4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
1R4NI 3ALBA 1FGZA 3FSSA 3FLVA 1K5DB 1GNUA 2DZMA 3DBHI 2JZZA 2PE6B 1WE7A 3DVNV 1LW3A 2N23A 1BT0A 2BKRB 3HIZA 3PTFC 3ML4A 4MT7A 5CLQB 4XZ4A 5IA7A 2GBNA 4AJYB 5J3TA 2D9ZA 2R2QA 4NPNA 2KNBA 1WJMA 3AJ4A 3DBRI 1U5GA 1TGZB 3CF6E 3DQVA 3M3JA 3L10B 2IYDB 1U27A 4M8MA 5DPRA 2WYQA 2KCJA 2YVCA 2MBOA 2CHWA 2O6VB 3GYOA 1EVHA 2DYNA 1WXAA 2LXAA 1TBEA 2M17A 3ZDMC 2I5FA 4AP4C 1V2YA 3VHTC 2P8VA 5JH5C 1MIXA 4EKUA 1WGDA 1WVHA 5G55A 4DBGA 3A8PA 4GDLB 4L6EA 5HE1A 1ZC3B 1IPGA 1W1DA 4G11A 2PEAA 2C60A 2GBJA 3TL5A 4N9F4 4GMXB 4DHJD 3RCPA 4B95A 1WGQA 3PG7A 2N7DA 2NVUI 1WJUA 3NSUA 1FB8A 3WANA 2KFKA 2PPHA 4LCDE 1XCGA 4MSQB 3LJUX 2RGFA 2ZPYA 2BKFA 2KC1A 1V89A 3D8EA 1V6EA 3L0WB 3W1SA 1WR1A 2K25A 2KQSA 3R7QA 2G45B 4DXAB 5C16A 5KQ4A 4W9KA 3JSVB 1RJ2A 1VCBA 1EGXA 2L0FA 4W9DA 2Y7BA 2K8CA 4GOCA 2NBUA 5LOPB 1V81A 2C9WB 5EFXA 1XQQA 2RGNB 1EO6A 3QARA 3TBLD 2W2WA 3TO1A 5LONB 1WGYA 4HPMB 3MPXA 1XODA 4GSWA 1U2BA 4W9HA 2LZ6A 3APCA 2CY4A 1PFJA 3PRPB 2D3GA 2I5CA 2G4DB 4GDLA 1I2HA 2AYOB 4LDTB 3L17A 1WI1A 3P7ZA 4GN1A 4MEMA 3ZUNA 4CHJA 3D8FA 1V86A 4TQ0A 1S1QB 1L2NA 1M7RA 2D9YA 4DDID 2J59M 2RSGA 3NS8A 2N7EA 1XR0B 1AQCA 1ZGUB 3K9PB 1P98A 2LWPA 2FAZA 2D07B 4E71A 2Z0PA 4K17A 1WXMA 4CHKA 4ZYNA 4WWPA 1WJ1A 3ONSA 4ANXA 4TV3A 1KZGA 4BKSD 4RMAA 3VAWA 2JXXA 2C5LC 3H9DA 4F8CB 5CTRC 1EF1A 3O65B 4JL9A 3DBLI 4W9EA 3IHPC 3KW5B 1HBKA 3I3TB 2EMSA 1WJ4A 2KK8A 4NY0A 4K1RB 4EZLA 1NU2A 2COPA 4GGQA 2L76A 5E6OA 3JSVA 1Q5WB 4ANWA 2IO1B 3SHQA 2KWCA 3JVZX 4HATB 1PLSA 1WG7A 3MTNB 3PREA 4KAXB 1NTIA 2NCNA 3ZNGC 4PS3A 1TQZA 4HAUB 1WX7A 3R3MA 2M0XA 4ZRIA 5E6PA 1WM2A 1OQYA 3OJ3A 3DVNU 1UGMA 3WAPA 3B0AA 1DDMA 4CYEA 1MAIA 2H7EA 2A4ZA 1VD2A 2C7NB 2DA0A 2ZCCA 2DFKA 3KVFB 2DENB 4W9LA 3JYUA 1Q67A 2Y8GA 2GBMA 3QBVB 2ZPNA 3QC8B 4E3CA 5C5BB 3S2AA 4Z2MB 1TTNA 4K7UA 4A6HA 1WGHA 3PP2A 5JLJB 2NR2A 3L08A 3ULCA 4FLHA 2YT0A 3DXDA 1OEYJ 2IO3B 4EUTA 1A5RA 2MDXA 3KY9A 4A6FB 4LJOB 1QZEA 2VKIA 3UQAA 2UYZB 2L0TA 1EUVB 2BYEA 3B1LX 2ABDA 4EJNA 3ML9A 2W9NA 1RRPB 4A20A 2PJHA 2ADZA 1JRUA 3HM3A 4HB3B 1V9JA 3CMMB 1HB8A 4MGKE 3RCZA 2KZRA 3X23A 1H8CA 1U5FA 3PRMB 1WI0A 4TQ1A 4IOYX 3MHSD 2KDBA 1V5OA 2MWSB 4KDLB 1WYWB 5C23A 2FCQA 3LDZE 3KSYA 2UWQA 1P0RA 2ZZPB 2GOWA 3DPDA 1KOTA 5KHQA 2DYBA 4II3B 2LG1A 2HE7A 4MJSB 1SE9A 2QKLA 3HK0A 5KQ1A 3ZVVA 2BWFA 2JWZA 2W2XD 4FJYA 3T06A 1M7EA 4JIOU 2PE9A 3NZSA 4WWNA 4MSMB 3A9JB 1W1GA 5BO4B 3X0WA 3EC8A 2G35A 3N7CA 4DHJB 2JP2A 1QQGA 1YIWA 2YF0A 3RZWC 2CAYA 2DHKA 1MIZB 1WMHA 1DBHA 4PYZA 5HE0A 2O2VA 2FDQA 4DDGD 2JF5A 3PT2B 3R7RA 3KRXA 3VUWA 3AI5A 4HAZB 3KH0A 3SO6A 3PVUA 2COAA 2L05A 3GOEA 2LYDA 4A6FA 1E8YA 4IW0A 3IFWB 2KMAA 2DN6A 3WYFB 1N3HA 3G9WA 5IAAC 1UNQA 5JHBA 2MBBB 3PLVA 1V49A 1DYNA 2K6QA 4GZUA 3ZIMA 1G6JA 4GPTB 3MJWA 3V60A 3U8ZA 2ELAA 3WALA 2VRRB 2KGXB 2LKOA 1XD3B 3TJPA 2V76A 1WRDB 2CR5A 3M62B 3APDA 2KDIA 4IWPA 2KO3A 3ZRFA 3A8QA 4TUUA 2V3SA 4D0NB 4HWIB 4YONA 3AU5A 2JUOA 3QX1A 4II2B 4B9KA 1WX8A 2I1JA 1LFDA 4GU2A 1W1HA 1OQNA 3DDCB 1WGRA 2Z0EB 4EFOA 1UPQA 4WAAA 1K5GB 2D2QA 1SHCA 1KJTA 2MCNB 1BTNA 1J0WA 3OJ4B 5LXIB 1SGHA 5J18A 4W9GA 4TYZA 4F7GA 4ZRKA 2Z0DB 2DX5B 4B6HA 1PQSA 3PGEA 1DDWA 3SYXA 2YT1A 3ZTCA 4BKGA 2LUEA 2IO2B 4A5KA 2KJHB 3UIPB 1WJNA 2M8SA 2BYFA 2Z0OA 1MKEA 1J8CA 2P0DA 5C6RA 3A98B 4MGZE 3VTWA 1RFAA 2WWZA 2JT4B 3ZNHB 2OOBB 2KQ7A 4KVGB 5DCNA 1RAXA 5JHAA 4URKA 4ICUA 2BYVE 1GC7A 1P6SA 2B3AA 2LRUA 4GB9A 5HE2A 1I42A 1X1GA 3DVGY 4AWJA 2J0KA 2AWTA 5KHOA 2XK5B 2LOZA 3SD5A 3NY5A 2MBHA 2J7QB 2D9WA 1WE6A 5GOWB 4TKNA 1D3ZA 2LVOA 5CX3A 2YS5A 2MP2B 4ANVA 2K00A 4GDKB 3KYDD 3ULBA 2LVPA 3RULA 4AUQC 3UINB 2N4FA 2CHXA 4ICVA 3U30A 2D11A 3VIAA 1X11A 1UNPA 2N1WA 2HRJA 3DBSA 3QHTA 2KVRA 1OEYA 1E8XA 1C3TA 2D10A 1OMWA 3VH3B 3QQ8B 1ZSQA 1GC6A 2O6VA 3Q3FA 5D3XA 2AL6A 4OVVA 4A3PA 1UH6A 1PMSA 4K2PA 1WX9A 1ST7A 2L7RA 1ACAA 2ZCBA 2MWNB 1Y19B 2ROZB 1UEFA 1WGGA 3PSEB 1BTKA 1KZ7A 4MGIE 2YS3A 2P0FA 1Q1OA 4NJ6A 4GIVA 2EC1A 2NPTB 2RR9A 3EECA 2NZ8B 2JVCA 2N1VA 2Z59B 2CRFA 2WH5A 3KZ1A 3NZUA 3UIOB 4HPLB 2FJ9A 1IYFA 4KHBB 2K2UA 4W9IA 4DX90 3ZNID 4DBBA 1ZM0A 2MX2A 2KTRB 4FJVB 2G4SA 2KJ6A 4MDKE 4IWQA 1YD8U 2MP2A 2Z0QA 1M94A 1P3QU 2GCLA 5FI0A 5DIFB 3OANA 4M0WB 4CO7A 4HAXB 1AARA 2MRPA 4KSKC 1U5EA 4IAPA 5DI9B 4KV2A 5JZEB 2BF8B 3A1QB 1E8ZA 4YL8A 2REXA 5DHAB 4FBJB 1Z87A 1LQBA 3KUCB 2MFQA 3ZDTA 2QKMA 3C0RB 1K8RB 1X1MA 4W9CA 4EMOA 4MM3A 3D8DA 3QIJA 2MLBA 3L16A 3RZFA 5AEKB 3EFUA 3ODOA 1KM7A 4WJOA 3QCAA 1Z2MA 2C7HA 1QC6A 3Q3JA 4MH0E 4XWXA 4CHMA 3ZW3A 2JZ3B 2NPTA 3UGBB 4HHVA 2LVQA 2XQNM 2RSUA 4BFRA 2CU1A 2IY1B 2KJRA 2ZVNA 3H6NA 4DK5A 3ML8A 1DROA 1WM3A 2VSZA 3IVFA 1XT9B 3TCAA 2A5UA 2DZIA 3IBEA 3H7PB 1X1FA 2KTRA 3HHMA 1Z5SB 2FIDA 3ECIA 3OLMD 4I6PA 3V62A 2D9XA 2D4QA 4KIKB 1J0GA 3N32A 4PS8A 3ZKJC 4EOYA 4W9FA 2R0DA 2QHOA 1P1AA 2ZVOA 5TR5A 4BBNF 2K39A 4Y94A 1XKEA 4IM3A 4FN2A 1NI2A 4FA6A 3UQBA 2RQ1A 1WZ0A 2K8BA 3EHVA 4KZCA 1P3RA 3L13A 3K9OB 3PVWA 3PVLA 1GJZA 3VOQA 2KHWB 2FCSA 4F7HA 1V80A 3L54A 4G0NB 1BWNA 2LBBA 3OAWA 3PZDA 4K2OA 1OY2A 4JLCA 3EPYA 2DKPA 1L7YA 2KD0A 4HXDA 1YX6B 4WJPA 3APFA 4AJWA 3KRWA 2IBIB 2WX1A 4E74A 5JHGA 4HVBA 2KLCA 2OQBA 2N9PC 1WF9A 3LJ3A 5DPSA 1FHWA 4XC2A 2ELBA 2IFSA 3DCGA 2DAFA 2KMCA 1S3SG 4FULA 3FEHA 1E7UA 2KOXA 3DXEA 4HDQA 1WFYA 2BGFA 2KC2A 3VQIA 4ZDVA 1E7VA 5C5BA 1CMXB 1YX5B 3F5RA 4HAWB 2KDFB 5DH9B 2LD9A 5AZGA 4HDOA 2AL3A 2KWVB 1U29A 2RVBB 1P9DU 3CSFA 3H7PA 2N9EB 2M14A 5CHWA 4IC7B 4ASWC 1TJ6A 2CODA 2GBRA 3W1YA 1GUAB 4KIKA 4BBKA 3ZTDA 2GS0A 1LB1A 2M4NA 2CS4A 2J0MA 3NHEB 4GMVA 4HCNB 2J0JA 4LJPB 1C1YB 2FCNA 5G2NA 1UBQA 3MDBC 3QK0A 2ASQA 3ZRCA 1NTYA 1V61A 4PYUA 2DYOA 5L83A 4BBNC 4C0AA 1V5MA 1ZVRA 2HD5B 1EF5A 2DLWA 1YQBA 2E2XA 2LASA 4H8SA 3HQCA 3ZLZA 4XX5A 2UZSA 4NSWA 5D7GA 4A3OA 2ZNVB 3VTUA 3D32A 3BINA 4JGHB 4MJSA 2COCA 1E8WA 3VUYA 3HW2B 3TFMA 1U5DA 3WAMA 5FI1A 2LGXA 2LI5A 2KFKB 1DDVA 2FNJB 4BKTA 1R4MI 2XBBC 2KN5A 4F7UP 4IFSA 3A9JA 2CQUA 3T8MA 1X86A 1P5TA 2GMIC 1OTRB 2W2XC 3QA8A 4KZ0A 4HK2A 3DXCA 4WJQA 4W9JA 1OGWA 4B6WA 1H4RA 4WSFA 5CLLB 3VVWB 2L2IA 3H7SA 4ZRJA 3DOWA 3PHWB 3NOBA 5HE3A 3A33B 5GMVA 3TIXA 1BAKA 4PNKA 2IYBA 2KDEB 2GCJA 3N3KB 1MK7B 4JQWC 4FJZA 4KDIC 2KTFA 3A9KB 2LULA 4G50A 4Z2NA 2K6DB 1UBIA 3ODWA 1ISNA 5D94A 4HB2B 3QJZA 3PV1A 4WWOA 4ANUA 2M38A 3KUZA 2YSZA 2PZ1A 2R09A 2KXJA 2K1FA 4IG7B 5DPTA 3P2BA 1TZ1A 3VXWA 3A4RA 1NBFC 5CHVC 1XX0A 2EKEC 2GJYA 2HTHB 3ZVRA 1TXDA 4I6NB 2ZEQA 4GXBA 3SUZA 2NS5A 2V1YA 3VH4B 4AOFA 1WIAA 2I1KA 2HJ8A 3PSCA 1WGUA 4PQ0A 3CXBB 2OJRA 3FM8C 2V4LA 5D2MB 2DYMA 3AXCA 2MSED 1UELA 4OVUA 4BOSC 1MPHA 1IRSA 3M63B 3SNHA 1UNRA 2L3ZA 2Q13A 3M95A 5JHHA 1FOEA 4F7ZA 2AEHA 4HAVB 2CB8A 3ODXA 5EDSA 4NAWB 3PS6A 5CHFA 1YJ1A 2MQJA 4BKSA 3UZTA 2DX5A 2DKQA 3RYTA 2CY5A 2RUKB 4MELA 3TMPB 1F9JA 2RPQA 1Q0WB 1U4AA 2BPSA 2KFJA 3B08A 1I7AA 4PS7A 2Y5BB 3RT3B 4DX8A 3GZNI 3A9KA 5LLIA 4DHZB 2H7DA 3KYCD 1FAOA 4HB0B 1MG8A 2RLOA 5KCVA 1J19A 1WXSA 5AZHA 5J2RA 2D9VA 2BWES 4NNJB 1T0YA 4MY6A 2L8JA 3M1IB 2FCMA 3SU8X 2Y8FA 2UZRA 2K8HA 4KSLC 2ZJDA 4WQOB 2IZVB 2JRIB 2L1CA 2HTHA 5DHFB 2NBVB 3V5WA 4M8NA 2XK5A 2KWUB 3HM6X 1KLVA 4RM8A 1LM8B 3RUIB 4BOZB 3IG3A 1RRBA 4GDKA 3F0WA 1E90A 1WY8A 2NBWB 4WVFB 3VUXA 4KHAA 4NQKE 1GG3A 3PLUA 3N30A 3VFKA 3O96A 2YS1A 2FUHB 1LXDA 2O6VD 1FHXA 4K7SA 2JPHA 3U7DA 4RM9A 2DAJA 1E5WA 3TW1A 1ZW7A 1IP9A 4P7IA 2RNRB 3SDLC 5AZFA 2M1MA 2G3QB 4NAWA 5D6JB 4HAYB 4WJ7A 2MBEA 5C1ZA 4MGYE 3T9LA 2YRYA 5L95C 3CIKA 3PRZA 2IO0B 3ENEA 3V6CB 3UF8A 2EMTA 4HLEA 2WX0A 2DZKA 4NJ7A 1WZ3A 4DHZE 2ROVA 4IM2A 1KI1B 2R2OA 2K2JA 2N0YA 5L81A 3V6EB 2JY6A 1V5UA 2C7MB 3V61A 5LXHA 1WH3A 4EEWA 3P6AA 4EZKA 2MA9B 1FHOA 4FADA 1FGYA 5D27A 2MW5A 2ZNVC 4I6LB 3GYPA 4FHKA 5IJMA 3FP5A 4A6KA 1WXVA 1EAZA 4MK0A 5D3WA 1WMHB 2O2VB 2VRWB 1SIFA 1V5PA 1H10A 4EZJA 2P0HA 2XEWA 3PHXB 2CHZA 3ZNZB 2WDTB 1B55A 3CSTA 1AWEA 2DHIA 3W1SC 3BJIA 4WJNA 2IY0B 4G3XB 5E6NA 4BVUC 3A1QA 2DYQA 1NDDA 1HB6A 4HJKA 1WR6E 2LOXA 3AU4A 4IWOA 2COFA 5JP4A 3SV1A 2UVMA 2JRHA 4K81A 2DHZA 3VTVA 4J6IA 1NTVA 1UPRA 1X05A 2MKRA 5FR6A 1Y5OA 2YLMA 4K7WA 1ZC4B 1XD4A 3A4SC 4LDTD 3RD2A 2LGYA 2KX3A 2KUPA 2DHJA 2RD0A 5D3YA 4FHJA 2LJ5A 2KLGA 1FXTB 4X57B 2FJLA 2CKHB 1Y8RC 3QAQA 3AULA 4IUMB 4HB4B 5J3YA 1I35A 1RLFA 2KANA 5D3VA 2X18A 2KKCA 2FIFA 3WIMA 1UD7A 3TVVA 1HE8A 3QWZB 2LXCA 2EJ8A 1UZXB 2LRWA 1ZKHA 2KX0A 2MBQA 1V5TA 2N9XA 3R66C 3BY4B 1V88A 4HCPB 1MK9B 4NQLB 4DWFA 2GBKA 3QWMA 5DPWA 1NVLA 2DZJA 3DVGX 2NMBA 2DTCA 3ZO5B 5J17A 2DX1A 5C79A 5HKHA 3JW0X 2LGDA 2OTXA 3KUDB 2L00B 5J3QA 3VDZA 3PPAA 1WJ6A 3WA0A 3PEGA 2BCJA 3WAOA 4F1SA 4KHOA 4IM0A 3H1UA
chains in the Genus database with same CATH superfamily
