3EPYA

Crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Acyl-CoA-binding domain-containing protein 7
total genus 30
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3epyA00
2AEHA 2EMSA 1J19A 4ZRIA 2CB8A 2I1KA 1EF1A 4HDOA 3PZDA 2FDQA 1ACAA 3PVLA 2EMTA 1ISNA 1MIZB 1HB8A 1MK9B 2HE7A 1ST7A 3AU4A 2RQ1A 3U7DA 2J0KA 2D2QA 4EKUA 1GC7A 3IVFA 3ZDTA 2WH5A 4HDQA 2YVCA 2J0JA 2ZPYA 1E5WA 1MIXA 1HB6A 3X23A 5IJMA 3FLVA 2CQUA 1NTIA 3FP5A 3G9WA 4ZRJA 1MK7B 2AL6A 4CYEA 1H4RA 2D10A 2LBBA 3QIJA 4P7IA 2HRJA 2I1JA 3WA0A 1SGHA 2D11A 3U8ZA 1NI2A 4F7GA 1GC6A 4ZRKA 3EPYA 2J0MA 2COPA 1HBKA 2ABDA 1NVLA 4NY0A 4DXAB 1GG3A 2FJ9A 3BINA 1Y19B 4YL8A 3AU5A
chains in the Genus database with same CATH superfamily
4ILGB 4HDOA 3PVLA 2EMTA 1MIZB 1MK9B 2D2QA 2R82A 4GXBA 3E9LA 3ZDTA 2ZPYA 1MIXA 1HB6A 2CQUA 1NTIA 1GGOA 3E66A 3QIJA 4JKAA 1SGHA 3U8ZA 1GC6A 4ZRKA 4JK7A 2ABDA 4ZRIA 2CB8A 5JVLA 3PZDA 1ACAA 4JKGB 1ST7A 4JKEA 1JDEA 2RQ1A 2J0KA 3SBTA 3IVFA 2WH5A 1VBHA 3FP5A 2I1JA 4TKNA 3EPYA 2J0MA 4ILJA 3ENBA 3E9PA 4P7IA 4JKBA 4YL8A 2AEHA 2EMSA 1J19A 3E9OA 2I1KA 1EF1A 3SBGA 1KBLA 1ISNA 3AU4A 1KC7A 1DIKA 4EKUA 4HDQA 5IJMA 1MK7B 4CYEA 2D10A 2DIKA 4JKCA 2HRJA 2D11A 4JKFA 1NI2A 2COPA 1HBKA 4NY0A 4DXAB 1GG3A 3BINA 1Y19B 4ZRJA 3AU5A 4JK8A 4ILHA 1VBGA 2FDQA 4JKHA 4JKGA 2X0SA 1HB8A 2HE7A 3U7DA 4JKDA 1GC7A 2YVCA 2J0JA 1E5WA 3X23A 4JK9A 3FLVA 3G9WA 2AL6A 1H4RA 2LBBA 3WA0A 4F7GA 1NVLA 2FJ9A
chains in the Genus database with same CATH topology
4ILGB 4HDOA 3PVLA 2EMTA 1MIZB 1MK9B 2D2QA 2R82A 4GXBA 3E9LA 3ZDTA 2ZPYA 1MIXA 1HB6A 2CQUA 1NTIA 1GGOA 3E66A 3QIJA 4JKAA 1SGHA 3U8ZA 1GC6A 4ZRKA 4JK7A 2ABDA 4ZRIA 2CB8A 5JVLA 3PZDA 1ACAA 4JKGB 1ST7A 4JKEA 1JDEA 2RQ1A 2J0KA 3SBTA 3IVFA 2WH5A 1VBHA 3FP5A 2I1JA 4TKNA 3EPYA 2J0MA 4ILJA 3ENBA 3E9PA 4P7IA 4JKBA 4YL8A 2AEHA 2EMSA 1J19A 3E9OA 2I1KA 1EF1A 3SBGA 1KBLA 1ISNA 3AU4A 1KC7A 1DIKA 4EKUA 4HDQA 5IJMA 1MK7B 4CYEA 2D10A 2DIKA 4JKCA 2HRJA 2D11A 4JKFA 1NI2A 2COPA 1HBKA 4NY0A 4DXAB 1GG3A 3BINA 1Y19B 4ZRJA 3AU5A 4JK8A 4ILHA 1VBGA 2FDQA 4JKHA 4JKGA 2X0SA 1HB8A 2HE7A 3U7DA 4JKDA 1GC7A 2YVCA 2J0JA 1E5WA 3X23A 4JK9A 3FLVA 3G9WA 2AL6A 1H4RA 2LBBA 3WA0A 4F7GA 1NVLA 2FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  2EMS A;  1J19 A;  4ZRI A;  2CB8 A;  2I1K A;  1EF1 A;  4HDO A;  3PZD A;  2FDQ A;  1ACA A;  3PVL A;  2EMT A;  1ISN A;  1MIZ B;  1HB8 A;  1MK9 B;  2HE7 A;  1ST7 A;  3AU4 A;  2RQ1 A;  3U7D A;  2J0K A;  2D2Q A;  4EKU A;  1GC7 A;  3IVF A;  3ZDT A;  2WH5 A;  4HDQ A;  2YVC A;  2J0J A;  2ZPY A;  1E5W A;  1MIX A;  1HB6 A;  3X23 A;  5IJM A;  3FLV A;  2CQU A;  1NTI A;  3FP5 A;  3G9W A;  4ZRJ A;  1MK7 B;  2AL6 A;  4CYE A;  1H4R A;  2D10 A;  2LBB A;  3QIJ A;  4P7I A;  2HRJ A;  2I1J A;  3WA0 A;  1SGH A;  2D11 A;  3U8Z A;  1NI2 A;  4F7G A;  1GC6 A;  4ZRK A;  3EPY A;  2J0M A;  2COP A;  1HBK A;  2ABD A;  1NVL A;  4NY0 A;  4DXA B;  1GG3 A;  2FJ9 A;  3BIN A;  1Y19 B;  4YL8 A;  3AU5 A; 
