4JKHA

Open and closed forms of d1781e human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVEDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkhA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkhA01
4JKFA 4JK7A 4JKAA 4ILJA 4JK9A 4JKGA 4JKEA 4JKGB 3ENBA 4JKCA 3E9OA 3E66A 4JKHA 4ILGB 3E9LA 3E9PA 4ILHA 4JKBA 3SBGA 4JK8A 3SBTA 4JKDA
chains in the Genus database with same CATH superfamily
3CYMA 2A1RA 1ATRA 3I33A 2XY7A 4K42A 2JWKA 3SUQA 2FBYA 3HSTB 2BTFA 1S1VA 1S5JA 3NAEA 3CJAA 1NKEA 5I3UA 1FKOA 1SGHA 2IVOA 3E9PA 4JN4A 3S3OA 4CHOA 1XI1A 1OH6A 1S72N 2ABDA 1I94K 3WA0A 1U4BA 4BE0A 1VRUA 4FJ8A 4WQ5C 4KHWA 3DLEA 3PUFA 1UWBA 1FW6A 5AQRA 3V9SA 3DLKA 4BG9A 4B9TA 3FE1A 1BI4B 1HLUA 1NGDA 1XHZA 2ZJQL 4O55A 1A5WA 2WONA 4ZTJA 3A0IX 3LWLA 1RT5A 2QWPA 1VQMN 1CXUA 2XRIA 4H4OA 3M6GA 4CBXA 1XNQK 4H5RA 3O4WA 3AVCA 3GOIA 1IJJA 3EPYA 3IMXA 1TUYA 3C0BA 3I0RA 2E2NA 5BREA 3T69A 4W5NA 2LSNA 4ELVA 3ULEA 5B8HA 4E7IA 4CJUA 4JKGA 4CZFA 1BO5O 1KTQA 3HPHA 4BR7A 4C8KA 1DTTA 1HRHA 4O4GA 4RW6A 3CC4N 4JV5K 2IDOA 1C0UA 1VSKA 3CJ1A 3FZKA 2HRJA 3BGRA 3KWGA 4C1NK 4E7KA 1IBKK 3EE8A 1NVLA 4ISFA 4AHRA 1Q9YA 1NK5A 3AARA 4LF5K 2YJFA 1W7AA 4BROA 4CGHA 4YOTA 4IOCL 4C8NA 5HOOA 4AILC 2X74A 4CZLA 3LP2A 1HB6A 4DS4A 3NF9A 1J5EK 3BEXA 3DLLL 2AJQA 3L2WA 4G1QA 5F0XA 4H0VB 2ASMA 4KHPK 2J4RA 3ASMA 2Z1GA 5F1XA 1IO2A 2KQ2A 3VN5A 3OYAA 1YHQN 4EZ9A 3MX2A 3WEEB 3ZETB 3NF8A 1BIUA 2NRWA 2J0JA 1BL3A 4PHTX 1NGAA 2IIRA 1BCOA 4ZHRA 1ATNA 4IKFA 4GKJK 3A5LC 5AQHA 4JRPA 3DXKB 2QKBA 1WSHA 4BWMA 3OYNA 5BN9A 2DPNA 4DTMA 4W5OA 2F9TA 2FSNA 1QHTA 3QEXA 3OS2A 3O3FA 1A5VA 5IWAK 3AY9A 5KTQA 4N56A 5DMRA 1NWKA 3UKRA 2IC3A 4FO0A 3MEDA 1VSJA 1WNSA 5J2MA 1C1CA 3AO1A 3THXB 4CJRA 1M1KO 3VGKA 2QWMA 1JCEA 5AFUH 3FFIA 3O4QA 1NK8A 3J7ZO 2YVCA 2YI1A 1TV6A 3ULDA 4Z4HA 3WT0A 4A5AA 3N4QA 1DIKA 3NH2A 2Q3SA 3VQBA 5HP1A 5AR0A 2A40A 5BRDA 3QIOA 5FPNA 2FSKA 4JKHA 4DU4A 4DTOA 4IEIA 1S3XA 1BU6O 1UOCA 4E1JA 2WH5A 3M8RA 4IWVA 1Y19B 4IG0A 3C7NA 2BGGA 4OPAA 1KVCA 2WBNA 3LALA 4CF9A 4ILJA 1TKZA 4Q5VA 3U3YA 2ASPA 4O0IA 3HL8A 2YHAA 2ZWHA 4Z4EA 2JGUA 4KTWA 3HOSA 2YV0X 3W3DA 4W5TA 1TAQA 4K41A 5M1QA 1C1AA 1OVQA 4CJKA 4DR1K 1XNRK 4FLYA 3LDQA 3NDKA 3AO5A 1X9MA 4HUGA 4NLBA 3OYKA 4CJLA 3NGZA 2HHWA 4B1ZA 2V7YA 4MDBA 4GW6A 2YHWA 3DRSA 3K5NA 4FJGA 3K2PA 4CGJA 4CECA 4GVEA 4YY3K 4M3YA 3C65A 4OPJA 4IG3A 4BR9A 3OVNA 3DLBA 4F8RA 5AQMA 3CCRN 4CERA 4ZRKA 3DYAA 3RTVA 2HBLA 1TKTA 4F3OA 1XC3A 1E4FT 4M3WA 4FL9A 3K9KA 1NMDA 5FPEA 2P9IB 3R3LA 1LAWA 2D0BA 2DY4A 5D3GA 3RSEB 3SCXA 5IT9O 3TARA 1KD1O 3PIOL 2YKMA 2A1SA 2GUPA 4BRFA 5ELZA 1S1UA 2Z1HA 3O9QA 2HVIA 4AHUA 1WBBA 1J19A 1X3MA 4WYBA 1QQOA 4PQUA 4CBWA 1LWFA 1V4TA 1G15A 4DR7K 4KAZA 1UA0A 5SZTA 4KH4A 4NCAA 3Q7CA 3VEXA 4CE9A 5FPMA 4AM6A 2P9PB 2ZJPL 2OPPA 5KQDA 2ASOA 1TGOA 4NXNK 5CHIA 1KAZA 2PYJA 5A2QO 3QICA 4YDUA 1V4SA 1X9WA 4CIFA 4DQRA 1RDDA 3SLCA 2VG7A 4H4MA 4PL7A 1EQYA 4ISEA 3VQ9A 4FPBA 1JCGA 2HSTA 1K8AO 3BINA 1J54A 1MDUB 3K58A 4DFMA 5BPMA 4IOXA 3WNFA 1C6VA 4M45A 2YNGA 1VQ9N 1H4RA 1YVUA 3L2QA 2P9UB 4A57A 1OVYA 3E9OA 3CIPA 1CZAN 4FK2A 1VQ6N 1WSJA 3ZX3A 1NK0A 3JYTA 2G8WA 1EWQA 4CEFA 2A6AA 2OA8A 4FJ7A 4N41A 4MLEA 3THWB 2B6AA 4J2EA 2Q0RA 4O5BA 4BE1A 3F9KA 3SUNA 5AQQA 1KVAA 4EKUA 3MN5A 4RCHA 1C0TA 2HBJA 5H1SQ 1HNXK 4DCHA 4O5FA 4EHUA 1U04A 3V4IA 2AA4A 3HK2A 2D0PA 1RBTA 3J7AP 3TAMA 3F9MA 4O44A 4I6MA 4KKOA 4BC3A 3BF1A 1ASWA 1SKRA 4JK8A 1RBRA 1VQLN 1TYQA 3DXMB 2J0MA 1ITGA 1SUQA 3SYZA 3HOTA 3AVLA 2HVHA 4QCLA 3ZT4A 3V1OA 4LF9K 4KB0A 4H0PA 1HYZA 4Z4CA 4FLWA 3P39A 4CHYA 3KLHA 3R9PA 3AA4A 5C12A 4BGBA 2Z1JA 1RDBA 3OYGA 3D2EB 2OZMA 4JI0K 3SBGA 1HB8A 5HRSA 2QI2A 3ATVA 4M3RA 1U45A 3U3GA 2HNZA 1RBSA 3PO5A 2DFEA 3H45C 5DM6L 3VA3A 1NG9A 5GAEP 2P9LB 3AO2A 3HZ6A 5HRRA 1W97L 1DLOA 1DEJA 5AQXA 4A61A 4EZ6A 1MA9B 4TKNA 2AL6A 1NI2A 3AO3A 4RG8A 4FK4A 5EXWA 4Y1DA 4BC2A 2AEHA 4DS5A 4KV8A 3U9DA 4BVOA 3SUPA 1VAZA 4JD2A 1OH5A 3I8BA 4LSNA 3VETA 5C0YA 3OS0A 4AQYK 3VQ7A 4CK2A 1NJYA 4FZZA 3QIJA 4Y0WA 2ZQBA 2O8EA 5JMVA 4FWLA 4GXBA 4M3TA 3RWUA 2OTJN 4WQ4A 2OZSA 4DTXA 3NHGA 4KI4A 4YOXA 3CM5A 4B1XB 1RT2A 3T1AA 1QZ5A 1RBVA 3ZCMA 1TK0A 2P9SA 4JKDA 1E4GT 1VSFA 3ZSQA 4KO0A 4OKKA 4BQLA 3TWHA 1Q9XA 1WLJA 1KSPA 4OPKA 4FSVA 4GV3A 3LM9A 4FPAA 4CZKA 3BUZB 3I8DA 4YOVA 4CYEA 3CM6A 1OH8A 2O8BB 4FM2A 1ASUA 1VQ7N 3R8EA 5FROA 3OTOK 4HUFA 4KHNA 1GLFO 1GLJO 2KFZA 3EN9A 3VF2A 3PVLA 1XUPO 3L2RA 3D7EO 1J5OA 3OYLA 3EYZA 1XMOK 3HI0A 3MXJA 3CCEN 2W40A 3KJVA 3HXMA 4E7LA 3MWTA 4E19A 4B3SK 1RT1A 1GC7A 1I3AA 1D8YA 1SQKA 3ZX2A 1ZBIA 1U49A 1S6QA 3BF3A 4JS5A 4YNQA 2IAJA 3U9ZA 2UXDK 2DFHA 1TKXA 1NK6A 4B3TK 2QKKA 1KLMA 1RBUA 1GLAG 3LDPA 4B9UA 3TSUA 1EXQA 1N33K 3V1RA 1WUAA 3DOLA 2P1JA 5HROA 1K73O 1ZBFA 3LZJA 4BRPA 4JKGB 4DUYK 1J9AA 2Q2RA 1RGIA 3VEYA 1NK7A 3OBWA 4BRMA 5C10A 2O8FA 1VSEA 4BACA 1QVGM 4FLUA 1NKCA 3RMBA 1KAXA 3WXLA 1GLEG 1NJXA 4FJMA 5AZJB 3U6FA 3VENA 1VBGA 3I0SA 4KHYA 4F2SA 1HYSA 4DFPA 4J2AA 1NGHA 3QBXA 5LMUK 3K5MA 4CFCA 3CI5A 1QS4A 1WSGA 4BR2A 2G8HA 2E5LK 4DSLA 1WOQA 1HJOA 1IG8A 2A3ZA 3SV3A 4KTQA 4M3ZA 2D1KA 3J7YP 3BY5A 1NBWA 4HVJA 4NY0A 1QHAA 3D2FA 4B1YB 1T7PA 4CJFA 3BZCA 4B8AB 1NMNA 1Q18A 1EP4A 1VHXA 4P7IA 4CFDA 4LC9B 1ZC6A 1BHLA 3AVAA 4A5BA 1N6QA 4KFBA 4A2BA 3A5MC 4NCBA 1JLBA 4BREA 4H5VA 2F96A 4FJLA 4E7HA 1XMQK 1FKPA 4M41A 2IVNA 3OYBA 1NGCA 5J2PA 3DMJA 3E1YA 3EEQA 4DV5K 3K5LA 4CJ3A 1BUPA 4WF9L 5F2RA 5MLCQ 4CIEA 2OCEA 4K8XA 2F9WA 1ZBHA 3M8QA 3H08A 1VK0A 3J81O 3LANA 4FWNA 1JLAA 5EU7A 1RT3A 5CZ2A 3H6EA 4ID1A 2OYQA 3AV9A 2O8CA 2P9NB 2QK9A 4FVMA 1KCFA 5GAGP 5TKYA 4YOYA 2YJEA 4OGCA 3CFOA 3ZLJA 1RTHA 2EX3A 4CF1A 4CJEA 1HNWK 4DLGA 2FDQA 1L3TA 4YL8A 4XH5A 4CIGA 2EMSA 5BPLA 1VQON 3QMLA 4DQPA 5I42A 3N4PA 4DSKA 4B1UB 2PAVA 5CY4A 4FJNA 4AH9A 4BRCA 4FLVA 3D0PA 4NXMK 4DB3A 5AQYA 1GLDG 1VBHA 3AA2A 3VQQA 4CCHA 3H3OB 3QO9A 3VA0A 2QW9A 1S1WA 3NVMA 3TR8A 3ZT1A 1HNIA 2YCHA 1T05A 2D0CA 4FK0A 3VQCA 3GDQA 2VGMA 4CJ7A 2I1KA 3KK2A 4KREA 3HP6A 4RWTA 1HYVA 1T8EA 1LW0A 2DFFA 2PYLA 3MCAB 4F9OA 4O0JA 2B4JA 1YAGA 1SS6A 3GE1A 4IFYA 1JLCA 2FF3B 1KQSM 2PFUA 2LBBA 4QS7A 4HCCA 3ID6A 3MN9A 1DTQA 2ITGA 4FJIA 3OYIA 4CZHA 3DRRA 4U7BA 4FYDA 1XQSC 1B92A 2D10A 4CI6A 5AQWA 5BR8K 3K0SA 3CJ9A 3UKUA 4B9MA 3QNNA 4OKJA 3FZHA 4BDYA 2ZF5O 4CVNE 1FXXA 3O6WA 4H0OA 1YI2N 4DR5K 1Q86O 4DR4K 1HNVA 1KXPA 1NOZA 1G99A 3C6TA 2VWKA 4CFBA 4BDZA 1KC8O 3TPQA 5C24A 5LY3A 4L3QA 1ZBSA 3BZKA 3CCLN 2EHGA 2CGJA 2Y1IA 4KPYA 5LMNK 1BDGA 2ZPYA 3VEZA 5AQNA 2IS3A 1CZ9A 4CEOA 2UYTA 1J53A 3O3GA 1QQNA 1YF5L 3PSIA 4F2RA 3QEWA 4DF4A 5M1NA 4DTJA 3DRPA 3MX5A 3AVGA 1NGGA 3V9ZA 3ENHA 4JKCA 3M8PA 3ZSZA 3WXMB 5C42A 2Z1IA 4YOWA 2ZJRL 4X62K 4NYNA 4RW8A 1A5XA 3O9UA 4DFJA 3NBPA 1VSDA 2KKZA 2NZTA 1DGKN 2JWLA 3R6MA 1QSSA 2W6KA 3KK7A 1FJGK 1JCFA 4BGAA 1NGEA 4UQGA 4J8FA 4J2DA 1KBLA 3LDLA 1VSIA 3H1QA 2NRRA 3CJ7A 3SPYA 2IVPA 2Q31A 