4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
molecule keywords Merlin
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
1UH6A 2DZMA 2WDTB 2OOBB 4K17A 1I42A 2OJRA 4P7IA 5D27A 3KYDD 1UBQA 5IJMA 2FJ9A 4GDLB 3AU5A 4DHJD 2IZVB 3GZNI 1WGHA 3BINA 1MG8A 1SIFA 3VFKA 5FI1A 4IW0A 1FHWA 1OQYA 3PHXB 3RUIB 2CQUA 3ULCA 3AXCA 4GDKB 2BCJA 3T8MA 3M3JA 2LXAA 1SHCA 2N4FA 3UF8A 4CHKA 3ZKJC 1NTVA 4URKA 2K6DB 1E8YA 1Z87A 4F7ZA 3DVNU 3WAMA 3ZRFA 4YL8A 3CSTA 5CHWA 2ROZB 2FCQA 2KWCA 2V1YA 2N9EB 1WZ0A 2LVOA 2RGFA 1V6EA 3A9KB 4RMAA 2BYFA 2MW5A 4HAVB 4M8NA 3S2AA 5LXHA 2COCA 1YIWA 5C16A 4HWIB 4NAWB 1P98A 1NVLA 2YRYA 5CX3A 2FCMA 3SD5A 2KUPA 2V3SA 1WJ1A 3D8FA 3V6EB 3ECIA 4K2PA 4W9CA 3PVWA 4NSWA 4WJNA 2ELBA 4BFRA 4DBGA 4RM8A 2DENB 2LVQA 4IWPA 3W1SC 1UNPA 3FP5A 2Y8FA 3G9WA 2DHJA 2L2IA 2FNJB 2ZPNA 5JLJB 3DDCB 3KUZA 1KM7A 2RVBB 2DX5B 2KC1A 2JRHA 4HXDA 3SU8X 3EC8A 1WF9A 5DHAB 1U5GA 3W1SA 4FJVB 2KJ6A 3HM3A 2LGXA 5C5BA 1P1AA 2JF5A 1MAIA 4GGQA 3NOBA 2ELAA 2C7NB 1KI1B 2DKPA 2K8HA 2K00A 2KTRA 3SNHA 3CF6E 4JIOU 3WYFB 5KQ1A 4LJOB 1JRUA 5HE2A 4EOYA 1WRDB 5JHGA 2V4LA 1LM8B 2FAZA 1M7EA 1M7RA 2GCJA 2W9NA 3N30A 2W2WA 3L10B 4BOSC 2LWPA 2BGFA 3CSFA 3QARA 1EAZA 2QKLA 2KMCA 1UGMA 1V2YA 3ALBA 2ZNVB 1ZM0A 1WGQA 2D4QA 2W2XD 2NZ8B 2PE6B 5KHQA 2MWSB 4HCNB 2LGDA 1Q0WB 1TZ1A 1NDDA 1WYWB 2BYVE 2CHZA 4K1RB 4X57B 5G2NA 4HDOA 2VRWB 3ULBA 1KLVA 3TFMA 4HVBA 2GCLA 4XWXA 2Q13A 3A9KA 5AEKB 2N9PC 2UYZB 2KC2A 3A1QB 4F1SA 2D9ZA 1WH3A 2R2QA 5C23A 3ZNHB 3QX1A 3CMMB 3UIPB 1E8XA 3GYPA 2Z0OA 3X0WA 4AOFA 2COPA 2N9XA 1OTRB 2EJ8A 4CHJA 4DDGD 2PZ1A 2XBBC 4IM3A 1YX5B 5JHBA 4HK2A 1MIZB 2L00B 3KVFB 3VUYA 3RCPA 4PYUA 4C0AA 2KFJA 4WJ7A 1ZW7A 2X18A 3FSSA 3H7PB 5FR6A 3HQCA 5J3TA 2RR9A 2KTFA 2Y5BB 1L2NA 2QKMA 1XD4A 3D8EA 3ZNID 2KHWB 3ZIMA 3V60A 3CXBB 4DBBA 2L0FA 4OVVA 1WZ3A 2YS5A 2RLOA 2C7MB 2KWVB 4G3XB 4KV2A 2J0KA 4BBKA 3M95A 4TV3A 2G4DB 2KFKA 1OEYJ 2AYOB 4HLEA 4KSKC 3ODOA 1W1DA 3GOEA 2KZRA 5CLQB 3AI5A 1WJUA 5AZFA 5KQ4A 4RM9A 1PLSA 5D3VA 2GJYA 4CYEA 3UIOB 4AUQC 2G35A 3VDZA 3QBVB 4ZRJA 5JP4A 3TCAA 2I1KA 3A98B 3R3MA 3ZNZB 3U30A 4A20A 3ML8A 4YONA 1WMHA 1DDMA 4DHJB 1BTNA 2LJ5A 1OY2A 1WM2A 2EMSA 4XX5A 3MPXA 1I2HA 1MK9B 1F9JA 2CODA 2OTXA 4IG7B 3SUZA 1DDVA 2VRRB 1R4MI 1S1QB 1ZKHA 2IYDB 2KVRA 2KGXB 2MCNB 2WWZA 1K5DB 2H7DA 2G3QB 1OEYA 4WJOA 3SHQA 2KDEB 3AULA 1ST7A 1E90A 2NBVB 2WYQA 3RZWC 1FGZA 1PFJA 4MJSA 2JZZA 4IWQA 4ZRIA 1AARA 4II2B 2JZ3B 1D3ZA 4GN1A 2NVUI 2N7DA 4HCPB 4LCDE 2WX1A 1FGYA 2MFQA 3TVVA 3QCAA 4A6HA 1UELA 5HE3A 1WG7A 2KN5A 5DI9B 2JY6A 2KOXA 3A1QA 3DQVA 4AP4C 1X1FA 2FDQA 4HAUB 4KVGB 1EF5A 1Z5SB 4MK0A 3N32A 4MM3A 1WE6A 5CHFA 2FCNA 3NY5A 3W1YA 2ROVA 1WFYA 3DVGX 1BT0A 2IY1B 3ZO5B 1WGGA 4EZJA 2RUKB 3ENEA 5DPSA 4FN2A 3SDLC 2V76A 2L8JA 1V5TA 2PJHA 3F5RA 1K5GB 1TQZA 1WXMA 3A9JA 1T0YA 3IFWB 4GIVA 2M1MA 2PEAA 3DBRI 3H6NA 3MJWA 1U2BA 3KY9A 1V81A 2AWTA 2PPHA 3O65B 4KIKA 2JT4B 3PHWB 5DCNA 2KQSA 2BPSA 4IM0A 5J17A 1RRBA 1WJ6A 3TO1A 2KANA 3EHVA 4D0NB 1GC6A 2JRIB 2O6VA 1ZC3B 4JGHB 5D7GA 3KH0A 3PSCA 3SV1A 1Y8RC 3OAWA 3WIMA 4MGIE 1NI2A 2KTRB 3QWZB 2D9WA 3WAOA 3QIJA 1YQBA 2MBQA 2MP2B 5JH5C 4HB0B 4AWJA 1AQCA 3N7CA 2DX5A 3EPYA 3APCA 3N3KB 5J18A 5D94A 2JP2A 1RLFA 4GSWA 4B95A 2CS4A 2DYOA 1N3HA 5LOPB 4F7GA 1HBKA 2I5FA 1OMWA 1QQGA 1UNRA 3VQIA 3VXWA 3A8PA 2M17A 2RQ1A 2MBBB 3L16A 3QQ8B 4TQ0A 3JSVA 3VUWA 3P6AA 4NJ7A 4I6LB 1G6JA 1MK7B 4DXAB 3DXCA 1BAKA 5CTRC 5D6JB 5E6OA 1UEFA 1XODA 3ODWA 4L6EA 4FADA 4DK5A 3H1UA 1TJ6A 4WVFB 1KOTA 2GBKA 2E2XA 2K8CA 5AZGA 1LB1A 3PVUA 2ZZPB 1P5TA 5DPRA 3ZW3A 4FLHA 1V80A 2CB8A 3RT3B 4ANUA 2KX0A 4N9F4 2ASQA 2GMIC 4MY6A 2DX1A 1GUAB 1R4NI 2BKFA 2KQ7A 3K9PB 1LW3A 5D3XA 2MLBA 3DVNV 1E5WA 3NZSA 4HB3B 2ZEQA 4WQOB 3V6CB 2J0MA 4TUUA 3VVWB 4A3PA 4MEMA 3PLVA 1ZVRA 3KYCD 2JWZA 5HKHA 2KX3A 1WM3A 3R7QA 1E7UA 4A3OA 1TGZB 5G55A 2AEHA 3IG3A 1WGUA 3ZNGC 2RGNB 2KDFB 5C6RA 2PE9A 4FULA 2DYQA 2KLGA 4F8CB 1XKEA 3ZTCA 2WH5A 2KK8A 1XCGA 3HW2B 1YX6B 3C0RB 3TMPB 2DLWA 1V5UA 4A5KA 1EVHA 1WMHB 3K9OB 3KUCB 5LXIB 1EGXA 1Q5WB 2MBOA 2KKCA 5HE1A 5E6NA 1VCBA 2Y8GA 4FHJA 4F7UP 4HJKA 5EFXA 2K25A 2C9WB 2MQJA 4TKNA 5L81A 3H7SA 2OQBA 4A6FB 2IO2B 3OJ3A 3D32A 3M1IB 2KJHB 4B6HA 4WJPA 2BWFA 1P3QU 3VH4B 1EUVB 1FOEA 2G4SA 3UINB 2HRJA 2ZCCA 4DDID 3MHSD 1WXSA 2J0JA 2N7EA 2IYBA 2L1CA 4DX8A 2JUOA 5J3QA 2A5UA 1VD2A 4HPLB 2VSZA 3JW0X 1WXAA 2K1FA 4W9IA 5IAAC 4PNKA 2MRPA 3HK0A 2M8SA 4MT7A 2XK5B 3PGEA 2YF0A 1YJ1A 4NPNA 4BKSD 1S3SG 1U27A 5CHVC 2O2VA 1NTIA 2YS1A 2COAA 2NS5A 1H10A 5TR5A 3RD2A 2XEWA 3UZTA 3Q3JA 4W9HA 2R09A 4EKUA 3Q3FA 4Z2MB 4DWFA 4GMXB 4HATB 4HHVA 4H8SA 2J59M 2Z0PA 3PLUA 1V89A 3FLVA 1EF1A 1NBFC 2D10A 2IY0B 3B1LX 2ZCBA 5DPWA 2GBNA 4FJZA 5JHHA 1NTYA 1XX0A 1RAXA 1RFAA 4J6IA 3HIZA 4M8MA 2HTHB 2LULA 4KAXB 4KHAA 3V5WA 1WX9A 2B3AA 3RYTA 1DYNA 1J0GA 3A9JB 3R66C 1W1GA 2D2QA 1XD3B 3NZUA 2RSUA 4IAPA 3PS6A 1PQSA 3ZDMC 1ISNA 2CHWA 4BBNC 1SGHA 1TBEA 4JLCA 3MDBC 2LUEA 3JVZX 1H4RA 4MGKE 1X1MA 4ZRKA 5C79A 4KIKB 1PMSA 3IHPC 1X86A 5KCVA 3BJIA 3RCZA 2CKHB 1X1GA 5C5BB 3NHEB 1U5DA 2D9YA 1DDWA 3QJZA 4IC7B 4JL9A 4NJ6A 3IBEA 2K8BA 2Z0DB 1V5PA 5L95C 5DPTA 4TYZA 2DZKA 2M14A 4G11A 2COFA 1IPGA 4MDKE 3ZTDA 3QWMA 2CY4A 4GOCA 1GJZA 1W1HA 2JXXA 2XK5A 3ML9A 3WALA 3A4SC 2KXJA 1LXDA 1UPQA 2MSED 5EDSA 1U5EA 3L0WB 3JYUA 5E6PA 5L83A 2RSGA 1GNUA 2CU1A 2J7QB 2NCNA 3PPAA 4K7WA 3QC8B 4KZ0A 2CAYA 2FJLA 3PEGA 1Z2MA 2C5LC 3EFUA 3V61A 4A6KA 1YD8U 2MWNB 1WXVA 1FXTB 4HB4B 1UZXB 2GBJA 2O2VB 1KZ7A 3APFA 4W9DA 5GMVA 4Y94A 1LFDA 4NQKE 4EEWA 2LD9A 4NQLB 3QA8A 2MBEA 5DHFB 3PVLA 3TL5A 4K7SA 2LRWA 1Q1OA 2G45B 1WJNA 2FCSA 4W9GA 1I7AA 1KZGA 2IO0B 3TJPA 1U29A 1V88A 1UD7A 1WGDA 2IBIB 1RRPB 2REXA 2DN6A 1OGWA 2ZVOA 4KHBB 2JPHA 3V62A 4E74A 3FM8C 4BKTA 5J3YA 2LZ6A 2N0YA 2R0DA 1WJMA 2FIFA 1U5FA 3VH3B 1TXDA 2LBBA 2ADZA 2LXCA 4WJQA 4W9EA 3H7PA 2LOXA 3VUXA 3APDA 3P2BA 1FHXA 2DKQA 1WJ4A 2KCJA 2L3ZA 2DHZA 3ZVRA 3VTWA 4K7UA 4FA6A 3DCGA 1OQNA 2BKRB 4IUMB 2BYEA 3KW5B 2KWUB 1ZGUB 3PTFC 1KJTA 2EKEC 2NBWB 4G50A 1A5RA 1NU2A 2MKRA 1SE9A 2W2XC 4KDLB 1WY8A 2GOWA 4W9KA 2BWES 4GPTB 2MBHA 4TQ1A 3IVFA 4BOZB 2YVCA 3ONSA 1XQQA 4BKGA 3VOQA 3U8ZA 2XQNM 2RD0A 2LG1A 1V49A 4KZCA 5J2RA 2NBUA 1FHOA 2DTCA 1RJ2A 5KHOA 1P0RA 5IA7A 1UBIA 4NNJB 1LQBA 2ZVNA 2ZNVC 2YT0A 3DXDA 5GOWB 2QHOA 3CIKA 4K2OA 2K6QA 3OLMD 4I6NB 1K8RB 2R2OA 3TIXA 3PRZA 1DBHA 4AJWA 4CHMA 1WVHA 2UWQA 2IO1B 2O6VD 1UPRA 1V5MA 4IFSA 4ICVA 4PS8A 3PP2A 4ASWC 4HAWB 2M4NA 1FAOA 4G0NB 1HB8A 1J19A 3DPDA 3AU4A 3SYXA 1QZEA 4GB9A 4LDTB 3TBLD 1IYFA 2C7HA 3BY4B 2KLCA 2DZJA 3NS8A 4PYZA 3ZRCA 2ABDA 4A6FA 4EMOA 3QHTA 2RPQA 4ICUA 1UNQA 3D8DA 4DHZB 1FB8A 5JZEB 2HTHA 2N23A 1H8CA 5LLIA 2A4ZA 3T9LA 2NPTB 1GG3A 1V9JA 4HB2B 2YS3A 1XT9B 3JSVB 2P0DA 1Q67A 3L13A 4BVUC 4E71A 4E3CA 3KUDB 4FJYA 2HE7A 3NSUA 2D3GA 3GYOA 3HM6X 4IWOA 4MELA 1WR6E 4MGZE 1HE8A 2L0TA 5DH9B 3DOWA 4ANWA 4CO7A 1IRSA 3DBSA 1ACAA 4PS3A 2KDIA 4ANXA 2DHKA 4FHKA 3TW1A 3UQBA 3FEHA 4DX90 2GS0A 2DAJA 1J8CA 2L05A 2AL3A 2EMTA 2DAFA 4M0WB 5FI0A 2EC1A 2JVCA 1IP9A 4PQ0A 3L08A 3OANA 3B0AA 4WSFA 4WWOA 3RULA 2IFSA 2LRUA 1BWNA 4W9JA 2L76A 3HHMA 4LDTD 4PS7A 2KDBA 3RZFA 2H7EA 4Z2NA 2CR5A 3DBLI 3MTNB 3UGBB 4HAYB 1CMXB 4ZDVA 3M62B 3H9DA 4IM2A 3F0WA 3PRMB 4EFOA 5LONB 2N1VA 3KRXA 2O6VB 4EZKA 1HB6A 2DA0A 5AZHA 1L7YA 2D07B 2MDXA 3A33B 3PG7A 4HAZB 1AWEA 1WR1A 2MA9B 3QK0A 1B55A 1X11A 2YSZA 3ZDTA 3X23A 1WE7A 2KJRA 5C1ZA 1I35A 3A4RA 2LASA 3A8QA 1TTNA 2KMAA 2WX0A 1GC7A 3PT2B 5BO4B 3VAWA 1ZSQA 2LVPA 2FIDA 2MP2A 3WANA 3VTUA 5D2MB 5D3YA 1P9DU 1WGYA 4OVUA 2DYMA 4EZLA 2CY5A 2LOZA 3KRWA 1MIXA 1QC6A 2K2JA 2K39A 2D11A 2L7RA 2NPTA 4B6WA 2CRFA 3M63B 3PRPB 4GDLA 4GMVA 4HPMB 4KSLC 4WWPA 4IOYX 4K81A 2Z59B 4WAAA 1WX7A 4AJYB 3ZVVA 2C60A 3LJUX 2HJ8A 2DYNA 3L17A 4NAWA 4HDQA 2AL6A 1Y19B 2UZRA 2GBRA 4XC2A 2BF8B 3EECA 2M38A 4II3B 3VTVA 3WAPA 4W9FA 4W9LA 1M94A 2LYDA 4GDKA 3AJ4A 4MH0E 3UQAA 2GBMA 2Z0EB 4GU2A 4ZYNA 1BTKA 2LKOA 2ZPYA 1X05A 1J0WA 3PREA 3ODXA 1P3RA 3VIAA 1E8WA 3SO6A 2I1JA 2VKIA 2KFKB 4LJPB 4HAXB 2MX2A 4B9KA 2P8VA 4MJSB 2DFKA 5DIFB 4WWNA 3KZ1A 3P7ZA 3KSYA 1WX8A 2M0XA 3L54A 1DROA 2Y7BA 3PZDA 4I6PA 2KD0A 2I5CA 3DVGY 2NR2A 4MGYE 3B08A 5JHAA 4GXBA 1WGRA 3ZLZA 3I3TB 2P0HA 1V86A 5HE0A 1MKEA 1E8ZA 1V5OA 3U7DA 1WI1A 2UZSA 2Z0QA 1WIAA 2DHIA 2KNBA 2LI5A 1ZC4B 3PSEB 4XZ4A 2DZIA 3O96A 3ZUNA 4DHZE 2IO3B 2LGYA 3QAQA 1U4AA 4FBJB 4BKSA 1WI0A 2DYBA 4EUTA 2HD5B 2KO3A 4BBNF 1Y5OA 4GZUA 2D9VA 1MPHA 2P0FA 3OJ4B 4MSMB 5CLLB 1P6SA 2FUHB 4ANVA 1C3TA 4KDIC 1C1YB 4F7HA 3R7RA 3DBHI 1V61A 4EJNA 2ZJDA 3LDZE 4MSQB 3T06A 4JQWC 2YLMA 2NMBA 2D9XA 3VHTC 3ML4A 2YT1A 3WA0A 2K2UA 5D3WA 2CHXA 3LJ3A 1E7VA 3PV1A 1XR0B 2RNRB 4NY0A 2UVMA 1EO6A 2N1WA 4KHOA 3DXEA
chains in the Genus database with same CATH superfamily
