2AL6A

Ferm domain of focal adhesion kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
373
structure length
343
Chain Sequence
b'GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQTDDYAEIIDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
molecule tags Transferase
source organism Gallus gallus
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
total genus 98
structure length 343
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2al6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2al6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al6A01
1QQGA 4K1RB 2MWNB 2HTHB 1MIZB 3D8DA 2RSGA 4HB2B 2L0FA 1ISNA 2EJ8A 2KUPA 1W1HA 3QWZB 2YRYA 3RULA 3ZTCA 3VH4B 4GMXB 2C60A 1X86A 2O2VA 3APDA 3QA8A 4WJPA 3MDBC 1KLVA 1G6JA 2K8BA 1TBEA 1V2YA 2QKMA 2EC1A 3N7CA 2FJ9A 2KJ6A 3ALBA 4IW0A 2MBQA 3MJWA 3CIKA 2DYOA 2KNBA 3TIXA 4KSKC 2IO0B 3VUXA 3VXWA 3WIMA 2Z0EB 1E8WA 1U2BA 3DBHI 3QARA 4HCPB 4E71A 3KYDD 2ROVA 1FHXA 1YX6B 3LJ3A 4WJOA 3KSYA 2VRRB 1VD2A 2XBBC 3BY4B 4BKSA 1D3ZA 4FHKA 4KHBB 2MBHA 5DPTA 3PP2A 5DPWA 1QZEA 3FLVA 3JYUA 3L16A 1P98A 3KUDB 4D0NB 3R3MA 4HWIB 4M8MA 4ICVA 1HBKA 3VIAA 5LXHA 4IOYX 4WVFB 3X23A 4HPMB 1ZC4B 5HE2A 3GYOA 1X1FA 3SUZA 3SD5A 2LULA 1I35A 2QHOA 2R2OA 4LJOB 2LGXA 2KLGA 2IO2B 2LXAA 2RR9A 3WA0A 5LOPB 3H1UA 4Y94A 2YS5A 5D3WA 2FDQA 1XD4A 5CHFA 4LDTD 3S2AA 3T9LA 3ZUNA 4ZRKA 4HLEA 2J0JA 4HDQA 1J0GA 3UZTA 1UH6A 2V76A 3DVNU 2C7HA 2P0HA 2N7DA 3N32A 1L7YA 3ZDMC 3IVFA 1LM8B 2FAZA 3G9WA 1KZ7A 1E90A 1SGHA 3A98B 2BGFA 3C0RB 4NQLB 3ZTDA 3EPYA 2LVPA 3B08A 2UYZB 4GGQA 4B6WA 4FJZA 3L17A 1FHWA 3UINB 4HAUB 1WG7A 4B6HA 2KJHB 2K25A 3B0AA 4G50A 4GZUA 2QKLA 4GMVA 2JRHA 3OLMD 4P7IA 1WGYA 2J59M 4NAWA 1BAKA 2K39A 2Y5BB 2VKIA 2COFA 2KO3A 3A9KA 2BYEA 3HIZA 3LDZE 2Z0OA 2IFSA 2Y8FA 2N9EB 3P2BA 1LW3A 2ELBA 3PG7A 1WVHA 2FNJB 4LDTB 4JIOU 4XC2A 1OY2A 2DYNA 2D10A 3DBRI 2IO3B 2MFQA 2KWVB 4F8CB 2YVCA 3PVWA 5J18A 2GJYA 3RZFA 5KQ1A 1P3QU 1V6EA 3H7SA 3A9KB 2Z0QA 1H4RA 2DFKA 3NHEB 3ZNHB 1Q5WB 3D32A 2KFJA 3FEHA 3KRWA 5IA7A 5AZGA 3AI5A 2KDBA 3KUZA 2LASA 3DBLI 1EF1A 3AU4A 4FULA 3UIOB 1WJUA 2N4FA 2P8VA 4I6LB 4JL9A 4HB4B 3TFMA 5DCNA 3VVWB 1GUAB 5DPSA 4II2B 4ANXA 3SNHA 3BJIA 3GYPA 2AL3A 3U8ZA 1P0RA 1UNQA 2R2QA 3WANA 2M14A 3IHPC 1NTIA 2DX5A 3DXCA 2NBWB 3QQ8B 4K7UA 1I2HA 1TQZA 1XKEA 2R0DA 3QBVB 4NJ7A 3HQCA 1AARA 2JRIB 2C9WB 3U30A 1OGWA 5LXIB 2H7EA 1H8CA 2I5FA 3OJ4B 1WE7A 2DX5B 2KDEB 2NR2A 1XT9B 1UGMA 1FGYA 4TQ1A 4GDLA 3UF8A 3QK0A 3KW5B 3Q3JA 3ZDTA 3DBSA 3N3KB 3UIPB 3V6EB 1E7VA 4DBBA 3ZNGC 4BOSC 1Q1OA 2CB8A 5C23A 2KC2A 3PRZA 2O6VB 2KC1A 2Q13A 3RCZA 4PYZA 2KGXB 4GDLB 1RAXA 2Y8GA 2KWCA 1NVLA 5DPRA 2RGNB 4GXBA 5LONB 3OJ3A 1UEFA 2N7EA 2NCNA 2G35A 3SO6A 4XZ4A 4WJ7A 4HAWB 4XX5A 2KXJA 4EEWA 3P6AA 1XR0B 1LFDA 4IFSA 4NQKE 4BBKA 1M7EA 3K9OB 4DHJD 4DHZE 3JSVA 1V86A 2LI5A 1WM2A 3RZWC 5C5BA 2GBNA 2P0FA 3KYCD 1WGHA 5GMVA 1TTNA 2LRWA 2LOZA 2J0KA 3OANA 2MBOA 4BKGA 4EOYA 2D9ZA 3MPXA 2NMBA 2YS1A 2X18A 4EJNA 1ZC3B 1NTYA 4L6EA 1ZVRA 3GZNI 5EDSA 2ROZB 3ZNZB 1V5OA 1WI0A 2KZRA 1P1AA 4NPNA 1YIWA 1RRBA 3B1LX 4BBNF 3VTVA 3SV1A 3F5RA 3BINA 3IFWB 3F0WA 3DQVA 4FJYA 3UQAA 3M95A 1IP9A 1BWNA 3CF6E 1MK9B 3A33B 4E3CA 1R4NI 2KTFA 2CR5A 4DK5A 4G3XB 2GOWA 2KQ7A 3VTWA 3CXBB 2N9PC 2D9YA 4MJSB 3PVLA 2FCMA 5E6OA 3WAPA 1WJMA 4KAXB 2BWES 3T8MA 1OEYJ 4GSWA 4IM0A 1TZ1A 2BKFA 5JLJB 2WDTB 4MT7A 3L0WB 1WM3A 5DI9B 3VFKA 2E2XA 4MJSA 2J7QB 1X1MA 1XD3B 4K7WA 5D7GA 4DWFA 3ONSA 1TXDA 1S1QB 4EFOA 1WY8A 5JZEB 2CRFA 4W9JA 1DDVA 4N9F4 1TGZB 1Z5SB 5JHGA 4A5KA 1FXTB 1YQBA 2V1YA 2I1JA 1OQNA 2LVQA 3DVNV 3R7RA 3O65B 5D6JB 1YX5B 4HVBA 4KVGB 1TJ6A 4TKNA 2DLWA 2A5UA 4A6HA 1WIAA 2MDXA 4CHJA 2CY5A 1GC6A 2KCJA 3ODOA 2JZZA 1J19A 2RNRB 2CKHB 2CHWA 2FCQA 3X0WA 4KDIC 3M1IB 3NY5A 3PRMB 5CX3A 3DCGA 2I5CA 4BOZB 1JRUA 2CAYA 2YSZA 5DH9B 2HRJA 1NI2A 2ZNVB 3L10B 1HE8A 4LJPB 1MG8A 4RMAA 2VRWB 2M0XA 2M8SA 3RCPA 1R4MI 2PJHA 2DZIA 3L54A 1QC6A 1L2NA 2R09A 2LKOA 2MX2A 3FP5A 1EAZA 2D9WA 2LGDA 1WZ0A 3A4SC 3ZKJC 2KLCA 4MGKE 1W1GA 2MRPA 4JLCA 4MELA 5IAAC 2OJRA 4M8NA 3M63B 2ZEQA 3QWMA 2W9NA 4GIVA 2D4QA 2AWTA 1X11A 2LOXA 4HB0B 4KHOA 1ZKHA 2KTRB 3KZ1A 3LJUX 4IAPA 1SIFA 2LVOA 3DXEA 3DPDA 3IG3A 4FHJA 1GNUA 2O6VD 4FLHA 4HHVA 4G0NB 3T06A 2FCNA 4OVUA 3NS8A 2KANA 4GB9A 2LXCA 4NNJB 2KMAA 2P0DA 3PT2B 5KQ4A 2M17A 2RGFA 2DKQA 3HW2B 2UZRA 2MLBA 4KDLB 3I3TB 5D94A 3KY9A 1EUVB 1RLFA 3ECIA 1P6SA 1Z87A 4HAZB 1T0YA 3QAQA 4BBNC 1UNPA 5HKHA 1U29A 3DDCB 1GJZA 2RQ1A 3QC8B 4MDKE 2K8HA 2M4NA 2Z0DB 1UPQA 5CLLB 4ZDVA 2MP2B 4C0AA 2KMCA 3QX1A 2IZVB 2W2XD 2YS3A 3DXDA 5HE1A 2V3SA 3W1YA 1P9DU 4A3PA 2ADZA 1Y5OA 2C5LC 2NBUA 2BPSA 3ML4A 3EC8A 1MIXA 2RUKB 1WJ4A 1EO6A 3AJ4A 1YD8U 2WYQA 3PREA 1Q0WB 2YT0A 4WJNA 4JGHB 5AZFA 1E8ZA 3ZLZA 1V5PA 2ZCBA 4TUUA 2HE7A 4ICUA 2OOBB 3A9JB 2FIFA 1M94A 1U5DA 5E6NA 3VAWA 1WGQA 4FA6A 3AXCA 4PS8A 5E6PA 5CHWA 2LYDA 4W9KA 1WFYA 2LG1A 2XK5A 1OEYA 1WJNA 1WGRA 1UELA 4HK2A 1UBQA 1AWEA 2GBKA 3M62B 5D3YA 2NZ8B 3HM6X 2KX0A 1OTRB 2CHXA 1P3RA 2DN6A 2RVBB 1WGUA 4OVVA 3ZNID 2L76A 5L83A 1ZM0A 2ELAA 1DROA 2ZCCA 2MCNB 1UBIA 4A20A 1V89A 3APCA 4KIKA 4MGZE 1U5FA 5CHVC 3SYXA 5JHHA 5J3TA 3KH0A 4E74A 1C3TA 3TW1A 3PPAA 2IY1B 2DHIA 1CMXB 2JXXA 1U5GA 2DZJA 2O2VB 5C1ZA 1WE6A 2PEAA 3CMMB 4GOCA 1ZW7A 4GN1A 3VDZA 3TCAA 2EKEC 2JVCA 2G4SA 1BTKA 1E5WA 5D3VA 1E8YA 2MWSB 4WAAA 2KTRA 3L13A 2COAA 2IY0B 2BCJA 3SDLC 3WAOA 4EZKA 4ZYNA 2WX1A 2KN5A 4NJ6A 4IM2A 3PLVA 2ZPNA 1DDMA 3HM3A 5G2NA 4BKSD 4CHKA 4B9KA 1YJ1A 2KOXA 3AULA 2D9VA 4KZ0A 2CS4A 5C79A 5CLQB 1PQSA 1WMHB 1RRPB 4ANUA 1WX9A 3QHTA 4BFRA 3JW0X 3HHMA 2EMSA 2BKRB 4II3B 4Z2NA 1V9JA 2CODA 5DIFB 1Q67A 1V81A 4HJKA 4EZJA 2JP2A 4URKA 3D8FA 4W9LA 2MSED 2O6VA 3R7QA 4PNKA 4A6KA 1IPGA 4EUTA 4W9EA 1WXAA 2LD9A 3ZVVA 3H6NA 4MSQB 1UZXB 4HCNB 2KDIA 1UPRA 1V5TA 2LBBA 1PMSA 4F7UP 3H9DA 4HAYB 4I6PA 2ZZPB 1F9JA 3SHQA 1FHOA 2B3AA 1NDDA 4PS3A 5JHBA 4YONA 3A9JA 3NSUA 3PEGA 2Y7BA 2KK8A 4A3OA 2UWQA 4MY6A 2LRUA 3VH3B 4AJWA 2COCA 2ZNVC 4IWOA 2DYBA 3K9PB 4WQOB 3O96A 1ZSQA 3PGEA 1S3SG 5KCVA 5IJMA 4W9IA 5HE0A 4WJQA 2N23A 1DYNA 4HDOA 4NAWB 3DOWA 1KZGA 1K5GB 4TV3A 3RT3B 3EFUA 2K2JA 2V4LA 4MH0E 2PPHA 2YLMA 1XCGA 2Z59B 2ASQA 2L3ZA 1XX0A 1XQQA 3V62A 4KIKB 4IWPA 2L1CA 4KZCA 2N1VA 1WZ3A 2GS0A 4ANWA 2WH5A 3WALA 4MK0A 2DX1A 5JP4A 4FJVB 3TJPA 2VSZA 2NBVB 2RD0A 2G3QB 4DX8A 2MQJA 3QJZA 4KV2A 2GBJA 4W9GA 2BYFA 2CQUA 4IG7B 1PLSA 3ODWA 2RPQA 1Y19B 4AJYB 3DVGY 2UZSA 5D27A 2N1WA 2BYVE 2ZVNA 2L7RA 5JHAA 3U7DA 4IUMB 3RYTA 1FAOA 2GCJA 1WXVA 1HB8A 2M1MA 4GU2A 1HB6A 2IO1B 1U5EA 3L08A 2K6DB 2ZJDA 4DDGD 4WSFA 2XEWA 1BTNA 4PS7A 2DAFA 3SU8X 3TL5A 4ZRIA 4DX90 2C7MB 2DA0A 4H8SA 4HATB 2C7NB 2W2WA 4IM3A 4WWPA 2JZ3B 3TMPB 2CY4A 1FGZA 2DKPA 2MBBB 3Q3FA 5LLIA 1AQCA 3NOBA 4NY0A 1LQBA 3ZIMA 3ULBA 2DTCA 4F7HA 3W1SC 1Z2MA 3PZDA 3ML8A 1X1GA 3GOEA 4W9CA 2PZ1A 2XQNM 5J3YA 5C5BB 3ZVRA 2M38A 2K6QA 4IC7B 2DZKA 3EECA 5J3QA 4GDKB 4WWNA 1B55A 2K00A 3P7ZA 5C6RA 4W9FA 1X05A 1ZGUB 4W9DA 1U27A 1WRDB 1C1YB 4BKTA 5HE3A 4MM3A 4I6NB 2MBEA 4PYUA 4ASWC 1Y8RC 2KJRA 4RM8A 1KOTA 1J0WA 1NU2A 2FJLA 2FUHB 3ML9A 2RLOA 2DZMA 3QIJA 4M0WB 2LWPA 4GPTB 1WR6E 3VQIA 3A1QB 1J8CA 4KHAA 2RSUA 2NPTA 5C16A 2DYQA 1MKEA 1IYFA 5FI0A 4MGYE 1WXSA 2ZPYA 2YT1A 3WYFB 2IYDB 2KKCA 4W9HA 3OAWA 1I42A 2MW5A 4EZLA 2OQBA 3PHWB 1MPHA 1I7AA 1SHCA 1DBHA 5J2RA 2NPTB 2I1KA 4K2PA 3VUWA 5BO4B 2PE9A 5FR6A 4BVUC 2G4DB 4IWQA 3ENEA 2JT4B 1P5TA 1M7RA 2UVMA 3TVVA 3V5WA 1WJ6A 1WX7A 3VTUA 5JH5C 3VUYA 5TR5A 1PFJA 4NSWA 1UNRA 4DDID 2COPA 1V80A 4TQ0A 4MEMA 5KHOA 1EVHA 3KVFB 1K5DB 1WF9A 2DHZA 2K8CA 2ZVOA 3JVZX 3PHXB 1FB8A 4K17A 2D07B 2DHJA 4WWOA 1MAIA 4K81A 4HXDA 5L81A 3WAMA 4K2OA 2L8JA 5AZHA 3ZW3A 2JY6A 1KM7A 2D3GA 2ABDA 2JF5A 3TBLD 2H7DA 1LB1A 2DHKA 2LJ5A 1GC7A 3N30A 4AUQC 5AEKB 1SE9A 2CU1A 2G45B 1E8XA 2AEHA 2DENB 3PV1A 1V88A 1IRSA 1FOEA 1RJ2A 2FCSA 4K7SA 3VHTC 2HD5B 5J17A 1ST7A 2OTXA 2KVRA 3RUIB 4F7GA 5DHFB 1N3HA 2HJ8A 2WX0A 4G11A 4FN2A 4X57B 3PSEB 3TO1A 1WX8A 2WWZA 2JPHA 3PRPB 1OMWA 2A4ZA 5G55A 1V5MA 1E7UA 1WH3A 2CHZA 2HTHA 3FSSA 4HAVB 2L0TA 2K2UA 5EFXA 1V5UA 3VOQA 2L05A 2N9XA 2LGYA 4GDKA 3RD2A 4AOFA 5KHQA 2D9XA 2LZ6A 5D3XA 1DDWA 3KRXA 3PLUA 2D11A 3QCAA 3ULCA 2KFKA 3D8EA 3APFA 3PTFC 3JSVB 3R66C 2D2QA 4HPLB 4HAXB 1WGDA 3IBEA 2BWFA 1WJ1A 1OQYA 3H7PB 1GG3A 1BT0A 3FM8C 2KHWB 2AL6A 4Z2MB 5CTRC 4HB3B 1V49A 2KFKB 1WXMA 4EMOA 4EKUA 2KWUB 3A1QA 3PS6A 3H7PA 3A8QA 4AP4C 2DYMA 2DAJA 2YF0A 1XODA 2PE6B 3V6CB 1VCBA 1A5RA 4ZRJA 3ZO5B 1W1DA 2EMTA 2REXA 1EF5A 4MGIE 3ZRFA 2L2IA 2JUOA 3UGBB 1UD7A 4ANVA 1NBFC 2GBRA 2KD0A 1LXDA 1K8RB 4CYEA 2LUEA 4DHJB 2MP2A 4B95A 5GOWB 2L00B 3NZUA 4F1SA 1V61A 1WMHA 3CSFA 4AWJA 5FI1A 2GBMA 1ACAA 2KDFB 4XWXA 4A6FB 4DHZB 2JWZA 1WI1A 4YL8A 3PVUA 2IYBA 2W2XC 3HK0A 4PQ0A 3ODXA 4F7ZA 2MKRA 4FBJB 2MA9B 3A8PA 2GMIC 4DBGA 4KSLC 5L95C 3MHSD 3W1SA 3UQBA 5D2MB 4A6FA 2N0YA 2IBIB 3V60A 5DHAB 1WYWB 4CO7A 4FADA 2FIDA 4JQWC 3PSCA 1EGXA 1KJTA 1WGGA 1H10A 4CHMA 1RFAA 2GCLA 3EHVA 2NVUI 3KUCB 2J0MA 3NZSA 2XK5B 1WR1A 4TYZA 3MTNB 3A4RA 4J6IA 3ZRCA 3V61A 1NTVA 1U4AA 3DVGX 3M3JA 4RM9A 2AYOB 2KX3A 2Z0PA 4MSMB 3AU5A 4DXAB 1KI1B 2K1FA 2NS5A 1MK7B 3CSTA 4LCDE 2KQSA 2BF8B
chains in the Genus database with same CATH superfamily
