2AL6A

Ferm domain of focal adhesion kinase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
373
structure length
343
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQTDDYAEIIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 98
structure length 343
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2al6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2al6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al6A01
3PPAA 3UIPB 4A20A 2XK5A 1BAKA 2BWES 2DYQA 2N7DA 3EHVA 3H7SA 3PV1A 2GCJA 3QA8A 4DBGA 2BYFA 4MM3A 4WWPA 1LM8B 1ZW7A 1P0RA 4DHJD 1E5WA 1I35A 3IVFA 3AU4A 3SV1A 1P9DU 4W9GA 4JIOU 1MG8A 4DBBA 2ZPNA 1U5FA 1W1DA 1TXDA 3ODWA 4HDOA 2XBBC 2DKPA 3CIKA 4HATB 2P0HA 1E8WA 1UPRA 1AARA 2D07B 3PS6A 2D4QA 4ZRIA 5L81A 3DVNV 3L16A 3W1YA 3SDLC 2CS4A 2ZNVC 3NOBA 2G4DB 2KANA 3MTNB 4TQ1A 2OQBA 4IG7B 2LRWA 3APCA 1HB6A 5AZHA 3AXCA 2YS1A 2KO3A 2D2QA 1RLFA 3M95A 4A3OA 4CYEA 3UINB 2WH5A 2RLOA 2YS3A 5FI1A 1V49A 1OQYA 2N4FA 2LBBA 4DDID 2GCLA 3QX1A 2DA0A 3V6CB 3VFKA 2MDXA 3UQBA 4HAWB 3LJUX 5D3VA 2DZMA 4N9F4 2YS5A 3OJ3A 4G3XB 1UH6A 2LUEA 3HIZA 4J6IA 3N7CA 1FHXA 1S3SG 1SIFA 1KOTA 2YF0A 2W2XD 3AULA 4KDIC 4EFOA 4K7WA 2D11A 3KY9A 4MSMB 4MGYE 2MKRA 4DXAB 1XCGA 3PVUA 4BBNF 5LXHA 1V88A 3O65B 3PT2B 2PJHA 1Z2MA 3TCAA 2WX1A 2RGNB 2L3ZA 4JGHB 5J3QA 1WF9A 2CODA 1LQBA 4FJVB 1MK9B 3UF8A 2NZ8B 5CHWA 4EJNA 2K1FA 2CHWA 3ZNZB 2DYMA 2WWZA 4I6LB 1JRUA 2DN6A 1OTRB 2W2XC 2D9ZA 4GN1A 1N3HA 4PNKA 2JXXA 4AJWA 3U30A 3RCZA 2NPTB 3EPYA 2K6DB 3A8PA 5JHAA 2REXA 4MJSB 4H8SA 4IOYX 2ZCCA 3ZTDA 1XD3B 2AYOB 5DPSA 3QAQA 2V4LA 2ZNVB 1C3TA 3WALA 2M1MA 2ZEQA 5DHFB 2EMSA 1J19A 1X05A 3TFMA 1DDWA 3A8QA 4BBKA 1WX8A 1WXVA 2V3SA 4TKNA 3DVNU 1QC6A 2VRWB 1WZ0A 2DZIA 2L05A 4IWQA 3T8MA 3KSYA 1G6JA 1OY2A 5KQ1A 1Q1OA 2DENB 4HLEA 2RGFA 3R66C 4E74A 1MKEA 4B6HA 1WGYA 2H7EA 1WZ3A 3HQCA 2MLBA 2ZZPB 5CLQB 3SD5A 3UQAA 2GOWA 4AUQC 4B6WA 4MELA 4PYZA 5DPTA 3JYUA 2CQUA 1WMHB 2YT1A 1WY8A 2HE7A 2DZJA 2LVQA 2VRRB 1V86A 3UIOB 2IZVB 2R0DA 3GYOA 1Y8RC 1EAZA 2YRYA 2YT0A 2KTRB 3M62B 5DPWA 4NJ7A 1WGRA 4TYZA 1P1AA 4IUMB 1V6EA 3HK0A 4KVGB 2DZKA 2FCQA 3QIJA 2L1CA 3H7PB 4PS3A 4BVUC 2Y8GA 1NDDA 3KYCD 2V1YA 1PLSA 2DX1A 1RAXA 1WXSA 3B1LX 3N30A 3VTUA 4BOSC 2ZVNA 2FCSA 3VVWB 4FADA 2GBJA 3B08A 3OLMD 2LGYA 1WYWB 4XZ4A 2KHWB 5AEKB 2HTHA 2JF5A 3OANA 4KSKC 4MY6A 1OMWA 4Z2NA 3FP5A 1R4NI 2IO2B 2K8BA 3EECA 3K9OB 3MHSD 4W9CA 2K8HA 2H7DA 3SHQA 2FAZA 4AOFA 1UNQA 3N3KB 5AZGA 1E8XA 4LJPB 2JUOA 1BTNA 2COAA 1V5OA 4JLCA 2BF8B 2I1JA 2LD9A 4WJNA 2JWZA 4DDGD 5FR6A 1KZGA 1WXMA 1WRDB 2PPHA 4K2OA 2BPSA 2I1KA 4B9KA 1FGZA 3L08A 4G0NB 1U5EA 4Z2MB 5KCVA 3UZTA 3PREA 3RD2A 1ST7A 3PLVA 3PSEB 5TR5A 4FA6A 4ZRJA 5IAAC 3V62A 4GZUA 1ISNA 1UEFA 2JY6A 5CX3A 2CU1A 2DYNA 2KX3A 4DX8A 2KWVB 2WDTB 1HB8A 1WM3A 1YX5B 2G4SA 3APDA 3KUDB 3GYPA 3VUXA 2KUPA 3OAWA 4A6HA 4MK0A 1EGXA 3X0WA 2G45B 3OJ4B 2COPA 4GDLB 4URKA 2Y8FA 1KLVA 3NZUA 1DYNA 4KZ0A 2RQ1A 2LG1A 2EMTA 1YD8U 3SYXA 5LLIA 4KSLC 1LW3A 2UYZB 2HJ8A 3ZVRA 1WR6E 2J59M 1FXTB 4HJKA 3ODOA 1SHCA 2QHOA 5L83A 1EF1A 2KC1A 3FLVA 2A5UA 3I3TB 1ZC3B 3DXDA 1SGHA 1V89A 2K2JA 2FCNA 2KFJA 2KQSA 3Q3FA 4KIKB 4ANVA 5J2RA 4DHZE 4W9LA 3M63B 5G55A 3AU5A 1XR0B 2M38A 1WJNA 4WJQA 4IWOA 1Y5OA 5D27A 3HHMA 3JW0X 4ASWC 4ANWA 1MIXA 2IO3B 2Y7BA 4I6NB 5LOPB 2PZ1A 3EC8A 3ZLZA 4ICVA 2CHZA 1WJMA 3TIXA 4AWJA 3F0WA 1UBQA 3PGEA 3P6AA 3A98B 2O6VA 2I5CA 4RM8A 3VUYA 3ZKJC 2D3GA 4AJYB 4F1SA 3H1UA 4F7ZA 3ZW3A 2GBRA 1WE6A 2Z59B 2KGXB 2DX5A 2M17A 3ALBA 3NS8A 4ZDVA 2ABDA 3F5RA 2COCA 3CF6E 4E71A 3GOEA 3QARA 2NMBA 5KHQA 4KDLB 1K5DB 2LJ5A 2D9XA 3PZDA 5DIFB 4KIKA 3QJZA 3VTVA 1RFAA 2KX0A 3JVZX 4GB9A 1P3QU 2DLWA 2KDEB 2NR2A 4NAWA 4BKGA 4LJOB 5DI9B 5CHFA 1FOEA 2IFSA 2N9PC 4NJ6A 1EO6A 5HKHA 1GJZA 1V61A 1E8YA 4HWIB 2D9WA 2DHKA 2B3AA 3X23A 2N1WA 2BCJA 3ML4A 2EC1A 1ACAA 4HAZB 5CLLB 4NY0A 3DPDA 2EJ8A 2HTHB 3SO6A 1UZXB 2AL6A 4KV2A 5LXIB 2NCNA 2XEWA 2JRHA 3L54A 5FI0A 3O96A 1UD7A 2L0TA 3QWZB 2YLMA 2NVUI 1XKEA 1IP9A 2DFKA 4MT7A 2CAYA 1W1HA 3D8DA 4HB3B 4I6PA 4MGIE 4ICUA 1WMHA 4A3PA 1I7AA 1V5MA 3NSUA 2MBHA 2C7MB 3DBLI 1FGYA 2MWNB 3FSSA 4KAXB 2DYOA 3JSVA 5C79A 5JHBA 2DKQA 2FJ9A 4WVFB 1E7UA 2FUHB 2IBIB 1Q5WB 3A1QB 3AI5A 1YIWA 3QQ8B 4EZKA 1WM2A 2KWUB 3KUCB 3ZRCA 2RUKB 1NBFC 1L2NA 1TQZA 1WGHA 2Z0EB 2KOXA 4E3CA 1KI1B 2LGDA 2YSZA 2P0DA 4KZCA 2RR9A 1E90A 4W9JA 3RT3B 3C0RB 1UNPA 2NBUA 2K2UA 4IM2A 4NPNA 1P5TA 3TJPA 3WANA 2GBNA 2IO1B 2DX5B 4WSFA 2MSED 1V5UA 5AZFA 3FM8C 1C1YB 4II3B 4TUUA 2DHJA 3ZTCA 1WVHA 4K17A 1LXDA 3ZO5B 2MP2B 2YVCA 2AWTA 5JZEB 2CY5A 3U7DA 4GMVA 2VSZA 4G11A 1WGDA 2UVMA 2CRFA 4A5KA 2ZVOA 4X57B 5CTRC 1HE8A 3CSFA 3DCGA 3R3MA 4MJSA 5C6RA 2L0FA 2LVOA 1GG3A 1FAOA 1J0GA 3H7PA 3BY4B 2C7HA 1NTVA 2MBQA 4WWOA 3NY5A 1M7RA 4FN2A 1OEYA 4F7UP 2ELAA 2COFA 2Q13A 1RRPB 2KDBA 1EF5A 3QCAA 5J18A 1XD4A 5L95C 4TQ0A 3KYDD 1GC7A 4PYUA 2R09A 4XC2A 4IW0A 4BKSD 2Z0OA 3WYFB 4EEWA 3PG7A 1WR1A 3UGBB 2ADZA 5D94A 1F9JA 1MIZB 2LXAA 1MK7B 1V5PA 1U27A 1DDMA 2R2OA 5C5BA 1E7VA 2K6QA 5JP4A 2KJRA 1RJ2A 1NI2A 2L8JA 2BYEA 2JPHA 2G35A 1UGMA 3ENEA 2W9NA 1R4MI 2KJ6A 3DVGY 2D10A 4P7IA 3PP2A 3T06A 4XWXA 3A9KB 3DDCB 3LJ3A 2N9XA 5E6NA 4HCNB 3VIAA 3ZUNA 3W1SA 3A33B 2RNRB 2JP2A 3CSTA 4HCPB 1QQGA 5EFXA 2LOZA 2MRPA 4IM3A 4FHKA 2O2VA 1A5RA 1Q67A 4KHBB 1XT9B 3TO1A 4BOZB 2PE9A 3PTFC 4G50A 4K7SA 3R7QA 3RZFA 4L6EA 1V5TA 3WAPA 2KXJA 2AL3A 4EZLA 4FLHA 4AP4C 2I5FA 3P7ZA 3WAMA 2C9WB 3V5WA 4ZRKA 4MGZE 4WQOB 2LASA 4RM9A 3RYTA 4DHZB 1WX9A 3T9LA 5KHOA 1Y19B 5D3XA 1S1QB 1J8CA 4CHJA 3B0AA 2BWFA 5GOWB 3DQVA 4GSWA 4LDTD 5CHVC 2KFKB 4F7GA 5DH9B 5C23A 2D9VA 4HB4B 5BO4B 3WA0A 2K8CA 2ROVA 5D3WA 2L76A 2O6VD 3V61A 3PVLA 3ZNGC 4B95A 1DROA 1IPGA 2JT4B 3DXCA 2MBEA 4GPTB 4IFSA 1NVLA 3BINA 1WG7A 2Z0PA 2M0XA 2N9EB 3DVGX 3HM3A 2NPTA 4K1RB 4YL8A 4A6FA 1WX7A 2LKOA 1TJ6A 3JSVB 3A9JA 2KLGA 3TVVA 3VAWA 2KMCA 3PEGA 1TGZB 3DXEA 3DBRI 3KH0A 3ML9A 4M0WB 4HHVA 1V9JA 2KD0A 3K9PB 4MEMA 3WIMA 2VKIA 2LVPA 2DHIA 3KZ1A 2L7RA 4D0NB 1TZ1A 2EKEC 2PEAA 1I2HA 2K00A 1U2BA 3A4RA 1PFJA 2L00B 1ZKHA 5E6OA 1W1GA 1OQNA 1HBKA 4WJ7A 1K8RB 2FIFA 2KC2A 3A9KA 3QC8B 1NTIA 3ULCA 3TMPB 4EKUA 2UZRA 3ONSA 2BKFA 2M14A 2OJRA 2RPQA 2NS5A 5C5BB 2ELBA 2Z0DB 3DBSA 1UPQA 5JHGA 1GNUA 3LDZE 1Q0WB 2FCMA 2KKCA 4NAWB 4HAYB 3V60A 4EOYA 1WIAA 2NBVB 2W2WA 2IY1B 4JL9A 3A1QA 2CY4A 1WJUA 1ZGUB 3M3JA 3MDBC 3R7RA 3D8EA 3NZSA 3W1SC 1RRBA 1ZC4B 1WXAA 1YJ1A 1MPHA 2Y5BB 3Q3JA 3TW1A 4FJZA 3SU8X 1P98A 3TL5A 4GXBA 5IA7A 1DDVA 3EFUA 3PRPB 3N32A 2LZ6A 3VXWA 1OEYJ 2MWSB 4HPMB 4GDKA 3ZIMA 3QHTA 2GBMA 2KJHB 3IHPC 2RD0A 4KHAA 2KTFA 1P3RA 5J3YA 1BT0A 1OGWA 4IWPA 3VHTC 3QK0A 2IYBA 1Z87A 1WH3A 4ANUA 3ODXA 4IC7B 4IAPA 3SUZA 2J0JA 1UBIA 5D2MB 1WE7A 2JVCA 2JZ3B 1GC6A 1DBHA 2FIDA 3RCPA 2C60A 3HW2B 2WYQA 1AQCA 2ZPYA 4PS7A 5HE1A 3P2BA 1IYFA 4M8NA 4DHJB 3D32A 1YX6B 2MBOA 3PHWB 2N23A 1U29A 1SE9A 4KHOA 3GZNI 3ML8A 3KRXA 2HD5B 2CKHB 4TV3A 5G2NA 1KM7A 2M8SA 4F7HA 2X18A 4PQ0A 4K7UA 5GMVA 3ZNID 4CHKA 1ZVRA 2KDFB 1FB8A 2LRUA 1X1FA 2IO0B 3ZNHB 1BTKA 2LWPA 3L0WB 5DCNA 2FJLA 1FHWA 2QKLA 4HK2A 3WAOA 2ROZB 4BKTA 2M4NA 2MBBB 4DWFA 5IJMA 4W9EA 1H8CA 3CXBB 4K81A 3HM6X 3APFA 2UWQA 4WWNA 4C0AA 3D8FA 4HB2B 4EUTA 1H4RA 4K2PA 2R2QA 2O6VB 4II2B 4GDLA 2FDQA 1B55A 2JRIB 4GU2A 2KLCA 2AEHA 2GS0A 4YONA 1KJTA 2CHXA 3VOQA 3ZDTA 1XX0A 2BGFA 4CHMA 4BFRA 4HPLB 1WJ6A 1KZ7A 1GUAB 2MW5A 5C16A 2RSGA 2IYDB 2KMAA 1T0YA 2N1VA 2QKMA 3H9DA 3L17A 3NHEB 3KRWA 2DHZA 4GIVA 4WJPA 4BKSA 1AWEA 1WGGA 4A6FB 3IFWB 4PS8A 1WGQA 3M1IB 2D9YA 3MPXA 4A6KA 5E6PA 1IRSA 2J7QB 3QWMA 1EUVB 1WI0A 5DPRA 1K5GB 2ZJDA 3BJIA 3AJ4A 2V76A 3G9WA 5J3TA 2NBWB 2GBKA 1H10A 2E2XA 4GGQA 4W9HA 4MSQB 2RVBB 3U8ZA 1V81A 4GMXB 1UNRA 4Y94A 1P6SA 2C5LC 4HXDA 1V2YA 2LYDA 2MFQA 5J17A 4M8MA 4OVUA 4HAVB 2JZZA 3PRMB 2KZRA 1LB1A 4HAXB 1L7YA 2ZCBA 4WJOA 3VTWA 5C1ZA 4MGKE 2XK5B 3L10B 2MCNB 1WFYA 4CO7A 3ZDMC 2J0MA 4IM0A 4MDKE 2Z0QA 2OTXA 5KQ4A 1BWNA 1CMXB 4NSWA 1MAIA 2L2IA 2J0KA 3ULBA 2FNJB 2KNBA 2DAJA 3TBLD 2ASQA 3PVWA 1WGUA 2N7EA 1X1GA 2IY0B 3PHXB 2HRJA 4LDTB 5D3YA 3VDZA 4XX5A 1TBEA 2C7NB 3KUZA 3SNHA 1ZSQA 1TTNA 2KDIA 3VQIA 3KW5B 1WI1A 4DK5A 2KTRA 4FJYA 3ZRFA 5EDSA 1NTYA 3A4SC 3IBEA 1U5DA 1YQBA 3A9JB 2O2VB 1EVHA 2CR5A 4NQKE 2K39A 3DOWA 1E8ZA 4WAAA 2P0FA 1U4AA 4NQLB 1VD2A 4ANXA 4HAUB 4ZYNA 3L13A 4HB0B 3RULA 3ECIA 4EZJA 2WX0A 4HVBA 5HE0A 1PQSA 4GOCA 2LOXA 2KWCA 2LULA 3PSCA 2MP2A 2KVRA 4GDKB 3RZWC 2DTCA 1QZEA 3IG3A 1NU2A 2A4ZA 2GMIC 2PE6B 2KN5A 3PRZA 2KK8A 4FHJA 3ZVVA 1ZM0A 2KFKA 4FBJB 4EMOA 2P8VA 2BYVE 3PLUA 1D3ZA 2RSUA 5D7GA 1X11A 2G3QB 2LGXA 5HE3A 3KVFB 3CMMB 4RMAA 2XQNM 5HE2A 2CB8A 1XQQA 1LFDA 2LXCA 2N0YA 4LCDE 1M7EA 2UZSA 5JLJB 2BKRB 3H6NA 4W9KA 1PMSA 2GJYA 5DHAB 1UELA 1X1MA 2MQJA 4DX90 1Z5SB 4HDQA 1V80A 4FULA 4BBNC 1X86A 4MH0E 1U5GA 5JH5C 1XODA 4JQWC 4W9DA 1FHOA 4W9FA 2MA9B 3S2AA 3MJWA 3VUWA 3VH4B 2KQ7A 4W9IA 1M94A 2K25A 1WJ1A 1J0WA 3RUIB 2MX2A 1I42A 2KCJA 3QBVB 2OOBB 5LONB 5JHHA 5D6JB 1WJ4A 2LI5A 2DYBA 4OVVA 2DAFA 4NNJB 3V6EB 3VH3B 4F8CB 1VCBA 3FEHA 3DBHI
chains in the Genus database with same CATH superfamily
