4JKHA

Open and closed forms of d1781e human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVEDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkhA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkhA01
4JKCA 3E9PA 4JK8A 4ILHA 3SBGA 4JKEA 4JKAA 3SBTA 4JK9A 4JKDA 4JK7A 3E9OA 4JKFA 4JKGA 4ILJA 3E9LA 4JKHA 3ENBA 4JKBA 4JKGB 3E66A 4ILGB
chains in the Genus database with same CATH superfamily
4IDHA 3U4LA 2E8AA 4ID5A 2VG5A 3IFRA 3ENOA 3ZLJA 3FZMA 1NMDA 3AVKA 4W5NA 3LPTA 3V1OA 5GIPA 3P38A 1RBTA 3EZ5A 4IZ9A 5I42A 3LP3A 3NE6A 1N33K 2HBJA 1IKWA 5AQHA 3WXKA 3OS2A 2P9KB 3MEGA 2GUPA 2XY6A 4OLAA 5C15A 2ASMA 1H4RA 1XC3A 1JXEA 3LALA 3AARA 5ELZA 2VQFK 4B1WB 1HNVA 3OYDA 2Q0RA 1X9JA 3THVA 5M1NA 5BN8A 4N41A 4YOUA 4KV8A 4JK7A 1TAQA 1NOYA 4JI7K 3VQ4A 3LP0A 1TV6A 2UXBK 3M5RA 1ESVA 4WFBL 3U3GA 4KPYA 2OPSA 3TTCA 1UOCA 1NNEA 4YY3K 2QWNA 4DR1K 3FZLA 4NY0A 2FDQA 1D5AA 2B5JA 4FOEA 4CJKA 4AHRA 2A40A 2BANA 5AQMA 2PBDA 3EPYA 1C1CA 4H0OA 4F4KA 4DF4A 4ZRKA 5BRHA 3C6TA 3ULEB 3NHGA 3ZX0A 3CCSN 2NRWA 3WUHA 2WC9A 3T3FA 1D8YA 1TL3A 4B9MA 2VWBA 5F2RA 3QEVA 3CC4N 2O8FA 3U3YA 3PX6A 4CF1A 1S72N 1X1PA 3UKUA 4B1UB 3BF3A 3EZWA 2LSNA 4B9TA 1NBWA 4CIGA 3RTVA 4KI6A 3VF2A 2CH6A 4M63C 4BC2A 4FPAA 5HP1A 3CJCA 4M45A 5AQRA 1BISA 4HTUA 5JS2A 1JJ2M 3K9KA 1FKOA 3K2PA 3KLIA 3LDPA 3CJBA 1JLAA 4IEEA 3PY8A 1E4GT 4YDUA 1DEJA 3SCXA 2I1JA 3BINA 3SMPA 4BRAA 4OVLA 2UUAK 2ZJRL 2G8WA 3NVMA 3L2RA 3OTOK 1BUPA 1SS6A 3MX5A 4DV5K 3C6HA 3O3GA 5AZIB 4DR7K 1LW2A 4LSNA 4CEEA 4RW7A 2ZGYA 2D5RA 4FCYA 4AM7A 3CHWA 3B8AX 3JS6A 1U49A 3DWLA 4E7JA 5JVLA 5C24A 1XHZA 4WFAL 1KVBA 1VQNN 1VSIA 4YOXA 4JI6K 2PYJA 5AQYA 4DSLA 3MN9A 4I2PA 2QKBA 5IWAK 2G8UA 2NRTA 5AQXA 1IKYA 4N56A 1NMNA 1Y64A 3M8PA 3RVCA 3CPEA 4DTSA 3HI0A 4LC9B 4DR4K 1HUXA 4CJTA 1VSHA 2KKZA 3OVNA 5BREA 4KH5A 4FJXA 3MEDA 4Z0UA 1VHXA 2R82A 1RFQA 3DRSA 3WQUA 3AA5X 1KC8O 4DV2K 5GADP 3UIQA 4FK4A 4YOTA 1K9MO 4JKBA 4IFEA 1KRPA 3VGLA 4CYEA 2GWKA 2A42A 3WNGA 1CZBA 4EHUA 3CCQN 4A61A 4KREA 4DV1K 4LF5K 1E4FT 1VQPN 1HBKA 3NGZA 2HHUA 3KK7A 2HHQA 1ZBLA 2XO7A 4CF0A 3WEEA 4JKFA 4CHOA 1E3MA 3KWGA 1EX4A 2HMPA 1JLCA 4C1NK 1LAWA 3BF1A 1A5XA 1TUUA 3RR7A 1ZYQA 3AU5A 2Q1NA 2LBBA 3AVLA 3BZKA 2YX6A 4K42A 4I6MB 5TKYA 1Q9YA 2QA4N 4CJ4A 5LMUK 2WFBA 3O4NA 3THYB 3V9SA 3CMEN 3VA3A 3QNNA 5FRMA 3J81O 3QO9A 3TTFA 4ISFA 1EF1A 1NJWA 3SAFA 4Y0WA 3MXMA 4FJ8A 3DXKB 4CF9A 2W6KA 3LAKA 1Y19B 4HTLA 4GV9A 1FXXA 2IGIA 4CBUA 4JKHA 1ASUA 3T19A 4DLGA 4BRGA 3OJSA 2P9PA 2XHBA 4JKGB 4PA1A 1J19A 1EQYA 3QBWA 4CZEA 5JICA 1KFDA 4FWSA 4KBOA 3IMXA 3A5LC 3M1FA 1J5OA 4FXDA 2QWPA 4JI0K 2OPRA 2UXDK 3PIPL 3SYZA 3WXMB 1WB9A 4B3SK 1IO2A 3PV8A 3ZT3A 3L3VA 4E7LA 2X78A 1HMVA 1NGAA 2IDOA 4BG8A 1ASVA 4NCBA 4NCGA 4WF9L 3S3MA 1WOQA 4FWKA 2E6LA 3ZSRA 1BU6O 2HF3A 4CGDA 5BPNA 3WA0A 4JS5A 1I39A 1ATRA 4BC5A 5M1OA 1D9DA 1ATNA 4KHQA 5E84A 1RDWX 2YHYA 4B9LA 1EP4A 3TAQA 4JK9A 2YV0X 1XHXA 4FJHA 4H5NA 4KHPK 2NRVA 2P9NA 3V9UA 3VPZA 2FSKA 1SKWA 2OTLN 3HPHA 5JVHL 1SKSA 5HRSA 4TKNA 3G4SN 2ASPA 1WSHA 4B9SA 4BRCA 4WE1A 3TAGA 3IDHA 1R59O 1EETA 2Y1JA 2O8DA 1K8KB 4MO5A 1S1UA 4FWOA 1Z6RA 4CBXA 1R0AA 5I9EB 3DLGA 4EP4A 4CFCA 4CI6A 4E1JA 4ILJA 1RDUA 3TANA 5KRSA 4TSXA 4DQPA 1KXPA 4CD1A 1EO1A 3JXUA 4W5QA 1HKGA 3IVFA 3KLEA 4F8RA 4CFDA 3VEOA 2DFHA 4B9NA 3WNFA 2E88A 1NVLA 1Z26A 1UA1A 3SAHA 1MU2A 1NU0A 5LJWA 1EWRA 3F9MA 3AVCA 3HBTA 3ALYA 3DLBA 4Z4FA 3E66A 4LY7A 1ZBIA 2E1ZA 1GLEG 3I55N 4DV7K 3CM5A 2NRXA 4FJGA 3FFIA 4CZHA 4JKAA 4M3TA 4LD0A 2G8HA 4FOIA 4C23A 5FLXO 1JDEA 3LDSA 2XY7A 3CCRN 3KWIA 3NF7A 1C0MA 1HYZA 5EVZA 3KK2A 1S22A 3THXB 1YUWA 4U7BA 1VQ7N 3AVJA 3MWTA 4FWQA 2HHXA 1C1BA 4J2DA 4JK8A 3AO1A 1RBUA 3UB5A 4OPAA 1BHLA 4KFBA 1YT3A 4DTNA 1HQEA 4JD2B 3RSEA 4BVPA 3BEXA 3IG1A 1YI2N 5KRTA 1JLEA 5AFUA 3HRGA 2NNWA 2O4GA 4EFHA 3NH0A 4CZLA 4YOVA 3CIPA 3H6EA 4GV3A 3MEEA 1XNQK 2HHVA 4A2BA 1NK4A 5F1XA 2AJQA 1DKGD 4LF9K 1BOTO 3R1XA 1G99A 4DSEA 4MDBA 3HOTA 2KTQA 1P8ZA 3G10A 5DM7L 3SZ2A 2DPNA 2KZMA 3ZEUB 4GXBA 1EXQA 4E7HA 2P9IA 2VGMA 4K41A 3AVHA 4JHDB 3VGMA 3L2WA 1VQKN 1LW0A 3F73A 1OH5A 1JXBA 3TARA 4DQRA 3ZSZA 3SUPA 2FSNA 3CF5L 4KTZA 1W7AA 3NGIA 1OVQA 3MMVA 4PWDA 4IFVA 3SK3A 4B9VA 1SV5A 4E1NA 4GY2B 2O8BA 5AQPA 2O8EB 4BE0A 1U47A 4BRDA 5FDLA 1VBHA 1KAYA 4M3UA 4M3RA 1V4TA 4AILC 4C8OA 4K8ZA 1DGKN 3G9WA 4GV6A 2OYQA 4G9ZA 3AA3A 4KB1A 4AH9A 3CM6A 4DV4K 3N4QA 2QWLA 3VQ5A 3OYAA 3DJCA 4IOAL 1C0GA 3U8ZA 2B6AA 1E5WA 4FW1A 3DXMB 1XWLA 1ITGA 2D11A 1L3UA 3EEQA 4C8KA 4FJ5A 4H0XB 3DOKA 4AM6A 4DSKA 1NTIA 4Y1CA 5JLHA 1YVUA 3GBTA 4IJNA 3FFKB 3BP8A 5AQOA 3WXIA 4DTOA 4CIEA 1J53A 4ELTA 2HBLA 5AQVA 4W5TA 3CI5A 4F3TA 1J5EK 2YI1A 2YNGA 4ZHRA 1BI4B 1X9MA 4YL8A 3ZSWA 1M1KO 3C65A 2QTDA 4B8AB 2FXUA 5ADXA 2GEMA 4DFKA 2O8CA 4LH4A 3HSCA 1CXQA 1NK6A 2G8FA 1NWKA 4CEAA 1YHQN 4BRMA 2FLOA 4IG3A 4FJ9A 4O8UA 1YITN 2UU9K 3J7AP 3ULDA 1VQ8N 3DLLL 2JWLA 3Q7CA 4DU3A 1GLLO 4IDKA 2HHSA 2D4WA 4E7KA 1KD1O 4CF2A 2JLEA 3C6AA 3TSPA 1U04A 3IS9A 3LDOA 4CGGA 1QVFM 3RRGA 5D3GA 1DTTA 5CZ1A 1JKHA 1OH8A 4BGBA 3E1YA 3DM2A 3TSUA 2HBMA 2IC3A 3MK6A 3MN7A 4Y1DA 1LOTB 4QS8A 5KPRA 4O8KA 2HHHK 3KVGA 4CD3A 3MN5A 2OCEA 1CXUA 3B6OA 3V9ZA 1IBKK 2KZZA 3QICA 3NAEA 1CLQA 1T3VA 3L4IA 2BDPA 1QQCA 3CCUN 4RWTA 1Z05A 5HROA 1KLNA 3SUQA 4IEIA 3OYFA 3FZHA 4DU1A 4CHPA 3K5MA 3ISNC 1WAJA 3DRRA 4LF4K 3F2KA 4NXMK 3D2FB 5CR4A 4CHYA 3AY9A 4DV3K 4BDYA 3O4QA 4KHWA 4DR2K 5F0XA 4BWJA 4HUFA 4BDZA 2F9WA 1NGHA 1X3MA 1NJIO 1N36K 5CZ2A 1SAZA 3GG4A 1XMQK 4Z4CA 2XY5A 2OZSA 4WQ5A 1MWKA 1Q9XA 5BRDA 5IJMA 4DF8A 1YIJN 5FROA 4HUGA 4NLBA 4DHYA 1H1VA 2H3GX 2FBVA 2KFNA 3AAPA 3M6GA 5HOOA 3O9SA 3VQPA 4DFMA 1OH7A 2V7ZA 4U67L 3CFOA 1RBSA 5AJ3K 3NH2A 3HK2A 3O80A 5KPTA 1ISNA 4CK2A 3OHRA 3V9WA 1UA0A 2W41A 4JI5K 1CZAN 4EAHD 1U4BA 3MWPA 3BGRA 4KKOA 1U45A 4GVMA 4CEFA 2YJEA 1YXQA 1ZBUA 2QWQA 5JVGL 3Q7BA 2P9UA 2I7NA 1UAXA 3A8YA 2P9SA 3P4IA 2HBKA 1GC7A 3K59A 1X3NA 4JAXA 1ZXOA 4DWIA 4JI8K 2X6SA 1IV0A 2VG7A 2ZGZA 4CEQA 3ID8A 3LZJA 4XH5A 4PY5A 3V1QA 1CZ9A 3CXCM 3OYCA 5HLFA 4F3OA 3N4PA 2A5XA 1RTIA 4IOXA 3KLFA 3AO3A 4H03B 1L3SA 1BG3A 1HQUA 2A41A 1HNIA 4IOCL 1IJJA 1I3AA 2OTJN 3K5LA 2PZSA 4WFNL 1RDBA 4M41A 4CFAA 3OYKA 1NKCA 3OBWA 1KAXA 4MDAA 3EN9A 1D9FA 4W5RA 1S5JA 3AVBA 2IIRA 1NJYA 3CPWM 1A5VA 4B9QA 2P9KA 2WONA 2AP1A 1TKZA 4PKGA 5C12A 2XRIA 3VQ9A 1HYSA 5C42A 4F2RA 2G8IA 5FPMA 4HWIA 2NRZA 4CESA 3HM9A 3L8BA 3NCIA 2WTUA 1GG3A 4M7YA 4WQ4A 4AF1A 3EO3A 4IJAA 3HM8A 3AA4A 2NZTA 3SJHA 2RHKA 3RMCA 4HCCA 3ZETB 4MQ3A 4FWMA 4C8MA 4FL9A 3AU4A 3HOSA 3WQTA 4RTFD 4K25A 1VBGA 3IRXA 3VQAA 4OGEA 1KCFA 4CBWA 3DLEA 3VQEA 1L3TA 3WXLA 3HZ6A 3AO5A 1VQ9N 4E1MA 3QETA 3ZT0A 2YVCA 3AA2A 1TK0A 5AQNA 4MLEA 2E5LK 3THWA 2NRRA 3HJFA 5M1QA 3ULEA 1EWQA 1RT1A 3OY9A 2ZWHA 3C95A 3MCAB 4O55A 3VQDA 1NOZA 1S9EA 4JI2K 3C7NB 4QAGA 3O9RA 1SGHA 4OPKA 5AQKA 5CY4A 3L2QA 4JEPA 3ATVA 1NKEA 1HB6A 1ILYA 4ELUA 1NK8A 2BUPA 1Q7YO 3EL2A 1HJOA 1GLDG 4CJ7A 2HF4A 1WBBA 3E9PA 2Z1GA 4EKUA 1C6VA 3KZBA 1QVGM 4EZ6A 4MLHA 3T1HK 1K73O 2F9TA 3QFUA 4IKFA 3CC2N 1TUYA 4BR9A 1FW6A 3LPUA 4GW6A 3ZYYX 4A5BA 1SZ2A 3K5NA 3QESA 1ACAA 2FSJA 1O1WA 4N47A 3V9XA 4H5VA 4CZIA 4YNQA 2QW9A 1C1AA 3NBPA 5K14A 5AZJB 1N5YA 2CGLA 1L5UA 1NGJA 4DQ8A 3LDLA 3ZSQA 5EU7A 3ASMA 2HNYA 2EWSA 1JLGA 1MK7B 3AO2A 4FZXC 1SL0A 3F9KA 1RT3A 5AZIA 1BGXT 1YJNN 3CJ1A 4I7FA 1GOBA 2RF2A 4BE2A 3ZT2A 2GV9A 1QHTA 4CJLA 4UY8O 1HPZA 3D45A 4BY9C 4CZFA 1GLBG 5GAHP 3TAEA 4FZYA 3LM9A 3O3HA 3LDNA 1M90O 2CB8A 2PY5A 3SLCA 4C8LA 3TAMA 1VRUA 3A2FA 5AQZA 3BY5A 2VYPA 2IVPA 3VEZA 1Q81O 1FJGK 1Q18A 4CE9A 3LAMA 3SNNA 4HDQA 1MDUB 1WBDA 1NM1A 4B1XB 5AQLA 4FJ7A 4B08A 4KI4A 3FR0A 3SQ4A 3VENA 3KK3A 4DUZK 4JN4A 1TK8A 4J2AA 1TYQA 4E19A 3S3OA 4Q5VA 4OGCA 3AVAA 4L3QA 3PX0A 3SJJA 4A59A 3KD1E 1VQLN 1KLMA 1HNZK 2D0AA 1BA1A 4HDOA 3U7DA 4AHSA 1X9WA 4BREA 5CYQA 4X64K 4YOYA 1G15A 3NF9A 5C2DA 3VF4A 3AVGA 1B9DA 2X6NA 4DQSA 3CCLN 5FRNA 3K5OA 1S1TA 3VA0A 3A5OC 3O6WA 3G71N 4DTJA 3LP1A 5J2PA 4FM2A 2FC0A 4BGAA 5KPZA 3WT0A 3QERA 1NGEA 4FVUA 4DUYK 3MDQA 4KTWA 2J0MA 1MWMA 4HCBA 1JCGA 1RT2A 1WNSA 3K9JA 2IS3A 2AA4A 3AO4A 3AVIA 3QFPA 3SV3A 2YHWA 3P39A 3ZSXA 5CYMA 3L4QA 3RRHA 1HNXK 4DG1A 4I6MA 1ST7A 1ASWA 3J80O 2QM1A 4CEZA 3VQQA 3HL8A 2QKKA 1A5WA 3UKRB 3THYA 1QE1A 4WCEL 3H3OB 1U2VB 3AVFA 3FLCO 3GDQA 2HE7A 3DXKA 3U8XA 4N76A 1MIZB 3BDPA 2P1JA 5H1SQ 4M3YA 3VERA 3VGKA 4IWVA 4YDUC 4AQYK 3GOIA 2AEHA 3RR8A 4JKGA 1ATSA 3QIOA 4PL8A 1HNWK 3H08A 3AGKA 1NK7A 3KKRA 2P9IB 4CVNE 3VQ7A 3M3ZA 3TAPA 3J8AA 4H0TB 2DTUA 4WQ4C 1MA9B 3K57A 4MO4A 3TU5A 1NJZA 5M1FA 5EX5A 4CECA 4JI3K 3SQ0A 1BQNA 4FK2A 3D6RA 3KD5E 4ID1A 2R7YA 4P7IA 4IO8A 4JRQA 2V7YA 3PZDA 4F9OA 1NKBA 3HT3A 4K8XA 2Q0UA 3QDKA 2YHXA 4BRHA 3J7ZO 2HSTA 3CCVN 4ZTFA 2WBNA 4EIAA 1WLJA 1DLOA 4CHNA 2I1KA 4FLYA 4F7GA 4QS7A 3VTIA 4EZ9A 1MIXA 2QK9A 1GLFO 2Q31A 3CMAN 3NDKA 4R79A 3ZSVA 4FLZA 3R9PA 3H1QA 1JCEA 3PSIA 4QS9A 4BRQA 4OX9K 3NF8A 1I94K 1WUAA 3QIJA 4DFJA 1K8KA 2QXLA 3DI6A 3CCEN 2UYTA 1N32K 4KAZA 1ZBSA 2HOEA 3SAGA 4DR6K 3OJUA 4X62K 2V52B 3K58A 3DMJA 1KVCA 4HUEA 1VSDA 4DKWA 2CQUA 1BCOA 4PHTX 4E89A 2DIKA 1HJRA 3ID6A 4KO0A 4CJSA 5DK5A 3OYMA 4CZJA 4B9UA 1HKBA 5JS1A 1KBLA 2QXFA 4MFBA 2YJFA 3VEWA 1X9SA 4ELVA 4OKEA 4DTMA 3QLHA 4BC3A 4BACA 2P9LB 3PSFA 4J2EA 1GGOA 2HHTA 4KHUA 2GX9A 3EKUA 5J2NA 4CJVA 1RGIA 3OYBA 1TL1A 1HKCA 1NK5A 2HMIA 1C0FA 2HNZA 3KLGA 1K8AO 3EY1A 4BR0A 5E26A 4JV5K 3P5JA 4DQQA 4FM0A 4CGJA 5FPEA 2Q3SA 3ZT1A 4E7IA 1P90A 1YTUA 4L8RB 4AHCA 2A1SA 4LF8K 3MAQA 1VSMA 3LP2A 4FVMA 4H8KA 3HTVA 2Z1HA 2D0OA 1TK5A 5KI6A 4YOWA 3HVRA 3LL3A 3TAFA 3THXA 1VSJA 2DFFA 3KJVA 3FLVA 3ZX2A 1ZBFA 4FLWA 4OO1J 4FWNA 1QHAA 4NLCA 1T8EA 1TAUA 3MECA 2D0CA 3D2EB 4IG0A 3ZCMA 4JD2A 4ISEA 5JMVA 3SBGA 5C25A 1YJ9N 3NMUA 5HL7L 5AQSA 2VWJA 3VTHA 4PKHA 1SL2A 4H0PA 4O0JA 2RE2A 5C2FA 4X66K 3ZSOA 4JI1K 1REVA 2ZD1A 3QBXA 1SL1A 4X65K 1RNHA 4FJJA 1VRTA 2IAJA 3ZEUA 4YHHK 5EOYA 4DR5K 4JHDA 4O5BA 3VETA 5AQTA 3MN6A 1S6QA 2KLAA 2OZMA 4O4GA 3SPYA 3VOVA 3CETA 5GAEP 4CJQA 3L2VA 4PKIA 4CFBA 3A5NC 2O8EA 2V51B 4PQUA 4G1QA 4ISGA 4DB3A 3OBYA 5GIOA 1QQOA 3DYAA 4JKCA 3NH1A 3OYIA 3MXIA 2G8VA 3JAMO 3C6UA 2ABDA 2A6AA 3HSTB 5AR0A 4BVOA 4LFBK 5HRNA 2BH1A 2GBZA 5LL6Z 4H0YB 1QTMA 3E9OA 4XEIA 4O0IA 3PVLA 2ZJPL 3DXMA 1NGFA 3T69A 3NVKA 3EE8A 2ZM6K 3S3NA 3O9TA 1LV5A 4GMJB 1JLQA 3CJAA 5HRRA 5M1PA 3PUFA 1GOAA 4QCLA 5JLFA 3FGUA 1KC7A 1YJWN 4XIUA 3CFPA 3NF6A 3TTDA 3TSQA 3AGRA 4CIFA 2O8FB 2FBYA 2G8KA 4BRNA 1VQON 4FM1A 3I0RA 1S1VA 3DRPA 3UKUB 4CJ5A 1QSSA 1BI4A 3WNEA 3BZCA 4RW8A 1N34K 4Q0BA 2EMTA 4RW6A 3VN5A 3O9UA 1T7PA 3K0SA 4BDPA 2O4IA 2HW3A 4M3ZA 1VQMN 3G0ZA 4CEDA 4Z4EA 3CJ9A 2QWOA 4BR7A 3PO4A 2EMSA 1RDDA 5GINA 1NI2A 2RN2A 4R5PA 2J0KA 4DSIA 1XQSC 4FJNA 1SQKA 3NGYA 3R8EA 4ZRIA 4KHNA 3T7ZA 1V4SA 3OS1A 5CHIA 5BR8K 4BR4A 1LCUA 3O9QA 2YKMA 3MCPA 1JCFA 4GKKK 4LFAK 4CJPA 3SV4A 4RCHA 3RMAA 5SZTA 4FZZA 1NJXA 3AV9A 4H5WA 4DSFA 1BQMA 1HPMA 1SUQA 4A62A 2ITMA 4DTPA 2Y1IA 3A0IX 4FWRA 3X23A 4DLEA 5C0YA 4IFYA 1VK0A 1IBMK 5J1EA 3FE1A 1BL3A 4CZKA 2P5OA 2ZE2A 3W3DA 4OJRA 4KTQA 4JKEA 3SQ1A 4DV6K 5LJVA 4W5OA 3THWB 3C94A 5AQIA 2E4LA 2FBXA 4CW7B 3TABA 1VQ6N 2EX3A 3D2FA 1DIKA 1LWEA 2CGKA 2IVOA 4J2BA 4Z4HA 3HP9A 3LANA 5A2QO 3OYLA 4H4MA 3V81A 2HNDA 4NB4A 3JYTA 3CQ8A 1HR0K 3O5BA 2OA8A 3I8DA 2X74A 1XC9A 4BWMA 1SKRA 1RBRA 4CEOA 1YVNA 3QEIA 2D0PA 1RT6A 1GLAG 3O1BA 4J8FA 4FYDA 4FSVA 4K43A 1BCMA 3S9HA 5BR9A 3WEEB 4BR5A 4YFUA 1JLBA 3IKMA 4H5TA 1RT7A 4JLHA 4CZMA 1RTJA 4CF8A 3OYHA 2FF3B 3KTQA 1YF5L 4ZRJA 3V1RA 2VQEK 1QQMA 4FJIA 3CCJN 4B1YB 3A5MC 4KH4A 4OKKA 2J4RA 1QSYA 1DTQA 5BN9A 3P1GA 1C0TA 5M1KA 4CJUA 2E6MA 4IXCA 3VESA 4AHVA 4OKJA 4DU4A 4GNIA 1WN7A 2P9PB 4JS4A 4DTRA 1TKTA 3LZIA 1Q8IA 4CGFA 1Q86O 3AVNA 3VMFB 1KQSM 2GWJA 4BRLA 1WSEA 4F2SA 1UWBA 2VG6A 5KGWA 4CGHA 4CJ3A 1BA0A 5B8HA 3AAQA 3TWHA 1W2BM 4Z4GA 1J6ZA 1NGBA 1TYQB 4FJMA 4AHUA 4DTUA 2F96A 4O44A 3ZX3A 4Z94A 3O4WA 1IBLK 2YKNA 3DLRA 3QB0A 2ATQA 2Q97A 3NFAA 3QINA 4JI4K 5EY4A 5AQFA 1GLJO 1RBVA 2QWRA 3OS0A 4RW9A 4FWLA 3V4IA 4PL7A 4LF6K 1RDAA 3ATUA 1LWCA 5SWMA 3VQCA 2P9NB 1IKXA 2BGGA 3EE9A 4C1NI 3TI0A 3ENHA 2HRJA 1B92A 3H46O 2GELA 3CC7N 3VF6A 3F5TA 4CCHA 2HVHA 1ZC6A 3GL1A 3VEYA 3KKSA 4DR3K 1IG8A 4FJLA 1JLFA 4BC4A 2KFZA 3L0QA 5HBMA 4KB0A 2O8DB 3O1WA 4FLTA 4B3OA 1ZBHA 3WXJA 3ZETA 1GOCA 3I0SA 3WNHA 3HXMA 4WQ5C 4FJKA 2HVIA 3G6EN 2B4JA 2WH5A 2JGUA 1BDGA 1Y97A 4H0VB 3FP5A 2GUIA 4IO9L 4M3WA 2Q2RA 2ETJA 3OYJA 1U6ZA 1K6YA 3GE1A 3HP6A 1B9FA 5LY3A 4JKDA 1NK9A 5AFUH 3QIPA 4CJRA 4B3MK 1MK9B 2Z1JA 5AQQA 4BRPA 4FLUA 1W0HA 3E01A 4KHSA 5T7BA 1TGOA 3OYNA 4H4OA 1NGDA 2F8SA 5BPLA 3OYGA 1WSFA 1OVYA 2IVNA 3C7NA 2DFEA 3KK1A 2BE2A 4DFPA 1NG9A 3H45C 3RWUA 4LFCK 2YNIA 1QS4A 4IBNA 3D0PA 2E2OA 2PAVA 2Z1IA 3E9LA 3AVMA 2A3ZA 4KH6A 1IKVA 3JSMA 4BROA 2ZQBA 2F4VK 1VSEA 1W97L 4BQLA 1T05A 3VQBA 1F21A 1S1XA 3MXJA 3CCMN 4M7XA 3CQYA 3TR8A 3O3FA 1L3VA 1RCHA 4FK0A 5AQGA 2UXCK 2CH5A 3VEVA 4CK1A 1RTDA 2NUBA 4N5SA 3U6FA 5AZJA 1WSJA 3UE5A 1RTHA 2RPIA 4LH5A 2E2NA 4YORA 3DAWA 3D7EO 4A2AA 1LWFA 4RG8A 3OYEA 3RSEB 1IH7A 3BUZB 4GKJK 3LWMA 4LF7K 4B1ZA 2YHBA 1TKXA 2X0SA 5CE3A 1FKPA 3B6PA 3V6DA 4UQGA 3TPQA 4NYNA 3P31A 3G25A 4XH1A 4E3SA 2UUBK 3I33A 4I9LA 1KAZA 1O13A 2BTFA 2EHGA 1HRHA 3O8MA 2JWKA 3EKSA 5AQUA 5DM6L 4BE1A 2E20A 5ADXH 1VSFA 4ILHA 4OPHA 2ZJQL 2A1RA 1S3XA 1HLUA 3R3LA 3PO5A 3O08A 4DS4A 1NLVA 1Q82O 1BIZA 5KQDA 2O8BB 1W9HA 3DOLA 2Q36A 5KGXA 1NK0A 4H5RA 4NXNK 1T03A 1XUPO 4HHTA 4DCHA 4JRPA 4BRFA 4ILGB 1VAZA 3CFRA 5GAGP 1IG9A 2VWKA 3KHYA 5BPMA 5BRFA 4XH4A 1XMOK 1KTQA 3CYMA 4DS5A 3RMDA 3CG7A 3H3NO 3R6MA 4B8CA 3ZDTA 1RILA 1J54A 3ITHA 3OA9A 2COPA 2IOCA 1Z25A 3HPGA 4FW2A 3ZT4A 2KHOA 3H1VX 3DLHA 1HX1A 4AHTA 4EP5A 1T6CA 3VQ6A 1LAVA 4CJEA 2WOMA 1QZ6A 4CK3A 2YNHA 3SUOA 1N8RO 4FLVA 3LM2A 