2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
2JUOA 4NJ6A 1UEFA 2LVPA 5IJMA 3KRWA 1U5DA 3UZTA 2UZSA 3PRPB 3V5WA 1WGHA 3DDCB 3VAWA 2CHXA 3SHQA 2KTFA 1JRUA 4Y94A 1XCGA 1WX8A 2XK5A 4W9EA 1V88A 4WJNA 1ISNA 2ZPYA 1R4NI 1J0WA 2MWSB 2KGXB 4NJ7A 2LRUA 2LGYA 1HE8A 2RUKB 5DPSA 2GBMA 1YX5B 2QKMA 3U8ZA 2MBOA 5JHGA 1ZVRA 4P7IA 2MWNB 2KO3A 3H7PB 2RD0A 4EJNA 2K8HA 3OAWA 5EFXA 2LGDA 3DXEA 1W1DA 1WM2A 2YT0A 3RCZA 3NHEB 4KHAA 2HJ8A 3TJPA 4EZKA 2GOWA 2D9ZA 1WI0A 1OY2A 3EC8A 3ZRCA 2ZNVB 2IYBA 1GC7A 2LJ5A 5KQ4A 2VRRB 2ZNVC 1V2YA 2NR2A 4G50A 4F7ZA 2IO3B 1NU2A 4K7WA 1FAOA 3PVUA 2DZIA 4IC7B 4FADA 1E7UA 1DYNA 5D7GA 2BCJA 3MJWA 4DBGA 2HTHA 2KXJA 4F1SA 3PTFC 1W1HA 3ZW3A 3QBVB 3PV1A 2L1CA 3KY9A 4FHJA 2I1JA 5C79A 2XK5B 2XQNM 3SNHA 1V86A 2LASA 5AZHA 3NY5A 5DPWA 2P8VA 4GMXB 1AWEA 4HLEA 2FIFA 4EUTA 2KC2A 2CU1A 5BO4B 3DVNU 2CHZA 4WAAA 1E8ZA 2KHWB 3Q3JA 1I7AA 2D4QA 4IFSA 3ZNID 1S1QB 3KZ1A 5FR6A 3NZUA 1WGDA 4HAVB 3ZKJC 4I6LB 1M7EA 1TTNA 1E8WA 3AJ4A 3JVZX 4MGKE 4JGHB 4HB3B 4TUUA 2JZ3B 2K25A 2K6QA 4LDTD 3A98B 4KDIC 2J0KA 2CAYA 5LXHA 2K8CA 3G9WA 2N4FA 2ABDA 5CLQB 4MGYE 3ODXA 3DCGA 4MEMA 3ZNGC 1EUVB 3U30A 2WX1A 4MSQB 3ZRFA 2RVBB 2KANA 2NPTA 4MSMB 1Q5WB 4FJYA 1U5FA 2DAJA 2L3ZA 1FB8A 4K7SA 4PNKA 4IWPA 4KHBB 2CS4A 4GDKB 4URKA 5L95C 2KCJA 1FGZA 1XR0B 4IM0A 4AOFA 3ZUNA 4M8MA 3V61A 2FJ9A 4DHZB 3PRZA 4A6KA 3MPXA 3DVGX 4K81A 3R7QA 1EGXA 4ZDVA 2ZCCA 1TBEA 1ACAA 1UH6A 2DHKA 3DXDA 2MCNB 2MP2A 3VUWA 4W9FA 2M4NA 1U5GA 1WMHB 2G35A 3I3TB 1WZ0A 3T8MA 1J0GA 5JLJB 2KK8A 1YD8U 3N3KB 2PE6B 3WYFB 5CLLB 1V49A 3TMPB 2V3SA 2K8BA 5LLIA 2DYQA 5C23A 1Z2MA 3F5RA 2NPTB 3VUYA 3L0WB 2QKLA 1WIAA 4KZ0A 4WJQA 1UPRA 4MGIE 1U4AA 1WZ3A 2RSUA 3EFUA 4IAPA 2J0MA 3FLVA 1A5RA 1BWNA 3NZSA 2KWVB 2DYNA 3UGBB 2M0XA 2L0TA 2J0JA 1I2HA 2LYDA 3DXCA 4NY0A 2MA9B 4B6WA 4OVUA 4EZJA 5HE1A 1WM3A 1FHWA 1LB1A 5JHBA 2LXCA 2O6VB 2COCA 4PQ0A 1WF9A 2MP2B 3PVWA 4AJYB 4MK0A 4NSWA 1WVHA 2COFA 2G3QB 3VTWA 3HIZA 1VCBA 3A9KA 3FSSA 1WG7A 5J18A 1KM7A 2O6VD 1GG3A 2LVOA 3DBLI 5E6NA 1FOEA 2YLMA 3CIKA 5AZGA 5JP4A 4CHKA 2R09A 2D9XA 2G4DB 1U5EA 2NBWB 1IPGA 3W1YA 2N1VA 4NPNA 2D9WA 2N1WA 1EVHA 2WWZA 3SO6A 1OGWA 4BBNC 2NBUA 2M8SA 4FN2A 4WVFB 3PGEA 2BF8B 4AWJA 3SDLC 3TBLD 5IAAC 3KRXA 3QIJA 5J3TA 2NMBA 2DLWA 2YRYA 3VXWA 1LXDA 2K2JA 2Q13A 1M7RA 5E6PA 1OEYJ 2M14A 2IY1B 2L8JA 1WXVA 2LKOA 2H7EA 2Y8FA 5TR5A 4HVBA 2HD5B 4FLHA 1DROA 2DZMA 1V89A 2V4LA 3JSVA 3TL5A 3X0WA 3JYUA 4MJSA 3RT3B 4C0AA 3UF8A 4TQ0A 5CHFA 3VOQA 4HATB 2DAFA 2ZZPB 1H4RA 3VVWB 4YL8A 2GBJA 1ZM0A 4WQOB 4PYZA 1P3QU 1KZ7A 1UZXB 2VKIA 5LONB 3ZNZB 4W9CA 4IUMB 3H7SA 1TQZA 3VIAA 4NAWB 4A3OA 3HQCA 2YS3A 3L13A 3WALA 5D3VA 2GBNA 3N30A 2LG1A 3EPYA 3RD2A 2M17A 3R7RA 1H10A 3KUCB 3H7PA 5AEKB 2KFKB 4HAXB 1YX6B 2KJHB 3ZDMC 5GMVA 3T06A 4FHKA 2BYFA 1V5PA 4XX5A 2UZRA 2GS0A 2FCQA 4MELA 2NVUI 1QZEA 3QJZA 4XZ4A 3JSVB 2LRWA 4KSKC 4MJSB 2IO1B 3TIXA 1GUAB 2MX2A 1WE6A 3DQVA 3DVGY 3H1UA 5KQ1A 1KOTA 2W9NA 1XD4A 2FDQA 2UVMA 1S3SG 1TGZB 1X86A 5DH9B 3TW1A 1XX0A 1SHCA 2KVRA 4DHZE 5L83A 3Q3FA 5LXIB 5HKHA 4GN1A 3M62B 2ASQA 3QC8B 2V76A 2IO2B 2LBBA 4W9DA 2JVCA 3PG7A 5DIFB 2Y7BA 2MQJA 3B0AA 4HB0B 2R0DA 3PP2A 4K2OA 2LD9A 2ZVOA 3GZNI 3ZIMA 2Z0DB 2YF0A 1EAZA 3WA0A 3WANA 1OQNA 1EF5A 2LVQA 3N7CA 3ML9A 4HJKA 4FA6A 1P3RA 2J59M 2FAZA 3QARA 2M38A 3TO1A 3UIPB 4BOSC 1UELA 1WI1A 1ZSQA 1Z5SB 2G4SA 3K9OB 5JHAA 4CO7A 4X57B 2MBHA 1WX7A 5CTRC 1WGUA 3KYDD 2DFKA 1TXDA 2D3GA 4W9LA 1XKEA 3TVVA 4M8NA 3T9LA 4TYZA 2KX3A 3ENEA 1BAKA 5C16A 2KDEB 3DBSA 1P6SA 2DENB 1LFDA 3UIOB 2L7RA 2JPHA 4GSWA 4GDKA 2OOBB 3CF6E 2JZZA 1U2BA 1XT9B 1YQBA 4NQLB 2JP2A 4IWQA 4B95A 4AUQC 3B1LX 4LDTB 5DHAB 2YT1A 2CY4A 3V6CB 4IG7B 2DHJA 2N7EA 4A6HA 4ANXA 2BWFA 4K2PA 3AULA 4W9JA 4WJPA 2J7QB 2V1YA 2ELAA 1P9DU 1WMHA 4ICVA 2GMIC 4PS8A 1C3TA 5J3YA 4IM3A 4WSFA 4FJZA 3QWMA 3LJ3A 3DVNV 2L2IA 4AP4C 2FCSA 4RM9A 1UBIA 1YIWA 2PEAA 1WGGA 2DYMA 3L17A 2YVCA 1V9JA 3L10B 2RNRB 2PZ1A 3CSTA 2LGXA 5EDSA 2Z0PA 2CRFA 2KTRB 3VH3B 1WJ1A 3JW0X 3S2AA 4YONA 3MHSD 5CHWA 3QCAA 4GXBA 4DX8A 4DDGD 3ODWA 4BFRA 2PJHA 4WWOA 1X11A 5IA7A 3IFWB 3PLVA 2MLBA 1XODA 2N0YA 3HHMA 4IWOA 4IW0A 3VQIA 3D8FA 2Z0QA 2D07B 2CR5A 3WAOA 2O6VA 2RPQA 1EF1A 2GJYA 2MRPA 3OANA 4DWFA 1DDVA 2KFJA 3N32A 4TQ1A 1NI2A 2JRIB 4BKTA 1WGQA 4ZRKA 2QHOA 1OMWA 2NBVB 3PSCA 2C5LC 1OTRB 3PT2B 4BKSD 2OTXA 3SV1A 4CHJA 3IVFA 1X1MA 2UYZB 3QK0A 3KUZA 5JH5C 1U27A 2GCJA 2KUPA 2KX0A 4OVVA 4HB2B 2WDTB 4GPTB 1KJTA 2H7DA 5AZFA 1NDDA 1WJNA 2K1FA 3OJ3A 4JL9A 1UNRA 3R66C 3APCA 4MT7A 2K00A 2N9PC 5DI9B 4A5KA 4HPLB 3OLMD 4F7UP 4K17A 4CYEA 1MK7B 4KSLC 1V5UA 2DA0A 4ZYNA 3LDZE 3RULA 5DHFB 2AL6A 1FXTB 2ROVA 2N23A 3OJ4B 2BKFA 4A6FB 2IZVB 1WX9A 3UQBA 2FCNA 2M1MA 1LW3A 2CQUA 2X18A 4KAXB 4L6EA 2DHZA 4WJ7A 2YS1A 4RMAA 2MBBB 4HAYB 3M3JA 5HE3A 4BVUC 2I5FA 3SYXA 3D8EA 4DBBA 2RSGA 3AU4A 4MM3A 3DBRI 3APDA 3V62A 3SU8X 1OQYA 3A4SC 2OQBA 2EMTA 3ML4A 4PS3A 4E74A 2GBRA 4KDLB 4HAWB 3HM3A 1P5TA 4W9HA 4AJWA 2PPHA 1Y8RC 3U7DA 1EO6A 2VSZA 2ZEQA 1KZGA 5KHOA 1E8YA 2L0FA 3AI5A 4NAWA 2DX5B 3ZVRA 1V61A 1WJUA 2C7NB 4EFOA 2IO0B 1Q0WB 3SD5A 2WH5A 1E90A 2HE7A 1P0RA 2RGNB 1NTIA 4EMOA 2KFKA 2ROZB 4HWIB 4DK5A 4W9GA 5DPTA 2MSED 3APFA 4ZRJA 5JHHA 3VTUA 4FULA 1H8CA 2KZRA 4EKUA 5DPRA 2COPA 5DCNA 1UNQA 1DDWA 3KH0A 1OEYA 2L05A 2LUEA 3ALBA 2MDXA 2AEHA 2BPSA 1K5DB 1HBKA 1I35A 4BOZB 3PVLA 1MK9B 2JWZA 5E6OA 1WFYA 2ZPNA 1MIXA 3IG3A 3RZWC 1RRBA 2KJRA 4HCNB 4IM2A 1AQCA 4WWNA 5D27A 3NOBA 2IBIB 3VTVA 5CHVC 2YS5A 3ZNHB 4GDLA 1PLSA 3ML8A 2Z0EB 3C0RB 3KUDB 4ANWA 3R3MA 2K39A 3FEHA 2CKHB 3NS8A 1L7YA 3X23A 3RCPA 4HCPB 1HB8A 3VFKA 1IYFA 1RFAA 4PYUA 4E71A 2D10A 1TJ6A 4HAUB 2DYBA 3TFMA 2O2VA 3ULCA 1E5WA 1WYWB 1WR1A 4MH0E 4A3PA 3NSUA 1Q67A 4GB9A 3FP5A 4HAZB 1GNUA 2R2OA 3ZTDA 1V5OA 2KWUB 4BBKA 2CB8A 2BYEA 4JIOU 1K8RB 2P0DA 5C5BB 2MW5A 3KVFB 4PS7A 1ZC3B 1P98A 1WRDB 2C9WB 4GU2A 2Y5BB 3VUXA 2KLCA 1WE7A 2P0HA 2BWES 4I6NB 1M94A 3PS6A 4HK2A 4LJPB 1QC6A 2W2XD 5KHQA 4EEWA 4GDLB 2WYQA 3L16A 3WAMA 1FHOA 2KOXA 1MIZB 3A4RA 1J8CA 2IFSA 4B6HA 2FCMA 2CODA 3O96A 1NBFC 3PHXB 1SE9A 4JLCA 2O2VB 1WGRA 2LULA 1RRPB 1I42A 2HRJA 2D9YA 2AL3A 1CMXB 2A5UA 4BBNF 2LOXA 1GJZA 1BTKA 1V5TA 1PFJA 2RR9A 4W9KA 4B9KA 4DXAB 1WJ6A 2KLGA 5D94A 4KV2A 3QQ8B 5D3XA 2JXXA 5LOPB 2RGFA 1WXAA 1AARA 3GOEA 3M1IB 2EJ8A 4H8SA 2EKEC 2KTRA 1LM8B 2WX0A 1FGYA 3P7ZA 1L2NA 1HB6A 2L76A 2KJ6A 2COAA 1E8XA 2K2UA 1X05A 1XQQA 4Z2MB 4F8CB 3AXCA 1KLVA 3ZLZA 2KDBA 2KQSA 1ST7A 3O65B 3WIMA 2B3AA 3UQAA 1BTNA 2RLOA 4ZRIA 2LXAA 2MFQA 2CHWA 1MKEA 4N9F4 3RZFA 1MG8A 3VDZA 2OJRA 2G45B 3HK0A 2JF5A 4BKSA 2LI5A 2N7DA 1WJ4A 5D3YA 5D6JB 1FHXA 3DPDA 2NS5A 3ULBA 3K9PB 4XC2A 3A33B 4JQWC 2IYDB 4E3CA 3MTNB 5C1ZA 3A1QA 4LCDE 2EC1A 2AWTA 4XWXA 2DX1A 2GBKA 2N9XA 3ODOA 3V6EB 2DKPA 4KZCA 3A8QA 2D9VA 2HTHB 4J6IA 3PZDA 3W1SA 4GMVA 1SGHA 1PQSA 4M0WB 3AU5A 3V60A 3PRMB 4TV3A 3SUZA 1U29A 5G2NA 4KVGB 4TKNA 3ZDTA 4FBJB 2NZ8B 2YSZA 2P0FA 3D32A 2DHIA 4A6FA 2BYVE 4F7HA 1K5GB 4ANUA 3L54A 4HDQA 3PREA 3HM6X 1PMSA 2N9EB 1WJMA 1SIFA 3BJIA 3RUIB 2DYOA 2PE9A 4I6PA 2XBBC 1MAIA 1RJ2A 1RAXA 4G0NB 1KI1B 4LJOB 2W2WA 2KN5A 4HB4B 2KD0A 4NNJB 1WXMA 4GZUA 5KCVA 3A1QB 1F9JA 4MDKE 2AYOB 2K6DB 5J17A 5D3WA 2BKRB 4DDID 1N3HA 1ZGUB 3A9JA 2JT4B 1W1GA 4KHOA 5J2RA 1UGMA 1TZ1A 4WWPA 3QA8A 1RLFA 3W1SC 3VHTC 3F0WA 2ADZA 2FJLA 4HDOA 3ZO5B 4II3B 1UBQA 4II2B 2DX5A 1UNPA 2NCNA 2KC1A 3TCAA 3H9DA 3BINA 3M63B 2JRHA 2KMCA 3PPAA 5G55A 1UPQA 4DHJB 2R2QA 3M95A 4K1RB 4CHMA 3GYOA 2UWQA 2REXA 2Z0OA 2D2QA 1V80A 2L00B 3KYCD 4GOCA 4RM8A 1UD7A 2KWCA 4DHJD 4FJVB 3PHWB 4ANVA 2LZ6A 3KSYA 3P6AA 3FM8C 4G3XB 4F7GA 1Q1OA 3IBEA 3ZTCA 1QQGA 1C1YB 2BGFA 3A9JB 4ICUA 2KQ7A 4K7UA 1WXSA 3DBHI 5J3QA 1Y5OA 3DOWA 2DZKA 4DX90 3QHTA 2DKQA 2C7HA 1V81A 2MBQA 3D8DA 2KDIA 1R4MI 2LWPA 4BKGA 1WH3A 5GOWB 3RYTA 3CSFA 2FIDA 2FNJB 1P1AA 3EECA 2CY5A 4NQKE 3H6NA 3QAQA 5FI1A 3VH4B 4KIKA 1LQBA 1D3ZA 2JY6A 5L81A 1DDMA 2KDFB 2I1KA 1X1FA 1T0YA 4EZLA 2KMAA 4MGZE 4W9IA 1IP9A 2ZCBA 1V5MA 2DZJA 1Z87A 2FUHB 2D11A 1YJ1A 1ZW7A 2GCLA 3WAPA 3GYPA 4Z2NA 2EMSA 3ONSA 3ZVVA 4A20A 2VRWB 5C5BA 3A9KB 3CMMB 1V6EA 2I5CA 1DBHA 1GC6A 3BY4B 4GIVA 3MDBC 3PLUA 1X1GA 3UINB 1WR6E 1E7VA 4WJOA 1WY8A 2RQ1A 3A8PA 2KNBA 4IOYX 4D0NB 1NTYA 2LOZA 3L08A 1J19A 1VD2A 4ASWC 5JZEB 2XEWA 4GGQA 4HXDA 2ZJDA 2Y8GA 1BT0A 4HHVA 5C6RA 1IRSA 3QWZB 2A4ZA 2Z59B 1ZC4B 3HW2B 2MBEA 4KIKB 2E2XA 3PSEB 1WGYA 3QX1A 1NTVA 4EOYA 2ZVNA 1NVLA 1B55A 2DTCA 2ELBA 3PEGA 1ZKHA 2DN6A 2IY0B 3KW5B 4G11A 3CXBB 4HPMB 5HE2A 1MPHA 3LJUX 5CX3A 3P2BA 5FI0A 2C7MB 1XD3B 2C60A 3ECIA 1G6JA 5HE0A 2W2XC 1Y19B 4MY6A 3EHVA 3IHPC 2KKCA 2MKRA 3B08A 5D2MB
chains in the Genus database with same CATH superfamily