2RMMA 2KWDA 1N63A 1MIZB 4HB2B 1ISNA 1WWTA 3VH4B 3C19A 1X86A 3QA8A 4K3CA 2WLBA 1TBEA 3MFGA 1V2YA 2QKMA 4KSKC 2Z0EB 1E8WA 3DBHI 4QAYA 3KYDD 2ROVA 4BKSA 2FJUB 4JX1C 4KHBB 2D3BA 1AN8A 1V1OA 3JYUA 4HWIB 4M8MA 4HPMB 3GYOA 1X1FA 2R2OA 2KLGA 5CHFA 1TJEA 2MJ3A 4LDTD 3S2AA 3ZUNA 1D5MC 4HLEA 1VRAB 1WXQA 2WU2B 3ZDMC 2N7DA 4RCOA 1L7YA 4PK1A 1LM8B 3G9WA 1KZ7A 1E90A 2KYWA 1B9RA 3AE3B 3EPYA 2KJHB 4G50A 4QJ3B 4IOIE 1WGYA 1BAKA 1F1HA 2KO3A 3VUXA 2FNJB 2YVCA 3PVWA 2GJYA 3H7SA 2DFKA 3ZNHB 1Q5WB 3NVZA 5AZGA 3KUZA 2LASA 3UIOB 2N4FA 2QEJC 5DCNA 3VVWB 1GUAB 5DPSA 1P7FA 3SNHA 4NAMA 3P4PB 2N0SB 2M14A 2HDEA 2ZW1A 4FXCA 1I2HA 3FVCA 5LXIB 1OGWA 3DBLB 1H8CA 3OJ4B 1WE7A 1YN4A 1FD6A 2LHDA 3UF8A 3UIPB 3DBSA 1IBXA 4DBBA 4N58A 3NVYA 4JKDA 2KC2A 3CWIA 3ZYYX 1SBBB 1RAXA 2Y8GA 4GDLB 2Y5PA 5LONB 1UEFA 4WJ7A 2SEBD 4IFSA 4NQKE 4BBKA 1V86A 1WM2A 1TTNA 2LRWA 3OANA 4JWSC 4L6EA 1NTYA 4OSNA 4N6EB 1WI0A 1P1AA 4BBNF 2Z59A 2UU7A 3F5RA 3BINA 4E3CA 1R4NI 3E9LA 4G3XB 2N9KA 3WAPA 4B0MA 1WJMA 2BWES 3T8MA 1OEYJ 1IUEA 2BKFA 1XLQA 5JLJB 4ITKA 3VFKA 3P1MA 2E2XA 1T77A 2J7QB 2PW9A 1DIKA 1EU4A 1WY8A 5JZEB 1TGZB 2V1YA 2EELA 1KH0A 3OG5A 3ODOA 3BWUD 2JZZA 2RNRB 3X0WA 2M0AA 3NY5A 3DCGA 2CAYA 5DH9B 4ANXA 2RDHA 4JK9A 3L54A 3RCPA 1R4MI 2R09A 2LKOA 2MX2A 2D9WA 3BVZA 3A4SC 1W1GA 3NVVA 2OJRA 3QWMA 1PFDA 2PTLA 1D6EC 2Z13A 1XEEA 4LNNA 2LOXA 1ZKHA 3LJUX 2LVOA 2EKIA 2O6VD 4HHVA 3AN1A 3BVGA 4OVUA 3LXFA 3DHHC 2RGFA 2MLBA 2UZRA 4YTPB 4GOUA 3Q3NC 1RLFA 3ECIA 1Z87A 1T0YA 4BBNC 3DDCB 2M4NA 3A58A 3FC4A 2E6XA 5I2SA 1MIXA 1YD8U 2R82A 1B1ZA 1EO6A 2KACA 3U2SC 1N6ZA 2OOBB 4HJGE 5E6NA 1U5DA 3Q8AA 2WXPA 2JWUA 4W9KA 2LG1A 2INCC 2XK5A 1OEYA 1UBQA 2V4IB 2GBKA 3HM6X 1OTRB 2DN6A 2L76A 2ELAA 2ZCCA 2MCNB 3APCA 4KIKA 4MGZE 1U5FA 3TEYA 2V9HA 1VJKA 3BIID 1VZ6A 1U5GA 2DZJA 3T3OA 2PEAA 1ZW7A 3VDZA 3TEZA 3TCAA 2EKEC 2ZW0A 2MJDA 2G4SA 3P4SB 1E8YA 3EGRA 4EZKA 2KN5A 4NJ6A 4IM2A 3PLVA 4REZA 1DDMA 4B9KA 4M01A 2Z14A 3DBHB 1QOBA 5CLQB 1PQSA 1BXTA 1VR9A 4BFRA 2G9HD 1QLBB 4II3B 4Z2NA 3FILB 3NJTA 2KVZA 3D8FA 4W9LA 2LD9A 3ZVVA 2WHIA 3H9DA 2LBBA 4HAYB 4I6PA 4LK0M 4TSSA 2B3AA 2INPE 3TEWA 5JHBA 5H8YE 4OT1A 2Y7BA 4A3OA 3HUIA 4AJWA 3IXSA 3K9PB 3O96A 1WYGA 1S3SG 1DOXA 5KCVA 5HE0A 1DYNA 2X0SA 4HDOA 3VR9B 1K5GB 3HRDD 4NZLB 4TV3A 1JRPA 3V62A 1SE2A 1F2RI 2KMMA 5JP4A 3ZQ4A 3L4PA 2RD0A 2MQJA 3QJZA 2BYFA 3AV8A 3HVDA 4AJYB 1Y19B 2ZVNA 2BYVE 1YQ4B 3SFEB 1OQRA 1WXVA 2Z8LA 2IO1B 3IT4B 4D2KA 4WSFA 4PS7A 5AUIA 4DX90 1C76A 4IM3A 1EM7A 4JKEA 4KGSA 1QOAA 5FKAC 3NOBA 3ZIMA 5LG4B 4F7HA 2AQ2B 1Z2MA 5JHAA 1X1GA 3ZVRA 2M38A 2K6QA 2DZKA 3EECA 5J3QA 3HVZA 4GDKB 1M4VA 1B55A 2K00A 3P7ZA 3P63A 5JVLA 1Y8RC 1J0WA 2DZMA 3PZ7A 2D3CA 4C00A 2NPTA 2L1AA 1T0RC 3SBTA 3WYFB 2IYDB 1I42A 4PT5A 4EZLA 3AE7B 1MPHA 4LNFA 3AEBB 2Q5WD 3GP7A 5FR6A 1KLGD 2JX5A 4ZRQA 3I63C 2JT4B 1M7RA 3TVVA 1ZDVA 5KHOA 3KVFB 1K5DB 2DHZA 3PHXB 2BB6A 1AYFA 4OW0A 4HXDA 3WAMA 3ZW3A 2D3GA 3IAM1 4ILHA 1LB1A 3N30A 1N60A 3W5UB 1L0VB 1FOEA 1FXIA 5DHFB 4B95A 4FN2A 4USAA 2JPHA 1UWMA 2WWZA 1E7UA 2ONQA 5KHQA 3VOQA 5BYQA 4AOFA 1L6UA 3PLUA 2LZ6A 5D3XA 1DDWA 1L5PA 3VTWA 2D11A 3R66C 2BWFA 1WJ1A 3H7PB 3N1YC 3GS2A 4M0WA 3IT6B 1RYJA 4EKUA 3H7PA 3A8QA 3MC0B 4WURA 1EF5A 2L2IA 3UGBB 1QKZA 2GBRA 2R61A 4DHJB 4CYEA 4F1SA 1V61A 5FI1A 1ACAA 4DHZB 2BBCA 1FRDA 2JWZA 2W2XC 1MFWA 3A8PA 1JCKB 4DBGA 5L95C 3W1SA 2K5PA 4EE2A 4FADA 1KJTA 1WGGA 3KUCB 4YTNB 1FCLA 4JKFA 1WR1A 3A4RA 3B2GA 1NYQA 4MSMB 2Z0PA 1BUIC 3V3XA 2K1FA 4LCDE 1PGXA 4LNKA 1KRHA 2MWNB 1C4PA 4WIPA 2EJ8A 2KUPA 3QWZB 2X38A 2C60A 1KLVA 4IW0A 3MC9A 2QILA 4C56C 1E6EB 3QARA 4HCPB 3LJ3A 1VD2A 4FHKA 2MBHA 5DPTA 3PP2A 1QZEA 3R3MA 3ZXRA 1MI0A 1P98A 4D0NB 3KUDB 4YT0B 1STEA 1HBKA 5LXHA 1KC7A 1TKGA 3SBGA 4AQ7A 3SD5A 2QHOA 3V05A 1ZOYB 5LOPB 1HZ6A 1XD4A 3T9LA 4HDQA 3AH7A 2V76A 3N32A 2C7HA 1MPEA 4CSQA 3C0RB 1SGHA 1KBLA 3Q2AC 2ZKMX 3B08A 2K3UA 3UINB 4HAUB 1WG7A 1P7EA 2K25A 2JRHA 2QKLA 4GMVA 4P7IA 4DIXA 4OZBA 3P2BA 3Q3OC 2ELBA 1WVHA 4LDTB 4JIOU 4OVZA 1MI1A 2MFQA 1TS5A 1P3QU 3A9KB 3NHEB 3D32A 3FEHA 1YJJA 3AI5A 2KDBA 2I2YA 5T8IA 4DXFA 4I6LB 3TFMA 4II2B 2R2QA 3WANA 3U8ZA 4P16A 4RGMA 4KHBA 1NTIA 2DX5A 3DXCA 2NBWB 4K7UA 3N1ZC 3AE4B 4C7YA 1TQZA 1XKEA 2R0DA 2DX5B 2NR2A 4KX6B 2V3PA 1WGKA 1XT9B 1UGMA 3QK0A 1FNVA 3Q3JA 3V6EB 1WSPA 1Q1OA 1FRRA 3AM9A 1QT9A 3PRZA 4IKGA 2V3NA 1C9FA 3RCZA 2KWCA 4ZHOA 5DPRA 2RGNB 4JE3B 4GXBA 2NCNA 4XX5A 4EEWA 3K9OB 1M7EA 2FBWB 2P0FA 2GBNA 1WGHA 3KYCD 3UI3A 2J0KA 4EJNA 1ET9A 1ZVRA 2JYEA 4A55A 3NVWA 3ZNZB 5EDSA 2KZRA 4NPNA 3IFWB 2WP9B 4FJYA 1BWNA 1UUPA 3A33B 2KTFA 4DK5A 2N9PC 2D9YA 3EFCA 3BK2A 4IM0A 3BZDB 2WDTB 2OJWA 1HTOA 4BAXA 4JKCA 4L2YA 1QQRA 1XLNA 5EE9A 2BB5A 4HKZE 1DDVA 1FXTB 3R7RA 1OQNA 3DVNV 3O65B 1SJED 2A5UA 4GLSC 4A6HA 5E6JA 1WIAA 2KCJA 4J3OD 2VH2A 5BMIA 4DXGA 2AQ1B 4KDIC 5CX3A 3GE8C 4BOZB 2I5CA 1JRUA 2ZNVB 3ZNGC 2K0PA 2M8SA 2DZIA 1QC6A 4MH8A 5GXGB 3FP5A 2LGDA 1SSNA 1ESFA 5IAAC 4YWGG 2ZEQA 2D4QA 2AWTA 5BYRA 4KHOA 2D5GA 4IAPA 3DPDA 1JWBD 1ZP0B 3I9V1 4G0NB 3T06A 1MG4A 3AE8B 3W5VB 5HI1A 2DKQA 3HW2B 1L6VA 4HROA 5HKHA 1P6SA 4ZYSA 1UNPA 1E0ZA 1LO5D 2RQ1A 3QC8B 2K8HA 1UPQA 5CLLB 2MP2B 4C0AA 1TZOA 1HQRD 2IZVB 1XO3A 3QX1A 1XLOA 3AB5A 4A3PA 2BYTA 2ADZA 1Y5OA 2C5LC 3ML4A 3EC8A 2RUKB 2WYQA 5AZFA 5J2RA 1Q0WB 1E8ZA 3HIEA 1V5PA 2ZCBA 2HE7A 1C4CA 4ICUA 2PMVA 2FIFA 1M94A 3AXCA 4PS8A 1UNSA 5CHWA 2LYDA 4DQOC 2MEKA 1UELA 4HK2A 3NUHB 1AWEA 4JK8A 1P3RA 2J4XA 1XXGA 1DROA 3NW8A 1V89A 1VZ7A 2IGDA 3NRZA 1JWMD 3TW1A 2K22A 2WXIA 2DHIA 2WXRA 3W9CB 2LJIA 4GN1A 1E5WA 5D3VA 1Q10A 4WAAA 2QMTA 2WX1A 2ZPNA 4CHKA 2W55A 2KOXA 2BS4B 2D9VA 2CS4A 1PUTA 1RRPB 3QHTA 3HHMA 4CQNA 2CODA 2YEPF 1V81A 4HJKA 4EZJA 4URKA 1TS4A 4C4VB 3R7QA 1IPGA 4A6KA 5G5HA 1AWDA 3AECB 1RFKA 4MSQB 4HCNB 3LYYA 3RI7C 4LNOA 1V5TA 3T3NA 5AUKA 1F9JA 1FHOA 3B77A 4PS3A 4WH4A 4YONA 2IGHA 3A9JA 3PEGA 2MH7A 2UWQA 1FO4A 3VH3B 2ZNVC 2KAJA 5IJMA 4HKQA 2N23A 4NAWB 2WXLA 3BVMA 2K2JA 2V4LA 3PO0A 4ANVA 2YLMA 2L3ZA 1XQQA 1SB3C 4KIKB 1WZ3A 2GS0A 2WH5A 4MK0A 1GAQB 2NBVB 2CQUA 4YSXB 4IG7B 3DVGY 1R4NB 2L7RA 2NBVA 2GCJA 2JZPA 1HB8A 2LGIA 4GU2A 2WXNA 3L08A 1BTNA 5D3DA 5FK9C 2DA0A 4HATB 3ZJVA 2CY4A 1HTQA 3TSSA 2DKPA 2MBBB 2Z4DA 3AEGB 1AQCA 3W1SC 3PZDA 3ML8A 3GOEA 2QC8A 3E9OA 2LGSA 1X05A 1T0QC 1U27A 4BKTA 4MM3A 5HHDG 1YOVB 4I6NB 2FUG1 4RNAA 1KOTA 4M00A 4M0WB 5D3IB 1FNWA 1IGCA 4KHAA 4US8A 5C16A 1TS3A 4LLGM 1MHHE 5FI0A 2YT1A 4W9HA 5G5GA 1IGDA 1I7AA 1SHCA 1DBHA 4GNKB 4K2PA 2KN4A 4IWQA 4XDCA 4XDDA 3VTUA 4L23A 1JW9D 5TR5A 3J9CA 4NSWA 4DDID 3H8HA 2COPA 1V80A 1K51A 1I4GA 1MHXA 2ZVOA 1FB8A 4K17A 4WWOA 4K81A 1RWSA 2KR0A 5IN7A 1KM7A 3TBLD 2H7DA 4AUQC 3Q14C 4N59A 3ZJUA 2AEHA 2DENB 1IRSA 2FCSA 4K7SA 1ZXIA 3VHTC 4ARIA 1GGOA 3RUIB 4F7GA 2HJ8A 1N3HA 4G11A 1YN5A 3TO1A 1WX8A 3PSEB 2IGGA 4OZAA 1N62A 2BT6A 1V5MA 4HAVB 3RNAC 5EFXA 2L05A 1FXAA 2N9XA 4GDKA 3RD2A 1TS2A 3QCAA 3ULCA 3PTFC 3APFA 3R2TA 1V1PB 1OQYA 3FM8C 4Z2MB 4HB3B 4AP4C 2DYMA 1XODA 3V6CB 4ZRJA 3N1XC 3ZRFA 2VZKD 2KUQA 1NBFC 1LXDA 2LUEA 5GOWB 2KDFB 2IYBA 3ODXA 1I4QA 4FBJB 2MA9B 3MHSD 2IBIB 3V60A 3PSCA 2W3RA 2GCLA 4MT5A 3NS1A 2J0MA 1NTVA 2KX3A 1T5XD 3Q8EA 4JWUC 2SAKA 2FCMA 1QQGA 2YEPB 3D8DA 2RSGA 3C8YA 1W1HA 1FFVA 2YRYA 4GMXB 2BVCA 4RF0A 3U12A 2K8BA 1G6JA 2EC1A 3MJWA 2IO0B 3WIMA 4E71A 5EE3A 1FHXA 4WJOA 3KSYA 2VRRB 1D3ZA 3BY4B 1T3QA 3L16A 3N20C 3VIAA 1TYGB 4IOYX 1QILA 3X23A 1ZC4B 2LEKA 2LULA 2GRIA 4C7ZA 3E66A 2PVGC 4LJOB 2LGXA 2IO2B 2LXAA 2RR9A 3WA0A 5IO9A 4Y94A 5D3WA 3GZNB 2JSVX 3KWVA 2J0JA 1ENFA 3OWEB 1UH6A 5M4YB 2FAZA 3FKYA 2BGFA 4NQLB 3ZTDA 2RPVA 2LVPA 2UYZB 4B6WA 3L17A 1FHWA 1YQ3B 4GZUA 3OLMD 2K39A 2Y5BB 2VKIA 2LUMA 2BYEA 2IFSA 2Z0OA 2DYNA 2D10A 3DBRI 2KWVB 4F8CB 5J18A 3RZFA 1V6EA 1WRIA 4Q2JA 1H4RA 3KRWA 1EWYC 1EF1A 3AU4A 4FULA 5I2MA 1WJUA 2P8VA 4XWWA 3P4QB 2AL3A 2WDVB 1ZE3D 2W3SA 1ACCA 3IHPC 5IOIA 1V8CA 4NJ7A 3HQCA 2H7EA 2I5FA 2KDEB 1FGYA 4GDLA 1T6BX 3ZDTA 3N3KB 1F77A 1E7VA 1SXTA 3AE5B 5C23A 2Q13A 2KGXB 1NVLA 2DIKA 1FNUA 1A70A 2G35A 4HAWB 2FE8A 3P6AA 1LFDA 4QJ5B 4DHZE 1DYQA 1CZPA 3JSVA 5H92C 2LI5A 1R7SA 3RZWC 3NWDA 3ZXVA 2LOZA 2MBOA 3MPXA 2NMBA 2YS1A 2HJ1A 1NEKB 2DNFA 3Q8CA 4MACA 2NMQA 2ROZB 1TY0A 1V5OA 1YIWA 3RNBC 3UQAA 1KTKA 3M95A 3KLSX 3CF6E 1MK9B 1DGJA 2CR5A 4IDIA 2GOWA 2KQ7A 3CXBB 5FR3A 4JKBA 2WU5B 3PVLA 4MJSB 4KAXB 3Q3MC 1I4PA 4GSWA 1TZ1A 3E56A 3ZJTA 4MT7A 3L0WB 3ETRA 3WCQA 4MJSA 1X1MA 3ONSA 1FFUA 5JXVA 2CRFA 4W9JA 1FEHA 4N9F4 3SEBA 1YQBA 1GB1A 2LVQA 4HVBA 4KVGB 4TKNA 1TJ6A 3GE3C 3I5JC 1EU3A 4XWTA 2CKHB 2FCQA 3M1IB 3PRMB 4CO7A 2YSZA 2M56B 4RMAA 4LJPB 1MG8A 2VRWB 2M0XA 2AQ3B 3IAS1 3Q8FA 1QF6A 5EE1A 4OZCA 1FM0D 2KLCA 4JLCA 4P6VF 4M8NA 3M63B 4S17A 2DWQA 2KTRB 1GNUA 2FCNA 2KANA 4GB9A 4NNJB 2P0DA 1I4RA 3PT2B 4HRSA 2M17A 2BS2B 1L4DB 1EUVB 4P1BC 4HAZB 1E10A 2Z0DB 4ZDVA 1YNTE 3E9SA 2KMCA 3MP9A 2W2XD 2YS3A 5HE1A 4C4VA 1UF0A 1HXYD 1P9DU 2BTEA 2BPSA 3R8BA 1WJ4A 5HFYA 2KT7A 2YT0A 4L1BA 4WJNA 3ZLZA 4TUUA 3A9JB 1ET6A 1TKYA 1WGQA 4FA6A 1WFYA 1WJNA 1WGRA 2LHEA 2WS3B 4XE0A 2CHXA 2RVBB 3ZNID 4OVVA 1YJIA 3DWGC 2E3TA 1UBIA 4A20A 2TSSA 2KQ4X 3SYXA 5J3TA 3KH0A 5IP4D 4E74A 1C3TA 1GPXA 3LB8C 1FCCC 1CMXB 2YT2A 2NTTA 5C1ZA 1WE6A 3CMMB 4B0EA 2JVCA 3BYTB 1NENB 2MWSB 2WDQB 3L13A 2COAA 1YMHE 2IY0B 4RFBA 3WAOA 3HM3A 5G2NA 3EUB2 2WXKA 1YJ1A 3N9YC 3AULA 4KZ0A 5C79A 1WMHB 4ANUA 2J42A 3JW0X 1D4BA 1Q67A 3U52E 2JP2A 3VRAB 3O13A 2O6VA 4PNKA 1KLUD 4RGOS 4US9A 1UZXB 2KDIA 1UPRA 4F7UP 1C79A 3AEDB 2ZZPB 1HZ5A 3FAHA 1NDDA 5C2TB 5BMHA 1CJEA 4RGNA 2KK8A 4MY6A 2LRUA 4WQMA 2COCA 2J53A 4WQOB 1ZSQA 4W9IA 3VR8B 3RT3B 4DWFA 4IWPA 2N1VA 1E7PB 3WALA 2DX1A 3TJPA 4C80A 4DX8A 3GB1A 1PLSA 3ODWA 4O1NA 3U7DA 4IUMB 1SE4A 4KGRA 1VBHA 1DOYA 1PGBA 2K6DB 1L4ZB 2ZJDA 4DDGD 3SU8X 2PLPA 2DAFA 2K49A 4ZRIA 2C7MB 4WWPA 3RMKC 4YSYB 4RF1A 3TMPB 5LLIA 2BS3B 4NY0A 4W9CA 2PZ1A 2XQNM 5C5BB 1IBXB 4ACFA 1NVID 4IC7B 2N7JA 4JPSA 5C6RA 1SE3A 1ZGUB 1C1YB 1FIQA 3DCXA 1J7AA 4ASWC 3RNGC 2V0GA 1NU2A 1C4AA 3ML9A 4GPTB 1D5XC 1WR6E 3VQIA 2WXOA 3A1QB 1J8CA 2RSUA 2JXTA 1IYFA 4MGYE 1I4HA 3ABVB 2KKCA 4YXDB 3OAWA 2OQBA 3PHWB 4P1CC 4JKAA 2NPTB 2I1KA 5BO4B 2G4DB 4XGAB 3AE2B 1WJ6A 1WX7A 2CJNA 4TQ0A 3AE6B 2MHJA 1WF9A 2K8CA 2LMCA 3Q69A 2D07B 4ZOHC 2DHJA 5L81A 4K2OA 2JF5A 1FMAD 3NZ3A 2LJ5A 2QJLA 5AEKB 4AS1A 1SE9A 4JKGB 3DHIC 2G45B 1E8XA 3PV1A 1V88A 2HD5B 5J17A 1ST7A 5IKCM 4OHJA 2QSDA 4JKGA 3PRPB 2A4ZA 5HG2A 2XN9C 1WH3A 1V5UA 2LGYA 2D9XA 4ZRPA 1C78A 3D8EA 1K50A 3JSVB 4HPLB 2D2QA 4HAXB 1WGDA 3IBEA 4MM3B 1BT0A 1V49A 2WXMA 2KWUB 2OHFA 4HSIA 3PS6A 2YF0A 1A5RA 1VCBA 4UDUC 2EMTA 2REXA 2JUOA 2KD0A 2PVOD 1K8RB 2MP2A 3HSAA 3CSFA 1N5WA 1SJHD 4RH6A 4YL8A 4PQ0A 1DOIA 2PIAA 1MJDA 2GMIC 1PYWD 2IJ0A 4KSLC 3UQBA 1OFFA 5D2MB 2N0YA 1D5ZC 5DHAB 1K52A 1WYWB 2KIGA 1EGXA 2WXGA 4CHMA 1RFAA 1TY2A 2NVUI 3NZSA 3Q8BA 3RNCC 2R2YA 3MTNB 4TYZA 3ZRCA 3V61A 3DVGX 1U4AA 3M3JA 4RM9A 5I4DA 1L0YB 2AYOB 1OQQA 3AU5A 4DXAB 2NS5A 