4CHQA 5HRPA 3FZFA 3IUCA 4FWPA 4B1VA 4FLXA 4A57A 5FPDA 4NO7A 3T1AA 4QOZB 3UKRA 4M42A 4WYBA 1S1WA 3FZKA 4DMNA 1U48A 1KVAA 3RMBA 4Z4IA 1TVRA 1U2VA 3CJ7A 2P5GA 2O8CB 3SPZA 4CZGA 4NYFA 2E1YA 3M8RA 2E2QA 2OANA 4E0DA 2D2QA 3PX4A 4KHYA 2ZF5O 4CERA 4CHZA 3KLHA 2CGJA 4BRIA 4BQZA 3HO1A 3VQ8A 1N6QA 1WSIA 2NLXA 1GC6A 3EYZA 3SQ2A 5J2MA 2KQ2A 1RT4A 2PFUA 2KW4A 2OPPA 4DV0K 2I7PA 2FJ9A 2FF6A 3LDQA 3I8BA 5I3UA 3U9DA 3HVTA 3CD6N 1QZ5A 4OPJA 2ZPYA 1RDCA 4OLBA 4M3XA 4BRKA 2ITGA 5C10A 4DSJA 3VEXA 5MLCQ 3OW2M 2YCHA 1S9GA 5J2QA 5LMNK 1HB8A 1KFSA 3I56N 5AQJA 2OPQA 2D10A 3L2UA 1VSKA 2UUCK 3P83D 4BR2A 1T44A 1NGCA 1GLCG 5TKWA 2I5JA 1FK9A 1OKJA 2YHAA 1VQ5N 3KIOA 5FPNA 1BWFO 1VQ4N 4DXAB 3L6QA 3QEPA 1NGIA 2DY4A 4JNEA 4GVEA 1RT5A 4ZTJA 2QWMA 1J9AA 4LSLA 2WUSA 1C0UA 2W6LA 4B3RK 4PUOA 3QEXA 2VGNA 4I9QA 1OH6A 4B3TK 1HYVA 4JYAK 2NRHA 2RQ1A 2P51A 1DT9A 1QSLA 5IT9O 3SUNA 3T1YK 3M8QA 1YAGA 1XI1A 4BG9A 4DQIA 3IAYA 3CERA 1BO5O 1QQNA 1BIUA 3C0BA 4CJWA 4FPBA 2GTDA 2FBTA 3MX2A 2ASOA 2F8TA 3HYFA 4CJFA 2QEXN 2VCPA 1EKEA 2P9LA 1S6PA 2YNFA 4CEBA 4NCAA 5KQ8A 3J7YP 4K0KK 2D1KA 1WSGA 3S41A 1T6DA 3W0LA 2J0JA 3LWLA 5DMRA 1XNRK 4I2QA 4KRFA 2XY8A 4O5FA 4FO0A 5EXWA 2E2PA 3ZSYA 5KTQA 1NGGA 2QI2A 1WAFA 1JL1A 2D0BA 3M8SA 1JL2A 4V19S 3PLAA 3DLKA 3PIOL 3CQXA 3SMSA 2P9UB 1VSLA 3SI6A 2P9SB 4DTXA 4HVJA 3SBTA 1D4XA 1KSPA 2HB5A 5E41A 2F7TA 3QEWA 2PYLA 3U9ZA 4C8NA 5AQWA 3D2EA 3HPOA 3QMLA 2RKIA 3L3UA 4EHTA 4A5AA 2AL6A 2HHWA 4RW4A 2W42A 4CGIA 3ENBA 1YTAA 3QNOA 2W40A 1TKDA 4ICLA
chains in the Genus database with same CATH topology
4IDHA 3SK3A 3VESA 3U4LA 4GY2B 2E8AA 5AQPA 4GNIA 4BRDA 3QFPA 3IFRA 2P9PB 1VBHA 2YHWA 1KAYA 3ENOA 3FZMA 1NMDA 1V4TA 3P39A 5GIPA 3P38A 3L4QA 4IZ9A 4I6MA 1Q86O 1DGKN 3G9WA 2HBJA 4GV6A 3WXKA 5AQHA 3VMFB 1KQSM 1ST7A 4G9ZA 2GWJA 4BRLA 2P9KB 2QM1A 2GUPA 3UKRB 1BA0A 5B8HA 3AAQA 2QWLA 3N4QA 5C15A 2ASMA 1H4RA 1XC3A 1J6ZA 1NGBA 1W2BM 1TYQB 4WCEL 4IOAL 3DJCA 3AARA 1C0GA 3U8ZA 5ELZA 1E5WA 4Z94A 3DXMB 3ZX3A 3H3OB 1U2VB 3O4WA 2D11A 3FLCO 3GDQA 3QB0A 4B1WB 4H0XB 2HE7A 3DXKA 4AM6A 2Q0RA 2Q97A 1NTIA 1X9JA 3U8XA 1MIZB 5EY4A 5BN8A 5M1NA 5H1SQ 5AQFA 1GLJO 2QWRA 3VERA 3VGKA 4YOUA 5JLHA 4IWVA 4YDUC 4JK7A 3GBTA 4IJNA 3FFKB 3BP8A 5AQOA 3WXIA 3GOIA 2AEHA 4JKGA 1ATSA 4FWLA 4PL8A 2HBLA 3AGKA 5AQVA 4PL7A 3M5RA 3ATUA 1ESVA 4WFBL 2P9IB 3CI5A 3TTCA 3M3ZA 2P9NB 2QWNA 2YI1A 3EE9A 3FZLA 3J8AA 4C1NI 4H0TB 3ENHA 4NY0A 2HRJA 3H46O 2FDQA 4YL8A 2GELA 1MA9B 4FOEA 4WQ4C 3CC7N 1M1KO 3VF6A 3F5TA 2A40A 4MO4A 5AQMA 2PBDA 3EPYA 3C65A 4H0OA 3TU5A 2QTDA 4ZRKA 5BRHA 1ZC6A 3GL1A 5M1FA 2FXUA 3VEYA 5EX5A 5ADXA 2GEMA 3ULEB 1IG8A 3ZX0A 4BC4A 3CCSN 3HSCA 3D6RA 3L0QA 2NRWA 3O1WA 1NWKA 4P7IA 3WUHA 1YHQN 4BRMA 2WC9A 3WXJA 2FLOA 3ZETA 4IO8A 4O8UA 1YITN 2V7YA 3PZDA 2VWBA 4F9OA 4WQ5C 5F2RA 3G6EN 2Q0UA 2WH5A 2YHXA 3QDKA 1VQ8N 4BRHA 3J7ZO 1BDGA 2HSTA 2JWLA 3DLLL 4H0VB 3FP5A 2WBNA 4EIAA 3CC4N 3CCVN 3Q7CA 4IO9L 1GLLO 1S72N 2Q2RA 2I1KA 2D4WA 3UKUA 1KD1O 1U6ZA 4F7GA 4QS7A 4B1UB 3BF3A 3EZWA 3GE1A 3VTIA 1MIXA 1NBWA 3C6AA 5LY3A 1GLFO 4JKDA 2Q31A 3CMAN 5AFUH 4R79A 3VF2A 2CH6A 4M63C 3TSPA 1MK9B 4BC2A 4FPAA 3LDOA 5AQQA 3R9PA 4BRPA 1QVFM 3H1QA 1JCEA 3CJCA 5AQRA 4QS9A 4BRQA 1WUAA 3QIJA 4BGBA 1JJ2M 3E1YA 3K9KA 3TSUA 1K8KA 1NGDA 2HBMA 2QXLA 3MK6A 3MN7A 2UYTA 3LDPA 3CCEN 5BPLA 3CJBA 1LOTB 4QS8A 5KPRA 4O8KA 1ZBSA 1OVYA 2HOEA 2IVNA 3KVGA 3MN5A 3C7NA 4CD3A 3SAGA 4IEEA 1E4GT 2V52B 4YDUA 1DEJA 2I1JA 3H45C 3BINA 4DKWA 3QICA 1T3VA 3L4IA 3SMPA 4BRAA 2CQUA 4PHTX 2ZJRL 2DIKA 3ID6A 3CCUN 4RWTA 1Z05A 2E2OA 2PAVA 3NVMA 1BUPA 1SS6A 3MX5A 3E9LA 3C6HA 3FZHA 4IEIA 5AZIB 4CZJA 1HKBA 2A3ZA 4KH6A 4BROA 1KBLA 2ZGYA 2YJFA 1W97L 3F2KA 4BQLA 3VEWA 3D2FB 5CR4A 3AY9A 4AM7A 3CCMN 3CHWA 4M7XA 3CQYA 3B8AX 4BC3A 5F0XA 3JS6A 2P9LB 1GGOA 3DWLA 2F9WA 5JVLA 1NGHA 1X3MA 2CH5A 5AQGA 3VEVA 4WFAL 1SAZA 1NJIO 2GX9A 3EKUA 3GG4A 1VQNN 4YOXA 1RGIA 5AZJA 3UE5A 5AQYA 1HKCA 3MN9A 4WQ5A 1C0FA 1MWKA 2E2NA 4YORA 3DAWA 1K8AO 3D7EO 4A2AA 5BRDA 5IJMA 2NRTA 5AQXA 4BR0A 5E26A 3RSEB 1Y64A 1YIJN 3BUZB 4NLBA 3RVCA 5FPEA 4DHYA 3CPEA 1H1VA 2H3GX 3HI0A 4LC9B 1P90A 1HUXA 4B1ZA 2KKZA 5BREA 4KH5A 3AAPA 3M6GA 2X0SA 5HOOA 5CE3A 3HTVA 2D0OA 3O9SA 4YOWA 2V7ZA 4U67L 2R82A 3LL3A 1RFQA 3TPQA 3WQUA 3P31A 3G25A 4XH1A 1KC8O 3I33A 3FLVA 3O80A 3ZX2A 5KPTA 1KAZA 5GADP 1ISNA 4FWNA 4OO1J 3OHRA 1O13A 4YOTA 1K9MO 1QHAA 2BTFA 4JKBA 4NLCA 4IFEA 4CJ7A 2W41A 2JWKA 3O8MA 3EKSA 3D2EB 3VGLA 4CYEA 5AQUA 2GWKA 1CZAN 2A42A 4EAHD 5DM6L 2E20A 4EHUA 4JD2A 5ADXH 3MWPA 3CCQN 4ISEA 4A61A 5JMVA 4ILHA 4OPHA 2ZJQL 3SBGA 1YJ9N 1S3XA 3NMUA 1E4FT 1HLUA 3R3LA 5HL7L 3O08A 1VQPN 1HBKA 1NLVA 5AQSA 1Q82O 3VTHA 3KK7A 4PKHA 5KQDA 4H0PA 2YJEA 1YXQA 2Q36A 2QWQA 5JVGL 3WEEA 4JKFA 2RE2A 2P9UA 3Q7BA 2I7NA 3KWGA 2HMPA 4H5RA 5C2FA 4C1NK 3BF1A 1TUUA 3A8YA 2P9SA 3AU5A 3QBXA 2Q1NA 3P4IA 1XUPO 2HBKA 1GC7A 2LBBA 4DCHA 1X3NA 2YX6A 4K42A 4I6MB 4JAXA 1ZXOA 5TKYA 4BRFA 2QA4N 4ILGB 1VAZA 5GAGP 2ZGZA 3ZEUA 3KHYA 3ID8A 5BPMA 2WFBA 5EOYA 5BRFA 4XH5A 4JHDA 4XH4A 3VETA 3CMEN 5AQTA 3MN6A 2KLAA 3CXCM 3TTFA 4ISFA 1EF1A 3H3NO 3N4PA 3R6MA 3CETA 2A5XA 3VOVA 5GAEP 3SAFA 4PKIA 4Y0WA 3ZDTA 3DXKB 4IOXA 4H03B 1Y19B 3OA9A 4HTLA 2COPA 3A5NC 4GV9A 1BG3A 4CBUA 4JKHA 2A41A 2V51B 2KHOA 1IJJA 3H1VX 1HX1A 4BRGA 4IOCL 2OTJN 2P9PA 4ISGA 4DB3A 1T6CA 4WFNL 4JKGB 1J19A 1EQYA 3OBYA 3OBWA 3QBWA 1QQOA 1KAXA 4MDAA 4JKCA 4CZEA 5JICA 1QZ6A 4FWSA 5GIOA 4KBOA 3EN9A 3IMXA 3A5LC 1N8RO 3M1FA 2QWPA 2IIRA 2ABDA 3LM2A 3PIPL 3CPWM 3FZFA 3IUCA 4FWPA 4B1VA 3WXMB 4B9QA 2P9KA 2A6AA 4A57A 5FPDA 4NO7A 2AP1A 4PKGA 5AR0A 4BVOA 5C12A 3UKRA 2BH1A 4WYBA 1NGAA 4H0YB 3E9OA 3FZKA 4XEIA 3PVLA 2ZJPL 4HWIA 3DXMA 1NGFA 5FPMA 2NRZA 1U2VA 3T69A 3EE8A 4BG8A 1WOQA 4WF9L 3NVKA 4FWKA 3CJ7A 1BU6O 2HF3A 3O9TA 5BPNA 3WA0A 3CJAA 1GG3A 4M7YA 4WQ4A 4AF1A 4CZGA 1ATRA 2E1YA 5M1OA 3EO3A 5M1PA 4BC5A 1ATNA 2E2QA 2OANA 4IJAA 3HM8A 5E84A 1RDWX 2NZTA 3SJHA 2RHKA 5JLFA 3ZETB 2D2QA 2ZF5O 3FGUA 1KC7A 2YHYA 2CGJA 1YJWN 4FWMA 4BRIA 4BQZA 4FL9A 3TTDA 3TSQA 3AU4A 2NLXA 1GC6A 4JK9A 3AGRA 4H5NA 3HOSA 2NRVA 2PFUA 3WQTA 4BRNA 2P9NA 1VQON 4RTFD 4K25A 1VBGA 3VPZA 2FSKA 3UKUB 2I7PA 4CBWA 2OTLN 2FJ9A 2FF6A 3LDQA 3WXLA 3HZ6A 5JVHL 3I8BA 1VQ9N 3U9DA 3CD6N 2EMTA 1QZ5A 3O9UA 4YOVA 2YVCA 2ZPYA 4TKNA 3G4SN 5AQNA 2ASPA 4MLEA 3K9JA 2NRRA 4BRCA 5M1QA 3IDHA 1R59O 3ULEA 1VQMN 4BRKA 5C10A 2ZWHA 1K8KB 3VEXA 3CJ9A 5MLCQ 2QWOA 3MCAB 2YCHA 4MO5A 4BR7A 3OW2M 1HB8A 2EMSA 1Z6RA 4FWOA 5GINA 1NI2A 3I56N 4CBXA 3C7NB 5AQJA 2D10A 2J0KA 3O9RA 1XQSC 5I9EB 1SQKA 4E1JA 4CI6A 3R8EA 4ILJA 1SGHA 4ZRIA 1RDUA 5AQKA 3T7ZA 1V4SA 4BR2A 1KXPA 1T44A 4JEPA 5CHIA 3ATVA 4CD1A 4BR4A 1GLCG 1NGCA 1EO1A 1HB6A 3JXUA 5TKWA 1LCUA 1OKJA 1HKGA 3O9QA 2BUPA 1ILYA 1Q7YO 1VQ5N 3EL2A 1HJOA 1JCFA 3IVFA 1GLDG 1BWFO 2HF4A 3MCPA 5FPNA 3E9PA 4DXAB 4RCHA 4EKUA 3VEOA 3L6QA 1VQ4N 1NGIA 3KZBA 4JNEA 1QVGM 