4JK9A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound co ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
219
Chain Sequence
b'LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 67
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk9A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk9A01
3ENBA 3SBGA 4JKHA 3E9OA 4JKBA 3SBTA 4JKDA 4ILGB 4ILJA 4JKGA 4JK7A 4JKAA 4JKFA 4JKCA 4JK9A 4JK8A 4ILHA 4JKEA 3E9LA 3E9PA 4JKGB 3E66A
chains in the Genus database with same CATH superfamily
3SNNA 4C1NI 4M3YA 4JKHA 5M1KA 2FJ9A 2PY5A 4ZRIA 4BRAA 1YAGA 1IKWA 2NLXA 2FDQA 1EX4A 4X62K 5C25A 5C2FA 4FWMA 3SAGA 3HT3A 3AA5X 1RFQA 5EVZA 2HNZA 4A2AA 3V9WA 2Q36A 3ID6A 3OJUA 3DRSA 4H0TB 4BDYA 3VGKA 3EY1A 3HP9A 5I3UA 5AQUA 2NNWA 5HRRA 4M3ZA 3CETA 3VETA 4CGFA 5ADXA 4GNIA 4AHTA 5AQWA 4GY2B 4C8KA 2WTUA 4DS4A 3CIPA 4FK0A 2QW9A 1RGIA 3F2KA 5AQKA 3HPGA 3TU5A 2KFZA 4DV1K 4DR6K 3P39A 5BN9A 2RHKA 1ILYA 3WQTA 1NK5A 4DV6K 3MXJA 3RRGA 3LPUA 2RN2A 1ZYQA 3SI6A 1LWEA 4GXBA 3HVTA 3NF7A 3WNEA 1Q7YO 3EZWA 2Y1JA 2E6LA 5KPRA 4H5NA 4PKGA 4ZHRA 2HHUA 4DTMA 1WAFA 3SJJA 3QBWA 2ABDA 4KI6A 2P9UA 3ZSZA 5BREA 1NK6A 4FJJA 3AVBA 4KH4A 4CZMA 3M8SA 4BG9A 3NVKA 1J5OA 4IO8A 2F96A 1VQ6N 5KI6A 4JK9A 3T1HK 4KREA 2KFNA 4A61A 5T7BA 3VOVA 4LD0A 1NK0A 3I0SA 1ATRA 1S6QA 4OPKA 4KI4A 3BINA 2XRIA 1IH7A 2HHQA 2D0CA 2E2QA 3OHRA 1RT2A 2YJFA 3DXMB 1MIXA 3A5MC 4O4GA 4DG1A 3VENA 3TPQA 4DQRA 4LFAK 3MCPA 4DR7K 1WSEA 1XWLA 3VEYA 3H45C 3R9PA 4CZIA 3O9RA 1VQMN 4H0XB 3LAKA 1HKGA 3ZX2A 4MO5A 4CJQA 2D0PA 1XNRK 1NGIA 1WNSA 1NGFA 3D2EA 4FOEA 3VTIA 3FZFA 1DTQA 2X74A 4YOWA 3MX5A 4LF6K 4JKBA 1WSHA 5FPMA 5JLFA 2ZD1A 2YKMA 1OKJA 4NLCA 3NFAA 2FBXA 2HNDA 4CERA 4FYDA 4WYBA 3OW2M 4JI6K 3ZETB 1GLCG 2YHXA 2GWKA 3MMVA 1TKDA 1YUWA 1T44A 1HQEA 2CGKA 3VGLA 4BG8A 1KD1O 3QIJA 1N34K 3PY8A 4Z94A 3VEZA 5JVHL 1L3UA 3EN9A 3MDQA 4OKJA 4DTNA 3QFUA 4CEDA 4DUYK 2HB5A 2UUCK 2OZMA 4KTZA 1JL2A 2ETJA 3JYTA 4XEIA 3CCUN 3CQXA 4JK7A 4CZKA 1OH5A 3FLCO 1N36K 5AZJA 4DFJA 4E1NA 5LMUK 2HF4A 3S41A 3VF4A 4JI8K 3SUNA 5LJVA 1NVLA 4CJVA 2HMIA 4JV5K 2YNGA 4CZEA 2OCEA 3E9OA 4V19S 1GC6A 1I39A 2KHOA 4BRQA 3THVA 3F5TA 1GOAA 1BDGA 4JHDA 3HO1A 5AQOA 4IJAA 2J4RA 2D11A 2QWNA 3CPEA 1V4SA 5HRPA 4QS9A 3IUCA 4HVJA 1WLJA 4PUOA 2DFFA 1VBGA 5B8HA 4WE1A 3L6QA 2DIKA 1NK8A 1HMVA 4CF2A 1WB9A 1TKXA 2E2OA 2I5JA 4BY9C 5M1PA 1NJWA 4IOAL 4M3RA 3CCJN 2QKBA 5GAEP 3N4PA 4I9LA 4BR0A 4XH5A 2YHAA 3DAWA 5CE3A 2E2NA 1RT1A 4IDHA 3JS6A 4CHOA 4B9TA 4B9SA 4CGIA 4TKNA 3I33A 3OYKA 1JXBA 1NWKA 1B9DA 2B5JA 3ULDA 4BE1A 4FM2A 3CFRA 1C0UA 1T3VA 3DOLA 1VSJA 3M6GA 1NBWA 2HF3A 1EKEA 3LDQA 5FRNA 1TUUA 2G8FA 1K6YA 4B9UA 2O8BB 5C24A 3DLRA 1XNQK 3SCXA 3NCIA 3HZ6A 1YJNN 3OA9A 4ICLA 2JWLA 3BDPA 3QICA 1QSYA 3CCVN 1O13A 1W7AA 1VAZA 1M1KO 4RCHA 4CK3A 2GEMA 4JKGB 4JNEA 4KHUA 3WA0A 3RVCA 2HHTA 5LL6Z 4DQQA 3PX0A 2ASOA 3VESA 1KVCA 4BR7A 4GV3A 1FJGK 4X65K 1N32K 3HOTA 3MECA 4ELUA 1XC3A 4DFPA 4JAXA 2QI2A 3OBYA 4B3MK 1BU6O 1HLUA 1B9FA 3J80O 1ZBIA 1BIUA 4CCHA 3GG4A 4NYFA 3KD1E 3HP6A 1QQNA 2GUPA 3C6TA 1U2VB 3K5OA 3BZKA 3MCAB 4BGBA 4K8ZA 1SS6A 1KFDA 4DXAB 4RG8A 5LJWA 1JCGA 3U6FA 1MA9B 4BACA 2QKKA 4CVNE 5J2NA 1V4TA 1HYSA 4K41A 4DQSA 4YNQA 1RT5A 2HSTA 3DXKA 3W0LA 1Y64A 1TL1A 3PO4A 4C1NK 1ZBUA 4JI2K 4BWMA 3TAFA 3NBPA 3TSQA 1RTIA 1KSPA 3IDHA 3MEGA 4KO0A 3HBTA 3H1VX 3VEXA 4AM7A 3D2FB 4FWRA 3QETA 4CEQA 3SUPA 1LWFA 3L3VA 2YNHA 4CD3A 3T69A 1IO2A 4JI7K 2GV9A 3V4IA 2J0KA 2HVIA 4NB4A 4B9QA 3BUZB 3W3DA 2UUBK 5J2MA 1DTTA 3K5LA 3KK2A 3VERA 3WNHA 3C6HA 2A41A 3MN6A 4DB3A 1U49A 4BRIA 3G10A 3O9TA 4WCEL 3LALA 3WEEA 3SV4A 3SMSA 3K57A 1I3AA 4CESA 3WNFA 5KGXA 4YDUA 3AGKA 5AJ3K 2CB8A 4BRFA 3M8RA 1OVQA 1KAZA 2Q97A 3P5JA 3GOIA 5JMVA 4AM6A 3O3FA 4JEPA 3T1YK 1IG8A 4CJFA 3PSFA 2XY8A 1GOBA 1QQOA 3CJ9A 5BRFA 3ZSWA 3ZT1A 2WBNA 2YCHA 4DSEA 3V81A 2D1KA 5I9EB 3NVMA 3KWGA 4O5BA 4WQ5A 1S6PA 3ID8A 2HHVA 1QZ6A 2I7PA 3SZ2A 1S3XA 4CIGA 4J2EA 2ZJRL 5HL7L 1NKCA 1ST7A 1HNVA 3V6DA 3ULEB 1HB8A 5BR9A 3JSMA 4TSXA 3OYDA 5AQXA 1YHQN 3V9XA 4GKKK 4FJGA 1X3MA 2D0AA 2E1YA 2FLOA 4DQPA 1DGKN 1X1PA 1XHXA 4DTSA 1OH8A 3LP2A 2BDPA 4BE0A 4CJKA 4BC4A 2ASPA 5ELZA 4JRQA 5CZ1A 4CFBA 2QXLA 2O8EB 4AHCA 4JLHA 5MLCQ 1EWRA 5BPLA 4B9VA 1WSGA 3CJBA 4B1UB 3BF1A 4RW7A 1HJRA 4UY8O 3VQQA 4FZYA 2D10A 3LZIA 4Z4FA 3I56N 3VA3A 1I94K 1LAVA 4IOXA 4OPAA 2DPNA 1Q9XA 2ASMA 1GOCA 5AZIA 1YITN 4Q5VA 4Z4IA 1Y97A 4JKDA 4KH6A 1QVGM 4HDOA 3OYJA 3TI0A 5HRSA 2UXBK 3KHYA 2G8KA 4BVOA 4PQUA 4BVPA 3SAHA 4DU1A 2GUIA 1HBKA 3C65A 1KLNA 4C8OA 4CGJA 4CK2A 1S1XA 5KPZA 2O8FB 4GW6A 3D0PA 4QS8A 1BG3A 1RT7A 3AO4A 1HNWK 1OVYA 2YX6A 4FWNA 3SQ1A 3A8YA 4AHRA 1Q8IA 3G4SN 5AQGA 4CHQA 3THYB 4W5QA 3MN5A 4JD2A 2P9SA 3V1RA 1DIKA 4B9MA 1S1WA 3KKSA 2IAJA 4AQYK 4DFKA 3BP8A 3S3MA 3THWA 1IG9A 4N76A 1ZBFA 3BY5A 1FKOA 1WUAA 3B6OA 3VQEA 5ADXH 3RRHA 2P9LA 2HBMA 3RSEB 3VEVA 2Z1HA 3H1QA 2GTDA 3BZCA 5AQIA 4XH4A 3U8ZA 3VN5A 5JICA 5AQYA 3QIOA 1BA1A 5E26A 4DSFA 2IC3A 3LM2A 3PSIA 1Z6RA 3QEWA 4JS5A 5BRHA 3J81O 1RNHA 4IJNA 1CZ9A 3T3FA 2E5LK 4IOCL 3L8BA 4O8KA 3PX4A 3ZCMA 4FLYA 1ASWA 4WF9L 4ILGB 1BI4B 1KXPA 5C10A 4YHHK 4L3QA 4IBNA 4PWDA 1T6CA 3L2RA 3DI6A 3P1GA 4F2RA 1F21A 2Q3SA 1J9AA 1RDCA 2V7YA 3CI5A 5BPMA 1NG9A 3R8EA 1IV0A 4OKEA 1LAWA 5EXWA 1BL3A 3MWPA 4BR9A 4E1MA 1JLFA 4Q0BA 4BRKA 1JJ2M 2P9KA 5IT9O 1LW2A 4OX9K 1MK7B 4KHYA 2IVNA 5J2QA 5C12A 5K14A 2FXUA 4ZRJA 3V9ZA 2A6AA 2NRRA 1A5WA 3DRPA 3CMAN 3AAPA 4CEZA 3IFRA 4CGGA 3EE9A 3CCEN 4Z4EA 4FWPA 4CJEA 4R79A 4RW9A 4QCLA 5HP1A 2P9NA 3QEPA 4EHTA 3GL1A 1J5EK 3O9SA 3SPZA 4LSLA 3CJ1A 2NRHA 2XHBA 2HHSA 4QOZB 3RTVA 1T05A 4I6MA 4KHWA 1X9WA 5AFUH 2EX3A 3VQ5A 1IBMK 4NCBA 4IO9L 1MK9B 4GVMA 2UU9K 5M1FA 3PX6A 3VQPA 3KLIA 1RBVA 3CQYA 4DF4A 4OPJA 2E6MA 4CD1A 4IWVA 2V51B 1QVFM 3TANA 3U9DA 1ASUA 3AVCA 1LOTB 1NGJA 1SKRA 5AQZA 5KQDA 2OZSA 1NTIA 3SQ2A 4P7IA 4G1QA 3CM5A 1WSIA 4DKWA 3SPYA 3ENBA 4EP4A 5I42A 4O44A 2BGGA 4DV0K 3MX2A 4LF4K 4FW1A 3SMPA 1E4FT 4H5WA 4WQ4C 1NU0A 4KRFA 4K0KK 5E84A 3AO1A 5C15A 3PV8A 3DLKA 4IXCA 3K59A 3KLEA 1YVUA 1BIZA 2NUBA 4BR2A 4C23A 5CYQA 3JXUA 4MLEA 3QNOA 3JAMO 3NDKA 3I8BA 3AVFA 4KKOA 4LC9B 3AA3A 1VQ5N 4M45A 2O8CA 2WC9A 3FP5A 1K8AO 3LL3A 1NGAA 2COPA 2KKZA 3O1BA 4LSNA 5J1EA 4B3SK 3QO9A 4JKEA 3A0IX 4PL8A 3FFKB 5KTQA 1L3TA 2GWJA 3OBWA 3PO5A 4NXMK 2NRZA 3G71N 4CJSA 3PZDA 2G8VA 3C7NA 2AJQA 1SQKA 1HPMA 1DLOA 3K5MA 5AQQA 3L2WA 5CZ2A 4B3OA 3QEIA 2Q31A 4CHPA 1NGCA 2VCPA 1HNIA 4CJ4A 5AFUA 1RT4A 2HBKA 3O3HA 1K8KB 3UIQA 2BH1A 3QB0A 4KHSA 2P9PB 3AVKA 1YXQA 3FGUA 4J2BA 1MWKA 3QINA 4O5FA 5AQMA 1N8RO 3J8AA 3CFOA 2O4IA 5HLFA 3ZSVA 1NK4A 1IKVA 1N33K 4CEFA 2HBJA 4LFCK 1HYZA 3J7AP 4CJTA 4Y1DA 3AVHA 4I7FA 2HRJA 4CEEA 4AH9A 4CHYA 1VRTA 3AAQA 4DUZK 5AQNA 3WXLA 4FLVA 1NOZA 3DLEA 1A5VA 3LP1A 4IEEA 1ISNA 2QA4N 3UKRA 4KHQA 3A2FA 4AHUA 4Z4HA 3CCRN 5CR4A 4KPYA 1Z26A 1HB6A 1BA0A 3S3NA 2IVPA 1Q9YA 3N4QA 