4JKHA

Open and closed forms of d1781e human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
b'ELFSNQIIWFVEDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkhA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkhA01
4ILGB 4JKEA 3SBTA 4ILHA 4JKFA 3SBGA 4JKHA 4JKAA 4JKGA 4JKGB 4JK9A 4ILJA 4JKBA 3E66A 3ENBA 4JKDA 4JK8A 4JK7A 3E9PA 3E9OA 3E9LA 4JKCA
chains in the Genus database with same CATH superfamily
3OA9A 1QSLA 2J0KA 1BA0A 1RCHA 3M8PA 3ALYA 5HRSA 1GG3A 3BZKA 1MK7B 2GX9A 4JKGB 1S1UA 3TAQA 3OHRA 1NJZA 5LJVA 2P9IA 3VEVA 4RTFD 3VQQA 1S1VA 3PX6A 3P83D 3CCLN 1P8ZA 3ZT2A 4HCBA 2J4RA 3GL1A 3OJUA 4BRHA 1GLEG 4DKWA 5J2PA 3HL8A 1VBGA 4DMNA 3PV8A 4A59A 3EKSA 2CB8A 4BR4A 2DFFA 4BR9A 4DUZK 1TKZA 3MCPA 3CPWM 2A41A 1X3NA 3O8MA 4GKJK 3MWPA 1H4RA 1BUPA 3T7ZA 5HBMA 4H5TA 3ZEUA 4B3RK 4AM7A 1BQMA 2YHAA 2D0CA 2QWPA 4FLWA 3UKUA 4C1NK 3N4PA 4C8OA 3VQ7A 2RN2A 2FSJA 1X1PA 3VGMA 5EXWA 1JCGA 2BGGA 1M90O 2HHVA 4IJAA 1S9GA 4CFCA 3V9ZA 2WOMA 3D6RA 3C94A 4CGHA 4BRMA 4DFJA 4Q0BA 2A5XA 4JKCA 1GLFO 2NNWA 1HNIA 4F3TA 3TSUA 4BWMA 4RW6A 1NMDA 2I5JA 1KTQA 4CJFA 4FJLA 4M42A 4PL7A 1K73O 1IKXA 3KWGA 3A5LC 4O55A 4PKHA 3VQ4A 3H1VX 4YNQA 4W5TA 3KKRA 3OY9A 5CYMA 2ZJRL 1OH6A 4LF4K 2P9IB 3O9QA 1HJRA 2IDOA 3ZETB 1OVQA 1WOQA 1NK8A 3R8EA 3L4QA 2HHTA 4DV6K 1W2BM 1M1KO 1HPMA 2HNZA 3WEEA 4BROA 1HUXA 4CBXA 4CEAA 4ILHA 3V9UA 1E4GT 4DG1A 3V4IA 1JL1A 2FSNA 1RT6A 3NF8A 5FRMA 1GLJO 3O80A 2YVCA 2X6SA 3SUOA 1L5UA 3LDNA 2GEMA 3TTDA 4B1ZA 4CJPA 4IFVA 4CZFA 4I9QA 2E88A 2P9KB 4C1NI 4LFCK 3HJFA 4DU3A 1SZ2A 3LP1A 3ZEUB 4XEIA 1YTUA 4M7YA 4JI5K 2OTJN 1SQKA 1RILA 4KREA 3R3LA 3ZX2A 2NRTA 3EPYA 1SV5A 3SK3A 4OKEA 2HHSA 4N76A 3ZT3A 3ASMA 1D4XA 3CMAN 3VETA 2E20A 2NRRA 3K9KA 3O6WA 3CJCA 4JI7K 3FZLA 3PO5A 5BR9A 2A6AA 4IFYA 3SJJA 3K9JA 3N4QA 3O1BA 2HBMA 2CQUA 4H03B 3TPQA 4CF2A 4B9UA 5DM7L 5AJ3K 4FM0A 3WUHA 3CI5A 1GLBG 3WA0A 2PBDA 3MEDA 4FW2A 1TK0A 2G8IA 5LJWA 4NB4A 2UXDK 3H1QA 1LAWA 2B6AA 3AAPA 5GAHP 4ICLA 3WT0A 4CFDA 4JI2K 1BL3A 2G8HA 1YJWN 4BC2A 1X3MA 5AQWA 2RF2A 3SPYA 3CJ1A 4FXDA 1VBHA 5GADP 1IG8A 2RE2A 2E6MA 5GINA 3I0SA 5KTQA 3L8BA 2A1RA 1S9EA 4K8XA 2A3ZA 1RBVA 2WC9A 3DRSA 4CCHA 1MA9B 3DMJA 3OYCA 2HW3A 2UUBK 3T19A 1ESVA 1S22A 5EY4A 4U7BA 1J6ZA 4A61A 2E2NA 3THWB 5F1XA 1W7AA 3AVHA 2E2QA 4FZXC 2GBZA 3AVJA 1HR0K 2KHOA 1Y97A 5AQGA 1WBBA 3O9SA 2AL6A 3CCRN 4H0VB 3CCQN 4ISEA 1RTIA 4BRNA 3TR8A 4C23A 1VQ4N 1Q82O 2X74A 3SCXA 4X64K 1YVUA 1KAYA 5KRSA 3RMBA 1HNVA 3L6QA 4HWIA 4DSLA 4B08A 4BQZA 1IJJA 2HNYA 4DLEA 1IH7A 4WQ4C 1VAZA 4QS7A 4FWSA 1LW2A 4LC9B 4M3TA 1HKCA 1SKRA 4KH5A 5AQQA 3ZT1A 1RTDA 3VN5A 4YDUC 5AQHA 5BRDA 2F8SA 4OPAA 2LSNA 3SQ0A 3P5JA 4FM1A 2HBJA 3R1XA 3QINA 3KVGA 3ATUA 4B1UB 1T6CA 1WNSA 1TUYA 2BH1A 3B8AX 2J0JA 3C65A 3AGRA 3TARA 1Z25A 3AVGA 1VSHA 1S5JA 3F9MA 4YOXA 3DJCA 4DV2K 1C6VA 3B6PA 2QWMA 2HVIA 1TL1A 2FXUA 3PUFA 5AZIA 3B6OA 4DTPA 2PZSA 4FJNA 4Z4CA 1ASWA 2ZM6K 1Z6RA 3IG1A 2IVPA 3FFIA 3HYFA 3V1OA 4Q5VA 4A5AA 1SL2A 4LF9K 3AO1A 2BUPA 5AQJA 1G15A 2IVOA 4LF8K 3M5RA 2D0AA 4CGGA 3CQYA 4AHRA 1K9MO 3FGUA 4WYBA 2QW9A 4JKDA 5JVLA 4GY2B 4ZRKA 4WF9L 2GTDA 2WBNA 2VQEK 3PIPL 2W41A 3G25A 4B9LA 5T7BA 5TKWA 5BPLA 4JKFA 3PX4A 1SKWA 5BPMA 4O44A 1HQEA 1HYVA 2O4GA 4IOAL 1P90A 4CJLA 3QESA 1HKBA 2VYPA 4DLGA 4PA1A 3V1RA 3AA2A 3MEEA 1BA1A 3K5NA 3CCUN 4FLYA 4OGCA 4JS5A 4M3YA 2P51A 4EHTA 1VQPN 2G8WA 3BY5A 1KFSA 1NOZA 3CCEN 3Q7BA 1I39A 3RRHA 5J1EA 4H5NA 2HMPA 2I1KA 3KJVA 5AQOA 2O8BB 4BRCA 1MDUB 3K5MA 2YNHA 5M1NA 4GVMA 5CZ1A 1NK9A 3C0BA 2YHBA 3O9UA 1KVCA 1MK9B 1WSFA 4E7IA 3PSIA 4H5WA 4CJUA 4JK8A 4E7LA 1R59O 4AHVA 4BE1A 3CC4N 4X62K 4JD2A 4CJRA 4W5OA 4O5BA 3FP5A 1N5YA 4JI0K 3AVAA 2VG5A 1TVRA 1NGBA 2AEHA 3ULDA 4KTQA 5AZIB 5FLXO 1C0FA 3DOLA 4JRQA 1ZBIA 1U2VB 3P39A 3TAGA 5F2RA 3BDPA 1X9MA 3DLHA 4B9TA 4DFPA 2W40A 3OJSA 4FWLA 3KLHA 2W42A 1L3UA 1EWQA 1RBRA 2PYJA 4FZZA 3U4LA 5HRRA 3V1QA 3U9ZA 3LDOA 1VSEA 3VEXA 4CIGA 4H0TB 1LOTB 3VQPA 4WQ5A 4Y1DA 1C1CA 5HRPA 3THVA 4KTWA 3P1GA 1VSMA 4BRKA 1OKJA 2VGNA 3FZKA 4BC5A 3ZCMA 3QIPA 2F9WA 1XNRK 4CFBA 1T44A 3HPOA 3LPTA 4MQ3A 4MO5A 4HHTA 1Q8IA 3PLAA 1QSSA 3IDHA 1QZ6A 3O9RA 1YTAA 4KB0A 4LH4A 4KV8A 4IDHA 4FLXA 3FZHA 1SKSA 3Q7CA 3QEPA 4CEFA 1VRUA 1RBUA 2Z1JA 4JI1K 3GOIA 3SV3A 3E1YA 2GV9A 3ZX0A 5FPEA 5LMUK 2HHWA 5AQPA 4HUGA 2QA4N 1MIXA 4JD2B 1U4BA 4FLVA 2ZPYA 3MCAB 2Z1IA 1LWFA 2V52B 3TAMA 4YOTA 4FZYA 4IO8A 3VEZA 5BRHA 4I6MA 1IO2A 1NM1A 3K58A 5FPMA 3VEOA 4EKUA 4B1VA 2Y1JA 1NKBA 3CETA 2CGLA 1E5WA 1C0GA 5JLFA 1NGIA 1NGDA 2QWQA 2ZF5O 3VQ6A 5KQ8A 5HRNA 4Y1CA 2YKNA 3AVFA 3S3OA 2R7YA 3ZLJA 3PSFA 3NCIA 1RT4A 1BIZA 3QFUA 3ULEA 3K0SA 1ZBFA 3M8QA 5JS2A 3MK6A 3T1YK 3P31A 3GDQA 4FLTA 3AARA 2Q31A 4DR5K 1JLEA 3L2QA 3JSMA 4MFBA 5IJMA 4B9MA 2KKZA 2V7YA 4E89A 1C0TA 2D1KA 5EX5A 3CF5L 1GOCA 1FJGK 5HL7L 1OH7A 3TAPA 1N34K 1MU2A 5C0YA 4FJ8A 2DIKA 4KRFA 3HSTB 1SGHA 4H0OA 1NJWA 3TAFA 2O8FB 4K41A 5AFUA 4JKGA 4DV5K 3J8AA 3HRGA 4B3OA 4BRFA 1FKOA 4DR2K 4JK7A 3HP6A 1DT9A 3VOVA 4ELTA 3M8SA 2P5OA 3VMFB 4HUEA 1RFQA 4FJIA 4CFAA 2QWOA 2ITMA 3MDQA 4E0DA 4O0JA 2NUBA 5CYQA 4CW7B 2UUCK 3CFRA 4YORA 3F73A 1RDBA 4AM6A 4CJ7A 4DTUA 1WSJA 3ENBA 3AVNA 3SYZA 4CIEA 1BU6O 1ZC6A 5HP1A 3V81A 4CZGA 4CGDA 4H0XB 3K57A 4PWDA 3IMXA 3MEGA 5AZJA 4HTUA 3QIJA 1XC9A 4M3RA 5AQFA 3G6EN 1RTHA 4Z0UA 4CHNA 4JHDA 1W97L 1I3AA 3DI6A 3CJBA 3MN9A 1FW6A 4IO9L 2UUAK 2DTUA 1SL0A 3OS1A 3O3FA 4JK9A 4CGFA 4GMJB 3HTVA 1IV0A 3PIOL 1HBKA 4YOWA 3J7AP 3VGLA 1LWCA 1KAXA 1ZBSA 1N8RO 1TAQA 4CF1A 5DK5A 5HROA 4L8RB 3C7NA 1E4FT 3U3YA 4B9NA 4H4MA 1GLLO 1SAZA 2P9UA 2YNIA 1Z26A 4DFMA 3C6UA 5BR8K 4N41A 4LD0A 4K42A 4CJSA 1L3VA 3R6MA 3FZMA 3ZETA 3DM2A 1B9FA 5KRTA 3ITHA 3DOKA 2CH6A 2FDQA 4DR7K 2F9TA 3LALA 1RDAA 2EX3A 5DMRA 3LDSA 4Z4HA 4M41A 1S1TA 3GG4A 1BG3A 4JKAA 3NAEA 4ZTJA 4NCGA 3KIOA 3A8YA 2D2QA 2Q3SA 2YHYA 2XRIA 3SAHA 4FJJA 2P9KA 3MN6A 2YCHA 2HHUA 4L3QA 3DXMA 4H8KA 3SQ4A 5AZJB 3ZSXA 4FCYA 4CF0A 1U49A 3OBWA 2VWKA 4BDZA 4JHDB 2D0BA 2GWJA 3T1AA 1Z05A 4FWOA 1FKPA 2QWNA 4FWMA 5JVGL 1J53A 3ZYYX 4DR4K 5ADXH 1TGOA 2JGUA 1L3TA 1TAUA 4NLBA 3EKUA 3HSCA 2FSKA 4FPAA 1W9HA 2FBTA 3CC2N 3PO4A 3ID6A 1GGOA 4BY9C 3C7NB 2IIRA 1XHZA 4DQRA 3CC7N 3K59A 2A1SA 2P9UB 4BE0A 4CGIA 2Q36A 4LSNA 5AFUH 2OPRA 4CERA 4UY8O 2XY5A 4AHSA 2WH5A 4CJTA 4PHTX 4FK2A 2GUIA 2HMIA 4LFBK 3VQCA 5AQYA 3D0PA 1YHQN 4JKEA 1XI1A 2WUSA 3H3NO 2ZQBA 2OTLN 3D7EO 4FJ7A 5CHIA 1XWLA 1QTMA 5AQUA 1CZBA 3O9TA 4MO4A 1ZYQA 4FJMA 3THWA 4EZ9A 4M3UA 1QQOA 2JWKA 3SNNA 4F7GA 1KLNA 2E6LA 4FPBA 4JEPA 3EZ5A 1IKVA 4DQPA 3U3GA 5BN9A 3CCVN 2HHQA 4G9ZA 3GBTA 5LMNK 1QSYA 5EVZA 1DTQA 2QXLA 3DXMB 3SUPA 5M1FA 3NGIA 4JAXA 4HVJA 3A0IX 4CJ5A 2NRVA 4CK2A 3NGZA 3SAGA 4J2AA 3KTQA 1HLUA 1XHXA 4JKHA 2KTQA 2OA8A 5TKYA 2X0SA 4KHNA 4HDOA 3AAQA 3ID8A 5C10A 2F4VK 4QCLA 4RW9A 2P1JA 4A57A 2E4LA 4CJ3A 4P7IA 4JNEA 1GLDG 5I9EB 2BDPA 2HF3A 1NK6A 1NWKA 3OVNA 