2AL6A

Ferm domain of focal adhesion kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
373
structure length
343
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQTDDYAEIIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 98
structure length 343
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2al6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2al6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al6A01
1WJ4A 1EAZA 2RNRB 3X0WA 3ML4A 2LVOA 2ABDA 2L1CA 1EVHA 5JHAA 2FUHB 2KCJA 1RLFA 4TQ0A 2NS5A 2Y7BA 1MG8A 2JF5A 2GJYA 2KJ6A 4HXDA 3X23A 1ZM0A 1VCBA 2MP2A 3PP2A 1WGRA 5FR6A 2QKLA 1KI1B 2L76A 1ZVRA 3KH0A 2JZ3B 4GMXB 4HJKA 4MGIE 2N9EB 2G3QB 1SHCA 1YQBA 2ASQA 3QC8B 1IRSA 1WFYA 2CR5A 1XX0A 2KNBA 3LDZE 3QK0A 2HRJA 4PS3A 5CTRC 3ZNHB 2J0KA 2LGDA 2AL3A 4TUUA 5G55A 5D3VA 2G4DB 2WYQA 4K2OA 2R09A 4NSWA 3FSSA 2BF8B 2DENB 3DCGA 2M0XA 3SHQA 2Z0OA 3A1QA 3T8MA 1XKEA 2K25A 2K8BA 2NBWB 2ROVA 4FJYA 4LCDE 2VRWB 3L16A 4CHJA 4RM9A 3VQIA 2N7DA 2ZPNA 5E6PA 1GJZA 1X11A 3QX1A 2GMIC 2NZ8B 3NZUA 2KTRB 2NBUA 1HB8A 4A20A 2FCNA 4DK5A 5DPWA 2LJ5A 1P98A 2DYQA 4K7WA 5CHVC 1EGXA 3DXDA 1P3QU 4CYEA 2MDXA 5E6NA 3VAWA 1TBEA 4HAZB 2W9NA 3D8FA 4F1SA 2C7MB 2OOBB 3IFWB 3AU5A 2CODA 1WYWB 1P0RA 2ELAA 2H7DA 2K00A 1HE8A 3PHXB 1TXDA 2KDEB 3EFUA 2OJRA 1MK7B 5HE0A 1WM3A 1YX5B 2UYZB 2O6VA 2YS3A 2JXXA 4ZRJA 3EHVA 2MBBB 5DPRA 2Q13A 3ZTCA 3ZRCA 2JRIB 4GPTB 5C5BA 2BGFA 1JRUA 3PLUA 4G11A 2K39A 1RAXA 1GC7A 3BINA 2Z0PA 2KD0A 2LRWA 4WSFA 2N9PC 3IG3A 4K81A 4EEWA 3APFA 2JPHA 1DBHA 3DBLI 3APCA 4IUMB 3T9LA 2A5UA 3CXBB 5LONB 2RR9A 3OAWA 5C16A 1DDWA 5KQ4A 2DZKA 2A4ZA 2MW5A 3PPAA 4FN2A 4XC2A 2VSZA 3U7DA 2Z0DB 4WJNA 2D07B 4HB2B 3MHSD 4G50A 5CX3A 5JH5C 3NHEB 3RUIB 3OANA 1FXTB 3P2BA 4N9F4 2MBEA 2KWUB 3H7SA 2ADZA 1CMXB 2KDIA 2ZCCA 5DCNA 4HWIB 4B9KA 1X1MA 1NTIA 3SD5A 3NSUA 3FP5A 1DDMA 5G2NA 3GYPA 3H1UA 2CRFA 2DZIA 1K5GB 2QKMA 1TTNA 5JLJB 4C0AA 4JGHB 1Q1OA 3KVFB 5J3TA 4HAUB 2LD9A 4KVGB 1NTVA 2R0DA 5CLLB 1M94A 1QC6A 1WY8A 2MBQA 2UWQA 3PGEA 2OTXA 5AEKB 2DX5A 2DN6A 3UIOB 2DYOA 4XX5A 2CY4A 2GOWA 4LDTD 1ZSQA 4AJYB 2BYEA 3L13A 1RJ2A 2LKOA 5C5BB 4GDLA 2MFQA 1M7EA 2DX5B 2XK5A 1EF1A 1RRPB 2KVRA 3C0RB 2YS1A 5J3YA 4G3XB 5AZGA 1PLSA 1U5FA 2DKPA 4NAWA 4AJWA 5C79A 4K1RB 1S1QB 2HJ8A 2LYDA 4WJ7A 1MIZB 2N4FA 4MT7A 2YT0A 1DROA 1WGHA 2K8CA 2KHWB 1U5EA 2VKIA 3JYUA 4KSLC 1V5PA 4GMVA 2MWNB 4DBGA 1T0YA 2FCQA 4JQWC 4HDOA 2NVUI 4MY6A 1UNQA 2M38A 3W1YA 1W1DA 2CHZA 4GIVA 4BKGA 3IHPC 1TJ6A 1YJ1A 4W9HA 1E7UA 2KC1A 2MBOA 2I1JA 2N23A 3ALBA 2WWZA 1C1YB 1V5MA 1N3HA 1P1AA 5FI0A 1AWEA 1GG3A 1NDDA 1V80A 3GOEA 5L83A 2YF0A 2K2UA 1OTRB 2CS4A 1NBFC 1Q67A 2GBRA 3H6NA 3U30A 3ODWA 5DHFB 4IW0A 1A5RA 3ML9A 1WRDB 2DLWA 1P6SA 2D9YA 3N32A 3ZO5B 2DHIA 2PE6B 3ZIMA 1FHWA 4HVBA 2YS5A 3M1IB 2C60A 4D0NB 3L08A 4MSMB 4FLHA 3ZRFA 3WA0A 3PVUA 2D3GA 5EDSA 4P7IA 4A3OA 5J3QA 2O6VB 4BFRA 3KYCD 1Z87A 3RCZA 3PRZA 4W9EA 1GC6A 2J0MA 4LJPB 2COFA 4Z2MB 2P0DA 4EZKA 1OQNA 5C6RA 1V6EA 1MK9B 2E2XA 2L8JA 3M95A 2DA0A 1OEYA 1WXAA 2Z59B 3NS8A 4DWFA 3A33B 1WGGA 3D32A 4IWPA 2EMSA 1H4RA 4HDQA 4HAVB 4WVFB 4BBNC 2GBKA 1U2BA 3A98B 3ODOA 4PQ0A 2YVCA 1EO6A 4RM8A 2XEWA 3TMPB 2G35A 5DHAB 1V5TA 2LWPA 3PZDA 2FCMA 4BBNF 3DVGX 3DPDA 3UQAA 2BWFA 3TCAA 2JT4B 5J18A 4DHZB 1AARA 1I2HA 2IZVB 3R3MA 2IO1B 2PEAA 2CQUA 3L10B 4J6IA 5D94A 3KW5B 4WJQA 2K2JA 1WJNA 2PPHA 3OLMD 3K9OB 4KV2A 1UBQA 1C3TA 2IFSA 4MJSB 1MPHA 2V4LA 1PFJA 3N7CA 2DTCA 4HAYB 1WE6A 3NOBA 2J0JA 4NPNA 4W9KA 3QHTA 2RQ1A 4WWNA 1YX6B 4JLCA 4IOYX 3V60A 2EJ8A 3ZUNA 3IVFA 4ZRIA 3RCPA 2DYNA 4EOYA 3KUCB 3RULA 5AZFA 4GSWA 4MK0A 4WJPA 2N1VA 2L7RA 3MDBC 3A9JA 5DI9B 1U4AA 1WMHA 4NJ7A 5GMVA 4TKNA 2M8SA 4FHKA 4ASWC 2L2IA 1WR6E 3QBVB 3B1LX 1WX8A 1RFAA 4GN1A 1WX9A 4X57B 1X1FA 3SV1A 1XD4A 3OJ3A 4HB4B 3VH4B 3WAMA 2NR2A 4KIKA 2X18A 1V89A 4BBKA 5AZHA 1X05A 2HTHA 2JZZA 1UPQA 4ZRKA 1WXVA 2KMCA 1WJ1A 2COAA 5HE2A 2UZSA 2L0FA 1LW3A 1I42A 3VVWB 1SIFA 3DVGY 4IM2A 3HM6X 4ZYNA 2DAFA 3ZDMC 2P0FA 3VTVA 1K5DB 1E8WA 3HM3A 3ONSA 3PLVA 4MSQB 1MKEA 3ZDTA 2ZNVC 5BO4B 2IYBA 3GYOA 3WALA 3PSEB 1UEFA 3VUYA 1FB8A 4ANXA 1KLVA 3PEGA 5TR5A 4ZDVA 5J2RA 1EF5A 2DX1A 2DZMA 2KDFB 3UF8A 1DYNA 2KUPA 2Y5BB 4A6HA 3TJPA 1OY2A 1WGUA 4K7UA 4KZCA 3ZLZA 5CHWA 4BKTA 4BOZB 3DBRI 3KRWA 2ZCBA 2AYOB 3R66C 4B95A 3PT2B 2WX1A 5EFXA 3DVNU 1ACAA 1Z2MA 2FCSA 1XD3B 3Q3FA 2RD0A 1WH3A 4DHZE 1ISNA 1BTKA 4FBJB 1UNRA 1X86A 5JHGA 1U27A 2KTFA 1ZW7A 2GBMA 3ULCA 5LXHA 3F5RA 3ODXA 2BYFA 2LXAA 3ZNGC 1V9JA 3L0WB 3KZ1A 2LOXA 1BT0A 2KFKB 2PJHA 4G0NB 2ZNVB 3FLVA 2Z0QA 2J59M 2B3AA 3HIZA 3GZNI 4HPLB 4KIKB 5D6JB 1SE9A 2RPQA 2ZVOA 1H10A 3OJ4B 4I6PA 4NAWB 5HE1A 3JVZX 5JZEB 1WI0A 3CIKA 3A8QA 4TV3A 5E6OA 3RD2A 1V61A 3KUZA 4B6HA 1BTNA 3DVNV 2UVMA 2GBNA 3TVVA 4W9LA 4KHOA 1UELA 3WIMA 4FJVB 2FJ9A 3K9PB 2RLOA 1LM8B 4KHAA 2LGXA 4ANWA 4W9CA 2CHWA 3DOWA 5FI1A 3LJ3A 3A1QB 1MAIA 2V3SA 2CHXA 5DPSA 3UGBB 3VIAA 1V2YA 1BAKA 5KCVA 2K1FA 2R2QA 3CMMB 3DDCB 3H9DA 4YONA 3NZSA 4EJNA 2JUOA 5DIFB 1NVLA 2NPTA 4CO7A 1U29A 2MKRA 1FHOA 2MA9B 1WF9A 3KUDB 3F0WA 2IO0B 4BVUC 3A9JB 2H7EA 1L7YA 4A6FA 2QHOA 3QJZA 3S2AA 3PS6A 1UPRA 4URKA 3PSCA 4W9JA 2DFKA 2DKQA 1K8RB 3A4RA 3MPXA 3O96A 1OMWA 2W2WA 2GBJA 2MLBA 2KKCA 3ECIA 3PV1A 4IC7B 1PMSA 3VHTC 2M14A 4FJZA 4E3CA 3SUZA 3VFKA 2LVQA 4GOCA 4GDLB 1KZ7A 1DDVA 3BY4B 3DBSA 2Y8FA 3ML8A 4EUTA 2ZZPB 1V88A 1U5DA 4BKSD 4KSKC 2JVCA 1AQCA 2RVBB 2NCNA 3G9WA 4MGZE 2KWCA 1NI2A 2HTHB 3UZTA 5L95C 2D4QA 1TZ1A 2BCJA 4DBBA 4F7UP 2CKHB 2MP2B 1J0GA 3ZVRA 3PREA 3H7PA 3JSVA 1IYFA 1BWNA 2CY5A 2ROZB 5L81A 1R4MI 3PTFC 1WR1A 3RYTA 3HW2B 5D27A 2IBIB 2PZ1A 1LFDA 5LLIA 4HLEA 3WANA 2N1WA 3A8PA 4YL8A 4HB3B 3B08A 3KRXA 4I6LB 2JWZA 1F9JA 4FADA 2FDQA 1YIWA 2C7NB 4XWXA 1WGDA 2D11A 1WMHB 4AP4C 3AXCA 4WWOA 3SNHA 1NTYA 2I5CA 1FHXA 2FNJB 2JP2A 1V81A 2G4SA 2YRYA 2XBBC 3QCAA 3CSFA 4LJOB 4M8NA 4DHJD 2UZRA 1Z5SB 4GDKA 4IM3A 4PS7A 3ZW3A 4Z2NA 2D9XA 1FAOA 2P0HA 1YD8U 4NY0A 2KXJA 3Q3JA 4MDKE 3U8ZA 2D10A 1E5WA 4LDTB 2LOZA 2XQNM 2RSGA 2AL6A 4MGYE 3V6CB 3ZNID 2KX0A 4F7ZA 2BYVE 2KGXB 4EMOA 2MX2A 4WJOA 1ZC3B 2RUKB 4W9GA 1WJ6A 2DYBA 3SDLC 4DX90 1P3RA 2GCLA 5LXIB 3SYXA 3ENEA 2D9WA 4GU2A 3UIPB 3PRMB 4ANUA 1WX7A 4DHJB 3H7PB 3DBHI 3JSVB 3V6EB 1OQYA 3W1SC 1KOTA 1KJTA 3FEHA 1FGYA 1UGMA 4KZ0A 4JIOU 2LRUA 4I6NB 2KX3A 1U5GA 2Y8GA 5IJMA 3HQCA 2I1KA 3PVLA 1NU2A 2D9ZA 2GCJA 4K17A 4FA6A 4F7GA 3QA8A 5GOWB 5D3YA 2ELBA 3I3TB 1Q5WB 2YT1A 3DQVA 1H8CA 4RMAA 5CHFA 2COPA 3LJUX 2V76A 5DPTA 4JL9A 2EMTA 1SGHA 2IYDB 2KFKA 4IWOA 2NMBA 5JHHA 4MELA 3TL5A 3VUXA 2LBBA 1LQBA 2V1YA 2RSUA 3AU4A 1WE7A 1G6JA 4OVUA 2C9WB 2LG1A 4M0WB 2L3ZA 1ZGUB 4WAAA 3KYDD 1I7AA 4ICVA 4F7HA 1KM7A 1HBKA 4A6FB 3MTNB 3QAQA 3W1SA 1E7VA 5D3XA 5LOPB 3A9KA 1PQSA 4MJSA 2MCNB 4EFOA 2ZEQA 1Y19B 2C5LC 3IBEA 1P5TA 1WZ3A 2BWES 4A5KA 2KJHB 3TFMA 4Y94A 2ZJDA 4EKUA 1J19A 4CHKA 1WVHA 3P6AA 1R4NI 5J17A 4GZUA 1V86A 1VD2A 4WQOB 2BKRB 4MH0E 2Z0EB 1WZ0A 2EKEC 1B55A 1E90A 2ZPYA 4L6EA 3NY5A 1E8XA 4FHJA 4EZLA 4M8MA 2CAYA 2FJLA 2M1MA 1X1GA 3HK0A 2VRRB 1Y5OA 2WX0A 3CSTA 2KK8A 3ZVVA 1E8YA 1V5OA 3EECA 4HCPB 3ZNZB 4AWJA 2IY1B 1D3ZA 2KJRA 4OVVA 2C7HA 1QQGA 1UZXB 2BKFA 2DHZA 2KZRA 2KOXA 3DXCA 2K6DB 3P7ZA 3WYFB 2LI5A 1UNPA 2KWVB 1E8ZA 1Y8RC 3RZFA 3BJIA 1WGYA 3L54A 3WAOA 5C1ZA 1WJMA 2W2XC 2MSED 1P9DU 2AWTA 3PVWA 4W9IA 4IWQA 2GS0A 3V5WA 2N9XA 2ZVNA 3VTUA 4KDIC 2L00B 2DHJA 2P8VA 1IPGA 2JRHA 2FAZA 2L05A 1OGWA 1GUAB 2KQSA 2HD5B 1WXSA 2KLCA 4W9FA 4DXAB 2YSZA 3VXWA 3VOQA 4FULA 3R7RA 5IAAC 4KAXB 1WGQA 2N7EA 2RGFA 1UH6A 4II2B 4NQKE 3M63B 2COCA 1TGZB 2G45B 1QZEA 4MM3A 4II3B 2N0YA 2O2VA 4EZJA 4KDLB 3AJ4A 1Q0WB 2BPSA 2NBVB 4TQ1A 4B6WA 4XZ4A 4MGKE 2CB8A 4A6KA 2K8HA 4K7SA 4NJ6A 1GNUA 3D8DA 3QIJA 1LXDA 4HK2A 2LVPA 2O2VB 4IM0A 2NPTB 3DXEA 2HE7A 4HAWB 4ANVA 3EPYA 5JP4A 2LXCA 4BOSC 1V49A 3PRPB 3M3JA 2FIDA 4PYZA 5KHOA 1XR0B 1FOEA 4W9DA 4GB9A 2CU1A 3VH3B 4GDKB 4HHVA 2O6VD 1UD7A 3M62B 4PS8A 2D2QA 4WWPA 1IP9A 4PNKA 3EC8A 2K6QA 4GXBA 3V62A 3QWMA 4AUQC 1W1HA 2MRPA 2RGNB 3WAPA 3RZWC 1ZC4B 1W1GA 3R7QA 1V5UA 3A9KB 3QARA 3ZKJC 3T06A 1UBIA 3AI5A 2J7QB 4DDGD 2KC2A 4TYZA 2R2OA 1WI1A 1LB1A 2DYMA 3D8EA 3PHWB 2REXA 2L0TA 3N30A 2JY6A 2KMAA 3QQ8B 3SU8X 2EC1A 1KZGA 4CHMA 1M7RA 1WIAA 2KDBA 2MWSB 3B0AA 4MEMA 2PE9A 4IFSA 1TQZA 1FGZA 2M17A 2XK5B 1ZKHA 1HB6A 1ST7A 5JHBA 2FIFA 3ZTDA 4HB0B 1L2NA 4E71A 4NQLB 1XQQA 2IO3B 2YLMA 3L17A 5D3WA 2LZ6A 3VTWA 2DZJA 2LASA 3N3KB 4NNJB 3VUWA 4IAPA 5DH9B 5HE3A 2KO3A 4K2PA 4HCNB 3TW1A 2KANA 1WJUA 5HKHA 2I5FA 5IA7A 2IO2B 3CF6E 1J8CA 3A4SC 4HPMB 4PYUA 3QWZB 5D7GA 2LUEA 3VDZA 3JW0X 1MIXA 4DDID 2DHKA 3KY9A 3KSYA 4DX8A 4HATB 3TO1A 3FM8C 1WG7A 5KQ1A 2MQJA 5D2MB 4BKSA 3AULA 4E74A 3V61A 1J0WA 4KHBB 4GGQA 1S3SG 2MBHA 3PG7A 3MJWA 3RT3B 1OEYJ 1RRBA 4IG7B 1WXMA 2D9VA 5KHQA 3UQBA 2LULA 5C23A 3ULBA 1EUVB 3TBLD 3TIXA 2KFJA 3HHMA 1XT9B 1XODA 4HAXB 2LGYA 3APDA 3UINB 2AEHA 5CLQB 2KN5A 1I35A 2KQ7A 2OQBA 3SO6A 2KLGA 1XCGA 1WM2A 2DAJA 2M4NA 4AOFA 4H8SA 2IY0B 2KTRA 2WH5A 2W2XD 2WDTB 4A3PA 4ICUA 3O65B 4F8CB
chains in the Genus database with same CATH superfamily
1ZP0B 2RDGA 2RNRB 2LVOA 2ABDA 2FUHB 2KCJA 3AMZA 4TQ0A 4HRSA 2KJ6A 2W55A 1VCBA 5FR6A 1WGRA 2QKLA 1KF6B 1KI1B 2L76A 3KH0A 4HJKA 3SR6A 3QC8B 3RMKC 2KNBA 1B9RA 1QF6A 2J0KA 3P4SB 2G4DB 4K2OA 4NSWA 2QEJC 3FSSA 3PZ7A 3DCGA 2WQYB 3A1QA 2K25A 2KUQA 3C19A 2ROVA 2WXGA 4FJYA 4LCDE 2QJLA 4CHJA 3AH7A 2KDMA 1GJZA 3DHHC 3QX1A 2NZ8B 4OZAA 3NZUA 5DPWA 4WAFA 1P98A 1QOAA 1WGKA 1Q10A 4CYEA 3VAWA 4F1SA 1ZOYB 3P4RB 3EUB2 2ELAA 1HE8A 2KDEB 3EFUA 5HE0A 1WM3A 1YX5B 2UYZB 3EHVA 5DPRA 2JXXA 3ZRCA 3ZTCA 2MBBB 2JRIB 5C5BA 3PLUA 1SSNA 1DOIA 1YOVB 5LONB 3PPAA 5C16A 1DDWA 2AQ1B 2MW5A 4XC2A 4IOIE 2D07B 1EM7A 3NHEB 3OANA 2KN4A 2V4IB 4N9F4 2EKIA 1QOGA 5DCNA 1X1MA 3H1UA 2QKMA 1FRRA 4C0AA 4JGHB 4HAUB 2D3CA 2LD9A 4KVGB 2R0DA 1M94A 4ZRPA 4EE2A 5AEKB 2OTXA 2WNMA 2DYOA 1JMLA 2CY4A 3NVVA 4REZA 1VLBA 1F52A 2MFQA 2YS1A 1U5FA 2AQ3B 2BB5A 1S1QB 1K53A 2HJ8A 4WJ7A 2V3SA 1DROA 2M56B 3JYUA 1I4RA 2VKIA 4DBGA 4GMVA 1T0YA 2BVCA 1TKEA 4BKGA 2MBOA 2I1JA 5HI1A 2K3UA 1V5MA 5FI0A 1AWEA 3AECB 5D3IB 2K2UA 2WXJA 3H6NA 2GBRA 1OFFA 5DHFB 3ML9A 2DLWA 1TIFA 3N32A 3DHGC 3M1IB 2Q5WD 2Y5CA 4D0NB 4JKFA 2NBVA 5EDSA 4BFRA 2OJWA 2JZPA 3KYCD 4W9EA 4Z2MB 2AX5A 1OQNA 3R2IA 1MK9B 3NS8A 2Z59B 5T8IA 4OHJA 3D32A 3TEWA 4HAVB 1H4RA 1AWDA 2GBKA 1E10A 1ENFA 3A98B 3AEEB 2WP9B 3ODOA 1PDXA 2XEWA 4YTNB 5DHAB 4BBNF 1HTOA 4K3CA 3DVGX 5J18A 3ZGZA 5MPOA 1V8CA 1AARA 5D94A 3L10B 2RRFA 3KW5B 3RNCC 4WJQA 1WJNA 2IFSA 2UU7A 2V4LA 4HAYB 1EWCA 2R2YA 4JKDA 4WWNA 3VRBB 4JLCA 2JYEA 4EOYA 3ZJTA 3RNAC 4GSWA 4MK0A 2LHDA 4TMAB 4WJPA 1PGAA 1U4AA 5EE9A 3U2SC 1T0QC 2L2IA 1WR6E 3QBVB 1RFAA 4GN1A 2HTME 3KQ4A 3OJ3A 3NVWA 2X18A 2HTHA 1FNVA 3Q8BA 1FMAD 4DXFA 4YSXB 1I42A 1LW3A 1E6EB 3HM6X 2DAFA 3VTVA 4MSQB 1E8WA 1MKEA 3ZDTA 1ZDVA 3GYOA 1FB8A 4XWWA 2DZMA 2Y5BB 4A6HA 1OY2A 4QXAB 5CHWA 2Y3AA 3URYA 3KRWA 4JKGB 4B95A 3PT2B 2TSSA 2FCSA 1TYGB 4NJCA 4DHZE 1M4VA 5JHGA 2K49A 2KTFA 4P1BC 3ULCA 3F5RA 3AEBB 3KZ1A 2ZNVB 3FLVA 4HPLB 5DPSA 4B0EA 3GZNI 4HSIA 3OJ4B 3ZJVA 3ENBA 1T6BX 4NAMA 1V61A 5JXVA 2UVMA 3AEFB 2RLOA 2KQ4X 3TUOA 3LJ3A 2CHXA 3UGBB 3VIAA 4EJNA 4CO7A 1KLGD 3F0WA 2IO0B 2DFKA 2KWDA 3A4RA 1OMWA 3VHTC 2KKCA 5C3JB 4FJZA 3OHMB 4GOUA 1VZ8A 3SUZA 2JQRB 4S0RA 4GDLB 1KZ7A 3BY4B 3DBSA 4IKGA 3ML8A 4ZRQA 2JVCA 2E3TA 4JE3B 2IGGA 2BCJA 2WXIA 3ZVRA 1R4MI 2QC8A 5D27A 3DWMA 4JKCA 1XLPA 3A8PA 3B08A 4A9AA 3KRXA 1MI1A 1TS4A 3AXCA 3VUYA 4JPSA 2I5CA 2JP2A 3QCAA 2XBBC 4M8NA 2L83A 4DHJD 2UZRA 1Z5SB 2WXQA 2ZW0A 3Q3JA 1FAOA 4MDKE 3U8ZA 3Q8CA 3GP7A 1SE3A 2XQNM 2AL6A 3ZNID 4O1NA 1MHXA 2MEKA 2PVOD 2MX2A 4EMOA 1KLUD 4WJOA 2RUKB 4W9GA 1CJEA 5LXIB 4GU2A 3UIPB 1IGDA 1QOBA 1WX7A 2J4XA 3W1SC 1KOTA 4KZ0A 4I6NB 4US8A 4K17A 1U5GA 2Y8GA 3HQCA 2I1KA 2D9ZA 1B1ZA 5GOWB 3AV8A 3I3TB 1I7HA 1AYFA 1TZOA 3LJUX 4BKSA 5IKCM 1SGHA 2KFKA 4IWOA 5JHHA 2QCZA 2W54A 3KWVA 3AU4A 1G6JA 2Y5PA 1ZGUB 3BIID 4WAAA 1I7AA 4F7HA 3MTNB 3QAQA 1NENB 5LOPB 1PQSA 2C5LC 1L6VA 2KJHB 1J19A 1R4NI 1KFYB 1V86A 2IJ0A 4WQOB 2BKRB 2I2YA 4L6EA 4L1RA 4FHJA 4M8MA 2VRRB 1DGJA 1V5OA 4AWJA 4JK7A 4OVVA 2K6DB 1FO4A 2KT7A 1E8ZA 1Y8RC 2PIAA 3RZFA 3BJIA 4J3OD 3WAOA 5C1ZA 2W2XC 4KHBA 1UWXA 3N1XC 2AWTA 3V5WA 2ZVNA 2L00B 2NTSA 3MC9A 1I4PA 3VXWA 3VOQA 4FULA 1WGQA 1LO5D 4II2B 1UH6A 3M63B 2COCA 4II3B 2N0YA 5IN7A 2WU5B 3I5JC 4KDLB 2NBVB 4B6WA 3OWEB 3NW8A 4A6KA 1GNUA 2LVPA 2NPTB 5AUIA 1C79A 5BYSA 3PRPB 4PYZA 4KKIA 1FOEA 4JX1C 2G1EA 4PS8A 4WWPA 4PNKA 2DWQA 3EC8A 2K6QA 2VZKB 5I2MA 3WAPA 2WXLA 2V0GA 1ZC4B 3R7QA 3ZKJC 2J7QB 3LB8C 3U52E 1XO3A 3PHWB 2L0TA 1KZGA 2MWSB 1R4NB 2PE9A 2XK5B 1ZKHA 1I4HA 2FIFA 4E71A 4NQLB 1XQQA 1TS5A 5D3WA 3MC0B 2KO3A 5HKHA 5IA7A 3CF6E 1BXTA 1J8CA 1SXTA 2N9LA 1MIXA 4OZBA 5D2MB 3FVCA 2NMQA 4GGQA 1L5PA 2MBHA 3W2DA 4IG7B 3TEZA 3ULBA 5HFYA 3E9SA 3APDA 3AM9A 1I35A 3R2TA 2WXRA 2KLGA 1PYWD 5IO9A 4AOFA 4H8SA 1HQRD 2BTEA 3O65B 3BVGA 1WJ4A 2LJIA 2L1CA 1EVHA 4WH4A 2Y7BA 2JF5A 4HXDA 2GJYA 2MP2A 3U7ZA 4GMXB 1I4QA 3N20C 4MGIE 1VR9A 4BBNC 1IRSA 2HRJA 2LFIA 2AL3A 1VDVA 3SHQA 2BF8B 2DENB 1TJEA 1SBBB 3NS1A 3L16A 1F77A 1X11A 3ZYYX 3RFZB 1TY0A 5CHVC 4K7WA 4QJ5B 2CJOA 3DXDA 1P3QU 2MDXA 2C7MB 1T0SC 2Z13A 2CODA 1QLBB 3IAM1 2H7DA 2K00A 4AS1A 2OJRA 1MK7B 3GE8C 4JKHA 4JWUC 2BGFA 5GXGB 5H92C 2K39A 1RAXA 2LRWA 2KD0A 4EEWA 3APFA 3DBLI 2FUG1 3APCA 3CXBB 2RR9A 3OAWA 4FN2A 4N58A 3MHSD 4GLSC 1FXTB 1L6UA 4RGOS 2HJ1A 3H7SA 2ADZA 3SD5A 1DDMA 2KAJA 3AE8B 1DOXA 4LNIA 1K5GB 2OHFA 3RNFC 1K51A 4USAA 2QIEB 3AB5A 3AE6B 4M0WA 1NTVA 2MBQA 1QC6A 3PGEA 1FXIA 2DX5A 3UIOB 2M19A 2GOWA 1RJ2A 1Y56A 2EELA 1NEKB 2DX5B 1EF1A 2KVRA 3C0RB 4G3XB 1ZYIA 4NAWA 4AJWA 3FC4A 1MIZB 1WGHA 4KSLC 1N63A 1V5PA 3HVDA 2MWNB 2NVUI 2Z8LA 4MH8A 1UNQA 2M38A 1W1DA 1YJ1A 2KC1A 3VR8B 1SF0A 1NDDA 1AN8A 1TT5B 1D6EC 2WS3B 1N62A 1TKYA 3KLSX 3ZO5B 1FHWA 4L23A 4B0MA 2C60A 4MSMB 3L08A 4FLHA 3ZRFA 2D3GA 2O6VB 2MJEA 3PRZA 1GC6A 4EZKA 5C6RA 3DHIC 2FE8A 3M95A 2DA0A 1OEYA 2RMMA 4DWFA 1JROA 3NG0A 4IWPA 2EMSA 4HDQA 3ETRA 2K8EA 4D6WA 3Q2AC 4PQ0A 2D3BA 1F2RC 4GNKB 3TMPB 3DWGC 1SJHD 4JK9A 1AW7A 2IZVB 1HA5A 3R3MA 2PEAA 4C4VB 4HPPA 3K9OB 1UBQA 1MPHA 1PFJA 1XCTL 4NPNA 2J0JA 3QHTA 1C76A 4IOYX 3V60A 2EJ8A 3IVFA 2DYNA 2N1VA 3MDBC 5GMVA 1WMHA 4NJ7A 2M8SA 4FHKA 3UI3A 1VZ7A 4ASWC 3B1LX 1WX9A 3SV1A 1XD4A 3ZXVA 4BBKA 1J7BA 5AZHA 3HIEA 1GB4A 1WXVA 1ET6A 2ACZB 2L0FA 3VVWB 4QJ4B 1SIFA 3DVGY 4XE0A 4ZYNA 3HM3A 3PLVA 3Q8AA 1FCCC 3PSEB 1UEFA 3PEGA 4ZDVA 1EF5A 2KDFB 2JSVX 3UF8A 4CSQA 1JWAD 3DBRI 3HRDD 5EFXA 1Z2MA 3P63A 1BTKA 1UNRA 2GBMA 2LXAA 2FJUB 4XDCA 5HHDG 3L0WB 1JALA 3P4PB 3W5VB 4P6VF 2LOXA 4LJPB 1CZPA 2PJHA 3S2AA 4BVUC 2B3AA 4KIKB 3NUHB 3MFGA 2RPQA 5LG4B 4RF1A 1H10A 1I4XA 3CIKA 3VR9B 4TV3A 3KUZA 3DVNV 4W9LA 3B77A 1LM8B 3DCXA 2LGXA 5FI1A 5IP4D 1SJED 1XLNA 2WDRB 4RGTA 3W5UB 3H9DA 3NZSA 2XN9C 5DIFB 1SEBD 4XDDA 1YN4A 1FHOA 2MA9B 1WF9A 2H7EA 2IDYA 2NTTA 4A6FA 2QHOA 3FKYA 2ICIA 4W9JA 2DKQA 2KACA 4N6EB 3O96A 1UNSA 2GBJA 2W2WA 2KMMA 2MLBA 3FAHA 4IC7B 1FNUA 4E3CA 3NVYA 4EUTA 3MP9A 2ZKMX 1OQRA 1U5DA 4C4VA 1AQCA 4A8XC 2KWCA 2D4QA 4M02A 2MP2B 4HKQA 2CU3A 3JSVA 5IOIA 4WURA 1WR1A 3HW2B 2J42A 2IBIB 1LFDA 1RM6C 4I6LB 1F2RI 1F9JA 4FADA 2FDQA 1YIWA 1WGDA 1WMHB 2D11A 4WWOA 3SNHA 1NTYA 2FNJB 1FHXA 2N9KA 1V81A 3AE1B 3W1YA 2YRYA 4EFOA 5LXHA 4JKGA 4PS7A 3NJTA 2GB1A 1YD8U 4NY0A 2D10A 3J9CA 1TY2A 2RSGA 1ZPSA 4F7ZA 1HEZE 3E56A 2INDC 1ZC3B 4WWMA 5C2TB 5BMGA 1WJ6A 1C78A 2DYBA 4DX90 3FILB 3PRMB 1KJTA 3FEHA 1UGMA 3IT4B 2LRUA 2KX3A 4LK0M 3PVLA 5FK9C 2GCJA 4F7GA 2ELBA 2YT1A 3R8BA 1H8CA 4RMAA 5CHFA 4ILJA 4DIXA 2NMBA 4MELA 3VUXA 2LBBA 1LQBA 2V1YA 2RSUA 1ZUD2 2C9WB 2L3ZA 1XEEA 4ICVA 3W1SA 3H8HA 1HBKA 1E7VA 3A9KA 2ZEQA 1Y19B 1P5TA 2D3AA 4A5KA 4CHKA 1WVHA 2Z4DA 3GS2A 5J17A 2CJNA 1RFKA 2Z0EB 1B55A 3NY5A 1MI0A 4EZLA 2FJLA 2M1MA 1D4BA 1E8YA 3Q8FA 2KJRA 3RI7C 2C7HA 2BKFA 2HDEA 2KZRA 3DXCA 2E6XA 1PUTA 3WYFB 2LI5A 1N60A 2QILA 2V3NA 3PVWA 4IWQA 1L4ZB 2N9XA 1JW9D 1J7CA 1SB3C 1OGWA 1ZE3D 4IDIA 2KLCA 1FIQA 2RPVA 2YSZA 4RNAA 1SE2A 2N7EA 2RGFA 4OT1A 3FILA 2G45B 1QZEA 4MM3A 4EZJA 1Q0WB 4TQ1A 5EE0A 2CB8A 4NJ6A 3BVZA 3A58A 4RGNA 3DXEA 4OZCA 3EPYA 2LXCA 1XXGA 4BOSC 2FIDA 1XR0B 4W9DA 3SEBA 2CU1A 4HHVA 2O6VD 1UD7A 4GXBA 3QWMA 1W1HA 2MRPA 1W1GA 4MACA 3A9KB 2JYTA 2BB6A 5H8YE 2D5GA 3O13A 1WI1A 1LB1A 3I9V1 2REXA 1IBXB 3N30A 2JY6A 1M7RA 3SFEB 3I57A 4OSNA 2M17A 2XNAC 4KGTA 5JHBA 1NVID 3ZTDA 1C9FA 2IO3B 2JX5A 2DBYA 3L17A 3B2GA 1F0ZA 3VTWA 2LASA 4IAPA 5DH9B 4K2PA 2KANA 4M00A 2WDQB 2I5FA 2IO2B 3VDZA 5D7GA 2LUEA 1FFVA 4HATB 3TO1A 2KVZA 3AULA 3V61A 3HUIA 4KHBB 3MJWA 1T5XD 4XGAB 1WXMA 2D9VA 3UQBA 1DIKA 2LULA 5C23A 3TBLD 3V3XA 1PGBA 2KFJA 2KN5A 2DIKA 4ARIA 2DAJA 2WDTB 4ICUA 2QDFA 3U12A 4MT5A 4LTUA 1JDEA 3ZJUA 1MG8A 4N59A 1ZM0A 3PP2A 1ZVRA 2JZ3B 1SHCA 4FBJB 2ASQA 2ONQA 3RT3B 2CR5A 4C00A 1XX0A 5CTRC 4ITKA 2LGDA 5D3VA 2M0XA 2Z0OA 3T8MA 3N1YC 2PMVA 2NBWB 4C56C 1FPYA 4RM9A 2ZPNA 5E6PA 2IPKD 2KTRB 4A20A 2FCNA 2LJ5A 1EGXA 5E6NA 4HAZB 2W9NA 2LGIA 1WYWB 1P0RA 1TXDA 1BUIC 4ZRJA 2Q13A 1EU3A 1GOZA 4G11A 2Z0PA 4WSFA 2N9PC 3DBRB 3IG3A 2JPHA 4IUMB 3T9LA 5KQ4A 2DZKA 2A4ZA 2LMCA 1MFWA 2X8XX 5CX3A 4JWSC 1XLQA 1YN5A 2KWUB 5IRSA 2BW2A 2KDIA 2ZCCA 4HWIB 3NSUA 3N1ZC 3GYPA 2DZIA 2SEBD 5G5GA 1TTNA 2VZKD 5JLJB 1L0XB 5E6JA 1Q1OA 3KVFB 2UWQA 2DN6A 2G9HD 4LNOA 2BYEA 2R61A 3L13A 2LKOA 1M7EA 2XK5A 1RRPB 5J3YA 1PLSA 2DKPA 4PYUA 3Q69A 1U5EA 2N0SB 1C4CA 1YNTE 1FD6A 4MY6A 1VBHA 3IHPC 1TJ6A 1E7UA 2B76B 2N23A 3ALBA 2WWZA 4JKBA 1C1YB 1N3HA 1GG3A 1V80A 4US9A 3U30A 1NBFC 3ODWA 1EU4A 4IW0A 1WRDB 2KYWA 1P6SA 2DHIA 2PE6B 3ZIMA 2W3SA 2YS5A 2YEPB 1STEA 3AEAB 4A3OA 5J3QA 3RCZA 2J0MA 2COFA 1BMLC 1V6EA 2WGSA 4PK1A 1WGGA 4A55A 3BVMA 1GGOA 1U2BA 3GZNB 1E0ZA 2YVCA 1EO6A 1A70A 2INPE 3PZDA 2FCMA 3DPDA 2BWFA 2JT4B 4DHZB 3HVZA 1I2HA 4J6IA 2CQUA 2K2JA 2PPHA 1C3TA 2GLSA 3KWLA 3N7CA 3NOBA 2RQ1A 1J7AA 3ZUNA 4BAXA 4ZRIA 3AE4B 1YJIA 3KUCB 3RNEC 2WXNA 3RULA 2L7RA 3A9JA 1YQ4B 3AE5B 2X0SA 1WX8A 3V05A 2MJDA 3VH4B 2NR2A 4KIKA 2OEDA 2WXHA 1V89A 1X05A 2JZZA 1WJ1A 2COAA 2UZSA 4KKJA 4IM2A 1HXYD 1K5DB 3ONSA 2ZNVC 3LXFA 2IYBA 4ANXA 5TR5A 4P1CC 5J2RA 2DX1A 1DYNA 2KUPA 3TJPA 4K7UA 4S17A 5D3DA 4BKTA 4BOZB 2AYOB 3R66C 2K0PA 4L2YA 3RNGC 2RD0A 1WH3A 1ISNA 3BK1A 3ODXA 1MVKA 1V9JA 2KFKB 1BT0A 5TSSA 3HIZA 2PLPA 1J0GA 5D6JB 2ZVOA 4RFBA 4NAWB 1T77A 5HE1A 5JZEB 4B6HA 1BTNA 3CIRB 3MC8A 1L0YB 3WIMA 1R7SA 1YN3A 3K9PB 4ANWA 2CHWA 1JWBD 5BMIA 3PZ8A 1MAIA 3DBLB 2K1FA 1BAKA 5KCVA 3DBHB 1MHHE 2JUOA 1NVLA 3GB1A 1U29A 2MKRA 3A9JB 4ILGB 3PS6A 2R82A 3PSCA 3MPXA 3ECIA 4LLGM 1PMSA 2M14A 1CK1A 1FFUA 3EGRA 4ACFA 2LVQA 1DDVA 3AE9B 4AQ7A 1DYQA 2PW9A 4BKSD 4KSKC 4MGZE 2RVBB 3G9WA 5L95C 2HTHB 3W9CB 1TZ1A 4DBBA 1C4PA 3Q3NC 3H7PA 4NZLB 4HLEA 2N1WA 4YL8A 4HB3B 1KH0A 2JWZA 2KIGA 2C7NB 4AP4C 1ACCA 2G4SA 3CSFA 4GDKA 4R3DA 4Z2NA 2D9XA 2X38A 2P0HA 2WLBA 2PVGC 4MGYE 3V6CB 1C77A 2J53A 2BYVE 1P7FA 1YJJA 3HSAA 1P3RA 2GCLA 3SFDB 3SYXA 4ANUA 1FM0D 3EA6A 1F1HA 4DHJB 3JSVB 3DBHI 3V6EB 1OQYA 3P4QB 1V1PB 2KIEA 5IJMA 3TEXA 4JKAA 1NU2A 4FA6A 3QA8A 1Q5WB 3DQVA 1SE4A 2COPA 1ZXIA 2V76A 5DPTA 2IYDB 3TL5A 4M0WB 1KM7A 4A6FB 3BYYB 5D3XA 4MJSA 4ZOHC 2MCNB 1WZ3A 2BWES 4A90A 3TFMA 4Y94A 2PKOA 4EKUA 1QKZA 1C4AA 4GZUA 1VD2A 4TSSA 1WZ0A 2EKEC 2ZPYA 1PGXA 4ARCA 4D2KA 1K50A 1R4MB 2BS3B 2CAYA 3CSTA 1X1GA 3HK0A 1Y5OA 3ZVVA 3EECA 2IY1B 1V1OA 1D3ZA 4FXCA 3WCQA 1QQGA 1NYQA 2DHZA 2KOXA 3RNBC 3L4PA 2WXKA 2KWVB 1WGYA 3L54A 4XYCA 1WJMA 1P9DU 4W9IA 1N6ZA 4RH6A 3NRZA 3VTUA 1JQ4A 3NWDA 1RYJA 2DHJA 2P8VA 2JRHA 2L05A 2FAZA 3MJ5A 1GUAB 2KQSA 2HD5B 1WWTA 3C8YA 4W9FA 4DXAB 4RF0A 3R7RA 4WIPA 4H2AA 4DXGA 4QAYA 3NVZA 1T3QA 1TGZB 3U4EG 4C80A 2JU6X 2WHIA 2BPSA 3AN1A 4K7SA 4QJ3B 3D8DA 3QIJA 1LXDA 4HK2A 4ANVA 4HAWB 2GRIA 3RPFC 3M3JA 1N5WA 2GI9A 3VH3B 4GDKB 5G5HA 3M62B 4UDUC 2D2QA 2H88B 3T3NA 3V62A 4AUQC 4YXDB 3QARA 3AI5A 2KC2A 2R2OA 3B9JA 4HKZE 1GPXA 2DYMA 1TS2A 1JCKB 2KMAA 3QQ8B 1V1PA 1GAQB 1WIAA 4IFSA 1TQZA 1UGJA 3NWFA 4KX6B 2BBCA 1ET9A 2YLMA 2LZ6A 1L4DB 2DZJA 5BYRA 3N3KB 4L1BA 4HCNB 3TW1A 2IGDA 4HPMB 4BZAA 3QWZB 2W3RA 5KQ1A 1ESFA 