4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
molecule keywords Merlin
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
2IFSA 2CR5A 1MPHA 2N9EB 1WZ3A 4NY0A 5G2NA 3ENEA 2JP2A 2COCA 2DN6A 3QAQA 1ZGUB 1LB1A 4HWIB 1KJTA 4MJSB 3DXCA 3H6NA 1UZXB 4ZRKA 1BTKA 1J0WA 4DWFA 3ZIMA 3U7DA 3M95A 2GMIC 5JHHA 2CHWA 3KSYA 1K8RB 2GCLA 2CY5A 3KVFB 2P0DA 4NQKE 3KYCD 4WWPA 2R2QA 5E6OA 5JP4A 4ZYNA 4LCDE 4ICVA 2EMSA 2ZZPB 2KXJA 2L8JA 3VQIA 2IO3B 1YIWA 4DBBA 2G4DB 4KIKA 4DHJD 3G9WA 3X23A 2K00A 2LKOA 2Z59B 5L83A 1XD4A 2V1YA 3DVNU 2BKRB 2KDBA 1RLFA 1SHCA 2HE7A 2I5CA 2GBRA 2LBBA 2JPHA 2MQJA 3PHXB 5J18A 4DHJB 4F7GA 3SV1A 3BY4B 1V5OA 3GYPA 1OGWA 3RZWC 2MWSB 5LLIA 2NVUI 2MP2A 1GUAB 2CU1A 3PP2A 3KYDD 1ZC3B 5KQ4A 1Z87A 3JVZX 5E6PA 5C5BA 4WSFA 5HE0A 2C60A 4DXAB 1E8ZA 3ZUNA 3NY5A 2DX1A 4GSWA 5KHOA 4FHJA 5HE3A 5KCVA 1E7UA 1LM8B 1WGUA 1UNRA 2K2JA 3L54A 3FEHA 4MGYE 3OJ3A 5LXIB 2DA0A 4A6FB 1WMHB 2CODA 3VTVA 1ZSQA 4A5KA 2R2OA 1FB8A 1V81A 4LJOB 4EZLA 1D3ZA 3I3TB 3KUDB 1E8YA 1XQQA 2GJYA 1YQBA 4HAYB 1WR6E 2NBUA 4G0NB 4PYUA 5DPSA 5KHQA 1L2NA 2GS0A 3ONSA 1X11A 3O65B 4J6IA 4MDKE 3F0WA 3HM6X 3V6CB 2L05A 3A33B 1GNUA 1WXMA 4HB3B 1ZVRA 2L0TA 1WYWB 3LJUX 2ZJDA 2MBOA 3QX1A 4RMAA 4BKTA 2K2UA 5JLJB 1QC6A 3SYXA 1JRUA 1Y5OA 1S3SG 4BKGA 3A1QB 4G50A 2I1KA 1WJ6A 3QWMA 3PRPB 1GC7A 1M7RA 3CSFA 4NQLB 5D3YA 4RM9A 1RRBA 1FGYA 4B9KA 1WM3A 1BWNA 2DX5B 2KDFB 2ZEQA 3QK0A 1TZ1A 1UELA 5LONB 5DPWA 3A9KA 1RJ2A 2P0FA 2GBNA 1Z5SB 4BFRA 4IC7B 2YT1A 3UIPB 2J0KA 4HATB 3AU5A 4MT7A 2DZIA 3GZNI 2MFQA 3ML9A 2KJ6A 5BO4B 2WH5A 1E90A 2VRRB 1WFYA 3PT2B 5D3WA 1KOTA 3DBRI 3FM8C 5D27A 1NDDA 3T9LA 4HJKA 3PLUA 2L00B 4HHVA 5D3XA 4HAVB 4IM0A 4FBJB 3PVLA 2RPQA 3TIXA 4HVBA 3Q3JA 2D9XA 3KZ1A 4A3PA 4H8SA 2KLGA 1ZM0A 1L7YA 2DENB 2N7EA 2LGYA 2NPTB 3CXBB 3JSVA 4MGKE 3V62A 3ZVVA 2EMTA 4MGIE 4EFOA 4MSQB 2CKHB 2M4NA 2IY1B 3ODXA 4NJ7A 2KZRA 5DCNA 3AI5A 3UF8A 2MW5A 1TJ6A 1LW3A 1EGXA 1EO6A 4X57B 2RVBB 4MGZE 3ZTCA 5EDSA 2LRUA 2V4LA 3VOQA 4Z2NA 3SDLC 1P3RA 2RSGA 1DYNA 1GG3A 3PVWA 2O2VA 4ICUA 3P7ZA 3TVVA 3IG3A 3RCZA 1ZKHA 4PS8A 3GYOA 1OEYJ 1YJ1A 2LYDA 3ZNGC 1NTIA 4URKA 2LGXA 2ZPNA 1XR0B 2PZ1A 4WJOA 2D10A 2IBIB 3SD5A 3MPXA 2AEHA 2OTXA 1EAZA 2JWZA 3L10B 3U30A 2QHOA 3PEGA 3UINB 1UPQA 1PLSA 4EJNA 1DROA 2ZNVB 3VIAA 1OY2A 1WGGA 2REXA 4NJ6A 5LXHA 5J2RA 4RM8A 1PFJA 4KAXB 1ZW7A 2PE6B 3SO6A 4KSLC 4OVUA 3RCPA 1EVHA 2WDTB 5D7GA 4XWXA 2D2QA 1ISNA 2O2VB 2QKLA 2LG1A 3NOBA 1TBEA 2AYOB 4NAWA 1Q67A 4JQWC 3SUZA 3BJIA 1WRDB 3UZTA 4MM3A 4M8MA 4XX5A 3WAMA 1WI1A 2OJRA 3PSCA 1PMSA 1V2YA 4IM2A 3ZNID 2ZCBA 4FJZA 2J0JA 4GMXB 2J59M 4BBKA 3PTFC 1U5DA 3ZTDA 2RUKB 1HB8A 4I6LB 4KDLB 3ZNHB 5IA7A 2Z0OA 3DQVA 1E8XA 2DHIA 2UVMA 1TTNA 3V61A 2KUPA 2HRJA 4IFSA 1P9DU 2LD9A 4K81A 1P1AA 1X1MA 1FHOA 2JT4B 4HAWB 3ZKJC 1X86A 2A4ZA 5D3VA 4II3B 2FIFA 3T8MA 3HW2B 3L13A 4IW0A 1B55A 3WIMA 1FHXA 5CX3A 1S1QB 1UNPA 4WWOA 2AL3A 3LDZE 4B95A 4CO7A 5FI0A 1IYFA 1H8CA 1WZ0A 4GN1A 4GMVA 2FAZA 2LUEA 2WYQA 1GC6A 3A1QA 2NZ8B 1BAKA 3QC8B 4M8NA 3DVGY 2KWUB 2DHJA 2IZVB 1MKEA 4YL8A 1MK7B 2D9YA 4MH0E 4DX90 1MK9B 4JL9A 3VUWA 4AUQC 5LOPB 3WANA 4HCNB 4HK2A 3A98B 1N3HA 3ZO5B 5J17A 1TQZA 5TR5A 1WJ1A 1C3TA 2IO1B 2DFKA 2I5FA 4TYZA 4ZRJA 1WGDA 2C7NB 3CIKA 5J3QA 4MELA 3AU4A 1KZ7A 2CRFA 4KHBB 2NPTA 3JSVB 3APCA 1QQGA 4HDQA 2LOXA 4WJPA 4MK0A 2N4FA 2R0DA 2KNBA 3KY9A 2MBEA 3QARA 5JHGA 3ZDTA 2BWES 3UIOB 2NBWB 1WGYA 2N9PC 2FCMA 3L08A 1I42A 2ROZB 2IO2B 2N7DA 3HHMA 2H7EA 2V76A 4KZ0A 5C23A 4LDTD 4BOSC 2EKEC 3B08A 3QJZA 1SGHA 3WYFB 2LVPA 4F8CB 3NZSA 4LJPB 5JH5C 2BKFA 4IWOA 4ZDVA 2KD0A 4GXBA 1MG8A 1Q5WB 1XT9B 4GDLB 3EFUA 2Q13A 3N3KB 4K7UA 2GBMA 4FADA 3NS8A 3VH3B 2LVOA 4E71A 4W9DA 2N1WA 3TBLD 1XX0A 3CMMB 1V61A 5FI1A 3AXCA 4FJYA 2KLCA 1OEYA 4EZJA 3AJ4A 1UD7A 4ANVA 2Y5BB 5HKHA 2L76A 2KHWB 1Y19B 2CAYA 1V88A 4HB2B 3H7SA 2YS1A 3QWZB 3PV1A 4IG7B 3ZRCA 2AL6A 1UGMA 1UPRA 2MBQA 2DYMA 3VUXA 2MDXA 2K25A 3ZW3A 1BT0A 3A4RA 2E2XA 2ELBA 2I1JA 1M94A 3N7CA 1V86A 3H1UA 4FLHA 1VCBA 4K1RB 4M0WB 1WH3A 2MRPA 1P6SA 4GU2A 4W9EA 4W9FA 1J8CA 1SIFA 3VAWA 5C16A 1NU2A 2DYBA 2IYDB 1DDWA 2UYZB 1Q0WB 4AWJA 3DVGX 1KZGA 2C5LC 4FN2A 4BBNF 2GBKA 2M17A 1SE9A 2ZCCA 5AZHA 2ADZA 1XCGA 2XK5B 2NMBA 2KTRA 3IHPC 4IWPA 5D2MB 5AZGA 4ANUA 2Y8GA 3TL5A 4AOFA 3IVFA 1U2BA 3NSUA 1WX7A 3KRXA 3DVNV 3DDCB 5AEKB 1LQBA 4CHJA 4B6HA 4BKSA 1C1YB 5DHFB 2BPSA 2MKRA 2LZ6A 4DK5A 4GB9A 2CB8A 2LOZA 4EZKA 4HLEA 2BYVE 2N9XA 1XODA 4A6FA 1WMHA 2JXXA 3GOEA 3VTWA 5JHAA 2C7HA 4KIKB 3A8PA 1HE8A 2UZSA 5KQ1A 2A5UA 2DAJA 3TW1A 4DHZE 3KW5B 2KVRA 1OTRB 2KANA 2KX0A 2DAFA 3W1SC 4BKSD 2EC1A 1H4RA 2KDIA 2DZKA 1ST7A 3Q3FA 4W9HA 2D07B 4K7WA 2JRHA 3OJ4B 2ZPYA 5G55A 3L16A 4CHKA 4WJNA 3MDBC 5DH9B 1V80A 2JF5A 1ACAA 1P0RA 4ASWC 1CMXB 2W9NA 3EPYA 2KGXB 2WWZA 3UQBA 2Y8FA 5GMVA 5CHFA 1W1HA 4MJSA 2JZZA 3ODOA 1RRPB 1EF5A 1K5DB 1RAXA 3C0RB 1X1GA 3M63B 2ZNVC 3P2BA 2MBHA 4TV3A 2LVQA 4EOYA 2VSZA 2DX5A 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 2IYBA 1DDMA 4HAUB 4NNJB 2DZMA 4W9LA 2MWNB 1J19A 1WJNA 2OOBB 4OVVA 3TO1A 2PPHA 3EHVA 4W9GA 4K2PA 4A20A 2XEWA 4AJYB 4E74A 2XK5A 1UH6A 2FDQA 2ELAA 2CQUA 3D8DA 1WR1A 2UWQA 4WWNA 3DOWA 1WIAA 1OQNA 3M1IB 2KMAA 2NBVB 3ODWA 4W9JA 2CY4A 2VRWB 3K9PB 4W9KA 3B1LX 3PS6A 3SNHA 1EUVB 4EKUA 1I7AA 1PQSA 3V6EB 2FIDA 1KI1B 4DHZB 4IUMB 1W1DA 4PS3A 4L6EA 2N1VA 4K7SA 3W1YA 4NAWB 1WI0A 3DXDA 3OLMD 2KFKB 2JVCA 3VDZA 4HDOA 5C5BB 3PHWB 2MCNB 2L2IA 4FHKA 2Z0DB 2YS3A 3WALA 1NBFC 3APDA 4G11A 3WAOA 2UZRA 1R4NI 1HBKA 1H10A 3QQ8B 3P6AA 1AWEA 2CHXA 1MIZB 2NR2A 3MJWA 3N32A 2X18A 2BYFA 1LFDA 2M1MA 3PGEA 1I35A 3VH4B 3ULCA 2D9VA 3FLVA 1V6EA 2C7MB 5J3YA 1FHWA 2HD5B 4MEMA 2WX1A 2D9WA 4EMOA 2LASA 2HTHB 2RGNB 3SU8X 3ZVRA 1V5UA 1E8WA 1YX5B 2RSUA 4ZRIA 1BTNA 4TQ1A 5DPRA 4EUTA 2RQ1A 2DKPA 4HPMB 3VFKA 2EJ8A 3QA8A 4K2OA 1WXVA 5IAAC 1AARA 2G35A 2DYOA 2YF0A 3HQCA 4A6HA 2GOWA 4FA6A 1WJUA 2NS5A 2CS4A 1DBHA 1UBQA 4E3CA 1FXTB 2W2WA 3M3JA 2KJHB 3ZRFA 3DBHI 4HCPB 4ANXA 3PG7A 1P98A 2LULA 4HB0B 2JUOA 2KKCA 3ML8A 4II2B 1ZC4B 3RD2A 2FCQA 2KOXA 2KO3A 1K5GB 3OAWA 2ABDA 5L81A 2K1FA 2BF8B 4BVUC 3PRMB 3A9JA 1W1GA 4TQ0A 3ML4A 4CYEA 2DLWA 2LGDA 3UGBB 2KDEB 3NZUA 3QHTA 4MSMB 2KC2A 1U5GA 4GDKB 1IPGA 3M62B 5CHVC 1HB6A 1I2HA 2PJHA 1NTYA 2L3ZA 4NPNA 5C1ZA 1DDVA 5HE1A 3QCAA 4KZCA 2L1CA 3D8EA 2MP2B 2LXCA 2KJRA 4A6KA 1X1FA 1F9JA 4NSWA 2YRYA 3TFMA 2MX2A 4GPTB 4IOYX 4MY6A 2BCJA 3DBSA 1E5WA 2YSZA 1WXAA 1TGZB 2IY0B 2K8CA 2N23A 3KRWA 2HJ8A 1WE7A 4WQOB 1TXDA 1WJ4A 2J7QB 3CSTA 3A8QA 4I6PA 4N9F4 4FJVB 4GGQA 5C79A 3SHQA 2M38A 1KM7A 2WX0A 3LJ3A 2O6VB 1Y8RC 2KWVB 1WVHA 2RGFA 3RYTA 2P8VA 3MHSD 3QIJA 4W9IA 3ULBA 3FSSA 2KQSA 3R3MA 4W9CA 2LXAA 4BOZB 4F7ZA 2COPA 2D11A 1FAOA 5DHAB 3H9DA 2DHZA 3VXWA 2PEAA 2MBBB 1WF9A 2BYEA 3HIZA 2DTCA 2JY6A 4JLCA 1OQYA 4KV2A 1NI2A 2NCNA 1XKEA 1V5MA 3RULA 3PRZA 2JZ3B 3QBVB 3CF6E 5CHWA 5FR6A 4HPLB 4IM3A 2ZVOA 1WM2A 3L17A 3V60A 1V9JA 4KHAA 5HE2A 2FJLA 3U8ZA 2RNRB 4WVFB 3DPDA 5JHBA 3UQAA 5CLQB 4D0NB 2GBJA 2G4SA 5DPTA 1A5RA 3K9OB 1EF1A 5D94A 3WA0A 3DBLI 2D9ZA 1G6JA 3EECA 2M0XA 4F7HA 4I6NB 2K8HA 4YONA 5AZFA 3IBEA 2YS5A 4GDKA 2R09A 4PNKA 3H7PB 3RZFA 1XD3B 2H7DA 2ROVA 3TMPB 1UNQA 4HXDA 3KUZA 3RT3B 1MIXA 4BBNC 2PE9A 4B6WA 4DBGA 3PSEB 2DKQA 2Z0QA 1YX6B 3FP5A 2L7RA 1V5PA 2Z0PA 3NHEB 2COAA 2KMCA 4HAZB 2K39A 2M14A 2W2XC 3AULA 3PZDA 4LDTB 4TUUA 1R4MI 4A3OA 4F1SA 5GOWB 2BGFA 5CTRC 4DX8A 4AJWA 4WJ7A 2GCJA 1WX8A 1X05A 3R66C 1P3QU 2O6VD 5EFXA 4JIOU 1WGRA 2CHZA 2DHKA 2DYQA 4KHOA 2G45B 2KK8A 4IAPA 3EC8A 3MTNB 3H7PA 3VTUA 1T0YA 1V5TA 3VVWB 2AWTA 1WGQA 4ANWA 4DDID 1E7VA 2KX3A 4IWQA 2KFKA 1V89A 2OQBA 1OMWA 5DI9B 2IO0B 2KC1A 3DCGA 4KDIC 3WAPA 2M8SA 2V3SA 4GZUA 1WE6A 3A9JB 3BINA 4JGHB 2D3GA 2G3QB 2N0YA 2LWPA 3APFA 2YVCA 2B3AA 1NVLA 4Y94A 5CLLB 2Z0EB 1FGZA 4CHMA 2W2XD 3O96A 1MAIA 5E6NA 2VKIA 3D32A 3HM3A 3W1SA 3PVUA 1IRSA 1NTVA 3N30A 2K6QA 2LRWA 2KQ7A 3X0WA 1WXSA 5J3TA 2YT0A 1UBIA 2BWFA 2KTFA 2MSED 4GDLA 3RUIB 2K8BA 3VHTC 3A4SC 2FUHB 1U27A 2L0FA 4PS7A 5C6RA 5JZEB 1QZEA 3VUYA 2RLOA 2FJ9A 2P0HA 3V5WA 3JW0X 5IJMA 3PPAA 4P7IA 2DYNA 4XZ4A 4AP4C 4K17A 3PREA 2KCJA 2K6DB 2RR9A 2RD0A 4HB4B 5DIFB 1U4AA 1J0GA 2ASQA 4EEWA 2JRIB 1FOEA 4XC2A 3S2AA 2J0MA 1U5FA 3TJPA 4F7UP 3KUCB 3ZNZB 1WJMA 2KWCA 3OANA 4GOCA 2KN5A 3D8FA 5D6JB 1LXDA 4PQ0A 2MA9B 2ZVNA 3TCAA 3DXEA 1UEFA 2D4QA 2HTHA 3ECIA 5L95C 4TKNA 2LI5A 1AQCA 2FNJB 3ALBA 1YD8U 2YLMA 1WX9A 3HK0A 2FCNA 3PLVA 1U5EA 3L0WB 3F5RA 1KLVA 1P5TA 4PYZA 4FULA 1WGHA 1Q1OA 4C0AA 3KH0A 3A9KB 4Z2MB 3R7RA 1VD2A 1RFAA 2QKMA 1U29A 2COFA 2XQNM 2FCSA 3JYUA 3B0AA 4WAAA 4WJQA 3ZDMC 2LJ5A 4KSKC 4HAXB 2KTRB 3ZLZA 1WG7A 1V49A 4DDGD 1M7EA 2Y7BA 1Z2MA 2DZJA 2KFJA 3IFWB 2O6VA 4G3XB 1IP9A 1GJZA 1WY8A 3T06A
chains in the Genus database with same CATH superfamily
