4P7IA

Crystal structure of the merlin ferm/dcaf1 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
molecule keywords Merlin
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4p7iA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4p7iA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4p7iA01
3QQ8B 2N9EB 2KLGA 4CHKA 5DPSA 1J0GA 1Y19B 1FXTB 3IVFA 3UIPB 1P6SA 1OQNA 4W9HA 3B0AA 3VXWA 2YS3A 2XEWA 3QJZA 2L05A 3MDBC 2P0HA 1V89A 3DXEA 3FEHA 5DH9B 5LONB 1S3SG 2IO2B 4GDLA 5J18A 1XD4A 3MTNB 4FJVB 2KDFB 1OEYA 3A4RA 4KIKA 2C5LC 4CYEA 2MA9B 5D27A 2N4FA 4WJOA 5JHBA 4MM3A 2A4ZA 1BTNA 4WQOB 3B1LX 3W1SC 2FAZA 1NU2A 2GS0A 1WG7A 1U29A 4YONA 1WI0A 2IO1B 2PPHA 3AXCA 4K7SA 4JLCA 2D3GA 1WZ3A 4M8MA 2D9XA 3WA0A 1WJ1A 2GBNA 1GNUA 2MBQA 4BKGA 2LGYA 3L17A 3PHXB 3LJUX 2BKRB 4MJSB 3U30A 3VDZA 2CHZA 3FSSA 1P1AA 1RLFA 4NPNA 3MHSD 5CTRC 4A3OA 1HB8A 4Y94A 1QZEA 4HB3B 1WGRA 4W9GA 3W1SA 1XT9B 4ICUA 2DHKA 2Z0DB 1SE9A 3D8EA 5J17A 1K5DB 2D2QA 4ZRJA 2NCNA 4NY0A 2ADZA 2FCNA 3A1QB 3M3JA 2JWZA 5AZGA 3SU8X 4GDKA 4KHOA 5J3TA 3R3MA 1PFJA 1KOTA 5E6OA 2KDBA 2DYBA 3WAPA 2UVMA 3KYDD 1HE8A 1WJ6A 2J0KA 2I5CA 2IY0B 2WYQA 4K81A 4WJQA 5C6RA 3O65B 4BFRA 3B08A 4ZRIA 3D8DA 5KQ1A 1F9JA 2MBEA 1HBKA 1SIFA 2ASQA 1TJ6A 2C9WB 2JUOA 2RR9A 3IBEA 4Z2NA 5HE3A 5IA7A 4EKUA 3WYFB 5DHFB 1LFDA 5AEKB 1Q1OA 2M4NA 4LJOB 4RM8A 1EUVB 5JLJB 3HM3A 2Z0QA 2JP2A 2C7MB 2BYVE 3PSCA 1RRPB 3TVVA 2NBWB 3PLVA 2JXXA 1QQGA 1WJMA 4WWOA 4DDID 1UNRA 2LYDA 4BBKA 2CQUA 3DBHI 3DQVA 2D11A 2R2OA 5JZEB 2IYBA 2FIDA 2KC2A 1CMXB 2W2XC 2IO3B 1WX8A 4WJPA 2NMBA 2DHJA 3GYPA 3P7ZA 2D4QA 2RNRB 1UD7A 3L08A 5L83A 5IJMA 2ROZB 2LJ5A 2DHIA 3ODOA 1ZW7A 2Y5BB 3ZNID 1OY2A 2KGXB 4WVFB 4DBBA 2LXCA 4XC2A 2O6VA 5DHAB 4PYZA 2GCJA 3TCAA 1RAXA 2IBIB 2W2XD 4G50A 2UZRA 4FA6A 2IY1B 4JGHB 2V4LA 4KHAA 3SHQA 4A20A 1TTNA 5CHVC 3VFKA 2KTFA 4K2PA 1E8YA 4ANXA 2P0DA 1OQYA 3BY4B 1NI2A 4ZRKA 2B3AA 4BKSD 2CODA 4XZ4A 2YT1A 2LASA 3VIAA 4FJYA 2FCSA 4K17A 2LVOA 2C7HA 4DX8A 1K5GB 1X11A 2FCMA 3CMMB 1KZ7A 1M7EA 3KYCD 4NQKE 2QKLA 2N0YA 1J0WA 5TR5A 4K1RB 3UGBB 3ULCA 1FGZA 4GU2A 2C60A 2KCJA 1SGHA 2N7EA 2ABDA 4NJ7A 4HB2B 3A9JA 4IWOA 4HLEA 2CB8A 1K8RB 2FJ9A 5JP4A 2MBOA 2BCJA 2ZVOA 3PV1A 5G55A 4KDIC 3KSYA 2OJRA 2CY5A 3ZVRA 2RGFA 4NJ6A 4B9KA 1PLSA 2K2JA 5JHGA 2N23A 4IC7B 4WWNA 2EKEC 3IG3A 4G0NB 5D3YA 4LJPB 4KSKC 2DA0A 1WE6A 1BAKA 1V5TA 5CHWA 1N3HA 1ZGUB 5AZFA 3CSFA 2XQNM 2D9VA 3PLUA 1P9DU 3H7PB 3R66C 4HWIB 3T9LA 2D9WA 4ANVA 1VCBA 1UZXB 1WGHA 2L76A 1NTIA 3P2BA 5KQ4A 4IUMB 5DPRA 1IYFA 1Q5WB 4G3XB 2DKQA 2WX0A 3PRZA 3CSTA 4TKNA 3A1QA 4HATB 1Z5SB 3HIZA 4GMVA 1W1DA 2CAYA 1P0RA 4LDTB 1C3TA 4ZYNA 2DZIA 4W9CA 4PQ0A 2KTRA 4E74A 1XD3B 4DHJB 2ZJDA 3I3TB 1UH6A 1DYNA 1YJ1A 3ZRCA 2KKCA 1YX5B 2ZVNA 4HCNB 2LOXA 1ZVRA 1X05A 2HE7A 2MWNB 4EZLA 5D94A 3R7QA 1DBHA 1IRSA 3O96A 1JRUA 2MWSB 3PSEB 3ML4A 2LI5A 4MT7A 2M14A 4W9LA 3K9OB 2LKOA 3D8FA 4NSWA 1LM8B 5CX3A 4FHKA 2RLOA 5DCNA 1YQBA 4DBGA 4P7IA 3JSVA 1X1FA 5FI0A 3AI5A 2XK5B 3LJ3A 3W1YA 5JH5C 3F5RA 5JHHA 1P98A 2LGDA 5CLLB 1WI1A 1WXVA 2MX2A 3KRXA 3M62B 3DVGX 4IWPA 3WANA 4B6WA 1WJUA 2UWQA 1X1MA 3NY5A 4MGZE 4W9EA 2MCNB 1I35A 3A33B 4GDLB 4IM0A 5L81A 4HDOA 4M8NA 4B95A 2GMIC 4OVUA 2P8VA 4W9FA 2DYOA 2KO3A 3ZKJC 2K1FA 2DN6A 2KJHB 5C79A 3RT3B 2NR2A 4DX90 5KCVA 3WAMA 3G9WA 3OJ3A 1GG3A 4LDTD 1KJTA 2J7QB 5J2RA 2NPTA 2BF8B 2K6DB 4KSLC 1LXDA 4XX5A 4GSWA 1P5TA 2KMCA 3VQIA 4DHJD 4BOSC 5LLIA 4EFOA 3Q3JA 4DHZE 2N7DA 1OMWA 3EC8A 4GB9A 3JSVB 3KRWA 2G3QB 4HAVB 3APCA 3L10B 3OAWA 3ZIMA 2KDIA 1E8WA 2R2QA 2DX1A 3EFUA 1T0YA 2L1CA 2DAFA 4GXBA 1WIAA 1V80A 1U5FA 1M7RA 1V2YA 1WRDB 3JVZX 3D32A 4IWQA 1DDWA 5FI1A 2ZEQA 2BWES 5GMVA 5AZHA 1BWNA 1WFYA 1MG8A 3MPXA 1TXDA 3HK0A 4GZUA 2I1KA 5HE0A 2KTRB 3DBRI 3U7DA 1ZM0A 2J0MA 1WF9A 2GBRA 2GCLA 3SUZA 2LZ6A 2AL3A 1E90A 3N3KB 4KDLB 3TFMA 1VD2A 4HDQA 2ZNVC 1ZC3B 4J6IA 3ZNGC 4F7HA 2A5UA 2NBUA 1FAOA 1UELA 4KV2A 2RQ1A 3KY9A 1AQCA 2G45B 2OOBB 4BBNF 4PS8A 4EOYA 3DXDA 5DPWA 2NZ8B 3H1UA 4JIOU 3VOQA 3UF8A 4KHBB 2V3SA 2L0FA 4IOYX 4II3B 2FUHB 3PT2B 2MSED 4HXDA 4A6FB 3DVNU 2HTHB 2RUKB 3BJIA 2KFKB 3H6NA 4HK2A 3DVNV 4I6PA 4II2B 1GJZA 5JHAA 4ZDVA 3TJPA 1WH3A 2KLCA 1FHXA 2KMAA 1AWEA 2LOZA 3OLMD 4N9F4 2KWVB 3M1IB 1Z87A 1RRBA 1UGMA 2O2VB 3IFWB 4HPLB 4NNJB 1L2NA 5DIFB 5D3XA 1MKEA 1UBQA 4PYUA 1UPQA 2M8SA 3VUXA 2K8BA 3QBVB 2HTHA 2KFKA 2L8JA 2CKHB 1KLVA 2WWZA 4JL9A 2Z0EB 4GMXB 3ZVVA 1EF1A 2AYOB 3KZ1A 1XCGA 3PRPB 1M94A 4ICVA 1Z2MA 2PE6B 3JW0X 3QC8B 4X57B 2DKPA 4EZKA 2MP2A 2AWTA 2DZJA 3UQAA 2RD0A 5C23A 2LWPA 1WR1A 4GOCA 3AU5A 1EO6A 2DZKA 2XBBC 5C5BB 2C7NB 1P3QU 3KUZA 3VHTC 5LOPB 3VTUA 1V5MA 2COAA 4TUUA 2KVRA 4FLHA 1XX0A 1XQQA 2G35A 3DBSA 3PGEA 3TMPB 3VH3B 4DXAB 4CO7A 3QWZB 3PVLA 3A9KB 2DHZA 4HPMB 1WMHB 5KHQA 1B55A 1NDDA 3VTWA 2MFQA 3KUDB 3DXCA 5E6PA 3QX1A 2N1VA 3WALA 2W9NA 3QWMA 4GGQA 1V61A 3RUIB 2YLMA 1WXMA 4YL8A 3DOWA 1E8ZA 1ISNA 4PS3A 3UQBA 2N9PC 3EECA 4A3PA 3ML8A 2X18A 3HW2B 4L6EA 1OEYJ 2N9XA 3KW5B 3PTFC 4DHZB 3RULA 1V81A 3RYTA 2DENB 2CS4A 1H4RA 1MAIA 4H8SA 3ODWA 1WE7A 2DYMA 2LBBA 2RSGA 3ULBA 3KUCB 2DX5B 3L0WB 2NBVB 2HRJA 2JZ3B 1H10A 2Z0OA 4KVGB 4NAWA 3VAWA 2BYEA 2D07B 3ECIA 2LULA 3VUYA 3PREA 2BYFA 2YF0A 5D7GA 4MEMA 3R7RA 3KVFB 4AOFA 3L16A 3SDLC 2GBKA 3GZNI 3VTVA 3WIMA 3N32A 4NAWB 4BVUC 2KANA 3SV1A 2LXAA 2YS1A 3PS6A 2G4SA 1FOEA 2CR5A 2XK5A 2ZPYA 2KD0A 2K00A 2OQBA 5C16A 2AL6A 5EFXA 2BGFA 2V1YA 3AULA 3C0RB 3EHVA 5FR6A 5EDSA 3DBLI 3X0WA 4D0NB 4MSMB 2CY4A 2ELAA 1I42A 2VSZA 2Y8FA 2FJLA 2K39A 2N1WA 3NSUA 2YVCA 2QHOA 5CHFA 1XKEA 1LB1A 1U5DA 4HHVA 2JF5A 2RPQA 4IM2A 1U5GA 2ZNVB 2DYQA 3T8MA 4AP4C 2EMSA 4MJSA 1E7VA 3V6EB 5D3VA 1TZ1A 2LD9A 4HB4B 3CF6E 3PRMB 3ZNHB 4AJYB 4AJWA 3UINB 3V6CB 1ZKHA 1TQZA 4FHJA 2KX3A 2KDEB 3TL5A 2CU1A 3PVUA 4JQWC 3SNHA 2NPTB 2VRRB 4BBNC 4KIKB 1KM7A 1GC7A 1UPRA 3FLVA 2YRYA 2R0DA 2WH5A 3TO1A 2ZCBA 3RCZA 1GUAB 1R4MI 2HJ8A 4F1SA 5DPTA 1W1GA 2DYNA 2MP2B 1UBIA 1WJNA 2PE9A 4HJKA 2KZRA 5LXIB 3M63B 1WJ4A 1WYWB 2KK8A 4HVBA 3DDCB 3RCPA 2JVCA 4TQ1A 1EVHA 3H7SA 2DFKA 5HE1A 4PS7A 4MGKE 3ZRFA 2D9ZA 2YT0A 3ML9A 1NTVA 2JT4B 2K8HA 1OGWA 5E6NA 3DVGY 2DTCA 1WM3A 1A5RA 2MBHA 5J3YA 2IZVB 1IPGA 2UZSA 4MSQB 2H7DA 2WX1A 4OVVA 5HKHA 1E5WA 1WGUA 4WSFA 1NVLA 2ZZPB 2M1MA 1J8CA 4I6LB 1LW3A 1QC6A 1V9JA 1KI1B 2OTXA 2KFJA 1V49A 1U5EA 3M95A 2GOWA 2KNBA 3S2AA 1WVHA 3JYUA 1V5PA 2EC1A 3GOEA 3SO6A 5D2MB 1UNPA 4GPTB 5D6JB 4TQ0A 2I5FA 4HAXB 5GOWB 1WMHA 2DAJA 4A5KA 1ST7A 3ZW3A 3RD2A 3FP5A 2Y7BA 4FULA 3ZLZA 5LXHA 1YIWA 1RJ2A 2R09A 2IO0B 1U2BA 2H7EA 4B6HA 2HD5B 2IFSA 3QIJA 2V76A 2KXJA 1WXSA 5C5BA 1Y5OA 2KJ6A 2L0TA 3L54A 3HM6X 4Z2MB 4G11A 2MQJA 1D3ZA 2FDQA 1J19A 3NOBA 3QK0A 2FIFA 2COPA 5KHOA 2MBBB 4FJZA 4HAZB 4EJNA 3CXBB 2BPSA 4ANUA 4RM9A 4WJNA 4XWXA 3X23A 1L7YA 2VKIA 1WR6E 4HAYB 4W9KA 2EMTA 1EF5A 1NBFC 3V61A 2M17A 4WWPA 3V62A 3NHEB 2RGNB 2FNJB 4I6NB 1WX7A 1BTKA 3PPAA 4F7GA 2GBJA 4DK5A 2MLBA 1FHWA 3OJ4B 4FADA 1V5OA 2COCA 3A4SC 1MK9B 4HAWB 4K7UA 2KWUB 4M0WB 1FHOA 4MDKE 2LVQA 2J0JA 3K9PB 1U27A 3ONSA 4W9DA 1X86A 1ZC4B 3ZO5B 2EJ8A 4A6FA 2W2WA 2JPHA 5CLQB 2KX0A 2LRWA 3F0WA 1AARA 2KN5A 4MELA 2LVPA 3AJ4A 2KOXA 2JRHA 1V6EA 1V88A 1U4AA 1WM2A 3APFA 3Q3FA 4F8CB 1UEFA 4W9IA 2NS5A 3H9DA 3A98B 1DDMA 4MGIE 4F7ZA 2Z0PA 3DPDA 5C1ZA 1V5UA 2MDXA 3PG7A 4A6HA 4PNKA 4HB0B 2DX5A 4WAAA 3PZDA 4NQLB 1MPHA 3NZUA 4BKSA 3ZUNA 1I7AA 4GDKB 1E7UA 2NVUI 1NTYA 3ENEA 4ASWC 2CHWA 3V5WA 2KC1A 4IM3A 3QA8A 4WJ7A 1SHCA 3HQCA 5HE2A 2QKMA 4CHJA 3PVWA 1OTRB 4W9JA 4EEWA 4F7UP 1E8XA 4IFSA 1WZ0A 4ANWA 4GN1A 2JZZA 1H8CA 2GBMA 1R4NI 4FN2A 1PMSA 3A8PA 2BWFA 1P3RA 2I1JA 5DI9B 3ZDTA 2M0XA 3PP2A 3RZWC 1V86A 3AU4A 4AUQC 3ALBA 1TGZB 3T06A 1Q67A 3A8QA 4EUTA 2CRFA 3TIXA 3IHPC 2BKFA 2KJRA 1X1GA 2RVBB 1YD8U 2LUEA 3MJWA 1ACAA 3SYXA 4IG7B 1XODA 4MGYE 1DDVA 1MIXA 2J59M 4KZ0A 2L7RA 3P6AA 1WGQA 3OANA 3BINA 1LQBA 4KAXB 2G4DB 2WDTB 4IW0A 1C1YB 2VRWB 4MK0A 2YSZA 2DZMA 2K2UA 2GJYA 1WX9A 3ODXA 3N7CA 3LDZE 2K8CA 4LCDE 2KUPA 3QARA 3ZNZB 3GYOA 2P0FA 4K2OA 2LRUA 2Q13A 3UIOB 1WGGA 3V60A 3ZTCA 1YX6B 4EZJA 5IAAC 2E2XA 1WXAA 3NZSA 4C0AA 1KZGA 1WY8A 4DDGD 5G2NA 3QAQA 1GC6A 3WAOA 4BOZB 2DLWA 1I2HA 4GIVA 3UZTA 3A9JB 2RSUA 5L95C 2JRIB 4AWJA 3PEGA 5J3QA 2L00B 1PQSA 3TW1A 1MK7B 2FCQA 3TBLD 4KZCA 1Y8RC 3VVWB 3A9KA 3RZFA 2AEHA 2PEAA 3EPYA 4MH0E 2UYZB 4FBJB 1EAZA 2KHWB 2PJHA 2YS5A 1UNQA 1Q0WB 4CHMA 2O6VD 4K7WA 3HHMA 3VH4B 3ZDMC 4BKTA 1FB8A 1EGXA 2MRPA 1HB6A 3QCAA 2KQSA 2D9YA 3CIKA 2COFA 2LGXA 3PHWB 4DWFA 3DCGA 3VUWA 1W1HA 3KH0A 1WGDA 2K6QA 4HCPB 2O6VB 3U8ZA 2ELBA 3L13A 2K25A 4A6KA 2MW5A 2ZCCA 3H7PA 3SD5A 1IP9A 1XR0B 1G6JA 2LG1A 3FM8C 4TYZA 4MY6A 5D3WA 2L3ZA 4TV3A 2MKRA 4IAPA 1BT0A 1S1QB 2D10A 1WGYA 4E71A 4HAUB 2IYDB 2L2IA 1FGYA 4EMOA 2O2VA 3APDA 3NS8A 2M38A 2JY6A 2ZPNA 3N30A 4URKA 2Z59B 2Y8GA 2REXA 3QHTA 4RMAA 1MIZB 2ROVA 1DROA 1RFAA 1TBEA 1ZSQA 2KQ7A 2KWCA 5BO4B 4E3CA 2PZ1A 2CHXA 3ZTDA
chains in the Genus database with same CATH superfamily