3WUHA 2X6NA 3UKUA 4DSKA 2FF3B 1QHAA 4KBOA 3G0ZA 2ZM6K 1TK8A 4EZ9A 5LMNK 3AO2A 2V7ZA 1SUQA 3KLHA 4F7GA 3KK3A 4DF8A 3TAGA 3L2QA 3P83D 1NMNA 2UUAK 2OA8A 3C94A 3SAFA 2OPQA 2VQEK 1X9SA 3P31A 3H3NO 4FCYA 4ID1A 3NF6A 1HR0K 1RCHA 2UYTA 3I0RA 5FPNA 3IS9A 4CJ3A 3OYHA 1N6QA 1U04A 3AA2A 1NKBA 2I1KA 3SV3A 3T1AA 4E7KA 2PFUA 2FBTA 4W5OA 1XI1A 1DKGD 2E1ZA 3V9UA 3VGMA 4FJ8A 2IOCA 1KAXA 2G8WA 2PAVA 3G9WA 3TARA 3OTOK 5JVLA 1R59O 4M7XA 4CI6A 3DLBA 1HUXA 4LY7A 3HXMA 3EZ5A 4FZZA 1KCFA 1IKYA 1Q82O 1NOYA 3RMCA 3KVGA 5M1OA 5HROA 3OYFA 3HL8A 4DQ8A 4FPBA 5CYMA 5F2RA 2P9UB 3ZT0A 4B9LA 2W42A 5HRNA 5FPDA 2ITMA 3THXA 4PA1A 1M90O 1Q81O 3RR8A 4B3TK 4DFMA 1SL1A 2YKNA 1BGXT 1NJZA 2FSKA 2VWJA 4DR1K 3QEVA 4DTJA 2FF6A 1J19A 4E89A 1ZC6A 3OJSA 4OO1J 2G8UA 1NMDA 4RW6A 3B8AX 4PY5A 4K25A 1Z05A 4FJ7A 5F1XA 3VPZA 1HKBA 3EYZA 4HUFA 4HUGA 2VGNA 4NCAA 4JKAA 4LH5A 1KLMA 5FLXO 2F8SA 4GV6A 4BRMA 5GAGP 1NNEA 1QSLA 3VQBA 3V1QA 4DTRA 2VG7A 4YL8A 3ENOA 3U7DA 2HMPA 4CZHA 3ZT4A 1TYQA 3H6EA 4DMNA 5AQJA 3D2EB 2X0SA 3CCLN 3VF2A 4ISEA 3MEDA 1EXQA 1GLBG 3SYZA 2F7TA 3QNNA 3HRGA 1RDWX 3KWIA 5TKWA 4CFCA 2AA4A 4ZTFA 1Y19B 5AQVA 3M5RA 1C1CA 3LDPA 5EU7A 3VF6A 3CCSN 1VQ9N 5HOOA 4Y1CA 3AY9A 4EFHA 4AHSA 4W5RA 3RMAA 4B1VA 3VMFB 3D7EO 4QS7A 3EEQA 1YI2N 1ESVA 4NO7A 3DLGA 2OTLN 2CGJA 3B6PA 2EMSA 4JI0K 3O9UA 1NGBA 4E7LA 1RTDA 3ISNC 4Y0WA 2KQ2A 4NYNA 3ZEUA 3D45A 3ZSXA 5AZJB 1YTUA 1KTQA 1GLAG 2FSNA 3LZJA 1DEJA 3MXIA 1C1BA 4LF7K 1NGEA 4H5RA 4DCHA 3IAYA 1S5JA 3TTCA 3U3GA 1MWMA 2QM1A 1X9JA 4FOIA 3AVIA 3IRXA 4JHDB 3CC2N 4JKFA 1KAYA 3M8PA 3MN7A 5SZTA 3EO3A 3HTVA 4CZGA 3OYMA 3E9PA 1JLEA 2BE2A 3L2UA 1VSIA 3CMEN 4KTQA 1T8EA 3NH2A 4HTLA 5LY3A 1W0HA 1EWQA 3OY9A 2BTFA 1VSHA 5GIPA 4HCCA 3ZT3A 1SZ2A 5SWMA 4FPAA 2OTJN 5JLHA 3WT0A 1ATNA 1K9MO 1BUPA 2Q2RA 3QEXA 4CYEA 3IMXA 4H0PA 3WXJA 4BC2A 4HWIA 4M7YA 3KLFA 2HHWA 5AQHA 3WXIA 3J7ZO 4J2AA 3MXMA 1TKZA 4A57A 4CJ5A 2RPIA 3S9HA 4E3SA 2RQ1A 1U45A 2YJEA 4DR3K 4OLBA 4BGAA 3THXB 4DTUA 3ZSYA 3VQ8A 3KD5E 1EQYA 3E66A 4X66K 2NRVA 3CCQN 4IFEA 2EWSA 2P5GA 1GG3A 4BWJA 1CXUA 2UXCK 4L8RB 2X78A 4IG0A 3CF5L 4FJ5A 2WONA 2CH5A 3EPYA 3QLHA 1TV6A 2IVOA 2O8DA 4LF8K 3OYAA 3MWTA 1HX1A 4IZ9A 1QS4A 2WOMA 2AP1A 3O9QA 4N56A 3AO3A 4CF8A 2QWPA 4I2PA 4FLWA 2I1JA 3O1WA 4JI4K 3DM2A 3EE8A 1W97L 2Z1IA 3LDOA 2E8AA 3LM9A 1TGOA 2I7NA 2W6LA 1NK7A 2Z1JA 3AVJA 2F9WA 3OYEA 3I55N 3SQ4A 3NF9A 4BRLA 4ELTA 3VQCA 5BR8K 4H5TA 1ZBSA 1WBBA 3M3ZA 3NMUA 3L0QA 5FPEA 3DXKB 1P90A 5DK5A 4HCBA 3O4NA 1YT3A 4IG3A 1A5XA 1XMQK 1VQ4N 1QTMA 5FROA 1TL3A 1S1UA 1UWBA 3F9MA 3K2PA 4FJIA 3NGZA 2NRTA 3O5BA 1C1AA 1T6DA 4CIEA 1LV5A 4N47A 4BR5A 4E7IA 3AVNA 5TKYA 1XUPO 4H0VB 3LWLA 5KPTA 4F2SA 3KLGA 3SBGA 4PL7A 1G15A 3R6MA 3VQDA 4CF1A 2KTQA 2LSNA 1BOTO 2IS3A 4H8KA 3CYMA 1CZAN 5BPNA 4GMJB 1FKPA 1NGHA 4M3WA 1XQSC 4DLEA 4PKHA 1RT3A 2VQFK 4OPHA 4ZTJA 3HPOA 1Q86O 4JI1K 1EETA 3ZSRA 2A5XA 2ZGZA 3VTHA 3SQ0A 3WEEB 1Q18A 4F9OA 2DFEA 3O80A 2KZZA 4CZLA 3DXMA 1YIJN 3G6EN 4JRPA 3HVRA 2FC0A 3T19A 3AVAA 3HSCA 3WXMB 4CK1A 3Q7BA 3KZBA 2OANA 2YNIA 1VBHA 2VGMA 4B8AB 1J54A 4FJMA 2X6SA 2A42A 1RBSA 4O8UA 3TR8A 3OS0A 1YVNA 1UOCA 1HNXK 2D0OA 4IKFA 2J0MA 1TAUA 1BCMA 5BN8A 1HJOA 1GGOA 4W5NA 4DU3A 4O0JA 4DR2K 4JYAK 3P38A 3L3UA 3P4IA 4OGCA 4A59A 1H4RA 3A5NC 4C8NA 3ZETA 4DTPA 3VQ9A 5A2QO 3NH0A 3VQ4A 3KKRA 2EMTA 1HPZA 1L5UA 4B1WB 1MU2A 3CG7A 3FFIA 1GC7A 3UB5A 1QQMA 4CBUA 3DWLA 4DQIA 4YOUA 4FWSA 4CJPA 3AA4A 4BE2A 1U48A 2RE2A 1W9HA 2VG6A 4M41A 3K5NA 1HQUA 2D2QA 4FW2A 3NAEA 4Z4GA 4HDQA 5FRMA 1OH7A 3FLVA 4JI3K 3AU5A 4N5SA 4B1ZA 4FJKA 1JCFA 3NGIA 1J6ZA 5KGWA 1SL2A 5CY4A 4ILHA 3VA0A 3O3GA 2VG5A 1NGGA 3FZHA 1NJXA 1EF1A 5EOYA 4KHPK 2A40A 1SV5A 1NK9A 3D6RA 4BREA 3MAQA 3ASMA 4FLXA 4KB0A 4FJHA 1NLVA 1SKSA 1W2BM 5AZIB 2QEXN 3TABA 4DU4A 1NKEA 2WFBA 3O4QA 4CJWA 5DM6L 3OYBA 4AHVA 1U47A 3OYLA 1HKCA 4LFBK 4OLAA 3IG1A 5C0YA 3K9JA 1K73O 1FK9A 1CXQA 4FVUA 4DV4K 2CH6A 5J2PA 1GLDG 3K0SA 3CJCA 3AGRA 4G9ZA 4BDPA 2O8BA 3QDKA 3HM8A 4ID5A 4YOVA 4JN4A 5EY4A 1XHZA 4FJLA 4JD2B 2P9SB 1BHLA 3T7ZA 3LDLA 1WSJA 3SBTA 3KIOA 1RDDA 3IKMA 1VQ8N 3THWB 4B3RK 4DV2K 3F9KA 1XC9A 1JCEA 4MO4A 1YJWN 1NJIO 4JKGA 3O08A 5AQSA 4NXNK 4FLTA 1X9MA 1JDEA 2YV0X 4CEAA 3KK7A 2DFHA 2P9LB 3AVLA 3U4LA 3U3YA 3KJVA 4B1XB 2BANA 3WQUA 4DSIA 4C8MA 4F3OA 3RWUA 3ZX0A 2JGUA 4OKKA 1S22A 5GIOA 4YOYA 4Z4CA 4NCGA 4YOXA 4KB1A 3LP0A 1E5WA 1ASVA 2Q1NA 3C6AA 4CJ7A 1FXXA 4HHTA 3H3OB 2KZMA 4BC3A 5KQ8A 2NRXA 1U2VA 4CECA 4LF5K 4OJRA 3HM9A 5GINA 3NH1A 2HHXA 5JVGL 2Q0UA 1QQCA 1ZBLA 4CEBA 1LWCA 1RTJA 1C0MA 4EP5A 2V52B 4BQZA 3DLLL 5AQTA 1RDUA 3R1XA 1JLCA 3H08A 1C0FA 4CGDA 2PBDA 4IFVA 4CBWA 4M63C 4CHZA 4CE9A 3TSPA 4ZRKA 3X23A 4PKIA 1UA0A 1RDBA 4DTXA 2JLEA 4A62A 4M3UA 3CJAA 1KBLA 4FM1A 2O4GA 4H0OA 4IFYA 2P9KB 3O8MA 2FBVA 1JL1A 3A5OC 4CZJA 2F9TA 4EZ6A 3L4QA 1VRUA 3S3OA 4K8XA 4FK4A 3D2FA 1VQ7N 2AEHA 1JLAA 2YHYA 4YDUC 3K9KA 2B4JA 4U67L 3TWHA 1EO1A 5H1SQ 3MK6A 1HRHA 4E7JA 3ZSQA 1GLFO 1CLQA 2QTDA 2P9NB 2XY5A 4B1YB 4BRGA 1E3MA 3K58A 3HJFA 4KV8A 1VSKA 2HHHK 4KH5A 2HVHA 4I6MB 3QBXA 3V9SA 2P9IA 3LPTA 1D8YA 3VEWA 2ZJQL 3SUQA 1IKXA 4CGHA 4CJRA 3ZLJA 4MQ3A 3CERA 4IDKA 4WQ5C 4CEOA 1BO5O 4FWOA 1RILA 1ITGA 1UAXA 5AQPA 3VQ7A 1S9GA 1KVBA 4GVEA 4DLGA 3DYAA 5HBMA 3CHWA 4J8FA 4CZFA 2EHGA 4FJ9A 2YI1A 1D9FA 1D4XA 1BISA 1D5AA 1HYVA 1LCUA 4EAHD 1IBKK 2ZWHA 5BRDA 2CGLA 2UXDK 3CXCM 3CFPA 4ILJA 3VEOA 4PHTX 1ZXOA 3GE1A 4E1JA 3M8QA 3DJCA 3TAQA 1L3VA 3FZLA 2A1SA 5M1NA 2Y1IA 2E2PA 3RR7A 1OH6A 1LW0A 3ULEA 2D0BA 2KW4A 5D3GA 4OVLA 4WFNL 4K42A 4HTUA 3TAEA 4FK2A 4FZXC 3LP3A 5F0XA 4H5VA 2G8IA 1SGHA 1QZ5A 3BF3A 2RF2A 2O8CB 4KHNA 4WQ4A 3WNGA 1S1TA 2OYQA 3HK2A 4CFDA 2O8EA 2YHWA 4KAZA 1RT6A 3OYIA 3PIOL 4CJLA 1R0AA 5GADP 1HNZK 1BCOA 4BROA 1TK5A 3A5LC 1ZBHA 4DV7K 5KRTA 3WXKA 1WAJA 3C7NB 1S72N 4WFBL 2B6AA 3CC7N 4FWLA 3AARA 4FSVA 5AQFA 3TAPA 4WFAL 3QFPA 3OS2A 2D5RA 3KK1A 1WBDA 2A3ZA 1VSFA 1N5YA 2CQUA 5GAHP 5AQLA 2ZJPL 5AR0A 3PIPL 2BUPA 1KC7A 4CF0A 4KTWA 3CPWM 1E4GT 3KTQA 4ELVA 3F73A 1RBUA 3HSTB 3EKUA 4DWIA 2E88A 2R82A 4MDAA 2F4VK 2O8FA 3ZX3A 2DTUA 2HOEA 3AV9A 2OPSA 4U7BA 2VWBA 2RKIA 3UKRB 3ALYA 5C42A 2ZGYA 1TK0A 5DM7L 4H4MA 4F4KA 2ATQA 3DMJA 3V1OA 2YNFA 3LAMA 3FZKA 2DY4A 3UKUB 3THYA 2P51A 1JKHA 3ZDTA 4CW7B 2ZF5O 4XIUA 4DSJA 4M3XA 4M3TA 4EIAA 1VQNN 5AQRA 2NZTA 3H46O 1WSFA 3PLAA 4FJNA 1H1VA 4AF1A 1TAQA 1C0TA 4KFBA 1FW6A 3RSEA 2HNYA 5CHIA 4Z0UA 3AU4A 2G8HA 1VK0A 3C6UA 4CIFA 4BRNA 1U4BA 2P9IB 4FL9A 4B8CA 3Q7CA 1L3SA 2A1RA 4E19A 2HBLA 1T03A 4C8LA 4EKUA 1KC8O 3L4IA 4JK8A 2IIRA 2AL6A 1T7PA 2F8TA 3HPHA 3AVMA 3CCMN 4LF9K 2VWKA 1JLQA 4E0DA 2W41A 1NGDA 2WUSA 3AVGA 2PYJA 4F3TA 5FDLA 3CC4N 4YORA 1BI4A 5C2DA 1J53A 1SAZA 3FZMA 4FM0A 4J2DA 2QWQA 1C0GA 5DMRA 3ENHA 2XO7A 2OPRA 1VSMA 3LANA 3CM6A 2QWRA 4RW4A 1U6ZA 1YF5L 4O55A 2J0JA 1UA1A 1ACAA 2P1JA 4I9QA 5M1QA 4CJUA 3PVLA 4W5TA 3I8DA 1TKTA 2D4WA 4R5PA 1EP4A 3SJHA 