3EPYA

Crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding domain-containing protein 7
molecule tags Lipid binding protein
source organism Homo sapiens
publication title Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa
rcsb
total genus 30
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3epyA00
2D10A 2I1KA 2J0JA 1ISNA 4ZRKA 2HRJA 2WH5A 2CQUA 3FP5A 4ZRIA 3PVLA 1NVLA 1MK7B 4HDOA 2EMSA 4HDQA 2I1JA 4F7GA 2ABDA 4ZRJA 2RQ1A 3G9WA 2EMTA 2AL6A 2YVCA 1MK9B 1MIXA 3FLVA 1J19A 1GG3A 1HB6A 3IVFA 3PZDA 3ZDTA 1Y19B 3WA0A 1ST7A 1E5WA 2AEHA 2LBBA 1GC6A 3AU4A 4YL8A 1H4RA 4EKUA 4CYEA 1NTIA 1EF1A 2CB8A 2COPA 2FJ9A 3AU5A 3QIJA 1MIZB 2FDQA 1NI2A 2J0MA 4DXAB 5IJMA 1ACAA 1HB8A 1GC7A 3X23A 2ZPYA 3U7DA 3U8ZA 2D2QA 2HE7A 1SGHA 3BINA 4NY0A 4P7IA 3EPYA 1HBKA 2D11A 2J0KA
chains in the Genus database with same CATH superfamily
2I1KA 4ILGB 1VBHA 2CQUA 3FP5A 1NVLA 4HDQA 4JKAA 4F7GA 4JKCA 2EMTA 3E9OA 1KC7A 2YVCA 1GG3A 1HB6A 3WA0A 4JK9A 4EKUA 1NTIA 2FJ9A 3QIJA 2FDQA 1NI2A 2HE7A 4P7IA 4JKBA 1HBKA 2J0KA 2D10A 1ISNA 2HRJA 4JKFA 1MK7B 5JVLA 3FLVA 1J19A 4JK7A 1E5WA 1ST7A 4YL8A 1GC6A 3AU4A 1JDEA 2DIKA 1GGOA 2COPA 2CB8A 3AU5A 4DXAB 1ACAA 1MIZB 4JKEA 3E66A 2ZPYA 3U7DA 2D2QA 3SBGA 3EPYA 2J0JA 4JKHA 4ZRKA 4ILHA 3SBTA 2WH5A 4ZRIA 4JKDA 2EMSA 2I1JA 4ZRJA 2RQ1A 3G9WA 4GXBA 3ZDTA 3PZDA 3E9PA 1Y19B 3E9LA 2AEHA 1VBGA 4CYEA 4HDOA 2X0SA 4TKNA 5IJMA 4ILJA 3X23A 3U8ZA 3BINA 1SGHA 4NY0A 2J0MA 2D11A 3PVLA 4JK8A 4JKGB 2ABDA 2R82A 2AL6A 1MK9B 1MIXA 3IVFA 2LBBA 1H4RA 4JKGA 1EF1A 1DIKA 1HB8A 1GC7A 3ENBA 1KBLA
chains in the Genus database with same CATH topology
2I1KA 4ILGB 1VBHA 2CQUA 3FP5A 1NVLA 4HDQA 4JKAA 4F7GA 4JKCA 2EMTA 3E9OA 1KC7A 2YVCA 1GG3A 1HB6A 3WA0A 4JK9A 4EKUA 1NTIA 2FJ9A 3QIJA 2FDQA 1NI2A 2HE7A 4P7IA 4JKBA 1HBKA 2J0KA 2D10A 1ISNA 2HRJA 4JKFA 1MK7B 5JVLA 3FLVA 1J19A 4JK7A 1E5WA 1ST7A 4YL8A 1GC6A 3AU4A 1JDEA 2DIKA 1GGOA 2COPA 2CB8A 3AU5A 4DXAB 1ACAA 1MIZB 4JKEA 3E66A 2ZPYA 3U7DA 2D2QA 3SBGA 3EPYA 2J0JA 4JKHA 4ZRKA 4ILHA 3SBTA 2WH5A 4ZRIA 4JKDA 2EMSA 2I1JA 4ZRJA 2RQ1A 3G9WA 4GXBA 3ZDTA 3PZDA 3E9PA 1Y19B 3E9LA 2AEHA 1VBGA 4CYEA 4HDOA 2X0SA 4TKNA 5IJMA 4ILJA 3X23A 3U8ZA 3BINA 1SGHA 4NY0A 2J0MA 2D11A 3PVLA 4JK8A 4JKGB 2ABDA 2R82A 2AL6A 1MK9B 1MIXA 3IVFA 2LBBA 1H4RA 4JKGA 1EF1A 1DIKA 1HB8A 1GC7A 3ENBA 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  2I1K A;  2J0J A;  1ISN A;  4ZRK A;  2HRJ A;  2WH5 A;  2CQU A;  3FP5 A;  4ZRI A;  3PVL A;  1NVL A;  1MK7 B;  4HDO A;  2EMS A;  4HDQ A;  2I1J A;  4F7G A;  2ABD A;  4ZRJ A;  2RQ1 A;  3G9W A;  2EMT A;  2AL6 A;  2YVC A;  1MK9 B;  1MIX A;  3FLV A;  1J19 A;  1GG3 A;  1HB6 A;  3IVF A;  3PZD