4YSZB 3SBTA 1WZ3A 2JP2A 2QC8A 4MJSB 1L4DB 4NQKE 3KYCD 2R2QA 1I4QA 5JP4A 4RF0A 2L8JA 1JWUD 2FE8A 4KIKA 3Q3NC 3DVNU 2BKRB 4JKHA 2KDBA 1RLFA 2I5CA 1Y56A 2LBBA 4H2AA 3W2DA 3GYPA 1OGWA 2K3UA 2NVUI 2KACA 1JCKB 2CU1A 3SU8X 2LHEA 3JVZX 4WSFA 5HE0A 4FHJA 5KCVA 1AN8A 1UNRA 3KWVA 1WMHB 2CODA 1FB8A 4LJOB 3I3TB 3KUDB 1YQBA 3T3NA 3MC0B 1FNUA 1GNUA 1K53A 3QX1A 4IKGA 2MBOA 2K2UA 1S3SG 2WDQB 2I1KA 2IJ0A 1M7RA 3CSFA 4NQLB 4RGNA 4B9KA 1FGYA 5LONB 1RJ2A 3I63C 3C8YA 2YT1A 3UIPB 3AU5A 2DZIA 2KJ6A 5BO4B 1T6BX 3BK2A 1FEHA 2WXFA 3DCXA 5BYSA 4HHVA 1L7YA 2DENB 3JSVA 2N7EA 1ROEA 4MGKE 3CXBB 1EO6A 3ZTCA 2JYEA 3EFCA 4A9AA 2RSGA 3TVVA 3IG3A 1ACCA 1OEYJ 1C79A 4URKA 3GZNB 4WJOA 3SD5A 4GOUA 3MPXA 4C4VA 3ZJUA 3L10B 4JKAA 1T0RC 1PLSA 2JX5A 2X0SA 1DROA 1BMLC 1WWTA 5J2RA 4NJ6A 1PFJA 3SO6A 2WDTB 2CU3A 3NWFA 2D2QA 2O2VB 4MACA 2LG1A 2AYOB 4M8MA 3UZTA 2Y5PA 3WAMA 1WI1A 4JK7A 1F0ZA 2J59M 1L0XB 1U5DA 1HB8A 4R3DA 2SAKA 2M0AA 5BMHA 1A70A 1L6VA 1TTNA 2LD9A 4K81A 1P1AA 2JT4B 4HAWB 1WRIA 3ZKJC 3L13A 4IW0A 4YTPB 1ZUD2 1UNPA 4B95A 1E0ZA 4GMVA 3DVGY 2X8XX 4AUQC 5LOPB 1YQ4B 1CJEA 3NWAA 2IO1B 2DFKA 4RGTA 4ZRJA 3CIKA 3JSVB 4ACFA 3APCA 4WJPA 3QARA 2R0DA 3WCQA 5JHGA 3ZDTA 2BWES 3DBRB 2N9PC 3L08A 2ROZB 2N7DA 2H7EA 2V76A 4LDTD 4RNAA 4BOSC 2EKEC 4IWOA 1XT9B 1YJJA 1KLUD 5D3IB 2N1WA 2GI9A 2EELA 4EZJA 5HKHA 1LO5D 1UD7A 4ANVA 3E56A 1Y19B 1V88A 2YS1A 2Z14A 3PV1A 1OQRA 1UPRA 4C80A 1ZOYB 2ELBA 4M0WB 2MRPA 3I5JC 1QF6A 5C16A 4AWJA 3DVGX 3DBLB 2CJNA 2GBKA 2M17A 1SE9A 1F2RI 3NVYA 3E9PA 2Y8GA 1FM0D 3TL5A 3IVFA 1U2BA 1WX7A 3DDCB 1LQBA 4B6HA 2BPSA 2MKRA 2LZ6A 1KRHA 1L0YB 1XODA 3GOEA 4KIKB 3A8PA 2UZSA 1TS2A 2KX0A 2DAFA 1NEKB 2D07B 3OJ4B 4ASWC 5DH9B 1V80A 1RM6C 1CMXB 2KGXB 3UQBA 3ODOA 1K5DB 1RAXA 4WIPA 3O13A 4OT1A 4NNJB 4RCOA 2DZMA 2MWNB 4LK0M 2FUG1 4K2PA 1EU3A 2XK5A 2FDQA 3D8DA 1HXYD 2N0SB 2KMAA 1YN5A 3B1LX 3PS6A 3SNHA 2DLBA 3V6EB 5LG4B 4L6EA 4KGRA 2B76B 3DXDA 3PHWB 4FHKA 1J7CA 1ZDVA 1VR9A 5HHDG 3QQ8B 3P6AA 3MJWA 1MIZB 3AE9B 2LMCA 2D9VA 5HG2A 1V6EA 3CIRB 1VJKA 1FHWA 1D5MC 2HD5B 2HTHB 3I57A 2KDMA 2RSUA 1N62A 4TQ1A 1BTNA 1GB4A 2EJ8A 3QA8A 1DYQA 1AARA 1QT9A 1SEBD 1WJUA 3FILA 4E3CA 2W2WA 2KJHB 3PG7A 1P98A 2XN9C 1SE3A 2KOXA 3V05A 4UDUC 2W55A 1MI0A 3A9JA 1C9FA 4TQ0A 2DIKA 2WU5B 1YOVB 2KC2A 2AQ3B 4RF1A 1I4PA 1D4BA 1D5XC 3QCAA 1SE2A 4JKGA 1X1FA 2YRYA 3TFMA 1R4MB 2OJWA 5I2SA 2BCJA 2AQ1B 2IY0B 3KRWA 3MFGA 5C2TB 1KF6B 5G5HA 4FJVB 4GGQA 3LJ3A 2O6VB 2H88B 1YN3A 4BOZB 3ULBA 2R2YA 3H9DA 2BYEA 4JLCA 2JY6A 2N7JA 3PRZA 4IM3A 1V9JA 4KHAA 5HE2A 3I9V1 2GBJA 1A5RA 3K9OB 2WXLA 3WA0A 1I4RA 1K52A 4F7HA 4I6NB 2K8HA 5AZFA 2L32A 3ZJTA 3DBHB 4KX6B 4BBNC 2PE9A 3Q8BA 2Z0QA 1I4XA 1QKZA 1MHHE 2KAJA 3Q14C 2KMCA 2M14A 4LDTB 5GOWB 2BGFA 5CTRC 4DX8A 2Z4DA 4WJ7A 2PIAA 1FCLA 2QSDA 1NI3A 2DYQA 2IDYA 3H7PA 1XCQL 3AEGB 4DDID 1E7VA 2BS3B 2W82A 4CQNA 5DI9B 2IO0B 1XLQA 2VZKD 2V3SA 4GZUA 3A9JB 3BINA 4JGHB 4JE3B 2N0YA 1TS5A 5CLLB 4XWTA 5E6NA 3D32A 3RNAC 2J42A 3X0WA 2BWFA 4A8XC 3VHTC 3A4SC 5FKAC 4PS7A 5C6RA 3VUYA 4RFBA 5M4YB 5IJMA 4IOIE 2DYNA 4AP4C 3PREA 2KCJA 4RGMA 2ASQA 2JRIB 4QXAB 1FOEA 3KUCB 1WJMA 3OANA 4GOCA 3D8FA 4M0WA 4PQ0A 2MA9B 2KT7A 3AEBB 5L95C 1SSNA 2LI5A 3U7ZA 1AQCA 2GRIA 3DWMA 1EWYC 1Q1OA 3KH0A 1HA5A 1RFAA 2COFA 4JK9A 4WAAA 2VZKB 4HAXB 4B0EA 1GJZA 1Z2MA 3IFWB 1XLPA 2O6VA 1TS3A 1EU4A 2IFSA 2DN6A 4US9A 1ZGUB 1LB1A 3BZDB 1UZXB 4ZRKA 1BTKA 1J0WA 4DWFA 3VRBB 3M95A 2GCLA 2CY5A 1N60A 4YSXB 5E6OA 2EMSA 2BT6A 1YIWA 4DBBA 1I4GA 2G4DB 2YEPB 4DHJD 3G9WA 2K00A 3SBGA 2PLPA 3P4QB 4P6VF 3PHXB 2GBRA 1JWBD 4F7GA 3BY4B 2WXHA 2M19A 1J7AA 4YSYB 1QOBA 2MP2A 3PP2A 3KYDD 3ZUNA 5FK9C 4GSWA 5KHOA 3AH7A 3RNFC 1TZOA 3L54A 2RDHA 2K2JA 3FEHA 1V8CA 4A5KA 2R2OA 1E8YA 1XQQA 2GJYA 5KHQA 4PYUA 3ONSA 4J6IA 3F0WA 3HM6X 3A33B 5G2NA 3NJTA 1WYWB 3LJUX 1ZE3D 4P1BC 4LNNA 4BKTA 1Y5OA 3A1QB 4G50A 1B1ZA 1WXQA 2Y3AA 1GC7A 5D3YA 1SBBB 3QK0A 1TZ1A 3EUB2 1T3QA 2P0FA 4HKQA 1L6UA 2WXMA 2J0KA 4HATB 3NRZA 2V0GA 3ML9A 3P4SB 4USAA 1K51A 1E90A 2VRRB 3URYA 3FM8C 5D27A 1FRDA 1ET9A 4HAVB 3W5UB 3PVLA 3Q3JA 4H8SA 2KLGA 3AE3B 2BS2B 2LGYA 3V62A 2EMTA 3E9LA 4MSQB 2M4NA 2IY1B 2KZRA 3AI5A 1TJ6A 1UWMA 3HVDA 2NBVA 1ESFA 1P3RA 1HTOA 4PS8A 4Q2JA 2GUMA 3ZNGC 1YJ1A 1V1OA 3E9SA 5C3JB 1VZ8A 1RFKA 3C19A 3NWDA 5EE9A 2OTXA 1EAZA 3VIAA 1JALA 2REXA 5LXHA 3AEEB 2BYTA 4KAXB 4KSLC 3LYYA 3RCPA 4L2YA 1EVHA 4S17A 5D7GA 4XWXA 2QKLA 1TBEA 1Q67A 1NYQA 4DIXA 3ZQ4A 3IAS1 2BTEA 4FJZA 1FO4A 4BBKA 5IA7A 2HRJA 2QCZA 1X1MA 3T8MA 3RNCC 3RN9C 4JWUC 1B55A 1FHXA 4WWOA 2AL3A 2H89B 3LDZE 2LUEA 1GC6A 2NZ8B 1F2RC 1GOZA 1C78A 1MK7B 4DX90 3BYTB 1TKGA 3WANA 4HCNB 3A98B 1TQZA 1M4VA 1WGDA 4MELA 4KHBB 1PGAA 3NVWA 5BYQA 3KY9A 4C7ZA 1ZXHA 1WGYA 2FCMA 2IO2B 3HHMA 2JSVX 1KBLA 3AM9A 5C23A 4F8CB 3NZSA 5JH5C 2BKFA 3Q3OC 3TUOA 1MG8A 1Q5WB 4K7UA 4FADA 2GBMA 2ONQA 2WXGA 3P1MA 4E71A 3UI3A 1XX0A 3AXCA 5FI1A 4FJYA 1OEYA 2LFIA 3Q3MC 3ZRCA 3QWZB 1UGMA 3GB1A 2K25A 2E2XA 1M94A 4ZRQA 3Q8EA 1WH3A 4N59A 4W9EA 1GPXA 2NTTA 2DYBA 1BUIC 1JDEA 1KZGA 4P16A 4BBNF 3B2FA 5AZHA 2ADZA 2XK5B 4IWPA 4ANUA 2UU7A 5AEKB 4CHJA 3MP9A 2Z13A 1NENB 2PKOA 1TKYA 4DK5A 1PDXA 3TEWA 2BYVE 2N9XA 4A6FA 2JXXA 3HIEA 3VTWA 5JHAA 5MPOA 3MHZA 2A5UA 3TW1A 4DHZE 3KW5B 2KIGA 1YN4A 2KVRA 2L83A 4K3CA 1H4RA 2JRHA 3BIID 4HKZE 4WJNA 2G1EA 1ACAA 3EPYA 5CHFA 2JZZA 3ZXRA 2ZNVC 3P2BA 2LVQA 2VSZA 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 2WLBA 2IYBA 4HAUB 1XF5L 1TT5B 2OOBB 4A20A 2MJDA 2PPHA 3EHVA 1KFYB 4E74A 1ZXIA 1UH6A 1WYGA 2CQUA 1WIAA 3B9JA 2CY4A 3K9PB 5JVLA 1JMLA 2NTSA 3R8BA 1EM7A 4DHZB 3Q6BA 4PS3A 4K7SA 1BXTA 3SR6A 2JVCA 4NZLB 2PMVA 2UZRA 1FMAD 2KIEA 1STEA 2BYFA 1LFDA 3VH4B 3ULCA 3PO0A 3FLVA 4O1NA 3RFZB 4JKCA 4MEMA 2WX1A 2LASA 1T0QC 2RGNB 4OW0A 1YX5B 4EUTA 1VBHA 4K2OA 2G35A 2DYOA 2V9HA 2GOWA 4XYCA 3Q2AC 1KH0A 1UBQA 3ZRFA 2OHFA 4MH8A 5HFYA 3N9YC 2D5GA 4ANXA 4II2B 3RD2A 2KKCA 3OAWA 2ABDA 5L81A 4BVUC 2BB5A 3PRMB 1XLOA 1W1GA 2DLWA 2LGDA 4ILHA 2KDEB 1U5GA 5CHVC 1IPGA 2WNMA 3M62B 3RPFC 1I2HA 1FXIA 1NTYA 3D8EA 3B77A 4NAMA 4MY6A 1OFFA 4M02A 3A58A 2K8CA 3GP7A 1J7BA 1CQVA 1YMHE 2HJ8A 4WQOB 2MJ3A 1TXDA 2J7QB 2QJLA 2WU2B 4BAXA 2M38A 1KM7A 1SB3C 1Y8RC 3VH3B 3RNEC 2MEKA 1AWDA 2COPA 2D11A 1FAOA 4MM3B 3VXWA 2DHZA 2MBBB 1WF9A 4DXGA 2DTCA 3R2TA 4KV2A 2BW2A 5FR6A 2LGSA 2ZVOA 3U8ZA 3UQAA 4WURA 2G4SA 5DPTA 5D94A 4ZRPA 2D9ZA 3EECA 2M0XA 3W9CB 2YS5A 3RZFA 1UGJA 4ZOHC 3U2SC 2H7DA 2ROVA 4HXDA 3KUZA 3RT3B 4B6WA 4DBGA 2IGDA 2L7RA 1V5PA 2VH1A 4ILGB 3AULA 3ABVB 4TUUA 2N9KA 2E6XA 3TSSA 2GCJA 5I2MA 3R66C 1P3QU 2O6VD 2G45B 2MHJA 1T0YA 1V5TA 4ANWA 1F52A 2Q5WD 2OQBA 3DCGA 2IPKD 1QOAA 2M8SA 2D3GA 2LWPA 4JPSA 2B3AA 1NVLA 2Z0EB 2NMQA 4CHMA 2W2XD 3O96A 1MAIA 2VKIA 4JWSC 3PVUA 2K6QA 2KQ7A 3BVZA 3P4PB 2WXIA 5J3TA 2YT0A 3RUIB 1OQQA 2K8BA 2L0FA 2LHDA 2X38A 5I4DA 5JZEB 1QZEA 2FJ9A 3PPAA 2N9LA 2K6DB 2K0PA 1KC7A 3BYYB 3HSAA 4XC2A 3ENBA 3ZGZA 3OWEB 4F7UP 3ZNZB 2KN5A 4JKBA 3TCAA 5TSSA 1V1PB 4TKNA 1JWAD 1YD8U 1P5TA 4PYZA 4FULA 3LXFA 1WGHA 4JKEA 4QJ3B 1FNWA 2XQNM 2FCSA 1HTQA 4WJQA 2LJ5A 4KSKC 1JQ4A 3J9CA 2KTRB 1WG7A 1V49A 1M7EA 1IP9A 4G3XB 4US8A 1FFVA 1N63A 2KYWA 3ENEA 2V3PA 2J52A 3QAQA 2EKIA 2WQYB 2QMTA 5H8YE 4YTNB 5IN7A 2CHWA 2YT2A 1K8RB 4WQMA 2P0DA 4WWPA 4WWMA 4WH4A 1VZ6A 2ZZPB 2IO3B 4ARIA 3X23A 2Z59B 2LKOA 5L83A 1XD4A 2HE7A 2JPHA 2MQJA 1I4HA 2K8EA 4JKGB 4ZHPA 5C5BA 1E8ZA 3NY5A 1LM8B 2WS3B 1WGUA 2JXTA 3CWIA 3OJ3A 1SF0A 2DA0A 4A6FB 2J53A 1ZSQA 1V81A 4G0NB 2WXJA 4HAYB 1WR6E 2GS0A 4XDCA 1WXMA 1ZVRA 2ZJDA 4A6QA 5JLJB 1QC6A 3SYXA 1QOGA 2HJ1A 1WJ6A 3QWMA 3FC4A 4RM9A 2ZEQA 2DX5B 3NW8A 4D2KA 3PZ7A 1UELA 4M01A 1Z5SB 2XNAC 4HRSA 5IOIA 4MT7A 3KLSX 3AMZA 2WH5A 1YQ3B 3PT2B 1KOTA 5D3WA 3DBRI 3FVCA 3T9LA 2L00B 5D3XA 1JROA 4IM0A 4M00A 3TIXA 4HVBA 1FFUA 1SJHD 2JWUA 4JKFA 4A3PA 2WXQA 2YEPF 4NJ7A 3MC8A 3UF8A 1LW3A 2LRUA 2V4LA 1FD6A 4Z2NA 2FBWB 1DYNA 1GG3A 2O2VA 3P7ZA 4PK1A 1NTIA 2LGXA 3NZ3A 1XR0B 1XO3A 2D10A 2AEHA 1TYGB 3U30A 4YWGG 1UPQA 2ZNVB 1OY2A 4RM8A 2PE6B 5DCNA 4NAWA 3SUZA 3BJIA 1WRDB 4AJWA 4MM3A 4ITKA 4YXDB 4AQ7A 3PSCA 4HJGE 1PMSA 3ZNID 4IDIA 1ZP0B 4GMXB 3PTFC 3ZTDA 2RUKB 3ZNHB 4KDLB 5AUIA 2Z0OA 3EA6A 2DHIA 1DGJA 2UVMA 3V61A 3VRAB 2GB1A 1FHOA 1E10A 3ZXVA 4II3B 2A4ZA 5D3VA 1C4CA 2FIFA 4PT5A 5BYRA 1K50A 2RRFA 1S1QB 1H8CA 4CO7A 2Y5CA 3IT4B 4GN1A 4GLSC 1KLVA 4XGAB 1BAKA 4M8NA 1HEZE 2IZVB 1MKEA 3VUWA 4JL9A 3ZO5B 1P7EA 1WJ1A 1C3TA 3GE3C 2Z8LA 4TYZA 3AV8A 3AU4A 1KZ7A 5IP4D 2PW9A 2LOXA 3DHIC 1EWCA 2NBWB 3AE8B 2V4IB 4TSSA 1L5PA 4KZ0A 3QJZA 3TEXA 4QJ5B 4ZDVA 2KD0A 4GXBA 1ZPSA 3EFUA 2Q13A 3N3KB 5LNK1 3NS8A 2LVOA 4W9DA 5BMGA 3TBLD 4DQOC 3CMMB 3AJ4A 2Y5BB 2L76A 1VRAB 4HB2B 3RNGC 2AL6A 2DYMA 2MDXA 3ZW3A 1V86A 4K1RB 2K5PA 4GU2A 4W9FA 3SFEB 3VAWA 1DDWA 1FNVA 3BK1A 2C5LC 1C76A 2ZCCA 3IHPC 5D2MB 5AZGA 4RGOS 3P63A 3NSUA 3KRXA 4C7YA 4BKSA 1QLBB 2CB8A 2LOZA 1QQRA 4HLEA 2DBYA 1HE8A 1ET6A 2KANA 3U52E 2W54A 3W1SC 2KDIA 3Q3FA 1ST7A 1IBXA 4K7WA 5G55A 3L16A 3MDBC 2FJUB 2W9NA 2WWZA 2Y8FA 1JW9D 1W1HA 4MJSA 1EF5A 3C0RB 1X1GA 3M63B 4ILJA 2MBHA 1MHXA 2V3NA 3RNBC 1DDMA 1WJNA 4OVVA 4AJYB 5T8IA 1WR1A 1YJIA 2NBVB 4W9JA 2VRWB 4MT5A 1TY0A 3AEAB 4EKUA 4IUMB 1XCTL 5IKCM 1NVID 3W1YA 4NAWB 1WI0A 3OLMD 2KFKB 1VLBA 2OEDA 3VDZA 5C5BB 3WALA 2L2IA 2YS3A 1NBFC 3APDA 4G11A 1C4AA 3WAOA 1R4NI 1H10A 3N32A 1AWEA 2CHXA 2NR2A 1I35A 2KUQA 3PGEA 2M1MA 3Q8AA 1SIJA 2HTME 1I7HA 1V1PA 3N1ZC 5G5GA 3ZVRA 1V5UA 1E8WA 5DPRA 4ZRIA 1FRRA 1KLGD 1Q10A 1XXGA 4HPMB 4N58A 2BBCA 1ZYIA 1V97A 3VR9B 4A6HA 3P42A 4FA6A 2NS5A 1DBHA 4KKJA 3DBHI 4HCPB 1GGOA 2JU6X 3ML8A 1ZC4B 4ARCA 2FCQA 1SE4A 3ML4A 4CYEA 4MSMB 1YNTE 1HB6A 2TSSA 4NPNA 5C1ZA 1DDVA 5HE1A 4KZCA 1MG4A 2LXCA 4A6KA 3NVZA 2QIEB 3TEYA 4NSWA 3R2IA 2MX2A 2BQQA 1E5WA 1WXAA 1TGZB 1E7PB 4LNFA 2N23A 1WJ4A 3CSTA 1SJED 4I6PA 4N9F4 4OSNA 5C79A 3SHQA 2RGFA 1WVHA 2P8VA 4W9CA 3QIJA 4W9IA 3R3MA 1J8CA 4HSIA 2L52A 1AYFA 5DHAB 2PEAA 1HZ5A 3HIZA 3TEZA 1OQYA 1NI2A 2NCNA 1XKEA 4A55A 5CHWA 4QAYA 4HPLB 1WM2A 2FJLA 4WVFB 3DPDA 5CLQB 1EF1A 3DBLI 2M56B 1ZDXA 4C00A 4YONA 4GDKA 4RH6A 4PNKA 1R7SA 4OHJA 1XD3B 3TMPB 4C56C 3AEDB 1MIXA 3PSEB 1YX6B 3NHEB 2COAA 5LXIB 4XDDA 3AE5B 1X05A 1PYWD 4JKDA 4JIOU 5EFXA 2CHZA 2KK8A 4IAPA 3VTUA 3VVWB 2AWTA 2KFKA 2KC1A 4KDIC 5FR3A 1MVKA 3WAPA 1WE6A 1C77A 2G3QB 3AE2B 3B2GA 2YVCA 2D3AA 4Y94A 1FGZA 3Q8CA 3W1SA 1UUPA 3GS2A 3HVZA 1IRSA 3N30A 2LRWA 4NJCA 1UBIA 2KTFA 2MSED 4GDLA 4GNKB 2JQRB 2FUHB 1U27A 4L23A 2J4XA 3NVVA 2IGGA 2HDEA 1C4PA 2P0HA 4K17A 2RD0A 4XWWA 5EE3A 5H92C 5DIFB 4L1BA 1XEEA 4EEWA 3S2AA 1U5FA 2ZKMX 3TJPA 2KWCA 2ZVNA 2INNE 2LJIA 3DXEA 2WXNA 1UEFA 2HTHA 3ECIA 1QOFA 4D6WA 4OZAA 4S0RA 3PLVA 2YLMA 1WX9A 1U5EA 2CJOA 3F5RA 4XE0A 2K22A 4Z2MB 3W5VB 1MPEA 1T77A 1VD2A 3JYUA 5IO9A 3B0AA 3ZDMC 1N5XA 1N6ZA 1FPYA 3T06A 4ZHOA 4KGTA 2CR5A 1MPHA 2N9EB 4NY0A 2QDFA 2COCA 4HWIB 1KJTA 4OVZA 3DXCA 1F1HA 2JYTA 3H6NA 3ZIMA 3U7DA 3RI7C 2GMIC 5JHHA 3KSYA 1VBGA 1MFWA 3BWUD 3KVFB 1NYRA 2BVCA 4ZYNA 3AE6B 4LCDE 2AQ2B 2RPVA 4ICVA 2KXJA 3VQIA 2V1YA 1SHCA 5J18A 4DHJB 3SV1A 1V5OA 3MC9A 3RZWC 2MWSB 5LLIA 2Z59A 1GUAB 4A90A 4DDGD 1ZC3B 5KQ4A 1Z87A 5E6PA 2C60A 4DXAB 2DX1A 5HE3A 1E7UA 2RDGA 4MGYE 1AW7A 2KR0A 3VTVA 1D3ZA 4YTMB 4EZLA 2NBUA 5DPSA 1ENFA 4K3BA 1X11A 3O65B 4MDKE 3V6CB 2L05A 2L0TA 