4GVEA 4MLHA 2E88A 1K73O 2F9TA 2QWMA 4H5WA 3QFUA 1HPMA 3CC2N 1TUYA 4BR9A 4A62A 3ZYYX 4A5BA 1SZ2A 1NVLA 2WUSA 2ITMA 3SAHA 3A0IX 1ACAA 4FWRA 2FSJA 2VGNA 4H5VA 4CZIA 2QW9A 3X23A 5LJWA 3F9MA 3HBTA 5C0YA 5AZJB 2NRHA 2CGLA 3E66A 3FE1A 1NGJA 4DQ8A 2RQ1A 3LDLA 1DT9A 4CZKA 3W3DA 2E1ZA 1GLEG 2EWSA 3I55N 1MK7B 2NRXA 4JKEA 4CZHA 4JKAA 5LJVA 1YAGA 4FOIA 5AZIA 4C23A 4BG9A 5AQIA 1YJNN 3CJ1A 1JDEA 3CERA 3CCRN 1BO5O 1QQNA 3C0BA 1VQ6N 3KWIA 4UY8O 4FPBA 2GTDA 3D2FA 4BY9C 3MX2A 2ASOA 1GLBG 4CZFA 5GAHP 5EVZA 3LM9A 2QEXN 1DIKA 2CGKA 2IVOA 2VCPA 3LDNA 1M90O 2CB8A 2P9LA 3SLCA 1S22A 5KQ8A 1YUWA 2D1KA 4U7BA 1VQ7N 3MWTA 3S41A 5AQZA 1T6DA 4FWQA 2VYPA 2J0JA 2IVPA 3VEZA 3W0LA 1Q81O 4JK8A 3UB5A 4OPAA 4NB4A 1Q18A 4O5FA 3O5BA 4FO0A 5EXWA 4HDQA 1MDUB 2E2PA 1NM1A 4B1XB 5AQLA 4JD2B 3RSEA 4BVPA 1YVNA 3BEXA 3FR0A 2D0PA 3VENA 1GLAG 1NGGA 2QI2A 4JN4A 1YI2N 1TYQA 3O1BA 4J8FA 4L3QA 5AFUA 3HRGA 4FSVA 4A59A 3PLAA 2NNWA 1VQLN 4EFHA 3PIOL 4K43A 4CZLA 1BA1A 3CQXA 4HDOA 3U7DA 3SMSA 2P9UB 3CIPA 3H6EA 3WEEB 5BR9A 4BR5A 4GV3A 3IKMA 4A2BA 4BREA 5F1XA 4H5TA 1DKGD 2P9SB 4CZMA 4YOYA 1BOTO 3R1XA 5C2DA 3VF4A 3CCLN 1G99A 4MDBA 3HOTA 1P8ZA 2FF3B 3A5OC 5DM7L 3SBTA 1D4XA 3O6WA 3G71N 2DPNA 1YF5L 2F7TA 4ZRJA 3U9ZA 3ZEUB 4GXBA 2P9IA 2VGMA 4BGAA 4K41A 3WT0A 1QQMA 5KPZA 5AQWA 1NGEA 4JHDB 3VGMA 3D2EA 4FVUA 3QMLA 3CCJN 1VQKN 4B1YB 3MDQA 3A5MC 4KH4A 4A5AA 4EHTA 2J4RA 2AL6A 5BN9A 2FSNA 2J0MA 1MWMA 3CF5L 3ENBA 1JCGA 5M1KA 2W40A 4IXCA 3MMVA 2AA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKC A;  3E9P A;  4JK8 A;  4ILH A;  3SBG A;  4JKE A;  4JKA A;  3SBT A;  4JK9 A;  4JKD A;  4JK7 A;  3E9O A;  4JKF A;  4JKG A;  4ILJ A;  3E9L A;  4JKH A;  3ENB A;  4JKB A;  4JKG B;  3E66 A;  4ILG B; 
#chains in the Genus database with same CATH topology
 4IDH A;  3U4L A;  2E8A A;  4ID5 A;  2VG5 A;  3IFR A;  3ENO A;  3ZLJ A;  3FZM A;  1NMD A;  3AVK A;  4W5N A;  3LPT A;  3V1O A;  5GIP A;  3P38 A;  1RBT A;  3EZ5 A;  4IZ9 A;  5I42 A;  3LP3 A;  3NE6 A;  1N33 K;  2HBJ A;  1IKW A;  5AQH A;  3WXK A;  3OS2 A;  2P9K B;  3MEG A;  2GUP A;  2XY6 A;  4OLA A;  5C15 A;  2ASM A;  1H4R A;  1XC3 A;  1JXE A;  3LAL A;  3AAR A;  5ELZ A;  2VQF K;  4B1W B;  1HNV A;  3OYD A;  2Q0R A;  1X9J A;  3THV A;  5M1N A;  5BN8 A;  4N41 A;  4YOU A;  4KV8 A;  4JK7 A;  1TAQ A;  1NOY A;  4JI7 K;  3VQ4 A;  3LP0 A;  1TV6 A;  2UXB K;  3M5R A;  1ESV A;  4WFB L;  3U3G A;  4KPY A;  2OPS A;  3TTC A;  1UOC A;  1NNE A;  4YY3 K;  2QWN A;  4DR1 K;  3FZL A;  4NY0 A;  2FDQ A;  1D5A A;  2B5J A;  4FOE A;  4CJK A;  4AHR A;  2A40 A;  2BAN A;  5AQM A;  2PBD A;  3EPY A;  1C1C A;  4H0O A;  4F4K A;  4DF4 A;  4ZRK A;  5BRH A;  3C6T A;  3ULE B;  3NHG A;  3ZX0 A;  3CCS N;  2NRW A;  3WUH A;  2WC9 A;  3T3F A;  1D8Y A;  1TL3 A;  4B9M A;  2VWB A;  5F2R A;  3QEV A;  3CC4 N;  2O8F A;  3U3Y A;  3PX6 A;  4CF1 A;  1S72 N;  1X1P A;  3UKU A;  4B1U B;  3BF3 A;  3EZW A;  2LSN A;  4B9T A;  1NBW A;  4CIG A;  3RTV A;  4KI6 A;  3VF2 A;  2CH6 A;  4M63 C;  4BC2 A;  4FPA A;  5HP1 A;  3CJC A;  4M45 A;  5AQR A;  1BIS A;  4HTU A;  5JS2 A;  1JJ2 M;  3K9K A;  1FKO A;  3K2P A;  3KLI A;  3LDP A;  3CJB A;  1JLA A;  4IEE A;  3PY8 A;  1E4G T;  4YDU A;  1DEJ A;  3SCX A;  2I1J A;  3BIN A;  3SMP A;  4BRA A;  4OVL A;  2UUA K;  2ZJR L;  2G8W A;  3NVM A;  3L2R A;  3OTO K;  1BUP A;  1SS6 A;  3MX5 A;  4DV5 K;  3C6H A;  3O3G A;  5AZI B;  4DR7 K;  1LW2 A;  4LSN A;  4CEE A;  4RW7 A;  2ZGY A;  2D5R A;  4FCY A;  4AM7 A;  3CHW A;  3B8A X;  3JS6 A;  1U49 A;  3DWL A;  4E7J A;  5JVL A;  5C24 A;  1XHZ A;  4WFA L;  1KVB A;  1VQN N;  1VSI A;  4YOX A;  4JI6 K;  2PYJ A;  5AQY A;  4DSL A;  3MN9 A;  4I2P A;  2QKB A;  5IWA K;  2G8U A;  2NRT A;  5AQX A;  1IKY A;  4N56 A;  1NMN A;  1Y64 A;  3M8P A;  3RVC A;  3CPE A;  4DTS A;  3HI0 A;  4LC9 B;  4DR4 K;  1HUX A;  4CJT A;  1VSH A;  2KKZ A;  3OVN A;  5BRE A;  4KH5 A;  4FJX A;  3MED A;  4Z0U A;  1VHX A;  2R82 A;  1RFQ A;  3DRS A;  3WQU A;  3AA5 X;  1KC8 O;  4DV2 K;  5GAD P;  3UIQ A;  4FK4 A;  4YOT A;  1K9M O;  4JKB A;  4IFE A;  1KRP A;  3VGL A;  4CYE A;  2GWK A;  2A42 A;  3WNG A;  1CZB A;  4EHU A;  3CCQ N;  4A61 A;  4KRE A;  4DV1 K;  4LF5 K;  1E4F T;  1VQP N;  1HBK A;  3NGZ A;  2HHU A;  3KK7 A;  2HHQ A;  1ZBL A;  2XO7 A;  4CF0 A;  3WEE A;  4JKF A;  4CHO A;  1E3M A;  3KWG A;  1EX4 A;  2HMP A;  1JLC A;  4C1N K;  1LAW A;  3BF1 A;  1A5X A;  1TUU A;  3RR7 A;  1ZYQ A;  3AU5 A;  2Q1N A;  2LBB A;  3AVL A;  3BZK A;  2YX6 A;  4K42 A;  4I6M B;  5TKY A;  1Q9Y A;  2QA4 N;  4CJ4 A;  5LMU K;  2WFB A;  3O4N A;  3THY B;  3V9S A;  3CME N;  3VA3 A;  3QNN A;  5FRM A;  3J81 O;  3QO9 A;  3TTF A;  4ISF A;  1EF1 A;  1NJW A;  3SAF A;  4Y0W A;  3MXM A;  4FJ8 A;  3DXK B;  4CF9 A;  2W6K A;  3LAK A;  1Y19 B;  4HTL A;  4GV9 A;  1FXX A;  2IGI A;  4CBU A;  4JKH A;  1ASU A;  3T19 A;  4DLG A;  4BRG A;  3OJS A;  2P9P A;  2XHB A;  4JKG B;  4PA1 A;  1J19 A;  1EQY A;  3QBW A;  4CZE A;  5JIC A;  1KFD A;  4FWS A;  4KBO A;  3IMX A;  3A5L C;  3M1F A;  1J5O A;  4FXD A;  2QWP A;  4JI0 K;  2OPR A;  2UXD K;  3PIP L;  3SYZ A;  3WXM B;  1WB9 A;  4B3S K;  1IO2 A;  3PV8 A;  3ZT3 A;  3L3V A;  4E7L A;  2X78 A;  1HMV A;  1NGA A;  2IDO A;  4BG8 A;  1ASV A;  4NCB A;  4NCG A;  4WF9 L;  3S3M A;  1WOQ A;  4FWK A;  2E6L A;  3ZSR A;  1BU6 O;  2HF3 A;  4CGD A;  5BPN A;  3WA0 A;  4JS5 A;  1I39 A;  1ATR A;  4BC5 A;  5M1O A;  1D9D A;  1ATN A;  4KHQ A;  5E84 A;  1RDW X;  2YHY A;  4B9L A;  1EP4 A;  3TAQ A;  4JK9 A;  2YV0 X;  1XHX A;  4FJH A;  4H5N A;  4KHP K;  2NRV A;  2P9N A;  3V9U A;  3VPZ A;  2FSK A;  1SKW A;  2OTL N;  3HPH A;  5JVH L;  1SKS A;  5HRS A;  4TKN A;  3G4S N;  2ASP A;  1WSH A;  4B9S A;  4BRC A;  4WE1 A;  3TAG A;  3IDH A;  1R59 O;  1EET A;  2Y1J A;  2O8D A;  1K8K B;  4MO5 A;  1S1U A;  4FWO A;  1Z6R A;  4CBX A;  1R0A A;  5I9E B;  3DLG A;  4EP4 A;  4CFC A;  4CI6 A;  4E1J A;  4ILJ A;  1RDU A;  3TAN A;  5KRS A;  4TSX A;  4DQP A;  1KXP A;  4CD1 A;  1EO1 A;  3JXU A;  4W5Q A;  1HKG A;  3IVF A;  3KLE A;  4F8R A;  4CFD A;  3VEO A;  2DFH A;  4B9N A;  3WNF A;  2E88 A;  1NVL A;  1Z26 A;  1UA1 A;  3SAH A;  1MU2 A;  1NU0 A;  5LJW A;  1EWR A;  3F9M A;  3AVC A;  3HBT A;  3ALY A;  3DLB A;  4Z4F A;  3E66 A;  4LY7 A;  1ZBI A;  2E1Z A;  1GLE G;  3I55 N;  4DV7 K;  3CM5 A;  2NRX A;  4FJG A;  3FFI A;  4CZH A;  4JKA A;  4M3T A;  4LD0 A;  2G8H A;  4FOI A;  4C23 A;  5FLX O;  1JDE A;  3LDS A;  2XY7 A;  3CCR N;  3KWI A;  3NF7 A;  1C0M A;  1HYZ A;  5EVZ A;  3KK2 A;  1S22 A;  3THX B;  1YUW A;  4U7B A;  1VQ7 N;  3AVJ A;  3MWT A;  4FWQ A;  2HHX A;  1C1B A;  4J2D A;  4JK8 A;  3AO1 A;  1RBU A;  3UB5 A;  4OPA A;  1BHL A;  4KFB A;  1YT3 A;  4DTN A;  1HQE A;  4JD2 B;  3RSE A;  4BVP A;  3BEX A;  3IG1 A;  1YI2 N;  5KRT A;  1JLE A;  5AFU A;  3HRG A;  