4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
b'PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
1R4NI 3IBEA 1KOTA 2GS0A 3QK0A 3DVNU 2R09A 4ZYNA 4JLCA 5D3XA 1X1GA 3V61A 3HQCA 1WE7A 2M4NA 3CF6E 4HCNB 2BF8B 3DBLI 5JHHA 2KJ6A 3FP5A 1J0WA 3VXWA 2LKOA 2K1FA 2FCSA 3L17A 1WYWB 1DDWA 3V5WA 2DA0A 2WDTB 2CKHB 3B08A 3DVGY 1J8CA 1DYNA 1GNUA 2O2VB 2DZMA 2J0JA 3KVFB 1EF5A 4IM3A 1L2NA 3H9DA 1QC6A 4HCPB 4HPLB 1I7AA 2DZKA 1WY8A 2HJ8A 2G35A 2IY1B 3A1QA 2YF0A 1W1HA 2MSED 2C7MB 4HAVB 1ZKHA 1XD4A 3T9LA 1ST7A 5JP4A 4CO7A 5E6NA 2KDBA 2N23A 1IYFA 2ZCCA 3GOEA 2D11A 3KY9A 2DAFA 4IFSA 1I35A 1WXSA 3ZVRA 4EEWA 1WGYA 1A5RA 4W9JA 1S3SG 3QHTA 1YQBA 2DYQA 5DI9B 1OQYA 3U30A 2Y5BB 2KANA 2VKIA 2QKLA 4WQOB 2DFKA 2JXXA 2NBWB 3M62B 4HAUB 4M8NA 5EDSA 2KLCA 1V2YA 3QARA 4NY0A 1LXDA 2MFQA 5IJMA 2PE9A 4K7UA 1ZC3B 3ODWA 2ZJDA 2CHZA 3MDBC 1V5PA 2MBEA 2XEWA 2R2OA 4MGZE 5CLQB 1WX8A 3QC8B 5AZFA 1AARA 4MJSB 1FB8A 2COFA 4G0NB 1P98A 1DROA 2CY4A 1WJ1A 2K8HA 2QKMA 2MX2A 4XZ4A 3PRPB 5TR5A 2FIDA 3A9JB 4DDID 2UWQA 2FDQA 4E74A 3H1UA 1YX5B 2ADZA 3FM8C 5LXIB 1U4AA 1HE8A 3HM6X 3KW5B 2K2JA 2G3QB 1XX0A 4BKGA 3QAQA 3ZRCA 3ZO5B 4CHJA 4RMAA 2C9WB 4WJPA 5EFXA 3P7ZA 1U2BA 4BOSC 4K2PA 2ZEQA 4K7SA 3P2BA 1VD2A 3W1SA 4E71A 1WRDB 4BKSA 1EF1A 1X1FA 2HD5B 4A6KA 4GDKB 3H7SA 2LOZA 3DPDA 2D4QA 2P8VA 3UZTA 2GBNA 2GJYA 4M8MA 2J7QB 1UPQA 1WM2A 2O6VB 3GYPA 2D9VA 4NPNA 3ZNHB 5LXHA 3ML9A 3PLVA 4DHZE 3A1QB 5DPSA 2GBJA 1V5MA 4M0WB 4PS7A 1UD7A 3APFA 3T8MA 2BYFA 2LASA 1EVHA 1WVHA 4WAAA 1BT0A 1QZEA 3WANA 4Z2MB 4EJNA 2D9WA 1LQBA 3M3JA 2AEHA 2UYZB 2ROVA 3QJZA 2FCMA 2FNJB 2R0DA 1V81A 5C16A 1WI0A 4C0AA 1WJ6A 2CRFA 1WH3A 3LJUX 2DKQA 1SGHA 2DHKA 4DBGA 1J19A 3PSCA 1U29A 5DPRA 5L81A 2NPTA 2KNBA 3CSTA 3D32A 2ZVNA 4MEMA 1UNQA 5DPWA 4IC7B 1GG3A 2JT4B 3VUYA 1BTKA 2MLBA 5LOPB 3CIKA 2NR2A 2KJRA 2OJRA 1WF9A 3JSVB 3ALBA 2R2QA 2KDFB 3ECIA 2W2XD 3DCGA 4LDTB 4Y94A 4IWOA 5GMVA 1IP9A 5JHAA 4K1RB 3TIXA 4GIVA 2A5UA 5DPTA 3CXBB 3HW2B 4KZ0A 2O6VD 4NAWB 1E8XA 1UBQA 4LCDE 2AL3A 4IW0A 1Y5OA 2DHJA 2WX0A 3S2AA 4KHAA 2CHWA 2RUKB 4DWFA 3JVZX 2NBUA 5G2NA 4WWPA 3PREA 2OOBB 4HK2A 4MGKE 3RCZA 2MWSB 2LULA 1AWEA 1XT9B 5CX3A 3PP2A 2JRHA 1NVLA 4ICVA 4GU2A 4A3PA 3AXCA 1RRBA 1FGYA 3TO1A 5J3QA 1YIWA 1WM3A 4MGYE 1DDMA 4A20A 3HK0A 2KMCA 5DHAB 2KMAA 3RULA 4IUMB 1P6SA 3KSYA 3APDA 1WGRA 1OEYA 2J0MA 4IM0A 4N9F4 3NSUA 4NJ6A 4ZRJA 2I5CA 4E3CA 2J0KA 2LYDA 4ANXA 2MRPA 1EO6A 2C7HA 3SO6A 4K17A 3L10B 3PG7A 2UVMA 1NTIA 3F5RA 2NBVB 2CR5A 2KFKB 1U5DA 3A8QA 4D0NB 3PRZA 4LJOB 3PHWB 1H8CA 5DHFB 1GJZA 3SDLC 1H4RA 3A4SC 3GYOA 2JPHA 2V1YA 2HTHA 2D9YA 3OLMD 4XX5A 1TTNA 3L08A 3IG3A 2DHZA 4HLEA 4HXDA 1KI1B 2GBKA 3UQBA 3VHTC 2W2XC 4HB4B 3PLUA 1RRPB 3F0WA 4FHJA 2G45B 1V89A 2YT1A 4URKA 4BOZB 4HAXB 4FN2A 3RUIB 2Y7BA 1EAZA 2VRWB 2CY5A 4MM3A 3QQ8B 4II2B 1C3TA 4A5KA 1WGUA 3L13A 3VH3B 4CHMA 2MA9B 5LONB 2GCJA 5JHBA 4NSWA 3PSEB 3VTWA 4NJ7A 5JH5C 4WSFA 3DVNV 2L2IA 3NY5A 4OVUA 2DYOA 1FOEA 2LD9A 5D94A 1VCBA 1Z2MA 4A6HA 5AZGA 2L1CA 4WJ7A 1OGWA 3LDZE 1AQCA 1Q5WB 2ZZPB 2JF5A 5CLLB 3CMMB 2MQJA 1GC6A 2N7DA 4NQLB 2LZ6A 4GDLB 3KYDD 1ISNA 1UBIA 2C5LC 2XK5A 3L0WB 3RCPA 4F8CB 5D27A 1V5TA 4GXBA 2KDEB 2LOXA 3T06A 3SUZA 2DYBA 2LUEA 4RM9A 2IYDB 1J0GA 4W9IA 2D9ZA 3SV1A 3R7RA 5BO4B 3HM3A 1WZ0A 5J3TA 3APCA 3TMPB 1UNRA 2EKEC 1WXVA 4DK5A 1KZGA 2PE6B 1S1QB 4FJYA 2N1WA 5CTRC 4BFRA 1M7RA 1IPGA 2WYQA 3PEGA 4BBKA 4B9KA 5E6OA 2NMBA 2DX1A 2D10A 4KV2A 3QBVB 3OJ4B 1OEYJ 4HAWB 1RLFA 5L83A 1FHWA 1WGDA 2WX1A 1V61A 4GMXB 1ZW7A 4NNJB 2BKRB 2MBHA 2BPSA 2KOXA 3SU8X 1KM7A 2KN5A 3MHSD 3ZIMA 2Z59B 1WJ4A 2ABDA 2KTRA 1JRUA 1WMHA 2Z0PA 2DLWA 2GBRA 3WIMA 4YONA 5IA7A 4JGHB 3I3TB 3EPYA 3O65B 3DBRI 3W1SC 4PQ0A 2JVCA 1E7UA 2LRWA 3U7DA 2HTHB 2LJ5A 4MT7A 3M1IB 3MTNB 3DOWA 4B6HA 2AL6A 1V5OA 2LGYA 1XCGA 2ZNVB 5CHVC 3X23A 1MAIA 2LXCA 3TL5A 4ANVA 5G55A 3ZW3A 4MGIE 3WAMA 3N32A 4HAZB 1WGQA 3DXCA 3DQVA 4B95A 4K7WA 1I2HA 3VVWB 2DTCA 4FADA 2YSZA 4MSQB 1U27A 3ZTDA 4OVVA 3UGBB 3V6CB 2J59M 1WJMA 3ODOA 3HHMA 2KGXB 1WIAA 3LJ3A 4HATB 1ACAA 1H10A 2JWZA 5DH9B 3WAOA 3D8EA 1WJUA 3SYXA 4FBJB 3JYUA 4KZCA 3PHXB 2RLOA 4XWXA 1UGMA 4WJOA 3L16A 2XK5B 3WYFB 4GGQA 1P9DU 5HE3A 1EGXA 3TJPA 2I5FA 3TFMA 5C6RA 2IFSA 4IAPA 2K6QA 5JHGA 1WXMA 4ICUA 2DX5A 1C1YB 2HRJA 4ZRKA 2KJHB 4LJPB 4EMOA 4DHJB 1LM8B 3B1LX 2L3ZA 3VTVA 1MKEA 4EZJA 2GOWA 2MDXA 2IY0B 4EUTA 2DYMA 3HIZA 2ZPNA 5HE2A 4I6LB 2IO2B 3PTFC 3SD5A 1HB6A 3A4RA 1XQQA 4NQKE 2MBOA 2Y8GA 3SHQA 2GMIC 2FIFA 1X11A 4EOYA 4I6PA 4HWIB 3UF8A 2COPA 5D3YA 4IG7B 3QX1A 4ZRIA 1E8WA 1W1GA 1E90A 3MPXA 2NS5A 3PZDA 4DX90 2V3SA 1WFYA 2KVRA 2LVPA 4KIKA 2RQ1A 1KJTA 4EZLA 1WMHB 3N3KB 3MJWA 4BBNF 3ODXA 2NZ8B 4F7HA 5C1ZA 4HAYB 1R4MI 2ROZB 1OQNA 3EC8A 3PPAA 1SIFA 1MK7B 3ZNGC 3PRMB 3V62A 2YS3A 3VQIA 5HE1A 3ULCA 3JW0X 2FCQA 3A9KA 2MBQA 3VOQA 2YRYA 4KHBB 4IWPA 4DHJD 2KDIA 2KXJA 2JZ3B 1WZ3A 4WJNA 1NBFC 2KTFA 1DBHA 1DDVA 1TGZB 2CODA 2KZRA 3VTUA 2B3AA 3H7PA 3EECA 1ZC4B 5C79A 3FEHA 2M8SA 4ZDVA 4BVUC 4PYUA 3DBHI 1MIZB 3KUZA 1PFJA 2ZNVC 1NI2A 1UH6A 3QWMA 5HKHA 3SNHA 4GN1A 3IHPC 1WI1A 2A4ZA 4ASWC 3FSSA 4EKUA 3ZNZB 1B55A 4W9CA 3AULA 3RT3B 4HB3B 1NTYA 1V5UA 4GOCA 2EC1A 2CHXA 1PMSA 3VFKA 4ANWA 2YS5A 3ZLZA 2FJ9A 3L54A 2Z0EB 2DX5B 2RVBB 2LGXA 2KWVB 1OY2A 5DIFB 4BBNC 3A98B 5CHWA 2CB8A 4XC2A 2CQUA 2N1VA 4MDKE 5L95C 2MW5A 3TVVA 1WX7A 2KX3A 3M63B 3KZ1A 4DXAB 3K9OB 4MH0E 1LW3A 3DXEA 2N9PC 4KSKC 4TYZA 1RFAA 2O2VA 1TQZA 3BINA 4LDTD 2FUHB 5J2RA 2KQSA 2MCNB 4GSWA 2LVQA 5J3YA 5C5BA 1Y19B 3V6EB 2L7RA 4PNKA 2L00B 2BYVE 1P5TA 3A8PA 1M7EA 3H6NA 4KIKB 1P0RA 2KWCA 1GUAB 1P1AA 2MP2A 2HE7A 1G6JA 2V4LA 3V60A 2KD0A 2WWZA 4MK0A 5IAAC 4WWOA 2UZSA 2KCJA 3PV1A 3ZDMC 3OANA 1BAKA 2MBBB 4JIOU 2JRIB 3UQAA 2RSUA 2NPTB 4RM8A 1PLSA 2OQBA 2KC2A 3EHVA 3PS6A 3VUWA 2JY6A 4MELA 1HB8A 4BKSD 3TBLD 1X05A 2KHWB 1XR0B 1RAXA 2M17A 4PS8A 3KUCB 3QWZB 1V86A 2GBMA 2KQ7A 3H7PB 2CS4A 5AEKB 2GCLA 3AU4A 3O96A 3KYCD 4MSMB 3DXDA 4W9GA 3FLVA 3ML4A 2AYOB 4K81A 1Z5SB 4KHOA 3QIJA 2Z0DB 4TUUA 1X86A 1YX6B 3PGEA 2FJLA 2OTXA 4W9LA 3DBSA 2D9XA 3ML8A 2XBBC 1OMWA 2EMSA 1E7VA 3BY4B 4ANUA 2ELBA 2PZ1A 4EZKA 1L7YA 1K5DB 1WJNA 2LBBA 2BYEA 1IRSA 3KUDB 3PVLA 1MPHA 1MIXA 5D2MB 3KRWA 2BGFA 1T0YA 3IFWB 1LB1A 1KLVA 1BWNA 4GDKA 2Y8FA 1FXTB 2YT0A 5DCNA 5FI0A 3RYTA 4W9HA 3UIPB 2V76A 2O6VA 3R7QA 3ZUNA 1ZSQA 4EFOA 4AOFA 2KK8A 3IVFA 2C7NB 5C5BB 4Z2NA 5KQ4A 2NCNA 1P3RA 4DHZB 4YL8A 5JLJB 5D7GA 3QA8A 4FULA 4IM2A 3NHEB 3BJIA 2YLMA 3ZVVA 1V9JA 3ZRFA 2MP2B 3CSFA 2CAYA 4DDGD 5D3VA 2JZZA 4FLHA 1TBEA 3C0RB 5C23A 1M94A 2KO3A 4HDOA 2YVCA 2Z0QA 5KHQA 5J17A 3M95A 3WA0A 3ZTCA 4PYZA 4II3B 3NZUA 5CHFA 2PPHA 1XODA 4HVBA 1YJ1A 1HBKA 3JSVA 2G4DB 5GOWB 3R3MA 2LWPA 2IBIB 2IO3B 1TJ6A 1I42A 4HDQA 3ULBA 1CMXB 4TQ1A 4NAWA 4F7ZA 4H8SA 2RR9A 2L0TA 4KSLC 5JZEB 2REXA 2QHOA 2RGFA 2ZVOA 2W9NA 2NVUI 2K8CA 1Z87A 3R66C 3VAWA 1TZ1A 1V80A 1Q0WB 2KKCA 4W9KA 1QQGA 4FA6A 4HPMB 4HJKA 1UELA 2W2WA 2MWNB 4TQ0A 2M38A 4L6EA 2KFJA 2L05A 4F7GA 2COAA 3RD2A 4FJVB 3AJ4A 4BKTA 3PT2B 1U5GA 3D8FA 4K2OA 2N9XA 1U5EA 1MG8A 4G11A 3PVUA 1TXDA 4G50A 2KUPA 4F7UP 1Y8RC 2RD0A 3P6AA 4IOYX 2KC1A 4HB0B 1MK9B 3RZWC 3KRXA 1BTNA 2KFKA 2G4SA 2JP2A 4X57B 2KTRB 4DBBA 2L0FA 1WGHA 3QCAA 4I6NB 2I1KA 2LVOA 4CHKA 3ZNID 4HHVA 2P0DA 1E5WA 4JL9A 4P7IA 2L8JA 3K9PB 4B6WA 3OJ3A 1RJ2A 5FR6A 2WH5A 2X18A 2JUOA 3W1YA 2PJHA 2VRRB 5E6PA 3WALA 2XQNM 1SE9A 2BCJA 4TKNA 1E8ZA 1K8RB 2LI5A 3VIAA 1ZGUB 2BKFA 1WXAA 4F1SA 1W1DA 4HB2B 2C60A 2RPQA 2ZCBA 1Q67A 1WGGA 2L76A 4PS3A 2IZVB 1XD3B 1XKEA 2Q13A 1LFDA 2M0XA 4AJYB 1V49A 2ELAA 2N0YA 1YD8U 2K39A 2DKPA 5HE0A 3PVWA 3U8ZA 4CYEA 3ZKJC 1UZXB 2FAZA 2K00A 2KX0A 3NOBA 4G3XB 4WWNA 2MKRA 2CU1A 3AI5A 4FHKA 3ENEA 2LG1A 2DENB 2VSZA 3NZSA 4KAXB 4GDLA 4AP4C 2COCA 4A6FA 1WG7A 1SHCA 1WR1A 1NTVA 1F9JA 4MY6A 1ZM0A 4KDLB 2DZIA 2FCNA 2RSGA 4GZUA 5KQ1A 2E2XA 2ZPYA 3KH0A 2P0HA 3B0AA 2AWTA 2RNRB 2D2QA 3GZNI 4W9FA 4W9DA 2N7EA 1KZ7A 1N3HA 2IYBA 4IWQA 1NU2A 2H7EA 2DN6A 2EJ8A 4AUQC 1FAOA 2P0FA 1V88A 2DZJA 1E8YA 1GC7A 4A3OA 2LGDA 3AU5A 1WX9A 3D8DA 1U5FA 2M1MA 4GPTB 4DX8A 1V6EA 1FHOA 5KCVA 2N4FA 4GMVA 5LLIA 4KDIC 2YS1A 2IO0B 2N9EB 4TV3A 3TCAA 2IO1B 2EMTA 3DVGX 4KVGB 4WVFB 1EUVB 3DDCB 3UIOB 2DAJA 1ZVRA 2KWUB 2DHIA 3RZFA 3EFUA 3VDZA 4WJQA 5D6JB 2KLGA 1X1MA 2K6DB 3N30A 3ZDTA 4JQWC 3A9KB 3VH4B 4J6IA 2K8BA 3N7CA 1PQSA 3Q3FA 2H7DA 2RGNB 4AJWA 3UINB 2D07B 1OTRB 2BWES 2UZRA 4MJSA 2D3GA 1FGZA 1UEFA 3G9WA 4FJZA 5AZHA 1UPRA 4W9EA 1Q1OA 1NDDA 3OAWA 1FHXA 1P3QU 3X0WA 4GB9A 2LRUA 3A33B 5J18A 2Z0OA 2BWFA 3NS8A 2K25A 3A9JA 3ONSA 1K5GB 5FI1A 3TW1A 5KHOA 2DYNA 3WAPA 4A6FB 3Q3JA 2LXAA 1WE6A 2I1JA 3VUXA 1D3ZA 2M14A 4AWJA 2K2UA 2ASQA 1WR6E 2PEAA 1UNPA 5D3WA
chains in the Genus database with same CATH superfamily