4HB3B 1DIKA 2JZPA 4RMAA 4HROA 4BKGA 2BS4B 1JRUA 1IGDA 3PRPB 3NG0A 1RRBA 1WGKA 1WM3A 1BWNA 2KDFB 2AX5A 5DPWA 3SFDB 1RWSA 3A9KA 2GBNA 4BFRA 4IC7B 2ACZB 3GZNI 2MFQA 3E66A 1WFYA 3LB8C 5JXVA 3T3OA 1NDDA 4FBJB 4HJKA 3PLUA 2RPQA 2D9XA 3KZ1A 1ZM0A 2NPTB 1JRPA 3ZVVA 4MGIE 4EFOA 2CKHB 3ODXA 3SEBA 4JK8A 2MW5A 1EGXA 4X57B 2RVBB 4MGZE 5EDSA 1D6EC 3VOQA 2KN4A 1GAQB 3SDLC 3PVWA 4C4VB 4ICUA 1JWMD 3RCZA 1ZKHA 3GYOA 2LYDA 2ZPNA 3FKYA 2PZ1A 1PFDA 2IBIB 3ZYYX 2JWZA 1FIQA 2QHOA 3PEGA 3UINB 4EJNA 1UWXA 3L4PA 1WGGA 1ZW7A 4OVUA 2DNFA 2VH2A 1ISNA 1DOXA 3HRDD 3NOBA 2LEKA 4JQWC 2LUMA 4XX5A 2OJRA 1V2YA 4IM2A 2ZCBA 2J0JA 1E9MA 2RMMA 4I6LB 3DQVA 1E8XA 3IXSA 2KUPA 4IFSA 1P9DU 4N6EB 1FXAA 3BVMA 1PGBA 2SEBD 1X86A 3HW2B 3WIMA 5CX3A 2PVGC 1IYFA 5FI0A 1WZ0A 3APFA 2FAZA 2WYQA 3A1QA 3QC8B 2KWUB 1CZPA 2DHJA 5BMIA 5GXGB 4YL8A 2D9YA 3DHHC 4MH0E 1MK9B 4EE2A 2KMMA 4HK2A 1N3HA 5J17A 5TR5A 4KGSA 2I5FA 2C7NB 5J3QA 2CRFA 1JWSD 2NPTA 3V3XA 1QQGA 4HDQA 1TJEA 4MK0A 2N4FA 2KNBA 2MH7A 2MBEA 2W3SA 2E3TA 2W3RA 1HQRD 3UIOB 5EE1A 1GB1A 1I42A 3B08A 1SGHA 3WYFB 2LVPA 4LJPB 2INCC 3GE8C 1LGRA 4GDLB 1WSPA 1V61A 2IGHA 2KLCA 4KHBA 1VZ7A 1IBXB 2KHWB 2CAYA 3H7SA 4IG7B 2K9XA 2MBQA 3VUXA 1BT0A 3A4RA 1PGXA 3H1UA 2I1JA 4FLHA 3N7CA 4DXFA 1VCBA 1P6SA 2LGIA 1SIFA 4FXCA 1NU2A 2IYDB 2UYZB 2KVZA 3RMKC 1Q0WB 5D3DA 1HZ6A 4FN2A 4OZCA 2WDVB 1IGCA 1XCGA 2NMBA 2KTRA 1QILA 4AOFA 4OZBA 3DVNV 2ON8A 1C1YB 5DHFB 3AEFB 1VDVA 4GB9A 4EZKA 1WMHA 3AE1B 4LNKA 2BB6A 2C7HA 1FCCC 5KQ1A 2DAJA 1OTRB 1IUEA 4BKSD 2EC1A 2DZKA 4W9HA 4CHKA 2ZPYA 4TMAB 2JF5A 2I2YA 4REZA 1P0RA 3NUHB 5GMVA 2K49A 4BZAA 3HUIA 1RRPB 3AECB 2MJEA 3PZ8A 4TV3A 5IRSA 4EOYA 2DX5A 2G9HD 2QEJC 3IT6B 1T5XD 4W9LA 1J19A 3TO1A 4W9GA 2XEWA 2I38A 4LNOA 2ELAA 1F77A 2UWQA 4WWNA 3DOWA 1OQNA 3M1IB 3ODWA 3AB5A 4W9KA 4LTUA 1EUVB 1I7AA 1PQSA 2WXOA 4KKIA 2FIDA 1KI1B 3N1XC 4P1CC 1W1DA 4WAFA 2N1VA 4ZYSA 2PVOD 1P7FA 4HDOA 2MCNB 3E9OA 2Z0DB 2D3BA 1HBKA 1MI1A 3OHMB 2WXPA 2X18A 1MJDA 1D5ZC 1N61A 2C7MB 2DWQA 5HI1A 5J3YA 2D9WA 4EMOA 2R82A 3FILB 5AUKA 2RQ1A 2DKPA 3VFKA 1E6EB 1UNSA 1WXVA 3MJ5A 5IAAC 3KWLA 2YF0A 3HQCA 2CS4A 1FXTB 3M3JA 2LULA 4HB0B 2JUOA 3DHGC 2KO3A 1K5GB 2K1FA 2GLSA 2BF8B 1KTKA 3UGBB 3NZUA 3QHTA 4GDKB 4QJ4B 2PJHA 3OG5A 2L3ZA 2D3CA 4LLGM 2L1CA 3P4RB 2MP2B 3H8HA 2KJRA 2ICIA 1F9JA 2WGSA 4GPTB 4IOYX 3DBSA 2YSZA 3U4EG 2KWDA 1WE7A 3A8QA 3Q8FA 1TS4A 2WX0A 3RYTA 2KWVB 3MHSD 2KQSA 3FSSA 2LXAA 3IAM1 3NS1A 3VR8B 3RULA 1V5MA 2JZ3B 3QBVB 3CF6E 3V60A 3L17A 2WHIA 1SXTA 2RNRB 5JHBA 1CK1A 4D0NB 2KQ4X 1T0SC 2QILA 2ZW1A 1G6JA 1TY2A 3AE4B 2INDC 1DOIA 4YT0B 1R4NB 3IBEA 3ZJVA 4L1RA 3AE7B 2R09A 3H7PB 3DWGC 4HEA1 1UNQA 5E6JA 2DKQA 3FP5A 2Z0PA 1N5WA 4HAZB 2K39A 3N20C 2W2XC 4A3OA 3PZDA 4HPPA 4F1SA 1R4MI 4AS1A 3N1YC 1WX8A 2PTLA 1WGRA 2WDRB 2DHKA 4KHOA 2L1AA 3EC8A 3MTNB 4CSQA 1WGQA 2KX3A 4IWQA 3EGRA 1V89A 1OMWA 3KQ4A 1RYJA 2R61A 2ZW0A 3U12A 1TKEA 3HM3A 2INPE 3FAHA 1NTVA 4LNIA 1WXSA 1UF0A 1XLNA 2WXRA 3BVGA 1PUTA 2WXKA 2RLOA 3V5WA 3JW0X 4P7IA 4XZ4A 2RR9A 4JX1C 4HB4B 1U4AA 1J0GA 2J0MA 1L4ZB 5D6JB 1LXDA 2D4QA 3Q69A 4J3OD 2RDBC 1DOYA 2FNJB 3ALBA 2FCNA 3HK0A 3ETRA 3L0WB 1L0VB 4B0MA 4C0AA 3A9KB 3AN1A 3R7RA 1B9RA 2QKMA 1U29A 2WP9B 5EE0A 3ZLZA 2Y7BA 2DZJA 2KFJA 4F7ZA 1L2NA 1TIFA 1WY8A
chains in the Genus database with same CATH topology
3SBTA 1WZ3A 2JP2A 4MJSB 4NQKE 3KYCD 2R2QA 5JP4A 2L8JA 4KIKA 3DVNU 2BKRB 4JKHA 2KDBA 1RLFA 2I5CA 2LBBA 3GYPA 1OGWA 2NVUI 2CU1A 3SU8X 3JVZX 4WSFA 5HE0A 4FHJA 5KCVA 1UNRA 1WMHB 2CODA 1FB8A 4LJOB 3I3TB 3KUDB 1YQBA 1GNUA 3QX1A 2MBOA 2K2UA 1S3SG 2I1KA 1M7RA 3CSFA 4NQLB 4B9KA 1FGYA 5LONB 1RJ2A 2YT1A 3UIPB 3AU5A 2DZIA 2KJ6A 5BO4B 4HHVA 1L7YA 2DENB 3JSVA 2N7EA 4MGKE 3CXBB 1EO6A 3ZTCA 2RSGA 3TVVA 3IG3A 1OEYJ 4URKA 4WJOA 3SD5A 3MPXA 3L10B 4JKAA 1PLSA 2X0SA 1DROA 5J2RA 4NJ6A 1PFJA 3SO6A 2WDTB 2D2QA 2O2VB 2LG1A 2AYOB 4M8MA 3UZTA 3WAMA 1WI1A 4JK7A 2J59M 1U5DA 1HB8A 1TTNA 2LD9A 4K81A 1P1AA 2JT4B 4HAWB 3ZKJC 3L13A 4IW0A 1UNPA 4B95A 4GMVA 3DVGY 4AUQC 5LOPB 2IO1B 2DFKA 4ZRJA 3CIKA 3JSVB 3APCA 4WJPA 3QARA 2R0DA 5JHGA 3ZDTA 2BWES 2N9PC 3L08A 2ROZB 2N7DA 2H7EA 2V76A 4LDTD 4BOSC 2EKEC 4IWOA 1XT9B 2N1WA 4EZJA 5HKHA 1UD7A 4ANVA 1Y19B 1V88A 2YS1A 3PV1A 1UPRA 2ELBA 4M0WB 2MRPA 5C16A 4AWJA 3DVGX 2GBKA 2M17A 1SE9A 3E9PA 2Y8GA 3TL5A 3IVFA 1U2BA 1WX7A 3DDCB 1LQBA 4B6HA 2BPSA 2MKRA 2LZ6A 1XODA 3GOEA 4KIKB 3A8PA 2UZSA 2KX0A 2DAFA 2D07B 3OJ4B 4ASWC 5DH9B 1V80A 1CMXB 2KGXB 3UQBA 3ODOA 1K5DB 1RAXA 4NNJB 2DZMA 2MWNB 4K2PA 2XK5A 2FDQA 3D8DA 2KMAA 3B1LX 3PS6A 3SNHA 3V6EB 4L6EA 3DXDA 3PHWB 4FHKA 3QQ8B 3P6AA 3MJWA 1MIZB 2D9VA 1V6EA 1FHWA 2HD5B 2HTHB 2RSUA 4TQ1A 1BTNA 2EJ8A 3QA8A 1AARA 1WJUA 4E3CA 2W2WA 2KJHB 3PG7A 1P98A 2KOXA 3A9JA 4TQ0A 2DIKA 2KC2A 3QCAA 4JKGA 1X1FA 2YRYA 3TFMA 2BCJA 2IY0B 3KRWA 4FJVB 4GGQA 3LJ3A 2O6VB 4BOZB 3ULBA 3H9DA 2BYEA 4JLCA 2JY6A 3PRZA 4IM3A 1V9JA 4KHAA 5HE2A 2GBJA 1A5RA 3K9OB 3WA0A 4F7HA 4I6NB 2K8HA 5AZFA 4BBNC 2PE9A 2Z0QA 2KMCA 2M14A 4LDTB 5GOWB 2BGFA 5CTRC 4DX8A 4WJ7A 2DYQA 3H7PA 4DDID 1E7VA 5DI9B 2IO0B 2V3SA 4GZUA 3A9JB 3BINA 4JGHB 2N0YA 5CLLB 5E6NA 3D32A 3X0WA 2BWFA 3VHTC 3A4SC 4PS7A 5C6RA 3VUYA 5IJMA 2DYNA 4AP4C 3PREA 2KCJA 2ASQA 2JRIB 1FOEA 3KUCB 1WJMA 3OANA 4GOCA 3D8FA 4PQ0A 2MA9B 5L95C 2LI5A 1AQCA 1Q1OA 3KH0A 1RFAA 2COFA 4JK9A 4WAAA 4HAXB 1GJZA 1Z2MA 3IFWB 2O6VA 2IFSA 2DN6A 1ZGUB 1LB1A 1UZXB 4ZRKA 1BTKA 1J0WA 4DWFA 3M95A 2GCLA 2CY5A 5E6OA 2EMSA 1YIWA 4DBBA 2G4DB 4DHJD 3G9WA 2K00A 3SBGA 3PHXB 2GBRA 4F7GA 3BY4B 2MP2A 3PP2A 3KYDD 3ZUNA 4GSWA 5KHOA 3L54A 2K2JA 3FEHA 4A5KA 2R2OA 1E8YA 1XQQA 2GJYA 5KHQA 4PYUA 3ONSA 4J6IA 3F0WA 3HM6X 3A33B 5G2NA 1WYWB 3LJUX 4BKTA 1Y5OA 3A1QB 4G50A 1GC7A 5D3YA 3QK0A 1TZ1A 2P0FA 2J0KA 4HATB 3ML9A 1E90A 2VRRB 3FM8C 5D27A 4HAVB 3PVLA 3Q3JA 4H8SA 2KLGA 2LGYA 3V62A 2EMTA 3E9LA 4MSQB 2M4NA 2IY1B 2KZRA 3AI5A 1TJ6A 1P3RA 4PS8A 3ZNGC 1YJ1A 2OTXA 1EAZA 3VIAA 2REXA 5LXHA 4KAXB 4KSLC 3RCPA 1EVHA 5D7GA 4XWXA 2QKLA 1TBEA 1Q67A 4FJZA 4BBKA 5IA7A 2HRJA 1X1MA 3T8MA 1B55A 1FHXA 4WWOA 2AL3A 3LDZE 2LUEA 1GC6A 2NZ8B 1MK7B 4DX90 3WANA 4HCNB 3A98B 1TQZA 1WGDA 4MELA 4KHBB 3KY9A 1WGYA 2FCMA 2IO2B 3HHMA 1KBLA 5C23A 4F8CB 3NZSA 5JH5C 2BKFA 1MG8A 1Q5WB 4K7UA 4FADA 2GBMA 4E71A 1XX0A 3AXCA 5FI1A 4FJYA 1OEYA 3ZRCA 3QWZB 1UGMA 2K25A 2E2XA 1M94A 1WH3A 4W9EA 2DYBA 1JDEA 1KZGA 4BBNF 5AZHA 2ADZA 2XK5B 4IWPA 4ANUA 5AEKB 4CHJA 4DK5A 2BYVE 2N9XA 4A6FA 2JXXA 5JHAA 3VTWA 2A5UA 3TW1A 4DHZE 3KW5B 2KVRA 1H4RA 2JRHA 4WJNA 1ACAA 3EPYA 5CHFA 2JZZA 2ZNVC 3P2BA 2LVQA 2VSZA 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 2IYBA 4HAUB 2OOBB 4A20A 2PPHA 3EHVA 4E74A 1UH6A 2CQUA 1WIAA 2CY4A 3K9PB 5JVLA 4DHZB 4PS3A 4K7SA 2JVCA 2UZRA 2BYFA 1LFDA 3VH4B 3ULCA 3FLVA 4JKCA 4MEMA 2WX1A 2LASA 2RGNB 1YX5B 4EUTA 1VBHA 4K2OA 2G35A 2DYOA 2GOWA 1UBQA 3ZRFA 4ANXA 4II2B 3RD2A 2KKCA 3OAWA 2ABDA 5L81A 4BVUC 3PRMB 1W1GA 2DLWA 2LGDA 4ILHA 2KDEB 1U5GA 5CHVC 1IPGA 3M62B 1I2HA 1NTYA 3D8EA 4MY6A 2K8CA 2HJ8A 4WQOB 1TXDA 2J7QB 2M38A 1KM7A 1Y8RC 3VH3B 2COPA 2D11A 1FAOA 3VXWA 2DHZA 2MBBB 1WF9A 2DTCA 4KV2A 5FR6A 2ZVOA 3U8ZA 3UQAA 2G4SA 5DPTA 5D94A 2D9ZA 3EECA 2M0XA 2YS5A 3RZFA 2H7DA 2ROVA 4HXDA 3KUZA 3RT3B 4B6WA 4DBGA 2L7RA 1V5PA 4ILGB 3AULA 4TUUA 2GCJA 3R66C 1P3QU 2O6VD 2G45B 1T0YA 1V5TA 4ANWA 2OQBA 3DCGA 2M8SA 2D3GA 2LWPA 2B3AA 1NVLA 2Z0EB 4CHMA 2W2XD 3O96A 1MAIA 2VKIA 3PVUA 2K6QA 2KQ7A 5J3TA 2YT0A 3RUIB 2K8BA 2L0FA 5JZEB 1QZEA 2FJ9A 3PPAA 2K6DB 1KC7A 4XC2A 3ENBA 4F7UP 3ZNZB 2KN5A 4JKBA 3TCAA 4TKNA 1YD8U 1P5TA 4PYZA 4FULA 1WGHA 4JKEA 2XQNM 2FCSA 4WJQA 2LJ5A 4KSKC 2KTRB 1WG7A 1V49A 1M7EA 1IP9A 4G3XB 3ENEA 3QAQA 2CHWA 1K8RB 4WWPA 2P0DA 2ZZPB 2IO3B 3X23A 2Z59B 2LKOA 5L83A 1XD4A 2HE7A 2JPHA 2MQJA 4JKGB 5C5BA 1E8ZA 3NY5A 1LM8B 1WGUA 3OJ3A 2DA0A 4A6FB 1ZSQA 1V81A 4G0NB 4HAYB 1WR6E 2GS0A 1WXMA 1ZVRA 2ZJDA 5JLJB 1QC6A 3SYXA 1WJ6A 3QWMA 4RM9A 2ZEQA 2DX5B 1UELA 1Z5SB 4MT7A 2WH5A 3PT2B 1KOTA 5D3WA 3DBRI 3T9LA 2L00B 5D3XA 4IM0A 3TIXA 4HVBA 4JKFA 4A3PA 4NJ7A 3UF8A 1LW3A 2LRUA 2V4LA 4Z2NA 1DYNA 1GG3A 2O2VA 3P7ZA 1NTIA 2LGXA 1XR0B 2D10A 2AEHA 3U30A 1UPQA 2ZNVB 1OY2A 4RM8A 2PE6B 5DCNA 4NAWA 3SUZA 3BJIA 1WRDB 4AJWA 4MM3A 3PSCA 1PMSA 3ZNID 4GMXB 3PTFC 3ZTDA 2RUKB 3ZNHB 4KDLB 2Z0OA 2DHIA 2UVMA 3V61A 1FHOA 4II3B 2A4ZA 5D3VA 2FIFA 1S1QB 1H8CA 4CO7A 4GN1A 1KLVA 1BAKA 4M8NA 2IZVB 1MKEA 3VUWA 4JL9A 3ZO5B 1WJ1A 1C3TA 4TYZA 3AU4A 1KZ7A 2LOXA 2NBWB 4KZ0A 3QJZA 4ZDVA 2KD0A 4GXBA 3EFUA 2Q13A 3N3KB 3NS8A 2LVOA 4W9DA 3TBLD 3CMMB 3AJ4A 2Y5BB 2L76A 4HB2B 2AL6A 2DYMA 2MDXA 3ZW3A 1V86A 4K1RB 4GU2A 4W9FA 3VAWA 1DDWA 2C5LC 2ZCCA 3IHPC 5D2MB 5AZGA 3NSUA 3KRXA 4BKSA 2CB8A 2LOZA 4HLEA 1HE8A 2KANA 3W1SC 2KDIA 3Q3FA 1ST7A 4K7WA 5G55A 3L16A 3MDBC 2W9NA 2WWZA 2Y8FA 1W1HA 4MJSA 1EF5A 3C0RB 1X1GA 3M63B 4ILJA 2MBHA 1DDMA 1WJNA 4OVVA 4AJYB 1WR1A 2NBVB 4W9JA 2VRWB 4EKUA 4IUMB 3W1YA 4NAWB 1WI0A 3OLMD 2KFKB 3VDZA 5C5BB 3WALA 2L2IA 2YS3A 1NBFC 3APDA 4G11A 3WAOA 1R4NI 1H10A 3N32A 1AWEA 2CHXA 2NR2A 1I35A 3PGEA 2M1MA 3ZVRA 1V5UA 1E8WA 5DPRA 4ZRIA 4HPMB 4A6HA 4FA6A 2NS5A 1DBHA 3DBHI 4HCPB 1GGOA 3ML8A 1ZC4B 2FCQA 3ML4A 4CYEA 4MSMB 1HB6A 4NPNA 5C1ZA 1DDVA 5HE1A 4KZCA 2LXCA 4A6KA 4NSWA 2MX2A 1E5WA 1WXAA 1TGZB 2N23A 1WJ4A 3CSTA 4I6PA 4N9F4 5C79A 3SHQA 2RGFA 1WVHA 2P8VA 1J8CA 3QIJA 4W9IA 3R3MA 4W9CA 5DHAB 2PEAA 3HIZA 1OQYA 1NI2A 2NCNA 1XKEA 5CHWA 4HPLB 1WM2A 2FJLA 4WVFB 3DPDA 5CLQB 1EF1A 3DBLI 4YONA 4GDKA 4PNKA 1XD3B 3TMPB 1MIXA 3PSEB 1YX6B 3NHEB 2COAA 5LXIB 1X05A 4JKDA 4JIOU 5EFXA 2CHZA 2KK8A 4IAPA 3VTUA 3VVWB 2AWTA 2KFKA 2KC1A 4KDIC 3WAPA 1WE6A 2G3QB 2YVCA 4Y94A 1FGZA 3W1SA 1IRSA 3N30A 2LRWA 1UBIA 2KTFA 2MSED 4GDLA 2FUHB 1U27A 2P0HA 4K17A 2RD0A 5DIFB 4EEWA 3S2AA 1U5FA 3TJPA 2KWCA 2ZVNA 3DXEA 1UEFA 2HTHA 3ECIA 3PLVA 2YLMA 1WX9A 1U5EA 3F5RA 4Z2MB 1VD2A 3JYUA 3B0AA 3ZDMC 3T06A 2CR5A 1MPHA 2N9EB 4NY0A 2COCA 4HWIB 1KJTA 3DXCA 3H6NA 3ZIMA 3U7DA 2GMIC 5JHHA 3KSYA 1VBGA 3KVFB 4ZYNA 4LCDE 4ICVA 2KXJA 3VQIA 2V1YA 1SHCA 5J18A 4DHJB 3SV1A 1V5OA 3RZWC 