2AL6A

Ferm domain of focal adhesion kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
373
structure length
343
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQTDDYAEIIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 98
structure length 343
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2al6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2al6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al6A01
3PRZA 1V6EA 1VD2A 3TW1A 2A4ZA 3ZUNA 3D8EA 5CHWA 1AQCA 4GN1A 1IRSA 3N7CA 2LD9A 2KNBA 1WMHA 1XT9B 3QX1A 3OLMD 2GBJA 2KHWB 3QK0A 2Z0QA 3LJ3A 1WXVA 5DHAB 4LDTD 2DZKA 3V6CB 4PNKA 1QZEA 1WMHB 2DKPA 2LJ5A 4ANXA 3PHWB 4FHKA 3JYUA 4ZRIA 2M0XA 4GDKA 4K2OA 3VUYA 4A6FA 2CY5A 4MSMB 4OVUA 1V5PA 1V5TA 2YSZA 3MJWA 4MGYE 1XODA 3A98B 4PQ0A 1GJZA 2ROVA 3T9LA 1HB8A 4PS3A 2MBEA 1WJMA 3DVGY 2GBKA 2DFKA 2KDFB 1DDWA 1OTRB 3KW5B 4NJ6A 4RM9A 1P9DU 2M14A 4HPLB 4BKSA 3UIOB 1FOEA 2IBIB 1X86A 2NMBA 4GMVA 2OQBA 2RSGA 2NS5A 4MJSA 2M4NA 4PS8A 2DHKA 2LG1A 4W9LA 2N23A 2YS1A 4GGQA 3DCGA 4NSWA 4ZYNA 3DXDA 2W2XC 4XX5A 4E71A 3D8DA 4FLHA 1XD4A 4RM8A 4C0AA 5D3YA 4ICVA 1WR6E 2KDEB 3PRMB 3IHPC 5L81A 2HJ8A 3R66C 1WI0A 2IY0B 1FAOA 4TQ1A 4B9KA 2BGFA 2C5LC 3ZNZB 3TO1A 1TZ1A 1UELA 4F7HA 3QARA 3WAOA 5FI1A 2ZCBA 4KZCA 2W9NA 2FCMA 2Z0PA 1WX7A 5C23A 4MGZE 3NSUA 4HAWB 1ZM0A 1OEYA 1HB6A 3FLVA 1H8CA 1CMXB 3DVGX 1WJUA 1YJ1A 3TBLD 1JRUA 4Y94A 3PG7A 4NAWB 3RULA 2N4FA 1OY2A 3FP5A 2MFQA 2RGNB 3RYTA 5J17A 2I1KA 1J8CA 2N7DA 1XX0A 1PLSA 1UPRA 2VRRB 3V61A 1V86A 3RCZA 2ELAA 2K39A 4II3B 2CKHB 3MPXA 1M94A 5J18A 4B6HA 2PZ1A 2R09A 2C7HA 4M0WB 2GS0A 5C1ZA 5D2MB 1WGRA 4BKSD 2PPHA 2ZPYA 5JH5C 2G45B 2UWQA 2LGDA 1Q0WB 1V5UA 3ZTDA 1FGYA 1G6JA 1L2NA 3LDZE 2FCSA 2O6VA 2COAA 4BOZB 2G4DB 1W1HA 1WJ1A 3RZWC 5DCNA 1N3HA 2Z0DB 4EZLA 3BINA 2ZNVB 2RQ1A 1WX9A 2KCJA 3A4RA 4E74A 4GIVA 3G9WA 4PYZA 3HM3A 2KXJA 1Z87A 3VFKA 3APCA 3M1IB 1LQBA 2KWCA 4P7IA 1DDVA 3NZSA 2MBOA 2EMSA 3V60A 3ULBA 2KZRA 1RLFA 3K9PB 3JSVB 2JWZA 2IO2B 5C79A 4NPNA 3KY9A 2MCNB 1V61A 3PV1A 2JZ3B 3KYDD 3QWZB 4EOYA 2Z0EB 3AJ4A 4WSFA 1WZ0A 3VIAA 3WYFB 2GBNA 1TQZA 2D9ZA 2H7DA 4LJOB 3ONSA 2MBQA 4TV3A 5G55A 2JY6A 5LOPB 1WG7A 3IFWB 2L0FA 1V9JA 2GCJA 3ZTCA 4K1RB 1TXDA 1V89A 1Z2MA 2JRHA 2WDTB 4DX8A 1FHXA 2COCA 2MX2A 4DK5A 2KJRA 1WJNA 2FIFA 2DN6A 2N0YA 5D3VA 3FM8C 2OOBB 1P6SA 5E6OA 2RLOA 2FUHB 5IAAC 1Y8RC 3ML4A 4DWFA 1C3TA 3A9JB 1WGUA 1WY8A 1V80A 4L6EA 3P6AA 4I6NB 4MT7A 3X23A 2C7NB 1MAIA 1U5FA 3DQVA 1YX5B 2JZZA 2KVRA 4JL9A 2FIDA 5DHFB 5J3QA 1NVLA 1ACAA 3IVFA 4FJVB 4URKA 2MRPA 2LWPA 3N32A 2RGFA 2ZCCA 3H7PA 4MK0A 4A3PA 3OANA 2N7EA 5DPTA 1QC6A 4HAVB 1VCBA 1V2YA 1C1YB 2COFA 3QA8A 1YX6B 2G3QB 3DVNV 5JHAA 2LGXA 1NTIA 3VVWB 4B95A 3KH0A 3D32A 4CHMA 4GMXB 1IPGA 4W9JA 1I7AA 1RRBA 2LUEA 3V6EB 2PE9A 4IG7B 3VHTC 4XWXA 3ENEA 1T0YA 2DLWA 5C5BA 3UQBA 5IJMA 4IW0A 4KHAA 2DAFA 3ODXA 5D6JB 3TMPB 3R3MA 4MH0E 4DHJB 2DHZA 5C5BB 2XK5A 2K6DB 5BO4B 2C60A 2JP2A 2EMTA 2IO0B 3VUWA 2V3SA 1A5RA 2MQJA 3NS8A 2C7MB 4GOCA 3SU8X 4NQKE 1UNQA 4WQOB 4GXBA 2JRIB 4G50A 1E5WA 1SGHA 2DAJA 1WIAA 2KJ6A 2BWES 4FULA 5JLJB 5AZHA 3ULCA 2BPSA 3ML8A 3CIKA 1J0GA 5HE1A 3LJUX 2B3AA 5JHBA 5CHVC 1YIWA 2YLMA 1WGHA 4TUUA 2XBBC 4KHOA 5FI0A 3ZDTA 1YQBA 3NY5A 5J3TA 2CR5A 2H7EA 5JHGA 1WM2A 5JZEB 4DHJD 3PRPB 2L76A 2A5UA 1H10A 2KWVB 3L17A 1EF1A 4OVVA 4ICUA 4FJYA 1RFAA 1KI1B 1UNPA 3L10B 1I35A 3ZRCA 1ZSQA 4GDKB 3NZUA 5C6RA 3B1LX 2OJRA 4A6FB 4KSLC 2QKMA 2MBBB 2GBMA 4KVGB 1K8RB 3UF8A 2G4SA 1WGGA 2P8VA 5C16A 2AYOB 1PQSA 3A4SC 2VKIA 2DZIA 4A6KA 1U27A 4BVUC 2DX5A 3PP2A 4K2PA 3B0AA 1E8YA 4EKUA 3R7RA 5CX3A 2N1WA 3ZNHB 3P2BA 5LXHA 4GPTB 3O65B 4MJSB 4W9CA 2MKRA 2FCNA 1KZ7A 1NTVA 3PLUA 1IP9A 4HXDA 1WR1A 3V5WA 2JUOA 3L0WB 3AULA 1Q67A 2MWSB 4FBJB 1GG3A 2NVUI 3EPYA 1LFDA 4A20A 1V5MA 2LOXA 4DDGD 1J0WA 2QKLA 3I3TB 3KUDB 4TQ0A 4X57B 1Q1OA 4IUMB 2GJYA 4ANWA 2UZSA 5J3YA 4HVBA 2JVCA 4M8NA 2L8JA 5DI9B 4IFSA 2J0JA 1SE9A 1WYWB 1XQQA 2KDIA 2FCQA 3GYOA 2DKQA 2KQSA 3VH3B 1U5EA 3VXWA 2K6QA 1FXTB 2D4QA 2BYVE 1XR0B 4TYZA 2RD0A 2E2XA 5KHOA 2CHZA 3JVZX 4M8MA 5TR5A 1ZVRA 3VTVA 4BBKA 4HPMB 2UZRA 2KANA 1RAXA 3H1UA 4IM3A 4NQLB 5KQ4A 5DPSA 1WF9A 4WWNA 4N9F4 2WX0A 3VUXA 3A9KA 3UGBB 5LLIA 4YONA 2LGYA 2PEAA 3A33B 1E8XA 3VAWA 2NBVB 2WX1A 1Y5OA 2KK8A 4BKTA 3VTUA 2ASQA 2HTHA 1XD3B 2O6VB 3A9KB 4GSWA 1UGMA 4CHJA 3DOWA 1TJ6A 1ZW7A 2MA9B 5D3WA 4W9HA 3SV1A 2IFSA 4IM2A 2HTHB 3DVNU 1J19A 3TVVA 2KFKA 3QBVB 1NBFC 1OQYA 4EUTA 2NPTA 1ZC4B 2GMIC 2BYFA 2I1JA 2KN5A 4HLEA 1U5DA 1P98A 2LVOA 2V1YA 2KFKB 2LULA 1E8ZA 5LONB 3SYXA 4ZRJA 3PHXB 4JQWC 3KUCB 3KZ1A 3KRWA 3GZNI 3F5RA 4MDKE 1BTKA 1PMSA 4IOYX 2WWZA 1GC7A 3VTWA 1H4RA 3UZTA 2IO1B 3ODWA 2ZPNA 1OQNA 4MGIE 3UIPB 2G35A 2Y5BB 4A6HA 4MY6A 1WGYA 1IYFA 2KMAA 2YF0A 4H8SA 2BYEA 1TGZB 4W9EA 1NU2A 2ADZA 2AL3A 2WYQA 2ZZPB 4IWOA 2EKEC 3FSSA 3L13A 2UVMA 4DHZB 4D0NB 3H7SA 3KUZA 2CU1A 3ZVVA 3PSEB 4HATB 2O6VD 3AXCA 1DYNA 1GNUA 2HE7A 3A8PA 1P3QU 1DDMA 2L05A 4YL8A 2KX0A 3S2AA 2NZ8B 4F7GA 4DBGA 5DIFB 1WZ3A 2MDXA 2N9XA 4B6WA 4F7ZA 1P1AA 4W9GA 4HCNB 4BOSC 4HDQA 4GU2A 4I6LB 3QQ8B 3W1SC 1MG8A 2W2XD 4DDID 2YVCA 4IC7B 1U4AA 2BWFA 3HK0A 1OGWA 4BBNF 4KHBB 2CAYA 2J0MA 4HAUB 4K81A 4HCPB 2L1CA 5D3XA 2NBUA 3U7DA 2K8HA 4LCDE 1WXMA 1M7EA 2CB8A 3MHSD 1LW3A 4FN2A 5G2NA 2MP2A 2YS3A 5HE2A 3ZKJC 1WFYA 3NOBA 4EJNA 2M17A 4KIKA 4IAPA 3KYCD 1X11A 2KFJA 3HW2B 2KQ7A 3H7PB 4ANVA 4AOFA 4CYEA 2YT0A 1MK7B 1S3SG 3ZLZA 4HB0B 3PGEA 3ZNGC 4MGKE 4WJQA 2L3ZA 3HM6X 3L08A 4KV2A 1ZC3B 2Z59B 2Y8FA 3DBHI 5CTRC 4W9IA 2D07B 1MKEA 1AARA 3DXCA 2COPA 3P7ZA 2VRWB 3KSYA 4G11A 3OJ3A 1L7YA 1P0RA 2HRJA 2LBBA 2BKFA 1UD7A 4F7UP 2YRYA 2UYZB 3N3KB 4DHZE 3OJ4B 3A1QA 1UH6A 3QC8B 2XK5B 2LYDA 2RR9A 1KM7A 5CLLB 1E7UA 2LI5A 4K7SA 4E3CA 2K8CA 1XCGA 1WVHA 1ST7A 1WXSA 4FJZA 1WM3A 1UZXB 4CO7A 3D8FA 3PZDA 4IM0A 3VQIA 3DBLI 1XKEA 1V5OA 5CLQB 5HE3A 1KZGA 1K5GB 3PEGA 3UQAA 2NBWB 1I42A 2OTXA 3QIJA 5GMVA 1DROA 1P3RA 2KMCA 3GYPA 1UNRA 2FJLA 4ASWC 4A5KA 1F9JA 2DYOA 3WANA 5JP4A 1V49A 4AUQC 4J6IA 4Z2MB 3IBEA 2KTFA 4JGHB 4F1SA 3M95A 3EFUA 4A3OA 3CXBB 2ABDA 3H9DA 5D94A 3EECA 1EVHA 2IZVB 4EEWA 3SO6A 2CHXA 4XZ4A 5KCVA 3PVLA 1X1FA 2MLBA 4W9DA 2LVPA 1EO6A 2N1VA 3PPAA 5EDSA 3EC8A 1WJ4A 4IWPA 3BJIA 1GUAB 2XEWA 2RPQA 1WE7A 2CQUA 3A8QA 3TL5A 5IA7A 2K00A 1S1QB 2ZNVC 2CODA 4BBNC 3PLVA 3ZDMC 2D2QA 3ALBA 3SDLC 2KUPA 2FDQA 2C9WB 4NNJB 2RVBB 4WWPA 4HB4B 2DENB 3MDBC 1V81A 4WJ7A 2LKOA 1I2HA 3QCAA 4WJNA 2ZVNA 3VH4B 2DYBA 2DX5B 2D9YA 2Z0OA 1UBQA 5CHFA 5LXIB 3QAQA 2Q13A 2DA0A 4HWIB 5HKHA 2DHJA 3ZNID 3X0WA 5L83A 5D27A 2J7QB 2LRUA 1R4MI 3SNHA 2R2QA 4MELA 1MIXA 1E90A 2AEHA 2DHIA 1WGDA 1RJ2A 4K7WA 2NCNA 4II2B 4GB9A 5KHQA 3TFMA 4CHKA 5D7GA 4NAWA 2P0HA 2KC2A 1U2BA 3PSCA 3RZFA 1BT0A 1EGXA 1WXAA 2KJHB 3EHVA 3Q3JA 2KKCA 1OEYJ 3SUZA 4WJPA 2EC1A 3RD2A 2DX1A 3FEHA 3JW0X 1OMWA 2GBRA 4KSKC 2N9EB 3RCPA 3CSFA 2VSZA 3DBSA 5E6PA 2ELBA 4KZ0A 2BF8B 1X05A 2M38A 5KQ1A 2ZVOA 2LXAA 2ZEQA 4ZDVA 1U29A 4WAAA 2KWUB 2V4LA 4HDOA 3PTFC 1E7VA 2I5CA 4DBBA 4HB3B 3ZRFA 2EJ8A 2D9WA 2XQNM 2DYMA 3L54A 3WA0A 3OAWA 1HBKA 5AZFA 1UBIA 3DPDA 3QJZA 4W9FA 3NHEB 3ML9A 2ROZB 3V62A 3ECIA 2N9PC 1KOTA 4HAZB 4KDIC 2PE6B 2KDBA 3PVUA 1Z5SB 3DBRI 4ANUA 3T06A 1WJ6A 4W9KA 4NY0A 4K17A 4JLCA 2KGXB 1DBHA 1W1GA 1WH3A 3CSTA 2L00B 5EFXA 2D10A 4PYUA 3WALA 3ZIMA 4JIOU 2RSUA 3T8MA 1TBEA 2BCJA 3QHTA 3M62B 2M1MA 3KRXA 3CMMB 3CF6E 1AWEA 1R4NI 4K7UA 3HQCA 2K1FA 1EF5A 1MIZB 2MSED 3JSVA 2LOZA 2NPTB 3PS6A 3HIZA 3RT3B 3SD5A 1ZGUB 2Y7BA 4MM3A 1KLVA 2BKRB 2MW5A 2LRWA 2KOXA 4PS7A 4G3XB 4EMOA 2D9VA 2L0TA 2D3GA 1QQGA 3PREA 2Y8GA 4BFRA 4XC2A 2YT1A 4EZKA 5GOWB 2GOWA 2MBHA 1EUVB 2V76A 1ZKHA 3HHMA 4HAXB 5JHHA 4AJYB 2W2WA 4KDLB 4BKGA 2FNJB 2LZ6A 1LXDA 1E8WA 2FAZA 5HE0A 2JF5A 4LJPB 1K5DB 2DZJA 2KLCA 3MTNB 2CS4A 4GDLA 2J0KA 4I6PA 2RUKB 2AL6A 4HAYB 1SIFA 4KAXB 4MSQB 4FA6A 1UPQA 3F0WA 3KVFB 2KO3A 1WI1A 4HK2A 1NDDA 2MWNB 1HE8A 1V88A 4DXAB 3N30A 4GDLB 3PT2B 1FB8A 2ZJDA 5DPWA 1FGZA 2CHWA 5E6NA 3O96A 3M63B 2NR2A 1X1GA 3B08A 2WH5A 3ZO5B 2K2UA 5L95C 4ZRKA 2O2VA 4AJWA 2RNRB 2IO3B 3A9JA 4IWQA 1RRPB 4WJOA 3WIMA 1LB1A 1D3ZA 3TJPA 1WE6A 4MEMA 3AU5A 2K25A 2R2OA 1WRDB 1B55A 4RMAA 2O2VB 4F8CB 3VDZA 2GCLA 3UINB 3ODOA 1SHCA 3ZVRA 2FJ9A 1NI2A 3L16A 1YD8U 2REXA 2KTRA 4HHVA 2HD5B 4HJKA 2P0DA 2K2JA 4GZUA 1MPHA 2CRFA 2L2IA 3QWMA 1TTNA 2KD0A 1Y19B 2X18A 2MP2B 1UEFA 3SHQA 2KTRB 3IG3A 5DH9B 4KIKB 3GOEA 3VOQA 2KC1A 1MK9B 3DXEA 3M3JA 2JT4B 3K9OB 2IY1B 2KX3A 4FHJA 5AZGA 2DTCA 2KLGA 3TCAA 1GC6A 3TIXA 3WAPA 4TKNA 2IYDB 2M8SA 3WAMA 1P5TA 2K8BA 3DDCB 1W1DA 2L7RA 1ISNA 5AEKB 4NJ7A 4AP4C 4HB2B 2DYQA 2LVQA 3U30A 3R7QA 4LDTB 1WX8A 3C0RB 4EFOA 5DPRA 2JXXA 3W1YA 1NTYA 2JPHA 2PJHA 1KJTA 3A1QB 4DX90 3AU4A 2R0DA 2QHOA 2YS5A 2LASA 3BY4B 3AI5A 3APDA 2I5FA 4FADA 3APFA 2IYBA 5FR6A 2LXCA 1BWNA 2J59M 1FHOA 4EZJA 4WVFB 2AWTA 1FHWA 2P0FA 1EAZA 1BAKA 3H6NA 1LM8B 3Q3FA 1Q5WB 1PFJA 1X1MA 2D9XA 4WWOA 5J2RA 4AWJA 1M7RA 3W1SA 2DZMA 3ZW3A 1BTNA 3PVWA 2D11A 4Z2NA 1WGQA 3U8ZA 3RUIB 2CY4A 2DYNA 1U5GA 4G0NB
chains in the Genus database with same CATH superfamily