2NNW A;  2O4G A;  4EFH A;  3NH0 A;  4CZL A;  4YOV A;  3CIP A;  3H6E A;  4GV3 A;  3MEE A;  1XNQ K;  2HHV A;  4A2B A;  1NK4 A;  5F1X A;  2AJQ A;  1DKG D;  4LF9 K;  1BOT O;  3R1X A;  1G99 A;  4DSE A;  4MDB A;  3HOT A;  2KTQ A;  1P8Z A;  3G10 A;  5DM7 L;  3SZ2 A;  2DPN A;  2KZM A;  3ZEU B;  4GXB A;  1EXQ A;  4E7H A;  2P9I A;  2VGM A;  4K41 A;  3AVH A;  4JHD B;  3VGM A;  3L2W A;  1VQK N;  1LW0 A;  3F73 A;  1OH5 A;  1JXB A;  3TAR A;  4DQR A;  3ZSZ A;  3SUP A;  2FSN A;  3CF5 L;  4KTZ A;  1W7A A;  3NGI A;  1OVQ A;  3MMV A;  4PWD A;  4IFV A;  3SK3 A;  4B9V A;  1SV5 A;  4E1N A;  4GY2 B;  2O8B A;  5AQP A;  2O8E B;  4BE0 A;  1U47 A;  4BRD A;  5FDL A;  1VBH A;  1KAY A;  4M3U A;  4M3R A;  1V4T A;  4AIL C;  4C8O A;  4K8Z A;  1DGK N;  3G9W A;  4GV6 A;  2OYQ A;  4G9Z A;  3AA3 A;  4KB1 A;  4AH9 A;  3CM6 A;  4DV4 K;  3N4Q A;  2QWL A;  3VQ5 A;  3OYA A;  3DJC A;  4IOA L;  1C0G A;  3U8Z A;  2B6A A;  1E5W A;  4FW1 A;  3DXM B;  1XWL A;  1ITG A;  2D11 A;  1L3U A;  3EEQ A;  4C8K A;  4FJ5 A;  4H0X B;  3DOK A;  4AM6 A;  4DSK A;  1NTI A;  4Y1C A;  5JLH A;  1YVU A;  3GBT A;  4IJN A;  3FFK B;  3BP8 A;  5AQO A;  3WXI A;  4DTO A;  4CIE A;  1J53 A;  4ELT A;  2HBL A;  5AQV A;  4W5T A;  3CI5 A;  4F3T A;  1J5E K;  2YI1 A;  2YNG A;  4ZHR A;  1BI4 B;  1X9M A;  4YL8 A;  3ZSW A;  1M1K O;  3C65 A;  2QTD A;  4B8A B;  2FXU A;  5ADX A;  2GEM A;  4DFK A;  2O8C A;  4LH4 A;  3HSC A;  1CXQ A;  1NK6 A;  2G8F A;  1NWK A;  4CEA A;  1YHQ N;  4BRM A;  2FLO A;  4IG3 A;  4FJ9 A;  4O8U A;  1YIT N;  2UU9 K;  3J7A P;  3ULD A;  1VQ8 N;  3DLL L;  2JWL A;  3Q7C A;  4DU3 A;  1GLL O;  4IDK A;  2HHS A;  2D4W A;  4E7K A;  1KD1 O;  4CF2 A;  2JLE A;  3C6A A;  3TSP A;  1U04 A;  3IS9 A;  3LDO A;  4CGG A;  1QVF M;  3RRG A;  5D3G A;  1DTT A;  5CZ1 A;  1JKH A;  1OH8 A;  4BGB A;  3E1Y A;  3DM2 A;  3TSU A;  2HBM A;  2IC3 A;  3MK6 A;  3MN7 A;  4Y1D A;  1LOT B;  4QS8 A;  5KPR A;  4O8K A;  2HHH K;  3KVG A;  4CD3 A;  3MN5 A;  2OCE A;  1CXU A;  3B6O A;  3V9Z A;  1IBK K;  2KZZ A;  3QIC A;  3NAE A;  1CLQ A;  1T3V A;  3L4I A;  2BDP A;  1QQC A;  3CCU N;  4RWT A;  1Z05 A;  5HRO A;  1KLN A;  3SUQ A;  4IEI A;  3OYF A;  3FZH A;  4DU1 A;  4CHP A;  3K5M A;  3ISN C;  1WAJ A;  3DRR A;  4LF4 K;  3F2K A;  4NXM K;  3D2F B;  5CR4 A;  4CHY A;  3AY9 A;  4DV3 K;  4BDY A;  3O4Q A;  4KHW A;  4DR2 K;  5F0X A;  4BWJ A;  4HUF A;  4BDZ A;  2F9W A;  1NGH A;  1X3M A;  1NJI O;  1N36 K;  5CZ2 A;  1SAZ A;  3GG4 A;  1XMQ K;  4Z4C A;  2XY5 A;  2OZS A;  4WQ5 A;  1MWK A;  1Q9X A;  5BRD A;  5IJM A;  4DF8 A;  1YIJ N;  5FRO A;  4HUG A;  4NLB A;  4DHY A;  1H1V A;  2H3G X;  2FBV A;  2KFN A;  3AAP A;  3M6G A;  5HOO A;  3O9S A;  3VQP A;  4DFM A;  1OH7 A;  2V7Z A;  4U67 L;  3CFO A;  1RBS A;  5AJ3 K;  3NH2 A;  3HK2 A;  3O80 A;  5KPT A;  1ISN A;  4CK2 A;  3OHR A;  3V9W A;  1UA0 A;  2W41 A;  4JI5 K;  1CZA N;  4EAH D;  1U4B A;  3MWP A;  3BGR A;  4KKO A;  1U45 A;  4GVM A;  4CEF A;  2YJE A;  1YXQ A;  1ZBU A;  2QWQ A;  5JVG L;  3Q7B A;  2P9U A;  2I7N A;  1UAX A;  3A8Y A;  2P9S A;  3P4I A;  2HBK A;  1GC7 A;  3K59 A;  1X3N A;  4JAX A;  1ZXO A;  4DWI A;  4JI8 K;  2X6S A;  1IV0 A;  2VG7 A;  2ZGZ A;  4CEQ A;  3ID8 A;  3LZJ A;  4XH5 A;  4PY5 A;  3V1Q A;  1CZ9 A;  3CXC M;  3OYC A;  5HLF A;  4F3O A;  3N4P A;  2A5X A;  1RTI A;  4IOX A;  3KLF A;  3AO3 A;  4H03 B;  1L3S A;  1BG3 A;  1HQU A;  2A41 A;  1HNI A;  4IOC L;  1IJJ A;  1I3A A;  2OTJ N;  3K5L A;  2PZS A;  4WFN L;  1RDB A;  4M41 A;  4CFA A;  3OYK A;  1NKC A;  3OBW A;  1KAX A;  4MDA A;  3EN9 A;  1D9F A;  4W5R A;  1S5J A;  3AVB A;  2IIR A;  1NJY A;  3CPW M;  1A5V A;  4B9Q A;  2P9K A;  2WON A;  2AP1 A;  1TKZ A;  4PKG A;  5C12 A;  2XRI A;  3VQ9 A;  1HYS A;  5C42 A;  4F2R A;  2G8I A;  5FPM A;  4HWI A;  2NRZ A;  4CES A;  3HM9 A;  3L8B A;  3NCI A;  2WTU A;  1GG3 A;  4M7Y A;  4WQ4 A;  4AF1 A;  3EO3 A;  4IJA A;  3HM8 A;  3AA4 A;  2NZT A;  3SJH A;  2RHK A;  3RMC A;  4HCC A;  3ZET B;  4MQ3 A;  4FWM A;  4C8M A;  4FL9 A;  3AU4 A;  3HOS A;  3WQT A;  4RTF D;  4K25 A;  1VBG A;  3IRX A;  3VQA A;  4OGE A;  1KCF A;  4CBW A;  3DLE A;  3VQE A;  1L3T A;  3WXL A;  3HZ6 A;  3AO5 A;  1VQ9 N;  4E1M A;  3QET A;  3ZT0 A;  2YVC A;  3AA2 A;  1TK0 A;  5AQN A;  4MLE A;  2E5L K;  3THW A;  2NRR A;  3HJF A;  5M1Q A;  3ULE A;  1EWQ A;  1RT1 A;  3OY9 A;  2ZWH A;  3C95 A;  3MCA B;  4O55 A;  3VQD A;  1NOZ A;  1S9E A;  4JI2 K;  3C7N B;  4QAG A;  3O9R A;  1SGH A;  4OPK A;  5AQK A;  5CY4 A;  3L2Q A;  4JEP A;  3ATV A;  1NKE A;  1HB6 A;  1ILY A;  4ELU A;  1NK8 A;  2BUP A;  1Q7Y O;  3EL2 A;  1HJO A;  1GLD G;  4CJ7 A;  2HF4 A;  1WBB A;  3E9P A;  2Z1G A;  4EKU A;  1C6V A;  3KZB A;  1QVG M;  4EZ6 A;  4MLH A;  3T1H K;  1K73 O;  2F9T A;  3QFU A;  4IKF A;  3CC2 N;  1TUY A;  4BR9 A;  1FW6 A;  3LPU A;  4GW6 A;  3ZYY X;  4A5B A;  1SZ2 A;  3K5N A;  3QES A;  1ACA A;  2FSJ A;  1O1W A;  4N47 A;  3V9X A;  4H5V A;  4CZI A;  4YNQ A;  2QW9 A;  1C1A A;  3NBP A;  5K14 A;  5AZJ B;  1N5Y A;  2CGL A;  1L5U A;  1NGJ A;  4DQ8 A;  3LDL A;  3ZSQ A;  5EU7 A;  3ASM A;  2HNY A;  2EWS A;  1JLG A;  1MK7 B;  3AO2 A;  4FZX C;  1SL0 A;  3F9K A;  1RT3 A;  5AZI A;  1BGX T;  1YJN N;  3CJ1 A;  4I7F A;  1GOB A;  2RF2 A;  4BE2 A;  3ZT2 A;  2GV9 A;  1QHT A;  4CJL A;  4UY8 O;  1HPZ A;  3D45 A;  4BY9 C;  4CZF A;  1GLB G;  5GAH P;  3TAE A;  4FZY A;  3LM9 A;  3O3H A;  3LDN A;  1M90 O;  2CB8 A;  2PY5 A;  3SLC A;  4C8L A;  3TAM A;  1VRU A;  3A2F A;  5AQZ A;  3BY5 A;  2VYP A;  2IVP A;  3VEZ A;  1Q81 O;  1FJG K;  1Q18 A;  4CE9 A;  3LAM A;  3SNN A;  4HDQ A;  1MDU B;  1WBD A;  1NM1 A;  4B1X B;  5AQL A;  4FJ7 A;  4B08 A;  4KI4 A;  3FR0 A;  3SQ4 A;  3VEN A;  3KK3 A;  4DUZ K;  4JN4 A;  1TK8 A;  4J2A A;  1TYQ A;  4E19 A;  3S3O A;  4Q5V A;  4OGC A;  3AVA A;  4L3Q A;  3PX0 A;  3SJJ A;  4A59 A;  3KD1 E;  1VQL N;  1KLM A;  1HNZ K;  2D0A A;  1BA1 A;  4HDO A;  3U7D A;  4AHS A;  1X9W A;  4BRE A;  5CYQ A;  4X64 K;  4YOY A;  1G15 A;  3NF9 A;  5C2D A;  3VF4 A;  3AVG A;  1B9D A;  2X6N A;  4DQS A;  3CCL N;  5FRN A;  3K5O A;  1S1T A;  3VA0 A;  3A5O C;  3O6W A;  3G71 N;  4DTJ A;  3LP1 A;  5J2P A;  4FM2 A;  2FC0 A;  4BGA A;  5KPZ A;  3WT0 A;  3QER A;  1NGE A;  4FVU A;  4DUY K;  3MDQ A;  4KTW A;  2J0M A;  1MWM A;  4HCB A;  1JCG A;  1RT2 A;  1WNS A;  3K9J A;  2IS3 A;  2AA4 A;  3AO4 A;  3AVI A;  3QFP A;  3SV3 A;  2YHW A;  3P39 A;  3ZSX A;  5CYM A;  3L4Q A;  3RRH A;  1HNX K;  4DG1 A;  4I6M A;  1ST7 A;  1ASW A;  3J80 O;  2QM1 A;  4CEZ A;  3VQQ A;  3HL8 A;  2QKK A;  1A5W A;  3UKR B;  3THY A;  1QE1 A;  4WCE L;  3H3O B;  1U2V B;  3AVF A;  3FLC O;  3GDQ A;  2HE7 A;  3DXK A;  3U8X A;  4N76 A;  1MIZ B;  3BDP A;  2P1J A;  5H1S Q;  4M3Y A;  3VER A;  3VGK A;  4IWV A;  4YDU C;  4AQY K;  3GOI A;  2AEH A;  3RR8 A;  