2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
3R7QA 5AEKB 2ZEQA 3B1LX 4DK5A 2DTCA 1V5OA 1NTYA 2DHJA 2O2VA 1WZ0A 3H9DA 5D94A 3NZSA 2L2IA 2AL3A 2FJ9A 2RD0A 1AQCA 2Z0EB 1E8XA 3DVNU 3VUXA 2Y5BB 3PRZA 2PJHA 4K2OA 3QJZA 1MKEA 2WX0A 3RULA 1ZSQA 3G9WA 3VOQA 1WI0A 4BKTA 1FHOA 3DXEA 2KDIA 2NMBA 2JPHA 2KOXA 4AJWA 4HATB 3DBRI 3OJ3A 4TUUA 2FAZA 5G2NA 5FI1A 1YJ1A 2MWSB 3TIXA 1V49A 1PMSA 2CHWA 2G45B 1AARA 4JGHB 3VH3B 4FN2A 1X86A 3DXCA 1FOEA 1RRBA 1P5TA 1XX0A 1BAKA 1B55A 3VIAA 3PHXB 3MHSD 3QARA 4DX8A 3ODXA 1OEYJ 1WXVA 4TQ1A 3R7RA 2Q13A 2LXCA 3WANA 4CO7A 3ZDTA 5E6OA 1C3TA 1PLSA 3GYPA 5JHGA 2XQNM 2KNBA 3ODOA 2FCNA 2RSUA 2YS5A 2XEWA 2G3QB 1RFAA 3NHEB 4EZKA 1VD2A 5J2RA 2O2VB 2AL6A 5D3VA 3VVWB 4GIVA 1YX5B 2CHXA 1FB8A 1E7VA 2ZNVC 2ZJDA 1IYFA 5CLLB 5C79A 3PEGA 2HD5B 2LVQA 4XWXA 3A9JA 1YIWA 3LJ3A 1TQZA 3NOBA 3VDZA 2JRHA 4NY0A 3M63B 2YS1A 5HE1A 1EGXA 3IBEA 3H1UA 3SU8X 4LDTD 2IBIB 2L05A 2COPA 5D27A 3A4SC 4TKNA 4IUMB 4EOYA 2AEHA 2M1MA 2MBOA 2ZNVB 3QC8B 2I1KA 1FHWA 4GDLA 2E2XA 2Y7BA 5DHAB 1BTKA 2MSED 2R2OA 2L0TA 3N3KB 1U5FA 2LXAA 3L54A 2LI5A 4M8MA 3AJ4A 2PPHA 4MGZE 2CS4A 3PGEA 4PS3A 3PZDA 1WMHB 4EMOA 3DOWA 2DHZA 1HE8A 5GMVA 4W9IA 2M17A 4FADA 2BKFA 2G35A 1Q0WB 4XX5A 1K8RB 4NAWA 2COCA 2DYQA 1WG7A 1X1GA 1ZW7A 4GSWA 1NTVA 4M0WB 4KHOA 3L10B 2A5UA 4FULA 5J17A 2MBQA 5LXIB 3HQCA 1TGZB 5CLQB 4JIOU 4MGYE 2ZCBA 1WH3A 3HK0A 3CF6E 2DKPA 1WRDB 3QHTA 1LM8B 2CKHB 4W9GA 3T8MA 1SGHA 3ZUNA 4DBGA 4EEWA 2GBKA 2MBEA 2K25A 3DQVA 4YL8A 2EJ8A 3A8PA 3ZTCA 2RR9A 2R09A 2KTRB 3RZFA 3FM8C 2KK8A 5C5BA 2WX1A 1KOTA 1V5PA 2D11A 2MW5A 3WIMA 1XODA 2MP2B 2XBBC 3M95A 2MX2A 4FJZA 5LONB 3PT2B 4K7UA 3PSCA 3DCGA 3PTFC 2LKOA 3P2BA 2C9WB 4IWPA 4HAXB 5C1ZA 3HIZA 1TTNA 1G6JA 3TVVA 1V86A 4MY6A 2CAYA 4B6HA 3ML4A 5KHQA 5DPSA 3ALBA 4ZRIA 5HE2A 4DHZB 3PRMB 4HDQA 3HM3A 4MGIE 2FIDA 2N7EA 1M94A 1RJ2A 2UZRA 4II2B 3ZW3A 4IFSA 1M7EA 3IFWB 4KDIC 2YT0A 3SV1A 3DBSA 3KUDB 3O65B 2FDQA 3TMPB 2HTHB 4NSWA 4TYZA 1JRUA 4DWFA 4W9CA 1V61A 3NY5A 4KHAA 2EC1A 4HWIB 4TQ0A 2RPQA 1T0YA 3UF8A 2GJYA 1VCBA 4A5KA 2N1WA 3SDLC 2W2XD 2DA0A 1ZC4B 3OANA 4IOYX 4PNKA 1V81A 3UINB 4DDGD 1HB6A 3M3JA 4K81A 2IO0B 2L7RA 3ENEA 2EKEC 3X0WA 2C60A 2IO1B 4HLEA 2QKMA 2AYOB 1OTRB 4BKSA 5J3YA 2LOZA 3EPYA 2KDBA 2KWCA 2LWPA 3ZO5B 2LG1A 1U27A 3P7ZA 4HAWB 1U29A 1J8CA 2DYOA 2LRUA 2LZ6A 2D2QA 5D3YA 2KMCA 3IVFA 3PREA 3IG3A 2CHZA 4KIKB 4E71A 1V9JA 4OVVA 1DDMA 1H10A 1OGWA 2IY1B 2J59M 2D07B 2ROVA 2KJRA 4HXDA 4Z2NA 3NS8A 3IHPC 1X11A 2Z0DB 2UWQA 2LVPA 5DI9B 2MLBA 1EF1A 1NVLA 1DDWA 4BBNF 3DXDA 3KVFB 1OMWA 3APFA 2M38A 2RVBB 1KLVA 3U7DA 2NZ8B 3PLUA 1SE9A 4F7ZA 4A3OA 2KTRA 3X23A 1V80A 2BKRB 3T9LA 4XC2A 5JZEB 1GUAB 2GS0A 5D3WA 2FCSA 2LOXA 2GBRA 2YRYA 2C7MB 2KHWB 3PRPB 2K2JA 2X18A 2MP2A 3DPDA 4GDLB 4ZRJA 3EHVA 3OJ4B 1WGUA 3DVGY 1NTIA 2Z0PA 4DDID 2DFKA 2LJ5A 3ZIMA 2DLWA 2Z0OA 2K6QA 4B95A 1WIAA 2Y8GA 2CQUA 2ROZB 1UBQA 3ML8A 5DIFB 4DHJB 2DAFA 2KN5A 3W1SA 3ZNZB 4GPTB 1UNRA 3ZNID 5DPTA 2WWZA 4MSMB 4AJYB 3SNHA 4BKGA 2CODA 4E74A 2LVOA 1IRSA 2MDXA 4IM0A 2EMTA 1Q67A 4FJYA 5D7GA 4K7WA 1RAXA 4GB9A 1DYNA 1WGDA 2DYMA 5CTRC 2JZ3B 2VRRB 1SIFA 1XR0B 3GZNI 1MIXA 2D10A 1RRPB 3PVWA 4MSQB 4IAPA 1PQSA 2W2XC 1BTNA 3EFUA 5CX3A 2ZPNA 2FIFA 3PHWB 2BYEA 1ISNA 1I7AA 4F7HA 1V5TA 5D6JB 5L95C 1LFDA 2MRPA 4AWJA 5JHAA 2DZMA 3KYDD 1WXMA 4ICUA 1F9JA 4IC7B 2KFJA 2K2UA 5DH9B 3M62B 3HHMA 3TJPA 4F8CB 4P7IA 4DXAB 4HB4B 1WJMA 3A1QB 2N7DA 2K00A 1DROA 1P0RA 4WJPA 3ZNHB 2KGXB 4WJ7A 5GOWB 1FXTB 3U30A 1Y8RC 4BOZB 2BWES 2ZVOA 2K1FA 4A6HA 3PS6A 2J0KA 4DBBA 1YQBA 3MPXA 2KTFA 4M8NA 3JSVA 2D4QA 4HB3B 4OVUA 4HAZB 1QZEA 1WJNA 2Z59B 1GC6A 4W9JA 1V6EA 4A6FA 5KQ1A 3AXCA 2LULA 5IJMA 1XD3B 3ZNGC 2GCLA 1WGHA 3UGBB 1X1MA 4FA6A 3VQIA 2M4NA 2COAA 2C7HA 3QK0A 2L3ZA 3UIOB 3L13A 1QQGA 1P3RA 2CY5A 2WH5A 1E7UA 2IYDB 2BCJA 1P1AA 4MJSB 2M0XA 3L17A 4FHJA 4G3XB 3A4RA 5J18A 4F7GA 2IO3B 2W2WA 1IPGA 1ST7A 1WMHA 3H7SA 4KZCA 4NQLB 4I6PA 1X05A 3ZKJC 4KVGB 5KCVA 1J0GA 1Z5SB 1MAIA 2KD0A 4NAWB 1K5DB 4ANUA 1WE6A 2K39A 3PG7A 3B08A 1U4AA 1ZKHA 5KQ4A 1WGYA 3DVNV 4DX90 3AU5A 4HAYB 4WSFA 3HW2B 1ZGUB 2KLCA 4GXBA 3CMMB 4G11A 1OQYA 4MH0E 1WYWB 4KAXB 2GBJA 4PQ0A 2AWTA 2HTHA 4GMXB 3JSVB 3ZRCA 2BPSA 3WA0A 1U5GA 4ZRKA 2N9PC 3V61A 2NPTB 5CHFA 3TCAA 5G55A 4GU2A 1WM2A 4KHBB 2KJHB 2BGFA 4WWOA 5AZFA 4FBJB 1X1FA 2OOBB 2XK5A 1DBHA 3LDZE 2NVUI 4MELA 4A20A 2UYZB 1IP9A 2MBBB 4XZ4A 3H6NA 2COFA 2JF5A 4WWPA 2DYNA 2N0YA 4H8SA 1TZ1A 4WQOB 5JLJB 3WAMA 2IY0B 3Q3JA 4ANWA 2H7DA 3VTVA 4JL9A 3D8FA 1WI1A 3ULBA 5JHBA 4AP4C 3M1IB 4A3PA 3ONSA 3ODWA 2KMAA 4WJOA 3L0WB 1V5UA 3VH4B 4KV2A 4GZUA 4EKUA 2ABDA 4HB0B 1KI1B 2JVCA 2NBWB 4W9KA 2JRIB 3KY9A 3L16A 3L08A 5IA7A 3RCPA 4D0NB 1EAZA 4PS7A 3RT3B 4HVBA 3N30A 2FNJB 2KWVB 1UELA 2MQJA 3OAWA 2B3AA 2K8CA 2P0DA 3KRXA 3AI5A 4MEMA 4EZJA 3CIKA 5EDSA 5DPRA 1V2YA 1FAOA 1I42A 4HB2B 2DX5A 3F5RA 2M8SA 2YSZA 4K1RB 2FCMA 2YF0A 2DX5B 4W9HA 1I35A 1MG8A 1TXDA 2KCJA 3FEHA 1OY2A 2ZPYA 2K6DB 2GMIC 4K2PA 5FR6A 5L83A 4II3B 1Q1OA 1P3QU 1GJZA 1W1GA 3SUZA 3NSUA 2JZZA 4N9F4 5J3TA 4EZLA 4LCDE 2I1JA 3V62A 5FI0A 4EJNA 2CB8A 1UNPA 2OTXA 1UH6A 4GDKA 3RCZA 3KRWA 2M14A 4GDKB 3TO1A 1KZ7A 1WGQA 1XCGA 2G4DB 3V6CB 3BY4B 2D3GA 4PS8A 2K8BA 2W9NA 5AZGA 2NR2A 4CYEA 2ZCCA 3S2AA 5HKHA 3PVLA 1BWNA 2LASA 2LGDA 3ZVRA 3D8DA 1A5RA 3WYFB 1WE7A 3D8EA 1BT0A 5DCNA 5E6PA 2MA9B 2LRWA 3A98B 5LOPB 2XK5B 1UBIA 2WYQA 1UGMA 4GOCA 1UEFA 3VTUA 1QC6A 3UQBA 2VRWB 4I6LB 3MJWA 2KC2A 3QX1A 2QKLA 2R0DA 5D3XA 3TFMA 4NJ6A 2L1CA 1R4NI 3Q3FA 5JH5C 3ZDMC 1WF9A 1WJ1A 3NZUA 3PLVA 2LD9A 5DHFB 2L76A 5JP4A 2BYFA 2C5LC 4DHJD 1EUVB 2IO2B 1MK9B 3A33B 2KFKB 1Z87A 2PZ1A 4HK2A 4GMVA 1EVHA 2JXXA 3KSYA 3R66C 3WAPA 2RSGA 1M7RA 2JWZA 3TBLD 1FHXA 2GBMA 4URKA 3ECIA 2BWFA 2N4FA 1WR1A 4NJ7A 1YD8U 1Z2MA 1WZ3A 3N7CA 3SYXA 2MKRA 2RGFA 3QBVB 1C1YB 4LDTB 2K8HA 3SO6A 4X57B 3RYTA 4WWNA 3KUCB 4A6FB 4F7UP 1NI2A 1WGGA 2Z0QA 2GOWA 3P6AA 2KLGA 3N32A 2KO3A 5IAAC 5C23A 3GOEA 3PV1A 3K9PB 2DX1A 3VHTC 2NBUA 3JVZX 2MWNB 4MGKE 3BINA 1E90A 3KH0A 3A8QA 4ZYNA 4Y94A 3PP2A 4HCPB 2KX0A 3OLMD 3R3MA 1U5DA 2CR5A 3QWZB 2V76A 2LBBA 1LQBA 2PE6B 4KSLC 2RQ1A 2RUKB 4RM9A 5BO4B 3UIPB 4YONA 4CHJA 2O6VA 3V6EB 3WALA 3ZRFA 3CSTA 4KIKA 1XT9B 3AU4A 2DHKA 2D9XA 2RNRB 3PPAA 4EUTA 3D32A 1E8ZA 2DENB 1I2HA 4ICVA 2DKQA 4KZ0A 3VAWA 5HE3A 5DPWA 1L7YA 4RM8A 3A9JB 2DN6A 5HE0A 4W9LA 3ML9A 1WXAA 1ZM0A 2CU1A 2NBVB 2V1YA 3HM6X 1WJ4A 2UVMA 1AWEA 1W1HA 1YX6B 2A4ZA 4MM3A 2GCJA 3ULCA 5CHVC 5C5BB 3W1YA 3KZ1A 1E8YA 1U5EA 3QWMA 2KQSA 4FLHA 4AOFA 4B9KA 2PEAA 1TBEA 4L6EA 2DYBA 2JT4B 4NNJB 5C6RA 5CHWA 5TR5A 4BOSC 1W1DA 3WAOA 3V60A 2LGYA 1WX8A 2HJ8A 3A1QA 4FHKA 1E5WA 3QA8A 4DHZE 1K5GB 5L81A 4HPLB 2O6VB 1J19A 2JP2A 2WDTB 3TL5A 1HBKA 2KZRA 2IFSA 2KKCA 3F0WA 3CXBB 1EO6A 2C7NB 2G4SA 2D9ZA 2N1VA 2KQ7A 2HE7A 5EFXA 3EC8A 4PYUA 4HDOA 4LJPB 1UPQA 2DHIA 4KDLB 1NDDA 2PE9A 2NPTA 2KVRA 4HPMB 1J0WA 4K17A 3MDBC 4MT7A 4IM2A 4C0AA 1WJ6A 2JY6A 2REXA 2P0HA 1KZGA 1KJTA 1S1QB 1EF5A 1GG3A 1WM3A 1WXSA 4HAVB 1WJUA 1OQNA 2KUPA 1PFJA 2UZSA 2R2QA 3B0AA 4IWOA 4KSKC 3KUZA 2JUOA 3TW1A 1H4RA 3K9OB 3ZVVA 3U8ZA 2O6VD 2MFQA 3JYUA 1WR6E 4BBNC 3APCA 3PSEB 4TV3A 3FP5A 2YS3A 1Y19B 2KDEB 4G0NB 4CHKA 2YLMA 3DDCB 1WGRA 4W9DA 2KFKA 2N9XA 2KJ6A 4PYZA 5LXHA 4F1SA 1GNUA 2EMSA 1LW3A 4G50A 1V88A 4JLCA 2RGNB 3SD5A 1MPHA 3O96A 1TJ6A 2BF8B 1RLFA 4ANVA 2J0MA 1FGYA 1CMXB 3DBHI 4IW0A 3FLVA 4JQWC 1UPRA 4WJQA 1MK7B 1FGZA 3T06A 2NCNA 3ZTDA 4WAAA 1XD4A 2I5FA 4ASWC 2CRFA 1UD7A 2VSZA 3AULA 3UQAA 3A9KB 2KC1A 2DZIA 1U2BA 1XQQA 4HJKA 4MJSA 1D3ZA 3V5WA 1WFYA 4RMAA 2KANA 3BJIA 4NPNA 1LXDA 2KWUB 4Z2MB 2YVCA 1LB1A 2V4LA 4J6IA 4W9FA 1WVHA 2D9WA 2HRJA 4K7SA 1NU2A 2CY4A 2ELAA 4FJVB 1L2NA 2OQBA 4MK0A 2N23A 2Y8FA 4I6NB 2ELBA 4HCNB 2QHOA 3APDA 4A6KA 2IZVB 2RLOA 3DBLI 1V89A 2L0FA 4LJOB 4ANXA 4BVUC 4E3CA 2ZZPB 2FCQA 2D9YA 2KXJA 2NS5A 3QCAA 3ZLZA 4ZDVA 5E6NA 1SHCA 3VFKA 4W9EA 2H7EA 2LGXA 5KHOA 2ASQA 2I5CA 2DAJA 1N3HA 2ZVNA 1ZVRA 1ACAA 1P6SA 2OJRA 5AZHA 3RZWC 3VTWA 1H8CA 3LJUX 2D9VA 3QIJA 2V3SA 1S3SG 4MDKE 2IYBA 2YT1A 2GBNA 4WVFB 1WX7A 2MBHA 3VUWA 2LYDA 2KDFB 5J3QA 1V5MA 3A9KA 3EECA 5C16A 3KYCD 4IWQA 5D2MB 2J7QB 3DVGX 4BFRA 5JHHA 3PVUA 1R4MI 2J0JA 1MIZB 1Y5OA 1Q5WB 5LLIA 3UZTA 2L00B 2L8JA 1HB8A 2MCNB 3JW0X 4WJNA 3VUYA 3FSSA 4BKSD 4HHVA 4BBKA 3GYOA 1E8WA 3RUIB 1WX9A 4IG7B 3W1SC 2BYVE 3C0RB 3QQ8B 3CSFA 3KW5B 2ADZA 1GC7A 3RD2A 2P0FA 1UZXB 1KM7A 2DZJA 3I3TB 3QAQA 2KX3A 1WY8A 1DDVA 4GN1A 1XKEA 1OEYA 3H7PB 2P8VA 4NQKE 3H7PA 2VKIA 4GGQA 2DZKA 4AUQC 3SHQA 1P98A 2FJLA 1P9DU 4CHMA 3VXWA 1NBFC 4B6WA 3MTNB 2N9EB 1UNQA 2FUHB 4IM3A 1ZC3B 2LUEA 4EFOA 4HAUB
chains in the Genus database with same CATH superfamily