3PRZA 1V6EA 1VD2A 3TW1A 2A4ZA 1C78A 1JWUD 3ZUNA 3D8EA 2CU3A 5CHWA 1AQCA 4GN1A 2Q5WD 1IRSA 3N7CA 2LD9A 2KNBA 1WMHA 1XT9B 3QX1A 1DGJA 3OLMD 1T0SC 2NTSA 2OHFA 2GBJA 2KHWB 3QK0A 2Z0QA 3LJ3A 1WXVA 3NW8A 5DHAB 4LDTD 2DZKA 3V6CB 4PNKA 1QZEA 1WMHB 3AN1A 3NVWA 2N7JA 2DKPA 2KN4A 5C3JB 2LJ5A 2WGSA 3W5UB 1YN5A 4ANXA 3PHWB 4FHKA 3JYUA 1NYRA 4ZRIA 1ESFA 3SBGA 2M0XA 4GDKA 4K2OA 3KLSX 1YMHE 3VUYA 4A6FA 2CY5A 4MSMB 4OVUA 1V5PA 1V5TA 2YSZA 3MJWA 2JWUA 3FKYA 3HUIA 4MGYE 1XODA 3A98B 4PQ0A 1GJZA 2ROVA 4UDUC 1CZPA 3T9LA 1HB8A 1VDVA 3P63A 3HVZA 4PS3A 2MBEA 5HG2A 1WJMA 1SE3A 3DVGY 2GBKA 2DFKA 2KDFB 1DDWA 3CIRB 4H2AA 4RH6A 1OTRB 4DQOC 3KW5B 2M0AA 4NJ6A 1FMAD 4XYCA 4RM9A 1P9DU 2M14A 4HPLB 1OQQA 4BKSA 3UIOB 1FOEA 2WXHA 2IBIB 1X86A 1PDXA 2NMBA 3ZQ4A 4GMVA 3TSSA 2OQBA 2RDHA 2RSGA 2NS5A 4MJSA 2M4NA 1FXIA 1SB3C 4PS8A 2DHKA 2LG1A 4W9LA 1V1PB 1F77A 2N23A 2YS1A 4JPSA 4GGQA 3DCGA 4NSWA 4ZYNA 3DXDA 2W2XC 4XX5A 4E71A 3TEWA 3D8DA 2K8EA 1F1HA 1FM0D 4FLHA 1XD4A 4RM8A 4C0AA 1J7AA 5D3YA 1C4PA 4ICVA 1WR6E 2KDEB 4C00A 3PRMB 1J7CA 3IHPC 5L81A 2HJ8A 3R66C 1WI0A 3URYA 2IY0B 1FAOA 2L83A 4TQ1A 4B9KA 2BGFA 2C5LC 3ZNZB 3TO1A 4QJ3B 1TZ1A 1UELA 4F7HA 1UF0A 2KUQA 3QARA 3WAOA 5FI1A 2ZCBA 4KZCA 2W9NA 2FCMA 1VLBA 2Z0PA 1YJIA 1WX7A 3I5JC 5C23A 2WP9B 2QSDA 4MGZE 3NSUA 4HAWB 1ZM0A 1OEYA 1HB6A 3FLVA 1H8CA 3OHMB 1CMXB 3DVGX 3IXSA 1WJUA 1YJ1A 3TBLD 1JRUA 4Y94A 3UI3A 3PG7A 1XLNA 4NAWB 3RULA 2N4FA 1OY2A 1C76A 1HZ5A 3KQ4A 3FP5A 5BYQA 1HTQA 2MFQA 2RGNB 3P4SB 1GOZA 3RYTA 5J17A 2I1KA 1J8CA 2N7DA 3EFCA 2H89B 3I9V1 3SFDB 1XX0A 1PLSA 1UPRA 2VRRB 3E9OA 2AQ2B 3V61A 4C80A 1V86A 1VZ8A 4XWWA 3RCZA 2ELAA 2K39A 3AE7B 1BXTA 1TT5B 4II3B 2CKHB 4M0WA 2WXIA 3MPXA 1M94A 5J18A 4B6HA 2PZ1A 3O13A 4FXCA 5FKAC 2R09A 2C7HA 2D3AA 4CSQA 4M0WB 1JROA 2GS0A 4L23A 5C1ZA 1IBXA 5D2MB 1WGRA 1K53A 3J9CA 4BKSD 2PPHA 2ZPYA 1STEA 5JH5C 2G45B 2UWQA 2LGDA 1Q0WB 1V5UA 3ZTDA 2NBVA 1N60A 1YQ3B 4JK8A 2EKIA 1FGYA 1G6JA 1L2NA 3LDZE 2FCSA 2WLBA 2PW9A 2O6VA 2KWDA 3BIID 1L0XB 2NMQA 2COAA 1SXTA 2IDYA 4BOZB 3W9CB 5BYRA 3RNCC 1KLGD 3RNFC 2DIKA 2G4DB 1TS3A 1W1HA 1UWXA 1WJ1A 3RZWC 1ZYIA 1TKEA 1L0YB 5DCNA 1N3HA 1QKZA 2Z0DB 4L1RA 4EZLA 2X38A 5D3DA 3BINA 5BMGA 2ZNVB 2RQ1A 1WX9A 1I4HA 2KCJA 3A4RA 4E74A 1HZ6A 4GIVA 4P6VF 3AEDB 3G9WA 2KVZA 4PYZA 3HM3A 3N20C 2KXJA 1Z87A 3NJTA 3VFKA 3APCA 4OT1A 3M1IB 1LQBA 2KWCA 4P7IA 1DDVA 1UNSA 1QT9A 4AS1A 3B2FA 3NZSA 2MBOA 2EMSA 3V60A 3ULBA 2KZRA 1RLFA 3K9PB 3JSVB 2JWZA 2WXOA 2IO2B 5C79A 4NPNA 4JE3B 1FNUA 3KY9A 2MCNB 4GLSC 1V61A 3PV1A 2JZ3B 3DWGC 3KYDD 2CJOA 3QWZB 3U12A 2PKOA 4MM3B 4QAYA 2Z0EB 3Q3OC 4EOYA 3DBRB 2K5PA 3AJ4A 4WSFA 1E9MA 2X0SA 1WZ0A 3VIAA 3WYFB 3HRDD 3Q8AA 1PYWD 1TQZA 2GBNA 2Z4DA 2D9ZA 3AE5B 2H7DA 2N0SB 4LJOB 3ONSA 2MBQA 5GXGB 2V3PA 4TV3A 5G55A 2JY6A 5LOPB 1PGAA 2QCZA 1WG7A 2ZKMX 3IFWB 4NZLB 2L0FA 1V9JA 1MFWA 4P1BC 2GCJA 4QJ4B 2MJDA 3ZTCA 2QILA 3BK2A 1TZOA 4K1RB 3MC9A 1TXDA 3U2SC 2PVOD 2WQYB 1CK1A 1V89A 4JKHA 1KLUD 1Z2MA 2JRHA 1FCCC 2WDTB 2INNE 4DX8A 1FHXA 2COCA 2MX2A 4DK5A 2KJRA 2ONQA 1N61A 1WJNA 2JXTA 2FIFA 2DN6A 4RGTA 3AEEB 2N0YA 3NWAA 5D3VA 1F52A 3FM8C 2OOBB 1TS5A 2VZKB 4OW0A 1P6SA 3B77A 5E6OA 2RLOA 2QEJC 5IOIA 4OSNA 2FUHB 5IAAC 1Y8RC 2LGSA 4OZBA 3NWDA 3ML4A 1YQ4B 1P7EA 4DWFA 1C79A 2LGIA 1C3TA 3FAHA 4KHBA 2WXKA 1IUEA 3A9JB 3C8YA 1WGUA 1WY8A 2BB5A 1FEHA 4PT5A 1PGXA 2WXPA 3T3OA 1V80A 4L6EA 1T77A 3P6AA 2IJ0A 4I6NB 3E56A 4MT7A 1KTKA 3AEGB 3X23A 2C7NB 4USAA 1MAIA 2HDEA 1U5FA 3DQVA 1YX5B 2JZZA 3T3NA 2KVRA 3AEAB 4JL9A 2FIDA 5E6JA 5DHFB 5J3QA 1NVLA 1ACAA 2PVGC 3IVFA 4FJVB 2WXJA 4URKA 2MRPA 2LWPA 3N32A 5I2MA 3AM9A 2RGFA 2BS2B 2N9LA 2ZCCA 3H7PA 4MK0A 2LHDA 1SBBB 1VZ6A 2V3NA 4RFBA 3OANA 4RNAA 4A3PA 2V0GA 2N7EA 3DHHC 4LNIA 1FCLA 5DPTA 4EE2A 1JMLA 1QC6A 4HROA 1MI0A 4HAVB 1VCBA 1L6UA 1V2YA 4RGOS 1C1YB 4LNNA 2COFA 3AECB 1AWDA 2Z59A 1YX6B 2G3QB 3QA8A 3DVNV 2FBWB 5JHAA 4C56C 2LGXA 1NTIA 3E9LA 3VVWB 4B95A 3KH0A 3D32A 4M00A 4CHMA 3P1MA 4GMXB 2HTME 1IPGA 2ON8A 4W9JA 1I7AA 1LO5D 1RRBA 2LUEA 3V6EB 4JWSC 1IGCA 3PO0A 2GB1A 2PE9A 4IG7B 1FFVA 3N9YC 3VHTC 4XWXA 3ENEA 1T0YA 3AE1B 2DLWA 1M4VA 5C5BA 3UQBA 5IJMA 4IW0A 4KHAA 4TMAB 3IAM1 2PIAA 2DAFA 1JDEA 3ODXA 2VZKD 5D6JB 3TMPB 3R3MA 5I2SA 1IGDA 4MH0E 4DHJB 2DHZA 4YTMB 4C7YA 5C5BB 1FRRA 5IO9A 2XK5A 2K3UA 2K6DB 5BO4B 1UUPA 4US9A 2C60A 1JALA 3B2GA 3FC4A 2JP2A 1SJHD 2LEKA 2EMTA 4B0MA 2IO0B 3VUWA 3DWMA 2V3SA 1A5RA 3P42A 4K3BA 1N5XA 2MQJA 4BAXA 3NS8A 2C7MB 4GOCA 3ZJVA 1ZDXA 3SU8X 1VJKA 4NQKE 1UGJA 1UNQA 4WQOB 1XF5L 4GXBA 4NJCA 2JRIB 3BZDB 2L1AA 4G50A 1E5WA 3DHGC 1SGHA 2DAJA 4ARIA 1WIAA 2KJ6A 2BWES 4FULA 5JLJB 5AZHA 3ULCA 1XEEA 1WGKA 1P7FA 2BPSA 1L4DB 3SEBA 3ML8A 5BMHA 3CIKA 3SBTA 2VH1A 1J0GA 5HE1A 1ZDVA 3LJUX 2B3AA 5JHBA 3GS2A 5CHVC 1YIWA 2YLMA 1WGHA 4TUUA 1UWMA 3SR6A 4C4VA 2M19A 3N1YC 2XBBC 4KHOA 5FI0A 3ZDTA 2FJUB 1YQBA 3NY5A 5J3TA 4IOIE 1BUIC 2CR5A 2H7EA 4ZHOA 5JHGA 1WM2A 4JKCA 2IGGA 5JZEB 4DHJD 4US8A 2JYEA 3PRPB 3BWUD 2BVCA 3RFZB 1D5ZC 2L76A 2A5UA 1H10A 2KWVB 3L17A 1CQVA 3IT6B 2I38A 3HVDA 1EF1A 4OVVA 1YN3A 5BMIA 2INCC 4ZOHC 4ICUA 4FJYA 1RFAA 3I57A 1KI1B 1UNPA 3L10B 4XWTA 1I35A 3DCXA 3ZRCA 1ZSQA 1FFUA 4GDKB 4M02A 3NZUA 5C6RA 1BMLC 3B1LX 2OJRA 4A6FB 4KSLC 1F2RC 1KFYB 1HXYD 2QKMA 1TJEA 1JW9D 2MBBB 2XNAC 1T0RC 2GBMA 4KVGB 1K8RB 3UF8A 2G4SA 1WGGA 2P8VA 5C16A 2AYOB 5MPOA 1HQRD 1PQSA 3A4SC 2VKIA 2DZIA 2D3CA 4A6KA 1TKYA 1FPYA 1U27A 4BVUC 2DX5A 4YXDB 2QMTA 2BS3B 3AH7A 4HRSA 4JKAA 3PP2A 1EM7A 1XO3A 1SE2A 1V97A 4K2PA 3B0AA 1E8YA 1AN8A 4EKUA 3R7RA 5CX3A 2N1WA 3ZNHB 1FNVA 3VR9B 4JK7A 2JSVX 3P2BA 5LXHA 3Q6BA 3TEXA 3NVZA 4GPTB 4YSZB 4JX1C 3O65B 4MJSB 2WXNA 1JQ4A 4YTPB 3EGRA 4W9CA 2MKRA 1MVKA 2D5GA 2FCNA 1PUTA 3AV8A 3MP9A 1KZ7A 1NTVA 3PLUA 1IP9A 4HXDA 1WR1A 2DBYA 1HA5A 3V5WA 4A90A 3Q69A 2WDVB 3RNBC 3E66A 2JUOA 3L0WB 3AULA 1Q67A 1GB4A 2YT2A 2MWSB 4N58A 4FBJB 1GG3A 2NVUI 3EPYA 1LFDA 2WXLA 4A20A 2E3TA 1D4BA 1V5MA 2NTTA 2LOXA 4DDGD 1B9RA 1J0WA 2QKLA 2MJEA 3I3TB 3KUDB 4TQ0A 1QLBB 4X57B 1Q1OA 1MI1A 4DXGA 4IUMB 2QJLA 2GJYA 1HEZE 4ANWA 3ZXVA 2UZSA 3LB8C 5J3YA 4HVBA 2JVCA 1F0ZA 4M8NA 5H8YE 2L8JA 3ZJUA 5DI9B 4IFSA 2J0JA 1VR9A 2H88B 1SE9A 1YOVB 1A70A 1I4PA 1WYWB 1XQQA 2KDIA 2FCQA 1F2RI 3GYOA 2DKQA 2KQSA 3VH3B 1WXQA 4JKDA 1U5EA 3VXWA 2K6QA 1JCKB 1FXTB 2D4QA 2BYVE 4P16A 1XR0B 1GGOA 4TYZA 2RD0A 2E2XA 5KHOA 2CHZA 3JVZX 4M8MA 5TR5A 1ZVRA 3VTVA 4BBKA 4HPMB 3HSAA 3E9PA 3NS1A 2HJ1A 2UZRA 4C7ZA 2KANA 2KIEA 1RAXA 1K52A 3H1UA 4IM3A 4NQLB 5KQ4A 5DPSA 3AE3B 1WF9A 3AEBB 1ZP0B 1IBXB 4WWNA 4N9F4 4LNKA 2WX0A 3VUXA 5LNK1 1E6EB 3A9KA 1ZXHA 3UGBB 5LLIA 4YONA 2KT7A 2LGYA 4KGRA 2PEAA 3HIEA 3AE8B 3A33B 1E8XA 3VAWA 1T3QA 2IGDA 2NBVB 3MFGA 2WX1A 1Y5OA 2KK8A 3NUHB 4BKTA 3VTUA 2ASQA 2HTHA 1XD3B 2O6VB 3A9KB 4R3DA 4GSWA 1XCQL 3IT4B 1UGMA 4N6EB 4KX6B 4CHJA 1FO4A 3DOWA 3R2TA 1TJ6A 1ZW7A 2MA9B 1K51A 5D3WA 1JWSD 4W9HA 3SV1A 2IFSA 2W82A 4IM2A 5HHDG 2HTHB 1RFKA 3DVNU 1J19A 3TVVA 4N59A 2KFKA 3QBVB 1NBFC 2LJIA 1OQYA 4EUTA 2NPTA 1ZC4B 2GMIC 1OFFA 2BYFA 2WHIA 3ZYYX 2I1JA 2KN5A 4HLEA 1DOXA 1U5DA 1P98A 4ILJA 3Q3NC 2LVOA 2V1YA 2KFKB 2LULA 1E8ZA 3VRBB 5LONB 3SYXA 4ZRJA 3PHXB 4JQWC 3KZ1A 3KUCB 3KRWA 3U52E 3GZNI 3F5RA 2JU6X 4MDKE 1BTKA 1PMSA 1MJDA 4OZCA 4IOYX 2WWZA 1GC7A 1TYGB 3E9SA 3Q2AC 3VTWA 2D3BA 1H4RA 3UZTA 3H8HA 2IO1B 3ODWA 1NI3A 1GAQB 2K49A 4RGNA 4JWUC 2ZPNA 2ZW0A 4S0RA 1OQNA 1XLQA 2INPE 2WXQA 4ITKA 1KC7A 4MGIE 3UIPB 1QOGA 3FVCA 2G35A 2Y5BB 4A6HA 4MY6A 1WGYA 2Y5CA 1IYFA 4WURA 2KMAA 2YF0A 4H8SA 2BYEA 1TGZB 2BB6A 2LUMA 4W9EA 1NU2A 2ADZA 2V9HA 2AL3A 2WYQA 1ZUD2 2ZZPB 4IWOA 1I4XA 2EKEC 3FSSA 3L13A 4XDDA 2UVMA 4DIXA 4DHZB 4D0NB 3H7SA 3KUZA 3B9JA 1L5PA 2CU1A 1GPXA 1EWCA 2WDRB 3ZVVA 1QOBA 3PSEB 2K22A 3CWIA 4HATB 2O6VD 3AXCA 4NAMA 1DYNA 1GNUA 3AE4B 2HE7A 3A8PA 2WNMA 5JXVA 4ZRPA 1P3QU 1DDMA 2ICIA 2L05A 1QF6A 5T8IA 4YL8A 3RMKC 2INDC 2KX0A 4TSSA 3S2AA 4WWMA 4MT5A 1RWSA 2NZ8B 4F7GA 1VZ7A 4DBGA 5DIFB 1SEBD 1WZ3A 1EU4A 2MDXA 2N9XA 4B6WA 3GZNB 1XCTL 4F7ZA 1K50A 1P1AA 3NRZA 4W9GA 4HCNB 2DNFA 1MPEA 4BOSC 3KWVA 3Q8BA 4HDQA 4GU2A 3Q8FA 4CQNA 4I6LB 3QQ8B 3W1SC 4ZYSA 1MG8A 1I4RA 1LGRA 2W2XD 4DDID 2YVCA 4IC7B 1U4AA 2BWFA 3ZJTA 4ILHA 3HK0A 1OGWA 4JKEA 2TSSA 4BBNF 4KHBB 3NVVA 2CAYA 2J0MA 2Y3AA 4HAUB 4K81A 4HCPB 2YEPF 2L1CA 5D3XA 2NBUA 4YTNB 3U7DA 2K8HA 4LCDE 1WXMA 1M7EA 2CB8A 3MHSD 1VBHA 1LW3A 2WXRA 3GP7A 1MG4A 4FN2A 5G2NA 2MP2A 4XE0A 1MHHE 2YS3A 5HE2A 3ZKJC 4GNKB 1WFYA 3NOBA 2RDBC 3EUB2 5JVLA 1KF6B 4EJNA 2M17A 4KIKA 4IAPA 3KYCD 3P4PB 2KACA 1QOAA 1X11A 2FE8A 2KFJA 2W3SA 3HW2B 4MACA 2W55A 2KQ7A 2DLBA 3H7PB 4OHJA 4ANVA 4AOFA 2L52A 4CYEA 2YT0A 1MK7B 1DOYA 1S3SG 3ZLZA 2GUMA 4HB0B 3PGEA 4LLGM 5IN7A 1NENB 3ZNGC 4MGKE 4WJQA 2L3ZA 3HM6X 2KYWA 3L08A 1KBLA 4KV2A 2W54A 1ZC3B 1I7HA 2Z59B 2Y8FA 3GB1A 2WDQB 3DBHI 1PFDA 5CTRC 1ROEA 2ZW1A 3RN9C 4W9IA 2D07B 2UU7A 1MKEA 4JKGA 4HJGE 1AARA 4M01A 3DXCA 2COPA 3P7ZA 2VRWB 3PZ7A 3KSYA 4G11A 3OJ3A 1L7YA 2J4XA 1P0RA 2HRJA 2LBBA 2BKFA 3WCQA 1UD7A 4F7UP 2YRYA 3MHZA 2UYZB 2EELA 3N3KB 1SIJA 2BS4B 4RGMA 1RYJA 1FNWA 3LYYA 4DHZE 3OJ4B 3A1QA 1OQRA 1UH6A 3QC8B 2XK5B 1SF0A 4HEA1 2LYDA 2RR9A 1KM7A 3OWEB 2G9HD 2GLSA 5CLLB 1E7UA 2LI5A 1N62A 4K7SA 4E3CA 1L0VB 2K8CA 1XCGA 3U7ZA 4LNOA 1WVHA 1ST7A 1WXSA 3NZ3A 4FJZA 1WM3A 4WAFA 1UZXB 2JX5A 4CO7A 3D8FA 2PLPA 3PZDA 1DYQA 4IM0A 1WYGA 4LTUA 3VQIA 1YNTE 3DBLI 1XKEA 1V5OA 4GOUA 5CLQB 5HE3A 1KZGA 1K5GB 1ET6A 3PEGA 1WSPA 3UQAA 2NBWB 1I42A 3ETRA 2OTXA 3QIJA 5GMVA 1DROA 1P3RA 2IGHA 3GYPA 2KMCA 2KDMA 1UNRA 2FJLA 2SEBD 1C4AA 3DBHB 4ASWC 4D2KA 3P4RB 5G5HA 4A5KA 1F9JA 2DYOA 3WANA 2AX5A 3DHIC 5TSSA 4O1NA 2J42A 5JP4A 1J7BA 1Y56A 2LHEA 1V49A 4AUQC 4J6IA 4Z2MB 3IBEA 2KTFA 4JGHB 4F1SA 2AQ1B 1E10A 3M95A 3EFUA 4C4VB 2J53A 4A3OA 1E0ZA 4YSYB 4B0EA 1ZOYB 3CXBB 2ABDA 1VBGA 3H9DA 5D94A 3BVMA 3EECA 1EVHA 2IZVB 2PMVA 4EEWA 3SO6A 1D6EC 1R7SA 2CHXA 4XZ4A 5KCVA 3PVLA 1X1FA 2K9XA 2MH7A 2MLBA 4W9DA 2LVPA 1EO6A 2N1VA 3PPAA 1EWYC 3GE3C 1VRAB 3AE9B 3BYYB 3Q8CA 5EDSA 3EC8A 5LG4B 3DBLB 2R61A 1TY2A 2OJWA 4K3CA 1WJ4A 4IWPA 3BJIA 1GUAB 2XEWA 2RMMA 2RPQA 1WE7A 2CQUA 1QILA 3A8QA 3C19A 3TL5A 5IA7A 2K00A 1S1QB 2ZNVC 4RCOA 2K0PA 2CODA 3A58A 4BBNC 3PLVA 3ZDMC 2D2QA 3ALBA 5FK9C 3SDLC 1C9FA 3ENBA 4A6QA 2KUPA 1JWBD 2CJNA 2FDQA 2C9WB 4NNJB 2RVBB 4WWPA 3W2DA 4HB4B 2N9KA 2WXGA 2DENB 3MDBC 2E6XA 1V81A 4WJ7A 1V1PA 2LKOA 1I2HA 2R2YA 3QCAA 1D5XC 4WJNA 2ZVNA 3NVYA 2BTEA 3RNAC 5C2TB 3VH4B 2DYBA 2DX5B 2D9YA 2V4IB 1QQRA 1T0QC 2Z0OA 4KGSA 1UBQA 5CHFA 5LXIB 3QAQA 2Q13A 2DA0A 1EU3A 4HWIB 5HKHA 2DHJA 3ZNID 3X0WA 5L83A 1TS2A 5D27A 2J7QB 2LRUA 1R4MI 3SNHA 1NYQA 2Z8LA 2GI9A 2R2QA 4DXFA 4MELA 2B76B 1MIXA 1E90A 5FR3A 2WU5B 3SFEB 2AEHA 2DHIA 1WGDA 1RJ2A 2WXFA 4K7WA 2NCNA 4II2B 4GB9A 5KHQA 3TFMA 4CHKA 5D7GA 2P0HA 2KC2A 4NAWA 1U2BA 3PSCA 3RZFA 3GE8C 1MHXA 3V3XA 4HKQA 4A9AA 1BT0A 1FIQA 2QDFA 2QIEB 4WH4A 4ILGB 1EGXA 1WXAA 2KJHB 1SE4A 3EHVA 3Q3JA 2KKCA 1OEYJ 2W3RA 3SUZA 3V05A 4REZA 1RM6C 4WJPA 4S17A 5EE1A 2EC1A 3RD2A 5M4YB 2DX1A 1V1OA 3FEHA 3JW0X 2BW2A 2Z14A 1OMWA 2GBRA 