2EMSA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule cd43
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cytoplasmic tail of adhesion molecule CD43 and its binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emsA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emsA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emsA01
4HDOA 4IC7B 4KZ0A 3VDZA 3VXWA 3PZDA 2ZEQA 3ZRCA 2Y5BB 2DAJA 2KLGA 3A8PA 2IO2B 5CLQB 3MTNB 5HE3A 3DBLI 4WJ7A 1SHCA 2D9YA 1KOTA 2CAYA 1ZC4B 3P6AA 1J19A 1MIZB 2OTXA 1E90A 2KC2A 4OVVA 5AZGA 5AZFA 3TL5A 4WJOA 4RMAA 4EOYA 1LXDA 2CHZA 3RYTA 3WALA 1FAOA 2LGYA 3GZNI 4NJ7A 4XWXA 4Y94A 1EF5A 4EKUA 2JWZA 2JPHA 3EHVA 4NNJB 3U30A 1DROA 3WAPA 4DX90 4K81A 3AU5A 1E8WA 3VVWB 2C9WB 2ZVOA 2DTCA 2DX5A 2NPTA 3B1LX 4X57B 1RAXA 3ZDTA 1WJUA 3T9LA 1K5GB 1MAIA 3U8ZA 1X05A 3WANA 2N9XA 4MJSA 2X18A 3ODWA 1UZXB 4E71A 3KRXA 4IM2A 4NQKE 1WXSA 4PYZA 4GMVA 4NAWA 4MEMA 3W1SC 1WY8A 4DHZB 2FNJB 5LOPB 3CMMB 2MRPA 5JH5C 1OQNA 1PFJA 3ONSA 1H8CA 3ODOA 1UNPA 2DHKA 5EFXA 3CXBB 2M17A 2KKCA 1XCGA 1IPGA 5CTRC 5E6NA 3FM8C 3KVFB 1C3TA 4OVUA 1U29A 4TQ0A 3IBEA 4KHBB 1P3RA 2DAFA 1OTRB 4W9EA 3SD5A 1YIWA 3V6CB 3T06A 3OJ3A 2YS5A 3EFUA 4PS8A 4GMXB 4D0NB 1FXTB 1M7RA 1H4RA 4GZUA 3MDBC 4Z2NA 3P7ZA 1LM8B 2REXA 4A20A 4L6EA 2ZZPB 3ZNID 2KUPA 4HPMB 5J3QA 3QK0A 4EZKA 2KCJA 2Z0PA 2HJ8A 1VCBA 1XKEA 2M1MA 4M8MA 2RSUA 3APCA 2JUOA 2LGXA 1UPQA 3PS6A 4IWOA 1Z87A 4WSFA 2KWUB 2M4NA 4NPNA 3V62A 4I6NB 2FUHB 3L17A 2BYFA 2PEAA 4G50A 2NR2A 2DHZA 4K7SA 1KZGA 3F5RA 3ZNGC 4NQLB 2UZSA 4Z2MB 2LUEA 3P2BA 4AP4C 5D7GA 3O96A 4KHOA 4ANVA 2I1JA 1MK9B 4WQOB 3ENEA 3N32A 2RGNB 4IOYX 1J0WA 1Y5OA 1P1AA 5D3VA 2DYOA 3JSVB 3PPAA 3QX1A 3VH4B 5J3YA 3M62B 4CO7A 2FCQA 2D10A 4CHJA 2XEWA 2Z0QA 3FEHA 1V9JA 2CR5A 4HB0B 2KO3A 2MP2B 1WVHA 3UF8A 3Q3JA 3BINA 2JRHA 2PJHA 3D8DA 1D3ZA 5C5BA 2HE7A 1W1HA 3PVUA 3SYXA 1ACAA 5BO4B 2L2IA 1UGMA 1J8CA 3KYDD 2I5CA 2NS5A 4MJSB 3RZWC 2K6QA 3FP5A 3PSCA 3JW0X 2MWSB 3K9PB 1BT0A 5HE0A 1XD3B 2ZCCA 1ZC3B 4EMOA 3AULA 5KHOA 2VRRB 1P5TA 3A9JB 4F7UP 4JQWC 2KQSA 5KQ4A 5D2MB 4HAZB 2L7RA 4MGZE 2EMTA 1C1YB 2DX1A 5HE2A 4B6HA 3JYUA 4ZYNA 4E3CA 2M0XA 3NZUA 3CSTA 4IW0A 3KYCD 1NU2A 1IP9A 2QKLA 1MPHA 4HAXB 2I5FA 4HAYB 1EAZA 2KXJA 2L8JA 1EF1A 3H1UA 1X86A 2ZNVC 3A4RA 2DHJA 2MBQA 2KMAA 2MBEA 1Q67A 1E8ZA 1U4AA 1BAKA 1U5GA 3NOBA 1AQCA 4A6KA 2O6VB 3PHWB 3PV1A 3ZTDA 1V86A 4AJWA 1V89A 4B9KA 2DYQA 5GOWB 2JF5A 3VIAA 5DCNA 1XQQA 1ZM0A 3VTWA 2DHIA 3KUZA 3APFA 4BBKA 1H10A 4YONA 2IFSA 3ULCA 1XODA 3A33B 2GBJA 4BVUC 3PRZA 1AWEA 5DH9B 5DPRA 4LJOB 4C0AA 2M14A 2C7NB 4MGYE 3F0WA 4CHKA 2LBBA 1LQBA 1CMXB 3KRWA 4BOZB 2GCJA 4YL8A 1E7UA 1UELA 2IBIB 3N7CA 2KWCA 3H6NA 2KGXB 1WGDA 2IYBA 2Z0EB 5DI9B 2L00B 3M95A 4G11A 3ZTCA 3LDZE 3UIPB 3MPXA 1YD8U 2ADZA 2BGFA 1WI0A 4MGKE 1B55A 4W9KA 4M8NA 4BOSC 1OY2A 2MBOA 1EGXA 1UPRA 2FAZA 2PE9A 3UZTA 2MKRA 4ZRKA 2O2VB 2ZJDA 5J17A 2N1VA 3K9OB 1WJMA 2R0DA 4DHJB 3VUYA 2GBRA 3HIZA 1P6SA 1DBHA 2BKRB 4W9LA 5AEKB 1TZ1A 2G3QB 1V2YA 2JZ3B 4HWIB 4WWPA 4IFSA 5FI1A 2LKOA 1YX5B 3DVNU 2GBMA 1UEFA 1J0GA 5FR6A 3ZNZB 2LZ6A 4HK2A 2FJ9A 3TBLD 1I35A 4HAWB 3SO6A 4ASWC 4HPLB 2FCSA 2Y8FA 5D27A 3QIJA 1RRBA 2K39A 1UBQA 1FHWA 2MA9B 2XK5A 3A1QB 2LYDA 2RVBB 1EUVB 2YS3A 4TUUA 4PYUA 1WR1A 2JY6A 2K8HA 2Z59B 3LJ3A 1V49A 3RCPA 4I6LB 4W9JA 2GBNA 4LCDE 3SU8X 2BPSA 5GMVA 2N1WA 3VAWA 2O6VA 2I1KA 1WGHA 3GOEA 4HJKA 2NMBA 2XBBC 2BYVE 1MK7B 1V5OA 1WJ4A 4DXAB 4NY0A 1UBIA 3B08A 5DPTA 5IA7A 3X0WA 5C1ZA 1WZ0A 4K1RB 3OANA 4K2PA 2ZPYA 2ASQA 4EEWA 3DVGX 2PPHA 5CHFA 2EKEC 3R7RA 4GN1A 2KNBA 5CLLB 5JHHA 1WGRA 2WDTB 3TIXA 2E2XA 4KVGB 2MW5A 1XR0B 2MP2A 3BY4B 3H9DA 1UNRA 1V6EA 2BKFA 2LG1A 3PHXB 3B0AA 2YS1A 4TKNA 1A5RA 3ZRFA 2YT0A 4W9IA 1MG8A 2XQNM 3TVVA 3WA0A 4GDLA 2LRUA 3DXCA 2KTFA 3KZ1A 2K2JA 2YF0A 2LVOA 4B6WA 4EJNA 3S2AA 5J2RA 4DDGD 3I3TB 3C0RB 2P0FA 3TMPB 4MSQB 3ECIA 1GG3A 2VRWB 4EZJA 1V5PA 5LXIB 2K1FA 3QA8A 5AZHA 3CIKA 1DDVA 2PE6B 4W9DA 1M7EA 1X11A 1WF9A 2LD9A 2M8SA 4ICVA 3SNHA 1NTVA 2Z0OA 5FI0A 4TV3A 1BTNA 2EJ8A 3RT3B 2DZKA 2DKQA 2P0DA 3R3MA 4E74A 2KC1A 1JRUA 4FLHA 2WH5A 1V80A 2NBUA 2IO0B 5HE1A 2AEHA 2KJHB 4KIKA 2CHWA 2GMIC 2J59M 1Q0WB 2KANA 5LONB 2J7QB 4IWPA 3A8QA 2AYOB 2DZIA 3HQCA 2DLWA 1WH3A 2KD0A 4W9FA 1UNQA 2V1YA 3U7DA 1W1DA 4K2OA 1WXVA 2A5UA 1WE7A 2N7EA 1K5DB 5C79A 2K8BA 3EECA 4W9HA 2LULA 4A6HA 3VUXA 4GB9A 4F1SA 5KHQA 3A9KA 4FBJB 1TQZA 4MY6A 1QQGA 5L83A 4HDQA 2COPA 3PP2A 2HRJA 3KY9A 3OLMD 3QQ8B 3R66C 2ROVA 3T8MA 2EMSA 2K8CA 2OQBA 3UQBA 1TGZB 2KJ6A 2KQ7A 1OGWA 1BTKA 1DYNA 1FGYA 2K2UA 2IO1B 2MDXA 3DVGY 3DCGA 4HXDA 4MSMB 3TJPA 3ZIMA 4KDIC 1NBFC 4HAVB 1X1FA 3JVZX 4P7IA 3DXDA 1GUAB 2K25A 3CSFA 3PVLA 4TYZA 1S3SG 5D94A 1I7AA 2GOWA 3QARA 2G45B 1E8YA 3VHTC 3DDCB 3WAMA 2DFKA 2COAA 1TJ6A 2C7MB 5JHGA 2KTRB 2HD5B 2R2OA 1AARA 1KZ7A 4W9GA 3ZDMC 1PQSA 2H7DA 1Q1OA 4WJQA 3SHQA 2ELAA 2QKMA 4FADA 1ZSQA 4GPTB 1EVHA 2L0FA 1OEYA 3GYOA 4RM8A 3HHMA 4IAPA 1V61A 1WI1A 1WX8A 4GIVA 3BJIA 3V60A 3H7PB 4LDTB 1Y19B 2GJYA 3AJ4A 1UD7A 3QHTA 4GDKA 4MH0E 4I6PA 5IAAC 2A4ZA 3V6EB 1OMWA 2RUKB 1U2BA 5D3WA 1ZGUB 2G35A 5C6RA 2CY4A 5G2NA 1WR6E 4WJNA 4M0WB 4A6FB 2R09A 1EO6A 4FN2A 1E7VA 3ML8A 2DZMA 1WGYA 4MELA 3G9WA 2UWQA 2NVUI 2RR9A 3A98B 1SIFA 3A9JA 1P98A 4K17A 2KVRA 3O65B 1GC7A 2DA0A 4XZ4A 2CY5A 2JRIB 2RNRB 3ODXA 4F8CB 3AU4A 3HM3A 3M3JA 3ML9A 4IG7B 4BKSA 1IYFA 4K7WA 4XX5A 3MJWA 2JT4B 4HATB 2L76A 2LXAA 1MKEA 1WMHB 2KFJA 4PNKA 2KFKB 1VD2A 1Z2MA 2RPQA 2QHOA 1U5DA 2L1CA 2W9NA 2MLBA 4KV2A 2L0TA 2G4SA 4HVBA 2CQUA 2D2QA 3X23A 2Q13A 2UVMA 3PG7A 2O2VA 2ZPNA 3L16A 4RM9A 1XD4A 3PRMB 3PRPB 2ROZB 3NY5A 3PLVA 3DVNV 1WE6A 3VTVA 3ZLZA 3APDA 2MQJA 4MM3A 3VOQA 4IM0A 3D32A 4LJPB 2CRFA 1LW3A 4GDLB 1V81A 4EZLA 2KX3A 1I2HA 1L7YA 4HB2B 3DBSA 3OJ4B 4AWJA 4FA6A 3QWZB 2DYMA 1I42A 1FOEA 4JL9A 2OOBB 3KW5B 2FJLA 1WM3A 4HB3B 4A5KA 2FIFA 4BFRA 2KLCA 5KQ1A 2KWVB 3DBHI 2D07B 1RRPB 4W9CA 1UH6A 3QJZA 2KDFB 2DX5B 2LI5A 2IZVB 2L3ZA 2NPTB 5CHVC 2D11A 4H8SA 2WX1A 4F7ZA 1KLVA 4NSWA 4B95A 1HB8A 5JZEB 2KK8A 4ICUA 2K6DB 1U5FA 3D8FA 2Z0DB 4N9F4 3ZO5B 4BKGA 5EDSA 2D9ZA 1NTIA 2MSED 3V5WA 2D4QA 1WX9A 3ALBA 4A3PA 5D6JB 3UQAA 2VSZA 5E6PA 4DX8A 1P9DU 2IY1B 1WJNA 2KZRA 1SGHA 4A3OA 4HLEA 5L95C 1YJ1A 3M63B 1RFAA 1GNUA 2LASA 2V4LA 3IHPC 3PSEB 1L2NA 2YVCA 3PREA 2W2XC 3QAQA 3PT2B 1WZ3A 2NBVB 4ZRJA 2OJRA 3CF6E 3ML4A 4KSKC 1GC6A 1WJ6A 4WAAA 1TXDA 1R4NI 1DDWA 2W2WA 2N9EB 2LJ5A 3VTUA 4EFOA 2DYBA 1DDMA 5TR5A 3DBRI 4DBGA 3NS8A 1WM2A 4KAXB 3IFWB 3L54A 4DK5A 2KDIA 1TTNA 1ZW7A 5G55A 3DPDA 2N0YA 4J6IA 4BBNC 2HTHB 3IG3A 3SV1A 2RQ1A 1WFYA 4MK0A 4IWQA 3QWMA 1LFDA 4GXBA 5DPSA 3HK0A 4HCPB 4MGIE 5C16A 2KDEB 3SDLC 2MFQA 3L10B 1KJTA 1GJZA 1WXMA 3N30A 2P8VA 4WVFB 3TW1A 2DENB 3A4SC 2PZ1A 4FHKA 3WAOA 3SUZA 3L13A 5E6OA 2ELBA 2V76A 2KTRA 4CHMA 3Q3FA 4FJZA 4IUMB 4KDLB 5HKHA 2D9WA 2Y7BA 2YT1A 1FHXA 1WX7A 3HM6X 4GSWA 4BKTA 3ULBA 2UYZB 2LWPA 3KUCB 1T0YA 1PLSA 2KN5A 3PGEA 1WJ1A 1ZKHA 2WX0A 3NSUA 1ZVRA 3TCAA 2BWFA 4XC2A 3RCZA 3VUWA 1HE8A 3W1SA 1R4MI 4AJYB 1P3QU 2CODA 2YRYA 1OQYA 1NI2A 3DQVA 1PMSA 3D8EA 4G3XB 2W2XD 3QC8B 4WWOA 1U27A 2BCJA 4GDKB 4F7HA 2DN6A 2GBKA 4NJ6A 1QZEA 1FHOA 2IY0B 4PS7A 3UGBB 4EUTA 5J18A 2FCNA 4KZCA 5C5BB 4GGQA 1WGGA 2UZRA 4JIOU 1WYWB 3A9KB 4II2B 2LOZA 4FULA 4BBNF 1E8XA 4HB4B 5JLJB 1Q5WB 2C7HA 2LGDA 3EC8A 4TQ1A 2DYNA 2JP2A 3VH3B 1WRDB 3EPYA 4ZDVA 1WIAA 2RLOA 4AUQC 4ANXA 2ZVNA 1NTYA 2COFA 2RSGA 4WWNA 2GCLA 2G4DB 5C23A 2KFKA 2N7DA 5L81A 3KH0A 2Y8GA 2RGFA 1U5EA 2LVQA 4PS3A 5CHWA 5DIFB 4MDKE 4AOFA 4KIKB 1N3HA 1ST7A 1RLFA 1YX6B 1S1QB 2L05A 3PTFC 2KDBA 2KOXA 4FHJA 4II3B 3V61A 2COCA 2H7EA 2NBWB 4HHVA 4HCNB 5DHFB 4ANWA 2YSZA 2IYDB 2MX2A 3L08A 4JGHB 1V5UA 4MT7A 2HTHA 3WYFB 3UIOB 2LOXA 3FSSA 4HAUB 1P0RA 3GYPA 3FLVA 5D3XA 5IJMA 2FCMA 5DPWA 2M38A 3DXEA 2IO3B 2KHWB 3DOWA 1WGQA 2D9XA 3HW2B 5D3YA 2C5LC 3L0WB 1Y8RC 3H7PA 3RD2A 1K8RB 3R7QA 3QCAA 4K7UA 3RUIB 1QC6A 2RD0A 3RZFA 3IVFA 4JLCA 4DHJD 1NVLA 5CX3A 3WIMA 2B3AA 2BF8B 1WG7A 2D3GA 1HBKA 3TO1A 2N9PC 4G0NB 1ISNA 4DHZE 2YLMA 1RJ2A 4A6FA 3ZUNA 4BKSD 4DDID 2J0MA 3N3KB 2CHXA 1V88A 4GU2A 3ZVRA 2R2QA 4LDTD 1XT9B 2NZ8B 5KCVA 2D9VA 1LB1A 2LXCA 3W1YA 3ZKJC 1SE9A 2AL3A 2J0KA 1V5MA 1M94A 4F7GA 1OEYJ 1YQBA 2WYQA 2LVPA 2CB8A 3NHEB 2N23A 2V3SA 3ZNHB 2P0HA 2CS4A 1F9JA 4GOCA 1W1GA 1NDDA 1X1MA 2O6VD 3AXCA 3RULA 2ABDA 2CU1A 2CKHB 2MBHA 3JSVA 1IRSA 3PLUA 5LXHA 3H7SA 2FDQA 1X1GA 4FJYA 4ANUA 1E5WA 3AI5A 5LLIA 2AWTA 3NZSA 2GS0A 2BYEA 4KSLC 1HB6A 2AL6A 4CYEA 2MWNB 2WWZA 3ZW3A 5JHBA 5JP4A 4ZRIA 2XK5B 2N4FA 3A1QA 2MCNB 5JHAA 4KHAA 3ZVVA 3PEGA 1FGZA 3PVWA 2KMCA 2J0JA 3QBVB 3OAWA 1G6JA 1WGUA 3LJUX 2VKIA 2ZCBA 4PQ0A 1KM7A 3KUDB 4IM3A 2C60A 1MIXA 3MHSD 3M1IB 2JZZA 3TFMA 4WJPA 1FB8A 1V5TA 4DWFA 1TBEA 2JVCA 1XX0A 4DBBA 1WXAA 1Z5SB 2MBBB 2ZNVB 3UINB 3VQIA 4URKA 3KSYA 1BWNA 5J3TA 3VFKA 1WMHA 1KI1B 2JXXA 2FIDA 2DKPA 4NAWB 2EC1A 2KX0A 5DHAB 2BWES 2LRWA 4FJVB 2DZJA 2NCNA 2K00A 2KJRA
chains in the Genus database with same CATH superfamily
