4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
1RLFA 2PZ1A 3UF8A 4WVFB 2KD0A 2NPTB 2KK8A 4NSWA 3MPXA 1N3HA 4XC2A 1WJUA 5DH9B 2XK5B 4TUUA 3DXDA 1UBQA 4DBBA 2KJ6A 4DHJB 2DX1A 2YLMA 3X0WA 3ZKJC 2ABDA 3GZNI 4KDIC 4HXDA 2AL6A 2DZMA 2RQ1A 4HAZB 1MAIA 2H7EA 2K2JA 1LXDA 2DYBA 3ZLZA 4TQ0A 3IBEA 3JVZX 1SE9A 3KSYA 3K9PB 3CF6E 1XX0A 3ML9A 4MT7A 3APFA 4YL8A 2J7QB 3ZNGC 4FJZA 4CYEA 4HHVA 1EVHA 4K81A 2GOWA 1NDDA 2BKRB 2KOXA 3EC8A 2L1CA 4GDLA 4I6NB 2LUEA 2WX0A 3GOEA 1C3TA 2PE9A 5LXIB 2FIDA 4HCNB 1YJ1A 4TYZA 2P0FA 2KKCA 2KMAA 3VFKA 1HB6A 2VSZA 3UIOB 2YS1A 2FAZA 2N1VA 1OY2A 2D4QA 3VUXA 1V5PA 2KFKA 1L2NA 3ZW3A 5HE3A 4X57B 2CHZA 2CRFA 1DBHA 1U5GA 4MK0A 1DDVA 2MBBB 2CAYA 2EJ8A 5JLJB 2FJ9A 4PNKA 4PYZA 3TMPB 3SV1A 1ISNA 3L08A 3A9JA 3NZSA 3T9LA 3KVFB 4BBNF 3ZO5B 2PEAA 2RGNB 2UZRA 4B6WA 2LGXA 3PHXB 1SHCA 4IW0A 1WXSA 5D27A 1V5TA 4BKSA 3A33B 3ALBA 2ZPYA 5C5BA 2ZJDA 2RUKB 4M0WB 4EEWA 2JY6A 5JHHA 5G2NA 1EUVB 4DHJD 5AZGA 4HWIB 2MW5A 2CS4A 1WJNA 3WYFB 2YT0A 1B55A 2RLOA 2KDEB 4G3XB 3DBHI 1MIXA 2EC1A 1BT0A 1C1YB 1WG7A 1FHOA 2RGFA 5CX3A 1MK7B 2OQBA 1GC6A 2W2XC 4K7WA 1WI0A 4PYUA 1P6SA 4GN1A 2DHKA 1YX5B 5LOPB 3PHWB 3PTFC 2KQ7A 2Z0OA 2YF0A 4B9KA 1UNPA 2DX5A 2N9PC 1J0WA 2GS0A 1V6EA 2DKQA 2MBHA 3PLUA 3VVWB 1M7RA 2FIFA 1PFJA 3EFUA 4J6IA 1OQNA 2G3QB 1WMHB 3ULBA 4BFRA 1WGYA 5D2MB 4A6KA 4BOSC 3DXCA 5FI0A 2K8HA 4GOCA 2D9WA 3MTNB 4XWXA 2FCNA 2MX2A 1V86A 2GMIC 4GSWA 4AP4C 2KX0A 3L16A 5J18A 5D6JB 4F7GA 5AZFA 5KQ1A 3EHVA 2MFQA 5C6RA 3HHMA 4E74A 1RJ2A 2JZ3B 2M38A 3H6NA 1BTKA 1WE6A 2EMTA 1ZGUB 3A1QA 3G9WA 3NY5A 3ODWA 4MJSA 4A6FA 5JH5C 1FB8A 2G4SA 3FSSA 3QHTA 3ZDMC 5DCNA 2UYZB 4LJOB 2H7DA 1Z5SB 2GBNA 4K7SA 3PGEA 5C16A 4K2OA 3M95A 3H7SA 2BGFA 2K2UA 2GBJA 4TV3A 2Z0QA 3HIZA 4HK2A 4HDOA 1P3RA 4NAWA 2M17A 2KCJA 1WY8A 4G50A 3SU8X 3RULA 4EZJA 3VTVA 4HPLB 4ZRKA 2OTXA 2MBOA 2LJ5A 3RUIB 2BWES 3PRPB 3WANA 4K7UA 1CMXB 1V9JA 2N7EA 4NQKE 2ROVA 1X86A 2R0DA 3TIXA 3DDCB 2MKRA 3LDZE 1S3SG 2CKHB 2QKMA 4BBNC 4N9F4 2JT4B 3QA8A 3M1IB 4MEMA 5CLLB 3C0RB 4B95A 2V4LA 5JHBA 3EPYA 2ZCCA 4WWPA 3VUYA 1S1QB 1F9JA 2COPA 4GB9A 3ZTCA 4RM8A 4IG7B 4CHKA 4GDKA 4BKSD 3UINB 1IPGA 4GMVA 4K2PA 3ODOA 2RPQA 2MP2B 1GG3A 4ZRIA 1X1FA 1BAKA 2HE7A 4IWQA 5DPRA 4M8NA 2RSUA 4CHJA 2NPTA 1T0YA 2Y8GA 1E5WA 2ZVOA 4FLHA 3CMMB 4MELA 1NBFC 1ACAA 2REXA 2XK5A 1AARA 1KM7A 1V49A 1W1DA 1AWEA 1QC6A 3ZNZB 2NS5A 2D07B 3WALA 1WZ0A 2BCJA 4RM9A 2N9EB 1PLSA 3TFMA 4URKA 2DKPA 4WJPA 3DXEA 4KHBB 2Y8FA 3PSEB 4WJ7A 1UNQA 5D3VA 1WX7A 2KN5A 4XZ4A 1Q0WB 3QARA 2R2OA 3DVGX 1FHXA 3WAMA 1L7YA 3WAPA 2UWQA 2KGXB 3N7CA 1U2BA 4II3B 4GDKB 1RAXA 2K8BA 3DOWA 3AI5A 4TKNA 4LCDE 4JLCA 5BO4B 3OJ4B 4B6HA 1WJ6A 3FP5A 2CQUA 1XT9B 3PVLA 2Z59B 2GCJA 3O65B 3PLVA 4W9CA 3W1SA 3CSTA 2VRWB 1WI1A 1W1GA 1WH3A 3HM3A 4LDTB 4DHZB 1X05A 4MY6A 2LRUA 3HW2B 3QC8B 3O96A 2UVMA 4KV2A 4KIKB 3VHTC 3UQBA 3VIAA 2MA9B 1E8XA 2CHXA 3H1UA 3DBLI 4I6PA 1MK9B 5GMVA 3LJ3A 1GC7A 1WJ1A 4HPMB 1KI1B 2J0MA 2V76A 2A5UA 3SNHA 2IO0B 1FHWA 2L0TA 5L81A 2K6DB 2A4ZA 2WH5A 4EZLA 5AZHA 3VXWA 1V61A 2MQJA 1XQQA 1U27A 3A4RA 3GYOA 2PPHA 1UH6A 2ZNVB 3A9KB 4HB4B 2LGYA 2YT1A 1Q67A 2Q13A 2NCNA 2E2XA 3NZUA 4ANXA 1MG8A 1UPQA 2JPHA 1LM8B 2JXXA 3QIJA 3QK0A 5L95C 4P7IA 3U8ZA 5C1ZA 2AWTA 4WJNA 3DVNU 4GGQA 1U5DA 2LBBA 2YS5A 4F7HA 4ANWA 1EAZA 3A8QA 4I6LB 4A20A 3IHPC 3TBLD 4W9KA 2AYOB 1OEYA 2NR2A 1HBKA 2KWVB 2MBQA 2GCLA 1X1GA 1ZC4B 3WA0A 4W9EA 2DAFA 4JIOU 1P98A 4WJOA 1M94A 1GNUA 2JF5A 3SO6A 2MWNB 3VH3B 3UZTA 3U7DA 4AWJA 3VTUA 2DZIA 4HAVB 2LKOA 3JSVB 5EFXA 5LXHA 4IAPA 1WYWB 3ZNHB 1KOTA 4IOYX 3ODXA 2HJ8A 5HE2A 2KHWB 1WMHA 3AJ4A 3ZNID 3KUZA 3RD2A 4IWPA 2R2QA 3OJ3A 3PP2A 3L54A 2CY4A 2NBWB 2KUPA 2KJRA 2COCA 3AU5A 2HTHB 4FHKA 4ASWC 4OVVA 3TO1A 1J19A 5C79A 2MBEA 2D3GA 4YONA 2KTFA 4ZDVA 3X23A 2N9XA 4IM0A 4BBKA 5IAAC 3N3KB 1TJ6A 2QKLA 3ZUNA 3K9OB 1P3QU 1WZ3A 2L00B 4IC7B 1E90A 3VTWA 1WGUA 2JUOA 2MSED 3PRMB 5C23A 2N7DA 3V5WA 1W1HA 2C7HA 3QWZB 2BF8B 3T06A 3RZWC 4IFSA 3BINA 3V62A 1IP9A 2RSGA 4W9DA 1ZVRA 3DVNV 2DENB 1P9DU 3VOQA 2B3AA 5E6OA 2KNBA 2J59M 3KY9A 4FJVB 3RYTA 4TQ1A 4HAUB 3ZIMA 1ZC3B 5FR6A 2LRWA 3OANA 2O2VB 2IYBA 2RD0A 2BKFA 3ZVVA 5FI1A 2FCSA 4L6EA 3SUZA 2C7NB 2IO2B 2HRJA 2IO3B 4II2B 2O6VB 3AXCA 2R09A 2ADZA 4F1SA 2VKIA 2YRYA 2M4NA 4MH0E 1DYNA 2KJHB 4EUTA 3B08A 4PQ0A 1BWNA 5KCVA 2KQSA 4GZUA 2P0DA 2KO3A 1KZGA 2KWUB 5J2RA 1I42A 5D3WA 2OOBB 2XEWA 2WDTB 1OTRB 2HD5B 4ANUA 2MP2A 4AOFA 3ZRFA 1WVHA 5GOWB 2IZVB 4JGHB 1VCBA 2ZPNA 1J0GA 2UZSA 4BOZB 3D32A 5LONB 3PV1A 4JQWC 3ULCA 3PVWA 1E7UA 1EGXA 4A3OA 4FBJB 2N0YA 4AUQC 2KX3A 2LYDA 4WAAA 1UBIA 3DQVA 3L13A 1WXAA 2KDIA 3QCAA 4EJNA 2G4DB 2BPSA 1Y19B 1WGGA 5AEKB 4CHMA 4DDGD 3RT3B 3APCA 1WXVA 2W9NA 1FGZA 2IBIB 3QJZA 4JL9A 1UEFA 1LW3A 2KFJA 2COAA 4GXBA 1V5UA 2J0JA 4KHAA 2N1WA 2PE6B 3DBSA 3CXBB 3VH4B 4Z2NA 3QBVB 4EZKA 4F8CB 3OAWA 1FOEA 1V5OA 4GU2A 3I3TB 3V6EB 4FADA 2Z0DB 2ASQA 3L10B 3A8PA 2AL3A 2BYEA 1I7AA 3FM8C 5KHOA 2C9WB 1LB1A 1TQZA 3SD5A 5IJMA 2KDFB 1ZKHA 4PS7A 2CU1A 4KZCA 2COFA 2LXAA 2GBRA 4K17A 1XKEA 3ML8A 2LVQA 2CODA 2DFKA 3LJUX 1KJTA 1YIWA 1DDMA 3ZDTA 2Z0PA 2I5FA 1NVLA 4H8SA 1WRDB 4KIKA 1MPHA 2MRPA 3HQCA 4CO7A 1UD7A 3P6AA 1HE8A 2JWZA 3KYCD 3ZRCA 1OGWA 4MGKE 2JP2A 3VAWA 1TXDA 1M7EA 1EF1A 3ZTDA 3PVUA 2XQNM 3A98B 3KRXA 4A6HA 1P1AA 4M8MA 4AJYB 3P2BA 1WJ4A 4RMAA 4OVUA 3B0AA 4GPTB 3VQIA 1YQBA 2L2IA 3A9KA 4FA6A 1V5MA 4A5KA 1V89A 5HKHA 2M1MA 4EKUA 5D7GA 3MDBC 4DBGA 1RRPB 5D3YA 5JHGA 2CB8A 4WWOA 4NPNA 1WR1A 2YSZA 3AULA 3QQ8B 1JRUA 2KANA 2DN6A 1WGRA 4FHJA 3DBRI 4KHOA 4FJYA 2LVPA 4MGIE 4W9GA 4PS3A 4DDID 1I35A 1TTNA 1WX9A 2I5CA 4Y94A 2DLWA 2IY0B 1ZM0A 2G45B 2K8CA 2WWZA 3VDZA 1WGQA 1Z2MA 1MKEA 2W2WA 2RVBB 2W2XD 1XODA 2KC2A 3KZ1A 4A3PA 2NBVB 1ST7A 2DZJA 3IG3A 3HM6X 1TZ1A 3PZDA 3ONSA 2J0KA 3KYDD 4HJKA 4WQOB 4NJ7A 2I1JA 1U29A 2NVUI 2MLBA 1I2HA 3JSVA 2YS3A 4D0NB 2L05A 1TGZB 2GBMA 1R4MI 1KLVA 2X18A 2V3SA 2PJHA 3D8DA 1Y8RC 3VUWA 3T8MA 3H7PB 2RNRB 5D3XA 4KSLC 2WYQA 3PG7A 2KTRB 1UGMA 5DI9B 1G6JA 5KHQA 5HE0A 2N23A 3HK0A 1V80A 3UIPB 3IVFA 3OLMD 3NSUA 3ZVRA 2JRHA 5DPWA 2HTHA 2ELBA 2ROZB 3PSCA 3F0WA 2DTCA 1WF9A 3B1LX 2IO1B 4WWNA 1PQSA 2DZKA 2DA0A 2LGDA 4ANVA 4MSMB 2AEHA 3W1YA 2DYQA 4MDKE 1K8RB 1XD3B 4W9FA 3D8EA 4KVGB 3APDA 2G35A 3N30A 4FN2A 1FGYA 3PRZA 4W9IA 5JP4A 1E8YA 2LOZA 2M0XA 4ICUA 3H9DA 1EO6A 1UELA 3PEGA 5EDSA 2L8JA 5E6PA 4AJWA 3M63B 2ZZPB 2NMBA 3RCZA 1P0RA 3BY4B 3SYXA 3AU4A 3P7ZA 4HB3B 2IY1B 2VRRB 2L0FA 3PS6A 4W9LA 5CLQB 4HVBA 3U30A 4G0NB 1DDWA 1NU2A 1QQGA 3ENEA 4LDTD 5DPSA 2WX1A 2D10A 1WJMA 2K25A 1V81A 2LOXA 4KAXB 2L7RA 2C5LC 1IRSA 1R4NI 5CHVC 2CHWA 2MCNB 2O2VA 3RZFA 1WFYA 2LASA 2LVOA 5DHAB 4ZRJA 2CY5A 4BKGA 1GUAB 4GDLB 4MM3A 1H4RA 2DYOA 1RRBA 2O6VA 1U5EA 5E6NA 2V1YA 2JZZA 5L83A 4F7UP 2FNJB 1AQCA 2BYVE 4BVUC 3FLVA 3JW0X 1BTNA 3DVGY 3MHSD 1WE7A 1NTVA 3CSFA 2D9ZA 2K00A 2KFKB 2Y5BB 1SGHA 1NI2A 3NHEB 4E3CA 3TVVA 4NJ6A 1A5RA 2LXCA 2EMSA 3Q3FA 1PMSA 2KXJA 2D9VA 1GJZA 2BWFA 3DPDA 4HDQA 1NTYA 5J17A 5CHWA 3DCGA 5D94A 4ICVA 2NBUA 3R7QA 5IA7A 4NY0A 2LZ6A 3L17A 2LG1A 1ZSQA 3NOBA 3KUDB 2FDQA 1U5FA 3A9JB 5JHAA 1EF5A 1E8WA 2D2QA 2P0HA 1V2YA 5JZEB 1Q5WB 4W9HA 3IFWB 3R66C 1NTIA 2KWCA 2D9YA 4PS8A 2C7MB 3V61A 2GJYA 3V6CB 3D8FA 1YD8U 5C5BB 2DHJA 2ZEQA 4E71A 4DXAB 4HAYB 3NS8A 2KMCA 4WJQA 4C0AA 4DX90 3RCPA 4IWOA 5CTRC 1UPRA 3V60A 1E7VA 4HATB 2JVCA 2I1KA 4FULA 3CIKA 3WIMA 1Q1OA 2KLGA 2LI5A 1OQYA 2JRIB 1WR6E 3KH0A 2K6QA 4HCPB 4MGZE 5DIFB 3EECA 4HLEA 2FCQA 2QHOA 3ECIA 4NNJB 1XD4A 1WGHA 1UZXB 4IM2A 4HB0B 1RFAA 3KUCB 2P8VA 2DX5B 2DYMA 2IYDB 1FAOA 4EOYA 1Y5OA 2L3ZA 4BKTA 3BJIA 2CR5A 4XX5A 2OJRA 1SIFA 1UNRA 3KW5B 3QAQA 3M3JA 1H10A 2D9XA 4GIVA 4DK5A 3PREA 3MJWA 1TBEA 4IM3A 2ZVNA 2DHIA 5KQ4A 3TCAA 4KZ0A 4NQLB 5J3YA 3L0WB 4MGYE 3PT2B 5G55A 1HB8A 2LWPA 1E8ZA 4HAWB 1Z87A 4G11A 1D3ZA 3M62B 3JYUA 4ZYNA 1XCGA 1WM2A 2KVRA 2ZCBA 1OMWA 2D11A 1WXMA 1K5DB 1VD2A 3A1QB 2ZNVC 1U4AA 4MJSB 2DYNA 4A6FB 2Y7BA 1FXTB 1LFDA 4KSKC 2XBBC 1K5GB 2KC1A 1WM3A 4DWFA 2YVCA 3WAOA 2FJLA 2NZ8B 3W1SC 4DX8A 3SHQA 2O6VD 4NAWB 5LLIA 2M14A 1MIZB 3FEHA 3UGBB 1P5TA 2C60A 4EFOA 4WSFA 4MSQB 2KDBA 2IFSA 4KDLB 1X1MA 2FCMA 2BYFA 1X11A 3S2AA 1QZEA 4IUMB 1YX6B 3A4SC 3F5RA 3R7RA 3TW1A 2KLCA 2Z0EB 1KZ7A 4W9JA 3QX1A 2L76A 2GBKA 1XR0B 2FUHB 3KRWA 1V88A 2K39A 1DROA 5HE1A 3QWMA 2MWSB 2ELAA 2DAJA 4GMXB 4DHZE 1WIAA 3SDLC 4Z2MB 4LJPB 2MDXA 2M8SA 2K1FA 1LQBA 4HB2B 2N4FA 5J3QA 2RR9A 3H7PA 4EMOA 2DHZA 2KTRA 4F7ZA 4HAXB 1WX8A 3TJPA 1OEYJ 2KZRA 2LD9A 3R3MA 3UQAA 2LULA 2EKEC 1IYFA 3PPAA 3ML4A 3Q3JA 3GYPA 1WGDA 5DHFB 3TL5A 5DPTA 1H8CA 5CHFA 1J8CA 5TR5A 4K1RB 3N32A 5J3TA 1ZW7A
chains in the Genus database with same CATH superfamily