3Q8BA 1D5XC 2G1EA 1R4NI 1FIQA 3IBEA 1TYGB 1KOTA 2GS0A 3QK0A 2W3RA 3DVNU 2R09A 4ZYNA 4JLCA 1JMLA 5D3XA 1X1GA 3V61A 4QJ3B 3DBHB 3HQCA 1WE7A 2M4NA 1VZ6A 2K22A 1HXYD 3CF6E 4HCNB 2BF8B 3DBLI 5JHHA 2KJ6A 3FP5A 2H89B 4OZCA 1J0WA 3VXWA 2LKOA 2K1FA 2FCSA 3L17A 1WYWB 1DDWA 3V5WA 3E9OA 2DA0A 2WDTB 2CKHB 4WAFA 3B08A 3DVGY 1J8CA 1DYNA 1GNUA 4P16A 2O2VB 2DZMA 3IT6B 1TKYA 2J0JA 4P1CC 3KVFB 1EF5A 2MEKA 4IM3A 1L2NA 3H9DA 3KWVA 1QC6A 4HCPB 4HPLB 1I7AA 2DZKA 1HTQA 1WY8A 2HJ8A 2G35A 2IY1B 3A1QA 1PGXA 5H92C 2YF0A 1W1HA 4M0WA 2MSED 3UI3A 2C7MB 4HAVB 1ZKHA 3MC8A 1XD4A 2GRIA 3T9LA 4YSXB 1ST7A 1C76A 5JP4A 4CO7A 5E6NA 1MJDA 2K5PA 4JKAA 2KDBA 3FAHA 2PW9A 2N23A 1IYFA 2ZCCA 3Q8AA 4JWSC 2WQYB 2D11A 3KY9A 2DAFA 3GOEA 4IFSA 1I35A 1SB3C 1WXSA 3ZVRA 2BQQA 1CZPA 1WGYA 4EEWA 2QMTA 1MVKA 1A5RA 4W9JA 1S3SG 3QHTA 1YQBA 1FFVA 2DYQA 5DI9B 3DCXA 1OQYA 2KMMA 2Y5BB 3U30A 2KANA 1N5WA 4NJCA 2VKIA 1VBHA 2QKLA 1CK1A 4WQOB 2DFKA 2JXXA 2NBWB 3M62B 2L52A 4HAUB 4M8NA 5EDSA 1EU4A 4B0EA 2KLCA 3NS1A 1V2YA 3QARA 4NY0A 1LXDA 2MFQA 3TUOA 5IJMA 2PE9A 4K7UA 1ZC3B 3ODWA 2ZJDA 2X0SA 2CHZA 3MDBC 1V5PA 5LNK1 2MBEA 2XEWA 2R2OA 2INDC 4MGZE 5CLQB 1WX8A 3QC8B 5AZFA 4QJ4B 1AARA 4MJSB 4RF1A 1FB8A 3HSAA 2COFA 5I4DA 4G0NB 4S17A 3DHGC 1P98A 1DROA 2XNAC 5JXVA 2ON8A 4HSIA 5IN7A 2CY4A 4H2AA 1WJ1A 2K8HA 2QKMA 1UNSA 2MX2A 1SJHD 4XZ4A 2WP9B 2AX5A 2DWQA 3PRPB 5TR5A 4JK7A 2FIDA 3A9JB 3ZJVA 2PLPA 1FM0D 1F2RC 4DDID 2UWQA 2FDQA 4E74A 3H1UA 1YX5B 2ADZA 3R2IA 3RNCC 4GNKB 3FM8C 3Q3OC 5LXIB 1U4AA 1FNUA 1HE8A 2BS3B 3HM6X 3RN9C 4LNIA 3KW5B 2K2JA 2G3QB 1KLGD 2D3AA 1XX0A 4BKGA 3QAQA 3ZRCA 3ZO5B 4ITKA 3NZ3A 3ZXRA 3N1YC 4CHJA 1SE3A 4RMAA 2C9WB 2KT7A 1SJED 3BK1A 3OG5A 3ETRA 4WJPA 5EFXA 2N0SB 3P7ZA 1U2BA 4BOSC 1EU3A 4K2PA 3I63C 3LXFA 2ZEQA 4K7SA 3P2BA 4ZOHC 1VD2A 3W1SA 4E71A 1WRDB 4BKSA 1SF0A 2HTME 1EF1A 2KWDA 3MP9A 1X1FA 2HD5B 4A6KA 4GDKB 3H7SA 4JK9A 1E10A 1P7EA 1QT9A 2LOZA 1N63A 1L6UA 3DPDA 2D4QA 2P8VA 3UZTA 2GBNA 2V3NA 3P42A 3P1MA 2WXPA 2GJYA 4M8MA 2J7QB 1UPQA 1L0YB 4JE3B 1K53A 1WM2A 2O6VB 4OHJA 3GYPA 2D9VA 1KLUD 1I4PA 2OEDA 2NBVA 1QOBA 4NPNA 2UU7A 3ZNHB 3AV8A 5LG4B 3IT4B 1F2RI 5LXHA 3ML9A 2R82A 3PLVA 1PUTA 4DHZE 3A1QB 2QDFA 5DPSA 2GBJA 1V5MA 4REZA 4C7ZA 4M0WB 4PS7A 1UD7A 3AE6B 3APFA 3T8MA 2BYFA 2LASA 1EVHA 1WVHA 1TS5A 4WAAA 1BT0A 1QZEA 3WANA 4Z2MB 4EJNA 4JKFA 2D9WA 1LQBA 3M3JA 3BYTB 2AEHA 2UYZB 2ROVA 2WU5B 3QJZA 2FCMA 2V3PA 2FNJB 2R0DA 1V81A 5C16A 1WI0A 4C0AA 1WJ6A 2LHDA 2CRFA 1PFDA 2WXMA 1I4XA 1AN8A 1WH3A 3LJUX 2PMVA 1N6ZA 2DKQA 2V9HA 1SGHA 2DHKA 3BYYB 4DBGA 1J19A 3MC9A 3PSCA 4TSSA 1U29A 5DPRA 4L1RA 5L81A 2W82A 2NPTA 3P4PB 4QAYA 2KNBA 3CSTA 2Y5CA 2D3BA 1MG4A 3D32A 2ZVNA 4MEMA 1NENB 2M0AA 1UNQA 4C4VA 5DPWA 4IC7B 1GG3A 2JT4B 1BTKA 3VUYA 2MLBA 3Q14C 5HG2A 5LOPB 3CIKA 2NR2A 1TKEA 2KJRA 2OJRA 1WF9A 3JSVB 3ALBA 1JWAD 2R2QA 1D5ZC 2KDFB 1QOGA 3ECIA 1EWYC 2W2XD 3DCGA 4LDTB 4Y94A 2MJEA 3HUIA 4IWOA 5GMVA 3VRAB 5JHAA 1IP9A 4K1RB 3TIXA 4GIVA 2A5UA 3EFCA 5DPTA 3CXBB 1JRPA 4A6QA 3HVDA 5EE3A 3ZQ4A 3HW2B 4KZ0A 2O6VD 4NAWB 2CJOA 1E8XA 4LNKA 1UBQA 4LCDE 2AL3A 4IW0A 1Y5OA 2DHJA 2WX0A 3S2AA 1TJEA 4KHAA 2CHWA 4XDDA 2RUKB 4DWFA 2XN9C 3JVZX 2NBUA 5G2NA 2KQ4X 4WWPA 4PK1A 3PREA 2JQRB 3AE8B 3I9V1 3CWIA 1C4AA 2D5GA 2M19A 2OOBB 2N9LA 4HK2A 4MGKE 3RCZA 1V97A 2MWSB 2LULA 4LNFA 1AWEA 1XT9B 4NZLB 5CX3A 3PP2A 1NVID 2WGSA 2JRHA 3P4RB 1NVLA 4ICVA 4GU2A 4A3PA 3AXCA 1RRBA 2VH2A 1FGYA 3TO1A 1RFKA 1ET9A 5J3QA 1MI1A 1YIWA 1WM3A 1E6EB 4MGYE 1DDMA 4A20A 3HK0A 2KMCA 5DHAB 2KMAA 3RULA 4IUMB 1P6SA 3KSYA 1FPYA 3APDA 3I57A 2IGHA 1WGRA 5IOIA 1OEYA 3NVZA 2J0MA 4IM0A 2WHIA 1FO4A 4N9F4 3NSUA 4NJ6A 4ZRJA 2I5CA 1NYQA 3NG0A 3A58A 2QEJC 4E3CA 2J0KA 1E7PB 2LYDA 4ANXA 1L6VA 2MRPA 1FEHA 1EO6A 2ZKMX 3SO6A 2C7HA 4OW0A 4K17A 2Y3AA 3L10B 4BAXA 4ILGB 3PG7A 4HEA1 2ZW1A 1OQRA 3RPFC 1NI3A 3W2DA 2Z59A 2UVMA 1NTIA 2CJNA 3F5RA 4RGTA 2NBVB 3FKYA 2CR5A 2KFKB 1IGDA 1U5DA 3A8QA 4D0NB 4ACFA 4YWGG 3PRZA 4K3CA 4LJOB 1Q10A 3PHWB 1H8CA 5DHFB 1GJZA 4WURA 1VR9A 3SDLC 2WDQB 1C79A 1H4RA 3A4SC 3GYOA 2JPHA 3T3NA 2V1YA 2HTHA 2D9YA 3OLMD 4XX5A 1TTNA 3L08A 3AE1B 3IG3A 5BYRA 1B9RA 2DHZA 4HLEA 2FE8A 1KI1B 4HXDA 2GBKA 3UQBA 3VHTC 2W2XC 1MFWA 2K0PA 1N60A 2NTSA 4HB4B 3PLUA 1RRPB 3F0WA 4FHJA 2G45B 1V89A 2YT1A 3NVWA 1LO5D 4YSYB 2DNFA 2BW2A 4URKA 4BOZB 4HAXB 4FN2A 3RUIB 2LMCA 2Y7BA 3AE5B 1FNVA 1EAZA 2K9XA 4KX6B 5FR3A 3HVZA 2VRWB 2WXRA 2CY5A 4MM3A 3N20C 3QQ8B 1PGAA 4II2B 1JQ4A 4QXAB 1C3TA 2PTLA 4A5KA 1WGUA 3L13A 3VH3B 4CHMA 2MA9B 1MPEA 5LONB 2AQ2B 2JSVX 3AE9B 4O1NA 2GCJA 2RDGA 3SBTA 1XCTL 2N9KA 5JHBA 4NSWA 3PSEB 3VTWA 2LFIA 4NJ7A 5JH5C 3R8BA 1TY2A 4WSFA 3DVNV 1JCKB 1ZPSA 2L2IA 4XYCA 3AEEB 3NY5A 4OVUA 4K3BA 2DYOA 1WWTA 1FOEA 2LD9A 5D94A 2D3CA 1VCBA 1Z2MA 4A6HA 5AZGA 2L1CA 2JXTA 4WJ7A 1OGWA 3LDZE 1E9MA 5E6JA 1AQCA 1Q5WB 2ZZPB 2LUMA 2JF5A 5CLLB 3CMMB 2MQJA 1GC6A 1YJJA 2N7DA 4NQLB 2K8EA 1SBBB 2LZ6A 4GDLB 3KYDD 1ISNA 1UBIA 2C5LC 2XK5A 3L0WB 3RCPA 2H88B 4F8CB 5D27A 1V5TA 3V3XA 4DXGA 4GXBA 2KDEB 2LOXA 3T06A 3SUZA 2DYBA 2LUEA 4RM9A 2IYDB 1J0GA 4S0RA 4W9IA 2D9ZA 2KYWA 3SV1A 1VLBA 1Y56A 3R7RA 1T6BX 1QKZA 1ET6A 3RNFC 5BO4B 3HM3A 1WZ0A 4WWMA 5J3TA 2HJ1A 3APCA 3TMPB 4RF0A 1UNRA 2EKEC 5IO9A 1T3QA 1WXVA 4DK5A 1KZGA 2PE6B 1S1QB 4FJYA 4XDCA 2N1WA 5CTRC 4BFRA 3PO0A 1M7RA 1IPGA 2WYQA 1YN3A 3PEGA 2L83A 4BBKA 4B9KA 5E6OA 2NMBA 2DX1A 2D10A 3ZYYX 4KV2A 3QBVB 3OJ4B 1OEYJ 4HAWB 1RLFA 5I2SA 2E6XA 4A55A 5L83A 1FHWA 3GP7A 3Q3MC 1WGDA 2WX1A 1V61A 1ZXIA 4GMXB 1ZW7A 4ILHA 2VZKB 4L2YA 4HPPA 4ILJA 4NNJB 2BKRB 1ZDVA 2MBHA 4RFBA 2BPSA 2KOXA 3GS2A 3SU8X 3VRBB 1KM7A 1FD6A 2KN5A 3MHSD 3ZIMA 2Z59B 1WJ4A 2ABDA 1QILA 1RM6C 2KTRA 1JRUA 1WMHA 2Z0PA 5FK9C 4PT5A 2DLWA 2GBRA 3WIMA 4YONA 2WDRB 5IA7A 4JGHB 3GZNB 3I3TB 3EPYA 1DOYA 3O65B 3DBRI 1DIKA 3Q69A 3W1SC 4PQ0A 2JVCA 2WDVB 1E7UA 1V1OA 2LRWA 3U7DA 2HTHB 2LJ5A 3DWMA 1TS3A 1QF6A 4MT7A 3M1IB 3MTNB 4P6VF 3DOWA 4B6HA 2AL6A 1NEKB 1V5OA 2LGYA 1XCGA 3V05A 3DHIC 3DHHC 2ZNVB 5CHVC 3P4SB 3X23A 1MAIA 4KHBA 3Q6BA 2LXCA 3TL5A 4ANVA 2ACZB 5G55A 4JKEA 3ZW3A 3FILA 1P7FA 4OSNA 4TMAB 1VRAB 4MGIE 3WAMA 4C00A 5D3IB 3N32A 4HAZB 1WGQA 3DXCA 3DQVA 1J7CA 2QSDA 4B95A 4XGAB 1LGRA 4K7WA 1I2HA 3VVWB 2DTCA 4FADA 2YSZA 4MSQB 1YQ4B 2I38A 2WXOA 1U27A 4YXDB 3ZTDA 2RMMA 4AQ7A 4WH4A 4OVVA 1FNWA 3UGBB 3I5JC 1YMHE 3V6CB 2J59M 1WJMA 3ODOA 3HHMA 1I7HA 3W5VB 3HRDD 2KGXB 1WIAA 3LJ3A 4HATB 1ACAA 1H10A 2JWZA 2R2YA 5DH9B 3WAOA 1YOVB 2DLBA 3D8EA 4A9AA 1WJUA 3SYXA 4FBJB 3JYUA 1ZXHA 3AE2B 3AMZA 2FJUB 4KZCA 4NAMA 3PHXB 2RLOA 4XWXA 1UGMA 1XLOA 1ZYIA 4XWWA 1QQRA 4WJOA 2PVGC 3L16A 1I4HA 2XK5B 3WYFB 4GGQA 4AS1A 1P9DU 1CQVA 5IRSA 5HE3A 1EGXA 3BIID 3TJPA 4EE2A 2I5FA 3TFMA 5C6RA 4LLGM 2IFSA 4IAPA 2K6QA 1PDXA 5AUIA 5JHGA 1WXMA 1DOIA 4ICUA 1AW7A 2DX5A 1C1YB 2HRJA 4ZRKA 2KJHB 4LJPB 4EMOA 4DHJB 1UGJA 1ACCA 1LM8B 3B1LX 3B2GA 2L3ZA 1D4BA 3VTVA 1MKEA 4EZJA 3N9YC 2GOWA 2MDXA 2IY0B 4EUTA 1V1PA 2DYMA 3EA6A 3HIZA 2ZPNA 4UDUC 5HE2A 4I6LB 1DGJA 3SFEB 2IGDA 2IO2B 3KWLA 3PTFC 3SD5A 1HB6A 3A4RA 1XQQA 4NQKE 2X38A 2MBOA 2IDYA 2TSSA 2Y8GA 1KH0A 3BWUD 3SHQA 2GMIC 2FIFA 2IGGA 2LJIA 1L4DB 1X11A 4EOYA 4I6PA 3AE7B 2V4IB 4HWIB 2J53A 1XF5L 3UF8A 2COPA 5D3YA 4IG7B 1EWCA 3QX1A 1E0ZA 4ZRIA 1E8WA 2Z13A 1W1GA 4IOIE 1E90A 3RNBC 3MPXA 2NS5A 3SFDB 3PZDA 4DX90 2V3SA 3LYYA 1WFYA 1R4NB 2KVRA 2LVPA 4KIKA 4HKQA 1TS4A 2WXLA 3Q8CA 2RQ1A 1KJTA 4ZRPA 4EZLA 1WMHB 3N3KB 4DXFA 3MJWA 4BBNF 3ODXA 2NZ8B 4F7HA 3CIRB 4HAYB 5C1ZA 3ZGZA 1R4MI 2ROZB 3C8YA 1OQNA 2ONQA 3EC8A 1T77A 1F1HA 1K51A 3DBLB 2OHFA 4L1BA 3PPAA 2BVCA 4OT1A 1SIFA 4RNAA 1MK7B 4N58A 3RFZB 3ZNGC 3PRMB 1UWXA 5HFYA 2BS4B 3HIEA 1T0SC 2MJ3A 1BUIC 1XLPA 3V62A 2YS3A 4L23A 3VQIA 1MHXA 5HE1A 2LHEA 3B2FA 1QLBB 3U2SC 3ULCA 3JW0X 2FCQA 4IKGA 3A9KA 2MBQA 3VOQA 2YRYA 3U52E 4KHBB 4IWPA 4DHJD 1JWBD 1VBGA 2KDIA 2KXJA 3FILB 2JZ3B 4ARCA 4YSZB 4MACA 1XCQL 3PZ8A 5BYSA 1YNTE 1WZ3A 1KF6B 4WJNA 1K50A 1NBFC 2BTEA 4KKJA 4A90A 2INNE 2LGSA 5M4YB 2KTFA 1DBHA 1JW9D 1DDVA 2I2YA 1TGZB 2CODA 2KZRA 3VTUA 4FXCA 4JK8A 2B3AA 3H7PA 3RNEC 3EECA 1ZC4B 5C79A 3FEHA 3SEBA 2M8SA 1PYWD 4ZDVA 4BVUC 2WXNA 4PYUA 3DBHI 1MIZB 3E56A 3AH7A 3RI7C 1TIFA 3J9CA 3AEFB 3GB1A 3KUZA 1L0XB 1PFJA 2ZNVC 1NI2A 3IAM1 1UH6A 4N6EB 3QWMA 5HKHA 1JWMD 1WGKA 3SNHA 4GN1A 3IHPC 3LB8C 1WI1A 2A4ZA 3RNAC 4ASWC 3FSSA 4EKUA 3ZNZB 1B55A 4W9CA 3AULA 4R3DA 3NVVA 1WYGA 3RT3B 4HB3B 1NTYA 5C3JB 1V5UA 4GOCA 1MHHE 2KVZA 2EC1A 4RH6A 1HZ5A 2CHXA 1PMSA 3VFKA 4ANWA 3E9PA 2YS5A 3ZLZA 4ZHPA 2FJ9A 3L54A 1OFFA 4HJGE 2Z0EB 2DX5B 2RVBB 5IP4D 2LGXA 1GB4A 1A70A 1UUPA 5EE0A 2BB6A 2KWVB 1OY2A 3ABVB 5DIFB 1KFYB 4BBNC 3A98B 4ZYSA 4DIXA 5CHWA 4ZHOA 2CB8A 2WXHA 4XC2A 1SEBD 2CQUA 2WU2B 2N1VA 4MDKE 5L95C 2MW5A 3TVVA 1WX7A 2KX3A 3M63B 4Q2JA 4KGRA 3MC0B 3KZ1A 2J52A 4RCOA 4DXAB 3K9OB 1LW3A 3DXEA 2N9PC 4MH0E 3NJTA 4KSKC 4TYZA 1RFAA 2Z8LA 2O2VA 1TQZA 3BINA 1FRDA 3NVYA 4LDTD 2FUHB 5J2RA 2KQSA 2MCNB 4CQNA 4GSWA 2LVQA 4MT5A 5J3YA 2JZPA 5C5BA 1Y19B 4GOUA 3V6EB 2L7RA 5G5HA 4PNKA 1F52A 1FRRA 1WXQA 2L00B 2BYVE 1P5TA 3A8PA 1M7EA 3H6NA 4KIKB 1P0RA 2KWCA 1GUAB 1GPXA 1P1AA 3NWFA 3FC4A 1VZ8A 2MP2A 1SIJA 4KGSA 2HE7A 2EELA 4CSQA 1UWMA 1G6JA 3Q2AC 2V4LA 2MHJA 3V60A 1AWDA 2KD0A 2WWZA 4MK0A 5IAAC 4WWOA 2UZSA 2KCJA 4WQMA 3PV1A 3SR6A 2MH7A 3ZDMC 3OANA 4IDIA 1SE2A 4B0MA 3URYA 1BAKA 1IGCA 2MBBB 4JIOU 2JRIB 3UQAA 2RSUA 2NPTB 4RM8A 1NYRA 1PLSA 1TKGA 2WXIA 5I2MA 2OQBA 2KIEA 2KC2A 5G5GA 4C4VB 3EHVA 3PS6A 3VUWA 3BK2A 1FCCC 2JY6A 4MELA 1HB8A 4BKSD 1SXTA 3OWEB 1IUEA 2B76B 3TBLD 3BVGA 1VDVA 2QJLA 5GXGB 1X05A 2KHWB 1XR0B 1GB1A 2KIGA 5HI1A 1RAXA 2M17A 4PS8A 2PVOD 3KUCB 3NRZA 3QWZB 1V86A 4J3OD 4DQOC 2GBMA 2KQ7A 3H7PB 1C77A 4KKIA 3AE3B 3ENBA 1L5PA 2CS4A 5AEKB 2GCLA 4JKCA 3AU4A 3O96A 3KYCD 4MSMB 5BMGA 3DXDA 4W9GA 3FLVA 1AYFA 3ML4A 2KDMA 2AYOB 5EE1A 4K81A 1Z5SB 4KHOA 3QIJA 1KRHA 2Z0DB 4TUUA 1X86A 2INCC 1D5MC 1YX6B 4C7YA 3N1XC 3PGEA 1IBXA 2FJLA 2OTXA 4W9LA 1RYJA 3DBSA 2D9XA 3ML8A 2JYEA 3MFGA 2XBBC 1OMWA 2EMSA 4C56C 3EGRA 1E7VA 3BY4B 4ANUA 2ELBA 1EM7A 3ZXVA 2PZ1A 1WSPA 1STEA 4EZKA 3E66A 3WCQA 1L7YA 3MJ5A 1K5DB 1WJNA 2LBBA 2BYEA 4USAA 3E9SA 1IRSA 3KUDB 3PVLA 4BZAA 2BYTA 1MPHA 4YT0B 1MIXA 5D2MB 1TS2A 3KRWA 2BGFA 1T0YA 3IFWB 1LB1A 1CJEA 1KLVA 4JKBA 1BWNA 1JALA 2Y8FA 1FXTB 1GAQB 4GDKA 1FCLA 2YT0A 2WLBA 1N61A 2PKOA 1XEEA 5DCNA 5FI0A 3RYTA 4W9HA 3UIPB 2V76A 2DBYA 2RDBC 1F77A 2O6VA 3U12A 3R7QA 3ZUNA 1ZSQA 4EFOA 1M4VA 5TSSA 2L1AA 4AOFA 2KK8A 1MI0A 3IVFA 1KTKA 4LNNA 2C7NB 2BT6A 5C5BB 4Z2NA 5KQ4A 3PZ7A 4HRSA 3Q8FA 2NCNA 1P3RA 2LEKA 2BB5A 4DHZB 4KGTA 4YL8A 3TEXA 3P63A 5JLJB 5D7GA 2WXQA 3QA8A 4FULA 4IM2A 2OJWA 1ZUD2 3NHEB 3BJIA 1V8CA 2YLMA 3ZVVA 4US8A 1ZE3D 4C80A 5BYQA 3NWDA 1V9JA 3ZRFA 2QILA 2MP2B 3CSFA 2J4XA 2CAYA 1HA5A 4DDGD 3W9CB 5D3VA 2JZZA 4FLHA 1TBEA 3C0RB 2Z14A 2IPKD 2WS3B 5C23A 1M94A 2KO3A 4HDOA 2YVCA 2Z0QA 5KHQA 1ZDXA 3AEDB 1D6EC 5J17A 4MM3B 3M95A 3WA0A 3ZTCA 4PYZA 4II3B 4MH8A 3NZUA 5CHFA 2PPHA 1XODA 5AUKA 5MPOA 2Z4DA 1C9FA 4HVBA 1K52A 5EE9A 1YJ1A 2ZW0A 1HBKA 1SSNA 3JSVA 2G4DB 3IAS1 1DOXA 3KLSX 5GOWB 2AQ1B 1C78A 3R3MA 2LWPA 3RMKC 2IBIB 2KR0A 2IO3B 1TJ6A 2VZKD 1I42A 4HDQA 2WXKA 1FMAD 2J42A 3ULBA 1CMXB 4TQ1A 4NAWA 2AQ3B 4OZBA 4F7ZA 3P4QB 2RRFA 3VR9B 2K3UA 3O13A 4H8SA 3B9JA 3IXSA 3TEWA 1YN5A 2RR9A 1YQ3B 2L0TA 1SE4A 