3EPYA

Crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding domain-containing protein 7
publication title Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 30
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3epyA00
1MK7B 2FDQA 2LBBA 3BINA 2J0JA 2I1KA 1SGHA 2HRJA 3FP5A 2CB8A 3EPYA 2J0MA 1HB6A 1ST7A 2RQ1A 1GC6A 1NTIA 1Y19B 4F7GA 2HE7A 3FLVA 2YVCA 1ACAA 1EF1A 1MK9B 1J19A 1H4RA 1HBKA 3G9WA 4ZRIA 3X23A 2CQUA 1MIXA 1E5WA 1HB8A 2ZPYA 3AU5A 4NY0A 4P7IA 4YL8A 3AU4A 4HDQA 4ZRJA 3PVLA 3WA0A 3U8ZA 3ZDTA 2ABDA 4DXAB 2D10A 2EMSA 2I1JA 2D11A 4EKUA 4ZRKA 1MIZB 3U7DA 4CYEA 3IVFA 2WH5A 4HDOA 1ISNA 5IJMA 1GG3A 2J0KA 2AL6A 3QIJA 1GC7A 2COPA 2AEHA 2D2QA 2FJ9A 3PZDA 2EMTA 1NI2A 1NVLA
chains in the Genus database with same CATH superfamily
4JKFA 2LBBA 3BINA 2I1KA 1SGHA 3EPYA 1HB6A 1ST7A 2RQ1A 1GC6A 1Y19B 5JVLA 1ACAA 1H4RA 1HBKA 3G9WA 4JKHA 4ZRIA 3X23A 3E9LA 3ZDTA 4DXAB 2D10A 2I1JA 1MIZB 4CYEA 4ILGB 4HDOA 1GC7A 1NI2A 1MK7B 2J0JA 2HRJA 4F7GA 2HE7A 1GGOA 3E9PA 4YL8A 1MIXA 3AU5A 1HB8A 2ZPYA 4NY0A 4GXBA 4ZRJA 3AU4A 4HDQA 3PVLA 2EMSA 2WH5A 4JKAA 2FDQA 1KC7A 4JKDA 3FP5A 2CB8A 1VBGA 2J0MA 3ENBA 1JDEA 3SBTA 2X0SA 3E66A 3SBGA 1NTIA 3FLVA 2YVCA 1EF1A 1MK9B 1J19A 1VBHA 4P7IA 3WA0A 3U8ZA 2ABDA 2DIKA 1KBLA 2R82A 5IJMA 1GG3A 4JKGA 2COPA 3PZDA 4JKBA 1NVLA 4JKEA 4JKGB 4JK9A 4ILHA 4ILJA 2CQUA 1E5WA 2D11A 4EKUA 1DIKA 4ZRKA 3U7DA 3IVFA 1ISNA 4JK7A 3E9OA 2J0KA 2AL6A 3QIJA 4JK8A 2AEHA 2D2QA 2FJ9A 4JKCA 2EMTA 4TKNA
chains in the Genus database with same CATH topology
4JKFA 2LBBA 3BINA 2I1KA 1SGHA 3EPYA 1HB6A 1ST7A 2RQ1A 1GC6A 1Y19B 5JVLA 1ACAA 1H4RA 1HBKA 3G9WA 4JKHA 4ZRIA 3X23A 3E9LA 3ZDTA 4DXAB 2D10A 2I1JA 1MIZB 4CYEA 4ILGB 4HDOA 1GC7A 1NI2A 1MK7B 2J0JA 2HRJA 4F7GA 2HE7A 1GGOA 3E9PA 4YL8A 1MIXA 3AU5A 1HB8A 2ZPYA 4NY0A 4GXBA 4ZRJA 3AU4A 4HDQA 3PVLA 2EMSA 2WH5A 4JKAA 2FDQA 1KC7A 4JKDA 3FP5A 2CB8A 1VBGA 2J0MA 3ENBA 1JDEA 3SBTA 2X0SA 3E66A 3SBGA 1NTIA 3FLVA 2YVCA 1EF1A 1MK9B 1J19A 1VBHA 4P7IA 3WA0A 3U8ZA 2ABDA 2DIKA 1KBLA 2R82A 5IJMA 1GG3A 4JKGA 2COPA 3PZDA 4JKBA 1NVLA 4JKEA 4JKGB 4JK9A 4ILHA 4ILJA 2CQUA 1E5WA 2D11A 4EKUA 1DIKA 4ZRKA 3U7DA 3IVFA 1ISNA 4JK7A 3E9OA 2J0KA 2AL6A 3QIJA 4JK8A 2AEHA 2D2QA 2FJ9A 4JKCA 2EMTA 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK7 B;  2FDQ A;  2LBB A;  3BIN A;  2J0J A;  2I1K A;  1SGH A;  2HRJ A;  3FP5 A;  2CB8 A;  3EPY A;  2J0M A;  1HB6 A;  1ST7 A;  2RQ1 A;  1GC6 A;  1NTI A;  1Y19 B;  4F7G A;  2HE7 A;  3FLV A;  2YVC A;  1ACA A;  1EF1 A;  1MK9 B;  1J19 A;  1H4R A;  1HBK A;  3G9W A;  4ZRI A;  3X23 A;  2CQU A;  1MIX A;  1E5W A;  1HB8 A;  2ZPY A;  3AU5 A;  4NY0 A;  4P7I A;  4YL8 A;  3AU4 A;  4HDQ A;  4ZRJ A;  3PVL A;  3WA0 A;  3U8Z A;  3ZDT A;  2ABD A;  4DXA B;  2D10 A;  2EMS A;  2I1J A;  2D11 A;  4EKU A;  4ZRK A;  1MIZ B;  3U7D A;  4CYE A;  3IVF A;  2WH5 A;  4HDO A;  1ISN A;  5IJM A;  1GG3 A;  2J0K A;  2AL6 A;  3QIJ A;  1GC7 A;  2COP A;  2AEH A;  2D2Q A;  2FJ9 A;  3PZD A;  2EMT A;  1NI2 A;  1NVL A; 