3FM8C 1WG7A 5AUKA 4E74A 1S3SG 2Z14A 3PG7A 2V9HA 1RRBA 5KHQA 3TIXA 3HHMA 4YTMB 2WDVB 1XT9B 1XODA 3UINB 3SBTA 5CLQB 2KQ7A 3SO6A 1PFDA 1WM2A 2LEKA 2IY0B 1VRAB 2MH7A 5LNK1 3B2FA 1QILA 1QOFA 1EAZA 5JHAA 3X0WA 3ML4A 3P42A 1RLFA 2NS5A 1OQQA 3X23A 2L1AA 2QSDA 5BYQA 2N9EB 2G3QB 1YQBA 3QK0A 1WFYA 1HZ6A 4PS3A 3LDZE 4ZHOA 2LGSA 3ZNHB 4TUUA 3T3OA 5G55A 2WYQA 2R09A 4RGMA 4OW0A 1XKEA 2K8BA 2VRWB 3VQIA 2N7DA 1JWUD 2GMIC 2NBUA 1HB8A 4DK5A 2DYQA 1P7EA 4XWTA 1TBEA 3D8FA 2AQ2B 2OOBB 3IFWB 3AU5A 3PHXB 3AEGB 2ON8A 4YTPB 2O6VA 2YS3A 1XF5L 4GPTB 1JRUA 4RCOA 1QT9A 1FRDA 1JWSD 1GC7A 3BINA 4K81A 1MJDA 1DBHA 3P1MA 2A5UA 3LYYA 5FKAC 2LHEA 2BS4B 2VSZA 3U7DA 3SBGA 2Z0DB 4WJNA 4HB2B 1TKGA 4G50A 2BS2B 5JH5C 3RUIB 3P2BA 2MBEA 1CMXB 4B9KA 1NTIA 3FP5A 5G2NA 2CRFA 4KGRA 5J3TA 2W82A 5EE3A 5CLLB 1WY8A 2BYTA 2V3PA 1T0RC 4XX5A 4LDTD 1ZSQA 4AJYB 5C5BB 4GDLA 1JWMD 2DNFA 3VFKA 5AZGA 5M4YB 5C79A 4HROA 4K1RB 2LYDA 2N4FA 4MT7A 2YT0A 1QQRA 2K8CA 2KHWB 4C7YA 1IBXA 2FCQA 4JQWC 4HDOA 3E9OA 2CHZA 4GIVA 4W9HA 4PT5A 2MHJA 1UWMA 1P1AA 3GOEA 5L83A 2YF0A 1KRHA 1OTRB 2CS4A 1Q67A 3E66A 1A5RA 4YSZB 2D9YA 3Q14C 4HJGE 4HVBA 1WYGA 3WA0A 3PVUA 4P7IA 4DQOC 1FEHA 1Z87A 2VH2A 2P0DA 3BYTB 2E2XA 2L8JA 1DOYA 1WXAA 3I63C 1XLOA 1NI3A 1CQVA 3A33B 2IGHA 4M01A 4WVFB 1IGCA 3Q8EA 4RM8A 2G35A 1V5TA 4JK8A 2LWPA 3UQAA 3TCAA 2GUMA 1IUEA 2IO1B 2RDHA 3OLMD 1N61A 4KV2A 4MJSB 1VJKA 4WQMA 2DTCA 1WE6A 4W9KA 1L0VB 1YX6B 3RCPA 1HTQA 5AZFA 2K9XA 3VRAB 5DI9B 2Z59A 4TKNA 2L32A 4P16A 1UUPA 4X57B 1X1FA 4HB4B 3WAMA 2BT6A 1UPQA 4ZRKA 1D5ZC 2KMCA 3GE3C 5HE2A 3ZDMC 2P0FA 2QMTA 5BO4B 1ZDXA 3WALA 2N7JA 2INCC 1KLVA 1WGUA 4KZCA 4OVZA 3ZLZA 2ZCBA 2WX1A 3DVNU 1ACAA 3Q3FA 1XD3B 2WXOA 3Q3MC 1X86A 1U27A 1E7PB 1ZW7A 3BZDB 2BYFA 2PTLA 3ZNGC 3BWUD 1UF0A 4G0NB 2Z0QA 2J59M 1SE9A 4I6PA 3JVZX 1WI0A 5E6OA 3A8QA 3RD2A 5FR3A 2GBNA 3TVVA 2WXFA 1D5XC 4KHOA 1UELA 2RDBC 2FJ9A 4FJVB 4KHAA 4W9CA 3DOWA 3A1QB 5JVLA 1V2YA 2R2QA 3CMMB 3DDCB 4YONA 3MHZA 2NPTA 1SIJA 3AE2B 3KUDB 2LUMA 2INNE 1WSPA 1L7YA 2WU2B 3QJZA 4URKA 1MG4A 1UPRA 1K8RB 1GB1A 3PV1A 4YT0B 4C7ZA 2K22A 4GOCA 4K3BA 2Y8FA 1YQ3B 2ZZPB 2FBWB 1V88A 3IT6B 2NCNA 3CWIA 1NI2A 3ABVB 1VBGA 3UZTA 4F7UP 2CKHB 3PREA 4JKEA 1IYFA 1BWNA 2CY5A 2ROZB 5L81A 3PTFC 1NYRA 3RYTA 2PZ1A 5LLIA 3WANA 1HZ5A 1LGRA 4XWXA 2L52A 3ZXRA 3AEDB 4LJOB 4IM3A 3ZW3A 1MPEA 2KXJA 2KR0A 4LDTB 1E5WA 1XCQL 2LOZA 1KBLA 4HEA1 2KX0A 5I4DA 2KGXB 3E9PA 4LNNA 2MJ3A 4MM3B 1KC7A 3SDLC 2H89B 3N9YC 3ENEA 2D9WA 5BMHA 4A6QA 3H7PB 1K52A 4ZYSA 1FGYA 3AE7B 4JIOU 1WXQA 1EWYC 2ZW1A 2BQQA 1OEYJ 5I2SA 5D3YA 4JL9A 2EMTA 2WXPA 2JXTA 1WE7A 4OVUA 2LG1A 2DLBA 3KYDD 1V97A 4CQNA 2M0AA 3IBEA 2VH1A 3Q6BA 1KTKA 3Q3OC 1JRPA 2ZJDA 3P6AA 1FCLA 4MH0E 2JWUA 3OG5A 2I38A 1E90A 3BK2A 1E8XA 4Q2JA 2WX0A 2KK8A 4HCPB 3ZNZB 1UZXB 3P7ZA 1UNPA 2K5PA 2MSED 3NZ3A 2GS0A 1YMHE 4KDIC 1IPGA 4KGSA 3IXSA 1WXSA 5HG2A 1FXAA 5IAAC 4KAXB 2YT2A 4LNKA 4NQKE 1WRIA 1E9MA 2O2VA 3AJ4A 4XZ4A 4MGKE 1ROEA 2K8HA 3PO0A 3RN9C 2O2VB 4IM0A 2HE7A 4YWGG 5JP4A 1V49A 5KHOA 4GB9A 2SAKA 1IP9A 4YSYB 4ZHPA 5EE1A 2RGNB 1ZXHA 3RZWC 1V5UA 3T06A 1UBIA 3ZQ4A 4DDGD 4TYZA 3D8EA 2WXMA 3SU8X 2EC1A 1I4GA 4CHMA 2KDBA 3B0AA 4ILHA 4MEMA 1FGZA 1HB6A 1ST7A 1L2NA 4HB0B 3IAS1 3TSSA 2YEPF 3NWAA 1TS3A 3TEYA 1D5MC 4NNJB 5HE3A 3VUWA 1WJUA 1VZ6A 4LNFA 3A4SC 3JW0X 4DDID 2DHKA 3KY9A 3KSYA 4DX8A 2MQJA 1FNWA 3AE3B 1J0WA 1RWSA 3E9LA 2J52A 1EUVB 4HAXB 2LGYA 2AEHA 2OQBA 3EFCA 1XCGA 2M4NA 1N5XA 2KTRA 2WH5A 2W2XD 4A3PA 4F8CB
chains in the Genus database with same CATH topology
2RNRB 2LVOA 2ABDA 2FUHB 2KCJA 4TQ0A 2KJ6A 1VCBA 5FR6A 1WGRA 2QKLA 1KI1B 2L76A 3KH0A 4HJKA 3QC8B 2KNBA 2J0KA 2G4DB 4K2OA 4NSWA 3FSSA 3DCGA 3A1QA 2K25A 2ROVA 4FJYA 4LCDE 4CHJA 1GJZA 3QX1A 2NZ8B 3NZUA 5DPWA 1P98A 4CYEA 3VAWA 4F1SA 2ELAA 1HE8A 2KDEB 3EFUA 5HE0A 1WM3A 1YX5B 2UYZB 3EHVA 5DPRA 2JXXA 3ZRCA 3ZTCA 2MBBB 2JRIB 5C5BA 3PLUA 5LONB 3PPAA 5C16A 1DDWA 2MW5A 4XC2A 2D07B 3NHEB 3OANA 4N9F4 5DCNA 1X1MA 3H1UA 2QKMA 4C0AA 4JGHB 4HAUB 2LD9A 4KVGB 2R0DA 1M94A 5AEKB 2OTXA 2DYOA 2CY4A 2MFQA 2YS1A 1U5FA 1S1QB 2HJ8A 4WJ7A 2V3SA 1DROA 3JYUA 4DBGA 2VKIA 4GMVA 1T0YA 4BKGA 2MBOA 2I1JA 1V5MA 5FI0A 1AWEA 2K2UA 3H6NA 2GBRA 5DHFB 3ML9A 2DLWA 3N32A 3M1IB 4D0NB 4JKFA 5EDSA 4BFRA 3KYCD 4W9EA 4Z2MB 1OQNA 1MK9B 3NS8A 2Z59B 3D32A 4HAVB 1H4RA 2GBKA 3A98B 3ODOA 2XEWA 5DHAB 4BBNF 3DVGX 5J18A 1AARA 5D94A 3L10B 3KW5B 4WJQA 1WJNA 2IFSA 2V4LA 4HAYB 4JKDA 4WWNA 4JLCA 4EOYA 4GSWA 4MK0A 4WJPA 1U4AA 2L2IA 1WR6E 3QBVB 1RFAA 4GN1A 3OJ3A 2X18A 2HTHA 1I42A 1LW3A 3HM6X 2DAFA 3VTVA 4MSQB 1E8WA 1MKEA 3ZDTA 3GYOA 1FB8A 2DZMA 2Y5BB 4A6HA 1OY2A 5CHWA 3KRWA 4JKGB 4B95A 3PT2B 2FCSA 4DHZE 5JHGA 2KTFA 3ULCA 3F5RA 3KZ1A 2ZNVB 3FLVA 4HPLB 5DPSA 3GZNI 3OJ4B 3ENBA 1V61A 2UVMA 2RLOA 3LJ3A 2CHXA 3UGBB 3VIAA 4EJNA 4CO7A 3F0WA 2IO0B 2DFKA 3A4RA 1OMWA 3VHTC 2KKCA 4FJZA 3SUZA 4GDLB 1KZ7A 3BY4B 3DBSA 3ML8A 2JVCA 2BCJA 3ZVRA 1R4MI 5D27A 4JKCA 3A8PA 3B08A 3KRXA 3VUYA 3AXCA 2I5CA 2JP2A 3QCAA 2XBBC 4M8NA 4DHJD 2UZRA 1Z5SB 3Q3JA 1FAOA 4MDKE 3U8ZA 2XQNM 2AL6A 3ZNID 2MX2A 4EMOA 4WJOA 2RUKB 4W9GA 5LXIB 4GU2A 3UIPB 1WX7A 3W1SC 1KOTA 4KZ0A 4I6NB 4K17A 1U5GA 2Y8GA 3HQCA 2I1KA 2D9ZA 5GOWB 3I3TB 3LJUX 4BKSA 1SGHA 2KFKA 4IWOA 5JHHA 3AU4A 1G6JA 1ZGUB 4WAAA 1I7AA 4F7HA 3MTNB 3QAQA 5LOPB 1PQSA 2C5LC 2KJHB 1J19A 1R4NI 1V86A 4WQOB 2BKRB 4L6EA 4FHJA 4M8MA 2VRRB 1V5OA 4AWJA 4JK7A 4OVVA 2K6DB 1E8ZA 1Y8RC 3RZFA 3BJIA 3WAOA 5C1ZA 2W2XC 2AWTA 3V5WA 2ZVNA 2L00B 3VXWA 3VOQA 4FULA 1WGQA 4II2B 1UH6A 3M63B 2COCA 4II3B 2N0YA 4KDLB 2NBVB 4B6WA 4A6KA 1GNUA 2LVPA 2NPTB 3PRPB 4PYZA 1FOEA 4PS8A 4WWPA 4PNKA 3EC8A 2K6QA 3WAPA 1ZC4B 3R7QA 3ZKJC 2J7QB 3PHWB 2L0TA 1KZGA 2MWSB 2PE9A 2XK5B 1ZKHA 2FIFA 4E71A 4NQLB 1XQQA 5D3WA 2KO3A 5HKHA 5IA7A 3CF6E 1J8CA 1MIXA 5D2MB 4GGQA 2MBHA 4IG7B 3ULBA 3APDA 1I35A 2KLGA 4AOFA 4H8SA 3O65B 1WJ4A 2L1CA 1EVHA 2Y7BA 2JF5A 4HXDA 2GJYA 2MP2A 4GMXB 4MGIE 4BBNC 1IRSA 2HRJA 2AL3A 3SHQA 2BF8B 2DENB 3L16A 1X11A 5CHVC 4K7WA 3DXDA 1P3QU 2MDXA 2C7MB 2CODA 2H7DA 2K00A 2OJRA 1MK7B 4JKHA 2BGFA 2K39A 1RAXA 2LRWA 2KD0A 4EEWA 3APFA 3DBLI 3APCA 3CXBB 2RR9A 3OAWA 4FN2A 3MHSD 1FXTB 3H7SA 2ADZA 3SD5A 1DDMA 1K5GB 1NTVA 2MBQA 1QC6A 3PGEA 2DX5A 3UIOB 2GOWA 1RJ2A 2DX5B 1EF1A 2KVRA 3C0RB 4G3XB 4NAWA 4AJWA 1MIZB 1WGHA 4KSLC 1V5PA 2MWNB 2NVUI 1UNQA 2M38A 1W1DA 1YJ1A 2KC1A 1NDDA 3ZO5B 1FHWA 2C60A 4MSMB 3L08A 4FLHA 3ZRFA 2D3GA 2O6VB 3PRZA 1GC6A 4EZKA 5C6RA 3M95A 2DA0A 1OEYA 4DWFA 4IWPA 2EMSA 4HDQA 4PQ0A 3TMPB 4JK9A 2IZVB 3R3MA 2PEAA 3K9OB 1UBQA 1MPHA 1PFJA 4NPNA 2J0JA 3QHTA 4IOYX 3V60A 2EJ8A 3IVFA 2DYNA 2N1VA 3MDBC 5GMVA 1WMHA 4NJ7A 2M8SA 4FHKA 4ASWC 3B1LX 1WX9A 3SV1A 1XD4A 4BBKA 5AZHA 1WXVA 2L0FA 3VVWB 1SIFA 3DVGY 4ZYNA 3HM3A 3PLVA 3PSEB 1UEFA 3PEGA 4ZDVA 1EF5A 2KDFB 3UF8A 3DBRI 5EFXA 1Z2MA 1BTKA 1UNRA 2GBMA 2LXAA 3L0WB 2LOXA 4LJPB 2PJHA 4BVUC 3S2AA 2B3AA 4KIKB 2RPQA 1H10A 3CIKA 4TV3A 3KUZA 3DVNV 4W9LA 1LM8B 2LGXA 5FI1A 3H9DA 3NZSA 5DIFB 1FHOA 2MA9B 1WF9A 2H7EA 4A6FA 2QHOA 4W9JA 2DKQA 3O96A 2GBJA 2MLBA 2W2WA 4IC7B 4E3CA 4EUTA 1U5DA 1AQCA 2KWCA 2D4QA 2MP2B 3JSVA 1WR1A 3HW2B 2IBIB 1LFDA 4I6LB 1F9JA 4FADA 2FDQA 1YIWA 1WGDA 1WMHB 2D11A 4WWOA 3SNHA 5LXHA 1NTYA 1FHXA 3W1YA 2FNJB 1V81A 4EFOA 2YRYA 4JKGA 4PS7A 1YD8U 4NY0A 2D10A 2RSGA 4F7ZA 1ZC3B 1WJ6A 2DYBA 4DX90 3PRMB 1KJTA 3FEHA 1UGMA 2LRUA 2KX3A 3PVLA 2GCJA 4F7GA 2ELBA 2YT1A 1H8CA 4RMAA 5CHFA 4ILJA 2NMBA 4MELA 3VUXA 2LBBA 1LQBA 2V1YA 2RSUA 2C9WB 2L3ZA 4ICVA 3W1SA 1HBKA 1E7VA 3A9KA 2ZEQA 1Y19B 1P5TA 4A5KA 4CHKA 1WVHA 5J17A 2Z0EB 1B55A 3NY5A 4EZLA 2FJLA 2M1MA 1E8YA 2KJRA 2C7HA 2BKFA 2KZRA 3DXCA 3WYFB 2LI5A 3PVWA 4IWQA 2N9XA 1OGWA 2KLCA 2YSZA 2N7EA 2RGFA 2G45B 1QZEA 4MM3A 4EZJA 1Q0WB 4TQ1A 2CB8A 4NJ6A 3DXEA 3EPYA 2LXCA 4BOSC 2FIDA 1XR0B 4W9DA 2CU1A 4HHVA 2O6VD 1UD7A 4GXBA 3QWMA 1W1HA 2MRPA 1W1GA 3A9KB 1WI1A 1LB1A 2REXA 3N30A 2JY6A 1M7RA 2M17A 5JHBA 3ZTDA 2IO3B 3L17A 3VTWA 2LASA 4IAPA 5DH9B 4K2PA 2KANA 2I5FA 2IO2B 3VDZA 5D7GA 2LUEA 4HATB 3TO1A 3AULA 3V61A 4KHBB 3MJWA 1WXMA 2D9VA 3UQBA 1DIKA 2LULA 5C23A 3TBLD 2KFJA 2KN5A 2DIKA 2DAJA 2WDTB 4ICUA 1JDEA 1MG8A 1ZM0A 3PP2A 1ZVRA 2JZ3B 1SHCA 4FBJB 2ASQA 3RT3B 2CR5A 1XX0A 5CTRC 2LGDA 5D3VA 2M0XA 2Z0OA 3T8MA 2NBWB 4RM9A 2ZPNA 5E6PA 2KTRB 4A20A 2FCNA 2LJ5A 1EGXA 5E6NA 4HAZB 2W9NA 1WYWB 1P0RA 1TXDA 4ZRJA 2Q13A 4G11A 2Z0PA 4WSFA 2N9PC 3IG3A 2JPHA 4IUMB 3T9LA 5KQ4A 2DZKA 2A4ZA 5CX3A 2KWUB 2KDIA 2ZCCA 4HWIB 3NSUA 3GYPA 2DZIA 1TTNA 5JLJB 1Q1OA 3KVFB 2UWQA 2DN6A 2BYEA 3L13A 2LKOA 1M7EA 2XK5A 1RRPB 5J3YA 1PLSA 2DKPA 4PYUA 1U5EA 4MY6A 1VBHA 3IHPC 1TJ6A 1E7UA 2N23A 3ALBA 2WWZA 4JKBA 1C1YB 1N3HA 1GG3A 1V80A 3U30A 1NBFC 3ODWA 4IW0A 1WRDB 1P6SA 2DHIA 2PE6B 3ZIMA 2YS5A 4A3OA 5J3QA 3RCZA 2J0MA 2COFA 1V6EA 1WGGA 1GGOA 1U2BA 2YVCA 1EO6A 3PZDA 2FCMA 3DPDA 2BWFA 2JT4B 4DHZB 1I2HA 4J6IA 2CQUA 2K2JA 2PPHA 1C3TA 3N7CA 3NOBA 2RQ1A 3ZUNA 4ZRIA 3KUCB 3RULA 2L7RA 3A9JA 2X0SA 1WX8A 3VH4B 2NR2A 4KIKA 1V89A 1X05A 2JZZA 1WJ1A 2COAA 2UZSA 4IM2A 1K5DB 3ONSA 2ZNVC 2IYBA 4ANXA 5TR5A 5J2RA 2DX1A 1DYNA 2KUPA 3TJPA 4K7UA 4BKTA 4BOZB 2AYOB 3R66C 2RD0A 1WH3A 1ISNA 3ODXA 1V9JA 2KFKB 1BT0A 3HIZA 1J0GA 5D6JB 2ZVOA 4NAWB 5HE1A 5JZEB 4B6HA 1BTNA 3WIMA 3K9PB 4ANWA 2CHWA 1MAIA 2K1FA 1BAKA 5KCVA 2JUOA 1NVLA 1U29A 2MKRA 3A9JB 4ILGB 3PS6A 2R82A 3PSCA 3MPXA 3ECIA 1PMSA 2M14A 2LVQA 1DDVA 4BKSD 4KSKC 4MGZE 2RVBB 3G9WA 5L95C 2HTHB 1TZ1A 4DBBA 3H7PA 4HLEA 2N1WA 4YL8A 4HB3B 2JWZA 2C7NB 4AP4C 2G4SA 3CSFA 4GDKA 4Z2NA 2D9XA 2P0HA 4MGYE 3V6CB 2BYVE 1P3RA 2GCLA 3SYXA 4ANUA 4DHJB 3JSVB 3DBHI 3V6EB 1OQYA 5IJMA 4FA6A 4JKAA 1NU2A 3QA8A 1Q5WB 3DQVA 2COPA 5DPTA 2V76A 2IYDB 3TL5A 4M0WB 1KM7A 4A6FB 5D3XA 4MJSA 2MCNB 1WZ3A 2BWES 3TFMA 4Y94A 4EKUA 4GZUA 1VD2A 1WZ0A 2EKEC 2ZPYA 2CAYA 3CSTA 1X1GA 3HK0A 1Y5OA 3ZVVA 3EECA 2IY1B 1D3ZA 1QQGA 2DHZA 2KOXA 2KWVB 1WGYA 3L54A 1WJMA 1P9DU 4W9IA 3VTUA 2DHJA 2P8VA 2JRHA 2L05A 2FAZA 1GUAB 2KQSA 2HD5B 4W9FA 4DXAB 3R7RA 1TGZB 2BPSA 4K7SA 3D8DA 3QIJA 1LXDA 4HK2A 4ANVA 4HAWB 3M3JA 3VH3B 4GDKB 3M62B 2D2QA 3V62A 4AUQC 