4JKG A;  1ATS A;  3QIO A;  4PL8 A;  1HNW K;  3H08 A;  3AGK A;  1NK7 A;  3KKR A;  2P9I B;  4CVN E;  3VQ7 A;  3M3Z A;  3TAP A;  3J8A A;  4H0T B;  2DTU A;  4WQ4 C;  1MA9 B;  3K57 A;  4MO4 A;  3TU5 A;  1NJZ A;  5M1F A;  5EX5 A;  4CEC A;  4JI3 K;  3SQ0 A;  1BQN A;  4FK2 A;  3D6R A;  3KD5 E;  4ID1 A;  2R7Y A;  4P7I A;  4IO8 A;  4JRQ A;  2V7Y A;  3PZD A;  4F9O A;  1NKB A;  3HT3 A;  4K8X A;  2Q0U A;  3QDK A;  2YHX A;  4BRH A;  3J7Z O;  2HST A;  3CCV N;  4ZTF A;  2WBN A;  4EIA A;  1WLJ A;  1DLO A;  4CHN A;  2I1K A;  4FLY A;  4F7G A;  4QS7 A;  3VTI A;  4EZ9 A;  1MIX A;  2QK9 A;  1GLF O;  2Q31 A;  3CMA N;  3NDK A;  4R79 A;  3ZSV A;  4FLZ A;  3R9P A;  3H1Q A;  1JCE A;  3PSI A;  4QS9 A;  4BRQ A;  4OX9 K;  3NF8 A;  1I94 K;  1WUA A;  3QIJ A;  4DFJ A;  1K8K A;  2QXL A;  3DI6 A;  3CCE N;  2UYT A;  1N32 K;  4KAZ A;  1ZBS A;  2HOE A;  3SAG A;  4DR6 K;  3OJU A;  4X62 K;  2V52 B;  3K58 A;  3DMJ A;  1KVC A;  4HUE A;  1VSD A;  4DKW A;  2CQU A;  1BCO A;  4PHT X;  4E89 A;  2DIK A;  1HJR A;  3ID6 A;  4KO0 A;  4CJS A;  5DK5 A;  3OYM A;  4CZJ A;  4B9U A;  1HKB A;  5JS1 A;  1KBL A;  2QXF A;  4MFB A;  2YJF A;  3VEW A;  1X9S A;  4ELV A;  4OKE A;  4DTM A;  3QLH A;  4BC3 A;  4BAC A;  2P9L B;  3PSF A;  4J2E A;  1GGO A;  2HHT A;  4KHU A;  2GX9 A;  3EKU A;  5J2N A;  4CJV A;  1RGI A;  3OYB A;  1TL1 A;  1HKC A;  1NK5 A;  2HMI A;  1C0F A;  2HNZ A;  3KLG A;  1K8A O;  3EY1 A;  4BR0 A;  5E26 A;  4JV5 K;  3P5J A;  4DQQ A;  4FM0 A;  4CGJ A;  5FPE A;  2Q3S A;  3ZT1 A;  4E7I A;  1P90 A;  1YTU A;  4L8R B;  4AHC A;  2A1S A;  4LF8 K;  3MAQ A;  1VSM A;  3LP2 A;  4FVM A;  4H8K A;  3HTV A;  2Z1H A;  2D0O A;  1TK5 A;  5KI6 A;  4YOW A;  3HVR A;  3LL3 A;  3TAF A;  3THX A;  1VSJ A;  2DFF A;  3KJV A;  3FLV A;  3ZX2 A;  1ZBF A;  4FLW A;  4OO1 J;  4FWN A;  1QHA A;  4NLC A;  1T8E A;  1TAU A;  3MEC A;  2D0C A;  3D2E B;  4IG0 A;  3ZCM A;  4JD2 A;  4ISE A;  5JMV A;  3SBG A;  5C25 A;  1YJ9 N;  3NMU A;  5HL7 L;  5AQS A;  2VWJ A;  3VTH A;  4PKH A;  1SL2 A;  4H0P A;  4O0J A;  2RE2 A;  5C2F A;  4X66 K;  3ZSO A;  4JI1 K;  1REV A;  2ZD1 A;  3QBX A;  1SL1 A;  4X65 K;  1RNH A;  4FJJ A;  1VRT A;  2IAJ A;  3ZEU A;  4YHH K;  5EOY A;  4DR5 K;  4JHD A;  4O5B A;  3VET A;  5AQT A;  3MN6 A;  1S6Q A;  2KLA A;  2OZM A;  4O4G A;  3SPY A;  3VOV A;  3CET A;  5GAE P;  4CJQ A;  3L2V A;  4PKI A;  4CFB A;  3A5N C;  2O8E A;  2V51 B;  4PQU A;  4G1Q A;  4ISG A;  4DB3 A;  3OBY A;  5GIO A;  1QQO A;  3DYA A;  4JKC A;  3NH1 A;  3OYI A;  3MXI A;  2G8V A;  3JAM O;  3C6U A;  2ABD A;  2A6A A;  3HST B;  5AR0 A;  4BVO A;  4LFB K;  5HRN A;  2BH1 A;  2GBZ A;  5LL6 Z;  4H0Y B;  1QTM A;  3E9O A;  4XEI A;  4O0I A;  3PVL A;  2ZJP L;  3DXM A;  1NGF A;  3T69 A;  3NVK A;  3EE8 A;  2ZM6 K;  3S3N A;  3O9T A;  1LV5 A;  4GMJ B;  1JLQ A;  3CJA A;  5HRR A;  5M1P A;  3PUF A;  1GOA A;  4QCL A;  5JLF A;  3FGU A;  1KC7 A;  1YJW N;  4XIU A;  3CFP A;  3NF6 A;  3TTD A;  3TSQ A;  3AGR A;  4CIF A;  2O8F B;  2FBY A;  2G8K A;  4BRN A;  1VQO N;  4FM1 A;  3I0R A;  1S1V A;  3DRP A;  3UKU B;  4CJ5 A;  1QSS A;  1BI4 A;  3WNE A;  3BZC A;  4RW8 A;  1N34 K;  4Q0B A;  2EMT A;  4RW6 A;  3VN5 A;  3O9U A;  1T7P A;  3K0S A;  4BDP A;  2O4I A;  2HW3 A;  4M3Z A;  1VQM N;  3G0Z A;  4CED A;  4Z4E A;  3CJ9 A;  2QWO A;  4BR7 A;  3PO4 A;  2EMS A;  1RDD A;  5GIN A;  1NI2 A;  2RN2 A;  4R5P A;  2J0K A;  4DSI A;  1XQS C;  4FJN A;  1SQK A;  3NGY A;  3R8E A;  4ZRI A;  4KHN A;  3T7Z A;  1V4S A;  3OS1 A;  5CHI A;  5BR8 K;  4BR4 A;  1LCU A;  3O9Q A;  2YKM A;  3MCP A;  1JCF A;  4GKK K;  4LFA K;  4CJP A;  3SV4 A;  4RCH A;  3RMA A;  5SZT A;  4FZZ A;  1NJX A;  3AV9 A;  4H5W A;  4DSF A;  1BQM A;  1HPM A;  1SUQ A;  4A62 A;  2ITM A;  4DTP A;  2Y1I A;  3A0I X;  4FWR A;  3X23 A;  4DLE A;  5C0Y A;  4IFY A;  1VK0 A;  1IBM K;  5J1E A;  3FE1 A;  1BL3 A;  4CZK A;  2P5O A;  2ZE2 A;  3W3D A;  4OJR A;  4KTQ A;  4JKE A;  3SQ1 A;  4DV6 K;  5LJV A;  4W5O A;  3THW B;  3C94 A;  5AQI A;  2E4L A;  2FBX A;  4CW7 B;  3TAB A;  1VQ6 N;  2EX3 A;  3D2F A;  1DIK A;  1LWE A;  2CGK A;  2IVO A;  4J2B A;  4Z4H A;  3HP9 A;  3LAN A;  5A2Q O;  3OYL A;  4H4M A;  3V81 A;  2HND A;  4NB4 A;  3JYT A;  3CQ8 A;  1HR0 K;  3O5B A;  2OA8 A;  3I8D A;  2X74 A;  1XC9 A;  4BWM A;  1SKR A;  1RBR A;  4CEO A;  1YVN A;  3QEI A;  2D0P A;  1RT6 A;  1GLA G;  3O1B A;  4J8F A;  4FYD A;  4FSV A;  4K43 A;  1BCM A;  3S9H A;  5BR9 A;  3WEE B;  4BR5 A;  4YFU A;  1JLB A;  3IKM A;  4H5T A;  1RT7 A;  4JLH A;  4CZM A;  1RTJ A;  4CF8 A;  3OYH A;  2FF3 B;  3KTQ A;  1YF5 L;  4ZRJ A;  3V1R A;  2VQE K;  1QQM A;  4FJI A;  3CCJ N;  4B1Y B;  3A5M C;  4KH4 A;  4OKK A;  2J4R A;  1QSY A;  1DTQ A;  5BN9 A;  3P1G A;  1C0T A;  5M1K A;  4CJU A;  2E6M A;  4IXC A;  3VES A;  4AHV A;  4OKJ A;  4DU4 A;  4GNI A;  1WN7 A;  2P9P B;  4JS4 A;  4DTR A;  1TKT A;  3LZI A;  1Q8I A;  4CGF A;  1Q86 O;  3AVN A;  3VMF B;  1KQS M;  2GWJ A;  4BRL A;  1WSE A;  4F2S A;  1UWB A;  2VG6 A;  5KGW A;  4CGH A;  4CJ3 A;  1BA0 A;  5B8H A;  3AAQ A;  3TWH A;  1W2B M;  4Z4G A;  1J6Z A;  1NGB A;  1TYQ B;  4FJM A;  4AHU A;  4DTU A;  2F96 A;  4O44 A;  3ZX3 A;  4Z94 A;  3O4W A;  1IBL K;  2YKN A;  3DLR A;  3QB0 A;  2ATQ A;  2Q97 A;  3NFA A;  3QIN A;  4JI4 K;  5EY4 A;  5AQF A;  1GLJ O;  1RBV A;  2QWR A;  3OS0 A;  4RW9 A;  4FWL A;  3V4I A;  4PL7 A;  4LF6 K;  1RDA A;  3ATU A;  1LWC A;  5SWM A;  3VQC A;  2P9N B;  1IKX A;  2BGG A;  3EE9 A;  4C1N I;  3TI0 A;  3ENH A;  2HRJ A;  1B92 A;  3H46 O;  2GEL A;  3CC7 N;  3VF6 A;  3F5T A;  4CCH A;  2HVH A;  1ZC6 A;  3GL1 A;  3VEY A;  3KKS A;  4DR3 K;  1IG8 A;  4FJL A;  1JLF A;  4BC4 A;  2KFZ A;  3L0Q A;  5HBM A;  4KB0 A;  2O8D B;  3O1W A;  4FLT A;  4B3O A;  1ZBH A;  3WXJ A;  3ZET A;  1GOC A;  3I0S A;  3WNH A;  3HXM A;  4WQ5 C;  4FJK A;  2HVI A;  3G6E N;  2B4J A;  2WH5 A;  2JGU A;  1BDG A;  1Y97 A;  4H0V B;  3FP5 A;  2GUI A;  4IO9 L;  4M3W A;  2Q2R A;  2ETJ A;  3OYJ A;  1U6Z A;  1K6Y A;  3GE1 A;  3HP6 A;  1B9F A;  5LY3 A;  4JKD A;  1NK9 A;  5AFU H;  3QIP A;  4CJR A;  4B3M K;  1MK9 B;  2Z1J A;  5AQQ A;  4BRP A;  4FLU A;  1W0H A;  3E01 A;  4KHS A;  5T7B A;  1TGO A;  3OYN A;  4H4O A;  1NGD A;  2F8S A;  5BPL A;  3OYG A;  1WSF A;  1OVY A;  2IVN A;  3C7N A;  2DFE A;  3KK1 A;  2BE2 A;  4DFP A;  1NG9 A;  3H45 C;  3RWU A;  4LFC K;  2YNI A;  1QS4 A;  4IBN A;  3D0P A;  2E2O A;  2PAV A;  2Z1I A;  3E9L A;  3AVM A;  2A3Z A;  4KH6 A;  1IKV A;  3JSM A;  4BRO A;  2ZQB A;  2F4V K;  1VSE A;  1W97 L;  4BQL A;  1T05 A;  3VQB A;  1F21 A;  1S1X A;  3MXJ A;  3CCM N;  4M7X A;  3CQY A;  3TR8 A;  3O3F A;  1L3V A;  1RCH A;  4FK0 A;  5AQG A;  2UXC K;  2CH5 A;  3VEV A;  4CK1 A;  1RTD A;  2NUB A;  4N5S A;  3U6F A;  5AZJ A;  1WSJ A;  3UE5 A;  1RTH A;  2RPI A;  4LH5 A;  2E2N A;  