2AL6A

Ferm domain of focal adhesion kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
373
structure length
343
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQTDDYAEIIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
total genus 98
structure length 343
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2al6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2al6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al6A01
2K8HA 1H10A 2W2WA 5EFXA 2IY1B 2K39A 3L16A 2RUKB 2GCLA 2L76A 2NCNA 4GIVA 1WGDA 3P7ZA 1CMXB 1V2YA 4HPMB 4EOYA 4WJPA 5DPTA 1FGZA 3PZDA 2N1WA 4B95A 1FHXA 2D10A 3B0AA 3N3KB 4IWQA 3KUZA 2FCQA 2K6QA 1TBEA 2MLBA 5FI1A 5C23A 3A8QA 5KCVA 3SDLC 5DHFB 1UD7A 1WMHB 2EMTA 3RZWC 5E6OA 3EFUA 2LJ5A 1I2HA 2KDBA 3A98B 1XX0A 2C7MB 1X11A 2MRPA 5C6RA 2YVCA 3SHQA 1SHCA 1E8ZA 2KNBA 3ML8A 3VFKA 4HAYB 2M0XA 2J0JA 3V60A 1UNPA 3ZVVA 2K8CA 4DXAB 1WMHA 5DPWA 4AOFA 3P2BA 4IW0A 4WSFA 2P8VA 2KC2A 1C1YB 4W9EA 3FSSA 1H8CA 3IFWB 3X23A 2KJRA 2LGYA 1V9JA 2KMAA 3ODWA 1KZGA 4ANVA 4F7ZA 2KVRA 3T06A 2JRIB 3ZIMA 5JLJB 4JL9A 1GJZA 3DBLI 2MFQA 2M8SA 3ENEA 2A4ZA 2WWZA 3RCZA 4Z2MB 1UH6A 4D0NB 1UGMA 3OLMD 2ZEQA 1V5MA 1WIAA 3KRXA 3UQAA 3U8ZA 3VUYA 4JGHB 4HXDA 1FXTB 1WFYA 4KIKB 2KTRA 5LXHA 1RAXA 2D9YA 2EKEC 2KZRA 1V61A 5DHAB 1ZC3B 4BKGA 2C9WB 1ISNA 2GBRA 1RFAA 2IFSA 2D9ZA 2DN6A 5LONB 1IPGA 3PLUA 2K2UA 4FBJB 4MEMA 1EAZA 4ANXA 2JY6A 3DDCB 3HQCA 4WJ7A 2HRJA 1YX5B 1LB1A 4MK0A 2Y8FA 4HB4B 2ROVA 2D11A 2HTHA 5D7GA 3QIJA 4WQOB 3A8PA 4W9CA 2DYOA 3R3MA 4HK2A 4W9DA 1I42A 3AXCA 3WA0A 2COAA 4K2OA 3TVVA 1MIZB 5J2RA 5D3WA 2YLMA 3H7PB 4BVUC 1UZXB 2FIFA 1XQQA 4A6FB 2KJHB 4GU2A 2M14A 2JT4B 5GOWB 4KZ0A 4HAUB 1HE8A 3T8MA 2MX2A 2LI5A 3KH0A 1KM7A 4DDGD 3WAMA 1KOTA 1UBQA 2OQBA 3WYFB 3DVGX 1P6SA 2OTXA 3APFA 2KANA 2CY5A 4P7IA 3H7PA 3ZW3A 3JSVA 3PREA 3ULBA 2BYFA 2CODA 1LFDA 1NTIA 1I7AA 2NBUA 1Y8RC 3GZNI 5IA7A 2BCJA 3U7DA 2LUEA 2RNRB 4PYUA 1NDDA 4ICUA 2KLGA 4MGYE 4ZYNA 3M63B 1DROA 2KLCA 4MGIE 2N0YA 2KDEB 4K17A 2BWFA 1R4NI 4X57B 4GB9A 4HATB 3QK0A 2DFKA 2O6VA 3A9KA 4FJZA 1IYFA 1U29A 4W9GA 2L7RA 4KHOA 2L8JA 2Z0PA 3QARA 1WR1A 3SU8X 3L17A 2Q13A 2KK8A 4DWFA 3VTVA 5CHFA 2ZNVB 2MA9B 3A1QA 4BOZB 2H7EA 3M95A 1TZ1A 3NY5A 2GBNA 4HCPB 3QAQA 2FNJB 2G35A 2RSGA 4ASWC 3RCPA 3VUXA 2ELAA 2DHJA 5LXIB 4XWXA 2COPA 4A3OA 2C5LC 2GJYA 5L81A 4WWNA 4FULA 2V1YA 2UVMA 1WGRA 3ZKJC 2BWES 3UZTA 3IHPC 2KWUB 2MW5A 3PT2B 1IRSA 4EZKA 4B9KA 1P3QU 4BOSC 2NZ8B 4RM9A 3NHEB 2KC1A 4M0WB 3K9OB 3ML4A 1K5GB 4ANUA 2QKMA 3VOQA 3ZNHB 2K00A 2KO3A 4H8SA 3PVLA 1XD4A 1IP9A 1ZC4B 1ZVRA 5CHWA 3QCAA 3QJZA 2DTCA 1L2NA 4FJYA 2DYBA 1M94A 4HAVB 4Z2NA 4MT7A 2DX1A 3IG3A 2KFKB 2KTFA 2ADZA 4F7HA 2K2JA 1Q0WB 3APCA 3W1SC 4N9F4 1ACAA 4HJKA 5D3XA 2DX5A 1V5UA 2FAZA 4BFRA 2BKFA 2IO1B 3PGEA 2YT1A 4EUTA 4IWPA 2MWSB 1FAOA 2LGDA 4JIOU 3TCAA 4I6PA 3DVNV 3PS6A 4GDKB 1WJ1A 4BKTA 2RGNB 1GC7A 3KY9A 2BPSA 2MSED 3RT3B 4I6LB 2JVCA 3L10B 4BBNF 1WGGA 1DDVA 3JW0X 2RVBB 3AJ4A 2DLWA 4GXBA 4MH0E 3WANA 2LVPA 4MSQB 4CYEA 3L13A 2WX1A 2NPTB 2YRYA 2ZVOA 1U4AA 1E7UA 2VSZA 1LQBA 4IOYX 3PVUA 1GC6A 2XQNM 1ZGUB 2Y8GA 2LXAA 4TYZA 5L83A 4NNJB 4KV2A 2L05A 2OJRA 3UIOB 3V62A 2KD0A 1NVLA 4G3XB 2M17A 3DXEA 2PE9A 3SUZA 3L54A 4DDID 2NPTA 3SV1A 2LVQA 5AEKB 3VXWA 4PS7A 2O6VD 1V49A 2RSUA 2IZVB 4NSWA 4CHJA 2O2VB 1NU2A 3BINA 2MBBB 3I3TB 1WE6A 4FADA 2VKIA 1UPRA 5L95C 5HKHA 4RM8A 2Z0QA 4AWJA 3CSTA 1BWNA 1AWEA 2REXA 2Y5BB 2L3ZA 5JHHA 1YD8U 1WI0A 2KKCA 1GNUA 2UZSA 1KJTA 3KUDB 5D2MB 3LJ3A 3MPXA 3VIAA 2O2VA 2KWCA 4AJYB 2E2XA 1WZ0A 2QHOA 1U5DA 2W2XC 2NR2A 1MIXA 3SD5A 2FCMA 3RD2A 2LD9A 1X1MA 1P9DU 2N1VA 2NS5A 3EECA 2DAFA 2MDXA 1V5PA 4K7UA 3PVWA 4RMAA 2B3AA 4WJQA 5DIFB 2DZMA 4LJPB 4II2B 3ODOA 4EJNA 3X0WA 1UPQA 1XCGA 1F9JA 3LDZE 4JQWC 2M38A 3D8EA 3W1SA 4NAWB 3VUWA 3V6EB 2XK5A 2WYQA 3PP2A 2KTRB 2CU1A 2IO2B 1WI1A 3AI5A 1V5OA 4GMVA 5KHQA 3ULCA 4TQ0A 2D9XA 1FHWA 3QWZB 4EMOA 4PQ0A 2KFJA 2COFA 3GYPA 1TXDA 3QA8A 2AEHA 5DH9B 3A33B 4FHKA 3JVZX 3GOEA 2KXJA 1HB6A 4DX8A 2UWQA 1P3RA 2J59M 3DBSA 4K7WA 4DK5A 4NAWA 4DHJD 1R4MI 3UINB 1UNQA 1ZKHA 2LOXA 2BGFA 2QKLA 2HTHB 3AU5A 3H6NA 2KUPA 4TQ1A 4A3PA 2JPHA 3DPDA 3ZNZB 3EC8A 2OOBB 2LRUA 3WALA 2CB8A 4HDQA 2N23A 1OQYA 2LGXA 1BAKA 4MDKE 4KDLB 4OVUA 2ELBA 2DYQA 1J19A 2DHIA 3DCGA 2YT0A 3DXDA 4AJWA 1Z87A 1PFJA 3VQIA 2Z0OA 3OANA 2ZCCA 1V86A 3SYXA 5E6PA 2MBQA 1UEFA 1WJUA 2V4LA 1BTNA 2CRFA 1MK7B 3KVFB 1S1QB 1WY8A 2ZPNA 3JSVB 4G50A 1UBIA 3PEGA 2ZJDA 2RD0A 1WXVA 1ZSQA 1EGXA 2KMCA 2DZKA 5FI0A 1DYNA 2I5FA 4DX90 5DCNA 4A5KA 4IC7B 2IYBA 3ZLZA 2K1FA 1WGUA 2CHZA 2IBIB 4E3CA 1J8CA 2LXCA 3TFMA 2L0TA 3DVGY 2O6VB 3A9KB 2I5CA 4YL8A 2JF5A 5DPSA 1QQGA 4KDIC 1Q5WB 2KWVB 1OMWA 5J3TA 4TUUA 3B1LX 2AL3A 2N4FA 1KLVA 2GS0A 2FCSA 1XD3B 1LXDA 5DPRA 3A1QB 2GMIC 1WGHA 2PZ1A 1HB8A 5JZEB 2M4NA 2P0HA 1DDWA 1X86A 3M3JA 3VVWB 1UNRA 3KUCB 4EZLA 2MBEA 2JWZA 2J0KA 3CSFA 3ZTCA 4IWOA 2DYNA 4MELA 1OGWA 4EEWA 3EPYA 4URKA 2AL6A 3QWMA 2JUOA 4EFOA 1YIWA 4MGKE 5KQ4A 1E8XA 1XR0B 3L08A 1Z2MA 1AQCA 4C0AA 1WXAA 4CO7A 2J0MA 1N3HA 5KQ1A 3TMPB 4W9KA 4NQKE 4XX5A 2DYMA 3OJ4B 3PHXB 2PJHA 2LULA 1K5DB 4AUQC 3V5WA 1ZW7A 3A9JA 3PHWB 3FLVA 2GCJA 2N7EA 5J3QA 1HBKA 1TGZB 1SIFA 2ZZPB 3KW5B 1WZ3A 1P98A 2YF0A 2XBBC 4FN2A 4II3B 1E90A 3D32A 4WAAA 2PEAA 4DHZE 4PS8A 1WG7A 3F5RA 3KZ1A 1PQSA 2G4SA 4AP4C 1XODA 3DVNU 3MTNB 4NQLB 1RRBA 4TV3A 1WXMA 3TL5A 2EJ8A 1U5GA 1WGYA 3VH3B 4DHJB 3CMMB 2CS4A 3QC8B 2IO0B 1EUVB 3N30A 4W9HA 1OEYJ 1MK9B 2DX5B 2IY0B 2C7NB 3HHMA 2JZ3B 2CHXA 2L2IA 1MG8A 1NBFC 4HWIB 2DHKA 2JZZA 4MJSA 2NVUI 4BBKA 4LJOB 4DBBA 2CKHB 2GBMA 4NJ7A 3B08A 3S2AA 2WH5A 2NBWB 2PPHA 4EKUA 1E8WA 1WYWB 4KAXB 3DBRI 1BT0A 3PPAA 2D9VA 5KHOA 1J0WA 4MY6A 1VCBA 2D9WA 1UELA 2KQ7A 3ZRFA 1ST7A 2KDIA 3ZO5B 4ICVA 5D3VA 1OTRB 1G6JA 3IVFA 1V89A 1LM8B 1P0RA 4HCNB 1TQZA 1WJ6A 2N7DA 2N9PC 1KZ7A 5FR6A 5J17A 1OY2A 1KI1B 2LOZA 3OAWA 4M8NA 5AZGA 4KSLC 4Y94A 1U5FA 5D6JB 3UIPB 5C1ZA 1Q1OA 5BO4B 2H7DA 2AWTA 3PRMB 2R2QA 3PRPB 1A5RA 2RQ1A 1WVHA 4LDTD 4ZDVA 4MGZE 2J7QB 2DAJA 1WJNA 4ZRKA 4WWPA 5D3YA 4M8MA 2P0FA 3LJUX 4NJ6A 5JHBA 4G0NB 4E71A 4PNKA 1Q67A 5HE1A 2R09A 3ZVRA 5JHAA 3RUIB 2BYEA 3T9LA 2DHZA 3HM3A 3NZUA 2LZ6A 2JP2A 1WRDB 3RZFA 2G4DB 1V81A 3HIZA 2YSZA 2W2XD 2V3SA 3DXCA 5D94A 2K25A 4A6KA 2C7HA 2G45B 2MCNB 2XEWA 1WM3A 3ALBA 2VRWB 3VAWA 3L0WB 3FP5A 3DBHI 3PG7A 2R2OA 4K1RB 1WJ4A 3WIMA 3D8FA 5JH5C 3KYCD 3H7SA 5G55A 1WGQA 4OVVA 2MBOA 1RJ2A 1NI2A 2I1JA 3AU4A 4W9IA 1EVHA 1S3SG 2YS5A 2EC1A 4FA6A 3ZNGC 2DZJA 3N7CA 2FJLA 3PSEB 4IFSA 3QHTA 2ZPYA 3DQVA 1V80A 1GG3A 2NBVB 3PV1A 3TJPA 1DBHA 4E74A 2XK5B 2FJ9A 4IM0A 4ANWA 3ZNID 1OEYA 4WWOA 4BKSD 2CY4A 5CLQB 2DKPA 1WX8A 4EZJA 3WAPA 1ZM0A 2LASA 3FM8C 4F8CB 2KHWB 1T0YA 3TIXA 1YX6B 1AARA 3A4SC 3W1YA 3N32A 2LVOA 1TTNA 3V6CB 3CXBB 4F7UP 2M1MA 3ZRCA 4BBNC 4CHKA 2YS1A 2JRHA 5LLIA 4ZRJA 1WX7A 3CIKA 2YS3A 3PSCA 4KSKC 4HB3B 2ZVNA 2N9XA 5JHGA 2K8BA 1LW3A 3AULA 3RYTA 2ABDA 1MAIA 3SO6A 3PRZA 2KX3A 2A5UA 1FB8A 1W1DA 1NTVA 5JP4A 1WF9A 3A4RA 1XT9B 4KZCA 2RPQA 1RRPB 1P1AA 3QBVB 2DA0A 2MBHA 2KDFB 2LKOA 5D27A 3QQ8B 2Y7BA 2L1CA 4XC2A 3ML9A 4B6HA 2IYDB 2RLOA 4GOCA 2L0FA 4MM3A 4B6WA 2D3GA 2GBKA 3VH4B 1FGYA 4W9LA 2ZNVC 1WXSA 1E8YA 3EHVA 2D07B 1EF1A 3BY4B 5C79A 2K6DB 1W1GA 2AYOB 3TO1A 2GOWA 4KVGB 2ASQA 1WH3A 2LYDA 2P0DA 1J0GA 4LDTB 2KQSA 3R7RA 3ZTDA 1V6EA 4YONA 1VD2A 4PS3A 4XZ4A 1V88A 4WVFB 3RULA 3UGBB 4GDLB 4KIKA 3MHSD 5TR5A 1D3ZA 3M1IB 4K81A 2UZRA 3P6AA 2DENB 2WX0A 5IJMA 3ZDMC 3NOBA 2KX0A 2LBBA 5EDSA 4HB2B 3TBLD 3VTWA 2W9NA 2KOXA 1E7VA 1U5EA 2G3QB 5HE2A 5C16A 3K9PB 4GDLA 2D4QA 3APDA 2C60A 2CAYA 2LG1A 2Z0DB 1WX9A 2JXXA 4HAXB 4A6HA 2DKQA 1OQNA 3MJWA 4J6IA 2WDTB 4F1SA 2LWPA 4PYZA 4A6FA 1U27A 2Z59B 3R66C 1EO6A 3GYOA 2MKRA 3H9DA 4ZRIA 2FCNA 1BTKA 3HM6X 4HAWB 3PLVA 1M7EA 1Y19B 2I1KA 3WAOA 3F0WA 4W9FA 2VRRB 5E6NA 2R0DA 1L7YA 4F7GA 1WM2A 5LOPB 3A9JB 4IM2A 2MQJA 1C3TA 1NTYA 3KYDD 2V76A 3HK0A 4FJVB 3G9WA 4CHMA 3SNHA 1E5WA 4HPLB 2KJ6A 4K7SA 1MKEA 2FDQA 1WR6E 2CQUA 3NS8A 3ONSA 3QX1A 4DBGA 4BKSA 2CHWA 3FEHA 3D8DA 1B55A 5HE0A 1RLFA 4MJSB 2CR5A 4IAPA 1TJ6A 2RGFA 2L00B 5AZHA 3R7QA 4MSMB 4GMXB 4HHVA 4A20A 3CF6E 3O65B 2EMSA 1YJ1A 4GSWA 4IG7B 5J18A 2COCA 5G2NA 2PE6B 3MDBC 3NSUA 2BKRB 4TKNA 2NMBA 1X05A 2MWNB 2FIDA 1H4RA 5AZFA 1V5TA 3VTUA 1WJMA 2HD5B 5CHVC 1SE9A 4FLHA 2HJ8A 4KHBB 1U2BA 2DZIA 3V61A 3UQBA 4HB0B 2UYZB 4FHJA 2RR9A 2ZCBA 1GUAB 3OJ3A 1K8RB 3O96A 2N9EB 1PLSA 4LCDE 2IO3B 4JLCA 5CLLB 2HE7A 1WE7A 3M62B 5DI9B 4K2PA 4WJOA 4KHAA 4W9JA 4GPTB 2LRWA 1EF5A 1FOEA 1W1HA 4GZUA 3C0RB 1PMSA 4HDOA 3BJIA 5J3YA 4HVBA 3Q3FA 1M7RA 2ROZB 5C5BB 3ZDTA 2BYVE 3ODXA 2KCJA 4WJNA 2Z0EB 1QZEA 5HE3A 1XKEA 2KFKA 3DOWA 1X1FA 2D2QA 1JRUA 1FHOA 2GBJA 3ECIA 4GGQA 3ZUNA 1DDMA 3KSYA 2KGXB 2MP2B 3VDZA 1I35A 1Z5SB 1QC6A 4G11A 1X1GA 1MPHA 5IAAC 5C5BA 3UF8A 1Y5OA 4HAZB 4I6NB 2BF8B 4GN1A 4NPNA 1SGHA 3H1UA 1P5TA 3IBEA 4DHZB 4GDKA 3TW1A 4IUMB 5GMVA 5CTRC 3HW2B 3PTFC 3Q3JA 2X18A 2KN5A 4L6EA 4HLEA 3JYUA 3KRWA 2MP2A 1YQBA 3U30A 3VHTC 4NY0A 4IM3A 3NZSA 5CX3A 2FUHB
chains in the Genus database with same CATH superfamily