3U7ZA 4YWGG 2KLGA 2MJEA 4CHKA 5DPSA 3AE5B 3UIPB 1P6SA 3B0AA 3DXEA 1S3SG 4GDLA 2RDHA 1XD4A 4RF1A 1OEYA 4CYEA 1MPEA 1BTNA 2J53A 2FAZA 1NU2A 1WG7A 1UGJA 1WI0A 4US8A 3B2FA 2D3GA 2E6XA 1T77A 3WA0A 3AEEB 2WDQB 4BKGA 2LGYA 4B0EA 3OWEB 3Q2AC 1GAQB 1RLFA 1HB8A 5IO9A 1WGRA 1XT9B 4ICUA 1I4QA 1SE9A 3D8EA 2NCNA 2ADZA 3M3JA 5AZGA 1RFKA 2WXJA 4KHOA 1KOTA 2UVMA 2JU6X 3KYDD 5C6RA 3O65B 3DBRB 3ZJVA 2RR9A 4EKUA 3WYFB 4LJOB 2QDFA 3FVCA 3HM3A 2BYVE 2C7MB 4C7YA 1F2RC 5IN7A 1RRPB 3TVVA 2NBWB 2NMQA 2JXXA 3I63C 2WXPA 3RNEC 2FIDA 3E56A 2W2XC 4RGNA 4PT5A 3Q6BA 5IJMA 2GUMA 1ZW7A 2LJ5A 3ZNID 4WVFB 1SBBB 2OHFA 4DBBA 1VZ7A 4NZLB 1TJEA 5DHAB 3MC9A 3SHQA 1FXIA 5CHVC 2YEPB 2KTFA 1E8YA 4ANXA 3BY4B 3NUHB 1NI2A 4ZRKA 2B3AA 3RI7C 1XLOA 2YT1A 2LVOA 1BUIC 2C7HA 1K5GB 3CMMB 1A5RA 2N0YA 4TMAB 4K1RB 3ULCA 1FGZA 1SGHA 3A9JA 4HLEA 2TSSA 3WCQA 1V1PA 2RGFA 3ZVRA 4IC7B 2N23A 2EKEC 3IG3A 5CHWA 1V5TA 2AQ3B 5AZFA 2MJ3A 3H7PB 2WXMA 3BVMA 2L76A 4JWUC 1Q5WB 4G3XB 2DKQA 3PRZA 3A1QA 3R2IA 2W55A 1C3TA 4YTNB 4W9CA 4WWMA 1UH6A 1DYNA 1K53A 1N5XA 3ZRCA 1YX5B 2MWNB 1YQ4B 1JRUA 2M14A 3K9OB 3SR6A 1TS4A 1F77A 3NVWA 2BS3B 1ROEA 4P7IA 1WYGA 4DBGA 1X1FA 4KKIA 4LNFA 1GB4A 1FNVA 2LGDA 5CLLB 2ACZB 3M62B 3RFZB 3KRXA 1C4AA 3DVGX 2JQRB 3WANA 1STEA 1JW9D 3AEAB 4B95A 4C7ZA 2DYOA 3SFDB 1JWAD 2INCC 2KJHB 2Y5PA 3G9WA 4LDTD 1OFFA 2J7QB 5J2RA 2NPTA 5HG2A 4XX5A 1LXDA 2K49A 4DHJD 3EC8A 3KRWA 3APCA 4HAVB 2NTTA 3OAWA 1OQRA 1L4ZB 1T0YA 5FK9C 1WIAA 4JKGB 1BWNA 2ZW1A 3DBRI 3UINB 3TMPB 2BTEA 2GBRA 2GCLA 3KWVA 2ZNVC 4J6IA 4KV2A 1YOVB 4ILHA 3VR9B 3B77A 1WSPA 4PS8A 1MJDA 4EOYA 5DPWA 1VZ8A 4KHBB 1ZUD2 5D3DA 4IOYX 4YSXB 4II3B 4TSSA 2MSED 4A6FB 5MPOA 3DVNV 4I6PA 2KLCA 1AWEA 2LOZA 3OLMD 2KWVB 3M1IB 1UGMA 3IFWB 3MJ5A 2I38A 5DIFB 1UBQA 2WXHA 2CKHB 1HTQA 3KZ1A 1XCGA 1ZP0B 3SFEB 4EZKA 1YNTE 5C5BB 1P3QU 1SB3C 4TUUA 4FLHA 1XX0A 4CO7A 3PGEA 4IKGA 4QJ4B 1YN3A 2DHZA 4HPMB 5KHQA 2MFQA 5E6PA 3WALA 2W9NA 1MI1A 1L0YB 4GGQA 1V61A 2YLMA 3UQBA 3EECA 4A3PA 2QCZA 3HW2B 4L6EA 1UUPA 4JKAA 1MAIA 1TS5A 3KUCB 2LBBA 2RSGA 1TT5B 2DX5B 2NBVB 3GS2A 4BVUC 2GBKA 3VTVA 4NAWB 1OQQA 2KANA 2N7JA 2PKOA 2MHJA 3AULA 4E71A 2OQBA 5C16A 2KACA 2AL6A 5EDSA 1HQRD 4D0NB 1I42A 2VSZA 5CHFA 1N62A 2WXFA 2DYQA 4MJSA 1KTKA 1NENB 3CF6E 1ZKHA 1TQZA 2ZW0A 3TL5A 2CU1A 4JQWC 2BBCA 1GC7A 3BYYB 3HUIA 5DPTA 1TKGA 1SE4A 3M63B 4FXCA 2R2YA 5I2SA 3RCPA 1EM7A 2JVCA 2WQYB 2D9ZA 3ML9A 2JT4B 2K8HA 2VZKD 5J3YA 4ILJA 5HKHA 4OVVA 1WGUA 1NVLA 2M1MA 4I6LB 2ON8A 1LW3A 1QC6A 2KFJA 1KI1B 2W3SA 1HXYD 5D6JB 1CK1A 2I5FA 1FRRA 3ZW3A 3RD2A 3FP5A 3ZLZA 4FULA 5LXHA 1YIWA 2R09A 4B6HA 1QOGA 5C5BA 2L0TA 3Q3MC 3L54A 3HM6X 1AN8A 5C2TB 1JWBD 1KH0A 1J19A 1FPYA 2FIFA 4FJZA 4ANUA 4ZYSA 2BPSA 3V61A 2EMTA 2IDYA 2M17A 2MLBA 4OZCA 2QILA 2J0JA 4A6FA 2W2WA 2JPHA 5CLQB 2LRWA 1ZYIA 1D6EC 2LVPA 3AJ4A 2KOXA 4KHBA 2JRHA 2MH7A 1V88A 1VR9A 3N1YC 1UEFA 4W9IA 3A98B 2LHEA 3O13A 4HRSA 2Z0PA 1QOBA 4XE0A 2VH1A 1C4PA 1K50A 2DX5A 1I7AA 1FRDA 1PDXA 1NTYA 3ENEA 3V5WA 4IM3A 4RGTA 3QA8A 5HE2A 5IKCM 5EE1A 2QSDA 4F7UP 1WZ0A 4ANWA 4GN1A 5I4DA 1R4NI 1PMSA 3AECB 2I1JA 1V86A 2KYWA 1Q67A 3A8QA 2L52A 1X1GA 1UWMA 2LUEA 3MJWA 4IG7B 1XODA 2L32A 1DDVA 2KDMA 2J52A 4KAXB 2G4DB 2VRWB 1JQ4A 2DZMA 3MP9A 3Q8BA 2KUPA 3QARA 3ZNZB 2P0FA 4K2OA 2JWUA 1YX6B 3E66A 2ICIA 2E2XA 2B76B 2WXLA 1WY8A 2OEDA 1C76A 1GC6A 4XWTA 2RSUA 2JRIB 4YTMB 5IP4D 1PQSA 2FCQA 4KZCA 1Y8RC 3RZFA 1F1HA 1ZPSA 1V97A 2HTME 3AEGB 4JKBA 2UYZB 1TYGB 4K3BA 2KHWB 1Q0WB 4K7WA 4XWWA 3VH4B 1FB8A 3CIKA 2COFA 2WXOA 3KH0A 3TEYA 2K6QA 1WGDA 2ELBA 3H7PA 3SD5A 3AEDB 1E0ZA 4TV3A 3Q14C 1AW7A 2MKRA 2N9KA 4EMOA 3APDA 3AM9A 1T6BX 2ZPNA 3N30A 2KWDA 2HJ1A 1TBEA 2KQ7A 1ZSQA 2WNMA 3FKYA 2ZKMX 2N9EB 3Q3OC 5LG4B 1FXTB 3IVFA 4W9HA 2YS3A 1QQRA 1V89A 2IO2B 1YJIA 2INDC 2C5LC 5BYSA 5JHBA 2A4ZA 3B1LX 5FKAC 2IO1B 1U29A 4K7SA 1HZ5A 1WJ1A 2GBNA 4MJSB 2LEKA 3VDZA 2CHZA 1TIFA 2LFIA 4ACFA 4CQNA 2CU3A 2Z0DB 3FILA 2D2QA 1CQVA 3A1QB 4NY0A 2FCNA 2WHIA 2JWZA 2MEKA 4MM3B 1NYRA 2KDBA 3WAPA 2I5CA 4GOUA 3B08A 3D8DA 3EFCA 1F9JA 2PTLA 1HBKA 2LHDA 4HROA 3RPFC 2Z0QA 3ZGZA 2LYDA 3DBHI 3DQVA 4RFBA 2D11A 2R2OA 5HFYA 2IYBA 2KQ4X 3NVYA 2NMBA 4JK9A 4ARCA 1K51A 5H92C 5L83A 1OY2A 3NG0A 2QJLA 2GCJA 1RAXA 4FA6A 2V4LA 4S0RA 4KHAA 3VFKA 4N58A 4K2PA 4USAA 3E9SA 4FJYA 5G5HA 1KZ7A 3KYCD 4NQKE 1J0WA 2N7EA 3B9JA 3TEZA 2FJ9A 1CZPA 4NJ6A 1C77A 3RMKC 4G0NB 4JE3B 5D3YA 1F2RI 2DA0A 1HA5A 1BAKA 1K52A 1FNWA 1P9DU 4HWIB 3J9CA 1VCBA 1D5XC 1UZXB 1WGHA 1NTIA 2X38A 5KQ4A 4IUMB 1IYFA 2WU2B 4TKNA 4HATB 4ZHPA 4GMVA 4QJ3B 1W1DA 1P0RA 1XD3B 3I3TB 2LOXA 1X05A 2Z13A 2CJOA 3MC0B 2MWSB 4W9LA 2LI5A 4MT7A 4NSWA 5DCNA 2BQQA 5FI0A 2XK5B 3W1YA 5JH5C 3F5RA 2W3RA 1WI1A 4LLGM 2UWQA 1X1MA 3NY5A 4W9EA 4GDLB 4HKZE 5L81A 2KAJA 2P8VA 3GP7A 1T0SC 3ZKJC 2EELA 5C79A 1FEHA 3DWMA 2WGSA 1FCCC 2H89B 3VQIA 1P5TA 2KMCA 4EFOA 3Q3JA 4M0WA 2R2QA 3EFUA 5E6JA 1XEEA 1V80A 1U5FA 1WRDB 4IWQA 1DDWA 1FFUA 2BWES 4RGMA 4ZHOA 3MPXA 1TXDA 1ENFA 4GZUA 3MTNB 2D3BA 3N3KB 2J0MA 1WF9A 4KDLB 1E90A 1JRPA 2A5UA 5EE9A 1FAOA 1UELA 4ZOHC 2RQ1A 1I7HA 3U2SC 4BBNF 2G45B 3DWGC 1Y56A 3VOQA 3AE4B 3UF8A 1PUTA 1JROA 4HXDA 1QOFA 2KFKB 2RUKB 4II2B 2R82A 4N9F4 3KQ4A 4NNJB 1RRBA 2KVZA 3VUXA 1UPQA 2KFKA 4N59A 5H8YE 3CIRB 4JL9A 4GMXB 3ZVVA 2WXGA 1M94A 4ICVA 1C9FA 4X57B 2RD0A 2NTSA 4HSIA 4GOCA 3AU5A 2IPKD 2DZKA 2XBBC 4OSNA 1D5ZC 3KUZA 3VHTC 1V5MA 1SE3A 2KVRA 3DBSA 3VH3B 4DXAB 3ZJUA 2K5PA 3AB5A 1B55A 1ZOYB 3DXCA 2N1VA 1FXAA 3DOWA 1E8ZA 1ISNA 3AEBB 3GZNB 2N9PC 3ML8A 1SE2A 3R8BA 5GXGB 3KW5B 3PTFC 3NRZA 1L4DB 3RULA 2DYMA 2DENB 1H4RA 4H8SA 3ODWA 3ULBA 4M01A 2HRJA 2BYEA 3HRDD 4AOFA 3L16A 3SDLC 2BS2B 4C4VA 2G4SA 4RH6A 2XK5A 2K00A 1ZXHA 2BGFA 2BVCA 4MSMB 2CY4A 2ELAA 1XF5L 1UF0A 2K39A 4YTPB 2YT2A 3NSUA 1N60A 4DIXA 1U5DA 3NS1A 1U5GA 3T8MA 1E7VA 5D3VA 1TZ1A 2LD9A 4HB4B 3PRMB 4AJWA 2JSVX 2V3NA 2K3UA 2KX3A 4FHJA 4KIKB 1KM7A 3FLVA 3RCZA 3SBGA 1TS3A 1R4MI 2HJ8A 2MP2B 2DIKA 2E3TA 2KK8A 1KF6B 3DDCB 3Q8FA 1TY2A 1NTVA 1T5XD 2IZVB 1IPGA 1KBLA 1I4RA 4WSFA 1V49A 5HHDG 1U5EA 4JKDA 2GOWA 1WVHA 3JYUA 1V5PA 2EC1A 2BB6A 3SO6A 4TQ0A 1UNPA 4GPTB 3AE9B 4HAXB 1WMHA 1BMLC 2M19A 1RJ2A 2FJUB 2KXJA 1ZDVA 2SEBD 1AYFA 2WS3B 4Z2MB 4G11A 1D3ZA 4ILGB 1FO4A 1FD6A 5KHOA 2MBBB 3CXBB 3W5VB 4XWXA 5FR3A 1KLGD 1EF5A 5BMHA 1QLBB 2FNJB 1WX7A 1BTKA 3PPAA 4F7GA 1XLNA 1RWSA 1MK9B 4HAWB 4MDKE 2LVQA 3ONSA 1X86A 1ZC4B 5EE3A 3AE8B 2X0SA 1AARA 1L0VB 1V6EA 3Q3FA 1WM2A 2NS5A 3H9DA 1DDMA 4MGIE 2LMCA 4A6HA 4PNKA 3PZDA 3NZUA 2NVUI 2MJDA 3VRAB 1OTRB 4W9JA 3HQCA 1DOIA 1J7CA 5M4YB 2JZZA 4FN2A 1P3RA 1WWTA 3KWLA 1SJHD 3IAS1 3PP2A 4QXAB 3AU4A 4AUQC 2CRFA 3IHPC 2KJRA 4A55A 2RVBB 1YD8U 3P1MA 1DYQA 4BAXA 4DQOC 4IW0A 3OANA 2K2UA 1WX9A 3ODXA 1PGXA 4LCDE 1JMLA 2LRUA 3V60A 3ZTCA 2Q13A 4EZJA 1WGGA 3MHZA 1HTOA 1GOZA 3OG5A 4JK8A 1TZOA 2PVGC 4AWJA 2M56B 3TBLD 4DXFA 1NYQA 4REZA 2PEAA 1J7AA 1EAZA 2YS5A 1EGXA 2MRPA 1HB6A 2W54A 4DWFA 2D9YA 2LGXA 1T3QA 1RYJA 3DCGA 1TS2A 4QJ5B 2DLBA 2O6VB 1WGKA 3U8ZA 2K25A 1IUEA 4P1BC 1XR0B 1G6JA 3FM8C 4TYZA 4MY6A 4HAUB 1XO3A 2PMVA 5BYRA 1FGYA 3PZ8A 4OZBA 3NS8A 2W82A 2M38A 2JY6A 3NWFA 2PZ1A 2CHXA 4KGTA 3QQ8B 4KX6B 1OQNA 3VXWA 4C00A 3QJZA 3MDBC 2P0HA 5LONB 2QMTA 2N9LA 4FJVB 4OVZA 1GGOA 2KDFB 3A4RA 4KIKA 2LJIA 4WQOB 2PPHA 2GS0A 4YONA 3AXCA 4JLCA 4M8MA 1WZ3A 1XCTL 2D9XA 2WXQA 3L17A 3PHXB 3LJUX 3U30A 1NVID 4BZAA 1P1AA 4A3OA 3MHSD 5CTRC 1QZEA 1IBXB 3H8HA 4M00A 4W9GA 2D3CA 2LGIA 5J17A 1K5DB 2BYTA 4M02A 2L83A 4IOIE 5J3TA 3R3MA 4WQMA 5E6OA 2DYBA 1HE8A 1WJ6A 2IY0B 4WJQA 4K81A 4BFRA 4PK1A 2MBEA 2C9WB 1TJ6A 3IBEA 4Z2NA 1MI0A 5AEKB 1LFDA 2G9HD 2M4NA 5JLJB 2RDGA 2JP2A 1QQGA 1Q10A 1WJMA 1EWCA 4DDID 1UNRA 5JZEB 1CMXB 2IO3B 2QEJC 1F0ZA 3GYPA 3P7ZA 2RNRB 3C8YA 2ROZB 2Y5BB 3ODOA 1JCKB 2KGXB 4XC2A 2O6VA 4PYZA 3TCAA 2W2XD 4A20A 2QC8A 3PZ7A 2GRIA 1MHXA 3AH7A 1R4MB 4BKSD 2FCMA 3WAMA 1M7EA 3UGBB 3RNCC 2QKLA 5TR5A 3BK1A 2C60A 2KCJA 2ABDA 2AQ2B 2CB8A 1K8RB 2PLPA 2CY5A 1SIJA 5JHGA 3CWIA 3MC8A 4LJPB 3GB1A 4KSKC 2FBWB 1ZGUB 3P4PB 3CSFA 2XQNM 2D9VA 3PLUA 3U12A 4S17A 4J3OD 5DPRA 3BK2A 2WX0A 2BW2A 3V05A 4D6WA 3HIZA 1Z5SB 4L23A 4GLSC 2XNAC 2DZIA 2KTRA 5AUIA 4A6QA 1JALA 3ZXRA 2KKCA 4EZLA 1ZVRA 4WAFA 2HE7A 1PYWD 5D94A 1DBHA 1IRSA 3O96A 1I4PA 3PSEB 3ML4A 3D8FA 1LM8B 4FHKA 1YQBA 2WLBA 1EU4A 5LNK1 2WXIA 5JHHA 1DGJA 4MGZE 2MCNB 3A33B 4M8NA 3GE3C 2GMIC 4W9FA 2KO3A 2K1FA 1ESFA 3E9PA 2DN6A 3RT3B 2KR0A 1JWMD 2D3AA 5KCVA 4HJGE 1I4HA 3OJ3A 1GG3A 1KJTA 2BF8B 2K6DB 4GSWA 5LLIA 4US9A 1OMWA 3BVZA 4GB9A 3JSVB 2IJ0A 3ZIMA 4GXBA 4L1RA 1V2YA 1M7RA 3JVZX 4ZRQA 3RNBC 3D32A 2ZEQA 3LYYA 2ONQA 1MG8A 1MFWA 2I1KA 5HE0A 3QCAA 1YJJA 3SUZA 2BS4B 2AL3A 4HDQA 1ZC3B 3ZNGC 4F7HA 2DNFA 4AS1A 3KY9A 3DXDA 1YN4A 3H1UA 4JIOU 2V3SA 1N6ZA 2L0FA 2N0SB 2FUHB 3PT2B 3DVNU 3AEFB 4HK2A 4NAMA 3TJPA 1QKZA 1WH3A 4QAYA 4PYUA 5D3XA 1MKEA 2INNE 1XLPA 2KIEA 2M8SA 3QBVB 1N61A 2Z0EB 1EF1A 1Z2MA 2PE6B 3QC8B 2DKPA 1ET9A 3UQAA 2MP2A 2DZJA 5C23A 2LWPA 3VTUA 1I4GA 1KFYB 2RMMA 3ENBA 2G35A 1L6UA 3BVGA 4JKGA 3NWDA 1D5MC 3VTWA 1NDDA 3U52E 4A9AA 1GPXA 1VBHA 4YL8A 4PS3A 1WRIA 3I9V1 2X18A 1KRHA 2N9XA 3NW8A 1OEYJ 4HEA1 2I2YA 4C4VB 2JZPA 4JKHA 3RYTA 3T3NA 2CS4A 2V3PA 4GU2A 1PGAA 1WE7A 2Z0OA 4O1NA 1MHHE 1UWXA 2D07B 3ECIA 2LULA 3VUYA 1C78A 3R7RA 2YF0A 5D7GA 1YN5A 3WIMA 3W5UB 2GLSA 1XXGA 4MACA 2LXAA 1T0QC 2YS1A 4RCOA 4ARIA 2ZPYA 3C0RB 5EFXA 4JPSA 5FR6A 3DBLI 3X0WA 2Y8FA 2RDBC 2FJLA 2H88B 2YVCA 1XKEA 1LB1A 2JF5A 2RPQA 4IM2A 3DBLB 1L6VA 3V6CB 2KDEB 4BBNC 3SNHA 2YRYA 2ZCBA 2WH5A 3DHHC 2DYNA 1UBIA 1WJNA 2PE9A 4HJKA 5LXIB 2V0GA 1WYWB 4HVBA 4LNOA 2K9XA 4IDIA 4TQ1A 1EVHA 3H7SA 2DFKA 4MGKE 2Z4DA 2YT0A 1SJED 3DVGY 2DTCA 1WM3A 2SAKA 2MBHA 3LB8C 4LK0M 2H7DA 2ZZPB 1V9JA 2OTXA 1FIQA 1NEKB 3S2AA 2WXNA 5D2MB 1MVKA 5GOWB 4A5KA 3HVDA 3BWUD 3N1XC 2IO0B 3TSSA 4XDDA 3QIJA 2V76A 1P7FA 1Y5OA 3ETRA 2RPVA 5BYQA 1DIKA 3NOBA 4OW0A 4MH8A 2KT7A 4RM9A 1HEZE 4W9KA 1WR6E 3W9CB 4HAYB 1NBFC 2GI9A 4WWPA 3NHEB 2RGNB 2GBJA 3E9OA 4HPPA 4DK5A 1FHWA 5BMGA 2COCA 2WU5B 2D5GA 4K7UA 2KWUB 4M0WB 3ZO5B 4W9DA 3GZNI 2KX0A 1DOXA 3F0WA 1U4AA 1B1ZA 4F7ZA 2EKIA 5C1ZA 3DPDA 3Q8CA 2JX5A 1V5UA 3PG7A 4HB0B 5D3IB 3AN1A 1MPHA 1IGCA 3ZUNA 3IT6B 1E7UA 4K3CA 4ASWC 2CHWA 2KC1A 2HDEA 4EEWA 2QKMA 3NWAA 4JWSC 3RNAC 4IFSA 2GBMA 3OHMB 3A8PA 2BWFA 3SEBA 4HKQA 3RZWC 2WP9B 3P4RB 3ALBA 4JKEA 1TGZB 3BIID 3T06A 2BKFA 1ACAA 3SYXA 3MFGA 1TKEA 4MGYE 1MIXA 4KZ0A 2L7RA 2YEPF 1WGQA 1LQBA 3BINA 1C1YB 4MK0A 2FUG1 2GJYA 3P42A 3LDZE 3N7CA 2K8CA 2QIEB 3N9YC 2KN4A 3UIOB 5G5GA 5IAAC 2LUMA 3NZSA 4C0AA 1KZGA 3FILB 5G2NA 3WAOA 1I2HA 3DHIC 3UZTA 2UU7A 5L95C 3PEGA 3TW1A 1MK7B 2BT6A 5IRSA 3A9KA 1UNSA 5AUKA 3EPYA 1XCQL 4FBJB 1GB1A 2PJHA 4YXDB 5JVLA 1FNUA 2KQSA 3PHWB 1J7BA 1W1HA 4KKJA 4ZRPA 2K22A 2KIGA 3DHGC 2ZCCA 1IP9A 2LG1A 2L3ZA 1QOAA 4IAPA 1S1QB 1WGYA 2D10A 1VLBA 2O2VA 1ACCA 3QHTA 4RMAA 1MIZB 4E3CA 1DROA 1N5WA 1RFAA 2PVOD 3KLSX 2KWCA 3ZTDA 2IGGA 2K0PA 1TKYA 3AE6B 2IGHA 1XLQA 1Y19B 1LO5D 3TEXA 2XEWA 1E10A 2L05A 4JKCA 5DH9B 5J18A 3FEHA 1JWSD 2WXRA 2MA9B 3RNFC 5D27A 2N4FA 3Q8EA 1AWDA 4MM3A 4WJOA 3UI3A 1L5PA 4RGOS 3W1SC 4WURA 1C79A 1F52A 1GNUA 4KGRA 