1NGFA 1VQNN 2EMSA 3QEIA 2GUPA 1TKDA 4B9SA 2F96A 4CHYA 3AA5X 1N32K 2ZD1A 3KLFA 4PUOA 3QDKA 4ISFA 1KSPA 4EP5A 3LAKA 4FK0A 5JVHL 1Q86O 2FBVA 1D5AA 1D9DA 4KHSA 4LY7A 1HKGA 1QQCA 3L3VA 1RNHA 3AVMA 5C25A 1FK9A 5A2QO 1DIKA 3G71N 3KK1A 4CGJA 2OPSA 3VEYA 4CJEA 4DQSA 5C42A 4CD3A 3VTIA 4B9VA 1U47A 2I7NA 1YF5L 1N6QA 3JXUA 4B1YB 3RMAA 4GW6A 3NH0A 3QBWA 1NK0A 3MMVA 3H08A 1NOYA 1E3MA 2FF6A 4GV3A 3VA0A 4BVOA 3SBGA 4KHPK 2I1JA 3UKRB 1S1WA 3H45C 2VGMA 3CQ8A 4CZIA 3ZDTA 1QHTA 4MDAA 4F2SA 3AVIA 4CYEA 1RT1A 4I9LA 4E3SA 3HBTA 1YXQA 2D0OA 4GV6A 4IDKA 1UA0A 3SMSA 1KVBA 3ISNC 3QLHA 3THXB 1D9FA 2ZWHA 4CBWA 4K43A 3HPHA 1OH8A 2QKBA 3AU4A 5JLHA 2O8BA 5M1OA 3MXMA 1NGEA 5CE3A 2DY4A 5M1QA 5J2QA 1NTIA 4CJQA 4BRIA 3TAEA 2AJQA 5ELZA 1ATNA 4H5VA 3VF6A 1JLQA 3WQUA 1S3XA 3LM9A 4RW7A 3L2WA 4PKIA 3BEXA 3SQ2A 3KK7A 1HYSA 1XQSC 2YV0X 4O0IA 1MIZB 3OS0A 3MAQA 1U2VA 1I94K 1K6YA 4CK3A 3SV4A 2CH5A 2XY7A 4ELVA 2P9LA 5HOOA 3NVKA 2HHHK 3D2EB 4IXCA 3M3ZA 4B1XB 3G4SN 1HRHA 5DM6L 5LY3A 1KQSM 4FJXA 1KRPA 4GKKK 2PFUA 2OPPA 2G8UA 4NXMK 3WNEA 1NG9A 3DXKA 3D2FA 2QXFA 1WB9A 1DTTA 4MLEA 3G0ZA 3I55N 3BINA 1HNXK 4ELUA 2E2PA 1J5OA 3KLIA 2EHGA 4ISGA 2HNDA 4OVLA 5E84A 2RHKA 3WXIA 3ZSWA 3WQTA 4KHUA 4BC4A 3E9OA 3VQDA 1TKTA 3AA3A 5I3UA 1NJXA 1IG9A 2LBBA 1ILYA 4C8NA 1ST7A 4K0KK 1OVYA 1HQUA 4DSFA 3VQEA 3RRGA 4EP4A 1UA1A 3HM9A 4H0YB 4ILJA 5IT9O 3MWTA 2QWRA 3C95A 2IVNA 2ZJPL 4DV7K 3CMEN 1JXEA 2YJFA 3SLCA 4CF8A 2D4WA 3LWLA 2BE2A 1UAXA 1RTJA 1T6DA 3JS6A 5GIPA 2IGIA 4JV5K 3THYA 2NLXA 2RPIA 2QM1A 2P9SB 3K5LA 1YVNA 4IZ9A 3HVTA 3I8BA 4DCHA 4Z4EA 5KPZA 5J2MA 3U8XA 1QZ5A 2E5LK 2P9LB 4YHHK 4YOYA 1Q18A 1MWMA 4BACA 2ASPA 2O8EB 3V9WA 2H3GX 3LDPA 4DV0K 4KAZA 3E9LA 4DTRA 1LAVA 3DLLL 4XH1A 1KXPA 5KGXA 4NO7A 1ACAA 3AO2A 3V6DA 5FROA 5AQVA 2QI2A 4NYFA 1WAJA 5AQSA 3SUNA 4NLCA 3VQBA 3VQAA 3DXKB 3D2FB 2O8CB 4DS4A 4BC3A 3CERA 3VTHA 3OTOK 1K8KB 1GOAA 4FOEA 3BF3A 1J54A 4N56A 3OYJA 1CXUA 1NGCA 3J7YP 2O8DB 4FM2A 3FLCO 1BHLA 1NU0A 1IBLK 4RW4A 2FF3B 3L2VA 4CJ4A 2O8FA 3ZSZA 2UYTA 4LFAK 3DLEA 1D8YA 4FLUA 3AVKA 3MXIA 1IBMK 4BRPA 1ATSA 3HPGA 1NGGA 3CHWA 3ZX3A 4DU1A 4E7KA 3NE6A 4J2BA 5BPNA 4F9OA 3J81O 1NLVA 4BWJA 4CF9A 4ID1A 2W6LA 2VWBA 3VPZA 4CZJA 3I0RA 4DS5A 3THYB 1WSHA 1ATRA 3OYDA 4CJWA 4CJVA 2V51B 1GC7A 2A40A 4DTMA 4IWVA 3QICA 3G10A 2ZGYA 3OYIA 3EN9A 3KD1E 3P38A 1GOBA 4NCAA 4BGAA 5EOYA 1U45A 1BGXT 1EX4A 1LV5A 1ISNA 4A2AA 4DV1K 4F8RA 3HI0A 3QO9A 1JLGA 3DRPA 4WFAL 4W5QA 4OO1J 3A5MC 4WE1A 1N33K 4CEOA 1EP4A 2E1YA 3U7DA 3CPEA 4BG8A 2ITGA 4KHQA 3C6AA 3L3UA 4FWQA 2QTDA 4DR6K 4XIUA 1L3SA 1VHXA 4FJGA 3DWLA 4CHZA 3WXLA 3D45A 4ZHRA 3AA4A 4BR5A 1T7PA 3EE9A 3BGRA 3EE8A 2HE7A 4PKGA 2YNGA 1RDCA 4E19A 3SAFA 3DLBA 4M3ZA 3I56N 1LCUA 4OJRA 3QEXA 1R0AA 3U9DA 3AV9A 3WXJA 3J7ZO 1O1WA 4FJKA 4XH4A 2BTFA 3TWHA 3ZSQA 3AU5A 1XC3A 3NF7A 4I2QA 1VRTA 2NRWA 3KKSA 3SI6A 1S1XA 5SWMA 4BR7A 1XNQK 2CGKA 3QNNA 4EIAA 4W5RA 4B3TK 4CE9A 1WBDA 4OX9K 2QWLA 4CZHA 4A62A 5KQDA 3TSQA 3AVBA 3SBTA 1K8AO 2P9PA 2OYQA 1X9WA 3CCSN 1BO5O 1HJOA 4FJHA 5H1SQ 4U67L 1VSJA 3MN7A 3MECA 4DUYK 2RQ1A 4B3MK 2YHWA 2ZJQL 3EO3A 3OYFA 2P9NA 1VSFA 2IAJA 3ZT4A 2E8AA 1Q9YA 3NBPA 1TV6A 3EYZA 1S6PA 3UB5A 1XUPO 4HCCA 3O4WA 3RSEA 3MN5A 3BZCA 4LH5A 3WNFA 3HXMA 3OBYA 3LZJA 2Q0UA 3M1FA 3NF6A 4FVMA 1IBKK 3K5OA 2HHXA 5JS1A 4MDBA 4BDYA 3M8RA 3IFRA 1NK4A 1X9JA 3FR0A 4I7FA 3QNOA 5BREA 1A5WA 3DRRA 4CJKA 2W6KA 2NZTA 1GLAG 3EZWA 3FFKB 3O4NA 4NY0A 3V9XA 3GE1A 4KBOA 3P4IA 3AVLA 1KCFA 1LWEA 4DU4A 4CEQA 5C2DA 4KI4A 4E1JA 4JN4A 4OLAA 2NRXA 1EXQA 1C0UA 3HM8A 3BF1A 4FWKA 4H0PA 4Z94A 4NCBA 2Z1GA 3RR7A 1ITGA 2KZMA 4KO0A 1SS6A 1VQ6N 2VCPA 2Q2RA 1QS4A 3IRXA 3L2RA 4B8CA 2FBXA 3VENA 4M45A 3VA3A 3VF4A 4DSJA 3H46O 1U48A 3U6FA 3V9SA 2VQFK 3LAMA 4FWPA 1TK5A 4E1MA 2P9PB 2COPA 3AO3A 3S3NA 1EO1A 4Z4IA 3TTFA 3L0QA 5C2FA 2XHBA 3SMPA 3QBXA 1NGAA 1NK7A 3IAYA 3TSPA 3QIOA 4AH9A 2E1ZA 5J2NA 3WXKA 3LDQA 4JS4A 2P9NB 3QERA 4BRGA 1H1VA 5IWAK 4AILC 1DKGD 3QETA 1NBWA 3RMCA 1V4TA 5AQIA 2B5JA 5EU7A 3W3DA 4DR3K 4DSIA 1Q81O 1J9AA 1MWKA 3WNGA 3RSEB 1BQNA 3R9PA 5KPRA 3PVLA 4JKBA 2Q0RA 4BREA 4BR2A 4CEEA 4B8AB 1HX1A 1O13A 4AF1A 5K14A 4B9QA 2UXBK 2G8FA 3HOTA 3O5BA 4OKJA 4DTXA 3SJHA 4CBUA 3S3MA 4GV9A 1B9DA 3CXCM 4FJ5A 5B8HA 2DPNA 1IKYA 5AQLA 2HRJA 1RBSA 3OS2A 1V4SA 1EF1A 1WAFA 4E1NA 4M3WA 4I2PA 4EZ6A 2YNFA 3LP2A 4FYDA 3CM5A 2GWKA 3IVFA 1B92A 1JXBA 2DFEA 1JLCA 4KPYA 2AA4A 5D3GA 4OPHA 4FSVA 4M7XA 2IC3A 3OYLA 2BANA 3OYBA 2DFHA 1NK5A 1F21A 3DYAA 3SZ2A 1T03A 4AHTA 1YJ9N 4JI3K 4DQQA 1TKXA 4DQIA 2GELA 1XMOK 4KHWA 5AQNA 1HPZA 3CJ9A 5AQTA 1VK0A 2OCEA 3O4QA 1EQYA 5KPTA 3NFAA 1NGHA 4DHYA 4N5SA 2HBLA 4KKOA 3T1HK 3UKRA 2OZMA 4A2BA 4BDPA 5AQRA 1T3VA 3ZT0A 1U04A 2UU9K 1NVLA 1J5EK 2CGJA 3AO4A 4IOXA 3OYEA 1KBLA 2ZE2A 4AQYK 3QEVA 1QQNA 2ATQA 4NXNK 3OW2M 4O8KA 5JICA 4C8KA 4HDQA 1N36K 1KC7A 4IG3A 1CXQA 3THXA 1RT5A 3ENOA 4E7HA 3UKUB 4DSKA 2FJ9A 1NNEA 4OPKA 5GAGP 1BOTO 2OPQA 4CEBA 4OGEA 1G99A 2OANA 1JLAA 4OKKA 2UXCK 4JLHA 4KB1A 4DWIA 4JI4K 4KHYA 1QE1A 1BCMA 1DGKN 1VSDA 3CFOA 4G1QA 1XMQK 4JYAK 5CZ2A 4IEEA 4WQ5C 3OYGA 3BUZB 3HO1A 3EEQA 5F0XA 4QOZB 1VSKA 3HP9A 4BRQA 4C8MA 1HNZK 3D2EA 4YOVA 4W5NA 5FDLA 2YJEA 1ZXOA 3A2FA 1BISA 3WEEB 3VF2A 4DFKA 1VQKN 3T3FA 4LSLA 4CD1A 1KAZA 1Q7YO 1VQ9N 4DV4K 1C0MA 4GNIA 1JCFA 3U8ZA 3OYHA 1BCOA 2NRZA 1HNWK 3KD5E 2V7ZA 3X23A 4IOCL 4FVUA 2WONA 3E9PA 4K8ZA 4J8FA 3PY8A 4FW1A 3LANA 3RWUA 1WLJA 2XO7A 2IOCA 4DF4A 4FO0A 1KFDA 4R79A 3CQXA 3G9WA 3VERA 3LWMA 4CHQA 4DSEA 4BRLA 1JL2A 4KH4A 4B1WB 4CZLA 1TK8A 3BP8A 5C24A 2FLOA 4YOUA 3NH1A 3M6GA 4CK1A 3MX5A 5FPDA 4IBNA 2FBYA 1UOCA 4FLZA 4PQUA 4DTSA 3HZ6A 1RDDA 2P9SA 3JAMO 1GLCG 1ZBUA 1YI2N 1YUWA 2HB5A 4RWTA 2XY6A 1DLOA 4PY5A 2OZSA 3H3OB 2XY8A 3LDLA 1YJNN 4FK4A 1SL1A 4ZRIA 5HLFA 1C1BA 4B3SK 1NI2A 3A5OC 3C6HA 1RT3A 1VQ7N 2O8EA 4AHUA 1A5XA 1RT7A 4UQGA 3ZSVA 2Z1HA 4WCEL 3K2PA 3VQ9A 1NJYA 3F2KA 4DF8A 1IKWA 3FLVA 4BRDA 5GAEP 4ZTFA 3C6TA 4Z4FA 1SUQA 1X9SA 3AY9A 1FXXA 1HB8A 4JI8K 3FZFA 4LF7K 2O8CA 2PY5A 3VQ5A 1YAGA 3CCJN 3S9HA 1Q9XA 2QEXN 4BR0A 5GIOA 1EETA 1K8KA 3L2UA 2WTUA 2VWJA 3HVRA 3DAWA 3H6EA 3VGKA 4YY3K 2O8DA 2YI1A 2I7PA 4RCHA 1ZBLA 3TTCA 2ETJA 3RR8A 2KLAA 3CCMN 3SQ1A 5AR0A 1RDWX 1W0HA 3LM2A 3IUCA 1TUUA 3FE1A 3TI0A 5M1KA 3IS9A 1S6QA 1EKEA 2WFBA 4EAHD 3MXJA 4ZRJA 2D5RA 2ASMA 3LP0A 4HUFA 4IEIA 1VQMN 3F5TA 3KK2A 3CJAA 3NF9A 2ZGZA 2QKKA 1GC6A 3KHYA 1S72N 3CFPA 1Y19B 4DXAB 2E2OA 3LP3A 4IG0A 1WSIA 3IKMA 5E26A 2G8KA 3VESA 2QK9A 4Z4GA 4DTJA 2JWLA 4FL9A 3NH2A 4DV3K 4J2EA 3OYNA 1KD1O 1NGJA 2D10A 4CHOA 2J0MA 3AGKA 2Y1IA 4CIFA 5KGWA 4WFBL 1JKHA 3LZIA 3RMDA 3AO5A 4K25A 2G8VA 4F3OA 2FC0A 2YHXA 4KTZA 4KH6A 4YL8A 3UIQA 5E41A 2VG6A 1BDGA 4BRAA 3ATVA 1JLFA 3QMLA 4A5BA 4RG8A 4FWNA 3HK2A 1OH5A 3QB0A 3KWIA 4HTLA 3J80O 3EY1A 3DLGA 1KC8O 1BWFO 3NHGA 1T05A 4CZMA 1BI4A 1JJ2M 1TL3A 1NMNA 4O8UA 4BQLA 3T69A 1VQLN 5FPNA 