2K8HA 1H10A 1TY0A 2W2WA 5EFXA 2IY1B 3SEBA 3U12A 2K39A 3L16A 3Q8CA 1R7SA 2RUKB 1JMLA 2GCLA 3AEFB 2L76A 2NCNA 4GIVA 2XN9C 1WGDA 3P7ZA 3NW8A 3GS2A 1CMXB 1V2YA 4HPMB 1VZ8A 4EOYA 3DHHC 2W54A 4WJPA 2V4IB 5DPTA 1FGZA 3PZDA 2N1WA 4RF0A 1FHXA 4B95A 2D10A 3DHIC 3B0AA 1YQ4B 3N3KB 4JWSC 1N60A 4IWQA 5D3IB 4BZAA 3KUZA 2FCQA 2K6QA 2DNFA 1I4QA 1TBEA 2MLBA 5BYRA 5FI1A 3P1MA 5C23A 3A8QA 1I4RA 1ZE3D 5KCVA 1VZ7A 3SDLC 3AE9B 5DHFB 4L1BA 1UD7A 1JRPA 1WMHB 1C79A 2EMTA 1ZDXA 3RZWC 5E6OA 1JCKB 3EFUA 2LJ5A 4JKHA 1N5XA 1I2HA 2KDBA 3A98B 1YN3A 1XX0A 2DLBA 4K3CA 1CZPA 1D5ZC 2C7MB 1X11A 2MRPA 5C6RA 1VDVA 2YVCA 3SHQA 1RWSA 2BBCA 1SHCA 2R2YA 1E8ZA 2KNBA 3ML8A 3HVZA 3VFKA 3NVWA 3W9CB 4HAYB 2M0XA 4ACFA 2J0JA 3V60A 1UNPA 2WP9B 2OHFA 3ZVVA 2K8CA 4DXAB 2JQRB 1WMHA 5DPWA 4AOFA 3P2BA 4LNIA 4IW0A 4WSFA 2Z14A 1VJKA 3DHGC 2P8VA 2KC2A 1C1YB 1E7PB 5EE1A 4W9EA 1OQQA 3FSSA 1H8CA 3IFWB 3X23A 3OG5A 2KJRA 3C19A 1FD6A 2LGYA 3RN9C 1V9JA 2KMAA 1TT5B 4MM3B 3ODWA 3DBLB 2ACZB 1UNSA 3RNAC 1KZGA 4N6EB 1KC7A 4ANVA 1MI0A 4F7ZA 2KVRA 3PO0A 3T06A 2G9HD 2JRIB 2SAKA 3ZIMA 5JLJB 4JL9A 1GJZA 3DBLI 4JK8A 1TZOA 2MFQA 2ICIA 5JVLA 2M8SA 1EU4A 3IXSA 3WCQA 3UI3A 3ENEA 2A4ZA 2WWZA 3RCZA 1T77A 1UGJA 3DWMA 3MC0B 4Z2MB 1ZP0B 1UH6A 4D0NB 1UGMA 2GRIA 3OLMD 2ZEQA 1V5MA 2PLPA 2WXRA 1WIAA 4WQMA 3KRXA 3UQAA 3U8ZA 3VUYA 3AE7B 4JGHB 4HXDA 4DQOC 1FXTB 1JQ4A 4XDDA 1WFYA 2JXTA 2INCC 4USAA 3AE2B 4KIKB 5IOIA 2KTRA 5LXHA 3CIRB 1RAXA 2D9YA 2MJDA 5HHDG 2EKEC 2KZRA 1V61A 5DHAB 1ZC3B 4BKGA 2C9WB 1ISNA 2GBRA 1RFAA 2IFSA 2D9ZA 2DN6A 5LONB 4US8A 1IPGA 2WHIA 3AMZA 1KBLA 1NI3A 3PLUA 4REZA 2K2UA 4RGNA 4FBJB 1TS3A 1M4VA 4C7YA 4ZYSA 1TY2A 4MEMA 1EAZA 4ANXA 2JY6A 1F77A 3W5UB 3DDCB 3HQCA 4WJ7A 2HRJA 4B0EA 1YX5B 1LB1A 4MK0A 2Y8FA 4HB4B 2ROVA 2D11A 2HTHA 5D7GA 3QIJA 2BW2A 1L4DB 4WQOB 3A8PA 4W9CA 3RNEC 2DYOA 3R3MA 1TIFA 2E3TA 4HK2A 2GLSA 4W9DA 1I42A 3AXCA 3WA0A 2COAA 4K2OA 3TVVA 1MIZB 1D5XC 1QT9A 5J2RA 5D3WA 1MJDA 2YLMA 3H7PB 4BVUC 1HA5A 1UZXB 2FIFA 1XQQA 3FAHA 1V1PA 4A6FB 1LO5D 2BVCA 2KJHB 4GU2A 2M14A 2JT4B 5GOWB 4KZ0A 1J7BA 2XNAC 4JKGB 4PT5A 4HAUB 1HE8A 3T8MA 2KQ4X 2MX2A 2LI5A 3KH0A 3EUB2 1KM7A 4DDGD 5JXVA 3WAMA 1KOTA 1UBQA 3E9OA 2OQBA 3WYFB 3DVGX 1P6SA 3NVVA 2OTXA 3GZNB 3APFA 4C80A 2KANA 3ABVB 2KWDA 3Q8FA 4HEA1 4HROA 2CY5A 4P7IA 3H7PA 2WXFA 3ZW3A 1WRIA 3JSVA 3PZ7A 3N1YC 2J42A 3PREA 2KT7A 3NJTA 1SB3C 3ULBA 2BYFA 2CODA 1LFDA 2JU6X 1NTIA 1I7AA 1Q10A 1Y8RC 2NBUA 3GZNI 2IJ0A 5IA7A 3BWUD 2BCJA 1N62A 1C4CA 3U7DA 4JKGA 2LUEA 2RNRB 2JWUA 1R4NB 2TSSA 1IGCA 2ONQA 3RI7C 4PYUA 2FJUB 1NDDA 3L4PA 4ICUA 3T3NA 1T6BX 2KLGA 4AQ7A 4MGYE 4ZYNA 3M63B 1DROA 2KLCA 4MGIE 2N0YA 5I4DA 2KDEB 4K17A 4KGTA 2BWFA 3FKYA 4OVZA 1R4NI 4X57B 4GB9A 4HATB 3QK0A 2DFKA 2O6VA 3A9KA 1QOGA 4FJZA 1IYFA 1U29A 1I4HA 2GI9A 1XCTL 3BZDB 4W9GA 1PDXA 2L7RA 4KHOA 1F0ZA 2L8JA 2Z0PA 3B77A 3QARA 4XWTA 1WR1A 1L6UA 2INPE 3SU8X 2KDMA 2MEKA 2EKIA 3L17A 1UUPA 2Q13A 2KK8A 4UDUC 4DWFA 3VTVA 1L0VB 5CHFA 2ZNVB 2M0AA 2MA9B 3A1QA 4BOZB 2RDHA 2BYTA 2H7EA 3M95A 1TZ1A 3NY5A 2GBNA 4HCPB 3QAQA 2FNJB 2G35A 3B2GA 3R2IA 3R2TA 3AE8B 2RSGA 2N9KA 4ASWC 3RCPA 3VUXA 4AS1A 2ELAA 2DHJA 2HTME 2FUG1 5LXIB 4XWXA 2N9LA 2COPA 4A3OA 2UU7A 2C5LC 2GJYA 5L81A 4WWNA 3ZYYX 4FULA 4YSZB 4RNAA 2KACA 2V1YA 2UVMA 1WGRA 3ZKJC 1N63A 4M01A 2BWES 1N61A 2MJ3A 3UZTA 2VZKD 1MVKA 2KWUB 2MW5A 3IHPC 3PT2B 3DWGC 1IRSA 3LB8C 2LUMA 1JWBD 4EZKA 4B9KA 3AN1A 1P3QU 4RF1A 1SSNA 4BOSC 4ZHOA 4YXDB 2NZ8B 1TJEA 4RM9A 3NHEB 2JYTA 2KC1A 4M0WB 3K9OB 3ML4A 1K5GB 4ANUA 4JKAA 2QKMA 1KLUD 1V1OA 3VOQA 1MHHE 1SBBB 3ZNHB 1KH0A 2K00A 2KO3A 1SJHD 3VRAB 4GOUA 1D5MC 4H8SA 3PVLA 1XD4A 5T8IA 1P7EA 1IP9A 1ZC4B 1ZVRA 5CHWA 2RRFA 3QCAA 2WU2B 3QJZA 2DTCA 1L2NA 4FJYA 2DYBA 1M94A 4HAVB 4Z2NA 4MT7A 2DX1A 1EM7A 3IG3A 2KFKB 2KTFA 2ADZA 4F7HA 2RDBC 2K2JA 2YEPF 1Q0WB 4RH6A 1DIKA 3APCA 4M0WA 3RNGC 3W1SC 4N9F4 1ACAA 4HJKA 5D3XA 2DX5A 1V5UA 2FAZA 4BFRA 2BKFA 3N9YC 2IO1B 3PGEA 3DCXA 2YT1A 4EUTA 4IWPA 2MWSB 1FAOA 2LGDA 2Z4DA 2FE8A 4JIOU 3IT4B 2W3SA 1FCLA 3TCAA 4I6PA 5G5GA 4D2KA 3E9LA 2CJOA 3DVNV 3PS6A 4GDKB 1WJ1A 4P1BC 2W82A 3V3XA 1C4PA 4BKTA 2RGNB 1OQRA 1GC7A 3KY9A 3NUHB 2BPSA 2MSED 3RT3B 4I6LB 1F1HA 1RYJA 2JVCA 3L10B 4BBNF 1WGGA 5HI1A 1DDVA 3JW0X 1HTOA 4KKJA 1B1ZA 2RVBB 3AJ4A 2DLWA 4GXBA 3TEWA 1VLBA 2BS2B 4MH0E 1L0YB 1GGOA 3C8YA 4IOIE 4KX6B 5AUKA 2YT2A 5H92C 4XE0A 3WANA 4H2AA 4IDIA 2LVPA 3LYYA 1N5WA 1GB1A 2HDEA 4LNFA 2D3AA 4MSQB 4CYEA 3L13A 5IRSA 2WX1A 2W55A 2NPTB 2YRYA 2ZVOA 1L0XB 1U4AA 1E7UA 2VSZA 1LQBA 4IOYX 3PVUA 1GC6A 2XQNM 1VZ6A 1ZGUB 2Y8GA 4NJCA 2LXAA 4TYZA 1SE4A 5L83A 4NNJB 4KV2A 2L05A 2OJRA 3UIOB 2OEDA 2AX5A 1TS2A 3V62A 2KD0A 1XO3A 1NVLA 2VH1A 1HQRD 4G3XB 2M17A 3DXEA 2PE9A 3SUZA 1BMLC 1KRHA 3L54A 2X0SA 4DDID 2IGHA 1HZ5A 2NPTA 4LK0M 3ZXRA 2WS3B 3H8HA 3SV1A 2LVQA 3RNFC 3SFDB 2QILA 5AEKB 3VXWA 3RFZB 1FIQA 4JX1C 5I2SA 4PS7A 2O6VD 3Q3MC 1V49A 2RSUA 2X8XX 2IZVB 4NSWA 2V9HA 1C9FA 5TSSA 4CHJA 2O2VB 1NU2A 3BINA 4RGMA 2MBBB 1QF6A 3GB1A 4J3OD 3I3TB 1WE6A 1F2RC 4FADA 2WDVB 2VKIA 1NVID 1UPRA 1T3QA 1DOXA 5L95C 1FPYA 5HKHA 4RM8A 3W2DA 2Z0QA 4AWJA 3CSTA 4IKGA 4XGAB 1BWNA 1AWEA 1ENFA 5HFYA 2REXA 3NVYA 1OFFA 4EE2A 2Y5BB 2L3ZA 2KIEA 4JKCA 5JHHA 3OHMB 1YD8U 2KIGA 1WI0A 2KKCA 1GNUA 2UZSA 3Q69A 5BYQA 3Q14C 2IGGA 2M19A 1KJTA 4ZRQA 3KUDB 3AE5B 4MACA 1YJIA 3HVDA 5D2MB 2EELA 4HKZE 2IGDA 3LJ3A 3MPXA 2WXLA 3VIAA 2O2VA 2VZKB 2KWCA 4AJYB 2E2XA 1WZ0A 4LNNA 2QHOA 1U5DA 1F52A 2W2XC 2NR2A 1AWDA 1MIXA 3SD5A 2FCMA 3RD2A 1FFVA 2LD9A 1FNUA 1X1MA 1NENB 1P9DU 2N1VA 2NS5A 3EECA 4DIXA 1T0QC 2DAFA 2MDXA 2BB6A 1V5PA 2MH7A 4K7UA 2J4XA 3PVWA 4RMAA 2B3AA 4WJQA 1CK1A 5DIFB 2DZMA 4LJPB 4II2B 3P4RB 3ODOA 1YN5A 4P6VF 4EJNA 3X0WA 1UPQA 1XCGA 2WXMA 1F9JA 2WXHA 3LDZE 2M38A 3D8EA 4JQWC 3W1SA 4NAWB 2V0GA 3VUWA 3AE6B 3V6EB 2K8EA 2XK5A 3A58A 2WYQA 1DOIA 3PP2A 4QJ5B 2KTRB 2H88B 2CU1A 3P42A 2ZW1A 1PGAA 2IO2B 1WI1A 1JWUD 3NWFA 1ZDVA 3AI5A 1V5OA 4GMVA 5KHQA 3ULCA 4TQ0A 2D9XA 1FHWA 2WXIA 2N7JA 4EMOA 4PQ0A 3QWZB 4ITKA 2KFJA 2COFA 2QDFA 3AE3B 3GYPA 1R4MB 1TXDA 3QA8A 2AEHA 2Y5PA 5DH9B 1GB4A 3A33B 4FHKA 3JVZX 1EU3A 3GOEA 2KXJA 1HB6A 1JWSD 4DX8A 2VH2A 2UWQA 1P3RA 1NYRA 2QIEB 3ETRA 2J59M 1QOAA 3DBSA 4CQNA 4K7WA 4DK5A 4NAWA 4DHJD 2FBWB 4RFBA 1I7HA 4GNKB 2WDQB 1R4MI 3UINB 1AYFA 1UNQA 1ZKHA 2LOXA 1K52A 2BGFA 2DIKA 1ZXHA 3GE8C 2QKLA 2HTHB 2PIAA 4RGTA 1QOFA 3AU5A 3H6NA 1UF0A 2KUPA 4TQ1A 3U2SC 2JPHA 3DPDA 4A3PA 2R82A 3ZNZB 2QEJC 1FFUA 3EC8A 2OOBB 4KGSA 2LRUA 3WALA 2CB8A 4HDQA 2N23A 1OQYA 2LGXA 4YSYB 1BAKA 4JK9A 3ZQ4A 4MDKE 2LJIA 1K53A 4KDLB 4OVUA 2ELBA 2DYQA 1V1PB 3IAS1 1CJEA 1J19A 2AQ2B 3TEXA 1STEA 2DHIA 3DCGA 4N59A 4ZHPA 2D3BA 2YT0A 3DXDA 4AJWA 1Z87A 1PFJA 3VQIA 2Z0OA 3OANA 1BXTA 2ZCCA 1V86A 3SYXA 3N1ZC 5E6PA 2MBQA 1UEFA 2QJLA 2L52A 2GUMA 1WJUA 2V4LA 1BTNA 2CRFA 1MK7B 5FR3A 2KMMA 4XWWA 1QILA 3KVFB 3HRDD 1S1QB 1WY8A 4WH4A 3BVMA 2ZPNA 3JSVB 4G50A 1UBIA 3PEGA 4QJ4B 2ZJDA 1F2RI 1GAQB 2RD0A 1WXVA 1ZSQA 1EGXA 1EWCA 2Y5CA 2KMCA 2LHDA 2DZKA 2WXOA 5FI0A 1DYNA 2I5FA 4DX90 3Q8AA 5DCNA 4C00A 4A5KA 2ZKMX 4LNKA 4IC7B 2IYBA 3ZLZA 2K1FA 1WGUA 1XLPA 3URYA 3SFEB 2X38A 2CHZA 2IBIB 4E3CA 2Y3AA 3SBTA 4N58A 5D3DA 1J8CA 1JROA 2LXCA 3TFMA 2L0TA 3CWIA 2NTSA 2WXNA 3DVGY 2LEKA 4JKBA 2O6VB 3A9KB 2I5CA 3MC9A 4YL8A 2JF5A 5DPSA 1QQGA 2WNMA 4KDIC 1Q5WB 5C3JB 2KWVB 1OMWA 5J3TA 1ZXIA 4TUUA 3B1LX 2AL3A 2N4FA 1KLVA 2GS0A 2FCSA 1XD3B 3AEDB 1LXDA 5DPRA 3A1QB 3KLSX 2GMIC 3ZXVA 1WGHA 2WGSA 2PZ1A 1HB8A 5JZEB 2M4NA 2P0HA 1DDWA 1X86A 3M3JA 3VVWB 1D6EC 1XLNA 1UNRA 2WXQA 3KUCB 4YWGG 4EZLA 4WIPA 2MBEA 4ARIA 2QCZA 2JWZA 2J0KA 4YTMB 3CSFA 3ZTCA 4IWOA 2DYNA 1JW9D 1OGWA 2M56B 4MELA 4EEWA 4WAFA 3EPYA 1XF5L 4URKA 2AL6A 3QWMA 1SF0A 3MHZA 5LNK1 4JPSA 4WURA 2JUOA 1KFYB 3NWDA 4QAYA 4EFOA 1YIWA 2D5GA 1ESFA 1YJJA 4OZBA 4MGKE 5KQ4A 2Z8LA 3EFCA 1TYGB 4YTPB 1E8XA 2LMCA 1XR0B 3L08A 1WGKA 1Z2MA 1AQCA 4C0AA 3E9PA 1XXGA 1WXAA 2DWQA 4CO7A 1VBHA 3E9SA 2J0MA 3IAM1 1N3HA 5KQ1A 3TMPB 2JZPA 3LXFA 3V05A 4W9KA 4NQKE 3TEZA 4XX5A 3HSAA 2KN4A 2DYMA 3OJ4B 3PHXB 1ZUD2 2PJHA 4OZCA 3SBGA 2NTTA 1DOYA 2LULA 1K5DB 4AUQC 3J9CA 3V5WA 3Q8EA 1ZW7A 3A9JA 3KQ4A 3PHWB 3FLVA 2GCJA 3NG0A 2N7EA 5J3QA 1HBKA 1TGZB 1SIFA 3ZJUA 2ZZPB 3KW5B 1PYWD 2BT6A 1WZ3A 1P98A 2YF0A 3Q8BA 4ILJA 2XBBC 4FN2A 4II3B 1PFDA 2WLBA 1E90A 3D32A 3AH7A 2Z13A 4WAAA 2PEAA 4DHZE 3NRZA 2PTLA 4NZLB 4PS8A 4YTNB 1WG7A 3F5RA 3KZ1A 1PQSA 1IBXA 2G4SA 2IPKD 4AP4C 1XODA 4C7ZA 3DVNU 3MTNB 2KR0A 4NQLB 1RRBA 4TV3A 1WXMA 3TL5A 2EJ8A 1U5GA 1WGYA 3AB5A 1FM0D 3VH3B 4DHJB 3CMMB 2CS4A 3QC8B 2IO0B 1EUVB 3N30A 4ZRPA 4W9HA 1OEYJ 1MK9B 4NAMA 3RNCC 2DX5B 2K9XA 4LNOA 2RMMA 2IY0B 1C76A 2C7NB 1ZYIA 2I38A 1L6VA 2JZ3B 3HHMA 2CHXA 2L2IA 1MG8A 1NBFC 4HWIB 2DHKA 2JZZA 4MJSA 2NVUI 4BBKA 1I4PA 4LJOB 4ILHA 4DBBA 2QSDA 4A55A 2CKHB 3DBRB 2GBMA 4NJ7A 3AE4B 3B08A 2NBWB 2WH5A 2PPHA 3S2AA 1E6EB 4EKUA 1E8WA 1WYWB 2KYWA 1VR9A 1YN4A 2BTEA 4KAXB 4ILGB 1YOVB 3DBRI 1BT0A 3PPAA 2D9VA 3AM9A 1UWXA 4XYCA 5KHOA 1J0WA 4MY6A 1QLBB 4C4VA 1VCBA 4L1RA 2D9WA 1UELA 2KQ7A 1JDEA 3ZRFA 2BB5A 1ST7A 2KDIA 3ZO5B 3P4PB 4ICVA 5D3VA 1OTRB 3P63A 3BYTB 2WXGA 1MFWA 1G6JA 3IVFA 2N0SB 1V89A 1XCQL 4M02A 1LM8B 1P0RA 4HCNB 1TQZA 1WJ6A 4KHBA 2N7DA 2N9PC 1KZ7A 3RMKC 1XLQA 2WXJA 2PMVA 5FR6A 2KAJA 1FNWA 5J17A 4JKFA 1OY2A 2CJNA 1KI1B 2LOZA 3OAWA 4M8NA 1HEZE 5AZGA 4KSLC 4Y94A 1U5FA 3I63C 2WQYB 5D6JB 3UIPB 2KUQA 5C1ZA 1Q1OA 5BO4B 2H7DA 2AWTA 2D3CA 3PRMB 2R2QA 3PRPB 1PUTA 4L2YA 1A5RA 1JALA 2RQ1A 1WVHA 4LDTD 4ZDVA 1C77A 4L23A 4MGZE 2J7QB 2DAJA 4WWMA 1IUEA 1WJNA 4FXCA 4ZRKA 4WWPA 1Y56A 1NYQA 5D3YA 1FNVA 4M8MA 2P0FA 3LJUX 3ZGZA 4P1CC 4NJ6A 5JHBA 4G0NB 4E71A 2MJEA 3AEEB 1D4BA 4LTUA 3O13A 1NEKB 4PNKA 3NZ3A 5BMHA 1Q67A 5HE1A 2R09A 3ZVRA 5JHAA 2RDGA 3RUIB 3E66A 2BYEA 5BYSA 3T9LA 2DHZA 3Q6BA 1T0SC 3HM3A 1MHXA 3NZUA 2LZ6A 2JP2A 3BK2A 1WRDB 3RZFA 2G4DB 1V81A 3HIZA 2WXPA 2YSZA 2W2XD 2SEBD 4QJ3B 2V3SA 3OWEB 3DXCA 4C56C 5D94A 2K25A 4A6KA 2BQQA 3DBHB 2C7HA 1DYQA 2G45B 1K51A 2MCNB 2XEWA 1TKEA 1WM3A 3ALBA 2VRWB 3VAWA 4B0MA 4TMAB 3AEGB 3L0WB 2INDC 3FP5A 3DBHI 3PG7A 1C78A 2R2OA 2V3NA 4K1RB 1WJ4A 3WIMA 3D8FA 5JH5C 3KYCD 3H7SA 5G55A 1WGQA 4OVVA 1HXYD 2WU5B 2MBOA 1RJ2A 1NI2A 2I1JA 3AU4A 4W9IA 5HG2A 1EVHA 4BAXA 1S3SG 2YS5A 2NMQA 1J7CA 2EC1A 1PGXA 1ROEA 1T5XD 2H89B 4FA6A 3ZNGC 2DZJA 4A9AA 3N7CA 2FJLA 3PSEB 4IFSA 2ON8A 2ZPYA 3DQVA 3QHTA 1V80A 1GG3A 2INNE 2NBVB 1AN8A 3PV1A 4TSSA 3TJPA 1DBHA 2DBYA 4E74A 2XK5B 2FJ9A 2ZW0A 5EE9A 4IM0A 2Q5WD 4ANWA 3ZNID 4HKQA 1OEYA 4WWOA 5EE3A 4BKSD 2CY4A 5CLQB 2DKPA 1FXIA 3AECB 1WX8A 3MC8A 4EZJA 3WAPA 1ZM0A 2LASA 3FM8C 2HJ1A 4F8CB 1ET6A 2KHWB 1T0YA 3N20C 3TIXA 1YX6B 1AARA 3A4SC 1FCCC 1XEEA 4OW0A 3W1YA 4MH8A 3N32A 3HUIA 2NBVA 1VBGA 1E9MA 2LVOA 1TTNA 3V6CB 3CXBB 4F7UP 2M1MA 5FKAC 3ZRCA 4GLSC 2YS1A 4BBNC 4CHKA 3ZJVA 2OJWA 2WXKA 4P16A 2JRHA 5LLIA 4RGOS 3W5VB 4ZRJA 1WX7A 3CIKA 2YS3A 3PSCA 1E10A 4KSKC 4HB3B 2ZVNA 2N9XA 1SIJA 3E56A 5JHGA 3KWLA 5MPOA 1SJED 2K8BA 1LW3A 3AULA 1HZ6A 1E0ZA 1SEBD 1SE3A 3RYTA 2ABDA 4RCOA 