2OJRA 2K22A 3ZJUA 3AU5A 2IZVB 1TKEA 1WGHA 1MG8A 2NMQA 3E9LA 3VFKA 1OQYA 2CQUA 2BCJA 2Q5WD 2WXOA 4P1CC 2LXAA 2L52A 1C4CA 3CSTA 2LVOA 2RGFA 3A9KB 5LXHA 3AE5B 3FILB 2COCA 5CX3A 1NVLA 2YRYA 3D8FA 3ECIA 2E3TA 4NSWA 4DBGA 4ARCA 3N9YC 3W1SC 2Y8FA 3DDCB 3KUZA 3TUOA 4JK7A 4QJ4B 2BQQA 2DX5B 2JRHA 2KC1A 1WF9A 3EC8A 5DHAB 1XF5L 5C5BA 3R2TA 4ZRPA 4GGQA 4QJ3B 2ELAA 4NQKE 2DKPA 5I2SA 4ZRQA 4EOYA 2VH2A 2FAZA 1M7EA 2GCJA 5LG4B 3I57A 2LWPA 2BGFA 1RFKA 1EAZA 2ZW1A 2W2XD 1WGQA 2PE6B 2LGDA 2YT2A 2BYVE 1WYWB 5G2NA 4HVBA 3U52E 5AEKB 3NVWA 4F1SA 2ZKMX 2R2QA 3ZNHB 1WRIA 1E8XA 3GYPA 1F77A 1SEBD 4CHJA 4IM3A 1IBXB 2ACZB 3KVFB 3RCPA 4PYUA 2KFJA 3BVZA 1ZW7A 2ON8A 1SBBB 3RNFC 1JMLA 5J3TA 4OVZA 2J53A 3V60A 2L0FA 5IKCM 2C7MB 4G3XB 4TV3A 3M95A 1SJHD 2G4DB 2AYOB 4KSKC 2KZRA 5CLQB 5KQ4A 4RM9A 1I7HA 2WXIA 4AUQC 3VDZA 1DOXA 4C7ZA 2WDVB 3AM9A 3L4PA 4A20A 3ML8A 1WMHA 4IKGA 1OY2A 2EMSA 1I2HA 1MK9B 4JE3B 3AE1B 3SUZA 3Q8BA 1DDVA 5C3JB 2KGXB 1XLNA 4B0MA 1I4QA 2KDEB 4EE2A 2WYQA 3RZWC 4MJSA 2JZZA 2RRFA 4ZRIA 1AARA 3NUHB 3NVVA 3V05A 4ARIA 1D3ZA 2NVUI 2V0GA 3QCAA 1MHHE 2JY6A 2KOXA 3A1QA 1LO5D 4ILJA 4KVGB 1EF5A 3W5VB 4MK0A 1WE6A 3NY5A 2ROVA 2L32A 4EZJA 4FN2A 4HRSA 3F5RA 1E0ZA 4DQOC 1K5GB 3IFWB 4GIVA 2M1MA 3DBRI 3H6NA 1V81A 1RRBA 3TO1A 5FKAC 2JRIB 3KH0A 3PSCA 3WIMA 2ONQA 1PYWD 4Q2JA 1NI2A 3WAOA 4JKAA 3GZNB 3QIJA 4HB0B 4AWJA 3N3KB 1AWDA 5D94A 4B95A 4XGAB 4NJCA 1N3HA 3VQIA 1VLBA 2IPKD 2M17A 3L16A 4TQ0A 1G6JA 4MH8A 2X0SA 1FEHA 1PUTA 4FADA 2GBKA 2N7JA 3AE3B 2ZZPB 5DPRA 1P5TA 3VRBB 3ZW3A 4ANUA 2KX0A 4N9F4 3DBLB 2Z14A 1GUAB 3K9PB 4KGSA 3V3XA 3PLVA 1ZVRA 3KYCD 5BMIA 2LHEA 4FXCA 1N5WA 1TGZB 1FCLA 2RGNB 2PE9A 5C6RA 2KDFB 2G1EA 2KLGA 2M0AA 2WH5A 2W3RA 3W5UB 1V5UA 1JWBD 1EVHA 3KLSX 1VBHA 2BS2B 5HE1A 4F7UP 2R61A 5EFXA 4TKNA 2BWFA 1P3QU 3VH4B 2GRIA 3FVCA 2IYBA 4DX8A 1N62A 3Q8AA 1VD2A 3JW0X 1PGBA 1FMAD 2K1FA 4BKSD 5BYQA 1YJ1A 4NAMA 2G9HD 1KBLA 1S3SG 2GLSA 5CHVC 2YS1A 2NS5A 3UZTA 3ENBA 4ILHA 4GNKB 4EKUA 4GMXB 4HATB 4HHVA 2JYTA 2J59M 3FC4A 3B1LX 2J42A 2LGSA 4DIXA 1NTYA 4M8MA 1QOGA 3HVDA 2LULA 3V5WA 1XLQA 2KIEA 2Y5PA 1PQSA 3N20C 1ISNA 3ZDMC 4YSYB 4BBNC 3MDBC 2LUEA 2VZKD 1H4RA 5C79A 4KIKB 3IHPC 3EA6A 5KCVA 3RCZA 4P6VF 4NJ6A 3QJZA 1DDWA 1XXGA 2IGGA 2K8BA 2WP9B 3IT4B 4JWUC 3C8YA 3HIEA 4GOCA 1GJZA 1W1HA 3AE8B 4L23A 2PVGC 2CJNA 5EDSA 5L83A 4JKCA 3PPAA 3EFUA 1YD8U 1FXTB 2Y5CA 3NVYA 1TY2A 1LFDA 1KLGD 2LD9A 2TSSA 4JPSA 5G5GA 1NENB 1Q1OA 1U29A 2DN6A 1RYJA 1WWTA 2QILA 1TS5A 3VTWA 2DHZA 2BKRB 4HEA1 3KW5B 4KGTA 1TS2A 1ENFA 4BOZB 5JVLA 3U8ZA 4RH6A 2LG1A 4KZCA 2NBUA 1NYRA 1RJ2A 1P0RA 5IA7A 2ZVNA 3DXDA 5GOWB 2QHOA 3TIXA 3U7ZA 2LJIA 4CHMA 1WVHA 4PS8A 2O6VD 4IFSA 4HAWB 5M4YB 2M4NA 4G0NB 1EU4A 2RPQA 3NG0A 1UNQA 3R8BA 2N9LA 4OZCA 2K8EA 1H8CA 2W3SA 5LLIA 5D3DA 4A8XC 1GG3A 1V9JA 3AEBB 2YS3A 1Q67A 3L13A 1V1PA 2HE7A 1SSNA 1HE8A 2L0TA 3TEWA 4RGMA 4YT0B 4M00A 1IGCA 4OHJA 4KKIA 3TEZA 2GS0A 3FAHA 2L05A 2AL3A 2DAFA 4M01A 5FI0A 4ZHPA 3Q8FA 2KDBA 4HAYB 1CMXB 1YJJA 4IM2A 1R4NB 3KQ4A 1K51A 2O6VB 1HB6A 2D07B 3IAM1 5I4DA 1X11A 2YSZA 2JQRB 2KJRA 1TTNA 4YTPB 5D2MB 3IT6B 3SFEB 1MIXA 2K2JA 1DYQA 4B6WA 2NTSA 1HQRD 4KSLC 2WQYB 4WAAA 3ZVVA 3E9SA 2HJ8A 2LGIA 1V8CA 1D5ZC 1C78A 4MH0E 4ZYNA 2ZPYA 1X05A 2PIAA 2K0PA 3VIAA 3SO6A 2MX2A 1PFDA 2P8VA 4MJSB 3KSYA 3AEDB 2D3AA 2KD0A 5JHAA 1N61A 3I3TB 4LNKA 1V5OA 2QSDA 3MJ5A 4DHZE 3ZUNA 4RGTA 1VZ6A 4FBJB 4BBNF 4GZUA 1C3TA 2B76B 1TT5B 3ML4A 3WANA 2CHXA 2D3BA 1E7VA 4MT5A 4NY0A 1JQ4A 1KLVA 3PVLA 1UH6A 4OW0A 1ROEA 1I4GA 5HI1A 1T0QC 3KYDD 2V9HA 5IJMA 2FJ9A 1E9MA 3SR6A 1JALA 1XO3A 3URYA 3PHXB 3ULCA 3M3JA 1SHCA 1VZ7A 4YL8A 3ZRFA 2KWCA 3P1MA 2N9EB 2WHIA 4M8NA 1UWXA 1FXIA 1YIWA 3MC8A 2FCMA 3SD5A 1SE2A 3V6EB 1B1ZA 4W9CA 1VJKA 4BFRA 2DENB 4IWPA 4RMAA 2FNJB 1ZP0B 2ZPNA 3L54A 3ZXVA 4C80A 1ZDVA 3FKYA 3AB5A 2RVBB 3P4RB 4HXDA 1Y56A 2JU6X 3W1SA 3PZ8A 4FJVB 3HM3A 4JKFA 2LHDA 2JF5A 3CF6E 1KI1B 2K00A 2KTRA 3SNHA 5HE2A 1WRDB 2V4LA 1M7RA 3N30A 1CZPA 2W2WA 4A9AA 3CSFA 3QARA 2Z13A 3ALBA 5KHQA 4HCNB 1Q0WB 1TZ1A 1NDDA 4K1RB 4X57B 5T8IA 2VRWB 3ULBA 3R2IA 3A9KA 2N9PC 2KC2A 3AEGB 3RNBC 1QQRA 1DGJA 3CMMB 3Q3NC 2Z0OA 3X0WA 2COPA 1OTRB 2DLBA 2XBBC 1L5PA 3VUYA 2L00B 3HSAA 3H7PB 3FSSA 4XE0A 2RR9A 1L2NA 2DBYA 3ZNID 1XD4A 1HXYD 3ZIMA 3CXBB 2YS5A 3HUIA 3E9PA 3NVZA 4BBKA 4LTUA 1OEYJ 3ZYYX 1WJUA 2R82A 1VBGA 1KC7A 3TCAA 3U30A 4YONA 1DDMA 4XX5A 3MPXA 1F9JA 1NEKB 2OTXA 2BS3B 1R4MI 1GB4A 2KVRA 2MCNB 2G3QB 1JWMD 2RDGA 1NVID 4IWQA 2INNE 3BYTB 4LCDE 2MFQA 3TVVA 1ZUD2 2KN5A 1UELA 5HE3A 1GAQB 3T3NA 4MM3A 2FE8A 2IY1B 2QC8A 1WGGA 3ENEA 2V76A 1V5TA 2DWQA 2WXNA 1U2BA 1T0RC 1AN8A 3NJTA 2FBWB 1WJ6A 2KANA 3EHVA 4XDCA 3LB8C 4JGHB 1SXTA 3SV1A 3OAWA 2D9WA 2MBQA 3P4QB 3EPYA 2MEKA 2JP2A 4GSWA 5LOPB 4F7GA 1HBKA 3VXWA 3AE7B 1UNRA 1ZPSA 2RQ1A 4NJ7A 1MK7B 3DXCA 1BAKA 2K3UA 4WQMA 4DK5A 3HVZA 3I63C 2RDBC 5AZGA 3OWEB 1LB1A 3PVUA 1BXTA 3MFGA 2ASQA 3RNGC 3DWMA 2KQ7A 2WLBA 4WQOB 4E74A 3NZSA 3V6CB 4A3PA 1JRPA 2PTLA 2KX3A 4KGRA 4A3OA 4FULA 2KUQA 4D2KA 3ZTCA 3C0RB 2KK8A 1L4ZB 2MH7A 3K9OB 3UI3A 4A5KA 1WMHB 2QJLA 3KUCB 1T0SC 1YQ3B 5LXIB 3SBTA 1EGXA 3MC9A 5L81A 3H7SA 3J9CA 2IO2B 4A6FB 3I5JC 3OJ3A 2MJDA 2RMMA 3M1IB 1MG4A 1Q10A 2HRJA 4A90A 1UWMA 1WXSA 3MHSD 3OHMB 1XCTL 4HPLB 2VSZA 4W9IA 3HK0A 2H89B 4MT7A 1N6ZA 2M8SA 1IBXA 1U27A 3RD2A 3Q3JA 2R09A 4LNOA 4DWFA 2AQ3B 1N60A 4H8SA 2LFIA 1KH0A 3FLVA 1EF1A 1HZ6A 2D10A 2IY0B 3DHHC 2ZCBA 3N1ZC 5JHHA 1RAXA 1RFAA 4J6IA 1QILA 4KHAA 1WX9A 4PK1A 3RYTA 1DYNA 2PKOA 4RNAA 1W1GA 1XD3B 2RSUA 4IAPA 3PS6A 2CHWA 3VR8B 1SGHA 4OZAA 4JLCA 2WGSA 1N63A 4MGKE 1T5XD 1X86A 2D9YA 3Q6BA 3BVGA 1V5PA 5BYSA 2DZKA 2COFA 4MDKE 1F52A 3ZTDA 2XK5A 2WS3B 2KXJA 3L0WB 3IXSA 4YWGG 5E6PA 1C9FA 1V97A 1GNUA 2J7QB 2NCNA 2QCZA 1Z2MA 4WIPA 1VR9A 3TSSA 2WXJA 4EEWA 3QA8A 1YMHE 3TL5A 4K7SA 1UD7A 1RRPB 1OGWA 2JPHA 2INCC 2N0YA 2M19A 1U5FA 1TXDA 2ADZA 4WJQA 3VUXA 3P2BA 3W9CB 1FHXA 1WJ4A 2M56B 2KCJA 3ZVRA 4K7UA 5HHDG 2ICIA 2AQ1B 1KJTA 2EKEC 2NBWB 1NU2A 4KDLB 1WYGA 3BYYB 4W9KA 2BWES 2YVCA 4N59A 1V49A 3B9JA 2YT0A 2HTME 2K6QA 3OLMD 1QOBA 2UWQA 4ASWC 1UPRA 5I2MA 3Q14C 5JXVA 3PP2A 1R7SA 3DPDA 1SJED 3SYXA 2C7HA 1SF0A 3NS8A 4PYZA 4A6FA 4DHZB 5JZEB 2N23A 3GB1A 2A4ZA 3T9LA 1XT9B 1T6BX 1FFUA 4FJYA 3GYOA 4IWOA 4MGZE 4MELA 1WR6E 5DH9B 1ZOYB 1KLUD 3DBSA 4YTMB 4ANXA 2CJOA 1IP9A 4M0WB 2EC1A 2JVCA 3L08A 3OANA 4WWOA 3DHIC 2LRUA 1BWNA 4W9JA 3HHMA 4LDTD 4PS7A 1HA5A 3MTNB 3M62B 3H9DA 4EFOA 4RGNA 3KRXA 4WURA 2DA0A 4C4VB 1J7CA 1AWEA 1XCQL 3AECB 1J7AA 3ZDTA 3X23A 1K53A 1WE7A 5C1ZA 1I35A 2PW9A 2KMAA 3VAWA 2WX0A 1GC7A 2D3CA 2LVPA 2FIDA 2J4XA 4P16A 1P9DU 1WGYA 2DYMA 4EZLA 2PLPA 2LOZA 4ITKA 1ACCA 1QC6A 1NYQA 2Z59B 1WX7A 2C60A 3P4SB 3TEYA 4HDQA 2AL6A 2I38A 2GBRA 2M38A 4C7YA 1I4XA 4W9FA 2LYDA 1STEA 2GBMA 2OHFA 2LKOA 2KQ4X 2KIGA 1J0WA 4US8A 1E8WA 1P3RA 1JWSD 2I1JA 2VKIA 2KFKB 4LJPB 4B9KA 3AMZA 2M0XA 3PZDA 2I5CA 1WGRA 2BB6A 3ZLZA 1MKEA 1E8ZA 2KNBA 3U7DA 1WI1A 1WIAA 3MP9A 2DHIA 2DZIA 3O96A 2V4IB 1D5MC 2IO3B 2LGYA 5HG2A 1WI0A 4EUTA 2HD5B 3OJ4B 1MPHA 1EWCA 5CLLB 3DBHI 1V61A 4MSQB 2ZJDA 2BYTA 2YLMA 2NMBA 5D3WA 1XR0B 2DHKA 2N1WA 1FD6A 4KHOA 2WDTB 4K17A 1V1OA 4HKQA 5D27A 2JXTA 3GZNI 4IW0A 3PO0A 4GDKB 3AXCA 4XYCA 2N4FA 4JKEA 1QF6A 3UF8A 3RMKC 3ZKJC 4CHKA 1ZXIA 2K6DB 1JCKB 2MHJA 1Z87A 4F7ZA 1GPXA 5H92C 3DVNU 5CHWA 2FCQA 2V1YA 1FM0D 2BYFA 4HAVB 3TEXA 4NAWB 4HWIB 5C16A 1L0YB 1P98A 2KACA 1GB1A 3PVWA 2ZW0A 4WJNA 4RM8A 4L1BA 1MHXA 1UNPA 3G9WA 5L95C 2KJ6A 2LGXA 4CSQA 1P1AA 2BB5A 1AYFA 2C7NB 4JIOU 2FUG1 2K8HA 3WYFB 5KQ1A 4LJOB 1FRDA 2KMMA 1HZ5A 2KMCA 1UGMA 1V2YA 1ZM0A 2D4QA 2H88B 2MWSB 2SEBD 4REZA 4DXFA 2Q13A 3NWAA 1JDEA 2D9ZA 1WH3A 1ZDXA 5C23A 2N9XA 5JHBA 2EJ8A 4DDGD 2PZ1A 1ZE3D 3GS2A 1N5XA 4WJ7A 3BIID 3HQCA 2Y5BB 2KTFA 3D8EA 2D5GA 5G5HA 1WZ3A 2RLOA 2KWVB 4KV2A 5IOIA 2J0KA 2KFKA 3GOEA 4O1NA 5AZFA 1KFYB 3UIOB 3T3OA 1D5XC 2Y3AA 4JKGB 4DHJB 4IG7B 4RCOA 2VRRB 2IYDB 3U4EG 2WWZA 1K5DB 2H7DA 1SE4A 3GP7A 3AULA 1E90A 4KHBA 3KWVA 1PFJA 1P7EA 1K52A 4II2B 3DQVA 1WG7A 1QT9A 5DI9B 4US9A 1YN3A 1FO4A 4HAUB 1Z5SB 4BAXA 1WGKA 3DVGX 1BT0A 1D6EC 4HSIA 3C19A 1TQZA 1E7PB 3A9JA 2PEAA 2W55A 3MJWA 3KY9A 2JWUA 3O65B 4KIKA 2JT4B 3PHWB 1E10A 2WU5B 1FXAA 3EUB2 1GC6A 2O6VA 5D7GA 3RNEC 4DXGA 2K9XA 4MGIE 3RN9C 3QWZB 1MJDA 2MP2B 1L6UA 4TSSA 1RLFA 2NBVA 3SBGA 2BT6A 1HEZE 2CS4A 2DYOA 2QDFA 5LNK1 3A8PA 2MBBB 3QQ8B 3JSVA 3VUWA 3P6AA 3GE3C 5D6JB 5E6OA 1UEFA 1XODA 3ODWA 4L6EA 5TSSA 1TJ6A 4WVFB 2E2XA 1J7BA 2K8CA 2OEDA 1V80A 2CB8A 3RT3B 4ZHOA 1B9RA 1UF0A 2BKFA 1JWUD 1LW3A 1VZ8A 2MLBA 3DVNV 4HB3B 4TUUA 4MEMA 5IO9A 3AE4B 5HKHA 2HDEA 1E7UA 2WXGA 3IG3A 2VH1A 3ZNGC 1TIFA 2CU3A 1XKEA 1XCGA 3HW2B 1YX6B 3TMPB 4RGOS 3DCXA 1A70A 4ZOHC 3AE9B 4A55A 2WXQA 1F2RI 4ACFA 1WXQA 2V3PA 1TJEA 2Y8GA 5GXGB 2OQBA 2KJHB 4WJPA 2BW2A 2JZPA 1EUVB 1FOEA 2KAJA 2ZCCA 4DDID 2N7EA 2JUOA 1C79A 2A5UA 1RWSA 1WXAA 3U2SC 5IAAC 2MRPA 2XK5B 4NPNA 3P63A 5AUKA 2MJ3A 5BMGA 2WNMA 1H10A 3ZGZA 4M02A 4W9HA 4M0WA 3PLUA 1PGXA 1NBFC 4N58A 3HIZA 3RFZB 2B3AA 2IJ0A 3A9JB 3ZQ4A 4K3CA 1TBEA 1MI1A 4XDDA 1X1MA 4ZRKA 1TZOA 2CKHB 1X1GA 5C5BB 4IC7B 1F2RC 1TKYA 2L83A 4JL9A 2K5PA 3N1YC 2Z0DB 1XEEA 4TYZA 1IPGA 1ZXHA 3NS1A 3ML9A 3AH7A 3WALA 3E56A 3A4SC 1FCCC 1LXDA 1UPQA 2RSGA 4KZ0A 2CAYA 3V61A 1AW7A 4QXAB 4A6KA 2GBJA 1WXVA 1UZXB 5H8YE 4K3BA 4W9DA 1KZ7A 4WAFA 3BK1A 3U12A 4NQLB 2L1AA 5E6JA 2MBEA 4ZYSA 3ETRA 1WSPA 5EE3A 2FCSA 4W9GA 3UINB 1I7AA 1KZGA 2IO0B 1V1PB 2IBIB 3H1UA 2REXA 2ZVOA 4BKTA 5J3YA 2LZ6A 4B0EA 3B77A 2X38A 4W9EA 2LOXA 3APDA 4R3DA 2L3ZA 2DKQA 4LNFA 1VRAB 3DCGA 1OQNA 2GUMA 2N0SB 1UNSA 2YEPB 3AEEB 3PTFC 4RF0A 1A5RA 2MKRA 1SE9A 4YSZB 2MBHA 4GPTB 4TQ1A 5BYRA 3IVFA 1XQQA 4BKGA 2XQNM 2RD0A 1SIJA 5KHOA 1CK1A 4NNJB 3BVMA 2ZNVC 3CIKA 4I6NB 4AS1A 1K8RB 3PRZA 1DBHA 4YXDB 1FAOA 3OG5A 1HB8A 1QZEA 1FNUA 1IYFA 3BY4B 4USAA 2DZJA 3ZRCA 1DIKA 2ABDA 4EMOA 3QHTA 2EKIA 4ICUA 1FB8A 1JW9D 2AQ2B 2HTHA 3RPFC 4BVUC 3E9OA 4HB2B 2WXLA 1MPEA 3KUDB 3ABVB 5EE1A 3B2GA 4ANWA 3DOWA 2RPVA 4LK0M 2WXPA 2XN9C 1ACAA 2KDIA 3O13A 4FHKA 4JX1C 2DAJA 1PDXA 2EMTA 5AUIA 3MHZA 3RULA 2LEKA 2L76A 4J3OD 3RZFA 2H7EA 4Z2NA 3DBLI 4ZDVA 4L1RA 3F0WA 5LONB 2N1VA 4EZKA 2AX5A 2RDHA 5AZHA 1L7YA 1MFWA 3A33B 1WR1A 4HAZB 3QK0A 1C77A 3A4RA 3A8QA 3PT2B 2MJEA 4OVUA 4GLSC 1I4HA 2CY5A 1ET6A 1ET9A 2D11A 2L7RA 2NPTA 3M63B 4GMVA 4HPMB 1CJEA 4NAWA 1Y19B 4LNNA 4XC2A 3VTVA 2BF8B 3EECA 4AQ7A 4II3B 4JWSC 1M94A 3SEBA 2Z0EB 1K50A 3PREA 3ODXA 3NRZA 3H8HA 4HAXB 1BMLC 4WWNA 4C56C 3P7ZA 3DVGY 2NR2A 4GXBA 2NTTA 4IOIE 4MSMB 3KWLA 2UZSA 2Z0QA 2W82A 4XZ4A 2LI5A 1QOFA 1I4PA 4JKGA 3I9V1 2DYBA 2LUMA 3BWUD 4JK9A 4F7HA 3R7RA 3LDZE 4QJ5B 2Z59A 3T06A 3WA0A 3S2AA 3PV1A 2RNRB 1OQQA 2UVMA 4FHJA 2DZMA 3NW8A 1I42A 2VZKB 2INPE 2OOBB 4P7IA 1UBQA 2WXHA 1MI0A 3P4PB 1DOIA 4GDLB 1EWYC 4N6EB 4DHJD 3BINA 1SIFA 5FI1A 1FHWA 3RUIB 2KT7A 3T8MA 1TS4A 4URKA 1NTVA 3DBHB 1F1HA 1E8YA 2ROZB 1WZ0A 1V6EA 2MW5A 2KDMA 3PZ7A 1EU3A 1XLPA 2KUPA 1OQRA 2V3SA 1WJ1A 3HRDD 4K2PA 3EFCA 2ELBA 3Q2AC 1GGOA 3VR9B 1TS3A 2LVQA 3FP5A 2L2IA 2DHJA 3WCQA 5JLJB 1KM7A 1UGJA 3SU8X 2KR0A 1U5GA 3IAS1 2WXRA 1MAIA 5D3IB 3NOBA 1JRUA 5JHGA 1LM8B 3B2FA 2Z4DA 2W9NA 3L10B 4BOSC 1FFVA 2QKLA 2ZNVB 2NZ8B 2EELA 1HTQA 4KKJA 1YOVB 2CHZA 4HDOA 2X8XX 3TFMA 2GCLA 4XWXA 2UYZB 