4HDOA 2RDGA 3NVZA 2ZEQA 3PZ7A 2IO2B 4WJ7A 2D9YA 1KOTA 2CAYA 1ZC4B 1J19A 1E90A 3HIEA 4LNNA 4WJOA 3TL5A 4RMAA 1LXDA 4EE2A 3WALA 1FAOA 4XWXA 4Y94A 3P4QB 4NNJB 2JPHA 4QXAB 2B76B 1K5GB 3U8ZA 4MJSA 1UZXB 1V1PA 2LMCA 4E71A 4NAWA 1MVKA 2MRPA 5JH5C 3HVDA 1H8CA 2J4XA 2DHKA 4JKHA 1FCCC 3FM8C 2Q5WD 4TQ0A 4HRSA 1NEKB 4C56C 4RGMA 4W9EA 2INNE 3T06A 3OJ3A 4D0NB 1FXTB 1M7RA 1H4RA 5I4DA 4L6EA 2KUPA 4OT1A 2Z0PA 2JYEA 2HJ8A 1XKEA 2KYWA 4IKGA 2JUOA 4IWOA 1UPQA 4NPNA 2FE8A 1FNUA 2K22A 2NR2A 2DHZA 4K7SA 1KZGA 3ZNGC 4NQLB 2UZSA 3P2BA 4AP4C 1YN5A 4KHOA 4ANVA 1VBGA 2RGNB 5D3VA 3PPAA 3L4PA 3M62B 2FCQA 2D10A 3FEHA 1V9JA 2CR5A 4HB0B 1WVHA 3Q3JA 3FVCA 2JRHA 4XWTA 1I4RA 2IGDA 1UGMA 3N1ZC 3RZWC 2GI9A 2M0AA 2MWSB 1BT0A 1K53A 3GE3C 4J3OD 1ZXIA 4JQWC 2WXLA 2KQSA 5D2MB 4ZYNA 4MGZE 1C1YB 1GAQB 2ZKMX 4B6HA 1KLUD 1DGJA 3KYCD 1TT5B 4HAYB 2KXJA 1VR9A 5FR3A 2DHJA 2MBEA 4EZLA 1BAKA 3NOBA 3ZTDA 4AJWA 1V86A 2DYQA 5GOWB 3TSSA 2JF5A 3P1MA 3U2SC 1ZPSA 1XQQA 1ZM0A 4BBKA 1I7HA 3A33B 4BVUC 2GBJA 1ROEA 2LBBA 1LQBA 4BOZB 3BWUD 1UELA 2KWCA 1Q10A 2KGXB 2Z0EB 3M95A 1YD8U 4MGKE 4M8NA 2PE9A 2O2VB 4QJ5B 2OEDA 1TKGA 2GBRA 2G3QB 1V2YA 4WWPA 4IFSA 4GLSC 4B0EA 1YX5B 2GBMA 1UEFA 2LFIA 3ZNZB 2LZ6A 1I35A 2FJ9A 3SO6A 4ASWC 2FCSA 3U52E 2K39A 2BTEA 4JK8A 4JKBA 3AE6B 1XO3A 2JY6A 2Z59B 1D4BA 5D3IB 3RCPA 4N6EB 3TEYA 1TJEA 4KGRA 2NMBA 1WJ4A 2E3TA 4NY0A 1UBIA 5DPTA 3X0WA 4EEWA 3HSAA 3NWAA 1JWUD 4YTNB 2E2XA 1CQVA 1XR0B 2MP2A 1XEEA 4Q2JA 1UNRA 1V6EA 4WURA 1A5RA 3BVMA 4WIPA 1T77A 3EA6A 3TVVA 2BVCA 3WA0A 4GDLA 2W82A 4R3DA 5J2RA 3W9CB 2J52A 2K1FA 3QA8A 1C78A 5AZHA 1DDVA 2KWDA 1BTNA 2WS3B 3DBHB 2INPE 2KJHB 4KX6B 2CHWA 2J59M 2BW2A 2QC8A 2AYOB 2DZIA 2Z8LA 3EGRA 3HQCA 1WH3A 1F0ZA 4JKGA 1W1DA 2NBVA 3OHMB 2K8BA 1GB4A 2W55A 3EECA 3R2IA 1IBXB 2X8XX 3AE4B 4A6HA 5KHQA 3A9KA 3DCXA 3PP2A 2HRJA 3QQ8B 2ROVA 3UQBA 2K8CA 1TGZB 2WGSA 1DYNA 2K2UA 2IO1B 2MDXA 2E6XA 1NBFC 3JVZX 2K25A 3QARA 2G45B 1E8YA 3WAMA 3DDCB 2IGHA 1SJHD 2C7MB 1AARA 4W9GA 1PQSA 2X38A 2VZKD 2TSSA 3KWLA 1V61A 3BJIA 4XDDA 2GJYA 1UD7A 4GDKA 1XLQA 5EE0A 4ARIA 1FNWA 2RUKB 2G35A 1WRIA 5G2NA 4A6FB 1M4VA 1WGYA 1LO5D 4RM8A 3A98B 4XYCA 2DA0A 2JRIB 1MI1A 3ODXA 1JMLA 3M3JA 3P4PB 1Z2MA 2PIAA 1U5DA 2L1CA 1QOGA 2DLBA 2G4SA 2ZPNA 2Q13A 4JKDA 5M4YB 4RM9A 1I4HA 1JW9D 2ROZB 3NY5A 2MQJA 2PKOA 1TIFA 1I2HA 1L5PA 4HB2B 3QWZB 4JL9A 4XGAB 3KW5B 4A5KA 2FIFA 4BFRA 2D07B 1RRPB 1UH6A 5HG2A 2WXFA 2KDFB 2NPTB 4TSSA 2IZVB 1YQ3B 4F7ZA 2D11A 2KK8A 2K6DB 3V5WA 4DX8A 5L95C 3PSEB 3PREA 1D5XC 3PT2B 3CF6E 1TXDA 2N9EB 2WHIA 4D6WA 3DBRI 3NS8A 1NI3A 4YWGG 1SJED 4K3BA 4N59A 1ZDXA 2HTHB 4YXDB 3AEDB 4MGIE 3SDLC 2MFQA 2PZ1A 3BVZA 1YN3A 2V76A 4CHMA 1FHXA 2GRIA 1T0YA 3SFDB 3TCAA 4AJYB 3W1SA 4JK7A 2CODA 4DXGA 3QC8B 1U27A 1L6VA 2R61A 4PS7A 4C4VA 3R2TA 4HSIA 4GGQA 3ZJUA 3A9KB 3W5VB 2DIKA 4YSZB 4OZCA 1L6UA 5I2MA 2Z59A 4WWNA 2K5PA 2G4DB 2FBWB 5C23A 2AQ2B 1J7CA 4PS3A 4AOFA 1S1QB 3I57A 1T5XD 3RNCC 4HHVA 4HCNB 4BAXA 2YSZA 2WXRA 1ZDVA 3L08A 4HROA 4JGHB 1QLBB 2WQYB 3AN1A 2JSVX 3WYFB 1WYGA 1MI0A 2V9HA 4PT5A 3GYPA 3FLVA 4ZYSA 1SE2A 3J9CA 2M56B 3T3NA 2C5LC 1Y8RC 1CJEA 3QCAA 4L23A 1PGBA 4ZOHC 3IVFA 4JLCA 1NVLA 2D3GA 2N9PC 3U7ZA 3TO1A 1XF5L 4DHZE 2YLMA 3ZUNA 4BKSD 1E7PB 4GU2A 1HTQA 1XT9B 1SBBB 3DBLB 2WP9B 2LXCA 1V5MA 1OEYJ 1T0SC 5G55A 3RFZB 2CS4A 1F9JA 2O6VD 3AXCA 2CU1A 3JSVA 2MBHA 1IRSA 5LXHA 1E5WA 1QOAA 3AI5A 1YN4A 2KIGA 2AL6A 1BMLC 1UGJA 3A1QA 2MCNB 1KLGD 4A55A 2KMCA 3PVWA 1A70A 3T3OA 4USAA 3LJUX 4PQ0A 1UWMA 1KM7A 3KUDB 2C60A 3Q8CA 2JZZA 4DWFA 2FJUB 1WXAA 1Z5SB 1BXTA 2JXXA 2FIDA 2KX0A 4FJVB 3P4RB 1N5XA 4KZ0A 1AW7A 1ZUD2 3VXWA 3ZRCA 2Y5BB 2DAJA 2KLGA 3A8PA 5CLQB 3DBLI 3AH7A 5AZGA 2H88B 2RDBC 2CHZA 2G9HD 3AE7B 3GZNI 4NJ7A 1EF5A 1FO4A 3EHVA 2I2YA 4K81A 3AU5A 1E6EB 1E8WA 2C9WB 2DX5A 1PUTA 3ZDTA 4P1BC 1MAIA 1X05A 3WANA 2WXIA 4P16A 3TEXA 5FK9C 3KRXA 2WLBA 4NQKE 5LOPB 3CMMB 1J7BA 1EM7A 3ODOA 1GOZA 3VRAB 1E10A 2M17A 1XCGA 1FIQA 4WAFA 3IBEA 2SAKA 2DAFA 1R4MB 1YJIA 3SD5A 1YIWA 5BMIA 1JALA 4GMXB 2WDRB 3MDBC 1LM8B 3QK0A 1ET9A 2KCJA 3MP9A 4QJ3B 2M1MA 2RSUA 1KTKA 2LGXA 4A8XC 1Z87A 4WSFA 2M4NA 3AEBB 1NENB 2FUHB 3CIRB 2KIEA 5IRSA 2M19A 2ICIA 2ACZB 2JX5A 4LNIA 3N32A 4IOYX 3VH4B 2XEWA 2KO3A 3UF8A 1DOYA 4L1RA 3BINA 3AE5B 2N9LA 5IO9A 1KC7A 1W1HA 3SYXA 1L0YB 3KYDD 4OSNA 2MJEA 3K9PB 5HE0A 2ZCCA 3DBRB 3AULA 5KHOA 1OQRA 5KQ4A 2EMTA 1FEHA 2DX1A 5HE2A 4E3CA 1NU2A 1IP9A 1XCTL 3H1UA 1P7EA 1EAZA 3U12A 4OZBA 2ZNVC 1IGCA 2MBQA 2KMAA 1E8ZA 1U4AA 1U5GA 1AQCA 4MH8A 2O6VB 2RPVA 4ACFA 4A90A 4B9KA 3VTWA 3KUZA 1EWCA 1H10A 5AUKA 1XODA 3PRZA 5DPRA 4C0AA 1MJDA 4JKFA 3T9LA 2L1AA 2L00B 3ZTCA 3LDZE 1XCQL 1WI0A 2R82A 4XDCA 1EGXA 2K8EA 2DWQA 4S0RA 2ZJDA 4JPSA 5J17A 4DHJB 1FCLA 4N58A 3VUYA 3HIZA 4ARCA 2WDVB 1DBHA 2BKRB 4W9LA 1QT9A 1TZ1A 3CWIA 1J0GA 2NTTA 3TBLD 2VH2A 4HPLB 3QIJA 1RRBA 1FHWA 2MA9B 2XK5A 1Y56A 2YS3A 2RMMA 1WR1A 4A9AA 2K8HA 3LJ3A 1JROA 4I6LB 2J53A 1TS5A 3SU8X 2BPSA 2N1WA 2O6VA 2I1KA 1WGHA 4HJKA 2INDC 4LK0M 1MK7B 1V5OA 1D6EC 1WZ0A 4K1RB 3OANA 4K2PA 1SIJA 3DVGX 2PPHA 2L52A 4KGSA 3R7RA 5CLLB 1WGRA 2WDTB 2FUG1 2BKFA 3TEWA 3Q14C 3DXCA 5BYSA 4LTUA 4L1BA 3TMPB 4MSQB 1GG3A 2VRWB 4EZJA 2N7JA 2WXMA 4W9DA 3AE1B 2WXQA 1WF9A 2M8SA 4ICVA 1NTVA 2Z0OA 3I63C 4TV3A 2JZPA 4D2KA 2DZKA 4E74A 3R3MA 4FLHA 2BBCA 2WH5A 1V80A 2NBUA 4QAYA 5HE1A 1Q0WB 2HTME 5LONB 4IWPA 3IT6B 4W9FA 2V1YA 4K2OA 1WXVA 2N7EA 1WE7A 4O1NA 1ZE3D 1XLNA 4ILGB 3DHHC 4GB9A 5L83A 3AEAB 3A58A 3T8MA 1D5MC 2KJ6A 2KQ7A 2KACA 1IBXA 1FGYA 4MSMB 1K52A 3DCGA 3AEGB 1S3SG 2GOWA 2WXOA 1UWXA 4RGNA 2DFKA 3E9LA 1SEBD 1C79A 2R2OA 1KZ7A 1N5WA 2H7DA 2K49A 4CSQA 1EVHA 3Q3MC 4IAPA 3V60A 3DHGC 4LDTB 1Y19B 1JWBD 3V6EB 2WXNA 1L4ZB 1J7AA 1ZGUB 3HVZA 2CY4A 4C4VB 1WR6E 4M0WB 1B9RA 2JXTA 4FN2A 4MELA 2UWQA 1P98A 4K17A 2ZW0A 3AU4A 3ML9A 4K7WA 1OFFA 3SEBA 1MKEA 1WMHB 4PNKA 3I9V1 2CQUA 2O2VA 2VZKB 3PG7A 1XD4A 4JWSC 3PRMB 3PLVA 3DVNV 2WXPA 1SXTA 4LJPB 1LW3A 1V81A 3MC0B 2KX3A 2DYMA 3P4SB 2OOBB 1DOXA 3SR6A 2KLCA 5KQ1A 2L83A 2DX5B 1FRDA 2QCZA 2WX1A 1HB8A 5JZEB 4ICUA 1VLBA 5EDSA 1TS3A 1WX9A 2D4QA 3ALBA 3UQAA 5D6JB 2VSZA 1P9DU 4ZRPA 1YOVB 3M63B 1RFAA 3PZ8A 1B1ZA 3OG5A 2JU6X 2CU3A 5IN7A 2OJRA 1JWSD 1WJ6A 1N61A 2QEJC 4HPPA 2BS2B 3V05A 1WM2A 4H2AA 4KAXB 2NMQA 4DK5A 4RGTA 3NWDA 4BBNC 4J6IA 4C00A 4MK0A 4IWQA 5C16A 3L10B 4JE3B 1WXMA 4FHKA 3A4SC 4XE0A 3L13A 2KTRA 4KDLB 3Q3FA 4IUMB 2MH7A 5IKCM 2D9WA 2Y7BA 4KHBA 1XLPA 4GSWA 3ULBA 2UYZB 3KUCB 1FFUA 4YTMB 3PGEA 1ESFA 1ZKHA 3NSUA 4GOUA 4YT0B 2I38A 1E9MA 3RCZA 1R4MI 1P3QU 2YRYA 1OQYA 1NI2A 4G3XB 1PMSA 3EUB2 4WWOA 4GDKB 3Q6BA 2IY0B 4EUTA 5IP4D 1FNVA 4FULA 4BBNF 4TQ1A 4HB4B 1Q5WB 2LGDA 2JP2A 1WIAA 4US8A 1SE3A 3AV8A 2GCLA 4REZA 3VR8B 3KH0A 2RGFA 1U5EA 1DYQA 4KIKB 4M02A 3C19A 4FHJA 4JK9A 1KRHA 2IYDB 2HTHA 3FSSA 1GB1A 4HAUB 1P0RA 2FCMA 2M38A 1WGQA 2D9XA 3HW2B 5C2TB 3H7PA 2WXKA 4K7UA 1I4QA 4DHJD 2B3AA 2BF8B 4ZRQA 1HBKA 3R8BA 4A6FA 5EE1A 2WU5B 1V88A 3ZVRA 5H8YE 4DQOC 1TKEA 3W1YA 3RMKC 1SE9A 4WQMA 2LVPA 4FXCA 2P0HA 3ETRA 4GOCA 1V1PB 3RULA 1X1MA 1ACCA 3Q8FA 2CKHB 3PLUA 4RF0A 2W3SA 2FDQA 5LLIA 3NZSA 2GS0A 2BYEA 4KSLC 5JHBA 2MWNB 3BYTB 5G5HA 4ZRIA 4KHAA 3EFCA 3OAWA 4P6VF 2D3CA 1MIXA 3MHSD 3TFMA 1FB8A 3VQIA 3RNGC 3NVYA 2EC1A 2LRWA 5TSSA 2KJRA 3O13A 3MHZA 4IC7B 3VDZA 3PZDA 3MTNB 3NZ3A 3P6AA 3RN9C 2KC2A 4OVVA 1CZPA 1C76A 1PDXA 3AECB 3RYTA 3B77A 2LGYA 3LB8C 4WWMA 4OW0A 1ZYIA 3U30A 1DROA 3WAPA 2H89B 3VVWB 2ZVOA 2DTCA 2NPTA 4X57B 1RAXA 2WXGA 2N9XA 1FXIA 1WWTA 4IM2A 4GMVA 4MEMA 2GB1A 3W1SC 4DHZB 2FNJB 1IGDA 2PMVA 1OQNA 3NUHB 3ONSA 3RPFC 1UNPA 3AEFB 4IOIE 2KKCA 1IPGA 1WXQA 5E6NA 1LGRA 3KVFB 4OVUA 4KHBB 1P3RA 3V6CB 5I2SA 4M0WA 3ZYYX 2XN9C 2QJLA 3AMZA 3EFUA 4PS8A 4GZUA 4Z2NA 4GNKB 2REXA 3RNFC 4C7ZA 3ZNID 3BZDB 5J3QA 1VCBA 4M8MA 3APCA 3E66A 3PS6A 2KWUB 5LNK1 4I6NB 2YEPF 3L17A 2BYFA 2PEAA 4G50A 5EE9A 1KH0A 3UI3A 3F5RA 1PGXA 1RM6C 2MJDA 5D7GA 3O96A 2I1JA 3ENEA 1J0WA 1Y5OA 2DYOA 3QX1A 5J3YA 1VZ6A 4CHJA 2IDYA 2MP2B 1ZXHA 1JWMD 3D8DA 3AB5A 2HE7A 2KDMA 1ACAA 5BO4B 2L2IA 2I5CA 2NS5A 1L0XB 2K6QA 3JW0X 3FILB 1XD3B 4EMOA 1I4GA 2VRRB 1P5TA 2ZW1A 1N62A 4F7UP 3A9JB 1R4NB 1K50A 1MPEA 3JYUA 2PVOD 3NZUA 3WCQA 4HAXB 1MPHA 1HXYD 1FRRA 2N0SB 1F77A 1Q67A 2IGGA 3PV1A 3ULCA 1AWEA 4LJOB 2M14A 4MGYE 3F0WA 4CHKA 1CMXB 2HDEA 1MHXA 2GCJA 4IM0A 3TJPA 3H6NA 2IBIB 2N9KA 5HI1A 4HJGE 3MPXA 2UU7A 1B55A 4W9KA 1OY2A 2MBOA 2FAZA 3E9PA 3RNBC 1YJJA 3C8YA 3K9OB 1WJMA 3DWMA 3NVWA 5AEKB 4HK2A 1F2RI 4HAWB 4ILJA 2Y8FA 5D27A 1I4PA 3LYYA 1UBQA 3KQ4A 2LYDA 1EUVB 3E9OA 4PYUA 2SEBD 1ENFA 4UDUC 2V4IB 2XBBC 2BYVE 4DXAB 2WU2B 3B08A 5IA7A 5C1ZA 1YQ4B 2ZPYA 5CHFA 5D3DA 2EKEC 5MPOA 4HEA1 3TIXA 4B6WA 2MW5A 3H9DA 3GB1A 3I5JC 3ZQ4A 3ZRFA 4W9IA 1MG8A 2AX5A 2WXJA 2LRUA 2K2JA 2YF0A 2BS3B 1L0VB 3S2AA 3C0RB 5LXIB 2KMMA 3ECIA 1V5PA 3BIID 1BUIC 2PE6B 1M7EA 2LD9A 4S17A 5FI0A 4AQ7A 2EJ8A 3SBTA 4RH6A 1GPXA 1UNSA 4WH4A 2IO0B 2AQ3B 2AEHA 2GMIC 2KANA 2D5GA 1PGAA 1WGKA 4US9A 2DLWA 2KD0A 3SBGA 3U7DA 2A5UA 2KQ4X 3VUXA 1V8CA 1FXAA 2ONQA 1V1OA 3URYA 4F1SA 4FBJB 4MY6A 4HDQA 2HJ1A 3KY9A 1HQRD 3AM9A 3R66C 2OQBA 1TYGB 1BTKA 4OHJA 3MJ5A 3DVGY 4HXDA 1DOIA 5C3JB 3B9JA 4TMAB 4HKQA 4CQNA 1GGOA 4P7IA 1GUAB 1RWSA 3PVLA 4TYZA 3Q8EA 2LEKA 2XNAC 5D94A 4B0MA 2COAA 1QQRA 1TJ6A 2INCC 2JWUA 4KKIA 3ZDMC 4GPTB 1MHHE 1OEYA 2EKIA 3MC9A 4KKJA 1WX8A 4RNAA 1WI1A 3H7PB 5IAAC 3AJ4A 5H92C 4MH0E 1VZ8A 4I6PA 1OMWA 1U2BA 2JQRB 5D3WA 5C6RA 2X0SA 4WJNA 3GE8C 2DZMA 3G9WA 2NVUI 2RR9A 2KVRA 1N63A 2CY5A 4F8CB 3HM3A 1IYFA 4BKSA 4NAMA 4RGOS 2JT4B 4HATB 2LXAA 2KFJA 1VD2A 2RPQA 3VRBB 4HVBA 4KV2A 3ZJVA 2UVMA 2D2QA 3X23A 3L16A 4AWJA 4C80A 3PRPB 3VTVA 4MM3A 5G5GA 3DBSA 1TZOA 4FA6A 1FOEA 2FJLA 1WM3A 5BYQA 4NZLB 2KWVB 4W9CA 1I4XA 3QJZA 1RFKA 2LI5A 4H8SA 4B95A 3ZO5B 2Z0DB 1HTOA 2D9ZA 1NTIA 5T8IA 4A3PA 3Q3NC 1NYQA 5E6PA 2IY1B 2KZRA 3DHIC 2DNFA 3IHPC 1GNUA 2LASA 3OWEB 2YVCA 4BZAA 3QAQA 3V3XA 3N20C 2NBVB 3ML4A 4KSKC 3VTUA 2W2WA 1NYRA 1F1HA 4EFOA 1DDMA 4M01A 5GXGB 4DBGA 3RNAC 1F2RC 1FPYA 3L54A 2KDIA 1ZW7A 2N0YA 3NJTA 3IG3A 3SV1A 3QWMA 1LFDA 1SSNA 5DPSA 2MEKA 1GJZA 3IT4B 3ENBA 3N30A 2P8VA 4WVFB 3TW1A 2DENB 2LJIA 2Z13A 3WAOA 3SUZA 5E6OA 2ELBA 4FJZA 2YT1A 3HM6X 2YEPB 2KN5A 2WX0A 5BMHA 1ZVRA 2KVZA 3VUWA 4QJ4B 4NJCA 4F7HA 1FHOA 2DBYA 1QKZA 1MG4A 2FCNA 5C5BB 1WGGA 2UZRA 1WSPA 4II2B 2LOZA 1N60A 1E8XA 3VH3B 3WIMA 2C7HA 4ZDVA 1WRDB 3EPYA 2RLOA 4AUQC 2PW9A 2ZVNA 1NTYA 2COFA 2IPKD 1JDEA 5L81A 5DIFB 1N3HA 1YX6B 2L05A 2KDBA 1K51A 4II3B 3V61A 2COCA 2NBWB 2NTSA 2WNMA 4MM3B 4ANWA 1V5UA 4MT7A 4RCOA 3DWGC 3GP7A 3FC4A 5IJMA 2LUMA 2IO3B 3DXEA 3RI7C 2KHWB 2LHDA 5D3YA 3L0WB 3RD2A 3GS2A 2V0GA 3RUIB 3RZFA 1WG7A 1KBLA 2BT6A 4G0NB 1ISNA 2J0MA 2R2QA 4LDTD 3B2FA 2NZ8B 1PYWD 2Y3AA 4JKCA 3NHEB 4PK1A 2CB8A 4YSXB 4LLGM 1W1GA 2QILA 1TY2A 3NWFA 3H7SA 4FJYA 1SB3C 3NW8A 2VH1A 3BK1A 1C4AA 1HB6A 4CYEA 2L32A 2XK5B 2N4FA 5JHAA 3PEGA 2MJ3A 1STEA 1G6JA 1AWDA 4XWWA 2ZCBA 4RFBA 3P42A 4WJPA 3M1IB 1V5TA 2JVCA 2J42A 2ZNVB 3ZJTA 4ITKA 3VFKA 1AYFA 1WMHA 3BVGA 1KI1B 2DKPA 5DHAB 2BWES 2DZJA 2NCNA 1F52A 2K00A 3IAM1 3TEZA 4L2YA 5HE3A 1SHCA 