3AEAB 4XDCA 1MAIA 1YNTE 5AUIA 3SO6A 5IN7A 1MPEA 5LG4B 3PRZA 2KX3A 2A5UA 1FB8A 1W1DA 1NTVA 5JP4A 1WF9A 3A4RA 2E6XA 1JWAD 1XT9B 3Q2AC 4KZCA 2B76B 3VR9B 2WDRB 2RPQA 1RRPB 1QKZA 1P1AA 3QBVB 1WXQA 2DA0A 3MJ5A 2MBHA 2QMTA 2KDFB 1SXTA 2LKOA 5D27A 3QQ8B 2Y7BA 2L1CA 4XC2A 2J52A 5BMGA 3ML9A 4B6HA 2IYDB 2RLOA 3BYYB 3MP9A 3N1XC 4GOCA 2L0FA 2G1EA 4MM3A 4B6WA 1K50A 4US9A 3ZJTA 2D3GA 2GBKA 3VH4B 4A90A 1FGYA 4W9LA 2ZNVC 1J7AA 1WXSA 1E8YA 3GP7A 4HSIA 3EHVA 1SE2A 2D07B 1EF1A 3BY4B 5C79A 2K6DB 1W1GA 2AYOB 4JE3B 3TO1A 2GOWA 4KVGB 2ASQA 1YMHE 1WH3A 2LYDA 1I4GA 1BUIC 2P0DA 1B9RA 1J0GA 4LDTB 2KQSA 5M4YB 3R7RA 4JKEA 3ZTDA 1V6EA 4YONA 5I2MA 4HPPA 5BMIA 1VD2A 3IT6B 2K49A 4PS3A 4XZ4A 2KVZA 1V88A 3AV8A 3Q3OC 4WVFB 3RULA 3UGBB 3NVZA 4GDLB 4KGRA 2K3UA 3RPFC 4KIKA 3MHSD 1GOZA 5TR5A 1D3ZA 1TKYA 1T0RC 3M1IB 3HIEA 4K81A 2UZRA 3P6AA 2DENB 4S17A 3EA6A 1FEHA 2YEPB 2WX0A 4R3DA 2IDYA 5IJMA 5E6JA 3ZDMC 4OSNA 1KTKA 3NOBA 2KX0A 2LBBA 5EDSA 4HB2B 3TBLD 3VTWA 2W9NA 1WWTA 3U52E 2KOXA 1V97A 1E7VA 1U5EA 2GB1A 2G3QB 5HE2A 2AQ1B 2J53A 2RPVA 5C16A 5H8YE 4D6WA 3K9PB 3SR6A 2D4QA 3AEBB 3APDA 2C60A 4GDLA 2CAYA 1AW7A 2L32A 3I57A 2LG1A 5FK9C 2Z0DB 4DXGA 1WX9A 2JXXA 4HAXB 4A6HA 2DKQA 3RNBC 1L5PA 1QQRA 1OQNA 3MJWA 2WDTB 4J6IA 1RM6C 5IP4D 1TKGA 4PK1A 4F1SA 2LWPA 4DXFA 1WSPA 2LGIA 4PYZA 4A6FA 1U27A 2Z59B 1ACCA 3NS1A 3R66C 1EO6A 3GYOA 2MKRA 3H9DA 1I4XA 4ZRIA 2FCNA 1BTKA 3HM6X 2L1AA 4HAWB 1L4ZB 3PLVA 1QOBA 1M7EA 2K5PA 1Y19B 2JSVX 3BVZA 1TS5A 2I1KA 3NWAA 3WAOA 3F0WA 4W9FA 1CQVA 2VRRB 5E6NA 2R0DA 1L7YA 3FILB 4JK7A 4K3BA 4YT0B 4F7GA 2BS3B 1WM2A 1FO4A 5LOPB 3A9JB 4IM2A 3TUOA 2MQJA 1C3TA 1NTYA 3KYDD 2V76A 3HK0A 4FJVB 3G9WA 4Q2JA 2Z59A 4CHMA 3EGRA 4OZAA 3TSSA 3SNHA 1E5WA 4HPLB 2KJ6A 4K7SA 1MKEA 2FDQA 2I2YA 1IBXB 1WR6E 3P4SB 1RFKA 2CQUA 3U7ZA 3NS8A 3ONSA 3QX1A 3AE1B 3P4QB 3GE3C 3VR8B 3FILA 4DBGA 4BKSA 4OT1A 1KLGD 2CHWA 3FEHA 1ZOYB 3D8DA 4CSQA 1B55A 5HE0A 1RLFA 5EE0A 4MJSB 2CR5A 4IAPA 3R8BA 1TJ6A 2RGFA 2L00B 5AZHA 3R7QA 2QC8A 4MSMB 4GMXB 1JWMD 4HHVA 4ARCA 2K22A 4A20A 1TS4A 1FRDA 3CF6E 1ZPSA 3O65B 2EMSA 1YJ1A 5G5HA 4GSWA 4IG7B 5J18A 2COCA 3Q3NC 1P7FA 5G2NA 2PKOA 2PE6B 3MDBC 3NSUA 2BKRB 4TKNA 2NMBA 3U4EG 1X05A 2MWNB 4C4VB 2JX5A 2FIDA 3FC4A 1H4RA 1IGDA 5AZFA 1V5TA 3VTUA 4JKDA 4A6QA 1WJMA 2HD5B 5CHVC 4A8XC 4M00A 1N6ZA 4MT5A 1SE9A 4FLHA 3BVGA 2AQ3B 2HJ8A 3BK1A 2K0PA 4KHBB 1MG4A 3PZ8A 1U2BA 2DZIA 3V61A 3UQBA 4HB0B 2UYZB 4FHJA 4JWUC 2RR9A 3TEYA 1V8CA 2ZCBA 1GUAB 3OJ3A 4OHJA 2JYEA 1HTQA 1K8RB 3O96A 2N9EB 1PLSA 4LCDE 2IO3B 4JLCA 5CLLB 2HE7A 1WE7A 4KKIA 1GPXA 3M62B 5GXGB 5DI9B 4K2PA 4WJOA 4KHAA 4W9JA 4GPTB 2LRWA 4LLGM 1EF5A 3I9V1 5IO9A 5C2TB 1FOEA 1W1HA 4GZUA 3C0RB 1PMSA 4HDOA 2LHEA 3MFGA 3BJIA 5J3YA 3KWVA 1ET9A 2L83A 4HVBA 4HJGE 3Q3FA 1M7RA 2ROZB 5C5BB 3ZDTA 2PVGC 2BYVE 3ODXA 1XLOA 2KCJA 1VRAB 4WJNA 2Z0EB 1PGBA 1QZEA 3ENBA 5HE3A 1XKEA 2KFKA 3DOWA 1X1FA 4YSXB 2D2QA 1JRUA 2W3RA 1FHOA 2GBJA 3B9JA 3ECIA 4GGQA 1C4AA 3ZUNA 1KF6B 2MHJA 1DDMA 3KSYA 4HRSA 1FXAA 2KGXB 2MP2B 1A70A 3VDZA 1I35A 4S0RA 1Z5SB 2R61A 3BIID 1QC6A 4G11A 1X1GA 1MPHA 4O1NA 4QXAB 1YQ3B 5IAAC 5C5BA 4ZOHC 2PW9A 5IKCM 3UF8A 1Y5OA 4HAZB 3FVCA 4I6NB 2BF8B 4GN1A 2V3PA 4NPNA 1DGJA 1SGHA 3H1UA 1FMAD 1WYGA 2PVOD 1P5TA 1LGRA 3IBEA 4DHZB 2LGSA 4GDKA 3TW1A 4IUMB 2LFIA 3T3OA 5GMVA 3B2FA 5CTRC 3HW2B 1FRRA 3PTFC 2CU3A 3Q3JA 2X18A 2KN5A 4L6EA 4HLEA 3I5JC 3JYUA 1EWYC 3KRWA 2MP2A 1YQBA 3U30A 3VHTC 4NY0A 4IM3A 3VRBB 3NZSA 2BS4B 1UWMA 5CX3A 1MI1A 2FUHB
chains in the Genus database with same CATH topology
2K8HA 1H10A 2W2WA 5EFXA 2IY1B 2K39A 3L16A 2RUKB 2GCLA 2L76A 2NCNA 4GIVA 1WGDA 3P7ZA 1CMXB 1V2YA 4HPMB 4EOYA 4WJPA 5DPTA 1FGZA 3PZDA 2N1WA 4B95A 1FHXA 2D10A 3B0AA 3N3KB 4IWQA 3KUZA 2FCQA 2K6QA 1TBEA 2MLBA 5FI1A 5C23A 3A8QA 5KCVA 3SDLC 5DHFB 1UD7A 1WMHB 2EMTA 3RZWC 5E6OA 3EFUA 2LJ5A 4JKHA 1I2HA 2KDBA 3A98B 1XX0A 2C7MB 1X11A 2MRPA 5C6RA 2YVCA 3SHQA 1SHCA 1E8ZA 2KNBA 3ML8A 3VFKA 4HAYB 2M0XA 2J0JA 3V60A 1UNPA 3ZVVA 2K8CA 4DXAB 1WMHA 5DPWA 4AOFA 3P2BA 4IW0A 4WSFA 2P8VA 2KC2A 1C1YB 4W9EA 3FSSA 1H8CA 3IFWB 3X23A 2KJRA 2LGYA 1V9JA 2KMAA 3ODWA 1KZGA 1KC7A 4ANVA 4F7ZA 2KVRA 3T06A 2JRIB 3ZIMA 5JLJB 4JL9A 1GJZA 3DBLI 4JK8A 2MFQA 5JVLA 2M8SA 3ENEA 2A4ZA 2WWZA 3RCZA 4Z2MB 1UH6A 4D0NB 1UGMA 3OLMD 2ZEQA 1V5MA 1WIAA 3KRXA 3UQAA 3U8ZA 3VUYA 4JGHB 4HXDA 1FXTB 1WFYA 4KIKB 2KTRA 5LXHA 1RAXA 2D9YA 2EKEC 2KZRA 1V61A 5DHAB 1ZC3B 4BKGA 2C9WB 1ISNA 2GBRA 1RFAA 2IFSA 2D9ZA 2DN6A 5LONB 1IPGA 1KBLA 3PLUA 2K2UA 4FBJB 4MEMA 1EAZA 4ANXA 2JY6A 3DDCB 3HQCA 4WJ7A 2HRJA 1YX5B 1LB1A 4MK0A 2Y8FA 4HB4B 2ROVA 2D11A 2HTHA 5D7GA 3QIJA 4WQOB 3A8PA 4W9CA 2DYOA 3R3MA 4HK2A 4W9DA 1I42A 3AXCA 3WA0A 2COAA 4K2OA 3TVVA 1MIZB 5J2RA 5D3WA 2YLMA 3H7PB 4BVUC 1UZXB 2FIFA 1XQQA 4A6FB 2KJHB 4GU2A 2M14A 2JT4B 5GOWB 4KZ0A 4JKGB 4HAUB 1HE8A 3T8MA 2MX2A 2LI5A 3KH0A 1KM7A 4DDGD 3WAMA 1KOTA 1UBQA 3E9OA 2OQBA 3WYFB 3DVGX 1P6SA 2OTXA 3APFA 2KANA 2CY5A 4P7IA 3H7PA 3ZW3A 3JSVA 3PREA 3ULBA 2BYFA 2CODA 1LFDA 1NTIA 1I7AA 2NBUA 1Y8RC 3GZNI 5IA7A 2BCJA 3U7DA 4JKGA 2LUEA 2RNRB 4PYUA 1NDDA 4ICUA 2KLGA 4MGYE 4ZYNA 3M63B 1DROA 2KLCA 4MGIE 2N0YA 2KDEB 4K17A 2BWFA 1R4NI 4X57B 4GB9A 4HATB 3QK0A 2DFKA 2O6VA 3A9KA 4FJZA 1IYFA 1U29A 4W9GA 2L7RA 4KHOA 2L8JA 2Z0PA 3QARA 1WR1A 3SU8X 3L17A 2Q13A 2KK8A 4DWFA 3VTVA 5CHFA 2ZNVB 2MA9B 3A1QA 4BOZB 2H7EA 3M95A 1TZ1A 3NY5A 2GBNA 4HCPB 3QAQA 2FNJB 2G35A 2RSGA 4ASWC 3RCPA 3VUXA 2ELAA 2DHJA 5LXIB 4XWXA 2COPA 4A3OA 2C5LC 2GJYA 5L81A 4WWNA 4FULA 2V1YA 2UVMA 1WGRA 3ZKJC 2BWES 3UZTA 3IHPC 2KWUB 2MW5A 3PT2B 1IRSA 4EZKA 4B9KA 1P3QU 4BOSC 2NZ8B 4RM9A 3NHEB 2KC1A 4M0WB 3K9OB 3ML4A 1K5GB 4ANUA 4JKAA 2QKMA 3VOQA 3ZNHB 2K00A 2KO3A 4H8SA 3PVLA 1XD4A 1IP9A 1ZC4B 1ZVRA 5CHWA 3QCAA 3QJZA 2DTCA 1L2NA 4FJYA 2DYBA 1M94A 4HAVB 4Z2NA 4MT7A 2DX1A 3IG3A 2KFKB 2KTFA 2ADZA 4F7HA 2K2JA 1Q0WB 1DIKA 3APCA 3W1SC 4N9F4 1ACAA 4HJKA 5D3XA 2DX5A 1V5UA 2FAZA 4BFRA 2BKFA 2IO1B 3PGEA 2YT1A 4EUTA 4IWPA 2MWSB 1FAOA 2LGDA 4JIOU 3TCAA 4I6PA 3E9LA 3DVNV 3PS6A 4GDKB 1WJ1A 4BKTA 2RGNB 1GC7A 3KY9A 2BPSA 2MSED 3RT3B 4I6LB 2JVCA 3L10B 4BBNF 1WGGA 1DDVA 3JW0X 2RVBB 3AJ4A 2DLWA 4GXBA 4MH0E 1GGOA 3WANA 2LVPA 4MSQB 4CYEA 3L13A 2WX1A 2NPTB 2YRYA 2ZVOA 1U4AA 1E7UA 2VSZA 1LQBA 4IOYX 3PVUA 1GC6A 2XQNM 1ZGUB 2Y8GA 2LXAA 4TYZA 5L83A 4NNJB 4KV2A 2L05A 2OJRA 3UIOB 3V62A 2KD0A 1NVLA 4G3XB 2M17A 3DXEA 2PE9A 3SUZA 3L54A 2X0SA 4DDID 2NPTA 3SV1A 2LVQA 5AEKB 3VXWA 4PS7A 2O6VD 1V49A 2RSUA 2IZVB 4NSWA 4CHJA 2O2VB 1NU2A 3BINA 2MBBB 3I3TB 1WE6A 4FADA 2VKIA 1UPRA 5L95C 5HKHA 4RM8A 2Z0QA 4AWJA 3CSTA 1BWNA 1AWEA 2REXA 2Y5BB 2L3ZA 4JKCA 5JHHA 1YD8U 1WI0A 2KKCA 1GNUA 2UZSA 1KJTA 3KUDB 5D2MB 3LJ3A 3MPXA 3VIAA 2O2VA 2KWCA 4AJYB 2E2XA 1WZ0A 2QHOA 1U5DA 2W2XC 2NR2A 1MIXA 3SD5A 2FCMA 3RD2A 2LD9A 1X1MA 1P9DU 2N1VA 2NS5A 3EECA 2DAFA 2MDXA 1V5PA 4K7UA 3PVWA 4RMAA 2B3AA 4WJQA 5DIFB 2DZMA 4LJPB 4II2B 3ODOA 4EJNA 3X0WA 1UPQA 1XCGA 1F9JA 3LDZE 4JQWC 2M38A 3D8EA 3W1SA 4NAWB 3VUWA 3V6EB 2XK5A 2WYQA 3PP2A 2KTRB 2CU1A 2IO2B 1WI1A 3AI5A 1V5OA 4GMVA 5KHQA 3ULCA 4TQ0A 2D9XA 1FHWA 3QWZB 4EMOA 4PQ0A 2KFJA 2COFA 3GYPA 1TXDA 3QA8A 2AEHA 5DH9B 3A33B 4FHKA 3JVZX 3GOEA 2KXJA 1HB6A 4DX8A 2UWQA 1P3RA 2J59M 3DBSA 4K7WA 4DK5A 4NAWA 4DHJD 1R4MI 3UINB 1UNQA 1ZKHA 2LOXA 2BGFA 2DIKA 2QKLA 2HTHB 3AU5A 3H6NA 2KUPA 4TQ1A 4A3PA 2JPHA 3DPDA 2R82A 3ZNZB 3EC8A 2OOBB 2LRUA 3WALA 2CB8A 4HDQA 2N23A 1OQYA 2LGXA 1BAKA 4JK9A 4MDKE 4KDLB 4OVUA 2ELBA 2DYQA 1J19A 2DHIA 3DCGA 2YT0A 3DXDA 4AJWA 1Z87A 1PFJA 3VQIA 2Z0OA 3OANA 2ZCCA 1V86A 3SYXA 5E6PA 2MBQA 1UEFA 1WJUA 2V4LA 1BTNA 2CRFA 1MK7B 3KVFB 1S1QB 1WY8A 2ZPNA 3JSVB 4G50A 1UBIA 3PEGA 2ZJDA 2RD0A 1WXVA 1ZSQA 1EGXA 2KMCA 2DZKA 5FI0A 1DYNA 2I5FA 4DX90 5DCNA 4A5KA 4IC7B 2IYBA 3ZLZA 2K1FA 1WGUA 2CHZA 2IBIB 4E3CA 3SBTA 1J8CA 2LXCA 3TFMA 2L0TA 3DVGY 2O6VB 4JKBA 3A9KB 2I5CA 4YL8A 2JF5A 5DPSA 1QQGA 4KDIC 1Q5WB 2KWVB 1OMWA 5J3TA 4TUUA 3B1LX 2AL3A 2N4FA 1KLVA 2GS0A 2FCSA 1XD3B 1LXDA 5DPRA 3A1QB 2GMIC 1WGHA 2PZ1A 1HB8A 5JZEB 2M4NA 2P0HA 1DDWA 1X86A 3M3JA 3VVWB 1UNRA 3KUCB 4EZLA 2MBEA 2JWZA 2J0KA 3CSFA 3ZTCA 4IWOA 2DYNA 4MELA 1OGWA 4EEWA 3EPYA 4URKA 2AL6A 3QWMA 2JUOA 4EFOA 1YIWA 4MGKE 5KQ4A 1E8XA 1XR0B 3L08A 1Z2MA 1AQCA 4C0AA 3E9PA 1WXAA 4CO7A 1VBHA 2J0MA 1N3HA 5KQ1A 3TMPB 4W9KA 4NQKE 4XX5A 2DYMA 3OJ4B 3PHXB 2PJHA 3SBGA 2LULA 1K5DB 4AUQC 3V5WA 1ZW7A 3A9JA 3PHWB 3FLVA 2GCJA 2N7EA 5J3QA 1HBKA 1TGZB 1SIFA 2ZZPB 3KW5B 1WZ3A 1P98A 2YF0A 4ILJA 2XBBC 4FN2A 4II3B 1E90A 3D32A 4WAAA 2PEAA 4DHZE 4PS8A 1WG7A 3F5RA 3KZ1A 1PQSA 2G4SA 4AP4C 1XODA 3DVNU 3MTNB 4NQLB 1RRBA 4TV3A 1WXMA 3TL5A 2EJ8A 1U5GA 1WGYA 3VH3B 4DHJB 3CMMB 2CS4A 3QC8B 2IO0B 1EUVB 3N30A 4W9HA 1OEYJ 1MK9B 2DX5B 2IY0B 2C7NB 3HHMA 2JZ3B 2CHXA 2L2IA 1MG8A 1NBFC 4HWIB 2DHKA 2JZZA 4MJSA 2NVUI 4BBKA 4LJOB 4ILHA 4DBBA 2CKHB 2GBMA 4NJ7A 3B08A 3S2AA 2WH5A 2NBWB 2PPHA 4EKUA 1E8WA 1WYWB 4KAXB 4ILGB 3DBRI 1BT0A 3PPAA 2D9VA 5KHOA 1J0WA 4MY6A 1VCBA 2D9WA 1UELA 2KQ7A 1JDEA 3ZRFA 1ST7A 2KDIA 3ZO5B 4ICVA 5D3VA 1OTRB 1G6JA 3IVFA 1V89A 1LM8B 1P0RA 4HCNB 1TQZA 1WJ6A 2N7DA 2N9PC 1KZ7A 5FR6A 5J17A 4JKFA 1OY2A 1KI1B 2LOZA 3OAWA 4M8NA 5AZGA 4KSLC 4Y94A 1U5FA 5D6JB 3UIPB 5C1ZA 1Q1OA 5BO4B 2H7DA 2AWTA 3PRMB 2R2QA 3PRPB 1A5RA 2RQ1A 1WVHA 4LDTD 4ZDVA 4MGZE 2J7QB 2DAJA 1WJNA 4ZRKA 4WWPA 5D3YA 4M8MA 2P0FA 3LJUX 4NJ6A 5JHBA 4G0NB 4E71A 4PNKA 1Q67A 5HE1A 2R09A 3ZVRA 5JHAA 3RUIB 3E66A 2BYEA 3T9LA 2DHZA 3HM3A 3NZUA 2LZ6A 2JP2A 1WRDB 3RZFA 2G4DB 1V81A 3HIZA 2YSZA 2W2XD 2V3SA 3DXCA 5D94A 2K25A 4A6KA 2C7HA 2G45B 2MCNB 2XEWA 1WM3A 3ALBA 2VRWB 3VAWA 3L0WB 3FP5A 3DBHI 3PG7A 2R2OA 4K1RB 1WJ4A 3WIMA 3D8FA 5JH5C 3KYCD 3H7SA 5G55A 1WGQA 4OVVA 2MBOA 1RJ2A 1NI2A 2I1JA 3AU4A 4W9IA 1EVHA 1S3SG 2YS5A 2EC1A 4FA6A 3ZNGC 2DZJA 3N7CA 2FJLA 3PSEB 4IFSA 3QHTA 2ZPYA 3DQVA 1V80A 1GG3A 2NBVB 3PV1A 3TJPA 1DBHA 4E74A 2XK5B 2FJ9A 4IM0A 4ANWA 3ZNID 1OEYA 4WWOA 4BKSD 2CY4A 5CLQB 2DKPA 1WX8A 4EZJA 3WAPA 1ZM0A 2LASA 3FM8C 4F8CB 2KHWB 1T0YA 3TIXA 1YX6B 1AARA 3A4SC 3W1YA 3N32A 1VBGA 2LVOA 1TTNA 3V6CB 