1RLFA 3MP9A 2WXOA 3ZXRA 2PZ1A 3NZ3A 3UF8A 4TSSA 4WVFB 4B0EA 1TZOA 2KD0A 2NPTB 2KK8A 4XWTA 4NSWA 3MPXA 3P4SB 1N3HA 3AECB 4XC2A 1WJUA 1I4XA 3DHGC 5DH9B 2GI9A 2XK5B 3AH7A 1HQRD 4TUUA 3OHMB 3DXDA 1UBQA 3TEYA 1LO5D 4DBBA 2Q5WD 2KJ6A 4DHJB 1MHHE 2DX1A 4QJ3B 2YLMA 3X0WA 3ZKJC 1VJKA 2B76B 3IAM1 2ABDA 3GZNI 4KDIC 4HXDA 1GAQB 2AL6A 2DZMA 2RQ1A 4HAZB 4JX1C 1TS5A 1MAIA 2H7EA 3A58A 2K2JA 1A70A 1SF0A 1LXDA 2DYBA 2W55A 3ZLZA 4TQ0A 5LG4B 3IBEA 3JVZX 1SE9A 1WWTA 3KSYA 1VR9A 4LNKA 4JK7A 3DCXA 2GRIA 1ROEA 3K9PB 3CF6E 2K8EA 1XX0A 3ML9A 4MT7A 1YQ4B 3APFA 3TEWA 4YL8A 2J7QB 3ZNGC 2YEPB 2RDBC 1QLBB 4FJZA 4M01A 3IT6B 3U12A 4CYEA 4HHVA 2R61A 1EVHA 1TKGA 4K81A 2GOWA 1EM7A 3E56A 1Y56A 1NDDA 4Q2JA 1TS3A 2BKRB 2KOXA 3EC8A 2L1CA 4GDLA 4I6NB 2X8XX 1V1PA 2L1AA 2LUEA 2WX0A 2BS2B 3GOEA 1OQRA 1C3TA 2PE9A 5LXIB 2FIDA 2I38A 3EUB2 4HCNB 1NYRA 1YJ1A 4TYZA 1I7HA 1MJDA 2P0FA 2KKCA 1UUPA 2KN4A 2KMAA 3VFKA 1HB6A 2VSZA 4JKBA 2YS1A 3UIOB 2FAZA 3AE3B 2N1VA 1TS2A 1OY2A 2D4QA 1ZP0B 4ZHPA 3VUXA 1WYGA 1V5PA 2KFKA 1L2NA 3ZW3A 5HE3A 4X57B 2CJOA 2CHZA 4JKHA 2CRFA 1DBHA 1U5GA 5I4DA 3Q3NC 2PLPA 4MK0A 2BB6A 1C4PA 1FD6A 1DDVA 2KMMA 4L23A 2OEDA 2FUG1 1TS4A 1I4GA 1DOIA 1I4RA 2MBBB 3VRBB 4MACA 1L0VB 2L52A 2CAYA 3KLSX 1JWUD 4M00A 4OZBA 2WGSA 2EJ8A 5JLJB 2FJ9A 1FNWA 4PNKA 4PYZA 5G5HA 1T3QA 3TMPB 4YSZB 2WS3B 3SV1A 3BWUD 1ISNA 3L08A 3A9JA 3NZSA 3AEEB 1JWBD 3T9LA 3KVFB 4BBNF 2WXJA 3ZO5B 2PEAA 2R2YA 2RGNB 3I57A 4OT1A 2JQRB 3W2DA 1TY2A 2UZRA 2DBYA 4B6WA 2LGXA 3PHXB 1SHCA 3ZXVA 1R7SA 3ZYYX 4IW0A 1WXSA 1YMHE 2JYEA 5D27A 1V5TA 4BKSA 3A33B 3ALBA 2ZPYA 5C5BA 2ZJDA 2RUKB 4M0WB 4EEWA 2JY6A 5JHHA 2LJIA 5G2NA 1EUVB 1FRRA 4DHJD 5AZGA 4HWIB 3GE8C 3SBTA 2MW5A 2CS4A 1HEZE 2K5PA 1FEHA 2W3SA 1B9RA 1WJNA 3WYFB 2YT0A 1B55A 5C3JB 3P42A 5C2TB 2RLOA 1EWCA 1XF5L 1WGKA 2KDEB 3FVCA 2INCC 4G3XB 3DBHI 1MIXA 2EC1A 1BT0A 1C1YB 2QIEB 1WG7A 1FHOA 2KIGA 4R3DA 2RGFA 5CX3A 1MK7B 3NWAA 2IDYA 2OQBA 1GC6A 2W2XC 4K7WA 1WI0A 3P63A 4L1RA 4PYUA 1P6SA 4GN1A 2JSVX 2DHKA 1YX5B 5LOPB 3PHWB 2DWQA 3BIID 3PTFC 1E7PB 3HVZA 5AUIA 2KQ7A 5D3DA 2Z0OA 2YF0A 4B9KA 1UNPA 2DX5A 2N9PC 1J0WA 2GS0A 1V6EA 2DKQA 2MBHA 3PLUA 3VVWB 2NMQA 5M4YB 1M7RA 1TKEA 3BVZA 1IGCA 2FIFA 3KQ4A 1PFJA 3EFUA 4J6IA 1OQNA 2J4XA 2G3QB 3AEBB 4WQMA 1WMHB 3ULBA 1L5PA 3N1ZC 4BFRA 1WGYA 5D2MB 4A6KA 4BOSC 3Q3MC 1F0ZA 1T0QC 3DXCA 5FI0A 2INDC 2K8HA 4GOCA 2D9WA 2Y5PA 4M02A 2PKOA 3O13A 3MTNB 1PGBA 3H8HA 4XWXA 1EWYC 1SE4A 2FCNA 2WU2B 2MX2A 1V86A 2GMIC 3EGRA 3ETRA 4GSWA 4AP4C 3DHIC 2KX0A 1YQ3B 3L16A 2J53A 3HVDA 5J18A 5D6JB 4F7GA 5AZFA 1FRDA 5KQ1A 1FNVA 3EHVA 2WQYB 2MFQA 3E9SA 5C6RA 1D5XC 3HHMA 3HSAA 4E74A 1RJ2A 2JZ3B 1EU4A 2M38A 1FCCC 1PYWD 3AEFB 4DXGA 2MJEA 3H6NA 1BTKA 2DNFA 1WE6A 2EMTA 1ZGUB 1PGXA 3GB1A 1HA5A 2QEJC 1I4QA 3A1QA 4DXFA 3G9WA 4OHJA 1VBGA 3NY5A 3ODWA 2ICIA 2WXGA 3KWVA 4MJSA 3SEBA 3FILB 4A6FA 5JH5C 1FB8A 2G4SA 3FSSA 2PW9A 4RF1A 3LXFA 1V1OA 3QHTA 4PT5A 5DCNA 3ZDMC 2UYZB 4LJOB 2H7DA 1Z5SB 2GBNA 4K7SA 3PGEA 1E9MA 5C16A 4K2OA 3M95A 3H7SA 2BGFA 2K2UA 2GBJA 4N6EB 4TV3A 2Z0QA 3HIZA 4HK2A 4HDOA 4J3OD 1P3RA 4DIXA 1K51A 4NAWA 2M17A 2KCJA 3NG0A 1WY8A 4G50A 2HJ1A 3SU8X 3RULA 4OVZA 4EZJA 4WURA 3VTVA 4HPLB 4ZRKA 1OQQA 1TJEA 2OTXA 2MBOA 2OHFA 2LJ5A 3RUIB 1GPXA 2BWES 3PRPB 3WANA 4K7UA 1CMXB 1KLUD 2ACZB 1V9JA 2N7EA 4NQKE 3PZ8A 2DLBA 2K22A 1RWSA 2ROVA 1L6UA 1X86A 2ZW1A 2R0DA 3RN9C 4AQ7A 3TIXA 3DDCB 2MKRA 5HFYA 3LDZE 2L32A 1S3SG 2BW2A 2CKHB 2QKMA 1T6BX 4BBNC 4N9F4 2JT4B 3QA8A 3M1IB 4MEMA 1C77A 3AEGB 2INNE 5CLLB 3C0RB 3RI7C 4B95A 2V4LA 5JHBA 3EPYA 2ZCCA 2PIAA 4WWPA 1QOAA 3VUYA 1S1QB 1F9JA 2G1EA 2COPA 5JVLA 4GB9A 2LUMA 1K52A 3ZTCA 4RM8A 4IG7B 4CHKA 3ZJVA 3C8YA 3OG5A 4GDKA 4GOUA 4BKSD 3UINB 1IPGA 1DOYA 4GMVA 2V0GA 1FXIA 4K2PA 3ODOA 2RPQA 4JKEA 2MP2B 3VR8B 4IDIA 3FC4A 1GG3A 4ZRIA 1SB3C 1X1FA 1FFVA 1BAKA 2HE7A 3AE5B 4IWQA 5DPRA 1KRHA 4M8NA 1HTQA 3TUOA 2RSUA 1D4BA 4CHJA 1XO3A 4ZRQA 2NPTA 1T0YA 2Y8GA 3GP7A 3IT4B 1E5WA 2AQ1B 2ZVOA 4FLHA 3CMMB 1R4MB 2WXHA 4MELA 1NBFC 1ACAA 1JWMD 2REXA 1FIQA 2XK5A 1AARA 1KM7A 1V49A 1W1DA 3NRZA 3N20C 3RNEC 1AWEA 1QC6A 4XDCA 3ZNZB 2NS5A 2CJNA 2D07B 5G5GA 3WALA 1WZ0A 2BCJA 3U7ZA 4RM9A 2N9EB 1PLSA 4JK8A 3TFMA 4URKA 2DKPA 4WJPA 3DXEA 1XEEA 4KHBB 2Y8FA 3PSEB 4WJ7A 1UNQA 5D3VA 1WX7A 2KN5A 3I5JC 3RNAC 4XZ4A 1Q0WB 3ZGZA 3QARA 2R2OA 4XGAB 1I4PA 1K53A 2Y5CA 3DVGX 2WP9B 1FHXA 2V3NA 3SBGA 3WAMA 1L7YA 3WAPA 2UWQA 1UWXA 2YT2A 2KGXB 3N7CA 1JRPA 3Q6BA 1U2BA 1ZXHA 2X0SA 4KGSA 4II3B 4GDKB 3AE8B 1RAXA 3RNGC 1XLOA 3GS2A 2K8BA 4JKCA 3DOWA 3AI5A 4REZA 3U2SC 4TKNA 4C7YA 1TYGB 4LCDE 1ZOYB 4JLCA 4CQNA 2IGGA 5BO4B 3OJ4B 4B6HA 1WJ6A 3BZDB 3FP5A 2CQUA 1XT9B 3PVLA 1SXTA 2Z59B 1STEA 1ZYIA 2LEKA 3BVMA 4D2KA 3W9CB 2GCJA 4QJ5B 3O65B 3PLVA 4W9CA 5EE1A 5IP4D 3W1SA 3CSTA 5IRSA 2VRWB 1WI1A 1W1GA 1E6EB 1WH3A 3HM3A 4LDTB 4DHZB 1X05A 4MY6A 2LRUA 3HW2B 1N60A 3QC8B 1ESFA 3O96A 2V3PA 4YXDB 2UVMA 4KV2A 1RM6C 4KIKB 4KGRA 3N1XC 1AN8A 3VHTC 3UQBA 1AYFA 4YWGG 3VIAA 5HI1A 1MG4A 1XLPA 3MC9A 4JKDA 3NWFA 2MA9B 5GXGB 1E8XA 1FO4A 2RRFA 2CHXA 2RPVA 3H1UA 3DBLI 3TEXA 4I6PA 1MK9B 5GMVA 3LJ3A 1GC7A 3BVGA 1WJ1A 4HPMB 1KI1B 2J0MA 1R4NB 2V76A 4P6VF 3E9LA 1UNSA 2RDHA 3E66A 2A5UA 3SNHA 4OZAA 2IO0B 1FHWA 2L0TA 2WDRB 5L81A 2K6DB 2JXTA 1NEKB 2A4ZA 4YSYB 2WH5A 3AV8A 4EZLA 1QKZA 5AZHA 3VXWA 1V61A 2MQJA 1XQQA 1NENB 1U27A 5IO9A 3P4QB 1ET6A 3A4RA 3GYOA 2PPHA 2VZKD 1KF6B 1UH6A 4P1CC 2ZNVB 3A9KB 4HB4B 2LGYA 2JWUA 3KWLA 1SEBD 4OZCA 4RGOS 2YT1A 1Q67A 2Q13A 3DWGC 2NCNA 2E2XA 3NZUA 1WXQA 4ANXA 1MG8A 1UPQA 3AE6B 2D3BA 2JPHA 1LM8B 2JXXA 3QIJA 3QK0A 5L95C 4P7IA 3U8ZA 5C1ZA 2AWTA 1GB4A 3AB5A 4WJNA 5IKCM 4M0WA 3DVNU 4GGQA 2AQ2B 1U5DA 5EE9A 2LBBA 2YS5A 4F7HA 2V9HA 4ANWA 4WIPA 1EAZA 3A8QA 1DOXA 2SAKA 4I6LB 4A20A 2IGDA 3IHPC 3TBLD 4L1BA 4W9KA 2AYOB 1NVID 1IBXB 1OEYA 2NR2A 1HBKA 2KWVB 1T0SC 3U4EG 2MBQA 2LHEA 2GCLA 1X1GA 5BYSA 3T3NA 1ZC4B 3WA0A 4W9EA 2DAFA 4JIOU 5IN7A 1P98A 4QJ4B 1TIFA 4WJOA 5MPOA 1M94A 1GNUA 4HPPA 2JF5A 3SO6A 2MWNB 2WXKA 3VH3B 4L2YA 3UZTA 3U7DA 5IOIA 4ILGB 4AWJA 2KDMA 4ZRPA 3VTUA 2KUQA 1PGAA 2DZIA 4HAVB 4RGMA 2LKOA 3JSVB 5EFXA 5LXHA 1ZDVA 4IAPA 1KC7A 1WYWB 3ZNHB 1KOTA 4NAMA 4JE3B 1HTOA 1MI1A 1SJHD 4IOYX 3ODXA 1F2RI 1HZ6A 2HJ8A 3NVZA 5HE2A 1XCTL 2KHWB 4HRSA 1QOBA 1VRAB 1WMHA 3P4PB 4YT0B 3AJ4A 1C76A 3ZNID 3KUZA 3RD2A 1WRIA 2KWDA 2R2QA 4IWPA 3OJ3A 3PP2A 3L54A 3PO0A 3BK1A 2CY4A 2NBWB 1TY0A 3ENBA 2KUPA 2KJRA 2COCA 3AU5A 2HTHB 4FHKA 4ASWC 4OVVA 3TO1A 2IPKD 1J19A 5C79A 1ZE3D 4YTMB 2MBEA 2W54A 2JYTA 2D3GA 4YONA 2KTFA 4ZDVA 3X23A 1JALA 2N9XA 4IM0A 4BBKA 5IAAC 3N3KB 1E10A 1TJ6A 1NYQA 2QKLA 3ZUNA 3K9OB 2WDQB 1P3QU 1WZ3A 1EU3A 1YN3A 3EFCA 2QDFA 2L00B 1PUTA 1V97A 4IC7B 1E90A 3VTWA 1WGUA 5FK9C 2JUOA 2MSED 3PRMB 5C23A 2N7DA 3V5WA 1W1HA 2C7HA 3MHZA 3QWZB 1HXYD 2BF8B 4C4VB 3T06A 3RZWC 3FILA 1T0RC 4IFSA 2N9LA 3BINA 1FCLA 3V62A 1N61A 1IP9A 3T3OA 4HROA 1BXTA 2RSGA 2KAJA 4W9DA 1ZVRA 4JKAA 3DVNV 4N59A 5TSSA 4HSIA 2DENB 1P9DU 4KKIA 1JCKB 3VOQA 1PFDA 1GOZA 2B3AA 4P1BC 5E6OA 4JK9A 2KNBA 2J59M 3KY9A 1TKYA 1VZ6A 4ZHOA 1NI3A 4FJVB 4K3CA 3RYTA 4OSNA 4TQ1A 4HAUB 3VRAB 3ZIMA 1ZC3B 5FR6A 2LRWA 3L4PA 3OANA 2O2VB 4QAYA 2IYBA 4BZAA 2RD0A 2BKFA 3W5VB 3ZQ4A 3ZVVA 5FI1A 1F52A 2FCSA 2H89B 4L6EA 3P1MA 5H8YE 2JX5A 3SUZA 2C7NB 4MM3B 4UDUC 1RYJA 2IO2B 4XDDA 4MT5A 2HRJA 2I2YA 2GLSA 2IO3B 4II2B 2WXNA 2O6VB 3AXCA 2R09A 2ADZA 5I2SA 4F1SA 2VKIA 3C19A 2YRYA 2M4NA 4MH0E 1N6ZA 3HIEA 3R2IA 1DYNA 3R8BA 2KJHB 4EUTA 4RGNA 3WCQA 3B08A 4PQ0A 1QOFA 4HKZE 3IXSA 3BYYB 1BWNA 5KCVA 2KQSA 2AQ3B 1F1HA 1Q10A 4GZUA 2FE8A 2P0DA 2KO3A 1KZGA 1L4ZB 2KWUB 5J2RA 1I42A 5D3WA 2OOBB 3AE4B 2XEWA 2WDTB 4C56C 3J9CA 1OTRB 2HD5B 4ANUA 2MP2A 4YTNB 3ZRFA 1WVHA 5GOWB 4AOFA 4YTPB 2IZVB 4JGHB 2IGHA 4MH8A 3B2FA 1VCBA 2ZPNA 1J0GA 2UZSA 4BOZB 3D32A 5LONB 1N62A 3PV1A 1VZ8A 4JQWC 1UGJA 2CU3A 3ULCA 3PVWA 1F77A 1E7UA 1EGXA 4A3OA 4S17A 3AE2B 4FBJB 2N0YA 4AUQC 2KX3A 4RH6A 2LYDA 4WAAA 1UBIA 3DQVA 3L13A 1WXAA 1MHXA 1KFYB 2KDIA 2QMTA 1F2RC 3QCAA 4EJNA 2G4DB 2BPSA 4HEA1 1Y19B 1WGGA 1CJEA 5AEKB 1AW7A 4CHMA 4OW0A 1D5MC 3SR6A 4KHBA 4DDGD 3RT3B 3APCA 1WXVA 2W9NA 1FGZA 2IBIB 3QJZA 3RFZB 4JL9A 2ZKMX 1UEFA 1LW3A 2KFJA 1B1ZA 2COAA 4GXBA 1V5UA 2K49A 2J0JA 4KHAA 2N1WA 3DBRB 1VDVA 2PE6B 3DBSA 3V05A 1C79A 3CXBB 3VH4B 3SFEB 3EA6A 4Z2NA 3QBVB 4BAXA 4EZKA 4F8CB 3OAWA 1FOEA 1V5OA 4GU2A 3IAS1 3I3TB 3V6EB 1VBHA 4FADA 2MJ3A 2Z0DB 2ASQA 3L10B 4RGTA 3A8PA 1E0ZA 2ZW0A 3AEAB 3ABVB 2QJLA 2AL3A 4JKFA 2BYEA 3AE1B 1YOVB 1I7AA 3NVVA 3FM8C 5EE0A 5KHOA 2K0PA 2C9WB 1FXAA 1LB1A 1TQZA 1JROA 3HRDD 3SD5A 5IJMA 4NJCA 2KDFB 1JDEA 1ZKHA 4PS7A 2CU1A 2Z59A 2KACA 4KZCA 2MJDA 2X38A 2COFA 2LXAA 2GBRA 1DIKA 4K17A 1XKEA 3ML8A 2LVQA 3GZNB 2CODA 5BMIA 3DHHC 2DFKA 3LJUX 1KJTA 1YIWA 4P16A 3LYYA 1DDMA 1KBLA 3ZDTA 2K3UA 3OWEB 2Z0PA 2I5FA 1NVLA 1SIJA 5JXVA 2BYTA 1JWAD 4H8SA 2NTSA 1WRDB 4KIKA 1MPHA 2Z13A 2MRPA 3AMZA 2M19A 3HQCA 4CO7A 1UD7A 3MFGA 3P6AA 1HE8A 2JWZA 3KYCD 3ZRCA 4EE2A 1OGWA 4MGKE 3RNBC 2JP2A 3VAWA 1JMLA 1TXDA 1M7EA 2PMVA 1YJJA 2V4IB 2D5GA 1EF1A 3ZTDA 4JWUC 4H2AA 3PVUA 2XQNM 3A98B 3KRXA 4A6HA 1P1AA 1XXGA 2BS3B 4M8MA 1MVKA 1C4CA 1QQRA 1SE3A 4AJYB 4XYCA 2N7JA 1RFKA 3AE9B 1ENFA 1WJ4A 3P2BA 4RMAA 1IGDA 4WH4A 4OVUA 3B0AA 4GPTB 3VQIA 1L6VA 1YQBA 2L2IA 3A9KA 4FA6A 1JW9D 3P4RB 3AM9A 1V5MA 4A5KA 5FKAC 1V89A 5BYQA 5HKHA 2M1MA 4USAA 3B9JA 4EKUA 5D7GA 3MDBC 4DBGA 1RRPB 3URYA 5D3YA 1T77A 5JHGA 2CB8A 4WWOA 4NPNA 1P7EA 1WR1A 2YSZA 4LNOA 3AULA 3QQ8B 3FAHA 1JRUA 2QSDA 2KANA 2DN6A 4KKJA 2WXPA 1MI0A 1WGRA 4FHJA 3DBRI 4KHOA 4FJYA 2LVPA 1N5WA 4MGIE 4W9GA 1YNTE 1IBXA 2WXIA 1DYQA 4PS3A 4DDID 1I35A 2W82A 1TTNA 1WX9A 3NVYA 2I5CA 4Y94A 2H88B 2DLWA 2IY0B 2BVCA 1ZM0A 2G45B 2K8CA 2WWZA 3VDZA 1WGQA 1Z2MA 1MKEA 2W2WA 2RVBB 2W2XD 1C78A 2XNAC 1I4HA 1XODA 4NZLB 2KC2A 1CQVA 4KGTA 3KZ1A 4A3PA 2NBVB 1ST7A 3E9OA 2DZJA 2QCZA 3IG3A 3HM6X 1TZ1A 3PZDA 5FR3A 3ONSA 2J0KA 3KYDD 3RPFC 2TSSA 4HJKA 4WQOB 3Q69A 4NJ7A 2I1JA 1U29A 2NVUI 1P7FA 2MLBA 2BBCA 1I2HA 3JSVA 3N9YC 4JKGB 2YS3A 1IUEA 4D0NB 1ZPSA 2L05A 5BMGA 1TGZB 2EKIA 2GBMA 1R4MI 1KLVA 2X18A 2V3SA 2W3RA 2PJHA 3D8DA 1Y8RC 3VUWA 3Q3OC 3T8MA 4HKQA 3H7PB 2RNRB 1L0XB 5D3XA 2KT7A 4KSLC 2WYQA 3PG7A 2GB1A 1JQ4A 2KTRB 4WWMA 3DBHB 1UGMA 3NUHB 5DI9B 2AX5A 1QF6A 2EELA 2WHIA 1G6JA 5KHQA 5HE0A 4K3BA 2N23A 3HK0A 1V80A 3DWMA 3UIPB 3IVFA 3OLMD 2RDGA 3NSUA 3ZVRA 2JRHA 5DPWA 1N5XA 2HTHA 5T8IA 5EE3A 2ELBA 2ROZB 3NW8A 1BMLC 3PSCA 3F0WA 2XN9C 2DTCA 1MPEA 1M4VA 3MC0B 4US9A 1WF9A 2PVOD 3B1LX 3Q8CA 2IO1B 4WWNA 1PQSA 3HUIA 4LNIA 2DZKA 2DA0A 4RCOA 2LGDA 4ANVA 1OFFA 2LFIA 2Z14A 4MSMB 1N63A 2AEHA 1C4AA 3W1YA 2DYQA 4MDKE 1K8RB 1XD3B 4N58A 2JU6X 4W9FA 4WAFA 3D8EA 4KVGB 3APDA 2G35A 3N30A 4FN2A 1CK1A 1FGYA 3CIRB 3Q2AC 3PRZA 4W9IA 1DGJA 5JP4A 1E8YA 2LOZA 4FXCA 2M0XA 4ICUA 3H9DA 2LMCA 1EO6A 4C4VA 1UELA 3PEGA 5EDSA 2N9KA 2L8JA 5E6PA 4O1NA 4AJWA 3M63B 2ZZPB 2NMBA 3RCZA 1P0RA 1D6EC 3BY4B 3SYXA 3AU4A 4ZYSA 3P7ZA 4HB3B 2IY1B 2VRRB 3TSSA 3SFDB 2WNMA 2WLBA 2L0FA 3PS6A 4IOIE 4W9LA 5CLQB 4HVBA 3U30A 4G0NB 1DDWA 4AS1A 1NU2A 1QQGA 3ENEA 3ZJUA 4LDTD 5DPSA 2WXMA 4LTUA 4QXAB 2WX1A 2D10A 1WJMA 1LGRA 1FPYA 5I2MA 2K25A 2L83A 1V81A 2LOXA 3NWDA 3MC8A 4KAXB 2L7RA 2C5LC 4A90A 1IRSA 2Z8LA 1R4NI 2YEPF 5CHVC 2CHWA 2MCNB 1YN4A 2O2VA 1XCQL 4LK0M 2ON8A 3RZFA 1WFYA 2LASA 2LVOA 5DHAB 4ZRJA 