4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/protein binding
molecule keywords Merlin
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
2ELBA 3VUXA 4DBGA 4HAYB 4WJQA 4GZUA 2J0KA 3ZVRA 2KTRB 4W9KA 2BKFA 2PEAA 2JRHA 3M3JA 4E3CA 1UH6A 4GDKB 5IA7A 5C79A 1QQGA 3PPAA 1Z2MA 1WGGA 2N23A 4XC2A 2G35A 3PP2A 2P8VA 2CHWA 4AJWA 1H8CA 1G6JA 4IM2A 4I6NB 1I2HA 2W2XC 2EKEC 4CHMA 1WJUA 1UEFA 4PQ0A 3DBHI 2CY4A 2BYEA 2CB8A 2CU1A 4CHKA 2KK8A 2KWCA 3P6AA 3M1IB 3PHXB 1FGYA 2DX5B 3M63B 3FSSA 3FM8C 2MP2A 1U5DA 2L05A 3DVNV 3TBLD 3KZ1A 4FN2A 3ZNGC 1WJ6A 1FHOA 1Y8RC 1FGZA 2WDTB 1V5OA 4A6FB 2J59M 5C6RA 2KMAA 2UYZB 1I35A 2NMBA 1TGZB 4FA6A 4FLHA 1WF9A 3TJPA 4W9LA 1M7RA 2MX2A 4BBNC 2DYQA 2COCA 2LRUA 4TQ1A 5DPSA 3VAWA 4WWOA 3VQIA 4KHAA 3EPYA 1DYNA 1R4NI 3W1SA 1L7YA 2O2VB 2BCJA 1XODA 3KRXA 2G45B 2G4DB 2MWNB 1MAIA 4E71A 3DVNU 3CIKA 3VOQA 2R2OA 4CYEA 3RYTA 2N1WA 1GG3A 4EMOA 2K39A 1KZGA 2JRIB 2KX0A 3PSEB 3VFKA 1E8YA 2N4FA 4HDQA 1YX6B 2KCJA 1TBEA 1ZGUB 1WM2A 2JZZA 3JW0X 3QCAA 3ZDMC 3TIXA 5D94A 2WH5A 3VIAA 2GMIC 4HAXB 4MEMA 2Z59B 1EF1A 5C5BA 2PPHA 1M94A 2C7HA 3RULA 5HE3A 2EMSA 3WAPA 3CSTA 4HAUB 3FP5A 3A4RA 4RM8A 2JF5A 2LOZA 3JSVA 1F9JA 1U5FA 3AI5A 3H7PA 5IAAC 1UBIA 3P2BA 3LJ3A 3OANA 3LDZE 3IFWB 3ZW3A 4FJYA 4LDTB 4MGKE 1EO6A 3PG7A 1UNQA 2LUEA 1J19A 2FIDA 4NJ6A 3TL5A 3PV1A 1P6SA 1KLVA 4ANVA 4GMXB 2DAJA 4IW0A 4ZRJA 2DX1A 3R7RA 1HB6A 3TW1A 3WA0A 4W9HA 1X11A 1UGMA 2ZEQA 1WIAA 2YRYA 1X1GA 3UINB 3QWMA 3H6NA 4G11A 1JRUA 2I5FA 4GGQA 2KC1A 1RJ2A 2FCSA 1WYWB 5CHWA 1LM8B 3KH0A 2RGNB 1J0WA 2KFKA 2DKQA 4G3XB 3L0WB 1ZM0A 3A8QA 1V88A 3CMMB 3L16A 1W1HA 3TFMA 1KJTA 3WALA 1WGUA 1P3RA 2MA9B 2WX1A 2IO0B 4AUQC 2KQ7A 4MSQB 2D07B 2KVRA 1N3HA 4MGIE 3UGBB 3EHVA 3KY9A 1UELA 1LQBA 1KI1B 1RAXA 3UF8A 3TVVA 2ROZB 1HB8A 2AWTA 2VRWB 4DX8A 1X1MA 2E2XA 4HXDA 3P7ZA 2K2JA 1WE6A 1UBQA 4W9FA 3GYPA 4HPMB 1U2BA 3RCZA 2L00B 4EZLA 3O96A 4NAWB 4GXBA 2RNRB 2JVCA 3CF6E 2L1CA 3A9KB 4FULA 2D9ZA 1WG7A 2D10A 4FADA 5C1ZA 2K25A 2K8HA 5JZEB 1NVLA 4KSKC 2IY1B 3V61A 4W9JA 1WR6E 1PLSA 1V9JA 2OQBA 2M14A 2EC1A 2KLGA 4KIKB 1NTVA 4CHJA 2N9EB 5JHHA 1S3SG 1V80A 3A8PA 2ZCCA 3ZNHB 4B9KA 1U5GA 1YIWA 3ZUNA 2KJRA 5HE0A 3SV1A 1E8XA 5C5BB 3D8FA 1TJ6A 2KHWB 2RUKB 1WGRA 4JLCA 2GJYA 2RR9A 5E6NA 1R4MI 1SGHA 4F7HA 2C5LC 1KM7A 3JSVB 3X23A 1AQCA 2DHKA 2KFJA 2OTXA 2HTHA 1X86A 1EVHA 4HCNB 4FJZA 3KVFB 3PRPB 5J2RA 2FJ9A 2KQSA 5CTRC 3SU8X 2Q13A 2N7EA 4XWXA 2M8SA 2QKMA 3WAOA 1UPQA 4IWQA 4XX5A 4PYZA 2UVMA 2KN5A 2COFA 1WMHA 2MWSB 3PVLA 1WY8A 2LULA 4M8MA 2KDFB 5G55A 2K8BA 4EFOA 2KXJA 4X57B 5AZGA 1V86A 2JT4B 2K6QA 2RD0A 1WXSA 2LVOA 3RUIB 4K2OA 2LZ6A 1X1FA 2KNBA 4HCPB 1BWNA 4G0NB 3SYXA 4ANUA 3AU5A 4TV3A 2L8JA 2BWFA 4CO7A 1PFJA 1QC6A 1D3ZA 2L3ZA 2C9WB 3IVFA 2O6VB 2Y7BA 2LG1A 2IFSA 3KSYA 5DPRA 4EKUA 4WJPA 1TQZA 2D4QA 2J0MA 4MGYE 3C0RB 4L6EA 2AL6A 4EZJA 4DWFA 1PQSA 2YT0A 2UZSA 2FCNA 3APDA 1V5TA 3MHSD 2JP2A 1WZ0A 2KDIA 5JHGA 2V4LA 4BKGA 2Z0QA 3AXCA 4B95A 3KYDD 3A1QA 1J0GA 3ZRCA 2XEWA 5CHVC 4W9CA 3EC8A 2YF0A 5CX3A 2P0FA 1M7EA 2RVBB 4WVFB 4ASWC 2DHZA 2W9NA 5J17A 3QAQA 4HLEA 5AZFA 3DCGA 1WXVA 1V5UA 2CODA 2V76A 2D9YA 4PYUA 2ABDA 3V62A 1ZC4B 1FHWA 4GIVA 2NCNA 1VCBA 4Z2NA 1WJMA 5KQ1A 2JXXA 2C60A 4BVUC 4H8SA 3ML4A 1U27A 4IUMB 2MCNB 1WI1A 3DBLI 3N7CA 2ROVA 5D3XA 4HATB 2BF8B 2ZVOA 2YVCA 2D2QA 1Z5SB 2KJ6A 2WYQA 4WAAA 2M0XA 4HB3B 5CHFA 2I1JA 3VH3B 2BGFA 1EGXA 2D11A 1XKEA 1P0RA 2CQUA 3UIOB 3FLVA 5DIFB 1V5MA 1RRPB 2JUOA 3PSCA 1WJ4A 2WWZA 4W9GA 4HB2B 4ANWA 1WGHA 2MBEA 2QKLA 4DHZB 3MDBC 4MGZE 4GPTB 5L95C 2ZPYA 3FEHA 3BY4B 3CXBB 1E90A 2MQJA 4MT7A 5G2NA 2BYFA 4K2PA 1V6EA 5D7GA 3R3MA 2FDQA 2VSZA 1RLFA 1P9DU 4JQWC 4DK5A 2N9PC 4HWIB 1UPRA 1LFDA 2CKHB 2KO3A 3N3KB 3KRWA 2GOWA 4BOZB 3HQCA 2C7MB 1WJ1A 1BT0A 3UQAA 2LGXA 2MLBA 5LLIA 2Z0EB 4K7SA 2IZVB 4KZ0A 2N9XA 2MW5A 1SE9A 2LWPA 4JL9A 2DHJA 4NQKE 2Z0OA 3DOWA 4KHOA 5E6OA 1K5DB 2KLCA 1V49A 3BJIA 3SHQA 5DHAB 1P3QU 2NPTA 1V81A 3ULBA 5JHAA 2REXA 2L0FA 2LBBA 2HE7A 1U5EA 2RSUA 4HVBA 1Z87A 1OEYA 2I1KA 1XQQA 3IHPC 2GBJA 4II2B 4RMAA 3NZUA 4WQOB 3AJ4A 2HJ8A 3QARA 5TR5A 2L2IA 3VTUA 2CY5A 3GZNI 3VUWA 2KWUB 3N30A 1OY2A 4IM0A 3N32A 4IM3A 3PT2B 3JYUA 3IG3A 3T06A 2YLMA 4JGHB 3SUZA 4A3OA 2EMTA 3GOEA 1IYFA 4K7UA 4M8NA 4URKA 5DH9B 2MBHA 1DBHA 4F7GA 2K6DB 3PVWA 4A20A 5L81A 4GMVA 1NI2A 5J3QA 2DLWA 2NZ8B 5HE1A 2FUHB 4IWOA 5J18A 3MTNB 3OLMD 4OVUA 1CMXB 4F7UP 4MELA 3ZNZB 5IJMA 4MDKE 2KC2A 2MKRA 4MY6A 3W1SC 3DXDA 1P1AA 2KJHB 3RZFA 1XR0B 3ZNID 4NSWA 2ZJDA 3UQBA 2MBBB 3PREA 2MP2B 4YONA 3HIZA 2XBBC 1W1GA 2K8CA 2KX3A 1WRDB 2L0TA 1AARA 2G3QB 1XD3B 5LXIB 1C1YB 4F8CB 5C23A 5D6JB 4TQ0A 2KTRA 4WSFA 1BTNA 3RD2A 2KANA 4GDKA 1OEYJ 3F0WA 1OTRB 4IOYX 2DN6A 2J7QB 3PRMB 3MPXA 1MG8A 2DYMA 5E6PA 3TO1A 4DBBA 2KKCA 3PZDA 2DENB 2NBVB 1ST7A 1RRBA 2VRRB 1NU2A 1V89A 3AULA 5DPTA 1PMSA 1OQNA 2B3AA 3F5RA 2LXCA 2DHIA 1XCGA 2AL3A 1YD8U 2LGDA 4GB9A 1TTNA 3M95A 1DDWA 2GBRA 4B6WA 4NQLB 3VTVA 1Y19B 2CRFA 2BKRB 3QJZA 3ZDTA 3ECIA 3OJ3A 3SD5A 3VHTC 4IG7B 1WR1A 2JY6A 3QX1A 4MJSA 2J0JA 3RT3B 2FAZA 1ZVRA 4TKNA 4A6FA 4A6KA 5DPWA 5KHQA 4LJOB 3VTWA 4EEWA 4BBKA 2N7DA 1LXDA 2JPHA 1XT9B 2NR2A 3QBVB 3QIJA 5D3WA 2DZKA 1TZ1A 2UZRA 4M0WB 2NPTB 2MDXA 3QHTA 2DZMA 4MM3A 1K5GB 3PEGA 3H7PB 1S1QB 3VXWA 4LJPB 1E8ZA 2KZRA 1E8WA 4Y94A 4OVVA 2D9XA 1GUAB 2O2VA 4GSWA 4DHJD 3DBRI 1Q67A 2M17A 2KDEB 3DXCA 2R2QA 1BAKA 3KUDB 4HB0B 2JZ3B 2K00A 4J6IA 3LJUX 4BKSA 4HJKA 3ZTDA 4N9F4 4W9IA 2COPA 2L76A 2LJ5A 4FHJA 4HPLB 2ELAA 3B08A 3VVWB 3NSUA 3D8EA 2OJRA 2IO3B 4FBJB 4IAPA 2Z0PA 2IO2B 2ZNVC 4K1RB 2LXAA 5GOWB 3NS8A 4G50A 4LCDE 1MK7B 4HHVA 3RZWC 3PS6A 1V2YA 3PHWB 1YJ1A 3WANA 4KZCA 2AEHA 3T8MA 2KGXB 2MFQA 5D2MB 3ZVVA 1IPGA 3PLUA 2V3SA 5FR6A 1H10A 2RPQA 4F7ZA 3QQ8B 2KMCA 2KFKB 1QZEA 5D3YA 3IBEA 3HK0A 1ISNA 2IBIB 3B0AA 2UWQA 3T9LA 5KCVA 1WGQA 3V6EB 2W2WA 3VH4B 4ANXA 2IYBA 3AU4A 4MH0E 2YS5A 1WH3A 2YS1A 1UD7A 4PS8A 5KHOA 4EOYA 3DPDA 1NDDA 3D8DA 4EZKA 2N1VA 2KD0A 3ZTCA 1T0YA 3DQVA 4YL8A 2ZNVB 2LD9A 2H7DA 1FOEA 4GN1A 5L83A 1FXTB 3CSFA 5D27A 4WWPA 4KSLC 1LW3A 4K17A 2WX0A 3ODOA 3ML9A 4KDLB 1GJZA 1OMWA 1ACAA 2RLOA 3OJ4B 2K2UA 4DDID 2NBUA 2O6VD 1I42A 5D3VA 2LKOA 3L54A 4DXAB 5HKHA 3A98B 3W1YA 3GYOA 4HK2A 3NZSA 3O65B 4KDIC 2V1YA 2YSZA 3K9PB 5LXHA 2FNJB 2CS4A 1ZSQA 4F1SA 5JHBA 1IP9A 4MSMB 3R7QA 4ZRIA 3A33B 3APFA 2L7RA 5EFXA 4AP4C 1A5RA 1WX8A 1FHXA 4KVGB 1UNRA 1VD2A 2ZVNA 4K7WA 4I6LB 2MSED 3MJWA 2C7NB 5C16A 5JLJB 4DX90 4DDGD 3V6CB 1U29A 4MJSB 2AYOB 2PE6B 3R66C 2CAYA 1Q1OA 3KW5B 3PLVA 4HAZB 2KWVB 4BBNF 1C3TA 4NAWA 2XK5A 4HDOA 2GBMA 2BWES 2BPSA 3DDCB 4WJOA 1ZC3B 3ODXA 3A9KA 1WX7A 1HBKA 2HTHB 3A9JA 2LGYA 1B55A 4AWJA 4MK0A 2I5CA 4I6PA 3SNHA 1ZW7A 1MIZB 3QK0A 2KUPA 4IWPA 2GBKA 4A5KA 1P98A 2Y8FA 3WIMA 2DFKA 2XQNM 2KOXA 4BKTA 1K8RB 2M1MA 3ENEA 4AJYB 1IRSA 2JWZA 2GCLA 1WMHB 2P0HA 3DVGY 4KIKA 2Y5BB 2LI5A 1SIFA 3HW2B 4GOCA 4WJNA 2LASA 2DYBA 5EDSA 1OGWA 3ALBA 3H9DA 4HB4B 1YX5B 3A4SC 3WYFB 2LRWA 2CR5A 5KQ4A 2ZPNA 1MKEA 2W2XD 5AEKB 2Z0DB 2R09A 1Q5WB 2HD5B 1SHCA 3APCA 2ASQA 2K1FA 4ICVA 4EUTA 4EJNA 3L13A 3HHMA 2LYDA 3K9OB 1V61A 3HM6X 1NTIA 3PRZA 2R0DA 3DVGX 1H4RA 4BKSD 3VUYA 5HE2A 2MBOA 1BTKA 3A1QB 3JVZX 1KZ7A 4FJVB 1NBFC 3I3TB 2NBWB 1RFAA 1Q0WB 2YT1A 5BO4B 2PZ1A 2RSGA 3KUCB 5CLLB 1EUVB 1LB1A 1DROA 4NY0A 5J3YA 5LOPB 4W9DA 3V5WA 3NOBA 3H1UA 2NS5A 1TXDA 3EFUA 1WVHA 1WFYA 2CHXA 2COAA 3ZO5B 4NPNA 4NJ7A 2QHOA 5FI0A 2O6VA 2KDBA 3PTFC 4JIOU 4XZ4A 1L2NA 5J3TA 2ZZPB 2A5UA 4LDTD 4D0NB 2GS0A 2IYDB 2FCQA 4KAXB 3G9WA 3ZLZA 4AOFA 2A4ZA 3ZIMA 5CLQB 3L17A 1KOTA 1YQBA 3NHEB 3EECA 1UNPA 4A6HA 3V60A 4GDLA 1ZKHA 2VKIA 1WGYA 2IY0B 2LVPA 4GU2A 2G4SA 3TCAA 1DDMA 1WM3A 1V5PA 1I7AA 1WX9A 2MRPA 3RCPA 3ODWA 2D3GA 3QWZB 3KYCD 3H7SA 5DHFB 2DZIA 4Z2MB 5JH5C 4TUUA 2FJLA 2DZJA 4DHZE 3QC8B 1J8CA 1Y5OA 4IC7B 2LVQA 2XK5B 3ML8A 3ULCA 2ZCBA 4RM9A 1WGDA 4WWNA 1WXMA 3L10B 3ZRFA 3UIPB 2KTFA 1FAOA 1WE7A 2DKPA 4IFSA 3A9JB 4DHJB 3SDLC 1OQYA 2MBQA 4A3PA 3S2AA 2DX5A 3ZKJC 1AWEA 2OOBB 5GMVA 1DDVA 4W9EA 5JP4A 2P0DA 3ONSA 4B6HA 2PJHA 1MPHA 2DYNA 1GNUA 1WI0A 3SO6A 3L08A 1E7VA 3QA8A 1P5TA 4BFRA 3Q3JA 1W1DA 1E7UA 2H7EA 2IO1B 2FIFA 3X0WA 2BYVE 5FI1A 2D9VA 4WJ7A 3HM3A 4PS7A 1WXAA 1GC6A 3DBSA 1X05A 2PE9A 2DYOA 3B1LX 5DCNA 2HRJA 4PS3A 2EJ8A 1FB8A 1XD4A 4NNJB 1MK9B 1UZXB 2YS3A 4HAVB 4K81A 4KV2A 3KUZA 4ICUA 4PNKA 2ADZA 2FCMA 3VDZA 2DTCA 1MIXA 1EF5A 1E5WA 4ZYNA 2M38A 4FHKA 3DXEA 3PGEA 1WZ3A 4HAWB 3PVUA 1WJNA 2D9WA 4P7IA 3M62B 3U30A 3Q3FA 3U7DA 3UZTA 4E74A 3BINA 3OAWA 3NY5A 2CHZA 2RQ1A 2M4NA 2X18A 4C0AA 2DAFA 1NTYA 4BOSC 1EAZA 1U4AA 3TMPB 3D32A 2GBNA 2RGFA 2N0YA 3U8ZA 3WAMA 4ZDVA 1GC7A 4II3B 4ZRKA 2LOXA 5LONB 5AZHA 2Y8GA 5DI9B 2NVUI 2DA0A 1HE8A 4KHBB 4GDLB 4TYZA 2GCJA 1XX0A
chains in the Genus database with same CATH superfamily