2QXFA 3G25A 1TUYA 3QESA 5EX5A 3HYFA 3LWMA 3ZSOA 1REVA 4EHUA 4YY3K 1IJJA 3OS1A 1VQPN 4YOTA 3VQAA 1KFSA 1QSSA 4H03B 1NJYA 1CZBA 3C0BA 1KRPA 4DSLA 4FJXA 4M42A 4K43A 3VQ6A 3L2VA 2GBZA 4A5BA 4H0YB 4HUEA 1S1VA 1RBTA 4FLZA 1TYQB 3FR0A 3R3LA 4YFUA 1YTAA 3ATVA 1JLBA 3EL2A 2R7YA 3FE1A 4FWQA 2ITGA 3OYCA 2PZSA 1RDAA 4FLUA 1VHXA 1MIZB 2WH5A 1KVAA 3E1YA 3J7YP 4RTFD 2FBYA 2W40A 3IVFA 4QAGA 1X3NA 3NGYA 2LBBA 1TVRA 3MEEA 2XY6A 1BQNA 3TTFA 3NE6A 2ZQBA 2OPPA 1SKWA 4MLHA 3U9ZA 2YVCA 5KRSA 3CD6N 4RW8A 2GX9A 2W6KA 3GDQA 4BQLA 4FO0A 5IJMA 4DR4K 2ZE2A 4GV9A 1GLLO 4AILC 1BQMA 1RBRA 1NM1A 4E7HA 4F8RA 2XY7A 1JXEA 4OGEA 4CHNA 4GKJK 1Z25A 3LDNA 1BWFO 1C6VA 2ZPYA 3ZYYX 3ZEUB 1VSEA 3ZT2A 4FXDA 5JS2A 4DHYA 2Q0RA 2QWLA 3RMDA 1VSDA 3SK3A 4A2BA 4I2QA 3DRRA 3O6WA 4JS4A 3C95A 1S9EA 4BC5A 4BRHA 1VQKN 2IDOA 4RWTA 3OVNA 4IEIA 1IBLK 3E9LA 4NY0A 1SL0A 2E20A 1ATSA 3PUFA 2VYPA 3OYNA 2E4LA 3DLHA 2HE7A 3TTDA 3MN9A 2JWKA 3ATUA 4BR4A 1MDUB 3TSUA 4BRCA 4FVMA 3RMBA 4A5AA 4CF9A 4DS5A 3HI0A 4BRPA 4JI5K 3EKSA 1RTHA 3LDSA 4JKCA 3ITHA 2HW3A 3DOKA 1XMOK 4DV5K 3O4WA 4H4OA 4UQGA 1G99A 4ISFA 3CQ8A 3NHGA 4DR5K 5E41A 3SUOA 3QIPA 1GLJO 4X64K 1KQSM 2P5OA 2FSJA 4CBXA 1VQLN 4ISGA 2Z1GA 1K8KA 1P8ZA 1VQON 4XH1A 2GELA 2P9PA 4MDBA 2KLAA 4B9NA 1QHTA 5IWAK 3HOSA 3AO5A 3OYGA 2IGIA 1YJ9N 2YHBA 4NLBA 1JLGA 3CJ7A 3SLCA 3NF8A 2QK9A 1GLEG 5JS1A 1NI2A 1DT9A 1QE1A 4B08A 3E01A 2QWOA 1WOQA 4FWKA 3QERA 1WN7A 3U8XA 4BRDA 4BDZA 4DTOA 3BEXA 3M1FA 2PYLA 4CFAA 4O0IA 3GBTA 4MFBA 3TAMA 2QWMA 1B92A 3QMLA 4DV3K 1O1WA 2O8DB 4N41A 3UE5A 3BGRA 2NRWA 1D9DA 2H3GX 4LH4A 1VSLA
chains in the Genus database with same CATH topology
2AA4A 4C1NI 3A5OC 4CZJA 4IOXA 4JKHA 2F9TA 4OPAA 1Y19B 2FJ9A 2DPNA 3L4QA 3M5RA 5AQVA 4ZRIA 5M1KA 2ASMA 4BRAA 1EO1A 1YAGA 3LDPA 3D2FA 5AZIA 1VQ7N 2AEHA 3VF6A 3CCSN 2NLXA 2FDQA 1VQ9N 5HOOA 3AY9A 2YHYA 4EFHA 5C2FA 4YDUC 4FWMA 3K9KA 3SAGA 1YITN 4JKDA 3VMFB 1RFQA 3D7EO 4KH6A 4QS7A 5EVZA 4HDOA 3MK6A 4A2AA 1ESVA 5H1SQ 1YI2N 4NO7A 2OTLN 1GLFO 2Q36A 3ID6A 2CGJA 2QTDA 2P9NB 3KHYA 4B1YB 4BVOA 2EMSA 4BRGA 4H0TB 3O9UA 1NGBA 4BVPA 3VGKA 3SAHA 4Y0WA 3C65A 1HBKA 2NNWA 5AQUA 3ZEUA 4KH5A 3CETA 3VETA 5AZJB 5ADXA 4I6MB 1GLAG 5KPZA 2FSNA 4GNIA 3QBXA 5AQWA 1DEJA 2P9IA 4GY2B 3VEWA 2ZJQL 3CIPA 2QW9A 1RGIA 3F2KA 4QS8A 1BG3A 5AQKA 3TU5A 1NGEA 4H5RA 4DCHA 3CERA 3TTCA 4WQ5C 1MWMA 1BO5O 2QM1A 1X9JA 1OVYA 4FWOA 4FOIA 3P39A 5BN9A 2YX6A 4FWNA 2RHKA 1ILYA 3WQTA 4JHDB 3CC2N 4JKFA 3A8YA 5AQPA 1KAYA 3G4SN 3MN7A 3EO3A 3HTVA 4GVEA 5AQGA 4CZGA 3E9PA 4GXBA 3MN5A 1Q7YO 4JD2A 2P9SA 3CHWA 4J8FA 1DIKA 3EZWA 4CZFA 5KPRA 4H5NA 4PKGA 3CMEN 3BP8A 4U67L 3QBWA 2ABDA 4HTLA 5LY3A 2YI1A 2P9UA 5BREA 2BTFA 1D4XA 1LCUA 5GIPA 4KH4A 4EAHD 1WUAA 2ZWHA 4CZMA 1SZ2A 5ADXH 4BG9A 5BRDA 2CGLA 3NVKA 2P9LA 3CXCM 2HBMA 3RSEB 4FPAA 3VEVA 5JLHA 4ILJA 1ATNA 4IO8A 3VEOA 3WT0A 3H1QA 4PHTX 1BUPA 1K9MO 1VQ6N 1ZXOA 3GE1A 2GTDA 4E1JA 4JK9A 2Q2RA 5AQIA 4XH4A 3U8ZA 3DJCA 4CYEA 4A61A 5JICA 3FZLA 3IMXA 4H0PA 3VOVA 5AQYA 3WXJA 1BA1A 4BC2A 5E26A 1ATRA 4HWIA 3LM2A 2E2PA 5M1NA 1Z6RA 3BINA 5BRHA 4M7YA 3ULEA 5AQHA 3WXIA 2E2QA 3OHRA 4IJNA 3J7ZO 2YJFA 3DXMB 1MIXA 4K42A 4WFNL 4IOCL 3A5MC 4O8KA 4A57A 5F0XA 3VENA 4H5VA 3TPQA 4WF9L 4ILGB 1KXPA 1SGHA 2RQ1A 1QZ5A 3MCPA 3BF3A 5C10A 2YJEA 4L3QA 4BGAA 3VEYA 3H45C 3R9PA 4CZIA 3O9RA 4WQ4A 1T6CA 1VQMN 4H0XB 1HKGA 3ZX2A 1EQYA 3E66A 4MO5A 2NRVA 2D0PA 3CCQN 4IFEA 1NGIA 1NGFA 3D2EA 2YHWA 2EWSA 1GG3A 4FOEA 3VTIA 3FZFA 2V7YA 3MX5A 3CI5A 5BPMA 4YOWA 3PIOL 4JKBA 3R8EA 5FPMA 3CF5L 5GADP 5JLFA 4BROA 2CH5A 1OKJA 4NLCA 3EPYA 5EXWA 3A5LC 3MWPA 2IVOA 4BR9A 4WYBA 4BRKA 1JJ2M 2P9KA 3WXKA 3C7NB 3OW2M 3MWTA 1MK7B 1HX1A 3ZETB 4IZ9A 1GLCG 2IVNA 5C12A 1S72N 4WFBL 2YHXA 2AP1A 2FXUA 3O9QA 2GWKA 4ZRJA 3MMVA 2A6AA 2NRRA 1YUWA 3CC7N 1T44A 3CMAN 3AAPA 4FWLA 3AARA 2QWPA 4FSVA 5AQFA 2CGKA 3VGLA 3IFRA 4BG8A 1KD1O 4WFAL 3QIJA 3QFPA 4Z94A 2I1JA 3EE9A 3O1WA 3VEZA 5JVHL 3EE8A 3CCEN 1W97L 2A3ZA 3EN9A 3LDOA 2E8AA 3LM9A 3MDQA 4FWPA 4R79A 3QFUA 2P9NA 4EHTA 3GL1A 2CQUA 5GAHP 5AQLA 2ZJPL 2I7NA 5AR0A 3PIPL 3O9SA 4XEIA 3CCUN 2BUPA 3CQXA 4JK7A 3CJ1A 1KC7A 2F9WA 2NRHA 4CZKA 3I55N 3FLCO 3CPWM 1E4GT 4BRLA 5AZJA 4I6MA 2HF4A 3EKUA 4H5TA 3S41A 1ZBSA 2E88A 2R82A 4MDAA 5AFUH 3VF4A 5LJVA 3M3ZA 3ZX3A 4IO9L 1NVLA 3L0QA 1MK9B 2HOEA 5FPEA 3DXKB 4U7BA 3NMUA 1P90A 5M1FA 2VWBA 2OTJN 4CZEA 1VQ4N 3CQYA 3E9OA 3UKRB 4CD1A 1GC6A 2KHOA 2ZGYA 4BRQA 4IWVA 5DM7L 3F5TA 2V51B 1QVFM 1BDGA 3F9MA 4JHDA 5AQOA 4IJAA 2J4RA 2D11A 2NRTA 3O5BA 3U9DA 2QWNA 3CPEA 1V4SA 3FZKA 1T6DA 1LOTB 1NGJA 3UKUB 4BR5A 4QS9A 3IUCA 5AQZA 3ZDTA 5KQDA 1NTIA 1VBGA 4P7IA 5B8HA 5TKYA 3L6QA 1XUPO 2DIKA 2ZF5O 4DKWA 4H0VB 4EIAA 1VQNN 5KPTA 3ENBA 5AQRA 3SBGA 2E2OA 2NZTA 3H46O 4PL7A 4BY9C 3MX2A 3R6MA 5M1PA 3PLAA 4IOAL 1H1VA 4AF1A 3CCJN 1BOTO 3SMPA 5GAEP 1CZAN 3RSEA 5BPNA 3N4PA 1E4FT 3AU4A 4XH5A 1NGHA 4BR0A 3DAWA 5CHIA 4H5WA 1XQSC 4WQ4C 5CE3A 4BRNA 2E2NA 4IDHA 3JS6A 4PKHA 2P9IB 4FL9A 4OPHA 3Q7CA 5E84A 1Q86O 5C15A 4IXCA 2HBLA 4EKUA 4TKNA 2A5XA 3I33A 1KC8O 1NWKA 4JK8A 2IIRA 2AL6A 2ZGZA 3L4IA 3VTHA 4BR2A 3WEEB 1Q18A 3JXUA 4C23A 4F9OA 3O80A 3CCMN 4CZLA 1T3VA 4MLEA 3M6GA 1NBWA 3DXMA 2HF3A 1YIJN 3LDQA 3G6EN 1TUUA 2W41A 1NGDA 3HSCA 3WXMB 3I8BA 2WUSA 3CC4N 4YORA 3Q7BA 4LC9B 3KZBA 5C2DA 1SAZA 3FZMA 1VQ5N 2OANA 3HZ6A 1VBHA 2VGMA 2QWQA 1YJNN 2WC9A 3OA9A 3FP5A 1C0GA 2JWLA 3ENHA 1K8AO 3QICA 3LL3A 3CCVN 1NGAA 1O13A 2COPA 2A42A 1VAZA 2KKZA 1M1KO 3O1BA 4O8UA 4JKEA 4RCHA 3A0IX 1YVNA 4PL8A 2GEMA 4JKGB 2D0OA 2QWRA 3FFKB 2J0MA 1U6ZA 1YF5L 4JNEA 3WA0A 2GWJA 2J0JA 1HJOA 3OBWA 3RVCA 5BN8A 1ACAA 1GGOA 2NRZA 5M1QA 3PVLA 3G71N 2D4WA 2ASOA 3VESA 3PZDA 3P38A 3P4IA 3SJHA 4BR7A 4GV3A 3G25A 4A59A 1H4RA 1TUYA 3A5NC 1SQKA 3C7NA 3ZETA 3HOTA 1HPMA 5EX5A 5AQQA 1XC3A 2EMTA 2Q31A 4JAXA 1NGCA 2QI2A 2VCPA 3OBYA 4B1WB 5AFUA 4EHUA 2HBKA 1K8KB 2BH1A 1GC7A 1BU6O 1HLUA 1QQMA 3UB5A 3QB0A 4CBUA 3DWLA 2P9PB 1IJJA 3GG4A 1QQNA 2GUPA 4FWSA 1YXQA 3FGUA 4YOUA 1MWKA 4YOTA 1VQPN 2RE2A 4H03B 4O5FA 5AQMA 3C0BA 3J8AA 1N8RO 1U2VB 3MCAB 4K43A 4BGBA 1SS6A 2D2QA 4DXAB 5LJWA 2HBJA 1JCGA 4HDQA 4A5BA 4H0YB 1MA9B 3FLVA 2HRJA 1TYQB 3FR0A 3R3LA 3AU5A 1V4TA 3ATVA 4K41A 4B1ZA 1JCFA 2HSTA 1J6ZA 3AAQA 5AQNA 3WXLA 3DXKA 4ILHA 3W0LA 4IEEA 1ISNA 1Y64A 2QA4N 1NGGA 3FZHA 3EL2A 3UKRA 1EF1A 5EOYA 3CCRN 4C1NK 5CR4A 3FE1A 4FWQA 1HB6A 2A40A 3D6RA 1BA0A 1MIZB 2WH5A 2IVPA 3E1YA 4BREA 4RTFD 3TSQA 3N4QA 3WUHA 2W40A 3UKUA 2FF3B 3IDHA 1QHAA 4KBOA 3IVFA 1X3NA 3HBTA 2LBBA 3H1VX 1NLVA 3VEXA 3TTFA 2V7ZA 3D2FB 4FWRA 4F7GA 5AZIB 4MLHA 4AM7A 1W2BM 2QEXN 3U9ZA 2YVCA 3CD6N 4CD3A 3T69A 2GX9A 3GDQA 4BQLA 4FO0A 5IJMA 4GV9A 2WFBA 3SAFA 2J0KA 1GLLO 4NB4A 4B9QA 3BUZB 3W3DA 5DM6L 1NM1A 3P31A 3H3NO 3VERA 1HKCA 3C6HA 2A41A 3LDNA 3MN6A 1BWFO 2ZPYA 4DB3A 5C0YA 2UYTA 3K9JA 3ZEUB 3ZYYX 5FPNA 4BRIA 1K73O 3O9TA 4DHYA 2Q0RA 2QWLA 3SK3A 4A2BA 4FVUA 4WCEL 