2X0SA 2GELA 4LFAK 1WSEA 1SL1A 4OLBA 5DM7L 5CYMA 4E1NA 3QETA 4E0DA 2EWSA 4XH1A 3SJHA 3CC2N 3TAQA 1ATSA 3OJSA 4IZ9A 1TYQB 4KHSA 4CFAA 2NRVA 4R5PA 3ZEUB 2D11A 3O9SA 5C15A 3TTDA 4MQ3A 1RNHA 2BUPA 4F7GA 1U2VA 2F7TA 5JVHL 4BRAA 3S3NA 3C6HA 2DTUA 4CJSA 2AP1A 1O1WA 4YDUC 4Z4IA 4BE2A 3SK3A 2RHKA 2FC0A 5LL6Z 3OY9A 4B8CA 2QWQA 2VG5A 2W41A 3ALYA 1N5YA 1NM1A 2HNDA 4WFAL 3CCQN 1QTMA 4H0XB 1P8ZA 3O80A 4GNIA 4H8KA 4QS9A 1MIZB 4BRGA 3VEOA 4BR4A 1MU2A 4A62A 5KPTA 3M5RA 4JI2K 1ILYA 3VQPA 3H1VX 4G9ZA 3OYJA 4CF2A 2P9KB 1VQPN 5J1EA 5ADXH 3WNEA 1T03A 4PKHA 4JD2B 1NU0A 2QM1A 2ITMA 2HMIA 4DSFA 3S3MA 2ZM6K 3THYA 5IJMA 1NK9A 3F73A 1C0GA 3V9WA 3MK6A 4BR5A 1B9FA 3WEEA 3ZETA 4FWSA 2ZGZA 3TSQA 3R1XA 3CERA 3WQUA 4BDPA 2VWBA 1K8KB 1NK4A 1HKGA 5GINA 1N36K 5E84A 3DXKA 3OBYA 2CB8A 3MEGA 1JLGA 5CE3A 5E41A 2VQEK 2P9SB 4BRKA 5LJWA 4C8OA 3AAPA 3HPOA 4NCGA 3TAEA 4ELTA 1J6ZA 1HQEA 3IRXA 5JLHA 4JRQA 3CFRA 1GC6A 1LWEA 4JK9A 1O13A 3THXA 1C0MA 1LW2A 4CZGA 2UUAK 3CETA 4YFUA 4ILGB 4FJXA 3AVBA 1HPZA 5AJ3K 3CD6N 4KHQA 2NNWA 4JNEA 4PA1A 5EOYA 4K8ZA 1JL1A 1GLCG 4CJ4A 2GWKA 4IO8A 2KLAA 4V19S 1C0FA 1HMVA 4MO5A 5T7BA 3HRGA 1F21A 3SUOA 3LAKA 1D9FA 5M1FA 2BDPA 2VCPA 3LDSA 3WNGA 3DLHA 4Z94A 4JKEA 4PWDA 4LH5A 3SMSA 4PKIA 3CJCA 4RW7A 1VSHA 4YOUA 4DR2K 3WUHA 1IKXA 4GVMA 3DLRA 5KGWA 4B3RK 3AVMA 2KHOA 4DHYA 3SBTA 3ITHA 3G71N 3PO4A 5AQPA 1SZ2A 1CZBA 3CCVN 3DLGA 4WQ4C 4DQSA 2FJ9A 4JHDA 5DK5A 4FW2A 2YHYA 4XEIA 5AQFA 3JAMO 3L8BA 2D5RA 3G25A 3G9WA 2O8FB 4E89A 2WTUA 1Q81O 3IDHA 1ISNA 4NLCA 2YNFA 5AQLA 3ZSOA 3EZ5A 1MK9B 1OKJA 4K43A 3QNOA 4DV2K 2Y1JA 1K6YA 4BRQA 5AZIB 3KZBA 4IXCA 4DV6K 1S9EA 3OYCA 4EAHD 4KHUA 4FLZA 4DFKA 3CMAN 3AVHA 2FXUA 2JLEA 4CJPA 3AVKA 2F8SA 3RR8A 3FZMA 3VQ6A 3JXUA 3PLAA 3DI6A 4DTUA 4KRFA 2Q0UA 2NRXA 2FBTA 2GTDA 4X65K 2F8TA 3VQ4A 3HP9A 4FZXC 4B3OA 2QWOA 1YJWN 2FF6A 4C1NI 1VSLA 1R59O 3KKRA 4CD3A 1SV5A 2IOCA 1ZBLA 2PBDA 2GEMA 1QSLA 1YTAA 3D2FB 3NCIA 5HLFA 3NH0A 1XHXA 5C25A 3ZSWA 3SJJA 3KLEA 1D9DA 1Q7YO 1WN7A 3A2FA 3L4IA 4IJNA 4LY7A 4CHNA 2P9IA 2E1YA 5SWMA 1JLEA 1NOYA 3DWLA 2V7ZA 4F4KA 4EP5A 3OYFA 3RSEA 2E2PA 2QA4N 3CC7N 3GL1A 4JS4A 2GBZA 4FWQA 3SNNA 3ATUA 4CJTA 3L2UA 3TSPA 2V51B 3CHWA 1VQ8N 3KVGA 1TL3A 5AQSA 1H1VA 3AA5X 4PL8A 4CK1A 1GLLO 1KFDA 4JKFA 1S1TA 4Q0BA 3LPTA 2EMTA 3HM8A 3AAQA 2P9PA 2W6LA 3HVTA 4IEEA 2E88A 4PUOA 3SQ4A 5C2DA 4BY9C 3NMUA 3O5BA 1L3VA 4J2BA 3SV4A 1QSYA 4FOIA 2R82A 1ZXOA 3RR7A 2O8CB 4JI5K 3P5JA 3HJFA 1N8RO 3QFUA 2GX9A 3VERA 4WFBL 3G4SN 4JKAA 5JVGL 3V81A 4DSIA 4GKKK 1JLQA 2P9UA 4BRNA 2V52B 3SI6A 3PV8A 4JI7K 4C8LA 4LF4K 1YITN 4DQQA 4O8UA 1NNEA 4HUEA 4JKBA 3KKSA 3VESA 5AFUA 4FJ5A 1RT6A 2I7NA 4MFBA 4OLAA 3EE9A 1D5AA 1QE1A 2E2QA 2A41A 3QDKA 1GG3A 4CW7B 3KLIA 5JICA 3OYHA 1IG9A 4B1VA 5FRMA 1ASVA 4DV7K 4FWRA 2YHBA 3V9XA 4H5TA 3CF5L 1Z05A 3ULEB 3FLVA 4IOAL 4DR3K 2A42A 4ZRIA 3KK3A 5JVLA 3CJBA 3IUCA 4K0KK 3ZDTA 3DXMA 3VF4A 4I9QA 3ZSVA 1RTDA 2B5JA 3QB0A 5AQIA 3LAMA 3O08A 3OS1A 4DU3A 3NGYA 3SMPA 3FFKB 4DSEA 3G0ZA 1YIJN 1QVFM 3T19A 3PSFA 3VEWA 3P4IA 3NFAA 3SPZA 2ZD1A 4CEZA 1TK8A 2P5GA 5EVZA 2DIKA 3VOVA 1VQNN 2X78A 4AHTA 4YHHK 1WSFA 5C2FA 3MEEA 4B1WB 1N34K 5KRTA 1TK5A 4LF7K 4FM1A 4I9LA 5BR9A 3LP0A 2WC9A 3UE5A 3S41A 1RT4A 5AQGA 1WAJA 2P9LA 3VQEA 4FLXA 3TANA 3UKUB 3CQ8A 2CH5A 4M63C 1NTIA 2WFBA 3DM2A 2GWJA 4DV4K 2P51A 1YTUA 3M3ZA 3HPGA 3M8SA 4OKEA 5CZ1A 2G8FA 3K59A 2HHUA 3PX6A 2Q97A 4KH5A 3L3UA 3BP8A 2I5JA 3E01A 2QWLA 4H5NA 4BR0A 1T6DA 3H3NO 1NJZA 3UKRB 4FW1A 3TAGA 3J8AA 3OYDA 3P83D 3M1FA 3O9TA 1RTJA 3TTFA 1CLQA 4LH4A 5KPRA 3DJCA 4CHQA 4Y1CA 5EX5A 4DTPA 3ZYYX 1NGBA 1BIZA 3EY1A 3O1WA 3CQXA 2QWNA 4IFEA 3VGMA 4BQZA 1KVBA 1ACAA 1W9HA 2UUCK 2R7YA 3ZX0A 4CEAA 2KW4A 2G8VA 1R0AA 1HUXA 1RFQA 3C95A 3T7ZA 2O8BA 3LDNA 1OH7A 3I55N 3AVIA 4DMNA 3HT3A 2G8KA 4L8RB 3RMAA 5HRPA 3MN7A 3WNHA 4CGIA 4BRLA 1RDUA 5E26A 3KD1E 1LCUA 1X3NA 3C7NB 1IKYA 5BPNA 2QEXN 3VQ8A 2H3GX 3LM2A 3WXIA 3TU5A 1YUWA 1UAXA 4DXAB 3KIOA 4WFNL 3PY8A 2RQ1A 1U48A 1EWRA 4JI8K 4JYAK 3RMDA 5AQKA 4HTLA 3QIPA 1TL1A 1L5UA 3C6UA 2CQUA 2ZE2A 3CXCM 2BE2A 3F5TA 3THVA 2IGIA 2RF2A 1MK7B 4DR6K 4QOZB 1GLBG 4C8MA 4BVPA 1IKWA 4CHZA 3NH1A 2G8UA 2QTDA 3FP5A 3H46O 4AHCA 2Q36A 2XY5A 1MIXA 1U2VB 1RDWX 2PY5A 4A2AA 1IH7A 2UUBK 5CR4A 3QEPA 1LAVA 5KPZA 1K9MO 3Q7BA 1HX1A 3SAFA 1VQKN 3NGIA 5JLFA 3KK1A 4YORA 1IV0A 5AQUA 5AZJA 4CJ5A 4GV6A 3T1YK 4BRDA 2YHXA 3ZSRA 3TAPA 4WQ5A 1DKGD 1S22A 3LP1A 4NB4A 3X23A 2YKNA 5GIOA 3A5OC 4ELUA 2RN2A 4X64K 2ATQA 1FK9A 3MMVA 1HKBA 3B8AX 3UIQA 3QERA 3I56N 2ETJA 4EP4A 4DF8A 4BRHA 4NO7A 4B9QA 2GV9A 1KRPA 2OPSA 3VPZA 4FWPA 3MXMA 4KB1A 3O9RA 4W5RA 1P90A 2PZSA 3NE6A 3LPUA 3THYB 4BRIA 3GBTA 4H03B 1XC9A 4FWMA 3J80O 4AHSA 2O8DA 2NRTA 4N47A 4CK3A 3SQ0A 3IFRA 2COPA 5FDLA 4Z4FA 4CF8A 4EIAA 4CZIA 3TABA 3A5NC 4CEEA 2HF3A 3B6PA 2XY8A 3MECA 5K14A 4CZMA 1VRTA 1VQ4N 1M90O 1X1PA 4RTFD 1T44A 5J2QA 3ZT0A 1S6PA 4FJHA 4B9SA 3CPWM 3CCSN 2X6NA 3RVCA 3V1QA 5LJVA 3O3HA 3CMEN 1JL2A 4XH4A 4OVLA 2OTLN 3CCJN 5KRSA 2E2OA 4JI3K 3FZFA 3V6DA 2P9NA 4FOEA 1SL2A 3NF7A 3S9HA 3CCMN 4ZRJA 5HL7L 1YVNA 4EFHA 1BI4A 1EO1A 1L3UA 1SKWA 4FZYA 1HBKA 3ZSYA 4PKGA 2D2QA 2G8IA 3L2VA 2KZMA 1BQMA 2E4LA 5M1PA 1QZ6A 1Y97A 4I6MB 5GIPA 2RKIA 3VEVA 3G10A 3FR0A 4IJAA 3RMCA 3AVFA 4H5WA 3OW2M 2OANA 4FWKA 2HBMA 1BQNA 3CCUN 2BH1A 4OO1J 3CG7A 3L0QA 2E6LA 4EHTA 4JHDB 3FGUA 1RDAA 1RT7A 4BC4A 3KHYA 1GOAA 1HR0K 4HDOA 3G6EN 3EL2A 3U8ZA 2FBVA 3HVRA 1CXQA 1WSIA 3U8XA 3CFPA 4WE1A 1EETA 3GG4A 2UU9K 4CGGA 2FSJA 1NGFA 2YNIA 3MDQA 4LF8K 1NKBA 3PX0A 4M3UA 4KI6A 3AGKA 5AQJA 4CJWA 3ENBA 2OPQA 1NLVA 3E66A 2WOMA 3D45A 4OGEA 4CESA 3SZ2A 4DWIA 4KBOA 3ENOA 3VQAA 4FJKA 1WAFA 3AU4A 3SQ2A 2HOEA 1RILA 5M1OA 4FJ9A 2NRHA 3K5OA 4HDQA 2A5XA 1YT3A 4IDKA 4E3SA 3LL3A 4B9VA 4UY8O 4H0TB 4JLHA 4LFBK 2O8EB 2GUIA 4LFCK 1DT9A 3PZDA 3ZT3A 1T3VA 4IO9L 1W2BM 5J2NA 4Z0UA 5M1KA 3OYMA 3AVJA 1BOTO 1IKVA 1L3SA 5GADP 4XIUA 1EKEA 5CYQA 3VTHA 5KGXA 1LOTB 2O4IA 4C23A 2E6MA 4OJRA 4CJQA 1GOBA 4MLHA 4CJVA 2D0OA 1BA1A 1UA1A 3MCPA 4DV0K 3QESA 4B9LA 4DG1A 5BRFA 5BN8A 4JK7A 3UB5A 4DLEA 2ZGYA 2HE7A 1LWCA 3RRGA 3NVKA 1YJ9N 4A59A 2YNHA 4IBNA 5TKWA 1XWLA 3TI0A 4DSJA 3QINA 1MWKA 1YJNN 3O4NA 4HCBA 1TUUA 3T3FA 4DTSA 3FZLA 2BANA 4CGFA 4LD0A 3QEIA 4FVUA 2HW3A 3L6QA 5KI6A 3EZWA 2E8AA 2D0AA 3QEVA 5FRNA 4F3TA 1HJRA 4CZJA 2HMPA 5FLXO 1JXBA 2HNYA 2VWJA 4JEPA 3K9JA 4DV3K 2VYPA 3JSMA 3MXIA 1E5WA 1Z25A 1BWFO 4JI1K 3OHRA 5HBMA 4MO4A 3KD5E 1C1BA 4DQ8A 4QS8A 3WXKA 1VQ5N 3P31A 4ZTFA 3IAYA 3OA9A 4PY5A 3QFPA 3LZIA 1I39A 1IBLK 1ESVA 4HHTA 2CH6A 3AVNA 4FWOA 2HHQA 4ISGA 5AQVA 1RCHA 2W42A 4B08A 4GV9A 2RE2A 4E1MA 1NGIA 1KLNA 4N76A 3HO1A 3WXJA 1U47A 5AQTA 4W5QA 2NUBA 3IVFA 3HBTA 3A8YA 3EO3A 1Y64A 2HF4A 4CEDA 4AF1A 2UXCK 3ZEUA 3P38A 1D4XA 3D6RA 3LDOA 1HNZK 3IS9A 1Q82O 3AO4A 3MWPA 4OX9K 1B9DA 1TKDA 1ZYQA 1WB9A 4I2PA 1VSMA 2YX6A 4LSLA 4AM7A 4JI6K 