1R4NI 3ALBA 1L6VA 1TS2A 1XCQL 3U52E 1FGZA 3FSSA 2LEKA 3AV8A 3E9LA 2K8EA 3FLVA 1K5DB 4RGOS 1XLPA 1GNUA 2QILA 2DZMA 3DBHI 2JZZA 3HUIA 2PE6B 3MP9A 1WE7A 4WWMA 5D3DA 1JCKB 3DVNV 1AW7A 4N58A 1T0RC 1LW3A 2N23A 1BT0A 2BKRB 3HIZA 2PVGC 3PTFC 3ML4A 4XGAB 4MT7A 5CLQB 4XZ4A 1SEBD 5IA7A 2L1AA 1F2RI 2GBNA 2QIEB 1XEEA 4AJYB 5J3TA 2D9ZA 3EGRA 2B76B 2R2QA 1PGAA 4K3BA 4NPNA 1ZE3D 2KNBA 1WJMA 3AJ4A 3DBRI 2WXOA 1U5GA 1TGZB 2M19A 5BYSA 3CF6E 2MH7A 3DQVA 3M3JA 3L10B 3IAM1 4OVZA 3FILA 3AE1B 2IYDB 3ZYYX 3Q69A 1XLOA 1U27A 4M8MA 5DPRA 1ZP0B 4S0RA 2WYQA 1Y56A 2KCJA 2YVCA 2MBOA 2CHWA 2O6VB 4US9A 3GYOA 1EVHA 2DYNA 1SXTA 1MVKA 1WXAA 2WQYB 5BYQA 3RI7C 3V05A 2LXAA 1TBEA 3RN9C 2M17A 2H89B 3ZDMC 2I5FA 4AP4C 1UWXA 1GOZA 1KC7A 5H92C 1FXIA 1V2YA 3SEBA 3VHTC 2P8VA 3WCQA 5JH5C 1MIXA 3GS2A 4EKUA 1WGDA 1R4NB 4M00A 1QF6A 2WHIA 3AE8B 1WVHA 1KLUD 5G55A 4DBGA 3NRZA 3A8PA 4GDLB 4L6EA 4TSSA 2WP9B 3Q8CA 4OSNA 5HE1A 4MT5A 1ZC3B 1IPGA 2JU6X 1W1DA 3P4PB 4G11A 2PEAA 1ZOYB 2BYTA 2C60A 4L2YA 2GBJA 4PT5A 3TL5A 4N9F4 4GMXB 2VH2A 4DHJD 3RCPA 4B95A 1WGQA 3PG7A 1V1PB 4HPPA 2N7DA 2NVUI 3W5UB 1WJUA 3NSUA 1XO3A 1FB8A 1PFDA 3WANA 2KFKA 2PPHA 3E9PA 4LCDE 1XCGA 4MSQB 3LJUX 2RGFA 1TZOA 1YMHE 1WRIA 2ZPYA 2BKFA 2KC1A 1QKZA 4WQMA 1OFFA 3NWAA 4OW0A 1JWAD 4JKFA 1TJEA 1V89A 3D8EA 1V6EA 1N63A 3L0WB 2W3RA 2LMCA 3W1SA 4YT0B 1WR1A 2K25A 1F77A 2KQSA 1L4ZB 3R7QA 2G45B 4NJCA 1FEHA 3NVWA 1WGKA 4XWWA 4DXAB 4RGMA 5C16A 5KQ4A 4W9KA 3JSVB 1RJ2A 4OZCA 1VCBA 4LNKA 1EGXA 3AEGB 2WU2B 2L0FA 2WS3B 2OHFA 4W9DA 3ZGZA 2Y7BA 1IBXB 2K8CA 4GOCA 2NBUA 5LOPB 1V97A 1V81A 2C9WB 5EFXA 2EKIA 4K3CA 4MM3B 4AS1A 1HXYD 1QOAA 1XQQA 2RGNB 1EO6A 3QARA 2D3AA 2J53A 1DOYA 1JQ4A 1QLBB 3TBLD 2W2WA 3TO1A 3E56A 4ILHA 2INNE 1PGXA 2N9LA 5LONB 4ZHOA 1WGYA 4HPMB 3MPXA 1XODA 4GSWA 1U2BA 4LNFA 4W9HA 2LZ6A 3Q6BA 5MPOA 3APCA 2CY4A 1PFJA 3PRPB 3AECB 2Z4DA 2D3GA 2I5CA 2G4DB 4GDLA 3AE5B 1I2HA 2KUQA 2AYOB 4LDTB 3L17A 5E6JA 1WI1A 3P7ZA 4GN1A 4MEMA 3ZUNA 4CHJA 3D8FA 2G9HD 1V86A 4TQ0A 1S1QB 2Z13A 3KWVA 4B0MA 1L2NA 1M7RA 2D9YA 4DDID 2J59M 2RSGA 2GB1A 2N7EA 1XR0B 1AQCA 3MC9A 1MG4A 3NS8A 1ZGUB 3DHIC 1P98A 3K9PB 2BBCA 2LWPA 2FAZA 2D07B 4E71A 3AMZA 2Z0PA 4K17A 1HA5A 1STEA 2QJLA 1WXMA 4YWGG 5C3JB 2RDGA 4CHKA 4ZYNA 4WWPA 1WJ1A 4C56C 3N1YC 3ONSA 5D3IB 4ANXA 4TV3A 1KZGA 4BKSD 4RMAA 4DQOC 3VAWA 2JXXA 5LNK1 2C5LC 3H9DA 4P1BC 1TKGA 1TYGB 4QJ3B 4F8CB 5CTRC 1EF1A 3O65B 4JL9A 3Q3OC 1I4RA 3DBLI 4W9EA 3IHPC 3KW5B 3VRBB 1HBKA 1HZ5A 3I3TB 3I5JC 2EMSA 1WJ4A 2ON8A 3TSSA 2KK8A 4NY0A 4K1RB 4EZLA 1NU2A 2COPA 4L1RA 4GGQA 4JKEA 2L76A 5E6OA 3JSVA 1Q5WB 3C19A 3I63C 4ANWA 2IO1B 3SHQA 1IGCA 2KWCA 3JVZX 4HATB 3NG0A 1PLSA 3DCXA 1D4BA 1WG7A 3MTNB 3PREA 4KAXB 4IDIA 4HKQA 1NTIA 4WIPA 2NCNA 3ZNGC 2OJWA 4PS3A 1TQZA 2RDHA 1F0ZA 4HAUB 1T3QA 1WX7A 3R3MA 2M0XA 4ZRIA 4JKAA 3B2FA 3E9OA 5E6PA 1NI3A 2K5PA 1WM2A 3V3XA 1OQYA 3OJ3A 3DVNU 1UGMA 1N5WA 3NZ3A 3AE7B 2BB5A 2K9XA 3WAPA 1TT5B 4LNNA 4XDDA 1YJIA 4RGTA 1QILA 1L0XB 3B0AA 2HDEA 1DDMA 4CYEA 1MAIA 2VZKD 2H7EA 2A4ZA 1VZ6A 1VD2A 2NBVA 2C7NB 2DA0A 4BZAA 2ZCCA 2DFKA 1SE4A 3KVFB 2DENB 4W9LA 3JYUA 1Q67A 2Y8GA 2GBMA 3QBVB 2ZPNA 3QC8B 4E3CA 3SR6A 5C5BB 3S2AA 1SE2A 4Z2MB 1TTNA 4K7UA 4A6HA 3ZXRA 1DOXA 1WGHA 3PP2A 5JLJB 1N62A 1GPXA 2NR2A 3L08A 3AE3B 3ULCA 4FLHA 2YT0A 2W55A 1FCCC 3DXDA 1OEYJ 2IO3B 3B2GA 3ZJVA 4EUTA 2WXJA 4KGRA 1A5RA 2MDXA 3KY9A 4A6FB 4LJOB 1KFYB 1QZEA 1TKEA 2VKIA 3UQAA 1JWMD 2UYZB 2L0TA 4A90A 1EUVB 1HEZE 3DBLB 2BYEA 3B1LX 2ABDA 1KRHA 4EJNA 3ML9A 1ROEA 2W9NA 3J9CA 1RRPB 4A20A 2PJHA 2ADZA 1JRUA 3HM3A 3MJ5A 4HB3B 3TUOA 1V9JA 2INDC 3NS1A 3CMMB 3UI3A 1HB8A 4MGKE 2RPVA 1C77A 3RCZA 2KZRA 3X23A 1H8CA 3NVVA 1U5FA 2MHJA 3PRMB 1WI0A 4TQ1A 4JKGB 4IOYX 3MHSD 5HHDG 2KDBA 2MJEA 1V5OA 3PO0A 2MWSB 4KDLB 1WYWB 5C23A 3N1ZC 2FCQA 3LDZE 3KSYA 1HTQA 2UWQA 4ZRPA 4DXFA 1P0RA 1ZXIA 2ZZPB 2GOWA 3DPDA 1KOTA 5KHQA 4ILJA 2DYBA 4II3B 2LG1A 2HE7A 4MJSB 1SE9A 3SBGA 1K50A 2QKLA 3HK0A 5KQ1A 3ZVVA 1CZPA 2BWFA 2JWZA 2W2XD 1JMLA 1WYGA 4FJYA 3T06A 1M7EA 4JIOU 1YQ3B 2PE9A 3NZSA 4WWNA 1TS3A 4MSMB 3A9JB 1W1GA 5BO4B 3X0WA 1YJJA 3EC8A 2G35A 3N7CA 4DHJB 1RWSA 2WXFA 2JP2A 1QQGA 1YIWA 2YF0A 3RZWC 2QDFA 3BYTB 2CAYA 1VDVA 4RNAA 2DHKA 1MIZB 1WMHA 1DBHA 4PYZA 5HE0A 2O2VA 2FDQA 3RMKC 4DDGD 2PIAA 2BS2B 2JF5A 3PT2B 3ABVB 2J4XA 1FIQA 3R7RA 3KRXA 3VUWA 3AI5A 4HAZB 2Z8LA 3KH0A 4AQ7A 3NWDA 3SO6A 4LNIA 4XE0A 1ZDVA 3PVUA 2COAA 2L05A 3GOEA 2LYDA 4A6FA 1E8YA 4IW0A 3IFWB 4JKHA 1SSNA 2KMAA 2DN6A 4M02A 3P42A 3WYFB 3KLSX 1AWDA 3N1XC 3AE4B 1N3HA 3G9WA 5IRSA 5IAAC 1UNQA 1BMLC 5JHBA 1FXAA 2MBBB 3BZDB 3PLVA 2SEBD 3AM9A 1GAQB 1V49A 1DYNA 2KACA 2AQ1B 4JWSC 3FVCA 2K6QA 4GZUA 3ZIMA 1G6JA 4GPTB 1I4QA 3IAS1 3MJWA 1D5XC 3V60A 3U8ZA 2ELAA 3WALA 2VRRB 2KGXB 2LKOA 1CK1A 2KT7A 2JWUA 2LGIA 1XD3B 1TY0A 3TJPA 2LJIA 2M0AA 3OG5A 2V76A 1WRDB 2CR5A 3M62B 3APDA 4JKGA 2KDIA 4IWPA 2K0PA 2IJ0A 2KO3A 4RCOA 2IPKD 3ZRFA 1KBLA 1FNVA 2N0SB 5M4YB 2CU3A 3A8QA 4TUUA 2V3SA 3Q14C 4D0NB 4HWIB 4YONA 4DIXA 3P1MA 3AU5A 2JUOA 3QX1A 4II2B 4B9KA 1WX8A 5HFYA 1ET9A 1J7AA 2I1JA 1C76A 1LFDA 4GU2A 3CIRB 1W1HA 2DNFA 1OQNA 1HQRD 4LK0M 3DDCB 1WGRA 2WXKA 2Z0EB 4EFOA 1UPQA 5EE9A 4WAAA 1K5GB 2D2QA 1SHCA 1KJTA 2MCNB 1BTNA 2M56B 1J0WA 3OJ4B 3RPFC 2ZW1A 5LXIB 1SGHA 5J18A 4ZOHC 4W9GA 4TYZA 4ZRQA 4F7GA 4ZRKA 2Z0DB 2DX5B 5C2TB 4JX1C 4B6HA 4BAXA 1EU4A 2WDRB 1PQSA 3PGEA 1DDWA 3SYXA 4P16A 2YT1A 3ZTCA 4BKGA 2LUEA 2NMQA 2IO2B 3Q2AC 4A5KA 4XWTA 2KJHB 3UIPB 1WJNA 2M8SA 3HSAA 2BYFA 2Y5CA 2Z0OA 5EE1A 1MKEA 1UUPA 3LXFA 1J8CA 2P0DA 5C6RA 2Q5WD 3A98B 4MGZE 3VTWA 3TEWA 1RFAA 2WWZA 2JT4B 3ZNHB 2OOBB 2KQ7A 4OZAA 5FR3A 4KVGB 4QJ4B 5DCNA 1RAXA 4KKIA 5JHAA 4URKA 3NWFA 2X38A 2FJUB 1JWBD 2R82A 4ICUA 2BYVE 4GOUA 1I4GA 4HRSA 1GC7A 1P6SA 2B3AA 2LRUA 4GB9A 5HE2A 1V8CA 1I42A 2J52A 2Y3AA 5EE3A 1X1GA 3DVGY 4AWJA 2ONQA 2J0KA 1FD6A 2AWTA 5KHOA 2LUMA 2E3TA 2XK5B 2LOZA 2JQRB 3SD5A 3NY5A 4HJGE 2MBHA 2J7QB 2D9WA 1WE6A 5GOWB 4TKNA 1MI0A 3SFDB 1MI1A 3U4EG 1R7SA 1BUIC 1D3ZA 2KDMA 2LVOA 5CX3A 2YS5A 1QOGA 2MP2B 4RGNA 4ANVA 5JVLA 2K00A 4GDKB 3KYDD 3DWGC 1N60A 3ULBA 1XXGA 2LVPA 3RULA 2D5GA 4AUQC 3UINB 2N4FA 1R4MB 3PZ8A 2CHXA 4ICVA 3U30A 2D11A 3VIAA 1X11A 3ETRA 1UNPA 1DGJA 1IGDA 2N1WA 4FXCA 2HRJA 1SB3C 1NEKB 3DBSA 3QHTA 2LHEA 2KVRA 1DOIA 1OEYA 2FE8A 1E8XA 1C3TA 1TS4A 1TY2A 1XLNA 2WGSA 2D10A 1LO5D 1SBBB 4MH8A 2N7JA 1OMWA 4Q2JA 3VH3B 1LGRA 5BMHA 3QQ8B 3ZJTA 1ZSQA 1GC6A 2WXIA 3BVGA 2O6VA 3Q3FA 5D3XA 2AL6A 4OVVA 4A3PA 1UH6A 1PMSA 4K2PA 1WX9A 1ST7A 2L7RA 1SIJA 1K51A 2WU5B 2WXQA 1MHXA 3NJTA 1ACAA 2ZCBA 2MWNB 2PVOD 1Y19B 1HTOA 1L6UA 4YTPB 3RNCC 2ROZB 1UEFA 2L32A 1WGGA 1FFVA 4KKJA 4YSZB 3PSEB 1BTKA 2WNMA 1KZ7A 4MGIE 2YS3A 2P0FA 4A8XC 2X0SA 1Q1OA 1I4XA 2WXNA 2WXLA 4NJ6A 4GIVA 3P4QB 2EC1A 2NPTB 4JKDA 2RR9A 2IGGA 3EECA 2NZ8B 4M01A 2JVCA 2N1VA 2Z59B 1ESFA 5H8YE 2CRFA 2WH5A 3KZ1A 4RFBA 3FKYA 4P6VF 3TEYA 3NZUA 4OZBA 5EE0A 3UIOB 4HPLB 3AEAB 4WURA 2FJ9A 3KQ4A 1IYFA 1WXQA 1MPEA 1V1PA 4KHBB 1OQRA 2K2UA 4W9IA 1FNUA 4DX90 3ZNID 3SFEB 4DBBA 4J3OD 2IGDA 1ZM0A 2MX2A 1ZPSA 1QT9A 1GB4A 1FRDA 1ZDXA 2KTRB 4FJVB 2G4SA 2KJ6A 1TIFA 1JW9D 1T77A 1FCLA 3O13A 4MDKE 3C8YA 4IWQA 1YD8U 1XF5L 2MP2A 2K22A 2Z0QA 1HZ6A 3NVZA 1M94A 1P3QU 1QQRA 3OWEB 2GCLA 1VRAB 5FI0A 3Q3MC 5IP4D 5DIFB 3OANA 1RFKA 4M0WB 5TSSA 4CO7A 1WSPA 4HAXB 1AARA 2MRPA 4KSKC 5FKAC 1VZ7A 2MJ3A 5BMGA 3HVZA 3VRAB 1K52A 1U5EA 4HEA1 4IAPA 5DI9B 2KVZA 4KV2A 5JZEB 2BF8B 1F52A 3A1QB 1E8ZA 4YL8A 2REXA 5DHAB 2NTTA 1Z87A 4FBJB 1LQBA 3KUCB 2MFQA 3ZDTA 1T6BX 1IBXA 2QKMA 3C0RB 2Z14A 1EWCA 1K8RB 1X1MA 4H2AA 3P4RB 4W9CA 4EMOA 4XYCA 1E9MA 2PKOA 5HG2A 4MM3A 3D8DA 3QIJA 2MLBA 3L16A 2R61A 3RZFA 5AEKB 3EFUA 1SJED 1F1HA 3AE6B 3BK2A 3ODOA 1KM7A 1RYJA 2V4IB 4WJOA 2KYWA 3QCAA 4A55A 3ENBA 4YXDB 1Z2MA 2C7HA 1QC6A 1YN3A 2LHDA 1TS5A 3Q3JA 4MH0E 1ENFA 4XWXA 4CHMA 3ZW3A 2CJOA 1E10A 2CJNA 1FM0D 2JZ3B 2NPTA 3UGBB 1I4PA 4HHVA 2LVQA 2XQNM 1VBHA 2Z59A 1AN8A 2RSUA 3AE9B 1T0SC 1MJDA 4BFRA 1J7CA 4PK1A 2CU1A 1JWUD 2IY1B 3B9JA 2KJRA 2ZVNA 3H6NA 4DK5A 5I2SA 1NVID 3ML8A 1DROA 1WM3A 2VSZA 4XDCA 3HRDD 1PGBA 2KMMA 3IVFA 1XT9B 3LYYA 3TCAA 2A5UA 3HVDA 2DZIA 3IBEA 2BS4B 5FK9C 3H7PB 1NYQA 1X1FA 2KTRA 3HHMA 3DWMA 2MEKA 4YSXB 2I2YA 1DYQA 1Z5SB 2BB6A 2FIDA 3ECIA 3OLMD 4I6PA 3V62A 4OHJA 2D9XA 2D4QA 4KIKB 1J0GA 3N32A 4PS8A 2D3BA 2RRFA 3ZKJC 4EOYA 4W9FA 2R0DA 2QHOA 1P1AA 2ZVOA 3CWIA 5I4DA 3P4SB 3NVYA 3URYA 5TR5A 4BBNF 2J42A 2K39A 4Y94A 1XKEA 4IM3A 4FN2A 1NI2A 4FA6A 3UQBA 2RQ1A 1WZ0A 2K8BA 3EHVA 4KZCA 3MFGA 1P3RA 3L13A 3K9OB 2G1EA 3PVWA 3PVLA 1GJZA 4HKZE 3VOQA 3BVZA 2JXTA 2KHWB 2SAKA 4IOIE 3IXSA 2FCSA 3L4PA 2BS3B 4F7HA 1V80A 3L54A 1KLGD 4G0NB 1BWNA 2LBBA 3AE2B 3OAWA 4A6QA 3PZDA 1DIKA 4K2OA 3I57A 4HSIA 1OY2A 1UF0A 1VLBA 4JLCA 2K49A 3EPYA 2DKPA 1L7YA 2KD0A 4HXDA 3Q8AA 5LG4B 1YX6B 4WJPA 3APFA 4AJWA 3KRWA 3E66A 1YN4A 2IBIB 2WX1A 3W9CB 4E74A 5JHGA 4ACFA 4JK7A 4CQNA 4HVBA 2KLCA 2OQBA 2N9PC 1WF9A 5G5GA 3LJ3A 4YTNB 5DPSA 1FHWA 4XC2A 2ELBA 2WDVB 3BVMA 5JXVA 2IFSA 3DCGA 2DAFA 2KMCA 1S3SG 1B9RA 4FULA 3FEHA 1E7UA 4LTUA 4JKCA 2KOXA 1NYRA 2V3PA 3DXEA 3GE8C 4JK9A 4HDQA 1WFYA 2BGFA 2KC2A 3VQIA 4N59A 4ZDVA 1E7VA 5C5BA 1CMXB 1YX5B 3RNAC 1ZXHA 3F5RA 4HAWB 2KDFB 5DH9B 2LD9A 3ZJUA 5AZGA 3AH7A 4HDOA 2AL3A 3KWLA 3T3OA 2KWVB 1U29A 2MJDA 5IO9A 2RVBB 1P9DU 2LGSA 3W2DA 3CSFA 1F2RC 1PUTA 3H7PA 2N9EB 2M14A 1I7HA 4UDUC 5CHWA 2PLPA 4IC7B 4ASWC 1TJ6A 2CODA 2GBRA 2WLBA 4YSYB 4ARIA 3W1YA 1JRPA 1GUAB 4KIKA 1KTKA 4BBKA 3ZTDA 2GS0A 1LB1A 3AN1A 2GRIA 2M4NA 2CS4A 2J0MA 3NHEB 3P63A 2R2YA 2GLSA 4GMVA 4HCNB 2J0JA 4LJPB 1C1YB 2FCNA 5G2NA 1UBQA 3MDBC 3QK0A 2ASQA 3ZRCA 1NTYA 1QOFA 1E6EB 1V61A 4PYUA 1B1ZA 2DYOA 5L83A 3RNGC 4BBNC 4C0AA 2JX5A 1V5MA 1ZVRA 4D6WA 2HD5B 1EF5A 2DLWA 1YQBA 1RM6C 1JDEA 2E2XA 2INCC 2LASA 4H8SA 3HQCA 5IN7A 3ZLZA 4XX5A 2D3CA 2WXHA 1WWTA 2KIEA 2UZSA 4NSWA 5D7GA 4A3OA 2ZNVB 3VTUA 3D32A 1K53A 3BINA 4JGHB 4MJSA 5AUKA 1FRRA 2COCA 1E8WA 1N5XA 3VUYA 2YEPF 3HW2B 3TFMA 4JPSA 4ILGB 1U5DA 3WAMA 1VBGA 5FI1A 2AQ2B 2KWDA 2LGXA 1BXTA 2LI5A 2KFKB 1DDVA 2FNJB 3FAHA 4BKTA 1R4MI 2XBBC 2KN5A 4F7UP 4IFSA 3A9JA 1VJKA 2CQUA 2PMVA 3T8MA 3SBTA 1X86A 1P5TA 2GMIC 1OTRB 3OHMB 2W2XC 3QA8A 1EM7A 4KZ0A 1M4VA 4HK2A 3DXCA 4WJQA 5AUIA 4W9JA 1OGWA 4B6WA 1H4RA 4R3DA 1XCTL 4WSFA 5CLLB 3VVWB 1FNWA 2V3NA 2L2IA 4NAMA 3H7SA 4US8A 4ZRJA 3DOWA 3PHWB 3NOBA 5HE3A 1KH0A 3A33B 5GMVA 5I2MA 3TIXA 1BAKA 4KGTA 4PNKA 2IYBA 2KDEB 2GCJA 3N3KB 1MK7B 4JQWC 1OQQA 2DLBA 5IOIA 4FJZA 2IGHA 4KDIC 2KTFA 3A9KB 3DHGC 2LULA 4G50A 2KAJA 4JE3B 4Z2NA 2K6DB 1UBIA 3ODWA 1ISNA 2HTME 5D94A 4HB2B 3QJZA 3PV1A 4WWOA 4ANUA 2M38A 3KUZA 2YSZA 3Q8BA 2PZ1A 2R09A 2KXJA 1ET6A 1L0VB 2K1FA 4IG7B 5DPTA 3P2BA 1T0QC 1TZ1A 3VXWA 3A4RA 1NBFC 4DXGA 2FBWB 5CHVC 1XX0A 3ZXVA 2EKEC 3U7ZA 1PDXA 2GJYA 1P7FA 1FFUA 2HTHB 3ZVRA 2AQ3B 1TXDA 4I6NB 4C4VB 2ZEQA 4GXBA 3SUZA 3DBHB 4WAFA 3RNFC 3DHHC 2NS5A 4QXAB 1L4DB 2V1YA 3VH4B 4AOFA 1UGJA 1WIAA 3U12A 1VR9A 3GB1A 2I1KA 2JYTA 2HJ8A 2WDQB 4IKGA 2VZKB 3PSCA 1WGUA 4PQ0A 3CXBB 2OJRA 3FM8C 2V4LA 4C7ZA 1TKYA 5D2MB 2DYMA 3AXCA 2MSED 1GGOA 1E7PB 1UELA 4OVUA 4BOSC 1AYFA 3RNBC 4GLSC 3AB5A 1MPHA 2DIKA 1IRSA 3M63B 3SNHA 4NZLB 1UNRA 2L3ZA 3H8HA 2Q13A 2WXMA 3M95A 3BK1A 5JHHA 1FOEA 1FPYA 1C9FA 3DBRB 2AEHA 4HAVB 4F7ZA 1UWMA 2CB8A 1GB1A 3AEDB 3IT4B 3ODXA 5EDSA 2V9HA 4NAWB 3PS6A 1J7BA 3I9V1 