2MBQA 3EGRA 2BKRB 2M0AA 2Z8LA 3FSSA 4NPNA 4Y94A 4HB3B 3W1SA 2Y5CA 2DHKA 4ZRJA 1T0RC 3SU8X 4GDKA 4XDCA 1PFJA 3BZDB 2GB1A 3U4EG 3B2GA 2J0KA 1QF6A 2WYQA 1VRAB 4ZRIA 5KQ1A 1SIFA 2ASQA 2JUOA 2FE8A 1JDEA 5HE3A 3AV8A 4KGSA 5IA7A 5DHFB 1Q1OA 4RM8A 1EUVB 3TEWA 2LGSA 2JYEA 3PSCA 2L1AA 3PLVA 3HIEA 4WWOA 1SSNA 3EA6A 4BBKA 2CQUA 2KC2A 1WX8A 4WJPA 2DHJA 1FCLA 1UD7A 2D4QA 3L08A 3AE1B 1EU3A 2DHIA 1N63A 2V4IB 2LXCA 4OZAA 4G50A 2IBIB 2OJWA 4NJCA 2UZRA 2IY1B 4JGHB 2G1EA 1D4BA 1TTNA 2WXKA 2P0DA 1OQYA 2CODA 4XZ4A 2LASA 4R3DA 3VIAA 2FCSA 4K17A 4DX8A 1X11A 4YT0B 4NJ7A 4HB2B 3P4SB 1RM6C 3ABVB 1ZXIA 4IWOA 2ZVOA 2MBOA 5JP4A 3PV1A 2BCJA 3PO0A 1V1OA 5G55A 4KDIC 3KSYA 2OJRA 4B9KA 1PLSA 2K2JA 4YSZB 2J42A 4UDUC 1WE6A 1N3HA 3AE3B 3R66C 2D9WA 4ANVA 3P2BA 3CSTA 4ITKA 2CAYA 4LDTB 4ZYNA 4GNKB 4PQ0A 4E74A 4DHJB 2ZJDA 1YJ1A 3FAHA 4D2KA 2ZVNA 2V9HA 4HCNB 4YSYB 3R7QA 1H8CA 4P1CC 1R4NB 2BB5A 2LKOA 4OT1A 1BXTA 5CX3A 2RLOA 3JSVA 3AI5A 3LJ3A 1P98A 4JX1C 2MX2A 1WXVA 4B6WA 4IWPA 1WJUA 1R7SA 1I35A 4IM0A 3T3OA 4HDOA 2Z14A 4OVUA 1E7PB 1YQ3B 2NR2A 4DX90 3N20C 4P6VF 3W2DA 4KSLC 4BOSC 4RNAA 4DHZE 2KMMA 2N7DA 3L10B 2G3QB 2KDIA 1E8WA 2DX1A 3IAM1 1FFVA 2L1CA 2DAFA 1LGRA 4Q2JA 3I57A 3DCXA 5FI1A 4L2YA 5GMVA 5AZHA 1WFYA 3HK0A 1KLVA 2Y3AA 2KTRB 3U7DA 1ZM0A 4CSQA 2LZ6A 3C19A 3TFMA 1VD2A 4MT5A 2NBUA 4LNIA 1C4CA 1AQCA 2OOBB 2NZ8B 2NBVA 5IOIA 2VZKB 1VZ6A 2HTHB 3BJIA 3H6NA 1GJZA 5JHAA 3NVVA 4ZDVA 4LNKA 3P4QB 4N6EB 1FHXA 2KMAA 2O2VB 1Z87A 4HPLB 1FMAD 4H2AA 2K8BA 2HTHA 2WDRB 2L8JA 2WWZA 3IXSA 3Q8AA 1B9RA 3R2TA 2AYOB 3L4PA 3PRPB 3JW0X 2AWTA 3AMZA 1P7EA 1WR1A 1EO6A 2C7NB 1WXQA 3NJTA 5LOPB 1DOYA 2COAA 1XQQA 3PVLA 3A9KB 1QT9A 1WMHB 3KUDB 3A58A 3QX1A 3ZQ4A 3QWMA 3RUIB 1WXMA 1IGDA 4DHZB 4RF0A 1V81A 2XN9C 4NAWA 3T9LA 3QWZB 1J0GA 3L0WB 3ZYYX 2JZ3B 1H10A 4KVGB 3VAWA 4LNNA 3PREA 2BYFA 4MEMA 3KVFB 2PIAA 3N32A 2DBYA 3SV1A 3PS6A 1FOEA 2CR5A 5EE0A 4OHJA 1JWUD 2KD0A 2V1YA 2DWQA 3EHVA 1IBXA 3BYTB 2N1WA 2QHOA 4HHVA 2ZNVB 4AP4C 2EMSA 4XYCA 3V6EB 3TUOA 4AJYB 3ZNHB 4P16A 3PVUA 2VRRB 2KUQA 1E9MA 2NPTB 4C56C 1UPRA 3Q69A 4DXGA 2R0DA 3TO1A 3Q3NC 4B0MA 1YMHE 1GUAB 2WDVB 5T8IA 4F1SA 1W1GA 5BMIA 2KZRA 1WJ4A 2JYTA 2VH2A 5HE1A 4PS7A 3ZRFA 1QILA 5E6NA 1OGWA 3GE8C 4MSQB 2UZSA 2WX1A 1E5WA 1J8CA 1ZE3D 3NVZA 3M95A 2INPE 2KNBA 3GOEA 3ZJTA 1PGBA 2DAJA 1ET6A 1ST7A 2Y7BA 3P63A 4A90A 1U2BA 2H7EA 1CJEA 2HD5B 2IFSA 1I4XA 3VR8B 1WXSA 2KJ6A 2JXTA 2MQJA 2FDQA 2R61A 3QK0A 3AE7B 2COPA 1SF0A 3SBTA 4HAZB 4EJNA 4WJNA 3RN9C 3X23A 1L7YA 2VKIA 3V62A 4I6NB 1V1PB 3OJ4B 4FADA 1V5OA 3A4SC 4C80A 2K8EA 4AQ7A 1FHOA 3K9PB 1U27A 3EUB2 3NZ3A 2EJ8A 4LTUA 1SEBD 4MELA 2KN5A 3APFA 4F8CB 2CJNA 2PW9A 5C3JB 2MDXA 1VDVA 4WIPA 4WAAA 4NQLB 4BKSA 1NI3A 1ZDXA 4GDKB 2J4XA 3E9LA 4L1BA 4EE2A 4WJ7A 1SHCA 4CHJA 3PVWA 1SXTA 1E8XA 3AE2B 1KLUD 5DI9B 2RRFA 3ZDTA 1EWYC 2M0XA 3HSAA 5TSSA 3RNGC 4EUTA 3TIXA 2J59M 3P6AA 3VRBB 2WDTB 3HVZA 2YSZA 5I2MA 1MG4A 1E6EB 1PFDA 4JK7A 3LXFA 2Q5WD 5HI1A 3GYOA 1FM0D 1HZ6A 1WXAA 3DBHB 4DDGD 3V3XA 3QAQA 3N1ZC 4BOZB 2DLWA 3I5JC 3A9JB 4GIVA 1L0XB 3URYA 4WH4A 3IT4B 1KC7A 5J3QA 1TY0A 2L00B 3VVWB 4XGAB 2IGDA 2AEHA 4JKFA 4MH0E 2O6VD 1UNQA 4CHMA 3HHMA 3ZDMC 4BKTA 1V8CA 2AQ1B 3VUWA 4A8XC 4HCPB 3L13A 3ZXVA 4A6KA 2MW5A 1M4VA 5D3WA 5JXVA 1BT0A 2IYDB 2L2IA 1VJKA 2X8XX 1VBGA 1A70A 2AX5A 4URKA 2Z59B 2Y8GA 2REXA 1L2NA 2ROVA 5BO4B 3FC4A 2Z59A 4WWNA
chains in the Genus database with same CATH topology
2KLGA 4CHKA 5DPSA 3UIPB 1P6SA 3B0AA 3DXEA 1S3SG 4GDLA 1XD4A 1OEYA 4CYEA 1BTNA 2FAZA 1NU2A 1WG7A 1WI0A 2D3GA 3WA0A 4BKGA 2LGYA 1RLFA 1HB8A 1WGRA 1XT9B 4ICUA 1SE9A 3D8EA 2NCNA 2ADZA 3M3JA 5AZGA 4KHOA 1KOTA 2UVMA 3KYDD 5C6RA 3O65B 2RR9A 4EKUA 3WYFB 4LJOB 3HM3A 2BYVE 2C7MB 1RRPB 3TVVA 2NBWB 2JXXA 2FIDA 2W2XC 5IJMA 2LJ5A 1ZW7A 3ZNID 4WVFB 4DBBA 5DHAB 3SHQA 5CHVC 2KTFA 1E8YA 4ANXA 3BY4B 1NI2A 4ZRKA 2B3AA 2YT1A 2LVOA 2C7HA 1K5GB 3CMMB 1A5RA 2N0YA 4K1RB 3ULCA 1FGZA 1SGHA 3A9JA 4HLEA 2RGFA 3ZVRA 4IC7B 2N23A 2EKEC 3IG3A 5CHWA 1V5TA 5AZFA 3H7PB 2L76A 1Q5WB 4G3XB 2DKQA 3PRZA 3A1QA 1C3TA 4W9CA 1UH6A 1DYNA 3ZRCA 1YX5B 2MWNB 1JRUA 2M14A 3K9OB 4DBGA 4P7IA 1X1FA 2LGDA 5CLLB 3M62B 3KRXA 3DVGX 3WANA 4B95A 2DYOA 2KJHB 3G9WA 4LDTD 2J7QB 5J2RA 2NPTA 4XX5A 1LXDA 4DHJD 3EC8A 3KRWA 3APCA 4HAVB 3OAWA 1T0YA 1WIAA 4JKGB 1BWNA 3DBRI 3UINB 3TMPB 2GBRA 2GCLA 2ZNVC 4J6IA 4KV2A 4ILHA 4PS8A 4EOYA 5DPWA 4KHBB 4IOYX 4II3B 2MSED 4A6FB 3DVNV 4I6PA 2KLCA 1AWEA 2LOZA 3OLMD 2KWVB 3M1IB 1UGMA 3IFWB 5DIFB 1UBQA 2CKHB 3KZ1A 1XCGA 4EZKA 5C5BB 1P3QU 4TUUA 4FLHA 1XX0A 4CO7A 3PGEA 2DHZA 4HPMB 5KHQA 2MFQA 5E6PA 3WALA 2W9NA 4GGQA 1V61A 2YLMA 3UQBA 3EECA 4A3PA 3HW2B 4L6EA 4JKAA 1MAIA 3KUCB 2LBBA 2RSGA 2DX5B 2NBVB 4BVUC 2GBKA 3VTVA 4NAWB 2KANA 3AULA 4E71A 2OQBA 5C16A 2AL6A 5EDSA 4D0NB 1I42A 2VSZA 5CHFA 2DYQA 4MJSA 3CF6E 1ZKHA 1TQZA 3TL5A 2CU1A 4JQWC 1GC7A 5DPTA 3M63B 3RCPA 2JVCA 2D9ZA 3ML9A 2JT4B 2K8HA 5J3YA 4ILJA 5HKHA 4OVVA 1WGUA 1NVLA 2M1MA 4I6LB 1LW3A 1QC6A 2KFJA 1KI1B 5D6JB 2I5FA 3ZW3A 3RD2A 3FP5A 3ZLZA 4FULA 5LXHA 1YIWA 2R09A 4B6HA 5C5BA 2L0TA 3L54A 3HM6X 1J19A 2FIFA 4FJZA 4ANUA 2BPSA 3V61A 2EMTA 2M17A 2MLBA 2J0JA 4A6FA 2W2WA 2JPHA 5CLQB 2LRWA 2LVPA 3AJ4A 2KOXA 2JRHA 1V88A 1UEFA 4W9IA 3A98B 2Z0PA 2DX5A 1I7AA 1NTYA 3ENEA 3V5WA 4IM3A 3QA8A 5HE2A 4F7UP 1WZ0A 4ANWA 4GN1A 1R4NI 1PMSA 2I1JA 1V86A 1Q67A 3A8QA 1X1GA 2LUEA 3MJWA 4IG7B 1XODA 1DDVA 4KAXB 2G4DB 2VRWB 2DZMA 2KUPA 3QARA 3ZNZB 2P0FA 4K2OA 1YX6B 3E66A 2E2XA 1WY8A 1GC6A 2RSUA 2JRIB 1PQSA 2FCQA 4KZCA 1Y8RC 3RZFA 4JKBA 2UYZB 2KHWB 1Q0WB 4K7WA 3VH4B 1FB8A 3CIKA 2COFA 3KH0A 1WGDA 2K6QA 2ELBA 3H7PA 3SD5A 4TV3A 2MKRA 4EMOA 3APDA 2ZPNA 3N30A 1TBEA 2KQ7A 1ZSQA 2N9EB 1FXTB 3IVFA 4W9HA 2YS3A 1V89A 2IO2B 2C5LC 5JHBA 2A4ZA 3B1LX 2IO1B 1U29A 4K7SA 1WJ1A 2GBNA 4MJSB 3VDZA 2CHZA 2Z0DB 2D2QA 3A1QB 4NY0A 2FCNA 2JWZA 2KDBA 3WAPA 2I5CA 3B08A 3D8DA 1F9JA 1HBKA 2Z0QA 2LYDA 3DBHI 3DQVA 2D11A 2R2OA 2IYBA 2NMBA 4JK9A 5L83A 1OY2A 2GCJA 1RAXA 4FA6A 2V4LA 4KHAA 3VFKA 4K2PA 4FJYA 1KZ7A 3KYCD 4NQKE 1J0WA 2N7EA 2FJ9A 4NJ6A 4G0NB 5D3YA 2DA0A 1BAKA 1P9DU 4HWIB 1VCBA 1UZXB 1WGHA 4IUMB 1NTIA 1IYFA 5KQ4A 4TKNA 4HATB 4GMVA 1W1DA 1P0RA 1XD3B 3I3TB 2LOXA 1X05A 2MWSB 4W9LA 2LI5A 4MT7A 4NSWA 5DCNA 5FI0A 2XK5B 3W1YA 5JH5C 3F5RA 1WI1A 2UWQA 1X1MA 3NY5A 4W9EA 4GDLB 5L81A 2P8VA 3ZKJC 5C79A 3VQIA 1P5TA 2KMCA 4EFOA 3Q3JA 2R2QA 3EFUA 1V80A 1U5FA 1WRDB 4IWQA 1DDWA 2BWES 3MPXA 3MTNB 1TXDA 4GZUA 3N3KB 2J0MA 1WF9A 4KDLB 1E90A 2A5UA 1FAOA 1UELA 2RQ1A 4BBNF 2G45B 3VOQA 3UF8A 4HXDA 2KFKB 2RUKB 4II2B 2R82A 4N9F4 4NNJB 1RRBA 3VUXA 1UPQA 2KFKA 4JL9A 4GMXB 3ZVVA 1M94A 4ICVA 4X57B 2RD0A 4GOCA 3AU5A 2DZKA 2XBBC 3KUZA 3VHTC 1V5MA 2KVRA 3DBSA 3VH3B 4DXAB 1B55A 3DXCA 2N1VA 3DOWA 1E8ZA 1ISNA 2N9PC 3ML8A 3KW5B 3PTFC 3RULA 2DENB 2DYMA 1H4RA 4H8SA 3ODWA 3ULBA 2HRJA 2BYEA 4AOFA 3L16A 3SDLC 2G4SA 2XK5A 2K00A 2BGFA 4MSMB 2CY4A 2ELAA 2K39A 3NSUA 1U5DA 1U5GA 3T8MA 1E7VA 5D3VA 1TZ1A 2LD9A 4HB4B 3PRMB 4AJWA 4FHJA 2KX3A 4KIKB 1KM7A 3FLVA 3RCZA 3SBGA 1R4MI 2HJ8A 2MP2B 2DIKA 2KK8A 3DDCB 1NTVA 2IZVB 1IPGA 1KBLA 4WSFA 1V49A 1U5EA 4JKDA 2GOWA 1WVHA 3JYUA 1V5PA 2EC1A 4TQ0A 3SO6A 1UNPA 4GPTB 4HAXB 1WMHA 1RJ2A 2KXJA 4Z2MB 4G11A 1D3ZA 4ILGB 5KHOA 2MBBB 3CXBB 4XWXA 1EF5A 2FNJB 1WX7A 1BTKA 3PPAA 4F7GA 1MK9B 4HAWB 4MDKE 2LVQA 3ONSA 1X86A 1ZC4B 2X0SA 1AARA 1V6EA 3Q3FA 1WM2A 2NS5A 3H9DA 1DDMA 4MGIE 4A6HA 4PNKA 3PZDA 3NZUA 2NVUI 1OTRB 4W9JA 3HQCA 2JZZA 4FN2A 1P3RA 3PP2A 3AU4A 4AUQC 2CRFA 3IHPC 2KJRA 2RVBB 1YD8U 4IW0A 3OANA 2K2UA 1WX9A 3ODXA 4LCDE 2LRUA 3V60A 3ZTCA 2Q13A 4EZJA 1WGGA 4JK8A 4AWJA 3TBLD 2PEAA 1EAZA 2YS5A 1EGXA 2MRPA 1HB6A 4DWFA 2D9YA 2LGXA 3DCGA 2O6VB 3U8ZA 2K25A 1XR0B 1G6JA 3FM8C 4TYZA 4MY6A 4HAUB 1FGYA 3NS8A 2M38A 2JY6A 2PZ1A 2CHXA 3QQ8B 1OQNA 3VXWA 3QJZA 3MDBC 2P0HA 5LONB 4FJVB 1GGOA 2KDFB 3A4RA 4KIKA 4WQOB 2PPHA 2GS0A 4YONA 3AXCA 4JLCA 4M8MA 1WZ3A 2D9XA 3L17A 3PHXB 3LJUX 3U30A 1P1AA 4A3OA 3MHSD 5CTRC 1QZEA 4W9GA 5J17A 1K5DB 5J3TA 3R3MA 5E6OA 2DYBA 1HE8A 1WJ6A 2IY0B 4WJQA 4K81A 4BFRA 2MBEA 2C9WB 1TJ6A 3IBEA 4Z2NA 5AEKB 1LFDA 2M4NA 5JLJB 2JP2A 1QQGA 1WJMA 4DDID 1UNRA 5JZEB 1CMXB 2IO3B 3GYPA 3P7ZA 2RNRB 2ROZB 2Y5BB 3ODOA 2KGXB 4XC2A 2O6VA 4PYZA 3TCAA 2W2XD 4A20A 4BKSD 2FCMA 3WAMA 1M7EA 3UGBB 2QKLA 5TR5A 2C60A 2KCJA 2ABDA 2CB8A 1K8RB 2CY5A 5JHGA 4LJPB 4KSKC 1ZGUB 3CSFA 2XQNM 2D9VA 3PLUA 5DPRA 2WX0A 3HIZA 1Z5SB 2DZIA 2KTRA 2KKCA 4EZLA 1ZVRA 2HE7A 5D94A 1DBHA 1IRSA 3O96A 3PSEB 3ML4A 3D8FA 1LM8B 4FHKA 1YQBA 5JHHA 4MGZE 2MCNB 3A33B 4M8NA 2GMIC 4W9FA 2KO3A 2K1FA 3E9PA 2DN6A 3RT3B 5KCVA 3OJ3A 1GG3A 1KJTA 2BF8B 2K6DB 4GSWA 5LLIA 1OMWA 4GB9A 3JSVB 3ZIMA 4GXBA 1V2YA 1M7RA 3JVZX 3D32A 2ZEQA 1MG8A 2I1KA 5HE0A 3QCAA 3SUZA 2AL3A 4HDQA 1ZC3B 3ZNGC 4F7HA 3KY9A 3DXDA 3H1UA 4JIOU 2V3SA 2L0FA 2FUHB 3PT2B 3DVNU 4HK2A 3TJPA 1WH3A 4PYUA 5D3XA 1MKEA 2M8SA 3QBVB 2Z0EB 1EF1A 1Z2MA 2PE6B 3QC8B 2DKPA 3UQAA 2MP2A 2DZJA 5C23A 2LWPA 3VTUA 3ENBA 2G35A 4JKGA 3VTWA 1NDDA 1VBHA 4YL8A 4PS3A 2X18A 2N9XA 1OEYJ 4JKHA 3RYTA 2CS4A 4GU2A 1WE7A 2Z0OA 2D07B 3ECIA 2LULA 3VUYA 3R7RA 2YF0A 5D7GA 3WIMA 2LXAA 2YS1A 2ZPYA 3C0RB 5EFXA 5FR6A 3DBLI 3X0WA 2Y8FA 2FJLA 2YVCA 1XKEA 1LB1A 2JF5A 2RPQA 4IM2A 3V6CB 2KDEB 4BBNC 3SNHA 2YRYA 2ZCBA 2WH5A 2DYNA 1UBIA 1WJNA 2PE9A 4HJKA 5LXIB 1WYWB 4HVBA 4TQ1A 1EVHA 3H7SA 2DFKA 4MGKE 2YT0A 3DVGY 2DTCA 1WM3A 2MBHA 2H7DA 2ZZPB 1V9JA 2OTXA 3S2AA 5D2MB 5GOWB 4A5KA 2IO0B 3QIJA 2V76A 1Y5OA 1DIKA 3NOBA 4RM9A 4W9KA 1WR6E 4HAYB 1NBFC 4WWPA 3NHEB 2RGNB 2GBJA 3E9OA 4DK5A 1FHWA 2COCA 4K7UA 2KWUB 4M0WB 3ZO5B 4W9DA 3GZNI 2KX0A 3F0WA 1U4AA 4F7ZA 5C1ZA 3DPDA 1V5UA 3PG7A 4HB0B 1MPHA 3ZUNA 1E7UA 4ASWC 2CHWA 2KC1A 4EEWA 2QKMA 4IFSA 2GBMA 3A8PA 2BWFA 3RZWC 3ALBA 4JKEA 1TGZB 3T06A 2BKFA 1ACAA 3SYXA 4MGYE 1MIXA 4KZ0A 2L7RA 1WGQA 1LQBA 3BINA 1C1YB 4MK0A 2GJYA 3LDZE 3N7CA 2K8CA 3UIOB 5IAAC 3NZSA 4C0AA 1KZGA 5G2NA 3WAOA 1I2HA 3UZTA 5L95C 3PEGA 3TW1A 1MK7B 3A9KA 3EPYA 4FBJB 2PJHA 5JVLA 2KQSA 3PHWB 1W1HA 2ZCCA 1IP9A 2LG1A 2L3ZA 4IAPA 1S1QB 1WGYA 2D10A 