5LNK1 2ZEQA 4FXCA 3SBGA 2DTCA 3H9DA 3NZSA 2L2IA 2FJ9A 1JWUD 3DVNU 3OWEB 2PJHA 3RULA 1EU3A 3NG0A 3VOQA 4ZHPA 4HATB 3OJ3A 1FMAD 1FRRA 5G2NA 5FI1A 1C9FA 1L0VB 3TIXA 1V49A 3Q8AA 1AARA 1AN8A 3VH3B 1RRBA 1UWMA 1XX0A 1B55A 4DX8A 1WXVA 3R7RA 1FNUA 4LNKA 3VAWA 2RSUA 3AV8A 4JK7A 1XLPA 5H8YE 3VVWB 4IOIE 1YX5B 2CHXA 1SXTA 2HD5B 4QXAB 1CJEA 4XWXA 2H89B 3NOBA 4US8A 2YS1A 4LDTD 1C79A 1YMHE 1L0XB 4C7YA 4EOYA 2AEHA 3BYTB 2MBOA 2J53A 1FHWA 4GDLA 1BTKA 2L0TA 3J9CA 3N3KB 3VRBB 3PGEA 2DHZA 1A70A 2M17A 2FE8A 3PO0A 1Q0WB 2QSDA 2M56B 2COCA 1GB1A 5J17A 2WQYB 1KFYB 1HA5A 1SIJA 3HK0A 3ZUNA 4EEWA 4W9GA 2SEBD 3FILA 4YL8A 1PUTA 3R2IA 3RZFA 1V5PA 1XODA 2MX2A 4YWGG 1N60A 5LONB 2TSSA 3C8YA 2X8XX 3P2BA 4FJZA 2LKOA 4IWPA 3R8BA 1TTNA 1ET9A 1TY0A 2CAYA 4HJGE 1TS4A 2WHIA 3V3XA 2FIDA 1RJ2A 4II2B 1M7EA 3IFWB 4KDIC 3DBSA 1STEA 1ZYIA 2HTHB 4NSWA 4TYZA 1ZDVA 1VZ7A 3VR9B 4DWFA 4KHAA 2EC1A 4HWIB 5EE3A 4TQ0A 4OZBA 4A5KA 2W2XD 3OANA 3ZJTA 4K81A 2IO0B 2IO1B 2QKMA 2AYOB 2LOZA 2KWCA 2LWPA 1JROA 2D2QA 3PREA 2CHZA 1V9JA 4LNNA 2KJRA 4BAXA 2ZW1A 2WXGA 1X11A 1OFFA 1NVLA 3KVFB 1NI3A 1FXAA 1KLVA 3U7DA 4A3OA 2KTRA 2BKRB 2BW2A 5D3WA 3PRPB 2KHWB 2YRYA 5AUKA 3OJ4B 1I4HA 1NTIA 2DFKA 2Z0OA 2K6QA 5DIFB 2KN5A 1QOBA 4RFBA 4BKGA 4YTMB 4E74A 1Q67A 5D7GA 1RAXA 2DYMA 2JZ3B 3GZNI 4Q2JA 1RRPB 5CX3A 2W2XC 1BTNA 1N5XA 3AN1A 1I7AA 3MFGA 5D6JB 1LFDA 2AX5A 3RNCC 1F9JA 1C77A 2L83A 2Y5PA 5IP4D 3TJPA 4C7ZA 2LMCA 4DXAB 4HB4B 1JW9D 3A1QB 4WJPA 1TYGB 1FXTB 4LNOA 3AEBB 2ZVOA 4JKBA 1JWMD 1YQBA 2KTFA 1QZEA 2Z59B 1HXYD 2BS2B 3Q3OC 2LULA 1XD3B 2GCLA 2M4NA 1J7CA 3QK0A 1FRDA 1QQGA 1KF6B 2MH7A 4FHJA 1VJKA 4I6PA 3W9CB 4KX6B 5KCVA 1J0GA 1ZPSA 3PLUA 3B08A 3PG7A 1U4AA 1XLNA 1WGYA 4K7UA 4HAYB 3CMMB 3DHIC 1OQYA 2PKOA 4KAXB 2AWTA 1U5GA 2N9PC 5CHFA 5G55A 4GU2A 1WM2A 1XO3A 4C56C 3AEGB 4MELA 4RGNA 2NVUI 2MBBB 2R61A 4XZ4A 2QEJC 3H6NA 4WWPA 3IAS1 3Q3JA 2H7DA 2JYTA 4JL9A 4JKCA 3D8FA 2J42A 1YN3A 3ONSA 3ODWA 1Y56A 2JX5A 3RI7C 2JVCA 5IA7A 1EAZA 1QILA 2KWVB 1UELA 2K8CA 1V2YA 4K1RB 1D5XC 1TXDA 3P1MA 2ZPYA 5TSSA 2GMIC 1FM0D 3SUZA 2WXNA 4OZCA 3NSUA 3SEBA 4N9F4 3U52E 5J3TA 4EZLA 4LCDE 2CB8A 2M14A 4GDKB 1KZ7A 1XCGA 2G4DB 3MC9A 3MJ5A 1BWNA 1A5RA 2WXFA 1WE7A 3D8EA 1BT0A 5DCNA 2KWDA 3A98B 2XK5B 1CK1A 1QC6A 2IPKD 4N6EB 1UUPA 2Y5CA 2L76A 5JP4A 2BYFA 2C5LC 1YQ3B 1MK9B 4C4VA 3I57A 4HK2A 4JKFA 2INPE 1E6EB 1I7HA 5GXGB 3SYXA 3SO6A 1QLBB 4WWNA 4A6FB 3P6AA 4O1NA 3N32A 3GOEA 3PV1A 4MGKE 4YSZB 3NW8A 2V9HA 3AE5B 3R3MA 1U5DA 3QWZB 2RUKB 4YONA 3V6EB 2WP9B 3R2TA 2DHKA 2D9XA 2RNRB 4EUTA 3D32A 4IKGA 2INNE 4KZ0A 4ICVA 5DPWA 2JWUA 3A9JB 2DN6A 3ML9A 3URYA 2CU1A 2NBVB 2BB5A 4LNFA 5IRSA 3C19A 2GCJA 3W1YA 4B9KA 2XNAC 5CHWA 4NNJB 2WDRB 2ZKMX 3WAOA 2LGYA 1WX8A 2V4IB 1K5GB 5L81A 1AWDA 2KZRA 3Q3NC 1UGJA 1EO6A 3IT4B 5EE0A 3N20C 2KQ7A 4OHJA 3EC8A 3W2DA 2DHIA 4WURA 1Q10A 4HPMB 3MDBC 4IM2A 1WJ6A 4HAVB 2R2QA 2KUPA 1PFJA 1YQ4B 4RH6A 2KUQA 3K9OB 3ZVVA 1HEZE 1WR6E 4OT1A 1Y19B 2WU2B 4G0NB 4CHKA 2YLMA 3DDCB 4W9DA 1C4PA 3ZGZA 4PYZA 2JZPA 1GNUA 2EMSA 1F1HA 1ZOYB 1L6VA 1V88A 4JLCA 4ILGB 3O96A 2BF8B 4KKJA 4ANVA 1I4GA 3NVWA 4JQWC 4IW0A 1ESFA 4JKHA 3AE2B 3ZTDA 2I5FA 4YTPB 1M4VA 4JKDA 1JWBD 1PGAA 3UQAA 2DZIA 1XQQA 4MJSA 1E0ZA 3BJIA 1LB1A 3N9YC 5IO9A 1L2NA 1CQVA 2ELBA 4BVUC 4E3CA 2FCQA 4ZDVA 5KHOA 1L4DB 2ASQA 2I5CA 3DBRB 3I5JC 1P6SA 3RZWC 2N9KA 4US9A 3LJUX 2WGSA 5JXVA 2LYDA 2KDFB 1V5MA 2J0JA 1MIZB 2PVOD 4YSYB 2K9XA 4WWMA 4BBKA 1XLOA 3W1SC 3FVCA 1K53A 3N1ZC 3DHGC 3QAQA 1KM7A 1P7FA 1XLQA 1WY8A 4GN1A 1OEYA 3H7PB 2VKIA 3SHQA 2KT7A 2BS3B 1T3QA 3MTNB 3AE8B 4HEA1 1DOYA 1V5OA 1NTYA 2AL3A 3P4SB 2Z0EB 2KAJA 2Y5BB 3PRZA 3GE8C 3QJZA 1MKEA 1JQ4A 1ZSQA 4BKTA 1WI0A 2QJLA 1FHOA 3DXEA 1RFKA 3E9SA 2RDHA 2LUMA 2KOXA 4AJWA 2YEPB 3DBRI 2DBYA 4L1RA 2MWSB 2CHWA 4A9AA 4JGHB 4FN2A 1FOEA 3DXCA 1L6UA 3AEAB 5EE9A 4A6QA 4TQ1A 2LXCA 5E6OA 1C3TA 3GYPA 2XEWA 2XQNM 2BYTA 2FCNA 5AEKB 4JKAA 3NHEB 5J2RA 2ZNVC 1IYFA 1EM7A 4HKZE 4D2KA 1V97A 2BVCA 2WNMA 3LJ3A 2PW9A 1TQZA 4MH8A 1BXTA 5FR3A 1T5XD 4NY0A 1EGXA 5HE1A 3SU8X 3LXFA 2COPA 5D27A 2CU3A 4TKNA 1GOZA 4IUMB 4P16A 5D3IB 3CIRB 1ENFA 4CSQA 2ZNVB 4ICUA 2I1KA 2Y7BA 2R2OA 1U5FA 3L54A 4YXDB 2CS4A 4KGSA 3PZDA 1WMHB 1KC7A 4EMOA 1E7PB 1HE8A 4FADA 2Y3AA 2BKFA 1K8RB 4NAWA 2DYQA 1JDEA 4M0WB 4JIOU 2EELA 4LTUA 1C78A 2DKPA 1WRDB 3QHTA 1LM8B 4DBGA 1ZP0B 2MBEA 3DQVA 2PTLA 3KWLA 2KK8A 1KOTA 1J7AA 2WX1A 3PTFC 4HAXB 4RF1A 3TVVA 1UF0A 1V86A 4MY6A 4M01A 1KTKA 3ALBA 5HE2A 4DHZB 3PRMB 4HDQA 2N7EA 2YT0A 3AEFB 3KUDB 3O65B 2FDQA 3TMPB 2LHDA 4JK9A 5H92C 5BYRA 4W9CA 2ON8A 2RPQA 3BVGA 3SFEB 3SDLC 4DDGD 2DA0A 4IOYX 2NMQA 2EKEC 3TSSA 4HLEA 2IGDA 1OQQA 3BK1A 5J3YA 2KDBA 1U27A 3P7ZA 1U29A 2LRUA 3IVFA 2KN4A 3IG3A 1FCLA 1DDMA 1H10A 4XWTA 2D07B 4M00A 4Z2NA 3NS8A 1FNWA 1EF1A 3DBLB 4ZRQA 1DDWA 2W3SA 1HZ5A 3DXDA 4BBNF 3BIID 1L5PA 1V80A 1GUAB 1XF5L 2FCSA 2WXQA 1SJHD 2C7MB 2K2JA 2MP2A 3DPDA 5C3JB 4ZRJA 2AQ3B 3EHVA 1PFDA 2Z0PA 4HSIA 5T8IA 4B95A 2Y8GA 2IGGA 2DAFA 4KGTA 5M4YB 5DPTA 2WWZA 1TIFA 2MDXA 2WXHA 4GB9A 4OSNA 2VRRB 3PVWA 3NVVA 1IUEA 1J7BA 1PQSA 4ARCA 2GLSA 1ISNA 4F7HA 5L95C 4AWJA 2KFJA 5DH9B 3EUB2 3IXSA 1VZ8A 3M62B 1LGRA 1F52A 2K00A 1DROA 3ZNHB 3B2GA 2KGXB 3U30A 2INDC 1D5ZC 2QDFA 2K1FA 4A6HA 3PS6A 2J0KA 3MPXA 1TKYA 4M8NA 4OVUA 4HB3B 4UDUC 1GC6A 3EGRA 1V6EA 1PGBA 5IN7A 3ZNGC 3VQIA 1MG4A 2B76B 3L13A 2CY5A 4MJSB 2D5GA 1PDXA 4M02A 4QJ4B 2RRFA 2IO3B 4KZCA 4DXGA 1IPGA 1ST7A 1WMHA 3NWDA 3ZKJC 1XCTL 1Z5SB 1MAIA 4RGOS 1GPXA 1ZGUB 4GXBA 1WYWB 4PQ0A 4GMXB 2KIGA 3ZRCA 2BPSA 5FKAC 4ZRKA 2Z13A 1PGXA 2NPTB 3TCAA 3TEZA 5AZFA 3BZDB 1X1FA 1C4CA 2XK5A 3LDZE 3N1XC 4A20A 2UYZB 4A90A 2JF5A 4H8SA 3DHHC 4WQOB 4ANWA 3ULBA 1WI1A 3BVMA 2EKIA 3M1IB 1BMLC 5BMGA 4WJOA 4P1CC 3VH4B 4KV2A 4GZUA 2MEKA 3Q8CA 2JRIB 2N7JA 3RCPA 3P4RB 2GUMA 4HVBA 4J3OD 2BBCA 2FNJB 1MFWA 2OHFA 2Q5WD 4EZJA 3CIKA 5DPRA 3ZXRA 2JXTA 4HB2B 2DX5A 3F5RA 4RNAA 2YSZA 1I42A 3LB8C 3FEHA 4K2PA 1R4NB 1P3QU 2JZZA 1I4PA 2M0AA 2I1JA 4EJNA 2PLPA 3AM9A 4GDKA 1UH6A 3T3OA 3TO1A 2NTTA 1UNSA 3BY4B 2WDVB 2K8BA 2W9NA 4M0WA 3S2AA 3PVLA 1ACCA 3D8DA 3WYFB 5E6PA 4GOCA 3VTUA 1UBIA 2WXIA 3MJWA 4AS1A 3QX1A 3HVZA 2L1CA 1R4NI 3Q3FA 3PLVA 3NZUA 5DHFB 2IO2B 2GI9A 1Z87A 1FCCC 2PZ1A 4HPPA 5G5HA 3WAPA 3R66C 3MC8A 2RSGA 1FHXA 2GBMA 3ECIA 1WR1A 1WZ3A 2MKRA 1C1YB 4X57B 2WXKA 4F7UP 3KUCB 1NI2A 1WGGA 2Z0QA 2PMVA 4H2AA 1C76A 5IAAC 4NJCA 5C23A 4XYCA 2KDMA 3K9PB 2DLBA 4B0EA 3JVZX 4OVZA 3AECB 2KX0A 3OLMD 5BMIA 2V76A 2LBBA 1LQBA 5BO4B 4RM9A 4K3BA 4KIKA 1XT9B 3AU4A 3NZ3A 2QMTA 1L7YA 5HE0A 4W9LA 1WXAA 3BVZA 1K52A 1AWEA 2A4ZA 3ULCA 2V0GA 2K0PA 1U5EA 3QWMA 3N1YC 1GB4A 1TBEA 2HJ8A 1K51A 3TL5A 1J19A 2JP2A 1HBKA 2IFSA 3NVZA 2N1VA 2C7NB 3CXBB 4XDCA 2D9ZA 2HE7A 5JVLA 4HDOA 1MI1A 3IT6B 1K50A 1NDDA 2PE9A 2NPTA 4K17A 4MT7A 1KZGA 1WXSA 1S1QB 3APFA 3E56A 3TEXA 2LGIA 2JUOA 3GZNB 3TW1A 2L32A 4BBNC 3PSEB 4TV3A 1BUIC 5MPOA 2YS3A 2QILA 4OZAA 1WGRA 1ZUD2 1QQRA 5LXHA 1LW3A 4WAFA 1VBHA 1RLFA 1CMXB 1KLUD 3DBHI 3Q14C 2LHEA 2V3NA 1B1ZA 1N5WA 1C4AA 3RPFC 3DWMA 2CRFA 3TUOA 4GLSC 3EA6A 4XDDA 5HHDG 1D3ZA 1TS2A 1WFYA 1ZE3D 4RMAA 2KANA 1TY2A 3AE3B 4NPNA 2KWUB 4J6IA 2V4LA 4C4VB 2OQBA 4MK0A 2N23A 4I6NB 3RNBC 4A6KA 3DBLI 2RLOA 1V89A 2L0FA 3QCAA 3HSAA 5E6NA 1SHCA 4MM3B 4ITKA 4W9EA 2H7EA 3VFKA 3ZXVA 2LGXA 3E66A 2DAJA 2ZVNA 1MPEA 5AZHA 2OJRA 3VTWA 2D9VA 3QIJA 4MDKE 2IYBA 4WVFB 1D4BA 3VUWA 3A9KA 5J3QA 1MJDA 4IWQA 3AMZA 4C80A 1VDVA 3DVGX 3PVUA 1R4MI 4RGMA 1SSNA 2MCNB 3VUYA 2W3RA 4BKSD 1E8WA 4JKGA 1WX9A 2WU5B 4IG7B 3RNAC 2BYVE 3QQ8B 3CSFA 3RD2A 2P0FA 2DZJA 3I3TB 1DDVA 4RF0A 4NQKE 2JQRB 4GGQA 1QT9A 2ACZB 1P98A 4CHMA 2K8EA 2LUEA 4EFOA 4HAUB 1KRHA 3B1LX 2DIKA 2DHJA 1WZ0A 4QJ5B 1AQCA 2WX0A 1ET6A 3G9WA 1AW7A 2K22A 4JWSC 2KDIA 2K49A 1F2RC 2JPHA 2FAZA 1R7SA 1YJ1A 2G45B 1PMSA 4GNKB 1X86A 1D6EC 3AEEB 3PHXB 3VIAA 3QARA 1OEYJ 4ILHA 4CO7A 3WANA 3ZDTA 1PLSA 2KNBA 3ODOA 1V8CA 5D3DA 4EZKA 2O2VB 1ROEA 5D3VA 2CJNA 1FB8A 2ZJDA 3A9JA 1YIWA 1HTQA 4JX1C 1RYJA 2FJUB 1L4ZB 2JRHA 4HROA 3IBEA 3H1UA 2L05A 4N59A 3A4SC 4CQNA 4KKIA 3QC8B 2E2XA 2MSED 4W9HA 2LXAA 4M8MA 3AJ4A 2PPHA 4MGZE 4YT0B 2K3UA 2W54A 3HVDA 3DOWA 3GP7A 5GMVA 3MP9A 1WYGA 1NTVA 2A5UA 4FULA 2MBQA 1MHXA 1TGZB 4MGYE 1E9MA 3SFDB 2ZCBA 4QAYA 3CF6E 4OW0A 1SGHA 3NVYA 1QKZA 3A8PA 2RR9A 2KTRB 3FM8C 2VZKB 4HRSA 2Z8LA 3PT2B 3DCGA 2C9WB 5C1ZA 3HIZA 5KHQA 3ML4A 5DPSA 1SEBD 4DQOC 4MGIE 3HM3A 5BYSA 3ZJVA 2UZRA 3ZW3A 3SV1A 1XEEA 1IGDA 2VH2A 1V61A 1T0YA 2GJYA 1VCBA 2N1WA 3UINB 3V05A 1ZC4B 1MVKA 3M3JA 2L7RA 3ENEA 2C60A 1HZ6A 1OTRB 4BKSA 1EU4A 2QIEB 3EPYA 1PYWD 3PZ7A 1J8CA 2LG1A 4HAWB 2BB6A 4USAA 1VRAB 1WSPA 5D3YA 2KMCA 4E71A 4KIKB 2IY1B 4HXDA 5AUIA 2ROVA 4JKEA 3IHPC 2UWQA 5DI9B 4MACA 3NWFA 1OMWA 1SE4A 2M38A 2RVBB 1SE9A 4F7ZA 2AQ1B 3X23A 3T9LA 2GBRA 3V6CB 1QOAA 3ZIMA 3EFCA 2CQUA 1UBQA 3Q8EA 4DHJB 1DGJA 3ZNZB 4GPTB 1UNRA 3ZNID 1IBXA 4MSMB 4AJYB 1EWCA 4IM0A 2EMTA 4K7WA 1F77A 1DYNA 1WGDA 2OEDA 5CTRC 1XR0B 2D10A 3TEWA 2SAKA 4IAPA 3SR6A 3EFUA 3LYYA 2FIFA 2X38A 2DWQA 4ACFA 5JHAA 2DZMA 4C00A 3HHMA 4P7IA 1WJMA 3L4PA 1P0RA 4WJ7A 1Y8RC 3AB5A 1B9RA 2BWES 2KQ4X 5E6JA 4JKGB 2D4QA 4W9JA 4HAZB 4ARIA 5IJMA 5BMHA 4KHBA 1WGHA 1X1MA 1DOXA 2COAA 2L3ZA 4TMAB 3GS2A 3UIOB 1P3RA 1VR9A 4L2YA 2WLBA 2BCJA 1P1AA 2M0XA 3L17A 4G3XB 5FK9C 3H7SA 2W2WA 2IDYA 4KVGB 2KD0A 4NAWB 1K5DB 4ANUA 1JRPA 4AOFA 4L23A 4DX90 5D94A 3HW2B 2KLCA 4MH0E 2GBJA 3GE3C 3JSVB 2HTHA 2G1EA 3WA0A 3RNFC 3U4EG 3V61A 4KHBB 2KJHB 4WWOA 1DBHA 1IP9A 3HUIA 2DYNA 4BZAA 1TZ1A 2FBWB 2MJ3A 5EE1A 5BYQA 4P6VF 3VTVA 1TS5A 5JHBA 4AP4C 2WDQB 4A3PA 3L0WB 2M19A 4EKUA 2ABDA 4HB0B 4W9KA 3W1SA 2NBWB 3A58A 3L16A 3KY9A 3L08A 4D0NB 4PS7A 2MQJA 3OAWA 2B3AA 3AI5A 2P0DA 2LFIA 3GB1A 4LNIA 1FIQA 2FCMA 2YF0A 1MG8A 2KCJA 1OY2A 3O13A 5FR6A 1GJZA 1Q1OA 2JU6X 1W1GA 1KBLA 2I2YA 3V62A 5FI0A 1DOIA 3RCZA 2IJ0A 3BYYB 2Z4DA 1FD6A 2KYWA 2NR2A 2ZCCA 5IOIA 5HKHA 4S0RA 3ZVRA 2R2YA 1V1PB 4AQ7A 1UGMA 1UEFA 3UQBA 3DBHB 2VRWB 4I6LB 3RMKC 2QKLA 2R0DA 1YJJA 1QF6A 1WF9A 1WJ1A 3AE9B 3RFZB 2LD9A 4DHJD 4D6WA 1EUVB 4GOUA 3A33B 2KFKB 1IBXB 2RPVA 1M7RA 2JWZA 4URKA 2BWFA 2N4FA 4NJ7A 1YD8U 1Z2MA 3N7CA 3QBVB 1YJIA 2GOWA 3CWIA 2KO3A 4TSSA 2DX1A 3VHTC 2NBUA 2MWNB 1SE2A 2PIAA 3SBTA 1D5MC 1E90A 3A8QA 3KH0A 4ZYNA 4HCPB 3WCQA 4S17A 2CR5A 4KSLC 3ZRFA 2O6VA 3WALA 3CSTA 1VLBA 2WXLA 2QCZA 4RCOA 1E8ZA 2Z14A 2DENB 1I2HA 1ZXHA 5HE3A 2N0SB 2MJDA 2V1YA 3HM6X 2UVMA 1W1HA 1YNTE 2GRIA 4MM3A 4ZHOA 5HG2A 5C5BB 1E8YA 2KQSA 2PEAA 4L6EA 2JT4B 3HRDD 2RDBC 5C6RA 3E9PA 1W1DA 4FHKA 3A1QA 4ZYSA 2KIEA 1E5WA 3QA8A 4DHZE 2WXJA 2NTSA 2O6VB 3PZ8A 4REZA 2FUG1 1WXQA 3AH7A 2G4SA 4N58A 2Z59A 4KDLB 4NAMA 2KVRA 1YN4A 2WXRA 4XE0A 2REXA 1KJTA 1WM3A 1L0YB 1SBBB 3UIPB 1GG3A 4KSKC 4IWOA 3KUZA 3U8ZA 2O6VD 3JYUA 3APCA 3VRAB 2KDEB 2L52A 5G5GA 2KFKA 1RM6C 2R82A 2KJ6A 4F1SA 3BK2A 1MPHA 2YEPF 3W5UB 2J0MA 1FGYA 3FLVA 3P63A 2W82A 4WJQA 4JK8A 2JYEA 3OG5A 2NCNA 4NZLB 4WAAA 4ASWC 3FILB 2VSZA 4XGAB 3AE1B 3A9KB 1ZDXA 2KC1A 3AEDB 4HJKA 3V5WA 3KWVA 2JSVX 4ILJA 3NRZA 2MHJA 4Z2MB 3BWUD 2YVCA 1T0RC 2D3CA 1FFVA 1HTOA 2HRJA 1NU2A 2CY4A 1NYQA 2ELAA 4FJVB 2Y8FA 4HCNB 2QHOA 3APDA 2IZVB 4ANXA 2D9YA 2KXJA 1YN5A 2LEKA 1ZVRA 2V3SA 1R4MB 1S3SG 2GBNA 1VZ6A 2D3AA 2J7QB 3IAM1 3KLSX 4BFRA 5JHHA 1Y5OA 5LLIA 2L00B 3ZJUA 2ICIA 2J4XA 3FSSA 3GYOA 3RUIB 2H88B 3KW5B 1GC7A 2K5PA 2INCC 5HI1A 