4KSLC 4OZAA 5FKAC 5JZEB 2REXA 5IKCM 2NTTA 2QHOA 3W5UB 2RGFA 2GUMA 3KQ4A 2X8XX 2ZVOA 4JKDA 1PGBA 2W9NA 2NVUI 2WXGA 2K8CA 1IBXB 1KBLA 1Z87A 3R66C 3VAWA 1TZ1A 1V80A 1Q0WB 1ZOYB 2KKCA 4W9KA 1QQGA 4FA6A 4HPMB 4JWUC 4HJKA 2PIAA 2EKIA 1UELA 2W2WA 1VJKA 2MWNB 4TQ0A 2M38A 2INPE 4L6EA 2KFJA 2L05A 4F7GA 2COAA 3RD2A 1T5XD 2SAKA 4FJVB 3AJ4A 4BKTA 3PT2B 1U5GA 3D8FA 4K2OA 2N9XA 4YTMB 1U5EA 2Q5WD 1JWSD 1MG8A 4G11A 3GE3C 3PVUA 1TXDA 3EUB2 4G50A 2KUPA 4F7UP 1FXAA 2KN4A 1Y8RC 2QC8A 2RD0A 3P6AA 2WNMA 3BVZA 4IOYX 2KC1A 4HB0B 2KUQA 1MK9B 3RZWC 3KRXA 4RGNA 1ROEA 3GE8C 1BTNA 5D3DA 2KFKA 2G4SA 2JP2A 4X57B 3H8HA 2KTRB 4DBBA 2ICIA 2L0FA 4ZRQA 1L0VB 1WGHA 3QCAA 4I6NB 4HKZE 2I1KA 2FUG1 2LVOA 4CHKA 3AE4B 3ZNID 4HHVA 2P0DA 2RDHA 1E5WA 4JL9A 4P7IA 2L8JA 2R61A 1J7BA 3K9PB 4B6WA 1JDEA 3OJ3A 3AM9A 4M02A 1ENFA 2JWUA 1R7SA 1RJ2A 1C4CA 1XLNA 2E3TA 2N7JA 2WH5A 2MJDA 2X18A 2JUOA 5FR6A 2NMQA 3W1YA 4M00A 5HHDG 4YTNB 2PJHA 1C4PA 4WIPA 2VRRB 5E6PA 3WALA 2XQNM 1SE9A 2BCJA 2GI9A 4TKNA 1HQRD 1E8ZA 1L4ZB 1K8RB 2IJ0A 3Q3NC 2LI5A 3VIAA 1ZGUB 2BKFA 1WXAA 4F1SA 1JROA 1W1DA 2V0GA 4HB2B 2C60A 2RPQA 3TEYA 2ZCBA 1Q67A 2W54A 1WGGA 3AN1A 2L76A 4PS3A 2IZVB 1XD3B 3ZJTA 1XKEA 3BVMA 2Q13A 4JKGA 1LFDA 2M0XA 4AJYB 3R2TA 4RGMA 1V49A 2ELAA 2DIKA 3DBRB 2N0YA 4A8XC 1YD8U 2K39A 5C2TB 2DKPA 1UF0A 3TEZA 5HE0A 3PVWA 3U8ZA 4CYEA 3ZKJC 1RWSA 1UZXB 2FAZA 3DWGC 2K00A 2K49A 2KX0A 2G9HD 4LNOA 3NOBA 4G3XB 4WWNA 3AECB 2MKRA 2CU1A 3AI5A 4FHKA 3ENEA 2LG1A 2DENB 2VSZA 3NZSA 4KAXB 2QCZA 4US9A 1HZ6A 4GDLA 4AP4C 2COCA 2BBCA 5BMIA 4A6FA 4XE0A 1WG7A 1SHCA 1WR1A 1ESFA 4XWTA 1NTVA 1F9JA 3N1ZC 1WRIA 4ARIA 3T3OA 4MY6A 1ZM0A 3AEGB 4KDLB 2DZIA 2FCNA 3SBGA 2YEPB 2RSGA 4GZUA 5KQ1A 2E2XA 2ZPYA 3KH0A 5JVLA 2P0HA 4D6WA 3B0AA 1I4GA 3U7ZA 2AWTA 2RNRB 2D2QA 3GZNI 1T0QC 3L4PA 1V1PB 4W9FA 3TSSA 2RPVA 4W9DA 4QJ5B 1DYQA 2N7EA 4JX1C 1TT5B 1KZ7A 3C19A 1B1ZA 1N3HA 4OVZA 2IYBA 5BMHA 4IWQA 1HEZE 1NU2A 3NWAA 2H7EA 2DN6A 2EJ8A 4AUQC 4LK0M 1FAOA 2P0FA 1V88A 1KC7A 2DZJA 1JWUD 2FBWB 4JPSA 1I4QA 1VZ7A 3U4EG 1E8YA 1GC7A 3Q8EA 1N5XA 4A3OA 2LGDA 3AU5A 3ZJUA 2YT2A 1WX9A 3D8DA 1U5FA 2M1MA 4GPTB 4DX8A 4M01A 1V6EA 1FHOA 5KCVA 1BMLC 2N4FA 4GMVA 5LLIA 1GOZA 4HROA 4KDIC 3FVCA 4N59A 2JX5A 2IO0B 2YS1A 1QOAA 2N9EB 2WXFA 1YN4A 4TV3A 3TCAA 2IO1B 2SEBD 2EMTA 3DVGX 4KVGB 1BXTA 4WVFB 1EUVB 4D2KA 3DDCB 2DAJA 3UIOB 1ZVRA 3BZDB 2VH1A 1J7AA 2KWUB 2DHIA 3RZFA 3EFUA 3VDZA 4WJQA 5T8IA 4YTPB 5D6JB 2KLGA 1X1MA 2K6DB 2YEPF 2KACA 3N30A 3ZDTA 4JQWC 3AEAB 4LTUA 3A9KB 3VH4B 1ZP0B 4J6IA 2M56B 3MHZA 2K8BA 2QIEB 1XO3A 4JKHA 3N7CA 1PQSA 3Q3FA 1FFUA 1FXIA 2H7DA 2RGNB 4AJWA 3UINB 1N62A 3E9LA 4RGOS 2GB1A 2BS2B 3NW8A 2D07B 1QOFA 1OTRB 2BWES 2UZRA 3AB5A 4JKGB 1YJIA 4MJSA 2D3GA 1FGZA 1UEFA 1R4MB 3G9WA 4FJZA 5AZHA 3OHMB 4GLSC 1UPRA 1F0ZA 2KAJA 1XLQA 4W9EA 1Q1OA 1NDDA 2CU3A 3OAWA 1FHXA 2LGIA 1P3QU 3X0WA 4GB9A 2LRUA 3A33B 5J18A 2Z0OA 2BWFA 2L32A 1GGOA 3RNGC 1TZOA 3NS8A 1XXGA 2K25A 3A9JA 3AEBB 1TY0A 3ONSA 1K5GB 5FI1A 1HTOA 3TW1A 5KHOA 2Y5PA 2DYNA 3B77A 2W3SA 2WXJA 3VR8B 3WAPA 4A6FB 3Q3JA 1I4RA 2W55A 4P1BC 2GLSA 1T0RC 5H8YE 2JYTA 2LXAA 1WE6A 2I1JA 3VUXA 1D3ZA 2JU6X 2M14A 2HDEA 4AWJA 2K2UA 2ASQA 1WR6E 2PEAA 1UNPA 5D3WA 1OQQA 3NUHB
chains in the Genus database with same CATH topology
1R4NI 3IBEA 1KOTA 2GS0A 3QK0A 3DVNU 2R09A 4ZYNA 4JLCA 5D3XA 1X1GA 3V61A 3HQCA 1WE7A 2M4NA 3CF6E 4HCNB 2BF8B 3DBLI 5JHHA 2KJ6A 3FP5A 1J0WA 3VXWA 2LKOA 2K1FA 2FCSA 3L17A 1WYWB 1DDWA 3V5WA 3E9OA 2DA0A 2WDTB 2CKHB 3B08A 3DVGY 1J8CA 1DYNA 1GNUA 2O2VB 2DZMA 2J0JA 3KVFB 1EF5A 4IM3A 1L2NA 3H9DA 1QC6A 4HCPB 4HPLB 1I7AA 2DZKA 1WY8A 2HJ8A 2G35A 2IY1B 3A1QA 2YF0A 1W1HA 2MSED 2C7MB 4HAVB 1ZKHA 1XD4A 3T9LA 1ST7A 5JP4A 4CO7A 5E6NA 4JKAA 2KDBA 2N23A 1IYFA 2ZCCA 3GOEA 2D11A 3KY9A 2DAFA 4IFSA 1I35A 1WXSA 3ZVRA 4EEWA 1WGYA 1A5RA 4W9JA 1S3SG 3QHTA 1YQBA 2DYQA 5DI9B 1OQYA 3U30A 2Y5BB 2KANA 2VKIA 2QKLA 1VBHA 4WQOB 2DFKA 2JXXA 2NBWB 3M62B 4HAUB 4M8NA 5EDSA 2KLCA 1V2YA 3QARA 4NY0A 1LXDA 2MFQA 5IJMA 2PE9A 4K7UA 1ZC3B 3ODWA 2ZJDA 2X0SA 2CHZA 3MDBC 1V5PA 2MBEA 2XEWA 2R2OA 4MGZE 5CLQB 1WX8A 3QC8B 5AZFA 1AARA 4MJSB 1FB8A 2COFA 4G0NB 1P98A 1DROA 2CY4A 1WJ1A 2K8HA 2QKMA 2MX2A 4XZ4A 3PRPB 5TR5A 4JK7A 2FIDA 3A9JB 4DDID 2UWQA 2FDQA 4E74A 3H1UA 1YX5B 2ADZA 3FM8C 5LXIB 1U4AA 1HE8A 3HM6X 3KW5B 2K2JA 2G3QB 1XX0A 4BKGA 3QAQA 3ZRCA 3ZO5B 4CHJA 4RMAA 2C9WB 4WJPA 5EFXA 3P7ZA 1U2BA 4BOSC 4K2PA 2ZEQA 4K7SA 3P2BA 1VD2A 3W1SA 4E71A 1WRDB 4BKSA 1EF1A 1X1FA 2HD5B 4A6KA 4GDKB 3H7SA 4JK9A 2LOZA 3DPDA 2D4QA 2P8VA 3UZTA 2GBNA 2GJYA 4M8MA 2J7QB 1UPQA 1WM2A 2O6VB 3GYPA 2D9VA 4NPNA 3ZNHB 5LXHA 3ML9A 2R82A 3PLVA 4DHZE 3A1QB 5DPSA 2GBJA 1V5MA 4M0WB 4PS7A 1UD7A 3APFA 3T8MA 2BYFA 2LASA 1EVHA 1WVHA 4WAAA 1BT0A 1QZEA 3WANA 4Z2MB 4EJNA 4JKFA 2D9WA 1LQBA 3M3JA 2AEHA 2UYZB 2ROVA 3QJZA 2FCMA 2FNJB 2R0DA 1V81A 5C16A 1WI0A 4C0AA 1WJ6A 2CRFA 1WH3A 3LJUX 2DKQA 1SGHA 2DHKA 4DBGA 1J19A 3PSCA 1U29A 5DPRA 5L81A 2NPTA 2KNBA 3CSTA 3D32A 2ZVNA 4MEMA 1UNQA 5DPWA 4IC7B 1GG3A 2JT4B 1BTKA 3VUYA 2MLBA 5LOPB 3CIKA 2NR2A 2KJRA 2OJRA 1WF9A 3JSVB 3ALBA 2R2QA 2KDFB 3ECIA 2W2XD 3DCGA 4LDTB 4Y94A 4IWOA 5GMVA 1IP9A 5JHAA 4K1RB 3TIXA 4GIVA 2A5UA 5DPTA 3CXBB 3HW2B 4KZ0A 2O6VD 4NAWB 1E8XA 1UBQA 4LCDE 2AL3A 4IW0A 1Y5OA 2DHJA 2WX0A 3S2AA 4KHAA 2CHWA 2RUKB 4DWFA 3JVZX 2NBUA 5G2NA 4WWPA 3PREA 2OOBB 4HK2A 4MGKE 3RCZA 2MWSB 2LULA 1AWEA 1XT9B 5CX3A 3PP2A 2JRHA 1NVLA 4ICVA 4GU2A 4A3PA 3AXCA 1RRBA 1FGYA 3TO1A 5J3QA 1YIWA 1WM3A 4MGYE 1DDMA 4A20A 3HK0A 2KMCA 5DHAB 2KMAA 3RULA 4IUMB 1P6SA 3KSYA 3APDA 1WGRA 1OEYA 2J0MA 4IM0A 4N9F4 3NSUA 4NJ6A 4ZRJA 2I5CA 4E3CA 2J0KA 2LYDA 4ANXA 2MRPA 1EO6A 2C7HA 3SO6A 4K17A 3L10B 4ILGB 3PG7A 2UVMA 1NTIA 3F5RA 2NBVB 2CR5A 2KFKB 1U5DA 3A8QA 4D0NB 3PRZA 4LJOB 3PHWB 1H8CA 5DHFB 1GJZA 3SDLC 1H4RA 3A4SC 3GYOA 2JPHA 2V1YA 2HTHA 2D9YA 3OLMD 4XX5A 1TTNA 3L08A 3IG3A 2DHZA 4HLEA 4HXDA 1KI1B 2GBKA 3UQBA 3VHTC 2W2XC 4HB4B 3PLUA 1RRPB 3F0WA 4FHJA 2G45B 1V89A 2YT1A 4URKA 4BOZB 4HAXB 4FN2A 3RUIB 2Y7BA 1EAZA 2VRWB 2CY5A 4MM3A 3QQ8B 4II2B 1C3TA 4A5KA 1WGUA 3L13A 3VH3B 4CHMA 2MA9B 5LONB 2GCJA 3SBTA 5JHBA 4NSWA 3PSEB 3VTWA 4NJ7A 5JH5C 4WSFA 3DVNV 2L2IA 3NY5A 4OVUA 2DYOA 1FOEA 2LD9A 5D94A 1VCBA 1Z2MA 4A6HA 5AZGA 2L1CA 4WJ7A 1OGWA 3LDZE 1AQCA 1Q5WB 2ZZPB 2JF5A 5CLLB 3CMMB 2MQJA 1GC6A 2N7DA 4NQLB 2LZ6A 4GDLB 3KYDD 1ISNA 1UBIA 2C5LC 2XK5A 3L0WB 3RCPA 4F8CB 5D27A 1V5TA 4GXBA 2KDEB 2LOXA 3T06A 3SUZA 2DYBA 2LUEA 4RM9A 2IYDB 1J0GA 4W9IA 2D9ZA 3SV1A 3R7RA 5BO4B 3HM3A 1WZ0A 5J3TA 3APCA 3TMPB 1UNRA 2EKEC 1WXVA 4DK5A 1KZGA 2PE6B 1S1QB 4FJYA 2N1WA 5CTRC 4BFRA 1M7RA 1IPGA 2WYQA 3PEGA 4BBKA 4B9KA 5E6OA 2NMBA 2DX1A 2D10A 4KV2A 3QBVB 3OJ4B 1OEYJ 4HAWB 1RLFA 5L83A 1FHWA 1WGDA 2WX1A 1V61A 4GMXB 1ZW7A 4ILHA 4ILJA 4NNJB 2BKRB 2MBHA 2BPSA 2KOXA 3SU8X 1KM7A 2KN5A 3MHSD 3ZIMA 2Z59B 1WJ4A 2ABDA 2KTRA 1JRUA 1WMHA 2Z0PA 2DLWA 2GBRA 3WIMA 4YONA 5IA7A 4JGHB 3I3TB 3EPYA 3O65B 3DBRI 1DIKA 3W1SC 4PQ0A 2JVCA 1E7UA 2LRWA 3U7DA 2HTHB 2LJ5A 4MT7A 3M1IB 3MTNB 3DOWA 4B6HA 2AL6A 1V5OA 2LGYA 1XCGA 2ZNVB 5CHVC 3X23A 1MAIA 2LXCA 3TL5A 4ANVA 5G55A 4JKEA 3ZW3A 4MGIE 3WAMA 3N32A 4HAZB 1WGQA 3DXCA 3DQVA 4B95A 4K7WA 1I2HA 3VVWB 2DTCA 4FADA 2YSZA 4MSQB 1U27A 3ZTDA 4OVVA 3UGBB 3V6CB 2J59M 1WJMA 3ODOA 3HHMA 2KGXB 1WIAA 3LJ3A 4HATB 1ACAA 1H10A 2JWZA 5DH9B 3WAOA 3D8EA 1WJUA 3SYXA 4FBJB 3JYUA 4KZCA 3PHXB 2RLOA 4XWXA 1UGMA 4WJOA 3L16A 2XK5B 3WYFB 4GGQA 1P9DU 5HE3A 1EGXA 3TJPA 2I5FA 3TFMA 5C6RA 2IFSA 4IAPA 2K6QA 5JHGA 1WXMA 4ICUA 2DX5A 1C1YB 2HRJA 4ZRKA 2KJHB 4LJPB 4EMOA 4DHJB 1LM8B 3B1LX 2L3ZA 3VTVA 1MKEA 4EZJA 2GOWA 2MDXA 2IY0B 4EUTA 2DYMA 3HIZA 2ZPNA 5HE2A 4I6LB 2IO2B 3PTFC 3SD5A 1HB6A 3A4RA 1XQQA 4NQKE 2MBOA 2Y8GA 3SHQA 2GMIC 2FIFA 1X11A 4EOYA 4I6PA 4HWIB 3UF8A 2COPA 5D3YA 4IG7B 3QX1A 4ZRIA 1E8WA 1W1GA 1E90A 3MPXA 2NS5A 3PZDA 4DX90 2V3SA 1WFYA 2KVRA 2LVPA 4KIKA 2RQ1A 1KJTA 4EZLA 1WMHB 3N3KB 3MJWA 4BBNF 3ODXA 2NZ8B 4F7HA 5C1ZA 4HAYB 1R4MI 2ROZB 1OQNA 3EC8A 3PPAA 1SIFA 1MK7B 3ZNGC 3PRMB 3V62A 2YS3A 3VQIA 5HE1A 3ULCA 3JW0X 2FCQA 3A9KA 2MBQA 3VOQA 2YRYA 4KHBB 4IWPA 4DHJD 1VBGA 2KDIA 2KXJA 2JZ3B 1WZ3A 4WJNA 1NBFC 2KTFA 1DBHA 1DDVA 1TGZB 2CODA 2KZRA 3VTUA 4JK8A 2B3AA 3H7PA 3EECA 1ZC4B 5C79A 3FEHA 2M8SA 4ZDVA 4BVUC 4PYUA 3DBHI 1MIZB 3KUZA 1PFJA 2ZNVC 1NI2A 1UH6A 3QWMA 5HKHA 3SNHA 4GN1A 3IHPC 1WI1A 2A4ZA 4ASWC 3FSSA 4EKUA 3ZNZB 1B55A 4W9CA 3AULA 3RT3B 4HB3B 1NTYA 1V5UA 4GOCA 2EC1A 2CHXA 1PMSA 3VFKA 4ANWA 3E9PA 2YS5A 3ZLZA 2FJ9A 3L54A 2Z0EB 2DX5B 2RVBB 2LGXA 2KWVB 1OY2A 5DIFB 4BBNC 3A98B 5CHWA 2CB8A 4XC2A 2CQUA 2N1VA 4MDKE 5L95C 2MW5A 3TVVA 1WX7A 2KX3A 3M63B 3KZ1A 4DXAB 3K9OB 4MH0E 1LW3A 3DXEA 2N9PC 4KSKC 4TYZA 1RFAA 2O2VA 1TQZA 3BINA 4LDTD 2FUHB 5J2RA 2KQSA 2MCNB 4GSWA 2LVQA 5J3YA 5C5BA 1Y19B 3V6EB 2L7RA 4PNKA 2L00B 2BYVE 1P5TA 3A8PA 1M7EA 3H6NA 4KIKB 1P0RA 2KWCA 1GUAB 1P1AA 2MP2A 2HE7A 1G6JA 2V4LA 3V60A 2KD0A 2WWZA 4MK0A 5IAAC 4WWOA 2UZSA 2KCJA 3PV1A 3ZDMC 3OANA 1BAKA 2MBBB 4JIOU 2JRIB 3UQAA 2RSUA 2NPTB 4RM8A 1PLSA 2OQBA 2KC2A 3EHVA 3PS6A 3VUWA 2JY6A 4MELA 1HB8A 4BKSD 3TBLD 1X05A 2KHWB 1XR0B 1RAXA 2M17A 4PS8A 3KUCB 3QWZB 1V86A 2GBMA 2KQ7A 3H7PB 3ENBA 2CS4A 5AEKB 2GCLA 4JKCA 3AU4A 3O96A 3KYCD 4MSMB 3DXDA 4W9GA 3FLVA 3ML4A 2AYOB 4K81A 1Z5SB 4KHOA 3QIJA 2Z0DB 4TUUA 1X86A 1YX6B 3PGEA 2FJLA 2OTXA 4W9LA 3DBSA 2D9XA 3ML8A 2XBBC 1OMWA 2EMSA 1E7VA 3BY4B 4ANUA 2ELBA 2PZ1A 4EZKA 3E66A 1L7YA 1K5DB 1WJNA 2LBBA 2BYEA 1IRSA 3KUDB 3PVLA 1MPHA 1MIXA 5D2MB 3KRWA 2BGFA 1T0YA 3IFWB 1LB1A 1KLVA 4JKBA 1BWNA 4GDKA 2Y8FA 1FXTB 2YT0A 5DCNA 5FI0A 3RYTA 4W9HA 3UIPB 2V76A 2O6VA 3R7QA 3ZUNA 1ZSQA 4EFOA 4AOFA 2KK8A 3IVFA 2C7NB 5C5BB 4Z2NA 5KQ4A 2NCNA 1P3RA 4DHZB 4YL8A 5JLJB 5D7GA 3QA8A 4FULA 4IM2A 3NHEB 3BJIA 2YLMA 3ZVVA 1V9JA 3ZRFA 2MP2B 3CSFA 2CAYA 4DDGD 5D3VA 2JZZA 4FLHA 1TBEA 3C0RB 5C23A 1M94A 2KO3A 4HDOA 2YVCA 2Z0QA 5KHQA 5J17A 3M95A 3WA0A 3ZTCA 4PYZA 4II3B 3NZUA 5CHFA 2PPHA 1XODA 4HVBA 1YJ1A 1HBKA 3JSVA 2G4DB 5GOWB 3R3MA 2LWPA 2IBIB 