2O2VA 3QHTA 4RMAA 1MIZB 4E3CA 1DROA 1RFAA 2KWCA 3ZTDA 1Y19B 2XEWA 2L05A 4JKCA 5DH9B 5J18A 3FEHA 2MA9B 5D27A 2N4FA 4WJOA 4MM3A 3W1SC 1GNUA 2MBQA 2BKRB 3FSSA 4NPNA 4Y94A 4HB3B 3W1SA 2DHKA 4ZRJA 3SU8X 4GDKA 1PFJA 2J0KA 2WYQA 4ZRIA 5KQ1A 1SIFA 2ASQA 2JUOA 1JDEA 5HE3A 5IA7A 5DHFB 1Q1OA 4RM8A 1EUVB 3PSCA 3PLVA 4WWOA 4BBKA 2CQUA 2KC2A 1WX8A 4WJPA 2DHJA 1UD7A 2D4QA 3L08A 2DHIA 2LXCA 4G50A 2IBIB 2UZRA 2IY1B 4JGHB 1TTNA 2P0DA 1OQYA 2CODA 4XZ4A 2LASA 3VIAA 2FCSA 4K17A 4DX8A 1X11A 4NJ7A 4HB2B 4IWOA 2ZVOA 2MBOA 5JP4A 3PV1A 2BCJA 5G55A 4KDIC 3KSYA 2OJRA 4B9KA 1PLSA 2K2JA 1WE6A 1N3HA 3R66C 2D9WA 4ANVA 3P2BA 3CSTA 2CAYA 4LDTB 4ZYNA 4PQ0A 4E74A 4DHJB 2ZJDA 1YJ1A 2ZVNA 4HCNB 3R7QA 1H8CA 2LKOA 5CX3A 2RLOA 3JSVA 3AI5A 3LJ3A 1P98A 2MX2A 1WXVA 4B6WA 4IWPA 1WJUA 1I35A 4IM0A 4HDOA 4OVUA 2NR2A 4DX90 4KSLC 4BOSC 4DHZE 2N7DA 3L10B 2G3QB 2KDIA 1E8WA 2DX1A 2L1CA 2DAFA 5FI1A 5GMVA 5AZHA 1WFYA 3HK0A 1KLVA 2KTRB 3U7DA 1ZM0A 2LZ6A 3TFMA 1VD2A 2NBUA 1AQCA 2OOBB 2NZ8B 2HTHB 3BJIA 3H6NA 1GJZA 5JHAA 4ZDVA 1FHXA 2KMAA 2O2VB 1Z87A 4HPLB 2K8BA 2HTHA 2L8JA 2WWZA 2AYOB 3PRPB 3JW0X 2AWTA 1WR1A 1EO6A 2C7NB 5LOPB 2COAA 1XQQA 3PVLA 3A9KB 1WMHB 3KUDB 3QX1A 3QWMA 3RUIB 1WXMA 4DHZB 1V81A 3T9LA 4NAWA 1J0GA 3QWZB 3L0WB 2JZ3B 1H10A 4KVGB 3VAWA 3PREA 2BYFA 4MEMA 3KVFB 3N32A 3SV1A 3PS6A 1FOEA 2CR5A 2KD0A 2V1YA 3EHVA 2N1WA 2QHOA 4HHVA 2ZNVB 4AP4C 2EMSA 3V6EB 4AJYB 3ZNHB 3PVUA 2NPTB 2VRRB 1UPRA 2R0DA 3TO1A 1GUAB 4F1SA 1W1GA 2KZRA 1WJ4A 5HE1A 4PS7A 3ZRFA 5E6NA 1OGWA 4MSQB 2UZSA 2WX1A 1E5WA 1J8CA 3M95A 2KNBA 3GOEA 2DAJA 1ST7A 2Y7BA 1U2BA 2H7EA 2HD5B 2IFSA 1WXSA 2KJ6A 2MQJA 2FDQA 3QK0A 2COPA 3SBTA 4HAZB 4EJNA 4WJNA 3X23A 1L7YA 2VKIA 3V62A 4I6NB 3OJ4B 4FADA 1V5OA 3A4SC 1FHOA 3K9PB 1U27A 2EJ8A 4MELA 2KN5A 3APFA 4F8CB 2MDXA 4WAAA 4NQLB 4BKSA 4GDKB 3E9LA 4WJ7A 1SHCA 4CHJA 3PVWA 1E8XA 5DI9B 3ZDTA 2M0XA 4EUTA 3TIXA 2J59M 3P6AA 2WDTB 2YSZA 4JK7A 3GYOA 1WXAA 4DDGD 3QAQA 4BOZB 2DLWA 4GIVA 3A9JB 1KC7A 5J3QA 2L00B 3VVWB 2AEHA 4JKFA 4MH0E 2O6VD 1UNQA 4CHMA 3HHMA 3ZDMC 4BKTA 3VUWA 4HCPB 3L13A 4A6KA 2MW5A 5D3WA 1BT0A 2IYDB 2L2IA 1VBGA 4URKA 2Z59B 2Y8GA 2REXA 1L2NA 2ROVA 5BO4B 4WWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  2N9E B;  2KLG A;  4CHK A;  5DPS A;  1J0G A;  1Y19 B;  1FXT B;  3IVF A;  3UIP B;  1P6S A;  1OQN A;  4W9H A;  3B0A A;  3VXW A;  2YS3 A;  2XEW A;  3QJZ A;  2L05 A;  3MDB C;  2P0H A;  1V89 A;  3DXE A;  3FEH A;  5DH9 B;  5LON B;  1S3S G;  2IO2 B;  4GDL A;  5J18 A;  1XD4 A;  3MTN B;  4FJV B;  2KDF B;  1OEY A;  3A4R A;  4KIK A;  2C5L C;  4CYE A;  2MA9 B;  5D27 A;  2N4F A;  4WJO A;  5JHB A;  4MM3 A;  2A4Z A;  1BTN A;  4WQO B;  3B1L X;  3W1S C;  2FAZ A;  1NU2 A;  2GS0 A;  1WG7 A;  1U29 A;  4YON A;  1WI0 A;  2IO1 B;  2PPH A;  3AXC A;  4K7S A;  4JLC A;  2D3G A;  1WZ3 A;  4M8M A;  2D9X A;  3WA0 A;  1WJ1 A;  2GBN A;  1GNU A;  2MBQ A;  4BKG A;  2LGY A;  3L17 A;  3PHX B;  3LJU X;  2BKR B;  4MJS B;  3U30 A;  3VDZ A;  2CHZ A;  3FSS A;  1P1A A;  1RLF A;  4NPN A;  3MHS D;  5CTR C;  4A3O A;  1HB8 A;  4Y94 A;  1QZE A;  4HB3 B;  1WGR A;  4W9G A;  3W1S A;  1XT9 B;  4ICU A;  2DHK A;  2Z0D B;  1SE9 A;  3D8E A;  5J17 A;  1K5D B;  2D2Q A;  4ZRJ A;  2NCN A;  4NY0 A;  2ADZ A;  2FCN A;  3A1Q B;  3M3J A;  2JWZ A;  5AZG A;  3SU8 X;  4GDK A;  4KHO A;  5J3T A;  3R3M A;  1PFJ A;  1KOT A;  5E6O A;  2KDB A;  2DYB A;  3WAP A;  2UVM A;  3KYD D;  1HE8 A;  1WJ6 A;  2J0K A;  2I5C A;  2IY0 B;  2WYQ A;  4K81 A;  4WJQ A;  5C6R A;  3O65 B;  4BFR A;  3B08 A;  4ZRI A;  3D8D A;  5KQ1 A;  1F9J A;  2MBE A;  1HBK A;  1SIF A;  2ASQ A;  1TJ6 A;  2C9W B;  2JUO A;  2RR9 A;  3IBE A;  4Z2N A;  5HE3 A;  5IA7 A;  4EKU A;  3WYF B;  5DHF B;  1LFD A;  5AEK B;  1Q1O A;  2M4N A;  4LJO B;  4RM8 A;  1EUV B;  5JLJ B;  3HM3 A;  2Z0Q A;  2JP2 A;  2C7M B;  2BYV E;  3PSC A;  1RRP B;  3TVV A;  2NBW B;  3PLV A;  2JXX A;  1QQG A;  1WJM A;  4WWO A;  4DDI D;  1UNR A;  2LYD A;  4BBK A;  2CQU A;  3DBH I;  3DQV A;  2D11 A;  2R2O A;  5JZE B;  2IYB A;  2FID A;  2KC2 A;  1CMX B;  2W2X C;  2IO3 B;  1WX8 A;  4WJP A;  2NMB A;  2DHJ A;  3GYP A;  3P7Z A;  2D4Q A;  2RNR B;  1UD7 A;  3L08 A;  5L83 A;  5IJM A;  2ROZ B;  2LJ5 A;  2DHI A;  3ODO A;  1ZW7 A;  2Y5B B;  3ZNI D;  1OY2 A;  2KGX B;  4WVF B;  4DBB A;  2LXC A;  4XC2 A;  2O6V A;  5DHA B;  4PYZ A;  2GCJ A;  3TCA A;  1RAX A;  2IBI B;  2W2X D;  4G50 A;  2UZR A;  4FA6 A;  2IY1 B;  4JGH B;  2V4L A;  4KHA A;  3SHQ A;  4A20 A;  1TTN A;  5CHV C;  3VFK A;  2KTF A;  4K2P A;  1E8Y A;  4ANX A;  2P0D A;  1OQY A;  3BY4 B;  1NI2 A;  4ZRK A;  2B3A A;  4BKS D;  2COD A;  4XZ4 A;  2YT1 A;  2LAS A;  3VIA A;  4FJY A;  2FCS A;  4K17 A;  2LVO A;  2C7H A;  4DX8 A;  1K5G B;  1X11 A;  2FCM A;  3CMM B;  1KZ7 A;  1M7E A;  3KYC D;  4NQK E;  2QKL A;  2N0Y A;  1J0W A;  5TR5 A;  4K1R B;  3UGB B;  3ULC A;  1FGZ A;  4GU2 A;  2C60 A;  2KCJ A;  1SGH A;  2N7E A;  2ABD A;  4NJ7 A;  4HB2 B;  3A9J A;  4IWO A;  4HLE A;  2CB8 A;  1K8R B;  2FJ9 A;  5JP4 A;  2MBO A;  2BCJ A;  2ZVO A;  3PV1 A;  5G55 A;  4KDI C;  3KSY A;  2OJR A;  2CY5 A;  3ZVR A;  2RGF A;  4NJ6 A;  4B9K A;  1PLS A;  2K2J A;  5JHG A;  2N23 A;  4IC7 B;  4WWN A;  2EKE C;  3IG3 A;  4G0N B;  5D3Y A;  4LJP B;  4KSK C;  2DA0 A;  1WE6 A;  1BAK A;  1V5T A;  5CHW A;  1N3H A;  1ZGU B;  5AZF A;  3CSF A;  2XQN M;  2D9V A;  3PLU A;  1P9D U;  3H7P B;  3R66 C;  4HWI B;  3T9L A;  2D9W A;  4ANV A;  1VCB A;  1UZX B;  1WGH A;  2L76 A;  1NTI A;  3P2B A;  5KQ4 A;  4IUM B;  5DPR A;  1IYF A;  1Q5W B;  4G3X B;  2DKQ A;  2WX0 A;  3PRZ A;  3CST A;  4TKN A;  3A1Q A;  4HAT B;  1Z5S B;  3HIZ A;  4GMV A;  1W1D A;  2CAY A;  1P0R A;  4LDT B;  1C3T A;  4ZYN A;  2DZI A;  4W9C A;  4PQ0 A;  2KTR A;  4E74 A;  1XD3 B;  4DHJ B;  2ZJD A;  3I3T B;  1UH6 A;  1DYN A;  1YJ1 A;  3ZRC A;  2KKC A;  1YX5 B;  2ZVN A;  4HCN B;  2LOX A;  1ZVR A;  1X05 A;  2HE7 A;  2MWN B;  4EZL A;  5D94 A;  3R7Q A;  1DBH A;  1IRS A;  3O96 A;  1JRU A;  2MWS B;  3PSE B;  3ML4 A;  2LI5 A;  4MT7 A;  2M14 A;  4W9L A;  3K9O B;  2LKO A;  3D8F A;  4NSW A;  1LM8 B;  5CX3 A;  4FHK A;  2RLO A;  5DCN A;  1YQB A;  4DBG A;  4P7I A;  3JSV A;  1X1F A;  5FI0 A;  3AI5 A;  2XK5 B;  3LJ3 A;  3W1Y A;  5JH5 C;  3F5R A;  5JHH A;  1P98 A;  2LGD A;  5CLL B;  1WI1 A;  1WXV A;  2MX2 A;  3KRX A;  3M62 B;  3DVG X;  4IWP A;  3WAN A;  4B6W A;  1WJU A;  2UWQ A;  1X1M A;  3NY5 A;  4MGZ E;  4W9E A;  2MCN B;  1I35 A;  3A33 B;  4GDL B;  4IM0 A;  5L81 A;  4HDO A;  4M8N A;  4B95 A;  2GMI C;  4OVU A;  2P8V A;  4W9F A;  2DYO A;  2KO3 A;  3ZKJ C;  2K1F A;  2DN6 A;  2KJH B;  5C79 A;  3RT3 B;  2NR2 A;  4DX9 0;  5KCV A;  3WAM A;  3G9W A;  3OJ3 A;  1GG3 A;  4LDT D;  1KJT A;  2J7Q B;  5J2R A;  2NPT A;  2BF8 B;  2K6D B;  4KSL C;  1LXD A;  4XX5 A;  4GSW A;  1P5T A;  2KMC A;  3VQI A;  4DHJ D;  4BOS C;  5LLI A;  4EFO A;  3Q3J A;  4DHZ E;  2N7D A;  1OMW A;  3EC8 A;  4GB9 A;  3JSV B;  3KRW A;  2G3Q B;  4HAV B;  3APC A;  3L10 B;  3OAW A;  3ZIM A;  2KDI A;  1E8W A;  2R2Q A;  2DX1 A;  3EFU A;  1T0Y A;  2L1C A;  2DAF A;  4GXB A;  1WIA A;  1V80 A;  1U5F A;  1M7R A;  1V2Y A;  1WRD B;  3JVZ X;  3D32 A;  4IWQ A;  1DDW A;  5FI1 A;  2ZEQ A;  2BWE S;  5GMV A;  5AZH A;  1BWN A;  1WFY A;  1MG8 A;  3MPX A;  1TXD A;  3HK0 A;  4GZU A;  2I1K A;  5HE0 A;  2KTR B;  3DBR I;  3U7D A;  1ZM0 A;  2J0M A;  1WF9 A;  2GBR A;  2GCL A;  3SUZ A;  2LZ6 A;  2AL3 A;  1E90 A;  3N3K B;  4KDL B;  3TFM A;  1VD2 A;  4HDQ A;  2ZNV C;  1ZC3 B;  4J6I A;  3ZNG C;  4F7H A;  2A5U A;  2NBU A;  1FAO A;  1UEL A;  4KV2 A;  2RQ1 A;  3KY9 A;  1AQC A;  2G45 B;  2OOB B;  4BBN F;  4PS8 A;  4EOY A;  3DXD A;  5DPW A;  2NZ8 B;  3H1U A;  4JIO U;  3VOQ A;  3UF8 A;  4KHB B;  2V3S A;  2L0F A;  4IOY X;  4II3 B;  2FUH B;  3PT2 B;  2MSE D;  4HXD A;  4A6F B;  3DVN U;  2HTH B;  2RUK B;  3BJI A;  2KFK B;  3H6N A;  4HK2 A;  3DVN V;  4I6P A;  4II2 B;  1GJZ A;  5JHA A;  4ZDV A;  3TJP A;  1WH3 A;  2KLC A;  1FHX A;  2KMA A;  1AWE A;  2LOZ A;  3OLM D;  4N9F 4;  2KWV B;  3M1I B;  1Z87 A;  1RRB A;  1UGM A;  2O2V B;  3IFW B;  4HPL B;  4NNJ B;  1L2N A;  5DIF B;  5D3X A;  1MKE A;  1UBQ A;  4PYU A;  1UPQ A;  2M8S A;  3VUX A;  2K8B A;  3QBV B;  2HTH A;  2KFK A;  2L8J A;  2CKH B;  1KLV A;  2WWZ A;  4JL9 A;  2Z0E B;  4GMX B;  3ZVV A;  1EF1 A;  2AYO B;  3KZ1 A;  1XCG A;  3PRP B;  1M94 A;  4ICV A;  1Z2M A;  2PE6 B;  3JW0 X;  3QC8 B;  4X57 B;  2DKP A;  4EZK A;  2MP2 A;  2AWT A;  2DZJ A;  3UQA A;  2RD0 A;  5C23 A;  2LWP A;  1WR1 A;  4GOC A;  3AU5 A;  1EO6 A;  2DZK A;  2XBB C;  5C5B B;  2C7N B;  1P3Q U;  3KUZ A;  3VHT C;  5LOP B;  3VTU A;  1V5M A;  2COA A;  4TUU A;  2KVR A;  4FLH A;  1XX0 A;  1XQQ A;  2G35 A;  3DBS A;  3PGE A;  3TMP B;  3VH3 B;  4DXA B;  4CO7 A;  3QWZ B;  3PVL A;  3A9K B;  2DHZ A;  4HPM B;  1WMH B;  5KHQ A;  1B55 A;  1NDD A;  3VTW A;  2MFQ A;  3KUD B;  3DXC A;  5E6P A;  3QX1 A;  2N1V A;  3WAL A;  2W9N A;  3QWM A;  4GGQ A;  1V61 A;  3RUI B;  2YLM A;  1WXM A;  4YL8 A;  3DOW A;  1E8Z A;  1ISN A;  4PS3 A;  3UQB A;  2N9P C;  3EEC A;  4A3P A;  3ML8 A;  2X18 A;  3HW2 B;  4L6E A;  1OEY J;  2N9X A;  3KW5 B;  3PTF C;  4DHZ B;  3RUL A;  1V81 A;  3RYT A;  2DEN B;  2CS4 A;  1H4R A;  1MAI A;  4H8S A;  3ODW A;  1WE7 A;  2DYM A;  2LBB A;  2RSG A;  3ULB A;  3KUC B;  2DX5 B;  3L0W B;  2NBV B;  2HRJ A;  2JZ3 B;  1H10 A;  2Z0O A;  4KVG B;  4NAW A;  3VAW A;  2BYE A;  2D07 B;  3ECI A;  2LUL A;  3VUY A;  3PRE A;  2BYF A;  2YF0 A;  5D7G A;  4MEM A;  3R7R A;  3KVF B;  4AOF A;  3L16 A;  3SDL C;  2GBK A;  3GZN I;  3VTV A;  3WIM A;  3N32 A;  4NAW B;  4BVU C;  2KAN A;  3SV1 A;  2LXA A;  2YS1 A;  3PS6 A;  2G4S A;  1FOE A;  2CR5 A;  2XK5 A;  2ZPY A;  2KD0 A;  2K00 A;  2OQB A;  5C16 A;  2AL6 A;  5EFX A;  2BGF A;  2V1Y A;  3AUL A;  3C0R B;  3EHV A;  5FR6 A;  5EDS A;  3DBL I;  3X0W A;  4D0N B;  4MSM B;  2CY4 A;  2ELA A;  1I42 A;  2VSZ A;  2Y8F A;  2FJL A;  2K39 A;  2N1W A;  3NSU