3S41A 4J2DA 4XH5A 4CEZA 3AVCA 1BIUA 4NYNA 4DR1K 2Q1NA 1C1AA 3OYAA 3RTVA 4EHUA 3L4IA 3TABA 2D11A 2HSTA 1JCEA 3ZSYA 4E7JA 1ASUA 3E01A 1VSLA 3KZBA 1RDUA 5SZTA 4TKNA 4BGBA 5MLCQ 3ZSOA 3KLEA 1NKCA 1YITN 3VQ8A 2O4IA 5JMVA 4FOIA 5CY4A 1ZBHA 3DLKA 4M63C 3NVMA 3ENHA 4CECA 4WQ4A 4GVEA 3A5NC 1T8EA 4YFUA 1JLBA 2X78A 3CYMA 1Y64A 3DLRA 1YIJN 1QVFM 3MX2A 4YDUA 4X65K 4N47A 2EMTA 1KLMA 2PYLA 2B4JA 3RVCA 3O1WA 4F2RA 5M1PA 2KFNA 3PX0A 3LPUA 4OPJA 5BN8A 4CZKA 5C12A 1U6ZA 3JYTA 3WXMB 4QS8A 1VQON 3I8DA 4OLBA 4PL8A 5I42A 1QVGM 2Q97A 3QFPA 3OYMA 2KFZA 3ZSRA 4BG9A 3NMUA 1DEJA 1HMVA 4WFNL 4CI6A 4IKFA 3W0LA 1TYQA 4Y0WA 4C8LA 2KZZA 3F9KA 1BI4B 1QQMA 2P5GA 4BVPA 5ADXA 1CZAN 3HOSA 3O3GA 4GXBA 3OYKA 3I33A 4X66K 4RW8A 2EWSA 4LF5K 2YKMA 5AQMA 2A42A 4BE2A 4O5FA 5AQXA 3QEWA 2X6NA 4KI6A 3KK3A 4FJ9A 1KVAA 1RT2A 1YT3A 3NGYA 5LL6Z 2HOEA 2ASOA 4IFEA 3WNHA 4O4GA 2PAVA 1HYZA 4ID5A 1ASVA 1NKEA 1NJIO 4IJNA 5KI6A 2VG7A 4TSXA 2HVHA 2ABDA 4AHCA 4H5RA 4QAGA 4CHPA 2IS3A 4CEDA 1WSGA 4QS9A 1LW0A 2KW4A 3LL3A 1VQ8N 2RKIA 5AQZA 5FRNA 2HBKA 4ILGB 4R5PA 4DB3A 4F4KA 3SPZA 4FWRA 4M3XA 3PZDA 3O08A 4I6MB 4CESA 3CG7A 1J19A 1RGIA 5C15A 4KFBA 1WN7A 4CVNE 4DTNA 4LF6K 2R82A 3SUQA 2JLEA 3CM6A 5AQKA 1A5VA 4DTOA 2KQ2A 4MLHA 4JI6K 5CR4A 3HT3A 3KLGA 4CZEA 2F7TA 3NDKA 3UE5A 3ULEB 1WSEA 2NRHA 3O3HA 3CJ7A 2F8TA 1HB6A 1QHAA 3VEWA 5BRFA 4V19S 1WUAA 4EFHA 1CLQA 3TANA 3TU5A 1TYQB 4JRPA 1CZ9A 2AP1A 2D0PA 1VSIA 3E66A 3CD6N 1REVA 4DQ8A 1VQ5N 4H4OA 1UWBA 1EWRA 2YX6A 3EL2A 1JDEA 1RBTA 3CIPA 2HF4A
chains in the Genus database with same CATH topology
3OA9A 2J0KA 2ZPYA 1BA0A 3ENOA 3MCAB 3UKUB 2V52B 2FJ9A 2PFUA 4YOTA 5GAGP 1BOTO 4IO8A 1GG3A 3VEZA 4I6MA 5BRHA 1MK7B 1NM1A 5FPMA 1G99A 3VEOA 4EKUA 2GX9A 4JKGB 2OANA 3DXKA 3D2FA 3OHRA 4B1VA 5LJVA 3CETA 2CGLA 2P9IA 1E5WA 4MLEA 1C0GA 4RTFD 3BINA 1NGIA 1NGDA 2E2PA 2QWQA 2ZF5O 3VEVA 5JLFA 4ISGA 1DGKN 5E84A 2RHKA 3WXIA 5KQ8A 3CCLN 3WQTA 1P8ZA 4BC4A 3QFUA 3E9OA 2J4RA 3GL1A 3ULEA 4BRHA 1GLEG 4DKWA 4IEEA 2LBBA 4WQ5C 3BUZB 1VBGA 3MK6A 1ILYA 1ST7A 1OVYA 3EKSA 3P31A 4A59A 5F0XA 2CB8A 3GDQA 4BR4A 4BRQA 3AARA 4H0YB 2Q31A 3CCJN 4ILJA 4BR9A 3CPWM 3MCPA 2A41A 1X3NA 3O8MA 5IJMA 3MWTA 3D2EA 2QWRA 2KKZA 2IVNA 1H4RA 1BUPA 2V7YA 2YJFA 3MWPA 2ZJPL 3CMEN 3T7ZA 3SLCA 4H5TA 3ZEUA 2D1KA 4YOVA 2D4WA 2YJEA 4AM7A 5EX5A 1ZXOA 2QWPA 3CF5L 1T6DA 3WEEB 3JS6A 5HL7L 3VF2A 5GIPA 3UKUA 4C1NK 5C0YA 2NLXA 3N4PA 2DIKA 1VQKN 2QM1A 4CD1A 1SGHA 2FSJA 1KAZA 2P9SB 4H0OA 1Q7YO 1VQ9N 1YVNA 4K41A 4GNIA 3VGMA 5AFUA 4JKGA 3I8BA 1JCGA 4IZ9A 5EXWA 1JCFA 3U8ZA 3J8AA 4DCHA 5KPZA 3HRGA 1M90O 2NRZA 3U8XA 4IJAA 4BRFA 1QZ5A 2P9LB 2V7ZA 4JK7A 3X23A 4YOYA 1DT9A 1Q18A 3VOVA 4IOCL 1MWMA 3D6RA 4FVUA 2ASPA 2H3GX 3LDPA 4BRMA 3E9PA 2A5XA 3VMFB 3E9LA 4JKCA 1GLFO 1RFQA 2NNWA 4J8FA 3DLLL 4XH1A 1KXPA 3TSUA 4NO7A 2QWOA 1NMDA 4FO0A 1ACAA 4PL7A 1K73O 4R79A 3CQXA 3G9WA 3MDQA 2ITMA 3VERA 5AQVA 2QI2A 3KWGA 4BRLA 3A5LC 4KH4A 4B1WB 4PKHA 4CZLA 3H1VX 5AQSA 4YORA 3BP8A 4NLCA 2FLOA 3D2FB 3DXKB 4YOUA 4AM6A 4CJ7A 2ZJRL 4BC3A 3ENBA 2P9IB 3M6GA 3O9QA 3CERA 1BU6O 3VTHA 1ZC6A 3ZETB 1K8KB 1WOQA 4CZGA 4FOEA 3R8EA 3L4QA 3MX5A 4H0XB 3BF3A 1W2BM 5FPDA 1M1KO 1HPMA 3IMXA 5AZJA 3QIJA 1NGCA 3WEEA 4BROA 1HUXA 3FLCO 4CBXA 3HZ6A 5AQFA 3G6EN 2P9SA 4ILHA 1GLCG 2FF3B 1E4GT 1W97L 4JHDA 1YI2N 3CJBA 2FSNA 1YUWA 2UYTA 3MN9A 4RWTA 4IO9L 1GLJO 3H3OB 2YVCA 3O80A 3LDLA 1YJNN 4BRPA 4JK9A 1ATSA 3LDNA 2GEMA 4ZRIA 1NGGA 3TTDA 3CHWA 3HTVA 4B1ZA 3ZX3A 3PIOL 1NI2A 1HBKA 3A5OC 3C6HA 1VQ7N 4YOWA 3VGLA 4CZFA 2E88A 5BPNA 4F9OA 2P9KB 4C1NI 1KAXA 1ZBSA 1N8RO 1SZ2A 3ZEUB 1NLVA 4XEIA 4WCEL 2VWBA 3C7NA 4M7YA 2OTJN 1E4FT 1SQKA 3VPZA 4CZJA 3F2KA 3R3LA 3ZX2A 2NRTA 3FLVA 1GLLO 4BRDA 1SAZA 2P9UA 5GAEP 1ATRA 3EPYA 3S41A 3SK3A 2V51B 3AY9A 1GC7A 2A40A 1HB8A 3FZFA 1D4XA 3CMAN 4IWVA 3VETA 2E20A 2NRRA 3K9KA 1YAGA 3CJCA 3O6WA 3FZLA 3QICA 2ZGYA 3R6MA 4K42A 2A6AA 3FZMA 3ZETA 3K9JA 3EN9A 3N4QA 1K8KA 2CQUA 2HBMA 3O1BA 3P38A 4H03B 3TPQA 4BGAA 5EOYA 5DM7L 3WUHA 1ISNA 3CI5A 3DAWA 3H6EA 3VGKA 2CH6A 2FDQA 1GLBG 3WA0A 2PBDA 2YI1A 4A2AA 2F9TA 2I7PA 4RCHA 3HI0A 4NB4A 5LJWA 4WFAL 4OO1J 3H1QA 3TTCA 3A5MC 2KLAA 3AAPA 5GAHP 3CCMN 2E1YA 3U7DA 5AR0A 3CPEA 4BG8A 3GG4A 1BG3A 4JKAA 3WT0A 1RDWX 3LM2A 3C6AA 3IUCA 1TUUA 4FWQA 2QTDA 3FE1A 4BC2A 1YJWN 5M1KA 1X3MA 5AQWA 3DWLA 3A8YA 2D2QA 3WXLA 2YHYA 3SAHA 2WFBA 3CJ1A 4BR5A 4EAHD 1VBHA 3EE9A 2P9KA 5GADP 4ZRJA 2ASMA 1IG8A 2RE2A 3MN6A 2YCHA 4L3QA 3DXMA 4IEIA 3EE8A 3F5TA 5GINA 3CJAA 2HE7A 4PKGA 1VQMN 2ZGZA 3SAFA 5AZJB 1GC6A 3KHYA 3I56N 1S72N 2A3ZA 1LCUA 2WC9A 3U9DA 3OBWA 1MA9B 3WXJA 3J7ZO 4JHDB 4XH4A 2BTFA 1Y19B 1ESVA 2GWJA 1S22A 5EY4A 4U7BA 1J6ZA 3AU5A 1XC3A 4DXAB 2E2OA 1Z05A 4A61A 2E2NA 3IKMA 5E26A 5F1XA 4FWOA 2E2QA 2NRWA 2QWNA 3VESA 2QEXN 4FWMA 2KHOA 5AQGA 4BR7A 3O9SA 5JVGL 2AL6A 2JWLA 2CGKA 3CCRN 4FL9A 3ZYYX 4H0VB 5ADXH 3CCQN 4EIAA 1KD1O 4ISEA 4NLBA 1NGJA 4BRNA 2D10A 4C23A 3EKUA 1VQ4N 3HSCA 1Q82O 2FSKA 2J0MA 4FPAA 3AGKA 3CC2N 2QWLA 4CZHA 4A62A 5KQDA 3TSQA 4WFBL 3SBTA 1K8AO 3ID6A 2P9PA 1KAYA 1GGOA 4BY9C 3C7NB 3CCSN 2IIRA 4K25A 1BO5O 1HJOA 3L6QA 2YHXA 4HWIA 4KH6A 3CC7N 4YL8A 4BQZA 1IJJA 2P9UB 4U67L 5H1SQ 3MN7A 2Q36A 4WQ4C 1VAZA 4QS7A 5AFUH 2RQ1A 1BDGA 2YHWA 4FWSA 4LC9B 2ZJQL 4UY8O 3EO3A 4BRAA 1HKCA 3ATVA 2P9NA 2WH5A 2E8AA 4KH5A 3QMLA 4A5BA 4PHTX 5AQQA 4FWNA 3UB5A 3QB0A 3KWIA 4HTLA 5AQYA 1XUPO 4YDUC 5AQHA 5BRDA 1YHQN 4JKEA 4OPAA 1KC8O 1BWFO 2WUSA 3H3NO 3O4WA 2OTLN 3D7EO 3RSEA 5CHIA 3MN5A 2HBJA 4CZMA 5AQUA 1JJ2M 3R1XA 3KVGA 3O9TA 3ATUA 4MO4A 3OBYA 4O8UA 4B1UB 1T6CA 2Q0UA 3M1FA 3T69A 4BQLA 1QQOA 2JWKA 4F7GA 1VQLN 5FPNA 1TUYA 2BH1A 3B8AX 2J0JA 3C65A 4MDBA 3AGRA 3IFRA 4FPBA 4XH5A 1X9JA 3FR0A 4JEPA 2Q1NA 3F9MA 4YOXA 3DJCA 5BREA 4EHUA 3L4IA 5BN9A 3CCVN 2NZTA 2QWMA 5GIOA 1GLAG 4G9ZA 3EZWA 3FFKB 2D11A 2HSTA 3GBTA 4NY0A 5EVZA 2FXUA 1JCEA 5AZIA 3GE1A 2QXLA 3KZBA 3P4IA 4KBOA 1RDUA 3DXMB 5M1FA 1Z6RA 2IVPA 4TKNA 4JAXA 4BGBA 4A5AA 5MLCQ 3A0IX 2BUPA 2NRVA 5AQJA 2IVOA 5C2DA 4E1JA 4JN4A 3SAGA 1YITN 1HLUA 4JKHA 5TKYA 2X0SA 2NRXA 3M5RA 5JMVA 3CQYA 1K9MO 4HDOA 3FGUA 3AAQA 4FOIA 3ID8A 4WYBA 5C10A 2QW9A 3HM8A 3BF1A 4FWKA 4H0PA 4M63C 3NVMA 4Z94A 3ENHA 4JKDA 5JVLA 4A57A 4GY2B 4WQ4A 4GVEA 4ZRKA 3A5NC 4WF9L 4P7IA 4JNEA 1GLDG 1SS6A 2GTDA 5I9EB 1VQ6N 2WBNA 3PIPL 2VCPA 2Q2RA 2W41A 3G25A 2HF3A 1Y64A 1NWKA 3VENA 1YIJN 3VF4A 1QVFM 3H46O 1NGFA 1VQNN 5TKWA 2EMSA 4JKFA 5BPLA 3MX2A 4FWPA 2GUPA 5BPMA 4YDUA 2P9PB 2COPA 1EO1A 2EMTA 3TTFA 3L0QA 5C2FA 3RVCA 3O1WA 1P90A 3QDKA 4ISFA 5M1PA 3SMPA 1HKBA 4IOAL 3QBXA 1NGAA 5BN8A 2VYPA 4CZKA 3TSPA 5C12A 5JVHL 1Q86O 1U6ZA 2E1ZA 3WXMB 4QS8A 1VQON 1BA1A 3CCUN 3WXKA 3LDQA 1HKGA 2P9NB 1VQPN 4EHTA 4PL8A 4BRGA 1QVGM 2Q97A 3QFPA 1H1VA 3CCEN 3Q7BA 1DKGD 1NBWA 4BG9A 1V4TA 1DEJA 3NMUA 5AQIA 1DIKA 3G71N 3W3DA 4WFNL 4CI6A 4H5NA 3W0LA 2HMPA 2I1KA 1Q81O 1MWKA 1TYQA 5AQOA 