2MWSB 5LLIA 1GUAB 4DDGD 1ZC3B 5KQ4A 1Z87A 5E6PA 2C60A 4DXAB 2DX1A 5HE3A 1E7UA 4MGYE 3VTVA 1D3ZA 4EZLA 2NBUA 5DPSA 1X11A 3O65B 4MDKE 3V6CB 2L05A 2L0TA 4HB3B 1DIKA 4RMAA 4BKGA 1JRUA 3PRPB 1RRBA 1WM3A 1BWNA 2KDFB 5DPWA 3A9KA 2GBNA 4BFRA 4IC7B 3GZNI 2MFQA 3E66A 1WFYA 1NDDA 4FBJB 4HJKA 3PLUA 2RPQA 2D9XA 3KZ1A 1ZM0A 2NPTB 3ZVVA 4MGIE 4EFOA 2CKHB 3ODXA 4JK8A 2MW5A 1EGXA 4X57B 2RVBB 4MGZE 5EDSA 3VOQA 3SDLC 3PVWA 4ICUA 3RCZA 1ZKHA 3GYOA 2LYDA 2ZPNA 2PZ1A 2IBIB 2JWZA 2QHOA 3PEGA 3UINB 4EJNA 1WGGA 1ZW7A 4OVUA 1ISNA 3NOBA 4JQWC 4XX5A 2OJRA 1V2YA 4IM2A 2ZCBA 2J0JA 4I6LB 3DQVA 1E8XA 2KUPA 4IFSA 1P9DU 1X86A 3HW2B 3WIMA 5CX3A 1IYFA 5FI0A 1WZ0A 3APFA 2FAZA 2WYQA 3A1QA 3QC8B 2KWUB 2DHJA 4YL8A 2D9YA 4MH0E 1MK9B 4HK2A 5J17A 1N3HA 5TR5A 2I5FA 2C7NB 5J3QA 2CRFA 2NPTA 1QQGA 4HDQA 4MK0A 2N4FA 2KNBA 2MBEA 3UIOB 1I42A 3B08A 1SGHA 3WYFB 2LVPA 4LJPB 4GDLB 1V61A 2KLCA 2KHWB 2CAYA 3H7SA 4IG7B 2MBQA 3VUXA 1BT0A 3A4RA 3H1UA 2I1JA 4FLHA 3N7CA 1VCBA 1P6SA 1SIFA 1NU2A 2IYDB 2UYZB 1Q0WB 4FN2A 1XCGA 2NMBA 2KTRA 4AOFA 3DVNV 1C1YB 5DHFB 4GB9A 4EZKA 1WMHA 2C7HA 5KQ1A 2DAJA 1OTRB 4BKSD 2EC1A 2DZKA 4W9HA 4CHKA 2ZPYA 2JF5A 1P0RA 5GMVA 1RRPB 4TV3A 4EOYA 2DX5A 4W9LA 1J19A 3TO1A 4W9GA 2XEWA 2ELAA 2UWQA 4WWNA 3DOWA 1OQNA 3M1IB 3ODWA 4W9KA 1EUVB 1I7AA 1PQSA 2FIDA 1KI1B 1W1DA 2N1VA 4HDOA 2MCNB 3E9OA 2Z0DB 1HBKA 2X18A 2C7MB 5J3YA 2D9WA 4EMOA 2R82A 2RQ1A 2DKPA 3VFKA 1WXVA 5IAAC 2YF0A 3HQCA 2CS4A 1FXTB 3M3JA 2LULA 4HB0B 2JUOA 2KO3A 1K5GB 2K1FA 2BF8B 3UGBB 3NZUA 3QHTA 4GDKB 2PJHA 2L3ZA 2L1CA 2MP2B 2KJRA 1F9JA 4GPTB 4IOYX 3DBSA 2YSZA 1WE7A 3A8QA 2WX0A 3RYTA 2KWVB 3MHSD 2KQSA 3FSSA 2LXAA 3RULA 1V5MA 2JZ3B 3QBVB 3CF6E 3V60A 3L17A 2RNRB 5JHBA 4D0NB 1G6JA 3IBEA 2R09A 3H7PB 1UNQA 2DKQA 3FP5A 2Z0PA 4HAZB 2K39A 4F1SA 2W2XC 4A3OA 3PZDA 1R4MI 1WX8A 1WGRA 2DHKA 4KHOA 3EC8A 3MTNB 1WGQA 2KX3A 4IWQA 1V89A 1OMWA 3HM3A 1NTVA 1WXSA 2RLOA 3V5WA 3JW0X 4P7IA 4XZ4A 2RR9A 4HB4B 1U4AA 1J0GA 2J0MA 5D6JB 1LXDA 2D4QA 2FNJB 3ALBA 2FCNA 3HK0A 3L0WB 4C0AA 3A9KB 3R7RA 2QKMA 1U29A 3ZLZA 2Y7BA 2DZJA 2KFJA 4F7ZA 1L2NA 1WY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFS A;  2CR5 A;  1MPH A;  2N9E B;  1WZ3 A;  4NY0 A;  5G2N A;  3ENE A;  2JP2 A;  2COC A;  2DN6 A;  3QAQ A;  1ZGU B;  1LB1 A;  4HWI B;  1KJT A;  4MJS B;  3DXC A;  3H6N A;  1UZX B;  4ZRK A;  1BTK A;  1J0W A;  4DWF A;  3ZIM A;  3U7D A;  3M95 A;  2GMI C;  5JHH A;  2CHW A;  3KSY A;  1K8R B;  2GCL A;  2CY5 A;  3KVF B;  2P0D A;  4NQK E;  3KYC D;  4WWP A;  2R2Q A;  5E6O A;  5JP4 A;  4ZYN A;  4LCD E;  4ICV A;  2EMS A;  2ZZP B;  2KXJ A;  2L8J A;  3VQI A;  2IO3 B;  1YIW A;  4DBB A;  2G4D B;  4KIK A;  4DHJ D;  3G9W A;  3X23 A;  2K00 A;  2LKO A;  2Z59 B;  5L83 A;  1XD4 A;  2V1Y A;  3DVN U;  2BKR B;  2KDB A;  1RLF A;  1SHC A;  2HE7 A;  2I5C A;  2GBR A;  2LBB A;  2JPH A;  2MQJ A;  3PHX B;  5J18 A;  4DHJ B;  4F7G A;  3SV1 A;  3BY4 B;  1V5O A;  3GYP A;  1OGW A;  3RZW C;  2MWS B;  5LLI A;  2NVU I;  2MP2 A;  1GUA B;  2CU1 A;  3PP2 A;  3KYD D;  1ZC3 B;  5KQ4 A;  1Z87 A;  3JVZ X;  5E6P A;  5C5B A;  4WSF A;  5HE0 A;  2C60 A;  4DXA B;  1E8Z A;  3ZUN A;  3NY5 A;  2DX1 A;  4GSW A;  5KHO A;  4FHJ A;  5HE3 A;  5KCV A;  1E7U A;  1LM8 B;  1WGU A;  1UNR A;  2K2J A;  3L54 A;  3FEH A;  4MGY E;  3OJ3 A;  5LXI B;  2DA0 A;  4A6F B;  1WMH B;  2COD A;  3VTV A;  1ZSQ A;  4A5K A;  2R2O A;  1FB8 A;  1V81 A;  4LJO B;  4EZL A;  1D3Z A;  3I3T B;  3KUD B;  1E8Y A;  1XQQ A;  2GJY A;  1YQB A;  4HAY B;  1WR6 E;  2NBU A;  4G0N B;  4PYU A;  5DPS A;  5KHQ A;  1L2N A;  2GS0 A;  3ONS A;  1X11 A;  3O65 B;  4J6I A;  4MDK E;  3F0W A;  3HM6 X;  3V6C B;  2L05 A;  3A33 B;  1GNU A;  1WXM A;  4HB3 B;  1ZVR A;  2L0T A;  1WYW B;  3LJU X;  2ZJD A;  2MBO A;  3QX1 A;  4RMA A;  4BKT A;  2K2U A;  5JLJ B;  1QC6 A;  3SYX A;  1JRU A;  1Y5O A;  1S3S G;  4BKG A;  3A1Q B;  4G50 A;  2I1K A;  1WJ6 A;  3QWM A;  3PRP B;  1GC7 A;  1M7R A;  3CSF A;  4NQL B;  5D3Y A;  4RM9 A;  1RRB A;  1FGY A;  4B9K A;  1WM3 A;  1BWN A;  2DX5 B;  2KDF B;  2ZEQ A;  3QK0 A;  1TZ1 A;  1UEL A;  5LON B;  5DPW A;  3A9K A;  1RJ2 A;  2P0F A;  2GBN A;  1Z5S B;  4BFR A;  4IC7 B;  2YT1 A;  3UIP B;  2J0K A;  4HAT B;  3AU5 A;  4MT7 A;  2DZI A;  3GZN I;  2MFQ A;  3ML9 A;  2KJ6 A;  5BO4 B;  2WH5 A;  1E90 A;  2VRR B;  1WFY A;  3PT2 B;  5D3W A;  1KOT A;  3DBR I;  3FM8 C;  5D27 A;  1NDD A;  3T9L A;  4HJK A;  3PLU A;  2L00 B;  4HHV A;  5D3X A;  4HAV B;  4IM0 A;  4FBJ B;  3PVL A;  2RPQ A;  3TIX A;  4HVB A;  3Q3J A;  2D9X A;  3KZ1 A;  4A3P A;  4H8S A;  2KLG A;  1ZM0 A;  1L7Y A;  2DEN B;  2N7E A;  2LGY A;  2NPT B;  3CXB B;  3JSV A;  4MGK E;  3V62 A;  3ZVV A;  2EMT A;  4MGI E;  4EFO A;  4MSQ B;  2CKH B;  2M4N A;  2IY1 B;  3ODX A;  4NJ7 A;  2KZR A;  5DCN A;  3AI5 A;  3UF8 A;  2MW5 A;  1TJ6 A;  1LW3 A;  1EGX A;  1EO6 A;  4X57 B;  2RVB B;  4MGZ E;  3ZTC A;  5EDS A;  2LRU A;  2V4L A;  3VOQ A;  4Z2N A;  3SDL C;  1P3R A;  2RSG A;  1DYN A;  1GG3 A;  3PVW A;  2O2V A;  4ICU A;  3P7Z A;  3TVV A;  3IG3 A;  3RCZ A;  1ZKH A;  4PS8 A;  3GYO A;  1OEY J;  1YJ1 A;  2LYD A;  3ZNG C;  1NTI A;  4URK A;  2LGX A;  2ZPN A;  1XR0 B;  2PZ1 A;  4WJO A;  2D10 A;  2IBI B;  3SD5 A;  3MPX A;  2AEH A;  2OTX A;  1EAZ A;  2JWZ A;  3L10 B;  3U30 A;  2QHO A;  3PEG A;  3UIN B;  1UPQ A;  1PLS A;  4EJN A;  1DRO A;  2ZNV B;  3VIA A;  1OY2 A;  1WGG A;  2REX A;  4NJ6 A;  5LXH A;  5J2R A;  4RM8 A;  1PFJ A;  4KAX B;  1ZW7 A;  2PE6 B;  3SO6 A;  4KSL C;  4OVU A;  3RCP A;  1EVH A;  2WDT B;  5D7G A;  4XWX A;  2D2Q A;  1ISN A;  2O2V B;  2QKL A;  2LG1 A;  3NOB A;  1TBE A;  2AYO B;  4NAW A;  1Q67 A;  4JQW C;  3SUZ A;  3BJI A;  1WRD B;  3UZT A;  4MM3 A;  4M8M A;  4XX5 A;  3WAM A;  1WI1 A;  2OJR A;  3PSC A;  1PMS A;  1V2Y A;  4IM2 A;  3ZNI D;  2ZCB A;  4FJZ A;  2J0J A;  4GMX B;  2J59 M;  4BBK A;  3PTF C;  1U5D A;  3ZTD A;  2RUK B;  1HB8 A;  4I6L B;  4KDL B;  3ZNH B;  5IA7 A;  2Z0O A;  3DQV A;  1E8X A;  2DHI A;  2UVM A;  1TTN A;  3V61 A;  2KUP A;  2HRJ A;  4IFS A;  1P9D U;  2LD9 A;  4K81 A;  1P1A A;  1X1M A;  1FHO A;  2JT4 B;  4HAW B;  3ZKJ C;  1X86 A;  2A4Z A;  5D3V A;  4II3 B;  2FIF A;  3T8M A;  3HW2 B;  3L13 A;  4IW0 A;  1B55 A;  3WIM A;  1FHX A;  5CX3 A;  1S1Q B;  1UNP A;  4WWO A;  2AL3 A;  3LDZ E;  4B95 A;  4CO7 A;  5FI0 A;  1IYF A;  1H8C A;  1WZ0 A;  4GN1 A;  4GMV A;  2FAZ A;  2LUE A;  2WYQ A;  1GC6 A;  3A1Q A;  2NZ8 B;  1BAK A;  3QC8 B;  4M8N A;  3DVG Y;  2KWU B;  2DHJ A;  2IZV B;  1MKE A;  4YL8 A;  1MK7 B;  2D9Y A;  4MH0 E;  4DX9 0;  1MK9 B;  4JL9 A;  3VUW A;  4AUQ C;  5LOP B;  3WAN A;  4HCN B;  4HK2 A;  3A98 B;  1N3H A;  3ZO5 B;  5J17 A;  1TQZ A;  5TR5 A;  1WJ1 A;  1C3T A;  2IO1 B;  2DFK A;  2I5F A;  4TYZ A;  4ZRJ A;  1WGD A;  2C7N B;  3CIK A;  5J3Q A;  4MEL A;  3AU4 A;  1KZ7 A;  2CRF A;  4KHB B;  2NPT A;  3JSV B;  3APC A;  1QQG A;  4HDQ A;  2LOX A;  4WJP A;  4MK0 A;  2N4F A;  2R0D A;  2KNB A;  3KY9 A;  2MBE A;  3QAR A;  5JHG A;  3ZDT A;  2BWE S;  3UIO B;  2NBW B;  1WGY A;  2N9P C;  2FCM A;  3L08 A;  1I42 A;  2ROZ B;  2IO2 B;  2N7D A;  3HHM A;  2H7E A;  2V76 A;  4KZ0 A;  5C23 A;  4LDT D;  4BOS C;  2EKE C;  3B08 A;  3QJZ A;  1SGH A;  3WYF B;  2LVP A;  4F8C B;  3NZS A;  4LJP B;  5JH5 C;  2BKF A;  4IWO A;  4ZDV A;  2KD0 A;  4GXB A;  1MG8 A;  1Q5W B;  1XT9 B;  4GDL B;  3EFU A;  2Q13 A;  3N3K B;  4K7U A;  2GBM A;  4FAD A;  3NS8 A;  3VH3 B;  2LVO A;  4E71 A;  4W9D A;  2N1W A;  3TBL D;  1XX0 A;  3CMM B;  1V61 A;  5FI1 A;  3AXC A;  4FJY A;  2KLC A;  1OEY A;  4EZJ A;  3AJ4 A;  1UD7 A;  4ANV A;  2Y5B B;  5HKH A;  2L76 A;  2KHW B;  1Y19 B;  2CAY A;  1V88 A;  4HB2 B;  3H7S A;  2YS1 A;  3QWZ B;  3PV1 A;  4IG7 B;  3ZRC A;  2AL6 A;  1UGM A;  1UPR A;  2MBQ A;  2DYM A;  3VUX A;  2MDX A;  2K25 A;  3ZW3 A;  1BT0 A;  3A4R A;  2E2X A;  2ELB A;  2I1J A;  1M94 A;  3N7C A;  1V86 A;  3H1U A;  4FLH A;  1VCB A;  4K1R B;  4M0W B;  1WH3 A;  2MRP A;  1P6S A;  4GU2 A;  4W9E A;  4W9F A;  1J8C A;  1SIF A;  3VAW A;  5C16 A;  1NU2 A;  2DYB A;  2IYD B;  1DDW A;  2UYZ B;  1Q0W B;  4AWJ A;  3DVG X;  1KZG A;  2C5L C;  4FN2 A;  4BBN F;  2GBK A;  2M17 A;  1SE9 A;  2ZCC A;  5AZH A;  2ADZ A;  1XCG A;  2XK5 B;  2NMB A;  2KTR A;  3IHP C;  4IWP A;  5D2M B;  5AZG A;  4ANU A;  2Y8G A;  3TL5 A;  4AOF A;  3IVF A;  1U2B A;  3NSU A;  1WX7 A;  3KRX A;  3DVN V;  3DDC B;  5AEK B;  1LQB A;  4CHJ A;  4B6H A;  4BKS A;  1C1Y B;  5DHF B;  2BPS A;  2MKR A;  2LZ6 A;  4DK5 A;  4GB9 A;  2CB8 A;  2LOZ A;  4EZK A;  4HLE A;  2BYV E;  2N9X A;  1XOD A;  4A6F A;  1WMH A;  2JXX A;  3GOE A;  3VTW A;  5JHA A;  2C7H A;  4KIK B;  3A8P A;  1HE8 A;  2UZS A;  5KQ1 A;  2A5U A;  2DAJ A;  3TW1 A;  4DHZ E;  3KW5 B;  2KVR A;  1OTR B;  2KAN A;  2KX0 A;  2DAF A;  3W1S C;  4BKS D;  2EC1 A;  1H4R A;  2KDI A;  2DZK A;  1ST7 A;  3Q3F A;  4W9H A;  2D07 B;  4K7W A;  2JRH A;  3OJ4 B;  2ZPY A;  5G55 A;  3L16 A;  4CHK A;  4WJN A;  3MDB C;  5DH9 B;  1V80 A;  2JF5 A;  1ACA A;  1P0R A;  4ASW C;  1CMX B;  2W9N A;  3EPY A;  2KGX B;  2WWZ A;  3UQB A;  2Y8F A;  5GMV A;  5CHF A;  1W1H A;  4MJS A;  2JZZ A;  3ODO A;  1RRP B;  1EF5 A;  1K5D B;  1RAX A;  3C0R B;  1X1G A;  3M63 B;  2ZNV C;  3P2B A;  2MBH A;  4TV3 A;  2LVQ A;  4EOY A;  2VSZ A;  2DX5 A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  2IYB A;  1DDM A;  4HAU B;  4NNJ B;  2DZM A;  4W9L A;  2MWN B;  1J19 A;  1WJN A;  2OOB B;  4OVV A;  3TO1 A;  2PPH A;  3EHV A;  4W9G A;  4K2P A;  4A20 A;  2XEW A;  4AJY B;  4E74 A;  2XK5 A;  1UH6 A;  2FDQ A;  2ELA A;  2CQU A;  3D8D A;  1WR1 A;  2UWQ A;  4WWN A;  3DOW A;  1WIA A;  1OQN A;  3M1I B;  2KMA A;  2NBV B;  3ODW A;  4W9J A;  2CY4 A;  2VRW B;  3K9P B;  4W9K A;  3B1L X;  3PS6 A;  3SNH A;  1EUV B;  4EKU A;  1I7A A;  1PQS A;  3V6E B;  2FID A;  1KI1 B;  4DHZ B;  4IUM B;  1W1D A;  4PS3 A;  4L6E A;  2N1V A;  4K7S A;  3W1Y A;  4NAW B;  1WI0 A;  3DXD A;  3OLM D;  2KFK B;  2JVC