4LNKA 2D3AA 1MIZB 2OTXA 2GLSA 5AZFA 3ZGZA 1KFYB 4EOYA 1RYJA 4KGTA 4JWUC 1T0QC 4EKUA 2JWZA 2QSDA 3VR9B 3N1YC 4DX90 3FAHA 1R7SA 3B1LX 1WJUA 2X18A 3ODWA 1WXSA 4PYZA 1WY8A 2LGSA 1VJKA 1PFJA 1FD6A 3AE8B 1L4DB 5EFXA 3CXBB 5CTRC 3KWVA 3NG0A 1C3TA 1U29A 1JRPA 2V3NA 1FFVA 1OTRB 2YS5A 5IOIA 3P7ZA 4A20A 2ZZPB 4HPMB 4EZKA 3KLSX 2LHEA 3V62A 2BQQA 1HZ5A 4Z2MB 2LUEA 4JX1C 1MK9B 4WQOB 3E9SA 1P1AA 3JSVB 2BS4B 3B2GA 2Z0QA 2EELA 3E56A 5LG4B 3Q3OC 2PJHA 1D3ZA 5C5BA 3PVUA 1J8CA 4MJSB 3NRZA 4RF1A 3FP5A 3PSCA 1MFWA 1QOFA 1ZC3B 2KT7A 1OQQA 4IDIA 2L7RA 4HAZB 3IXSA 2M0XA 3CSTA 4IW0A 2QKLA 2L8JA 2I5FA 1EF1A 1X86A 3A4RA 3PTFC 3HRDD 5DPWA 4A6KA 3PHWB 1V89A 3VIAA 3AEEB 5DCNA 2DHIA 3APFA 1XLOA 4YONA 2IFSA 5DH9B 2C7NB 1T3QA 3KRWA 3AE3B 1E7UA 4YL8A 3N7CA 1WGDA 2IYBA 5DI9B 2V3PA 4G11A 3UIPB 2ADZA 2JYTA 2BGFA 2BYTA 1HEZE 4BOSC 1UPRA 1JCKB 3UZTA 2MKRA 4ZRKA 1T0RC 2N1VA 2R0DA 1P6SA 4MACA 5AUIA 4HWIB 2JZ3B 5FI1A 2LKOA 2KN4A 3DVNU 5FR6A 1ET6A 3A1QB 2RVBB 4TUUA 1KF6B 1VZ7A 3NS1A 1V49A 4W9JA 2GBNA 4LCDE 2PVGC 5GMVA 3VAWA 3GOEA 4A6QA 1TS2A 4HKZE 2ASQA 3AE2B 1QILA 1QF6A 4GN1A 2KNBA 5JHHA 4ANXA 1VDVA 3ABVB 4KVGB 3BY4B 1C9FA 3PHXB 2LG1A 3B0AA 2YS1A 4TKNA 2YT0A 2XQNM 2KTFA 3KZ1A 5JVLA 2LVOA 4EJNA 5BMGA 3LXFA 4DDGD 2Z4DA 3I3TB 2P0FA 1TKYA 4OZAA 1SF0A 3CIKA 5FKAC 4MT5A 1X11A 3SNHA 5HHDG 3RT3B 2DKQA 2P0DA 3BYYB 3SFEB 2KC1A 1JRUA 4KIKA 3HUIA 2J7QB 3A8QA 2PLPA 4K3CA 1SE4A 1UNQA 3MC8A 1K5DB 5C79A 1NVID 4W9HA 2LULA 3N1XC 2D3BA 2CJNA 1TQZA 1QQGA 2COPA 1C4CA 4AS1A 4LNFA 3OLMD 2EMSA 1UF0A 3Q8BA 1OGWA 3IAS1 3ZIMA 4KDIC 4HAVB 1X1FA 3CSFA 3DXDA 1I7AA 2YT2A 3VHTC 3W2DA 3N9YC 1PFDA 5JHGA 1V97A 2KTRB 2HD5B 1HZ6A 1P7FA 1Q1OA 4FADA 4WJQA 2WDQB 2ELAA 2QKMA 3SHQA 1ZSQA 2L0FA 4M00A 3GYOA 3HHMA 3ZXVA 2BB6A 4GIVA 4LNOA 3QHTA 1C77A 2A4ZA 2R09A 1EO6A 1E7VA 3ML8A 4C7YA 1FM0D 1SIFA 3A9JA 3O65B 4XZ4A 1GC7A 2KUQA 1E0ZA 2RNRB 2Y5PA 2OHFA 4IG7B 4XX5A 3MJWA 2L76A 1EU3A 2W54A 2KFKB 2QHOA 2W9NA 4JKEA 2K9XA 2L0TA 2MLBA 3W5UB 3Q8AA 2QIEB 3GZNB 1EU4A 2Y5CA 1QOBA 1WE6A 3ZLZA 3APDA 3VOQA 3D32A 2CRFA 4GDLB 2AQ1B 2R2YA 1L7YA 4ILHA 3OJ4B 1I42A 2LGIA 3Q69A 1T6BX 4HB3B 3U4EG 4DIXA 3DBHI 1KLVA 2L3ZA 5CHVC 3FILA 4NSWA 1EWYC 1U5FA 3D8FA 4N9F4 4YSYB 4BKGA 2MSED 2QDFA 1TY0A 1WJNA 2ON8A 1SGHA 2BB5A 3NVVA 4A3OA 1YJ1A 4HLEA 2V4LA 1L2NA 3ZXRA 1UUPA 2W2XC 4DXFA 1WZ3A 2RDHA 4ZRJA 2GUMA 4YTPB 1TS4A 1XXGA 1GC6A 4WAAA 1R4NI 1DDWA 2LJ5A 2DYBA 5TR5A 1JQ4A 1JWAD 3IFWB 1TTNA 3DPDA 3Q2AC 1VBHA 2RQ1A 1IUEA 1WFYA 4GXBA 1DIKA 3HK0A 4HCPB 5E6JA 2KDEB 1KJTA 2W3RA 3H8HA 5HKHA 1WX7A 4JKAA 3AE9B 4BKTA 1CK1A 2LWPA 1PLSA 4OVZA 1WJ1A 2BWFA 1ZOYB 1D5ZC 4XC2A 1HE8A 1AN8A 3DQVA 5J18A 3D8EA 2W2XD 2BCJA 2DN6A 2GBKA 4NJ6A 1QZEA 3UGBB 4P1CC 4KZCA 2RRFA 4JIOU 1ZP0B 1WYWB 4CO7A 5JLJB 3EC8A 2DYNA 2IJ0A 2RSGA 4ZHPA 2KFKA 2N7DA 2Y8GA 2K0PA 2LVQA 5CHWA 4MDKE 2KR0A 1ST7A 1RLFA 2KOXA 2H7EA 5DHFB 2MX2A 2G1EA 3UIOB 2LOXA 2WXHA 5JXVA 1N6ZA 5D3XA 1FMAD 3DOWA 3R7QA 1K8RB 1QC6A 2RD0A 3PO0A 2Z14A 5CX3A 2MHJA 2KAJA 1RJ2A 4DDID 3N3KB 2CHXA 3P63A 5KCVA 2D9VA 1LB1A 3ZKJC 2AL3A 2J0KA 1M94A 1YQBA 4F7GA 2WYQA 3ZNHB 2N23A 2V3SA 1NDDA 2CJOA 2ABDA 5BYRA 1X1GA 2K3UA 4ZHOA 4ANUA 2AWTA 1YNTE 2WWZA 3ZW3A 5JP4A 3TUOA 3BK2A 3ZVVA 1FGZA 1YMHE 2PTLA 2J0JA 3QBVB 3RNEC 1WGUA 5HFYA 2VKIA 1C4PA 2OJWA 4IM3A 1TBEA 1XX0A 4DBBA 2MBBB 3UINB 1VRAB 5EE3A 4URKA 3KSYA 1BWNA 5J3TA 1HA5A 3FKYA 2QMTA 3MFGA 4NAWB 4JKGB
chains in the Genus database with same CATH topology
4HDOA 2ZEQA 2IO2B 4WJ7A 2D9YA 1KOTA 2CAYA 1ZC4B 1J19A 1E90A 3TL5A 4WJOA 4RMAA 1LXDA 3WALA 1FAOA 4XWXA 4Y94A 4NNJB 2JPHA 1K5GB 3U8ZA 4MJSA 1UZXB 4E71A 4NAWA 2MRPA 5JH5C 1H8CA 2DHKA 4JKHA 3FM8C 4TQ0A 4W9EA 3T06A 3OJ3A 4D0NB 1FXTB 1M7RA 1H4RA 4L6EA 2KUPA 2Z0PA 2HJ8A 1XKEA 4IWOA 2JUOA 1UPQA 4NPNA 2NR2A 2DHZA 4K7SA 1KZGA 3ZNGC 4NQLB 2UZSA 3P2BA 4AP4C 4KHOA 4ANVA 1VBGA 2RGNB 5D3VA 3PPAA 3M62B 2FCQA 2D10A 3FEHA 1V9JA 2CR5A 4HB0B 1WVHA 3Q3JA 2JRHA 1UGMA 3RZWC 2MWSB 1BT0A 4JQWC 2KQSA 5D2MB 4ZYNA 4MGZE 1C1YB 4B6HA 3KYCD 4HAYB 2KXJA 2DHJA 2MBEA 4EZLA 1BAKA 3NOBA 3ZTDA 4AJWA 1V86A 2DYQA 5GOWB 2JF5A 1XQQA 1ZM0A 4BBKA 3A33B 4BVUC 2GBJA 2LBBA 1LQBA 4BOZB 1UELA 2KWCA 2KGXB 2Z0EB 3M95A 1YD8U 4MGKE 4M8NA 2PE9A 2O2VB 2GBRA 2G3QB 1V2YA 4WWPA 4IFSA 1YX5B 2GBMA 1UEFA 3ZNZB 2LZ6A 1I35A 2FJ9A 3SO6A 4ASWC 2FCSA 2K39A 4JK8A 4JKBA 2JY6A 2Z59B 3RCPA 2NMBA 1WJ4A 4NY0A 1UBIA 5DPTA 3X0WA 4EEWA 2E2XA 1XR0B 2MP2A 1UNRA 1V6EA 1A5RA 3TVVA 3WA0A 4GDLA 5J2RA 2K1FA 3QA8A 5AZHA 1DDVA 1BTNA 2KJHB 2CHWA 2J59M 2AYOB 2DZIA 3HQCA 1WH3A 4JKGA 1W1DA 2K8BA 3EECA 4A6HA 5KHQA 3A9KA 3PP2A 2HRJA 3QQ8B 2ROVA 3UQBA 2K8CA 1TGZB 1DYNA 2K2UA 2IO1B 2MDXA 1NBFC 3JVZX 2K25A 3QARA 2G45B 1E8YA 3WAMA 3DDCB 2C7MB 1AARA 4W9GA 1PQSA 1V61A 3BJIA 2GJYA 1UD7A 4GDKA 2RUKB 2G35A 5G2NA 4A6FB 1WGYA 4RM8A 3A98B 2DA0A 2JRIB 3ODXA 3M3JA 1Z2MA 1U5DA 2L1CA 2G4SA 2ZPNA 2Q13A 4JKDA 4RM9A 2ROZB 3NY5A 2MQJA 1I2HA 4HB2B 3QWZB 4JL9A 3KW5B 4A5KA 2FIFA 4BFRA 2D07B 1RRPB 1UH6A 2KDFB 2NPTB 4F7ZA 2IZVB 2D11A 2KK8A 2K6DB 3V5WA 4DX8A 5L95C 3PSEB 3PREA 3PT2B 3CF6E 1TXDA 2N9EB 3DBRI 3NS8A 2HTHB 4MGIE 3SDLC 2MFQA 2PZ1A 2V76A 4CHMA 1FHXA 1T0YA 3TCAA 4AJYB 3W1SA 4JK7A 2CODA 3QC8B 1U27A 4PS7A 4GGQA 3A9KB 2DIKA 4WWNA 2G4DB 5C23A 4PS3A 4AOFA 1S1QB 4HHVA 4HCNB 2YSZA 3L08A 4JGHB 3WYFB 3GYPA 3FLVA 2C5LC 1Y8RC 3QCAA 3IVFA 4JLCA 1NVLA 2D3GA 2N9PC 3TO1A 4DHZE 2YLMA 3ZUNA 4BKSD 4GU2A 1XT9B 2LXCA 5G55A 1V5MA 1OEYJ 2CS4A 1F9JA 2O6VD 3AXCA 2CU1A 3JSVA 2MBHA 1IRSA 5LXHA 1E5WA 3AI5A 2AL6A 3A1QA 2MCNB 2KMCA 3PVWA 3LJUX 4PQ0A 1KM7A 3KUDB 2C60A 2JZZA 4DWFA 1WXAA 1Z5SB 2JXXA 2FIDA 2KX0A 4FJVB 4KZ0A 3VXWA 3ZRCA 2Y5BB 2DAJA 2KLGA 3A8PA 5CLQB 3DBLI 5AZGA 2CHZA 3GZNI 4NJ7A 1EF5A 3EHVA 4K81A 3AU5A 1E8WA 2C9WB 2DX5A 3ZDTA 1MAIA 1X05A 3WANA 3KRXA 4NQKE 5LOPB 3CMMB 3ODOA 2M17A 1XCGA 3IBEA 2DAFA 3SD5A 1YIWA 4GMXB 3MDBC 1LM8B 3QK0A 2KCJA 2M1MA 2RSUA 2LGXA 1Z87A 4WSFA 2M4NA 2FUHB 3N32A 4IOYX 3VH4B 2XEWA 2KO3A 3UF8A 3BINA 1KC7A 1W1HA 3SYXA 3KYDD 3K9PB 5HE0A 2ZCCA 3AULA 5KHOA 5KQ4A 2EMTA 2DX1A 5HE2A 4E3CA 1NU2A 1IP9A 3H1UA 1EAZA 2ZNVC 2MBQA 2KMAA 1E8ZA 1U4AA 1U5GA 1AQCA 2O6VB 4B9KA 3VTWA 3KUZA 1H10A 1XODA 3PRZA 5DPRA 4C0AA 4JKFA 3T9LA 2L00B 3ZTCA 3LDZE 1WI0A 2R82A 1EGXA 2ZJDA 5J17A 4DHJB 3VUYA 3HIZA 1DBHA 2BKRB 4W9LA 1TZ1A 1J0GA 3TBLD 4HPLB 3QIJA 1RRBA 1FHWA 2MA9B 2XK5A 2YS3A 1WR1A 2K8HA 3LJ3A 4I6LB 3SU8X 2BPSA 2N1WA 2O6VA 2I1KA 1WGHA 4HJKA 1MK7B 1V5OA 1WZ0A 4K1RB 3OANA 4K2PA 3DVGX 2PPHA 3R7RA 5CLLB 1WGRA 2WDTB 2BKFA 3DXCA 3TMPB 4MSQB 1GG3A 2VRWB 4EZJA 4W9DA 1WF9A 2M8SA 4ICVA 1NTVA 2Z0OA 4TV3A 2DZKA 4E74A 3R3MA 4FLHA 2WH5A 1V80A 2NBUA 5HE1A 1Q0WB 5LONB 4IWPA 4W9FA 2V1YA 4K2OA 1WXVA 2N7EA 1WE7A 4ILGB 4GB9A 5L83A 3T8MA 2KJ6A 2KQ7A 1FGYA 4MSMB 3DCGA 1S3SG 2GOWA 2DFKA 3E9LA 2R2OA 1KZ7A 2H7DA 1EVHA 4IAPA 3V60A 4LDTB 1Y19B 3V6EB 1ZGUB 2CY4A 1WR6E 4M0WB 4FN2A 4MELA 2UWQA 1P98A 4K17A 3AU4A 3ML9A 4K7WA 1MKEA 1WMHB 4PNKA 2CQUA 2O2VA 3PG7A 1XD4A 3PRMB 3PLVA 3DVNV 4LJPB 1LW3A 1V81A 2KX3A 2DYMA 2OOBB 2KLCA 5KQ1A 2DX5B 2WX1A 1HB8A 5JZEB 4ICUA 5EDSA 1WX9A 2D4QA 3ALBA 3UQAA 5D6JB 2VSZA 1P9DU 3M63B 1RFAA 2OJRA 1WJ6A 1WM2A 4KAXB 4DK5A 4BBNC 4J6IA 4MK0A 4IWQA 5C16A 3L10B 1WXMA 4FHKA 3A4SC 3L13A 2KTRA 4KDLB 3Q3FA 4IUMB 2D9WA 2Y7BA 4GSWA 3ULBA 2UYZB 3KUCB 3PGEA 1ZKHA 3NSUA 3RCZA 1R4MI 1P3QU 2YRYA 1OQYA 1NI2A 4G3XB 1PMSA 4WWOA 4GDKB 2IY0B 4EUTA 4FULA 4BBNF 4TQ1A 4HB4B 1Q5WB 2LGDA 2JP2A 1WIAA 2GCLA 3KH0A 2RGFA 1U5EA 4KIKB 4FHJA 4JK9A 2IYDB 2HTHA 3FSSA 4HAUB 1P0RA 2FCMA 2M38A 1WGQA 2D9XA 3HW2B 3H7PA 4K7UA 4DHJD 2B3AA 2BF8B 1HBKA 4A6FA 1V88A 3ZVRA 3W1YA 1SE9A 2LVPA 2P0HA 4GOCA 3RULA 1X1MA 2CKHB 3PLUA 2FDQA 5LLIA 3NZSA 2GS0A 2BYEA 4KSLC 5JHBA 2MWNB 4ZRIA 4KHAA 3OAWA 1MIXA 3MHSD 3TFMA 1FB8A 3VQIA 2EC1A 2LRWA 2KJRA 4IC7B 3VDZA 3PZDA 3MTNB 3P6AA 2KC2A 4OVVA 3RYTA 2LGYA 3U30A 1DROA 3WAPA 3VVWB 2ZVOA 2DTCA 2NPTA 4X57B 1RAXA 2N9XA 4IM2A 4GMVA 4MEMA 3W1SC 4DHZB 2FNJB 1OQNA 3ONSA 1UNPA 2KKCA 1IPGA 5E6NA 3KVFB 4OVUA 4KHBB 1P3RA 3V6CB 3EFUA 4PS8A 4GZUA 4Z2NA 2REXA 3ZNID 5J3QA 1VCBA 4M8MA 3APCA 3E66A 3PS6A 2KWUB 4I6NB 3L17A 2BYFA 2PEAA 4G50A 3F5RA 5D7GA 3O96A 2I1JA 3ENEA 1J0WA 1Y5OA 2DYOA 3QX1A 5J3YA 4CHJA 2MP2B 3D8DA 2HE7A 1ACAA 5BO4B 2L2IA 2I5CA 2NS5A 2K6QA 3JW0X 1XD3B 4EMOA 2VRRB 1P5TA 3A9JB 4F7UP 3JYUA 3NZUA 4HAXB 1MPHA 1Q67A 3PV1A 3ULCA 1AWEA 4LJOB 2M14A 4MGYE 3F0WA 4CHKA 1CMXB 2GCJA 3TJPA 4IM0A 3H6NA 2IBIB 3MPXA 1B55A 4W9KA 1OY2A 2MBOA 2FAZA 3E9PA 3K9OB 1WJMA 5AEKB 4HK2A 4HAWB 4ILJA 2Y8FA 5D27A 1UBQA 2LYDA 1EUVB 3E9OA 4PYUA 2XBBC 2BYVE 4DXAB 3B08A 5IA7A 5C1ZA 2ZPYA 5CHFA 2EKEC 3TIXA 4B6WA 2MW5A 3H9DA 3ZRFA 4W9IA 1MG8A 2LRUA 2K2JA 2YF0A 3S2AA 3C0RB 5LXIB 3ECIA 1V5PA 2PE6B 1M7EA 2LD9A 5FI0A 2EJ8A 3SBTA 2IO0B 2AEHA 2GMIC 2KANA 2DLWA 2KD0A 3SBGA 3U7DA 2A5UA 3VUXA 4F1SA 4FBJB 4MY6A 4HDQA 3KY9A 3R66C 2OQBA 1BTKA 4HXDA 3DVGY 1GGOA 4P7IA 1GUAB 3PVLA 4TYZA 5D94A 2COAA 1TJ6A 3ZDMC 4GPTB 1OEYA 1WX8A 1WI1A 3H7PB 5IAAC 3AJ4A 4MH0E 4I6PA 1OMWA 1U2BA 5D3WA 5C6RA 2X0SA 4WJNA 2DZMA 3G9WA 2NVUI 2RR9A 2KVRA 2CY5A 4F8CB 3HM3A 1IYFA 4BKSA 2JT4B 4HATB 2LXAA 2KFJA 1VD2A 2RPQA 4HVBA 4KV2A 2UVMA 2D2QA 3X23A 3L16A 4AWJA 3PRPB 3VTVA 4MM3A 3DBSA 4FA6A 1FOEA 2FJLA 1WM3A 2KWVB 4W9CA 3QJZA 2LI5A 4H8SA 4B95A 3ZO5B 2Z0DB 2D9ZA 1NTIA 4A3PA 5E6PA 2IY1B 2KZRA 3IHPC 1GNUA 2LASA 2YVCA 3QAQA 2NBVB 3ML4A 4KSKC 3VTUA 2W2WA 4EFOA 1DDMA 4DBGA 3L54A 2KDIA 1ZW7A 2N0YA 3IG3A 3SV1A 3QWMA 1LFDA 5DPSA 1GJZA 3ENBA 3N30A 2P8VA 4WVFB 3TW1A 2DENB 3WAOA 3SUZA 5E6OA 2ELBA 4FJZA 2YT1A 3HM6X 2KN5A 2WX0A 1ZVRA 3VUWA 4F7HA 1FHOA 2FCNA 5C5BB 1WGGA 2UZRA 4II2B 2LOZA 1E8XA 3VH3B 3WIMA 2C7HA 4ZDVA 1WRDB 3EPYA 2RLOA 4AUQC 2ZVNA 1NTYA 2COFA 1JDEA 5L81A 5DIFB 1N3HA 1YX6B 2L05A 2KDBA 4II3B 3V61A 2COCA 2NBWB 4ANWA 1V5UA 4MT7A 5IJMA 2IO3B 3DXEA 2KHWB 5D3YA 3L0WB 3RD2A 3RUIB 3RZFA 1WG7A 1KBLA 4G0NB 1ISNA 2J0MA 2R2QA 4LDTD 2NZ8B 4JKCA 3NHEB 2CB8A 1W1GA 3H7SA 4FJYA 1HB6A 4CYEA 2XK5B 2N4FA 5JHAA 3PEGA 1G6JA 2ZCBA 4WJPA 3M1IB 1V5TA 2JVCA 2ZNVB 