ZNI D;  3M63 B;  2ELB A;  1TBE A;  2MJD A;  3WAP A;  1YQ4 B;  3KYD D;  3BIN A;  2FJL A;  2C5L C;  4L2Y A;  1N63 A;  2PE9 A;  2FID A;  5C5B A;  1U29 A;  3B1L X;  2NTS A;  5DPS A;  5GXG B;  5IRS A;  4JK8 A;  1NYQ A;  1JWS D;  4I6P A;  1UWX A;  2DAF A;  1V81 A;  2LD9 A;  1PQS A;  3ZNH B;  4WVF B;  4RGM A;  3C0R B;  3SBT A;  1CMX B;  1F0Z A;  3PLV A;  5FKA C;  3NVV A;  4JQW C;  3UZT A;  5GOW B;  4N58 A;  1UNP A;  1BML C;  1ZC4 B;  3ONS A;  2MP2 A;  4ZRJ A;  2KIG A;  3Q6B A;  1HA5 A;  2KAJ A;  2PE6 B;  1AWD A;  2LRU A;  2RNR B;  2J59 M;  1WGH A;  3LDZ E;  3Q3O C;  3AUL A;  4OZA A;  2KJ6 A;  3DBL B;  2RGN B;  4FJZ A;  4Y94 A;  4K1R B;  1P5T A;  2I5C A;  1UUP A;  2CU1 A;  4F7U P;  1ZXI A;  2MBE A;  5AUI A;  2JX5 A;  4GSW A;  1V9J A;  2DYM A;  2Y5B B;  1J8C A;  4GXB A;  2B3A A;  4GLS C;  2G9H D;  4IOY X;  2LHD A;  4G11 A;  2ROV A;  1FMA D;  1SE3 A;  4NSW A;  2KT7 A;  1C9F A;  5J3T A;  2CR5 A;  1MPE A;  4IWQ A;  4NAW B;  1AQC A;  1J0W A;  3H7P A;  1V1P B;  3UQB A;  3ML9 A;  3WAO A;  1WFY A;  4M8N A;  2IYD B;  2I1J A;  2IJ0 A;  4C00 A;  1XCG A;  3N32 A;  3HK0 A;  4HJK A;  2N1W A;  1FHO A;  3PT2 B;  3L10 B;  4W9E A;  3S2A A;  4KZC A;  1YNT E;  4GDL A;  3OJ4 B;  5HE1 A;  2JRI B;  3E9S A;  4MEM A;  2YVC A;  1VZ6 A;  3HVZ A;  3K9O B;  3VTW A;  1JCK B;  3RNB C;  4KDL B;  2MBQ A;  1L2N A;  5AEK B;  2CHZ A;  1F52 A;  4ITK A;  4L1B A;  3QIJ A;  2YT1 A;  3L0W B;  2KVR A;  2KWC A;  3C19 A;  2Q5W D;  1U5F A;  2ZVN A;  1JML A;  1IPG A;  1PGX A;  2IGG A;  3RFZ B;  1HB8 A;  2JZP A;  5G5G A;  1EF1 A;  2ICI A;  1MFW A;  2ZNV C;  3DXE A;  1MJD A;  2LFI A;  3Q3J A;  3P42 A;  3NJT A;  3AEF B;  1MK7 B;  4W9K A;  3QAR A;  4ZYS A;  1ZDX A;  1AWE A;  5KCV A;  2VRW B;  4G3X B;  2K6Q A;  2O6V D;  2Y3A A;  4JGH B;  4AS1 A;  1E7U A;  1YIW A;  3PEG A;  5C2T B;  1UD7 A;  1UH6 A;  2KMC A;  2Y8F A;  3Q3M C;  2VZK D;  1MVK A;  4HAW B;  3R7R A;  4J3O D;  3MC8 A;  2KDM A;  3ZJU A;  1QIL A;  2AL3 A;  2CJN A;  4A5K A;  1PUT A;  1RM6 C;  1RJ2 A;  2BS4 B;  5H8Y E;  1FXT B;  5E6P A;  2YS1 A;  1TJ6 A;  3BZD B;  2AWT A;  1U5E A;  2MDX A;  3OAN A;  3VUY A;  2O2V B;  1IGC A;  3RUL A;  1GJZ A;  5DHF B;  3PS6 A;  1NBF C;  3QHT A;  2BB6 A;  2DTC A;  1JAL A;  2R61 A;  4HAT B;  4M0W A;  1NTV A;  1E0Z A;  4JWU C;  3A1Q B;  3ZVR A;  3SR6 A;  4MT5 A;  3SDL C;  2LAS A;  2KR0 A;  3EHV A;  1DBH A;  3HIZ A;  2LZ6 A;  3FVC A;  1NTI A;  1F9J A;  2D4Q A;  3GS2 A;  1QZE A;  3UI3 A;  4LLG M;  1WGQ A;  3DHI C;  2Z0O A;  1F1H A;  1TS2 A;  3UIP B;  4C56 C;  3PHW B;  4JKB A;  2KTR B;  2X38 A;  3VH4 B;  2BWF A;  2MBH A;  1V86 A;  1GG3 A;  2BPS A;  2FBW B;  4HAU B;  3VH3 B;  1V49 A;  2BYV E;  3A9J B;  2NPT B;  4WIP A;  2I2Y A;  3APF A;  2DAJ A;  2BS3 B;  2WDQ B;  1JWA D;  4S17 A;  2J0K A;  2K8C A;  1Y56 A;  4GDK B;  4KGR A;  3URY A;  3Q69 A;  2D11 A;  2WXR A;  2WXP A;  3ZO5 B;  4A3O A;  1ESF A;  2NBV A;  2KWV B;  2HD5 B;  4AOF A;  3QWM A;  4D0N B;  3RZF A;  1SJE D;  3U7Z A;  2PJH A;  4HPL B;  4I6N B;  2JUO A;  2IGH A;  2BKF A;  3P7Z A;  2ZW0 A;  1WMH B;  2L76 A;  2L52 A;  3H1U A;  4C80 A;  2LXA A;  4MAC A;  4URK A;  5FR3 A;  1X1M A;  1HTO A;  3AEC B;  4WWP A;  1VBH A;  2MHJ A;  2P0H A;  3CIR B;  4B0M A;  3CMM B;  2HTM E;  3AM9 A;  1V5U A;  4OW0 A;  1W1D A;  2KWD A;  3RNC C;  3MP9 A;  1VR9 A;  4N59 A;  2PLP A;  