4JK9A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound co ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 67
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk9A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk9A01
3E9PA 4JK7A 4JKFA 4JKGA 3E9OA 4JKCA 4JKHA 3ENBA 4JKDA 4JKGB 4JKEA 4ILJA 3E9LA 4JKAA 4JK8A 3SBGA 4JK9A 4ILHA 3SBTA 4JKBA 4ILGB 3E66A
chains in the Genus database with same CATH superfamily
4CZGA 1Z26A 4ELTA 3U4LA 2I5JA 1GGOA 3DLEA 4DR4K 4IO9L 4JHDB 3MECA 4NLCA 2ZJRL 2PAVA 3VEZA 4BRLA 3LWLA 4DV7K 4O8KA 3H08A 4FJMA 1RDUA 4HTUA 2CGJA 4BC2A 1VBGA 3VQ5A 3SZ2A 2Q0RA 2UYTA 5FRNA 1CZAN 4BG9A 2D4WA 4YOTA 2NUBA 4BRGA 2HHHK 3CPEA 3O4NA 5I42A 4K41A 4BDPA 3EEQA 3NE6A 3IVFA 4QCLA 5IT9O 1NGCA 2QWOA 4OKJA 5BPMA 3RVCA 4AQYK 4CJ4A 3HL8A 5BRDA 3VGKA 4CJ7A 3SJHA 2JWKA 3EKUA 3WEEB 4CJFA 1KC7A 4MLEA 5FPEA 2F8TA 1NKBA 1V4SA 2QTDA 4WE1A 4AHSA 1N32K 2RQ1A 1FJGK 3TTCA 3BY5A 4EKUA 1B9FA 1D9FA 3PIPL 3CC4N 4R5PA 5AQIA 3KLFA 5JVHL 4H4MA 3S3OA 4YOXA 3P5JA 4NYNA 3M8RA 2CH5A 1RFQA 4BRDA 4DG1A 1BWFO 3AVNA 4JI2K 2AA4A 1JLBA 2W41A 2KW4A 5EX5A 4BC5A 1YF5L 4KHQA 4U7BA 3N4PA 3SV3A 4DS4A 3U8XA 3IDHA 4EAHD 4FLWA 2ZE2A 4DUYK 4X65K 3BEXA 2YX6A 4ZTJA 3OA9A 1KAXA 4YORA 2IVNA 4KAZA 3NF6A 4CHYA 4CYEA 2QWMA 4JK7A 4DTUA 3AVHA 4GW6A 1J5OA 2YNIA 3THYA 3NVMA 1ZBHA 5AQRA 5C25A 5M1KA 3NFAA 3TSPA 1HQEA 4J2DA 3BP8A 2G8FA 1MDUB 2PYJA 4LFCK 4EZ9A 4CVNE 4M42A 3ZDTA 1VQ7N 1ZBLA 1L3SA 2OZSA 4PY5A 5LJWA 2FSKA 4QOZB 4E7IA 5AQPA 3H3OB 2P9KA 2VG5A 4DTXA 3OBWA 1VSLA 4LF9K 1QSYA 4CIGA 2P9NB 4I7FA 3O3GA 3CCMN 3WUHA 2IVOA 4DTMA 4O4GA 2DFEA 3KK7A 5AR0A 2GUPA 2Q1NA 4CFCA 5ADXH 2WC9A 3CXCM 3CJ9A 1WB9A 2BUPA 4KHPK 2IVPA 3NGYA 2PY5A 1DTQA 1OKJA 1RDDA 3G71N 4FYDA 1T05A 2F7TA 1IG9A 4IOXA 4CEAA 3TWHA 1BA0A 5JVGL 3L4QA 1D4XA 3A5LC 2P9LA 2NRZA 4ICLA 1TVRA 1U47A 3ZX0A 3HYFA 5J2MA 2ZGZA 1GLAG 1OVQA 1KAYA 1X9JA 3FE1A 4JRQA 2Y1JA 4YDUC 4CD1A 1XUPO 3U7DA 2YI1A 1XQSC 2VGMA 3LALA 3TSUA 2Z1JA 2Q36A 3VQ8A 1VQ6N 3ZSOA 3VOVA 3P39A 4R79A 2FBVA 5KQDA 5AZIB 2QEXN 3V9WA 1YHQN 4JKHA 1BUPA 4CK2A 4GV3A 2O8FB 3VQ9A 4YDUA 5CY4A 4CJUA 1DTTA 4EP4A 4K25A 5F0XA 3ULDA 4DTNA 3SBTA 4JKBA 1C0GA 3K5NA 4FZZA 2W6KA 4O0IA 1VAZA 1CZBA 3U9DA 3VA3A 3K59A 3KVGA 3KD5E 1S5JA 4AH9A 4FK2A 2YNFA 2F8SA 2NNWA 1TUYA 3IRXA 3CM6A 2GV9A 3DLLL 1TV6A 3MDQA 1HPZA 3CF5L 1TAUA 1HNXK 3ZT0A 2GWJA 1YJNN 3FZKA 3ZX3A 1VQ5N 4DWIA 4FJKA 5B8HA 4B1ZA 2W40A 3LWMA 3SPYA 1RBSA 4ZRKA 3KTQA 5HRPA 1IO2A 2HVIA 3QINA 1NVLA 3I8DA 3SI6A 4C1NK 3D2EB 5JLHA 3FLCO 5TKWA 1WSFA 3HBTA 4J2EA 4O0JA 4TKNA 1JXEA 4FJ5A 4I2QA 2A42A 4DF4A 4F4KA 4BRCA 4B1WB 1YAGA 1SKWA 5AQNA 1MWMA 3G4SN 4WFBL 1VQKN 1KAZA 1QQCA 3I33A 1WSIA 1E4FT 3LPTA 2WH5A 3QEVA 1MIZB 3CQYA 4H0PA 4FSVA 3RRGA 3EPYA 5H1SQ 4HUFA 1VQNN 3THXA 3BF3A 3O4QA 1HRHA 3VTHA 1GOAA 3AAQA 3D7EO 4DU3A 3ZYYX 3AGKA 1ATNA 3G25A 3MN9A 2E1YA 3D2EA 5J2QA 3I0RA 3QMLA 4FJIA 1NGIA 3CC7N 4RW8A 4CZIA 2D1KA 1YITN 1XC3A 4JEPA 4FWPA 4LSNA 4BC3A 3BF1A 1HNWK 1KLNA 4IKFA 2HW3A 3P4IA 1RBUA 3PVLA 2P9UA 4KKOA 4J8FA 3A2FA 3J81O 2YKNA 1BIZA 3D45A 3R9PA 1XHXA 5CZ2A 4FVUA 4O55A 5AQJA 3V9XA 1LWFA 3C65A 1SGHA 3G0ZA 4LF8K 3K9JA 2NLXA 3ZCMA 3CCSN 2RHKA 3WNGA 3QFUA 1Q9XA 1RDAA 3RMBA 2QWNA 4H5WA 3AVBA 5J2NA 1REVA 2ZD1A 4F8RA 4DU1A 2W6LA 1JL2A 4ISGA 1XWLA 3ZETB 4JYAK 1RDWX 2QXLA 4BRAA 5DM7L 2ETJA 4K0KK 1GG3A 4DTRA 2HBJA 3J7ZO 2PYLA 1HPMA 2HNYA 3H3NO 2HHUA 3O80A 3AVJA 1ZBUA 4Y1CA 1NK8A 4JI0K 4K43A 3OYKA 1ZYQA 2YVCA 1NU0A 2VWJA 4E7HA 4CGFA 5BR9A 4JD2A 5GADP 2NRHA 2VWKA 1S6PA 1JCFA 1RDCA 5GIPA 4FJ7A 3HPHA 3K5LA 1HUXA 4KBOA 1EQYA 4KI4A 1SL2A 5C12A 2E1ZA 3NDKA 4ID1A 1E5WA 1NKCA 1TL3A 3DI6A 2E6MA 2HOEA 5AQQA 2Z1GA 3PY8A 3A5OC 2OANA 4IJNA 4G9ZA 3KLIA 4MO4A 1NK6A 1D5AA 4TSXA 3G10A 4DB3A 4CBXA 1NM1A 4OO1J 3L3VA 1BOTO 4Z4CA 2JLEA 5M1NA 4V19S 2WONA 1C0FA 5E84A 4YOVA 2D0CA 2JGUA 2UU9K 1ZC6A 3L3UA 2E2QA 5TKYA 3KWGA 1XMOK 4OVLA 1QQMA 3C7NB 3MK6A 4DQPA 3LDNA 3MEEA 4G1QA 2D0BA 5J2PA 4Z4HA 3ATVA 2V51B 2G8KA 4JKGA 3NGIA 4E7LA 4NXMK 5BPNA 4DLGA 2RN2A 3OJSA 4DUZK 1JL1A 2I1JA 4CEQA 1S1WA 3UKRA 3F2KA 1ACAA 4HUGA 4YHHK 2Q31A 3EL2A 3ULEA 2ATQA 4Z4GA 3PLAA 2VG6A 2OCEA 3QB0A 3VQ6A 4M3TA 3ZSXA 5AQWA 3EZWA 3O9RA 3THVA 4E1MA 1N33K 1J53A 1Q8IA 1XI1A 1KTQA 4BDZA 4GY2B 4YOWA 2G8WA 4OKEA 4BRFA 3K5OA 1W9HA 3U6FA 4BQZA 4KFBA 4JI1K 3R3LA 4JKDA 4CHZA 2YHBA 3VF2A 1Z25A 2IOCA 4PUOA 4Q0BA 3H1QA 3T1YK 4O5FA 1JDEA 3PSFA 4NO7A 2CB8A 5BR8K 4FJHA 2A6AA 1KCFA 2EMTA 4W5OA 3LM9A 4HHTA 3U9ZA 1VQON 1WBBA 4CK3A 2P9SB 4KH5A 4PWDA 4YL8A 3ZT2A 3IS9A 4JAXA 3QICA 3IG1A 1ILYA 3KKSA 3C6TA 3ZETA 4QS9A 4PHTX 1RDBA 2NRVA 3B6PA 3NGZA 2IAJA 1VQMN 2J0JA 3PUFA 4LY7A 5AQZA 1HKCA 1YJWN 3AA2A 4BRHA 3LDQA 4FLYA 3SQ2A 1HNZK 2QWPA 3VQDA 4DV5K 5DM6L 2B4JA 1I3AA 1EWRA 3SAGA 1UA1A 1ISNA 1LW2A 2R7YA 1GC6A 2HF3A 3OJUA 4NXNK 2P9PA 4E19A 1RCHA 4H0OA 1R0AA 2WTUA 3NH2A 5C42A 5CE3A 4EIAA 2QWQA 2QI2A 1TL1A 3QERA 2XY5A 2FJ9A 1X1PA 3QBXA 4CHOA 3S3NA 1CZ9A 1RGIA 1W7AA 1OVYA 1EETA 3ZSZA 1GLLO 1FW6A 1ESVA 1NK7A 3TAQA 1NJZA 2P9NA 3HP9A 1I39A 4JK8A 3CCUN 4M7XA 4N47A 4NCAA 2E2PA 2GBZA 1T44A 4E89A 2YJEA 4CJEA 1XMQK 1H4RA 1S9GA 4K8ZA 4CZEA 1UOCA 1EP4A 1XNRK 1KFDA 1HB8A 4DTOA 3QETA 3K57A 3K5MA 3O4WA 2P9IB 2X6NA 2D2QA 4GVEA 1K8AO 4FM0A 2Y1IA 2HMIA 2HHSA 4CGDA 4RW4A 4DU4A 1NTIA 3LZJA 3WQUA 5EVZA 1SL1A 4IG3A 3VEXA 3HP6A 5AQFA 4E7KA 2WBNA 4JS5A 1HJRA 1N5YA 4W5QA 3ISNC 4FPBA 5HP1A 4B3OA 3F5TA 1KVAA 5C2FA 3CJBA 2EHGA 3AAPA 4JI4K 2ASPA 3GBTA 4FW2A 4IFVA 3CCVN 1QZ6A 3O9UA 2ZWHA 2XY6A 1ZBSA 4CJ3A 1K9MO 4BY9C 3KJVA 2D11A 4CJVA 3EZ5A 1N34K 3DXMA 5JS1A 4GV9A 4BE2A 3VQBA 2QKKA 3M8SA 4FCYA 1Q86O 1RBTA 1NGAA 1S1UA 3V9UA 1A5XA 3WA0A 1RT1A 1IKWA 1KVCA 3OVNA 2QWLA 3QO9A 1QHAA 3VF6A 4A59A 4CFAA 5C10A 4DV3K 4B9VA 1QQOA 4WQ4C 5C15A 2FBYA 1GOCA 2QXFA 2YHYA 3NHGA 3MAQA 3N4QA 3SMPA 4B9QA 3LDOA 5JMVA 3VQ7A 3AA4A 2LBBA 4Z4IA 1IV0A 4DR1K 4MLHA 4DV6K 3CERA 1ATRA 4AHRA 3TAEA 4DQ8A 3DAWA 2ZPYA 4DR2K 2VWBA 2BE2A 4B9TA 4DF8A 3SUPA 4CEZA 5ADXA 4K8XA 2GWKA 1LAWA 3KLGA 3OYBA 