3CXBB 4F7UP 2M1MA 3ZRCA 4BBNC 4CHKA 2YS1A 2JRHA 5LLIA 4ZRJA 1WX7A 3CIKA 2YS3A 3PSCA 4KSKC 4HB3B 2ZVNA 2N9XA 5JHGA 2K8BA 1LW3A 3AULA 3RYTA 2ABDA 1MAIA 3SO6A 3PRZA 2KX3A 2A5UA 1FB8A 1W1DA 1NTVA 5JP4A 1WF9A 3A4RA 1XT9B 4KZCA 2RPQA 1RRPB 1P1AA 3QBVB 2DA0A 2MBHA 2KDFB 2LKOA 5D27A 3QQ8B 2Y7BA 2L1CA 4XC2A 3ML9A 4B6HA 2IYDB 2RLOA 4GOCA 2L0FA 4MM3A 4B6WA 2D3GA 2GBKA 3VH4B 1FGYA 4W9LA 2ZNVC 1WXSA 1E8YA 3EHVA 2D07B 1EF1A 3BY4B 5C79A 2K6DB 1W1GA 2AYOB 3TO1A 2GOWA 4KVGB 2ASQA 1WH3A 2LYDA 2P0DA 1J0GA 4LDTB 2KQSA 3R7RA 3ZTDA 4JKEA 1V6EA 4YONA 1VD2A 4PS3A 4XZ4A 1V88A 4WVFB 3RULA 3UGBB 4GDLB 4KIKA 3MHSD 5TR5A 1D3ZA 3M1IB 4K81A 2UZRA 3P6AA 2DENB 2WX0A 5IJMA 3ZDMC 3NOBA 2KX0A 2LBBA 5EDSA 4HB2B 3TBLD 3VTWA 2W9NA 2KOXA 1E7VA 1U5EA 2G3QB 5HE2A 5C16A 3K9PB 4GDLA 2D4QA 3APDA 2C60A 2CAYA 2LG1A 2Z0DB 1WX9A 2JXXA 4HAXB 4A6HA 2DKQA 1OQNA 3MJWA 4J6IA 2WDTB 4F1SA 2LWPA 4PYZA 4A6FA 1U27A 2Z59B 3R66C 1EO6A 3GYOA 2MKRA 3H9DA 4ZRIA 2FCNA 1BTKA 3HM6X 4HAWB 3PLVA 1M7EA 1Y19B 2I1KA 3WAOA 3F0WA 4W9FA 2VRRB 5E6NA 2R0DA 1L7YA 4JK7A 4F7GA 1WM2A 5LOPB 3A9JB 4IM2A 2MQJA 1C3TA 1NTYA 3KYDD 2V76A 3HK0A 4FJVB 3G9WA 4CHMA 3SNHA 1E5WA 4HPLB 2KJ6A 4K7SA 1MKEA 2FDQA 1WR6E 2CQUA 3NS8A 3ONSA 3QX1A 4DBGA 4BKSA 2CHWA 3FEHA 3D8DA 1B55A 5HE0A 1RLFA 4MJSB 2CR5A 4IAPA 1TJ6A 2RGFA 2L00B 5AZHA 3R7QA 4MSMB 4GMXB 4HHVA 4A20A 3CF6E 3O65B 2EMSA 1YJ1A 4GSWA 4IG7B 5J18A 2COCA 5G2NA 2PE6B 3MDBC 3NSUA 2BKRB 4TKNA 2NMBA 1X05A 2MWNB 2FIDA 1H4RA 5AZFA 1V5TA 3VTUA 4JKDA 1WJMA 2HD5B 5CHVC 1SE9A 4FLHA 2HJ8A 4KHBB 1U2BA 2DZIA 3V61A 3UQBA 4HB0B 2UYZB 4FHJA 2RR9A 2ZCBA 1GUAB 3OJ3A 1K8RB 3O96A 2N9EB 1PLSA 4LCDE 2IO3B 4JLCA 5CLLB 2HE7A 1WE7A 3M62B 5DI9B 4K2PA 4WJOA 4KHAA 4W9JA 4GPTB 2LRWA 1EF5A 1FOEA 1W1HA 4GZUA 3C0RB 1PMSA 4HDOA 3BJIA 5J3YA 4HVBA 3Q3FA 1M7RA 2ROZB 5C5BB 3ZDTA 2BYVE 3ODXA 2KCJA 4WJNA 2Z0EB 1QZEA 3ENBA 5HE3A 1XKEA 2KFKA 3DOWA 1X1FA 2D2QA 1JRUA 1FHOA 2GBJA 3ECIA 4GGQA 3ZUNA 1DDMA 3KSYA 2KGXB 2MP2B 3VDZA 1I35A 1Z5SB 1QC6A 4G11A 1X1GA 1MPHA 5IAAC 5C5BA 3UF8A 1Y5OA 4HAZB 4I6NB 2BF8B 4GN1A 4NPNA 1SGHA 3H1UA 1P5TA 3IBEA 4DHZB 4GDKA 3TW1A 4IUMB 5GMVA 5CTRC 3HW2B 3PTFC 3Q3JA 2X18A 2KN5A 4L6EA 4HLEA 3JYUA 3KRWA 2MP2A 1YQBA 3U30A 3VHTC 4NY0A 4IM3A 3NZSA 5CX3A 2FUHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8H A;  1H10 A;  2W2W A;  5EFX A;  2IY1 B;  2K39 A;  3L16 A;  2RUK B;  2GCL A;  2L76 A;  2NCN A;  4GIV A;  1WGD A;  3P7Z A;  1CMX B;  1V2Y A;  4HPM B;  4EOY A;  4WJP A;  5DPT A;  1FGZ A;  3PZD A;  2N1W A;  4B95 A;  1FHX A;  2D10 A;  3B0A A;  3N3K B;  4IWQ A;  3KUZ A;  2FCQ A;  2K6Q A;  1TBE A;  2MLB A;  5FI1 A;  5C23 A;  3A8Q A;  5KCV A;  3SDL C;  5DHF B;  1UD7 A;  1WMH B;  2EMT A;  3RZW C;  5E6O A;  3EFU A;  2LJ5 A;  1I2H A;  2KDB A;  3A98 B;  1XX0 A;  2C7M B;  1X11 A;  2MRP A;  5C6R A;  2YVC A;  3SHQ A;  1SHC A;  1E8Z A;  2KNB A;  3ML8 A;  3VFK A;  4HAY B;  2M0X A;  2J0J A;  3V60 A;  1UNP A;  3ZVV A;  2K8C A;  4DXA B;  1WMH A;  5DPW A;  4AOF A;  3P2B A;  4IW0 A;  4WSF A;  2P8V A;  2KC2 A;  1C1Y B;  4W9E A;  3FSS A;  1H8C A;  3IFW B;  3X23 A;  2KJR A;  2LGY A;  1V9J A;  2KMA A;  3ODW A;  1KZG A;  4ANV A;  4F7Z A;  2KVR A;  3T06 A;  2JRI B;  3ZIM A;  5JLJ B;  4JL9 A;  1GJZ A;  3DBL I;  2MFQ A;  2M8S A;  3ENE A;  2A4Z A;  2WWZ A;  3RCZ A;  4Z2M B;  1UH6 A;  4D0N B;  1UGM A;  3OLM D;  2ZEQ A;  1V5M A;  1WIA A;  3KRX A;  3UQA A;  3U8Z A;  3VUY A;  4JGH B;  4HXD A;  1FXT B;  1WFY A;  4KIK B;  2KTR A;  5LXH A;  1RAX A;  2D9Y A;  2EKE C;  2KZR A;  1V61 A;  5DHA B;  1ZC3 B;  4BKG A;  2C9W B;  1ISN A;  2GBR A;  1RFA A;  2IFS A;  2D9Z A;  2DN6 A;  5LON B;  1IPG A;  3PLU A;  2K2U A;  4FBJ B;  4MEM A;  1EAZ A;  4ANX A;  2JY6 A;  3DDC B;  3HQC A;  4WJ7 A;  2HRJ A;  1YX5 B;  1LB1 A;  4MK0 A;  2Y8F A;  4HB4 B;  2ROV A;  2D11 A;  2HTH A;  5D7G A;  3QIJ A;  4WQO B;  3A8P A;  4W9C A;  2DYO A;  3R3M A;  4HK2 A;  4W9D A;  1I42 A;  3AXC A;  3WA0 A;  2COA A;  4K2O A;  3TVV A;  1MIZ B;  5J2R A;  5D3W A;  2YLM A;  3H7P B;  4BVU C;  1UZX B;  2FIF A;  1XQQ A;  4A6F B;  2KJH B;  4GU2 A;  2M14 A;  2JT4 B;  5GOW B;  4KZ0 A;  4HAU B;  1HE8 A;  3T8M A;  2MX2 A;  2LI5 A;  3KH0 A;  1KM7 A;  4DDG D;  3WAM A;  1KOT A;  1UBQ A;  2OQB A;  3WYF B;  3DVG X;  1P6S A;  2OTX A;  3APF A;  2KAN A;  2CY5 A;  4P7I A;  3H7P A;  3ZW3 A;  3JSV A;  3PRE A;  3ULB A;  2BYF A;  2COD A;  1LFD A;  1NTI A;  1I7A A;  2NBU A;  1Y8R C;  3GZN I;  5IA7 A;  2BCJ A;  3U7D A;  2LUE A;  2RNR B;  4PYU A;  1NDD A;  4ICU A;  2KLG A;  4MGY E;  4ZYN A;  3M63 B;  1DRO A;  2KLC A;  4MGI E;  2N0Y A;  2KDE B;  4K17 A;  2BWF A;  1R4N I;  4X57 B;  4GB9 A;  4HAT B;  3QK0 A;  2DFK A;  2O6V A;  3A9K A;  4FJZ A;  1IYF A;  1U29 A;  4W9G A;  2L7R A;  4KHO A;  2L8J A;  2Z0P A;  3QAR A;  1WR1 A;  3SU8 X;  3L17 A;  2Q13 A;  2KK8 A;  4DWF A;  3VTV A;  5CHF A;  2ZNV B;  2MA9 B;  3A1Q A;  4BOZ B;  2H7E A;  3M95 A;  1TZ1 A;  3NY5 A;  2GBN A;  4HCP B;  3QAQ A;  2FNJ B;  2G35 A;  2RSG A;  4ASW C;  3RCP A;  3VUX A;  2ELA A;  2DHJ A;  5LXI B;  4XWX A;  2COP A;  4A3O A;  2C5L C;  2GJY A;  5L81 A;  4WWN A;  4FUL A;  2V1Y A;  2UVM A;  1WGR A;  3ZKJ C;  2BWE S;  3UZT A;  3IHP C;  2KWU B;  2MW5 A;  3PT2 B;  1IRS A;  4EZK A;  4B9K A;  1P3Q U;  4BOS C;  2NZ8 B;  4RM9 A;  3NHE B;  2KC1 A;  4M0W B;  3K9O B;  3ML4 A;  1K5G B;  4ANU A;  2QKM A;  3VOQ A;  3ZNH B;  2K00 A;  2KO3 A;  4H8S A;  3PVL A;  1XD4 A;  1IP9 A;  1ZC4 B;  1ZVR A;  5CHW A;  3QCA A;  3QJZ A;  2DTC A;  1L2N A;  4FJY A;  2DYB A;  1M94 A;  4HAV B;  4Z2N A;  4MT7 A;  2DX1 A;  3IG3 A;  2KFK B;  2KTF A;  2ADZ A;  4F7H A;  2K2J A;  1Q0W B;  3APC A;  3W1S C;  4N9F 4;  1ACA A;  4HJK A;  5D3X A;  2DX5 A;  1V5U A;  2FAZ A;  4BFR A;  2BKF A;  2IO1 B;  3PGE A;  2YT1 A;  4EUT A;  4IWP A;  2MWS B;  1FAO A;  2LGD A;  4JIO U;  3TCA A;  4I6P A;  3DVN V;  3PS6 A;  4GDK B;  1WJ1 A;  4BKT A;  2RGN B;  1GC7 A;  3KY9 A;  2BPS A;  2MSE D;  3RT3 B;  4I6L B;  2JVC A;  3L10 B;  4BBN F;  1WGG A;  1DDV A;  3JW0 X;  2RVB B;  3AJ4 A;  2DLW A;  4GXB A;  4MH0 E;  3WAN A;  2LVP A;  4MSQ B;  4CYE A;  3L13 A;  2WX1 A;  2NPT B;  2YRY A;  2ZVO A;  1U4A A;  1E7U A;  2VSZ A;  1LQB A;  4IOY X;  3PVU A;  1GC6 A;  2XQN M;  1ZGU B;  2Y8G A;  2LXA A;  4TYZ A;  5L83 A;  4NNJ B;  4KV2 A;  2L05 A;  2OJR A;  3UIO B;  3V62 A;  2KD0 A;  1NVL A;  4G3X B;  2M17 A;  3DXE A;  2PE9 A;  3SUZ A;  3L54 A;  4DDI D;  2NPT A;  3SV1 A;  2LVQ A;  5AEK B;  3VXW A;  4PS7 A;  2O6V D;  1V49 A;  2RSU A;  2IZV B;  4NSW A;  4CHJ A;  2O2V B;  1NU2 A;  3BIN A;  2MBB B;  3I3T B;  1WE6 A;  4FAD A;  2VKI A;  1UPR A;  5L95 C;  5HKH A;  4RM8 A;  2Z0Q A;  4AWJ A;  3CST A;  1BWN A;  1AWE A;  2REX A;  2Y5B B;  2L3Z A;  5JHH A;  1YD8 U;  1WI0 A;  2KKC A;  1GNU A;  2UZS A;  1KJT A;  3KUD B;  5D2M B;  3LJ3 A;  3MPX A;  3VIA A;  2O2V A;  2KWC A;  4AJY B;  2E2X A;  1WZ0 A;  2QHO A;  1U5D A;  2W2X C;  2NR2 A;  1MIX A;  3SD5 A;  2FCM A;  3RD2 A;  2LD9 A;  1X1M A;  1P9D U;  2N1V A;  2NS5 A;  3EEC A;  2DAF A;  2MDX A;  1V5P A;  4K7U A;  3PVW A;  4RMA A;  2B3A A;  4WJQ A;  5DIF B;  2DZM A;  4LJP B;  4II2 B;  3ODO A;  4EJN A;  3X0W A;  1UPQ A;  1XCG A;  1F9J A;  3LDZ E;  4JQW C;  2M38 A;  3D8E A;  3W1S A;  4NAW B;  3VUW A;  3V6E B;  2XK5 A;  2WYQ A;  3PP2 A;  2KTR B;  2CU1 A;  2IO2 B;  1WI1 A;  3AI5 A;  1V5O A;  4GMV A;  5KHQ A;  3ULC A;  4TQ0 A;  2D9X A;  1FHW A;  3QWZ B;  4EMO A;  4PQ0 A;  2KFJ A;  2COF A;  3GYP A;  1TXD A;  3QA8 A;  2AEH A;  5DH9 B;  3A33 B;  4FHK A;  3JVZ X;  3GOE A;  2KXJ A;  1HB6 A;  4DX8 A;  2UWQ A;  1P3R A;  2J59 M;  3DBS A;  4K7W A;  4DK5 A;  4NAW A;  4DHJ D;  1R4M I;  3UIN B;  1UNQ A;  1ZKH A;  2LOX A;  2BGF A;  2QKL A;  2HTH B;  3AU5 A;  3H6N A;  2KUP A;  4TQ1 A;  4A3P A;  2JPH A;  3DPD A;  3ZNZ B;  3EC8 A;  2OOB B;  2LRU A;  3WAL A;  2CB8 A;  4HDQ A;  2N23 A;  1OQY A;  2LGX A;  1BAK A;  4MDK E;  4KDL B;  4OVU A;  2ELB A;  2DYQ A;  1J19 A;  2DHI A;  3DCG A;  2YT0 A;  3DXD A;  4AJW A;  1Z87 A;  1PFJ A;  3VQI A;  2Z0O A;  3OAN A;  2ZCC A;  1V86 A;  3SYX A;  5E6P A;  2MBQ A;  1UEF A;  1WJU A;  2V4L A;  1BTN A;  2CRF A;  1MK7 B;  3KVF B;  1S1Q B;  1WY8 A;  2ZPN A;  3JSV B;  4G50 A;  1UBI A;  3PEG A;  2ZJD A;  2RD0 A;  1WXV A;  1ZSQ A;  1EGX A;  2KMC A;  2DZK A;  5FI0 A;  1DYN A;  2I5F A;  4DX9 0;  5DCN A;  4A5K A;  4IC7 B;  2IYB A;  3ZLZ A;  2K1F A;  1WGU A;  2CHZ A;  2IBI B;  4E3C A;  1J8C A;  2LXC A;  3TFM A;  2L0T A;  3DVG Y;  2O6V B;  3A9K B;  2I5C A;  4YL8 A;  2JF5 A;  5DPS A;  1QQG A;  4KDI C;  1Q5W B;  2KWV B;  1OMW A;  5J3T A;  4TUU A;  3B1L X;  2AL3 A;  2N4F A;  1KLV A;  2GS0 A;  2FCS A;  1XD3 B;  1LXD A;  5DPR A;  3A1Q B;  2GMI C;  1WGH A;  2PZ1 A;  1HB8 A;  5JZE B;  2M4N A;  2P0H A;  1DDW A;  1X86 A;  3M3J A;  3VVW B;  1UNR A;  3KUC B;  4EZL A;  2MBE A;  2JWZ A;  2J0K A;  3CSF A;  3ZTC A;  4IWO A;  2DYN A;  4MEL A;  1OGW A;  4EEW A;  3EPY A;  4URK A;  2AL6 A;  3QWM A;  2JUO A;  4EFO A;  1YIW A;  4MGK E;  5KQ4 A;  1E8X A;  1XR0 B;  3L08 A;  1Z2M A;  1AQC A;  4C0A A;  1WXA A;  4CO7 A;  2J0M A;  1N3H A;  5KQ1 A;  3TMP B;  4W9K A;  4NQK E;  4XX5 A;  2DYM A;  3OJ4 B;  3PHX B;  2PJH A;  2LUL A;  1K5D B;  4AUQ C;  3V5W A;  1ZW7 A;  3A9J A;  3PHW B;  3FLV A;  2GCJ A;  2N7E A;  5J3Q A;  1HBK A;  1TGZ B;  1SIF A;  2ZZP B;  3KW5 B;  1WZ3 A;  1P98 A;  2YF0 A;  2XBB C;  4FN2 A;  4II3 B;  1E90 A;  3D32 A;  4WAA A;  2PEA A;  4DHZ E;  4PS8 A;  1WG7 A;  3F5R A;  3KZ1 A;  1PQS A;  2G4S A;  4AP4 C;  1XOD A;  3DVN U;  3MTN B;  4NQL B;  1RRB A;  4TV3 A;  1WXM A;  3TL5 A;  2EJ8 A;  1U5G A;  1WGY A;  3VH3 B;  4DHJ B;  3CMM B;  2CS4 A;  3QC8 B;  2IO0 B;  1EUV B;  3N30 A;  4W9H A;  1OEY J;  1MK9 B;  2DX5 B;  2IY0 B;  2C7N B;  3HHM A;  2JZ3 B;  2CHX A;  2L2I A;  1MG8 A;  1NBF C;  4HWI B;  2DHK A;  2JZZ A;  4MJS A;  2NVU I;  4BBK A;  4LJO B;  4DBB A;  2CKH B;  2GBM A;  4NJ7 A;  3B08 A;  3S2A A;  2WH5 