1MK7B 2D3AA 2KQSA 2GB1A 1F52A 4K1RB 2HTHB 3RFZB 2L0FA 3RULA 2HTME 3ZTCA 1GOZA 2O2VA 3APDA 4WJPA 3MDBC 2W82A 4HPPA 2QIEB 3N7CA 2FJ9A 2KJ6A 3ALBA 2MBQA 3CIKA 2DYOA 2KNBA 1MVKA 3TIXA 3VXWA 2KIEA 2PKOA 2RDGA 1U2BA 1YX6B 4LTUA 2XBBC 1K53A 5DPWA 3FLVA 4ICVA 4QXAB 4WVFB 4NJCA 5HE2A 3BYYB 3SUZA 1CQVA 3U7ZA 1I35A 3H1UA 4KGTA 2YS5A 2FDQA 4ZRKA 1J0GA 1XLPA 2ON8A 3UZTA 3DVNU 2P0HA 3IVFA 1I7HA 3A98B 4XYCA 4BZAA 1ZXHA 4GGQA 1AW7A 4FJZA 4B6HA 3B0AA 2W54A 2J59M 4NAWA 3HIZA 3LDZE 2COFA 3A9KA 4JQWC 2WNMA 3I57A 2Y8FA 2N9EB 4DHJD 1LW3A 3PG7A 4XC2A 1OY2A 1F0ZA 2IO3B 5KQ1A 5MPOA 2Z0QA 2M19A 5IRSA 1TKEA 2KFJA 1JMLA 5IA7A 4YSZB 1JALA 3DBLI 2JU6X 4JL9A 4HB4B 3B2FA 3RN9C 3BJIA 3GYPA 1P0RA 1UNQA 1KFYB 4A8XC 3QQ8B 1HEZE 4HEA1 4YTMB 2I38A 3QBVB 2LFIA 2JRIB 1AARA 3U30A 2C9WB 1ZUD2 5TSSA 4TQ1A 3KW5B 4BOSC 2GUMA 1R4MB 2CB8A 2H89B 2O6VB 2KC1A 4PYZA 2AX5A 3OJ3A 2N7EA 3SO6A 4XZ4A 2KXJA 4TMAB 1XR0B 1XCTL 5C5BA 5GMVA 1I4XA 1T0SC 4BKGA 4EOYA 2D9ZA 3RNFC 2X18A 3NWFA 1ZC3B 3GZNI 1RRBA 3B1LX 3VTVA 3SV1A 3F0WA 3DQVA 3MJ5A 4A9AA 3B9JA 2G1EA 5E6OA 4ILGB 2INDC 4ARCA 1JROA 1WM3A 5DI9B 1XD3B 4K7WA 5D7GA 1TXDA 1S1QB 4EFOA 1Z5SB 5JHGA 4A5KA 3OHMB 2I1JA 2B76B 2CJOA 5D6JB 4L1RA 1YX5B 2DLWA 2MDXA 2JYTA 4CHJA 2CY5A 1GC6A 1J19A 2CHWA 3URYA 1KF6B 3ZGZA 1IP9A 2HRJA 1NI2A 3L10B 1HE8A 2PJHA 1L2NA 1JDEA 1EAZA 1HA5A 1WZ0A 1QOGA 1ZPSA 2IPKD 3ZKJC 2MRPA 4MELA 2W9NA 3P42A 4GIVA 3Q6BA 1TT5B 1X11A 4HB0B 2OEDA 1J7CA 3KZ1A 1SIFA 3DXEA 1VZ8A 3IG3A 4ILJA 4FHJA 4FLHA 3NS8A 5EE0A 2LXCA 2KMAA 2IDYA 5KQ4A 5D94A 4KDLB 5BMGA 3I3TB 3KY9A 3QAQA 1U29A 1GJZA 4MDKE 4KKIA 2GLSA 1RM6C 3DXDA 2V3SA 2WXQA 3W1YA 2L52A 1J7BA 1UGJA 2MJEA 3DBRB 1SF0A 1PGAA 2NBUA 3PZ8A 3AJ4A 3PREA 4K3BA 4JGHB 4RGTA 3VAWA 5E6PA 2WDRB 3M62B 5D3YA 2NZ8B 2KX0A 3KWLA 5L83A 1WGUA 1ZM0A 1SEBD 5CHVC 1NI3A 5JHHA 3PPAA 2IY1B 2JXXA 1FPYA 2O2VB 4GOCA 1BTKA 3P4RB 2KTRA 2XNAC 3SDLC 2BCJA 1UWXA 1EWCA 4ZYNA 4BKSD 1QOFA 4KKJA 1JWUD 2WGSA 2J52A 1VDVA 1WX9A 2EMSA 2BKRB 3MHZA 1JQ4A 1V9JA 5DIFB 3AEEB 4LNIA 2MSED 4EUTA 1F2RC 3DHGC 3ENBA 4W9EA 1WXAA 5C3JB 4ZHPA 3H6NA 5LNK1 1PMSA 3SHQA 2ACZB 1Y56A 3AMZA 1VBGA 3SFDB 3NSUA 2Y3AA 2WQYB 4IWOA 2DYBA 3PGEA 4WJQA 3TUOA 3DOWA 1KZGA 2WXFA 3EFUA 4MH0E 2PPHA 2Z59B 1XCGA 4WAFA 2ASQA 1XX0A 2L1CA 3MC8A 4KZCA 4ANWA 2VH1A 1ZDXA 3AEFB 4FJVB 2VSZA 2G3QB 4KV2A 2GBJA 4W9GA 2QCZA 2RPQA 2UZSA 5D27A 1C77A 2N1WA 3RYTA 1FAOA 2M1MA 1HB6A 4QJ4B 1U5EA 3TL5A 2XEWA 4H8SA 2C7NB 2Y5CA 2W2WA 2JZ3B 1ROEA 1FGZA 1L0XB 3Q3FA 4A90A 1LQBA 3ULBA 2DTCA 5J3YA 3CIRB 4WWNA 4A6QA 1JWSD 4W9FA 3U4EG 1N5XA 1XF5L 3DWMA 4W9DA 1WRDB 3VRBB 5HE3A 2MBEA 4PYUA 2KJRA 4RM8A 2FJLA 2FUHB 1ZYIA 2RLOA 3QIJA 2NTSA 1TIFA 2LWPA 2DYQA 1MKEA 1WXSA 2ZPYA 2BQQA 3EA6A 2MW5A 2RRFA 3KQ4A 4H2AA 4M02A 2KDMA 3VUWA 1CK1A 4BVUC 2ICIA 2L83A 2PE9A 3ENEA 1GB4A 5JH5C 1P5TA 2UVMA 3V5WA 2DLBA 3AE9B 4WWMA 3VUYA 4JKHA 1PFJA 1UNRA 1SIJA 2DBYA 1VLBA 4MEMA 1EVHA 4R3DA 5BYSA 3JVZX 1MAIA 3RNEC 2L8JA 5AZHA 2JY6A 2ABDA 3SR6A 2DHKA 1GC7A 1NYRA 3TEXA 2CU1A 1RJ2A 4S0RA 2KVRA 2OTXA 2CU3A 2BW2A 2WX0A 4X57B 5G55A 1OMWA 2L0TA 2CHZA 2HTHA 3FSSA 2K2UA 1LGRA 1V1PA 2INNE 1E9MA 4MGKE 3KRXA 1V97A 2KFKA 2QDFA 1GG3A 2K8EA 1JWAD 1XCQL 2KHWB 2AL6A 5CTRC 1PDXA 2KFKB 1WXMA 4EMOA 2RDBC 3A1QA 3E9PA 2DAJA 2H88B 2PE6B 3NWAA 3ZO5B 1W1DA 4MGIE 1UD7A 3R2IA 4JK7A 2WXJA 2L00B 3NZUA 1WMHA 4AWJA 3AE1B 2X8XX 2GBMA 4XWXA 4A6FB 1WI1A 3PVUA 4D6WA 3HK0A 3FILA 4F7ZA 2MKRA 1N61A 4A6FA 2K9XA 2FIDA 2GI9A 1H10A 2VZKB 2JQRB 3EHVA 2XK5B 4J6IA 1BMLC 2WXHA 3W2DA 2N9LA 3NG0A 1YN3A 3RPFC 2L32A 1KI1B 3AEAB 3BK1A 3CSTA 2BF8B
chains in the Genus database with same CATH topology
1MIZB 4HB2B 1ISNA 3VH4B 1X86A 3QA8A 1TBEA 1V2YA 2QKMA 4KSKC 2Z0EB 1E8WA 3DBHI 3KYDD 2ROVA 4BKSA 4KHBB 3JYUA 4HWIB 4M8MA 4HPMB 3GYOA 1X1FA 2R2OA 2KLGA 5CHFA 4LDTD 3S2AA 3ZUNA 4HLEA 3ZDMC 2N7DA 1L7YA 1LM8B 3G9WA 1KZ7A 1E90A 3EPYA 2KJHB 4G50A 1WGYA 1BAKA 2KO3A 3VUXA 2FNJB 2YVCA 3PVWA 2GJYA 3H7SA 2DFKA 3ZNHB 1Q5WB 5AZGA 3KUZA 2LASA 3UIOB 2N4FA 5DCNA 3VVWB 1GUAB 5DPSA 3SNHA 2M14A 1I2HA 5LXIB 1OGWA 1H8CA 3OJ4B 1WE7A 3UF8A 3UIPB 3DBSA 4DBBA 4JKDA 2KC2A 4GDLB 1RAXA 2Y8GA 5LONB 1UEFA 4WJ7A 4IFSA 4NQKE 4BBKA 1V86A 1WM2A 1TTNA 2LRWA 3OANA 4L6EA 1NTYA 1WI0A 1P1AA 4BBNF 3F5RA 3BINA 4E3CA 1R4NI 3E9LA 4G3XB 3WAPA 1WJMA 2BWES 3T8MA 1OEYJ 2BKFA 5JLJB 3VFKA 2E2XA 2J7QB 1DIKA 1WY8A 5JZEB 1TGZB 2V1YA 3ODOA 2JZZA 2RNRB 3X0WA 3NY5A 3DCGA 2CAYA 5DH9B 4ANXA 4JK9A 3L54A 3RCPA 1R4MI 2R09A 2LKOA 2MX2A 2D9WA 3A4SC 1W1GA 2OJRA 3QWMA 2LOXA 1ZKHA 3LJUX 2LVOA 2O6VD 4HHVA 4OVUA 2RGFA 2MLBA 2UZRA 1RLFA 3ECIA 1Z87A 1T0YA 4BBNC 3DDCB 2M4NA 1MIXA 1YD8U 2R82A 1EO6A 2OOBB 5E6NA 1U5DA 4W9KA 2LG1A 2XK5A 1OEYA 1UBQA 2GBKA 3HM6X 1OTRB 2DN6A 2L76A 2ELAA 2ZCCA 2MCNB 3APCA 4KIKA 4MGZE 1U5FA 1U5GA 2DZJA 2PEAA 1ZW7A 3VDZA 3TCAA 2EKEC 2G4SA 1E8YA 4EZKA 2KN5A 4NJ6A 4IM2A 3PLVA 1DDMA 4B9KA 5CLQB 1PQSA 4BFRA 4II3B 4Z2NA 3D8FA 4W9LA 2LD9A 3ZVVA 3H9DA 2LBBA 4HAYB 4I6PA 2B3AA 5JHBA 2Y7BA 4A3OA 4AJWA 3K9PB 3O96A 1S3SG 5KCVA 5HE0A 1DYNA 2X0SA 4HDOA 1K5GB 4TV3A 3V62A 5JP4A 2RD0A 2MQJA 3QJZA 2BYFA 4AJYB 1Y19B 2ZVNA 2BYVE 1WXVA 2IO1B 4WSFA 4PS7A 4DX90 4IM3A 4JKEA 3NOBA 3ZIMA 4F7HA 1Z2MA 5JHAA 1X1GA 3ZVRA 2M38A 2K6QA 2DZKA 3EECA 5J3QA 4GDKB 1B55A 2K00A 3P7ZA 5JVLA 1Y8RC 1J0WA 2DZMA 2NPTA 3SBTA 3WYFB 2IYDB 1I42A 4EZLA 1MPHA 5FR6A 2JT4B 1M7RA 3TVVA 5KHOA 3KVFB 1K5DB 2DHZA 3PHXB 3WAMA 4HXDA 3ZW3A 2D3GA 4ILHA 1LB1A 3N30A 1FOEA 5DHFB 4B95A 4FN2A 2JPHA 2WWZA 1E7UA 5KHQA 3VOQA 4AOFA 3PLUA 2LZ6A 3VTWA 5D3XA 1DDWA 2D11A 3R66C 2BWFA 1WJ1A 3H7PB 4EKUA 3H7PA 3A8QA 1EF5A 2L2IA 3UGBB 2GBRA 4DHJB 4CYEA 4F1SA 1V61A 5FI1A 1ACAA 4DHZB 2JWZA 2W2XC 3A8PA 4DBGA 5L95C 3W1SA 4FADA 1KJTA 1WGGA 3KUCB 4JKFA 1WR1A 3A4RA 4MSMB 2Z0PA 2K1FA 4LCDE 2MWNB 2EJ8A 2KUPA 3QWZB 2C60A 1KLVA 4IW0A 3QARA 4HCPB 3LJ3A 1VD2A 4FHKA 2MBHA 5DPTA 3PP2A 1QZEA 3R3MA 1P98A 3KUDB 4D0NB 1HBKA 5LXHA 1KC7A 3SBGA 3SD5A 2QHOA 5LOPB 1XD4A 3T9LA 4HDQA 2V76A 3N32A 2C7HA 3C0RB 1SGHA 1KBLA 3B08A 3UINB 4HAUB 1WG7A 2K25A 2JRHA 2QKLA 4GMVA 4P7IA 3P2BA 2ELBA 1WVHA 4LDTB 4JIOU 2MFQA 1P3QU 3A9KB 3NHEB 3D32A 3FEHA 3AI5A 2KDBA 4I6LB 3TFMA 4II2B 2R2QA 3WANA 3U8ZA 1NTIA 2DX5A 3DXCA 2NBWB 4K7UA 1TQZA 1XKEA 2R0DA 2DX5B 2NR2A 1XT9B 1UGMA 3QK0A 3Q3JA 3V6EB 1Q1OA 3PRZA 3RCZA 2KWCA 5DPRA 2RGNB 4GXBA 2NCNA 4XX5A 4EEWA 3K9OB 1M7EA 2GBNA 2P0FA 3KYCD 1WGHA 2J0KA 4EJNA 1ZVRA 5EDSA 3ZNZB 2KZRA 4NPNA 3IFWB 4FJYA 1BWNA 3A33B 2KTFA 4DK5A 2N9PC 2D9YA 4IM0A 2WDTB 4JKCA 1DDVA 1FXTB 3R7RA 1OQNA 3DVNV 3O65B 2A5UA 4A6HA 1WIAA 2KCJA 4KDIC 5CX3A 4BOZB 2I5CA 1JRUA 2ZNVB 3ZNGC 2M8SA 2DZIA 1QC6A 3FP5A 2LGDA 5IAAC 2ZEQA 2D4QA 2AWTA 4KHOA 4IAPA 3DPDA 4G0NB 3T06A 2DKQA 3HW2B 5HKHA 1P6SA 1UNPA 2RQ1A 3QC8B 2K8HA 1UPQA 5CLLB 2MP2B 4C0AA 3QX1A 2IZVB 4A3PA 2ADZA 1Y5OA 2C5LC 3ML4A 3EC8A 2RUKB 2WYQA 5AZFA 5J2RA 1Q0WB 1E8ZA 1V5PA 2ZCBA 2HE7A 4ICUA 2FIFA 1M94A 3AXCA 4PS8A 5CHWA 2LYDA 1UELA 4HK2A 1AWEA 4JK8A 1P3RA 1DROA 1V89A 3TW1A 2DHIA 4GN1A 1E5WA 5D3VA 4WAAA 2WX1A 2ZPNA 4CHKA 2KOXA 2D9VA 2CS4A 1RRPB 3QHTA 3HHMA 2CODA 1V81A 4HJKA 4EZJA 4URKA 3R7QA 1IPGA 4A6KA 4MSQB 4HCNB 1V5TA 1F9JA 1FHOA 4PS3A 4YONA 3A9JA 3PEGA 2UWQA 3VH3B 2ZNVC 5IJMA 2N23A 4NAWB 2K2JA 2V4LA 4ANVA 2YLMA 2L3ZA 1XQQA 4KIKB 1WZ3A 2GS0A 2WH5A 4MK0A 2NBVB 2CQUA 4IG7B 3DVGY 2L7RA 2GCJA 1HB8A 4GU2A 3L08A 1BTNA 2DA0A 4HATB 2CY4A 2DKPA 2MBBB 1AQCA 3W1SC 3PZDA 3ML8A 3GOEA 3E9OA 1X05A 1U27A 4BKTA 4MM3A 4I6NB 1KOTA 4M0WB 4KHAA 5C16A 5FI0A 2YT1A 4W9HA 1I7AA 1SHCA 1DBHA 4K2PA 4IWQA 3VTUA 5TR5A 4NSWA 4DDID 2COPA 1V80A 2ZVOA 1FB8A 4K17A 4WWOA 4K81A 1KM7A 3TBLD 2H7DA 4AUQC 2AEHA 2DENB 1IRSA 2FCSA 4K7SA 3VHTC 1GGOA 3RUIB 4F7GA 2HJ8A 1N3HA 4G11A 3PSEB 3TO1A 1WX8A 1V5MA 4HAVB 5EFXA 2L05A 2N9XA 4GDKA 3RD2A 3QCAA 3ULCA 3PTFC 3APFA 1OQYA 3FM8C 4Z2MB 4HB3B 4AP4C 2DYMA 1XODA 3V6CB 4ZRJA 3ZRFA 1NBFC 1LXDA 2LUEA 5GOWB 2KDFB 2IYBA 3ODXA 4FBJB 2MA9B 3MHSD 2IBIB 3V60A 3PSCA 2GCLA 2J0MA 1NTVA 2KX3A 2FCMA 1QQGA 3D8DA 2RSGA 1W1HA 2YRYA 4GMXB 1G6JA 2K8BA 2EC1A 3MJWA 2IO0B 3WIMA 4E71A 1FHXA 4WJOA 3KSYA 2VRRB 1D3ZA 3BY4B 3L16A 3VIAA 4IOYX 3X23A 1ZC4B 2LULA 3E66A 4LJOB 2LGXA 2IO2B 2LXAA 2RR9A 3WA0A 4Y94A 5D3WA 2J0JA 1UH6A 2FAZA 2BGFA 4NQLB 3ZTDA 2LVPA 2UYZB 4B6WA 3L17A 1FHWA 4GZUA 3OLMD 2K39A 2Y5BB 2VKIA 2BYEA 2Z0OA 2IFSA 2DYNA 2D10A 3DBRI 2KWVB 4F8CB 5J18A 3RZFA 1V6EA 1H4RA 3KRWA 1EF1A 3AU4A 4FULA 1WJUA 2P8VA 2AL3A 3IHPC 4NJ7A 3HQCA 2H7EA 2I5FA 2KDEB 1FGYA 4GDLA 3ZDTA 3N3KB 1E7VA 5C23A 2Q13A 2KGXB 1NVLA 2DIKA 2G35A 4HAWB 3P6AA 1LFDA 4DHZE 3JSVA 2LI5A 3RZWC 2LOZA 2MBOA 3MPXA 2NMBA 2YS1A 2ROZB 1V5OA 1YIWA 3UQAA 3M95A 3CF6E 1MK9B 2CR5A 2GOWA 2KQ7A 3CXBB 4JKBA 4MJSB 3PVLA 4KAXB 4GSWA 1TZ1A 4MT7A 3L0WB 4MJSA 1X1MA 3ONSA 2CRFA 4W9JA 4N9F4 1YQBA 2LVQA 4HVBA 4KVGB 4TKNA 1TJ6A 2CKHB 2FCQA 3M1IB 3PRMB 4CO7A 2YSZA 4RMAA 4LJPB 1MG8A 2VRWB 2M0XA 2KLCA 4JLCA 4M8NA 3M63B 2KTRB 1GNUA 2FCNA 2KANA 4GB9A 4NNJB 2P0DA 3PT2B 2M17A 1EUVB 4HAZB 2Z0DB 4ZDVA 2KMCA 2W2XD 2YS3A 5HE1A 1P9DU 2BPSA 1WJ4A 2YT0A 4WJNA 3ZLZA 4TUUA 3A9JB 1WGQA 4FA6A 1WFYA 1WJNA 1WGRA 2CHXA 2RVBB 3ZNID 4OVVA 1UBIA 4A20A 3SYXA 5J3TA 3KH0A 4E74A 1C3TA 1CMXB 5C1ZA 1WE6A 3CMMB 2JVCA 2MWSB 3L13A 2COAA 2IY0B 3WAOA 3HM3A 5G2NA 1YJ1A 3AULA 4KZ0A 5C79A 1WMHB 4ANUA 3JW0X 1Q67A 2JP2A 2O6VA 4PNKA 1UZXB 2KDIA 1UPRA 4F7UP 2ZZPB 1NDDA 2KK8A 4MY6A 2LRUA 2COCA 4WQOB 1ZSQA 4W9IA 3RT3B 4DWFA 4IWPA 2N1VA 3WALA 2DX1A 3TJPA 4DX8A 1PLSA 3ODWA 3U7DA 4IUMB 1VBHA 2K6DB 2ZJDA 4DDGD 3SU8X 2DAFA 4ZRIA 2C7MB 4WWPA 3TMPB 5LLIA 4NY0A 4W9CA 2PZ1A 2XQNM 5C5BB 4IC7B 5C6RA 1ZGUB 1C1YB 4ASWC 1NU2A 3ML9A 4GPTB 1WR6E 3VQIA 3A1QB 1J8CA 2RSUA 1IYFA 4MGYE 2KKCA 3OAWA 2OQBA 3PHWB 4JKAA 2NPTB 2I1KA 5BO4B 2G4DB 1WJ6A 1WX7A 4TQ0A 1WF9A 2K8CA 2D07B 2DHJA 5L81A 4K2OA 2JF5A 2LJ5A 5AEKB 1SE9A 4JKGB 2G45B 1E8XA 3PV1A 1V88A 2HD5B 5J17A 1ST7A 4JKGA 3PRPB 2A4ZA 1WH3A 1V5UA 2LGYA 2D9XA 3D8EA 3JSVB 4HPLB 2D2QA 4HAXB 1WGDA 3IBEA 1BT0A 1V49A 2KWUB 3PS6A 2YF0A 1A5RA 1VCBA 2EMTA 2REXA 2JUOA 2KD0A 1K8RB 2MP2A 3CSFA 4YL8A 4PQ0A 