2JUOA 4NJ6A 1UEFA 2LVPA 5IJMA 3KRWA 1U5DA 4XGAB 3UZTA 2UZSA 3PRPB 3V5WA 1WGHA 3DDCB 3VAWA 2CHXA 3SHQA 2KTFA 1JRUA 4Y94A 1XCGA 1WX8A 2XK5A 1L6UA 4W9EA 1V88A 4WJNA 4JX1C 1ISNA 1QOGA 2QILA 2ZPYA 1R4NI 1J0WA 2MWSB 2M0AA 2KGXB 4NJ7A 2LRUA 2LGYA 1HE8A 2RUKB 5DPSA 2GBMA 1N62A 5I2SA 1YX5B 2QKMA 1T0SC 1DYQA 3W2DA 3AEEB 3U8ZA 1YQ3B 2MBOA 5JHGA 1EWYC 1NYQA 1UF0A 2LGSA 4AQ7A 1IGDA 4RGOS 2W55A 1ZVRA 2L52A 4P7IA 1PGAA 2MWNB 1NVID 2KO3A 2RD0A 3H7PB 4EJNA 2K8HA 2PTLA 3OAWA 5EFXA 3FILA 2LGDA 3DXEA 1W1DA 5AUKA 1WM2A 3ABVB 2YT0A 3RCZA 3GZNB 3NHEB 4KHAA 2HJ8A 2JWUA 4QXAB 2GUMA 3RNFC 3KLSX 4RF1A 2Z8LA 3TJPA 4EZKA 2GOWA 4GLSC 2D9ZA 1WI0A 1OY2A 3EC8A 1I4XA 3ZRCA 2ZNVB 1YJIA 2IYBA 1GC7A 2LJ5A 5KQ4A 1HXYD 1JWMD 2VRRB 2ZNVC 1V2YA 2NR2A 1RFKA 4G50A 4F7ZA 2IO3B 1NU2A 4K7WA 1FAOA 3PVUA 2DZIA 4IC7B 3N1ZC 2XN9C 4FADA 1E7UA 2BT6A 1DYNA 5D7GA 2BCJA 4BAXA 1JWUD 3MJWA 4DBGA 2HTHA 2KXJA 4F1SA 3PTFC 1W1HA 1T0RC 3ZW3A 3QBVB 3PV1A 2L1CA 3KY9A 3Q3NC 3GS2A 1VR9A 1N5WA 4FHJA 2I1JA 4USAA 5C79A 2XK5B 2XQNM 3SNHA 1V86A 2LASA 5AZHA 3NY5A 5DPWA 4JK9A 2P8VA 2JU6X 1N5XA 4GMXB 2KT7A 1AWEA 4KHBA 4HLEA 2FIFA 3Q3MC 4EUTA 2KC2A 5D3DA 5TSSA 2CU1A 1C77A 5BO4B 3DVNU 4L1BA 2CHZA 4WAAA 2PVGC 1E8ZA 2KHWB 2JSVX 2K49A 3AEDB 4B0EA 3Q3JA 3FILB 1TKEA 2WP9B 1WYGA 2LEKA 3ETRA 1I7AA 2D4QA 4IFSA 2WXFA 4WWMA 3ZNID 1S1QB 3A58A 3KZ1A 4GOUA 5FR6A 3NZUA 1WGDA 4HAVB 3ZKJC 4I6LB 1BUIC 1M7EA 1D6EC 2Q5WD 3BVGA 1TTNA 1E8WA 3AJ4A 3JVZX 4MGKE 4JGHB 4HB3B 4JPSA 4TUUA 2R82A 2JZ3B 2K25A 2K6QA 4LDTD 3A98B 5FR3A 3VR9B 4KDIC 1DOYA 2J0KA 2CAYA 5LXHA 2K8CA 3G9WA 2BS3B 4YSZB 3HRDD 2Y5CA 2Y5PA 2N4FA 2ABDA 2D3AA 3FKYA 5CLQB 4MGYE 3ODXA 3DCGA 3U4EG 4MEMA 3ZNGC 1EUVB 3U30A 2WX1A 3SFEB 4MSQB 3ZRFA 1ZXHA 2RVBB 2KANA 2KACA 2NPTA 4DIXA 4MSMB 3W5VB 2WHIA 4ZHOA 1Q5WB 4RGTA 2Y3AA 4FJYA 4S17A 1U5FA 2DAJA 2L3ZA 4IDIA 3E66A 2KQ4X 2INNE 1FB8A 4K7SA 4PNKA 4IWPA 4A6QA 2PW9A 4KHBB 1C78A 3VRBB 3SEBA 2CS4A 4GDKB 3AECB 4URKA 1FPYA 3P4QB 5L95C 1MI1A 2KCJA 1YN4A 1FGZA 3L4PA 3AE1B 2YEPB 1JQ4A 1XR0B 4IM0A 2WXOA 4AOFA 3ZUNA 4M8MA 3V61A 2BBCA 3U12A 2FJ9A 2BB5A 3ZYYX 4DHZB 3PRZA 4A6KA 1STEA 2BW2A 3MPXA 3DVGX 4K81A 3R7QA 1EGXA 4ZDVA 2ZCCA 1TBEA 1ACAA 1UH6A 1LGRA 2DHKA 4MH8A 3DXDA 1FEHA 1ZE3D 2MCNB 2MP2A 3VUWA 4W9FA 3I9V1 2M4NA 1U5GA 1WMHB 2G35A 3I3TB 2GB1A 1WZ0A 3AH7A 1SE3A 3T8MA 2FBWB 1C4AA 1J0GA 5JLJB 2KK8A 5H92C 1YD8U 3N3KB 1NYRA 2PE6B 3WYFB 1ZP0B 5CLLB 3E9SA 1WWTA 1V49A 2QIEB 2PVOD 3TMPB 3OHMB 2SEBD 2V3SA 3MC0B 1JDEA 4K3BA 2K8BA 5LLIA 2DYQA 1L6VA 5C23A 5IRSA 3RFZB 5BYRA 1Z2MA 3F5RA 2NPTB 3VUYA 2K0PA 3L0WB 2TSSA 4DQOC 2QKLA 1WIAA 1V97A 4KZ0A 1RM6C 1I4QA 4WJQA 3R8BA 1UPRA 4PK1A 4C80A 4MGIE 1U4AA 1WZ3A 2RSUA 3EFUA 4IAPA 1VZ8A 2JXTA 4HJGE 3IAM1 2J0MA 4MT5A 3FLVA 5GXGB 3TEXA 1A5RA 1BWNA 2DIKA 3NZSA 4NJCA 2KWVB 2DYNA 3UGBB 2M0XA 2L0TA 2J0JA 3GE8C 1AWDA 1I2HA 2LYDA 4NZLB 3E9PA 3DXCA 4NY0A 5D3IB 2MA9B 4OZCA 1FNUA 1ROEA 1TY2A 3B9JA 4B6WA 2QJLA 4OVUA 4EZJA 5HE1A 1WM3A 1FHWA 1LB1A 5JHBA 2LXCA 2O6VB 2COCA 4PQ0A 4YWGG 1MVKA 3BK1A 1WF9A 1FCLA 2MP2B 2QC8A 3PVWA 2JQRB 4AJYB 3E9OA 4MK0A 2X8XX 3MP9A 4NSWA 1WVHA 2COFA 1TKGA 4DXFA 2G3QB 3VTWA 3HIZA 2RDBC 1L0XB 1VCBA 3A9KA 3FSSA 1WG7A 5J18A 1KM7A 2O6VD 2IGHA 1GG3A 2LVOA 3DBLI 5E6NA 1FOEA 3NWDA 2YLMA 3T3OA 3AE9B 5FK9C 2I2YA 1C79A 3CIKA 3NJTA 3P42A 5AZGA 4B0MA 5JP4A 4S0RA 2R09A 2D9XA 4CHKA 2DLBA 4JKAA 1HTOA 1ET9A 1FNWA 1FFVA 1RWSA 2G4DB 1U5EA 2NBWB 3FC4A 1IPGA 3W1YA 1I4RA 2N1VA 4NPNA 2D9WA 4XE0A 3RNAC 2N1WA 1EVHA 2WWZA 2KDMA 3AM9A 3SO6A 1OGWA 4BBNC 4LNOA 3BZDB 2NBUA 1KTKA 2M8SA 2Z13A 4FN2A 1C4PA 4WVFB 2KMMA 4GNKB 2XNAC 3HVZA 3PGEA 3SR6A 2BF8B 4AWJA 3SDLC 2Z59A 3TBLD 2PMVA 5IAAC 3KRXA 1ZXIA 3QIJA 5J3TA 2NMBA 4ZHPA 2DLWA 2YRYA 3I63C 2N9KA 1CZPA 1LXDA 3VXWA 1YNTE 4JE3B 3UI3A 2K2JA 2Q13A 1M7RA 5E6PA 4M00A 2E6XA 1OEYJ 2M14A 2IY1B 4US8A 2L8JA 1MJDA 1WXVA 2LKOA 2H7EA 4YSXB 1K53A 2Y8FA 5TR5A 4YXDB 2R61A 4JKEA 4ILGB 4HVBA 5BMHA 2HD5B 4FLHA 2Z14A 5EE9A 2GI9A 2M19A 1DROA 3FVCA 4N6EB 1JWBD 4L1RA 2DZMA 2FJUB 4MM3B 1V89A 2V4LA 1TJEA 2IGDA 3JSVA 3TL5A 3X0WA 1HA5A 3JYUA 4MJSA 3RT3B 4IKGA 2J53A 4C0AA 1C4CA 3DHHC 3UF8A 4TQ0A 3RN9C 4QJ5B 5CHFA 3VOQA 4HATB 2DAFA 2ZZPB 4N59A 1H4RA 1VLBA 3VVWB 4YL8A 2GBJA 1ZM0A 4WQOB 4PYZA 1P3QU 1KZ7A 1UZXB 2VKIA 1QT9A 5LONB 3ZNZB 4ZOHC 2H89B 1DOIA 4W9CA 2YT2A 4IUMB 3H7SA 1P7EA 1VBHA 1TQZA 2V0GA 3VIAA 4NAWB 4A3OA 3HQCA 1F77A 1QOFA 2YS3A 3L13A 3WALA 5D3VA 2GBNA 3N30A 2LG1A 1AN8A 3EPYA 3RD2A 2M17A 3R7RA 1H10A 3KUCB 3H7PA 5AEKB 2Z4DA 5JXVA 2KFKB 4TMAB 4HAXB 1YX6B 3Q6BA 2KJHB 4ZRPA 1KC7A 3ZDMC 5GMVA 1FRRA 3T06A 4FHKA 2WLBA 2BYFA 1V5PA 4XX5A 2UZRA 1CK1A 3BVZA 4OZBA 2GS0A 2FCQA 1SB3C 3N20C 2W54A 4MELA 2NVUI 1A70A 1QZEA 3QJZA 4XZ4A 2WU5B 3JSVB 3SBGA 2LRWA 4KSKC 4MJSB 2WXLA 2IO1B 2N7JA 3TIXA 1GUAB 2CJOA 2MX2A 5BYQA 1WE6A 3DWGC 1HEZE 3DQVA 4C4VB 1C76A 3DVGY 4HKZE 3H1UA 5KQ1A 1KOTA 2PLPA 2BS4B 2W9NA 1XD4A 5IKCM 3Q69A 2FDQA 1YQ4B 2UVMA 1S3SG 5EE0A 1TGZB 1C9FA 1X86A 5DH9B 3TW1A 1XX0A 1HZ6A 1SHCA 1ZUD2 1UNSA 2KVRA 4DHZE 5L83A 4ARCA 3Q3FA 1PYWD 5LXIB 5HKHA 4GN1A 3M62B 2ASQA 1EU4A 3QC8B 1SIJA 1T77A 2V76A 2IO2B 2QDFA 2LBBA 4W9DA 2JVCA 3PG7A 1UGJA 1K52A 3SFDB 5DIFB 3Q3OC 2Y7BA 2MQJA 3B0AA 3NVWA 1PGBA 2AX5A 4HB0B 2R0DA 1ACCA 1L5PA 4RCOA 3P1MA 3PP2A 4TSSA 4K2OA 2LD9A 2ZVOA 3MC8A 3GZNI 3ZIMA 1VBGA 2Z0DB 2YF0A 2LUMA 1V1PB 1EAZA 3WA0A 3WANA 2PKOA 1OQNA 3ZXRA 3LB8C 1EF5A 3WCQA 3AE3B 4YTNB 2LVQA 1E6EB 3N7CA 1TIFA 3ML9A 4HJKA 4LNKA 4FA6A 1ENFA 1P3RA 1R4NB 2J59M 5BMGA 2FAZA 3QARA 1VJKA 2M38A 4JKCA 3TO1A 3CIRB 1LO5D 3UIPB 4BOSC 1UELA 1WI1A 1ZSQA 1Z5SB 2G4SA 3K9OB 5JHAA 4CO7A 2WXKA 4X57B 1F2RC 2MBHA 1WX7A 5CTRC 1WGUA 3KYDD 2DFKA 3IT4B 1TXDA 2G9HD 1YJJA 2D3GA 3TSSA 4W9LA 1XKEA 3TVVA 4M8NA 3T9LA 5C3JB 5LG4B 4TYZA 2KX3A 3ENEA 1BAKA 5C16A 4IOIE 2KDEB 2UU7A 4OZAA 3DBSA 1WGKA 1L4DB 1V8CA 3AEAB 2IPKD 4YT0B 1P6SA 1ET6A 2ON8A 5AUIA 2DENB 1LFDA 2LFIA 3EUB2 4KGSA 2DWQA 3UIOB 3Q8AA 4LK0M 2L7RA 2JPHA 4GSWA 4GDKA 2OOBB 3CF6E 2JZZA 1U2BA 1XT9B 1Y56A 1YQBA 4NQLB 4LLGM 1FFUA 2JP2A 4IWQA 4B95A 4A9AA 4AUQC 3B1LX 1GB1A 4LDTB 5DHAB 2CY4A 2YT1A 3V6CB 4IG7B 2DHJA 2KUQA 2N7EA 2QSDA 4A6HA 4ANXA 1FNVA 1M4VA 2BWFA 4K2PA 3HUIA 3V3XA 3AULA 4W9JA 4WJPA 2M56B 3B77A 2J7QB 2V1YA 2ELAA 1P9DU 1FO4A 1WMHA 4ICVA 2GMIC 1WSPA 4PS8A 1XLOA 1C3TA 5J3YA 1XF5L 4IM3A 4WSFA 2KWDA 3MFGA 4FJZA 3P63A 3O13A 3QWMA 3LJ3A 2WDVB 3DVNV 2L2IA 4AP4C 2FCSA 2H88B 4RM9A 5LNK1 1UBIA 1YIWA 2PEAA 1WGGA 4A90A 2DYMA 3L17A 2YVCA 1SXTA 1V9JA 3L10B 2RNRB 2KIEA 2PZ1A 3CSTA 2LGXA 5EDSA 2Z0PA 2CRFA 1MHXA 2INPE 2HJ1A 3P4SB 2KTRB 3VH3B 3ENBA 5HFYA 1WJ1A 3JW0X 3S2AA 4YONA 3MHSD 5CHWA 3R2TA 4EE2A 3QCAA 3AE7B 4GXBA 4DX8A 2WXHA 2KVZA 4DDGD 3ODWA 4BFRA 2PJHA 4L23A 4WWOA 3C8YA 1P7FA 1X11A 5IA7A 3IFWB 3PLVA 2MLBA 1XODA 2N0YA 1BXTA 3HHMA 4IWOA 3AE2B 3BYYB 3N1YC 4IW0A 2WU2B 4QJ3B 1J7BA 3AEFB 3VQIA 4JKBA 3D8FA 2Z0QA 2EELA 4C56C 3ZJVA 2D07B 1JWAD 1VRAB 2CR5A 5IO9A 3WAOA 2O6VA 4JK7A 2RPQA 1EF1A 3IXSA 2GJYA 2MRPA 3OANA 2INCC 4DWFA 1DDVA 3DHIC 2KFJA 3N32A 3R2IA 1KLGD 4TQ1A 1NI2A 1D5XC 1D5ZC 2JRIB 4BKTA 1WGQA 4ZRKA 2QHOA 3E9LA 1OMWA 3Q8FA 1NI3A 3PSCA 2NBVB 2C5LC 1OTRB 3PT2B 5EE3A 4BKSD 2FUG1 2OTXA 3SV1A 4JKGA 3N1XC 4REZA 4CHJA 2LMCA 3IVFA 3AE6B 2WDRB 3PZ8A 4FXCA 3Q8EA 1X1MA 2UYZB 3QK0A 1I4HA 3KUZA 5JH5C 1U27A 2GCJA 2KUPA 1FXAA 2KX0A 4HB2B 3HVDA 4OVVA 4JKHA 2WDTB 4GPTB 1KJTA 2H7DA 1MPEA 2OJWA 2WNMA 2X38A 5AZFA 1Q10A 3PO0A 4C00A 1GOZA 1NDDA 1WJNA 1TKYA 2K1FA 5BMIA 1D5MC 3OJ3A 1SEBD 4JL9A 1UNRA 3R66C 4RH6A 3APCA 4MT7A 2K00A 2N9PC 5DI9B 4A5KA 1E7PB 4HPLB 3OLMD 4F7UP 4K17A 4CYEA 2QMTA 1MK7B 4RNAA 4KSLC 1SJED 1V5UA 2DA0A 4ZYNA 1HZ5A 3LDZE 4C7ZA 3RULA 5DHFB 2AL6A 1FXTB 2ROVA 2CU3A 2N23A 3OJ4B 2BKFA 4A6FB 2OHFA 2IZVB 1ZOYB 3RNGC 2ZW0A 1WX9A 5EE1A 3LXFA 3UQBA 2FCNA 2M1MA 1LW3A 2CQUA 2X18A 4KAXB 2K5PA 4L6EA 4LNIA 2DHZA 2JZPA 4WJ7A 3DHGC 2YS1A 4RMAA 2MBBB 4HAYB 3M3JA 5HE3A 4BVUC 2I5FA 3SYXA 5I2MA 4OW0A 3D8EA 5FKAC 4DBBA 2NTTA 4JKGB 2RSGA 3AE4B 3AU4A 4MM3A 3DBRI 3APDA 3V62A 3SU8X 1OQYA 3A4SC 2OQBA 3Q8BA 2EMTA 3ML4A 1DIKA 4WQMA 4PS3A 4E74A 2GBRA 2KYWA 4KDLB 4HAWB 3HM3A 4XWWA 1P5TA 4W9HA 4AJWA 2PPHA 1Y8RC 3U7DA 1EO6A 2PIAA 2ZW1A 2VSZA 2ZEQA 2I38A 1KZGA 3TUOA 5G5GA 3DBHB 4ZRQA 5KHOA 1T0QC 5C2TB 1EM7A 2DNFA 4MACA 1E8YA 2L0FA 2VZKB 1SF0A 3AI5A 2DX5B 4NAWA 4LNNA 3ZVRA 1V61A 1WJUA 2C7NB 3KQ4A 4EFOA 1FMAD 2IO0B 3P4RB 2E3TA 1Q0WB 3SD5A 3B2FA 2WH5A 3NRZA 2WXNA 1E90A 2HE7A 1P0RA 1QOAA 1R4MB 2RGNB 1XEEA 4R3DA 4HRSA 1NTIA 5T8IA 1QKZA 4EMOA 2KFKA 2ROZB 1KF6B 1TS5A 4HWIB 2VZKD 4KX6B 4DK5A 1PUTA 1T5XD 3HIEA 4W9GA 5DPTA 4HKQA 2WXPA 1ZPSA 2MSED 3APFA 1XO3A 2J52A 4KKIA 4ZRJA 5JHHA 1XCQL 1IUEA 1HTQA 3VTUA 4FULA 1B9RA 1H8CA 4D2KA 2KZRA 4EKUA 5DPRA 2COPA 1ZYIA 1OQQA 5DCNA 1UNQA 1DDWA 1I4GA 3AMZA 3KH0A 1OEYA 2L05A 2LUEA 1I7HA 3ALBA 1B1ZA 2MDXA 4JKDA 2AEHA 2BPSA 1K5DB 1HBKA 3B2GA 4C4VA 1I35A 4HPPA 4BOZB 3PVLA 1MK9B 2JWZA 5E6OA 2MJDA 1WFYA 3J9CA 2D5GA 2ZPNA 1MIXA 4JKFA 2OEDA 3IG3A 3RZWC 1RRBA 2KJRA 1VZ6A 4HCNB 3ZQ4A 2K8EA 4IM2A 4ZYSA 4LTUA 1N60A 1AQCA 4WWNA 4HSIA 5D27A 3NOBA 3AEBB 2IBIB 1K51A 3VTVA 5CHVC 2WS3B 2YS5A 3ZNHB 4GDLA 1PLSA 3I5JC 1TS3A 3ML8A 2Z0EB 3C0RB 2WXJA 3KUDB 4ANWA 3R3MA 2K39A 3FEHA 2CKHB 3NS8A 1L7YA 2WGSA 3X23A 3Q14C 1UWMA 3RCPA 4HCPB 1HB8A 2RRFA 3VFKA 1IYFA 2GLSA 5HG2A 1RFAA 4PYUA 4E71A 2D10A 1EWCA 1V1PA 1TJ6A 4HAUB 2DYBA 3TFMA 4UDUC 4QAYA 2O2VA 3ULCA 5I4DA 1E5WA 1KRHA 1WYWB 1WR1A 2V4IB 4MH0E 4A3PA 4ILHA 2JYTA 3NSUA 1Q67A 4GB9A 4ITKA 3FP5A 2WDQB 4HAZB 1MI0A 5G5HA 1GNUA 2R2OA 2MJ3A 3ZTDA 1V5OA 2KWUB 4PT5A 4BBKA 2CB8A 2BYEA 2GRIA 4JIOU 1HQRD 1K8RB 2P0DA 5C5BB 2MW5A 3KVFB 4PS7A 1ZC3B 2B76B 3P4PB 4D6WA 1PFDA 4WAFA 1P98A 1WRDB 2C9WB 4GU2A 2Y5BB 3VUXA 1SSNA 2KLCA 1WE7A 2P0HA 2BB6A 2BWES 1UUPA 4I6NB 1M94A 3PS6A 2KR0A 4HK2A 3BVMA 4LJPB 3ZGZA 1QC6A 4M01A 2W2XD 5KHQA 2BYTA 4EEWA 4GDLB 4CSQA 2BS2B 3PZ7A 2WYQA 3L16A 1PGXA 1CJEA 3WAMA 1FHOA 2KOXA 3NUHB 1MIZB 3C19A 1SE2A 3A4RA 1J8CA 2IFSA 4B6HA 2FCMA 2CODA 3O96A 4N58A 1NBFC 3PHXB 1SE9A 1TZOA 1F0ZA 3RPFC 4YTMB 4JLCA 2AQ1B 3Q8CA 3NVZA 2O2VB 2ZKMX 1WGRA 2LULA 1RRPB 1F2RI 1I42A 2EKIA 2HRJA 2D9YA 2AL3A 1CMXB 2A5UA 4BBNF 3DWMA 2LOXA 1GJZA 4JWSC 1BTKA 1VDVA 4WURA 3Q2AC 2RPVA 1V5TA 1PFJA 1L0YB 1DGJA 2RR9A 3GP7A 4W9KA 2DBYA 3ZXVA 3NS1A 3KWVA 1GGOA 2VH1A 4B9KA 4DXAB 3TEWA 1WJ6A 2KLGA 4P1CC 5D94A 3RNEC 2HDEA 4KV2A 3QQ8B 5D3XA 2JXXA 5LOPB 2RGFA 1WXAA 1AARA 2JYEA 1UWXA 3GOEA 4HEA1 3M1IB 1WRIA 2EJ8A 4C7YA 4H8SA 2SAKA 2L83A 1XCTL 2EKEC 2KTRA 4WH4A 1LM8B 2WX0A 1FGYA 1L0VB 3P7ZA 1JROA 1L2NA 4RGMA 1HB6A 2L76A 3U52E 2KJ6A 2COAA 4M0WA 4O1NA 1E8XA 1E9MA 2K2UA 1X05A 1XQQA 1TY0A 4Z2MB 1JALA 3FAHA 1L4ZB 4F8CB 2L32A 3AXCA 1KLVA 1XLPA 3ZLZA 2KDBA 2KQSA 4RF0A 1ST7A 3O65B 3WIMA 2B3AA 3UQAA 1BTNA 1ZDXA 2RLOA 4ZRIA 2LXAA 2MFQA 2CHWA 1MKEA 1ZDVA 4N9F4 3RZFA 1MG8A 1KFYB 3VDZA 2OJRA 2G45B 1XXGA 2VH2A 3NVVA 4KGTA 3HK0A 2JF5A 2QCZA 4BKSA 3DCXA 4OVZA 4YTPB 2LI5A 3IAS1 2N7DA 1WJ4A 1XLQA 5D3YA 4Q2JA 4JWUC 2IDYA 5D6JB 1FHXA 3DPDA 2NS5A 3KWLA 3ULBA 4P6VF 1FCCC 3K9PB 4XC2A 2FE8A 1YN5A 3A33B 2NBVA 4JQWC 2IYDB 2KAJA 1YOVB 4E3CA 4ACFA 3MTNB 3AEGB 1PDXA 2V3PA 2RDGA 1NEKB 5C1ZA 3A1QA 4AS1A 2LHDA 4LCDE 5M4YB 2EC1A 1FRDA 2AWTA 1D4BA 4XWXA 3N9YC 2DX1A 4XYCA 1T3QA 1JMLA 3NVYA 3V05A 3U7ZA 2GBKA 2N9XA 3ODOA 