A;  2NBW B;  2PPH A;  4EKU A;  1E8W A;  1WYW B;  4KAX B;  3DBR I;  1BT0 A;  3PPA A;  2D9V A;  5KHO A;  1J0W A;  4MY6 A;  1VCB A;  2D9W A;  1UEL A;  2KQ7 A;  3ZRF A;  1ST7 A;  2KDI A;  3ZO5 B;  4ICV A;  5D3V A;  1OTR B;  1G6J A;  3IVF A;  1V89 A;  1LM8 B;  1P0R A;  4HCN B;  1TQZ A;  1WJ6 A;  2N7D A;  2N9P C;  1KZ7 A;  5FR6 A;  5J17 A;  1OY2 A;  1KI1 B;  2LOZ A;  3OAW A;  4M8N A;  5AZG A;  4KSL C;  4Y94 A;  1U5F A;  5D6J B;  3UIP B;  5C1Z A;  1Q1O A;  5BO4 B;  2H7D A;  2AWT A;  3PRM B;  2R2Q A;  3PRP B;  1A5R A;  2RQ1 A;  1WVH A;  4LDT D;  4ZDV A;  4MGZ E;  2J7Q B;  2DAJ A;  1WJN A;  4ZRK A;  4WWP A;  5D3Y A;  4M8M A;  2P0F A;  3LJU X;  4NJ6 A;  5JHB A;  4G0N B;  4E71 A;  4PNK A;  1Q67 A;  5HE1 A;  2R09 A;  3ZVR A;  5JHA A;  3RUI B;  2BYE A;  3T9L A;  2DHZ A;  3HM3 A;  3NZU A;  2LZ6 A;  2JP2 A;  1WRD B;  3RZF A;  2G4D B;  1V81 A;  3HIZ A;  2YSZ A;  2W2X D;  2V3S A;  3DXC A;  5D94 A;  2K25 A;  4A6K A;  2C7H A;  2G45 B;  2MCN B;  2XEW A;  1WM3 A;  3ALB A;  2VRW B;  3VAW A;  3L0W B;  3FP5 A;  3DBH I;  3PG7 A;  2R2O A;  4K1R B;  1WJ4 A;  3WIM A;  3D8F A;  5JH5 C;  3KYC D;  3H7S A;  5G55 A;  1WGQ A;  4OVV A;  2MBO A;  1RJ2 A;  1NI2 A;  2I1J A;  3AU4 A;  4W9I A;  1EVH A;  1S3S G;  2YS5 A;  2EC1 A;  4FA6 A;  3ZNG C;  2DZJ A;  3N7C A;  2FJL A;  3PSE B;  4IFS A;  3QHT A;  2ZPY A;  3DQV A;  1V80 A;  1GG3 A;  2NBV B;  3PV1 A;  3TJP A;  1DBH A;  4E74 A;  2XK5 B;  2FJ9 A;  4IM0 A;  4ANW A;  3ZNI D;  1OEY A;  4WWO A;  4BKS D;  2CY4 A;  5CLQ B;  2DKP A;  1WX8 A;  4EZJ A;  3WAP A;  1ZM0 A;  2LAS A;  3FM8 C;  4F8C B;  2KHW B;  1T0Y A;  3TIX A;  1YX6 B;  1AAR A;  3A4S C;  3W1Y A;  3N32 A;  2LVO A;  1TTN A;  3V6C B;  3CXB B;  4F7U P;  2M1M A;  3ZRC A;  4BBN C;  4CHK A;  2YS1 A;  2JRH A;  5LLI A;  4ZRJ A;  1WX7 A;  3CIK A;  2YS3 A;  3PSC A;  4KSK C;  4HB3 B;  2ZVN A;  2N9X A;  5JHG A;  2K8B A;  1LW3 A;  3AUL A;  3RYT A;  2ABD A;  1MAI A;  3SO6 A;  3PRZ A;  2KX3 A;  2A5U A;  1FB8 A;  1W1D A;  1NTV A;  5JP4 A;  1WF9 A;  3A4R A;  1XT9 B;  4KZC A;  2RPQ A;  1RRP B;  1P1A A;  3QBV B;  2DA0 A;  2MBH A;  2KDF B;  2LKO A;  5D27 A;  3QQ8 B;  2Y7B A;  2L1C A;  4XC2 A;  3ML9 A;  4B6H A;  2IYD B;  2RLO A;  4GOC A;  2L0F A;  4MM3 A;  4B6W A;  2D3G A;  2GBK A;  3VH4 B;  1FGY A;  4W9L A;  2ZNV C;  1WXS A;  1E8Y A;  3EHV A;  2D07 B;  1EF1 A;  3BY4 B;  5C79 A;  2K6D B;  1W1G A;  2AYO B;  3TO1 A;  2GOW A;  4KVG B;  2ASQ A;  1WH3 A;  2LYD A;  2P0D A;  1J0G A;  4LDT B;  2KQS A;  3R7R A;  3ZTD A;  1V6E A;  4YON A;  1VD2 A;  4PS3 A;  4XZ4 A;  1V88 A;  4WVF B;  3RUL A;  3UGB B;  4GDL B;  4KIK A;  3MHS D;  5TR5 A;  1D3Z A;  3M1I B;  4K81 A;  2UZR A;  3P6A A;  2DEN B;  2WX0 A;  5IJM A;  3ZDM C;  3NOB A;  2KX0 A;  2LBB A;  5EDS A;  4HB2 B;  3TBL D;  3VTW A;  2W9N A;  2KOX A;  1E7V A;  1U5E A;  2G3Q B;  5HE2 A;  5C16 A;  3K9P B;  4GDL A;  2D4Q A;  3APD A;  2C60 A;  2CAY A;  2LG1 A;  2Z0D B;  1WX9 A;  2JXX A;  4HAX B;  4A6H A;  2DKQ A;  1OQN A;  3MJW A;  4J6I A;  2WDT B;  4F1S A;  2LWP A;  4PYZ A;  4A6F A;  1U27 A;  2Z59 B;  3R66 C;  1EO6 A;  3GYO A;  2MKR A;  3H9D A;  4ZRI A;  2FCN A;  1BTK A;  3HM6 X;  4HAW B;  3PLV A;  1M7E A;  1Y19 B;  2I1K A;  3WAO A;  3F0W A;  4W9F A;  2VRR B;  5E6N A;  2R0D A;  1L7Y A;  4F7G A;  1WM2 A;  5LOP B;  3A9J B;  4IM2 A;  2MQJ A;  1C3T A;  1NTY A;  3KYD D;  2V76 A;  3HK0 A;  4FJV B;  3G9W A;  4CHM A;  3SNH A;  1E5W A;  4HPL B;  2KJ6 A;  4K7S A;  1MKE A;  2FDQ A;  1WR6 E;  2CQU A;  3NS8 A;  3ONS A;  3QX1 A;  4DBG A;  4BKS A;  2CHW A;  3FEH A;  3D8D A;  1B55 A;  5HE0 A;  1RLF A;  4MJS B;  2CR5 A;  4IAP A;  1TJ6 A;  2RGF A;  2L00 B;  5AZH A;  3R7Q A;  4MSM B;  4GMX B;  4HHV A;  4A20 A;  3CF6 E;  3O65 B;  2EMS A;  1YJ1 A;  4GSW A;  4IG7 B;  5J18 A;  2COC A;  5G2N A;  2PE6 B;  3MDB C;  3NSU A;  2BKR B;  4TKN A;  2NMB A;  1X05 A;  2MWN B;  2FID A;  1H4R A;  5AZF A;  1V5T A;  3VTU A;  1WJM A;  2HD5 B;  5CHV C;  1SE9 A;  4FLH A;  2HJ8 A;  4KHB B;  1U2B A;  2DZI A;  3V61 A;  3UQB A;  4HB0 B;  2UYZ B;  4FHJ A;  2RR9 A;  2ZCB A;  1GUA B;  3OJ3 A;  1K8R B;  3O96 A;  2N9E B;  1PLS A;  4LCD E;  2IO3 B;  4JLC A;  5CLL B;  2HE7 A;  1WE7 A;  3M62 B;  5DI9 B;  4K2P A;  4WJO A;  4KHA A;  4W9J A;  4GPT B;  2LRW A;  1EF5 A;  1FOE A;  1W1H A;  4GZU A;  3C0R B;  1PMS A;  4HDO A;  3BJI A;  5J3Y A;  4HVB A;  3Q3F A;  1M7R A;  2ROZ B;  5C5B B;  3ZDT A;  2BYV E;  3ODX A;  2KCJ A;  4WJN A;  2Z0E B;  1QZE A;  5HE3 A;  1XKE A;  2KFK A;  3DOW A;  1X1F A;  2D2Q A;  1JRU A;  1FHO A;  2GBJ A;  3ECI A;  4GGQ A;  3ZUN A;  1DDM A;  3KSY A;  2KGX B;  2MP2 B;  3VDZ A;  1I35 A;  1Z5S B;  1QC6 A;  4G11 A;  1X1G A;  1MPH A;  5IAA C;  5C5B A;  3UF8 A;  1Y5O A;  4HAZ B;  4I6N B;  2BF8 B;  4GN1 A;  4NPN A;  1SGH A;  3H1U A;  1P5T A;  3IBE A;  4DHZ B;  4GDK A;  3TW1 A;  4IUM B;  5GMV A;  5CTR C;  3HW2 B;  3PTF C;  3Q3J A;  2X18 A;  2KN5 A;  4L6E A;  4HLE A;  3JYU A;  3KRW A;  2MP2 A;  1YQB A;  3U30 A;  3VHT C;  4NY0 A;  4IM3 A;  3NZS A;  5CX3 A;  2FUH B; 
#chains in the Genus database with same CATH topology
 2K8H A;  1H10 A;  1TY0 A;  2W2W A;  5EFX A;  2IY1 B;  3SEB A;  3U12 A;  2K39 A;  3L16 A;  3Q8C A;  1R7S A;  2RUK B;  1JML A;  2GCL A;  3AEF B;  2L76 A;  2NCN A;  4GIV A;  2XN9 C;  1WGD A;  3P7Z A;  3NW8 A;  3GS2 A;  1CMX B;  1V2Y A;  4HPM B;  1VZ8 A;  4EOY A;  3DHH C;  2W54 A;  4WJP A;  2V4I B;  5DPT A;  1FGZ A;  3PZD A;  2N1W A;  4RF0 A;  1FHX A;  4B95 A;  2D10 A;  3DHI C;  3B0A A;  1YQ4 B;  3N3K B;  4JWS C;  1N60 A;  4IWQ A;  5D3I B;  4BZA A;  3KUZ A;  2FCQ A;  2K6Q A;  2DNF A;  1I4Q A;  1TBE A;  2MLB A;  5BYR A;  5FI1 A;  3P1M A;  5C23 A;  3A8Q A;  1I4R A;  1ZE3 D;  5KCV A;  1VZ7 A;  3SDL C;  3AE9 B;  5DHF B;  4L1B A;  1UD7 A;  1JRP A;  1WMH B;  1C79 A;  2EMT A;  1ZDX A;  3RZW C;  5E6O A;  1JCK B;  3EFU A;  2LJ5 A;  4JKH A;  1N5X A;  1I2H A;  2KDB A;  3A98 B;  1YN3 A;  1XX0 A;  2DLB A;  4K3C A;  1CZP A;  1D5Z C;  2C7M B;  1X11 A;  2MRP A;  5C6R A;  1VDV A;  2YVC A;  3SHQ A;  1RWS A;  2BBC A;  1SHC A;  2R2Y A;  1E8Z A;  2KNB A;  3ML8 A;  3HVZ A;  3VFK A;  3NVW A;  3W9C B;  4HAY B;  2M0X A;  4ACF A;  2J0J A;  3V60 A;  1UNP A;  2WP9 B;  2OHF A;  3ZVV A;  2K8C A;  4DXA B;  2JQR B;  1WMH A;  5DPW A;  4AOF A;  3P2B A;  4LNI A;  4IW0 A;  4WSF A;  2Z14 A;  1VJK A;  3DHG C;  2P8V A;  2KC2 A;  1C1Y B;  1E7P B;  5EE1 A;  4W9E A;  1OQQ A;  3FSS A;  1H8C A;  3IFW B;  3X23 A;  3OG5 A;  2KJR A;  3C19 A;  1FD6 A;  2LGY A;  3RN9 C;  1V9J A;  2KMA A;  1TT5 B;  4MM3 B;  3ODW A;  3DBL B;  2ACZ B;  1UNS A;  3RNA C;  1KZG A;  4N6E B;  1KC7 A;  4ANV A;  1MI0 A;  4F7Z A;  2KVR A;  3PO0 A;  3T06 A;  2G9H D;  2JRI B;  2SAK A;  3ZIM A;  5JLJ B;  4JL9 A;  1GJZ A;  3DBL I;  4JK8 A;  1TZO A;  2MFQ A;  2ICI A;  5JVL A;  2M8S A;  1EU4 A;  3IXS A;  3WCQ A;  3UI3 A;  3ENE A;  2A4Z A;  2WWZ A;  3RCZ A;  1T77 A;  1UGJ A;  3DWM A;  3MC0 B;  4Z2M B;  1ZP0 B;  1UH6 A;  4D0N B;  1UGM A;  2GRI A;  3OLM D;  2ZEQ A;  1V5M A;  2PLP A;  2WXR A;  1WIA A;  4WQM A;  3KRX A;  3UQA A;  3U8Z A;  3VUY A;  3AE7 B;  4JGH B;  4HXD A;  4DQO C;  1FXT B;  1JQ4 A;  4XDD A;  1WFY A;  2JXT A;  2INC C;  4USA A;  3AE2 B;  4KIK B;  5IOI A;  2KTR A;  5LXH A;  3CIR B;  1RAX A;  2D9Y A;  2MJD A;  5HHD G;  2EKE C;  2KZR A;  1V61 A;  5DHA B;  1ZC3 B;  4BKG A;  2C9W B;  1ISN A;  2GBR A;  1RFA A;  2IFS A;  2D9Z A;  2DN6 A;  5LON B;  4US8 A;  1IPG A;  2WHI A;  3AMZ A;  1KBL A;  1NI3 A;  3PLU A;  4REZ A;  2K2U A;  4RGN A;  4FBJ B;  1TS3 A;  1M4V A;  4C7Y A;  4ZYS A;  1TY2 A;  4MEM A;  1EAZ A;  4ANX A;  2JY6 A;  1F77 A;  3W5U B;  3DDC B;  3HQC A;  4WJ7 A;  2HRJ A;  4B0E A;  1YX5 B;  1LB1 A;  4MK0 A;  2Y8F A;  4HB4 B;  2ROV A;  2D11 A;  2HTH A;  5D7G A;  3QIJ A;  2BW2 A;  1L4D B;  4WQO B;  3A8P A;  4W9C A;  3RNE C;  2DYO A;  3R3M A;  1TIF A;  2E3T A;  4HK2 A;  2GLS A;  4W9D A;  1I42 A;  3AXC A;  3WA0 A;  2COA A;  4K2O A;  3TVV A;  1MIZ B;  1D5X C;  1QT9 A;  5J2R A;  5D3W A;  1MJD A;  2YLM A;  3H7P B;  4BVU C;  1HA5 A;  1UZX B;  2FIF A;  1XQQ A;  3FAH A;  1V1P A;  4A6F B;  1LO5 D;  2BVC A;  2KJH B;  4GU2 A;  2M14 A;  2JT4 B;  5GOW B;  4KZ0 A;  1J7B A;  2XNA C;  4JKG B;  4PT5 A;  4HAU B;  1HE8 A;  3T8M A;  2KQ4 X;  2MX2 A;  2LI5 A;  3KH0 A;  3EUB 2;  1KM7 A;  4DDG D;  5JXV A;  3WAM A;  1KOT A;  1UBQ A;  3E9O A;  2OQB A;  3WYF B;  3DVG X;  1P6S A;  3NVV A;  2OTX A;  3GZN B;  3APF A;  4C80 A;  2KAN A;  3ABV B;  2KWD A;  3Q8F A;  4HEA 1;  4HRO A;  2CY5 A;  4P7I A;  3H7P A;  2WXF A;  3ZW3 A;  1WRI A;  3JSV A;  3PZ7 A;  3N1Y C;  2J42 A;  3PRE A;  2KT7 A;  3NJT A;  1SB3 C;  3ULB A;  2BYF A;  2COD A;  1LFD A;  2JU6 X;  1NTI A;  1I7A A;  1Q10 A;  1Y8R C;  2NBU A;  3GZN I;  2IJ0 A;  5IA7 A;  3BWU D;  2BCJ A;  1N62 A;  1C4C A;  3U7D A;  4JKG A;  2LUE A;  2RNR B;  2JWU A;  1R4N B;  2TSS A;  1IGC A;  2ONQ A;  3RI7 C;  4PYU A;  2FJU B;  1NDD A;  3L4P A;  4ICU A;  3T3N A;  1T6B X;  2KLG A;  4AQ7 A;  4MGY E;  4ZYN A;  3M63 B;  1DRO A;  2KLC A;  4MGI E;  2N0Y A;  5I4D A;  2KDE B;  4K17 A;  4KGT A;  2BWF A;  3FKY A;  4OVZ A;  1R4N I;  4X57 B;  4GB9 A;  4HAT B;  3QK0 A;  2DFK A;  2O6V A;  3A9K A;  1QOG A;  4FJZ A;  1IYF A;  1U29 A;  1I4H A;  2GI9 A;  1XCT L;  3BZD B;  4W9G A;  1PDX A;  2L7R A;  4KHO A;  1F0Z A;  2L8J A;  2Z0P A;  3B77 A;  3QAR A;  4XWT A;  1WR1 A;  1L6U A;  2INP E;  3SU8 X;  2KDM A;  2MEK A;  2EKI A;  3L17 A;  1UUP A;  2Q13 A;  2KK8 A;  4UDU C;  4DWF A;  3VTV A;  1L0V B;  5CHF A;  2ZNV B;  2M0A A;  2MA9 B;  3A1Q A;  4BOZ B;  2RDH A;  2BYT A;  2H7E A;  3M95 A;  1TZ1 A;  3NY5 A;  2GBN A;  4HCP B;  3QAQ A;  2FNJ B;  2G35 A;  3B2G A;  3R2I A;  3R2T A;  3AE8 B;  2RSG A;  2N9K A;  4ASW C;  3RCP A;  3VUX A;  4AS1 A;  2ELA A;  2DHJ A;  2HTM E;  2FUG 1;  5LXI B;  4XWX A;  2N9L A;  2COP A;  4A3O A;  2UU7 A;  2C5L C;  2GJY A;  5L81 A;  4WWN A;  3ZYY X;  4FUL A;  