1VLBA 5JVLA 2ELBA 4Q2JA 5C2TB 3VUXA 4DBGA 4HAYB 4WJQA 4GZUA 2J0KA 3ZVRA 2RRFA 2KTRB 4W9KA 2BKFA 2PEAA 2JRHA 3BVZA 1K50A 3M3JA 4E3CA 1UH6A 4L23A 4GDKB 5IA7A 5C79A 1QQGA 3PPAA 1QOGA 2VZKD 4P16A 1Z2MA 1TS5A 1WGGA 2N23A 4XC2A 4CQNA 2G35A 3PP2A 2P8VA 2CHWA 4AJWA 1H8CA 4MACA 1G6JA 4IM2A 4I6NB 1I2HA 2W2XC 2EKEC 4CHMA 1WJUA 2X38A 3Q8CA 1UEFA 4PQ0A 1F52A 3DBHI 2CY4A 2BYEA 2CB8A 2CU1A 3RFZB 4CHKA 2EELA 2KK8A 2KWCA 3P6AA 3N9YC 1IBXA 3M1IB 5EE3A 3PHXB 4N59A 3Q8BA 1FGYA 2DX5B 3M63B 4BAXA 3FSSA 5MPOA 4XWTA 3FM8C 3URYA 2MP2A 2K5PA 1U5DA 2L05A 3DVNV 3TBLD 1MHHE 3KZ1A 3DBLB 1UUPA 4FN2A 1ET6A 3ZNGC 3MFGA 1WJ6A 1FHOA 4ARIA 1Y8RC 1FGZA 1E9MA 2WDTB 4HKZE 1V5OA 2WDVB 4A6FB 2J59M 5C6RA 1XCTL 2KMAA 2UYZB 1I35A 2NMBA 1DYQA 2N0SB 1TGZB 4WURA 4FA6A 1ZXIA 3RMKC 2AQ2B 4FLHA 1WF9A 3TJPA 1HXYD 1MHXA 4W9LA 1M7RA 2MX2A 4BBNC 2TSSA 3AH7A 2WQYB 4NZLB 2DYQA 2COCA 2LRUA 4TQ1A 4IOIE 3P42A 5DPSA 3VAWA 4WWOA 2KAJA 1RFKA 3VQIA 4KHAA 3EPYA 1DYNA 5I2SA 1R4NI 3W1SA 1L7YA 1C77A 2O2VB 1E7PB 2BCJA 1XODA 3KRXA 2G45B 1HQRD 2G4DB 2MWNB 1MAIA 4E71A 3DVNU 3CIKA 3C8YA 3VOQA 1R4NB 2R2OA 4CYEA 4JWSC 3RYTA 5AUIA 2N1WA 1GG3A 4EMOA 2K39A 1KZGA 2JRIB 2KX0A 2FBWB 3PSEB 3VFKA 1QLBB 1E8YA 2N4FA 4ZHPA 1GGOA 4HDQA 1YX6B 1FXIA 4N58A 2KCJA 1TBEA 1ZGUB 1WM2A 2JZZA 3JW0X 3QCAA 3TIXA 3ZDMC 4C4VB 5D94A 2WH5A 2YEPF 3VIAA 3AE2B 2GMIC 4HAXB 4MEMA 2Z59B 2J4XA 1EF1A 5C5BA 2PPHA 1FCCC 2PVOD 4HEA1 1M94A 2C7HA 3RULA 5HE3A 2EMSA 1L6UA 3WAPA 4RF0A 3CSTA 4HAUB 3FP5A 3AE8B 3A4RA 3E9PA 4M0WA 3AEEB 4RM8A 2JF5A 1FM0D 4ZRQA 2LOZA 3JSVA 1TZOA 2N9LA 2UU7A 3NJTA 1F9JA 1U5FA 3AI5A 3H7PA 5IAAC 1UBIA 3P2BA 3LJ3A 3OANA 3LDZE 3IFWB 3ZW3A 2PTLA 4FJYA 4LDTB 1FIQA 1QT9A 2BS3B 4MGKE 1EO6A 1V1PA 3N1ZC 3PG7A 1UNQA 2LUEA 2LHDA 2GRIA 1J19A 1YN3A 2FIDA 2E3TA 5IN7A 1ZPSA 4MH8A 2G9HD 5C3JB 4NJ6A 3TL5A 5IP4D 3PV1A 1P6SA 1KLVA 4ANVA 4GMXB 1F0ZA 1FD6A 2KUQA 2DAJA 3AECB 4IW0A 3AE7B 4ITKA 4ZRJA 5T8IA 2DX1A 3R7RA 1HB6A 3TW1A 4OVZA 3MC0B 3WA0A 3Q2AC 4W9HA 3NWAA 3GZNB 4C56C 1X11A 1EU4A 1UGMA 1CQVA 5I4DA 1BUIC 2ZEQA 1WIAA 3DHHC 2YRYA 5G5HA 1X1GA 3UINB 3QWMA 3H6NA 4G11A 1JRUA 2I5FA 4GGQA 3LB8C 2KC1A 2BVCA 1RJ2A 2Z14A 1WYWB 2FCSA 3B9JA 5CHWA 2JU6X 4QAYA 3SFEB 1LM8B 2QEJC 3AEDB 3KH0A 2KACA 2RGNB 3U4EG 1J0WA 1FRRA 2KFKA 2DKQA 4G3XB 3L0WB 1ZM0A 3A8QA 4JKFA 2WXLA 1JALA 1V88A 3CMMB 3L16A 1N5XA 3KQ4A 1W1HA 2IGDA 1PUTA 2R82A 3TFMA 1FFVA 1D5MC 4KKJA 5LNK1 1KJTA 5BYRA 3WALA 5AUKA 1WGUA 1P3RA 2MA9B 3RI7C 1L0XB 2WX1A 2IO0B 4AUQC 2KQ7A 3Q8FA 4MSQB 3AEBB 2KIEA 2D07B 2KVRA 2PVGC 1N3HA 4MGIE 3UGBB 3EHVA 3KY9A 1UELA 1LQBA 3I63C 1KI1B 1RAXA 3UF8A 1FMAD 3TVVA 2ROZB 4RFBA 1HB8A 2AWTA 2VRWB 4DX8A 1X1MA 2E2XA 4HXDA 4ZYSA 3P7ZA 2K2JA 1WE6A 2MJ3A 1UBQA 4W9FA 3GYPA 4HPMB 1U2BA 3SR6A 1C79A 3RCZA 2L00B 4LNFA 4EZLA 3O96A 5H8YE 4NAWB 1PFDA 2Y5CA 1PYWD 4GXBA 2RNRB 2JVCA 3CF6E 4DQOC 2L1CA 1MFWA 3A9KB 1ENFA 4FULA 4QJ5B 4P6VF 1HA5A 3AE3B 2D9ZA 2WXHA 1WG7A 2D10A 3ENBA 1K51A 3ETRA 2BS4B 4FADA 2X0SA 5C1ZA 2K25A 2K8HA 5JZEB 1NVLA 4KSKC 2IY1B 4LLGM 3V61A 2V3NA 1C78A 3Q8AA 4W9JA 3E9SA 1WR6E 1PLSA 4KGSA 1V9JA 4PT5A 1ZXHA 2OQBA 1I4GA 2M14A 1EWCA 2EC1A 2KLGA 2D3BA 4REZA 4KIKB 1NTVA 4CHJA 4RCOA 2N9EB 5JHHA 2WXRA 1HTOA 1L4DB 1WWTA 1S3SG 1V80A 1EM7A 3U12A 3A8PA 4ILJA 3E56A 3NW8A 3ZXRA 2ZCCA 3ZNHB 4B9KA 1U5GA 3MC9A 1YIWA 3ZUNA 2KJRA 2WXGA 5HE0A 3SV1A 1E8XA 3RN9C 3KLSX 1KLGD 1KBLA 5C5BB 3D8FA 2K3UA 1TJ6A 2KHWB 4NAMA 3EA6A 2RUKB 1WGRA 3DWGC 4JLCA 1PGBA 2GJYA 2RR9A 2L32A 2WXFA 5E6NA 1R4MI 1SGHA 4F7HA 2C5LC 1KM7A 3JSVB 4S0RA 3X23A 1AQCA 2DHKA 1ZDXA 2KFJA 4L1BA 2OTXA 2HTHA 1X86A 1EVHA 4HCNB 2AQ3B 4OW0A 2LEKA 4FJZA 3U2SC 3OHMB 3KVFB 4YWGG 3PRPB 4XYCA 1R4MB 5J2RA 1GB1A 2FJ9A 2KQSA 1HTQA 5CTRC 3SU8X 1WGKA 1V1PB 4JKCA 2Q13A 2N7EA 5EE1A 4XWXA 2M8SA 2QKMA 1FNUA 4RH6A 3WAOA 1UPQA 2MJDA 2ON8A 1ZDVA 4IWQA 4XX5A 3AMZA 1P7EA 4PYZA 2UVMA 2KN5A 2COFA 1WMHA 2MWSB 3PVLA 1WY8A 4XDDA 2LULA 4M8MA 2KDFB 5G55A 2K8BA 4EFOA 2KXJA 4X57B 5AZGA 3E9OA 1V86A 2JT4B 3IXSA 2K6QA 3T3OA 2RD0A 1WXSA 3AE5B 2LVOA 1V1OA 3RNGC 2VH2A 3RUIB 2WXPA 4K2OA 1I4PA 3GB1A 2LZ6A 3LXFA 3HSAA 1MJDA 4MT5A 1X1FA 2KNBA 4HCPB 3DHGC 1BWNA 4G0NB 3SYXA 4ANUA 3AU5A 4JKDA 4TV3A 2L8JA 3W9CB 2BWFA 4CO7A 2VZKB 1PFJA 1N61A 4PK1A 1QC6A 1D3ZA 2L3ZA 2C9WB 3IVFA 2O6VB 2Y7BA 2LG1A 3AB5A 2IFSA 1YNTE 3KSYA 5DPRA 5BYSA 4AQ7A 2INNE 4EKUA 4WJPA 1TQZA 4O1NA 2D4QA 3R2IA 2J0MA 2KVZA 4MGYE 4OZBA 4JKGA 5E6JA 3ZQ4A 3C0RB 4L6EA 2AL6A 1LO5D 1DIKA 4EZJA 4DWFA 1PQSA 2YT0A 1SIJA 2UZSA 2FCNA 3APDA 3EUB2 1V5TA 4M00A 3MHSD 2JP2A 1WZ0A 2KDIA 4KGTA 5JHGA 2V4LA 4BKGA 1AWDA 2Z0QA 3AXCA 4B95A 3KYDD 3E9LA 3A1QA 1J0GA 3ZRCA 3FVCA 2XEWA 5CHVC 4W9CA 3EC8A 5EE0A 2YF0A 5CX3A 2P0FA 2PIAA 1M7EA 4KX6B 1I7HA 2RVBB 4WVFB 5BYQA 1LGRA 4ASWC 1OFFA 2DHZA 2W9NA 2WHIA 5J17A 3V05A 5D3IB 1XXGA 4LTUA 3QAQA 4HLEA 5AZFA 3DCGA 2ICIA 4A6QA 1WXVA 1V5UA 2CODA 2V76A 1GAQB 2D9YA 1T0QC 1GPXA 2WDQB 1B9RA 2M56B 4PYUA 3GE8C 2ABDA 3V62A 1ZC4B 1FHWA 5LG4B 4GIVA 2NCNA 2NMQA 1VCBA 4Z2NA 1WJMA 1AN8A 3P63A 5KQ1A 2JXXA 2C60A 4BVUC 4H8SA 3ML4A 1U27A 4IUMB 2MCNB 1KF6B 3FILA 1WI1A 2GUMA 1J7BA 4YTNB 3DBLI 3TEWA 3N7CA 2ROVA 4YSYB 5D3XA 1ZOYB 4HATB 2BF8B 2ZVOA 2FE8A 2QSDA 2YVCA 2D2QA 1Z5SB 4KKIA 1Y56A 3B77A 1E6EB 2KJ6A 2WYQA 1SJHD 4WAAA 1N62A 2M0XA 3I57A 3FAHA 1YOVB 4HB3B 5CHFA 2I1JA 1SB3C 1QOFA 3VH3B 1T77A 2BGFA 1EGXA 2D11A 1XKEA 4A9AA 1P0RA 1TY2A 4XE0A 2CQUA 3UIOB 3FLVA 5DIFB 2M19A 1V5MA 3CIRB 1JWBD 2MEKA 2WNMA 1RRPB 2JUOA 3PSCA 1WJ4A 2WWZA 1SE3A 4W9GA 4HB2B 1KH0A 4ANWA 1C4CA 3GE3C 2HJ1A 1WGHA 2MBEA 4UDUC 2QKLA 4DHZB 3MDBC 2J52A 4MGZE 4GPTB 3P4QB 5L95C 2ZPYA 3FEHA 1PDXA 2QCZA 4YTPB 3W5UB 3BY4B 3CXBB 2Z4DA 1MI0A 1E90A 2MQJA 4MT7A 5G2NA 2BYFA 4K2PA 1V6EA 5H92C 2V0GA 1QOAA 5D7GA 3R3MA 5BMHA 2NBVA 1Q10A 2FDQA 2VSZA 1RLFA 1P9DU 3BYTB 4JQWC 2KQ4X 4DK5A 1OQQA 2N9PC 1F2RC 4HWIB 5I2MA 1UPRA 3IAS1 1LFDA 2CKHB 2KO3A 3AV8A 3N3KB 3KRWA 1NEKB 1L0VB 2GOWA 4BOZB 3HQCA 2C7MB 1WJ1A 2JXTA 1BT0A 2ACZB 3UQAA 2LGXA 2MLBA 5LLIA 2Z0EB 4K7SA 4N6EB 2IZVB 1DOXA 4KZ0A 1I4QA 5HG2A 2N9XA 1UF0A 2MW5A 1SE9A 2K9XA 2LWPA 3EFCA 2WXJA 4K3CA 4D6WA 4JL9A 2DHJA 4OSNA 4QJ4B 3FC4A 4NQKE 2Z0OA 3DOWA 1MVKA 4KHOA 5E6OA 1K5DB 1C4AA 2QJLA 1E0ZA 2KLCA 1YQ4B 1EWYC 1V49A 3BZDB 1K52A 3BJIA 3N20C 3SHQA 1F2RI 5DHAB 1P3QU 2NPTA 1V81A 4OHJA 3ULBA 2GI9A 2WXOA 2SEBD 5JHAA 2REXA 4HSIA 2L0FA 3B2GA 2LBBA 4TMAB 2HE7A 1U5EA 5IRSA 2ONQA 2W54A 3U7ZA 2RSUA 2WU2B 4HVBA 1C9FA 1Z87A 1OEYA 2I1KA 1WRIA 1KLUD 1XQQA 2IPKD 2R2YA 3IHPC 2GBJA 4II2B 1T5XD 4RMAA 1P7FA 4JKGB 3NZUA 4WQOB 1J7CA 3AJ4A 2B76B 2HJ8A 3QARA 1UNSA 5TR5A 2L2IA 3VTUA 2FJUB 2CY5A 3GZNI 1ACCA 3VUWA 2YEPB 3P4SB 1ET9A 2KWUB 1SSNA 3N30A 3SFDB 2WP9B 1OY2A 4IM0A 3N32A 3SEBA 4IM3A 3PT2B 3JYUA 3IG3A 1DOIA 1ZE3D 5FKAC 5TSSA 3T06A 1L4ZB 2RDBC 2YLMA 2M0AA 4JGHB 2RDHA 3SUZA 4A3OA 2EMTA 3GOEA 3OWEB 1IYFA 4K7UA 4M8NA 4URKA 2Z8LA 5DH9B 2MBHA 1DBHA 4F7GA 2K6DB 3PVWA 1SJED 5L81A 4GMVA 2DIKA 4A20A 1NI2A 2I2YA 5J3QA 2DLWA 2NZ8B 5HE1A 2FUHB 4IWOA 5J18A 3MTNB 3OLMD 2JZPA 4YXDB 4OVUA 1CMXB 3IAM1 2IJ0A 4F7UP 4MELA 3ZNZB 5IJMA 1AW7A 4MDKE 2KC2A 3AE4B 2MKRA 1C76A 3P4RB 4MY6A 3W1SC 3BVMA 3DXDA 1P1AA 2KJHB 3RZFA 1XR0B 3TEZA 3ZNID 2Y5PA 4NSWA 1IBXB 3UI3A 2ZJDA 2R61A 1VZ7A 2LFIA 2KIGA 3UQBA 2MBBB 3SBGA 3SBTA 4XGAB 3PREA 2IGGA 2MP2B 2V9HA 4IDIA 4DXFA 3Q14C 4YONA 3HIZA 2XBBC 5G5GA 1W1GA 2KT7A 2K8CA 2KX3A 1WRDB 2L0TA 1DOYA 1CK1A 1AARA 3ZJUA 2G3QB 1XD3B 5LXIB 4JKHA 1C1YB 4F8CB 2BW2A 5C23A 5D6JB 2LHEA 4TQ0A 1NYQA 2LUMA 2KTRA 4WSFA 1BTNA 3RD2A 1XCQL 3BYYB 2KANA 4GDKA 1OEYJ 4JKEA 3F0WA 1OTRB 4IOYX 2VH1A 2LMCA 1T0RC 2DN6A 2N9KA 2J7QB 3PRMB 3MPXA 1MG8A 1FNVA 1DGJA 2DLBA 2DYMA 1FCLA 2WXKA 5E6PA 3TO1A 4DBBA 2KKCA 3PZDA 1NYRA 5JXVA 2DENB 2NBVB 1ST7A 1RRBA 2EKIA 1V97A 2VRRB 1NU2A 1V89A 2KWDA 3AULA 5DPTA 1PMSA 1JWSD 1OQNA 3NVYA 3ZJVA 4LNIA 5IKCM 4YT0B 2DWQA 2B3AA 2SAKA 3F5RA 3RNAC 2LXCA 2DHIA 1XCGA 2AL3A 1YD8U 4OT1A 2LGDA 1KC7A 3NWFA 4GB9A 1TTNA 3M95A 4J3OD 1DDWA 1CZPA 2GBRA 1JROA 2D3CA 2K49A 4B6WA 1SE4A 4NQLB 3VTVA 1Y19B 1NENB 2CRFA 2BKRB 3QJZA 3ZDTA 3MP9A 3ECIA 4GNKB 3OJ3A 3SD5A 5FK9C 4IG7B 1WR1A 3VHTC 2JY6A 4DXGA 3QX1A 4MJSA 2J0JA 3RT3B 1JW9D 2FAZA 4TKNA 1ZVRA 4A6FA 4A6KA 1PGAA 5DPWA 5KHQA 1KRHA 3VR9B 1TIFA 4LJOB 1SBBB 3VTWA 4EEWA 2NTSA 4BBKA 2WU5B 2AQ1B 2N7DA 2KDMA 1OQRA 2RPVA 1LXDA 2JPHA 1NVID 1XT9B 4WH4A 1JMLA 4ACFA 2NR2A 3QBVB 3BK1A 3QIJA 5D3WA 2DZKA 3Q6BA 1TZ1A 2UZRA 4M0WB 2BB6A 1PGXA 2NPTB 3O13A 2MDXA 3QHTA 2DZMA 4MM3A 1K5GB 2K8EA 3PEGA 4GOUA 1S1QB 3H7PB 4TSSA 4LJPB 2KZRA 1E8ZA 1E8WA 2J53A 3AEFB 3VXWA 4Y94A 4OVVA 2D9XA 1GUAB 2O2VA 3AEGB 4GSWA 2W55A 4DHJD 3DBRI 1Q67A 5IOIA 5GXGB 4M02A 1KFYB 2G1EA 2M17A 2KDEB 3DXCA 1B1ZA 1RYJA 2R2QA 1BAKA 3KUDB 4HB0B 3RPFC 1TKGA 2JZ3B 2K00A 4J6IA 3LJUX 3DBRB 4BKSA 4HJKA 1EU3A 3ZTDA 4N9F4 4W9IA 4C00A 2COPA 2L76A 2LJ5A 1I4RA 4FHJA 4HPLB 4NJCA 2ELAA 3A58A 1FEHA 3B08A 3VVWB 3NSUA 4M01A 4US9A 1UWXA 1IGCA 1N6ZA 3N1XC 3D8EA 2OJRA 2IO3B 4FBJB 4WWMA 4IAPA 2Z0PA 1JWUD 2IO2B 3AE9B 5HHDG 3I9V1 2ZNVC 2H89B 4K1RB 2LXAA 5GOWB 3NS8A 4G50A 4LK0M 4LCDE 1MK7B 4HHVA 3RZWC 3NWDA 2BS2B 2JYEA 3PS6A 1V2YA 3PHWB 1YJ1A 2LGIA 1YJJA 3U52E 3W5VB 4KZCA 3WANA 2AEHA 3T8MA 2KGXB 2MFQA 2LJIA 5D2MB 3NS1A 3ZVVA 4B0MA 1YMHE 1IPGA 3PLUA 2V3SA 5FR6A 3P4PB 3RNCC 1H10A 2RPQA 4F7ZA 3QQ8B 2KMCA 2KFKB 2JSVX 4JWUC 1QZEA 5D3YA 3IBEA 2X8XX 3HK0A 1ISNA 2IBIB 1N5WA 3B0AA 2UWQA 3T9LA 2JYTA 4JK9A 1NI3A 5KCVA 1WGQA 1YJIA 3V6EB 2Z13A 3MJ5A 2BTEA 4ZOHC 2GB1A 4US8A 2W2WA 3MHZA 3VH4B 4ANXA 2WS3B 2IYBA 3AU4A 4MH0E 2L1AA 2KYWA 2YS5A 1WH3A 2YS1A 4A55A 1UD7A 4PS8A 4RGNA 1SE2A 3R2TA 5KHOA 1YN5A 2HDEA 3Q3NC 4EOYA 2LGSA 2WXIA 4XWWA 3DPDA 1NDDA 3D8DA 4EZKA 4WIPA 2N1VA 2KD0A 1QKZA 2MHJA 3W2DA 3ZTCA 1T0YA 3DQVA 4YL8A 2ZNVB 2LD9A 2H7DA 1FRDA 1FOEA 4GN1A 5L83A 1FXTB 3ZJTA 3CSFA 5D27A 1IUEA 1ESFA 4WWPA 3NRZA 4KSLC 4HKQA 1LW3A 4K17A 1I4XA 2WX0A 1XLNA 3ODOA 1JWAD 3ML9A 4KDLB 1GJZA 2XNAC 1OMWA 1ACAA 4LNKA 2RLOA 1BXTA 3IT6B 4RNAA 1C4PA 3PO0A 2OJWA 3OJ4B 2K2UA 4DDID 2NBUA 2O6VD 1I42A 5D3VA 2LKOA 4L1RA 2L52A 4DXAB 3L54A 5HKHA 3AM9A 3A98B 3HUIA 1MI1A 2OHFA 3W1YA 3GYOA 2W3SA 4HK2A 3DHIC 3NZSA 2IGHA 3O65B 4KDIC 1MPEA 2V1YA 2YSZA 3K9PB 5LXHA 2FNJB 2CS4A 3NUHB 1ZSQA 2CJNA 3HRDD 4F1SA 5JHBA 1IP9A 1XLOA 4MSMB 4ZRIA 3R7QA 3A33B 3APFA 2L7RA 3DBHB 5EFXA 4AP4C 1A5RA 1WX8A 1FHXA 1IGDA 4KVGB 1BMLC 1UNRA 1VD2A 2ZVNA 4K7WA 4I6LB 2E6XA 2Q5WD 2MSED 3MJWA 2C7NB 5C16A 5JLJB 1T0SC 4DX90 2I38A 4DDGD 3V6CB 2INDC 1U29A 4MJSB 2AYOB 2PE6B 3R66C 2CAYA 4B0EA 4EE2A 1Q1OA 1SXTA 3KW5B 3PLVA 4HAZB 3KWVA 1GB4A 2KWVB 2Y3AA 4BBNF 1C3TA 4NAWA 2XK5A 4HJGE 4HDOA 2GBMA 2BWES 2BPSA 2JQRB 4K3BA 3DDCB 4WJOA 1TT5B 1ZC3B 1TS4A 3ODXA 3A9KA 1WX7A 1HBKA 3N1YC 4GLSC 3LYYA 3GS2A 2HTHB 3A9JA 4MM3B 2LGYA 1B55A 4AWJA 4MK0A 2I5CA 2QDFA 4I6PA 1VBGA 3SNHA 1FFUA 1ZW7A 1MIZB 3EGRA 3QK0A 1TS3A 2KUPA 4IWPA 2GBKA 4A5KA 1WSPA 1P98A 2Y8FA 2PW9A 3WIMA 2DFKA 4A8XC 2DBYA 2XQNM 2KOXA 4A90A 4BKTA 1K8RB 2M1MA 2BBCA 2YT2A 3ENEA 4AJYB 4RGTA 3CWIA 1IRSA 2JWZA 2GCLA 1WMHB 2P0HA 3DVGY 3Q3OC 4RGMA 4P1BC 2PLPA 4KIKA 3R8BA 1FPYA 4HROA 2Y5BB 4LNOA 2LI5A 1SIFA 1K53A 1QOBA 3HW2B 3C19A 4GOCA 4WJNA 3BK2A 1ROEA 4H2AA 2LASA 2DYBA 5EDSA 2MJEA 1HZ5A 2K0PA 2V3PA 2V4IB 3ZXVA 