3A1QB 3GE8C 3QX1A 3UIPB 3RNAC 4AOFA 5EE9A 1YX5B 5IN7A 3P42A 3AEFB 4QAYA 3Q3MC 1T77A 4HK2A 1MIZB 3SFDB 4C0AA 3FILA 5FR6A 2X18A 3NWFA 4KX6B 1UUPA 1C4AA 2QKMA 2KHWB 4DBBA 4OVVA 3DWGC 1MVKA 4HLEA 3ODOA 1W1DA 3AI5A 3EGRA 1PLSA 5D3VA 2GJYA 4CYEA 2G35A 3QBVB 4ZRJA 5JP4A 2K49A 2I1KA 3A98B 3R3MA 3ZNZB 5FR3A 1BTNA 2LJ5A 2QMTA 1WM2A 4LNIA 2CODA 1S1QB 1ZKHA 3RNCC 3NWDA 4WJOA 1OEYA 4JK8A 3SHQA 1ST7A 2NBVB 4XWWA 1FGZA 3ZJTA 1FIQA 2UU7A 4RFBA 2JZ3B 4GN1A 1YJIA 4HCPB 2N7DA 2WX1A 1FGYA 3DBRB 4A6HA 2Z8LA 4AP4C 1X1FA 2FDQA 5CHFA 3N32A 2FCNA 1R4MB 3W1YA 1WFYA 1TY0A 2RUKB 5DPSA 3SDLC 3Q8EA 5BMHA 4S0RA 2L8JA 2PJHA 1WXMA 2IGDA 1T0YA 3CIRB 2AWTA 2PPHA 2GI9A 5DCNA 4HKZE 4IDIA 2KQSA 2BPSA 4IM0A 5J17A 4D0NB 4D6WA 1PGAA 2WXFA 1ZC3B 1C4PA 1GOZA 1SB3C 1Y8RC 2KWDA 3AE6B 2KTRB 5JH5C 1T3QA 1YQBA 1AQCA 3N7CA 2DX5A 3APCA 3BZDB 5J18A 1QQGA 2I5FA 1OMWA 2QIEB 1L6VA 3E66A 4I6LB 4DXAB 5CTRC 2BS4B 3VRAB 4P1BC 2JX5A 3DHGC 2BBCA 1KOTA 2FJUB 2N9KA 4FLHA 2GMIC 4MY6A 2DX1A 1R4NI 5D3XA 4F8CB 3VVWB 1E5WA 2ZEQA 1YQ4B 1F0ZA 2J0MA 1E6EB 2JWZA 1WM3A 3R7QA 5G55A 2AEHA 1WGUA 4S17A 1ZYIA 1FNVA 2DYQA 1JROA 2KYWA 4ILGB 4JKDA 2DLWA 1LGRA 1Q5WB 2MBOA 2KKCA 5E6NA 1VCBA 4YTNB 4HJKA 2K25A 2C9WB 2MQJA 3D32A 1DOYA 1QOAA 3LXFA 2G4SA 2J0JA 2L1CA 5J3QA 2LMCA 3BK2A 4PNKA 3PGEA 2YF0A 2JSVX 5TR5A 2O2VA 1NTIA 2E6XA 2COAA 2HJ1A 2XEWA 4H2AA 3Q3FA 4Z2MB 2WU2B 2Z0PA 2WDQB 1V89A 5DPWA 2GBNA 4FJZA 1FNWA 1XX0A 3ZXRA 1EM7A 2HTHB 4KAXB 2YEPF 3Q8CA 4HPPA 1J0GA 3R66C 2D2QA 3NZUA 2WXMA 5HFYA 1YN5A 3JVZX 4MM3B 1M4VA 3AE2B 1PMSA 3BJIA 3NHEB 1U5DA 3IBEA 1FRRA 4RF1A 4G11A 5DPTA 2M14A 4OT1A 3QWMA 2CY4A 1KF6B 2JXXA 4C4VA 3N1XC 1HTOA 2MSED 1U5EA 3NZ3A 3JYUA 2CU1A 4K7WA 3QC8B 2FJLA 3PEGA 2V3NA 2C5LC 4LLGM 3WAMA 2MWNB 2INDC 4HB4B 3APFA 2O2VB 5GMVA 4Y94A 3AV8A 2IDYA 2PMVA 5DHFB 1RM6C 2LRWA 2G45B 1WJNA 3TJPA 1V88A 1WGDA 3LYYA 3Q3OC 4KHBB 1C76A 3V62A 2WDRB 3FM8C 2KVZA 2FIFA 2R0DA 1WJMA 3VH3B 2LBBA 2GB1A 1KRHA 2LXCA 2BVCA 4C00A 3H7PA 3MC0B 2DIKA 4FA6A 1BUIC 4MACA 1IGDA 4IUMB 2BYEA 2KWUB 1ZGUB 4G50A 4WWMA 4BZAA 2W2XC 1WY8A 2GOWA 3ONSA 1IUEA 3VOQA 4GOUA 1KTKA 5J2RA 1FHOA 2DTCA 1UBIA 4YSXB 1LQBA 4HJGE 4A6QA 5EE0A 5C2TB 4K2OA 2R2OA 4AJWA 2I2YA 2IO1B 4ICVA 1V5MA 4L2YA 4GB9A 1L0VB 1J19A 3AEAB 3AU4A 4UDUC 3TBLD 4LDTB 2KLCA 1L0XB 3D8DA 4JKBA 4CQNA 3W2DA 4XWTA 2NPTB 1NI3A 3JSVB 2P0DA 4E3CA 4E71A 3NSUA 2D3GA 1YNTE 3HM6X 1SE3A 4CO7A 1IRSA 4PS3A 2R2YA 1XLOA 1VDVA 3TW1A 1J8CA 3FEHA 4DX90 4PQ0A 3B0AA 4WSFA 1D4BA 2OJWA 2IFSA 4PT5A 2CR5A 3UGBB 4WH4A 3PRMB 2MDXA 1ESFA 3CWIA 3PG7A 2MA9B 1B55A 2LASA 5BO4B 1ZSQA 4OZBA 4TMAB 1FPYA 2MP2A 2XNAC 3VTUA 5D3YA 1P7FA 1L4DB 4HROA 1TYGB 3KRWA 3A58A 2K39A 2CRFA 3PRPB 4GDLA 2BTEA 4AJYB 4WWPA 3RI7C 4IOYX 4K81A 4JKHA 2IGHA 5MPOA 2PVOD 2DNFA 3LJUX 1QLBB 2DYNA 3L17A 3WAPA 2UZRA 2JYEA 4W9LA 4GDKA 3AJ4A 3UQAA 3AN1A 4GU2A 1BTKA 4OSNA 1OFFA 1CQVA 5FK9C 2DFKA 5DIFB 3ZJVA 3KZ1A 1TKGA 3Q69A 3ZO5B 1WX8A 3UQBA 2KN4A 1DROA 2Y7BA 2SAKA 4I6PA 4MGYE 3B08A 5IP4D 1YN4A 2P0HA 1V86A 5HE0A 2J52A 2WXKA 3PSEB 1ZC4B 1QKZA 1JWAD 3QAQA 1U4AA 4BKSA 2KO3A 1Y5OA 2D9VA 2P0FA 1P6SA 2FUHB 4ANVA 4KDIC 1C1YB 4EJNA 4NZLB 2QEJC 4JQWC 2D9XA 3VHTC 1I4RA 2YT1A 2W54A 2K2UA 5IRSA 3LJ3A 4B6HA 1EO6A 3DXEA
chains in the Genus database with same CATH topology
2OJRA 3AU5A 2IZVB 1WGHA 1MG8A 3VFKA 3E9LA 1OQYA 2CQUA 2BCJA 2LXAA 3CSTA 2LVOA 2RGFA 3A9KB 5LXHA 2COCA 5CX3A 1NVLA 2YRYA 3D8FA 3ECIA 4NSWA 4DBGA 3W1SC 2Y8FA 3DDCB 3KUZA 4JK7A 2DX5B 2JRHA 2KC1A 3EC8A 1WF9A 5DHAB 5C5BA 4GGQA 2ELAA 4NQKE 2DKPA 4EOYA 2FAZA 1M7EA 2GCJA 2LWPA 2BGFA 1EAZA 2W2XD 1WGQA 2PE6B 2LGDA 2BYVE 1WYWB 5G2NA 4HVBA 5AEKB 4F1SA 2R2QA 3ZNHB 1E8XA 3GYPA 4CHJA 4IM3A 3KVFB 3RCPA 4PYUA 2KFJA 1ZW7A 5J3TA 3V60A 2L0FA 2C7MB 4G3XB 4TV3A 3M95A 2G4DB 2AYOB 4KSKC 2KZRA 5CLQB 5KQ4A 4RM9A 4AUQC 3VDZA 4A20A 3ML8A 1WMHA 1OY2A 2EMSA 1I2HA 1MK9B 3SUZA 1DDVA 2KGXB 2KDEB 2WYQA 3RZWC 4MJSA 2JZZA 4ZRIA 1AARA 1D3ZA 2NVUI 3QCAA 2JY6A 2KOXA 3A1QA 4ILJA 4KVGB 1EF5A 4MK0A 1WE6A 3NY5A 2ROVA 4EZJA 4FN2A 3F5RA 1K5GB 3IFWB 4GIVA 2M1MA 3DBRI 3H6NA 1V81A 1RRBA 3TO1A 2JRIB 3KH0A 3PSCA 3WIMA 1NI2A 3WAOA 4JKAA 3QIJA 4HB0B 4AWJA 3N3KB 5D94A 4B95A 1N3HA 3VQIA 2M17A 3L16A 4TQ0A 1G6JA 2X0SA 4FADA 2GBKA 2ZZPB 5DPRA 1P5TA 3ZW3A 4ANUA 2KX0A 4N9F4 1GUAB 3K9PB 3PLVA 1ZVRA 3KYCD 1TGZB 2RGNB 2KDFB 5C6RA 2PE9A 2KLGA 2WH5A 1V5UA 1EVHA 1VBHA 5HE1A 4F7UP 5EFXA 4TKNA 2BWFA 1P3QU 3VH4B 2IYBA 4DX8A 1VD2A 3JW0X 2K1FA 4BKSD 1YJ1A 1KBLA 1S3SG 5CHVC 2YS1A 2NS5A 3UZTA 3ENBA 4ILHA 4EKUA 4GMXB 4HATB 4HHVA 2J59M 3B1LX 1NTYA 4M8MA 2LULA 3V5WA 1PQSA 3ZDMC 1ISNA 4BBNC 3MDBC 2LUEA 1H4RA 5C79A 4KIKB 3IHPC 5KCVA 3RCZA 4NJ6A 3QJZA 1DDWA 2K8BA 4GOCA 1GJZA 1W1HA 5EDSA 5L83A 4JKCA 3PPAA 3EFUA 1YD8U 1FXTB 1LFDA 2LD9A 1Q1OA 1U29A 2DN6A 3VTWA 2DHZA 2BKRB 3KW5B 4BOZB 5JVLA 3U8ZA 2LG1A 4KZCA 2NBUA 1RJ2A 1P0RA 5IA7A 2ZVNA 3DXDA 5GOWB 2QHOA 3TIXA 4CHMA 1WVHA 4PS8A 2O6VD 4IFSA 4HAWB 2M4NA 4G0NB 2RPQA 1UNQA 1H8CA 5LLIA 1GG3A 1V9JA 2YS3A 1Q67A 3L13A 2HE7A 1HE8A 2L0TA 2GS0A 2L05A 2AL3A 2DAFA 5FI0A 2KDBA 4HAYB 1CMXB 4IM2A 2O6VB 1HB6A 2D07B 1X11A 2YSZA 2KJRA 1TTNA 5D2MB 1MIXA 2K2JA 4B6WA 4KSLC 4WAAA 3ZVVA 2HJ8A 4MH0E 4ZYNA 2ZPYA 1X05A 3VIAA 3SO6A 2MX2A 2P8VA 4MJSB 3KSYA 2KD0A 5JHAA 3I3TB 1V5OA 4DHZE 3ZUNA 4FBJB 4BBNF 4GZUA 1C3TA 3WANA 3ML4A 2CHXA 1E7VA 4NY0A 1KLVA 3PVLA 1UH6A 3KYDD 5IJMA 2FJ9A 3PHXB 3ULCA 3M3JA 1SHCA 3ZRFA 4YL8A 2KWCA 2N9EB 4M8NA 1YIWA 2FCMA 3SD5A 3V6EB 4W9CA 4BFRA 2DENB 4IWPA 4RMAA 2FNJB 2ZPNA 3L54A 4HXDA 2RVBB 3W1SA 4FJVB 3HM3A 4JKFA 2JF5A 3CF6E 1KI1B 2K00A 2KTRA 3SNHA 5HE2A 1WRDB 2V4LA 1M7RA 3N30A 2W2WA 3CSFA 3QARA 3ALBA 5KHQA 4HCNB 1Q0WB 1TZ1A 1NDDA 4K1RB 4X57B 2VRWB 3ULBA 3A9KA 2N9PC 2KC2A 3CMMB 2Z0OA 3X0WA 2COPA 1OTRB 2XBBC 3VUYA 2L00B 3H7PB 3FSSA 2RR9A 1L2NA 3ZNID 1XD4A 3ZIMA 3CXBB 2YS5A 3E9PA 4BBKA 1OEYJ 1WJUA 2R82A 1VBGA 1KC7A 3TCAA 3U30A 4YONA 1DDMA 4XX5A 3MPXA 1F9JA 2OTXA 1R4MI 2KVRA 2MCNB 2G3QB 4IWQA 4LCDE 2MFQA 3TVVA 2KN5A 1UELA 5HE3A 4MM3A 2IY1B 1WGGA 3ENEA 2V76A 1V5TA 1U2BA 1WJ6A 2KANA 3EHVA 4JGHB 3SV1A 3OAWA 2D9WA 2MBQA 3EPYA 2JP2A 4GSWA 5LOPB 4F7GA 1HBKA 3VXWA 1UNRA 2RQ1A 4NJ7A 1MK7B 3DXCA 1BAKA 4DK5A 5AZGA 1LB1A 3PVUA 2ASQA 2KQ7A 4WQOB 4E74A 3NZSA 3V6CB 4A3PA 2KX3A 4A3OA 4FULA 3ZTCA 3C0RB 2KK8A 3K9OB 4A5KA 1WMHB 3KUCB 5LXIB 3SBTA 1EGXA 5L81A 3H7SA 2IO2B 4A6FB 3OJ3A 3M1IB 2HRJA 3MHSD 1WXSA 4HPLB 2VSZA 4W9IA 3HK0A 2M8SA 4MT7A 1U27A 3RD2A 3Q3JA 2R09A 4DWFA 4H8SA 3FLVA 1EF1A 2D10A 2IY0B 2ZCBA 5JHHA 1RAXA 1RFAA 4J6IA 4KHAA 1WX9A 3RYTA 1DYNA 1W1GA 1XD3B 2RSUA 4IAPA 3PS6A 2CHWA 1SGHA 4JLCA 4MGKE 1X86A 2D9YA 1V5PA 2DZKA 2COFA 4MDKE 3ZTDA 2XK5A 2KXJA 3L0WB 5E6PA 1GNUA 2J7QB 2NCNA 1Z2MA 4EEWA 3QA8A 3TL5A 4K7SA 1UD7A 1RRPB 1OGWA 2JPHA 2N0YA 1U5FA 1TXDA 2ADZA 4WJQA 3VUXA 3P2BA 1FHXA 1WJ4A 2KCJA 3ZVRA 4K7UA 1KJTA 2EKEC 2NBWB 1NU2A 4KDLB 4W9KA 2BWES 2YVCA 1V49A 2YT0A 2K6QA 3OLMD 2UWQA 4ASWC 1UPRA 3PP2A 3DPDA 3SYXA 2C7HA 3NS8A 4PYZA 4A6FA 4DHZB 5JZEB 2N23A 2A4ZA 3T9LA 1XT9B 4FJYA 3GYOA 4IWOA 4MGZE 4MELA 1WR6E 5DH9B 3DBSA 4ANXA 1IP9A 4M0WB 2EC1A 2JVCA 3L08A 3OANA 4WWOA 2LRUA 1BWNA 4W9JA 3HHMA 4LDTD 4PS7A 3MTNB 3M62B 3H9DA 4EFOA 3KRXA 2DA0A 1AWEA 3ZDTA 3X23A 1WE7A 5C1ZA 1I35A 2KMAA 3VAWA 2WX0A 1GC7A 2LVPA 2FIDA 1P9DU 1WGYA 2DYMA 4EZLA 2LOZA 1QC6A 2Z59B 1WX7A 2C60A 4HDQA 2AL6A 2GBRA 2M38A 4W9FA 2LYDA 2GBMA 2LKOA 1J0WA 1E8WA 1P3RA 2I1JA 2VKIA 2KFKB 4LJPB 4B9KA 2M0XA 3PZDA 2I5CA 1WGRA 3ZLZA 1MKEA 1E8ZA 2KNBA 3U7DA 1WI1A 1WIAA 2DHIA 2DZIA 3O96A 2IO3B 2LGYA 1WI0A 4EUTA 2HD5B 3OJ4B 1MPHA 5CLLB 3DBHI 1V61A 4MSQB 2ZJDA 2YLMA 2NMBA 5D3WA 1XR0B 2DHKA 2N1WA 4KHOA 2WDTB 4K17A 5D27A 3GZNI 4IW0A 4GDKB 3AXCA 2N4FA 4JKEA 3UF8A 4CHKA 3ZKJC 2K6DB 4F7ZA 1Z87A 3DVNU 5CHWA 2FCQA 2V1YA 2BYFA 4HAVB 4NAWB 4HWIB 5C16A 1P98A 3PVWA 4WJNA 4RM8A 1UNPA 3G9WA 5L95C 2KJ6A 2LGXA 1P1AA 2C7NB 4JIOU 2K8HA 3WYFB 5KQ1A 4LJOB 2KMCA 1UGMA 1V2YA 1ZM0A 2D4QA 2MWSB 2Q13A 1JDEA 2D9ZA 1WH3A 5C23A 2N9XA 5JHBA 2EJ8A 4DDGD 2PZ1A 4WJ7A 3HQCA 2Y5BB 2KTFA 3D8EA 1WZ3A 2RLOA 2KWVB 4KV2A 2J0KA 2KFKA 3GOEA 5AZFA 3UIOB 4JKGB 4DHJB 4IG7B 2VRRB 2IYDB 2WWZA 1K5DB 2H7DA 3AULA 1E90A 1PFJA 4II2B 3DQVA 1WG7A 5DI9B 4HAUB 1Z5SB 3DVGX 1BT0A 1TQZA 3A9JA 2PEAA 3MJWA 3KY9A 3O65B 4KIKA 2JT4B 3PHWB 1GC6A 2O6VA 5D7GA 4MGIE 3QWZB 2MP2B 1RLFA 3SBGA 2CS4A 2DYOA 3A8PA 2MBBB 3QQ8B 3JSVA 3VUWA 3P6AA 5D6JB 5E6OA 1UEFA 1XODA 3ODWA 4L6EA 1TJ6A 4WVFB 2E2XA 2K8CA 1V80A 2CB8A 3RT3B 2BKFA 1LW3A 2MLBA 3DVNV 4HB3B 4TUUA 4MEMA 5HKHA 1E7UA 3IG3A 3ZNGC 1XKEA 1XCGA 3HW2B 1YX6B 3TMPB 2Y8GA 2OQBA 2KJHB 4WJPA 1EUVB 1FOEA 2ZCCA 4DDID 2N7EA 2JUOA 2A5UA 1WXAA 5IAAC 2MRPA 2XK5B 4NPNA 1H10A 4W9HA 3PLUA 1NBFC 3HIZA 2B3AA 3A9JB 1TBEA 1X1MA 4ZRKA 2CKHB 1X1GA 5C5BB 4IC7B 4JL9A 2Z0DB 4TYZA 1IPGA 3ML9A 3WALA 3A4SC 1LXDA 1UPQA 2RSGA 4KZ0A 2CAYA 3V61A 4A6KA 2GBJA 1WXVA 1UZXB 4W9DA 1KZ7A 4NQLB 2MBEA 3UINB 2FCSA 4W9GA 1I7AA 1KZGA 2IO0B 2IBIB 3H1UA 2REXA 2ZVOA 4BKTA 5J3YA 2LZ6A 4W9EA 2LOXA 3APDA 2L3ZA 2DKQA 3DCGA 1OQNA 3PTFC 1A5RA 2MKRA 1SE9A 2MBHA 4GPTB 4TQ1A 3IVFA 1XQQA 4BKGA 2XQNM 2RD0A 5KHOA 4NNJB 2ZNVC 3CIKA 4I6NB 1K8RB 3PRZA 1DBHA 1FAOA 1HB8A 1QZEA 1IYFA 3BY4B 2DZJA 3ZRCA 1DIKA 2ABDA 4EMOA 3QHTA 4ICUA 1FB8A 2HTHA 4BVUC 3E9OA 4HB2B 3KUDB 4ANWA 3DOWA 1ACAA 2KDIA 4FHKA 2DAJA 2EMTA 3RULA 2L76A 3RZFA 2H7EA 4Z2NA 3DBLI 4ZDVA 3F0WA 5LONB 2N1VA 4EZKA 5AZHA 1L7YA 3A33B 1WR1A 4HAZB 3QK0A 3A4RA 3A8QA 3PT2B 4OVUA 2CY5A 2D11A 2L7RA 2NPTA 3M63B 4GMVA 4HPMB 4NAWA 1Y19B 3VTVA 4XC2A 2BF8B 3EECA 4II3B 1M94A 2Z0EB 3PREA 3ODXA 4HAXB 4WWNA 3P7ZA 3DVGY 2NR2A 4GXBA 4MSMB 2UZSA 2Z0QA 4XZ4A 2LI5A 4JKGA 2DYBA 4JK9A 4F7HA 3R7RA 3LDZE 3T06A 3S2AA 3WA0A 3PV1A 2RNRB 2UVMA 4FHJA 2DZMA 1I42A 2OOBB 4P7IA 1UBQA 4GDLB 4DHJD 3BINA 1SIFA 5FI1A 1FHWA 3RUIB 3T8MA 4URKA 1NTVA 1E8YA 2ROZB 1WZ0A 1V6EA 2MW5A 2KUPA 2V3SA 1WJ1A 4K2PA 2ELBA 1GGOA 2LVQA 3FP5A 2L2IA 2DHJA 5JLJB 1KM7A 3SU8X 1U5GA 1MAIA 3NOBA 1JRUA 5JHGA 1LM8B 2W9NA 3L10B 4BOSC 2QKLA 2ZNVB 