3QLHA 2KZZA 2NRZA 4CF0A 3O1BA 2P5OA 3W0LA 3TAFA 1EF1A 4O8KA 3B6OA 5BRHA 3AU5A 2VQFK 4AHVA 2HHTA 4TSXA 4FM0A 1ZBUA 4CHPA 5HRNA 1JXEA 3MAQA 4M7XA 2QXFA 3IKMA 3EKSA 3CQYA 2P9KA 4U67L 2CGLA 1RDCA 3IG1A 1IBMK 4B3MK 2F4VK 2Q1NA 1SL0A 4BC5A 4GY2B 1HPMA 3T1HK 4IFVA 3U4LA 4CEBA 1S1XA 3ZT2A 2E1ZA 1KAYA 3RRHA 1NGJA 3KLGA 5JS2A 4X66K 1RTIA 4M7YA 1MWMA 1HKCA 3AGRA 2WUSA 1WBDA 3SAHA 3HM9A 2HHVA 1K8KA 3LWMA 1BG3A 4JAXA 2J0KA 3O8MA 4RW4A 1NJIO 4N5SA 1E3MA 1YXQA 3U7DA 4B9NA 5I9EB 1QQCA 5KQ8A 2E20A 5AQOA 3C94A 1NJWA 4M3XA 2HB5A 1QQMA 1TVRA 4E7JA 3HYFA 4OPHA 2O4GA 3AA3A 1W0HA 1ST7A 2KTQA 1T6CA 1X9JA 4M42A 3ZSXA 4FLTA 4R79A 3ISNC 2UXBK 2XHBA 1KFSA 3HSCA 3THWA 4CEQA 3NF6A 3TTCA 3LP3A 4RW9A 3K57A 4BG8A 5FPDA 1REVA 2VG6A 2X6SA 2CGKA 2HBKA 5AQZA 2HHHK 3CPEA 4MDAA 4IDHA 3PX4A 3VGLA 3C6AA 1SKSA 4QAGA 1S9GA 3VTIA 5EY4A 4CZEA 4I7FA 4CGDA 3VQDA 3MN6A 1JJ2M 3KWIA 4JI4K 1JLFA 2QXLA 2RPIA 3ID8A 2HHSA 1BCMA 3OJUA 4DU1A 3P1GA 1KC7A 4DTRA 4BWJA 2D4WA 2NLXA 3VQ5A 3QBWA 4ICLA 4GMJB 3DOKA 1JDEA 1GGOA 4NYFA 3DAWA 4CBUA 1SAZA 3EKUA 4DKWA 3V9UA 4I2QA 3D2EA 3SAGA 4DUZK 2FBXA 1LV5A 2FLOA 4FJJA 5AZIA 1JKHA 3BDPA 4HTUA 4HWIA 3L3VA 1TAUA 1BGXT 2QWRA 4KH6A 2I1JA 4DTNA 5JS1A 3FLCO 3L4QA 4LF6K 1BISA 2XO7A 1HQUA 3E9LA 3SQ1A 1Z26A 4ILHA 1Z6RA 2VGNA 4FCYA 1U6ZA 4ID5A 3HTVA 3VMFB 3WQTA 1GOCA 1EX4A 4H0YB 3KLFA 4DV1K 1BA0A 2XY6A 3JS6A 2O8DB 5GAHP 2OPRA 4CD1A 4K25A 4FXDA 1Q8IA 4Z4GA 2I7PA 2KFNA 2HHXA 4KTZA 3PIPL 3OYEA 4DQIA 1N32K 3F2KA 3VF6A 5ADXA 1X9SA 3KTQA 4WCEL
chains in the Genus database with same CATH topology
4BQLA 1J6ZA 1T44A 1ATRA 3I33A 4FSVA 5JLHA 4GV3A 3LM9A 4FPAA 4K42A 4CZKA 2JWKA 3CPWM 2BTFA 1GC6A 3CCSN 3BUZB 4JK9A 4YOVA 4CYEA 1O13A 3RVCA 5LJVA 3CMEN 4CZGA 3CJAA 4XH4A 3CETA 4ILGB 1SGHA 2IVOA 3E9PA 2OTLN 1VQ7N 3R8EA 3CCJN 4JN4A 3CD6N 2E2OA 1S72N 2ABDA 3WA0A 2NNWA 4JNEA 1GLFO 5EOYA 1GLJO 1GLCG 3FZFA 3EN9A 2GWKA 3VF2A 2P9NA 4IO8A 3PVLA 1XUPO 4WQ5C 2KLAA 4FOEA 1C0FA 3D7EO 5AQRA 3CCMN 4MO5A 4ZRJA 5HL7L 3HI0A 3HRGA 1YVNA 4BG9A 3FE1A 3CCEN 2W40A 4EFHA 3MWTA 5M1FA 1EO1A 1HLUA 1NGDA 2VCPA 1GC7A 1HBKA 4Z94A 2ZJQL 4JKEA 4PKGA 3SMSA 2D2QA 4PKIA 1SQKA 3ZX2A 3CJCA 3A0IX 2QWPA 4YOUA 3BF3A 5M1PA 3WUHA 1VQMN 1QZ6A 3U9ZA 4I6MB 2KHOA 4DHYA 5GIPA 3M6GA 4CBXA 3SBTA 4H5RA 3VEVA 3G71N 3O4WA 3FR0A 4IJAA 3GOIA 1GLAG 3LDPA 4H5WA 1IJJA 3EPYA 3TSUA 3OW2M 3IMXA 1TUYA 1WUAA 2OANA 3C0BA 2E2NA 4FWKA 2HBMA 5AQPA 3T69A 1SZ2A 2BH1A 5BREA 3CCUN 1K73O 3CCVN 4WQ4C 4BRPA 4OO1J 3ULEA 2FJ9A 5B8HA 3L0QA 4JHDA 4EHTA 4JHDB 4JKGA 4CZFA 4JKGB 1BO5O 3FGUA 2YHYA 4XEIA 2Q2RA 1RGIA 5AQFA 3VEYA 4BC4A 3KHYA 3OBWA 4HDOA 4BRMA 4BR7A 3G6EN 5C10A 3EL2A 3G25A 3G9WA 3U8ZA 1QVGM 3CC4N 1Q81O 3IDHA 1ISNA 4NLCA 5AQLA 1MK9B 1OKJA 3U8XA 1KAXA 4K43A 3WXLA 1GLEG 3CJ1A 3FZKA 4BRQA 5AZIB 3GG4A 3KZBA 2HRJA 5AZJB 4IXCA 2FSJA 3KWGA 1NGFA 4EAHD 3VENA 3MDQA 1VBGA 4C1NK 3CMAN 2FXUA 3AGKA 5AQJA 3EE8A 1NGHA 3QBXA 1NVLA 3ENBA 3FZMA 4ISFA 3CI5A 3JXUA 3PLAA 4BR2A 1NLVA 3E66A 3AARA 1WOQA 2Q0UA 2NRXA 2YJFA 1HJOA 2GTDA 3ENOA 4KBOA 4BROA 1IG8A 2A3ZA 3AU4A 2D1KA 2QWOA 4YOTA 1YJWN 4IOCL 2FF6A 2HOEA 4C1NI 5HOOA 1R59O 1NBWA 5M1OA 2NRHA 4CD3A 4CZLA 4NY0A 1HB6A 4HDQA 1QHAA 2A5XA 2GEMA 2PBDA 3BEXA 3D2FA 4B1YB 3D2FB 3LL3A 3DLLL 5F0XA 4H0VB 2ASMA 4H0TB 4UY8O 2J4RA 1Q18A 1Q7YO 1DT9A 3PZDA 1T3VA 3L4IA 4IJNA 5F1XA 2P9IA 2E1YA 4IO9L 1W2BM 4P7IA 1YHQN 3DWLA 2V7ZA 3MX2A 4LC9B 1ZC6A 3WEEB 3ZETB 4A5BA 5M1KA 2NRWA 3RSEA 4A2BA 2J0JA 1BOTO 2E2PA 4PHTX 2QA4N 1NGAA 3A5MC 3GL1A 3CC7N 2IIRA 4FWQA 4H5VA 4BREA 5GADP 1ATNA 3ATUA 3A5LC 5AQHA 3DXKB 3VTHA 1LOTB 2IVNA 3TSPA 2V51B 4C23A 3CHWA 4MLHA 2DPNA 2D0OA 1BA1A 5BN9A 1NGCA 3KVGA 1VQ8N 2F9TA 2FSNA 3E1YA 1H1VA 3MCPA 5AQSA 4PL8A 5BRFA 1GLLO 4JKFA 3AY9A 5BN8A 4JK7A 1BUPA 3UB5A 2ZGYA 2HE7A 1NWKA 3NVKA 3UKRA 1YJ9N 4A59A 4FO0A 4WF9L 5F2RA 5MLCQ 2EMTA 5TKWA 3HM8A 3AAQA 2P9PA 4IEEA 2E88A 2F9WA 1M1KO 5C2DA 4BY9C 3VGKA 1MWKA 2QWMA 1YJNN 1JCEA 1TUUA 3NMUA 3O5BA 4FWNA 3FZLA 5AFUH 3J7ZO 4FVUA 3H6EA 3L6QA 4FOIA 2YVCA 2R82A 1ZXOA 2P9NB 2YI1A 3EZWA 2E8AA 5GAGP 5TKYA 4YOYA 1N8RO 3QFUA 3WT0A 2YJEA 2GX9A 4A5AA 3VERA 4CZJA 3N4QA 1DIKA 2HMPA 4WFBL 4JKAA 3G4SN 5JVGL 5AR0A 2A40A 4JEPA 2FDQA 3K9JA 5BRDA 2P9UA 2VYPA 4YL8A 2V52B 4BRNA 4XH5A 1E5WA 2EMSA 5FPNA 5BPLA 1VQON 1BWFO 4JKHA 2FSKA 3QMLA 1YITN 3N4PA 4IEIA 1S3XA 3OHRA 4O8UA 1BU6O 4MO4A 4B1UB 2PAVA 4E1JA 4JKBA 2WH5A 4DQ8A 3VESA 5AFUA 4QS8A 3WXKA 4BRCA 2I7NA 3P31A 1VQ5N 4IWVA 4DB3A 1Y19B 3EE9A 3C7NA 3OA9A 3QFPA 2E2QA 4OPAA 2A41A 3QDKA 1GG3A 5AQYA 1ESVA 2WBNA 5JICA 4B1VA 1GLDG 2CH6A 4FWOA 1VBHA 4FWRA 4ISGA 4H5TA 5AQVA 4ILJA 3H3OB 3CF5L 1Z05A 3ULEB 3FLVA 4IOAL 2QW9A 4GV9A 2ASPA 2RE2A 3NVMA 2A42A 1NGIA 4ZRIA 2YCHA 2ZWHA 3WXJA 5AQTA 3HOSA 3W3DA 5JVLA 3CJBA 3IUCA 3GDQA 3IVFA 2VGMA 3A8YA 3HBTA 3EO3A 1Y64A 4K41A 5M1QA 2HF4A 4CJ7A 3ZDTA 2I1KA 3DXMA 3VF4A 4AF1A 4RWTA 3ZEUA 3LDQA 3QB0A 5AQIA 3P38A 3O08A 3MCAB 1D4XA 3D6RA 4F9OA 3LDOA 4NLBA 1YAGA 1SS6A 3FFKB 3SMPA 3GE1A 1YIJN 1Q82O 1QVFM 3MWPA 4B1ZA 2V7YA 4MDBA 2FF3B 3VEWA 1KQSM 3P4IA 2PFUA 2LBBA 4QS7A 5EVZA 2DIKA 2YX6A 3VOVA 2YHWA 1VQNN 3ID6A 3MN9A 5C2FA 4AM7A 4CZHA 4B1WB 4GVEA 2NRZA 5BR9A 3C65A 3O1BA 4U7BA 3W0LA 1XQSC 2WC9A 1EF1A 4O8KA 2D10A 3UE5A 4BR9A 3S41A 5BRHA 3AU5A 4CI6A 5AQWA 5AQGA 2P9LA 3CJ9A 5AQMA 3UKUA 3UKUB 3CCRN 4ZRKA 2CH5A 2HBLA 4M63C 1XC3A 1E4FT 4FL9A 3K9KA 3FZHA 1NMDA 2ZF5O 5FPEA 1NTIA 2P9IB 2WFBA 3R3LA 2GWJA 3O6WA 4H0OA 1YI2N 1Q86O 3RSEB 4M7XA 3M3ZA 1KXPA 3IKMA 1KD1O 3EKSA 3CQYA 1G99A 2P9KA 4U67L 2CGLA 2Q97A 3PIOL 4KH5A 2GUPA 4BRFA 3BP8A 5ELZA 1KC8O 2Q1NA 3O9QA 2QWLA 4BC5A 4GY2B 3TPQA 4H5NA 1HPMA 1J19A 1X3MA 1T6DA 4WYBA 1QQOA 4L3QA 3U4LA 4BR0A 1ZBSA 5LY3A 3CCLN 2E1ZA 3H3NO 4CBWA 1KAYA 1V4TA 1NGJA 3UKRB 2CGJA 4M7YA 1MWMA 1HKCA 3AGRA 4KH4A 3Q7CA 2WUSA 3VEXA 1BDGA 2ZPYA 3J8AA 5FPMA 3SAHA 3VEZA 4AM6A 3M1FA 2P9PB 3O9TA 2ZJPL 1K8KA 5AQNA 5KQDA 1BG3A 2ASOA 4JAXA 3TTFA 2J0KA 5KPRA 5CHIA 3O8MA 1KAZA 2UYTA 3DJCA 3QICA 1NJIO 1QQNA 1V4SA 4YDUA 5EX5A 1YXQA 1YF5L 3U7DA 3ZYYX 1NGBA 3SLCA 5I9EB 4PL7A 1EQYA 4ISEA 4FPBA 1JCGA 2HSTA 3CQXA 3O1WA 2QWNA 4IFEA 3BINA 3VGMA 4BQZA 1K8AO 1MDUB 5KQ8A 5M1NA 2E20A 5AQOA 1ACAA 5BPMA 4IOXA 1QQMA 3MX5A 3ZX0A 1VQ9N 1H4RA 1NGGA 1HUXA 1RFQA 4OPHA 2P9UB 3T7ZA 4A57A 1ST7A 1OVYA 3ENHA 4JKCA 1T6CA 3E9OA 1X9JA 3CIPA 3LDNA 1CZAN 3I55N 1VQ6N 3WXMB 3ZX3A 4YOWA 4R79A 2ZJRL 3O9UA 3HSCA 3MN7A 2A6AA 1RDUA 5E26A 4BRLA 4MLEA 1LCUA 2KKZA 3TTCA 2NZTA 1DGKN 2JWLA 2Q0RA 3R6MA 1X3NA 3C7NB 3KK7A 5BPNA 2QEXN 4BG8A 5FPDA 1JCFA 2H3GX 3LM2A 1NGEA 3WXIA 4BGAA 2CGKA 5AQQA 3TU5A 2HBKA 1YUWA 4EKUA 3MN5A 4RCHA 5AQZA 4J8FA 4DXAB 3CPEA 2HBJA 4MDAA 5H1SQ 1KBLA 4DCHA 3LDLA 4WFNL 4IDHA 2RQ1A 4O5FA 4EHUA 3H1QA 3C6AA 2NRRA 3VGLA 3CJ7A 2IVPA 2AA4A 2Q31A 5AQKA 2X0SA 4HTLA 2GELA 2D0PA 3VTIA 5EY4A 3F9MA 5DM7L 4I6MA 2EWSA 4XH1A 3SJHA 4BC3A 4CZEA 