4KSKC 2N9EB 3RCPA 4HPPA 3CSFA 3KWLA 2VSZA 4PK1A 3DBSA 5E6PA 2ELBA 3W5VB 4KZ0A 2BF8B 1X05A 2M38A 5KQ1A 1TKGA 2ZVOA 2LXAA 2ZEQA 2KR0A 4ZDVA 1U29A 4WAAA 2KWUB 2V4LA 4HDOA 3PTFC 1E7VA 2I5CA 4JKFA 4IDIA 4DBBA 3NG0A 4HB3B 5HFYA 3ZRFA 2EJ8A 2D9WA 2XQNM 2DYMA 3L54A 3WA0A 3OAWA 1HBKA 5AZFA 1TIFA 1C4CA 1UBIA 1R4MB 3DPDA 3N1ZC 3QJZA 4A8XC 4W9FA 3RPFC 3NHEB 3AB5A 3FILA 3ML9A 2ROZB 3V62A 3ECIA 2XN9C 2N9PC 3TUOA 1KOTA 4HAZB 4KDIC 2PE6B 2KDBA 3PVUA 3ZXRA 1Z5SB 3DBRI 3I63C 4ANUA 3T06A 1WJ6A 4W9KA 4NY0A 4K17A 1YJJA 3FILB 4JLCA 1FXAA 2Y5PA 2KGXB 1T5XD 2DWQA 1DBHA 1W1GA 2SAKA 1T6BX 1WH3A 3CSTA 2L00B 5EFXA 2KMMA 5H92C 2FUG1 2JYTA 2D10A 2AQ3B 4PYUA 4D6WA 3WALA 3ZIMA 3MC0B 1C77A 2ACZB 2JZPA 4JIOU 2RSUA 4YT0B 3T8MA 1TBEA 2BCJA 3QHTA 3M62B 2M1MA 3KRXA 3CMMB 3CF6E 1AWEA 1R4NI 3IAS1 4K7UA 3HQCA 2K1FA 1EF5A 1ET9A 1TY0A 2YEPB 4LNFA 3AE6B 1MIZB 2MSED 3JSVA 2LOZA 3Q14C 2NPTB 5I4DA 3PS6A 3HIZA 3RT3B 3SD5A 1ZGUB 4KKJA 2Y7BA 1XLPA 2MEKA 4MM3A 2BT6A 1KLVA 2BKRB 2MW5A 2LRWA 2J52A 3L4PA 2KOXA 3BYTB 5D3IB 1FD6A 4PS7A 4G3XB 2GRIA 4EMOA 3N1XC 2Z13A 2D9VA 2KIGA 1JWMD 4RF0A 2L0TA 1NVID 2D3GA 2BQQA 1QQGA 4L1BA 3PREA 3AE2B 2Y8GA 4BFRA 4XC2A 2YT1A 4EZKA 5GOWB 2GOWA 1AW7A 2MBHA 1EUVB 2V76A 1ZKHA 3HHMA 4HAXB 5JHHA 4LK0M 4AJYB 4KGTA 2W2WA 4KDLB 4BKGA 2FNJB 3Q3MC 2LZ6A 4RF1A 1LXDA 1E8WA 2FAZA 5HE0A 2JF5A 4MH8A 2KAJA 4HKZE 4LJPB 1K5DB 1SJED 2DZJA 2KLCA 3MTNB 5AUKA 2LMCA 2CS4A 4GDLA 2J0KA 4I6PA 2RUKB 2AL6A 4HAYB 1SIFA 4KAXB 1B1ZA 3PZ8A 3ZGZA 1DOIA 4MSQB 4FA6A 2IPKD 1UPQA 3F0WA 3KVFB 2KO3A 1WI1A 4WIPA 4HK2A 1NDDA 2PTLA 2MWNB 1R4NB 1HE8A 1V88A 4DXAB 3N30A 4GDLB 2LFIA 1L6VA 3PT2B 3ABVB 5G5GA 4XGAB 1FB8A 1KH0A 1V8CA 2ZJDA 4OZAA 5DPWA 1FGZA 2CHWA 5E6NA 3O96A 2M56B 3M63B 4ARCA 2NR2A 1X1GA 3B08A 1XXGA 2RRFA 2WH5A 4YSXB 3ZO5B 2K2UA 3MJ5A 5EE9A 4ACFA 5L95C 4ZRKA 3OG5A 3MC8A 1L4ZB 4ZRQA 2O2VA 3RNEC 4AJWA 2RNRB 3Q8EA 2IO3B 3A9JA 2QC8A 1TS4A 4QXAB 4IWQA 1RRPB 4WJOA 3WIMA 1LB1A 3BVZA 3BVGA 1D3ZA 1XLOA 3TJPA 1WE6A 4MEMA 4IKGA 3AU5A 2K25A 2R2OA 1ACCA 1B55A 1WRDB 1SSNA 4RMAA 2O2VB 4F8CB 2WU2B 4WQMA 3VDZA 2WS3B 2GCLA 3UINB 5BYSA 2OEDA 3ODOA 1SHCA 3R2IA 1ZXIA 2RDGA 2G1EA 4HSIA 3ZVRA 2FJ9A 3VRAB 3RNGC 1YN4A 3BK1A 1NI2A 2RPVA 1YD8U 3L16A 2REXA 2KTRA 4HHVA 2HD5B 4HJKA 4KKIA 5EE0A 1E7PB 2P0DA 2K2JA 4GZUA 1MPHA 2CRFA 2L2IA 3QWMA 1TTNA 2KD0A 1Y19B 1PGBA 2X18A 2MP2B 1UEFA 2VH2A 3SHQA 3NWFA 2KTRB 1JRPA 1N5WA 4L2YA 3IG3A 5DH9B 4KIKB 3GOEA 3VOQA 2KC1A 2KQ4X 1MK9B 3DXEA 1ENFA 3M3JA 5HI1A 2JT4B 3K9OB 2IY1B 2KX3A 4FHJA 5AZGA 2DTCA 2KLGA 2MJ3A 3TCAA 1WWTA 4A55A 1GC6A 4XDCA 4QJ5B 3RI7C 1N63A 3TIXA 3WAPA 1GB1A 4JKBA 1DIKA 4TKNA 2IYDB 2M8SA 3WAMA 1FRDA 4JK9A 1P5TA 2K8BA 3DDCB 3U4EG 1W1DA 2L7RA 1NEKB 1ISNA 5AEKB 4Q2JA 4NJ7A 4AP4C 5AUIA 5IP4D 4JKGB 4HB2B 2DYQA 2LVQA 3U30A 2BBCA 3R7QA 2JQRB 4LDTB 1Q10A 1WX8A 4YWGG 3TEYA 3C0RB 4EFOA 3LXFA 1HTOA 3AMZA 2X8XX 3P4QB 5DPRA 2JXXA 3W1YA 1NTYA 2JPHA 2PJHA 1QOFA 1KJTA 3AEFB 1AYFA 3A1QB 3VR8B 4DX90 2I2YA 3AU4A 2R0DA 2QHOA 1ZPSA 2YS5A 2LASA 3BY4B 3AI5A 3APDA 2I5FA 3EA6A 5EE3A 4FADA 5IKCM 3APFA 2IYBA 5FR6A 2LXCA 1BWNA 2J59M 4BZAA 1FHOA 4EZJA 4J3OD 4WVFB 2AWTA 1FHWA 2R82A 2P0FA 1KRHA 2L32A 1EAZA 1BAKA 3H6NA 1LM8B 3Q3FA 1Q5WB 3TEZA 1PFJA 1X1MA 4OVZA 2D9XA 4WWOA 5J2RA 4AWJA 1ZE3D 3R8BA 4AQ7A 1M7RA 5IRSA 3W1SA 2DZMA 3ZW3A 1BTNA 1WRIA 3PVWA 2D11A 1D5MC 1CJEA 1N6ZA 2BYTA 4Z2NA 1WGQA 2WXMA 3U8ZA 3RUIB 1I4QA 2CY4A 1JWAD 1I4GA 2DYNA 2MHJA 1U5GA 4ZHPA 4P1CC 4G0NB
chains in the Genus database with same CATH topology
3PRZA 1V6EA 1VD2A 3TW1A 2A4ZA 3ZUNA 3D8EA 5CHWA 1AQCA 4GN1A 1IRSA 3N7CA 2LD9A 2KNBA 1WMHA 1XT9B 3QX1A 3OLMD 2GBJA 2KHWB 3QK0A 2Z0QA 3LJ3A 1WXVA 5DHAB 4LDTD 2DZKA 3V6CB 4PNKA 1QZEA 1WMHB 2DKPA 2LJ5A 4ANXA 3PHWB 4FHKA 3JYUA 4ZRIA 2M0XA 3SBGA 4GDKA 4K2OA 3VUYA 4A6FA 2CY5A 4MSMB 4OVUA 1V5PA 1V5TA 2YSZA 3MJWA 4MGYE 1XODA 3A98B 4PQ0A 1GJZA 2ROVA 3T9LA 1HB8A 4PS3A 2MBEA 1WJMA 3DVGY 2GBKA 2DFKA 2KDFB 1DDWA 1OTRB 3KW5B 4NJ6A 4RM9A 1P9DU 2M14A 4HPLB 4BKSA 3UIOB 1FOEA 2IBIB 1X86A 2NMBA 4GMVA 2OQBA 2RSGA 2NS5A 4MJSA 2M4NA 4PS8A 2DHKA 2LG1A 4W9LA 2N23A 2YS1A 4GGQA 3DCGA 4NSWA 4ZYNA 3DXDA 2W2XC 4XX5A 4E71A 3D8DA 4FLHA 1XD4A 4RM8A 4C0AA 5D3YA 4ICVA 1WR6E 2KDEB 3PRMB 3IHPC 5L81A 2HJ8A 3R66C 1WI0A 2IY0B 1FAOA 4TQ1A 4B9KA 2BGFA 2C5LC 3ZNZB 3TO1A 1TZ1A 1UELA 4F7HA 3QARA 3WAOA 5FI1A 2ZCBA 4KZCA 2W9NA 2FCMA 2Z0PA 1WX7A 5C23A 4MGZE 3NSUA 4HAWB 1ZM0A 1OEYA 1HB6A 3FLVA 1H8CA 1CMXB 3DVGX 1WJUA 1YJ1A 3TBLD 1JRUA 4Y94A 3PG7A 4NAWB 3RULA 2N4FA 1OY2A 3FP5A 2MFQA 2RGNB 3RYTA 5J17A 2I1KA 1J8CA 2N7DA 1XX0A 1PLSA 1UPRA 2VRRB 3E9OA 3V61A 1V86A 3RCZA 2ELAA 2K39A 4II3B 2CKHB 3MPXA 1M94A 5J18A 4B6HA 2PZ1A 2R09A 2C7HA 4M0WB 2GS0A 5C1ZA 5D2MB 1WGRA 4BKSD 2PPHA 2ZPYA 5JH5C 2G45B 2UWQA 2LGDA 1Q0WB 1V5UA 3ZTDA 4JK8A 1FGYA 1G6JA 1L2NA 3LDZE 2FCSA 2O6VA 2COAA 4BOZB 2DIKA 2G4DB 1W1HA 1WJ1A 3RZWC 5DCNA 1N3HA 2Z0DB 4EZLA 3BINA 2ZNVB 2RQ1A 1WX9A 2KCJA 3A4RA 4E74A 4GIVA 3G9WA 4PYZA 3HM3A 2KXJA 1Z87A 3VFKA 3APCA 3M1IB 1LQBA 2KWCA 4P7IA 1DDVA 3NZSA 2MBOA 2EMSA 3V60A 3ULBA 2KZRA 1RLFA 3K9PB 3JSVB 2JWZA 2IO2B 5C79A 4NPNA 3KY9A 2MCNB 1V61A 3PV1A 2JZ3B 3KYDD 3QWZB 4EOYA 2Z0EB 3AJ4A 4WSFA 2X0SA 1WZ0A 3VIAA 3WYFB 2GBNA 1TQZA 2D9ZA 2H7DA 4LJOB 3ONSA 2MBQA 4TV3A 5G55A 2JY6A 5LOPB 1WG7A 3IFWB 2L0FA 1V9JA 2GCJA 3ZTCA 4K1RB 1TXDA 1V89A 4JKHA 1Z2MA 2JRHA 2WDTB 4DX8A 1FHXA 2COCA 2MX2A 4DK5A 2KJRA 1WJNA 2FIFA 2DN6A 2N0YA 5D3VA 3FM8C 2OOBB 1P6SA 5E6OA 2RLOA 2FUHB 5IAAC 1Y8RC 3ML4A 4DWFA 1C3TA 3A9JB 1WGUA 1WY8A 1V80A 4L6EA 3P6AA 4I6NB 4MT7A 3X23A 2C7NB 1MAIA 1U5FA 3DQVA 1YX5B 2JZZA 2KVRA 4JL9A 2FIDA 5DHFB 5J3QA 1NVLA 1ACAA 3IVFA 4FJVB 4URKA 2MRPA 2LWPA 3N32A 2RGFA 2ZCCA 3H7PA 4MK0A 4A3PA 3OANA 2N7EA 5DPTA 1QC6A 4HAVB 1VCBA 1V2YA 1C1YB 2COFA 3QA8A 1YX6B 2G3QB 3DVNV 5JHAA 2LGXA 1NTIA 3E9LA 3VVWB 4B95A 3KH0A 3D32A 4CHMA 4GMXB 1IPGA 4W9JA 1I7AA 1RRBA 2LUEA 3V6EB 2PE9A 4IG7B 3VHTC 4XWXA 3ENEA 1T0YA 2DLWA 5C5BA 3UQBA 5IJMA 4IW0A 4KHAA 2DAFA 1JDEA 3ODXA 5D6JB 3TMPB 3R3MA 4MH0E 4DHJB 2DHZA 5C5BB 2XK5A 2K6DB 5BO4B 2C60A 2JP2A 2EMTA 2IO0B 3VUWA 2V3SA 1A5RA 2MQJA 3NS8A 2C7MB 4GOCA 3SU8X 4NQKE 1UNQA 4WQOB 4GXBA 2JRIB 4G50A 1E5WA 1SGHA 2DAJA 1WIAA 2KJ6A 2BWES 4FULA 5JLJB 5AZHA 3ULCA 2BPSA 3ML8A 3CIKA 3SBTA 1J0GA 5HE1A 3LJUX 2B3AA 5JHBA 5CHVC 1YIWA 2YLMA 1WGHA 4TUUA 2XBBC 4KHOA 5FI0A 3ZDTA 1YQBA 3NY5A 5J3TA 2CR5A 2H7EA 5JHGA 1WM2A 4JKCA 5JZEB 4DHJD 3PRPB 2L76A 2A5UA 1H10A 2KWVB 3L17A 1EF1A 4OVVA 4ICUA 4FJYA 1RFAA 1KI1B 1UNPA 3L10B 1I35A 3ZRCA 1ZSQA 4GDKB 3NZUA 5C6RA 3B1LX 2OJRA 4A6FB 4KSLC 2QKMA 2MBBB 2GBMA 4KVGB 1K8RB 3UF8A 2G4SA 1WGGA 2P8VA 5C16A 2AYOB 1PQSA 3A4SC 2VKIA 2DZIA 4A6KA 1U27A 4BVUC 2DX5A 4JKAA 3PP2A 4K2PA 3B0AA 1E8YA 4EKUA 3R7RA 5CX3A 2N1WA 3ZNHB 4JK7A 3P2BA 5LXHA 4GPTB 3O65B 4MJSB 4W9CA 2MKRA 2FCNA 1KZ7A 1NTVA 3PLUA 1IP9A 4HXDA 1WR1A 3V5WA 3E66A 2JUOA 3L0WB 3AULA 1Q67A 2MWSB 4FBJB 1GG3A 2NVUI 3EPYA 1LFDA 4A20A 1V5MA 2LOXA 4DDGD 1J0WA 2QKLA 3I3TB 3KUDB 4TQ0A 4X57B 1Q1OA 4IUMB 2GJYA 4ANWA 2UZSA 5J3YA 4HVBA 2JVCA 4M8NA 2L8JA 5DI9B 4IFSA 2J0JA 1SE9A 1WYWB 1XQQA 2KDIA 2FCQA 3GYOA 2DKQA 2KQSA 3VH3B 4JKDA 1U5EA 3VXWA 2K6QA 1FXTB 2D4QA 2BYVE 1XR0B 1GGOA 4TYZA 2RD0A 2E2XA 5KHOA 2CHZA 3JVZX 4M8MA 5TR5A 1ZVRA 3VTVA 4BBKA 4HPMB 3E9PA 2UZRA 2KANA 1RAXA 3H1UA 4IM3A 4NQLB 5KQ4A 5DPSA 1WF9A 4WWNA 4N9F4 2WX0A 3VUXA 3A9KA 3UGBB 5LLIA 4YONA 2LGYA 2PEAA 3A33B 1E8XA 3VAWA 2NBVB 2WX1A 1Y5OA 2KK8A 4BKTA 3VTUA 2ASQA 2HTHA 1XD3B 2O6VB 3A9KB 4GSWA 1UGMA 4CHJA 3DOWA 1TJ6A 1ZW7A 2MA9B 5D3WA 4W9HA 3SV1A 2IFSA 4IM2A 2HTHB 3DVNU 1J19A 3TVVA 2KFKA 3QBVB 1NBFC 1OQYA 4EUTA 2NPTA 1ZC4B 2GMIC 2BYFA 2I1JA 2KN5A 4HLEA 1U5DA 1P98A 4ILJA 2LVOA 2V1YA 2KFKB 2LULA 1E8ZA 5LONB 3SYXA 4ZRJA 3PHXB 4JQWC 3KUCB 3KZ1A 3KRWA 3GZNI 3F5RA 4MDKE 1BTKA 1PMSA 4IOYX 2WWZA 1GC7A 3VTWA 1H4RA 3UZTA 2IO1B 3ODWA 2ZPNA 1OQNA 1KC7A 4MGIE 3UIPB 2G35A 2Y5BB 4A6HA 4MY6A 1WGYA 1IYFA 2KMAA 2YF0A 4H8SA 2BYEA 1TGZB 4W9EA 1NU2A 2ADZA 2AL3A 2WYQA 2ZZPB 4IWOA 2EKEC 3FSSA 3L13A 2UVMA 4DHZB 4D0NB 3H7SA 3KUZA 2CU1A 3ZVVA 3PSEB 4HATB 2O6VD 3AXCA 1DYNA 1GNUA 2HE7A 3A8PA 1P3QU 1DDMA 2L05A 4YL8A 2KX0A 3S2AA 2NZ8B 4F7GA 4DBGA 5DIFB 1WZ3A 2MDXA 2N9XA 4B6WA 4F7ZA 1P1AA 4W9GA 4HCNB 4BOSC 4HDQA 4GU2A 4I6LB 3QQ8B 3W1SC 1MG8A 2W2XD 4DDID 2YVCA 4IC7B 1U4AA 2BWFA 4ILHA 3HK0A 1OGWA 4JKEA 4BBNF 4KHBB 2CAYA 2J0MA 4HAUB 4K81A 4HCPB 2L1CA 5D3XA 2NBUA 3U7DA 2K8HA 4LCDE 1WXMA 1M7EA 2CB8A 3MHSD 1VBHA 1LW3A 4FN2A 5G2NA 2MP2A 2YS3A 5HE2A 3ZKJC 1WFYA 3NOBA 5JVLA 4EJNA 2M17A 4KIKA 4IAPA 3KYCD 1X11A 2KFJA 3HW2B 2KQ7A 3H7PB 4ANVA 4AOFA 4CYEA 2YT0A 1MK7B 1S3SG 3ZLZA 4HB0B 3PGEA 3ZNGC 4MGKE 4WJQA 2L3ZA 3HM6X 3L08A 1KBLA 4KV2A 1ZC3B 2Z59B 2Y8FA 3DBHI 5CTRC 4W9IA 2D07B 1MKEA 4JKGA 1AARA 3DXCA 2COPA 3P7ZA 2VRWB 3KSYA 4G11A 3OJ3A 1L7YA 1P0RA 2HRJA 2LBBA 2BKFA 1UD7A 4F7UP 2YRYA 2UYZB 3N3KB 4DHZE 3OJ4B 3A1QA 1UH6A 3QC8B 2XK5B 2LYDA 2RR9A 1KM7A 5CLLB 1E7UA 2LI5A 4K7SA 4E3CA 2K8CA 1XCGA 1WVHA 1ST7A 1WXSA 4FJZA 1WM3A 1UZXB 4CO7A 3D8FA 3PZDA 4IM0A 3VQIA 3DBLI 1XKEA 1V5OA 5CLQB 5HE3A 1KZGA 1K5GB 3PEGA 3UQAA 2NBWB 1I42A 2OTXA 3QIJA 5GMVA 1DROA 1P3RA 2KMCA 3GYPA 1UNRA 2FJLA 4ASWC 4A5KA 1F9JA 2DYOA 3WANA 5JP4A 1V49A 4AUQC 4J6IA 4Z2MB 3IBEA 2KTFA 4JGHB 4F1SA 3M95A 3EFUA 4A3OA 3CXBB 2ABDA 1VBGA 3H9DA 5D94A 3EECA 1EVHA 2IZVB 4EEWA 3SO6A 2CHXA 4XZ4A 5KCVA 3PVLA 1X1FA 2MLBA 4W9DA 2LVPA 1EO6A 2N1VA 3PPAA 5EDSA 3EC8A 1WJ4A 4IWPA 3BJIA 1GUAB 2XEWA 2RPQA 1WE7A 2CQUA 3A8QA 3TL5A 5IA7A 2K00A 1S1QB 2ZNVC 2CODA 4BBNC 3PLVA 3ZDMC 2D2QA 3ALBA 3SDLC 3ENBA 2KUPA 2FDQA 2C9WB 4NNJB 2RVBB 4WWPA 4HB4B 2DENB 3MDBC 1V81A 4WJ7A 2LKOA 1I2HA 3QCAA 4WJNA 2ZVNA 3VH4B 2DYBA 2DX5B 2D9YA 2Z0OA 1UBQA 5CHFA 5LXIB 3QAQA 2Q13A 2DA0A 4HWIB 5HKHA 2DHJA 3ZNID 3X0WA 5L83A 5D27A 2J7QB 2LRUA 1R4MI 3SNHA 2R2QA 4MELA 1MIXA 1E90A 2AEHA 2DHIA 1WGDA 1RJ2A 4K7WA 2NCNA 4II2B 4GB9A 5KHQA 3TFMA 4CHKA 5D7GA 4NAWA 2P0HA 2KC2A 1U2BA 3PSCA 3RZFA 1BT0A 4ILGB 1EGXA 1WXAA 2KJHB 3EHVA 3Q3JA 2KKCA 1OEYJ 3SUZA 