3V6EB 2DKPA 4KZCA 2ONQA 3A8QA 4KKJA 2D9VA 4A8XC 2HTHB 4J6IA 2R2YA 3PZDA 1MG4A 3MJ5A 3W1SA 4RGNA 4GMVA 1SGHA 1R7SA 1PQSA 4M0WB 1RYJA 3AU5A 1T6BX 3V60A 3PRMB 3AB5A 4TV3A 3SUZA 1N6ZA 1U29A 3TEZA 2MEKA 2LHEA 5G2NA 4KVGB 3RI7C 4TKNA 3ZDTA 1MHHE 2NZ8B 4FBJB 2BTEA 1TS4A 2YSZA 2P0FA 3D32A 2DHIA 1J7AA 3URYA 4JK8A 4A6FA 2BYVE 4F7HA 1K5GB 4ANUA 2BVCA 3L54A 3BYTB 2QEJC 1TT5B 4HDQA 3PREA 3HM6X 1PMSA 4J3OD 2N9EB 1FIQA 1WJMA 3BK2A 1SIFA 3BJIA 3ZJUA 2W82A 3RUIB 2DYOA 2PE9A 4I6PA 2XBBC 4ILJA 1MAIA 4M02A 4DXGA 1RJ2A 3AE8B 5BYSA 1RAXA 2KN4A 4G0NB 2W3RA 4US9A 1WXQA 2MH7A 1KI1B 4LJOB 1GPXA 2G1EA 2W2WA 4K3CA 2KN5A 4HB4B 3I57A 2KD0A 3HSAA 1J7CA 2D3CA 4YSYB 5MPOA 2ICIA 4NNJB 1WXMA 4GZUA 5KCVA 3A1QB 1F9JA 4MDKE 2AYOB 2K6DB 5J17A 5D3WA 2BKRB 4DDID 1N3HA 1ZGUB 3A9JA 3EFCA 2JT4B 1W1GA 4KHOA 5J2RA 1UGMA 3VR8B 1QQRA 1TZ1A 4WWPA 3NZ3A 3NWFA 3QA8A 1RLFA 3SBTA 5E6JA 3W1SC 3VHTC 3F0WA 2ADZA 2FJLA 4HDOA 4WIPA 3ZO5B 3MHZA 4II3B 1UBQA 3TEYA 1V1OA 4II2B 2DX5A 1XLNA 1MFWA 1UNPA 2NCNA 2JX5A 1ESFA 3TCAA 2KC1A 3H9DA 2D3BA 3E56A 3BINA 3T3NA 3M63B 2JRHA 2KMCA 3PPAA 2J42A 5IP4D 5G55A 1JRPA 1FD6A 1UPQA 2K3UA 4DHJB 1F52A 2R2QA 1JCKB 2N0SB 3M95A 4K1RB 4CHMA 4P16A 3GYOA 2UWQA 2REXA 2Z0OA 4A55A 2D2QA 1V80A 2MJEA 2L00B 3KYCD 4GOCA 4RM8A 1BMLC 1UD7A 2KWCA 2WXMA 2AQ2B 3AN1A 4DHJD 4FJVB 2L1AA 1VZ7A 3PHWB 4ANVA 1TS2A 2LZ6A 3KSYA 3IT6B 1YMHE 3NWAA 3P6AA 3H8HA 3RMKC 2RDHA 3FM8C 4G3XB 5HI1A 4F7GA 1SE4A 3GE3C 4QJ4B 1Q1OA 3IBEA 3ZTCA 1QQGA 1C1YB 3VRAB 2BGFA 2IGGA 3A9JB 4ICUA 4NAMA 2KQ7A 3GB1A 4K7UA 4LNFA 2WXQA 2AQ3B 3EA6A 3BIID 1WXSA 3DBHI 1F1HA 5J3QA 2RMMA 3DBLB 2K9XA 1IBXA 2INDC 1Y5OA 3DOWA 3LYYA 2DZKA 4DX90 3AE5B 3QHTA 1EU3A 2DKQA 2C7HA 1V81A 3DBRB 5IN7A 4ARIA 2MBQA 3D8DA 2J4XA 2KDIA 1R4MI 2LWPA 4BKGA 1KBLA 1WH3A 5GOWB 3RYTA 3CSFA 3EGRA 2FIDA 2FNJB 1P1AA 3EECA 2CY5A 4NQKE 1JW9D 3H6NA 2V9HA 3QAQA 5FI1A 2WQYB 4L2YA 3VH4B 2CJNA 4KIKA 1LQBA 1D3ZA 2JY6A 5L81A 1DDMA 2KDFB 1KH0A 4OSNA 2W3SA 2I1KA 1X1FA 1T0YA 4EZLA 2KMAA 4MGZE 4W9IA 1IP9A 2ZCBA 1V5MA 2DZJA 1Z87A 2FUHB 2D11A 1YJ1A 3RNCC 1OQRA 1E0ZA 3NW8A 1ZW7A 1AYFA 2MHJA 2GCLA 3WAPA 2N9LA 3GYPA 4Z2NA 2EMSA 3W9CB 1N61A 3ONSA 5H8YE 4HROA 4XDDA 3ZVVA 2YEPF 4A20A 2VRWB 5C5BA 3A9KB 3CMMB 1V6EA 2I5CA 1DBHA 2WXRA 1FXIA 3OWEB 1GC6A 2KIGA 3BY4B 4GIVA 3MDBC 3PLUA 1QOBA 1X1GA 3AV8A 5IOIA 1OFFA 3UINB 1WR6E 1IBXB 1TYGB 2IJ0A 1E7VA 1QLBB 4WJOA 4XWTA 1WY8A 2RQ1A 1QF6A 1FM0D 3W5UB 1KLUD 3A8PA 3NG0A 2KNBA 4IOYX 2WXIA 2K22A 4H2AA 4D0NB 2BQQA 4RFBA 1CQVA 1NTYA 2LOZA 3L08A 1J19A 5HHDG 1VD2A 4ASWC 5JZEB 2XEWA 4GGQA 4HXDA 2ZJDA 2Y8GA 1BT0A 1AW7A 4HHVA 5C6RA 1IRSA 3QWZB 2A4ZA 2Z59B 1ZC4B 3HW2B 1K50A 2MBEA 4KIKB 2E2XA 3PSEB 1WGYA 1YN3A 3QX1A 1IGCA 1NTVA 4BZAA 4EOYA 2ZVNA 2HTME 3U2SC 1NVLA 4KGRA 1NENB 1B55A 1SJHD 2DTCA 1N63A 4XDCA 3BWUD 2ELBA 3PEGA 1ZKHA 3CWIA 1QILA 2DN6A 2IY0B 3KW5B 1JWSD 2X0SA 4G11A 4OT1A 5JVLA 3CXBB 4HPMB 4P1BC 5HE2A 4OHJA 1MPHA 3LJUX 5CX3A 1SBBB 2LJIA 3RNBC 2ACZB 1GB4A 2NMQA 2V3NA 3P2BA 5FI0A 2C7MB 1I4PA 1XD3B 1DOXA 2C60A 3MC9A 2NTSA 4CQNA 3ECIA 1G6JA 5HE0A 2W2XC 1Y19B 4MY6A 3OG5A 3ZJTA 3EHVA 3IHPC 2KKCA 2LGIA 1E10A 2MKRA 3B08A 5D2MB 1GAQB 2WXGA
chains in the Genus database with same CATH topology
2JUOA 4NJ6A 1UEFA 2LVPA 5IJMA 3KRWA 1U5DA 3UZTA 2UZSA 3PRPB 3V5WA 1WGHA 3DDCB 3VAWA 2CHXA 3SHQA 2KTFA 1JRUA 4Y94A 1XCGA 1WX8A 2XK5A 4W9EA 1V88A 4WJNA 1ISNA 2ZPYA 1R4NI 1J0WA 2MWSB 2KGXB 4NJ7A 2LRUA 2LGYA 1HE8A 2RUKB 5DPSA 2GBMA 1YX5B 2QKMA 3U8ZA 2MBOA 5JHGA 1ZVRA 4P7IA 2MWNB 2KO3A 3H7PB 2RD0A 4EJNA 2K8HA 3OAWA 5EFXA 2LGDA 3DXEA 1W1DA 1WM2A 2YT0A 3RCZA 3NHEB 4KHAA 2HJ8A 3TJPA 4EZKA 2GOWA 2D9ZA 1WI0A 1OY2A 3EC8A 3ZRCA 2ZNVB 2IYBA 1GC7A 2LJ5A 5KQ4A 2VRRB 2ZNVC 1V2YA 2NR2A 4G50A 4F7ZA 2IO3B 1NU2A 4K7WA 1FAOA 3PVUA 2DZIA 4IC7B 4FADA 1E7UA 1DYNA 5D7GA 2BCJA 3MJWA 4DBGA 2HTHA 2KXJA 4F1SA 3PTFC 1W1HA 3ZW3A 3QBVB 3PV1A 2L1CA 3KY9A 4FHJA 2I1JA 5C79A 2XK5B 2XQNM 3SNHA 1V86A 2LASA 5AZHA 3NY5A 5DPWA 4JK9A 2P8VA 4GMXB 1AWEA 4HLEA 2FIFA 4EUTA 2KC2A 2CU1A 5BO4B 3DVNU 2CHZA 4WAAA 1E8ZA 2KHWB 3Q3JA 1I7AA 2D4QA 4IFSA 3ZNID 1S1QB 3KZ1A 5FR6A 3NZUA 1WGDA 4HAVB 3ZKJC 4I6LB 1M7EA 1TTNA 1E8WA 3AJ4A 3JVZX 4MGKE 4JGHB 4HB3B 4TUUA 2R82A 2JZ3B 2K25A 2K6QA 4LDTD 3A98B 4KDIC 2J0KA 2CAYA 5LXHA 2K8CA 3G9WA 2N4FA 2ABDA 5CLQB 4MGYE 3ODXA 3DCGA 4MEMA 3ZNGC 1EUVB 3U30A 2WX1A 4MSQB 3ZRFA 2RVBB 2KANA 2NPTA 4MSMB 1Q5WB 4FJYA 1U5FA 2DAJA 2L3ZA 3E66A 1FB8A 4K7SA 4PNKA 4IWPA 4KHBB 2CS4A 4GDKB 4URKA 5L95C 2KCJA 1FGZA 1XR0B 4IM0A 4AOFA 3ZUNA 4M8MA 3V61A 2FJ9A 4DHZB 3PRZA 4A6KA 3MPXA 3DVGX 4K81A 3R7QA 1EGXA 4ZDVA 2ZCCA 1TBEA 1ACAA 1UH6A 2DHKA 3DXDA 2MCNB 2MP2A 3VUWA 4W9FA 2M4NA 1U5GA 1WMHB 2G35A 3I3TB 1WZ0A 3T8MA 1J0GA 5JLJB 2KK8A 1YD8U 3N3KB 2PE6B 3WYFB 5CLLB 1V49A 3TMPB 2V3SA 1JDEA 2K8BA 5LLIA 2DYQA 5C23A 1Z2MA 3F5RA 2NPTB 3VUYA 3L0WB 2QKLA 1WIAA 4KZ0A 4WJQA 1UPRA 4MGIE 1U4AA 1WZ3A 2RSUA 3EFUA 4IAPA 2J0MA 3FLVA 1A5RA 1BWNA 2DIKA 3NZSA 2KWVB 2DYNA 3UGBB 2M0XA 2L0TA 2J0JA 1I2HA 2LYDA 3E9PA 3DXCA 4NY0A 2MA9B 4B6WA 4OVUA 4EZJA 5HE1A 1WM3A 1FHWA 1LB1A 5JHBA 2LXCA 2O6VB 2COCA 4PQ0A 1WF9A 2MP2B 3PVWA 4AJYB 3E9OA 4MK0A 4NSWA 1WVHA 2COFA 2G3QB 3VTWA 3HIZA 1VCBA 3A9KA 3FSSA 1WG7A 5J18A 1KM7A 2O6VD 1GG3A 2LVOA 3DBLI 5E6NA 1FOEA 2YLMA 3CIKA 5AZGA 5JP4A 4CHKA 2R09A 2D9XA 4JKAA 2G4DB 1U5EA 2NBWB 1IPGA 3W1YA 2N1VA 4NPNA 2D9WA 2N1WA 1EVHA 2WWZA 3SO6A 1OGWA 4BBNC 2NBUA 2M8SA 4FN2A 4WVFB 3PGEA 2BF8B 4AWJA 3SDLC 3TBLD 5IAAC 3KRXA 3QIJA 5J3TA 2NMBA 2DLWA 2YRYA 1LXDA 3VXWA 2K2JA 2Q13A 1M7RA 5E6PA 1OEYJ 2M14A 2IY1B 2L8JA 1WXVA 2LKOA 2H7EA 2Y8FA 5TR5A 4JKEA 4ILGB 4HVBA 2HD5B 4FLHA 1DROA 2DZMA 1V89A 2V4LA 3JSVA 3TL5A 3X0WA 3JYUA 4MJSA 3RT3B 4C0AA 3UF8A 4TQ0A 5CHFA 3VOQA 4HATB 2DAFA 2ZZPB 1H4RA 3VVWB 4YL8A 2GBJA 1ZM0A 4WQOB 4PYZA 1P3QU 1KZ7A 1UZXB 2VKIA 5LONB 3ZNZB 4W9CA 4IUMB 3H7SA 1VBHA 1TQZA 3VIAA 4NAWB 4A3OA 3HQCA 2YS3A 3L13A 3WALA 5D3VA 2GBNA 3N30A 2LG1A 3EPYA 3RD2A 2M17A 3R7RA 1H10A 3KUCB 3H7PA 5AEKB 2KFKB 4HAXB 1YX6B 2KJHB 1KC7A 3ZDMC 5GMVA 3T06A 4FHKA 2BYFA 1V5PA 4XX5A 2UZRA 2GS0A 2FCQA 4MELA 2NVUI 1QZEA 3QJZA 4XZ4A 3JSVB 3SBGA 2LRWA 4KSKC 4MJSB 2IO1B 3TIXA 1GUAB 2MX2A 1WE6A 3DQVA 3DVGY 3H1UA 5KQ1A 1KOTA 2W9NA 1XD4A 2FDQA 2UVMA 1S3SG 1TGZB 1X86A 5DH9B 3TW1A 1XX0A 1SHCA 2KVRA 4DHZE 5L83A 3Q3FA 5LXIB 5HKHA 4GN1A 3M62B 2ASQA 3QC8B 2V76A 2IO2B 2LBBA 4W9DA 2JVCA 3PG7A 5DIFB 2Y7BA 2MQJA 3B0AA 4HB0B 2R0DA 3PP2A 4K2OA 2LD9A 2ZVOA 3GZNI 3ZIMA 1VBGA 2Z0DB 2YF0A 1EAZA 3WA0A 3WANA 1OQNA 1EF5A 2LVQA 3N7CA 3ML9A 4HJKA 4FA6A 1P3RA 2J59M 2FAZA 3QARA 2M38A 4JKCA 3TO1A 3UIPB 4BOSC 1UELA 1WI1A 1ZSQA 1Z5SB 2G4SA 3K9OB 5JHAA 4CO7A 4X57B 2MBHA 1WX7A 5CTRC 1WGUA 3KYDD 2DFKA 1TXDA 2D3GA 4W9LA 1XKEA 3TVVA 4M8NA 3T9LA 4TYZA 2KX3A 3ENEA 1BAKA 5C16A 2KDEB 3DBSA 1P6SA 2DENB 1LFDA 3UIOB 2L7RA 2JPHA 4GSWA 4GDKA 2OOBB 3CF6E 2JZZA 1U2BA 1XT9B 1YQBA 4NQLB 2JP2A 4IWQA 4B95A 4AUQC 3B1LX 4LDTB 5DHAB 2CY4A 2YT1A 3V6CB 4IG7B 2DHJA 2N7EA 4A6HA 4ANXA 2BWFA 4K2PA 3AULA 4W9JA 4WJPA 2J7QB 2V1YA 2ELAA 1P9DU 1WMHA 4ICVA 2GMIC 4PS8A 1C3TA 5J3YA 4IM3A 4WSFA 4FJZA 3QWMA 3LJ3A 3DVNV 2L2IA 4AP4C 2FCSA 4RM9A 1UBIA 1YIWA 2PEAA 1WGGA 2DYMA 3L17A 2YVCA 1V9JA 3L10B 2RNRB 2PZ1A 3CSTA 2LGXA 5EDSA 2Z0PA 2CRFA 2KTRB 3VH3B 3ENBA 1WJ1A 3JW0X 3S2AA 4YONA 3MHSD 5CHWA 3QCAA 4GXBA 4DX8A 4DDGD 3ODWA 4BFRA 2PJHA 4WWOA 1X11A 5IA7A 3IFWB 3PLVA 2MLBA 1XODA 2N0YA 3HHMA 4IWOA 4IW0A 3VQIA 4JKBA 3D8FA 2Z0QA 2D07B 2CR5A 3WAOA 2O6VA 4JK7A 2RPQA 1EF1A 2GJYA 2MRPA 3OANA 4DWFA 1DDVA 2KFJA 3N32A 4TQ1A 1NI2A 2JRIB 4BKTA 1WGQA 4ZRKA 2QHOA 3E9LA 1OMWA 2NBVB 3PSCA 2C5LC 1OTRB 3PT2B 4BKSD 2OTXA 3SV1A 4JKGA 4CHJA 3IVFA 1X1MA 2UYZB 3QK0A 3KUZA 5JH5C 1U27A 2GCJA 2KUPA 2KX0A 4OVVA 4HB2B 4JKHA 2WDTB 4GPTB 1KJTA 2H7DA 5AZFA 1NDDA 1WJNA 2K1FA 3OJ3A 4JL9A 1UNRA 3R66C 3APCA 4MT7A 2K00A 2N9PC 5DI9B 4A5KA 4HPLB 3OLMD 4F7UP 4K17A 4CYEA 1MK7B 4KSLC 1V5UA 2DA0A 4ZYNA 3LDZE 3RULA 5DHFB 2AL6A 1FXTB 2ROVA 2N23A 3OJ4B 2BKFA 4A6FB 2IZVB 1WX9A 3UQBA 2FCNA 2M1MA 1LW3A 2CQUA 2X18A 4KAXB 4L6EA 2DHZA 4WJ7A 2YS1A 4RMAA 2MBBB 4HAYB 3M3JA 5HE3A 4BVUC 2I5FA 3SYXA 3D8EA 4DBBA 4JKGB 2RSGA 3AU4A 4MM3A 3DBRI 3APDA 3V62A 3SU8X 1OQYA 3A4SC 2OQBA 2EMTA 3ML4A 1DIKA 4PS3A 4E74A 2GBRA 4KDLB 4HAWB 3HM3A 1P5TA 4W9HA 4AJWA 2PPHA 1Y8RC 3U7DA 1EO6A 2VSZA 2ZEQA 1KZGA 5KHOA 1E8YA 2L0FA 3AI5A 4NAWA 2DX5B 3ZVRA 1V61A 1WJUA 2C7NB 4EFOA 2IO0B 1Q0WB 3SD5A 2WH5A 1E90A 2HE7A 1P0RA 2RGNB 1NTIA 4EMOA 2KFKA 2ROZB 4HWIB 4DK5A 4W9GA 5DPTA 2MSED 3APFA 4ZRJA 5JHHA 3VTUA 4FULA 1H8CA 2KZRA 4EKUA 5DPRA 2COPA 5DCNA 1UNQA 1DDWA 3KH0A 1OEYA 2L05A 2LUEA 3ALBA 2MDXA 4JKDA 2AEHA 2BPSA 1K5DB 1HBKA 1I35A 4BOZB 3PVLA 1MK9B 2JWZA 5E6OA 1WFYA 2ZPNA 1MIXA 4JKFA 3IG3A 3RZWC 1RRBA 2KJRA 4HCNB 4IM2A 1AQCA 4WWNA 5D27A 3NOBA 2IBIB 3VTVA 5CHVC 2YS5A 3ZNHB 4GDLA 1PLSA 3ML8A 2Z0EB 3C0RB 3KUDB 4ANWA 3R3MA 2K39A 3FEHA 2CKHB 3NS8A 1L7YA 3X23A 3RCPA 4HCPB 1HB8A 3VFKA 1IYFA 1RFAA 4PYUA 4E71A 2D10A 1TJ6A 4HAUB 2DYBA 3TFMA 2O2VA 3ULCA 1E5WA 1WYWB 1WR1A 4MH0E 4A3PA 4ILHA 3NSUA 1Q67A 4GB9A 3FP5A 4HAZB 1GNUA 2R2OA 3ZTDA 1V5OA 2KWUB 4BBKA 2CB8A 2BYEA 4JIOU 1K8RB 2P0DA 5C5BB 2MW5A 3KVFB 4PS7A 1ZC3B 1P98A 1WRDB 2C9WB 4GU2A 2Y5BB 3VUXA 2KLCA 1WE7A 2P0HA 2BWES 4I6NB 1M94A 3PS6A 4HK2A 4LJPB 1QC6A 2W2XD 5KHQA 4EEWA 4GDLB 2WYQA 3L16A 3WAMA 1FHOA 2KOXA 1MIZB 3A4RA 1J8CA 2IFSA 4B6HA 2FCMA 2CODA 3O96A 1NBFC 3PHXB 1SE9A 4JLCA 2O2VB 1WGRA 2LULA 1RRPB 1I42A 2HRJA 2D9YA 2AL3A 1CMXB 2A5UA 4BBNF 2LOXA 1GJZA 1BTKA 1V5TA 1PFJA 2RR9A 4W9KA 1GGOA 4B9KA 4DXAB 1WJ6A 2KLGA 5D94A 4KV2A 3QQ8B 5D3XA 2JXXA 5LOPB 2RGFA 1WXAA 1AARA 3GOEA 3M1IB 2EJ8A 4H8SA 2EKEC 2KTRA 1LM8B 2WX0A 1FGYA 3P7ZA 1L2NA 1HB6A 2L76A 2KJ6A 2COAA 1E8XA 2K2UA 1X05A 1XQQA 4Z2MB 4F8CB 3AXCA 1KLVA 3ZLZA 2KDBA 2KQSA 1ST7A 3O65B 3WIMA 2B3AA 3UQAA 1BTNA 2RLOA 4ZRIA 2LXAA 2MFQA 2CHWA 1MKEA 4N9F4 3RZFA 1MG8A 3VDZA 2OJRA 2G45B 3HK0A 2JF5A 4BKSA 2LI5A 2N7DA 1WJ4A 5D3YA 5D6JB 1FHXA 3DPDA 2NS5A 3ULBA 