1ATSA 3BF1A 3CC2N 2CQUA 3MN6A 3CXCM 4JK8A 1JJ2M 3KWIA 4IZ9A 1VQLN 1TYQA 1TYQB 2QXLA 3F5TA 3DXMB 3ID8A 2J0MA 2NRVA 1MK7B 3HOTA 3ZEUB 2D11A 1KC7A 1GLBG 4BVPA 3O9SA 2D4WA 5C15A 3TTDA 4H0PA 2NLXA 2BUPA 3QBWA 2QTDA 3FP5A 3H46O 3P39A 2Q36A 1JDEA 4F7GA 1GGOA 1MIXA 1U2VA 1U2VB 1RDWX 2F7TA 3R9PA 4BRAA 5JVHL 3C6HA 4A2AA 5C12A 2AP1A 4YDUC 4BGBA 3DAWA 4CBUA 1SAZA 3EKUA 4DKWA 5CR4A 3D2EA 5KPZA 3D2EB 3SK3A 1K9MO 3Q7BA 1HX1A 2RHKA 3SBGA 3SAGA 3SAFA 1HB8A 1VQKN 5JLFA 2FLOA 2QI2A 3ATVA 4YORA 2QWQA 5AZIA 5AQUA 5AZJA 2W41A 4GV6A 4HWIA 4BRDA 2YHXA 3H45C 4WQ5A 5DM6L 1DKGD 1NM1A 1S22A 2QWRA 4WFAL 4KH6A 2I1JA 5GAEP 3CCQN 2P9LB 4H0XB 3HZ6A 1P8ZA 3O80A 4GNIA 4NB4A 3X23A 4QS9A 1W97L 3FLCO 3L4QA 1MIZB 4BRGA 5GIOA 1DEJA 3A5OC 3VEOA 5AQXA 4BR4A 4A61A 3E9LA 1MA9B 4TKNA 4A62A 5KPTA 3M5RA 2AL6A 1HKBA 1NI2A 3B8AX 3MMVA 1ILYA 5EXWA 4ILHA 3I56N 1Z6RA 2VGNA 3H1VX 4G9ZA 4BC2A 2P9KB 1VQPN 4BRHA 2AEHA 4NO7A 4B9QA 3U9DA 5ADXH 1U6ZA 3VPZA 4BVOA 1VAZA 3HTVA 4FWPA 4JD2A 4JD2B 2QM1A 3I8BA 4PKHA 3O9RA 2ITMA 3VETA 5C0YA 1P90A 3VMFB 3WQTA 3QIJA 4Y0WA 5IJMA 1C0GA 4H0YB 4BRIA 3GBTA 3MK6A 4FWLA 5JMVA 4H03B 4BR5A 4GXBA 4FWMA 1BA0A 3WEEA 3ZETA 4FWSA 2OTJN 4WQ4A 2ZGZA 3JS6A 3TSQA 2NRTA 3R1XA 5GAHP 3CERA 3WQUA 4YOXA 3IFRA 2COPA 2VWBA 4CD1A 4EIAA 4CZIA 1K8KB 4K25A 4B1XB 1HKGA 5GINA 3A5NC 5E84A 3DXKA 2I7PA 3OBYA 2CB8A 2HF3A 5CE3A 1QZ5A 3PIPL 4CZMA 3F2KA 1VQ4N 2P9SA 4JKDA 2P9SB 1E4GT 3VF6A 4BRKA 5ADXA 5LJWA 3AAPA 1M90O 4RTFD 4WCEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  4JK7 A;  4JKA A;  4ILJ A;  4JK9 A;  4JKG A;  4JKE A;  4JKG B;  3ENB A;  4JKC A;  3E9O A;  3E66 A;  4JKH A;  4ILG B;  3E9L A;  3E9P A;  4ILH A;  4JKB A;  3SBG A;  4JK8 A;  3SBT A;  4JKD A; 
#chains in the Genus database with same CATH topology
 3CYM A;  2A1R A;  1ATR A;  3I33 A;  2XY7 A;  4K42 A;  2JWK A;  3SUQ A;  2FBY A;  3HST B;  2BTF A;  1S1V A;  1S5J A;  3NAE A;  3CJA A;  1NKE A;  5I3U A;  1FKO A;  1SGH A;  2IVO A;  3E9P A;  4JN4 A;  3S3O A;  4CHO A;  1XI1 A;  1OH6 A;  1S72 N;  2ABD A;  1I94 K;  3WA0 A;  1U4B A;  4BE0 A;  1VRU A;  4FJ8 A;  4WQ5 C;  4KHW A;  3DLE A;  3PUF A;  1UWB A;  1FW6 A;  5AQR A;  3V9S A;  3DLK A;  4BG9 A;  4B9T A;  3FE1 A;  1BI4 B;  1HLU A;  1NGD A;  1XHZ A;  2ZJQ L;  4O55 A;  1A5W A;  2WON A;  4ZTJ A;  3A0I X;  3LWL A;  1RT5 A;  2QWP A;  1VQM N;  1CXU A;  2XRI A;  4H4O A;  3M6G A;  4CBX A;  1XNQ K;  4H5R A;  3O4W A;  3AVC A;  3GOI A;  1IJJ A;  3EPY A;  3IMX A;  1TUY A;  3C0B A;  3I0R A;  2E2N A;  5BRE A;  3T69 A;  4W5N A;  2LSN A;  4ELV A;  3ULE A;  5B8H A;  4E7I A;  4CJU A;  4JKG A;  4CZF A;  1BO5 O;  1KTQ A;  3HPH A;  4BR7 A;  4C8K A;  1DTT A;  1HRH A;  4O4G A;  4RW6 A;  3CC4 N;  4JV5 K;  2IDO A;  1C0U A;  1VSK A;  3CJ1 A;  3FZK A;  2HRJ A;  3BGR A;  3KWG A;  4C1N K;  4E7K A;  1IBK K;  3EE8 A;  1NVL A;  4ISF A;  4AHR A;  1Q9Y A;  1NK5 A;  3AAR A;  4LF5 K;  2YJF A;  1W7A A;  4BRO A;  4CGH A;  4YOT A;  4IOC L;  4C8N A;  5HOO A;  4AIL C;  2X74 A;  4CZL A;  3LP2 A;  1HB6 A;  4DS4 A;  3NF9 A;  1J5E K;  3BEX A;  3DLL L;  2AJQ A;  3L2W A;  4G1Q A;  5F0X A;  4H0V B;  2ASM A;  4KHP K;  2J4R A;  3ASM A;  2Z1G A;  5F1X A;  1IO2 A;  2KQ2 A;  3VN5 A;  3OYA A;  1YHQ N;  4EZ9 A;  3MX2 A;  3WEE B;  3ZET B;  3NF8 A;  1BIU A;  2NRW A;  2J0J A;  1BL3 A;  4PHT X;  1NGA A;  2IIR A;  1BCO A;  4ZHR A;  1ATN A;  4IKF A;  4GKJ K;  3A5L C;  5AQH A;  4JRP A;  3DXK B;  2QKB A;  1WSH A;  4BWM A;  3OYN A;  5BN9 A;  2DPN A;  4DTM A;  4W5O A;  2F9T A;  2FSN A;  1QHT A;  3QEX A;  3OS2 A;  3O3F A;  1A5V A;  5IWA K;  3AY9 A;  5KTQ A;  4N56 A;  5DMR A;  1NWK A;  3UKR A;  2IC3 A;  4FO0 A;  3MED A;  1VSJ A;  1WNS A;  5J2M A;  1C1C A;  3AO1 A;  3THX B;  4CJR A;  1M1K O;  3VGK A;  2QWM A;  1JCE A;  5AFU H;  3FFI A;  3O4Q A;  1NK8 A;  3J7Z O;  2YVC A;  2YI1 A;  1TV6 A;  3ULD A;  4Z4H A;  3WT0 A;  4A5A A;  3N4Q A;  1DIK A;  3NH2 A;  2Q3S A;  3VQB A;  5HP1 A;  5AR0 A;  2A40 A;  5BRD A;  3QIO A;  5FPN A;  2FSK A;  4JKH A;  4DU4 A;  4DTO A;  4IEI A;  1S3X A;  1BU6 O;  1UOC A;  4E1J A;  2WH5 A;  3M8R A;  4IWV A;  1Y19 B;  4IG0 A;  3C7N A;  2BGG A;  4OPA A;  1KVC A;  2WBN A;  3LAL A;  4CF9 A;  4ILJ A;  1TKZ A;  4Q5V A;  3U3Y A;  2ASP A;  4O0I A;  3HL8 A;  2YHA A;  2ZWH A;  4Z4E A;  2JGU A;  4KTW A;  3HOS A;  2YV0 X;  3W3D A;  4W5T A;  1TAQ A;  4K41 A;  5M1Q A;  1C1A A;  1OVQ A;  4CJK A;  4DR1 K;  1XNR K;  4FLY A;  3LDQ A;  3NDK A;  3AO5 A;  1X9M A;  4HUG A;  4NLB A;  3OYK A;  4CJL A;  3NGZ A;  2HHW A;  4B1Z A;  2V7Y A;  4MDB A;  4GW6 A;  2YHW A;  3DRS A;  3K5N A;  4FJG A;  3K2P A;  4CGJ A;  4CEC A;  4GVE A;  4YY3 K;  4M3Y A;  3C65 A;  4OPJ A;  4IG3 A;  4BR9 A;  3OVN A;  3DLB A;  4F8R A;  5AQM A;  3CCR N;  4CER A;  4ZRK A;  3DYA A;  3RTV A;  2HBL A;  1TKT A;  4F3O A;  1XC3 A;  1E4F T;  4M3W A;  4FL9 A;  3K9K A;  1NMD A;  5FPE A;  2P9I B;  3R3L A;  1LAW A;  2D0B A;  2DY4 A;  5D3G A;  3RSE B;  3SCX A;  5IT9 O;  3TAR A;  1KD1 O;  3PIO L;  2YKM A;  2A1S A;  2GUP A;  4BRF A;  5ELZ A;  1S1U A;  2Z1H A;  3O9Q A;  2HVI A;  4AHU A;  1WBB A;  1J19 A;  1X3M A;  4WYB A;  1QQO A;  4PQU A;  4CBW A;  1LWF A;  1V4T A;  1G15 A;  4DR7 K;  4KAZ A;  1UA0 A;  5SZT A;  4KH4 A;  4NCA A;  3Q7C A;  3VEX A;  4CE9 A;  5FPM A;  4AM6 A;  2P9P B;  2ZJP L;  2OPP A;  5KQD A;  2ASO A;  1TGO A;  4NXN K;  5CHI A;  1KAZ A;  2PYJ A;  5A2Q O;  3QIC A;  4YDU A;  1V4S A;  1X9W A;  4CIF A;  4DQR A;  1RDD A;  3SLC A;  2VG7 A;  4H4M A;  4PL7 A;  1EQY A;  4ISE A;  3VQ9 A;  4FPB A;  1JCG A;  2HST A;  1K8A O;  3BIN A;  1J54 A;  1MDU B;  3K58 A;  4DFM A;  5BPM A;  4IOX A;  3WNF A;  1C6V A;  4M45 A;  2YNG A;  1VQ9 N;  1H4R A;  1YVU A;  3L2Q A;  2P9U B;  4A57 A;  1OVY A;  3E9O A;  3CIP A;  1CZA N;  4FK2 A;  1VQ6 N;  1WSJ A;  3ZX3 A;  1NK0 A;  3JYT A;  2G8W A;  1EWQ A;  4CEF A;  2A6A A;  2OA8 A;  4FJ7 A;  4N41 A;  4MLE A;  3THW B;  2B6A A;  4J2E A;  2Q0R A;  4O5B A;  4BE1 A;  3F9K A;  3SUN A;  5AQQ A;  1KVA A;  4EKU A;  3MN5 A;  4RCH A;  1C0T A;  2HBJ A;  5H1S Q;  1HNX K;  4DCH A;  4O5F A;  4EHU A;  1U04 A;  3V4I A;  2AA4 A;  3HK2 A;  2D0P A;  1RBT A;  3J7A P;  3TAM A;  3F9M A;  4O44 A;  4I6M A;  4KKO A;  4BC3 A;  3BF1 A;  1ASW A;  1SKR A;  4JK8 A;  1RBR A;  1VQL N;  1TYQ A;  3DXM B;  2J0M A;  1ITG A;  1SUQ A;  3SYZ A;  3HOT A;  3AVL A;  2HVH A;  4QCL A;  3ZT4 A;  3V1O A;  4LF9 K;  4KB0 A;  4H0P A;  1HYZ A;  4Z4C A;  4FLW A;  3P39 A;  4CHY A;  3KLH A;  3R9P A;  3AA4 A;  5C12 A;  4BGB A;  2Z1J A;  1RDB A;  3OYG A;  3D2E B;  2OZM A;  4JI0 K;  3SBG A;  1HB8 A;  5HRS A;  2QI2 A;  3ATV A;  4M3R A;  1U45 A;  3U3G A;  2HNZ A;  1RBS A;  3PO5 A;  2DFE A;  3H45 C;  5DM6 L;  3VA3 A;  1NG9 A;  5GAE P;  2P9L B;  3AO2 A;  3HZ6 A;  5HRR A;  1W97 L;  1DLO A;  1DEJ A;  5AQX A;  4A61 A;  4EZ6 A;  1MA9 B;  4TKN A;  2AL6 A;  1NI2 A;  3AO3 A;  4RG8 A;  4FK4 A;  5EXW A;  4Y1D A;  4BC2 A;  2AEH A;  4DS5 A;  4KV8 A;  3U9D A;  4BVO A;  3SUP A;  1VAZ A;  4JD2 A;  1OH5 A;  3I8B A;  4LSN A;  3VET A;  5C0Y A;  3OS0 A;  4AQY K;  3VQ7 A;  4CK2 A;  1NJY A;  4FZZ A;  3QIJ A;  4Y0W A;  2ZQB A;  2O8E A;  5JMV A;  4FWL A;  4GXB A;  4M3T A;  3RWU A;  2OTJ N;  4WQ4 A;  2OZS A;  4DTX A;  3NHG A;  4KI4 A;  4YOX A;  3CM5 A;  4B1X B;  1RT2 A;  3T1A A;  1QZ5 A;  1RBV A;  3ZCM A;  1TK0 A;  2P9S A;  4JKD A;  1E4G T;  1VSF A;  3ZSQ A;  4KO0 A;  4OKK A;  4BQL A;  3TWH A;  1Q9X A;  1WLJ A;  1KSP A;  4OPK A;  4FSV A;  4GV3 A;  3LM9 A;  4FPA A;  4CZK A;  3BUZ B;  3I8D A;  4YOV A;  4CYE A;  3CM6 A;  1OH8 A;  2O8B B;  4FM2 A;  1ASU A;  1VQ7 N;  3R8E A;  5FRO A;  3OTO K;  4HUF A;  4KHN A;  1GLF O;  1GLJ O;  2KFZ A;  3EN9 A;  3VF2 A;  3PVL A;  1XUP O;  3L2R A;  3D7E O;  1J5O A;  3OYL A;  3EYZ A;  1XMO K;  3HI0 A;  3MXJ A;  3CCE N;  2W40 A;  3KJV A;  3HXM A;  4E7L A;  3MWT A;  4E19 A;  4B3S K;  1RT1 A;  1GC7 A;  1I3A A;  1D8Y A;  1SQK A;  3ZX2 A;  1ZBI A;  1U49 A;  1S6Q A;  3BF3 A;  4JS5 A;  4YNQ A;  2IAJ A;  3U9Z A;  2UXD K;  2DFH A;  1TKX A;  1NK6 A;  4B3T K;  2QKK A;  1KLM A;  1RBU A;  1GLA G;  3LDP A;  4B9U A;  3TSU A;  1EXQ A;  1N33 K;  3V1R A;  1WUA A;  3DOL A;  2P1J A;  5HRO A;  1K73 O;  1ZBF A;  3LZJ A;  4BRP A;  4JKG B;  4DUY K;  1J9A A;  2Q2R A;  1RGI A;  3VEY A;  1NK7 A;  3OBW A;  4BRM A;  5C10 A;  2O8F A;  1VSE A;  4BAC A;  1QVG M;  4FLU A;  1NKC A;  3RMB A;  1KAX A;  3WXL A;  1GLE G;  1NJX A;  4FJM A;  5AZJ B;  3U6F A;  3VEN A;  1VBG A;  3I0S A;  4KHY A;  4F2S A;  1HYS A;  4DFP A;  4J2A A;  1NGH A;  3QBX A;  5LMU K;  3K5M A;  4CFC A;  3CI5 A;  1QS4 A;  1WSG A;  4BR2 A;  2G8H A;  2E5L K;  4DSL A;  1WOQ A;  1HJO A;  1IG8 A;  2A3Z A;  3SV3 A;  4KTQ A;  4M3Z A;  2D1K A;  3J7Y P;  3BY5 A;  1NBW A;  4HVJ A;  4NY0 A;  1QHA A;  3D2F A;  4B1Y B;  1T7P A;  4CJF A;  3BZC A;  4B8A B;  1NMN A;  1Q18 A;  1EP4 A;  1VHX A;  4P7I A;  4CFD A;  4LC9 B;  1ZC6 A;  1BHL A;  3AVA A;  4A5B A;  1N6Q A;  4KFB A;  4A2B A;  3A5M C;  4NCB A;  1JLB A;  4BRE A;  4H5V A;  2F96 A;  4FJL A;  4E7H A;  1XMQ K;  1FKP A;  4M41 A;  2IVN A;  3OYB A;  1NGC A;  5J2P A;  3DMJ A;  3E1Y A;  3EEQ A;  4DV5 K;  3K5L A;  4CJ3 A;  1BUP A;  4WF9 L;  5F2R A;  5MLC Q;  4CIE A;  2OCE A;  4K8X A;  2F9W A;  1ZBH A;  3M8Q A;  3H08 A;  1VK0 A;  3J81 O;  3LAN A;  4FWN A;  1JLA A;  5EU7 A;  1RT3 A;  5CZ2 A;  3H6E A;  4ID1 A;  2OYQ A;  3AV9 A;  2O8C A;  2P9N B;  2QK9 A;  4FVM A;  1KCF A;  5GAG P;  5TKY A;  4YOY A;  2YJE A;  4OGC A;  3CFO A;  3ZLJ A;  1RTH A;  2EX3 A;  4CF1 A;  4CJE A;  1HNW K;  4DLG A;  2FDQ A;  1L3T A;  4YL8 A;  4XH5 A;  4CIG A;  2EMS A;  5BPL A;  1VQO N;  3QML A;  4DQP A;  5I42 A;  3N4P A;  4DSK A;  4B1U B;  2PAV A;  5CY4 A;  4FJN A;  4AH9 A;  4BRC A;  4FLV A;  3D0P A;  4NXM K;  4DB3 A;  5AQY A;  1GLD G;  1VBH A;  3AA2 A;  3VQQ A;  4CCH A;  3H3O B;  3QO9 A;  3VA0 A;  2QW9 A;  1S1W A;  3NVM A;  3TR8 A;  3ZT1 A;  1HNI A;  2YCH A;  1T05 A;  2D0C A;  4FK0 A;  3VQC A;  3GDQ A;  2VGM A;  4CJ7 A;  2I1K A;  3KK2 A;  4KRE A;  3HP6 A;  4RWT A;  1HYV A;  1T8E A;  1LW0 A;  2DFF A;  2PYL A;  3MCA B;  4F9O A;  4O0J A;  2B4J A;  1YAG A;  1SS6 A;  3GE1 A;  4IFY A;  1JLC A;  2FF3 B;  1KQS M;  2PFU A;  2LBB A;  4QS7 A;  4HCC A;  3ID6 A;  3MN9 A;  1DTQ A;  2ITG A;  4FJI A;  3OYI A;  4CZH A;  3DRR A;  4U7B A;  4FYD A;  1XQS C;  1B92 A;  2D10 A;  4CI6 A;  5AQW A;  5BR8 K;  3K0S A;  3CJ9 A;  3UKU A;  4B9M A;  3QNN A;  4OKJ A;  3FZH A;  4BDY A;  2ZF5 O;  4CVN E;  1FXX A;  3O6W A;  4H0O A;  1YI2 N;  4DR5 K;  1Q86 O;  4DR4 K;  1HNV A;  1KXP A;  1NOZ A;  1G99 A;  3C6T A;  2VWK A;  4CFB A;  4BDZ A;  1KC8 O;  3TPQ A;  5C24 A;  5LY3 A;  4L3Q A;  1ZBS A;  3BZK A;  3CCL N;  2EHG A;  2CGJ A;  2Y1I A;  4KPY A;  5LMN K;  1BDG A;  2ZPY A;  3VEZ A;  5AQN A;  2IS3 A;  1CZ9 A;  4CEO A;  2UYT A;  1J53 A;  3O3G A;  1QQN A;  1YF5 L;  3PSI A;  4F2R A;  3QEW A;  4DF4 A;  5M1N A;  4DTJ A;  3DRP A;  3MX5 A;  3AVG A;  1NGG A;  3V9Z A;  3ENH A;  4JKC A;  3M8P A;  3ZSZ A;  3WXM B;  5C42 A;  2Z1I A;  4YOW A;  2ZJR L;  4X62 K;  4NYN A;  4RW8 A;  1A5X A;  3O9U A;  4DFJ A;  3NBP A;  1VSD A;  2KKZ A;  2NZT A;  1DGK N;  2JWL A;  3R6M A;  1QSS A;  2W6K A;  3KK7 A;  1FJG K;  1JCF A;  4BGA A;  1NGE A;  4UQG A;  4J8F A;  4J2D A;  1KBL A;  3LDL A;  1VSI A;  3H1Q A;  2NRR A;  3CJ7 A;  3SPY A;  2IVP A;  2Q31 A;  2X0S A;  2GEL A;  4LFA K;  1WSE A;  1SL1 A;  4OLB A;  5DM7 L;  5CYM A;  4E1N A;  3QET A;  4E0D A;  2EWS A;  4XH1 A;  3SJH A;  3CC2 N;  3TAQ A;  1ATS A;  3OJS A;  4IZ9 A;  1TYQ B;  4KHS A;  4CFA A;  2NRV A;  4R5P A;  3ZEU B;  2D11 A;  3O9S A;  5C15 A;  3TTD A;  4MQ3 A;  1RNH A;  2BUP A;  4F7G A;  1U2V A;  2F7T A;  5JVH L;  4BRA A;  3S3N A;  3C6H A;  2DTU A;  4CJS A;  2AP1 A;  1O1W A;  4YDU C;  4Z4I A;  4BE2 A;  3SK3 A;  2RHK A;  2FC0 A;  5LL6 Z;  3OY9 A;  4B8C A;  2QWQ A;  2VG5 A;  2W41 A;  3ALY A;  1N5Y A;  1NM1 A;  2HND A;  4WFA L;  3CCQ N;  1QTM A;  4H0X B;  1P8Z A;  3O80 A;  4GNI A;  4H8K A;  4QS9 A;  1MIZ B;  4BRG A;  3VEO A;  4BR4 A;  1MU2 A;  4A62 A;  5KPT A;  3M5R A;  4JI2 K;  1ILY A;  3VQP A;  3H1V X;  4G9Z A;  3OYJ A;  4CF2 A;  2P9K B;  1VQP N;  5J1E A;  5ADX H;  3WNE A;  1T03 A;  4PKH A;  4JD2 B;  1NU0 A;  2QM1 A;  2ITM A;  2HMI A;  4DSF A;  3S3M A;  2ZM6 K;  3THY A;  5IJM A;  1NK9 A;  3F73 A;  1C0G A;  3V9W A;  3MK6 A;  4BR5 A;  1B9F A;  3WEE A;  3ZET A;  4FWS A;  2ZGZ A;  3TSQ A;  3R1X A;  3CER A;  3WQU A;  4BDP A;  2VWB A;  1K8K B;  1NK4 A;  1HKG A;  5GIN A;  1N36 K;  5E84 A;  3DXK A;  3OBY A;  2CB8 A;  3MEG A;  1JLG A;  5CE3 A;  5E41 A;  2VQE K;  2P9S B;  4BRK A;  5LJW A;  4C8O A;  3AAP A;  3HPO A;  4NCG A;  3TAE A;  4ELT A;  1J6Z A;  1HQE A;  3IRX A;  5JLH A;  4JRQ A;  3CFR A;  1GC6 A;  1LWE A;  4JK9 A;  1O13 A;  3THX A;  1C0M A;  1LW2 A;  4CZG A;  2UUA K;  3CET A;  4YFU A;  4ILG B;  4FJX A;  3AVB A;  1HPZ A;  5AJ3 K;  3CD6 N;  4KHQ A;  2NNW A;  4JNE A;  4PA1 A;  5EOY A;  4K8Z A;  1JL1 A;  1GLC G;  4CJ4 A;  2GWK A;  4IO8 A;  2KLA A;  4V19 S;  1C0F A;  1HMV A;  4MO5 A;  5T7B A;  3HRG A;  1F21 A;  3SUO A;  3LAK A;  1D9F A;  5M1F A;  2BDP A;  2VCP A;  3LDS A;  3WNG A;  3DLH A;  4Z94 A;  4JKE A;  4PWD A;  4LH5 A;  3SMS A;  4PKI A;  3CJC A;  4RW7 A;  1VSH A;  4YOU A;  4DR2 K;  3WUH A;  1IKX A;  4GVM A;  3DLR A;  5KGW A;  4B3R K;  3AVM A;  2KHO A;  4DHY A;  3SBT A;  3ITH A;  3G71 N;  3PO4 A;  5AQP A;  1SZ2 A;  1CZB A;  3CCV N;  3DLG A;  4WQ4 C;  4DQS A;  2FJ9 A;  4JHD A;  5DK5 A;  4FW2 A;  2YHY A;  4XEI A;  5AQF A;  3JAM O;  3L8B A;  2D5R A;  3G25 A;  3G9W A;  2O8F B;  4E89 