4WJPA 2EC1A 3RD2A 2DX1A 3FEHA 3JW0X 1OMWA 2GBRA 4KSKC 2N9EB 3RCPA 3CSFA 2VSZA 3DBSA 5E6PA 2ELBA 4KZ0A 2BF8B 1X05A 2M38A 5KQ1A 2ZVOA 2LXAA 2ZEQA 4ZDVA 1U29A 4WAAA 2KWUB 2V4LA 4HDOA 3PTFC 1E7VA 2I5CA 4JKFA 4DBBA 4HB3B 3ZRFA 2EJ8A 2D9WA 2XQNM 2DYMA 3L54A 3WA0A 3OAWA 1HBKA 5AZFA 1UBIA 3DPDA 3QJZA 4W9FA 3NHEB 3ML9A 2ROZB 3V62A 3ECIA 2N9PC 1KOTA 4HAZB 4KDIC 2PE6B 2KDBA 3PVUA 1Z5SB 3DBRI 4ANUA 3T06A 1WJ6A 4W9KA 4NY0A 4K17A 4JLCA 2KGXB 1DBHA 1W1GA 1WH3A 3CSTA 2L00B 5EFXA 2D10A 4PYUA 3WALA 3ZIMA 4JIOU 2RSUA 3T8MA 1TBEA 2BCJA 3QHTA 3M62B 2M1MA 3KRXA 3CMMB 3CF6E 1AWEA 1R4NI 4K7UA 3HQCA 2K1FA 1EF5A 1MIZB 2MSED 3JSVA 2LOZA 2NPTB 3PS6A 3HIZA 3RT3B 3SD5A 1ZGUB 2Y7BA 4MM3A 1KLVA 2BKRB 2MW5A 2LRWA 2KOXA 4PS7A 4G3XB 4EMOA 2D9VA 2L0TA 2D3GA 1QQGA 3PREA 2Y8GA 4BFRA 4XC2A 2YT1A 4EZKA 5GOWB 2GOWA 2MBHA 1EUVB 2V76A 1ZKHA 3HHMA 4HAXB 5JHHA 4AJYB 2W2WA 4KDLB 4BKGA 2FNJB 2LZ6A 1LXDA 1E8WA 2FAZA 5HE0A 2JF5A 4LJPB 1K5DB 2DZJA 2KLCA 3MTNB 2CS4A 4GDLA 2J0KA 4I6PA 2RUKB 2AL6A 4HAYB 1SIFA 4KAXB 4MSQB 4FA6A 1UPQA 3F0WA 3KVFB 2KO3A 1WI1A 4HK2A 1NDDA 2MWNB 1HE8A 1V88A 4DXAB 3N30A 4GDLB 3PT2B 1FB8A 2ZJDA 5DPWA 1FGZA 2CHWA 5E6NA 3O96A 3M63B 2NR2A 1X1GA 3B08A 2WH5A 3ZO5B 2K2UA 5L95C 4ZRKA 2O2VA 4AJWA 2RNRB 2IO3B 3A9JA 4IWQA 1RRPB 4WJOA 3WIMA 1LB1A 1D3ZA 3TJPA 1WE6A 4MEMA 3AU5A 2K25A 2R2OA 1WRDB 1B55A 4RMAA 2O2VB 4F8CB 3VDZA 2GCLA 3UINB 3ODOA 1SHCA 3ZVRA 2FJ9A 1NI2A 3L16A 1YD8U 2REXA 2KTRA 4HHVA 2HD5B 4HJKA 2P0DA 2K2JA 4GZUA 1MPHA 2CRFA 2L2IA 3QWMA 1TTNA 2KD0A 1Y19B 2X18A 2MP2B 1UEFA 3SHQA 2KTRB 3IG3A 5DH9B 4KIKB 3GOEA 3VOQA 2KC1A 1MK9B 3DXEA 3M3JA 2JT4B 3K9OB 2IY1B 2KX3A 4FHJA 5AZGA 2DTCA 2KLGA 3TCAA 1GC6A 3TIXA 3WAPA 4JKBA 1DIKA 4TKNA 2IYDB 2M8SA 3WAMA 4JK9A 1P5TA 2K8BA 3DDCB 1W1DA 2L7RA 1ISNA 5AEKB 4NJ7A 4AP4C 4JKGB 4HB2B 2DYQA 2LVQA 3U30A 3R7QA 4LDTB 1WX8A 3C0RB 4EFOA 5DPRA 2JXXA 3W1YA 1NTYA 2JPHA 2PJHA 1KJTA 3A1QB 4DX90 3AU4A 2R0DA 2QHOA 2YS5A 2LASA 3BY4B 3AI5A 3APDA 2I5FA 4FADA 3APFA 2IYBA 5FR6A 2LXCA 1BWNA 2J59M 1FHOA 4EZJA 4WVFB 2AWTA 1FHWA 2R82A 2P0FA 1EAZA 1BAKA 3H6NA 1LM8B 3Q3FA 1Q5WB 1PFJA 1X1MA 2D9XA 4WWOA 5J2RA 4AWJA 1M7RA 3W1SA 2DZMA 3ZW3A 1BTNA 3PVWA 2D11A 4Z2NA 1WGQA 3U8ZA 3RUIB 2CY4A 2DYNA 1U5GA 4G0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRZ A;  1V6E A;  1VD2 A;  3TW1 A;  2A4Z A;  3ZUN A;  3D8E A;  5CHW A;  1AQC A;  4GN1 A;  1IRS A;  3N7C A;  2LD9 A;  2KNB A;  1WMH A;  1XT9 B;  3QX1 A;  3OLM D;  2GBJ A;  2KHW B;  3QK0 A;  2Z0Q A;  3LJ3 A;  1WXV A;  5DHA B;  4LDT D;  2DZK A;  3V6C B;  4PNK A;  1QZE A;  1WMH B;  2DKP A;  2LJ5 A;  4ANX A;  3PHW B;  4FHK A;  3JYU A;  4ZRI A;  2M0X A;  4GDK A;  4K2O A;  3VUY A;  4A6F A;  2CY5 A;  4MSM B;  4OVU A;  1V5P A;  1V5T A;  2YSZ A;  3MJW A;  4MGY E;  1XOD A;  3A98 B;  4PQ0 A;  1GJZ A;  2ROV A;  3T9L A;  1HB8 A;  4PS3 A;  2MBE A;  1WJM A;  3DVG Y;  2GBK A;  2DFK A;  2KDF B;  1DDW A;  1OTR B;  3KW5 B;  4NJ6 A;  4RM9 A;  1P9D U;  2M14 A;  4HPL B;  4BKS A;  3UIO B;  1FOE A;  2IBI B;  1X86 A;  2NMB A;  4GMV A;  2OQB A;  2RSG A;  2NS5 A;  4MJS A;  2M4N A;  4PS8 A;  2DHK A;  2LG1 A;  4W9L A;  2N23 A;  2YS1 A;  4GGQ A;  3DCG A;  4NSW A;  4ZYN A;  3DXD A;  2W2X C;  4XX5 A;  4E71 A;  3D8D A;  4FLH A;  1XD4 A;  4RM8 A;  4C0A A;  5D3Y A;  4ICV A;  1WR6 E;  2KDE B;  3PRM B;  3IHP C;  5L81 A;  2HJ8 A;  3R66 C;  1WI0 A;  2IY0 B;  1FAO A;  4TQ1 A;  4B9K A;  2BGF A;  2C5L C;  3ZNZ B;  3TO1 A;  1TZ1 A;  1UEL A;  4F7H A;  3QAR A;  3WAO A;  5FI1 A;  2ZCB A;  4KZC A;  2W9N A;  2FCM A;  2Z0P A;  1WX7 A;  5C23 A;  4MGZ E;  3NSU A;  4HAW B;  1ZM0 A;  1OEY A;  1HB6 A;  3FLV A;  1H8C A;  1CMX B;  3DVG X;  1WJU A;  1YJ1 A;  3TBL D;  1JRU A;  4Y94 A;  3PG7 A;  4NAW B;  3RUL A;  2N4F A;  1OY2 A;  3FP5 A;  2MFQ A;  2RGN B;  3RYT A;  5J17 A;  2I1K A;  1J8C A;  2N7D A;  1XX0 A;  1PLS A;  1UPR A;  2VRR B;  3V61 A;  1V86 A;  3RCZ A;  2ELA A;  2K39 A;  4II3 B;  2CKH B;  3MPX A;  1M94 A;  5J18 A;  4B6H A;  2PZ1 A;  2R09 A;  2C7H A;  4M0W B;  2GS0 A;  5C1Z A;  5D2M B;  1WGR A;  4BKS D;  2PPH A;  2ZPY A;  5JH5 C;  2G45 B;  2UWQ A;  2LGD A;  1Q0W B;  1V5U A;  3ZTD A;  1FGY A;  1G6J A;  1L2N A;  3LDZ E;  2FCS A;  2O6V A;  2COA A;  4BOZ B;  2G4D B;  1W1H A;  1WJ1 A;  3RZW C;  5DCN A;  1N3H A;  2Z0D B;  4EZL A;  3BIN A;  2ZNV B;  2RQ1 A;  1WX9 A;  2KCJ A;  3A4R A;  4E74 A;  4GIV A;  3G9W A;  4PYZ A;  3HM3 A;  2KXJ A;  1Z87 A;  3VFK A;  3APC A;  3M1I B;  1LQB A;  2KWC A;  4P7I A;  1DDV A;  3NZS A;  2MBO A;  2EMS A;  3V60 A;  3ULB A;  2KZR A;  1RLF A;  3K9P B;  3JSV B;  2JWZ A;  2IO2 B;  5C79 A;  4NPN A;  3KY9 A;  2MCN B;  1V61 A;  3PV1 A;  2JZ3 B;  3KYD D;  3QWZ B;  4EOY A;  2Z0E B;  3AJ4 A;  4WSF A;  1WZ0 A;  3VIA A;  3WYF B;  2GBN A;  1TQZ A;  2D9Z A;  2H7D A;  4LJO B;  3ONS A;  2MBQ A;  4TV3 A;  5G55 A;  2JY6 A;  5LOP B;  1WG7 A;  3IFW B;  2L0F A;  1V9J A;  2GCJ A;  3ZTC A;  4K1R B;  1TXD A;  1V89 A;  1Z2M A;  2JRH A;  2WDT B;  4DX8 A;  1FHX A;  2COC A;  2MX2 A;  4DK5 A;  2KJR A;  1WJN A;  2FIF A;  2DN6 A;  2N0Y A;  5D3V A;  3FM8 C;  2OOB B;  1P6S A;  5E6O A;  2RLO A;  2FUH B;  5IAA C;  1Y8R C;  3ML4 A;  4DWF A;  1C3T A;  3A9J B;  1WGU A;  1WY8 A;  1V80 A;  4L6E A;  3P6A A;  4I6N B;  4MT7 A;  3X23 A;  2C7N B;  1MAI A;  1U5F A;  3DQV A;  1YX5 B;  2JZZ A;  2KVR A;  4JL9 A;  2FID A;  5DHF B;  5J3Q A;  1NVL A;  1ACA A;  3IVF A;  4FJV B;  4URK A;  2MRP A;  2LWP A;  3N32 A;  2RGF A;  2ZCC A;  3H7P A;  4MK0 A;  4A3P A;  3OAN A;  2N7E A;  5DPT A;  1QC6 A;  4HAV B;  1VCB A;  1V2Y A;  1C1Y B;  2COF A;  3QA8 A;  1YX6 B;  2G3Q B;  3DVN V;  5JHA A;  2LGX A;  1NTI A;  3VVW B;  4B95 A;  3KH0 A;  3D32 A;  4CHM A;  4GMX B;  1IPG A;  4W9J A;  1I7A A;  1RRB A;  2LUE A;  3V6E B;  2PE9 A;  4IG7 B;  3VHT C;  4XWX A;  3ENE A;  1T0Y A;  2DLW A;  5C5B A;  3UQB A;  5IJM A;  4IW0 A;  4KHA A;  2DAF A;  3ODX A;  5D6J B;  3TMP B;  3R3M A;  4MH0 E;  4DHJ B;  2DHZ A;  5C5B B;  2XK5 A;  2K6D B;  5BO4 B;  2C60 A;  2JP2 A;  2EMT A;  2IO0 B;  3VUW A;  2V3S A;  1A5R A;  2MQJ A;  3NS8 A;  2C7M B;  4GOC A;  3SU8 X;  4NQK E;  1UNQ A;  4WQO B;  4GXB A;  2JRI B;  4G50 A;  1E5W A;  1SGH A;  2DAJ A;  1WIA A;  2KJ6 A;  2BWE S;  4FUL A;  5JLJ B;  5AZH A;  3ULC A;  2BPS A;  3ML8 A;  3CIK A;  1J0G A;  5HE1 A;  3LJU X;  2B3A A;  5JHB A;  5CHV C;  1YIW A;  2YLM A;  1WGH A;  4TUU A;  2XBB C;  4KHO A;  5FI0 A;  3ZDT A;  1YQB A;  3NY5 A;  5J3T A;  2CR5 A;  2H7E A;  5JHG A;  1WM2 A;  5JZE B;  4DHJ D;  3PRP B;  2L76 A;  2A5U A;  1H10 A;  2KWV B;  3L17 A;  1EF1 A;  4OVV A;  4ICU A;  4FJY A;  1RFA A;  1KI1 B;  1UNP A;  3L10 B;  1I35 A;  3ZRC A;  1ZSQ A;  4GDK B;  3NZU A;  5C6R A;  3B1L X;  2OJR A;  4A6F B;  4KSL C;  2QKM A;  2MBB B;  2GBM A;  4KVG B;  1K8R B;  3UF8 A;  2G4S A;  1WGG A;  2P8V A;  5C16 A;  2AYO B;  1PQS A;  3A4S C;  2VKI A;  2DZI A;  4A6K A;  1U27 A;  4BVU C;  2DX5 A;  3PP2 A;  4K2P A;  3B0A A;  1E8Y A;  4EKU A;  3R7R A;  5CX3 A;  2N1W A;  3ZNH B;  3P2B A;  5LXH A;  4GPT B;  3O65 B;  4MJS B;  4W9C A;  2MKR A;  2FCN A;  1KZ7 A;  1NTV A;  3PLU A;  1IP9 A;  4HXD A;  1WR1 A;  3V5W A;  2JUO A;  3L0W B;  3AUL A;  1Q67 A;  2MWS B;  4FBJ B;  1GG3 A;  2NVU I;  3EPY A;  1LFD A;  4A20 A;  1V5M A;  2LOX A;  4DDG D;  1J0W A;  2QKL A;  3I3T B;  3KUD B;  4TQ0 A;  4X57 B;  1Q1O A;  4IUM B;  2GJY A;  4ANW A;  2UZS A;  5J3Y A;  4HVB A;  2JVC A;  4M8N A;  2L8J A;  5DI9 B;  4IFS A;  2J0J A;  1SE9 A;  1WYW B;  1XQQ A;  2KDI A;  2FCQ A;  3GYO A;  2DKQ A;  2KQS A;  3VH3 B;  1U5E A;  3VXW A;  2K6Q A;  1FXT B;  2D4Q A;  2BYV E;  1XR0 B;  4TYZ A;  2RD0 A;  2E2X A;  5KHO A;  2CHZ A;  3JVZ X;  4M8M A;  5TR5 A;  1ZVR A;  3VTV A;  4BBK A;  4HPM B;  2UZR A;  2KAN A;  1RAX A;  3H1U A;  4IM3 A;  4NQL B;  5KQ4 A;  5DPS A;  1WF9 A;  4WWN A;  4N9F 4;  2WX0 A;  3VUX A;  3A9K A;  3UGB B;  5LLI A;  4YON A;  2LGY A;  2PEA A;  3A33 B;  1E8X A;  3VAW A;  2NBV B;  2WX1 A;  1Y5O A;  2KK8 A;  4BKT A;  3VTU A;  2ASQ A;  2HTH A;  1XD3 B;  2O6V B;  3A9K B;  4GSW A;  1UGM A;  4CHJ A;  3DOW A;  1TJ6 A;  1ZW7 A;  2MA9 B;  5D3W A;  4W9H A;  3SV1 A;  2IFS A;  4IM2 A;  2HTH B;  3DVN U;  1J19 A;  3TVV A;  2KFK A;  3QBV B;  1NBF C;  1OQY A;  4EUT A;  2NPT A;  1ZC4 B;  2GMI C;  2BYF A;  2I1J A;  2KN5 A;  4HLE A;  1U5D A;  1P98 A;  2LVO A;  2V1Y A;  2KFK B;  2LUL A;  1E8Z A;  5LON B;  3SYX A;  4ZRJ A;  3PHX B;  4JQW C;  3KUC B;  3KZ1 A;  3KRW A;  3GZN I;  3F5R A;  4MDK E;  1BTK A;  1PMS A;  4IOY X;  2WWZ A;  1GC7 A;  3VTW A;  1H4R A;  3UZT A;  2IO1 B;  3ODW A;  2ZPN A;  1OQN A;  4MGI E;  3UIP B;  2G35 A;  2Y5B B;  4A6H A;  4MY6 A;  1WGY A;  1IYF A;  2KMA A;  2YF0 A;  4H8S A;  2BYE A;  1TGZ B;  4W9E A;  1NU2 A;  2ADZ A;  2AL3 A;  2WYQ A;  2ZZP B;  4IWO A;  2EKE C;  3FSS A;  3L13 A;  2UVM A;  4DHZ B;  4D0N B;  3H7S A;  3KUZ A;  2CU1 A;  3ZVV A;  3PSE B;  4HAT B;  2O6V D;  3AXC A;  1DYN A;  1GNU A;  2HE7 A;  3A8P A;  1P3Q U;  1DDM A;  2L05 A;  4YL8 A;  2KX0 A;  3S2A A;  2NZ8 B;  4F7G A;  4DBG A;  5DIF B;  1WZ3 A;  2MDX A;  2N9X A;  4B6W A;  4F7Z A;  1P1A A;  4W9G A;  4HCN B;  4BOS C;  4HDQ A;  4GU2 A;  4I6L B;  3QQ8 B;  3W1S C;  1MG8 A;  2W2X D;  4DDI D;  2YVC A;  4IC7 B;  1U4A A;  2BWF A;  3HK0 A;  1OGW A;  4BBN F;  4KHB B;  2CAY A;  2J0M A;  4HAU B;  4K81 A;  4HCP B;  2L1C A;  5D3X A;  2NBU A;  3U7D A;  2K8H A;  4LCD E;  1WXM A;  1M7E A;  2CB8 A;  3MHS D;  1LW3 A;  4FN2 A;  5G2N A;  2MP2 A;  2YS3 A;  5HE2 A;  3ZKJ C;  1WFY A;  3NOB A;  4EJN A;  2M17 A;  4KIK A;  4IAP A;  3KYC D;  1X11 A;  2KFJ A;  3HW2 B;  2KQ7 A;  3H7P B;  4ANV A;  4AOF A;  4CYE A;  2YT0 A;  1MK7 B;  1S3S G;  3ZLZ A;  4HB0 B;  3PGE A;  3ZNG C;  4MGK E;  4WJQ A;  2L3Z A;  3HM6 X;  3L08 A;  4KV2 A;  1ZC3 B;  2Z59 B;  2Y8F A;  3DBH I;  5CTR C;  4W9I A;  2D07 B;  1MKE A;  1AAR A;  3DXC A;  2COP A;  3P7Z A;  2VRW B;  3KSY A;  4G11 A;  3OJ3 A;  1L7Y A;  1P0R A;  2HRJ A;  2LBB A;  2BKF A;  1UD7 A;  4F7U P;  2YRY A;  2UYZ B;  3N3K B;  4DHZ E;  3OJ4 B;  3A1Q A;  1UH6 A;  3QC8 B;  2XK5 B;  2LYD A;  2RR9 A;  1KM7 A;  5CLL B;  1E7U A;  2LI5 A;  4K7S A;  4E3C A;  2K8C A;  1XCG A;  1WVH A;  1ST7 A;  1WXS A;  4FJZ A;  1WM3 A;  1UZX B;  4CO7 A;  3D8F A;  3PZD A;  4IM0 A;  3VQI A;  3DBL I;  1XKE A;  1V5O A;  5CLQ B;  5HE3 A;  1KZG A;  1K5G B;  3PEG A;  3UQA A;  2NBW B;  1I42 A;  2OTX A;  3QIJ A;  5GMV A;  1DRO A;  1P3R A;  2KMC A;  3GYP A;  1UNR A;  2FJL A;  4ASW C;  4A5K A;  1F9J A;  2DYO A;  3WAN A;  5JP4 A;  1V49 A;  4AUQ C;  4J6I A;  4Z2M B;  3IBE A;  2KTF A;  4JGH B;  4F1S A;  3M95 A;  3EFU A;  4A3O A;  3CXB B;  2ABD A;  3H9D A;  5D94 A;  3EEC A;  1EVH A;  2IZV B;  4EEW A;  3SO6 A;  2CHX A;  4XZ4 A;  5KCV A;  3PVL A;  1X1F A;  2MLB A;  4W9D A;  2LVP A;  1EO6 A;  2N1V A;  3PPA A;  5EDS A;  3EC8 A;  1WJ4 A;  4IWP A;  3BJI A;  1GUA B;  2XEW A;  2RPQ A;  1WE7 A;  2CQU A;  3A8Q A;  3TL5 A;  5IA7 A;  2K00 A;  1S1Q B;  2ZNV C;  2COD A;  4BBN C;  3PLV A;  3ZDM C;  2D2Q A;  3ALB A;  3SDL C;  2KUP A;  2FDQ A;  2C9W B;  4NNJ B;  2RVB B;  4WWP A;  4HB4 B;  2DEN B;  3MDB C;  1V81 A;  4WJ7 A;  2LKO A;  1I2H A;  3QCA A;  4WJN A;  2ZVN A;  3VH4 B;  2DYB A;  2DX5 B;  2D9Y A;  2Z0O A;  1UBQ A;  5CHF A;  5LXI B;  3QAQ A;  2Q13 A;  2DA0 A;  4HWI B;  5HKH A;  2DHJ A;  3ZNI D;  3X0W A;  5L83 A;  5D27 A;  2J7Q B;  2LRU A;  1R4M I;  3SNH A;  2R2Q A;  4MEL A;  1MIX A;  1E90 A;  2AEH A;  2DHI A;  1WGD A;  1RJ2 A;  4K7W A;  2NCN A;  4II2 B;  4GB9 A;  5KHQ A;  3TFM A;  4CHK A;  5D7G A;  4NAW A;  2P0H A;  2KC2 A;  1U2B A;  3PSC A;  3RZF A;  1BT0 A;  1EGX A;  1WXA A;  2KJH B;  3EHV A;  3Q3J A;  2KKC A;  1OEY J;  3SUZ A;  4WJP A;  2EC1 A;  3RD2 A;  2DX1 A;  3FEH A;  3JW0 X;  1OMW A;  2GBR A;  4KSK C;  2N9E B;  3RCP A;  3CSF A;  2VSZ A;  3DBS A;  5E6P A;  2ELB A;  4KZ0 A;  2BF8 B;  1X05 A;  2M38 A;  5KQ1 A;  2ZVO A;  2LXA A;  2ZEQ A;  4ZDV A;  1U29 A;  4WAA A;  2KWU B;  2V4L A;  4HDO A;  3PTF C;  1E7V A;  2I5C A;  4DBB A;  4HB3 B;  3ZRF A;  2EJ8 A;  2D9W A;  2XQN M;  2DYM A;  3L54 A;  3WA0 A;  3OAW A;  1HBK A;  5AZF A;  1UBI A;  3DPD A;  3QJZ A;  4W9F A;  3NHE B;  3ML9 A;  2ROZ B;  3V62 A;  3ECI A;  2N9P C;  1KOT A;  4HAZ B;  4KDI C;  2PE6 B;  2KDB A;  3PVU A;  1Z5S B;  3DBR I;  4ANU A;  3T06 A;  1WJ6 A;  4W9K A;  4NY0 A;  4K17 A;  4JLC A;  2KGX B;  1DBH A;  1W1G A;  1WH3 A;  3CST A;  2L00 B;  5EFX A;  2D10 A;  4PYU A;  3WAL A;  3ZIM A;  4JIO U;  2RSU A;  3T8M A;  1TBE A;  2BCJ A;  3QHT A;  3M62 B;  2M1M A;  3KRX A;  3CMM B;  3CF6 E;  1AWE A;  1R4N I;  4K7U A;  3HQC A;  2K1F A;  1EF5 A;  1MIZ B;  2MSE D;  3JSV A;  2LOZ A;  2NPT B;  3PS6 A;  3HIZ A;  3RT3 B;  3SD5 A;  1ZGU B;  2Y7B A;  4MM3 A;  1KLV A;  2BKR B;  2MW5 A;  2LRW A;  2KOX A;  4PS7 A;  4G3X B;  4EMO A;  2D9V A;  2L0T A;  2D3G A;  1QQG A;  3PRE A;  2Y8G A;  4BFR A;  4XC2 A;  2YT1 A;  4EZK A;  5GOW B;  2GOW A;  2MBH A;  1EUV B;  2V76 A;  1ZKH A;  3HHM A;  4HAX B;  5JHH A;  4AJY B;  2W2W A;  4KDL B;  4BKG A;  2FNJ B;  2LZ6 A;  1LXD A;  1E8W A;  2FAZ A;  5HE0 A;  2JF5 A;  4LJP B;  1K5D B;  2DZJ A;  2KLC A;  3MTN B;  2CS4 A;  4GDL A;  2J0K A;  4I6P A;  2RUK B;  2AL6 A;  4HAY B;  1SIF A;  4KAX B;  4MSQ B;  4FA6 A;  1UPQ A;  3F0W A;  3KVF B;  2KO3 A;  1WI1 A;  4HK2 A;  1NDD A;  2MWN B;  1HE8 A;  1V88 A;  4DXA B;  3N30 A;  4GDL B;  3PT2 B;  1FB8 A;  2ZJD A;  5DPW A;  1FGZ A;  2CHW A;  5E6N A;  3O96 A;  3M63 B;  2NR2 A;  1X1G A;  3B08 A;  2WH5 A;  3ZO5 B;  2K2U A;  5L95 C;  4ZRK A;  2O2V A;  4AJW A;  2RNR B;  2IO3 B;  3A9J A;  4IWQ A;  1RRP B;  4WJO A;  3WIM A;  1LB1 A;  1D3Z A;  3TJP A;  1WE6 A;  4MEM A;  3AU5 A;  2K25 A;  2R2O A;  1WRD B;  1B55 A;  4RMA A;  2O2V B;  4F8C B;  3VDZ A;  2GCL A;  3UIN B;  3ODO A;  1SHC A;  3ZVR A;  2FJ9 A;  1NI2 A;  3L16 A;  1YD8 U;  2REX A;  2KTR A;  4HHV A;  2HD5 B;  4HJK A;  2P0D A;  2K2J A;  4GZU A;  1MPH A;  2CRF A;  2L2I A;  3QWM A;  1TTN A;  2KD0 A;  1Y19 B;  2X18 A;  2MP2 B;  1UEF A;  3SHQ A;  2KTR B;  3IG3 A;  5DH9 B;  4KIK B;  3GOE A;  3VOQ A;  2KC1 A;  1MK9 B;  3DXE A;  3M3J A;  2JT4 B;  3K9O B;  2IY1 B;  2KX3 A;  4FHJ A;  5AZG A;  2DTC A;  2KLG A;  3TCA A;  1GC6 A;  3TIX A;  3WAP A;  4TKN A;  2IYD B;  2M8S A;  3WAM A;  1P5T A;  2K8B A;  3DDC B;  1W1D A;  2L7R A;  1ISN A;  5AEK B;  4NJ7 A;  4AP4 C;  4HB2 B;  2DYQ A;  2LVQ A;  3U30 A;  3R7Q A;  4LDT B;  1WX8 A;  3C0R B;  4EFO A;  5DPR A;  2JXX A;  3W1Y A;  1NTY A;  2JPH A;  2PJH A;  1KJT A;  3A1Q B;  4DX9 0;  3AU4 A;  2R0D A;  2QHO A;  2YS5 A;  2LAS A;  3BY4 B;  3AI5 A;  3APD A;  2I5F A;  4FAD A;  3APF A;  2IYB A;  5FR6 A;  2LXC A;  1BWN A;  2J59 M;  1FHO A;  4EZJ A;  4WVF B;  2AWT A;  1FHW A;  2P0F A;  1EAZ A;  1BAK A;  3H6N A;  1LM8 B;  3Q3F A;  1Q5W B;  1PFJ A;  1X1M A;  2D9X A;  4WWO A;  5J2R A;  4AWJ A;  1M7R A;  3W1S A;  2DZM A;  3ZW3 A;  1BTN A;  3PVW A;  2D11 A;  4Z2N A;  1WGQ A;  3U8Z A;  3RUI B;  2CY4 A;  2DYN A;  1U5G A;  4G0N B; 
#chains in the Genus database with same CATH topology
 3PRZ A;  1V6E A;  1VD2 A;  3TW1 A;  2A4Z A;  1C78 A;  1JWU D;  3ZUN A;  3D8E A;  2CU3 A;  5CHW A;  1AQC A;  4GN1 A;  2Q5W D;  1IRS A;  3N7C A;  2LD9 A;  2KNB A;  1WMH A;  1XT9 B;  3QX1 A;  1DGJ A;  3OLM D;  1T0S C;  2NTS A;  2OHF A;  2GBJ A;  2KHW B;  3QK0 A;  2Z0Q A;  3LJ3 A;  1WXV A;  3NW8 A;  5DHA B;  4LDT D;  2DZK A;  3V6C B;  4PNK A;  1QZE A;  1WMH B;  3AN1 A;  3NVW A;  2N7J A;  2DKP A;  2KN4 A;  5C3J B;  2LJ5 A;  2WGS A;  3W5U B;  1YN5 A;  4ANX A;  3PHW B;  4FHK A;  3JYU A;  1NYR A;  4ZRI A;  1ESF A;  3SBG A;  2M0X A;  4GDK A;  4K2O A;  3KLS X;  1YMH E;  3VUY A;  4A6F A;  2CY5 A;  4MSM B;  4OVU A;  1V5P A;  1V5T A;  2YSZ A;  3MJW A;  2JWU A;  3FKY A;  3HUI A;  4MGY E;  1XOD A;  3A98 B;  4PQ0 A;  1GJZ A;  2ROV A;  4UDU C;  1CZP A;  3T9L A;  1HB8 A;  1VDV A;  3P63 A;  3HVZ A;  4PS3 A;  2MBE A;  5HG2 A;  1WJM A;  1SE3 A;  3DVG Y;  2GBK A;  2DFK A;  2KDF B;  1DDW A;  3CIR B;  4H2A A;  4RH6 A;  1OTR B;  4DQO C;  3KW5 B;  2M0A A;  4NJ6 A;  1FMA D;  4XYC A;  4RM9 A;  1P9D U;  2M14 A;  4HPL B;  1OQQ A;  4BKS A;  3UIO B;  1FOE A;  2WXH A;  2IBI B;  1X86 A;  1PDX A;  2NMB A;  3ZQ4 A;  4GMV A;  3TSS A;  2OQB A;  2RDH A;  2RSG A;  2NS5 A;  4MJS A;  2M4N A;  1FXI A;  1SB3 C;  4PS8 A;  2DHK A;  2LG1 A;  4W9L A;  1V1P B;  1F77 A;  2N23 A;  2YS1 A;  4JPS A;  4GGQ A;  3DCG A;  4NSW A;  4ZYN A;  3DXD A;  2W2X C;  4XX5 A;  4E71 A;  3TEW A;  3D8D A;  2K8E A;  1F1H A;  1FM0 D;  4FLH A;  1XD4 A;  4RM8 A;  4C0A A;  1J7A A;  5D3Y A;  1C4P A;  4ICV A;  1WR6 E;  2KDE B;  4C00 A;  3PRM B;  1J7C A;  3IHP C;  5L81 A;  2HJ8 A;  3R66 C;  1WI0 A;  3URY A;  2IY0 B;  1FAO A;  2L83 A;  4TQ1 A;  4B9K A;  2BGF A;  2C5L C;  3ZNZ B;  3TO1 A;  4QJ3 B;  1TZ1 A;  1UEL A;  4F7H A;  1UF0 A;  2KUQ A;  3QAR A;  3WAO A;  5FI1 A;  2ZCB A;  4KZC A;  2W9N A;  2FCM A;  1VLB A;  2Z0P A;  1YJI A;  1WX7 A;  3I5J C;  5C23 A;  2WP9 B;  2QSD A;  4MGZ E;  3NSU A;  4HAW B;  1ZM0 A;  1OEY A;  1HB6 A;  3FLV A;  1H8C A;  3OHM B;  1CMX B;  3DVG X;  3IXS A;  1WJU A;  1YJ1 A;  3TBL D;  1JRU A;  4Y94 A;  3UI3 A;  3PG7 A;  1XLN A;  4NAW B;  3RUL A;  2N4F A;  1OY2 A;  1C76 A;  1HZ5 A;  3KQ4 A;  3FP5 A;  5BYQ A;  1HTQ A;  2MFQ A;  2RGN B;  3P4S B;  1GOZ A;  3RYT A;  5J17 A;  2I1K A;  1J8C A;  2N7D A;  3EFC A;  2H89 B;  3I9V 1;  3SFD B;  1XX0 A;  1PLS A;  1UPR A;  2VRR B;  3E9O A;  2AQ2 B;  3V61 A;  4C80 A;  1V86 A;  1VZ8 A;  4XWW A;  3RCZ A;  2ELA A;  2K39 A;  3AE7 B;  1BXT A;  1TT5 B;  4II3 B;  2CKH B;  4M0W A;  2WXI A;  3MPX A;  1M94 A;  5J18 A;  4B6H A;  2PZ1 A;  3O13 A;  4FXC A;  5FKA C;  2R09 A;  2C7H A;  2D3A A;  4CSQ A;  4M0W B;  1JRO A;  2GS0 A;  4L23 A;  5C1Z A;  1IBX A;  5D2M B;  1WGR A;  1K53 A;  3J9C A;  4BKS D;  2PPH A;  2ZPY A;  1STE A;  5JH5 C;  2G45 B;  2UWQ A;  2LGD A;  1Q0W B;  1V5U A;  3ZTD A;  2NBV A;  1N60 A;  1YQ3 B;  4JK8 A;  2EKI A;  1FGY A;  1G6J A;  1L2N A;  3LDZ E;  2FCS A;  2WLB A;  2PW9 A;  2O6V A;  2KWD A;  3BII D;  1L0X B;  2NMQ A;  2COA A;  1SXT A;  2IDY A;  4BOZ B;  3W9C B;  5BYR A;  3RNC C;  1KLG D;  3RNF C;  2DIK A;  2G4D B;  1TS3 A;  1W1H A;  1UWX A;  1WJ1 A;  3RZW C;  1ZYI A;  1TKE A;  1L0Y B;  5DCN A;  1N3H A;  1QKZ A;  2Z0D B;  4L1R A;  4EZL A;  2X38 A;  5D3D A;  3BIN A;  5BMG A;  2ZNV B;  2RQ1 A;  1WX9 A;  1I4H A;  2KCJ A;  3A4R A;  4E74 A;  1HZ6 A;  4GIV A;  4P6V F;  3AED B;  3G9W A;  2KVZ A;  4PYZ A;  3HM3 A;  3N20 C;  2KXJ A;  1Z87 A;  3NJT A;  3VFK A;  3APC A;  4OT1 A;  3M1I B;  1LQB A;  2KWC A;  4P7I A;  1DDV A;  1UNS A;  1QT9 A;  4AS1 A;  3B2F A;  3NZS A;  2MBO A;  2EMS A;  3V60 A;  3ULB A;  2KZR A;  1RLF A;  3K9P B;  3JSV B;  2JWZ A;  2WXO A;  2IO2 B;  5C79 A;  4NPN A;  4JE3 B;  1FNU A;  3KY9 A;  2MCN B;  4GLS C;  1V61 A;  3PV1 A;  2JZ3 B;  3DWG C;  3KYD D;  2CJO A;  3QWZ B;  3U12 A;  2PKO A;  4MM3 B;  4QAY A;  2Z0E B;  3Q3O C;  4EOY A;  3DBR B;  2K5P A;  3AJ4 A;  4WSF A;  1E9M A;  2X0S A;  1WZ0 A;  3VIA A;  3WYF B;  3HRD D;  3Q8A A;  1PYW D;  1TQZ A;  2GBN A;  2Z4D A;  2D9Z A;  3AE5 B;  2H7D A;  2N0S B;  4LJO B;  3ONS A;  2MBQ A;  5GXG B;  2V3P A;  4TV3 A;  5G55 A;  2JY6 A;  5LOP B;  1PGA A;  2QCZ A;  1WG7 A;  2ZKM X;  3IFW B;  4NZL B;  2L0F A;  1V9J A;  1MFW A;  4P1B C;  2GCJ A;  4QJ4 B;  2MJD A;  3ZTC A;  2QIL A;  3BK2 A;  1TZO A;  4K1R B;  3MC9 A;  1TXD A;  3U2S C;  2PVO D;  2WQY B;  1CK1 A;  1V89 A;  4JKH A;  1KLU D;  1Z2M A;  2JRH A;  1FCC C;  2WDT B;  2INN E;  4DX8 A;  1FHX A;  2COC A;  2MX2 A;  4DK5 A;  2KJR A;  2ONQ A;  1N61 A;  1WJN A;  2JXT A;  2FIF A;  2DN6 A;  4RGT A;  3AEE B;  2N0Y A;  3NWA A;  5D3V A;  1F52 A;  3FM8 C;  2OOB B;  1TS5 A;  2VZK B;  4OW0 A;  1P6S A;  3B77 A;  5E6O A;  2RLO A;  2QEJ C;  5IOI A;  4OSN A;  2FUH B;  5IAA C;  1Y8R C;  2LGS A;  4OZB A;  3NWD A;  3ML4 A;  1YQ4 