3VEYA 4BRCA 3RSEB 4Y0WA 4CD3A 1MDUB 3VTIA 3R9PA 5KPRA 1QQMA 5M1NA 3PVLA 2I7NA 4BVPA 5ADXA 1YF5L 1CZAN 4JKBA 3C0BA 3O9UA 1MK9B 2Q0RA 3JXUA 4BREA 4BR2A 4B1YB 3HOSA 4H5WA 4GXBA 4JK8A 3I33A 1R59O 3QBWA 3CC4N 4JD2A 1HX1A 2EWSA 3MMVA 1O13A 4AF1A 5AQMA 2A42A 4B9QA 3FP5A 3HOTA 4O5FA 5AQXA 3O5BA 1NGBA 2FF6A 4GV3A 2AEHA 3SJHA 5AZIB 4CBUA 1C0FA 4GV9A 4BVOA 3SBGA 3CXCM 1U2VB 5B8HA 2DPNA 3P39A 2I1JA 5AQLA 3UKRB 3H45C 5F2RA 2VGMA 4CZIA 2HRJA 2HOEA 2ASOA 4IFEA 3ZDTA 1V4SA 1EF1A 2PAVA 2W40A 4MDAA 1NJIO 4IJNA 3I55N 4CYEA 4FWLA 4BR0A 2ABDA 2GWKA 4H5RA 3HBTA 1YXQA 3IVFA 2D0OA 4QS9A 3U4LA 4GV6A 2AA4A 3LL3A 4OPHA 1VQ8N 3U9ZA 5AQZA 3SMSA 3LDOA 2HBKA 4FSVA 4ILGB 3VEXA 4DB3A 4M7XA 2ZWHA 4CBWA 4K43A 4H0TB 5BR9A 3AU4A 5JLHA 1LOTB 4FWRA 5M1OA 3PZDA 3O08A 4WQ5A 1NGEA 4I6MB 5C15A 1J19A 1RGIA 5CE3A 5M1QA 1YJ9N 1NTIA 4BRKA 4BRIA 2R82A 1OKJA 2VGNA 3FZKA 1ATNA 4H5VA 5ELZA 5AQKA 4BC5A 3VF6A 2GELA 3WQUA 4MLHA 1S3XA 2F9WA 3LM9A 5AQNA 5CR4A 1T44A 3CJ9A 4PKIA 3BEXA 5AQTA 3KK7A 4CZEA 2F7TA 4MO5A 1XQSC 1MIZB 1EQYA 3UE5A 5KPTA 3ULEB 3IDHA 1QZ6A 1NGHA 3O9RA 3PLAA 4DHYA 1U2VA 2NRHA 3CJ7A 2HBLA 1HB6A 1QHAA 3VEWA 4IDHA 3UKRA 5BRFA 4A2BA 3FZHA 1WUAA 2CH5A 4EFHA 3Q7CA 1TYQB 5AQRA 3TU5A 1T3VA 1NVLA 2AP1A 2D0PA 2CGJA 2P9LA 5HOOA 3E66A 3NVKA 4IOXA 3GOIA 1KBLA 3D2EB 3E1YA 4IXCA 3M3ZA 3CD6N 3ZX0A 4B1XB 5FPEA 5AQPA 4DQ8A 3G4SN 1VQ5N 1QQNA 2QA4N 2YX6A 3OW2M 4O8KA 5JICA 1MIXA 4HDQA 3EL2A 4JD2B 5DM6L 5LY3A 1JDEA 1KC7A 1KQSM 3CIPA 2HF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILG B;  4JKE A;  3SBT A;  4ILH A;  4JKF A;  3SBG A;  4JKH A;  4JKA A;  4JKG A;  4JKG B;  4JK9 A;  4ILJ A;  4JKB A;  3E66 A;  3ENB A;  4JKD A;  4JK8 A;  4JK7 A;  3E9P A;  3E9O A;  3E9L A;  4JKC A; 
#chains in the Genus database with same CATH topology
 3OA9 A;  1QSL A;  2J0K A;  1BA0 A;  1RCH A;  3M8P A;  3ALY A;  5HRS A;  1GG3 A;  3BZK A;  1MK7 B;  2GX9 A;  4JKG B;  1S1U A;  3TAQ A;  3OHR A;  1NJZ A;  5LJV A;  2P9I A;  3VEV A;  4RTF D;  3VQQ A;  1S1V A;  3PX6 A;  3P83 D;  3CCL N;  1P8Z A;  3ZT2 A;  4HCB A;  2J4R A;  3GL1 A;  3OJU A;  4BRH A;  1GLE G;  4DKW A;  5J2P A;  3HL8 A;  1VBG A;  4DMN A;  3PV8 A;  4A59 A;  3EKS A;  2CB8 A;  4BR4 A;  2DFF A;  4BR9 A;  4DUZ K;  1TKZ A;  3MCP A;  3CPW M;  2A41 A;  1X3N A;  3O8M A;  4GKJ K;  3MWP A;  1H4R A;  1BUP A;  3T7Z A;  5HBM A;  4H5T A;  3ZEU A;  4B3R K;  4AM7 A;  1BQM A;  2YHA A;  2D0C A;  2QWP A;  4FLW A;  3UKU A;  4C1N K;  3N4P A;  4C8O A;  3VQ7 A;  2RN2 A;  2FSJ A;  1X1P A;  3VGM A;  5EXW A;  1JCG A;  2BGG A;  1M90 O;  2HHV A;  4IJA A;  1S9G A;  4CFC A;  3V9Z A;  2WOM A;  3D6R A;  3C94 A;  4CGH A;  4BRM A;  4DFJ A;  4Q0B A;  2A5X A;  4JKC A;  1GLF O;  2NNW A;  1HNI A;  4F3T A;  3TSU A;  4BWM A;  4RW6 A;  1NMD A;  2I5J A;  1KTQ A;  4CJF A;  4FJL A;  4M42 A;  4PL7 A;  1K73 O;  1IKX A;  3KWG A;  3A5L C;  4O55 A;  4PKH A;  3VQ4 A;  3H1V X;  4YNQ A;  4W5T A;  3KKR A;  3OY9 A;  5CYM A;  2ZJR L;  1OH6 A;  4LF4 K;  2P9I B;  3O9Q A;  1HJR A;  2IDO A;  3ZET B;  1OVQ A;  1WOQ A;  1NK8 A;  3R8E A;  3L4Q A;  2HHT A;  4DV6 K;  1W2B M;  1M1K O;  1HPM A;  2HNZ A;  3WEE A;  4BRO A;  1HUX A;  4CBX A;  4CEA A;  4ILH A;  3V9U A;  1E4G T;  4DG1 A;  3V4I A;  1JL1 A;  2FSN A;  1RT6 A;  3NF8 A;  5FRM A;  1GLJ O;  3O80 A;  2YVC A;  2X6S A;  3SUO A;  1L5U A;  3LDN A;  2GEM A;  3TTD A;  4B1Z A;  4CJP A;  4IFV A;  4CZF A;  4I9Q A;  2E88 A;  2P9K B;  4C1N I;  4LFC K;  3HJF A;  4DU3 A;  1SZ2 A;  3LP1 A;  3ZEU B;  4XEI A;  1YTU A;  4M7Y A;  4JI5 K;  2OTJ N;  1SQK A;  1RIL A;  4KRE A;  3R3L A;  3ZX2 A;  2NRT A;  3EPY A;  1SV5 A;  3SK3 A;  4OKE A;  2HHS A;  4N76 A;  3ZT3 A;  3ASM A;  1D4X A;  3CMA N;  3VET A;  2E20 A;  2NRR A;  3K9K A;  3O6W A;  3CJC A;  4JI7 K;  3FZL A;  3PO5 A;  5BR9 A;  2A6A A;  4IFY A;  3SJJ A;  3K9J A;  3N4Q A;  3O1B A;  2HBM A;  2CQU A;  4H03 B;  3TPQ A;  4CF2 A;  4B9U A;  5DM7 L;  5AJ3 K;  4FM0 A;  3WUH A;  3CI5 A;  1GLB G;  3WA0 A;  2PBD A;  3MED A;  4FW2 A;  1TK0 A;  2G8I A;  5LJW A;  4NB4 A;  2UXD K;  3H1Q A;  1LAW A;  2B6A A;  3AAP A;  5GAH P;  4ICL A;  3WT0 A;  4CFD A;  4JI2 K;  1BL3 A;  2G8H A;  1YJW N;  4BC2 A;  1X3M A;  5AQW A;  2RF2 A;  3SPY A;  3CJ1 A;  4FXD A;  1VBH A;  5GAD P;  1IG8 A;  2RE2 A;  2E6M A;  5GIN A;  3I0S A;  5KTQ A;  3L8B A;  2A1R A;  1S9E A;  4K8X A;  2A3Z A;  1RBV A;  2WC9 A;  3DRS A;  4CCH A;  1MA9 B;  3DMJ A;  3OYC A;  2HW3 A;  2UUB K;  3T19 A;  1ESV A;  1S22 A;  5EY4 A;  4U7B A;  1J6Z A;  4A61 A;  2E2N A;  3THW B;  5F1X A;  1W7A A;  3AVH A;  2E2Q A;  4FZX C;  2GBZ A;  3AVJ A;  1HR0 K;  2KHO A;  1Y97 A;  5AQG A;  1WBB A;  3O9S A;  2AL6 A;  3CCR N;  4H0V B;  3CCQ N;  4ISE A;  1RTI A;  4BRN A;  3TR8 A;  4C23 A;  1VQ4 N;  1Q82 O;  2X74 A;  3SCX A;  4X64 K;  1YVU A;  1KAY A;  5KRS A;  3RMB A;  1HNV A;  3L6Q A;  4HWI A;  4DSL A;  4B08 A;  4BQZ A;  1IJJ A;  2HNY A;  4DLE A;  1IH7 A;  4WQ4 C;  1VAZ A;  4QS7 A;  4FWS A;  1LW2 A;  4LC9 B;  4M3T A;  1HKC A;  1SKR A;  4KH5 A;  5AQQ A;  3ZT1 A;  1RTD A;  3VN5 A;  4YDU C;  5AQH A;  5BRD A;  2F8S A;  4OPA A;  2LSN A;  3SQ0 A;  3P5J A;  4FM1 A;  2HBJ A;  3R1X A;  3QIN A;  3KVG A;  3ATU A;  4B1U B;  1T6C A;  1WNS A;  1TUY A;  2BH1 A;  3B8A X;  2J0J A;  3C65 A;  3AGR A;  3TAR A;  1Z25 A;  3AVG A;  1VSH A;  1S5J A;  3F9M A;  4YOX A;  3DJC A;  4DV2 K;  1C6V A;  3B6P A;  2QWM A;  2HVI A;  1TL1 A;  2FXU A;  3PUF A;  5AZI A;  3B6O A;  4DTP A;  2PZS A;  4FJN A;  4Z4C A;  1ASW A;  2ZM6 K;  1Z6R A;  3IG1 A;  2IVP A;  3FFI A;  3HYF A;  3V1O A;  4Q5V A;  4A5A A;  1SL2 A;  4LF9 K;  3AO1 A;  2BUP A;  5AQJ A;  1G15 A;  2IVO A;  4LF8 K;  3M5R A;  2D0A A;  4CGG A;  3CQY A;  4AHR A;  1K9M O;  3FGU A;  4WYB A;  2QW9 A;  4JKD A;  5JVL A;  4GY2 B;  4ZRK A;  4WF9 L;  2GTD A;  2WBN A;  2VQE K;  3PIP L;  2W41 A;  3G25 A;  4B9L A;  5T7B A;  5TKW A;  5BPL A;  4JKF A;  3PX4 A;  1SKW A;  5BPM A;  4O44 A;  1HQE A;  1HYV A;  2O4G A;  4IOA L;  1P90 A;  4CJL A;  3QES A;  1HKB A;  2VYP A;  4DLG A;  4PA1 A;  3V1R A;  3AA2 A;  3MEE A;  1BA1 A;  3K5N A;  3CCU N;  4FLY A;  4OGC A;  4JS5 A;  4M3Y A;  2P51 A;  4EHT A;  1VQP N;  2G8W A;  3BY5 A;  1KFS A;  1NOZ A;  3CCE N;  3Q7B A;  1I39 A;  3RRH A;  5J1E A;  4H5N A;  2HMP A;  2I1K A;  3KJV A;  5AQO A;  2O8B B;  4BRC A;  1MDU B;  3K5M A;  2YNH A;  5M1N A;  4GVM A;  5CZ1 A;  1NK9 A;  3C0B A;  2YHB A;  3O9U A;  1KVC A;  1MK9 B;  1WSF A;  4E7I A;  3PSI A;  4H5W A;  4CJU A;  4JK8 A;  4E7L A;  1R59 O;  4AHV A;  4BE1 A;  3CC4 N;  4X62 K;  4JD2 A;  4CJR A;  4W5O A;  4O5B A;  3FP5 A;  1N5Y A;  4JI0 K;  3AVA A;  2VG5 A;  1TVR A;  1NGB A;  2AEH A;  3ULD A;  4KTQ A;  5AZI B;  5FLX O;  1C0F A;  3DOL A;  4JRQ A;  1ZBI A;  1U2V B;  3P39 A;  3TAG A;  5F2R A;  3BDP A;  1X9M A;  3DLH