2IO3B 1TJ6A 1I42A 4HDQA 3ULBA 1CMXB 4TQ1A 4NAWA 4F7ZA 4H8SA 2RR9A 2L0TA 4KSLC 5JZEB 2REXA 2QHOA 2RGFA 2ZVOA 4JKDA 2W9NA 2NVUI 2K8CA 1KBLA 1Z87A 3R66C 3VAWA 1TZ1A 1V80A 1Q0WB 2KKCA 4W9KA 1QQGA 4FA6A 4HPMB 4HJKA 1UELA 2W2WA 2MWNB 4TQ0A 2M38A 4L6EA 2KFJA 2L05A 4F7GA 2COAA 3RD2A 4FJVB 3AJ4A 4BKTA 3PT2B 1U5GA 3D8FA 4K2OA 2N9XA 1U5EA 1MG8A 4G11A 3PVUA 1TXDA 4G50A 2KUPA 4F7UP 1Y8RC 2RD0A 3P6AA 4IOYX 2KC1A 4HB0B 1MK9B 3RZWC 3KRXA 1BTNA 2KFKA 2G4SA 2JP2A 4X57B 2KTRB 4DBBA 2L0FA 1WGHA 3QCAA 4I6NB 2I1KA 2LVOA 4CHKA 3ZNID 4HHVA 2P0DA 1E5WA 4JL9A 4P7IA 2L8JA 3K9PB 4B6WA 1JDEA 3OJ3A 1RJ2A 5FR6A 2WH5A 2X18A 2JUOA 3W1YA 2PJHA 2VRRB 5E6PA 3WALA 2XQNM 1SE9A 2BCJA 4TKNA 1E8ZA 1K8RB 2LI5A 3VIAA 1ZGUB 2BKFA 1WXAA 4F1SA 1W1DA 4HB2B 2C60A 2RPQA 2ZCBA 1Q67A 1WGGA 2L76A 4PS3A 2IZVB 1XD3B 1XKEA 2Q13A 4JKGA 1LFDA 2M0XA 4AJYB 1V49A 2ELAA 2DIKA 2N0YA 1YD8U 2K39A 2DKPA 5HE0A 3PVWA 3U8ZA 4CYEA 3ZKJC 1UZXB 2FAZA 2K00A 2KX0A 3NOBA 4G3XB 4WWNA 2MKRA 2CU1A 3AI5A 4FHKA 3ENEA 2LG1A 2DENB 2VSZA 3NZSA 4KAXB 4GDLA 4AP4C 2COCA 4A6FA 1WG7A 1SHCA 1WR1A 1NTVA 1F9JA 4MY6A 1ZM0A 4KDLB 2DZIA 2FCNA 3SBGA 2RSGA 4GZUA 5KQ1A 2E2XA 2ZPYA 3KH0A 5JVLA 2P0HA 3B0AA 2AWTA 2RNRB 2D2QA 3GZNI 4W9FA 4W9DA 2N7EA 1KZ7A 1N3HA 2IYBA 4IWQA 1NU2A 2H7EA 2DN6A 2EJ8A 4AUQC 1FAOA 2P0FA 1V88A 1KC7A 2DZJA 1E8YA 1GC7A 4A3OA 2LGDA 3AU5A 1WX9A 3D8DA 1U5FA 2M1MA 4GPTB 4DX8A 1V6EA 1FHOA 5KCVA 2N4FA 4GMVA 5LLIA 4KDIC 2YS1A 2IO0B 2N9EB 4TV3A 3TCAA 2IO1B 2EMTA 3DVGX 4KVGB 4WVFB 1EUVB 3DDCB 3UIOB 2DAJA 1ZVRA 2KWUB 2DHIA 3RZFA 3EFUA 3VDZA 4WJQA 5D6JB 2KLGA 1X1MA 2K6DB 3N30A 3ZDTA 4JQWC 3A9KB 3VH4B 4J6IA 2K8BA 4JKHA 3N7CA 1PQSA 3Q3FA 2H7DA 2RGNB 4AJWA 3UINB 3E9LA 2D07B 1OTRB 2BWES 2UZRA 4JKGB 4MJSA 2D3GA 1FGZA 1UEFA 3G9WA 4FJZA 5AZHA 1UPRA 4W9EA 1Q1OA 1NDDA 3OAWA 1FHXA 1P3QU 3X0WA 4GB9A 2LRUA 3A33B 5J18A 2Z0OA 2BWFA 1GGOA 3NS8A 2K25A 3A9JA 3ONSA 1K5GB 5FI1A 3TW1A 5KHOA 2DYNA 3WAPA 4A6FB 3Q3JA 2LXAA 1WE6A 2I1JA 3VUXA 1D3ZA 2M14A 4AWJA 2K2UA 2ASQA 1WR6E 2PEAA 1UNPA 5D3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4N I;  3IBE A;  1KOT A;  2GS0 A;  3QK0 A;  3DVN U;  2R09 A;  4ZYN A;  4JLC A;  5D3X A;  1X1G A;  3V61 A;  3HQC A;  1WE7 A;  2M4N A;  3CF6 E;  4HCN B;  2BF8 B;  3DBL I;  5JHH A;  2KJ6 A;  3FP5 A;  1J0W A;  3VXW A;  2LKO A;  2K1F A;  2FCS A;  3L17 A;  1WYW B;  1DDW A;  3V5W A;  2DA0 A;  2WDT B;  2CKH B;  3B08 A;  3DVG Y;  1J8C A;  1DYN A;  1GNU A;  2O2V B;  2DZM A;  2J0J A;  3KVF B;  1EF5 A;  4IM3 A;  1L2N A;  3H9D A;  1QC6 A;  4HCP B;  4HPL B;  1I7A A;  2DZK A;  1WY8 A;  2HJ8 A;  2G35 A;  2IY1 B;  3A1Q A;  2YF0 A;  1W1H A;  2MSE D;  2C7M B;  4HAV B;  1ZKH A;  1XD4 A;  3T9L A;  1ST7 A;  5JP4 A;  4CO7 A;  5E6N A;  2KDB A;  2N23 A;  1IYF A;  2ZCC A;  3GOE A;  2D11 A;  3KY9 A;  2DAF A;  4IFS A;  1I35 A;  1WXS A;  3ZVR A;  4EEW A;  1WGY A;  1A5R A;  4W9J A;  1S3S G;  3QHT A;  1YQB A;  2DYQ A;  5DI9 B;  1OQY A;  3U30 A;  2Y5B B;  2KAN A;  2VKI A;  2QKL A;  4WQO B;  2DFK A;  2JXX A;  2NBW B;  3M62 B;  4HAU B;  4M8N A;  5EDS A;  2KLC A;  1V2Y A;  3QAR A;  4NY0 A;  1LXD A;  2MFQ A;  5IJM A;  2PE9 A;  4K7U A;  1ZC3 B;  3ODW A;  2ZJD A;  2CHZ A;  3MDB C;  1V5P A;  2MBE A;  2XEW A;  2R2O A;  4MGZ E;  5CLQ B;  1WX8 A;  3QC8 B;  5AZF A;  1AAR A;  4MJS B;  1FB8 A;  2COF A;  4G0N B;  1P98 A;  1DRO A;  2CY4 A;  1WJ1 A;  2K8H A;  2QKM A;  2MX2 A;  4XZ4 A;  3PRP B;  5TR5 A;  2FID A;  3A9J B;  4DDI D;  2UWQ A;  2FDQ A;  4E74 A;  3H1U A;  1YX5 B;  2ADZ A;  3FM8 C;  5LXI B;  1U4A A;  1HE8 A;  3HM6 X;  3KW5 B;  2K2J A;  2G3Q B;  1XX0 A;  4BKG A;  3QAQ A;  3ZRC A;  3ZO5 B;  4CHJ A;  4RMA A;  2C9W B;  4WJP A;  5EFX A;  3P7Z A;  1U2B A;  4BOS C;  4K2P A;  2ZEQ A;  4K7S A;  3P2B A;  1VD2 A;  3W1S A;  4E71 A;  1WRD B;  4BKS A;  1EF1 A;  1X1F A;  2HD5 B;  4A6K A;  4GDK B;  3H7S A;  2LOZ A;  3DPD A;  2D4Q A;  2P8V A;  3UZT A;  2GBN A;  2GJY A;  4M8M A;  2J7Q B;  1UPQ A;  1WM2 A;  2O6V B;  3GYP A;  2D9V A;  4NPN A;  3ZNH B;  5LXH A;  3ML9 A;  3PLV A;  4DHZ E;  3A1Q B;  5DPS A;  2GBJ A;  1V5M A;  4M0W B;  4PS7 A;  1UD7 A;  3APF A;  3T8M A;  2BYF A;  2LAS A;  1EVH A;  1WVH A;  4WAA A;  1BT0 A;  1QZE A;  3WAN A;  4Z2M B;  4EJN A;  2D9W A;  1LQB A;  3M3J A;  2AEH A;  2UYZ B;  2ROV A;  3QJZ A;  2FCM A;  2FNJ B;  2R0D A;  1V81 A;  5C16 A;  1WI0 A;  4C0A A;  1WJ6 A;  2CRF A;  1WH3 A;  3LJU X;  2DKQ A;  1SGH A;  2DHK A;  4DBG A;  1J19 A;  3PSC A;  1U29 A;  5DPR A;  5L81 A;  2NPT A;  2KNB A;  3CST A;  3D32 A;  2ZVN A;  4MEM A;  1UNQ A;  5DPW A;  4IC7 B;  1GG3 A;  2JT4 B;  3VUY A;  1BTK A;  2MLB A;  5LOP B;  3CIK A;  2NR2 A;  2KJR A;  2OJR A;  1WF9 A;  3JSV B;  3ALB A;  2R2Q A;  2KDF B;  3ECI A;  2W2X D;  3DCG A;  4LDT B;  4Y94 A;  4IWO A;  5GMV A;  1IP9 A;  5JHA A;  4K1R B;  3TIX A;  4GIV A;  2A5U A;  5DPT A;  3CXB B;  3HW2 B;  4KZ0 A;  2O6V D;  4NAW B;  1E8X A;  1UBQ A;  4LCD E;  2AL3 A;  4IW0 A;  1Y5O A;  2DHJ A;  2WX0 A;  3S2A A;  4KHA A;  2CHW A;  2RUK B;  4DWF A;  3JVZ X;  2NBU A;  5G2N A;  4WWP A;  3PRE A;  2OOB B;  4HK2 A;  4MGK E;  3RCZ A;  2MWS B;  2LUL A;  1AWE A;  1XT9 B;  5CX3 A;  3PP2 A;  2JRH A;  1NVL A;  4ICV A;  4GU2 A;  4A3P A;  3AXC A;  1RRB A;  1FGY A;  3TO1 A;  5J3Q A;  1YIW A;  1WM3 A;  4MGY E;  1DDM A;  4A20 A;  3HK0 A;  2KMC A;  5DHA B;  2KMA A;  3RUL A;  4IUM B;  1P6S A;  3KSY A;  3APD A;  1WGR A;  1OEY A;  2J0M A;  4IM0 A;  4N9F 4;  3NSU A;  4NJ6 A;  4ZRJ A;  2I5C A;  4E3C A;  2J0K A;  2LYD A;  4ANX A;  2MRP A;  1EO6 A;  2C7H A;  3SO6 A;  4K17 A;  3L10 B;  3PG7 A;  2UVM A;  1NTI A;  3F5R A;  2NBV B;  2CR5 A;  2KFK B;  1U5D A;  3A8Q A;  4D0N B;  3PRZ A;  4LJO B;  3PHW B;  1H8C A;  5DHF B;  1GJZ A;  3SDL C;  1H4R A;  3A4S C;  3GYO A;  2JPH A;  2V1Y A;  2HTH A;  2D9Y A;  3OLM D;  4XX5 A;  1TTN A;  3L08 A;  3IG3 A;  2DHZ A;  4HLE A;  4HXD A;  1KI1 B;  2GBK A;  3UQB A;  3VHT C;  2W2X C;  4HB4 B;  3PLU A;  1RRP B;  3F0W A;  4FHJ A;  2G45 B;  1V89 A;  2YT1 A;  4URK A;  4BOZ B;  4HAX B;  4FN2 A;  3RUI B;  2Y7B A;  1EAZ A;  2VRW B;  2CY5 A;  4MM3 A;  3QQ8 B;  4II2 B;  1C3T A;  4A5K A;  1WGU A;  3L13 A;  3VH3 B;  4CHM A;  2MA9 B;  5LON B;  2GCJ A;  5JHB A;  4NSW A;  3PSE B;  3VTW A;  4NJ7 A;  5JH5 C;  4WSF A;  3DVN V;  2L2I A;  3NY5 A;  4OVU A;  2DYO A;  1FOE A;  2LD9 A;  5D94 A;  1VCB A;  1Z2M A;  4A6H A;  5AZG A;  2L1C A;  4WJ7 A;  1OGW A;  3LDZ E;  1AQC A;  1Q5W B;  2ZZP B;  2JF5 A;  5CLL B;  3CMM B;  2MQJ A;  1GC6 A;  2N7D A;  4NQL B;  2LZ6 A;  4GDL B;  3KYD D;  1ISN A;  1UBI A;  2C5L C;  2XK5 A;  3L0W B;  3RCP A;  4F8C B;  5D27 A;  1V5T A;  4GXB A;  2KDE B;  2LOX A;  3T06 A;  3SUZ A;  2DYB A;  2LUE A;  4RM9 A;  2IYD B;  1J0G A;  4W9I A;  2D9Z A;  3SV1 A;  3R7R A;  5BO4 B;  3HM3 A;  1WZ0 A;  5J3T A;  3APC A;  3TMP B;  1UNR A;  2EKE C;  1WXV A;  4DK5 A;  1KZG A;  2PE6 B;  1S1Q B;  4FJY A;  2N1W A;  5CTR C;  4BFR A;  1M7R A;  1IPG A;  2WYQ A;  3PEG A;  4BBK A;  4B9K A;  5E6O A;  2NMB A;  2DX1 A;  2D10 A;  4KV2 A;  3QBV B;  3OJ4 B;  1OEY J;  4HAW B;  1RLF A;  5L83 A;  1FHW A;  1WGD A;  2WX1 A;  1V61 A;  4GMX B;  1ZW7 A;  4NNJ B;  2BKR B;  2MBH A;  2BPS A;  2KOX A;  3SU8 X;  1KM7 A;  2KN5 A;  3MHS D;  3ZIM A;  2Z59 B;  1WJ4 A;  2ABD A;  2KTR A;  1JRU A;  1WMH A;  2Z0P A;  2DLW A;  2GBR A;  3WIM A;  4YON A;  5IA7 A;  4JGH B;  3I3T B;  3EPY A;  3O65 B;  3DBR I;  3W1S C;  4PQ0 A;  2JVC A;  1E7U A;  2LRW A;  3U7D A;  2HTH B;  2LJ5 A;  4MT7 A;  3M1I B;  3MTN B;  3DOW A;  4B6H A;  2AL6 A;  1V5O A;  2LGY A;  1XCG A;  2ZNV B;  5CHV C;  3X23 A;  1MAI A;  2LXC A;  3TL5 A;  4ANV A;  5G55 A;  3ZW3 A;  4MGI E;  3WAM A;  3N32 A;  4HAZ B;  1WGQ A;  3DXC A;  3DQV A;  4B95 A;  4K7W A;  1I2H A;  3VVW B;  2DTC A;  4FAD A;  2YSZ A;  4MSQ B;  1U27 A;  3ZTD A;  4OVV A;  3UGB B;  3V6C B;  2J59 M;  1WJM A;  3ODO A;  3HHM A;  2KGX B;  1WIA A;  3LJ3 A;  4HAT B;  1ACA A;  1H10 A;  2JWZ A;  5DH9 B;  3WAO A;  3D8E A;  1WJU A;  3SYX A;  4FBJ B;  3JYU A;  4KZC A;  3PHX B;  2RLO A;  4XWX A;  1UGM A;  4WJO A;  3L16 A;  2XK5 B;  3WYF B;  4GGQ A;  1P9D U;  5HE3 A;  1EGX A;  3TJP A;  2I5F A;  3TFM A;  5C6R A;  2IFS A;  4IAP A;  2K6Q A;  5JHG A;  1WXM A;  4ICU A;  2DX5 A;  1C1Y B;  2HRJ A;  4ZRK A;  2KJH B;  4LJP B;  4EMO A;  4DHJ B;  1LM8 B;  3B1L X;  2L3Z A;  3VTV A;  1MKE A;  4EZJ A;  2GOW A;  2MDX A;  2IY0 B;  4EUT A;  2DYM A;  3HIZ A;  2ZPN A;  5HE2 A;  4I6L B;  2IO2 B;  3PTF C;  3SD5 A;  1HB6 A;  3A4R A;  1XQQ A;  4NQK E;  2MBO A;  2Y8G A;  3SHQ A;  2GMI C;  2FIF A;  1X11 A;  4EOY A;  4I6P A;  4HWI B;  3UF8 A;  2COP A;  5D3Y A;  4IG7 B;  3QX1 A;  4ZRI A;  1E8W A;  1W1G A;  1E90 A;  3MPX A;  2NS5 A;  3PZD A;  4DX9 0;  2V3S A;  1WFY A;  2KVR A;  2LVP A;  4KIK A;  2RQ1 A;  1KJT A;  4EZL A;  1WMH B;  3N3K B;  3MJW A;  4BBN F;  3ODX A;  2NZ8 B;  4F7H A;  5C1Z A;  4HAY B;  1R4M I;  2ROZ B;  1OQN A;  3EC8 A;  3PPA A;  1SIF A;  1MK7 B;  3ZNG C;  3PRM B;  3V62 A;  2YS3 A;  3VQI A;  5HE1 A;  3ULC A;  3JW0 X;  2FCQ A;  3A9K A;  2MBQ A;  3VOQ A;  2YRY A;  4KHB B;  4IWP A;  4DHJ D;  2KDI A;  2KXJ A;  2JZ3 B;  1WZ3 A;  4WJN A;  1NBF C;  2KTF A;  1DBH A;  1DDV A;  1TGZ B;  2COD A;  2KZR A;  3VTU A;  2B3A A;  3H7P A;  3EEC A;  1ZC4 B;  5C79 A;  3FEH A;  2M8S A;  4ZDV A;  4BVU C;  4PYU A;  3DBH I;  1MIZ B;  3KUZ A;  1PFJ A;  2ZNV C;  1NI2 A;  1UH6 A;  3QWM A;  5HKH A;  3SNH A;  4GN1 A;  3IHP C;  1WI1 A;  2A4Z A;  4ASW C;  3FSS A;  4EKU A;  3ZNZ B;  1B55 A;  4W9C A;  3AUL A;  3RT3 B;  4HB3 B;  1NTY A;  1V5U A;  4GOC A;  2EC1 A;  2CHX A;  1PMS A;  3VFK A;  4ANW A;  2YS5 A;  3ZLZ A;  2FJ9 A;  3L54 A;  2Z0E B;  2DX5 B;  2RVB B;  2LGX A;  2KWV B;  1OY2 A;  5DIF B;  4BBN C;  3A98 B;  5CHW A;  2CB8 A;  4XC2 A;  2CQU A;  2N1V A;  4MDK E;  5L95 C;  2MW5 A;  3TVV A;  1WX7 A;  2KX3 A;  3M63 B;  3KZ1 A;  4DXA B;  3K9O B;  4MH0 E;  