1ZDXA 2CY5A 5BYRA 4BKGA 2WXFA 1GUAB 4GDLB 1V1PB 4MM3A 1T5XD 1H4RA 5D3IB 3GE3C 2DYOA 2E3TA 4GNKB 1RRBA 2O6VA 1U5EA 5E6NA 4S0RA 2V1YA 2JZZA 5L83A 4F7UP 2FNJB 1AQCA 2BYVE 4BVUC 3FLVA 3JW0X 1BTNA 3DVGY 3MHSD 2KYWA 1WE7A 1NTVA 3CSFA 2D9ZA 2K00A 2KFKB 4IKGA 2Y5BB 1SGHA 1NI2A 3NHEB 4E3CA 3TVVA 1L0YB 4NJ6A 1A5RA 2LXCA 2EMSA 3Q3FA 5HG2A 4ILJA 1PMSA 2BT6A 2KXJA 2D9VA 4ARCA 1GJZA 2JZPA 4A55A 2BWFA 3Q8FA 3DPDA 4HDQA 4PK1A 4ARIA 1NTYA 5J17A 5CHWA 2WU5B 3DCGA 2GUMA 3NJTA 5D94A 4ICVA 4XE0A 2NBUA 3R7QA 5IA7A 4NY0A 2PVGC 2LZ6A 2UU7A 3L17A 2LG1A 2Y3AA 1ZSQA 3NOBA 1D5ZC 4B0MA 3KUDB 1GGOA 2FDQA 1U5FA 3A9JB 5JHAA 1EF5A 1QOGA 4JPSA 1E8WA 2D2QA 1ZUD2 2P0HA 1V2YA 5JZEB 1Q5WB 4W9HA 4RNAA 1BUIC 4TMAB 3Q8EA 3B77A 3IFWB 3R66C 1NTIA 2KWCA 5BMHA 2D9YA 4PS8A 2C7MB 1HZ5A 3V61A 2D3CA 2MH7A 2GJYA 3V6CB 3D8FA 5AUKA 1YD8U 5C5BB 1J7BA 2DHJA 2ZEQA 4E71A 4DXAB 4HAYB 3NS8A 2KMCA 4A6QA 4WJQA 1VZ7A 4C0AA 5H92C 2VH2A 4DX90 3BYTB 1KTKA 3RCPA 3PZ7A 1SJED 1UWMA 4IWOA 5CTRC 4C7ZA 1UPRA 2QILA 3V60A 1E7VA 4HATB 2JVCA 2J52A 2Z4DA 2I1KA 1MFWA 4FULA 3CIKA 3WIMA 2RMMA 1Q1OA 2KLGA 2LI5A 3AN1A 2NTTA 2JRIB 1OQYA 2G9HD 1WR6E 3KH0A 2M0AA 2K6QA 4HCPB 4MGZE 2DIKA 5DIFB 3EECA 4HLEA 2FCQA 2QHOA 1WSPA 3ECIA 4NNJB 1XD4A 1XLQA 3U52E 1WGHA 1UZXB 4IM2A 4HB0B 4RF0A 2MHJA 4XWWA 3CWIA 4ILHA 1RFAA 4ITKA 3KUCB 2P8VA 3BK2A 2DX5B 2DYMA 3I9V1 2IYDB 4YSXB 3MJ5A 1FAOA 4EOYA 1Y5OA 2LHDA 2KIEA 2L3ZA 4BKTA 3UI3A 3BJIA 2CR5A 4KX6B 1FNUA 2D3AA 1YN5A 4XX5A 2OJRA 1SIFA 4A8XC 1UNRA 3Q8BA 2SEBD 3KW5B 3QAQA 3M3JA 2KR0A 1H10A 1C9FA 2D9XA 4GIVA 3B2GA 4DK5A 2WXRA 1ACCA 1CZPA 4C80A 2OJWA 3PREA 5E6JA 1KLGD 4CSQA 3MJWA 2N0SB 1TBEA 4IM3A 2ZVNA 3TEZA 2K9XA 2DHIA 3N1YC 1KH0A 5KQ4A 3TCAA 4KZ0A 4NQLB 5J3YA 2WXQA 2LGSA 1XLNA 1V8CA 3L0WB 4MGYE 1TT5B 3PT2B 3R2TA 5G55A 1HB8A 2LWPA 3FKYA 4A9AA 1E8ZA 2KQ4X 4HAWB 1Z87A 4JWSC 4G11A 1D3ZA 3M62B 1QILA 3JYUA 4ZYNA 1XCGA 2LGIA 2KVZA 1WM2A 2KVRA 2HDEA 4C00A 2FBWB 4RFBA 2ZCBA 2BS4B 1OMWA 2D11A 1QT9A 1WXMA 1K5DB 1VD2A 2R82A 1AWDA 2ZNVC 3A1QB 1U4AA 1J7AA 1SE2A 4MJSB 2DYNA 4A6FB 1SSNA 2Y7BA 4ZOHC 3AE7B 1FXTB 1LFDA 4KSKC 2XBBC 1YJIA 1K5GB 2KC1A 4LLGM 1GB1A 1PDXA 4GLSC 1WM3A 4DWFA 2YVCA 3WAOA 2FJLA 3LB8C 2NZ8B 1ZXIA 4LNFA 2HTME 2ONQA 3W1SC 4US8A 2PTLA 3VR9B 4DX8A 3DBLB 2E6XA 2O6VD 3SHQA 4NAWB 5LLIA 2M14A 1MIZB 3FEHA 3UGBB 2VZKB 1P5TA 2C60A 4EFOA 4WSFA 4MSQB 2KDBA 2IFSA 4KDLB 1X1MA 2FCMA 1FM0D 2BYFA 2J42A 2WDVB 2INPE 2BB5A 3Q8AA 1VLBA 1X11A 3S2AA 3W5UB 3I63C 1QZEA 4IUMB 2BQQA 1FFUA 1YX6B 3A4SC 4LNNA 3NVWA 3F5RA 1K50A 3R7RA 2NBVA 3TW1A 2IJ0A 2KLCA 2Z0EB 1KZ7A 4W9JA 4DQOC 3AEDB 3QX1A 2L76A 3ZJTA 2GBKA 1XR0B 2FUHB 3KRWA 1V88A 2K39A 1DROA 5HE1A 3QWMA 2M56B 1L4DB 3NS1A 2MWSB 4JKGA 2ELAA 1J7CA 2DAJA 2QC8A 5HHDG 4GMXB 4DHZE 4ACFA 1WIAA 3SDLC 4Z2MB 4LJPB 2MDXA 2MEKA 3E9PA 2M8SA 1ET9A 2K1FA 1LQBA 2WXLA 4HB2B 2N4FA 3V3XA 5J3QA 2RR9A 3H7PA 4EMOA 3RMKC 2DHZA 2KTRA 2VH1A 4F7ZA 4HAXB 1UF0A 1WX8A 3TJPA 2BTEA 1OEYJ 2KZRA 2LD9A 3RNFC 3RNCC 2FJUB 3R3MA 3UQAA 2LULA 2EKEC 1SBBB 1IYFA 5LNK1 3PPAA 3ML4A 3Q3JA 3GYPA 1WGDA 5DHFB 3TL5A 5DPTA 1H8CA 5CHFA 4D6WA 1FMAD 4HJGE 1J8CA 1JWSD 5TR5A 4K1RB 3Q14C 3N32A 5J3TA 1ZW7A
chains in the Genus database with same CATH topology
1RLFA 2PZ1A 3UF8A 4WVFB 2KD0A 2NPTB 2KK8A 4NSWA 3MPXA 1N3HA 4XC2A 1WJUA 5DH9B 2XK5B 4TUUA 3DXDA 1UBQA 4DBBA 2KJ6A 4DHJB 2DX1A 2YLMA 3X0WA 3ZKJC 2ABDA 3GZNI 4KDIC 4HXDA 2AL6A 2DZMA 2RQ1A 4HAZB 1MAIA 2H7EA 2K2JA 1LXDA 2DYBA 3ZLZA 4TQ0A 3IBEA 3JVZX 1SE9A 3KSYA 4JK7A 3K9PB 3CF6E 1XX0A 3ML9A 4MT7A 3APFA 4YL8A 2J7QB 3ZNGC 4FJZA 4CYEA 4HHVA 1EVHA 4K81A 2GOWA 1NDDA 2BKRB 2KOXA 3EC8A 2L1CA 4GDLA 4I6NB 2LUEA 2WX0A 3GOEA 1C3TA 2PE9A 5LXIB 2FIDA 4HCNB 1YJ1A 4TYZA 2P0FA 2KKCA 2KMAA 3VFKA 1HB6A 2VSZA 4JKBA 2YS1A 3UIOB 2FAZA 2N1VA 1OY2A 2D4QA 3VUXA 1V5PA 2KFKA 1L2NA 3ZW3A 5HE3A 4X57B 2CHZA 4JKHA 2CRFA 1DBHA 1U5GA 4MK0A 1DDVA 2MBBB 2CAYA 2EJ8A 5JLJB 2FJ9A 4PNKA 4PYZA 3TMPB 3SV1A 1ISNA 3L08A 3A9JA 3NZSA 3T9LA 3KVFB 4BBNF 3ZO5B 2PEAA 2RGNB 2UZRA 4B6WA 2LGXA 3PHXB 1SHCA 4IW0A 1WXSA 5D27A 1V5TA 4BKSA 3A33B 3ALBA 2ZPYA 5C5BA 2ZJDA 2RUKB 4M0WB 4EEWA 2JY6A 5JHHA 5G2NA 1EUVB 4DHJD 5AZGA 4HWIB 3SBTA 2MW5A 2CS4A 1WJNA 3WYFB 2YT0A 1B55A 2RLOA 2KDEB 4G3XB 3DBHI 1MIXA 2EC1A 1BT0A 1C1YB 1WG7A 1FHOA 2RGFA 5CX3A 1MK7B 2OQBA 1GC6A 2W2XC 4K7WA 1WI0A 4PYUA 1P6SA 4GN1A 2DHKA 1YX5B 5LOPB 3PHWB 3PTFC 2KQ7A 2Z0OA 2YF0A 4B9KA 1UNPA 2DX5A 2N9PC 1J0WA 2GS0A 1V6EA 2DKQA 2MBHA 3PLUA 3VVWB 1M7RA 2FIFA 1PFJA 3EFUA 4J6IA 1OQNA 2G3QB 1WMHB 3ULBA 4BFRA 1WGYA 5D2MB 4A6KA 4BOSC 3DXCA 5FI0A 2K8HA 4GOCA 2D9WA 3MTNB 4XWXA 2FCNA 2MX2A 1V86A 2GMIC 4GSWA 4AP4C 2KX0A 3L16A 5J18A 5D6JB 4F7GA 5AZFA 5KQ1A 3EHVA 2MFQA 5C6RA 3HHMA 4E74A 1RJ2A 2JZ3B 2M38A 3H6NA 1BTKA 1WE6A 2EMTA 1ZGUB 3A1QA 3G9WA 1VBGA 3NY5A 3ODWA 4MJSA 4A6FA 5JH5C 1FB8A 2G4SA 3FSSA 3QHTA 5DCNA 3ZDMC 2UYZB 4LJOB 2H7DA 1Z5SB 2GBNA 4K7SA 3PGEA 5C16A 4K2OA 3M95A 3H7SA 2BGFA 2K2UA 2GBJA 4TV3A 2Z0QA 3HIZA 4HK2A 4HDOA 1P3RA 4NAWA 2M17A 2KCJA 1WY8A 4G50A 3SU8X 3RULA 4EZJA 3VTVA 4HPLB 4ZRKA 2OTXA 2MBOA 2LJ5A 3RUIB 2BWES 3PRPB 3WANA 4K7UA 1CMXB 1V9JA 2N7EA 4NQKE 2ROVA 1X86A 2R0DA 3TIXA 3DDCB 2MKRA 3LDZE 1S3SG 2CKHB 2QKMA 4BBNC 4N9F4 2JT4B 3QA8A 3M1IB 4MEMA 5CLLB 3C0RB 4B95A 2V4LA 5JHBA 3EPYA 2ZCCA 4WWPA 3VUYA 1S1QB 1F9JA 2COPA 5JVLA 4GB9A 3ZTCA 4RM8A 4IG7B 4CHKA 4GDKA 4BKSD 3UINB 1IPGA 4GMVA 4K2PA 3ODOA 2RPQA 4JKEA 2MP2B 1GG3A 4ZRIA 1X1FA 1BAKA 2HE7A 4IWQA 5DPRA 4M8NA 2RSUA 4CHJA 2NPTA 1T0YA 2Y8GA 1E5WA 2ZVOA 4FLHA 3CMMB 4MELA 1NBFC 1ACAA 2REXA 2XK5A 1AARA 1KM7A 1V49A 1W1DA 1AWEA 1QC6A 3ZNZB 2NS5A 2D07B 3WALA 1WZ0A 2BCJA 4RM9A 2N9EB 1PLSA 4JK8A 3TFMA 4URKA 2DKPA 4WJPA 3DXEA 4KHBB 2Y8FA 3PSEB 4WJ7A 1UNQA 5D3VA 1WX7A 2KN5A 4XZ4A 1Q0WB 3QARA 2R2OA 3DVGX 1FHXA 3SBGA 3WAMA 1L7YA 3WAPA 2UWQA 2KGXB 3N7CA 1U2BA 2X0SA 4II3B 4GDKB 1RAXA 2K8BA 4JKCA 3DOWA 3AI5A 4TKNA 4LCDE 4JLCA 5BO4B 3OJ4B 4B6HA 1WJ6A 3FP5A 2CQUA 1XT9B 3PVLA 2Z59B 2GCJA 3O65B 3PLVA 4W9CA 3W1SA 3CSTA 2VRWB 1WI1A 1W1GA 1WH3A 3HM3A 4LDTB 4DHZB 1X05A 4MY6A 2LRUA 3HW2B 3QC8B 3O96A 2UVMA 4KV2A 4KIKB 3VHTC 3UQBA 3VIAA 4JKDA 2MA9B 1E8XA 2CHXA 3H1UA 3DBLI 4I6PA 1MK9B 5GMVA 3LJ3A 1GC7A 1WJ1A 4HPMB 1KI1B 2J0MA 2V76A 3E9LA 3E66A 2A5UA 3SNHA 2IO0B 1FHWA 2L0TA 5L81A 2K6DB 2A4ZA 2WH5A 4EZLA 5AZHA 3VXWA 1V61A 2MQJA 1XQQA 1U27A 3A4RA 3GYOA 2PPHA 1UH6A 2ZNVB 3A9KB 4HB4B 2LGYA 2YT1A 1Q67A 2Q13A 2NCNA 2E2XA 3NZUA 4ANXA 1MG8A 1UPQA 2JPHA 1LM8B 2JXXA 3QIJA 3QK0A 5L95C 4P7IA 3U8ZA 5C1ZA 2AWTA 4WJNA 3DVNU 4GGQA 1U5DA 2LBBA 2YS5A 4F7HA 4ANWA 1EAZA 3A8QA 4I6LB 4A20A 3IHPC 3TBLD 4W9KA 2AYOB 1OEYA 2NR2A 1HBKA 2KWVB 2MBQA 2GCLA 1X1GA 1ZC4B 3WA0A 4W9EA 2DAFA 4JIOU 1P98A 4WJOA 1M94A 1GNUA 2JF5A 3SO6A 2MWNB 3VH3B 3UZTA 3U7DA 4ILGB 4AWJA 3VTUA 2DZIA 4HAVB 2LKOA 3JSVB 5EFXA 5LXHA 4IAPA 1KC7A 1WYWB 3ZNHB 1KOTA 4IOYX 3ODXA 2HJ8A 5HE2A 2KHWB 1WMHA 3AJ4A 3ZNID 3KUZA 3RD2A 4IWPA 2R2QA 3OJ3A 3PP2A 3L54A 2CY4A 2NBWB 3ENBA 2KUPA 2KJRA 2COCA 3AU5A 2HTHB 4FHKA 4ASWC 4OVVA 3TO1A 1J19A 5C79A 2MBEA 2D3GA 4YONA 2KTFA 4ZDVA 3X23A 2N9XA 4IM0A 4BBKA 5IAAC 3N3KB 1TJ6A 2QKLA 3ZUNA 3K9OB 1P3QU 1WZ3A 2L00B 4IC7B 1E90A 3VTWA 1WGUA 2JUOA 2MSED 3PRMB 5C23A 2N7DA 3V5WA 1W1HA 2C7HA 3QWZB 2BF8B 3T06A 3RZWC 4IFSA 3BINA 3V62A 1IP9A 2RSGA 4W9DA 1ZVRA 4JKAA 3DVNV 2DENB 1P9DU 3VOQA 2B3AA 5E6OA 4JK9A 2KNBA 2J59M 3KY9A 4FJVB 3RYTA 4TQ1A 4HAUB 3ZIMA 1ZC3B 5FR6A 2LRWA 3OANA 2O2VB 2IYBA 2RD0A 2BKFA 3ZVVA 5FI1A 2FCSA 4L6EA 3SUZA 2C7NB 2IO2B 2HRJA 2IO3B 4II2B 2O6VB 3AXCA 2R09A 2ADZA 4F1SA 2VKIA 2YRYA 2M4NA 4MH0E 1DYNA 2KJHB 4EUTA 3B08A 4PQ0A 1BWNA 5KCVA 2KQSA 4GZUA 2P0DA 2KO3A 1KZGA 2KWUB 5J2RA 1I42A 5D3WA 2OOBB 2XEWA 2WDTB 1OTRB 2HD5B 4ANUA 2MP2A 4AOFA 3ZRFA 1WVHA 5GOWB 2IZVB 4JGHB 1VCBA 2ZPNA 1J0GA 2UZSA 4BOZB 3D32A 5LONB 3PV1A 4JQWC 3ULCA 3PVWA 1E7UA 1EGXA 4A3OA 4FBJB 2N0YA 4AUQC 2KX3A 2LYDA 4WAAA 1UBIA 3DQVA 3L13A 1WXAA 2KDIA 3QCAA 4EJNA 2G4DB 2BPSA 1Y19B 1WGGA 5AEKB 4CHMA 4DDGD 3RT3B 3APCA 1WXVA 2W9NA 1FGZA 2IBIB 3QJZA 4JL9A 1UEFA 1LW3A 2KFJA 2COAA 4GXBA 1V5UA 2J0JA 4KHAA 2N1WA 2PE6B 3DBSA 3CXBB 3VH4B 4Z2NA 3QBVB 4EZKA 4F8CB 3OAWA 1FOEA 1V5OA 4GU2A 3I3TB 3V6EB 1VBHA 4FADA 2Z0DB 2ASQA 3L10B 3A8PA 2AL3A 4JKFA 2BYEA 1I7AA 3FM8C 5KHOA 2C9WB 1LB1A 1TQZA 3SD5A 5IJMA 2KDFB 1JDEA 1ZKHA 4PS7A 2CU1A 4KZCA 2COFA 2LXAA 2GBRA 1DIKA 4K17A 1XKEA 3ML8A 2LVQA 2CODA 2DFKA 3LJUX 1KJTA 1YIWA 1DDMA 1KBLA 3ZDTA 2Z0PA 2I5FA 1NVLA 4H8SA 1WRDB 4KIKA 1MPHA 2MRPA 3HQCA 4CO7A 1UD7A 3P6AA 1HE8A 2JWZA 3KYCD 3ZRCA 1OGWA 4MGKE 2JP2A 3VAWA 1TXDA 1M7EA 1EF1A 3ZTDA 3PVUA 2XQNM 3A98B 3KRXA 4A6HA 1P1AA 4M8MA 4AJYB 3P2BA 1WJ4A 4RMAA 4OVUA 3B0AA 4GPTB 3VQIA 1YQBA 2L2IA 3A9KA 4FA6A 1V5MA 4A5KA 1V89A 5HKHA 2M1MA 4EKUA 5D7GA 3MDBC 4DBGA 1RRPB 5D3YA 5JHGA 2CB8A 4WWOA 4NPNA 1WR1A 2YSZA 3AULA 3QQ8B 1JRUA 2KANA 2DN6A 1WGRA 4FHJA 3DBRI 4KHOA 4FJYA 2LVPA 4MGIE 4W9GA 4PS3A 4DDID 1I35A 1TTNA 1WX9A 2I5CA 4Y94A 2DLWA 2IY0B 1ZM0A 2G45B 2K8CA 2WWZA 3VDZA 1WGQA 1Z2MA 1MKEA 2W2WA 2RVBB 2W2XD 1XODA 2KC2A 3KZ1A 4A3PA 2NBVB 1ST7A 3E9OA 2DZJA 3IG3A 3HM6X 1TZ1A 3PZDA 3ONSA 2J0KA 3KYDD 4HJKA 4WQOB 4NJ7A 2I1JA 1U29A 2NVUI 2MLBA 1I2HA 3JSVA 4JKGB 2YS3A 4D0NB 2L05A 1TGZB 2GBMA 1R4MI 1KLVA 2X18A 2V3SA 2PJHA 3D8DA 1Y8RC 3VUWA 3T8MA 3H7PB 2RNRB 5D3XA 4KSLC 2WYQA 3PG7A 2KTRB 1UGMA 5DI9B 1G6JA 5KHQA 5HE0A 2N23A 3HK0A 1V80A 3UIPB 3IVFA 3OLMD 3NSUA 3ZVRA 2JRHA 5DPWA 2HTHA 2ELBA 2ROZB 3PSCA 3F0WA 2DTCA 1WF9A 3B1LX 2IO1B 4WWNA 1PQSA 2DZKA 2DA0A 2LGDA 4ANVA 4MSMB 2AEHA 3W1YA 2DYQA 4MDKE 1K8RB 1XD3B 4W9FA 3D8EA 4KVGB 3APDA 2G35A 3N30A 4FN2A 1FGYA 3PRZA 4W9IA 5JP4A 1E8YA 2LOZA 2M0XA 4ICUA 3H9DA 1EO6A 1UELA 3PEGA 5EDSA 2L8JA 5E6PA 4AJWA 3M63B 2ZZPB 2NMBA 3RCZA 1P0RA 3BY4B 3SYXA 3AU4A 3P7ZA 4HB3B 2IY1B 2VRRB 2L0FA 3PS6A 4W9LA 5CLQB 4HVBA 3U30A 4G0NB 1DDWA 1NU2A 1QQGA 3ENEA 4LDTD 5DPSA 2WX1A 2D10A 1WJMA 2K25A 1V81A 2LOXA 4KAXB 2L7RA 2C5LC 1IRSA 1R4NI 5CHVC 2CHWA 2MCNB 2O2VA 3RZFA 1WFYA 