1XKEA 3H7PA 4P1BC 2DZKA 1NBFC 1UNQA 2FUHB 4IM3A 3VR8B 3R7QA 2ONQA 4DK5A 2O2VA 2RD0A 3VUXA 1JCKB 1E8XA 1FFUA 1I4QA 3RNGC 4K2OA 2NMBA 3P4PB 3KQ4A 4TUUA 1P5TA 1BAKA 3MHSD 4K3CA 3ODXA 4YTNB 1WGKA 3Q8BA 2Q13A 5JHGA 2YS5A 2G3QB 1RFAA 1V1OA 1VD2A 3NJTA 2AL6A 3AE4B 4GIVA 4DXFA 1E7VA 5CLLB 5C79A 3PEGA 1FEHA 2LVQA 3ABVB 1GAQB 1RWSA 3VDZA 3M63B 4PK1A 2VH1A 1FXIA 2IBIB 5C2TB 5IKCM 2M1MA 5DHAB 2LI5A 4PS3A 4W9IA 3NUHB 1P7EA 2G35A 4XX5A 4GSWA 1WG7A 1X1GA 1ZW7A 4KHOA 3L10B 5HFYA 5LXIB 3HQCA 5CLQB 1WH3A 2CKHB 3T8MA 4LK0M 2GBKA 2K25A 2EJ8A 2R09A 3I9V1 1FNVA 5C5BA 2D11A 2MW5A 3WIMA 2MP2B 2XBBC 1IGCA 3M95A 4PT5A 3PSCA 3UI3A 1G6JA 4B6HA 3Q6BA 4ZRIA 2D3BA 4B0MA 1M94A 4IFSA 2KMMA 1F2RI 1JRUA 1CZPA 3NY5A 2XN9C 4A55A 3UF8A 4PNKA 1V81A 3B2FA 1TKGA 1HB6A 2W55A 3X0WA 1E10A 1JWAD 3Q8FA 1MI0A 2V3PA 4R3DA 3ZO5B 2DYOA 2LZ6A 4EE2A 4OVVA 1OGWA 3P4QB 2J59M 3NS1A 2Z0DB 2GB1A 2LVPA 2MLBA 1ZXIA 5I4DA 1XCQL 3OHMB 1TJEA 1WWTA 2NZ8B 4KGRA 4XC2A 5JZEB 2GS0A 2LOXA 4GDLB 2X18A 1N62A 1WGUA 3DVGY 1JALA 4DDID 2LJ5A 1DIKA 4WQMA 2DLWA 1WIAA 2ROZB 3ML8A 4L1BA 3MHZA 3SNHA 3RNEC 2CODA 2LVOA 1IRSA 2X0SA 4FJYA 2YT2A 2WXMA 4LLGM 1SIFA 1MIXA 4MSQB 2DNFA 2NBVA 2ZPNA 3PHWB 2BYEA 1MHHE 1V5TA 3FC4A 2MRPA 3KYDD 1WXMA 4IC7B 2K2UA 4WIPA 1KLGD 1I4RA 4F8CB 3E9LA 2N7DA 5GOWB 4BOZB 5I2SA 3ZYYX 3AE6B 3NWAA 4JE3B 1NVID 4DBBA 5I2MA 3JSVA 1WJNA 5LG4B 4A6FA 5KQ1A 3AXCA 3UGBB 4FA6A 4QJ3B 2C7HA 3B77A 2KR0A 2WH5A 1E7UA 1YOVB 2IYDB 3A4RA 5J18A 4F7GA 3B9JA 1SB3C 4NQLB 1X05A 2KACA 1WE6A 2LJIA 2K39A 3DVNV 1ZKHA 5KQ4A 2J52A 3AU5A 4WSFA 1FO4A 4G11A 2L1AA 4WH4A 2WS3B 4A8XC 2CJOA 3P42A 1N63A 2BGFA 4FBJB 2OOBB 2WXOA 2COFA 2OJWA 2N0YA 3WAMA 5JLJB 2KVZA 3FAHA 2IY0B 3ETRA 2E6XA 2WXPA 4HKQA 2KMAA 1V5UA 1TZOA 4RGTA 1KI1B 3RT3B 3N30A 4IDIA 3KRXA 4MEMA 5EDSA 1T0QC 3ZQ4A 1FAOA 1QOFA 2M8SA 2BT6A 2DX5B 1I35A 2K6DB 5L83A 4II3B 1T0SC 4DIXA 2RMMA 1UNPA 2OTXA 3KRWA 1WGQA 1SJED 1LO5D 2D3GA 4PS8A 5AZGA 2VZKD 4CYEA 2LASA 2LGDA 1I4XA 1V1PA 1F0ZA 1QOGA 2MA9B 2LRWA 5LOPB 2WYQA 3U12A 4ZRPA 3U7ZA 2KC2A 2HDEA 5D3XA 3TFMA 4NJ6A 5JH5C 3ZDMC 3TEYA 1SE3A 4XWWA 3Q69A 4ZOHC 2I38A 4GMVA 1EVHA 2JXXA 3KSYA 3TBLD 1DYQA 3E9OA 2RGFA 2MJEA 4LDTB 2K8HA 3RYTA 2HTME 2KLGA 1T77A 3FKYA 3BINA 4Y94A 3PP2A 1JMLA 2PE6B 1EWYC 2RQ1A 4CHJA 2AQ2B 2E3TA 1KH0A 3PPAA 1T6BX 2DKQA 3AE7B 4RM8A 1ZM0A 1WJ4A 1YX6B 4JWUC 1NYRA 5CHVC 3KZ1A 1WRIA 4FLHA 2UU7A 2DYBA 5TR5A 3T3NA 4BOSC 3V60A 2RDGA 2PVGC 4HPLB 3RN9C 2G9HD 2WDTB 1JWSD 1SF0A 3W5VB 2KKCA 3F0WA 2IGHA 4PYUA 5EFXA 4LJPB 1UPQA 1J0WA 4C0AA 2JY6A 2P0HA 1EF5A 1NEKB 1OQNA 2UZSA 1UWXA 1WJUA 3B0AA 1FPYA 1H4RA 2MFQA 3FP5A 3U2SC 2BQQA 2N9XA 3ENBA 1GGOA 4G50A 2RGNB 3SD5A 1TJ6A 1UPRA 1MK7B 1FGZA 3T06A 3Q2AC 4JPSA 4YSXB 1XD4A 1TKEA 1UD7A 3AULA 1OQRA 2N9LA 1U2BA 1VBGA 1NENB 3Q3MC 1LXDA 4W9FA 1WVHA 2D9WA 3I63C 4K7SA 2QC8A 1HQRD 4LJOB 2ZZPB 2NS5A 3ZLZA 1N6ZA 1XXGA 1N3HA 1ACAA 1H8CA 2LGSA 3HIEA 2YT1A 1WX7A 3ZTCA 2MBHA 3EECA 3DCXA 3MC0B 5C16A 3KYCD 5D2MB 1Q5WB 3UZTA 2L8JA 1HB8A 1TS3A 3DWGC 3JW0X 3H8HA 4WJNA 2BS4B 2ZW0A 4HHVA 1N61A 1AYFA 1TT5B 3C0RB 2ADZA 2BTEA 1UZXB 2KX3A 2P8VA 2HJ1A 4MT5A 4AUQC 2FJLA 1P9DU 3VXWA 4B6WA 2N9EB 1ZC3B
chains in the Genus database with same CATH topology
2ZEQA 3SBGA 2DTCA 3H9DA 3NZSA 2L2IA 2FJ9A 3DVNU 2PJHA 3RULA 3VOQA 4HATB 3OJ3A 5G2NA 5FI1A 3TIXA 1V49A 1AARA 3VH3B 1RRBA 1XX0A 1B55A 4DX8A 1WXVA 3R7RA 3VAWA 2RSUA 4JK7A 3VVWB 1YX5B 2CHXA 2HD5B 4XWXA 3NOBA 2YS1A 4LDTD 4EOYA 2AEHA 2MBOA 1FHWA 4GDLA 1BTKA 2L0TA 3N3KB 3PGEA 2DHZA 2M17A 1Q0WB 2COCA 5J17A 3HK0A 3ZUNA 4EEWA 4W9GA 4YL8A 3RZFA 1V5PA 1XODA 2MX2A 4FJZA 5LONB 3VUWA 3P2BA 2LKOA 4IWPA 1TTNA 2CAYA 2FIDA 1RJ2A 4II2B 1M7EA 3IFWB 4KDIC 3DBSA 2HTHB 4NSWA 4TYZA 4DWFA 4KHAA 2EC1A 4HWIB 4TQ0A 4A5KA 2W2XD 3OANA 4K81A 2IO0B 2IO1B 2QKMA 2AYOB 2LOZA 2KWCA 2LWPA 2D2QA 3PREA 2CHZA 1V9JA 2KJRA 1X11A 1NVLA 3KVFB 1KLVA 3U7DA 4A3OA 2KTRA 2BKRB 5D3WA 3PRPB 2KHWB 2YRYA 3OJ4B 1NTIA 2DFKA 2Z0OA 2K6QA 5DIFB 2KN5A 4BKGA 4E74A 1Q67A 5D7GA 1RAXA 2DYMA 2JZ3B 3GZNI 1RRPB 5CX3A 2W2XC 1BTNA 1I7AA 5D6JB 1LFDA 1F9JA 3TJPA 4DXAB 4HB4B 3A1QB 4WJPA 1FXTB 2ZVOA 4JKBA 1YQBA 2KTFA 1QZEA 2Z59B 2LULA 1XD3B 2GCLA 2M4NA 3QK0A 1QQGA 4FHJA 4I6PA 5KCVA 1J0GA 3PLUA 3B08A 3PG7A 1U4AA 1WGYA 4K7UA 4HAYB 3CMMB 1OQYA 4KAXB 2AWTA 1U5GA 2N9PC 5CHFA 5G55A 4GU2A 1WM2A 4MELA 2NVUI 2MBBB 4XZ4A 3H6NA 4WWPA 3Q3JA 2H7DA 4JL9A 4JKCA 3D8FA 3ONSA 3ODWA 2JVCA 5IA7A 1EAZA 2KWVB 1UELA 2K8CA 1V2YA 4K1RB 1TXDA 2ZPYA 2GMIC 3SUZA 3NSUA 4N9F4 5J3TA 4EZLA 4LCDE 2CB8A 2M14A 4GDKB 1KZ7A 1XCGA 2G4DB 1BWNA 1A5RA 1WE7A 3D8EA 1BT0A 5DCNA 3A98B 2XK5B 1QC6A 2L76A 5JP4A 2BYFA 2C5LC 1MK9B 4HK2A 4JKFA 3SYXA 3SO6A 4WWNA 4A6FB 3P6AA 3N32A 3GOEA 3PV1A 4MGKE 3R3MA 1U5DA 3QWZB 2RUKB 4YONA 3V6EB 2DHKA 2D9XA 2RNRB 4EUTA 3D32A 4KZ0A 4ICVA 5DPWA 3A9JB 2DN6A 3ML9A 2CU1A 2NBVB 2GCJA 3W1YA 4B9KA 5CHWA 4NNJB 3WAOA 2LGYA 1WX8A 1K5GB 5L81A 2KZRA 1EO6A 2KQ7A 3EC8A 2DHIA 4HPMB 3MDBC 4IM2A 1WJ6A 4HAVB 2R2QA 2KUPA 1PFJA 3K9OB 3ZVVA 1WR6E 1Y19B 4G0NB 4CHKA 2YLMA 3DDCB 4W9DA 4PYZA 1GNUA 2EMSA 1V88A 4JLCA 4ILGB 3O96A 2BF8B 4ANVA 4JQWC 4IW0A 4JKHA 3ZTDA 2I5FA 4JKDA 3UQAA 2DZIA 1XQQA 4MJSA 3BJIA 1LB1A 1L2NA 2ELBA 4BVUC 4E3CA 2FCQA 4ZDVA 5KHOA 2ASQA 2I5CA 1P6SA 3RZWC 3LJUX 2LYDA 2KDFB 1V5MA 2J0JA 1MIZB 4BBKA 3W1SC 3QAQA 1KM7A 1WY8A 4GN1A 1OEYA 3H7PB 2VKIA 3SHQA 3MTNB 1V5OA 1NTYA 2AL3A 2Z0EB 2Y5BB 3PRZA 3QJZA 1MKEA 1ZSQA 4BKTA 1WI0A 1FHOA 3DXEA 2KOXA 4AJWA 3DBRI 2MWSB 2CHWA 4JGHB 4FN2A 1FOEA 3DXCA 4TQ1A 2LXCA 5E6OA 1C3TA 3GYPA 2XEWA 2XQNM 5AEKB 2FCNA 4JKAA 3NHEB 5J2RA 2ZNVC 1IYFA 3LJ3A 1TQZA 4NY0A 1EGXA 5HE1A 3SU8X 2COPA 5D27A 4IUMB 4TKNA 2ZNVB 4ICUA 2I1KA 2Y7BA 2R2OA 1U5FA 3L54A 2CS4A 3PZDA 1WMHB 1KC7A 4EMOA 1HE8A 4FADA 2BKFA 1K8RB 4NAWA 2DYQA 1JDEA 4M0WB 4JIOU 2DKPA 1WRDB 3QHTA 1LM8B 4DBGA 2MBEA 3DQVA 2KK8A 1KOTA 2WX1A 3PTFC 4HAXB 3TVVA 1V86A 4MY6A 3ALBA 5HE2A 4DHZB 3PRMB 4HDQA 2N7EA 2YT0A 3KUDB 3O65B 2FDQA 3TMPB 4JK9A 4W9CA 2RPQA 3SDLC 4DDGD 2DA0A 4IOYX 2EKEC 4HLEA 5J3YA 2KDBA 1U27A 3P7ZA 1U29A 2LRUA 3IVFA 3IG3A 1DDMA 1H10A 2D07B 4Z2NA 3NS8A 1EF1A 1DDWA 4BBNF 3DXDA 1V80A 1GUAB 2FCSA 2C7MB 2K2JA 2MP2A 3DPDA 4ZRJA 3EHVA 2Z0PA 4B95A 2Y8GA 2DAFA 5DPTA 2WWZA 2MDXA 4GB9A 2VRRB 3PVWA 1PQSA 1ISNA 4F7HA 5L95C 4AWJA 2KFJA 5DH9B 3M62B 2K00A 1DROA 3ZNHB 2KGXB 3U30A 2K1FA 4A6HA 3PS6A 2J0KA 3MPXA 4M8NA 4OVUA 4HB3B 1GC6A 1V6EA 3ZNGC 3VQIA 3L13A 2CY5A 4MJSB 2IO3B 4KZCA 1IPGA 1ST7A 1WMHA 3ZKJC 1Z5SB 1MAIA 1ZGUB 4GXBA 1WYWB 4PQ0A 4GMXB 3ZRCA 2BPSA 4ZRKA 2NPTB 3TCAA 5AZFA 1X1FA 2XK5A 3LDZE 4A20A 2UYZB 2JF5A 4H8SA 4WQOB 4ANWA 3ULBA 1WI1A 3M1IB 4WJOA 3VH4B 4KV2A 4GZUA 2JRIB 3RCPA 4HVBA 2FNJB 4EZJA 3CIKA 5DPRA 1I42A 4HB2B 2DX5A 3F5RA 2YSZA 3FEHA 4K2PA 1P3QU 2JZZA 2I1JA 4EJNA 4GDKA 1UH6A 3TO1A 3BY4B 2K8BA 2W9NA 3S2AA 3PVLA 3D8DA 3WYFB 5E6PA 4GOCA 3VTUA 1UBIA 3MJWA 3QX1A 2L1CA 1R4NI 3Q3FA 3PLVA 3NZUA 5DHFB 2IO2B 1Z87A 2PZ1A 3WAPA 3R66C 2RSGA 1FHXA 2GBMA 3ECIA 1WR1A 1WZ3A 2MKRA 1C1YB 4X57B 3KUCB 4F7UP 1NI2A 1WGGA 2Z0QA 5IAAC 5C23A 3K9PB 3JVZX 2KX0A 3OLMD 2V76A 2LBBA 1LQBA 5BO4B 4RM9A 4KIKA 1XT9B 3AU4A 1L7YA 5HE0A 4W9LA 1WXAA 1AWEA 2A4ZA 3ULCA 1U5EA 3QWMA 1TBEA 2HJ8A 3TL5A 1J19A 2JP2A 1HBKA 2IFSA 2N1VA 2C7NB 3CXBB 2D9ZA 2HE7A 5JVLA 4HDOA 1NDDA 2PE9A 2NPTA 4K17A 4MT7A 1KZGA 1S1QB 3APFA 1WXSA 2JUOA 3TW1A 4BBNC 3PSEB 4TV3A 2YS3A 1WGRA 5LXHA 1LW3A 1VBHA 1RLFA 1CMXB 3DBHI 2CRFA 1D3ZA 1WFYA 4RMAA 2KANA 4NPNA 2KWUB 4J6IA 2V4LA 2OQBA 4MK0A 2N23A 4I6NB 4A6KA 3DBLI 2RLOA 1V89A 2L0FA 3QCAA 5E6NA 1SHCA 3VFKA 4W9EA 2H7EA 2LGXA 3E66A 2DAJA 2ZVNA 5AZHA 2OJRA 3VTWA 2D9VA 3QIJA 4MDKE 2IYBA 4WVFB 3A9KA 5J3QA 4IWQA 3DVGX 3PVUA 1R4MI 2MCNB 3VUYA 4BKSD 1E8WA 4JKGA 1WX9A 4IG7B 2BYVE 3QQ8B 3CSFA 3RD2A 2P0FA 2DZJA 3I3TB 1DDVA 4NQKE 4GGQA 1P98A 4CHMA 2LUEA 4EFOA 4HAUB 3B1LX 2DIKA 2DHJA 1WZ0A 1AQCA 2WX0A 3G9WA 2KDIA 2JPHA 2FAZA 1YJ1A 2G45B 1PMSA 1X86A 3PHXB 3VIAA 3QARA 1OEYJ 4ILHA 4CO7A 3WANA 3ZDTA 1PLSA 2KNBA 3ODOA 4EZKA 2O2VB 5D3VA 1FB8A 2ZJDA 3A9JA 1YIWA 2JRHA 3IBEA 3H1UA 2L05A 3A4SC 3QC8B 2E2XA 2MSED 4W9HA 2LXAA 4M8MA 3AJ4A 2PPHA 4MGZE 3DOWA 5GMVA 1NTVA 2A5UA 4FULA 2MBQA 1TGZB 4MGYE 2ZCBA 3CF6E 1SGHA 3A8PA 2RR9A 2KTRB 3FM8C 3PT2B 3DCGA 2C9WB 5C1ZA 3HIZA 5KHQA 3ML4A 5DPSA 4MGIE 3HM3A 2UZRA 3ZW3A 3SV1A 1V61A 1T0YA 2GJYA 1VCBA 2N1WA 3UINB 1ZC4B 3M3JA 2L7RA 3ENEA 2C60A 1OTRB 4BKSA 3EPYA 1J8CA 2LG1A 4HAWB 5D3YA 2KMCA 4E71A 4KIKB 2IY1B 4HXDA 2ROVA 4JKEA 3IHPC 2UWQA 5DI9B 1OMWA 2M38A 2RVBB 1SE9A 4F7ZA 3X23A 3T9LA 2GBRA 3V6CB 3ZIMA 2CQUA 1UBQA 4DHJB 3ZNZB 4GPTB 1UNRA 3ZNID 4MSMB 4AJYB 4IM0A 2EMTA 4K7WA 1DYNA 1WGDA 5CTRC 1XR0B 2D10A 4IAPA 3EFUA 2FIFA 5JHAA 2DZMA 3HHMA 4P7IA 1WJMA 1P0RA 4WJ7A 1Y8RC 2BWES 4JKGB 2D4QA 4W9JA 4HAZB 5IJMA 1WGHA 1X1MA 2COAA 2L3ZA 3UIOB 1P3RA 2BCJA 1P1AA 2M0XA 3L17A 4G3XB 3H7SA 2W2WA 4KVGB 2KD0A 4NAWB 1K5DB 4ANUA 4AOFA 4DX90 5D94A 3HW2B 2KLCA 4MH0E 2GBJA 3JSVB 2HTHA 3WA0A 3V61A 4KHBB 2KJHB 4WWOA 1DBHA 1IP9A 2DYNA 1TZ1A 3VTVA 5JHBA 4AP4C 4A3PA 3L0WB 3W1SA 4EKUA 2ABDA 4HB0B 4W9KA 2NBWB 3L16A 3KY9A 3L08A 4D0NB 4PS7A 2MQJA 3OAWA 2B3AA 3AI5A 2P0DA 2FCMA 2YF0A 1MG8A 2KCJA 1OY2A 5FR6A 1GJZA 1Q1OA 1W1GA 1KBLA 3V62A 5FI0A 3RCZA 2NR2A 2ZCCA 5HKHA 3ZVRA 1UGMA 1UEFA 3UQBA 2VRWB 4I6LB 2QKLA 2R0DA 1WF9A 1WJ1A 2LD9A 4DHJD 1EUVB 3A33B 2KFKB 1M7RA 2JWZA 4URKA 2BWFA 2N4FA 4NJ7A 1YD8U 1Z2MA 3N7CA 3QBVB 2GOWA 2KO3A 2DX1A 3VHTC 2NBUA 2MWNB 3SBTA 1E90A 3KH0A 3A8QA 4ZYNA 4HCPB 2CR5A 4KSLC 3ZRFA 2O6VA 3WALA 3CSTA 1E8ZA 2DENB 1I2HA 5HE3A 2V1YA 3HM6X 2UVMA 1W1HA 4MM3A 5C5BB 1E8YA 2KQSA 2PEAA 4L6EA 2JT4B 5C6RA 3E9PA 1W1DA 4FHKA 3A1QA 1E5WA 3QA8A 4DHZE 2O6VB 2G4SA 4KDLB 2KVRA 2REXA 1KJTA 1WM3A 3UIPB 1GG3A 4KSKC 4IWOA 3KUZA 3U8ZA 2O6VD 3JYUA 3APCA 2KDEB 2KFKA 2R82A 2KJ6A 4F1SA 1MPHA 2J0MA 1FGYA 3FLVA 4WJQA 4JK8A 2NCNA 4WAAA 4ASWC 2VSZA 3A9KB 2KC1A 4HJKA 3V5WA 4ILJA 4Z2MB 2YVCA 2HRJA 1NU2A 2CY4A 2ELAA 4FJVB 2Y8FA 4HCNB 2QHOA 3APDA 2IZVB 4ANXA 2D9YA 2KXJA 1ZVRA 