3VFKA 1WMHA 1KI1B 2DKPA 5DHAB 2BWES 2DZJA 2NCNA 2K00A 5HE3A 1SHCA 1MIZB 2OTXA 5AZFA 4EOYA 4EKUA 2JWZA 4DX90 3B1LX 1WJUA 2X18A 3ODWA 1WXSA 4PYZA 1WY8A 1PFJA 5EFXA 3CXBB 5CTRC 1C3TA 1U29A 1OTRB 2YS5A 3P7ZA 4A20A 2ZZPB 4HPMB 4EZKA 3V62A 4Z2MB 2LUEA 1MK9B 4WQOB 1P1AA 3JSVB 2Z0QA 2PJHA 1D3ZA 5C5BA 3PVUA 1J8CA 4MJSB 3FP5A 3PSCA 1ZC3B 4HAZB 2L7RA 2M0XA 3CSTA 4IW0A 2QKLA 2L8JA 2I5FA 1EF1A 1X86A 3A4RA 3PTFC 5DPWA 4A6KA 3PHWB 1V89A 3VIAA 5DCNA 2DHIA 3APFA 4YONA 2IFSA 5DH9B 2C7NB 3KRWA 1E7UA 4YL8A 3N7CA 1WGDA 2IYBA 5DI9B 4G11A 3UIPB 2ADZA 2BGFA 4BOSC 1UPRA 3UZTA 2MKRA 4ZRKA 2N1VA 2R0DA 1P6SA 4HWIB 2JZ3B 5FI1A 2LKOA 3DVNU 5FR6A 3A1QB 2RVBB 4TUUA 1V49A 4W9JA 2GBNA 4LCDE 5GMVA 3VAWA 3GOEA 2ASQA 4GN1A 2KNBA 5JHHA 4ANXA 4KVGB 3BY4B 3PHXB 2LG1A 3B0AA 2YS1A 4TKNA 2YT0A 2XQNM 2KTFA 3KZ1A 5JVLA 2LVOA 4EJNA 4DDGD 3I3TB 2P0FA 3CIKA 1X11A 3SNHA 3RT3B 2DKQA 2P0DA 2KC1A 1JRUA 4KIKA 2J7QB 3A8QA 1UNQA 1K5DB 5C79A 4W9HA 2LULA 1TQZA 1QQGA 2COPA 3OLMD 2EMSA 1OGWA 3ZIMA 4KDIC 4HAVB 1X1FA 3CSFA 3DXDA 1I7AA 3VHTC 5JHGA 2KTRB 2HD5B 1Q1OA 4FADA 4WJQA 3SHQA 2ELAA 2QKMA 1ZSQA 2L0FA 3GYOA 3HHMA 4GIVA 3QHTA 2A4ZA 2R09A 1EO6A 1E7VA 3ML8A 1SIFA 3A9JA 3O65B 4XZ4A 1GC7A 2RNRB 4IG7B 4XX5A 3MJWA 2L76A 2KFKB 2QHOA 4JKEA 2MLBA 2W9NA 2L0TA 1WE6A 3ZLZA 3APDA 3VOQA 3D32A 2CRFA 4GDLB 1L7YA 3OJ4B 4ILHA 1I42A 4HB3B 3DBHI 1KLVA 2L3ZA 5CHVC 4NSWA 1U5FA 3D8FA 4N9F4 4BKGA 2MSED 1WJNA 1SGHA 4A3OA 4HLEA 1YJ1A 2V4LA 1L2NA 2W2XC 1WZ3A 4ZRJA 1GC6A 4WAAA 1R4NI 1DDWA 2LJ5A 2DYBA 5TR5A 3IFWB 1TTNA 3DPDA 1VBHA 2RQ1A 1WFYA 4GXBA 1DIKA 3HK0A 4HCPB 2KDEB 1KJTA 5HKHA 1WX7A 4JKAA 4BKTA 2LWPA 1PLSA 1WJ1A 2BWFA 4XC2A 1HE8A 3DQVA 5J18A 3D8EA 2W2XD 2BCJA 2DN6A 2GBKA 4NJ6A 1QZEA 3UGBB 4KZCA 4JIOU 1WYWB 4CO7A 5JLJB 3EC8A 2DYNA 2RSGA 2KFKA 2N7DA 2Y8GA 2LVQA 5CHWA 4MDKE 1ST7A 1RLFA 2KOXA 2H7EA 5DHFB 2MX2A 3UIOB 2LOXA 5D3XA 3DOWA 3R7QA 1K8RB 1QC6A 2RD0A 5CX3A 1RJ2A 4DDID 3N3KB 2CHXA 5KCVA 2D9VA 1LB1A 3ZKJC 2AL3A 2J0KA 1M94A 1YQBA 4F7GA 2WYQA 3ZNHB 2N23A 2V3SA 1NDDA 2ABDA 1X1GA 4ANUA 2AWTA 2WWZA 3ZW3A 5JP4A 3ZVVA 1FGZA 2J0JA 3QBVB 1WGUA 2VKIA 4IM3A 1TBEA 1XX0A 4DBBA 2MBBB 3UINB 4URKA 3KSYA 1BWNA 5J3TA 4NAWB 4JKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  4IC7 B;  4KZ0 A;  3VDZ A;  3VXW A;  3PZD A;  2ZEQ A;  3ZRC A;  2Y5B B;  2DAJ A;  2KLG A;  3A8P A;  2IO2 B;  5CLQ B;  3MTN B;  5HE3 A;  3DBL I;  4WJ7 A;  1SHC A;  2D9Y A;  1KOT A;  2CAY A;  1ZC4 B;  3P6A A;  1J19 A;  1MIZ B;  2OTX A;  1E90 A;  2KC2 A;  4OVV A;  5AZG A;  5AZF A;  3TL5 A;  4WJO A;  4RMA A;  4EOY A;  1LXD A;  2CHZ A;  3RYT A;  3WAL A;  1FAO A;  2LGY A;  3GZN I;  4NJ7 A;  4XWX A;  4Y94 A;  1EF5 A;  4EKU A;  2JWZ A;  2JPH A;  3EHV A;  4NNJ B;  3U30 A;  1DRO A;  3WAP A;  4DX9 0;  4K81 A;  3AU5 A;  1E8W A;  3VVW B;  2C9W B;  2ZVO A;  2DTC A;  2DX5 A;  2NPT A;  3B1L X;  4X57 B;  1RAX A;  3ZDT A;  1WJU A;  3T9L A;  1K5G B;  1MAI A;  3U8Z A;  1X05 A;  3WAN A;  2N9X A;  4MJS A;  2X18 A;  3ODW A;  1UZX B;  4E71 A;  3KRX A;  4IM2 A;  4NQK E;  1WXS A;  4PYZ A;  4GMV A;  4NAW A;  4MEM A;  3W1S C;  1WY8 A;  4DHZ B;  2FNJ B;  5LOP B;  3CMM B;  2MRP A;  5JH5 C;  1OQN A;  1PFJ A;  3ONS A;  1H8C A;  3ODO A;  1UNP A;  2DHK A;  5EFX A;  3CXB B;  2M17 A;  2KKC A;  1XCG A;  1IPG A;  5CTR C;  5E6N A;  3FM8 C;  3KVF B;  1C3T A;  4OVU A;  1U29 A;  4TQ0 A;  3IBE A;  4KHB B;  1P3R A;  2DAF A;  1OTR B;  4W9E A;  3SD5 A;  1YIW A;  3V6C B;  3T06 A;  3OJ3 A;  2YS5 A;  3EFU A;  4PS8 A;  4GMX B;  4D0N B;  1FXT B;  1M7R A;  1H4R A;  4GZU A;  3MDB C;  4Z2N A;  3P7Z A;  1LM8 B;  2REX A;  4A20 A;  4L6E A;  2ZZP B;  3ZNI D;  2KUP A;  4HPM B;  5J3Q A;  3QK0 A;  4EZK A;  2KCJ A;  2Z0P A;  2HJ8 A;  1VCB A;  1XKE A;  2M1M A;  4M8M A;  2RSU A;  3APC A;  2JUO A;  2LGX A;  1UPQ A;  3PS6 A;  4IWO A;  1Z87 A;  4WSF A;  2KWU B;  2M4N A;  4NPN A;  3V62 A;  4I6N B;  2FUH B;  3L17 A;  2BYF A;  2PEA A;  4G50 A;  2NR2 A;  2DHZ A;  4K7S A;  1KZG A;  3F5R A;  3ZNG C;  4NQL B;  2UZS A;  4Z2M B;  2LUE A;  3P2B A;  4AP4 C;  5D7G A;  3O96 A;  4KHO A;  4ANV A;  2I1J A;  1MK9 B;  4WQO B;  3ENE A;  3N32 A;  2RGN B;  4IOY X;  1J0W A;  1Y5O A;  1P1A A;  5D3V A;  2DYO A;  3JSV B;  3PPA A;  3QX1 A;  3VH4 B;  5J3Y A;  3M62 B;  4CO7 A;  2FCQ A;  2D10 A;  4CHJ A;  2XEW A;  2Z0Q A;  3FEH A;  1V9J A;  2CR5 A;  4HB0 B;  2KO3 A;  2MP2 B;  1WVH A;  3UF8 A;  3Q3J A;  3BIN A;  2JRH A;  2PJH A;  3D8D A;  1D3Z A;  5C5B A;  2HE7 A;  1W1H A;  3PVU A;  3SYX A;  1ACA A;  5BO4 B;  2L2I A;  1UGM A;  1J8C A;  3KYD D;  2I5C A;  2NS5 A;  4MJS B;  3RZW C;  2K6Q A;  3FP5 A;  3PSC A;  3JW0 X;  2MWS B;  3K9P B;  1BT0 A;  5HE0 A;  1XD3 B;  2ZCC A;  1ZC3 B;  4EMO A;  3AUL A;  5KHO A;  2VRR B;  1P5T A;  3A9J B;  4F7U P;  4JQW C;  2KQS A;  5KQ4 A;  5D2M B;  4HAZ B;  2L7R A;  4MGZ E;  2EMT A;  1C1Y B;  2DX1 A;  5HE2 A;  4B6H A;  3JYU A;  4ZYN A;  4E3C A;  2M0X A;  3NZU A;  3CST A;  4IW0 A;  3KYC D;  1NU2 A;  1IP9 A;  2QKL A;  1MPH A;  4HAX B;  2I5F A;  4HAY B;  1EAZ A;  2KXJ A;  2L8J A;  1EF1 A;  3H1U A;  1X86 A;  2ZNV C;  3A4R A;  2DHJ A;  2MBQ A;  2KMA A;  2MBE A;  1Q67 A;  1E8Z A;  1U4A A;  1BAK A;  1U5G A;  3NOB A;  1AQC A;  4A6K A;  2O6V B;  3PHW B;  3PV1 A;  3ZTD A;  1V86 A;  4AJW A;  1V89 A;  4B9K A;  2DYQ A;  5GOW B;  2JF5 A;  3VIA A;  5DCN A;  1XQQ A;  1ZM0 A;  3VTW A;  2DHI A;  3KUZ A;  3APF A;  4BBK A;  1H10 A;  4YON A;  2IFS A;  3ULC A;  1XOD A;  3A33 B;  2GBJ A;  4BVU C;  3PRZ A;  1AWE A;  5DH9 B;  5DPR A;  4LJO B;  4C0A A;  2M14 A;  2C7N B;  4MGY E;  3F0W A;  4CHK A;  2LBB A;  1LQB A;  1CMX B;  3KRW A;  4BOZ B;  2GCJ A;  4YL8 A;  1E7U A;  1UEL A;  2IBI B;  3N7C A;  2KWC A;  3H6N A;  2KGX B;  1WGD A;  2IYB A;  2Z0E B;  5DI9 B;  2L00 B;  3M95 A;  4G11 A;  3ZTC A;  3LDZ E;  3UIP B;  3MPX A;  1YD8 U;  2ADZ A;  2BGF A;  1WI0 A;  4MGK E;  1B55 A;  4W9K A;  4M8N A;  4BOS C;  1OY2 A;  2MBO A;  1EGX A;  1UPR A;  2FAZ A;  2PE9 A;  3UZT A;  2MKR A;  4ZRK A;  2O2V B;  2ZJD A;  5J17 A;  2N1V A;  3K9O B;  1WJM A;  2R0D A;  4DHJ B;  3VUY A;  2GBR A;  3HIZ A;  1P6S A;  1DBH A;  2BKR B;  4W9L A;  5AEK B;  1TZ1 A;  2G3Q B;  1V2Y A;  2JZ3 B;  4HWI B;  4WWP A;  4IFS A;  5FI1 A;  2LKO A;  1YX5 B;  3DVN U;  2GBM A;  1UEF A;  1J0G A;  5FR6 A;  3ZNZ B;  2LZ6 A;  4HK2 A;  2FJ9 A;  3TBL D;  1I35 A;  4HAW B;  3SO6 A;  4ASW C;  4HPL B;  2FCS A;  2Y8F A;  5D27 A;  3QIJ A;  1RRB A;  2K39 A;  1UBQ A;  1FHW A;  2MA9 B;  2XK5 A;  3A1Q B;  2LYD A;  2RVB B;  1EUV B;  2YS3 A;  4TUU A;  4PYU A;  1WR1 A;  2JY6 A;  2K8H A;  2Z59 B;  3LJ3 A;  1V49 A;  3RCP A;  4I6L B;  4W9J A;  2GBN A;  4LCD E;  3SU8 X;  2BPS A;  5GMV A;  2N1W A;  3VAW A;  2O6V A;  2I1K A;  1WGH A;  3GOE A;  4HJK A;  2NMB A;  2XBB C;  2BYV E;  1MK7 B;  1V5O A;  1WJ4 A;  4DXA B;  4NY0 A;  1UBI A;  3B08 A;  5DPT A;  5IA7 A;  3X0W A;  5C1Z A;  1WZ0 A;  4K1R B;  3OAN A;  4K2P A;  2ZPY A;  2ASQ A;  4EEW A;  3DVG X;  2PPH A;  5CHF A;  2EKE C;  3R7R A;  4GN1 A;  2KNB A;  5CLL B;  5JHH A;  1WGR A;  2WDT B;  3TIX A;  2E2X A;  4KVG B;  2MW5 A;  1XR0 B;  2MP2 A;  3BY4 B;  3H9D A;  1UNR A;  1V6E A;  2BKF A;  2LG1 A;  3PHX B;  3B0A A;  2YS1 A;  4TKN A;  1A5R A;  3ZRF A;  2YT0 A;  4W9I A;  1MG8 A;  2XQN M;  3TVV A;  3WA0 A;  4GDL A;  2LRU A;  3DXC A;  2KTF A;  3KZ1 A;  2K2J A;  2YF0 A;  2LVO A;  4B6W A;  4EJN A;  3S2A A;  5J2R A;  4DDG D;  3I3T B;  3C0R B;  2P0F A;  3TMP B;  4MSQ B;  3ECI A;  1GG3 A;  2VRW B;  4EZJ A;  1V5P A;  5LXI B;  2K1F A;  3QA8 A;  5AZH A;  3CIK A;  1DDV A;  2PE6 B;  4W9D A;  1M7E A;  1X11 A;  1WF9 A;  2LD9 A;  2M8S A;  4ICV A;  3SNH A;  1NTV A;  2Z0O A;  5FI0 A;  4TV3 A;  1BTN A;  2EJ8 A;  3RT3 B;  2DZK A;  2DKQ A;  2P0D A;  3R3M A;  4E74 A;  2KC1 A;  1JRU A;  4FLH A;  2WH5 A;  1V80 A;  2NBU A;  2IO0 B;  5HE1 A;  2AEH A;  2KJH B;  4KIK A;  2CHW A;  2GMI C;  2J59 M;  1Q0W B;  2KAN A;  5LON B;  2J7Q B;  4IWP A;  3A8Q A;  2AYO B;  2DZI A;  3HQC A;  2DLW A;  1WH3 A;  2KD0 A;  4W9F A;  1UNQ A;  2V1Y A;  3U7D A;  1W1D A;  4K2O A;  1WXV A;  2A5U A;  1WE7 A;  2N7E A;  1K5D B;  5C79 A;  2K8B A;  3EEC A;  4W9H A;  2LUL A;  4A6H A;  3VUX A;  4GB9 A;  4F1S A;  5KHQ A;  3A9K A;  4FBJ B;  1TQZ A;  4MY6 A;  1QQG A;  5L83 A;  4HDQ A;  2COP A;  3PP2 A;  2HRJ A;  3KY9 A;  3OLM D;  3QQ8 B;  3R66 C;  2ROV A;  3T8M A;  2EMS A;  2K8C A;  2OQB A;  3UQB A;  1TGZ B;  2KJ6 A;  2KQ7 A;  1OGW A;  1BTK A;  1DYN A;  1FGY A;  2K2U A;  2IO1 B;  2MDX A;  3DVG Y;  3DCG A;  4HXD A;  4MSM B;  3TJP A;  3ZIM A;  4KDI C;  1NBF C;  4HAV B;  1X1F A;  3JVZ X;  4P7I A;  3DXD A;  1GUA B;  2K25 A;  3CSF A;  3PVL A;  4TYZ A;  1S3S G;  5D94 A;  1I7A A;  2GOW A;  3QAR A;  2G45 B;  1E8Y A;  3VHT C;  3DDC B;  3WAM A;  2DFK A;  2COA A;  1TJ6 A;  2C7M B;  5JHG A;  2KTR B;  2HD5 B;  2R2O A;  1AAR A;  1KZ7 A;  4W9G A;  3ZDM C;  1PQS A;  2H7D A;  1Q1O A;  4WJQ A;  3SHQ A;  2ELA A;  2QKM A;  4FAD A;  1ZSQ A;  4GPT B;  1EVH A;  2L0F A;  1OEY A;  3GYO A;  4RM8 A;  3HHM A;  4IAP A;  1V61 A;  1WI1 A;  1WX8 A;  4GIV A;  3BJI A;  3V60 A;  3H7P B;  4LDT B;  1Y19 B;  2GJY A;  3AJ4 A;  1UD7 A;  3QHT A;  4GDK A;  4MH0 E;  4I6P A;  5IAA C;  2A4Z A;  3V6E B;  1OMW A;  2RUK B;  1U2B A;  5D3W A;  1ZGU B;  2G35 A;  5C6R A;  2CY4 A;  5G2N A;  1WR6 E;  4WJN A;  4M0W B;  4A6F B;  2R09 A;  1EO6 A;  4FN2 A;  1E7V A;  3ML8 A;  2DZM A;  1WGY A;  4MEL A;  3G9W A;  2UWQ A;  2NVU I;  2RR9 A;  3A98 B;  1SIF A;  3A9J A;  1P98 A;  4K17 A;  2KVR A;  3O65 B;  1GC7 A;  2DA0 A;  4XZ4 A;  2CY5 A;  2JRI B;  2RNR B;  3ODX A;  4F8C B;  3AU4 A;  3HM3 A;  3M3J A;  3ML9 A;  4IG7 B;  4BKS A;  1IYF A;  4K7W A;  4XX5 A;  3MJW A;  2JT4 B;  4HAT B;  2L76 A;  2LXA A;  1MKE A;  1WMH B;  2KFJ A;  4PNK A;  2KFK B;  1VD2 A;  1Z2M A;  2RPQ A;  2QHO A;  1U5D A;  2L1C A;  2W9N A;  2MLB A;  4KV2 A;  2L0T A;  2G4S A;  4HVB A;  2CQU A;  2D2Q A;  3X23 A;  2Q13 A;  