A;  3VDZ A;  4HDO A;  5C5B B;  3PHW B;  2MCN B;  2L2I A;  4FHK A;  2Z0D B;  2YS3 A;  3WAL A;  1NBF C;  3APD A;  4G11 A;  3WAO A;  2UZR A;  1R4N I;  1HBK A;  1H10 A;  3QQ8 B;  3P6A A;  1AWE A;  2CHX A;  1MIZ B;  2NR2 A;  3MJW A;  3N32 A;  2X18 A;  2BYF A;  1LFD A;  2M1M A;  3PGE A;  1I35 A;  3VH4 B;  3ULC A;  2D9V A;  3FLV A;  1V6E A;  2C7M B;  5J3Y A;  1FHW A;  2HD5 B;  4MEM A;  2WX1 A;  2D9W A;  4EMO A;  2LAS A;  2HTH B;  2RGN B;  3SU8 X;  3ZVR A;  1V5U A;  1E8W A;  1YX5 B;  2RSU A;  4ZRI A;  1BTN A;  4TQ1 A;  5DPR A;  4EUT A;  2RQ1 A;  2DKP A;  4HPM B;  3VFK A;  2EJ8 A;  3QA8 A;  4K2O A;  1WXV A;  5IAA C;  1AAR A;  2G35 A;  2DYO A;  2YF0 A;  3HQC A;  4A6H A;  2GOW A;  4FA6 A;  1WJU A;  2NS5 A;  2CS4 A;  1DBH A;  1UBQ A;  4E3C A;  1FXT B;  2W2W A;  3M3J A;  2KJH B;  3ZRF A;  3DBH I;  4HCP B;  4ANX A;  3PG7 A;  1P98 A;  2LUL A;  4HB0 B;  2JUO A;  2KKC A;  3ML8 A;  4II2 B;  1ZC4 B;  3RD2 A;  2FCQ A;  2KOX A;  2KO3 A;  1K5G B;  3OAW A;  2ABD A;  5L81 A;  2K1F A;  2BF8 B;  4BVU C;  3PRM B;  3A9J A;  1W1G A;  4TQ0 A;  3ML4 A;  4CYE A;  2DLW A;  2LGD A;  3UGB B;  2KDE B;  3NZU A;  3QHT A;  4MSM B;  2KC2 A;  1U5G A;  4GDK B;  1IPG A;  3M62 B;  5CHV C;  1HB6 A;  1I2H A;  2PJH A;  1NTY A;  2L3Z A;  4NPN A;  5C1Z A;  1DDV A;  5HE1 A;  3QCA A;  4KZC A;  2L1C A;  3D8E A;  2MP2 B;  2LXC A;  2KJR A;  4A6K A;  1X1F A;  1F9J A;  4NSW A;  2YRY A;  3TFM A;  2MX2 A;  4GPT B;  4IOY X;  4MY6 A;  2BCJ A;  3DBS A;  1E5W A;  2YSZ A;  1WXA A;  1TGZ B;  2IY0 B;  2K8C A;  2N23 A;  3KRW A;  2HJ8 A;  1WE7 A;  4WQO B;  1TXD A;  1WJ4 A;  2J7Q B;  3CST A;  3A8Q A;  4I6P A;  4N9F 4;  4FJV B;  4GGQ A;  5C79 A;  3SHQ A;  2M38 A;  1KM7 A;  2WX0 A;  3LJ3 A;  2O6V B;  1Y8R C;  2KWV B;  1WVH A;  2RGF A;  3RYT A;  2P8V A;  3MHS D;  3QIJ A;  4W9I A;  3ULB A;  3FSS A;  2KQS A;  3R3M A;  4W9C A;  2LXA A;  4BOZ B;  4F7Z A;  2COP A;  2D11 A;  1FAO A;  5DHA B;  3H9D A;  2DHZ A;  3VXW A;  2PEA A;  2MBB B;  1WF9 A;  2BYE A;  3HIZ A;  2DTC A;  2JY6 A;  4JLC A;  1OQY A;  4KV2 A;  1NI2 A;  2NCN A;  1XKE A;  1V5M A;  3RUL A;  3PRZ A;  2JZ3 B;  3QBV B;  3CF6 E;  5CHW A;  5FR6 A;  4HPL B;  4IM3 A;  2ZVO A;  1WM2 A;  3L17 A;  3V60 A;  1V9J A;  4KHA A;  5HE2 A;  2FJL A;  3U8Z A;  2RNR B;  4WVF B;  3DPD A;  5JHB A;  3UQA A;  5CLQ B;  4D0N B;  2GBJ A;  2G4S A;  5DPT A;  1A5R A;  3K9O B;  1EF1 A;  5D94 A;  3WA0 A;  3DBL I;  2D9Z A;  1G6J A;  3EEC A;  2M0X A;  4F7H A;  4I6N B;  2K8H A;  4YON A;  5AZF A;  3IBE A;  2YS5 A;  4GDK A;  2R09 A;  4PNK A;  3H7P B;  3RZF A;  1XD3 B;  2H7D A;  2ROV A;  3TMP B;  1UNQ A;  4HXD A;  3KUZ A;  3RT3 B;  1MIX A;  4BBN C;  2PE9 A;  4B6W A;  4DBG A;  3PSE B;  2DKQ A;  2Z0Q A;  1YX6 B;  3FP5 A;  2L7R A;  1V5P A;  2Z0P A;  3NHE B;  2COA A;  2KMC A;  4HAZ B;  2K39 A;  2M14 A;  2W2X C;  3AUL A;  3PZD A;  4LDT B;  4TUU A;  1R4M I;  4A3O A;  4F1S A;  5GOW B;  2BGF A;  5CTR C;  4DX8 A;  4AJW A;  4WJ7 A;  2GCJ A;  1WX8 A;  1X05 A;  3R66 C;  1P3Q U;  2O6V D;  5EFX A;  4JIO U;  1WGR A;  2CHZ A;  2DHK A;  2DYQ A;  4KHO A;  2G45 B;  2KK8 A;  4IAP A;  3EC8 A;  3MTN B;  3H7P A;  3VTU A;  1T0Y A;  1V5T A;  3VVW B;  2AWT A;  1WGQ A;  4ANW A;  4DDI D;  1E7V A;  2KX3 A;  4IWQ A;  2KFK A;  1V89 A;  2OQB A;  1OMW A;  5DI9 B;  2IO0 B;  2KC1 A;  3DCG A;  4KDI C;  3WAP A;  2M8S A;  2V3S A;  4GZU A;  1WE6 A;  3A9J B;  3BIN A;  4JGH B;  2D3G A;  2G3Q B;  2N0Y A;  2LWP A;  3APF A;  2YVC A;  2B3A A;  1NVL A;  4Y94 A;  5CLL B;  2Z0E B;  1FGZ A;  4CHM A;  2W2X D;  3O96 A;  1MAI A;  5E6N A;  2VKI A;  3D32 A;  3HM3 A;  3W1S A;  3PVU A;  1IRS A;  1NTV A;  3N30 A;  2K6Q A;  2LRW A;  2KQ7 A;  3X0W A;  1WXS A;  5J3T A;  2YT0 A;  1UBI A;  2BWF A;  2KTF A;  2MSE D;  4GDL A;  3RUI B;  2K8B A;  3VHT C;  3A4S C;  2FUH B;  1U27 A;  2L0F A;  4PS7 A;  5C6R A;  5JZE B;  1QZE A;  3VUY A;  2RLO A;  2FJ9 A;  2P0H A;  3V5W A;  3JW0 X;  5IJM A;  3PPA A;  4P7I A;  2DYN A;  4XZ4 A;  4AP4 C;  4K17 A;  3PRE A;  2KCJ A;  2K6D B;  2RR9 A;  2RD0 A;  4HB4 B;  5DIF B;  1U4A A;  1J0G A;  2ASQ A;  4EEW A;  2JRI B;  1FOE A;  4XC2 A;  3S2A A;  2J0M A;  1U5F A;  3TJP A;  4F7U P;  3KUC B;  3ZNZ B;  1WJM A;  2KWC A;  3OAN A;  4GOC A;  2KN5 A;  3D8F A;  5D6J B;  1LXD A;  4PQ0 A;  2MA9 B;  2ZVN A;  3TCA A;  3DXE A;  1UEF A;  2D4Q A;  2HTH A;  3ECI A;  5L95 C;  4TKN A;  2LI5 A;  1AQC A;  2FNJ B;  3ALB A;  1YD8 U;  2YLM A;  1WX9 A;  3HK0 A;  2FCN A;  3PLV A;  1U5E A;  3L0W B;  3F5R A;  1KLV A;  1P5T A;  4PYZ A;  4FUL A;  1WGH A;  1Q1O A;  4C0A A;  3KH0 A;  3A9K B;  4Z2M B;  3R7R A;  1VD2 A;  1RFA A;  2QKM A;  1U29 A;  2COF A;  2XQN M;  2FCS A;  3JYU A;  3B0A A;  4WAA A;  4WJQ A;  3ZDM C;  2LJ5 A;  4KSK C;  4HAX B;  2KTR B;  3ZLZ A;  1WG7 A;  1V49 A;  4DDG D;  1M7E A;  2Y7B A;  1Z2M A;  2DZJ A;  2KFJ A;  3IFW B;  2O6V A;  4G3X B;  1IP9 A;  1GJZ A;  1WY8 A;  3T06 A; 
#chains in the Genus database with same CATH topology
 4YSZ B;  3SBT A;  1WZ3 A;  2JP2 A;  2QC8 A;  4MJS B;  1L4D B;  4NQK E;  3KYC D;  2R2Q A;  1I4Q A;  5JP4 A;  4RF0 A;  2L8J A;  1JWU D;  2FE8 A;  4KIK A;  3Q3N C;  3DVN U;  2BKR B;  4JKH A;  2KDB A;  1RLF A;  2I5C A;  1Y56 A;  2LBB A;  4H2A A;  3W2D A;  3GYP A;  1OGW A;  2K3U A;  2NVU I;  2KAC A;  1JCK B;  2CU1 A;  3SU8 X;  2LHE A;  3JVZ X;  4WSF A;  5HE0 A;  4FHJ A;  5KCV A;  1AN8 A;  1UNR A;  3KWV A;  1WMH B;  2COD A;  1FB8 A;  4LJO B;  3I3T B;  3KUD B;  1YQB A;  3T3N A;  3MC0 B;  1FNU A;  1GNU A;  1K53 A;  3QX1 A;  4IKG A;  2MBO A;  2K2U A;  1S3S G;  2WDQ B;  2I1K A;  2IJ0 A;  1M7R A;  3CSF A;  4NQL B;  4RGN A;  4B9K A;  1FGY A;  5LON B;  1RJ2 A;  3I63 C;  3C8Y A;  2YT1 A;  3UIP B;  3AU5 A;  2DZI A;  2KJ6 A;  5BO4 B;  1T6B X;  3BK2 A;  1FEH A;  2WXF A;  3DCX A;  5BYS A;  4HHV A;  1L7Y A;  2DEN B;  3JSV A;  2N7E A;  1ROE A;  4MGK E;  3CXB B;  1EO6 A;  3ZTC A;  2JYE A;  3EFC A;  4A9A A;  2RSG A;  3TVV A;  3IG3 A;  1ACC A;  1OEY J;  1C79 A;  4URK A;  3GZN B;  4WJO A;  3SD5 A;  4GOU A;  3MPX A;  4C4V A;  3ZJU A;  3L10 B;  4JKA A;  1T0R C;  1PLS A;  2JX5 A;  2X0S A;  1DRO A;  1BML C;  1WWT A;  5J2R A;  4NJ6 A;  1PFJ A;  3SO6 A;  2WDT B;  2CU3 A;  3NWF A;  2D2Q A;  2O2V B;  4MAC A;  2LG1 A;  2AYO B;  4M8M A;  3UZT A;  2Y5P A;  3WAM A;  1WI1 A;  4JK7 A;  1F0Z A;  2J59 M;  1L0X B;  1U5D A;  1HB8 A;  4R3D A;  2SAK A;  2M0A A;  5BMH A;  1A70 A;  1L6V A;  1TTN A;  2LD9 A;  4K81 A;  1P1A A;  2JT4 B;  4HAW B;  1WRI A;  3ZKJ C;  3L13 A;  4IW0 A;  4YTP B;  1ZUD 2;  1UNP A;  4B95 A;  1E0Z A;  4GMV A;  3DVG Y;  2X8X X;  4AUQ C;  5LOP B;  1YQ4 B;  1CJE A;  3NWA A;  2IO1 B;  2DFK A;  4RGT A;  4ZRJ A;  3CIK A;  3JSV B;  4ACF A;  3APC A;  4WJP A;  3QAR A;  2R0D A;  3WCQ A;  5JHG A;  3ZDT A;  2BWE S;  3DBR B;  2N9P C;  3L08 A;  2ROZ B;  2N7D A;  2H7E A;  2V76 A;  4LDT D;  4RNA A;  4BOS C;  2EKE C;  4IWO A;  1XT9 B;  1YJJ A;  1KLU D;  5D3I B;  2N1W A;  2GI9 A;  2EEL A;  4EZJ A;  5HKH A;  1LO5 D;  1UD7 A;  4ANV A;  3E56 A;  1Y19 B;  1V88 A;  2YS1 A;  2Z14 A;  3PV1 A;  1OQR A;  1UPR A;  4C80 A;  1ZOY B;  2ELB A;  4M0W B;  2MRP A;  3I5J C;  1QF6 A;  5C16 A;  4AWJ A;  3DVG X;  3DBL B;  2CJN A;  2GBK A;  2M17 A;  1SE9 A;  1F2R I;  3NVY A;  3E9P A;  2Y8G A;  1FM0 D;  3TL5 A;  3IVF A;  1U2B A;  1WX7 A;  3DDC B;  1LQB A;  4B6H A;  2BPS A;  2MKR A;  2LZ6 A;  1KRH A;  1L0Y B;  1XOD A;  3GOE A;  4KIK B;  3A8P A;  2UZS A;  1TS2 A;  2KX0 A;  2DAF A;  1NEK B;  2D07 B;  3OJ4 B;  4ASW C;  5DH9 B;  1V80 A;  1RM6 C;  1CMX B;  2KGX B;  3UQB A;  3ODO A;  1K5D B;  1RAX A;  4WIP A;  3O13 A;  4OT1 A;  4NNJ B;  4RCO A;  2DZM A;  2MWN B;  4LK0 M;  2FUG 1;  4K2P A;  1EU3 A;  2XK5 A;  2FDQ A;  3D8D A;  1HXY D;  2N0S B;  2KMA A;  1YN5 A;  3B1L X;  3PS6 A;  3SNH A;  2DLB A;  3V6E B;  5LG4 B;  4L6E A;  4KGR A;  2B76 B;  3DXD A;  3PHW B;  4FHK A;  1J7C A;  1ZDV A;  1VR9 A;  5HHD G;  3QQ8 B;  3P6A A;  3MJW A;  1MIZ B;  3AE9 B;  2LMC A;  2D9V A;  5HG2 A;  1V6E A;  3CIR B;  1VJK A;  1FHW A;  1D5M C;  2HD5 B;  2HTH B;  3I57 A;  2KDM A;  2RSU A;  1N62 A;  4TQ1 A;  1BTN A;  1GB4 A;  2EJ8 A;  3QA8 A;  1DYQ A;  1AAR A;  1QT9 A;  1SEB D;  1WJU A;  3FIL A;  4E3C A;  2W2W A;  2KJH B;  3PG7 A;  1P98 A;  2XN9 C;  1SE3 A;  2KOX A;  3V05 A;  4UDU C;  2W55 A;  1MI0 A;  3A9J A;  1C9F A;  4TQ0 A;  2DIK A;  2WU5 B;  1YOV B;  2KC2 A;  2AQ3 B;  4RF1 A;  1I4P A;  1D4B A;  1D5X C;  3QCA A;  1SE2 A;  4JKG A;  1X1F A;  2YRY A;  3TFM A;  1R4M B;  2OJW A;  5I2S A;  2BCJ A;  2AQ1 B;  2IY0 B;  3KRW A;  3MFG A;  5C2T B;  1KF6 B;  5G5H A;  4FJV B;  4GGQ A;  3LJ3 A;  2O6V B;  2H88 B;  1YN3 A;  4BOZ B;  3ULB A;  2R2Y A;  3H9D A;  2BYE A;  4JLC A;  2JY6 A;  2N7J A;  3PRZ A;  4IM3 A;  1V9J A;  4KHA A;  5HE2 A;  3I9V 1;  2GBJ A;  1A5R A;  3K9O B;  2WXL A;  3WA0 A;  1I4R A;  1K52 A;  4F7H A;  4I6N B;  2K8H A;  5AZF A;  2L32 A;  3ZJT A;  3DBH B;  4KX6 B;  4BBN C;  2PE9 A;  3Q8B A;  2Z0Q A;  1I4X A;  1QKZ A;  1MHH E;  2KAJ A;  3Q14 C;  2KMC A;  2M14 A;  4LDT B;  5GOW B;  2BGF A;  5CTR C;  4DX8 A;  2Z4D A;  4WJ7 A;  2PIA A;  1FCL A;  2QSD A;  1NI3 A;  2DYQ A;  2IDY A;  3H7P A;  1XCQ L;  3AEG B;  4DDI D;  1E7V A;  2BS3 B;  2W82 A;  4CQN A;  5DI9 B;  2IO0 B;  1XLQ A;  2VZK D;  2V3S A;  4GZU A;  3A9J B;  3BIN A;  4JGH B;  4JE3 B;  2N0Y A;  1TS5 A;  5CLL B;  4XWT A;  5E6N A;  3D32 A;  3RNA C;  2J42 A;  3X0W A;  2BWF A;  4A8X C;  3VHT C;  3A4S C;  5FKA C;  4PS7 A;  5C6R A;  3VUY A;  4RFB A;  5M4Y B;  5IJM A;  4IOI E;  2DYN A;  4AP4 C;  3PRE A;  2KCJ A;  4RGM A;  2ASQ A;  2JRI B;  4QXA B;  1FOE A;  3KUC B;  1WJM A;  3OAN A;  4GOC A;  3D8F A;  4M0W A;  4PQ0 A;  2MA9 B;  2KT7 A;  3AEB B;  5L95 C;  1SSN A;  2LI5 A;  3U7Z A;  1AQC A;  2GRI A;  3DWM A;  1EWY C;  1Q1O A;  3KH0 A;  1HA5 A;  1RFA A;  2COF A;  4JK9 A;  4WAA A;  2VZK B;  4HAX B;  4B0E A;  1GJZ A;  1Z2M A;  3IFW