4FO0A 4B3TK 4A61A 4CJTA 4J2BA 5AQUA 4H03B 3CJAA 1LOTB 1NJWA 4FXDA 3ENOA 1DKGD 3U8ZA 4H0XB 3LP0A 3VETA 3ZSWA 4ELVA 3QLHA 3P83D 1HB6A 1VSFA 2XRIA 2YHWA 1T3VA 3HOTA 4M3XA 3D0PA 5AQKA 4LF7K 5C0YA 1HX1A 4B8CA 5GAGP 5CZ1A 3W3DA 1K8KB 2O8BA 4BC4A 2FF6A 5HOOA 1HKGA 2CGKA 3VEYA 3KKRA 1VQPN 1NG9A 5BN8A 3V4IA 5IWAK 1DT9A 4LD0A 4CIEA 5J1EA 4K42A 4AF1A 4DV4K 4BG8A 2OPPA 1NJYA 2HHWA 3FZLA 5DMRA 3LAMA 3VESA 2GX9A 2UXDK 1IJJA 4ELUA 1KLMA 4CF1A 3WXMB 3CYMA 4BVPA 3C0BA 1HNIA 1GLBG 3OTOK 3SUQA 1OH6A 4H5VA 3L6QA 3FGUA 3O3HA 2P9PB 5KPTA 2O8EB 1VSHA 1VSMA 4CCHA 1YVUA 3WT0A 2G8VA 5EY4A 1RT4A 1NGDA 1MA9B 3WNHA 3H46O 1HKBA 4FJJA 2Q3SA 1M1KO 4A2BA 3SAHA 4BREA 3UE5A 1I94K 1HMVA 2IIRA 2EX3A 3AVFA 1JLCA 4YY3K 4FJ8A 5JS2A 3PO4A 4JKEA 2YKMA 4KO0A 3FLVA 2OTJN 4GKJK 2KFZA 4CEDA 4CEOA 2EWSA 5MLCQ 4DTSA 1E4GT 4DSKA 3LDSA 2A1RA 1GLJO 4I9LA 4IEEA 1RT3A 4EHTA 4N5SA 1KSPA 3DLRA 3JXUA 4WF9L 4DS5A 3OW2M 4MO5A 5SZTA 1D8YA 1D9DA 1C0UA 1TYQA 1U45A 4OJRA 1Z6RA 2AL6A 3THWA 4FLXA 4FJGA 3EE9A 4IWVA 3DYAA 2CGLA 4PA1A 4YOYA 1BL3A 4JI5K 4LF4K 3SK3A 5M1PA 4BWMA 3CCEN 3VEWA 3DRPA 1VK0A 3AGRA 3DRSA 3GG4A 1BG3A 3CC2N 3AVMA 4B9MA 1RT5A 2OPRA 5FRMA 1NKEA 1FKPA 3EY1A 4FJ9A 1CLQA 3ZT4A 5EXWA 1QSSA 5BREA 1WSHA 4LFBK 1NGHA 1LCUA 5KGXA 4LH5A 2KHOA 1ASWA 3NVKA 4CJWA 1IBKK 1U2VB 3HM9A 4JHDA 1NBWA 2ZJQL 3FZHA 1BI4B 1BCMA 4L8RB 4ILJA 2LSNA 4HTLA 2BGGA 3BINA 3F9KA 1W2BM 1RT7A 1X3NA 3HI0A 4H0TB 3VQCA 3SUOA 4B3RK 3BUZB 3VERA 1DIKA 3LPUA 3HZ6A 2O4IA 1BU6O 3OS0A 3DOLA 3LP1A 2VGNA 2QWRA 4KPYA 4A2AA 2JWLA 2P9IA 5HRRA 3TANA 3RSEB 3TTFA 2UXCK 5I3UA 3HPOA 2GUIA 1YUWA 3SBGA 3MWTA 4LSLA 1U6ZA 2PFUA 3QFPA 4CF8A 3OYHA 1GLDG 3MCPA 3OYMA 4MFBA 1NLVA 2E2NA 1WAJA 5AQOA 3U3GA 1KRPA 3C95A 4C8MA 3K0SA 3O1BA 1YTUA 5FPMA 1K73O 5CYMA 4PQUA 3UKUB 2BANA 4BRPA 3DM2A 4X64K 4EHUA 1TK5A 1C1BA 3C94A 3QEIA 1G15A 1GLCG 1HYSA 2V7YA 3P1GA 4B1VA 1LAVA 1RTIA 4DQIA 4FJNA 1FK9A 5HROA 4M3YA 1SL0A 4DR5K 2I7NA 2OTLN 5I9EB 4YOUA 3AU4A 4PKGA 2E8AA 1LW0A 3HJFA 4A5BA 4DTJA 5GIOA 1OH8A 4YNQA 4WQ4A 4CI6A 4FL9A 1EO1A 1DGKN 5SWMA 1YT3A 4LH4A 2E2OA 1J19A 5K14A 3PX6A 3JSMA 1ITGA 1WUAA 3PO5A 1KFSA 2KZMA 1VBHA 3O5BA 5FLXO 1FKOA 1GLEG 4F9OA 5AQMA 4FPAA 1TKXA 1A5VA 3M8QA 4DMNA 3HOSA 1VQ4N 3FFIA 3OBYA 3JYTA 4XIUA 4DFJA 2R82A 5AFUH 4BGAA 2QA4N 4OGEA 3SJJA 3TPQA 1GC7A 1QTMA 4O8UA 4UY8O 3KK3A 4BRNA 3DOKA 1ASVA 3WXIA 4O44A 3AO4A 3M3ZA 2QM1A 3AVLA 3VENA 4B9SA 2HRJA 1HYZA 3CFPA 2HHQA 4PL7A 3CFOA 3LL3A 3NF8A 1KD1O 3OY9A 4FWLA 1L5UA 1RT2A 4DQSA 4B8AB 4KB0A 1XHZA 1QSLA 4JN4A 3CJ7A 3H6EA 3E9PA 3ENHA 3NCIA 4H5TA 4CZJA 4E3SA 1NGBA 4FZYA 4JKFA 5D3GA 1RTHA 3MN5A 4FK4A 1S1XA 2BTFA 4KV8A 2WFBA 2F96A 4CHNA 4CGIA 3KWIA 3D6RA 4N76A 1JCEA 4DTPA 2E88A 3O9SA 1YVNA 4CGHA 4OPJA 3KLHA 1TKDA 4Z4EA 3QEPA 3QDKA 3A5MC 4BRQA 4CZMA 3HVTA 3CCJN 4X62K 3C6HA 4BR0A 3AARA 1VQ9N 4H5RA 3O08A 3OYJA 3CI5A 5HRNA 3B6OA 2HB5A 4DSJA 1Y19B 3V1RA 4DR3K 1V4TA 4FWNA 4B1YB 3WNEA 2WUSA 2VQEK 5KTQA 3SNNA 4ZRJA 2O8BB 3ITHA 2YJFA 3PX0A 2OPQA 3SQ1A 2DIKA 4X66K 3VPZA 3AO3A 4CECA 3T3FA 4ZHRA 1VRTA 4C8NA 1BCOA 3QNNA 1IBMK 4Y1DA 4L3QA 4H0YB 5GAEP 1NNEA 2ITMA 4C8KA 4N41A 3HTVA 4FM2A 1BDGA 2HHTA 4MDAA 1S9EA 2CH6A 1BI4A 4KHYA 4RW9A 2X74A 4DSIA 3IKMA 3CQ8A 4HDQA 2KLAA 1P90A 1QVFM 4FLTA 1WLJA 3VN5A 4NCBA 1WNSA 3NMUA 1VSDA 2HE7A 4C8OA 1JLGA 4E1JA 2GELA 1NJXA 3S3MA 2GEMA 3OYNA 4KHUA 4CGGA 3QIJA 5AZIA 2RF2A 1TKTA 1RBVA 1T6DA 5AQXA 5BPLA 2B6AA 1W97L 2VG7A 3OYLA 1N36K 1Q9YA 3LP3A 3A0IX 2DFHA 4B9UA 3MWPA 2X78A 1K6YA 4IZ9A 1WOQA 2O8DB 4CJLA 3IAYA 4IDHA 1GOBA 1Q82O 3I8BA 3E01A 4QS8A 3FP5A 1MIXA 3M5RA 2HVHA 3KHYA 3THWB 3G9WA 1BISA 4FWKA 3ATUA 3KIOA 4DSFA 2I1KA 3IMXA 5JVLA 2IDOA 4JS4A 4CZKA 4LF6K 1EWQA 1J54A 1CXQA 1LWEA 3FFKB 4BRIA 3CJ1A 1KBLA 4Z0UA 1VSEA 4JI8K 3FR0A 2D10A 3VEOA 3MXJA 2E5LK 4FWSA 2ZGYA 5HL7L 4WFAL 4ISFA 2HBLA 3KK1A 4Z94A 1NK5A 1RT6A 4H0VB 5EOYA 3OYAA 4KHNA 1K8KA 3QESA 3TAPA 3EO3A 1S1TA 4UQGA 1EF1A 1S6QA 2F9WA 1KQSM 1NGGA 2UUBK 4F3TA 4CGJA 3OS1A 4CJKA 4JI6K 5M1OA 4DKWA 1X3MA 3CPWM 2P9KB 5KPRA 1TAQA 4BWJA 1RTJA 2ZM6K 3L2RA 4CEEA 2NRWA 3THXB 3E1YA 2YV0X 4BQLA 3ASMA 2P5GA 1YTAA 2A40A 4CFBA 4DSEA 5LY3A 3OYDA 3CCLN 4CHPA 1BHLA 1B92A 1WSGA 5IJMA 2FSJA 5E26A 1EX4A 4JNEA 3VQEA 5EU7A 3VA0A 3AVIA 4B3MK 3KZBA 3AU5A 5CR4A 3PZDA 3NH1A 1J6ZA 2VYPA 4CE9A 2IGIA 1BA1A 2OA8A 4CD3A 3EKSA 4JV5K 4OGCA 1NOYA 1T7PA 2OZMA 3ZEUB 3CD6N 4BR5A 3VQ4A 1IKYA 3MN6A 3SLCA 3L2VA 2Q97A 1ATSA 3R8EA 1OH5A 1L3UA 1U04A 1QZ5A 4B08A 3GOIA 2D0OA 3MN7A 4N56A 3NAEA 4JK9A 2KQ2A 3SCXA 4ILHA 3MMVA 1UWBA 4PKIA 4B3SK 2X6SA 4E7JA 2HNZA 2KKZA 3AO5A 4WYBA 3OS2A 4F2RA 3CCRN 3RMDA 3KK2A 4MQ3A 3CMAN 3ZSYA 4J2AA 4HUEA 3O3FA 2J0KA 4GKKK 1KXPA 1HR0K 4OLAA 1J9AA 5C2DA 3GE1A 4H5NA 4KI6A 1JJ2M 4FOEA 3WEEA 3EYZA 4CW7B 1VSJA 2E20A 3AVCA 4IEIA 4FJLA 3QBWA 4NCGA 2A3ZA 4AILC 2ASOA 5AJ3K 4GNIA 4IOCL 3AY9A 5AQSA 4FWMA 3RSEA 1L3TA 2Z1HA 3BGRA 2H3GX 3M6GA 5AQTA 2KTQA 1IG8A 3L2UA 3SV4A 3J80O 3V9SA 3AV9A 3PX4A 2YCHA 3O6WA 2HHXA 3MX2A 3MX5A 2KZZA 4LF5K 4IXCA 5LL6Z 3R6MA 1T8EA 1NK9A 3OYCA 4JI3K 1O1WA 3DJCA 3ZX2A 2DTUA 1HNVA 2G8IA 2WOMA 4DFPA 4BVOA 2BDPA 1C6VA 1S3XA 5AZJA 3SPZA 4CK1A 3DRRA 4CESA 1SKRA 3CFRA 3F73A 3L0QA 4JKCA 2YHXA 3H45C 4FW1A 1M90O 4B1XB 3ID6A 4BDYA 1CXUA 3DXKB 3OHRA 2ASMA 1ZBIA 1S72N 4IJAA 2F9TA 2IS3A 4CHQA 3FZFA 5LMUK 2QK9A 3T19A 1W0HA 5F2RA 4JI7K 1OH7A 4BE1A 4E1NA 5KGWA 2FXUA 4IG0A 5ELZA 1JCGA 4CZLA 1L3VA 2G8HA 2B5JA 4KREA 2ITGA 4IFEA 2P9UB 2VCPA 4IBNA 4YFUA 2RKIA 3MEGA 4EFHA 2W42A 1NWKA 4BRMA 4AHCA 1NGJA 4GVMA 5HLFA 1BQNA 5AZJB 4QS7A 3M1FA 3T69A 4M3ZA 3WXJA 2O8DA 4BR4A 1IKVA 4JD2B 3HXMA 2RPIA 4W5NA 1Q81O 1U48A 1TYQB 3ZSRA 2V52B 2UXBK 2HBMA 1IKXA 2J0MA 3VQQA 5AQVA 1HJOA 3ZSVA 4CJPA 4B9LA 3F9MA 4IFYA 5JICA 1P8ZA 3V1QA 4DCHA 3Q7BA 2P1JA 3P38A 5GAHP 1U2VA 3HSCA 2AP1A 4XEIA 3ZLJA 5GINA 4CEBA 3CHWA 4CJSA 1RTDA 4A5AA 3TU5A 1MK9B 2Z1IA 3BZCA 3IFRA 2EMSA 1XNQK 2P9SA 2AJQA 2E6LA 1SKSA 2FLOA 3I55N 3S9HA 1MWKA 3HT3A 3P31A 4ZTFA 3UIQA 4DV2K 4LFAK 1ST7A 3TAFA 2UUAK 3AVAA 5KRSA 