A;  4B9T A;  4DFP A;  2W40 A;  3OJS A;  4FWL A;  3KLH A;  2W42 A;  1L3U A;  1EWQ A;  1RBR A;  2PYJ A;  4FZZ A;  3U4L A;  5HRR A;  3V1Q A;  3U9Z A;  3LDO A;  1VSE A;  3VEX A;  4CIG A;  4H0T B;  1LOT B;  3VQP A;  4WQ5 A;  4Y1D A;  1C1C A;  5HRP A;  3THV A;  4KTW A;  3P1G A;  1VSM A;  4BRK A;  1OKJ A;  2VGN A;  3FZK A;  4BC5 A;  3ZCM A;  3QIP A;  2F9W A;  1XNR K;  4CFB A;  1T44 A;  3HPO A;  3LPT A;  4MQ3 A;  4MO5 A;  4HHT A;  1Q8I A;  3PLA A;  1QSS A;  3IDH A;  1QZ6 A;  3O9R A;  1YTA A;  4KB0 A;  4LH4 A;  4KV8 A;  4IDH A;  4FLX A;  3FZH A;  1SKS A;  3Q7C A;  3QEP A;  4CEF A;  1VRU A;  1RBU A;  2Z1J A;  4JI1 K;  3GOI A;  3SV3 A;  3E1Y A;  2GV9 A;  3ZX0 A;  5FPE A;  5LMU K;  2HHW A;  5AQP A;  4HUG A;  2QA4 N;  1MIX A;  4JD2 B;  1U4B A;  4FLV A;  2ZPY A;  3MCA B;  2Z1I A;  1LWF A;  2V52 B;  3TAM A;  4YOT A;  4FZY A;  4IO8 A;  3VEZ A;  5BRH A;  4I6M A;  1IO2 A;  1NM1 A;  3K58 A;  5FPM A;  3VEO A;  4EKU A;  4B1V A;  2Y1J A;  1NKB A;  3CET A;  2CGL A;  1E5W A;  1C0G A;  5JLF A;  1NGI A;  1NGD A;  2QWQ A;  2ZF5 O;  3VQ6 A;  5KQ8 A;  5HRN A;  4Y1C A;  2YKN A;  3AVF A;  3S3O A;  2R7Y A;  3ZLJ A;  3PSF A;  3NCI A;  1RT4 A;  1BIZ A;  3QFU A;  3ULE A;  3K0S A;  1ZBF A;  3M8Q A;  5JS2 A;  3MK6 A;  3T1Y K;  3P31 A;  3GDQ A;  4FLT A;  3AAR A;  2Q31 A;  4DR5 K;  1JLE A;  3L2Q A;  3JSM A;  4MFB A;  5IJM A;  4B9M A;  2KKZ A;  2V7Y A;  4E89 A;  1C0T A;  2D1K A;  5EX5 A;  3CF5 L;  1GOC A;  1FJG K;  5HL7 L;  1OH7 A;  3TAP A;  1N34 K;  1MU2 A;  5C0Y A;  4FJ8 A;  2DIK A;  4KRF A;  3HST B;  1SGH A;  4H0O A;  1NJW A;  3TAF A;  2O8F B;  4K41 A;  5AFU A;  4JKG A;  4DV5 K;  3J8A A;  3HRG A;  4B3O A;  4BRF A;  1FKO A;  4DR2 K;  4JK7 A;  3HP6 A;  1DT9 A;  3VOV A;  4ELT A;  3M8S A;  2P5O A;  3VMF B;  4HUE A;  1RFQ A;  4FJI A;  4CFA A;  2QWO A;  2ITM A;  3MDQ A;  4E0D A;  4O0J A;  2NUB A;  5CYQ A;  4CW7 B;  2UUC K;  3CFR A;  4YOR A;  3F73 A;  1RDB A;  4AM6 A;  4CJ7 A;  4DTU A;  1WSJ A;  3ENB A;  3AVN A;  3SYZ A;  4CIE A;  1BU6 O;  1ZC6 A;  5HP1 A;  3V81 A;  4CZG A;  4CGD A;  4H0X B;  3K57 A;  4PWD A;  3IMX A;  3MEG A;  5AZJ A;  4HTU A;  3QIJ A;  1XC9 A;  4M3R A;  5AQF A;  3G6E N;  1RTH A;  4Z0U A;  4CHN A;  4JHD A;  1W97 L;  1I3A A;  3DI6 A;  3CJB A;  3MN9 A;  1FW6 A;  4IO9 L;  2UUA K;  2DTU A;  1SL0 A;  3OS1 A;  3O3F A;  4JK9 A;  4CGF A;  4GMJ B;  3HTV A;  1IV0 A;  3PIO L;  1HBK A;  4YOW A;  3J7A P;  3VGL A;  1LWC A;  1KAX A;  1ZBS A;  1N8R O;  1TAQ A;  4CF1 A;  5DK5 A;  5HRO A;  4L8R B;  3C7N A;  1E4F T;  3U3Y A;  4B9N A;  4H4M A;  1GLL O;  1SAZ A;  2P9U A;  2YNI A;  1Z26 A;  4DFM A;  3C6U A;  5BR8 K;  4N41 A;  4LD0 A;  4K42 A;  4CJS A;  1L3V A;  3R6M A;  3FZM A;  3ZET A;  3DM2 A;  1B9F A;  5KRT A;  3ITH A;  3DOK A;  2CH6 A;  2FDQ A;  4DR7 K;  2F9T A;  3LAL A;  1RDA A;  2EX3 A;  5DMR A;  3LDS A;  4Z4H A;  4M41 A;  1S1T A;  3GG4 A;  1BG3 A;  4JKA A;  3NAE A;  4ZTJ A;  4NCG A;  3KIO A;  3A8Y A;  2D2Q A;  2Q3S A;  2YHY A;  2XRI A;  3SAH A;  4FJJ A;  2P9K A;  3MN6 A;  2YCH A;  2HHU A;  4L3Q A;  3DXM A;  4H8K A;  3SQ4 A;  5AZJ B;  3ZSX A;  4FCY A;  4CF0 A;  1U49 A;  3OBW A;  2VWK A;  4BDZ A;  4JHD B;  2D0B A;  2GWJ A;  3T1A A;  1Z05 A;  4FWO A;  1FKP A;  2QWN A;  4FWM A;  5JVG L;  1J53 A;  3ZYY X;  4DR4 K;  5ADX H;  1TGO A;  2JGU A;  1L3T A;  1TAU A;  4NLB A;  3EKU A;  3HSC A;  2FSK A;  4FPA A;  1W9H A;  2FBT A;  3CC2 N;  3PO4 A;  3ID6 A;  1GGO A;  4BY9 C;  3C7N B;  2IIR A;  1XHZ A;  4DQR A;  3CC7 N;  3K59 A;  2A1S A;  2P9U B;  4BE0 A;  4CGI A;  2Q36 A;  4LSN A;  5AFU H;  2OPR A;  4CER A;  4UY8 O;  2XY5 A;  4AHS A;  2WH5 A;  4CJT A;  4PHT X;  4FK2 A;  2GUI A;  2HMI A;  4LFB K;  3VQC A;  5AQY A;  3D0P A;  1YHQ N;  4JKE A;  1XI1 A;  2WUS A;  3H3N O;  2ZQB A;  2OTL N;  3D7E O;  4FJ7 A;  5CHI A;  1XWL A;  1QTM A;  5AQU A;  1CZB A;  3O9T A;  4MO4 A;  1ZYQ A;  4FJM A;  3THW A;  4EZ9 A;  4M3U A;  1QQO A;  2JWK A;  3SNN A;  4F7G A;  1KLN A;  2E6L A;  4FPB A;  4JEP A;  3EZ5 A;  1IKV A;  4DQP A;  3U3G A;  5BN9 A;  3CCV N;  2HHQ A;  4G9Z A;  3GBT A;  5LMN K;  1QSY A;  5EVZ A;  1DTQ A;  2QXL A;  3DXM B;  3SUP A;  5M1F A;  3NGI A;  4JAX A;  4HVJ A;  3A0I X;  4CJ5 A;  2NRV A;  4CK2 A;  3NGZ A;  3SAG A;  4J2A A;  3KTQ A;  1HLU A;  1XHX A;  4JKH A;  2KTQ A;  2OA8 A;  5TKY A;  2X0S A;  4KHN A;  4HDO A;  3AAQ A;  3ID8 A;  5C10 A;  2F4V K;  4QCL A;  4RW9 A;  2P1J A;  4A57 A;  2E4L A;  4CJ3 A;  4P7I A;  4JNE A;  1GLD G;  5I9E B;  2BDP A;  2HF3 A;  1NK6 A;  1NWK A;  3OVN A;  1NGF A;  1VQN N;  2EMS A;  3QEI A;  2GUP A;  1TKD A;  4B9S A;  2F96 A;  4CHY A;  3AA5 X;  1N32 K;  2ZD1 A;  3KLF A;  4PUO A;  3QDK A;  4ISF A;  1KSP A;  4EP5 A;  3LAK A;  4FK0 A;  5JVH L;  1Q86 O;  2FBV A;  1D5A A;  1D9D A;  4KHS A;  4LY7 A;  1HKG A;  1QQC A;  3L3V A;  1RNH A;  3AVM A;  5C25 A;  1FK9 A;  5A2Q O;  1DIK A;  3G71 N;  3KK1 A;  4CGJ A;  2OPS A;  3VEY A;  4CJE A;  4DQS A;  5C42 A;  4CD3 A;  3VTI A;  4B9V A;  1U47 A;  2I7N A;  1YF5 L;  1N6Q A;  3JXU A;  4B1Y B;  3RMA A;  4GW6 A;  3NH0 A;  3QBW A;  1NK0 A;  3MMV A;  3H08 A;  1NOY A;  1E3M A;  2FF6 A;  4GV3 A;  3VA0 A;  4BVO A;  3SBG A;  4KHP K;  2I1J A;  3UKR B;  1S1W A;  3H45 C;  2VGM A;  3CQ8 A;  4CZI A;  3ZDT A;  1QHT A;  4MDA A;  4F2S A;  3AVI A;  4CYE A;  1RT1 A;  4I9L A;  4E3S A;  3HBT A;  1YXQ A;  2D0O A;  4GV6 A;  4IDK A;  1UA0 A;  3SMS A;  1KVB A;  3ISN C;  3QLH A;  3THX B;  1D9F A;  2ZWH A;  4CBW A;  4K43 A;  3HPH A;  1OH8 A;  2QKB A;  3AU4 A;  5JLH A;  2O8B A;  5M1O A;  3MXM A;  1NGE A;  5CE3 A;  2DY4 A;  5M1Q A;  5J2Q A;  1NTI A;  4CJQ A;  4BRI A;  3TAE A;  2AJQ A;  5ELZ A;  1ATN A;  4H5V A;  3VF6 A;  1JLQ A;  3WQU A;  1S3X A;  3LM9 A;  4RW7 A;  3L2W A;  4PKI A;  3BEX A;  3SQ2 A;  3KK7 A;  1HYS A;  1XQS C;  2YV0 X;  4O0I A;  1MIZ B;  3OS0 A;  3MAQ A;  1U2V A;  1I94 K;  1K6Y A;  4CK3 A;  3SV4 A;  2CH5 A;  2XY7 A;  4ELV A;  2P9L A;  5HOO A;  3NVK A;  2HHH K;  3D2E B;  4IXC A;  3M3Z A;  4B1X B;  3G4S N;  1HRH A;  5DM6 L;  5LY3 A;  1KQS M;  4FJX A;  1KRP A;  4GKK K;  2PFU A;  2OPP A;  2G8U A;  4NXM K;  3WNE A;  1NG9 A;  3DXK A;  3D2F A;  2QXF A;  1WB9 A;  1DTT A;  4MLE A;  3G0Z A;  3I55 N;  3BIN A;  1HNX K;  4ELU A;  2E2P A;  1J5O A;  3KLI A;  2EHG A;  4ISG A;  2HND A;  4OVL A;  5E84 A;  2RHK A;  3WXI A;  3ZSW A;  3WQT A;  4KHU A;  4BC4 A;  3E9O A;  3VQD A;  1TKT A;  3AA3 A;  5I3U A;  1NJX A;  1IG9 A;  2LBB A;  1ILY A;  4C8N A;  1ST7 A;  4K0K K;  1OVY A;  1HQU A;  4DSF A;  3VQE A;  3RRG A;  4EP4 A;  1UA1 A;  3HM9 A;  4H0Y B;  4ILJ A;  5IT9 O;  3MWT A;  2QWR A;  3C95 A;  2IVN A;  2ZJP L;  4DV7 K;  3CME N;  1JXE A;  2YJF A;  3SLC A;  4CF8 A;  2D4W A;  3LWL A;  2BE2 A;  1UAX A;  1RTJ A;  1T6D A;  3JS6 A;  5GIP A;  2IGI A;  4JV5 