3SEB A;  4B9K A;  3V3X A;  1K5D B;  2W9N A;  4EOY A;  4WAA A;  3VIA A;  1DGJ A;  5H92 C;  2YF0 A;  2D3G A;  2V4L A;  2WQY B;  2MA9 B;  4A55 A;  1NI2 A;  1J19 A;  1NI3 A;  2L0F A;  3PRM B;  4EKU A;  4W9C A;  5C23 A;  3PRE A;  1D3Z A;  3GP7 A;  4IWO A;  4NJ6 A;  3D32 A;  4WUR A;  3EFU A;  2R0D A;  2LGY A;  2MJE A;  1P3R A;  1H4R A;  2EEL A;  2KQ7 A;  1WJU A;  3KWL A;  2DLB A;  3MC9 A;  3OHM B;  5CHF A;  5EE0 A;  2KHW B;  3PRP B;  1I4X A;  3F0W A;  4IDI A;  1A5R A;  2V3N A;  3AH7 A;  4YXD B;  1V5M A;  2KJR A;  2D10 A;  1BAK A;  2D9Z A;  2LGX A;  5FI1 A;  2JWZ A;  2W82 A;  5D3Y A;  3I3T B;  3ZKJ C;  5DIF B;  2G1E A;  4WWO A;  3IBE A;  4TUU A;  1EU3 A;  2CJO A;  2DWQ A;  1UBQ A;  2FIF A;  1T6B X;  1TQZ A;  2W3S A;  2EMT A;  2IY0 B;  2ZCB A;  3Q8B A;  2KXJ A;  4EZK A;  3DBH B;  5C3J B;  2ONQ A;  3GOE A;  5LNK 1;  2BGF A;  2X8X X;  4IUM B;  3VTU A;  2KGX B;  2E6X A;  1EWY C;  2NMB A;  3AEG B;  1TS4 A;  1WGU A;  1L0X B;  4YWG G;  2R2O A;  1MHH E;  1QQG A;  1XCQ L;  3TEY A;  1MI1 A;  2N0S B;  1TIF A;  1UEF A;  3KY9 A;  2D2Q A;  2PKO A;  1T0Y A;  3IHP C;  3WAL A;  4Z2M B;  2IYB A;  1KC7 A;  2D3B A;  2JPH A;  3ZTD A;  1WXQ A;  3HM3 A;  1GC6 A;  1OQR A;  5E6O A;  1U27 A;  1ZC3 B;  2LKO A;  2DX5 A;  3IT6 B;  3AE4 B;  4Q2J A;  2N9K A;  5JHA A;  2J42 A;  2C9W B;  2GRI A;  4OVU A;  1P0R A;  3RPF C;  2FCQ A;  1WXS A;  2XK5 A;  4ARC A;  1KZG A;  4B0E A;  4HCN B;  4KGT A;  4FJY A;  2DN6 A;  2KDF B;  4GOC A;  1JW9 D;  1FGZ A;  2MX2 A;  5BYQ A;  4ZRI A;  1NYR A;  3LB8 C;  2CHW A;  2VSZ A;  2MBB B;  1HXY D;  1YMH E;  1ZE3 D;  1V61 A;  1U5D A;  1L0V B;  3NS8 A;  3ODW A;  2KYW A;  1I35 A;  4FHJ A;  3SUZ A;  1LM8 B;  2FCS A;  2OED A;  4ACF A;  4MJS B;  4PYU A;  4IAP A;  2GOW A;  5J2R A;  1IP9 A;  2GJY A;  1L6U A;  4JKA A;  4JPS A;  1V5P A;  2Q13 A;  2BQQ A;  2LBB A;  4DWF A;  3N7C A;  1AW7 A;  5L95 C;  2PTL A;  4UDU C;  2P8V A;  1Q67 A;  3ML8 A;  3PLU A;  1SGH A;  5KHO A;  4BKS A;  4YTM B;  1PDX A;  3PP2 A;  4MGK E;  4HAX B;  1N3H A;  5TR5 A;  1SSN A;  3B08 A;  1FD6 A;  2E2X A;  2G4D B;  2K39 A;  4HEA 1;  2J53 A;  4RGN A;  1VD2 A;  2D9X A;  3DVN U;  3LJU X;  1Q5W B;  4RM9 A;  1TZ1 A;  4A20 A;  3TEX A;  3DBR B;  1XF5 L;  2DNF A;  2MLB A;  1RLF A;  2Z59 B;  5EE9 A;  3X0W A;  1GB4 A;  1PLS A;  1E8Z A;  3VXW A;  2V4I B;  5EDS A;  3IG3 A;  4AUQ C;  1GAQ B;  3ZLZ A;  3Q8C A;  1FHW A;  3IXS A;  4S0R A;  3KSY A;  4DK5 A;  4ZHO A;  2IO3 B;  1RYJ A;  2N23 A;  3FIL B;  4A6F B;  4NPN A;  5J3Y A;  3PTF C;  1FFV A;  4K3C A;  3L54 A;  5AZG A;  5D94 A;  2ABD A;  3AE8 B;  2DFK A;  4L6E A;  4KGS A;  5HE3 A;  3QX1 A;  2M8S A;  2GUM A;  4GOU A;  2BYE A;  4A8X C;  1S3S G;  3DHG C;  1T0Q C;  2G4S A;  2YEP F;  2FJ9 A;  1KTK A;  1WRD B;  2MFQ A;  4P1B C;  1V8C A;  1NTY A;  2UU7 A;  5IN7 A;  3AU4 A;  1I4P A;  1FOE A;  3M3J A;  1XX0 A;  2XEW A;  1VRA B;  2OJR A;  2CAY A;  4KV2 A;  4WH4 A;  2MWN B;  1FFU A;  1R4M B;  1FM0 D;  2VRR B;  3Q3F A;  2IY1 B;  1Z2M A;  5BO4 B;  3T3O A;  1WYW B;  4TSS A;  4JKE A;  3R66 C;  3RNF C;  4ZYN A;  3RI7 C;  1WGG A;  2JXX A;  4TV3 A;  5HHD G;  4K7W A;  3B77 A;  4C7Z A;  2Z14 A;  5AUK A;  2COP A;  2C7N B;  1XR0 B;  1F77 A;  4M00 A;  1E7V A;  4IOI E;  1T3Q A;  1OY2 A;  1P7F A;  2ASQ A;  2QJL A;  1T0R C;  2JYE A;  2LVP A;  3VUX A;  4XWW A;  2EKE C;  1TTN A;  