2UVM A;  3PG7 A;  2O2V A;  2ZPN A;  3L16 A;  4RM9 A;  1XD4 A;  3PRM B;  3PRP B;  2ROZ B;  3NY5 A;  3PLV A;  3DVN V;  1WE6 A;  3VTV A;  3ZLZ A;  3APD A;  2MQJ A;  4MM3 A;  3VOQ A;  4IM0 A;  3D32 A;  4LJP B;  2CRF A;  1LW3 A;  4GDL B;  1V81 A;  4EZL A;  2KX3 A;  1I2H A;  1L7Y A;  4HB2 B;  3DBS A;  3OJ4 B;  4AWJ A;  4FA6 A;  3QWZ B;  2DYM A;  1I42 A;  1FOE A;  4JL9 A;  2OOB B;  3KW5 B;  2FJL A;  1WM3 A;  4HB3 B;  4A5K A;  2FIF A;  4BFR A;  2KLC A;  5KQ1 A;  2KWV B;  3DBH I;  2D07 B;  1RRP B;  4W9C A;  1UH6 A;  3QJZ A;  2KDF B;  2DX5 B;  2LI5 A;  2IZV B;  2L3Z A;  2NPT B;  5CHV C;  2D11 A;  4H8S A;  2WX1 A;  4F7Z A;  1KLV A;  4NSW A;  4B95 A;  1HB8 A;  5JZE B;  2KK8 A;  4ICU A;  2K6D B;  1U5F A;  3D8F A;  2Z0D B;  4N9F 4;  3ZO5 B;  4BKG A;  5EDS A;  2D9Z A;  1NTI A;  2MSE D;  3V5W A;  2D4Q A;  1WX9 A;  3ALB A;  4A3P A;  5D6J B;  3UQA A;  2VSZ A;  5E6P A;  4DX8 A;  1P9D U;  2IY1 B;  1WJN A;  2KZR A;  1SGH A;  4A3O A;  4HLE A;  5L95 C;  1YJ1 A;  3M63 B;  1RFA A;  1GNU A;  2LAS A;  2V4L A;  3IHP C;  3PSE B;  1L2N A;  2YVC A;  3PRE A;  2W2X C;  3QAQ A;  3PT2 B;  1WZ3 A;  2NBV B;  4ZRJ A;  2OJR A;  3CF6 E;  3ML4 A;  4KSK C;  1GC6 A;  1WJ6 A;  4WAA A;  1TXD A;  1R4N I;  1DDW A;  2W2W A;  2N9E B;  2LJ5 A;  3VTU A;  4EFO A;  2DYB A;  1DDM A;  5TR5 A;  3DBR I;  4DBG A;  3NS8 A;  1WM2 A;  4KAX B;  3IFW B;  3L54 A;  4DK5 A;  2KDI A;  1TTN A;  1ZW7 A;  5G55 A;  3DPD A;  2N0Y A;  4J6I A;  4BBN C;  2HTH B;  3IG3 A;  3SV1 A;  2RQ1 A;  1WFY A;  4MK0 A;  4IWQ A;  3QWM A;  1LFD A;  4GXB A;  5DPS A;  3HK0 A;  4HCP B;  4MGI E;  5C16 A;  2KDE B;  3SDL C;  2MFQ A;  3L10 B;  1KJT A;  1GJZ A;  1WXM A;  3N30 A;  2P8V A;  4WVF B;  3TW1 A;  2DEN B;  3A4S C;  2PZ1 A;  4FHK A;  3WAO A;  3SUZ A;  3L13 A;  5E6O A;  2ELB A;  2V76 A;  2KTR A;  4CHM A;  3Q3F A;  4FJZ A;  4IUM B;  4KDL B;  5HKH A;  2D9W A;  2Y7B A;  2YT1 A;  1FHX A;  1WX7 A;  3HM6 X;  4GSW A;  4BKT A;  3ULB A;  2UYZ B;  2LWP A;  3KUC B;  1T0Y A;  1PLS A;  2KN5 A;  3PGE A;  1WJ1 A;  1ZKH A;  2WX0 A;  3NSU A;  1ZVR A;  3TCA A;  2BWF A;  4XC2 A;  3RCZ A;  3VUW A;  1HE8 A;  3W1S A;  1R4M I;  4AJY B;  1P3Q U;  2COD A;  2YRY A;  1OQY A;  1NI2 A;  3DQV A;  1PMS A;  3D8E A;  4G3X B;  2W2X D;  3QC8 B;  4WWO A;  1U27 A;  2BCJ A;  4GDK B;  4F7H A;  2DN6 A;  2GBK A;  4NJ6 A;  1QZE A;  1FHO A;  2IY0 B;  4PS7 A;  3UGB B;  4EUT A;  5J18 A;  2FCN A;  4KZC A;  5C5B B;  4GGQ A;  1WGG A;  2UZR A;  4JIO U;  1WYW B;  3A9K B;  4II2 B;  2LOZ A;  4FUL A;  4BBN F;  1E8X A;  4HB4 B;  5JLJ B;  1Q5W B;  2C7H A;  2LGD A;  3EC8 A;  4TQ1 A;  2DYN A;  2JP2 A;  3VH3 B;  1WRD B;  3EPY A;  4ZDV A;  1WIA A;  2RLO A;  4AUQ C;  4ANX A;  2ZVN A;  1NTY A;  2COF A;  2RSG A;  4WWN A;  2GCL A;  2G4D B;  5C23 A;  2KFK A;  2N7D A;  5L81 A;  3KH0 A;  2Y8G A;  2RGF A;  1U5E A;  2LVQ A;  4PS3 A;  5CHW A;  5DIF B;  4MDK E;  4AOF A;  4KIK B;  1N3H A;  1ST7 A;  1RLF A;  1YX6 B;  1S1Q B;  2L05 A;  3PTF C;  2KDB A;  2KOX A;  4FHJ A;  4II3 B;  3V61 A;  2COC A;  2H7E A;  2NBW B;  4HHV A;  4HCN B;  5DHF B;  4ANW A;  2YSZ A;  2IYD B;  2MX2 A;  3L08 A;  4JGH B;  1V5U A;  4MT7 A;  2HTH A;  3WYF B;  3UIO B;  2LOX A;  3FSS A;  4HAU B;  1P0R A;  3GYP A;  3FLV A;  5D3X A;  5IJM A;  2FCM A;  5DPW A;  2M38 A;  3DXE A;  2IO3 B;  2KHW B;  3DOW A;  1WGQ A;  2D9X A;  3HW2 B;  5D3Y A;  2C5L C;  3L0W B;  1Y8R C;  3H7P A;  3RD2 A;  1K8R B;  3R7Q A;  3QCA A;  4K7U A;  3RUI B;  1QC6 A;  2RD0 A;  3RZF A;  3IVF A;  4JLC A;  4DHJ D;  1NVL A;  5CX3 A;  3WIM A;  2B3A A;  2BF8 B;  1WG7 A;  2D3G A;  1HBK A;  3TO1 A;  2N9P C;  4G0N B;  1ISN A;  4DHZ E;  2YLM A;  1RJ2 A;  4A6F A;  3ZUN A;  4BKS D;  4DDI D;  2J0M A;  3N3K B;  2CHX A;  1V88 A;  4GU2 A;  3ZVR A;  2R2Q A;  4LDT D;  1XT9 B;  2NZ8 B;  5KCV A;  2D9V A;  1LB1 A;  2LXC A;  3W1Y A;  3ZKJ C;  1SE9 A;  2AL3 A;  2J0K A;  1V5M A;  1M94 A;  4F7G A;  1OEY J;  1YQB A;  2WYQ A;  2LVP A;  2CB8 A;  3NHE B;  2N23 A;  2V3S A;  3ZNH B;  2P0H A;  2CS4 A;  1F9J A;  4GOC A;  1W1G A;  1NDD A;  1X1M A;  2O6V D;  3AXC A;  3RUL A;  2ABD A;  2CU1 A;  2CKH B;  2MBH A;  3JSV A;  1IRS A;  3PLU A;  5LXH A;  3H7S A;  2FDQ A;  1X1G A;  4FJY A;  4ANU A;  1E5W A;  3AI5 A;  5LLI A;  2AWT A;  3NZS A;  2GS0 A;  2BYE A;  4KSL C;  1HB6 A;  2AL6 A;  4CYE A;  2MWN B;  2WWZ A;  3ZW3 A;  5JHB A;  5JP4 A;  4ZRI A;  2XK5 B;  2N4F A;  3A1Q A;  2MCN B;  5JHA A;  4KHA A;  3ZVV A;  3PEG A;  1FGZ A;  3PVW A;  2KMC A;  2J0J A;  3QBV B;  3OAW A;  1G6J A;  1WGU A;  3LJU X;  2VKI A;  2ZCB A;  4PQ0 A;  1KM7 A;  3KUD B;  4IM3 A;  2C60 A;  1MIX A;  3MHS D;  3M1I B;  2JZZ A;  3TFM A;  4WJP A;  1FB8 A;  1V5T A;  4DWF A;  1TBE A;  2JVC A;  1XX0 A;  4DBB A;  1WXA A;  1Z5S B;  2MBB B;  2ZNV B;  3UIN B;  3VQI A;  4URK A;  3KSY A;  1BWN A;  5J3T A;  3VFK A;  1WMH A;  1KI1 B;  2JXX A;  2FID A;  2DKP A;  4NAW B;  2EC1 A;  2KX0 A;  5DHA B;  2BWE S;  2LRW A;  4FJV B;  2DZJ A;  2NCN A;  2K00 A;  2KJR A; 
#chains in the Genus database with same CATH topology
 4HDO A;  2RDG A;  3NVZ A;  2ZEQ A;  3PZ7 A;  2IO2 B;  4WJ7 A;  2D9Y A;  1KOT A;  2CAY A;  1ZC4 B;  1J19 A;  1E90 A;  3HIE A;  4LNN A;  4WJO A;  3TL5 A;  4RMA A;  1LXD A;  4EE2 A;  3WAL A;  1FAO A;  4XWX A;  4Y94 A;  3P4Q B;  4NNJ B;  2JPH A;  4QXA B;  2B76 B;  1K5G B;  3U8Z A;  4MJS A;  1UZX B;  1V1P A;  2LMC A;  4E71 A;  4NAW A;  1MVK A;  2MRP A;  5JH5 C;  3HVD A;  1H8C A;  2J4X A;  2DHK A;  4JKH A;  1FCC C;  3FM8 C;  2Q5W D;  4TQ0 A;  4HRS A;  1NEK B;  4C56 C;  4RGM A;  4W9E A;  2INN E;  3T06 A;  3OJ3 A;  4D0N B;  1FXT B;  1M7R A;  1H4R A;  5I4D A;  4L6E A;  2KUP A;  4OT1 A;  2Z0P A;  2JYE A;  2HJ8 A;  1XKE A;  2KYW A;  4IKG A;  2JUO A;  4IWO A;  1UPQ A;  4NPN A;  2FE8 A;  1FNU A;  2K22 A;  2NR2 A;  2DHZ A;  4K7S A;  1KZG A;  3ZNG C;  4NQL B;  2UZS A;  3P2B A;  4AP4 C;  1YN5 A;  4KHO A;  4ANV A;  1VBG A;  2RGN B;  5D3V A;  3PPA A;  3L4P A;  3M62 B;  2FCQ A;  2D10 A;  3FEH A;  1V9J A;  2CR5 A;  4HB0 B;  1WVH A;  3Q3J A;  3FVC A;  2JRH A;  4XWT A;  1I4R A;  2IGD A;  1UGM A;  3N1Z C;  3RZW C;  2GI9 A;  2M0A A;  2MWS B;  1BT0 A;  1K53 A;  3GE3 C;  4J3O D;  1ZXI A;  4JQW C;  2WXL A;  2KQS A;  5D2M B;  4ZYN A;  4MGZ E;  1C1Y B;  1GAQ B;  2ZKM X;  4B6H A;  1KLU D;  1DGJ A;  3KYC D;  1TT5 B;  4HAY B;  2KXJ A;  1VR9 A;  5FR3 A;  2DHJ A;  2MBE A;  4EZL A;  1BAK A;  3NOB A;  3ZTD A;  4AJW A;  1V86 A;  2DYQ A;  5GOW B;  3TSS A;  2JF5 A;  3P1M A;  3U2S C;  1ZPS A;  1XQQ A;  1ZM0 A;  4BBK A;  1I7H A;  3A33 B;  4BVU C;  2GBJ A;  1ROE A;  2LBB A;  1LQB A;  4BOZ B;  3BWU D;  1UEL A;  2KWC A;  1Q10 A;  2KGX B;  2Z0E B;  3M95 A;  1YD8 U;  4MGK E;  4M8N A;  2PE9 A;  2O2V B;  4QJ5 B;  2OED A;  1TKG A;  2GBR A;  2G3Q B;  1V2Y A;  4WWP A;  4IFS A;  4GLS C;  4B0E A;  1YX5 B;  2GBM A;  1UEF A;  2LFI A;  3ZNZ B;  2LZ6 A;  1I35 A;  2FJ9 A;  3SO6 A;  4ASW C;  2FCS A;  3U52 E;  2K39 A;  2BTE A;  4JK8 A;  4JKB A;  3AE6 B;  1XO3 A;  2JY6 A;  2Z59 B;  1D4B A;  5D3I B;  3RCP A;  4N6E B;  3TEY A;  1TJE A;  4KGR A;  2NMB A;  1WJ4 A;  2E3T A;  4NY0 A;  1UBI A;  5DPT A;  3X0W A;  4EEW A;  3HSA A;  3NWA A;  1JWU D;  4YTN B;  2E2X A;  1CQV A;  1XR0 B;  2MP2 A;  1XEE A;  4Q2J A;  1UNR A;  1V6E A;  4WUR A;  1A5R A;  3BVM A;  4WIP A;  1T77 A;  3EA6 A;  3TVV A;  2BVC A;  3WA0 A;  4GDL A;  2W82 A;  4R3D A;  5J2R A;  3W9C B;  2J52 A;  2K1F A;  3QA8 A;  1C78 A;  5AZH A;  1DDV A;  2KWD A;  1BTN A;  2WS3 B;  3DBH B;  2INP E;  2KJH B;  4KX6 B;  2CHW A;  2J59 M;  2BW2 A;  2QC8 A;  2AYO B;  2DZI A;  2Z8L A;  3EGR A;  3HQC A;  1WH3 A;  1F0Z A;  4JKG A;  1W1D A;  2NBV A;  3OHM B;  2K8B A;  1GB4 A;  2W55 A;  3EEC A;  3R2I A;  1IBX B;  2X8X X;  3AE4 B;  4A6H A;  5KHQ A;  3A9K A;  3DCX A;  3PP2 A;  2HRJ A;  3QQ8 B;  2ROV A;  3UQB A;  2K8C A;  1TGZ B;  2WGS A;  1DYN A;  2K2U A;  2IO1 B;  2MDX A;  2E6X A;  1NBF C;  3JVZ X;  2K25 A;  3QAR A;  2G45 B;  1E8Y A;  3WAM A;  3DDC B;  2IGH A;  1SJH D;  2C7M B;  1AAR A;  4W9G A;  1PQS A;  2X38 A;  2VZK D;  2TSS A;  3KWL A;  1V61 A;  3BJI A;  4XDD A;  2GJY A;  1UD7 A;  4GDK A;  1XLQ A;  5EE0 A;  4ARI A;  1FNW A;  2RUK B;  2G35 A;  1WRI A;  5G2N A;  4A6F B;  1M4V A;  1WGY A;  1LO5 D;  4RM8 A;  3A98 B;  4XYC A;  2DA0 A;  2JRI B;  1MI1 A;  3ODX A;  1JML A;  3M3J A;  3P4P B;  1Z2M A;  2PIA A;  1U5D A;  2L1C A;  1QOG A;  2DLB A;  2G4S A;  2ZPN A;  2Q13 A;  4JKD A;  5M4Y B;  4RM9 A;  1I4H A;  1JW9 D;  2ROZ B;  3NY5 A;  2MQJ A;  2PKO A;  1TIF A;  1I2H A;  1L5P A;  4HB2 B;  3QWZ B;  4JL9 A;  4XGA B;  3KW5 B;  4A5K A;  2FIF A;  4BFR A;  2D07 B;  1RRP B;  1UH6 A;  5HG2 A;  2WXF A;  2KDF B;  2NPT B;  4TSS A;  2IZV B;  1YQ3 B;  4F7Z A;  2D11 A;  2KK8 A;  2K6D B;  3V5W A;  4DX8 A;  5L95 C;  3PSE B;  3PRE A;  1D5X C;  3PT2 B;  3CF6 E;  1TXD A;  2N9E B;  2WHI A;  4D6W A;  3DBR I;  3NS8 A;  1NI3 A;  4YWG G;  1SJE D;  4K3B A;  4N59 A;  1ZDX A;  2HTH B;  4YXD B;  3AED B;  4MGI E;  3SDL C;  2MFQ A;  2PZ1 A;  3BVZ A;  1YN3 A;  2V76 A;  4CHM A;  1FHX A;  2GRI A;  1T0Y A;  3SFD B;  3TCA A;  4AJY B;  3W1S A;  4JK7 A;  2COD A;  4DXG A;  3QC8 B;  1U27 A;  1L6V A;  2R61 A;  4PS7 A;  4C4V A;  3R2T A;  4HSI A;  4GGQ A;  3ZJU A;  3A9K B;  3W5V B;  2DIK A;  4YSZ B;  4OZC A;  1L6U A;  5I2M A;  2Z59 A;  4WWN A;  2K5P A;  2G4D B;  2FBW B;  5C23 A;  2AQ2 B;  1J7C A;  4PS3 A;  4AOF A;  1S1Q B;  3I57 A;  1T5X D;  3RNC C;  4HHV A;  4HCN B;  4BAX A;  2YSZ A;  2WXR A;  1ZDV A;  3L08 A;  4HRO A;  4JGH B;  1QLB B;  2WQY B;  3AN1 A;  2JSV X;  3WYF B;  1WYG A;  1MI0 A;  2V9H A;  4PT5 A;  3GYP A;  3FLV A;  4ZYS A;  1SE2 A;  3J9C A;  2M56 B;  3T3N A;  2C5L C;  1Y8R C;  1CJE A;  3QCA A;  4L23 A;  1PGB A;  4ZOH C;  3IVF A;  4JLC A;  1NVL A;  2D3G A;  2N9P C;  3U7Z A;  3TO1 A;  1XF5 L;  4DHZ E;  2YLM A;  3ZUN A;  4BKS D;  1E7P B;  4GU2 A;  1HTQ A;  1XT9 B;  1SBB B;  3DBL B;  2WP9 