2LASA 2LVOA 5DHAB 4ZRJA 2CY5A 4BKGA 1GUAB 4GDLB 4MM3A 1H4RA 2DYOA 1RRBA 2O6VA 1U5EA 5E6NA 2V1YA 2JZZA 5L83A 4F7UP 2FNJB 1AQCA 2BYVE 4BVUC 3FLVA 3JW0X 1BTNA 3DVGY 3MHSD 1WE7A 1NTVA 3CSFA 2D9ZA 2K00A 2KFKB 2Y5BB 1SGHA 1NI2A 3NHEB 4E3CA 3TVVA 4NJ6A 1A5RA 2LXCA 2EMSA 3Q3FA 4ILJA 1PMSA 2KXJA 2D9VA 1GJZA 2BWFA 3DPDA 4HDQA 1NTYA 5J17A 5CHWA 3DCGA 5D94A 4ICVA 2NBUA 3R7QA 5IA7A 4NY0A 2LZ6A 3L17A 2LG1A 1ZSQA 3NOBA 3KUDB 1GGOA 2FDQA 1U5FA 3A9JB 5JHAA 1EF5A 1E8WA 2D2QA 2P0HA 1V2YA 5JZEB 1Q5WB 4W9HA 3IFWB 3R66C 1NTIA 2KWCA 2D9YA 4PS8A 2C7MB 3V61A 2GJYA 3V6CB 3D8FA 1YD8U 5C5BB 2DHJA 2ZEQA 4E71A 4DXAB 4HAYB 3NS8A 2KMCA 4WJQA 4C0AA 4DX90 3RCPA 4IWOA 5CTRC 1UPRA 3V60A 1E7VA 4HATB 2JVCA 2I1KA 4FULA 3CIKA 3WIMA 1Q1OA 2KLGA 2LI5A 2JRIB 1OQYA 1WR6E 3KH0A 2K6QA 4HCPB 4MGZE 2DIKA 5DIFB 3EECA 4HLEA 2FCQA 2QHOA 3ECIA 4NNJB 1XD4A 1WGHA 1UZXB 4IM2A 4HB0B 4ILHA 1RFAA 3KUCB 2P8VA 2DX5B 2DYMA 2IYDB 1FAOA 4EOYA 1Y5OA 2L3ZA 4BKTA 3BJIA 2CR5A 4XX5A 2OJRA 1SIFA 1UNRA 3KW5B 3QAQA 3M3JA 1H10A 2D9XA 4GIVA 4DK5A 3PREA 3MJWA 1TBEA 4IM3A 2ZVNA 2DHIA 5KQ4A 3TCAA 4KZ0A 4NQLB 5J3YA 3L0WB 4MGYE 3PT2B 5G55A 1HB8A 2LWPA 1E8ZA 4HAWB 1Z87A 4G11A 1D3ZA 3M62B 3JYUA 4ZYNA 1XCGA 1WM2A 2KVRA 2ZCBA 1OMWA 2D11A 1WXMA 1K5DB 1VD2A 2R82A 3A1QB 2ZNVC 1U4AA 4MJSB 2DYNA 4A6FB 2Y7BA 1FXTB 1LFDA 4KSKC 2XBBC 1K5GB 2KC1A 1WM3A 4DWFA 2YVCA 3WAOA 2FJLA 2NZ8B 3W1SC 4DX8A 3SHQA 2O6VD 4NAWB 5LLIA 2M14A 1MIZB 3FEHA 3UGBB 1P5TA 2C60A 4EFOA 4WSFA 4MSQB 2KDBA 2IFSA 4KDLB 1X1MA 2FCMA 2BYFA 1X11A 3S2AA 1QZEA 4IUMB 1YX6B 3A4SC 3F5RA 3R7RA 3TW1A 2KLCA 2Z0EB 1KZ7A 4W9JA 3QX1A 2L76A 2GBKA 1XR0B 2FUHB 3KRWA 1V88A 2K39A 1DROA 5HE1A 3QWMA 2MWSB 4JKGA 2ELAA 2DAJA 4GMXB 4DHZE 1WIAA 3SDLC 4Z2MB 4LJPB 2MDXA 3E9PA 2M8SA 2K1FA 1LQBA 4HB2B 2N4FA 5J3QA 2RR9A 3H7PA 4EMOA 2DHZA 2KTRA 4F7ZA 4HAXB 1WX8A 3TJPA 1OEYJ 2KZRA 2LD9A 3R3MA 3UQAA 2LULA 2EKEC 1IYFA 3PPAA 3ML4A 3Q3JA 3GYPA 1WGDA 5DHFB 3TL5A 5DPTA 1H8CA 5CHFA 1J8CA 5TR5A 4K1RB 3N32A 5J3TA 1ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLF A;  2PZ1 A;  3UF8 A;  4WVF B;  2KD0 A;  2NPT B;  2KK8 A;  4NSW A;  3MPX A;  1N3H A;  4XC2 A;  1WJU A;  5DH9 B;  2XK5 B;  4TUU A;  3DXD A;  1UBQ A;  4DBB A;  2KJ6 A;  4DHJ B;  2DX1 A;  2YLM A;  3X0W A;  3ZKJ C;  2ABD A;  3GZN I;  4KDI C;  4HXD A;  2AL6 A;  2DZM A;  2RQ1 A;  4HAZ B;  1MAI A;  2H7E A;  2K2J A;  1LXD A;  2DYB A;  3ZLZ A;  4TQ0 A;  3IBE A;  3JVZ X;  1SE9 A;  3KSY A;  3K9P B;  3CF6 E;  1XX0 A;  3ML9 A;  4MT7 A;  3APF A;  4YL8 A;  2J7Q B;  3ZNG C;  4FJZ A;  4CYE A;  4HHV A;  1EVH A;  4K81 A;  2GOW A;  1NDD A;  2BKR B;  2KOX A;  3EC8 A;  2L1C A;  4GDL A;  4I6N B;  2LUE A;  2WX0 A;  3GOE A;  1C3T A;  2PE9 A;  5LXI B;  2FID A;  4HCN B;  1YJ1 A;  4TYZ A;  2P0F A;  2KKC A;  2KMA A;  3VFK A;  1HB6 A;  2VSZ A;  3UIO B;  2YS1 A;  2FAZ A;  2N1V A;  1OY2 A;  2D4Q A;  3VUX A;  1V5P A;  2KFK A;  1L2N A;  3ZW3 A;  5HE3 A;  4X57 B;  2CHZ A;  2CRF A;  1DBH A;  1U5G A;  4MK0 A;  1DDV A;  2MBB B;  2CAY A;  2EJ8 A;  5JLJ B;  2FJ9 A;  4PNK A;  4PYZ A;  3TMP B;  3SV1 A;  1ISN A;  3L08 A;  3A9J A;  3NZS A;  3T9L A;  3KVF B;  4BBN F;  3ZO5 B;  2PEA A;  2RGN B;  2UZR A;  4B6W A;  2LGX A;  3PHX B;  1SHC A;  4IW0 A;  1WXS A;  5D27 A;  1V5T A;  4BKS A;  3A33 B;  3ALB A;  2ZPY A;  5C5B A;  2ZJD A;  2RUK B;  4M0W B;  4EEW A;  2JY6 A;  5JHH A;  5G2N A;  1EUV B;  4DHJ D;  5AZG A;  4HWI B;  2MW5 A;  2CS4 A;  1WJN A;  3WYF B;  2YT0 A;  1B55 A;  2RLO A;  2KDE B;  4G3X B;  3DBH I;  1MIX A;  2EC1 A;  1BT0 A;  1C1Y B;  1WG7 A;  1FHO A;  2RGF A;  5CX3 A;  1MK7 B;  2OQB A;  1GC6 A;  2W2X C;  4K7W A;  1WI0 A;  4PYU A;  1P6S A;  4GN1 A;  2DHK A;  1YX5 B;  5LOP B;  3PHW B;  3PTF C;  2KQ7 A;  2Z0O A;  2YF0 A;  4B9K A;  1UNP A;  2DX5 A;  2N9P C;  1J0W A;  2GS0 A;  1V6E A;  2DKQ A;  2MBH A;  3PLU A;  3VVW B;  1M7R A;  2FIF A;  1PFJ A;  3EFU A;  4J6I A;  1OQN A;  2G3Q B;  1WMH B;  3ULB A;  4BFR A;  1WGY A;  5D2M B;  4A6K A;  4BOS C;  3DXC A;  5FI0 A;  2K8H A;  4GOC A;  2D9W A;  3MTN B;  4XWX A;  2FCN A;  2MX2 A;  1V86 A;  2GMI C;  4GSW A;  4AP4 C;  2KX0 A;  3L16 A;  5J18 A;  5D6J B;  4F7G A;  5AZF A;  5KQ1 A;  3EHV A;  2MFQ A;  5C6R A;  3HHM A;  4E74 A;  1RJ2 A;  2JZ3 B;  2M38 A;  3H6N A;  1BTK A;  1WE6 A;  2EMT A;  1ZGU B;  3A1Q A;  3G9W A;  3NY5 A;  3ODW A;  4MJS A;  4A6F A;  5JH5 C;  1FB8 A;  2G4S A;  3FSS A;  3QHT A;  3ZDM C;  5DCN A;  2UYZ B;  4LJO B;  2H7D A;  1Z5S B;  2GBN A;  4K7S A;  3PGE A;  5C16 A;  4K2O A;  3M95 A;  3H7S A;  2BGF A;  2K2U A;  2GBJ A;  4TV3 A;  2Z0Q A;  3HIZ A;  4HK2 A;  4HDO A;  1P3R A;  4NAW A;  2M17 A;  2KCJ A;  1WY8 A;  4G50 A;  3SU8 X;  3RUL A;  4EZJ A;  3VTV A;  4HPL B;  4ZRK A;  2OTX A;  2MBO A;  2LJ5 A;  3RUI B;  2BWE S;  3PRP B;  3WAN A;  4K7U A;  1CMX B;  1V9J A;  2N7E A;  4NQK E;  2ROV A;  1X86 A;  2R0D A;  3TIX A;  3DDC B;  2MKR A;  3LDZ E;  1S3S G;  2CKH B;  2QKM A;  4BBN C;  4N9F 4;  2JT4 B;  3QA8 A;  3M1I B;  4MEM A;  5CLL B;  3C0R B;  4B95 A;  2V4L A;  5JHB A;  3EPY A;  2ZCC A;  4WWP A;  3VUY A;  1S1Q B;  1F9J A;  2COP A;  4GB9 A;  3ZTC A;  4RM8 A;  4IG7 B;  4CHK A;  4GDK A;  4BKS D;  3UIN B;  1IPG A;  4GMV A;  4K2P A;  3ODO A;  2RPQ A;  2MP2 B;  1GG3 A;  4ZRI A;  1X1F A;  1BAK A;  2HE7 A;  4IWQ A;  5DPR A;  4M8N A;  2RSU A;  4CHJ A;  2NPT A;  1T0Y A;  2Y8G A;  1E5W A;  2ZVO A;  4FLH A;  3CMM B;  4MEL A;  1NBF C;  1ACA A;  2REX A;  2XK5 A;  1AAR A;  1KM7 A;  1V49 A;  1W1D A;  1AWE A;  1QC6 A;  3ZNZ B;  2NS5 A;  2D07 B;  3WAL A;  1WZ0 A;  2BCJ A;  4RM9 A;  2N9E B;  1PLS A;  3TFM A;  4URK A;  2DKP A;  4WJP A;  3DXE A;  4KHB B;  2Y8F A;  3PSE B;  4WJ7 A;  1UNQ A;  5D3V A;  1WX7 A;  2KN5 A;  4XZ4 A;  1Q0W B;  3QAR A;  2R2O A;  3DVG X;  1FHX A;  3WAM A;  1L7Y A;  3WAP A;  2UWQ A;  2KGX B;  3N7C A;  1U2B A;  4II3 B;  4GDK B;  1RAX A;  2K8B A;  3DOW A;  3AI5 A;  4TKN A;  4LCD E;  4JLC A;  5BO4 B;  3OJ4 B;  4B6H A;  1WJ6 A;  3FP5 A;  2CQU A;  1XT9 B;  3PVL A;  2Z59 B;  2GCJ A;  3O65 B;  3PLV A;  4W9C A;  3W1S A;  3CST A;  2VRW B;  1WI1 A;  1W1G A;  1WH3 A;  3HM3 A;  4LDT B;  4DHZ B;  1X05 A;  4MY6 A;  2LRU A;  3HW2 B;  3QC8 B;  3O96 A;  2UVM A;  4KV2 A;  4KIK B;  3VHT C;  3UQB A;  3VIA A;  2MA9 B;  1E8X A;  2CHX A;  3H1U A;  3DBL I;  4I6P A;  1MK9 B;  5GMV A;  3LJ3 A;  1GC7 A;  1WJ1 A;  4HPM B;  1KI1 B;  2J0M A;  2V76 A;  2A5U A;  3SNH A;  2IO0 B;  1FHW A;  2L0T A;  5L81 A;  2K6D B;  2A4Z A;  2WH5 A;  4EZL A;  5AZH A;  3VXW A;  1V61 A;  2MQJ A;  1XQQ A;  1U27 A;  3A4R A;  3GYO A;  2PPH A;  1UH6 A;  2ZNV B;  3A9K B;  4HB4 B;  2LGY A;  2YT1 A;  1Q67 A;  2Q13 A;  2NCN A;  2E2X A;  3NZU A;  4ANX A;  1MG8 A;  1UPQ A;  2JPH A;  1LM8 B;  2JXX A;  3QIJ A;  3QK0 A;  5L95 C;  4P7I A;  3U8Z A;  5C1Z A;  2AWT A;  4WJN A;  3DVN U;  4GGQ A;  1U5D A;  2LBB A;  2YS5 A;  4F7H A;  4ANW A;  1EAZ A;  3A8Q A;  4I6L B;  4A20 A;  3IHP C;  3TBL D;  4W9K A;  2AYO B;  1OEY A;  2NR2 A;  1HBK A;  2KWV B;  2MBQ A;  2GCL A;  1X1G A;  1ZC4 B;  3WA0 A;  4W9E A;  2DAF A;  4JIO U;  1P98 A;  4WJO A;  1M94 A;  1GNU A;  2JF5 A;  3SO6 A;  2MWN B;  3VH3 B;  3UZT A;  3U7D A;  4AWJ A;  3VTU A;  2DZI A;  4HAV B;  2LKO A;  3JSV B;  5EFX A;  5LXH A;  4IAP A;  1WYW B;  3ZNH B;  1KOT A;  4IOY X;  3ODX A;  2HJ8 A;  5HE2 A;  2KHW B;  1WMH A;  3AJ4 A;  3ZNI D;  3KUZ A;  3RD2 A;  4IWP A;  2R2Q A;  3OJ3 A;  3PP2 A;  3L54 A;  2CY4 A;  2NBW B;  2KUP A;  2KJR A;  2COC A;  3AU5 A;  2HTH B;  4FHK A;  4ASW C;  4OVV A;  3TO1 A;  1J19 A;  5C79 A;  2MBE A;  2D3G A;  4YON A;  2KTF A;  4ZDV A;  3X23 A;  2N9X A;  4IM0 A;  4BBK A;  5IAA C;  3N3K B;  1TJ6 A;  2QKL A;  3ZUN A;  3K9O B;  1P3Q U;  1WZ3 A;  2L00 B;  4IC7 B;  1E90 A;  3VTW A;  1WGU A;  2JUO A;  2MSE D;  3PRM B;  5C23 A;  2N7D A;  3V5W A;  1W1H A;  2C7H A;  3QWZ B;  2BF8 B;  3T06 A;  3RZW C;  4IFS A;  3BIN A;  3V62 A;  1IP9 A;  2RSG A;  4W9D A;  1ZVR A;  3DVN V;  2DEN B;  1P9D U;  3VOQ A;  2B3A A;  5E6O A;  2KNB A;  2J59 M;  3KY9 A;  4FJV B;  3RYT A;  4TQ1 A;  4HAU B;  3ZIM A;  1ZC3 B;  5FR6 A;  2LRW A;  3OAN A;  2O2V B;  2IYB A;  2RD0 A;  2BKF A;  3ZVV A;  5FI1 A;  2FCS A;  4L6E A;  3SUZ A;  2C7N B;  2IO2 B;  2HRJ A;  2IO3 B;  4II2 B;  2O6V B;  3AXC A;  2R09 A;  2ADZ A;  4F1S A;  2VKI A;  2YRY A;  2M4N A;  4MH0 E;  1DYN A;  2KJH B;  4EUT A;  3B08 A;  4PQ0 A;  1BWN A;  5KCV A;  2KQS A;  4GZU A;  2P0D A;  2KO3 A;  1KZG A;  2KWU B;  5J2R A;  1I42 A;  5D3W A;  2OOB B;  2XEW A;  2WDT B;  1OTR B;  2HD5 B;  4ANU A;  2MP2 A;  4AOF A;  3ZRF A;  1WVH A;  5GOW B;  2IZV B;  4JGH B;  1VCB A;  2ZPN A;  1J0G A;  2UZS A;  4BOZ B;  3D32 A;  5LON B;  3PV1 A;  4JQW C;  3ULC A;  3PVW A;  1E7U A;  1EGX A;  4A3O A;  4FBJ B;  2N0Y A;  4AUQ C;  2KX3 A;  2LYD A;  4WAA A;  1UBI A;  3DQV A;  3L13 A;  1WXA A;  2KDI A;  3QCA A;  4EJN A;  2G4D B;  2BPS A;  1Y19 B;  1WGG A;  5AEK B;  4CHM A;  4DDG D;  3RT3 B;  3APC A;  1WXV A;  2W9N A;  1FGZ A;  2IBI B;  3QJZ A;  4JL9 A;  1UEF A;  1LW3 A;  2KFJ A;  2COA A;  4GXB A;  1V5U A;  2J0J A;  4KHA A;  2N1W A;  2PE6 B;  3DBS A;  3CXB B;  3VH4 B;  4Z2N A;  3QBV B;  4EZK A;  4F8C B;  3OAW A;  1FOE A;  1V5O A;  4GU2 A;  3I3T B;  3V6E B;  4FAD A;  2Z0D B;  2ASQ A;  3L10 B;  3A8P A;  2AL3 A;  2BYE A;  1I7A A;  3FM8 C;  5KHO A;  2C9W B;  1LB1 A;  1TQZ A;  3SD5 A;  5IJM A;  2KDF B;  1ZKH A;  4PS7 A;  2CU1 A;  4KZC A;  2COF A;  2LXA A;  2GBR A;  4K17 A;  1XKE A;  3ML8 A;  2LVQ A;  2COD A;  2DFK A;  3LJU X;  1KJT A;  1YIW A;  1DDM A;  3ZDT A;  2Z0P A;  2I5F A;  1NVL A;  4H8S A;  1WRD B;  4KIK A;  1MPH A;  2MRP A;  3HQC A;  4CO7 A;  1UD7 A;  3P6A A;  1HE8 A;  2JWZ A;  3KYC D;  3ZRC A;  1OGW A;  4MGK E;  2JP2 A;  3VAW A;  1TXD A;  1M7E A;  1EF1 A;  3ZTD A;  3PVU A;  2XQN M;  3A98 B;  3KRX A;  4A6H A;  1P1A A;  4M8M A;  4AJY B;  3P2B A;  1WJ4 A;  4RMA A;  4OVU A;  3B0A A;  