2V3SA 1S3SG 2GBNA 2J7QB 4BFRA 5JHHA 1Y5OA 5LLIA 2L00B 3FSSA 3GYOA 3RUIB 3KW5B 1GC7A 1XKEA 3H7PA 2DZKA 1NBFC 1UNQA 2FUHB 4IM3A 3R7QA 4DK5A 2O2VA 2RD0A 3VUXA 1E8XA 4K2OA 2NMBA 4TUUA 1P5TA 1BAKA 3MHSD 3ODXA 2Q13A 5JHGA 2YS5A 2G3QB 1RFAA 1VD2A 2AL6A 4GIVA 1E7VA 5CLLB 5C79A 3PEGA 2LVQA 3VDZA 3M63B 2IBIB 2M1MA 5DHAB 2LI5A 4PS3A 4W9IA 4XX5A 2G35A 4GSWA 1WG7A 1X1GA 1ZW7A 4KHOA 3L10B 5LXIB 3HQCA 5CLQB 1WH3A 2CKHB 3T8MA 2GBKA 2K25A 2EJ8A 2R09A 5C5BA 2D11A 2MW5A 3WIMA 2MP2B 2XBBC 3M95A 3PSCA 1G6JA 4B6HA 4ZRIA 1M94A 4IFSA 1JRUA 3NY5A 3UF8A 4PNKA 1V81A 1HB6A 3X0WA 3ZO5B 2DYOA 2LZ6A 4OVVA 1OGWA 2J59M 2Z0DB 2LVPA 2MLBA 2NZ8B 4XC2A 5JZEB 2GS0A 2LOXA 4GDLB 2X18A 1WGUA 3DVGY 4DDID 2LJ5A 1DIKA 2DLWA 1WIAA 2ROZB 3ML8A 3SNHA 2CODA 2LVOA 1IRSA 2X0SA 4FJYA 1SIFA 1MIXA 4MSQB 2ZPNA 3PHWB 2BYEA 1V5TA 2MRPA 3KYDD 1WXMA 4IC7B 2K2UA 4F8CB 3E9LA 2N7DA 5GOWB 4BOZB 4DBBA 3JSVA 1WJNA 4A6FA 5KQ1A 3AXCA 3UGBB 4FA6A 2C7HA 2WH5A 1E7UA 2IYDB 3A4RA 5J18A 4F7GA 4NQLB 1X05A 1WE6A 2K39A 3DVNV 1ZKHA 5KQ4A 3AU5A 4WSFA 4G11A 2BGFA 4FBJB 2OOBB 2COFA 2N0YA 3WAMA 5JLJB 2IY0B 2KMAA 1V5UA 1KI1B 3RT3B 3N30A 3KRXA 4MEMA 5EDSA 1FAOA 2M8SA 2DX5B 1I35A 2K6DB 5L83A 4II3B 1UNPA 2OTXA 3KRWA 1WGQA 2D3GA 4PS8A 5AZGA 4CYEA 2LASA 2LGDA 2MA9B 2LRWA 5LOPB 2WYQA 2KC2A 5D3XA 3TFMA 4NJ6A 5JH5C 3ZDMC 4GMVA 1EVHA 2JXXA 3KSYA 3TBLD 3E9OA 2RGFA 4LDTB 2K8HA 3RYTA 2KLGA 3BINA 4Y94A 3PP2A 2PE6B 2RQ1A 4CHJA 3PPAA 2DKQA 4RM8A 1ZM0A 1WJ4A 1YX6B 5CHVC 3KZ1A 4FLHA 2DYBA 5TR5A 4BOSC 3V60A 4HPLB 2WDTB 2KKCA 3F0WA 4PYUA 5EFXA 4LJPB 1UPQA 1J0WA 4C0AA 2JY6A 2P0HA 1EF5A 1WJUA 1OQNA 2UZSA 3B0AA 1H4RA 2MFQA 3FP5A 2N9XA 3ENBA 1GGOA 4G50A 2RGNB 3SD5A 1TJ6A 1UPRA 1MK7B 1FGZA 3T06A 1XD4A 1UD7A 3AULA 1U2BA 1VBGA 1LXDA 4W9FA 1WVHA 2D9WA 4K7SA 4LJOB 2ZZPB 2NS5A 3ZLZA 1N3HA 1ACAA 1H8CA 2YT1A 3ZTCA 1WX7A 2MBHA 3EECA 5C16A 3KYCD 5D2MB 1Q5WB 3UZTA 2L8JA 1HB8A 3JW0X 4WJNA 4HHVA 3C0RB 2ADZA 1UZXB 2KX3A 2P8VA 4AUQC 2FJLA 1P9DU 3VXWA 4B6WA 2N9EB 1ZC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7Q A;  5AEK B;  2ZEQ A;  3B1L X;  4DK5 A;  2DTC A;  1V5O A;  1NTY A;  2DHJ A;  2O2V A;  1WZ0 A;  3H9D A;  5D94 A;  3NZS A;  2L2I A;  2AL3 A;  2FJ9 A;  2RD0 A;  1AQC A;  2Z0E B;  1E8X A;  3DVN U;  3VUX A;  2Y5B B;  3PRZ A;  2PJH A;  4K2O A;  3QJZ A;  1MKE A;  2WX0 A;  3RUL A;  1ZSQ A;  3G9W A;  3VOQ A;  1WI0 A;  4BKT A;  1FHO A;  3DXE A;  2KDI A;  2NMB A;  2JPH A;  2KOX A;  4AJW A;  4HAT B;  3DBR I;  3OJ3 A;  4TUU A;  2FAZ A;  5G2N A;  5FI1 A;  1YJ1 A;  2MWS B;  3TIX A;  1V49 A;  1PMS A;  2CHW A;  2G45 B;  1AAR A;  4JGH B;  3VH3 B;  4FN2 A;  1X86 A;  3DXC A;  1FOE A;  1RRB A;  1P5T A;  1XX0 A;  1BAK A;  1B55 A;  3VIA A;  3PHX B;  3MHS D;  3QAR A;  4DX8 A;  3ODX A;  1OEY J;  1WXV A;  4TQ1 A;  3R7R A;  2Q13 A;  2LXC A;  3WAN A;  4CO7 A;  3ZDT A;  5E6O A;  1C3T A;  1PLS A;  3GYP A;  5JHG A;  2XQN M;  2KNB A;  3ODO A;  2FCN A;  2RSU A;  2YS5 A;  2XEW A;  2G3Q B;  1RFA A;  3NHE B;  4EZK A;  1VD2 A;  5J2R A;  2O2V B;  2AL6 A;  5D3V A;  3VVW B;  4GIV A;  1YX5 B;  2CHX A;  1FB8 A;  1E7V A;  2ZNV C;  2ZJD A;  1IYF A;  5CLL B;  5C79 A;  3PEG A;  2HD5 B;  2LVQ A;  4XWX A;  3A9J A;  1YIW A;  3LJ3 A;  1TQZ A;  3NOB A;  3VDZ A;  2JRH A;  4NY0 A;  3M63 B;  2YS1 A;  5HE1 A;  1EGX A;  3IBE A;  3H1U A;  3SU8 X;  4LDT D;  2IBI B;  2L05 A;  2COP A;  5D27 A;  3A4S C;  4TKN A;  4IUM B;  4EOY A;  2AEH A;  2M1M A;  2MBO A;  2ZNV B;  3QC8 B;  2I1K A;  1FHW A;  4GDL A;  2E2X A;  2Y7B A;  5DHA B;  1BTK A;  2MSE D;  2R2O A;  2L0T A;  3N3K B;  1U5F A;  2LXA A;  3L54 A;  2LI5 A;  4M8M A;  3AJ4 A;  2PPH A;  4MGZ E;  2CS4 A;  3PGE A;  4PS3 A;  3PZD A;  1WMH B;  4EMO A;  3DOW A;  2DHZ A;  1HE8 A;  5GMV A;  4W9I A;  2M17 A;  4FAD A;  2BKF A;  2G35 A;  1Q0W B;  4XX5 A;  1K8R B;  4NAW A;  2COC A;  2DYQ A;  1WG7 A;  1X1G A;  1ZW7 A;  4GSW A;  1NTV A;  4M0W B;  4KHO A;  3L10 B;  2A5U A;  4FUL A;  5J17 A;  2MBQ A;  5LXI B;  3HQC A;  1TGZ B;  5CLQ B;  4JIO U;  4MGY E;  2ZCB A;  1WH3 A;  3HK0 A;  3CF6 E;  2DKP A;  1WRD B;  3QHT A;  1LM8 B;  2CKH B;  4W9G A;  3T8M A;  1SGH A;  3ZUN A;  4DBG A;  4EEW A;  2GBK A;  2MBE A;  2K25 A;  3DQV A;  4YL8 A;  2EJ8 A;  3A8P A;  3ZTC A;  2RR9 A;  2R09 A;  2KTR B;  3RZF A;  3FM8 C;  2KK8 A;  5C5B A;  2WX1 A;  1KOT A;  1V5P A;  2D11 A;  2MW5 A;  3WIM A;  1XOD A;  2MP2 B;  2XBB C;  3M95 A;  2MX2 A;  4FJZ A;  5LON B;  3PT2 B;  4K7U A;  3PSC A;  3DCG A;  3PTF C;  2LKO A;  3P2B A;  2C9W B;  4IWP A;  4HAX B;  5C1Z A;  3HIZ A;  1TTN A;  1G6J A;  3TVV A;  1V86 A;  4MY6 A;  2CAY A;  4B6H A;  3ML4 A;  5KHQ A;  5DPS A;  3ALB A;  4ZRI A;  5HE2 A;  4DHZ B;  3PRM B;  4HDQ A;  3HM3 A;  4MGI E;  2FID A;  2N7E A;  1M94 A;  1RJ2 A;  2UZR A;  4II2 B;  3ZW3 A;  4IFS A;  1M7E A;  3IFW B;  4KDI C;  2YT0 A;  3SV1 A;  3DBS A;  3KUD B;  3O65 B;  2FDQ A;  3TMP B;  2HTH B;  4NSW A;  4TYZ A;  1JRU A;  4DWF A;  4W9C A;  1V61 A;  3NY5 A;  4KHA A;  2EC1 A;  4HWI B;  4TQ0 A;  2RPQ A;  1T0Y A;  3UF8 A;  2GJY A;  1VCB A;  4A5K A;  2N1W A;  3SDL C;  2W2X D;  2DA0 A;  1ZC4 B;  3OAN A;  4IOY X;  4PNK A;  1V81 A;  3UIN B;  4DDG D;  1HB6 A;  3M3J A;  4K81 A;  2IO0 B;  2L7R A;  3ENE A;  2EKE C;  3X0W A;  2C60 A;  2IO1 B;  4HLE A;  2QKM A;  2AYO B;  1OTR B;  4BKS A;  5J3Y A;  2LOZ A;  3EPY A;  2KDB A;  2KWC A;  2LWP A;  3ZO5 B;  2LG1 A;  1U27 A;  3P7Z A;  4HAW B;  1U29 A;  1J8C A;  2DYO A;  2LRU A;  2LZ6 A;  2D2Q A;  5D3Y A;  2KMC A;  3IVF A;  3PRE A;  3IG3 A;  2CHZ A;  4KIK B;  4E71 A;  1V9J A;  4OVV A;  1DDM A;  1H10 A;  1OGW A;  2IY1 B;  2J59 M;  2D07 B;  2ROV A;  2KJR A;  4HXD A;  4Z2N A;  3NS8 A;  3IHP C;  1X11 A;  2Z0D B;  2UWQ A;  2LVP A;  5DI9 B;  2MLB A;  1EF1 A;  1NVL A;  1DDW A;  4BBN F;  3DXD A;  3KVF B;  1OMW A;  3APF A;  2M38 A;  2RVB B;  1KLV A;  3U7D A;  2NZ8 B;  3PLU A;  1SE9 A;  4F7Z A;  4A3O A;  2KTR A;  3X23 A;  1V80 A;  2BKR B;  3T9L A;  4XC2 A;  5JZE B;  1GUA B;  2GS0 A;  5D3W A;  2FCS A;  2LOX A;  2GBR A;  2YRY A;  2C7M B;  2KHW B;  3PRP B;  2K2J A;  2X18 A;  2MP2 A;  3DPD A;  4GDL B;  4ZRJ A;  3EHV A;  3OJ4 B;  1WGU A;  3DVG Y;  1NTI A;  2Z0P A;  4DDI D;  2DFK A;  2LJ5 A;  3ZIM A;  2DLW A;  2Z0O A;  2K6Q A;  4B95 A;  1WIA A;  2Y8G A;  2CQU A;  2ROZ B;  1UBQ A;  3ML8 A;  5DIF B;  4DHJ B;  2DAF A;  2KN5 A;  3W1S A;  3ZNZ B;  4GPT B;  1UNR A;  3ZNI D;  5DPT A;  2WWZ A;  4MSM B;  4AJY B;  3SNH A;  4BKG A;  2COD A;  4E74 A;  2LVO A;  1IRS A;  2MDX A;  4IM0 A;  2EMT A;  1Q67 A;  4FJY A;  5D7G A;  4K7W A;  1RAX A;  4GB9 A;  1DYN A;  1WGD A;  2DYM A;  5CTR C;  2JZ3 B;  2VRR B;  1SIF A;  1XR0 B;  3GZN I;  1MIX A;  2D10 A;  1RRP B;  3PVW A;  4MSQ B;  4IAP A;  1PQS A;  2W2X C;  1BTN A;  3EFU A;  5CX3 A;  2ZPN A;  2FIF A;  3PHW B;  2BYE A;  1ISN A;  1I7A A;  4F7H A;  1V5T A;  5D6J B;  5L95 C;  1LFD A;  2MRP A;  4AWJ A;  5JHA A;  2DZM A;  3KYD D;  1WXM A;  4ICU A;  1F9J A;  4IC7 B;  2KFJ A;  2K2U A;  5DH9 B;  3M62 B;  3HHM A;  3TJP A;  4F8C B;  4P7I A;  4DXA B;  4HB4 B;  1WJM A;  3A1Q B;  2N7D A;  2K00 A;  1DRO A;  1P0R A;  4WJP A;  3ZNH B;  2KGX B;  4WJ7 A;  5GOW B;  1FXT B;  3U30 A;  1Y8R C;  4BOZ B;  2BWE S;  2ZVO A;  2K1F A;  4A6H A;  3PS6 A;  2J0K A;  4DBB A;  1YQB A;  3MPX A;  2KTF A;  4M8N A;  3JSV A;  2D4Q A;  4HB3 B;  4OVU A;  4HAZ B;  1QZE A;  1WJN A;  2Z59 B;  1GC6 A;  4W9J A;  1V6E A;  4A6F A;  5KQ1 A;  3AXC A;  2LUL A;  5IJM A;  1XD3 B;  3ZNG C;  2GCL A;  1WGH A;  3UGB B;  1X1M A;  4FA6 A;  3VQI A;  2M4N A;  2COA A;  2C7H A;  3QK0 A;  2L3Z A;  3UIO B;  3L13 A;  1QQG A;  1P3R A;  2CY5 A;  2WH5 A;  1E7U A;  2IYD B;  2BCJ A;  1P1A A;  4MJS B;  2M0X A;  3L17 A;  4FHJ A;  4G3X B;  3A4R A;  5J18 A;  4F7G A;  2IO3 B;  2W2W A;  1IPG A;  1ST7 A;  1WMH A;  3H7S A;  4KZC A;  4NQL B;  4I6P A;  1X05 A;  3ZKJ C;  4KVG B;  5KCV A;  1J0G A;  1Z5S B;  1MAI A;  2KD0 A;  4NAW B;  1K5D B;  4ANU A;  1WE6 A;  2K39 A;  3PG7 A;  3B08 A;  1U4A A;  1ZKH A;  5KQ4 A;  1WGY A;  3DVN V;  4DX9 0;  3AU5 A;  4HAY B;  4WSF A;  3HW2 B;  1ZGU B;  2KLC A;  4GXB A;  3CMM B;  4G11 A;  1OQY A;  4MH0 E;  1WYW B;  4KAX B;  2GBJ A;  4PQ0 A;  2AWT A;  2HTH A;  4GMX B;  3JSV B;  3ZRC A;  2BPS A;  3WA0 A;  1U5G A;  4ZRK A;  2N9P C;  3V61 A;  2NPT B;  5CHF A;  3TCA A;  5G55 A;  4GU2 A;  1WM2 A;  4KHB B;  2KJH B;  2BGF A;  4WWO A;  5AZF A;  4FBJ B;  1X1F A;  2OOB B;  2XK5 A;  1DBH A;  3LDZ E;  2NVU I;  4MEL A;  4A20 A;  2UYZ B;  1IP9 A;  2MBB B;  4XZ4 A;  3H6N A;  2COF A;  2JF5 A;  4WWP A;  2DYN A;  2N0Y A;  4H8S A;  1TZ1 A;  4WQO B;  5JLJ B;  3WAM A;  2IY0 B;  3Q3J A;  4ANW A;  2H7D A;  3VTV A;  4JL9 A;  3D8F A;  1WI1 A;  3ULB A;  5JHB A;  4AP4 C;  3M1I B;  4A3P A;  3ONS A;  3ODW A;  2KMA A;  4WJO A;  3L0W B;  1V5U A;  3VH4 B;  4KV2 A;  4GZU A;  4EKU A;  2ABD A;  4HB0 B;  1KI1 B;  2JVC A;  2NBW B;  4W9K A;  2JRI B;  3KY9 A;  3L16 A;  3L08 A;  5IA7 A;  3RCP A;  4D0N B;  1EAZ A;  4PS7 A;  3RT3 B;  4HVB A;  3N30 A;  2FNJ B;  2KWV B;  1UEL A;  2MQJ A;  3OAW A;  2B3A A;  2K8C A;  2P0D A;  3KRX A;  3AI5 A;  4MEM A;  4EZJ A;  3CIK A;  5EDS A;  5DPR A;  1V2Y A;  1FAO A;  1I42 A;  4HB2 B;  2DX5 A;  3F5R A;  2M8S A;  2YSZ A;  4K1R B;  2FCM A;  2YF0 A;  2DX5 B;  4W9H A;  1I35 A;  1MG8 A;  1TXD A;  2KCJ A;  3FEH A;  1OY2 A;  2ZPY A;  2K6D B;  2GMI C;  4K2P A;  5FR6 A;  5L83 A;  4II3 B;  1Q1O A;  1P3Q U;  1GJZ A;  1W1G A;  3SUZ A;  3NSU A;  2JZZ A;  4N9F 4;  5J3T A;  4EZL A;  4LCD E;  2I1J A;  3V62 A;  5FI0 A;  4EJN A;  2CB8 A;  1UNP A;  2OTX A;  1UH6 A;  4GDK A;  3RCZ A;  3KRW A;  2M14 A;  4GDK B;  3TO1 A;  1KZ7 A;  1WGQ A;  1XCG A;  2G4D B;  3V6C B;  3BY4 B;  2D3G A;  4PS8 A;  2K8B A;  2W9N A;  5AZG A;  2NR2 A;  4CYE A;  2ZCC A;  3S2A A;  5HKH A;  3PVL A;  1BWN A;  2LAS A;  2LGD A;  3ZVR A;  3D8D A;  1A5R A;  3WYF B;  1WE7 A;  3D8E A;  1BT0 A;  5DCN A;  