1IH7A 3BDPA 3ZSQA 3KD1E 3VMFB 5A2QO 1VHXA 4JRPA 1NK0A 3D2FB 1R59O 4BACA 3UKUA 4CF2A 3T1AA 3D2FA 3MEDA 3HPGA 4GV6A 1VQLN 3EE8A 1X9SA 4I9QA 3V1OA 3PV8A 1C1CA 3MXMA 2D0PA 4WCEL 5BN9A 3L8BA 1A5WA 1WAFA 4RWTA 4HCBA 1JKHA 3CMEN 1U49A 1SZ2A 5LMNK 3TARA 3E9LA 4O5BA 4PKHA 3ALYA 4QAGA 4C1NI 1NMDA 4M63C 1KVBA 3T7ZA 1QS4A 4C23A 4AM7A 4CFDA 4OKKA 4HVJA 3L4IA 4FK0A 1MU2A 1NK4A 3VQAA 4CJ5A 3M8PA 1NMNA 4PL8A 3TAMA 2D5RA 4I6MB 2OYQA 3W0LA 1TGOA 1YXQA 1Y64A 3X23A 3ZT1A 4JKAA 2ZF5O 3SQ4A 1Z05A 4AHTA 2G8UA 1JLAA 3RRHA 3SUNA 5JLFA 5AQGA 2O8EA 3DLKA 4DV1K 3RTVA 2XY7A 4Q5VA 1Y97A 1VSIA 5FROA 4KHWA 1TK8A 1WBDA 3WQTA 4RW7A 4FWRA 1SQKA 4DXAB 4I6MA 3QEWA 3NBPA 1C1AA 1WSJA 4FLVA 3OYIA 4KTWA 2FF3B 2XHBA 3HRGA 4WQ5A 3TI0A 1U4BA 4JLHA 4DV0K 3UB5A 3VQPA 1BO5O 1UA0A 3V6DA 3LANA 5F1XA 1NOZA 2HSTA 3LP2A 3WNFA 1E3MA 3J7AP 2HF4A 1LV5A 4HCCA 1RBRA 2QW9A 1XC9A 4DHYA 3O9TA 4B1UB 3MCAB 3HVRA 4FVMA 4Y0WA 3JAMO 4AHVA 1UAXA 3UKRB 1Q7YO 3K58A 4BE0A 3I0SA 1WN7A 2NRTA 4CIFA 3TR8A 5AQLA 4JKGB 1DEJA 1O13A 5AQYA 1SAZA 1HQUA 5FPNA 3Q7CA 1B9DA 3DWLA 3J8AA 4NYFA 3DMJA 4AHUA 5C24A 3TSQA 4XH1A 2OPSA 3PIOL 4FM1A 3VF4A 3C6UA 2P51A 4DFMA 1YIJN 2BH1A 3GL1A 1TK0A 1H1VA 4FWOA 4WFNL 3FZMA 4RCHA 3V9ZA 4NLBA 3DLHA 4EZ6A 3THYB 3AO2A 3EN9A 3RR8A 1TUUA 2O4GA 4M3UA 4FLZA 1GLFO 3SQ0A 1F21A 4GXBA 3E66A 2HNDA 3TABA 5CYQA 4DSLA 4IO8A 1C0MA 2YNGA 1FXXA 2HBKA 4C8LA 4RTFD 3CM5A 4AM6A 1J5EK 4EP5A 1QHTA 5E41A 2I7PA 4CF9A 3QIPA 1G99A 4GMJB 3S41A 3V81A 3SYZA 3OYEA 1KC8O 4U67L 1QVGM 2NRXA 3AO1A 3C6AA 4RW6A 3SAFA 3L2QA 3HK2A 3K2PA 2FC0A 4ILGB 1JLQA 3R1XA 4DR6K 3B8AX 2F4VK 4KTZA 1EXQA 3RWUA 1YI2N 4IOAL 3ID8A 4FLUA 4H8KA 3AVGA 4DLEA 1X9WA 3QNOA 1Q18A 3CJCA 4F7GA 1NGFA 3HM8A 3DLGA 4ISEA 2HMPA 1VSKA 3CQXA 2NZTA 4NY0A 4CF0A 5LJVA 3AVKA 3DXMB 3AA3A 4CERA 3T1HK 4LC9B 4CZFA 1S1VA 5M1QA 5KQ8A 1YJ9N 3O1WA 2COPA 1QQNA 3CCQN 4A57A 3WXLA 2PZSA 1ASUA 2DPNA 3L2WA 4OPAA 1NI2A 4M45A 2ABDA 1NJIO 3HO1A 2A41A 4M3WA 3CIPA 2DY4A 5KPZA 1WSEA 5AFUA 2AEHA 1ZBFA 1TKZA 2D0AA 1LWCA 1VRUA 2NRRA 2YNHA 3GDQA 1JXBA 4DQQA 3NF7A 3MXIA 4DFKA 4OLBA 4WQ5C 2FBXA 3TTDA 5FDLA 1SS6A 3IUCA 4OPHA 1HYVA 1ZXOA 2YHAA 3DLBA 3QIOA 1IBLK 1HLUA 3E9OA 2XY8A 4W5RA 2CQUA 3U3YA 2GTDA 3TAGA 4CJQA 3PSIA 3A8YA 3J7YP 3ENBA 3VEVA 2FBTA 4E0DA 2KFNA 2FSNA 3SMSA 4W5TA 1RILA 4BR7A 5HBMA 4RG8A 4M41A 2Q2RA 4HDOA 3H1VX 4Z4FA 2HHVA 4FZXC 3VGLA 2UUCK 5DK5A 3ZT3A 5AQHA 3DXKA 3OYGA 4CBUA 1SV5A 3AA5X 2ZJPL 2PBDA 1JLEA 5KRTA 4M7YA 3JS6A 4KTQA 1BGXT 3RR7A 2P5OA 2Q0UA 4ZRIA 5M1FA 4CJRA 1X9MA 4OX9K 1JLFA 3LM2A 4F3OA 4OPKA 4CEFA 2O8FA 5HRSA 4CBWA 3K9KA 2XO7A 1EKEA 4BGBA 3O8MA 3LDPA 4M3RA 1SUQA 1RNHA 4I2PA 4FWQA 1DLOA 2E4LA 3LZIA 3ZEUA 3G6EN 4P7IA 2RE2A 1NGEA 2IC3A 4CZHA 4KH6A 4BR2A 2VQFK 4DQRA 3O9QA 2O8CB 3LAKA 3LDLA 2FDQA 3ULEB 5CHIA 4KHSA 3VTIA 2O8CA 3CG7A 2DFFA 4A62A 4XH4A 4ID5A 1VQ8N 3A5NC 2X0SA 4DR7K 3WXKA 4IDKA 1QE1A 2P9LB 1BQMA 1S22A 5BRFA 2V7ZA 3BZKA 5T7BA 3KLEA 4HWIA 3NF9A 4FJXA 3C7NA 4KH4A 4BRKA 4FOIA 3OYFA 5KI6A 3NH0A 1N6QA 1C0TA 5FPDA 1MK7B 4KRFA 3HSTB 4NB4A 4BROA 4KB1A 4H4OA 3CETA 4MDBA 3QEXA 3VGMA 1T6CA 4F2SA 4XH5A 2A5XA 4B9NA 1N8RO 3RMCA 2A1SA 1T03A 1BIUA 5BRHA 3I56N 2J4RA 1HBKA 2QKBA 3RMAA 4BR9A 2ZQBA
chains in the Genus database with same CATH topology
4CZGA 2FXUA 5ELZA 1JCGA 4CZLA 3HZ6A 1BU6O 3U4LA 4IFEA 1GGOA 2P9UB 2VCPA 2VGNA 2QWRA 3ATVA 4IO9L 2V51B 2JWLA 4JHDB 2P9IA 4A2AA 4JKGA 3RSEB 4EFHA 3TTFA 4NLCA 2ZJRL 5BPNA 2PAVA 3VEZA 4BRLA 1NWKA 2I1JA 4BRMA 1NGJA 4O8KA 3UKRA 3F2KA 1ACAA 5AZJB 2Q31A 3EL2A 4QS7A 1RDUA 3M1FA 3T69A 3ULEA 1YUWA 3WXJA 3SBGA 3PLAA 3MWTA 2CGJA 4BC2A 1VBGA 4BR4A 3QB0A 4JD2B 1U6ZA 2Q0RA 2UYTA 3EZWA 3O9RA 2PFUA 3QFPA 5AQWA 1TYQB 1CZAN 1Q81O 4BG9A 2V52B 1GLDG 2HBMA 3MCPA 2D4WA 2J0MA 1NLVA 2E2NA 4GY2B 4YOTA 4YOWA 4BRGA 5AQVA 1HJOA 5AQOA 4BRFA 3F9MA 5JICA 1P8ZA 4BQZA 3O1BA 3CPEA 4DCHA 5FPMA 1K73O 3R3LA 4JKDA 3Q7BA 4K41A 3VF2A 3P38A 5GAHP 3UKUB 1U2VA 4BRPA 3IVFA 3HSCA 2AP1A 3H1QA 4XEIA 1NGCA 2QWOA 4EHUA 4O5FA 5BPMA 5GINA 3RVCA 3CHWA 1JDEA 4A5AA 3TU5A 1GLCG 2V7YA 4B1VA 1MK9B 4NO7A 2CB8A 5BRDA 3VGKA 4CJ7A 3IFRA 3SJHA 2JWKA 3EKUA 3WEEB 2EMSA 2A6AA 2P9SA 2EMTA 1KC7A 3LM9A 4MLEA 2FLOA 2I7NA 5FPEA 2OTLN 3U9ZA 1VQON 3I55N 1MWKA 5I9EB 2P9SB 4KH5A 4YOUA 1V4SA 3P31A 3AU4A 4YL8A 2QTDA 4PKGA 2E8AA 1ST7A 4JAXA 2RQ1A 3QICA 3VMFB 1ILYA 4A5BA 3TTCA 5GIOA 3ZETA 4EKUA 4QS9A 4WQ4A 3D2FB 4FL9A 4CI6A 1R59O 4PHTX 3PIPL 2NRVA 3CC4N 1EO1A 1DGKN 1VQMN 2J0JA 3UKUA 5AQZA 1HKCA 1YJWN 5AQIA 4BRHA 3LDQA 3D2FA 4GV6A 1VQLN 3EE8A 2E2OA 5JVHL 1J19A 4YOXA 2D0PA 2QWPA 4WCEL 2CH5A 1RFQA 5BN9A 1WUAA 4BRDA 1BWFO 4RWTA 5DM6L 2AA4A 1VBHA 3O5BA 2W41A 4F9OA 1GLEG 5AQMA 4FPAA 5EX5A 4BC5A 1YF5L 3SAGA 4U7BA 3N4PA 1ISNA 3HOSA 3CMEN 3U8XA 1VQ4N 3IDHA 1SZ2A 3OBYA 1GC6A 2HF3A 3E9LA 4EAHD 4PKHA 2P9PA 4C1NI 4H0OA 1NMDA 2R82A 5AFUH 4BGAA 2QA4N 4M63C 5CE3A 4EIAA 2QWQA 2QI2A 3BEXA 2YX6A 3TPQA 3T7ZA 3OA9A 4C23A 4AM7A 1KAXA 1GC7A 2FJ9A 4YORA 4O8UA 2IVNA 4UY8O 4CYEA 2QWMA 4JK7A 3L4IA 4BRNA 3QBXA 3WXIA 3NVMA 5AQRA 4PL8A 5M1KA 1RGIA 3TSPA 3BP8A 1OVYA 3M3ZA 4I6MB 2QM1A 1MDUB 1GLLO 3W0LA 1ESVA 3VENA 3ZDTA 1YXQA 2P9NA 2HRJA 1VQ7N 4PL7A 1Y64A 3X23A 4JKAA 4JK8A 3LL3A 5LJWA 2FSKA 2ZF5O 1Z05A 3CCUN 4M7XA 1KD1O 4FWLA 5JLFA 5AQPA 3H3OB 2P9KA 3OBWA 5AQGA 2E2PA 4JN4A 1T44A 2YJEA 3CJ7A 3H6EA 3E9PA 3ENHA 1H4RA 2P9NB 3WQTA 3CCMN 4H5TA 4CZJA 4CZEA 1NGBA 4FWRA 4JKFA 1SQKA 3WUHA 4DXAB 4I6MA 1HB8A 3MN5A 2BTFA 2IVOA 2WFBA 3KK7A 3KWIA 3O4WA 2P9IB 3D6RA 5AR0A 2FF3B 2GUPA 2D2QA 1JCEA 2Q1NA 2E88A 3HRGA 1YVNA 3O9SA 4GVEA 4WQ5A 5ADXH 2WC9A 1K8AO 3QDKA 3CJ9A 3CXCM 3A5MC 2BUPA 4BRQA 3UB5A 1BO5O 4CZMA 2IVPA 1NTIA 3CCJN 1OKJA 5F1XA 2HSTA 3WQUA 5EVZA 3C6HA 3G71N 4BR0A 2HF4A 3VEXA 2F7TA 3AARA 5AQFA 2QW9A 2WBNA 4IOXA 1VQ9N 4H5RA 4DHYA 3O08A 3O9TA 3CI5A 3MCAB 4B1UB 1BA0A 5JVGL 3L4QA 1D4XA 1Y19B 3A5LC 2P9LA 4FPBA 4Y0WA 2NRZA 1V4TA 4FWNA 3UKRB 4B1YB 1Q7YO 2WUSA 3F5TA 3ZX0A 5C2FA 3CJBA 2ZGZA 4ZRJA 1GLAG 1X9JA 1KAYA 2NRTA 3AAPA 3FE1A 2ASPA 5AQLA 4JKGB 1DEJA 