2GMIC 4KSLC 3UQBA 5D2MB 2N0YA 5DHAB 1WYWB 1EGXA 4CHMA 1RFAA 2NVUI 3NZSA 3MTNB 4TYZA 3ZRCA 3V61A 3DVGX 1U4AA 3M3JA 4RM9A 2AYOB 3AU5A 4DXAB 2NS5A 1MK7B 2KQSA 4K1RB 2HTHB 2L0FA 3RULA 3ZTCA 2O2VA 3APDA 4WJPA 3MDBC 3N7CA 2FJ9A 2KJ6A 3ALBA 2MBQA 3CIKA 2DYOA 2KNBA 3TIXA 3VXWA 1U2BA 1YX6B 2XBBC 5DPWA 3FLVA 4ICVA 4WVFB 5HE2A 3SUZA 1I35A 3H1UA 2YS5A 2FDQA 4ZRKA 1J0GA 3UZTA 3DVNU 2P0HA 3IVFA 3A98B 4GGQA 4FJZA 4B6HA 3B0AA 2J59M 4NAWA 3HIZA 3LDZE 2COFA 3A9KA 4JQWC 2Y8FA 2N9EB 4DHJD 1LW3A 3PG7A 4XC2A 1OY2A 2IO3B 5KQ1A 2Z0QA 2KFJA 5IA7A 3DBLI 4JL9A 4HB4B 3BJIA 3GYPA 1P0RA 1UNQA 3QQ8B 3QBVB 2JRIB 1AARA 3U30A 2C9WB 4TQ1A 3KW5B 4BOSC 2CB8A 2O6VB 2KC1A 4PYZA 3OJ3A 2N7EA 3SO6A 4XZ4A 2KXJA 1XR0B 5C5BA 5GMVA 4BKGA 4EOYA 2D9ZA 2X18A 1ZC3B 3GZNI 1RRBA 3B1LX 3VTVA 3SV1A 3F0WA 3DQVA 5E6OA 4ILGB 1WM3A 5DI9B 1XD3B 4K7WA 5D7GA 1TXDA 1S1QB 4EFOA 1Z5SB 5JHGA 4A5KA 2I1JA 5D6JB 1YX5B 2DLWA 2MDXA 4CHJA 2CY5A 1GC6A 1J19A 2CHWA 1IP9A 2HRJA 1NI2A 3L10B 1HE8A 2PJHA 1L2NA 1JDEA 1EAZA 1WZ0A 3ZKJC 2MRPA 4MELA 2W9NA 4GIVA 1X11A 4HB0B 3KZ1A 1SIFA 3DXEA 3IG3A 4ILJA 4FHJA 4FLHA 3NS8A 2LXCA 2KMAA 5KQ4A 5D94A 4KDLB 3I3TB 3KY9A 3QAQA 1U29A 1GJZA 4MDKE 3DXDA 2V3SA 3W1YA 2NBUA 3AJ4A 3PREA 4JGHB 3VAWA 5E6PA 3M62B 5D3YA 2NZ8B 2KX0A 5L83A 1WGUA 1ZM0A 5CHVC 5JHHA 3PPAA 2IY1B 2JXXA 2O2VB 4GOCA 1BTKA 2KTRA 3SDLC 2BCJA 4ZYNA 4BKSD 1WX9A 2EMSA 2BKRB 1V9JA 5DIFB 2MSED 4EUTA 3ENBA 4W9EA 1WXAA 3H6NA 1PMSA 3SHQA 1VBGA 3NSUA 4IWOA 2DYBA 3PGEA 4WJQA 3DOWA 1KZGA 3EFUA 4MH0E 2PPHA 2Z59B 1XCGA 2ASQA 1XX0A 2L1CA 4KZCA 4ANWA 4FJVB 2VSZA 2G3QB 4KV2A 2GBJA 4W9GA 2RPQA 2UZSA 5D27A 2N1WA 3RYTA 1FAOA 2M1MA 1HB6A 1U5EA 3TL5A 2XEWA 4H8SA 2C7NB 2W2WA 2JZ3B 1FGZA 3Q3FA 1LQBA 3ULBA 2DTCA 5J3YA 4WWNA 4W9FA 4W9DA 1WRDB 5HE3A 2MBEA 4PYUA 2KJRA 4RM8A 2FJLA 2FUHB 2RLOA 3QIJA 2LWPA 2DYQA 1MKEA 1WXSA 2ZPYA 2MW5A 3VUWA 4BVUC 2PE9A 3ENEA 5JH5C 1P5TA 2UVMA 3V5WA 3VUYA 4JKHA 1PFJA 1UNRA 4MEMA 1EVHA 3JVZX 1MAIA 2L8JA 5AZHA 2JY6A 2ABDA 2DHKA 1GC7A 2CU1A 1RJ2A 2KVRA 2OTXA 2WX0A 4X57B 5G55A 1OMWA 2L0TA 2CHZA 2HTHA 3FSSA 2K2UA 4MGKE 3KRXA 2KFKA 1GG3A 2KHWB 2AL6A 5CTRC 2KFKB 1WXMA 4EMOA 3A1QA 3E9PA 2DAJA 2PE6B 3ZO5B 1W1DA 4MGIE 1UD7A 4JK7A 2L00B 3NZUA 1WMHA 4AWJA 2GBMA 4XWXA 4A6FB 1WI1A 3PVUA 3HK0A 4F7ZA 2MKRA 4A6FA 2FIDA 1H10A 3EHVA 2XK5B 4J6IA 1KI1B 3CSTA 2BF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQG A;  4K1R B;  2MWN B;  2HTH B;  1MIZ B;  3D8D A;  2RSG A;  4HB2 B;  2L0F A;  1ISN A;  2EJ8 A;  2KUP A;  1W1H A;  3QWZ B;  2YRY A;  3RUL A;  3ZTC A;  3VH4 B;  4GMX B;  2C60 A;  1X86 A;  2O2V A;  3APD A;  3QA8 A;  4WJP A;  3MDB C;  1KLV A;  1G6J A;  2K8B A;  1TBE A;  1V2Y A;  2QKM A;  2EC1 A;  3N7C A;  2FJ9 A;  2KJ6 A;  3ALB A;  4IW0 A;  2MBQ A;  3MJW A;  3CIK A;  2DYO A;  2KNB A;  3TIX A;  4KSK C;  2IO0 B;  3VUX A;  3VXW A;  3WIM A;  2Z0E B;  1E8W A;  1U2B A;  3DBH I;  3QAR A;  4HCP B;  4E71 A;  3KYD D;  2ROV A;  1FHX A;  1YX6 B;  3LJ3 A;  4WJO A;  3KSY A;  2VRR B;  1VD2 A;  2XBB C;  3BY4 B;  4BKS A;  1D3Z A;  4FHK A;  4KHB B;  2MBH A;  5DPT A;  3PP2 A;  5DPW A;  1QZE A;  3FLV A;  3JYU A;  3L16 A;  1P98 A;  3KUD B;  4D0N B;  3R3M A;  4HWI B;  4M8M A;  4ICV A;  1HBK A;  3VIA A;  5LXH A;  4IOY X;  4WVF B;  3X23 A;  4HPM B;  1ZC4 B;  5HE2 A;  3GYO A;  1X1F A;  3SUZ A;  3SD5 A;  2LUL A;  1I35 A;  2QHO A;  2R2O A;  4LJO B;  2LGX A;  2KLG A;  2IO2 B;  2LXA A;  2RR9 A;  3WA0 A;  5LOP B;  3H1U A;  4Y94 A;  2YS5 A;  5D3W A;  2FDQ A;  1XD4 A;  5CHF A;  4LDT D;  3S2A A;  3T9L A;  3ZUN A;  4ZRK A;  4HLE A;  2J0J A;  4HDQ A;  1J0G A;  3UZT A;  1UH6 A;  2V76 A;  3DVN U;  2C7H A;  2P0H A;  2N7D A;  3N32 A;  1L7Y A;  3ZDM C;  3IVF A;  1LM8 B;  2FAZ A;  3G9W A;  1KZ7 A;  1E90 A;  1SGH A;  3A98 B;  2BGF A;  3C0R B;  4NQL B;  3ZTD A;  3EPY A;  2LVP A;  3B08 A;  2UYZ B;  4GGQ A;  4B6W A;  4FJZ A;  3L17 A;  1FHW A;  3UIN B;  4HAU B;  1WG7 A;  4B6H A;  2KJH B;  2K25 A;  3B0A A;  4G50 A;  4GZU A;  2QKL A;  4GMV A;  2JRH A;  3OLM D;  4P7I A;  1WGY A;  2J59 M;  4NAW A;  1BAK A;  2K39 A;  2Y5B B;  2VKI A;  2COF A;  2KO3 A;  3A9K A;  2BYE A;  3HIZ A;  3LDZ E;  2Z0O A;  2IFS A;  2Y8F A;  2N9E B;  3P2B A;  1LW3 A;  2ELB A;  3PG7 A;  1WVH A;  2FNJ B;  4LDT B;  4JIO U;  4XC2 A;  1OY2 A;  2DYN A;  2D10 A;  3DBR I;  2IO3 B;  2MFQ A;  2KWV B;  4F8C B;  2YVC A;  3PVW A;  5J18 A;  2GJY A;  3RZF A;  5KQ1 A;  1P3Q U;  1V6E A;  3H7S A;  3A9K B;  2Z0Q A;  1H4R A;  2DFK A;  3NHE B;  3ZNH B;  1Q5W B;  3D32 A;  2KFJ A;  3FEH A;  3KRW A;  5IA7 A;  5AZG A;  3AI5 A;  2KDB A;  3KUZ A;  2LAS A;  3DBL I;  1EF1 A;  3AU4 A;  4FUL A;  3UIO B;  1WJU A;  2N4F A;  2P8V A;  4I6L B;  4JL9 A;  4HB4 B;  3TFM A;  5DCN A;  3VVW B;  1GUA B;  5DPS A;  4II2 B;  4ANX A;  3SNH A;  3BJI A;  3GYP A;  2AL3 A;  3U8Z A;  1P0R A;  1UNQ A;  2R2Q A;  3WAN A;  2M14 A;  3IHP C;  1NTI A;  2DX5 A;  3DXC A;  2NBW B;  3QQ8 B;  4K7U A;  1I2H A;  1TQZ A;  1XKE A;  2R0D A;  3QBV B;  4NJ7 A;  3HQC A;  1AAR A;  2JRI B;  2C9W B;  3U30 A;  1OGW A;  5LXI B;  2H7E A;  1H8C A;  2I5F A;  3OJ4 B;  1WE7 A;  2DX5 B;  2KDE B;  2NR2 A;  1XT9 B;  1UGM A;  1FGY A;  4TQ1 A;  4GDL A;  3UF8 A;  3QK0 A;  3KW5 B;  3Q3J A;  3ZDT A;  3DBS A;  3N3K B;  3UIP B;  3V6E B;  1E7V A;  4DBB A;  3ZNG C;  4BOS C;  1Q1O A;  2CB8 A;  5C23 A;  2KC2 A;  3PRZ A;  2O6V B;  2KC1 A;  2Q13 A;  3RCZ A;  4PYZ A;  2KGX B;  4GDL B;  1RAX A;  2Y8G A;  2KWC A;  1NVL A;  5DPR A;  2RGN B;  4GXB A;  5LON B;  3OJ3 A;  1UEF A;  2N7E A;  2NCN A;  2G35 A;  3SO6 A;  4XZ4 A;  4WJ7 A;  4HAW B;  4XX5 A;  2KXJ A;  4EEW A;  3P6A A;  1XR0 B;  1LFD A;  4IFS A;  4NQK E;  4BBK A;  1M7E A;  3K9O B;  4DHJ D;  4DHZ E;  3JSV A;  1V86 A;  2LI5 A;  1WM2 A;  3RZW C;  5C5B A;  2GBN A;  2P0F A;  3KYC D;  1WGH A;  5GMV A;  1TTN A;  2LRW A;  2LOZ A;  2J0K A;  3OAN A;  2MBO A;  4BKG A;  4EOY A;  2D9Z A;  3MPX A;  2NMB A;  2YS1 A;  2X18 A;  4EJN A;  1ZC3 B;  1NTY A;  4L6E A;  1ZVR A;  3GZN I;  5EDS A;  2ROZ B;  3ZNZ B;  1V5O A;  1WI0 A;  2KZR A;  1P1A A;  4NPN A;  1YIW A;  1RRB A;  3B1L X;  4BBN F;  3VTV A;  3SV1 A;  3F5R A;  3BIN A;  3IFW B;  3F0W A;  3DQV A;  4FJY A;  3UQA A;  3M95 A;  1IP9 A;  1BWN A;  3CF6 E;  1MK9 B;  3A33 B;  4E3C A;  1R4N I;  2KTF A;  2CR5 A;  4DK5 A;  4G3X B;  2GOW A;  2KQ7 A;  3VTW A;  3CXB B;  2N9P C;  2D9Y A;  4MJS B;  3PVL A;  2FCM A;  5E6O A;  3WAP A;  1WJM A;  4KAX B;  2BWE S;  3T8M A;  1OEY J;  4GSW A;  4IM0 A;  1TZ1 A;  2BKF A;  5JLJ B;  2WDT B;  4MT7 A;  3L0W B;  1WM3 A;  5DI9 B;  3VFK A;  2E2X A;  4MJS A;  2J7Q B;  1X1M A;  1XD3 B;  4K7W A;  5D7G A;  4DWF A;  3ONS A;  1TXD A;  1S1Q B;  4EFO A;  1WY8 A;  5JZE B;  2CRF A;  4W9J A;  1DDV A;  4N9F 4;  1TGZ B;  1Z5S B;  5JHG A;  4A5K A;  1FXT B;  1YQB A;  2V1Y A;  2I1J A;  1OQN A;  2LVQ A;  3DVN V;  3R7R A;  3O65 B;  5D6J B;  1YX5 B;  4HVB A;  4KVG B;  1TJ6 A;  4TKN A;  2DLW A;  2A5U A;  4A6H A;  1WIA A;  2MDX A;  4CHJ A;  2CY5 A;  1GC6 A;  2KCJ A;  3ODO A;  2JZZ A;  1J19 A;  2RNR B;  2CKH B;  2CHW A;  2FCQ A;  3X0W A;  4KDI C;  3M1I B;  3NY5 A;  3PRM B;  5CX3 A;  3DCG A;  2I5C A;  4BOZ B;  1JRU A;  2CAY A;  2YSZ A;  5DH9 B;  2HRJ A;  1NI2 A;  2ZNV B;  3L10 B;  1HE8 A;  4LJP B;  1MG8 A;  4RMA A;  2VRW B;  2M0X A;  2M8S A;  3RCP A;  1R4M I;  2PJH A;  2DZI A;  3L54 A;  1QC6 A;  1L2N A;  2R09 A;  2LKO A;  2MX2 A;  3FP5 A;  1EAZ A;  2D9W A;  2LGD A;  1WZ0 A;  3A4S C;  3ZKJ C;  2KLC A;  4MGK E;  1W1G A;  2MRP A;  4JLC A;  4MEL A;  5IAA C;  2OJR A;  4M8N A;  3M63 B;  2ZEQ A;  3QWM A;  2W9N A;  4GIV A;  2D4Q A;  2AWT A;  1X11 A;  2LOX A;  4HB0 B;  4KHO A;  1ZKH A;  2KTR B;  3KZ1 A;  3LJU X;  4IAP A;  1SIF A;  2LVO A;  3DXE A;  3DPD A;  3IG3 A;  4FHJ A;  1GNU A;  2O6V D;  4FLH A;  4HHV A;  4G0N B;  3T06 A;  2FCN A;  4OVU A;  3NS8 A;  2KAN A;  4GB9 A;  2LXC A;  4NNJ B;  2KMA A;  2P0D A;  3PT2 B;  5KQ4 A;  2M17 A;  2RGF A;  2DKQ A;  3HW2 B;  2UZR A;  2MLB A;  4KDL B;  3I3T B;  5D94 A;  3KY9 A;  1EUV B;  1RLF A;  3ECI A;  1P6S A;  1Z87 A;  4HAZ B;  1T0Y A;  3QAQ A;  4BBN C;  1UNP A;  5HKH A;  1U29 A;  3DDC B;  1GJZ A;  2RQ1 A;  3QC8 B;  4MDK E;  2K8H A;  2M4N A;  2Z0D B;  1UPQ A;  5CLL B;  4ZDV A;  2MP2 B;  4C0A A;  2KMC A;  3QX1 A;  2IZV B;  2W2X D;  2YS3 A;  3DXD A;  5HE1 A;  2V3S A;  3W1Y A;  1P9D U;  4A3P A;  2ADZ A;  1Y5O A;  2C5L C;  2NBU A;  2BPS A;  3ML4 A;  3EC8 A;  1MIX A;  2RUK B;  1WJ4 A;  1EO6 A;  3AJ4 A;  1YD8 U;  2WYQ A;  3PRE A;  1Q0W B;  2YT0 A;  4WJN A;  4JGH B;  5AZF A;  1E8Z A;  3ZLZ A;  1V5P A;  2ZCB A;  4TUU A;  2HE7 A;  4ICU A;  2OOB B;  3A9J B;  2FIF A;  1M94 A;  1U5D A;  5E6N A;  3VAW A;  1WGQ A;  4FA6 A;  3AXC A;  4PS8 A;  5E6P A;  5CHW A;  2LYD A;  4W9K A;  1WFY A;  2LG1 A;  2XK5 A;  1OEY A;  1WJN A;  1WGR A;  1UEL A;  4HK2 A;  1UBQ A;  1AWE A;  2GBK A;  3M62 B;  5D3Y A;  2NZ8 B;  3HM6 X;  2KX0 A;  1OTR B;  2CHX A;  1P3R A;  2DN6 A;  2RVB B;  1WGU A;  4OVV A;  3ZNI D;  2L76 A;  5L83 A;  1ZM0 A;  2ELA A;  1DRO A;  2ZCC A;  2MCN B;  1UBI A;  4A20 A;  1V89 A;  3APC A;  4KIK A;  4MGZ E;  1U5F A;  5CHV C;  3SYX A;  5JHH A;  5J3T A;  3KH0 A;  4E74 A;  1C3T A;  3TW1 A;  3PPA A;  2IY1 B;  2DHI A;  1CMX B;  2JXX A;  1U5G A;  2DZJ A;  2O2V B;  5C1Z A;  1WE6 A;  2PEA A;  3CMM B;  4GOC A;  1ZW7 A;  4GN1 A;  3VDZ A;  3TCA A;  2EKE C;  2JVC A;  2G4S A;  1BTK A;  1E5W A;  5D3V A;  1E8Y A;  2MWS B;  4WAA A;  2KTR A;  3L13 A;  2COA A;  2IY0 B;  2BCJ A;  3SDL C;  3WAO A;  4EZK A;  4ZYN A;  2WX1 A;  2KN5 A;  4NJ6 A;  4IM2 A;  3PLV A;  2ZPN A;  1DDM A;  3HM3 A;  5G2N A;  4BKS D;  4CHK A;  4B9K A;  1YJ1 A;  2KOX A;  3AUL A;  2D9V A;  4KZ0 A;  2CS4 A;  5C79 A;  5CLQ B;  1PQS A;  1WMH B;  1RRP B;  4ANU A;  1WX9 A;  3QHT A;  4BFR A;  3JW0 X;  3HHM A;  2EMS A;  2BKR B;  4II3 B;  4Z2N A;  1V9J A;  2COD A;  5DIF B;  1Q67 A;  1V81 A;  4HJK A;  4EZJ A;  2JP2 A;  4URK A;  3D8F A;  4W9L A;  2MSE D;  2O6V A;  3R7Q