2NZ8B 2CHZA 4HDOA 3TFMA 2GCLA 4XWXA 2UYZB 3A1QB 3QX1A 3UIPB 4AOFA 1YX5B 4HK2A 1MIZB 4C0AA 5FR6A 2X18A 2QKMA 2KHWB 4DBBA 4OVVA 4HLEA 3ODOA 1W1DA 3AI5A 1PLSA 5D3VA 2GJYA 4CYEA 2G35A 3QBVB 4ZRJA 5JP4A 2I1KA 3A98B 3R3MA 3ZNZB 1BTNA 2LJ5A 1WM2A 2CODA 1S1QB 1ZKHA 4WJOA 1OEYA 4JK8A 3SHQA 1ST7A 2NBVB 1FGZA 2JZ3B 4GN1A 4HCPB 2N7DA 2WX1A 1FGYA 4A6HA 4AP4C 1X1FA 2FDQA 5CHFA 3N32A 2FCNA 3W1YA 1WFYA 2RUKB 5DPSA 3SDLC 2L8JA 2PJHA 1WXMA 1T0YA 2AWTA 2PPHA 5DCNA 2KQSA 2BPSA 4IM0A 5J17A 4D0NB 1ZC3B 1Y8RC 5JH5C 2KTRB 1YQBA 1AQCA 3N7CA 2DX5A 3APCA 5J18A 1QQGA 2I5FA 1OMWA 3E66A 4I6LB 4DXAB 5CTRC 1KOTA 4FLHA 2GMIC 4MY6A 2DX1A 1R4NI 5D3XA 4F8CB 3VVWB 1E5WA 2ZEQA 2J0MA 2JWZA 1WM3A 3R7QA 5G55A 2AEHA 1WGUA 2DYQA 4ILGB 4JKDA 2DLWA 1Q5WB 2MBOA 2KKCA 5E6NA 1VCBA 4HJKA 2K25A 2C9WB 2MQJA 3D32A 2G4SA 2J0JA 2L1CA 5J3QA 4PNKA 3PGEA 2YF0A 5TR5A 2O2VA 1NTIA 2COAA 2XEWA 3Q3FA 4Z2MB 2Z0PA 1V89A 5DPWA 2GBNA 4FJZA 1XX0A 2HTHB 4KAXB 1J0GA 3R66C 2D2QA 3NZUA 3JVZX 1PMSA 3BJIA 3NHEB 1U5DA 3IBEA 5DPTA 4G11A 2M14A 3QWMA 2CY4A 2JXXA 2MSED 1U5EA 3JYUA 2CU1A 4K7WA 3QC8B 2FJLA 3PEGA 2C5LC 3WAMA 2MWNB 4HB4B 3APFA 2O2VB 5GMVA 4Y94A 5DHFB 2LRWA 2G45B 1WJNA 3TJPA 1V88A 1WGDA 4KHBB 3V62A 3FM8C 2FIFA 2R0DA 1WJMA 3VH3B 2LBBA 2LXCA 3H7PA 2DIKA 4FA6A 4IUMB 2BYEA 2KWUB 1ZGUB 4G50A 2W2XC 1WY8A 2GOWA 3ONSA 3VOQA 5J2RA 1FHOA 2DTCA 1UBIA 1LQBA 4K2OA 2R2OA 4AJWA 2IO1B 4ICVA 1V5MA 4GB9A 3TBLD 1J19A 3AU4A 4LDTB 2KLCA 3D8DA 4JKBA 2NPTB 3JSVB 2P0DA 4E3CA 4E71A 3NSUA 2D3GA 3HM6X 4CO7A 1IRSA 4PS3A 3TW1A 1J8CA 3FEHA 4DX90 4PQ0A 3B0AA 4WSFA 2IFSA 2CR5A 3UGBB 3PRMB 2MDXA 3PG7A 2MA9B 1B55A 2LASA 5BO4B 1ZSQA 2MP2A 3VTUA 5D3YA 3KRWA 2K39A 2CRFA 3PRPB 4GDLA 4AJYB 4WWPA 4IOYX 4K81A 4JKHA 3LJUX 2DYNA 3L17A 3WAPA 2UZRA 4W9LA 4GDKA 3AJ4A 3UQAA 4GU2A 1BTKA 2DFKA 5DIFB 3KZ1A 3ZO5B 3UQBA 1WX8A 1DROA 2Y7BA 4I6PA 4MGYE 3B08A 2P0HA 1V86A 5HE0A 3PSEB 1ZC4B 3QAQA 1U4AA 4BKSA 2KO3A 1Y5OA 2D9VA 2P0FA 1P6SA 2FUHB 4ANVA 4KDIC 1C1YB 4EJNA 4JQWC 2D9XA 3VHTC 2YT1A 2K2UA 3LJ3A 4B6HA 1EO6A 3DXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UH6 A;  2DZM A;  2WDT B;  2OOB B;  4K17 A;  1I42 A;  2OJR A;  4P7I A;  5D27 A;  3KYD D;  1UBQ A;  5IJM A;  2FJ9 A;  4GDL B;  3AU5 A;  4DHJ D;  2IZV B;  3GZN I;  1WGH A;  3BIN A;  1MG8 A;  1SIF A;  3VFK A;  5FI1 A;  4IW0 A;  1FHW A;  1OQY A;  3PHX B;  3RUI B;  2CQU A;  3ULC A;  3AXC A;  4GDK B;  2BCJ A;  3T8M A;  3M3J A;  2LXA A;  1SHC A;  2N4F A;  3UF8 A;  4CHK A;  3ZKJ C;  1NTV A;  4URK A;  2K6D B;  1E8Y A;  1Z87 A;  4F7Z A;  3DVN U;  3WAM A;  3ZRF A;  4YL8 A;  3CST A;  5CHW A;  2ROZ B;  2FCQ A;  2KWC A;  2V1Y A;  2N9E B;  1WZ0 A;  2LVO A;  2RGF A;  1V6E A;  3A9K B;  4RMA A;  2BYF A;  2MW5 A;  4HAV B;  4M8N A;  3S2A A;  5LXH A;  2COC A;  1YIW A;  5C16 A;  4HWI B;  4NAW B;  1P98 A;  1NVL A;  2YRY A;  5CX3 A;  2FCM A;  3SD5 A;  2KUP A;  2V3S A;  1WJ1 A;  3D8F A;  3V6E B;  3ECI A;  4K2P A;  4W9C A;  3PVW A;  4NSW A;  4WJN A;  2ELB A;  4BFR A;  4DBG A;  4RM8 A;  2DEN B;  2LVQ A;  4IWP A;  3W1S C;  1UNP A;  3FP5 A;  2Y8F A;  3G9W A;  2DHJ A;  2L2I A;  2FNJ B;  2ZPN A;  5JLJ B;  3DDC B;  3KUZ A;  1KM7 A;  2RVB B;  2DX5 B;  2KC1 A;  2JRH A;  4HXD A;  3SU8 X;  3EC8 A;  1WF9 A;  5DHA B;  1U5G A;  3W1S A;  4FJV B;  2KJ6 A;  3HM3 A;  2LGX A;  5C5B A;  1P1A A;  2JF5 A;  1MAI A;  4GGQ A;  3NOB A;  2ELA A;  2C7N B;  1KI1 B;  2DKP A;  2K8H A;  2K00 A;  2KTR A;  3SNH A;  3CF6 E;  4JIO U;  3WYF B;  5KQ1 A;  4LJO B;  1JRU A;  5HE2 A;  4EOY A;  1WRD B;  5JHG A;  2V4L A;  1LM8 B;  2FAZ A;  1M7E A;  1M7R A;  2GCJ A;  2W9N A;  3N30 A;  2W2W A;  3L10 B;  4BOS C;  2LWP A;  2BGF A;  3CSF A;  3QAR A;  1EAZ A;  2QKL A;  2KMC A;  1UGM A;  1V2Y A;  3ALB A;  2ZNV B;  1ZM0 A;  1WGQ A;  2D4Q A;  2W2X D;  2NZ8 B;  2PE6 B;  5KHQ A;  2MWS B;  4HCN B;  2LGD A;  1Q0W B;  1TZ1 A;  1NDD A;  1WYW B;  2BYV E;  2CHZ A;  4K1R B;  4X57 B;  5G2N A;  4HDO A;  2VRW B;  3ULB A;  1KLV A;  3TFM A;  4HVB A;  2GCL A;  4XWX A;  2Q13 A;  3A9K A;  5AEK B;  2N9P C;  2UYZ B;  2KC2 A;  3A1Q B;  4F1S A;  2D9Z A;  1WH3 A;  2R2Q A;  5C23 A;  3ZNH B;  3QX1 A;  3CMM B;  3UIP B;  1E8X A;  3GYP A;  2Z0O A;  3X0W A;  4AOF A;  2COP A;  2N9X A;  1OTR B;  2EJ8 A;  4CHJ A;  4DDG D;  2PZ1 A;  2XBB C;  4IM3 A;  1YX5 B;  5JHB A;  4HK2 A;  1MIZ B;  2L00 B;  3KVF B;  3VUY A;  3RCP A;  4PYU A;  4C0A A;  2KFJ A;  4WJ7 A;  1ZW7 A;  2X18 A;  3FSS A;  3H7P B;  5FR6 A;  3HQC A;  5J3T A;  2RR9 A;  2KTF A;  2Y5B B;  1L2N A;  2QKM A;  1XD4 A;  3D8E A;  3ZNI D;  2KHW B;  3ZIM A;  3V60 A;  3CXB B;  4DBB A;  2L0F A;  4OVV A;  1WZ3 A;  2YS5 A;  2RLO A;  2C7M B;  2KWV B;  4G3X B;  4KV2 A;  2J0K A;  4BBK A;  3M95 A;  4TV3 A;  2G4D B;  2KFK A;  1OEY J;  2AYO B;  4HLE A;  4KSK C;  3ODO A;  1W1D A;  3GOE A;  2KZR A;  5CLQ B;  3AI5 A;  1WJU A;  5AZF A;  5KQ4 A;  4RM9 A;  1PLS A;  5D3V A;  2GJY A;  4CYE A;  3UIO B;  4AUQ C;  2G35 A;  3VDZ A;  3QBV B;  4ZRJ A;  5JP4 A;  3TCA A;  2I1K A;  3A98 B;  3R3M A;  3ZNZ B;  3U30 A;  4A20 A;  3ML8 A;  4YON A;  1WMH A;  1DDM A;  4DHJ B;  1BTN A;  2LJ5 A;  1OY2 A;  1WM2 A;  2EMS A;  4XX5 A;  3MPX A;  1I2H A;  1MK9 B;  1F9J A;  2COD A;  2OTX A;  4IG7 B;  3SUZ A;  1DDV A;  2VRR B;  1R4M I;  1S1Q B;  1ZKH A;  2IYD B;  2KVR A;  2KGX B;  2MCN B;  2WWZ A;  1K5D B;  2H7D A;  2G3Q B;  1OEY A;  4WJO A;  3SHQ A;  2KDE B;  3AUL A;  1ST7 A;  1E90 A;  2NBV B;  2WYQ A;  3RZW C;  1FGZ A;  1PFJ A;  4MJS A;  2JZZ A;  4IWQ A;  4ZRI A;  1AAR A;  4II2 B;  2JZ3 B;  1D3Z A;  4GN1 A;  2NVU I;  2N7D A;  4HCP B;  4LCD E;  2WX1 A;  1FGY A;  2MFQ A;  3TVV A;  3QCA A;  4A6H A;  1UEL A;  5HE3 A;  1WG7 A;  2KN5 A;  5DI9 B;  2JY6 A;  2KOX A;  3A1Q A;  3DQV A;  4AP4 C;  1X1F A;  2FDQ A;  4HAU B;  4KVG B;  1EF5 A;  1Z5S B;  4MK0 A;  3N32 A;  4MM3 A;  1WE6 A;  5CHF A;  2FCN A;  3NY5 A;  3W1Y A;  2ROV A;  1WFY A;  3DVG X;  1BT0 A;  2IY1 B;  3ZO5 B;  1WGG A;  4EZJ A;  2RUK B;  3ENE A;  5DPS A;  4FN2 A;  3SDL C;  2V76 A;  2L8J A;  1V5T A;  2PJH A;  3F5R A;  1K5G B;  1TQZ A;  1WXM A;  3A9J A;  1T0Y A;  3IFW B;  4GIV A;  2M1M A;  2PEA A;  3DBR I;  3H6N A;  3MJW A;  1U2B A;  3KY9 A;  1V81 A;  2AWT A;  2PPH A;  3O65 B;  4KIK A;  2JT4 B;  3PHW B;  5DCN A;  2KQS A;  2BPS A;  4IM0 A;  5J17 A;  1RRB A;  1WJ6 A;  3TO1 A;  2KAN A;  3EHV A;  4D0N B;  1GC6 A;  2JRI B;  2O6V A;  1ZC3 B;  4JGH B;  5D7G A;  3KH0 A;  3PSC A;  3SV1 A;  1Y8R C;  3OAW A;  3WIM A;  4MGI E;  1NI2 A;  2KTR B;  3QWZ B;  2D9W A;  3WAO A;  3QIJ A;  1YQB A;  2MBQ A;  2MP2 B;  5JH5 C;  4HB0 B;  4AWJ A;  1AQC A;  3N7C A;  2DX5 A;  3EPY A;  3APC A;  3N3K B;  5J18 A;  5D94 A;  2JP2 A;  1RLF A;  4GSW A;  4B95 A;  2CS4 A;  2DYO A;  1N3H A;  5LOP B;  4F7G A;  1HBK A;  2I5F A;  1OMW A;  1QQG A;  1UNR A;  3VQI A;  3VXW A;  3A8P A;  2M17 A;  2RQ1 A;  2MBB B;  3L16 A;  3QQ8 B;  4TQ0 A;  3JSV A;  3VUW A;  3P6A A;  4NJ7 A;  4I6L B;  1G6J A;  1MK7 B;  4DXA B;  3DXC A;  1BAK A;  5CTR C;  5D6J B;  5E6O A;  1UEF A;  1XOD A;  3ODW A;  4L6E A;  4FAD A;  4DK5 A;  3H1U A;  1TJ6 A;  4WVF B;  1KOT A;  2GBK A;  2E2X A;  2K8C A;  5AZG A;  1LB1 A;  3PVU A;  2ZZP B;  1P5T A;  5DPR A;  3ZW3 A;  4FLH A;  1V80 A;  2CB8 A;  3RT3 B;  4ANU A;  2KX0 A;  4N9F 4;  2ASQ A;  2GMI C;  4MY6 A;  2DX1 A;  1GUA B;  1R4N I;  2BKF A;  2KQ7 A;  3K9P B;  1LW3 A;  5D3X A;  2MLB A;  3DVN V;  1E5W A;  3NZS A;  4HB3 B;  2ZEQ A;  4WQO B;  3V6C B;  2J0M A;  4TUU A;  3VVW B;  4A3P A;  4MEM A;  3PLV A;  1ZVR A;  3KYC D;  2JWZ A;  5HKH A;  2KX3 A;  1WM3 A;  3R7Q A;  1E7U A;  4A3O A;  1TGZ B;  5G55 A;  2AEH A;  3IG3 A;  1WGU A;  3ZNG C;  2RGN B;  2KDF B;  5C6R A;  2PE9 A;  4FUL A;  2DYQ A;  2KLG A;  4F8C B;  1XKE A;  3ZTC A;  2WH5 A;  2KK8 A;  1XCG A;  3HW2 B;  1YX6 B;  3C0R B;  3TMP B;  2DLW A;  1V5U A;  4A5K A;  1EVH A;  1WMH B;  3K9O B;  3KUC B;  5LXI B;  1EGX A;  1Q5W B;  2MBO A;  2KKC A;  5HE1 A;  5E6N A;  1VCB A;  2Y8G A;  4FHJ A;  4F7U P;  4HJK A;  5EFX A;  2K25 A;  2C9W B;  2MQJ A;  4TKN A;  5L81 A;  3H7S A;  2OQB A;  4A6F B;  2IO2 B;  3OJ3 A;  3D32 A;  3M1I B;  2KJH B;  4B6H A;  4WJP A;  2BWF A;  1P3Q U;  3VH4 B;  1EUV B;  1FOE A;  2G4S A;  3UIN B;  2HRJ A;  2ZCC A;  4DDI D;  3MHS D;  1WXS A;  2J0J A;  2N7E A;  2IYB A;  2L1C A;  4DX8 A;  2JUO A;  5J3Q A;  2A5U A;  1VD2 A;  4HPL B;  2VSZ A;  3JW0 X;  1WXA A;  2K1F A;  4W9I A;  5IAA C;  4PNK A;  2MRP A;  3HK0 A;  2M8S A;  4MT7 A;  2XK5 B;  3PGE A;  2YF0 A;  1YJ1 A;  4NPN A;  4BKS D;  1S3S G;  1U27 A;  5CHV C;  2O2V A;  1NTI A;  2YS1 A;  2COA A;  2NS5 A;  1H10 A;  5TR5 A;  3RD2 A;  2XEW A;  3UZT A;  3Q3J A;  4W9H A;  2R09 A;  4EKU A;  3Q3F A;  4Z2M B;  4DWF A;  4GMX B;  4HAT B;  4HHV A;  4H8S A;  2J59 M;  2Z0P A;  3PLU A;  1V89 A;  3FLV A;  1EF1 A;  1NBF C;  2D10 A;  2IY0 B;  3B1L X;  2ZCB A;  5DPW A;  2GBN A;  4FJZ A;  5JHH A;  1NTY A;  1XX0 A;  1RAX A;  1RFA A;  4J6I A;  3HIZ A;  4M8M A;  2HTH B;  2LUL A;  4KAX B;  4KHA A;  3V5W A;  1WX9 A;  2B3A A;  3RYT A;  1DYN A;  1J0G A;  3A9J B;  3R66 C;  1W1G A;  2D2Q A;  1XD3 B;  3NZU A;  2RSU A;  4IAP A;  3PS6 A;  1PQS A;  3ZDM C;  1ISN A;  2CHW A;  4BBN C;  1SGH A;  1TBE A;  4JLC A;  3MDB C;  2LUE A;  3JVZ X;  1H4R A;  4MGK E;  1X1M A;  4ZRK A;  5C79 A;  4KIK B;  1PMS A;  3IHP C;  1X86 A;  5KCV A;  3BJI A;  3RCZ A;  2CKH B;  1X1G A;  5C5B B;  3NHE B;  1U5D A;  2D9Y A;  1DDW A;  3QJZ A;  4IC7 B;  4JL9 A;  4NJ6 A;  3IBE A;  2K8B A;  2Z0D B;  1V5P A;  5L95 C;  5DPT A;  4TYZ A;  2DZK A;  2M14 A;  4G11 A;  2COF A;  1IPG A;  4MDK E;  3ZTD A;  3QWM A;  2CY4 A;  4GOC A;  1GJZ A;  1W1H A;  2JXX A;  2XK5 A;  3ML9 A;  3WAL A;  3A4S C;  2KXJ A;  1LXD A;  1UPQ A;  2MSE D;  5EDS A;  1U5E A;  3L0W B;  3JYU A;  5E6P A;  5L83 A;  2RSG A;  1GNU A;  2CU1 A;  2J7Q B;  2NCN A;  3PPA A;  4K7W A;  3QC8 B;  4KZ0 A;  2CAY A;  2FJL A;  3PEG A;  1Z2M A;  