1XUPO 2YJFA 4YDUC 1O13A 3GBTA 1SAZA 5AQYA 4CD1A 3CCVN 3U7DA 1QZ6A 3O9UA 2DIKA 3Q7CA 5FPNA 2ZWHA 3DWLA 3VPZA 2YI1A 1XQSC 1ZBSA 2VGMA 3J8AA 1K9MO 3TSUA 4BY9C 2Q36A 2D11A 1VQ6N 3DXMA 3TSQA 3VOVA 4GV9A 3P39A 4H0YB 4L3QA 5GAEP 4XH1A 3PIOL 2ITMA 1Q86O 4R79A 3HTVA 1NGAA 1BDGA 3VF4A 4MDAA 3WA0A 2CH6A 5KQDA 1YIJN 2BH1A 5AZIB 3GL1A 1YHQN 2QEXN 4JKHA 1H1VA 4FWOA 4WFNL 1BUPA 2QWLA 4GV3A 3FZMA 4RCHA 4NLBA 1QHAA 4YDUA 3VF6A 3IKMA 4A59A 4K25A 5C10A 4HDQA 3EN9A 2KLAA 1P90A 1TUUA 1QQOA 4WQ4C 5F0XA 1QVFM 5C15A 3SBTA 4JKBA 3NMUA 1GLFO 1C0GA 2HE7A 4GXBA 4E1JA 1VAZA 2GELA 3E66A 2YHYA 2GEMA 4IO8A 3U9DA 2HBKA 3KVGA 3N4QA 4RTFD 3SMPA 4AM6A 3LDOA 3QIJA 5AZIA 4B9QA 5JMVA 2NNWA 1T6DA 1TUYA 5AQXA 5BPLA 3DLLL 2I7PA 2LBBA 1W97L 1G99A 3MDQA 3CF5L 3S41A 4MLHA 3CERA 1ATRA 1YJNN 2GWJA 1KC8O 3FZKA 3A0IX 4DQ8A 3DAWA 2ZPYA 4U67L 2NRXA 3ZX3A 3C6AA 3SAFA 1QVGM 1VQ5N 2VWBA 3MWPA 5B8HA 4ILGB 4IZ9A 1WOQA 4B1ZA 2W40A 5ADXA 4IDHA 3R1XA 2GWKA 1Q82O 3I8BA 4QS8A 4ZRKA 3FP5A 1MIXA 3B8AX 3M5RA 3KHYA 3G9WA 4FO0A 4FWKA 3ATUA 1YI2N 4A61A 4IOAL 1NVLA 3ID8A 2I1KA 3IMXA 5JVLA 5AQUA 4H03B 4C1NK 3CJAA 1LOTB 3D2EB 4CZKA 5JLHA 3ENOA 3FLCO 1Q18A 1DKGD 3CJCA 4F7GA 1NGFA 3FFKB 3HBTA 3HM8A 5TKWA 4ISEA 3U8ZA 4H0XB 2HMPA 4BRIA 3VETA 3CJ1A 3CQXA 2NZTA 4NY0A 1KBLA 4TKNA 5LJVA 1HB6A 3FR0A 2YHWA 2D10A 1T3VA 3DXMB 3VEOA 3HOTA 4LC9B 2A42A 4CZFA 4FWSA 5AQKA 5M1QA 4BRCA 2ZGYA 5HL7L 4WFAL 5KQ8A 4B1WB 4ISFA 3O1WA 1YAGA 1YJ9N 2HBLA 2COPA 4Z94A 1QQNA 5AQNA 3CCQN 4H0VB 4A57A 5C0YA 1HX1A 3WXLA 5EOYA 1MWMA 3G4SN 5GAGP 1K8KA 4WFBL 1VQKN 1KAZA 3EO3A 3I33A 3W3DA 2DPNA 1K8KB 1E4FT 4BC4A 3CD6N 2WH5A 2FF6A 1MIZB 4OPAA 1EF1A 2F9WA 5HOOA 1HKGA 1NGGA 3CQYA 1NI2A 1KQSM 2ABDA 2CGKA 4H0PA 3VEYA 1NJIO 4FSVA 2A41A 1VQPN 3CIPA 5M1OA 5KPZA 3EPYA 5BN8A 4DKWA 1X3MA 1DT9A 5H1SQ 3CPWM 2P9KB 5KPRA 5AFUA 4K42A 1VQNN 4AF1A 2AEHA 3BF3A 4BG8A 3GDQA 3VTHA 2NRRA 2NRWA 3AAQA 3D7EO 3E1YA 3ZYYX 3FZLA 3AGKA 4WQ5C 3TTDA 1ATNA 3G25A 4BQLA 1SS6A 3MN9A 2E1YA 3VESA 3IUCA 4OPHA 2GX9A 3D2EA 1ZXOA 2A40A 3QMLA 1NGIA 3CC7N 1HLUA 3E9OA 1IJJA 5LY3A 2CQUA 4CZIA 2GTDA 2D1KA 1YITN 1XC3A 4JEPA 4FWPA 3CCLN 3WXMB 4BC3A 3A8YA 3BF1A 5IJMA 2FSJA 5E26A 4BVPA 3ENBA 3P4IA 3C0BA 4JNEA 1GLBG 3PVLA 2P9UA 3VEVA 4J8FA 2FSNA 3SMSA 4H5VA 3L6QA 3R9PA 3FGUA 4BR7A 3KZBA 3AU5A 5CR4A 3PZDA 1J6ZA 4FVUA 2P9PB 2VYPA 2Q2RA 1BA1A 4HDOA 3H1VX 5KPTA 5AQJA 3VGLA 4CD3A 3EKSA 3WT0A 5EY4A 1NGDA 1MA9B 3C65A 5AQHA 1SGHA 3DXKA 3ZEUB 4BR5A 3H46O 3MN6A 4CBUA 1HKBA 3SLCA 3LDNA 2ZJPL 1M1KO 2PBDA 3K9JA 4A2BA 4BREA 3SAHA 2Q97A 1ATSA 2NLXA 3UE5A 3R8EA 2IIRA 3CCSN 2RHKA 1QZ5A 3QFUA 4M7YA 3JS6A 4JKEA 3GOIA 3FLVA 2D0OA 3MN7A 2OTJN 4JK9A 2QWNA 4ILHA 3MMVA 4H5WA 2Q0UA 4ZRIA 4PKIA 5M1FA 2KKZA 3LM2A 4ISGA 4WYBA 3ZETB 3CCRN 2EWSA 5MLCQ 1RDWX 2QXLA 1E4GT 4BRAA 3CMAN 5DM7L 1GG3A 4CBWA 1GLJO 3K9KA 2HBJA 3J7ZO 4BGBA 2J0KA 1HPMA 3O8MA 3LDPA 4IEEA 3H3NO 1KXPA 4EHTA 3O80A 3JXUA 4FWQA 4WF9L 3ZEUA 3OW2M 5C2DA 3GE1A 4H5NA 4K43A 4MO5A 4FOEA 3G6EN 3WEEA 4P7IA 2YVCA 1NGEA 2RE2A 1JJ2M 1TYQA 4CZHA 1Z6RA 2E20A 4KH6A 4BR2A 5BR9A 4JD2A 2AL6A 3O9QA 3LDLA 2FDQA 3EE9A 4IWVA 5GADP 4IEIA 2NRHA 3ULEB 2CGLA 3QBWA 5CHIA 2A3ZA 3VTIA 5GIPA 1JCFA 2ASOA 4GNIA 4IOCL 4YOYA 3AY9A 5AQSA 1HUXA 4A62A 4FWMA 4KBOA 4XH4A 1EQYA 3RSEA 1VQ8N 3A5NC 2X0SA 2H3GX 3M6GA 5AQTA 5M1PA 3SK3A 3WXKA 2P9LB 5BRFA 1IG8A 1S22A 3VEWA 5C12A 2E1ZA 3CCEN 3AGRA 1E5WA 2V7ZA 3GG4A 1BG3A 5AQQA 2HOEA 2YCHA 3O6WA 3MX2A 3MX5A 3CC2N 3A5OC 2OANA 4HWIA 4IJNA 4IXCA 3C7NA 3R6MA 4G9ZA 4KH4A 4BRKA 4FOIA 4MO4A 3DJCA 3ZX2A 5FPDA 1MK7B 4NB4A 5EXWA 4BROA 4BVOA 5BREA 3CETA 4MDBA 1NGHA 1LCUA 1S3XA 3VGMA 5AZJA 1T6CA 4DB3A 2KHOA 4CBXA 1NM1A 3NVKA 4XH5A 4OO1J 1U2VB 2A5XA 1BOTO 3L0QA 5M1NA 4JKCA 4JHDA 1C0FA 2YHXA 5E84A 1NBWA 3H45C 1N8RO 4YOVA 1M90O 4B1XB 2ZJQL 3ID6A 3FZHA 1ZC6A 3DXKB 3OHRA 4ILJA 2ASMA 2E2QA 4HTLA 5TKYA 3KWGA 1S72N 4IJAA 2F9TA 3BINA 3FZFA 5BRHA 3I56N 2J4RA 1HBKA 1W2BM 1X3NA 3HI0A 1QQMA 4H0TB 3C7NB 3BUZB 3MK6A 5F2RA 3VERA 4BR9A 1DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9P A;  4JK7 A;  4JKF A;  4JKG A;  3E9O A;  4JKC A;  4JKH A;  3ENB A;  4JKD A;  4JKG B;  4JKE A;  4ILJ A;  3E9L A;  4JKA A;  4JK8 A;  3SBG A;  4JK9 A;  4ILH A;  3SBT A;  4JKB A;  4ILG B;  3E66 A; 
#chains in the Genus database with same CATH topology
 4CZG A;  1Z26 A;  4ELT A;  3U4L A;  2I5J A;  1GGO A;  3DLE A;  4DR4 K;  4IO9 L;  4JHD B;  3MEC A;  4NLC A;  2ZJR L;  2PAV A;  3VEZ A;  4BRL A;  3LWL A;  4DV7 K;  4O8K A;  3H08 A;  4FJM A;  1RDU A;  4HTU A;  2CGJ A;  4BC2 A;  1VBG A;  3VQ5 A;  3SZ2 A;  2Q0R A;  2UYT A;  5FRN A;  1CZA N;  4BG9 A;  2D4W A;  4YOT A;  2NUB A;  4BRG A;  2HHH K;  3CPE A;  3O4N A;  5I42 A;  4K41 A;  4BDP A;  3EEQ A;  3NE6 A;  3IVF A;  4QCL A;  5IT9 O;  1NGC A;  2QWO A;  4OKJ A;  5BPM A;  3RVC A;  4AQY K;  4CJ4 A;  3HL8 A;  5BRD A;  3VGK A;  4CJ7 A;  3SJH A;  2JWK A;  3EKU A;  3WEE B;  4CJF A;  1KC7 A;  4MLE A;  5FPE A;  2F8T A;  1NKB A;  1V4S A;  2QTD A;  4WE1 A;  4AHS A;  1N32 K;  2RQ1 A;  1FJG K;  3TTC A;  3BY5 A;  4EKU A;  1B9F A;  1D9F A;  3PIP L;  3CC4 N;  4R5P A;  5AQI A;  3KLF A;  5JVH L;  4H4M A;  3S3O A;  4YOX A;  3P5J A;  4NYN A;  3M8R A;  2CH5 A;  1RFQ A;  4BRD A;  4DG1 A;  1BWF O;  3AVN A;  4JI2 K;  2AA4 A;  1JLB A;  2W41 A;  2KW4 A;  5EX5 A;  4BC5 A;  1YF5 L;  4KHQ A;  4U7B A;  3N4P A;  3SV3 A;  4DS4 A;  3U8X A;  3IDH A;  4EAH D;  4FLW A;  2ZE2 A;  4DUY K;  4X65 K;  3BEX A;  2YX6 A;  4ZTJ A;  3OA9 A;  1KAX A;  4YOR A;  2IVN A;  4KAZ A;  3NF6 A;  4CHY A;  4CYE A;  2QWM A;  4JK7 A;  4DTU A;  3AVH A;  4GW6 A;  1J5O A;  2YNI A;  3THY A;  3NVM A;  1ZBH A;  5AQR A;  5C25 A;  5M1K A;  3NFA A;  3TSP A;  1HQE A;  4J2D A;  3BP8 A;  2G8F A;  1MDU B;  2PYJ A;  4LFC K;  4EZ9 A;  4CVN E;  4M42 A;  3ZDT A;  1VQ7 N;  1ZBL A;  1L3S A;  2OZS A;  4PY5 A;  5LJW A;  2FSK A;  4QOZ B;  4E7I A;  5AQP A;  3H3O B;  2P9K A;  2VG5 A;  4DTX A;  3OBW A;  1VSL A;  4LF9 K;  1QSY A;  4CIG A;  2P9N B;  