2KDB A;  3ETR A;  4DHZ E;  1YJ1 A;  5C5B B;  3N3K B;  5JZE B;  2KNB A;  2Z8L A;  2UZR A;  1IUE A;  4HRO A;  5HE2 A;  3N20 C;  3L08 A;  2DZJ A;  1N60 A;  2M1M A;  2YEP B;  3L4P A;  2WX1 A;  4QJ4 B;  1UEL A;  2NTT A;  3A9K A;  2YS5 A;  2XNA C;  3PVU A;  1LGR A;  4NQK E;  2YT0 A;  2HJ1 A;  3DCX A;  5CHW A;  3ZIM A;  4GZU A;  3AV8 A;  4HPP A;  4ARI A;  3MHZ A;  4TQ1 A;  1RRB A;  2IDY A;  2K25 A;  5JHB A;  1WZ3 A;  1OEY A;  2AYO B;  2KJH B;  3MJW A;  3VR8 B;  4RMA A;  3A4R A;  4US8 A;  1XOD A;  1MK9 B;  2DYN A;  3NVW A;  2LGS A;  2BWE S;  2KIE A;  1P7E A;  3OLM D;  4ZRQ A;  3O96 A;  4WWN A;  3MC0 B;  1IBX A;  1E90 A;  2WXH A;  1V5T A;  3QBV B;  1VJK A;  2ACZ B;  2VH1 A;  4A6Q A;  4F1S A;  3KZ1 A;  2PVG C;  4K17 A;  1B1Z A;  2DHK A;  3V61 A;  1DDV A;  3TVV A;  3BY4 B;  3NVY A;  1V6E A;  2DHI A;  1OEY J;  3Q2A C;  2RQ1 A;  4OZB A;  4MM3 A;  3VRB B;  3P2B A;  1ZKH A;  1WGR A;  1YJI A;  4USA A;  4NAM A;  3SU8 X;  1D5M C;  2YS3 A;  3OAW A;  1D5Z C;  3ULC A;  4FUL A;  2K6D B;  4WWM A;  2EC1 A;  1I4R A;  4NZL B;  4PK1 A;  1QOA A;  2H89 B;  4IFS A;  1XT9 B;  1JWM D;  2RSG A;  1C77 A;  3GYO A;  2DIK A;  2KQ4 X;  4JKC A;  2CU3 A;  2O6V A;  4CSQ A;  1Q10 A;  1FAO A;  3PVW A;  3NZ3 A;  2PEA A;  1R4N B;  4JK7 A;  1DDW A;  2Z4D A;  3GZN B;  2ON8 A;  1GNU A;  2LHE A;  5DPR A;  1E8Y A;  3FM8 C;  2PZ1 A;  1MPH A;  4WQM A;  2RR9 A;  4GDL B;  2WXM A;  2WDR B;  2L8J A;  2W3R A;  4MT7 A;  1E8W A;  4NJ7 A;  4YL8 A;  1ZDV A;  3RCP A;  3NS1 A;  4PS8 A;  5JP4 A;  2L1A A;  2FJU B;  2HTH B;  2GBK A;  4QAY A;  5IJM A;  4AWJ A;  4EJN A;  1U5G A;  2ZW1 A;  1D4B A;  1Z87 A;  4YON A;  4RGO S;  3ZVV A;  4HLE A;  5DH9 B;  3P4R B;  3Q8E A;  4MK0 A;  3NZU A;  2KCJ A;  2AL6 A;  2JYT A;  1J7A A;  2GI9 A;  3E9O A;  2M14 A;  4MGI E;  1RRP B;  1KLV A;  3U4E G;  4E74 A;  5C6R A;  1X11 A;  2N7D A;  3P4S B;  1J0G A;  1YJJ A;  4DXF A;  2AQ1 B;  3DOW A;  2CB8 A;  3ODO A;  2SEB D;  3M62 B;  2K0P A;  2IO2 B;  1WY8 A;  3R3M A;  4C4V A;  2DBY A;  4LJO B;  2KX0 A;  4ASW C;  2W2X D;  4MEL A;  2ZVO A;  1GUA B;  3D8E A;  1UNR A;  2N1V A;  5CX3 A;  2SAK A;  4JIO U;  4JKH A;  3PV1 A;  1EUV B;  3ODX A;  3W2D A;  4QJ5 B;  2KD0 A;  5LLI A;  1SF0 A;  4IG7 B;  2FDQ A;  4W9F A;  5MPO A;  3NG0 A;  2RPV A;  3KW5 B;  4IKG A;  3U2S C;  2WNM A;  2NVU I;  3PO0 A;  4RGT A;  1YX5 B;  4BBN F;  3KYC D;  4M0W B;  4LNO A;  3PZ7 A;  3BYY B;  2R2Q A;  2AEH A;  1UNQ A;  2QKL A;  1WM3 A;  1XD3 B;  1I4Q A;  3M1I B;  4NJC A;  1WGY A;  2Z0E B;  3SFD B;  3IT4 B;  4X57 B;  2FAZ A;  1TKY A;  1KZ7 A;  4F7Z A;  1X1G A;  2WS3 B;  2R2Y A;  4JKF A;  4ILG B;  2RSU A;  3AE5 B;  3ZQ4 A;  4EZL A;  1TXD A;  1FHX A;  1PFJ A;  1HE8 A;  4HPM B;  1Y5O A;  3RUI B;  2Z0D B;  3A33 B;  3HW2 B;  2RDB C;  1E5W A;  4OT1 A;  1L4D B;  1LB1 A;  2QCZ A;  5CLQ B;  2JXT A;  2MH7 A;  4R3D A;  1C79 A;  1XEE A;  1QQR A;  2QEJ C;  4LNK A;  1BTN A;  3U7D A;  1CJE A;  1LW3 A;  5BMH A;  4MDK E;  2GBN A;  1IYF A;  4XGA B;  2KLG A;  1TZO A;  4KHB B;  2KN5 A;  5LOP B;  1GPX A;  4HVB A;  2W2X C;  3HHM A;  1WR6 E;  4RF1 A;  1PMS A;  3Q8F A;  2BBC A;  5J18 A;  3NY5 A;  5I2S A;  2RD0 A;  1TYG B;  2K22 A;  4ANU A;  2V3S A;  1DYQ A;  2K8H A;  2KTF A;  2FUG 1;  1XLN A;  1FEH A;  4PQ0 A;  3V60 A;  1KBL A;  3Q3N C;  4DHJ B;  3E9L A;  2V76 A;  2DLW A;  1M4V A;  1SIF A;  