3K9PB 4XC2A 3A33B 4JQWC 2IYDB 4E3CA 3MTNB 5C1ZA 3A1QA 4LCDE 2EC1A 2AWTA 4XWXA 2DX1A 2GBKA 2N9XA 3ODOA 3V6EB 2DKPA 4KZCA 3A8QA 2D9VA 2HTHB 4J6IA 3PZDA 3W1SA 4GMVA 1SGHA 1PQSA 4M0WB 3AU5A 3V60A 3PRMB 4TV3A 3SUZA 1U29A 5G2NA 4KVGB 4TKNA 3ZDTA 4FBJB 2NZ8B 2YSZA 2P0FA 3D32A 2DHIA 4JK8A 4A6FA 2BYVE 4F7HA 1K5GB 4ANUA 3L54A 4HDQA 3PREA 3HM6X 1PMSA 2N9EB 1WJMA 1SIFA 3BJIA 3RUIB 2DYOA 2PE9A 4I6PA 2XBBC 4ILJA 1MAIA 1RJ2A 1RAXA 4G0NB 1KI1B 4LJOB 2W2WA 2KN5A 4HB4B 2KD0A 4NNJB 1WXMA 4GZUA 5KCVA 3A1QB 1F9JA 4MDKE 2AYOB 2K6DB 5J17A 5D3WA 2BKRB 4DDID 1N3HA 1ZGUB 3A9JA 2JT4B 1W1GA 4KHOA 5J2RA 1UGMA 1TZ1A 4WWPA 3QA8A 1RLFA 3SBTA 3W1SC 3VHTC 3F0WA 2ADZA 2FJLA 4HDOA 3ZO5B 4II3B 1UBQA 4II2B 2DX5A 1UNPA 2NCNA 2KC1A 3TCAA 3H9DA 3BINA 3M63B 2JRHA 2KMCA 3PPAA 5G55A 1UPQA 4DHJB 2R2QA 3M95A 4K1RB 4CHMA 3GYOA 2UWQA 2REXA 2Z0OA 2D2QA 1V80A 2L00B 3KYCD 4GOCA 4RM8A 1UD7A 2KWCA 4DHJD 4FJVB 3PHWB 4ANVA 2LZ6A 3KSYA 3P6AA 3FM8C 4G3XB 4F7GA 1Q1OA 3IBEA 3ZTCA 1QQGA 1C1YB 2BGFA 3A9JB 4ICUA 2KQ7A 4K7UA 1WXSA 3DBHI 5J3QA 1Y5OA 3DOWA 2DZKA 4DX90 3QHTA 2DKQA 2C7HA 1V81A 2MBQA 3D8DA 2KDIA 1R4MI 2LWPA 4BKGA 1KBLA 1WH3A 5GOWB 3RYTA 3CSFA 2FIDA 2FNJB 1P1AA 3EECA 2CY5A 4NQKE 3H6NA 3QAQA 5FI1A 3VH4B 4KIKA 1LQBA 1D3ZA 2JY6A 5L81A 1DDMA 2KDFB 2I1KA 1X1FA 1T0YA 4EZLA 2KMAA 4MGZE 4W9IA 1IP9A 2ZCBA 1V5MA 2DZJA 1Z87A 2FUHB 2D11A 1YJ1A 1ZW7A 2GCLA 3WAPA 3GYPA 4Z2NA 2EMSA 3ONSA 3ZVVA 4A20A 2VRWB 5C5BA 3A9KB 3CMMB 1V6EA 2I5CA 1DBHA 1GC6A 3BY4B 4GIVA 3MDBC 3PLUA 1X1GA 3UINB 1WR6E 1E7VA 4WJOA 1WY8A 2RQ1A 3A8PA 2KNBA 4IOYX 4D0NB 1NTYA 2LOZA 3L08A 1J19A 1VD2A 4ASWC 5JZEB 2XEWA 4GGQA 4HXDA 2ZJDA 2Y8GA 1BT0A 4HHVA 5C6RA 1IRSA 3QWZB 2A4ZA 2Z59B 1ZC4B 3HW2B 2MBEA 4KIKB 2E2XA 3PSEB 1WGYA 3QX1A 1NTVA 4EOYA 2ZVNA 1NVLA 1B55A 2DTCA 2ELBA 3PEGA 1ZKHA 2DN6A 2IY0B 3KW5B 2X0SA 4G11A 5JVLA 3CXBB 4HPMB 5HE2A 1MPHA 3LJUX 5CX3A 3P2BA 5FI0A 2C7MB 1XD3B 2C60A 3ECIA 1G6JA 5HE0A 2W2XC 1Y19B 4MY6A 3EHVA 3IHPC 2KKCA 2MKRA 3B08A 5D2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUO A;  4NJ6 A;  1UEF A;  2LVP A;  5IJM A;  3KRW A;  1U5D A;  3UZT A;  2UZS A;  3PRP B;  3V5W A;  1WGH A;  3DDC B;  3VAW A;  2CHX A;  3SHQ A;  2KTF A;  1JRU A;  4Y94 A;  1XCG A;  1WX8 A;  2XK5 A;  4W9E A;  1V88 A;  4WJN A;  1ISN A;  2ZPY A;  1R4N I;  1J0W A;  2MWS B;  2KGX B;  4NJ7 A;  2LRU A;  2LGY A;  1HE8 A;  2RUK B;  5DPS A;  2GBM A;  1YX5 B;  2QKM A;  3U8Z A;  2MBO A;  5JHG A;  1ZVR A;  4P7I A;  2MWN B;  2KO3 A;  3H7P B;  2RD0 A;  4EJN A;  2K8H A;  3OAW A;  5EFX A;  2LGD A;  3DXE A;  1W1D A;  1WM2 A;  2YT0 A;  3RCZ A;  3NHE B;  4KHA A;  2HJ8 A;  3TJP A;  4EZK A;  2GOW A;  2D9Z A;  1WI0 A;  1OY2 A;  3EC8 A;  3ZRC A;  2ZNV B;  2IYB A;  1GC7 A;  2LJ5 A;  5KQ4 A;  2VRR B;  2ZNV C;  1V2Y A;  2NR2 A;  4G50 A;  4F7Z A;  2IO3 B;  1NU2 A;  4K7W A;  1FAO A;  3PVU A;  2DZI A;  4IC7 B;  4FAD A;  1E7U A;  1DYN A;  5D7G A;  2BCJ A;  3MJW A;  4DBG A;  2HTH A;  2KXJ A;  4F1S A;  3PTF C;  1W1H A;  3ZW3 A;  3QBV B;  3PV1 A;  2L1C A;  3KY9 A;  4FHJ A;  2I1J A;  5C79 A;  2XK5 B;  2XQN M;  3SNH A;  1V86 A;  2LAS A;  5AZH A;  3NY5 A;  5DPW A;  2P8V A;  4GMX B;  1AWE A;  4HLE A;  2FIF A;  4EUT A;  2KC2 A;  2CU1 A;  5BO4 B;  3DVN U;  2CHZ A;  4WAA A;  1E8Z A;  2KHW B;  3Q3J A;  1I7A A;  2D4Q A;  4IFS A;  3ZNI D;  1S1Q B;  3KZ1 A;  5FR6 A;  3NZU A;  1WGD A;  4HAV B;  3ZKJ C;  4I6L B;  1M7E A;  1TTN A;  1E8W A;  3AJ4 A;  3JVZ X;  4MGK E;  4JGH B;  4HB3 B;  4TUU A;  2JZ3 B;  2K25 A;  2K6Q A;  4LDT D;  3A98 B;  4KDI C;  2J0K A;  2CAY A;  5LXH A;  2K8C A;  3G9W A;  2N4F A;  2ABD A;  5CLQ B;  4MGY E;  3ODX A;  3DCG A;  4MEM A;  3ZNG C;  1EUV B;  3U30 A;  2WX1 A;  4MSQ B;  3ZRF A;  2RVB B;  2KAN A;  2NPT A;  4MSM B;  1Q5W B;  4FJY A;  1U5F A;  2DAJ A;  2L3Z A;  1FB8 A;  4K7S A;  4PNK A;  4IWP A;  4KHB B;  2CS4 A;  4GDK B;  4URK A;  5L95 C;  2KCJ A;  1FGZ A;  1XR0 B;  4IM0 A;  4AOF A;  3ZUN A;  4M8M A;  3V61 A;  2FJ9 A;  4DHZ B;  3PRZ A;  4A6K A;  3MPX A;  3DVG X;  4K81 A;  3R7Q A;  1EGX A;  4ZDV A;  2ZCC A;  1TBE A;  1ACA A;  1UH6 A;  2DHK A;  3DXD A;  2MCN B;  2MP2 A;  3VUW A;  4W9F A;  2M4N A;  1U5G A;  1WMH B;  2G35 A;  3I3T B;  1WZ0 A;  3T8M A;  1J0G A;  5JLJ B;  2KK8 A;  1YD8 U;  3N3K B;  2PE6 B;  3WYF B;  5CLL B;  1V49 A;  3TMP B;  2V3S A;  2K8B A;  5LLI A;  2DYQ A;  5C23 A;  1Z2M A;  3F5R A;  2NPT B;  3VUY A;  3L0W B;  2QKL A;  1WIA A;  4KZ0 A;  4WJQ A;  1UPR A;  4MGI E;  1U4A A;  1WZ3 A;  2RSU A;  3EFU A;  4IAP A;  2J0M A;  3FLV A;  1A5R A;  1BWN A;  3NZS A;  2KWV B;  2DYN A;  3UGB B;  2M0X A;  2L0T A;  2J0J A;  1I2H A;  2LYD A;  3DXC A;  4NY0 A;  2MA9 B;  4B6W A;  4OVU A;  4EZJ A;  5HE1 A;  1WM3 A;  1FHW A;  1LB1 A;  5JHB A;  2LXC A;  2O6V B;  2COC A;  4PQ0 A;  1WF9 A;  2MP2 B;  3PVW A;  4AJY B;  4MK0 A;  4NSW A;  1WVH A;  2COF A;  2G3Q B;  3VTW A;  3HIZ A;  1VCB A;  3A9K A;  3FSS A;  1WG7 A;  5J18 A;  1KM7 A;  2O6V D;  1GG3 A;  2LVO A;  3DBL I;  5E6N A;  1FOE A;  2YLM A;  3CIK A;  5AZG A;  5JP4 A;  4CHK A;  2R09 A;  2D9X A;  2G4D B;  1U5E A;  2NBW B;  1IPG A;  3W1Y A;  2N1V A;  4NPN A;  2D9W A;  2N1W A;  1EVH A;  2WWZ A;  3SO6 A;  1OGW A;  4BBN C;  2NBU A;  2M8S A;  4FN2 A;  4WVF B;  3PGE A;  2BF8 B;  4AWJ A;  3SDL C;  3TBL D;  5IAA C;  3KRX A;  3QIJ A;  5J3T A;  2NMB A;  2DLW A;  2YRY A;  3VXW A;  1LXD A;  2K2J A;  2Q13 A;  1M7R A;  5E6P A;  1OEY J;  2M14 A;  2IY1 B;  2L8J A;  1WXV A;  2LKO A;  2H7E A;  2Y8F A;  5TR5 A;  4HVB A;  2HD5 B;  4FLH A;  1DRO A;  2DZM A;  1V89 A;  2V4L A;  3JSV A;  3TL5 A;  3X0W A;  3JYU A;  4MJS A;  3RT3 B;  4C0A A;  3UF8 A;  4TQ0 A;  5CHF A;  3VOQ A;  4HAT B;  2DAF A;  2ZZP B;  1H4R A;  3VVW B;  4YL8 A;  2GBJ A;  1ZM0 A;  4WQO B;  4PYZ A;  1P3Q U;  1KZ7 A;  1UZX B;  2VKI A;  5LON B;  3ZNZ B;  4W9C A;  4IUM B;  3H7S A;  1TQZ A;  3VIA A;  4NAW B;  4A3O A;  3HQC A;  2YS3 A;  3L13 A;  3WAL A;  5D3V A;  2GBN A;  3N30 A;  2LG1 A;  3EPY A;  3RD2 A;  2M17 A;  3R7R A;  1H10 A;  3KUC B;  3H7P A;  5AEK B;  2KFK B;  4HAX B;  1YX6 B;  2KJH B;  3ZDM C;  5GMV A;  3T06 A;  4FHK A;  2BYF A;  1V5P A;  4XX5 A;  2UZR A;  2GS0 A;  2FCQ A;  4MEL A;  2NVU I;  1QZE A;  3QJZ A;  4XZ4 A;  3JSV B;  2LRW A;  4KSK C;  4MJS B;  2IO1 B;  3TIX A;  1GUA B;  2MX2 A;  1WE6 A;  3DQV A;  3DVG Y;  3H1U A;  5KQ1 A;  1KOT A;  2W9N A;  1XD4 A;  2FDQ A;  2UVM A;  1S3S G;  1TGZ B;  1X86 A;  5DH9 B;  3TW1 A;  1XX0 A;  1SHC A;  2KVR A;  4DHZ E;  5L83 A;  3Q3F A;  5LXI B;  5HKH A;  4GN1 A;  3M62 B;  2ASQ A;  3QC8 B;  2V76 A;  2IO2 B;  2LBB A;  4W9D A;  2JVC A;  3PG7 A;  5DIF B;  2Y7B A;  2MQJ A;  3B0A A;  4HB0 B;  2R0D A;  3PP2 A;  4K2O A;  2LD9 A;  2ZVO A;  3GZN I;  3ZIM A;  2Z0D B;  2YF0 A;  1EAZ A;  3WA0 A;  3WAN A;  1OQN A;  1EF5 A;  2LVQ A;  3N7C A;  3ML9 A;  4HJK A;  4FA6 A;  1P3R A;  2J59 M;  2FAZ A;  3QAR A;  2M38 A;  3TO1 A;  3UIP B;  4BOS C;  1UEL A;  1WI1 A;  1ZSQ A;  1Z5S B;  2G4S A;  3K9O B;  5JHA A;  4CO7 A;  4X57 B;  2MBH A;  1WX7 A;  5CTR C;  1WGU A;  3KYD D;  2DFK A;  1TXD A;  2D3G A;  4W9L A;  1XKE A;  3TVV A;  4M8N A;  3T9L A;  4TYZ A;  2KX3 A;  3ENE A;  1BAK A;  5C16 A;  2KDE B;  3DBS A;  1P6S A;  2DEN B;  1LFD A;  3UIO B;  2L7R A;  2JPH A;  4GSW A;  4GDK A;  2OOB B;  3CF6 E;  2JZZ A;  1U2B A;  1XT9 B;  1YQB A;  4NQL B;  2JP2 A;  4IWQ A;  4B95 A;  4AUQ C;  3B1L X;  4LDT B;  5DHA B;  2YT1 A;  2CY4 A;  3V6C B;  4IG7 B;  2DHJ A;  2N7E A;  4A6H A;  4ANX A;  2BWF A;  4K2P A;  3AUL A;  4W9J A;  4WJP A;  2J7Q B;  2V1Y A;  2ELA A;  1P9D U;  1WMH A;  4ICV A;  2GMI C;  4PS8 A;  1C3T A;  5J3Y A;  4IM3 A;  4WSF A;  4FJZ A;  3QWM A;  3LJ3 A;  3DVN V;  2L2I A;  4AP4 C;  2FCS A;  4RM9 A;  1UBI A;  1YIW A;  2PEA A;  1WGG A;  2DYM A;  3L17 A;  2YVC A;  1V9J A;  3L10 B;  2RNR B;  2PZ1 A;  3CST A;  2LGX A;  5EDS A;  2Z0P A;  2CRF A;  2KTR B;  3VH3 B;  1WJ1 A;  3JW0 X;  3S2A A;  4YON A;  3MHS D;  5CHW A;  3QCA A;  4GXB A;  4DX8 A;  4DDG D;  3ODW A;  4BFR A;  2PJH A;  4WWO A;  1X11 A;  5IA7 A;  3IFW B;  3PLV A;  2MLB A;  1XOD A;  2N0Y A;  3HHM A;  4IWO A;  4IW0 A;  3VQI A;  3D8F A;  2Z0Q A;  2D07 B;  2CR5 A;  3WAO A;  2O6V A;  2RPQ A;  1EF1 A;  2GJY A;  2MRP A;  3OAN A;  4DWF A;  1DDV A;  2KFJ A;  3N32 A;  4TQ1 A;  1NI2 A;  2JRI B;  4BKT A;  1WGQ A;  4ZRK A;  2QHO A;  1OMW A;  2NBV B;  3PSC A;  2C5L C;  1OTR B;  3PT2 B;  4BKS D;  2OTX A;  3SV1 A;  4CHJ A;  3IVF A;  1X1M A;  2UYZ B;  3QK0 A;  3KUZ A;  5JH5 C;  1U27 A;  2GCJ A;  2KUP A;  2KX0 A;  4OVV A;  4HB2 B;  2WDT B;  4GPT B;  1KJT A;  2H7D A;  5AZF A;  1NDD A;  1WJN A;  2K1F A;  3OJ3 A;  4JL9 A;  1UNR A;  3R66 C;  3APC A;  4MT7 A;  2K00 A;  2N9P C;  5DI9 B;  4A5K A;  4HPL B;  3OLM D;  4F7U P;  4K17 A;  4CYE A;  1MK7 B;  4KSL C;  1V5U A;  2DA0 A;  4ZYN A;  3LDZ E;  3RUL A;  5DHF B;  2AL6 A;  1FXT B;  2ROV A;  2N23 A;  3OJ4 B;  2BKF A;  4A6F B;  2IZV B;  1WX9 A;  3UQB A;  2FCN A;  2M1M A;  1LW3 A;  2CQU A;  2X18 A;  4KAX B;  4L6E A;  2DHZ A;  4WJ7 A;  2YS1 A;  4RMA A;  2MBB B;  4HAY B;  3M3J A;  5HE3 A;  4BVU C;  2I5F A;  3SYX A;  3D8E A;  4DBB A;  2RSG A;  3AU4 A;  4MM3 A;  3DBR I;  3APD A;  3V62 A;  3SU8 X;  1OQY A;  3A4S C;  2OQB A;  2EMT A;  3ML4 A;  4PS3 A;  4E74 A;  2GBR A;  4KDL B;  4HAW B;  3HM3 A;  1P5T A;  4W9H A;  4AJW A;  2PPH A;  1Y8R C;  3U7D A;  1EO6 A;  2VSZ A;  2ZEQ A;  1KZG A;  5KHO A;  1E8Y A;  2L0F A;  3AI5 A;  4NAW A;  2DX5 B;  3ZVR A;  1V61 A;  1WJU A;  2C7N B;  4EFO A;  2IO0 B;  1Q0W B;  3SD5 A;  2WH5 A;  1E90 A;  2HE7 A;  1P0R A;  2RGN B;  1NTI A;  4EMO A;  2KFK A;  2ROZ B;  4HWI B;  4DK5 A;  4W9G A;  5DPT A;  2MSE D;  3APF A;  4ZRJ A;  5JHH A;  3VTU A;  4FUL A;  1H8C A;  2KZR A;  4EKU A;  5DPR A;  2COP A;  5DCN A;  1UNQ A;  1DDW A;  3KH0 A;  1OEY A;  2L05 A;  2LUE A;  3ALB A;  2MDX A;  2AEH A;  2BPS A;  1K5D B;  1HBK A;  1I35 A;  