4I7F A;  3O3G A;  3CCM N;  3WUH A;  2IVO A;  4DTM A;  4O4G A;  2DFE A;  3KK7 A;  5AR0 A;  2GUP A;  2Q1N A;  4CFC A;  5ADX H;  2WC9 A;  3CXC M;  3CJ9 A;  1WB9 A;  2BUP A;  4KHP K;  2IVP A;  3NGY A;  2PY5 A;  1DTQ A;  1OKJ A;  1RDD A;  3G71 N;  4FYD A;  1T05 A;  2F7T A;  1IG9 A;  4IOX A;  4CEA A;  3TWH A;  1BA0 A;  5JVG L;  3L4Q A;  1D4X A;  3A5L C;  2P9L A;  2NRZ A;  4ICL A;  1TVR A;  1U47 A;  3ZX0 A;  3HYF A;  5J2M A;  2ZGZ A;  1GLA G;  1OVQ A;  1KAY A;  1X9J A;  3FE1 A;  4JRQ A;  2Y1J A;  4YDU C;  4CD1 A;  1XUP O;  3U7D A;  2YI1 A;  1XQS C;  2VGM A;  3LAL A;  3TSU A;  2Z1J A;  2Q36 A;  3VQ8 A;  1VQ6 N;  3ZSO A;  3VOV A;  3P39 A;  4R79 A;  2FBV A;  5KQD A;  5AZI B;  2QEX N;  3V9W A;  1YHQ N;  4JKH A;  1BUP A;  4CK2 A;  4GV3 A;  2O8F B;  3VQ9 A;  4YDU A;  5CY4 A;  4CJU A;  1DTT A;  4EP4 A;  4K25 A;  5F0X A;  3ULD A;  4DTN A;  3SBT A;  4JKB A;  1C0G A;  3K5N A;  4FZZ A;  2W6K A;  4O0I A;  1VAZ A;  1CZB A;  3U9D A;  3VA3 A;  3K59 A;  3KVG A;  3KD5 E;  1S5J A;  4AH9 A;  4FK2 A;  2YNF A;  2F8S A;  2NNW A;  1TUY A;  3IRX A;  3CM6 A;  2GV9 A;  3DLL L;  1TV6 A;  3MDQ A;  1HPZ A;  3CF5 L;  1TAU A;  1HNX K;  3ZT0 A;  2GWJ A;  1YJN N;  3FZK A;  3ZX3 A;  1VQ5 N;  4DWI A;  4FJK A;  5B8H A;  4B1Z A;  2W40 A;  3LWM A;  3SPY A;  1RBS A;  4ZRK A;  3KTQ A;  5HRP A;  1IO2 A;  2HVI A;  3QIN A;  1NVL A;  3I8D A;  3SI6 A;  4C1N K;  3D2E B;  5JLH A;  3FLC O;  5TKW A;  1WSF A;  3HBT A;  4J2E A;  4O0J A;  4TKN A;  1JXE A;  4FJ5 A;  4I2Q A;  2A42 A;  4DF4 A;  4F4K A;  4BRC A;  4B1W B;  1YAG A;  1SKW A;  5AQN A;  1MWM A;  3G4S N;  4WFB L;  1VQK N;  1KAZ A;  1QQC A;  3I33 A;  1WSI A;  1E4F T;  3LPT A;  2WH5 A;  3QEV A;  1MIZ B;  3CQY A;  4H0P A;  4FSV A;  3RRG A;  3EPY A;  5H1S Q;  4HUF A;  1VQN N;  3THX A;  3BF3 A;  3O4Q A;  1HRH A;  3VTH A;  1GOA A;  3AAQ A;  3D7E O;  4DU3 A;  3ZYY X;  3AGK A;  1ATN A;  3G25 A;  3MN9 A;  2E1Y A;  3D2E A;  5J2Q A;  3I0R A;  3QML A;  4FJI A;  1NGI A;  3CC7 N;  4RW8 A;  4CZI A;  2D1K A;  1YIT N;  1XC3 A;  4JEP A;  4FWP A;  4LSN A;  4BC3 A;  3BF1 A;  1HNW K;  1KLN A;  4IKF A;  2HW3 A;  3P4I A;  1RBU A;  3PVL A;  2P9U A;  4KKO A;  4J8F A;  3A2F A;  3J81 O;  2YKN A;  1BIZ A;  3D45 A;  3R9P A;  1XHX A;  5CZ2 A;  4FVU A;  4O55 A;  5AQJ A;  3V9X A;  1LWF A;  3C65 A;  1SGH A;  3G0Z A;  4LF8 K;  3K9J A;  2NLX A;  3ZCM A;  3CCS N;  2RHK A;  3WNG A;  3QFU A;  1Q9X A;  1RDA A;  3RMB A;  2QWN A;  4H5W A;  3AVB A;  5J2N A;  1REV A;  2ZD1 A;  4F8R A;  4DU1 A;  2W6L A;  1JL2 A;  4ISG A;  1XWL A;  3ZET B;  4JYA K;  1RDW X;  2QXL A;  4BRA A;  5DM7 L;  2ETJ A;  4K0K K;  1GG3 A;  4DTR A;  2HBJ A;  3J7Z O;  2PYL A;  1HPM A;  2HNY A;  3H3N O;  2HHU A;  3O80 A;  3AVJ A;  1ZBU A;  4Y1C A;  1NK8 A;  4JI0 K;  4K43 A;  3OYK A;  1ZYQ A;  2YVC A;  1NU0 A;  2VWJ A;  4E7H A;  4CGF A;  5BR9 A;  4JD2 A;  5GAD P;  2NRH A;  2VWK A;  1S6P A;  1JCF A;  1RDC A;  5GIP A;  4FJ7 A;  3HPH A;  3K5L A;  1HUX A;  4KBO A;  1EQY A;  4KI4 A;  1SL2 A;  5C12 A;  2E1Z A;  3NDK A;  4ID1 A;  1E5W A;  1NKC A;  1TL3 A;  3DI6 A;  2E6M A;  2HOE A;  5AQQ A;  2Z1G A;  3PY8 A;  3A5O C;  2OAN A;  4IJN A;  4G9Z A;  3KLI A;  4MO4 A;  1NK6 A;  1D5A A;  4TSX A;  3G10 A;  4DB3 A;  4CBX A;  1NM1 A;  4OO1 J;  3L3V A;  1BOT O;  4Z4C A;  2JLE A;  5M1N A;  4V19 S;  2WON A;  1C0F A;  5E84 A;  4YOV A;  2D0C A;  2JGU A;  2UU9 K;  1ZC6 A;  3L3U A;  2E2Q A;  5TKY A;  3KWG A;  1XMO K;  4OVL A;  1QQM A;  3C7N B;  3MK6 A;  4DQP A;  3LDN A;  3MEE A;  4G1Q A;  2D0B A;  5J2P A;  4Z4H A;  3ATV A;  2V51 B;  2G8K A;  4JKG A;  3NGI A;  4E7L A;  4NXM K;  5BPN A;  4DLG A;  2RN2 A;  3OJS A;  4DUZ K;  1JL1 A;  2I1J A;  4CEQ A;  1S1W A;  3UKR A;  3F2K A;  1ACA A;  4HUG A;  4YHH K;  2Q31 A;  3EL2 A;  3ULE A;  2ATQ A;  4Z4G A;  3PLA A;  2VG6 A;  2OCE A;  3QB0 A;  3VQ6 A;  4M3T A;  3ZSX A;  5AQW A;  3EZW A;  3O9R A;  3THV A;  4E1M A;  1N33 K;  1J53 A;  1Q8I A;  1XI1 A;  1KTQ A;  4BDZ A;  4GY2 B;  4YOW A;  2G8W A;  4OKE A;  4BRF A;  3K5O A;  1W9H A;  3U6F A;  4BQZ A;  4KFB A;  4JI1 K;  3R3L A;  4JKD A;  4CHZ A;  2YHB A;  3VF2 A;  1Z25 A;  2IOC A;  4PUO A;  4Q0B A;  3H1Q A;  3T1Y K;  4O5F A;  1JDE A;  3PSF A;  4NO7 A;  2CB8 A;  5BR8 K;  4FJH A;  2A6A A;  1KCF A;  2EMT A;  4W5O A;  3LM9 A;  4HHT A;  3U9Z A;  1VQO N;  1WBB A;  4CK3 A;  2P9S B;  4KH5 A;  4PWD A;  4YL8 A;  3ZT2 A;  3IS9 A;  4JAX A;  3QIC A;  3IG1 A;  1ILY A;  3KKS A;  3C6T A;  3ZET A;  4QS9 A;  4PHT X;  1RDB A;  2NRV A;  3B6P A;  3NGZ A;  2IAJ A;  1VQM N;  2J0J A;  3PUF A;  4LY7 A;  5AQZ A;  1HKC A;  1YJW N;  3AA2 A;  4BRH A;  3LDQ A;  4FLY A;  3SQ2 A;  1HNZ K;  2QWP A;  3VQD A;  4DV5 K;  5DM6 L;  2B4J A;  1I3A A;  1EWR A;  3SAG A;  1UA1 A;  1ISN A;  1LW2 A;  2R7Y A;  1GC6 A;  2HF3 A;  3OJU A;  4NXN K;  2P9P A;  4E19 A;  1RCH A;  4H0O A;  1R0A A;  2WTU A;  3NH2 A;  5C42 A;  5CE3 A;  4EIA A;  2QWQ A;  2QI2 A;  1TL1 A;  3QER A;  2XY5 A;  2FJ9 A;  1X1P A;  3QBX A;  4CHO A;  3S3N A;  1CZ9 A;  1RGI A;  1W7A A;  1OVY A;  1EET A;  3ZSZ A;  1GLL O;  1FW6 A;  1ESV A;  1NK7 A;  3TAQ A;  1NJZ A;  2P9N A;  3HP9 A;  1I39 A;  4JK8 A;  3CCU N;  4M7X A;  4N47 A;  4NCA A;  2E2P A;  2GBZ A;  1T44 A;  4E89 A;  2YJE A;  4CJE A;  1XMQ K;  1H4R A;  1S9G A;  4K8Z A;  4CZE A;  1UOC A;  1EP4 A;  1XNR K;  1KFD A;  1HB8 A;  4DTO A;  3QET A;  3K57 A;  3K5M A;  3O4W A;  2P9I B;  2X6N A;  2D2Q A;  4GVE A;  1K8A O;  4FM0 A;  2Y1I A;  2HMI A;  2HHS A;  4CGD A;  4RW4 A;  4DU4 A;  1NTI A;  3LZJ A;  3WQU A;  5EVZ A;  1SL1 A;  4IG3 A;  3VEX A;  3HP6 A;  5AQF A;  4E7K A;  2WBN A;  4JS5 A;  1HJR A;  1N5Y A;  4W5Q A;  3ISN C;  4FPB A;  5HP1 A;  4B3O A;  3F5T A;  1KVA A;  5C2F A;  3CJB A;  2EHG A;  3AAP A;  4JI4 K;  2ASP A;  3GBT A;  4FW2 A;  4IFV A;  3CCV N;  1QZ6 A;  3O9U A;  2ZWH A;  2XY6 A;  1ZBS A;  4CJ3 A;  1K9M O;  4BY9 C;  3KJV A;  2D11 A;  4CJV A;  3EZ5 A;  1N34 K;  3DXM A;  5JS1 A;  4GV9 A;  