3UIPB 2GCJA 2BYFA 4MM3A 1LM8B 1I35A 3AU4A 2ZPNA 1E7PB 2XBBC 2P0HA 1E8WA 2BW2A 5BMGA 2D07B 4ZRIA 2K22A 2BYTA 4NZLB 1JRPA 3AXCA 2QMTA 3M95A 2D2QA 4CYEA 2YS3A 1OQYA 2LBBA 4ILGB 3TEWA 3VFKA 3HIEA 2DZMA 2YS5A 1HZ5A 1UH6A 1KOTA 3GB1A 1C4AA 3MC0B 4K7WA 3KY9A 4MT5A 2MKRA 3RPFC 1XCGA 2RPVA 4WURA 5LXHA 1V88A 3P4SB 2WX1A 2CODA 1TY2A 2N9LA 3ZNZB 3KQ4A 4LK0M 4GN1A 4AJWA 2NPTB 2BB6A 3FC4A 3A8PA 2WLBA 4MJSB 4H8SA 4IOYX 1MJDA 3Q8CA 1C3TA 3WALA 1E10A 4P16A 3AEFB 4BBKA 2V3SA 2EMSA 1J19A 3TFMA 2R61A 3A8QA 1WX8A 4TKNA 1QC6A 2VRWB 4RF0A 2DENB 3R66C 1WGYA 2H7EA 2IGGA 3HQCA 4AQ7A 2ZZPB 5H8YE 2GOWA 4WAFA 2QIEB 1TJEA 3B2FA 3TEYA 3JYUA 3RNGC 1WY8A 1V86A 3UIOB 2BQQA 3M62B 5DPWA 1ET9A 1WGRA 3HK0A 4BVUC 3KYCD 2V1YA 3N30A 4BOSC 2FCSA 3AE8B 4JKCA 4MH8A 4XZ4A 3TSSA 3OANA 3EECA 2K8HA 1UNQA 5AZGA 2V3NA 3B77A 4JLCA 1WRDB 2PPHA 4WIPA 1KF6B 4G0NB 3UZTA 1I4HA 2L1AA 3NW8A 3V62A 4GZUA 1ISNA 1UEFA 1WYGA 1WM3A 2SEBD 2J42A 4A6HA 2Z14A 4M00A 1EGXA 3OJ4B 1C9FA 1R4NB 1DYNA 4L23A 3EFCA 3J9CA 5LLIA 3HSAA 3ODOA 1SHCA 3OHMB 4USAA 1EF1A 1SGHA 1V89A 3AE2B 4KIKB 4W9LA 2M38A 1NYQA 1WJNA 4DXGA 4ASWC 1QOGA 5LOPB 2PZ1A 3ZLZA 1ACCA 1WJMA 3TIXA 3PGEA 1AW7A 3C19A 3E9LA 4JKFA 4F1SA 2G1EA 1WE6A 2DX5A 4ZDVA 1QOAA 2COCA 2DNFA 4KDLB 5HFYA 1ESFA 1RFAA 1ZOYB 2KX0A 3BZDB 3H8HA 4OZAA 5CHFA 2MJ3A 3URYA 2IFSA 2N9PC 1EO6A 4HWIB 2EC1A 1ACAA 3SO6A 1KTKA 2AL6A 2XEWA 5FI0A 1XKEA 1SE2A 4MT7A 1W1HA 4HB3B 2BVCA 4A3PA 4ICUA 1V5MA 2LUMA 4L2YA 1GAQB 2RDHA 5C79A 2DKQA 3IAM1 2IBIB 2FUHB 3A1QB 3QQ8B 4EZKA 1QOFA 1YIWA 2H88B 1WM2A 3ZRCA 2YSZA 2P0DA 2RR9A 1E90A 2VH2A 3RT3B 1VBHA 2K2UA 3TJPA 1P5TA 2MSED 5AZFA 5FKAC 1C1YB 4II3B 4K17A 1LXDA 3HUIA 1F2RC 2VSZA 2UVMA 4X57B 3CSFA 2LVOA 1FAOA 3GP7A 3V3XA 1KC7A 2Q13A 1QLBB 2KDBA 1XD4A 3KYDD 4PYUA 2PVGC 4XC2A 2Z0OA 4EEWA 1WR1A 5D94A 4YT0B 2PTLA 1MIZB 1BUIC 1N6ZA 1DDMA 1NI2A 1D6EC 1T0QC 2G35A 1UGMA 2BYEA 2JPHA 5IOIA 2KJ6A 5GXGB 2D10A 2Q5WD 4EE2A 1RM6C 3VIAA 3E9SA 4LNFA 3A33B 4N59A 2X38A 2JP2A 3CSTA 4YTPB 5EFXA 4IM3A 2LOZA 2FBWB 1TS4A 4KHBB 1V1PA 4G50A 3RI7C 4L6EA 1FM0D 3AEAB 2I5FA 3WAMA 4MGZE 4ZRKA 4JKBA 2LASA 5C2TB 1S1QB 2BWFA 3DQVA 2KFKB 5BO4B 4B0EA 3ZNGC 2L76A 3NS1A 3V61A 3B9JA 4WH4A 3IXSA 4IFSA 1NVLA 2M0XA 1WG7A 1L5PA 2N9EB 3HM3A 4A3OA 4WWMA 3JSVB 2WNMA 2D3BA 2WXFA 2KLGA 3DBRI 4M0WB 4MEMA 2VKIA 2DHIA 4RF1A 2EKEC 2PEAA 3A4RA 1PFJA 3N9YC 3QC8B 3TMPB 1T6BX 3V60A 4HAYB 2GLSA 1WIAA 4D6WA 2CY4A 3M3JA 1RRBA 1ZC4B 3Q3JA 4FJZA 1D5MC 4A90A 1SIJA 3SU8X 4GXBA 5IA7A 3EFUA 2LZ6A 4C4VB 4GDKA 3ZIMA 2KJHB 2NTSA 3VHTC 1BT0A 1Z87A 1WH3A 1UBIA 3SUZA 2J0JA 2FIDA 3RCPA 2ZPYA 2AQ1B 5HE1A 3P2BA 1VBGA 1VZ7A 3PHWB 1SE9A 3GZNI 4Q2JA 1C77A 2CKHB 5JXVA 5G2NA 1KM7A 3ZNID 3R2IA 4PQ0A 5GMVA 4CHKA 3I63C 1ZP0B 4M02A 1F2RI 1YOVB 3U4EG 2LWPA 3ZNHB 1FHWA 3E56A 3P63A 5IJMA 1EWYC 3HM6X 4C0AA 4EUTA 1H4RA 4II2B 3Q8BA 1B55A 2GS0A 1L6VA 5FK9C 2AX5A 1GB1A 1YQ4B 2RDBC 2MW5A 2KMAA 3NHEB 3KRWA 1JALA 2DHZA 1AWEA 2MHJA 4PS8A 5HHDG 1IUEA 1WGQA 3M1IB 3LYYA 1IRSA 1KLGD 2ZJDA 3G9WA 5J3TA 2GBKA 1H10A 4W9HA 1V81A 4GMXB 1UNRA 5J17A 1V2YA 2LYDA 2MFQA 4M8MA 4OVUA 3VTWA 2Y3AA 4MGKE 2MCNB 2FJUB 3MJ5A 2J0MA 4MDKE 3NVYA 1CMXB 1BWNA 2L2IA 2ASQA 3PVWA 3VDZA 2N7EA 3AEEB 2IY0B 3HRDD 1TBEA 1HZ6A 3VR8B 4HKZE 1TTNA 3AB5A 3ZRFA 1CQVA 3IBEA 1U5DA 1YQBA 1EVHA 1JWMD 3DOWA 4US8A 2K49A 1P7FA 1KLUD 4NQLB 1UNSA 4YSYB 4HB0B 3RULA 1BMLC 3RZWC 2KVRA 3IG3A 4IW0A 3PRZA 4FHJA 2KK8A 1JMLA 2P8VA 2BYVE 1DOIA 2IJ0A 3KVFB 2XQNM 5HE2A 1TS2A 4ARCA 1LFDA 2SAKA 2N0YA 1SB3C 2EELA 4LCDE 4A6QA 1M7EA 4W9KA 1PMSA 2RDGA 1UELA 2MJEA 2KR0A 1X1MA 4DX90 1V80A 1EWCA 3Q8FA 4MH0E 5FR3A 1FHOA 3CWIA 2MA9B 3S2AA 3MJWA 3VUWA 2KQ7A 4W9IA 1J0WA 2KCJA 5LONB 5D6JB 1B1ZA 1VCBA 3PPAA 4A20A 2BWES 2DYQA 1SXTA 1B9RA 1XO3A 4WWPA 4QJ5B 1FO4A 1P0RA 1SBBB 4W9GA 3SV1A 4JIOU 1MG8A 3Q14C 1U5FA 3T3OA 1TXDA 4HSIA 4HDOA 2DKPA 2J53A 1NEKB 2INPE 5L81A 2WXOA 3W1YA 3L16A 1NVID 2ZNVC 1IBXB 2G4DB 2KANA 2OQBA 5AZHA 2YS1A 1RLFA 2WH5A 5FI1A 1OQQA 3V6CB 2MDXA 4HAWB 3LJUX 5D3VA 4REZA 4KGSA 2WHIA 3OJ3A 3HIZA 4J6IA 4LNIA 1FHXA 1FNWA 1VDVA 5IO9A 3W5VB 4KDIC 2JXTA 3WCQA 2PJHA 3TCAA 3U2SC 1LQBA 1MK9B 5EE0A 2PLPA 2DYMA 2WDVB 1OTRB 2W2XC 1AN8A 4OZBA 5AUKA 4PNKA 1J7AA 1YN3A 3ABVB 5JHAA 3ZTDA 3QAQA 2ZKMX 3AE3B 1MVKA 3U7ZA 1Q1OA 2VZKB 4AUQC 4C00A 4B6WA 2BS3B 2CQUA 1WMHB 4QJ4B 1F0ZA 2R0DA 3GYOA 4RGOS 2YRYA 2KTRB 2KAJA 1I4RA 4TYZA 1P1AA 3LXFA 4IUMB 1V6EA 2GRIA 4KVGB 2L1CA 3H7PB 2YT2A 1NDDA 2DX1A 1RAXA 4FADA 1EU4A 3NVVA 3B08A 4C4VA 2LEKA 4HEA1 2KHWB 2W55A 5AEKB 4XWWA 2JF5A 4KSKC 5JH5C 2IO2B 4Z2NA 3FP5A 4W9CA 4AOFA 4LJPB 3AE7B 2BF8B 2LD9A 4DDGD 4YWGG 5IAAC 4JK9A 2JY6A 2WDTB 1N5XA 2KQ4X 3KUDB 1HB8A 2G4SA 1YX5B 2KUPA 3OAWA 1C78A 1SSNA 2G45B 4GDLB 4AS1A 1GB4A 4KZ0A 2RQ1A 2LG1A 3V05A 2V3PA 3SYXA 1LW3A 2J59M 1CK1A 2QHOA 4ZHPA 2KC1A 3Q3FA 2KFJA 3BVGA 2D3AA 1FEHA 1IGCA 3M63B 5G55A 3AU5A 4IWOA 1Y5OA 1V1PB 2Y7BA 1F77A 3EC8A 2CHZA 4AWJA 3KLSX 5BYQA 2K8EA 3ZKJC 2D3GA 3I9V1 3NS8A 3ALBA 3CF6E 4PT5A 4P1CC 2WXJA 3DBHB 1TZOA 5TSSA 2D9XA 1P7EA 3E66A 3JVZX 4NAWA 4LJOB 4MM3B 1GJZA 2D9WA 2B3AA 3X23A 2N1WA 3DPDA 5CLLB 3RFZB 4HAZB 1DGJA 4JWSC 4NY0A 2QEJC 2EJ8A 4KV2A 2NCNA 2JRHA 2YLMA 2NVUI 1E0ZA 2DFKA 2ON8A 4I6PA 4OZCA 1I7AA 3DBLI 1FGYA 4KAXB 4WVFB 1TT5B 1Q5WB 4OVZA 1NBFC 1I7HA 1WGHA 4E3CA 1E6EB 3WANA 4IM2A 1STEA 2WXKA 2IO1B 1V5UA 1MHXA 2DHJA 2MP2B 4GNKB 2AWTA 5JZEB 3W2DA 4HRSA 4GMVA 2ONQA 4G11A 2E6XA 4YSZB 2CRFA 2WDRB 2ZW1A 2ZVOA 3N1ZC 2I38A 3R3MA 2Z59A 3H7PA 3BY4B 2C7HA 1N61A 2I2YA 1YN4A 3NY5A 3Q3OC 2K0PA 4FN2A 1OEYA 3KWLA 3W5UB 4JK8A 4P1BC 2V0GA 3QCAA 4BKSD 3WYFB 4L1RA 1MK7B 1V5PA 1U27A 1E7VA 2K6QA 2KJRA 1RJ2A 1M4VA 1YNTE 3ZYYX 3ENEA 2W9NA 3DVGY 4ACFA 2N7JA 4P7IA 4XWXA 3A9KB 3LJ3A 4HCNB 3ZUNA 2D3CA 4HCPB 5H92C 1QQGA 2MRPA 1BXTA 2O2VA 3A58A 1D5ZC 4BOZB 2PKOA 4K7SA 4TSSA 3RZFA 1JW9D 2KXJA 2PIAA 4AP4C 4BAXA 4JKGA 2C9WB 4DHZB 4XDCA 1WX9A 5KHOA 5D3XA 4GSWA 1C4CA 3LB8C 1PGBA 2ROVA 4HPPA 1LGRA 1DROA 2JT4B 2MBEA 4A6FA 1WX7A 1XLNA 3A9JA 4KX6B 1FXIA 2KMCA 2OEDA 3ML9A 3WIMA 1FCLA 3KZ1A 1YMHE 4D0NB 2K00A 5HI1A 2L00B 1ZKHA 1W1GA 4A8XC 2OJRA 2Z0DB 3DBSA 5C5BB 2ELBA 5FR6A 1GNUA 3DHIC 4JL9A 3R7RA 3A1QA 2EKIA 3W1SC 1FXAA 2Y5BB 3N1YC 1FMAD 3TL5A 1DIKA 4RH6A 1OEYJ 2GBMA 2KIGA 4KHAA 3QK0A 4ANUA 3ODXA 5D2MB 1WE7A 2JVCA 2JZ3B 3HW2B 4KKJA 3RNEC 4DHJB 3D32A 1YX6B 4KHOA 3KRXA 2HD5B 4ZOHC 2M8SA 4F7HA 2AQ3B 2K3UA 2MEKA 4K7UA 4BZAA 1ZVRA 4ILHA 3E9PA 1X1FA 1IGDA 2IO0B 2QKLA 4BKTA 2M4NA 1L4ZB 4K81A 3APFA 4DXFA 2UWQA 4WWNA 1L6UA 4HB2B 4GDLA 4HKQA 3AEGB 2QC8A 3PZ8A 4HPLB 1WJ6A 2ICIA 1KZ7A 1GUAB 2IYDB 2N1VA 3H9DA 1WGGA 2WXHA 1ZXHA 3TEZA 3IFWB 2W3RA 2D9YA 5E6PA 3QWMA 1WI0A 1K5GB 4GGQA 2E2XA 3GE3C 2RVBB 2WXMA 1ROEA 3DHGC 1AYFA 5BMHA 4HAVB 3PRMB 4WJOA 4LTUA 5C1ZA 2N0SB 3L10B 1WFYA 1K51A 1QF6A 3ZDMC 5MPOA 2KN4A 2Z0QA 5KQ4A 3TEXA 1VZ8A 2KNBA 1WGUA 3GS2A 1X1GA 3U52E 5D3YA 3PO0A 4XX5A 3KUZA 3SNHA 4DK5A 4DIXA 3KW5B 3ENBA 1NTYA 3A4SC 4N58A 4WAAA 2P0FA 4ANXA 4HAUB 2WX0A 4GOCA 2LOXA 2KWCA 2PVOD 2LULA 4GDKB 4J3OD 2WU5B 1CJEA 3AE9B 3PLUA 2LGXA 5HE3A 4RFBA 4RMAA 3I5JC 1OQRA 1XQQA 5JLJB 2UZSA 3H6NA 2GJYA 2IPKD 5DHAB 1I4QA 1Z5SB 4N6EB 4HDQA 4BBNC 1X86A 1ZDXA 1HTQA 2W3SA 5LG4B 2K25A 2MX2A 1WJ4A 4XGAB 4OVVA 2DAFA 3V6EB 4A55A 3VH3B 1TYGB 3FEHA 1BAKA 2N7DA 3EHVA 3PV1A 3FAHA 4DBGA 1UUPA 1ZW7A 4DHJD 1E5WA 3IVFA 1TIFA 4KHBA 1JWUD 3CIKA 4HATB 2KIEA 1UPRA 1AARA 2D4QA 4K3CA 5EE3A 2LRWA 3APCA 1HB6A 4M01A 1SJHD 3IAS1 2Z8LA 4ZRPA 3UINB 1VR9A 2RLOA 1V49A 2N4FA 2GCLA 3QX1A 2DA0A 2RRFA 4C56C 3UQBA 1YQ3B 3MHZA 3L4PA 2LUEA 2DWQA 3N7CA 2IGDA 1NENB 2WU2B 4HROA 4YXDB 3AEBB 2W2XD 3AULA 3Q69A 2D11A 4MGYE 3T3NA 4H2AA 3BWUD 3PT2B 3ZJVA 3IT4B 2Z13A 4FXCA 2RGNB 2L3ZA 1FFUA 3Q2AC 3UF8A 1L0XB 5CHWA 5G5GA 4EJNA 1SJED 2K1FA 2WWZA 1JRUA 4O1NA 5BYSA 4YTNB 2ZCCA 4GLSC 1XD3B 2AYOB 5DPSA 2V4LA 2D5GA 4YTMB 2WXIA 2ZEQA 5DHFB 1WXVA 1DDWA 1TY0A 4CO7A 4IWQA 4PK1A 2WXQA 2DZIA 2JZPA 3T8MA 4D2KA 1OY2A 5KQ1A 4E74A 1WZ3A 2MLBA 1JQ4A 2JWUA 4MELA 4PYZA 5DPTA 2VRRB 2HE7A 2L83A 2IZVB 1TS3A 1EAZA 2BB5A 1Y56A 2DZKA 2FCQA 3CIRB 4PS3A 3B1LX 1PLSA 1WXSA 2ZVNA 2GBJA 3OLMD 2LGYA 1WYWB 2K8BA 3MHSD 3SHQA 1WRIA 2H7DA 4JKGB 1ET6A 3N3KB 1E8XA 2JUOA 1BTNA 2COAA 4WJNA 2JWZA 4KGRA 1WXMA 4K2OA 2BPSA 2I1KA 4B9KA 1FGZA 3L08A 4Z2MB 1HTOA 3PREA 4FA6A 5TR5A 2JYTA 4ZRJA 1YJIA 2IDYA 3NJTA 5CX3A 3AE4B 2LFIA 2CU1A 4DX8A 1K52A 3VUXA 3APDA 3GYPA 1ZUD2 3AE5B 4JE3B 3X0WA 1UF0A 2BS2B 2COPA 4URKA 2AQ2B 2Y8FA 1KLVA 3NZUA 4KSLC 1Q10A 2UYZB 1KRHA 1T3QA 1WR6E 5L83A 2A5UA 3I3TB 1ZC3B 2KQSA 4ANVA 2N9KA 1XR0B 3HHMA 3JW0X 1ZPSA 4XYCA 4I6NB 4ICVA 3F0WA 1UBQA 1XLOA 3P6AA 4RM8A 2O6VA 2I5CA 2GBRA 2M17A 5I2SA 2ABDA 3F5RA 2WGSA 3GOEA 1XXGA 4IDIA 2NMBA 2OHFA 4KIKA 1K5DB 3VTVA 5KHQA 3PZDA 3QJZA 2DLWA 2DIKA 2KDEB 3EA6A 4JX1C 4BKGA 5DI9B 2B76B 1FOEA 2OJWA 3SEBA 3AECB 1UGJA 1E8YA 4IC7B 2DHKA 3ZW3A 1N62A 4QAYA 1UZXB 3OWEB 3L54A 1UD7A 2L0TA 2LHDA 1MI0A 2CAYA 3D8DA 4MGIE 1WMHA 2MBHA 3NSUA 2MWNB 3FSSA 4CQNA 1E7UA 1JWBD 2WXRA 1JROA 2KWUB 3KUCB 2RUKB 1L2NA 2Z0EB 1KI1B 4XE0A 1UNPA 1R4MB 2NBUA 2GBNA 2DX5B 3AV8A 3FM8C 5BMIA 3ZTCA 4TUUA 4JWUC 1WVHA 2H89B 2YVCA 1QQRA 2CY5A 4A5KA 2W82A 1HE8A 2HDEA 2JU6X 2BBCA 1GG3A 1PUTA 1NTVA 4QXAB 2WXGA 4WWOA 4LNNA 4F7UP 2ELAA 2COFA 2WS3B 3FKYA 2LMCA 5I4DA 1RRPB 1EF5A 5J18A 1FFVA 3DWGC 5L95C 4US9A 2JX5A 2R09A 2ACZB 1WSPA 3PG7A 3UGBB 1F9JA 1J7CA 2LXAA 2QCZA 2QDFA 2L8JA 2INCC 3PP2A 2N9XA 2X0SA 2RNRB 2V4IB 4ZRQA 2LJIA 4FHKA 2INNE 2PW9A 4ITKA 2DBYA 2PE9A 3R7QA 2AL3A 4EZLA 4FLHA 3P7ZA 4JKAA 3Q3MC 4WQOB 3RYTA 3T9LA 5G5HA 4CSQA 1J8CA 4CHJA 3B0AA 4LDTD 5GOWB 5CHVC 4F7GA 4HB4B 2CJOA 2O6VD 5D3WA 1IPGA 1I4GA 3NWAA 2M56B 2QSDA 1J7BA 3BINA 2Z0PA 4K1RB 3DVGX 2NPTA 4ZHOA 3NUHB 2LKOA 3PZ7A 1TJ6A 2GUMA 3VAWA 1TGZB 3DXEA 3KH0A 3Q3NC 2KD0A 2LGIA 3RNFC 1MHHE 2L7RA 4RGMA 1TZ1A 1I2HA 1U2BA 5E6OA 1HBKA 4WJ7A 1K8RB 1NTIA 3NRZA 2UZRA 3ONSA 2BKFA 2YEPF 2M14A 3TUOA 2NS5A 4ZYNA 1UPQA 5JHGA 3BVMA 4EOYA 2NBVB 2W2WA 2IY1B 5J2RA 1WJUA 1ZGUB 3MDBC 3D8EA 1WXAA 1MPHA 3TW1A 1I4PA 1PYWD 1P98A 1DDVA 3VXWA 2INDC 4HPMB 3IHPC 1WXQA 2RD0A 3ZQ4A 1OGWA 4IWPA 2IYBA 1PFDA 1MG4A 1DBHA 2WYQA 4PS7A 2C60A 3VRAB 4JKHA 4W9FA 2MBOA 2N23A 2L52A 3ML8A 2KDMA 1GPXA 1JWSD 4TV3A 4OT1A 2NMQA 2J4XA 2LRUA 3AMZA 2M0AA 3L0WB 4HJGE 4HK2A 1H8CA 4DWFA 4W9EA 3R2TA 2LHEA 3D8FA 1R7SA 2FDQA 2JRIB 4GU2A 2KLCA 2CHXA 3VOQA 3R8BA 4BFRA 2RSGA 1T0YA 4BKSA 1ZYIA 2JYEA 4A6KA 5AUIA 1JDEA 4JKEA 3BK1A 5DPRA 2FUG1 3BJIA 5E6JA 4MSQB 3ZXVA 1K53A 4ILJA 2C5LC 4LLGM 2KZRA 1LB1A 4HAXB 1HXYD 2ZCBA 2XK5B 1N60A 3NWDA 3AH7A 4S17A 1MAIA 2WDQB 3MFGA 1QOBA 2DAJA 3TBLD 4LDTB 4RNAA 3AEDB 2KWDA 3PHXB 2HRJA 2C7NB 2KDIA 1ZSQA 2KTRA 2WP9B 4WQMA 3A9JB 2K39A 2KUQA 1E8ZA 3BYYB 1FIQA 2K5PA 3L13A 3O13A 3EGRA 1PQSA 3RNBC 3P42A 2MP2A 3PSCA 2CJNA 1QZEA 1C76A 3I57A 1AWDA 1D3ZA 1ZM0A 2KFKA 3SFEB 4IKGA 1X11A 2G3QB 3AE1B 2CB8A 3NZ3A 2LXCA 2BKRB 2R2YA 4C80A 3NG0A 3SBGA 2MQJA 4FULA 1U5GA 1XODA 4JQWC 4W9DA 3W9CB 2LGSA 3MP9A 3VH4B 1WJ1A 3RUIB 1I42A 3QBVB 