4BOZ B;  3PVL A;  1MK9 B;  2JWZ A;  5E6O A;  1WFY A;  2ZPN A;  1MIX A;  3IG3 A;  3RZW C;  1RRB A;  2KJR A;  4HCN B;  4IM2 A;  1AQC A;  4WWN A;  5D27 A;  3NOB A;  2IBI B;  3VTV A;  5CHV C;  2YS5 A;  3ZNH B;  4GDL A;  1PLS A;  3ML8 A;  2Z0E B;  3C0R B;  3KUD B;  4ANW A;  3R3M A;  2K39 A;  3FEH A;  2CKH B;  3NS8 A;  1L7Y A;  3X23 A;  3RCP A;  4HCP B;  1HB8 A;  3VFK A;  1IYF A;  1RFA A;  4PYU A;  4E71 A;  2D10 A;  1TJ6 A;  4HAU B;  2DYB A;  3TFM A;  2O2V A;  3ULC A;  1E5W A;  1WYW B;  1WR1 A;  4MH0 E;  4A3P A;  3NSU A;  1Q67 A;  4GB9 A;  3FP5 A;  4HAZ B;  1GNU A;  2R2O A;  3ZTD A;  1V5O A;  2KWU B;  4BBK A;  2CB8 A;  2BYE A;  4JIO U;  1K8R B;  2P0D A;  5C5B B;  2MW5 A;  3KVF B;  4PS7 A;  1ZC3 B;  1P98 A;  1WRD B;  2C9W B;  4GU2 A;  2Y5B B;  3VUX A;  2KLC A;  1WE7 A;  2P0H A;  2BWE S;  4I6N B;  1M94 A;  3PS6 A;  4HK2 A;  4LJP B;  1QC6 A;  2W2X D;  5KHQ A;  4EEW A;  4GDL B;  2WYQ A;  3L16 A;  3WAM A;  1FHO A;  2KOX A;  1MIZ B;  3A4R A;  1J8C A;  2IFS A;  4B6H A;  2FCM A;  2COD A;  3O96 A;  1NBF C;  3PHX B;  1SE9 A;  4JLC A;  2O2V B;  1WGR A;  2LUL A;  1RRP B;  1I42 A;  2HRJ A;  2D9Y A;  2AL3 A;  1CMX B;  2A5U A;  4BBN F;  2LOX A;  1GJZ A;  1BTK A;  1V5T A;  1PFJ A;  2RR9 A;  4W9K A;  4B9K A;  4DXA B;  1WJ6 A;  2KLG A;  5D94 A;  4KV2 A;  3QQ8 B;  5D3X A;  2JXX A;  5LOP B;  2RGF A;  1WXA A;  1AAR A;  3GOE A;  3M1I B;  2EJ8 A;  4H8S A;  2EKE C;  2KTR A;  1LM8 B;  2WX0 A;  1FGY A;  3P7Z A;  1L2N A;  1HB6 A;  2L76 A;  2KJ6 A;  2COA A;  1E8X A;  2K2U A;  1X05 A;  1XQQ A;  4Z2M B;  4F8C B;  3AXC A;  1KLV A;  3ZLZ A;  2KDB A;  2KQS A;  1ST7 A;  3O65 B;  3WIM A;  2B3A A;  3UQA A;  1BTN A;  2RLO A;  4ZRI A;  2LXA A;  2MFQ A;  2CHW A;  1MKE A;  4N9F 4;  3RZF A;  1MG8 A;  3VDZ A;  2OJR A;  2G45 B;  3HK0 A;  2JF5 A;  4BKS A;  2LI5 A;  2N7D A;  1WJ4 A;  5D3Y A;  5D6J B;  1FHX A;  3DPD A;  2NS5 A;  3ULB A;  3K9P B;  4XC2 A;  3A33 B;  4JQW C;  2IYD B;  4E3C A;  3MTN B;  5C1Z A;  3A1Q A;  4LCD E;  2EC1 A;  2AWT A;  4XWX A;  2DX1 A;  2GBK A;  2N9X A;  3ODO A;  3V6E B;  2DKP A;  4KZC A;  3A8Q A;  2D9V A;  2HTH B;  4J6I A;  3PZD A;  3W1S A;  4GMV A;  1SGH A;  1PQS A;  4M0W B;  3AU5 A;  3V60 A;  3PRM B;  4TV3 A;  3SUZ A;  1U29 A;  5G2N A;  4KVG B;  4TKN A;  3ZDT A;  4FBJ B;  2NZ8 B;  2YSZ A;  2P0F A;  3D32 A;  2DHI A;  4A6F A;  2BYV E;  4F7H A;  1K5G B;  4ANU A;  3L54 A;  4HDQ A;  3PRE A;  3HM6 X;  1PMS A;  2N9E B;  1WJM A;  1SIF A;  3BJI A;  3RUI B;  2DYO A;  2PE9 A;  4I6P A;  2XBB C;  1MAI A;  1RJ2 A;  1RAX A;  4G0N B;  1KI1 B;  4LJO B;  2W2W A;  2KN5 A;  4HB4 B;  2KD0 A;  4NNJ B;  1WXM A;  4GZU A;  5KCV A;  3A1Q B;  1F9J A;  4MDK E;  2AYO B;  2K6D B;  5J17 A;  5D3W A;  2BKR B;  4DDI D;  1N3H A;  1ZGU B;  3A9J A;  2JT4 B;  1W1G A;  4KHO A;  5J2R A;  1UGM A;  1TZ1 A;  4WWP A;  3QA8 A;  1RLF A;  3W1S C;  3VHT C;  3F0W A;  2ADZ A;  2FJL A;  4HDO A;  3ZO5 B;  4II3 B;  1UBQ A;  4II2 B;  2DX5 A;  1UNP A;  2NCN A;  2KC1 A;  3TCA A;  3H9D A;  3BIN A;  3M63 B;  2JRH A;  2KMC A;  3PPA A;  5G55 A;  1UPQ A;  4DHJ B;  2R2Q A;  3M95 A;  4K1R B;  4CHM A;  3GYO A;  2UWQ A;  2REX A;  2Z0O A;  2D2Q A;  1V80 A;  2L00 B;  3KYC D;  4GOC A;  4RM8 A;  1UD7 A;  2KWC A;  4DHJ D;  4FJV B;  3PHW B;  4ANV A;  2LZ6 A;  3KSY A;  3P6A A;  3FM8 C;  4G3X B;  4F7G A;  1Q1O A;  3IBE A;  3ZTC A;  1QQG A;  1C1Y B;  2BGF A;  3A9J B;  4ICU A;  2KQ7 A;  4K7U A;  1WXS A;  3DBH I;  5J3Q A;  1Y5O A;  3DOW A;  2DZK A;  4DX9 0;  3QHT A;  2DKQ A;  2C7H A;  1V81 A;  2MBQ A;  3D8D A;  2KDI A;  1R4M I;  2LWP A;  4BKG A;  1WH3 A;  5GOW B;  3RYT A;  3CSF A;  2FID A;  2FNJ B;  1P1A A;  3EEC A;  2CY5 A;  4NQK E;  3H6N A;  3QAQ A;  5FI1 A;  3VH4 B;  4KIK A;  1LQB A;  1D3Z A;  2JY6 A;  5L81 A;  1DDM A;  2KDF B;  2I1K A;  1X1F A;  1T0Y A;  4EZL A;  2KMA A;  4MGZ E;  4W9I A;  1IP9 A;  2ZCB A;  1V5M A;  2DZJ A;  1Z87 A;  2FUH B;  2D11 A;  1YJ1 A;  1ZW7 A;  2GCL A;  3WAP A;  3GYP A;  4Z2N A;  2EMS A;  3ONS A;  3ZVV A;  4A20 A;  2VRW B;  5C5B A;  3A9K B;  3CMM B;  1V6E A;  2I5C A;  1DBH A;  1GC6 A;  3BY4 B;  4GIV A;  3MDB C;  3PLU A;  1X1G A;  3UIN B;  1WR6 E;  1E7V A;  4WJO A;  1WY8 A;  2RQ1 A;  3A8P A;  2KNB A;  4IOY X;  4D0N B;  1NTY A;  2LOZ A;  3L08 A;  1J19 A;  1VD2 A;  4ASW C;  5JZE B;  2XEW A;  4GGQ A;  4HXD A;  2ZJD A;  2Y8G A;  1BT0 A;  4HHV A;  5C6R A;  1IRS A;  3QWZ B;  2A4Z A;  2Z59 B;  1ZC4 B;  3HW2 B;  2MBE A;  4KIK B;  2E2X A;  3PSE B;  1WGY A;  3QX1 A;  1NTV A;  4EOY A;  2ZVN A;  1NVL A;  1B55 A;  2DTC A;  2ELB A;  3PEG A;  1ZKH A;  2DN6 A;  2IY0 B;  3KW5 B;  4G11 A;  3CXB B;  4HPM B;  5HE2 A;  1MPH A;  3LJU X;  5CX3 A;  3P2B A;  5FI0 A;  2C7M B;  1XD3 B;  2C60 A;  3ECI A;  1G6J A;  5HE0 A;  2W2X C;  1Y19 B;  4MY6 A;  3EHV A;  3IHP C;  2KKC A;  2MKR A;  3B08 A;  5D2M B; 
#chains in the Genus database with same CATH topology
 2JUO A;  4NJ6 A;  1UEF A;  2LVP A;  5IJM A;  3KRW A;  1U5D A;  4XGA B;  3UZT A;  2UZS A;  3PRP B;  3V5W A;  1WGH A;  3DDC B;  3VAW A;  2CHX A;  3SHQ A;  2KTF A;  1JRU A;  4Y94 A;  1XCG A;  1WX8 A;  2XK5 A;  1L6U A;  4W9E A;  1V88 A;  4WJN A;  4JX1 C;  1ISN A;  1QOG A;  2QIL A;  2ZPY A;  1R4N I;  1J0W A;  2MWS B;  2M0A A;  2KGX B;  4NJ7 A;  2LRU A;  2LGY A;  1HE8 A;  2RUK B;  5DPS A;  2GBM A;  1N62 A;  5I2S A;  1YX5 B;  2QKM A;  1T0S C;  1DYQ A;  3W2D A;  3AEE B;  3U8Z A;  1YQ3 B;  2MBO A;  5JHG A;  1EWY C;  1NYQ A;  1UF0 A;  2LGS A;  4AQ7 A;  1IGD A;  4RGO S;  2W55 A;  1ZVR A;  2L52 A;  4P7I A;  1PGA A;  2MWN B;  1NVI D;  2KO3 A;  2RD0 A;  3H7P B;  4EJN A;  2K8H A;  2PTL A;  3OAW A;  5EFX A;  3FIL A;  2LGD A;  3DXE A;  1W1D A;  5AUK A;  1WM2 A;  3ABV B;  2YT0 A;  3RCZ A;  3GZN B;  3NHE B;  4KHA A;  2HJ8 A;  2JWU A;  4QXA B;  2GUM A;  3RNF C;  3KLS X;  4RF1 A;  2Z8L A;  3TJP A;  4EZK A;  2GOW A;  4GLS C;  2D9Z A;  1WI0 A;  1OY2 A;  3EC8 A;  1I4X A;  3ZRC A;  2ZNV B;  1YJI A;  2IYB A;  1GC7 A;  2LJ5 A;  5KQ4 A;  1HXY D;  1JWM D;  2VRR B;  2ZNV C;  1V2Y A;  2NR2 A;  1RFK A;  4G50 A;  4F7Z A;  2IO3 B;  1NU2 A;  4K7W A;  1FAO A;  3PVU A;  2DZI A;  4IC7 B;  3N1Z C;  2XN9 C;  4FAD A;  1E7U A;  2BT6 A;  1DYN A;  5D7G A;  2BCJ A;  4BAX A;  1JWU D;  3MJW A;  4DBG A;  2HTH A;  2KXJ A;  4F1S A;  3PTF C;  1W1H A;  1T0R C;  3ZW3 A;  3QBV B;  3PV1 A;  2L1C A;  3KY9 A;  3Q3N C;  3GS2 A;  1VR9 A;  1N5W A;  4FHJ A;  2I1J A;  4USA A;  5C79 A;  2XK5 B;  2XQN M;  3SNH A;  1V86 A;  2LAS A;  5AZH A;  3NY5 A;  5DPW A;  4JK9 A;  2P8V A;  2JU6 X;  1N5X A;  4GMX B;  2KT7 A;  1AWE A;  4KHB A;  4HLE A;  2FIF A;  3Q3M C;  4EUT A;  2KC2 A;  5D3D A;  5TSS A;  2CU1 A;  1C77 A;  5BO4 B;  3DVN U;  4L1B A;  2CHZ A;  4WAA A;  2PVG C;  1E8Z A;  2KHW B;  2JSV X;  2K49 A;  3AED B;  4B0E A;  3Q3J A;  3FIL B;  1TKE A;  2WP9 B;  1WYG A;  2LEK A;  3ETR A;  1I7A A;  2D4Q A;  4IFS A;  2WXF A;  4WWM A;  3ZNI D;  1S1Q B;  3A58 A;  3KZ1 A;  4GOU A;  5FR6 A;  3NZU A;  1WGD A;  4HAV B;  3ZKJ C;  4I6L B;  1BUI C;  1M7E A;  1D6E C;  2Q5W D;  3BVG A;  1TTN A;  1E8W A;  3AJ4 A;  3JVZ X;  4MGK E;  4JGH B;  4HB3 B;  4JPS A;  4TUU A;  2R82 A;  2JZ3 B;  2K25 A;  2K6Q A;  4LDT D;  3A98 B;  5FR3 A;  3VR9 B;  4KDI C;  1DOY A;  2J0K A;  2CAY A;  5LXH A;  2K8C A;  3G9W A;  2BS3 B;  4YSZ B;  3HRD D;  2Y5C A;  2Y5P A;  2N4F A;  2ABD A;  2D3A A;  3FKY A;  5CLQ B;  4MGY E;  3ODX A;  3DCG A;  3U4E G;  4MEM A;  3ZNG C;  1EUV B;  3U30 A;  2WX1 A;  3SFE B;  4MSQ B;  3ZRF A;  1ZXH A;  2RVB B;  2KAN A;  2KAC A;  2NPT A;  4DIX A;  4MSM B;  3W5V B;  2WHI A;  4ZHO A;  1Q5W B;  4RGT A;  2Y3A A;  4FJY A;  4S17 A;  1U5F A;  2DAJ A;  2L3Z A;  4IDI A;  3E66 A;  2KQ4 X;  2INN E;  1FB8 A;  4K7S A;  4PNK A;  4IWP A;  4A6Q A;  2PW9 A;  4KHB B;  1C78 A;  3VRB B;  3SEB A;  2CS4 A;  4GDK B;  3AEC B;  4URK A;  1FPY A;  3P4Q B;  5L95 C;  1MI1 A;  2KCJ A;  1YN4 A;  1FGZ A;  3L4P A;  3AE1 B;  2YEP B;  1JQ4 A;  1XR0 B;  4IM0 A;  2WXO A;  4AOF A;  3ZUN A;  4M8M A;  3V61 A;  2BBC A;  3U12 A;  2FJ9 A;  2BB5 A;  3ZYY X;  4DHZ B;  3PRZ A;  4A6K A;  1STE A;  2BW2 A;  3MPX A;  3DVG X;  4K81 A;  3R7Q A;  1EGX A;  4ZDV A;  2ZCC A;  1TBE A;  1ACA A;  1UH6 A;  1LGR A;  2DHK A;  4MH8 A;  3DXD A;  1FEH A;  1ZE3 D;  2MCN B;  2MP2 A;  3VUW A;  4W9F A;  3I9V 1;  2M4N A;  1U5G A;  1WMH B;  2G35 A;  3I3T B;  2GB1 A;  1WZ0 A;  3AH7 A;  1SE3 A;  3T8M A;  2FBW B;  1C4A A;  1J0G A;  5JLJ B;  2KK8 A;  5H92 C;  1YD8 U;  3N3K B;  1NYR A;  2PE6 B;  3WYF B;  1ZP0 B;  5CLL B;  3E9S A;  1WWT A;  1V49 A;  2QIE B;  2PVO D;  3TMP B;  3OHM B;  2SEB D;  2V3S A;  3MC0 B;  1JDE A;  4K3B A;  2K8B A;  5LLI A;  2DYQ A;  1L6V A;  5C23 A;  5IRS A;  3RFZ B;  5BYR A;  1Z2M A;  3F5R A;  2NPT B;  3VUY A;  2K0P A;  3L0W B;  2TSS A;  4DQO C;  2QKL A;  1WIA A;  1V97 A;  4KZ0 A;  1RM6 C;  1I4Q A;  4WJQ A;  3R8B A;  1UPR A;  4PK1 A;  4C80 A;  4MGI E;  1U4A A;  1WZ3 A;  2RSU A;  3EFU A;  4IAP A;  1VZ8 A;  2JXT A;  4HJG E;  3IAM 1;  2J0M A;  4MT5 A;  3FLV A;  5GXG B;  3TEX A;  1A5R A;  1BWN A;  2DIK A;  3NZS A;  4NJC A;  2KWV B;  2DYN A;  3UGB B;  2M0X A;  2L0T A;  2J0J A;  3GE8 C;  1AWD A;  1I2H A;  2LYD A;  4NZL B;  3E9P A;  3DXC A;  4NY0 A;  5D3I B;  2MA9 B;  4OZC A;  1FNU A;  1ROE A;  1TY2 A;  3B9J A;  4B6W A;  2QJL A;  4OVU A;  4EZJ A;  5HE1 A;  1WM3 A;  1FHW A;  1LB1 A;  5JHB A;  2LXC A;  2O6V B;  2COC A;  4PQ0 A;  4YWG G;  1MVK A;  3BK1 A;  1WF9 A;  1FCL A;  2MP2 B;  2QC8 A;  3PVW A;  2JQR B;  4AJY B;  3E9O A;  4MK0 A;  2X8X X;  3MP9 A;  4NSW A;  1WVH A;  2COF A;  1TKG A;  4DXF A;  2G3Q B;  3VTW A;  3HIZ A;  2RDB C;  1L0X B;  1VCB A;  3A9K A;  3FSS A;  1WG7 A;  5J18 A;  1KM7 A;  2O6V D;  2IGH A;  1GG3 A;  2LVO A;  3DBL I;  5E6N A;  1FOE A;  3NWD A;  2YLM A;  3T3O A;  3AE9 B;  5FK9 C;  2I2Y A;  1C79 A;  3CIK A;  3NJT A;  3P42 A;  5AZG A;  4B0M A;  5JP4 A;  4S0R