4BE2 A;  3VQB A;  2QKK A;  3M8S A;  4FCY A;  1Q86 O;  1RBT A;  1NGA A;  1S1U A;  3V9U A;  1A5X A;  3WA0 A;  1RT1 A;  1IKW A;  1KVC A;  3OVN A;  2QWL A;  3QO9 A;  1QHA A;  3VF6 A;  4A59 A;  4CFA A;  5C10 A;  4DV3 K;  4B9V A;  1QQO A;  4WQ4 C;  5C15 A;  2FBY A;  1GOC A;  2QXF A;  2YHY A;  3NHG A;  3MAQ A;  3N4Q A;  3SMP A;  4B9Q A;  3LDO A;  5JMV A;  3VQ7 A;  3AA4 A;  2LBB A;  4Z4I A;  1IV0 A;  4DR1 K;  4MLH A;  4DV6 K;  3CER A;  1ATR A;  4AHR A;  3TAE A;  4DQ8 A;  3DAW A;  2ZPY A;  4DR2 K;  2VWB A;  2BE2 A;  4B9T A;  4DF8 A;  3SUP A;  4CEZ A;  5ADX A;  4K8X A;  2GWK A;  1LAW A;  3KLG A;  3OYB A;  4FO0 A;  4B3T K;  4A61 A;  4CJT A;  4J2B A;  5AQU A;  4H03 B;  3CJA A;  1LOT B;  1NJW A;  4FXD A;  3ENO A;  1DKG D;  3U8Z A;  4H0X B;  3LP0 A;  3VET A;  3ZSW A;  4ELV A;  3QLH A;  3P83 D;  1HB6 A;  1VSF A;  2XRI A;  2YHW A;  1T3V A;  3HOT A;  4M3X A;  3D0P A;  5AQK A;  4LF7 K;  5C0Y A;  1HX1 A;  4B8C A;  5GAG P;  5CZ1 A;  3W3D A;  1K8K B;  2O8B A;  4BC4 A;  2FF6 A;  5HOO A;  1HKG A;  2CGK A;  3VEY A;  3KKR A;  1VQP N;  1NG9 A;  5BN8 A;  3V4I A;  5IWA K;  1DT9 A;  4LD0 A;  4CIE A;  5J1E A;  4K42 A;  4AF1 A;  4DV4 K;  4BG8 A;  2OPP A;  1NJY A;  2HHW A;  3FZL A;  5DMR A;  3LAM A;  3VES A;  2GX9 A;  2UXD K;  1IJJ A;  4ELU A;  1KLM A;  4CF1 A;  3WXM B;  3CYM A;  4BVP A;  3C0B A;  1HNI A;  1GLB G;  3OTO K;  3SUQ A;  1OH6 A;  4H5V A;  3L6Q A;  3FGU A;  3O3H A;  2P9P B;  5KPT A;  2O8E B;  1VSH A;  1VSM A;  4CCH A;  1YVU A;  3WT0 A;  2G8V A;  5EY4 A;  1RT4 A;  1NGD A;  1MA9 B;  3WNH A;  3H46 O;  1HKB A;  4FJJ A;  2Q3S A;  1M1K O;  4A2B A;  3SAH A;  4BRE A;  3UE5 A;  1I94 K;  1HMV A;  2IIR A;  2EX3 A;  3AVF A;  1JLC A;  4YY3 K;  4FJ8 A;  5JS2 A;  3PO4 A;  4JKE A;  2YKM A;  4KO0 A;  3FLV A;  2OTJ N;  4GKJ K;  2KFZ A;  4CED A;  4CEO A;  2EWS A;  5MLC Q;  4DTS A;  1E4G T;  4DSK A;  3LDS A;  2A1R A;  1GLJ O;  4I9L A;  4IEE A;  1RT3 A;  4EHT A;  4N5S A;  1KSP A;  3DLR A;  3JXU A;  4WF9 L;  4DS5 A;  3OW2 M;  4MO5 A;  5SZT A;  1D8Y A;  1D9D A;  1C0U A;  1TYQ A;  1U45 A;  4OJR A;  1Z6R A;  2AL6 A;  3THW A;  4FLX A;  4FJG A;  3EE9 A;  4IWV A;  3DYA A;  2CGL A;  4PA1 A;  4YOY A;  1BL3 A;  4JI5 K;  4LF4 K;  3SK3 A;  5M1P A;  4BWM A;  3CCE N;  3VEW A;  3DRP A;  1VK0 A;  3AGR A;  3DRS A;  3GG4 A;  1BG3 A;  3CC2 N;  3AVM A;  4B9M A;  1RT5 A;  2OPR A;  5FRM A;  1NKE A;  1FKP A;  3EY1 A;  4FJ9 A;  1CLQ A;  3ZT4 A;  5EXW A;  1QSS A;  5BRE A;  1WSH A;  4LFB K;  1NGH A;  1LCU A;  5KGX A;  4LH5 A;  2KHO A;  1ASW A;  3NVK A;  4CJW A;  1IBK K;  1U2V B;  3HM9 A;  4JHD A;  1NBW A;  2ZJQ L;  3FZH A;  1BI4 B;  1BCM A;  4L8R B;  4ILJ A;  2LSN A;  4HTL A;  2BGG A;  3BIN A;  3F9K A;  1W2B M;  1RT7 A;  1X3N A;  3HI0 A;  4H0T B;  3VQC A;  3SUO A;  4B3R K;  3BUZ B;  3VER A;  1DIK A;  3LPU A;  3HZ6 A;  2O4I A;  1BU6 O;  3OS0 A;  3DOL A;  3LP1 A;  2VGN A;  2QWR A;  4KPY A;  4A2A A;  2JWL A;  2P9I A;  5HRR A;  3TAN A;  3RSE B;  3TTF A;  2UXC K;  5I3U A;  3HPO A;  2GUI A;  1YUW A;  3SBG A;  3MWT A;  4LSL A;  1U6Z A;  2PFU A;  3QFP A;  4CF8 A;  3OYH A;  1GLD G;  3MCP A;  3OYM A;  4MFB A;  1NLV A;  2E2N A;  1WAJ A;  5AQO A;  3U3G A;  1KRP A;  3C95 A;  4C8M A;  3K0S A;  3O1B A;  1YTU A;  5FPM A;  1K73 O;  5CYM A;  4PQU A;  3UKU B;  2BAN A;  4BRP A;  3DM2 A;  4X64 K;  4EHU A;  1TK5 A;  1C1B A;  3C94 A;  3QEI A;  1G15 A;  1GLC G;  1HYS A;  2V7Y A;  3P1G A;  4B1V A;  1LAV A;  1RTI A;  4DQI A;  4FJN A;  1FK9 A;  5HRO A;  4M3Y A;  1SL0 A;  4DR5 K;  2I7N A;  2OTL N;  5I9E B;  4YOU A;  3AU4 A;  4PKG A;  2E8A A;  1LW0 A;  3HJF A;  4A5B A;  4DTJ A;  5GIO A;  1OH8 A;  4YNQ A;  4WQ4 A;  4CI6 A;  4FL9 A;  1EO1 A;  1DGK N;  5SWM A;  1YT3 A;  4LH4 A;  2E2O A;  1J19 A;  5K14 A;  3PX6 A;  3JSM A;  1ITG A;  1WUA A;  3PO5 A;  1KFS A;  2KZM A;  1VBH A;  3O5B A;  5FLX O;  1FKO A;  1GLE G;  4F9O A;  5AQM A;  4FPA A;  1TKX A;  1A5V A;  3M8Q A;  4DMN A;  3HOS A;  1VQ4 N;  3FFI A;  3OBY A;  3JYT A;  4XIU A;  4DFJ A;  2R82 A;  5AFU H;  4BGA A;  2QA4 N;  4OGE A;  3SJJ A;  3TPQ A;  1GC7 A;  1QTM A;  4O8U A;  4UY8 O;  3KK3 A;  4BRN A;  3DOK A;  1ASV A;  3WXI A;  4O44 A;  3AO4 A;  3M3Z A;  2QM1 A;  3AVL A;  3VEN A;  4B9S A;  2HRJ A;  1HYZ A;  3CFP A;  2HHQ A;  4PL7 A;  3CFO A;  3LL3 A;  3NF8 A;  1KD1 O;  3OY9 A;  4FWL A;  1L5U A;  1RT2 A;  4DQS A;  4B8A B;  4KB0 A;  1XHZ A;  1QSL A;  4JN4 A;  3CJ7 A;  3H6E A;  3E9P A;  3ENH A;  3NCI A;  4H5T A;  4CZJ A;  4E3S A;  1NGB A;  4FZY A;  4JKF A;  5D3G A;  1RTH A;  3MN5 A;  4FK4 A;  1S1X A;  2BTF A;  4KV8 A;  2WFB A;  2F96 A;  4CHN A;  4CGI A;  3KWI A;  3D6R A;  4N76 A;  1JCE A;  4DTP A;  2E88 A;  3O9S A;  1YVN A;  4CGH A;  4OPJ A;  3KLH A;  1TKD A;  4Z4E A;  3QEP A;  3QDK A;  3A5M C;  4BRQ A;  4CZM A;  3HVT A;  3CCJ N;  4X62 K;  3C6H A;  4BR0 A;  3AAR A;  1VQ9 N;  4H5R A;  3O08 A;  3OYJ A;  3CI5 A;  5HRN A;  3B6O A;  2HB5 A;  4DSJ A;  1Y19 B;  3V1R A;  4DR3 K;  1V4T A;  4FWN A;  4B1Y B;  3WNE A;  2WUS A;  2VQE K;  5KTQ A;  3SNN A;  4ZRJ A;  2O8B B;  3ITH A;  2YJF A;  3PX0 A;  2OPQ A;  3SQ1 A;  2DIK A;  4X66 K;  3VPZ A;  3AO3 A;  4CEC A;  3T3F A;  4ZHR A;  1VRT A;  4C8N A;  1BCO A;  3QNN A;  1IBM K;  4Y1D A;  4L3Q A;  4H0Y B;  5GAE P;  1NNE A;  2ITM A;  4C8K A;  4N41 A;  3HTV A;  4FM2 A;  1BDG A;  2HHT A;  4MDA A;  1S9E A;  2CH6 A;  1BI4 A;  4KHY A;  4RW9 A;  2X74 A;  4DSI A;  3IKM A;  3CQ8 A;  4HDQ A;  2KLA A;  1P90 A;  1QVF M;  4FLT A;  1WLJ A;  3VN5 A;  4NCB A;  1WNS A;  3NMU A;  1VSD A;  2HE7 A;  4C8O A;  1JLG A;  4E1J A;  2GEL A;  1NJX A;  3S3M A;  2GEM A;  3OYN A;  4KHU A;  4CGG A;  3QIJ A;  5AZI A;  2RF2 A;  1TKT A;  1RBV A;  1T6D A;  5AQX A;  5BPL A;  2B6A A;  1W97 L;  2VG7 A;  3OYL A;  1N36 K;  1Q9Y A;  3LP3 A;  3A0I X;  2DFH A;  4B9U A;  3MWP A;  2X78 A;  1K6Y A;  4IZ9 A;  1WOQ A;  2O8D B;  4CJL A;  3IAY A;  4IDH A;  1GOB A;  1Q82 O;  3I8B A;  3E01 A;  4QS8 A;  3FP5 A;  