#chains in the Genus database with same CATH topology
 4JKF A;  2LBB A;  3BIN A;  2I1K A;  1SGH A;  3EPY A;  1HB6 A;  1ST7 A;  2RQ1 A;  1GC6 A;  1Y19 B;  5JVL A;  1ACA A;  1H4R A;  1HBK A;  3G9W A;  4JKH A;  4ZRI A;  3X23 A;  3E9L A;  3ZDT A;  4DXA B;  2D10 A;  2I1J A;  1MIZ B;  4CYE A;  4ILG B;  4HDO A;  1GC7 A;  1NI2 A;  1MK7 B;  2J0J A;  2HRJ A;  4F7G A;  2HE7 A;  1GGO A;  3E9P A;  4YL8 A;  1MIX A;  3AU5 A;  1HB8 A;  2ZPY A;  4NY0 A;  4GXB A;  4ZRJ A;  3AU4 A;  4HDQ A;  3PVL A;  2EMS A;  2WH5 A;  4JKA A;  2FDQ A;  1KC7 A;  4JKD A;  3FP5 A;  2CB8 A;  1VBG A;  2J0M A;  3ENB A;  1JDE A;  3SBT A;  2X0S A;  3E66 A;  3SBG A;  1NTI A;  3FLV A;  2YVC A;  1EF1 A;  1MK9 B;  1J19 A;  1VBH A;  4P7I A;  3WA0 A;  3U8Z A;  2ABD A;  2DIK A;  1KBL A;  2R82 A;  5IJM A;  1GG3 A;  4JKG A;  2COP A;  3PZD A;  4JKB A;  1NVL A;  4JKE A;  4JKG B;  4JK9 A;  4ILH A;  4ILJ A;  2CQU A;  1E5W A;  2D11 A;  4EKU A;  1DIK A;  4ZRK A;  3U7D A;  3IVF A;  1ISN A;  4JK7 A;  3E9O A;  2J0K A;  2AL6 A;  3QIJ A;  4JK8 A;  2AEH A;  2D2Q A;  2FJ9 A;  4JKC A;  2EMT A;  4TKN A; 
#chains in the Genus database with same CATH homology
 4JKF A;  2LBB A;  3BIN A;  2I1K A;  1SGH A;  3EPY A;  1HB6 A;  1ST7 A;  2RQ1 A;  1GC6 A;  1Y19 B;  5JVL A;  1ACA A;  1H4R A;  1HBK A;  3G9W A;  4JKH A;  4ZRI A;  3X23 A;  3E9L A;  3ZDT A;  4DXA B;  2D10 A;  2I1J A;  1MIZ B;  4CYE A;  4ILG B;  4HDO A;  1GC7 A;  1NI2 A;  1MK7 B;  2J0J A;  2HRJ A;  4F7G A;  2HE7 A;  1GGO A;  3E9P A;  4YL8 A;  1MIX A;  3AU5 A;  1HB8 A;  2ZPY A;  4NY0 A;  4GXB A;  4ZRJ A;  3AU4 A;  4HDQ A;  3PVL A;  2EMS A;  2WH5 A;  4JKA A;  2FDQ A;  1KC7 A;  4JKD A;  3FP5 A;  2CB8 A;  1VBG A;  2J0M A;  3ENB A;  1JDE A;  3SBT A;  2X0S A;  3E66 A;  3SBG A;  1NTI A;  3FLV A;  2YVC A;  1EF1 A;  1MK9 B;  1J19 A;  1VBH A;  4P7I A;  3WA0 A;  3U8Z A;  2ABD A;  2DIK A;  1KBL A;  2R82 A;  5IJM A;  1GG3 A;  4JKG A;  2COP A;  3PZD A;  4JKB A;  1NVL A;  4JKE A;  4JKG B;  4JK9 A;  4ILH A;  4ILJ A;  2CQU A;  1E5W A;  2D11 A;  4EKU A;  1DIK A;  4ZRK A;  3U7D A;  3IVF A;  1ISN A;  4JK7 A;  3E9O A;  2J0K A;  2AL6 A;  3QIJ A;  4JK8 A;  2AEH A;  2D2Q A;  2FJ9 A;  4JKC A;  2EMT A;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...