4HAY B;  2O2V A;  1MIZ B;  4MY6 A;  2COC A;  1VZ7 A;  1WM2 A;  4GMV A;  3PSC A;  2M0A A;  1OQN A;  1SB3 C;  3A1Q A;  2N9L A;  2EJ8 A;  1BTK A;  3BK2 A;  5JH5 C;  4F7G A;  1MAI A;  2WXN A;  5HG2 A;  2GBJ A;  3CSF A;  3TL5 A;  1YD8 U;  1FXI A;  4MGZ E;  4OSN A;  1KLG D;  2RPQ A;  2WXL A;  2GB1 A;  4KSL C;  2DZM A;  1I4G A;  4MSM B;  2KK8 A;  1N5W A;  2KTR A;  4AQ7 A;  3NWA A;  2D5G A;  2R09 A;  3AI5 A;  3I9V 1;  2KUQ A;  3PPA A;  3MJ5 A;  1D6E C;  2Y5P A;  4K3B A;  2NPT A;  5JXV A;  4GNK B;  3DCG A;  1ZOY B;  2G45 B;  3O65 B;  3MPX A;  4HAZ B;  4IC7 B;  2NBW B;  5GMV A;  2IFS A;  2L00 B;  2LUM A;  4FHK A;  4GDK A;  1I42 A;  2H7D A;  2D9Y A;  4JL9 A;  4NQL B;  4BAX A;  2RMM A;  2BS2 B;  3R2I A;  4TMA B;  1HB6 A;  2M56 B;  1P98 A;  3H9D A;  2D9V A;  4KIK B;  2W55 A;  3CWI A;  4YSY B;  2A5U A;  3OJ3 A;  1WJM A;  3VAW A;  2IO0 B;  3BJI A;  5FI0 A;  1WMH A;  2LJI A;  2PIA A;  1FCC C;  2WU2 B;  3N9Y C;  4HJG E;  2AQ2 B;  4AJY B;  2PPH A;  4XE0 A;  4A6K A;  1JWB D;  3PSE B;  4HDO A;  2MWS B;  1WX8 A;  3AE2 B;  4ZOH C;  3UIN B;  2J0M A;  1FCL A;  5LXI B;  4BKG A;  1BXT A;  4HB0 B;  1SE4 A;  3CXB B;  3HUI A;  2JP2 A;  3O13 A;  3KWV A;  2M17 A;  2ZPN A;  3P6A A;  5DPT A;  4F8C B;  4XDC A;  3V05 A;  1TY0 A;  2UWQ A;  4WJN A;  4B6W A;  4L1R A;  1R4N I;  3GZN I;  1JWU D;  2LEK A;  1C4P A;  2CY4 A;  1Y19 B;  3DBL I;  2M4N A;  2COD A;  2XBB C;  3VOQ A;  5I4D A;  1OMW A;  1WWT A;  3BWU D;  1GC7 A;  2KAC A;  5D7G A;  1SJH D;  5J17 A;  2LGD A;  2N7J A;  4IWP A;  4HB4 B;  2XK5 B;  4HXD A;  4RF0 A;  4CYE A;  5L83 A;  3ML4 A;  4XC2 A;  4LDT B;  2XN9 C;  3KQ4 A;  1EGX A;  2VH2 A;  1H8C A;  5JHH A;  2G3Q B;  1ZSQ A;  1ZW7 A;  3RMK C;  3R8B A;  4DDG D;  3RNG C;  2H88 B;  2DA0 A;  4EEW A;  3CIK A;  1WGK A;  2UVM A;  5DI9 B;  2LG1 A;  3SBG A;  1WXM A;  1K51 A;  4A6H A;  1VZ8 A;  2JWU A;  3SHQ A;  5LON B;  4HSI A;  5IP4 D;  3U30 A;  4GIV A;  2E3T A;  5G55 A;  2BVC A;  3T9L A;  2V0G A;  1ST7 A;  2LGI A;  3VRA B;  1VCB A;  1JRU A;  3AED B;  2WXI A;  3EGR A;  1K52 A;  1LO5 D;  1K53 A;  2KC2 A;  3DHH C;  4RH6 A;  4XDD A;  4DHJ D;  3W5U B;  1DRO A;  1ZPS A;  3QQ8 B;  4ICU A;  4CHJ A;  2LVO A;  3TSS A;  4JKG A;  5DPW A;  1MHX A;  5E6J A;  4DBB A;  4JLC A;  3FEH A;  2MJ3 A;  3LYY A;  5E6N A;  2MW5 A;  3KUD B;  2TSS A;  3SNH A;  2KDE B;  2L7R A;  2WDT B;  3EEC A;  2UYZ B;  2DYQ A;  4GMX B;  2Y7B A;  4FA6 A;  3ENB A;  2K49 A;  3PG7 A;  1OQY A;  1WF9 A;  2K2U A;  1KI1 B;  3TEW A;  3GE3 C;  3PVL A;  4YT0 B;  2C7M B;  4FLH A;  3W5V B;  4GGQ A;  2ZEQ A;  4YTP B;  1P6S A;  2KC1 A;  1E8X A;  1R7S A;  3J9C A;  1ZVR A;  4M01 A;  2GCL A;  2DKP A;  1XXG A;  1XD4 A;  1MKE A;  4GU2 A;  5DHA B;  3R2T A;  2FUH B;  4BOZ B;  1A70 A;  2WX0 A;  3JW0 X;  5D3X A;  2KOX A;  4N9F 4;  4B6H A;  3DWG C;  1BT0 A;  4XWX A;  1ACC A;  2JU6 X;  4MH8 A;  2NZ8 B;  2BKR B;  4K2O A;  2P0F A;  1DOX A;  2LXC A;  1UGJ A;  3ECI A;  1ZYI A;  4ZRP A;  2ZNV B;  4DIX A;  2V1Y A;  2LJ5 A;  3EPY A;  4DX8 A;  1TT5 B;  1YN3 A;  4OHJ A;  5JHG A;  1S1Q B;  4FN2 A;  1FNV A;  2X0S A;  2M0X A;  4II2 B;  5G2N A;  1WI1 A;  1X86 A;  1J7C A;  1QOB A;  2DX1 A;  2N0Y A;  2QSD A;  1UZX B;  1QF6 A;  4G0N B;  1F2R C;  1V2Y A;  2H7E A;  2QC8 A;  2D9W A;  1C4C A;  3WIM A;  2B76 B;  4HDQ A;  4FJV B;  1DIK A;  2WGS A;  2WXK A;  3T3N A;  1D5X C;  3ZRC A;  3VTV A;  5DCN A;  4W9L A;  2N9X A;  3FP5 A;  4K81 A;  1I7H A;  1HTQ A;  3MHS D;  3KVF B;  3A9K B;  4K2P A;  4LDT D;  3QWZ B;  2EMS A;  1SIJ A;  3I5J C;  1L5P A;  3GB1 A;  4Z2N A;  3APD A;  3JSV A;  2IO1 B;  4M02 A;  3GYP A;  3BK1 A;  2KFK B;  2CRF A;  1F2R I;  4ANX A;  3WAN A;  2PW9 A;  3SFE B;  3V62 A;  2WH5 A;  2KX3 A;  4RM8 A;  3F5R A;  4A3P A;  2KN4 A; 