2IGHA 2QJLA 1WGKA 2Z4DA 4NNJB 5I2MA 2XK5A 3ZXRA 3H7SA 5BYRA 3QA8A 1P9DU 1E9MA 4DBBA 5D3DA 1W1DA 3ODWA 1ZDVA 1I4XA 3PS6A 3DVNV 4YSXB 3SDLC 1DOXA 2CS4A 3NOBA 3MTNB 1IBXA 4TQ1A 4IG7B 1PGAA 2KO3A 1D5XC 3P4PB 4C7YA 3N20C 5HG2A 3Q8EA 3SFDB 1SE4A 3HVZA 4DDID 1TKYA 4GOUA 1NYRA 4B0MA 4N9F4 3BVZA 4G3XB 1S3SG 1SIFA 2HJ1A 2YF0A 2VZKD 4EFOA 4MSMB 4DXAB 3PVUA 2Y5CA 4BBNF 3O65B 1Z2MA 4JGHB 5J3QA 1WF9A 1C4PA 4FJVB 1PGXA 2NZ8B 1FPYA 1NI3A 3SBTA 2CHWA 4I6LB 2DN6A 2D9ZA 3MC9A 1N3HA 2JXXA 3VR9B 1D4BA 3U30A 3RCZA 3EPYA 2K6DB 1VLBA 3VRBB 2REXA 2UU7A 2ZNVB 3AM9A 3FVCA 2M1MA 1LO5D 4NAMA 3P4QB 1X05A 3DVNU 1WZ0A 2L05A 3KSYA 4HLEA 2RGFA 2DLBA 1MKEA 4B6HA 3IT6B 5CLQB 2X8XX 3ETRA 1RFKA 3SD5A 4NJCA 1C79A 3FILA 2YT1A 2DZJA 2LVQA 1N5WA 3DCXA 1Y8RC 2YT0A 4OHJA 4NJ7A 1T0SC 3E9OA 3QIJA 2Y8GA 1G6JA 3VTUA 1A70A 3VVWB 4LNKA 4MACA 1YN5A 2HTHA 5T8IA 2E3TA 4MY6A 1OMWA 1R4NI 3MC8A 3K9OB 2W54A 2FAZA 2WXLA 1GOZA 1V5OA 5IKCM 2I1JA 1KZGA 3RD2A 1DOYA 1PDXA 1U5EA 5KCVA 1MPEA 1ST7A 3PLVA 3PSEB 4M0WA 3DBRB 3SR6A 3Q6BA 2TSSA 2DYNA 1T77A 2KWVB 2KX3A 1F1HA 5M4YB 5LNK1 4MK0A 3N1XC 2EMTA 1YD8U 2HJ8A 2M19A 3ZVRA 2GI9A 1FXTB 4HJKA 5IN7A 1QILA 3FLVA 3DXDA 2FCNA 2K2JA 3AN1A 4DHZE 4ZYSA 5D3IB 1ZXIA 4WJQA 4ANWA 5D27A 5IRSA 1MIXA 2IO3B 3Q8AA 4L1BA 3A98B 3VUYA 1XLPA 4AJYB 3H1UA 4F7ZA 2Z59B 2KGXB 1N63A 1ZE3D 1L4DB 2BT6A 4P6VF 4E71A 1EM7A 3QARA 2LJ5A 5DIFB 2V9HA 4GB9A 1P3QU 1MFWA 2NR2A 2R82A 4NJ6A 5HKHA 1V61A 2BCJA 3ML4A 1KH0A 2HTHB 5LXIB 2RMMA 3O96A 2KMMA 3QWZB 1IP9A 1JWAD 5EE9A 4C7ZA 2C7MB 3U12A 2DYOA 3JSVA 5JHBA 4JK7A 2FJ9A 2KT7A 1OFFA 2NBVA 3AI5A 1FCCC 1TQZA 4S0RA 2KOXA 3ZJTA 2LGDA 4KZCA 4W9JA 1T0RC 4KKIA 3C0RB 1FNUA 4NPNA 4DQOC 1V8CA 4WSFA 1F52A 3ZO5B 3OG5A 3DWMA 3U7DA 3ZGZA 1SE3A 1WGDA 5CTRC 3DCGA 4MJSA 5C6RA 2L0FA 1J0GA 1KFYB 3ZJUA 2MBQA 1M7RA 1KBLA 1XF5L 2K9XA 1TS5A 1L0YB 4TQ0A 1GC7A 3RNCC 2ZW0A 2ADZA 3GE8C 2R2OA 2YEPB 1QKZA 3BIID 5C5BA 5JP4A 2Y5PA 1R4MI 1MI1A 2GB1A 3T06A 3DDCB 3KWVA 4RGTA 1SEBD 5E6NA 3W1SA 1TKEA 1XCTL 2KYWA 1A5RA 1Q67A 1HEZE 1XT9B 3TO1A 2XN9C 3DBLB 3PTFC 3RMKC 1V5TA 3WAPA 3RNAC 3V5WA 1HQRD 2JQRB 4RM9A 1Y19B 2KACA 3BYTB 5DH9B 5C23A 2D9VA 3WA0A 2K8CA 4B95A 3PVLA 3DXCA 4GPTB 1XEEA 4YL8A 1ENFA 1FRDA 5EE1A 2MJDA 3TVVA 2MH7A 3PEGA 3GZNB 1QT9A 4HHVA 1V9JA 3BK2A 3K9PB 2LVPA 2J52A 2L32A 2FIFA 1OQNA 3A9KA 2KC2A 4JKDA 4LNOA 3ULCA 4EKUA 5IP4D 2JSVX 2RPQA 4ARIA 3LDZE 4NAWB 1Q0WB 2FCMA 2KKCA 2BS4B 3NZSA 3NWFA 1YJ1A 1FRRA 1JCKB 1EU3A 3C8YA 3EUB2 2PMVA 1L0VB 3PRPB 3N32A 1XCQL 2MWSB 3QHTA 2KTFA 1P3RA 5J3YA 4TMAB 2CU3A 2FE8A 4IAPA 1SF0A 1GC6A 1AQCA 1WWTA 4M8NA 4A9AA 3FILB 1XLQA 1U29A 4UDUC 2X18A 2NTTA 1V1OA 2KDFB 1FB8A 1BTKA 5DCNA 2FJLA 1RYJA 1FNVA 4RCOA 3WAOA 2ROZB 1DYQA 2MBBB 3CXBB 1UWXA 4K2PA 2G9HD 2O6VB 2R2QA 2AEHA 4YONA 1KJTA 3P4RB 3ZDTA 4KGTA 1XX0A 2BGFA 4CHMA 2WXPA 5C3JB 5C16A 4GIVA 2QKMA 3L17A 1VZ6A 4WJPA 3HVDA 4A6FB 2HTME 2VH1A 1V97A 3MPXA 2J7QB 3UQAA 1EUVB 3AJ4A 4XDDA 2V76A 2XNAC 2NBWB 1FD6A 1VRAB 3U8ZA 2QILA 1K50A 1IYFA 4Y94A 1P6SA 4HXDA 2JZZA 1L7YA 4IM0A 1T5XD 2OTXA 4NSWA 3ULBA 2J0KA 2FNJB 4RGNA 4OW0A 4XWTA 2BTEA 1TKGA 3VQIA 1WI1A 4FJYA 5EDSA 3RN9C 4JPSA 2KVZA 2O2VB 2CR5A 4NQKE 4IOIE 1RWSA 1U4AA 1VD2A 3DHHC 1VJKA 3ECIA 4EZJA 4HVBA 5HE0A 3B2GA 2DTCA 1NU2A 2A4ZA 2GMIC 2PE6B 1HA5A 2KN5A 4FBJB 3NVWA 3ZVVA 4EMOA 4QJ3B 2RSUA 5D7GA 3CMMB 2WXNA 1YJJA 2WQYB 1GGOA 1CZPA 3AE6B 4R3DA 4K3BA 3P1MA 1M94A 1UWMA 2OOBB 3NVZA 4OSNA 5JHHA 3UI3A 2LI5A 2DYBA 4F8CB 5JVLA 3DBHI
chains in the Genus database with same CATH topology
3UIPB 2GCJA 2BYFA 4MM3A 1LM8B 1I35A 3AU4A 2ZPNA 2XBBC 2P0HA 1E8WA 2D07B 4ZRIA 3AXCA 3M95A 2D2QA 4CYEA 2YS3A 1OQYA 2LBBA 4ILGB 3VFKA 2DZMA 2YS5A 1UH6A 1KOTA 4K7WA 3KY9A 2MKRA 5LXHA 1XCGA 1V88A 2WX1A 2CODA 3ZNZB 4GN1A 4AJWA 2NPTB 3A8PA 4MJSB 4H8SA 4IOYX 1C3TA 3WALA 4BBKA 2EMSA 1J19A 3TFMA 2V3SA 3A8QA 1WX8A 4TKNA 1QC6A 2VRWB 2DENB 3R66C 1WGYA 2H7EA 3HQCA 2ZZPB 2GOWA 3JYUA 1WY8A 1V86A 3UIOB 3M62B 5DPWA 1WGRA 3HK0A 4BVUC 3KYCD 2V1YA 3N30A 4BOSC 2FCSA 4JKCA 4XZ4A 3OANA 3EECA 2K8HA 1UNQA 5AZGA 4JLCA 1WRDB 2PPHA 4G0NB 3UZTA 3V62A 4GZUA 1ISNA 1UEFA 1WM3A 4A6HA 1EGXA 3OJ4B 1DYNA 5LLIA 3ODOA 1SHCA 1EF1A 1SGHA 1V89A 4KIKB 4W9LA 2M38A 1WJNA 4ASWC 5LOPB 2PZ1A 3ZLZA 1WJMA 3TIXA 3PGEA 3E9LA 4JKFA 4F1SA 1WE6A 2DX5A 4ZDVA 2COCA 4KDLB 1RFAA 2KX0A 5CHFA 2IFSA 2N9PC 1EO6A 4HWIB 2EC1A 1ACAA 3SO6A 2AL6A 2XEWA 5FI0A 1XKEA 4MT7A 1W1HA 4HB3B 4A3PA 4ICUA 1V5MA 5C79A 2DKQA 2FUHB 2IBIB 3A1QB 3QQ8B 4EZKA 1YIWA 1WM2A 3ZRCA 2YSZA 2P0DA 2RR9A 1E90A 3RT3B 1VBHA 2K2UA 3TJPA 1P5TA 2MSED 5AZFA 1C1YB 4II3B 4K17A 1LXDA 2VSZA 2UVMA 4X57B 3CSFA 2LVOA 1FAOA 1KC7A 2Q13A 2KDBA 1XD4A 3KYDD 4PYUA 4XC2A 2Z0OA 4EEWA 1WR1A 5D94A 1MIZB 1DDMA 1NI2A 2BYEA 2JPHA 2G35A 1UGMA 2KJ6A 2D10A 3VIAA 3A33B 2JP2A 3CSTA 5EFXA 4IM3A 2LOZA 4KHBB 4G50A 4L6EA 2I5FA 3WAMA 4MGZE 4ZRKA 4JKBA 2LASA 1S1QB 2BWFA 3DQVA 2KFKB 5BO4B 3ZNGC 2L76A 3V61A 4A3OA 4IFSA 1NVLA 1WG7A 2M0XA 2N9EB 3HM3A 3JSVB 2KLGA 3DBRI 4M0WB 4MEMA 2VKIA 2DHIA 2EKEC 2PEAA 3A4RA 1PFJA 3QC8B 3TMPB 3V60A 4HAYB 1WIAA 3M3JA 2CY4A 1RRBA 1ZC4B 3Q3JA 4FJZA 3SU8X 4GXBA 5IA7A 3EFUA 2LZ6A 4GDKA 3ZIMA 2KJHB 3VHTC 1BT0A 1Z87A 1WH3A 1UBIA 3SUZA 2J0JA 2FIDA 3RCPA 2ZPYA 5HE1A 3P2BA 1VBGA 3PHWB 1SE9A 3GZNI 2CKHB 5G2NA 1KM7A 3ZNID 4CHKA 4PQ0A 5GMVA 3ZNHB 2LWPA 1FHWA 5IJMA 3HM6X 4C0AA 4EUTA 1H4RA 4II2B 1B55A 2GS0A 2MW5A 2KMAA 3NHEB 3KRWA 2DHZA 1AWEA 4PS8A 1WGQA 3M1IB 1IRSA 2ZJDA 3G9WA 5J3TA 2GBKA 1H10A 4W9HA 1V81A 4GMXB 1UNRA 5J17A 1V2YA 2LYDA 2MFQA 4M8MA 4OVUA 3VTWA 4MGKE 2MCNB 2J0MA 4MDKE 1CMXB 1BWNA 2L2IA 2ASQA 3PVWA 3VDZA 2N7EA 2IY0B 1TBEA 1TTNA 3ZRFA 3IBEA 1U5DA 1YQBA 1EVHA 3DOWA 4NQLB 4HB0B 3RULA 3RZWC 2KVRA 4IW0A 3IG3A 3PRZA 4FHJA 2KK8A 2P8VA 2BYVE 3KVFB 2XQNM 5HE2A 1LFDA 4LCDE 2N0YA 1M7EA 4W9KA 1PMSA 1UELA 1X1MA 4DX90 1V80A 4MH0E 1FHOA 2MA9B 3S2AA 3MJWA 3VUWA 2KQ7A 4W9IA 1J0WA 2KCJA 5LONB 5D6JB 1VCBA 3PPAA 4A20A 2BWES 2DYQA 4WWPA 1P0RA 4W9GA 3SV1A 4JIOU 1MG8A 1U5FA 1TXDA 4HDOA 2DKPA 5L81A 3W1YA 3L16A 2ZNVC 2G4DB 2KANA 2OQBA 5AZHA 2YS1A 1RLFA 2WH5A 5FI1A 3V6CB 2MDXA 4HAWB 3LJUX 5D3VA 3OJ3A 3HIZA 4J6IA 1FHXA 4KDIC 2PJHA 3TCAA 1LQBA 1MK9B 2DYMA 1OTRB 2W2XC 4PNKA 5JHAA 3ZTDA 3QAQA 1Q1OA 4AUQC 4B6WA 2CQUA 1WMHB 2R0DA 3GYOA 2YRYA 2KTRB 4TYZA 1P1AA 4IUMB 1V6EA 4KVGB 2L1CA 3H7PB 1NDDA 2DX1A 1RAXA 4FADA 3B08A 2KHWB 5AEKB 2JF5A 4KSKC 5JH5C 2IO2B 4Z2NA 3FP5A 4W9CA 4AOFA 4LJPB 2BF8B 2LD9A 4DDGD 5IAAC 4JK9A 2JY6A 2WDTB 3KUDB 1HB8A 2G4SA 1YX5B 2KUPA 3OAWA 2G45B 4GDLB 4KZ0A 2RQ1A 2LG1A 3SYXA 1LW3A 2J59M 2QHOA 2KC1A 3Q3FA 2KFJA 3M63B 5G55A 3AU5A 4IWOA 1Y5OA 2Y7BA 3EC8A 2CHZA 4AWJA 3ZKJC 2D3GA 3NS8A 3ALBA 3CF6E 2D9XA 3E66A 3JVZX 4NAWA 4LJOB 1GJZA 2D9WA 2B3AA 3X23A 2N1WA 3DPDA 5CLLB 4HAZB 4NY0A 2EJ8A 4KV2A 2NCNA 2JRHA 2YLMA 2NVUI 2DFKA 4I6PA 1I7AA 3DBLI 1FGYA 4KAXB 4WVFB 1Q5WB 1NBFC 1WGHA 4E3CA 3WANA 4IM2A 2IO1B 1V5UA 2DHJA 2MP2B 2AWTA 5JZEB 4GMVA 4G11A 2CRFA 2ZVOA 3R3MA 3H7PA 3BY4B 2C7HA 3NY5A 4FN2A 1OEYA 4JK8A 3QCAA 4BKSD 3WYFB 1MK7B 1V5PA 1U27A 1E7VA 2K6QA 2KJRA 1RJ2A 3ENEA 2W9NA 3DVGY 4P7IA 4XWXA 3A9KB 3LJ3A 4HCNB 3ZUNA 4HCPB 1QQGA 2MRPA 2O2VA 4BOZB 4K7SA 3RZFA 2KXJA 4AP4C 4JKGA 2C9WB 4DHZB 1WX9A 5KHOA 5D3XA 4GSWA 2ROVA 1DROA 2JT4B 2MBEA 4A6FA 1WX7A 3A9JA 2KMCA 3ML9A 3WIMA 3KZ1A 4D0NB 2K00A 2L00B 1ZKHA 1W1GA 2OJRA 2Z0DB 5FR6A 5C5BB 2ELBA 3DBSA 1GNUA 4JL9A 3R7RA 3A1QA 3W1SC 2Y5BB 3TL5A 1DIKA 1OEYJ 2GBMA 4KHAA 3QK0A 4ANUA 3ODXA 5D2MB 1WE7A 2JVCA 2JZ3B 3HW2B 4DHJB 3D32A 1YX6B 4KHOA 3KRXA 2HD5B 2M8SA 4F7HA 4K7UA 1ZVRA 4ILHA 3E9PA 1X1FA 2IO0B 2QKLA 4BKTA 2M4NA 4K81A 3APFA 2UWQA 4WWNA 4HB2B 4GDLA 4HPLB 1WJ6A 1KZ7A 1GUAB 2IYDB 2N1VA 3H9DA 1WGGA 3IFWB 2D9YA 5E6PA 3QWMA 1WI0A 1K5GB 4GGQA 2E2XA 2RVBB 4HAVB 3PRMB 4WJOA 5C1ZA 3L10B 1WFYA 3ZDMC 2Z0QA 5KQ4A 2KNBA 1WGUA 1X1GA 5D3YA 4XX5A 3KUZA 3SNHA 4DK5A 3KW5B 3ENBA 1NTYA 3A4SC 4WAAA 2P0FA 4ANXA 4HAUB 2WX0A 4GOCA 2LOXA 2KWCA 2LULA 4GDKB 3PLUA 2LGXA 5HE3A 4RMAA 1XQQA 5JLJB 2UZSA 3H6NA 2GJYA 5DHAB 1Z5SB 4HDQA 4BBNC 1X86A 2K25A 2MX2A 1WJ4A 4OVVA 2DAFA 3V6EB 3VH3B 3FEHA 1BAKA 2N7DA 3EHVA 3PV1A 4DBGA 1ZW7A 4DHJD 1E5WA 3IVFA 3CIKA 4HATB 1UPRA 1AARA 2D4QA 2LRWA 3APCA 1HB6A 3UINB 2RLOA 1V49A 2N4FA 2GCLA 3QX1A 2DA0A 3UQBA 2LUEA 3N7CA 2W2XD 3AULA 2D11A 4MGYE 3PT2B 2RGNB 2L3ZA 3UF8A 5CHWA 4EJNA 2K1FA 2WWZA 1JRUA 2ZCCA 1XD3B 2AYOB 5DPSA 2V4LA 2ZEQA 5DHFB 1WXVA 1DDWA 4CO7A 4IWQA 2DZIA 3T8MA 1OY2A 5KQ1A 4E74A 1WZ3A 2MLBA 4MELA 4PYZA 5DPTA 2VRRB 2HE7A 2IZVB 1EAZA 2DZKA 2FCQA 4PS3A 3B1LX 1PLSA 1WXSA 2ZVNA 2GBJA 3OLMD 2LGYA 1WYWB 2K8BA 3MHSD 3SHQA 2H7DA 4JKGB 3N3KB 1E8XA 2JUOA 1BTNA 2COAA 4WJNA 2JWZA 1WXMA 4K2OA 2BPSA 2I1KA 4B9KA 1FGZA 3L08A 4Z2MB 3PREA 4FA6A 5TR5A 4ZRJA 5CX3A 2CU1A 4DX8A 3VUXA 3APDA 3GYPA 3X0WA 4URKA 2COPA 1KLVA 2Y8FA 3NZUA 4KSLC 2UYZB 1WR6E 5L83A 2A5UA 3I3TB 1ZC3B 2KQSA 4ANVA 1XR0B 3HHMA 3JW0X 4I6NB 4ICVA 3F0WA 1UBQA 3P6AA 4RM8A 2O6VA 2I5CA 2GBRA 2M17A 2ABDA 3F5RA 3GOEA 2NMBA 5KHQA 4KIKA 1K5DB 3VTVA 3PZDA 3QJZA 2DLWA 2DIKA 2KDEB 4BKGA 5DI9B 1FOEA 1E8YA 4IC7B 3ZW3A 2DHKA 1UZXB 3L54A 1UD7A 2L0TA 2CAYA 3D8DA 4MGIE 1WMHA 2MBHA 3NSUA 2MWNB 3FSSA 1E7UA 2KWUB 3KUCB 2RUKB 1L2NA 2Z0EB 1KI1B 1UNPA 2NBUA 2GBNA 2DX5B 3FM8C 3ZTCA 4TUUA 1WVHA 2YVCA 2CY5A 4A5KA 1HE8A 1GG3A 1NTVA 4WWOA 4F7UP 2ELAA 2COFA 1RRPB 1EF5A 5J18A 5L95C 2R09A 3PG7A 3UGBB 1F9JA 2LXAA 2L8JA 3PP2A 2N9XA 2X0SA 2RNRB 4FHKA 2PE9A 3R7QA 2AL3A 4EZLA 4FLHA 3P7ZA 4JKAA 4WQOB 3RYTA 3T9LA 1J8CA 4CHJA 3B0AA 4LDTD 5GOWB 5CHVC 4F7GA 4HB4B 2O6VD 5D3WA 1IPGA 3BINA 2Z0PA 4K1RB 3DVGX 2NPTA 2LKOA 1TJ6A 3VAWA 1TGZB 3DXEA 3KH0A 2KD0A 2L7RA 1TZ1A 1I2HA 1U2BA 5E6OA 1HBKA 4WJ7A 1K8RB 1NTIA 2UZRA 3ONSA 2BKFA 2M14A 2NS5A 4ZYNA 1UPQA 5JHGA 4EOYA 5J2RA 2NBVB 2W2WA 2IY1B 1WJUA 1ZGUB 3MDBC 3D8EA 1WXAA 1MPHA 3TW1A 1P98A 1DDVA 3VXWA 4HPMB 3IHPC 2RD0A 1OGWA 4IWPA 2IYBA 1DBHA 2WYQA 4PS7A 2C60A 4JKHA 4W9FA 2MBOA 2N23A 3ML8A 4TV3A 2LRUA 3L0WB 4HK2A 1H8CA 4DWFA 4W9EA 3D8FA 2FDQA 2JRIB 4GU2A 2KLCA 2CHXA 3VOQA 4BFRA 2RSGA 1T0YA 4BKSA 