1LW3 A;  3DXE A;  2N9P C;  4KSK C;  4TYZ A;  1RFA A;  2O2V A;  1TQZ A;  3BIN A;  4LDT D;  2FUH B;  5J2R A;  2KQS A;  2MCN B;  4GSW A;  2LVQ A;  5J3Y A;  5C5B A;  1Y19 B;  3V6E B;  2L7R A;  4PNK A;  2L00 B;  2BYV E;  1P5T A;  3A8P A;  1M7E A;  3H6N A;  4KIK B;  1P0R A;  2KWC A;  1GUA B;  1P1A A;  2MP2 A;  2HE7 A;  1G6J A;  2V4L A;  3V60 A;  2KD0 A;  2WWZ A;  4MK0 A;  5IAA C;  4WWO A;  2UZS A;  2KCJ A;  3PV1 A;  3ZDM C;  3OAN A;  1BAK A;  2MBB B;  4JIO U;  2JRI B;  3UQA A;  2RSU A;  2NPT B;  4RM8 A;  1PLS A;  2OQB A;  2KC2 A;  3EHV A;  3PS6 A;  3VUW A;  2JY6 A;  4MEL A;  1HB8 A;  4BKS D;  3TBL D;  1X05 A;  2KHW B;  1XR0 B;  1RAX A;  2M17 A;  4PS8 A;  3KUC B;  3QWZ B;  1V86 A;  2GBM A;  2KQ7 A;  3H7P B;  2CS4 A;  5AEK B;  2GCL A;  3AU4 A;  3O96 A;  3KYC D;  4MSM B;  3DXD A;  4W9G A;  3FLV A;  3ML4 A;  2AYO B;  4K81 A;  1Z5S B;  4KHO A;  3QIJ A;  2Z0D B;  4TUU A;  1X86 A;  1YX6 B;  3PGE A;  2FJL A;  2OTX A;  4W9L A;  3DBS A;  2D9X A;  3ML8 A;  2XBB C;  1OMW A;  2EMS A;  1E7V A;  3BY4 B;  4ANU A;  2ELB A;  2PZ1 A;  4EZK A;  1L7Y A;  1K5D B;  1WJN A;  2LBB A;  2BYE A;  1IRS A;  3KUD B;  3PVL A;  1MPH A;  1MIX A;  5D2M B;  3KRW A;  2BGF A;  1T0Y A;  3IFW B;  1LB1 A;  1KLV A;  1BWN A;  4GDK A;  2Y8F A;  1FXT B;  2YT0 A;  5DCN A;  5FI0 A;  3RYT A;  4W9H A;  3UIP B;  2V76 A;  2O6V A;  3R7Q A;  3ZUN A;  1ZSQ A;  4EFO A;  4AOF A;  2KK8 A;  3IVF A;  2C7N B;  5C5B B;  4Z2N A;  5KQ4 A;  2NCN A;  1P3R A;  4DHZ B;  4YL8 A;  5JLJ B;  5D7G A;  3QA8 A;  4FUL A;  4IM2 A;  3NHE B;  3BJI A;  2YLM A;  3ZVV A;  1V9J A;  3ZRF A;  2MP2 B;  3CSF A;  2CAY A;  4DDG D;  5D3V A;  2JZZ A;  4FLH A;  1TBE A;  3C0R B;  5C23 A;  1M94 A;  2KO3 A;  4HDO A;  2YVC A;  2Z0Q A;  5KHQ A;  5J17 A;  3M95 A;  3WA0 A;  3ZTC A;  4PYZ A;  4II3 B;  3NZU A;  5CHF A;  2PPH A;  1XOD A;  4HVB A;  1YJ1 A;  1HBK A;  3JSV A;  2G4D B;  5GOW B;  3R3M A;  2LWP A;  2IBI B;  2IO3 B;  1TJ6 A;  1I42 A;  4HDQ A;  3ULB A;  1CMX B;  4TQ1 A;  4NAW A;  4F7Z A;  4H8S A;  2RR9 A;  2L0T A;  4KSL C;  5JZE B;  2REX A;  2QHO A;  2RGF A;  2ZVO A;  2W9N A;  2NVU I;  2K8C A;  1Z87 A;  3R66 C;  3VAW A;  1TZ1 A;  1V80 A;  1Q0W B;  2KKC A;  4W9K A;  1QQG A;  4FA6 A;  4HPM B;  4HJK A;  1UEL A;  2W2W A;  2MWN B;  4TQ0 A;  2M38 A;  4L6E A;  2KFJ A;  2L05 A;  4F7G A;  2COA A;  3RD2 A;  4FJV B;  3AJ4 A;  4BKT A;  3PT2 B;  1U5G A;  3D8F A;  4K2O A;  2N9X A;  1U5E A;  1MG8 A;  4G11 A;  3PVU A;  1TXD A;  4G50 A;  2KUP A;  4F7U P;  1Y8R C;  2RD0 A;  3P6A A;  4IOY X;  2KC1 A;  4HB0 B;  1MK9 B;  3RZW C;  3KRX A;  1BTN A;  2KFK A;  2G4S A;  2JP2 A;  4X57 B;  2KTR B;  4DBB A;  2L0F A;  1WGH A;  3QCA A;  4I6N B;  2I1K A;  2LVO A;  4CHK A;  3ZNI D;  4HHV A;  2P0D A;  1E5W A;  4JL9 A;  4P7I A;  2L8J A;  3K9P B;  4B6W A;  3OJ3 A;  1RJ2 A;  5FR6 A;  2WH5 A;  2X18 A;  2JUO A;  3W1Y A;  2PJH A;  2VRR B;  5E6P A;  3WAL A;  2XQN M;  1SE9 A;  2BCJ A;  4TKN A;  1E8Z A;  1K8R B;  2LI5 A;  3VIA A;  1ZGU B;  2BKF A;  1WXA A;  4F1S A;  1W1D A;  4HB2 B;  2C60 A;  2RPQ A;  2ZCB A;  1Q67 A;  1WGG A;  2L76 A;  4PS3 A;  2IZV B;  1XD3 B;  1XKE A;  2Q13 A;  1LFD A;  2M0X A;  4AJY B;  1V49 A;  2ELA A;  2N0Y A;  1YD8 U;  2K39 A;  2DKP A;  5HE0 A;  3PVW A;  3U8Z A;  4CYE A;  3ZKJ C;  1UZX B;  2FAZ A;  2K00 A;  2KX0 A;  3NOB A;  4G3X B;  4WWN A;  2MKR A;  2CU1 A;  3AI5 A;  4FHK A;  3ENE A;  2LG1 A;  2DEN B;  2VSZ A;  3NZS A;  4KAX B;  4GDL A;  4AP4 C;  2COC A;  4A6F A;  1WG7 A;  1SHC A;  1WR1 A;  1NTV A;  1F9J A;  4MY6 A;  1ZM0 A;  4KDL B;  2DZI A;  2FCN A;  2RSG A;  4GZU A;  5KQ1 A;  2E2X A;  2ZPY A;  3KH0 A;  2P0H A;  3B0A A;  2AWT A;  2RNR B;  2D2Q A;  3GZN I;  4W9F A;  4W9D A;  2N7E A;  1KZ7 A;  1N3H A;  2IYB A;  4IWQ A;  1NU2 A;  2H7E A;  2DN6 A;  2EJ8 A;  4AUQ C;  1FAO A;  2P0F A;  1V88 A;  2DZJ A;  1E8Y A;  1GC7 A;  4A3O A;  2LGD A;  3AU5 A;  1WX9 A;  3D8D A;  1U5F A;  2M1M A;  4GPT B;  4DX8 A;  1V6E A;  1FHO A;  5KCV A;  2N4F A;  4GMV A;  5LLI A;  4KDI C;  2YS1 A;  2IO0 B;  2N9E B;  4TV3 A;  3TCA A;  2IO1 B;  2EMT A;  3DVG X;  4KVG B;  4WVF B;  1EUV B;  3DDC B;  3UIO B;  2DAJ A;  1ZVR A;  2KWU B;  2DHI A;  3RZF A;  3EFU A;  3VDZ A;  4WJQ A;  5D6J B;  2KLG A;  1X1M A;  2K6D B;  3N30 A;  3ZDT A;  4JQW C;  3A9K B;  3VH4 B;  4J6I A;  2K8B A;  3N7C A;  1PQS A;  3Q3F A;  2H7D A;  2RGN B;  4AJW A;  3UIN B;  2D07 B;  1OTR B;  2BWE S;  2UZR A;  4MJS A;  2D3G A;  1FGZ A;  1UEF A;  3G9W A;  4FJZ A;  5AZH A;  1UPR A;  4W9E A;  1Q1O A;  1NDD A;  3OAW A;  1FHX A;  1P3Q U;  3X0W A;  4GB9 A;  2LRU A;  3A33 B;  5J18 A;  2Z0O A;  2BWF A;  3NS8 A;  2K25 A;  3A9J A;  3ONS A;  1K5G B;  5FI1 A;  3TW1 A;  5KHO A;  2DYN A;  3WAP A;  4A6F B;  3Q3J A;  2LXA A;  1WE6 A;  2I1J A;  3VUX A;  1D3Z A;  2M14 A;  4AWJ A;  2K2U A;  2ASQ A;  1WR6 E;  2PEA A;  1UNP A;  5D3W A; 
#chains in the Genus database with same CATH topology
 3Q8B A;  1D5X C;  2G1E A;  1R4N I;  1FIQ A;  3IBE A;  1TYG B;  1KOT A;  2GS0 A;  3QK0 A;  2W3R A;  3DVN U;  2R09 A;  4ZYN A;  4JLC A;  1JML A;  5D3X A;  1X1G A;  3V61 A;  4QJ3 B;  3DBH B;  3HQC A;  1WE7 A;  2M4N A;  1VZ6 A;  2K22 A;  1HXY D;  3CF6 E;  4HCN B;  2BF8 B;  3DBL I;  5JHH A;  2KJ6 A;  3FP5 A;  2H89 B;  4OZC A;  1J0W A;  3VXW A;  2LKO A;  2K1F A;  2FCS A;  3L17 A;  1WYW B;  1DDW A;  3V5W A;  3E9O A;  2DA0 A;  2WDT B;  2CKH B;  4WAF A;  3B08 A;  3DVG Y;  1J8C A;  1DYN A;  1GNU A;  4P16 A;  2O2V B;  2DZM A;  3IT6 B;  1TKY A;  2J0J A;  4P1C C;  3KVF B;  1EF5 A;  2MEK A;  4IM3 A;  1L2N A;  3H9D A;  3KWV A;  1QC6 A;  4HCP B;  4HPL B;  1I7A A;  2DZK A;  1HTQ A;  1WY8 A;  2HJ8 A;  2G35 A;  2IY1 B;  3A1Q A;  1PGX A;  5H92 C;  2YF0 A;  1W1H A;  4M0W A;  2MSE D;  3UI3 A;  2C7M B;  4HAV B;  1ZKH A;  3MC8 A;  1XD4 A;  2GRI A;  3T9L A;  4YSX B;  1ST7 A;  1C76 A;  5JP4 A;  4CO7 A;  5E6N A;  1MJD A;  2K5P A;  4JKA A;  2KDB A;  3FAH A;  2PW9 A;  2N23 A;  1IYF A;  2ZCC A;  3Q8A A;  4JWS C;  2WQY B;  2D11 A;  3KY9 A;  2DAF A;  3GOE A;  4IFS A;  1I35 A;  1SB3 C;  1WXS A;  3ZVR A;  2BQQ A;  1CZP A;  1WGY A;  4EEW A;  2QMT A;  1MVK A;  1A5R A;  4W9J A;  1S3S G;  3QHT A;  1YQB A;  1FFV A;  2DYQ A;  5DI9 B;  3DCX A;  1OQY A;  2KMM A;  2Y5B B;  3U30 A;  2KAN A;  1N5W A;  4NJC A;  2VKI A;  1VBH A;  2QKL A;  1CK1 A;  4WQO B;  2DFK A;  2JXX A;  2NBW B;  3M62 B;  2L52 A;  4HAU B;  4M8N A;  5EDS A;  1EU4 A;  4B0E A;  2KLC A;  3NS1 A;  1V2Y A;  3QAR A;  4NY0 A;  1LXD A;  2MFQ A;  3TUO A;  5IJM A;  2PE9 A;  4K7U A;  1ZC3 B;  3ODW A;  2ZJD A;  2X0S A;  2CHZ A;  3MDB C;  1V5P A;  5LNK 1;  2MBE A;  2XEW A;  2R2O A;  2IND C;  4MGZ E;  5CLQ B;  1WX8 A;  3QC8 B;  5AZF A;  4QJ4 B;  1AAR A;  4MJS B;  4RF1 A;  1FB8 A;  3HSA A;  2COF A;  5I4D A;  4G0N B;  4S17 A;  3DHG C;  1P98 A;  1DRO A;  2XNA C;  5JXV A;  2ON8 A;  4HSI A;  5IN7 A;  2CY4 A;  4H2A A;  1WJ1 A;  2K8H A;  2QKM A;  1UNS A;  2MX2 A;  1SJH D;  4XZ4 A;  2WP9 B;  2AX5 A;  2DWQ A;  3PRP B;  5TR5 A;  4JK7 A;  2FID A;  3A9J B;  3ZJV A;  2PLP A;  1FM0 D;  1F2R C;  4DDI D;  2UWQ A;  2FDQ A;  4E74 A;  3H1U A;  1YX5 B;  2ADZ A;  3R2I A;  3RNC C;  4GNK B;  3FM8 C;  3Q3O C;  5LXI B;  1U4A A;  1FNU A;  1HE8 A;  2BS3 B;  3HM6 X;  3RN9 C;  4LNI A;  3KW5 B;  2K2J A;  2G3Q B;  1KLG D;  2D3A A;  1XX0 A;  4BKG A;  3QAQ A;  3ZRC A;  3ZO5 B;  4ITK A;  3NZ3 A;  3ZXR A;  3N1Y C;  4CHJ A;  1SE3 A;  4RMA A;  2C9W B;  2KT7 A;  1SJE D;  3BK1 A;  3OG5 A;  3ETR A;  4WJP A;  5EFX A;  2N0S B;  3P7Z A;  1U2B A;  4BOS C;  1EU3 A;  4K2P A;  3I63 C;  3LXF A;  2ZEQ A;  4K7S A;  3P2B A;  4ZOH C;  1VD2 A;  3W1S A;  4E71 A;  1WRD B;  4BKS A;  1SF0 A;  2HTM E;  1EF1 A;  2KWD A;  3MP9 A;  1X1F A;  2HD5 B;  4A6K A;  4GDK B;  3H7S A;  4JK9 A;  1E10 A;  1P7E A;  1QT9 A;  2LOZ A;  1N63 A;  1L6U A;  3DPD A;  2D4Q A;  2P8V A;  3UZT A;  2GBN A;  2V3N A;  3P42 A;  3P1M A;  2WXP A;  2GJY A;  4M8M A;  2J7Q B;  1UPQ A;  1L0Y B;  4JE3 B;  1K53 A;  1WM2 A;  2O6V B;  4OHJ A;  3GYP A;  2D9V A;  1KLU D;  1I4P A;  2OED A;  2NBV A;  1QOB A;  4NPN A;  2UU7 A;  3ZNH B;  3AV8 A;  5LG4 B;  3IT4 B;  1F2R I;  5LXH A;  3ML9 A;  2R82 A;  3PLV A;  1PUT A;  4DHZ E;  3A1Q B;  2QDF A;  5DPS A;  2GBJ A;  1V5M A;  4REZ A;  4C7Z A;  4M0W B;  4PS7 A;  1UD7 A;  3AE6 B;  3APF A;  3T8M A;  2BYF A;  2LAS A;  1EVH A;  1WVH A;  1TS5 A;  4WAA A;  1BT0 A;  1QZE A;  3WAN A;  4Z2M B;  4EJN A;  4JKF A;  2D9W A;  1LQB A;  3M3J A;  3BYT B;  2AEH A;  2UYZ B;  2ROV A;  2WU5 B;  3QJZ A;  2FCM A;  2V3P A;  2FNJ B;  2R0D A;  1V81 A;  5C16 A;  1WI0 A;  4C0A A;  1WJ6 A;  2LHD A;  2CRF A;  1PFD A;  2WXM A;  1I4X A;  1AN8 A;  1WH3 A;  3LJU X;  2PMV A;  1N6Z A;  2DKQ A;  2V9H A;  1SGH A;  2DHK A;  3BYY B;  4DBG A;  1J19 A;  3MC9 A;  3PSC A;  4TSS A;  1U29 A;  5DPR A;  4L1R A;  5L81 A;  2W82 A;  2NPT A;  3P4P B;  4QAY A;  2KNB A;  3CST A;  2Y5C A;  2D3B A;  1MG4 A;  3D32 A;  2ZVN A;  4MEM A;  1NEN B;  2M0A A;  1UNQ A;  4C4V A;  5DPW A;  4IC7 B;  1GG3 A;  2JT4 B;  1BTK A;  3VUY A;  2MLB A;  3Q14 C;  5HG2 A;  5LOP B;  3CIK A;  2NR2 A;  1TKE A;  2KJR A;  2OJR A;  1WF9 A;  3JSV B;  3ALB A;  1JWA D;  2R2Q A;  1D5Z C;  2KDF B;  1QOG A;  3ECI A;  1EWY C;  2W2X D;  3DCG A;  4LDT B;  4Y94 A;  2MJE A;  3HUI A;  4IWO A;  5GMV A;  3VRA B;  5JHA A;  1IP9 A;  4K1R B;  3TIX A;  4GIV A;  2A5U A;  3EFC A;  5DPT A;  3CXB B;  1JRP A;  4A6Q A;  3HVD A;  5EE3 A;  3ZQ4 A;  3HW2 B;  4KZ0 A;  2O6V D;  4NAW B;  2CJO A;  1E8X A;  4LNK A;  1UBQ A;  4LCD E;  2AL3 A;  4IW0 A;  1Y5O A;  2DHJ A;  2WX0 A;  3S2A A;  1TJE A;  4KHA A;  2CHW A;  4XDD A;  2RUK B;  4DWF A;  2XN9 C;  3JVZ X;  2NBU A;  5G2N A;  2KQ4 X;  4WWP A;  4PK1 A;  3PRE A;  2JQR B;  3AE8 B;  3I9V 1;  3CWI A;  1C4A A;  2D5G A;  2M19 A;  2OOB B;  2N9L A;  4HK2 A;  4MGK E;  3RCZ A;  1V97 A;  2MWS B;  2LUL A;  4LNF A;  1AWE A;  1XT9 B;  