4YSZ B;  4RNA A;  2KAC A;  2V1Y A;  2UVM A;  1WGR A;  3ZKJ C;  1N63 A;  4M01 A;  2BWE S;  1N61 A;  2MJ3 A;  3UZT A;  2VZK D;  1MVK A;  2KWU B;  2MW5 A;  3IHP C;  3PT2 B;  3DWG C;  1IRS A;  3LB8 C;  2LUM A;  1JWB D;  4EZK A;  4B9K A;  3AN1 A;  1P3Q U;  4RF1 A;  1SSN A;  4BOS C;  4ZHO A;  4YXD B;  2NZ8 B;  1TJE A;  4RM9 A;  3NHE B;  2JYT A;  2KC1 A;  4M0W B;  3K9O B;  3ML4 A;  1K5G B;  4ANU A;  4JKA A;  2QKM A;  1KLU D;  1V1O A;  3VOQ A;  1MHH E;  1SBB B;  3ZNH B;  1KH0 A;  2K00 A;  2KO3 A;  1SJH D;  3VRA B;  4GOU A;  1D5M C;  4H8S A;  3PVL A;  1XD4 A;  5T8I A;  1P7E A;  1IP9 A;  1ZC4 B;  1ZVR A;  5CHW A;  2RRF A;  3QCA A;  2WU2 B;  3QJZ A;  2DTC A;  1L2N A;  4FJY A;  2DYB A;  1M94 A;  4HAV B;  4Z2N A;  4MT7 A;  2DX1 A;  1EM7 A;  3IG3 A;  2KFK B;  2KTF A;  2ADZ A;  4F7H A;  2RDB C;  2K2J A;  2YEP F;  1Q0W B;  4RH6 A;  1DIK A;  3APC A;  4M0W A;  3RNG C;  3W1S C;  4N9F 4;  1ACA A;  4HJK A;  5D3X A;  2DX5 A;  1V5U A;  2FAZ A;  4BFR A;  2BKF A;  3N9Y C;  2IO1 B;  3PGE A;  3DCX A;  2YT1 A;  4EUT A;  4IWP A;  2MWS B;  1FAO A;  2LGD A;  2Z4D A;  2FE8 A;  4JIO U;  3IT4 B;  2W3S A;  1FCL A;  3TCA A;  4I6P A;  5G5G A;  4D2K A;  3E9L A;  2CJO A;  3DVN V;  3PS6 A;  4GDK B;  1WJ1 A;  4P1B C;  2W82 A;  3V3X A;  1C4P A;  4BKT A;  2RGN B;  1OQR A;  1GC7 A;  3KY9 A;  3NUH B;  2BPS A;  2MSE D;  3RT3 B;  4I6L B;  1F1H A;  1RYJ A;  2JVC A;  3L10 B;  4BBN F;  1WGG A;  5HI1 A;  1DDV A;  3JW0 X;  1HTO A;  4KKJ A;  1B1Z A;  2RVB B;  3AJ4 A;  2DLW A;  4GXB A;  3TEW A;  1VLB A;  2BS2 B;  4MH0 E;  1L0Y B;  1GGO A;  3C8Y A;  4IOI E;  4KX6 B;  5AUK A;  2YT2 A;  5H92 C;  4XE0 A;  3WAN A;  4H2A A;  4IDI A;  2LVP A;  3LYY A;  1N5W A;  1GB1 A;  2HDE A;  4LNF A;  2D3A A;  4MSQ B;  4CYE A;  3L13 A;  5IRS A;  2WX1 A;  2W55 A;  2NPT B;  2YRY A;  2ZVO A;  1L0X B;  1U4A A;  1E7U A;  2VSZ A;  1LQB A;  4IOY X;  3PVU A;  1GC6 A;  2XQN M;  1VZ6 A;  1ZGU B;  2Y8G A;  4NJC A;  2LXA A;  4TYZ A;  1SE4 A;  5L83 A;  4NNJ B;  4KV2 A;  2L05 A;  2OJR A;  3UIO B;  2OED A;  2AX5 A;  1TS2 A;  3V62 A;  2KD0 A;  1XO3 A;  1NVL A;  2VH1 A;  1HQR D;  4G3X B;  2M17 A;  3DXE A;  2PE9 A;  3SUZ A;  1BML C;  1KRH A;  3L54 A;  2X0S A;  4DDI D;  2IGH A;  1HZ5 A;  2NPT A;  4LK0 M;  3ZXR A;  2WS3 B;  3H8H A;  3SV1 A;  2LVQ A;  3RNF C;  3SFD B;  2QIL A;  5AEK B;  3VXW A;  3RFZ B;  1FIQ A;  4JX1 C;  5I2S A;  4PS7 A;  2O6V D;  3Q3M C;  1V49 A;  2RSU A;  2X8X X;  2IZV B;  4NSW A;  2V9H A;  1C9F A;  5TSS A;  4CHJ A;  2O2V B;  1NU2 A;  3BIN A;  4RGM A;  2MBB B;  1QF6 A;  3GB1 A;  4J3O D;  3I3T B;  1WE6 A;  1F2R C;  4FAD A;  2WDV B;  2VKI A;  1NVI D;  1UPR A;  1T3Q A;  1DOX A;  5L95 C;  1FPY A;  5HKH A;  4RM8 A;  3W2D A;  2Z0Q A;  4AWJ A;  3CST A;  4IKG A;  4XGA B;  1BWN A;  1AWE A;  1ENF A;  5HFY A;  2REX A;  3NVY A;  1OFF A;  4EE2 A;  2Y5B B;  2L3Z A;  2KIE A;  4JKC A;  5JHH A;  3OHM B;  1YD8 U;  2KIG A;  1WI0 A;  2KKC A;  1GNU A;  2UZS A;  3Q69 A;  5BYQ A;  3Q14 C;  2IGG A;  2M19 A;  1KJT A;  4ZRQ A;  3KUD B;  3AE5 B;  4MAC A;  1YJI A;  3HVD A;  5D2M B;  2EEL A;  4HKZ E;  2IGD A;  3LJ3 A;  3MPX A;  2WXL A;  3VIA A;  2O2V A;  2VZK B;  2KWC A;  4AJY B;  2E2X A;  1WZ0 A;  4LNN A;  2QHO A;  1U5D A;  1F52 A;  2W2X C;  2NR2 A;  1AWD A;  1MIX A;  3SD5 A;  2FCM A;  3RD2 A;  1FFV A;  2LD9 A;  1FNU A;  1X1M A;  1NEN B;  1P9D U;  2N1V A;  2NS5 A;  3EEC A;  4DIX A;  1T0Q C;  2DAF A;  2MDX A;  2BB6 A;  1V5P A;  2MH7 A;  4K7U A;  2J4X A;  3PVW A;  4RMA A;  2B3A A;  4WJQ A;  1CK1 A;  5DIF B;  2DZM A;  4LJP B;  4II2 B;  3P4R B;  3ODO A;  1YN5 A;  4P6V F;  4EJN A;  3X0W A;  1UPQ A;  1XCG A;  2WXM A;  1F9J A;  2WXH A;  3LDZ E;  2M38 A;  3D8E A;  4JQW C;  3W1S A;  4NAW B;  2V0G A;  3VUW A;  3AE6 B;  3V6E B;  2K8E A;  2XK5 A;  3A58 A;  2WYQ A;  1DOI A;  3PP2 A;  4QJ5 B;  2KTR B;  2H88 B;  2CU1 A;  3P42 A;  2ZW1 A;  1PGA A;  2IO2 B;  1WI1 A;  1JWU D;  3NWF A;  1ZDV A;  3AI5 A;  1V5O A;  4GMV A;  5KHQ A;  3ULC A;  4TQ0 A;  2D9X A;  1FHW A;  2WXI A;  2N7J A;  4EMO A;  4PQ0 A;  3QWZ B;  4ITK A;  2KFJ A;  2COF A;  2QDF A;  3AE3 B;  3GYP A;  1R4M B;  1TXD A;  3QA8 A;  2AEH A;  2Y5P A;  5DH9 B;  1GB4 A;  3A33 B;  4FHK A;  3JVZ X;  1EU3 A;  3GOE A;  2KXJ A;  1HB6 A;  1JWS D;  4DX8 A;  2VH2 A;  2UWQ A;  1P3R A;  1NYR A;  2QIE B;  3ETR A;  2J59 M;  1QOA A;  3DBS A;  4CQN A;  4K7W A;  4DK5 A;  4NAW A;  4DHJ D;  2FBW B;  4RFB A;  1I7H A;  4GNK B;  2WDQ B;  1R4M I;  3UIN B;  1AYF A;  1UNQ A;  1ZKH A;  2LOX A;  1K52 A;  2BGF A;  2DIK A;  1ZXH A;  3GE8 C;  2QKL A;  2HTH B;  2PIA A;  4RGT A;  1QOF A;  3AU5 A;  3H6N A;  1UF0 A;  2KUP A;  4TQ1 A;  3U2S C;  2JPH A;  3DPD A;  4A3P A;  2R82 A;  3ZNZ B;  2QEJ C;  1FFU A;  3EC8 A;  2OOB B;  4KGS A;  2LRU A;  3WAL A;  2CB8 A;  4HDQ A;  2N23 A;  1OQY A;  2LGX A;  4YSY B;  1BAK A;  4JK9 A;  3ZQ4 A;  4MDK E;  2LJI A;  1K53 A;  4KDL B;  4OVU A;  2ELB A;  2DYQ A;  1V1P B;  3IAS 1;  1CJE A;  1J19 A;  2AQ2 B;  3TEX A;  1STE A;  2DHI A;  3DCG A;  4N59 A;  4ZHP A;  2D3B A;  2YT0 A;  3DXD A;  4AJW A;  1Z87 A;  1PFJ A;  3VQI A;  2Z0O A;  3OAN A;  1BXT A;  2ZCC A;  1V86 A;  3SYX A;  3N1Z C;  5E6P A;  2MBQ A;  1UEF A;  2QJL A;  2L52 A;  2GUM A;  1WJU A;  2V4L A;  1BTN A;  2CRF A;  1MK7 B;  5FR3 A;  2KMM A;  4XWW A;  1QIL A;  3KVF B;  3HRD D;  1S1Q B;  1WY8 A;  4WH4 A;  3BVM A;  2ZPN A;  3JSV B;  4G50 A;  1UBI A;  3PEG A;  4QJ4 B;  2ZJD A;  1F2R I;  1GAQ B;  2RD0 A;  1WXV A;  1ZSQ A;  1EGX A;  1EWC A;  2Y5C A;  2KMC A;  2LHD A;  2DZK A;  2WXO A;  5FI0 A;  1DYN A;  2I5F A;  4DX9 0;  3Q8A A;  5DCN A;  4C00 A;  4A5K A;  2ZKM X;  4LNK A;  4IC7 B;  2IYB A;  3ZLZ A;  2K1F A;  1WGU A;  1XLP A;  3URY A;  3SFE B;  2X38 A;  2CHZ A;  2IBI B;  4E3C A;  2Y3A A;  3SBT A;  4N58 A;  5D3D A;  1J8C A;  1JRO A;  2LXC A;  3TFM A;  2L0T A;  3CWI A;  2NTS A;  2WXN A;  3DVG Y;  2LEK A;  4JKB A;  2O6V B;  3A9K B;  2I5C A;  3MC9 A;  4YL8 A;  2JF5 A;  5DPS A;  1QQG A;  2WNM A;  4KDI C;  1Q5W B;  5C3J B;  2KWV B;  1OMW A;  5J3T A;  1ZXI A;  4TUU A;  3B1L X;  2AL3 A;  2N4F A;  1KLV A;  2GS0 A;  2FCS A;  1XD3 B;  3AED B;  1LXD A;  5DPR A;  3A1Q B;  3KLS X;  2GMI C;  3ZXV A;  1WGH A;  2WGS A;  2PZ1 A;  1HB8 A;  5JZE B;  2M4N A;  2P0H A;  1DDW A;  1X86 A;  3M3J A;  3VVW B;  1D6E C;  1XLN A;  1UNR A;  2WXQ A;  3KUC B;  4YWG G;  4EZL A;  4WIP A;  2MBE A;  4ARI A;  2QCZ A;  2JWZ A;  2J0K A;  4YTM B;  3CSF A;  3ZTC A;  4IWO A;  2DYN A;  1JW9 D;  1OGW A;  2M56 B;  4MEL A;  4EEW A;  4WAF A;  3EPY A;  1XF5 L;  4URK A;  2AL6 A;  3QWM A;  1SF0 A;  3MHZ A;  5LNK 1;  4JPS A;  4WUR A;  2JUO A;  1KFY B;  3NWD A;  4QAY A;  4EFO A;  1YIW A;  2D5G A;  1ESF A;  1YJJ A;  4OZB A;  4MGK E;  5KQ4 A;  2Z8L A;  3EFC A;  1TYG B;  4YTP B;  1E8X A;  2LMC A;  1XR0 B;  3L08 A;  1WGK A;  1Z2M A;  1AQC A;  4C0A A;  3E9P A;  1XXG A;  1WXA A;  2DWQ A;  4CO7 A;  1VBH A;  3E9S A;  2J0M A;  3IAM 1;  1N3H A;  5KQ1 A;  3TMP B;  2JZP A;  3LXF A;  3V05 A;  4W9K A;  4NQK E;  3TEZ A;  4XX5 A;  3HSA A;  2KN4 A;  2DYM A;  3OJ4 B;  3PHX B;  1ZUD 2;  2PJH A;  4OZC A;  3SBG A;  2NTT A;  1DOY A;  2LUL A;  1K5D B;  4AUQ C;  3J9C A;  3V5W A;  3Q8E A;  1ZW7 A;  3A9J A;  3KQ4 A;  3PHW B;  3FLV A;  2GCJ A;  3NG0 A;  2N7E A;  5J3Q A;  1HBK A;  1TGZ B;  1SIF A;  3ZJU A;  2ZZP B;  3KW5 B;  1PYW D;  2BT6 A;  1WZ3 A;  1P98 A;  2YF0 A;  3Q8B A;  4ILJ A;  2XBB C;  4FN2 A;  4II3 B;  1PFD A;  2WLB A;  1E90 A;  3D32 A;  3AH7 A;  2Z13 A;  4WAA A;  2PEA A;  4DHZ E;  3NRZ A;  2PTL A;  4NZL B;  4PS8 A;  4YTN B;  1WG7 A;  3F5R A;  3KZ1 A;  1PQS A;  1IBX A;  2G4S A;  2IPK D;  4AP4 C;  1XOD A;  4C7Z A;  3DVN U;  3MTN B;  2KR0 A;  4NQL B;  1RRB A;  4TV3 A;  1WXM A;  3TL5 A;  2EJ8 A;  1U5G A;  1WGY A;  3AB5 A;  1FM0 D;  3VH3 B;  4DHJ B;  3CMM B;  2CS4 A;  3QC8 B;  2IO0 B;  1EUV B;  3N30 A;  4ZRP A;  4W9H A;  1OEY J;  1MK9 B;  4NAM A;  3RNC C;  2DX5 B;  2K9X A;  4LNO A;  2RMM A;  2IY0 B;  1C76 A;  2C7N B;  1ZYI A;  2I38 A;  1L6V A;  2JZ3 B;  3HHM A;  2CHX A;  2L2I A;  1MG8 A;  1NBF C;  4HWI B;  2DHK A;  2JZZ A;  4MJS A;  2NVU I;  4BBK A;  1I4P A;  4LJO B;  4ILH A;  4DBB A;  2QSD A;  4A55 A;  2CKH B;  3DBR B;  2GBM A;  4NJ7 A;  3AE4 B;  3B08 A;  2NBW B;  2WH5 A;  2PPH A;  3S2A A;  1E6E B;  4EKU A;  1E8W A;  1WYW B;  2KYW A;  1VR9 A;  1YN4 A;  2BTE A;  4KAX B;  4ILG B;  1YOV B;  3DBR I;  1BT0 A;  3PPA A;  2D9V A;  3AM9 A;  1UWX A;  4XYC A;  5KHO A;  1J0W A;  4MY6 A;  1QLB B;  4C4V A;  1VCB A;  4L1R A;  2D9W A;  1UEL A;  2KQ7 A;  1JDE A;  3ZRF A;  2BB5 A;  1ST7 A;  2KDI A;  3ZO5 B;  3P4P B;  4ICV A;  5D3V A;  1OTR B;  3P63 A;  3BYT B;  2WXG A;  1MFW A;  1G6J A;  3IVF A;  2N0S B;  1V89 A;  1XCQ L;  4M02 A;  1LM8 B;  1P0R A;  4HCN B;  1TQZ A;  1WJ6 A;  4KHB A;  2N7D A;  2N9P C;  1KZ7 A;  3RMK C;  1XLQ A;  2WXJ A;  2PMV A;  5FR6 A;  2KAJ A;  1FNW A;  5J17 A;  4JKF A;  1OY2 A;  2CJN A;  1KI1 B;  2LOZ A;  3OAW A;  4M8N A;  1HEZ E;  5AZG A;  4KSL C;  4Y94 A;  1U5F A;  3I63 C;  2WQY B;  5D6J B;  3UIP B;  2KUQ A;  5C1Z A;  1Q1O A;  5BO4 B;  2H7D A;  2AWT A;  2D3C A;  3PRM B;  2R2Q A;  3PRP B;  1PUT A;  4L2Y A;  1A5R A;  1JAL A;  2RQ1 A;  1WVH A;  4LDT D;  4ZDV A;  1C77 A;  4L23 A;  4MGZ E;  2J7Q B;  2DAJ A;  4WWM A;  1IUE A;  1WJN A;  4FXC A;  4ZRK A;  4WWP A;  1Y56 A;  1NYQ A;  5D3Y A;  1FNV A;  4M8M A;  2P0F A;  3LJU X;  3ZGZ A;  4P1C C;  4NJ6 A;  5JHB A;  4G0N B;  4E71 A;  2MJE A;  3AEE B;  1D4B A;  4LTU A;  3O13 A;  1NEK B;  4PNK A;  3NZ3 A;  5BMH A;  1Q67 A;  5HE1 A;  2R09 A;  3ZVR A;  5JHA A;  2RDG A;  3RUI B;  3E66 A;  2BYE A;  5BYS A;  3T9L A;  2DHZ A;  3Q6B A;  1T0S C;  3HM3 A;  1MHX A;  3NZU A;  2LZ6 A;  2JP2 A;  3BK2 A;  1WRD B;  3RZF A;  2G4D B;  1V81 A;  3HIZ A;  2WXP A;  2YSZ A;  2W2X D;  2SEB D;  4QJ3 B;  2V3S A;  3OWE B;  3DXC A;  4C56 C;  5D94 A;  2K25 A;  4A6K A;  2BQQ A;  3DBH B;  2C7H A;  1DYQ A;  2G45 B;  1K51 A;  2MCN B;  2XEW A;  1TKE A;  1WM3 A;  3ALB A;  2VRW B;  3VAW A;  4B0M A;  4TMA B;  3AEG B;  3L0W B;  2IND C;  3FP5 A;  3DBH I;  3PG7 A;  1C78 A;  2R2O A;  2V3N A;  4K1R B;  1WJ4 A;  3WIM A;  3D8F A;  5JH5 C;  3KYC D;  3H7S A;  5G55 A;  1WGQ A;  4OVV A;  1HXY D;  2WU5 B;  2MBO A;  1RJ2 A;  1NI2 A;  2I1J A;  3AU4 A;  4W9I A;  5HG2 A;  1EVH A;  4BAX A;  1S3S G;  2YS5 A;  2NMQ A;  1J7C A;  2EC1 A;  1PGX A;  1ROE A;  1T5X D;  2H89 B;  4FA6 A;  3ZNG C;  2DZJ A;  4A9A A;  3N7C A;  2FJL A;  3PSE B;  4IFS A;  2ON8 A;  2ZPY A;  3DQV A;  3QHT A;  1V80 A;  1GG3 A;  2INN E;  2NBV B;  1AN8 A;  3PV1 A;  4TSS A;  3TJP A;  1DBH A;  2DBY A;  4E74 A;  2XK5 B;  2FJ9 A;  2ZW0 A;  5EE9 A;  4IM0 A;  2Q5W D;  4ANW A;  3ZNI D;  4HKQ A;  1OEY A;  4WWO A;  5EE3 A;  4BKS D;  2CY4 A;  5CLQ B;  2DKP A;  1FXI A;  3AEC B;  1WX8 A;  3MC8 A;  4EZJ A;  3WAP A;  1ZM0 A;  2LAS A;  3FM8 C;  2HJ1 A;  4F8C B;  1ET6 A;  2KHW B;  1T0Y A;  3N20 C;  3TIX A;  1YX6 B;  1AAR A;  3A4S C;  1FCC C;  1XEE A;  4OW0 A;  3W1Y A;  4MH8 A;  3N32 A;  3HUI A;  2NBV A;  1VBG A;  1E9M A;  2LVO A;  1TTN A;  3V6C B;  3CXB B;  4F7U P;  2M1M A;  5FKA C;  3ZRC A;  4GLS C;  2YS1 A;  4BBN C;  4CHK A;  3ZJV A;  2OJW A;  2WXK A;  4P16 A;  2JRH A;  5LLI A;  4RGO S;  3W5V B;  4ZRJ A;  1WX7 A;  3CIK A;  2YS3 A;  3PSC A;  1E10 A;  4KSK C;  4HB3 B;  2ZVN A;  2N9X A;  1SIJ A;  3E56 A;  5JHG A;  3KWL A;  5MPO A;  1SJE D;  2K8B A;  1LW3 A;  3AUL A;  1HZ6 A;  1E0Z A;  1SEB D;  1SE3 A;  3RYT A;  2ABD A;  4RCO A;  3AEA B;  4XDC A;  1MAI A;  1YNT E;  5AUI A;  3SO6 A;  5IN7 A;  1MPE A;  5LG4 B;  3PRZ A;  2KX3 A;  2A5U A;  1FB8 A;  1W1D A;  1NTV A;  5JP4 A;  1WF9 A;  3A4R A;  2E6X A;  1JWA D;  1XT9 B;  3Q2A C;  4KZC A;  2B76 B;  3VR9 B;  2WDR B;  2RPQ A;  1RRP B;  1QKZ A;  1P1A A;  3QBV B;  1WXQ A;  2DA0 A;  3MJ5 A;  2MBH A;  2QMT A;  2KDF B;  1SXT A;  2LKO A;  5D27 A;  3QQ8 B;  2Y7B A;  2L1C A;  4XC2 A;  2J52 A;  5BMG A;  3ML9 A;  4B6H A;  2IYD B;  2RLO A;  3BYY B;  3MP9 A;  3N1X C;  4GOC A;  2L0F A;  2G1E A;  4MM3 A;  4B6W A;  1K50 A;  4US9 A;  3ZJT A;  2D3G A;  2GBK A;  3VH4 B;  4A90 A;  1FGY A;  4W9L A;  2ZNV C;  1J7A A;  1WXS A;  1E8Y A;  3GP7 A;  4HSI A;  3EHV A;  1SE2 A;  2D07 B;  1EF1 A;  3BY4 B;  5C79 A;  2K6D B;  1W1G A;  2AYO B;  4JE3 B;  3TO1 A;  2GOW A;  4KVG B;  2ASQ A;  1YMH E;  1WH3 A;  2LYD A;  1I4G A;  1BUI C;  2P0D A;  1B9R A;  1J0G A;  4LDT B;  2KQS A;  5M4Y B;  3R7R A;  4JKE A;  3ZTD A;  1V6E A;  4YON A;  5I2M A;  4HPP A;  5BMI A;  1VD2 A;  3IT6 B;  2K49 A;  4PS3 A;  4XZ4 A;  2KVZ A;  1V88 A;  3AV8 A;  3Q3O C;  4WVF B;  3RUL A;  3UGB B;  3NVZ A;  4GDL B;  4KGR A;  2K3U A;  3RPF C;  4KIK A;  3MHS D;  1GOZ A;  5TR5 A;  1D3Z A;  1TKY A;  1T0R C;  3M1I B;  3HIE A;  4K81 A;  2UZR A;  3P6A A;  2DEN B;  4S17 A;  3EA6 A;  1FEH A;  2YEP B;  2WX0 A;  4R3D A;  2IDY A;  5IJM A;  5E6J A;  3ZDM C;  4OSN A;  1KTK A;  3NOB A;  2KX0 A;  2LBB A;  5EDS A;  4HB2 B;  3TBL D;  3VTW A;  2W9N A;  1WWT A;  3U52 E;  2KOX A;  1V97 A;  1E7V A;  1U5E A;  2GB1 A;  2G3Q B;  5HE2 A;  2AQ1 B;  2J53 A;  2RPV A;  5C16 A;  5H8Y E;  4D6W A;  3K9P B;  3SR6 A;  2D4Q A;  3AEB B;  3APD A;  2C60 A;  4GDL A;  2CAY A;  1AW7 A;  2L32 A;  3I57 A;  2LG1 A;  5FK9 C;  2Z0D B;  4DXG A;  1WX9 A;  2JXX A;  4HAX B;  4A6H A;  2DKQ A;  3RNB C;  1L5P A;  1QQR A;  1OQN A;  3MJW A;  2WDT B;  4J6I A;  1RM6 C;  5IP4 D;  1TKG A;  4PK1 A;  4F1S A;  2LWP A;  4DXF A;  1WSP A;  2LGI A;  4PYZ A;  4A6F A;  1U27 A;  2Z59 B;  1ACC A;  3NS1 A;  3R66 C;  1EO6 A;  3GYO A;  2MKR A;  3H9D A;  1I4X A;  4ZRI A;  2FCN A;  1BTK A;  3HM6 X;  2L1A A;  4HAW B;  1L4Z B;  3PLV A;  1QOB A;  1M7E A;  2K5P A;  1Y19 B;  2JSV X;  3BVZ A;  1TS5 A;  2I1K A;  3NWA A;  3WAO A;  3F0W A;  4W9F A;  1CQV A;  2VRR B;  5E6N A;  2R0D A;  1L7Y A;  3FIL B;  4JK7 A;  4K3B A;  4YT0 B;  4F7G A;  2BS3 B;  1WM2 A;  1FO4 A;  5LOP B;  3A9J B;  4IM2 A;  3TUO A;  2MQJ A;  1C3T A;  1NTY A;  3KYD D;  2V76 A;  3HK0 A;  4FJV B;  3G9W A;  4Q2J A;  2Z59 A;  4CHM A;  3EGR A;  4OZA A;  3TSS A;  3SNH A;  1E5W A;  4HPL B;  2KJ6 A;  4K7S A;  1MKE A;  2FDQ A;  2I2Y A;  1IBX B;  1WR6 E;  3P4S B;  1RFK A;  2CQU A;  3U7Z A;  3NS8 A;  3ONS A;  3QX1 A;  3AE1 B;  3P4Q B;  3GE3 C;  3VR8 B;  3FIL A;  4DBG A;  4BKS A;  4OT1 A;  1KLG D;  2CHW A;  3FEH A;  1ZOY B;  3D8D A;  4CSQ A;  1B55 A;  5HE0 A;  1RLF A;  5EE0 A;  4MJS B;  2CR5 A;  4IAP A;  3R8B A;  1TJ6 A;  2RGF A;  2L00 B;  5AZH A;  3R7Q A;  2QC8 A;  4MSM B;  4GMX B;  1JWM D;  4HHV A;  4ARC A;  2K22 A;  4A20 A;  1TS4 A;  1FRD A;  3CF6 E;  1ZPS A;  3O65 B;  2EMS A;  1YJ1 A;  5G5H A;  4GSW A;  4IG7 B;  5J18 A;  2COC A;  3Q3N C;  1P7F A;  5G2N A;  2PKO A;  2PE6 B;  3MDB C;  3NSU A;  2BKR B;  4TKN A;  2NMB A;  3U4E G;  1X05 A;  2MWN B;  4C4V B;  2JX5 A;  2FID A;  3FC4 A;  1H4R A;  1IGD A;  5AZF A;  1V5T A;  3VTU A;  4JKD A;  4A6Q A;  1WJM A;  2HD5 B;  5CHV C;  4A8X C;  4M00 A;  1N6Z A;  4MT5 A;  1SE9 A;  4FLH A;  3BVG A;  2AQ3 B;  2HJ8 A;  3BK1 A;  2K0P A;  4KHB B;  1MG4 A;  3PZ8 A;  1U2B A;  2DZI A;  3V61 A;  3UQB A;  4HB0 B;  2UYZ B;  4FHJ A;  4JWU C;  2RR9 A;  3TEY A;  1V8C A;  2ZCB A;  1GUA B;  3OJ3 A;  4OHJ A;  2JYE A;  1HTQ A;  1K8R B;  3O96 A;  2N9E B;  1PLS A;  4LCD E;  2IO3 B;  4JLC A;  5CLL B;  2HE7 A;  1WE7 A;  4KKI A;  1GPX A;  3M62 B;  5GXG B;  5DI9 B;  4K2P A;  4WJO A;  4KHA A;  4W9J A;  4GPT B;  2LRW A;  4LLG M;  1EF5 A;  3I9V 1;  5IO9 A;  5C2T B;  1FOE A;  1W1H A;  4GZU A;  3C0R B;  1PMS A;  4HDO A;  2LHE A;  3MFG A;  3BJI A;  5J3Y A;  3KWV A;  1ET9 A;  2L83 A;  4HVB A;  4HJG E;  3Q3F A;  1M7R A;  2ROZ B;  5C5B B;  3ZDT A;  2PVG C;  2BYV E;  3ODX A;  1XLO A;  2KCJ A;  1VRA B;  4WJN A;  2Z0E B;  1PGB A;  1QZE A;  3ENB A;  5HE3 A;  1XKE A;  2KFK A;  3DOW A;  1X1F A;  4YSX B;  2D2Q A;  1JRU A;  2W3R A;  1FHO A;  2GBJ A;  3B9J A;  3ECI A;  4GGQ A;  1C4A A;  3ZUN A;  1KF6 B;  2MHJ A;  1DDM A;  3KSY A;  4HRS A;  1FXA A;  2KGX B;  2MP2 B;  1A70 A;  3VDZ A;  1I35 A;  4S0R A;  1Z5S B;  2R61 A;  3BII D;  1QC6 A;  4G11 A;  1X1G A;  1MPH A;  4O1N A;  4QXA B;  1YQ3 B;  5IAA C;  5C5B A;  4ZOH C;  2PW9 A;  5IKC M;  3UF8 A;  1Y5O A;  4HAZ B;  3FVC A;  4I6N B;  2BF8 B;  4GN1 A;  2V3P A;  4NPN A;  1DGJ A;  1SGH A;  3H1U A;  1FMA D;  1WYG A;  2PVO D;  1P5T A;  1LGR A;  3IBE A;  4DHZ B;  2LGS A;  4GDK A;  3TW1 A;  4IUM B;  2LFI A;  3T3O A;  5GMV A;  3B2F A;  5CTR C;  3HW2 B;  1FRR A;  3PTF C;  2CU3 A;  3Q3J A;  2X18 A;  2KN5 A;  4L6E A;  4HLE A;  3I5J C;  3JYU A;  1EWY C;  3KRW A;  2MP2 A;  1YQB A;  3U30 A;  3VHT C;  4NY0 A;  4IM3 A;  3VRB B;  3NZS A;  2BS4 B;  1UWM A;  5CX3 A;  1MI1 A;  2FUH B; 
#chains in the Genus database with same CATH homology
 2K8H A;  1H10 A;  2W2W A;  5EFX A;  2IY1 B;  2K39 A;  3L16 A;  2RUK B;  2GCL A;  2L76 A;  2NCN A;  4GIV A;  1WGD A;  3P7Z A;  1CMX B;  1V2Y A;  4HPM B;  4EOY A;  4WJP A;  5DPT A;  1FGZ A;  3PZD A;  2N1W A;  4B95 A;  1FHX A;  2D10 A;  3B0A A;  3N3K B;  4IWQ A;  3KUZ A;  2FCQ A;  2K6Q A;  1TBE A;  2MLB A;  5FI1 A;  5C23 A;  3A8Q A;  5KCV A;  3SDL C;  5DHF B;  1UD7 A;  1WMH B;  2EMT A;  3RZW C;  5E6O A;  3EFU A;  2LJ5 A;  4JKH A;  1I2H A;  2KDB A;  3A98 B;  1XX0 A;  2C7M B;  1X11 A;  2MRP A;  5C6R A;  2YVC A;  3SHQ A;  1SHC A;  1E8Z A;  2KNB A;  3ML8 A;  3VFK A;  4HAY B;  2M0X A;  2J0J A;  3V60 A;  1UNP A;  3ZVV A;  2K8C A;  4DXA B;  1WMH A;  5DPW A;  4AOF A;  3P2B A;  4IW0 A;  4WSF A;  2P8V A;  2KC2 A;  1C1Y B;  4W9E A;  3FSS A;  1H8C A;  3IFW B;  3X23 A;  2KJR A;  2LGY A;  1V9J A;  2KMA A;  3ODW A;  1KZG A;  1KC7 A;  4ANV A;  4F7Z A;  2KVR A;  3T06 A;  2JRI B;  3ZIM A;  5JLJ B;  4JL9 A;  1GJZ A;  3DBL I;  4JK8 A;  2MFQ A;  5JVL A;  2M8S A;  3ENE A;  2A4Z A;  2WWZ A;  3RCZ A;  4Z2M B;  1UH6 A;  4D0N B;  1UGM A;  3OLM D;  2ZEQ A;  1V5M A;  1WIA A;  3KRX A;  3UQA A;  3U8Z A;  3VUY A;  4JGH B;  4HXD A;  1FXT B;  1WFY A;  4KIK B;  2KTR A;  5LXH A;  1RAX A;  2D9Y A;  2EKE C;  2KZR A;  1V61 A;  5DHA B;  1ZC3 B;  4BKG A;  2C9W B;  1ISN A;  2GBR A;  1RFA A;  2IFS A;  2D9Z A;  2DN6 A;  5LON B;  1IPG A;  1KBL A;  3PLU A;  2K2U A;  4FBJ B;  4MEM A;  1EAZ A;  4ANX A;  2JY6 A;  3DDC B;  3HQC A;  4WJ7 A;  2HRJ A;  1YX5 B;  1LB1 A;  4MK0 A;  2Y8F A;  4HB4 B;  2ROV A;  2D11 A;  2HTH A;  5D7G A;  3QIJ A;  4WQO B;  3A8P A;  4W9C A;  2DYO A;  3R3M A;  4HK2 A;  4W9D A;  1I42 A;  3AXC A;  3WA0 A;  2COA A;  4K2O A;  3TVV A;  1MIZ B;  5J2R A;  5D3W A;  2YLM A;  3H7P B;  4BVU C;  1UZX B;  2FIF A;  1XQQ A;  4A6F B;  2KJH B;  4GU2 A;  2M14 A;  2JT4 B;  5GOW B;  4KZ0 A;  4JKG B;  4HAU B;  1HE8 A;  3T8M A;  2MX2 A;  2LI5 A;  3KH0 A;  1KM7 A;  4DDG D;  3WAM A;  1KOT A;  1UBQ A;  3E9O A;  2OQB A;  3WYF B;  3DVG X;  1P6S A;  2OTX A;  3APF A;  2KAN A;  2CY5 A;  4P7I A;  3H7P A;  3ZW3 A;  3JSV A;  3PRE A;  3ULB A;  2BYF A;  2COD A;  1LFD A;  1NTI A;  1I7A A;  2NBU A;  1Y8R C;  3GZN I;  5IA7 A;  2BCJ A;  3U7D A;  4JKG A;  2LUE A;  2RNR B;  4PYU A;  1NDD A;  4ICU A;  2KLG A;  4MGY E;  4ZYN A;  3M63 B;  1DRO A;  2KLC A;  4MGI E;  2N0Y A;  2KDE B;  4K17 A;  2BWF A;  1R4N I;  4X57 B;  4GB9 A;  4HAT B;  3QK0 A;  2DFK A;  2O6V A;  3A9K A;  4FJZ A;  1IYF A;  1U29 A;  4W9G A;  2L7R A;  4KHO A;  2L8J A;  2Z0P A;  3QAR A;  1WR1 A;  3SU8 X;  3L17 A;  2Q13 A;  2KK8 A;  4DWF A;  3VTV A;  5CHF A;  2ZNV B;  2MA9 B;  3A1Q A;  4BOZ B;  2H7E A;  3M95 A;  1TZ1 A;  3NY5 A;  2GBN A;  4HCP B;  3QAQ A;  2FNJ B;  2G35 A;  2RSG A;  4ASW C;  3RCP A;  3VUX A;  2ELA A;  2DHJ A;  5LXI B;  4XWX A;  2COP A;  4A3O A;  2C5L C;  2GJY A;  5L81 A;  4WWN A;  4FUL A;  2V1Y A;  2UVM A;  1WGR A;  3ZKJ C;  2BWE S;  3UZT A;  3IHP C;  2KWU B;  2MW5 A;  3PT2 B;  1IRS A;  4EZK A;  4B9K A;  1P3Q U;  4BOS C;  2NZ8 B;  4RM9 A;  3NHE B;  2KC1 A;  4M0W B;  3K9O B;  3ML4 A;  1K5G B;  