B;  1XLP A;  2O6V A;  1TS3 A;  1EU4 A;  2IFS A;  2DN6 A;  4US9 A;  1ZGU B;  1LB1 A;  3BZD B;  1UZX B;  4ZRK A;  1BTK A;  1J0W A;  4DWF A;  3VRB B;  3M95 A;  2GCL A;  2CY5 A;  1N60 A;  4YSX B;  5E6O A;  2EMS A;  2BT6 A;  1YIW A;  4DBB A;  1I4G A;  2G4D B;  2YEP B;  4DHJ D;  3G9W A;  2K00 A;  3SBG A;  2PLP A;  3P4Q B;  4P6V F;  3PHX B;  2GBR A;  1JWB D;  4F7G A;  3BY4 B;  2WXH A;  2M19 A;  1J7A A;  4YSY B;  1QOB A;  2MP2 A;  3PP2 A;  3KYD D;  3ZUN A;  5FK9 C;  4GSW A;  5KHO A;  3AH7 A;  3RNF C;  1TZO A;  3L54 A;  2RDH A;  2K2J A;  3FEH A;  1V8C A;  4A5K A;  2R2O A;  1E8Y A;  1XQQ A;  2GJY A;  5KHQ A;  4PYU A;  3ONS A;  4J6I A;  3F0W A;  3HM6 X;  3A33 B;  5G2N A;  3NJT A;  1WYW B;  3LJU X;  1ZE3 D;  4P1B C;  4LNN A;  4BKT A;  1Y5O A;  3A1Q B;  4G50 A;  1B1Z A;  1WXQ A;  2Y3A A;  1GC7 A;  5D3Y A;  1SBB B;  3QK0 A;  1TZ1 A;  3EUB 2;  1T3Q A;  2P0F A;  4HKQ A;  1L6U A;  2WXM A;  2J0K A;  4HAT B;  3NRZ A;  2V0G A;  3ML9 A;  3P4S B;  4USA A;  1K51 A;  1E90 A;  2VRR B;  3URY A;  3FM8 C;  5D27 A;  1FRD A;  1ET9 A;  4HAV B;  3W5U B;  3PVL A;  3Q3J A;  4H8S A;  2KLG A;  3AE3 B;  2BS2 B;  2LGY A;  3V62 A;  2EMT A;  3E9L A;  4MSQ B;  2M4N A;  2IY1 B;  2KZR A;  3AI5 A;  1TJ6 A;  1UWM A;  3HVD A;  2NBV A;  1ESF A;  1P3R A;  1HTO A;  4PS8 A;  4Q2J A;  2GUM A;  3ZNG C;  1YJ1 A;  1V1O A;  3E9S A;  5C3J B;  1VZ8 A;  1RFK A;  3C19 A;  3NWD A;  5EE9 A;  2OTX A;  1EAZ A;  3VIA A;  1JAL A;  2REX A;  5LXH A;  3AEE B;  2BYT A;  4KAX B;  4KSL C;  3LYY A;  3RCP A;  4L2Y A;  1EVH A;  4S17 A;  5D7G A;  4XWX A;  2QKL A;  1TBE A;  1Q67 A;  1NYQ A;  4DIX A;  3ZQ4 A;  3IAS 1;  2BTE A;  4FJZ A;  1FO4 A;  4BBK A;  5IA7 A;  2HRJ A;  2QCZ A;  1X1M A;  3T8M A;  3RNC C;  3RN9 C;  4JWU C;  1B55 A;  1FHX A;  4WWO A;  2AL3 A;  2H89 B;  3LDZ E;  2LUE A;  1GC6 A;  2NZ8 B;  1F2R C;  1GOZ A;  1C78 A;  1MK7 B;  4DX9 0;  3BYT B;  1TKG A;  3WAN A;  4HCN B;  3A98 B;  1TQZ A;  1M4V A;  1WGD A;  4MEL A;  4KHB B;  1PGA A;  3NVW A;  5BYQ A;  3KY9 A;  4C7Z A;  1ZXH A;  1WGY A;  2FCM A;  2IO2 B;  3HHM A;  2JSV X;  1KBL A;  3AM9 A;  5C23 A;  4F8C B;  3NZS A;  5JH5 C;  2BKF A;  3Q3O C;  3TUO A;  1MG8 A;  1Q5W B;  4K7U A;  4FAD A;  2GBM A;  2ONQ A;  2WXG A;  3P1M A;  4E71 A;  3UI3 A;  1XX0 A;  3AXC A;  5FI1 A;  4FJY A;  1OEY A;  2LFI A;  3Q3M C;  3ZRC A;  3QWZ B;  1UGM A;  3GB1 A;  2K25 A;  2E2X A;  1M94 A;  4ZRQ A;  3Q8E A;  1WH3 A;  4N59 A;  4W9E A;  1GPX A;  2NTT A;  2DYB A;  1BUI C;  1JDE A;  1KZG A;  4P16 A;  4BBN F;  3B2F A;  5AZH A;  2ADZ A;  2XK5 B;  4IWP A;  4ANU A;  2UU7 A;  5AEK B;  4CHJ A;  3MP9 A;  2Z13 A;  1NEN B;  2PKO A;  1TKY A;  4DK5 A;  1PDX A;  3TEW A;  2BYV E;  2N9X A;  4A6F A;  2JXX A;  3HIE A;  3VTW A;  5JHA A;  5MPO A;  3MHZ A;  2A5U A;  3TW1 A;  4DHZ E;  3KW5 B;  2KIG A;  1YN4 A;  2KVR A;  2L83 A;  4K3C A;  1H4R A;  2JRH A;  3BII D;  4HKZ E;  4WJN A;  2G1E A;  1ACA A;  3EPY A;  5CHF A;  2JZZ A;  3ZXR A;  2ZNV C;  3P2B A;  2LVQ A;  2VSZ A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  2WLB A;  2IYB A;  4HAU B;  1XF5 L;  1TT5 B;  2OOB B;  4A20 A;  2MJD A;  2PPH A;  3EHV A;  1KFY B;  4E74 A;  1ZXI A;  1UH6 A;  1WYG A;  2CQU A;  1WIA A;  3B9J A;  2CY4 A;  3K9P B;  5JVL A;  1JML A;  2NTS A;  3R8B A;  1EM7 A;  4DHZ B;  3Q6B A;  4PS3 A;  4K7S A;  1BXT A;  3SR6 A;  2JVC A;  4NZL B;  2PMV A;  2UZR A;  1FMA D;  2KIE A;  1STE A;  2BYF A;  1LFD A;  3VH4 B;  3ULC A;  3PO0 A;  3FLV A;  4O1N A;  3RFZ B;  4JKC A;  4MEM A;  2WX1 A;  2LAS A;  1T0Q C;  2RGN B;  4OW0 A;  1YX5 B;  4EUT A;  1VBH A;  4K2O A;  2G35 A;  2DYO A;  2V9H A;  2GOW A;  4XYC A;  3Q2A C;  1KH0 A;  1UBQ A;  3ZRF A;  2OHF A;  4MH8 A;  5HFY A;  3N9Y C;  2D5G A;  4ANX A;  4II2 B;  3RD2 A;  2KKC A;  3OAW A;  2ABD A;  5L81 A;  4BVU C;  2BB5 A;  3PRM B;  1XLO A;  1W1G A;  2DLW A;  2LGD A;  4ILH A;  2KDE B;  1U5G A;  5CHV C;  1IPG A;  2WNM A;  3M62 B;  3RPF C;  1I2H A;  1FXI A;  1NTY A;  3D8E A;  3B77 A;  4NAM A;  4MY6 A;  1OFF A;  4M02 A;  3A58 A;  2K8C A;  3GP7 A;  1J7B A;  1CQV A;  1YMH E;  2HJ8 A;  4WQO B;  2MJ3 A;  1TXD A;  2J7Q B;  2QJL A;  2WU2 B;  4BAX A;  2M38 A;  1KM7 A;  1SB3 C;  1Y8R C;  3VH3 B;  3RNE C;  2MEK A;  1AWD A;  2COP A;  2D11 A;  1FAO A;  4MM3 B;  3VXW A;  2DHZ A;  2MBB B;  1WF9 A;  4DXG A;  2DTC A;  3R2T A;  4KV2 A;  2BW2 A;  5FR6 A;  2LGS A;  2ZVO A;  3U8Z A;  3UQA A;  4WUR A;  2G4S A;  5DPT A;  5D94 A;  4ZRP A;  2D9Z A;  3EEC A;  2M0X A;  3W9C B;  2YS5 A;  3RZF A;  1UGJ A;  4ZOH C;  3U2S C;  2H7D A;  2ROV A;  4HXD A;  3KUZ A;  3RT3 B;  4B6W A;  4DBG A;  2IGD A;  2L7R A;  1V5P A;  2VH1 A;  4ILG B;  3AUL A;  3ABV B;  4TUU A;  2N9K A;  2E6X A;  3TSS A;  2GCJ A;  5I2M A;  3R66 C;  1P3Q U;  2O6V D;  2G45 B;  2MHJ A;  1T0Y A;  1V5T A;  4ANW A;  1F52 A;  2Q5W D;  2OQB A;  3DCG A;  2IPK D;  1QOA A;  2M8S A;  2D3G A;  2LWP A;  4JPS A;  2B3A A;  1NVL A;  2Z0E B;  2NMQ A;  4CHM A;  2W2X D;  3O96 A;  1MAI A;  2VKI A;  4JWS C;  3PVU A;  2K6Q A;  2KQ7 A;  3BVZ A;  3P4P B;  2WXI A;  5J3T A;  2YT0 A;  3RUI B;  1OQQ A;  2K8B A;  2L0F A;  2LHD A;  2X38 A;  5I4D A;  5JZE B;  1QZE A;  2FJ9 A;  3PPA A;  2N9L A;  2K6D B;  2K0P A;  1KC7 A;  3BYY B;  3HSA A;  4XC2 A;  3ENB A;  3ZGZ A;  3OWE B;  4F7U P;  3ZNZ B;  2KN5 A;  4JKB A;  3TCA A;  5TSS A;  1V1P B;  4TKN A;  1JWA D;  1YD8 U;  1P5T A;  4PYZ A;  4FUL A;  3LXF A;  1WGH A;  4JKE A;  4QJ3 B;  1FNW A;  2XQN M;  2FCS A;  1HTQ A;  4WJQ A;  2LJ5 A;  4KSK C;  1JQ4 A;  3J9C A;  2KTR B;  1WG7 A;  1V49 A;  1M7E A;  1IP9 A;  4G3X B;  4US8 A;  1FFV A;  1N63 A;  2KYW A;  3ENE A;  2V3P A;  2J52 A;  3QAQ A;  2EKI A;  2WQY B;  2QMT A;  5H8Y E;  4YTN B;  5IN7 A;  2CHW A;  2YT2 A;  1K8R B;  4WQM A;  2P0D A;  4WWP A;  4WWM A;  4WH4 A;  1VZ6 A;  2ZZP B;  2IO3 B;  4ARI A;  3X23 A;  2Z59 B;  2LKO A;  5L83 A;  1XD4 A;  2HE7 A;  2JPH A;  2MQJ A;  1I4H A;  2K8E A;  4JKG B;  4ZHP A;  5C5B A;  1E8Z A;  3NY5 A;  1LM8 B;  2WS3 B;  1WGU A;  2JXT A;  3CWI A;  3OJ3 A;  1SF0 A;  2DA0 A;  4A6F B;  2J53 A;  1ZSQ A;  1V81 A;  4G0N B;  2WXJ A;  4HAY B;  1WR6 E;  2GS0 A;  4XDC A;  1WXM A;  1ZVR A;  2ZJD A;  4A6Q A;  5JLJ B;  1QC6 A;  3SYX A;  1QOG A;  2HJ1 A;  1WJ6 A;  3QWM A;  3FC4 A;  4RM9 A;  2ZEQ A;  2DX5 B;  3NW8 A;  4D2K A;  3PZ7 A;  1UEL A;  4M01 A;  1Z5S B;  2XNA C;  4HRS A;  5IOI A;  4MT7 A;  3KLS X;  3AMZ A;  2WH5 A;  1YQ3 B;  3PT2 B;  1KOT A;  5D3W A;  3DBR I;  3FVC A;  3T9L A;  2L00 B;  5D3X A;  1JRO A;  4IM0 A;  4M00 A;  3TIX A;  4HVB A;  1FFU A;  1SJH D;  2JWU A;  4JKF A;  4A3P A;  2WXQ A;  2YEP F;  4NJ7 A;  3MC8 A;  3UF8 A;  1LW3 A;  2LRU A;  2V4L A;  1FD6 A;  4Z2N A;  2FBW B;  1DYN A;  1GG3 A;  2O2V A;  3P7Z A;  4PK1 A;  1NTI A;  2LGX A;  3NZ3 A;  1XR0 B;  1XO3 A;  2D10 A;  2AEH A;  1TYG B;  3U30 A;  4YWG G;  1UPQ A;  2ZNV B;  1OY2 A;  4RM8 A;  2PE6 B;  5DCN A;  4NAW A;  3SUZ A;  3BJI A;  1WRD B;  4AJW A;  4MM3 A;  4ITK A;  4YXD B;  4AQ7 A;  3PSC A;  4HJG E;  1PMS A;  3ZNI D;  4IDI A;  1ZP0 B;  4GMX B;  3PTF C;  3ZTD A;  2RUK B;  3ZNH B;  4KDL B;  5AUI A;  2Z0O A;  3EA6 A;  2DHI A;  1DGJ A;  2UVM A;  3V61 A;  3VRA B;  2GB1 A;  1FHO A;  1E10 A;  3ZXV A;  4II3 B;  2A4Z A;  5D3V A;  1C4C A;  2FIF A;  4PT5 A;  5BYR A;  1K50 A;  2RRF A;  1S1Q B;  1H8C A;  4CO7 A;  2Y5C A;  3IT4 B;  4GN1 A;  4GLS C;  1KLV A;  4XGA B;  1BAK A;  4M8N A;  1HEZ E;  2IZV B;  1MKE A;  3VUW A;  4JL9 A;  3ZO5 B;  1P7E A;  1WJ1 A;  1C3T A;  3GE3 C;  2Z8L A;  4TYZ A;  3AV8 A;  3AU4 A;  1KZ7 A;  5IP4 D;  2PW9 A;  2LOX A;  3DHI C;  1EWC A;  2NBW B;  3AE8 B;  2V4I B;  4TSS A;  1L5P A;  4KZ0 A;  3QJZ A;  3TEX A;  4QJ5 B;  4ZDV A;  2KD0 A;  4GXB A;  1ZPS A;  3EFU A;  2Q13 A;  3N3K B;  5LNK 1;  3NS8 A;  2LVO A;  4W9D A;  5BMG A;  3TBL D;  4DQO C;  3CMM B;  3AJ4 A;  2Y5B B;  2L76 A;  1VRA B;  4HB2 B;  3RNG C;  2AL6 A;  2DYM A;  2MDX A;  3ZW3 A;  1V86 A;  4K1R B;  2K5P A;  4GU2 A;  4W9F A;  3SFE B;  3VAW A;  1DDW A;  1FNV A;  3BK1 A;  2C5L C;  1C76 A;  2ZCC A;  3IHP C;  5D2M B;  5AZG A;  4RGO S;  3P63 A;  3NSU A;  3KRX A;  4C7Y A;  4BKS A;  1QLB B;  2CB8 A;  2LOZ A;  1QQR A;  4HLE A;  2DBY A;  1HE8 A;  1ET6 A;  2KAN A;  3U52 E;  2W54 A;  3W1S C;  2KDI A;  3Q3F A;  1ST7 A;  1IBX A;  4K7W A;  5G55 A;  3L16 A;  3MDB C;  2FJU B;  2W9N A;  2WWZ A;  2Y8F A;  1JW9 D;  1W1H A;  4MJS A;  1EF5 A;  3C0R B;  1X1G A;  3M63 B;  4ILJ A;  2MBH A;  1MHX A;  2V3N A;  3RNB C;  1DDM A;  1WJN A;  4OVV A;  4AJY B;  5T8I A;  1WR1 A;  1YJI A;  2NBV B;  4W9J A;  2VRW B;  4MT5 A;  1TY0 A;  3AEA B;  4EKU A;  4IUM B;  1XCT L;  5IKC M;  1NVI D;  3W1Y A;  4NAW B;  1WI0 A;  3OLM D;  2KFK B;  1VLB A;  2OED A;  3VDZ A;  5C5B B;  3WAL A;  2L2I A;  2YS3 A;  1NBF C;  3APD A;  4G11 A;  1C4A A;  3WAO A;  1R4N I;  1H10 A;  3N32 A;  1AWE A;  2CHX A;  2NR2 A;  1I35 A;  2KUQ A;  3PGE A;  2M1M A;  3Q8A A;  1SIJ A;  2HTM E;  1I7H A;  1V1P A;  3N1Z C;  5G5G A;  3ZVR A;  1V5U A;  1E8W A;  5DPR A;  4ZRI A;  1FRR A;  1KLG D;  1Q10 A;  1XXG A;  4HPM B;  4N58 A;  2BBC A;  1ZYI A;  1V97 A;  3VR9 B;  4A6H A;  3P42 A;  4FA6 A;  2NS5 A;  1DBH A;  4KKJ A;  3DBH I;  4HCP B;  1GGO A;  2JU6 X;  3ML8 A;  1ZC4 B;  4ARC A;  2FCQ A;  1SE4 A;  3ML4 A;  4CYE A;  4MSM B;  1YNT E;  1HB6 A;  2TSS A;  4NPN A;  5C1Z A;  1DDV A;  5HE1 A;  4KZC A;  1MG4 A;  2LXC A;  4A6K A;  3NVZ A;  2QIE B;  3TEY A;  4NSW A;  3R2I A;  2MX2 A;  2BQQ A;  1E5W A;  1WXA A;  1TGZ B;  1E7P B;  4LNF A;  2N23 A;  1WJ4 A;  3CST A;  1SJE D;  4I6P A;  4N9F 4;  4OSN A;  5C79 A;  3SHQ A;  2RGF A;  1WVH A;  2P8V A;  4W9C A;  3QIJ A;  4W9I A;  3R3M A;  1J8C A;  4HSI A;  2L52 A;  1AYF A;  5DHA B;  2PEA A;  1HZ5 A;  3HIZ A;  3TEZ A;  1OQY A;  1NI2 A;  2NCN A;  1XKE A;  4A55 A;  5CHW A;  4QAY A;  4HPL B;  1WM2 A;  2FJL A;  4WVF B;  3DPD A;  5CLQ B;  1EF1 A;  3DBL I;  2M56 B;  1ZDX