A;  2YVC A;  2QHO A;  5CHF A;  1XKE A;  1LB1 A;  1U5D A;  4HHV A;  2JF5 A;  2RPQ A;  4IM2 A;  1U5G A;  2ZNV B;  2DYQ A;  3T8M A;  4AP4 C;  2EMS A;  4MJS A;  1E7V A;  3V6E B;  5D3V A;  1TZ1 A;  2LD9 A;  4HB4 B;  3CF6 E;  3PRM B;  3ZNH B;  4AJY B;  4AJW A;  3UIN B;  3V6C B;  1ZKH A;  1TQZ A;  4FHJ A;  2KX3 A;  2KDE B;  3TL5 A;  2CU1 A;  3PVU A;  4JQW C;  3SNH A;  2NPT B;  2VRR B;  4BBN C;  4KIK B;  1KM7 A;  1GC7 A;  1UPR A;  3FLV A;  2YRY A;  2R0D A;  2WH5 A;  3TO1 A;  2ZCB A;  3RCZ A;  1GUA B;  1R4M I;  2HJ8 A;  4F1S A;  5DPT A;  1W1G A;  2DYN A;  2MP2 B;  1UBI A;  1WJN A;  2PE9 A;  4HJK A;  2KZR A;  5LXI B;  3M63 B;  1WJ4 A;  1WYW B;  2KK8 A;  4HVB A;  3DDC B;  3RCP A;  2JVC A;  4TQ1 A;  1EVH A;  3H7S A;  2DFK A;  5HE1 A;  4PS7 A;  4MGK E;  3ZRF A;  2D9Z A;  2YT0 A;  3ML9 A;  1NTV A;  2JT4 B;  2K8H A;  1OGW A;  5E6N A;  3DVG Y;  2DTC A;  1WM3 A;  1A5R A;  2MBH A;  5J3Y A;  2IZV B;  1IPG A;  2UZS A;  4MSQ B;  2H7D A;  2WX1 A;  4OVV A;  5HKH A;  1E5W A;  1WGU A;  4WSF A;  1NVL A;  2ZZP B;  2M1M A;  1J8C A;  4I6L B;  1LW3 A;  1QC6 A;  1V9J A;  1KI1 B;  2OTX A;  2KFJ A;  1V49 A;  1U5E A;  3M95 A;  2GOW A;  2KNB A;  3S2A A;  1WVH A;  3JYU A;  1V5P A;  2EC1 A;  3GOE A;  3SO6 A;  5D2M B;  1UNP A;  4GPT B;  5D6J B;  4TQ0 A;  2I5F A;  4HAX B;  5GOW B;  1WMH A;  2DAJ A;  4A5K A;  1ST7 A;  3ZW3 A;  3RD2 A;  3FP5 A;  2Y7B A;  4FUL A;  3ZLZ A;  5LXH A;  1YIW A;  1RJ2 A;  2R09 A;  2IO0 B;  1U2B A;  2H7E A;  4B6H A;  2HD5 B;  2IFS A;  3QIJ A;  2V76 A;  2KXJ A;  1WXS A;  5C5B A;  1Y5O A;  2KJ6 A;  2L0T A;  3L54 A;  3HM6 X;  4Z2M B;  4G11 A;  2MQJ A;  1D3Z A;  2FDQ A;  1J19 A;  3NOB A;  3QK0 A;  2FIF A;  2COP A;  5KHO A;  2MBB B;  4FJZ A;  4HAZ B;  4EJN A;  3CXB B;  2BPS A;  4ANU A;  4RM9 A;  4WJN A;  4XWX A;  3X23 A;  1L7Y A;  2VKI A;  1WR6 E;  4HAY B;  4W9K A;  2EMT A;  1EF5 A;  1NBF C;  3V61 A;  2M17 A;  4WWP A;  3V62 A;  3NHE B;  2RGN B;  2FNJ B;  4I6N B;  1WX7 A;  1BTK A;  3PPA A;  4F7G A;  2GBJ A;  4DK5 A;  2MLB A;  1FHW A;  3OJ4 B;  4FAD A;  1V5O A;  2COC A;  3A4S C;  1MK9 B;  4HAW B;  4K7U A;  2KWU B;  4M0W B;  1FHO A;  4MDK E;  2LVQ A;  2J0J A;  3K9P B;  1U27 A;  3ONS A;  4W9D A;  1X86 A;  1ZC4 B;  3ZO5 B;  2EJ8 A;  4A6F A;  2W2W A;  2JPH A;  5CLQ B;  2KX0 A;  2LRW A;  3F0W A;  1AAR A;  2KN5 A;  4MEL A;  2LVP A;  3AJ4 A;  2KOX A;  2JRH A;  1V6E A;  1V88 A;  1U4A A;  1WM2 A;  3APF A;  3Q3F A;  4F8C B;  1UEF A;  4W9I A;  2NS5 A;  3H9D A;  3A98 B;  1DDM A;  4MGI E;  4F7Z A;  2Z0P A;  3DPD A;  5C1Z A;  1V5U A;  2MDX A;  3PG7 A;  4A6H A;  4PNK A;  4HB0 B;  2DX5 A;  4WAA A;  3PZD A;  4NQL B;  1MPH A;  3NZU A;  4BKS A;  3ZUN A;  1I7A A;  4GDK B;  1E7U A;  2NVU I;  1NTY A;  3ENE A;  4ASW C;  2CHW A;  3V5W A;  2KC1 A;  4IM3 A;  3QA8 A;  4WJ7 A;  1SHC A;  3HQC A;  5HE2 A;  2QKM A;  4CHJ A;  3PVW A;  1OTR B;  4W9J A;  4EEW A;  4F7U P;  1E8X A;  4IFS A;  1WZ0 A;  4ANW A;  4GN1 A;  2JZZ A;  1H8C A;  2GBM A;  1R4N I;  4FN2 A;  1PMS A;  3A8P A;  2BWF A;  1P3R A;  2I1J A;  5DI9 B;  3ZDT A;  2M0X A;  3PP2 A;  3RZW C;  1V86 A;  3AU4 A;  4AUQ C;  3ALB A;  1TGZ B;  3T06 A;  1Q67 A;  3A8Q A;  4EUT A;  2CRF A;  3TIX A;  3IHP C;  2BKF A;  2KJR A;  1X1G A;  2RVB B;  1YD8 U;  2LUE A;  3MJW A;  1ACA A;  3SYX A;  4IG7 B;  1XOD A;  4MGY E;  1DDV A;  1MIX A;  2J59 M;  4KZ0 A;  2L7R A;  3P6A A;  1WGQ A;  3OAN A;  3BIN A;  1LQB A;  4KAX B;  2G4D B;  2WDT B;  4IW0 A;  1C1Y B;  2VRW B;  4MK0 A;  2YSZ A;  2DZM A;  2K2U A;  2GJY A;  1WX9 A;  3ODX A;  3N7C A;  3LDZ E;  2K8C A;  4LCD E;  2KUP A;  3QAR A;  3ZNZ B;  3GYO A;  2P0F A;  4K2O A;  2LRU A;  2Q13 A;  3UIO B;  1WGG A;  3V60 A;  3ZTC A;  1YX6 B;  4EZJ A;  5IAA C;  2E2X A;  1WXA A;  3NZS A;  4C0A A;  1KZG A;  1WY8 A;  4DDG D;  5G2N A;  3QAQ A;  1GC6 A;  3WAO A;  4BOZ B;  2DLW A;  1I2H A;  4GIV A;  3UZT A;  3A9J B;  2RSU A;  5L95 C;  2JRI B;  4AWJ A;  3PEG A;  5J3Q A;  2L00 B;  1PQS A;  3TW1 A;  1MK7 B;  2FCQ A;  3TBL D;  4KZC A;  1Y8R C;  3VVW B;  3A9K A;  3RZF A;  2AEH A;  2PEA A;  3EPY A;  4MH0 E;  2UYZ B;  4FBJ B;  1EAZ A;  2KHW B;  2PJH A;  2YS5 A;  1UNQ A;  1Q0W B;  4CHM A;  2O6V D;  4K7W A;  3HHM A;  3VH4 B;  3ZDM C;  4BKT A;  1FB8 A;  1EGX A;  2MRP A;  1HB6 A;  3QCA A;  2KQS A;  2D9Y A;  3CIK A;  2COF A;  2LGX A;  3PHW B;  4DWF A;  3DCG A;  3VUW A;  1W1H A;  3KH0 A;  1WGD A;  2K6Q A;  4HCP B;  2O6V B;  3U8Z A;  2ELB A;  3L13 A;  2K25 A;  4A6K A;  2MW5 A;  2ZCC A;  3H7P A;  3SD5 A;  1IP9 A;  1XR0 B;  1G6J A;  2LG1 A;  3FM8 C;  4TYZ A;  4MY6 A;  5D3W A;  2L3Z A;  4TV3 A;  2MKR A;  4IAP A;  1BT0 A;  1S1Q B;  2D10 A;  1WGY A;  4E71 A;  4HAU B;  2IYD B;  2L2I A;  1FGY A;  4EMO A;  2O2V A;  3APD A;  3NS8 A;  2M38 A;  2JY6 A;  2ZPN A;  3N30 A;  4URK A;  2Z59 B;  2Y8G A;  2REX A;  3QHT A;  4RMA A;  1MIZ B;  2ROV A;  1DRO A;  1RFA A;  1TBE A;  1ZSQ A;  2KQ7 A;  2KWC A;  5BO4 B;  4E3C A;  2PZ1 A;  2CHX A;  3ZTD A; 
#chains in the Genus database with same CATH topology
 3U7Z A;  4YWG G;  2KLG A;  2MJE A;  4CHK A;  5DPS A;  3AE5 B;  3UIP B;  1P6S A;  3B0A A;  3DXE A;  1S3S G;  4GDL A;  2RDH A;  1XD4 A;  4RF1 A;  1OEY A;  4CYE A;  1MPE A;  1BTN A;  2J53 A;  2FAZ A;  1NU2 A;  1WG7 A;  1UGJ A;  1WI0 A;  4US8 A;  3B2F A;  2D3G A;  2E6X A;  1T77 A;  3WA0 A;  3AEE B;  2WDQ B;  4BKG A;  2LGY A;  4B0E A;  3OWE B;  3Q2A C;  1GAQ B;  1RLF A;  1HB8 A;  5IO9 A;  1WGR A;  1XT9 B;  4ICU A;  1I4Q A;  1SE9 A;  3D8E A;  2NCN A;  2ADZ A;  3M3J A;  5AZG A;  1RFK A;  2WXJ A;  4KHO A;  1KOT A;  2UVM A;  2JU6 X;  3KYD D;  5C6R A;  3O65 B;  3DBR B;  3ZJV A;  2RR9 A;  4EKU A;  3WYF B;  4LJO B;  2QDF A;  3FVC A;  3HM3 A;  2BYV E;  2C7M B;  4C7Y A;  1F2R C;  5IN7 A;  1RRP B;  3TVV A;  2NBW B;  2NMQ A;  2JXX A;  3I63 C;  2WXP A;  3RNE C;  2FID A;  3E56 A;  2W2X C;  4RGN A;  4PT5 A;  3Q6B A;  5IJM A;  2GUM A;  1ZW7 A;  2LJ5 A;  3ZNI D;  4WVF B;  1SBB B;  2OHF A;  4DBB A;  1VZ7 A;  4NZL B;  1TJE A;  5DHA B;  3MC9 A;  3SHQ A;  1FXI A;  5CHV C;  2YEP B;  2KTF A;  1E8Y A;  4ANX A;  3BY4 B;  3NUH B;  1NI2 A;  4ZRK A;  2B3A A;  3RI7 C;  1XLO A;  2YT1 A;  2LVO A;  1BUI C;  2C7H A;  1K5G B;  3CMM B;  1A5R A;  2N0Y A;  4TMA B;  4K1R B;  3ULC A;  1FGZ A;  1SGH A;  3A9J A;  4HLE A;  2TSS A;  3WCQ A;  1V1P A;  2RGF A;  3ZVR A;  4IC7 B;  2N23 A;  2EKE C;  3IG3 A;  5CHW A;  1V5T A;  2AQ3 B;  5AZF A;  2MJ3 A;  3H7P B;  2WXM A;  3BVM A;  2L76 A;  4JWU C;  1Q5W B;  4G3X B;  2DKQ A;  3PRZ A;  3A1Q A;  3R2I A;  2W55 A;  1C3T A;  4YTN B;  4W9C A;  4WWM A;  1UH6 A;  1DYN A;  1K53 A;  1N5X A;  3ZRC A;  1YX5 B;  2MWN B;  1YQ4 B;  1JRU A;  2M14 A;  3K9O B;  3SR6 A;  1TS4 A;  1F77 A;  3NVW A;  2BS3 B;  1ROE A;  4P7I A;  1WYG A;  4DBG A;  1X1F A;  4KKI A;  4LNF A;  1GB4 A;  1FNV A;  2LGD A;  5CLL B;  2ACZ B;  3M62 B;  3RFZ B;  3KRX A;  1C4A A;  3DVG X;  2JQR B;  3WAN A;  1STE A;  1JW9 D;  3AEA B;  4B95 A;  4C7Z A;  2DYO A;  3SFD B;  1JWA D;  2INC C;  2KJH B;  2Y5P A;  3G9W A;  4LDT D;  1OFF A;  2J7Q B;  5J2R A;  2NPT A;  5HG2 A;  4XX5 A;  1LXD A;  2K49 A;  4DHJ D;  3EC8 A;  3KRW A;  3APC A;  4HAV B;  2NTT A;  3OAW A;  1OQR A;  1L4Z B;  1T0Y A;  5FK9 C;  1WIA A;  4JKG B;  1BWN A;  2ZW1 A;  3DBR I;  3UIN B;  3TMP B;  2BTE A;  2GBR A;  2GCL A;  3KWV A;  2ZNV C;  4J6I A;  4KV2 A;  1YOV B;  4ILH A;  3VR9 B;  3B77 A;  1WSP A;  4PS8 A;  1MJD A;  4EOY A;  5DPW A;  1VZ8 A;  4KHB B;  1ZUD 2;  5D3D A;  4IOY X;  4YSX B;  4II3 B;  4TSS A;  2MSE D;  4A6F B;  5MPO A;  3DVN V;  4I6P A;  2KLC A;  1AWE A;  2LOZ A;  3OLM D;  2KWV B;  3M1I B;  1UGM A;  3IFW B;  3MJ5 A;  2I38 A;  5DIF B;  1UBQ A;  2WXH A;  2CKH B;  1HTQ A;  3KZ1 A;  1XCG A;  1ZP0 B;  3SFE B;  4EZK A;  1YNT E;  5C5B B;  1P3Q U;  1SB3 C;  4TUU A;  4FLH A;  1XX0 A;  4CO7 A;  3PGE A;  4IKG A;  4QJ4 B;  1YN3 A;  2DHZ A;  4HPM B;  5KHQ A;  2MFQ A;  5E6P A;  3WAL A;  2W9N A;  1MI1 A;  1L0Y B;  4GGQ A;  1V61 A;  2YLM A;  3UQB A;  3EEC A;  4A3P A;  2QCZ A;  3HW2 B;  4L6E A;  1UUP A;  4JKA A;  1MAI A;  1TS5 A;  3KUC B;  2LBB A;  2RSG A;  1TT5 B;  2DX5 B;  2NBV B;  3GS2 A;  4BVU C;  2GBK A;  3VTV A;  4NAW B;  1OQQ A;  2KAN A;  2N7J A;  2PKO A;  2MHJ A;  3AUL A;  4E71 A;  2OQB A;  5C16 A;  2KAC A;  2AL6 A;  5EDS A;  1HQR D;  4D0N B;  1I42 A;  2VSZ A;  5CHF A;  1N62 A;  2WXF A;  2DYQ A;  4MJS A;  1KTK A;  1NEN B;  3CF6 E;  1ZKH A;  1TQZ A;  2ZW0 A;  3TL5 A;  2CU1 A;  4JQW C;  2BBC A;  1GC7 A;  3BYY B;  3HUI A;  5DPT A;  1TKG A;  1SE4 A;  3M63 B;  4FXC A;  2R2Y A;  5I2S A;  3RCP A;  1EM7 A;  2JVC A;  2WQY B;  2D9Z A;  3ML9 A;  2JT4 B;  2K8H A;  2VZK D;  5J3Y A;  4ILJ A;  5HKH A;  4OVV A;  1WGU A;  1NVL A;  2M1M A;  4I6L B;  2ON8 A;  1LW3 A;  1QC6 A;  2KFJ A;  1KI1 B;  2W3S A;  1HXY D;  5D6J B;  1CK1 A;  2I5F A;  1FRR A;  3ZW3 A;  3RD2 A;  3FP5 A;  3ZLZ A;  4FUL A;  5LXH A;  1YIW A;  2R09 A;  4B6H A;  1QOG A;  5C5B A;  2L0T A;  3Q3M C;  3L54 A;  3HM6 X;  1AN8 A;  5C2T B;  1JWB D;  1KH0 A;  1J19 A;  1FPY A;  2FIF A;  4FJZ A;  4ANU A;  4ZYS A;  2BPS A;  3V61 A;  2EMT A;  2IDY A;  2M17 A;  2MLB A;  4OZC A;  2QIL A;  2J0J A;  4A6F A;  2W2W A;  2JPH A;  5CLQ B;  2LRW A;  1ZYI A;  1D6E C;  2LVP A;  3AJ4 A;  2KOX A;  4KHB A;  2JRH A;  2MH7 A;  1V88 A;  1VR9 A;  3N1Y C;  1UEF A;  4W9I A;  3A98 B;  2LHE A;  3O13 A;  4HRS A;  2Z0P A;  1QOB A;  4XE0 A;  2VH1 A;  1C4P A;  1K50 A;  2DX5 A;  1I7A A;  1FRD A;  1PDX A;  1NTY A;  3ENE A;  3V5W A;  4IM3 A;  4RGT A;  3QA8 A;  5HE2 A;  5IKC M;  5EE1 A;  2QSD A;  4F7U P;  1WZ0 A;  4ANW A;  4GN1 A;  5I4D A;  1R4N I;  1PMS A;  3AEC B;  2I1J A;  1V86 A;  2KYW A;  1Q67 A;  3A8Q A;  2L52 A;  1X1G A;  1UWM A;  2LUE A;  3MJW A;  4IG7 B;  1XOD A;  2L32 A;  1DDV A;  2KDM A;  2J52 A;  4KAX B;  2G4D B;  2VRW B;  1JQ4 A;  2DZM A;  3MP9 A;  3Q8B A;  2KUP A;  3QAR A;  3ZNZ B;  2P0F A;  4K2O A;  2JWU A;  