4NZL B;  5CX3 A;  3PP2 A;  1NVI D;  2WGS A;  2JRH A;  3P4R B;  1NVL A;  4ICV A;  4GU2 A;  4A3P A;  3AXC A;  1RRB A;  2VH2 A;  1FGY A;  3TO1 A;  1RFK A;  1ET9 A;  5J3Q A;  1MI1 A;  1YIW A;  1WM3 A;  1E6E B;  4MGY E;  1DDM A;  4A20 A;  3HK0 A;  2KMC A;  5DHA B;  2KMA A;  3RUL A;  4IUM B;  1P6S A;  3KSY A;  1FPY A;  3APD A;  3I57 A;  2IGH A;  1WGR A;  5IOI A;  1OEY A;  3NVZ A;  2J0M A;  4IM0 A;  2WHI A;  1FO4 A;  4N9F 4;  3NSU A;  4NJ6 A;  4ZRJ A;  2I5C A;  1NYQ A;  3NG0 A;  3A58 A;  2QEJ C;  4E3C A;  2J0K A;  1E7P B;  2LYD A;  4ANX A;  1L6V A;  2MRP A;  1FEH A;  1EO6 A;  2ZKM X;  3SO6 A;  2C7H A;  4OW0 A;  4K17 A;  2Y3A A;  3L10 B;  4BAX A;  4ILG B;  3PG7 A;  4HEA 1;  2ZW1 A;  1OQR A;  3RPF C;  1NI3 A;  3W2D A;  2Z59 A;  2UVM A;  1NTI A;  2CJN A;  3F5R A;  4RGT A;  2NBV B;  3FKY A;  2CR5 A;  2KFK B;  1IGD A;  1U5D A;  3A8Q A;  4D0N B;  4ACF A;  4YWG G;  3PRZ A;  4K3C A;  4LJO B;  1Q10 A;  3PHW B;  1H8C A;  5DHF B;  1GJZ A;  4WUR A;  1VR9 A;  3SDL C;  2WDQ B;  1C79 A;  1H4R A;  3A4S C;  3GYO A;  2JPH A;  3T3N A;  2V1Y A;  2HTH A;  2D9Y A;  3OLM D;  4XX5 A;  1TTN A;  3L08 A;  3AE1 B;  3IG3 A;  5BYR A;  1B9R A;  2DHZ A;  4HLE A;  2FE8 A;  1KI1 B;  4HXD A;  2GBK A;  3UQB A;  3VHT C;  2W2X C;  1MFW A;  2K0P A;  1N60 A;  2NTS A;  4HB4 B;  3PLU A;  1RRP B;  3F0W A;  4FHJ A;  2G45 B;  1V89 A;  2YT1 A;  3NVW A;  1LO5 D;  4YSY B;  2DNF A;  2BW2 A;  4URK A;  4BOZ B;  4HAX B;  4FN2 A;  3RUI B;  2LMC A;  2Y7B A;  3AE5 B;  1FNV A;  1EAZ A;  2K9X A;  4KX6 B;  5FR3 A;  3HVZ A;  2VRW B;  2WXR A;  2CY5 A;  4MM3 A;  3N20 C;  3QQ8 B;  1PGA A;  4II2 B;  1JQ4 A;  4QXA B;  1C3T A;  2PTL A;  4A5K A;  1WGU A;  3L13 A;  3VH3 B;  4CHM A;  2MA9 B;  1MPE A;  5LON B;  2AQ2 B;  2JSV X;  3AE9 B;  4O1N A;  2GCJ A;  2RDG A;  3SBT A;  1XCT L;  2N9K A;  5JHB A;  4NSW A;  3PSE B;  3VTW A;  2LFI A;  4NJ7 A;  5JH5 C;  3R8B A;  1TY2 A;  4WSF A;  3DVN V;  1JCK B;  1ZPS A;  2L2I A;  4XYC A;  3AEE B;  3NY5 A;  4OVU A;  4K3B A;  2DYO A;  1WWT A;  1FOE A;  2LD9 A;  5D94 A;  2D3C A;  1VCB A;  1Z2M A;  4A6H A;  5AZG A;  2L1C A;  2JXT A;  4WJ7 A;  1OGW A;  3LDZ E;  1E9M A;  5E6J A;  1AQC A;  1Q5W B;  2ZZP B;  2LUM A;  2JF5 A;  5CLL B;  3CMM B;  2MQJ A;  1GC6 A;  1YJJ A;  2N7D A;  4NQL B;  2K8E A;  1SBB B;  2LZ6 A;  4GDL B;  3KYD D;  1ISN A;  1UBI A;  2C5L C;  2XK5 A;  3L0W B;  3RCP A;  2H88 B;  4F8C B;  5D27 A;  1V5T A;  3V3X A;  4DXG A;  4GXB A;  2KDE B;  2LOX A;  3T06 A;  3SUZ A;  2DYB A;  2LUE A;  4RM9 A;  2IYD B;  1J0G A;  4S0R A;  4W9I A;  2D9Z A;  2KYW A;  3SV1 A;  1VLB A;  1Y56 A;  3R7R A;  1T6B X;  1QKZ A;  1ET6 A;  3RNF C;  5BO4 B;  3HM3 A;  1WZ0 A;  4WWM A;  5J3T A;  2HJ1 A;  3APC A;  3TMP B;  4RF0 A;  1UNR A;  2EKE C;  5IO9 A;  1T3Q A;  1WXV A;  4DK5 A;  1KZG A;  2PE6 B;  1S1Q B;  4FJY A;  4XDC A;  2N1W A;  5CTR C;  4BFR A;  3PO0 A;  1M7R A;  1IPG A;  2WYQ A;  1YN3 A;  3PEG A;  2L83 A;  4BBK A;  4B9K A;  5E6O A;  2NMB A;  2DX1 A;  2D10 A;  3ZYY X;  4KV2 A;  3QBV B;  3OJ4 B;  1OEY J;  4HAW B;  1RLF A;  5I2S A;  2E6X A;  4A55 A;  5L83 A;  1FHW A;  3GP7 A;  3Q3M C;  1WGD A;  2WX1 A;  1V61 A;  1ZXI A;  4GMX B;  1ZW7 A;  4ILH A;  2VZK B;  4L2Y A;  4HPP A;  4ILJ A;  4NNJ B;  2BKR B;  1ZDV A;  2MBH A;  4RFB A;  2BPS A;  2KOX A;  3GS2 A;  3SU8 X;  3VRB B;  1KM7 A;  1FD6 A;  2KN5 A;  3MHS D;  3ZIM A;  2Z59 B;  1WJ4 A;  2ABD A;  1QIL A;  1RM6 C;  2KTR A;  1JRU A;  1WMH A;  2Z0P A;  5FK9 C;  4PT5 A;  2DLW A;  2GBR A;  3WIM A;  4YON A;  2WDR B;  5IA7 A;  4JGH B;  3GZN B;  3I3T B;  3EPY A;  1DOY A;  3O65 B;  3DBR I;  1DIK A;  3Q69 A;  3W1S C;  4PQ0 A;  2JVC A;  2WDV B;  1E7U A;  1V1O A;  2LRW A;  3U7D A;  2HTH B;  2LJ5 A;  3DWM A;  1TS3 A;  1QF6 A;  4MT7 A;  3M1I B;  3MTN B;  4P6V F;  3DOW A;  4B6H A;  2AL6 A;  1NEK B;  1V5O A;  2LGY A;  1XCG A;  3V05 A;  3DHI C;  3DHH C;  2ZNV B;  5CHV C;  3P4S B;  3X23 A;  1MAI A;  4KHB A;  3Q6B A;  2LXC A;  3TL5 A;  4ANV A;  2ACZ B;  5G55 A;  4JKE A;  3ZW3 A;  3FIL A;  1P7F A;  4OSN A;  4TMA B;  1VRA B;  4MGI E;  3WAM A;  4C00 A;  5D3I B;  3N32 A;  4HAZ B;  1WGQ A;  3DXC A;  3DQV A;  1J7C A;  2QSD A;  4B95 A;  4XGA B;  1LGR A;  4K7W A;  1I2H A;  3VVW B;  2DTC A;  4FAD A;  2YSZ A;  4MSQ B;  1YQ4 B;  2I38 A;  2WXO A;  1U27 A;  4YXD B;  3ZTD A;  2RMM A;  4AQ7 A;  4WH4 A;  4OVV A;  1FNW A;  3UGB B;  3I5J C;  1YMH E;  3V6C B;  2J59 M;  1WJM A;  3ODO A;  3HHM A;  1I7H A;  3W5V B;  3HRD D;  2KGX B;  1WIA A;  3LJ3 A;  4HAT B;  1ACA A;  1H10 A;  2JWZ A;  2R2Y A;  5DH9 B;  3WAO A;  1YOV B;  2DLB A;  3D8E A;  4A9A A;  1WJU A;  3SYX A;  4FBJ B;  3JYU A;  1ZXH A;  3AE2 B;  3AMZ A;  2FJU B;  4KZC A;  4NAM A;  3PHX B;  2RLO A;  4XWX A;  1UGM A;  1XLO A;  1ZYI A;  4XWW A;  1QQR A;  4WJO A;  2PVG C;  3L16 A;  1I4H A;  2XK5 B;  3WYF B;  4GGQ A;  4AS1 A;  1P9D U;  1CQV A;  5IRS A;  5HE3 A;  1EGX A;  3BII D;  3TJP A;  4EE2 A;  2I5F A;  3TFM A;  5C6R A;  4LLG M;  2IFS A;  4IAP A;  2K6Q A;  1PDX A;  5AUI A;  5JHG A;  1WXM A;  1DOI A;  4ICU A;  1AW7 A;  2DX5 A;  1C1Y B;  2HRJ A;  4ZRK A;  2KJH B;  4LJP B;  4EMO A;  4DHJ B;  1UGJ A;  1ACC A;  1LM8 B;  3B1L X;  3B2G A;  2L3Z A;  1D4B A;  3VTV A;  1MKE A;  4EZJ A;  3N9Y C;  2GOW A;  2MDX A;  2IY0 B;  4EUT A;  1V1P A;  2DYM A;  3EA6 A;  3HIZ A;  2ZPN A;  4UDU C;  5HE2 A;  4I6L B;  1DGJ A;  3SFE B;  2IGD A;  2IO2 B;  3KWL A;  3PTF C;  3SD5 A;  1HB6 A;  3A4R A;  1XQQ A;  4NQK E;  2X38 A;  2MBO A;  2IDY A;  2TSS A;  2Y8G A;  1KH0 A;  3BWU D;  3SHQ A;  2GMI C;  2FIF A;  2IGG A;  2LJI A;  1L4D B;  1X11 A;  4EOY A;  4I6P A;  3AE7 B;  2V4I B;  4HWI B;  2J53 A;  1XF5 L;  3UF8 A;  2COP A;  5D3Y A;  4IG7 B;  1EWC A;  3QX1 A;  1E0Z A;  4ZRI A;  1E8W A;  2Z13 A;  1W1G A;  4IOI E;  1E90 A;  3RNB C;  3MPX A;  2NS5 A;  3SFD B;  3PZD A;  4DX9 0;  2V3S A;  3LYY A;  1WFY A;  1R4N B;  2KVR A;  2LVP A;  4KIK A;  4HKQ A;  1TS4 A;  2WXL A;  3Q8C A;  2RQ1 A;  1KJT A;  4ZRP A;  4EZL A;  1WMH B;  3N3K B;  4DXF A;  3MJW A;  4BBN F;  3ODX A;  2NZ8 B;  4F7H A;  3CIR B;  4HAY B;  5C1Z A;  3ZGZ A;  1R4M I;  2ROZ B;  3C8Y A;  1OQN A;  2ONQ A;  3EC8 A;  1T77 A;  1F1H A;  1K51 A;  3DBL B;  2OHF A;  4L1B A;  3PPA A;  2BVC A;  4OT1 A;  1SIF A;  4RNA A;  1MK7 B;  4N58 A;  3RFZ B;  3ZNG C;  3PRM B;  1UWX A;  5HFY A;  2BS4 B;  3HIE A;  1T0S C;  2MJ3 A;  1BUI C;  1XLP A;  3V62 A;  2YS3 A;  4L23 A;  3VQI A;  1MHX A;  5HE1 A;  2LHE A;  3B2F A;  1QLB B;  3U2S C;  3ULC A;  3JW0 X;  2FCQ A;  4IKG A;  3A9K A;  2MBQ A;  3VOQ A;  2YRY A;  3U52 E;  4KHB B;  4IWP A;  4DHJ D;  1JWB D;  1VBG A;  2KDI A;  2KXJ A;  3FIL B;  2JZ3 B;  4ARC A;  4YSZ B;  4MAC A;  1XCQ L;  3PZ8 A;  5BYS A;  1YNT E;  1WZ3 A;  1KF6 B;  4WJN A;  1K50 A;  1NBF C;  2BTE A;  4KKJ A;  4A90 A;  2INN E;  2LGS A;  5M4Y B;  2KTF A;  1DBH A;  1JW9 D;  1DDV A;  2I2Y A;  1TGZ B;  2COD A;  2KZR A;  3VTU A;  4FXC A;  4JK8 A;  2B3A A;  3H7P A;  3RNE C;  3EEC A;  1ZC4 B;  5C79 A;  3FEH A;  3SEB A;  2M8S A;  1PYW D;  4ZDV A;  4BVU C;  2WXN A;  4PYU A;  3DBH I;  1MIZ B;  3E56 A;  3AH7 A;  3RI7 C;  1TIF A;  3J9C A;  3AEF B;  3GB1 A;  3KUZ A;  1L0X B;  1PFJ A;  2ZNV C;  1NI2 A;  3IAM 1;  1UH6 A;  4N6E B;  3QWM A;  5HKH A;  1JWM D;  1WGK A;  3SNH A;  4GN1 A;  3IHP C;  3LB8 C;  1WI1 A;  2A4Z A;  3RNA C;  4ASW C;  3FSS A;  4EKU A;  3ZNZ B;  1B55 A;  4W9C A;  3AUL A;  4R3D A;  3NVV A;  1WYG A;  3RT3 B;  4HB3 B;  1NTY A;  5C3J B;  1V5U A;  4GOC A;  1MHH E;  2KVZ A;  2EC1 A;  4RH6 A;  1HZ5 A;  2CHX A;  1PMS A;  3VFK A;  4ANW A;  3E9P A;  2YS5 A;  3ZLZ A;  4ZHP A;  2FJ9 A;  3L54 A;  1OFF A;  4HJG E;  2Z0E B;  2DX5 B;  2RVB B;  5IP4 D;  2LGX A;  1GB4 A;  1A70 A;  1UUP A;  5EE0 A;  2BB6 A;  2KWV B;  1OY2 A;  3ABV B;  5DIF B;  1KFY B;  4BBN C;  3A98 B;  4ZYS A;  4DIX A;  5CHW A;  4ZHO A;  2CB8 A;  2WXH A;  4XC2 A;  1SEB D;  2CQU A;  2WU2 B;  2N1V A;  4MDK E;  5L95 C;  2MW5 A;  3TVV A;  1WX7 A;  2KX3 A;  3M63 B;  4Q2J A;  4KGR A;  3MC0 B;  3KZ1 A;  2J52 A;  4RCO A;  4DXA B;  3K9O B;  1LW3 A;  3DXE A;  2N9P C;  4MH0 E;  3NJT A;  4KSK C;  4TYZ A;  1RFA A;  2Z8L A;  2O2V A;  1TQZ A;  3BIN A;  1FRD A;  3NVY A;  4LDT D;  2FUH B;  5J2R A;  2KQS A;  2MCN B;  4CQN A;  4GSW A;  2LVQ A;  4MT5 A;  5J3Y A;  2JZP A;  5C5B A;  1Y19 B;  4GOU A;  3V6E B;  2L7R A;  5G5H A;  4PNK A;  1F52 A;  1FRR A;  1WXQ A;  2L00 B;  2BYV E;  1P5T A;  3A8P A;  1M7E A;  3H6N A;  4KIK B;  1P0R A;  2KWC A;  1GUA B;  1GPX A;  1P1A A;  3NWF A;  3FC4 A;  1VZ8 A;  2MP2 A;  1SIJ A;  4KGS A;  2HE7 A;  2EEL A;  4CSQ A;  1UWM A;  1G6J A;  3Q2A C;  2V4L A;  2MHJ A;  3V60 A;  1AWD A;  2KD0 A;  2WWZ A;  4MK0 A;  5IAA C;  4WWO A;  2UZS A;  2KCJ A;  4WQM A;  3PV1 A;  3SR6 A;  2MH7 A;  3ZDM C;  3OAN A;  4IDI A;  1SE2 A;  4B0M A;  3URY A;  1BAK A;  1IGC A;  2MBB B;  4JIO U;  2JRI B;  3UQA A;  2RSU A;  2NPT B;  4RM8 A;  1NYR A;  1PLS A;  1TKG A;  2WXI A;  5I2M A;  2OQB A;  2KIE A;  2KC2 A;  5G5G A;  4C4V B;  3EHV A;  3PS6 A;  3VUW A;  3BK2 A;  1FCC C;  2JY6 A;  4MEL A;  1HB8 A;  4BKS D;  1SXT A;  3OWE B;  1IUE A;  2B76 B;  3TBL D;  3BVG A;  1VDV A;  2QJL A;  5GXG B;  1X05 A;  2KHW B;  1XR0 B;  1GB1 A;  2KIG A;  5HI1 A;  1RAX A;  2M17 A;  4PS8 A;  2PVO D;  3KUC B;  3NRZ A;  3QWZ B;  1V86 A;  4J3O D;  4DQO C;  2GBM A;  2KQ7 A;  3H7P B;  1C77 A;  4KKI A;  3AE3 B;  3ENB A;  1L5P A;  2CS4 A;  5AEK B;  2GCL A;  4JKC A;  3AU4 A;  3O96 A;  3KYC D;  4MSM B;  5BMG A;  3DXD A;  4W9G A;  3FLV A;  1AYF A;  3ML4 A;  2KDM A;  2AYO B;  5EE1 A;  4K81 A;  1Z5S B;  4KHO A;  3QIJ A;  1KRH A;  2Z0D B;  4TUU A;  1X86 A;  2INC C;  1D5M C;  1YX6 B;  4C7Y A;  3N1X C;  3PGE A;  1IBX A;  2FJL A;  2OTX A;  4W9L A;  1RYJ A;  3DBS A;  2D9X A;  3ML8 A;  2JYE A;  3MFG A;  2XBB C;  1OMW A;  2EMS A;  4C56 C;  3EGR A;  1E7V A;  3BY4 B;  4ANU A;  2ELB A;  1EM7 A;  