4A6KA 1JDEA 5DPRA 4JKEA 3BJIA 4MSQB 4ILJA 2C5LC 2KZRA 1LB1A 4HAXB 2ZCBA 2XK5B 1MAIA 2DAJA 3TBLD 4LDTB 3PHXB 2HRJA 2C7NB 2KDIA 1ZSQA 2KTRA 3A9JB 2K39A 1E8ZA 3L13A 1PQSA 2MP2A 3PSCA 1QZEA 1D3ZA 1ZM0A 2KFKA 1X11A 2G3QB 2CB8A 2LXCA 2BKRB 3SBGA 2MQJA 4FULA 1U5GA 1XODA 4JQWC 4W9DA 3VH4B 1WJ1A 3RUIB 1I42A 3QBVB 4NNJB 2XK5A 3H7SA 3QA8A 1P9DU 4DBBA 1W1DA 3ODWA 3PS6A 3DVNV 3SDLC 2CS4A 3NOBA 3MTNB 4TQ1A 4IG7B 2KO3A 4DDID 4N9F4 4G3XB 1S3SG 1SIFA 2YF0A 4EFOA 4MSMB 4DXAB 3PVUA 4BBNF 3O65B 1Z2MA 4JGHB 5J3QA 1WF9A 4FJVB 2NZ8B 3SBTA 2CHWA 4I6LB 2DN6A 2D9ZA 1N3HA 2JXXA 3U30A 3RCZA 3EPYA 2K6DB 2REXA 2ZNVB 2M1MA 1X05A 3DVNU 1WZ0A 2L05A 3KSYA 4HLEA 2RGFA 1MKEA 4B6HA 5CLQB 3SD5A 2YT1A 2DZJA 2LVQA 1Y8RC 2YT0A 4NJ7A 3E9OA 3QIJA 2Y8GA 1G6JA 3VTUA 3VVWB 2HTHA 4MY6A 1OMWA 1R4NI 3K9OB 2FAZA 1V5OA 2I1JA 1KZGA 3RD2A 1U5EA 5KCVA 1ST7A 3PLVA 3PSEB 2DYNA 2KX3A 2KWVB 4MK0A 2EMTA 1YD8U 2HJ8A 3ZVRA 1FXTB 4HJKA 3FLVA 3DXDA 2FCNA 2K2JA 4DHZE 4WJQA 4ANWA 5D27A 1MIXA 2IO3B 3A98B 3VUYA 4AJYB 3H1UA 4F7ZA 2Z59B 2KGXB 4E71A 3QARA 2LJ5A 5DIFB 4GB9A 1P3QU 2NR2A 2R82A 4NJ6A 5HKHA 1V61A 2BCJA 3ML4A 2HTHB 5LXIB 3O96A 3QWZB 1IP9A 2C7MB 2DYOA 3JSVA 5JHBA 4JK7A 2FJ9A 3AI5A 1TQZA 2KOXA 2LGDA 4KZCA 4W9JA 3C0RB 4NPNA 4WSFA 3ZO5B 3U7DA 1WGDA 5CTRC 3DCGA 4MJSA 5C6RA 2L0FA 1J0GA 2MBQA 1M7RA 1KBLA 4TQ0A 1GC7A 2ADZA 2R2OA 5C5BA 5JP4A 1R4MI 3T06A 3DDCB 5E6NA 3W1SA 1A5RA 1Q67A 1XT9B 3TO1A 3PTFC 1V5TA 3WAPA 3V5WA 4RM9A 1Y19B 5DH9B 5C23A 2D9VA 3WA0A 2K8CA 4B95A 3PVLA 3DXCA 4GPTB 4YL8A 3TVVA 3PEGA 4HHVA 1V9JA 3K9PB 2LVPA 2FIFA 1OQNA 3A9KA 2KC2A 4JKDA 3ULCA 4EKUA 2RPQA 3LDZE 4NAWB 1Q0WB 2FCMA 2KKCA 3NZSA 1YJ1A 3PRPB 3N32A 2MWSB 3QHTA 2KTFA 1P3RA 5J3YA 4IAPA 1GC6A 1AQCA 4M8NA 1U29A 2X18A 2KDFB 1FB8A 1BTKA 5DCNA 2FJLA 3WAOA 2ROZB 2MBBB 3CXBB 4K2PA 2R2QA 2O6VB 2AEHA 4YONA 1KJTA 3ZDTA 1XX0A 2BGFA 4CHMA 5C16A 4GIVA 2QKMA 3L17A 4WJPA 4A6FB 3MPXA 2J7QB 3UQAA 1EUVB 3AJ4A 2V76A 2NBWB 3U8ZA 1IYFA 4Y94A 1P6SA 4HXDA 2JZZA 1L7YA 4IM0A 2OTXA 4NSWA 3ULBA 2J0KA 2FNJB 3VQIA 1WI1A 4FJYA 5EDSA 2O2VB 2CR5A 4NQKE 1U4AA 1VD2A 4EZJA 3ECIA 4HVBA 5HE0A 2DTCA 1NU2A 2A4ZA 2GMIC 2PE6B 2KN5A 4FBJB 3ZVVA 4EMOA 2RSUA 5D7GA 3CMMB 1GGOA 1M94A 2OOBB 5JHHA 2LI5A 2DYBA 4F8CB 5JVLA 3DBHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PPA A;  3UIP B;  4A20 A;  2XK5 A;  1BAK A;  2BWE S;  2DYQ A;  2N7D A;  3EHV A;  3H7S A;  3PV1 A;  2GCJ A;  3QA8 A;  4DBG A;  2BYF A;  4MM3 A;  4WWP A;  1LM8 B;  1ZW7 A;  1P0R A;  4DHJ D;  1E5W A;  1I35 A;  3IVF A;  3AU4 A;  3SV1 A;  1P9D U;  4W9G A;  4JIO U;  1MG8 A;  4DBB A;  2ZPN A;  1U5F A;  1W1D A;  1TXD A;  3ODW A;  4HDO A;  2XBB C;  2DKP A;  3CIK A;  4HAT B;  2P0H A;  1E8W A;  1UPR A;  1AAR A;  2D07 B;  3PS6 A;  2D4Q A;  4ZRI A;  5L81 A;  3DVN V;  3L16 A;  3W1Y A;  3SDL C;  2CS4 A;  2ZNV C;  3NOB A;  2G4D B;  2KAN A;  3MTN B;  4TQ1 A;  2OQB A;  4IG7 B;  2LRW A;  3APC A;  1HB6 A;  5AZH A;  3AXC A;  2YS1 A;  2KO3 A;  2D2Q A;  1RLF A;  3M95 A;  4A3O A;  4CYE A;  3UIN B;  2WH5 A;  2RLO A;  2YS3 A;  5FI1 A;  1V49 A;  1OQY A;  2N4F A;  2LBB A;  4DDI D;  2GCL A;  3QX1 A;  2DA0 A;  3V6C B;  3VFK A;  2MDX A;  3UQB A;  4HAW B;  3LJU X;  5D3V A;  2DZM A;  4N9F 4;  2YS5 A;  3OJ3 A;  4G3X B;  1UH6 A;  2LUE A;  3HIZ A;  4J6I A;  3N7C A;  1FHX A;  1S3S G;  1SIF A;  1KOT A;  2YF0 A;  2W2X D;  3AUL A;  4KDI C;  4EFO A;  4K7W A;  2D11 A;  3KY9 A;  4MSM B;  4MGY E;  2MKR A;  4DXA B;  1XCG A;  3PVU A;  4BBN F;  5LXH A;  1V88 A;  3O65 B;  3PT2 B;  2PJH A;  1Z2M A;  3TCA A;  2WX1 A;  2RGN B;  2L3Z A;  4JGH B;  5J3Q A;  1WF9 A;  2COD A;  1LQB A;  4FJV B;  1MK9 B;  3UF8 A;  2NZ8 B;  5CHW A;  4EJN A;  2K1F A;  2CHW A;  3ZNZ B;  2DYM A;  2WWZ A;  4I6L B;  1JRU A;  2DN6 A;  1OTR B;  2W2X C;  2D9Z A;  4GN1 A;  1N3H A;  4PNK A;  2JXX A;  4AJW A;  3U30 A;  3RCZ A;  2NPT B;  3EPY A;  2K6D B;  3A8P A;  5JHA A;  2REX A;  4MJS B;  4H8S A;  4IOY X;  2ZCC A;  3ZTD A;  1XD3 B;  2AYO B;  5DPS A;  3QAQ A;  2V4L A;  2ZNV B;  1C3T A;  3WAL A;  2M1M A;  2ZEQ A;  5DHF B;  2EMS A;  1J19 A;  1X05 A;  3TFM A;  1DDW A;  3A8Q A;  4BBK A;  1WX8 A;  1WXV A;  2V3S A;  4TKN A;  3DVN U;  1QC6 A;  2VRW B;  1WZ0 A;  2DZI A;  2L05 A;  4IWQ A;  3T8M A;  3KSY A;  1G6J A;  1OY2 A;  5KQ1 A;  1Q1O A;  2DEN B;  4HLE A;  2RGF A;  3R66 C;  4E74 A;  1MKE A;  4B6H A;  1WGY A;  2H7E A;  1WZ3 A;  3HQC A;  2MLB A;  2ZZP B;  5CLQ B;  3SD5 A;  3UQA A;  2GOW A;  4AUQ C;  4B6W A;  4MEL A;  4PYZ A;  5DPT A;  3JYU A;  2CQU A;  1WMH B;  2YT1 A;  1WY8 A;  2HE7 A;  2DZJ A;  2LVQ A;  2VRR B;  1V86 A;  3UIO B;  2IZV B;  2R0D A;  3GYO A;  1Y8R C;  1EAZ A;  2YRY A;  2YT0 A;  2KTR B;  3M62 B;  5DPW A;  4NJ7 A;  1WGR A;  4TYZ A;  1P1A A;  4IUM B;  1V6E A;  3HK0 A;  4KVG B;  2DZK A;  2FCQ A;  3QIJ A;  2L1C A;  3H7P B;  4PS3 A;  4BVU C;  2Y8G A;  1NDD A;  3KYC D;  2V1Y A;  1PLS A;  2DX1 A;  1RAX A;  1WXS A;  3B1L X;  3N30 A;  3VTU A;  4BOS C;  2ZVN A;  2FCS A;  3VVW B;  4FAD A;  2GBJ A;  3B08 A;  3OLM D;  2LGY A;  1WYW B;  4XZ4 A;  2KHW B;  5AEK B;  2HTH A;  2JF5 A;  3OAN A;  4KSK C;  4MY6 A;  1OMW A;  4Z2N A;  3FP5 A;  1R4N I;  2IO2 B;  2K8B A;  3EEC A;  3K9O B;  3MHS D;  4W9C A;  2K8H A;  2H7D A;  3SHQ A;  2FAZ A;  4AOF A;  1UNQ A;  3N3K B;  5AZG A;  1E8X A;  4LJP B;  2JUO A;  1BTN A;  2COA A;  1V5O A;  4JLC A;  2BF8 B;  2I1J A;  2LD9 A;  4WJN A;  2JWZ A;  4DDG D;  5FR6 A;  1KZG A;  1WXM A;  1WRD B;  2PPH A;  4K2O A;  2BPS A;  2I1K A;  4B9K A;  1FGZ A;  3L08 A;  4G0N B;  1U5E A;  4Z2M B;  5KCV A;  3UZT A;  3PRE A;  3RD2 A;  1ST7 A;  3PLV A;  3PSE B;  5TR5 A;  4FA6 A;  4ZRJ A;  5IAA C;  3V62 A;  4GZU A;  1ISN A;  1UEF A;  2JY6 A;  5CX3 A;  2CU1 A;  2DYN A;  2KX3 A;  4DX8 A;  2KWV B;  2WDT B;  1HB8 A;  1WM3 A;  1YX5 B;  2G4S A;  3APD A;  3KUD B;  3GYP A;  3VUX A;  2KUP A;  3OAW A;  4A6H A;  4MK0 A;  1EGX A;  3X0W A;  2G45 B;  3OJ4 B;  2COP A;  4GDL B;  4URK A;  2Y8F A;  1KLV A;  3NZU A;  1DYN A;  4KZ0 A;  2RQ1 A;  2LG1 A;  2EMT A;  1YD8 U;  3SYX A;  5LLI A;  4KSL C;  1LW3 A;  2UYZ B;  2HJ8 A;  3ZVR A;  1WR6 E;  2J59 M;  1FXT B;  4HJK A;  3ODO A;  1SHC A;  2QHO A;  5L83 A;  1EF1 A;  2KC1 A;  3FLV A;  2A5U A;  3I3T B;  1ZC3 B;  3DXD A;  1SGH A;  1V89 A;  2K2J A;  2FCN A;  2KFJ A;  2KQS A;  3Q3F A;  4KIK B;  4ANV A;  5J2R A;  4DHZ E;  4W9L A;  3M63 B;  5G55 A;  3AU5 A;  1XR0 B;  2M38 A;  1WJN A;  4WJQ A;  4IWO A;  1Y5O A;  5D27 A;  3HHM A;  3JW0 X;  4ASW C;  4ANW A;  1MIX A;  2IO3 B;  2Y7B A;  4I6N B;  5LOP B;  2PZ1 A;  3EC8 A;  3ZLZ A;  4ICV A;  2CHZ A;  1WJM A;  3TIX A;  4AWJ A;  3F0W A;  1UBQ A;  3PGE A;  3P6A A;  3A98 B;  2O6V A;  2I5C A;  4RM8 A;  3VUY A;  3ZKJ C;  2D3G A;  4AJY B;  4F1S A;  3H1U A;  4F7Z A;  3ZW3 A;  2GBR A;  1WE6 A;  2Z59 B;  2KGX B;  2DX5 A;  2M17 A;  3ALB A;  3NS8 A;  4ZDV A;  2ABD A;  3F5R A;  2COC A;  3CF6 E;  4E71 A;  3GOE A;  3QAR A;  2NMB A;  5KHQ A;  4KDL B;  1K5D B;  2LJ5 A;  2D9X A;  3PZD A;  5DIF B;  4KIK A;  3QJZ A;  3VTV A;  1RFA A;  2KX0 A;  3JVZ X;  4GB9 A;  1P3Q U;  2DLW A;  2KDE B;  2NR2 A;  4NAW A;  4BKG A;  4LJO B;  5DI9 B;  5CHF A;  1FOE A;  2IFS A;  2N9P C;  4NJ6 A;  1EO6 A;  5HKH A;  1GJZ A;  1V61 A;  1E8Y A;  4HWI B;  2D9W A;  2DHK A;  2B3A A;  3X23 A;  2N1W A;  2BCJ A;  3ML4 A;  2EC1 A;  1ACA A;  4HAZ B;  5CLL B;  4NY0 A;  3DPD A;  2EJ8 A;  2HTH B;  3SO6 A;  1UZX B;  2AL6 A;  4KV2 A;  5LXI B;  2NCN A;  2XEW A;  2JRH A;  3L54 A;  5FI0 A;  3O96 A;  1UD7 A;  2L0T A;  3QWZ B;  2YLM A;  2NVU I;  1XKE A;  1IP9 A;  2DFK A;  4MT7 A;  2CAY A;  1W1H A;  3D8D A;  4HB3 B;  4I6P A;  4MGI E;  4ICU A;  1WMH A;  4A3P A;  1I7A A;  1V5M A;  3NSU A;  2MBH A;  2C7M B;  3DBL I;  1FGY A;  2MWN B;  3FSS A;  4KAX B;  2DYO A;  3JSV A;  5C79 A;  5JHB A;  2DKQ A;  2FJ9 A;  4WVF B;  1E7U A;  2FUH B;  2IBI B;  1Q5W B;  3A1Q B;  3AI5 A;  1YIW A;  3QQ8 B;  4EZK A;  1WM2 A;  2KWU B;  3KUC B;  3ZRC A;  2RUK B;  1NBF C;  1L2N A;  1TQZ A;  1WGH A;  2Z0E B;  2KOX A;  4E3C A;  1KI1 B;  2LGD A;  2YSZ A;  2P0D A;  4KZC A;  2RR9 A;  1E90 A;  4W9J A;  3RT3 B;  3C0R B;  1UNP A;  2NBU A;  2K2U A;  4IM2 A;  4NPN A;  1P5T A;  3TJP A;  3WAN A;  2GBN A;  2IO1 B;  2DX5 B;  4WSF A;  2MSE D;  1V5U A;  5AZF A;  3FM8 C;  1C1Y B;  4II3 B;  4TUU A;  2DHJ A;  3ZTC A;  1WVH A;  4K17 A;  1LXD A;  3ZO5 B;  2MP2 B;  2YVC A;  2AWT A;  5JZE B;  2CY5 A;  3U7D A;  4GMV A;  2VSZ A;  4G11 A;  1WGD A;  2UVM A;  2CRF A;  4A5K A;  2ZVO A;  4X57 B;  5CTR C;  1HE8 A;  3CSF A;  3DCG A;  3R3M A;  4MJS A;  5C6R A;  2L0F A;  2LVO A;  1GG3 A;  1FAO A;  1J0G A;  3H7P A;  3BY4 B;  2C7H A;  1NTV A;  2MBQ A;  4WWO A;  3NY5 A;  1M7R A;  4FN2 A;  1OEY A;  4F7U P;  2ELA A;  2COF A;  2Q13 A;  1RRP B;  2KDB A;  1EF5 A;  3QCA A;  5J18 A;  1XD4 A;  5L95 C;  4TQ0 A;  3KYD D;  1GC7 A;  4PYU A;  2R09 A;  4XC2 A;  4IW0 A;  4BKS D;  2Z0O A;  3WYF B;  4EEW A;  3PG7 A;  1WR1 A;  3UGB B;  2ADZ A;  5D94 A;  1F9J A;  1MIZ B;  2LXA A;  1MK7 B;  1V5P A;  1U27 A;  1DDM A;  2R2O A;  5C5B A;  1E7V A;  2K6Q A;  5JP4 A;  2KJR A;  1RJ2 A;  1NI2 A;  2L8J A;  2BYE A;  2JPH A;  2G35 A;  1UGM A;  3ENE A;  2W9N A;  1R4M I;  2KJ6 A;  3DVG Y;  2D10 A;  4P7I A;  3PP2 A;  3T06 A;  4XWX A;  3A9K B;  3DDC B;  3LJ3 A;  2N9X A;  5E6N A;  4HCN B;  3VIA A;  3ZUN A;  3W1S A;  3A33 B;  2RNR B;  2JP2 A;  3CST A;  4HCP B;  1QQG A;  5EFX A;  2LOZ A;  2MRP A;  4IM3 A;  4FHK A;  2O2V A;  1A5R A;  1Q67 A;  4KHB B;  1XT9 B;  3TO1 A;  4BOZ B;  2PE9 A;  3PTF C;  4G50 A;  4K7S A;  3R7Q A;  3RZF A;  4L6E A;  1V5T A;  3WAP A;  2KXJ A;  2AL3 A;  4EZL A;  4FLH A;  4AP4 C;  2I5F A;  3P7Z A;  3WAM A;  2C9W B;  3V5W A;  4ZRK A;  4MGZ E;  4WQO B;  2LAS A;  4RM9 A;  3RYT A;  4DHZ B;  1WX9 A;  3T9L A;  5KHO A;  1Y19 B;  5D3X A;  1S1Q B;  1J8C A;  4CHJ A;  3B0A A;  2BWF A;  5GOW B;  3DQV A;  4GSW A;  4LDT D;  5CHV C;  2KFK B;  4F7G A;  5DH9 B;  5C23 A;  2D9V A;  