A;  4C00 A;  4YON A;  4GDK A;  4RH6 A;  4PNK A;  1R7S A;  4OHJ A;  1XD3 B;  3TMP B;  4C56 C;  3AED B;  1MIX A;  3PSE B;  1YX6 B;  3NHE B;  2COA A;  5LXI B;  4XDD A;  3AE5 B;  1X05 A;  1PYW D;  4JKD A;  4JIO U;  5EFX A;  2CHZ A;  2KK8 A;  4IAP A;  3VTU A;  3VVW B;  2AWT A;  2KFK A;  2KC1 A;  4KDI C;  5FR3 A;  1MVK A;  3WAP A;  1WE6 A;  1C77 A;  2G3Q B;  3AE2 B;  3B2G A;  2YVC A;  2D3A A;  4Y94 A;  1FGZ A;  3Q8C A;  3W1S A;  1UUP A;  3GS2 A;  3HVZ A;  1IRS A;  3N30 A;  2LRW A;  4NJC A;  1UBI A;  2KTF A;  2MSE D;  4GDL A;  4GNK B;  2JQR B;  2FUH B;  1U27 A;  4L23 A;  2J4X A;  3NVV A;  2IGG A;  2HDE A;  1C4P A;  2P0H A;  4K17 A;  2RD0 A;  4XWW A;  5EE3 A;  5H92 C;  5DIF B;  4L1B A;  1XEE A;  4EEW A;  3S2A A;  1U5F A;  2ZKM X;  3TJP A;  2KWC A;  2ZVN A;  2INN E;  2LJI A;  3DXE A;  2WXN A;  1UEF A;  2HTH A;  3ECI A;  1QOF A;  4D6W A;  4OZA A;  4S0R A;  3PLV A;  2YLM A;  1WX9 A;  1U5E A;  2CJO A;  3F5R A;  4XE0 A;  2K22 A;  4Z2M B;  3W5V B;  1MPE A;  1T77 A;  1VD2 A;  3JYU A;  5IO9 A;  3B0A A;  3ZDM C;  1N5X A;  1N6Z A;  1FPY A;  3T06 A;  4ZHO A;  4KGT A;  2CR5 A;  1MPH A;  2N9E B;  4NY0 A;  2QDF A;  2COC A;  4HWI B;  1KJT A;  4OVZ A;  3DXC A;  1F1H A;  2JYT A;  3H6N A;  3ZIM A;  3U7D A;  3RI7 C;  2GMI C;  5JHH A;  3KSY A;  1VBG A;  1MFW A;  3BWU D;  3KVF B;  1NYR A;  2BVC A;  4ZYN A;  3AE6 B;  4LCD E;  2AQ2 B;  2RPV A;  4ICV A;  2KXJ A;  3VQI A;  2V1Y A;  1SHC A;  5J18 A;  4DHJ B;  3SV1 A;  1V5O A;  3MC9 A;  3RZW C;  2MWS B;  5LLI A;  2Z59 A;  1GUA B;  4A90 A;  4DDG D;  1ZC3 B;  5KQ4 A;  1Z87 A;  5E6P A;  2C60 A;  4DXA B;  2DX1 A;  5HE3 A;  1E7U A;  2RDG A;  4MGY E;  1AW7 A;  2KR0 A;  3VTV A;  1D3Z A;  4YTM B;  4EZL A;  2NBU A;  5DPS A;  1ENF A;  4K3B A;  1X11 A;  3O65 B;  4MDK E;  3V6C B;  2L05 A;  2L0T A;  4HB3 B;  1DIK A;  2JZP A;  4RMA A;  4HRO A;  4BKG A;  2BS4 B;  1JRU A;  1IGD A;  3PRP B;  3NG0 A;  1RRB A;  1WGK A;  1WM3 A;  1BWN A;  2KDF B;  2AX5 A;  5DPW A;  3SFD B;  1RWS A;  3A9K A;  2GBN A;  4BFR A;  4IC7 B;  2ACZ B;  3GZN I;  2MFQ A;  3E66 A;  1WFY A;  3LB8 C;  5JXV A;  3T3O A;  1NDD A;  4FBJ B;  4HJK A;  3PLU A;  2RPQ A;  2D9X A;  3KZ1 A;  1ZM0 A;  2NPT B;  1JRP A;  3ZVV A;  4MGI E;  4EFO A;  2CKH B;  3ODX A;  3SEB A;  4JK8 A;  2MW5 A;  1EGX A;  4X57 B;  2RVB B;  4MGZ E;  5EDS A;  1D6E C;  3VOQ A;  2KN4 A;  1GAQ B;  3SDL C;  3PVW A;  4C4V B;  4ICU A;  1JWM D;  3RCZ A;  1ZKH A;  3GYO A;  2LYD A;  2ZPN A;  3FKY A;  2PZ1 A;  1PFD A;  2IBI B;  3ZYY X;  2JWZ A;  1FIQ A;  2QHO A;  3PEG A;  3UIN B;  4EJN A;  1UWX A;  3L4P A;  1WGG A;  1ZW7 A;  4OVU A;  2DNF A;  2VH2 A;  1ISN A;  1DOX A;  3HRD D;  3NOB A;  2LEK A;  4JQW C;  2LUM A;  4XX5 A;  2OJR A;  1V2Y A;  4IM2 A;  2ZCB A;  2J0J A;  1E9M A;  2RMM A;  4I6L B;  3DQV A;  1E8X A;  3IXS A;  2KUP A;  4IFS A;  1P9D U;  4N6E B;  1FXA A;  3BVM A;  1PGB A;  2SEB D;  1X86 A;  3HW2 B;  3WIM A;  5CX3 A;  2PVG C;  1IYF A;  5FI0 A;  1WZ0 A;  3APF A;  2FAZ A;  2WYQ A;  3A1Q A;  3QC8 B;  2KWU B;  1CZP A;  2DHJ A;  5BMI A;  5GXG B;  4YL8 A;  2D9Y A;  3DHH C;  4MH0 E;  1MK9 B;  4EE2 A;  2KMM A;  4HK2 A;  1N3H A;  5J17 A;  5TR5 A;  4KGS A;  2I5F A;  2C7N B;  5J3Q A;  2CRF A;  1JWS D;  2NPT A;  3V3X A;  1QQG A;  4HDQ A;  1TJE A;  4MK0 A;  2N4F A;  2KNB A;  2MH7 A;  2MBE A;  2W3S A;  2E3T A;  2W3R A;  1HQR D;  3UIO B;  5EE1 A;  1GB1 A;  1I42 A;  3B08 A;  1SGH A;  3WYF B;  2LVP A;  4LJP B;  2INC C;  3GE8 C;  1LGR A;  4GDL B;  1WSP A;  1V61 A;  2IGH A;  2KLC A;  4KHB A;  1VZ7 A;  1IBX B;  2KHW B;  2CAY A;  3H7S A;  4IG7 B;  2K9X A;  2MBQ A;  3VUX A;  1BT0 A;  3A4R A;  1PGX A;  3H1U A;  2I1J A;  4FLH A;  3N7C A;  4DXF A;  1VCB A;  1P6S A;  2LGI A;  1SIF A;  4FXC A;  1NU2 A;  2IYD B;  2UYZ B;  2KVZ A;  3RMK C;  1Q0W B;  5D3D A;  1HZ6 A;  4FN2 A;  4OZC A;  2WDV B;  1IGC A;  1XCG A;  2NMB A;  2KTR A;  1QIL A;  4AOF A;  4OZB A;  3DVN V;  2ON8 A;  1C1Y B;  5DHF B;  3AEF B;  1VDV A;  4GB9 A;  4EZK A;  1WMH A;  3AE1 B;  4LNK A;  2BB6 A;  2C7H A;  1FCC C;  5KQ1 A;  2DAJ A;  1OTR B;  1IUE A;  4BKS D;  2EC1 A;  2DZK A;  4W9H A;  4CHK A;  2ZPY A;  4TMA B;  2JF5 A;  2I2Y A;  4REZ A;  1P0R A;  3NUH B;  5GMV A;  2K49 A;  4BZA A;  3HUI A;  1RRP B;  3AEC B;  2MJE A;  3PZ8 A;  4TV3 A;  5IRS A;  4EOY A;  2DX5 A;  2G9H D;  2QEJ C;  3IT6 B;  1T5X D;  4W9L A;  1J19 A;  3TO1 A;  4W9G A;  2XEW A;  2I38 A;  4LNO A;  2ELA A;  1F77 A;  2UWQ A;  4WWN A;  3DOW A;  1OQN A;  3M1I B;  3ODW A;  3AB5 A;  4W9K A;  4LTU A;  1EUV B;  1I7A A;  1PQS A;  2WXO A;  4KKI A;  2FID A;  1KI1 B;  3N1X C;  4P1C C;  1W1D A;  4WAF A;  2N1V A;  4ZYS A;  2PVO D;  1P7F A;  4HDO A;  2MCN B;  3E9O A;  2Z0D B;  2D3B A;  1HBK A;  1MI1 A;  3OHM B;  2WXP A;  2X18 A;  1MJD A;  1D5Z C;  1N61 A;  2C7M B;  2DWQ A;  5HI1 A;  5J3Y A;  2D9W A;  4EMO A;  2R82 A;  3FIL B;  5AUK A;  2RQ1 A;  2DKP A;  3VFK A;  1E6E B;  1UNS A;  1WXV A;  3MJ5 A;  5IAA C;  3KWL A;  2YF0 A;  3HQC A;  2CS4 A;  1FXT B;  3M3J A;  2LUL A;  4HB0 B;  2JUO A;  3DHG C;  2KO3 A;  1K5G B;  2K1F A;  2GLS A;  2BF8 B;  1KTK A;  3UGB B;  3NZU A;  3QHT A;  4GDK B;  4QJ4 B;  2PJH A;  3OG5 A;  2L3Z A;  2D3C A;  4LLG M;  2L1C A;  3P4R B;  2MP2 B;  3H8H A;  2KJR A;  2ICI A;  1F9J A;  2WGS A;  4GPT B;  4IOY X;  3DBS A;  2YSZ A;  3U4E G;  2KWD A;  1WE7 A;  3A8Q A;  3Q8F A;  1TS4 A;  2WX0 A;  3RYT A;  2KWV B;  3MHS D;  2KQS A;  3FSS A;  2LXA A;  3IAM 1;  3NS1 A;  3VR8 B;  3RUL A;  1V5M A;  2JZ3 B;  3QBV B;  3CF6 E;  3V60 A;  3L17 A;  2WHI A;  1SXT A;  2RNR B;  5JHB A;  1CK1 A;  4D0N B;  2KQ4 X;  1T0S C;  2QIL A;  2ZW1 A;  1G6J A;  1TY2 A;  3AE4 B;  2IND C;  1DOI A;  4YT0 B;  1R4N B;  3IBE A;  3ZJV A;  4L1R A;  3AE7 B;  2R09 A;  3H7P B;  3DWG C;  4HEA 1;  1UNQ A;  5E6J A;  2DKQ A;  3FP5 A;  2Z0P A;  1N5W A;  4HAZ B;  2K39 A;  3N20 C;  2W2X C;  4A3O A;  3PZD A;  4HPP A;  4F1S A;  1R4M I;  4AS1 A;  3N1Y C;  1WX8 A;  2PTL A;  1WGR A;  2WDR B;  2DHK A;  4KHO A;  2L1A A;  3EC8 A;  3MTN B;  4CSQ A;  1WGQ A;  2KX3 A;  4IWQ A;  3EGR A;  1V89 A;  1OMW A;  3KQ4 A;  1RYJ A;  2R61 A;  2ZW0 A;  3U12 A;  1TKE A;  3HM3 A;  2INP E;  3FAH A;  1NTV A;  4LNI A;  1WXS A;  1UF0 A;  1XLN A;  2WXR A;  3BVG A;  1PUT A;  2WXK A;  2RLO A;  3V5W A;  3JW0 X;  4P7I A;  4XZ4 A;  2RR9 A;  4JX1 C;  4HB4 B;  1U4A A;  1J0G A;  2J0M A;  1L4Z B;  5D6J B;  1LXD A;  2D4Q A;  3Q69 A;  4J3O D;  2RDB C;  1DOY A;  2FNJ B;  3ALB A;  2FCN A;  3HK0 A;  3ETR A;  3L0W B;  1L0V B;  4B0M A;  4C0A A;  3A9K B;  3AN1 A;  3R7R A;  1B9R A;  2QKM A;  1U29 A;  2WP9 B;  5EE0 A;  3ZLZ A;  2Y7B A;  2DZJ A;  2KFJ A;  4F7Z A;  1L2N A;  1TIF A;  1WY8 A; 
#chains in the Genus database with same CATH homology
 3SBT A;  1WZ3 A;  2JP2 A;  4MJS B;  4NQK E;  3KYC D;  2R2Q A;  5JP4 A;  2L8J A;  4KIK A;  3DVN U;  2BKR B;  4JKH A;  2KDB A;  1RLF A;  2I5C A;  2LBB A;  3GYP A;  1OGW A;  2NVU I;  2CU1 A;  3SU8 X;  3JVZ X;  4WSF A;  5HE0 A;  4FHJ A;  5KCV A;  1UNR A;  1WMH B;  2COD A;  1FB8 A;  4LJO B;  3I3T B;  3KUD B;  1YQB A;  1GNU A;  3QX1 A;  2MBO A;  2K2U A;  1S3S G;  2I1K A;  1M7R A;  3CSF A;  4NQL B;  4B9K A;  1FGY A;  5LON B;  1RJ2 A;  2YT1 A;  3UIP B;  3AU5 A;  2DZI A;  2KJ6 A;  5BO4 B;  4HHV A;  1L7Y A;  2DEN B;  3JSV A;  2N7E A;  4MGK E;  3CXB B;  1EO6 A;  3ZTC A;  2RSG A;  3TVV A;  3IG3 A;  1OEY J;  4URK A;  4WJO A;  3SD5 A;  3MPX A;  3L10 B;  4JKA A;  1PLS A;  2X0S A;  1DRO A;  5J2R A;  4NJ6 A;  1PFJ A;  3SO6 A;  2WDT B;  2D2Q A;  2O2V B;  2LG1 A;  2AYO B;  4M8M A;  3UZT A;  3WAM A;  1WI1 A;  4JK7 A;  2J59 M;  1U5D A;  1HB8 A;  1TTN A;  2LD9 A;  4K81 A;  1P1A A;  2JT4 B;  4HAW B;  3ZKJ C;  3L13 A;  4IW0 A;  1UNP A;  4B95 A;  4GMV A;  3DVG Y;  4AUQ C;  5LOP B;  2IO1 B;  2DFK A;  4ZRJ A;  3CIK A;  3JSV B;  3APC A;  4WJP A;  3QAR A;  2R0D A;  5JHG A;  3ZDT A;  2BWE S;  2N9P C;  3L08 A;  2ROZ B;  2N7D A;  2H7E A;  2V76 A;  4LDT D;  4BOS C;  2EKE C;  4IWO A;  1XT9 B;  2N1W A;  4EZJ A;  5HKH A;  1UD7 A;  4ANV A;  1Y19 B;  1V88 A;  2YS1 A;  3PV1 A;  1UPR A;  2ELB A;  4M0W B;  2MRP A;  5C16 A;  4AWJ A;  3DVG X;  2GBK A;  2M17 A;  1SE9 A;  3E9P A;  2Y8G A;  3TL5 A;  3IVF A;  1U2B A;  1WX7 A;  3DDC B;  1LQB A;  4B6H A;  2BPS A;  2MKR A;  2LZ6 A;  1XOD A;  3GOE A;  4KIK B;  3A8P A;  2UZS A;  2KX0 A;  2DAF A;  2D07 B;  3OJ4 B;  4ASW C;  5DH9 B;  1V80 A;  1CMX B;  2KGX B;  3UQB A;  3ODO A;  1K5D B;  1RAX A;  4NNJ B;  2DZM A;  2MWN B;  4K2P A;  2XK5 A;  2FDQ A;  3D8D A;  2KMA A;  3B1L X;  3PS6 A;  3SNH A;  3V6E B;  4L6E A;  3DXD A;  3PHW B;  4FHK A;  3QQ8 B;  3P6A A;  3MJW A;  1MIZ B;  2D9V A;  1V6E A;  1FHW A;  2HD5 B;  2HTH B;  2RSU A;  4TQ1 A;  1BTN A;  2EJ8 A;  3QA8 A;  1AAR A;  1WJU A;  4E3C A;  2W2W A;  2KJH B;  3PG7 A;  1P98 A;  2KOX A;  3A9J A;  4TQ0 A;  2DIK A;  2KC2 A;  3QCA A;  4JKG A;  1X1F A;  2YRY A;  3TFM A;  2BCJ A;  2IY0 B;  3KRW A;  4FJV B;  4GGQ A;  3LJ3 A;  2O6V B;  4BOZ B;  3ULB A;  3H9D A;  2BYE A;  4JLC A;  2JY6 A;  3PRZ A;  4IM3 A;  1V9J A;  4KHA A;  5HE2 A;  2GBJ A;  1A5R A;  3K9O B;  3WA0 A;  4F7H A;  4I6N B;  2K8H A;  5AZF A;  4BBN C;  2PE9 A;  2Z0Q A;  2KMC A;  2M14 A;  4LDT B;  5GOW B;  2BGF A;  5CTR C;  4DX8 A;  4WJ7 A;  2DYQ A;  3H7P A;  4DDI D;  1E7V A;  5DI9 B;  2IO0 B;  2V3S A;  4GZU A;  3A9J B;  3BIN A;  4JGH B;  2N0Y A;  5CLL B;  5E6N A;  3D32 A;  3X0W A;  2BWF A;  3VHT C;  3A4S C;  4PS7 A;  5C6R A;  3VUY A;  5IJM A;  2DYN A;  4AP4 C;  3PRE A;  2KCJ A;  2ASQ A;  2JRI B;  1FOE A;  3KUC B;  1WJM A;  3OAN A;  4GOC A;  3D8F A;  4PQ0 A;  2MA9 B;  5L95 C;  2LI5 A;  1AQC A;  1Q1O A;  3KH0 A;  1RFA A;  2COF A;  4JK9 A;  4WAA A;  4HAX B;  1GJZ A;  1Z2M A;  3IFW B;  2O6V A;  2IFS A;  2DN6 A;  1ZGU B;  1LB1 A;  1UZX B;  4ZRK A;  1BTK A;  1J0W A;  4DWF A;  3M95 A;  2GCL A;  2CY5 A;  5E6O A;  2EMS A;  1YIW A;  4DBB A;  2G4D