A;  2WTU A;  1Q81 O;  3IDH A;  1ISN A;  4NLC A;  2YNF A;  5AQL A;  3ZSO A;  3EZ5 A;  1MK9 B;  1OKJ A;  4K43 A;  3QNO A;  4DV2 K;  2Y1J A;  1K6Y A;  4BRQ A;  5AZI B;  3KZB A;  4IXC A;  4DV6 K;  1S9E A;  3OYC A;  4EAH D;  4KHU A;  4FLZ A;  4DFK A;  3CMA N;  3AVH A;  2FXU A;  2JLE A;  4CJP A;  3AVK A;  2F8S A;  3RR8 A;  3FZM A;  3VQ6 A;  3JXU A;  3PLA A;  3DI6 A;  4DTU A;  4KRF A;  2Q0U A;  2NRX A;  2FBT A;  2GTD A;  4X65 K;  2F8T A;  3VQ4 A;  3HP9 A;  4FZX C;  4B3O A;  2QWO A;  1YJW N;  2FF6 A;  4C1N I;  1VSL A;  1R59 O;  3KKR A;  4CD3 A;  1SV5 A;  2IOC A;  1ZBL A;  2PBD A;  2GEM A;  1QSL A;  1YTA A;  3D2F B;  3NCI A;  5HLF A;  3NH0 A;  1XHX A;  5C25 A;  3ZSW A;  3SJJ A;  3KLE A;  1D9D A;  1Q7Y O;  1WN7 A;  3A2F A;  3L4I A;  4IJN A;  4LY7 A;  4CHN A;  2P9I A;  2E1Y A;  5SWM A;  1JLE A;  1NOY A;  3DWL A;  2V7Z A;  4F4K A;  4EP5 A;  3OYF A;  3RSE A;  2E2P A;  2QA4 N;  3CC7 N;  3GL1 A;  4JS4 A;  2GBZ A;  4FWQ A;  3SNN A;  3ATU A;  4CJT A;  3L2U A;  3TSP A;  2V51 B;  3CHW A;  1VQ8 N;  3KVG A;  1TL3 A;  5AQS A;  1H1V A;  3AA5 X;  4PL8 A;  4CK1 A;  1GLL O;  1KFD A;  4JKF A;  1S1T A;  4Q0B A;  3LPT A;  2EMT A;  3HM8 A;  3AAQ A;  2P9P A;  2W6L A;  3HVT A;  4IEE A;  2E88 A;  4PUO A;  3SQ4 A;  5C2D A;  4BY9 C;  3NMU A;  3O5B A;  1L3V A;  4J2B A;  3SV4 A;  1QSY A;  4FOI A;  2R82 A;  1ZXO A;  3RR7 A;  2O8C B;  4JI5 K;  3P5J A;  3HJF A;  1N8R O;  3QFU A;  2GX9 A;  3VER A;  4WFB L;  3G4S N;  4JKA A;  5JVG L;  3V81 A;  4DSI A;  4GKK K;  1JLQ A;  2P9U A;  4BRN A;  2V52 B;  3SI6 A;  3PV8 A;  4JI7 K;  4C8L A;  4LF4 K;  1YIT N;  4DQQ A;  4O8U A;  1NNE A;  4HUE A;  4JKB A;  3KKS A;  3VES A;  5AFU A;  4FJ5 A;  1RT6 A;  2I7N A;  4MFB A;  4OLA A;  3EE9 A;  1D5A A;  1QE1 A;  2E2Q A;  2A41 A;  3QDK A;  1GG3 A;  4CW7 B;  3KLI A;  5JIC A;  3OYH A;  1IG9 A;  4B1V A;  5FRM A;  1ASV A;  4DV7 K;  4FWR A;  2YHB A;  3V9X A;  4H5T A;  3CF5 L;  1Z05 A;  3ULE B;  3FLV A;  4IOA L;  4DR3 K;  2A42 A;  4ZRI A;  3KK3 A;  5JVL A;  3CJB A;  3IUC A;  4K0K K;  3ZDT A;  3DXM A;  3VF4 A;  4I9Q A;  3ZSV A;  1RTD A;  2B5J A;  3QB0 A;  5AQI A;  3LAM A;  3O08 A;  3OS1 A;  4DU3 A;  3NGY A;  3SMP A;  3FFK B;  4DSE A;  3G0Z A;  1YIJ N;  1QVF M;  3T19 A;  3PSF A;  3VEW A;  3P4I A;  3NFA A;  3SPZ A;  2ZD1 A;  4CEZ A;  1TK8 A;  2P5G A;  5EVZ A;  2DIK A;  3VOV A;  1VQN N;  2X78 A;  4AHT A;  4YHH K;  1WSF A;  5C2F A;  3MEE A;  4B1W B;  1N34 K;  5KRT A;  1TK5 A;  4LF7 K;  4FM1 A;  4I9L A;  5BR9 A;  3LP0 A;  2WC9 A;  3UE5 A;  3S41 A;  1RT4 A;  5AQG A;  1WAJ A;  2P9L A;  3VQE A;  4FLX A;  3TAN A;  3UKU B;  3CQ8 A;  2CH5 A;  4M63 C;  1NTI A;  2WFB A;  3DM2 A;  2GWJ A;  4DV4 K;  2P51 A;  1YTU A;  3M3Z A;  3HPG A;  3M8S A;  4OKE A;  5CZ1 A;  2G8F A;  3K59 A;  2HHU A;  3PX6 A;  2Q97 A;  4KH5 A;  3L3U A;  3BP8 A;  2I5J A;  3E01 A;  2QWL A;  4H5N A;  4BR0 A;  1T6D A;  3H3N O;  1NJZ A;  3UKR B;  4FW1 A;  3TAG A;  3J8A A;  3OYD A;  3P83 D;  3M1F A;  3O9T A;  1RTJ A;  3TTF A;  1CLQ A;  4LH4 A;  5KPR A;  3DJC A;  4CHQ A;  4Y1C A;  5EX5 A;  4DTP A;  3ZYY X;  1NGB A;  1BIZ A;  3EY1 A;  3O1W A;  3CQX A;  2QWN A;  4IFE A;  3VGM A;  4BQZ A;  1KVB A;  1ACA A;  1W9H A;  2UUC K;  2R7Y A;  3ZX0 A;  4CEA A;  2KW4 A;  2G8V A;  1R0A A;  1HUX A;  1RFQ A;  3C95 A;  3T7Z A;  2O8B A;  3LDN A;  1OH7 A;  3I55 N;  3AVI A;  4DMN A;  3HT3 A;  2G8K A;  4L8R B;  3RMA A;  5HRP A;  3MN7 A;  3WNH A;  4CGI A;  4BRL A;  1RDU A;  5E26 A;  3KD1 E;  1LCU A;  1X3N A;  3C7N B;  1IKY A;  5BPN A;  2QEX N;  3VQ8 A;  2H3G X;  3LM2 A;  3WXI A;  3TU5 A;  1YUW A;  1UAX A;  4DXA B;  3KIO A;  4WFN L;  3PY8 A;  2RQ1 A;  1U48 A;  1EWR A;  4JI8 K;  4JYA K;  3RMD A;  5AQK A;  4HTL A;  3QIP A;  1TL1 A;  1L5U A;  3C6U A;  2CQU A;  2ZE2 A;  3CXC M;  2BE2 A;  3F5T A;  3THV A;  2IGI A;  2RF2 A;  1MK7 B;  4DR6 K;  4QOZ B;  1GLB G;  4C8M A;  4BVP A;  1IKW A;  4CHZ A;  3NH1 A;  2G8U A;  2QTD A;  3FP5 A;  3H46 O;  4AHC A;  2Q36 A;  2XY5 A;  1MIX A;  1U2V B;  1RDW X;  2PY5 A;  4A2A A;  1IH7 A;  2UUB K;  5CR4 A;  3QEP A;  1LAV A;  5KPZ A;  1K9M O;  3Q7B A;  1HX1 A;  3SAF A;  1VQK N;  3NGI A;  5JLF A;  3KK1 A;  4YOR A;  1IV0 A;  5AQU A;  5AZJ A;  4CJ5 A;  4GV6 A;  3T1Y K;  4BRD A;  2YHX A;  3ZSR A;  3TAP A;  4WQ5 A;  1DKG D;  1S22 A;  3LP1 A;  4NB4 A;  3X23 A;  2YKN A;  5GIO A;  3A5O C;  4ELU A;  2RN2 A;  4X64 K;  2ATQ A;  1FK9 A;  3MMV A;  1HKB A;  3B8A X;  3UIQ A;  3QER A;  3I56 N;  2ETJ A;  4EP4 A;  4DF8 A;  4BRH A;  4NO7 A;  4B9Q A;  2GV9 A;  1KRP A;  2OPS A;  3VPZ A;  4FWP A;  3MXM A;  4KB1 A;  3O9R A;  4W5R A;  1P90 A;  2PZS A;  3NE6 A;  3LPU A;  3THY B;  4BRI A;  3GBT A;  4H03 B;  1XC9 A;  4FWM A;  3J80 O;  4AHS A;  2O8D A;  2NRT A;  4N47 A;  4CK3 A;  3SQ0 A;  3IFR A;  2COP A;  5FDL A;  4Z4F A;  4CF8 A;  4EIA A;  4CZI A;  3TAB A;  3A5N C;  4CEE A;  2HF3 A;  3B6P A;  2XY8 A;  3MEC A;  5K14 A;  4CZM A;  1VRT A;  1VQ4 N;  1M90 O;  1X1P A;  4RTF D;  1T44 A;  5J2Q A;  3ZT0 A;  1S6P A;  4FJH A;  4B9S A;  3CPW M;  3CCS N;  2X6N A;  3RVC A;  3V1Q A;  5LJV A;  3O3H A;  3CME N;  1JL2 A;  4XH4 A;  4OVL A;  2OTL N;  3CCJ N;  5KRS A;  2E2O A;  4JI3 K;  3FZF A;  3V6D A;  2P9N A;  4FOE A;  1SL2 A;  3NF7 A;  3S9H A;  3CCM N;  4ZRJ A;  5HL7 L;  1YVN A;  4EFH A;  1BI4 A;  1EO1 A;  1L3U A;  1SKW A;  4FZY A;  1HBK A;  3ZSY A;  4PKG A;  2D2Q A;  2G8I A;  3L2V A;  2KZM A;  1BQM A;  2E4L A;  5M1P A;  1QZ6 A;  1Y97 A;  4I6M B;  5GIP A;  2RKI A;  3VEV A;  3G10 A;  3FR0 A;  4IJA A;  3RMC A;  3AVF A;  4H5W A;  3OW2 M;  2OAN A;  4FWK A;  2HBM A;  1BQN A;  3CCU N;  2BH1 A;  4OO1 J;  3CG7 A;  3L0Q A;  2E6L A;  4EHT A;  4JHD B;  3FGU A;  1RDA A;  1RT7 A;  4BC4 A;  3KHY A;  1GOA A;  1HR0 K;  4HDO A;  3G6E N;  3EL2 A;  3U8Z A;  2FBV A;  3HVR A;  1CXQ A;  1WSI A;  3U8X A;  3CFP A;  4WE1 A;  1EET A;  3GG4 A;  2UU9 K;  4CGG A;  2FSJ A;  1NGF A;  2YNI A;  3MDQ A;  4LF8 K;  1NKB A;  3PX0 A;  4M3U A;  4KI6 A;  3AGK A;  5AQJ A;  4CJW A;  3ENB A;  2OPQ A;  1NLV A;  3E66 A;  2WOM A;  3D45 A;  4OGE A;  4CES A;  3SZ2 A;  4DWI A;  4KBO A;  3ENO A;  3VQA A;  4FJK A;  1WAF A;  3AU4 A;  3SQ2 A;  2HOE A;  1RIL A;  5M1O A;  4FJ9 A;  2NRH A;  3K5O A;  4HDQ A;  2A5X A;  1YT3 A;  4IDK A;  4E3S A;  3LL3 A;  4B9V A;  4UY8 O;  4H0T B;  4JLH A;  4LFB K;  2O8E B;  2GUI A;  4LFC K;  1DT9 A;  3PZD A;  3ZT3 A;  1T3V A;  4IO9 L;  1W2B M;  5J2N A;  4Z0U A;  5M1K A;  3OYM A;  3AVJ A;  1BOT O;  1IKV A;  1L3S A;  5GAD P;  4XIU A;  1EKE A;  5CYQ A;  3VTH A;  5KGX A;  1LOT B;  2O4I A;  4C23 A;  2E6M A;  4OJR A;  4CJQ A;  1GOB A;  4MLH A;  4CJV A;  2D0O A;  1BA1 A;  1UA1 A;  3MCP A;  4DV0 K;  3QES A;  4B9L A;  4DG1 A;  5BRF A;  5BN8 A;  4JK7 A;  3UB5 A;  4DLE A;  2ZGY A;  2HE7 A;  1LWC A;  