A;  4PNK A;  4A6K A;  1IPG A;  4EUT A;  4W9E A;  1WXA A;  2LD9 A;  3ZVV A;  3H6N A;  4MSQ B;  1UZX B;  4HCN B;  2KDI A;  1UPR A;  1V5T A;  2LBB A;  1PMS A;  4F7U P;  3H9D A;  4HAY B;  4I6P A;  2ZZP B;  1F9J A;  3SHQ A;  1FHO A;  2B3A A;  1NDD A;  4PS3 A;  5JHB A;  4YON A;  3A9J A;  3NSU A;  3PEG A;  2Y7B A;  2KK8 A;  4A3O A;  2UWQ A;  4MY6 A;  2LRU A;  3VH3 B;  4AJW A;  2COC A;  2ZNV C;  4IWO A;  2DYB A;  3K9P B;  4WQO B;  3O96 A;  1ZSQ A;  3PGE A;  1S3S G;  5KCV A;  5IJM A;  4W9I A;  5HE0 A;  4WJQ A;  2N23 A;  1DYN A;  4HDO A;  4NAW B;  3DOW A;  1KZG A;  1K5G B;  4TV3 A;  3RT3 B;  3EFU A;  2K2J A;  2V4L A;  4MH0 E;  2PPH A;  2YLM A;  1XCG A;  2Z59 B;  2ASQ A;  2L3Z A;  1XX0 A;  1XQQ A;  3V62 A;  4KIK B;  4IWP A;  2L1C A;  4KZC A;  2N1V A;  1WZ3 A;  2GS0 A;  4ANW A;  2WH5 A;  3WAL A;  4MK0 A;  2DX1 A;  5JP4 A;  4FJV B;  3TJP A;  2VSZ A;  2NBV B;  2RD0 A;  2G3Q B;  4DX8 A;  2MQJ A;  3QJZ A;  4KV2 A;  2GBJ A;  4W9G A;  2BYF A;  2CQU A;  4IG7 B;  1PLS A;  3ODW A;  2RPQ A;  1Y19 B;  4AJY B;  3DVG Y;  2UZS A;  5D27 A;  2N1W A;  2BYV E;  2ZVN A;  2L7R A;  5JHA A;  3U7D A;  4IUM B;  3RYT A;  1FAO A;  2GCJ A;  1WXV A;  1HB8 A;  2M1M A;  4GU2 A;  1HB6 A;  2IO1 B;  1U5E A;  3L08 A;  2K6D B;  2ZJD A;  4DDG D;  4WSF A;  2XEW A;  1BTN A;  4PS7 A;  2DAF A;  3SU8 X;  3TL5 A;  4ZRI A;  4DX9 0;  2C7M B;  2DA0 A;  4H8S A;  4HAT B;  2C7N B;  2W2W A;  4IM3 A;  4WWP A;  2JZ3 B;  3TMP B;  2CY4 A;  1FGZ A;  2DKP A;  2MBB B;  3Q3F A;  5LLI A;  1AQC A;  3NOB A;  4NY0 A;  1LQB A;  3ZIM A;  3ULB A;  2DTC A;  4F7H A;  3W1S C;  1Z2M A;  3PZD A;  3ML8 A;  1X1G A;  3GOE A;  4W9C A;  2PZ1 A;  2XQN M;  5J3Y A;  5C5B B;  3ZVR A;  2M38 A;  2K6Q A;  4IC7 B;  2DZK A;  3EEC A;  5J3Q A;  4GDK B;  4WWN A;  1B55 A;  2K00 A;  3P7Z A;  5C6R A;  4W9F A;  1X05 A;  1ZGU B;  4W9D A;  1U27 A;  1WRD B;  1C1Y B;  4BKT A;  5HE3 A;  4MM3 A;  4I6N B;  2MBE A;  4PYU A;  4ASW C;  1Y8R C;  2KJR A;  4RM8 A;  1KOT A;  1J0W A;  1NU2 A;  2FJL A;  2FUH B;  3ML9 A;  2RLO A;  2DZM A;  3QIJ A;  4M0W B;  2LWP A;  4GPT B;  1WR6 E;  3VQI A;  3A1Q B;  1J8C A;  4KHA A;  2RSU A;  2NPT A;  5C16 A;  2DYQ A;  1MKE A;  1IYF A;  5FI0 A;  4MGY E;  1WXS A;  2ZPY A;  2YT1 A;  3WYF B;  2IYD B;  2KKC A;  4W9H A;  3OAW A;  1I42 A;  2MW5 A;  4EZL A;  2OQB A;  3PHW B;  1MPH A;  1I7A A;  1SHC A;  1DBH A;  5J2R A;  2NPT B;  2I1K A;  4K2P A;  3VUW A;  5BO4 B;  2PE9 A;  5FR6 A;  4BVU C;  2G4D B;  4IWQ A;  3ENE A;  2JT4 B;  1P5T A;  1M7R A;  2UVM A;  3TVV A;  3V5W A;  1WJ6 A;  1WX7 A;  3VTU A;  5JH5 C;  3VUY A;  5TR5 A;  1PFJ A;  4NSW A;  1UNR A;  4DDI D;  2COP A;  1V80 A;  4TQ0 A;  4MEM A;  5KHO A;  1EVH A;  3KVF B;  1K5D B;  1WF9 A;  2DHZ A;  2K8C A;  2ZVO A;  3JVZ X;  3PHX B;  1FB8 A;  4K17 A;  2D07 B;  2DHJ A;  4WWO A;  1MAI A;  4K81 A;  4HXD A;  5L81 A;  3WAM A;  4K2O A;  2L8J A;  5AZH A;  3ZW3 A;  2JY6 A;  1KM7 A;  2D3G A;  2ABD A;  2JF5 A;  3TBL D;  2H7D A;  1LB1 A;  2DHK A;  2LJ5 A;  1GC7 A;  3N30 A;  4AUQ C;  5AEK B;  1SE9 A;  2CU1 A;  2G45 B;  1E8X A;  2AEH A;  2DEN B;  3PV1 A;  1V88 A;  1IRS A;  1FOE A;  1RJ2 A;  2FCS A;  4K7S A;  3VHT C;  2HD5 B;  5J17 A;  1ST7 A;  2OTX A;  2KVR A;  3RUI B;  4F7G A;  5DHF B;  1N3H A;  2HJ8 A;  2WX0 A;  4G11 A;  4FN2 A;  4X57 B;  3PSE B;  3TO1 A;  1WX8 A;  2WWZ A;  2JPH A;  3PRP B;  1OMW A;  2A4Z A;  5G55 A;  1V5M A;  1E7U A;  1WH3 A;  2CHZ A;  2HTH A;  3FSS A;  4HAV B;  2L0T A;  2K2U A;  5EFX A;  1V5U A;  3VOQ A;  2L05 A;  2N9X A;  2LGY A;  4GDK A;  3RD2 A;  4AOF A;  5KHQ A;  2D9X A;  2LZ6 A;  5D3X A;  1DDW A;  3KRX A;  3PLU A;  2D11 A;  3QCA A;  3ULC A;  2KFK A;  3D8E A;  3APF A;  3PTF C;  3JSV B;  3R66 C;  2D2Q A;  4HPL B;  4HAX B;  1WGD A;  3IBE A;  2BWF A;  1WJ1 A;  1OQY A;  3H7P B;  1GG3 A;  1BT0 A;  3FM8 C;  2KHW B;  2AL6 A;  4Z2M B;  5CTR C;  4HB3 B;  1V49 A;  2KFK B;  1WXM A;  4EMO A;  4EKU A;  2KWU B;  3A1Q A;  3PS6 A;  3H7P A;  3A8Q A;  4AP4 C;  2DYM A;  2DAJ A;  2YF0 A;  1XOD A;  2PE6 B;  3V6C B;  1VCB A;  1A5R A;  4ZRJ A;  3ZO5 B;  1W1D A;  2EMT A;  2REX A;  1EF5 A;  4MGI E;  3ZRF A;  2L2I A;  2JUO A;  3UGB B;  1UD7 A;  4ANV A;  1NBF C;  2GBR A;  2KD0 A;  1LXD A;  1K8R B;  4CYE A;  2LUE A;  4DHJ B;  2MP2 A;  4B95 A;  5GOW B;  2L00 B;  3NZU A;  4F1S A;  1V61 A;  1WMH A;  3CSF A;  4AWJ A;  5FI1 A;  2GBM A;  1ACA A;  2KDF B;  4XWX A;  4A6F B;  4DHZ B;  2JWZ A;  1WI1 A;  4YL8 A;  3PVU A;  2IYB A;  2W2X C;  3HK0 A;  4PQ0 A;  3ODX A;  4F7Z A;  2MKR A;  4FBJ B;  2MA9 B;  3A8P A;  2GMI C;  4DBG A;  4KSL C;  5L95 C;  3MHS D;  3W1S A;  3UQB A;  5D2M B;  4A6F A;  2N0Y A;  2IBI B;  3V60 A;  5DHA B;  1WYW B;  4CO7 A;  4FAD A;  2FID A;  4JQW C;  3PSC A;  1EGX A;  1KJT A;  1WGG A;  1H10 A;  4CHM A;  1RFA A;  2GCL A;  3EHV A;  2NVU I;  3KUC B;  2J0M A;  3NZS A;  2XK5 B;  1WR1 A;  4TYZ A;  3MTN B;  3A4R A;  4J6I A;  3ZRC A;  3V61 A;  1NTV A;  1U4A A;  3DVG X;  3M3J A;  4RM9 A;  2AYO B;  2KX3 A;  2Z0P A;  4MSM B;  3AU5 A;  4DXA B;  1KI1 B;  2K1F A;  2NS5 A;  1MK7 B;  3CST A;  4LCD E;  2KQS A;  2BF8 B; 
#chains in the Genus database with same CATH topology
 2RMM A;  2KWD A;  1N63 A;  1MIZ B;  4HB2 B;  1ISN A;  1WWT A;  3VH4 B;  3C19 A;  1X86 A;  3QA8 A;  4K3C A;  2WLB A;  1TBE A;  3MFG A;  1V2Y A;  2QKM A;  4KSK C;  2Z0E B;  1E8W A;  3DBH I;  4QAY A;  3KYD D;  2ROV A;  4BKS A;  2FJU B;  4JX1 C;  4KHB B;  2D3B A;  1AN8 A;  1V1O A;  3JYU A;  4HWI B;  4M8M A;  4HPM B;  3GYO A;  1X1F A;  2R2O A;  2KLG A;  5CHF A;  1TJE A;  2MJ3 A;  4LDT D;  3S2A A;  3ZUN A;  1D5M C;  4HLE A;  1VRA B;  1WXQ A;  2WU2 B;  3ZDM C;  2N7D A;  4RCO A;  1L7Y A;  4PK1 A;  1LM8 B;  3G9W A;  1KZ7 A;  1E90 A;  2KYW A;  1B9R A;  3AE3 B;  3EPY A;  2KJH B;  4G50 A;  4QJ3 B;  4IOI E;  1WGY A;  1BAK A;  1F1H A;  2KO3 A;  3VUX A;  2FNJ B;  2YVC A;  3PVW A;  2GJY A;  3H7S A;  2DFK A;  3ZNH B;  1Q5W B;  3NVZ A;  5AZG A;  3KUZ A;  2LAS A;  3UIO B;  2N4F A;  2QEJ C;  5DCN A;  3VVW B;  1GUA B;  5DPS A;  1P7F A;  3SNH A;  4NAM A;  3P4P B;  2N0S B;  2M14 A;  2HDE A;  2ZW1 A;  4FXC A;  1I2H A;  3FVC A;  5LXI B;  1OGW A;  3DBL B;  1H8C A;  3OJ4 B;  1WE7 A;  1YN4 A;  1FD6 A;  2LHD A;  3UF8 A;  3UIP B;  3DBS A;  1IBX A;  4DBB A;  4N58 A;  3NVY A;  4JKD A;  2KC2 A;  3CWI A;  3ZYY X;  1SBB B;  1RAX A;  2Y8G A;  4GDL B;  2Y5P A;  5LON B;  1UEF A;  4WJ7 A;  2SEB D;  4IFS A;  4NQK E;  4BBK A;  1V86 A;  1WM2 A;  1TTN A;  2LRW A;  3OAN A;  4JWS C;  4L6E A;  1NTY A;  4OSN A;  4N6E B;  1WI0 A;  1P1A A;  4BBN F;  2Z59 A;  2UU7 A;  3F5R A;  3BIN A;  4E3C A;  1R4N I;  3E9L A;  4G3X B;  2N9K A;  3WAP A;  4B0M A;  1WJM A;  2BWE S;  3T8M A;  1OEY J;  1IUE A;  2BKF A;  1XLQ A;  5JLJ B;  4ITK A;  3VFK A;  3P1M A;  2E2X A;  1T77 A;  2J7Q B;  2PW9 A;  1DIK A;  1EU4 A;  1WY8 A;  5JZE B;  1TGZ B;  2V1Y A;  2EEL A;  1KH0 A;  3OG5 A;  3ODO A;  3BWU D;  2JZZ A;  2RNR B;  3X0W A;  2M0A A;  3NY5 A;  3DCG A;  2CAY A;  5DH9 B;  4ANX A;  2RDH A;  4JK9 A;  3L54 A;  3RCP A;  1R4M I;  2R09 A;  2LKO A;  2MX2 A;  2D9W A;  3BVZ A;  3A4S C;  1W1G A;  3NVV A;  2OJR A;  3QWM A;  1PFD A;  2PTL A;  1D6E C;  2Z13 A;  1XEE A;  4LNN A;  2LOX A;  1ZKH A;  3LJU X;  2LVO A;  2EKI A;  2O6V D;  4HHV A;  3AN1 A;  3BVG A;  4OVU A;  3LXF A;  3DHH C;  2RGF A;  2MLB A;  2UZR A;  4YTP B;  4GOU A;  3Q3N C;  1RLF A;  3ECI A;  1Z87 A;  1T0Y A;  4BBN C;  3DDC B;  2M4N A;  3A58 A;  3FC4 A;  2E6X A;  5I2S A;  1MIX A;  1YD8 U;  2R82 A;  1B1Z A;  1EO6 A;  2KAC A;  3U2S C;  1N6Z A;  2OOB B;  4HJG E;  5E6N A;  1U5D A;  3Q8A A;  2WXP A;  2JWU A;  4W9K A;  2LG1 A;  2INC C;  2XK5 A;  1OEY A;  1UBQ A;  2V4I B;  2GBK A;  3HM6 X;  1OTR B;  2DN6 A;  2L76 A;  2ELA A;  2ZCC A;  2MCN B;  3APC A;  4KIK A;  4MGZ E;  1U5F A;  3TEY A;  2V9H A;  1VJK A;  3BII D;  1VZ6 A;  1U5G A;  2DZJ A;  3T3O A;  2PEA A;  1ZW7 A;  3VDZ A;  3TEZ A;  3TCA A;  2EKE C;  2ZW0 A;  2MJD A;  2G4S A;  3P4S B;  1E8Y A;  3EGR A;  4EZK A;  2KN5 A;  4NJ6 A;  4IM2 A;  3PLV A;  4REZ A;  1DDM A;  4B9K A;  4M01 A;  2Z14 A;  3DBH B;  1QOB A;  5CLQ B;  1PQS A;  1BXT A;  1VR9 A;  4BFR A;  2G9H D;  1QLB B;  4II3 B;  4Z2N A;  3FIL B;  3NJT A;  2KVZ A;  3D8F A;  4W9L A;  2LD9 A;  3ZVV A;  2WHI A;  3H9D A;  2LBB A;  4HAY B;  4I6P A;  4LK0 M;  4TSS A;  2B3A A;  2INP E;  3TEW A;  5JHB A;  5H8Y E;  4OT1 A;  2Y7B A;  4A3O A;  3HUI A;  4AJW A;  3IXS A;  3K9P B;  3O96 A;  1WYG A;  1S3S G;  1DOX A;  5KCV A;  5HE0 A;  1DYN A;  2X0S A;  4HDO A;  3VR9 B;  1K5G B;  3HRD D;  4NZL B;  4TV3 A;  1JRP A;  3V62 A;  1SE2 A;  1F2R I;  2KMM A;  5JP4 A;  3ZQ4 A;  3L4P A;  2RD0 A;  2MQJ A;  3QJZ A;  2BYF A;  3AV8 A;  3HVD A;  4AJY B;  1Y19 B;  2ZVN A;  2BYV E;  1YQ4 B;  3SFE B;  1OQR A;  1WXV A;  2Z8L A;  2IO1 B;  3IT4 B;  4D2K A;  4WSF A;  4PS7 A;  5AUI A;  4DX9 0;  1C76 A;  4IM3 A;  1EM7 A;  4JKE A;  4KGS A;  1QOA A;  5FKA C;  3NOB A;  3ZIM A;  5LG4 B;  4F7H A;  2AQ2 B;  1Z2M A;  5JHA A;  1X1G A;  3ZVR A;  2M38 A;  2K6Q A;  2DZK A;  3EEC A;  5J3Q A;  3HVZ A;  4GDK B;  1M4V A;  1B55 A;  2K00 A;  3P7Z A;  3P63 A;  5JVL A;  1Y8R C;  1J0W A;  2DZM A;  3PZ7 A;  2D3C A;  4C00 A;  2NPT A;  2L1A A;  1T0R C;  3SBT A;  3WYF B;  2IYD B;  1I42 A;  4PT5 A;  4EZL A;  3AE7 B;  1MPH A;  4LNF A;  3AEB B;  2Q5W D;  3GP7 A;  5FR6 A;  1KLG D;  2JX5 A;  4ZRQ A;  3I63 C;  2JT4 B;  1M7R A;  3TVV A;  1ZDV A;  5KHO A;  3KVF B;  1K5D B;  2DHZ A;  3PHX B;  2BB6 A;  1AYF A;  4OW0 A;  4HXD A;  3WAM A;  3ZW3 A;  2D3G A;  3IAM 1;  4ILH A;  1LB1 A;  3N30 A;  1N60 A;  3W5U B;  1L0V B;  1FOE A;  1FXI A;  5DHF B;  4B95 A;  4FN2 A;  4USA A;  2JPH A;  1UWM A;  2WWZ A;  1E7U A;  2ONQ A;  5KHQ A;  3VOQ A;  5BYQ A;  4AOF A;  1L6U A;  3PLU A;  2LZ6 A;  5D3X A;  1DDW A;  1L5P A;  3VTW A;  2D11 A;  3R66 C;  2BWF A;  1WJ1 A;  3H7P B;  3N1Y C;  3GS2 A;  4M0W A;  3IT6 B;  1RYJ A;  4EKU A;  3H7P A;  3A8Q A;  3MC0 