3O6WA 3WEEA 2I1KA 2CH6A 4BC5A 3SMSA 1GLDG 2PFUA 4BRHA 1VQKN 4RWTA 1DKGD 3CJCA 2E1ZA 4IEIA 3AGRA 4YDUA 3E9LA 4NY0A 3VGMA 3AGKA 2E20A 1KAXA 2CB8A 1ATSA 2PAVA 4BRFA 3G9WA 4G9ZA 1KAZA 2Q97A 2VYPA 3QDKA 5JVLA 3GOIA 3HM8A 5JMVA 1R59O 4JN4A 4M7XA 5EY4A 4CI6A 4AM6A 4YOVA 1HUXA 4JEPA 2HE7A 3TTDA 1IG8A 3MN9A 1Q82O 2JWKA 3ATUA 4BR4A 4JD2B 2P9SB 1QVGM 1MDUB 3KVGA 5M1OA 3LDLA 3T7ZA 3TSUA 4BRCA 3SBTA 4DQ8A 4FPBA 4A5AA 1QQOA 3CJ9A 5BRFA 3IKMA 3HI0A 1VQ8N 5F2RA 2P9UB 4BRPA 2WBNA 3EKSA 1JCEA 2YCHA 4MO4A 2ITMA 5FPDA 1YJWN 4JKGA 3O08A 5AQSA 1NJIO 1Q81O 1M90O 4JKCA 1JDEA 2D1KA 3KK7A 2FSKA 2P9LB 3O4WA 5I9EB 3NVMA 3KWGA 4WQ5A 2FF6A 3U4LA 1J19A 1ZC6A 1G99A 3ID8A 4ISFA 4OO1J 1QZ6A 2I7PA 4B1XB 3WQUA 1GLJO 1NMDA 1S3XA 1KQSM 2FSJA 4CBXA 3ZX0A 2ZJRL 3B8AX 1S22A 5GIOA 5HL7L 1VQLN 4K25A 1Z05A 4ISGA 5F1XA 1ST7A 3VPZA 4YOYA 1K8KA 1HKBA 1HB8A 3ULEB 5BR9A 1P8ZA 4YOXA 5AQXA 1VQON 1YHQN 4XH1A 2GELA 2P9PA 2VGNA 1X3MA 1E5WA 2E1YA 2FLOA 4MDBA 2Q1NA 1DGKN 4JKAA 2KLAA 3C6AA 3HOSA 4CJ7A 3H3OB 4BC3A 5KQ8A 2NRXA 1U2VA 4GV6A 1YJ9N 4BRMA 5GAGP 4NLBA 5GINA 3CJ7A 3SLCA 5JVGL 4YL8A 3ENOA 1GLEG 2Q0UA 3U7DA 2HMPA 4BC4A 2ASPA 4CZHA 1NI2A 5ELZA 1TYQA 3H6EA 1DT9A 2V52B 4BQZA 2QXLA 2QWOA 5AQJA 5MLCQ 3D2EB 5AQTA 1WOQA 1RDUA 3R1XA 5BPLA 3DLLL 4FWKA 2X0SA 1C0FA 3CJBA 3CCLN 2PBDA 3VF2A 4CBWA 4M63C 3U8XA 4BRDA 4B1UB 3BEXA 3BF1A 3M1FA 3TSPA 4ISEA 4ZRKA 3X23A 4B1VA 4PKIA 4UY8O 3GBTA 2QWMA 1GLBG 4A62A 3QMLA 3CJAA 1KBLA 2F7TA 2D10A 4H0OA 2P9KB 3UE5A 2NRWA 3I56N 2H3GX 1RDWX 3HRGA 3KWIA 5TKWA 3O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENB A;  3SBG A;  4JKH A;  3E9O A;  4JKB A;  3SBT A;  4JKD A;  4ILG B;  4ILJ A;  4JKG A;  4JK7 A;  4JKA A;  4JKF A;  4JKC A;  4JK9 A;  4JK8 A;  4ILH A;  4JKE A;  3E9L A;  3E9P A;  4JKG B;  3E66 A; 
#chains in the Genus database with same CATH topology
 3SNN A;  4C1N I;  4M3Y A;  4JKH A;  5M1K A;  2FJ9 A;  2PY5 A;  4ZRI A;  4BRA A;  1YAG A;  1IKW A;  2NLX A;  2FDQ A;  1EX4 A;  4X62 K;  5C25 A;  5C2F A;  4FWM A;  3SAG A;  3HT3 A;  3AA5 X;  1RFQ A;  5EVZ A;  2HNZ A;  4A2A A;  3V9W A;  2Q36 A;  3ID6 A;  3OJU A;  3DRS A;  4H0T B;  4BDY A;  3VGK A;  3EY1 A;  3HP9 A;  5I3U A;  5AQU A;  2NNW A;  5HRR A;  4M3Z A;  3CET A;  3VET A;  4CGF A;  5ADX A;  4GNI A;  4AHT A;  5AQW A;  4GY2 B;  4C8K A;  2WTU A;  4DS4 A;  3CIP A;  4FK0 A;  2QW9 A;  1RGI A;  3F2K A;  5AQK A;  3HPG A;  3TU5 A;  2KFZ A;  4DV1 K;  4DR6 K;  3P39 A;  5BN9 A;  2RHK A;  1ILY A;  3WQT A;  1NK5 A;  4DV6 K;  3MXJ A;  3RRG A;  3LPU A;  2RN2 A;  1ZYQ A;  3SI6 A;  1LWE A;  4GXB A;  3HVT A;  3NF7 A;  3WNE A;  1Q7Y O;  3EZW A;  2Y1J A;  2E6L A;  5KPR A;  4H5N A;  4PKG A;  4ZHR A;  2HHU A;  4DTM A;  1WAF A;  3SJJ A;  3QBW A;  2ABD A;  4KI6 A;  2P9U A;  3ZSZ A;  5BRE A;  1NK6 A;  4FJJ A;  3AVB A;  4KH4 A;  4CZM A;  3M8S A;  4BG9 A;  3NVK A;  1J5O A;  4IO8 A;  2F96 A;  1VQ6 N;  5KI6 A;  4JK9 A;  3T1H K;  4KRE A;  2KFN A;  4A61 A;  5T7B A;  3VOV A;  4LD0 A;  1NK0 A;  3I0S A;  1ATR A;  1S6Q A;  4OPK A;  4KI4 A;  3BIN A;  2XRI A;  1IH7 A;  2HHQ A;  2D0C A;  2E2Q A;  3OHR A;  1RT2 A;  2YJF A;  3DXM B;  1MIX A;  3A5M C;  4O4G A;  4DG1 A;  3VEN A;  3TPQ A;  4DQR A;  4LFA K;  3MCP A;  4DR7 K;  1WSE A;  1XWL A;  3VEY A;  3H45 C;  3R9P A;  4CZI A;  3O9R A;  1VQM N;  4H0X B;  3LAK A;  1HKG A;  3ZX2 A;  4MO5 A;  4CJQ A;  2D0P A;  1XNR K;  1NGI A;  1WNS A;  1NGF A;  3D2E A;  4FOE A;  3VTI A;  3FZF A;  1DTQ A;  2X74 A;  4YOW A;  3MX5 A;  4LF6 K;  4JKB A;  1WSH A;  5FPM A;  5JLF A;  2ZD1 A;  2YKM A;  1OKJ A;  4NLC A;  3NFA A;  2FBX A;  2HND A;  4CER A;  4FYD A;  4WYB A;  3OW2 M;  4JI6 K;  3ZET B;  1GLC G;  2YHX A;  2GWK A;  3MMV A;  1TKD A;  1YUW A;  1T44 A;  1HQE A;  2CGK A;  3VGL A;  4BG8 A;  1KD1 O;  3QIJ A;  1N34 K;  3PY8 A;  4Z94 A;  3VEZ A;  5JVH L;  1L3U A;  3EN9 A;  3MDQ A;  4OKJ A;  4DTN A;  3QFU A;  4CED A;  4DUY K;  2HB5 A;  2UUC K;  2OZM A;  4KTZ A;  1JL2 A;  2ETJ A;  3JYT A;  4XEI A;  3CCU N;  3CQX A;  4JK7 A;  4CZK A;  1OH5 A;  3FLC O;  1N36 K;  5AZJ A;  4DFJ A;  4E1N A;  5LMU K;  2HF4 A;  3S41 A;  3VF4 A;  4JI8 K;  3SUN A;  5LJV A;  1NVL A;  4CJV A;  2HMI A;  4JV5 K;  2YNG A;  4CZE A;  2OCE A;  3E9O A;  4V19 S;  1GC6 A;  1I39 A;  2KHO A;  4BRQ A;  3THV A;  3F5T A;  1GOA A;  1BDG A;  4JHD A;  3HO1 A;  5AQO A;  4IJA A;  2J4R A;  2D11 A;  2QWN A;  3CPE A;  1V4S A;  5HRP A;  4QS9 A;  3IUC A;  4HVJ A;  1WLJ A;  4PUO A;  2DFF A;  1VBG A;  5B8H A;  4WE1 A;  3L6Q A;  2DIK A;  1NK8 A;  1HMV A;  4CF2 A;  1WB9 A;  1TKX A;  2E2O A;  2I5J A;  4BY9 C;  5M1P A;  1NJW A;  4IOA L;  4M3R A;  3CCJ N;  2QKB A;  5GAE P;  3N4P A;  4I9L A;  4BR0 A;  4XH5 A;  2YHA A;  3DAW A;  5CE3 A;  2E2N A;  1RT1 A;  4IDH A;  3JS6 A;  4CHO A;  4B9T A;  4B9S A;  4CGI A;  4TKN A;  3I33 A;  3OYK A;  1JXB A;  1NWK A;  1B9D A;  2B5J A;  3ULD A;  4BE1 A;  4FM2 A;  3CFR A;  1C0U A;  1T3V A;  3DOL A;  1VSJ A;  3M6G A;  1NBW A;  2HF3 A;  1EKE A;  3LDQ A;  5FRN A;  1TUU A;  2G8F A;  1K6Y A;  4B9U A;  2O8B B;  5C24 A;  3DLR A;  1XNQ K;  3SCX A;  3NCI A;  3HZ6 A;  1YJN N;  3OA9 A;  4ICL A;  2JWL A;  3BDP A;  3QIC A;  1QSY A;  3CCV N;  1O13 A;  1W7A A;  1VAZ A;  1M1K O;  4RCH A;  4CK3 A;  2GEM A;  4JKG B;  4JNE A;  4KHU A;  3WA0 A;  3RVC A;  2HHT A;  5LL6 Z;  4DQQ A;  3PX0 A;  2ASO A;  3VES A;  1KVC A;  4BR7 A;  4GV3 A;  1FJG K;  4X65 K;  1N32 K;  3HOT A;  3MEC A;  4ELU A;  1XC3 A;  4DFP A;  4JAX A;  2QI2 A;  3OBY A;  4B3M K;  1BU6 O;  1HLU A;  1B9F A;  3J80 O;  1ZBI A;  1BIU A;  4CCH A;  3GG4 A;  4NYF A;  3KD1 E;  3HP6 A;  1QQN A;  2GUP A;  3C6T A;  1U2V B;  3K5O A;  3BZK A;  3MCA B;  4BGB A;  4K8Z A;  1SS6 A;  1KFD A;  4DXA B;  4RG8 A;  5LJW A;  1JCG A;  3U6F A;  1MA9 B;  4BAC A;  2QKK A;  4CVN E;  5J2N A;  1V4T A;  1HYS A;  4K41 A;  4DQS A;  4YNQ A;  1RT5 A;  2HST A;  3DXK A;  3W0L A;  1Y64 A;  1TL1 A;  3PO4 A;  4C1N K;  1ZBU A;  4JI2 K;  4BWM A;  3TAF A;  3NBP A;  3TSQ A;  1RTI A;  1KSP A;  3IDH A;  3MEG A;  4KO0 A;  3HBT A;  3H1V X;  3VEX A;  4AM7 A;  3D2F B;  4FWR A;  3QET A;  4CEQ A;  3SUP A;  1LWF A;  3L3V A;  2YNH A;  4CD3 A;  3T69 A;  1IO2 A;  4JI7 K;  2GV9 A;  3V4I A;  2J0K A;  2HVI A;  4NB4 A;  4B9Q A;  3BUZ B;  3W3D A;  2UUB K;  5J2M A;  1DTT A;  3K5L A;  3KK2 A;  3VER A;  3WNH A;  3C6H A;  2A41 A;  3MN6 A;  4DB3 A;  1U49 A;  4BRI A;  3G10 A;  3O9T A;  4WCE L;  3LAL A;  3WEE A;  3SV4 A;  3SMS A;  3K57 A;  1I3A A;  4CES A;  3WNF A;  5KGX A;  4YDU A;  3AGK A;  5AJ3 K;  2CB8 A;  4BRF A;  3M8R A;  1OVQ A;  1KAZ A;  2Q97 A;  3P5J A;  3GOI A;  5JMV A;  4AM6 A;  3O3F A;  4JEP A;  3T1Y K;  1IG8 A;  4CJF A;  3PSF A;  2XY8 A;  1GOB A;  1QQO A;  3CJ9 A;  5BRF A;  3ZSW A;  3ZT1 A;  2WBN A;  2YCH A;  4DSE A;  3V81 A;  2D1K A;  5I9E B;  3NVM