1MIX A;  3M5R A;  2HVH A;  3KHY A;  3THW B;  3G9W A;  1BIS A;  4FWK A;  3ATU A;  3KIO A;  4DSF A;  2I1K A;  3IMX A;  5JVL A;  2IDO A;  4JS4 A;  4CZK A;  4LF6 K;  1EWQ A;  1J54 A;  1CXQ A;  1LWE A;  3FFK B;  4BRI A;  3CJ1 A;  1KBL A;  4Z0U A;  1VSE A;  4JI8 K;  3FR0 A;  2D10 A;  3VEO A;  3MXJ A;  2E5L K;  4FWS A;  2ZGY A;  5HL7 L;  4WFA L;  4ISF A;  2HBL A;  3KK1 A;  4Z94 A;  1NK5 A;  1RT6 A;  4H0V B;  5EOY A;  3OYA A;  4KHN A;  1K8K A;  3QES A;  3TAP A;  3EO3 A;  1S1T A;  4UQG A;  1EF1 A;  1S6Q A;  2F9W A;  1KQS M;  1NGG A;  2UUB K;  4F3T A;  4CGJ A;  3OS1 A;  4CJK A;  4JI6 K;  5M1O A;  4DKW A;  1X3M A;  3CPW M;  2P9K B;  5KPR A;  1TAQ A;  4BWJ A;  1RTJ A;  2ZM6 K;  3L2R A;  4CEE A;  2NRW A;  3THX B;  3E1Y A;  2YV0 X;  4BQL A;  3ASM A;  2P5G A;  1YTA A;  2A40 A;  4CFB A;  4DSE A;  5LY3 A;  3OYD A;  3CCL N;  4CHP A;  1BHL A;  1B92 A;  1WSG A;  5IJM A;  2FSJ A;  5E26 A;  1EX4 A;  4JNE A;  3VQE A;  5EU7 A;  3VA0 A;  3AVI A;  4B3M K;  3KZB A;  3AU5 A;  5CR4 A;  3PZD A;  3NH1 A;  1J6Z A;  2VYP A;  4CE9 A;  2IGI A;  1BA1 A;  2OA8 A;  4CD3 A;  3EKS A;  4JV5 K;  4OGC A;  1NOY A;  1T7P A;  2OZM A;  3ZEU B;  3CD6 N;  4BR5 A;  3VQ4 A;  1IKY A;  3MN6 A;  3SLC A;  3L2V A;  2Q97 A;  1ATS A;  3R8E A;  1OH5 A;  1L3U A;  1U04 A;  1QZ5 A;  4B08 A;  3GOI A;  2D0O A;  3MN7 A;  4N56 A;  3NAE A;  4JK9 A;  2KQ2 A;  3SCX A;  4ILH A;  3MMV A;  1UWB A;  4PKI A;  4B3S K;  2X6S A;  4E7J A;  2HNZ A;  2KKZ A;  3AO5 A;  4WYB A;  3OS2 A;  4F2R A;  3CCR N;  3RMD A;  3KK2 A;  4MQ3 A;  3CMA N;  3ZSY A;  4J2A A;  4HUE A;  3O3F A;  2J0K A;  4GKK K;  1KXP A;  1HR0 K;  4OLA A;  1J9A A;  5C2D A;  3GE1 A;  4H5N A;  4KI6 A;  1JJ2 M;  4FOE A;  3WEE A;  3EYZ A;  4CW7 B;  1VSJ A;  2E20 A;  3AVC A;  4IEI A;  4FJL A;  3QBW A;  4NCG A;  2A3Z A;  4AIL C;  2ASO A;  5AJ3 K;  4GNI A;  4IOC L;  3AY9 A;  5AQS A;  4FWM A;  3RSE A;  1L3T A;  2Z1H A;  3BGR A;  2H3G X;  3M6G A;  5AQT A;  2KTQ A;  1IG8 A;  3L2U A;  3SV4 A;  3J80 O;  3V9S A;  3AV9 A;  3PX4 A;  2YCH A;  3O6W A;  2HHX A;  3MX2 A;  3MX5 A;  2KZZ A;  4LF5 K;  4IXC A;  5LL6 Z;  3R6M A;  1T8E A;  1NK9 A;  3OYC A;  4JI3 K;  1O1W A;  3DJC A;  3ZX2 A;  2DTU A;  1HNV A;  2G8I A;  2WOM A;  4DFP A;  4BVO A;  2BDP A;  1C6V A;  1S3X A;  5AZJ A;  3SPZ A;  4CK1 A;  3DRR A;  4CES A;  1SKR A;  3CFR A;  3F73 A;  3L0Q A;  4JKC A;  2YHX A;  3H45 C;  4FW1 A;  1M90 O;  4B1X B;  3ID6 A;  4BDY A;  1CXU A;  3DXK B;  3OHR A;  2ASM A;  1ZBI A;  1S72 N;  4IJA A;  2F9T A;  2IS3 A;  4CHQ A;  3FZF A;  5LMU K;  2QK9 A;  3T19 A;  1W0H A;  5F2R A;  4JI7 K;  1OH7 A;  4BE1 A;  4E1N A;  5KGW A;  2FXU A;  4IG0 A;  5ELZ A;  1JCG A;  4CZL A;  1L3V A;  2G8H A;  2B5J A;  4KRE A;  2ITG A;  4IFE A;  2P9U B;  2VCP A;  4IBN A;  4YFU A;  2RKI A;  3MEG A;  4EFH A;  2W42 A;  1NWK A;  4BRM A;  4AHC A;  1NGJ A;  4GVM A;  5HLF A;  1BQN A;  5AZJ B;  4QS7 A;  3M1F A;  3T69 A;  4M3Z A;  3WXJ A;  2O8D A;  4BR4 A;  1IKV A;  4JD2 B;  3HXM A;  2RPI A;  4W5N A;  1Q81 O;  1U48 A;  1TYQ B;  3ZSR A;  2V52 B;  2UXB K;  2HBM A;  1IKX A;  2J0M A;  3VQQ A;  5AQV A;  1HJO A;  3ZSV A;  4CJP A;  4B9L A;  3F9M A;  4IFY A;  5JIC A;  1P8Z A;  3V1Q A;  4DCH A;  3Q7B A;  2P1J A;  3P38 A;  5GAH P;  1U2V A;  3HSC A;  2AP1 A;  4XEI A;  3ZLJ A;  5GIN A;  4CEB A;  3CHW A;  4CJS A;  1RTD A;  4A5A A;  3TU5 A;  1MK9 B;  2Z1I A;  3BZC A;  3IFR A;  2EMS A;  1XNQ K;  2P9S A;  2AJQ A;  2E6L A;  1SKS A;  2FLO A;  3I55 N;  3S9H A;  1MWK A;  3HT3 A;  3P31 A;  4ZTF A;  3UIQ A;  4DV2 K;  4LFA K;  1ST7 A;  3TAF A;  2UUA K;  3AVA A;  5KRS A;  1IH7 A;  3BDP A;  3ZSQ A;  3KD1 E;  3VMF B;  5A2Q O;  1VHX A;  4JRP A;  1NK0 A;  3D2F B;  1R59 O;  4BAC A;  3UKU A;  4CF2 A;  3T1A A;  3D2F A;  3MED A;  3HPG A;  4GV6 A;  1VQL N;  3EE8 A;  1X9S A;  4I9Q A;  3V1O A;  3PV8 A;  1C1C A;  3MXM A;  2D0P A;  4WCE L;  5BN9 A;  3L8B A;  1A5W A;  1WAF A;  4RWT A;  4HCB A;  1JKH A;  3CME N;  1U49 A;  1SZ2 A;  5LMN K;  3TAR A;  3E9L A;  4O5B A;  4PKH A;  3ALY A;  4QAG A;  4C1N I;  1NMD A;  4M63 C;  1KVB A;  3T7Z A;  1QS4 A;  4C23 A;  4AM7 A;  4CFD A;  4OKK A;  4HVJ A;  3L4I A;  4FK0 A;  1MU2 A;  1NK4 A;  3VQA A;  4CJ5 A;  3M8P A;  1NMN A;  4PL8 A;  3TAM A;  2D5R A;  4I6M B;  2OYQ A;  3W0L A;  1TGO A;  1YXQ A;  1Y64 A;  3X23 A;  3ZT1 A;  4JKA A;  2ZF5 O;  3SQ4 A;  1Z05 A;  4AHT A;  2G8U A;  1JLA A;  3RRH A;  3SUN A;  5JLF A;  5AQG A;  2O8E A;  3DLK A;  4DV1 K;  3RTV A;  2XY7 A;  4Q5V A;  1Y97 A;  1VSI A;  5FRO A;  4KHW A;  1TK8 A;  1WBD A;  3WQT A;  4RW7 A;  4FWR A;  1SQK A;  4DXA B;  4I6M A;  3QEW A;  3NBP A;  1C1A A;  1WSJ A;  4FLV A;  3OYI A;  4KTW A;  2FF3 B;  2XHB A;  3HRG A;  4WQ5 A;  3TI0 A;  1U4B A;  4JLH A;  4DV0 K;  3UB5 A;  3VQP A;  1BO5 O;  1UA0 A;  3V6D A;  3LAN A;  5F1X A;  1NOZ A;  2HST A;  3LP2 A;  3WNF A;  1E3M A;  3J7A P;  2HF4 A;  1LV5 A;  4HCC A;  1RBR A;  2QW9 A;  1XC9 A;  4DHY A;  3O9T A;  4B1U B;  3MCA B;  3HVR A;  4FVM A;  4Y0W A;  3JAM O;  4AHV A;  1UAX A;  3UKR B;  1Q7Y O;  3K58 A;  4BE0 A;  3I0S A;  1WN7 A;  2NRT A;  4CIF A;  3TR8 A;  5AQL A;  4JKG B;  1DEJ A;  1O13 A;  5AQY A;  1SAZ A;  1HQU A;  5FPN A;  3Q7C A;  1B9D A;  3DWL A;  3J8A A;  4NYF A;  3DMJ A;  4AHU A;  5C24 A;  3TSQ A;  4XH1 A;  2OPS A;  3PIO L;  4FM1 A;  3VF4 A;  3C6U A;  2P51 A;  4DFM A;  1YIJ N;  2BH1 A;  3GL1 A;  1TK0 A;  1H1V A;  4FWO A;  4WFN L;  3FZM A;  4RCH A;  3V9Z A;  4NLB A;  3DLH A;  4EZ6 A;  3THY B;  3AO2 A;  3EN9 A;  3RR8 A;  1TUU A;  2O4G A;  4M3U A;  4FLZ A;  1GLF O;  3SQ0 A;  1F21 A;  4GXB A;  3E66 A;  2HND A;  3TAB A;  5CYQ A;  4DSL A;  4IO8 A;  1C0M A;  2YNG A;  1FXX A;  2HBK A;  4C8L A;  4RTF D;  3CM5 A;  4AM6 A;  1J5E K;  4EP5 A;  1QHT A;  5E41 A;  2I7P A;  4CF9 A;  3QIP A;  1G99 A;  4GMJ B;  3S41 A;  3V81 A;  3SYZ A;  3OYE A;  1KC8 O;  4U67 L;  1QVG M;  2NRX A;  3AO1 A;  3C6A A;  4RW6 A;  3SAF A;  3L2Q A;  3HK2 A;  3K2P A;  2FC0 A;  