5E6P A;  2MA9 B;  2LRW A;  3A98 B;  5LOP B;  2XK5 B;  1UBI A;  2WYQ A;  1UGM A;  4GOC A;  1UEF A;  3VTU A;  1QC6 A;  3UQB A;  2VRW B;  4I6L B;  3MJW A;  2KC2 A;  3QX1 A;  2QKL A;  2R0D A;  5D3X A;  3TFM A;  4NJ6 A;  2L1C A;  1R4N I;  3Q3F A;  5JH5 C;  3ZDM C;  1WF9 A;  1WJ1 A;  3NZU A;  3PLV A;  2LD9 A;  5DHF B;  2L76 A;  5JP4 A;  2BYF A;  2C5L C;  4DHJ D;  1EUV B;  2IO2 B;  1MK9 B;  3A33 B;  2KFK B;  1Z87 A;  2PZ1 A;  4HK2 A;  4GMV A;  1EVH A;  2JXX A;  3KSY A;  3R66 C;  3WAP A;  2RSG A;  1M7R A;  2JWZ A;  3TBL D;  1FHX A;  2GBM A;  4URK A;  3ECI A;  2BWF A;  2N4F A;  1WR1 A;  4NJ7 A;  1YD8 U;  1Z2M A;  1WZ3 A;  3N7C A;  3SYX A;  2MKR A;  2RGF A;  3QBV B;  1C1Y B;  4LDT B;  2K8H A;  3SO6 A;  4X57 B;  3RYT A;  4WWN A;  3KUC B;  4A6F B;  4F7U P;  1NI2 A;  1WGG A;  2Z0Q A;  2GOW A;  3P6A A;  2KLG A;  3N32 A;  2KO3 A;  5IAA C;  5C23 A;  3GOE A;  3PV1 A;  3K9P B;  2DX1 A;  3VHT C;  2NBU A;  3JVZ X;  2MWN B;  4MGK E;  3BIN A;  1E90 A;  3KH0 A;  3A8Q A;  4ZYN A;  4Y94 A;  3PP2 A;  4HCP B;  2KX0 A;  3OLM D;  3R3M A;  1U5D A;  2CR5 A;  3QWZ B;  2V76 A;  2LBB A;  1LQB A;  2PE6 B;  4KSL C;  2RQ1 A;  2RUK B;  4RM9 A;  5BO4 B;  3UIP B;  4YON A;  4CHJ A;  2O6V A;  3V6E B;  3WAL A;  3ZRF A;  3CST A;  4KIK A;  1XT9 B;  3AU4 A;  2DHK A;  2D9X A;  2RNR B;  3PPA A;  4EUT A;  3D32 A;  1E8Z A;  2DEN B;  1I2H A;  4ICV A;  2DKQ A;  4KZ0 A;  3VAW A;  5HE3 A;  5DPW A;  1L7Y A;  4RM8 A;  3A9J B;  2DN6 A;  5HE0 A;  4W9L A;  3ML9 A;  1WXA A;  1ZM0 A;  2CU1 A;  2NBV B;  2V1Y A;  3HM6 X;  1WJ4 A;  2UVM A;  1AWE A;  1W1H A;  1YX6 B;  2A4Z A;  4MM3 A;  2GCJ A;  3ULC A;  5CHV C;  5C5B B;  3W1Y A;  3KZ1 A;  1E8Y A;  1U5E A;  3QWM A;  2KQS A;  4FLH A;  4AOF A;  4B9K A;  2PEA A;  1TBE A;  4L6E A;  2DYB A;  2JT4 B;  4NNJ B;  5C6R A;  5CHW A;  5TR5 A;  4BOS C;  1W1D A;  3WAO A;  3V60 A;  2LGY A;  1WX8 A;  2HJ8 A;  3A1Q A;  4FHK A;  1E5W A;  3QA8 A;  4DHZ E;  1K5G B;  5L81 A;  4HPL B;  2O6V B;  1J19 A;  2JP2 A;  2WDT B;  3TL5 A;  1HBK A;  2KZR A;  2IFS A;  2KKC A;  3F0W A;  3CXB B;  1EO6 A;  2C7N B;  2G4S A;  2D9Z A;  2N1V A;  2KQ7 A;  2HE7 A;  5EFX A;  3EC8 A;  4PYU A;  4HDO A;  4LJP B;  1UPQ A;  2DHI A;  4KDL B;  1NDD A;  2PE9 A;  2NPT A;  2KVR A;  4HPM B;  1J0W A;  4K17 A;  3MDB C;  4MT7 A;  4IM2 A;  4C0A A;  1WJ6 A;  2JY6 A;  2REX A;  2P0H A;  1KZG A;  1KJT A;  1S1Q B;  1EF5 A;  1GG3 A;  1WM3 A;  1WXS A;  4HAV B;  1WJU A;  1OQN A;  2KUP A;  1PFJ A;  2UZS A;  2R2Q A;  3B0A A;  4IWO A;  4KSK C;  3KUZ A;  2JUO A;  3TW1 A;  1H4R A;  3K9O B;  3ZVV A;  3U8Z A;  2O6V D;  2MFQ A;  3JYU A;  1WR6 E;  4BBN C;  3APC A;  3PSE B;  4TV3 A;  3FP5 A;  2YS3 A;  1Y19 B;  2KDE B;  4G0N B;  4CHK A;  2YLM A;  3DDC B;  1WGR A;  4W9D A;  2KFK A;  2N9X A;  2KJ6 A;  4PYZ A;  5LXH A;  4F1S A;  1GNU A;  2EMS A;  1LW3 A;  4G50 A;  1V88 A;  4JLC A;  2RGN B;  3SD5 A;  1MPH A;  3O96 A;  1TJ6 A;  2BF8 B;  1RLF A;  4ANV A;  2J0M A;  1FGY A;  1CMX B;  3DBH I;  4IW0 A;  3FLV A;  4JQW C;  1UPR A;  4WJQ A;  1MK7 B;  1FGZ A;  3T06 A;  2NCN A;  3ZTD A;  4WAA A;  1XD4 A;  2I5F A;  4ASW C;  2CRF A;  1UD7 A;  2VSZ A;  3AUL A;  3UQA A;  3A9K B;  2KC1 A;  2DZI A;  1U2B A;  1XQQ A;  4HJK A;  4MJS A;  1D3Z A;  3V5W A;  1WFY A;  4RMA A;  2KAN A;  3BJI A;  4NPN A;  1LXD A;  2KWU B;  4Z2M B;  2YVC A;  1LB1 A;  2V4L A;  4J6I A;  4W9F A;  1WVH A;  2D9W A;  2HRJ A;  4K7S A;  1NU2 A;  2CY4 A;  2ELA A;  4FJV B;  1L2N A;  2OQB A;  4MK0 A;  2N23 A;  2Y8F A;  4I6N B;  2ELB A;  4HCN B;  2QHO A;  3APD A;  4A6K A;  2IZV B;  2RLO A;  3DBL I;  1V89 A;  2L0F A;  4LJO B;  4ANX A;  4BVU C;  4E3C A;  2ZZP B;  2FCQ A;  2D9Y A;  2KXJ A;  2NS5 A;  3QCA A;  3ZLZ A;  4ZDV A;  5E6N A;  1SHC A;  3VFK A;  4W9E A;  2H7E A;  2LGX A;  5KHO A;  2ASQ A;  2I5C A;  2DAJ A;  1N3H A;  2ZVN A;  1ZVR A;  1ACA A;  1P6S A;  2OJR A;  5AZH A;  3RZW C;  3VTW A;  1H8C A;  3LJU X;  2D9V A;  3QIJ A;  2V3S A;  1S3S G;  4MDK E;  2IYB A;  2YT1 A;  2GBN A;  4WVF B;  1WX7 A;  2MBH A;  3VUW A;  2LYD A;  2KDF B;  5J3Q A;  1V5M A;  3A9K A;  3EEC A;  5C16 A;  3KYC D;  4IWQ A;  5D2M B;  2J7Q B;  3DVG X;  4BFR A;  5JHH A;  3PVU A;  1R4M I;  2J0J A;  1MIZ B;  1Y5O A;  1Q5W B;  5LLI A;  3UZT A;  2L00 B;  2L8J A;  1HB8 A;  2MCN B;  3JW0 X;  4WJN A;  3VUY A;  3FSS A;  4BKS D;  4HHV A;  4BBK A;  3GYO A;  1E8W A;  3RUI B;  1WX9 A;  4IG7 B;  3W1S C;  2BYV E;  3C0R B;  3QQ8 B;  3CSF A;  3KW5 B;  2ADZ A;  1GC7 A;  3RD2 A;  2P0F A;  1UZX B;  1KM7 A;  2DZJ A;  3I3T B;  3QAQ A;  2KX3 A;  1WY8 A;  1DDV A;  4GN1 A;  1XKE A;  1OEY A;  3H7P B;  2P8V A;  4NQK E;  3H7P A;  2VKI A;  4GGQ A;  2DZK A;  4AUQ C;  3SHQ A;  1P98 A;  2FJL A;  1P9D U;  4CHM A;  3VXW A;  1NBF C;  4B6W A;  3MTN B;  2N9E B;  1UNQ A;  2FUH B;  4IM3 A;  1ZC3 B;  2LUE A;  4EFO A;  4HAU B; 
#chains in the Genus database with same CATH topology
 5LNK 1;  2ZEQ A;  4FXC A;  3SBG A;  2DTC A;  3H9D A;  3NZS A;  2L2I A;  2FJ9 A;  1JWU D;  3DVN U;  3OWE B;  2PJH A;  3RUL A;  1EU3 A;  3NG0 A;  3VOQ A;  4ZHP A;  4HAT B;  3OJ3 A;  1FMA D;  1FRR A;  5G2N A;  5FI1 A;  1C9F A;  1L0V B;  3TIX A;  1V49 A;  3Q8A A;  1AAR A;  1AN8 A;  3VH3 B;  1RRB A;  1UWM A;  1XX0 A;  1B55 A;  4DX8 A;  1WXV A;  3R7R A;  1FNU A;  4LNK A;  3VAW A;  2RSU A;  3AV8 A;  4JK7 A;  1XLP A;  5H8Y E;  3VVW B;  4IOI E;  1YX5 B;  2CHX A;  1SXT A;  2HD5 B;  4QXA B;  1CJE A;  4XWX A;  2H89 B;  3NOB A;  4US8 A;  2YS1 A;  4LDT D;  1C79 A;  1YMH E;  1L0X B;  4C7Y A;  4EOY A;  2AEH A;  3BYT B;  2MBO A;  2J53 A;  1FHW A;  4GDL A;  1BTK A;  2L0T A;  3J9C A;  3N3K B;  3VRB B;  3PGE A;  2DHZ A;  1A70 A;  2M17 A;  2FE8 A;  3PO0 A;  1Q0W B;  2QSD A;  2M56 B;  2COC A;  1GB1 A;  5J17 A;  2WQY B;  1KFY B;  1HA5 A;  1SIJ A;  3HK0 A;  3ZUN A;  4EEW A;  4W9G A;  2SEB D;  3FIL A;  4YL8 A;  1PUT A;  3R2I A;  3RZF A;  1V5P A;  1XOD A;  2MX2 A;  4YWG G;  1N60 A;  5LON B;  2TSS A;  3C8Y A;  2X8X X;  3P2B A;  4FJZ A;  2LKO A;  4IWP A;  3R8B A;  1TTN A;  1ET9 A;  1TY0 A;  2CAY A;  4HJG E;  1TS4 A;  2WHI A;  3V3X A;  2FID A;  1RJ2 A;  4II2 B;  1M7E A;  3IFW B;  4KDI C;  3DBS A;  1STE A;  1ZYI A;  2HTH B;  4NSW A;  4TYZ A;  1ZDV A;  1VZ7 A;  3VR9 B;  4DWF A;  4KHA A;  2EC1 A;  4HWI B;  5EE3 A;  4TQ0 A;  4OZB A;  4A5K A;  2W2X D;  3OAN A;  3ZJT A;  4K81 A;  2IO0 B;  2IO1 B;  2QKM A;  2AYO B;  2LOZ A;  2KWC A;  2LWP A;  1JRO A;  2D2Q A;  3PRE A;  2CHZ A;  1V9J A;  4LNN A;  2KJR A;  4BAX A;  2ZW1 A;  2WXG A;  1X11 A;  1OFF A;  1NVL A;  3KVF B;  1NI3 A;  1FXA A;  1KLV A;  3U7D A;  4A3O A;  2KTR A;  2BKR B;  2BW2 A;  5D3W A;  3PRP B;  2KHW B;  2YRY A;  5AUK A;  3OJ4 B;  1I4H A;  1NTI A;  2DFK A;  2Z0O A;  2K6Q A;  5DIF B;  2KN5 A;  1QOB A;  4RFB A;  4BKG A;  4YTM B;  4E74 A;  1Q67 A;  5D7G A;  1RAX A;  2DYM A;  2JZ3 B;  3GZN I;  4Q2J A;  1RRP B;  5CX3 A;  2W2X C;  1BTN A;  1N5X A;  3AN1 A;  1I7A A;  3MFG A;  5D6J B;  1LFD A;  2AX5 A;  3RNC C;  1F9J A;  1C77 A;  2L83 A;  2Y5P A;  5IP4 D;  3TJP A;  4C7Z A;  2LMC A;  4DXA B;  4HB4 B;  1JW9 D;  3A1Q B;  4WJP A;  1TYG B;  1FXT B;  4LNO A;  3AEB B;  2ZVO A;  4JKB A;  1JWM D;  1YQB A;  2KTF A;  1QZE A;  2Z59 B;  1HXY D;  2BS2 B;  3Q3O C;  2LUL A;  1XD3 B;  2GCL A;  2M4N A;  1J7C A;  3QK0 A;  1FRD A;  1QQG A;  1KF6 B;  2MH7 A;  4FHJ A;  1VJK A;  4I6P A;  3W9C B;  4KX6 B;  5KCV A;  1J0G A;  1ZPS A;  3PLU A;  3B08 A;  3PG7 A;  1U4A A;  1XLN A;  1WGY A;  4K7U A;  4HAY B;  3CMM B;  3DHI C;  1OQY A;  2PKO A;  4KAX B;  2AWT A;  1U5G A;  2N9P C;  5CHF A;  5G55 A;  4GU2 A;  1WM2 A;  1XO3 A;  4C56 C;  3AEG B;  4MEL A;  4RGN A;  2NVU I;  2MBB B;  2R61 A;  4XZ4 A;  2QEJ C;  3H6N A;  4WWP A;  3IAS 1;  3Q3J A;  2H7D A;  2JYT A;  4JL9 A;  4JKC A;  3D8F A;  2J42 A;  1YN3 A;  3ONS A;  3ODW A;  1Y56 A;  2JX5 A;  3RI7 C;  2JVC A;  5IA7 A;  1EAZ A;  1QIL A;  2KWV B;  1UEL A;  2K8C A;  1V2Y A;  4K1R B;  1D5X C;  1TXD A;  3P1M A;  2ZPY A;  5TSS A;  2GMI C;  1FM0 D;  3SUZ A;  2WXN A;  4OZC A;  3NSU A;  3SEB A;  4N9F 4;  3U52 E;  5J3T A;  4EZL A;  4LCD E;  2CB8 A;  2M14 A;  4GDK B;  1KZ7 A;  1XCG A;  2G4D B;  3MC9 A;  3MJ5 A;  1BWN A;  1A5R A;  2WXF A;  1WE7 A;  3D8E A;  1BT0 A;  5DCN A;  2KWD A;  3A98 B;  2XK5 B;  1CK1 A;  1QC6 A;  2IPK D;  4N6E B;  1UUP A;  2Y5C A;  2L76 A;  5JP4 A;  2BYF A;  2C5L C;  1YQ3 B;  1MK9 B;  4C4V A;  3I57 A;  4HK2 A;  4JKF A;  2INP E;  1E6E B;  1I7H A;  5GXG B;  3SYX A;  3SO6 A;  1QLB B;  4WWN A;  4A6F B;  3P6A A;  4O1N A;  3N32 A;  3GOE A;  3PV1 A;  4MGK E;  4YSZ B;  3NW8 A;  2V9H A;  3AE5 B;  3R3M A;  1U5D A;  3QWZ B;  2RUK B;  4YON A;  3V6E B;  2WP9 B;  3R2T A;  2DHK A;  2D9X A;  2RNR B;  4EUT A;  3D32 A;  4IKG A;  2INN E;  4KZ0 A;  4ICV A;  5DPW A;  2JWU A;  3A9J B;  2DN6 A;  3ML9 A;  3URY A;  2CU1 A;  2NBV B;  2BB5 A;  4LNF A;  5IRS A;  3C19 A;  2GCJ A;  3W1Y A;  4B9K A;  2XNA C;  5CHW A;  4NNJ B;  2WDR B;  2ZKM X;  3WAO A;  2LGY A;  1WX8 A;  2V4I B;  1K5G B;  5L81 A;  1AWD A;  2KZR A;  3Q3N C;  1UGJ A;  1EO6 A;  3IT4 B;  5EE0 A;  3N20 C;  2KQ7 A;  4OHJ A;  3EC8 A;  3W2D A;  2DHI A;  4WUR A;  1Q10 A;  4HPM B;  3MDB C;  4IM2 A;  1WJ6 A;  4HAV B;  2R2Q A;  2KUP A;  1PFJ A;  1YQ4 B;  4RH6 A;  2KUQ A;  3K9O B;  3ZVV A;  1HEZ E;  1WR6 E;  4OT1 A;  1Y19 B;  2WU2 B;  4G0N B;  4CHK A;  2YLM A;  3DDC B;  4W9D A;  1C4P A;  3ZGZ A;  4PYZ A;  2JZP A;  1GNU A;  2EMS A;  1F1H A;  1ZOY B;  1L6V A;  1V88 A;  4JLC A;  4ILG B;  3O96 A;  2BF8 B;  4KKJ A;  4ANV A;  1I4G A;  3NVW A;  4JQW C;  4IW0 A;  1ESF A;  4JKH A;  3AE2 B;  3ZTD A;  2I5F A;  4YTP B;  1M4V A;  4JKD A;  1JWB D;  1PGA A;  3UQA A;  2DZI A;  1XQQ A;  4MJS A;  1E0Z A;  3BJI A;  1LB1 A;  3N9Y C;  5IO9 A;  1L2N A;  1CQV A;  2ELB A;  4BVU C;  4E3C A;  2FCQ A;  4ZDV A;  5KHO A;  1L4D B;  2ASQ A;  2I5C A;  3DBR B;  3I5J C;  1P6S A;  3RZW C;  2N9K