A;  3KWG A;  4O5B A;  4WQ5 A;  1S6P A;  3ID8 A;  2HHV A;  1QZ6 A;  2I7P A;  3SZ2 A;  1S3X A;  4CIG A;  4J2E A;  2ZJR L;  5HL7 L;  1NKC A;  1ST7 A;  1HNV A;  3V6D A;  3ULE B;  1HB8 A;  5BR9 A;  3JSM A;  4TSX A;  3OYD A;  5AQX A;  1YHQ N;  3V9X A;  4GKK K;  4FJG A;  1X3M A;  2D0A A;  2E1Y A;  2FLO A;  4DQP A;  1DGK N;  1X1P A;  1XHX A;  4DTS A;  1OH8 A;  3LP2 A;  2BDP A;  4BE0 A;  4CJK A;  4BC4 A;  2ASP A;  5ELZ A;  4JRQ A;  5CZ1 A;  4CFB A;  2QXL A;  2O8E B;  4AHC A;  4JLH A;  5MLC Q;  1EWR A;  5BPL A;  4B9V A;  1WSG A;  3CJB A;  4B1U B;  3BF1 A;  4RW7 A;  1HJR A;  4UY8 O;  3VQQ A;  4FZY A;  2D10 A;  3LZI A;  4Z4F A;  3I56 N;  3VA3 A;  1I94 K;  1LAV A;  4IOX A;  4OPA A;  2DPN A;  1Q9X A;  2ASM A;  1GOC A;  5AZI A;  1YIT N;  4Q5V A;  4Z4I A;  1Y97 A;  4JKD A;  4KH6 A;  1QVG M;  4HDO A;  3OYJ A;  3TI0 A;  5HRS A;  2UXB K;  3KHY A;  2G8K A;  4BVO A;  4PQU A;  4BVP A;  3SAH A;  4DU1 A;  2GUI A;  1HBK A;  3C65 A;  1KLN A;  4C8O A;  4CGJ A;  4CK2 A;  1S1X A;  5KPZ A;  2O8F B;  4GW6 A;  3D0P A;  4QS8 A;  1BG3 A;  1RT7 A;  3AO4 A;  1HNW K;  1OVY A;  2YX6 A;  4FWN A;  3SQ1 A;  3A8Y A;  4AHR A;  1Q8I A;  3G4S N;  5AQG A;  4CHQ A;  3THY B;  4W5Q A;  3MN5 A;  4JD2 A;  2P9S A;  3V1R A;  1DIK A;  4B9M A;  1S1W A;  3KKS A;  2IAJ A;  4AQY K;  4DFK A;  3BP8 A;  3S3M A;  3THW A;  1IG9 A;  4N76 A;  1ZBF A;  3BY5 A;  1FKO A;  1WUA A;  3B6O A;  3VQE A;  5ADX H;  3RRH A;  2P9L A;  2HBM A;  3RSE B;  3VEV A;  2Z1H A;  3H1Q A;  2GTD A;  3BZC A;  5AQI A;  4XH4 A;  3U8Z A;  3VN5 A;  5JIC A;  5AQY A;  3QIO A;  1BA1 A;  5E26 A;  4DSF A;  2IC3 A;  3LM2 A;  3PSI A;  1Z6R A;  3QEW A;  4JS5 A;  5BRH A;  3J81 O;  1RNH A;  4IJN A;  1CZ9 A;  3T3F A;  2E5L K;  4IOC L;  3L8B A;  4O8K A;  3PX4 A;  3ZCM A;  4FLY A;  1ASW A;  4WF9 L;  4ILG B;  1BI4 B;  1KXP A;  5C10 A;  4YHH K;  4L3Q A;  4IBN A;  4PWD A;  1T6C A;  3L2R A;  3DI6 A;  3P1G A;  4F2R A;  1F21 A;  2Q3S A;  1J9A A;  1RDC A;  2V7Y A;  3CI5 A;  5BPM A;  1NG9 A;  3R8E A;  1IV0 A;  4OKE A;  1LAW A;  5EXW A;  1BL3 A;  3MWP A;  4BR9 A;  4E1M A;  1JLF A;  4Q0B A;  4BRK A;  1JJ2 M;  2P9K A;  5IT9 O;  1LW2 A;  4OX9 K;  1MK7 B;  4KHY A;  2IVN A;  5J2Q A;  5C12 A;  5K14 A;  2FXU A;  4ZRJ A;  3V9Z A;  2A6A A;  2NRR A;  1A5W A;  3DRP A;  3CMA N;  3AAP A;  4CEZ A;  3IFR A;  4CGG A;  3EE9 A;  3CCE N;  4Z4E A;  4FWP A;  4CJE A;  4R79 A;  4RW9 A;  4QCL A;  5HP1 A;  2P9N A;  3QEP A;  4EHT A;  3GL1 A;  1J5E K;  3O9S A;  3SPZ A;  4LSL A;  3CJ1 A;  2NRH A;  2XHB A;  2HHS A;  4QOZ B;  3RTV A;  1T05 A;  4I6M A;  4KHW A;  1X9W A;  5AFU H;  2EX3 A;  3VQ5 A;  1IBM K;  4NCB A;  4IO9 L;  1MK9 B;  4GVM A;  2UU9 K;  5M1F A;  3PX6 A;  3VQP A;  3KLI A;  1RBV A;  3CQY A;  4DF4 A;  4OPJ A;  2E6M A;  4CD1 A;  4IWV A;  2V51 B;  1QVF M;  3TAN A;  3U9D A;  1ASU A;  3AVC A;  1LOT B;  1NGJ A;  1SKR A;  5AQZ A;  5KQD A;  2OZS A;  1NTI A;  3SQ2 A;  4P7I A;  4G1Q A;  3CM5 A;  1WSI A;  4DKW A;  3SPY A;  3ENB A;  4EP4 A;  5I42 A;  4O44 A;  2BGG A;  4DV0 K;  3MX2 A;  4LF4 K;  4FW1 A;  3SMP A;  1E4F T;  4H5W A;  4WQ4 C;  1NU0 A;  4KRF A;  4K0K K;  5E84 A;  3AO1 A;  5C15 A;  3PV8 A;  3DLK A;  4IXC A;  3K59 A;  3KLE A;  1YVU A;  1BIZ A;  2NUB A;  4BR2 A;  4C23 A;  5CYQ A;  3JXU A;  4MLE A;  3QNO A;  3JAM O;  3NDK A;  3I8B A;  3AVF A;  4KKO A;  4LC9 B;  3AA3 A;  1VQ5 N;  4M45 A;  2O8C A;  2WC9 A;  3FP5 A;  1K8A O;  3LL3 A;  1NGA A;  2COP A;  2KKZ A;  3O1B A;  4LSN A;  5J1E A;  4B3S K;  3QO9 A;  4JKE A;  3A0I X;  4PL8 A;  3FFK B;  5KTQ A;  1L3T A;  2GWJ A;  3OBW A;  3PO5 A;  4NXM K;  2NRZ A;  3G71 N;  4CJS A;  3PZD A;  2G8V A;  3C7N A;  2AJQ A;  1SQK A;  1HPM A;  1DLO A;  3K5M A;  5AQQ A;  3L2W A;  5CZ2 A;  4B3O A;  3QEI A;  2Q31 A;  4CHP A;  1NGC A;  2VCP A;  1HNI A;  4CJ4 A;  5AFU A;  1RT4 A;  2HBK A;  3O3H A;  1K8K B;  3UIQ A;  2BH1 A;  3QB0 A;  4KHS A;  2P9P B;  3AVK A;  1YXQ A;  3FGU A;  4J2B A;  1MWK A;  3QIN A;  4O5F A;  5AQM A;  1N8R O;  3J8A A;  3CFO A;  2O4I A;  5HLF A;  3ZSV A;  1NK4 A;  1IKV A;  1N33 K;  4CEF A;  2HBJ A;  4LFC K;  1HYZ A;  3J7A P;  4CJT A;  4Y1D A;  3AVH A;  4I7F A;  2HRJ A;  4CEE A;  4AH9 A;  4CHY A;  1VRT A;  3AAQ A;  4DUZ K;  5AQN A;  3WXL A;  4FLV A;  1NOZ A;  3DLE A;  1A5V A;  3LP1 A;  4IEE A;  1ISN A;  2QA4 N;  3UKR A;  4KHQ A;  3A2F A;  4AHU A;  4Z4H A;  3CCR N;  5CR4 A;  4KPY A;  1Z26 A;  1HB6 A;  1BA0 A;  3S3N A;  2IVP A;  1Q9Y A;  3N4Q A;  3WUH A;  2X6N A;  3UKU A;  4DSK A;  2FF3 B;  1QHA A;  4KBO A;  3G0Z A;  2ZM6 K;  1TK8 A;  4EZ9 A;  5LMN K;  3AO2 A;  2V7Z A;  1SUQ A;  3KLH A;  4F7G A;  3KK3 A;  4DF8 A;  3TAG A;  3L2Q A;  3P83 D;  1NMN A;  2UUA K;  2OA8 A;  3C94 A;  3SAF A;  2OPQ A;  2VQE K;  1X9S A;  3P31 A;  3H3N O;  4FCY A;  4ID1 A;  3NF6 A;  1HR0 K;  1RCH A;  2UYT A;  3I0R A;  5FPN A;  3IS9 A;  4CJ3 A;  3OYH A;  1N6Q A;  1U04 A;  3AA2 A;  1NKB A;  2I1K A;  3SV3 A;  3T1A A;  4E7K A;  2PFU A;  2FBT A;  4W5O A;  1XI1 A;  1DKG D;  2E1Z A;  3V9U A;  3VGM A;  4FJ8 A;  2IOC A;  1KAX A;  2G8W A;  2PAV A;  3G9W A;  3TAR A;  3OTO K;  5JVL A;  1R59 O;  4M7X A;  4CI6 A;  3DLB A;  1HUX A;  4LY7 A;  3HXM A;  3EZ5 A;  4FZZ A;  1KCF A;  1IKY A;  1Q82 O;  1NOY A;  3RMC A;  3KVG A;  5M1O A;  5HRO A;  3OYF A;  3HL8 A;  4DQ8 A;  4FPB A;  5CYM A;  5F2R A;  2P9U B;  3ZT0 A;  4B9L A;  2W42 A;  5HRN A;  5FPD A;  2ITM A;  3THX A;  4PA1 A;  1M90 O;  1Q81 O;  3RR8 A;  4B3T K;  4DFM A;  1SL1 A;  2YKN A;  1BGX T;  1NJZ A;  2FSK A;  2VWJ A;  4DR1 K;  3QEV A;  4DTJ A;  2FF6 A;  1J19 A;  4E89 A;  1ZC6 A;  3OJS A;  4OO1 J;  2G8U A;  1NMD A;  4RW6 A;  3B8A X;  4PY5 A;  4K25 A;  1Z05 A;  4FJ7 A;  5F1X A;  3VPZ A;  1HKB A;  3EYZ A;  4HUF A;  4HUG A;  2VGN A;  4NCA A;  4JKA A;  4LH5 A;  1KLM A;  5FLX O;  2F8S A;  4GV6 A;  4BRM A;  5GAG P;  1NNE A;  1QSL A;  3VQB A;  3V1Q A;  4DTR A;  2VG7 A;  4YL8 A;  3ENO A;  3U7D A;  2HMP A;  4CZH A;  3ZT4 A;  1TYQ A;  3H6E A;  4DMN A;  5AQJ A;  3D2E B;  2X0S A;  3CCL N;  3VF2 A;  4ISE A;  3MED A;  1EXQ A;  1GLB G;  3SYZ A;  2F7T A;  3QNN A;  3HRG A;  1RDW X;  3KWI A;  5TKW A;  4CFC A;  2AA4 A;  4ZTF A;  1Y19 B;  5AQV A;  3M5R A;  1C1C A;  3LDP A;  5EU7 A;  3VF6 A;  3CCS N;  1VQ9 N;  5HOO A;  4Y1C A;  3AY9 A;  4EFH A;  4AHS A;  4W5R A;  3RMA A;  4B1V A;  3VMF B;  3D7E O;  4QS7 A;  3EEQ A;  1YI2 N;  1ESV A;  4NO7 A;  3DLG A;  2OTL N;  2CGJ A;  3B6P A;  2EMS A;  4JI0 K;  3O9U A;  1NGB A;  4E7L A;  1RTD A;  3ISN C;  4Y0W A;  2KQ2 A;  4NYN A;  3ZEU A;  3D45 A;  3ZSX A;  5AZJ B;  1YTU A;  1KTQ A;  1GLA G;  2FSN A;  3LZJ A;  1DEJ A;  3MXI A;  1C1B A;  4LF7 K;  1NGE A;  4H5R A;  4DCH A;  3IAY A;  1S5J A;  3TTC A;  3U3G A;  1MWM A;  2QM1 A;  1X9J A;  4FOI A;  3AVI A;  3IRX A;  4JHD B;  3CC2 N;  4JKF A;  1KAY A;  