1YX6 B;  3E66 A;  2ICI A;  2E2X A;  2B76 B;  2WXL A;  1WY8 A;  2OED A;  1C76 A;  1GC6 A;  4XWT A;  2RSU A;  2JRI B;  4YTM B;  5IP4 D;  1PQS A;  2FCQ A;  4KZC A;  1Y8R C;  3RZF A;  1F1H A;  1ZPS A;  1V97 A;  2HTM E;  3AEG B;  4JKB A;  2UYZ B;  1TYG B;  4K3B A;  2KHW B;  1Q0W B;  4K7W A;  4XWW A;  3VH4 B;  1FB8 A;  3CIK A;  2COF A;  2WXO A;  3KH0 A;  3TEY A;  2K6Q A;  1WGD A;  2ELB A;  3H7P A;  3SD5 A;  3AED B;  1E0Z A;  4TV3 A;  3Q14 C;  1AW7 A;  2MKR A;  2N9K A;  4EMO A;  3APD A;  3AM9 A;  1T6B X;  2ZPN A;  3N30 A;  2KWD A;  2HJ1 A;  1TBE A;  2KQ7 A;  1ZSQ A;  2WNM A;  3FKY A;  2ZKM X;  2N9E B;  3Q3O C;  5LG4 B;  1FXT B;  3IVF A;  4W9H A;  2YS3 A;  1QQR A;  1V89 A;  2IO2 B;  1YJI A;  2IND C;  2C5L C;  5BYS A;  5JHB A;  2A4Z A;  3B1L X;  5FKA C;  2IO1 B;  1U29 A;  4K7S A;  1HZ5 A;  1WJ1 A;  2GBN A;  4MJS B;  2LEK A;  3VDZ A;  2CHZ A;  1TIF A;  2LFI A;  4ACF A;  4CQN A;  2CU3 A;  2Z0D B;  3FIL A;  2D2Q A;  1CQV A;  3A1Q B;  4NY0 A;  2FCN A;  2WHI A;  2JWZ A;  2MEK A;  4MM3 B;  1NYR A;  2KDB A;  3WAP A;  2I5C A;  4GOU A;  3B08 A;  3D8D A;  3EFC A;  1F9J A;  2PTL A;  1HBK A;  2LHD A;  4HRO A;  3RPF C;  2Z0Q A;  3ZGZ A;  2LYD A;  3DBH I;  3DQV A;  4RFB A;  2D11 A;  2R2O A;  5HFY A;  2IYB A;  2KQ4 X;  3NVY A;  2NMB A;  4JK9 A;  4ARC A;  1K51 A;  5H92 C;  5L83 A;  1OY2 A;  3NG0 A;  2QJL A;  2GCJ A;  1RAX A;  4FA6 A;  2V4L A;  4S0R A;  4KHA A;  3VFK A;  4N58 A;  4K2P A;  4USA A;  3E9S A;  4FJY A;  5G5H A;  1KZ7 A;  3KYC D;  4NQK E;  1J0W A;  2N7E A;  3B9J A;  3TEZ A;  2FJ9 A;  1CZP A;  4NJ6 A;  1C77 A;  3RMK C;  4G0N B;  4JE3 B;  5D3Y A;  1F2R I;  2DA0 A;  1HA5 A;  1BAK A;  1K52 A;  1FNW A;  1P9D U;  4HWI B;  3J9C A;  1VCB A;  1D5X C;  1UZX B;  1WGH A;  1NTI A;  2X38 A;  5KQ4 A;  4IUM B;  1IYF A;  2WU2 B;  4TKN A;  4HAT B;  4ZHP A;  4GMV A;  4QJ3 B;  1W1D A;  1P0R A;  1XD3 B;  3I3T B;  2LOX A;  1X05 A;  2Z13 A;  2CJO A;  3MC0 B;  2MWS B;  4W9L A;  2LI5 A;  4MT7 A;  4NSW A;  5DCN A;  2BQQ A;  5FI0 A;  2XK5 B;  3W1Y A;  5JH5 C;  3F5R A;  2W3R A;  1WI1 A;  4LLG M;  2UWQ A;  1X1M A;  3NY5 A;  4W9E A;  4GDL B;  4HKZ E;  5L81 A;  2KAJ A;  2P8V A;  3GP7 A;  1T0S C;  3ZKJ C;  2EEL A;  5C79 A;  1FEH A;  3DWM A;  2WGS A;  1FCC C;  2H89 B;  3VQI A;  1P5T A;  2KMC A;  4EFO A;  3Q3J A;  4M0W A;  2R2Q A;  3EFU A;  5E6J A;  1XEE A;  1V80 A;  1U5F A;  1WRD B;  4IWQ A;  1DDW A;  1FFU A;  2BWE S;  4RGM A;  4ZHO A;  3MPX A;  1TXD A;  1ENF A;  4GZU A;  3MTN B;  2D3B A;  3N3K B;  2J0M A;  1WF9 A;  4KDL B;  1E90 A;  1JRP A;  2A5U A;  5EE9 A;  1FAO A;  1UEL A;  4ZOH C;  2RQ1 A;  1I7H A;  3U2S C;  4BBN F;  2G45 B;  3DWG C;  1Y56 A;  3VOQ A;  3AE4 B;  3UF8 A;  1PUT A;  1JRO A;  4HXD A;  1QOF A;  2KFK B;  2RUK B;  4II2 B;  2R82 A;  4N9F 4;  3KQ4 A;  4NNJ B;  1RRB A;  2KVZ A;  3VUX A;  1UPQ A;  2KFK A;  4N59 A;  5H8Y E;  3CIR B;  4JL9 A;  4GMX B;  3ZVV A;  2WXG A;  1M94 A;  4ICV A;  1C9F A;  4X57 B;  2RD0 A;  2NTS A;  4HSI A;  4GOC A;  3AU5 A;  2IPK D;  2DZK A;  2XBB C;  4OSN A;  1D5Z C;  3KUZ A;  3VHT C;  1V5M A;  1SE3 A;  2KVR A;  3DBS A;  3VH3 B;  4DXA B;  3ZJU A;  2K5P A;  3AB5 A;  1B55 A;  1ZOY B;  3DXC A;  2N1V A;  1FXA A;  3DOW A;  1E8Z A;  1ISN A;  3AEB B;  3GZN B;  2N9P C;  3ML8 A;  1SE2 A;  3R8B A;  5GXG B;  3KW5 B;  3PTF C;  3NRZ A;  1L4D B;  3RUL A;  2DYM A;  2DEN B;  1H4R A;  4H8S A;  3ODW A;  3ULB A;  4M01 A;  2HRJ A;  2BYE A;  3HRD D;  4AOF A;  3L16 A;  3SDL C;  2BS2 B;  4C4V A;  2G4S A;  4RH6 A;  2XK5 A;  2K00 A;  1ZXH A;  2BGF A;  2BVC A;  4MSM B;  2CY4 A;  2ELA A;  1XF5 L;  1UF0 A;  2K39 A;  4YTP B;  2YT2 A;  3NSU A;  1N60 A;  4DIX A;  1U5D A;  3NS1 A;  1U5G A;  3T8M A;  1E7V A;  5D3V A;  1TZ1 A;  2LD9 A;  4HB4 B;  3PRM B;  4AJW A;  2JSV X;  2V3N A;  2K3U A;  2KX3 A;  4FHJ A;  4KIK B;  1KM7 A;  3FLV A;  3RCZ A;  3SBG A;  1TS3 A;  1R4M I;  2HJ8 A;  2MP2 B;  2DIK A;  2E3T A;  2KK8 A;  1KF6 B;  3DDC B;  3Q8F A;  1TY2 A;  1NTV A;  1T5X D;  2IZV B;  1IPG A;  1KBL A;  1I4R A;  4WSF A;  1V49 A;  5HHD G;  1U5E A;  4JKD A;  2GOW A;  1WVH A;  3JYU A;  1V5P A;  2EC1 A;  2BB6 A;  3SO6 A;  4TQ0 A;  1UNP A;  4GPT B;  3AE9 B;  4HAX B;  1WMH A;  1BML C;  2M19 A;  1RJ2 A;  2FJU B;  2KXJ A;  1ZDV A;  2SEB D;  1AYF A;  2WS3 B;  4Z2M B;  4G11 A;  1D3Z A;  4ILG B;  1FO4 A;  1FD6 A;  5KHO A;  2MBB B;  3CXB B;  3W5V B;  4XWX A;  5FR3 A;  1KLG D;  1EF5 A;  5BMH A;  1QLB B;  2FNJ B;  1WX7 A;  1BTK A;  3PPA A;  4F7G A;  1XLN A;  1RWS A;  1MK9 B;  4HAW B;  4MDK E;  2LVQ A;  3ONS A;  1X86 A;  1ZC4 B;  5EE3 A;  3AE8 B;  2X0S A;  1AAR A;  1L0V B;  1V6E A;  3Q3F A;  1WM2 A;  2NS5 A;  3H9D A;  1DDM A;  4MGI E;  2LMC A;  4A6H A;  4PNK A;  3PZD A;  3NZU A;  2NVU I;  2MJD A;  3VRA B;  1OTR B;  4W9J A;  3HQC A;  1DOI A;  1J7C A;  5M4Y B;  2JZZ A;  4FN2 A;  1P3R A;  1WWT A;  3KWL A;  1SJH D;  3IAS 1;  3PP2 A;  4QXA B;  3AU4 A;  4AUQ C;  2CRF A;  3IHP C;  2KJR A;  4A55 A;  2RVB B;  1YD8 U;  3P1M A;  1DYQ A;  4BAX A;  4DQO C;  4IW0 A;  3OAN A;  2K2U A;  1WX9 A;  3ODX A;  1PGX A;  4LCD E;  1JML A;  2LRU A;  3V60 A;  3ZTC A;  2Q13 A;  4EZJ A;  1WGG A;  3MHZ A;  1HTO A;  1GOZ A;  3OG5 A;  4JK8 A;  1TZO A;  2PVG C;  4AWJ A;  2M56 B;  3TBL D;  4DXF A;  1NYQ A;  4REZ A;  2PEA A;  1J7A A;  1EAZ A;  2YS5 A;  1EGX A;  2MRP A;  1HB6 A;  2W54 A;  4DWF A;  2D9Y A;  2LGX A;  1T3Q A;  1RYJ A;  3DCG A;  1TS2 A;  4QJ5 B;  2DLB A;  2O6V B;  1WGK A;  3U8Z A;  2K25 A;  1IUE A;  4P1B C;  1XR0 B;  1G6J A;  3FM8 C;  4TYZ A;  4MY6 A;  4HAU B;  1XO3 A;  2PMV A;  5BYR A;  1FGY A;  3PZ8 A;  4OZB A;  3NS8 A;  2W82 A;  2M38 A;  2JY6 A;  3NWF A;  2PZ1 A;  2CHX A;  4KGT A;  3QQ8 B;  4KX6 B;  1OQN A;  3VXW A;  4C00 A;  3QJZ A;  3MDB C;  2P0H A;  5LON B;  2QMT A;  2N9L A;  4FJV B;  4OVZ A;  1GGO A;  2KDF B;  3A4R A;  4KIK A;  2LJI A;  4WQO B;  2PPH A;  2GS0 A;  4YON A;  3AXC A;  4JLC A;  4M8M A;  1WZ3 A;  1XCT L;  2D9X A;  2WXQ A;  3L17 A;  3PHX B;  3LJU X;  3U30 A;  1NVI D;  4BZA A;  1P1A A;  4A3O A;  3MHS D;  5CTR C;  1QZE A;  1IBX B;  3H8H A;  4M00 A;  4W9G A;  2D3C A;  2LGI A;  5J17 A;  1K5D B;  2BYT A;  4M02 A;  2L83 A;  4IOI E;  5J3T A;  3R3M A;  4WQM A;  5E6O A;  2DYB A;  1HE8 A;  1WJ6 A;  2IY0 B;  4WJQ A;  4K81 A;  4BFR A;  4PK1 A;  2MBE A;  2C9W B;  1TJ6 A;  3IBE A;  4Z2N A;  1MI0 A;  5AEK B;  1LFD A;  2G9H D;  2M4N A;  5JLJ B;  2RDG A;  2JP2 A;  1QQG A;  1Q10 A;  1WJM A;  1EWC A;  4DDI D;  1UNR A;  5JZE B;  1CMX B;  2IO3 B;  2QEJ C;  1F0Z A;  3GYP A;  3P7Z A;  2RNR B;  3C8Y A;  2ROZ B;  2Y5B B;  3ODO A;  1JCK B;  2KGX B;  4XC2 A;  2O6V A;  4PYZ A;  3TCA A;  2W2X D;  4A20 A;  2QC8 A;  3PZ7 A;  2GRI A;  1MHX A;  3AH7 A;  1R4M B;  4BKS D;  2FCM A;  3WAM A;  1M7E A;  3UGB B;  3RNC C;  2QKL A;  5TR5 A;  3BK1 A;  2C60 A;  2KCJ A;  2ABD A;  2AQ2 B;  2CB8 A;  1K8R B;  2PLP A;  2CY5 A;  1SIJ A;  5JHG A;  3CWI A;  3MC8 A;  4LJP B;  3GB1 A;  4KSK C;  2FBW B;  1ZGU B;  3P4P B;  3CSF A;  2XQN M;  2D9V A;  3PLU A;  3U12 A;  4S17 A;  4J3O D;  5DPR A;  3BK2 A;  2WX0 A;  2BW2 A;  3V05 A;  4D6W A;  3HIZ A;  1Z5S B;  4L23 A;  4GLS C;  2XNA C;  2DZI A;  2KTR A;  5AUI A;  4A6Q A;  1JAL A;  3ZXR A;  2KKC A;  4EZL A;  1ZVR A;  4WAF A;  2HE7 A;  1PYW D;  5D94 A;  1DBH A;  1IRS A;  3O96 A;  1I4P A;  3PSE B;  3ML4 A;  3D8F A;  1LM8 B;  4FHK A;  1YQB A;  2WLB A;  1EU4 A;  5LNK 1;  2WXI A;  5JHH A;  1DGJ A;  4MGZ E;  2MCN B;  3A33 B;  4M8N A;  3GE3 C;  2GMI C;  4W9F A;  2KO3 A;  2K1F A;  1ESF A;  3E9P A;  2DN6 A;  3RT3 B;  2KR0 A;  1JWM D;  2D3A A;  5KCV A;  4HJG E;  1I4H A;  3OJ3 A;  1GG3 A;  1KJT A;  2BF8 B;  2K6D B;  4GSW A;  5LLI A;  4US9 A;  1OMW A;  3BVZ A;  4GB9 A;  3JSV B;  2IJ0 A;  3ZIM A;  4GXB A;  4L1R A;  1V2Y A;  1M7R A;  3JVZ X;  4ZRQ A;  3RNB C;  3D32 A;  2ZEQ A;  3LYY A;  2ONQ A;  1MG8 A;  1MFW A;  2I1K A;  5HE0 A;  3QCA A;  1YJJ A;  3SUZ A;  2BS4 B;  2AL3 A;  4HDQ A;  1ZC3 B;  3ZNG C;  4F7H A;  2DNF A;  4AS1 A;  3KY9 A;  3DXD A;  1YN4 A;  3H1U A;  4JIO U;  2V3S A;  1N6Z A;  2L0F A;  2N0S B;  2FUH B;  3PT2 B;  3DVN U;  3AEF B;  4HK2 A;  4NAM A;  3TJP A;  1QKZ A;  1WH3 A;  4QAY A;  4PYU A;  5D3X A;  1MKE A;  2INN E;  1XLP A;  2KIE A;  2M8S A;  3QBV B;  1N61 A;  2Z0E B;  1EF1 A;  1Z2M A;  2PE6 B;  3QC8 B;  2DKP A;  1ET9 A;  3UQA A;  2MP2 A;  2DZJ A;  5C23 A;  2LWP A;  3VTU A;  1I4G A;  1KFY B;  2RMM A;  3ENB A;  2G35 A;  1L6U A;  3BVG A;  4JKG A;  3NWD A;  1D5M C;  3VTW A;  1NDD A;  3U52 E;  4A9A A;  1GPX A;  1VBH A;  4YL8 A;  4PS3 A;  1WRI A;  3I9V 1;  2X18 A;  1KRH A;  2N9X A;  3NW8 A;  1OEY J;  4HEA 1;  2I2Y A;  4C4V B;  2JZP A;  4JKH A;  3RYT A;  3T3N A;  2CS4 A;  2V3P A;  4GU2 A;  1PGA A;  1WE7 A;  2Z0O A;  4O1N A;  1MHH E;  1UWX A;  2D07 B;  3ECI A;  2LUL A;  3VUY A;  1C78 A;  3R7R A;  2YF0 A;  5D7G A;  1YN5 A;  3WIM A;  3W5U B;  2GLS A;  1XXG A;  4MAC A;  2LXA A;  1T0Q C;  2YS1 A;  4RCO A;  4ARI A;  2ZPY A;  3C0R B;  5EFX A;  4JPS A;  5FR6 A;  3DBL I;  3X0W A;  2Y8F A;  2RDB C;  2FJL A;  2H88 B;  2YVC A;  1XKE A;  1LB1 A;  2JF5 A;  2RPQ A;  4IM2 A;  3DBL B;  1L6V A;  3V6C B;  2KDE B;  4BBN C;  3SNH A;  2YRY A;  2ZCB A;  2WH5 A;  3DHH C;  2DYN A;  1UBI A;  1WJN A;  2PE9 A;  4HJK A;  5LXI B;  2V0G A;  1WYW B;  4HVB A;  4LNO A;  2K9X A;  4IDI A;  4TQ1 A;  1EVH A;  3H7S A;  2DFK A;  4MGK E;  2Z4D A;  2YT0 A;  1SJE D;  3DVG Y;  2DTC A;  1WM3 A;  2SAK A;  2MBH A;  3LB8 C;  4LK0 M;  2H7D A;  2ZZP B;  1V9J A;  2OTX A;  1FIQ A;  1NEK B;  3S2A A;  2WXN A;  5D2M B;  1MVK A;  5GOW B;  4A5K A;  3HVD A;  3BWU D;  3N1X C;  2IO0 B;  3TSS A;  4XDD A;  3QIJ A;  2V76 A;  1P7F A;  1Y5O A;  3ETR A;  2RPV A;  5BYQ A;  1DIK A;  3NOB A;  4OW0 A;  4MH8 A;  2KT7 A;  4RM9 A;  1HEZ E;  4W9K A;  1WR6 E;  3W9C B;  4HAY B;  1NBF C;  2GI9 A;  4WWP A;  3NHE B;  2RGN B;  2GBJ A;  3E9O A;  4HPP A;  4DK5 A;  1FHW A;  5BMG