2C5L C;  3EFU A;  3V61 A;  4A6K A;  1YD8 U;  2MWN B;  1WXV A;  1FXT B;  4HB4 B;  1UZX B;  2GBJ A;  2O2V B;  1KZ7 A;  3APF A;  4W9D A;  5GMV A;  4Y94 A;  1LFD A;  4NQK E;  4EEW A;  2LD9 A;  4NQL B;  3QA8 A;  2MBE A;  5DHF B;  3PVL A;  3TL5 A;  4K7S A;  2LRW A;  1Q1O A;  2G45 B;  1WJN A;  2FCS A;  4W9G A;  1I7A A;  1KZG A;  2IO0 B;  3TJP A;  1U29 A;  1V88 A;  1UD7 A;  1WGD A;  2IBI B;  1RRP B;  2REX A;  2DN6 A;  1OGW A;  2ZVO A;  4KHB B;  2JPH A;  3V62 A;  4E74 A;  3FM8 C;  4BKT A;  5J3Y A;  2LZ6 A;  2N0Y A;  2R0D A;  1WJM A;  2FIF A;  1U5F A;  3VH3 B;  1TXD A;  2LBB A;  2ADZ A;  2LXC A;  4WJQ A;  4W9E A;  3H7P A;  2LOX A;  3VUX A;  3APD A;  3P2B A;  1FHX A;  2DKQ A;  1WJ4 A;  2KCJ A;  2L3Z A;  2DHZ A;  3ZVR A;  3VTW A;  4K7U A;  4FA6 A;  3DCG A;  1OQN A;  2BKR B;  4IUM B;  2BYE A;  3KW5 B;  2KWU B;  1ZGU B;  3PTF C;  1KJT A;  2EKE C;  2NBW B;  4G50 A;  1A5R A;  1NU2 A;  2MKR A;  1SE9 A;  2W2X C;  4KDL B;  1WY8 A;  2GOW A;  4W9K A;  2BWE S;  4GPT B;  2MBH A;  4TQ1 A;  3IVF A;  4BOZ B;  2YVC A;  3ONS A;  1XQQ A;  4BKG A;  3VOQ A;  3U8Z A;  2XQN M;  2RD0 A;  2LG1 A;  1V49 A;  4KZC A;  5J2R A;  2NBU A;  1FHO A;  2DTC A;  1RJ2 A;  5KHO A;  1P0R A;  5IA7 A;  1UBI A;  4NNJ B;  1LQB A;  2ZVN A;  2ZNV C;  2YT0 A;  3DXD A;  5GOW B;  2QHO A;  3CIK A;  4K2O A;  2K6Q A;  3OLM D;  4I6N B;  1K8R B;  2R2O A;  3TIX A;  3PRZ A;  1DBH A;  4AJW A;  4CHM A;  1WVH A;  2UWQ A;  2IO1 B;  2O6V D;  1UPR A;  1V5M A;  4IFS A;  4ICV A;  4PS8 A;  3PP2 A;  4ASW C;  4HAW B;  2M4N A;  1FAO A;  4G0N B;  1HB8 A;  1J19 A;  3DPD A;  3AU4 A;  3SYX A;  1QZE A;  4GB9 A;  4LDT B;  3TBL D;  1IYF A;  2C7H A;  3BY4 B;  2KLC A;  2DZJ A;  3NS8 A;  4PYZ A;  3ZRC A;  2ABD A;  4A6F A;  4EMO A;  3QHT A;  2RPQ A;  4ICU A;  1UNQ A;  3D8D A;  4DHZ B;  1FB8 A;  5JZE B;  2HTH A;  2N23 A;  1H8C A;  5LLI A;  2A4Z A;  3T9L A;  2NPT B;  1GG3 A;  1V9J A;  4HB2 B;  2YS3 A;  1XT9 B;  3JSV B;  2P0D A;  1Q67 A;  3L13 A;  4BVU C;  4E71 A;  4E3C A;  3KUD B;  4FJY A;  2HE7 A;  3NSU A;  2D3G A;  3GYO A;  3HM6 X;  4IWO A;  4MEL A;  1WR6 E;  4MGZ E;  1HE8 A;  2L0T A;  5DH9 B;  3DOW A;  4ANW A;  4CO7 A;  1IRS A;  3DBS A;  1ACA A;  4PS3 A;  2KDI A;  4ANX A;  2DHK A;  4FHK A;  3TW1 A;  3UQB A;  3FEH A;  4DX9 0;  2GS0 A;  2DAJ A;  1J8C A;  2L05 A;  2AL3 A;  2EMT A;  2DAF A;  4M0W B;  5FI0 A;  2EC1 A;  2JVC A;  1IP9 A;  4PQ0 A;  3L08 A;  3OAN A;  3B0A A;  4WSF A;  4WWO A;  3RUL A;  2IFS A;  2LRU A;  1BWN A;  4W9J A;  2L76 A;  3HHM A;  4LDT D;  4PS7 A;  2KDB A;  3RZF A;  2H7E A;  4Z2N A;  2CR5 A;  3DBL I;  3MTN B;  3UGB B;  4HAY B;  1CMX B;  4ZDV A;  3M62 B;  3H9D A;  4IM2 A;  3F0W A;  3PRM B;  4EFO A;  5LON B;  2N1V A;  3KRX A;  2O6V B;  4EZK A;  1HB6 A;  2DA0 A;  5AZH A;  1L7Y A;  2D07 B;  2MDX A;  3A33 B;  3PG7 A;  4HAZ B;  1AWE A;  1WR1 A;  2MA9 B;  3QK0 A;  1B55 A;  1X11 A;  2YSZ A;  3ZDT A;  3X23 A;  1WE7 A;  2KJR A;  5C1Z A;  1I35 A;  3A4R A;  2LAS A;  3A8Q A;  1TTN A;  2KMA A;  2WX0 A;  1GC7 A;  3PT2 B;  5BO4 B;  3VAW A;  1ZSQ A;  2LVP A;  2FID A;  2MP2 A;  3WAN A;  3VTU A;  5D2M B;  5D3Y A;  1P9D U;  1WGY A;  4OVU A;  2DYM A;  4EZL A;  2CY5 A;  2LOZ A;  3KRW A;  1MIX A;  1QC6 A;  2K2J A;  2K39 A;  2D11 A;  2L7R A;  2NPT A;  4B6W A;  2CRF A;  3M63 B;  3PRP B;  4GDL A;  4GMV A;  4HPM B;  4KSL C;  4WWP A;  4IOY X;  4K81 A;  2Z59 B;  4WAA A;  1WX7 A;  4AJY B;  3ZVV A;  2C60 A;  3LJU X;  2HJ8 A;  2DYN A;  3L17 A;  4NAW A;  4HDQ A;  2AL6 A;  1Y19 B;  2UZR A;  2GBR A;  4XC2 A;  2BF8 B;  3EEC A;  2M38 A;  4II3 B;  3VTV A;  3WAP A;  4W9F A;  4W9L A;  1M94 A;  2LYD A;  4GDK A;  3AJ4 A;  4MH0 E;  3UQA A;  2GBM A;  2Z0E B;  4GU2 A;  4ZYN A;  1BTK A;  2LKO A;  2ZPY A;  1X05 A;  1J0W A;  3PRE A;  3ODX A;  1P3R A;  3VIA A;  1E8W A;  3SO6 A;  2I1J A;  2VKI A;  2KFK B;  4LJP B;  4HAX B;  2MX2 A;  4B9K A;  2P8V A;  4MJS B;  2DFK A;  5DIF B;  4WWN A;  3KZ1 A;  3P7Z A;  3KSY A;  1WX8 A;  2M0X A;  3L54 A;  1DRO A;  2Y7B A;  3PZD A;  4I6P A;  2KD0 A;  2I5C A;  3DVG Y;  2NR2 A;  4MGY E;  3B08 A;  5JHA A;  4GXB A;  1WGR A;  3ZLZ A;  3I3T B;  2P0H A;  1V86 A;  5HE0 A;  1MKE A;  1E8Z A;  1V5O A;  3U7D A;  1WI1 A;  2UZS A;  2Z0Q A;  1WIA A;  2DHI A;  2KNB A;  2LI5 A;  1ZC4 B;  3PSE B;  4XZ4 A;  2DZI A;  3O96 A;  3ZUN A;  4DHZ E;  2IO3 B;  2LGY A;  3QAQ A;  1U4A A;  4FBJ B;  4BKS A;  1WI0 A;  2DYB A;  4EUT A;  2HD5 B;  2KO3 A;  4BBN F;  1Y5O A;  4GZU A;  2D9V A;  1MPH A;  2P0F A;  3OJ4 B;  4MSM B;  5CLL B;  1P6S A;  2FUH B;  4ANV A;  1C3T A;  4KDI C;  1C1Y B;  4F7H A;  3R7R A;  3DBH I;  1V61 A;  4EJN A;  2ZJD A;  3LDZ E;  4MSQ B;  3T06 A;  4JQW C;  2YLM A;  2NMB A;  2D9X A;  3VHT C;  3ML4 A;  2YT1 A;  3WA0 A;  2K2U A;  5D3W A;  2CHX A;  3LJ3 A;  1E7V A;  3PV1 A;  1XR0 B;  2RNR B;  4NY0 A;  2UVM A;  1EO6 A;  2N1W A;  4KHO A;  3DXE A; 
#chains in the Genus database with same CATH topology
 2OJR A;  2K22 A;  3ZJU A;  3AU5 A;  2IZV B;  1TKE A;  1WGH A;  1MG8 A;  2NMQ A;  3E9L A;  3VFK A;  1OQY A;  2CQU A;  2BCJ A;  2Q5W D;  2WXO A;  4P1C C;  2LXA A;  2L52 A;  1C4C A;  3CST A;  2LVO A;  2RGF A;  3A9K B;  5LXH A;  3AE5 B;  3FIL B;  2COC A;  5CX3 A;  1NVL A;  2YRY A;  3D8F A;  3ECI A;  2E3T A;  4NSW A;  4DBG A;  4ARC A;  3N9Y C;  3W1S C;  2Y8F A;  3DDC B;  3KUZ A;  3TUO A;  4JK7 A;  4QJ4 B;  2BQQ A;  2DX5 B;  2JRH A;  2KC1 A;  1WF9 A;  3EC8 A;  5DHA B;  1XF5 L;  5C5B A;  3R2T A;  4ZRP A;  4GGQ A;  4QJ3 B;  2ELA A;  4NQK E;  2DKP A;  5I2S A;  4ZRQ A;  4EOY A;  2VH2 A;  2FAZ A;  1M7E A;  2GCJ A;  5LG4 B;  3I57 A;  2LWP A;  2BGF A;  1RFK A;  1EAZ A;  2ZW1 A;  2W2X D;  1WGQ A;  2PE6 B;  2LGD A;  2YT2 A;  2BYV E;  1WYW B;  5G2N A;  4HVB A;  3U52 E;  5AEK B;  3NVW A;  4F1S A;  2ZKM X;  2R2Q A;  3ZNH B;  1WRI A;  1E8X A;  3GYP A;  1F77 A;  1SEB D;  4CHJ A;  4IM3 A;  1IBX B;  2ACZ B;  3KVF B;  3RCP A;  4PYU A;  2KFJ A;  3BVZ A;  1ZW7 A;  2ON8 A;  1SBB B;  3RNF C;  1JML A;  5J3T A;  4OVZ A;  2J53 A;  3V60 A;  2L0F A;  5IKC M;  2C7M B;  4G3X B;  4TV3 A;  3M95 A;  1SJH D;  2G4D B;  2AYO B;  4KSK C;  2KZR A;  5CLQ B;  5KQ4 A;  4RM9 A;  1I7H A;  2WXI A;  4AUQ C;  3VDZ A;  1DOX A;  4C7Z A;  2WDV B;  3AM9 A;  3L4P A;  4A20 A;  3ML8 A;  1WMH A;  4IKG A;  1OY2 A;  2EMS A;  1I2H A;  1MK9 B;  4JE3 B;  3AE1 B;  3SUZ A;  3Q8B A;  1DDV A;  5C3J B;  2KGX B;  1XLN A;  4B0M A;  1I4Q A;  2KDE B;  4EE2 A;  2WYQ A;  3RZW C;  4MJS A;  2JZZ A;  2RRF A;  4ZRI A;  1AAR A;  3NUH B;  3NVV A;  3V05 A;  4ARI A;  1D3Z A;  2NVU I;  2V0G A;  3QCA A;  1MHH E;  2JY6 A;  2KOX A;  3A1Q A;  1LO5 D;  4ILJ A;  4KVG B;  1EF5 A;  3W5V B;  4MK0 A;  1WE6 A;  3NY5 A;  2ROV A;  2L32 A;  4EZJ A;  4FN2 A;  4HRS A;  3F5R A;  1E0Z A;  4DQO C;  1K5G B;  3IFW B;  4GIV A;  2M1M A;  3DBR I;  3H6N A;  1V81 A;  1RRB A;  3TO1 A;  5FKA C;  2JRI B;  3KH0 A;  3PSC A;  3WIM A;  2ONQ A;  1PYW D;  4Q2J A;  1NI2 A;  3WAO A;  4JKA A;  3GZN B;  3QIJ A;  4HB0 B;  4AWJ A;  3N3K B;  1AWD A;  5D94 A;  4B95 A;  4XGA B;  4NJC A;  1N3H A;  3VQI A;  1VLB A;  2IPK D;  2M17 A;  3L16 A;  4TQ0 A;  1G6J A;  4MH8 A;  2X0S A;  1FEH A;  1PUT A;  4FAD A;  2GBK A;  2N7J A;  3AE3 B;  2ZZP B;  5DPR A;  1P5T A;  3VRB B;  3ZW3 A;  4ANU A;  2KX0 A;  4N9F 4;  3DBL B;  2Z14 A;  1GUA B;  3K9P B;  4KGS A;  3V3X A;  3PLV A;  1ZVR A;  3KYC D;  5BMI A;  2LHE A;  4FXC A;  1N5W A;  1TGZ B;  1FCL A;  2RGN B;  2PE9 A;  5C6R A;  2KDF B;  2G1E A;  2KLG A;  2M0A A;  2WH5 A;  2W3R A;  3W5U B;  1V5U A;  1JWB D;  1EVH A;  3KLS X;  1VBH A;  2BS2 B;  5HE1 A;  4F7U P;  2R61 A;  5EFX A;  4TKN A;  2BWF A;  1P3Q U;  3VH4 B;  2GRI A;  3FVC A;  2IYB A;  4DX8 A;  1N62 A;  3Q8A A;  1VD2 A;  3JW0 X;  1PGB A;  1FMA D;  2K1F A;  4BKS D;  5BYQ A;  1YJ1 A;  4NAM A;  2G9H D;  1KBL A;  1S3S G;  2GLS A;  5CHV C;  2YS1 A;  2NS5 A;  3UZT A;  3ENB A;  4ILH A;  4GNK B;  4EKU A;  4GMX B;  4HAT B;  4HHV A;  2JYT A;  2J59 M;  3FC4 A;  3B1L X;  2J42 A;  2LGS A;  4DIX A;  1NTY A;  4M8M A;  1QOG A;  3HVD A;  2LUL A;  3V5W A;  1XLQ A;  2KIE A;  2Y5P A;  1PQS A;  3N20 C;  1ISN A;  3ZDM C;  4YSY B;  4BBN C;  3MDB C;  2LUE A;  2VZK D;  1H4R A;  5C79 A;  4KIK B;  3IHP C;  3EA6 A;  5KCV A;  3RCZ A;  4P6V F;  4NJ6 A;  3QJZ A;  1DDW A;  1XXG A;  2IGG A;  2K8B A;  2WP9 B;  3IT4 B;  4JWU C;  3C8Y A;  3HIE A;  4GOC A;  1GJZ A;  1W1H A;  3AE8 B;  4L23 A;  2PVG C;  2CJN A;  5EDS A;  5L83 A;  4JKC A;  3PPA A;  3EFU A;  1YD8 U;  1FXT B;  2Y5C A;  3NVY A;  1TY2 A;  1LFD A;  1KLG D;  2LD9 A;  2TSS A;  4JPS A;  5G5G A;  1NEN B;  1Q1O A;  1U29 A;  2DN6 A;  1RYJ A;  1WWT A;  2QIL A;  1TS5 A;  3VTW A;  2DHZ A;  2BKR B;  4HEA 1;  3KW5 B;  4KGT A;  1TS2 A;  1ENF A;  4BOZ B;  5JVL A;  3U8Z A;  4RH6 A;  2LG1 A;  4KZC A;  2NBU A;  1NYR A;  1RJ2 A;  1P0R A;  5IA7 A;  2ZVN A;  3DXD A;  5GOW B;  2QHO A;  3TIX A;  3U7Z A;  2LJI A;  4CHM A;  1WVH A;  4PS8 A;  2O6V D;  4IFS A;  4HAW B;  5M4Y B;  2M4N A;  4G0N B;  1EU4 A;  2RPQ A;  3NG0 A;  1UNQ A;  3R8B A;  2N9L A;  4OZC A;  2K8E A;  1H8C A;  2W3S A;  5LLI A;  5D3D A;  4A8X C;  1GG3 A;  1V9J A;  3AEB B;  2YS3 A;  1Q67 A;  3L13 A;  1V1P A;  2HE7 A;  1SSN A;  1HE8 A;  2L0T A;  3TEW A;  4RGM A;  4YT0 B;  4M00 A;  1IGC A;  4OHJ A;  4KKI A;  3TEZ A;  2GS0 A;  3FAH A;  2L05 A;  2AL3 A;  2DAF A;  4M01 A;  5FI0 A;  4ZHP A;  3Q8F A;  2KDB A;  4HAY B;  1CMX B;  1YJJ A;  4IM2 A;  1R4N B;  3KQ4 A;  1K51 A;  2O6V B;  1HB6 A;  2D07 B;  3IAM 1;  5I4D A;  1X11 A;  2YSZ A;  2JQR B;  2KJR A;  1TTN A;  4YTP B;  5D2M B;  3IT6 B;  3SFE B;  1MIX A;  2K2J A;  1DYQ A;  4B6W A;  2NTS A;  1HQR D;  4KSL C;  2WQY B;  4WAA A;  3ZVV A;  3E9S A;  2HJ8 A;  2LGI A;  1V8C A;  1D5Z C;  1C78 A;  4MH0 E;  4ZYN A;  2ZPY A;  1X05 A;  2PIA A;  2K0P A;  3VIA A;  3SO6 A;  2MX2 A;  1PFD A;  2P8V A;  4MJS B;  3KSY A;  3AED B;  2D3A A;  2KD0 A;  