3ZXV A;  2PZ1 A;  1WSP A;  1STE A;  4EZK A;  3E66 A;  3WCQ A;  1L7Y A;  3MJ5 A;  1K5D B;  1WJN A;  2LBB A;  2BYE A;  4USA A;  3E9S A;  1IRS A;  3KUD B;  3PVL A;  4BZA A;  2BYT A;  1MPH A;  4YT0 B;  1MIX A;  5D2M B;  1TS2 A;  3KRW A;  2BGF A;  1T0Y A;  3IFW B;  1LB1 A;  1CJE A;  1KLV A;  4JKB A;  1BWN A;  1JAL A;  2Y8F A;  1FXT B;  1GAQ B;  4GDK A;  1FCL A;  2YT0 A;  2WLB A;  1N61 A;  2PKO A;  1XEE A;  5DCN A;  5FI0 A;  3RYT A;  4W9H A;  3UIP B;  2V76 A;  2DBY A;  2RDB C;  1F77 A;  2O6V A;  3U12 A;  3R7Q A;  3ZUN A;  1ZSQ A;  4EFO A;  1M4V A;  5TSS A;  2L1A A;  4AOF A;  2KK8 A;  1MI0 A;  3IVF A;  1KTK A;  4LNN A;  2C7N B;  2BT6 A;  5C5B B;  4Z2N A;  5KQ4 A;  3PZ7 A;  4HRS A;  3Q8F A;  2NCN A;  1P3R A;  2LEK A;  2BB5 A;  4DHZ B;  4KGT A;  4YL8 A;  3TEX A;  3P63 A;  5JLJ B;  5D7G A;  2WXQ A;  3QA8 A;  4FUL A;  4IM2 A;  2OJW A;  1ZUD 2;  3NHE B;  3BJI A;  1V8C A;  2YLM A;  3ZVV A;  4US8 A;  1ZE3 D;  4C80 A;  5BYQ A;  3NWD A;  1V9J A;  3ZRF A;  2QIL A;  2MP2 B;  3CSF A;  2J4X A;  2CAY A;  1HA5 A;  4DDG D;  3W9C B;  5D3V A;  2JZZ A;  4FLH A;  1TBE A;  3C0R B;  2Z14 A;  2IPK D;  2WS3 B;  5C23 A;  1M94 A;  2KO3 A;  4HDO A;  2YVC A;  2Z0Q A;  5KHQ A;  1ZDX A;  3AED B;  1D6E C;  5J17 A;  4MM3 B;  3M95 A;  3WA0 A;  3ZTC A;  4PYZ A;  4II3 B;  4MH8 A;  3NZU A;  5CHF A;  2PPH A;  1XOD A;  5AUK A;  5MPO A;  2Z4D A;  1C9F A;  4HVB A;  1K52 A;  5EE9 A;  1YJ1 A;  2ZW0 A;  1HBK A;  1SSN A;  3JSV A;  2G4D B;  3IAS 1;  1DOX A;  3KLS X;  5GOW B;  2AQ1 B;  1C78 A;  3R3M A;  2LWP A;  3RMK C;  2IBI B;  2KR0 A;  2IO3 B;  1TJ6 A;  2VZK D;  1I42 A;  4HDQ A;  2WXK A;  1FMA D;  2J42 A;  3ULB A;  1CMX B;  4TQ1 A;  4NAW A;  2AQ3 B;  4OZB A;  4F7Z A;  3P4Q B;  2RRF A;  3VR9 B;  2K3U A;  3O13 A;  4H8S A;  3B9J A;  3IXS A;  3TEW A;  1YN5 A;  2RR9 A;  1YQ3 B;  2L0T A;  1SE4 A;  4KSL C;  4OZA A;  5FKA C;  5JZE B;  2REX A;  5IKC M;  2NTT A;  2QHO A;  3W5U B;  2RGF A;  2GUM A;  3KQ4 A;  2X8X X;  2ZVO A;  4JKD A;  1PGB A;  2W9N A;  2NVU I;  2WXG A;  2K8C A;  1IBX B;  1KBL A;  1Z87 A;  3R66 C;  3VAW A;  1TZ1 A;  1V80 A;  1Q0W B;  1ZOY B;  2KKC A;  4W9K A;  1QQG A;  4FA6 A;  4HPM B;  4JWU C;  4HJK A;  2PIA A;  2EKI A;  1UEL A;  2W2W A;  1VJK A;  2MWN B;  4TQ0 A;  2M38 A;  2INP E;  4L6E A;  2KFJ A;  2L05 A;  4F7G A;  2COA A;  3RD2 A;  1T5X D;  2SAK A;  4FJV B;  3AJ4 A;  4BKT A;  3PT2 B;  1U5G A;  3D8F A;  4K2O A;  2N9X A;  4YTM B;  1U5E A;  2Q5W D;  1JWS D;  1MG8 A;  4G11 A;  3GE3 C;  3PVU A;  1TXD A;  3EUB 2;  4G50 A;  2KUP A;  4F7U P;  1FXA A;  2KN4 A;  1Y8R C;  2QC8 A;  2RD0 A;  3P6A A;  2WNM A;  3BVZ A;  4IOY X;  2KC1 A;  4HB0 B;  2KUQ A;  1MK9 B;  3RZW C;  3KRX A;  4RGN A;  1ROE A;  3GE8 C;  1BTN A;  5D3D A;  2KFK A;  2G4S A;  2JP2 A;  4X57 B;  3H8H A;  2KTR B;  4DBB A;  2ICI A;  2L0F A;  4ZRQ A;  1L0V B;  1WGH A;  3QCA A;  4I6N B;  4HKZ E;  2I1K A;  2FUG 1;  2LVO A;  4CHK A;  3AE4 B;  3ZNI D;  4HHV A;  2P0D A;  2RDH A;  1E5W A;  4JL9 A;  4P7I A;  2L8J A;  2R61 A;  1J7B A;  3K9P B;  4B6W A;  1JDE A;  3OJ3 A;  3AM9 A;  4M02 A;  1ENF A;  2JWU A;  1R7S A;  1RJ2 A;  1C4C A;  1XLN A;  2E3T A;  2N7J A;  2WH5 A;  2MJD A;  2X18 A;  2JUO A;  5FR6 A;  2NMQ A;  3W1Y A;  4M00 A;  5HHD G;  4YTN B;  2PJH A;  1C4P A;  4WIP A;  2VRR B;  5E6P A;  3WAL A;  2XQN M;  1SE9 A;  2BCJ A;  2GI9 A;  4TKN A;  1HQR D;  1E8Z A;  1L4Z B;  1K8R B;  2IJ0 A;  3Q3N C;  2LI5 A;  3VIA A;  1ZGU B;  2BKF A;  1WXA A;  4F1S A;  1JRO A;  1W1D A;  2V0G A;  4HB2 B;  2C60 A;  2RPQ A;  3TEY A;  2ZCB A;  1Q67 A;  2W54 A;  1WGG A;  3AN1 A;  2L76 A;  4PS3 A;  2IZV B;  1XD3 B;  3ZJT A;  1XKE A;  3BVM A;  2Q13 A;  4JKG A;  1LFD A;  2M0X A;  4AJY B;  3R2T A;  4RGM A;  1V49 A;  2ELA A;  2DIK A;  3DBR B;  2N0Y A;  4A8X C;  1YD8 U;  2K39 A;  5C2T B;  2DKP A;  1UF0 A;  3TEZ A;  5HE0 A;  3PVW A;  3U8Z A;  4CYE A;  3ZKJ C;  1RWS A;  1UZX B;  2FAZ A;  3DWG C;  2K00 A;  2K49 A;  2KX0 A;  2G9H D;  4LNO A;  3NOB A;  4G3X B;  4WWN A;  3AEC B;  2MKR A;  2CU1 A;  3AI5 A;  4FHK A;  3ENE A;  2LG1 A;  2DEN B;  2VSZ A;  3NZS A;  4KAX B;  2QCZ A;  4US9 A;  1HZ6 A;  4GDL A;  4AP4 C;  2COC A;  2BBC A;  5BMI A;  4A6F A;  4XE0 A;  1WG7 A;  1SHC A;  1WR1 A;  1ESF A;  4XWT A;  1NTV A;  1F9J A;  3N1Z C;  1WRI A;  4ARI A;  3T3O A;  4MY6 A;  1ZM0 A;  3AEG B;  4KDL B;  2DZI A;  2FCN A;  3SBG A;  2YEP B;  2RSG A;  4GZU A;  5KQ1 A;  2E2X A;  2ZPY A;  3KH0 A;  5JVL A;  2P0H A;  4D6W A;  3B0A A;  1I4G A;  3U7Z A;  2AWT A;  2RNR B;  2D2Q A;  3GZN I;  1T0Q C;  3L4P A;  1V1P B;  4W9F A;  3TSS A;  2RPV A;  4W9D A;  4QJ5 B;  1DYQ A;  2N7E A;  4JX1 C;  1TT5 B;  1KZ7 A;  3C19 A;  1B1Z A;  1N3H A;  4OVZ A;  2IYB A;  5BMH A;  4IWQ A;  1HEZ E;  1NU2 A;  3NWA A;  2H7E A;  2DN6 A;  2EJ8 A;  4AUQ C;  4LK0 M;  1FAO A;  2P0F A;  1V88 A;  1KC7 A;  2DZJ A;  1JWU D;  2FBW B;  4JPS A;  1I4Q A;  1VZ7 A;  3U4E G;  1E8Y A;  1GC7 A;  3Q8E A;  1N5X A;  4A3O A;  2LGD A;  3AU5 A;  3ZJU A;  2YT2 A;  1WX9 A;  3D8D A;  1U5F A;  2M1M A;  4GPT B;  4DX8 A;  4M01 A;  1V6E A;  1FHO A;  5KCV A;  1BML C;  2N4F A;  4GMV A;  5LLI A;  1GOZ A;  4HRO A;  4KDI C;  3FVC A;  4N59 A;  2JX5 A;  2IO0 B;  2YS1 A;  1QOA A;  2N9E B;  2WXF A;  1YN4 A;  4TV3 A;  3TCA A;  2IO1 B;  2SEB D;  2EMT A;  3DVG X;  4KVG B;  1BXT A;  4WVF B;  1EUV B;  4D2K A;  3DDC B;  2DAJ A;  3UIO B;  1ZVR A;  3BZD B;  2VH1 A;  1J7A A;  2KWU B;  2DHI A;  3RZF A;  3EFU A;  3VDZ A;  4WJQ A;  5T8I A;  4YTP B;  5D6J B;  2KLG A;  1X1M A;  2K6D B;  2YEP F;  2KAC A;  3N30 A;  3ZDT A;  4JQW C;  3AEA B;  4LTU A;  3A9K B;  3VH4 B;  1ZP0 B;  4J6I A;  2M56 B;  3MHZ A;  2K8B A;  2QIE B;  1XO3 A;  4JKH A;  3N7C A;  1PQS A;  3Q3F A;  1FFU A;  1FXI A;  2H7D A;  2RGN B;  4AJW A;  3UIN B;  1N62 A;  3E9L A;  4RGO S;  2GB1 A;  2BS2 B;  3NW8 A;  2D07 B;  1QOF A;  1OTR B;  2BWE S;  2UZR A;  3AB5 A;  4JKG B;  1YJI A;  4MJS A;  2D3G A;  1FGZ A;  1UEF A;  1R4M B;  3G9W A;  4FJZ A;  5AZH A;  3OHM B;  4GLS C;  1UPR A;  1F0Z A;  2KAJ A;  1XLQ A;  4W9E A;  1Q1O A;  1NDD A;  2CU3 A;  3OAW A;  1FHX A;  2LGI A;  1P3Q U;  3X0W A;  4GB9 A;  2LRU A;  3A33 B;  5J18 A;  2Z0O A;  2BWF A;  2L32 A;  1GGO A;  3RNG C;  1TZO A;  3NS8 A;  1XXG A;  2K25 A;  3A9J A;  3AEB B;  1TY0 A;  3ONS A;  1K5G B;  5FI1 A;  1HTO A;  3TW1 A;  5KHO A;  2Y5P A;  2DYN A;  3B77 A;  2W3S A;  2WXJ A;  3VR8 B;  3WAP A;  4A6F B;  3Q3J A;  1I4R A;  2W55 A;  4P1B C;  2GLS A;  1T0R C;  5H8Y E;  2JYT A;  2LXA A;  1WE6 A;  2I1J A;  3VUX A;  1D3Z A;  2JU6 X;  2M14 A;  2HDE A;  4AWJ A;  2K2U A;  2ASQ A;  1WR6 E;  2PEA A;  1UNP A;  5D3W A;  1OQQ A;  3NUH B; 
#chains in the Genus database with same CATH homology
 1R4N I;  3IBE A;  1KOT A;  2GS0 A;  3QK0 A;  3DVN U;  2R09 A;  4ZYN A;  4JLC A;  5D3X A;  1X1G A;  3V61 A;  3HQC A;  1WE7 A;  2M4N A;  3CF6 E;  4HCN B;  2BF8 B;  3DBL I;  5JHH A;  2KJ6 A;  3FP5 A;  1J0W A;  3VXW A;  2LKO A;  2K1F A;  2FCS A;  3L17 A;  1WYW B;  1DDW A;  3V5W A;  3E9O A;  2DA0 A;  2WDT B;  2CKH B;  3B08 A;  3DVG Y;  1J8C A;  1DYN A;  1GNU A;  2O2V B;  2DZM A;  2J0J A;  3KVF B;  1EF5 A;  4IM3 A;  1L2N A;  3H9D A;  1QC6 A;  4HCP B;  4HPL B;  1I7A A;  2DZK A;  1WY8 A;  2HJ8 A;  2G35 A;  2IY1 B;  3A1Q A;  2YF0 A;  1W1H A;  2MSE D;  2C7M B;  4HAV B;  1ZKH A;  1XD4 A;  3T9L A;  1ST7 A;  5JP4 A;  4CO7 A;  5E6N A;  4JKA A;  2KDB A;  2N23 A;  1IYF A;  2ZCC A;  3GOE A;  2D11 A;  3KY9 A;  2DAF A;  4IFS A;  1I35 A;  1WXS A;  3ZVR A;  4EEW A;  1WGY A;  1A5R A;  4W9J A;  1S3S G;  3QHT A;  1YQB A;  2DYQ A;  5DI9 B;  1OQY A;  3U30 A;  2Y5B B;  2KAN A;  2VKI A;  2QKL A;  1VBH A;  4WQO B;  2DFK A;  2JXX A;  2NBW B;  3M62 B;  4HAU B;  4M8N A;  5EDS A;  2KLC A;  1V2Y A;  3QAR A;  4NY0 A;  1LXD A;  2MFQ A;  5IJM A;  2PE9 A;  4K7U A;  1ZC3 B;  3ODW A;  2ZJD A;  2X0S A;  2CHZ A;  3MDB C;  1V5P A;  2MBE A;  2XEW A;  2R2O A;  4MGZ E;  5CLQ B;  1WX8 A;  3QC8 B;  5AZF A;  1AAR A;  4MJS B;  1FB8 A;  2COF A;  4G0N B;  1P98 A;  1DRO A;  2CY4 A;  1WJ1 A;  2K8H A;  2QKM A;  2MX2 A;  4XZ4 A;  3PRP B;  5TR5 A;  4JK7 A;  2FID A;  3A9J B;  4DDI D;  2UWQ A;  2FDQ A;  4E74 A;  3H1U A;  1YX5 B;  2ADZ A;  3FM8 C;  5LXI B;  1U4A A;  1HE8 A;  3HM6 X;  3KW5 B;  2K2J A;  2G3Q B;  1XX0 A;  4BKG A;  3QAQ A;  3ZRC A;  3ZO5 B;  4CHJ A;  4RMA A;  2C9W B;  4WJP A;  5EFX A;  3P7Z A;  1U2B A;  4BOS C;  4K2P A;  2ZEQ A;  4K7S A;  3P2B A;  1VD2 A;  3W1S A;  4E71 A;  1WRD B;  4BKS A;  1EF1 A;  1X1F A;  2HD5 B;  4A6K A;  4GDK B;  3H7S A;  4JK9 A;  2LOZ A;  3DPD A;  2D4Q A;  2P8V A;  3UZT A;  2GBN A;  2GJY A;  4M8M A;  2J7Q B;  1UPQ A;  1WM2 A;  2O6V B;  3GYP A;  2D9V A;  4NPN A;  3ZNH B;  5LXH A;  3ML9 A;  2R82 A;  3PLV A;  4DHZ E;  3A1Q B;  5DPS A;  2GBJ A;  1V5M A;  4M0W B;  4PS7 A;  1UD7 A;  3APF A;  3T8M A;  2BYF A;  2LAS A;  1EVH A;  1WVH A;  4WAA A;  1BT0 A;  1QZE A;  3WAN A;  4Z2M B;  4EJN A;  4JKF A;  2D9W A;  1LQB A;  3M3J A;  2AEH A;  2UYZ B;  2ROV A;  3QJZ A;  2FCM A;  2FNJ B;  2R0D A;  1V81 A;  5C16 A;  1WI0 A;  4C0A A;  1WJ6 A;  2CRF A;  1WH3 A;  3LJU X;  2DKQ A;  1SGH A;  2DHK A;  4DBG A;  1J19 A;  3PSC A;  1U29 A;  5DPR A;  5L81 A;  2NPT A;  2KNB A;  3CST A;  3D32 A;  2ZVN A;  4MEM A;  1UNQ A;  5DPW A;  4IC7 B;  1GG3 A;  2JT4 B;  1BTK A;  3VUY A;  2MLB A;  5LOP B;  3CIK A;  2NR2 A;  2KJR A;  2OJR A;  1WF9 A;  3JSV B;  3ALB A;  2R2Q A;  2KDF B;  3ECI A;  2W2X D;  3DCG A;  4LDT B;  4Y94 A;  4IWO A;  5GMV A;  1IP9 A;  5JHA A;  4K1R B;  3TIX A;  4GIV A;  2A5U A;  5DPT A;  3CXB B;  3HW2 B;  4KZ0 A;  2O6V D;  4NAW B;  1E8X A;  1UBQ A;  4LCD E;  2AL3 A;  4IW0 A;  1Y5O A;  2DHJ A;  2WX0 A;  3S2A A;  4KHA A;  2CHW A;  2RUK B;  4DWF A;  3JVZ X;  2NBU A;  5G2N A;  4WWP A;  3PRE A;  2OOB B;  4HK2 A;  4MGK E;  3RCZ A;  2MWS B;  2LUL A;  1AWE A;  1XT9 B;  5CX3 A;  3PP2 A;  2JRH