B;  1P7E A;  4DWF A;  1C79 A;  2LGI A;  1C3T A;  3FAH A;  4KHB A;  2WXK A;  1IUE A;  3A9J B;  3C8Y A;  1WGU A;  1WY8 A;  2BB5 A;  1FEH A;  4PT5 A;  1PGX A;  2WXP A;  3T3O A;  1V80 A;  4L6E A;  1T77 A;  3P6A A;  2IJ0 A;  4I6N B;  3E56 A;  4MT7 A;  1KTK A;  3AEG B;  3X23 A;  2C7N B;  4USA A;  1MAI A;  2HDE A;  1U5F A;  3DQV A;  1YX5 B;  2JZZ A;  3T3N A;  2KVR A;  3AEA B;  4JL9 A;  2FID A;  5E6J A;  5DHF B;  5J3Q A;  1NVL A;  1ACA A;  2PVG C;  3IVF A;  4FJV B;  2WXJ A;  4URK A;  2MRP A;  2LWP A;  3N32 A;  5I2M A;  3AM9 A;  2RGF A;  2BS2 B;  2N9L A;  2ZCC A;  3H7P A;  4MK0 A;  2LHD A;  1SBB B;  1VZ6 A;  2V3N A;  4RFB A;  3OAN A;  4RNA A;  4A3P A;  2V0G A;  2N7E A;  3DHH C;  4LNI A;  1FCL A;  5DPT A;  4EE2 A;  1JML A;  1QC6 A;  4HRO A;  1MI0 A;  4HAV B;  1VCB A;  1L6U A;  1V2Y A;  4RGO S;  1C1Y B;  4LNN A;  2COF A;  3AEC B;  1AWD A;  2Z59 A;  1YX6 B;  2G3Q B;  3QA8 A;  3DVN V;  2FBW B;  5JHA A;  4C56 C;  2LGX A;  1NTI A;  3E9L A;  3VVW B;  4B95 A;  3KH0 A;  3D32 A;  4M00 A;  4CHM A;  3P1M A;  4GMX B;  2HTM E;  1IPG A;  2ON8 A;  4W9J A;  1I7A A;  1LO5 D;  1RRB A;  2LUE A;  3V6E B;  4JWS C;  1IGC A;  3PO0 A;  2GB1 A;  2PE9 A;  4IG7 B;  1FFV A;  3N9Y C;  3VHT C;  4XWX A;  3ENE A;  1T0Y A;  3AE1 B;  2DLW A;  1M4V A;  5C5B A;  3UQB A;  5IJM A;  4IW0 A;  4KHA A;  4TMA B;  3IAM 1;  2PIA A;  2DAF A;  1JDE A;  3ODX A;  2VZK D;  5D6J B;  3TMP B;  3R3M A;  5I2S A;  1IGD A;  4MH0 E;  4DHJ B;  2DHZ A;  4YTM B;  4C7Y A;  5C5B B;  1FRR A;  5IO9 A;  2XK5 A;  2K3U A;  2K6D B;  5BO4 B;  1UUP A;  4US9 A;  2C60 A;  1JAL A;  3B2G A;  3FC4 A;  2JP2 A;  1SJH D;  2LEK A;  2EMT A;  4B0M A;  2IO0 B;  3VUW A;  3DWM A;  2V3S A;  1A5R A;  3P42 A;  4K3B A;  1N5X A;  2MQJ A;  4BAX A;  3NS8 A;  2C7M B;  4GOC A;  3ZJV A;  1ZDX A;  3SU8 X;  1VJK A;  4NQK E;  1UGJ A;  1UNQ A;  4WQO B;  1XF5 L;  4GXB A;  4NJC A;  2JRI B;  3BZD B;  2L1A A;  4G50 A;  1E5W A;  3DHG C;  1SGH A;  2DAJ A;  4ARI A;  1WIA A;  2KJ6 A;  2BWE S;  4FUL A;  5JLJ B;  5AZH A;  3ULC A;  1XEE A;  1WGK A;  1P7F A;  2BPS A;  1L4D B;  3SEB A;  3ML8 A;  5BMH A;  3CIK A;  3SBT A;  2VH1 A;  1J0G A;  5HE1 A;  1ZDV A;  3LJU X;  2B3A A;  5JHB A;  3GS2 A;  5CHV C;  1YIW A;  2YLM A;  1WGH A;  4TUU A;  1UWM A;  3SR6 A;  4C4V A;  2M19 A;  3N1Y C;  2XBB C;  4KHO A;  5FI0 A;  3ZDT A;  2FJU B;  1YQB A;  3NY5 A;  5J3T A;  4IOI E;  1BUI C;  2CR5 A;  2H7E A;  4ZHO A;  5JHG A;  1WM2 A;  4JKC A;  2IGG A;  5JZE B;  4DHJ D;  4US8 A;  2JYE A;  3PRP B;  3BWU D;  2BVC A;  3RFZ B;  1D5Z C;  2L76 A;  2A5U A;  1H10 A;  2KWV B;  3L17 A;  1CQV A;  3IT6 B;  2I38 A;  3HVD A;  1EF1 A;  4OVV A;  1YN3 A;  5BMI A;  2INC C;  4ZOH C;  4ICU A;  4FJY A;  1RFA A;  3I57 A;  1KI1 B;  1UNP A;  3L10 B;  4XWT A;  1I35 A;  3DCX A;  3ZRC A;  1ZSQ A;  1FFU A;  4GDK B;  4M02 A;  3NZU A;  5C6R A;  1BML C;  3B1L X;  2OJR A;  4A6F B;  4KSL C;  1F2R C;  1KFY B;  1HXY D;  2QKM A;  1TJE A;  1JW9 D;  2MBB B;  2XNA C;  1T0R C;  2GBM A;  4KVG B;  1K8R B;  3UF8 A;  2G4S A;  1WGG A;  2P8V A;  5C16 A;  2AYO B;  5MPO A;  1HQR D;  1PQS A;  3A4S C;  2VKI A;  2DZI A;  2D3C A;  4A6K A;  1TKY A;  1FPY A;  1U27 A;  4BVU C;  2DX5 A;  4YXD B;  2QMT A;  2BS3 B;  3AH7 A;  4HRS A;  4JKA A;  3PP2 A;  1EM7 A;  1XO3 A;  1SE2 A;  1V97 A;  4K2P A;  3B0A A;  1E8Y A;  1AN8 A;  4EKU A;  3R7R A;  5CX3 A;  2N1W A;  3ZNH B;  1FNV A;  3VR9 B;  4JK7 A;  2JSV X;  3P2B A;  5LXH A;  3Q6B A;  3TEX A;  3NVZ A;  4GPT B;  4YSZ B;  4JX1 C;  3O65 B;  4MJS B;  2WXN A;  1JQ4 A;  4YTP B;  3EGR A;  4W9C A;  2MKR A;  1MVK A;  2D5G A;  2FCN A;  1PUT A;  3AV8 A;  3MP9 A;  1KZ7 A;  1NTV A;  3PLU A;  1IP9 A;  4HXD A;  1WR1 A;  2DBY A;  1HA5 A;  3V5W A;  4A90 A;  3Q69 A;  2WDV B;  3RNB C;  3E66 A;  2JUO A;  3L0W B;  3AUL A;  1Q67 A;  1GB4 A;  2YT2 A;  2MWS B;  4N58 A;  4FBJ B;  1GG3 A;  2NVU I;  3EPY A;  1LFD A;  2WXL A;  4A20 A;  2E3T A;  1D4B A;  1V5M A;  2NTT A;  2LOX A;  4DDG D;  1B9R A;  1J0W A;  2QKL A;  2MJE A;  3I3T B;  3KUD B;  4TQ0 A;  1QLB B;  4X57 B;  1Q1O A;  1MI1 A;  4DXG A;  4IUM B;  2QJL A;  2GJY A;  1HEZ E;  4ANW A;  3ZXV A;  2UZS A;  3LB8 C;  5J3Y A;  4HVB A;  2JVC A;  1F0Z A;  4M8N A;  5H8Y E;  2L8J A;  3ZJU A;  5DI9 B;  4IFS A;  2J0J A;  1VR9 A;  2H88 B;  1SE9 A;  1YOV B;  1A70 A;  1I4P A;  1WYW B;  1XQQ A;  2KDI A;  2FCQ A;  1F2R I;  3GYO A;  2DKQ A;  2KQS A;  3VH3 B;  1WXQ A;  4JKD A;  1U5E A;  3VXW A;  2K6Q A;  1JCK B;  1FXT B;  2D4Q A;  2BYV E;  4P16 A;  1XR0 B;  1GGO A;  4TYZ A;  2RD0 A;  2E2X A;  5KHO A;  2CHZ A;  3JVZ X;  4M8M A;  5TR5 A;  1ZVR A;  3VTV A;  4BBK A;  4HPM B;  3HSA A;  3E9P A;  3NS1 A;  2HJ1 A;  2UZR A;  4C7Z A;  2KAN A;  2KIE A;  1RAX A;  1K52 A;  3H1U A;  4IM3 A;  4NQL B;  5KQ4 A;  5DPS A;  3AE3 B;  1WF9 A;  3AEB B;  1ZP0 B;  1IBX B;  4WWN A;  4N9F 4;  4LNK A;  2WX0 A;  3VUX A;  5LNK 1;  1E6E B;  3A9K A;  1ZXH A;  3UGB B;  5LLI A;  4YON A;  2KT7 A;  2LGY A;  4KGR A;  2PEA A;  3HIE A;  3AE8 B;  3A33 B;  1E8X A;  3VAW A;  1T3Q A;  2IGD A;  2NBV B;  3MFG A;  2WX1 A;  1Y5O A;  2KK8 A;  3NUH B;  4BKT A;  3VTU A;  2ASQ A;  2HTH A;  1XD3 B;  2O6V B;  3A9K B;  4R3D A;  4GSW A;  1XCQ L;  3IT4 B;  1UGM A;  4N6E B;  4KX6 B;  4CHJ A;  1FO4 A;  3DOW A;  3R2T A;  1TJ6 A;  1ZW7 A;  2MA9 B;  1K51 A;  5D3W A;  1JWS D;  4W9H A;  3SV1 A;  2IFS A;  2W82 A;  4IM2 A;  5HHD G;  2HTH B;  1RFK A;  3DVN U;  1J19 A;  3TVV A;  4N59 A;  2KFK A;  3QBV B;  1NBF C;  2LJI A;  1OQY A;  4EUT A;  2NPT A;  1ZC4 B;  2GMI C;  1OFF A;  2BYF A;  2WHI A;  3ZYY X;  2I1J A;  2KN5 A;  4HLE A;  1DOX A;  1U5D A;  1P98 A;  4ILJ A;  3Q3N C;  2LVO A;  2V1Y A;  2KFK B;  2LUL A;  1E8Z A;  3VRB B;  5LON B;  3SYX A;  4ZRJ A;  3PHX B;  4JQW C;  3KZ1 A;  3KUC B;  3KRW A;  3U52 E;  3GZN I;  3F5R A;  2JU6 X;  4MDK E;  1BTK A;  1PMS A;  1MJD A;  4OZC A;  4IOY X;  2WWZ A;  1GC7 A;  1TYG B;  3E9S A;  3Q2A C;  3VTW A;  2D3B A;  1H4R A;  3UZT A;  3H8H A;  2IO1 B;  3ODW A;  1NI3 A;  1GAQ B;  2K49 A;  4RGN A;  4JWU C;  2ZPN A;  2ZW0 A;  4S0R A;  1OQN A;  1XLQ A;  2INP E;  2WXQ A;  4ITK A;  1KC7 A;  4MGI E;  3UIP B;  1QOG A;  3FVC A;  2G35 A;  2Y5B B;  4A6H A;  4MY6 A;  1WGY A;  2Y5C A;  1IYF A;  4WUR A;  2KMA A;  2YF0 A;  4H8S A;  2BYE A;  1TGZ B;  2BB6 A;  2LUM A;  4W9E A;  1NU2 A;  2ADZ A;  2V9H A;  2AL3 A;  2WYQ A;  1ZUD 2;  2ZZP B;  4IWO A;  1I4X A;  2EKE C;  3FSS A;  3L13 A;  4XDD A;  2UVM A;  4DIX A;  4DHZ B;  4D0N B;  3H7S A;  3KUZ A;  3B9J A;  1L5P A;  2CU1 A;  1GPX A;  1EWC A;  2WDR B;  3ZVV A;  1QOB A;  3PSE B;  2K22 A;  3CWI A;  4HAT B;  2O6V D;  3AXC A;  4NAM A;  1DYN A;  1GNU A;  3AE4 B;  2HE7 A;  3A8P A;  2WNM A;  5JXV A;  4ZRP A;  1P3Q U;  1DDM A;  2ICI A;  2L05 A;  1QF6 A;  5T8I A;  4YL8 A;  3RMK C;  2IND C;  2KX0 A;  4TSS A;  3S2A A;  4WWM A;  4MT5 A;  1RWS A;  2NZ8 B;  4F7G A;  1VZ7 A;  4DBG A;  5DIF B;  1SEB D;  1WZ3 A;  1EU4 A;  2MDX A;  2N9X A;  4B6W A;  3GZN B;  1XCT L;  4F7Z A;  1K50 A;  1P1A A;  3NRZ A;  4W9G A;  4HCN B;  2DNF A;  1MPE A;  4BOS C;  3KWV A;  3Q8B A;  4HDQ A;  4GU2 A;  3Q8F A;  4CQN A;  4I6L B;  3QQ8 B;  3W1S C;  4ZYS A;  1MG8 A;  1I4R A;  1LGR A;  2W2X D;  4DDI D;  2YVC A;  4IC7 B;  1U4A A;  2BWF A;  3ZJT A;  4ILH A;  3HK0 A;  1OGW A;  4JKE A;  2TSS A;  4BBN F;  4KHB B;  3NVV A;  2CAY A;  2J0M A;  2Y3A A;  4HAU B;  4K81 A;  4HCP B;  2YEP F;  2L1C A;  5D3X A;  2NBU A;  4YTN B;  3U7D A;  2K8H A;  4LCD E;  1WXM A;  1M7E A;  2CB8 A;  3MHS D;  1VBH A;  1LW3 A;  2WXR A;  3GP7 A;  1MG4 A;  4FN2 A;  5G2N A;  2MP2 A;  4XE0 A;  1MHH E;  2YS3 A;  5HE2 A;  3ZKJ C;  4GNK B;  1WFY A;  3NOB A;  2RDB C;  3EUB 2;  5JVL A;  1KF6 B;  4EJN A;  2M17 A;  4KIK A;  4IAP A;  3KYC D;  3P4P B;  2KAC A;  1QOA A;  1X11 A;  2FE8 A;  2KFJ A;  2W3S A;  3HW2 B;  4MAC A;  2W55 A;  2KQ7 A;  2DLB A;  3H7P B;  4OHJ A;  4ANV A;  4AOF A;  2L52 A;  4CYE A;  2YT0 A;  1MK7 B;  1DOY A;  1S3S G;  3ZLZ A;  2GUM A;  4HB0 B;  3PGE A;  4LLG M;  5IN7 A;  1NEN B;  3ZNG C;  4MGK E;  4WJQ A;  2L3Z A;  3HM6 X;  2KYW A;  3L08 A;  1KBL A;  4KV2 A;  2W54 A;  1ZC3 B;  1I7H A;  2Z59 B;  2Y8F A;  3GB1 A;  2WDQ B;  3DBH I;  1PFD A;  5CTR C;  1ROE A;  2ZW1 A;  3RN9 C;  4W9I A;  2D07 B;  2UU7 A;  1MKE A;  4JKG A;  4HJG E;  1AAR A;  4M01 A;  3DXC A;  2COP A;  3P7Z A;  2VRW B;  3PZ7 A;  3KSY A;  4G11 A;  3OJ3 A;  1L7Y A;  2J4X A;  1P0R A;  2HRJ A;  2LBB A;  2BKF A;  3WCQ A;  1UD7 A;  4F7U P;  2YRY A;  3MHZ A;  2UYZ B;  2EEL A;  3N3K B;  1SIJ A;  2BS4 B;  4RGM A;  1RYJ A;  1FNW A;  3LYY A;  4DHZ E;  3OJ4 B;  3A1Q A;  1OQR A;  1UH6 A;  3QC8 B;  2XK5 B;  1SF0 A;  4HEA 1;  2LYD A;  2RR9 A;  1KM7 A;  3OWE B;  2G9H D;  2GLS A;  5CLL B;  1E7U A;  2LI5 A;  1N62 A;  4K7S A;  4E3C A;  1L0V B;  2K8C A;  1XCG A;  3U7Z A;  4LNO A;  1WVH A;  1ST7 A;  1WXS A;  3NZ3 A;  4FJZ A;  1WM3 A;  4WAF A;  1UZX B;  2JX5 A;  4CO7 A;  3D8F A;  2PLP A;  3PZD A;  1DYQ A;  4IM0 A;  1WYG A;  4LTU A;  3VQI A;  1YNT E;  3DBL I;  1XKE A;  1V5O A;  4GOU A;  5CLQ B;  5HE3 A;  1KZG A;  1K5G B;  1ET6 A;  3PEG A;  1WSP A;  3UQA A;  2NBW B;  1I42 A;  3ETR A;  2OTX A;  3QIJ A;  5GMV A;  1DRO A;  1P3R A;  2IGH A;  3GYP A;  2KMC A;  2KDM A;  1UNR A;  2FJL A;  2SEB D;  1C4A A;  3DBH B;  4ASW C;  4D2K A;  3P4R B;  5G5H A;  4A5K A;  1F9J A;  2DYO A;  3WAN A;  2AX5 A;  3DHI C;  5TSS A;  4O1N A;  2J42 A;  5JP4 A;  1J7B A;  1Y56 A;  2LHE A;  1V49 A;  4AUQ C;  4J6I A;  4Z2M B;  3IBE A;  2KTF A;  4JGH B;  4F1S A;  2AQ1 B;  1E10 A;  3M95 A;  3EFU A;  4C4V B;  2J53 A;  4A3O A;  1E0Z A;  4YSY B;  4B0E A;  1ZOY B;  3CXB B;  2ABD A;  1VBG A;  3H9D A;  5D94 A;  3BVM A;  3EEC A;  1EVH A;  2IZV B;  2PMV A;  4EEW A;  3SO6 A;  1D6E C;  1R7S A;  2CHX A;  4XZ4 A;  5KCV A;  3PVL A;  1X1F A;  2K9X A;  2MH7 A;  2MLB A;  4W9D A;  2LVP A;  1EO6 A;  2N1V A;  3PPA A;  1EWY C;  3GE3 C;  1VRA B;  3AE9 B;  3BYY B;  