2BW2A 5CHFA 1C4AA 1YJ1A 5G5HA 1D6EC 2MQJA 3AEEB 4C7YA 4BKSA 3UZTA 2DX5A 2DKQA 3RYTA 3TEXA 2CY5A 2NTSA 2RUKB 2TSSA 3MC0B 4MELA 3TMPB 3AEFB 2E6XA 1F9JA 2PTLA 2RPQA 1Q0WB 1U4AA 2BPSA 2KFJA 2IDYA 3B08A 1I7AA 4PS7A 2Y5BB 4CSQA 2KQ4X 5IKCM 3RT3B 2FUG1 4DX8A 3GE3C 3GZNI 3TEZA 3A9KA 2AX5A 1C78A 1YN5A 4L1BA 5LLIA 2K3UA 4DHZB 2H7DA 3KYCD 2WXRA 1FAOA 4HB0B 1MG8A 4A9AA 1VZ8A 2QEJC 3PZ7A 2RLOA 5KCVA 1J19A 1WXSA 5AZHA 5J2RA 2V0GA 2D9VA 2BWES 4NNJB 1T0YA 4MY6A 2L8JA 3M1IB 2FCMA 3SU8X 2Y8FA 2UZRA 4S17A 2K8HA 4KSLC 2ZJDA 4WQOB 2IZVB 2W82A 2KR0A 2JRIB 2L1CA 2HTHA 5DHFB 1C4CA 2NBVB 4C4VA 3V5WA 3R2IA 4M8NA 2XK5A 1L0YB 3GP7A 4L23A 4QAYA 1KF6B 2KWUB 4O1NA 2JYEA 2BQQA 2Y5PA 3HM6X 3R8BA 4RF0A 1KLVA 4RM8A 1LM8B 3RUIB 1N61A 1C4PA 4BOZB 3IG3A 1RRBA 4GDKA 3F0WA 1E90A 4JK8A 1WY8A 3LB8C 2NBWB 4WVFB 2WXGA 3VUXA 4KHAA 4NQKE 1E0ZA 2H88B 3N9YC 1GG3A 3PLUA 3N30A 3VFKA 3O96A 1YNTE 2YS1A 2FUHB 1LXDA 2O6VD 1FHXA 4K7SA 1SE3A 2BVCA 2JPHA 3U7DA 4RM9A 2DAJA 1E5WA 2KN4A 3TW1A 1ZW7A 1IP9A 1Q10A 4P7IA 2RNRB 3SDLC 5AZFA 1IUEA 2M1MA 2G3QB 4NAWA 5D6JB 5HI1A 1V1OA 4HAYB 4WJ7A 1MFWA 4D2KA 2MBEA 5C1ZA 4MGYE 3T9LA 2VH1A 2GI9A 2YRYA 1EWYC 1JROA 1P7EA 5L95C 3CIKA 3PRZA 2IO0B 3ENEA 4B0EA 3V6CB 3UF8A 1JALA 4ZYSA 2EMTA 4HLEA 2WX0A 3GZNB 2DZKA 4RH6A 1L5PA 3BYYB 4NJ7A 1WZ3A 4DHZE 2ROVA 3MC8A 4IM2A 1KI1B 2R2OA 2K2JA 2DWQA 2N0YA 3AEBB 5L81A 3Q8FA 3V6EB 2JY6A 1JWSD 4EE2A 3IT6B 3RNEC 1V5UA 2C7MB 3V61A 5LXHA 1WH3A 2JZPA 4EEWA 3NUHB 3P6AA 4EZKA 4C80A 3ZQ4A 2MA9B 1FHOA 4FADA 1FGYA 5D27A 2MW5A 3W5VB 2ZNVC 4I6LB 3GYPA 4FHKA 2X8XX 5IJMA 4KHBA 1ZUD2 3FP5A 4A6KA 4GNKB 1WXVA 1EAZA 2YEPB 1CQVA 4MK0A 5D3WA 1WMHB 3BWUD 2O2VB 2LFIA 2VRWB 3VR9B 4ARCA 2QCZA 1SIFA 1T5XD 1D5ZC 3Q8EA 1V5PA 3MHZA 1YOVB 1H10A 4KX6B 4WH4A 4EZJA 2P0HA 2QSDA 2XEWA 3PHXB 2CHZA 1UNSA 3ZNZB 2WDTB 1B55A 3CSTA 2PW9A 4USAA 1AWEA 4REZA 2DHIA 1YQ4B 3W1SC 3RFZB 4LLGM 4M0WA 1FMAD 4KGSA 3BJIA 5BMIA 5BYRA 3EA6A 4WJNA 2IY0B 1SF0A 1C79A 2ICIA 4RF1A 4G3XB 4LNOA 5E6NA 4BVUC 3A1QA 2DYQA 2L52A 3HIEA 3N20C 1NDDA 1HB6A 2I38A 4HJKA 1WR6E 2LOXA 3AU4A 4IWOA 2KIGA 3B77A 2COFA 5JP4A 3SV1A 2UVMA 4YTMB 2JRHA 4K81A 2DHZA 3VTVA 2RDBC 4J6IA 1NTVA 2MKRA 1UPRA 1X05A 1ACCA 4C00A 4OT1A 5FR6A 1Y5OA 2YLMA 3E9SA 3BIID 1D5MC 1EU3A 4K7WA 1ZC4B 1XD4A 3A4SC 4LDTD 3RD2A 2LGYA 4JWUC 2KX3A 4JKBA 1NENB 2KUPA 2DHJA 2RD0A 2JSVX 5D3YA 4FHJA 2LJ5A 4QJ5B 2KLGA 1FXTB 4X57B 2FJLA 2CKHB 1Y8RC 3QAQA 3AULA 4IUMB 3R2TA 2W3SA 4HB4B 3U2SC 5J3YA 1I35A 1RLFA 2KANA 2HJ1A 2ZKMX 5D3VA 1A70A 2X18A 1MHHE 2KKCA 2QMTA 4MACA 2INPE 2FIFA 3FC4A 2OEDA 4HROA 3WIMA 1UD7A 3TVVA 1HE8A 3QWZB 1QOBA 2L83A 3T3NA 2LXCA 2RMMA 4TMAB 2UU7A 2EJ8A 1UZXB 2LRWA 1ZKHA 4ZHPA 4ITKA 2KX0A 2MBQA 2QC8A 3FILB 4P1CC 1V5TA 2N9XA 2W54A 1XLQA 3R66C 1N6ZA 2EELA 3BY4B 1V88A 2WXPA 3EFCA 4HCPB 2DBYA 1PYWD 2ACZB 1MK9B 4NQLB 4DWFA 2GBKA 3QWMA 2XN9C 5DPWA 1NVLA 2DZJA 1I4HA 2ZW0A 3DVGX 1ZYIA 1CJEA 2NMBA 3NW8A 2DTCA 3ZO5B 3A58A 5J17A 1SJHD 2BT6A 2DX1A 2XNAC 5C79A 5HKHA 3VR8B 2YT2A 3JW0X 2BTEA 2N9KA 2LGDA 2GUMA 2OTXA 5T8IA 3KUDB 2L00B 1FO4A 5J3QA 3VDZA 3PPAA 1WJ6A 3WA0A 3PEGA 3EUB2 2BCJA 4N6EB 3WAOA 3Q3NC 4F1SA 4KHOA 4IM0A 3H1UA 5GXGB
chains in the Genus database with same CATH topology
1R4NI 3ALBA 1FGZA 3FSSA 3E9LA 3FLVA 1K5DB 1GNUA 2DZMA 3DBHI 2JZZA 2PE6B 1WE7A 3DVNV 1LW3A 2N23A 1BT0A 2BKRB 3HIZA 3PTFC 3ML4A 4MT7A 5CLQB 4XZ4A 5IA7A 2GBNA 4AJYB 5J3TA 2D9ZA 2R2QA 4NPNA 2KNBA 1WJMA 3AJ4A 3DBRI 1U5GA 1TGZB 3CF6E 3DQVA 3M3JA 3L10B 2IYDB 1U27A 4M8MA 5DPRA 2WYQA 2KCJA 2YVCA 2MBOA 2CHWA 2O6VB 3GYOA 1EVHA 2DYNA 1WXAA 2LXAA 1TBEA 2M17A 3ZDMC 2I5FA 4AP4C 1KC7A 1V2YA 3VHTC 2P8VA 5JH5C 1MIXA 4EKUA 1WGDA 1WVHA 5G55A 4DBGA 3A8PA 4GDLB 4L6EA 5HE1A 1ZC3B 1IPGA 1W1DA 4G11A 2PEAA 2C60A 2GBJA 3TL5A 4N9F4 4GMXB 4DHJD 3RCPA 4B95A 1WGQA 3PG7A 2N7DA 2NVUI 1WJUA 3NSUA 1FB8A 3WANA 2KFKA 2PPHA 3E9PA 4LCDE 1XCGA 4MSQB 3LJUX 2RGFA 2ZPYA 2BKFA 2KC1A 4JKFA 1V89A 3D8EA 1V6EA 3L0WB 3W1SA 1WR1A 2K25A 2KQSA 3R7QA 2G45B 4DXAB 5C16A 5KQ4A 4W9KA 3JSVB 1RJ2A 1VCBA 1EGXA 2L0FA 4W9DA 2Y7BA 2K8CA 4GOCA 2NBUA 5LOPB 1V81A 2C9WB 5EFXA 1XQQA 2RGNB 1EO6A 3QARA 3TBLD 2W2WA 3TO1A 4ILHA 5LONB 1WGYA 4HPMB 3MPXA 1XODA 4GSWA 1U2BA 4W9HA 2LZ6A 3APCA 2CY4A 1PFJA 3PRPB 2D3GA 2I5CA 2G4DB 4GDLA 1I2HA 2AYOB 4LDTB 3L17A 1WI1A 3P7ZA 4GN1A 4MEMA 3ZUNA 4CHJA 3D8FA 1V86A 4TQ0A 1S1QB 1L2NA 1M7RA 2D9YA 4DDID 2J59M 2RSGA 3NS8A 2N7EA 1XR0B 1AQCA 1ZGUB 3K9PB 1P98A 2LWPA 2FAZA 2D07B 4E71A 2Z0PA 4K17A 1WXMA 4CHKA 4ZYNA 4WWPA 1WJ1A 3ONSA 4ANXA 4TV3A 1KZGA 4BKSD 4RMAA 3VAWA 2JXXA 2C5LC 3H9DA 4F8CB 5CTRC 1EF1A 3O65B 4JL9A 3DBLI 4W9EA 3IHPC 3KW5B 1HBKA 3I3TB 2EMSA 1WJ4A 2KK8A 4NY0A 4K1RB 4EZLA 1NU2A 2COPA 4GGQA 5E6OA 4JKEA 2L76A 3JSVA 1Q5WB 4ANWA 2IO1B 3SHQA 2KWCA 3JVZX 4HATB 1PLSA 1WG7A 3MTNB 3PREA 4KAXB 1NTIA 2NCNA 3ZNGC 4PS3A 1TQZA 4HAUB 1WX7A 3R3MA 2M0XA 4ZRIA 4JKAA 3E9OA 5E6PA 1WM2A 1OQYA 3OJ3A 3DVNU 1UGMA 3WAPA 3B0AA 1DDMA 4CYEA 1MAIA 2H7EA 2A4ZA 1VD2A 2C7NB 2DA0A 2ZCCA 2DFKA 3KVFB 2DENB 4W9LA 3JYUA 1Q67A 2Y8GA 2GBMA 3QBVB 2ZPNA 3QC8B 4E3CA 5C5BB 3S2AA 4Z2MB 1TTNA 4K7UA 4A6HA 1WGHA 3PP2A 5JLJB 2NR2A 3L08A 3ULCA 4FLHA 2YT0A 3DXDA 1OEYJ 2IO3B 4EUTA 1A5RA 2MDXA 3KY9A 4A6FB 4LJOB 1QZEA 2VKIA 3UQAA 2UYZB 2L0TA 1EUVB 2BYEA 3B1LX 2ABDA 4EJNA 3ML9A 2W9NA 1RRPB 4A20A 2PJHA 2ADZA 1JRUA 3HM3A 4HB3B 1V9JA 3CMMB 1HB8A 4MGKE 3RCZA 2KZRA 3X23A 1H8CA 1U5FA 3PRMB 1WI0A 4TQ1A 4JKGB 4IOYX 3MHSD 2KDBA 1V5OA 2MWSB 4KDLB 1WYWB 5C23A 2FCQA 3LDZE 3KSYA 2UWQA 1P0RA 2ZZPB 2GOWA 3DPDA 1KOTA 5KHQA 4ILJA 2DYBA 4II3B 2LG1A 2HE7A 4MJSB 1SE9A 3SBGA 2QKLA 3HK0A 5KQ1A 3ZVVA 2BWFA 2JWZA 2W2XD 4FJYA 3T06A 1M7EA 4JIOU 2PE9A 3NZSA 4WWNA 4MSMB 3A9JB 1W1GA 5BO4B 3X0WA 3EC8A 2G35A 3N7CA 4DHJB 2JP2A 1QQGA 1YIWA 2YF0A 3RZWC 2CAYA 2DHKA 1MIZB 1WMHA 1DBHA 4PYZA 5HE0A 2O2VA 2FDQA 4DDGD 2JF5A 3PT2B 3R7RA 3KRXA 3VUWA 3AI5A 4HAZB 3KH0A 3SO6A 3PVUA 2COAA 2L05A 3GOEA 2LYDA 4A6FA 1E8YA 4IW0A 3IFWB 4JKHA 2KMAA 2DN6A 3WYFB 1N3HA 3G9WA 5IAAC 1UNQA 5JHBA 2MBBB 3PLVA 1V49A 1DYNA 2K6QA 4GZUA 3ZIMA 1G6JA 4GPTB 3MJWA 3V60A 3U8ZA 2ELAA 3WALA 2VRRB 2KGXB 2LKOA 1XD3B 3TJPA 2V76A 1WRDB 2CR5A 3M62B 3APDA 4JKGA 2KDIA 4IWPA 2KO3A 3ZRFA 1KBLA 3A8QA 4TUUA 2V3SA 4D0NB 4HWIB 4YONA 3AU5A 2JUOA 3QX1A 4II2B 4B9KA 1WX8A 2I1JA 1LFDA 4GU2A 1W1HA 1OQNA 3DDCB 1WGRA 2Z0EB 4EFOA 1UPQA 4WAAA 1K5GB 2D2QA 1SHCA 1KJTA 2MCNB 1BTNA 1J0WA 3OJ4B 5LXIB 1SGHA 5J18A 4W9GA 4TYZA 4F7GA 4ZRKA 2Z0DB 2DX5B 4B6HA 1PQSA 3PGEA 1DDWA 3SYXA 2YT1A 3ZTCA 4BKGA 2LUEA 2IO2B 4A5KA 2KJHB 3UIPB 1WJNA 2M8SA 2BYFA 2Z0OA 1MKEA 1J8CA 2P0DA 5C6RA 3A98B 4MGZE 3VTWA 1RFAA 2WWZA 2JT4B 3ZNHB 2OOBB 2KQ7A 4KVGB 5DCNA 1RAXA 5JHAA 4URKA 4ICUA 2R82A 2BYVE 1GC7A 1P6SA 2B3AA 2LRUA 4GB9A 5HE2A 1I42A 1X1GA 3DVGY 4AWJA 2J0KA 2AWTA 5KHOA 2XK5B 2LOZA 3SD5A 3NY5A 2MBHA 2J7QB 2D9WA 1WE6A 5GOWB 4TKNA 1D3ZA 2LVOA 5CX3A 2YS5A 2MP2B 4ANVA 5JVLA 2K00A 4GDKB 3KYDD 3ULBA 2LVPA 3RULA 4AUQC 3UINB 2N4FA 2CHXA 4ICVA 3U30A 2D11A 3VIAA 1X11A 1UNPA 2N1WA 2HRJA 3DBSA 3QHTA 2KVRA 1OEYA 1E8XA 1C3TA 2D10A 1OMWA 3VH3B 3QQ8B 1ZSQA 1GC6A 2O6VA 3Q3FA 5D3XA 2AL6A 4OVVA 4A3PA 1UH6A 1PMSA 4K2PA 1WX9A 1ST7A 2L7RA 1ACAA 2ZCBA 2MWNB 1Y19B 2ROZB 1UEFA 1WGGA 3PSEB 1BTKA 1KZ7A 4MGIE 2YS3A 2P0FA 2X0SA 1Q1OA 4NJ6A 4GIVA 2EC1A 2NPTB 4JKDA 2RR9A 3EECA 2NZ8B 2JVCA 2N1VA 2Z59B 2CRFA 2WH5A 3KZ1A 3NZUA 3UIOB 4HPLB 2FJ9A 1IYFA 4KHBB 2K2UA 4W9IA 4DX90 3ZNID 4DBBA 1ZM0A 2MX2A 2KTRB 4FJVB 2G4SA 2KJ6A 4MDKE 4IWQA 1YD8U 2MP2A 2Z0QA 1M94A 1P3QU 2GCLA 5FI0A 5DIFB 3OANA 4M0WB 4CO7A 4HAXB 1AARA 2MRPA 4KSKC 1U5EA 4IAPA 5DI9B 4KV2A 5JZEB 2BF8B 3A1QB 1E8ZA 4YL8A 2REXA 5DHAB 4FBJB 1Z87A 1LQBA 3KUCB 2MFQA 3ZDTA 2QKMA 3C0RB 1K8RB 1X1MA 4W9CA 4EMOA 4MM3A 3D8DA 3QIJA 2MLBA 3L16A 3RZFA 5AEKB 3EFUA 3ODOA 1KM7A 4WJOA 3QCAA 3ENBA 1Z2MA 2C7HA 1QC6A 3Q3JA 4MH0E 4XWXA 4CHMA 3ZW3A 2JZ3B 2NPTA 3UGBB 4HHVA 2LVQA 2XQNM 1VBHA 2RSUA 4BFRA 2CU1A 2IY1B 2KJRA 2ZVNA 3H6NA 4DK5A 3ML8A 1DROA 1WM3A 2VSZA 3IVFA 1XT9B 3TCAA 2A5UA 2DZIA 3IBEA 3H7PB 1X1FA 2KTRA 3HHMA 1Z5SB 2FIDA 3ECIA 3OLMD 4I6PA 3V62A 2D9XA 2D4QA 4KIKB 1J0GA 3N32A 4PS8A 3ZKJC 4EOYA 4W9FA 2R0DA 2QHOA 1P1AA 2ZVOA 5TR5A 4BBNF 2K39A 4Y94A 1XKEA 4IM3A 4FN2A 1NI2A 4FA6A 3UQBA 2RQ1A 1WZ0A 2K8BA 3EHVA 4KZCA 1P3RA 3L13A 3K9OB 3PVWA 3PVLA 1GJZA 3VOQA 2KHWB 2FCSA 4F7HA 1V80A 3L54A 4G0NB 1BWNA 2LBBA 3OAWA 3PZDA 1DIKA 4K2OA 1OY2A 4JLCA 3EPYA 2DKPA 1L7YA 2KD0A 4HXDA 1YX6B 4WJPA 3APFA 4AJWA 3KRWA 3E66A 2IBIB 2WX1A 4E74A 5JHGA 4JK7A 4HVBA 2KLCA 2OQBA 2N9PC 1WF9A 3LJ3A 5DPSA 1FHWA 4XC2A 2ELBA 2IFSA 3DCGA 2DAFA 2KMCA 1S3SG 4FULA 3FEHA 1E7UA 4JKCA 2KOXA 3DXEA 4JK9A 4HDQA 1WFYA 2BGFA 2KC2A 3VQIA 4ZDVA 1E7VA 5C5BA 1CMXB 1YX5B 3F5RA 4HAWB 2KDFB 5DH9B 2LD9A 5AZGA 4HDOA 2AL3A 2KWVB 1U29A 2RVBB 1P9DU 3CSFA 3H7PA 2N9EB 2M14A 5CHWA 4IC7B 4ASWC 1TJ6A 2CODA 2GBRA 3W1YA 1GUAB 4KIKA 4BBKA 3ZTDA 2GS0A 1LB1A 2M4NA 2CS4A 2J0MA 3NHEB 4GMVA 4HCNB 2J0JA 4LJPB 1C1YB 2FCNA 5G2NA 1UBQA 3MDBC 3QK0A 2ASQA 3ZRCA 1NTYA 1V61A 4PYUA 2DYOA 5L83A 4BBNC 4C0AA 1V5MA 1ZVRA 2HD5B 1EF5A 2DLWA 1YQBA 1JDEA 2E2XA 2LASA 4H8SA 3HQCA 3ZLZA 4XX5A 2UZSA 4NSWA 5D7GA 4A3OA 2ZNVB 3VTUA 3D32A 3BINA 4JGHB 4MJSA 2COCA 1E8WA 3VUYA 3HW2B 3TFMA 4ILGB 1U5DA 3WAMA 1VBGA 5FI1A 2LGXA 2LI5A 2KFKB 1DDVA 2FNJB 4BKTA 1R4MI 2XBBC 2KN5A 4F7UP 4IFSA 3A9JA 2CQUA 3T8MA 3SBTA 1X86A 1P5TA 2GMIC 1OTRB 2W2XC 3QA8A 4KZ0A 4HK2A 3DXCA 4WJQA 4W9JA 1OGWA 4B6WA 1H4RA 4WSFA 5CLLB 3VVWB 2L2IA 3H7SA 4ZRJA 3DOWA 3PHWB 3NOBA 5HE3A 3A33B 5GMVA 3TIXA 1BAKA 4PNKA 2IYBA 2KDEB 2GCJA 3N3KB 1MK7B 4JQWC 4FJZA 4KDIC 2KTFA 3A9KB 4G50A 2LULA 4Z2NA 2K6DB 1UBIA 3ODWA 1ISNA 5D94A 4HB2B 3QJZA 3PV1A 4WWOA 4ANUA 2M38A 3KUZA 2YSZA 2PZ1A 2R09A 2KXJA 2K1FA 4IG7B 5DPTA 3P2BA 1TZ1A 3VXWA 3A4RA 1NBFC 5CHVC 1XX0A 2EKEC 2GJYA 2HTHB 3ZVRA 1TXDA 4I6NB 2ZEQA 4GXBA 3SUZA 2NS5A 2V1YA 3VH4B 4AOFA 1WIAA 2I1KA 2HJ8A 3PSCA 1WGUA 4PQ0A 3CXBB 2OJRA 3FM8C 2V4LA 5D2MB 2DYMA 3AXCA 2MSED 1GGOA 1UELA 4OVUA 4BOSC 1MPHA 2DIKA 