A;  4US9 A;  3LJU X;  2WGS A;  5JXV A;  2LYD A;  2KDF B;  1V5M A;  2J0J A;  1MIZ B;  2PVO D;  4YSY B;  2K9X A;  4WWM A;  4BBK A;  1XLO A;  3W1S C;  3FVC A;  1K53 A;  3N1Z C;  3DHG C;  3QAQ A;  1KM7 A;  1P7F A;  1XLQ A;  1WY8 A;  4GN1 A;  1OEY A;  3H7P B;  2VKI A;  3SHQ A;  2KT7 A;  2BS3 B;  1T3Q A;  3MTN B;  3AE8 B;  4HEA 1;  1DOY A;  1V5O A;  1NTY A;  2AL3 A;  3P4S B;  2Z0E B;  2KAJ A;  2Y5B B;  3PRZ A;  3GE8 C;  3QJZ A;  1MKE A;  1JQ4 A;  1ZSQ A;  4BKT A;  1WI0 A;  2QJL A;  1FHO A;  3DXE A;  1RFK A;  3E9S A;  2RDH A;  2LUM A;  2KOX A;  4AJW A;  2YEP B;  3DBR I;  2DBY A;  4L1R A;  2MWS B;  2CHW A;  4A9A A;  4JGH B;  4FN2 A;  1FOE A;  3DXC A;  1L6U A;  3AEA B;  5EE9 A;  4A6Q A;  4TQ1 A;  2LXC A;  5E6O A;  1C3T A;  3GYP A;  2XEW A;  2XQN M;  2BYT A;  2FCN A;  5AEK B;  4JKA A;  3NHE B;  5J2R A;  2ZNV C;  1IYF A;  1EM7 A;  4HKZ E;  4D2K A;  1V97 A;  2BVC A;  2WNM A;  3LJ3 A;  2PW9 A;  1TQZ A;  4MH8 A;  1BXT A;  5FR3 A;  1T5X D;  4NY0 A;  1EGX A;  5HE1 A;  3SU8 X;  3LXF A;  2COP A;  5D27 A;  2CU3 A;  4TKN A;  1GOZ A;  4IUM B;  4P16 A;  5D3I B;  3CIR B;  1ENF A;  4CSQ A;  2ZNV B;  4ICU A;  2I1K A;  2Y7B A;  2R2O A;  1U5F A;  3L54 A;  4YXD B;  2CS4 A;  4KGS A;  3PZD A;  1WMH B;  1KC7 A;  4EMO A;  1E7P B;  1HE8 A;  4FAD A;  2Y3A A;  2BKF A;  1K8R B;  4NAW A;  2DYQ A;  1JDE A;  4M0W B;  4JIO U;  2EEL A;  4LTU A;  1C78 A;  2DKP A;  1WRD B;  3QHT A;  1LM8 B;  4DBG A;  1ZP0 B;  2MBE A;  3DQV A;  2PTL A;  3KWL A;  2KK8 A;  1KOT A;  1J7A A;  2WX1 A;  3PTF C;  4HAX B;  4RF1 A;  3TVV A;  1UF0 A;  1V86 A;  4MY6 A;  4M01 A;  1KTK A;  3ALB A;  5HE2 A;  4DHZ B;  3PRM B;  4HDQ A;  2N7E A;  2YT0 A;  3AEF B;  3KUD B;  3O65 B;  2FDQ A;  3TMP B;  2LHD A;  4JK9 A;  5H92 C;  5BYR A;  4W9C A;  2ON8 A;  2RPQ A;  3BVG A;  3SFE B;  3SDL C;  4DDG D;  2DA0 A;  4IOY X;  2NMQ A;  2EKE C;  3TSS A;  4HLE A;  2IGD A;  1OQQ A;  3BK1 A;  5J3Y A;  2KDB A;  1U27 A;  3P7Z A;  1U29 A;  2LRU A;  3IVF A;  2KN4 A;  3IG3 A;  1FCL A;  1DDM A;  1H10 A;  4XWT A;  2D07 B;  4M00 A;  4Z2N A;  3NS8 A;  1FNW A;  1EF1 A;  3DBL B;  4ZRQ A;  1DDW A;  2W3S A;  1HZ5 A;  3DXD A;  4BBN F;  3BII D;  1L5P A;  1V80 A;  1GUA B;  1XF5 L;  2FCS A;  2WXQ A;  1SJH D;  2C7M B;  2K2J A;  2MP2 A;  3DPD A;  5C3J B;  4ZRJ A;  2AQ3 B;  3EHV A;  1PFD A;  2Z0P A;  4HSI A;  5T8I A;  4B95 A;  2Y8G A;  2IGG A;  2DAF A;  4KGT A;  5M4Y B;  5DPT A;  2WWZ A;  1TIF A;  2MDX A;  2WXH A;  4GB9 A;  4OSN A;  2VRR B;  3PVW A;  3NVV A;  1IUE A;  1J7B A;  1PQS A;  4ARC A;  2GLS A;  1ISN A;  4F7H A;  5L95 C;  4AWJ A;  2KFJ A;  5DH9 B;  3EUB 2;  3IXS A;  1VZ8 A;  3M62 B;  1LGR A;  1F52 A;  2K00 A;  1DRO A;  3ZNH B;  3B2G A;  2KGX B;  3U30 A;  2IND C;  1D5Z C;  2QDF A;  2K1F A;  4A6H A;  3PS6 A;  2J0K A;  3MPX A;  1TKY A;  4M8N A;  4OVU A;  4HB3 B;  4UDU C;  1GC6 A;  3EGR A;  1V6E A;  1PGB A;  5IN7 A;  3ZNG C;  3VQI A;  1MG4 A;  2B76 B;  3L13 A;  2CY5 A;  4MJS B;  2D5G A;  1PDX A;  4M02 A;  4QJ4 B;  2RRF A;  2IO3 B;  4KZC A;  4DXG A;  1IPG A;  1ST7 A;  1WMH A;  3NWD A;  3ZKJ C;  1XCT L;  1Z5S B;  1MAI A;  4RGO S;  1GPX A;  1ZGU B;  4GXB A;  1WYW B;  4PQ0 A;  4GMX B;  2KIG A;  3ZRC A;  2BPS A;  5FKA C;  4ZRK A;  2Z13 A;  1PGX A;  2NPT B;  3TCA A;  3TEZ A;  5AZF A;  3BZD B;  1X1F A;  1C4C A;  2XK5 A;  3LDZ E;  3N1X C;  4A20 A;  2UYZ B;  4A90 A;  2JF5 A;  4H8S A;  3DHH C;  4WQO B;  4ANW A;  3ULB A;  1WI1 A;  3BVM A;  2EKI A;  3M1I B;  1BML C;  5BMG A;  4WJO A;  4P1C C;  3VH4 B;  4KV2 A;  4GZU A;  2MEK A;  3Q8C A;  2JRI B;  2N7J A;  3RCP A;  3P4R B;  2GUM A;  4HVB A;  4J3O D;  2BBC A;  2FNJ B;  1MFW A;  2OHF A;  2Q5W D;  4EZJ A;  3CIK A;  5DPR A;  3ZXR A;  2JXT A;  4HB2 B;  2DX5 A;  3F5R A;  4RNA A;  2YSZ A;  1I42 A;  3LB8 C;  3FEH A;  4K2P A;  1R4N B;  1P3Q U;  2JZZ A;  1I4P A;  2M0A A;  2I1J A;  4EJN A;  2PLP A;  3AM9 A;  4GDK A;  1UH6 A;  3T3O A;  3TO1 A;  2NTT A;  1UNS A;  3BY4 B;  2WDV B;  2K8B A;  2W9N A;  4M0W A;  3S2A A;  3PVL A;  1ACC A;  3D8D A;  3WYF B;  5E6P A;  4GOC A;  3VTU A;  1UBI A;  2WXI A;  3MJW A;  4AS1 A;  3QX1 A;  3HVZ A;  2L1C A;  1R4N I;  3Q3F A;  3PLV A;  3NZU A;  5DHF B;  2IO2 B;  2GI9 A;  1Z87 A;  1FCC C;  2PZ1 A;  4HPP A;  5G5H A;  3WAP A;  3R66 C;  3MC8 A;  2RSG A;  1FHX A;  2GBM A;  3ECI A;  1WR1 A;  1WZ3 A;  2MKR A;  1C1Y B;  4X57 B;  2WXK A;  4F7U P;  3KUC B;  1NI2 A;  1WGG A;  2Z0Q A;  2PMV A;  4H2A A;  1C76 A;  5IAA C;  4NJC A;  5C23 A;  4XYC A;  2KDM A;  3K9P B;  2DLB A;  4B0E A;  3JVZ X;  4OVZ A;  3AEC B;  2KX0 A;  3OLM D;  5BMI A;  2V76 A;  2LBB A;  1LQB A;  5BO4 B;  4RM9 A;  4K3B A;  4KIK A;  1XT9 B;  3AU4 A;  3NZ3 A;  2QMT A;  1L7Y A;  5HE0 A;  4W9L A;  1WXA A;  3BVZ A;  1K52 A;  1AWE A;  2A4Z A;  3ULC A;  2V0G A;  2K0P A;  1U5E A;  3QWM A;  3N1Y C;  1GB4 A;  1TBE A;  2HJ8 A;  1K51 A;  3TL5 A;  1J19 A;  2JP2 A;  1HBK A;  2IFS A;  3NVZ A;  2N1V A;  2C7N B;  3CXB B;  4XDC A;  2D9Z A;  2HE7 A;  5JVL A;  4HDO A;  1MI1 A;  3IT6 B;  1K50 A;  1NDD A;  2PE9 A;  2NPT A;  4K17 A;  4MT7 A;  1KZG A;  1WXS A;  1S1Q B;  3APF A;  3E56 A;  3TEX A;  2LGI A;  2JUO A;  3GZN B;  3TW1 A;  2L32 A;  4BBN C;  3PSE B;  4TV3 A;  1BUI C;  5MPO A;  2YS3 A;  2QIL A;  4OZA A;  1WGR A;  1ZUD 2;  1QQR A;  5LXH A;  1LW3 A;  4WAF A;  1VBH A;  1RLF A;  1CMX B;  1KLU D;  3DBH I;  3Q14 C;  2LHE A;  2V3N A;  1B1Z A;  1N5W A;  1C4A A;  3RPF C;  3DWM A;  2CRF A;  3TUO A;  4GLS C;  3EA6 A;  4XDD A;  5HHD G;  1D3Z A;  1TS2 A;  1WFY A;  1ZE3 D;  4RMA A;  2KAN A;  1TY2 A;  3AE3 B;  4NPN A;  2KWU B;  4J6I A;  2V4L A;  4C4V B;  2OQB A;  4MK0 A;  2N23 A;  4I6N B;  3RNB C;  4A6K A;  3DBL I;  2RLO A;  1V89 A;  2L0F A;  3QCA A;  3HSA A;  5E6N A;  1SHC A;  4MM3 B;  4ITK A;  4W9E A;  2H7E A;  3VFK A;  3ZXV A;  2LGX A;  3E66 A;  2DAJ A;  2ZVN A;  1MPE A;  5AZH A;  2OJR A;  3VTW A;  2D9V A;  3QIJ A;  4MDK E;  2IYB A;  4WVF B;  1D4B A;  3VUW A;  3A9K A;  5J3Q A;  1MJD A;  4IWQ A;  3AMZ A;  4C80 A;  1VDV A;  3DVG X;  3PVU A;  1R4M I;  4RGM A;  1SSN A;  2MCN B;  3VUY A;  2W3R A;  4BKS D;  1E8W A;  4JKG A;  1WX9 A;  2WU5 B;  4IG7 B;  3RNA C;  2BYV E;  3QQ8 B;  3CSF A;  3RD2 A;  2P0F A;  2DZJ A;  3I3T B;  1DDV A;  4RF0 A;  4NQK E;  2JQR B;  4GGQ A;  1QT9 A;  2ACZ B;  1P98 A;  4CHM A;  2K8E A;  2LUE A;  4EFO A;  4HAU B;  1KRH A;  3B1L X;  2DIK A;  2DHJ A;  1WZ0 A;  4QJ5 B;  1AQC A;  2WX0 A;  1ET6 A;  3G9W A;  1AW7 A;  2K22 A;  4JWS C;  2KDI A;  2K49 A;  1F2R C;  2JPH A;  2FAZ A;  1R7S A;  1YJ1 A;  2G45 B;  1PMS A;  4GNK B;  1X86 A;  1D6E C;  3AEE B;  3PHX B;  3VIA A;  3QAR A;  1OEY J;  4ILH A;  4CO7 A;  3WAN A;  3ZDT A;  1PLS A;  2KNB A;  3ODO A;  1V8C A;  5D3D A;  4EZK A;  2O2V B;  1ROE A;  5D3V A;  2CJN A;  1FB8 A;  2ZJD A;  3A9J A;  1YIW A;  1HTQ A;  4JX1 C;  1RYJ A;  2FJU B;  1L4Z B;  2JRH A;  4HRO A;  3IBE A;  3H1U A;  2L05 A;  4N59 A;  3A4S C;  4CQN A;  4KKI A;  3QC8 B;  2E2X A;  2MSE D;  4W9H A;  2LXA A;  4M8M A;  3AJ4 A;  2PPH A;  4MGZ E;  4YT0 B;  2K3U A;  2W54 A;  3HVD A;  3DOW A;  3GP7 A;  5GMV A;  3MP9 A;  1WYG A;  1NTV A;  2A5U A;  4FUL A;  2MBQ A;  1MHX A;  1TGZ B;  4MGY E;  1E9M A;  3SFD B;  2ZCB A;  4QAY A;  3CF6 E;  4OW0 A;  1SGH A;  3NVY A;  1QKZ A;  3A8P A;  2RR9 A;  2KTR B;  3FM8 C;  2VZK B;  4HRS A;  2Z8L A;  3PT2 B;  3DCG A;  2C9W B;  5C1Z A;  3HIZ A;  5KHQ A;  3ML4 A;  5DPS A;  1SEB D;  4DQO C;  4MGI E;  3HM3 A;  5BYS A;  3ZJV A;  2UZR A;  3ZW3 A;  3SV1 A;  1XEE A;  1IGD A;  2VH2 A;  1V61 A;  1T0Y A;  2GJY A;  1VCB A;  2N1W A;  3UIN B;  3V05 A;  1ZC4 B;  1MVK A;  3M3J A;  2L7R A;  3ENE A;  2C60 A;  1HZ6 A;  1OTR B;  4BKS A;  1EU4 A;  2QIE B;  3EPY A;  1PYW D;  3PZ7 A;  1J8C A;  2LG1 A;  4HAW B;  2BB6 A;  4USA A;  1VRA B;  1WSP A;  5D3Y A;  2KMC A;  4E71 A;  4KIK B;  2IY1 B;  4HXD A;  5AUI A;  2ROV A;  4JKE A;  3IHP C;  2UWQ A;  5DI9 B;  4MAC A;  3NWF A;  1OMW A;  1SE4 A;  2M38 A;  2RVB B;  1SE9 A;  4F7Z A;  2AQ1 B;  3X23 A;  3T9L A;  2GBR A;  3V6C B;  1QOA A;  3ZIM A;  3EFC A;  2CQU A;  1UBQ A;  3Q8E A;  4DHJ B;  1DGJ A;  3ZNZ B;  4GPT B;  1UNR A;  3ZNI D;  1IBX A;  4MSM B;  4AJY B;  1EWC A;  4IM0 A;  2EMT A;  4K7W A;  1F77 A;  1DYN A;  1WGD A;  2OED A;  5CTR C;  1XR0 B;  2D10 A;  3TEW A;  2SAK A;  4IAP A;  3SR6 A;  3EFU A;  3LYY A;  2FIF A;  2X38 A;  2DWQ A;  4ACF A;  5JHA A;  2DZM A;  4C00 A;  3HHM A;  4P7I A;  1WJM A;  3L4P A;  1P0R A;  4WJ7 A;  1Y8R C;  3AB5 A;  1B9R A;  2BWE S;  2KQ4 X;  5E6J A;  4JKG B;  2D4Q A;  4W9J A;  4HAZ B;  4ARI A;  5IJM A;  5BMH A;  4KHB A;  1WGH A;  1X1M A;  1DOX A;  2COA A;  2L3Z A;  4TMA B;  3GS2 A;  3UIO B;  1P3R A;  1VR9 A;  4L2Y A;  2WLB A;  2BCJ A;  1P1A A;  2M0X A;  3L17 A;  4G3X B;  5FK9 C;  3H7S A;  2W2W A;  2IDY A;  4KVG B;  2KD0 A;  4NAW B;  1K5D B;  4ANU A;  1JRP A;  4AOF A;  4L23 A;  4DX9 0;  5D94 A;  3HW2 B;  2KLC A;  4MH0 E;  2GBJ A;  3GE3 C;  3JSV B;  2HTH A;  2G1E A;  3WA0 A;  3RNF C;  3U4E G;  3V61 A;  4KHB B;  2KJH B;  4WWO A;  1DBH A;  1IP9 A;  3HUI A;  2DYN A;  4BZA A;  1TZ1 A;  2FBW B;  2MJ3 A;  5EE1 A;  5BYQ A;  4P6V F;  3VTV A;  1TS5 A;  5JHB A;  4AP4 C;  2WDQ B;  4A3P A;  3L0W B;  2M19 A;  4EKU A;  2ABD A;  4HB0 B;  4W9K A;  3W1S A;  2NBW B;  3A58 A;  3L16 A;  3KY9 A;  3L08 A;  4D0N B;  4PS7 A;  2MQJ A;  3OAW A;  2B3A A;  3AI5 A;  2P0D A;  2LFI A;  3GB1 A;  4LNI A;  1FIQ A;  2FCM A;  2YF0 A;  1MG8 A;  2KCJ A;  1OY2 A;  3O13 A;  5FR6 A;  1GJZ A;  1Q1O A;  2JU6 X;  1W1G A;  1KBL A;  2I2Y A;  3V62 A;  5FI0 A;  1DOI A;  3RCZ A;  2IJ0 A;  3BYY B;  2Z4D A;  1FD6 A;  2KYW A;  2NR2 A;  2ZCC A;  5IOI A;  5HKH A;  4S0R A;  3ZVR A;  2R2Y A;  1V1P B;  4AQ7 A;  1UGM A;  1UEF A;  3UQB A;  3DBH B;  2VRW B;  4I6L B;  3RMK C;  2QKL A;  2R0D A;  1YJJ A;  1QF6 A;  1WF9 A;  1WJ1 A;  3AE9 B;  3RFZ B;  2LD9 A;  4DHJ D;  4D6W A;  1EUV