B;  2LXC A;  1V5M A;  1OEY J;  1T0S C;  5G55 A;  3RFZ B;  2CS4 A;  1F9J A;  2O6V D;  3AXC A;  2CU1 A;  3JSV A;  2MBH A;  1IRS A;  5LXH A;  1E5W A;  1QOA A;  3AI5 A;  1YN4 A;  2KIG A;  2AL6 A;  1BML C;  1UGJ A;  3A1Q A;  2MCN B;  1KLG D;  4A55 A;  2KMC A;  3PVW A;  1A70 A;  3T3O A;  4USA A;  3LJU X;  4PQ0 A;  1UWM A;  1KM7 A;  3KUD B;  2C60 A;  3Q8C A;  2JZZ A;  4DWF A;  2FJU B;  1WXA A;  1Z5S B;  1BXT A;  2JXX A;  2FID A;  2KX0 A;  4FJV B;  3P4R B;  1N5X A;  4KZ0 A;  1AW7 A;  1ZUD 2;  3VXW A;  3ZRC A;  2Y5B B;  2DAJ A;  2KLG A;  3A8P A;  5CLQ B;  3DBL I;  3AH7 A;  5AZG A;  2H88 B;  2RDB C;  2CHZ A;  2G9H D;  3AE7 B;  3GZN I;  4NJ7 A;  1EF5 A;  1FO4 A;  3EHV A;  2I2Y A;  4K81 A;  3AU5 A;  1E6E B;  1E8W A;  2C9W B;  2DX5 A;  1PUT A;  3ZDT A;  4P1B C;  1MAI A;  1X05 A;  3WAN A;  2WXI A;  4P16 A;  3TEX A;  5FK9 C;  3KRX A;  2WLB A;  4NQK E;  5LOP B;  3CMM B;  1J7B A;  1EM7 A;  3ODO A;  1GOZ A;  3VRA B;  1E10 A;  2M17 A;  1XCG A;  1FIQ A;  4WAF A;  3IBE A;  2SAK A;  2DAF A;  1R4M B;  1YJI A;  3SD5 A;  1YIW A;  5BMI A;  1JAL A;  4GMX B;  2WDR B;  3MDB C;  1LM8 B;  3QK0 A;  1ET9 A;  2KCJ A;  3MP9 A;  4QJ3 B;  2M1M A;  2RSU A;  1KTK A;  2LGX A;  4A8X C;  1Z87 A;  4WSF A;  2M4N A;  3AEB B;  1NEN B;  2FUH B;  3CIR B;  2KIE A;  5IRS A;  2M19 A;  2ICI A;  2ACZ B;  2JX5 A;  4LNI A;  3N32 A;  4IOY X;  3VH4 B;  2XEW A;  2KO3 A;  3UF8 A;  1DOY A;  4L1R A;  3BIN A;  3AE5 B;  2N9L A;  5IO9 A;  1KC7 A;  1W1H A;  3SYX A;  1L0Y B;  3KYD D;  4OSN A;  2MJE A;  3K9P B;  5HE0 A;  2ZCC A;  3DBR B;  3AUL A;  5KHO A;  1OQR A;  5KQ4 A;  2EMT A;  1FEH A;  2DX1 A;  5HE2 A;  4E3C A;  1NU2 A;  1IP9 A;  1XCT L;  3H1U A;  1P7E A;  1EAZ A;  3U12 A;  4OZB A;  2ZNV C;  1IGC A;  2MBQ A;  2KMA A;  1E8Z A;  1U4A A;  1U5G A;  1AQC A;  4MH8 A;  2O6V B;  2RPV A;  4ACF A;  4A90 A;  4B9K A;  3VTW A;  3KUZ A;  1EWC A;  1H10 A;  5AUK A;  1XOD A;  3PRZ A;  5DPR A;  4C0A A;  1MJD A;  4JKF A;  3T9L A;  2L1A A;  2L00 B;  3ZTC A;  3LDZ E;  1XCQ L;  1WI0 A;  2R82 A;  4XDC A;  1EGX A;  2K8E A;  2DWQ A;  4S0R A;  2ZJD A;  4JPS A;  5J17 A;  4DHJ B;  1FCL A;  4N58 A;  3VUY A;  3HIZ A;  4ARC A;  2WDV B;  1DBH A;  2BKR B;  4W9L A;  1QT9 A;  1TZ1 A;  3CWI A;  1J0G A;  2NTT A;  3TBL D;  2VH2 A;  4HPL B;  3QIJ A;  1RRB A;  1FHW A;  2MA9 B;  2XK5 A;  1Y56 A;  2YS3 A;  2RMM A;  1WR1 A;  4A9A A;  2K8H A;  3LJ3 A;  1JRO A;  4I6L B;  2J53 A;  1TS5 A;  3SU8 X;  2BPS A;  2N1W A;  2O6V A;  2I1K A;  1WGH A;  4HJK A;  2IND C;  4LK0 M;  1MK7 B;  1V5O A;  1D6E C;  1WZ0 A;  4K1R B;  3OAN A;  4K2P A;  1SIJ A;  3DVG X;  2PPH A;  2L52 A;  4KGS A;  3R7R A;  5CLL B;  1WGR A;  2WDT B;  2FUG 1;  2BKF A;  3TEW A;  3Q14 C;  3DXC A;  5BYS A;  4LTU A;  4L1B A;  3TMP B;  4MSQ B;  1GG3 A;  2VRW B;  4EZJ A;  2N7J A;  2WXM A;  4W9D A;  3AE1 B;  2WXQ A;  1WF9 A;  2M8S A;  4ICV A;  1NTV A;  2Z0O A;  3I63 C;  4TV3 A;  2JZP A;  4D2K A;  2DZK A;  4E74 A;  3R3M A;  4FLH A;  2BBC A;  2WH5 A;  1V80 A;  2NBU A;  4QAY A;  5HE1 A;  1Q0W B;  2HTM E;  5LON B;  4IWP A;  3IT6 B;  4W9F A;  2V1Y A;  4K2O A;  1WXV A;  2N7E A;  1WE7 A;  4O1N A;  1ZE3 D;  1XLN A;  4ILG B;  3DHH C;  4GB9 A;  5L83 A;  3AEA B;  3A58 A;  3T8M A;  1D5M C;  2KJ6 A;  2KQ7 A;  2KAC A;  1IBX A;  1FGY A;  4MSM B;  1K52 A;  3DCG A;  3AEG B;  1S3S G;  2GOW A;  2WXO A;  1UWX A;  4RGN A;  2DFK A;  3E9L A;  1SEB D;  1C79 A;  2R2O A;  1KZ7 A;  1N5W A;  2H7D A;  2K49 A;  4CSQ A;  1EVH A;  3Q3M C;  4IAP A;  3V60 A;  3DHG C;  4LDT B;  1Y19 B;  1JWB D;  3V6E B;  2WXN A;  1L4Z B;  1J7A A;  1ZGU B;  3HVZ A;  2CY4 A;  4C4V B;  1WR6 E;  4M0W B;  1B9R A;  2JXT A;  4FN2 A;  4MEL A;  2UWQ A;  1P98 A;  4K17 A;  2ZW0 A;  3AU4 A;  3ML9 A;  4K7W A;  1OFF A;  3SEB A;  1MKE A;  1WMH B;  4PNK A;  3I9V 1;  2CQU A;  2O2V A;  2VZK B;  3PG7 A;  1XD4 A;  4JWS C;  3PRM B;  3PLV A;  3DVN V;  2WXP A;  1SXT A;  4LJP B;  1LW3 A;  1V81 A;  3MC0 B;  2KX3 A;  2DYM A;  3P4S B;  2OOB B;  1DOX A;  3SR6 A;  2KLC A;  5KQ1 A;  2L83 A;  2DX5 B;  1FRD A;  2QCZ A;  2WX1 A;  1HB8 A;  5JZE B;  4ICU A;  1VLB A;  5EDS A;  1TS3 A;  1WX9 A;  2D4Q A;  3ALB A;  3UQA A;  5D6J B;  2VSZ A;  1P9D U;  4ZRP A;  1YOV B;  3M63 B;  1RFA A;  3PZ8 A;  1B1Z A;  3OG5 A;  2JU6 X;  2CU3 A;  5IN7 A;  2OJR A;  1JWS D;  1WJ6 A;  1N61 A;  2QEJ C;  4HPP A;  2BS2 B;  3V05 A;  1WM2 A;  4H2A A;  4KAX B;  2NMQ A;  4DK5 A;  4RGT A;  3NWD A;  4BBN C;  4J6I A;  4C00 A;  4MK0 A;  4IWQ A;  5C16 A;  3L10 B;  4JE3 B;  1WXM A;  4FHK A;  3A4S C;  4XE0 A;  3L13 A;  2KTR A;  4KDL B;  3Q3F A;  4IUM B;  2MH7 A;  5IKC M;  2D9W A;  2Y7B A;  4KHB A;  1XLP A;  4GSW A;  3ULB A;  2UYZ B;  3KUC B;  1FFU A;  4YTM B;  3PGE A;  1ESF A;  1ZKH A;  3NSU A;  4GOU A;  4YT0 B;  2I38 A;  1E9M A;  3RCZ A;  1R4M I;  1P3Q U;  2YRY A;  1OQY A;  1NI2 A;  4G3X B;  1PMS A;  3EUB 2;  4WWO A;  4GDK B;  3Q6B A;  2IY0 B;  4EUT A;  5IP4 D;  1FNV A;  4FUL A;  4BBN F;  4TQ1 A;  4HB4 B;  1Q5W B;  2LGD A;  2JP2 A;  1WIA A;  4US8 A;  1SE3 A;  3AV8 A;  2GCL A;  4REZ A;  3VR8 B;  3KH0 A;  2RGF A;  1U5E A;  1DYQ A;  4KIK B;  4M02 A;  3C19 A;  4FHJ A;  4JK9 A;  1KRH A;  2IYD B;  2HTH A;  3FSS A;  1GB1 A;  4HAU B;  1P0R A;  2FCM A;  2M38 A;  1WGQ A;  2D9X A;  3HW2 B;  5C2T B;  3H7P A;  2WXK A;  4K7U A;  1I4Q A;  4DHJ D;  2B3A A;  2BF8 B;  4ZRQ A;  1HBK A;  3R8B A;  4A6F A;  5EE1 A;  2WU5 B;  1V88 A;  3ZVR A;  5H8Y E;  4DQO C;  1TKE A;  3W1Y A;  3RMK C;  1SE9 A;  4WQM A;  2LVP A;  4FXC A;  2P0H A;  3ETR A;  4GOC A;  1V1P B;  3RUL A;  1X1M A;  1ACC A;  3Q8F A;  2CKH B;  3PLU A;  4RF0 A;  2W3S A;  2FDQ A;  5LLI A;  3NZS A;  2GS0 A;  2BYE A;  4KSL C;  5JHB A;  2MWN B;  3BYT B;  5G5H A;  4ZRI A;  4KHA A;  3EFC A;  3OAW A;  4P6V F;  2D3C A;  1MIX A;  3MHS D;  3TFM A;  1FB8 A;  3VQI A;  3RNG C;  3NVY A;  2EC1 A;  2LRW A;  5TSS A;  2KJR A;  3O13 A;  3MHZ A;  4IC7 B;  3VDZ A;  3PZD A;  3MTN B;  3NZ3 A;  3P6A A;  3RN9 C;  2KC2 A;  4OVV A;  1CZP A;  1C76 A;  1PDX A;  3AEC B;  3RYT A;  3B77 A;  2LGY A;  3LB8 C;  4WWM A;  4OW0 A;  1ZYI A;  3U30 A;  1DRO A;  3WAP A;  2H89 B;  3VVW B;  2ZVO A;  2DTC A;  2NPT A;  4X57 B;  1RAX A;  2WXG A;  2N9X A;  1FXI A;  1WWT A;  4IM2 A;  4GMV A;  4MEM A;  2GB1 A;  3W1S C;  4DHZ B;  2FNJ B;  1IGD A;  2PMV A;  1OQN A;  3NUH B;  3ONS A;  3RPF C;  1UNP A;  3AEF B;  4IOI E;  2KKC A;  1IPG A;  1WXQ A;  5E6N A;  1LGR A;  3KVF B;  4OVU A;  4KHB B;  1P3R A;  3V6C B;  5I2S A;  4M0W A;  3ZYY X;  2XN9 C;  2QJL A;  3AMZ A;  3EFU A;  4PS8 A;  4GZU A;  4Z2N A;  4GNK B;  2REX A;  3RNF C;  4C7Z A;  3ZNI D;  3BZD B;  5J3Q A;  1VCB A;  4M8M A;  3APC A;  3E66 A;  3PS6 A;  2KWU B;  5LNK 1;  4I6N B;  2YEP F;  3L17 A;  2BYF A;  2PEA A;  4G50 A;  5EE9 A;  1KH0 A;  3UI3 A;  3F5R A;  1PGX A;  1RM6 C;  2MJD A;  5D7G A;  3O96 A;  2I1J A;  3ENE A;  1J0W A;  1Y5O A;  2DYO A;  3QX1 A;  5J3Y A;  1VZ6 A;  4CHJ A;  2IDY A;  2MP2 B;  1ZXH A;  1JWM D;  3D8D A;  3AB5 A;  2HE7 A;  2KDM A;  1ACA A;  5BO4 B;  2L2I A;  2I5C A;  2NS5 A;  1L0X B;  2K6Q A;  3JW0 X;  3FIL B;  1XD3 B;  4EMO A;  1I4G A;  2VRR B;  1P5T A;  2ZW1 A;  1N62 A;  4F7U P;  3A9J B;  1R4N B;  1K50 A;  1MPE A;  3JYU A;  2PVO D;  3NZU A;  3WCQ A;  4HAX B;  1MPH A;  1HXY D;  1FRR A;  2N0S B;  1F77 A;  1Q67 A;  2IGG A;  3PV1 A;  3ULC A;  1AWE A;  4LJO B;  2M14 A;  4MGY E;  3F0W A;  4CHK A;  1CMX B;  2HDE A;  1MHX A;  2GCJ A;  4IM0 A;  3TJP A;  3H6N A;  2IBI B;  2N9K A;  5HI1 A;  4HJG E;  3MPX A;  2UU7 A;  1B55 A;  4W9K A;  1OY2 A;  2MBO A;  2FAZ A;  3E9P A;  3RNB C;  1YJJ A;  3C8Y A;  3K9O B;  1WJM A;  3DWM A;  3NVW A;  5AEK B;  4HK2 A;  1F2R I;  4HAW B;  4ILJ A;  2Y8F A;  5D27 A;  1I4P A;  3LYY A;  1UBQ A;  3KQ4 A;  2LYD A;  1EUV B;  3E9O A;  4PYU A;  2SEB D;  1ENF A;  4UDU C;  2V4I B;  2XBB C;  2BYV E;  4DXA B;  2WU2 B;  3B08 A;  5IA7 A;  5C1Z A;  1YQ4 B;  2ZPY A;  5CHF A;  5D3D A;  2EKE C;  5MPO A;  4HEA 1;  3TIX A;  4B6W A;  2MW5 A;  3H9D A;  3GB1 A;  3I5J C;  3ZQ4 A;  3ZRF A;  4W9I A;  1MG8 A;  2AX5 A;  2WXJ A;  2LRU A;  2K2J A;  2YF0 A;  2BS3 B;  1L0V B;  3S2A A;  3C0R B;  5LXI B;  2KMM A;  3ECI A;  1V5P A;  3BII D;  1BUI C;  2PE6 B;  1M7E A;  2LD9 A;  4S17 A;  5FI0 A;  4AQ7 A;  2EJ8 A;  3SBT A;  4RH6 A;  1GPX A;  1UNS A;  4WH4 A;  2IO0 B;  2AQ3 B;  2AEH A;  2GMI C;  2KAN A;  2D5G A;  1PGA A;  1WGK A;  4US9 A;  2DLW A;  2KD0 A;  3SBG A;  3U7D A;  2A5U A;  2KQ4 X;  3VUX A;  1V8C A;  1FXA A;  2ONQ A;  1V1O A;  3URY A;  4F1S A;  4FBJ B;  4MY6 A;  4HDQ A;  2HJ1 A;  3KY9 A;  1HQR D;  3AM9 A;  3R66 C;  2OQB A;  1TYG B;  1BTK A;  4OHJ A;  3MJ5 A;  3DVG Y;  4HXD A;  1DOI A;  5C3J B;  3B9J A;  4TMA B;  4HKQ A;  4CQN A;  1GGO A;  4P7I A;  1GUA B;  1RWS A;  3PVL A;  4TYZ A;  3Q8E A;  2LEK A;  2XNA C;  5D94 A;  4B0M A;  2COA A;  1QQR A;  1TJ6 A;  2INC C;  2JWU A;  4KKI A;  3ZDM C;  4GPT B;  1MHH E;  1OEY A;  2EKI A;  3MC9 A;  4KKJ A;  1WX8 A;  4RNA A;  1WI1 A;  3H7P B;  5IAA C;  3AJ4 A;  5H92 C;  4MH0 E;  1VZ8 A;  4I6P A;  1OMW A;  1U2B A;  2JQR B;  5D3W A;  5C6R A;  2X0S A;  4WJN A;  3GE8 C;  2DZM A;  3G9W A;  2NVU I;  2RR9 A;  2KVR A;  1N63 A;  2CY5 A;  4F8C B;  3HM3 A;  1IYF A;  4BKS A;  4NAM A;  4RGO S;  2JT4 B;  4HAT B;  2LXA A;  2KFJ A;  1VD2 A;  2RPQ A;  3VRB B;  4HVB A;  4KV2 A;  3ZJV A;  2UVM A;  2D2Q A;  3X23 A;  3L16 A;  4AWJ A;  4C80 A;  3PRP B;  3VTV A;  4MM3 A;  5G5G A;  3DBS A;  1TZO A;  4FA6 A;  1FOE A;  2FJL A;  1WM3 A;  5BYQ A;  4NZL B;  2KWV B;  4W9C A;  1I4X A;  3QJZ A;  1RFK A;  2LI5 A;  4H8S A;  4B95 A;  3ZO5 B;  2Z0D B;  1HTO A;  2D9Z A;  1NTI A;  5T8I A;  4A3P A;  3Q3N C;  1NYQ A;  5E6P A;  2IY1 B;  2KZR A;  3DHI C;  2DNF A;  3IHP C;  1GNU A;  2LAS A;  3OWE B;  2YVC A;  4BZA A;  3QAQ A;  3V3X A;  3N20 C;  2NBV B;  3ML4 A;  4KSK C;  3VTU A;  2W2W A;  1NYR A;  1F1H A;  4EFO A;  1DDM A;  4M01 A;  5GXG B;  4DBG