3M8P A;  3MN7 A;  5SZT A;  3EO3 A;  3HTV A;  4CZG A;  3OYM A;  3E9P A;  1JLE A;  2BE2 A;  3L2U A;  1VSI A;  3CME N;  4KTQ A;  1T8E A;  3NH2 A;  4HTL A;  5LY3 A;  1W0H A;  1EWQ A;  3OY9 A;  2BTF A;  1VSH A;  5GIP A;  4HCC A;  3ZT3 A;  1SZ2 A;  5SWM A;  4FPA A;  2OTJ N;  5JLH A;  3WT0 A;  1ATN A;  1K9M O;  1BUP A;  2Q2R A;  3QEX A;  4CYE A;  3IMX A;  4H0P A;  3WXJ A;  4BC2 A;  4HWI A;  4M7Y A;  3KLF A;  2HHW A;  5AQH A;  3WXI A;  3J7Z O;  4J2A A;  3MXM A;  1TKZ A;  4A57 A;  4CJ5 A;  2RPI A;  3S9H A;  4E3S A;  2RQ1 A;  1U45 A;  2YJE A;  4DR3 K;  4OLB A;  4BGA A;  3THX B;  4DTU A;  3ZSY A;  3VQ8 A;  3KD5 E;  1EQY A;  3E66 A;  4X66 K;  2NRV A;  3CCQ N;  4IFE A;  2EWS A;  2P5G A;  1GG3 A;  4BWJ A;  1CXU A;  2UXC K;  4L8R B;  2X78 A;  4IG0 A;  3CF5 L;  4FJ5 A;  2WON A;  2CH5 A;  3EPY A;  3QLH A;  1TV6 A;  2IVO A;  2O8D A;  4LF8 K;  3OYA A;  3MWT A;  1HX1 A;  4IZ9 A;  1QS4 A;  2WOM A;  2AP1 A;  3O9Q A;  4N56 A;  3AO3 A;  4CF8 A;  2QWP A;  4I2P A;  4FLW A;  2I1J A;  3O1W A;  4JI4 K;  3DM2 A;  3EE8 A;  1W97 L;  2Z1I A;  3LDO A;  2E8A A;  3LM9 A;  1TGO A;  2I7N A;  2W6L A;  1NK7 A;  2Z1J A;  3AVJ A;  2F9W A;  3OYE A;  3I55 N;  3SQ4 A;  3NF9 A;  4BRL A;  4ELT A;  3VQC A;  5BR8 K;  4H5T A;  1ZBS A;  1WBB A;  3M3Z A;  3NMU A;  3L0Q A;  5FPE A;  3DXK B;  1P90 A;  5DK5 A;  4HCB A;  3O4N A;  1YT3 A;  4IG3 A;  1A5X A;  1XMQ K;  1VQ4 N;  1QTM A;  5FRO A;  1TL3 A;  1S1U A;  1UWB A;  3F9M A;  3K2P A;  4FJI A;  3NGZ A;  2NRT A;  3O5B A;  1C1A A;  1T6D A;  4CIE A;  1LV5 A;  4N47 A;  4BR5 A;  4E7I A;  3AVN A;  5TKY A;  1XUP O;  4H0V B;  3LWL A;  5KPT A;  4F2S A;  3KLG A;  3SBG A;  4PL7 A;  1G15 A;  3R6M A;  3VQD A;  4CF1 A;  2KTQ A;  2LSN A;  1BOT O;  2IS3 A;  4H8K A;  3CYM A;  1CZA N;  5BPN A;  4GMJ B;  1FKP A;  1NGH A;  4M3W A;  1XQS C;  4DLE A;  4PKH A;  1RT3 A;  2VQF K;  4OPH A;  4ZTJ A;  3HPO A;  1Q86 O;  4JI1 K;  1EET A;  3ZSR A;  2A5X A;  2ZGZ A;  3VTH A;  3SQ0 A;  3WEE B;  1Q18 A;  4F9O A;  2DFE A;  3O80 A;  2KZZ A;  4CZL A;  3DXM A;  1YIJ N;  3G6E N;  4JRP A;  3HVR A;  2FC0 A;  3T19 A;  3AVA A;  3HSC A;  3WXM B;  4CK1 A;  3Q7B A;  3KZB A;  2OAN A;  2YNI A;  1VBH A;  2VGM A;  4B8A B;  1J54 A;  4FJM A;  2X6S A;  2A42 A;  1RBS A;  4O8U A;  3TR8 A;  3OS0 A;  1YVN A;  1UOC A;  1HNX K;  2D0O A;  4IKF A;  2J0M A;  1TAU A;  1BCM A;  5BN8 A;  1HJO A;  1GGO A;  4W5N A;  4DU3 A;  4O0J A;  4DR2 K;  4JYA K;  3P38 A;  3L3U A;  3P4I A;  4OGC A;  4A59 A;  1H4R A;  3A5N C;  4C8N A;  3ZET A;  4DTP A;  3VQ9 A;  5A2Q O;  3NH0 A;  3VQ4 A;  3KKR A;  2EMT A;  1HPZ A;  1L5U A;  4B1W B;  1MU2 A;  3CG7 A;  3FFI A;  1GC7 A;  3UB5 A;  1QQM A;  4CBU A;  3DWL A;  4DQI A;  4YOU A;  4FWS A;  4CJP A;  3AA4 A;  4BE2 A;  1U48 A;  2RE2 A;  1W9H A;  2VG6 A;  4M41 A;  3K5N A;  1HQU A;  2D2Q A;  4FW2 A;  3NAE A;  4Z4G A;  4HDQ A;  5FRM A;  1OH7 A;  3FLV A;  4JI3 K;  3AU5 A;  4N5S A;  4B1Z A;  4FJK A;  1JCF A;  3NGI A;  1J6Z A;  5KGW A;  1SL2 A;  5CY4 A;  4ILH A;  3VA0 A;  3O3G A;  2VG5 A;  1NGG A;  3FZH A;  1NJX A;  1EF1 A;  5EOY A;  4KHP K;  2A40 A;  1SV5 A;  1NK9 A;  3D6R A;  4BRE A;  3MAQ A;  3ASM A;  4FLX A;  4KB0 A;  4FJH A;  1NLV A;  1SKS A;  1W2B M;  5AZI B;  2QEX N;  3TAB A;  4DU4 A;  1NKE A;  2WFB A;  3O4Q A;  4CJW A;  5DM6 L;  3OYB A;  4AHV A;  1U47 A;  3OYL A;  1HKC A;  4LFB K;  4OLA A;  3IG1 A;  5C0Y A;  3K9J A;  1K73 O;  1FK9 A;  1CXQ A;  4FVU A;  4DV4 K;  2CH6 A;  5J2P A;  1GLD G;  3K0S A;  3CJC A;  3AGR A;  4G9Z A;  4BDP A;  2O8B A;  3QDK A;  3HM8 A;  4ID5 A;  4YOV A;  4JN4 A;  5EY4 A;  1XHZ A;  4FJL A;  4JD2 B;  2P9S B;  1BHL A;  3T7Z A;  3LDL A;  1WSJ A;  3SBT A;  3KIO A;  1RDD A;  3IKM A;  1VQ8 N;  3THW B;  4B3R K;  4DV2 K;  3F9K A;  1XC9 A;  1JCE A;  4MO4 A;  1YJW N;  1NJI O;  4JKG A;  3O08 A;  5AQS A;  4NXN K;  4FLT A;  1X9M A;  1JDE A;  2YV0 X;  4CEA A;  3KK7 A;  2DFH A;  2P9L B;  3AVL A;  3U4L A;  3U3Y A;  3KJV A;  4B1X B;  2BAN A;  3WQU A;  4DSI A;  4C8M A;  4F3O A;  3RWU A;  3ZX0 A;  2JGU A;  4OKK A;  1S22 A;  5GIO A;  4YOY A;  4Z4C A;  4NCG A;  4YOX A;  4KB1 A;  3LP0 A;  1E5W A;  1ASV A;  2Q1N A;  3C6A A;  4CJ7 A;  1FXX A;  4HHT A;  3H3O B;  2KZM A;  4BC3 A;  5KQ8 A;  2NRX A;  1U2V A;  4CEC A;  4LF5 K;  4OJR A;  3HM9 A;  5GIN A;  3NH1 A;  2HHX A;  5JVG L;  2Q0U A;  1QQC A;  1ZBL A;  4CEB A;  1LWC A;  1RTJ A;  1C0M A;  4EP5 A;  2V52 B;  4BQZ A;  3DLL L;  5AQT A;  1RDU A;  3R1X A;  1JLC A;  3H08 A;  1C0F A;  4CGD A;  2PBD A;  4IFV A;  4CBW A;  4M63 C;  4CHZ A;  4CE9 A;  3TSP A;  4ZRK A;  3X23 A;  4PKI A;  1UA0 A;  1RDB A;  4DTX A;  2JLE A;  4A62 A;  4M3U A;  3CJA A;  1KBL A;  4FM1 A;  2O4G A;  4H0O A;  4IFY A;  2P9K B;  3O8M A;  2FBV A;  1JL1 A;  3A5O C;  4CZJ A;  2F9T A;  4EZ6 A;  3L4Q A;  1VRU A;  3S3O A;  4K8X A;  4FK4 A;  3D2F A;  1VQ7 N;  2AEH A;  1JLA A;  2YHY A;  4YDU C;  3K9K A;  2B4J A;  4U67 L;  3TWH A;  1EO1 A;  5H1S Q;  3MK6 A;  1HRH A;  4E7J A;  3ZSQ A;  1GLF O;  1CLQ A;  2QTD A;  2P9N B;  2XY5 A;  4B1Y B;  4BRG A;  1E3M A;  3K58 A;  3HJF A;  4KV8 A;  1VSK A;  2HHH K;  4KH5 A;  2HVH A;  4I6M B;  3QBX A;  3V9S A;  2P9I A;  3LPT A;  1D8Y A;  3VEW A;  2ZJQ L;  3SUQ A;  1IKX A;  4CGH A;  4CJR A;  3ZLJ A;  4MQ3 A;  3CER A;  4IDK A;  4WQ5 C;  4CEO A;  1BO5 O;  4FWO A;  1RIL A;  1ITG A;  1UAX A;  5AQP A;  3VQ7 A;  1S9G A;  1KVB A;  4GVE A;  4DLG A;  3DYA A;  5HBM A;  3CHW A;  4J8F A;  4CZF A;  2EHG A;  4FJ9 A;  2YI1 A;  1D9F A;  1D4X A;  1BIS A;  1D5A A;  1HYV A;  1LCU A;  4EAH D;  1IBK K;  2ZWH A;  5BRD A;  2CGL A;  2UXD K;  3CXC M;  3CFP A;  4ILJ A;  3VEO A;  4PHT X;  1ZXO A;  3GE1 A;  4E1J A;  3M8Q A;  3DJC A;  3TAQ A;  1L3V A;  3FZL A;  2A1S A;  5M1N A;  2Y1I A;  2E2P A;  3RR7 A;  1OH6 A;  1LW0 A;  3ULE A;  2D0B A;  2KW4 A;  5D3G A;  4OVL A;  4WFN L;  4K42 A;  4HTU A;  3TAE A;  4FK2 A;  4FZX C;  3LP3 A;  5F0X A;  4H5V A;  2G8I A;  1SGH A;  1QZ5 A;  3BF3 A;  2RF2 A;  2O8C B;  4KHN A;  4WQ4 A;  3WNG A;  1S1T A;  2OYQ A;  3HK2 A;  4CFD A;  2O8E A;  2YHW A;  4KAZ A;  1RT6 A;  3OYI A;  3PIO L;  4CJL A;  1R0A A;  5GAD P;  1HNZ K;  1BCO A;  4BRO A;  1TK5 A;  3A5L C;  1ZBH A;  4DV7 K;  5KRT A;  3WXK A;  1WAJ A;  3C7N B;  1S72 N;  4WFB L;  2B6A A;  3CC7 N;  4FWL A;  3AAR A;  4FSV A;  5AQF A;  3TAP A;  4WFA L;  3QFP A;  3OS2 A;  2D5R A;  3KK1 A;  1WBD A;  2A3Z A;  1VSF A;  1N5Y A;  2CQU A;  5GAH P;  5AQL A;  2ZJP L;  5AR0 A;  3PIP L;  2BUP A;  1KC7 A;  4CF0 A;  4KTW A;  3CPW M;  1E4G T;  3KTQ A;  4ELV A;  3F73 A;  1RBU A;  3HST B;  3EKU A;  4DWI A;  2E88 A;  2R82 A;  4MDA A;  2F4V K;  2O8F A;  3ZX3 A;  2DTU A;  2HOE A;  3AV9 A;  2OPS A;  4U7B A;  2VWB A;  2RKI A;  3UKR B;  3ALY A;  5C42 A;  2ZGY A;  1TK0 A;  5DM7 L;  4H4M A;  4F4K A;  2ATQ A;  