5JHA A;  1N61 A;  3I3T B;  4LNK A;  1V5O A;  2QSD A;  3MJ5 A;  4DHZ E;  3ZUN A;  4RGT A;  1VZ6 A;  4FBJ B;  4BBN F;  4GZU A;  1C3T A;  2B76 B;  1TT5 B;  3ML4 A;  3WAN A;  2CHX A;  2D3B A;  1E7V A;  4MT5 A;  4NY0 A;  1JQ4 A;  1KLV A;  3PVL A;  1UH6 A;  4OW0 A;  1ROE A;  1I4G A;  5HI1 A;  1T0Q C;  3KYD D;  2V9H A;  5IJM A;  2FJ9 A;  1E9M A;  3SR6 A;  1JAL A;  1XO3 A;  3URY A;  3PHX B;  3ULC A;  3M3J A;  1SHC A;  1VZ7 A;  4YL8 A;  3ZRF A;  2KWC A;  3P1M A;  2N9E B;  2WHI A;  4M8N A;  1UWX A;  1FXI A;  1YIW A;  3MC8 A;  2FCM A;  3SD5 A;  1SE2 A;  3V6E B;  1B1Z A;  4W9C A;  1VJK A;  4BFR A;  2DEN B;  4IWP A;  4RMA A;  2FNJ B;  1ZP0 B;  2ZPN A;  3L54 A;  3ZXV A;  4C80 A;  1ZDV A;  3FKY A;  3AB5 A;  2RVB B;  3P4R B;  4HXD A;  1Y56 A;  2JU6 X;  3W1S A;  3PZ8 A;  4FJV B;  3HM3 A;  4JKF A;  2LHD A;  2JF5 A;  3CF6 E;  1KI1 B;  2K00 A;  2KTR A;  3SNH A;  5HE2 A;  1WRD B;  2V4L A;  1M7R A;  3N30 A;  1CZP A;  2W2W A;  4A9A A;  3CSF A;  3QAR A;  2Z13 A;  3ALB A;  5KHQ A;  4HCN B;  1Q0W B;  1TZ1 A;  1NDD A;  4K1R B;  4X57 B;  5T8I A;  2VRW B;  3ULB A;  3R2I A;  3A9K A;  2N9P C;  2KC2 A;  3AEG B;  3RNB C;  1QQR A;  1DGJ A;  3CMM B;  3Q3N C;  2Z0O A;  3X0W A;  2COP A;  1OTR B;  2DLB A;  2XBB C;  1L5P A;  3VUY A;  2L00 B;  3HSA A;  3H7P B;  3FSS A;  4XE0 A;  2RR9 A;  1L2N A;  2DBY A;  3ZNI D;  1XD4 A;  1HXY D;  3ZIM A;  3CXB B;  2YS5 A;  3HUI A;  3E9P A;  3NVZ A;  4BBK A;  4LTU A;  1OEY J;  3ZYY X;  1WJU A;  2R82 A;  1VBG A;  1KC7 A;  3TCA A;  3U30 A;  4YON A;  1DDM A;  4XX5 A;  3MPX A;  1F9J A;  1NEK B;  2OTX A;  2BS3 B;  1R4M I;  1GB4 A;  2KVR A;  2MCN B;  2G3Q B;  1JWM D;  2RDG A;  1NVI D;  4IWQ A;  2INN E;  3BYT B;  4LCD E;  2MFQ A;  3TVV A;  1ZUD 2;  2KN5 A;  1UEL A;  5HE3 A;  1GAQ B;  3T3N A;  4MM3 A;  2FE8 A;  2IY1 B;  2QC8 A;  1WGG A;  3ENE A;  2V76 A;  1V5T A;  2DWQ A;  2WXN A;  1U2B A;  1T0R C;  1AN8 A;  3NJT A;  2FBW B;  1WJ6 A;  2KAN A;  3EHV A;  4XDC A;  3LB8 C;  4JGH B;  1SXT A;  3SV1 A;  3OAW A;  2D9W A;  2MBQ A;  3P4Q B;  3EPY A;  2MEK A;  2JP2 A;  4GSW A;  5LOP B;  4F7G A;  1HBK A;  3VXW A;  3AE7 B;  1UNR A;  1ZPS A;  2RQ1 A;  4NJ7 A;  1MK7 B;  3DXC A;  1BAK A;  2K3U A;  4WQM A;  4DK5 A;  3HVZ A;  3I63 C;  2RDB C;  5AZG A;  3OWE B;  1LB1 A;  3PVU A;  1BXT A;  3MFG A;  2ASQ A;  3RNG C;  3DWM A;  2KQ7 A;  2WLB A;  4WQO B;  4E74 A;  3NZS A;  3V6C B;  4A3P A;  1JRP A;  2PTL A;  2KX3 A;  4KGR A;  4A3O A;  4FUL A;  2KUQ A;  4D2K A;  3ZTC A;  3C0R B;  2KK8 A;  1L4Z B;  2MH7 A;  3K9O B;  3UI3 A;  4A5K A;  1WMH B;  2QJL A;  3KUC B;  1T0S C;  1YQ3 B;  5LXI B;  3SBT A;  1EGX A;  3MC9 A;  5L81 A;  3H7S A;  3J9C A;  2IO2 B;  4A6F B;  3I5J C;  3OJ3 A;  2MJD A;  2RMM A;  3M1I B;  1MG4 A;  1Q10 A;  2HRJ A;  4A90 A;  1UWM A;  1WXS A;  3MHS D;  3OHM B;  1XCT L;  4HPL B;  2VSZ A;  4W9I A;  3HK0 A;  2H89 B;  4MT7 A;  1N6Z A;  2M8S A;  1IBX A;  1U27 A;  3RD2 A;  3Q3J A;  2R09 A;  4LNO A;  4DWF A;  2AQ3 B;  1N60 A;  4H8S A;  2LFI A;  1KH0 A;  3FLV A;  1EF1 A;  1HZ6 A;  2D10 A;  2IY0 B;  3DHH C;  2ZCB A;  3N1Z C;  5JHH A;  1RAX A;  1RFA A;  4J6I A;  1QIL A;  4KHA A;  1WX9 A;  4PK1 A;  3RYT A;  1DYN A;  2PKO A;  4RNA A;  1W1G A;  1XD3 B;  2RSU A;  4IAP A;  3PS6 A;  2CHW A;  3VR8 B;  1SGH A;  4OZA A;  4JLC A;  2WGS A;  1N63 A;  4MGK E;  1T5X D;  1X86 A;  2D9Y A;  3Q6B A;  3BVG A;  1V5P A;  5BYS A;  2DZK A;  2COF A;  4MDK E;  1F52 A;  3ZTD A;  2XK5 A;  2WS3 B;  2KXJ A;  3L0W B;  3IXS A;  4YWG G;  5E6P A;  1C9F A;  1V97 A;  1GNU A;  2J7Q B;  2NCN A;  2QCZ A;  1Z2M A;  4WIP A;  1VR9 A;  3TSS A;  2WXJ A;  4EEW A;  3QA8 A;  1YMH E;  3TL5 A;  4K7S A;  1UD7 A;  1RRP B;  1OGW A;  2JPH A;  2INC C;  2N0Y A;  2M19 A;  1U5F A;  1TXD A;  2ADZ A;  4WJQ A;  3VUX A;  3P2B A;  3W9C B;  1FHX A;  1WJ4 A;  2M56 B;  2KCJ A;  3ZVR A;  4K7U A;  5HHD G;  2ICI A;  2AQ1 B;  1KJT A;  2EKE C;  2NBW B;  1NU2 A;  4KDL B;  1WYG A;  3BYY B;  4W9K A;  2BWE S;  2YVC A;  4N59 A;  1V49 A;  3B9J A;  2YT0 A;  2HTM E;  2K6Q A;  3OLM D;  1QOB A;  2UWQ A;  4ASW C;  1UPR A;  5I2M A;  3Q14 C;  5JXV A;  3PP2 A;  1R7S A;  3DPD A;  1SJE D;  3SYX A;  2C7H A;  1SF0 A;  3NS8 A;  4PYZ A;  4A6F A;  4DHZ B;  5JZE B;  2N23 A;  3GB1 A;  2A4Z A;  3T9L A;  1XT9 B;  1T6B X;  1FFU A;  4FJY A;  3GYO A;  4IWO A;  4MGZ E;  4MEL A;  1WR6 E;  5DH9 B;  1ZOY B;  1KLU D;  3DBS A;  4YTM B;  4ANX A;  2CJO A;  1IP9 A;  4M0W B;  2EC1 A;  2JVC A;  3L08 A;  3OAN A;  4WWO A;  3DHI C;  2LRU A;  1BWN A;  4W9J A;  3HHM A;  4LDT D;  4PS7 A;  1HA5 A;  3MTN B;  3M62 B;  3H9D A;  4EFO A;  4RGN A;  3KRX A;  4WUR A;  2DA0 A;  4C4V B;  1J7C A;  1AWE A;  1XCQ L;  3AEC B;  1J7A A;  3ZDT A;  3X23 A;  1K53 A;  1WE7 A;  5C1Z A;  1I35 A;  2PW9 A;  2KMA A;  3VAW A;  2WX0 A;  1GC7 A;  2D3C A;  2LVP A;  2FID A;  2J4X A;  4P16 A;  1P9D U;  1WGY A;  2DYM A;  4EZL A;  2PLP A;  2LOZ A;  4ITK A;  1ACC A;  1QC6 A;  1NYQ A;  2Z59 B;  1WX7 A;  2C60 A;  3P4S B;  3TEY A;  4HDQ A;  2AL6 A;  2I38 A;  2GBR A;  2M38 A;  4C7Y A;  1I4X A;  4W9F A;  2LYD A;  1STE A;  2GBM A;  2OHF A;  2LKO A;  2KQ4 X;  2KIG A;  1J0W A;  4US8 A;  1E8W A;  1P3R A;  1JWS D;  2I1J A;  2VKI A;  2KFK B;  4LJP B;  4B9K A;  3AMZ A;  2M0X A;  3PZD A;  2I5C A;  1WGR A;  2BB6 A;  3ZLZ A;  1MKE A;  1E8Z A;  2KNB A;  3U7D A;  1WI1 A;  1WIA A;  3MP9 A;  2DHI A;  2DZI A;  3O96 A;  2V4I B;  1D5M C;  2IO3 B;  2LGY A;  5HG2 A;  1WI0 A;  4EUT A;  2HD5 B;  3OJ4 B;  1MPH A;  1EWC A;  5CLL B;  3DBH I;  1V61 A;  4MSQ B;  2ZJD A;  2BYT A;  2YLM A;  2NMB A;  5D3W A;  1XR0 B;  2DHK A;  2N1W A;  1FD6 A;  4KHO A;  2WDT B;  4K17 A;  1V1O A;  4HKQ A;  5D27 A;  2JXT A;  3GZN I;  4IW0 A;  3PO0 A;  4GDK B;  3AXC A;  4XYC A;  2N4F A;  4JKE A;  1QF6 A;  3UF8 A;  3RMK C;  3ZKJ C;  4CHK A;  1ZXI A;  2K6D B;  1JCK B;  2MHJ A;  1Z87 A;  4F7Z A;  1GPX A;  5H92 C;  3DVN U;  5CHW A;  2FCQ A;  2V1Y A;  1FM0 D;  2BYF A;  4HAV B;  3TEX A;  4NAW B;  4HWI B;  5C16 A;  1L0Y B;  1P98 A;  2KAC A;  1GB1 A;  3PVW A;  2ZW0 A;  4WJN A;  4RM8 A;  4L1B A;  1MHX A;  1UNP A;  3G9W A;  5L95 C;  2KJ6 A;  2LGX A;  4CSQ A;  1P1A A;  2BB5 A;  1AYF A;  2C7N B;  4JIO U;  2FUG 1;  2K8H A;  3WYF B;  5KQ1 A;  4LJO B;  1FRD A;  2KMM A;  1HZ5 A;  2KMC A;  1UGM A;  1V2Y A;  1ZM0 A;  2D4Q A;  2H88 B;  2MWS B;  2SEB D;  4REZ A;  4DXF A;  2Q13 A;  3NWA A;  1JDE A;  2D9Z A;  1WH3 A;  1ZDX A;  5C23 A;  2N9X A;  5JHB A;  2EJ8 A;  4DDG D;  2PZ1 A;  1ZE3 D;  3GS2 A;  1N5X A;  4WJ7 A;  3BII D;  3HQC A;  2Y5B B;  2KTF A;  3D8E A;  2D5G A;  5G5H A;  1WZ3 A;  2RLO A;  2KWV B;  4KV2 A;  5IOI A;  2J0K A;  2KFK A;  3GOE A;  4O1N A;  5AZF A;  1KFY B;  3UIO B;  3T3O A;  1D5X C;  2Y3A A;  4JKG B;  4DHJ B;  4IG7 B;  4RCO A;  2VRR B;  2IYD B;  3U4E G;  2WWZ A;  1K5D B;  2H7D A;  1SE4 A;  3GP7 A;  3AUL A;  1E90 A;  4KHB A;  3KWV A;  1PFJ A;  1P7E A;  1K52 A;  4II2 B;  3DQV A;  1WG7 A;  1QT9 A;  5DI9 B;  4US9 A;  1YN3 A;  1FO4 A;  4HAU B;  1Z5S B;  4BAX A;  1WGK A;  3DVG X;  1BT0 A;  1D6E C;  4HSI A;  3C19 A;  1TQZ A;  1E7P B;  3A9J A;  2PEA A;  2W55 A;  3MJW A;  3KY9 A;  2JWU A;  3O65 B;  4KIK A;  2JT4 B;  3PHW B;  1E10 A;  2WU5 B;  1FXA A;  3EUB 2;  1GC6 A;  2O6V A;  5D7G A;  3RNE C;  4DXG A;  2K9X A;  4MGI E;  3RN9 C;  3QWZ B;  1MJD A;  2MP2 B;  1L6U A;  4TSS A;  1RLF A;  2NBV A;  3SBG A;  2BT6 A;  1HEZ E;  2CS4 A;  2DYO A;  2QDF A;  5LNK 1;  3A8P A;  2MBB B;  3QQ8 B;  3JSV A;  3VUW A;  3P6A A;  3GE3 C;  5D6J B;  5E6O A;  1UEF A;  1XOD A;  3ODW A;  4L6E A;  5TSS A;  1TJ6 A;  4WVF B;  2E2X A;  1J7B A;  2K8C A;  2OED A;  1V80 A;  2CB8 A;  3RT3 B;  4ZHO A;  1B9R A;  1UF0 A;  2BKF A;  1JWU D;  1LW3 A;  1VZ8 A;  2MLB A;  3DVN V;  4HB3 B;  4TUU A;  4MEM A;  5IO9 A;  3AE4 B;  5HKH A;  2HDE A;  1E7U A;  2WXG A;  3IG3 A;  2VH1 A;  3ZNG C;  1TIF A;  2CU3 A;  1XKE A;  1XCG A;  3HW2 B;  1YX6 B;  3TMP B;  4RGO S;  3DCX A;  1A70 A;  4ZOH C;  3AE9 B;  4A55 A;  2WXQ A;  1F2R I;  4ACF A;  1WXQ A;  2V3P A;  1TJE A;  2Y8G A;  5GXG B;  2OQB A;  2KJH B;  4WJP A;  2BW2 A;  2JZP A;  1EUV B;  1FOE A;  2KAJ A;  2ZCC A;  4DDI D;  2N7E A;  2JUO A;  1C79 A;  2A5U A;  1RWS A;  1WXA A;  3U2S C;  5IAA C;  2MRP A;  2XK5 B;  4NPN A;  3P63 A;  5AUK A;  2MJ3 A;  5BMG A;  2WNM A;  1H10 A;  3ZGZ A;  4M02 A;  4W9H A;  4M0W A;  3PLU A;  1PGX A;  1NBF C;  4N58 A;  3HIZ A;  3RFZ B;  2B3A A;  2IJ0 A;  3A9J B;  3ZQ4 A;  4K3C A;  1TBE A;  1MI1 A;  4XDD A;  1X1M A;  4ZRK A;  1TZO A;  2CKH B;  1X1G A;  5C5B B;  4IC7 B;  1F2R C;  1TKY A;  2L83 A;  4JL9 A;  2K5P A;  3N1Y C;  2Z0D B;  1XEE A;  4TYZ A;  1IPG A;  1ZXH A;  3NS1 A;  3ML9 A;  3AH7 A;  3WAL A;  3E56 A;  3A4S C;  1FCC C;  1LXD A;  1UPQ A;  2RSG A;  4KZ0 A;  2CAY A;  3V61 A;  1AW7 A;  4QXA B;  4A6K A;  2GBJ A;  1WXV A;  1UZX B;  5H8Y E;  4K3B A;  4W9D A;  1KZ7 A;  4WAF A;  3BK1 A;  3U12 A;  4NQL B;  2L1A A;  5E6J A;  2MBE A;  4ZYS A;  3ETR A;  1WSP A;  5EE3 A;  2FCS A;  4W9G A;  3UIN B;  1I7A A;  1KZG A;  2IO0 B;  1V1P B;  2IBI B;  3H1U A;  2REX A;  2ZVO A;  4BKT A;  5J3Y A;  2LZ6 A;  4B0E A;  3B77 A;  2X38 A;  4W9E A;  2LOX A;  3APD A;  4R3D A;  2L3Z A;  2DKQ A;  4LNF A;  1VRA B;  3DCG A;  1OQN A;  2GUM A;  2N0S B;  1UNS A;  2YEP B;  3AEE B;  3PTF C;  4RF0 A;  1A5R A;  2MKR A;  1SE9 A;  4YSZ B;  2MBH A;  4GPT B;  4TQ1 A;  5BYR A;  3IVF A;  1XQQ A;  4BKG A;  2XQN M;  2RD0 A;  1SIJ A;  5KHO A;  1CK1 A;  4NNJ B;  3BVM A;  2ZNV C;  3CIK A;  4I6N B;  4AS1 A;  1K8R B;  3PRZ A;  1DBH A;  4YXD B;  1FAO A;  3OG5 A;  1HB8 A;  1QZE A;  1FNU A;  1IYF A;  3BY4 B;  4USA A;  2DZJ A;  3ZRC A;  1DIK A;  2ABD A;  4EMO A;  3QHT A;  2EKI A;  4ICU A;  1FB8 A;  1JW9 D;  2AQ2 B;  2HTH A;  3RPF C;  4BVU C;  3E9O A;  4HB2 B;  2WXL A;  1MPE A;  3KUD B;  3ABV B;  5EE1 A;  3B2G A;  4ANW A;  3DOW A;  2RPV A;  4LK0 M;  2WXP A;  2XN9 C;  