A;  3RNA C;  1F2R C;  1FPY A;  3L54 A;  2KDI A;  1ZW7 A;  2N0Y A;  3NJT A;  3IG3 A;  3SV1 A;  3QWM A;  1LFD A;  1SSN A;  5DPS A;  2MEK A;  1GJZ A;  3IT4 B;  3ENB A;  3N30 A;  2P8V A;  4WVF B;  3TW1 A;  2DEN B;  2LJI A;  2Z13 A;  3WAO A;  3SUZ A;  5E6O A;  2ELB A;  4FJZ A;  2YT1 A;  3HM6 X;  2YEP B;  2KN5 A;  2WX0 A;  5BMH A;  1ZVR A;  2KVZ A;  3VUW A;  4QJ4 B;  4NJC A;  4F7H A;  1FHO A;  2DBY A;  1QKZ A;  1MG4 A;  2FCN A;  5C5B B;  1WGG A;  2UZR A;  1WSP A;  4II2 B;  2LOZ A;  1N60 A;  1E8X A;  3VH3 B;  3WIM A;  2C7H A;  4ZDV A;  1WRD B;  3EPY A;  2RLO A;  4AUQ C;  2PW9 A;  2ZVN A;  1NTY A;  2COF A;  2IPK D;  1JDE A;  5L81 A;  5DIF B;  1N3H A;  1YX6 B;  2L05 A;  2KDB A;  1K51 A;  4II3 B;  3V61 A;  2COC A;  2NBW B;  2NTS A;  2WNM A;  4MM3 B;  4ANW A;  1V5U A;  4MT7 A;  4RCO A;  3DWG C;  3GP7 A;  3FC4 A;  5IJM A;  2LUM A;  2IO3 B;  3DXE A;  3RI7 C;  2KHW B;  2LHD A;  5D3Y A;  3L0W B;  3RD2 A;  3GS2 A;  2V0G A;  3RUI B;  3RZF A;  1WG7 A;  1KBL A;  2BT6 A;  4G0N B;  1ISN A;  2J0M A;  2R2Q A;  4LDT D;  3B2F A;  2NZ8 B;  1PYW D;  2Y3A A;  4JKC A;  3NHE B;  4PK1 A;  2CB8 A;  4YSX B;  4LLG M;  1W1G A;  2QIL A;  1TY2 A;  3NWF A;  3H7S A;  4FJY A;  1SB3 C;  3NW8 A;  2VH1 A;  3BK1 A;  1C4A A;  1HB6 A;  4CYE A;  2L32 A;  2XK5 B;  2N4F A;  5JHA A;  3PEG A;  2MJ3 A;  1STE A;  1G6J A;  1AWD A;  4XWW A;  2ZCB A;  4RFB A;  3P42 A;  4WJP A;  3M1I B;  1V5T A;  2JVC A;  2J42 A;  2ZNV B;  3ZJT A;  4ITK A;  3VFK A;  1AYF A;  1WMH A;  3BVG A;  1KI1 B;  2DKP A;  5DHA B;  2BWE S;  2DZJ A;  2NCN A;  1F52 A;  2K00 A;  3IAM 1;  3TEZ A;  4L2Y A;  5HE3 A;  1SHC A;  4LNK A;  2D3A A;  1MIZ B;  2OTX A;  2GLS A;  5AZF A;  3ZGZ A;  1KFY B;  4EOY A;  1RYJ A;  4KGT A;  4JWU C;  1T0Q C;  4EKU A;  2JWZ A;  2QSD A;  3VR9 B;  3N1Y C;  4DX9 0;  3FAH A;  1R7S A;  3B1L X;  1WJU A;  2X18 A;  3ODW A;  1WXS A;  4PYZ A;  1WY8 A;  2LGS A;  1VJK A;  1PFJ A;  1FD6 A;  3AE8 B;  1L4D B;  5EFX A;  3CXB B;  5CTR C;  3KWV A;  3NG0 A;  1C3T A;  1U29 A;  1JRP A;  2V3N A;  1FFV A;  1OTR B;  2YS5 A;  5IOI A;  3P7Z A;  4A20 A;  2ZZP B;  4HPM B;  4EZK A;  3KLS X;  2LHE A;  3V62 A;  2BQQ A;  1HZ5 A;  4Z2M B;  2LUE A;  4JX1 C;  1MK9 B;  4WQO B;  3E9S A;  1P1A A;  3JSV B;  2BS4 B;  3B2G A;  2Z0Q A;  2EEL A;  3E56 A;  5LG4 B;  3Q3O C;  2PJH A;  1D3Z A;  5C5B A;  3PVU A;  1J8C A;  4MJS B;  3NRZ A;  4RF1 A;  3FP5 A;  3PSC A;  1MFW A;  1QOF A;  1ZC3 B;  2KT7 A;  1OQQ A;  4IDI A;  2L7R A;  4HAZ B;  3IXS A;  2M0X A;  3CST A;  4IW0 A;  2QKL A;  2L8J A;  2I5F A;  1EF1 A;  1X86 A;  3A4R A;  3PTF C;  3HRD D;  5DPW A;  4A6K A;  3PHW B;  1V89 A;  3VIA A;  3AEE B;  5DCN A;  2DHI A;  3APF A;  1XLO A;  4YON A;  2IFS A;  5DH9 B;  2C7N B;  1T3Q A;  3KRW A;  3AE3 B;  1E7U A;  4YL8 A;  3N7C A;  1WGD A;  2IYB A;  5DI9 B;  2V3P A;  4G11 A;  3UIP B;  2ADZ A;  2JYT A;  2BGF A;  2BYT A;  1HEZ E;  4BOS C;  1UPR A;  1JCK B;  3UZT A;  2MKR A;  4ZRK A;  1T0R C;  2N1V A;  2R0D A;  1P6S A;  4MAC A;  5AUI A;  4HWI B;  2JZ3 B;  5FI1 A;  2LKO A;  2KN4 A;  3DVN U;  5FR6 A;  1ET6 A;  3A1Q B;  2RVB B;  4TUU A;  1KF6 B;  1VZ7 A;  3NS1 A;  1V49 A;  4W9J A;  2GBN A;  4LCD E;  2PVG C;  5GMV A;  3VAW A;  3GOE A;  4A6Q A;  1TS2 A;  4HKZ E;  2ASQ A;  3AE2 B;  1QIL A;  1QF6 A;  4GN1 A;  2KNB A;  5JHH A;  4ANX A;  1VDV A;  3ABV B;  4KVG B;  3BY4 B;  1C9F A;  3PHX B;  2LG1 A;  3B0A A;  2YS1 A;  4TKN A;  2YT0 A;  2XQN M;  2KTF A;  3KZ1 A;  5JVL A;  2LVO A;  4EJN A;  5BMG A;  3LXF A;  4DDG D;  2Z4D A;  3I3T B;  2P0F A;  1TKY A;  4OZA A;  1SF0 A;  3CIK A;  5FKA C;  4MT5 A;  1X11 A;  3SNH A;  5HHD G;  3RT3 B;  2DKQ A;  2P0D A;  3BYY B;  3SFE B;  2KC1 A;  1JRU A;  4KIK A;  3HUI A;  2J7Q B;  3A8Q A;  2PLP A;  4K3C A;  1SE4 A;  1UNQ A;  3MC8 A;  1K5D B;  5C79 A;  1NVI D;  4W9H A;  2LUL A;  3N1X C;  2D3B A;  2CJN A;  1TQZ A;  1QQG A;  2COP A;  1C4C A;  4AS1 A;  4LNF A;  3OLM D;  2EMS A;  1UF0 A;  3Q8B A;  1OGW A;  3IAS 1;  3ZIM A;  4KDI C;  4HAV B;  1X1F A;  3CSF A;  3DXD A;  1I7A A;  2YT2 A;  3VHT C;  3W2D A;  3N9Y C;  1PFD A;  5JHG A;  1V97 A;  2KTR B;  2HD5 B;  1HZ6 A;  1P7F A;  1Q1O A;  4FAD A;  4WJQ A;  2WDQ B;  2ELA A;  2QKM A;  3SHQ A;  1ZSQ A;  2L0F A;  4M00 A;  3GYO A;  3HHM A;  3ZXV A;  2BB6 A;  4GIV A;  4LNO A;  3QHT A;  1C77 A;  2A4Z A;  2R09 A;  1EO6 A;  1E7V A;  3ML8 A;  4C7Y A;  1FM0 D;  1SIF A;  3A9J A;  3O65 B;  4XZ4 A;  1GC7 A;  2KUQ A;  1E0Z A;  2RNR B;  2Y5P A;  2OHF A;  4IG7 B;  4XX5 A;  3MJW A;  2L76 A;  1EU3 A;  2W54 A;  2KFK B;  2QHO A;  2W9N A;  4JKE A;  2K9X A;  2L0T A;  2MLB A;  3W5U B;  3Q8A A;  2QIE B;  3GZN B;  1EU4 A;  2Y5C A;  1QOB A;  1WE6 A;  3ZLZ A;  3APD A;  3VOQ A;  3D32 A;  2CRF A;  4GDL B;  2AQ1 B;  2R2Y A;  1L7Y A;  4ILH A;  3OJ4 B;  1I42 A;  2LGI A;  3Q69 A;  1T6B X;  4HB3 B;  3U4E G;  4DIX A;  3DBH I;  1KLV A;  2L3Z A;  5CHV C;  3FIL A;  4NSW A;  1EWY C;  1U5F A;  3D8F A;  4N9F 4;  4YSY B;  4BKG A;  2MSE D;  2QDF A;  1TY0 A;  1WJN A;  2ON8 A;  1SGH A;  2BB5 A;  3NVV A;  4A3O A;  1YJ1 A;  4HLE A;  2V4L A;  1L2N A;  3ZXR A;  1UUP A;  2W2X C;  4DXF A;  1WZ3 A;  2RDH A;  4ZRJ A;  2GUM A;  4YTP B;  1TS4 A;  1XXG A;  1GC6 A;  4WAA A;  1R4N I;  1DDW A;  2LJ5 A;  2DYB A;  5TR5 A;  1JQ4 A;  1JWA D;  3IFW B;  1TTN A;  3DPD A;  3Q2A C;  1VBH A;  2RQ1 A;  1IUE A;  1WFY A;  4GXB A;  1DIK A;  3HK0 A;  4HCP B;  5E6J A;  2KDE B;  1KJT A;  2W3R A;  3H8H A;  5HKH A;  1WX7 A;  4JKA A;  3AE9 B;  4BKT A;  1CK1 A;  2LWP A;  1PLS A;  4OVZ A;  1WJ1 A;  2BWF A;  1ZOY B;  1D5Z C;  4XC2 A;  1HE8 A;  1AN8 A;  3DQV A;  5J18 A;  3D8E A;  2W2X D;  2BCJ A;  2DN6 A;  2GBK A;  4NJ6 A;  1QZE A;  3UGB B;  4P1C C;  4KZC A;  2RRF A;  4JIO U;  1ZP0 B;  1WYW B;  4CO7 A;  5JLJ B;  3EC8 A;  2DYN A;  2IJ0 A;  2RSG A;  4ZHP A;  2KFK A;  2N7D A;  2Y8G A;  2K0P A;  2LVQ A;  5CHW A;  4MDK E;  2KR0 A;  1ST7 A;  1RLF A;  2KOX A;  2H7E A;  5DHF B;  2MX2 A;  2G1E A;  3UIO B;  2LOX A;  2WXH A;  5JXV A;  1N6Z A;  5D3X A;  1FMA D;  3DOW A;  3R7Q A;  1K8R B;  1QC6 A;  2RD0 A;  3PO0 A;  2Z14 A;  5CX3 A;  2MHJ A;  2KAJ A;  1RJ2 A;  4DDI D;  3N3K B;  2CHX A;  3P63 A;  5KCV A;  2D9V A;  1LB1 A;  3ZKJ C;  2AL3 A;  2J0K A;  1M94 A;  1YQB A;  4F7G A;  2WYQ A;  3ZNH B;  2N23 A;  2V3S A;  1NDD A;  2CJO A;  2ABD A;  5BYR A;  1X1G A;  2K3U A;  4ZHO A;  4ANU A;  2AWT A;  1YNT E;  2WWZ A;  3ZW3 A;  5JP4 A;  3TUO A;  3BK2 A;  3ZVV A;  1FGZ A;  1YMH E;  2PTL A;  2J0J A;  3QBV B;  3RNE C;  1WGU A;  5HFY A;  2VKI A;  1C4P A;  2OJW A;  4IM3 A;  1TBE A;  1XX0 A;  4DBB A;  2MBB B;  3UIN B;  1VRA B;  5EE3 A;  4URK A;  3KSY A;  1BWN A;  5J3T A;  1HA5 A;  3FKY A;  2QMT A;  3MFG A;  4NAW B;  4JKG B; 
#chains in the Genus database with same CATH homology
 4HDO A;  2ZEQ A;  2IO2 B;  4WJ7 A;  2D9Y A;  1KOT A;  2CAY A;  1ZC4 B;  1J19 A;  1E90 A;  3TL5 A;  4WJO A;  4RMA A;  1LXD A;  3WAL A;  1FAO A;  4XWX A;  4Y94 A;  4NNJ B;  2JPH A;  1K5G B;  3U8Z A;  4MJS A;  1UZX B;  4E71 A;  4NAW A;  2MRP A;  5JH5 C;  1H8C A;  2DHK A;  4JKH A;  3FM8 C;  4TQ0 A;  4W9E A;  3T06 A;  3OJ3 A;  4D0N B;  1FXT B;  1M7R A;  1H4R A;  4L6E A;  2KUP A;  2Z0P A;  2HJ8 A;  1XKE A;  4IWO A;  2JUO A;  1UPQ A;  4NPN A;  2NR2 A;  2DHZ A;  4K7S A;  1KZG A;  3ZNG C;  4NQL B;  2UZS A;  3P2B A;  4AP4 C;  4KHO A;  4ANV A;  1VBG A;  2RGN B;  5D3V A;  3PPA A;  3M62 B;  2FCQ A;  2D10 A;  3FEH A;  1V9J A;  2CR5 A;  4HB0 B;  1WVH A;  3Q3J A;  2JRH A;  1UGM A;  3RZW C;  2MWS B;  1BT0 A;  4JQW C;  2KQS A;  5D2M B;  4ZYN A;  4MGZ E;  1C1Y B;  4B6H A;  3KYC D;  4HAY B;  2KXJ A;  2DHJ A;  2MBE A;  4EZL A;  1BAK A;  3NOB A;  3ZTD A;  4AJW A;  1V86 A;  2DYQ A;  5GOW B;  2JF5 A;  1XQQ A;  1ZM0 A;  4BBK A;  3A33 B;  4BVU C;  2GBJ A;  2LBB A;  1LQB A;  4BOZ B;  1UEL A;  2KWC A;  2KGX B;  2Z0E B;  3M95 A;  1YD8 U;  4MGK E;  4M8N A;  2PE9 A;  2O2V B;  2GBR A;  2G3Q B;  1V2Y A;  4WWP A;  4IFS A;  1YX5 B;  2GBM A;  1UEF A;  3ZNZ B;  2LZ6 A;  1I35 A;  2FJ9 A;  3SO6 A;  4ASW C;  2FCS A;  2K39 A;  4JK8 A;  4JKB A;  2JY6 A;  2Z59 B;  3RCP A;  2NMB A;  1WJ4 A;  4NY0 A;  1UBI A;  5DPT A;  3X0W A;  4EEW A;  2E2X A;  1XR0 B;  2MP2 A;  1UNR A;  1V6E A;  1A5R A;  3TVV A;  3WA0 A;  4GDL A;  5J2R A;  2K1F A;  3QA8 A;  5AZH A;  1DDV A;  1BTN A;  2KJH B;  2CHW A;  2J59 M;  2AYO B;  2DZI A;  3HQC A;  1WH3 A;  4JKG A;  1W1D A;  2K8B A;  3EEC A;  4A6H A;  5KHQ A;  3A9K A;  3PP2 A;  2HRJ A;  3QQ8 B;  2ROV A;  3UQB A;  2K8C A;  1TGZ B;  1DYN A;  2K2U A;  2IO1 B;  2MDX A;  1NBF C;  3JVZ X;  2K25 A;  3QAR A;  2G45 B;  1E8Y A;  3WAM A;  3DDC B;  2C7M B;  1AAR A;  4W9G A;  1PQS A;  1V61 A;  3BJI A;  2GJY A;  1UD7 A;  4GDK A;  2RUK B;  2G35 A;  5G2N A;  4A6F B;  1WGY A;  4RM8 A;  3A98 B;  2DA0 A;  2JRI B;  3ODX A;  3M3J A;  1Z2M A;  1U5D A;  2L1C A;  2G4S A;  2ZPN A;  2Q13 A;  4JKD A;  4RM9 A;  2ROZ B;  3NY5 A;  2MQJ A;  1I2H A;  4HB2 B;  3QWZ B;  4JL9 A;  3KW5 B;  4A5K A;  2FIF A;  4BFR A;  2D07 B;  1RRP B;  1UH6 A;  2KDF B;  2NPT B;  4F7Z A;  2IZV B;  2D11 A;  2KK8 A;  2K6D B;  3V5W A;  4DX8 A;  5L95 C;  3PSE B;  3PRE A;  3PT2 B;  3CF6 E;  1TXD A;  2N9E B;  3DBR I;  3NS8 A;  2HTH B;  4MGI E;  3SDL C;  2MFQ A;  2PZ1 A;  2V76 A;  4CHM A;  1FHX A;  1T0Y A;  3TCA A;  4AJY B;  3W1S A;  4JK7 A;  2COD A;  3QC8 B;  1U27 A;  4PS7 A;  4GGQ A;  3A9K B;  2DIK A;  4WWN A;  2G4D B;  5C23 A;  4PS3 A;  4AOF A;  1S1Q B;  4HHV A;  4HCN B;  2YSZ A;  3L08 A;  4JGH B;  3WYF B;  3GYP A;  3FLV A;  2C5L C;  1Y8R C;  3QCA A;  3IVF A;  4JLC A;  1NVL A;  2D3G A;  2N9P C;  3TO1 A;  4DHZ E;  2YLM A;  3ZUN A;  4BKS D;  4GU2 A;  1XT9 B;  2LXC A;  5G55 A;  1V5M A;  1OEY J;  2CS4 A;  1F9J A;  2O6V D;  3AXC A;  2CU1 A;  3JSV A;  2MBH A;  1IRS A;  5LXH A;  1E5W A;  3AI5 A;  2AL6 A;  3A1Q A;  2MCN B;  2KMC A;  3PVW A;  3LJU X;  4PQ0 A;  1KM7 A;  3KUD B;  2C60 A;  2JZZ A;  4DWF