B;  4GOU A;  3A33 B;  2KFK B;  1IBX B;  2RPV A;  1M7R A;  2JWZ A;  4URK A;  2BWF A;  2N4F A;  4NJ7 A;  1YD8 U;  1Z2M A;  3N7C A;  3QBV B;  1YJI A;  2GOW A;  3CWI A;  2KO3 A;  4TSS A;  2DX1 A;  3VHT C;  2NBU A;  2MWN B;  1SE2 A;  2PIA A;  3SBT A;  1D5M C;  1E90 A;  3A8Q A;  3KH0 A;  4ZYN A;  4HCP B;  3WCQ A;  4S17 A;  2CR5 A;  4KSL C;  3ZRF A;  2O6V A;  3WAL A;  3CST A;  1VLB A;  2WXL A;  2QCZ A;  4RCO A;  1E8Z A;  2Z14 A;  2DEN B;  1I2H A;  1ZXH A;  5HE3 A;  2N0S B;  2MJD A;  2V1Y A;  3HM6 X;  2UVM A;  1W1H A;  1YNT E;  2GRI A;  4MM3 A;  4ZHO A;  5HG2 A;  5C5B B;  1E8Y A;  2KQS A;  2PEA A;  4L6E A;  2JT4 B;  3HRD D;  2RDB C;  5C6R A;  3E9P A;  1W1D A;  4FHK A;  3A1Q A;  4ZYS A;  2KIE A;  1E5W A;  3QA8 A;  4DHZ E;  2WXJ A;  2NTS A;  2O6V B;  3PZ8 A;  4REZ A;  2FUG 1;  1WXQ A;  3AH7 A;  2G4S A;  4N58 A;  2Z59 A;  4KDL B;  4NAM A;  2KVR A;  1YN4 A;  2WXR A;  4XE0 A;  2REX A;  1KJT A;  1WM3 A;  1L0Y B;  1SBB B;  3UIP B;  1GG3 A;  4KSK C;  4IWO A;  3KUZ A;  3U8Z A;  2O6V D;  3JYU A;  3APC A;  3VRA B;  2KDE B;  2L52 A;  5G5G A;  2KFK A;  1RM6 C;  2R82 A;  2KJ6 A;  4F1S A;  3BK2 A;  1MPH A;  2YEP F;  3W5U B;  2J0M A;  1FGY A;  3FLV A;  3P63 A;  2W82 A;  4WJQ A;  4JK8 A;  2JYE A;  3OG5 A;  2NCN A;  4NZL B;  4WAA A;  4ASW C;  3FIL B;  2VSZ A;  4XGA B;  3AE1 B;  3A9K B;  1ZDX A;  2KC1 A;  3AED B;  4HJK A;  3V5W A;  3KWV A;  2JSV X;  4ILJ A;  3NRZ A;  2MHJ A;  4Z2M B;  3BWU D;  2YVC A;  1T0R C;  2D3C A;  1FFV A;  1HTO A;  2HRJ A;  1NU2 A;  2CY4 A;  1NYQ A;  2ELA A;  4FJV B;  2Y8F A;  4HCN B;  2QHO A;  3APD A;  2IZV B;  4ANX A;  2D9Y A;  2KXJ A;  1YN5 A;  2LEK A;  1ZVR A;  2V3S A;  1R4M B;  1S3S G;  2GBN A;  1VZ6 A;  2D3A A;  2J7Q B;  3IAM 1;  3KLS X;  4BFR A;  5JHH A;  1Y5O A;  5LLI A;  2L00 B;  3ZJU A;  2ICI A;  2J4X A;  3FSS A;  3GYO A;  3RUI B;  2H88 B;  3KW5 B;  1GC7 A;  2K5P A;  2INC C;  5HI1 A;  1XKE A;  3H7P A;  4P1B C;  2DZK A;  1NBF C;  1UNQ A;  2FUH B;  4IM3 A;  3VR8 B;  3R7Q A;  2ONQ A;  4DK5 A;  2O2V A;  2RD0 A;  3VUX A;  1JCK B;  1E8X A;  1FFU A;  1I4Q A;  3RNG C;  4K2O A;  2NMB A;  3P4P B;  3KQ4 A;  4TUU A;  1P5T A;  1BAK A;  3MHS D;  4K3C A;  3ODX A;  4YTN B;  1WGK A;  3Q8B A;  2Q13 A;  5JHG A;  2YS5 A;  2G3Q B;  1RFA A;  1V1O A;  1VD2 A;  3NJT A;  2AL6 A;  3AE4 B;  4GIV A;  4DXF A;  1E7V A;  5CLL B;  5C79 A;  3PEG A;  1FEH A;  2LVQ A;  3ABV B;  1GAQ B;  1RWS A;  3VDZ A;  3M63 B;  4PK1 A;  2VH1 A;  1FXI A;  2IBI B;  5C2T B;  5IKC M;  2M1M A;  5DHA B;  2LI5 A;  4PS3 A;  4W9I A;  3NUH B;  1P7E A;  2G35 A;  4XX5 A;  4GSW A;  1WG7 A;  1X1G A;  1ZW7 A;  4KHO A;  3L10 B;  5HFY A;  5LXI B;  3HQC A;  5CLQ B;  1WH3 A;  2CKH B;  3T8M A;  4LK0 M;  2GBK A;  2K25 A;  2EJ8 A;  2R09 A;  3I9V 1;  1FNV A;  5C5B A;  2D11 A;  2MW5 A;  3WIM A;  2MP2 B;  2XBB C;  1IGC A;  3M95 A;  4PT5 A;  3PSC A;  3UI3 A;  1G6J A;  4B6H A;  3Q6B A;  4ZRI A;  2D3B A;  4B0M A;  1M94 A;  4IFS A;  2KMM A;  1F2R I;  1JRU A;  1CZP A;  3NY5 A;  2XN9 C;  4A55 A;  3UF8 A;  4PNK A;  1V81 A;  3B2F A;  1TKG A;  1HB6 A;  2W55 A;  3X0W A;  1E10 A;  1JWA D;  3Q8F A;  1MI0 A;  2V3P A;  4R3D A;  3ZO5 B;  2DYO A;  2LZ6 A;  4EE2 A;  4OVV A;  1OGW A;  3P4Q B;  2J59 M;  3NS1 A;  2Z0D B;  2GB1 A;  2LVP A;  2MLB A;  1ZXI A;  5I4D A;  1XCQ L;  3OHM B;  1TJE A;  1WWT A;  2NZ8 B;  4KGR A;  4XC2 A;  5JZE B;  2GS0 A;  2LOX A;  4GDL B;  2X18 A;  1N62 A;  1WGU A;  3DVG Y;  1JAL A;  4DDI D;  2LJ5 A;  1DIK A;  4WQM A;  2DLW A;  1WIA A;  2ROZ B;  3ML8 A;  4L1B A;  3MHZ A;  3SNH A;  3RNE C;  2COD A;  2LVO A;  1IRS A;  2X0S A;  4FJY A;  2YT2 A;  2WXM A;  4LLG M;  1SIF A;  1MIX A;  4MSQ B;  2DNF A;  2NBV A;  2ZPN A;  3PHW B;  2BYE A;  1MHH E;  1V5T A;  3FC4 A;  2MRP A;  3KYD D;  1WXM A;  4IC7 B;  2K2U A;  4WIP A;  1KLG D;  1I4R A;  4F8C B;  3E9L A;  2N7D A;  5GOW B;  4BOZ B;  5I2S A;  3ZYY X;  3AE6 B;  3NWA A;  4JE3 B;  1NVI D;  4DBB A;  5I2M A;  3JSV A;  1WJN A;  5LG4 B;  4A6F A;  5KQ1 A;  3AXC A;  3UGB B;  4FA6 A;  4QJ3 B;  2C7H A;  3B77 A;  2KR0 A;  2WH5 A;  1E7U A;  1YOV B;  2IYD B;  3A4R A;  5J18 A;  4F7G A;  3B9J A;  1SB3 C;  4NQL B;  1X05 A;  2KAC A;  1WE6 A;  2LJI A;  2K39 A;  3DVN V;  1ZKH A;  5KQ4 A;  2J52 A;  3AU5 A;  4WSF A;  1FO4 A;  4G11 A;  2L1A A;  4WH4 A;  2WS3 B;  4A8X C;  2CJO A;  3P42 A;  1N63 A;  2BGF A;  4FBJ B;  2OOB B;  2WXO A;  2COF A;  2OJW A;  2N0Y A;  3WAM A;  5JLJ B;  2KVZ A;  3FAH A;  2IY0 B;  3ETR A;  2E6X A;  2WXP A;  4HKQ A;  2KMA A;  1V5U A;  1TZO A;  4RGT A;  1KI1 B;  3RT3 B;  3N30 A;  4IDI A;  3KRX A;  4MEM A;  5EDS A;  1T0Q C;  3ZQ4 A;  1FAO A;  1QOF A;  2M8S A;  2BT6 A;  2DX5 B;  1I35 A;  2K6D B;  5L83 A;  4II3 B;  1T0S C;  4DIX A;  2RMM A;  1UNP A;  2OTX A;  3KRW A;  1WGQ A;  1SJE D;  1LO5 D;  2D3G A;  4PS8 A;  5AZG A;  2VZK D;  4CYE A;  2LAS A;  2LGD A;  1I4X A;  1V1P A;  1F0Z A;  1QOG A;  2MA9 B;  2LRW A;  5LOP B;  2WYQ A;  3U12 A;  4ZRP A;  3U7Z A;  2KC2 A;  2HDE A;  5D3X A;  3TFM A;  4NJ6 A;  5JH5 C;  3ZDM C;  3TEY A;  1SE3 A;  4XWW A;  3Q69 A;  4ZOH C;  2I38 A;  4GMV A;  1EVH A;  2JXX A;  3KSY A;  3TBL D;  1DYQ A;  3E9O A;  2RGF A;  2MJE A;  4LDT B;  2K8H A;  3RYT A;  2HTM E;  2KLG A;  1T77 A;  3FKY A;  3BIN A;  4Y94 A;  3PP2 A;  1JML A;  2PE6 B;  1EWY C;  2RQ1 A;  4CHJ A;  2AQ2 B;  2E3T A;  1KH0 A;  3PPA A;  1T6B X;  2DKQ A;  3AE7 B;  4RM8 A;  1ZM0 A;  1WJ4 A;  1YX6 B;  4JWU C;  1NYR A;  5CHV C;  3KZ1 A;  1WRI A;  4FLH A;  2UU7 A;  2DYB A;  5TR5 A;  3T3N A;  4BOS C;  3V60 A;  2RDG A;  2PVG C;  4HPL B;  3RN9 C;  2G9H D;  2WDT B;  1JWS D;  1SF0 A;  3W5V B;  2KKC A;  3F0W A;  2IGH A;  4PYU A;  5EFX A;  4LJP B;  1UPQ A;  1J0W A;  4C0A A;  2JY6 A;  2P0H A;  1EF5 A;  1NEK B;  1OQN A;  2UZS A;  1UWX A;  1WJU A;  3B0A A;  1FPY A;  1H4R A;  2MFQ A;  3FP5 A;  3U2S C;  2BQQ A;  2N9X A;  3ENB A;  1GGO A;  4G50 A;  2RGN B;  3SD5 A;  1TJ6 A;  1UPR A;  1MK7 B;  1FGZ A;  3T06 A;  3Q2A C;  4JPS A;  4YSX B;  1XD4 A;  1TKE A;  1UD7 A;  3AUL A;  1OQR A;  2N9L A;  1U2B A;  1VBG A;  1NEN B;  3Q3M C;  1LXD A;  4W9F A;  1WVH A;  2D9W A;  3I63 C;  4K7S A;  2QC8 A;  1HQR D;  4LJO B;  2ZZP B;  2NS5 A;  3ZLZ A;  1N6Z A;  1XXG A;  1N3H A;  1ACA A;  1H8C A;  2LGS A;  3HIE A;  2YT1 A;  1WX7 A;  3ZTC A;  2MBH A;  3EEC A;  3DCX A;  3MC0 B;  5C16 A;  3KYC D;  5D2M B;  1Q5W B;  3UZT A;  2L8J A;  1HB8 A;  1TS3 A;  3DWG C;  3JW0 X;  3H8H A;  4WJN A;  2BS4 B;  2ZW0 A;  4HHV A;  1N61 A;  1AYF A;  1TT5 B;  3C0R B;  2ADZ A;  2BTE A;  1UZX B;  2KX3 A;  2P8V A;  2HJ1 A;  4MT5 A;  4AUQ C;  2FJL A;  1P9D U;  3VXW A;  4B6W A;  2N9E B;  1ZC3 B; 
#chains in the Genus database with same CATH homology
 2ZEQ A;  3SBG A;  2DTC A;  3H9D A;  3NZS A;  2L2I A;  2FJ9 A;  3DVN U;  2PJH A;  3RUL A;  3VOQ A;  4HAT B;  3OJ3 A;  5G2N A;  5FI1 A;  3TIX A;  1V49 A;  1AAR A;  3VH3 B;  1RRB A;  1XX0 A;  1B55 A;  4DX8 A;  1WXV A;  3R7R A;  3VAW A;  2RSU A;  4JK7 A;  3VVW B;  1YX5 B;  2CHX A;  2HD5 B;  4XWX A;  3NOB A;  2YS1 A;  4LDT D;  4EOY A;  2AEH A;  2MBO A;  1FHW A;  4GDL A;  1BTK A;  2L0T A;  3N3K B;  3PGE A;  2DHZ A;  2M17 A;  1Q0W B;  2COC A;  5J17 A;  3HK0 A;  3ZUN A;  4EEW A;  4W9G A;  4YL8 A;  3RZF A;  1V5P A;  1XOD A;  2MX2 A;  4FJZ A;  5LON B;  3VUW A;  3P2B A;  2LKO A;  4IWP A;  1TTN A;  2CAY A;  2FID A;  1RJ2 A;  4II2 B;  1M7E A;  3IFW B;  4KDI C;  3DBS A;  2HTH B;  4NSW A;  4TYZ A;  4DWF A;  4KHA A;  2EC1 A;  4HWI B;  4TQ0 A;  4A5K A;  2W2X D;  3OAN A;  4K81 A;  2IO0 B;  2IO1 B;  2QKM A;  2AYO B;  2LOZ A;  2KWC A;  2LWP A;  2D2Q A;  3PRE A;  2CHZ A;  1V9J A;  2KJR A;  1X11 A;  1NVL A;  3KVF B;  1KLV A;  3U7D A;  4A3O A;  2KTR A;  2BKR B;  5D3W A;  3PRP B;  2KHW B;  2YRY A;  3OJ4 B;  1NTI A;  2DFK A;  2Z0O A;  2K6Q A;  5DIF B;  2KN5 A;  4BKG A;  4E74 A;  1Q67 A;  5D7G A;  1RAX A;  2DYM A;  2JZ3 B;  3GZN I;  1RRP B;  5CX3 A;  2W2X C;  1BTN A;  1I7A A;  5D6J B;  1LFD A;  1F9J A;  3TJP A;  4DXA B;  4HB4 B;  3A1Q B;  4WJP A;  1FXT B;  2ZVO A;  4JKB A;  1YQB A;  2KTF A;  1QZE A;  2Z59 B;  2LUL A;  1XD3 B;  2GCL A;  2M4N A;  3QK0 A;  1QQG A;  4FHJ A;  4I6P A;  5KCV A;  1J0G A;  3PLU A;  3B08 A;  3PG7 A;  1U4A A;  1WGY A;  4K7U A;  4HAY B;  3CMM B;  1OQY A;  4KAX B;  2AWT A;  1U5G A;  2N9P C;  5CHF A;  5G55 A;  4GU2 A;  1WM2 A;  4MEL A;  2NVU I;  2MBB B;  4XZ4 A;  3H6N A;  4WWP A;  3Q3J A;  2H7D A;  4JL9 A;  4JKC A;  3D8F A;  3ONS A;  3ODW A;  2JVC A;  5IA7 A;  1EAZ A;  2KWV B;  1UEL A;  2K8C A;  1V2Y A;  4K1R B;  1TXD A;  2ZPY A;  2GMI C;  3SUZ A;  3NSU A;  4N9F 4;  5J3T A;  4EZL A;  4LCD E;  2CB8 A;  2M14 A;  4GDK B;  1KZ7 A;  1XCG A;  2G4D B;  1BWN A;  1A5R A;  1WE7 A;  3D8E A;  1BT0 A;  5DCN A;  3A98 B;  2XK5 B;  1QC6 A;  2L76 A;  5JP4 A;  2BYF A;  2C5L C;  1MK9 B;  4HK2 A;  4JKF A;  3SYX A;  3SO6 A;  4WWN A;  4A6F B;  3P6A A;  3N32 A;  3GOE A;  3PV1 A;  4MGK E;  3R3M A;  1U5D A;  3QWZ B;  2RUK B;  4YON A;  3V6E B;  2DHK A;  2D9X A;  2RNR B;  4EUT A;  3D32 A;  4KZ0 A;  4ICV A;  5DPW A;  3A9J B;  2DN6 A;  3ML9 A;  2CU1 A;  2NBV B;  2GCJ A;  3W1Y A;  4B9K A;  5CHW A;  4NNJ B;  3WAO A;  2LGY A;  1WX8 A;  1K5G B;  5L81 A;  2KZR A;  1EO6 A;  2KQ7 A;  3EC8 A;  2DHI A;  4HPM B;  3MDB C;  4IM2 A;  1WJ6 A;  4HAV B;  2R2Q A;  2KUP A;  1PFJ A;  3K9O B;  3ZVV A;  1WR6 E;  1Y19 B;  4G0N B;  4CHK A;  2YLM A;  3DDC B;  4W9D A;  4PYZ A;  1GNU A;  2EMS A;  1V88 A;  4JLC A;  4ILG B;  3O96 A;  2BF8 B;  4ANV A;  4JQW C;  4IW0 A;  4JKH A;  3ZTD A;  2I5F A;  4JKD A;  3UQA A;  2DZI A;  1XQQ A;  4MJS A;  3BJI A;  1LB1 A;  1L2N A;  2ELB A;  4BVU C;  4E3C A;  2FCQ A;  4ZDV A;  5KHO A;  2ASQ A;  2I5C A;  1P6S A;  3RZW C;  3LJU X;  2LYD A;  2KDF B;  1V5M A;  2J0J A;  1MIZ B;  4BBK A;  3W1S C;  3QAQ A;  1KM7 A;  1WY8 A;  4GN1 A;  1OEY A;  3H7P B;  2VKI A;  3SHQ A;  3MTN B;  1V5O