#chains in the Genus database with same CATH topology
 4ILG B;  4HDO A;  3PVL A;  2EMT A;  1MIZ B;  1MK9 B;  2D2Q A;  2R82 A;  4GXB A;  3E9L A;  3ZDT A;  2ZPY A;  1MIX A;  1HB6 A;  2CQU A;  1NTI A;  1GGO A;  3E66 A;  3QIJ A;  4JKA A;  1SGH A;  3U8Z A;  1GC6 A;  4ZRK A;  4JK7 A;  2ABD A;  4ZRI A;  2CB8 A;  5JVL A;  3PZD A;  1ACA A;  4JKG B;  1ST7 A;  4JKE A;  1JDE A;  2RQ1 A;  2J0K A;  3SBT A;  3IVF A;  2WH5 A;  1VBH A;  3FP5 A;  2I1J A;  4TKN A;  3EPY A;  2J0M A;  4ILJ A;  3ENB A;  3E9P A;  4P7I A;  4JKB A;  4YL8 A;  2AEH A;  2EMS A;  1J19 A;  3E9O A;  2I1K A;  1EF1 A;  3SBG A;  1KBL A;  1ISN A;  3AU4 A;  1KC7 A;  1DIK A;  4EKU A;  4HDQ A;  5IJM A;  1MK7 B;  4CYE A;  2D10 A;  2DIK A;  4JKC A;  2HRJ A;  2D11 A;  4JKF A;  1NI2 A;  2COP A;  1HBK A;  4NY0 A;  4DXA B;  1GG3 A;  3BIN A;  1Y19 B;  4ZRJ A;  3AU5 A;  4JK8 A;  4ILH A;  1VBG A;  2FDQ A;  4JKH A;  4JKG A;  2X0S A;  1HB8 A;  2HE7 A;  3U7D A;  4JKD A;  1GC7 A;  2YVC A;  2J0J A;  1E5W A;  3X23 A;  4JK9 A;  3FLV A;  3G9W A;  2AL6 A;  1H4R A;  2LBB A;  3WA0 A;  4F7G A;  1NVL A;  2FJ9 A; 
#chains in the Genus database with same CATH homology
 4ILG B;  4HDO A;  3PVL A;  2EMT A;  1MIZ B;  1MK9 B;  2D2Q A;  2R82 A;  4GXB A;  3E9L A;  3ZDT A;  2ZPY A;  1MIX A;  1HB6 A;  2CQU A;  1NTI A;  1GGO A;  3E66 A;  3QIJ A;  4JKA A;  1SGH A;  3U8Z A;  1GC6 A;  4ZRK A;  4JK7 A;  2ABD A;  4ZRI A;  2CB8 A;  5JVL A;  3PZD A;  1ACA A;  4JKG B;  1ST7 A;  4JKE A;  1JDE A;  2RQ1 A;  2J0K A;  3SBT A;  3IVF A;  2WH5 A;  1VBH A;  3FP5 A;  2I1J A;  4TKN A;  3EPY A;  2J0M A;  4ILJ A;  3ENB A;  3E9P A;  4P7I A;  4JKB A;  4YL8 A;  2AEH A;  2EMS A;  1J19 A;  3E9O A;  2I1K A;  1EF1 A;  3SBG A;  1KBL A;  1ISN A;  3AU4 A;  1KC7 A;  1DIK A;  4EKU A;  4HDQ A;  5IJM A;  1MK7 B;  4CYE A;  2D10 A;  2DIK A;  4JKC A;  2HRJ A;  2D11 A;  4JKF A;  1NI2 A;  2COP A;  1HBK A;  4NY0 A;  4DXA B;  1GG3 A;  3BIN A;  1Y19 B;  4ZRJ A;  3AU5 A;  4JK8 A;  4ILH A;  1VBG A;  2FDQ A;  4JKH A;  4JKG A;  2X0S A;  1HB8 A;  2HE7 A;  3U7D A;  4JKD A;  1GC7 A;  2YVC A;  2J0J A;  1E5W A;  3X23 A;  4JK9 A;  3FLV A;  3G9W A;  2AL6 A;  1H4R A;  2LBB A;  3WA0 A;  4F7G A;  1NVL A;  2FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...