1IRSA 3M63B 3SNHA 1UNRA 2L3ZA 2Q13A 3M95A 5JHHA 1FOEA 4F7ZA 2AEHA 4HAVB 2CB8A 3ODXA 5EDSA 4NAWB 3PS6A 5CHFA 1YJ1A 2MQJA 4BKSA 3UZTA 2DX5A 2DKQA 3RYTA 2CY5A 2RUKB 4MELA 3TMPB 1F9JA 2RPQA 1Q0WB 1U4AA 2BPSA 2KFJA 3B08A 1I7AA 4PS7A 2Y5BB 3RT3B 4DX8A 3GZNI 3A9KA 5LLIA 4DHZB 2H7DA 3KYCD 1FAOA 4HB0B 1MG8A 2RLOA 5KCVA 1J19A 1WXSA 5AZHA 5J2RA 2D9VA 2BWES 4NNJB 1T0YA 4MY6A 2L8JA 3M1IB 2FCMA 3SU8X 2Y8FA 2UZRA 2K8HA 4KSLC 2ZJDA 4WQOB 2IZVB 2JRIB 2L1CA 2HTHA 5DHFB 2NBVB 3V5WA 4M8NA 2XK5A 2KWUB 3HM6X 1KLVA 4RM8A 1LM8B 3RUIB 4BOZB 3IG3A 1RRBA 4GDKA 3F0WA 1E90A 4JK8A 1WY8A 2NBWB 4WVFB 3VUXA 4KHAA 4NQKE 1GG3A 3PLUA 3N30A 3VFKA 3O96A 2YS1A 2FUHB 1LXDA 2O6VD 1FHXA 4K7SA 2JPHA 3U7DA 4RM9A 2DAJA 1E5WA 3TW1A 1ZW7A 1IP9A 4P7IA 2RNRB 3SDLC 5AZFA 2M1MA 2G3QB 4NAWA 5D6JB 4HAYB 4WJ7A 2MBEA 5C1ZA 4MGYE 3T9LA 2YRYA 5L95C 3CIKA 3PRZA 2IO0B 3ENEA 3V6CB 3UF8A 2EMTA 4HLEA 2WX0A 2DZKA 4NJ7A 1WZ3A 4DHZE 2ROVA 4IM2A 1KI1B 2R2OA 2K2JA 2N0YA 5L81A 3V6EB 2JY6A 1V5UA 2C7MB 3V61A 5LXHA 1WH3A 4EEWA 3P6AA 4EZKA 2MA9B 1FHOA 4FADA 1FGYA 5D27A 2MW5A 2ZNVC 4I6LB 3GYPA 4FHKA 5IJMA 3FP5A 4A6KA 1WXVA 1EAZA 4MK0A 5D3WA 1WMHB 2O2VB 2VRWB 1SIFA 1V5PA 1H10A 4EZJA 2P0HA 2XEWA 3PHXB 2CHZA 3ZNZB 2WDTB 1B55A 3CSTA 1AWEA 2DHIA 3W1SC 3BJIA 4WJNA 2IY0B 4G3XB 5E6NA 4BVUC 3A1QA 2DYQA 1NDDA 1HB6A 4HJKA 1WR6E 2LOXA 3AU4A 4IWOA 2COFA 5JP4A 3SV1A 2UVMA 2JRHA 4K81A 2DHZA 3VTVA 4J6IA 1NTVA 2MKRA 1UPRA 1X05A 5FR6A 1Y5OA 2YLMA 4K7WA 1ZC4B 1XD4A 3A4SC 4LDTD 3RD2A 2LGYA 2KX3A 4JKBA 2KUPA 2DHJA 2RD0A 5D3YA 4FHJA 2LJ5A 2KLGA 1FXTB 4X57B 2FJLA 2CKHB 1Y8RC 3QAQA 3AULA 4IUMB 4HB4B 5J3YA 1I35A 1RLFA 2KANA 5D3VA 2X18A 2KKCA 2FIFA 3WIMA 1UD7A 3TVVA 1HE8A 3QWZB 2LXCA 2EJ8A 1UZXB 2LRWA 1ZKHA 2KX0A 2MBQA 1V5TA 2N9XA 3R66C 3BY4B 1V88A 4HCPB 1MK9B 4NQLB 4DWFA 2GBKA 3QWMA 5DPWA 1NVLA 2DZJA 3DVGX 2NMBA 2DTCA 3ZO5B 5J17A 2DX1A 5C79A 5HKHA 3JW0X 2LGDA 2OTXA 3KUDB 2L00B 5J3QA 3VDZA 3PPAA 1WJ6A 3WA0A 3PEGA 2BCJA 3WAOA 4F1SA 4KHOA 4IM0A 3H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4N I;  3ALB A;  1FGZ A;  3FSS A;  3FLV A;  1K5D B;  1GNU A;  2DZM A;  3DBH I;  2JZZ A;  2PE6 B;  1WE7 A;  3DVN V;  1LW3 A;  2N23 A;  1BT0 A;  2BKR B;  3HIZ A;  3PTF C;  3ML4 A;  4MT7 A;  5CLQ B;  4XZ4 A;  5IA7 A;  2GBN A;  4AJY B;  5J3T A;  2D9Z A;  2R2Q A;  4NPN A;  2KNB A;  1WJM A;  3AJ4 A;  3DBR I;  1U5G A;  1TGZ B;  3CF6 E;  3DQV A;  3M3J A;  3L10 B;  2IYD B;  1U27 A;  4M8M A;  5DPR A;  2WYQ A;  2KCJ A;  2YVC A;  2MBO A;  2CHW A;  2O6V B;  3GYO A;  1EVH A;  2DYN A;  1WXA A;  2LXA A;  1TBE A;  2M17 A;  3ZDM C;  2I5F A;  4AP4 C;  1V2Y A;  3VHT C;  2P8V A;  5JH5 C;  1MIX A;  4EKU A;  1WGD A;  1WVH A;  5G55 A;  4DBG A;  3A8P A;  4GDL B;  4L6E A;  5HE1 A;  1ZC3 B;  1IPG A;  1W1D A;  4G11 A;  2PEA A;  2C60 A;  2GBJ A;  3TL5 A;  4N9F 4;  4GMX B;  4DHJ D;  3RCP A;  4B95 A;  1WGQ A;  3PG7 A;  2N7D A;  2NVU I;  1WJU A;  3NSU A;  1FB8 A;  3WAN A;  2KFK A;  2PPH A;  4LCD E;  1XCG A;  4MSQ B;  3LJU X;  2RGF A;  2ZPY A;  2BKF A;  2KC1 A;  1V89 A;  3D8E A;  1V6E A;  3L0W B;  3W1S A;  1WR1 A;  2K25 A;  2KQS A;  3R7Q A;  2G45 B;  4DXA B;  5C16 A;  5KQ4 A;  4W9K A;  3JSV B;  1RJ2 A;  1VCB A;  1EGX A;  2L0F A;  4W9D A;  2Y7B A;  2K8C A;  4GOC A;  2NBU A;  5LOP B;  1V81 A;  2C9W B;  5EFX A;  1XQQ A;  2RGN B;  1EO6 A;  3QAR A;  3TBL D;  2W2W A;  3TO1 A;  5LON B;  1WGY A;  4HPM B;  3MPX A;  1XOD A;  4GSW A;  1U2B A;  4W9H A;  2LZ6 A;  3APC A;  2CY4 A;  1PFJ A;  3PRP B;  2D3G A;  2I5C A;  2G4D B;  4GDL A;  1I2H A;  2AYO B;  4LDT B;  3L17 A;  1WI1 A;  3P7Z A;  4GN1 A;  4MEM A;  3ZUN A;  4CHJ A;  3D8F A;  1V86 A;  4TQ0 A;  1S1Q B;  1L2N A;  1M7R A;  2D9Y A;  4DDI D;  2J59 M;  2RSG A;  3NS8 A;  2N7E A;  1XR0 B;  1AQC A;  1ZGU B;  3K9P B;  1P98 A;  2LWP A;  2FAZ A;  2D07 B;  4E71 A;  2Z0P A;  4K17 A;  1WXM A;  4CHK A;  4ZYN A;  4WWP A;  1WJ1 A;  3ONS A;  4ANX A;  4TV3 A;  1KZG A;  4BKS D;  4RMA A;  3VAW A;  2JXX A;  2C5L C;  3H9D A;  4F8C B;  5CTR C;  1EF1 A;  3O65 B;  4JL9 A;  3DBL I;  4W9E A;  3IHP C;  3KW5 B;  1HBK A;  3I3T B;  2EMS A;  1WJ4 A;  2KK8 A;  4NY0 A;  4K1R B;  4EZL A;  1NU2 A;  2COP A;  4GGQ A;  2L76 A;  5E6O A;  3JSV A;  1Q5W B;  4ANW A;  2IO1 B;  3SHQ A;  2KWC A;  3JVZ X;  4HAT B;  1PLS A;  1WG7 A;  3MTN B;  3PRE A;  4KAX B;  1NTI A;  2NCN A;  3ZNG C;  4PS3 A;  1TQZ A;  4HAU B;  1WX7 A;  3R3M A;  2M0X A;  4ZRI A;  5E6P A;  1WM2 A;  1OQY A;  3OJ3 A;  3DVN U;  1UGM A;  3WAP A;  3B0A A;  1DDM A;  4CYE A;  1MAI A;  2H7E A;  2A4Z A;  1VD2 A;  2C7N B;  2DA0 A;  2ZCC A;  2DFK A;  3KVF B;  2DEN B;  4W9L A;  3JYU A;  1Q67 A;  2Y8G A;  2GBM A;  3QBV B;  2ZPN A;  3QC8 B;  4E3C A;  5C5B B;  3S2A A;  4Z2M B;  1TTN A;  4K7U A;  4A6H A;  1WGH A;  3PP2 A;  5JLJ B;  2NR2 A;  3L08 A;  3ULC A;  4FLH A;  2YT0 A;  3DXD A;  1OEY J;  2IO3 B;  4EUT A;  1A5R A;  2MDX A;  3KY9 A;  4A6F B;  4LJO B;  1QZE A;  2VKI A;  3UQA A;  2UYZ B;  2L0T A;  1EUV B;  2BYE A;  3B1L X;  2ABD A;  4EJN A;  3ML9 A;  2W9N A;  1RRP B;  4A20 A;  2PJH A;  2ADZ A;  1JRU A;  3HM3 A;  4HB3 B;  1V9J A;  3CMM B;  1HB8 A;  4MGK E;  3RCZ A;  2KZR A;  3X23 A;  1H8C A;  1U5F A;  3PRM B;  1WI0 A;  4TQ1 A;  4IOY X;  3MHS D;  2KDB A;  1V5O A;  2MWS B;  4KDL B;  1WYW B;  5C23 A;  2FCQ A;  3LDZ E;  3KSY A;  2UWQ A;  1P0R A;  2ZZP B;  2GOW A;  3DPD A;  1KOT A;  5KHQ A;  2DYB A;  4II3 B;  2LG1 A;  2HE7 A;  4MJS B;  1SE9 A;  2QKL A;  3HK0 A;  5KQ1 A;  3ZVV A;  2BWF A;  2JWZ A;  2W2X D;  4FJY A;  3T06 A;  1M7E A;  4JIO U;  2PE9 A;  3NZS A;  4WWN A;  4MSM B;  3A9J B;  1W1G A;  5BO4 B;  3X0W A;  3EC8 A;  2G35 A;  3N7C A;  4DHJ B;  2JP2 A;  1QQG A;  1YIW A;  2YF0 A;  3RZW C;  2CAY A;  2DHK A;  1MIZ B;  1WMH A;  1DBH A;  4PYZ A;  5HE0 A;  2O2V A;  2FDQ A;  4DDG D;  2JF5 A;  3PT2 B;  3R7R A;  3KRX A;  3VUW A;  3AI5 A;  4HAZ B;  3KH0 A;  3SO6 A;  3PVU A;  2COA A;  2L05 A;  3GOE A;  2LYD A;  4A6F A;  1E8Y A;  4IW0 A;  3IFW B;  2KMA A;  2DN6 A;  3WYF B;  1N3H A;  3G9W A;  5IAA C;  1UNQ A;  5JHB A;  2MBB B;  3PLV A;  1V49 A;  1DYN A;  2K6Q A;  4GZU A;  3ZIM A;  1G6J A;  4GPT B;  3MJW A;  3V60 A;  3U8Z A;  2ELA A;  3WAL A;  2VRR B;  2KGX B;  2LKO A;  1XD3 B;  3TJP A;  2V76 A;  1WRD B;  2CR5 A;  3M62 B;  3APD A;  2KDI A;  4IWP A;  2KO3 A;  3ZRF A;  3A8Q A;  4TUU A;  2V3S A;  4D0N B;  4HWI B;  4YON A;  3AU5 A;  2JUO A;  3QX1 A;  4II2 B;  4B9K A;  1WX8 A;  2I1J A;  1LFD A;  4GU2 A;  1W1H A;  1OQN A;  3DDC B;  1WGR A;  2Z0E B;  4EFO A;  1UPQ A;  4WAA A;  1K5G B;  2D2Q A;  1SHC A;  1KJT A;  2MCN B;  1BTN A;  1J0W A;  3OJ4 B;  5LXI B;  1SGH A;  5J18 A;  4W9G A;  4TYZ A;  4F7G A;  4ZRK A;  2Z0D B;  2DX5 B;  4B6H A;  1PQS A;  3PGE A;  1DDW A;  3SYX A;  2YT1 A;  3ZTC A;  4BKG A;  2LUE A;  2IO2 B;  4A5K A;  2KJH B;  3UIP B;  1WJN A;  2M8S A;  2BYF A;  2Z0O A;  1MKE A;  1J8C A;  2P0D A;  5C6R A;  3A98 B;  4MGZ E;  3VTW A;  1RFA A;  2WWZ A;  2JT4 B;  3ZNH B;  2OOB B;  2KQ7 A;  4KVG B;  5DCN A;  1RAX A;  5JHA A;  4URK A;  4ICU A;  2BYV E;  1GC7 A;  1P6S A;  2B3A A;  2LRU A;  4GB9 A;  5HE2 A;  1I42 A;  1X1G A;  3DVG Y;  4AWJ A;  2J0K A;  2AWT A;  5KHO A;  2XK5 B;  2LOZ A;  3SD5 A;  3NY5 A;  2MBH A;  2J7Q B;  2D9W A;  1WE6 A;  5GOW B;  4TKN A;  1D3Z A;  2LVO A;  5CX3 A;  2YS5 A;  2MP2 B;  4ANV A;  2K00 A;  4GDK B;  3KYD D;  3ULB A;  2LVP A;  3RUL A;  4AUQ C;  3UIN B;  2N4F A;  2CHX A;  4ICV A;  3U30 A;  2D11 A;  3VIA A;  1X11 A;  1UNP A;  2N1W A;  2HRJ A;  3DBS A;  3QHT A;  2KVR A;  1OEY A;  1E8X A;  1C3T A;  2D10 A;  1OMW A;  3VH3 B;  3QQ8 B;  1ZSQ A;  1GC6 A;  2O6V A;  3Q3F A;  5D3X A;  2AL6 A;  4OVV A;  4A3P A;  1UH6 A;  1PMS A;  4K2P A;  1WX9 A;  1ST7 A;  2L7R A;  1ACA A;  2ZCB A;  2MWN B;  1Y19 B;  2ROZ B;  1UEF A;  1WGG A;  3PSE B;  1BTK A;  1KZ7 A;  4MGI E;  2YS3 A;  2P0F A;  1Q1O A;  4NJ6 A;  4GIV A;  2EC1 A;  2NPT B;  2RR9 A;  3EEC A;  2NZ8 B;  2JVC A;  2N1V A;  2Z59 B;  2CRF A;  2WH5 A;  3KZ1 A;  3NZU A;  3UIO B;  4HPL B;  2FJ9 A;  1IYF A;  4KHB B;  2K2U A;  4W9I A;  4DX9 0;  3ZNI D;  4DBB A;  1ZM0 A;  2MX2 A;  2KTR B;  4FJV B;  2G4S A;  2KJ6 A;  4MDK E;  4IWQ A;  1YD8 U;  2MP2 A;  2Z0Q A;  1M94 A;  1P3Q U;  2GCL A;  5FI0 A;  5DIF B;  3OAN A;  4M0W B;  4CO7 A;  4HAX B;  1AAR A;  2MRP A;  4KSK C;  1U5E A;  4IAP A;  5DI9 B;  4KV2 A;  5JZE B;  2BF8 B;  3A1Q B;  1E8Z A;  4YL8 A;  2REX A;  5DHA B;  4FBJ B;  1Z87 A;  1LQB A;  3KUC B;  2MFQ A;  3ZDT A;  2QKM A;  3C0R B;  1K8R B;  1X1M A;  4W9C A;  4EMO A;  4MM3 A;  3D8D A;  3QIJ A;  2MLB A;  3L16 A;  3RZF A;  5AEK B;  3EFU A;  3ODO A;  1KM7 A;  4WJO A;  3QCA A;  1Z2M A;  2C7H A;  1QC6 A;  3Q3J A;  4MH0 E;  4XWX A;  4CHM A;  3ZW3 A;  2JZ3 B;  2NPT A;  3UGB B;  4HHV A;  2LVQ A;  2XQN M;  2RSU A;  4BFR A;  2CU1 A;  2IY1 B;  2KJR A;  2ZVN A;  3H6N A;  4DK5 A;  3ML8 A;  1DRO A;  1WM3 A;  2VSZ A;  3IVF A;  1XT9 B;  3TCA A;  2A5U A;  2DZI A;  3IBE A;  3H7P B;  1X1F A;  2KTR A;  3HHM A;  1Z5S B;  2FID A;  3ECI A;  3OLM D;  4I6P A;  3V62 A;  2D9X A;  2D4Q A;  4KIK B;  1J0G A;  3N32 A;  4PS8 A;  3ZKJ C;  4EOY A;  4W9F A;  2R0D A;  2QHO A;  1P1A A;  2ZVO A;  5TR5 A;  4BBN F;  2K39 A;  4Y94 A;  1XKE A;  4IM3 A;  4FN2 A;  1NI2 A;  4FA6 A;  3UQB A;  2RQ1 A;  1WZ0 A;  2K8B A;  3EHV A;  4KZC A;  1P3R A;  3L13 A;  3K9O B;  3PVW A;  3PVL A;  1GJZ A;  3VOQ A;  2KHW B;  2FCS A;  4F7H A;  1V80 A;  3L54 A;  4G0N B;  1BWN A;  2LBB A;  3OAW A;  3PZD A;  4K2O A;  1OY2 A;  4JLC A;  3EPY A;  2DKP A;  1L7Y A;  2KD0 A;  4HXD A;  1YX6 B;  4WJP A;  3APF A;  4AJW A;  3KRW A;  2IBI B;  2WX1 A;  4E74 A;  5JHG A;  4HVB A;  2KLC A;  2OQB A;  2N9P C;  1WF9 A;  3LJ3 A;  5DPS A;  1FHW A;  4XC2 A;  2ELB A;  2IFS A;  3DCG A;  2DAF A;  2KMC A;  1S3S G;  4FUL A;  3FEH A;  1E7U A;  2KOX A;  3DXE A;  4HDQ A;  1WFY A;  2BGF A;  2KC2 A;  3VQI A;  4ZDV A;  1E7V A;  