4HB4 B;  5BO4 B;  3WA0 A;  2K8C A;  2ROV A;  5D3W A;  2L76 A;  2O6V D;  3V61 A;  3PVL A;  3ZNG C;  4B95 A;  1DRO A;  1IPG A;  2JT4 B;  3DXC A;  2MBE A;  4GPT B;  4IFS A;  1NVL A;  3BIN A;  1WG7 A;  2Z0P A;  2M0X A;  2N9E B;  3DVG X;  3HM3 A;  2NPT A;  4K1R B;  4YL8 A;  4A6F A;  1WX7 A;  2LKO A;  1TJ6 A;  3JSV B;  3A9J A;  2KLG A;  3TVV A;  3VAW A;  2KMC A;  3PEG A;  1TGZ B;  3DXE A;  3DBR I;  3KH0 A;  3ML9 A;  4M0W B;  4HHV A;  1V9J A;  2KD0 A;  3K9P B;  4MEM A;  3WIM A;  2VKI A;  2LVP A;  2DHI A;  3KZ1 A;  2L7R A;  4D0N B;  1TZ1 A;  2EKE C;  2PEA A;  1I2H A;  2K00 A;  1U2B A;  3A4R A;  1PFJ A;  2L00 B;  1ZKH A;  5E6O A;  1W1G A;  1OQN A;  1HBK A;  4WJ7 A;  1K8R B;  2FIF A;  2KC2 A;  3A9K A;  3QC8 B;  1NTI A;  3ULC A;  3TMP B;  4EKU A;  2UZR A;  3ONS A;  2BKF A;  2M14 A;  2OJR A;  2RPQ A;  2NS5 A;  5C5B B;  2ELB A;  2Z0D B;  3DBS A;  1UPQ A;  5JHG A;  1GNU A;  3LDZ E;  1Q0W B;  2FCM A;  2KKC A;  4NAW B;  4HAY B;  3V60 A;  4EOY A;  1WIA A;  2NBV B;  2W2W A;  2IY1 B;  4JL9 A;  3A1Q A;  2CY4 A;  1WJU A;  1ZGU B;  3M3J A;  3MDB C;  3R7R A;  3D8E A;  3NZS A;  3W1S C;  1RRB A;  1ZC4 B;  1WXA A;  1YJ1 A;  1MPH A;  2Y5B B;  3Q3J A;  3TW1 A;  4FJZ A;  3SU8 X;  1P98 A;  3TL5 A;  4GXB A;  5IA7 A;  1DDV A;  3EFU A;  3PRP B;  3N32 A;  2LZ6 A;  3VXW A;  1OEY J;  2MWS B;  4HPM B;  4GDK A;  3ZIM A;  3QHT A;  2GBM A;  2KJH B;  3IHP C;  2RD0 A;  4KHA A;  2KTF A;  1P3R A;  5J3Y A;  1BT0 A;  1OGW A;  4IWP A;  3VHT C;  3QK0 A;  2IYB A;  1Z87 A;  1WH3 A;  4ANU A;  3ODX A;  4IC7 B;  4IAP A;  3SUZ A;  2J0J A;  1UBI A;  5D2M B;  1WE7 A;  2JVC A;  2JZ3 B;  1GC6 A;  1DBH A;  2FID A;  3RCP A;  2C60 A;  3HW2 B;  2WYQ A;  1AQC A;  2ZPY A;  4PS7 A;  5HE1 A;  3P2B A;  1IYF A;  4M8N A;  4DHJ B;  3D32 A;  1YX6 B;  2MBO A;  3PHW B;  2N23 A;  1U29 A;  1SE9 A;  4KHO A;  3GZN I;  3ML8 A;  3KRX A;  2HD5 B;  2CKH B;  4TV3 A;  5G2N A;  1KM7 A;  2M8S A;  4F7H A;  2X18 A;  4PQ0 A;  4K7U A;  5GMV A;  3ZNI D;  4CHK A;  1ZVR A;  2KDF B;  1FB8 A;  2LRU A;  1X1F A;  2IO0 B;  3ZNH B;  1BTK A;  2LWP A;  3L0W B;  5DCN A;  2FJL A;  1FHW A;  2QKL A;  4HK2 A;  3WAO A;  2ROZ B;  4BKT A;  2M4N A;  2MBB B;  4DWF A;  5IJM A;  4W9E A;  1H8C A;  3CXB B;  4K81 A;  3HM6 X;  3APF A;  2UWQ A;  4WWN A;  4C0A A;  3D8F A;  4HB2 B;  4EUT A;  1H4R A;  4K2P A;  2R2Q A;  2O6V B;  4II2 B;  4GDL A;  2FDQ A;  1B55 A;  2JRI B;  4GU2 A;  2KLC A;  2AEH A;  2GS0 A;  4YON A;  1KJT A;  2CHX A;  3VOQ A;  3ZDT A;  1XX0 A;  2BGF A;  4CHM A;  4BFR A;  4HPL B;  1WJ6 A;  1KZ7 A;  1GUA B;  2MW5 A;  5C16 A;  2RSG A;  2IYD B;  2KMA A;  1T0Y A;  2N1V A;  2QKM A;  3H9D A;  3L17 A;  3NHE B;  3KRW A;  2DHZ A;  4GIV A;  4WJP A;  4BKS A;  1AWE A;  1WGG A;  4A6F B;  3IFW B;  4PS8 A;  1WGQ A;  3M1I B;  2D9Y A;  3MPX A;  4A6K A;  5E6P A;  1IRS A;  2J7Q B;  3QWM A;  1EUV B;  1WI0 A;  5DPR A;  1K5G B;  2ZJD A;  3BJI A;  3AJ4 A;  2V76 A;  3G9W A;  5J3T A;  2NBW B;  2GBK A;  1H10 A;  2E2X A;  4GGQ A;  4W9H A;  4MSQ B;  2RVB B;  3U8Z A;  1V81 A;  4GMX B;  1UNR A;  4Y94 A;  1P6S A;  2C5L C;  4HXD A;  1V2Y A;  2LYD A;  2MFQ A;  5J17 A;  4M8M A;  4OVU A;  4HAV B;  2JZZ A;  3PRM B;  2KZR A;  1LB1 A;  4HAX B;  1L7Y A;  2ZCB A;  4WJO A;  3VTW A;  5C1Z A;  4MGK E;  2XK5 B;  3L10 B;  2MCN B;  1WFY A;  4CO7 A;  3ZDM C;  2J0M A;  4IM0 A;  4MDK E;  2Z0Q A;  2OTX A;  5KQ4 A;  1BWN A;  1CMX B;  4NSW A;  1MAI A;  2L2I A;  2J0K A;  3ULB A;  2FNJ B;  2KNB A;  2DAJ A;  3TBL D;  2ASQ A;  3PVW A;  1WGU A;  2N7E A;  1X1G A;  2IY0 B;  3PHX B;  2HRJ A;  4LDT B;  5D3Y A;  3VDZ A;  4XX5 A;  1TBE A;  2C7N B;  3KUZ A;  3SNH A;  1ZSQ A;  1TTN A;  2KDI A;  3VQI A;  3KW5 B;  1WI1 A;  4DK5 A;  2KTR A;  4FJY A;  3ZRF A;  5EDS A;  1NTY A;  3A4S C;  3IBE A;  1U5D A;  1YQB A;  3A9J B;  2O2V B;  1EVH A;  2CR5 A;  4NQK E;  2K39 A;  3DOW A;  1E8Z A;  4WAA A;  2P0F A;  1U4A A;  4NQL B;  1VD2 A;  4ANX A;  4HAU B;  4ZYN A;  3L13 A;  4HB0 B;  3RUL A;  3ECI A;  4EZJ A;  2WX0 A;  4HVB A;  5HE0 A;  1PQS A;  4GOC A;  2LOX A;  2KWC A;  2LUL A;  3PSC A;  2MP2 A;  2KVR A;  4GDK B;  3RZW C;  2DTC A;  1QZE A;  3IG3 A;  1NU2 A;  2A4Z A;  2GMI C;  2PE6 B;  2KN5 A;  3PRZ A;  2KK8 A;  4FHJ A;  3ZVV A;  1ZM0 A;  2KFK A;  4FBJ B;  4EMO A;  2P8V A;  2BYV E;  3PLU A;  1D3Z A;  2RSU A;  5D7G A;  1X11 A;  2G3Q B;  2LGX A;  5HE3 A;  3KVF B;  3CMM B;  4RMA A;  2XQN M;  5HE2 A;  2CB8 A;  1XQQ A;  1LFD A;  2LXC A;  2N0Y A;  4LCD E;  1M7E A;  2UZS A;  5JLJ B;  2BKR B;  3H6N A;  4W9K A;  1PMS A;  2GJY A;  5DHA B;  1UEL A;  1X1M A;  2MQJ A;  4DX9 0;  1Z5S B;  4HDQ A;  1V80 A;  4FUL A;  4BBN C;  1X86 A;  4MH0 E;  1U5G A;  5JH5 C;  1XOD A;  4JQW C;  4W9D A;  1FHO A;  4W9F A;  2MA9 B;  3S2A A;  3MJW A;  3VUW A;  3VH4 B;  2KQ7 A;  4W9I A;  1M94 A;  2K25 A;  1WJ1 A;  1J0W A;  3RUI B;  2MX2 A;  1I42 A;  2KCJ A;  3QBV B;  2OOB B;  5LON B;  5JHH A;  5D6J B;  1WJ4 A;  2LI5 A;  2DYB A;  4OVV A;  2DAF A;  4NNJ B;  3V6E B;  3VH3 B;  4F8C B;  1VCB A;  3FEH A;  3DBH I; 
#chains in the Genus database with same CATH topology
 3UIP B;  2GCJ A;  2BYF A;  4MM3 A;  1LM8 B;  1I35 A;  3AU4 A;  2ZPN A;  1E7P B;  2XBB C;  2P0H A;  1E8W A;  2BW2 A;  5BMG A;  2D07 B;  4ZRI A;  2K22 A;  2BYT A;  4NZL B;  1JRP A;  3AXC A;  2QMT A;  3M95 A;  2D2Q A;  4CYE A;  2YS3 A;  1OQY A;  2LBB A;  4ILG B;  3TEW A;  3VFK A;  3HIE A;  2DZM A;  2YS5 A;  1HZ5 A;  1UH6 A;  1KOT A;  3GB1 A;  1C4A A;  3MC0 B;  4K7W A;  3KY9 A;  4MT5 A;  2MKR A;  3RPF C;  1XCG A;  2RPV A;  4WUR A;  5LXH A;  1V88 A;  3P4S B;  2WX1 A;  2COD A;  1TY2 A;  2N9L A;  3ZNZ B;  3KQ4 A;  4LK0 M;  4GN1 A;  4AJW A;  2NPT B;  2BB6 A;  3FC4 A;  3A8P A;  2WLB A;  4MJS B;  4H8S A;  4IOY X;  1MJD A;  3Q8C A;  1C3T A;  3WAL A;  1E10 A;  4P16 A;  3AEF B;  4BBK A;  2V3S A;  2EMS A;  1J19 A;  3TFM A;  2R61 A;  3A8Q A;  1WX8 A;  4TKN A;  1QC6 A;  2VRW B;  4RF0 A;  2DEN B;  3R66 C;  1WGY A;  2H7E A;  2IGG A;  3HQC A;  4AQ7 A;  2ZZP B;  5H8Y E;  2GOW A;  4WAF A;  2QIE B;  1TJE A;  3B2F A;  3TEY A;  3JYU A;  3RNG C;  1WY8 A;  1V86 A;  3UIO B;  2BQQ A;  3M62 B;  5DPW A;  1ET9 A;  1WGR A;  3HK0 A;  4BVU C;  3KYC D;  2V1Y A;  3N30 A;  4BOS C;  2FCS A;  3AE8 B;  4JKC A;  4MH8 A;  4XZ4 A;  3TSS A;  3OAN A;  3EEC A;  2K8H A;  1UNQ A;  5AZG A;  2V3N A;  3B77 A;  4JLC A;  1WRD B;  2PPH A;  4WIP A;  1KF6 B;  4G0N B;  3UZT A;  1I4H A;  2L1A A;  3NW8 A;  3V62 A;  4GZU A;  1ISN A;  1UEF A;  1WYG A;  1WM3 A;  2SEB D;  2J42 A;  4A6H A;  2Z14 A;  4M00 A;  1EGX A;  3OJ4 B;  1C9F A;  1R4N B;  1DYN A;  4L23 A;  3EFC A;  3J9C A;  5LLI A;  3HSA A;  3ODO A;  1SHC A;  3OHM B;  4USA A;  1EF1 A;  1SGH A;  1V89 A;  3AE2 B;  4KIK B;  4W9L A;  2M38 A;  1NYQ A;  1WJN A;  4DXG A;  4ASW C;  1QOG A;  5LOP B;  2PZ1 A;  3ZLZ A;  1ACC A;  1WJM A;  3TIX A;  3PGE A;  1AW7 A;  3C19 A;  3E9L A;  4JKF A;  4F1S A;  2G1E A;  1WE6 A;  2DX5 A;  4ZDV A;  1QOA A;  2COC A;  2DNF A;  4KDL B;  5HFY A;  1ESF A;  1RFA A;  1ZOY B;  2KX0 A;  3BZD B;  3H8H A;  4OZA A;  5CHF A;  2MJ3 A;  3URY A;  2IFS A;  2N9P C;  1EO6 A;  4HWI B;  2EC1 A;  1ACA A;  3SO6 A;  1KTK A;  2AL6 A;  2XEW A;  5FI0 A;  1XKE A;  1SE2 A;  4MT7 A;  1W1H A;  4HB3 B;  2BVC A;  4A3P A;  4ICU A;  1V5M A;  2LUM A;  4L2Y A;  1GAQ B;  2RDH A;  5C79 A;  2DKQ A;  3IAM 1;  2IBI B;  2FUH B;  3A1Q B;  3QQ8 B;  4EZK A;  1QOF A;  1YIW A;  2H88 B;  1WM2 A;  3ZRC A;  2YSZ A;  2P0D A;  2RR9 A;  1E90 A;  2VH2 A;  3RT3 B;  1VBH A;  2K2U A;  3TJP A;  1P5T A;  2MSE D;  5AZF A;  5FKA C;  1C1Y B;  4II3 B;  4K17 A;  1LXD A;  3HUI A;  1F2R C;  2VSZ A;  2UVM A;  4X57 B;  3CSF A;  2LVO A;  1FAO A;  3GP7 A;  3V3X A;  1KC7 A;  2Q13 A;  1QLB B;  2KDB A;  1XD4 A;  3KYD D;  4PYU A;  2PVG C;  4XC2 A;  2Z0O A;  4EEW A;  1WR1 A;  5D94 A;  4YT0 B;  2PTL A;  1MIZ B;  1BUI C;  1N6Z A;  1DDM A;  1NI2 A;  1D6E C;  1T0Q C;  2G35 A;  1UGM A;  2BYE A;  2JPH A;  5IOI A;  2KJ6 A;  5GXG B;  2D10 A;  2Q5W D;  4EE2 A;  1RM6 C;  3VIA A;  3E9S A;  4LNF A;  3A33 B;  4N59 A;  2X38 A;  2JP2 A;  3CST A;  4YTP B;  5EFX A;  4IM3 A;  2LOZ A;  2FBW B;  1TS4 A;  4KHB B;  1V1P A;  4G50 A;  3RI7 C;  4L6E A;  1FM0 D;  3AEA B;  2I5F A;  3WAM A;  4MGZ E;  4ZRK A;  4JKB A;  2LAS A;  5C2T B;  1S1Q B;  2BWF A;  3DQV A;  2KFK B;  5BO4 B;  4B0E A;  3ZNG C;  2L76 A;  3NS1 A;  3V61 A;  3B9J A;  4WH4 A;  3IXS A;  4IFS A;  1NVL A;  2M0X A;  1WG7 A;  1L5P A;  2N9E B;  3HM3 A;  4A3O A;  4WWM A;  3JSV B;  2WNM A;  2D3B A;  2WXF A;  2KLG A;  3DBR I;  4M0W B;  4MEM A;  2VKI A;  2DHI A;  4RF1 A;  2EKE C;  2PEA A;  3A4R A;  1PFJ A;  3N9Y C;  3QC8 B;  3TMP B;  1T6B X;  3V60 A;  4HAY B;  2GLS A;  1WIA A;  4D6W A;  2CY4 A;  3M3J A;  1RRB A;  1ZC4 B;  3Q3J A;  4FJZ A;  1D5M C;  4A90 A;  1SIJ A;  3SU8 X;  4GXB A;  5IA7 A;  3EFU A;  2LZ6 A;  4C4V B;  4GDK A;  3ZIM A;  2KJH B;  2NTS A;  3VHT C;  1BT0 A;  1Z87 A;  1WH3 A;  1UBI A;  3SUZ A;  2J0J A;  2FID A;  3RCP A;  2ZPY A;  2AQ1 B;  5HE1 A;  3P2B A;  1VBG A;  1VZ7 A;  3PHW B;  1SE9 A;  3GZN I;  4Q2J A;  1C77 A;  2CKH B;  5JXV A;  5G2N A;  1KM7 A;  3ZNI D;  3R2I A;  4PQ0 A;  5GMV A;  4CHK A;  3I63 C;  1ZP0 B;  4M02 A;  1F2R I;  1YOV B;  3U4E G;  2LWP A;  3ZNH B;  1FHW A;  3E56 A;  3P63 A;  5IJM A;  1EWY C;  3HM6 X;  4C0A A;  4EUT A;  1H4R A;  4II2 B;  3Q8B A;  1B55 A;  2GS0 A;  1L6V A;  5FK9 C;  2AX5 A;  1GB1 A;  1YQ4 B;  2RDB C;  2MW5 A;  2KMA A;  3NHE B;  3KRW A;  1JAL A;  2DHZ A;  1AWE A;  2MHJ A;  4PS8 A;  5HHD G;  1IUE A;  1WGQ A;  3M1I B;  3LYY A;  1IRS A;  1KLG D;  2ZJD A;  3G9W A;  5J3T A;  2GBK A;  1H10 A;  4W9H A;  1V81 A;  4GMX B;  1UNR A;  5J17 A;  1V2Y A;  2LYD A;  2MFQ A;  4M8M A;  4OVU A;  3VTW A;  2Y3A A;  4MGK E;  2MCN B;  2FJU B;  3MJ5 A;  2J0M A;  4MDK E;  3NVY A;  1CMX B;  1BWN A;  2L2I A;  2ASQ A;  3PVW A;  3VDZ A;  2N7E A;  3AEE B;  2IY0 B;  3HRD D;  1TBE A;  1HZ6 A;  3VR8 