A;  1NTY A;  2AL3 A;  2Z0E B;  2Y5B B;  3PRZ A;  3QJZ A;  1MKE A;  1ZSQ A;  4BKT A;  1WI0 A;  1FHO A;  3DXE A;  2KOX A;  4AJW A;  3DBR I;  2MWS B;  2CHW A;  4JGH B;  4FN2 A;  1FOE A;  3DXC A;  4TQ1 A;  2LXC A;  5E6O A;  1C3T A;  3GYP A;  2XEW A;  2XQN M;  5AEK B;  2FCN A;  4JKA A;  3NHE B;  5J2R A;  2ZNV C;  1IYF A;  3LJ3 A;  1TQZ A;  4NY0 A;  1EGX A;  5HE1 A;  3SU8 X;  2COP A;  5D27 A;  4IUM B;  4TKN A;  2ZNV B;  4ICU A;  2I1K A;  2Y7B A;  2R2O A;  1U5F A;  3L54 A;  2CS4 A;  3PZD A;  1WMH B;  1KC7 A;  4EMO A;  1HE8 A;  4FAD A;  2BKF A;  1K8R B;  4NAW A;  2DYQ A;  1JDE A;  4M0W B;  4JIO U;  2DKP A;  1WRD B;  3QHT A;  1LM8 B;  4DBG A;  2MBE A;  3DQV A;  2KK8 A;  1KOT A;  2WX1 A;  3PTF C;  4HAX B;  3TVV A;  1V86 A;  4MY6 A;  3ALB A;  5HE2 A;  4DHZ B;  3PRM B;  4HDQ A;  2N7E A;  2YT0 A;  3KUD B;  3O65 B;  2FDQ A;  3TMP B;  4JK9 A;  4W9C A;  2RPQ A;  3SDL C;  4DDG D;  2DA0 A;  4IOY X;  2EKE C;  4HLE A;  5J3Y A;  2KDB A;  1U27 A;  3P7Z A;  1U29 A;  2LRU A;  3IVF A;  3IG3 A;  1DDM A;  1H10 A;  2D07 B;  4Z2N A;  3NS8 A;  1EF1 A;  1DDW A;  4BBN F;  3DXD A;  1V80 A;  1GUA B;  2FCS A;  2C7M B;  2K2J A;  2MP2 A;  3DPD A;  4ZRJ A;  3EHV A;  2Z0P A;  4B95 A;  2Y8G A;  2DAF A;  5DPT A;  2WWZ A;  2MDX A;  4GB9 A;  2VRR B;  3PVW A;  1PQS A;  1ISN A;  4F7H A;  5L95 C;  4AWJ A;  2KFJ A;  5DH9 B;  3M62 B;  2K00 A;  1DRO A;  3ZNH B;  2KGX B;  3U30 A;  2K1F A;  4A6H A;  3PS6 A;  2J0K A;  3MPX A;  4M8N A;  4OVU A;  4HB3 B;  1GC6 A;  1V6E A;  3ZNG C;  3VQI A;  3L13 A;  2CY5 A;  4MJS B;  2IO3 B;  4KZC A;  1IPG A;  1ST7 A;  1WMH A;  3ZKJ C;  1Z5S B;  1MAI A;  1ZGU B;  4GXB A;  1WYW B;  4PQ0 A;  4GMX B;  3ZRC A;  2BPS A;  4ZRK A;  2NPT B;  3TCA A;  5AZF A;  1X1F A;  2XK5 A;  3LDZ E;  4A20 A;  2UYZ B;  2JF5 A;  4H8S A;  4WQO B;  4ANW A;  3ULB A;  1WI1 A;  3M1I B;  4WJO A;  3VH4 B;  4KV2 A;  4GZU A;  2JRI B;  3RCP A;  4HVB A;  2FNJ B;  4EZJ A;  3CIK A;  5DPR A;  1I42 A;  4HB2 B;  2DX5 A;  3F5R A;  2YSZ A;  3FEH A;  4K2P A;  1P3Q U;  2JZZ A;  2I1J A;  4EJN A;  4GDK A;  1UH6 A;  3TO1 A;  3BY4 B;  2K8B A;  2W9N A;  3S2A A;  3PVL A;  3D8D A;  3WYF B;  5E6P A;  4GOC A;  3VTU A;  1UBI A;  3MJW A;  3QX1 A;  2L1C A;  1R4N I;  3Q3F A;  3PLV A;  3NZU A;  5DHF B;  2IO2 B;  1Z87 A;  2PZ1 A;  3WAP A;  3R66 C;  2RSG A;  1FHX A;  2GBM A;  3ECI A;  1WR1 A;  1WZ3 A;  2MKR A;  1C1Y B;  4X57 B;  3KUC B;  4F7U P;  1NI2 A;  1WGG A;  2Z0Q A;  5IAA C;  5C23 A;  3K9P B;  3JVZ X;  2KX0 A;  3OLM D;  2V76 A;  2LBB A;  1LQB A;  5BO4 B;  4RM9 A;  4KIK A;  1XT9 B;  3AU4 A;  1L7Y A;  5HE0 A;  4W9L A;  1WXA A;  1AWE A;  2A4Z A;  3ULC A;  1U5E A;  3QWM A;  1TBE A;  2HJ8 A;  3TL5 A;  1J19 A;  2JP2 A;  1HBK A;  2IFS A;  2N1V A;  2C7N B;  3CXB B;  2D9Z A;  2HE7 A;  5JVL A;  4HDO A;  1NDD A;  2PE9 A;  2NPT A;  4K17 A;  4MT7 A;  1KZG A;  1S1Q B;  3APF A;  1WXS A;  2JUO A;  3TW1 A;  4BBN C;  3PSE B;  4TV3 A;  2YS3 A;  1WGR A;  5LXH A;  1LW3 A;  1VBH A;  1RLF A;  1CMX B;  3DBH I;  2CRF A;  1D3Z A;  1WFY A;  4RMA A;  2KAN A;  4NPN A;  2KWU B;  4J6I A;  2V4L A;  2OQB A;  4MK0 A;  2N23 A;  4I6N B;  4A6K A;  3DBL I;  2RLO A;  1V89 A;  2L0F A;  3QCA A;  5E6N A;  1SHC A;  3VFK A;  4W9E A;  2H7E A;  2LGX A;  3E66 A;  2DAJ A;  2ZVN A;  5AZH A;  2OJR A;  3VTW A;  2D9V A;  3QIJ A;  4MDK E;  2IYB A;  4WVF B;  3A9K A;  5J3Q A;  4IWQ A;  3DVG X;  3PVU A;  1R4M I;  2MCN B;  3VUY A;  4BKS D;  1E8W A;  4JKG A;  1WX9 A;  4IG7 B;  2BYV E;  3QQ8 B;  3CSF A;  3RD2 A;  2P0F A;  2DZJ A;  3I3T B;  1DDV A;  4NQK E;  4GGQ A;  1P98 A;  4CHM A;  2LUE A;  4EFO A;  4HAU B;  3B1L X;  2DIK A;  2DHJ A;  1WZ0 A;  1AQC A;  2WX0 A;  3G9W A;  2KDI A;  2JPH A;  2FAZ A;  1YJ1 A;  2G45 B;  1PMS A;  1X86 A;  3PHX B;  3VIA A;  3QAR A;  1OEY J;  4ILH A;  4CO7 A;  3WAN A;  3ZDT A;  1PLS A;  2KNB A;  3ODO A;  4EZK A;  2O2V B;  5D3V A;  1FB8 A;  2ZJD A;  3A9J A;  1YIW A;  2JRH A;  3IBE A;  3H1U A;  2L05 A;  3A4S C;  3QC8 B;  2E2X A;  2MSE D;  4W9H A;  2LXA A;  4M8M A;  3AJ4 A;  2PPH A;  4MGZ E;  3DOW A;  5GMV A;  1NTV A;  2A5U A;  4FUL A;  2MBQ A;  1TGZ B;  4MGY E;  2ZCB A;  3CF6 E;  1SGH A;  3A8P A;  2RR9 A;  2KTR B;  3FM8 C;  3PT2 B;  3DCG A;  2C9W B;  5C1Z A;  3HIZ A;  5KHQ A;  3ML4 A;  5DPS A;  4MGI E;  3HM3 A;  2UZR A;  3ZW3 A;  3SV1 A;  1V61 A;  1T0Y A;  2GJY A;  1VCB A;  2N1W A;  3UIN B;  1ZC4 B;  3M3J A;  2L7R A;  3ENE A;  2C60 A;  1OTR B;  4BKS A;  3EPY A;  1J8C A;  2LG1 A;  4HAW B;  5D3Y A;  2KMC A;  4E71 A;  4KIK B;  2IY1 B;  4HXD A;  2ROV A;  4JKE A;  3IHP C;  2UWQ A;  5DI9 B;  1OMW A;  2M38 A;  2RVB B;  1SE9 A;  4F7Z A;  3X23 A;  3T9L A;  2GBR A;  3V6C B;  3ZIM A;  2CQU A;  1UBQ A;  4DHJ B;  3ZNZ B;  4GPT B;  1UNR A;  3ZNI D;  4MSM B;  4AJY B;  4IM0 A;  2EMT A;  4K7W A;  1DYN A;  1WGD A;  5CTR C;  1XR0 B;  2D10 A;  4IAP A;  3EFU A;  2FIF A;  5JHA A;  2DZM A;  3HHM A;  4P7I A;  1WJM A;  1P0R A;  4WJ7 A;  1Y8R C;  2BWE S;  4JKG B;  2D4Q A;  4W9J A;  4HAZ B;  5IJM A;  1WGH A;  1X1M A;  2COA A;  2L3Z A;  3UIO B;  1P3R A;  2BCJ A;  1P1A A;  2M0X A;  3L17 A;  4G3X B;  3H7S A;  2W2W A;  4KVG B;  2KD0 A;  4NAW B;  1K5D B;  4ANU A;  4AOF A;  4DX9 0;  5D94 A;  3HW2 B;  2KLC A;  4MH0 E;  2GBJ A;  3JSV B;  2HTH A;  3WA0 A;  3V61 A;  4KHB B;  2KJH B;  4WWO A;  1DBH A;  1IP9 A;  2DYN A;  1TZ1 A;  3VTV A;  5JHB A;  4AP4 C;  4A3P A;  3L0W B;  3W1S A;  4EKU A;  2ABD A;  4HB0 B;  4W9K A;  2NBW B;  3L16 A;  3KY9 A;  3L08 A;  4D0N B;  4PS7 A;  2MQJ A;  3OAW A;  2B3A A;  3AI5 A;  2P0D A;  2FCM A;  2YF0 A;  1MG8 A;  2KCJ A;  1OY2 A;  5FR6 A;  1GJZ A;  1Q1O A;  1W1G A;  1KBL A;  3V62 A;  5FI0 A;  3RCZ A;  2NR2 A;  2ZCC A;  5HKH A;  3ZVR A;  1UGM A;  1UEF A;  3UQB A;  2VRW B;  4I6L B;  2QKL A;  2R0D A;  1WF9 A;  1WJ1 A;  2LD9 A;  4DHJ D;  1EUV B;  3A33 B;  2KFK B;  1M7R A;  2JWZ A;  4URK A;  2BWF A;  2N4F A;  4NJ7 A;  1YD8 U;  1Z2M A;  3N7C A;  3QBV B;  2GOW A;  2KO3 A;  2DX1 A;  3VHT C;  2NBU A;  2MWN B;  3SBT A;  1E90 A;  3KH0 A;  3A8Q A;  4ZYN A;  4HCP B;  2CR5 A;  4KSL C;  3ZRF A;  2O6V A;  3WAL A;  3CST A;  1E8Z A;  2DEN B;  1I2H A;  5HE3 A;  2V1Y A;  3HM6 X;  2UVM A;  1W1H A;  4MM3 A;  5C5B B;  1E8Y A;  2KQS A;  2PEA A;  4L6E A;  2JT4 B;  5C6R A;  3E9P A;  1W1D A;  4FHK A;  3A1Q A;  1E5W A;  3QA8 A;  4DHZ E;  2O6V B;  2G4S A;  4KDL B;  2KVR A;  2REX A;  1KJT A;  1WM3 A;  3UIP B;  1GG3 A;  4KSK C;  4IWO A;  3KUZ A;  3U8Z A;  2O6V D;  3JYU A;  3APC A;  2KDE B;  2KFK A;  2R82 A;  2KJ6 A;  4F1S A;  1MPH A;  2J0M A;  1FGY A;  3FLV A;  4WJQ A;  4JK8 A;  2NCN A;  4WAA A;  4ASW C;  2VSZ A;  3A9K B;  2KC1 A;  4HJK A;  3V5W A;  4ILJ A;  4Z2M B;  2YVC A;  2HRJ A;  1NU2 A;  2CY4 A;  2ELA A;  4FJV B;  2Y8F A;  4HCN B;  2QHO A;  3APD A;  2IZV B;  4ANX A;  2D9Y A;  2KXJ A;  1ZVR A;  2V3S A;  1S3S G;  2GBN A;  2J7Q B;  4BFR A;  5JHH A;  1Y5O A;  5LLI A;  2L00 B;  3FSS A;  3GYO A;  3RUI B;  3KW5 B;  1GC7 A;  1XKE A;  3H7P A;  2DZK A;  1NBF C;  1UNQ A;  2FUH B;  4IM3 A;  3R7Q A;  4DK5 A;  2O2V A;  2RD0 A;  3VUX A;  1E8X A;  4K2O A;  2NMB A;  4TUU A;  1P5T A;  1BAK A;  3MHS D;  3ODX A;  2Q13 A;  5JHG A;  2YS5 A;  2G3Q B;  1RFA A;  1VD2 A;  2AL6 A;  4GIV A;  1E7V A;  5CLL B;  5C79 A;  3PEG A;  2LVQ A;  3VDZ A;  3M63 B;  2IBI B;  2M1M A;  5DHA B;  2LI5 A;  4PS3 A;  4W9I A;  4XX5 A;  2G35 A;  4GSW A;  1WG7 A;  1X1G A;  1ZW7 A;  4KHO A;  3L10 B;  5LXI B;  3HQC A;  5CLQ B;  1WH3 A;  2CKH B;  3T8M A;  2GBK A;  2K25 A;  2EJ8 A;  2R09 A;  5C5B A;  2D11 A;  2MW5 A;  3WIM A;  2MP2 B;  2XBB C;  3M95 A;  3PSC A;  1G6J A;  4B6H A;  4ZRI A;  1M94 A;  4IFS A;  1JRU A;  3NY5 A;  3UF8 A;  4PNK A;  1V81 A;  1HB6 A;  3X0W A;  3ZO5 B;  2DYO A;  2LZ6 A;  4OVV A;  1OGW A;  2J59 M;  2Z0D B;  2LVP A;  2MLB A;  2NZ8 B;  4XC2 A;  5JZE B;  2GS0 A;  2LOX A;  4GDL B;  2X18 A;  1WGU A;  3DVG Y;  4DDI D;  2LJ5 A;  1DIK A;  2DLW A;  1WIA A;  2ROZ B;  3ML8 A;  3SNH A;  2COD A;  2LVO A;  1IRS A;  2X0S A;  4FJY A;  1SIF A;  1MIX A;  4MSQ B;  2ZPN A;  3PHW B;  2BYE A;  1V5T A;  2MRP A;  3KYD D;  1WXM A;  4IC7 B;  2K2U A;  4F8C B;  3E9L A;  2N7D A;  5GOW B;  4BOZ B;  4DBB A;  3JSV A;  1WJN A;  4A6F A;  5KQ1 A;  3AXC A;  3UGB B;  4FA6 A;  2C7H A;  2WH5 A;  1E7U A;  2IYD B;  3A4R A;  5J18 A;  4F7G A;  4NQL B;  1X05 A;  1WE6 A;  2K39 A;  3DVN V;  1ZKH A;  5KQ4 A;  3AU5 A;  4WSF A;  4G11 A;  2BGF A;  4FBJ B;  2OOB B;  2COF A;  2N0Y A;  3WAM A;  5JLJ B;  2IY0 B;  2KMA A;  1V5U A;  1KI1 B;  3RT3 B;  3N30 A;  3KRX A;  4MEM A;  5EDS A;  1FAO A;  2M8S A;  2DX5 B;  1I35 A;  2K6D B;  5L83 A;  4II3 B;  1UNP A;  2OTX A;  3KRW A;  1WGQ A;  2D3G A;  4PS8 A;  5AZG A;  4CYE A;  2LAS A;  2LGD A;  2MA9 B;  2LRW A;  5LOP B;  2WYQ A;  2KC2 A;  5D3X A;  3TFM A;  4NJ6 A;  5JH5 C;  3ZDM C;  4GMV A;  1EVH A;  2JXX A;  3KSY A;  3TBL D;  3E9O A;  2RGF A;  4LDT B;  2K8H A;  3RYT A;  2KLG A;  3BIN A;  4Y94 A;  3PP2 A;  2PE6 B;  2RQ1 A;  4CHJ A;  3PPA A;  2DKQ A;  4RM8 A;  1ZM0 A;  1WJ4 A;  1YX6 B;  5CHV C;  3KZ1 A;  4FLH A;  2DYB A;  5TR5 A;  4BOS C;  3V60 A;  4HPL B;  2WDT B;  2KKC A;  3F0W A;  4PYU A;  5EFX A;  4LJP B;  1UPQ A;  1J0W A;  4C0A A;  2JY6 A;  2P0H A;  1EF5 A;  1WJU A;  1OQN A;  2UZS A;  3B0A A;  1H4R A;  2MFQ A;  3FP5 A;  2N9X A;  3ENB A;  1GGO A;  4G50 A;  2RGN B;  3SD5 A;  1TJ6 A;  1UPR A;  1MK7 B;  1FGZ A;  3T06 A;  1XD4 A;  1UD7 A;  3AUL A;  1U2B A;  1VBG A;  1LXD A;  4W9F A;  1WVH A;  2D9W A;  4K7S A;  4LJO B;  2ZZP B;  2NS5 A;  3ZLZ A;  1N3H A;  1ACA A;  1H8C A;  2YT1 A;  3ZTC A;  1WX7 A;  2MBH A;  3EEC A;  5C16 A;  3KYC D;  5D2M B;  1Q5W B;  3UZT A;  2L8J A;  1HB8 A;  3JW0 X;  4WJN A;  4HHV A;  3C0R B;  2ADZ A;  1UZX B;  2KX3 A;  2P8V A;  4AUQ C;  2FJL A;  1P9D U;  3VXW A;  4B6W A;  2N9E B;  1ZC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...