3QARA 3AI5A 2KC2A 2R2OA 2DYMA 3QQ8B 2KMAA 1WIAA 4IFSA 1TQZA 2YLMA 2LZ6A 2DZJA 3N3KB 4HCNB 3TW1A 4HPMB 3QWZB 5KQ1A 3FM8C 1WG7A 4E74A 1S3SG 3PG7A 1RRBA 5KHQA 3TIXA 3HHMA 1XT9B 1XODA 3UINB 3SBTA 5CLQB 2KQ7A 3SO6A 1WM2A 2IY0B 1EAZA 5JHAA 3X0WA 3ML4A 1RLFA 2NS5A 3X23A 2N9EB 2G3QB 1YQBA 3QK0A 1WFYA 4PS3A 3LDZE 3ZNHB 4TUUA 5G55A 2WYQA 2R09A 1XKEA 2K8BA 2VRWB 3VQIA 2N7DA 2GMIC 2NBUA 1HB8A 4DK5A 2DYQA 1TBEA 3D8FA 2OOBB 3IFWB 3AU5A 3PHXB 2O6VA 2YS3A 4GPTB 1JRUA 1GC7A 3BINA 4K81A 1DBHA 2A5UA 2VSZA 3U7DA 3SBGA 2Z0DB 4WJNA 4HB2B 4G50A 5JH5C 3RUIB 3P2BA 2MBEA 1CMXB 4B9KA 1NTIA 3FP5A 5G2NA 2CRFA 5J3TA 5CLLB 1WY8A 4XX5A 4LDTD 1ZSQA 4AJYB 5C5BB 4GDLA 3VFKA 5AZGA 5C79A 4K1RB 2LYDA 2N4FA 4MT7A 2YT0A 2K8CA 2KHWB 2FCQA 4JQWC 4HDOA 3E9OA 2CHZA 4GIVA 4W9HA 1P1AA 3GOEA 5L83A 2YF0A 1OTRB 2CS4A 1Q67A 3E66A 1A5RA 2D9YA 4HVBA 3WA0A 3PVUA 4P7IA 1Z87A 2P0DA 2E2XA 2L8JA 1WXAA 3A33B 4WVFB 4RM8A 2G35A 1V5TA 4JK8A 2LWPA 3UQAA 3TCAA 2IO1B 3OLMD 4KV2A 4MJSB 2DTCA 1WE6A 4W9KA 1YX6B 3RCPA 5AZFA 5DI9B 4TKNA 4X57B 1X1FA 4HB4B 3WAMA 1UPQA 4ZRKA 2KMCA 5HE2A 3ZDMC 2P0FA 5BO4B 3WALA 1KLVA 1WGUA 4KZCA 3ZLZA 2ZCBA 2WX1A 3DVNU 1ACAA 3Q3FA 1XD3B 1X86A 1U27A 1ZW7A 2BYFA 3ZNGC 4G0NB 2Z0QA 2J59M 1SE9A 4I6PA 3JVZX 1WI0A 5E6OA 3A8QA 3RD2A 2GBNA 3TVVA 4KHOA 1UELA 4FJVB 2FJ9A 4KHAA 4W9CA 3DOWA 3A1QB 5JVLA 1V2YA 2R2QA 3CMMB 3DDCB 4YONA 2NPTA 3KUDB 1L7YA 3QJZA 4URKA 1UPRA 1K8RB 3PV1A 4GOCA 2Y8FA 2ZZPB 1V88A 2NCNA 1NI2A 1VBGA 3UZTA 4F7UP 2CKHB 3PREA 4JKEA 1IYFA 1BWNA 2CY5A 2ROZB 5L81A 3PTFC 3RYTA 2PZ1A 5LLIA 3WANA 4XWXA 4LJOB 4IM3A 3ZW3A 2KXJA 4LDTB 1E5WA 2LOZA 1KBLA 2KX0A 2KGXB 3E9PA 1KC7A 3SDLC 3ENEA 2D9WA 3H7PB 1FGYA 4JIOU 1OEYJ 5D3YA 4JL9A 2EMTA 1WE7A 4OVUA 2LG1A 3KYDD 3IBEA 2ZJDA 3P6AA 4MH0E 1E90A 1E8XA 2WX0A 2KK8A 4HCPB 3ZNZB 1UZXB 3P7ZA 1UNPA 2MSED 2GS0A 4KDIC 1IPGA 1WXSA 5IAAC 4KAXB 4NQKE 2O2VA 3AJ4A 4XZ4A 4MGKE 2K8HA 2O2VB 4IM0A 2HE7A 5JP4A 1V49A 5KHOA 4GB9A 1IP9A 2RGNB 3RZWC 1V5UA 3T06A 1UBIA 4DDGD 4TYZA 3D8EA 3SU8X 2EC1A 4CHMA 2KDBA 3B0AA 4ILHA 4MEMA 1FGZA 1HB6A 1ST7A 1L2NA 4HB0B 4NNJB 3VUWA 5HE3A 1WJUA 3A4SC 3JW0X 4DDID 2DHKA 3KY9A 3KSYA 4DX8A 2MQJA 1J0WA 3E9LA 1EUVB 4HAXB 2LGYA 2AEHA 2OQBA 1XCGA 2M4NA 2KTRA 2WH5A 2W2XD 4A3PA 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ4 A;  1EAZ A;  2RNR B;  3X0W A;  3ML4 A;  2LVO A;  2ABD A;  2L1C A;  1EVH A;  5JHA A;  2FUH B;  2KCJ A;  1RLF A;  4TQ0 A;  2NS5 A;  2Y7B A;  1MG8 A;  2JF5 A;  2GJY A;  2KJ6 A;  4HXD A;  3X23 A;  1ZM0 A;  1VCB A;  2MP2 A;  3PP2 A;  1WGR A;  5FR6 A;  2QKL A;  1KI1 B;  2L76 A;  1ZVR A;  3KH0 A;  2JZ3 B;  4GMX B;  4HJK A;  4MGI E;  2N9E B;  2G3Q B;  1SHC A;  1YQB A;  2ASQ A;  3QC8 B;  1IRS A;  1WFY A;  2CR5 A;  1XX0 A;  2KNB A;  3LDZ E;  3QK0 A;  2HRJ A;  4PS3 A;  5CTR C;  3ZNH B;  2J0K A;  2LGD A;  2AL3 A;  4TUU A;  5G55 A;  5D3V A;  2G4D B;  2WYQ A;  4K2O A;  2R09 A;  4NSW A;  3FSS A;  2BF8 B;  2DEN B;  3DCG A;  2M0X A;  3SHQ A;  2Z0O A;  3A1Q A;  3T8M A;  1XKE A;  2K25 A;  2K8B A;  2NBW B;  2ROV A;  4FJY A;  4LCD E;  2VRW B;  3L16 A;  4CHJ A;  4RM9 A;  3VQI A;  2N7D A;  2ZPN A;  5E6P A;  1GJZ A;  1X11 A;  3QX1 A;  2GMI C;  2NZ8 B;  3NZU A;  2KTR B;  2NBU A;  1HB8 A;  4A20 A;  2FCN A;  4DK5 A;  5DPW A;  2LJ5 A;  1P98 A;  2DYQ A;  4K7W A;  5CHV C;  1EGX A;  3DXD A;  1P3Q U;  4CYE A;  2MDX A;  5E6N A;  3VAW A;  1TBE A;  4HAZ B;  2W9N A;  3D8F A;  4F1S A;  2C7M B;  2OOB B;  3IFW B;  3AU5 A;  2COD A;  1WYW B;  1P0R A;  2ELA A;  2H7D A;  2K00 A;  1HE8 A;  3PHX B;  1TXD A;  2KDE B;  3EFU A;  2OJR A;  1MK7 B;  5HE0 A;  1WM3 A;  1YX5 B;  2UYZ B;  2O6V A;  2YS3 A;  2JXX A;  4ZRJ A;  3EHV A;  2MBB B;  5DPR A;  2Q13 A;  3ZTC A;  3ZRC A;  2JRI B;  4GPT B;  5C5B A;  2BGF A;  1JRU A;  3PLU A;  4G11 A;  2K39 A;  1RAX A;  1GC7 A;  3BIN A;  2Z0P A;  2KD0 A;  2LRW A;  4WSF A;  2N9P C;  3IG3 A;  4K81 A;  4EEW A;  3APF A;  2JPH A;  1DBH A;  3DBL I;  3APC A;  4IUM B;  3T9L A;  2A5U A;  3CXB B;  5LON B;  2RR9 A;  3OAW A;  5C16 A;  1DDW A;  5KQ4 A;  2DZK A;  2A4Z A;  2MW5 A;  3PPA A;  4FN2 A;  4XC2 A;  2VSZ A;  3U7D A;  2Z0D B;  4WJN A;  2D07 B;  4HB2 B;  3MHS D;  4G50 A;  5CX3 A;  5JH5 C;  3NHE B;  3RUI B;  3OAN A;  1FXT B;  3P2B A;  4N9F 4;  2MBE A;  2KWU B;  3H7S A;  2ADZ A;  1CMX B;  2KDI A;  2ZCC A;  5DCN A;  4HWI B;  4B9K A;  1X1M A;  1NTI A;  3SD5 A;  3NSU A;  3FP5 A;  1DDM A;  5G2N A;  3GYP A;  3H1U A;  2CRF A;  2DZI A;  1K5G B;  2QKM A;  1TTN A;  5JLJ B;  4C0A A;  4JGH B;  1Q1O A;  3KVF B;  5J3T A;  4HAU B;  2LD9 A;  4KVG B;  1NTV A;  2R0D A;  5CLL B;  1M94 A;  1QC6 A;  1WY8 A;  2MBQ A;  2UWQ A;  3PGE A;  2OTX A;  5AEK B;  2DX5 A;  2DN6 A;  3UIO B;  2DYO A;  4XX5 A;  2CY4 A;  2GOW A;  4LDT D;  1ZSQ A;  4AJY B;  2BYE A;  3L13 A;  1RJ2 A;  2LKO A;  5C5B B;  4GDL A;  2MFQ A;  1M7E A;  2DX5 B;  2XK5 A;  1EF1 A;  1RRP B;  2KVR A;  3C0R B;  2YS1 A;  5J3Y A;  4G3X B;  5AZG A;  1PLS A;  1U5F A;  2DKP A;  4NAW A;  4AJW A;  5C79 A;  4K1R B;  1S1Q B;  2HJ8 A;  2LYD A;  4WJ7 A;  1MIZ B;  2N4F A;  4MT7 A;  2YT0 A;  1DRO A;  1WGH A;  2K8C A;  2KHW B;  1U5E A;  2VKI A;  3JYU A;  4KSL C;  1V5P A;  4GMV A;  2MWN B;  4DBG A;  1T0Y A;  2FCQ A;  4JQW C;  4HDO A;  2NVU I;  4MY6 A;  1UNQ A;  2M38 A;  3W1Y A;  1W1D A;  2CHZ A;  4GIV A;  4BKG A;  3IHP C;  1TJ6 A;  1YJ1 A;  4W9H A;  1E7U A;  2KC1 A;  2MBO A;  2I1J A;  2N23 A;  3ALB A;  2WWZ A;  1C1Y B;  1V5M A;  1N3H A;  1P1A A;  5FI0 A;  1AWE A;  1GG3 A;  1NDD A;  1V80 A;  3GOE A;  5L83 A;  2YF0 A;  2K2U A;  1OTR B;  2CS4 A;  1NBF C;  1Q67 A;  2GBR A;  3H6N A;  3U30 A;  3ODW A;  5DHF B;  4IW0 A;  1A5R A;  3ML9 A;  1WRD B;  2DLW A;  1P6S A;  2D9Y A;  3N32 A;  3ZO5 B;  2DHI A;  2PE6 B;  3ZIM A;  1FHW A;  4HVB A;  2YS5 A;  3M1I B;  2C60 A;  4D0N B;  3L08 A;  4MSM B;  4FLH A;  3ZRF A;  3WA0 A;  3PVU A;  2D3G A;  5EDS A;  4P7I A;  4A3O A;  5J3Q A;  2O6V B;  4BFR A;  3KYC D;  1Z87 A;  3RCZ A;  3PRZ A;  4W9E A;  1GC6 A;  2J0M A;  4LJP B;  2COF A;  4Z2M B;  2P0D A;  4EZK A;  1OQN A;  5C6R A;  1V6E A;  1MK9 B;  2E2X A;  2L8J A;  3M95 A;  2DA0 A;  1OEY A;  1WXA A;  2Z59 B;  3NS8 A;  4DWF A;  3A33 B;  1WGG A;  3D32 A;  4IWP A;  2EMS A;  1H4R A;  4HDQ A;  4HAV B;  4WVF B;  4BBN C;  2GBK A;  1U2B A;  3A98 B;  3ODO A;  4PQ0 A;  2YVC A;  1EO6 A;  4RM8 A;  2XEW A;  3TMP B;  2G35 A;  5DHA B;  1V5T A;  2LWP A;  3PZD A;  2FCM A;  4BBN F;  3DVG X;  3DPD A;  3UQA A;  2BWF A;  3TCA A;  2JT4 B;  5J18 A;  4DHZ B;  1AAR A;  1I2H A;  2IZV B;  3R3M A;  2IO1 B;  2PEA A;  2CQU A;  3L10 B;  4J6I A;  5D94 A;  3KW5 B;  4WJQ A;  2K2J A;  1WJN A;  2PPH A;  3OLM D;  3K9O B;  4KV2 A;  1UBQ A;  1C3T A;  2IFS A;  4MJS B;  1MPH A;  2V4L A;  1PFJ A;  3N7C A;  2DTC A;  4HAY B;  1WE6 A;  3NOB A;  2J0J A;  4NPN A;  4W9K A;  3QHT A;  2RQ1 A;  4WWN A;  1YX6 B;  4JLC A;  4IOY X;  3V60 A;  2EJ8 A;  3ZUN A;  3IVF A;  4ZRI A;  3RCP A;  2DYN A;  4EOY A;  3KUC B;  3RUL A;  5AZF A;  4GSW A;  4MK0 A;  4WJP A;  2N1V A;  2L7R A;  3MDB C;  3A9J A;  5DI9 B;  1U4A A;  1WMH A;  4NJ7 A;  5GMV A;  4TKN A;  2M8S A;  4FHK A;  4ASW C;  2L2I A;  1WR6 E;  3QBV B;  3B1L X;  1WX8 A;  1RFA A;  4GN1 A;  1WX9 A;  4X57 B;  1X1F A;  3SV1 A;  1XD4 A;  3OJ3 A;  4HB4 B;  3VH4 B;  3WAM A;  2NR2 A;  4KIK A;  2X18 A;  1V89 A;  4BBK A;  5AZH A;  1X05 A;  2HTH A;  2JZZ A;  1UPQ A;  4ZRK A;  1WXV A;  2KMC A;  1WJ1 A;  2COA A;  5HE2 A;  2UZS A;  2L0F A;  1LW3 A;  1I42 A;  3VVW B;  1SIF A;  3DVG Y;  4IM2 A;  3HM6 X;  4ZYN A;  2DAF A;  3ZDM C;  2P0F A;  3VTV A;  1K5D B;  1E8W A;  3HM3 A;  3ONS A;  3PLV A;  4MSQ B;  1MKE A;  3ZDT A;  2ZNV C;  5BO4 B;  2IYB A;  3GYO A;  3WAL A;  3PSE B;  1UEF A;  3VUY A;  1FB8 A;  4ANX A;  1KLV A;  3PEG A;  5TR5 A;  4ZDV A;  5J2R A;  1EF5 A;  2DX1 A;  2DZM A;  2KDF B;  3UF8 A;  1DYN A;  2KUP A;  2Y5B B;  4A6H A;  3TJP A;  1OY2 A;  1WGU A;  4K7U A;  4KZC A;  3ZLZ A;  5CHW A;  4BKT A;  4BOZ B;  3DBR I;  3KRW A;  2ZCB A;  2AYO B;  3R66 C;  4B95 A;  3PT2 B;  2WX1 A;  5EFX A;  3DVN U;  1ACA A;  1Z2M A;  2FCS A;  1XD3 B;  3Q3F A;  2RD0 A;  1WH3 A;  4DHZ E;  1ISN A;  1BTK A;  4FBJ B;  1UNR A;  1X86 A;  5JHG A;  1U27 A;  2KTF A;  1ZW7 A;  2GBM A;  3ULC A;  5LXH A;  3F5R A;  3ODX A;  2BYF A;  2LXA A;  3ZNG C;  1V9J A;  3L0W B;  3KZ1 A;  2LOX A;  1BT0 A;  2KFK B;  2PJH A;  4G0N B;  2ZNV B;  3FLV A;  2Z0Q A;  2J59 M;  2B3A A;  3HIZ A;  3GZN I;  4HPL B;  4KIK B;  5D6J B;  1SE9 A;  2RPQ A;  2ZVO A;  1H10 A;  3OJ4 B;  4I6P A;  4NAW B;  5HE1 A;  3JVZ X;  5JZE B;  1WI0 A;  3CIK A;  3A8Q A;  4TV3 A;  5E6O A;  3RD2 A;  1V61 A;  3KUZ A;  4B6H A;  1BTN A;  3DVN V;  2UVM A;  2GBN A;  3TVV A;  4W9L A;  4KHO A;  1UEL A;  3WIM A;  4FJV B;  2FJ9 A;  3K9P B;  2RLO A;  1LM8 B;  4KHA A;  2LGX A;  4ANW A;  4W9C A;  2CHW A;  3DOW A;  5FI1 A;  3LJ3 A;  3A1Q B;  1MAI A;  2V3S A;  2CHX A;  5DPS A;  3UGB B;  3VIA A;  1V2Y A;  1BAK A;  5KCV A;  2K1F A;  2R2Q A;  3CMM B;  3DDC B;  3H9D A;  4YON A;  3NZS A;  4EJN A;  2JUO A;  5DIF B;  1NVL A;  2NPT A;  4CO7 A;  1U29 A;  2MKR A;  1FHO A;  2MA9 B;  1WF9 A;  3KUD B;  3F0W A;  2IO0 B;  4BVU C;  3A9J B;  2H7E A;  1L7Y A;  4A6F A;  2QHO A;  3QJZ A;  3S2A A;  3PS6 A;  1UPR A;  4URK A;  3PSC A;  4W9J A;  2DFK A;  2DKQ A;  1K8R B;  3A4R A;  3MPX A;  3O96 A;  1OMW A;  2W2W A;  2GBJ A;  2MLB A;  2KKC A;  3ECI A;  3PV1 A;  4IC7 B;  1PMS A;  3VHT C;  2M14 A;  4FJZ A;  4E3C A;  3SUZ A;  3VFK A;  2LVQ A;  4GOC A;  4GDL B;  1KZ7 A;  1DDV A;  3BY4 B;  3DBS A;  2Y8F A;  3ML8 A;  4EUT A;  2ZZP B;  1V88 A;  1U5D A;  4BKS D;  4KSK C;  2JVC A;  1AQC A;  2RVB B;  2NCN A;  3G9W A;  4MGZ E;  2KWC A;  1NI2 A;  2HTH B;  3UZT A;  5L95 C;  2D4Q A;  1TZ1 A;  2BCJ A;  4DBB A;  4F7U P;  2CKH B;  2MP2 B;  1J0G A;  3ZVR A;  3PRE A;  3H7P A;  3JSV A;  1IYF A;  1BWN A;  2CY5 A;  2ROZ B;  5L81 A;  1R4M I;  3PTF C;  1WR1 A;  3RYT A;  3HW2 B;  5D27 A;  2IBI