B;  4HKZ E;  1TTN A;  3AB5 A;  3ZRF A;  1CQV A;  3IBE A;  1U5D A;  1YQB A;  1EVH A;  1JWM D;  3DOW A;  4US8 A;  2K49 A;  1P7F A;  1KLU D;  4NQL B;  1UNS A;  4YSY B;  4HB0 B;  3RUL A;  1BML C;  3RZW C;  2KVR A;  3IG3 A;  4IW0 A;  3PRZ A;  4FHJ A;  2KK8 A;  1JML A;  2P8V A;  2BYV E;  1DOI A;  2IJ0 A;  3KVF B;  2XQN M;  5HE2 A;  1TS2 A;  4ARC A;  1LFD A;  2SAK A;  2N0Y A;  1SB3 C;  2EEL A;  4LCD E;  4A6Q A;  1M7E A;  4W9K A;  1PMS A;  2RDG A;  1UEL A;  2MJE A;  2KR0 A;  1X1M A;  4DX9 0;  1V80 A;  1EWC A;  3Q8F A;  4MH0 E;  5FR3 A;  1FHO A;  3CWI A;  2MA9 B;  3S2A A;  3MJW A;  3VUW A;  2KQ7 A;  4W9I A;  1J0W A;  2KCJ A;  5LON B;  5D6J B;  1B1Z A;  1VCB A;  3PPA A;  4A20 A;  2BWE S;  2DYQ A;  1SXT A;  1B9R A;  1XO3 A;  4WWP A;  4QJ5 B;  1FO4 A;  1P0R A;  1SBB B;  4W9G A;  3SV1 A;  4JIO U;  1MG8 A;  3Q14 C;  1U5F A;  3T3O A;  1TXD A;  4HSI A;  4HDO A;  2DKP A;  2J53 A;  1NEK B;  2INP E;  5L81 A;  2WXO A;  3W1Y A;  3L16 A;  1NVI D;  2ZNV C;  1IBX B;  2G4D B;  2KAN A;  2OQB A;  5AZH A;  2YS1 A;  1RLF A;  2WH5 A;  5FI1 A;  1OQQ A;  3V6C B;  2MDX A;  4HAW B;  3LJU X;  5D3V A;  4REZ A;  4KGS A;  2WHI A;  3OJ3 A;  3HIZ A;  4J6I A;  4LNI A;  1FHX A;  1FNW A;  1VDV A;  5IO9 A;  3W5V B;  4KDI C;  2JXT A;  3WCQ A;  2PJH A;  3TCA A;  3U2S C;  1LQB A;  1MK9 B;  5EE0 A;  2PLP A;  2DYM A;  2WDV B;  1OTR B;  2W2X C;  1AN8 A;  4OZB A;  5AUK A;  4PNK A;  1J7A A;  1YN3 A;  3ABV B;  5JHA A;  3ZTD A;  3QAQ A;  2ZKM X;  3AE3 B;  1MVK A;  3U7Z A;  1Q1O A;  2VZK B;  4AUQ C;  4C00 A;  4B6W A;  2BS3 B;  2CQU A;  1WMH B;  4QJ4 B;  1F0Z A;  2R0D A;  3GYO A;  4RGO S;  2YRY A;  2KTR B;  2KAJ A;  1I4R A;  4TYZ A;  1P1A A;  3LXF A;  4IUM B;  1V6E A;  2GRI A;  4KVG B;  2L1C A;  3H7P B;  2YT2 A;  1NDD A;  2DX1 A;  1RAX A;  4FAD A;  1EU4 A;  3NVV A;  3B08 A;  4C4V A;  2LEK A;  4HEA 1;  2KHW B;  2W55 A;  5AEK B;  4XWW A;  2JF5 A;  4KSK C;  5JH5 C;  2IO2 B;  4Z2N A;  3FP5 A;  4W9C A;  4AOF A;  4LJP B;  3AE7 B;  2BF8 B;  2LD9 A;  4DDG D;  4YWG G;  5IAA C;  4JK9 A;  2JY6 A;  2WDT B;  1N5X A;  2KQ4 X;  3KUD B;  1HB8 A;  2G4S A;  1YX5 B;  2KUP A;  3OAW A;  1C78 A;  1SSN A;  2G45 B;  4GDL B;  4AS1 A;  1GB4 A;  4KZ0 A;  2RQ1 A;  2LG1 A;  3V05 A;  2V3P A;  3SYX A;  1LW3 A;  2J59 M;  1CK1 A;  2QHO A;  4ZHP A;  2KC1 A;  3Q3F A;  2KFJ A;  3BVG A;  2D3A A;  1FEH A;  1IGC A;  3M63 B;  5G55 A;  3AU5 A;  4IWO A;  1Y5O A;  1V1P B;  2Y7B A;  1F77 A;  3EC8 A;  2CHZ A;  4AWJ A;  3KLS X;  5BYQ A;  2K8E A;  3ZKJ C;  2D3G A;  3I9V 1;  3NS8 A;  3ALB A;  3CF6 E;  4PT5 A;  4P1C C;  2WXJ A;  3DBH B;  1TZO A;  5TSS A;  2D9X A;  1P7E A;  3E66 A;  3JVZ X;  4NAW A;  4LJO B;  4MM3 B;  1GJZ A;  2D9W A;  2B3A A;  3X23 A;  2N1W A;  3DPD A;  5CLL B;  3RFZ B;  4HAZ B;  1DGJ A;  4JWS C;  4NY0 A;  2QEJ C;  2EJ8 A;  4KV2 A;  2NCN A;  2JRH A;  2YLM A;  2NVU I;  1E0Z A;  2DFK A;  2ON8 A;  4I6P A;  4OZC A;  1I7A A;  3DBL I;  1FGY A;  4KAX B;  4WVF B;  1TT5 B;  1Q5W B;  4OVZ A;  1NBF C;  1I7H A;  1WGH A;  4E3C A;  1E6E B;  3WAN A;  4IM2 A;  1STE A;  2WXK A;  2IO1 B;  1V5U A;  1MHX A;  2DHJ A;  2MP2 B;  4GNK B;  2AWT A;  5JZE B;  3W2D A;  4HRS A;  4GMV A;  2ONQ A;  4G11 A;  2E6X A;  4YSZ B;  2CRF A;  2WDR B;  2ZW1 A;  2ZVO A;  3N1Z C;  2I38 A;  3R3M A;  2Z59 A;  3H7P A;  3BY4 B;  2C7H A;  1N61 A;  2I2Y A;  1YN4 A;  3NY5 A;  3Q3O C;  2K0P A;  4FN2 A;  1OEY A;  3KWL A;  3W5U B;  4JK8 A;  4P1B C;  2V0G A;  3QCA A;  4BKS D;  3WYF B;  4L1R A;  1MK7 B;  1V5P A;  1U27 A;  1E7V A;  2K6Q A;  2KJR A;  1RJ2 A;  1M4V A;  1YNT E;  3ZYY X;  3ENE A;  2W9N A;  3DVG Y;  4ACF A;  2N7J A;  4P7I A;  4XWX A;  3A9K B;  3LJ3 A;  4HCN B;  3ZUN A;  2D3C A;  4HCP B;  5H92 C;  1QQG A;  2MRP A;  1BXT A;  2O2V A;  3A58 A;  1D5Z C;  4BOZ B;  2PKO A;  4K7S A;  4TSS A;  3RZF A;  1JW9 D;  2KXJ A;  2PIA A;  4AP4 C;  4BAX A;  4JKG A;  2C9W B;  4DHZ B;  4XDC A;  1WX9 A;  5KHO A;  5D3X A;  4GSW A;  1C4C A;  3LB8 C;  1PGB A;  2ROV A;  4HPP A;  1LGR A;  1DRO A;  2JT4 B;  2MBE A;  4A6F A;  1WX7 A;  1XLN A;  3A9J A;  4KX6 B;  1FXI A;  2KMC A;  2OED A;  3ML9 A;  3WIM A;  1FCL A;  3KZ1 A;  1YMH E;  4D0N B;  2K00 A;  5HI1 A;  2L00 B;  1ZKH A;  1W1G A;  4A8X C;  2OJR A;  2Z0D B;  3DBS A;  5C5B B;  2ELB A;  5FR6 A;  1GNU A;  3DHI C;  4JL9 A;  3R7R A;  3A1Q A;  2EKI A;  3W1S C;  1FXA A;  2Y5B B;  3N1Y C;  1FMA D;  3TL5 A;  1DIK A;  4RH6 A;  1OEY J;  2GBM A;  2KIG A;  4KHA A;  3QK0 A;  4ANU A;  3ODX A;  5D2M B;  1WE7 A;  2JVC A;  2JZ3 B;  3HW2 B;  4KKJ A;  3RNE C;  4DHJ B;  3D32 A;  1YX6 B;  4KHO A;  3KRX A;  2HD5 B;  4ZOH C;  2M8S A;  4F7H A;  2AQ3 B;  2K3U A;  2MEK A;  4K7U A;  4BZA A;  1ZVR A;  4ILH A;  3E9P A;  1X1F A;  1IGD A;  2IO0 B;  2QKL A;  4BKT A;  2M4N A;  1L4Z B;  4K81 A;  3APF A;  4DXF A;  2UWQ A;  4WWN A;  1L6U A;  4HB2 B;  4GDL A;  4HKQ A;  3AEG B;  2QC8 A;  3PZ8 A;  4HPL B;  1WJ6 A;  2ICI A;  1KZ7 A;  1GUA B;  2IYD B;  2N1V A;  3H9D A;  1WGG A;  2WXH A;  1ZXH A;  3TEZ A;  3IFW B;  2W3R A;  2D9Y A;  5E6P A;  3QWM A;  1WI0 A;  1K5G B;  4GGQ A;  2E2X A;  3GE3 C;  2RVB B;  2WXM A;  1ROE A;  3DHG C;  1AYF A;  5BMH A;  4HAV B;  3PRM B;  4WJO A;  4LTU A;  5C1Z A;  2N0S B;  3L10 B;  1WFY A;  1K51 A;  1QF6 A;  3ZDM C;  5MPO A;  2KN4 A;  2Z0Q A;  5KQ4 A;  3TEX A;  1VZ8 A;  2KNB A;  1WGU A;  3GS2 A;  1X1G A;  3U52 E;  5D3Y A;  3PO0 A;  4XX5 A;  3KUZ A;  3SNH A;  4DK5 A;  4DIX A;  3KW5 B;  3ENB A;  1NTY A;  3A4S C;  4N58 A;  4WAA A;  2P0F A;  4ANX A;  4HAU B;  2WX0 A;  4GOC A;  2LOX A;  2KWC A;  2PVO D;  2LUL A;  4GDK B;  4J3O D;  2WU5 B;  1CJE A;  3AE9 B;  3PLU A;  2LGX A;  5HE3 A;  4RFB A;  4RMA A;  3I5J C;  1OQR A;  1XQQ A;  5JLJ B;  2UZS A;  3H6N A;  2GJY A;  2IPK D;  5DHA B;  1I4Q A;  1Z5S B;  4N6E B;  4HDQ A;  4BBN C;  1X86 A;  1ZDX A;  1HTQ A;  2W3S A;  5LG4 B;  2K25 A;  2MX2 A;  1WJ4 A;  4XGA B;  4OVV A;  2DAF A;  3V6E B;  4A55 A;  3VH3 B;  1TYG B;  3FEH A;  1BAK A;  2N7D A;  3EHV A;  3PV1 A;  3FAH A;  4DBG A;  1UUP A;  1ZW7 A;  4DHJ D;  1E5W A;  3IVF A;  1TIF A;  4KHB A;  1JWU D;  3CIK A;  4HAT B;  2KIE A;  1UPR A;  1AAR A;  2D4Q A;  4K3C A;  5EE3 A;  2LRW A;  3APC A;  1HB6 A;  4M01 A;  1SJH D;  3IAS 1;  2Z8L A;  4ZRP A;  3UIN B;  1VR9 A;  2RLO A;  1V49 A;  2N4F A;  2GCL A;  3QX1 A;  2DA0 A;  2RRF A;  4C56 C;  3UQB A;  1YQ3 B;  3MHZ A;  3L4P A;  2LUE A;  2DWQ A;  3N7C A;  2IGD A;  1NEN B;  2WU2 B;  4HRO A;  4YXD B;  3AEB B;  2W2X D;  3AUL A;  3Q69 A;  2D11 A;  4MGY E;  3T3N A;  4H2A A;  3BWU D;  3PT2 B;  3ZJV A;  3IT4 B;  2Z13 A;  4FXC A;  2RGN B;  2L3Z A;  1FFU A;  3Q2A C;  3UF8 A;  1L0X B;  5CHW A;  5G5G A;  4EJN A;  1SJE D;  2K1F A;  2WWZ A;  1JRU A;  4O1N A;  5BYS A;  4YTN B;  2ZCC A;  4GLS C;  1XD3 B;  2AYO B;  5DPS A;  2V4L A;  2D5G A;  4YTM B;  2WXI A;  2ZEQ A;  5DHF B;  1WXV A;  1DDW A;  1TY0 A;  4CO7 A;  4IWQ A;  4PK1 A;  2WXQ A;  2DZI A;  2JZP A;  3T8M A;  4D2K A;  1OY2 A;  5KQ1 A;  4E74 A;  1WZ3 A;  2MLB A;  1JQ4 A;  2JWU A;  4MEL A;  4PYZ A;  5DPT A;  2VRR B;  2HE7 A;  2L83 A;  2IZV B;  1TS3 A;  1EAZ A;  2BB5 A;  1Y56 A;  2DZK A;  2FCQ A;  3CIR B;  4PS3 A;  3B1L X;  1PLS A;  1WXS A;  2ZVN A;  2GBJ A;  3OLM D;  2LGY A;  1WYW B;  2K8B A;  3MHS D;  3SHQ A;  1WRI A;  2H7D A;  4JKG B;  1ET6 A;  3N3K B;  1E8X A;  2JUO A;  1BTN A;  2COA A;  4WJN A;  2JWZ A;  4KGR A;  1WXM A;  4K2O A;  2BPS A;  2I1K A;  4B9K A;  1FGZ A;  3L08 A;  4Z2M B;  1HTO A;  3PRE A;  4FA6 A;  5TR5 A;  2JYT A;  4ZRJ A;  1YJI A;  2IDY A;  3NJT A;  5CX3 A;  3AE4 B;  2LFI A;  2CU1 A;  4DX8 A;  1K52 A;  3VUX A;  3APD A;  3GYP A;  1ZUD 2;  3AE5 B;  4JE3 B;  3X0W A;  1UF0 A;  2BS2 B;  2COP A;  4URK A;  2AQ2 B;  2Y8F A;  1KLV A;  3NZU A;  4KSL C;  1Q10 A;  2UYZ B;  1KRH A;  1T3Q A;  1WR6 E;  5L83 A;  2A5U A;  3I3T B;  1ZC3 B;  2KQS A;  4ANV A;  2N9K A;  1XR0 B;  3HHM A;  3JW0 X;  1ZPS A;  4XYC A;  4I6N B;  4ICV A;  3F0W A;  1UBQ A;  1XLO A;  3P6A A;  4RM8 A;  2O6V A;  2I5C A;  2GBR A;  2M17 A;  5I2S A;  2ABD A;  3F5R A;  2WGS A;  3GOE A;  1XXG A;  4IDI A;  2NMB A;  2OHF A;  4KIK A;  1K5D B;  3VTV A;  5KHQ A;  3PZD A;  3QJZ A;  2DLW A;  2DIK A;  2KDE B;  3EA6 A;  4JX1 C;  4BKG A;  5DI9 B;  2B76 B;  1FOE A;  2OJW A;  3SEB A;  3AEC B;  1UGJ A;  1E8Y A;  4IC7 B;  2DHK A;  3ZW3 A;  1N62 A;  4QAY A;  1UZX B;  3OWE B;  3L54 A;  1UD7 A;  2L0T A;  2LHD A;  1MI0 A;  2CAY A;  3D8D A;  4MGI E;  1WMH A;  2MBH A;  3NSU A;  2MWN B;  3FSS A;  4CQN A;  1E7U A;  1JWB D;  2WXR A;  1JRO A;  2KWU B;  3KUC B;  2RUK B;  1L2N A;  2Z0E B;  1KI1 B;  4XE0 A;  1UNP A;  1R4M B;  2NBU A;  2GBN A;  2DX5 B;  3AV8 A;  3FM8 C;  5BMI A;  3ZTC A;  4TUU A;  4JWU C;  1WVH A;  2H89 B;  2YVC A;  1QQR A;  2CY5 A;  4A5K A;  2W82 A;  1HE8 A;  2HDE A;  2JU6 X;  2BBC A;  1GG3 A;  1PUT A;  1NTV A;  4QXA B;  2WXG A;  4WWO A;  4LNN A;  4F7U P;  2ELA A;  2COF A;  2WS3 B;  3FKY A;  2LMC A;  5I4D A;  1RRP B;  1EF5 A;  5J18 A;  1FFV A;  3DWG C;  5L95 C;  4US9 A;  2JX5 A;  2R09 A;  2ACZ B;  1WSP A;  3PG7 A;  3UGB B;  1F9J A;  1J7C A;  2LXA A;  2QCZ A;  2QDF A;  2L8J A;  2INC C;  3PP2 A;  2N9X A;  2X0S A;  2RNR B;  2V4I B;  4ZRQ A;  2LJI A;  4FHK A;  2INN E;  2PW9 A;  4ITK A;  2DBY A;  2PE9 A;  3R7Q A;  2AL3 A;  4EZL A;  4FLH A;  3P7Z A;  4JKA A;  3Q3M C;  4WQO B;  3RYT A;  3T9L A;  5G5H A;  4CSQ A;  1J8C A;  4CHJ A;  3B0A A;  4LDT D;  5GOW B;  5CHV C;  4F7G A;  4HB4 B;  2CJO A;  2O6V D;  5D3W A;  1IPG A;  1I4G A;  3NWA A;  2M56 B;  2QSD A;  1J7B A;  3BIN A;  2Z0P A;  4K1R B;  3DVG X;  2NPT A;  4ZHO A;  3NUH B;  2LKO A;  3PZ7 A;  1TJ6 A;  2GUM A;  3VAW A;  1TGZ B;  3DXE A;  3KH0 A;  3Q3N C;  2KD0 A;  2LGI A;  3RNF C;  1MHH E;  2L7R A;  4RGM A;  1TZ1 A;  1I2H A;  1U2B A;  5E6O A;  1HBK A;  4WJ7 A;  1K8R B;  1NTI A;  3NRZ A;  2UZR A;  3ONS A;  2BKF A;  2YEP F;  2M14 A;  3TUO A;  2NS5 A;  4ZYN A;  1UPQ A;  5JHG A;  3BVM A;  