4YOR A;  3DAW A;  3D7E O;  4A2A A;  1LWF A;  4RG8 A;  3OYE A;  3RSE B;  1IH7 A;  3BUZ B;  4GKJ K;  3LWM A;  4LF7 K;  4B1Z A;  2YHB A;  1TKX A;  2X0S A;  5CE3 A;  1FKP A;  3B6P A;  3V6D A;  4UQG A;  3TPQ A;  4NYN A;  3P31 A;  3G25 A;  4XH1 A;  4E3S A;  2UUB K;  3I33 A;  4I9L A;  1KAZ A;  1O13 A;  2BTF A;  2EHG A;  1HRH A;  3O8M A;  2JWK A;  3EKS A;  5AQU A;  5DM6 L;  4BE1 A;  2E20 A;  5ADX H;  1VSF A;  4ILH A;  4OPH A;  2ZJQ L;  2A1R A;  1S3X A;  1HLU A;  3R3L A;  3PO5 A;  3O08 A;  4DS4 A;  1NLV A;  1Q82 O;  1BIZ A;  5KQD A;  2O8B B;  1W9H A;  3DOL A;  2Q36 A;  5KGX A;  1NK0 A;  4H5R A;  4NXN K;  1T03 A;  1XUP O;  4HHT A;  4DCH A;  4JRP A;  4BRF A;  4ILG B;  1VAZ A;  3CFR A;  5GAG P;  1IG9 A;  2VWK A;  3KHY A;  5BPM A;  5BRF A;  4XH4 A;  1XMO K;  1KTQ A;  3CYM A;  4DS5 A;  3RMD A;  3CG7 A;  3H3N O;  3R6M A;  4B8C A;  3ZDT A;  1RIL A;  1J54 A;  3ITH A;  3OA9 A;  2COP A;  2IOC A;  1Z25 A;  3HPG A;  4FW2 A;  3ZT4 A;  2KHO A;  3H1V X;  3DLH A;  1HX1 A;  4AHT A;  4EP5 A;  1T6C A;  3VQ6 A;  1LAV A;  4CJE A;  2WOM A;  1QZ6 A;  4CK3 A;  2YNH A;  3SUO A;  1N8R O;  4FLV A;  3LM2 A;  4CHQ A;  5HRP A;  3FZF A;  3IUC A;  4FWP A;  4B1V A;  4FLX A;  4A57 A;  5FPD A;  4NO7 A;  3T1A A;  4QOZ B;  3UKR A;  4M42 A;  4WYB A;  1S1W A;  3FZK A;  4DMN A;  1U48 A;  1KVA A;  3RMB A;  4Z4I A;  1TVR A;  1U2V A;  3CJ7 A;  2P5G A;  2O8C B;  3SPZ A;  4CZG A;  4NYF A;  2E1Y A;  3M8R A;  2E2Q A;  2OAN A;  4E0D A;  2D2Q A;  3PX4 A;  4KHY A;  2ZF5 O;  4CER A;  4CHZ A;  3KLH A;  2CGJ A;  4BRI A;  4BQZ A;  3HO1 A;  3VQ8 A;  1N6Q A;  1WSI A;  2NLX A;  1GC6 A;  3EYZ A;  3SQ2 A;  5J2M A;  2KQ2 A;  1RT4 A;  2PFU A;  2KW4 A;  2OPP A;  4DV0 K;  2I7P A;  2FJ9 A;  2FF6 A;  3LDQ A;  3I8B A;  5I3U A;  3U9D A;  3HVT A;  3CD6 N;  1QZ5 A;  4OPJ A;  2ZPY A;  1RDC A;  4OLB A;  4M3X A;  4BRK A;  2ITG A;  5C10 A;  4DSJ A;  3VEX A;  5MLC Q;  3OW2 M;  2YCH A;  1S9G A;  5J2Q A;  5LMN K;  1HB8 A;  1KFS A;  3I56 N;  5AQJ A;  2OPQ A;  2D10 A;  3L2U A;  1VSK A;  2UUC K;  3P83 D;  4BR2 A;  1T44 A;  1NGC A;  1GLC G;  5TKW A;  2I5J A;  1FK9 A;  1OKJ A;  2YHA A;  1VQ5 N;  3KIO A;  5FPN A;  1BWF O;  1VQ4 N;  4DXA B;  3L6Q A;  3QEP A;  1NGI A;  2DY4 A;  4JNE A;  4GVE A;  1RT5 A;  4ZTJ A;  2QWM A;  1J9A A;  4LSL A;  2WUS A;  1C0U A;  2W6L A;  4B3R K;  4PUO A;  3QEX A;  2VGN A;  4I9Q A;  1OH6 A;  4B3T K;  1HYV A;  4JYA K;  2NRH A;  2RQ1 A;  2P51 A;  1DT9 A;  1QSL A;  5IT9 O;  3SUN A;  3T1Y K;  3M8Q A;  1YAG A;  1XI1 A;  4BG9 A;  4DQI A;  3IAY A;  3CER A;  1BO5 O;  1QQN A;  1BIU A;  3C0B A;  4CJW A;  4FPB A;  2GTD A;  2FBT A;  3MX2 A;  2ASO A;  2F8T A;  3HYF A;  4CJF A;  2QEX N;  2VCP A;  1EKE A;  2P9L A;  1S6P A;  2YNF A;  4CEB A;  4NCA A;  5KQ8 A;  3J7Y P;  4K0K K;  2D1K A;  1WSG A;  3S41 A;  1T6D A;  3W0L A;  2J0J A;  3LWL A;  5DMR A;  1XNR K;  4I2Q A;  4KRF A;  2XY8 A;  4O5F A;  4FO0 A;  5EXW A;  2E2P A;  3ZSY A;  5KTQ A;  1NGG A;  2QI2 A;  1WAF A;  1JL1 A;  2D0B A;  3M8S A;  1JL2 A;  4V19 S;  3PLA A;  3DLK A;  3PIO L;  3CQX A;  3SMS A;  2P9U B;  1VSL A;  3SI6 A;  2P9S B;  4DTX A;  4HVJ A;  3SBT A;  1D4X A;  1KSP A;  2HB5 A;  5E41 A;  2F7T A;  3QEW A;  2PYL A;  3U9Z A;  4C8N A;  5AQW A;  3D2E A;  3HPO A;  3QML A;  2RKI A;  3L3U A;  4EHT A;  4A5A A;  2AL6 A;  2HHW A;  4RW4 A;  2W42 A;  4CGI A;  3ENB A;  1YTA A;  3QNO A;  2W40 A;  1TKD A;  4ICL A; 
#chains in the Genus database with same CATH homology
 4IDH A;  3SK3 A;  3VES A;  3U4L A;  4GY2 B;  2E8A A;  5AQP A;  4GNI A;  4BRD A;  3QFP A;  3IFR A;  2P9P B;  1VBH A;  2YHW A;  1KAY A;  3ENO A;  3FZM A;  1NMD A;  1V4T A;  3P39 A;  5GIP A;  3P38 A;  3L4Q A;  4IZ9 A;  4I6M A;  1Q86 O;  1DGK N;  3G9W A;  2HBJ A;  4GV6 A;  3WXK A;  5AQH A;  3VMF B;  1KQS M;  1ST7 A;  4G9Z A;  2GWJ A;  4BRL A;  2P9K B;  2QM1 A;  2GUP A;  3UKR B;  1BA0 A;  5B8H A;  3AAQ A;  2QWL A;  3N4Q A;  5C15 A;  2ASM A;  1H4R A;  1XC3 A;  1J6Z A;  1NGB A;  1W2B M;  1TYQ B;  4WCE L;  4IOA L;  3DJC A;  3AAR A;  1C0G A;  3U8Z A;  5ELZ A;  1E5W A;  4Z94 A;  3DXM B;  3ZX3 A;  3H3O B;  1U2V B;  3O4W A;  2D11 A;  3FLC O;  3GDQ A;  3QB0 A;  4B1W B;  4H0X B;  2HE7 A;  3DXK A;  4AM6 A;  2Q0R A;  2Q97 A;  1NTI A;  1X9J A;  3U8X A;  1MIZ B;  5EY4 A;  5BN8 A;  5M1N A;  5H1S Q;  5AQF A;  1GLJ O;  2QWR A;  3VER A;  3VGK A;  4YOU A;  5JLH A;  4IWV A;  4YDU C;  4JK7 A;  3GBT A;  4IJN A;  3FFK B;  3BP8 A;  5AQO A;  3WXI A;  3GOI A;  2AEH A;  4JKG A;  1ATS A;  4FWL A;  4PL8 A;  2HBL A;  3AGK A;  5AQV A;  4PL7 A;  3M5R A;  3ATU A;  1ESV A;  4WFB L;  2P9I B;  3CI5 A;  3TTC A;  3M3Z A;  2P9N B;  2QWN A;  2YI1 A;  3EE9 A;  3FZL A;  3J8A A;  4C1N I;  4H0T B;  3ENH A;  4NY0 A;  2HRJ A;  3H46 O;  2FDQ A;  4YL8 A;  2GEL A;  1MA9 B;  4FOE A;  4WQ4 C;  3CC7 N;  1M1K O;  3VF6 A;  3F5T A;  2A40 A;  4MO4 A;  5AQM A;  2PBD A;  3EPY A;  3C65 A;  4H0O A;  3TU5 A;  2QTD A;  4ZRK A;  5BRH A;  1ZC6 A;  3GL1 A;  5M1F A;  2FXU A;  3VEY A;  5EX5 A;  5ADX A;  2GEM A;  3ULE B;  1IG8 A;  3ZX0 A;  4BC4 A;  3CCS N;  3HSC A;  3D6R A;  3L0Q A;  2NRW A;  3O1W A;  1NWK A;  4P7I A;  3WUH A;  1YHQ N;  4BRM A;  2WC9 A;  3WXJ A;  2FLO A;  3ZET A;  4IO8 A;  4O8U A;  1YIT N;  2V7Y A;  3PZD A;  2VWB A;  4F9O A;  4WQ5 C;  5F2R A;  3G6E N;  2Q0U A;  2WH5 A;  2YHX A;  3QDK A;  1VQ8 N;  4BRH A;  3J7Z O;  1BDG A;  2HST A;  2JWL A;  3DLL L;  4H0V B;  3FP5 A;  2WBN A;  4EIA A;  3CC4 N;  3CCV N;  3Q7C A;  4IO9 L;  1GLL O;  1S72 N;  2Q2R A;  2I1K A;  2D4W A;  3UKU A;  1KD1 O;  1U6Z A;  4F7G A;  4QS7 A;  4B1U B;  3BF3 A;  3EZW A;  3GE1 A;  3VTI A;  1MIX A;  1NBW A;  3C6A A;  5LY3 A;  1GLF O;  4JKD A;  2Q31 A;  3CMA N;  5AFU H;  4R79 A;  3VF2 A;  2CH6 A;  4M63 C;  3TSP A;  1MK9 B;  4BC2 A;  4FPA A;  3LDO A;  5AQQ A;  3R9P A;  4BRP A;  1QVF M;  3H1Q A;  1JCE A;  3CJC A;  5AQR A;  4QS9 A;  4BRQ A;  1WUA A;  3QIJ A;  4BGB A;  1JJ2 M;  3E1Y A;  3K9K A;  3TSU A;  1K8K A;  1NGD A;  2HBM A;  2QXL A;  3MK6 A;  3MN7 A;  2UYT A;  3LDP A;  3CCE N;  5BPL A;  3CJB A;  1LOT B;  4QS8 A;  5KPR A;  4O8K A;  1ZBS A;  1OVY A;  2HOE A;  2IVN A;  3KVG A;  3MN5 A;  3C7N A;  4CD3 A;  3SAG A;  4IEE A;  1E4G T;  2V52 B;  4YDU A;  1DEJ A;  2I1J A;  3H45 C;  3BIN A;  4DKW A;  3QIC A;  1T3V A;  3L4I A;  3SMP A;  4BRA A;  2CQU A;  4PHT X;  2ZJR L;  2DIK A;  3ID6 A;  3CCU N;  4RWT A;  1Z05 A;  2E2O A;  2PAV A;  3NVM A;  1BUP A;  1SS6 A;  3MX5 A;  3E9L A;  3C6H A;  3FZH A;  4IEI A;  5AZI B;  4CZJ A;  1HKB A;  2A3Z A;  4KH6 A;  4BRO A;  1KBL A;  2ZGY A;  2YJF A;  1W97 L;  3F2K A;  4BQL A;  3VEW A;  3D2F B;  5CR4 A;  3AY9 A;  4AM7 A;  3CCM N;  3CHW A;  4M7X A;  3CQY A;  3B8A X;  4BC3 A;  5F0X A;  3JS6 A;  2P9L B;  1GGO A;  3DWL A;  2F9W A;  5JVL A;  1NGH