B;  2PZ1 A;  1LFD A;  5LLI A;  4HLE A;  3WAN A;  2N1W A;  3A8P A;  4YL8 A;  4HB3 B;  3B08 A;  3KRX A;  4I6L B;  2JWZ A;  1F9J A;  4FAD A;  2FDQ A;  1YIW A;  2C7N B;  4XWX A;  1WGD A;  2D11 A;  1WMH B;  4AP4 C;  3AXC A;  4WWO A;  3SNH A;  1NTY A;  2I5C A;  1FHX A;  2FNJ B;  2JP2 A;  1V81 A;  2G4S A;  2YRY A;  2XBB C;  3QCA A;  3CSF A;  4LJO B;  4M8N A;  4DHJ D;  2UZR A;  1Z5S B;  4GDK A;  4IM3 A;  4PS7 A;  3ZW3 A;  4Z2N A;  2D9X A;  1FAO A;  2P0H A;  1YD8 U;  4NY0 A;  2KXJ A;  3Q3J A;  4MDK E;  3U8Z A;  2D10 A;  1E5W A;  4LDT B;  2LOZ A;  2XQN M;  2RSG A;  2AL6 A;  4MGY E;  3V6C B;  3ZNI D;  2KX0 A;  4F7Z A;  2BYV E;  2KGX B;  4EMO A;  2MX2 A;  4WJO A;  1ZC3 B;  2RUK B;  4W9G A;  1WJ6 A;  2DYB A;  3SDL C;  4DX9 0;  1P3R A;  2GCL A;  5LXI B;  3SYX A;  3ENE A;  2D9W A;  4GU2 A;  3UIP B;  3PRM B;  4ANU A;  1WX7 A;  4DHJ B;  3H7P B;  3DBH I;  3JSV B;  3V6E B;  1OQY A;  3W1S C;  1KOT A;  1KJT A;  3FEH A;  1FGY A;  1UGM A;  4KZ0 A;  4JIO U;  2LRU A;  4I6N B;  2KX3 A;  1U5G A;  2Y8G A;  5IJM A;  3HQC A;  2I1K A;  3PVL A;  1NU2 A;  2D9Z A;  2GCJ A;  4K17 A;  4FA6 A;  4F7G A;  3QA8 A;  5GOW B;  5D3Y A;  2ELB A;  3I3T B;  1Q5W B;  2YT1 A;  3DQV A;  1H8C A;  4RMA A;  5CHF A;  2COP A;  3LJU X;  2V76 A;  5DPT A;  4JL9 A;  2EMT A;  1SGH A;  2IYD B;  2KFK A;  4IWO A;  2NMB A;  5JHH A;  4MEL A;  3TL5 A;  3VUX A;  2LBB A;  1LQB A;  2V1Y A;  2RSU A;  3AU4 A;  1WE7 A;  1G6J A;  4OVU A;  2C9W B;  2LG1 A;  4M0W B;  2L3Z A;  1ZGU B;  4WAA A;  3KYD D;  1I7A A;  4ICV A;  4F7H A;  1KM7 A;  1HBK A;  4A6F B;  3MTN B;  3QAQ A;  3W1S A;  1E7V A;  5D3X A;  5LOP B;  3A9K A;  1PQS A;  4MJS A;  2MCN B;  4EFO A;  2ZEQ A;  1Y19 B;  2C5L C;  3IBE A;  1P5T A;  1WZ3 A;  2BWE S;  4A5K A;  2KJH B;  3TFM A;  4Y94 A;  2ZJD A;  4EKU A;  1J19 A;  4CHK A;  1WVH A;  3P6A A;  1R4N I;  5J17 A;  4GZU A;  1V86 A;  1VD2 A;  4WQO B;  2BKR B;  4MH0 E;  2Z0E B;  1WZ0 A;  2EKE C;  1B55 A;  1E90 A;  2ZPY A;  4L6E A;  3NY5 A;  1E8X A;  4FHJ A;  4EZL A;  4M8M A;  2CAY A;  2FJL A;  2M1M A;  1X1G A;  3HK0 A;  2VRR B;  1Y5O A;  2WX0 A;  3CST A;  2KK8 A;  3ZVV A;  1E8Y A;  1V5O A;  3EEC A;  4HCP B;  3ZNZ B;  4AWJ A;  2IY1 B;  1D3Z A;  2KJR A;  4OVV A;  2C7H A;  1QQG A;  1UZX B;  2BKF A;  2DHZ A;  2KZR A;  2KOX A;  3DXC A;  2K6D B;  3P7Z A;  3WYF B;  2LI5 A;  1UNP A;  2KWV B;  1E8Z A;  1Y8R C;  3RZF A;  3BJI A;  1WGY A;  3L54 A;  3WAO A;  5C1Z A;  1WJM A;  2W2X C;  2MSE D;  1P9D U;  2AWT A;  3PVW A;  4W9I A;  4IWQ A;  2GS0 A;  3V5W A;  2N9X A;  2ZVN A;  3VTU A;  4KDI C;  2L00 B;  2DHJ A;  2P8V A;  1IPG A;  2JRH A;  2FAZ A;  2L05 A;  1OGW A;  1GUA B;  2KQS A;  2HD5 B;  1WXS A;  2KLC A;  4W9F A;  4DXA B;  2YSZ A;  3VXW A;  3VOQ A;  4FUL A;  3R7R A;  5IAA C;  4KAX B;  1WGQ A;  2N7E A;  2RGF A;  1UH6 A;  4II2 B;  4NQK E;  3M63 B;  2COC A;  1TGZ B;  2G45 B;  1QZE A;  4MM3 A;  4II3 B;  2N0Y A;  2O2V A;  4EZJ A;  4KDL B;  3AJ4 A;  1Q0W B;  2BPS A;  2NBV B;  4TQ1 A;  4B6W A;  4XZ4 A;  4MGK E;  2CB8 A;  4A6K A;  2K8H A;  4K7S A;  4NJ6 A;  1GNU A;  3D8D A;  3QIJ A;  1LXD A;  4HK2 A;  2LVP A;  2O2V B;  4IM0 A;  2NPT B;  3DXE A;  2HE7 A;  4HAW B;  4ANV A;  3EPY A;  5JP4 A;  2LXC A;  4BOS C;  1V49 A;  3PRP B;  3M3J A;  2FID A;  4PYZ A;  5KHO A;  1XR0 B;  1FOE A;  4W9D A;  4GB9 A;  2CU1 A;  3VH3 B;  4GDK B;  4HHV A;  2O6V D;  1UD7 A;  3M62 B;  4PS8 A;  2D2Q A;  4WWP A;  1IP9 A;  4PNK A;  3EC8 A;  2K6Q A;  4GXB A;  3V62 A;  3QWM A;  4AUQ C;  1W1H A;  2MRP A;  2RGN B;  3WAP A;  3RZW C;  1ZC4 B;  1W1G A;  3R7Q A;  1V5U A;  3A9K B;  3QAR A;  3ZKJ C;  3T06 A;  1UBI A;  3AI5 A;  2J7Q B;  4DDG D;  2KC2 A;  4TYZ A;  2R2O A;  1WI1 A;  1LB1 A;  2DYM A;  3D8E A;  3PHW B;  2REX A;  2L0T A;  3N30 A;  2JY6 A;  2KMA A;  3QQ8 B;  3SU8 X;  2EC1 A;  1KZG A;  4CHM A;  1M7R A;  1WIA A;  2KDB A;  2MWS B;  3B0A A;  4MEM A;  2PE9 A;  4IFS A;  1TQZ A;  1FGZ A;  2M17 A;  2XK5 B;  1ZKH A;  1HB6 A;  1ST7 A;  5JHB A;  2FIF A;  3ZTD A;  4HB0 B;  1L2N A;  4E71 A;  4NQL B;  1XQQ A;  2IO3 B;  2YLM A;  3L17 A;  5D3W A;  2LZ6 A;  3VTW A;  2DZJ A;  2LAS A;  3N3K B;  4NNJ B;  3VUW A;  4IAP A;  5DH9 B;  5HE3 A;  2KO3 A;  4K2P A;  4HCN B;  3TW1 A;  2KAN A;  1WJU A;  5HKH A;  2I5F A;  5IA7 A;  2IO2 B;  3CF6 E;  1J8C A;  3A4S C;  4HPM B;  4PYU A;  3QWZ B;  5D7G A;  2LUE A;  3VDZ A;  3JW0 X;  1MIX A;  4DDI D;  2DHK A;  3KY9 A;  3KSY A;  4DX8 A;  4HAT B;  3TO1 A;  3FM8 C;  1WG7 A;  5KQ1 A;  2MQJ A;  5D2M B;  4BKS A;  3AUL A;  4E74 A;  3V61 A;  1J0W A;  4KHB B;  4GGQ A;  1S3S G;  2MBH A;  3PG7 A;  3MJW A;  3RT3 B;  1OEY J;  1RRB A;  4IG7 B;  1WXM A;  2D9V A;  5KHQ A;  3UQB A;  2LUL A;  5C23 A;  3ULB A;  1EUV B;  3TBL D;  3TIX A;  2KFJ A;  3HHM A;  1XT9 B;  1XOD A;  4HAX B;  2LGY A;  3APD A;  3UIN B;  2AEH A;  5CLQ B;  2KN5 A;  1I35 A;  2KQ7 A;  2OQB A;  3SO6 A;  2KLG A;  1XCG A;  1WM2 A;  2DAJ A;  2M4N A;  4AOF A;  4H8S A;  2IY0 B;  2KTR A;  2WH5 A;  2W2X D;  2WDT B;  4A3P A;  4ICU A;  3O65 B;  4F8C B; 
#chains in the Genus database with same CATH topology
 1ZP0 B;  2RDG A;  2RNR B;  2LVO A;  2ABD A;  2FUH B;  2KCJ A;  3AMZ A;  4TQ0 A;  4HRS A;  2KJ6 A;  2W55 A;  1VCB A;  5FR6 A;  1WGR A;  2QKL A;  1KF6 B;  1KI1 B;  2L76 A;  3KH0 A;  4HJK A;  3SR6 A;  3QC8 B;  3RMK C;  2KNB A;  1B9R A;  1QF6 A;  2J0K A;  3P4S B;  2G4D B;  4K2O A;  4NSW A;  2QEJ C;  3FSS A;  3PZ7 A;  3DCG A;  2WQY B;  3A1Q A;  2K25 A;  2KUQ A;  3C19 A;  2ROV A;  2WXG A;  4FJY A;  4LCD E;  2QJL A;  4CHJ A;  3AH7 A;  2KDM A;  1GJZ A;  3DHH C;  3QX1 A;  2NZ8 B;  4OZA A;  3NZU A;  5DPW A;  4WAF A;  1P98 A;  1QOA A;  1WGK A;  1Q10 A;  4CYE A;  3VAW A;  4F1S A;  1ZOY B;  3P4R B;  3EUB 2;  2ELA A;  1HE8 A;  2KDE B;  3EFU A;  5HE0 A;  1WM3 A;  1YX5 B;  2UYZ B;  3EHV A;  5DPR A;  2JXX A;  3ZRC A;  3ZTC A;  2MBB B;  2JRI B;  5C5B A;  3PLU A;  1SSN A;  1DOI A;  1YOV B;  5LON B;  3PPA A;  5C16 A;  1DDW A;  2AQ1 B;  2MW5 A;  4XC2 A;  4IOI E;  2D07 B;  1EM7 A;  3NHE B;  3OAN A;  2KN4 A;  2V4I B;  4N9F 4;  2EKI A;  1QOG A;  5DCN A;  1X1M A;  3H1U A;  2QKM A;  1FRR A;  4C0A A;  4JGH B;  4HAU B;  2D3C A;  2LD9 A;  4KVG B;  2R0D A;  1M94 A;  4ZRP A;  4EE2 A;  5AEK B;  2OTX A;  2WNM A;  2DYO A;  1JML A;  2CY4 A;  3NVV A;  4REZ A;  1VLB A;  1F52 A;  2MFQ A;  2YS1 A;  1U5F A;  2AQ3 B;  2BB5 A;  1S1Q B;  1K53 A;  2HJ8 A;  4WJ7 A;  2V3S A;  1DRO A;  2M56 B;  3JYU A;  1I4R A;  2VKI A;  4DBG A;  4GMV A;  1T0Y A;  2BVC A;  1TKE A;  4BKG A;  2MBO A;  2I1J A;  5HI1 A;  2K3U A;  1V5M A;  5FI0 A;  1AWE A;  3AEC B;  5D3I B;  2K2U A;  2WXJ A;  3H6N A;  2GBR A;  1OFF A;  5DHF B;  3ML9 A;  2DLW A;  1TIF A;  3N32 A;  3DHG C;  3M1I B;  2Q5W D;  2Y5C A;  4D0N B;  4JKF A;  2NBV A;  5EDS A;  4BFR A;  2OJW A;  2JZP A;  3KYC D;  4W9E A;  4Z2M B;  2AX5 A;  1OQN A;  3R2I A;  1MK9 B;  3NS8 A;  2Z59 B;  5T8I A;  4OHJ A;  3D32 A;  3TEW A;  4HAV B;  1H4R A;  1AWD A;  2GBK A;  1E10 A;  1ENF A;  3A98 B;  3AEE B;  2WP9 B;  3ODO A;  1PDX A;  2XEW A;  4YTN B;  5DHA B;  4BBN F;  1HTO A;  4K3C A;  3DVG X;  5J18 A;  3ZGZ A;  5MPO A;  1V8C A;  1AAR A;  5D94 A;  3L10 B;  2RRF A;  3KW5 B;  3RNC C;  4WJQ A;  1WJN A;  2IFS A;  2UU7 A;  2V4L A;  4HAY B;  1EWC A;  2R2Y A;  4JKD A;  4WWN A;  3VRB B;  4JLC A;  2JYE A;  4EOY A;  3ZJT A;  3RNA C;  4GSW A;  4MK0 A;  2LHD A;  4TMA B;  4WJP A;  1PGA A;  1U4A A;  5EE9 A;  3U2S C;  1T0Q C;  2L2I A;  1WR6 E;  3QBV B;  1RFA A;  4GN1 A;  2HTM E;  3KQ4 A;  3OJ3 A;  3NVW A;  2X18 A;  2HTH A;  1FNV A;  3Q8B A;  1FMA D;  4DXF A;  4YSX B;  1I42 A;  1LW3 A;  1E6E B;  3HM6 X;  2DAF A;  3VTV A;  4MSQ B;  1E8W A;  1MKE A;  3ZDT A;  1ZDV A;  3GYO A;  1FB8 A;  4XWW A;  2DZM A;  2Y5B B;  4A6H A;  1OY2 A;  4QXA B;  5CHW A;  2Y3A A;  3URY A;  3KRW A;  4JKG B;  4B95 A;  3PT2 B;  2TSS A;  2FCS A;  1TYG B;  4NJC A;  4DHZ E;  1M4V A;  5JHG A;  2K49 A;  2KTF A;  4P1B C;  3ULC A;  3F5R A;  3AEB B;  3KZ1 A;  2ZNV B;  3FLV A;  4HPL B;  5DPS A;  4B0E A;  3GZN I;  4HSI A;  3OJ4 B;  3ZJV A;  3ENB A;  1T6B X;  4NAM A;  1V61 A;  5JXV A;  2UVM A;  3AEF B;  2RLO A;  2KQ4 X;  3TUO A;  3LJ3 A;  2CHX A;  3UGB B;  3VIA A;  4EJN A;  4CO7 A;  1KLG D;  3F0W A;  2IO0 B;  2DFK A;  2KWD A;  3A4R A;  1OMW A;  3VHT C;  2KKC A;  5C3J B;  4FJZ A;  3OHM B;  4GOU A;  1VZ8 A;  3SUZ A;  2JQR B;  4S0R A;  4GDL B;  1KZ7 A;  3BY4 B;  3DBS A;  4IKG A;  3ML8 A;  4ZRQ A;  2JVC A;  2E3T A;  4JE3 B;  2IGG A;  2BCJ A;  2WXI A;  3ZVR A;  1R4M I;  2QC8 A;  5D27 A;  3DWM A;  4JKC A;  1XLP A;  3A8P A;  3B08 A;  4A9A A;  3KRX A;  1MI1 A;  1TS4 A;  3AXC A;  3VUY A;  4JPS A;  2I5C A;  2JP2 A;  3QCA A;  2XBB C;  4M8N A;  2L83 A;  4DHJ D;  2UZR A;  1Z5S B;  2WXQ A;  2ZW0 A;  3Q3J A;  1FAO A;  4MDK E;  3U8Z A;  3Q8C A;  3GP7 A;  1SE3 A;  2XQN M;  2AL6 A;  3ZNI D;  4O1N A;  1MHX A;  2MEK A;  2PVO D;  2MX2 A;  4EMO A;  1KLU D;  4WJO A;  2RUK B;  4W9G A;  1CJE A;  5LXI B;  4GU2 A;  3UIP B;  1IGD A;  1QOB A;  1WX7 A;  2J4X A;  3W1S C;  1KOT A;  4KZ0 A;  4I6N B;  4US8 A;  4K17 A;  1U5G A;  2Y8G A;  3HQC A;  2I1K A;  2D9Z A;  1B1Z A;  5GOW B;  3AV8 A;  3I3T B;  1I7H A;  1AYF A;  1TZO A;  3LJU X;  4BKS A;  5IKC M;  1SGH A;  2KFK A;  4IWO A;  5JHH A;  2QCZ A;  2W54 A;  3KWV A;  3AU4 A;  1G6J A;  2Y5P A;  1ZGU B;  3BII D;  4WAA A;  1I7A A;  4F7H A;  3MTN B;  3QAQ A;  1NEN B;  5LOP B;  1PQS A;  2C5L C;  1L6V A;  2KJH B;  1J19 A;  1R4N I;  1KFY B;  1V86 A;  2IJ0 A;  4WQO B;  2BKR B;  2I2Y A;  4L6E A;  4L1R A;  4FHJ A;  4M8M A;  2VRR B;  1DGJ A;  1V5O A;  4AWJ A;  4JK7 A;  4OVV A;  2K6D B;  1FO4 A;  2KT7 A;  1E8Z A;  1Y8R C;  2PIA A;  3RZF A;  3BJI A;  4J3O D;  3WAO A;  5C1Z A;  2W2X C;  4KHB A;  1UWX A;  3N1X C;  2AWT A;  3V5W A;  2ZVN A;  2L00 B;  2NTS A;  3MC9 A;  1I4P A;  3VXW A;  3VOQ A;  4FUL A;  1WGQ A;  1LO5 D;  4II2 B;  1UH6 A;  3M63 B;  2COC A;  4II3 B;  2N0Y