1OGWA 3ALBA 3H9DA 1N60A 2ZW0A 4HB4B 1YX5B 2GLSA 3A4SC 3NZ3A 4QJ3B 3WYFB 2LRWA 1ZP0B 2CR5A 1TY0A 5KQ4A 3WCQA 4HPPA 1HEZE 2ZPNA 3B2FA 1MKEA 2W2XD 5AEKB 2Z0DB 3I5JC 2R09A 1Q5WB 2D3AA 3BWUD 2HD5B 1SHCA 3APCA 2ASQA 2K1FA 2QC8A 1D5XC 3NVVA 4C7ZA 4ICVA 1J7AA 4EUTA 4JKAA 4EJNA 3L13A 3Q8EA 3HHMA 3RNFC 2LYDA 2WDRB 5BMIA 1ZUD2 3K9OB 1V61A 3FKYA 4JX1C 3HM6X 4FXCA 1NTIA 3PRZA 2WXMA 2R0DA 1E10A 4CSQA 3DVGX 1H4RA 4BKSD 3VUYA 5HE2A 2MBOA 2H88B 1BTKA 3A1QB 3JVZX 1KZ7A 3ZGZA 4JKBA 1M4VA 4FJVB 2INCC 2PKOA 1A70A 1NBFC 3I3TB 2NBWB 4JK8A 1RFAA 1JCKB 1Q0WB 2YT1A 4OZCA 5BO4B 2PZ1A 1VBHA 2RSGA 3AEAB 5CLLB 3KUCB 4IKGA 3KWLA 1EUVB 2WXNA 5HI1A 1LB1A 1DROA 1TS2A 4NY0A 5J3YA 5LOPB 1L0YB 4W9DA 2CJOA 3V5WA 3VRAB 3NOBA 1KTKA 3HVDA 3H1UA 3TEYA 2NS5A 1TXDA 3J9CA 3EFUA 1WVHA 1WFYA 2CHXA 2COAA 2RDGA 3ZO5B 4NPNA 2NTTA 1TJEA 4NJ7A 2BQQA 2QHOA 5FI0A 2O6VA 2KDBA 3PTFC 4JIOU 3VR8B 5BMGA 1CJEA 2BT6A 4XZ4A 3NVZA 1N63A 1L2NA 5J3TA 2ZZPB 1RWSA 2A5UA 4LDTD 1XO3A 4D0NB 3FILB 2GS0A 4RGOS 2IYDB 2FCQA 4KAXB 2BB5A 3G9WA 4JPSA 3ZLZA 4AOFA 2A4ZA 3ZIMA 5CLQB 1D6EC 1QF6A 1SEBD 3L17A 4WQMA 1KOTA 1YQBA 2RMMA 3NHEB 3EECA 1AYFA 1UNPA 4A6HA 4QXAB 3V60A 4KHBA 4GDLA 1ZKHA 2VKIA 1WGYA 2IY0B 3DCXA 5FR3A 2LVPA 4GU2A 2G4SA 3TCAA 2K22A 1JQ4A 1DDMA 1WM3A 1V5PA 1I7AA 1WX9A 1ZYIA 2L83A 2MRPA 1F1HA 3RCPA 1WXQA 3ODWA 3T3NA 2D3GA 3QWZB 3KYCD 3E66A 3H7SA 5DHFB 2WXQA 1TKEA 2PMVA 2DZIA 1T3QA 3GP7A 1V8CA 4Z2MB 5JH5C 1WYGA 4TUUA 2FJLA 3VRBB 2DZJA 2W82A 2XN9C 4YSZB 4DHZE 3QC8B 4D2KA 4WAFA 1J8CA 1XLQA 3OG5A 1Y5OA 4IC7B 3AN1A 5D3DA 2LVQA 1TYGB 4KGRA 2XK5B 1XF5L 3ML8A 3ULCA 2ZCBA 3IT4B 4RM9A 1WGDA 4WWNA 1WXMA 2WLBA 3L10B 3ZRFA 3UIPB 2KTFA 2AX5A 1FAOA 1WE7A 3NVWA 2DKPA 4IFSA 3A9JB 4DHJB 3SDLC 4YSXB 2KMMA 2QIEB 1OQYA 2MBQA 4A3PA 3S2AA 2DX5A 1FNWA 3AE6B 3PZ7A 3ZKJC 4DIXA 1AWEA 2ZW1A 2OOBB 5GMVA 1DDVA 2JWUA 4W9EA 5JP4A 2P0DA 3ONSA 1R7SA 4B6HA 2PJHA 3L4PA 1MPHA 3ZYYX 1D5ZC 3BVGA 2W3RA 2DYNA 1GNUA 1VR9A 1WI0A 3RNEC 3SO6A 1XLPA 1UWMA 2JX5A 3L08A 1E7VA 3QA8A 1P5TA 4BFRA 3Q3JA 1W1DA 1E7UA 2H7EA 1FXAA 2IO1B 2ZKMX 2CU3A 2FIFA 3X0WA 2HTME 4JK7A 3DWMA 2BYVE 5FI1A 4LNNA 2D9VA 4WJ7A 3HM3A 1QILA 4PS7A 2BYTA 4RF1A 1WXAA 1GC6A 1YQ3B 3DBSA 4YTMB 1X05A 3TUOA 2PE9A 2DYOA 3B1LX 1JDEA 5DCNA 4USAA 3Q3MC 3MC8A 3Q69A 3PZ8A 2HRJA 4PS3A 1QQRA 2EJ8A 1FB8A 1GOZA 1XD4A 4NNJB 1MK9B 1HZ6A 1UZXB 3HVZA 2YS3A 4HAVB 4C7YA 4K81A 4KV2A 3KUZA 1VZ6A 1F77A 4C80A 1L6VA 2DNFA 4ICUA 4PNKA 4S17A 2WGSA 3ABVB 1MG4A 1VZ8A 5M4YB 2ADZA 2FCMA 4C4VA 2KN4A 3RNBC 3VDZA 2DTCA 1MIXA 1EF5A 1SF0A 1E5WA 2FUG1 2N7JA 2Z59A 4ZYNA 1FO4A 4R3DA 2M38A 4FHKA 3DXEA 3PGEA 4ZHOA 1WZ3A 4HAWB 4JE3B 3PVUA 1WJNA 2D9WA 4P7IA 2QILA 3M62B 3P1MA 3U30A 3Q3FA 4ARCA 4OZAA 4HRSA 4AS1A 3U7DA 3BIID 4ILHA 3UZTA 4E74A 4XDCA 2KR0A 4L2YA 3BINA 3H8HA 2INPE 2QMTA 3OAWA 3NY5A 3HIEA 2CHZA 2MH7A 2RQ1A 1VRAB 2M4NA 2X18A 1RM6C 2D5GA 4C0AA 2DAFA 3AE1B 5EE9A 1NTYA 4BOSC 2IDYA 1EAZA 1U4AA 3TMPB 1D4BA 3D32A 1VDVA 1XEEA 2GBNA 2RGFA 2N0YA 4ZRPA 3U8ZA 3WAMA 3TSSA 1JWMD 2OEDA 3TEXA 4ILGB 4ZDVA 1GC7A 1I4HA 4II3B 4ZRKA 1STEA 1JRPA 2LOXA 4BZAA 1UGJA 1TKYA 5LONB 1VJKA 5AZHA 2Y8GA 3V3XA 3NG0A 5DI9B 2J42A 2NVUI 4P1CC 2DA0A 1HE8A 1L5PA 1YN4A 4KHBB 4GDLB 4TYZA 2GCJA 1T6BX 1XX0A 5HFYA 5IO9A
chains in the Genus database with same CATH topology
5JVLA 2ELBA 3VUXA 4DBGA 4HAYB 4WJQA 4GZUA 2J0KA 3ZVRA 2KTRB 4W9KA 2BKFA 2PEAA 2JRHA 3M3JA 4E3CA 1UH6A 4GDKB 5IA7A 5C79A 1QQGA 3PPAA 1Z2MA 1WGGA 2N23A 4XC2A 2G35A 3PP2A 2P8VA 2CHWA 4AJWA 1H8CA 1G6JA 4IM2A 4I6NB 1I2HA 2W2XC 2EKEC 4CHMA 1WJUA 1UEFA 4PQ0A 3DBHI 2CY4A 2BYEA 2CB8A 2CU1A 4CHKA 2KK8A 2KWCA 3P6AA 3M1IB 3PHXB 1FGYA 2DX5B 3M63B 3FSSA 3FM8C 2MP2A 1U5DA 2L05A 3DVNV 3TBLD 3KZ1A 4FN2A 3ZNGC 1WJ6A 1FHOA 1Y8RC 1FGZA 2WDTB 1V5OA 4A6FB 2J59M 5C6RA 2KMAA 2UYZB 1I35A 2NMBA 1TGZB 4FA6A 4FLHA 1WF9A 3TJPA 4W9LA 1M7RA 2MX2A 4BBNC 2DYQA 2COCA 2LRUA 4TQ1A 5DPSA 3VAWA 4WWOA 3VQIA 4KHAA 3EPYA 1DYNA 1R4NI 3W1SA 1L7YA 2O2VB 2BCJA 1XODA 3KRXA 2G45B 2G4DB 2MWNB 1MAIA 4E71A 3DVNU 3CIKA 3VOQA 2R2OA 4CYEA 3RYTA 2N1WA 1GG3A 4EMOA 2K39A 1KZGA 2JRIB 2KX0A 3PSEB 3VFKA 1E8YA 2N4FA 1GGOA 4HDQA 1YX6B 2KCJA 1TBEA 1ZGUB 1WM2A 2JZZA 3JW0X 3QCAA 3TIXA 3ZDMC 5D94A 2WH5A 3VIAA 2GMIC 4HAXB 4MEMA 2Z59B 1EF1A 5C5BA 2PPHA 1M94A 2C7HA 3RULA 5HE3A 2EMSA 3WAPA 3CSTA 4HAUB 3FP5A 3A4RA 3E9PA 4RM8A 2JF5A 2LOZA 3JSVA 1F9JA 1U5FA 3AI5A 3H7PA 5IAAC 1UBIA 3P2BA 3LJ3A 3OANA 3LDZE 3IFWB 3ZW3A 4FJYA 4LDTB 4MGKE 1EO6A 3PG7A 1UNQA 2LUEA 1J19A 2FIDA 4NJ6A 3TL5A 3PV1A 1P6SA 1KLVA 4ANVA 4GMXB 2DAJA 4IW0A 4ZRJA 2DX1A 3R7RA 1HB6A 3TW1A 3WA0A 4W9HA 1X11A 1UGMA 2ZEQA 1WIAA 2YRYA 1X1GA 3UINB 3QWMA 3H6NA 4G11A 1JRUA 2I5FA 4GGQA 2KC1A 1RJ2A 2FCSA 1WYWB 5CHWA 1LM8B 3KH0A 2RGNB 1J0WA 2KFKA 2DKQA 4G3XB 3L0WB 1ZM0A 3A8QA 4JKFA 1V88A 3CMMB 3L16A 1W1HA 2R82A 3TFMA 1KJTA 3WALA 1WGUA 1P3RA 2MA9B 2WX1A 2IO0B 4AUQC 2KQ7A 4MSQB 2D07B 2KVRA 1N3HA 4MGIE 3UGBB 3EHVA 3KY9A 1UELA 1LQBA 1KI1B 1RAXA 3UF8A 3TVVA 2ROZB 1HB8A 2AWTA 2VRWB 4DX8A 1X1MA 2E2XA 4HXDA 3P7ZA 2K2JA 1WE6A 1UBQA 4W9FA 3GYPA 4HPMB 1U2BA 3RCZA 2L00B 4EZLA 3O96A 4NAWB 4GXBA 2RNRB 2JVCA 3CF6E 2L1CA 3A9KB 4FULA 2D9ZA 1WG7A 2D10A 3ENBA 4FADA 2X0SA 5C1ZA 2K25A 2K8HA 5JZEB 1NVLA 4KSKC 2IY1B 3V61A 4W9JA 1WR6E 1PLSA 1V9JA 2OQBA 2M14A 2EC1A 2KLGA 4KIKB 1NTVA 4CHJA 2N9EB 5JHHA 1S3SG 1V80A 3A8PA 4ILJA 2ZCCA 3ZNHB 4B9KA 1U5GA 1YIWA 3ZUNA 2KJRA 5HE0A 3SV1A 1E8XA 1KBLA 5C5BB 3D8FA 1TJ6A 2KHWB 2RUKB 1WGRA 4JLCA 2GJYA 2RR9A 5E6NA 1R4MI 1SGHA 4F7HA 2C5LC 1KM7A 3JSVB 3X23A 1AQCA 2DHKA 2KFJA 2OTXA 2HTHA 1X86A 1EVHA 4HCNB 4FJZA 3KVFB 3PRPB 5J2RA 2FJ9A 2KQSA 5CTRC 3SU8X 4JKCA 2Q13A 2N7EA 4XWXA 2M8SA 2QKMA 3WAOA 1UPQA 4IWQA 4XX5A 4PYZA 2UVMA 2KN5A 2COFA 1WMHA 2MWSB 3PVLA 1WY8A 2LULA 4M8MA 2KDFB 5G55A 2K8BA 4EFOA 2KXJA 4X57B 5AZGA 3E9OA 1V86A 2JT4B 2K6QA 2RD0A 1WXSA 2LVOA 3RUIB 4K2OA 2LZ6A 1X1FA 2KNBA 4HCPB 1BWNA 4G0NB 3SYXA 4ANUA 3AU5A 4JKDA 4TV3A 2L8JA 2BWFA 4CO7A 1PFJA 1QC6A 1D3ZA 2L3ZA 2C9WB 3IVFA 2O6VB 2Y7BA 2LG1A 2IFSA 3KSYA 5DPRA 4EKUA 4WJPA 1TQZA 2D4QA 2J0MA 4MGYE 4JKGA 3C0RB 4L6EA 2AL6A 1DIKA 4EZJA 4DWFA 1PQSA 2YT0A 2UZSA 2FCNA 3APDA 1V5TA 3MHSD 2JP2A 1WZ0A 2KDIA 5JHGA 2V4LA 4BKGA 2Z0QA 3AXCA 4B95A 3KYDD 3E9LA 3A1QA 1J0GA 3ZRCA 2XEWA 5CHVC 4W9CA 3EC8A 2YF0A 5CX3A 2P0FA 1M7EA 2RVBB 4WVFB 4ASWC 2DHZA 2W9NA 5J17A 3QAQA 4HLEA 5AZFA 3DCGA 1WXVA 1V5UA 2CODA 2V76A 2D9YA 4PYUA 2ABDA 3V62A 1ZC4B 1FHWA 4GIVA 2NCNA 1VCBA 4Z2NA 1WJMA 5KQ1A 2JXXA 2C60A 4BVUC 4H8SA 3ML4A 1U27A 4IUMB 2MCNB 1WI1A 3DBLI 3N7CA 2ROVA 5D3XA 4HATB 2BF8B 2ZVOA 2YVCA 2D2QA 1Z5SB 2KJ6A 2WYQA 4WAAA 2M0XA 4HB3B 5CHFA 2I1JA 3VH3B 2BGFA 1EGXA 2D11A 1XKEA 1P0RA 2CQUA 3UIOB 3FLVA 5DIFB 1V5MA 1RRPB 2JUOA 3PSCA 1WJ4A 2WWZA 4W9GA 4HB2B 4ANWA 1WGHA 2MBEA 2QKLA 4DHZB 3MDBC 4MGZE 4GPTB 5L95C 2ZPYA 3FEHA 3BY4B 3CXBB 1E90A 2MQJA 4MT7A 5G2NA 2BYFA 4K2PA 1V6EA 5D7GA 3R3MA 2FDQA 2VSZA 1RLFA 1P9DU 4JQWC 4DK5A 2N9PC 4HWIB 1UPRA 1LFDA 2CKHB 2KO3A 3N3KB 3KRWA 2GOWA 4BOZB 3HQCA 2C7MB 1WJ1A 1BT0A 3UQAA 2LGXA 2MLBA 5LLIA 2Z0EB 4K7SA 2IZVB 4KZ0A 2N9XA 2MW5A 1SE9A 2LWPA 4JL9A 2DHJA 4NQKE 2Z0OA 3DOWA 4KHOA 5E6OA 1K5DB 2KLCA 1V49A 3BJIA 3SHQA 5DHAB 1P3QU 2NPTA 1V81A 3ULBA 5JHAA 2REXA 2L0FA 2LBBA 2HE7A 1U5EA 2RSUA 4HVBA 1Z87A 1OEYA 2I1KA 1XQQA 3IHPC 2GBJA 4II2B 4RMAA 4JKGB 3NZUA 4WQOB 3AJ4A 2HJ8A 3QARA 5TR5A 2L2IA 3VTUA 2CY5A 3GZNI 3VUWA 2KWUB 3N30A 1OY2A 4IM0A 3N32A 4IM3A 3PT2B 3JYUA 3IG3A 3T06A 2YLMA 4JGHB 3SUZA 4A3OA 2EMTA 3GOEA 1IYFA 4K7UA 4M8NA 4URKA 5DH9B 2MBHA 1DBHA 4F7GA 2K6DB 3PVWA 4A20A 5L81A 4GMVA 2DIKA 1NI2A 5J3QA 2DLWA 2NZ8B 5HE1A 2FUHB 4IWOA 5J18A 3MTNB 3OLMD 4OVUA 1CMXB 4F7UP 4MELA 3ZNZB 5IJMA 4MDKE 2KC2A 2MKRA 4MY6A 3W1SC 3DXDA 1P1AA 2KJHB 3RZFA 1XR0B 3ZNID 4NSWA 2ZJDA 3UQBA 2MBBB 3SBGA 3SBTA 3PREA 2MP2B 4YONA 3HIZA 2XBBC 1W1GA 2K8CA 2KX3A 1WRDB 2L0TA 1AARA 2G3QB 1XD3B 5LXIB 4JKHA 1C1YB 4F8CB 5C23A 5D6JB 4TQ0A 2KTRA 4WSFA 1BTNA 3RD2A 2KANA 4GDKA 1OEYJ 4JKEA 3F0WA 1OTRB 4IOYX 2DN6A 2J7QB 3PRMB 3MPXA 1MG8A 2DYMA 5E6PA 3TO1A 4DBBA 2KKCA 3PZDA 2DENB 2NBVB 1ST7A 1RRBA 2VRRB 1NU2A 1V89A 3AULA 5DPTA 1PMSA 1OQNA 2B3AA 3F5RA 2LXCA 2DHIA 1XCGA 2AL3A 1YD8U 2LGDA 1KC7A 4GB9A 1TTNA 3M95A 1DDWA 2GBRA 4B6WA 4NQLB 3VTVA 1Y19B 2CRFA 2BKRB 3QJZA 3ZDTA 3ECIA 3OJ3A 3SD5A 3VHTC 4IG7B 1WR1A 2JY6A 3QX1A 4MJSA 2J0JA 3RT3B 2FAZA 4TKNA 1ZVRA 4A6FA 4A6KA 5DPWA 5KHQA 4LJOB 3VTWA 4EEWA 4BBKA 2N7DA 1LXDA 2JPHA 1XT9B 2NR2A 3QBVB 3QIJA 5D3WA 2DZKA 1TZ1A 2UZRA 4M0WB 2NPTB 2MDXA 3QHTA 2DZMA 4MM3A 1K5GB 3PEGA 3H7PB 1S1QB 3VXWA 4LJPB 1E8ZA 2KZRA 1E8WA 4Y94A 4OVVA 2D9XA 1GUAB 2O2VA 4GSWA 4DHJD 3DBRI 1Q67A 2M17A 2KDEB 3DXCA 2R2QA 1BAKA 3KUDB 4HB0B 2JZ3B 2K00A 4J6IA 3LJUX 4BKSA 4HJKA 3ZTDA 4N9F4 4W9IA 2COPA 2L76A 2LJ5A 4FHJA 4HPLB 2ELAA 3B08A 3VVWB 3NSUA 3D8EA 2OJRA 2IO3B 4FBJB 4IAPA 2Z0PA 2IO2B 2ZNVC 4K1RB 2LXAA 5GOWB 3NS8A 4G50A 4LCDE 1MK7B 4HHVA 3RZWC 3PS6A 1V2YA 3PHWB 1YJ1A 3WANA 4KZCA 2AEHA 3T8MA 2KGXB 2MFQA 5D2MB 3ZVVA 1IPGA 3PLUA 2V3SA 5FR6A 1H10A 2RPQA 4F7ZA 3QQ8B 2KMCA 2KFKB 1QZEA 5D3YA 3IBEA 3HK0A 1ISNA 2IBIB 3B0AA 2UWQA 3T9LA 4JK9A 5KCVA 1WGQA 3V6EB 2W2WA 3VH4B 4ANXA 2IYBA 3AU4A 4MH0E 2YS5A 1WH3A 2YS1A 1UD7A 4PS8A 5KHOA 4EOYA 3DPDA 1NDDA 3D8DA 4EZKA 2N1VA 2KD0A 3ZTCA 1T0YA 3DQVA 4YL8A 2ZNVB 2LD9A 2H7DA 1FOEA 4GN1A 5L83A 1FXTB 3CSFA 5D27A 4WWPA 4KSLC 1LW3A 4K17A 2WX0A 3ODOA 3ML9A 4KDLB 1GJZA 1OMWA 1ACAA 2RLOA 3OJ4B 2K2UA 4DDID 2NBUA 2O6VD 1I42A 5D3VA 2LKOA 3L54A 4DXAB 5HKHA 3A98B 3W1YA 3GYOA 4HK2A 3NZSA 3O65B 4KDIC 2V1YA 2YSZA 3K9PB 5LXHA 2FNJB 2CS4A 1ZSQA 4F1SA 5JHBA 1IP9A 4MSMB 3R7QA 4ZRIA 3A33B 3APFA 2L7RA 5EFXA 4AP4C 1A5RA 1WX8A 1FHXA 4KVGB 1UNRA 1VD2A 2ZVNA 4K7WA 4I6LB 2MSED 3MJWA 2C7NB 5C16A 5JLJB 4DX90 4DDGD 3V6CB 1U29A 4MJSB 2AYOB 2PE6B 3R66C 2CAYA 1Q1OA 3KW5B 3PLVA 4HAZB 2KWVB 4BBNF 1C3TA 4NAWA 2XK5A 4HDOA 2GBMA 2BWES 2BPSA 4WJOA 3DDCB 1ZC3B 3ODXA 3A9KA 1WX7A 1HBKA 2HTHB 3A9JA 2LGYA 1B55A 4AWJA 4MK0A 2I5CA 4I6PA 1VBGA 3SNHA 1ZW7A 1MIZB 