A;  1NVL A;  4ICV A;  4GU2 A;  4A3P A;  3AXC A;  1RRB A;  1FGY A;  3TO1 A;  5J3Q A;  1YIW A;  1WM3 A;  4MGY E;  1DDM A;  4A20 A;  3HK0 A;  2KMC A;  5DHA B;  2KMA A;  3RUL A;  4IUM B;  1P6S A;  3KSY A;  3APD A;  1WGR A;  1OEY A;  2J0M A;  4IM0 A;  4N9F 4;  3NSU A;  4NJ6 A;  4ZRJ A;  2I5C A;  4E3C A;  2J0K A;  2LYD A;  4ANX A;  2MRP A;  1EO6 A;  2C7H A;  3SO6 A;  4K17 A;  3L10 B;  4ILG B;  3PG7 A;  2UVM A;  1NTI A;  3F5R A;  2NBV B;  2CR5 A;  2KFK B;  1U5D A;  3A8Q A;  4D0N B;  3PRZ A;  4LJO B;  3PHW B;  1H8C A;  5DHF B;  1GJZ A;  3SDL C;  1H4R A;  3A4S C;  3GYO A;  2JPH A;  2V1Y A;  2HTH A;  2D9Y A;  3OLM D;  4XX5 A;  1TTN A;  3L08 A;  3IG3 A;  2DHZ A;  4HLE A;  4HXD A;  1KI1 B;  2GBK A;  3UQB A;  3VHT C;  2W2X C;  4HB4 B;  3PLU A;  1RRP B;  3F0W A;  4FHJ A;  2G45 B;  1V89 A;  2YT1 A;  4URK A;  4BOZ B;  4HAX B;  4FN2 A;  3RUI B;  2Y7B A;  1EAZ A;  2VRW B;  2CY5 A;  4MM3 A;  3QQ8 B;  4II2 B;  1C3T A;  4A5K A;  1WGU A;  3L13 A;  3VH3 B;  4CHM A;  2MA9 B;  5LON B;  2GCJ A;  3SBT A;  5JHB A;  4NSW A;  3PSE B;  3VTW A;  4NJ7 A;  5JH5 C;  4WSF A;  3DVN V;  2L2I A;  3NY5 A;  4OVU A;  2DYO A;  1FOE A;  2LD9 A;  5D94 A;  1VCB A;  1Z2M A;  4A6H A;  5AZG A;  2L1C A;  4WJ7 A;  1OGW A;  3LDZ E;  1AQC A;  1Q5W B;  2ZZP B;  2JF5 A;  5CLL B;  3CMM B;  2MQJ A;  1GC6 A;  2N7D A;  4NQL B;  2LZ6 A;  4GDL B;  3KYD D;  1ISN A;  1UBI A;  2C5L C;  2XK5 A;  3L0W B;  3RCP A;  4F8C B;  5D27 A;  1V5T A;  4GXB A;  2KDE B;  2LOX A;  3T06 A;  3SUZ A;  2DYB A;  2LUE A;  4RM9 A;  2IYD B;  1J0G A;  4W9I A;  2D9Z A;  3SV1 A;  3R7R A;  5BO4 B;  3HM3 A;  1WZ0 A;  5J3T A;  3APC A;  3TMP B;  1UNR A;  2EKE C;  1WXV A;  4DK5 A;  1KZG A;  2PE6 B;  1S1Q B;  4FJY A;  2N1W A;  5CTR C;  4BFR A;  1M7R A;  1IPG A;  2WYQ A;  3PEG A;  4BBK A;  4B9K A;  5E6O A;  2NMB A;  2DX1 A;  2D10 A;  4KV2 A;  3QBV B;  3OJ4 B;  1OEY J;  4HAW B;  1RLF A;  5L83 A;  1FHW A;  1WGD A;  2WX1 A;  1V61 A;  4GMX B;  1ZW7 A;  4ILH A;  4ILJ A;  4NNJ B;  2BKR B;  2MBH A;  2BPS A;  2KOX A;  3SU8 X;  1KM7 A;  2KN5 A;  3MHS D;  3ZIM A;  2Z59 B;  1WJ4 A;  2ABD A;  2KTR A;  1JRU A;  1WMH A;  2Z0P A;  2DLW A;  2GBR A;  3WIM A;  4YON A;  5IA7 A;  4JGH B;  3I3T B;  3EPY A;  3O65 B;  3DBR I;  1DIK A;  3W1S C;  4PQ0 A;  2JVC A;  1E7U A;  2LRW A;  3U7D A;  2HTH B;  2LJ5 A;  4MT7 A;  3M1I B;  3MTN B;  3DOW A;  4B6H A;  2AL6 A;  1V5O A;  2LGY A;  1XCG A;  2ZNV B;  5CHV C;  3X23 A;  1MAI A;  2LXC A;  3TL5 A;  4ANV A;  5G55 A;  4JKE A;  3ZW3 A;  4MGI E;  3WAM A;  3N32 A;  4HAZ B;  1WGQ A;  3DXC A;  3DQV A;  4B95 A;  4K7W A;  1I2H A;  3VVW B;  2DTC A;  4FAD A;  2YSZ A;  4MSQ B;  1U27 A;  3ZTD A;  4OVV A;  3UGB B;  3V6C B;  2J59 M;  1WJM A;  3ODO A;  3HHM A;  2KGX B;  1WIA A;  3LJ3 A;  4HAT B;  1ACA A;  1H10 A;  2JWZ A;  5DH9 B;  3WAO A;  3D8E A;  1WJU A;  3SYX A;  4FBJ B;  3JYU A;  4KZC A;  3PHX B;  2RLO A;  4XWX A;  1UGM A;  4WJO A;  3L16 A;  2XK5 B;  3WYF B;  4GGQ A;  1P9D U;  5HE3 A;  1EGX A;  3TJP A;  2I5F A;  3TFM A;  5C6R A;  2IFS A;  4IAP A;  2K6Q A;  5JHG A;  1WXM A;  4ICU A;  2DX5 A;  1C1Y B;  2HRJ A;  4ZRK A;  2KJH B;  4LJP B;  4EMO A;  4DHJ B;  1LM8 B;  3B1L X;  2L3Z A;  3VTV A;  1MKE A;  4EZJ A;  2GOW A;  2MDX A;  2IY0 B;  4EUT A;  2DYM A;  3HIZ A;  2ZPN A;  5HE2 A;  4I6L B;  2IO2 B;  3PTF C;  3SD5 A;  1HB6 A;  3A4R A;  1XQQ A;  4NQK E;  2MBO A;  2Y8G A;  3SHQ A;  2GMI C;  2FIF A;  1X11 A;  4EOY A;  4I6P A;  4HWI B;  3UF8 A;  2COP A;  5D3Y A;  4IG7 B;  3QX1 A;  4ZRI A;  1E8W A;  1W1G A;  1E90 A;  3MPX A;  2NS5 A;  3PZD A;  4DX9 0;  2V3S A;  1WFY A;  2KVR A;  2LVP A;  4KIK A;  2RQ1 A;  1KJT A;  4EZL A;  1WMH B;  3N3K B;  3MJW A;  4BBN F;  3ODX A;  2NZ8 B;  4F7H A;  5C1Z A;  4HAY B;  1R4M I;  2ROZ B;  1OQN A;  3EC8 A;  3PPA A;  1SIF A;  1MK7 B;  3ZNG C;  3PRM B;  3V62 A;  2YS3 A;  3VQI A;  5HE1 A;  3ULC A;  3JW0 X;  2FCQ A;  3A9K A;  2MBQ A;  3VOQ A;  2YRY A;  4KHB B;  4IWP A;  4DHJ D;  1VBG A;  2KDI A;  2KXJ A;  2JZ3 B;  1WZ3 A;  4WJN A;  1NBF C;  2KTF A;  1DBH A;  1DDV A;  1TGZ B;  2COD A;  2KZR A;  3VTU A;  4JK8 A;  2B3A A;  3H7P A;  3EEC A;  1ZC4 B;  5C79 A;  3FEH A;  2M8S A;  4ZDV A;  4BVU C;  4PYU A;  3DBH I;  1MIZ B;  3KUZ A;  1PFJ A;  2ZNV C;  1NI2 A;  1UH6 A;  3QWM A;  5HKH A;  3SNH A;  4GN1 A;  3IHP C;  1WI1 A;  2A4Z A;  4ASW C;  3FSS A;  4EKU A;  3ZNZ B;  1B55 A;  4W9C A;  3AUL A;  3RT3 B;  4HB3 B;  1NTY A;  1V5U A;  4GOC A;  2EC1 A;  2CHX A;  1PMS A;  3VFK A;  4ANW A;  3E9P A;  2YS5 A;  3ZLZ A;  2FJ9 A;  3L54 A;  2Z0E B;  2DX5 B;  2RVB B;  2LGX A;  2KWV B;  1OY2 A;  5DIF B;  4BBN C;  3A98 B;  5CHW A;  2CB8 A;  4XC2 A;  2CQU A;  2N1V A;  4MDK E;  5L95 C;  2MW5 A;  3TVV A;  1WX7 A;  2KX3 A;  3M63 B;  3KZ1 A;  4DXA B;  3K9O B;  4MH0 E;  1LW3 A;  3DXE A;  2N9P C;  4KSK C;  4TYZ A;  1RFA A;  2O2V A;  1TQZ A;  3BIN A;  4LDT D;  2FUH B;  5J2R A;  2KQS A;  2MCN B;  4GSW A;  2LVQ A;  5J3Y A;  5C5B A;  1Y19 B;  3V6E B;  2L7R A;  4PNK A;  2L00 B;  2BYV E;  1P5T A;  3A8P A;  1M7E A;  3H6N A;  4KIK B;  1P0R A;  2KWC A;  1GUA B;  1P1A A;  2MP2 A;  2HE7 A;  1G6J A;  2V4L A;  3V60 A;  2KD0 A;  2WWZ A;  4MK0 A;  5IAA C;  4WWO A;  2UZS A;  2KCJ A;  3PV1 A;  3ZDM C;  3OAN A;  1BAK A;  2MBB B;  4JIO U;  2JRI B;  3UQA A;  2RSU A;  2NPT B;  4RM8 A;  1PLS A;  2OQB A;  2KC2 A;  3EHV A;  3PS6 A;  3VUW A;  2JY6 A;  4MEL A;  1HB8 A;  4BKS D;  3TBL D;  1X05 A;  2KHW B;  1XR0 B;  1RAX A;  2M17 A;  4PS8 A;  3KUC B;  3QWZ B;  1V86 A;  2GBM A;  2KQ7 A;  3H7P B;  3ENB A;  2CS4 A;  5AEK B;  2GCL A;  4JKC A;  3AU4 A;  3O96 A;  3KYC D;  4MSM B;  3DXD A;  4W9G A;  3FLV A;  3ML4 A;  2AYO B;  4K81 A;  1Z5S B;  4KHO A;  3QIJ A;  2Z0D B;  4TUU A;  1X86 A;  1YX6 B;  3PGE A;  2FJL A;  2OTX A;  4W9L A;  3DBS A;  2D9X A;  3ML8 A;  2XBB C;  1OMW A;  2EMS A;  1E7V A;  3BY4 B;  4ANU A;  2ELB A;  2PZ1 A;  4EZK A;  3E66 A;  1L7Y A;  1K5D B;  1WJN A;  2LBB A;  2BYE A;  1IRS A;  3KUD B;  3PVL A;  1MPH A;  1MIX A;  5D2M B;  3KRW A;  2BGF A;  1T0Y A;  3IFW B;  1LB1 A;  1KLV A;  4JKB A;  1BWN A;  4GDK A;  2Y8F A;  1FXT B;  2YT0 A;  5DCN A;  5FI0 A;  3RYT A;  4W9H A;  3UIP B;  2V76 A;  2O6V A;  3R7Q A;  3ZUN A;  1ZSQ A;  4EFO A;  4AOF A;  2KK8 A;  3IVF A;  2C7N B;  5C5B B;  4Z2N A;  5KQ4 A;  2NCN A;  1P3R A;  4DHZ B;  4YL8 A;  5JLJ B;  5D7G A;  3QA8 A;  4FUL A;  4IM2 A;  3NHE B;  3BJI A;  2YLM A;  3ZVV A;  1V9J A;  3ZRF A;  2MP2 B;  3CSF A;  2CAY A;  4DDG D;  5D3V A;  2JZZ A;  4FLH A;  1TBE A;  3C0R B;  5C23 A;  1M94 A;  2KO3 A;  4HDO A;  2YVC A;  2Z0Q A;  5KHQ A;  5J17 A;  3M95 A;  3WA0 A;  3ZTC A;  4PYZ A;  4II3 B;  3NZU A;  5CHF A;  2PPH A;  1XOD A;  4HVB A;  1YJ1 A;  1HBK A;  3JSV A;  2G4D B;  5GOW B;  3R3M A;  2LWP A;  2IBI B;  2IO3 B;  1TJ6 A;  1I42 A;  4HDQ A;  3ULB A;  1CMX B;  4TQ1 A;  4NAW A;  4F7Z A;  4H8S A;  2RR9 A;  2L0T A;  4KSL C;  5JZE B;  2REX A;  2QHO A;  2RGF A;  2ZVO A;  4JKD A;  2W9N A;  2NVU I;  2K8C A;  1KBL A;  1Z87 A;  3R66 C;  3VAW A;  1TZ1 A;  1V80 A;  1Q0W B;  2KKC A;  4W9K A;  1QQG A;  4FA6 A;  4HPM B;  4HJK A;  1UEL A;  2W2W A;  2MWN B;  4TQ0 A;  2M38 A;  4L6E A;  2KFJ A;  2L05 A;  4F7G A;  2COA A;  3RD2 A;  4FJV B;  3AJ4 A;  4BKT A;  3PT2 B;  1U5G A;  3D8F A;  4K2O A;  2N9X A;  1U5E A;  1MG8 A;  4G11 A;  3PVU A;  1TXD A;  4G50 A;  2KUP A;  4F7U P;  1Y8R C;  2RD0 A;  3P6A A;  4IOY X;  2KC1 A;  4HB0 B;  1MK9 B;  3RZW C;  3KRX A;  1BTN A;  2KFK A;  2G4S A;  2JP2 A;  4X57 B;  2KTR B;  4DBB A;  2L0F A;  1WGH A;  3QCA A;  4I6N B;  2I1K A;  2LVO A;  4CHK A;  3ZNI D;  4HHV A;  2P0D A;  1E5W A;  4JL9 A;  4P7I A;  2L8J A;  3K9P B;  4B6W A;  1JDE A;  3OJ3 A;  1RJ2 A;  5FR6 A;  2WH5 A;  2X18 A;  2JUO A;  3W1Y A;  2PJH A;  2VRR B;  5E6P A;  3WAL A;  2XQN M;  1SE9 A;  2BCJ A;  4TKN A;  1E8Z A;  1K8R B;  2LI5 A;  3VIA A;  1ZGU B;  2BKF A;  1WXA A;  4F1S A;  1W1D A;  4HB2 B;  2C60 A;  2RPQ A;  2ZCB A;  1Q67 A;  1WGG A;  2L76 A;  4PS3 A;  2IZV B;  1XD3 B;  1XKE A;  2Q13 A;  4JKG A;  1LFD A;  2M0X A;  4AJY B;  1V49 A;  2ELA A;  2DIK A;  2N0Y A;  1YD8 U;  2K39 A;  2DKP A;  5HE0 A;  3PVW A;  3U8Z A;  4CYE A;  3ZKJ C;  1UZX B;  2FAZ A;  2K00 A;  2KX0 A;  3NOB A;  4G3X B;  4WWN A;  2MKR A;  2CU1 A;  3AI5 A;  4FHK A;  3ENE A;  2LG1 A;  2DEN B;  2VSZ A;  3NZS A;  4KAX B;  4GDL A;  4AP4 C;  2COC A;  4A6F A;  1WG7 A;  1SHC A;  1WR1 A;  1NTV A;  1F9J A;  4MY6 A;  1ZM0 A;  4KDL B;  2DZI A;  2FCN A;  3SBG A;  2RSG A;  4GZU A;  5KQ1 A;  2E2X A;  2ZPY A;  3KH0 A;  5JVL A;  2P0H A;  3B0A A;  2AWT A;  2RNR B;  2D2Q A;  3GZN I;  4W9F A;  4W9D A;  2N7E A;  1KZ7 A;  1N3H A;  2IYB A;  4IWQ A;  1NU2 A;  2H7E A;  2DN6 A;  2EJ8 A;  4AUQ C;  1FAO A;  2P0F A;  1V88 A;  1KC7 A;  2DZJ A;  1E8Y A;  1GC7 A;  4A3O A;  2LGD A;  3AU5 A;  1WX9 A;  3D8D A;  1U5F A;  2M1M A;  4GPT B;  4DX8 A;  1V6E A;  1FHO A;  5KCV A;  2N4F A;  4GMV A;  5LLI A;  4KDI C;  2YS1 A;  2IO0 B;  2N9E B;  4TV3 A;  3TCA A;  2IO1 B;  2EMT A;  3DVG X;  4KVG B;  4WVF B;  1EUV B;  3DDC B;  3UIO B;  2DAJ A;  1ZVR A;  2KWU B;  2DHI A;  3RZF A;  3EFU A;  3VDZ A;  4WJQ A;  5D6J B;  2KLG A;  1X1M A;  2K6D B;  3N30 A;  3ZDT A;  4JQW C;  3A9K B;  3VH4 B;  4J6I A;  2K8B A;  4JKH A;  3N7C A;  1PQS A;  3Q3F A;  2H7D A;  2RGN B;  4AJW A;  3UIN B;  3E9L A;  2D07 B;  1OTR B;  2BWE S;  2UZR A;  4JKG B;  4MJS A;  2D3G A;  1FGZ A;  1UEF A;  3G9W A;  4FJZ A;  5AZH A;  1UPR A;  4W9E A;  1Q1O A;  1NDD A;  3OAW A;  1FHX A;  1P3Q U;  3X0W A;  4GB9 A;  2LRU A;  3A33 B;  5J18 A;  2Z0O A;  2BWF A;  1GGO A;  3NS8 A;  2K25 A;  3A9J A;  3ONS A;  1K5G B;  5FI1 A;  3TW1 A;  5KHO A;  2DYN A;  3WAP A;  4A6F B;  3Q3J A;  2LXA A;  1WE6 A;  2I1J A;  3VUX A;  1D3Z A;  2M14 A;  4AWJ A;  2K2U A;  2ASQ A;  1WR6 E;  2PEA A;  1UNP A;  5D3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...