3Q8C A;  5EDS A;  3EC8 A;  5LG4 B;  3DBL B;  2R61 A;  1TY2 A;  2OJW A;  4K3C A;  1WJ4 A;  4IWP A;  3BJI A;  1GUA B;  2XEW A;  2RMM A;  2RPQ A;  1WE7 A;  2CQU A;  1QIL A;  3A8Q A;  3C19 A;  3TL5 A;  5IA7 A;  2K00 A;  1S1Q B;  2ZNV C;  4RCO A;  2K0P A;  2COD A;  3A58 A;  4BBN C;  3PLV A;  3ZDM C;  2D2Q A;  3ALB A;  5FK9 C;  3SDL C;  1C9F A;  3ENB A;  4A6Q A;  2KUP A;  1JWB D;  2CJN A;  2FDQ A;  2C9W B;  4NNJ B;  2RVB B;  4WWP A;  3W2D A;  4HB4 B;  2N9K A;  2WXG A;  2DEN B;  3MDB C;  2E6X A;  1V81 A;  4WJ7 A;  1V1P A;  2LKO A;  1I2H A;  2R2Y A;  3QCA A;  1D5X C;  4WJN A;  2ZVN A;  3NVY A;  2BTE A;  3RNA C;  5C2T B;  3VH4 B;  2DYB A;  2DX5 B;  2D9Y A;  2V4I B;  1QQR A;  1T0Q C;  2Z0O A;  4KGS A;  1UBQ A;  5CHF A;  5LXI B;  3QAQ A;  2Q13 A;  2DA0 A;  1EU3 A;  4HWI B;  5HKH A;  2DHJ A;  3ZNI D;  3X0W A;  5L83 A;  1TS2 A;  5D27 A;  2J7Q B;  2LRU A;  1R4M I;  3SNH A;  1NYQ A;  2Z8L A;  2GI9 A;  2R2Q A;  4DXF A;  4MEL A;  2B76 B;  1MIX A;  1E90 A;  5FR3 A;  2WU5 B;  3SFE B;  2AEH A;  2DHI A;  1WGD A;  1RJ2 A;  2WXF A;  4K7W A;  2NCN A;  4II2 B;  4GB9 A;  5KHQ A;  3TFM A;  4CHK A;  5D7G A;  2P0H A;  2KC2 A;  4NAW A;  1U2B A;  3PSC A;  3RZF A;  3GE8 C;  1MHX A;  3V3X A;  4HKQ A;  4A9A A;  1BT0 A;  1FIQ A;  2QDF A;  2QIE B;  4WH4 A;  4ILG B;  1EGX A;  1WXA A;  2KJH B;  1SE4 A;  3EHV A;  3Q3J A;  2KKC A;  1OEY J;  2W3R A;  3SUZ A;  3V05 A;  4REZ A;  1RM6 C;  4WJP A;  4S17 A;  5EE1 A;  2EC1 A;  3RD2 A;  5M4Y B;  2DX1 A;  1V1O A;  3FEH A;  3JW0 X;  2BW2 A;  2Z14 A;  1OMW A;  2GBR A;  4KSK C;  2N9E B;  3RCP A;  4HPP A;  3CSF A;  3KWL A;  2VSZ A;  4PK1 A;  3DBS A;  5E6P A;  2ELB A;  3W5V B;  4KZ0 A;  2BF8 B;  1X05 A;  2M38 A;  5KQ1 A;  1TKG A;  2ZVO A;  2LXA A;  2ZEQ A;  2KR0 A;  4ZDV A;  1U29 A;  4WAA A;  2KWU B;  2V4L A;  4HDO A;  3PTF C;  1E7V A;  2I5C A;  4JKF A;  4IDI A;  4DBB A;  3NG0 A;  4HB3 B;  5HFY A;  3ZRF A;  2EJ8 A;  2D9W A;  2XQN M;  2DYM A;  3L54 A;  3WA0 A;  3OAW A;  1HBK A;  5AZF A;  1TIF A;  1C4C A;  1UBI A;  1R4M B;  3DPD A;  3N1Z C;  3QJZ A;  4A8X C;  4W9F A;  3RPF C;  3NHE B;  3AB5 A;  3FIL A;  3ML9 A;  2ROZ B;  3V62 A;  3ECI A;  2XN9 C;  2N9P C;  3TUO A;  1KOT A;  4HAZ B;  4KDI C;  2PE6 B;  2KDB A;  3PVU A;  3ZXR A;  1Z5S B;  3DBR I;  3I63 C;  4ANU A;  3T06 A;  1WJ6 A;  4W9K A;  4NY0 A;  4K17 A;  1YJJ A;  3FIL B;  4JLC A;  1FXA A;  2Y5P A;  2KGX B;  1T5X D;  2DWQ A;  1DBH A;  1W1G A;  2SAK A;  1T6B X;  1WH3 A;  3CST A;  2L00 B;  5EFX A;  2KMM A;  5H92 C;  2FUG 1;  2JYT A;  2D10 A;  2AQ3 B;  4PYU A;  4D6W A;  3WAL A;  3ZIM A;  3MC0 B;  1C77 A;  2ACZ B;  2JZP A;  4JIO U;  2RSU A;  4YT0 B;  3T8M A;  1TBE A;  2BCJ A;  3QHT A;  3M62 B;  2M1M A;  3KRX A;  3CMM B;  3CF6 E;  1AWE A;  1R4N I;  3IAS 1;  4K7U A;  3HQC A;  2K1F A;  1EF5 A;  1ET9 A;  1TY0 A;  2YEP B;  4LNF A;  3AE6 B;  1MIZ B;  2MSE D;  3JSV A;  2LOZ A;  3Q14 C;  2NPT B;  5I4D A;  3PS6 A;  3HIZ A;  3RT3 B;  3SD5 A;  1ZGU B;  4KKJ A;  2Y7B A;  1XLP A;  2MEK A;  4MM3 A;  2BT6 A;  1KLV A;  2BKR B;  2MW5 A;  2LRW A;  2J52 A;  3L4P A;  2KOX A;  3BYT B;  5D3I B;  1FD6 A;  4PS7 A;  4G3X B;  2GRI A;  4EMO A;  3N1X C;  2Z13 A;  2D9V A;  2KIG A;  1JWM D;  4RF0 A;  2L0T A;  1NVI D;  2D3G A;  2BQQ A;  1QQG A;  4L1B A;  3PRE A;  3AE2 B;  2Y8G A;  4BFR A;  4XC2 A;  2YT1 A;  4EZK A;  5GOW B;  2GOW A;  1AW7 A;  2MBH A;  1EUV B;  2V76 A;  1ZKH A;  3HHM A;  4HAX B;  5JHH A;  4LK0 M;  4AJY B;  4KGT A;  2W2W A;  4KDL B;  4BKG A;  2FNJ B;  3Q3M C;  2LZ6 A;  4RF1 A;  1LXD A;  1E8W A;  2FAZ A;  5HE0 A;  2JF5 A;  4MH8 A;  2KAJ A;  4HKZ E;  4LJP B;  1K5D B;  1SJE D;  2DZJ A;  2KLC A;  3MTN B;  5AUK A;  2LMC A;  2CS4 A;  4GDL A;  2J0K A;  4I6P A;  2RUK B;  2AL6 A;  4HAY B;  1SIF A;  4KAX B;  1B1Z A;  3PZ8 A;  3ZGZ A;  1DOI A;  4MSQ B;  4FA6 A;  2IPK D;  1UPQ A;  3F0W A;  3KVF B;  2KO3 A;  1WI1 A;  4WIP A;  4HK2 A;  1NDD A;  2PTL A;  2MWN B;  1R4N B;  1HE8 A;  1V88 A;  4DXA B;  3N30 A;  4GDL B;  2LFI A;  1L6V A;  3PT2 B;  3ABV B;  5G5G A;  4XGA B;  1FB8 A;  1KH0 A;  1V8C A;  2ZJD A;  4OZA A;  5DPW A;  1FGZ A;  2CHW A;  5E6N A;  3O96 A;  2M56 B;  3M63 B;  4ARC A;  2NR2 A;  1X1G A;  3B08 A;  1XXG A;  2RRF A;  2WH5 A;  4YSX B;  3ZO5 B;  2K2U A;  3MJ5 A;  5EE9 A;  4ACF A;  5L95 C;  4ZRK A;  3OG5 A;  3MC8 A;  1L4Z B;  4ZRQ A;  2O2V A;  3RNE C;  4AJW A;  2RNR B;  3Q8E A;  2IO3 B;  3A9J A;  2QC8 A;  1TS4 A;  4QXA B;  4IWQ A;  1RRP B;  4WJO A;  3WIM A;  1LB1 A;  3BVZ A;  3BVG A;  1D3Z A;  1XLO A;  3TJP A;  1WE6 A;  4MEM A;  4IKG A;  3AU5 A;  2K25 A;  2R2O A;  1ACC A;  1B55 A;  1WRD B;  1SSN A;  4RMA A;  2O2V B;  4F8C B;  2WU2 B;  4WQM A;  3VDZ A;  2WS3 B;  2GCL A;  3UIN B;  5BYS A;  2OED A;  3ODO A;  1SHC A;  3R2I A;  1ZXI A;  2RDG A;  2G1E A;  4HSI A;  3ZVR A;  2FJ9 A;  3VRA B;  3RNG C;  1YN4 A;  3BK1 A;  1NI2 A;  2RPV A;  1YD8 U;  3L16 A;  2REX A;  2KTR A;  4HHV A;  2HD5 B;  4HJK A;  4KKI A;  5EE0 A;  1E7P B;  2P0D A;  2K2J A;  4GZU A;  1MPH A;  2CRF A;  2L2I A;  3QWM A;  1TTN A;  2KD0 A;  1Y19 B;  1PGB A;  2X18 A;  2MP2 B;  1UEF A;  2VH2 A;  3SHQ A;  3NWF A;  2KTR B;  1JRP A;  1N5W A;  4L2Y A;  3IG3 A;  5DH9 B;  4KIK B;  3GOE A;  3VOQ A;  2KC1 A;  2KQ4 X;  1MK9 B;  3DXE A;  1ENF A;  3M3J A;  5HI1 A;  2JT4 B;  3K9O B;  2IY1 B;  2KX3 A;  4FHJ A;  5AZG A;  2DTC A;  2KLG A;  2MJ3 A;  3TCA A;  1WWT A;  4A55 A;  1GC6 A;  4XDC A;  4QJ5 B;  3RI7 C;  1N63 A;  3TIX A;  3WAP A;  1GB1 A;  4JKB A;  1DIK A;  4TKN A;  2IYD B;  2M8S A;  3WAM A;  1FRD A;  4JK9 A;  1P5T A;  2K8B A;  3DDC B;  3U4E G;  1W1D A;  2L7R A;  1NEK B;  1ISN A;  5AEK B;  4Q2J A;  4NJ7 A;  4AP4 C;  5AUI A;  5IP4 D;  4JKG B;  4HB2 B;  2DYQ A;  2LVQ A;  3U30 A;  2BBC A;  3R7Q A;  2JQR B;  4LDT B;  1Q10 A;  1WX8 A;  4YWG G;  3TEY A;  3C0R B;  4EFO A;  3LXF A;  1HTO A;  3AMZ A;  2X8X X;  3P4Q B;  5DPR A;  2JXX A;  3W1Y A;  1NTY A;  2JPH A;  2PJH A;  1QOF A;  1KJT A;  3AEF B;  1AYF A;  3A1Q B;  3VR8 B;  4DX9 0;  2I2Y A;  3AU4 A;  2R0D A;  2QHO A;  1ZPS A;  2YS5 A;  2LAS A;  3BY4 B;  3AI5 A;  3APD A;  2I5F A;  3EA6 A;  5EE3 A;  4FAD A;  5IKC M;  3APF A;  2IYB A;  5FR6 A;  2LXC A;  1BWN A;  2J59 M;  4BZA A;  1FHO A;  4EZJ A;  4J3O D;  4WVF B;  2AWT A;  1FHW A;  2R82 A;  2P0F A;  1KRH A;  2L32 A;  1EAZ A;  1BAK A;  3H6N A;  1LM8 B;  3Q3F A;  1Q5W B;  3TEZ A;  1PFJ A;  1X1M A;  4OVZ A;  2D9X A;  4WWO A;  5J2R A;  4AWJ A;  1ZE3 D;  3R8B A;  4AQ7 A;  1M7R A;  5IRS A;  3W1S A;  2DZM A;  3ZW3 A;  1BTN A;  1WRI A;  3PVW A;  2D11 A;  1D5M C;  1CJE A;  1N6Z A;  2BYT A;  4Z2N A;  1WGQ A;  2WXM A;  3U8Z A;  3RUI B;  1I4Q A;  2CY4 A;  1JWA D;  1I4G A;  2DYN A;  2MHJ A;  1U5G A;  4ZHP A;  4P1C C;  4G0N B; 
#chains in the Genus database with same CATH homology
 3PRZ A;  1V6E A;  1VD2 A;  3TW1 A;  2A4Z A;  3ZUN A;  3D8E A;  5CHW A;  1AQC A;  4GN1 A;  1IRS A;  3N7C A;  2LD9 A;  2KNB A;  1WMH A;  1XT9 B;  3QX1 A;  3OLM D;  2GBJ A;  2KHW B;  3QK0 A;  2Z0Q A;  3LJ3 A;  1WXV A;  5DHA B;  4LDT D;  2DZK A;  3V6C B;  4PNK A;  1QZE A;  1WMH B;  2DKP A;  2LJ5 A;  4ANX A;  3PHW B;  4FHK A;  3JYU A;  4ZRI A;  2M0X A;  3SBG A;  4GDK A;  4K2O A;  3VUY A;  4A6F A;  2CY5 A;  4MSM B;  4OVU A;  1V5P A;  1V5T A;  2YSZ A;  3MJW A;  4MGY E;  1XOD A;  3A98 B;  4PQ0 A;  1GJZ A;  2ROV A;  3T9L A;  1HB8 A;  4PS3 A;  2MBE A;  1WJM A;  3DVG Y;  2GBK A;  2DFK A;  2KDF B;  1DDW A;  1OTR B;  3KW5 B;  4NJ6 A;  4RM9 A;  1P9D U;  2M14 A;  4HPL B;  4BKS A;  3UIO B;  1FOE A;  2IBI B;  1X86 A;  2NMB A;  4GMV A;  2OQB A;  2RSG A;  2NS5 A;  4MJS A;  2M4N A;  4PS8 A;  2DHK A;  2LG1 A;  4W9L A;  2N23 A;  2YS1 A;  4GGQ A;  3DCG A;  4NSW A;  4ZYN A;  3DXD A;  2W2X C;  4XX5 A;  4E71 A;  3D8D A;  4FLH A;  1XD4 A;  4RM8 A;  4C0A A;  5D3Y A;  4ICV A;  1WR6 E;  2KDE B;  3PRM B;  3IHP C;  5L81 A;  2HJ8 A;  3R66 C;  1WI0 A;  2IY0 B;  1FAO A;  4TQ1 A;  4B9K A;  2BGF A;  2C5L C;  3ZNZ B;  3TO1 A;  1TZ1 A;  1UEL A;  4F7H A;  3QAR A;  3WAO A;  5FI1 A;  2ZCB A;  4KZC A;  2W9N A;  2FCM A;  2Z0P A;  1WX7 A;  5C23 A;  4MGZ E;  3NSU A;  4HAW B;  1ZM0 A;  1OEY A;  1HB6 A;  3FLV A;  1H8C A;  1CMX B;  3DVG X;  1WJU A;  1YJ1 A;  3TBL D;  1JRU A;  4Y94 A;  3PG7 A;  4NAW B;  3RUL A;  2N4F A;  1OY2 A;  3FP5 A;  2MFQ A;  2RGN B;  3RYT A;  5J17 A;  2I1K A;  1J8C A;  2N7D A;  1XX0 A;  1PLS A;  1UPR A;  2VRR B;  3E9O A;  3V61 A;  1V86 A;  3RCZ A;  2ELA A;  2K39 A;  4II3 B;  2CKH B;  3MPX A;  1M94 A;  5J18 A;  4B6H A;  2PZ1 A;  2R09 A;  2C7H A;  4M0W B;  2GS0 A;  5C1Z A;  5D2M B;  1WGR A;  4BKS D;  2PPH A;  2ZPY A;  5JH5 C;  2G45 B;  2UWQ A;  2LGD A;  1Q0W B;  1V5U A;  3ZTD A;  4JK8 A;  1FGY A;  1G6J A;  1L2N A;  3LDZ E;  2FCS A;  2O6V A;  2COA A;  4BOZ B;  2DIK A;  2G4D B;  1W1H A;  1WJ1 A;  3RZW C;  5DCN A;  1N3H A;  2Z0D B;  4EZL A;  3BIN A;  2ZNV B;  2RQ1 A;  1WX9 A;  2KCJ A;  3A4R A;  4E74 A;  4GIV A;  3G9W A;  4PYZ A;  3HM3 A;  2KXJ A;  1Z87 A;  3VFK A;  3APC A;  3M1I B;  1LQB A;  2KWC A;  4P7I A;  1DDV A;  3NZS A;  2MBO A;  2EMS A;  3V60 A;  3ULB A;  2KZR A;  1RLF A;  3K9P B;  3JSV B;  2JWZ A;  2IO2 B;  5C79 A;  4NPN A;  3KY9 A;  2MCN B;  1V61 A;  3PV1 A;  2JZ3 B;  3KYD D;  3QWZ B;  4EOY A;  2Z0E B;  3AJ4 A;  4WSF A;  2X0S A;  1WZ0 A;  3VIA A;  3WYF B;  2GBN A;  1TQZ A;  2D9Z A;  2H7D A;  4LJO B;  3ONS A;  2MBQ A;  4TV3 A;  5G55 A;  2JY6 A;  5LOP B;  1WG7 A;  3IFW B;  2L0F A;  1V9J A;  2GCJ A;  3ZTC A;  4K1R B;  1TXD A;  1V89 A;  4JKH A;  1Z2M A;  2JRH A;  2WDT B;  4DX8 A;  1FHX A;  2COC A;  2MX2 A;  4DK5 A;  2KJR A;  1WJN A;  2FIF A;  2DN6 A;  2N0Y A;  5D3V A;  3FM8 C;  2OOB B;  1P6S A;  5E6O A;  2RLO A;  2FUH B;  5IAA C;  1Y8R C;  3ML4 A;  4DWF A;  1C3T A;  3A9J B;  1WGU A;  1WY8 A;  1V80 A;  4L6E A;  3P6A A;  4I6N B;  4MT7 A;  3X23 A;  2C7N B;  1MAI A;  1U5F A;  3DQV A;  1YX5 B;  2JZZ A;  2KVR A;  4JL9 A;  2FID A;  