3QK0A 2KUPA 4IWPA 2GBKA 4A5KA 1P98A 2Y8FA 3WIMA 2DFKA 2XQNM 2KOXA 4BKTA 1K8RB 2M1MA 3ENEA 4AJYB 1IRSA 2JWZA 2GCLA 1WMHB 2P0HA 3DVGY 4KIKA 2Y5BB 2LI5A 1SIFA 3HW2B 4GOCA 4WJNA 2LASA 2DYBA 5EDSA 1OGWA 3ALBA 3H9DA 4HB4B 1YX5B 3A4SC 3WYFB 2LRWA 2CR5A 5KQ4A 2ZPNA 1MKEA 2W2XD 5AEKB 2Z0DB 2R09A 1Q5WB 2HD5B 1SHCA 3APCA 2ASQA 2K1FA 4ICVA 4EUTA 4JKAA 4EJNA 3L13A 3HHMA 2LYDA 3K9OB 1V61A 3HM6X 1NTIA 3PRZA 2R0DA 3DVGX 1H4RA 4BKSD 3VUYA 5HE2A 2MBOA 1BTKA 3A1QB 3JVZX 1KZ7A 4JKBA 4FJVB 1NBFC 3I3TB 2NBWB 4JK8A 1RFAA 1Q0WB 2YT1A 5BO4B 2PZ1A 1VBHA 2RSGA 3KUCB 5CLLB 1EUVB 1LB1A 1DROA 4NY0A 5J3YA 5LOPB 4W9DA 3V5WA 3NOBA 3H1UA 2NS5A 1TXDA 3EFUA 1WVHA 1WFYA 2CHXA 2COAA 3ZO5B 4NPNA 4NJ7A 2QHOA 5FI0A 2O6VA 2KDBA 3PTFC 4JIOU 4XZ4A 1L2NA 5J3TA 2ZZPB 2A5UA 4LDTD 4D0NB 2GS0A 2IYDB 2FCQA 4KAXB 3G9WA 3ZLZA 4AOFA 2A4ZA 3ZIMA 5CLQB 3L17A 1KOTA 1YQBA 3NHEB 3EECA 1UNPA 4A6HA 3V60A 4GDLA 1ZKHA 2VKIA 1WGYA 2IY0B 2LVPA 4GU2A 2G4SA 3TCAA 1DDMA 1WM3A 1V5PA 1I7AA 1WX9A 2MRPA 3RCPA 3ODWA 2D3GA 3QWZB 3KYCD 3E66A 3H7SA 5DHFB 2DZIA 4Z2MB 5JH5C 4TUUA 2FJLA 2DZJA 4DHZE 3QC8B 1J8CA 1Y5OA 4IC7B 2LVQA 2XK5B 3ML8A 3ULCA 2ZCBA 4RM9A 1WGDA 4WWNA 1WXMA 3L10B 3ZRFA 3UIPB 2KTFA 1FAOA 1WE7A 2DKPA 4IFSA 3A9JB 4DHJB 3SDLC 1OQYA 2MBQA 4A3PA 3S2AA 2DX5A 3ZKJC 1AWEA 2OOBB 5GMVA 1DDVA 4W9EA 5JP4A 2P0DA 3ONSA 4B6HA 2PJHA 1MPHA 2DYNA 1GNUA 1WI0A 3SO6A 3L08A 1E7VA 3QA8A 1P5TA 4BFRA 3Q3JA 1W1DA 1E7UA 2H7EA 2IO1B 2FIFA 3X0WA 4JK7A 2BYVE 5FI1A 2D9VA 4WJ7A 3HM3A 4PS7A 1WXAA 1GC6A 3DBSA 1X05A 2PE9A 2DYOA 3B1LX 1JDEA 5DCNA 2HRJA 4PS3A 2EJ8A 1FB8A 1XD4A 4NNJB 1MK9B 1UZXB 2YS3A 4HAVB 4K81A 4KV2A 3KUZA 4ICUA 4PNKA 2ADZA 2FCMA 3VDZA 2DTCA 1MIXA 1EF5A 1E5WA 4ZYNA 2M38A 4FHKA 3DXEA 3PGEA 1WZ3A 4HAWB 3PVUA 1WJNA 2D9WA 4P7IA 3M62B 3U30A 3Q3FA 3U7DA 4ILHA 3UZTA 4E74A 3BINA 3OAWA 3NY5A 2CHZA 2RQ1A 2M4NA 2X18A 4C0AA 2DAFA 1NTYA 4BOSC 1EAZA 1U4AA 3TMPB 3D32A 2GBNA 2RGFA 2N0YA 3U8ZA 3WAMA 4ILGB 4ZDVA 1GC7A 4II3B 4ZRKA 2LOXA 5LONB 5AZHA 2Y8GA 5DI9B 2NVUI 2DA0A 1HE8A 4KHBB 4GDLB 4TYZA 2GCJA 1XX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELB A;  3VUX A;  4DBG A;  4HAY B;  4WJQ A;  4GZU A;  2J0K A;  3ZVR A;  2KTR B;  4W9K A;  2BKF A;  2PEA A;  2JRH A;  3M3J A;  4E3C A;  1UH6 A;  4GDK B;  5IA7 A;  5C79 A;  1QQG A;  3PPA A;  1Z2M A;  1WGG A;  2N23 A;  4XC2 A;  2G35 A;  3PP2 A;  2P8V A;  2CHW A;  4AJW A;  1H8C A;  1G6J A;  4IM2 A;  4I6N B;  1I2H A;  2W2X C;  2EKE C;  4CHM A;  1WJU A;  1UEF A;  4PQ0 A;  3DBH I;  2CY4 A;  2BYE A;  2CB8 A;  2CU1 A;  4CHK A;  2KK8 A;  2KWC A;  3P6A A;  3M1I B;  3PHX B;  1FGY A;  2DX5 B;  3M63 B;  3FSS A;  3FM8 C;  2MP2 A;  1U5D A;  2L05 A;  3DVN V;  3TBL D;  3KZ1 A;  4FN2 A;  3ZNG C;  1WJ6 A;  1FHO A;  1Y8R C;  1FGZ A;  2WDT B;  1V5O A;  4A6F B;  2J59 M;  5C6R A;  2KMA A;  2UYZ B;  1I35 A;  2NMB A;  1TGZ B;  4FA6 A;  4FLH A;  1WF9 A;  3TJP A;  4W9L A;  1M7R A;  2MX2 A;  4BBN C;  2DYQ A;  2COC A;  2LRU A;  4TQ1 A;  5DPS A;  3VAW A;  4WWO A;  3VQI A;  4KHA A;  3EPY A;  1DYN A;  1R4N I;  3W1S A;  1L7Y A;  2O2V B;  2BCJ A;  1XOD A;  3KRX A;  2G45 B;  2G4D B;  2MWN B;  1MAI A;  4E71 A;  3DVN U;  3CIK A;  3VOQ A;  2R2O A;  4CYE A;  3RYT A;  2N1W A;  1GG3 A;  4EMO A;  2K39 A;  1KZG A;  2JRI B;  2KX0 A;  3PSE B;  3VFK A;  1E8Y A;  2N4F A;  4HDQ A;  1YX6 B;  2KCJ A;  1TBE A;  1ZGU B;  1WM2 A;  2JZZ A;  3JW0 X;  3QCA A;  3ZDM C;  3TIX A;  5D94 A;  2WH5 A;  3VIA A;  2GMI C;  4HAX B;  4MEM A;  2Z59 B;  1EF1 A;  5C5B A;  2PPH A;  1M94 A;  2C7H A;  3RUL A;  5HE3 A;  2EMS A;  3WAP A;  3CST A;  4HAU B;  3FP5 A;  3A4R A;  4RM8 A;  2JF5 A;  2LOZ A;  3JSV A;  1F9J A;  1U5F A;  3AI5 A;  3H7P A;  5IAA C;  1UBI A;  3P2B A;  3LJ3 A;  3OAN A;  3LDZ E;  3IFW B;  3ZW3 A;  4FJY A;  4LDT B;  4MGK E;  1EO6 A;  3PG7 A;  1UNQ A;  2LUE A;  1J19 A;  2FID A;  4NJ6 A;  3TL5 A;  3PV1 A;  1P6S A;  1KLV A;  4ANV A;  4GMX B;  2DAJ A;  4IW0 A;  4ZRJ A;  2DX1 A;  3R7R A;  1HB6 A;  3TW1 A;  3WA0 A;  4W9H A;  1X11 A;  1UGM A;  2ZEQ A;  1WIA A;  2YRY A;  1X1G A;  3UIN B;  3QWM A;  3H6N A;  4G11 A;  1JRU A;  2I5F A;  4GGQ A;  2KC1 A;  1RJ2 A;  2FCS A;  1WYW B;  5CHW A;  1LM8 B;  3KH0 A;  2RGN B;  1J0W A;  2KFK A;  2DKQ A;  4G3X B;  3L0W B;  1ZM0 A;  3A8Q A;  1V88 A;  3CMM B;  3L16 A;  1W1H A;  3TFM A;  1KJT A;  3WAL A;  1WGU A;  1P3R A;  2MA9 B;  2WX1 A;  2IO0 B;  4AUQ C;  2KQ7 A;  4MSQ B;  2D07 B;  2KVR A;  1N3H A;  4MGI E;  3UGB B;  3EHV A;  3KY9 A;  1UEL A;  1LQB A;  1KI1 B;  1RAX A;  3UF8 A;  3TVV A;  2ROZ B;  1HB8 A;  2AWT A;  2VRW B;  4DX8 A;  1X1M A;  2E2X A;  4HXD A;  3P7Z A;  2K2J A;  1WE6 A;  1UBQ A;  4W9F A;  3GYP A;  4HPM B;  1U2B A;  3RCZ A;  2L00 B;  4EZL A;  3O96 A;  4NAW B;  4GXB A;  2RNR B;  2JVC A;  3CF6 E;  2L1C A;  3A9K B;  4FUL A;  2D9Z A;  1WG7 A;  2D10 A;  4FAD A;  5C1Z A;  2K25 A;  2K8H A;  5JZE B;  1NVL A;  4KSK C;  2IY1 B;  3V61 A;  4W9J A;  1WR6 E;  1PLS A;  1V9J A;  2OQB A;  2M14 A;  2EC1 A;  2KLG A;  4KIK B;  1NTV A;  4CHJ A;  2N9E B;  5JHH A;  1S3S G;  1V80 A;  3A8P A;  2ZCC A;  3ZNH B;  4B9K A;  1U5G A;  1YIW A;  3ZUN A;  2KJR A;  5HE0 A;  3SV1 A;  1E8X A;  5C5B B;  3D8F A;  1TJ6 A;  2KHW B;  2RUK B;  1WGR A;  4JLC A;  2GJY A;  2RR9 A;  5E6N A;  1R4M I;  1SGH A;  4F7H A;  2C5L C;  1KM7 A;  3JSV B;  3X23 A;  1AQC A;  2DHK A;  2KFJ A;  2OTX A;  2HTH A;  1X86 A;  1EVH A;  4HCN B;  4FJZ A;  3KVF B;  3PRP B;  5J2R A;  2FJ9 A;  2KQS A;  5CTR C;  3SU8 X;  2Q13 A;  2N7E A;  4XWX A;  2M8S A;  2QKM A;  3WAO A;  1UPQ A;  4IWQ A;  4XX5 A;  4PYZ A;  2UVM A;  2KN5 A;  2COF A;  1WMH A;  2MWS B;  3PVL A;  1WY8 A;  2LUL A;  4M8M A;  2KDF B;  5G55 A;  2K8B A;  4EFO A;  2KXJ A;  4X57 B;  5AZG A;  1V86 A;  2JT4 B;  2K6Q A;  2RD0 A;  1WXS A;  2LVO A;  3RUI B;  4K2O A;  2LZ6 A;  1X1F A;  2KNB A;  4HCP B;  1BWN A;  4G0N B;  3SYX A;  4ANU A;  3AU5 A;  4TV3 A;  2L8J A;  2BWF A;  4CO7 A;  1PFJ A;  1QC6 A;  1D3Z A;  2L3Z A;  2C9W B;  3IVF A;  2O6V B;  2Y7B A;  2LG1 A;  2IFS A;  3KSY A;  5DPR A;  4EKU A;  4WJP A;  1TQZ A;  2D4Q A;  2J0M A;  4MGY E;  3C0R B;  4L6E A;  2AL6 A;  4EZJ A;  4DWF A;  1PQS A;  2YT0 A;  2UZS A;  2FCN A;  3APD A;  1V5T A;  3MHS D;  2JP2 A;  1WZ0 A;  2KDI A;  5JHG A;  2V4L A;  4BKG A;  2Z0Q A;  3AXC A;  4B95 A;  3KYD D;  3A1Q A;  1J0G A;  3ZRC A;  2XEW A;  5CHV C;  4W9C A;  3EC8 A;  2YF0 A;  5CX3 A;  2P0F A;  1M7E A;  2RVB B;  4WVF B;  4ASW C;  2DHZ A;  2W9N A;  5J17 A;  3QAQ A;  4HLE A;  5AZF A;  3DCG A;  1WXV A;  1V5U A;  2COD A;  2V76 A;  2D9Y A;  4PYU A;  2ABD A;  3V62 A;  1ZC4 B;  1FHW A;  4GIV A;  2NCN A;  1VCB A;  4Z2N A;  1WJM A;  5KQ1 A;  2JXX A;  2C60 A;  4BVU C;  4H8S A;  3ML4 A;  1U27 A;  4IUM B;  2MCN B;  1WI1 A;  3DBL I;  3N7C A;  2ROV A;  5D3X A;  4HAT B;  2BF8 B;  2ZVO A;  2YVC A;  2D2Q A;  1Z5S B;  2KJ6 A;  2WYQ A;  4WAA A;  2M0X A;  4HB3 B;  5CHF A;  2I1J A;  3VH3 B;  2BGF A;  1EGX A;  2D11 A;  1XKE A;  1P0R A;  2CQU A;  3UIO B;  3FLV A;  5DIF B;  1V5M A;  1RRP B;  2JUO A;  3PSC A;  1WJ4 A;  2WWZ A;  4W9G A;  4HB2 B;  4ANW A;  1WGH A;  2MBE A;  2QKL A;  4DHZ B;  3MDB C;  4MGZ E;  4GPT B;  5L95 C;  2ZPY A;  3FEH A;  3BY4 B;  3CXB B;  1E90 A;  2MQJ A;  4MT7 A;  5G2N A;  2BYF A;  4K2P A;  1V6E A;  5D7G A;  3R3M A;  2FDQ A;  2VSZ A;  1RLF A;  1P9D U;  4JQW C;  4DK5 A;  2N9P C;  4HWI B;  1UPR A;  1LFD A;  2CKH B;  2KO3 A;  3N3K B;  3KRW A;  2GOW A;  4BOZ B;  3HQC A;  2C7M B;  1WJ1 A;  1BT0 A;  3UQA A;  2LGX A;  2MLB A;  5LLI A;  2Z0E B;  4K7S A;  2IZV B;  4KZ0 A;  2N9X A;  2MW5 A;  1SE9 A;  2LWP A;  4JL9 A;  2DHJ A;  4NQK E;  2Z0O A;  3DOW A;  4KHO A;  5E6O A;  1K5D B;  2KLC A;  1V49 A;  3BJI A;  3SHQ A;  5DHA B;  1P3Q U;  2NPT A;  1V81 A;  3ULB A;  5JHA A;  2REX A;  2L0F A;  2LBB A;  2HE7 A;  1U5E A;  2RSU A;  4HVB A;  1Z87 A;  1OEY A;  2I1K A;  1XQQ A;  3IHP C;  2GBJ A;  4II2 B;  4RMA A;  3NZU A;  4WQO B;  3AJ4 A;  2HJ8 A;  3QAR A;  5TR5 A;  2L2I A;  3VTU A;  2CY5 A;  3GZN I;  3VUW A;  2KWU B;  3N30 A;  1OY2 A;  4IM0 A;  3N32 A;  4IM3 A;  3PT2 B;  3JYU A;  3IG3 A;  3T06 A;  2YLM A;  4JGH B;  3SUZ A;  4A3O A;  2EMT A;  3GOE A;  1IYF A;  4K7U A;  4M8N A;  4URK A;  5DH9 B;  2MBH A;  1DBH A;  4F7G A;  2K6D B;  3PVW A;  4A20 A;  5L81 A;  4GMV A;  1NI2 A;  5J3Q A;  2DLW A;  2NZ8 B;  5HE1 A;  2FUH B;  4IWO A;  5J18 A;  3MTN B;  3OLM D;  4OVU A;  1CMX B;  4F7U P;  4MEL A;  3ZNZ B;  5IJM A;  4MDK E;  2KC2 A;  2MKR A;  4MY6 A;  3W1S C;  3DXD A;  1P1A A;  2KJH B;  3RZF A;  1XR0 B;  3ZNI D;  4NSW A;  2ZJD A;  3UQB A;  2MBB B;  3PRE A;  2MP2 B;  4YON A;  3HIZ A;  2XBB C;  1W1G A;  2K8C A;  2KX3 A;  1WRD B;  2L0T A;  1AAR A;  2G3Q B;  1XD3 B;  5LXI B;  1C1Y B;  4F8C B;  5C23 A;  5D6J B;  4TQ0 A;  2KTR A;  4WSF A;  1BTN A;  3RD2 A;  2KAN A;  4GDK A;  1OEY J;  3F0W A;  1OTR B;  4IOY X;  2DN6 A;  2J7Q B;  3PRM B;  3MPX A;  1MG8 A;  2DYM A;  5E6P A;  3TO1 A;  4DBB A;  2KKC A;  3PZD A;  2DEN B;  2NBV B;  1ST7 A;  1RRB A;  2VRR B;  1NU2 A;  1V89 A;  3AUL A;  5DPT A;  1PMS A;  1OQN A;  2B3A A;  3F5R A;  2LXC A;  2DHI A;  1XCG A;  2AL3 A;  1YD8 U;  2LGD A;  4GB9 A;  1TTN A;  3M95 A;  1DDW A;  2GBR A;  4B6W A;  4NQL B;  3VTV A;  1Y19 B;  2CRF A;  2BKR B;  3QJZ A;  3ZDT A;  3ECI A;  3OJ3 A;  3SD5 A;  3VHT C;  4IG7 B;  1WR1 A;  2JY6 A;  3QX1 A;  4MJS A;  2J0J A;  3RT3 B;  2FAZ A;  1ZVR A;  4TKN A;  4A6F A;  4A6K A;  5DPW A;  5KHQ A;  4LJO B;  3VTW A;  4EEW A;  4BBK A;  2N7D A;  1LXD A;  2JPH A;  1XT9 B;  2NR2 A;  3QBV B;  3QIJ A;  5D3W A;  2DZK A;  1TZ1 A;  2UZR A;  4M0W B;  2NPT B;  2MDX A;  3QHT A;  2DZM A;  4MM3 A;  1K5G B;  3PEG A;  3H7P B;  1S1Q B;  3VXW A;  4LJP B;  1E8Z A;  2KZR A;  1E8W A;  4Y94 A;  4OVV A;  2D9X A;  1GUA B;  2O2V A;  4GSW A;  4DHJ D;  3DBR I;  1Q67 A;  2M17 A;  2KDE B;  3DXC A;  2R2Q A;  1BAK A;  3KUD B;  4HB0 B;  2JZ3 B;  2K00 A;  4J6I A;  