A;  2COC A;  2WU5 B;  2D5G A;  4K7U A;  2KWU B;  4M0W B;  3ZO5 B;  4W9D A;  3GZN I;  2KX0 A;  1DOX A;  3F0W A;  1U4A A;  1B1Z A;  4F7Z A;  2EKI A;  5C1Z A;  3DPD A;  3Q8C A;  2JX5 A;  1V5U A;  3PG7 A;  4HB0 B;  5D3I B;  3AN1 A;  1MPH A;  1IGC A;  3ZUN A;  3IT6 B;  1E7U A;  4K3C A;  4ASW C;  2CHW A;  2KC1 A;  2HDE A;  4EEW A;  2QKM A;  3NWA A;  4JWS C;  3RNA C;  4IFS A;  2GBM A;  3OHM B;  3A8P A;  2BWF A;  3SEB A;  4HKQ A;  3RZW C;  2WP9 B;  3P4R B;  3ALB A;  4JKE A;  1TGZ B;  3BII D;  3T06 A;  2BKF A;  1ACA A;  3SYX A;  3MFG A;  1TKE A;  4MGY E;  1MIX A;  4KZ0 A;  2L7R A;  2YEP F;  1WGQ A;  1LQB A;  3BIN A;  1C1Y B;  4MK0 A;  2FUG 1;  2GJY A;  3P42 A;  3LDZ E;  3N7C A;  2K8C A;  2QIE B;  3N9Y C;  2KN4 A;  3UIO B;  5G5G A;  5IAA C;  2LUM A;  3NZS A;  4C0A A;  1KZG A;  3FIL B;  5G2N A;  3WAO A;  1I2H A;  3DHI C;  3UZT A;  2UU7 A;  5L95 C;  3PEG A;  3TW1 A;  1MK7 B;  2BT6 A;  5IRS A;  3A9K A;  1UNS A;  5AUK A;  3EPY A;  1XCQ L;  4FBJ B;  1GB1 A;  2PJH A;  4YXD B;  5JVL A;  1FNU A;  2KQS A;  3PHW B;  1J7B A;  1W1H A;  4KKJ A;  4ZRP A;  2K22 A;  2KIG A;  3DHG C;  2ZCC A;  1IP9 A;  2LG1 A;  2L3Z A;  1QOA A;  4IAP A;  1S1Q B;  1WGY A;  2D10 A;  1VLB A;  2O2V A;  1ACC A;  3QHT A;  4RMA A;  1MIZ B;  4E3C A;  1DRO A;  1N5W A;  1RFA A;  2PVO D;  3KLS X;  2KWC A;  3ZTD A;  2IGG A;  2K0P A;  1TKY A;  3AE6 B;  2IGH A;  1XLQ A;  1Y19 B;  1LO5 D;  3TEX A;  2XEW A;  1E10 A;  2L05 A;  4JKC A;  5DH9 B;  5J18 A;  3FEH A;  1JWS D;  2WXR A;  2MA9 B;  3RNF C;  5D27 A;  2N4F A;  3Q8E A;  1AWD A;  4MM3 A;  4WJO A;  3UI3 A;  1L5P A;  4RGO S;  3W1S C;  4WUR A;  1C79 A;  1F52 A;  1GNU A;  4KGR A;  2MBQ A;  3EGR A;  2BKR B;  2M0A A;  2Z8L A;  3FSS A;  4NPN A;  4Y94 A;  4HB3 B;  3W1S A;  2Y5C A;  2DHK A;  4ZRJ A;  1T0R C;  3SU8 X;  4GDK A;  4XDC A;  1PFJ A;  3BZD B;  2GB1 A;  3U4E G;  3B2G A;  2J0K A;  1QF6 A;  2WYQ A;  1VRA B;  4ZRI A;  5KQ1 A;  1SIF A;  2ASQ A;  2JUO A;  2FE8 A;  1JDE A;  5HE3 A;  3AV8 A;  4KGS A;  5IA7 A;  5DHF B;  1Q1O A;  4RM8 A;  1EUV B;  3TEW A;  2LGS A;  2JYE A;  3PSC A;  2L1A A;  3PLV A;  3HIE A;  4WWO A;  1SSN A;  3EA6 A;  4BBK A;  2CQU A;  2KC2 A;  1WX8 A;  4WJP A;  2DHJ A;  1FCL A;  1UD7 A;  2D4Q A;  3L08 A;  3AE1 B;  1EU3 A;  2DHI A;  1N63 A;  2V4I B;  2LXC A;  4OZA A;  4G50 A;  2IBI B;  2OJW A;  4NJC A;  2UZR A;  2IY1 B;  4JGH B;  2G1E A;  1D4B A;  1TTN A;  2WXK A;  2P0D A;  1OQY A;  2COD A;  4XZ4 A;  2LAS A;  4R3D A;  3VIA A;  2FCS A;  4K17 A;  4DX8 A;  1X11 A;  4YT0 B;  4NJ7 A;  4HB2 B;  3P4S B;  1RM6 C;  3ABV B;  1ZXI A;  4IWO A;  2ZVO A;  2MBO A;  5JP4 A;  3PV1 A;  2BCJ A;  3PO0 A;  1V1O A;  5G55 A;  4KDI C;  3KSY A;  2OJR A;  4B9K A;  1PLS A;  2K2J A;  4YSZ B;  2J42 A;  4UDU C;  1WE6 A;  1N3H A;  3AE3 B;  3R66 C;  2D9W A;  4ANV A;  3P2B A;  3CST A;  4ITK A;  2CAY A;  4LDT B;  4ZYN A;  4GNK B;  4PQ0 A;  4E74 A;  4DHJ B;  2ZJD A;  1YJ1 A;  3FAH A;  4D2K A;  2ZVN A;  2V9H A;  4HCN B;  4YSY B;  3R7Q A;  1H8C A;  4P1C C;  1R4N B;  2BB5 A;  2LKO A;  4OT1 A;  1BXT A;  5CX3 A;  2RLO A;  3JSV A;  3AI5 A;  3LJ3 A;  1P98 A;  4JX1 C;  2MX2 A;  1WXV A;  4B6W A;  4IWP A;  1WJU A;  1R7S A;  1I35 A;  4IM0 A;  3T3O A;  4HDO A;  2Z14 A;  4OVU A;  1E7P B;  1YQ3 B;  2NR2 A;  4DX9 0;  3N20 C;  4P6V F;  3W2D A;  4KSL C;  4BOS C;  4RNA A;  4DHZ E;  2KMM A;  2N7D A;  3L10 B;  2G3Q B;  2KDI A;  1E8W A;  2DX1 A;  3IAM 1;  1FFV A;  2L1C A;  2DAF A;  1LGR A;  4Q2J A;  3I57 A;  3DCX A;  5FI1 A;  4L2Y A;  5GMV A;  5AZH A;  1WFY A;  3HK0 A;  1KLV A;  2Y3A A;  2KTR B;  3U7D A;  1ZM0 A;  4CSQ A;  2LZ6 A;  3C19 A;  3TFM A;  1VD2 A;  4MT5 A;  2NBU A;  4LNI A;  1C4C A;  1AQC A;  2OOB B;  2NZ8 B;  2NBV A;  5IOI A;  2VZK B;  1VZ6 A;  2HTH B;  3BJI A;  3H6N A;  1GJZ A;  5JHA A;  3NVV A;  4ZDV A;  4LNK A;  3P4Q B;  4N6E B;  1FHX A;  2KMA A;  2O2V B;  1Z87 A;  4HPL B;  1FMA D;  4H2A A;  2K8B A;  2HTH A;  2WDR B;  2L8J A;  2WWZ A;  3IXS A;  3Q8A A;  1B9R A;  3R2T A;  2AYO B;  3L4P A;  3PRP B;  3JW0 X;  2AWT A;  3AMZ A;  1P7E A;  1WR1 A;  1EO6 A;  2C7N B;  1WXQ A;  3NJT A;  5LOP B;  1DOY A;  2COA A;  1XQQ A;  3PVL A;  3A9K B;  1QT9 A;  1WMH B;  3KUD B;  3A58 A;  3QX1 A;  3ZQ4 A;  3QWM A;  3RUI B;  1WXM A;  1IGD A;  4DHZ B;  4RF0 A;  1V81 A;  2XN9 C;  4NAW A;  3T9L A;  3QWZ B;  1J0G A;  3L0W B;  3ZYY X;  2JZ3 B;  1H10 A;  4KVG B;  3VAW A;  4LNN A;  3PRE A;  2BYF A;  4MEM A;  3KVF B;  2PIA A;  3N32 A;  2DBY A;  3SV1 A;  3PS6 A;  1FOE A;  2CR5 A;  5EE0 A;  4OHJ A;  1JWU D;  2KD0 A;  2V1Y A;  2DWQ A;  3EHV A;  1IBX A;  3BYT B;  2N1W A;  2QHO A;  4HHV A;  2ZNV B;  4AP4 C;  2EMS A;  4XYC A;  3V6E B;  3TUO A;  4AJY B;  3ZNH B;  4P16 A;  3PVU A;  2VRR B;  2KUQ A;  1E9M A;  2NPT B;  4C56 C;  1UPR A;  3Q69 A;  4DXG A;  2R0D A;  3TO1 A;  3Q3N C;  4B0M A;  1YMH E;  1GUA B;  2WDV B;  5T8I A;  4F1S A;  1W1G A;  5BMI A;  2KZR A;  1WJ4 A;  2JYT A;  2VH2 A;  5HE1 A;  4PS7 A;  3ZRF A;  1QIL A;  5E6N A;  1OGW A;  3GE8 C;  4MSQ B;  2UZS A;  2WX1 A;  1E5W A;  1J8C A;  1ZE3 D;  3NVZ A;  3M95 A;  2INP E;  2KNB A;  3GOE A;  3ZJT A;  1PGB A;  2DAJ A;  1ET6 A;  1ST7 A;  2Y7B A;  3P63 A;  4A90 A;  1U2B A;  2H7E A;  1CJE A;  2HD5 B;  2IFS A;  1I4X A;  3VR8 B;  1WXS A;  2KJ6 A;  2JXT A;  2MQJ A;  2FDQ A;  2R61 A;  3QK0 A;  3AE7 B;  2COP A;  1SF0 A;  3SBT A;  4HAZ B;  4EJN A;  4WJN A;  3RN9 C;  3X23 A;  1L7Y A;  2VKI A;  3V62 A;  4I6N B;  1V1P B;  3OJ4 B;  4FAD A;  1V5O A;  3A4S C;  4C80 A;  2K8E A;  4AQ7 A;  1FHO A;  3K9P B;  1U27 A;  3EUB 2;  3NZ3 A;  2EJ8 A;  4LTU A;  1SEB D;  4MEL A;  2KN5 A;  3APF A;  4F8C B;  2CJN A;  2PW9 A;  5C3J B;  2MDX A;  1VDV A;  4WIP A;  4WAA A;  4NQL B;  4BKS A;  1NI3 A;  1ZDX A;  4GDK B;  2J4X A;  3E9L A;  4L1B A;  4EE2 A;  4WJ7 A;  1SHC A;  4CHJ A;  3PVW A;  1SXT A;  1E8X A;  3AE2 B;  1KLU D;  5DI9 B;  2RRF A;  3ZDT A;  1EWY C;  2M0X A;  3HSA A;  5TSS A;  3RNG C;  4EUT A;  3TIX A;  2J59 M;  3P6A A;  3VRB B;  2WDT B;  3HVZ A;  2YSZ A;  5I2M A;  1MG4 A;  1E6E B;  1PFD A;  4JK7 A;  3LXF A;  2Q5W D;  5HI1 A;  3GYO A;  1FM0 D;  1HZ6 A;  1WXA A;  3DBH B;  4DDG D;  3V3X A;  3QAQ A;  3N1Z C;  4BOZ B;  2DLW A;  3I5J C;  3A9J B;  4GIV A;  1L0X B;  3URY A;  4WH4 A;  3IT4 B;  1KC7 A;  5J3Q A;  1TY0 A;  2L00 B;  3VVW B;  4XGA B;  2IGD A;  2AEH A;  4JKF A;  4MH0 E;  2O6V D;  1UNQ A;  4CHM A;  3HHM A;  3ZDM C;  4BKT A;  1V8C A;  2AQ1 B;  3VUW A;  4A8X C;  4HCP B;  3L13 A;  3ZXV A;  4A6K A;  2MW5 A;  1M4V A;  5D3W A;  5JXV A;  1BT0 A;  2IYD B;  2L2I A;  1VJK A;  2X8X X;  1VBG A;  1A70 A;  2AX5 A;  4URK A;  2Z59 B;  2Y8G A;  2REX A;  1L2N A;  2ROV A;  5BO4 B;  3FC4 A;  2Z59 A;  4WWN A; 
#chains in the Genus database with same CATH homology
 2KLG A;  4CHK A;  5DPS A;  3UIP B;  1P6S A;  3B0A A;  3DXE A;  1S3S G;  4GDL A;  1XD4 A;  1OEY A;  4CYE A;  1BTN A;  2FAZ A;  1NU2 A;  1WG7 A;  1WI0 A;  2D3G A;  3WA0 A;  4BKG A;  2LGY A;  1RLF A;  1HB8 A;  1WGR A;  1XT9 B;  4ICU A;  1SE9 A;  3D8E A;  2NCN A;  2ADZ A;  3M3J A;  5AZG A;  4KHO A;  1KOT A;  2UVM A;  3KYD D;  5C6R A;  3O65 B;  2RR9 A;  4EKU A;  3WYF B;  4LJO B;  3HM3 A;  2BYV E;  2C7M B;  1RRP B;  3TVV A;  2NBW B;  2JXX A;  2FID A;  2W2X C;  5IJM A;  2LJ5 A;  1ZW7 A;  3ZNI D;  4WVF B;  4DBB A;  5DHA B;  3SHQ A;  5CHV C;  2KTF A;  1E8Y A;  4ANX A;  3BY4 B;  1NI2 A;  4ZRK A;  2B3A A;  2YT1 A;  2LVO A;  2C7H A;  1K5G B;  3CMM B;  1A5R A;  2N0Y A;  4K1R B;  3ULC A;  1FGZ A;  1SGH A;  3A9J A;  4HLE A;  2RGF A;  3ZVR A;  4IC7 B;  2N23 A;  2EKE C;  3IG3 A;  5CHW A;  1V5T A;  5AZF A;  3H7P B;  2L76 A;  1Q5W B;  4G3X B;  2DKQ A;  3PRZ A;  3A1Q A;  1C3T A;  4W9C A;  1UH6 A;  1DYN A;  3ZRC A;  1YX5 B;  2MWN B;  1JRU A;  2M14 A;  3K9O B;  4DBG A;  4P7I A;  1X1F A;  2LGD A;  5CLL B;  3M62 B;  3KRX A;  3DVG X;  3WAN A;  4B95 A;  2DYO A;  2KJH B;  3G9W A;  4LDT D;  2J7Q B;  5J2R A;  2NPT A;  4XX5 A;  1LXD A;  4DHJ D;  3EC8 A;  3KRW A;  3APC A;  4HAV B;  3OAW A;  1T0Y A;  1WIA A;  4JKG B;  1BWN A;  3DBR I;  3UIN B;  3TMP B;  2GBR A;  2GCL A;  2ZNV C;  4J6I A;  4KV2 A;  4ILH A;  4PS8 A;  4EOY A;  5DPW A;  4KHB B;  4IOY X;  4II3 B;  2MSE D;  4A6F B;  3DVN V;  4I6P A;  2KLC A;  1AWE A;  2LOZ A;  3OLM D;  2KWV B;  3M1I B;  1UGM A;  3IFW B;  5DIF B;  1UBQ A;  2CKH B;  3KZ1 A;  1XCG A;  4EZK A;  5C5B B;  1P3Q U;  4TUU A;  4FLH A;  1XX0 A;  4CO7 A;  3PGE A;  2DHZ A;  4HPM B;  5KHQ A;  2MFQ A;  5E6P A;  3WAL A;  2W9N A;  4GGQ A;  1V61 A;  2YLM A;  3UQB A;  3EEC A;  4A3P A;  3HW2 B;  4L6E A;  4JKA A;  1MAI A;  3KUC B;  2LBB A;  2RSG A;  2DX5 B;  2NBV B;  4BVU C;  2GBK A;  3VTV A;  4NAW B;  2KAN A;  3AUL A;  4E71 A;  2OQB A;  5C16 A;  2AL6 A;  5EDS A;  4D0N B;  1I42 A;  2VSZ A;  5CHF A;  2DYQ A;  4MJS A;  3CF6 E;  1ZKH A;  1TQZ A;  3TL5 A;  2CU1 A;  4JQW C;  1GC7 A;  5DPT A;  3M63 B;  3RCP A;  2JVC A;  2D9Z A;  3ML9 A;  2JT4 B;  2K8H A;  5J3Y A;  4ILJ A;  5HKH A;  4OVV A;  1WGU A;  1NVL A;  2M1M A;  4I6L B;  1LW3 A;  1QC6 A;  2KFJ A;  1KI1 B;  5D6J B;  2I5F A;  3ZW3 A;  3RD2 A;  3FP5 A;  3ZLZ A;  4FUL A;  5LXH A;  1YIW A;  2R09 A;  4B6H A;  5C5B A;  2L0T A;  3L54 A;  3HM6 X;  1J19 A;  2FIF A;  4FJZ A;  4ANU A;  2BPS A;  3V61 A;  2EMT A;  2M17 A;  2MLB A;  2J0J A;  4A6F A;  2W2W A;  2JPH A;  5CLQ B;  2LRW A;  2LVP A;  3AJ4 A;  2KOX A;  2JRH A;  1V88 A;  1UEF A;  4W9I A;  3A98 B;  2Z0P A;  2DX5 A;  1I7A A;  1NTY A;  3ENE A;  3V5W A;  4IM3 A;  3QA8 A;  5HE2 A;  4F7U P;  1WZ0 A;  4ANW A;  4GN1 A;  1R4N I;  1PMS A;  2I1J A;  1V86 A;  1Q67 A;  3A8Q A;  1X1G A;  2LUE A;  3MJW A;  4IG7 B;  1XOD A;  1DDV A;  4KAX B;  2G4D B;  2VRW B;  2DZM A;  2KUP A;  3QAR A;  3ZNZ B;  2P0F A;  4K2O A;  1YX6 B;  3E66 A;  2E2X A;  1WY8 A;  1GC6 A;  2RSU A;  2JRI B;  1PQS A;  2FCQ A;  4KZC A;  1Y8R C;  3RZF A;  4JKB A;  2UYZ B;  2KHW B;  1Q0W B;  4K7W A;  