3RRG A;  3NVK A;  1YJ9 N;  4A59 A;  2YNH A;  4IBN A;  5TKW A;  1XWL A;  3TI0 A;  4DSJ A;  3QIN A;  1MWK A;  1YJN N;  3O4N A;  4HCB A;  1TUU A;  3T3F A;  4DTS A;  3FZL A;  2BAN A;  4CGF A;  4LD0 A;  3QEI A;  4FVU A;  2HW3 A;  3L6Q A;  5KI6 A;  3EZW A;  2E8A A;  2D0A A;  3QEV A;  5FRN A;  4F3T A;  1HJR A;  4CZJ A;  2HMP A;  5FLX O;  1JXB A;  2HNY A;  2VWJ A;  4JEP A;  3K9J A;  4DV3 K;  2VYP A;  3JSM A;  3MXI A;  1E5W A;  1Z25 A;  1BWF O;  4JI1 K;  3OHR A;  5HBM A;  4MO4 A;  3KD5 E;  1C1B A;  4DQ8 A;  4QS8 A;  3WXK A;  1VQ5 N;  3P31 A;  4ZTF A;  3IAY A;  3OA9 A;  4PY5 A;  3QFP A;  3LZI A;  1I39 A;  1IBL K;  1ESV A;  4HHT A;  2CH6 A;  3AVN A;  4FWO A;  2HHQ A;  4ISG A;  5AQV A;  1RCH A;  2W42 A;  4B08 A;  4GV9 A;  2RE2 A;  4E1M A;  1NGI A;  1KLN A;  4N76 A;  3HO1 A;  3WXJ A;  1U47 A;  5AQT A;  4W5Q A;  2NUB A;  3IVF A;  3HBT A;  3A8Y A;  3EO3 A;  1Y64 A;  2HF4 A;  4CED A;  4AF1 A;  2UXC K;  3ZEU A;  3P38 A;  1D4X A;  3D6R A;  3LDO A;  1HNZ K;  3IS9 A;  1Q82 O;  3AO4 A;  3MWP A;  4OX9 K;  1B9D A;  1TKD A;  1ZYQ A;  1WB9 A;  4I2P A;  1VSM A;  2YX6 A;  4LSL A;  4AM7 A;  4JI6 K;  3QLH A;  2KZZ A;  2NRZ A;  4CF0 A;  3O1B A;  2P5O A;  3W0L A;  3TAF A;  1EF1 A;  4O8K A;  3B6O A;  5BRH A;  3AU5 A;  2VQF K;  4AHV A;  2HHT A;  4TSX A;  4FM0 A;  1ZBU A;  4CHP A;  5HRN A;  1JXE A;  3MAQ A;  4M7X A;  2QXF A;  3IKM A;  3EKS A;  3CQY A;  2P9K A;  4U67 L;  2CGL A;  1RDC A;  3IG1 A;  1IBM K;  4B3M K;  2F4V K;  2Q1N A;  1SL0 A;  4BC5 A;  4GY2 B;  1HPM A;  3T1H K;  4IFV A;  3U4L A;  4CEB A;  1S1X A;  3ZT2 A;  2E1Z A;  1KAY A;  3RRH A;  1NGJ A;  3KLG A;  5JS2 A;  4X66 K;  1RTI A;  4M7Y A;  1MWM A;  1HKC A;  3AGR A;  2WUS A;  1WBD A;  3SAH A;  3HM9 A;  2HHV A;  1K8K A;  3LWM A;  1BG3 A;  4JAX A;  2J0K A;  3O8M A;  4RW4 A;  1NJI O;  4N5S A;  1E3M A;  1YXQ A;  3U7D A;  4B9N A;  5I9E B;  1QQC A;  5KQ8 A;  2E20 A;  5AQO A;  3C94 A;  1NJW A;  4M3X A;  2HB5 A;  1QQM A;  1TVR A;  4E7J A;  3HYF A;  4OPH A;  2O4G A;  3AA3 A;  1W0H A;  1ST7 A;  2KTQ A;  1T6C A;  1X9J A;  4M42 A;  3ZSX A;  4FLT A;  4R79 A;  3ISN C;  2UXB K;  2XHB A;  1KFS A;  3HSC A;  3THW A;  4CEQ A;  3NF6 A;  3TTC A;  3LP3 A;  4RW9 A;  3K57 A;  4BG8 A;  5FPD A;  1REV A;  2VG6 A;  2X6S A;  2CGK A;  2HBK A;  5AQZ A;  2HHH K;  3CPE A;  4MDA A;  4IDH A;  3PX4 A;  3VGL A;  3C6A A;  1SKS A;  4QAG A;  1S9G A;  3VTI A;  5EY4 A;  4CZE A;  4I7F A;  4CGD A;  3VQD A;  3MN6 A;  1JJ2 M;  3KWI A;  4JI4 K;  1JLF A;  2QXL A;  2RPI A;  3ID8 A;  2HHS A;  1BCM A;  3OJU A;  4DU1 A;  3P1G A;  1KC7 A;  4DTR A;  4BWJ A;  2D4W A;  2NLX A;  3VQ5 A;  3QBW A;  4ICL A;  4GMJ B;  3DOK A;  1JDE A;  1GGO A;  4NYF A;  3DAW A;  4CBU A;  1SAZ A;  3EKU A;  4DKW A;  3V9U A;  4I2Q A;  3D2E A;  3SAG A;  4DUZ K;  2FBX A;  1LV5 A;  2FLO A;  4FJJ A;  5AZI A;  1JKH A;  3BDP A;  4HTU A;  4HWI A;  3L3V A;  1TAU A;  1BGX T;  2QWR A;  4KH6 A;  2I1J A;  4DTN A;  5JS1 A;  3FLC O;  3L4Q A;  4LF6 K;  1BIS A;  2XO7 A;  1HQU A;  3E9L A;  3SQ1 A;  1Z26 A;  4ILH A;  1Z6R A;  2VGN A;  4FCY A;  1U6Z A;  4ID5 A;  3HTV A;  3VMF B;  3WQT A;  1GOC A;  1EX4 A;  4H0Y B;  3KLF A;  4DV1 K;  1BA0 A;  2XY6 A;  3JS6 A;  2O8D B;  5GAH P;  2OPR A;  4CD1 A;  4K25 A;  4FXD A;  1Q8I A;  4Z4G A;  2I7P A;  2KFN A;  2HHX A;  4KTZ A;  3PIP L;  3OYE A;  4DQI A;  1N32 K;  3F2K A;  3VF6 A;  5ADX A;  1X9S A;  3KTQ A;  4WCE L; 
#chains in the Genus database with same CATH homology
 4BQL A;  1J6Z A;  1T44 A;  1ATR A;  3I33 A;  4FSV A;  5JLH A;  4GV3 A;  3LM9 A;  4FPA A;  4K42 A;  4CZK A;  2JWK A;  3CPW M;  2BTF A;  1GC6 A;  3CCS N;  3BUZ B;  4JK9 A;  4YOV A;  4CYE A;  1O13 A;  3RVC A;  5LJV A;  3CME N;  4CZG A;  3CJA A;  4XH4 A;  3CET A;  4ILG B;  1SGH A;  2IVO A;  3E9P A;  2OTL N;  1VQ7 N;  3R8E A;  3CCJ N;  4JN4 A;  3CD6 N;  2E2O A;  1S72 N;  2ABD A;  3WA0 A;  2NNW A;  4JNE A;  1GLF O;  5EOY A;  1GLJ O;  1GLC G;  3FZF A;  3EN9 A;  2GWK A;  3VF2 A;  2P9N A;  4IO8 A;  3PVL A;  1XUP O;  4WQ5 C;  2KLA A;  4FOE A;  1C0F A;  3D7E O;  5AQR A;  3CCM N;  4MO5 A;  4ZRJ A;  5HL7 L;  3HI0 A;  3HRG A;  1YVN A;  4BG9 A;  3FE1 A;  3CCE N;  2W40 A;  4EFH A;  3MWT A;  5M1F A;  1EO1 A;  1HLU A;  1NGD A;  2VCP A;  1GC7 A;  1HBK A;  4Z94 A;  2ZJQ L;  4JKE A;  4PKG A;  3SMS A;  2D2Q A;  4PKI A;  1SQK A;  3ZX2 A;  3CJC A;  3A0I X;  2QWP A;  4YOU A;  3BF3 A;  5M1P A;  3WUH A;  1VQM N;  1QZ6 A;  3U9Z A;  4I6M B;  2KHO A;  4DHY A;  5GIP A;  3M6G A;  4CBX A;  3SBT A;  4H5R A;  3VEV A;  3G71 N;  3O4W A;  3FR0 A;  4IJA A;  3GOI A;  1GLA G;  3LDP A;  4H5W A;  1IJJ A;  3EPY A;  3TSU A;  3OW2 M;  3IMX A;  1TUY A;  1WUA A;  2OAN A;  3C0B A;  2E2N A;  4FWK A;  2HBM A;  5AQP A;  3T69 A;  1SZ2 A;  2BH1 A;  5BRE A;  3CCU N;  1K73 O;  3CCV N;  4WQ4 C;  4BRP A;  4OO1 J;  3ULE A;  2FJ9 A;  5B8H A;  3L0Q A;  4JHD A;  4EHT A;  4JHD B;  4JKG A;  4CZF A;  4JKG B;  1BO5 O;  3FGU A;  2YHY A;  4XEI A;  2Q2R A;  1RGI A;  5AQF A;  3VEY A;  4BC4 A;  3KHY A;  3OBW A;  4HDO A;  4BRM A;  4BR7 A;  3G6E N;  5C10 A;  3EL2 A;  3G25 A;  3G9W A;  3U8Z A;  1QVG M;  3CC4 N;  1Q81 O;  3IDH A;  1ISN A;  4NLC A;  5AQL A;  1MK9 B;  1OKJ A;  3U8X A;  1KAX A;  4K43 A;  3WXL A;  1GLE G;  3CJ1 A;  3FZK A;  4BRQ A;  5AZI B;  3GG4 A;  3KZB A;  2HRJ A;  5AZJ B;  4IXC A;  2FSJ A;  3KWG A;  1NGF A;  4EAH D;  3VEN A;  3MDQ A;  1VBG A;  4C1N K;  3CMA N;  2FXU A;  3AGK A;  5AQJ A;  3EE8 A;  1NGH A;  3QBX A;  1NVL A;  3ENB A;  3FZM A;  4ISF A;  3CI5 A;  3JXU A;  3PLA A;  4BR2 A;  1NLV A;  3E66 A;  3AAR A;  1WOQ A;  2Q0U A;  2NRX A;  2YJF A;  1HJO A;  2GTD A;  3ENO A;  4KBO A;  4BRO A;  1IG8 A;  2A3Z A;  3AU4 A;  2D1K A;  2QWO A;  4YOT A;  1YJW N;  4IOC L;  2FF6 A;  2HOE A;  4C1N I;  5HOO A;  1R59 O;  1NBW A;  5M1O A;  2NRH A;  4CD3 A;  4CZL A;  4NY0 A;  1HB6 A;  4HDQ A;  1QHA A;  2A5X A;  2GEM A;  2PBD A;  3BEX A;  3D2F A;  4B1Y B;  3D2F B;  3LL3 A;  3DLL L;  5F0X A;  4H0V B;  2ASM A;  4H0T B;  4UY8 O;  2J4R A;  1Q18 A;  1Q7Y O;  1DT9 A;  3PZD A;  1T3V A;  3L4I A;  4IJN A;  5F1X A;  2P9I A;  2E1Y A;  4IO9 L;  1W2B M;  4P7I A;  1YHQ N;  3DWL A;  2V7Z A;  3MX2 A;  4LC9 B;  1ZC6 A;  3WEE B;  3ZET B;  4A5B A;  5M1K A;  2NRW A;  3RSE A;  4A2B A;  2J0J A;  1BOT O;  2E2P A;  4PHT X;  2QA4 N;  1NGA A;  3A5M C;  3GL1 A;  3CC7 N;  2IIR A;  4FWQ A;  4H5V A;  4BRE A;  5GAD P;  1ATN A;  3ATU A;  3A5L C;  5AQH A;  3DXK B;  3VTH A;  1LOT B;  2IVN A;  3TSP A;  2V51 B;  4C23 A;  3CHW A;  4MLH A;  2DPN A;  2D0O A;  1BA1 A;  5BN9 A;  1NGC A;  3KVG A;  1VQ8 N;  2F9T A;  2FSN A;  3E1Y A;  1H1V A;  3MCP A;  5AQS A;  4PL8 A;  5BRF A;  1GLL O;  4JKF A;  3AY9 A;  5BN8 A;  4JK7 A;  1BUP A;  3UB5 A;  2ZGY A;  2HE7 A;  1NWK A;  3NVK A;  3UKR A;  1YJ9 N;  