A;  3ZDT A;  1Y19 B;  3WA0 A;  1ST7 A;  1E5W A;  2AEH A;  2LBB A;  1GC6 A;  3AU4 A;  4YL8 A;  1H4R A;  4EKU A;  4CYE A;  1NTI A;  1EF1 A;  2CB8 A;  2COP A;  2FJ9 A;  3AU5 A;  3QIJ A;  1MIZ B;  2FDQ A;  1NI2 A;  2J0M A;  4DXA B;  5IJM A;  1ACA A;  1HB8 A;  1GC7 A;  3X23 A;  2ZPY A;  3U7D A;  3U8Z A;  2D2Q A;  2HE7 A;  1SGH A;  3BIN A;  4NY0 A;  4P7I A;  3EPY A;  1HBK A;  2D11 A;  2J0K A; 
#chains in the Genus database with same CATH topology
 2I1K A;  4ILG B;  1VBH A;  2CQU A;  3FP5 A;  1NVL A;  4HDQ A;  4JKA A;  4F7G A;  4JKC A;  2EMT A;  3E9O A;  1KC7 A;  2YVC A;  1GG3 A;  1HB6 A;  3WA0 A;  4JK9 A;  4EKU A;  1NTI A;  2FJ9 A;  3QIJ A;  2FDQ A;  1NI2 A;  2HE7 A;  4P7I A;  4JKB A;  1HBK A;  2J0K A;  2D10 A;  1ISN A;  2HRJ A;  4JKF A;  1MK7 B;  5JVL A;  3FLV A;  1J19 A;  4JK7 A;  1E5W A;  1ST7 A;  4YL8 A;  1GC6 A;  3AU4 A;  1JDE A;  2DIK A;  1GGO A;  2COP A;  2CB8 A;  3AU5 A;  4DXA B;  1ACA A;  1MIZ B;  4JKE A;  3E66 A;  2ZPY A;  3U7D A;  2D2Q A;  3SBG A;  3EPY A;  2J0J A;  4JKH A;  4ZRK A;  4ILH A;  3SBT A;  2WH5 A;  4ZRI A;  4JKD A;  2EMS A;  2I1J A;  4ZRJ A;  2RQ1 A;  3G9W A;  4GXB A;  3ZDT A;  3PZD A;  3E9P A;  1Y19 B;  3E9L A;  2AEH A;  1VBG A;  4CYE A;  4HDO A;  2X0S A;  4TKN A;  5IJM A;  4ILJ A;  3X23 A;  3U8Z A;  3BIN A;  1SGH A;  4NY0 A;  2J0M A;  2D11 A;  3PVL A;  4JK8 A;  4JKG B;  2ABD A;  2R82 A;  2AL6 A;  1MK9 B;  1MIX A;  3IVF A;  2LBB A;  1H4R A;  4JKG A;  1EF1 A;  1DIK A;  1HB8 A;  1GC7 A;  3ENB A;  1KBL A; 
#chains in the Genus database with same CATH homology
 2I1K A;  4ILG B;  1VBH A;  2CQU A;  3FP5 A;  1NVL A;  4HDQ A;  4JKA A;  4F7G A;  4JKC A;  2EMT A;  3E9O A;  1KC7 A;  2YVC A;  1GG3 A;  1HB6 A;  3WA0 A;  4JK9 A;  4EKU A;  1NTI A;  2FJ9 A;  3QIJ A;  2FDQ A;  1NI2 A;  2HE7 A;  4P7I A;  4JKB A;  1HBK A;  2J0K A;  2D10 A;  1ISN A;  2HRJ A;  4JKF A;  1MK7 B;  5JVL A;  3FLV A;  1J19 A;  4JK7 A;  1E5W A;  1ST7 A;  4YL8 A;  1GC6 A;  3AU4 A;  1JDE A;  2DIK A;  1GGO A;  2COP A;  2CB8 A;  3AU5 A;  4DXA B;  1ACA A;  1MIZ B;  4JKE A;  3E66 A;  2ZPY A;  3U7D A;  2D2Q A;  3SBG A;  3EPY A;  2J0J A;  4JKH A;  4ZRK A;  4ILH A;  3SBT A;  2WH5 A;  4ZRI A;  4JKD A;  2EMS A;  2I1J A;  4ZRJ A;  2RQ1 A;  3G9W A;  4GXB A;  3ZDT A;  3PZD A;  3E9P A;  1Y19 B;  3E9L A;  2AEH A;  1VBG A;  4CYE A;  4HDO A;  2X0S A;  4TKN A;  5IJM A;  4ILJ A;  3X23 A;  3U8Z A;  3BIN A;  1SGH A;  4NY0 A;  2J0M A;  2D11 A;  3PVL A;  4JK8 A;  4JKG B;  2ABD A;  2R82 A;  2AL6 A;  1MK9 B;  1MIX A;  3IVF A;  2LBB A;  1H4R A;  4JKG A;  1EF1 A;  1DIK A;  1HB8 A;  1GC7 A;  3ENB A;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...