1ACA A;  2KDI A;  3O13 A;  4FHK A;  4JX1 C;  2DAJ A;  1PDX A;  2EMT A;  5AUI A;  3MHZ A;  3RUL A;  2LEK A;  2L76 A;  4J3O D;  3RZF A;  2H7E A;  4Z2N A;  3DBL I;  4ZDV A;  4L1R A;  3F0W A;  5LON B;  2N1V A;  4EZK A;  2AX5 A;  2RDH A;  5AZH A;  1L7Y A;  1MFW A;  3A33 B;  1WR1 A;  4HAZ B;  3QK0 A;  1C77 A;  3A4R A;  3A8Q A;  3PT2 B;  2MJE A;  4OVU A;  4GLS C;  1I4H A;  2CY5 A;  1ET6 A;  1ET9 A;  2D11 A;  2L7R A;  2NPT A;  3M63 B;  4GMV A;  4HPM B;  1CJE A;  4NAW A;  1Y19 B;  4LNN A;  4XC2 A;  3VTV A;  2BF8 B;  3EEC A;  4AQ7 A;  4II3 B;  4JWS C;  1M94 A;  3SEB A;  2Z0E B;  1K50 A;  3PRE A;  3ODX A;  3NRZ A;  3H8H A;  4HAX B;  1BML C;  4WWN A;  4C56 C;  3P7Z A;  3DVG Y;  2NR2 A;  4GXB A;  2NTT A;  4IOI E;  4MSM B;  3KWL A;  2UZS A;  2Z0Q A;  2W82 A;  4XZ4 A;  2LI5 A;  1QOF A;  1I4P A;  4JKG A;  3I9V 1;  2DYB A;  2LUM A;  3BWU D;  4JK9 A;  4F7H A;  3R7R A;  3LDZ E;  4QJ5 B;  2Z59 A;  3T06 A;  3WA0 A;  3S2A A;  3PV1 A;  2RNR B;  1OQQ A;  2UVM A;  4FHJ A;  2DZM A;  3NW8 A;  1I42 A;  2VZK B;  2INP E;  2OOB B;  4P7I A;  1UBQ A;  2WXH A;  1MI0 A;  3P4P B;  1DOI A;  4GDL B;  1EWY C;  4N6E B;  4DHJ D;  3BIN A;  1SIF A;  5FI1 A;  1FHW A;  3RUI B;  2KT7 A;  3T8M A;  1TS4 A;  4URK A;  1NTV A;  3DBH B;  1F1H A;  1E8Y A;  2ROZ B;  1WZ0 A;  1V6E A;  2MW5 A;  2KDM A;  3PZ7 A;  1EU3 A;  1XLP A;  2KUP A;  1OQR A;  2V3S A;  1WJ1 A;  3HRD D;  4K2P A;  3EFC A;  2ELB A;  3Q2A C;  1GGO A;  3VR9 B;  1TS3 A;  2LVQ A;  3FP5 A;  2L2I A;  2DHJ A;  3WCQ A;  5JLJ B;  1KM7 A;  1UGJ A;  3SU8 X;  2KR0 A;  1U5G A;  3IAS 1;  2WXR A;  1MAI A;  5D3I B;  3NOB A;  1JRU A;  5JHG A;  1LM8 B;  3B2F A;  2Z4D A;  2W9N A;  3L10 B;  4BOS C;  1FFV A;  2QKL A;  2ZNV B;  2NZ8 B;  2EEL A;  1HTQ A;  4KKJ A;  1YOV B;  2CHZ A;  4HDO A;  2X8X X;  3TFM A;  2GCL A;  4XWX A;  2UYZ B;  3A1Q B;  3GE8 C;  3QX1 A;  3UIP B;  3RNA C;  4AOF A;  5EE9 A;  1YX5 B;  5IN7 A;  3P42 A;  3AEF B;  4QAY A;  3Q3M C;  1T77 A;  4HK2 A;  1MIZ B;  3SFD B;  4C0A A;  3FIL A;  5FR6 A;  2X18 A;  3NWF A;  4KX6 B;  1UUP A;  1C4A A;  2QKM A;  2KHW B;  4DBB A;  4OVV A;  3DWG C;  1MVK A;  4HLE A;  3ODO A;  1W1D A;  3AI5 A;  3EGR A;  1PLS A;  5D3V A;  2GJY A;  4CYE A;  2G35 A;  3QBV B;  4ZRJ A;  5JP4 A;  2K49 A;  2I1K A;  3A98 B;  3R3M A;  3ZNZ B;  5FR3 A;  1BTN A;  2LJ5 A;  2QMT A;  1WM2 A;  4LNI A;  2COD A;  1S1Q B;  1ZKH A;  3RNC C;  3NWD A;  4WJO A;  1OEY A;  4JK8 A;  3SHQ A;  1ST7 A;  2NBV B;  4XWW A;  1FGZ A;  3ZJT A;  1FIQ A;  2UU7 A;  4RFB A;  2JZ3 B;  4GN1 A;  1YJI A;  4HCP B;  2N7D A;  2WX1 A;  1FGY A;  3DBR B;  4A6H A;  2Z8L A;  4AP4 C;  1X1F A;  2FDQ A;  5CHF A;  3N32 A;  2FCN A;  1R4M B;  3W1Y A;  1WFY A;  1TY0 A;  2RUK B;  5DPS A;  3SDL C;  3Q8E A;  5BMH A;  4S0R A;  2L8J A;  2PJH A;  1WXM A;  2IGD A;  1T0Y A;  3CIR B;  2AWT A;  2PPH A;  2GI9 A;  5DCN A;  4HKZ E;  4IDI A;  2KQS A;  2BPS A;  4IM0 A;  5J17 A;  4D0N B;  4D6W A;  1PGA A;  2WXF A;  1ZC3 B;  1C4P A;  1GOZ A;  1SB3 C;  1Y8R C;  2KWD A;  3AE6 B;  2KTR B;  5JH5 C;  1T3Q A;  1YQB A;  1AQC A;  3N7C A;  2DX5 A;  3APC A;  3BZD B;  5J18 A;  1QQG A;  2I5F A;  1OMW A;  2QIE B;  1L6V A;  3E66 A;  4I6L B;  4DXA B;  5CTR C;  2BS4 B;  3VRA B;  4P1B C;  2JX5 A;  3DHG C;  2BBC A;  1KOT A;  2FJU B;  2N9K A;  4FLH A;  2GMI C;  4MY6 A;  2DX1 A;  1R4N I;  5D3X A;  4F8C B;  3VVW B;  1E5W A;  2ZEQ A;  1YQ4 B;  1F0Z A;  2J0M A;  1E6E B;  2JWZ A;  1WM3 A;  3R7Q A;  5G55 A;  2AEH A;  1WGU A;  4S17 A;  1ZYI A;  1FNV A;  2DYQ A;  1JRO A;  2KYW A;  4ILG B;  4JKD A;  2DLW A;  1LGR A;  1Q5W B;  2MBO A;  2KKC A;  5E6N A;  1VCB A;  4YTN B;  4HJK A;  2K25 A;  2C9W B;  2MQJ A;  3D32 A;  1DOY A;  1QOA A;  3LXF A;  2G4S A;  2J0J A;  2L1C A;  5J3Q A;  2LMC A;  3BK2 A;  4PNK A;  3PGE A;  2YF0 A;  2JSV X;  5TR5 A;  2O2V A;  1NTI A;  2E6X A;  2COA A;  2HJ1 A;  2XEW A;  4H2A A;  3Q3F A;  4Z2M B;  2WU2 B;  2Z0P A;  2WDQ B;  1V89 A;  5DPW A;  2GBN A;  4FJZ A;  1FNW A;  1XX0 A;  3ZXR A;  1EM7 A;  2HTH B;  4KAX B;  2YEP F;  3Q8C A;  4HPP A;  1J0G A;  3R66 C;  2D2Q A;  3NZU A;  2WXM A;  5HFY A;  1YN5 A;  3JVZ X;  4MM3 B;  1M4V A;  3AE2 B;  1PMS A;  3BJI A;  3NHE B;  1U5D A;  3IBE A;  1FRR A;  4RF1 A;  4G11 A;  5DPT A;  2M14 A;  4OT1 A;  3QWM A;  2CY4 A;  1KF6 B;  2JXX A;  4C4V A;  3N1X C;  1HTO A;  2MSE D;  1U5E A;  3NZ3 A;  3JYU A;  2CU1 A;  4K7W A;  3QC8 B;  2FJL A;  3PEG A;  2V3N A;  2C5L C;  4LLG M;  3WAM A;  2MWN B;  2IND C;  4HB4 B;  3APF A;  2O2V B;  5GMV A;  4Y94 A;  3AV8 A;  2IDY A;  2PMV A;  5DHF B;  1RM6 C;  2LRW A;  2G45 B;  1WJN A;  3TJP A;  1V88 A;  1WGD A;  3LYY A;  3Q3O C;  4KHB B;  1C76 A;  3V62 A;  2WDR B;  3FM8 C;  2KVZ A;  2FIF A;  2R0D A;  1WJM A;  3VH3 B;  2LBB A;  2GB1 A;  1KRH A;  2LXC A;  2BVC A;  4C00 A;  3H7P A;  3MC0 B;  2DIK A;  4FA6 A;  1BUI C;  4MAC A;  1IGD A;  4IUM B;  2BYE A;  2KWU B;  1ZGU B;  4G50 A;  4WWM A;  4BZA A;  2W2X C;  1WY8 A;  2GOW A;  3ONS A;  1IUE A;  3VOQ A;  4GOU A;  1KTK A;  5J2R A;  1FHO A;  2DTC A;  1UBI A;  4YSX B;  1LQB A;  4HJG E;  4A6Q A;  5EE0 A;  5C2T B;  4K2O A;  2R2O A;  4AJW A;  2I2Y A;  2IO1 B;  4ICV A;  1V5M A;  4L2Y A;  4GB9 A;  1L0V B;  1J19 A;  3AEA B;  3AU4 A;  4UDU C;  3TBL D;  4LDT B;  2KLC A;  1L0X B;  3D8D A;  4JKB A;  4CQN A;  3W2D A;  4XWT A;  2NPT B;  1NI3 A;  3JSV B;  2P0D A;  4E3C A;  4E71 A;  3NSU A;  2D3G A;  1YNT E;  3HM6 X;  1SE3 A;  4CO7 A;  1IRS A;  4PS3 A;  2R2Y A;  1XLO A;  1VDV A;  3TW1 A;  1J8C A;  3FEH A;  4DX9 0;  4PQ0 A;  3B0A A;  4WSF A;  1D4B A;  2OJW A;  2IFS A;  4PT5 A;  2CR5 A;  3UGB B;  4WH4 A;  3PRM B;  2MDX A;  1ESF A;  3CWI A;  3PG7 A;  2MA9 B;  1B55 A;  2LAS A;  5BO4 B;  1ZSQ A;  4OZB A;  4TMA B;  1FPY A;  2MP2 A;  2XNA C;  3VTU A;  5D3Y A;  1P7F A;  1L4D B;  4HRO A;  1TYG B;  3KRW A;  3A58 A;  2K39 A;  2CRF A;  3PRP B;  4GDL A;  2BTE A;  4AJY B;  4WWP A;  3RI7 C;  4IOY X;  4K81 A;  4JKH A;  2IGH A;  5MPO A;  2PVO D;  2DNF A;  3LJU X;  1QLB B;  2DYN A;  3L17 A;  3WAP A;  2UZR A;  2JYE A;  4W9L A;  4GDK A;  3AJ4 A;  3UQA A;  3AN1 A;  4GU2 A;  1BTK A;  4OSN A;  1OFF A;  1CQV A;  5FK9 C;  2DFK A;  5DIF B;  3ZJV A;  3KZ1 A;  1TKG A;  3Q69 A;  3ZO5 B;  1WX8 A;  3UQB A;  2KN4 A;  1DRO A;  2Y7B A;  2SAK A;  4I6P A;  4MGY E;  3B08 A;  5IP4 D;  1YN4 A;  2P0H A;  1V86 A;  5HE0 A;  2J52 A;  2WXK A;  3PSE B;  1ZC4 B;  1QKZ A;  1JWA D;  3QAQ A;  1U4A A;  4BKS A;  2KO3 A;  1Y5O A;  2D9V A;  2P0F A;  1P6S A;  2FUH B;  4ANV A;  4KDI C;  1C1Y B;  4EJN A;  4NZL B;  2QEJ C;  4JQW C;  2D9X A;  3VHT C;  1I4R A;  2YT1 A;  2W54 A;  2K2U A;  5IRS A;  3LJ3 A;  4B6H A;  1EO6 A;  3DXE A; 
#chains in the Genus database with same CATH homology
 2OJR A;  3AU5 A;  2IZV B;  1WGH A;  1MG8 A;  3VFK A;  3E9L A;  1OQY A;  2CQU A;  2BCJ A;  2LXA A;  3CST A;  2LVO A;  2RGF A;  3A9K B;  5LXH A;  2COC A;  5CX3 A;  1NVL A;  2YRY A;  3D8F A;  3ECI A;  4NSW A;  4DBG A;  3W1S C;  2Y8F A;  3DDC B;  3KUZ A;  4JK7 A;  2DX5 B;  2JRH A;  2KC1 A;  3EC8 A;  1WF9 A;  5DHA B;  5C5B A;  4GGQ A;  2ELA A;  4NQK E;  2DKP A;  4EOY A;  2FAZ A;  1M7E A;  2GCJ A;  2LWP A;  2BGF A;  1EAZ A;  2W2X D;  1WGQ A;  2PE6 B;  2LGD A;  2BYV E;  1WYW B;  5G2N A;  4HVB A;  5AEK B;  4F1S A;  2R2Q A;  3ZNH B;  1E8X A;  3GYP A;  4CHJ A;  4IM3 A;  3KVF B;  3RCP A;  4PYU A;  2KFJ A;  1ZW7 A;  5J3T A;  3V60 A;  2L0F A;  2C7M B;  4G3X B;  4TV3 A;  3M95 A;  2G4D B;  2AYO B;  4KSK C;  2KZR A;  5CLQ B;  5KQ4 A;  4RM9 A;  4AUQ C;  3VDZ A;  4A20 A;  3ML8 A;  1WMH A;  1OY2 A;  2EMS A;  1I2H A;  1MK9 B;  3SUZ A;  1DDV A;  2KGX B;  2KDE B;  2WYQ A;  3RZW C;  4MJS A;  2JZZ A;  4ZRI A;  1AAR A;  1D3Z A;  2NVU I;  3QCA A;  2JY6 A;  2KOX A;  3A1Q A;  4ILJ A;  4KVG B;  1EF5 A;  4MK0 A;  1WE6 A;  3NY5 A;  2ROV A;  4EZJ A;  4FN2 A;  3F5R A;  1K5G B;  3IFW B;  4GIV A;  2M1M A;  3DBR I;  3H6N A;  1V81 A;  1RRB A;  3TO1 A;  2JRI B;  3KH0 A;  3PSC A;  3WIM A;  1NI2 A;  3WAO A;  4JKA A;  3QIJ A;  4HB0 B;  4AWJ A;  3N3K B;  5D94 A;  4B95 A;  1N3H A;  3VQI A;  2M17 A;  3L16 A;  4TQ0 A;  1G6J A;  2X0S A;  4FAD A;  2GBK A;  2ZZP B;  5DPR A;  1P5T A;  3ZW3 A;  4ANU A;  2KX0 A;  4N9F 4;  1GUA B;  3K9P B;  3PLV A;  1ZVR A;  3KYC D;  1TGZ B;  2RGN B;  2KDF B;  5C6R A;  2PE9 A;  2KLG A;  2WH5 A;  1V5U A;  1EVH A;  1VBH A;  5HE1 A;  4F7U P;  5EFX A;  4TKN A;  2BWF A;  1P3Q U;  3VH4 B;  2IYB A;  4DX8 A;  1VD2 A;  3JW0 X;  2K1F A;  4BKS D;  1YJ1 A;  1KBL A;  1S3S G;  5CHV C;  2YS1 A;  2NS5 A;  3UZT A;  3ENB A;  4ILH A;  4EKU A;  4GMX B;  4HAT B;  4HHV A;  2J59 M;  3B1L X;  1NTY A;  4M8M A;  2LUL A;  3V5W A;  1PQS A;  3ZDM C;  1ISN A;  4BBN C;  3MDB C;  2LUE A;  1H4R A;  5C79 A;  4KIK B;  3IHP C;  5KCV A;  3RCZ A;  4NJ6 A;  3QJZ A;  1DDW A;  2K8B A;  4GOC A;  1GJZ A;  1W1H A;  5EDS A;  5L83 A;  4JKC A;  3PPA A;  3EFU A;  1YD8 U;  1FXT B;  1LFD A;  2LD9 A;  1Q1O A;  1U29 A;  2DN6 A;  3VTW A;  2DHZ A;  2BKR B;  3KW5 B;  4BOZ B;  5JVL A;  3U8Z A;  2LG1 A;  4KZC A;  2NBU A;  1RJ2 A;  1P0R A;  5IA7 A;  2ZVN A;  3DXD A;  5GOW B;  2QHO A;  3TIX A;  4CHM A;  1WVH A;  4PS8 A;  2O6V D;  4IFS A;  4HAW B;  2M4N A;  4G0N B;  2RPQ A;  1UNQ A;  1H8C A;  5LLI A;  1GG3 A;  1V9J A;  2YS3 A;  1Q67 A;  3L13 A;  2HE7 A;  1HE8 A;  2L0T A;  2GS0 A;  2L05 A;  2AL3 A;  2DAF A;  5FI0 A;  2KDB A;  4HAY B;  1CMX B;  4IM2 A;  2O6V B;  1HB6 A;  2D07 B;  1X11 A;  2YSZ A;  2KJR A;  1TTN A;  5D2M B;  1MIX A;  2K2J A;  4B6W A;  4KSL C;  4WAA A;  3ZVV A;  2HJ8 A;  4MH0 E;  4ZYN A;  2ZPY A;  1X05 A;  3VIA A;  3SO6 A;  2MX2 A;  2P8V A;  4MJS B;  3KSY A;  2KD0 A;  5JHA A;  3I3T B;  1V5O A;  4DHZ E;  3ZUN A;  4FBJ B;  4BBN F;  4GZU A;  1C3T A;  3WAN A;  3ML4 A;  2CHX A;  1E7V A;  4NY0 A;  1KLV A;  3PVL A;  1UH6 A;  3KYD D;  5IJM A;  2FJ9 A;  3PHX B;  3ULC A;  3M3J A;  1SHC A;  3ZRF A;  4YL8 A;  2KWC