4GPT B;  3VQI A;  1YQB A;  2L2I A;  3A9K A;  4FA6 A;  1V5M A;  4A5K A;  1V89 A;  5HKH A;  2M1M A;  4EKU A;  5D7G A;  3MDB C;  4DBG A;  1RRP B;  5D3Y A;  5JHG A;  2CB8 A;  4WWO A;  4NPN A;  1WR1 A;  2YSZ A;  3AUL A;  3QQ8 B;  1JRU A;  2KAN A;  2DN6 A;  1WGR A;  4FHJ A;  3DBR I;  4KHO A;  4FJY A;  2LVP A;  4MGI E;  4W9G A;  4PS3 A;  4DDI D;  1I35 A;  1TTN A;  1WX9 A;  2I5C A;  4Y94 A;  2DLW A;  2IY0 B;  1ZM0 A;  2G45 B;  2K8C A;  2WWZ A;  3VDZ A;  1WGQ A;  1Z2M A;  1MKE A;  2W2W A;  2RVB B;  2W2X D;  1XOD A;  2KC2 A;  3KZ1 A;  4A3P A;  2NBV B;  1ST7 A;  2DZJ A;  3IG3 A;  3HM6 X;  1TZ1 A;  3PZD A;  3ONS A;  2J0K A;  3KYD D;  4HJK A;  4WQO B;  4NJ7 A;  2I1J A;  1U29 A;  2NVU I;  2MLB A;  1I2H A;  3JSV A;  2YS3 A;  4D0N B;  2L05 A;  1TGZ B;  2GBM A;  1R4M I;  1KLV A;  2X18 A;  2V3S A;  2PJH A;  3D8D A;  1Y8R C;  3VUW A;  3T8M A;  3H7P B;  2RNR B;  5D3X A;  4KSL C;  2WYQ A;  3PG7 A;  2KTR B;  1UGM A;  5DI9 B;  1G6J A;  5KHQ A;  5HE0 A;  2N23 A;  3HK0 A;  1V80 A;  3UIP B;  3IVF A;  3OLM D;  3NSU A;  3ZVR A;  2JRH A;  5DPW A;  2HTH A;  2ELB A;  2ROZ B;  3PSC A;  3F0W A;  2DTC A;  1WF9 A;  3B1L X;  2IO1 B;  4WWN A;  1PQS A;  2DZK A;  2DA0 A;  2LGD A;  4ANV A;  4MSM B;  2AEH A;  3W1Y A;  2DYQ A;  4MDK E;  1K8R B;  1XD3 B;  4W9F A;  3D8E A;  4KVG B;  3APD A;  2G35 A;  3N30 A;  4FN2 A;  1FGY A;  3PRZ A;  4W9I A;  5JP4 A;  1E8Y A;  2LOZ A;  2M0X A;  4ICU A;  3H9D A;  1EO6 A;  1UEL A;  3PEG A;  5EDS A;  2L8J A;  5E6P A;  4AJW A;  3M63 B;  2ZZP B;  2NMB A;  3RCZ A;  1P0R A;  3BY4 B;  3SYX A;  3AU4 A;  3P7Z A;  4HB3 B;  2IY1 B;  2VRR B;  2L0F A;  3PS6 A;  4W9L A;  5CLQ B;  4HVB A;  3U30 A;  4G0N B;  1DDW A;  1NU2 A;  1QQG A;  3ENE A;  4LDT D;  5DPS A;  2WX1 A;  2D10 A;  1WJM A;  2K25 A;  1V81 A;  2LOX A;  4KAX B;  2L7R A;  2C5L C;  1IRS A;  1R4N I;  5CHV C;  2CHW A;  2MCN B;  2O2V A;  3RZF A;  1WFY A;  2LAS A;  2LVO A;  5DHA B;  4ZRJ A;  2CY5 A;  4BKG A;  1GUA B;  4GDL B;  4MM3 A;  1H4R A;  2DYO A;  1RRB A;  2O6V A;  1U5E A;  5E6N A;  2V1Y A;  2JZZ A;  5L83 A;  4F7U P;  2FNJ B;  1AQC A;  2BYV E;  4BVU C;  3FLV A;  3JW0 X;  1BTN A;  3DVG Y;  3MHS D;  1WE7 A;  1NTV A;  3CSF A;  2D9Z A;  2K00 A;  2KFK B;  2Y5B B;  1SGH A;  1NI2 A;  3NHE B;  4E3C A;  3TVV A;  4NJ6 A;  1A5R A;  2LXC A;  2EMS A;  3Q3F A;  1PMS A;  2KXJ A;  2D9V A;  1GJZ A;  2BWF A;  3DPD A;  4HDQ A;  1NTY A;  5J17 A;  5CHW A;  3DCG A;  5D94 A;  4ICV A;  2NBU A;  3R7Q A;  5IA7 A;  4NY0 A;  2LZ6 A;  3L17 A;  2LG1 A;  1ZSQ A;  3NOB A;  3KUD B;  2FDQ A;  1U5F A;  3A9J B;  5JHA A;  1EF5 A;  1E8W A;  2D2Q A;  2P0H A;  1V2Y A;  5JZE B;  1Q5W B;  4W9H A;  3IFW B;  3R66 C;  1NTI A;  2KWC A;  2D9Y A;  4PS8 A;  2C7M B;  3V61 A;  2GJY A;  3V6C B;  3D8F A;  1YD8 U;  5C5B B;  2DHJ A;  2ZEQ A;  4E71 A;  4DXA B;  4HAY B;  3NS8 A;  2KMC A;  4WJQ A;  4C0A A;  4DX9 0;  3RCP A;  4IWO A;  5CTR C;  1UPR A;  3V60 A;  1E7V A;  4HAT B;  2JVC A;  2I1K A;  4FUL A;  3CIK A;  3WIM A;  1Q1O A;  2KLG A;  2LI5 A;  1OQY A;  2JRI B;  1WR6 E;  3KH0 A;  2K6Q A;  4HCP B;  4MGZ E;  5DIF B;  3EEC A;  4HLE A;  2FCQ A;  2QHO A;  3ECI A;  4NNJ B;  1XD4 A;  1WGH A;  1UZX B;  4IM2 A;  4HB0 B;  1RFA A;  3KUC B;  2P8V A;  2DX5 B;  2DYM A;  2IYD B;  1FAO A;  4EOY A;  1Y5O A;  2L3Z A;  4BKT A;  3BJI A;  2CR5 A;  4XX5 A;  2OJR A;  1SIF A;  1UNR A;  3KW5 B;  3QAQ A;  3M3J A;  1H10 A;  2D9X A;  4GIV A;  4DK5 A;  3PRE A;  3MJW A;  1TBE A;  4IM3 A;  2ZVN A;  2DHI A;  5KQ4 A;  3TCA A;  4KZ0 A;  4NQL B;  5J3Y A;  3L0W B;  4MGY E;  3PT2 B;  5G55 A;  1HB8 A;  2LWP A;  1E8Z A;  4HAW B;  1Z87 A;  4G11 A;  1D3Z A;  3M62 B;  3JYU A;  4ZYN A;  1XCG A;  1WM2 A;  2KVR A;  2ZCB A;  1OMW A;  2D11 A;  1WXM A;  1K5D B;  1VD2 A;  3A1Q B;  2ZNV C;  1U4A A;  4MJS B;  2DYN A;  4A6F B;  2Y7B A;  1FXT B;  1LFD A;  4KSK C;  2XBB C;  1K5G B;  2KC1 A;  1WM3 A;  4DWF A;  2YVC A;  3WAO A;  2FJL A;  2NZ8 B;  3W1S C;  4DX8 A;  3SHQ A;  2O6V D;  4NAW B;  5LLI A;  2M14 A;  1MIZ B;  3FEH A;  3UGB B;  1P5T A;  2C60 A;  4EFO A;  4WSF A;  4MSQ B;  2KDB A;  2IFS A;  4KDL B;  1X1M A;  2FCM A;  2BYF A;  1X11 A;  3S2A A;  1QZE A;  4IUM B;  1YX6 B;  3A4S C;  3F5R A;  3R7R A;  3TW1 A;  2KLC A;  2Z0E B;  1KZ7 A;  4W9J A;  3QX1 A;  2L76 A;  2GBK A;  1XR0 B;  2FUH B;  3KRW A;  1V88 A;  2K39 A;  1DRO A;  5HE1 A;  3QWM A;  2MWS B;  2ELA A;  2DAJ A;  4GMX B;  4DHZ E;  1WIA A;  3SDL C;  4Z2M B;  4LJP B;  2MDX A;  2M8S A;  2K1F A;  1LQB A;  4HB2 B;  2N4F A;  5J3Q A;  2RR9 A;  3H7P A;  4EMO A;  2DHZ A;  2KTR A;  4F7Z A;  4HAX B;  1WX8 A;  3TJP A;  1OEY J;  2KZR A;  2LD9 A;  3R3M A;  3UQA A;  2LUL A;  2EKE C;  1IYF A;  3PPA A;  3ML4 A;  3Q3J A;  3GYP A;  1WGD A;  5DHF B;  3TL5 A;  5DPT A;  1H8C A;  5CHF A;  1J8C A;  5TR5 A;  4K1R B;  3N32 A;  5J3T A;  1ZW7 A; 
#chains in the Genus database with same CATH topology
 1RLF A;  3MP9 A;  2WXO A;  3ZXR A;  2PZ1 A;  3NZ3 A;  3UF8 A;  4TSS A;  4WVF B;  4B0E A;  1TZO A;  2KD0 A;  2NPT B;  2KK8 A;  4XWT A;  4NSW A;  3MPX A;  3P4S B;  1N3H A;  3AEC B;  4XC2 A;  1WJU A;  1I4X A;  3DHG C;  5DH9 B;  2GI9 A;  2XK5 B;  3AH7 A;  1HQR D;  4TUU A;  3OHM B;  3DXD A;  1UBQ A;  3TEY A;  1LO5 D;  4DBB A;  2Q5W D;  2KJ6 A;  4DHJ B;  1MHH E;  2DX1 A;  4QJ3 B;  2YLM A;  3X0W A;  3ZKJ C;  1VJK A;  2B76 B;  3IAM 1;  2ABD A;  3GZN I;  4KDI C;  4HXD A;  1GAQ B;  2AL6 A;  2DZM A;  2RQ1 A;  4HAZ B;  4JX1 C;  1TS5 A;  1MAI A;  2H7E A;  3A58 A;  2K2J A;  1A70 A;  1SF0 A;  1LXD A;  2DYB A;  2W55 A;  3ZLZ A;  4TQ0 A;  5LG4 B;  3IBE A;  3JVZ X;  1SE9 A;  1WWT A;  3KSY A;  1VR9 A;  4LNK A;  4JK7 A;  3DCX A;  2GRI A;  1ROE A;  3K9P B;  3CF6 E;  2K8E A;  1XX0 A;  3ML9 A;  4MT7 A;  1YQ4 B;  3APF A;  3TEW A;  4YL8 A;  2J7Q B;  3ZNG C;  2YEP B;  2RDB C;  1QLB B;  4FJZ A;  4M01 A;  3IT6 B;  3U12 A;  4CYE A;  4HHV A;  2R61 A;  1EVH A;  1TKG A;  4K81 A;  2GOW A;  1EM7 A;  3E56 A;  1Y56 A;  1NDD A;  4Q2J A;  1TS3 A;  2BKR B;  2KOX A;  3EC8 A;  2L1C A;  4GDL A;  4I6N B;  2X8X X;  1V1P A;  2L1A A;  2LUE A;  2WX0 A;  2BS2 B;  3GOE A;  1OQR A;  1C3T A;  2PE9 A;  5LXI B;  2FID A;  2I38 A;  3EUB 2;  4HCN B;  1NYR A;  1YJ1 A;  4TYZ A;  1I7H A;  1MJD A;  2P0F A;  2KKC A;  1UUP A;  2KN4 A;  2KMA A;  3VFK A;  1HB6 A;  2VSZ A;  4JKB A;  2YS1 A;  3UIO B;  2FAZ A;  3AE3 B;  2N1V A;  1TS2 A;  1OY2 A;  2D4Q A;  1ZP0 B;  4ZHP A;  3VUX A;  1WYG A;  1V5P A;  2KFK A;  1L2N A;  3ZW3 A;  5HE3 A;  4X57 B;  2CJO A;  2CHZ A;  4JKH A;  2CRF A;  1DBH A;  1U5G A;  5I4D A;  3Q3N C;  2PLP A;  4MK0 A;  2BB6 A;  1C4P A;  1FD6 A;  1DDV A;  2KMM A;  4L23 A;  2OED A;  2FUG 1;  1TS4 A;  1I4G A;  1DOI A;  1I4R A;  2MBB B;  3VRB B;  4MAC A;  1L0V B;  2L52 A;  2CAY A;  3KLS X;  1JWU D;  4M00 A;  4OZB A;  2WGS A;  2EJ8 A;  5JLJ B;  2FJ9 A;  1FNW A;  4PNK A;  4PYZ A;  5G5H A;  1T3Q A;  3TMP B;  4YSZ B;  2WS3 B;  3SV1 A;  3BWU D;  1ISN A;  3L08 A;  3A9J A;  3NZS A;  3AEE B;  1JWB D;  3T9L A;  3KVF B;  4BBN F;  2WXJ A;  3ZO5 B;  2PEA A;  2R2Y A;  2RGN B;  3I57 A;  4OT1 A;  2JQR B;  3W2D A;  1TY2 A;  2UZR A;  2DBY A;  4B6W A;  2LGX A;  3PHX B;  1SHC A;  3ZXV A;  1R7S A;  3ZYY X;  4IW0 A;  1WXS A;  1YMH E;  2JYE A;  5D27 A;  1V5T A;  4BKS A;  3A33 B;  3ALB A;  2ZPY A;  5C5B A;  2ZJD A;  2RUK B;  4M0W B;  4EEW A;  2JY6 A;  5JHH A;  2LJI A;  5G2N A;  1EUV B;  1FRR A;  4DHJ D;  5AZG A;  4HWI B;  3GE8 C;  3SBT A;  2MW5 A;  2CS4 A;  1HEZ E;  2K5P A;  1FEH A;  2W3S A;  1B9R A;  1WJN A;  3WYF B;  2YT0 A;  1B55 A;  5C3J B;  3P42 A;  5C2T B;  2RLO A;  1EWC A;  1XF5 L;  1WGK A;  2KDE B;  3FVC A;  2INC C;  4G3X B;  3DBH I;  1MIX A;  2EC1 A;  1BT0 A;  1C1Y B;  2QIE B;  1WG7 A;  1FHO A;  2KIG A;  4R3D A;  2RGF A;  5CX3 A;  1MK7 B;  3NWA A;  2IDY A;  2OQB A;  1GC6 A;  2W2X C;  4K7W A;  1WI0 A;  3P63 A;  4L1R A;  4PYU A;  1P6S A;  4GN1 A;  2JSV X;  2DHK A;  1YX5 B;  5LOP B;  3PHW B;  2DWQ A;  3BII D;  3PTF C;  1E7P B;  3HVZ A;  5AUI A;  2KQ7 A;  5D3D A;  2Z0O A;  2YF0 A;  4B9K A;  1UNP A;  2DX5 A;  2N9P C;  1J0W A;  2GS0 A;  1V6E A;  2DKQ A;  2MBH A;  3PLU A;  3VVW B;  2NMQ A;  5M4Y B;  1M7R A;  1TKE A;  3BVZ A;  1IGC A;  2FIF A;  3KQ4 A;  1PFJ A;  3EFU A;  4J6I A;  1OQN A;  2J4X A;  2G3Q B;  3AEB B;  4WQM A;  1WMH B;  3ULB A;  1L5P A;  3N1Z C;  4BFR A;  1WGY A;  5D2M B;  4A6K A;  4BOS C;  3Q3M C;  1F0Z A;  1T0Q C;  3DXC A;  5FI0 A;  2IND C;  2K8H A;  4GOC A;  2D9W A;  2Y5P A;  4M02 A;  2PKO A;  3O13 A;  3MTN B;  1PGB A;  3H8H A;  4XWX A;  1EWY C;  1SE4 A;  2FCN A;  2WU2 B;  2MX2 A;  1V86 A;  2GMI C;  3EGR A;  3ETR A;  4GSW A;  4AP4 C;  3DHI C;  2KX0 A;  1YQ3 B;  3L16 A;  2J53 A;  3HVD A;  5J18 A;  5D6J B;  4F7G A;  5AZF A;  1FRD A;  5KQ1 A;  1FNV A;  3EHV A;  2WQY B;  2MFQ A;  3E9S A;  5C6R A;  1D5X C;  3HHM A;  3HSA A;  4E74 A;  1RJ2 A;  2JZ3 B;  1EU4 A;  2M38 A;  1FCC C;  1PYW D;  3AEF B;  4DXG A;  2MJE A;  3H6N A;  1BTK A;  2DNF A;  1WE6 A;  2EMT A;  1ZGU B;  1PGX A;  3GB1 A;  1HA5 A;  2QEJ C;  1I4Q A;  3A1Q A;  4DXF A;  3G9W A;  4OHJ A;  1VBG A;  3NY5 A;  3ODW A;  2ICI A;  2WXG A;  3KWV A;  4MJS A;  3SEB A;  3FIL B;  4A6F A;  5JH5 C;  1FB8 A;  2G4S A;  3FSS A;  2PW9 A;  4RF1 A;  3LXF A;  1V1O A;  3QHT A;  4PT5 A;  5DCN A;  3ZDM C;  2UYZ B;  4LJO B;  2H7D A;  1Z5S B;  2GBN A;  4K7S A;  3PGE A;  1E9M A;  5C16 A;  4K2O A;  3M95 A;  3H7S A;  2BGF A;  2K2U A;  2GBJ A;  4N6E B;  4TV3 A;  2Z0Q A;  3HIZ A;  4HK2 A;  4HDO A;  4J3O D;  1P3R A;  4DIX A;  1K51 A;  4NAW A;  2M17 A;  2KCJ A;  3NG0 A;  1WY8 A;  4G50 A;  2HJ1 A;  3SU8 X;  3RUL A;  4OVZ A;  4EZJ A;  4WUR A;  3VTV A;  4HPL B;  4ZRK A;  1OQQ A;  1TJE A;  2OTX A;  2MBO A;  2OHF A;  2LJ5 A;  3RUI B;  1GPX A;  2BWE S;  3PRP B;  3WAN A;  4K7U A;  1CMX B;  1KLU D;  2ACZ B;  1V9J A;  2N7E A;  4NQK E;  3PZ8 A;  2DLB A;  2K22 A;  1RWS A;  