A;  5IN7 A;  2WU5 B;  3I5J C;  4KDL B;  2NBV B;  4B6W A;  3OWE B;  3NW8 A;  4A6K A;  1GNU A;  2LVP A;  2NPT B;  5AUI A;  1C79 A;  5BYS A;  3PRP B;  4PYZ A;  4KKI A;  1FOE A;  4JX1 C;  2G1E A;  4PS8 A;  4WWP A;  4PNK A;  2DWQ A;  3EC8 A;  2K6Q A;  2VZK B;  5I2M A;  3WAP A;  2WXL A;  2V0G A;  1ZC4 B;  3R7Q A;  3ZKJ C;  2J7Q B;  3LB8 C;  3U52 E;  1XO3 A;  3PHW B;  2L0T A;  1KZG A;  2MWS B;  1R4N B;  2PE9 A;  2XK5 B;  1ZKH A;  1I4H A;  2FIF A;  4E71 A;  4NQL B;  1XQQ A;  1TS5 A;  5D3W A;  3MC0 B;  2KO3 A;  5HKH A;  5IA7 A;  3CF6 E;  1BXT A;  1J8C A;  1SXT A;  2N9L A;  1MIX A;  4OZB A;  5D2M B;  3FVC A;  2NMQ A;  4GGQ A;  1L5P A;  2MBH A;  3W2D A;  4IG7 B;  3TEZ A;  3ULB A;  5HFY A;  3E9S A;  3APD A;  3AM9 A;  1I35 A;  3R2T A;  2WXR A;  2KLG A;  1PYW D;  5IO9 A;  4AOF A;  4H8S A;  1HQR D;  2BTE A;  3O65 B;  3BVG A;  1WJ4 A;  2LJI A;  2L1C A;  1EVH A;  4WH4 A;  2Y7B A;  2JF5 A;  4HXD A;  2GJY A;  2MP2 A;  3U7Z A;  4GMX B;  1I4Q A;  3N20 C;  4MGI E;  1VR9 A;  4BBN C;  1IRS A;  2HRJ A;  2LFI A;  2AL3 A;  1VDV A;  3SHQ A;  2BF8 B;  2DEN B;  1TJE A;  1SBB B;  3NS1 A;  3L16 A;  1F77 A;  1X11 A;  3ZYY X;  3RFZ B;  1TY0 A;  5CHV C;  4K7W A;  4QJ5 B;  2CJO A;  3DXD A;  1P3Q U;  2MDX A;  2C7M B;  1T0S C;  2Z13 A;  2COD A;  1QLB B;  3IAM 1;  2H7D A;  2K00 A;  4AS1 A;  2OJR A;  1MK7 B;  3GE8 C;  4JKH A;  4JWU C;  2BGF A;  5GXG B;  5H92 C;  2K39 A;  1RAX A;  2LRW A;  2KD0 A;  4EEW A;  3APF A;  3DBL I;  2FUG 1;  3APC A;  3CXB B;  2RR9 A;  3OAW A;  4FN2 A;  4N58 A;  3MHS D;  4GLS C;  1FXT B;  1L6U A;  4RGO S;  2HJ1 A;  3H7S A;  2ADZ A;  3SD5 A;  1DDM A;  2KAJ A;  3AE8 B;  1DOX A;  4LNI A;  1K5G B;  2OHF A;  3RNF C;  1K51 A;  4USA A;  2QIE B;  3AB5 A;  3AE6 B;  4M0W A;  1NTV A;  2MBQ A;  1QC6 A;  3PGE A;  1FXI A;  2DX5 A;  3UIO B;  2M19 A;  2GOW A;  1RJ2 A;  1Y56 A;  2EEL A;  1NEK B;  2DX5 B;  1EF1 A;  2KVR A;  3C0R B;  4G3X B;  1ZYI A;  4NAW A;  4AJW A;  3FC4 A;  1MIZ B;  1WGH A;  4KSL C;  1N63 A;  1V5P A;  3HVD A;  2MWN B;  2NVU I;  2Z8L A;  4MH8 A;  1UNQ A;  2M38 A;  1W1D A;  1YJ1 A;  2KC1 A;  3VR8 B;  1SF0 A;  1NDD A;  1AN8 A;  1TT5 B;  1D6E C;  2WS3 B;  1N62 A;  1TKY A;  3KLS X;  3ZO5 B;  1FHW A;  4L23 A;  4B0M A;  2C60 A;  4MSM B;  3L08 A;  4FLH A;  3ZRF A;  2D3G A;  2O6V B;  2MJE A;  3PRZ A;  1GC6 A;  4EZK A;  5C6R A;  3DHI C;  2FE8 A;  3M95 A;  2DA0 A;  1OEY A;  2RMM A;  4DWF A;  1JRO A;  3NG0 A;  4IWP A;  2EMS A;  4HDQ A;  3ETR A;  2K8E A;  4D6W A;  3Q2A C;  4PQ0 A;  2D3B A;  1F2R C;  4GNK B;  3TMP B;  3DWG C;  1SJH D;  4JK9 A;  1AW7 A;  2IZV B;  1HA5 A;  3R3M A;  2PEA A;  4C4V B;  4HPP A;  3K9O B;  1UBQ A;  1MPH A;  1PFJ A;  1XCT L;  4NPN A;  2J0J A;  3QHT A;  1C76 A;  4IOY X;  3V60 A;  2EJ8 A;  3IVF A;  2DYN A;  2N1V A;  3MDB C;  5GMV A;  1WMH A;  4NJ7 A;  2M8S A;  4FHK A;  3UI3 A;  1VZ7 A;  4ASW C;  3B1L X;  1WX9 A;  3SV1 A;  1XD4 A;  3ZXV A;  4BBK A;  1J7B A;  5AZH A;  3HIE A;  1GB4 A;  1WXV A;  1ET6 A;  2ACZ B;  2L0F A;  3VVW B;  4QJ4 B;  1SIF A;  3DVG Y;  4XE0 A;  4ZYN A;  3HM3 A;  3PLV A;  3Q8A A;  1FCC C;  3PSE B;  1UEF A;  3PEG A;  4ZDV A;  1EF5 A;  2KDF B;  2JSV X;  3UF8 A;  4CSQ A;  1JWA D;  3DBR I;  3HRD D;  5EFX A;  1Z2M A;  3P63 A;  1BTK A;  1UNR A;  2GBM A;  2LXA A;  2FJU B;  4XDC A;  5HHD G;  3L0W B;  1JAL A;  3P4P B;  3W5V B;  4P6V F;  2LOX A;  4LJP B;  1CZP A;  2PJH A;  3S2A A;  4BVU C;  2B3A A;  4KIK B;  3NUH B;  3MFG A;  2RPQ A;  5LG4 B;  4RF1 A;  1H10 A;  1I4X A;  3CIK A;  3VR9 B;  4TV3 A;  3KUZ A;  3DVN V;  4W9L A;  3B77 A;  1LM8 B;  3DCX A;  2LGX A;  5FI1 A;  5IP4 D;  1SJE D;  1XLN A;  2WDR B;  4RGT A;  3W5U B;  3H9D A;  3NZS A;  2XN9 C;  5DIF B;  1SEB D;  4XDD A;  1YN4 A;  1FHO A;  2MA9 B;  1WF9 A;  2H7E A;  2IDY A;  2NTT A;  4A6F A;  2QHO A;  3FKY A;  2ICI A;  4W9J A;  2DKQ A;  2KAC A;  4N6E B;  3O96 A;  1UNS A;  2GBJ A;  2W2W A;  2KMM A;  2MLB A;  3FAH A;  4IC7 B;  1FNU A;  4E3C A;  3NVY A;  4EUT A;  3MP9 A;  2ZKM X;  1OQR A;  1U5D A;  4C4V A;  1AQC A;  4A8X C;  2KWC A;  2D4Q A;  4M02 A;  2MP2 B;  4HKQ A;  2CU3 A;  3JSV A;  5IOI A;  4WUR A;  1WR1 A;  3HW2 B;  2J42 A;  2IBI B;  1LFD A;  1RM6 C;  4I6L B;  1F2R I;  1F9J A;  4FAD A;  2FDQ A;  1YIW A;  1WGD A;  1WMH B;  2D11 A;  4WWO A;  3SNH A;  1NTY A;  2FNJ B;  1FHX A;  2N9K A;  1V81 A;  3AE1 B;  3W1Y A;  2YRY A;  4EFO A;  5LXH A;  4JKG A;  4PS7 A;  3NJT A;  2GB1 A;  1YD8 U;  4NY0 A;  2D10 A;  3J9C A;  1TY2 A;  2RSG A;  1ZPS A;  4F7Z A;  1HEZ E;  3E56 A;  2IND C;  1ZC3 B;  4WWM A;  5C2T B;  5BMG A;  1WJ6 A;  1C78 A;  2DYB A;  4DX9 0;  3FIL B;  3PRM B;  1KJT A;  3FEH A;  1UGM A;  3IT4 B;  2LRU A;  2KX3 A;  4LK0 M;  3PVL A;  5FK9 C;  2GCJ A;  4F7G A;  2ELB A;  2YT1 A;  3R8B A;  1H8C A;  4RMA A;  5CHF A;  4ILJ A;  4DIX A;  2NMB A;  4MEL A;  3VUX A;  2LBB A;  1LQB A;  2V1Y A;  2RSU A;  1ZUD 2;  2C9W B;  2L3Z A;  1XEE A;  4ICV A;  3W1S A;  3H8H A;  1HBK A;  1E7V A;  3A9K A;  2ZEQ A;  1Y19 B;  1P5T A;  2D3A A;  4A5K A;  4CHK A;  1WVH A;  2Z4D A;  3GS2 A;  5J17 A;  2CJN A;  1RFK A;  2Z0E B;  1B55 A;  3NY5 A;  1MI0 A;  4EZL A;  2FJL A;  2M1M A;  1D4B A;  1E8Y A;  3Q8F A;  2KJR A;  3RI7 C;  2C7H A;  2BKF A;  2HDE A;  2KZR A;  3DXC A;  2E6X A;  1PUT A;  3WYF B;  2LI5 A;  1N60 A;  2QIL A;  2V3N A;  3PVW A;  4IWQ A;  1L4Z B;  2N9X A;  1JW9 D;  1J7C A;  1SB3 C;  1OGW A;  1ZE3 D;  4IDI A;  2KLC A;  1FIQ A;  2RPV A;  2YSZ A;  4RNA A;  1SE2 A;  2N7E A;  2RGF A;  4OT1 A;  3FIL A;  2G45 B;  1QZE A;  4MM3 A;  4EZJ A;  1Q0W B;  4TQ1 A;  5EE0 A;  2CB8 A;  4NJ6 A;  3BVZ A;  3A58 A;  4RGN A;  3DXE A;  4OZC A;  3EPY A;  2LXC A;  1XXG A;  4BOS C;  2FID A;  1XR0 B;  4W9D A;  3SEB A;  2CU1 A;  4HHV A;  2O6V D;  1UD7 A;  4GXB A;  3QWM A;  1W1H A;  2MRP A;  1W1G A;  4MAC A;  3A9K B;  2JYT A;  2BB6 A;  5H8Y E;  2D5G A;  3O13 A;  1WI1 A;  1LB1 A;  3I9V 1;  2REX A;  1IBX B;  3N30 A;  2JY6 A;  1M7R A;  3SFE B;  3I57 A;  4OSN A;  2M17 A;  2XNA C;  4KGT A;  5JHB A;  1NVI D;  3ZTD A;  1C9F A;  2IO3 B;  2JX5 A;  2DBY A;  3L17 A;  3B2G A;  1F0Z A;  3VTW A;  2LAS A;  4IAP A;  5DH9 B;  4K2P A;  2KAN A;  4M00 A;  2WDQ B;  2I5F A;  2IO2 B;  3VDZ A;  5D7G A;  2LUE A;  1FFV A;  4HAT B;  3TO1 A;  2KVZ A;  3AUL A;  3V61 A;  3HUI A;  4KHB B;  3MJW A;  1T5X D;  4XGA B;  1WXM A;  2D9V A;  3UQB A;  1DIK A;  2LUL A;  5C23 A;  3TBL D;  3V3X A;  1PGB A;  2KFJ A;  2KN5 A;  2DIK A;  4ARI A;  2DAJ A;  2WDT B;  4ICU A;  2QDF A;  3U12 A;  4MT5 A;  4LTU A;  1JDE A;  3ZJU A;  1MG8 A;  4N59 A;  1ZM0 A;  3PP2 A;  1ZVR A;  2JZ3 B;  1SHC A;  4FBJ B;  2ASQ A;  2ONQ A;  3RT3 B;  2CR5 A;  4C00 A;  1XX0 A;  5CTR C;  4ITK A;  2LGD A;  5D3V A;  2M0X A;  2Z0O A;  3T8M A;  3N1Y C;  2PMV A;  2NBW B;  4C56 C;  1FPY A;  4RM9 A;  2ZPN A;  5E6P A;  2IPK D;  2KTR B;  4A20 A;  2FCN A;  2LJ5 A;  1EGX A;  5E6N A;  4HAZ B;  2W9N A;  2LGI A;  1WYW B;  1P0R A;  1TXD A;  1BUI C;  4ZRJ A;  2Q13 A;  1EU3 A;  1GOZ A;  4G11 A;  2Z0P A;  4WSF A;  2N9P C;  3DBR B;  3IG3 A;  2JPH A;  4IUM B;  3T9L A;  5KQ4 A;  2DZK A;  2A4Z A;  2LMC A;  1MFW A;  2X8X X;  5CX3 A;  4JWS C;  1XLQ A;  1YN5 A;  2KWU B;  5IRS A;  2BW2 A;  2KDI A;  2ZCC A;  4HWI B;  3NSU A;  3N1Z C;  3GYP A;  2DZI A;  2SEB D;  5G5G A;  1TTN A;  2VZK D;  5JLJ B;  1L0X B;  5E6J A;  1Q1O A;  3KVF B;  2UWQ A;  2DN6 A;  2G9H D;  4LNO A;  2BYE A;  2R61 A;  3L13 A;  2LKO A;  1M7E A;  2XK5 A;  1RRP B;  5J3Y A;  1PLS A;  2DKP A;  4PYU A;  3Q69 A;  1U5E A;  2N0S B;  1C4C A;  1YNT E;  1FD6 A;  4MY6 A;  1VBH A;  3IHP C;  1TJ6 A;  1E7U A;  2B76 B;  2N23 A;  3ALB A;  2WWZ A;  4JKB A;  1C1Y B;  1N3H A;  1GG3 A;  1V80 A;  4US9 A;  3U30 A;  1NBF C;  3ODW A;  1EU4 A;  4IW0 A;  1WRD B;  2KYW A;  1P6S A;  2DHI A;  2PE6 B;  3ZIM A;  2W3S A;  2YS5 A;  2YEP B;  1STE A;  3AEA B;  4A3O A;  5J3Q A;  3RCZ A;  2J0M A;  2COF A;  1BML C;  1V6E A;  2WGS A;  4PK1 A;  1WGG A;  4A55 A;  3BVM A;  1GGO A;  1U2B A;  3GZN B;  1E0Z A;  2YVC A;  1EO6 A;  1A70 A;  2INP E;  3PZD A;  2FCM A;  3DPD A;  2BWF A;  2JT4 B;  4DHZ B;  3HVZ A;  1I2H A;  4J6I A;  2CQU A;  2K2J A;  2PPH A;  1C3T A;  2GLS A;  3KWL A;  3N7C A;  3NOB A;  2RQ1 A;  1J7A A;  3ZUN A;  4BAX A;  4ZRI A;  3AE4 B;  1YJI A;  3KUC B;  3RNE C;  2WXN A;  3RUL A;  2L7R A;  3A9J A;  1YQ4 B;  3AE5 B;  2X0S A;  1WX8 A;  3V05 A;  2MJD A;  3VH4 B;  2NR2 A;  4KIK A;  2OED A;  2WXH A;  1V89 A;  1X05 A;  2JZZ A;  1WJ1 A;  2COA A;  2UZS A;  4KKJ A;  4IM2 A;  1HXY D;  1K5D B;  3ONS A;  2ZNV C;  3LXF A;  2IYB A;  4ANX A;  5TR5 A;  4P1C C;  5J2R A;  2DX1 A;  1DYN A;  2KUP A;  3TJP A;  4K7U A;  4S17 A;  5D3D A;  4BKT A;  4BOZ B;  2AYO B;  3R66 C;  2K0P A;  4L2Y A;  3RNG C;  2RD0 A;  1WH3 A;  1ISN A;  3BK1 A;  3ODX A;  1MVK A;  1V9J A;  2KFK B;  1BT0 A;  5TSS A;  3HIZ A;  2PLP A;  1J0G A;  5D6J B;  2ZVO A;  4RFB A;  4NAW B;  1T77 A;  5HE1 A;  5JZE B;  4B6H A;  1BTN A;  3CIR B;  3MC8 A;  1L0Y B;  3WIM A;  1R7S A;  1YN3 A;  3K9P B;  4ANW A;  2CHW A;  1JWB D;  5BMI A;  3PZ8 A;  1MAI A;  3DBL B;  2K1F A;  1BAK A;  5KCV A;  3DBH B;  1MHH E;  2JUO A;  1NVL A;  3GB1 A;  1U29 A;  2MKR A;  3A9J B;  4ILG B;  3PS6 A;  2R82 A;  3PSC A;  3MPX A;  3ECI A;  4LLG M;  1PMS A;  2M14 A;  1CK1 A;  1FFU A;  3EGR A;  4ACF A;  2LVQ A;  1DDV A;  3AE9 B;  4AQ7 A;  1DYQ A;  2PW9 A;  4BKS D;  4KSK C;  4MGZ E;  2RVB B;  3G9W A;  5L95 C;  2HTH B;  3W9C B;  1TZ1 A;  4DBB A;  1C4P A;  3Q3N C;  3H7P A;  4NZL B;  4HLE A;  2N1W A;  4YL8 A;  4HB3 B;  1KH0 A;  2JWZ A;  2KIG A;  2C7N B;  4AP4 C;  1ACC A;  2G4S A;  3CSF A;  4GDK A;  4R3D A;  4Z2N A;  2D9X A;  2X38 A;  2P0H A;  2WLB A;  2PVG C;  4MGY E;  3V6C B;  1C77 A;  2J53 A;  2BYV E;  1P7F A;  1YJJ A;  3HSA A;  1P3R A;  2GCL A;  3SFD B;  3SYX A;  4ANU A;  1FM0 D;  3EA6 A;  1F1H A;  4DHJ B;  3JSV B;  3DBH I;  3V6E B;  1OQY A;  3P4Q B;  1V1P B;  2KIE A;  5IJM A;  3TEX