3LJU X;  4BKS A;  4HJK A;  3ZTD A;  4N9F 4;  4W9I A;  2COP A;  2L76 A;  2LJ5 A;  4FHJ A;  4HPL B;  2ELA A;  3B08 A;  3VVW B;  3NSU A;  3D8E A;  2OJR A;  2IO3 B;  4FBJ B;  4IAP A;  2Z0P A;  2IO2 B;  2ZNV C;  4K1R B;  2LXA A;  5GOW B;  3NS8 A;  4G50 A;  4LCD E;  1MK7 B;  4HHV A;  3RZW C;  3PS6 A;  1V2Y A;  3PHW B;  1YJ1 A;  3WAN A;  4KZC A;  2AEH A;  3T8M A;  2KGX B;  2MFQ A;  5D2M B;  3ZVV A;  1IPG A;  3PLU A;  2V3S A;  5FR6 A;  1H10 A;  2RPQ A;  4F7Z A;  3QQ8 B;  2KMC A;  2KFK B;  1QZE A;  5D3Y A;  3IBE A;  3HK0 A;  1ISN A;  2IBI B;  3B0A A;  2UWQ A;  3T9L A;  5KCV A;  1WGQ A;  3V6E B;  2W2W A;  3VH4 B;  4ANX A;  2IYB A;  3AU4 A;  4MH0 E;  2YS5 A;  1WH3 A;  2YS1 A;  1UD7 A;  4PS8 A;  5KHO A;  4EOY A;  3DPD A;  1NDD A;  3D8D A;  4EZK A;  2N1V A;  2KD0 A;  3ZTC A;  1T0Y A;  3DQV A;  4YL8 A;  2ZNV B;  2LD9 A;  2H7D A;  1FOE A;  4GN1 A;  5L83 A;  1FXT B;  3CSF A;  5D27 A;  4WWP A;  4KSL C;  1LW3 A;  4K17 A;  2WX0 A;  3ODO A;  3ML9 A;  4KDL B;  1GJZ A;  1OMW A;  1ACA A;  2RLO A;  3OJ4 B;  2K2U A;  4DDI D;  2NBU A;  2O6V D;  1I42 A;  5D3V A;  2LKO A;  3L54 A;  4DXA B;  5HKH A;  3A98 B;  3W1Y A;  3GYO A;  4HK2 A;  3NZS A;  3O65 B;  4KDI C;  2V1Y A;  2YSZ A;  3K9P B;  5LXH A;  2FNJ B;  2CS4 A;  1ZSQ A;  4F1S A;  5JHB A;  1IP9 A;  4MSM B;  3R7Q A;  4ZRI A;  3A33 B;  3APF A;  2L7R A;  5EFX A;  4AP4 C;  1A5R A;  1WX8 A;  1FHX A;  4KVG B;  1UNR A;  1VD2 A;  2ZVN A;  4K7W A;  4I6L B;  2MSE D;  3MJW A;  2C7N B;  5C16 A;  5JLJ B;  4DX9 0;  4DDG D;  3V6C B;  1U29 A;  4MJS B;  2AYO B;  2PE6 B;  3R66 C;  2CAY A;  1Q1O A;  3KW5 B;  3PLV A;  4HAZ B;  2KWV B;  4BBN F;  1C3T A;  4NAW A;  2XK5 A;  4HDO A;  2GBM A;  2BWE S;  2BPS A;  3DDC B;  4WJO A;  1ZC3 B;  3ODX A;  3A9K A;  1WX7 A;  1HBK A;  2HTH B;  3A9J A;  2LGY A;  1B55 A;  4AWJ A;  4MK0 A;  2I5C A;  4I6P A;  3SNH A;  1ZW7 A;  1MIZ B;  3QK0 A;  2KUP A;  4IWP A;  2GBK A;  4A5K A;  1P98 A;  2Y8F A;  3WIM A;  2DFK A;  2XQN M;  2KOX A;  4BKT A;  1K8R B;  2M1M A;  3ENE A;  4AJY B;  1IRS A;  2JWZ A;  2GCL A;  1WMH B;  2P0H A;  3DVG Y;  4KIK A;  2Y5B B;  2LI5 A;  1SIF A;  3HW2 B;  4GOC A;  4WJN A;  2LAS A;  2DYB A;  5EDS A;  1OGW A;  3ALB A;  3H9D A;  4HB4 B;  1YX5 B;  3A4S C;  3WYF B;  2LRW A;  2CR5 A;  5KQ4 A;  2ZPN A;  1MKE A;  2W2X D;  5AEK B;  2Z0D B;  2R09 A;  1Q5W B;  2HD5 B;  1SHC A;  3APC A;  2ASQ A;  2K1F A;  4ICV A;  4EUT A;  4EJN A;  3L13 A;  3HHM A;  2LYD A;  3K9O B;  1V61 A;  3HM6 X;  1NTI A;  3PRZ A;  2R0D A;  3DVG X;  1H4R A;  4BKS D;  3VUY A;  5HE2 A;  2MBO A;  1BTK A;  3A1Q B;  3JVZ X;  1KZ7 A;  4FJV B;  1NBF C;  3I3T B;  2NBW B;  1RFA A;  1Q0W B;  2YT1 A;  5BO4 B;  2PZ1 A;  2RSG A;  3KUC B;  5CLL B;  1EUV B;  1LB1 A;  1DRO A;  4NY0 A;  5J3Y A;  5LOP B;  4W9D A;  3V5W A;  3NOB A;  3H1U A;  2NS5 A;  1TXD A;  3EFU A;  1WVH A;  1WFY A;  2CHX A;  2COA A;  3ZO5 B;  4NPN A;  4NJ7 A;  2QHO A;  5FI0 A;  2O6V A;  2KDB A;  3PTF C;  4JIO U;  4XZ4 A;  1L2N A;  5J3T A;  2ZZP B;  2A5U A;  4LDT D;  4D0N B;  2GS0 A;  2IYD B;  2FCQ A;  4KAX B;  3G9W A;  3ZLZ A;  4AOF A;  2A4Z A;  3ZIM A;  5CLQ B;  3L17 A;  1KOT A;  1YQB A;  3NHE B;  3EEC A;  1UNP A;  4A6H A;  3V60 A;  4GDL A;  1ZKH A;  2VKI A;  1WGY A;  2IY0 B;  2LVP A;  4GU2 A;  2G4S A;  3TCA A;  1DDM A;  1WM3 A;  1V5P A;  1I7A A;  1WX9 A;  2MRP A;  3RCP A;  3ODW A;  2D3G A;  3QWZ B;  3KYC D;  3H7S A;  5DHF B;  2DZI A;  4Z2M B;  5JH5 C;  4TUU A;  2FJL A;  2DZJ A;  4DHZ E;  3QC8 B;  1J8C A;  1Y5O A;  4IC7 B;  2LVQ A;  2XK5 B;  3ML8 A;  3ULC A;  2ZCB A;  4RM9 A;  1WGD A;  4WWN A;  1WXM A;  3L10 B;  3ZRF A;  3UIP B;  2KTF A;  1FAO A;  1WE7 A;  2DKP A;  4IFS A;  3A9J B;  4DHJ B;  3SDL C;  1OQY A;  2MBQ A;  4A3P A;  3S2A A;  2DX5 A;  3ZKJ C;  1AWE A;  2OOB B;  5GMV A;  1DDV A;  4W9E A;  5JP4 A;  2P0D A;  3ONS A;  4B6H A;  2PJH A;  1MPH A;  2DYN A;  1GNU A;  1WI0 A;  3SO6 A;  3L08 A;  1E7V A;  3QA8 A;  1P5T A;  4BFR A;  3Q3J A;  1W1D A;  1E7U A;  2H7E A;  2IO1 B;  2FIF A;  3X0W A;  2BYV E;  5FI1 A;  2D9V A;  4WJ7 A;  3HM3 A;  4PS7 A;  1WXA A;  1GC6 A;  3DBS A;  1X05 A;  2PE9 A;  2DYO A;  3B1L X;  5DCN A;  2HRJ A;  4PS3 A;  2EJ8 A;  1FB8 A;  1XD4 A;  4NNJ B;  1MK9 B;  1UZX B;  2YS3 A;  4HAV B;  4K81 A;  4KV2 A;  3KUZ A;  4ICU A;  4PNK A;  2ADZ A;  2FCM A;  3VDZ A;  2DTC A;  1MIX A;  1EF5 A;  1E5W A;  4ZYN A;  2M38 A;  4FHK A;  3DXE A;  3PGE A;  1WZ3 A;  4HAW B;  3PVU A;  1WJN A;  2D9W A;  4P7I A;  3M62 B;  3U30 A;  3Q3F A;  3U7D A;  3UZT A;  4E74 A;  3BIN A;  3OAW A;  3NY5 A;  2CHZ A;  2RQ1 A;  2M4N A;  2X18 A;  4C0A A;  2DAF A;  1NTY A;  4BOS C;  1EAZ A;  1U4A A;  3TMP B;  3D32 A;  2GBN A;  2RGF A;  2N0Y A;  3U8Z A;  3WAM A;  4ZDV A;  1GC7 A;  4II3 B;  4ZRK A;  2LOX A;  5LON B;  5AZH A;  2Y8G A;  5DI9 B;  2NVU I;  2DA0 A;  1HE8 A;  4KHB B;  4GDL B;  4TYZ A;  2GCJ A;  1XX0 A; 
#chains in the Genus database with same CATH topology
 1VLB A;  5JVL A;  2ELB A;  4Q2J A;  5C2T B;  3VUX A;  4DBG A;  4HAY B;  4WJQ A;  4GZU A;  2J0K A;  3ZVR A;  2RRF A;  2KTR B;  4W9K A;  2BKF A;  2PEA A;  2JRH A;  3BVZ A;  1K50 A;  3M3J A;  4E3C A;  1UH6 A;  4L23 A;  4GDK B;  5IA7 A;  5C79 A;  1QQG A;  3PPA A;  1QOG A;  2VZK D;  4P16 A;  1Z2M A;  1TS5 A;  1WGG A;  2N23 A;  4XC2 A;  4CQN A;  2G35 A;  3PP2 A;  2P8V A;  2CHW A;  4AJW A;  1H8C A;  4MAC A;  1G6J A;  4IM2 A;  4I6N B;  1I2H A;  2W2X C;  2EKE C;  4CHM A;  1WJU A;  2X38 A;  3Q8C A;  1UEF A;  4PQ0 A;  1F52 A;  3DBH I;  2CY4 A;  2BYE A;  2CB8 A;  2CU1 A;  3RFZ B;  4CHK A;  2EEL A;  2KK8 A;  2KWC A;  3P6A A;  3N9Y C;  1IBX A;  3M1I B;  5EE3 A;  3PHX B;  4N59 A;  3Q8B A;  1FGY A;  2DX5 B;  3M63 B;  4BAX A;  3FSS A;  5MPO A;  4XWT A;  3FM8 C;  3URY A;  2MP2 A;  2K5P A;  1U5D A;  2L05 A;  3DVN V;  3TBL D;  1MHH E;  3KZ1 A;  3DBL B;  1UUP A;  4FN2 A;  1ET6 A;  3ZNG C;  3MFG A;  1WJ6 A;  1FHO A;  4ARI A;  1Y8R C;  1FGZ A;  1E9M A;  2WDT B;  4HKZ E;  1V5O A;  2WDV B;  4A6F B;  2J59 M;  5C6R A;  1XCT L;  2KMA A;  2UYZ B;  1I35 A;  2NMB A;  1DYQ A;  2N0S B;  1TGZ B;  4WUR A;  4FA6 A;  1ZXI A;  3RMK C;  2AQ2 B;  4FLH A;  1WF9 A;  3TJP A;  1HXY D;  1MHX A;  4W9L A;  1M7R A;  2MX2 A;  4BBN C;  2TSS A;  3AH7 A;  2WQY B;  4NZL B;  2DYQ A;  2COC A;  2LRU A;  4TQ1 A;  4IOI E;  3P42 A;  5DPS A;  3VAW A;  4WWO A;  2KAJ A;  1RFK A;  3VQI A;  4KHA A;  3EPY A;  1DYN A;  5I2S A;  1R4N I;  3W1S A;  1L7Y A;  1C77 A;  2O2V B;  1E7P B;  2BCJ A;  1XOD A;  3KRX A;  2G45 B;  1HQR D;  2G4D B;  2MWN B;  1MAI A;  4E71 A;  3DVN U;  3CIK A;  3C8Y A;  3VOQ A;  1R4N B;  2R2O A;  4CYE A;  4JWS C;  3RYT A;  5AUI A;  2N1W A;  1GG3 A;  4EMO A;  2K39 A;  1KZG A;  2JRI B;  2KX0 A;  2FBW B;  3PSE B;  3VFK A;  1QLB B;  1E8Y A;  2N4F A;  4ZHP A;  1GGO A;  4HDQ A;  1YX6 B;  1FXI A;  4N58 A;  2KCJ A;  1TBE A;  1ZGU B;  1WM2 A;  2JZZ A;  3JW0 X;  3QCA A;  3TIX A;  3ZDM C;  4C4V B;  5D94 A;  2WH5 A;  2YEP F;  3VIA A;  3AE2 B;  2GMI C;  4HAX B;  4MEM A;  2Z59 B;  2J4X A;  1EF1 A;  5C5B A;  2PPH A;  1FCC C;  2PVO D;  4HEA 1;  1M94 A;  2C7H A;  3RUL A;  5HE3 A;  2EMS A;  1L6U A;  3WAP A;  4RF0 A;  3CST A;  4HAU B;  3FP5 A;  3AE8 B;  3A4R A;  3E9P A;  4M0W A;  3AEE B;  4RM8 A;  2JF5 A;  1FM0 D;  4ZRQ A;  2LOZ A;  3JSV A;  1TZO A;  2N9L A;  2UU7 A;  3NJT A;  1F9J A;  1U5F A;  3AI5 A;  3H7P A;  5IAA C;  1UBI A;  3P2B A;  3LJ3 A;  3OAN A;  3LDZ E;  3IFW B;  3ZW3 A;  2PTL A;  4FJY A;  4LDT B;  1FIQ A;  1QT9 A;  2BS3 B;  4MGK E;  1EO6 A;  1V1P A;  3N1Z C;  3PG7 A;  1UNQ A;  2LUE A;  2LHD A;  2GRI A;  1J19 A;  1YN3 A;  2FID A;  2E3T A;  5IN7 A;  1ZPS A;  4MH8 A;  2G9H D;  5C3J B;  4NJ6 A;  3TL5 A;  5IP4 D;  3PV1 A;  1P6S A;  1KLV A;  4ANV A;  4GMX B;  1F0Z A;  1FD6 A;  2KUQ A;  2DAJ A;  3AEC B;  4IW0 A;  3AE7 B;  4ITK A;  4ZRJ A;  5T8I A;  2DX1 A;  3R7R A;  1HB6 A;  3TW1 A;  4OVZ A;  3MC0 B;  3WA0 A;  3Q2A C;  4W9H A;  3NWA A;  3GZN B;  4C56 C;  1X11 A;  1EU4 A;  1UGM A;  1CQV A;  5I4D A;  1BUI C;  2ZEQ A;  1WIA A;  3DHH C;  2YRY A;  5G5H A;  1X1G A;  3UIN B;  3QWM A;  3H6N A;  4G11 A;  1JRU A;  2I5F A;  4GGQ A;  3LB8 C;  2KC1 A;  2BVC A;  1RJ2 A;  2Z14 A;  1WYW B;  2FCS A;  3B9J A;  5CHW A;  2JU6 X;  4QAY A;  3SFE B;  1LM8 B;  2QEJ C;  3AED B;  3KH0 A;  2KAC A;  2RGN B;  3U4E G;  1J0W A;  1FRR A;  2KFK A;  2DKQ A;  4G3X B;  3L0W B;  1ZM0 A;  3A8Q A;  4JKF A;  2WXL A;  1JAL A;  1V88 A;  3CMM B;  3L16 A;  1N5X A;  3KQ4 A;  1W1H A;  2IGD A;  1PUT A;  2R82 A;  3TFM A;  1FFV A;  1D5M C;  4KKJ A;  5LNK 1;  1KJT A;  5BYR A;  3WAL A;  5AUK A;  1WGU A;  1P3R A;  2MA9 B;  3RI7 C;  1L0X B;  2WX1 A;  2IO0 B;  4AUQ C;  2KQ7 A;  3Q8F A;  4MSQ B;  3AEB B;  2KIE A;  2D07 B;  2KVR A;  2PVG C;  1N3H A;  4MGI E;  3UGB B;  3EHV A;  3KY9 A;  1UEL A;  1LQB A;  3I63 C;  1KI1 B;  1RAX A;  3UF8 A;  1FMA D;  3TVV A;  2ROZ B;  4RFB A;  1HB8 A;  2AWT A;  2VRW B;  4DX8 A;  1X1M A;  2E2X A;  4HXD A;  4ZYS A;  3P7Z A;  2K2J A;  1WE6 A;  2MJ3 A;  1UBQ A;  4W9F A;  3GYP A;  4HPM B;  1U2B A;  3SR6 A;  1C79 A;  3RCZ A;  2L00 B;  4LNF A;  4EZL A;  3O96 A;  5H8Y E;  4NAW B;  1PFD A;  2Y5C A;  1PYW D;  4GXB A;  2RNR B;  2JVC A;  3CF6 E;  4DQO C;  2L1C A;  1MFW A;  3A9K B;  1ENF A;  4FUL A;  4QJ5 B;  4P6V F;  1HA5 A;  3AE3 B;  2D9Z A;  2WXH A;  1WG7 A;  2D10 A;  3ENB A;  1K51 A;  3ETR A;  2BS4 B;  4FAD A;  2X0S A;  5C1Z A;  2K25 A;  2K8H A;  5JZE B;  1NVL A;  4KSK C;  2IY1 B;  4LLG M;  3V61 A;  2V3N A;  1C78 A;  3Q8A A;  4W9J A;  3E9S A;  1WR6 E;  1PLS A;  4KGS A;  1V9J A;  4PT5 A;  1ZXH A;  2OQB A;  1I4G A;  2M14 A;  1EWC A;  2EC1 A;  2KLG A;  2D3B A;  4REZ A;  4KIK B;  1NTV A;  4CHJ A;  4RCO A;  2N9E B;  5JHH A;  2WXR A;  1HTO A;  1L4D B;  1WWT A;  1S3S G;  1V80 A;  1EM7 A;  3U12 A;  3A8P A;  4ILJ A;  3E56 A;  3NW8 A;  3ZXR A;  2ZCC A;  3ZNH B;  4B9K A;  1U5G A;  3MC9 A;  1YIW