A;  2R09 A;  2D9X A;  4CHK A;  2DLB A;  4JKA A;  1HTO A;  1ET9 A;  1FNW A;  1FFV A;  1RWS A;  2G4D B;  1U5E A;  2NBW B;  3FC4 A;  1IPG A;  3W1Y A;  1I4R A;  2N1V A;  4NPN A;  2D9W A;  4XE0 A;  3RNA C;  2N1W A;  1EVH A;  2WWZ A;  2KDM A;  3AM9 A;  3SO6 A;  1OGW A;  4BBN C;  4LNO A;  3BZD B;  2NBU A;  1KTK A;  2M8S A;  2Z13 A;  4FN2 A;  1C4P A;  4WVF B;  2KMM A;  4GNK B;  2XNA C;  3HVZ A;  3PGE A;  3SR6 A;  2BF8 B;  4AWJ A;  3SDL C;  2Z59 A;  3TBL D;  2PMV A;  5IAA C;  3KRX A;  1ZXI A;  3QIJ A;  5J3T A;  2NMB A;  4ZHP A;  2DLW A;  2YRY A;  3I63 C;  2N9K A;  1CZP A;  1LXD A;  3VXW A;  1YNT E;  4JE3 B;  3UI3 A;  2K2J A;  2Q13 A;  1M7R A;  5E6P A;  4M00 A;  2E6X A;  1OEY J;  2M14 A;  2IY1 B;  4US8 A;  2L8J A;  1MJD A;  1WXV A;  2LKO A;  2H7E A;  4YSX B;  1K53 A;  2Y8F A;  5TR5 A;  4YXD B;  2R61 A;  4JKE A;  4ILG B;  4HVB A;  5BMH A;  2HD5 B;  4FLH A;  2Z14 A;  5EE9 A;  2GI9 A;  2M19 A;  1DRO A;  3FVC A;  4N6E B;  1JWB D;  4L1R A;  2DZM A;  2FJU B;  4MM3 B;  1V89 A;  2V4L A;  1TJE A;  2IGD A;  3JSV A;  3TL5 A;  3X0W A;  1HA5 A;  3JYU A;  4MJS A;  3RT3 B;  4IKG A;  2J53 A;  4C0A A;  1C4C A;  3DHH C;  3UF8 A;  4TQ0 A;  3RN9 C;  4QJ5 B;  5CHF A;  3VOQ A;  4HAT B;  2DAF A;  2ZZP B;  4N59 A;  1H4R A;  1VLB A;  3VVW B;  4YL8 A;  2GBJ A;  1ZM0 A;  4WQO B;  4PYZ A;  1P3Q U;  1KZ7 A;  1UZX B;  2VKI A;  1QT9 A;  5LON B;  3ZNZ B;  4ZOH C;  2H89 B;  1DOI A;  4W9C A;  2YT2 A;  4IUM B;  3H7S A;  1P7E A;  1VBH A;  1TQZ A;  2V0G A;  3VIA A;  4NAW B;  4A3O A;  3HQC A;  1F77 A;  1QOF A;  2YS3 A;  3L13 A;  3WAL A;  5D3V A;  2GBN A;  3N30 A;  2LG1 A;  1AN8 A;  3EPY A;  3RD2 A;  2M17 A;  3R7R A;  1H10 A;  3KUC B;  3H7P A;  5AEK B;  2Z4D A;  5JXV A;  2KFK B;  4TMA B;  4HAX B;  1YX6 B;  3Q6B A;  2KJH B;  4ZRP A;  1KC7 A;  3ZDM C;  5GMV A;  1FRR A;  3T06 A;  4FHK A;  2WLB A;  2BYF A;  1V5P A;  4XX5 A;  2UZR A;  1CK1 A;  3BVZ A;  4OZB A;  2GS0 A;  2FCQ A;  1SB3 C;  3N20 C;  2W54 A;  4MEL A;  2NVU I;  1A70 A;  1QZE A;  3QJZ A;  4XZ4 A;  2WU5 B;  3JSV B;  3SBG A;  2LRW A;  4KSK C;  4MJS B;  2WXL A;  2IO1 B;  2N7J A;  3TIX A;  1GUA B;  2CJO A;  2MX2 A;  5BYQ A;  1WE6 A;  3DWG C;  1HEZ E;  3DQV A;  4C4V B;  1C76 A;  3DVG Y;  4HKZ E;  3H1U A;  5KQ1 A;  1KOT A;  2PLP A;  2BS4 B;  2W9N A;  1XD4 A;  5IKC M;  3Q69 A;  2FDQ A;  1YQ4 B;  2UVM A;  1S3S G;  5EE0 A;  1TGZ B;  1C9F A;  1X86 A;  5DH9 B;  3TW1 A;  1XX0 A;  1HZ6 A;  1SHC A;  1ZUD 2;  1UNS A;  2KVR A;  4DHZ E;  5L83 A;  4ARC A;  3Q3F A;  1PYW D;  5LXI B;  5HKH A;  4GN1 A;  3M62 B;  2ASQ A;  1EU4 A;  3QC8 B;  1SIJ A;  1T77 A;  2V76 A;  2IO2 B;  2QDF A;  2LBB A;  4W9D A;  2JVC A;  3PG7 A;  1UGJ A;  1K52 A;  3SFD B;  5DIF B;  3Q3O C;  2Y7B A;  2MQJ A;  3B0A A;  3NVW A;  1PGB A;  2AX5 A;  4HB0 B;  2R0D A;  1ACC A;  1L5P A;  4RCO A;  3P1M A;  3PP2 A;  4TSS A;  4K2O A;  2LD9 A;  2ZVO A;  3MC8 A;  3GZN I;  3ZIM A;  1VBG A;  2Z0D B;  2YF0 A;  2LUM A;  1V1P B;  1EAZ A;  3WA0 A;  3WAN A;  2PKO A;  1OQN A;  3ZXR A;  3LB8 C;  1EF5 A;  3WCQ A;  3AE3 B;  4YTN B;  2LVQ A;  1E6E B;  3N7C A;  1TIF A;  3ML9 A;  4HJK A;  4LNK A;  4FA6 A;  1ENF A;  1P3R A;  1R4N B;  2J59 M;  5BMG A;  2FAZ A;  3QAR A;  1VJK A;  2M38 A;  4JKC A;  3TO1 A;  3CIR B;  1LO5 D;  3UIP B;  4BOS C;  1UEL A;  1WI1 A;  1ZSQ A;  1Z5S B;  2G4S A;  3K9O B;  5JHA A;  4CO7 A;  2WXK A;  4X57 B;  1F2R C;  2MBH A;  1WX7 A;  5CTR C;  1WGU A;  3KYD D;  2DFK A;  3IT4 B;  1TXD A;  2G9H D;  1YJJ A;  2D3G A;  3TSS A;  4W9L A;  1XKE A;  3TVV A;  4M8N A;  3T9L A;  5C3J B;  5LG4 B;  4TYZ A;  2KX3 A;  3ENE A;  1BAK A;  5C16 A;  4IOI E;  2KDE B;  2UU7 A;  4OZA A;  3DBS A;  1WGK A;  1L4D B;  1V8C A;  3AEA B;  2IPK D;  4YT0 B;  1P6S A;  1ET6 A;  2ON8 A;  5AUI A;  2DEN B;  1LFD A;  2LFI A;  3EUB 2;  4KGS A;  2DWQ A;  3UIO B;  3Q8A A;  4LK0 M;  2L7R A;  2JPH A;  4GSW A;  4GDK A;  2OOB B;  3CF6 E;  2JZZ A;  1U2B A;  1XT9 B;  1Y56 A;  1YQB A;  4NQL B;  4LLG M;  1FFU A;  2JP2 A;  4IWQ A;  4B95 A;  4A9A A;  4AUQ C;  3B1L X;  1GB1 A;  4LDT B;  5DHA B;  2CY4 A;  2YT1 A;  3V6C B;  4IG7 B;  2DHJ A;  2KUQ A;  2N7E A;  2QSD A;  4A6H A;  4ANX A;  1FNV A;  1M4V A;  2BWF A;  4K2P A;  3HUI A;  3V3X A;  3AUL A;  4W9J A;  4WJP A;  2M56 B;  3B77 A;  2J7Q B;  2V1Y A;  2ELA A;  1P9D U;  1FO4 A;  1WMH A;  4ICV A;  2GMI C;  1WSP A;  4PS8 A;  1XLO A;  1C3T A;  5J3Y A;  1XF5 L;  4IM3 A;  4WSF A;  2KWD A;  3MFG A;  4FJZ A;  3P63 A;  3O13 A;  3QWM A;  3LJ3 A;  2WDV B;  3DVN V;  2L2I A;  4AP4 C;  2FCS A;  2H88 B;  4RM9 A;  5LNK 1;  1UBI A;  1YIW A;  2PEA A;  1WGG A;  4A90 A;  2DYM A;  3L17 A;  2YVC A;  1SXT A;  1V9J A;  3L10 B;  2RNR B;  2KIE A;  2PZ1 A;  3CST A;  2LGX A;  5EDS A;  2Z0P A;  2CRF A;  1MHX A;  2INP E;  2HJ1 A;  3P4S B;  2KTR B;  3VH3 B;  3ENB A;  5HFY A;  1WJ1 A;  3JW0 X;  3S2A A;  4YON A;  3MHS D;  5CHW A;  3R2T A;  4EE2 A;  3QCA A;  3AE7 B;  4GXB A;  4DX8 A;  2WXH A;  2KVZ A;  4DDG D;  3ODW A;  4BFR A;  2PJH A;  4L23 A;  4WWO A;  3C8Y A;  1P7F A;  1X11 A;  5IA7 A;  3IFW B;  3PLV A;  2MLB A;  1XOD A;  2N0Y A;  1BXT A;  3HHM A;  4IWO A;  3AE2 B;  3BYY B;  3N1Y C;  4IW0 A;  2WU2 B;  4QJ3 B;  1J7B A;  3AEF B;  3VQI A;  4JKB A;  3D8F A;  2Z0Q A;  2EEL A;  4C56 C;  3ZJV A;  2D07 B;  1JWA D;  1VRA B;  2CR5 A;  5IO9 A;  3WAO A;  2O6V A;  4JK7 A;  2RPQ A;  1EF1 A;  3IXS A;  2GJY A;  2MRP A;  3OAN A;  2INC C;  4DWF A;  1DDV A;  3DHI C;  2KFJ A;  3N32 A;  3R2I A;  1KLG D;  4TQ1 A;  1NI2 A;  1D5X C;  1D5Z C;  2JRI B;  4BKT A;  1WGQ A;  4ZRK A;  2QHO A;  3E9L A;  1OMW A;  3Q8F A;  1NI3 A;  3PSC A;  2NBV B;  2C5L C;  1OTR B;  3PT2 B;  5EE3 A;  4BKS D;  2FUG 1;  2OTX A;  3SV1 A;  4JKG A;  3N1X C;  4REZ A;  4CHJ A;  2LMC A;  3IVF A;  3AE6 B;  2WDR B;  3PZ8 A;  4FXC A;  3Q8E A;  1X1M A;  2UYZ B;  3QK0 A;  1I4H A;  3KUZ A;  5JH5 C;  1U27 A;  2GCJ A;  2KUP A;  1FXA A;  2KX0 A;  4HB2 B;  3HVD A;  4OVV A;  4JKH A;  2WDT B;  4GPT B;  1KJT A;  2H7D A;  1MPE A;  2OJW A;  2WNM A;  2X38 A;  5AZF A;  1Q10 A;  3PO0 A;  4C00 A;  1GOZ A;  1NDD A;  1WJN A;  1TKY A;  2K1F A;  5BMI A;  1D5M C;  3OJ3 A;  1SEB D;  4JL9 A;  1UNR A;  3R66 C;  4RH6 A;  3APC A;  4MT7 A;  2K00 A;  2N9P C;  5DI9 B;  4A5K A;  1E7P B;  4HPL B;  3OLM D;  4F7U P;  4K17 A;  4CYE A;  2QMT A;  1MK7 B;  4RNA A;  4KSL C;  1SJE D;  1V5U A;  2DA0 A;  4ZYN A;  1HZ5 A;  3LDZ E;  4C7Z A;  3RUL A;  5DHF B;  2AL6 A;  1FXT B;  2ROV A;  2CU3 A;  2N23 A;  3OJ4 B;  2BKF A;  4A6F B;  2OHF A;  2IZV B;  1ZOY B;  3RNG C;  2ZW0 A;  1WX9 A;  5EE1 A;  3LXF A;  3UQB A;  2FCN A;  2M1M A;  1LW3 A;  2CQU A;  2X18 A;  4KAX B;  2K5P A;  4L6E A;  4LNI A;  2DHZ A;  2JZP A;  4WJ7 A;  3DHG C;  2YS1 A;  4RMA A;  2MBB B;  4HAY B;  3M3J A;  5HE3 A;  4BVU C;  2I5F A;  3SYX A;  5I2M A;  4OW0 A;  3D8E A;  5FKA C;  4DBB A;  2NTT A;  4JKG B;  2RSG A;  3AE4 B;  3AU4 A;  4MM3 A;  3DBR I;  3APD A;  3V62 A;  3SU8 X;  1OQY A;  3A4S C;  2OQB A;  3Q8B A;  2EMT A;  3ML4 A;  1DIK A;  4WQM A;  4PS3 A;  4E74 A;  2GBR A;  2KYW A;  4KDL B;  4HAW B;  3HM3 A;  4XWW A;  1P5T A;  4W9H A;  4AJW A;  2PPH A;  1Y8R C;  3U7D A;  1EO6 A;  2PIA A;  2ZW1 A;  2VSZ A;  2ZEQ A;  2I38 A;  1KZG A;  3TUO A;  5G5G A;  3DBH B;  4ZRQ A;  5KHO A;  1T0Q C;  5C2T B;  1EM7 A;  2DNF A;  4MAC A;  1E8Y A;  2L0F A;  2VZK B;  1SF0 A;  3AI5 A;  2DX5 B;  4NAW A;  4LNN A;  3ZVR A;  1V61 A;  1WJU A;  2C7N B;  3KQ4 A;  4EFO A;  1FMA D;  2IO0 B;  3P4R B;  2E3T A;  1Q0W B;  3SD5 A;  3B2F A;  2WH5 A;  3NRZ A;  2WXN A;  1E90 A;  2HE7 A;  1P0R A;  1QOA A;  1R4M B;  2RGN B;  1XEE A;  4R3D A;  4HRS A;  1NTI A;  5T8I A;  1QKZ A;  4EMO A;  2KFK A;  2ROZ B;  1KF6 B;  1TS5 A;  4HWI B;  2VZK D;  4KX6 B;  4DK5 A;  1PUT A;  1T5X D;  3HIE A;  4W9G A;  5DPT A;  4HKQ A;  2WXP A;  1ZPS A;  2MSE D;  3APF A;  1XO3 A;  2J52 A;  4KKI A;  4ZRJ A;  5JHH A;  1XCQ L;  1IUE A;  1HTQ A;  3VTU A;  4FUL A;  1B9R A;  1H8C A;  4D2K A;  2KZR A;  4EKU A;  5DPR A;  2COP A;  1ZYI A;  1OQQ A;  5DCN A;  1UNQ A;  1DDW A;  1I4G A;  3AMZ A;  3KH0 A;  1OEY A;  2L05 A;  2LUE A;  1I7H A;  3ALB A;  1B1Z A;  2MDX A;  4JKD A;  2AEH A;  2BPS A;  1K5D B;  1HBK A;  3B2G A;  4C4V A;  1I35 A;  4HPP A;  4BOZ B;  3PVL A;  1MK9 B;  2JWZ A;  5E6O A;  2MJD A;  1WFY A;  3J9C A;  2D5G A;  2ZPN A;  1MIX A;  4JKF A;  2OED A;  3IG3 A;  3RZW C;  1RRB A;  2KJR A;  1VZ6 A;  4HCN B;  3ZQ4 A;  2K8E A;  4IM2 A;  4ZYS A;  4LTU A;  1N60 A;  1AQC A;  4WWN A;  4HSI A;  5D27 A;  3NOB A;  3AEB B;  2IBI B;  1K51 A;  3VTV A;  5CHV C;  2WS3 B;  2YS5 A;  3ZNH B;  4GDL A;  1PLS A;  3I5J C;  1TS3 A;  3ML8 A;  2Z0E B;  3C0R B;  2WXJ A;  3KUD B;  4ANW A;  3R3M A;  2K39 A;  3FEH A;  2CKH B;  3NS8 A;  1L7Y A;  2WGS A;  3X23 A;  3Q14 C;  1UWM A;  3RCP A;  4HCP B;  1HB8 A;  2RRF A;  3VFK A;  1IYF A;  2GLS A;  5HG2 A;  1RFA A;  4PYU A;  4E71 A;  2D10 A;  1EWC A;  1V1P A;  1TJ6 A;  4HAU B;  2DYB A;  3TFM A;  4UDU C;  4QAY A;  2O2V A;  3ULC A;  5I4D A;  1E5W A;  1KRH A;  1WYW B;  1WR1 A;  2V4I B;  4MH0 E;  4A3P A;  4ILH A;  2JYT A;  3NSU A;  1Q67 A;  4GB9 A;  4ITK A;  3FP5 A;  2WDQ B;  4HAZ B;  1MI0 A;  5G5H A;  1GNU A;  2R2O A;  2MJ3 A;  3ZTD A;  1V5O A;  2KWU B;  4PT5 A;  4BBK A;  2CB8 A;  2BYE A;  2GRI A;  4JIO U;  1HQR D;  1K8R B;  2P0D A;  5C5B B;  2MW5 A;  3KVF B;  4PS7 A;  1ZC3 B;  2B76 B;  3P4P B;  4D6W A;  1PFD A;  4WAF A;  1P98 A;  1WRD B;  2C9W B;  4GU2 A;  2Y5B B;  3VUX A;  1SSN A;  2KLC A;  1WE7 A;  2P0H A;  2BB6 A;  2BWE S;  1UUP A;  4I6N B;  1M94 A;  3PS6 A;  2KR0 A;  4HK2 A;  3BVM A;  4LJP B;  3ZGZ A;  1QC6 A;  4M01 A;  2W2X D;  5KHQ A;  2BYT A;  4EEW A;  4GDL B;  4CSQ A;  2BS2 B;  3PZ7 A;  2WYQ A;  3L16 A;  1PGX A;  1CJE A;  3WAM A;  1FHO A;  2KOX A;  3NUH B;  1MIZ B;  3C19 A;  1SE2 A;  3A4R A;  1J8C A;  2IFS A;  4B6H A;  2FCM A;  2COD A;  3O96 A;  4N58 