#chains in the Genus database with same CATH homology
 1ZGU B;  1AAR A;  2X18 A;  2JZ3 B;  1IRS A;  3TO1 A;  2FCM A;  4HAV B;  3MTN B;  4A6F A;  4WJO A;  2N4F A;  3E66 A;  3CST A;  2BYF A;  2L0T A;  1JDE A;  4BKS D;  1XQQ A;  1LFD A;  1M7E A;  2R82 A;  1SE9 A;  1WR1 A;  1W1G A;  4IM2 A;  2RVB B;  1WI0 A;  1WH3 A;  2HJ8 A;  3SV1 A;  1KM7 A;  2Y8G A;  1UBI A;  1NVL A;  2BCJ A;  2DZI A;  3L16 A;  5D3W A;  2MP2 B;  2N7E A;  1WX7 A;  1DDM A;  2O6V B;  3W1S C;  2I5F A;  4K7U A;  1V5O A;  2LWP A;  1WVH A;  4BVU C;  2NS5 A;  3G9W A;  2RLO A;  3HM6 X;  4GB9 A;  3ZDM C;  4KSK C;  2WYQ A;  3DBH I;  2YSZ A;  2COA A;  3AU5 A;  3H7S A;  3A98 B;  1WE6 A;  1P9D U;  5D2M B;  4FAD A;  2LVQ A;  3DDC B;  5HKH A;  2ELA A;  2GS0 A;  3H7P B;  2L2I A;  2HE7 A;  1WG7 A;  3HQC A;  4KZ0 A;  1WJ6 A;  3K9P B;  1X1F A;  4WSF A;  1WJ4 A;  2ADZ A;  3QK0 A;  3T06 A;  5C16 A;  4PNK A;  5IAA C;  4EMO A;  4LJP B;  4BFR A;  2DYO A;  2JT4 B;  3MDB C;  3V5W A;  4HHV A;  4H8S A;  2JRH A;  1HBK A;  3KRX A;  2KWU B;  5L81 A;  3RYT A;  1WXV A;  2REX A;  5CTR C;  4ICV A;  3T8M A;  3IVF A;  2L3Z A;  2J7Q B;  1EF5 A;  3ZNG C;  1V88 A;  2MKR A;  2ZJD A;  2M38 A;  2L05 A;  1Q1O A;  1MIX A;  5C79 A;  3H6N A;  1WZ0 A;  4JKD A;  3LJ3 A;  5AZH A;  3AXC A;  4DXA B;  2YLM A;  3PHX B;  4ANV A;  1DYN A;  4TQ0 A;  2L1C A;  1LQB A;  3DXD A;  3VHT C;  2HTH A;  2N9P C;  3TFM A;  2DYB A;  4II3 B;  4NAW A;  2C60 A;  4KHO A;  3APC A;  2ZPY A;  3ZTC A;  4ILH A;  1I7A A;  1UPR A;  3RD2 A;  5D27 A;  3IFW B;  3UGB B;  1KOT A;  2MCN B;  3DBR I;  3CF6 E;  4FBJ B;  3N30 A;  3ZDT A;  4EFO A;  4NY0 A;  3DXC A;  4W9H A;  4P7I A;  3DVN V;  2LOX A;  2CS4 A;  2NCN A;  3TMP B;  3NOB A;  1BWN A;  2LI5 A;  1K8R B;  2KO3 A;  2NBV B;  3UQA A;  5HE0 A;  1WX9 A;  2DKQ A;  2ZCC A;  4BBK A;  2CQU A;  3FSS A;  2UZS A;  4HK2 A;  4CHK A;  3RCZ A;  3UF8 A;  4I6L B;  5JVL A;  4GPT B;  4HB2 B;  1R4M I;  1V80 A;  4ILJ A;  2A4Z A;  2GMI C;  4F7H A;  1UGM A;  4W9J A;  1RFA A;  1OGW A;  4AJW A;  4ZDV A;  4DHZ B;  2JY6 A;  2LUE A;  4EUT A;  2MRP A;  2QKM A;  3ZUN A;  4DX9 0;  4HWI B;  2KLC A;  2KQS A;  2YRY A;  3A4S C;  1P1A A;  1WJ1 A;  2LRW A;  4W9G A;  3TBL D;  3ULB A;  2KKC A;  5CLL B;  2I1K A;  5IA7 A;  2CHX A;  3V6C B;  2GCJ A;  1Q0W B;  4JK9 A;  2DEN B;  2KAN A;  3A9J A;  1LXD A;  3V6E B;  1W1H A;  1NDD A;  2MBO A;  2CY5 A;  3KUC B;  5JLJ B;  2XQN M;  2N9E B;  4PYZ A;  1U2B A;  2DZK A;  3NHE B;  5KHQ A;  3D8F A;  2Z0Q A;  4E3C A;  4KAX B;  3VVW B;  2ROZ B;  3W1Y A;  2JZZ A;  2DHZ A;  4IW0 A;  3QCA A;  2LYD A;  3A8Q A;  2OOB B;  3ENE A;  3TIX A;  4AP4 C;  4XX5 A;  5CHV C;  3WYF B;  4DDI D;  1UPQ A;  3NSU A;  3KH0 A;  1K5G B;  1V89 A;  1KJT A;  3VQI A;  1EO6 A;  3NZS A;  5D6J B;  5C1Z A;  4LCD E;  4GN1 A;  1TGZ B;  3TJP A;  1EVH A;  2DX5 B;  4XZ4 A;  3FLV A;  4M8M A;  5D3V A;  1RAX A;  3QAQ A;  3SYX A;  2P0D A;  3M95 A;  1OTR B;  2IZV B;  4KIK A;  4JKG B;  