A;  4JKA A;  1NU2 A;  4FA6 A;  3QA8 A;  1Q5W B;  3DQV A;  1SE4 A;  2COP A;  1ZXI A;  2V76 A;  5DPT A;  2IYD B;  3TL5 A;  4M0W B;  1KM7 A;  4A6F B;  3BYY B;  5D3X A;  4MJS A;  4ZOH C;  2MCN B;  1WZ3 A;  2BWE S;  4A90 A;  3TFM A;  4Y94 A;  2PKO A;  4EKU A;  1QKZ A;  1C4A A;  4GZU A;  1VD2 A;  4TSS A;  1WZ0 A;  2EKE C;  2ZPY A;  1PGX A;  4ARC A;  4D2K A;  1K50 A;  1R4M B;  2BS3 B;  2CAY A;  3CST A;  1X1G A;  3HK0 A;  1Y5O A;  3ZVV A;  3EEC A;  2IY1 B;  1V1O A;  1D3Z A;  4FXC A;  3WCQ A;  1QQG A;  1NYQ A;  2DHZ A;  2KOX A;  3RNB C;  3L4P A;  2WXK A;  2KWV B;  1WGY A;  3L54 A;  4XYC A;  1WJM A;  1P9D U;  4W9I A;  1N6Z A;  4RH6 A;  3NRZ A;  3VTU A;  1JQ4 A;  3NWD A;  1RYJ A;  2DHJ A;  2P8V A;  2JRH A;  2L05 A;  2FAZ A;  3MJ5 A;  1GUA B;  2KQS A;  2HD5 B;  1WWT A;  3C8Y A;  4W9F A;  4DXA B;  4RF0 A;  3R7R A;  4WIP A;  4H2A A;  4DXG A;  4QAY A;  3NVZ A;  1T3Q A;  1TGZ B;  3U4E G;  4C80 A;  2JU6 X;  2WHI A;  2BPS A;  3AN1 A;  4K7S A;  4QJ3 B;  3D8D A;  3QIJ A;  1LXD A;  4HK2 A;  4ANV A;  4HAW B;  2GRI A;  3RPF C;  3M3J A;  1N5W A;  2GI9 A;  3VH3 B;  4GDK B;  5G5H A;  3M62 B;  4UDU C;  2D2Q A;  2H88 B;  3T3N A;  3V62 A;  4AUQ C;  4YXD B;  3QAR A;  3AI5 A;  2KC2 A;  2R2O A;  3B9J A;  4HKZ E;  1GPX A;  2DYM A;  1TS2 A;  1JCK B;  2KMA A;  3QQ8 B;  1V1P A;  1GAQ B;  1WIA A;  4IFS A;  1TQZ A;  1UGJ A;  3NWF A;  4KX6 B;  2BBC A;  1ET9 A;  2YLM A;  2LZ6 A;  1L4D B;  2DZJ A;  5BYR A;  3N3K B;  4L1B A;  4HCN B;  3TW1 A;  2IGD A;  4HPM B;  4BZA A;  3QWZ B;  2W3R A;  5KQ1 A;  1ESF A;  3FM8 C;  1WG7 A;  5AUK A;  4E74 A;  1S3S G;  2Z14 A;  3PG7 A;  2V9H A;  1RRB A;  5KHQ A;  3TIX A;  3HHM A;  4YTM B;  2WDV B;  1XT9 B;  1XOD A;  3UIN B;  3SBT A;  5CLQ B;  2KQ7 A;  3SO6 A;  1PFD A;  1WM2 A;  2LEK A;  2IY0 B;  1VRA B;  2MH7 A;  5LNK 1;  3B2F A;  1QIL A;  1QOF A;  1EAZ A;  5JHA A;  3X0W A;  3ML4 A;  3P42 A;  1RLF A;  2NS5 A;  1OQQ A;  3X23 A;  2L1A A;  2QSD A;  5BYQ A;  2N9E B;  2G3Q B;  1YQB A;  3QK0 A;  1WFY A;  1HZ6 A;  4PS3 A;  3LDZ E;  4ZHO A;  2LGS A;  3ZNH B;  4TUU A;  3T3O A;  5G55 A;  2WYQ A;  2R09 A;  4RGM A;  4OW0 A;  1XKE A;  2K8B A;  2VRW B;  3VQI A;  2N7D A;  1JWU D;  2GMI C;  2NBU A;  1HB8 A;  4DK5 A;  2DYQ A;  1P7E A;  4XWT A;  1TBE A;  3D8F A;  2AQ2 B;  2OOB B;  3IFW B;  3AU5 A;  3PHX B;  3AEG B;  2ON8 A;  4YTP B;  2O6V A;  2YS3 A;  1XF5 L;  4GPT B;  1JRU A;  4RCO A;  1QT9 A;  1FRD A;  1JWS D;  1GC7 A;  3BIN A;  4K81 A;  1MJD A;  1DBH A;  3P1M A;  2A5U A;  3LYY A;  5FKA C;  2LHE A;  2BS4 B;  2VSZ A;  3U7D A;  3SBG A;  2Z0D B;  4WJN A;  4HB2 B;  1TKG A;  4G50 A;  2BS2 B;  5JH5 C;  3RUI B;  3P2B A;  2MBE A;  1CMX B;  4B9K A;  1NTI A;  3FP5 A;  5G2N A;  2CRF A;  4KGR A;  5J3T A;  2W82 A;  5EE3 A;  5CLL B;  1WY8 A;  2BYT A;  2V3P A;  1T0R C;  4XX5 A;  4LDT D;  1ZSQ A;  4AJY B;  5C5B B;  4GDL A;  1JWM D;  2DNF A;  3VFK A;  5AZG A;  5M4Y B;  5C79 A;  4HRO A;  4K1R B;  2LYD A;  2N4F A;  4MT7 A;  2YT0 A;  1QQR A;  2K8C A;  2KHW B;  4C7Y A;  1IBX A;  2FCQ A;  4JQW C;  4HDO A;  3E9O A;  2CHZ A;  4GIV A;  4W9H A;  4PT5 A;  2MHJ A;  1UWM A;  1P1A A;  3GOE A;  5L83 A;  2YF0 A;  1KRH A;  1OTR B;  2CS4 A;  1Q67 A;  3E66 A;  1A5R A;  4YSZ B;  2D9Y A;  3Q14 C;  4HJG E;  4HVB A;  1WYG A;  3WA0 A;  3PVU A;  4P7I A;  4DQO C;  1FEH A;  1Z87 A;  2VH2 A;  2P0D A;  3BYT B;  2E2X A;  2L8J A;  1DOY A;  1WXA A;  3I63 C;  1XLO A;  1NI3 A;  1CQV A;  3A33 B;  2IGH A;  4M01 A;  4WVF B;  1IGC A;  3Q8E A;  4RM8 A;  2G35 A;  1V5T A;  4JK8 A;  2LWP A;  3UQA A;  3TCA A;  2GUM A;  1IUE A;  2IO1 B;  2RDH A;  3OLM D;  1N61 A;  4KV2 A;  4MJS B;  1VJK A;  4WQM A;  2DTC A;  1WE6 A;  4W9K A;  1L0V B;  1YX6 B;  3RCP A;  1HTQ A;  5AZF A;  2K9X A;  3VRA B;  5DI9 B;  2Z59 A;  4TKN A;  2L32 A;  4P16 A;  1UUP A;  4X57 B;  1X1F A;  4HB4 B;  3WAM A;  2BT6 A;  1UPQ A;  4ZRK A;  1D5Z C;  2KMC A;  3GE3 C;  5HE2 A;  3ZDM C;  2P0F A;  2QMT A;  5BO4 B;  1ZDX A;  3WAL A;  2N7J A;  2INC C;  1KLV A;  1WGU A;  4KZC A;  4OVZ A;  3ZLZ A;  2ZCB A;  2WX1 A;  3DVN U;  1ACA A;  3Q3F A;  1XD3 B;  2WXO A;  3Q3M C;  1X86 A;  1U27 A;  1E7P B;  1ZW7 A;  3BZD B;  2BYF A;  2PTL A;  3ZNG C;  3BWU D;  1UF0 A;  4G0N B;  2Z0Q A;  2J59 M;  1SE9 A;  4I6P A;  3JVZ X;  1WI0 A;  5E6O A;  3A8Q A;  3RD2 A;  5FR3 A;  2GBN A;  3TVV A;  2WXF A;  1D5X C;  4KHO A;  1UEL A;  2RDB C;  2FJ9 A;  4FJV B;  4KHA A;  4W9C A;  3DOW A;  3A1Q B;  5JVL A;  1V2Y A;  2R2Q A;  3CMM B;  3DDC B;  4YON A;  3MHZ A;  2NPT A;  1SIJ A;  3AE2 B;  3KUD B;  2LUM A;  2INN E;  1WSP A;  1L7Y A;  2WU2 B;  3QJZ A;  4URK A;  1MG4 A;  1UPR A;  1K8R B;  1GB1 A;  3PV1 A;  4YT0 B;  4C7Z A;  2K22 A;  4GOC A;  4K3B A;  2Y8F A;  1YQ3 B;  2ZZP B;  2FBW B;  1V88 A;  3IT6 B;  2NCN A;  3CWI A;  1NI2 A;  3ABV B;  1VBG A;  3UZT A;  4F7U P;  2CKH B;  3PRE A;  4JKE A;  1IYF A;  1BWN A;  2CY5 A;  2ROZ B;  5L81 A;  3PTF C;  1NYR A;  3RYT A;  2PZ1 A;  5LLI A;  3WAN A;  1HZ5 A;  1LGR A;  4XWX A;  2L52 A;  3ZXR A;  3AED B;  4LJO B;  4IM3 A;  3ZW3 A;  1MPE A;  2KXJ A;  2KR0 A;  4LDT B;  1E5W A;  1XCQ L;  2LOZ A;  1KBL A;  4HEA 1;  2KX0 A;  5I4D A;  2KGX B;  3E9P A;  4LNN A;  2MJ3 A;  4MM3 B;  1KC7 A;  3SDL C;  2H89 B;  3N9Y C;  3ENE A;  2D9W A;  5BMH A;  4A6Q A;  3H7P B;  1K52 A;  4ZYS A;  1FGY A;  3AE7 B;  4JIO U;  1WXQ A;  1EWY C;  2ZW1 A;  2BQQ A;  1OEY J;  5I2S A;  5D3Y A;  4JL9 A;  2EMT A;  2WXP A;  2JXT A;  1WE7 A;  4OVU A;  2LG1 A;  2DLB A;  3KYD D;  1V97 A;  4CQN A;  2M0A A;  3IBE A;  2VH1 A;  3Q6B A;  1KTK A;  3Q3O C;  1JRP A;  2ZJD A;  3P6A A;  1FCL A;  4MH0 E;  2JWU A;  3OG5 A;  2I38 A;  1E90 A;  3BK2 A;  1E8X A;  4Q2J A;  2WX0 A;  2KK8 A;  4HCP B;  3ZNZ B;  1UZX B;  3P7Z A;  1UNP A;  2K5P A;  2MSE D;  3NZ3 A;  2GS0 A;  1YMH E;  4KDI C;  1IPG A;  4KGS A;  3IXS A;  1WXS A;  5HG2 A;  1FXA A;  5IAA C;  4KAX B;  2YT2 A;  4LNK A;  4NQK E;  1WRI A;  1E9M A;  2O2V A;  3AJ4 A;  4XZ4 A;  4MGK E;  1ROE A;  2K8H A;  3PO0 A;  3RN9 C;  2O2V B;  4IM0 A;  2HE7 A;  4YWG G;  5JP4 A;  1V49 A;  5KHO A;  4GB9 A;  2SAK A;  1IP9 A;  4YSY B;  4ZHP A;  5EE1 A;  2RGN B;  1ZXH A;  3RZW C;  1V5U A;  3T06 A;  1UBI A;  3ZQ4 A;  4DDG D;  4TYZ A;  3D8E A;  2WXM A;  3SU8 X;  2EC1 A;  1I4G A;  4CHM A;  2KDB A;  3B0A A;  4ILH A;  4MEM A;  1FGZ A;  1HB6 A;  1ST7 A;  1L2N A;  4HB0 B;  3IAS 1;  3TSS A;  2YEP F;  3NWA A;  1TS3 A;  3TEY A;  1D5M C;  4NNJ B;  5HE3 A;  3VUW A;  1WJU A;  1VZ6 A;  4LNF A;  3A4S C;  3JW0 X;  4DDI D;  2DHK A;  3KY9 A;  3KSY A;  4DX8 A;  2MQJ A;  1FNW A;  3AE3 B;  1J0W A;  1RWS A;  3E9L A;  2J52 A;  1EUV B;  4HAX B;  2LGY A;  2AEH A;  2OQB A;  3EFC A;  1XCG A;  2M4N A;  1N5X A;  2KTR A;  2WH5 A;  2W2X D;  4A3P A;  4F8C B; 
#chains in the Genus database with same CATH homology
 2RNR B;  2LVO A;  2ABD A;  2FUH B;  2KCJ A;  4TQ0 A;  2KJ6 A;  1VCB A;  5FR6 A;  1WGR A;  2QKL A;  1KI1 B;  2L76 A;  3KH0 A;  4HJK A;  3QC8 B;  2KNB A;  2J0K A;  2G4D B;  4K2O A;  4NSW A;  3FSS A;  3DCG A;  3A1Q A;  2K25 A;  2ROV A;  4FJY A;  4LCD E;  4CHJ A;  1GJZ A;  3QX1 A;  2NZ8 B;  3NZU A;  5DPW A;  1P98 A;  4CYE A;  3VAW A;  4F1S A;  2ELA A;  1HE8 A;  2KDE B;  3EFU A;  5HE0 A;  1WM3 A;  1YX5 B;  2UYZ B;  3EHV A;  5DPR A;  2JXX A;  3ZRC A;  3ZTC A;  2MBB B;  2JRI B;  5C5B A;  3PLU A;  5LON B;  3PPA A;  5C16 A;  1DDW A;  2MW5 A;  4XC2 A;  2D07 B;  3NHE B;  3OAN A;  4N9F 4;  5DCN A;  1X1M A;  3H1U A;  2QKM A;  4C0A A;  4JGH B;  4HAU B;  2LD9 A;  4KVG B;  2R0D A;  1M94 A;  5AEK B;  2OTX A;  2DYO A;  2CY4 A;  2MFQ A;  2YS1 A;  1U5F A;  1S1Q B;  2HJ8 A;  4WJ7 A;  2V3S A;  1DRO A;  3JYU A;  4DBG A;  2VKI A;  4GMV A;  1T0Y A;  4BKG A;  2MBO A;  2I1J A;  1V5M A;  5FI0 A;  1AWE A;  2K2U A;  3H6N A;  2GBR A;  5DHF B;  3ML9 A;  2DLW A;  3N32 A;  3M1I B;  4D0N B;  4JKF A;  5EDS A;  4BFR A;  3KYC D;  4W9E A;  4Z2M B;  1OQN A;  1MK9 B;  3NS8 A;  2Z59 B;  3D32 A;  4HAV B;  1H4R A;  2GBK A;  3A98 B;  3ODO A;  2XEW A;  5DHA B;  4BBN F;  3DVG X;  5J18 A;  1AAR A;  5D94 A;  3L10 B;  3KW5 B;  4WJQ A;  1WJN A;  2IFS A;  2V4L A;  4HAY B;  4JKD A;  4WWN A;  4JLC A;  4EOY A;  4GSW A;  4MK0 A;  4WJP A;  1U4A A;  2L2I A;  1WR6 E;  3QBV B;  1RFA A;  4GN1 A;  3OJ3 A;  2X18 A;  2HTH A;  1I42 A;  1LW3 A;  3HM6 X;  2DAF A;  3VTV A;  4MSQ B;  1E8W A;  1MKE A;  3ZDT A;  3GYO A;  1FB8 A;  2DZM A;  2Y5B B;  4A6H A;  1OY2 A;  5CHW A;  3KRW A;  4JKG B;  4B95 A;  3PT2 B;  2FCS A;  4DHZ E;  5JHG A;  2KTF A;  3ULC A;  3F5R A;  3KZ1 A;  2ZNV B;  3FLV A;  4HPL B;  5DPS A;  3GZN I;  3OJ4 B;  3ENB A;  1V61 A;  2UVM A;  2RLO A;  3LJ3 A;  2CHX A;  3UGB B;  3VIA A;  4EJN A;  4CO7 A;  3F0W A;  2IO0 B;  2DFK A;  3A4R A;  1OMW A;  3VHT C;  2KKC A;  4FJZ A;  3SUZ A;  4GDL B;  1KZ7 A;  3BY4 B;  3DBS A;  3ML8 A;  2JVC A;  2BCJ A;  3ZVR A;  1R4M I;  5D27 A;  4JKC A;  3A8P A;  3B08 A;  3KRX A;  3VUY A;  3AXC A;  2I5C A;  2JP2 A;  3QCA A;  2XBB C;  4M8N A;  4DHJ D;  2UZR A;  1Z5S B;  3Q3J A;  1FAO A;  4MDK E;  3U8Z A;  2XQN M;  2AL6 A;  3ZNI D;  2MX2 A;  4EMO A;  4WJO A;  2RUK B;  4W9G A;  5LXI B;  4GU2 A;  3UIP B;  1WX7 A;  3W1S C;  1KOT A;  4KZ0 A;  4I6N B;  4K17 A;  1U5G A;  2Y8G A;  3HQC A;  2I1K A;  2D9Z A;  5GOW B;  3I3T B;  3LJU X;  4BKS A;  1SGH A;  2KFK A;  4IWO A;  5JHH A;  3AU4 A;  1G6J A;  1ZGU B;  4WAA A;  1I7A A;  4F7H A;  3MTN B;  3QAQ A;  5LOP B;  1PQS A;  2C5L C;  2KJH B;  1J19 A;  1R4N I;  1V86 A;  4WQO B;  2BKR B;  4L6E A;  4FHJ A;  4M8M A;  2VRR B;  1V5O A;  4AWJ A;  4JK7 A;  4OVV A;  2K6D B;  1E8Z A;  1Y8R C;  3RZF A;  3BJI A;  3WAO A;  5C1Z A;  2W2X C;  2AWT A;  3V5W A;  2ZVN A;  2L00 B;  3VXW A;  3VOQ A;  4FUL A;  1WGQ A;  4II2 B;  1UH6 A;  3M63 B;  2COC A;  4II3 B;  2N0Y A;  4KDL B;  2NBV B;  4B6W A;  4A6K A;  1GNU A;  2LVP A;  2NPT B;  3PRP B;  4PYZ A;  1FOE A;  4PS8 A;  4WWP A;  4PNK A;  3EC8 A;  2K6Q A;  3WAP A;  1ZC4 