A;  1NBF C;  3PHX B;  1SE9 A;  1TZO A;  1F0Z A;  3RPF C;  4YTM B;  4JLC A;  2AQ1 B;  3Q8C A;  3NVZ A;  2O2V B;  2ZKM X;  1WGR A;  2LUL A;  1RRP B;  1F2R I;  1I42 A;  2EKI A;  2HRJ A;  2D9Y A;  2AL3 A;  1CMX B;  2A5U A;  4BBN F;  3DWM A;  2LOX A;  1GJZ A;  4JWS C;  1BTK A;  1VDV A;  4WUR A;  3Q2A C;  2RPV A;  1V5T A;  1PFJ A;  1L0Y B;  1DGJ A;  2RR9 A;  3GP7 A;  4W9K A;  2DBY A;  3ZXV A;  3NS1 A;  3KWV A;  1GGO A;  2VH1 A;  4B9K A;  4DXA B;  3TEW A;  1WJ6 A;  2KLG A;  4P1C C;  5D94 A;  3RNE C;  2HDE A;  4KV2 A;  3QQ8 B;  5D3X A;  2JXX A;  5LOP B;  2RGF A;  1WXA A;  1AAR A;  2JYE A;  1UWX A;  3GOE A;  4HEA 1;  3M1I B;  1WRI A;  2EJ8 A;  4C7Y A;  4H8S A;  2SAK A;  2L83 A;  1XCT L;  2EKE C;  2KTR A;  4WH4 A;  1LM8 B;  2WX0 A;  1FGY A;  1L0V B;  3P7Z A;  1JRO A;  1L2N A;  4RGM A;  1HB6 A;  2L76 A;  3U52 E;  2KJ6 A;  2COA A;  4M0W A;  4O1N A;  1E8X A;  1E9M A;  2K2U A;  1X05 A;  1XQQ A;  1TY0 A;  4Z2M B;  1JAL A;  3FAH A;  1L4Z B;  4F8C B;  2L32 A;  3AXC A;  1KLV A;  1XLP A;  3ZLZ A;  2KDB A;  2KQS A;  4RF0 A;  1ST7 A;  3O65 B;  3WIM A;  2B3A A;  3UQA A;  1BTN A;  1ZDX A;  2RLO A;  4ZRI A;  2LXA A;  2MFQ A;  2CHW A;  1MKE A;  1ZDV A;  4N9F 4;  3RZF A;  1MG8 A;  1KFY B;  3VDZ A;  2OJR A;  2G45 B;  1XXG A;  2VH2 A;  3NVV A;  4KGT A;  3HK0 A;  2JF5 A;  2QCZ A;  4BKS A;  3DCX A;  4OVZ A;  4YTP B;  2LI5 A;  3IAS 1;  2N7D A;  1WJ4 A;  1XLQ A;  5D3Y A;  4Q2J A;  4JWU C;  2IDY A;  5D6J B;  1FHX A;  3DPD A;  2NS5 A;  3KWL A;  3ULB A;  4P6V F;  1FCC C;  3K9P B;  4XC2 A;  2FE8 A;  1YN5 A;  3A33 B;  2NBV A;  4JQW C;  2IYD B;  2KAJ A;  1YOV B;  4E3C A;  4ACF A;  3MTN B;  3AEG B;  1PDX A;  2V3P A;  2RDG A;  1NEK B;  5C1Z A;  3A1Q A;  4AS1 A;  2LHD A;  4LCD E;  5M4Y B;  2EC1 A;  1FRD A;  2AWT A;  1D4B A;  4XWX A;  3N9Y C;  2DX1 A;  4XYC A;  1T3Q A;  1JML A;  3NVY A;  3V05 A;  3U7Z A;  2GBK A;  2N9X A;  3ODO A;  3V6E B;  2DKP A;  4KZC A;  2ONQ A;  3A8Q A;  4KKJ A;  2D9V A;  4A8X C;  2HTH B;  4J6I A;  2R2Y A;  3PZD A;  1MG4 A;  3MJ5 A;  3W1S A;  4RGN A;  4GMV A;  1SGH A;  1R7S A;  1PQS A;  4M0W B;  1RYJ A;  3AU5 A;  1T6B X;  3V60 A;  3PRM B;  3AB5 A;  4TV3 A;  3SUZ A;  1N6Z A;  1U29 A;  3TEZ A;  2MEK A;  2LHE A;  5G2N A;  4KVG B;  3RI7 C;  4TKN A;  3ZDT A;  1MHH E;  2NZ8 B;  4FBJ B;  2BTE A;  1TS4 A;  2YSZ A;  2P0F A;  3D32 A;  2DHI A;  1J7A A;  3URY A;  4JK8 A;  4A6F A;  2BYV E;  4F7H A;  1K5G B;  4ANU A;  2BVC A;  3L54 A;  3BYT B;  2QEJ C;  1TT5 B;  4HDQ A;  3PRE A;  3HM6 X;  1PMS A;  4J3O D;  2N9E B;  1FIQ A;  1WJM A;  3BK2 A;  1SIF A;  3BJI A;  3ZJU A;  2W82 A;  3RUI B;  2DYO A;  2PE9 A;  4I6P A;  2XBB C;  4ILJ A;  1MAI A;  4M02 A;  4DXG A;  1RJ2 A;  3AE8 B;  5BYS A;  1RAX A;  2KN4 A;  4G0N B;  2W3R A;  4US9 A;  1WXQ A;  2MH7 A;  1KI1 B;  4LJO B;  1GPX A;  2G1E A;  2W2W A;  4K3C A;  2KN5 A;  4HB4 B;  3I57 A;  2KD0 A;  3HSA A;  1J7C A;  2D3C A;  4YSY B;  5MPO A;  2ICI A;  4NNJ B;  1WXM A;  4GZU A;  5KCV A;  3A1Q B;  1F9J A;  4MDK E;  2AYO B;  2K6D B;  5J17 A;  5D3W A;  2BKR B;  4DDI D;  1N3H A;  1ZGU B;  3A9J A;  3EFC A;  2JT4 B;  1W1G A;  4KHO A;  5J2R A;  1UGM A;  3VR8 B;  1QQR A;  1TZ1 A;  4WWP A;  3NZ3 A;  3NWF A;  3QA8 A;  1RLF A;  3SBT A;  5E6J A;  3W1S C;  3VHT C;  3F0W A;  2ADZ A;  2FJL A;  4HDO A;  4WIP A;  3ZO5 B;  3MHZ A;  4II3 B;  1UBQ A;  3TEY A;  1V1O A;  4II2 B;  2DX5 A;  1XLN A;  1MFW A;  1UNP A;  2NCN A;  2JX5 A;  1ESF A;  3TCA A;  2KC1 A;  3H9D A;  2D3B A;  3E56 A;  3BIN A;  3T3N A;  3M63 B;  2JRH A;  2KMC A;  3PPA A;  2J42 A;  5IP4 D;  5G55 A;  1JRP A;  1FD6 A;  1UPQ A;  2K3U A;  4DHJ B;  1F52 A;  2R2Q A;  1JCK B;  2N0S B;  3M95 A;  4K1R B;  4CHM A;  4P16 A;  3GYO A;  2UWQ A;  2REX A;  2Z0O A;  4A55 A;  2D2Q A;  1V80 A;  2MJE A;  2L00 B;  3KYC D;  4GOC A;  4RM8 A;  1BML C;  1UD7 A;  2KWC A;  2WXM A;  2AQ2 B;  3AN1 A;  4DHJ D;  4FJV B;  2L1A A;  1VZ7 A;  3PHW B;  4ANV A;  1TS2 A;  2LZ6 A;  3KSY A;  3IT6 B;  1YMH E;  3NWA A;  3P6A A;  3H8H A;  3RMK C;  2RDH A;  3FM8 C;  4G3X B;  5HI1 A;  4F7G A;  1SE4 A;  3GE3 C;  4QJ4 B;  1Q1O A;  3IBE A;  3ZTC A;  1QQG A;  1C1Y B;  3VRA B;  2BGF A;  2IGG A;  3A9J B;  4ICU A;  4NAM A;  2KQ7 A;  3GB1 A;  4K7U A;  4LNF A;  2WXQ A;  2AQ3 B;  3EA6 A;  3BII D;  1WXS A;  3DBH I;  1F1H A;  5J3Q A;  2RMM A;  3DBL B;  2K9X A;  1IBX A;  2IND C;  1Y5O A;  3DOW A;  3LYY A;  2DZK A;  4DX9 0;  3AE5 B;  3QHT A;  1EU3 A;  2DKQ A;  2C7H A;  1V81 A;  3DBR B;  5IN7 A;  4ARI A;  2MBQ A;  3D8D A;  2J4X A;  2KDI A;  1R4M I;  2LWP A;  4BKG A;  1KBL A;  1WH3 A;  5GOW B;  3RYT A;  3CSF A;  3EGR A;  2FID A;  2FNJ B;  1P1A A;  3EEC A;  2CY5 A;  4NQK E;  1JW9 D;  3H6N A;  2V9H A;  3QAQ A;  5FI1 A;  2WQY B;  4L2Y A;  3VH4 B;  2CJN A;  4KIK A;  1LQB A;  1D3Z A;  2JY6 A;  5L81 A;  1DDM A;  2KDF B;  1KH0 A;  4OSN A;  2W3S A;  2I1K A;  1X1F A;  1T0Y A;  4EZL A;  2KMA A;  4MGZ E;  4W9I A;  1IP9 A;  2ZCB A;  1V5M A;  2DZJ A;  1Z87 A;  2FUH B;  2D11 A;  1YJ1 A;  3RNC C;  1OQR A;  1E0Z A;  3NW8 A;  1ZW7 A;  1AYF A;  2MHJ A;  2GCL A;  3WAP A;  2N9L A;  3GYP A;  4Z2N A;  2EMS A;  3W9C B;  1N61 A;  3ONS A;  5H8Y E;  4HRO A;  4XDD A;  3ZVV A;  2YEP F;  4A20 A;  2VRW B;  5C5B A;  3A9K B;  3CMM B;  1V6E A;  2I5C A;  1DBH A;  2WXR A;  1FXI A;  3OWE B;  1GC6 A;  2KIG A;  3BY4 B;  4GIV A;  3MDB C;  3PLU A;  1QOB A;  1X1G A;  3AV8 A;  5IOI A;  1OFF A;  3UIN B;  1WR6 E;  1IBX B;  1TYG B;  2IJ0 A;  1E7V A;  1QLB B;  4WJO A;  4XWT A;  1WY8 A;  2RQ1 A;  1QF6 A;  1FM0 D;  3W5U B;  1KLU D;  3A8P A;  3NG0 A;  2KNB A;  4IOY X;  2WXI A;  2K22 A;  4H2A A;  4D0N B;  2BQQ A;  4RFB A;  1CQV A;  1NTY A;  2LOZ A;  3L08 A;  1J19 A;  5HHD G;  1VD2 A;  4ASW C;  5JZE B;  2XEW A;  4GGQ A;  4HXD A;  2ZJD A;  2Y8G A;  1BT0 A;  1AW7 A;  4HHV A;  5C6R A;  1IRS A;  3QWZ B;  2A4Z A;  2Z59 B;  1ZC4 B;  3HW2 B;  1K50 A;  2MBE A;  4KIK B;  2E2X A;  3PSE B;  1WGY A;  1YN3 A;  3QX1 A;  1IGC A;  1NTV A;  4BZA A;  4EOY A;  2ZVN A;  2HTM E;  3U2S C;  1NVL A;  4KGR A;  1NEN B;  1B55 A;  1SJH D;  2DTC A;  1N63 A;  4XDC A;  3BWU D;  2ELB A;  3PEG A;  1ZKH A;  3CWI A;  1QIL A;  2DN6 A;  2IY0 B;  3KW5 B;  1JWS D;  2X0S A;  4G11 A;  4OT1 A;  5JVL A;  3CXB B;  4HPM B;  4P1B C;  5HE2 A;  4OHJ A;  1MPH A;  3LJU X;  5CX3 A;  1SBB B;  2LJI A;  3RNB C;  2ACZ B;  1GB4 A;  2NMQ A;  2V3N A;  3P2B A;  5FI0 A;  2C7M B;  1I4P A;  1XD3 B;  1DOX A;  2C60 A;  3MC9 A;  2NTS A;  4CQN A;  3ECI A;  1G6J A;  5HE0 A;  2W2X C;  1Y19 B;  4MY6 A;  3OG5 A;  3ZJT A;  3EHV A;  3IHP C;  2KKC A;  2LGI A;  1E10 A;  2MKR A;  3B08 A;  5D2M B;  1GAQ B;  2WXG A; 
#chains in the Genus database with same CATH homology
 2JUO A;  4NJ6 A;  1UEF A;  2LVP A;  5IJM A;  3KRW A;  1U5D A;  3UZT A;  2UZS A;  3PRP B;  3V5W A;  1WGH A;  3DDC B;  3VAW A;  2CHX A;  3SHQ A;  2KTF A;  1JRU A;  4Y94 A;  1XCG A;  1WX8 A;  2XK5 A;  4W9E A;  1V88 A;  4WJN A;  1ISN A;  2ZPY A;  1R4N I;  1J0W A;  2MWS B;  2KGX B;  4NJ7 A;  2LRU A;  2LGY A;  1HE8 A;  2RUK B;  5DPS A;  2GBM A;  1YX5 B;  2QKM A;  3U8Z A;  2MBO A;  5JHG A;  1ZVR A;  4P7I A;  2MWN B;  2KO3 A;  3H7P B;  2RD0 A;  4EJN A;  2K8H A;  3OAW A;  5EFX A;  2LGD A;  3DXE A;  1W1D A;  1WM2 A;  2YT0 A;  3RCZ A;  3NHE B;  4KHA A;  2HJ8 A;  3TJP A;  4EZK A;  2GOW A;  2D9Z A;  1WI0 A;  1OY2 A;  3EC8 A;  3ZRC A;  2ZNV B;  2IYB A;  1GC7 A;  2LJ5 A;  5KQ4 A;  2VRR B;  2ZNV C;  1V2Y A;  2NR2 A;  4G50 A;  4F7Z A;  2IO3 B;  1NU2 A;  4K7W A;  1FAO A;  3PVU A;  2DZI A;  4IC7 B;  4FAD A;  1E7U A;  1DYN A;  5D7G A;  2BCJ A;  3MJW A;  4DBG A;  2HTH A;  2KXJ A;  4F1S A;  3PTF C;  1W1H A;  3ZW3 A;  3QBV B;  3PV1 A;  2L1C A;  3KY9 A;  4FHJ A;  2I1J A;  5C79 A;  2XK5 B;  2XQN M;  3SNH A;  1V86 A;  2LAS A;  5AZH A;  3NY5 A;  5DPW A;  4JK9 A;  2P8V A;  4GMX B;  1AWE A;  4HLE A;  2FIF A;  4EUT A;  2KC2 A;  2CU1 A;  5BO4 B;  3DVN U;  2CHZ A;  4WAA A;  1E8Z A;  2KHW B;  3Q3J A;  1I7A A;  2D4Q A;  4IFS A;  3ZNI D;  1S1Q B;  3KZ1 A;  5FR6 A;  3NZU A;  1WGD A;  4HAV B;  3ZKJ C;  4I6L B;  1M7E A;  1TTN A;  1E8W A;  3AJ4 A;  3JVZ X;  4MGK E;  4JGH B;  4HB3 B;  4TUU A;  2R82 A;  2JZ3 B;  2K25 A;  2K6Q A;  4LDT D;  3A98 B;  4KDI C;  2J0K A;  2CAY A;  5LXH A;  2K8C A;  3G9W A;  2N4F A;  2ABD A;  5CLQ B;  4MGY E;  3ODX A;  3DCG A;  4MEM A;  3ZNG C;  1EUV B;  3U30 A;  2WX1 A;  4MSQ B;  3ZRF A;  2RVB B;  2KAN A;  2NPT A;  4MSM B;  1Q5W B;  4FJY A;  1U5F A;  2DAJ A;  2L3Z A;  3E66 A;  1FB8 A;  4K7S A;  4PNK A;  4IWP A;  4KHB B;  2CS4 A;  4GDK B;  4URK A;  5L95 C;  2KCJ A;  1FGZ A;  1XR0 B;  4IM0 A;  4AOF A;  3ZUN A;  4M8M A;  3V61 A;  2FJ9 A;  4DHZ B;  3PRZ A;  4A6K A;  3MPX A;  3DVG X;  4K81 A;  3R7Q A;  1EGX A;  4ZDV A;  2ZCC A;  1TBE A;  1ACA A;  1UH6 A;  2DHK A;  3DXD A;  2MCN B;  2MP2 A;  3VUW A;  4W9F A;  2M4N A;  1U5G A;  1WMH B;  2G35 A;  3I3T B;  1WZ0 A;  3T8M A;  1J0G A;  5JLJ B;  2KK8 A;  1YD8 U;  3N3K B;  2PE6 B;  3WYF B;  5CLL B;  1V49 A;  3TMP B;  2V3S A;  1JDE A;  2K8B A;  5LLI A;  2DYQ A;  5C23 A;  1Z2M A;  3F5R A;  2NPT B;  3VUY A;  3L0W B;  2QKL A;  1WIA A;  4KZ0 A;  4WJQ A;  1UPR A;  4MGI E;  1U4A A;  1WZ3 A;  2RSU A;  3EFU A;  4IAP A;  2J0M A;  3FLV A;  1A5R A;  1BWN A;  2DIK A;  3NZS A;  2KWV B;  2DYN A;  3UGB B;  2M0X A;  2L0T A;  2J0J A;  1I2H A;  2LYD A;  3E9P A;  3DXC A;  4NY0 A;  2MA9 B;  4B6W A;  4OVU A;  4EZJ A;  5HE1 A;  1WM3 A;  1FHW A;  1LB1 A;  5JHB A;  2LXC A;  2O6V B;  2COC A;  4PQ0 A;  1WF9 A;  2MP2 B;  3PVW A;  4AJY B;  3E9O A;  4MK0 A;  4NSW A;  1WVH A;  2COF A;  2G3Q B;  3VTW A;  3HIZ A;  1VCB A;  3A9K A;  3FSS A;  1WG7 A;  5J18 A;  1KM7 A;  2O6V D;  1GG3 A;  2LVO A;  3DBL I;  5E6N A;  1FOE A;  2YLM A;  3CIK A;  5AZG A;  5JP4 A;  4CHK A;  2R09 A;  2D9X A;  4JKA A;  2G4D B;  1U5E A;  2NBW B;  1IPG A;  3W1Y A;  2N1V A;  4NPN A;  2D9W