B;  4WUR A;  1EF5 A;  2L2I A;  3UGB B;  1QKZ A;  2GBR A;  2R61 A;  4DHJ B;  4CYE A;  4F1S A;  1V61 A;  5FI1 A;  1ACA A;  4DHZ B;  2BBC A;  1FRD A;  2JWZ A;  2W2X C;  1MFW A;  3A8P A;  1JCK B;  4DBG A;  5L95 C;  3W1S A;  2K5P A;  4EE2 A;  4FAD A;  1KJT A;  1WGG A;  3KUC B;  4YTN B;  1FCL A;  4JKF A;  1WR1 A;  3A4R A;  3B2G A;  1NYQ A;  4MSM B;  2Z0P A;  1BUI C;  3V3X A;  2K1F A;  4LCD E;  1PGX A;  4LNK A;  1KRH A;  2MWN B;  1C4P A;  4WIP A;  2EJ8 A;  2KUP A;  3QWZ B;  2X38 A;  2C60 A;  1KLV A;  4IW0 A;  3MC9 A;  2QIL A;  4C56 C;  1E6E B;  3QAR A;  4HCP B;  3LJ3 A;  1VD2 A;  4FHK A;  2MBH A;  5DPT A;  3PP2 A;  1QZE A;  3R3M A;  3ZXR A;  1MI0 A;  1P98 A;  4D0N B;  3KUD B;  4YT0 B;  1STE A;  1HBK A;  5LXH A;  1KC7 A;  1TKG A;  3SBG A;  4AQ7 A;  3SD5 A;  2QHO A;  3V05 A;  1ZOY B;  5LOP B;  1HZ6 A;  1XD4 A;  3T9L A;  4HDQ A;  3AH7 A;  2V76 A;  3N32 A;  2C7H A;  1MPE A;  4CSQ A;  3C0R B;  1SGH A;  1KBL A;  3Q2A C;  2ZKM X;  3B08 A;  2K3U A;  3UIN B;  4HAU B;  1WG7 A;  1P7E A;  2K25 A;  2JRH A;  2QKL A;  4GMV A;  4P7I A;  4DIX A;  4OZB A;  3P2B A;  3Q3O C;  2ELB A;  1WVH A;  4LDT B;  4JIO U;  4OVZ A;  1MI1 A;  2MFQ A;  1TS5 A;  1P3Q U;  3A9K B;  3NHE B;  3D32 A;  3FEH A;  1YJJ A;  3AI5 A;  2KDB A;  2I2Y A;  5T8I A;  4DXF A;  4I6L B;  3TFM A;  4II2 B;  2R2Q A;  3WAN A;  3U8Z A;  4P16 A;  4RGM A;  4KHB A;  1NTI A;  2DX5 A;  3DXC A;  2NBW B;  4K7U A;  3N1Z C;  3AE4 B;  4C7Y A;  1TQZ A;  1XKE A;  2R0D A;  2DX5 B;  2NR2 A;  4KX6 B;  2V3P A;  1WGK A;  1XT9 B;  1UGM A;  3QK0 A;  1FNV A;  3Q3J A;  3V6E B;  1WSP A;  1Q1O A;  1FRR A;  3AM9 A;  1QT9 A;  3PRZ A;  4IKG A;  2V3N A;  1C9F A;  3RCZ A;  2KWC A;  4ZHO A;  5DPR A;  2RGN B;  4JE3 B;  4GXB A;  2NCN A;  4XX5 A;  4EEW A;  3K9O B;  1M7E A;  2FBW B;  2P0F A;  2GBN A;  1WGH A;  3KYC D;  3UI3 A;  2J0K A;  4EJN A;  1ET9 A;  1ZVR A;  2JYE A;  4A55 A;  3NVW A;  3ZNZ B;  5EDS A;  2KZR A;  4NPN A;  3IFW B;  2WP9 B;  4FJY A;  1BWN A;  1UUP A;  3A33 B;  2KTF A;  4DK5 A;  2N9P C;  2D9Y A;  3EFC A;  3BK2 A;  4IM0 A;  3BZD B;  2WDT B;  2OJW A;  1HTO A;  4BAX A;  4JKC A;  4L2Y A;  1QQR A;  1XLN A;  5EE9 A;  2BB5 A;  4HKZ E;  1DDV A;  1FXT B;  3R7R A;  1OQN A;  3DVN V;  3O65 B;  1SJE D;  2A5U A;  4GLS C;  4A6H A;  5E6J A;  1WIA A;  2KCJ A;  4J3O D;  2VH2 A;  5BMI A;  4DXG A;  2AQ1 B;  4KDI C;  5CX3 A;  3GE8 C;  4BOZ B;  2I5C A;  1JRU A;  2ZNV B;  3ZNG C;  2K0P A;  2M8S A;  2DZI A;  1QC6 A;  4MH8 A;  5GXG B;  3FP5 A;  2LGD A;  1SSN A;  1ESF A;  5IAA C;  4YWG G;  2ZEQ A;  2D4Q A;  2AWT A;  5BYR A;  4KHO A;  2D5G A;  4IAP A;  3DPD A;  1JWB D;  1ZP0 B;  3I9V 1;  4G0N B;  3T06 A;  1MG4 A;  3AE8 B;  3W5V B;  5HI1 A;  2DKQ A;  3HW2 B;  1L6V A;  4HRO A;  5HKH A;  1P6S A;  4ZYS A;  1UNP A;  1E0Z A;  1LO5 D;  2RQ1 A;  3QC8 B;  2K8H A;  1UPQ A;  5CLL B;  2MP2 B;  4C0A A;  1TZO A;  1HQR D;  2IZV B;  1XO3 A;  3QX1 A;  1XLO A;  3AB5 A;  4A3P A;  2BYT A;  2ADZ A;  1Y5O A;  2C5L C;  3ML4 A;  3EC8 A;  2RUK B;  2WYQ A;  5AZF A;  5J2R A;  1Q0W B;  1E8Z A;  3HIE A;  1V5P A;  2ZCB A;  2HE7 A;  1C4C A;  4ICU A;  2PMV A;  2FIF A;  1M94 A;  3AXC A;  4PS8 A;  1UNS A;  5CHW A;  2LYD A;  4DQO C;  2MEK A;  1UEL A;  4HK2 A;  3NUH B;  1AWE A;  4JK8 A;  1P3R A;  2J4X A;  1XXG A;  1DRO A;  3NW8 A;  1V89 A;  1VZ7 A;  2IGD A;  3NRZ A;  1JWM D;  3TW1 A;  2K22 A;  2WXI A;  2DHI A;  2WXR A;  3W9C B;  2LJI A;  4GN1 A;  1E5W A;  5D3V A;  1Q10 A;  4WAA A;  2QMT A;  2WX1 A;  2ZPN A;  4CHK A;  2W55 A;  2KOX A;  2BS4 B;  2D9V A;  2CS4 A;  1PUT A;  1RRP B;  3QHT A;  3HHM A;  4CQN A;  2COD A;  2YEP F;  1V81 A;  4HJK A;  4EZJ A;  4URK A;  1TS4 A;  4C4V B;  3R7Q A;  1IPG A;  4A6K A;  5G5H A;  1AWD A;  3AEC B;  1RFK A;  4MSQ B;  4HCN B;  3LYY A;  3RI7 C;  4LNO A;  1V5T A;  3T3N A;  5AUK A;  1F9J A;  1FHO A;  3B77 A;  4PS3 A;  4WH4 A;  4YON A;  2IGH A;  3A9J A;  3PEG A;  2MH7 A;  2UWQ A;  1FO4 A;  3VH3 B;  2ZNV C;  2KAJ A;  5IJM A;  4HKQ A;  2N23 A;  4NAW B;  2WXL A;  3BVM A;  2K2J A;  2V4L A;  3PO0 A;  4ANV A;  2YLM A;  2L3Z A;  1XQQ A;  1SB3 C;  4KIK B;  1WZ3 A;  2GS0 A;  2WH5 A;  4MK0 A;  1GAQ B;  2NBV B;  2CQU A;  4YSX B;  4IG7 B;  3DVG Y;  1R4N B;  2L7R A;  2NBV A;  2GCJ A;  2JZP A;  1HB8 A;  2LGI A;  4GU2 A;  2WXN A;  3L08 A;  1BTN A;  5D3D A;  5FK9 C;  2DA0 A;  4HAT B;  3ZJV A;  2CY4 A;  1HTQ A;  3TSS A;  2DKP A;  2MBB B;  2Z4D A;  3AEG B;  1AQC A;  3W1S C;  3PZD A;  3ML8 A;  3GOE A;  2QC8 A;  3E9O A;  2LGS A;  1X05 A;  1T0Q C;  1U27 A;  4BKT A;  4MM3 A;  5HHD G;  1YOV B;  4I6N B;  2FUG 1;  4RNA A;  1KOT A;  4M00 A;  4M0W B;  5D3I B;  1FNW A;  1IGC A;  4KHA A;  4US8 A;  5C16 A;  1TS3 A;  4LLG M;  1MHH E;  5FI0 A;  2YT1 A;  4W9H A;  5G5G A;  1IGD A;  1I7A A;  1SHC A;  1DBH A;  4GNK B;  4K2P A;  2KN4 A;  4IWQ A;  4XDC A;  4XDD A;  3VTU A;  4L23 A;  1JW9 D;  5TR5 A;  3J9C A;  4NSW A;  4DDI D;  3H8H A;  2COP A;  1V80 A;  1K51 A;  1I4G A;  1MHX A;  2ZVO A;  1FB8 A;  4K17 A;  4WWO A;  4K81 A;  1RWS A;  2KR0 A;  5IN7 A;  1KM7 A;  3TBL D;  2H7D A;  4AUQ C;  3Q14 C;  4N59 A;  3ZJU A;  2AEH A;  2DEN B;  1IRS A;  2FCS A;  4K7S A;  1ZXI A;  3VHT C;  4ARI A;  1GGO A;  3RUI B;  4F7G A;  2HJ8 A;  1N3H A;  4G11 A;  1YN5 A;  3TO1 A;  1WX8 A;  3PSE B;  2IGG A;  4OZA A;  1N62 A;  2BT6 A;  1V5M A;  4HAV B;  3RNA C;  5EFX A;  2L05 A;  1FXA A;  2N9X A;  4GDK A;  3RD2 A;  1TS2 A;  3QCA A;  3ULC A;  3PTF C;  3APF A;  3R2T A;  1V1P B;  1OQY A;  3FM8 C;  4Z2M B;  4HB3 B;  4AP4 C;  2DYM A;  1XOD A;  3V6C B;  4ZRJ A;  3N1X C;  3ZRF A;  2VZK D;  2KUQ A;  1NBF C;  1LXD A;  2LUE A;  5GOW B;  2KDF B;  2IYB A;  3ODX A;  1I4Q A;  4FBJ B;  2MA9 B;  3MHS D;  2IBI B;  3V60 A;  3PSC A;  2W3R A;  2GCL A;  4MT5 A;  3NS1 A;  2J0M A;  1NTV A;  2KX3 A;  1T5X D;  3Q8E A;  4JWU C;  2SAK A;  2FCM A;  1QQG A;  2YEP B;  3D8D A;  2RSG A;  3C8Y A;  1W1H A;  1FFV A;  2YRY A;  4GMX B;  2BVC A;  4RF0 A;  3U12 A;  2K8B A;  1G6J A;  2EC1 A;  3MJW A;  2IO0 B;  3WIM A;  4E71 A;  5EE3 A;  1FHX A;  4WJO A;  3KSY A;  2VRR B;  1D3Z A;  3BY4 B;  1T3Q A;  3L16 A;  3N20 C;  3VIA A;  1TYG B;  4IOY X;  1QIL A;  3X23 A;  1ZC4 B;  2LEK A;  2LUL A;  2GRI A;  4C7Z A;  3E66 A;  2PVG C;  4LJO B;  2LGX A;  2IO2 B;  2LXA A;  2RR9 A;  3WA0 A;  5IO9 A;  4Y94 A;  5D3W A;  3GZN B;  2JSV X;  3KWV A;  2J0J A;  1ENF A;  3OWE B;  1UH6 A;  5M4Y B;  2FAZ A;  3FKY A;  2BGF A;  4NQL B;  3ZTD A;  2RPV A;  2LVP A;  2UYZ B;  4B6W A;  3L17 A;  1FHW A;  1YQ3 B;  4GZU A;  3OLM D;  2K39 A;  2Y5B B;  2VKI A;  2LUM A;  2BYE A;  2IFS A;  2Z0O A;  2DYN A;  2D10 A;  3DBR I;  2KWV B;  4F8C B;  5J18 A;  3RZF A;  1V6E A;  1WRI A;  4Q2J A;  1H4R A;  3KRW A;  1EWY C;  1EF1 A;  3AU4 A;  4FUL A;  5I2M A;  1WJU A;  2P8V A;  4XWW A;  3P4Q B;  2AL3 A;  2WDV B;  1ZE3 D;  2W3S A;  1ACC A;  3IHP C;  5IOI A;  1V8C A;  4NJ7 A;  3HQC A;  2H7E A;  2I5F A;  2KDE B;  1FGY A;  4GDL A;  1T6B X;  3ZDT A;  3N3K B;  1F77 A;  1E7V A;  1SXT A;  3AE5 B;  5C23 A;  2Q13 A;  2KGX B;  1NVL A;  2DIK A;  1FNU A;  1A70 A;  2G35 A;  4HAW B;  2FE8 A;  3P6A A;  1LFD A;  4QJ5 B;  4DHZ E;  1DYQ A;  1CZP A;  3JSV A;  5H92 C;  2LI5 A;  1R7S A;  3RZW C;  3NWD A;  3ZXV A;  2LOZ A;  2MBO A;  3MPX A;  2NMB A;  2YS1 A;  2HJ1 A;  1NEK B;  2DNF A;  3Q8C A;  4MAC A;  2NMQ A;  2ROZ B;  1TY0 A;  1V5O A;  1YIW A;  3RNB C;  3UQA A;  1KTK A;  3M95 A;  3KLS X;  3CF6 E;  1MK9 B;  1DGJ A;  2CR5 A;  4IDI A;  2GOW A;  2KQ7 A;  3CXB B;  5FR3 A;  4JKB A;  2WU5 B;  3PVL A;  4MJS B;  4KAX B;  3Q3M C;  1I4P A;  4GSW A;  1TZ1 A;  3E56 A;  3ZJT A;  4MT7 A;  3L0W B;  3ETR A;  3WCQ A;  4MJS A;  1X1M A;  3ONS A;  1FFU A;  5JXV A;  2CRF A;  4W9J A;  1FEH A;  4N9F 4;  3SEB A;  1YQB A;  1GB1 A;  2LVQ A;  4HVB A;  4KVG B;  4TKN A;  1TJ6 A;  3GE3 C;  3I5J C;  1EU3 A;  4XWT A;  2CKH B;  2FCQ A;  3M1I B;  3PRM B;  4CO7 A;  2YSZ A;  2M56 B;  4RMA A;  4LJP B;  1MG8 A;  2VRW B;  2M0X A;  2AQ3 B;  3IAS 1;  3Q8F A;  1QF6 A;  5EE1 A;  4OZC A;  1FM0 D;  2KLC A;  4JLC A;  4P6V F;  4M8N A;  3M63 B;  4S17 A;  2DWQ A;  2KTR B;  1GNU A;  2FCN A;  2KAN A;  4GB9 A;  4NNJ B;  2P0D A;  1I4R A;  3PT2 B;  4HRS A;  2M17 A;  2BS2 B;  1L4D B;  1EUV B;  4P1B C;  4HAZ B;  1E10 A;  2Z0D B;  4ZDV A;  1YNT E;  3E9S A;  2KMC A;  3MP9 A;  2W2X D;  2YS3 A;  5HE1 A;  4C4V A;  1UF0 A;  1HXY D;  1P9D U;  2BTE A;  2BPS A;  3R8B A;  1WJ4 A;  5HFY A;  2KT7 A;  2YT0 A;  4L1B A;  4WJN A;  3ZLZ A;  4TUU A;  3A9J B;  1ET6 A;  1TKY A;  1WGQ A;  4FA6 A;  1WFY A;  1WJN A;  1WGR A;  2LHE A;  2WS3 B;  4XE0 A;  2CHX A;  2RVB B;  3ZNI D;  4OVV A;  1YJI A;  3DWG C;  2E3T A;  1UBI A;  4A20 A;  2TSS A;  2KQ4 X;  3SYX A;  5J3T A;  3KH0 A;  5IP4 D;  4E74 A;  1C3T A;  1GPX A;  3LB8 C;  1FCC C;  1CMX B;  2YT2 A;  2NTT A;  5C1Z A;  1WE6 A;  3CMM B;  4B0E A;  2JVC A;  3BYT B;  1NEN B;  2MWS B;  2WDQ B;  3L13 A;  2COA A;  1YMH E;  2IY0 B;  4RFB A;  3WAO A;  3HM3 A;  5G2N A;  3EUB 2;  2WXK A;  1YJ1 A;  3N9Y C;  3AUL A;  4KZ0 A;  5C79 A;  1WMH B;  4ANU A;  2J42 A;  3JW0 X;  1D4B A;  1Q67 A;  3U52 E;  2JP2 A;  3VRA B;  3O13 A;  2O6V A;  4PNK A;  1KLU D;  4RGO S;  4US9 A;  1UZX B;  2KDI A;  1UPR A;  4F7U P;  1C79 A;  3AED B;  2ZZP B;  1HZ5 A;  3FAH A;  1NDD A;  5C2T B;  5BMH A;  1CJE A;  4RGN A;  2KK8 A;  4MY6 A;  2LRU A;  4WQM A;  2COC A;  2J53 A;  4WQO B;  1ZSQ A;  4W9I A;  3VR8 B;  3RT3 B;  4DWF A;  4IWP A;  2N1V A;  1E7P B;  3WAL A;  2DX1 A;  3TJP A;  4C80 A;  4DX8 A;  3GB1 A;  1PLS A;  3ODW A;  4O1N A;  3U7D A;  4IUM B;  1SE4 A;  4KGR A;  1VBH A;  1DOY A;  1PGB A;  2K6D B;  1L4Z B;  2ZJD A;  4DDG D;  3SU8 X;  2PLP A;  2DAF A;  2K49 A;  4ZRI A;  2C7M B;  4WWP A;  3RMK C;  4YSY B;  4RF1 A;  3TMP B;  5LLI A;  2BS3 B;  4NY0 A;  4W9C A;  2PZ1 A;  2XQN M;  5C5B B;  1IBX B;  4ACF A;  1NVI D;  4IC7 B;  2N7J A;  4JPS A;  5C6R A;  1SE3 A;  1ZGU B;  1C1Y B;  1FIQ A;  3DCX A;  1J7A A;  4ASW C;  