3VH4 B;  1FB8 A;  3CIK A;  2COF A;  3KH0 A;  1WGD A;  2K6Q A;  2ELB A;  3H7P A;  3SD5 A;  4TV3 A;  2MKR A;  4EMO A;  3APD A;  2ZPN A;  3N30 A;  1TBE A;  2KQ7 A;  1ZSQ A;  2N9E B;  1FXT B;  3IVF A;  4W9H A;  2YS3 A;  1V89 A;  2IO2 B;  2C5L C;  5JHB A;  2A4Z A;  3B1L X;  2IO1 B;  1U29 A;  4K7S A;  1WJ1 A;  2GBN A;  4MJS B;  3VDZ A;  2CHZ A;  2Z0D B;  2D2Q A;  3A1Q B;  4NY0 A;  2FCN A;  2JWZ A;  2KDB A;  3WAP A;  2I5C A;  3B08 A;  3D8D A;  1F9J A;  1HBK A;  2Z0Q A;  2LYD A;  3DBH I;  3DQV A;  2D11 A;  2R2O A;  2IYB A;  2NMB A;  4JK9 A;  5L83 A;  1OY2 A;  2GCJ A;  1RAX A;  4FA6 A;  2V4L A;  4KHA A;  3VFK A;  4K2P A;  4FJY A;  1KZ7 A;  3KYC D;  4NQK E;  1J0W A;  2N7E A;  2FJ9 A;  4NJ6 A;  4G0N B;  5D3Y A;  2DA0 A;  1BAK A;  1P9D U;  4HWI B;  1VCB A;  1UZX B;  1WGH A;  4IUM B;  1NTI A;  1IYF A;  5KQ4 A;  4TKN A;  4HAT B;  4GMV A;  1W1D A;  1P0R A;  1XD3 B;  3I3T B;  2LOX A;  1X05 A;  2MWS B;  4W9L A;  2LI5 A;  4MT7 A;  4NSW A;  5DCN A;  5FI0 A;  2XK5 B;  3W1Y A;  5JH5 C;  3F5R A;  1WI1 A;  2UWQ A;  1X1M A;  3NY5 A;  4W9E A;  4GDL B;  5L81 A;  2P8V A;  3ZKJ C;  5C79 A;  3VQI A;  1P5T A;  2KMC A;  4EFO A;  3Q3J A;  2R2Q A;  3EFU A;  1V80 A;  1U5F A;  1WRD B;  4IWQ A;  1DDW A;  2BWE S;  3MPX A;  3MTN B;  1TXD A;  4GZU A;  3N3K B;  2J0M A;  1WF9 A;  4KDL B;  1E90 A;  2A5U A;  1FAO A;  1UEL A;  2RQ1 A;  4BBN F;  2G45 B;  3VOQ A;  3UF8 A;  4HXD A;  2KFK B;  2RUK B;  4II2 B;  2R82 A;  4N9F 4;  4NNJ B;  1RRB A;  3VUX A;  1UPQ A;  2KFK A;  4JL9 A;  4GMX B;  3ZVV A;  1M94 A;  4ICV A;  4X57 B;  2RD0 A;  4GOC A;  3AU5 A;  2DZK A;  2XBB C;  3KUZ A;  3VHT C;  1V5M A;  2KVR A;  3DBS A;  3VH3 B;  4DXA B;  1B55 A;  3DXC A;  2N1V A;  3DOW A;  1E8Z A;  1ISN A;  2N9P C;  3ML8 A;  3KW5 B;  3PTF C;  3RUL A;  2DEN B;  2DYM A;  1H4R A;  4H8S A;  3ODW A;  3ULB A;  2HRJ A;  2BYE A;  4AOF A;  3L16 A;  3SDL C;  2G4S A;  2XK5 A;  2K00 A;  2BGF A;  4MSM B;  2CY4 A;  2ELA A;  2K39 A;  3NSU A;  1U5D A;  1U5G A;  3T8M A;  1E7V A;  5D3V A;  1TZ1 A;  2LD9 A;  4HB4 B;  3PRM B;  4AJW A;  4FHJ A;  2KX3 A;  4KIK B;  1KM7 A;  3FLV A;  3RCZ A;  3SBG A;  1R4M I;  2HJ8 A;  2MP2 B;  2DIK A;  2KK8 A;  3DDC B;  1NTV A;  2IZV B;  1IPG A;  1KBL A;  4WSF A;  1V49 A;  1U5E A;  4JKD A;  2GOW A;  1WVH A;  3JYU A;  1V5P A;  2EC1 A;  4TQ0 A;  3SO6 A;  1UNP A;  4GPT B;  4HAX B;  1WMH A;  1RJ2 A;  2KXJ A;  4Z2M B;  4G11 A;  1D3Z A;  4ILG B;  5KHO A;  2MBB B;  3CXB B;  4XWX A;  1EF5 A;  2FNJ B;  1WX7 A;  1BTK A;  3PPA A;  4F7G A;  1MK9 B;  4HAW B;  4MDK E;  2LVQ A;  3ONS A;  1X86 A;  1ZC4 B;  2X0S A;  1AAR A;  1V6E A;  3Q3F A;  1WM2 A;  2NS5 A;  3H9D A;  1DDM A;  4MGI E;  4A6H A;  4PNK A;  3PZD A;  3NZU A;  2NVU I;  1OTR B;  4W9J A;  3HQC A;  2JZZ A;  4FN2 A;  1P3R A;  3PP2 A;  3AU4 A;  4AUQ C;  2CRF A;  3IHP C;  2KJR A;  2RVB B;  1YD8 U;  4IW0 A;  3OAN A;  2K2U A;  1WX9 A;  3ODX A;  4LCD E;  2LRU A;  3V60 A;  3ZTC A;  2Q13 A;  4EZJ A;  1WGG A;  4JK8 A;  4AWJ A;  3TBL D;  2PEA A;  1EAZ A;  2YS5 A;  1EGX A;  2MRP A;  1HB6 A;  4DWF A;  2D9Y A;  2LGX A;  3DCG A;  2O6V B;  3U8Z A;  2K25 A;  1XR0 B;  1G6J A;  3FM8 C;  4TYZ A;  4MY6 A;  4HAU B;  1FGY A;  3NS8 A;  2M38 A;  2JY6 A;  2PZ1 A;  2CHX A;  3QQ8 B;  1OQN A;  3VXW A;  3QJZ A;  3MDB C;  2P0H A;  5LON B;  4FJV B;  1GGO A;  2KDF B;  3A4R A;  4KIK A;  4WQO B;  2PPH A;  2GS0 A;  4YON A;  3AXC A;  4JLC A;  4M8M A;  1WZ3 A;  2D9X A;  3L17 A;  3PHX B;  3LJU X;  3U30 A;  1P1A A;  4A3O A;  3MHS D;  5CTR C;  1QZE A;  4W9G A;  5J17 A;  1K5D B;  5J3T A;  3R3M A;  5E6O A;  2DYB A;  1HE8 A;  1WJ6 A;  2IY0 B;  4WJQ A;  4K81 A;  4BFR A;  2MBE A;  2C9W B;  1TJ6 A;  3IBE A;  4Z2N A;  5AEK B;  1LFD A;  2M4N A;  5JLJ B;  2JP2 A;  1QQG A;  1WJM A;  4DDI D;  1UNR A;  5JZE B;  1CMX B;  2IO3 B;  3GYP A;  3P7Z A;  2RNR B;  2ROZ B;  2Y5B B;  3ODO A;  2KGX B;  4XC2 A;  2O6V A;  4PYZ A;  3TCA A;  2W2X D;  4A20 A;  4BKS D;  2FCM A;  3WAM A;  1M7E A;  3UGB B;  2QKL A;  5TR5 A;  2C60 A;  2KCJ A;  2ABD A;  2CB8 A;  1K8R B;  2CY5 A;  5JHG A;  4LJP B;  4KSK C;  1ZGU B;  3CSF A;  2XQN M;  2D9V A;  3PLU A;  5DPR A;  2WX0 A;  3HIZ A;  1Z5S B;  2DZI A;  2KTR A;  2KKC A;  4EZL A;  1ZVR A;  2HE7 A;  5D94 A;  1DBH A;  1IRS A;  3O96 A;  3PSE B;  3ML4 A;  3D8F A;  1LM8 B;  4FHK A;  1YQB A;  5JHH A;  4MGZ E;  2MCN B;  3A33 B;  4M8N A;  2GMI C;  4W9F A;  2KO3 A;  2K1F A;  3E9P A;  2DN6 A;  3RT3 B;  5KCV A;  3OJ3 A;  1GG3 A;  1KJT A;  2BF8 B;  2K6D B;  4GSW A;  5LLI A;  1OMW A;  4GB9 A;  3JSV B;  3ZIM A;  4GXB A;  1V2Y A;  1M7R A;  3JVZ X;  3D32 A;  2ZEQ A;  1MG8 A;  2I1K A;  5HE0 A;  3QCA A;  3SUZ A;  2AL3 A;  4HDQ A;  1ZC3 B;  3ZNG C;  4F7H A;  3KY9 A;  3DXD A;  3H1U A;  4JIO U;  2V3S A;  2L0F A;  2FUH B;  3PT2 B;  3DVN U;  4HK2 A;  3TJP A;  1WH3 A;  4PYU A;  5D3X A;  1MKE A;  2M8S A;  3QBV B;  2Z0E B;  1EF1 A;  1Z2M A;  2PE6 B;  3QC8 B;  2DKP A;  3UQA A;  2MP2 A;  2DZJ A;  5C23 A;  2LWP A;  3VTU A;  3ENB A;  2G35 A;  4JKG A;  3VTW A;  1NDD A;  1VBH A;  4YL8 A;  4PS3 A;  2X18 A;  2N9X A;  1OEY J;  4JKH A;  3RYT A;  2CS4 A;  4GU2 A;  1WE7 A;  2Z0O A;  2D07 B;  3ECI A;  2LUL A;  3VUY A;  3R7R A;  2YF0 A;  5D7G A;  3WIM A;  2LXA A;  2YS1 A;  2ZPY A;  3C0R B;  5EFX A;  5FR6 A;  3DBL I;  3X0W A;  2Y8F A;  2FJL A;  2YVC A;  1XKE A;  1LB1 A;  2JF5 A;  2RPQ A;  4IM2 A;  3V6C B;  2KDE B;  4BBN C;  3SNH A;  2YRY A;  2ZCB A;  2WH5 A;  2DYN A;  1UBI A;  1WJN A;  2PE9 A;  4HJK A;  5LXI B;  1WYW B;  4HVB A;  4TQ1 A;  1EVH A;  3H7S A;  2DFK A;  4MGK E;  2YT0 A;  3DVG Y;  2DTC A;  1WM3 A;  2MBH A;  2H7D A;  2ZZP B;  1V9J A;  2OTX A;  3S2A A;  5D2M B;  5GOW B;  4A5K A;  2IO0 B;  3QIJ A;  2V76 A;  1Y5O A;  1DIK A;  3NOB A;  4RM9 A;  4W9K A;  1WR6 E;  4HAY B;  1NBF C;  4WWP A;  3NHE B;  2RGN B;  2GBJ A;  3E9O A;  4DK5 A;  1FHW A;  2COC A;  4K7U A;  2KWU B;  4M0W B;  3ZO5 B;  4W9D A;  3GZN I;  2KX0 A;  3F0W A;  1U4A A;  4F7Z A;  5C1Z A;  3DPD A;  1V5U A;  3PG7 A;  4HB0 B;  1MPH A;  3ZUN A;  1E7U A;  4ASW C;  2CHW A;  2KC1 A;  4EEW A;  2QKM A;  4IFS A;  2GBM A;  3A8P A;  2BWF A;  3RZW C;  3ALB A;  4JKE A;  1TGZ B;  3T06 A;  2BKF A;  1ACA A;  3SYX A;  4MGY E;  1MIX A;  4KZ0 A;  2L7R A;  1WGQ A;  1LQB A;  3BIN A;  1C1Y B;  4MK0 A;  2GJY A;  3LDZ E;  3N7C A;  2K8C A;  3UIO B;  5IAA C;  3NZS A;  4C0A A;  1KZG A;  5G2N A;  3WAO A;  1I2H A;  3UZT A;  5L95 C;  3PEG A;  3TW1 A;  1MK7 B;  3A9K A;  3EPY A;  4FBJ B;  2PJH A;  5JVL A;  2KQS A;  3PHW B;  1W1H A;  2ZCC A;  1IP9 A;  2LG1 A;  2L3Z A;  4IAP A;  1S1Q B;  1WGY A;  2D10 A;  2O2V A;  3QHT A;  4RMA A;  1MIZ B;  4E3C A;  1DRO A;  1RFA A;  2KWC A;  3ZTD A;  1Y19 B;  2XEW A;  2L05 A;  4JKC A;  5DH9 B;  5J18 A;  3FEH A;  2MA9 B;  5D27 A;  2N4F A;  4WJO A;  4MM3 A;  3W1S C;  1GNU A;  2MBQ A;  2BKR B;  3FSS A;  4NPN A;  4Y94 A;  4HB3 B;  3W1S A;  2DHK A;  4ZRJ A;  3SU8 X;  4GDK A;  1PFJ A;  2J0K A;  2WYQ A;  4ZRI A;  5KQ1 A;  1SIF A;  2ASQ A;  2JUO A;  1JDE A;  5HE3 A;  5IA7 A;  5DHF B;  1Q1O A;  4RM8 A;  1EUV B;  3PSC A;  3PLV A;  4WWO A;  4BBK A;  2CQU A;  2KC2 A;  1WX8 A;  4WJP A;  2DHJ A;  1UD7 A;  2D4Q A;  3L08 A;  2DHI A;  2LXC A;  4G50 A;  2IBI B;  2UZR A;  2IY1 B;  4JGH B;  1TTN A;  2P0D A;  1OQY A;  2COD A;  4XZ4 A;  2LAS A;  3VIA A;  2FCS A;  4K17 A;  4DX8 A;  1X11 A;  4NJ7 A;  4HB2 B;  4IWO A;  2ZVO A;  2MBO A;  5JP4 A;  3PV1 A;  2BCJ A;  5G55 A;  4KDI C;  3KSY A;  2OJR A;  4B9K A;  1PLS A;  2K2J A;  1WE6 A;  1N3H A;  3R66 C;  2D9W A;  4ANV A;  3P2B A;  3CST A;  2CAY A;  4LDT B;  4ZYN A;  4PQ0 A;  4E74 A;  4DHJ B;  2ZJD A;  1YJ1 A;  2ZVN A;  4HCN B;  3R7Q A;  1H8C A;  2LKO A;  5CX3 A;  2RLO A;  3JSV A;  3AI5 A;  3LJ3 A;  1P98 A;  2MX2 A;  1WXV A;  4B6W A;  4IWP A;  1WJU A;  1I35 A;  4IM0 A;  4HDO A;  4OVU A;  2NR2 A;  4DX9 0;  4KSL C;  4BOS C;  4DHZ E;  2N7D A;  3L10 B;  2G3Q B;  2KDI A;  1E8W A;  2DX1 A;  2L1C A;  2DAF A;  5FI1 A;  5GMV A;  5AZH A;  1WFY A;  3HK0 A;  1KLV A;  2KTR B;  3U7D A;  1ZM0 A;  2LZ6 A;  3TFM A;  1VD2 A;  2NBU A;  1AQC A;  2OOB B;  2NZ8 B;  2HTH B;  3BJI A;  3H6N A;  1GJZ A;  5JHA A;  4ZDV A;  1FHX A;  2KMA A;  2O2V B;  1Z87 A;  4HPL B;  2K8B A;  2HTH A;  2L8J A;  2WWZ A;  2AYO B;  3PRP B;  3JW0 X;  2AWT A;  1WR1 A;  1EO6 A;  2C7N B;  5LOP B;  2COA A;  1XQQ A;  3PVL A;  3A9K B;  1WMH B;  3KUD B;  3QX1 A;  3QWM A;  3RUI B;  1WXM A;  4DHZ B;  1V81 A;  3T9L A;  4NAW A;  1J0G A;  3QWZ B;  3L0W B;  2JZ3 B;  1H10 A;  4KVG B;  3VAW A;  3PRE A;  2BYF A;  4MEM A;  3KVF B;  3N32 A;  3SV1 A;  3PS6 A;  1FOE A;  2CR5 A;  2KD0 A;  2V1Y A;  3EHV A;  2N1W A;  2QHO A;  4HHV A;  2ZNV B;  4AP4 C;  2EMS A;  3V6E B;  4AJY B;  3ZNH B;  3PVU A;  2NPT B;  2VRR B;  1UPR A;  2R0D A;  3TO1 A;  1GUA B;  4F1S A;  1W1G A;  2KZR A;  1WJ4 A;  5HE1 A;  4PS7 A;  3ZRF A;  5E6N A;  1OGW A;  4MSQ B;  2UZS A;  2WX1 A;  1E5W A;  1J8C A;  3M95 A;  2KNB A;  3GOE A;  2DAJ A;  1ST7 A;  2Y7B A;  1U2B A;  2H7E A;  2HD5 B;  2IFS A;  1WXS A;  2KJ6 A;  2MQJ A;  2FDQ A;  3QK0 A;  2COP A;  3SBT A;  4HAZ B;  4EJN A;  4WJN A;  3X23 A;  1L7Y A;  2VKI A;  3V62 A;  4I6N B;  3OJ4 B;  4FAD A;  1V5O A;  3A4S C;  1FHO A;  3K9P B;  1U27 A;  2EJ8 A;  4MEL A;  2KN5 A;  3APF A;  4F8C B;  2MDX A;  4WAA A;  4NQL B;  4BKS A;  4GDK B;  3E9L A;  4WJ7 A;  1SHC A;  4CHJ A;  3PVW A;  1E8X A;  5DI9 B;  3ZDT A;  2M0X A;  4EUT A;  3TIX A;  2J59 M;  3P6A A;  2WDT B;  2YSZ A;  4JK7 A;  3GYO A;  1WXA A;  4DDG D;  3QAQ A;  4BOZ B;  2DLW A;  4GIV A;  3A9J B;  1KC7 A;  5J3Q A;  2L00 B;  3VVW B;  2AEH A;  4JKF A;  4MH0 E;  2O6V D;  1UNQ A;  4CHM A;  3HHM A;  3ZDM C;  4BKT A;  3VUW A;  4HCP B;  3L13 A;  4A6K A;  2MW5 A;  5D3W A;  1BT0 A;  2IYD B;  2L2I A;  1VBG A;  4URK A;  2Z59 B;  2Y8G A;  2REX A;  1L2N A;  2ROV A;  5BO4 B;  4WWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...