4EOY A;  2NBV B;  2W2W A;  2IY1 B;  5J2R A;  1WJU A;  1ZGU B;  3MDB C;  3D8E A;  1WXA A;  1MPH A;  3TW1 A;  1I4P A;  1PYW D;  1P98 A;  1DDV A;  3VXW A;  2IND C;  4HPM B;  3IHP C;  1WXQ A;  2RD0 A;  3ZQ4 A;  1OGW A;  4IWP A;  2IYB A;  1PFD A;  1MG4 A;  1DBH A;  2WYQ A;  4PS7 A;  2C60 A;  3VRA B;  4JKH A;  4W9F A;  2MBO A;  2N23 A;  2L52 A;  3ML8 A;  2KDM A;  1GPX A;  1JWS D;  4TV3 A;  4OT1 A;  2NMQ A;  2J4X A;  2LRU A;  3AMZ A;  2M0A A;  3L0W B;  4HJG E;  4HK2 A;  1H8C A;  4DWF A;  4W9E A;  3R2T A;  2LHE A;  3D8F A;  1R7S A;  2FDQ A;  2JRI B;  4GU2 A;  2KLC A;  2CHX A;  3VOQ A;  3R8B A;  4BFR A;  2RSG A;  1T0Y A;  4BKS A;  1ZYI A;  2JYE A;  4A6K A;  5AUI A;  1JDE A;  4JKE A;  3BK1 A;  5DPR A;  2FUG 1;  3BJI A;  5E6J A;  4MSQ B;  3ZXV A;  1K53 A;  4ILJ A;  2C5L C;  4LLG M;  2KZR A;  1LB1 A;  4HAX B;  1HXY D;  2ZCB A;  2XK5 B;  1N60 A;  3NWD A;  3AH7 A;  4S17 A;  1MAI A;  2WDQ B;  3MFG A;  1QOB A;  2DAJ A;  3TBL D;  4LDT B;  4RNA A;  3AED B;  2KWD A;  3PHX B;  2HRJ A;  2C7N B;  2KDI A;  1ZSQ A;  2KTR A;  2WP9 B;  4WQM A;  3A9J B;  2K39 A;  2KUQ A;  1E8Z A;  3BYY B;  1FIQ A;  2K5P A;  3L13 A;  3O13 A;  3EGR A;  1PQS A;  3RNB C;  3P42 A;  2MP2 A;  3PSC A;  2CJN A;  1QZE A;  1C76 A;  3I57 A;  1AWD A;  1D3Z A;  1ZM0 A;  2KFK A;  3SFE B;  4IKG A;  1X11 A;  2G3Q B;  3AE1 B;  2CB8 A;  3NZ3 A;  2LXC A;  2BKR B;  2R2Y A;  4C80 A;  3NG0 A;  3SBG A;  2MQJ A;  4FUL A;  1U5G A;  1XOD A;  4JQW C;  4W9D A;  3W9C B;  2LGS A;  3MP9 A;  3VH4 B;  1WJ1 A;  3RUI B;  1I42 A;  3QBV B;  2IGH A;  2QJL A;  1WGK A;  2Z4D A;  4NNJ B;  5I2M A;  2XK5 A;  3ZXR A;  3H7S A;  5BYR A;  3QA8 A;  1P9D U;  1E9M A;  4DBB A;  5D3D A;  1W1D A;  3ODW A;  1ZDV A;  1I4X A;  3PS6 A;  3DVN V;  4YSX B;  3SDL C;  1DOX A;  2CS4 A;  3NOB A;  3MTN B;  1IBX A;  4TQ1 A;  4IG7 B;  1PGA A;  2KO3 A;  1D5X C;  3P4P B;  4C7Y A;  3N20 C;  5HG2 A;  3Q8E A;  3SFD B;  1SE4 A;  3HVZ A;  4DDI D;  1TKY A;  4GOU A;  1NYR A;  4B0M A;  4N9F 4;  3BVZ A;  4G3X B;  1S3S G;  1SIF A;  2HJ1 A;  2YF0 A;  2VZK D;  4EFO A;  4MSM B;  4DXA B;  3PVU A;  2Y5C A;  4BBN F;  3O65 B;  1Z2M A;  4JGH B;  5J3Q A;  1WF9 A;  1C4P A;  4FJV B;  1PGX A;  2NZ8 B;  1FPY A;  1NI3 A;  3SBT A;  2CHW A;  4I6L B;  2DN6 A;  2D9Z A;  3MC9 A;  1N3H A;  2JXX A;  3VR9 B;  1D4B A;  3U30 A;  3RCZ A;  3EPY A;  2K6D B;  1VLB A;  3VRB B;  2REX A;  2UU7 A;  2ZNV B;  3AM9 A;  3FVC A;  2M1M A;  1LO5 D;  4NAM A;  3P4Q B;  1X05 A;  3DVN U;  1WZ0 A;  2L05 A;  3KSY A;  4HLE A;  2RGF A;  2DLB A;  1MKE A;  4B6H A;  3IT6 B;  5CLQ B;  2X8X X;  3ETR A;  1RFK A;  3SD5 A;  4NJC A;  1C79 A;  3FIL A;  2YT1 A;  2DZJ A;  2LVQ A;  1N5W A;  3DCX A;  1Y8R C;  2YT0 A;  4OHJ A;  4NJ7 A;  1T0S C;  3E9O A;  3QIJ A;  2Y8G A;  1G6J A;  3VTU A;  1A70 A;  3VVW B;  4LNK A;  4MAC A;  1YN5 A;  2HTH A;  5T8I A;  2E3T A;  4MY6 A;  1OMW A;  1R4N I;  3MC8 A;  3K9O B;  2W54 A;  2FAZ A;  2WXL A;  1GOZ A;  1V5O A;  5IKC M;  2I1J A;  1KZG A;  3RD2 A;  1DOY A;  1PDX A;  1U5E A;  5KCV A;  1MPE A;  1ST7 A;  3PLV A;  3PSE B;  4M0W A;  3DBR B;  3SR6 A;  3Q6B A;  2TSS A;  2DYN A;  1T77 A;  2KWV B;  2KX3 A;  1F1H A;  5M4Y B;  5LNK 1;  4MK0 A;  3N1X C;  2EMT A;  1YD8 U;  2HJ8 A;  2M19 A;  3ZVR A;  2GI9 A;  1FXT B;  4HJK A;  5IN7 A;  1QIL A;  3FLV A;  3DXD A;  2FCN A;  2K2J A;  3AN1 A;  4DHZ E;  4ZYS A;  5D3I B;  1ZXI A;  4WJQ A;  4ANW A;  5D27 A;  5IRS A;  1MIX A;  2IO3 B;  3Q8A A;  4L1B A;  3A98 B;  3VUY A;  1XLP A;  4AJY B;  3H1U A;  4F7Z A;  2Z59 B;  2KGX B;  1N63 A;  1ZE3 D;  1L4D B;  2BT6 A;  4P6V F;  4E71 A;  1EM7 A;  3QAR A;  2LJ5 A;  5DIF B;  2V9H A;  4GB9 A;  1P3Q U;  1MFW A;  2NR2 A;  2R82 A;  4NJ6 A;  5HKH A;  1V61 A;  2BCJ A;  3ML4 A;  1KH0 A;  2HTH B;  5LXI B;  2RMM A;  3O96 A;  2KMM A;  3QWZ B;  1IP9 A;  1JWA D;  5EE9 A;  4C7Z A;  2C7M B;  3U12 A;  2DYO A;  3JSV A;  5JHB A;  4JK7 A;  2FJ9 A;  2KT7 A;  1OFF A;  2NBV A;  3AI5 A;  1FCC C;  1TQZ A;  4S0R A;  2KOX A;  3ZJT A;  2LGD A;  4KZC A;  4W9J A;  1T0R C;  4KKI A;  3C0R B;  1FNU A;  4NPN A;  4DQO C;  1V8C A;  4WSF A;  1F52 A;  3ZO5 B;  3OG5 A;  3DWM A;  3U7D A;  3ZGZ A;  1SE3 A;  1WGD A;  5CTR C;  3DCG A;  4MJS A;  5C6R A;  2L0F A;  1J0G A;  1KFY B;  3ZJU A;  2MBQ A;  1M7R A;  1KBL A;  1XF5 L;  2K9X A;  1TS5 A;  1L0Y B;  4TQ0 A;  1GC7 A;  3RNC C;  2ZW0 A;  2ADZ A;  3GE8 C;  2R2O A;  2YEP B;  1QKZ A;  3BII D;  5C5B A;  5JP4 A;  2Y5P A;  1R4M I;  1MI1 A;  2GB1 A;  3T06 A;  3DDC B;  3KWV A;  4RGT A;  1SEB D;  5E6N A;  3W1S A;  1TKE A;  1XCT L;  2KYW A;  1A5R A;  1Q67 A;  1HEZ E;  1XT9 B;  3TO1 A;  2XN9 C;  3DBL B;  3PTF C;  3RMK C;  1V5T A;  3WAP A;  3RNA C;  3V5W A;  1HQR D;  2JQR B;  4RM9 A;  1Y19 B;  2KAC A;  3BYT B;  5DH9 B;  5C23 A;  2D9V A;  3WA0 A;  2K8C A;  4B95 A;  3PVL A;  3DXC A;  4GPT B;  1XEE A;  4YL8 A;  1ENF A;  1FRD A;  5EE1 A;  2MJD A;  3TVV A;  2MH7 A;  3PEG A;  3GZN B;  1QT9 A;  4HHV A;  1V9J A;  3BK2 A;  3K9P B;  2LVP A;  2J52 A;  2L32 A;  2FIF A;  1OQN A;  3A9K A;  2KC2 A;  4JKD A;  4LNO A;  3ULC A;  4EKU A;  5IP4 D;  2JSV X;  2RPQ A;  4ARI A;  3LDZ E;  4NAW B;  1Q0W B;  2FCM A;  2KKC A;  2BS4 B;  3NZS A;  3NWF A;  1YJ1 A;  1FRR A;  1JCK B;  1EU3 A;  3C8Y A;  3EUB 2;  2PMV A;  1L0V B;  3PRP B;  3N32 A;  1XCQ L;  2MWS B;  3QHT A;  2KTF A;  1P3R A;  5J3Y A;  4TMA B;  2CU3 A;  2FE8 A;  4IAP A;  1SF0 A;  1GC6 A;  1AQC A;  1WWT A;  4M8N A;  4A9A A;  3FIL B;  1XLQ A;  1U29 A;  4UDU C;  2X18 A;  2NTT A;  1V1O A;  2KDF B;  1FB8 A;  1BTK A;  5DCN A;  2FJL A;  1RYJ A;  1FNV A;  4RCO A;  3WAO A;  2ROZ B;  1DYQ A;  2MBB B;  3CXB B;  1UWX A;  4K2P A;  2G9H D;  2O6V B;  2R2Q A;  2AEH A;  4YON A;  1KJT A;  3P4R B;  3ZDT A;  4KGT A;  1XX0 A;  2BGF A;  4CHM A;  2WXP A;  5C3J B;  5C16 A;  4GIV A;  2QKM A;  3L17 A;  1VZ6 A;  4WJP A;  3HVD A;  4A6F B;  2HTM E;  2VH1 A;  1V97 A;  3MPX A;  2J7Q B;  3UQA A;  1EUV B;  3AJ4 A;  4XDD A;  2V76 A;  2XNA C;  2NBW B;  1FD6 A;  1VRA B;  3U8Z A;  2QIL A;  1K50 A;  1IYF A;  4Y94 A;  1P6S A;  4HXD A;  2JZZ A;  1L7Y A;  4IM0 A;  1T5X D;  2OTX A;  4NSW A;  3ULB A;  2J0K A;  2FNJ B;  4RGN A;  4OW0 A;  4XWT A;  2BTE A;  1TKG A;  3VQI A;  1WI1 A;  4FJY A;  5EDS A;  3RN9 C;  4JPS A;  2KVZ A;  2O2V B;  2CR5 A;  4NQK E;  4IOI E;  1RWS A;  1U4A A;  1VD2 A;  3DHH C;  1VJK A;  3ECI A;  4EZJ A;  4HVB A;  5HE0 A;  3B2G A;  2DTC A;  1NU2 A;  2A4Z A;  2GMI C;  2PE6 B;  1HA5 A;  2KN5 A;  4FBJ B;  3NVW A;  3ZVV A;  4EMO A;  4QJ3 B;  2RSU A;  5D7G A;  3CMM B;  2WXN A;  1YJJ A;  2WQY B;  1GGO A;  1CZP A;  3AE6 B;  4R3D A;  4K3B A;  3P1M A;  1M94 A;  1UWM A;  2OOB B;  3NVZ A;  4OSN A;  5JHH A;  3UI3 A;  2LI5 A;  2DYB A;  4F8C B;  5JVL A;  3DBH I; 
#chains in the Genus database with same CATH homology
 3UIP B;  2GCJ A;  2BYF A;  4MM3 A;  1LM8 B;  1I35 A;  3AU4 A;  2ZPN A;  2XBB C;  2P0H A;  1E8W A;  2D07 B;  4ZRI A;  3AXC A;  3M95 A;  2D2Q A;  4CYE A;  2YS3 A;  1OQY A;  2LBB A;  4ILG B;  3VFK A;  2DZM A;  2YS5 A;  1UH6 A;  1KOT A;  4K7W A;  3KY9 A;  2MKR A;  5LXH A;  1XCG A;  1V88 A;  2WX1 A;  2COD A;  3ZNZ B;  4GN1 A;  4AJW A;  2NPT B;  3A8P A;  4MJS B;  4H8S A;  4IOY X;  1C3T A;  3WAL A;  4BBK A;  2EMS A;  1J19 A;  3TFM A;  2V3S A;  3A8Q A;  1WX8 A;  4TKN A;  1QC6 A;  2VRW B;  2DEN B;  3R66 C;  1WGY A;  2H7E A;  3HQC A;  2ZZP B;  2GOW A;  3JYU A;  1WY8 A;  1V86 A;  3UIO B;  3M62 B;  5DPW A;  1WGR A;  3HK0 A;  4BVU C;  3KYC D;  2V1Y A;  3N30 A;  4BOS C;  2FCS A;  4JKC A;  4XZ4 A;  3OAN A;  3EEC A;  2K8H A;  1UNQ A;  5AZG A;  4JLC A;  1WRD B;  2PPH A;  4G0N B;  3UZT A;  3V62 A;  4GZU A;  1ISN A;  1UEF A;  1WM3 A;  4A6H A;  1EGX A;  3OJ4 B;  1DYN A;  5LLI A;  3ODO A;  1SHC A;  1EF1 A;  1SGH A;  1V89 A;  4KIK B;  4W9L A;  2M38 A;  1WJN A;  4ASW C;  5LOP B;  2PZ1 A;  3ZLZ A;  1WJM A;  3TIX A;  3PGE A;  3E9L A;  4JKF A;  4F1S A;  1WE6 A;  2DX5 A;  4ZDV A;  2COC A;  4KDL B;  1RFA A;  2KX0 A;  5CHF A;  2IFS A;  2N9P C;  1EO6 A;  4HWI B;  2EC1 A;  1ACA A;  3SO6 A;  2AL6 A;  2XEW A;  5FI0 A;  1XKE A;  4MT7 A;  1W1H A;  4HB3 B;  4A3P A;  4ICU A;  1V5M A;  5C79 A;  2DKQ A;  2FUH B;  2IBI B;  3A1Q B;  3QQ8 B;  4EZK A;  1YIW A;  1WM2 A;  3ZRC A;  2YSZ A;  2P0D A;  2RR9 A;  1E90 A;  3RT3 B;  1VBH A;  2K2U A;  3TJP A;  1P5T A;  2MSE D;  5AZF A;  1C1Y B;  4II3 B;  4K17 A;  1LXD A;  2VSZ A;  2UVM A;  4X57 B;  3CSF A;  2LVO A;  1FAO A;  1KC7 A;  2Q13 A;  2KDB A;  1XD4 A;  3KYD D;  4PYU A;  4XC2 A;  2Z0O A;  4EEW A;  1WR1 A;  5D94 A;  1MIZ B;  1DDM A;  1NI2 A;  2BYE A;  2JPH A;  2G35 A;  1UGM A;  2KJ6 A;  2D10 A;  3VIA A;  3A33 B;  2JP2 A;  3CST A;  5EFX A;  4IM3 A;  2LOZ A;  4KHB B;  4G50 A;  4L6E A;  2I5F A;  3WAM A;  4MGZ E;  4ZRK A;  4JKB A;  2LAS A;  1S1Q B;  2BWF A;  3DQV A;  2KFK B;  5BO4 B;  3ZNG C;  2L76 A;  3V61 A;  4A3O A;  4IFS A;  1NVL A;  1WG7 A;  2M0X A;  2N9E B;  3HM3 A;  3JSV B;  2KLG A;  3DBR I;  4M0W B;  4MEM A;  2VKI A;  2DHI A;  2EKE C;  2PEA A;  3A4R A;  1PFJ A;  3QC8 B;  3TMP B;  3V60 A;  4HAY B;  1WIA A;  3M3J A;  2CY4 A;  1RRB A;  1ZC4 B;  3Q3J A;  4FJZ A;  3SU8 X;  4GXB A;  5IA7 A;  3EFU A;  2LZ6 A;  4GDK A;  3ZIM A;  2KJH B;  3VHT C;  1BT0 A;  1Z87 A;  1WH3 A;  1UBI A;  3SUZ A;  2J0J A;  2FID A;  3RCP A;  2ZPY A;  5HE1 A;  3P2B A;  1VBG A;  3PHW B;  1SE9 A;  3GZN I;  2CKH B;  5G2N A;  1KM7 A;  3ZNI D;  4CHK A;  4PQ0 A;  5GMV A;  3ZNH B;  2LWP A;  1FHW A;  5IJM A;  3HM6 X;  4C0A A;  4EUT A;  1H4R A;  4II2 B;  1B55 A;  2GS0 A;  2MW5 A;  2KMA A;  3NHE B;  3KRW A;  2DHZ A;  1AWE A;  4PS8 A;  1WGQ A;  3M1I B;  1IRS A;  2ZJD A;  3G9W A;  5J3T A;  2GBK A;  1H10 A;  4W9H A;  1V81 A;  4GMX B;  1UNR A;  5J17 A;  1V2Y A;  2LYD A;  2MFQ A;  4M8M A;  4OVU A;  3VTW A;  4MGK E;  2MCN B;  2J0M A;  4MDK E;  1CMX B;  1BWN A;  2L2I A;  2ASQ A;  3PVW A;  3VDZ A;  2N7E A;  2IY0 B;  1TBE A;  1TTN A;  3ZRF A;  