3RNG C;  2V0G A;  1NU2 A;  1C4A A;  3ML9 A;  4GPT B;  1D5X C;  1WR6 E;  3VQI A;  2WXO A;  3A1Q B;  1J8C A;  2RSU A;  2JXT A;  1IYF A;  4MGY E;  1I4H A;  3ABV B;  2KKC A;  4YXD B;  3OAW A;  2OQB A;  3PHW B;  4P1C C;  4JKA A;  2NPT B;  2I1K A;  5BO4 B;  2G4D B;  4XGA B;  3AE2 B;  1WJ6 A;  1WX7 A;  2CJN A;  4TQ0 A;  3AE6 B;  2MHJ A;  1WF9 A;  2K8C A;  2LMC A;  3Q69 A;  2D07 B;  4ZOH C;  2DHJ A;  5L81 A;  4K2O A;  2JF5 A;  1FMA D;  3NZ3 A;  2LJ5 A;  2QJL A;  5AEK B;  4AS1 A;  1SE9 A;  4JKG B;  3DHI C;  2G45 B;  1E8X A;  3PV1 A;  1V88 A;  2HD5 B;  5J17 A;  1ST7 A;  5IKC M;  4OHJ A;  2QSD A;  4JKG A;  3PRP B;  2A4Z A;  5HG2 A;  2XN9 C;  1WH3 A;  1V5U A;  2LGY A;  2D9X A;  4ZRP A;  1C78 A;  3D8E A;  1K50 A;  3JSV B;  4HPL B;  2D2Q A;  4HAX B;  1WGD A;  3IBE A;  4MM3 B;  1BT0 A;  1V49 A;  2WXM A;  2KWU B;  2OHF A;  4HSI A;  3PS6 A;  2YF0 A;  1A5R A;  1VCB A;  4UDU C;  2EMT A;  2REX A;  2JUO A;  2KD0 A;  2PVO D;  1K8R B;  2MP2 A;  3HSA A;  3CSF A;  1N5W A;  1SJH D;  4RH6 A;  4YL8 A;  4PQ0 A;  1DOI A;  2PIA A;  1MJD A;  2GMI C;  1PYW D;  2IJ0 A;  4KSL C;  3UQB A;  1OFF A;  5D2M B;  2N0Y A;  1D5Z C;  5DHA B;  1K52 A;  1WYW B;  2KIG A;  1EGX A;  2WXG A;  4CHM A;  1RFA A;  1TY2 A;  2NVU I;  3NZS A;  3Q8B A;  3RNC C;  2R2Y A;  3MTN B;  4TYZ A;  3ZRC A;  3V61 A;  3DVG X;  1U4A A;  3M3J A;  4RM9 A;  5I4D A;  1L0Y B;  2AYO B;  1OQQ A;  3AU5 A;  4DXA B;  2NS5 A;  1MK7 B;  2D3A A;  2KQS A;  2GB1 A;  1F52 A;  4K1R B;  2HTH B;  3RFZ B;  2L0F A;  3RUL A;  2HTM E;  3ZTC A;  1GOZ A;  2O2V A;  3APD A;  4WJP A;  3MDB C;  2W82 A;  4HPP A;  2QIE B;  3N7C A;  2FJ9 A;  2KJ6 A;  3ALB A;  2MBQ A;  3CIK A;  2DYO A;  2KNB A;  1MVK A;  3TIX A;  3VXW A;  2KIE A;  2PKO A;  2RDG A;  1U2B A;  1YX6 B;  4LTU A;  2XBB C;  1K53 A;  5DPW A;  3FLV A;  4ICV A;  4QXA B;  4WVF B;  4NJC A;  5HE2 A;  3BYY B;  3SUZ A;  1CQV A;  3U7Z A;  1I35 A;  3H1U A;  4KGT A;  2YS5 A;  2FDQ A;  4ZRK A;  1J0G A;  1XLP A;  2ON8 A;  3UZT A;  3DVN U;  2P0H A;  3IVF A;  1I7H A;  3A98 B;  4XYC A;  4BZA A;  1ZXH A;  4GGQ A;  1AW7 A;  4FJZ A;  4B6H A;  3B0A A;  2W54 A;  2J59 M;  4NAW A;  3HIZ A;  3LDZ E;  2COF A;  3A9K A;  4JQW C;  2WNM A;  3I57 A;  2Y8F A;  2N9E B;  4DHJ D;  1LW3 A;  3PG7 A;  4XC2 A;  1OY2 A;  1F0Z A;  2IO3 B;  5KQ1 A;  5MPO A;  2Z0Q A;  2M19 A;  5IRS A;  1TKE A;  2KFJ A;  1JML A;  5IA7 A;  4YSZ B;  1JAL A;  3DBL I;  2JU6 X;  4JL9 A;  4HB4 B;  3B2F A;  3RN9 C;  3BJI A;  3GYP A;  1P0R A;  1UNQ A;  1KFY B;  4A8X C;  3QQ8 B;  1HEZ E;  4HEA 1;  4YTM B;  2I38 A;  3QBV B;  2LFI A;  2JRI B;  1AAR A;  3U30 A;  2C9W B;  1ZUD 2;  5TSS A;  4TQ1 A;  3KW5 B;  4BOS C;  2GUM A;  1R4M B;  2CB8 A;  2H89 B;  2O6V B;  2KC1 A;  4PYZ A;  2AX5 A;  3OJ3 A;  2N7E A;  3SO6 A;  4XZ4 A;  2KXJ A;  4TMA B;  1XR0 B;  1XCT L;  5C5B A;  5GMV A;  1I4X A;  1T0S C;  4BKG A;  4EOY A;  2D9Z A;  3RNF C;  2X18 A;  3NWF A;  1ZC3 B;  3GZN I;  1RRB A;  3B1L X;  3VTV A;  3SV1 A;  3F0W A;  3DQV A;  3MJ5 A;  4A9A A;  3B9J A;  2G1E A;  5E6O A;  4ILG B;  2IND C;  4ARC A;  1JRO A;  1WM3 A;  5DI9 B;  1XD3 B;  4K7W A;  5D7G A;  1TXD A;  1S1Q B;  4EFO A;  1Z5S B;  5JHG A;  4A5K A;  3OHM B;  2I1J A;  2B76 B;  2CJO A;  5D6J B;  4L1R A;  1YX5 B;  2DLW A;  2MDX A;  2JYT A;  4CHJ A;  2CY5 A;  1GC6 A;  1J19 A;  2CHW A;  3URY A;  1KF6 B;  3ZGZ A;  1IP9 A;  2HRJ A;  1NI2 A;  3L10 B;  1HE8 A;  2PJH A;  1L2N A;  1JDE A;  1EAZ A;  1HA5 A;  1WZ0 A;  1QOG A;  1ZPS A;  2IPK D;  3ZKJ C;  2MRP A;  4MEL A;  2W9N A;  3P42 A;  4GIV A;  3Q6B A;  1TT5 B;  1X11 A;  4HB0 B;  2OED A;  1J7C A;  3KZ1 A;  1SIF A;  3DXE A;  1VZ8 A;  3IG3 A;  4ILJ A;  4FHJ A;  4FLH A;  3NS8 A;  5EE0 A;  2LXC A;  2KMA A;  2IDY A;  5KQ4 A;  5D94 A;  4KDL B;  5BMG A;  3I3T B;  3KY9 A;  3QAQ A;  1U29 A;  1GJZ A;  4MDK E;  4KKI A;  2GLS A;  1RM6 C;  3DXD A;  2V3S A;  2WXQ A;  3W1Y A;  2L52 A;  1J7B A;  1UGJ A;  2MJE A;  3DBR B;  1SF0 A;  1PGA A;  2NBU A;  3PZ8 A;  3AJ4 A;  3PRE A;  4K3B A;  4JGH B;  4RGT A;  3VAW A;  5E6P A;  2WDR B;  3M62 B;  5D3Y A;  2NZ8 B;  2KX0 A;  3KWL A;  5L83 A;  1WGU A;  1ZM0 A;  1SEB D;  5CHV C;  1NI3 A;  5JHH A;  3PPA A;  2IY1 B;  2JXX A;  1FPY A;  2O2V B;  4GOC A;  1BTK A;  3P4R B;  2KTR A;  2XNA C;  3SDL C;  2BCJ A;  1UWX A;  1EWC A;  4ZYN A;  4BKS D;  1QOF A;  4KKJ A;  1JWU D;  2WGS A;  2J52 A;  1VDV A;  1WX9 A;  2EMS A;  2BKR B;  3MHZ A;  1JQ4 A;  1V9J A;  5DIF B;  3AEE B;  4LNI A;  2MSE D;  4EUT A;  1F2R C;  3DHG C;  3ENB A;  4W9E A;  1WXA A;  5C3J B;  4ZHP A;  3H6N A;  5LNK 1;  1PMS A;  3SHQ A;  2ACZ B;  1Y56 A;  3AMZ A;  1VBG A;  3SFD B;  3NSU A;  2Y3A A;  2WQY B;  4IWO A;  2DYB A;  3PGE A;  4WJQ A;  3TUO A;  3DOW A;  1KZG A;  2WXF A;  3EFU A;  4MH0 E;  2PPH A;  2Z59 B;  1XCG A;  4WAF A;  2ASQ A;  1XX0 A;  2L1C A;  3MC8 A;  4KZC A;  4ANW A;  2VH1 A;  1ZDX A;  3AEF B;  4FJV B;  2VSZ A;  2G3Q B;  4KV2 A;  2GBJ A;  4W9G A;  2QCZ A;  2RPQ A;  2UZS A;  5D27 A;  1C77 A;  2N1W A;  3RYT A;  1FAO A;  2M1M A;  1HB6 A;  4QJ4 B;  1U5E A;  3TL5 A;  2XEW A;  4H8S A;  2C7N B;  2Y5C A;  2W2W A;  2JZ3 B;  1ROE A;  1FGZ A;  1L0X B;  3Q3F A;  4A90 A;  1LQB A;  3ULB A;  2DTC A;  5J3Y A;  3CIR B;  4WWN A;  4A6Q A;  1JWS D;  4W9F A;  3U4E G;  1N5X A;  1XF5 L;  3DWM A;  4W9D A;  1WRD B;  3VRB B;  5HE3 A;  2MBE A;  4PYU A;  2KJR A;  4RM8 A;  2FJL A;  2FUH B;  1ZYI A;  2RLO A;  3QIJ A;  2NTS A;  1TIF A;  2LWP A;  2DYQ A;  1MKE A;  1WXS A;  2ZPY A;  2BQQ A;  3EA6 A;  2MW5 A;  2RRF A;  3KQ4 A;  4H2A A;  4M02 A;  2KDM A;  3VUW A;  1CK1 A;  4BVU C;  2ICI A;  2L83 A;  2PE9 A;  3ENE A;  1GB4 A;  5JH5 C;  1P5T A;  2UVM A;  3V5W A;  2DLB A;  3AE9 B;  4WWM A;  3VUY A;  4JKH A;  1PFJ A;  1UNR A;  1SIJ A;  2DBY A;  1VLB A;  4MEM A;  1EVH A;  4R3D A;  5BYS A;  3JVZ X;  1MAI A;  3RNE C;  2L8J A;  5AZH A;  2JY6 A;  2ABD A;  3SR6 A;  2DHK A;  1GC7 A;  1NYR A;  3TEX A;  2CU1 A;  1RJ2 A;  4S0R A;  2KVR A;  2OTX A;  2CU3 A;  2BW2 A;  2WX0 A;  4X57 B;  5G55 A;  1OMW A;  2L0T A;  2CHZ A;  2HTH A;  3FSS A;  2K2U A;  1LGR A;  1V1P A;  2INN E;  1E9M A;  4MGK E;  3KRX A;  1V97 A;  2KFK A;  2QDF A;  1GG3 A;  2K8E A;  1JWA D;  1XCQ L;  2KHW B;  2AL6 A;  5CTR C;  1PDX A;  2KFK B;  1WXM A;  4EMO A;  2RDB C;  3A1Q A;  3E9P A;  2DAJ A;  2H88 B;  2PE6 B;  3NWA A;  3ZO5 B;  1W1D A;  4MGI E;  1UD7 A;  3R2I A;  4JK7 A;  2WXJ A;  2L00 B;  3NZU A;  1WMH A;  4AWJ A;  3AE1 B;  2X8X X;  2GBM A;  4XWX A;  4A6F B;  1WI1 A;  3PVU A;  4D6W A;  3HK0 A;  3FIL A;  4F7Z A;  2MKR A;  1N61 A;  4A6F A;  2K9X A;  2FID A;  2GI9 A;  1H10 A;  2VZK B;  2JQR B;  3EHV A;  2XK5 B;  4J6I A;  1BML C;  2WXH A;  3W2D A;  2N9L A;  3NG0 A;  1YN3 A;  3RPF C;  2L32 A;  1KI1 B;  3AEA B;  3BK1 A;  3CST A;  2BF8 B; 
#chains in the Genus database with same CATH homology
 1MIZ B;  4HB2 B;  1ISN A;  3VH4 B;  1X86 A;  3QA8 A;  1TBE A;  1V2Y A;  2QKM A;  4KSK C;  2Z0E B;  1E8W A;  3DBH I;  3KYD D;  2ROV A;  4BKS A;  4KHB B;  3JYU A;  4HWI B;  4M8M A;  4HPM B;  3GYO A;  1X1F A;  2R2O A;  2KLG A;  5CHF A;  4LDT D;  3S2A A;  3ZUN A;  4HLE A;  3ZDM C;  2N7D A;  1L7Y A;  1LM8 B;  3G9W A;  1KZ7 A;  1E90 A;  3EPY A;  2KJH B;  4G50 A;  1WGY A;  1BAK A;  2KO3 A;  3VUX A;  2FNJ B;  2YVC A;  3PVW A;  2GJY A;  3H7S A;  2DFK A;  3ZNH B;  1Q5W B;  5AZG A;  3KUZ A;  2LAS A;  3UIO B;  2N4F A;  5DCN A;  3VVW B;  1GUA B;  5DPS A;  3SNH A;  2M14 A;  1I2H A;  5LXI B;  1OGW A;  1H8C A;  3OJ4 B;  1WE7 A;  3UF8 A;  3UIP B;  3DBS A;  4DBB A;  4JKD A;  2KC2 A;  4GDL B;  1RAX A;  2Y8G A;  5LON B;  1UEF A;  4WJ7 A;  4IFS A;  4NQK E;  4BBK A;  1V86 A;  1WM2 A;  1TTN A;  2LRW A;  3OAN A;  4L6E A;  1NTY A;  1WI0 A;  1P1A A;  4BBN F;  3F5R A;  3BIN A;  4E3C A;  1R4N I;  3E9L A;  4G3X B;  3WAP A;  1WJM A;  2BWE S;  3T8M A;  1OEY J;  2BKF A;  5JLJ B;  3VFK A;  2E2X A;  2J7Q B;  1DIK A;  1WY8 A;  5JZE B;  1TGZ B;  2V1Y A;  3ODO A;  2JZZ A;  2RNR B;  3X0W A;  3NY5 A;  3DCG A;  2CAY A;  5DH9 B;  4ANX A;  4JK9 A;  3L54 A;  3RCP A;  1R4M I;  2R09 A;  2LKO A;  2MX2 A;  2D9W A;  3A4S C;  1W1G A;  2OJR A;  3QWM A;  2LOX A;  1ZKH A;  3LJU X;  2LVO A;  2O6V D;  4HHV A;  4OVU A;  2RGF A;  2MLB A;  2UZR A;  1RLF A;  3ECI A;  1Z87 A;  1T0Y A;  4BBN C;  3DDC B;  2M4N A;  1MIX A;  1YD8 U;  2R82 A;  1EO6 A;  2OOB B;  5E6N A;  1U5D A;  4W9K A;  2LG1 A;  2XK5 A;  1OEY A;  1UBQ A;  2GBK A;  3HM6 X;  1OTR B;  2DN6 A;  2L76 A;  2ELA A;  2ZCC A;  2MCN B;  3APC A;  4KIK A;  4MGZ E;  1U5F A;  1U5G A;  2DZJ A;  2PEA A;  1ZW7 A;  3VDZ A;  3TCA A;  2EKE C;  2G4S A;  1E8Y A;  4EZK A;  2KN5 A;  4NJ6 A;  4IM2 A;  3PLV A;  1DDM A;  4B9K A;  5CLQ B;  1PQS A;  4BFR A;  4II3 B;  4Z2N A;  3D8F A;  4W9L A;  2LD9 A;  3ZVV A;  3H9D A;  2LBB A;  4HAY B;  4I6P A;  2B3A A;  5JHB A;  2Y7B A;  4A3O A;  4AJW A;  3K9P B;  3O96 A;  1S3S G;  5KCV A;  5HE0 A;  1DYN A;  2X0S A;  4HDO A;  1K5G B;  4TV3 A;  3V62 A;  5JP4 A;  2RD0 A;  2MQJ A;  3QJZ A;  2BYF A;  4AJY B;  1Y19 B;  2ZVN A;  2BYV E;  1WXV A;  2IO1 B;  4WSF A;  4PS7 A;  4DX9 0;  4IM3 A;  4JKE A;  3NOB A;  3ZIM A;  4F7H A;  1Z2M A;  5JHA A;  1X1G A;  3ZVR A;  2M38 A;  2K6Q A;  2DZK A;  3EEC A;  5J3Q A;  4GDK B;  1B55 A;  2K00 A;  3P7Z A;  5JVL A;  1Y8R C;  1J0W A;  2DZM A;  2NPT A;  3SBT A;  3WYF B;  2IYD B;  1I42 A;  4EZL A;  1MPH A;  5FR6 A;  2JT4 B;  1M7R A;  3TVV A;  5KHO A;  3KVF B;  1K5D B;  2DHZ A;  3PHX B;  3WAM A;  4HXD A;  3ZW3 A;  2D3G A;  4ILH A;  1LB1 A;  3N30 A;  1FOE A;  5DHF B;  4B95 A;  4FN2 A;  2JPH A;  2WWZ A;  1E7U A;  5KHQ A;  3VOQ A;  4AOF A;  3PLU A;  2LZ6 A;  3VTW A;  5D3X A;  1DDW A;  2D11 A;  3R66 C;  2BWF A;  1WJ1 A;  3H7P B;  4EKU A;  3H7P A;  3A8Q A;  1EF5 A;  2L2I A;  3UGB B;  2GBR A;  4DHJ B;  4CYE A;  4F1S A;  1V61 A;  5FI1 A;  1ACA A;  4DHZ B;  2JWZ A;  2W2X C;  3A8P A;  4DBG A;  5L95 C;  3W1S A;  4FAD A;  1KJT A;  1WGG A;  3KUC B;  4JKF A;  