3DMJ A;  3V1O A;  2YNF A;  3LAM A;  3FZK A;  2DY4 A;  3UKU B;  3THY A;  2P51 A;  1JKH A;  3ZDT A;  4CW7 B;  2ZF5 O;  4XIU A;  4DSJ A;  4M3X A;  4M3T A;  4EIA A;  1VQN N;  5AQR A;  2NZT A;  3H46 O;  1WSF A;  3PLA A;  4FJN A;  1H1V A;  4AF1 A;  1TAQ A;  1C0T A;  4KFB A;  1FW6 A;  3RSE A;  2HNY A;  5CHI A;  4Z0U A;  3AU4 A;  2G8H A;  1VK0 A;  3C6U A;  4CIF A;  4BRN A;  1U4B A;  2P9I B;  4FL9 A;  4B8C A;  3Q7C A;  1L3S A;  2A1R A;  4E19 A;  2HBL A;  1T03 A;  4C8L A;  4EKU A;  1KC8 O;  3L4I A;  4JK8 A;  2IIR A;  2AL6 A;  1T7P A;  2F8T A;  3HPH A;  3AVM A;  3CCM N;  4LF9 K;  2VWK A;  1JLQ A;  4E0D A;  2W41 A;  1NGD A;  2WUS A;  3AVG A;  2PYJ A;  4F3T A;  5FDL A;  3CC4 N;  4YOR A;  1BI4 A;  5C2D A;  1J53 A;  1SAZ A;  3FZM A;  4FM0 A;  4J2D A;  2QWQ A;  1C0G A;  5DMR A;  3ENH A;  2XO7 A;  2OPR A;  1VSM A;  3LAN A;  3CM6 A;  2QWR A;  4RW4 A;  1U6Z A;  1YF5 L;  4O55 A;  2J0J A;  1UA1 A;  1ACA A;  2P1J A;  4I9Q A;  5M1Q A;  4CJU A;  3PVL A;  4W5T A;  3I8D A;  1TKT A;  2D4W A;  4R5P A;  1EP4 A;  3SJH A;  2QXF A;  3G25 A;  1TUY A;  3QES A;  5EX5 A;  3HYF A;  3LWM A;  3ZSO A;  1REV A;  4EHU A;  4YY3 K;  1IJJ A;  3OS1 A;  1VQP N;  4YOT A;  3VQA A;  1KFS A;  1QSS A;  4H03 B;  1NJY A;  1CZB A;  3C0B A;  1KRP A;  4DSL A;  4FJX A;  4M42 A;  4K43 A;  3VQ6 A;  3L2V A;  2GBZ A;  4A5B A;  4H0Y B;  4HUE A;  1S1V A;  1RBT A;  4FLZ A;  1TYQ B;  3FR0 A;  3R3L A;  4YFU A;  1YTA A;  3ATV A;  1JLB A;  3EL2 A;  2R7Y A;  3FE1 A;  4FWQ A;  2ITG A;  3OYC A;  2PZS A;  1RDA A;  4FLU A;  1VHX A;  1MIZ B;  2WH5 A;  1KVA A;  3E1Y A;  3J7Y P;  4RTF D;  2FBY A;  2W40 A;  3IVF A;  4QAG A;  1X3N A;  3NGY A;  2LBB A;  1TVR A;  3MEE A;  2XY6 A;  1BQN A;  3TTF A;  3NE6 A;  2ZQB A;  2OPP A;  1SKW A;  4MLH A;  3U9Z A;  2YVC A;  5KRS A;  3CD6 N;  4RW8 A;  2GX9 A;  2W6K A;  3GDQ A;  4BQL A;  4FO0 A;  5IJM A;  4DR4 K;  2ZE2 A;  4GV9 A;  1GLL O;  4AIL C;  1BQM A;  1RBR A;  1NM1 A;  4E7H A;  4F8R A;  2XY7 A;  1JXE A;  4OGE A;  4CHN A;  4GKJ K;  1Z25 A;  3LDN A;  1BWF O;  1C6V A;  2ZPY A;  3ZYY X;  3ZEU B;  1VSE A;  3ZT2 A;  4FXD A;  5JS2 A;  4DHY A;  2Q0R A;  2QWL A;  3RMD A;  1VSD A;  3SK3 A;  4A2B A;  4I2Q A;  3DRR A;  3O6W A;  4JS4 A;  3C95 A;  1S9E A;  4BC5 A;  4BRH A;  1VQK N;  2IDO A;  4RWT A;  3OVN A;  4IEI A;  1IBL K;  3E9L A;  4NY0 A;  1SL0 A;  2E20 A;  1ATS A;  3PUF A;  2VYP A;  3OYN A;  2E4L A;  3DLH A;  2HE7 A;  3TTD A;  3MN9 A;  2JWK A;  3ATU A;  4BR4 A;  1MDU B;  3TSU A;  4BRC A;  4FVM A;  3RMB A;  4A5A A;  4CF9 A;  4DS5 A;  3HI0 A;  4BRP A;  4JI5 K;  3EKS A;  1RTH A;  3LDS A;  4JKC A;  3ITH A;  2HW3 A;  3DOK A;  1XMO K;  4DV5 K;  3O4W A;  4H4O A;  4UQG A;  1G99 A;  4ISF A;  3CQ8 A;  3NHG A;  4DR5 K;  5E41 A;  3SUO A;  3QIP A;  1GLJ O;  4X64 K;  1KQS M;  2P5O A;  2FSJ A;  4CBX A;  1VQL N;  4ISG A;  2Z1G A;  1K8K A;  1P8Z A;  1VQO N;  4XH1 A;  2GEL A;  2P9P A;  4MDB A;  2KLA A;  4B9N A;  1QHT A;  5IWA K;  3HOS A;  3AO5 A;  3OYG A;  2IGI A;  1YJ9 N;  2YHB A;  4NLB A;  1JLG A;  3CJ7 A;  3SLC A;  3NF8 A;  2QK9 A;  1GLE G;  5JS1 A;  1NI2 A;  1DT9 A;  1QE1 A;  4B08 A;  3E01 A;  2QWO A;  1WOQ A;  4FWK A;  3QER A;  1WN7 A;  3U8X A;  4BRD A;  4BDZ A;  4DTO A;  3BEX A;  3M1F A;  2PYL A;  4CFA A;  4O0I A;  3GBT A;  4MFB A;  3TAM A;  2QWM A;  1B92 A;  3QML A;  4DV3 K;  1O1W A;  2O8D B;  4N41 A;  3UE5 A;  3BGR A;  2NRW A;  1D9D A;  2H3G X;  4LH4 A;  1VSL A; 
#chains in the Genus database with same CATH homology
 2AA4 A;  4C1N I;  3A5O C;  4CZJ A;  4IOX A;  4JKH A;  2F9T A;  4OPA A;  1Y19 B;  2FJ9 A;  2DPN A;  3L4Q A;  3M5R A;  5AQV A;  4ZRI A;  5M1K A;  2ASM A;  4BRA A;  1EO1 A;  1YAG A;  3LDP A;  3D2F A;  5AZI A;  1VQ7 N;  2AEH A;  3VF6 A;  3CCS N;  2NLX A;  2FDQ A;  1VQ9 N;  5HOO A;  3AY9 A;  2YHY A;  4EFH A;  5C2F A;  4YDU C;  4FWM A;  3K9K A;  3SAG A;  1YIT N;  4JKD A;  3VMF B;  1RFQ A;  3D7E O;  4KH6 A;  4QS7 A;  5EVZ A;  4HDO A;  3MK6 A;  4A2A A;  1ESV A;  5H1S Q;  1YI2 N;  4NO7 A;  2OTL N;  1GLF O;  2Q36 A;  3ID6 A;  2CGJ A;  2QTD A;  2P9N B;  3KHY A;  4B1Y B;  4BVO A;  2EMS A;  4BRG A;  4H0T B;  3O9U A;  1NGB A;  4BVP A;  3VGK A;  3SAH A;  4Y0W A;  3C65 A;  1HBK A;  2NNW A;  5AQU A;  3ZEU A;  4KH5 A;  3CET A;  3VET A;  5AZJ B;  5ADX A;  4I6M B;  1GLA G;  5KPZ A;  2FSN A;  4GNI A;  3QBX A;  5AQW A;  1DEJ A;  2P9I A;  4GY2 B;  3VEW A;  2ZJQ L;  3CIP A;  2QW9 A;  1RGI A;  3F2K A;  4QS8 A;  1BG3 A;  5AQK A;  3TU5 A;  1NGE A;  4H5R A;  4DCH A;  3CER A;  3TTC A;  4WQ5 C;  1MWM A;  1BO5 O;  2QM1 A;  1X9J A;  1OVY A;  4FWO A;  4FOI A;  3P39 A;  5BN9 A;  2YX6 A;  4FWN A;  2RHK A;  1ILY A;  3WQT A;  4JHD B;  3CC2 N;  4JKF A;  3A8Y A;  5AQP A;  1KAY A;  3G4S N;  3MN7 A;  3EO3 A;  3HTV A;  4GVE A;  5AQG A;  4CZG A;  3E9P A;  4GXB A;  3MN5 A;  1Q7Y O;  4JD2 A;  2P9S A;  3CHW A;  4J8F A;  1DIK A;  3EZW A;  4CZF A;  5KPR A;  4H5N A;  4PKG A;  3CME N;  3BP8 A;  4U67 L;  3QBW A;  2ABD A;  4HTL A;  5LY3 A;  2YI1 A;  2P9U A;  5BRE A;  2BTF A;  1D4X A;  1LCU A;  5GIP A;  4KH4 A;  4EAH D;  1WUA A;  2ZWH A;  4CZM A;  1SZ2 A;  5ADX H;  4BG9 A;  5BRD A;  2CGL A;  3NVK A;  2P9L A;  3CXC M;  2HBM A;  3RSE B;  4FPA A;  3VEV A;  5JLH A;  4ILJ A;  1ATN A;  4IO8 A;  3VEO A;  3WT0 A;  3H1Q A;  4PHT X;  1BUP A;  1K9M O;  1VQ6 N;  1ZXO A;  3GE1 A;  2GTD A;  4E1J A;  4JK9 A;  2Q2R A;  5AQI A;  4XH4 A;  3U8Z A;  3DJC A;  4CYE A;  4A61 A;  5JIC A;  3FZL A;  3IMX A;  4H0P A;  3VOV A;  5AQY A;  3WXJ A;  1BA1 A;  4BC2 A;  5E26 A;  1ATR A;  4HWI A;  3LM2 A;  2E2P A;  5M1N A;  1Z6R A;  3BIN A;  5BRH A;  4M7Y A;  3ULE A;  5AQH A;  3WXI A;  2E2Q A;  3OHR A;  4IJN A;  3J7Z O;  2YJF A;  3DXM B;  1MIX A;  4K42 A;  4WFN L;  4IOC L;  3A5M C;  4O8K A;  4A57 A;  5F0X A;  3VEN A;  4H5V A;  3TPQ A;  4WF9 L;  4ILG B;  1KXP A;  1SGH A;  2RQ1 A;  1QZ5 A;  3MCP A;  3BF3 A;  5C10 A;  2YJE A;  4L3Q A;  4BGA A;  3VEY A;  3H45 C;  3R9P A;  4CZI A;  3O9R A;  4WQ4 A;  1T6C A;  1VQM N;  4H0X B;  1HKG A;  3ZX2 A;  1EQY A;  3E66 A;  4MO5 A;  2NRV A;  2D0P A;  3CCQ N;  4IFE A;  1NGI A;  1NGF A;  3D2E A;  2YHW A;  2EWS A;  1GG3 A;  4FOE A;  3VTI A;  3FZF A;  2V7Y A;  3MX5 A;  3CI5 A;  5BPM A;  4YOW A;  3PIO L;  4JKB A;  3R8E A;  5FPM A;  3CF5 L;  5GAD P;  5JLF A;  4BRO A;  2CH5 A;  1OKJ A;  4NLC A;  3EPY A;  5EXW A;  3A5L C;  3MWP A;  2IVO A;  4BR9 A;  4WYB A;  4BRK A;  1JJ2 M;  2P9K A;  3WXK A;  3C7N B;  3OW2 M;  3MWT A;  1MK7 B;  1HX1 A;  3ZET B;  4IZ9 A;  1GLC G;  2IVN A;  5C12 A;  1S72 N;  4WFB L;  2YHX A;  2AP1 A;  2FXU A;  3O9Q A;  2GWK A;  4ZRJ A;  3MMV A;  2A6A A;  2NRR A;  1YUW A;  3CC7 N;  1T44 A;  3CMA N;  3AAP A;  4FWL A;  3AAR A;  2QWP A;  4FSV A;  5AQF A;  2CGK A;  3VGL A;  3IFR A;  4BG8 A;  1KD1 O;  4WFA L;  