3IBE A;  1U5D A;  1YQB A;  1EVH A;  3DOW A;  4NQL B;  4HB0 B;  3RUL A;  3RZW C;  2KVR A;  4IW0 A;  3IG3 A;  3PRZ A;  4FHJ A;  2KK8 A;  2P8V A;  2BYV E;  3KVF B;  2XQN M;  5HE2 A;  1LFD A;  4LCD E;  2N0Y A;  1M7E A;  4W9K A;  1PMS A;  1UEL A;  1X1M A;  4DX9 0;  1V80 A;  4MH0 E;  1FHO A;  2MA9 B;  3S2A A;  3MJW A;  3VUW A;  2KQ7 A;  4W9I A;  1J0W A;  2KCJ A;  5LON B;  5D6J B;  1VCB A;  3PPA A;  4A20 A;  2BWE S;  2DYQ A;  4WWP A;  1P0R A;  4W9G A;  3SV1 A;  4JIO U;  1MG8 A;  1U5F A;  1TXD A;  4HDO A;  2DKP A;  5L81 A;  3W1Y A;  3L16 A;  2ZNV C;  2G4D B;  2KAN A;  2OQB A;  5AZH A;  2YS1 A;  1RLF A;  2WH5 A;  5FI1 A;  3V6C B;  2MDX A;  4HAW B;  3LJU X;  5D3V A;  3OJ3 A;  3HIZ A;  4J6I A;  1FHX A;  4KDI C;  2PJH A;  3TCA A;  1LQB A;  1MK9 B;  2DYM A;  1OTR B;  2W2X C;  4PNK A;  5JHA A;  3ZTD A;  3QAQ A;  1Q1O A;  4AUQ C;  4B6W A;  2CQU A;  1WMH B;  2R0D A;  3GYO A;  2YRY A;  2KTR B;  4TYZ A;  1P1A A;  4IUM B;  1V6E A;  4KVG B;  2L1C A;  3H7P B;  1NDD A;  2DX1 A;  1RAX A;  4FAD A;  3B08 A;  2KHW B;  5AEK B;  2JF5 A;  4KSK C;  5JH5 C;  2IO2 B;  4Z2N A;  3FP5 A;  4W9C A;  4AOF A;  4LJP B;  2BF8 B;  2LD9 A;  4DDG D;  5IAA C;  4JK9 A;  2JY6 A;  2WDT B;  3KUD B;  1HB8 A;  2G4S A;  1YX5 B;  2KUP A;  3OAW A;  2G45 B;  4GDL B;  4KZ0 A;  2RQ1 A;  2LG1 A;  3SYX A;  1LW3 A;  2J59 M;  2QHO A;  2KC1 A;  3Q3F A;  2KFJ A;  3M63 B;  5G55 A;  3AU5 A;  4IWO A;  1Y5O A;  2Y7B A;  3EC8 A;  2CHZ A;  4AWJ A;  3ZKJ C;  2D3G A;  3NS8 A;  3ALB A;  3CF6 E;  2D9X A;  3E66 A;  3JVZ X;  4NAW A;  4LJO B;  1GJZ A;  2D9W A;  2B3A A;  3X23 A;  2N1W A;  3DPD A;  5CLL B;  4HAZ B;  4NY0 A;  2EJ8 A;  4KV2 A;  2NCN A;  2JRH A;  2YLM A;  2NVU I;  2DFK A;  4I6P A;  1I7A A;  3DBL I;  1FGY A;  4KAX B;  4WVF B;  1Q5W B;  1NBF C;  1WGH A;  4E3C A;  3WAN A;  4IM2 A;  2IO1 B;  1V5U A;  2DHJ A;  2MP2 B;  2AWT A;  5JZE B;  4GMV A;  4G11 A;  2CRF A;  2ZVO A;  3R3M A;  3H7P A;  3BY4 B;  2C7H A;  3NY5 A;  4FN2 A;  1OEY A;  4JK8 A;  3QCA A;  4BKS D;  3WYF B;  1MK7 B;  1V5P A;  1U27 A;  1E7V A;  2K6Q A;  2KJR A;  1RJ2 A;  3ENE A;  2W9N A;  3DVG Y;  4P7I A;  4XWX A;  3A9K B;  3LJ3 A;  4HCN B;  3ZUN A;  4HCP B;  1QQG A;  2MRP A;  2O2V A;  4BOZ B;  4K7S A;  3RZF A;  2KXJ A;  4AP4 C;  4JKG A;  2C9W B;  4DHZ B;  1WX9 A;  5KHO A;  5D3X A;  4GSW A;  2ROV A;  1DRO A;  2JT4 B;  2MBE A;  4A6F A;  1WX7 A;  3A9J A;  2KMC A;  3ML9 A;  3WIM A;  3KZ1 A;  4D0N B;  2K00 A;  2L00 B;  1ZKH A;  1W1G A;  2OJR A;  2Z0D B;  5FR6 A;  5C5B B;  2ELB A;  3DBS A;  1GNU A;  4JL9 A;  3R7R A;  3A1Q A;  3W1S C;  2Y5B B;  3TL5 A;  1DIK A;  1OEY J;  2GBM A;  4KHA A;  3QK0 A;  4ANU A;  3ODX A;  5D2M B;  1WE7 A;  2JVC A;  2JZ3 B;  3HW2 B;  4DHJ B;  3D32 A;  1YX6 B;  4KHO A;  3KRX A;  2HD5 B;  2M8S A;  4F7H A;  4K7U A;  1ZVR A;  4ILH A;  3E9P A;  1X1F A;  2IO0 B;  2QKL A;  4BKT A;  2M4N A;  4K81 A;  3APF A;  2UWQ A;  4WWN A;  4HB2 B;  4GDL A;  4HPL B;  1WJ6 A;  1KZ7 A;  1GUA B;  2IYD B;  2N1V A;  3H9D A;  1WGG A;  3IFW B;  2D9Y A;  5E6P A;  3QWM A;  1WI0 A;  1K5G B;  4GGQ A;  2E2X A;  2RVB B;  4HAV B;  3PRM B;  4WJO A;  5C1Z A;  3L10 B;  1WFY A;  3ZDM C;  2Z0Q A;  5KQ4 A;  2KNB A;  1WGU A;  1X1G A;  5D3Y A;  4XX5 A;  3KUZ A;  3SNH A;  4DK5 A;  3KW5 B;  3ENB A;  1NTY A;  3A4S C;  4WAA A;  2P0F A;  4ANX A;  4HAU B;  2WX0 A;  4GOC A;  2LOX A;  2KWC A;  2LUL A;  4GDK B;  3PLU A;  2LGX A;  5HE3 A;  4RMA A;  1XQQ A;  5JLJ B;  2UZS A;  3H6N A;  2GJY A;  5DHA B;  1Z5S B;  4HDQ A;  4BBN C;  1X86 A;  2K25 A;  2MX2 A;  1WJ4 A;  4OVV A;  2DAF A;  3V6E B;  3VH3 B;  3FEH A;  1BAK A;  2N7D A;  3EHV A;  3PV1 A;  4DBG A;  1ZW7 A;  4DHJ D;  1E5W A;  3IVF A;  3CIK A;  4HAT B;  1UPR A;  1AAR A;  2D4Q A;  2LRW A;  3APC A;  1HB6 A;  3UIN B;  2RLO A;  1V49 A;  2N4F A;  2GCL A;  3QX1 A;  2DA0 A;  3UQB A;  2LUE A;  3N7C A;  2W2X D;  3AUL A;  2D11 A;  4MGY E;  3PT2 B;  2RGN B;  2L3Z A;  3UF8 A;  5CHW A;  4EJN A;  2K1F A;  2WWZ A;  1JRU A;  2ZCC A;  1XD3 B;  2AYO B;  5DPS A;  2V4L A;  2ZEQ A;  5DHF B;  1WXV A;  1DDW A;  4CO7 A;  4IWQ A;  2DZI A;  3T8M A;  1OY2 A;  5KQ1 A;  4E74 A;  1WZ3 A;  2MLB A;  4MEL A;  4PYZ A;  5DPT A;  2VRR B;  2HE7 A;  2IZV B;  1EAZ A;  2DZK A;  2FCQ A;  4PS3 A;  3B1L X;  1PLS A;  1WXS A;  2ZVN A;  2GBJ A;  3OLM D;  2LGY A;  1WYW B;  2K8B A;  3MHS D;  3SHQ A;  2H7D A;  4JKG B;  3N3K B;  1E8X A;  2JUO A;  1BTN A;  2COA A;  4WJN A;  2JWZ A;  1WXM A;  4K2O A;  2BPS A;  2I1K A;  4B9K A;  1FGZ A;  3L08 A;  4Z2M B;  3PRE A;  4FA6 A;  5TR5 A;  4ZRJ A;  5CX3 A;  2CU1 A;  4DX8 A;  3VUX A;  3APD A;  3GYP A;  3X0W A;  4URK A;  2COP A;  1KLV A;  2Y8F A;  3NZU A;  4KSL C;  2UYZ B;  1WR6 E;  5L83 A;  2A5U A;  3I3T B;  1ZC3 B;  2KQS A;  4ANV A;  1XR0 B;  3HHM A;  3JW0 X;  4I6N B;  4ICV A;  3F0W A;  1UBQ A;  3P6A A;  4RM8 A;  2O6V A;  2I5C A;  2GBR A;  2M17 A;  2ABD A;  3F5R A;  3GOE A;  2NMB A;  5KHQ A;  4KIK A;  1K5D B;  3VTV A;  3PZD A;  3QJZ A;  2DLW A;  2DIK A;  2KDE B;  4BKG A;  5DI9 B;  1FOE A;  1E8Y A;  4IC7 B;  3ZW3 A;  2DHK A;  1UZX B;  3L54 A;  1UD7 A;  2L0T A;  2CAY A;  3D8D A;  4MGI E;  1WMH A;  2MBH A;  3NSU A;  2MWN B;  3FSS A;  1E7U A;  2KWU B;  3KUC B;  2RUK B;  1L2N A;  2Z0E B;  1KI1 B;  1UNP A;  2NBU A;  2GBN A;  2DX5 B;  3FM8 C;  3ZTC A;  4TUU A;  1WVH A;  2YVC A;  2CY5 A;  4A5K A;  1HE8 A;  1GG3 A;  1NTV A;  4WWO A;  4F7U P;  2ELA A;  2COF A;  1RRP B;  1EF5 A;  5J18 A;  5L95 C;  2R09 A;  3PG7 A;  3UGB B;  1F9J A;  2LXA A;  2L8J A;  3PP2 A;  2N9X A;  2X0S A;  2RNR B;  4FHK A;  2PE9 A;  3R7Q A;  2AL3 A;  4EZL A;  4FLH A;  3P7Z A;  4JKA A;  4WQO B;  3RYT A;  3T9L A;  1J8C A;  4CHJ A;  3B0A A;  4LDT D;  5GOW B;  5CHV C;  4F7G A;  4HB4 B;  2O6V D;  5D3W A;  1IPG A;  3BIN A;  2Z0P A;  4K1R B;  3DVG X;  2NPT A;  2LKO A;  1TJ6 A;  3VAW A;  1TGZ B;  3DXE A;  3KH0 A;  2KD0 A;  2L7R A;  1TZ1 A;  1I2H A;  1U2B A;  5E6O A;  1HBK A;  4WJ7 A;  1K8R B;  1NTI A;  2UZR A;  3ONS A;  2BKF A;  2M14 A;  2NS5 A;  4ZYN A;  1UPQ A;  5JHG A;  4EOY A;  5J2R A;  2NBV B;  2W2W A;  2IY1 B;  1WJU A;  1ZGU B;  3MDB C;  3D8E A;  1WXA A;  1MPH A;  3TW1 A;  1P98 A;  1DDV A;  3VXW A;  4HPM B;  3IHP C;  2RD0 A;  1OGW A;  4IWP A;  2IYB A;  1DBH A;  2WYQ A;  4PS7 A;  2C60 A;  4JKH A;  4W9F A;  2MBO A;  2N23 A;  3ML8 A;  4TV3 A;  2LRU A;  3L0W B;  4HK2 A;  1H8C A;  4DWF A;  4W9E A;  3D8F A;  2FDQ A;  2JRI B;  4GU2 A;  2KLC A;  2CHX A;  3VOQ A;  4BFR A;  2RSG A;  1T0Y A;  4BKS A;  4A6K A;  1JDE A;  5DPR A;  4JKE A;  3BJI A;  4MSQ B;  4ILJ A;  2C5L C;  2KZR A;  1LB1 A;  4HAX B;  2ZCB A;  2XK5 B;  1MAI A;  2DAJ A;  3TBL D;  4LDT B;  3PHX B;  2HRJ A;  2C7N B;  2KDI A;  1ZSQ A;  2KTR A;  3A9J B;  2K39 A;  1E8Z A;  3L13 A;  1PQS A;  2MP2 A;  3PSC A;  1QZE A;  1D3Z A;  1ZM0 A;  2KFK A;  1X11 A;  2G3Q B;  2CB8 A;  2LXC A;  2BKR B;  3SBG A;  2MQJ A;  4FUL A;  1U5G A;  1XOD A;  4JQW C;  4W9D A;  3VH4 B;  1WJ1 A;  3RUI B;  1I42 A;  3QBV B;  4NNJ B;  2XK5 A;  3H7S A;  3QA8 A;  1P9D U;  4DBB A;  1W1D A;  3ODW A;  3PS6 A;  3DVN V;  3SDL C;  2CS4 A;  3NOB A;  3MTN B;  4TQ1 A;  4IG7 B;  2KO3 A;  4DDI D;  4N9F 4;  4G3X B;  1S3S G;  1SIF A;  2YF0 A;  4EFO A;  4MSM B;  4DXA B;  3PVU A;  4BBN F;  3O65 B;  1Z2M A;  4JGH B;  5J3Q A;  1WF9 A;  4FJV B;  2NZ8 B;  3SBT A;  2CHW A;  4I6L B;  2DN6 A;  2D9Z A;  1N3H A;  2JXX A;  3U30 A;  3RCZ A;  3EPY A;  2K6D B;  2REX A;  2ZNV B;  2M1M A;  1X05 A;  3DVN U;  1WZ0 A;  2L05 A;  3KSY A;  4HLE A;  2RGF A;  1MKE A;  4B6H A;  5CLQ B;  3SD5 A;  2YT1 A;  2DZJ A;  2LVQ A;  1Y8R C;  2YT0 A;  4NJ7 A;  3E9O A;  3QIJ A;  2Y8G A;  1G6J A;  3VTU A;  3VVW B;  2HTH A;  4MY6 A;  1OMW A;  1R4N I;  3K9O B;  2FAZ A;  1V5O A;  2I1J A;  1KZG A;  3RD2 A;  1U5E A;  5KCV A;  1ST7 A;  3PLV A;  3PSE B;  2DYN A;  2KX3 A;  2KWV B;  4MK0 A;  2EMT A;  1YD8 U;  2HJ8 A;  3ZVR A;  1FXT B;  4HJK A;  3FLV A;  3DXD A;  2FCN A;  2K2J A;  4DHZ E;  4WJQ A;  4ANW A;  5D27 A;  1MIX A;  2IO3 B;  3A98 B;  3VUY A;  4AJY B;  3H1U A;  4F7Z A;  2Z59 B;  2KGX B;  4E71 A;  3QAR A;  2LJ5 A;  5DIF B;  4GB9 A;  1P3Q U;  2NR2 A;  2R82 A;  4NJ6 A;  5HKH A;  1V61 A;  2BCJ A;  3ML4 A;  2HTH B;  5LXI B;  3O96 A;  3QWZ B;  1IP9 A;  2C7M B;  2DYO A;  3JSV A;  5JHB A;  4JK7 A;  2FJ9 A;  3AI5 A;  1TQZ A;  2KOX A;  2LGD A;  4KZC A;  4W9J A;  3C0R B;  4NPN A;  4WSF A;  3ZO5 B;  3U7D A;  1WGD A;  5CTR C;  3DCG A;  4MJS A;  5C6R A;  2L0F A;  1J0G A;  2MBQ A;  1M7R A;  1KBL A;  4TQ0 A;  1GC7 A;  2ADZ A;  2R2O A;  5C5B A;  5JP4 A;  1R4M I;  3T06 A;  3DDC B;  5E6N A;  3W1S A;  1A5R A;  1Q67 A;  1XT9 B;  3TO1 A;  3PTF C;  1V5T A;  3WAP A;  3V5W A;  4RM9 A;  1Y19 B;  5DH9 B;  5C23 A;  2D9V A;  3WA0 A;  2K8C A;  4B95 A;  3PVL A;  3DXC A;  4GPT B;  4YL8 A;  3TVV A;  3PEG A;  4HHV A;  1V9J A;  3K9P B;  2LVP A;  2FIF A;  1OQN A;  3A9K A;  2KC2 A;  4JKD A;  3ULC A;  4EKU A;  2RPQ A;  3LDZ E;  4NAW B;  1Q0W B;  2FCM A;  2KKC A;  3NZS A;  1YJ1 A;  3PRP B;  3N32 A;  2MWS B;  3QHT A;  2KTF A;  1P3R A;  5J3Y A;  4IAP A;  1GC6 A;  1AQC A;  4M8N A;  1U29 A;  2X18 A;  2KDF B;  1FB8 A;  1BTK A;  5DCN A;  2FJL A;  3WAO A;  2ROZ B;  2MBB B;  3CXB B;  4K2P A;  2R2Q A;  2O6V B;  2AEH A;  4YON A;  1KJT A;  3ZDT A;  1XX0 A;  2BGF A;  4CHM A;  5C16 A;  4GIV A;  2QKM A;  3L17 A;  4WJP A;  4A6F B;  3MPX A;  2J7Q B;  3UQA A;  1EUV B;  3AJ4 A;  2V76 A;  2NBW B;  3U8Z A;  1IYF A;  4Y94 A;  1P6S A;  4HXD A;  2JZZ A;  1L7Y A;  4IM0 A;  2OTX A;  4NSW A;  3ULB A;  2J0K A;  2FNJ B;  3VQI A;  1WI1 A;  4FJY A;  5EDS A;  2O2V B;  2CR5 A;  4NQK E;  1U4A A;  1VD2 A;  4EZJ A;  3ECI A;  4HVB A;  5HE0 A;  2DTC A;  1NU2 A;  2A4Z A;  2GMI C;  2PE6 B;  2KN5 A;  4FBJ B;  3ZVV A;  4EMO A;  2RSU A;  5D7G A;  3CMM B;  1GGO A;  1M94 A;  2OOB B;  5JHH A;  2LI5 A;  2DYB A;  4F8C B;  5JVL A;  3DBH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...