4ANU A;  4JKA A;  2QKM A;  3VOQ A;  3ZNH B;  2K00 A;  2KO3 A;  4H8S A;  3PVL A;  1XD4 A;  1IP9 A;  1ZC4 B;  1ZVR A;  5CHW A;  3QCA A;  3QJZ A;  2DTC A;  1L2N A;  4FJY A;  2DYB A;  1M94 A;  4HAV B;  4Z2N A;  4MT7 A;  2DX1 A;  3IG3 A;  2KFK B;  2KTF A;  2ADZ A;  4F7H A;  2K2J A;  1Q0W B;  1DIK A;  3APC A;  3W1S C;  4N9F 4;  1ACA A;  4HJK A;  5D3X A;  2DX5 A;  1V5U A;  2FAZ A;  4BFR A;  2BKF A;  2IO1 B;  3PGE A;  2YT1 A;  4EUT A;  4IWP A;  2MWS B;  1FAO A;  2LGD A;  4JIO U;  3TCA A;  4I6P A;  3E9L A;  3DVN V;  3PS6 A;  4GDK B;  1WJ1 A;  4BKT A;  2RGN B;  1GC7 A;  3KY9 A;  2BPS A;  2MSE D;  3RT3 B;  4I6L B;  2JVC A;  3L10 B;  4BBN F;  1WGG A;  1DDV A;  3JW0 X;  2RVB B;  3AJ4 A;  2DLW A;  4GXB A;  4MH0 E;  1GGO A;  3WAN A;  2LVP A;  4MSQ B;  4CYE A;  3L13 A;  2WX1 A;  2NPT B;  2YRY A;  2ZVO A;  1U4A A;  1E7U A;  2VSZ A;  1LQB A;  4IOY X;  3PVU A;  1GC6 A;  2XQN M;  1ZGU B;  2Y8G A;  2LXA A;  4TYZ A;  5L83 A;  4NNJ B;  4KV2 A;  2L05 A;  2OJR A;  3UIO B;  3V62 A;  2KD0 A;  1NVL A;  4G3X B;  2M17 A;  3DXE A;  2PE9 A;  3SUZ A;  3L54 A;  2X0S A;  4DDI D;  2NPT A;  3SV1 A;  2LVQ A;  5AEK B;  3VXW A;  4PS7 A;  2O6V D;  1V49 A;  2RSU A;  2IZV B;  4NSW A;  4CHJ A;  2O2V B;  1NU2 A;  3BIN A;  2MBB B;  3I3T B;  1WE6 A;  4FAD A;  2VKI A;  1UPR A;  5L95 C;  5HKH A;  4RM8 A;  2Z0Q A;  4AWJ A;  3CST A;  1BWN A;  1AWE A;  2REX A;  2Y5B B;  2L3Z A;  4JKC A;  5JHH A;  1YD8 U;  1WI0 A;  2KKC A;  1GNU A;  2UZS A;  1KJT A;  3KUD B;  5D2M B;  3LJ3 A;  3MPX A;  3VIA A;  2O2V A;  2KWC A;  4AJY B;  2E2X A;  1WZ0 A;  2QHO A;  1U5D A;  2W2X C;  2NR2 A;  1MIX A;  3SD5 A;  2FCM A;  3RD2 A;  2LD9 A;  1X1M A;  1P9D U;  2N1V A;  2NS5 A;  3EEC A;  2DAF A;  2MDX A;  1V5P A;  4K7U A;  3PVW A;  4RMA A;  2B3A A;  4WJQ A;  5DIF B;  2DZM A;  4LJP B;  4II2 B;  3ODO A;  4EJN A;  3X0W A;  1UPQ A;  1XCG A;  1F9J A;  3LDZ E;  4JQW C;  2M38 A;  3D8E A;  3W1S A;  4NAW B;  3VUW A;  3V6E B;  2XK5 A;  2WYQ A;  3PP2 A;  2KTR B;  2CU1 A;  2IO2 B;  1WI1 A;  3AI5 A;  1V5O A;  4GMV A;  5KHQ A;  3ULC A;  4TQ0 A;  2D9X A;  1FHW A;  3QWZ B;  4EMO A;  4PQ0 A;  2KFJ A;  2COF A;  3GYP A;  1TXD A;  3QA8 A;  2AEH A;  5DH9 B;  3A33 B;  4FHK A;  3JVZ X;  3GOE A;  2KXJ A;  1HB6 A;  4DX8 A;  2UWQ A;  1P3R A;  2J59 M;  3DBS A;  4K7W A;  4DK5 A;  4NAW A;  4DHJ D;  1R4M I;  3UIN B;  1UNQ A;  1ZKH A;  2LOX A;  2BGF A;  2DIK A;  2QKL A;  2HTH B;  3AU5 A;  3H6N A;  2KUP A;  4TQ1 A;  4A3P A;  2JPH A;  3DPD A;  2R82 A;  3ZNZ B;  3EC8 A;  2OOB B;  2LRU A;  3WAL A;  2CB8 A;  4HDQ A;  2N23 A;  1OQY A;  2LGX A;  1BAK A;  4JK9 A;  4MDK E;  4KDL B;  4OVU A;  2ELB A;  2DYQ A;  1J19 A;  2DHI A;  3DCG A;  2YT0 A;  3DXD A;  4AJW A;  1Z87 A;  1PFJ A;  3VQI A;  2Z0O A;  3OAN A;  2ZCC A;  1V86 A;  3SYX A;  5E6P A;  2MBQ A;  1UEF A;  1WJU A;  2V4L A;  1BTN A;  2CRF A;  1MK7 B;  3KVF B;  1S1Q B;  1WY8 A;  2ZPN A;  3JSV B;  4G50 A;  1UBI A;  3PEG A;  2ZJD A;  2RD0 A;  1WXV A;  1ZSQ A;  1EGX A;  2KMC A;  2DZK A;  5FI0 A;  1DYN A;  2I5F A;  4DX9 0;  5DCN A;  4A5K A;  4IC7 B;  2IYB A;  3ZLZ A;  2K1F A;  1WGU A;  2CHZ A;  2IBI B;  4E3C A;  3SBT A;  1J8C A;  2LXC A;  3TFM A;  2L0T A;  3DVG Y;  2O6V B;  4JKB A;  3A9K B;  2I5C A;  4YL8 A;  2JF5 A;  5DPS A;  1QQG A;  4KDI C;  1Q5W B;  2KWV B;  1OMW A;  5J3T A;  4TUU A;  3B1L X;  2AL3 A;  2N4F A;  1KLV A;  2GS0 A;  2FCS A;  1XD3 B;  1LXD A;  5DPR A;  3A1Q B;  2GMI C;  1WGH A;  2PZ1 A;  1HB8 A;  5JZE B;  2M4N A;  2P0H A;  1DDW A;  1X86 A;  3M3J A;  3VVW B;  1UNR A;  3KUC B;  4EZL A;  2MBE A;  2JWZ A;  2J0K A;  3CSF A;  3ZTC A;  4IWO A;  2DYN A;  4MEL A;  1OGW A;  4EEW A;  3EPY A;  4URK A;  2AL6 A;  3QWM A;  2JUO A;  4EFO A;  1YIW A;  4MGK E;  5KQ4 A;  1E8X A;  1XR0 B;  3L08 A;  1Z2M A;  1AQC A;  4C0A A;  3E9P A;  1WXA A;  4CO7 A;  1VBH A;  2J0M A;  1N3H A;  5KQ1 A;  3TMP B;  4W9K A;  4NQK E;  4XX5 A;  2DYM A;  3OJ4 B;  3PHX B;  2PJH A;  3SBG A;  2LUL A;  1K5D B;  4AUQ C;  3V5W A;  1ZW7 A;  3A9J A;  3PHW B;  3FLV A;  2GCJ A;  2N7E A;  5J3Q A;  1HBK A;  1TGZ B;  1SIF A;  2ZZP B;  3KW5 B;  1WZ3 A;  1P98 A;  2YF0 A;  4ILJ A;  2XBB C;  4FN2 A;  4II3 B;  1E90 A;  3D32 A;  4WAA A;  2PEA A;  4DHZ E;  4PS8 A;  1WG7 A;  3F5R A;  3KZ1 A;  1PQS A;  2G4S A;  4AP4 C;  1XOD A;  3DVN U;  3MTN B;  4NQL B;  1RRB A;  4TV3 A;  1WXM A;  3TL5 A;  2EJ8 A;  1U5G A;  1WGY A;  3VH3 B;  4DHJ B;  3CMM B;  2CS4 A;  3QC8 B;  2IO0 B;  1EUV B;  3N30 A;  4W9H A;  1OEY J;  1MK9 B;  2DX5 B;  2IY0 B;  2C7N B;  3HHM A;  2JZ3 B;  2CHX A;  2L2I A;  1MG8 A;  1NBF C;  4HWI B;  2DHK A;  2JZZ A;  4MJS A;  2NVU I;  4BBK A;  4LJO B;  4ILH A;  4DBB A;  2CKH B;  2GBM A;  4NJ7 A;  3B08 A;  3S2A A;  2WH5 A;  2NBW B;  2PPH A;  4EKU A;  1E8W A;  1WYW B;  4KAX B;  4ILG B;  3DBR I;  1BT0 A;  3PPA A;  2D9V A;  5KHO A;  1J0W A;  4MY6 A;  1VCB A;  2D9W A;  1UEL A;  2KQ7 A;  1JDE A;  3ZRF A;  1ST7 A;  2KDI A;  3ZO5 B;  4ICV A;  5D3V A;  1OTR B;  1G6J A;  3IVF A;  1V89 A;  1LM8 B;  1P0R A;  4HCN B;  1TQZ A;  1WJ6 A;  2N7D A;  2N9P C;  1KZ7 A;  5FR6 A;  5J17 A;  4JKF A;  1OY2 A;  1KI1 B;  2LOZ A;  3OAW A;  4M8N A;  5AZG A;  4KSL C;  4Y94 A;  1U5F A;  5D6J B;  3UIP B;  5C1Z A;  1Q1O A;  5BO4 B;  2H7D A;  2AWT A;  3PRM B;  2R2Q A;  3PRP B;  1A5R A;  2RQ1 A;  1WVH A;  4LDT D;  4ZDV A;  4MGZ E;  2J7Q B;  2DAJ A;  1WJN A;  4ZRK A;  4WWP A;  5D3Y A;  4M8M A;  2P0F A;  3LJU X;  4NJ6 A;  5JHB A;  4G0N B;  4E71 A;  4PNK A;  1Q67 A;  5HE1 A;  2R09 A;  3ZVR A;  5JHA A;  3RUI B;  3E66 A;  2BYE A;  3T9L A;  2DHZ A;  3HM3 A;  3NZU A;  2LZ6 A;  2JP2 A;  1WRD B;  3RZF A;  2G4D B;  1V81 A;  3HIZ A;  2YSZ A;  2W2X D;  2V3S A;  3DXC A;  5D94 A;  2K25 A;  4A6K A;  2C7H A;  2G45 B;  2MCN B;  2XEW A;  1WM3 A;  3ALB A;  2VRW B;  3VAW A;  3L0W B;  3FP5 A;  3DBH I;  3PG7 A;  2R2O A;  4K1R B;  1WJ4 A;  3WIM A;  3D8F A;  5JH5 C;  3KYC D;  3H7S A;  5G55 A;  1WGQ A;  4OVV A;  2MBO A;  1RJ2 A;  1NI2 A;  2I1J A;  3AU4 A;  4W9I A;  1EVH A;  1S3S G;  2YS5 A;  2EC1 A;  4FA6 A;  3ZNG C;  2DZJ A;  3N7C A;  2FJL A;  3PSE B;  4IFS A;  3QHT A;  2ZPY A;  3DQV A;  1V80 A;  1GG3 A;  2NBV B;  3PV1 A;  3TJP A;  1DBH A;  4E74 A;  2XK5 B;  2FJ9 A;  4IM0 A;  4ANW A;  3ZNI D;  1OEY A;  4WWO A;  4BKS D;  2CY4 A;  5CLQ B;  2DKP A;  1WX8 A;  4EZJ A;  3WAP A;  1ZM0 A;  2LAS A;  3FM8 C;  4F8C B;  2KHW B;  1T0Y A;  3TIX A;  1YX6 B;  1AAR A;  3A4S C;  3W1Y A;  3N32 A;  1VBG A;  2LVO A;  1TTN A;  3V6C B;  3CXB B;  4F7U P;  2M1M A;  3ZRC A;  4BBN C;  4CHK A;  2YS1 A;  2JRH A;  5LLI A;  4ZRJ A;  1WX7 A;  3CIK A;  2YS3 A;  3PSC A;  4KSK C;  4HB3 B;  2ZVN A;  2N9X A;  5JHG A;  2K8B A;  1LW3 A;  3AUL A;  3RYT A;  2ABD A;  1MAI A;  3SO6 A;  3PRZ A;  2KX3 A;  2A5U A;  1FB8 A;  1W1D A;  1NTV A;  5JP4 A;  1WF9 A;  3A4R A;  1XT9 B;  4KZC A;  2RPQ A;  1RRP B;  1P1A A;  3QBV B;  2DA0 A;  2MBH A;  2KDF B;  2LKO A;  5D27 A;  3QQ8 B;  2Y7B A;  2L1C A;  4XC2 A;  3ML9 A;  4B6H A;  2IYD B;  2RLO A;  4GOC A;  2L0F A;  4MM3 A;  4B6W A;  2D3G A;  2GBK A;  3VH4 B;  1FGY A;  4W9L A;  2ZNV C;  1WXS A;  1E8Y A;  3EHV A;  2D07 B;  1EF1 A;  3BY4 B;  5C79 A;  2K6D B;  1W1G A;  2AYO B;  3TO1 A;  2GOW A;  4KVG B;  2ASQ A;  1WH3 A;  2LYD A;  2P0D A;  1J0G A;  4LDT B;  2KQS A;  3R7R A;  3ZTD A;  4JKE A;  1V6E A;  4YON A;  1VD2 A;  4PS3 A;  4XZ4 A;  1V88 A;  4WVF B;  3RUL A;  3UGB B;  4GDL B;  4KIK A;  3MHS D;  5TR5 A;  1D3Z A;  3M1I B;  4K81 A;  2UZR A;  3P6A A;  2DEN B;  2WX0 A;  5IJM A;  3ZDM C;  3NOB A;  2KX0 A;  2LBB A;  5EDS A;  4HB2 B;  3TBL D;  3VTW A;  2W9N A;  2KOX A;  1E7V A;  1U5E A;  2G3Q B;  5HE2 A;  5C16 A;  3K9P B;  4GDL A;  2D4Q A;  3APD A;  2C60 A;  2CAY A;  2LG1 A;  2Z0D B;  1WX9 A;  2JXX A;  4HAX B;  4A6H A;  2DKQ A;  1OQN A;  3MJW A;  4J6I A;  2WDT B;  4F1S A;  2LWP A;  4PYZ A;  4A6F A;  1U27 A;  2Z59 B;  3R66 C;  1EO6 A;  3GYO A;  2MKR A;  3H9D A;  4ZRI A;  2FCN A;  1BTK A;  3HM6 X;  4HAW B;  3PLV A;  1M7E A;  1Y19 B;  2I1K A;  3WAO A;  3F0W A;  4W9F A;  2VRR B;  5E6N A;  2R0D A;  1L7Y A;  4JK7 A;  4F7G A;  1WM2 A;  5LOP B;  3A9J B;  4IM2 A;  2MQJ A;  1C3T A;  1NTY A;  3KYD D;  2V76 A;  3HK0 A;  4FJV B;  3G9W A;  4CHM A;  3SNH A;  1E5W A;  4HPL B;  2KJ6 A;  4K7S A;  1MKE A;  2FDQ A;  1WR6 E;  2CQU A;  3NS8 A;  3ONS A;  3QX1 A;  4DBG A;  4BKS A;  2CHW A;  3FEH A;  3D8D A;  1B55 A;  5HE0 A;  1RLF A;  4MJS B;  2CR5 A;  4IAP A;  1TJ6 A;  2RGF A;  2L00 B;  5AZH A;  3R7Q A;  4MSM B;  4GMX B;  4HHV A;  4A20 A;  3CF6 E;  3O65 B;  2EMS A;  1YJ1 A;  4GSW A;  4IG7 B;  5J18 A;  2COC A;  5G2N A;  2PE6 B;  3MDB C;  3NSU A;  2BKR B;  4TKN A;  2NMB A;  1X05 A;  2MWN B;  2FID A;  1H4R A;  5AZF A;  1V5T A;  3VTU A;  4JKD A;  1WJM A;  2HD5 B;  5CHV C;  1SE9 A;  4FLH A;  2HJ8 A;  4KHB B;  1U2B A;  2DZI A;  3V61 A;  3UQB A;  4HB0 B;  2UYZ B;  4FHJ A;  2RR9 A;  2ZCB A;  1GUA B;  3OJ3 A;  1K8R B;  3O96 A;  2N9E B;  1PLS A;  4LCD E;  2IO3 B;  4JLC A;  5CLL B;  2HE7 A;  1WE7 A;  3M62 B;  5DI9 B;  4K2P A;  4WJO A;  4KHA A;  4W9J A;  4GPT B;  2LRW A;  1EF5 A;  1FOE A;  1W1H A;  4GZU A;  3C0R B;  1PMS A;  4HDO A;  3BJI A;  5J3Y A;  4HVB A;  3Q3F A;  1M7R A;  2ROZ B;  5C5B B;  3ZDT A;  2BYV E;  3ODX A;  2KCJ A;  4WJN A;  2Z0E B;  1QZE A;  3ENB A;  5HE3 A;  1XKE A;  2KFK A;  3DOW A;  1X1F A;  2D2Q A;  1JRU A;  1FHO A;  2GBJ A;  3ECI A;  4GGQ A;  3ZUN A;  1DDM A;  3KSY A;  2KGX B;  2MP2 B;  3VDZ A;  1I35 A;  1Z5S B;  1QC6 A;  4G11 A;  1X1G A;  1MPH A;  5IAA C;  5C5B A;  3UF8 A;  1Y5O A;  4HAZ B;  4I6N B;  2BF8 B;  4GN1 A;  4NPN A;  1SGH A;  3H1U A;  1P5T A;  3IBE A;  4DHZ B;  4GDK A;  3TW1 A;  4IUM B;  5GMV A;  5CTR C;  3HW2 B;  3PTF C;  3Q3J A;  2X18 A;  2KN5 A;  4L6E A;  4HLE A;  3JYU A;  3KRW A;  2MP2 A;  1YQB A;  3U30 A;  3VHT C;  4NY0 A;  4IM3 A;  3NZS A;  5CX3 A;  2FUH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...