5C5B A;  1CMX B;  1YX5 B;  3F5R A;  4HAW B;  2KDF B;  5DH9 B;  2LD9 A;  5AZG A;  4HDO A;  2AL3 A;  2KWV B;  1U29 A;  2RVB B;  1P9D U;  3CSF A;  3H7P A;  2N9E B;  2M14 A;  5CHW A;  4IC7 B;  4ASW C;  1TJ6 A;  2COD A;  2GBR A;  3W1Y A;  1GUA B;  4KIK A;  4BBK A;  3ZTD A;  2GS0 A;  1LB1 A;  2M4N A;  2CS4 A;  2J0M A;  3NHE B;  4GMV A;  4HCN B;  2J0J A;  4LJP B;  1C1Y B;  2FCN A;  5G2N A;  1UBQ A;  3MDB C;  3QK0 A;  2ASQ A;  3ZRC A;  1NTY A;  1V61 A;  4PYU A;  2DYO A;  5L83 A;  4BBN C;  4C0A A;  1V5M A;  1ZVR A;  2HD5 B;  1EF5 A;  2DLW A;  1YQB A;  2E2X A;  2LAS A;  4H8S A;  3HQC A;  3ZLZ A;  4XX5 A;  2UZS A;  4NSW A;  5D7G A;  4A3O A;  2ZNV B;  3VTU A;  3D32 A;  3BIN A;  4JGH B;  4MJS A;  2COC A;  1E8W A;  3VUY A;  3HW2 B;  3TFM A;  1U5D A;  3WAM A;  5FI1 A;  2LGX A;  2LI5 A;  2KFK B;  1DDV A;  2FNJ B;  4BKT A;  1R4M I;  2XBB C;  2KN5 A;  4F7U P;  4IFS A;  3A9J A;  2CQU A;  3T8M A;  1X86 A;  1P5T A;  2GMI C;  1OTR B;  2W2X C;  3QA8 A;  4KZ0 A;  4HK2 A;  3DXC A;  4WJQ A;  4W9J A;  1OGW A;  4B6W A;  1H4R A;  4WSF A;  5CLL B;  3VVW B;  2L2I A;  3H7S A;  4ZRJ A;  3DOW A;  3PHW B;  3NOB A;  5HE3 A;  3A33 B;  5GMV A;  3TIX A;  1BAK A;  4PNK A;  2IYB A;  2KDE B;  2GCJ A;  3N3K B;  1MK7 B;  4JQW C;  4FJZ A;  4KDI C;  2KTF A;  3A9K B;  2LUL A;  4G50 A;  4Z2N A;  2K6D B;  1UBI A;  3ODW A;  1ISN A;  5D94 A;  4HB2 B;  3QJZ A;  3PV1 A;  4WWO A;  4ANU A;  2M38 A;  3KUZ A;  2YSZ A;  2PZ1 A;  2R09 A;  2KXJ A;  2K1F A;  4IG7 B;  5DPT A;  3P2B A;  1TZ1 A;  3VXW A;  3A4R A;  1NBF C;  5CHV C;  1XX0 A;  2EKE C;  2GJY A;  2HTH B;  3ZVR A;  1TXD A;  4I6N B;  2ZEQ A;  4GXB A;  3SUZ A;  2NS5 A;  2V1Y A;  3VH4 B;  4AOF A;  1WIA A;  2I1K A;  2HJ8 A;  3PSC A;  1WGU A;  4PQ0 A;  3CXB B;  2OJR A;  3FM8 C;  2V4L A;  5D2M B;  2DYM A;  3AXC A;  2MSE D;  1UEL A;  4OVU A;  4BOS C;  1MPH A;  1IRS A;  3M63 B;  3SNH A;  1UNR A;  2L3Z A;  2Q13 A;  3M95 A;  5JHH A;  1FOE A;  4F7Z A;  2AEH A;  4HAV B;  2CB8 A;  3ODX A;  5EDS A;  4NAW B;  3PS6 A;  5CHF A;  1YJ1 A;  2MQJ A;  4BKS A;  3UZT A;  2DX5 A;  2DKQ A;  3RYT A;  2CY5 A;  2RUK B;  4MEL A;  3TMP B;  1F9J A;  2RPQ A;  1Q0W B;  1U4A A;  2BPS A;  2KFJ A;  3B08 A;  1I7A A;  4PS7 A;  2Y5B B;  3RT3 B;  4DX8 A;  3GZN I;  3A9K A;  5LLI A;  4DHZ B;  2H7D A;  3KYC D;  1FAO A;  4HB0 B;  1MG8 A;  2RLO A;  5KCV A;  1J19 A;  1WXS A;  5AZH A;  5J2R A;  2D9V A;  2BWE S;  4NNJ B;  1T0Y A;  4MY6 A;  2L8J A;  3M1I B;  2FCM A;  3SU8 X;  2Y8F A;  2UZR A;  2K8H A;  4KSL C;  2ZJD A;  4WQO B;  2IZV B;  2JRI B;  2L1C A;  2HTH A;  5DHF B;  2NBV B;  3V5W A;  4M8N A;  2XK5 A;  2KWU B;  3HM6 X;  1KLV A;  4RM8 A;  1LM8 B;  3RUI B;  4BOZ B;  3IG3 A;  1RRB A;  4GDK A;  3F0W A;  1E90 A;  1WY8 A;  2NBW B;  4WVF B;  3VUX A;  4KHA A;  4NQK E;  1GG3 A;  3PLU A;  3N30 A;  3VFK A;  3O96 A;  2YS1 A;  2FUH B;  1LXD A;  2O6V D;  1FHX A;  4K7S A;  2JPH A;  3U7D A;  4RM9 A;  2DAJ A;  1E5W A;  3TW1 A;  1ZW7 A;  1IP9 A;  4P7I A;  2RNR B;  3SDL C;  5AZF A;  2M1M A;  2G3Q B;  4NAW A;  5D6J B;  4HAY B;  4WJ7 A;  2MBE A;  5C1Z A;  4MGY E;  3T9L A;  2YRY A;  5L95 C;  3CIK A;  3PRZ A;  2IO0 B;  3ENE A;  3V6C B;  3UF8 A;  2EMT A;  4HLE A;  2WX0 A;  2DZK A;  4NJ7 A;  1WZ3 A;  4DHZ E;  2ROV A;  4IM2 A;  1KI1 B;  2R2O A;  2K2J A;  2N0Y A;  5L81 A;  3V6E B;  2JY6 A;  1V5U A;  2C7M B;  3V61 A;  5LXH A;  1WH3 A;  4EEW A;  3P6A A;  4EZK A;  2MA9 B;  1FHO A;  4FAD A;  1FGY A;  5D27 A;  2MW5 A;  2ZNV C;  4I6L B;  3GYP A;  4FHK A;  5IJM A;  3FP5 A;  4A6K A;  1WXV A;  1EAZ A;  4MK0 A;  5D3W A;  1WMH B;  2O2V B;  2VRW B;  1SIF A;  1V5P A;  1H10 A;  4EZJ A;  2P0H A;  2XEW A;  3PHX B;  2CHZ A;  3ZNZ B;  2WDT B;  1B55 A;  3CST A;  1AWE A;  2DHI A;  3W1S C;  3BJI A;  4WJN A;  2IY0 B;  4G3X B;  5E6N A;  4BVU C;  3A1Q A;  2DYQ A;  1NDD A;  1HB6 A;  4HJK A;  1WR6 E;  2LOX A;  3AU4 A;  4IWO A;  2COF A;  5JP4 A;  3SV1 A;  2UVM A;  2JRH A;  4K81 A;  2DHZ A;  3VTV A;  4J6I A;  1NTV A;  1UPR A;  1X05 A;  2MKR A;  5FR6 A;  1Y5O A;  2YLM A;  4K7W A;  1ZC4 B;  1XD4 A;  3A4S C;  4LDT D;  3RD2 A;  2LGY A;  2KX3 A;  2KUP A;  2DHJ A;  2RD0 A;  5D3Y A;  4FHJ A;  2LJ5 A;  2KLG A;  1FXT B;  4X57 B;  2FJL A;  2CKH B;  1Y8R C;  3QAQ A;  3AUL A;  4IUM B;  4HB4 B;  5J3Y A;  1I35 A;  1RLF A;  2KAN A;  5D3V A;  2X18 A;  2KKC A;  2FIF A;  3WIM A;  1UD7 A;  3TVV A;  1HE8 A;  3QWZ B;  2LXC A;  2EJ8 A;  1UZX B;  2LRW A;  1ZKH A;  2KX0 A;  2MBQ A;  1V5T A;  2N9X A;  3R66 C;  3BY4 B;  1V88 A;  4HCP B;  1MK9 B;  4NQL B;  4DWF A;  2GBK A;  3QWM A;  5DPW A;  1NVL A;  2DZJ A;  3DVG X;  2NMB A;  2DTC A;  3ZO5 B;  5J17 A;  2DX1 A;  5C79 A;  5HKH A;  3JW0 X;  2LGD A;  2OTX A;  3KUD B;  2L00 B;  5J3Q A;  3VDZ A;  3PPA A;  1WJ6 A;  3WA0 A;  3PEG A;  2BCJ A;  3WAO A;  4F1S A;  4KHO A;  4IM0 A;  3H1U A; 
#chains in the Genus database with same CATH topology
 1R4N I;  3ALB A;  1L6V A;  1TS2 A;  1XCQ L;  3U52 E;  1FGZ A;  3FSS A;  2LEK A;  3AV8 A;  3E9L A;  2K8E A;  3FLV A;  1K5D B;  4RGO S;  1XLP A;  1GNU A;  2QIL A;  2DZM A;  3DBH I;  2JZZ A;  3HUI A;  2PE6 B;  3MP9 A;  1WE7 A;  4WWM A;  5D3D A;  1JCK B;  3DVN V;  1AW7 A;  4N58 A;  1T0R C;  1LW3 A;  2N23 A;  1BT0 A;  2BKR B;  3HIZ A;  2PVG C;  3PTF C;  3ML4 A;  4XGA B;  4MT7 A;  5CLQ B;  4XZ4 A;  1SEB D;  5IA7 A;  2L1A A;  1F2R I;  2GBN A;  2QIE B;  1XEE A;  4AJY B;  5J3T A;  2D9Z A;  3EGR A;  2B76 B;  2R2Q A;  1PGA A;  4K3B A;  4NPN A;  1ZE3 D;  2KNB A;  1WJM A;  3AJ4 A;  3DBR I;  2WXO A;  1U5G A;  1TGZ B;  2M19 A;  5BYS A;  3CF6 E;  2MH7 A;  3DQV A;  3M3J A;  3L10 B;  3IAM 1;  4OVZ A;  3FIL A;  3AE1 B;  2IYD B;  3ZYY X;  3Q69 A;  1XLO A;  1U27 A;  4M8M A;  5DPR A;  1ZP0 B;  4S0R A;  2WYQ A;  1Y56 A;  2KCJ A;  2YVC A;  2MBO A;  2CHW A;  2O6V B;  4US9 A;  3GYO A;  1EVH A;  2DYN A;  1SXT A;  1MVK A;  1WXA A;  2WQY B;  5BYQ A;  3RI7 C;  3V05 A;  2LXA A;  1TBE A;  3RN9 C;  2M17 A;  2H89 B;  3ZDM C;  2I5F A;  4AP4 C;  1UWX A;  1GOZ A;  1KC7 A;  5H92 C;  1FXI A;  1V2Y A;  3SEB A;  3VHT C;  2P8V A;  3WCQ A;  5JH5 C;  1MIX A;  3GS2 A;  4EKU A;  1WGD A;  1R4N B;  4M00 A;  1QF6 A;  2WHI A;  3AE8 B;  1WVH A;  1KLU D;  5G55 A;  4DBG A;  3NRZ A;  3A8P A;  4GDL B;  4L6E A;  4TSS A;  2WP9 B;  3Q8C A;  4OSN A;  5HE1 A;  4MT5 A;  1ZC3 B;  1IPG A;  2JU6 X;  1W1D A;  3P4P B;  4G11 A;  2PEA A;  1ZOY B;  2BYT A;  2C60 A;  4L2Y A;  2GBJ A;  4PT5 A;  3TL5 A;  4N9F 4;  4GMX B;  2VH2 A;  4DHJ D;  3RCP A;  4B95 A;  1WGQ A;  3PG7 A;  1V1P B;  4HPP A;  2N7D A;  2NVU I;  3W5U B;  1WJU A;  3NSU A;  1XO3 A;  1FB8 A;  1PFD A;  3WAN A;  2KFK A;  2PPH A;  3E9P A;  4LCD E;  1XCG A;  4MSQ B;  3LJU X;  2RGF A;  1TZO A;  1YMH E;  1WRI A;  2ZPY A;  2BKF A;  2KC1 A;  1QKZ A;  4WQM A;  1OFF A;  3NWA A;  4OW0 A;  1JWA D;  4JKF A;  1TJE A;  1V89 A;  3D8E A;  1V6E A;  1N63 A;  3L0W B;  2W3R A;  2LMC A;  3W1S A;  4YT0 B;  1WR1 A;  2K25 A;  1F77 A;  2KQS A;  1L4Z B;  3R7Q A;  2G45 B;  4NJC A;  1FEH A;  3NVW A;  1WGK A;  4XWW A;  4DXA B;  4RGM A;  5C16 A;  5KQ4 A;  4W9K A;  3JSV B;  1RJ2 A;  4OZC A;  1VCB A;  4LNK A;  1EGX A;  3AEG B;  2WU2 B;  2L0F A;  2WS3 B;  2OHF A;  4W9D A;  3ZGZ A;  2Y7B A;  1IBX B;  2K8C A;  4GOC A;  2NBU A;  5LOP B;  1V97 A;  1V81 A;  2C9W B;  5EFX A;  2EKI A;  4K3C A;  4MM3 B;  4AS1 A;  1HXY D;  1QOA A;  1XQQ A;  2RGN B;  1EO6 A;  3QAR A;  2D3A A;  2J53 A;  1DOY A;  1JQ4 A;  1QLB B;  3TBL D;  2W2W A;  3TO1 A;  3E56 A;  4ILH A;  2INN E;  1PGX A;  2N9L A;  5LON B;  4ZHO A;  1WGY A;  4HPM B;  3MPX A;  1XOD A;  4GSW A;  1U2B A;  4LNF A;  4W9H A;  2LZ6 A;  3Q6B A;  5MPO A;  3APC A;  2CY4 A;  1PFJ A;  3PRP B;  3AEC B;  2Z4D A;  2D3G A;  2I5C A;  2G4D B;  4GDL A;  3AE5 B;  1I2H A;  2KUQ A;  2AYO B;  4LDT B;  3L17 A;  5E6J A;  1WI1 A;  3P7Z A;  4GN1 A;  4MEM A;  3ZUN A;  4CHJ A;  3D8F A;  2G9H D;  1V86 A;  4TQ0 A;  1S1Q B;  2Z13 A;  3KWV A;  4B0M A;  1L2N A;  1M7R A;  2D9Y A;  4DDI D;  2J59 M;  2RSG A;  2GB1 A;  2N7E A;  1XR0 B;  1AQC A;  3MC9 A;  1MG4 A;  3NS8 A;  1ZGU B;  3DHI C;  1P98 A;  3K9P B;  2BBC A;  2LWP A;  2FAZ A;  2D07 B;  4E71 A;  3AMZ A;  2Z0P A;  4K17 A;  1HA5 A;  1STE A;  2QJL A;  1WXM A;  4YWG G;  5C3J B;  2RDG A;  4CHK A;  4ZYN A;  4WWP A;  1WJ1 A;  4C56 C;  3N1Y C;  3ONS A;  5D3I B;  4ANX A;  4TV3 A;  1KZG A;  4BKS D;  4RMA A;  4DQO C;  3VAW A;  2JXX A;  5LNK 1;  2C5L C;  3H9D A;  4P1B C;  1TKG A;  1TYG B;  4QJ3 B;  4F8C B;  5CTR C;  1EF1 A;  3O65 B;  4JL9 A;  3Q3O C;  1I4R A;  3DBL I;  4W9E A;  3IHP C;  3KW5 B;  3VRB B;  1HBK A;  1HZ5 A;  3I3T B;  3I5J C;  2EMS A;  1WJ4 A;  2ON8 A;  3TSS A;  2KK8 A;  4NY0 A;  4K1R B;  4EZL A;  1NU2 A;  2COP A;  4L1R A;  4GGQ A;  4JKE A;  2L76 A;  5E6O A;  3JSV A;  1Q5W B;  3C19 A;  3I63 C;  4ANW A;  2IO1 B;  3SHQ A;  1IGC A;  2KWC A;  3JVZ X;  4HAT B;  3NG0 A;  1PLS A;  3DCX A;  1D4B A;  1WG7 A;  3MTN B;  3PRE A;  4KAX B;  4IDI A;  4HKQ A;  1NTI A;  4WIP A;  2NCN A;  3ZNG C;  2OJW A;  4PS3 A;  1TQZ A;  2RDH A;  1F0Z A;  4HAU B;  1T3Q A;  1WX7 A;  3R3M A;  2M0X A;  4ZRI A;  4JKA A;  3B2F A;  3E9O A;  5E6P A;  1NI3 A;  2K5P A;  1WM2 A;  3V3X A;  1OQY A;  3OJ3 A;  3DVN U;  1UGM A;  1N5W A;  3NZ3 A;  3AE7 B;  2BB5 A;  2K9X A;  3WAP A;  1TT5 B;  4LNN A;  4XDD A;  1YJI A;  4RGT A;  1QIL A;  1L0X B;  3B0A A;  2HDE A;  1DDM A;  4CYE A;  1MAI A;  2VZK D;  2H7E A;  2A4Z A;  1VZ6 A;  1VD2 A;  2NBV A;  2C7N B;  2DA0 A;  4BZA A;  2ZCC A;  2DFK A;  1SE4 A;  3KVF B;  2DEN B;  4W9L A;  3JYU A;  1Q67 A;  2Y8G A;  2GBM A;  3QBV B;  2ZPN A;  3QC8 B;  4E3C A;  3SR6 A;  5C5B B;  3S2A A;  1SE2 A;  4Z2M B;  1TTN A;  4K7U A;  4A6H A;  3ZXR A;  1DOX A;  1WGH A;  3PP2 A;  5JLJ B;  1N62 A;  1GPX A;  2NR2 A;  3L08 A;  3AE3 B;  3ULC A;  4FLH A;  2YT0 A;  2W55 A;  1FCC C;  3DXD A;  1OEY J;  2IO3 B;  3B2G A;  3ZJV A;  4EUT A;  