K;  3THY A;  2NLX A;  2RPI A;  2QM1 A;  2P9S B;  3K5L A;  1YVN A;  4IZ9 A;  3HVT A;  3I8B A;  4DCH A;  4Z4E A;  5KPZ A;  5J2M A;  3U8X A;  1QZ5 A;  2E5L K;  2P9L B;  4YHH K;  4YOY A;  1Q18 A;  1MWM A;  4BAC A;  2ASP A;  2O8E B;  3V9W A;  2H3G X;  3LDP A;  4DV0 K;  4KAZ A;  3E9L A;  4DTR A;  1LAV A;  3DLL L;  4XH1 A;  1KXP A;  5KGX A;  4NO7 A;  1ACA A;  3AO2 A;  3V6D A;  5FRO A;  5AQV A;  2QI2 A;  4NYF A;  1WAJ A;  5AQS A;  3SUN A;  4NLC A;  3VQB A;  3VQA A;  3DXK B;  3D2F B;  2O8C B;  4DS4 A;  4BC3 A;  3CER A;  3VTH A;  3OTO K;  1K8K B;  1GOA A;  4FOE A;  3BF3 A;  1J54 A;  4N56 A;  3OYJ A;  1CXU A;  1NGC A;  3J7Y P;  2O8D B;  4FM2 A;  3FLC O;  1BHL A;  1NU0 A;  1IBL K;  4RW4 A;  2FF3 B;  3L2V A;  4CJ4 A;  2O8F A;  3ZSZ A;  2UYT A;  4LFA K;  3DLE A;  1D8Y A;  4FLU A;  3AVK A;  3MXI A;  1IBM K;  4BRP A;  1ATS A;  3HPG A;  1NGG A;  3CHW A;  3ZX3 A;  4DU1 A;  4E7K A;  3NE6 A;  4J2B A;  5BPN A;  4F9O A;  3J81 O;  1NLV A;  4BWJ A;  4CF9 A;  4ID1 A;  2W6L A;  2VWB A;  3VPZ A;  4CZJ A;  3I0R A;  4DS5 A;  3THY B;  1WSH A;  1ATR A;  3OYD A;  4CJW A;  4CJV A;  2V51 B;  1GC7 A;  2A40 A;  4DTM A;  4IWV A;  3QIC A;  3G10 A;  2ZGY A;  3OYI A;  3EN9 A;  3KD1 E;  3P38 A;  1GOB A;  4NCA A;  4BGA A;  5EOY A;  1U45 A;  1BGX T;  1EX4 A;  1LV5 A;  1ISN A;  4A2A A;  4DV1 K;  4F8R A;  3HI0 A;  3QO9 A;  1JLG A;  3DRP A;  4WFA L;  4W5Q A;  4OO1 J;  3A5M C;  4WE1 A;  1N33 K;  4CEO A;  1EP4 A;  2E1Y A;  3U7D A;  3CPE A;  4BG8 A;  2ITG A;  4KHQ A;  3C6A A;  3L3U A;  4FWQ A;  2QTD A;  4DR6 K;  4XIU A;  1L3S A;  1VHX A;  4FJG A;  3DWL A;  4CHZ A;  3WXL A;  3D45 A;  4ZHR A;  3AA4 A;  4BR5 A;  1T7P A;  3EE9 A;  3BGR A;  3EE8 A;  2HE7 A;  4PKG A;  2YNG A;  1RDC A;  4E19 A;  3SAF A;  3DLB A;  4M3Z A;  3I56 N;  1LCU A;  4OJR A;  3QEX A;  1R0A A;  3U9D A;  3AV9 A;  3WXJ A;  3J7Z O;  1O1W A;  4FJK A;  4XH4 A;  2BTF A;  3TWH A;  3ZSQ A;  3AU5 A;  1XC3 A;  3NF7 A;  4I2Q A;  1VRT A;  2NRW A;  3KKS A;  3SI6 A;  1S1X A;  5SWM A;  4BR7 A;  1XNQ K;  2CGK A;  3QNN A;  4EIA A;  4W5R A;  4B3T K;  4CE9 A;  1WBD A;  4OX9 K;  2QWL A;  4CZH A;  4A62 A;  5KQD A;  3TSQ A;  3AVB A;  3SBT A;  1K8A O;  2P9P A;  2OYQ A;  1X9W A;  3CCS N;  1BO5 O;  1HJO A;  4FJH A;  5H1S Q;  4U67 L;  1VSJ A;  3MN7 A;  3MEC A;  4DUY K;  2RQ1 A;  4B3M K;  2YHW A;  2ZJQ L;  3EO3 A;  3OYF A;  2P9N A;  1VSF A;  2IAJ A;  3ZT4 A;  2E8A A;  1Q9Y A;  3NBP A;  1TV6 A;  3EYZ A;  1S6P A;  3UB5 A;  1XUP O;  4HCC A;  3O4W A;  3RSE A;  3MN5 A;  3BZC A;  4LH5 A;  3WNF A;  3HXM A;  3OBY A;  3LZJ A;  2Q0U A;  3M1F A;  3NF6 A;  4FVM A;  1IBK K;  3K5O A;  2HHX A;  5JS1 A;  4MDB A;  4BDY A;  3M8R A;  3IFR A;  1NK4 A;  1X9J A;  3FR0 A;  4I7F A;  3QNO A;  5BRE A;  1A5W A;  3DRR A;  4CJK A;  2W6K A;  2NZT A;  1GLA G;  3EZW A;  3FFK B;  3O4N A;  4NY0 A;  3V9X A;  3GE1 A;  4KBO A;  3P4I A;  3AVL A;  1KCF A;  1LWE A;  4DU4 A;  4CEQ A;  5C2D A;  4KI4 A;  4E1J A;  4JN4 A;  4OLA A;  2NRX A;  1EXQ A;  1C0U A;  3HM8 A;  3BF1 A;  4FWK A;  4H0P A;  4Z94 A;  4NCB A;  2Z1G A;  3RR7 A;  1ITG A;  2KZM A;  4KO0 A;  1SS6 A;  1VQ6 N;  2VCP A;  2Q2R A;  1QS4 A;  3IRX A;  3L2R A;  4B8C A;  2FBX A;  3VEN A;  4M45 A;  3VA3 A;  3VF4 A;  4DSJ A;  3H46 O;  1U48 A;  3U6F A;  3V9S A;  2VQF K;  3LAM A;  4FWP A;  1TK5 A;  4E1M A;  2P9P B;  2COP A;  3AO3 A;  3S3N A;  1EO1 A;  4Z4I A;  3TTF A;  3L0Q A;  5C2F A;  2XHB A;  3SMP A;  3QBX A;  1NGA A;  1NK7 A;  3IAY A;  3TSP A;  3QIO A;  4AH9 A;  2E1Z A;  5J2N A;  3WXK A;  3LDQ A;  4JS4 A;  2P9N B;  3QER A;  4BRG A;  1H1V A;  5IWA K;  4AIL C;  1DKG D;  3QET A;  1NBW A;  3RMC A;  1V4T A;  5AQI A;  2B5J A;  5EU7 A;  3W3D A;  4DR3 K;  4DSI A;  1Q81 O;  1J9A A;  1MWK A;  3WNG A;  3RSE B;  1BQN A;  3R9P A;  5KPR A;  3PVL A;  4JKB A;  2Q0R A;  4BRE A;  4BR2 A;  4CEE A;  4B8A B;  1HX1 A;  1O13 A;  4AF1 A;  5K14 A;  4B9Q A;  2UXB K;  2G8F A;  3HOT A;  3O5B A;  4OKJ A;  4DTX A;  3SJH A;  4CBU A;  3S3M A;  4GV9 A;  1B9D A;  3CXC M;  4FJ5 A;  5B8H A;  2DPN A;  1IKY A;  5AQL A;  2HRJ A;  1RBS A;  3OS2 A;  1V4S A;  1EF1 A;  1WAF A;  4E1N A;  4M3W A;  4I2P A;  4EZ6 A;  2YNF A;  3LP2 A;  4FYD A;  3CM5 A;  2GWK A;  3IVF A;  1B92 A;  1JXB A;  2DFE A;  1JLC A;  4KPY A;  2AA4 A;  5D3G A;  4OPH A;  4FSV A;  4M7X A;  2IC3 A;  3OYL A;  2BAN A;  3OYB A;  2DFH A;  1NK5 A;  1F21 A;  3DYA A;  3SZ2 A;  1T03 A;  4AHT A;  1YJ9 N;  4JI3 K;  4DQQ A;  1TKX A;  4DQI A;  2GEL A;  1XMO K;  4KHW A;  5AQN A;  1HPZ A;  3CJ9 A;  5AQT A;  1VK0 A;  2OCE A;  3O4Q A;  1EQY A;  5KPT A;  3NFA A;  1NGH A;  4DHY A;  4N5S A;  2HBL A;  4KKO A;  3T1H K;  3UKR A;  2OZM A;  4A2B A;  4BDP A;  5AQR A;  1T3V A;  3ZT0 A;  1U04 A;  2UU9 K;  1NVL A;  1J5E K;  2CGJ A;  3AO4 A;  4IOX A;  3OYE A;  1KBL A;  2ZE2 A;  4AQY K;  3QEV A;  1QQN A;  2ATQ A;  4NXN K;  3OW2 M;  4O8K A;  5JIC A;  4C8K A;  4HDQ A;  1N36 K;  1KC7 A;  4IG3 A;  1CXQ A;  3THX A;  1RT5 A;  3ENO A;  4E7H A;  3UKU B;  4DSK A;  2FJ9 A;  1NNE A;  4OPK A;  5GAG P;  1BOT O;  2OPQ A;  4CEB A;  4OGE A;  1G99 A;  2OAN A;  1JLA A;  4OKK A;  2UXC K;  4JLH A;  4KB1 A;  4DWI A;  4JI4 K;  4KHY A;  1QE1 A;  1BCM A;  1DGK N;  1VSD A;  3CFO A;  4G1Q A;  1XMQ K;  4JYA K;  5CZ2 A;  4IEE A;  4WQ5 C;  3OYG A;  3BUZ B;  3HO1 A;  3EEQ A;  5F0X A;  4QOZ B;  1VSK A;  3HP9 A;  4BRQ A;  4C8M A;  1HNZ K;  3D2E A;  4YOV A;  4W5N A;  5FDL A;  2YJE A;  1ZXO A;  3A2F A;  1BIS A;  3WEE B;  3VF2 A;  4DFK A;  1VQK N;  3T3F A;  4LSL A;  4CD1 A;  1KAZ A;  1Q7Y O;  1VQ9 N;  4DV4 K;  1C0M A;  4GNI A;  1JCF A;  3U8Z A;  3OYH A;  1BCO A;  2NRZ A;  1HNW K;  3KD5 E;  2V7Z A;  3X23 A;  4IOC L;  4FVU A;  2WON A;  3E9P A;  4K8Z A;  4J8F A;  3PY8 A;  4FW1 A;  3LAN A;  3RWU A;  1WLJ A;  2XO7 A;  2IOC A;  4DF4 A;  4FO0 A;  1KFD A;  4R79 A;  3CQX A;  3G9W A;  3VER A;  3LWM A;  4CHQ A;  4DSE A;  4BRL A;  1JL2 A;  4KH4 A;  4B1W B;  4CZL A;  1TK8 A;  3BP8 A;  5C24 A;  2FLO A;  4YOU A;  3NH1 A;  3M6G A;  4CK1 A;  3MX5 A;  5FPD A;  4IBN A;  2FBY A;  1UOC A;  4FLZ A;  4PQU A;  4DTS A;  3HZ6 A;  1RDD A;  2P9S A;  3JAM O;  1GLC G;  1ZBU A;  1YI2 N;  1YUW A;  2HB5 A;  4RWT A;  2XY6 A;  1DLO A;  4PY5 A;  2OZS A;  3H3O B;  2XY8 A;  3LDL A;  1YJN N;  4FK4 A;  1SL1 A;  4ZRI A;  5HLF A;  1C1B A;  4B3S K;  1NI2 A;  3A5O C;  3C6H A;  1RT3 A;  1VQ7 N;  2O8E A;  4AHU A;  1A5X A;  1RT7 A;  4UQG A;  3ZSV A;  2Z1H A;  4WCE L;  3K2P A;  3VQ9 A;  1NJY A;  3F2K A;  4DF8 A;  1IKW A;  3FLV A;  4BRD A;  5GAE P;  4ZTF A;  3C6T A;  4Z4F A;  1SUQ A;  1X9S A;  3AY9 A;  1FXX A;  1HB8 A;  4JI8 K;  3FZF A;  4LF7 K;  2O8C A;  2PY5 A;  3VQ5 A;  1YAG A;  3CCJ N;  3S9H A;  1Q9X A;  2QEX N;  4BR0 A;  5GIO A;  1EET A;  1K8K A;  3L2U A;  2WTU A;  2VWJ A;  3HVR A;  3DAW A;  3H6E A;  3VGK A;  4YY3 K;  2O8D A;  2YI1 A;  2I7P A;  4RCH A;  1ZBL A;  3TTC A;  2ETJ A;  3RR8 A;  2KLA A;  3CCM N;  3SQ1 A;  5AR0 A;  1RDW X;  1W0H A;  3LM2 A;  3IUC A;  1TUU A;  3FE1 A;  3TI0 A;  5M1K A;  3IS9 A;  1S6Q A;  1EKE A;  2WFB A;  4EAH D;  3MXJ A;  4ZRJ A;  2D5R A;  2ASM A;  3LP0 A;  4HUF A;  4IEI A;  1VQM N;  3F5T A;  3KK2 A;  3CJA A;  3NF9 A;  2ZGZ A;  2QKK A;  1GC6 A;  3KHY A;  1S72 N;  3CFP A;  1Y19 B;  4DXA B;  2E2O A;  3LP3 A;  4IG0 A;  1WSI A;  3IKM A;  5E26 A;  2G8K A;  3VES A;  2QK9 A;  4Z4G A;  4DTJ A;  2JWL A;  4FL9 A;  3NH2 A;  4DV3 K;  4J2E A;  3OYN A;  1KD1 O;  1NGJ A;  2D10 A;  4CHO A;  2J0M A;  3AGK A;  2Y1I A;  4CIF A;  5KGW A;  4WFB L;  1JKH A;  3LZI A;  3RMD A;  3AO5 A;  4K25 A;  2G8V A;  4F3O A;  2FC0 A;  2YHX A;  4KTZ A;  4KH6 A;  4YL8 A;  3UIQ A;  5E41 A;  2VG6 A;  1BDG A;  4BRA A;  3ATV A;  1JLF A;  3QML A;  4A5B A;  4RG8 A;  4FWN A;  3HK2 A;  1OH5 A;  3QB0 A;  3KWI A;  4HTL A;  3J80 O;  3EY1 A;  3DLG A;  1KC8 O;  1BWF O;  3NHG A;  1T05 A;  4CZM A;  1BI4 A;  1JJ2 M;  1TL3 A;  1NMN A;  4O8U A;  4BQL A;  3T69 A;  1VQL N;  5FPN A;  3S41 A;  4J2D A;  4XH5 A;  4CEZ A;  3AVC A;  1BIU A;  4NYN A;  4DR1 K;  2Q1N A;  1C1A A;  3OYA A;  3RTV A;  4EHU A;  3L4I A;  3TAB A;  2D11 A;  2HST A;  1JCE A;  3ZSY A;  4E7J A;  1ASU A;  3E01 A;  1VSL A;  3KZB A;  1RDU A;  5SZT A;  4TKN A;  4BGB A;  5MLC Q;  3ZSO A;  3KLE A;  1NKC A;  1YIT N;  3VQ8 A;  2O4I A;  5JMV A;  4FOI A;  5CY4 A;  1ZBH A;  3DLK A;  4M63 C;  3NVM A;  3ENH A;  4CEC A;  4WQ4 A;  4GVE A;  3A5N C;  1T8E A;  4YFU A;  1JLB A;  2X78 A;  3CYM A;  1Y64 A;  3DLR A;  1YIJ N;  1QVF M;  3MX2 A;  4YDU A;  4X65 K;  4N47 A;  2EMT A;  1KLM A;  2PYL A;  2B4J A;  3RVC A;  3O1W A;  4F2R A;  5M1P A;  2KFN A;  3PX0 A;  3LPU A;  4OPJ A;  5BN8 A;  4CZK A;  5C12 A;  1U6Z A;  3JYT A;  3WXM B;  4QS8 A;  1VQO N;  3I8D A;  4OLB A;  4PL8 A;  5I42 A;  1QVG M;  2Q97 A;  3QFP A;  3OYM A;  2KFZ A;  3ZSR A;  4BG9 A;  3NMU A;  1DEJ A;  1HMV A;  4WFN L;  4CI6 A;  4IKF A;  3W0L A;  1TYQ A;  4Y0W A;  4C8L A;  2KZZ A;  3F9K A;  1BI4 B;  1QQM A;  2P5G A;  4BVP A;  5ADX A;  1CZA N;  3HOS A;  3O3G A;  4GXB A;  3OYK A;  3I33 A;  4X66 K;  4RW8 A;  2EWS A;  4LF5 K;  2YKM A;  5AQM A;  2A42 A;  4BE2 A;  4O5F A;  5AQX A;  3QEW A;  2X6N A;  4KI6 A;  3KK3 A;  4FJ9 A;  1KVA A;  1RT2 A;  1YT3 A;  3NGY A;  5LL6 Z;  2HOE A;  2ASO A;  4IFE A;  3WNH A;  4O4G A;  2PAV A;  1HYZ A;  4ID5 A;  1ASV A;  1NKE A;  1NJI O;  4IJN A;  5KI6 A;  2VG7 A;  4TSX A;  2HVH A;  2ABD A;  4AHC A;  4H5R A;  4QAG A;  4CHP A;  2IS3 A;  4CED A;  1WSG A;  4QS9 A;  1LW0 A;  2KW4 A;  3LL3 A;  1VQ8 N;  2RKI A;  5AQZ A;  5FRN A;  2HBK A;  4ILG B;  4R5P A;  4DB3 A;  4F4K A;  3SPZ A;  4FWR A;  4M3X A;  3PZD A;  3O08 A;  4I6M B;  4CES A;  3CG7 A;  1J19 A;  1RGI A;  5C15 A;  4KFB A;  1WN7 A;  4CVN E;  4DTN A;  4LF6 K;  2R82 A;  3SUQ A;  2JLE A;  3CM6 A;  5AQK A;  1A5V A;  4DTO A;  2KQ2 A;  4MLH A;  4JI6 K;  5CR4 A;  3HT3 A;  3KLG A;  4CZE A;  2F7T A;  3NDK A;  3UE5 A;  3ULE B;  1WSE A;  2NRH A;  3O3H A;  3CJ7 A;  2F8T A;  1HB6 A;  1QHA A;  3VEW A;  5BRF A;  4V19 S;  1WUA A;  4EFH A;  1CLQ A;  3TAN A;  3TU5 A;  1TYQ B;  4JRP A;  1CZ9 A;  2AP1 A;  2D0P A;  1VSI A;  3E66 A;  3CD6 N;  1REV A;  4DQ8 A;  1VQ5 N;  4H4O A;  1UWB A;  1EWR A;  2YX6 A;  3EL2 A;  1JDE A;  1RBT A;  3CIP A;  2HF4 A; 
#chains in the Genus database with same CATH homology
 3OA9 A;  2J0K A;  2ZPY A;  1BA0 A;  3ENO A;  3MCA B;  3UKU B;  2V52 B;  2FJ9 A;  2PFU A;  4YOT A;  5GAG P;  1BOT O;  4IO8 A;  1GG3 A;  3VEZ A;  4I6M A;  5BRH A;  1MK7 B;  1NM1 A;  5FPM A;  1G99 A;  3VEO A;  4EKU A;  2GX9 A;  4JKG B;  2OAN A;  3DXK A;  3D2F A;  3OHR A;  4B1V A;  5LJV A;  3CET A;  2CGL A;  2P9I A;  1E5W A;  4MLE A;  1C0G A;  4RTF D;  3BIN A;  1NGI A;  1NGD A;  2E2P A;  2QWQ A;  2ZF5 O;  3VEV A;  5JLF A;  4ISG A;  1DGK N;  5E84 A;  2RHK A;  3WXI A;  5KQ8 A;  3CCL N;  3WQT A;  1P8Z A;  4BC4 A;  3QFU A;  3E9O A;  2J4R A;  3GL1 A;  3ULE A;  4BRH A;  1GLE G;  4DKW A;  4IEE A;  2LBB A;  4WQ5 C;  3BUZ B;  1VBG A;  3MK6 A;  1ILY A;  1ST7 A;  1OVY A;  3EKS A;  3P31 A;  4A59 A;  5F0X A;  2CB8 A;  3GDQ A;  4BR4 A;  4BRQ A;  3AAR A;  4H0Y B;  2Q31 A;  3CCJ N;  4ILJ A;  4BR9 A;  3CPW M;  3MCP A;  2A41 A;  1X3N A;  3O8M A;  5IJM A;  3MWT A;  3D2E A;  2QWR A;  2KKZ A;  2IVN A;  1H4R A;  1BUP A;  2V7Y A;  2YJF A;  3MWP A;  2ZJP L;  3CME N;  3T7Z A;  3SLC A;  4H5T A;  3ZEU A;  2D1K A;  4YOV A;  2D4W A;  2YJE A;  4AM7 A;  5EX5 A;  1ZXO A;  2QWP A;  3CF5 L;  1T6D A;  3WEE B;  3JS6 A;  5HL7 L;  3VF2 A;  5GIP A;  3UKU A;  4C1N K;  5C0Y A;  2NLX A;  3N4P A;  2DIK A;  1VQK N;  2QM1 A;  4CD1 A;  1SGH A;  2FSJ A;  1KAZ A;  2P9S B;  4H0O A;  1Q7Y O;  1VQ9 N;  1YVN A;  4K41 A;  4GNI A;  3VGM A;  5AFU A;  4JKG A;  3I8B A;  1JCG A;  4IZ9 A;  5EXW A;  1JCF A;  3U8Z A;  3J8A A;  4DCH A;  5KPZ A;  3HRG A;  1M90 O;  2NRZ A;  3U8X A;  4IJA A;  4BRF A;  1QZ5 A;  2P9L B;  2V7Z A;  4JK7 A;  3X23 A;  4YOY A;  1DT9 A;  1Q18 A;  3VOV A;  4IOC L;  1MWM A;  3D6R A;  4FVU A;  2ASP A;  2H3G X;  3LDP A;  4BRM A;  3E9P A;  2A5X A;  3VMF B;  3E9L A;  4JKC A;  1GLF O;  1RFQ A;  2NNW A;  4J8F A;  3DLL L;  4XH1 A;  1KXP A;  3TSU A;  4NO7 A;  2QWO A;  1NMD A;  4FO0 A;  1ACA A;  4PL7 A;  1K73 O;  4R79 A;  3CQX A;  3G9W A;  3MDQ A;  2ITM A;  3VER A;  5AQV A;  2QI2 A;  3KWG A;  4BRL A;  3A5L C;  4KH4 A;  4B1W B;  4PKH A;  4CZL A;  3H1V X;  5AQS A;  4YOR A;  3BP8 A;  4NLC A;  2FLO A;  3D2F B;  3DXK B;  4YOU A;  4AM6 A;  4CJ7 A;  2ZJR L;  4BC3 A;  3ENB A;  2P9I B;  3M6G A;  3O9Q A;  3CER A;  1BU6 O;  3VTH A;  1ZC6 A;  3ZET B;  1K8K B;  1WOQ A;  4CZG A;  4FOE A;  3R8E A;  3L4Q A;  3MX5 A;  4H0X B;  3BF3 A;  1W2B M;  5FPD A;  1M1K O;  1HPM A;  3IMX A;  5AZJ A;  3QIJ A;  1NGC A;  3WEE A;  4BRO A;  1HUX A;  3FLC O;  4CBX A;  3HZ6 A;  5AQF A;  3G6E N;  2P9S A;  4ILH A;  1GLC G;  2FF3 B;  1E4G T;  1W97 L;  4JHD A;  1YI2 N;  3CJB A;  2FSN A;  1YUW A;  2UYT A;  3MN9 A;  4RWT A;  4IO9 L;  1GLJ O;  3H3O B;  2YVC A;  3O80 A;  3LDL A;  1YJN N;  4BRP A;  4JK9 A;  1ATS A;  3LDN A;  2GEM A;  4ZRI A;  1NGG A;  3TTD A;  3CHW A;  3HTV A;  4B1Z A;  3ZX3 A;  3PIO L;  1NI2 A;  1HBK A;  3A5O C;  3C6H A;  1VQ7 N;  4YOW A;  3VGL A;  4CZF A;  2E88 A;  5BPN A;  4F9O A;  2P9K B;  4C1N I;  1KAX A;  1ZBS A;  1N8R O;  1SZ2 A;  3ZEU B;  1NLV A;  4XEI A;  4WCE L;  2VWB A;  3C7N A;  4M7Y A;  2OTJ N;  1E4F T;  1SQK A;  3VPZ A;  4CZJ A;  3F2K A;  3R3L A;  3ZX2 A;  2NRT A;  3FLV A;  1GLL O;  4BRD A;  1SAZ A;  2P9U A;  5GAE P;  1ATR A;  3EPY A;  3S41 A;  3SK3 A;  2V51 B;  3AY9 A;  1GC7 A;  2A40 A;  1HB8 A;  3FZF A;  1D4X A;  3CMA N;  4IWV A;  3VET