A;  2N1W A;  1EVH A;  2WWZ A;  3SO6 A;  1OGW A;  4BBN C;  2NBU A;  2M8S A;  4FN2 A;  4WVF B;  3PGE A;  2BF8 B;  4AWJ A;  3SDL C;  3TBL D;  5IAA C;  3KRX A;  3QIJ A;  5J3T A;  2NMB A;  2DLW A;  2YRY A;  1LXD A;  3VXW A;  2K2J A;  2Q13 A;  1M7R A;  5E6P A;  1OEY J;  2M14 A;  2IY1 B;  2L8J A;  1WXV A;  2LKO A;  2H7E A;  2Y8F A;  5TR5 A;  4JKE A;  4ILG B;  4HVB A;  2HD5 B;  4FLH A;  1DRO A;  2DZM A;  1V89 A;  2V4L A;  3JSV A;  3TL5 A;  3X0W A;  3JYU A;  4MJS A;  3RT3 B;  4C0A A;  3UF8 A;  4TQ0 A;  5CHF A;  3VOQ A;  4HAT B;  2DAF A;  2ZZP B;  1H4R A;  3VVW B;  4YL8 A;  2GBJ A;  1ZM0 A;  4WQO B;  4PYZ A;  1P3Q U;  1KZ7 A;  1UZX B;  2VKI A;  5LON B;  3ZNZ B;  4W9C A;  4IUM B;  3H7S A;  1VBH A;  1TQZ A;  3VIA A;  4NAW B;  4A3O A;  3HQC A;  2YS3 A;  3L13 A;  3WAL A;  5D3V A;  2GBN A;  3N30 A;  2LG1 A;  3EPY A;  3RD2 A;  2M17 A;  3R7R A;  1H10 A;  3KUC B;  3H7P A;  5AEK B;  2KFK B;  4HAX B;  1YX6 B;  2KJH B;  1KC7 A;  3ZDM C;  5GMV A;  3T06 A;  4FHK A;  2BYF A;  1V5P A;  4XX5 A;  2UZR A;  2GS0 A;  2FCQ A;  4MEL A;  2NVU I;  1QZE A;  3QJZ A;  4XZ4 A;  3JSV B;  3SBG A;  2LRW A;  4KSK C;  4MJS B;  2IO1 B;  3TIX A;  1GUA B;  2MX2 A;  1WE6 A;  3DQV A;  3DVG Y;  3H1U A;  5KQ1 A;  1KOT A;  2W9N A;  1XD4 A;  2FDQ A;  2UVM A;  1S3S G;  1TGZ B;  1X86 A;  5DH9 B;  3TW1 A;  1XX0 A;  1SHC A;  2KVR A;  4DHZ E;  5L83 A;  3Q3F A;  5LXI B;  5HKH A;  4GN1 A;  3M62 B;  2ASQ A;  3QC8 B;  2V76 A;  2IO2 B;  2LBB A;  4W9D A;  2JVC A;  3PG7 A;  5DIF B;  2Y7B A;  2MQJ A;  3B0A A;  4HB0 B;  2R0D A;  3PP2 A;  4K2O A;  2LD9 A;  2ZVO A;  3GZN I;  3ZIM A;  1VBG A;  2Z0D B;  2YF0 A;  1EAZ A;  3WA0 A;  3WAN A;  1OQN A;  1EF5 A;  2LVQ A;  3N7C A;  3ML9 A;  4HJK A;  4FA6 A;  1P3R A;  2J59 M;  2FAZ A;  3QAR A;  2M38 A;  4JKC A;  3TO1 A;  3UIP B;  4BOS C;  1UEL A;  1WI1 A;  1ZSQ A;  1Z5S B;  2G4S A;  3K9O B;  5JHA A;  4CO7 A;  4X57 B;  2MBH A;  1WX7 A;  5CTR C;  1WGU A;  3KYD D;  2DFK A;  1TXD A;  2D3G A;  4W9L A;  1XKE A;  3TVV A;  4M8N A;  3T9L A;  4TYZ A;  2KX3 A;  3ENE A;  1BAK A;  5C16 A;  2KDE B;  3DBS A;  1P6S A;  2DEN B;  1LFD A;  3UIO B;  2L7R A;  2JPH A;  4GSW A;  4GDK A;  2OOB B;  3CF6 E;  2JZZ A;  1U2B A;  1XT9 B;  1YQB A;  4NQL B;  2JP2 A;  4IWQ A;  4B95 A;  4AUQ C;  3B1L X;  4LDT B;  5DHA B;  2CY4 A;  2YT1 A;  3V6C B;  4IG7 B;  2DHJ A;  2N7E A;  4A6H A;  4ANX A;  2BWF A;  4K2P A;  3AUL A;  4W9J A;  4WJP A;  2J7Q B;  2V1Y A;  2ELA A;  1P9D U;  1WMH A;  4ICV A;  2GMI C;  4PS8 A;  1C3T A;  5J3Y A;  4IM3 A;  4WSF A;  4FJZ A;  3QWM A;  3LJ3 A;  3DVN V;  2L2I A;  4AP4 C;  2FCS A;  4RM9 A;  1UBI A;  1YIW A;  2PEA A;  1WGG A;  2DYM A;  3L17 A;  2YVC A;  1V9J A;  3L10 B;  2RNR B;  2PZ1 A;  3CST A;  2LGX A;  5EDS A;  2Z0P A;  2CRF A;  2KTR B;  3VH3 B;  3ENB A;  1WJ1 A;  3JW0 X;  3S2A A;  4YON A;  3MHS D;  5CHW A;  3QCA A;  4GXB A;  4DX8 A;  4DDG D;  3ODW A;  4BFR A;  2PJH A;  4WWO A;  1X11 A;  5IA7 A;  3IFW B;  3PLV A;  2MLB A;  1XOD A;  2N0Y A;  3HHM A;  4IWO A;  4IW0 A;  3VQI A;  4JKB A;  3D8F A;  2Z0Q A;  2D07 B;  2CR5 A;  3WAO A;  2O6V A;  4JK7 A;  2RPQ A;  1EF1 A;  2GJY A;  2MRP A;  3OAN A;  4DWF A;  1DDV A;  2KFJ A;  3N32 A;  4TQ1 A;  1NI2 A;  2JRI B;  4BKT A;  1WGQ A;  4ZRK A;  2QHO A;  3E9L A;  1OMW A;  2NBV B;  3PSC A;  2C5L C;  1OTR B;  3PT2 B;  4BKS D;  2OTX A;  3SV1 A;  4JKG A;  4CHJ A;  3IVF A;  1X1M A;  2UYZ B;  3QK0 A;  3KUZ A;  5JH5 C;  1U27 A;  2GCJ A;  2KUP A;  2KX0 A;  4OVV A;  4HB2 B;  4JKH A;  2WDT B;  4GPT B;  1KJT A;  2H7D A;  5AZF A;  1NDD A;  1WJN A;  2K1F A;  3OJ3 A;  4JL9 A;  1UNR A;  3R66 C;  3APC A;  4MT7 A;  2K00 A;  2N9P C;  5DI9 B;  4A5K A;  4HPL B;  3OLM D;  4F7U P;  4K17 A;  4CYE A;  1MK7 B;  4KSL C;  1V5U A;  2DA0 A;  4ZYN A;  3LDZ E;  3RUL A;  5DHF B;  2AL6 A;  1FXT B;  2ROV A;  2N23 A;  3OJ4 B;  2BKF A;  4A6F B;  2IZV B;  1WX9 A;  3UQB A;  2FCN A;  2M1M A;  1LW3 A;  2CQU A;  2X18 A;  4KAX B;  4L6E A;  2DHZ A;  4WJ7 A;  2YS1 A;  4RMA A;  2MBB B;  4HAY B;  3M3J A;  5HE3 A;  4BVU C;  2I5F A;  3SYX A;  3D8E A;  4DBB A;  4JKG B;  2RSG A;  3AU4 A;  4MM3 A;  3DBR I;  3APD A;  3V62 A;  3SU8 X;  1OQY A;  3A4S C;  2OQB A;  2EMT A;  3ML4 A;  1DIK A;  4PS3 A;  4E74 A;  2GBR A;  4KDL B;  4HAW B;  3HM3 A;  1P5T A;  4W9H A;  4AJW A;  2PPH A;  1Y8R C;  3U7D A;  1EO6 A;  2VSZ A;  2ZEQ A;  1KZG A;  5KHO A;  1E8Y A;  2L0F A;  3AI5 A;  4NAW A;  2DX5 B;  3ZVR A;  1V61 A;  1WJU A;  2C7N B;  4EFO A;  2IO0 B;  1Q0W B;  3SD5 A;  2WH5 A;  1E90 A;  2HE7 A;  1P0R A;  2RGN B;  1NTI A;  4EMO A;  2KFK A;  2ROZ B;  4HWI B;  4DK5 A;  4W9G A;  5DPT A;  2MSE D;  3APF A;  4ZRJ A;  5JHH A;  3VTU A;  4FUL A;  1H8C A;  2KZR A;  4EKU A;  5DPR A;  2COP A;  5DCN A;  1UNQ A;  1DDW A;  3KH0 A;  1OEY A;  2L05 A;  2LUE A;  3ALB A;  2MDX A;  4JKD A;  2AEH A;  2BPS A;  1K5D B;  1HBK A;  1I35 A;  4BOZ B;  3PVL A;  1MK9 B;  2JWZ A;  5E6O A;  1WFY A;  2ZPN A;  1MIX A;  4JKF A;  3IG3 A;  3RZW C;  1RRB A;  2KJR A;  4HCN B;  4IM2 A;  1AQC A;  4WWN A;  5D27 A;  3NOB A;  2IBI B;  3VTV A;  5CHV C;  2YS5 A;  3ZNH B;  4GDL A;  1PLS A;  3ML8 A;  2Z0E B;  3C0R B;  3KUD B;  4ANW A;  3R3M A;  2K39 A;  3FEH A;  2CKH B;  3NS8 A;  1L7Y A;  3X23 A;  3RCP A;  4HCP B;  1HB8 A;  3VFK A;  1IYF A;  1RFA A;  4PYU A;  4E71 A;  2D10 A;  1TJ6 A;  4HAU B;  2DYB A;  3TFM A;  2O2V A;  3ULC A;  1E5W A;  1WYW B;  1WR1 A;  4MH0 E;  4A3P A;  4ILH A;  3NSU A;  1Q67 A;  4GB9 A;  3FP5 A;  4HAZ B;  1GNU A;  2R2O A;  3ZTD A;  1V5O A;  2KWU B;  4BBK A;  2CB8 A;  2BYE A;  4JIO U;  1K8R B;  2P0D A;  5C5B B;  2MW5 A;  3KVF B;  4PS7 A;  1ZC3 B;  1P98 A;  1WRD B;  2C9W B;  4GU2 A;  2Y5B B;  3VUX A;  2KLC A;  1WE7 A;  2P0H A;  2BWE S;  4I6N B;  1M94 A;  3PS6 A;  4HK2 A;  4LJP B;  1QC6 A;  2W2X D;  5KHQ A;  4EEW A;  4GDL B;  2WYQ A;  3L16 A;  3WAM A;  1FHO A;  2KOX A;  1MIZ B;  3A4R A;  1J8C A;  2IFS A;  4B6H A;  2FCM A;  2COD A;  3O96 A;  1NBF C;  3PHX B;  1SE9 A;  4JLC A;  2O2V B;  1WGR A;  2LUL A;  1RRP B;  1I42 A;  2HRJ A;  2D9Y A;  2AL3 A;  1CMX B;  2A5U A;  4BBN F;  2LOX A;  1GJZ A;  1BTK A;  1V5T A;  1PFJ A;  2RR9 A;  4W9K A;  1GGO A;  4B9K A;  4DXA B;  1WJ6 A;  2KLG A;  5D94 A;  4KV2 A;  3QQ8 B;  5D3X A;  2JXX A;  5LOP B;  2RGF A;  1WXA A;  1AAR A;  3GOE A;  3M1I B;  2EJ8 A;  4H8S A;  2EKE C;  2KTR A;  1LM8 B;  2WX0 A;  1FGY A;  3P7Z A;  1L2N A;  1HB6 A;  2L76 A;  2KJ6 A;  2COA A;  1E8X A;  2K2U A;  1X05 A;  1XQQ A;  4Z2M B;  4F8C B;  3AXC A;  1KLV A;  3ZLZ A;  2KDB A;  2KQS A;  1ST7 A;  3O65 B;  3WIM A;  2B3A A;  3UQA A;  1BTN A;  2RLO A;  4ZRI A;  2LXA A;  2MFQ A;  2CHW A;  1MKE A;  4N9F 4;  3RZF A;  1MG8 A;  3VDZ A;  2OJR A;  2G45 B;  3HK0 A;  2JF5 A;  4BKS A;  2LI5 A;  2N7D A;  1WJ4 A;  5D3Y A;  5D6J B;  1FHX A;  3DPD A;  2NS5 A;  3ULB A;  3K9P B;  4XC2 A;  3A33 B;  4JQW C;  2IYD B;  4E3C A;  3MTN B;  5C1Z A;  3A1Q A;  4LCD E;  2EC1 A;  2AWT A;  4XWX A;  2DX1 A;  2GBK A;  2N9X A;  3ODO A;  3V6E B;  2DKP A;  4KZC A;  3A8Q A;  2D9V A;  2HTH B;  4J6I A;  3PZD A;  3W1S A;  4GMV A;  1SGH A;  1PQS A;  4M0W B;  3AU5 A;  3V60 A;  3PRM B;  4TV3 A;  3SUZ A;  1U29 A;  5G2N A;  4KVG B;  4TKN A;  3ZDT A;  4FBJ B;  2NZ8 B;  2YSZ A;  2P0F A;  3D32 A;  2DHI A;  4JK8 A;  4A6F A;  2BYV E;  4F7H A;  1K5G B;  4ANU A;  3L54 A;  4HDQ A;  3PRE A;  3HM6 X;  1PMS A;  2N9E B;  1WJM A;  1SIF A;  3BJI A;  3RUI B;  2DYO A;  2PE9 A;  4I6P A;  2XBB C;  4ILJ A;  1MAI A;  1RJ2 A;  1RAX A;  4G0N B;  1KI1 B;  4LJO B;  2W2W A;  2KN5 A;  4HB4 B;  2KD0 A;  4NNJ B;  1WXM A;  4GZU A;  5KCV A;  3A1Q B;  1F9J A;  4MDK E;  2AYO B;  2K6D B;  5J17 A;  5D3W A;  2BKR B;  4DDI D;  1N3H A;  1ZGU B;  3A9J A;  2JT4 B;  1W1G A;  4KHO A;  5J2R A;  1UGM A;  1TZ1 A;  4WWP A;  3QA8 A;  1RLF A;  3SBT A;  3W1S C;  3VHT C;  3F0W A;  2ADZ A;  2FJL A;  4HDO A;  3ZO5 B;  4II3 B;  1UBQ A;  4II2 B;  2DX5 A;  1UNP A;  2NCN A;  2KC1 A;  3TCA A;  3H9D A;  3BIN A;  3M63 B;  2JRH A;  2KMC A;  3PPA A;  5G55 A;  1UPQ A;  4DHJ B;  2R2Q A;  3M95 A;  4K1R B;  4CHM A;  3GYO A;  2UWQ A;  2REX A;  2Z0O A;  2D2Q A;  1V80 A;  2L00 B;  3KYC D;  4GOC A;  4RM8 A;  1UD7 A;  2KWC A;  4DHJ D;  4FJV B;  3PHW B;  4ANV A;  2LZ6 A;  3KSY A;  3P6A A;  3FM8 C;  4G3X B;  4F7G A;  1Q1O A;  3IBE A;  3ZTC A;  1QQG A;  1C1Y B;  2BGF A;  3A9J B;  4ICU A;  2KQ7 A;  4K7U A;  1WXS A;  3DBH I;  5J3Q A;  1Y5O A;  3DOW A;  2DZK A;  4DX9 0;  3QHT A;  2DKQ A;  2C7H A;  1V81 A;  2MBQ A;  3D8D A;  2KDI A;  1R4M I;  2LWP A;  4BKG A;  1KBL A;  1WH3 A;  5GOW B;  3RYT A;  3CSF A;  2FID A;  2FNJ B;  1P1A A;  3EEC A;  2CY5 A;  4NQK E;  3H6N A;  3QAQ A;  5FI1 A;  3VH4 B;  4KIK A;  1LQB A;  1D3Z A;  2JY6 A;  5L81 A;  1DDM A;  2KDF B;  2I1K A;  1X1F A;  1T0Y A;  4EZL A;  2KMA A;  4MGZ E;  4W9I A;  1IP9 A;  2ZCB A;  1V5M A;  2DZJ A;  1Z87 A;  2FUH B;  2D11 A;  1YJ1 A;  1ZW7 A;  2GCL A;  3WAP A;  3GYP A;  4Z2N A;  2EMS A;  3ONS A;  3ZVV A;  4A20 A;  2VRW B;  5C5B A;  3A9K B;  3CMM B;  1V6E A;  2I5C A;  1DBH A;  1GC6 A;  3BY4 B;  4GIV A;  3MDB C;  3PLU A;  1X1G A;  3UIN B;  1WR6 E;  1E7V A;  4WJO A;  1WY8 A;  2RQ1 A;  3A8P A;  2KNB A;  4IOY X;  4D0N B;  1NTY A;  2LOZ A;  3L08 A;  1J19 A;  1VD2 A;  4ASW C;  5JZE B;  2XEW A;  4GGQ A;  4HXD A;  2ZJD A;  2Y8G A;  1BT0 A;  4HHV A;  5C6R A;  1IRS A;  3QWZ B;  2A4Z A;  2Z59 B;  1ZC4 B;  3HW2 B;  2MBE A;  4KIK B;  2E2X A;  3PSE B;  1WGY A;  3QX1 A;  1NTV A;  4EOY A;  2ZVN A;  1NVL A;  1B55 A;  2DTC A;  2ELB A;  3PEG A;  1ZKH A;  2DN6 A;  2IY0 B;  3KW5 B;  2X0S A;  4G11 A;  5JVL A;  3CXB B;  4HPM B;  5HE2 A;  1MPH A;  3LJU X;  5CX3 A;  3P2B A;  5FI0 A;  2C7M B;  1XD3 B;  2C60 A;  3ECI A;  1G6J A;  5HE0 A;  2W2X C;  1Y19 B;  4MY6 A;  3EHV A;  3IHP C;  2KKC A;  2MKR A;  3B08 A;  5D2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...