2WXJ A;  4KGR A;  1A5R A;  2MDX A;  3KY9 A;  4A6F B;  4LJO B;  1KFY B;  1QZE A;  1TKE A;  2VKI A;  3UQA A;  1JWM D;  2UYZ B;  2L0T A;  4A90 A;  1EUV B;  1HEZ E;  3DBL B;  2BYE A;  3B1L X;  2ABD A;  1KRH A;  4EJN A;  3ML9 A;  1ROE A;  2W9N A;  3J9C A;  1RRP B;  4A20 A;  2PJH A;  2ADZ A;  1JRU A;  3HM3 A;  3MJ5 A;  4HB3 B;  3TUO A;  1V9J A;  2IND C;  3NS1 A;  3CMM B;  3UI3 A;  1HB8 A;  4MGK E;  2RPV A;  1C77 A;  3RCZ A;  2KZR A;  3X23 A;  1H8C A;  3NVV A;  1U5F A;  2MHJ A;  3PRM B;  1WI0 A;  4TQ1 A;  4JKG B;  4IOY X;  3MHS D;  5HHD G;  2KDB A;  2MJE A;  1V5O A;  3PO0 A;  2MWS B;  4KDL B;  1WYW B;  5C23 A;  3N1Z C;  2FCQ A;  3LDZ E;  3KSY A;  1HTQ A;  2UWQ A;  4ZRP A;  4DXF A;  1P0R A;  1ZXI A;  2ZZP B;  2GOW A;  3DPD A;  1KOT A;  5KHQ A;  4ILJ A;  2DYB A;  4II3 B;  2LG1 A;  2HE7 A;  4MJS B;  1SE9 A;  3SBG A;  1K50 A;  2QKL A;  3HK0 A;  5KQ1 A;  3ZVV A;  1CZP A;  2BWF A;  2JWZ A;  2W2X D;  1JML A;  1WYG A;  4FJY A;  3T06 A;  1M7E A;  4JIO U;  1YQ3 B;  2PE9 A;  3NZS A;  4WWN A;  1TS3 A;  4MSM B;  3A9J B;  1W1G A;  5BO4 B;  3X0W A;  1YJJ A;  3EC8 A;  2G35 A;  3N7C A;  4DHJ B;  1RWS A;  2WXF A;  2JP2 A;  1QQG A;  1YIW A;  2YF0 A;  3RZW C;  2QDF A;  3BYT B;  2CAY A;  1VDV A;  4RNA A;  2DHK A;  1MIZ B;  1WMH A;  1DBH A;  4PYZ A;  5HE0 A;  2O2V A;  2FDQ A;  3RMK C;  4DDG D;  2PIA A;  2BS2 B;  2JF5 A;  3PT2 B;  3ABV B;  2J4X A;  1FIQ A;  3R7R A;  3KRX A;  3VUW A;  3AI5 A;  4HAZ B;  2Z8L A;  3KH0 A;  4AQ7 A;  3NWD A;  3SO6 A;  4LNI A;  4XE0 A;  1ZDV A;  3PVU A;  2COA A;  2L05 A;  3GOE A;  2LYD A;  4A6F A;  1E8Y A;  4IW0 A;  3IFW B;  4JKH A;  1SSN A;  2KMA A;  2DN6 A;  4M02 A;  3P42 A;  3WYF B;  3KLS X;  1AWD A;  3N1X C;  3AE4 B;  1N3H A;  3G9W A;  5IRS A;  5IAA C;  1UNQ A;  1BML C;  5JHB A;  1FXA A;  2MBB B;  3BZD B;  3PLV A;  2SEB D;  3AM9 A;  1GAQ B;  1V49 A;  1DYN A;  2KAC A;  2AQ1 B;  4JWS C;  3FVC A;  2K6Q A;  4GZU A;  3ZIM A;  1G6J A;  4GPT B;  1I4Q A;  3IAS 1;  3MJW A;  1D5X C;  3V60 A;  3U8Z A;  2ELA A;  3WAL A;  2VRR B;  2KGX B;  2LKO A;  1CK1 A;  2KT7 A;  2JWU A;  2LGI A;  1XD3 B;  1TY0 A;  3TJP A;  2LJI A;  2M0A A;  3OG5 A;  2V76 A;  1WRD B;  2CR5 A;  3M62 B;  3APD A;  4JKG A;  2KDI A;  4IWP A;  2K0P A;  2IJ0 A;  2KO3 A;  4RCO A;  2IPK D;  3ZRF A;  1KBL A;  1FNV A;  2N0S B;  5M4Y B;  2CU3 A;  3A8Q A;  4TUU A;  2V3S A;  3Q14 C;  4D0N B;  4HWI B;  4YON A;  4DIX A;  3P1M A;  3AU5 A;  2JUO A;  3QX1 A;  4II2 B;  4B9K A;  1WX8 A;  5HFY A;  1ET9 A;  1J7A A;  2I1J A;  1C76 A;  1LFD A;  4GU2 A;  3CIR B;  1W1H A;  2DNF A;  1OQN A;  1HQR D;  4LK0 M;  3DDC B;  1WGR A;  2WXK A;  2Z0E B;  4EFO A;  1UPQ A;  5EE9 A;  4WAA A;  1K5G B;  2D2Q A;  1SHC A;  1KJT A;  2MCN B;  1BTN A;  2M56 B;  1J0W A;  3OJ4 B;  3RPF C;  2ZW1 A;  5LXI B;  1SGH A;  5J18 A;  4ZOH C;  4W9G A;  4TYZ A;  4ZRQ A;  4F7G A;  4ZRK A;  2Z0D B;  2DX5 B;  5C2T B;  4JX1 C;  4B6H A;  4BAX A;  1EU4 A;  2WDR B;  1PQS A;  3PGE A;  1DDW A;  3SYX A;  4P16 A;  2YT1 A;  3ZTC A;  4BKG A;  2LUE A;  2NMQ A;  2IO2 B;  3Q2A C;  4A5K A;  4XWT A;  2KJH B;  3UIP B;  1WJN A;  2M8S A;  3HSA A;  2BYF A;  2Y5C A;  2Z0O A;  5EE1 A;  1MKE A;  1UUP A;  3LXF A;  1J8C A;  2P0D A;  5C6R A;  2Q5W D;  3A98 B;  4MGZ E;  3VTW A;  3TEW A;  1RFA A;  2WWZ A;  2JT4 B;  3ZNH B;  2OOB B;  2KQ7 A;  4OZA A;  5FR3 A;  4KVG B;  4QJ4 B;  5DCN A;  1RAX A;  4KKI A;  5JHA A;  4URK A;  3NWF A;  2X38 A;  2FJU B;  1JWB D;  2R82 A;  4ICU A;  2BYV E;  4GOU A;  1I4G A;  4HRS A;  1GC7 A;  1P6S A;  2B3A A;  2LRU A;  4GB9 A;  5HE2 A;  1V8C A;  1I42 A;  2J52 A;  2Y3A A;  5EE3 A;  1X1G A;  3DVG Y;  4AWJ A;  2ONQ A;  2J0K A;  1FD6 A;  2AWT A;  5KHO A;  2LUM A;  2E3T A;  2XK5 B;  2LOZ A;  2JQR B;  3SD5 A;  3NY5 A;  4HJG E;  2MBH A;  2J7Q B;  2D9W A;  1WE6 A;  5GOW B;  4TKN A;  1MI0 A;  3SFD B;  1MI1 A;  3U4E G;  1R7S A;  1BUI C;  1D3Z A;  2KDM A;  2LVO A;  5CX3 A;  2YS5 A;  1QOG A;  2MP2 B;  4RGN A;  4ANV A;  5JVL A;  2K00 A;  4GDK B;  3KYD D;  3DWG C;  1N60 A;  3ULB A;  1XXG A;  2LVP A;  3RUL A;  2D5G A;  4AUQ C;  3UIN B;  2N4F A;  1R4M B;  3PZ8 A;  2CHX A;  4ICV A;  3U30 A;  2D11 A;  3VIA A;  1X11 A;  3ETR A;  1UNP A;  1DGJ A;  1IGD A;  2N1W A;  4FXC A;  2HRJ A;  1SB3 C;  1NEK B;  3DBS A;  3QHT A;  2LHE A;  2KVR A;  1DOI A;  1OEY A;  2FE8 A;  1E8X A;  1C3T A;  1TS4 A;  1TY2 A;  1XLN A;  2WGS A;  2D10 A;  1LO5 D;  1SBB B;  4MH8 A;  2N7J A;  1OMW A;  4Q2J A;  3VH3 B;  1LGR A;  5BMH A;  3QQ8 B;  3ZJT A;  1ZSQ A;  1GC6 A;  2WXI A;  3BVG A;  2O6V A;  3Q3F A;  5D3X A;  2AL6 A;  4OVV A;  4A3P A;  1UH6 A;  1PMS A;  4K2P A;  1WX9 A;  1ST7 A;  2L7R A;  1SIJ A;  1K51 A;  2WU5 B;  2WXQ A;  1MHX A;  3NJT A;  1ACA A;  2ZCB A;  2MWN B;  2PVO D;  1Y19 B;  1HTO A;  1L6U A;  4YTP B;  3RNC C;  2ROZ B;  1UEF A;  2L32 A;  1WGG A;  1FFV A;  4KKJ A;  4YSZ B;  3PSE B;  1BTK A;  2WNM A;  1KZ7 A;  4MGI E;  2YS3 A;  2P0F A;  4A8X C;  2X0S A;  1Q1O A;  1I4X A;  2WXN A;  2WXL A;  4NJ6 A;  4GIV A;  3P4Q B;  2EC1 A;  2NPT B;  4JKD A;  2RR9 A;  2IGG A;  3EEC A;  2NZ8 B;  4M01 A;  2JVC A;  2N1V A;  2Z59 B;  1ESF A;  5H8Y E;  2CRF A;  2WH5 A;  3KZ1 A;  4RFB A;  3FKY A;  4P6V F;  3TEY A;  3NZU A;  4OZB A;  5EE0 A;  3UIO B;  4HPL B;  3AEA B;  4WUR A;  2FJ9 A;  3KQ4 A;  1IYF A;  1WXQ A;  1MPE A;  1V1P A;  4KHB B;  1OQR A;  2K2U A;  4W9I A;  1FNU A;  4DX9 0;  3ZNI D;  3SFE B;  4DBB A;  4J3O D;  2IGD A;  1ZM0 A;  2MX2 A;  1ZPS A;  1QT9 A;  1GB4 A;  1FRD A;  1ZDX A;  2KTR B;  4FJV B;  2G4S A;  2KJ6 A;  1TIF A;  1JW9 D;  1T77 A;  1FCL A;  3O13 A;  4MDK E;  3C8Y A;  4IWQ A;  1YD8 U;  1XF5 L;  2MP2 A;  2K22 A;  2Z0Q A;  1HZ6 A;  3NVZ A;  1M94 A;  1P3Q U;  1QQR A;  3OWE B;  2GCL A;  1VRA B;  5FI0 A;  3Q3M C;  5IP4 D;  5DIF B;  3OAN A;  1RFK A;  4M0W B;  5TSS A;  4CO7 A;  1WSP A;  4HAX B;  1AAR A;  2MRP A;  4KSK C;  5FKA C;  1VZ7 A;  2MJ3 A;  5BMG A;  3HVZ A;  3VRA B;  1K52 A;  1U5E A;  4HEA 1;  4IAP A;  5DI9 B;  2KVZ A;  4KV2 A;  5JZE B;  2BF8 B;  1F52 A;  3A1Q B;  1E8Z A;  4YL8 A;  2REX A;  5DHA B;  2NTT A;  1Z87 A;  4FBJ B;  1LQB A;  3KUC B;  2MFQ A;  3ZDT A;  1T6B X;  1IBX A;  2QKM A;  3C0R B;  2Z14 A;  1EWC A;  1K8R B;  1X1M A;  4H2A A;  3P4R B;  4W9C A;  4EMO A;  4XYC A;  1E9M A;  2PKO A;  5HG2 A;  4MM3 A;  3D8D A;  3QIJ A;  2MLB A;  3L16 A;  2R61 A;  3RZF A;  5AEK B;  3EFU A;  1SJE D;  1F1H A;  3AE6 B;  3BK2 A;  3ODO A;  1KM7 A;  1RYJ A;  2V4I B;  4WJO A;  2KYW A;  3QCA A;  4A55 A;  3ENB A;  4YXD B;  1Z2M A;  2C7H A;  1QC6 A;  1YN3 A;  2LHD A;  1TS5 A;  3Q3J A;  4MH0 E;  1ENF A;  4XWX A;  4CHM A;  3ZW3 A;  2CJO A;  1E10 A;  2CJN A;  1FM0 D;  2JZ3 B;  2NPT A;  3UGB B;  1I4P A;  4HHV A;  2LVQ A;  2XQN M;  1VBH A;  2Z59 A;  1AN8 A;  2RSU A;  3AE9 B;  1T0S C;  1MJD A;  4BFR A;  1J7C A;  4PK1 A;  2CU1 A;  1JWU D;  2IY1 B;  3B9J A;  2KJR A;  2ZVN A;  3H6N A;  4DK5 A;  5I2S A;  1NVI D;  3ML8 A;  1DRO A;  1WM3 A;  2VSZ A;  4XDC A;  3HRD D;  1PGB A;  2KMM A;  3IVF A;  1XT9 B;  3LYY A;  3TCA A;  2A5U A;  3HVD A;  2DZI A;  3IBE A;  2BS4 B;  5FK9 C;  3H7P B;  1NYQ A;  1X1F A;  2KTR A;  3HHM A;  3DWM A;  2MEK A;  4YSX B;  2I2Y A;  1DYQ A;  1Z5S B;  2BB6 A;  2FID A;  3ECI A;  3OLM D;  4I6P A;  3V62 A;  4OHJ A;  2D9X A;  2D4Q A;  4KIK B;  1J0G A;  3N32 A;  4PS8 A;  2D3B A;  2RRF A;  3ZKJ C;  4EOY A;  4W9F A;  2R0D A;  2QHO A;  1P1A A;  2ZVO A;  3CWI A;  5I4D A;  3P4S B;  3NVY A;  3URY A;  5TR5 A;  4BBN F;  2J42 A;  2K39 A;  4Y94 A;  1XKE A;  4IM3 A;  4FN2 A;  1NI2 A;  4FA6 A;  3UQB A;  2RQ1 A;  1WZ0 A;  2K8B A;  3EHV A;  4KZC A;  3MFG A;  1P3R A;  3L13 A;  3K9O B;  2G1E A;  3PVW A;  3PVL A;  1GJZ A;  4HKZ E;  3VOQ A;  3BVZ A;  2JXT A;  2KHW B;  2SAK A;  4IOI E;  3IXS A;  2FCS A;  3L4P A;  2BS3 B;  4F7H A;  1V80 A;  3L54 A;  1KLG D;  4G0N B;  1BWN A;  2LBB A;  3AE2 B;  3OAW A;  4A6Q A;  3PZD A;  1DIK A;  4K2O A;  3I57 A;  4HSI A;  1OY2 A;  1UF0 A;  1VLB A;  4JLC A;  2K49 A;  3EPY A;  2DKP A;  1L7Y A;  2KD0 A;  4HXD A;  3Q8A A;  5LG4 B;  1YX6 B;  4WJP A;  3APF A;  4AJW A;  3KRW A;  3E66 A;  1YN4 A;  2IBI B;  2WX1 A;  3W9C B;  4E74 A;  5JHG A;  4ACF A;  4JK7 A;  4CQN A;  4HVB A;  2KLC A;  2OQB A;  2N9P C;  1WF9 A;  5G5G A;  3LJ3 A;  4YTN B;  5DPS A;  1FHW A;  4XC2 A;  2ELB A;  2WDV B;  3BVM A;  5JXV A;  2IFS A;  3DCG A;  2DAF A;  2KMC A;  1S3S G;  1B9R A;  4FUL A;  3FEH A;  1E7U A;  4LTU A;  4JKC A;  2KOX A;  1NYR A;  2V3P A;  3DXE A;  3GE8 C;  4JK9 A;  4HDQ A;  1WFY A;  2BGF A;  2KC2 A;  3VQI A;  4N59 A;  4ZDV A;  1E7V A;  5C5B A;  1CMX B;  1YX5 B;  3RNA C;  1ZXH A;  3F5R A;  4HAW B;  2KDF B;  5DH9 B;  2LD9 A;  3ZJU A;  5AZG A;  3AH7 A;  4HDO A;  2AL3 A;  3KWL A;  3T3O A;  2KWV B;  1U29 A;  2MJD A;  5IO9 A;  2RVB B;  1P9D U;  2LGS A;  3W2D A;  3CSF A;  1F2R C;  1PUT A;  3H7P A;  2N9E B;  2M14 A;  1I7H A;  4UDU C;  5CHW A;  2PLP A;  4IC7 B;  4ASW C;  1TJ6 A;  2COD A;  2GBR A;  2WLB A;  4YSY B;  4ARI A;  3W1Y A;  1JRP A;  1GUA B;  4KIK A;  1KTK A;  4BBK A;  3ZTD A;  2GS0 A;  1LB1 A;  3AN1 A;  2GRI A;  2M4N A;  2CS4 A;  2J0M A;  3NHE B;  3P63 A;  2R2Y A;  2GLS A;  4GMV A;  4HCN B;  2J0J A;  4LJP B;  1C1Y B;  2FCN A;  5G2N A;  1UBQ A;  3MDB C;  3QK0 A;  2ASQ A;  3ZRC A;  1NTY A;  1QOF A;  1E6E B;  1V61 A;  4PYU A;  1B1Z A;  2DYO A;  5L83 A;  3RNG C;  4BBN C;  4C0A A;  2JX5 A;  1V5M A;  1ZVR A;  4D6W A;  2HD5 B;  1EF5 A;  2DLW A;  1YQB A;  1RM6 C;  1JDE A;  2E2X A;  2INC C;  2LAS A;  4H8S A;  3HQC A;  5IN7 A;  3ZLZ A;  4XX5 A;  2D3C A;  2WXH A;  1WWT A;  2KIE A;  2UZS A;  4NSW A;  5D7G A;  4A3O A;  2ZNV B;  3VTU A;  3D32 A;  1K53 A;  3BIN A;  4JGH B;  4MJS A;  5AUK A;  1FRR A;  2COC A;  1E8W A;  1N5X A;  3VUY A;  2YEP F;  3HW2 B;  3TFM A;  4JPS A;  4ILG B;  1U5D A;  3WAM A;  1VBG A;  5FI1 A;  2AQ2 B;  2KWD A;  2LGX A;  1BXT A;  2LI5 A;  2KFK