A;  2E20 A;  2NRR A;  3K9K A;  1YAG A;  3CJC A;  3O6W A;  3FZL A;  3QIC A;  2ZGY A;  3R6M A;  4K42 A;  2A6A A;  3FZM A;  3ZET A;  3K9J A;  3EN9 A;  3N4Q A;  1K8K A;  2CQU A;  2HBM A;  3O1B A;  3P38 A;  4H03 B;  3TPQ A;  4BGA A;  5EOY A;  5DM7 L;  3WUH A;  1ISN A;  3CI5 A;  3DAW A;  3H6E A;  3VGK A;  2CH6 A;  2FDQ A;  1GLB G;  3WA0 A;  2PBD A;  2YI1 A;  4A2A A;  2F9T A;  2I7P A;  4RCH A;  3HI0 A;  4NB4 A;  5LJW A;  4WFA L;  4OO1 J;  3H1Q A;  3TTC A;  3A5M C;  2KLA A;  3AAP A;  5GAH P;  3CCM N;  2E1Y A;  3U7D A;  5AR0 A;  3CPE A;  4BG8 A;  3GG4 A;  1BG3 A;  4JKA A;  3WT0 A;  1RDW X;  3LM2 A;  3C6A A;  3IUC A;  1TUU A;  4FWQ A;  2QTD A;  3FE1 A;  4BC2 A;  1YJW N;  5M1K A;  1X3M A;  5AQW A;  3DWL A;  3A8Y A;  2D2Q A;  3WXL A;  2YHY A;  3SAH A;  2WFB A;  3CJ1 A;  4BR5 A;  4EAH D;  1VBH A;  3EE9 A;  2P9K A;  5GAD P;  4ZRJ A;  2ASM A;  1IG8 A;  2RE2 A;  3MN6 A;  2YCH A;  4L3Q A;  3DXM A;  4IEI A;  3EE8 A;  3F5T A;  5GIN A;  3CJA A;  2HE7 A;  4PKG A;  1VQM N;  2ZGZ A;  3SAF A;  5AZJ B;  1GC6 A;  3KHY A;  3I56 N;  1S72 N;  2A3Z A;  1LCU A;  2WC9 A;  3U9D A;  3OBW A;  1MA9 B;  3WXJ A;  3J7Z O;  4JHD B;  4XH4 A;  2BTF A;  1Y19 B;  1ESV A;  2GWJ A;  1S22 A;  5EY4 A;  4U7B A;  1J6Z A;  3AU5 A;  1XC3 A;  4DXA B;  2E2O A;  1Z05 A;  4A61 A;  2E2N A;  3IKM A;  5E26 A;  5F1X A;  4FWO A;  2E2Q A;  2NRW A;  2QWN A;  3VES A;  2QEX N;  4FWM A;  2KHO A;  5AQG A;  4BR7 A;  3O9S A;  5JVG L;  2AL6 A;  2JWL A;  2CGK A;  3CCR N;  4FL9 A;  3ZYY X;  4H0V B;  5ADX H;  3CCQ N;  4EIA A;  1KD1 O;  4ISE A;  4NLB A;  1NGJ A;  4BRN A;  2D10 A;  4C23 A;  3EKU A;  1VQ4 N;  3HSC A;  1Q82 O;  2FSK A;  2J0M A;  4FPA A;  3AGK A;  3CC2 N;  2QWL A;  4CZH A;  4A62 A;  5KQD A;  3TSQ A;  4WFB L;  3SBT A;  1K8A O;  3ID6 A;  2P9P A;  1KAY A;  1GGO A;  4BY9 C;  3C7N B;  3CCS N;  2IIR A;  4K25 A;  1BO5 O;  1HJO A;  3L6Q A;  2YHX A;  4HWI A;  4KH6 A;  3CC7 N;  4YL8 A;  4BQZ A;  1IJJ A;  2P9U B;  4U67 L;  5H1S Q;  3MN7 A;  2Q36 A;  4WQ4 C;  1VAZ A;  4QS7 A;  5AFU H;  2RQ1 A;  1BDG A;  2YHW A;  4FWS A;  4LC9 B;  2ZJQ L;  4UY8 O;  3EO3 A;  4BRA A;  1HKC A;  3ATV A;  2P9N A;  2WH5 A;  2E8A A;  4KH5 A;  3QML A;  4A5B A;  4PHT X;  5AQQ A;  4FWN A;  3UB5 A;  3QB0 A;  3KWI A;  4HTL A;  5AQY A;  1XUP O;  4YDU C;  5AQH A;  5BRD A;  1YHQ N;  4JKE A;  4OPA A;  1KC8 O;  1BWF O;  2WUS A;  3H3N O;  3O4W A;  2OTL N;  3D7E O;  3RSE A;  5CHI A;  3MN5 A;  2HBJ A;  4CZM A;  5AQU A;  1JJ2 M;  3R1X A;  3KVG A;  3O9T A;  3ATU A;  4MO4 A;  3OBY A;  4O8U A;  4B1U B;  1T6C A;  2Q0U A;  3M1F A;  3T69 A;  4BQL A;  1QQO A;  2JWK A;  4F7G A;  1VQL N;  5FPN A;  1TUY A;  2BH1 A;  3B8A X;  2J0J A;  3C65 A;  4MDB A;  3AGR A;  3IFR A;  4FPB A;  4XH5 A;  1X9J A;  3FR0 A;  4JEP A;  2Q1N A;  3F9M A;  4YOX A;  3DJC A;  5BRE A;  4EHU A;  3L4I A;  5BN9 A;  3CCV N;  2NZT A;  2QWM A;  5GIO A;  1GLA G;  4G9Z A;  3EZW A;  3FFK B;  2D11 A;  2HST A;  3GBT A;  4NY0 A;  5EVZ A;  2FXU A;  1JCE A;  5AZI A;  3GE1 A;  2QXL A;  3KZB A;  3P4I A;  4KBO A;  1RDU A;  3DXM B;  5M1F A;  1Z6R A;  2IVP A;  4TKN A;  4JAX A;  4BGB A;  4A5A A;  5MLC Q;  3A0I X;  2BUP A;  2NRV A;  5AQJ A;  2IVO A;  5C2D A;  4E1J A;  4JN4 A;  3SAG A;  1YIT N;  1HLU A;  4JKH A;  5TKY A;  2X0S A;  2NRX A;  3M5R A;  5JMV A;  3CQY A;  1K9M O;  4HDO A;  3FGU A;  3AAQ A;  4FOI A;  3ID8 A;  4WYB A;  5C10 A;  2QW9 A;  3HM8 A;  3BF1 A;  4FWK A;  4H0P A;  4M63 C;  3NVM A;  4Z94 A;  3ENH A;  4JKD A;  5JVL A;  4A57 A;  4GY2 B;  4WQ4 A;  4GVE A;  4ZRK A;  3A5N C;  4WF9 L;  4P7I A;  4JNE A;  1GLD G;  1SS6 A;  2GTD A;  5I9E B;  1VQ6 N;  2WBN A;  3PIP L;  2VCP A;  2Q2R A;  2W41 A;  3G25 A;  2HF3 A;  1Y64 A;  1NWK A;  3VEN A;  1YIJ N;  3VF4 A;  1QVF M;  3H46 O;  1NGF A;  1VQN N;  5TKW A;  2EMS A;  4JKF A;  5BPL A;  3MX2 A;  4FWP A;  2GUP A;  5BPM A;  4YDU A;  2P9P B;  2COP A;  1EO1 A;  2EMT A;  3TTF A;  3L0Q A;  5C2F A;  3RVC A;  3O1W A;  1P90 A;  3QDK A;  4ISF A;  5M1P A;  3SMP A;  1HKB A;  4IOA L;  3QBX A;  1NGA A;  5BN8 A;  2VYP A;  4CZK A;  3TSP A;  5C12 A;  5JVH L;  1Q86 O;  1U6Z A;  2E1Z A;  3WXM B;  4QS8 A;  1VQO N;  1BA1 A;  3CCU N;  3WXK A;  3LDQ A;  1HKG A;  2P9N B;  1VQP N;  4EHT A;  4PL8 A;  4BRG A;  1QVG M;  2Q97 A;  3QFP A;  1H1V A;  3CCE N;  3Q7B A;  1DKG D;  1NBW A;  4BG9 A;  1V4T A;  1DEJ A;  3NMU A;  5AQI A;  1DIK A;  3G71 N;  3W3D A;  4WFN L;  4CI6 A;  4H5N A;  3W0L A;  2HMP A;  2I1K A;  1Q81 O;  1MWK A;  1TYQ A;  5AQO A;  3VEY A;  4BRC A;  3RSE B;  4Y0W A;  4CD3 A;  1MDU B;  3VTI A;  3R9P A;  5KPR A;  1QQM A;  5M1N A;  3PVL A;  2I7N A;  4BVP A;  5ADX A;  1YF5 L;  1CZA N;  4JKB A;  3C0B A;  3O9U A;  1MK9 B;  2Q0R A;  3JXU A;  4BRE A;  4BR2 A;  4B1Y B;  3HOS A;  4H5W A;  4GXB A;  4JK8 A;  3I33 A;  1R59 O;  3QBW A;  3CC4 N;  4JD2 A;  1HX1 A;  2EWS A;  3MMV A;  1O13 A;  4AF1 A;  5AQM A;  2A42 A;  4B9Q A;  3FP5 A;  3HOT A;  4O5F A;  5AQX A;  3O5B A;  1NGB A;  2FF6 A;  4GV3 A;  2AEH A;  3SJH A;  5AZI B;  4CBU A;  1C0F A;  4GV9 A;  4BVO A;  3SBG A;  3CXC M;  1U2V B;  5B8H A;  2DPN A;  3P39 A;  2I1J A;  5AQL A;  3UKR B;  3H45 C;  5F2R A;  2VGM A;  4CZI A;  2HRJ A;  2HOE A;  2ASO A;  4IFE A;  3ZDT A;  1V4S A;  1EF1 A;  2PAV A;  2W40 A;  4MDA A;  1NJI O;  4IJN A;  3I55 N;  4CYE A;  4FWL A;  4BR0 A;  2ABD A;  2GWK A;  4H5R A;  3HBT A;  1YXQ A;  3IVF A;  2D0O A;  4QS9 A;  3U4L A;  4GV6 A;  2AA4 A;  3LL3 A;  4OPH A;  1VQ8 N;  3U9Z A;  5AQZ A;  3SMS A;  3LDO A;  2HBK A;  4FSV A;  4ILG B;  3VEX A;  4DB3 A;  4M7X A;  2ZWH A;  4CBW A;  4K43 A;  4H0T B;  5BR9 A;  3AU4 A;  5JLH A;  1LOT B;  4FWR A;  5M1O A;  3PZD A;  3O08 A;  4WQ5 A;  1NGE A;  4I6M B;  5C15 A;  1J19 A;  1RGI A;  5CE3 A;  5M1Q A;  1YJ9 N;  1NTI A;  4BRK A;  4BRI A;  2R82 A;  1OKJ A;  2VGN A;  3FZK A;  1ATN A;  4H5V A;  5ELZ A;  5AQK A;  4BC5 A;  3VF6 A;  2GEL A;  3WQU A;  4MLH A;  1S3X A;  2F9W A;  3LM9 A;  5AQN A;  5CR4 A;  1T44 A;  3CJ9 A;  4PKI A;  3BEX A;  5AQT A;  3KK7 A;  4CZE A;  2F7T A;  4MO5 A;  1XQS C;  1MIZ B;  1EQY A;  3UE5 A;  5KPT A;  3ULE B;  3IDH A;  1QZ6 A;  1NGH A;  3O9R A;  3PLA A;  4DHY A;  1U2V A;  2NRH A;  3CJ7 A;  2HBL A;  1HB6 A;  1QHA A;  3VEW A;  4IDH A;  3UKR A;  5BRF A;  4A2B A;  3FZH A;  1WUA A;  2CH5 A;  4EFH A;  3Q7C A;  1TYQ B;  5AQR A;  3TU5 A;  1T3V A;  1NVL A;  2AP1 A;  2D0P A;  2CGJ A;  2P9L A;  5HOO A;  3E66 A;  3NVK A;  4IOX A;  3GOI A;  1KBL A;  3D2E B;  3E1Y A;  4IXC A;  3M3Z A;  3CD6 N;  3ZX0 A;  4B1X B;  5FPE A;  5AQP A;  4DQ8 A;  3G4S N;  1VQ5 N;  1QQN A;  2QA4 N;  2YX6 A;  3OW2 M;  4O8K A;  5JIC A;  1MIX A;  4HDQ A;  3EL2 A;  4JD2 B;  5DM6 L;  5LY3 A;  1JDE A;  1KC7 A;  1KQS M;  3CIP A;  2HF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...