A;  1X3M A;  2CH5 A;  5AQG A;  3VEV A;  4WFA L;  1SAZ A;  1NJI O;  2GX9 A;  3EKU A;  3GG4 A;  1VQN N;  4YOX A;  1RGI A;  5AZJ A;  3UE5 A;  5AQY A;  1HKC A;  3MN9 A;  4WQ5 A;  1C0F A;  1MWK A;  2E2N A;  4YOR A;  3DAW A;  1K8A O;  3D7E O;  4A2A A;  5BRD A;  5IJM A;  2NRT A;  5AQX A;  4BR0 A;  5E26 A;  3RSE B;  1Y64 A;  1YIJ N;  3BUZ B;  4NLB A;  3RVC A;  5FPE A;  4DHY A;  3CPE A;  1H1V A;  2H3G X;  3HI0 A;  4LC9 B;  1P90 A;  1HUX A;  4B1Z A;  2KKZ A;  5BRE A;  4KH5 A;  3AAP A;  3M6G A;  2X0S A;  5HOO A;  5CE3 A;  3HTV A;  2D0O A;  3O9S A;  4YOW A;  2V7Z A;  4U67 L;  2R82 A;  3LL3 A;  1RFQ A;  3TPQ A;  3WQU A;  3P31 A;  3G25 A;  4XH1 A;  1KC8 O;  3I33 A;  3FLV A;  3O80 A;  3ZX2 A;  5KPT A;  1KAZ A;  5GAD P;  1ISN A;  4FWN A;  4OO1 J;  3OHR A;  1O13 A;  4YOT A;  1K9M O;  1QHA A;  2BTF A;  4JKB A;  4NLC A;  4IFE A;  4CJ7 A;  2W41 A;  2JWK A;  3O8M A;  3EKS A;  3D2E B;  3VGL A;  4CYE A;  5AQU A;  2GWK A;  1CZA N;  2A42 A;  4EAH D;  5DM6 L;  2E20 A;  4EHU A;  4JD2 A;  5ADX H;  3MWP A;  3CCQ N;  4ISE A;  4A61 A;  5JMV A;  4ILH A;  4OPH A;  2ZJQ L;  3SBG A;  1YJ9 N;  1S3X A;  3NMU A;  1E4F T;  1HLU A;  3R3L A;  5HL7 L;  3O08 A;  1VQP N;  1HBK A;  1NLV A;  5AQS A;  1Q82 O;  3VTH A;  3KK7 A;  4PKH A;  5KQD A;  4H0P A;  2YJE A;  1YXQ A;  2Q36 A;  2QWQ A;  5JVG L;  3WEE A;  4JKF A;  2RE2 A;  2P9U A;  3Q7B A;  2I7N A;  3KWG A;  2HMP A;  4H5R A;  5C2F A;  4C1N K;  3BF1 A;  1TUU A;  3A8Y A;  2P9S A;  3AU5 A;  3QBX A;  2Q1N A;  3P4I A;  1XUP O;  2HBK A;  1GC7 A;  2LBB A;  4DCH A;  1X3N A;  2YX6 A;  4K42 A;  4I6M B;  4JAX A;  1ZXO A;  5TKY A;  4BRF A;  2QA4 N;  4ILG B;  1VAZ A;  5GAG P;  2ZGZ A;  3ZEU A;  3KHY A;  3ID8 A;  5BPM A;  2WFB A;  5EOY A;  5BRF A;  4XH5 A;  4JHD A;  4XH4 A;  3VET A;  3CME N;  5AQT A;  3MN6 A;  2KLA A;  3CXC M;  3TTF A;  4ISF A;  1EF1 A;  3H3N O;  3N4P A;  3R6M A;  3CET A;  2A5X A;  3VOV A;  5GAE P;  3SAF A;  4PKI A;  4Y0W A;  3ZDT A;  3DXK B;  4IOX A;  4H03 B;  1Y19 B;  3OA9 A;  4HTL A;  2COP A;  3A5N C;  4GV9 A;  1BG3 A;  4CBU A;  4JKH A;  2A41 A;  2V51 B;  2KHO A;  1IJJ A;  3H1V X;  1HX1 A;  4BRG A;  4IOC L;  2OTJ N;  2P9P A;  4ISG A;  4DB3 A;  1T6C A;  4WFN L;  4JKG B;  1J19 A;  1EQY A;  3OBY A;  3OBW A;  3QBW A;  1QQO A;  1KAX A;  4MDA A;  4JKC A;  4CZE A;  5JIC A;  1QZ6 A;  4FWS A;  5GIO A;  4KBO A;  3EN9 A;  3IMX A;  3A5L C;  1N8R O;  3M1F A;  2QWP A;  2IIR A;  2ABD A;  3LM2 A;  3PIP L;  3CPW M;  3FZF A;  3IUC A;  4FWP A;  4B1V A;  3WXM B;  4B9Q A;  2P9K A;  2A6A A;  4A57 A;  5FPD A;  4NO7 A;  2AP1 A;  4PKG A;  5AR0 A;  4BVO A;  5C12 A;  3UKR A;  2BH1 A;  4WYB A;  1NGA A;  4H0Y B;  3E9O A;  3FZK A;  4XEI A;  3PVL A;  2ZJP L;  4HWI A;  3DXM A;  1NGF A;  5FPM A;  2NRZ A;  1U2V A;  3T69 A;  3EE8 A;  4BG8 A;  1WOQ A;  4WF9 L;  3NVK A;  4FWK A;  3CJ7 A;  1BU6 O;  2HF3 A;  3O9T A;  5BPN A;  3WA0 A;  3CJA A;  1GG3 A;  4M7Y A;  4WQ4 A;  4AF1 A;  4CZG A;  1ATR A;  2E1Y A;  5M1O A;  3EO3 A;  5M1P A;  4BC5 A;  1ATN A;  2E2Q A;  2OAN A;  4IJA A;  3HM8 A;  5E84 A;  1RDW X;  2NZT A;  3SJH A;  2RHK A;  5JLF A;  3ZET B;  2D2Q A;  2ZF5 O;  3FGU A;  1KC7 A;  2YHY A;  2CGJ A;  1YJW N;  4FWM A;  4BRI A;  4BQZ A;  4FL9 A;  3TTD A;  3TSQ A;  3AU4 A;  2NLX A;  1GC6 A;  4JK9 A;  3AGR A;  4H5N A;  3HOS A;  2NRV A;  2PFU A;  3WQT A;  4BRN A;  2P9N A;  1VQO N;  4RTF D;  4K25 A;  1VBG A;  3VPZ A;  2FSK A;  3UKU B;  2I7P A;  4CBW A;  2OTL N;  2FJ9 A;  2FF6 A;  3LDQ A;  3WXL A;  3HZ6 A;  5JVH L;  3I8B A;  1VQ9 N;  3U9D A;  3CD6 N;  2EMT A;  1QZ5 A;  3O9U A;  4YOV A;  2YVC A;  2ZPY A;  4TKN A;  3G4S N;  5AQN A;  2ASP A;  4MLE A;  3K9J A;  2NRR A;  4BRC A;  5M1Q A;  3IDH A;  1R59 O;  3ULE A;  1VQM N;  4BRK A;  5C10 A;  2ZWH A;  1K8K B;  3VEX A;  3CJ9 A;  5MLC Q;  2QWO A;  3MCA B;  2YCH A;  4MO5 A;  4BR7 A;  3OW2 M;  1HB8 A;  2EMS A;  1Z6R A;  4FWO A;  5GIN A;  1NI2 A;  3I56 N;  4CBX A;  3C7N B;  5AQJ A;  2D10 A;  2J0K A;  3O9R A;  1XQS C;  5I9E B;  1SQK A;  4E1J A;  4CI6 A;  3R8E A;  4ILJ A;  1SGH A;  4ZRI A;  1RDU A;  5AQK A;  3T7Z A;  1V4S A;  4BR2 A;  1KXP A;  1T44 A;  4JEP A;  5CHI A;  3ATV A;  4CD1 A;  4BR4 A;  1GLC G;  1NGC A;  1EO1 A;  1HB6 A;  3JXU A;  5TKW A;  1LCU A;  1OKJ A;  1HKG A;  3O9Q A;  2BUP A;  1ILY A;  1Q7Y O;  1VQ5 N;  3EL2 A;  1HJO A;  1JCF A;  3IVF A;  1GLD G;  1BWF O;  2HF4 A;  3MCP A;  5FPN A;  3E9P A;  4DXA B;  4RCH A;  4EKU A;  3VEO A;  3L6Q A;  1VQ4 N;  1NGI A;  3KZB A;  4JNE A;  1QVG M;  4GVE A;  4MLH A;  2E88 A;  1K73 O;  2F9T A;  2QWM A;  4H5W A;  3QFU A;  1HPM A;  3CC2 N;  1TUY A;  4BR9 A;  4A62 A;  3ZYY X;  4A5B A;  1SZ2 A;  1NVL A;  2WUS A;  2ITM A;  3SAH A;  3A0I X;  1ACA A;  4FWR A;  2FSJ A;  2VGN A;  4H5V A;  4CZI A;  2QW9 A;  3X23 A;  5LJW A;  3F9M A;  3HBT A;  5C0Y A;  5AZJ B;  2NRH A;  2CGL A;  3E66 A;  3FE1 A;  1NGJ A;  4DQ8 A;  2RQ1 A;  3LDL A;  1DT9 A;  4CZK A;  3W3D A;  2E1Z A;  1GLE G;  2EWS A;  3I55 N;  1MK7 B;  2NRX A;  4JKE A;  4CZH A;  4JKA A;  5LJV A;  1YAG A;  4FOI A;  5AZI A;  4C23 A;  4BG9 A;  5AQI A;  1YJN N;  3CJ1 A;  1JDE A;  3CER A;  3CCR N;  1BO5 O;  1QQN A;  3C0B A;  1VQ6 N;  3KWI A;  4UY8 O;  4FPB A;  2GTD A;  3D2F A;  4BY9 C;  3MX2 A;  2ASO A;  1GLB G;  4CZF A;  5GAH P;  5EVZ A;  3LM9 A;  2QEX N;  1DIK A;  2CGK A;  2IVO A;  2VCP A;  3LDN A;  1M90 O;  2CB8 A;  2P9L A;  3SLC A;  1S22 A;  5KQ8 A;  1YUW A;  2D1K A;  4U7B A;  1VQ7 N;  3MWT A;  3S41 A;  5AQZ A;  1T6D A;  4FWQ A;  2VYP A;  2J0J A;  2IVP A;  3VEZ A;  3W0L A;  1Q81 O;  4JK8 A;  3UB5 A;  4OPA A;  4NB4 A;  1Q18 A;  4O5F A;  3O5B A;  4FO0 A;  5EXW A;  4HDQ A;  1MDU B;  2E2P A;  1NM1 A;  4B1X B;  5AQL A;  4JD2 B;  3RSE A;  4BVP A;  1YVN A;  3BEX A;  3FR0 A;  2D0P A;  3VEN A;  1GLA G;  1NGG A;  2QI2 A;  4JN4 A;  1YI2 N;  1TYQ A;  3O1B A;  4J8F A;  4L3Q A;  5AFU A;  3HRG A;  4FSV A;  4A59 A;  3PLA A;  2NNW A;  1VQL N;  4EFH A;  3PIO L;  4K43 A;  4CZL A;  1BA1 A;  3CQX A;  4HDO A;  3U7D A;  3SMS A;  2P9U B;  3CIP A;  3H6E A;  3WEE B;  5BR9 A;  4BR5 A;  4GV3 A;  3IKM A;  4A2B A;  4BRE A;  5F1X A;  4H5T A;  1DKG D;  2P9S B;  4CZM A;  4YOY A;  1BOT O;  3R1X A;  5C2D A;  3VF4 A;  3CCL N;  1G99 A;  4MDB A;  3HOT A;  1P8Z A;  2FF3 B;  3A5O C;  5DM7 L;  3SBT A;  1D4X A;  3O6W A;  3G71 N;  2DPN A;  1YF5 L;  2F7T A;  4ZRJ A;  3U9Z A;  3ZEU B;  4GXB A;  2P9I A;  2VGM A;  4BGA A;  4K41 A;  3WT0 A;  1QQM A;  5KPZ A;  5AQW A;  1NGE A;  4JHD B;  3VGM A;  3D2E A;  4FVU A;  3QML A;  3CCJ N;  1VQK N;  4B1Y B;  3MDQ A;  3A5M C;  4KH4 A;  4A5A A;  4EHT A;  2J4R A;  2AL6 A;  5BN9 A;  2FSN A;  2J0M A;  1MWM A;  3CF5 L;  3ENB A;  1JCG A;  5M1K A;  2W40 A;  4IXC A;  3MMV A;  2AA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...