3WA0 A;  2NBU A;  2RUK B;  1M7R A;  2CKH B;  3VFK A;  1WGD A;  4MH0 E;  1Y8R C;  2IBI B;  4K7S A;  4G50 A;  3R7Q A;  4WJQ A;  5AZF A;  4HB3 B;  3DVG X;  1MG8 A;  3QA8 A;  3PGE A;  4WJ7 A;  2J0J A;  3JVZ X;  3L17 A;  5J3Q A;  2LUL A;  3W1S A;  1H10 A;  3E9P A;  2GBR A;  3ZRF A;  1FB8 A;  3ALB A;  2MQJ A;  3QC8 B;  4TYZ A;  2G35 A;  2HRJ A;  5FR6 A;  1M94 A;  2JF5 A;  5KQ1 A;  4HCP B;  1ISN A;  3WAM A;  2MSE D;  3ZNZ B;  3A8P A;  1WIA A;  1FGY A;  1I2H A;  2NR2 A;  2COF A;  2KZR A;  4BOS C;  3SO6 A;  1NU2 A;  4KVG B;  5EFX A;  2K2J A;  3ZW3 A;  2W2W A;  1X05 A;  2K1F A;  4BBN C;  2KUP A;  4NNJ B;  2K8B A;  4ANW A;  4WQO B;  4KDI C;  3PZD A;  2WWZ A;  1B55 A;  4OVV A;  4W9I A;  1ZM0 A;  3UIO B;  3VUW A;  4E71 A;  3VDZ A;  3L13 A;  4MSQ B;  4MJS A;  4DBG A;  2BF8 B;  1L7Y A;  3U8Z A;  4EZJ A;  3JSV B;  4PS7 A;  4ZRK A;  3DPD A;  2K00 A;  2OTX A;  3DVG Y;  2DHJ A;  4PS3 A;  2FCN A;  1U4A A;  2LOZ A;  1EAZ A;  1YQB A;  3SD5 A;  1Z5S B;  3EC8 A;  4C0A A;  3D8D A;  4MGY E;  5LXH A;  3DBS A;  2VKI A;  2C7H A;  4W9D A;  2OQB A;  3RZW C;  4CHM A;  5KQ4 A;  1WE7 A;  4BKT A;  1YX6 B;  2KDI A;  3B0A A;  2QHO A;  3JYU A;  4TKN A;  3TCA A;  3DQV A;  4IM0 A;  3PRZ A;  4CO7 A;  1P3Q U;  1ACA A;  2KFJ A;  2ZZP B;  1G6J A;  1C1Y B;  3KUZ A;  1QC6 A;  3AJ4 A;  1WXA A;  2JVC A;  1C3T A;  4J6I A;  1XKE A;  3KRW A;  2GBM A;  4WJP A;  2D07 B;  4KHA A;  2FNJ B;  3TW1 A;  2RGF A;  2KMA A;  4B95 A;  3X23 A;  1GGO A;  3QJZ A;  4IM3 A;  3RT3 B;  2Z0P A;  1SHC A;  2KFK A;  1VBG A;  1WJN A;  3ZNI D;  3M63 B;  2ELB A;  1TBE A;  3WAP A;  3KYD D;  3BIN A;  2FJL A;  2C5L C;  2PE9 A;  2FID A;  5C5B A;  1U29 A;  3B1L X;  5DPS A;  4JK8 A;  4I6P A;  2DAF A;  1V81 A;  2LD9 A;  1PQS A;  3ZNH B;  4WVF B;  3C0R B;  3SBT A;  1CMX B;  3PLV A;  4JQW C;  3UZT A;  5GOW B;  1UNP A;  1ZC4 B;  3ONS A;  2MP2 A;  4ZRJ A;  2PE6 B;  2LRU A;  2RNR B;  2J59 M;  1WGH A;  3LDZ E;  3AUL A;  2KJ6 A;  2RGN B;  4FJZ A;  4Y94 A;  4K1R B;  1P5T A;  2I5C A;  2CU1 A;  4F7U P;  2MBE A;  4GSW A;  1V9J A;  2DYM A;  2Y5B B;  1J8C A;  4GXB A;  2B3A A;  4G11 A;  4IOY X;  2ROV A;  4NSW A;  5J3T A;  2CR5 A;  4IWQ A;  4NAW B;  1AQC A;  1J0W A;  3H7P A;  3UQB A;  3ML9 A;  3WAO A;  1WFY A;  4M8N A;  2IYD B;  2I1J A;  1XCG A;  3N32 A;  3HK0 A;  4HJK A;  2N1W A;  1FHO A;  3PT2 B;  3L10 B;  4W9E A;  3S2A A;  4KZC A;  4GDL A;  3OJ4 B;  5HE1 A;  2JRI B;  4MEM A;  2YVC A;  3K9O B;  3VTW A;  4KDL B;  2MBQ A;  1L2N A;  5AEK B;  2CHZ A;  3QIJ A;  2YT1 A;  3L0W B;  2KVR A;  2KWC A;  1U5F A;  2ZVN A;  1IPG A;  1HB8 A;  1EF1 A;  2ZNV C;  3DXE A;  3Q3J A;  1MK7 B;  4W9K A;  3QAR A;  1AWE A;  5KCV A;  2VRW B;  4G3X B;  2K6Q A;  2O6V D;  4JGH B;  1E7U A;  1YIW A;  3PEG A;  1UD7 A;  1UH6 A;  2KMC A;  2Y8F A;  4HAW B;  3R7R A;  2AL3 A;  4A5K A;  1RJ2 A;  1FXT B;  5E6P A;  2YS1 A;  1TJ6 A;  2AWT A;  1U5E A;  2MDX A;  3OAN A;  3VUY A;  2O2V B;  3RUL A;  1GJZ A;  5DHF B;  3PS6 A;  1NBF C;  3QHT A;  2DTC A;  4HAT B;  1NTV A;  3A1Q B;  3ZVR A;  3SDL C;  2LAS A;  3EHV A;  1DBH A;  3HIZ A;  2LZ6 A;  1NTI A;  1F9J A;  2D4Q A;  1QZE A;  1WGQ A;  2Z0O A;  3UIP B;  3PHW B;  4JKB A;  2KTR B;  3VH4 B;  2BWF A;  2MBH A;  1V86 A;  1GG3 A;  2BPS A;  4HAU B;  3VH3 B;  1V49 A;  2BYV E;  3A9J B;  2NPT B;  3APF A;  2DAJ A;  2J0K A;  2K8C A;  4GDK B;  