1WR1 A;  3A4R A;  4MSM B;  2Z0P A;  2K1F A;  4LCD E;  2MWN B;  2EJ8 A;  2KUP A;  3QWZ B;  2C60 A;  1KLV A;  4IW0 A;  3QAR A;  4HCP B;  3LJ3 A;  1VD2 A;  4FHK A;  2MBH A;  5DPT A;  3PP2 A;  1QZE A;  3R3M A;  1P98 A;  3KUD B;  4D0N B;  1HBK A;  5LXH A;  1KC7 A;  3SBG A;  3SD5 A;  2QHO A;  5LOP B;  1XD4 A;  3T9L A;  4HDQ A;  2V76 A;  3N32 A;  2C7H A;  3C0R B;  1SGH A;  1KBL A;  3B08 A;  3UIN B;  4HAU B;  1WG7 A;  2K25 A;  2JRH A;  2QKL A;  4GMV A;  4P7I A;  3P2B A;  2ELB A;  1WVH A;  4LDT B;  4JIO U;  2MFQ A;  1P3Q U;  3A9K B;  3NHE B;  3D32 A;  3FEH A;  3AI5 A;  2KDB A;  4I6L B;  3TFM A;  4II2 B;  2R2Q A;  3WAN A;  3U8Z A;  1NTI A;  2DX5 A;  3DXC A;  2NBW B;  4K7U A;  1TQZ A;  1XKE A;  2R0D A;  2DX5 B;  2NR2 A;  1XT9 B;  1UGM A;  3QK0 A;  3Q3J A;  3V6E B;  1Q1O A;  3PRZ A;  3RCZ A;  2KWC A;  5DPR A;  2RGN B;  4GXB A;  2NCN A;  4XX5 A;  4EEW A;  3K9O B;  1M7E A;  2GBN A;  2P0F A;  3KYC D;  1WGH A;  2J0K A;  4EJN A;  1ZVR A;  5EDS A;  3ZNZ B;  2KZR A;  4NPN A;  3IFW B;  4FJY A;  1BWN A;  3A33 B;  2KTF A;  4DK5 A;  2N9P C;  2D9Y A;  4IM0 A;  2WDT B;  4JKC A;  1DDV A;  1FXT B;  3R7R A;  1OQN A;  3DVN V;  3O65 B;  2A5U A;  4A6H A;  1WIA A;  2KCJ A;  4KDI C;  5CX3 A;  4BOZ B;  2I5C A;  1JRU A;  2ZNV B;  3ZNG C;  2M8S A;  2DZI A;  1QC6 A;  3FP5 A;  2LGD A;  5IAA C;  2ZEQ A;  2D4Q A;  2AWT A;  4KHO A;  4IAP A;  3DPD A;  4G0N B;  3T06 A;  2DKQ A;  3HW2 B;  5HKH A;  1P6S A;  1UNP A;  2RQ1 A;  3QC8 B;  2K8H A;  1UPQ A;  5CLL B;  2MP2 B;  4C0A A;  3QX1 A;  2IZV B;  4A3P A;  2ADZ A;  1Y5O A;  2C5L C;  3ML4 A;  3EC8 A;  2RUK B;  2WYQ A;  5AZF A;  5J2R A;  1Q0W B;  1E8Z A;  1V5P A;  2ZCB A;  2HE7 A;  4ICU A;  2FIF A;  1M94 A;  3AXC A;  4PS8 A;  5CHW A;  2LYD A;  1UEL A;  4HK2 A;  1AWE A;  4JK8 A;  1P3R A;  1DRO A;  1V89 A;  3TW1 A;  2DHI A;  4GN1 A;  1E5W A;  5D3V A;  4WAA A;  2WX1 A;  2ZPN A;  4CHK A;  2KOX A;  2D9V A;  2CS4 A;  1RRP B;  3QHT A;  3HHM A;  2COD A;  1V81 A;  4HJK A;  4EZJ A;  4URK A;  3R7Q A;  1IPG A;  4A6K A;  4MSQ B;  4HCN B;  1V5T A;  1F9J A;  1FHO A;  4PS3 A;  4YON A;  3A9J A;  3PEG A;  2UWQ A;  3VH3 B;  2ZNV C;  5IJM A;  2N23 A;  4NAW B;  2K2J A;  2V4L A;  4ANV A;  2YLM A;  2L3Z A;  1XQQ A;  4KIK B;  1WZ3 A;  2GS0 A;  2WH5 A;  4MK0 A;  2NBV B;  2CQU A;  4IG7 B;  3DVG Y;  2L7R A;  2GCJ A;  1HB8 A;  4GU2 A;  3L08 A;  1BTN A;  2DA0 A;  4HAT B;  2CY4 A;  2DKP A;  2MBB B;  1AQC A;  3W1S C;  3PZD A;  3ML8 A;  3GOE A;  3E9O A;  1X05 A;  1U27 A;  4BKT A;  4MM3 A;  4I6N B;  1KOT A;  4M0W B;  4KHA A;  5C16 A;  5FI0 A;  2YT1 A;  4W9H A;  1I7A A;  1SHC A;  1DBH A;  4K2P A;  4IWQ A;  3VTU A;  5TR5 A;  4NSW A;  4DDI D;  2COP A;  1V80 A;  2ZVO A;  1FB8 A;  4K17 A;  4WWO A;  4K81 A;  1KM7 A;  3TBL D;  2H7D A;  4AUQ C;  2AEH A;  2DEN B;  1IRS A;  2FCS A;  4K7S A;  3VHT C;  1GGO A;  3RUI B;  4F7G A;  2HJ8 A;  1N3H A;  4G11 A;  3PSE B;  3TO1 A;  1WX8 A;  1V5M A;  4HAV B;  5EFX A;  2L05 A;  2N9X A;  4GDK A;  3RD2 A;  3QCA A;  3ULC A;  3PTF C;  3APF A;  1OQY A;  3FM8 C;  4Z2M B;  4HB3 B;  4AP4 C;  2DYM A;  1XOD A;  3V6C B;  4ZRJ A;  3ZRF A;  1NBF C;  1LXD A;  2LUE A;  5GOW B;  2KDF B;  2IYB A;  3ODX A;  4FBJ B;  2MA9 B;  3MHS D;  2IBI B;  3V60 A;  3PSC A;  2GCL A;  2J0M A;  1NTV A;  2KX3 A;  2FCM A;  1QQG A;  3D8D A;  2RSG A;  1W1H A;  2YRY A;  4GMX B;  1G6J A;  2K8B A;  2EC1 A;  3MJW A;  2IO0 B;  3WIM A;  4E71 A;  1FHX A;  4WJO A;  3KSY A;  2VRR B;  1D3Z A;  3BY4 B;  3L16 A;  3VIA A;  4IOY X;  3X23 A;  1ZC4 B;  2LUL A;  3E66 A;  4LJO B;  2LGX A;  2IO2 B;  2LXA A;  2RR9 A;  3WA0 A;  4Y94 A;  5D3W A;  2J0J A;  1UH6 A;  2FAZ A;  2BGF A;  4NQL B;  3ZTD A;  2LVP A;  2UYZ B;  4B6W A;  3L17 A;  1FHW A;  4GZU A;  3OLM D;  2K39 A;  2Y5B B;  2VKI A;  2BYE A;  2Z0O A;  2IFS A;  2DYN A;  2D10 A;  3DBR I;  2KWV B;  4F8C B;  5J18 A;  3RZF A;  1V6E A;  1H4R A;  3KRW A;  1EF1 A;  3AU4 A;  4FUL A;  1WJU A;  2P8V A;  2AL3 A;  3IHP C;  4NJ7 A;  3HQC A;  2H7E A;  2I5F A;  2KDE B;  1FGY A;  4GDL A;  3ZDT A;  3N3K B;  1E7V A;  5C23 A;  2Q13 A;  2KGX B;  1NVL A;  2DIK A;  2G35 A;  4HAW B;  3P6A A;  1LFD A;  4DHZ E;  3JSV A;  2LI5 A;  3RZW C;  2LOZ A;  2MBO A;  3MPX A;  2NMB A;  2YS1 A;  2ROZ B;  1V5O A;  1YIW A;  3UQA A;  3M95 A;  3CF6 E;  1MK9 B;  2CR5 A;  2GOW A;  2KQ7 A;  3CXB B;  4JKB A;  4MJS B;  3PVL A;  4KAX B;  4GSW A;  1TZ1 A;  4MT7 A;  3L0W B;  4MJS A;  1X1M A;  3ONS A;  2CRF A;  4W9J A;  4N9F 4;  1YQB A;  2LVQ A;  4HVB A;  4KVG B;  4TKN A;  1TJ6 A;  2CKH B;  2FCQ A;  3M1I B;  3PRM B;  4CO7 A;  2YSZ A;  4RMA A;  4LJP B;  1MG8 A;  2VRW B;  2M0X A;  2KLC A;  4JLC A;  4M8N A;  3M63 B;  2KTR B;  1GNU A;  2FCN A;  2KAN A;  4GB9 A;  4NNJ B;  2P0D A;  3PT2 B;  2M17 A;  1EUV B;  4HAZ B;  2Z0D B;  4ZDV A;  2KMC A;  2W2X D;  2YS3 A;  5HE1 A;  1P9D U;  2BPS A;  1WJ4 A;  2YT0 A;  4WJN A;  3ZLZ A;  4TUU A;  3A9J B;  1WGQ A;  4FA6 A;  1WFY A;  1WJN A;  1WGR A;  2CHX A;  2RVB B;  3ZNI D;  4OVV A;  1UBI A;  4A20 A;  3SYX A;  5J3T A;  3KH0 A;  4E74 A;  1C3T A;  1CMX B;  5C1Z A;  1WE6 A;  3CMM B;  2JVC A;  2MWS B;  3L13 A;  2COA A;  2IY0 B;  3WAO A;  3HM3 A;  5G2N A;  1YJ1 A;  3AUL A;  4KZ0 A;  5C79 A;  1WMH B;  4ANU A;  3JW0 X;  1Q67 A;  2JP2 A;  2O6V A;  4PNK A;  1UZX B;  2KDI A;  1UPR A;  4F7U P;  2ZZP B;  1NDD A;  2KK8 A;  4MY6 A;  2LRU A;  2COC A;  4WQO B;  1ZSQ A;  4W9I A;  3RT3 B;  4DWF A;  4IWP A;  2N1V A;  3WAL A;  2DX1 A;  3TJP A;  4DX8 A;  1PLS A;  3ODW A;  3U7D A;  4IUM B;  1VBH A;  2K6D B;  2ZJD A;  4DDG D;  3SU8 X;  2DAF A;  4ZRI A;  2C7M B;  4WWP A;  3TMP B;  5LLI A;  4NY0 A;  4W9C A;  2PZ1 A;  2XQN M;  5C5B B;  4IC7 B;  5C6R A;  1ZGU B;  1C1Y B;  4ASW C;  1NU2 A;  3ML9 A;  4GPT B;  1WR6 E;  3VQI A;  3A1Q B;  1J8C A;  2RSU A;  1IYF A;  4MGY E;  2KKC A;  3OAW A;  2OQB A;  3PHW B;  4JKA A;  2NPT B;  2I1K A;  5BO4 B;  2G4D B;  1WJ6 A;  1WX7 A;  4TQ0 A;  1WF9 A;  2K8C A;  2D07 B;  2DHJ A;  5L81 A;  4K2O A;  2JF5 A;  2LJ5 A;  5AEK B;  1SE9 A;  4JKG B;  2G45 B;  1E8X A;  3PV1 A;  1V88 A;  2HD5 B;  5J17 A;  1ST7 A;  4JKG A;  3PRP B;  2A4Z A;  1WH3 A;  1V5U A;  2LGY A;  2D9X A;  3D8E A;  3JSV B;  4HPL B;  2D2Q A;  4HAX B;  1WGD A;  3IBE A;  1BT0 A;  1V49 A;  2KWU B;  3PS6 A;  2YF0 A;  1A5R A;  1VCB A;  2EMT A;  2REX A;  2JUO A;  2KD0 A;  1K8R B;  2MP2 A;  3CSF A;  4YL8 A;  4PQ0 A;  2GMI C;  4KSL C;  3UQB A;  5D2M B;  2N0Y A;  5DHA B;  1WYW B;  1EGX A;  4CHM A;  1RFA A;  2NVU I;  3NZS A;  3MTN B;  4TYZ A;  3ZRC A;  3V61 A;  3DVG X;  1U4A A;  3M3J A;  4RM9 A;  2AYO B;  3AU5 A;  4DXA B;  2NS5 A;  1MK7 B;  2KQS A;  4K1R B;  2HTH B;  2L0F A;  3RUL A;  3ZTC A;  2O2V A;  3APD A;  4WJP A;  3MDB C;  3N7C A;  2FJ9 A;  2KJ6 A;  3ALB A;  2MBQ A;  3CIK A;  2DYO A;  2KNB A;  3TIX A;  3VXW A;  1U2B A;  1YX6 B;  2XBB C;  5DPW A;  3FLV A;  4ICV A;  4WVF B;  5HE2 A;  3SUZ A;  1I35 A;  3H1U A;  2YS5 A;  2FDQ A;  4ZRK A;  1J0G A;  3UZT A;  3DVN U;  2P0H A;  3IVF A;  3A98 B;  4GGQ A;  4FJZ A;  4B6H A;  3B0A A;  2J59 M;  4NAW A;  3HIZ A;  3LDZ E;  2COF A;  3A9K A;  4JQW C;  2Y8F A;  2N9E B;  4DHJ D;  1LW3 A;  3PG7 A;  4XC2 A;  1OY2 A;  2IO3 B;  5KQ1 A;  2Z0Q A;  2KFJ A;  5IA7 A;  3DBL I;  4JL9 A;  4HB4 B;  3BJI A;  3GYP A;  1P0R A;  1UNQ A;  3QQ8 B;  3QBV B;  2JRI B;  1AAR A;  3U30 A;  2C9W B;  4TQ1 A;  3KW5 B;  4BOS C;  2CB8 A;  2O6V B;  2KC1 A;  4PYZ A;  3OJ3 A;  2N7E A;  3SO6 A;  4XZ4 A;  2KXJ A;  1XR0 B;  5C5B A;  5GMV A;  4BKG A;  4EOY A;  2D9Z A;  2X18 A;  1ZC3 B;  3GZN I;  1RRB A;  3B1L X;  3VTV A;  3SV1 A;  3F0W A;  3DQV A;  5E6O A;  4ILG B;  1WM3 A;  5DI9 B;  1XD3 B;  4K7W A;  5D7G A;  1TXD A;  1S1Q B;  4EFO A;  1Z5S B;  5JHG A;  4A5K A;  2I1J A;  5D6J B;  1YX5 B;  2DLW A;  2MDX A;  4CHJ A;  2CY5 A;  1GC6 A;  1J19 A;  2CHW A;  1IP9 A;  2HRJ A;  1NI2 A;  3L10 B;  1HE8 A;  2PJH A;  1L2N A;  1JDE A;  1EAZ A;  1WZ0 A;  3ZKJ C;  2MRP A;  4MEL A;  2W9N A;  4GIV A;  1X11 A;  4HB0 B;  3KZ1 A;  1SIF A;  3DXE A;  3IG3 A;  4ILJ A;  4FHJ A;  4FLH A;  3NS8 A;  2LXC A;  2KMA A;  5KQ4 A;  5D94 A;  4KDL B;  3I3T B;  3KY9 A;  3QAQ A;  1U29 A;  1GJZ A;  4MDK E;  3DXD A;  2V3S A;  3W1Y A;  2NBU A;  3AJ4 A;  3PRE A;  4JGH B;  3VAW A;  5E6P A;  3M62 B;  5D3Y A;  2NZ8 B;  2KX0 A;  5L83 A;  1WGU A;  1ZM0 A;  5CHV C;  5JHH A;  3PPA A;  2IY1 B;  2JXX A;  2O2V B;  4GOC A;  1BTK A;  2KTR A;  3SDL C;  2BCJ A;  4ZYN A;  4BKS D;  1WX9 A;  2EMS A;  2BKR B;  1V9J A;  5DIF B;  2MSE D;  4EUT A;  3ENB A;  4W9E A;  1WXA A;  3H6N A;  1PMS A;  3SHQ A;  1VBG A;  3NSU A;  4IWO A;  2DYB A;  3PGE A;  4WJQ A;  3DOW A;  1KZG A;  3EFU A;  4MH0 E;  2PPH A;  2Z59 B;  1XCG A;  2ASQ A;  1XX0 A;  2L1C A;  4KZC A;  4ANW A;  4FJV B;  2VSZ A;  2G3Q B;  4KV2 A;  2GBJ A;  4W9G A;  2RPQ A;  2UZS A;  5D27 A;  2N1W A;  3RYT A;  1FAO A;  2M1M A;  1HB6 A;  1U5E A;  3TL5 A;  2XEW A;  4H8S A;  2C7N B;  2W2W A;  2JZ3 B;  1FGZ A;  3Q3F A;  1LQB A;  3ULB A;  2DTC A;  5J3Y A;  4WWN A;  4W9F A;  4W9D A;  1WRD B;  5HE3 A;  2MBE A;  4PYU A;  2KJR A;  4RM8 A;  2FJL A;  2FUH B;  2RLO A;  3QIJ A;  2LWP A;  2DYQ A;  1MKE A;  1WXS A;  2ZPY A;  2MW5 A;  3VUW A;  4BVU C;  2PE9 A;  3ENE A;  5JH5 C;  1P5T A;  2UVM A;  3V5W A;  3VUY A;  4JKH A;  1PFJ A;  1UNR A;  4MEM A;  1EVH A;  3JVZ X;  1MAI A;  2L8J A;  5AZH A;  2JY6 A;  2ABD A;  2DHK A;  1GC7 A;  2CU1 A;  1RJ2 A;  2KVR A;  2OTX A;  2WX0 A;  4X57 B;  5G55 A;  1OMW A;  2L0T A;  2CHZ A;  2HTH A;  3FSS A;  2K2U A;  4MGK E;  3KRX A;  2KFK A;  1GG3 A;  2KHW B;  2AL6 A;  5CTR C;  2KFK B;  1WXM A;  4EMO A;  3A1Q A;  3E9P A;  2DAJ A;  2PE6 B;  3ZO5 B;  1W1D A;  4MGI E;  1UD7 A;  4JK7 A;  2L00 B;  3NZU A;  1WMH A;  4AWJ A;  2GBM A;  4XWX A;  4A6F B;  1WI1 A;  3PVU A;  3HK0 A;  4F7Z A;  2MKR A;  4A6F A;  2FID A;  1H10 A;  3EHV A;  2XK5 B;  4J6I A;  1KI1 B;  3CST A;  2BF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...