4A59 A;  4FO0 A;  4WF9 L;  5F2R A;  5MLC Q;  2EMT A;  5TKW A;  3HM8 A;  3AAQ A;  2P9P A;  4IEE A;  2E88 A;  2F9W A;  1M1K O;  5C2D A;  4BY9 C;  3VGK A;  1MWK A;  2QWM A;  1YJN N;  1JCE A;  1TUU A;  3NMU A;  3O5B A;  4FWN A;  3FZL A;  5AFU H;  3J7Z O;  4FVU A;  3H6E A;  3L6Q A;  4FOI A;  2YVC A;  2R82 A;  1ZXO A;  2P9N B;  2YI1 A;  3EZW A;  2E8A A;  5GAG P;  5TKY A;  4YOY A;  1N8R O;  3QFU A;  3WT0 A;  2YJE A;  2GX9 A;  4A5A A;  3VER A;  4CZJ A;  3N4Q A;  1DIK A;  2HMP A;  4WFB L;  4JKA A;  3G4S N;  5JVG L;  5AR0 A;  2A40 A;  4JEP A;  2FDQ A;  3K9J A;  5BRD A;  2P9U A;  2VYP A;  4YL8 A;  2V52 B;  4BRN A;  4XH5 A;  1E5W A;  2EMS A;  5FPN A;  5BPL A;  1VQO N;  1BWF O;  4JKH A;  2FSK A;  3QML A;  1YIT N;  3N4P A;  4IEI A;  1S3X A;  3OHR A;  4O8U A;  1BU6 O;  4MO4 A;  4B1U B;  2PAV A;  4E1J A;  4JKB A;  2WH5 A;  4DQ8 A;  3VES A;  5AFU A;  4QS8 A;  3WXK A;  4BRC A;  2I7N A;  3P31 A;  1VQ5 N;  4IWV A;  4DB3 A;  1Y19 B;  3EE9 A;  3C7N A;  3OA9 A;  3QFP A;  2E2Q A;  4OPA A;  2A41 A;  3QDK A;  1GG3 A;  5AQY A;  1ESV A;  2WBN A;  5JIC A;  4B1V A;  1GLD G;  2CH6 A;  4FWO A;  1VBH A;  4FWR A;  4ISG A;  4H5T A;  5AQV A;  4ILJ A;  3H3O B;  3CF5 L;  1Z05 A;  3ULE B;  3FLV A;  4IOA L;  2QW9 A;  4GV9 A;  2ASP A;  2RE2 A;  3NVM A;  2A42 A;  1NGI A;  4ZRI A;  2YCH A;  2ZWH A;  3WXJ A;  5AQT A;  3HOS A;  3W3D A;  5JVL A;  3CJB A;  3IUC A;  3GDQ A;  3IVF A;  2VGM A;  3A8Y A;  3HBT A;  3EO3 A;  1Y64 A;  4K41 A;  5M1Q A;  2HF4 A;  4CJ7 A;  3ZDT A;  2I1K A;  3DXM A;  3VF4 A;  4AF1 A;  4RWT A;  3ZEU A;  3LDQ A;  3QB0 A;  5AQI A;  3P38 A;  3O08 A;  3MCA B;  1D4X A;  3D6R A;  4F9O A;  3LDO A;  4NLB A;  1YAG A;  1SS6 A;  3FFK B;  3SMP A;  3GE1 A;  1YIJ N;  1Q82 O;  1QVF M;  3MWP A;  4B1Z A;  2V7Y A;  4MDB A;  2FF3 B;  3VEW A;  1KQS M;  3P4I A;  2PFU A;  2LBB A;  4QS7 A;  5EVZ A;  2DIK A;  2YX6 A;  3VOV A;  2YHW A;  1VQN N;  3ID6 A;  3MN9 A;  5C2F A;  4AM7 A;  4CZH A;  4B1W B;  4GVE A;  2NRZ A;  5BR9 A;  3C65 A;  3O1B A;  4U7B A;  3W0L A;  1XQS C;  2WC9 A;  1EF1 A;  4O8K A;  2D10 A;  3UE5 A;  4BR9 A;  3S41 A;  5BRH A;  3AU5 A;  4CI6 A;  5AQW A;  5AQG A;  2P9L A;  3CJ9 A;  5AQM A;  3UKU A;  3UKU B;  3CCR N;  4ZRK A;  2CH5 A;  2HBL A;  4M63 C;  1XC3 A;  1E4F T;  4FL9 A;  3K9K A;  3FZH A;  1NMD A;  2ZF5 O;  5FPE A;  1NTI A;  2P9I B;  2WFB A;  3R3L A;  2GWJ A;  3O6W A;  4H0O A;  1YI2 N;  1Q86 O;  3RSE B;  4M7X A;  3M3Z A;  1KXP A;  3IKM A;  1KD1 O;  3EKS A;  3CQY A;  1G99 A;  2P9K A;  4U67 L;  2CGL A;  2Q97 A;  3PIO L;  4KH5 A;  2GUP A;  4BRF A;  3BP8 A;  5ELZ A;  1KC8 O;  2Q1N A;  3O9Q A;  2QWL A;  4BC5 A;  4GY2 B;  3TPQ A;  4H5N A;  1HPM A;  1J19 A;  1X3M A;  1T6D A;  4WYB A;  1QQO A;  4L3Q A;  3U4L A;  4BR0 A;  1ZBS A;  5LY3 A;  3CCL N;  2E1Z A;  3H3N O;  4CBW A;  1KAY A;  1V4T A;  1NGJ A;  3UKR B;  2CGJ A;  4M7Y A;  1MWM A;  1HKC A;  3AGR A;  4KH4 A;  3Q7C A;  2WUS A;  3VEX A;  1BDG A;  2ZPY A;  3J8A A;  5FPM A;  3SAH A;  3VEZ A;  4AM6 A;  3M1F A;  2P9P B;  3O9T A;  2ZJP L;  1K8K A;  5AQN A;  5KQD A;  1BG3 A;  2ASO A;  4JAX A;  3TTF A;  2J0K A;  5KPR A;  5CHI A;  3O8M A;  1KAZ A;  2UYT A;  3DJC A;  3QIC A;  1NJI O;  1QQN A;  1V4S A;  4YDU A;  5EX5 A;  1YXQ A;  1YF5 L;  3U7D A;  3ZYY X;  1NGB A;  3SLC A;  5I9E B;  4PL7 A;  1EQY A;  4ISE A;  4FPB A;  1JCG A;  2HST A;  3CQX A;  3O1W A;  2QWN A;  4IFE A;  3BIN A;  3VGM A;  4BQZ A;  1K8A O;  1MDU B;  5KQ8 A;  5M1N A;  2E20 A;  5AQO A;  1ACA A;  5BPM A;  4IOX A;  1QQM A;  3MX5 A;  3ZX0 A;  1VQ9 N;  1H4R A;  1NGG A;  1HUX A;  1RFQ A;  4OPH A;  2P9U B;  3T7Z A;  4A57 A;  1ST7 A;  1OVY A;  3ENH A;  4JKC A;  1T6C A;  3E9O A;  1X9J A;  3CIP A;  3LDN A;  1CZA N;  3I55 N;  1VQ6 N;  3WXM B;  3ZX3 A;  4YOW A;  4R79 A;  2ZJR L;  3O9U A;  3HSC A;  3MN7 A;  2A6A A;  1RDU A;  5E26 A;  4BRL A;  4MLE A;  1LCU A;  2KKZ A;  3TTC A;  2NZT A;  1DGK N;  2JWL A;  2Q0R A;  3R6M A;  1X3N A;  3C7N B;  3KK7 A;  5BPN A;  2QEX N;  4BG8 A;  5FPD A;  1JCF A;  2H3G X;  3LM2 A;  1NGE A;  3WXI A;  4BGA A;  2CGK A;  5AQQ A;  3TU5 A;  2HBK A;  1YUW A;  4EKU A;  3MN5 A;  4RCH A;  5AQZ A;  4J8F A;  4DXA B;  3CPE A;  2HBJ A;  4MDA A;  5H1S Q;  1KBL A;  4DCH A;  3LDL A;  4WFN L;  4IDH A;  2RQ1 A;  4O5F A;  4EHU A;  3H1Q A;  3C6A A;  2NRR A;  3VGL A;  3CJ7 A;  2IVP A;  2AA4 A;  2Q31 A;  5AQK A;  2X0S A;  4HTL A;  2GEL A;  2D0P A;  3VTI A;  5EY4 A;  3F9M A;  5DM7 L;  4I6M A;  2EWS A;  4XH1 A;  3SJH A;  4BC3 A;  4CZE A;  1ATS A;  3BF1 A;  3CC2 N;  2CQU A;  3MN6 A;  3CXC M;  4JK8 A;  1JJ2 M;  3KWI A;  4IZ9 A;  1VQL N;  1TYQ A;  1TYQ B;  2QXL A;  3F5T A;  3DXM B;  3ID8 A;  2J0M A;  2NRV A;  1MK7 B;  3HOT A;  3ZEU B;  2D11 A;  1KC7 A;  1GLB G;  4BVP A;  3O9S A;  2D4W A;  5C15 A;  3TTD A;  4H0P A;  2NLX A;  2BUP A;  3QBW A;  2QTD A;  3FP5 A;  3H46 O;  3P39 A;  2Q36 A;  1JDE A;  4F7G A;  1GGO A;  1MIX A;  1U2V A;  1U2V B;  1RDW X;  2F7T A;  3R9P A;  4BRA A;  5JVH L;  3C6H A;  4A2A A;  5C12 A;  2AP1 A;  4YDU C;  4BGB A;  3DAW A;  4CBU A;  1SAZ A;  3EKU A;  4DKW A;  5CR4 A;  3D2E A;  5KPZ A;  3D2E B;  3SK3 A;  1K9M O;  3Q7B A;  1HX1 A;  2RHK A;  3SBG A;  3SAG A;  3SAF A;  1HB8 A;  1VQK N;  5JLF A;  2FLO A;  2QI2 A;  3ATV A;  4YOR A;  2QWQ A;  5AZI A;  5AQU A;  5AZJ A;  2W41 A;  4GV6 A;  4HWI A;  4BRD A;  2YHX A;  3H45 C;  4WQ5 A;  5DM6 L;  1DKG D;  1NM1 A;  1S22 A;  2QWR A;  4WFA L;  4KH6 A;  2I1J A;  5GAE P;  3CCQ N;  2P9L B;  4H0X B;  3HZ6 A;  1P8Z A;  3O80 A;  4GNI A;  4NB4 A;  3X23 A;  4QS9 A;  1W97 L;  3FLC O;  3L4Q A;  1MIZ B;  4BRG A;  5GIO A;  1DEJ A;  3A5O C;  3VEO A;  5AQX A;  4BR4 A;  4A61 A;  3E9L A;  1MA9 B;  4TKN A;  4A62 A;  5KPT A;  3M5R A;  2AL6 A;  1HKB A;  1NI2 A;  3B8A X;  3MMV A;  1ILY A;  5EXW A;  4ILH A;  3I56 N;  1Z6R A;  2VGN A;  3H1V X;  4G9Z A;  4BC2 A;  2P9K B;  1VQP N;  4BRH A;  2AEH A;  4NO7 A;  4B9Q A;  3U9D A;  5ADX H;  1U6Z A;  3VPZ A;  4BVO A;  1VAZ A;  3HTV A;  4FWP A;  4JD2 A;  4JD2 B;  2QM1 A;  3I8B A;  4PKH A;  3O9R A;  2ITM A;  3VET A;  5C0Y A;  1P90 A;  3VMF B;  3WQT A;  3QIJ A;  4Y0W A;  5IJM A;  1C0G A;  4H0Y B;  4BRI A;  3GBT A;  3MK6 A;  4FWL A;  5JMV A;  4H03 B;  4BR5 A;  4GXB A;  4FWM A;  1BA0 A;  3WEE A;  3ZET A;  4FWS A;  2OTJ N;  4WQ4 A;  2ZGZ A;  3JS6 A;  3TSQ A;  2NRT A;  3R1X A;  5GAH P;  3CER A;  3WQU A;  4YOX A;  3IFR A;  2COP A;  2VWB A;  4CD1 A;  4EIA A;  4CZI A;  1K8K B;  4K25 A;  4B1X B;  1HKG A;  5GIN A;  3A5N C;  5E84 A;  3DXK A;  2I7P A;  3OBY A;  2CB8 A;  2HF3 A;  5CE3 A;  1QZ5 A;  3PIP L;  4CZM A;  3F2K A;  1VQ4 N;  2P9S A;  4JKD A;  2P9S B;  1E4G T;  3VF6 A;  4BRK A;  5ADX A;  5LJW A;  3AAP A;  1M90 O;  4RTF D;  4WCE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...