2D11 A;  3ZO5 B;  4A3O A;  2KWV B;  2HD5 B;  4AOF A;  3QWM A;  4D0N B;  3RZF A;  2PJH A;  4HPL B;  4I6N B;  2JUO A;  2BKF A;  3P7Z A;  1WMH B;  2L76 A;  3H1U A;  2LXA A;  4URK A;  1X1M A;  4WWP A;  1VBH A;  2P0H A;  3CMM B;  1V5U A;  1W1D A;  4B9K A;  1K5D B;  2W9N A;  4EOY A;  4WAA A;  3VIA A;  2YF0 A;  2D3G A;  2V4L A;  2MA9 B;  1NI2 A;  1J19 A;  2L0F A;  3PRM B;  4EKU A;  4W9C A;  5C23 A;  3PRE A;  1D3Z A;  4IWO A;  4NJ6 A;  3D32 A;  3EFU A;  2R0D A;  2LGY A;  1P3R A;  1H4R A;  2KQ7 A;  1WJU A;  5CHF A;  2KHW B;  3PRP B;  3F0W A;  1A5R A;  1V5M A;  2KJR A;  2D10 A;  1BAK A;  2D9Z A;  2LGX A;  5FI1 A;  2JWZ A;  5D3Y A;  3I3T B;  3ZKJ C;  5DIF B;  4WWO A;  3IBE A;  4TUU A;  1UBQ A;  2FIF A;  1TQZ A;  2EMT A;  2IY0 B;  2ZCB A;  2KXJ A;  4EZK A;  3GOE A;  2BGF A;  4IUM B;  3VTU A;  2KGX B;  2NMB A;  1WGU A;  2R2O A;  1QQG A;  1UEF A;  3KY9 A;  2D2Q A;  1T0Y A;  3IHP C;  3WAL A;  4Z2M B;  2IYB A;  1KC7 A;  2JPH A;  3ZTD A;  3HM3 A;  1GC6 A;  5E6O A;  1U27 A;  1ZC3 B;  2LKO A;  2DX5 A;  5JHA A;  2C9W B;  4OVU A;  1P0R A;  2FCQ A;  1WXS A;  2XK5 A;  1KZG A;  4HCN B;  4FJY A;  2DN6 A;  2KDF B;  4GOC A;  1FGZ A;  2MX2 A;  4ZRI A;  2CHW A;  2VSZ A;  2MBB B;  1V61 A;  1U5D A;  3NS8 A;  3ODW A;  1I35 A;  4FHJ A;  3SUZ A;  1LM8 B;  2FCS A;  4MJS B;  4PYU A;  4IAP A;  2GOW A;  5J2R A;  1IP9 A;  2GJY A;  4JKA A;  1V5P A;  2Q13 A;  2LBB A;  4DWF A;  3N7C A;  5L95 C;  2P8V A;  1Q67 A;  3ML8 A;  3PLU A;  1SGH A;  5KHO A;  4BKS A;  3PP2 A;  4MGK E;  4HAX B;  1N3H A;  5TR5 A;  3B08 A;  2E2X A;  2G4D B;  2K39 A;  1VD2 A;  2D9X A;  3DVN U;  3LJU X;  1Q5W B;  4RM9 A;  1TZ1 A;  4A20 A;  2MLB A;  1RLF A;  2Z59 B;  3X0W A;  1PLS A;  1E8Z A;  3VXW A;  5EDS A;  3IG3 A;  4AUQ C;  3ZLZ A;  1FHW A;  3KSY A;  4DK5 A;  2IO3 B;  2N23 A;  4A6F B;  4NPN A;  5J3Y A;  3PTF C;  3L54 A;  5AZG A;  5D94 A;  2ABD A;  2DFK A;  4L6E A;  5HE3 A;  3QX1 A;  2M8S A;  2BYE A;  1S3S G;  2G4S A;  2FJ9 A;  1WRD B;  2MFQ A;  1NTY A;  3AU4 A;  1FOE A;  3M3J A;  1XX0 A;  2XEW A;  2OJR A;  2CAY A;  4KV2 A;  2MWN B;  2VRR B;  3Q3F A;  2IY1 B;  1Z2M A;  5BO4 B;  1WYW B;  4JKE A;  3R66 C;  4ZYN A;  1WGG A;  2JXX A;  4TV3 A;  4K7W A;  2COP A;  2C7N B;  1XR0 B;  1E7V A;  1OY2 A;  2ASQ A;  2LVP A;  3VUX A;  2EKE C;  1TTN A;  2KDB A;  4DHZ E;  1YJ1 A;  5C5B B;  3N3K B;  5JZE B;  2KNB A;  2UZR A;  5HE2 A;  3L08 A;  2DZJ A;  2M1M A;  2WX1 A;  1UEL A;  3A9K A;  2YS5 A;  3PVU A;  4NQK E;  2YT0 A;  5CHW A;  3ZIM A;  4GZU A;  4TQ1 A;  1RRB A;  2K25 A;  5JHB A;  1WZ3 A;  1OEY A;  2AYO B;  2KJH B;  3MJW A;  4RMA A;  3A4R A;  1XOD A;  1MK9 B;  2DYN A;  2BWE S;  3OLM D;  3O96 A;  4WWN A;  1E90 A;  1V5T A;  3QBV B;  4F1S A;  3KZ1 A;  4K17 A;  2DHK A;  3V61 A;  1DDV A;  3TVV A;  3BY4 B;  1V6E A;  2DHI A;  1OEY J;  2RQ1 A;  4MM3 A;  3P2B A;  1ZKH A;  1WGR A;  3SU8 X;  2YS3 A;  3OAW A;  3ULC A;  4FUL A;  2K6D B;  2EC1 A;  4IFS A;  1XT9 B;  2RSG A;  3GYO A;  2DIK A;  2O6V A;  4JKC A;  1FAO A;  3PVW A;  2PEA A;  4JK7 A;  1DDW A;  1GNU A;  5DPR A;  1E8Y A;  3FM8 C;  2PZ1 A;  1MPH A;  2RR9 A;  4GDL B;  2L8J A;  4MT7 A;  1E8W A;  4NJ7 A;  4YL8 A;  3RCP A;  4PS8 A;  5JP4 A;  2HTH B;  2GBK A;  5IJM A;  4AWJ A;  4EJN A;  1U5G A;  1Z87 A;  4YON A;  3ZVV A;  4HLE A;  5DH9 B;  4MK0 A;  3NZU A;  2KCJ A;  2AL6 A;  3E9O A;  