B;  4DHJ D;  3G9W A;  2K00 A;  3SBG A;  3PHX B;  2GBR A;  4F7G A;  3BY4 B;  2MP2 A;  3PP2 A;  3KYD D;  3ZUN A;  4GSW A;  5KHO A;  3L54 A;  2K2J A;  3FEH A;  4A5K A;  2R2O A;  1E8Y A;  1XQQ A;  2GJY A;  5KHQ A;  4PYU A;  3ONS A;  4J6I A;  3F0W A;  3HM6 X;  3A33 B;  5G2N A;  1WYW B;  3LJU X;  4BKT A;  1Y5O A;  3A1Q B;  4G50 A;  1GC7 A;  5D3Y A;  3QK0 A;  1TZ1 A;  2P0F A;  2J0K A;  4HAT B;  3ML9 A;  1E90 A;  2VRR B;  3FM8 C;  5D27 A;  4HAV B;  3PVL A;  3Q3J A;  4H8S A;  2KLG A;  2LGY A;  3V62 A;  2EMT A;  3E9L A;  4MSQ B;  2M4N A;  2IY1 B;  2KZR A;  3AI5 A;  1TJ6 A;  1P3R A;  4PS8 A;  3ZNG C;  1YJ1 A;  2OTX A;  1EAZ A;  3VIA A;  2REX A;  5LXH A;  4KAX B;  4KSL C;  3RCP A;  1EVH A;  5D7G A;  4XWX A;  2QKL A;  1TBE A;  1Q67 A;  4FJZ A;  4BBK A;  5IA7 A;  2HRJ A;  1X1M A;  3T8M A;  1B55 A;  1FHX A;  4WWO A;  2AL3 A;  3LDZ E;  2LUE A;  1GC6 A;  2NZ8 B;  1MK7 B;  4DX9 0;  3WAN A;  4HCN B;  3A98 B;  1TQZ A;  1WGD A;  4MEL A;  4KHB B;  3KY9 A;  1WGY A;  2FCM A;  2IO2 B;  3HHM A;  1KBL A;  5C23 A;  4F8C B;  3NZS A;  5JH5 C;  2BKF A;  1MG8 A;  1Q5W B;  4K7U A;  4FAD A;  2GBM A;  4E71 A;  1XX0 A;  3AXC A;  5FI1 A;  4FJY A;  1OEY A;  3ZRC A;  3QWZ B;  1UGM A;  2K25 A;  2E2X A;  1M94 A;  1WH3 A;  4W9E A;  2DYB A;  1JDE A;  1KZG A;  4BBN F;  5AZH A;  2ADZ A;  2XK5 B;  4IWP A;  4ANU A;  5AEK B;  4CHJ A;  4DK5 A;  2BYV E;  2N9X A;  4A6F A;  2JXX A;  5JHA A;  3VTW A;  2A5U A;  3TW1 A;  4DHZ E;  3KW5 B;  2KVR A;  1H4R A;  2JRH A;  4WJN A;  1ACA A;  3EPY A;  5CHF A;  2JZZ A;  2ZNV C;  3P2B A;  2LVQ A;  2VSZ A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  2IYB A;  4HAU B;  2OOB B;  4A20 A;  2PPH A;  3EHV A;  4E74 A;  1UH6 A;  2CQU A;  1WIA A;  2CY4 A;  3K9P B;  5JVL A;  4DHZ B;  4PS3 A;  4K7S A;  2JVC A;  2UZR A;  2BYF A;  1LFD A;  3VH4 B;  3ULC A;  3FLV A;  4JKC A;  4MEM A;  2WX1 A;  2LAS A;  2RGN B;  1YX5 B;  4EUT A;  1VBH A;  4K2O A;  2G35 A;  2DYO A;  2GOW A;  1UBQ A;  3ZRF A;  4ANX A;  4II2 B;  3RD2 A;  2KKC A;  3OAW A;  2ABD A;  5L81 A;  4BVU C;  3PRM B;  1W1G A;  2DLW A;  2LGD A;  4ILH A;  2KDE B;  1U5G A;  5CHV C;  1IPG A;  3M62 B;  1I2H A;  1NTY A;  3D8E A;  4MY6 A;  2K8C A;  2HJ8 A;  4WQO B;  1TXD A;  2J7Q B;  2M38 A;  1KM7 A;  1Y8R C;  3VH3 B;  2COP A;  2D11 A;  1FAO A;  3VXW A;  2DHZ A;  2MBB B;  1WF9 A;  2DTC A;  4KV2 A;  5FR6 A;  2ZVO A;  3U8Z A;  3UQA A;  2G4S A;  5DPT A;  5D94 A;  2D9Z A;  3EEC A;  2M0X A;  2YS5 A;  3RZF A;  2H7D A;  2ROV A;  4HXD A;  3KUZ A;  3RT3 B;  4B6W A;  4DBG A;  2L7R A;  1V5P A;  4ILG B;  3AUL A;  4TUU A;  2GCJ A;  3R66 C;  1P3Q U;  2O6V D;  2G45 B;  1T0Y A;  1V5T A;  4ANW A;  2OQB A;  3DCG A;  2M8S A;  2D3G A;  2LWP A;  2B3A A;  1NVL A;  2Z0E B;  4CHM A;  2W2X D;  3O96 A;  1MAI A;  2VKI A;  3PVU A;  2K6Q A;  2KQ7 A;  5J3T A;  2YT0 A;  3RUI B;  2K8B A;  2L0F A;  5JZE B;  1QZE A;  2FJ9 A;  3PPA A;  2K6D B;  1KC7 A;  4XC2 A;  3ENB A;  4F7U P;  3ZNZ B;  2KN5 A;  4JKB A;  3TCA A;  4TKN A;  1YD8 U;  1P5T A;  4PYZ A;  4FUL A;  1WGH A;  4JKE A;  2XQN M;  2FCS A;  4WJQ A;  2LJ5 A;  4KSK C;  2KTR B;  1WG7 A;  1V49 A;  1M7E A;  1IP9 A;  4G3X B;  3ENE A;  3QAQ A;  2CHW A;  1K8R B;  4WWP A;  2P0D A;  2ZZP B;  2IO3 B;  3X23 A;  2Z59 B;  2LKO A;  5L83 A;  1XD4 A;  2HE7 A;  2JPH A;  2MQJ A;  4JKG B;  5C5B A;  1E8Z A;  3NY5 A;  1LM8 B;  1WGU A;  3OJ3 A;  2DA0 A;  4A6F B;  1ZSQ A;  1V81 A;  4G0N B;  4HAY B;  1WR6 E;  2GS0 A;  1WXM A;  1ZVR A;  2ZJD A;  5JLJ B;  1QC6 A;  3SYX A;  1WJ6 A;  3QWM A;  4RM9 A;  2ZEQ A;  2DX5 B;  1UEL A;  1Z5S B;  4MT7 A;  2WH5 A;  3PT2 B;  1KOT A;  5D3W A;  3DBR I;  3T9L A;  2L00 B;  5D3X A;  4IM0 A;  3TIX A;  4HVB A;  4JKF A;  4A3P A;  4NJ7 A;  3UF8 A;  1LW3 A;  2LRU A;  2V4L A;  4Z2N A;  1DYN A;  1GG3 A;  2O2V A;  3P7Z A;  1NTI A;  2LGX A;  1XR0 B;  2D10 A;  2AEH A;  3U30 A;  1UPQ A;  2ZNV B;  1OY2 A;  4RM8 A;  2PE6 B;  5DCN A;  4NAW A;  3SUZ A;  3BJI A;  1WRD B;  4AJW A;  4MM3 A;  3PSC A;  1PMS A;  3ZNI D;  4GMX B;  3PTF C;  3ZTD A;  2RUK B;  3ZNH B;  4KDL B;  2Z0O A;  2DHI A;  2UVM A;  3V61 A;  1FHO A;  4II3 B;  2A4Z A;  5D3V A;  2FIF A;  1S1Q B;  1H8C A;  4CO7 A;  4GN1 A;  1KLV A;  1BAK A;  4M8N A;  2IZV B;  1MKE A;  3VUW A;  4JL9 A;  3ZO5 B;  1WJ1 A;  1C3T A;  4TYZ A;  3AU4 A;  1KZ7 A;  2LOX A;  2NBW B;  4KZ0 A;  3QJZ A;  4ZDV A;  2KD0 A;  4GXB A;  3EFU A;  2Q13 A;  3N3K B;  3NS8 A;  2LVO A;  4W9D A;  3TBL D;  3CMM B;  3AJ4 A;  2Y5B B;  2L76 A;  4HB2 B;  2AL6 A;  2DYM A;  2MDX A;  3ZW3 A;  1V86 A;  4K1R B;  4GU2 A;  4W9F A;  3VAW A;  1DDW A;  2C5L C;  2ZCC A;  3IHP C;  5D2M B;  5AZG A;  3NSU A;  3KRX A;  4BKS A;  2CB8 A;  2LOZ A;  4HLE A;  1HE8 A;  2KAN A;  3W1S C;  2KDI A;  3Q3F A;  1ST7 A;  4K7W A;  5G55 A;  3L16 A;  3MDB C;  2W9N A;  2WWZ A;  2Y8F A;  1W1H A;  4MJS A;  1EF5 A;  3C0R B;  1X1G A;  3M63 B;  4ILJ A;  2MBH A;  1DDM A;  1WJN A;  4OVV A;  4AJY B;  1WR1 A;  2NBV B;  4W9J A;  2VRW B;  4EKU A;  4IUM B;  3W1Y A;  4NAW B;  1WI0 A;  3OLM D;  2KFK B;  3VDZ A;  5C5B B;  3WAL A;  2L2I A;  2YS3 A;  1NBF C;  3APD A;  4G11 A;  3WAO A;  1R4N I;  1H10 A;  3N32 A;  1AWE A;  2CHX A;  2NR2 A;  1I35 A;  3PGE A;  2M1M A;  3ZVR A;  1V5U A;  1E8W A;  5DPR A;  4ZRI A;  4HPM B;  4A6H A;  4FA6 A;  2NS5 A;  1DBH A;  3DBH I;  4HCP B;  1GGO A;  3ML8 A;  1ZC4 B;  2FCQ A;  3ML4 A;  4CYE A;  4MSM B;  1HB6 A;  4NPN A;  5C1Z A;  1DDV A;  5HE1 A;  4KZC A;  2LXC A;  4A6K A;  4NSW A;  2MX2 A;  1E5W A;  1WXA A;  1TGZ B;  2N23 A;  1WJ4 A;  3CST A;  4I6P A;  4N9F 4;  5C79 A;  3SHQ A;  2RGF A;  1WVH A;  2P8V A;  1J8C A;  3QIJ A;  4W9I A;  3R3M A;  4W9C A;  5DHA B;  2PEA A;  3HIZ A;  1OQY A;  1NI2 A;  2NCN A;  1XKE A;  5CHW A;  4HPL B;  1WM2 A;  2FJL A;  4WVF B;  3DPD A;  5CLQ B;  1EF1 A;  3DBL I;  4YON A;  4GDK A;  4PNK A;  1XD3 B;  3TMP B;  1MIX A;  3PSE B;  1YX6 B;  3NHE B;  2COA A;  5LXI B;  1X05 A;  4JKD A;  4JIO U;  5EFX A;  2CHZ A;  2KK8 A;  4IAP A;  3VTU A;  3VVW B;  2AWT A;  2KFK A;  2KC1 A;  4KDI C;  3WAP A;  1WE6 A;  2G3Q B;  2YVC A;  4Y94 A;  1FGZ A;  3W1S A;  1IRS A;  3N30 A;  2LRW A;  1UBI A;  2KTF A;  2MSE D;  4GDL A;  2FUH B;  1U27 A;  2P0H A;  4K17 A;  2RD0 A;  5DIF B;  4EEW A;  3S2A A;  1U5F A;  3TJP A;  2KWC A;  2ZVN A;  3DXE A;  1UEF A;  2HTH A;  3ECI A;  3PLV A;  2YLM A;  1WX9 A;  1U5E A;  3F5R A;  4Z2M B;  1VD2 A;  3JYU A;  3B0A A;  3ZDM C;  3T06 A;  2CR5 A;  1MPH A;  2N9E B;  4NY0 A;  2COC A;  4HWI B;  1KJT A;  3DXC A;  3H6N A;  3ZIM A;  3U7D A;  2GMI C;  5JHH A;  3KSY A;  1VBG A;  3KVF B;  4ZYN A;  4LCD E;  4ICV A;  2KXJ A;  3VQI A;  2V1Y A;  1SHC A;  5J18 A;  4DHJ B;  3SV1 A;  1V5O A;  3RZW C;  2MWS B;  5LLI A;  1GUA B;  4DDG D;  1ZC3 B;  5KQ4 A;  1Z87 A;  5E6P A;  2C60 A;  4DXA B;  2DX1 A;  5HE3 A;  1E7U A;  4MGY E;  3VTV A;  1D3Z A;  4EZL A;  2NBU A;  5DPS A;  1X11 A;  3O65 B;  4MDK E;  3V6C B;  2L05 A;  2L0T A;  4HB3 B;  1DIK A;  4RMA A;  4BKG A;  1JRU A;  3PRP B;  1RRB A;  1WM3 A;  1BWN A;  2KDF B;  5DPW A;  3A9K A;  2GBN A;  4BFR A;  4IC7 B;  3GZN I;  2MFQ A;  3E66 A;  1WFY A;  1NDD A;  4FBJ B;  4HJK A;  3PLU A;  2RPQ A;  2D9X A;  3KZ1 A;  1ZM0 A;  2NPT B;  3ZVV A;  4MGI E;  4EFO A;  2CKH B;  3ODX A;  4JK8 A;  2MW5 A;  1EGX A;  4X57 B;  2RVB B;  4MGZ E;  5EDS A;  3VOQ A;  3SDL C;  3PVW A;  4ICU A;  3RCZ A;  1ZKH A;  3GYO A;  2LYD A;  2ZPN A;  2PZ1 A;  2IBI B;  2JWZ A;  2QHO A;  3PEG A;  3UIN B;  4EJN A;  1WGG A;  1ZW7 A;  4OVU A;  1ISN A;  3NOB A;  4JQW C;  4XX5 A;  2OJR A;  1V2Y A;  4IM2 A;  2ZCB A;  2J0J A;  4I6L B;  3DQV A;  1E8X A;  2KUP A;  4IFS A;  1P9D U;  1X86 A;  3HW2 B;  3WIM A;  5CX3 A;  1IYF A;  5FI0 A;  1WZ0 A;  3APF A;  2FAZ A;  2WYQ A;  3A1Q A;  3QC8 B;  2KWU B;  2DHJ A;  4YL8 A;  2D9Y A;  4MH0 E;  1MK9 B;  4HK2 A;  5J17 A;  1N3H A;  5TR5 A;  2I5F A;  2C7N B;  5J3Q A;  2CRF A;  2NPT A;  1QQG A;  4HDQ A;  4MK0 A;  2N4F A;  2KNB A;  2MBE A;  3UIO B;  1I42 A;  3B08 A;  1SGH A;  3WYF B;  2LVP A;  4LJP B;  4GDL B;  1V61 A;  2KLC A;  2KHW B;  2CAY A;  3H7S A;  4IG7 B;  2MBQ A;  3VUX A;  1BT0 A;  3A4R A;  3H1U A;  2I1J A;  4FLH A;  3N7C A;  1VCB A;  1P6S A;  1SIF A;  1NU2 A;  2IYD B;  2UYZ B;  1Q0W B;  4FN2 A;  1XCG A;  2NMB A;  2KTR A;  4AOF A;  3DVN V;  1C1Y B;  5DHF B;  4GB9 A;  4EZK A;  1WMH A;  2C7H A;  5KQ1 A;  2DAJ A;  1OTR B;  4BKS D;  2EC1 A;  2DZK A;  4W9H A;  4CHK A;  2ZPY A;  2JF5 A;  1P0R A;  5GMV A;  1RRP B;  4TV3 A;  4EOY A;  2DX5 A;  4W9L A;  1J19 A;  3TO1 A;  4W9G A;  2XEW A;  2ELA A;  2UWQ A;  4WWN A;  3DOW A;  1OQN A;  3M1I B;  3ODW A;  4W9K A;  1EUV B;  1I7A A;  1PQS A;  2FID A;  1KI1 B;  1W1D A;  2N1V A;  4HDO A;  2MCN B;  3E9O A;  2Z0D B;  1HBK A;  2X18 A;  2C7M B;  5J3Y A;  2D9W A;  4EMO A;  2R82 A;  2RQ1 A;  2DKP A;  3VFK A;  1WXV A;  5IAA C;  2YF0 A;  3HQC A;  2CS4 A;  1FXT B;  3M3J A;  2LUL A;  4HB0 B;  2JUO A;  2KO3 A;  1K5G B;  2K1F A;  2BF8 B;  3UGB B;  3NZU A;  3QHT A;  4GDK B;  2PJH A;  2L3Z A;  2L1C A;  2MP2 B;  2KJR A;  1F9J A;  4GPT B;  4IOY X;  3DBS A;  2YSZ A;  1WE7 A;  3A8Q A;  2WX0 A;  3RYT A;  2KWV B;  3MHS D;  2KQS A;  3FSS A;  2LXA A;  3RUL A;  1V5M A;  2JZ3 B;  3QBV B;  3CF6 E;  3V60 A;  3L17 A;  2RNR B;  5JHB A;  4D0N B;  1G6J A;  3IBE A;  2R09 A;  3H7P B;  1UNQ A;  2DKQ A;  3FP5 A;  2Z0P A;  4HAZ B;  2K39 A;  4F1S A;  2W2X C;  4A3O A;  3PZD A;  1R4M I;  1WX8 A;  1WGR A;  2DHK A;  4KHO A;  3EC8 A;  3MTN B;  1WGQ A;  2KX3 A;  4IWQ A;  1V89 A;  1OMW A;  3HM3 A;  1NTV A;  1WXS A;  2RLO A;  3V5W A;  3JW0 X;  4P7I A;  4XZ4 A;  2RR9 A;  4HB4 B;  1U4A A;  1J0G A;  2J0M A;  5D6J B;  1LXD A;  2D4Q A;  2FNJ B;  3ALB A;  2FCN A;  3HK0 A;  3L0W B;  4C0A A;  3A9K B;  3R7R A;  2QKM A;  1U29 A;  3ZLZ A;  2Y7B A;  2DZJ A;  2KFJ A;  4F7Z A;  1L2N A;  1WY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...