B;  1DDV A;  2FNJ B;  3FAH A;  4BKT A;  1R4M I;  2XBB C;  2KN5 A;  4F7U P;  4IFS A;  3A9J A;  1VJK A;  2CQU A;  2PMV A;  3T8M A;  3SBT A;  1X86 A;  1P5T A;  2GMI C;  1OTR B;  3OHM B;  2W2X C;  3QA8 A;  1EM7 A;  4KZ0 A;  1M4V A;  4HK2 A;  3DXC A;  4WJQ A;  5AUI A;  4W9J A;  1OGW A;  4B6W A;  1H4R A;  4R3D A;  1XCT L;  4WSF A;  5CLL B;  3VVW B;  1FNW A;  2V3N A;  2L2I A;  4NAM A;  3H7S A;  4US8 A;  4ZRJ A;  3DOW A;  3PHW B;  3NOB A;  5HE3 A;  1KH0 A;  3A33 B;  5GMV A;  5I2M A;  3TIX A;  1BAK A;  4KGT A;  4PNK A;  2IYB A;  2KDE B;  2GCJ A;  3N3K B;  1MK7 B;  4JQW C;  1OQQ A;  2DLB A;  5IOI A;  4FJZ A;  2IGH A;  4KDI C;  2KTF A;  3A9K B;  3DHG C;  2LUL A;  4G50 A;  2KAJ A;  4JE3 B;  4Z2N A;  2K6D B;  1UBI A;  3ODW A;  1ISN A;  2HTM E;  5D94 A;  4HB2 B;  3QJZ A;  3PV1 A;  4WWO A;  4ANU A;  2M38 A;  3KUZ A;  2YSZ A;  3Q8B A;  2PZ1 A;  2R09 A;  2KXJ A;  1ET6 A;  1L0V B;  2K1F A;  4IG7 B;  5DPT A;  3P2B A;  1T0Q C;  1TZ1 A;  3VXW A;  3A4R A;  1NBF C;  4DXG A;  2FBW B;  5CHV C;  1XX0 A;  3ZXV A;  2EKE C;  3U7Z A;  1PDX A;  2GJY A;  1P7F A;  1FFU A;  2HTH B;  3ZVR A;  2AQ3 B;  1TXD A;  4I6N B;  4C4V B;  2ZEQ A;  4GXB A;  3SUZ A;  3DBH B;  4WAF A;  3RNF C;  3DHH C;  2NS5 A;  4QXA B;  1L4D B;  2V1Y A;  3VH4 B;  4AOF A;  1UGJ A;  1WIA A;  3U12 A;  1VR9 A;  3GB1 A;  2I1K A;  2JYT A;  2HJ8 A;  2WDQ B;  4IKG A;  2VZK B;  3PSC A;  1WGU A;  4PQ0 A;  3CXB B;  2OJR A;  3FM8 C;  2V4L A;  4C7Z A;  1TKY A;  5D2M B;  2DYM A;  3AXC A;  2MSE D;  1GGO A;  1E7P B;  1UEL A;  4OVU A;  4BOS C;  1AYF A;  3RNB C;  4GLS C;  3AB5 A;  1MPH A;  2DIK A;  1IRS A;  3M63 B;  3SNH A;  4NZL B;  1UNR A;  2L3Z A;  3H8H A;  2Q13 A;  2WXM A;  3M95 A;  3BK1 A;  5JHH A;  1FOE A;  1FPY A;  1C9F A;  3DBR B;  2AEH A;  4HAV B;  4F7Z A;  1UWM A;  2CB8 A;  1GB1 A;  3AED B;  3IT4 B;  3ODX A;  5EDS A;  2V9H A;  4NAW B;  3PS6 A;  1J7B A;  3I9V 1;  2BW2 A;  5CHF A;  1C4A A;  1YJ1 A;  5G5H A;  1D6E C;  2MQJ A;  3AEE B;  4C7Y A;  4BKS A;  3UZT A;  2DX5 A;  2DKQ A;  3RYT A;  3TEX A;  2CY5 A;  2NTS A;  2RUK B;  2TSS A;  3MC0 B;  4MEL A;  3TMP B;  3AEF B;  2E6X A;  1F9J A;  2PTL A;  2RPQ A;  1Q0W B;  1U4A A;  2BPS A;  2KFJ A;  2IDY A;  3B08 A;  1I7A A;  4PS7 A;  2Y5B B;  4CSQ A;  2KQ4 X;  5IKC M;  3RT3 B;  2FUG 1;  4DX8 A;  3GE3 C;  3GZN I;  3TEZ A;  3A9K A;  2AX5 A;  1C78 A;  1YN5 A;  4L1B A;  5LLI A;  2K3U A;  4DHZ B;  2H7D A;  3KYC D;  2WXR A;  1FAO A;  4HB0 B;  1MG8 A;  4A9A A;  1VZ8 A;  2QEJ C;  3PZ7 A;  2RLO A;  5KCV A;  1J19 A;  1WXS A;  5AZH A;  5J2R A;  2V0G A;  2D9V A;  2BWE S;  4NNJ B;  1T0Y A;  4MY6 A;  2L8J A;  3M1I B;  2FCM A;  3SU8 X;  2Y8F A;  2UZR A;  4S17 A;  2K8H A;  4KSL C;  2ZJD A;  4WQO B;  2IZV B;  2W82 A;  2KR0 A;  2JRI B;  2L1C A;  2HTH A;  5DHF B;  1C4C A;  2NBV B;  4C4V A;  3V5W A;  3R2I A;  4M8N A;  2XK5 A;  1L0Y B;  3GP7 A;  4L23 A;  4QAY A;  1KF6 B;  2KWU B;  4O1N A;  2JYE A;  2BQQ A;  2Y5P A;  3HM6 X;  3R8B A;  4RF0 A;  1KLV A;  4RM8 A;  1LM8 B;  3RUI B;  1N61 A;  1C4P A;  4BOZ B;  3IG3 A;  1RRB A;  4GDK A;  3F0W A;  1E90 A;  4JK8 A;  1WY8 A;  3LB8 C;  2NBW B;  4WVF B;  2WXG A;  3VUX A;  4KHA A;  4NQK E;  1E0Z A;  2H88 B;  3N9Y C;  1GG3 A;  3PLU A;  3N30 A;  3VFK A;  3O96 A;  1YNT E;  2YS1 A;  2FUH B;  1LXD A;  2O6V D;  1FHX A;  4K7S A;  1SE3 A;  2BVC A;  2JPH A;  3U7D A;  4RM9 A;  2DAJ A;  1E5W A;  2KN4 A;  3TW1 A;  1ZW7 A;  1IP9 A;  1Q10 A;  4P7I A;  2RNR B;  3SDL C;  5AZF A;  1IUE A;  2M1M A;  2G3Q B;  4NAW A;  5D6J B;  5HI1 A;  1V1O A;  4HAY B;  4WJ7 A;  1MFW A;  4D2K A;  2MBE A;  5C1Z A;  4MGY E;  3T9L A;  2VH1 A;  2GI9 A;  2YRY A;  1EWY C;  1JRO A;  1P7E A;  5L95 C;  3CIK A;  3PRZ A;  2IO0 B;  3ENE A;  4B0E A;  3V6C B;  3UF8 A;  1JAL A;  4ZYS A;  2EMT A;  4HLE A;  2WX0 A;  3GZN B;  2DZK A;  4RH6 A;  1L5P A;  3BYY B;  4NJ7 A;  1WZ3 A;  4DHZ E;  2ROV A;  3MC8 A;  4IM2 A;  1KI1 B;  2R2O A;  2K2J A;  2DWQ A;  2N0Y A;  3AEB B;  5L81 A;  3Q8F A;  3V6E B;  2JY6 A;  1JWS D;  4EE2 A;  3IT6 B;  3RNE C;  1V5U A;  2C7M B;  3V61 A;  5LXH A;  1WH3 A;  2JZP A;  4EEW A;  3NUH B;  3P6A A;  4EZK A;  4C80 A;  3ZQ4 A;  2MA9 B;  1FHO A;  4FAD A;  1FGY A;  5D27 A;  2MW5 A;  3W5V B;  2ZNV C;  4I6L B;  3GYP A;  4FHK A;  2X8X X;  5IJM A;  4KHB A;  1ZUD 2;  3FP5 A;  4A6K A;  4GNK B;  1WXV A;  1EAZ A;  2YEP B;  1CQV A;  4MK0 A;  5D3W A;  1WMH B;  3BWU D;  2O2V B;  2LFI A;  2VRW B;  3VR9 B;  4ARC A;  2QCZ A;  1SIF A;  1T5X D;  1D5Z C;  3Q8E A;  1V5P A;  3MHZ A;  1YOV B;  1H10 A;  4KX6 B;  4WH4 A;  4EZJ A;  2P0H A;  2QSD A;  2XEW A;  3PHX B;  2CHZ A;  1UNS A;  3ZNZ B;  2WDT B;  1B55 A;  3CST A;  2PW9 A;  4USA A;  1AWE A;  4REZ A;  2DHI A;  1YQ4 B;  3W1S C;  3RFZ B;  4LLG M;  4M0W A;  1FMA D;  4KGS A;  3BJI A;  5BMI A;  5BYR A;  3EA6 A;  4WJN A;  2IY0 B;  1SF0 A;  1C79 A;  2ICI A;  4RF1 A;  4G3X B;  4LNO A;  5E6N A;  4BVU C;  3A1Q A;  2DYQ A;  2L52 A;  3HIE A;  3N20 C;  1NDD A;  1HB6 A;  2I38 A;  4HJK A;  1WR6 E;  2LOX A;  3AU4 A;  4IWO A;  2KIG A;  3B77 A;  2COF A;  5JP4 A;  3SV1 A;  2UVM A;  4YTM B;  2JRH A;  4K81 A;  2DHZ A;  3VTV A;  2RDB C;  4J6I A;  1NTV A;  2MKR A;  1UPR A;  1X05 A;  1ACC A;  4C00 A;  4OT1 A;  5FR6 A;  1Y5O A;  2YLM A;  3E9S A;  3BII D;  1D5M C;  1EU3 A;  4K7W A;  1ZC4 B;  1XD4 A;  3A4S C;  4LDT D;  3RD2 A;  2LGY A;  4JWU C;  2KX3 A;  4JKB A;  1NEN B;  2KUP A;  2DHJ A;  2RD0 A;  2JSV X;  5D3Y A;  4FHJ A;  2LJ5 A;  4QJ5 B;  2KLG A;  1FXT B;  4X57 B;  2FJL A;  2CKH B;  1Y8R C;  3QAQ A;  3AUL A;  4IUM B;  3R2T A;  2W3S A;  4HB4 B;  3U2S C;  5J3Y A;  1I35 A;  1RLF A;  2KAN A;  2HJ1 A;  2ZKM X;  5D3V A;  1A70 A;  2X18 A;  1MHH E;  2KKC A;  2QMT A;  4MAC A;  2INP E;  2FIF A;  3FC4 A;  2OED A;  4HRO A;  3WIM A;  1UD7 A;  3TVV A;  1HE8 A;  3QWZ B;  1QOB A;  2L83 A;  3T3N A;  2LXC A;  2RMM A;  4TMA B;  2UU7 A;  2EJ8 A;  1UZX B;  2LRW A;  1ZKH A;  4ZHP A;  4ITK A;  2KX0 A;  2MBQ A;  2QC8 A;  3FIL B;  4P1C C;  1V5T A;  2N9X A;  2W54 A;  1XLQ A;  3R66 C;  1N6Z A;  2EEL A;  3BY4 B;  1V88 A;  2WXP A;  3EFC A;  4HCP B;  2DBY A;  1PYW D;  2ACZ B;  1MK9 B;  4NQL B;  4DWF A;  2GBK A;  3QWM A;  2XN9 C;  5DPW A;  1NVL A;  2DZJ A;  1I4H A;  2ZW0 A;  3DVG X;  1ZYI A;  1CJE A;  2NMB A;  3NW8 A;  2DTC A;  3ZO5 B;  3A58 A;  5J17 A;  1SJH D;  2BT6 A;  2DX1 A;  2XNA C;  5C79 A;  5HKH A;  3VR8 B;  2YT2 A;  3JW0 X;  2BTE A;  2N9K A;  2LGD A;  2GUM A;  2OTX A;  5T8I A;  3KUD B;  2L00 B;  1FO4 A;  5J3Q A;  3VDZ A;  3PPA A;  1WJ6 A;  3WA0 A;  3PEG A;  3EUB 2;  2BCJ A;  4N6E B;  3WAO A;  3Q3N C;  4F1S A;  4KHO A;  4IM0 A;  3H1U A;  5GXG B; 
#chains in the Genus database with same CATH homology
 1R4N I;  3ALB A;  1FGZ A;  3FSS A;  3E9L A;  3FLV A;  1K5D B;  1GNU A;  2DZM A;  3DBH I;  2JZZ A;  2PE6 B;  1WE7 A;  3DVN V;  1LW3 A;  2N23 A;  1BT0 A;  2BKR B;  3HIZ A;  3PTF C;  3ML4 A;  4MT7 A;  5CLQ B;  4XZ4 A;  5IA7 A;  2GBN A;  4AJY B;  5J3T A;  2D9Z A;  2R2Q A;  4NPN A;  2KNB A;  1WJM A;  3AJ4 A;  3DBR I;  1U5G A;  1TGZ B;  3CF6 E;  3DQV A;  3M3J A;  3L10 B;  2IYD B;  1U27 A;  4M8M A;  5DPR A;  2WYQ A;  2KCJ A;  2YVC A;  2MBO A;  2CHW A;  2O6V B;  3GYO A;  1EVH A;  2DYN A;  1WXA A;  2LXA A;  1TBE A;  2M17 A;  3ZDM C;  2I5F A;  4AP4 C;  1KC7 A;  1V2Y A;  3VHT C;  2P8V A;  5JH5 C;  1MIX A;  4EKU A;  1WGD A;  1WVH A;  5G55 A;  4DBG A;  3A8P A;  4GDL B;  4L6E A;  5HE1 A;  1ZC3 B;  1IPG A;  1W1D A;  4G11 A;  2PEA A;  2C60 A;  2GBJ A;  3TL5 A;  4N9F 4;  4GMX B;  4DHJ D;  3RCP A;  4B95 A;  1WGQ A;  3PG7 A;  2N7D A;  2NVU I;  1WJU A;  3NSU A;  1FB8 A;  3WAN A;  2KFK A;  2PPH A;  3E9P A;  4LCD E;  1XCG A;  4MSQ B;  3LJU X;  2RGF A;  2ZPY A;  2BKF A;  2KC1 A;  4JKF A;  1V89 A;  3D8E A;  1V6E A;  3L0W B;  3W1S A;  1WR1 A;  2K25 A;  2KQS A;  3R7Q A;  2G45 B;  4DXA B;  5C16 A;  5KQ4 A;  4W9K A;  3JSV B;  1RJ2 A;  1VCB A;  1EGX A;  2L0F A;  4W9D A;  2Y7B A;  2K8C A;  4GOC A;  2NBU A;  5LOP B;  1V81 A;  2C9W B;  5EFX A;  1XQQ A;  2RGN B;  1EO6 A;  3QAR A;  3TBL D;  2W2W A;  3TO1 A;  4ILH A;  5LON B;  1WGY A;  4HPM B;  3MPX A;  1XOD A;  4GSW A;  1U2B A;  4W9H A;  2LZ6 A;  3APC A;  2CY4 A;  1PFJ A;  3PRP B;  2D3G A;  2I5C A;  2G4D B;  4GDL A;  1I2H A;  2AYO B;  4LDT B;  3L17 A;  1WI1 A;  3P7Z A;  4GN1 A;  4MEM A;  3ZUN A;  4CHJ A;  3D8F A;  1V86 A;  4TQ0 A;  1S1Q B;  1L2N A;  1M7R A;  2D9Y A;  4DDI D;  2J59 M;  2RSG A;  3NS8 A;  2N7E A;  1XR0 B;  1AQC A;  1ZGU B;  3K9P B;  1P98 A;  2LWP A;  2FAZ A;  2D07 B;  4E71 A;  2Z0P A;  4K17 A;  1WXM A;  4CHK A;  4ZYN A;  4WWP A;  1WJ1 A;  3ONS A;  4ANX A;  4TV3 A;  1KZG A;  4BKS D;  4RMA A;  3VAW A;  2JXX A;  2C5L C;  3H9D A;  4F8C B;  5CTR C;  1EF1 A;  3O65 B;  4JL9 A;  3DBL I;  4W9E A;  3IHP C;  3KW5 B;  1HBK A;  3I3T B;  2EMS A;  1WJ4 A;  2KK8 A;  4NY0 A;  4K1R B;  4EZL A;  1NU2 A;  2COP A;  4GGQ A;  5E6O A;  4JKE A;  2L76 A;  3JSV A;  1Q5W B;  4ANW A;  2IO1 B;  3SHQ A;  2KWC A;  3JVZ X;  4HAT B;  1PLS A;  1WG7 A;  3MTN B;  3PRE A;  4KAX B;  1NTI A;  2NCN A;  3ZNG C;  4PS3 A;  1TQZ A;  4HAU B;  1WX7 A;  3R3M A;  2M0X A;  4ZRI A;  4JKA A;  3E9O A;  5E6P A;  1WM2 A;  1OQY A;  3OJ3 A;  3DVN U;  1UGM A;  3WAP A;  3B0A A;  1DDM A;  4CYE A;  1MAI A;  2H7E A;  2A4Z A;  1VD2 A;  2C7N B;  2DA0 A;  2ZCC A;  2DFK A;  3KVF B;  2DEN B;  4W9L A;  3JYU A;  1Q67 A;  2Y8G A;  2GBM A;  3QBV B;  2ZPN A;  3QC8 B;  4E3C A;  5C5B B;  3S2A A;  4Z2M B;  1TTN A;  4K7U A;  4A6H A;  1WGH A;  3PP2 A;  5JLJ B;  2NR2 A;  3L08 A;  3ULC A;  4FLH A;  2YT0 A;  3DXD A;  1OEY J;  2IO3 B;  4EUT A;  1A5R A;  2MDX A;  3KY9 A;  4A6F B;  4LJO B;  1QZE A;  2VKI A;  3UQA A;  2UYZ B;  2L0T A;  1EUV B;  2BYE A;  3B1L X;  2ABD A;  4EJN A;  3ML9 A;  2W9N A;  1RRP B;  4A20 A;  2PJH A;  2ADZ A;  1JRU A;  3HM3 A;  4HB3 B;  1V9J A;  3CMM B;  1HB8 A;  4MGK E;  3RCZ A;  2KZR A;  3X23 A;  1H8C A;  1U5F A;  3PRM B;  1WI0 A;  4TQ1 A;  4JKG B;  4IOY X;  3MHS D;  2KDB A;  1V5O A;  2MWS B;  4KDL B;  1WYW B;  5C23 A;  2FCQ A;  3LDZ E;  3KSY A;  2UWQ A;  1P0R A;  2ZZP B;  2GOW A;  3DPD A;  1KOT A;  5KHQ A;  4ILJ A;  2DYB A;  4II3 B;  2LG1 A;  2HE7 A;  4MJS B;  1SE9 A;  3SBG A;  2QKL A;  3HK0 A;  5KQ1 A;  3ZVV A;  2BWF A;  2JWZ A;  2W2X D;  4FJY A;  3T06 A;  1M7E A;  4JIO U;  2PE9 A;  3NZS A;  4WWN A;  4MSM B;  3A9J B;  1W1G A;  5BO4 B;  3X0W A;  3EC8 A;  2G35 A;  3N7C A;  4DHJ B;  2JP2 A;  1QQG A;  1YIW A;  2YF0 A;  3RZW C;  2CAY A;  2DHK A;  1MIZ B;  1WMH A;  1DBH A;  4PYZ A;  5HE0 A;  2O2V A;  2FDQ A;  4DDG D;  2JF5 A;  3PT2 B;  3R7R A;  3KRX A;  3VUW A;  3AI5 A;  4HAZ B;  3KH0 A;  3SO6 A;  3PVU A;  2COA A;  2L05 A;  3GOE A;  2LYD A;  4A6F A;  1E8Y A;  4IW0 A;  3IFW B;  4JKH A;  2KMA A;  2DN6 A;  3WYF B;  1N3H A;  3G9W A;  5IAA C;  1UNQ A;  5JHB A;  2MBB B;  3PLV A;  1V49 A;  1DYN A;  2K6Q A;  4GZU A;  3ZIM A;  1G6J A;  4GPT B;  3MJW A;  3V60 A;  3U8Z A;  2ELA A;  3WAL A;  2VRR B;  2KGX B;  2LKO A;  1XD3 B;  3TJP A;  2V76 A;  1WRD B;  2CR5 A;  3M62 B;  3APD A;  4JKG A;  2KDI A;  4IWP A;  2KO3 A;  3ZRF A;  1KBL A;  3A8Q A;  4TUU A;  2V3S A;  4D0N B;  4HWI B;  4YON A;  3AU5 A;  2JUO A;  3QX1 A;  4II2 B;  4B9K A;  1WX8 A;  2I1J A;  1LFD A;  4GU2 A;  1W1H A;  1OQN A;  3DDC B;  1WGR A;  2Z0E B;  4EFO A;  1UPQ A;  4WAA A;  1K5G B;  2D2Q A;  1SHC A;  1KJT A;  2MCN B;  1BTN A;  1J0W A;  3OJ4 B;  5LXI B;  1SGH A;  5J18 A;  4W9G A;  4TYZ A;  4F7G A;  4ZRK A;  2Z0D B;  2DX5 B;  4B6H A;  1PQS A;  3PGE A;  1DDW A;  3SYX A;  2YT1 A;  3ZTC A;  4BKG A;  2LUE A;  2IO2 B;  4A5K A;  2KJH B;  3UIP B;  1WJN A;  2M8S A;  2BYF A;  2Z0O A;  1MKE A;  1J8C A;  2P0D A;  5C6R A;  3A98 B;  4MGZ E;  3VTW A;  1RFA A;  2WWZ A;  2JT4 B;  3ZNH B;  2OOB B;  2KQ7 A;  4KVG B;  5DCN A;  1RAX A;  5JHA A;  4URK A;  4ICU A;  2R82 A;  2BYV E;  1GC7 A;  1P6S A;  2B3A A;  2LRU A;  4GB9 A;  5HE2 A;  1I42 A;  1X1G A;  3DVG Y;  4AWJ A;  2J0K A;  2AWT A;  5KHO A;  2XK5 B;  2LOZ A;  3SD5 A;  3NY5 A;  2MBH A;  2J7Q B;  2D9W A;  1WE6 A;  5GOW B;  4TKN A;  1D3Z A;  2LVO A;  5CX3 A;  2YS5 A;  2MP2 B;  4ANV A;  5JVL A;  2K00 A;  4GDK B;  3KYD D;  3ULB A;  2LVP A;  3RUL A;  4AUQ C;  3UIN B;  2N4F A;  2CHX A;  4ICV A;  3U30 A;  2D11 A;  3VIA A;  1X11 A;  1UNP A;  2N1W A;  2HRJ A;  3DBS A;  3QHT A;  2KVR A;  1OEY A;  1E8X A;  1C3T A;  2D10 A;  1OMW A;  3VH3 B;  3QQ8 B;  1ZSQ A;  1GC6 A;  2O6V A;  3Q3F A;  5D3X A;  2AL6 A;  4OVV A;  4A3P A;  1UH6 A;  1PMS A;  4K2P A;  1WX9 A;  1ST7 A;  2L7R A;  1ACA A;  2ZCB A;  2MWN B;  1Y19 B;  2ROZ B;  1UEF A;  1WGG A;  3PSE B;  1BTK A;  1KZ7 A;  4MGI E;  2YS3 A;  2P0F A;  2X0S A;  1Q1O A;  4NJ6 A;  4GIV A;  2EC1 A;  2NPT B;  4JKD A;  2RR9 A;  3EEC A;  2NZ8 B;  2JVC A;  2N1V A;  2Z59 B;  2CRF A;  2WH5 A;  3KZ1 A;  3NZU A;  3UIO B;  4HPL B;  2FJ9 A;  1IYF A;  4KHB B;  2K2U A;  4W9I A;  4DX9 0;  3ZNI D;  4DBB A;  1ZM0 A;  2MX2 A;  2KTR B;  4FJV B;  2G4S A;  2KJ6 A;  4MDK E;  4IWQ A;  1YD8 U;  2MP2 A;  2Z0Q A;  1M94 A;  1P3Q U;  2GCL A;  5FI0 A;  5DIF B;  3OAN A;  4M0W B;  4CO7 A;  4HAX B;  1AAR A;  2MRP A;  4KSK C;  1U5E A;  4IAP A;  5DI9 B;  4KV2 A;  5JZE B;  2BF8 B;  3A1Q B;  1E8Z A;  4YL8 A;  2REX A;  5DHA B;  4FBJ B;  1Z87 A;  1LQB A;  3KUC B;  2MFQ A;  3ZDT A;  2QKM A;  3C0R B;  1K8R B;  1X1M A;  4W9C A;  4EMO A;  4MM3 A;  3D8D A;  3QIJ A;  2MLB A;  3L16 A;  3RZF A;  5AEK B;  3EFU A;  3ODO A;  1KM7 A;  4WJO A;  3QCA A;  3ENB A;  1Z2M A;  2C7H A;  1QC6 A;  3Q3J A;  4MH0 E;  4XWX A;  4CHM A;  3ZW3 A;  2JZ3 B;  2NPT A;  3UGB B;  4HHV A;  2LVQ A;  2XQN M;  1VBH A;  2RSU A;  4BFR A;  2CU1 A;  2IY1 B;  2KJR A;  2ZVN A;  3H6N A;  4DK5 A;  3ML8 A;  1DRO A;  1WM3 A;  2VSZ A;  3IVF A;  1XT9 B;  3TCA A;  2A5U A;  2DZI A;  3IBE A;  3H7P B;  1X1F A;  2KTR A;  3HHM A;  1Z5S B;  2FID A;  3ECI A;  3OLM D;  4I6P A;  3V62 A;  2D9X A;  2D4Q A;  4KIK B;  1J0G A;  3N32 A;  4PS8 A;  3ZKJ C;  4EOY A;  4W9F A;  2R0D A;  2QHO A;  1P1A A;  2ZVO A;  5TR5 A;  4BBN F;  2K39 A;  4Y94 A;  1XKE A;  4IM3 A;  4FN2 A;  1NI2 A;  4FA6 A;  3UQB A;  2RQ1 A;  1WZ0 A;  2K8B A;  3EHV A;  4KZC A;  1P3R A;  3L13 A;  3K9O B;  3PVW A;  3PVL A;  1GJZ A;  3VOQ A;  2KHW B;  2FCS A;  4F7H A;  1V80 A;  3L54 A;  4G0N B;  1BWN A;  2LBB A;  3OAW A;  3PZD A;  1DIK A;  4K2O A;  1OY2 A;  4JLC A;  3EPY A;  2DKP A;  1L7Y A;  2KD0 A;  4HXD A;  1YX6 B;  4WJP A;  3APF A;  4AJW A;  3KRW A;  3E66 A;  2IBI B;  2WX1 A;  4E74 A;  5JHG A;  4JK7 A;  4HVB A;  2KLC A;  2OQB A;  2N9P C;  1WF9 A;  3LJ3 A;  5DPS A;  1FHW A;  4XC2 A;  2ELB A;  2IFS A;  3DCG A;  2DAF A;  2KMC A;  1S3S G;  4FUL A;  3FEH A;  1E7U A;  4JKC A;  2KOX A;  3DXE A;  4JK9 A;  4HDQ A;  1WFY A;  2BGF A;  2KC2 A;  3VQI A;  4ZDV A;  1E7V A;  5C5B A;  1CMX B;  1YX5 B;  3F5R A;  4HAW B;  2KDF B;  5DH9 B;  2LD9 A;  5AZG A;  4HDO A;  2AL3 A;  2KWV B;  1U29 A;  2RVB B;  1P9D U;  3CSF A;  3H7P A;  2N9E B;  2M14 A;  5CHW A;  4IC7 B;  4ASW C;  1TJ6 A;  2COD A;  2GBR A;  3W1Y A;  1GUA B;  4KIK A;  4BBK A;  3ZTD A;  2GS0 A;  1LB1 A;  2M4N A;  2CS4 A;  2J0M A;  3NHE B;  4GMV A;  4HCN B;  2J0J A;  4LJP B;  1C1Y B;  2FCN A;  5G2N A;  1UBQ A;  3MDB C;  3QK0 A;  2ASQ A;  3ZRC A;  1NTY A;  1V61 A;  4PYU A;  2DYO A;  5L83 A;  4BBN C;  4C0A A;  1V5M A;  1ZVR A;  2HD5 B;  1EF5 A;  2DLW A;  1YQB A;  1JDE A;  2E2X A;  2LAS A;  4H8S A;  3HQC A;  3ZLZ A;  4XX5 A;  2UZS A;  4NSW A;  5D7G A;  4A3O A;  2ZNV B;  3VTU A;  3D32 A;  3BIN A;  4JGH B;  4MJS A;  2COC A;  1E8W A;  3VUY A;  3HW2 B;  3TFM A;  4ILG B;  1U5D A;  3WAM A;  1VBG A;  5FI1 A;  2LGX A;  2LI5 A;  2KFK B;  1DDV A;  2FNJ B;  4BKT A;  1R4M I;  2XBB C;  2KN5 A;  4F7U P;  4IFS A;  3A9J A;  2CQU A;  3T8M A;  3SBT A;  1X86 A;  1P5T A;  2GMI C;  1OTR B;  2W2X C;  3QA8 A;  4KZ0 A;  4HK2 A;  3DXC A;  4WJQ A;  4W9J A;  1OGW A;  4B6W A;  1H4R A;  4WSF A;  5CLL B;  3VVW B;  2L2I A;  3H7S A;  4ZRJ A;  3DOW A;  3PHW B;  3NOB A;  5HE3 A;  3A33 B;  5GMV A;  3TIX A;  1BAK A;  4PNK A;  2IYB A;  2KDE B;  2GCJ A;  3N3K B;  1MK7 B;  4JQW C;  4FJZ A;  4KDI C;  2KTF A;  3A9K B;  4G50 A;  2LUL A;  4Z2N A;  2K6D B;  1UBI A;  3ODW A;  1ISN A;  5D94 A;  4HB2 B;  3QJZ A;  3PV1 A;  4WWO A;  4ANU A;  2M38 A;  3KUZ A;  2YSZ A;  2PZ1 A;  2R09 A;  2KXJ A;  2K1F A;  4IG7 B;  5DPT A;  3P2B A;  1TZ1 A;  3VXW A;  3A4R A;  1NBF C;  5CHV C;  1XX0 A;  2EKE C;  2GJY A;  2HTH B;  3ZVR A;  1TXD A;  4I6N B;  2ZEQ A;  4GXB A;  3SUZ A;  2NS5 A;  2V1Y A;  3VH4 B;  4AOF A;  1WIA A;  2I1K A;  2HJ8 A;  3PSC A;  1WGU A;  4PQ0 A;  3CXB B;  2OJR A;  3FM8 C;  2V4L A;  5D2M B;  2DYM A;  3AXC A;  2MSE D;  1GGO A;  1UEL A;  4OVU A;  4BOS C;  1MPH A;  2DIK A;  1IRS A;  3M63 B;  3SNH A;  1UNR A;  2L3Z A;  2Q13 A;  3M95 A;  5JHH A;  1FOE A;  4F7Z A;  2AEH A;  4HAV B;  2CB8 A;  3ODX A;  5EDS A;  4NAW B;  3PS6 A;  5CHF A;  1YJ1 A;  2MQJ A;  4BKS A;  3UZT A;  2DX5 A;  2DKQ A;  3RYT A;  2CY5 A;  2RUK B;  4MEL A;  3TMP B;  1F9J A;  2RPQ A;  1Q0W B;  1U4A A;  2BPS A;  2KFJ A;  3B08 A;  1I7A A;  4PS7 A;  2Y5B B;  3RT3 B;  4DX8 A;  3GZN I;  3A9K A;  5LLI A;  4DHZ B;  2H7D A;  3KYC D;  1FAO A;  4HB0 B;  1MG8 A;  2RLO A;  5KCV A;  1J19 A;  1WXS A;  5AZH A;  5J2R A;  2D9V A;  2BWE S;  4NNJ B;  1T0Y A;  4MY6 A;  2L8J A;  3M1I B;  2FCM A;  3SU8 X;  2Y8F A;  2UZR A;  2K8H A;  4KSL C;  2ZJD A;  4WQO B;  2IZV B;  2JRI B;  2L1C A;  2HTH A;  5DHF B;  2NBV B;  3V5W A;  4M8N A;  2XK5 A;  2KWU B;  3HM6 X;  1KLV A;  4RM8 A;  1LM8 B;  3RUI B;  4BOZ B;  3IG3 A;  1RRB A;  4GDK A;  3F0W A;  1E90 A;  4JK8 A;  1WY8 A;  2NBW B;  4WVF B;  3VUX A;  4KHA A;  4NQK E;  1GG3 A;  3PLU A;  3N30 A;  3VFK A;  3O96 A;  2YS1 A;  2FUH B;  1LXD A;  2O6V D;  1FHX A;  4K7S A;  2JPH A;  3U7D A;  4RM9 A;  2DAJ A;  1E5W A;  3TW1 A;  1ZW7 A;  1IP9 A;  4P7I A;  2RNR B;  3SDL C;  5AZF A;  2M1M A;  2G3Q B;  4NAW A;  5D6J B;  4HAY B;  4WJ7 A;  2MBE A;  5C1Z A;  4MGY E;  3T9L A;  2YRY A;  5L95 C;  3CIK A;  3PRZ A;  2IO0 B;  3ENE A;  3V6C B;  3UF8 A;  2EMT A;  4HLE A;  2WX0 A;  2DZK A;  4NJ7 A;  1WZ3 A;  4DHZ E;  2ROV A;  4IM2 A;  1KI1 B;  2R2O A;  2K2J A;  2N0Y A;  5L81 A;  3V6E B;  2JY6 A;  1V5U A;  2C7M B;  3V61 A;  5LXH A;  1WH3 A;  4EEW A;  3P6A A;  4EZK A;  2MA9 B;  1FHO A;  4FAD A;  1FGY A;  5D27 A;  2MW5 A;  2ZNV C;  4I6L B;  3GYP A;  4FHK A;  5IJM A;  3FP5 A;  4A6K A;  1WXV A;  1EAZ A;  4MK0 A;  5D3W A;  1WMH B;  2O2V B;  2VRW B;  1SIF A;  1V5P A;  1H10 A;  4EZJ A;  2P0H A;  2XEW A;  3PHX B;  2CHZ A;  3ZNZ B;  2WDT B;  1B55 A;  3CST A;  1AWE A;  2DHI A;  3W1S C;  3BJI A;  4WJN A;  2IY0 B;  4G3X B;  5E6N A;  4BVU C;  3A1Q A;  2DYQ A;  1NDD A;  1HB6 A;  4HJK A;  1WR6 E;  2LOX A;  3AU4 A;  4IWO A;  2COF A;  5JP4 A;  3SV1 A;  2UVM A;  2JRH A;  4K81 A;  2DHZ A;  3VTV A;  4J6I A;  1NTV A;  2MKR A;  1UPR A;  1X05 A;  5FR6 A;  1Y5O A;  2YLM A;  4K7W A;  1ZC4 B;  1XD4 A;  3A4S C;  4LDT D;  3RD2 A;  2LGY A;  2KX3 A;  4JKB A;  2KUP A;  2DHJ A;  2RD0 A;  5D3Y A;  4FHJ A;  2LJ5 A;  2KLG A;  1FXT B;  4X57 B;  2FJL A;  2CKH B;  1Y8R C;  3QAQ A;  3AUL A;  4IUM B;  4HB4 B;  5J3Y A;  1I35 A;  1RLF A;  2KAN A;  5D3V A;  2X18 A;  2KKC A;  2FIF A;  3WIM A;  1UD7 A;  3TVV A;  1HE8 A;  3QWZ B;  2LXC A;  2EJ8 A;  1UZX B;  2LRW A;  1ZKH A;  2KX0 A;  2MBQ A;  1V5T A;  2N9X A;  3R66 C;  3BY4 B;  1V88 A;  4HCP B;  1MK9 B;  4NQL B;  4DWF A;  2GBK A;  3QWM A;  5DPW A;  1NVL A;  2DZJ A;  3DVG X;  2NMB A;  2DTC A;  3ZO5 B;  5J17 A;  2DX1 A;  5C79 A;  5HKH A;  3JW0 X;  2LGD A;  2OTX A;  3KUD B;  2L00 B;  5J3Q A;  3VDZ A;  3PPA A;  1WJ6 A;  3WA0 A;  3PEG A;  2BCJ A;  3WAO A;  4F1S A;  4KHO A;  4IM0 A;  3H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...