B;  3R7Q A;  3ZKJ C;  2J7Q B;  3PHW B;  2L0T A;  1KZG A;  2MWS B;  2PE9 A;  2XK5 B;  1ZKH A;  2FIF A;  4E71 A;  4NQL B;  1XQQ A;  5D3W A;  2KO3 A;  5HKH A;  5IA7 A;  3CF6 E;  1J8C A;  1MIX A;  5D2M B;  4GGQ A;  2MBH A;  4IG7 B;  3ULB A;  3APD A;  1I35 A;  2KLG A;  4AOF A;  4H8S A;  3O65 B;  1WJ4 A;  2L1C A;  1EVH A;  2Y7B A;  2JF5 A;  4HXD A;  2GJY A;  2MP2 A;  4GMX B;  4MGI E;  4BBN C;  1IRS A;  2HRJ A;  2AL3 A;  3SHQ A;  2BF8 B;  2DEN B;  3L16 A;  1X11 A;  5CHV C;  4K7W A;  3DXD A;  1P3Q U;  2MDX A;  2C7M B;  2COD A;  2H7D A;  2K00 A;  2OJR A;  1MK7 B;  4JKH A;  2BGF A;  2K39 A;  1RAX A;  2LRW A;  2KD0 A;  4EEW A;  3APF A;  3DBL I;  3APC A;  3CXB B;  2RR9 A;  3OAW A;  4FN2 A;  3MHS D;  1FXT B;  3H7S A;  2ADZ A;  3SD5 A;  1DDM A;  1K5G B;  1NTV A;  2MBQ A;  1QC6 A;  3PGE A;  2DX5 A;  3UIO B;  2GOW A;  1RJ2 A;  2DX5 B;  1EF1 A;  2KVR A;  3C0R B;  4G3X B;  4NAW A;  4AJW A;  1MIZ B;  1WGH A;  4KSL C;  1V5P A;  2MWN B;  2NVU I;  1UNQ A;  2M38 A;  1W1D A;  1YJ1 A;  2KC1 A;  1NDD A;  3ZO5 B;  1FHW A;  2C60 A;  4MSM B;  3L08 A;  4FLH A;  3ZRF A;  2D3G A;  2O6V B;  3PRZ A;  1GC6 A;  4EZK A;  5C6R A;  3M95 A;  2DA0 A;  1OEY A;  4DWF A;  4IWP A;  2EMS A;  4HDQ A;  4PQ0 A;  3TMP B;  4JK9 A;  2IZV B;  3R3M A;  2PEA A;  3K9O B;  1UBQ A;  1MPH A;  1PFJ A;  4NPN A;  2J0J A;  3QHT A;  4IOY X;  3V60 A;  2EJ8 A;  3IVF A;  2DYN A;  2N1V A;  3MDB C;  5GMV A;  1WMH A;  4NJ7 A;  2M8S A;  4FHK A;  4ASW C;  3B1L X;  1WX9 A;  3SV1 A;  1XD4 A;  4BBK A;  5AZH A;  1WXV A;  2L0F A;  3VVW B;  1SIF A;  3DVG Y;  4ZYN A;  3HM3 A;  3PLV A;  3PSE B;  1UEF A;  3PEG A;  4ZDV A;  1EF5 A;  2KDF B;  3UF8 A;  3DBR I;  5EFX A;  1Z2M A;  1BTK A;  1UNR A;  2GBM A;  2LXA A;  3L0W B;  2LOX A;  4LJP B;  2PJH A;  4BVU C;  3S2A A;  2B3A A;  4KIK B;  2RPQ A;  1H10 A;  3CIK A;  4TV3 A;  3KUZ A;  3DVN V;  4W9L A;  1LM8 B;  2LGX A;  5FI1 A;  3H9D A;  3NZS A;  5DIF B;  1FHO A;  2MA9 B;  1WF9 A;  2H7E A;  4A6F A;  2QHO A;  4W9J A;  2DKQ A;  3O96 A;  2GBJ A;  2MLB A;  2W2W A;  4IC7 B;  4E3C A;  4EUT A;  1U5D A;  1AQC A;  2KWC A;  2D4Q A;  2MP2 B;  3JSV A;  1WR1 A;  3HW2 B;  2IBI B;  1LFD A;  4I6L B;  1F9J A;  4FAD A;  2FDQ A;  1YIW A;  1WGD A;  1WMH B;  2D11 A;  4WWO A;  3SNH A;  5LXH A;  1NTY A;  1FHX A;  3W1Y A;  2FNJ B;  1V81 A;  4EFO A;  2YRY A;  4JKG A;  4PS7 A;  1YD8 U;  4NY0 A;  2D10 A;  2RSG A;  4F7Z A;  1ZC3 B;  1WJ6 A;  2DYB A;  4DX9 0;  3PRM B;  1KJT A;  3FEH A;  1UGM A;  2LRU A;  2KX3 A;  3PVL A;  2GCJ A;  4F7G A;  2ELB A;  2YT1 A;  1H8C A;  4RMA A;  5CHF A;  4ILJ A;  2NMB A;  4MEL A;  3VUX A;  2LBB A;  1LQB A;  2V1Y A;  2RSU A;  2C9W B;  2L3Z A;  4ICV A;  3W1S A;  1HBK A;  1E7V A;  3A9K A;  2ZEQ A;  1Y19 B;  1P5T A;  4A5K A;  4CHK A;  1WVH A;  5J17 A;  2Z0E B;  1B55 A;  3NY5 A;  4EZL A;  2FJL A;  2M1M A;  1E8Y A;  2KJR A;  2C7H A;  2BKF A;  2KZR A;  3DXC A;  3WYF B;  2LI5 A;  3PVW A;  4IWQ A;  2N9X A;  1OGW A;  2KLC A;  2YSZ A;  2N7E A;  2RGF A;  2G45 B;  1QZE A;  4MM3 A;  4EZJ A;  1Q0W B;  4TQ1 A;  2CB8 A;  4NJ6 A;  3DXE A;  3EPY A;  2LXC A;  4BOS C;  2FID A;  1XR0 B;  4W9D A;  2CU1 A;  4HHV A;  2O6V D;  1UD7 A;  4GXB A;  3QWM A;  1W1H A;  2MRP A;  1W1G A;  3A9K B;  1WI1 A;  1LB1 A;  2REX A;  3N30 A;  2JY6 A;  1M7R A;  2M17 A;  5JHB A;  3ZTD A;  2IO3 B;  3L17 A;  3VTW A;  2LAS A;  4IAP A;  5DH9 B;  4K2P A;  2KAN A;  2I5F A;  2IO2 B;  3VDZ A;  5D7G A;  2LUE A;  4HAT B;  3TO1 A;  3AUL A;  3V61 A;  4KHB B;  3MJW A;  1WXM A;  2D9V A;  3UQB A;  1DIK A;  2LUL A;  5C23 A;  3TBL D;  2KFJ A;  2KN5 A;  2DIK A;  2DAJ A;  2WDT B;  4ICU A;  1JDE A;  1MG8 A;  1ZM0 A;  3PP2 A;  1ZVR A;  2JZ3 B;  1SHC A;  4FBJ B;  2ASQ A;  3RT3 B;  2CR5 A;  1XX0 A;  5CTR C;  2LGD A;  5D3V A;  2M0X A;  2Z0O A;  3T8M A;  2NBW B;  4RM9 A;  2ZPN A;  5E6P A;  2KTR B;  4A20 A;  2FCN A;  2LJ5 A;  1EGX A;  5E6N A;  4HAZ B;  2W9N A;  1WYW B;  1P0R A;  1TXD A;  4ZRJ A;  2Q13 A;  4G11 A;  2Z0P A;  4WSF A;  2N9P C;  3IG3 A;  2JPH A;  4IUM B;  3T9L A;  5KQ4 A;  2DZK A;  2A4Z A;  5CX3 A;  2KWU B;  2KDI A;  2ZCC A;  4HWI B;  3NSU A;  3GYP A;  2DZI A;  1TTN A;  5JLJ B;  1Q1O A;  3KVF B;  2UWQ A;  2DN6 A;  2BYE A;  3L13 A;  2LKO A;  1M7E A;  2XK5 A;  1RRP B;  5J3Y A;  1PLS A;  2DKP A;  4PYU A;  1U5E A;  4MY6 A;  1VBH A;  3IHP C;  1TJ6 A;  1E7U A;  2N23 A;  3ALB A;  2WWZ A;  4JKB A;  1C1Y B;  1N3H A;  1GG3 A;  1V80 A;  3U30 A;  1NBF C;  3ODW A;  4IW0 A;  1WRD B;  1P6S A;  2DHI A;  2PE6 B;  3ZIM A;  2YS5 A;  4A3O A;  5J3Q A;  3RCZ A;  2J0M A;  2COF A;  1V6E A;  1WGG A;  1GGO A;  1U2B A;  2YVC A;  1EO6 A;  3PZD A;  2FCM A;  3DPD A;  2BWF A;  2JT4 B;  4DHZ B;  1I2H A;  4J6I A;  2CQU A;  2K2J A;  2PPH A;  1C3T A;  3N7C A;  3NOB A;  2RQ1 A;  3ZUN A;  4ZRI A;  3KUC B;  3RUL A;  2L7R A;  3A9J A;  2X0S A;  1WX8 A;  3VH4 B;  2NR2 A;  4KIK A;  1V89 A;  1X05 A;  2JZZ A;  1WJ1 A;  2COA A;  2UZS A;  4IM2 A;  1K5D B;  3ONS A;  2ZNV C;  2IYB A;  4ANX A;  5TR5 A;  5J2R A;  2DX1 A;  1DYN A;  2KUP A;  3TJP A;  4K7U A;  4BKT A;  4BOZ B;  2AYO B;  3R66 C;  2RD0 A;  1WH3 A;  1ISN A;  3ODX A;  1V9J A;  2KFK B;  1BT0 A;  3HIZ A;  1J0G A;  5D6J B;  2ZVO A;  4NAW B;  5HE1 A;  5JZE B;  4B6H A;  1BTN A;  3WIM A;  3K9P B;  4ANW A;  2CHW A;  1MAI A;  2K1F A;  1BAK A;  5KCV A;  2JUO A;  1NVL A;  1U29 A;  2MKR A;  3A9J B;  4ILG B;  3PS6 A;  2R82 A;  3PSC A;  3MPX A;  3ECI A;  1PMS A;  2M14 A;  2LVQ A;  1DDV A;  4BKS D;  4KSK C;  4MGZ E;  2RVB B;  3G9W A;  5L95 C;  2HTH B;  1TZ1 A;  4DBB A;  3H7P A;  4HLE A;  2N1W A;  4YL8 A;  4HB3 B;  2JWZ A;  2C7N B;  4AP4 C;  2G4S A;  3CSF A;  4GDK A;  4Z2N A;  2D9X A;  2P0H A;  4MGY E;  3V6C B;  2BYV E;  1P3R A;  2GCL A;  3SYX A;  4ANU A;  4DHJ B;  3JSV B;  3DBH I;  3V6E B;  1OQY A;  5IJM A;  4FA6 A;  4JKA A;  1NU2 A;  3QA8 A;  1Q5W B;  3DQV A;  2COP A;  5DPT A;  2V76 A;  2IYD B;  3TL5 A;  4M0W B;  1KM7 A;  4A6F B;  5D3X A;  4MJS A;  2MCN B;  1WZ3 A;  2BWE S;  3TFM A;  4Y94 A;  4EKU A;  4GZU A;  1VD2 A;  1WZ0 A;  2EKE C;  2ZPY A;  2CAY A;  3CST A;  1X1G A;  3HK0 A;  1Y5O A;  3ZVV A;  3EEC A;  2IY1 B;  1D3Z A;  1QQG A;  2DHZ A;  2KOX A;  2KWV B;  1WGY A;  3L54 A;  1WJM A;  1P9D U;  4W9I A;  3VTU A;  2DHJ A;  2P8V A;  2JRH A;  2L05 A;  2FAZ A;  1GUA B;  2KQS A;  2HD5 B;  4W9F A;  4DXA B;  3R7R A;  1TGZ B;  2BPS A;  4K7S A;  3D8D A;  3QIJ A;  1LXD A;  4HK2 A;  4ANV A;  4HAW B;  3M3J A;  3VH3 B;  4GDK B;  3M62 B;  2D2Q A;  3V62 A;  4AUQ C;  3QAR A;  3AI5 A;  2KC2 A;  2R2O A;  2DYM A;  3QQ8 B;  2KMA A;  1WIA A;  4IFS A;  1TQZ A;  2YLM A;  2LZ6 A;  2DZJ A;  3N3K B;  4HCN B;  3TW1 A;  4HPM B;  3QWZ B;  5KQ1 A;  3FM8 C;  1WG7 A;  4E74 A;  1S3S G;  3PG7 A;  1RRB A;  5KHQ A;  3TIX A;  3HHM A;  1XT9 B;  1XOD A;  3UIN B;  3SBT A;  5CLQ B;  2KQ7 A;  3SO6 A;  1WM2 A;  2IY0 B;  1EAZ A;  5JHA A;  3X0W A;  3ML4 A;  1RLF A;  2NS5 A;  3X23 A;  2N9E B;  2G3Q B;  1YQB A;  3QK0 A;  1WFY A;  4PS3 A;  3LDZ E;  3ZNH B;  4TUU A;  5G55 A;  2WYQ A;  2R09 A;  1XKE A;  2K8B A;  2VRW B;  3VQI A;  2N7D A;  2GMI C;  2NBU A;  1HB8 A;  4DK5 A;  2DYQ A;  1TBE A;  3D8F A;  2OOB B;  3IFW B;  3AU5 A;  3PHX B;  2O6V A;  2YS3 A;  4GPT B;  1JRU A;  1GC7 A;  3BIN A;  4K81 A;  1DBH A;  2A5U A;  2VSZ A;  3U7D A;  3SBG A;  2Z0D B;  4WJN A;  4HB2 B;  4G50 A;  5JH5 C;  3RUI B;  3P2B A;  2MBE A;  1CMX B;  4B9K A;  1NTI A;  3FP5 A;  5G2N A;  2CRF A;  5J3T A;  5CLL B;  1WY8 A;  4XX5 A;  4LDT D;  1ZSQ A;  4AJY B;  5C5B B;  4GDL A;  3VFK A;  5AZG A;  5C79 A;  4K1R B;  2LYD A;  2N4F A;  4MT7 A;  2YT0 A;  2K8C A;  2KHW B;  2FCQ A;  4JQW C;  4HDO A;  3E9O A;  2CHZ A;  4GIV A;  4W9H A;  1P1A A;  3GOE A;  5L83 A;  2YF0 A;  1OTR B;  2CS4 A;  1Q67 A;  3E66 A;  1A5R A;  2D9Y A;  4HVB A;  3WA0 A;  3PVU A;  4P7I A;  1Z87 A;  2P0D A;  2E2X A;  2L8J A;  1WXA A;  3A33 B;  4WVF B;  4RM8 A;  2G35 A;  1V5T A;  4JK8 A;  2LWP A;  3UQA A;  3TCA A;  2IO1 B;  3OLM D;  4KV2 A;  4MJS B;  2DTC A;  1WE6 A;  4W9K A;  1YX6 B;  3RCP A;  5AZF A;  5DI9 B;  4TKN A;  4X57 B;  1X1F A;  4HB4 B;  3WAM A;  1UPQ A;  4ZRK A;  2KMC A;  5HE2 A;  3ZDM C;  2P0F A;  5BO4 B;  3WAL A;  1KLV A;  1WGU A;  4KZC A;  3ZLZ A;  2ZCB A;  2WX1 A;  3DVN U;  1ACA A;  3Q3F A;  1XD3 B;  1X86 A;  1U27 A;  1ZW7 A;  2BYF A;  3ZNG C;  4G0N B;  2Z0Q A;  2J59 M;  1SE9 A;  4I6P A;  3JVZ X;  1WI0 A;  5E6O A;  3A8Q A;  3RD2 A;  2GBN A;  3TVV A;  4KHO A;  1UEL A;  4FJV B;  2FJ9 A;  4KHA A;  4W9C A;  3DOW A;  3A1Q B;  5JVL A;  1V2Y A;  2R2Q A;  3CMM B;  3DDC B;  4YON A;  2NPT A;  3KUD B;  1L7Y A;  3QJZ A;  4URK A;  1UPR A;  1K8R B;  3PV1 A;  4GOC A;  2Y8F A;  2ZZP B;  1V88 A;  2NCN A;  1NI2 A;  1VBG A;  3UZT A;  4F7U P;  2CKH B;  3PRE A;  4JKE A;  1IYF A;  1BWN A;  2CY5 A;  2ROZ B;  5L81 A;  3PTF C;  3RYT A;  2PZ1 A;  5LLI A;  3WAN A;  4XWX A;  4LJO B;  4IM3 A;  3ZW3 A;  2KXJ A;  4LDT B;  1E5W A;  2LOZ A;  1KBL A;  2KX0 A;  2KGX B;  3E9P A;  1KC7 A;  3SDL C;  3ENE A;  2D9W A;  3H7P B;  1FGY A;  4JIO U;  1OEY J;  5D3Y A;  4JL9 A;  2EMT A;  1WE7 A;  4OVU A;  2LG1 A;  3KYD D;  3IBE A;  2ZJD A;  3P6A A;  4MH0 E;  1E90 A;  1E8X A;  2WX0 A;  2KK8 A;  4HCP B;  3ZNZ B;  1UZX B;  3P7Z A;  1UNP A;  2MSE D;  2GS0 A;  4KDI C;  1IPG A;  1WXS A;  5IAA C;  4KAX B;  4NQK E;  2O2V A;  3AJ4 A;  4XZ4 A;  4MGK E;  2K8H A;  2O2V B;  4IM0 A;  2HE7 A;  5JP4 A;  1V49 A;  5KHO A;  4GB9 A;  1IP9 A;  2RGN B;  3RZW C;  1V5U A;  3T06 A;  1UBI A;  4DDG D;  4TYZ A;  3D8E A;  3SU8 X;  2EC1 A;  4CHM A;  2KDB A;  3B0A A;  4ILH A;  4MEM A;  1FGZ A;  1HB6 A;  1ST7 A;  1L2N A;  4HB0 B;  4NNJ B;  3VUW A;  5HE3 A;  1WJU A;  3A4S C;  3JW0 X;  4DDI D;  2DHK A;  3KY9 A;  3KSY A;  4DX8 A;  2MQJ A;  1J0W A;  3E9L A;  1EUV B;  4HAX B;  2LGY A;  2AEH A;  2OQB A;  1XCG A;  2M4N A;  2KTR A;  2WH5 A;  2W2X D;  4A3P A;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...