A;  2N9E B;  4M8N A;  1YIW A;  2FCM A;  3SD5 A;  3V6E B;  4W9C A;  4BFR A;  2DEN B;  4IWP A;  4RMA A;  2FNJ B;  2ZPN A;  3L54 A;  4HXD A;  2RVB B;  3W1S A;  4FJV B;  3HM3 A;  4JKF A;  2JF5 A;  3CF6 E;  1KI1 B;  2K00 A;  2KTR A;  3SNH A;  5HE2 A;  1WRD B;  2V4L A;  1M7R A;  3N30 A;  2W2W A;  3CSF A;  3QAR A;  3ALB A;  5KHQ A;  4HCN B;  1Q0W B;  1TZ1 A;  1NDD A;  4K1R B;  4X57 B;  2VRW B;  3ULB A;  3A9K A;  2N9P C;  2KC2 A;  3CMM B;  2Z0O A;  3X0W A;  2COP A;  1OTR B;  2XBB C;  3VUY A;  2L00 B;  3H7P B;  3FSS A;  2RR9 A;  1L2N A;  3ZNI D;  1XD4 A;  3ZIM A;  3CXB B;  2YS5 A;  3E9P A;  4BBK A;  1OEY J;  1WJU A;  2R82 A;  1VBG A;  1KC7 A;  3TCA A;  3U30 A;  4YON A;  1DDM A;  4XX5 A;  3MPX A;  1F9J A;  2OTX A;  1R4M I;  2KVR A;  2MCN B;  2G3Q B;  4IWQ A;  4LCD E;  2MFQ A;  3TVV A;  2KN5 A;  1UEL A;  5HE3 A;  4MM3 A;  2IY1 B;  1WGG A;  3ENE A;  2V76 A;  1V5T A;  1U2B A;  1WJ6 A;  2KAN A;  3EHV A;  4JGH B;  3SV1 A;  3OAW A;  2D9W A;  2MBQ A;  3EPY A;  2JP2 A;  4GSW A;  5LOP B;  4F7G A;  1HBK A;  3VXW A;  1UNR A;  2RQ1 A;  4NJ7 A;  1MK7 B;  3DXC A;  1BAK A;  4DK5 A;  5AZG A;  1LB1 A;  3PVU A;  2ASQ A;  2KQ7 A;  4WQO B;  4E74 A;  3NZS A;  3V6C B;  4A3P A;  2KX3 A;  4A3O A;  4FUL A;  3ZTC A;  3C0R B;  2KK8 A;  3K9O B;  4A5K A;  1WMH B;  3KUC B;  5LXI B;  3SBT A;  1EGX A;  5L81 A;  3H7S A;  2IO2 B;  4A6F B;  3OJ3 A;  3M1I B;  2HRJ A;  3MHS D;  1WXS A;  4HPL B;  2VSZ A;  4W9I A;  3HK0 A;  2M8S A;  4MT7 A;  1U27 A;  3RD2 A;  3Q3J A;  2R09 A;  4DWF A;  4H8S A;  3FLV A;  1EF1 A;  2D10 A;  2IY0 B;  2ZCB A;  5JHH A;  1RAX A;  1RFA A;  4J6I A;  4KHA A;  1WX9 A;  3RYT A;  1DYN A;  1W1G A;  1XD3 B;  2RSU A;  4IAP A;  3PS6 A;  2CHW A;  1SGH A;  4JLC A;  4MGK E;  1X86 A;  2D9Y A;  1V5P A;  2DZK A;  2COF A;  4MDK E;  3ZTD A;  2XK5 A;  2KXJ A;  3L0W B;  5E6P A;  1GNU A;  2J7Q B;  2NCN A;  1Z2M A;  4EEW A;  3QA8 A;  3TL5 A;  4K7S A;  1UD7 A;  1RRP B;  1OGW A;  2JPH A;  2N0Y A;  1U5F A;  1TXD A;  2ADZ A;  4WJQ A;  3VUX A;  3P2B A;  1FHX A;  1WJ4 A;  2KCJ A;  3ZVR A;  4K7U A;  1KJT A;  2EKE C;  2NBW B;  1NU2 A;  4KDL B;  4W9K A;  2BWE S;  2YVC A;  1V49 A;  2YT0 A;  2K6Q A;  3OLM D;  2UWQ A;  4ASW C;  1UPR A;  3PP2 A;  3DPD A;  3SYX A;  2C7H A;  3NS8 A;  4PYZ A;  4A6F A;  4DHZ B;  5JZE B;  2N23 A;  2A4Z A;  3T9L A;  1XT9 B;  4FJY A;  3GYO A;  4IWO A;  4MGZ E;  4MEL A;  1WR6 E;  5DH9 B;  3DBS A;  4ANX A;  1IP9 A;  4M0W B;  2EC1 A;  2JVC A;  3L08 A;  3OAN A;  4WWO A;  2LRU A;  1BWN A;  4W9J A;  3HHM A;  4LDT D;  4PS7 A;  3MTN B;  3M62 B;  3H9D A;  4EFO A;  3KRX A;  2DA0 A;  1AWE A;  3ZDT A;  3X23 A;  1WE7 A;  5C1Z A;  1I35 A;  2KMA A;  3VAW A;  2WX0 A;  1GC7 A;  2LVP A;  2FID A;  1P9D U;  1WGY A;  2DYM A;  4EZL A;  2LOZ A;  1QC6 A;  2Z59 B;  1WX7 A;  2C60 A;  4HDQ A;  2AL6 A;  2GBR A;  2M38 A;  4W9F A;  2LYD A;  2GBM A;  2LKO A;  1J0W A;  1E8W A;  1P3R A;  2I1J A;  2VKI A;  2KFK B;  4LJP B;  4B9K A;  2M0X A;  3PZD A;  2I5C A;  1WGR A;  3ZLZ A;  1MKE A;  1E8Z A;  2KNB A;  3U7D A;  1WI1 A;  1WIA A;  2DHI A;  2DZI A;  3O96 A;  2IO3 B;  2LGY A;  1WI0 A;  4EUT A;  2HD5 B;  3OJ4 B;  1MPH A;  5CLL B;  3DBH I;  1V61 A;  4MSQ B;  2ZJD A;  2YLM A;  2NMB A;  5D3W A;  1XR0 B;  2DHK A;  2N1W A;  4KHO A;  2WDT B;  4K17 A;  5D27 A;  3GZN I;  4IW0 A;  4GDK B;  3AXC A;  2N4F A;  4JKE A;  3UF8 A;  4CHK A;  3ZKJ C;  2K6D B;  4F7Z A;  1Z87 A;  3DVN U;  5CHW A;  2FCQ A;  2V1Y A;  2BYF A;  4HAV B;  4NAW B;  4HWI B;  5C16 A;  1P98 A;  3PVW A;  4WJN A;  4RM8 A;  1UNP A;  3G9W A;  5L95 C;  2KJ6 A;  2LGX A;  1P1A A;  2C7N B;  4JIO U;  2K8H A;  3WYF B;  5KQ1 A;  4LJO B;  2KMC A;  1UGM A;  1V2Y A;  1ZM0 A;  2D4Q A;  2MWS B;  2Q13 A;  1JDE A;  2D9Z A;  1WH3 A;  5C23 A;  2N9X A;  5JHB A;  2EJ8 A;  4DDG D;  2PZ1 A;  4WJ7 A;  3HQC A;  2Y5B B;  2KTF A;  3D8E A;  1WZ3 A;  2RLO A;  2KWV B;  4KV2 A;  2J0K A;  2KFK A;  3GOE A;  5AZF A;  3UIO B;  4JKG B;  4DHJ B;  4IG7 B;  2VRR B;  2IYD B;  2WWZ A;  1K5D B;  2H7D A;  3AUL A;  1E90 A;  1PFJ A;  4II2 B;  3DQV A;  1WG7 A;  5DI9 B;  4HAU B;  1Z5S B;  3DVG X;  1BT0 A;  1TQZ A;  3A9J A;  2PEA A;  3MJW A;  3KY9 A;  3O65 B;  4KIK A;  2JT4 B;  3PHW B;  1GC6 A;  2O6V A;  5D7G A;  4MGI E;  3QWZ B;  2MP2 B;  1RLF A;  3SBG A;  2CS4 A;  2DYO A;  3A8P A;  2MBB B;  3QQ8 B;  3JSV A;  3VUW A;  3P6A A;  5D6J B;  5E6O A;  1UEF A;  1XOD A;  3ODW A;  4L6E A;  1TJ6 A;  4WVF B;  2E2X A;  2K8C A;  1V80 A;  2CB8 A;  3RT3 B;  2BKF A;  1LW3 A;  2MLB A;  3DVN V;  4HB3 B;  4TUU A;  4MEM A;  5HKH A;  1E7U A;  3IG3 A;  3ZNG C;  1XKE A;  1XCG A;  3HW2 B;  1YX6 B;  3TMP B;  2Y8G A;  2OQB A;  2KJH B;  4WJP A;  1EUV B;  1FOE A;  2ZCC A;  4DDI D;  2N7E A;  2JUO A;  2A5U A;  1WXA A;  5IAA C;  2MRP A;  2XK5 B;  4NPN A;  1H10 A;  4W9H A;  3PLU A;  1NBF C;  3HIZ A;  2B3A A;  3A9J B;  1TBE A;  1X1M A;  4ZRK A;  2CKH B;  1X1G A;  5C5B B;  4IC7 B;  4JL9 A;  2Z0D B;  4TYZ A;  1IPG A;  3ML9 A;  3WAL A;  3A4S C;  1LXD A;  1UPQ A;  2RSG A;  4KZ0 A;  2CAY A;  3V61 A;  4A6K A;  2GBJ A;  1WXV A;  1UZX B;  4W9D A;  1KZ7 A;  4NQL B;  2MBE A;  3UIN B;  2FCS A;  4W9G A;  1I7A A;  1KZG A;  2IO0 B;  2IBI B;  3H1U A;  2REX A;  2ZVO A;  4BKT A;  5J3Y A;  2LZ6 A;  4W9E A;  2LOX A;  3APD A;  2L3Z A;  2DKQ A;  3DCG A;  1OQN A;  3PTF C;  1A5R A;  2MKR A;  1SE9 A;  2MBH A;  4GPT B;  4TQ1 A;  3IVF A;  1XQQ A;  4BKG A;  2XQN M;  2RD0 A;  5KHO A;  4NNJ B;  2ZNV C;  3CIK A;  4I6N B;  1K8R B;  3PRZ A;  1DBH A;  1FAO A;  1HB8 A;  1QZE A;  1IYF A;  3BY4 B;  2DZJ A;  3ZRC A;  1DIK A;  2ABD A;  4EMO A;  3QHT A;  4ICU A;  1FB8 A;  2HTH A;  4BVU C;  3E9O A;  4HB2 B;  3KUD B;  4ANW A;  3DOW A;  1ACA A;  2KDI A;  4FHK A;  2DAJ A;  2EMT A;  3RUL A;  2L76 A;  3RZF A;  2H7E A;  4Z2N A;  3DBL I;  4ZDV A;  3F0W A;  5LON B;  2N1V A;  4EZK A;  5AZH A;  1L7Y A;  3A33 B;  1WR1 A;  4HAZ B;  3QK0 A;  3A4R A;  3A8Q A;  3PT2 B;  4OVU A;  2CY5 A;  2D11 A;  2L7R A;  2NPT A;  3M63 B;  4GMV A;  4HPM B;  4NAW A;  1Y19 B;  3VTV A;  4XC2 A;  2BF8 B;  3EEC A;  4II3 B;  1M94 A;  2Z0E B;  3PRE A;  3ODX A;  4HAX B;  4WWN A;  3P7Z A;  3DVG Y;  2NR2 A;  4GXB A;  4MSM B;  2UZS A;  2Z0Q A;  4XZ4 A;  2LI5 A;  4JKG A;  2DYB A;  4JK9 A;  4F7H A;  3R7R A;  3LDZ E;  3T06 A;  3S2A A;  3WA0 A;  3PV1 A;  2RNR B;  2UVM A;  4FHJ A;  2DZM A;  1I42 A;  2OOB B;  4P7I A;  1UBQ A;  4GDL B;  4DHJ D;  3BIN A;  1SIF A;  5FI1 A;  1FHW A;  3RUI B;  3T8M A;  4URK A;  1NTV A;  1E8Y A;  2ROZ B;  1WZ0 A;  1V6E A;  2MW5 A;  2KUP A;  2V3S A;  1WJ1 A;  4K2P A;  2ELB A;  1GGO A;  2LVQ A;  3FP5 A;  2L2I A;  2DHJ A;  5JLJ B;  1KM7 A;  3SU8 X;  1U5G A;  1MAI A;  3NOB A;  1JRU A;  5JHG A;  1LM8 B;  2W9N A;  3L10 B;  4BOS C;  2QKL A;  2ZNV B;  2NZ8 B;  2CHZ A;  4HDO A;  3TFM A;  2GCL A;  4XWX A;  2UYZ B;  3A1Q B;  3QX1 A;  3UIP B;  4AOF A;  1YX5 B;  4HK2 A;  1MIZ B;  4C0A A;  5FR6 A;  2X18 A;  2QKM A;  2KHW B;  4DBB A;  4OVV A;  4HLE A;  3ODO A;  1W1D A;  3AI5 A;  1PLS A;  5D3V A;  2GJY A;  4CYE A;  2G35 A;  3QBV B;  4ZRJ A;  5JP4 A;  2I1K A;  3A98 B;  3R3M A;  3ZNZ B;  1BTN A;  2LJ5 A;  1WM2 A;  2COD A;  1S1Q B;  1ZKH A;  4WJO A;  1OEY A;  4JK8 A;  3SHQ A;  1ST7 A;  2NBV B;  1FGZ A;  2JZ3 B;  4GN1 A;  4HCP B;  2N7D A;  2WX1 A;  1FGY A;  4A6H A;  4AP4 C;  1X1F A;  2FDQ A;  5CHF A;  3N32 A;  2FCN A;  3W1Y A;  1WFY A;  2RUK B;  5DPS A;  3SDL C;  2L8J A;  2PJH A;  1WXM A;  1T0Y A;  2AWT A;  2PPH A;  5DCN A;  2KQS A;  2BPS A;  4IM0 A;  5J17 A;  4D0N B;  1ZC3 B;  1Y8R C;  5JH5 C;  2KTR B;  1YQB A;  1AQC A;  3N7C A;  2DX5 A;  3APC A;  5J18 A;  1QQG A;  2I5F A;  1OMW A;  3E66 A;  4I6L B;  4DXA B;  5CTR C;  1KOT A;  4FLH A;  2GMI C;  4MY6 A;  2DX1 A;  1R4N I;  5D3X A;  4F8C B;  3VVW B;  1E5W A;  2ZEQ A;  2J0M A;  2JWZ A;  1WM3 A;  3R7Q A;  5G55 A;  2AEH A;  1WGU A;  2DYQ A;  4ILG B;  4JKD A;  2DLW A;  1Q5W B;  2MBO A;  2KKC A;  5E6N A;  1VCB A;  4HJK A;  2K25 A;  2C9W B;  2MQJ A;  3D32 A;  2G4S A;  2J0J A;  2L1C A;  5J3Q A;  4PNK A;  3PGE A;  2YF0 A;  5TR5 A;  2O2V A;  1NTI A;  2COA A;  2XEW A;  3Q3F A;  4Z2M B;  2Z0P A;  1V89 A;  5DPW A;  2GBN A;  4FJZ A;  1XX0 A;  2HTH B;  4KAX B;  1J0G A;  3R66 C;  2D2Q A;  3NZU A;  3JVZ X;  1PMS A;  3BJI A;  3NHE B;  1U5D A;  3IBE A;  5DPT A;  4G11 A;  2M14 A;  3QWM A;  2CY4 A;  2JXX A;  2MSE D;  1U5E A;  3JYU A;  2CU1 A;  4K7W A;  3QC8 B;  2FJL A;  3PEG A;  2C5L C;  3WAM A;  2MWN B;  4HB4 B;  3APF A;  2O2V B;  5GMV A;  4Y94 A;  5DHF B;  2LRW A;  2G45 B;  1WJN A;  3TJP A;  1V88 A;  1WGD A;  4KHB B;  3V62 A;  3FM8 C;  2FIF A;  2R0D A;  1WJM A;  3VH3 B;  2LBB A;  2LXC A;  3H7P A;  2DIK A;  4FA6 A;  4IUM B;  2BYE A;  2KWU B;  1ZGU B;  4G50 A;  2W2X C;  1WY8 A;  2GOW A;  3ONS A;  3VOQ A;  5J2R A;  1FHO A;  2DTC A;  1UBI A;  1LQB A;  4K2O A;  2R2O A;  4AJW A;  2IO1 B;  4ICV A;  1V5M A;  4GB9 A;  3TBL D;  1J19 A;  3AU4 A;  4LDT B;  2KLC A;  3D8D A;  4JKB A;  2NPT B;  3JSV B;  2P0D A;  4E3C A;  4E71 A;  3NSU A;  2D3G A;  3HM6 X;  4CO7 A;  1IRS A;  4PS3 A;  3TW1 A;  1J8C A;  3FEH A;  4DX9 0;  4PQ0 A;  3B0A A;  4WSF A;  2IFS A;  2CR5 A;  3UGB B;  3PRM B;  2MDX A;  3PG7 A;  2MA9 B;  1B55 A;  2LAS A;  5BO4 B;  1ZSQ A;  2MP2 A;  3VTU A;  5D3Y A;  3KRW A;  2K39 A;  2CRF A;  3PRP B;  4GDL A;  4AJY B;  4WWP A;  4IOY X;  4K81 A;  4JKH A;  3LJU X;  2DYN A;  3L17 A;  3WAP A;  2UZR A;  4W9L A;  4GDK A;  3AJ4 A;  3UQA A;  4GU2 A;  1BTK A;  2DFK A;  5DIF B;  3KZ1 A;  3ZO5 B;  3UQB A;  1WX8 A;  1DRO A;  2Y7B A;  4I6P A;  4MGY E;  3B08 A;  2P0H A;  1V86 A;  5HE0 A;  3PSE B;  1ZC4 B;  3QAQ A;  1U4A A;  4BKS A;  2KO3 A;  1Y5O A;  2D9V A;  2P0F A;  1P6S A;  2FUH B;  4ANV A;  4KDI C;  1C1Y B;  4EJN A;  4JQW C;  2D9X A;  3VHT C;  2YT1 A;  2K2U A;  3LJ3 A;  4B6H A;  1EO6 A;  3DXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...