5DHF B;  5J3Q A;  1NVL A;  1ACA A;  3IVF A;  4FJV B;  4URK A;  2MRP A;  2LWP A;  3N32 A;  2RGF A;  2ZCC A;  3H7P A;  4MK0 A;  4A3P A;  3OAN A;  2N7E A;  5DPT A;  1QC6 A;  4HAV B;  1VCB A;  1V2Y A;  1C1Y B;  2COF A;  3QA8 A;  1YX6 B;  2G3Q B;  3DVN V;  5JHA A;  2LGX A;  1NTI A;  3E9L A;  3VVW B;  4B95 A;  3KH0 A;  3D32 A;  4CHM A;  4GMX B;  1IPG A;  4W9J A;  1I7A A;  1RRB A;  2LUE A;  3V6E B;  2PE9 A;  4IG7 B;  3VHT C;  4XWX A;  3ENE A;  1T0Y A;  2DLW A;  5C5B A;  3UQB A;  5IJM A;  4IW0 A;  4KHA A;  2DAF A;  1JDE A;  3ODX A;  5D6J B;  3TMP B;  3R3M A;  4MH0 E;  4DHJ B;  2DHZ A;  5C5B B;  2XK5 A;  2K6D B;  5BO4 B;  2C60 A;  2JP2 A;  2EMT A;  2IO0 B;  3VUW A;  2V3S A;  1A5R A;  2MQJ A;  3NS8 A;  2C7M B;  4GOC A;  3SU8 X;  4NQK E;  1UNQ A;  4WQO B;  4GXB A;  2JRI B;  4G50 A;  1E5W A;  1SGH A;  2DAJ A;  1WIA A;  2KJ6 A;  2BWE S;  4FUL A;  5JLJ B;  5AZH A;  3ULC A;  2BPS A;  3ML8 A;  3CIK A;  3SBT A;  1J0G A;  5HE1 A;  3LJU X;  2B3A A;  5JHB A;  5CHV C;  1YIW A;  2YLM A;  1WGH A;  4TUU A;  2XBB C;  4KHO A;  5FI0 A;  3ZDT A;  1YQB A;  3NY5 A;  5J3T A;  2CR5 A;  2H7E A;  5JHG A;  1WM2 A;  4JKC A;  5JZE B;  4DHJ D;  3PRP B;  2L76 A;  2A5U A;  1H10 A;  2KWV B;  3L17 A;  1EF1 A;  4OVV A;  4ICU A;  4FJY A;  1RFA A;  1KI1 B;  1UNP A;  3L10 B;  1I35 A;  3ZRC A;  1ZSQ A;  4GDK B;  3NZU A;  5C6R A;  3B1L X;  2OJR A;  4A6F B;  4KSL C;  2QKM A;  2MBB B;  2GBM A;  4KVG B;  1K8R B;  3UF8 A;  2G4S A;  1WGG A;  2P8V A;  5C16 A;  2AYO B;  1PQS A;  3A4S C;  2VKI A;  2DZI A;  4A6K A;  1U27 A;  4BVU C;  2DX5 A;  4JKA A;  3PP2 A;  4K2P A;  3B0A A;  1E8Y A;  4EKU A;  3R7R A;  5CX3 A;  2N1W A;  3ZNH B;  4JK7 A;  3P2B A;  5LXH A;  4GPT B;  3O65 B;  4MJS B;  4W9C A;  2MKR A;  2FCN A;  1KZ7 A;  1NTV A;  3PLU A;  1IP9 A;  4HXD A;  1WR1 A;  3V5W A;  3E66 A;  2JUO A;  3L0W B;  3AUL A;  1Q67 A;  2MWS B;  4FBJ B;  1GG3 A;  2NVU I;  3EPY A;  1LFD A;  4A20 A;  1V5M A;  2LOX A;  4DDG D;  1J0W A;  2QKL A;  3I3T B;  3KUD B;  4TQ0 A;  4X57 B;  1Q1O A;  4IUM B;  2GJY A;  4ANW A;  2UZS A;  5J3Y A;  4HVB A;  2JVC A;  4M8N A;  2L8J A;  5DI9 B;  4IFS A;  2J0J A;  1SE9 A;  1WYW B;  1XQQ A;  2KDI A;  2FCQ A;  3GYO A;  2DKQ A;  2KQS A;  3VH3 B;  4JKD A;  1U5E A;  3VXW A;  2K6Q A;  1FXT B;  2D4Q A;  2BYV E;  1XR0 B;  1GGO A;  4TYZ A;  2RD0 A;  2E2X A;  5KHO A;  2CHZ A;  3JVZ X;  4M8M A;  5TR5 A;  1ZVR A;  3VTV A;  4BBK A;  4HPM B;  3E9P A;  2UZR A;  2KAN A;  1RAX A;  3H1U A;  4IM3 A;  4NQL B;  5KQ4 A;  5DPS A;  1WF9 A;  4WWN A;  4N9F 4;  2WX0 A;  3VUX A;  3A9K A;  3UGB B;  5LLI A;  4YON A;  2LGY A;  2PEA A;  3A33 B;  1E8X A;  3VAW A;  2NBV B;  2WX1 A;  1Y5O A;  2KK8 A;  4BKT A;  3VTU A;  2ASQ A;  2HTH A;  1XD3 B;  2O6V B;  3A9K B;  4GSW A;  1UGM A;  4CHJ A;  3DOW A;  1TJ6 A;  1ZW7 A;  2MA9 B;  5D3W A;  4W9H A;  3SV1 A;  2IFS A;  4IM2 A;  2HTH B;  3DVN U;  1J19 A;  3TVV A;  2KFK A;  3QBV B;  1NBF C;  1OQY A;  4EUT A;  2NPT A;  1ZC4 B;  2GMI C;  2BYF A;  2I1J A;  2KN5 A;  4HLE A;  1U5D A;  1P98 A;  4ILJ A;  2LVO A;  2V1Y A;  2KFK B;  2LUL A;  1E8Z A;  5LON B;  3SYX A;  4ZRJ A;  3PHX B;  4JQW C;  3KUC B;  3KZ1 A;  3KRW A;  3GZN I;  3F5R A;  4MDK E;  1BTK A;  1PMS A;  4IOY X;  2WWZ A;  1GC7 A;  3VTW A;  1H4R A;  3UZT A;  2IO1 B;  3ODW A;  2ZPN A;  1OQN A;  1KC7 A;  4MGI E;  3UIP B;  2G35 A;  2Y5B B;  4A6H A;  4MY6 A;  1WGY A;  1IYF A;  2KMA A;  2YF0 A;  4H8S A;  2BYE A;  1TGZ B;  4W9E A;  1NU2 A;  2ADZ A;  2AL3 A;  2WYQ A;  2ZZP B;  4IWO A;  2EKE C;  3FSS A;  3L13 A;  2UVM A;  4DHZ B;  4D0N B;  3H7S A;  3KUZ A;  2CU1 A;  3ZVV A;  3PSE B;  4HAT B;  2O6V D;  3AXC A;  1DYN A;  1GNU A;  2HE7 A;  3A8P A;  1P3Q U;  1DDM A;  2L05 A;  4YL8 A;  2KX0 A;  3S2A A;  2NZ8 B;  4F7G A;  4DBG A;  5DIF B;  1WZ3 A;  2MDX A;  2N9X A;  4B6W A;  4F7Z A;  1P1A A;  4W9G A;  4HCN B;  4BOS C;  4HDQ A;  4GU2 A;  4I6L B;  3QQ8 B;  3W1S C;  1MG8 A;  2W2X D;  4DDI D;  2YVC A;  4IC7 B;  1U4A A;  2BWF A;  4ILH A;  3HK0 A;  1OGW A;  4JKE A;  4BBN F;  4KHB B;  2CAY A;  2J0M A;  4HAU B;  4K81 A;  4HCP B;  2L1C A;  5D3X A;  2NBU A;  3U7D A;  2K8H A;  4LCD E;  1WXM A;  1M7E A;  2CB8 A;  3MHS D;  1VBH A;  1LW3 A;  4FN2 A;  5G2N A;  2MP2 A;  2YS3 A;  5HE2 A;  3ZKJ C;  1WFY A;  3NOB A;  5JVL A;  4EJN A;  2M17 A;  4KIK A;  4IAP A;  3KYC D;  1X11 A;  2KFJ A;  3HW2 B;  2KQ7 A;  3H7P B;  4ANV A;  4AOF A;  4CYE A;  2YT0 A;  1MK7 B;  1S3S G;  3ZLZ A;  4HB0 B;  3PGE A;  3ZNG C;  4MGK E;  4WJQ A;  2L3Z A;  3HM6 X;  3L08 A;  1KBL A;  4KV2 A;  1ZC3 B;  2Z59 B;  2Y8F A;  3DBH I;  5CTR C;  4W9I A;  2D07 B;  1MKE A;  4JKG A;  1AAR A;  3DXC A;  2COP A;  3P7Z A;  2VRW B;  3KSY A;  4G11 A;  3OJ3 A;  1L7Y A;  1P0R A;  2HRJ A;  2LBB A;  2BKF A;  1UD7 A;  4F7U P;  2YRY A;  2UYZ B;  3N3K B;  4DHZ E;  3OJ4 B;  3A1Q A;  1UH6 A;  3QC8 B;  2XK5 B;  2LYD A;  2RR9 A;  1KM7 A;  5CLL B;  1E7U A;  2LI5 A;  4K7S A;  4E3C A;  2K8C A;  1XCG A;  1WVH A;  1ST7 A;  1WXS A;  4FJZ A;  1WM3 A;  1UZX B;  4CO7 A;  3D8F A;  3PZD A;  4IM0 A;  3VQI A;  3DBL I;  1XKE A;  1V5O A;  5CLQ B;  5HE3 A;  1KZG A;  1K5G B;  3PEG A;  3UQA A;  2NBW B;  1I42 A;  2OTX A;  3QIJ A;  5GMV A;  1DRO A;  1P3R A;  2KMC A;  3GYP A;  1UNR A;  2FJL A;  4ASW C;  4A5K A;  1F9J A;  2DYO A;  3WAN A;  5JP4 A;  1V49 A;  4AUQ C;  4J6I A;  4Z2M B;  3IBE A;  2KTF A;  4JGH B;  4F1S A;  3M95 A;  3EFU A;  4A3O A;  3CXB B;  2ABD A;  1VBG A;  3H9D A;  5D94 A;  3EEC A;  1EVH A;  2IZV B;  4EEW A;  3SO6 A;  2CHX A;  4XZ4 A;  5KCV A;  3PVL A;  1X1F A;  2MLB A;  4W9D A;  2LVP A;  1EO6 A;  2N1V A;  3PPA A;  5EDS A;  3EC8 A;  1WJ4 A;  4IWP A;  3BJI A;  1GUA B;  2XEW A;  2RPQ A;  1WE7 A;  2CQU A;  3A8Q A;  3TL5 A;  5IA7 A;  2K00 A;  1S1Q B;  2ZNV C;  2COD A;  4BBN C;  3PLV A;  3ZDM C;  2D2Q A;  3ALB A;  3SDL C;  3ENB A;  2KUP A;  2FDQ A;  2C9W B;  4NNJ B;  2RVB B;  4WWP A;  4HB4 B;  2DEN B;  3MDB C;  1V81 A;  4WJ7 A;  2LKO A;  1I2H A;  3QCA A;  4WJN A;  2ZVN A;  3VH4 B;  2DYB A;  2DX5 B;  2D9Y A;  2Z0O A;  1UBQ A;  5CHF A;  5LXI B;  3QAQ A;  2Q13 A;  2DA0 A;  4HWI B;  5HKH A;  2DHJ A;  3ZNI D;  3X0W A;  5L83 A;  5D27 A;  2J7Q B;  2LRU A;  1R4M I;  3SNH A;  2R2Q A;  4MEL A;  1MIX A;  1E90 A;  2AEH A;  2DHI A;  1WGD A;  1RJ2 A;  4K7W A;  2NCN A;  4II2 B;  4GB9 A;  5KHQ A;  3TFM A;  4CHK A;  5D7G A;  4NAW A;  2P0H A;  2KC2 A;  1U2B A;  3PSC A;  3RZF A;  1BT0 A;  4ILG B;  1EGX A;  1WXA A;  2KJH B;  3EHV A;  3Q3J A;  2KKC A;  1OEY J;  3SUZ A;  4WJP A;  2EC1 A;  3RD2 A;  2DX1 A;  3FEH A;  3JW0 X;  1OMW A;  2GBR A;  4KSK C;  2N9E B;  3RCP A;  3CSF A;  2VSZ A;  3DBS A;  5E6P A;  2ELB A;  4KZ0 A;  2BF8 B;  1X05 A;  2M38 A;  5KQ1 A;  2ZVO A;  2LXA A;  2ZEQ A;  4ZDV A;  1U29 A;  4WAA A;  2KWU B;  2V4L A;  4HDO A;  3PTF C;  1E7V A;  2I5C A;  4JKF A;  4DBB A;  4HB3 B;  3ZRF A;  2EJ8 A;  2D9W A;  2XQN M;  2DYM A;  3L54 A;  3WA0 A;  3OAW A;  1HBK A;  5AZF A;  1UBI A;  3DPD A;  3QJZ A;  4W9F A;  3NHE B;  3ML9 A;  2ROZ B;  3V62 A;  3ECI A;  2N9P C;  1KOT A;  4HAZ B;  4KDI C;  2PE6 B;  2KDB A;  3PVU A;  1Z5S B;  3DBR I;  4ANU A;  3T06 A;  1WJ6 A;  4W9K A;  4NY0 A;  4K17 A;  4JLC A;  2KGX B;  1DBH A;  1W1G A;  1WH3 A;  3CST A;  2L00 B;  5EFX A;  2D10 A;  4PYU A;  3WAL A;  3ZIM A;  4JIO U;  2RSU A;  3T8M A;  1TBE A;  2BCJ A;  3QHT A;  3M62 B;  2M1M A;  3KRX A;  3CMM B;  3CF6 E;  1AWE A;  1R4N I;  4K7U A;  3HQC A;  2K1F A;  1EF5 A;  1MIZ B;  2MSE D;  3JSV A;  2LOZ A;  2NPT B;  3PS6 A;  3HIZ A;  3RT3 B;  3SD5 A;  1ZGU B;  2Y7B A;  4MM3 A;  1KLV A;  2BKR B;  2MW5 A;  2LRW A;  2KOX A;  4PS7 A;  4G3X B;  4EMO A;  2D9V A;  2L0T A;  2D3G A;  1QQG A;  3PRE A;  2Y8G A;  4BFR A;  4XC2 A;  2YT1 A;  4EZK A;  5GOW B;  2GOW A;  2MBH A;  1EUV B;  2V76 A;  1ZKH A;  3HHM A;  4HAX B;  5JHH A;  4AJY B;  2W2W A;  4KDL B;  4BKG A;  2FNJ B;  2LZ6 A;  1LXD A;  1E8W A;  2FAZ A;  5HE0 A;  2JF5 A;  4LJP B;  1K5D B;  2DZJ A;  2KLC A;  3MTN B;  2CS4 A;  4GDL A;  2J0K A;  4I6P A;  2RUK B;  2AL6 A;  4HAY B;  1SIF A;  4KAX B;  4MSQ B;  4FA6 A;  1UPQ A;  3F0W A;  3KVF B;  2KO3 A;  1WI1 A;  4HK2 A;  1NDD A;  2MWN B;  1HE8 A;  1V88 A;  4DXA B;  3N30 A;  4GDL B;  3PT2 B;  1FB8 A;  2ZJD A;  5DPW A;  1FGZ A;  2CHW A;  5E6N A;  3O96 A;  3M63 B;  2NR2 A;  1X1G A;  3B08 A;  2WH5 A;  3ZO5 B;  2K2U A;  5L95 C;  4ZRK A;  2O2V A;  4AJW A;  2RNR B;  2IO3 B;  3A9J A;  4IWQ A;  1RRP B;  4WJO A;  3WIM A;  1LB1 A;  1D3Z A;  3TJP A;  1WE6 A;  4MEM A;  3AU5 A;  2K25 A;  2R2O A;  1WRD B;  1B55 A;  4RMA A;  2O2V B;  4F8C B;  3VDZ A;  2GCL A;  3UIN B;  3ODO A;  1SHC A;  3ZVR A;  2FJ9 A;  1NI2 A;  3L16 A;  1YD8 U;  2REX A;  2KTR A;  4HHV A;  2HD5 B;  4HJK A;  2P0D A;  2K2J A;  4GZU A;  1MPH A;  2CRF A;  2L2I A;  3QWM A;  1TTN A;  2KD0 A;  1Y19 B;  2X18 A;  2MP2 B;  1UEF A;  3SHQ A;  2KTR B;  3IG3 A;  5DH9 B;  4KIK B;  3GOE A;  3VOQ A;  2KC1 A;  1MK9 B;  3DXE A;  3M3J A;  2JT4 B;  3K9O B;  2IY1 B;  2KX3 A;  4FHJ A;  5AZG A;  2DTC A;  2KLG A;  3TCA A;  1GC6 A;  3TIX A;  3WAP A;  4JKB A;  1DIK A;  4TKN A;  2IYD B;  2M8S A;  3WAM A;  4JK9 A;  1P5T A;  2K8B A;  3DDC B;  1W1D A;  2L7R A;  1ISN A;  5AEK B;  4NJ7 A;  4AP4 C;  4JKG B;  4HB2 B;  2DYQ A;  2LVQ A;  3U30 A;  3R7Q A;  4LDT B;  1WX8 A;  3C0R B;  4EFO A;  5DPR A;  2JXX A;  3W1Y A;  1NTY A;  2JPH A;  2PJH A;  1KJT A;  3A1Q B;  4DX9 0;  3AU4 A;  2R0D A;  2QHO A;  2YS5 A;  2LAS A;  3BY4 B;  3AI5 A;  3APD A;  2I5F A;  4FAD A;  3APF A;  2IYB A;  5FR6 A;  2LXC A;  1BWN A;  2J59 M;  1FHO A;  4EZJ A;  4WVF B;  2AWT A;  1FHW A;  2R82 A;  2P0F A;  1EAZ A;  1BAK A;  3H6N A;  1LM8 B;  3Q3F A;  1Q5W B;  1PFJ A;  1X1M A;  2D9X A;  4WWO A;  5J2R A;  4AWJ A;  1M7R A;  3W1S A;  2DZM A;  3ZW3 A;  1BTN A;  3PVW A;  2D11 A;  4Z2N A;  1WGQ A;  3U8Z A;  3RUI B;  2CY4 A;  2DYN A;  1U5G A;  4G0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...