3QIJ A;  3QFP A;  4Z94 A;  2I1J A;  3EE9 A;  3O1W A;  3VEZ A;  5JVH L;  3EE8 A;  3CCE N;  1W97 L;  2A3Z A;  3EN9 A;  3LDO A;  2E8A A;  3LM9 A;  3MDQ A;  4FWP A;  4R79 A;  3QFU A;  2P9N A;  4EHT A;  3GL1 A;  2CQU A;  5GAH P;  5AQL A;  2ZJP L;  2I7N A;  5AR0 A;  3PIP L;  3O9S A;  4XEI A;  3CCU N;  2BUP A;  3CQX A;  4JK7 A;  3CJ1 A;  1KC7 A;  2F9W A;  2NRH A;  4CZK A;  3I55 N;  3FLC O;  3CPW M;  1E4G T;  4BRL A;  5AZJ A;  4I6M A;  2HF4 A;  3EKU A;  4H5T A;  3S41 A;  1ZBS A;  2E88 A;  2R82 A;  4MDA A;  5AFU H;  3VF4 A;  5LJV A;  3M3Z A;  3ZX3 A;  4IO9 L;  1NVL A;  3L0Q A;  1MK9 B;  2HOE A;  5FPE A;  3DXK B;  4U7B A;  3NMU A;  1P90 A;  5M1F A;  2VWB A;  2OTJ N;  4CZE A;  1VQ4 N;  3CQY A;  3E9O A;  3UKR B;  4CD1 A;  1GC6 A;  2KHO A;  2ZGY A;  4BRQ A;  4IWV A;  5DM7 L;  3F5T A;  2V51 B;  1QVF M;  1BDG A;  3F9M A;  4JHD A;  5AQO A;  4IJA A;  2J4R A;  2D11 A;  2NRT A;  3O5B A;  3U9D A;  2QWN A;  3CPE A;  1V4S A;  3FZK A;  1T6D A;  1LOT B;  1NGJ A;  3UKU B;  4BR5 A;  4QS9 A;  3IUC A;  5AQZ A;  3ZDT A;  5KQD A;  1NTI A;  1VBG A;  4P7I A;  5B8H A;  5TKY A;  3L6Q A;  1XUP O;  2DIK A;  2ZF5 O;  4DKW A;  4H0V B;  4EIA A;  1VQN N;  5KPT A;  3ENB A;  5AQR A;  3SBG A;  2E2O A;  2NZT A;  3H46 O;  4PL7 A;  4BY9 C;  3MX2 A;  3R6M A;  5M1P A;  3PLA A;  4IOA L;  1H1V A;  4AF1 A;  3CCJ N;  1BOT O;  3SMP A;  5GAE P;  1CZA N;  3RSE A;  5BPN A;  3N4P A;  1E4F T;  3AU4 A;  4XH5 A;  1NGH A;  4BR0 A;  3DAW A;  5CHI A;  4H5W A;  1XQS C;  4WQ4 C;  5CE3 A;  4BRN A;  2E2N A;  4IDH A;  3JS6 A;  4PKH A;  2P9I B;  4FL9 A;  4OPH A;  3Q7C A;  5E84 A;  1Q86 O;  5C15 A;  4IXC A;  2HBL A;  4EKU A;  4TKN A;  2A5X A;  3I33 A;  1KC8 O;  1NWK A;  4JK8 A;  2IIR A;  2AL6 A;  2ZGZ A;  3L4I A;  3VTH A;  4BR2 A;  3WEE B;  1Q18 A;  3JXU A;  4C23 A;  4F9O A;  3O80 A;  3CCM N;  4CZL A;  1T3V A;  4MLE A;  3M6G A;  1NBW A;  3DXM A;  2HF3 A;  1YIJ N;  3LDQ A;  3G6E N;  1TUU A;  2W41 A;  1NGD A;  3HSC A;  3WXM B;  3I8B A;  2WUS A;  3CC4 N;  4YOR A;  3Q7B A;  4LC9 B;  3KZB A;  5C2D A;  1SAZ A;  3FZM A;  1VQ5 N;  2OAN A;  3HZ6 A;  1VBH A;  2VGM A;  2QWQ A;  1YJN N;  2WC9 A;  3OA9 A;  3FP5 A;  1C0G A;  2JWL A;  3ENH A;  1K8A O;  3QIC A;  3LL3 A;  3CCV N;  1NGA A;  1O13 A;  2COP A;  2A42 A;  1VAZ A;  2KKZ A;  1M1K O;  3O1B A;  4O8U A;  4JKE A;  4RCH A;  3A0I X;  1YVN A;  4PL8 A;  2GEM A;  4JKG B;  2D0O A;  2QWR A;  3FFK B;  2J0M A;  1U6Z A;  1YF5 L;  4JNE A;  3WA0 A;  2GWJ A;  2J0J A;  1HJO A;  3OBW A;  3RVC A;  5BN8 A;  1ACA A;  1GGO A;  2NRZ A;  5M1Q A;  3PVL A;  3G71 N;  2D4W A;  2ASO A;  3VES A;  3PZD A;  3P38 A;  3P4I A;  3SJH A;  4BR7 A;  4GV3 A;  3G25 A;  4A59 A;  1H4R A;  1TUY A;  3A5N C;  1SQK A;  3C7N A;  3ZET A;  3HOT A;  1HPM A;  5EX5 A;  5AQQ A;  1XC3 A;  2EMT A;  2Q31 A;  4JAX A;  1NGC A;  2QI2 A;  2VCP A;  3OBY A;  4B1W B;  5AFU A;  4EHU A;  2HBK A;  1K8K B;  2BH1 A;  1GC7 A;  1BU6 O;  1HLU A;  1QQM A;  3UB5 A;  3QB0 A;  4CBU A;  3DWL A;  2P9P B;  1IJJ A;  3GG4 A;  1QQN A;  2GUP A;  4FWS A;  1YXQ A;  3FGU A;  4YOU A;  1MWK A;  4YOT A;  1VQP N;  2RE2 A;  4H03 B;  4O5F A;  5AQM A;  3C0B A;  3J8A A;  1N8R O;  1U2V B;  3MCA B;  4K43 A;  4BGB A;  1SS6 A;  2D2Q A;  4DXA B;  5LJW A;  2HBJ A;  1JCG A;  4HDQ A;  4A5B A;  4H0Y B;  1MA9 B;  3FLV A;  2HRJ A;  1TYQ B;  3FR0 A;  3R3L A;  3AU5 A;  1V4T A;  3ATV A;  4K41 A;  4B1Z A;  1JCF A;  2HST A;  1J6Z A;  3AAQ A;  5AQN A;  3WXL A;  3DXK A;  4ILH A;  3W0L A;  4IEE A;  1ISN A;  1Y64 A;  2QA4 N;  1NGG A;  3FZH A;  3EL2 A;  3UKR A;  1EF1 A;  5EOY A;  3CCR N;  4C1N K;  5CR4 A;  3FE1 A;  4FWQ A;  1HB6 A;  2A40 A;  3D6R A;  1BA0 A;  1MIZ B;  2WH5 A;  2IVP A;  3E1Y A;  4BRE A;  4RTF D;  3TSQ A;  3N4Q A;  3WUH A;  2W40 A;  3UKU A;  2FF3 B;  3IDH A;  1QHA A;  4KBO A;  3IVF A;  1X3N A;  3HBT A;  2LBB A;  3H1V X;  1NLV A;  3VEX A;  3TTF A;  2V7Z A;  3D2F B;  4FWR A;  4F7G A;  5AZI B;  4MLH A;  4AM7 A;  1W2B M;  2QEX N;  3U9Z A;  2YVC A;  3CD6 N;  4CD3 A;  3T69 A;  2GX9 A;  3GDQ A;  4BQL A;  4FO0 A;  5IJM A;  4GV9 A;  2WFB A;  3SAF A;  2J0K A;  1GLL O;  4NB4 A;  4B9Q A;  3BUZ B;  3W3D A;  5DM6 L;  1NM1 A;  3P31 A;  3H3N O;  3VER A;  1HKC A;  3C6H A;  2A41 A;  3LDN A;  3MN6 A;  1BWF O;  2ZPY A;  4DB3 A;  5C0Y A;  2UYT A;  3K9J A;  3ZEU B;  3ZYY X;  5FPN A;  4BRI A;  1K73 O;  3O9T A;  4DHY A;  2Q0R A;  2QWL A;  3SK3 A;  4A2B A;  4FVU A;  4WCE L;  3O6W A;  3WEE A;  2I1K A;  2CH6 A;  4BC5 A;  3SMS A;  1GLD G;  2PFU A;  4BRH A;  1VQK N;  4RWT A;  1DKG D;  3CJC A;  2E1Z A;  4IEI A;  3AGR A;  4YDU A;  3E9L A;  4NY0 A;  3VGM A;  3AGK A;  2E20 A;  1KAX A;  2CB8 A;  1ATS A;  2PAV A;  4BRF A;  3G9W A;  4G9Z A;  1KAZ A;  2Q97 A;  2VYP A;  3QDK A;  5JVL A;  3GOI A;  3HM8 A;  5JMV A;  1R59 O;  4JN4 A;  4M7X A;  5EY4 A;  4CI6 A;  4AM6 A;  4YOV A;  1HUX A;  4JEP A;  2HE7 A;  3TTD A;  1IG8 A;  3MN9 A;  1Q82 O;  2JWK A;  3ATU A;  4BR4 A;  4JD2 B;  2P9S B;  1QVG M;  1MDU B;  3KVG A;  5M1O A;  3LDL A;  3T7Z A;  3TSU A;  4BRC A;  3SBT A;  4DQ8 A;  4FPB A;  4A5A A;  1QQO A;  3CJ9 A;  5BRF A;  3IKM A;  3HI0 A;  1VQ8 N;  5F2R A;  2P9U B;  4BRP A;  2WBN A;  3EKS A;  1JCE A;  2YCH A;  4MO4 A;  2ITM A;  5FPD A;  1YJW N;  4JKG A;  3O08 A;  5AQS A;  1NJI O;  1Q81 O;  1M90 O;  4JKC A;  1JDE A;  2D1K A;  3KK7 A;  2FSK A;  2P9L B;  3O4W A;  5I9E B;  3NVM A;  3KWG A;  4WQ5 A;  2FF6 A;  3U4L A;  1J19 A;  1ZC6 A;  1G99 A;  3ID8 A;  4ISF A;  4OO1 J;  1QZ6 A;  2I7P A;  4B1X B;  3WQU A;  1GLJ O;  1NMD A;  1S3X A;  1KQS M;  2FSJ A;  4CBX A;  3ZX0 A;  2ZJR L;  3B8A X;  1S22 A;  5GIO A;  5HL7 L;  1VQL N;  4K25 A;  1Z05 A;  4ISG A;  5F1X A;  1ST7 A;  3VPZ A;  4YOY A;  1K8K A;  1HKB A;  1HB8 A;  3ULE B;  5BR9 A;  1P8Z A;  4YOX A;  5AQX A;  1VQO N;  1YHQ N;  4XH1 A;  2GEL A;  2P9P A;  2VGN A;  1X3M A;  1E5W A;  2E1Y A;  2FLO A;  4MDB A;  2Q1N A;  1DGK N;  4JKA A;  2KLA A;  3C6A A;  3HOS A;  4CJ7 A;  3H3O B;  4BC3 A;  5KQ8 A;  2NRX A;  1U2V A;  4GV6 A;  1YJ9 N;  4BRM A;  5GAG P;  4NLB A;  5GIN A;  3CJ7 A;  3SLC A;  5JVG L;  4YL8 A;  3ENO A;  1GLE G;  2Q0U A;  3U7D A;  2HMP A;  4BC4 A;  2ASP A;  4CZH A;  1NI2 A;  5ELZ A;  1TYQ A;  3H6E A;  1DT9 A;  2V52 B;  4BQZ A;  2QXL A;  2QWO A;  5AQJ A;  5MLC Q;  3D2E B;  5AQT A;  1WOQ A;  1RDU A;  3R1X A;  5BPL A;  3DLL L;  4FWK A;  2X0S A;  1C0F A;  3CJB A;  3CCL N;  2PBD A;  3VF2 A;  4CBW A;  4M63 C;  3U8X A;  4BRD A;  4B1U B;  3BEX A;  3BF1 A;  3M1F A;  3TSP A;  4ISE A;  4ZRK A;  3X23 A;  4B1V A;  4PKI A;  4UY8 O;  3GBT A;  2QWM A;  1GLB G;  4A62 A;  3QML A;  3CJA A;  1KBL A;  2F7T A;  2D10 A;  4H0O A;  2P9K B;  3UE5 A;  2NRW A;  3I56 N;  2H3G X;  1RDW X;  3HRG A;  3KWI A;  5TKW A;  3O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...