2M14 A;  4MGI E;  1RRP B;  1KLV A;  4E74 A;  5C6R A;  1X11 A;  2N7D A;  1J0G A;  3DOW A;  2CB8 A;  3ODO A;  3M62 B;  3R3M A;  2IO2 B;  1WY8 A;  4LJO B;  2KX0 A;  4ASW C;  2W2X D;  4MEL A;  2ZVO A;  1GUA B;  3D8E A;  1UNR A;  2N1V A;  5CX3 A;  4JIO U;  4JKH A;  3PV1 A;  1EUV B;  3ODX A;  2KD0 A;  5LLI A;  4IG7 B;  2FDQ A;  4W9F A;  3KW5 B;  2NVU I;  1YX5 B;  4BBN F;  3KYC D;  4M0W B;  2R2Q A;  2AEH A;  1UNQ A;  2QKL A;  1WM3 A;  1XD3 B;  3M1I B;  1WGY A;  2Z0E B;  4X57 B;  2FAZ A;  1KZ7 A;  4F7Z A;  1X1G A;  4JKF A;  4ILG B;  2RSU A;  4EZL A;  1TXD A;  1FHX A;  1PFJ A;  1HE8 A;  4HPM B;  1Y5O A;  3RUI B;  2Z0D B;  3A33 B;  3HW2 B;  1E5W A;  1LB1 A;  5CLQ B;  1BTN A;  3U7D A;  1LW3 A;  4MDK E;  2GBN A;  1IYF A;  2KLG A;  4KHB B;  2KN5 A;  5LOP B;  4HVB A;  2W2X C;  3HHM A;  1WR6 E;  1PMS A;  5J18 A;  3NY5 A;  2RD0 A;  4ANU A;  2V3S A;  2K8H A;  2KTF A;  4PQ0 A;  3V60 A;  1KBL A;  4DHJ B;  3E9L A;  2V76 A;  2DLW A;  2O2V A;  1SIF A;  4HAY B;  1MIZ B;  4MY6 A;  2COC A;  1WM2 A;  4GMV A;  3PSC A;  1OQN A;  3A1Q A;  2EJ8 A;  1BTK A;  5JH5 C;  4F7G A;  1MAI A;  2GBJ A;  3CSF A;  3TL5 A;  1YD8 U;  4MGZ E;  2RPQ A;  4KSL C;  2DZM A;  4MSM B;  2KK8 A;  2KTR A;  2R09 A;  3AI5 A;  3PPA A;  2NPT A;  3DCG A;  2G45 B;  3O65 B;  3MPX A;  4HAZ B;  4IC7 B;  2NBW B;  5GMV A;  2IFS A;  2L00 B;  4FHK A;  4GDK A;  1I42 A;  2H7D A;  2D9Y A;  4JL9 A;  4NQL B;  1HB6 A;  1P98 A;  3H9D A;  2D9V A;  4KIK B;  2A5U A;  3OJ3 A;  1WJM A;  3VAW A;  2IO0 B;  3BJI A;  5FI0 A;  1WMH A;  4AJY B;  2PPH A;  4A6K A;  3PSE B;  4HDO A;  2MWS B;  1WX8 A;  3UIN B;  2J0M A;  5LXI B;  4BKG A;  4HB0 B;  3CXB B;  2JP2 A;  2M17 A;  2ZPN A;  3P6A A;  5DPT A;  4F8C B;  2UWQ A;  4WJN A;  4B6W A;  1R4N I;  3GZN I;  2CY4 A;  1Y19 B;  3DBL I;  2M4N A;  2COD A;  2XBB C;  3VOQ A;  1OMW A;  1GC7 A;  5D7G A;  5J17 A;  2LGD A;  4IWP A;  4HB4 B;  2XK5 B;  4HXD A;  4CYE A;  5L83 A;  3ML4 A;  4XC2 A;  4LDT B;  1EGX A;  1H8C A;  5JHH A;  2G3Q B;  1ZSQ A;  1ZW7 A;  4DDG D;  4EEW A;  2DA0 A;  2UVM A;  5DI9 B;  2LG1 A;  3SBG A;  1WXM A;  4A6H A;  3SHQ A;  5LON B;  3U30 A;  4GIV A;  5G55 A;  3T9L A;  1ST7 A;  1VCB A;  1JRU A;  2KC2 A;  4DHJ D;  1DRO A;  3QQ8 B;  4ICU A;  4CHJ A;  2LVO A;  4JKG A;  5DPW A;  4DBB A;  4JLC A;  3FEH A;  5E6N A;  2MW5 A;  3KUD B;  3SNH A;  2KDE B;  2L7R A;  2WDT B;  3EEC A;  2UYZ B;  2DYQ A;  4GMX B;  2Y7B A;  4FA6 A;  3ENB A;  3PG7 A;  1OQY A;  1WF9 A;  2K2U A;  1KI1 B;  3PVL A;  2C7M B;  4FLH A;  4GGQ A;  2ZEQ A;  1P6S A;  2KC1 A;  1E8X A;  1ZVR A;  2GCL A;  2DKP A;  1XD4 A;  1MKE A;  4GU2 A;  5DHA B;  2FUH B;  4BOZ B;  2WX0 A;  3JW0 X;  5D3X A;  2KOX A;  4N9F 4;  4B6H A;  1BT0 A;  4XWX A;  2NZ8 B;  2BKR B;  4K2O A;  2P0F A;  2LXC A;  3ECI A;  2ZNV B;  2V1Y A;  2LJ5 A;  3EPY A;  4DX8 A;  5JHG A;  1S1Q B;  4FN2 A;  2X0S A;  2M0X A;  4II2 B;  5G2N A;  1WI1 A;  1X86 A;  2DX1 A;  2N0Y A;  1UZX B;  4G0N B;  1V2Y A;  2H7E A;  2D9W A;  3WIM A;  4HDQ A;  4FJV B;  1DIK A;  3ZRC A;  3VTV A;  5DCN A;  4W9L A;  2N9X A;  3FP5 A;  4K81 A;  3MHS D;  3KVF B;  3A9K B;  4K2P A;  4LDT D;  3QWZ B;  2EMS A;  4Z2N A;  3APD A;  3JSV A;  2IO1 B;  3GYP A;  2KFK B;  2CRF A;  4ANX A;  3WAN A;  3V62 A;  2WH5 A;  2KX3 A;  4RM8 A;  3F5R A;  4A3P A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...