2ROV A;  1L6U A;  1X86 A;  2ZW1 A;  2R0D A;  3RN9 C;  4AQ7 A;  3TIX A;  3DDC B;  2MKR A;  5HFY A;  3LDZ E;  2L32 A;  1S3S G;  2BW2 A;  2CKH B;  2QKM A;  1T6B X;  4BBN C;  4N9F 4;  2JT4 B;  3QA8 A;  3M1I B;  4MEM A;  1C77 A;  3AEG B;  2INN E;  5CLL B;  3C0R B;  3RI7 C;  4B95 A;  2V4L A;  5JHB A;  3EPY A;  2ZCC A;  2PIA A;  4WWP A;  1QOA A;  3VUY A;  1S1Q B;  1F9J A;  2G1E A;  2COP A;  5JVL A;  4GB9 A;  2LUM A;  1K52 A;  3ZTC A;  4RM8 A;  4IG7 B;  4CHK A;  3ZJV A;  3C8Y A;  3OG5 A;  4GDK A;  4GOU A;  4BKS D;  3UIN B;  1IPG A;  1DOY A;  4GMV A;  2V0G A;  1FXI A;  4K2P A;  3ODO A;  2RPQ A;  4JKE A;  2MP2 B;  3VR8 B;  4IDI A;  3FC4 A;  1GG3 A;  4ZRI A;  1SB3 C;  1X1F A;  1FFV A;  1BAK A;  2HE7 A;  3AE5 B;  4IWQ A;  5DPR A;  1KRH A;  4M8N A;  1HTQ A;  3TUO A;  2RSU A;  1D4B A;  4CHJ A;  1XO3 A;  4ZRQ A;  2NPT A;  1T0Y A;  2Y8G A;  3GP7 A;  3IT4 B;  1E5W A;  2AQ1 B;  2ZVO A;  4FLH A;  3CMM B;  1R4M B;  2WXH A;  4MEL A;  1NBF C;  1ACA A;  1JWM D;  2REX A;  1FIQ A;  2XK5 A;  1AAR A;  1KM7 A;  1V49 A;  1W1D A;  3NRZ A;  3N20 C;  3RNE C;  1AWE A;  1QC6 A;  4XDC A;  3ZNZ B;  2NS5 A;  2CJN A;  2D07 B;  5G5G A;  3WAL A;  1WZ0 A;  2BCJ A;  3U7Z A;  4RM9 A;  2N9E B;  1PLS A;  4JK8 A;  3TFM A;  4URK A;  2DKP A;  4WJP A;  3DXE A;  1XEE A;  4KHB B;  2Y8F A;  3PSE B;  4WJ7 A;  1UNQ A;  5D3V A;  1WX7 A;  2KN5 A;  3I5J C;  3RNA C;  4XZ4 A;  1Q0W B;  3ZGZ A;  3QAR A;  2R2O A;  4XGA B;  1I4P A;  1K53 A;  2Y5C A;  3DVG X;  2WP9 B;  1FHX A;  2V3N A;  3SBG A;  3WAM A;  1L7Y A;  3WAP A;  2UWQ A;  1UWX A;  2YT2 A;  2KGX B;  3N7C A;  1JRP A;  3Q6B A;  1U2B A;  1ZXH A;  2X0S A;  4KGS A;  4II3 B;  4GDK B;  3AE8 B;  1RAX A;  3RNG C;  1XLO A;  3GS2 A;  2K8B A;  4JKC A;  3DOW A;  3AI5 A;  4REZ A;  3U2S C;  4TKN A;  4C7Y A;  1TYG B;  4LCD E;  1ZOY B;  4JLC A;  4CQN A;  2IGG A;  5BO4 B;  3OJ4 B;  4B6H A;  1WJ6 A;  3BZD B;  3FP5 A;  2CQU A;  1XT9 B;  3PVL A;  1SXT A;  2Z59 B;  1STE A;  1ZYI A;  2LEK A;  3BVM A;  4D2K A;  3W9C B;  2GCJ A;  4QJ5 B;  3O65 B;  3PLV A;  4W9C A;  5EE1 A;  5IP4 D;  3W1S A;  3CST A;  5IRS A;  2VRW B;  1WI1 A;  1W1G A;  1E6E B;  1WH3 A;  3HM3 A;  4LDT B;  4DHZ B;  1X05 A;  4MY6 A;  2LRU A;  3HW2 B;  1N60 A;  3QC8 B;  1ESF A;  3O96 A;  2V3P A;  4YXD B;  2UVM A;  4KV2 A;  1RM6 C;  4KIK B;  4KGR A;  3N1X C;  1AN8 A;  3VHT C;  3UQB A;  1AYF A;  4YWG G;  3VIA A;  5HI1 A;  1MG4 A;  1XLP A;  3MC9 A;  4JKD A;  3NWF A;  2MA9 B;  5GXG B;  1E8X A;  1FO4 A;  2RRF A;  2CHX A;  2RPV A;  3H1U A;  3DBL I;  3TEX A;  4I6P A;  1MK9 B;  5GMV A;  3LJ3 A;  1GC7 A;  3BVG A;  1WJ1 A;  4HPM B;  1KI1 B;  2J0M A;  1R4N B;  2V76 A;  4P6V F;  3E9L A;  1UNS A;  2RDH A;  3E66 A;  2A5U A;  3SNH A;  4OZA A;  2IO0 B;  1FHW A;  2L0T A;  2WDR B;  5L81 A;  2K6D B;  2JXT A;  1NEK B;  2A4Z A;  4YSY B;  2WH5 A;  3AV8 A;  4EZL A;  1QKZ A;  5AZH A;  3VXW A;  1V61 A;  2MQJ A;  1XQQ A;  1NEN B;  1U27 A;  5IO9 A;  3P4Q B;  1ET6 A;  3A4R A;  3GYO A;  2PPH A;  2VZK D;  1KF6 B;  1UH6 A;  4P1C C;  2ZNV B;  3A9K B;  4HB4 B;  2LGY A;  2JWU A;  3KWL A;  1SEB D;  4OZC A;  4RGO S;  2YT1 A;  1Q67 A;  2Q13 A;  3DWG C;  2NCN A;  2E2X A;  3NZU A;  1WXQ A;  4ANX A;  1MG8 A;  1UPQ A;  3AE6 B;  2D3B A;  2JPH A;  1LM8 B;  2JXX A;  3QIJ A;  3QK0 A;  5L95 C;  4P7I A;  3U8Z A;  5C1Z A;  2AWT A;  1GB4 A;  3AB5 A;  4WJN A;  5IKC M;  4M0W A;  3DVN U;  4GGQ A;  2AQ2 B;  1U5D A;  5EE9 A;  2LBB A;  2YS5 A;  4F7H A;  2V9H A;  4ANW A;  4WIP A;  1EAZ A;  3A8Q A;  1DOX A;  2SAK A;  4I6L B;  4A20 A;  2IGD A;  3IHP C;  3TBL D;  4L1B A;  4W9K A;  2AYO B;  1NVI D;  1IBX B;  1OEY A;  2NR2 A;  1HBK A;  2KWV B;  1T0S C;  3U4E G;  2MBQ A;  2LHE A;  2GCL A;  1X1G A;  5BYS A;  3T3N A;  1ZC4 B;  3WA0 A;  4W9E A;  2DAF A;  4JIO U;  5IN7 A;  1P98 A;  4QJ4 B;  1TIF A;  4WJO A;  5MPO A;  1M94 A;  1GNU A;  4HPP A;  2JF5 A;  3SO6 A;  2MWN B;  2WXK A;  3VH3 B;  4L2Y A;  3UZT A;  3U7D A;  5IOI A;  4ILG B;  4AWJ A;  2KDM A;  4ZRP A;  3VTU A;  2KUQ A;  1PGA A;  2DZI A;  4HAV B;  4RGM A;  2LKO A;  3JSV B;  5EFX A;  5LXH A;  1ZDV A;  4IAP A;  1KC7 A;  1WYW B;  3ZNH B;  1KOT A;  4NAM A;  4JE3 B;  1HTO A;  1MI1 A;  1SJH D;  4IOY X;  3ODX A;  1F2R I;  1HZ6 A;  2HJ8 A;  3NVZ A;  5HE2 A;  1XCT L;  2KHW B;  4HRS A;  1QOB A;  1VRA B;  1WMH A;  3P4P B;  4YT0 B;  3AJ4 A;  1C76 A;  3ZNI D;  3KUZ A;  3RD2 A;  1WRI A;  2KWD A;  2R2Q A;  4IWP A;  3OJ3 A;  3PP2 A;  3L54 A;  3PO0 A;  3BK1 A;  2CY4 A;  2NBW B;  1TY0 A;  3ENB A;  2KUP A;  2KJR A;  2COC A;  3AU5 A;  2HTH B;  4FHK A;  4ASW C;  4OVV A;  3TO1 A;  2IPK D;  1J19 A;  5C79 A;  1ZE3 D;  4YTM B;  2MBE A;  2W54 A;  2JYT A;  2D3G A;  4YON A;  2KTF A;  4ZDV A;  3X23 A;  1JAL A;  2N9X A;  4IM0 A;  4BBK A;  5IAA C;  3N3K B;  1E10 A;  1TJ6 A;  1NYQ A;  2QKL A;  3ZUN A;  3K9O B;  2WDQ B;  1P3Q U;  1WZ3 A;  1EU3 A;  1YN3 A;  3EFC A;  2QDF A;  2L00 B;  1PUT A;  1V97 A;  4IC7 B;  1E90 A;  3VTW A;  1WGU A;  5FK9 C;  2JUO A;  2MSE D;  3PRM B;  5C23 A;  2N7D A;  3V5W A;  1W1H A;  2C7H A;  3MHZ A;  3QWZ B;  1HXY D;  2BF8 B;  4C4V B;  3T06 A;  3RZW C;  3FIL A;  1T0R C;  4IFS A;  2N9L A;  3BIN A;  1FCL A;  3V62 A;  1N61 A;  1IP9 A;  3T3O A;  4HRO A;  1BXT A;  2RSG A;  2KAJ A;  4W9D A;  1ZVR A;  4JKA A;  3DVN V;  4N59 A;  5TSS A;  4HSI A;  2DEN B;  1P9D U;  4KKI A;  1JCK B;  3VOQ A;  1PFD A;  1GOZ A;  2B3A A;  4P1B C;  5E6O A;  4JK9 A;  2KNB A;  2J59 M;  3KY9 A;  1TKY A;  1VZ6 A;  4ZHO A;  1NI3 A;  4FJV B;  4K3C A;  3RYT A;  4OSN A;  4TQ1 A;  4HAU B;  3VRA B;  3ZIM A;  1ZC3 B;  5FR6 A;  2LRW A;  3L4P A;  3OAN A;  2O2V B;  4QAY A;  2IYB A;  4BZA A;  2RD0 A;  2BKF A;  3W5V B;  3ZQ4 A;  3ZVV A;  5FI1 A;  1F52 A;  2FCS A;  2H89 B;  4L6E A;  3P1M A;  5H8Y E;  2JX5 A;  3SUZ A;  2C7N B;  4MM3 B;  4UDU C;  1RYJ A;  2IO2 B;  4XDD A;  4MT5 A;  2HRJ A;  2I2Y A;  2GLS A;  2IO3 B;  4II2 B;  2WXN A;  2O6V B;  3AXC A;  2R09 A;  2ADZ A;  5I2S A;  4F1S A;  2VKI A;  3C19 A;  2YRY A;  2M4N A;  4MH0 E;  1N6Z A;  3HIE A;  3R2I A;  1DYN A;  3R8B A;  2KJH B;  4EUT A;  4RGN A;  3WCQ A;  3B08 A;  4PQ0 A;  1QOF A;  4HKZ E;  3IXS A;  3BYY B;  1BWN A;  5KCV A;  2KQS A;  2AQ3 B;  1F1H A;  1Q10 A;  4GZU A;  2FE8 A;  2P0D A;  2KO3 A;  1KZG A;  1L4Z B;  2KWU B;  5J2R A;  1I42 A;  5D3W A;  2OOB B;  3AE4 B;  2XEW A;  2WDT B;  4C56 C;  3J9C A;  1OTR B;  2HD5 B;  4ANU A;  2MP2 A;  4YTN B;  3ZRF A;  1WVH A;  5GOW B;  4AOF A;  4YTP B;  2IZV B;  4JGH B;  2IGH A;  4MH8 A;  3B2F A;  1VCB A;  2ZPN A;  1J0G A;  2UZS A;  4BOZ B;  3D32 A;  5LON B;  1N62 A;  3PV1 A;  1VZ8 A;  4JQW C;  1UGJ A;  2CU3 A;  3ULC A;  3PVW A;  1F77 A;  1E7U A;  1EGX A;  4A3O A;  4S17 A;  3AE2 B;  4FBJ B;  2N0Y A;  4AUQ C;  2KX3 A;  4RH6 A;  2LYD A;  4WAA A;  1UBI A;  3DQV A;  3L13 A;  1WXA A;  1MHX A;  1KFY B;  2KDI A;  2QMT A;  1F2R C;  3QCA A;  4EJN A;  2G4D B;  2BPS A;  4HEA 1;  1Y19 B;  1WGG A;  1CJE A;  5AEK B;  1AW7 A;  4CHM A;  4OW0 A;  1D5M C;  3SR6 A;  4KHB A;  4DDG D;  3RT3 B;  3APC A;  1WXV A;  2W9N A;  1FGZ A;  2IBI B;  3QJZ A;  3RFZ B;  4JL9 A;  2ZKM X;  1UEF A;  1LW3 A;  2KFJ A;  1B1Z A;  2COA A;  4GXB A;  1V5U A;  2K49 A;  2J0J A;  4KHA A;  2N1W A;  3DBR B;  1VDV A;  2PE6 B;  3DBS A;  3V05 A;  1C79 A;  3CXB B;  3VH4 B;  3SFE B;  3EA6 A;  4Z2N A;  3QBV B;  4BAX A;  4EZK A;  4F8C B;  3OAW A;  1FOE A;  1V5O A;  4GU2 A;  3IAS 1;  3I3T B;  3V6E B;  1VBH A;  4FAD A;  2MJ3 A;  2Z0D B;  2ASQ A;  3L10 B;  4RGT A;  3A8P A;  1E0Z A;  2ZW0 A;  3AEA B;  3ABV B;  2QJL A;  2AL3 A;  4JKF A;  2BYE A;  3AE1 B;  1YOV B;  1I7A A;  3NVV A;  3FM8 C;  5EE0 A;  5KHO A;  2K0P A;  2C9W B;  1FXA A;  1LB1 A;  1TQZ A;  1JRO A;  3HRD D;  3SD5 A;  5IJM A;  4NJC A;  2KDF B;  1JDE A;  1ZKH A;  4PS7 A;  2CU1 A;  2Z59 A;  2KAC A;  4KZC A;  2MJD A;  2X38 A;  2COF A;  2LXA A;  2GBR A;  1DIK A;  4K17 A;  1XKE A;  3ML8 A;  2LVQ A;  3GZN B;  2COD A;  5BMI A;  3DHH C;  2DFK A;  3LJU X;  1KJT A;  1YIW A;  4P16 A;  3LYY A;  1DDM A;  1KBL A;  3ZDT A;  2K3U A;  3OWE B;  2Z0P A;  2I5F A;  1NVL A;  1SIJ A;  5JXV A;  2BYT A;  1JWA D;  4H8S A;  2NTS A;  1WRD B;  4KIK A;  1MPH A;  2Z13 A;  2MRP A;  3AMZ A;  2M19 A;  3HQC A;  4CO7 A;  1UD7 A;  3MFG A;  3P6A A;  1HE8 A;  2JWZ A;  3KYC D;  3ZRC A;  4EE2 A;  1OGW A;  4MGK E;  3RNB C;  2JP2 A;  3VAW A;  1JML A;  1TXD A;  1M7E A;  2PMV A;  1YJJ A;  2V4I B;  2D5G A;  1EF1 A;  3ZTD A;  4JWU C;  4H2A A;  3PVU A;  2XQN M;  3A98 B;  3KRX A;  4A6H A;  1P1A A;  1XXG A;  2BS3 B;  4M8M A;  1MVK A;  1C4C A;  1QQR A;  1SE3 A;  4AJY B;  4XYC A;  2N7J A;  1RFK A;  3AE9 B;  1ENF A;  1WJ4 A;  3P2B A;  4RMA A;  1IGD A;  4WH4 A;  4OVU A;  3B0A A;  4GPT B;  3VQI A;  1L6V A;  1YQB A;  2L2I A;  3A9K A;  4FA6 A;  1JW9 D;  3P4R B;  3AM9 A;  1V5M A;  4A5K A;  5FKA C;  1V89 A;  5BYQ A;  5HKH A;  2M1M A;  4USA A;  3B9J A;  4EKU A;  5D7G A;  3MDB C;  4DBG A;  1RRP B;  3URY A;  5D3Y A;  1T77 A;  5JHG A;  2CB8 A;  4WWO A;  4NPN A;  1P7E A;  1WR1 A;  2YSZ A;  4LNO A;  3AUL A;  3QQ8 B;  3FAH A;  1JRU A;  2QSD A;  2KAN A;  2DN6 A;  4KKJ A;  2WXP A;  1MI0 A;  1WGR A;  4FHJ A;  3DBR I;  4KHO A;  4FJY A;  2LVP A;  1N5W A;  4MGI E;  4W9G A;  1YNT E;  1IBX A;  2WXI A;  1DYQ A;  4PS3 A;  4DDI D;  1I35 A;  2W82 A;  1TTN A;  1WX9 A;  3NVY A;  2I5C A;  4Y94 A;  2H88 B;  2DLW A;  2IY0 B;  2BVC A;  1ZM0 A;  2G45 B;  2K8C A;  2WWZ A;  3VDZ A;  1WGQ A;  1Z2M A;  1MKE A;  2W2W A;  2RVB B;  2W2X D;  1C78 A;  2XNA C;  1I4H A;  1XOD A;  4NZL B;  2KC2 A;  1CQV A;  4KGT A;  3KZ1 A;  4A3P A;  2NBV B;  1ST7 A;  3E9O A;  2DZJ A;  2QCZ A;  3IG3 A;  3HM6 X;  1TZ1 A;  3PZD A;  5FR3 A;  3ONS A;  2J0K A;  3KYD D;  3RPF C;  2TSS A;  4HJK A;  4WQO B;  3Q69 A;  4NJ7 A;  2I1J A;  1U29 A;  2NVU I;  1P7F A;  2MLB A;  2BBC A;  1I2H A;  3JSV A;  3N9Y C;  4JKG B;  2YS3 A;  1IUE A;  4D0N