A;  1WXA A;  1Z5S B;  2JXX A;  2FID A;  2KX0 A;  4FJV B;  4KZ0 A;  3VXW A;  3ZRC A;  2Y5B B;  2DAJ A;  2KLG A;  3A8P A;  5CLQ B;  3DBL I;  5AZG A;  2CHZ A;  3GZN I;  4NJ7 A;  1EF5 A;  3EHV A;  4K81 A;  3AU5 A;  1E8W A;  2C9W B;  2DX5 A;  3ZDT A;  1MAI A;  1X05 A;  3WAN A;  3KRX A;  4NQK E;  5LOP B;  3CMM B;  3ODO A;  2M17 A;  1XCG A;  3IBE A;  2DAF A;  3SD5 A;  1YIW A;  4GMX B;  3MDB C;  1LM8 B;  3QK0 A;  2KCJ A;  2M1M A;  2RSU A;  2LGX A;  1Z87 A;  4WSF A;  2M4N A;  2FUH B;  3N32 A;  4IOY X;  3VH4 B;  2XEW A;  2KO3 A;  3UF8 A;  3BIN A;  1KC7 A;  1W1H A;  3SYX A;  3KYD D;  3K9P B;  5HE0 A;  2ZCC A;  3AUL A;  5KHO A;  5KQ4 A;  2EMT A;  2DX1 A;  5HE2 A;  4E3C A;  1NU2 A;  1IP9 A;  3H1U A;  1EAZ A;  2ZNV C;  2MBQ A;  2KMA A;  1E8Z A;  1U4A A;  1U5G A;  1AQC A;  2O6V B;  4B9K A;  3VTW A;  3KUZ A;  1H10 A;  1XOD A;  3PRZ A;  5DPR A;  4C0A A;  4JKF A;  3T9L A;  2L00 B;  3ZTC A;  3LDZ E;  1WI0 A;  2R82 A;  1EGX A;  2ZJD A;  5J17 A;  4DHJ B;  3VUY A;  3HIZ A;  1DBH A;  2BKR B;  4W9L A;  1TZ1 A;  1J0G A;  3TBL D;  4HPL B;  3QIJ A;  1RRB A;  1FHW A;  2MA9 B;  2XK5 A;  2YS3 A;  1WR1 A;  2K8H A;  3LJ3 A;  4I6L B;  3SU8 X;  2BPS A;  2N1W A;  2O6V A;  2I1K A;  1WGH A;  4HJK A;  1MK7 B;  1V5O A;  1WZ0 A;  4K1R B;  3OAN A;  4K2P A;  3DVG X;  2PPH A;  3R7R A;  5CLL B;  1WGR A;  2WDT B;  2BKF A;  3DXC A;  3TMP B;  4MSQ B;  1GG3 A;  2VRW B;  4EZJ A;  4W9D A;  1WF9 A;  2M8S A;  4ICV A;  1NTV A;  2Z0O A;  4TV3 A;  2DZK A;  4E74 A;  3R3M A;  4FLH A;  2WH5 A;  1V80 A;  2NBU A;  5HE1 A;  1Q0W B;  5LON B;  4IWP A;  4W9F A;  2V1Y A;  4K2O A;  1WXV A;  2N7E A;  1WE7 A;  4ILG B;  4GB9 A;  5L83 A;  3T8M A;  2KJ6 A;  2KQ7 A;  1FGY A;  4MSM B;  3DCG A;  1S3S G;  2GOW A;  2DFK A;  3E9L A;  2R2O A;  1KZ7 A;  2H7D A;  1EVH A;  4IAP A;  3V60 A;  4LDT B;  1Y19 B;  3V6E B;  1ZGU B;  2CY4 A;  1WR6 E;  4M0W B;  4FN2 A;  4MEL A;  2UWQ A;  1P98 A;  4K17 A;  3AU4 A;  3ML9 A;  4K7W A;  1MKE A;  1WMH B;  4PNK A;  2CQU A;  2O2V A;  3PG7 A;  1XD4 A;  3PRM B;  3PLV A;  3DVN V;  4LJP B;  1LW3 A;  1V81 A;  2KX3 A;  2DYM A;  2OOB B;  2KLC A;  5KQ1 A;  2DX5 B;  2WX1 A;  1HB8 A;  5JZE B;  4ICU A;  5EDS A;  1WX9 A;  2D4Q A;  3ALB A;  3UQA A;  5D6J B;  2VSZ A;  1P9D U;  3M63 B;  1RFA A;  2OJR A;  1WJ6 A;  1WM2 A;  4KAX B;  4DK5 A;  4BBN C;  4J6I A;  4MK0 A;  4IWQ A;  5C16 A;  3L10 B;  1WXM A;  4FHK A;  3A4S C;  3L13 A;  2KTR A;  4KDL B;  3Q3F A;  4IUM B;  2D9W A;  2Y7B A;  4GSW A;  3ULB A;  2UYZ B;  3KUC B;  3PGE A;  1ZKH A;  3NSU A;  3RCZ A;  1R4M I;  1P3Q U;  2YRY A;  1OQY A;  1NI2 A;  4G3X B;  1PMS A;  4WWO A;  4GDK B;  2IY0 B;  4EUT A;  4FUL A;  4BBN F;  4TQ1 A;  4HB4 B;  1Q5W B;  2LGD A;  2JP2 A;  1WIA A;  2GCL A;  3KH0 A;  2RGF A;  1U5E A;  4KIK B;  4FHJ A;  4JK9 A;  2IYD B;  2HTH A;  3FSS A;  4HAU B;  1P0R A;  2FCM A;  2M38 A;  1WGQ A;  2D9X A;  3HW2 B;  3H7P A;  4K7U A;  4DHJ D;  2B3A A;  2BF8 B;  1HBK A;  4A6F A;  1V88 A;  3ZVR A;  3W1Y A;  1SE9 A;  2LVP A;  2P0H A;  4GOC A;  3RUL A;  1X1M A;  2CKH B;  3PLU A;  2FDQ A;  5LLI A;  3NZS A;  2GS0 A;  2BYE A;  4KSL C;  5JHB A;  2MWN B;  4ZRI A;  4KHA A;  3OAW A;  1MIX A;  3MHS D;  3TFM A;  1FB8 A;  3VQI A;  2EC1 A;  2LRW A;  2KJR A;  4IC7 B;  3VDZ A;  3PZD A;  3MTN B;  3P6A A;  2KC2 A;  4OVV A;  3RYT A;  2LGY A;  3U30 A;  1DRO A;  3WAP A;  3VVW B;  2ZVO A;  2DTC A;  2NPT A;  4X57 B;  1RAX A;  2N9X A;  4IM2 A;  4GMV A;  4MEM A;  3W1S C;  4DHZ B;  2FNJ B;  1OQN A;  3ONS A;  1UNP A;  2KKC A;  1IPG A;  5E6N A;  3KVF B;  4OVU A;  4KHB B;  1P3R A;  3V6C B;  3EFU A;  4PS8 A;  4GZU A;  4Z2N A;  2REX A;  3ZNI D;  5J3Q A;  1VCB A;  4M8M A;  3APC A;  3E66 A;  3PS6 A;  2KWU B;  4I6N B;  3L17 A;  2BYF A;  2PEA A;  4G50 A;  3F5R A;  5D7G A;  3O96 A;  2I1J A;  3ENE A;  1J0W A;  1Y5O A;  2DYO A;  3QX1 A;  5J3Y A;  4CHJ A;  2MP2 B;  3D8D A;  2HE7 A;  1ACA A;  5BO4 B;  2L2I A;  2I5C A;  2NS5 A;  2K6Q A;  3JW0 X;  1XD3 B;  4EMO A;  2VRR B;  1P5T A;  3A9J B;  4F7U P;  3JYU A;  3NZU A;  4HAX B;  1MPH A;  1Q67 A;  3PV1 A;  3ULC A;  1AWE A;  4LJO B;  2M14 A;  4MGY E;  3F0W A;  4CHK A;  1CMX B;  2GCJ A;  3TJP A;  4IM0 A;  3H6N A;  2IBI B;  3MPX A;  1B55 A;  4W9K A;  1OY2 A;  2MBO A;  2FAZ A;  3E9P A;  3K9O B;  1WJM A;  5AEK B;  4HK2 A;  4HAW B;  4ILJ A;  2Y8F A;  5D27 A;  1UBQ A;  2LYD A;  1EUV B;  3E9O A;  4PYU A;  2XBB C;  2BYV E;  4DXA B;  3B08 A;  5IA7 A;  5C1Z A;  2ZPY A;  5CHF A;  2EKE C;  3TIX A;  4B6W A;  2MW5 A;  3H9D A;  3ZRF A;  4W9I A;  1MG8 A;  2LRU A;  2K2J A;  2YF0 A;  3S2A A;  3C0R B;  5LXI B;  3ECI A;  1V5P A;  2PE6 B;  1M7E A;  2LD9 A;  5FI0 A;  2EJ8 A;  3SBT A;  2IO0 B;  2AEH A;  2GMI C;  2KAN A;  2DLW A;  2KD0 A;  3SBG A;  3U7D A;  2A5U A;  3VUX A;  4F1S A;  4FBJ B;  4MY6 A;  4HDQ A;  3KY9 A;  3R66 C;  2OQB A;  1BTK A;  4HXD A;  3DVG Y;  1GGO A;  4P7I A;  1GUA B;  3PVL A;  4TYZ A;  5D94 A;  2COA A;  1TJ6 A;  3ZDM C;  4GPT B;  1OEY A;  1WX8 A;  1WI1 A;  3H7P B;  5IAA C;  3AJ4 A;  4MH0 E;  4I6P A;  1OMW A;  1U2B A;  5D3W A;  5C6R A;  2X0S A;  4WJN A;  2DZM A;  3G9W A;  2NVU I;  2RR9 A;  2KVR A;  2CY5 A;  4F8C B;  3HM3 A;  1IYF A;  4BKS A;  2JT4 B;  4HAT B;  2LXA A;  2KFJ A;  1VD2 A;  2RPQ A;  4HVB A;  4KV2 A;  2UVM A;  2D2Q A;  3X23 A;  3L16 A;  4AWJ A;  3PRP B;  3VTV A;  4MM3 A;  3DBS A;  4FA6 A;  1FOE A;  2FJL A;  1WM3 A;  2KWV B;  4W9C A;  3QJZ A;  2LI5 A;  4H8S A;  4B95 A;  3ZO5 B;  2Z0D B;  2D9Z A;  1NTI A;  4A3P A;  5E6P A;  2IY1 B;  2KZR A;  3IHP C;  1GNU A;  2LAS A;  2YVC A;  3QAQ A;  2NBV B;  3ML4 A;  4KSK C;  3VTU A;  2W2W A;  4EFO A;  1DDM A;  4DBG A;  3L54 A;  2KDI A;  1ZW7 A;  2N0Y A;  3IG3 A;  3SV1 A;  3QWM A;  1LFD A;  5DPS A;  1GJZ A;  3ENB A;  3N30 A;  2P8V A;  4WVF B;  3TW1 A;  2DEN B;  3WAO A;  3SUZ A;  5E6O A;  2ELB A;  4FJZ A;  2YT1 A;  3HM6 X;  2KN5 A;  2WX0 A;  1ZVR A;  3VUW A;  4F7H A;  1FHO A;  2FCN A;  5C5B B;  1WGG A;  2UZR A;  4II2 B;  2LOZ A;  1E8X A;  3VH3 B;  3WIM A;  2C7H A;  4ZDV A;  1WRD B;  3EPY A;  2RLO A;  4AUQ C;  2ZVN A;  1NTY A;  2COF A;  1JDE A;  5L81 A;  5DIF B;  1N3H A;  1YX6 B;  2L05 A;  2KDB A;  4II3 B;  3V61 A;  2COC A;  2NBW B;  4ANW A;  1V5U A;  4MT7 A;  5IJM A;  2IO3 B;  3DXE A;  2KHW B;  5D3Y A;  3L0W B;  3RD2 A;  3RUI B;  3RZF A;  1WG7 A;  1KBL A;  4G0N B;  1ISN A;  2J0M A;  2R2Q A;  4LDT D;  2NZ8 B;  4JKC A;  3NHE B;  2CB8 A;  1W1G A;  3H7S A;  4FJY A;  1HB6 A;  4CYE A;  2XK5 B;  2N4F A;  5JHA A;  3PEG A;  1G6J A;  2ZCB A;  4WJP A;  3M1I B;  1V5T A;  2JVC A;  2ZNV B;  3VFK A;  1WMH A;  1KI1 B;  2DKP A;  5DHA B;  2BWE S;  2DZJ A;  2NCN A;  2K00 A;  5HE3 A;  1SHC A;  1MIZ B;  2OTX A;  5AZF A;  4EOY A;  4EKU A;  2JWZ A;  4DX9 0;  3B1L X;  1WJU A;  2X18 A;  3ODW A;  1WXS A;  4PYZ A;  1WY8 A;  1PFJ A;  5EFX A;  3CXB B;  5CTR C;  1C3T A;  1U29 A;  1OTR B;  2YS5 A;  3P7Z A;  4A20 A;  2ZZP B;  4HPM B;  4EZK A;  3V62 A;  4Z2M B;  2LUE A;  1MK9 B;  4WQO B;  1P1A A;  3JSV B;  2Z0Q A;  2PJH A;  1D3Z A;  5C5B A;  3PVU A;  1J8C A;  4MJS B;  3FP5 A;  3PSC A;  1ZC3 B;  4HAZ B;  2L7R A;  2M0X A;  3CST A;  4IW0 A;  2QKL A;  2L8J A;  2I5F A;  1EF1 A;  1X86 A;  3A4R A;  3PTF C;  5DPW A;  4A6K A;  3PHW B;  1V89 A;  3VIA A;  5DCN A;  2DHI A;  3APF A;  4YON A;  2IFS A;  5DH9 B;  2C7N B;  3KRW A;  1E7U A;  4YL8 A;  3N7C A;  1WGD A;  2IYB A;  5DI9 B;  4G11 A;  3UIP B;  2ADZ A;  2BGF A;  4BOS C;  1UPR A;  3UZT A;  2MKR A;  4ZRK A;  2N1V A;  2R0D A;  1P6S A;  4HWI B;  2JZ3 B;  5FI1 A;  2LKO A;  3DVN U;  5FR6 A;  3A1Q B;  2RVB B;  4TUU A;  1V49 A;  4W9J A;  2GBN A;  4LCD E;  5GMV A;  3VAW A;  3GOE A;  2ASQ A;  4GN1 A;  2KNB A;  5JHH A;  4ANX A;  4KVG B;  3BY4 B;  3PHX B;  2LG1 A;  3B0A A;  2YS1 A;  4TKN A;  2YT0 A;  2XQN M;  2KTF A;  3KZ1 A;  5JVL A;  2LVO A;  4EJN A;  4DDG D;  3I3T B;  2P0F A;  3CIK A;  1X11 A;  3SNH A;  3RT3 B;  2DKQ A;  2P0D A;  2KC1 A;  1JRU A;  4KIK A;  2J7Q B;  3A8Q A;  1UNQ A;  1K5D B;  5C79 A;  4W9H A;  2LUL A;  1TQZ A;  1QQG A;  2COP A;  3OLM D;  2EMS A;  1OGW A;  3ZIM A;  4KDI C;  4HAV B;  1X1F A;  3CSF A;  3DXD A;  1I7A A;  3VHT C;  5JHG A;  2KTR B;  2HD5 B;  1Q1O A;  4FAD A;  4WJQ A;  3SHQ A;  2ELA A;  2QKM A;  1ZSQ A;  2L0F A;  3GYO A;  3HHM A;  4GIV A;  3QHT A;  2A4Z A;  2R09 A;  1EO6 A;  1E7V A;  3ML8 A;  1SIF A;  3A9J A;  3O65 B;  4XZ4 A;  1GC7 A;  2RNR B;  4IG7 B;  4XX5 A;  3MJW A;  2L76 A;  2KFK B;  2QHO A;  4JKE A;  2MLB A;  2W9N A;  2L0T A;  1WE6 A;  3ZLZ A;  3APD A;  3VOQ A;  3D32 A;  2CRF A;  4GDL B;  1L7Y A;  3OJ4 B;  4ILH A;  1I42 A;  4HB3 B;  3DBH I;  1KLV A;  2L3Z A;  5CHV C;  4NSW A;  1U5F A;  3D8F A;  4N9F 4;  4BKG A;  2MSE D;  1WJN A;  1SGH A;  4A3O A;  4HLE A;  1YJ1 A;  2V4L A;  1L2N A;  2W2X C;  1WZ3 A;  4ZRJ A;  1GC6 A;  4WAA A;  1R4N I;  1DDW A;  2LJ5 A;  2DYB A;  5TR5 A;  3IFW B;  1TTN A;  3DPD A;  1VBH A;  2RQ1 A;  1WFY A;  4GXB A;  1DIK A;  3HK0 A;  4HCP B;  2KDE B;  1KJT A;  5HKH A;  1WX7 A;  4JKA A;  4BKT A;  2LWP A;  1PLS A;  1WJ1 A;  2BWF A;  4XC2 A;  1HE8 A;  3DQV A;  5J18 A;  3D8E A;  2W2X D;  2BCJ A;  2DN6 A;  2GBK A;  4NJ6 A;  1QZE A;  3UGB B;  4KZC A;  4JIO U;  1WYW B;  4CO7 A;  5JLJ B;  3EC8 A;  2DYN A;  2RSG A;  2KFK A;  2N7D A;  2Y8G A;  2LVQ A;  5CHW A;  4MDK E;  1ST7 A;  1RLF A;  2KOX A;  2H7E A;  5DHF B;  2MX2 A;  3UIO B;  2LOX A;  5D3X A;  3DOW A;  3R7Q A;  1K8R B;  1QC6 A;  2RD0 A;  5CX3 A;  1RJ2 A;  4DDI D;  3N3K B;  2CHX A;  5KCV A;  2D9V A;  1LB1 A;  3ZKJ C;  2AL3 A;  2J0K A;  1M94 A;  1YQB A;  4F7G A;  2WYQ A;  3ZNH B;  2N23 A;  2V3S A;  1NDD A;  2ABD A;  1X1G A;  4ANU A;  2AWT A;  2WWZ A;  3ZW3 A;  5JP4 A;  3ZVV A;  1FGZ A;  2J0J A;  3QBV B;  1WGU A;  2VKI A;  4IM3 A;  1TBE A;  1XX0 A;  4DBB A;  2MBB B;  3UIN B;  4URK A;  3KSY A;  1BWN A;  5J3T A;  4NAW B;  4JKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...