A;  3ZUN A;  2KJR A;  2WXG A;  5HE0 A;  3SV1 A;  1E8X A;  3RN9 C;  3KLS X;  1KLG D;  1KBL A;  5C5B B;  3D8F A;  2K3U A;  1TJ6 A;  2KHW B;  4NAM A;  3EA6 A;  2RUK B;  1WGR A;  3DWG C;  4JLC A;  1PGB A;  2GJY A;  2RR9 A;  2L32 A;  2WXF A;  5E6N A;  1R4M I;  1SGH A;  4F7H A;  2C5L C;  1KM7 A;  3JSV B;  4S0R A;  3X23 A;  1AQC A;  2DHK A;  1ZDX A;  2KFJ A;  4L1B A;  2OTX A;  2HTH A;  1X86 A;  1EVH A;  4HCN B;  2AQ3 B;  4OW0 A;  2LEK A;  4FJZ A;  3U2S C;  3OHM B;  3KVF B;  4YWG G;  3PRP B;  4XYC A;  1R4M B;  5J2R A;  1GB1 A;  2FJ9 A;  2KQS A;  1HTQ A;  5CTR C;  3SU8 X;  1WGK A;  1V1P B;  4JKC A;  2Q13 A;  2N7E A;  5EE1 A;  4XWX A;  2M8S A;  2QKM A;  1FNU A;  4RH6 A;  3WAO A;  1UPQ A;  2MJD A;  2ON8 A;  1ZDV A;  4IWQ A;  4XX5 A;  3AMZ A;  1P7E A;  4PYZ A;  2UVM A;  2KN5 A;  2COF A;  1WMH A;  2MWS B;  3PVL A;  1WY8 A;  4XDD A;  2LUL A;  4M8M A;  2KDF B;  5G55 A;  2K8B A;  4EFO A;  2KXJ A;  4X57 B;  5AZG A;  3E9O A;  1V86 A;  2JT4 B;  3IXS A;  2K6Q A;  3T3O A;  2RD0 A;  1WXS A;  3AE5 B;  2LVO A;  1V1O A;  3RNG C;  2VH2 A;  3RUI B;  2WXP A;  4K2O A;  1I4P A;  3GB1 A;  2LZ6 A;  3LXF A;  3HSA A;  1MJD A;  4MT5 A;  1X1F A;  2KNB A;  4HCP B;  3DHG C;  1BWN A;  4G0N B;  3SYX A;  4ANU A;  3AU5 A;  4JKD A;  4TV3 A;  2L8J A;  3W9C B;  2BWF A;  4CO7 A;  2VZK B;  1PFJ A;  1N61 A;  4PK1 A;  1QC6 A;  1D3Z A;  2L3Z A;  2C9W B;  3IVF A;  2O6V B;  2Y7B A;  2LG1 A;  3AB5 A;  2IFS A;  1YNT E;  3KSY A;  5DPR A;  5BYS A;  4AQ7 A;  2INN E;  4EKU A;  4WJP A;  1TQZ A;  4O1N A;  2D4Q A;  3R2I A;  2J0M A;  2KVZ A;  4MGY E;  4OZB A;  4JKG A;  5E6J A;  3ZQ4 A;  3C0R B;  4L6E A;  2AL6 A;  1LO5 D;  1DIK A;  4EZJ A;  4DWF A;  1PQS A;  2YT0 A;  1SIJ A;  2UZS A;  2FCN A;  3APD A;  3EUB 2;  1V5T A;  4M00 A;  3MHS D;  2JP2 A;  1WZ0 A;  2KDI A;  4KGT A;  5JHG A;  2V4L A;  4BKG A;  1AWD A;  2Z0Q A;  3AXC A;  4B95 A;  3KYD D;  3E9L A;  3A1Q A;  1J0G A;  3ZRC A;  3FVC A;  2XEW A;  5CHV C;  4W9C A;  3EC8 A;  5EE0 A;  2YF0 A;  5CX3 A;  2P0F A;  2PIA A;  1M7E A;  4KX6 B;  1I7H A;  2RVB B;  4WVF B;  5BYQ A;  1LGR A;  4ASW C;  1OFF A;  2DHZ A;  2W9N A;  2WHI A;  5J17 A;  3V05 A;  5D3I B;  1XXG A;  4LTU A;  3QAQ A;  4HLE A;  5AZF A;  3DCG A;  2ICI A;  4A6Q A;  1WXV A;  1V5U A;  2COD A;  2V76 A;  1GAQ B;  2D9Y A;  1T0Q C;  1GPX A;  2WDQ B;  1B9R A;  2M56 B;  4PYU A;  3GE8 C;  2ABD A;  3V62 A;  1ZC4 B;  1FHW A;  5LG4 B;  4GIV A;  2NCN A;  2NMQ A;  1VCB A;  4Z2N A;  1WJM A;  1AN8 A;  3P63 A;  5KQ1 A;  2JXX A;  2C60 A;  4BVU C;  4H8S A;  3ML4 A;  1U27 A;  4IUM B;  2MCN B;  1KF6 B;  3FIL A;  1WI1 A;  2GUM A;  1J7B A;  4YTN B;  3DBL I;  3TEW A;  3N7C A;  2ROV A;  4YSY B;  5D3X A;  1ZOY B;  4HAT B;  2BF8 B;  2ZVO A;  2FE8 A;  2QSD A;  2YVC A;  2D2Q A;  1Z5S B;  4KKI A;  1Y56 A;  3B77 A;  1E6E B;  2KJ6 A;  2WYQ A;  1SJH D;  4WAA A;  1N62 A;  2M0X A;  3I57 A;  3FAH A;  1YOV B;  4HB3 B;  5CHF A;  2I1J A;  1SB3 C;  1QOF A;  3VH3 B;  1T77 A;  2BGF A;  1EGX A;  2D11 A;  1XKE A;  4A9A A;  1P0R A;  1TY2 A;  4XE0 A;  2CQU A;  3UIO B;  3FLV A;  5DIF B;  2M19 A;  1V5M A;  3CIR B;  1JWB D;  2MEK A;  2WNM A;  1RRP B;  2JUO A;  3PSC A;  1WJ4 A;  2WWZ A;  1SE3 A;  4W9G A;  4HB2 B;  1KH0 A;  4ANW A;  1C4C A;  3GE3 C;  2HJ1 A;  1WGH A;  2MBE A;  4UDU C;  2QKL A;  4DHZ B;  3MDB C;  2J52 A;  4MGZ E;  4GPT B;  3P4Q B;  5L95 C;  2ZPY A;  3FEH A;  1PDX A;  2QCZ A;  4YTP B;  3W5U B;  3BY4 B;  3CXB B;  2Z4D A;  1MI0 A;  1E90 A;  2MQJ A;  4MT7 A;  5G2N A;  2BYF A;  4K2P A;  1V6E A;  5H92 C;  2V0G A;  1QOA A;  5D7G A;  3R3M A;  5BMH A;  2NBV A;  1Q10 A;  2FDQ A;  2VSZ A;  1RLF A;  1P9D U;  3BYT B;  4JQW C;  2KQ4 X;  4DK5 A;  1OQQ A;  2N9P C;  1F2R C;  4HWI B;  5I2M A;  1UPR A;  3IAS 1;  1LFD A;  2CKH B;  2KO3 A;  3AV8 A;  3N3K B;  3KRW A;  1NEK B;  1L0V B;  2GOW A;  4BOZ B;  3HQC A;  2C7M B;  1WJ1 A;  2JXT A;  1BT0 A;  2ACZ B;  3UQA A;  2LGX A;  2MLB A;  5LLI A;  2Z0E B;  4K7S A;  4N6E B;  2IZV B;  1DOX A;  4KZ0 A;  1I4Q A;  5HG2 A;  2N9X A;  1UF0 A;  2MW5 A;  1SE9 A;  2K9X A;  2LWP A;  3EFC A;  2WXJ A;  4K3C A;  4D6W A;  4JL9 A;  2DHJ A;  4OSN A;  4QJ4 B;  3FC4 A;  4NQK E;  2Z0O A;  3DOW A;  1MVK A;  4KHO A;  5E6O A;  1K5D B;  1C4A A;  2QJL A;  1E0Z A;  2KLC A;  1YQ4 B;  1EWY C;  1V49 A;  3BZD B;  1K52 A;  3BJI A;  3N20 C;  3SHQ A;  1F2R I;  5DHA B;  1P3Q U;  2NPT A;  1V81 A;  4OHJ A;  3ULB A;  2GI9 A;  2WXO A;  2SEB D;  5JHA A;  2REX A;  4HSI A;  2L0F A;  3B2G A;  2LBB A;  4TMA B;  2HE7 A;  1U5E A;  5IRS A;  2ONQ A;  2W54 A;  3U7Z A;  2RSU A;  2WU2 B;  4HVB A;  1C9F A;  1Z87 A;  1OEY A;  2I1K A;  1WRI A;  1KLU D;  1XQQ A;  2IPK D;  2R2Y A;  3IHP C;  2GBJ A;  4II2 B;  1T5X D;  4RMA A;  1P7F A;  4JKG B;  3NZU A;  4WQO B;  1J7C A;  3AJ4 A;  2B76 B;  2HJ8 A;  3QAR A;  1UNS A;  5TR5 A;  2L2I A;  3VTU A;  2FJU B;  2CY5 A;  3GZN I;  1ACC A;  3VUW A;  2YEP B;  3P4S B;  1ET9 A;  2KWU B;  1SSN A;  3N30 A;  3SFD B;  2WP9 B;  1OY2 A;  4IM0 A;  3N32 A;  3SEB A;  4IM3 A;  3PT2 B;  3JYU A;  3IG3 A;  1DOI A;  1ZE3 D;  5FKA C;  5TSS A;  3T06 A;  1L4Z B;  2RDB C;  2YLM A;  2M0A A;  4JGH B;  2RDH A;  3SUZ A;  4A3O A;  2EMT A;  3GOE A;  3OWE B;  1IYF A;  4K7U A;  4M8N A;  4URK A;  2Z8L A;  5DH9 B;  2MBH A;  1DBH A;  4F7G A;  2K6D B;  3PVW A;  1SJE D;  5L81 A;  4GMV A;  2DIK A;  4A20 A;  1NI2 A;  2I2Y A;  5J3Q A;  2DLW A;  2NZ8 B;  5HE1 A;  2FUH B;  4IWO A;  5J18 A;  3MTN B;  3OLM D;  2JZP A;  4YXD B;  4OVU A;  1CMX B;  3IAM 1;  2IJ0 A;  4F7U P;  4MEL A;  3ZNZ B;  5IJM A;  1AW7 A;  4MDK E;  2KC2 A;  3AE4 B;  2MKR A;  1C76 A;  3P4R B;  4MY6 A;  3W1S C;  3BVM A;  3DXD A;  1P1A A;  2KJH B;  3RZF A;  1XR0 B;  3TEZ A;  3ZNI D;  2Y5P A;  4NSW A;  1IBX B;  3UI3 A;  2ZJD A;  2R61 A;  1VZ7 A;  2LFI A;  2KIG A;  3UQB A;  2MBB B;  3SBG A;  3SBT A;  4XGA B;  3PRE A;  2IGG A;  2MP2 B;  2V9H A;  4IDI A;  4DXF A;  3Q14 C;  4YON A;  3HIZ A;  2XBB C;  5G5G A;  1W1G A;  2KT7 A;  2K8C A;  2KX3 A;  1WRD B;  2L0T A;  1DOY A;  1CK1 A;  1AAR A;  3ZJU A;  2G3Q B;  1XD3 B;  5LXI B;  4JKH A;  1C1Y B;  4F8C B;  2BW2 A;  5C23 A;  5D6J B;  2LHE A;  4TQ0 A;  1NYQ A;  2LUM A;  2KTR A;  4WSF A;  1BTN A;  3RD2 A;  1XCQ L;  3BYY B;  2KAN A;  4GDK A;  1OEY J;  4JKE A;  3F0W A;  1OTR B;  4IOY X;  2VH1 A;  2LMC A;  1T0R C;  2DN6 A;  2N9K A;  2J7Q B;  3PRM B;  3MPX A;  1MG8 A;  1FNV A;  1DGJ A;  2DLB A;  2DYM A;  1FCL A;  2WXK A;  5E6P A;  3TO1 A;  4DBB A;  2KKC A;  3PZD A;  1NYR A;  5JXV A;  2DEN B;  2NBV B;  1ST7 A;  1RRB A;  2EKI A;  1V97 A;  2VRR B;  1NU2 A;  1V89 A;  2KWD A;  3AUL A;  5DPT A;  1PMS A;  1JWS D;  1OQN A;  3NVY A;  3ZJV A;  4LNI A;  5IKC M;  4YT0 B;  2DWQ A;  2B3A A;  2SAK A;  3F5R A;  3RNA C;  2LXC A;  2DHI A;  1XCG A;  2AL3 A;  1YD8 U;  4OT1 A;  2LGD A;  1KC7 A;  3NWF A;  4GB9 A;  1TTN A;  3M95 A;  4J3O D;  1DDW A;  1CZP A;  2GBR A;  1JRO A;  2D3C A;  2K49 A;  4B6W A;  1SE4 A;  4NQL B;  3VTV A;  1Y19 B;  1NEN B;  2CRF A;  2BKR B;  3QJZ A;  3ZDT A;  3MP9 A;  3ECI A;  4GNK B;  3OJ3 A;  3SD5 A;  5FK9 C;  4IG7 B;  1WR1 A;  3VHT C;  2JY6 A;  4DXG A;  3QX1 A;  4MJS A;  2J0J A;  3RT3 B;  1JW9 D;  2FAZ A;  4TKN A;  1ZVR A;  4A6F A;  4A6K A;  1PGA A;  5DPW A;  5KHQ A;  1KRH A;  3VR9 B;  1TIF A;  4LJO B;  1SBB B;  3VTW A;  4EEW A;  2NTS A;  4BBK A;  2WU5 B;  2AQ1 B;  2N7D A;  2KDM A;  1OQR A;  2RPV A;  1LXD A;  2JPH A;  1NVI D;  1XT9 B;  4WH4 A;  1JML A;  4ACF A;  2NR2 A;  3QBV B;  3BK1 A;  3QIJ A;  5D3W A;  2DZK A;  3Q6B A;  1TZ1 A;  2UZR A;  4M0W B;  2BB6 A;  1PGX A;  2NPT B;  3O13 A;  2MDX A;  3QHT A;  2DZM A;  4MM3 A;  1K5G B;  2K8E A;  3PEG A;  4GOU A;  1S1Q B;  3H7P B;  4TSS A;  4LJP B;  2KZR A;  1E8Z A;  1E8W A;  2J53 A;  3AEF B;  3VXW A;  4Y94 A;  4OVV A;  2D9X A;  1GUA B;  2O2V A;  3AEG B;  4GSW A;  2W55 A;  4DHJ D;  3DBR I;  1Q67 A;  5IOI A;  5GXG B;  4M02 A;  1KFY B;  2G1E A;  2M17 A;  2KDE B;  3DXC A;  1B1Z A;  1RYJ A;  2R2Q A;  1BAK A;  3KUD B;  4HB0 B;  3RPF C;  1TKG A;  2JZ3 B;  2K00 A;  4J6I A;  3LJU X;  3DBR B;  4BKS A;  4HJK A;  1EU3 A;  3ZTD A;  4N9F 4;  4W9I A;  4C00 A;  2COP A;  2L76 A;  2LJ5 A;  1I4R A;  4FHJ A;  4HPL B;  4NJC A;  2ELA A;  3A58 A;  1FEH A;  3B08 A;  3VVW B;  3NSU A;  4M01 A;  4US9 A;  1UWX A;  1IGC A;  1N6Z A;  3N1X C;  3D8E A;  2OJR A;  2IO3 B;  4FBJ B;  4WWM A;  4IAP A;  2Z0P A;  1JWU D;  2IO2 B;  3AE9 B;  5HHD G;  3I9V 1;  2ZNV C;  2H89 B;  4K1R B;  2LXA A;  5GOW B;  3NS8 A;  4G50 A;  4LK0 M;  4LCD E;  1MK7 B;  4HHV A;  3RZW C;  3NWD A;  2BS2 B;  2JYE A;  3PS6 A;  1V2Y A;  3PHW B;  1YJ1 A;  2LGI A;  1YJJ A;  3U52 E;  3W5V B;  4KZC A;  3WAN A;  2AEH A;  3T8M A;  2KGX B;  2MFQ A;  2LJI A;  5D2M B;  3NS1 A;  3ZVV A;  4B0M A;  1YMH E;  1IPG A;  3PLU A;  2V3S A;  5FR6 A;  3P4P B;  3RNC C;  1H10 A;  2RPQ A;  4F7Z A;  3QQ8 B;  2KMC A;  2KFK B;  2JSV X;  4JWU C;  1QZE A;  5D3Y A;  3IBE A;  2X8X X;  3HK0 A;  1ISN A;  2IBI B;  1N5W A;  3B0A A;  2UWQ A;  3T9L A;  2JYT A;  4JK9 A;  1NI3 A;  5KCV A;  1WGQ A;  1YJI A;  3V6E B;  2Z13 A;  3MJ5 A;  2BTE A;  4ZOH C;  2GB1 A;  4US8 A;  2W2W A;  3MHZ A;  3VH4 B;  4ANX A;  2WS3 B;  2IYB A;  3AU4 A;  4MH0 E;  2L1A A;  2KYW A;  2YS5 A;  1WH3 A;  2YS1 A;  4A55 A;  1UD7 A;  4PS8 A;  4RGN A;  1SE2 A;  3R2T A;  5KHO A;  1YN5 A;  2HDE A;  3Q3N C;  4EOY A;  2LGS A;  2WXI A;  4XWW A;  3DPD A;  1NDD A;  3D8D A;  4EZK A;  4WIP A;  2N1V A;  2KD0 A;  1QKZ A;  2MHJ A;  3W2D A;  3ZTC A;  1T0Y A;  3DQV A;  4YL8 A;  2ZNV B;  2LD9 A;  2H7D A;  1FRD A;  1FOE A;  4GN1 A;  5L83 A;  1FXT B;  3ZJT A;  3CSF A;  5D27 A;  1IUE A;  1ESF A;  4WWP A;  3NRZ A;  4KSL C;  4HKQ A;  1LW3 A;  4K17 A;  1I4X A;  2WX0 A;  1XLN A;  3ODO A;  1JWA D;  3ML9 A;  4KDL B;  1GJZ A;  2XNA C;  1OMW A;  1ACA A;  4LNK A;  2RLO A;  1BXT A;  3IT6 B;  4RNA A;  1C4P A;  3PO0 A;  2OJW A;  3OJ4 B;  2K2U A;  4DDI D;  2NBU A;  2O6V D;  1I42 A;  5D3V A;  2LKO A;  4L1R A;  2L52 A;  4DXA B;  3L54 A;  5HKH A;  3AM9 A;  3A98 B;  3HUI A;  1MI1 A;  2OHF A;  3W1Y A;  3GYO A;  2W3S A;  4HK2 A;  3DHI C;  3NZS A;  2IGH A;  3O65 B;  4KDI C;  1MPE A;  2V1Y A;  2YSZ A;  3K9P B;  5LXH A;  2FNJ B;  2CS4 A;  3NUH B;  1ZSQ A;  2CJN A;  3HRD D;  4F1S A;  5JHB A;  1IP9 A;  1XLO A;  4MSM B;  4ZRI A;  3R7Q A;  3A33 B;  3APF A;  2L7R A;  3DBH B;  5EFX A;  4AP4 C;  1A5R A;  1WX8 A;  1FHX A;  1IGD A;  4KVG B;  1BML C;  1UNR A;  1VD2 A;  2ZVN A;  4K7W A;  4I6L B;  2E6X A;  2Q5W D;  2MSE D;  3MJW A;  2C7N B;  5C16 A;  5JLJ B;  1T0S C;  4DX9 0;  2I38 A;  4DDG D;  3V6C B;  2IND C;  1U29 A;  4MJS B;  2AYO B;  2PE6 B;  3R66 C;  2CAY A;  4B0E A;  4EE2 A;  1Q1O A;  1SXT A;  3KW5 B;  3PLV A;  4HAZ B;  3KWV A;  1GB4 A;  2KWV B;  2Y3A A;  4BBN F;  1C3T A;  4NAW A;  2XK5 A;  4HJG E;  4HDO A;  2GBM A;  2BWE S;  2BPS A;  2JQR B;  4K3B A;  3DDC B;  4WJO A;  1TT5 B;  1ZC3 B;  1TS4 A;  3ODX A;  3A9K A;  1WX7 A;  1HBK A;  3N1Y C;  4GLS C;  3LYY A;  3GS2 A;  2HTH B;  3A9J A;  4MM3 B;  2LGY A;  1B55 A;  4AWJ A;  4MK0 A;  2I5C A;  2QDF A;  4I6P A;  1VBG A;  3SNH A;  1FFU A;  1ZW7 A;  1MIZ B;  3EGR A;  3QK0 A;  1TS3 A;  2KUP A;  4IWP A;  2GBK A;  4A5K A;  1WSP A;  1P98 A;  2Y8F A;  2PW9 A;  3WIM A;  2DFK A;  4A8X C;  2DBY A;  2XQN M;  2KOX A;  4A90 A;  4BKT A;  1K8R B;  2M1M A;  2BBC A;  2YT2 A;  3ENE A;  4AJY B;  4RGT A;  3CWI A;  1IRS A;  2JWZ A;  2GCL A;  1WMH B;  2P0H A;  3DVG Y;  3Q3O C;  4RGM A;  4P1B C;  2PLP A;  4KIK A;  3R8B A;  1FPY A;  4HRO A;  2Y5B B;  4LNO A;  2LI5 A;  1SIF A;  1K53 A;  1QOB A;  3HW2 B;  3C19 A;  4GOC A;  4WJN A;  3BK2 A;  1ROE A;  4H2A A;  2LAS A;  2DYB A;  5EDS A;  2MJE A;  1HZ5 A;  2K0P A;  2V3P A;  2V4I B;  3ZXV A;  1OGW A;  3ALB A;  3H9D A;  1N60 A;  2ZW0 A;  4HB4 B;  1YX5 B;  2GLS A;  3A4S C;  3NZ3 A;  4QJ3 B;  3WYF B;  2LRW A;  1ZP0 B;  2CR5 A;  1TY0 A;  5KQ4 A;  3WCQ A;  4HPP A;  1HEZ E;  2ZPN A;  3B2F A;  1MKE A;  2W2X D;  5AEK B;  2Z0D B;  3I5J C;  2R09 A;  1Q5W B;  2D3A A;  3BWU D;  2HD5 B;  1SHC A;  3APC A;  2ASQ A;  2K1F A;  2QC8 A;  1D5X C;  3NVV A;  4C7Z A;  4ICV A;  1J7A A;  4EUT A;  4JKA A;  4EJN A;  3L13 A;  3Q8E A;  3HHM A;  3RNF C;  2LYD A;  2WDR B;  5BMI A;  1ZUD 2;  3K9O B;  1V61 A;  3FKY A;  4JX1 C;  3HM6 X;  4FXC A;  1NTI A;  3PRZ A;  2WXM A;  2R0D A;  1E10 A;  4CSQ A;  3DVG X;  1H4R A;  4BKS D;  3VUY A;  5HE2 A;  2MBO A;  2H88 B;  1BTK A;  3A1Q B;  3JVZ X;  1KZ7 A;  3ZGZ A;  4JKB A;  1M4V A;  4FJV B;  2INC C;  2PKO A;  1A70 A;  1NBF C;  3I3T B;  2NBW B;  4JK8 A;  1RFA A;  1JCK B;  1Q0W B;  2YT1 A;  4OZC A;  5BO4 B;  2PZ1 A;  1VBH A;  2RSG A;  3AEA B;  5CLL B;  3KUC B;  4IKG A;  3KWL A;  1EUV B;  2WXN A;  5HI1 A;  1LB1 A;  1DRO A;  1TS2 A;  4NY0 A;  5J3Y A;  5LOP B;  1L0Y B;  4W9D A;  2CJO A;  3V5W A;  3VRA B;  3NOB A;  1KTK A;  3HVD A;  3H1U A;  3TEY A;  2NS5 A;  1TXD A;  3J9C A;  3EFU A;  1WVH A;  1WFY A;  2CHX A;  2COA A;  2RDG A;  3ZO5 B;  4NPN A;  2NTT A;  1TJE A;  4NJ7 A;  2BQQ A;  2QHO A;  5FI0 A;  2O6V A;  2KDB A;  3PTF C;  4JIO U;  3VR8 B;  5BMG A;  1CJE A;  2BT6 A;  4XZ4 A;  3NVZ A;  1N63 A;  1L2N A;  5J3T A;  2ZZP B;  1RWS A;  2A5U A;  4LDT D;  1XO3 A;  4D0N B;  3FIL B;  2GS0 A;  4RGO S;  2IYD B;  2FCQ A;  4KAX B;  2BB5 A;  3G9W A;  4JPS A;  3ZLZ A;  4AOF A;  2A4Z A;  3ZIM A;  5CLQ B;  1D6E C;  1QF6 A;  1SEB D;  3L17 A;  4WQM A;  1KOT A;  1YQB A;  2RMM A;  3NHE B;  3EEC A;  1AYF A;  1UNP A;  4A6H A;  4QXA B;  3V60 A;  4KHB A;  4GDL A;  1ZKH A;  2VKI A;  1WGY A;  2IY0 B;  3DCX A;  5FR3 A;  2LVP A;  4GU2 A;  2G4S A;  3TCA A;  2K22 A;  1JQ4 A;  1DDM A;  1WM3 A;  1V5P A;  1I7A A;  1WX9 A;  1ZYI A;  2L83 A;  2MRP A;  1F1H A;  3RCP A;  1WXQ A;  3ODW A;  3T3N A;  2D3G A;  3QWZ B;  3KYC D;  3E66 A;  3H7S A;  5DHF B;  2WXQ A;  1TKE A;  2PMV A;  2DZI A;  1T3Q A;  3GP7 A;  1V8C A;  4Z2M B;  5JH5 C;  1WYG A;  4TUU A;  2FJL A;  3VRB B;  2DZJ A;  2W82 A;  2XN9 C;  4YSZ B;  4DHZ E;  3QC8 B;  4D2K A;  4WAF A;  1J8C A;  1XLQ A;  3OG5 A;  1Y5O A;  4IC7 B;  3AN1 A;  5D3D A;  2LVQ A;  1TYG B;  4KGR A;  2XK5 B;  1XF5 L;  3ML8 A;  3ULC A;  2ZCB A;  3IT4 B;  4RM9 A;  1WGD A;  4WWN A;  1WXM A;  2WLB A;  3L10 B;  3ZRF A;  3UIP B;  2KTF A;  2AX5 A;  1FAO A;  1WE7 A;  3NVW A;  2DKP A;  4IFS A;  3A9J B;  4DHJ B;  3SDL C;  4YSX B;  2KMM A;  2QIE B;  1OQY A;  2MBQ A;  4A3P A;  3S2A A;  2DX5 A;  1FNW A;  3AE6 B;  3PZ7 A;  3ZKJ C;  4DIX A;  1AWE A;  2ZW1 A;  2OOB B;  5GMV A;  1DDV A;  2JWU A;  4W9E A;  5JP4 A;  2P0D A;  3ONS A;  1R7S A;  4B6H A;  2PJH A;  3L4P A;  1MPH A;  3ZYY X;  1D5Z C;  3BVG A;  2W3R A;  2DYN A;  1GNU A;  1VR9 A;  1WI0 A;  3RNE C;  3SO6 A;  1XLP A;  1UWM A;  2JX5 A;  3L08 A;  1E7V A;  3QA8 A;  1P5T A;  4BFR A;  3Q3J A;  1W1D A;  1E7U A;  2H7E A;  1FXA A;  2IO1 B;  2ZKM X;  2CU3 A;  2FIF A;  3X0W A;  2HTM E;  4JK7 A;  3DWM A;  2BYV E;  5FI1 A;  4LNN A;  2D9V A;  4WJ7 A;  3HM3 A;  1QIL A;  4PS7 A;  2BYT A;  4RF1 A;  1WXA A;  1GC6 A;  1YQ3 B;  3DBS A;  4YTM B;  1X05 A;  3TUO A;  2PE9 A;  2DYO A;  3B1L X;  1JDE A;  5DCN A;  4USA A;  3Q3M C;  3MC8 A;  3Q69 A;  3PZ8 A;  2HRJ A;  4PS3 A;  1QQR A;  2EJ8 A;  1FB8 A;  1GOZ A;  1XD4 A;  4NNJ B;  1MK9 B;  1HZ6 A;  1UZX B;  3HVZ A;  2YS3 A;  4HAV B;  4C7Y A;  4K81 A;  4KV2 A;  3KUZ A;  1VZ6 A;  1F77 A;  4C80 A;  1L6V A;  2DNF A;  4ICU A;  4PNK A;  4S17 A;  2WGS A;  3ABV B;  1MG4 A;  1VZ8 A;  5M4Y B;  2ADZ A;  2FCM A;  4C4V A;  2KN4 A;  3RNB C;  3VDZ A;  2DTC A;  1MIX A;  1EF5 A;  1SF0 A;  1E5W A;  2FUG 1;  2N7J A;  2Z59 A;  4ZYN A;  1FO4 A;  4R3D A;  2M38 A;  4FHK A;  3DXE A;  3PGE A;  4ZHO A;  1WZ3 A;  4HAW B;  4JE3 B;  3PVU A;  1WJN A;  2D9W A;  4P7I A;  2QIL A;  3M62 B;  3P1M A;  3U30 A;  3Q3F A;  4ARC A;  4OZA A;  4HRS A;  4AS1 A;  3U7D A;  3BII D;  4ILH A;  3UZT A;  4E74 A;  4XDC A;  2KR0 A;  4L2Y A;  3BIN A;  3H8H A;  2INP E;  2QMT A;  3OAW A;  3NY5 A;  3HIE A;  2CHZ A;  2MH7 A;  2RQ1 A;  1VRA B;  2M4N A;  2X18 A;  1RM6 C;  2D5G A;  4C0A A;  2DAF A;  3AE1 B;  5EE9 A;  1NTY A;  4BOS C;  2IDY A;  1EAZ A;  1U4A A;  3TMP B;  1D4B A;  3D32 A;  1VDV A;  1XEE A;  2GBN A;  2RGF A;  2N0Y A;  4ZRP A;  3U8Z A;  3WAM A;  3TSS A;  1JWM D;  2OED A;  3TEX A;  4ILG B;  4ZDV A;  1GC7 A;  1I4H A;  4II3 B;  4ZRK A;  1STE A;  1JRP A;  2LOX A;  4BZA A;  1UGJ A;  1TKY A;  5LON B;  1VJK A;  5AZH A;  2Y8G A;  3V3X A;  3NG0 A;  5DI9 B;  2J42 A;  2NVU I;  4P1C C;  2DA0 A;  1HE8 A;  1L5P A;  1YN4 A;  4KHB B;  4GDL B;  4TYZ A;  2GCJ A;  1T6B X;  1XX0 A;  5HFY A;  5IO9 A; 
#chains in the Genus database with same CATH homology
 5JVL A;  2ELB A;  3VUX A;  4DBG A;  4HAY B;  4WJQ A;  4GZU A;  2J0K A;  3ZVR A;  2KTR B;  4W9K A;  2BKF A;  2PEA A;  2JRH A;  3M3J A;  4E3C A;  1UH6 A;  4GDK B;  5IA7 A;  5C79 A;  1QQG A;  3PPA A;  1Z2M A;  1WGG A;  2N23 A;  4XC2 A;  2G35 A;  3PP2 A;  2P8V A;  2CHW A;  4AJW A;  1H8C A;  1G6J A;  4IM2 A;  4I6N B;  1I2H A;  2W2X C;  2EKE C;  4CHM A;  1WJU A;  1UEF A;  4PQ0 A;  3DBH I;  2CY4 A;  2BYE A;  2CB8 A;  2CU1 A;  4CHK A;  2KK8 A;  2KWC A;  3P6A A;  3M1I B;  3PHX B;  1FGY A;  2DX5 B;  3M63 B;  3FSS A;  3FM8 C;  2MP2 A;  1U5D A;  2L05 A;  3DVN V;  3TBL D;  3KZ1 A;  4FN2 A;  3ZNG C;  1WJ6 A;  1FHO A;  1Y8R C;  1FGZ A;  2WDT B;  1V5O A;  4A6F B;  2J59 M;  5C6R A;  2KMA A;  2UYZ B;  1I35 A;  2NMB A;  1TGZ B;  4FA6 A;  4FLH A;  1WF9 A;  3TJP A;  4W9L A;  1M7R A;  2MX2 A;  4BBN C;  2DYQ A;  2COC A;  2LRU A;  4TQ1 A;  5DPS A;  3VAW A;  4WWO A;  3VQI A;  4KHA A;  3EPY A;  1DYN A;  1R4N I;  3W1S A;  1L7Y A;  2O2V B;  2BCJ A;  1XOD A;  3KRX A;  2G45 B;  2G4D B;  2MWN B;  1MAI A;  4E71 A;  3DVN U;  3CIK A;  3VOQ A;  2R2O A;  4CYE A;  3RYT A;  2N1W A;  1GG3 A;  4EMO A;  2K39 A;  1KZG A;  2JRI B;  2KX0 A;  3PSE B;  3VFK A;  1E8Y A;  2N4F A;  1GGO A;  4HDQ A;  1YX6 B;  2KCJ A;  1TBE A;  1ZGU B;  1WM2 A;  2JZZ A;  3JW0 X;  3QCA A;  3TIX A;  3ZDM C;  5D94 A;  2WH5 A;  3VIA A;  2GMI C;  4HAX B;  4MEM A;  2Z59 B;  1EF1 A;  5C5B A;  2PPH A;  1M94 A;  2C7H A;  3RUL A;  5HE3 A;  2EMS A;  3WAP A;  3CST A;  4HAU B;  3FP5 A;  3A4R A;  3E9P A;  4RM8 A;  2JF5 A;  2LOZ A;  3JSV A;  1F9J A;  1U5F A;  3AI5 A;  3H7P A;  5IAA C;  1UBI A;  3P2B A;  3LJ3 A;  3OAN A;  3LDZ E;  3IFW B;  3ZW3 A;  4FJY A;  4LDT B;  4MGK E;  1EO6 A;  3PG7 A;  1UNQ A;  2LUE A;  1J19 A;  2FID A;  4NJ6 A;  3TL5 A;  3PV1 A;  1P6S A;  1KLV A;  4ANV A;  4GMX B;  2DAJ A;  4IW0 A;  4ZRJ A;  2DX1 A;  3R7R A;  1HB6 A;  3TW1 A;  3WA0 A;  4W9H A;  1X11 A;  1UGM A;  2ZEQ A;  1WIA A;  2YRY A;  1X1G A;  3UIN B;  3QWM A;  3H6N A;  4G11 A;  1JRU A;  2I5F A;  4GGQ A;  2KC1 A;  1RJ2 A;  2FCS A;  1WYW B;  5CHW A;  1LM8 B;  3KH0 A;  2RGN B;  1J0W A;  2KFK A;  2DKQ A;  4G3X B;  3L0W B;  1ZM0 A;  3A8Q A;  4JKF A;  1V88 A;  3CMM B;  3L16 A;  1W1H A;  2R82 A;  3TFM A;  1KJT A;  3WAL A;  1WGU A;  1P3R A;  2MA9 B;  2WX1 A;  2IO0 B;  4AUQ C;  2KQ7 A;  4MSQ B;  2D07 B;  2KVR A;  1N3H A;  4MGI E;  3UGB B;  3EHV A;  3KY9 A;  1UEL A;  1LQB A;  1KI1 B;  1RAX A;  3UF8 A;  3TVV A;  2ROZ B;  1HB8 A;  2AWT A;  2VRW B;  4DX8 A;  1X1M A;  2E2X A;  4HXD A;  3P7Z A;  2K2J A;  1WE6 A;  1UBQ A;  4W9F A;  3GYP A;  4HPM B;  1U2B A;  3RCZ A;  2L00 B;  4EZL A;  3O96 A;  4NAW B;  4GXB A;  2RNR B;  2JVC A;  3CF6 E;  2L1C A;  3A9K B;  4FUL A;  2D9Z A;  1WG7 A;  2D10 A;  3ENB A;  4FAD A;  2X0S A;  5C1Z A;  2K25 A;  2K8H A;  5JZE B;  1NVL A;  4KSK C;  2IY1 B;  3V61 A;  4W9J A;  1WR6 E;  1PLS A;  1V9J A;  2OQB A;  2M14 A;  2EC1 A;  2KLG A;  4KIK B;  1NTV A;  4CHJ A;  2N9E B;  5JHH A;  1S3S G;  1V80 A;  3A8P A;  4ILJ A;  2ZCC A;  3ZNH B;  4B9K A;  1U5G A;  1YIW A;  3ZUN A;  2KJR A;  5HE0 A;  3SV1 A;  1E8X A;  1KBL A;  5C5B B;  3D8F A;  