B;  1ZPS A;  2L05 A;  5BMG A;  1TGZ B;  2EKI A;  2GBM A;  1R4M I;  1KLV A;  2X18 A;  2V3S A;  2W3R A;  2PJH A;  3D8D A;  1Y8R C;  3VUW A;  3Q3O C;  3T8M A;  4HKQ A;  3H7P B;  2RNR B;  1L0X B;  5D3X A;  2KT7 A;  4KSL C;  2WYQ A;  3PG7 A;  2GB1 A;  1JQ4 A;  2KTR B;  4WWM A;  3DBH B;  1UGM A;  3NUH B;  5DI9 B;  2AX5 A;  1QF6 A;  2EEL A;  2WHI A;  1G6J A;  5KHQ A;  5HE0 A;  4K3B A;  2N23 A;  3HK0 A;  1V80 A;  3DWM A;  3UIP B;  3IVF A;  3OLM D;  2RDG A;  3NSU A;  3ZVR A;  2JRH A;  5DPW A;  1N5X A;  2HTH A;  5T8I A;  5EE3 A;  2ELB A;  2ROZ B;  3NW8 A;  1BML C;  3PSC A;  3F0W A;  2XN9 C;  2DTC A;  1MPE A;  1M4V A;  3MC0 B;  4US9 A;  1WF9 A;  2PVO D;  3B1L X;  3Q8C A;  2IO1 B;  4WWN A;  1PQS A;  3HUI A;  4LNI A;  2DZK A;  2DA0 A;  4RCO A;  2LGD A;  4ANV A;  1OFF A;  2LFI A;  2Z14 A;  4MSM B;  1N63 A;  2AEH A;  1C4A A;  3W1Y A;  2DYQ A;  4MDK E;  1K8R B;  1XD3 B;  4N58 A;  2JU6 X;  4W9F A;  4WAF A;  3D8E A;  4KVG B;  3APD A;  2G35 A;  3N30 A;  4FN2 A;  1CK1 A;  1FGY A;  3CIR B;  3Q2A C;  3PRZ A;  4W9I A;  1DGJ A;  5JP4 A;  1E8Y A;  2LOZ A;  4FXC A;  2M0X A;  4ICU A;  3H9D A;  2LMC A;  1EO6 A;  4C4V A;  1UEL A;  3PEG A;  5EDS A;  2N9K A;  2L8J A;  5E6P A;  4O1N A;  4AJW A;  3M63 B;  2ZZP B;  2NMB A;  3RCZ A;  1P0R A;  1D6E C;  3BY4 B;  3SYX A;  3AU4 A;  4ZYS A;  3P7Z A;  4HB3 B;  2IY1 B;  2VRR B;  3TSS A;  3SFD B;  2WNM A;  2WLB A;  2L0F A;  3PS6 A;  4IOI E;  4W9L A;  5CLQ B;  4HVB A;  3U30 A;  4G0N B;  1DDW A;  4AS1 A;  1NU2 A;  1QQG A;  3ENE A;  3ZJU A;  4LDT D;  5DPS A;  2WXM A;  4LTU A;  4QXA B;  2WX1 A;  2D10 A;  1WJM A;  1LGR A;  1FPY A;  5I2M A;  2K25 A;  2L83 A;  1V81 A;  2LOX A;  3NWD A;  3MC8 A;  4KAX B;  2L7R A;  2C5L C;  4A90 A;  1IRS A;  2Z8L A;  1R4N I;  2YEP F;  5CHV C;  2CHW A;  2MCN B;  1YN4 A;  2O2V A;  1XCQ L;  4LK0 M;  2ON8 A;  3RZF A;  1WFY A;  2LAS A;  2LVO A;  5DHA B;  4ZRJ A;  1ZDX A;  2CY5 A;  5BYR A;  4BKG A;  2WXF A;  1GUA B;  4GDL B;  1V1P B;  4MM3 A;  1T5X D;  1H4R A;  5D3I B;  3GE3 C;  2DYO A;  2E3T A;  4GNK B;  1RRB A;  2O6V A;  1U5E A;  5E6N A;  4S0R A;  2V1Y A;  2JZZ A;  5L83 A;  4F7U P;  2FNJ B;  1AQC A;  2BYV E;  4BVU C;  3FLV A;  3JW0 X;  1BTN A;  3DVG Y;  3MHS D;  2KYW A;  1WE7 A;  1NTV A;  3CSF A;  2D9Z A;  2K00 A;  2KFK B;  4IKG A;  2Y5B B;  1SGH A;  1NI2 A;  3NHE B;  4E3C A;  3TVV A;  1L0Y B;  4NJ6 A;  1A5R A;  2LXC A;  2EMS A;  3Q3F A;  5HG2 A;  4ILJ A;  1PMS A;  2BT6 A;  2KXJ A;  2D9V A;  4ARC A;  1GJZ A;  2JZP A;  4A55 A;  2BWF A;  3Q8F A;  3DPD A;  4HDQ A;  4PK1 A;  4ARI A;  1NTY A;  5J17 A;  5CHW A;  2WU5 B;  3DCG A;  2GUM A;  3NJT A;  5D94 A;  4ICV A;  4XE0 A;  2NBU A;  3R7Q A;  5IA7 A;  4NY0 A;  2PVG C;  2LZ6 A;  2UU7 A;  3L17 A;  2LG1 A;  2Y3A A;  1ZSQ A;  3NOB A;  1D5Z C;  4B0M A;  3KUD B;  1GGO A;  2FDQ A;  1U5F A;  3A9J B;  5JHA A;  1EF5 A;  1QOG A;  4JPS A;  1E8W A;  2D2Q A;  1ZUD 2;  2P0H A;  1V2Y A;  5JZE B;  1Q5W B;  4W9H A;  4RNA A;  1BUI C;  4TMA B;  3Q8E A;  3B77 A;  3IFW B;  3R66 C;  1NTI A;  2KWC A;  5BMH A;  2D9Y A;  4PS8 A;  2C7M B;  1HZ5 A;  3V61 A;  2D3C A;  2MH7 A;  2GJY A;  3V6C B;  3D8F A;  5AUK A;  1YD8 U;  5C5B B;  1J7B A;  2DHJ A;  2ZEQ A;  4E71 A;  4DXA B;  4HAY B;  3NS8 A;  2KMC A;  4A6Q A;  4WJQ A;  1VZ7 A;  4C0A A;  5H92 C;  2VH2 A;  4DX9 0;  3BYT B;  1KTK A;  3RCP A;  3PZ7 A;  1SJE D;  1UWM A;  4IWO A;  5CTR C;  4C7Z A;  1UPR A;  2QIL A;  3V60 A;  1E7V A;  4HAT B;  2JVC A;  2J52 A;  2Z4D A;  2I1K A;  1MFW A;  4FUL A;  3CIK A;  3WIM A;  2RMM A;  1Q1O A;  2KLG A;  2LI5 A;  3AN1 A;  2NTT A;  2JRI B;  1OQY A;  2G9H D;  1WR6 E;  3KH0 A;  2M0A A;  2K6Q A;  4HCP B;  4MGZ E;  2DIK A;  5DIF B;  3EEC A;  4HLE A;  2FCQ A;  2QHO A;  1WSP A;  3ECI A;  4NNJ B;  1XD4 A;  1XLQ A;  3U52 E;  1WGH A;  1UZX B;  4IM2 A;  4HB0 B;  4RF0 A;  2MHJ A;  4XWW A;  3CWI A;  4ILH A;  1RFA A;  4ITK A;  3KUC B;  2P8V A;  3BK2 A;  2DX5 B;  2DYM A;  3I9V 1;  2IYD B;  4YSX B;  3MJ5 A;  1FAO A;  4EOY A;  1Y5O A;  2LHD A;  2KIE A;  2L3Z A;  4BKT A;  3UI3 A;  3BJI A;  2CR5 A;  4KX6 B;  1FNU A;  2D3A A;  1YN5 A;  4XX5 A;  2OJR A;  1SIF A;  4A8X C;  1UNR A;  3Q8B A;  2SEB D;  3KW5 B;  3QAQ A;  3M3J A;  2KR0 A;  1H10 A;  1C9F A;  2D9X A;  4GIV A;  3B2G A;  4DK5 A;  2WXR A;  1ACC A;  1CZP A;  4C80 A;  2OJW A;  3PRE A;  5E6J A;  1KLG D;  4CSQ A;  3MJW A;  2N0S B;  1TBE A;  4IM3 A;  2ZVN A;  3TEZ A;  2K9X A;  2DHI A;  3N1Y C;  1KH0 A;  5KQ4 A;  3TCA A;  4KZ0 A;  4NQL B;  5J3Y A;  2WXQ A;  2LGS A;  1XLN A;  1V8C A;  3L0W B;  4MGY E;  1TT5 B;  3PT2 B;  3R2T A;  5G55 A;  1HB8 A;  2LWP A;  3FKY A;  4A9A A;  1E8Z A;  2KQ4 X;  4HAW B;  1Z87 A;  4JWS C;  4G11 A;  1D3Z A;  3M62 B;  1QIL A;  3JYU A;  4ZYN A;  1XCG A;  2LGI A;  2KVZ A;  1WM2 A;  2KVR A;  2HDE A;  4C00 A;  2FBW B;  4RFB A;  2ZCB A;  2BS4 B;  1OMW A;  2D11 A;  1QT9 A;  1WXM A;  1K5D B;  1VD2 A;  2R82 A;  1AWD A;  2ZNV C;  3A1Q B;  1U4A A;  1J7A A;  1SE2 A;  4MJS B;  2DYN A;  4A6F B;  1SSN A;  2Y7B A;  4ZOH C;  3AE7 B;  1FXT B;  1LFD A;  4KSK C;  2XBB C;  1YJI A;  1K5G B;  2KC1 A;  4LLG M;  1GB1 A;  1PDX A;  4GLS C;  1WM3 A;  4DWF A;  2YVC A;  3WAO A;  2FJL A;  3LB8 C;  2NZ8 B;  1ZXI A;  4LNF A;  2HTM E;  2ONQ A;  3W1S C;  4US8 A;  2PTL A;  3VR9 B;  4DX8 A;  3DBL B;  2E6X A;  2O6V D;  3SHQ A;  4NAW B;  5LLI A;  2M14 A;  1MIZ B;  3FEH A;  3UGB B;  2VZK B;  1P5T A;  2C60 A;  4EFO A;  4WSF A;  4MSQ B;  2KDB A;  2IFS A;  4KDL B;  1X1M A;  2FCM A;  1FM0 D;  2BYF A;  2J42 A;  2WDV B;  2INP E;  2BB5 A;  3Q8A A;  1VLB A;  1X11 A;  3S2A A;  3W5U B;  3I63 C;  1QZE A;  4IUM B;  2BQQ A;  1FFU A;  1YX6 B;  3A4S C;  4LNN A;  3NVW A;  3F5R A;  1K50 A;  3R7R A;  2NBV A;  3TW1 A;  2IJ0 A;  2KLC A;  2Z0E B;  1KZ7 A;  4W9J A;  4DQO C;  3AED B;  3QX1 A;  2L76 A;  3ZJT A;  2GBK A;  1XR0 B;  2FUH B;  3KRW A;  1V88 A;  2K39 A;  1DRO A;  5HE1 A;  3QWM A;  2M56 B;  1L4D B;  3NS1 A;  2MWS B;  4JKG A;  2ELA A;  1J7C A;  2DAJ A;  2QC8 A;  5HHD G;  4GMX B;  4DHZ E;  4ACF A;  1WIA A;  3SDL C;  4Z2M B;  4LJP B;  2MDX A;  2MEK A;  3E9P A;  2M8S A;  1ET9 A;  2K1F A;  1LQB A;  2WXL A;  4HB2 B;  2N4F A;  3V3X A;  5J3Q A;  2RR9 A;  3H7P A;  4EMO A;  3RMK C;  2DHZ A;  2KTR A;  2VH1 A;  4F7Z A;  4HAX B;  1UF0 A;  1WX8 A;  3TJP A;  2BTE A;  1OEY J;  2KZR A;  2LD9 A;  3RNF C;  3RNC C;  2FJU B;  3R3M A;  3UQA A;  2LUL A;  2EKE C;  1SBB B;  1IYF A;  5LNK 1;  3PPA A;  3ML4 A;  3Q3J A;  3GYP A;  1WGD A;  5DHF B;  3TL5 A;  5DPT A;  1H8C A;  5CHF A;  4D6W A;  1FMA D;  4HJG E;  1J8C A;  1JWS D;  5TR5 A;  4K1R B;  3Q14 C;  3N32 A;  5J3T A;  1ZW7 A; 
#chains in the Genus database with same CATH homology
 1RLF A;  2PZ1 A;  3UF8 A;  4WVF B;  2KD0 A;  2NPT B;  2KK8 A;  4NSW A;  3MPX A;  1N3H A;  4XC2 A;  1WJU A;  5DH9 B;  2XK5 B;  4TUU A;  3DXD A;  1UBQ A;  4DBB A;  2KJ6 A;  4DHJ B;  2DX1 A;  2YLM A;  3X0W A;  3ZKJ C;  2ABD A;  3GZN I;  4KDI C;  4HXD A;  2AL6 A;  2DZM A;  2RQ1 A;  4HAZ B;  1MAI A;  2H7E A;  2K2J A;  1LXD A;  2DYB A;  3ZLZ A;  4TQ0 A;  3IBE A;  3JVZ X;  1SE9 A;  3KSY A;  4JK7 A;  3K9P B;  3CF6 E;  1XX0 A;  3ML9 A;  4MT7 A;  3APF A;  4YL8 A;  2J7Q B;  3ZNG C;  4FJZ A;  4CYE A;  4HHV A;  1EVH A;  4K81 A;  2GOW A;  1NDD A;  2BKR B;  2KOX A;  3EC8 A;  2L1C A;  4GDL A;  4I6N B;  2LUE A;  2WX0 A;  3GOE A;  1C3T A;  2PE9 A;  5LXI B;  2FID A;  4HCN B;  1YJ1 A;  4TYZ A;  2P0F A;  2KKC A;  2KMA A;  3VFK A;  1HB6 A;  2VSZ A;  4JKB A;  2YS1 A;  3UIO B;  2FAZ A;  2N1V A;  1OY2 A;  2D4Q A;  3VUX A;  1V5P A;  2KFK A;  1L2N A;  3ZW3 A;  5HE3 A;  4X57 B;  2CHZ A;  4JKH A;  2CRF A;  1DBH A;  1U5G A;  4MK0 A;  1DDV A;  2MBB B;  2CAY A;  2EJ8 A;  5JLJ B;  2FJ9 A;  4PNK A;  4PYZ A;  3TMP B;  3SV1 A;  1ISN A;  3L08 A;  3A9J A;  3NZS A;  3T9L A;  3KVF B;  4BBN F;  3ZO5 B;  2PEA A;  2RGN B;  2UZR A;  4B6W A;  2LGX A;  3PHX B;  1SHC A;  4IW0 A;  1WXS A;  5D27 A;  1V5T A;  4BKS A;  3A33 B;  3ALB A;  2ZPY A;  5C5B A;  2ZJD A;  2RUK B;  4M0W B;  4EEW A;  2JY6 A;  5JHH A;  5G2N A;  1EUV B;  4DHJ D;  5AZG A;  4HWI B;  3SBT A;  2MW5 A;  2CS4 A;  1WJN A;  3WYF B;  2YT0 A;  1B55 A;  2RLO A;  2KDE B;  4G3X B;  3DBH I;  1MIX A;  2EC1 A;  1BT0 A;  1C1Y B;  1WG7 A;  1FHO A;  2RGF A;  5CX3 A;  1MK7 B;  2OQB A;  1GC6 A;  2W2X C;  4K7W A;  1WI0 A;  4PYU A;  1P6S A;  4GN1 A;  2DHK A;  1YX5 B;  5LOP B;  3PHW B;  3PTF C;  2KQ7 A;  2Z0O A;  2YF0 A;  4B9K A;  1UNP A;  2DX5 A;  2N9P C;  1J0W A;  2GS0 A;  1V6E A;  2DKQ A;  2MBH A;  3PLU A;  3VVW B;  1M7R A;  2FIF A;  1PFJ A;  3EFU A;  4J6I A;  1OQN A;  2G3Q B;  1WMH B;  3ULB A;  4BFR A;  1WGY A;  5D2M B;  4A6K A;  4BOS C;  3DXC A;  5FI0 A;  2K8H A;  4GOC A;  2D9W A;  3MTN B;  4XWX A;  2FCN A;  2MX2 A;  1V86 A;  2GMI C;  4GSW A;  4AP4 C;  2KX0 A;  3L16 A;  5J18 A;  5D6J B;  4F7G A;  5AZF A;  5KQ1 A;  3EHV A;  2MFQ A;  5C6R A;  3HHM A;  4E74 A;  1RJ2 A;  2JZ3 B;  2M38 A;  3H6N A;  1BTK A;  1WE6 A;  2EMT A;  1ZGU B;  3A1Q A;  3G9W A;  1VBG A;  3NY5 A;  3ODW A;  4MJS A;  4A6F A;  5JH5 C;  1FB8 A;  2G4S A;  3FSS A;  3QHT A;  5DCN A;  3ZDM C;  2UYZ B;  4LJO B;  2H7D A;  1Z5S B;  2GBN A;  4K7S A;  3PGE A;  5C16 A;  4K2O A;  3M95 A;  3H7S A;  2BGF A;  2K2U A;  2GBJ A;  4TV3 A;  2Z0Q A;  3HIZ A;  4HK2 A;  4HDO A;  1P3R A;  4NAW A;  2M17 A;  2KCJ A;  1WY8 A;  4G50 A;  3SU8 X;  3RUL A;  4EZJ A;  3VTV A;  4HPL B;  4ZRK A;  2OTX A;  2MBO A;  2LJ5 A;  3RUI B;  2BWE S;  3PRP B;  3WAN A;  4K7U A;  1CMX B;  1V9J A;  2N7E A;  4NQK E;  2ROV A;  1X86 A;  2R0D A;  3TIX A;  3DDC B;  2MKR A;  3LDZ E;  1S3S G;  2CKH B;  2QKM A;  4BBN C;  4N9F 4;  2JT4 B;  3QA8 A;  3M1I B;  4MEM A;  5CLL B;  3C0R B;  4B95 A;  2V4L A;  5JHB A;  3EPY A;  2ZCC A;  4WWP A;  3VUY A;  1S1Q B;  1F9J A;  2COP A;  5JVL A;  4GB9 A;  3ZTC A;  4RM8 A;  4IG7 B;  4CHK A;  4GDK A;  4BKS D;  3UIN B;  1IPG A;  4GMV A;  4K2P A;  3ODO A;  2RPQ A;  4JKE A;  2MP2 B;  1GG3 A;  4ZRI A;  1X1F A;  1BAK A;  2HE7 A;  4IWQ A;  5DPR A;  4M8N A;  2RSU A;  4CHJ A;  2NPT A;  1T0Y A;  2Y8G A;  1E5W A;  2ZVO A;  4FLH A;  3CMM B;  4MEL A;  1NBF C;  1ACA A;  2REX A;  2XK5 A;  1AAR A;  1KM7 A;  1V49 A;  1W1D A;  1AWE A;  1QC6 A;  3ZNZ B;  2NS5 A;  2D07 B;  3WAL A;  1WZ0 A;  2BCJ A;  4RM9 A;  2N9E B;  1PLS A;  4JK8 A;  3TFM A;  4URK A;  2DKP A;  4WJP A;  3DXE A;  4KHB B;  2Y8F A;  3PSE B;  4WJ7 A;  1UNQ A;  5D3V A;  1WX7 A;  2KN5 A;  4XZ4 A;  1Q0W B;  3QAR A;  2R2O A;  3DVG X;  1FHX A;  3SBG A;  3WAM A;  1L7Y A;  3WAP A;  2UWQ A;  2KGX B;  3N7C A;  1U2B A;  2X0S A;  4II3 B;  4GDK B;  1RAX A;  2K8B A;  4JKC A;  3DOW A;  3AI5 A;  4TKN A;  4LCD E;  4JLC A;  5BO4 B;  3OJ4 B;  4B6H A;  1WJ6 A;  3FP5 A;  2CQU A;  1XT9 B;  3PVL A;  2Z59 B;  2GCJ A;  3O65 B;  3PLV A;  4W9C A;  3W1S A;  3CST A;  2VRW B;  1WI1 A;  1W1G A;  1WH3 A;  3HM3 A;  4LDT B;  4DHZ B;  1X05 A;  4MY6 A;  2LRU A;  3HW2 B;  3QC8 B;  3O96 A;  2UVM A;  4KV2 A;  4KIK B;  3VHT C;  3UQB A;  3VIA A;  4JKD A;  2MA9 B;  1E8X A;  2CHX A;  3H1U A;  3DBL I;  4I6P A;  1MK9 B;  5GMV A;  3LJ3 A;  1GC7 A;  1WJ1 A;  4HPM B;  1KI1 B;  2J0M A;  2V76 A;  3E9L A;  3E66 A;  2A5U A;  3SNH A;  2IO0 B;  1FHW A;  2L0T A;  5L81 A;  2K6D B;  2A4Z A;  2WH5 A;  4EZL A;  5AZH A;  3VXW A;  1V61 A;  2MQJ A;  1XQQ A;  1U27 A;  3A4R A;  3GYO A;  2PPH A;  1UH6 A;  2ZNV B;  3A9K B;  4HB4 B;  2LGY A;  2YT1 A;  1Q67 A;  2Q13 A;  2NCN A;  2E2X A;  3NZU A;  4ANX A;  1MG8 A;  1UPQ A;  2JPH A;  1LM8 B;  2JXX A;  3QIJ A;  3QK0 A;  5L95 C;  4P7I A;  3U8Z A;  5C1Z A;  2AWT A;  4WJN A;  3DVN U;  4GGQ A;  1U5D A;  2LBB A;  2YS5 A;  4F7H A;  4ANW A;  1EAZ A;  3A8Q A;  4I6L B;  4A20 A;  3IHP C;  3TBL D;  4W9K A;  2AYO B;  1OEY A;  2NR2 A;  1HBK A;  2KWV B;  2MBQ A;  2GCL A;  1X1G A;  1ZC4 B;  3WA0 A;  4W9E A;  2DAF A;  4JIO U;  1P98 A;  4WJO A;  1M94 A;  1GNU A;  2JF5 A;  3SO6 A;  2MWN B;  3VH3 B;  3UZT A;  3U7D A;  4ILG B;  4AWJ A;  3VTU A;  2DZI A;  4HAV B;  2LKO A;  3JSV B;  5EFX A;  5LXH A;  4IAP A;  1KC7 A;  1WYW B;  3ZNH B;  1KOT A;  4IOY X;  3ODX A;  2HJ8 A;  5HE2 A;  2KHW B;  1WMH A;  3AJ4 A;  3ZNI D;  3KUZ A;  3RD2 A;  4IWP A;  2R2Q A;  3OJ3 A;  3PP2 A;  3L54 A;  2CY4 A;  2NBW B;  3ENB A;  2KUP A;  2KJR A;  2COC A;  3AU5 A;  2HTH B;  4FHK A;  4ASW C;  4OVV A;  3TO1 A;  1J19 A;  5C79 A;  2MBE A;  2D3G A;  4YON A;  2KTF A;  4ZDV A;  3X23 A;  2N9X A;  4IM0 A;  4BBK A;  5IAA C;  3N3K B;  1TJ6 A;  2QKL A;  3ZUN A;  3K9O B;  1P3Q U;  1WZ3 A;  2L00 B;  4IC7 B;  1E90 A;  3VTW A;  1WGU A;  2JUO A;  2MSE D;  3PRM B;  5C23 A;  2N7D A;  3V5W A;  1W1H A;  2C7H A;  3QWZ B;  2BF8 B;  3T06 A;  3RZW C;  4IFS A;  3BIN A;  3V62 A;  1IP9 A;  2RSG A;  4W9D A;  1ZVR A;  4JKA A;  3DVN V;  2DEN B;  1P9D U;  3VOQ A;  2B3A A;  5E6O A;  4JK9 A;  2KNB A;  2J59 M;  3KY9 A;  4FJV B;  3RYT A;  4TQ1 A;  4HAU B;  3ZIM A;  1ZC3 B;  5FR6 A;  2LRW A;  3OAN A;  2O2V B;  2IYB A;  2RD0 A;  2BKF A;  3ZVV A;  5FI1 A;  2FCS A;  4L6E A;  3SUZ A;  2C7N B;  2IO2 B;  2HRJ A;  2IO3 B;  4II2 B;  2O6V B;  3AXC A;  2R09 A;  2ADZ A;  4F1S A;  2VKI A;  2YRY A;  2M4N A;  4MH0 E;  1DYN A;  2KJH B;  4EUT A;  3B08 A;  4PQ0 A;  1BWN A;  5KCV A;  2KQS A;  4GZU A;  2P0D A;  2KO3 A;  1KZG A;  2KWU B;  5J2R A;  1I42 A;  5D3W A;  2OOB B;  2XEW A;  2WDT B;  1OTR B;  2HD5 B;  4ANU A;  2MP2 A;  4AOF A;  3ZRF A;  1WVH A;  5GOW B;  2IZV B;  4JGH B;  1VCB A;  2ZPN A;  1J0G A;  2UZS A;  4BOZ B;  3D32 A;  5LON B;  3PV1 A;  4JQW C;  3ULC A;  3PVW A;  1E7U A;  1EGX A;  4A3O A;  4FBJ B;  2N0Y A;  4AUQ C;  2KX3 A;  2LYD A;  4WAA A;  1UBI A;  3DQV A;  3L13 A;  1WXA A;  2KDI A;  3QCA A;  4EJN A;  2G4D B;  2BPS A;  1Y19 B;  1WGG A;  5AEK B;  4CHM A;  4DDG D;  3RT3 B;  3APC A;  1WXV A;  2W9N A;  1FGZ A;  2IBI B;  3QJZ A;  4JL9 A;  1UEF A;  1LW3 A;  2KFJ A;  2COA A;  4GXB A;  1V5U A;  2J0J A;  4KHA A;  2N1W A;  2PE6 B;  3DBS A;  3CXB B;  3VH4 B;  4Z2N A;  3QBV B;  4EZK A;  4F8C B;  3OAW A;  1FOE A;  1V5O A;  4GU2 A;  3I3T B;  3V6E B;  1VBH A;  4FAD A;  2Z0D B;  2ASQ A;  3L10 B;  3A8P A;  2AL3 A;  4JKF A;  2BYE A;  1I7A A;  3FM8 C;  5KHO A;  2C9W B;  1LB1 A;  1TQZ A;  3SD5 A;  5IJM A;  2KDF B;  1JDE A;  1ZKH A;  4PS7 A;  2CU1 A;  4KZC A;  2COF A;  2LXA A;  2GBR A;  1DIK A;  4K17 A;  1XKE A;  3ML8 A;  2LVQ A;  2COD A;  2DFK A;  3LJU X;  1KJT A;  1YIW A;  1DDM A;  1KBL A;  3ZDT A;  2Z0P A;  2I5F A;  1NVL A;  4H8S A;  1WRD B;  4KIK A;  1MPH A;  2MRP A;  3HQC A;  4CO7 A;  1UD7 A;  3P6A A;  1HE8 A;  2JWZ A;  3KYC D;  3ZRC A;  1OGW A;  4MGK E;  2JP2 A;  3VAW A;  1TXD A;  1M7E A;  1EF1 A;  3ZTD A;  3PVU A;  2XQN M;  3A98 B;  3KRX A;  4A6H A;  1P1A A;  4M8M A;  4AJY B;  3P2B A;  1WJ4 A;  4RMA A;  4OVU A;  3B0A A;  4GPT B;  3VQI A;  1YQB A;  2L2I A;  3A9K A;  4FA6 A;  1V5M A;  4A5K A;  1V89 A;  5HKH A;  2M1M A;  4EKU A;  5D7G A;  3MDB C;  4DBG A;  1RRP B;  5D3Y A;  5JHG A;  2CB8 A;  4WWO A;  4NPN A;  1WR1 A;  2YSZ A;  3AUL A;  3QQ8 B;  1JRU A;  2KAN A;  2DN6 A;  1WGR A;  4FHJ A;  3DBR I;  4KHO A;  4FJY A;  2LVP A;  4MGI E;  4W9G A;  4PS3 A;  4DDI D;  1I35 A;  1TTN A;  1WX9 A;  2I5C A;  4Y94 A;  2DLW A;  2IY0 B;  1ZM0 A;  2G45 B;  2K8C A;  2WWZ A;  3VDZ A;  1WGQ A;  1Z2M A;  1MKE A;  2W2W A;  2RVB B;  2W2X D;  1XOD A;  2KC2 A;  3KZ1 A;  4A3P A;  2NBV B;  1ST7 A;  3E9O A;  2DZJ A;  3IG3 A;  3HM6 X;  1TZ1 A;  3PZD A;  3ONS A;  2J0K A;  3KYD D;  4HJK A;  4WQO B;  4NJ7 A;  2I1J A;  1U29 A;  2NVU I;  2MLB A;  1I2H A;  3JSV A;  4JKG B;  2YS3 A;  4D0N B;  2L05 A;  1TGZ B;  2GBM A;  1R4M I;  1KLV A;  2X18 A;  2V3S A;  2PJH A;  3D8D A;  1Y8R C;  3VUW A;  3T8M A;  3H7P B;  2RNR B;  5D3X A;  4KSL C;  2WYQ A;  3PG7 A;  2KTR B;  1UGM A;  5DI9 B;  1G6J A;  5KHQ A;  5HE0 A;  2N23 A;  3HK0 A;  1V80 A;  3UIP B;  3IVF A;  3OLM D;  3NSU A;  3ZVR A;  2JRH A;  5DPW A;  2HTH A;  2ELB A;  2ROZ B;  3PSC A;  3F0W A;  2DTC A;  1WF9 A;  3B1L X;  2IO1 B;  4WWN A;  1PQS A;  2DZK A;  2DA0 A;  2LGD A;  4ANV A;  4MSM B;  2AEH A;  3W1Y A;  2DYQ A;  4MDK E;  1K8R B;  1XD3 B;  4W9F A;  3D8E A;  4KVG B;  3APD A;  2G35 A;  3N30 A;  4FN2 A;  1FGY A;  3PRZ A;  4W9I A;  5JP4 A;  1E8Y A;  2LOZ A;  2M0X A;  4ICU A;  3H9D A;  1EO6 A;  1UEL A;  3PEG A;  5EDS A;  2L8J A;  5E6P A;  4AJW A;  3M63 B;  2ZZP B;  2NMB A;  3RCZ A;  1P0R A;  3BY4 B;  3SYX A;  3AU4 A;  3P7Z A;  4HB3 B;  2IY1 B;  2VRR B;  2L0F A;  3PS6 A;  4W9L A;  5CLQ B;  4HVB A;  3U30 A;  4G0N B;  1DDW A;  1NU2 A;  1QQG A;  3ENE A;  4LDT D;  5DPS A;  2WX1 A;  2D10 A;  1WJM A;  2K25 A;  1V81 A;  2LOX A;  4KAX B;  2L7R A;  2C5L C;  1IRS A;  1R4N I;  5CHV C;  2CHW A;  2MCN B;  2O2V A;  3RZF A;  1WFY A;  2LAS A;  2LVO A;  5DHA B;  4ZRJ A;  2CY5 A;  4BKG A;  1GUA B;  4GDL B;  4MM3 A;  1H4R A;  2DYO A;  1RRB A;  2O6V A;  1U5E A;  5E6N A;  2V1Y A;  2JZZ A;  5L83 A;  4F7U P;  2FNJ B;  1AQC A;  2BYV E;  4BVU C;  3FLV A;  3JW0 X;  1BTN A;  3DVG Y;  3MHS D;  1WE7 A;  1NTV A;  3CSF A;  2D9Z A;  2K00 A;  2KFK B;  2Y5B B;  1SGH A;  1NI2 A;  3NHE B;  4E3C A;  3TVV A;  4NJ6 A;  1A5R A;  2LXC A;  2EMS A;  3Q3F A;  4ILJ A;  1PMS A;  2KXJ A;  2D9V A;  1GJZ A;  2BWF A;  3DPD A;  4HDQ A;  1NTY A;  5J17 A;  5CHW A;  3DCG A;  5D94 A;  4ICV A;  2NBU A;  3R7Q A;  5IA7 A;  4NY0 A;  2LZ6 A;  3L17 A;  2LG1 A;  1ZSQ A;  3NOB A;  3KUD B;  1GGO A;  2FDQ A;  1U5F A;  3A9J B;  5JHA A;  1EF5 A;  1E8W A;  2D2Q A;  2P0H A;  1V2Y A;  5JZE B;  1Q5W B;  4W9H A;  3IFW B;  3R66 C;  1NTI A;  2KWC A;  2D9Y A;  4PS8 A;  2C7M B;  3V61 A;  2GJY A;  3V6C B;  3D8F A;  1YD8 U;  5C5B B;  2DHJ A;  2ZEQ A;  4E71 A;  4DXA B;  4HAY B;  3NS8 A;  2KMC A;  4WJQ A;  4C0A A;  4DX9 0;  3RCP A;  4IWO A;  5CTR C;  1UPR A;  3V60 A;  1E7V A;  4HAT B;  2JVC A;  2I1K A;  4FUL A;  3CIK A;  3WIM A;  1Q1O A;  2KLG A;  2LI5 A;  2JRI B;  1OQY A;  1WR6 E;  3KH0 A;  2K6Q A;  4HCP B;  4MGZ E;  2DIK A;  5DIF B;  3EEC A;  4HLE A;  2FCQ A;  2QHO A;  3ECI A;  4NNJ B;  1XD4 A;  1WGH A;  1UZX B;  4IM2 A;  4HB0 B;  4ILH A;  1RFA A;  3KUC B;  2P8V A;  2DX5 B;  2DYM A;  2IYD B;  1FAO A;  4EOY A;  1Y5O A;  2L3Z A;  4BKT A;  3BJI A;  2CR5 A;  4XX5 A;  2OJR A;  1SIF A;  1UNR A;  3KW5 B;  3QAQ A;  3M3J A;  1H10 A;  2D9X A;  4GIV A;  4DK5 A;  3PRE A;  3MJW A;  1TBE A;  4IM3 A;  2ZVN A;  2DHI A;  5KQ4 A;  3TCA A;  4KZ0 A;  4NQL B;  5J3Y A;  3L0W B;  4MGY E;  3PT2 B;  5G55 A;  1HB8 A;  2LWP A;  1E8Z A;  4HAW B;  1Z87 A;  4G11 A;  1D3Z A;  3M62 B;  3JYU A;  4ZYN A;  1XCG A;  1WM2 A;  2KVR A;  2ZCB A;  1OMW A;  2D11 A;  1WXM A;  1K5D B;  1VD2 A;  2R82 A;  3A1Q B;  2ZNV C;  1U4A A;  4MJS B;  2DYN A;  4A6F B;  2Y7B A;  1FXT B;  1LFD A;  4KSK C;  2XBB C;  1K5G B;  2KC1 A;  1WM3 A;  4DWF A;  2YVC A;  3WAO A;  2FJL A;  2NZ8 B;  3W1S C;  4DX8 A;  3SHQ A;  2O6V D;  4NAW B;  5LLI A;  2M14 A;  1MIZ B;  3FEH A;  3UGB B;  1P5T A;  2C60 A;  4EFO A;  4WSF A;  4MSQ B;  2KDB A;  2IFS A;  4KDL B;  1X1M A;  2FCM A;  2BYF A;  1X11 A;  3S2A A;  1QZE A;  4IUM B;  1YX6 B;  3A4S C;  3F5R A;  3R7R A;  3TW1 A;  2KLC A;  2Z0E B;  1KZ7 A;  4W9J A;  3QX1 A;  2L76 A;  2GBK A;  1XR0 B;  2FUH B;  3KRW A;  1V88 A;  2K39 A;  1DRO A;  5HE1 A;  3QWM A;  2MWS B;  4JKG A;  2ELA A;  2DAJ A;  4GMX B;  4DHZ E;  1WIA A;  3SDL C;  4Z2M B;  4LJP B;  2MDX A;  3E9P A;  2M8S A;  2K1F A;  1LQB A;  4HB2 B;  2N4F A;  5J3Q A;  2RR9 A;  3H7P A;  4EMO A;  2DHZ A;  2KTR A;  4F7Z A;  4HAX B;  1WX8 A;  3TJP A;  1OEY J;  2KZR A;  2LD9 A;  3R3M A;  3UQA A;  2LUL A;  2EKE C;  1IYF A;  3PPA A;  3ML4 A;  3Q3J A;  3GYP A;  1WGD A;  5DHF B;  3TL5 A;  5DPT A;  1H8C A;  5CHF A;  1J8C A;  5TR5 A;  4K1R B;  3N32 A;  5J3T A;  1ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...