1TJ6 A;  2KHW B;  2RUK B;  1WGR A;  4JLC A;  2GJY A;  2RR9 A;  5E6N A;  1R4M I;  1SGH A;  4F7H A;  2C5L C;  1KM7 A;  3JSV B;  3X23 A;  1AQC A;  2DHK A;  2KFJ A;  2OTX A;  2HTH A;  1X86 A;  1EVH A;  4HCN B;  4FJZ A;  3KVF B;  3PRP B;  5J2R A;  2FJ9 A;  2KQS A;  5CTR C;  3SU8 X;  4JKC A;  2Q13 A;  2N7E A;  4XWX A;  2M8S A;  2QKM A;  3WAO A;  1UPQ A;  4IWQ A;  4XX5 A;  4PYZ A;  2UVM A;  2KN5 A;  2COF A;  1WMH A;  2MWS B;  3PVL A;  1WY8 A;  2LUL A;  4M8M A;  2KDF B;  5G55 A;  2K8B A;  4EFO A;  2KXJ A;  4X57 B;  5AZG A;  3E9O A;  1V86 A;  2JT4 B;  2K6Q A;  2RD0 A;  1WXS A;  2LVO A;  3RUI B;  4K2O A;  2LZ6 A;  1X1F A;  2KNB A;  4HCP B;  1BWN A;  4G0N B;  3SYX A;  4ANU A;  3AU5 A;  4JKD A;  4TV3 A;  2L8J A;  2BWF A;  4CO7 A;  1PFJ A;  1QC6 A;  1D3Z A;  2L3Z A;  2C9W B;  3IVF A;  2O6V B;  2Y7B A;  2LG1 A;  2IFS A;  3KSY A;  5DPR A;  4EKU A;  4WJP A;  1TQZ A;  2D4Q A;  2J0M A;  4MGY E;  4JKG A;  3C0R B;  4L6E A;  2AL6 A;  1DIK A;  4EZJ A;  4DWF A;  1PQS A;  2YT0 A;  2UZS A;  2FCN A;  3APD A;  1V5T A;  3MHS D;  2JP2 A;  1WZ0 A;  2KDI A;  5JHG A;  2V4L A;  4BKG A;  2Z0Q A;  3AXC A;  4B95 A;  3KYD D;  3E9L A;  3A1Q A;  1J0G A;  3ZRC A;  2XEW A;  5CHV C;  4W9C A;  3EC8 A;  2YF0 A;  5CX3 A;  2P0F A;  1M7E A;  2RVB B;  4WVF B;  4ASW C;  2DHZ A;  2W9N A;  5J17 A;  3QAQ A;  4HLE A;  5AZF A;  3DCG A;  1WXV A;  1V5U A;  2COD A;  2V76 A;  2D9Y A;  4PYU A;  2ABD A;  3V62 A;  1ZC4 B;  1FHW A;  4GIV A;  2NCN A;  1VCB A;  4Z2N A;  1WJM A;  5KQ1 A;  2JXX A;  2C60 A;  4BVU C;  4H8S A;  3ML4 A;  1U27 A;  4IUM B;  2MCN B;  1WI1 A;  3DBL I;  3N7C A;  2ROV A;  5D3X A;  4HAT B;  2BF8 B;  2ZVO A;  2YVC A;  2D2Q A;  1Z5S B;  2KJ6 A;  2WYQ A;  4WAA A;  2M0X A;  4HB3 B;  5CHF A;  2I1J A;  3VH3 B;  2BGF A;  1EGX A;  2D11 A;  1XKE A;  1P0R A;  2CQU A;  3UIO B;  3FLV A;  5DIF B;  1V5M A;  1RRP B;  2JUO A;  3PSC A;  1WJ4 A;  2WWZ A;  4W9G A;  4HB2 B;  4ANW A;  1WGH A;  2MBE A;  2QKL A;  4DHZ B;  3MDB C;  4MGZ E;  4GPT B;  5L95 C;  2ZPY A;  3FEH A;  3BY4 B;  3CXB B;  1E90 A;  2MQJ A;  4MT7 A;  5G2N A;  2BYF A;  4K2P A;  1V6E A;  5D7G A;  3R3M A;  2FDQ A;  2VSZ A;  1RLF A;  1P9D U;  4JQW C;  4DK5 A;  2N9P C;  4HWI B;  1UPR A;  1LFD A;  2CKH B;  2KO3 A;  3N3K B;  3KRW A;  2GOW A;  4BOZ B;  3HQC A;  2C7M B;  1WJ1 A;  1BT0 A;  3UQA A;  2LGX A;  2MLB A;  5LLI A;  2Z0E B;  4K7S A;  2IZV B;  4KZ0 A;  2N9X A;  2MW5 A;  1SE9 A;  2LWP A;  4JL9 A;  2DHJ A;  4NQK E;  2Z0O A;  3DOW A;  4KHO A;  5E6O A;  1K5D B;  2KLC A;  1V49 A;  3BJI A;  3SHQ A;  5DHA B;  1P3Q U;  2NPT A;  1V81 A;  3ULB A;  5JHA A;  2REX A;  2L0F A;  2LBB A;  2HE7 A;  1U5E A;  2RSU A;  4HVB A;  1Z87 A;  1OEY A;  2I1K A;  1XQQ A;  3IHP C;  2GBJ A;  4II2 B;  4RMA A;  4JKG B;  3NZU A;  4WQO B;  3AJ4 A;  2HJ8 A;  3QAR A;  5TR5 A;  2L2I A;  3VTU A;  2CY5 A;  3GZN I;  3VUW A;  2KWU B;  3N30 A;  1OY2 A;  4IM0 A;  3N32 A;  4IM3 A;  3PT2 B;  3JYU A;  3IG3 A;  3T06 A;  2YLM A;  4JGH B;  3SUZ A;  4A3O A;  2EMT A;  3GOE A;  1IYF A;  4K7U A;  4M8N A;  4URK A;  5DH9 B;  2MBH A;  1DBH A;  4F7G A;  2K6D B;  3PVW A;  4A20 A;  5L81 A;  4GMV A;  2DIK A;  1NI2 A;  5J3Q A;  2DLW A;  2NZ8 B;  5HE1 A;  2FUH B;  4IWO A;  5J18 A;  3MTN B;  3OLM D;  4OVU A;  1CMX B;  4F7U P;  4MEL A;  3ZNZ B;  5IJM A;  4MDK E;  2KC2 A;  2MKR A;  4MY6 A;  3W1S C;  3DXD A;  1P1A A;  2KJH B;  3RZF A;  1XR0 B;  3ZNI D;  4NSW A;  2ZJD A;  3UQB A;  2MBB B;  3SBG A;  3SBT A;  3PRE A;  2MP2 B;  4YON A;  3HIZ A;  2XBB C;  1W1G A;  2K8C A;  2KX3 A;  1WRD B;  2L0T A;  1AAR A;  2G3Q B;  1XD3 B;  5LXI B;  4JKH A;  1C1Y B;  4F8C B;  5C23 A;  5D6J B;  4TQ0 A;  2KTR A;  4WSF A;  1BTN A;  3RD2 A;  2KAN A;  4GDK A;  1OEY J;  4JKE A;  3F0W A;  1OTR B;  4IOY X;  2DN6 A;  2J7Q B;  3PRM B;  3MPX A;  1MG8 A;  2DYM A;  5E6P A;  3TO1 A;  4DBB A;  2KKC A;  3PZD A;  2DEN B;  2NBV B;  1ST7 A;  1RRB A;  2VRR B;  1NU2 A;  1V89 A;  3AUL A;  5DPT A;  1PMS A;  1OQN A;  2B3A A;  3F5R A;  2LXC A;  2DHI A;  1XCG A;  2AL3 A;  1YD8 U;  2LGD A;  1KC7 A;  4GB9 A;  1TTN A;  3M95 A;  1DDW A;  2GBR A;  4B6W A;  4NQL B;  3VTV A;  1Y19 B;  2CRF A;  2BKR B;  3QJZ A;  3ZDT A;  3ECI A;  3OJ3 A;  3SD5 A;  3VHT C;  4IG7 B;  1WR1 A;  2JY6 A;  3QX1 A;  4MJS A;  2J0J A;  3RT3 B;  2FAZ A;  4TKN A;  1ZVR A;  4A6F A;  4A6K A;  5DPW A;  5KHQ A;  4LJO B;  3VTW A;  4EEW A;  4BBK A;  2N7D A;  1LXD A;  2JPH A;  1XT9 B;  2NR2 A;  3QBV B;  3QIJ A;  5D3W A;  2DZK A;  1TZ1 A;  2UZR A;  4M0W B;  2NPT B;  2MDX A;  3QHT A;  2DZM A;  4MM3 A;  1K5G B;  3PEG A;  3H7P B;  1S1Q B;  3VXW A;  4LJP B;  1E8Z A;  2KZR A;  1E8W A;  4Y94 A;  4OVV A;  2D9X A;  1GUA B;  2O2V A;  4GSW A;  4DHJ D;  3DBR I;  1Q67 A;  2M17 A;  2KDE B;  3DXC A;  2R2Q A;  1BAK A;  3KUD B;  4HB0 B;  2JZ3 B;  2K00 A;  4J6I A;  3LJU X;  4BKS A;  4HJK A;  3ZTD A;  4N9F 4;  4W9I A;  2COP A;  2L76 A;  2LJ5 A;  4FHJ A;  4HPL B;  2ELA A;  3B08 A;  3VVW B;  3NSU A;  3D8E A;  2OJR A;  2IO3 B;  4FBJ B;  4IAP A;  2Z0P A;  2IO2 B;  2ZNV C;  4K1R B;  2LXA A;  5GOW B;  3NS8 A;  4G50 A;  4LCD E;  1MK7 B;  4HHV A;  3RZW C;  3PS6 A;  1V2Y A;  3PHW B;  1YJ1 A;  3WAN A;  4KZC A;  2AEH A;  3T8M A;  2KGX B;  2MFQ A;  5D2M B;  3ZVV A;  1IPG A;  3PLU A;  2V3S A;  5FR6 A;  1H10 A;  2RPQ A;  4F7Z A;  3QQ8 B;  2KMC A;  2KFK B;  1QZE A;  5D3Y A;  3IBE A;  3HK0 A;  1ISN A;  2IBI B;  3B0A A;  2UWQ A;  3T9L A;  4JK9 A;  5KCV A;  1WGQ A;  3V6E B;  2W2W A;  3VH4 B;  4ANX A;  2IYB A;  3AU4 A;  4MH0 E;  2YS5 A;  1WH3 A;  2YS1 A;  1UD7 A;  4PS8 A;  5KHO A;  4EOY A;  3DPD A;  1NDD A;  3D8D A;  4EZK A;  2N1V A;  2KD0 A;  3ZTC A;  1T0Y A;  3DQV A;  4YL8 A;  2ZNV B;  2LD9 A;  2H7D A;  1FOE A;  4GN1 A;  5L83 A;  1FXT B;  3CSF A;  5D27 A;  4WWP A;  4KSL C;  1LW3 A;  4K17 A;  2WX0 A;  3ODO A;  3ML9 A;  4KDL B;  1GJZ A;  1OMW A;  1ACA A;  2RLO A;  3OJ4 B;  2K2U A;  4DDI D;  2NBU A;  2O6V D;  1I42 A;  5D3V A;  2LKO A;  3L54 A;  4DXA B;  5HKH A;  3A98 B;  3W1Y A;  3GYO A;  4HK2 A;  3NZS A;  3O65 B;  4KDI C;  2V1Y A;  2YSZ A;  3K9P B;  5LXH A;  2FNJ B;  2CS4 A;  1ZSQ A;  4F1S A;  5JHB A;  1IP9 A;  4MSM B;  3R7Q A;  4ZRI A;  3A33 B;  3APF A;  2L7R A;  5EFX A;  4AP4 C;  1A5R A;  1WX8 A;  1FHX A;  4KVG B;  1UNR A;  1VD2 A;  2ZVN A;  4K7W A;  4I6L B;  2MSE D;  3MJW A;  2C7N B;  5C16 A;  5JLJ B;  4DX9 0;  4DDG D;  3V6C B;  1U29 A;  4MJS B;  2AYO B;  2PE6 B;  3R66 C;  2CAY A;  1Q1O A;  3KW5 B;  3PLV A;  4HAZ B;  2KWV B;  4BBN F;  1C3T A;  4NAW A;  2XK5 A;  4HDO A;  2GBM A;  2BWE S;  2BPS A;  4WJO A;  3DDC B;  1ZC3 B;  3ODX A;  3A9K A;  1WX7 A;  1HBK A;  2HTH B;  3A9J A;  2LGY A;  1B55 A;  4AWJ A;  4MK0 A;  2I5C A;  4I6P A;  1VBG A;  3SNH A;  1ZW7 A;  1MIZ B;  3QK0 A;  2KUP A;  4IWP A;  2GBK A;  4A5K A;  1P98 A;  2Y8F A;  3WIM A;  2DFK A;  2XQN M;  2KOX A;  4BKT A;  1K8R B;  2M1M A;  3ENE A;  4AJY B;  1IRS A;  2JWZ A;  2GCL A;  1WMH B;  2P0H A;  3DVG Y;  4KIK A;  2Y5B B;  2LI5 A;  1SIF A;  3HW2 B;  4GOC A;  4WJN A;  2LAS A;  2DYB A;  5EDS A;  1OGW A;  3ALB A;  3H9D A;  4HB4 B;  1YX5 B;  3A4S C;  3WYF B;  2LRW A;  2CR5 A;  5KQ4 A;  2ZPN A;  1MKE A;  2W2X D;  5AEK B;  2Z0D B;  2R09 A;  1Q5W B;  2HD5 B;  1SHC A;  3APC A;  2ASQ A;  2K1F A;  4ICV A;  4EUT A;  4JKA A;  4EJN A;  3L13 A;  3HHM A;  2LYD A;  3K9O B;  1V61 A;  3HM6 X;  1NTI A;  3PRZ A;  2R0D A;  3DVG X;  1H4R A;  4BKS D;  3VUY A;  5HE2 A;  2MBO A;  1BTK A;  3A1Q B;  3JVZ X;  1KZ7 A;  4JKB A;  4FJV B;  1NBF C;  3I3T B;  2NBW B;  4JK8 A;  1RFA A;  1Q0W B;  2YT1 A;  5BO4 B;  2PZ1 A;  1VBH A;  2RSG A;  3KUC B;  5CLL B;  1EUV B;  1LB1 A;  1DRO A;  4NY0 A;  5J3Y A;  5LOP B;  4W9D A;  3V5W A;  3NOB A;  3H1U A;  2NS5 A;  1TXD A;  3EFU A;  1WVH A;  1WFY A;  2CHX A;  2COA A;  3ZO5 B;  4NPN A;  4NJ7 A;  2QHO A;  5FI0 A;  2O6V A;  2KDB A;  3PTF C;  4JIO U;  4XZ4 A;  1L2N A;  5J3T A;  2ZZP B;  2A5U A;  4LDT D;  4D0N B;  2GS0 A;  2IYD B;  2FCQ A;  4KAX B;  3G9W A;  3ZLZ A;  4AOF A;  2A4Z A;  3ZIM A;  5CLQ B;  3L17 A;  1KOT A;  1YQB A;  3NHE B;  3EEC A;  1UNP A;  4A6H A;  3V60 A;  4GDL A;  1ZKH A;  2VKI A;  1WGY A;  2IY0 B;  2LVP A;  4GU2 A;  2G4S A;  3TCA A;  1DDM A;  1WM3 A;  1V5P A;  1I7A A;  1WX9 A;  2MRP A;  3RCP A;  3ODW A;  2D3G A;  3QWZ B;  3KYC D;  3E66 A;  3H7S A;  5DHF B;  2DZI A;  4Z2M B;  5JH5 C;  4TUU A;  2FJL A;  2DZJ A;  4DHZ E;  3QC8 B;  1J8C A;  1Y5O A;  4IC7 B;  2LVQ A;  2XK5 B;  3ML8 A;  3ULC A;  2ZCB A;  4RM9 A;  1WGD A;  4WWN A;  1WXM A;  3L10 B;  3ZRF A;  3UIP B;  2KTF A;  1FAO A;  1WE7 A;  2DKP A;  4IFS A;  3A9J B;  4DHJ B;  3SDL C;  1OQY A;  2MBQ A;  4A3P A;  3S2A A;  2DX5 A;  3ZKJ C;  1AWE A;  2OOB B;  5GMV A;  1DDV A;  4W9E A;  5JP4 A;  2P0D A;  3ONS A;  4B6H A;  2PJH A;  1MPH A;  2DYN A;  1GNU A;  1WI0 A;  3SO6 A;  3L08 A;  1E7V A;  3QA8 A;  1P5T A;  4BFR A;  3Q3J A;  1W1D A;  1E7U A;  2H7E A;  2IO1 B;  2FIF A;  3X0W A;  4JK7 A;  2BYV E;  5FI1 A;  2D9V A;  4WJ7 A;  3HM3 A;  4PS7 A;  1WXA A;  1GC6 A;  3DBS A;  1X05 A;  2PE9 A;  2DYO A;  3B1L X;  1JDE A;  5DCN A;  2HRJ A;  4PS3 A;  2EJ8 A;  1FB8 A;  1XD4 A;  4NNJ B;  1MK9 B;  1UZX B;  2YS3 A;  4HAV B;  4K81 A;  4KV2 A;  3KUZ A;  4ICU A;  4PNK A;  2ADZ A;  2FCM A;  3VDZ A;  2DTC A;  1MIX A;  1EF5 A;  1E5W A;  4ZYN A;  2M38 A;  4FHK A;  3DXE A;  3PGE A;  1WZ3 A;  4HAW B;  3PVU A;  1WJN A;  2D9W A;  4P7I A;  3M62 B;  3U30 A;  3Q3F A;  3U7D A;  4ILH A;  3UZT A;  4E74 A;  3BIN A;  3OAW A;  3NY5 A;  2CHZ A;  2RQ1 A;  2M4N A;  2X18 A;  4C0A A;  2DAF A;  1NTY A;  4BOS C;  1EAZ A;  1U4A A;  3TMP B;  3D32 A;  2GBN A;  2RGF A;  2N0Y A;  3U8Z A;  3WAM A;  4ILG B;  4ZDV A;  1GC7 A;  4II3 B;  4ZRK A;  2LOX A;  5LON B;  5AZH A;  2Y8G A;  5DI9 B;  2NVU I;  2DA0 A;  1HE8 A;  4KHB B;  4GDL B;  4TYZ A;  2GCJ A;  1XX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...