4ILG B;  1JLQ A;  3R1X A;  4DR6 K;  3B8A X;  2F4V K;  4KTZ A;  1EXQ A;  3RWU A;  1YI2 N;  4IOA L;  3ID8 A;  4FLU A;  4H8K A;  3AVG A;  4DLE A;  1X9W A;  3QNO A;  1Q18 A;  3CJC A;  4F7G A;  1NGF A;  3HM8 A;  3DLG A;  4ISE A;  2HMP A;  1VSK A;  3CQX A;  2NZT A;  4NY0 A;  4CF0 A;  5LJV A;  3AVK A;  3DXM B;  3AA3 A;  4CER A;  3T1H K;  4LC9 B;  4CZF A;  1S1V A;  5M1Q A;  5KQ8 A;  1YJ9 N;  3O1W A;  2COP A;  1QQN A;  3CCQ N;  4A57 A;  3WXL A;  2PZS A;  1ASU A;  2DPN A;  3L2W A;  4OPA A;  1NI2 A;  4M45 A;  2ABD A;  1NJI O;  3HO1 A;  2A41 A;  4M3W A;  3CIP A;  2DY4 A;  5KPZ A;  1WSE A;  5AFU A;  2AEH A;  1ZBF A;  1TKZ A;  2D0A A;  1LWC A;  1VRU A;  2NRR A;  2YNH A;  3GDQ A;  1JXB A;  4DQQ A;  3NF7 A;  3MXI A;  4DFK A;  4OLB A;  4WQ5 C;  2FBX A;  3TTD A;  5FDL A;  1SS6 A;  3IUC A;  4OPH A;  1HYV A;  1ZXO A;  2YHA A;  3DLB A;  3QIO A;  1IBL K;  1HLU A;  3E9O A;  2XY8 A;  4W5R A;  2CQU A;  3U3Y A;  2GTD A;  3TAG A;  4CJQ A;  3PSI A;  3A8Y A;  3J7Y P;  3ENB A;  3VEV A;  2FBT A;  4E0D A;  2KFN A;  2FSN A;  3SMS A;  4W5T A;  1RIL A;  4BR7 A;  5HBM A;  4RG8 A;  4M41 A;  2Q2R A;  4HDO A;  3H1V X;  4Z4F A;  2HHV A;  4FZX C;  3VGL A;  2UUC K;  5DK5 A;  3ZT3 A;  5AQH A;  3DXK A;  3OYG A;  4CBU A;  1SV5 A;  3AA5 X;  2ZJP L;  2PBD A;  1JLE A;  5KRT A;  4M7Y A;  3JS6 A;  4KTQ A;  1BGX T;  3RR7 A;  2P5O A;  2Q0U A;  4ZRI A;  5M1F A;  4CJR A;  1X9M A;  4OX9 K;  1JLF A;  3LM2 A;  4F3O A;  4OPK A;  4CEF A;  2O8F A;  5HRS A;  4CBW A;  3K9K A;  2XO7 A;  1EKE A;  4BGB A;  3O8M A;  3LDP A;  4M3R A;  1SUQ A;  1RNH A;  4I2P A;  4FWQ A;  1DLO A;  2E4L A;  3LZI A;  3ZEU A;  3G6E N;  4P7I A;  2RE2 A;  1NGE A;  2IC3 A;  4CZH A;  4KH6 A;  4BR2 A;  2VQF K;  4DQR A;  3O9Q A;  2O8C B;  3LAK A;  3LDL A;  2FDQ A;  3ULE B;  5CHI A;  4KHS A;  3VTI A;  2O8C A;  3CG7 A;  2DFF A;  4A62 A;  4XH4 A;  4ID5 A;  1VQ8 N;  3A5N C;  2X0S A;  4DR7 K;  3WXK A;  4IDK A;  1QE1 A;  2P9L B;  1BQM A;  1S22 A;  5BRF A;  2V7Z A;  3BZK A;  5T7B A;  3KLE A;  4HWI A;  3NF9 A;  4FJX A;  3C7N A;  4KH4 A;  4BRK A;  4FOI A;  3OYF A;  5KI6 A;  3NH0 A;  1N6Q A;  1C0T A;  5FPD A;  1MK7 B;  4KRF A;  3HST B;  4NB4 A;  4BRO A;  4KB1 A;  4H4O A;  3CET A;  4MDB A;  3QEX A;  3VGM A;  1T6C A;  4F2S A;  4XH5 A;  2A5X A;  4B9N A;  1N8R O;  3RMC A;  2A1S A;  1T03 A;  1BIU A;  5BRH A;  3I56 N;  2J4R A;  1HBK A;  2QKB A;  3RMA A;  4BR9 A;  2ZQB A; 
#chains in the Genus database with same CATH homology
 4CZG A;  2FXU A;  5ELZ A;  1JCG A;  4CZL A;  3HZ6 A;  1BU6 O;  3U4L A;  4IFE A;  1GGO A;  2P9U B;  2VCP A;  2VGN A;  2QWR A;  3ATV A;  4IO9 L;  2V51 B;  2JWL A;  4JHD B;  2P9I A;  4A2A A;  4JKG A;  3RSE B;  4EFH A;  3TTF A;  4NLC A;  2ZJR L;  5BPN A;  2PAV A;  3VEZ A;  4BRL A;  1NWK A;  2I1J A;  4BRM A;  1NGJ A;  4O8K A;  3UKR A;  3F2K A;  1ACA A;  5AZJ B;  2Q31 A;  3EL2 A;  4QS7 A;  1RDU A;  3M1F A;  3T69 A;  3ULE A;  1YUW A;  3WXJ A;  3SBG A;  3PLA A;  3MWT A;  2CGJ A;  4BC2 A;  1VBG A;  4BR4 A;  3QB0 A;  4JD2 B;  1U6Z A;  2Q0R A;  2UYT A;  3EZW A;  3O9R A;  2PFU A;  3QFP A;  5AQW A;  1TYQ B;  1CZA N;  1Q81 O;  4BG9 A;  2V52 B;  1GLD G;  2HBM A;  3MCP A;  2D4W A;  2J0M A;  1NLV A;  2E2N A;  4GY2 B;  4YOT A;  4YOW A;  4BRG A;  5AQV A;  1HJO A;  5AQO A;  4BRF A;  3F9M A;  5JIC A;  1P8Z A;  4BQZ A;  3O1B A;  3CPE A;  4DCH A;  5FPM A;  1K73 O;  3R3L A;  4JKD A;  3Q7B A;  4K41 A;  3VF2 A;  3P38 A;  5GAH P;  3UKU B;  1U2V A;  4BRP A;  3IVF A;  3HSC A;  2AP1 A;  3H1Q A;  4XEI A;  1NGC A;  2QWO A;  4EHU A;  4O5F A;  5BPM A;  5GIN A;  3RVC A;  3CHW A;  1JDE A;  4A5A A;  3TU5 A;  1GLC G;  2V7Y A;  4B1V A;  1MK9 B;  4NO7 A;  2CB8 A;  5BRD A;  3VGK A;  4CJ7 A;  3IFR A;  3SJH A;  2JWK A;  3EKU A;  3WEE B;  2EMS A;  2A6A A;  2P9S A;  2EMT A;  1KC7 A;  3LM9 A;  4MLE A;  2FLO A;  2I7N A;  5FPE A;  2OTL N;  3U9Z A;  1VQO N;  3I55 N;  1MWK A;  5I9E B;  2P9S B;  4KH5 A;  4YOU A;  1V4S A;  3P31 A;  3AU4 A;  4YL8 A;  2QTD A;  4PKG A;  2E8A A;  1ST7 A;  4JAX A;  2RQ1 A;  3QIC A;  3VMF B;  1ILY A;  4A5B A;  3TTC A;  5GIO A;  3ZET A;  4EKU A;  4QS9 A;  4WQ4 A;  3D2F B;  4FL9 A;  4CI6 A;  1R59 O;  4PHT X;  3PIP L;  2NRV A;  3CC4 N;  1EO1 A;  1DGK N;  1VQM N;  2J0J A;  3UKU A;  5AQZ A;  1HKC A;  1YJW N;  5AQI A;  4BRH A;  3LDQ A;  3D2F A;  4GV6 A;  1VQL N;  3EE8 A;  2E2O A;  5JVH L;  1J19 A;  4YOX A;  2D0P A;  2QWP A;  4WCE L;  2CH5 A;  1RFQ A;  5BN9 A;  1WUA A;  4BRD A;  1BWF O;  4RWT A;  5DM6 L;  2AA4 A;  1VBH A;  3O5B A;  2W41 A;  4F9O A;  1GLE G;  5AQM A;  4FPA A;  5EX5 A;  4BC5 A;  1YF5 L;  3SAG A;  4U7B A;  3N4P A;  1ISN A;  3HOS A;  3CME N;  3U8X A;  1VQ4 N;  3IDH A;  1SZ2 A;  3OBY A;  1GC6 A;  2HF3 A;  3E9L A;  4EAH D;  4PKH A;  2P9P A;  4C1N I;  4H0O A;  1NMD A;  2R82 A;  5AFU H;  4BGA A;  2QA4 N;  4M63 C;  5CE3 A;  4EIA A;  2QWQ A;  2QI2 A;  3BEX A;  2YX6 A;  3TPQ A;  3T7Z A;  3OA9 A;  4C23 A;  4AM7 A;  1KAX A;  1GC7 A;  2FJ9 A;  4YOR A;  4O8U A;  2IVN A;  4UY8 O;  4CYE A;  2QWM A;  4JK7 A;  3L4I A;  4BRN A;  3QBX A;  3WXI A;  3NVM A;  5AQR A;  4PL8 A;  5M1K A;  1RGI A;  3TSP A;  3BP8 A;  1OVY A;  3M3Z A;  4I6M B;  2QM1 A;  1MDU B;  1GLL O;  3W0L A;  1ESV A;  3VEN A;  3ZDT A;  1YXQ A;  2P9N A;  2HRJ A;  1VQ7 N;  4PL7 A;  1Y64 A;  3X23 A;  4JKA A;  4JK8 A;  3LL3 A;  5LJW A;  2FSK A;  2ZF5 O;  1Z05 A;  3CCU N;  4M7X A;  1KD1 O;  4FWL A;  5JLF A;  5AQP A;  3H3O B;  2P9K A;  3OBW A;  5AQG A;  2E2P A;  4JN4 A;  1T44 A;  2YJE A;  3CJ7 A;  3H6E A;  3E9P A;  3ENH A;  1H4R A;  2P9N B;  3WQT A;  3CCM N;  4H5T A;  4CZJ A;  4CZE A;  1NGB A;  4FWR A;  4JKF A;  1SQK A;  3WUH A;  4DXA B;  4I6M A;  1HB8 A;  3MN5 A;  2BTF A;  2IVO A;  2WFB A;  3KK7 A;  3KWI A;  3O4W A;  2P9I B;  3D6R A;  5AR0 A;  2FF3 B;  2GUP A;  2D2Q A;  1JCE A;  2Q1N A;  2E88 A;  3HRG A;  1YVN A;  3O9S A;  4GVE A;  4WQ5 A;  5ADX H;  2WC9 A;  1K8A O;  3QDK A;  3CJ9 A;  3CXC M;  3A5M C;  2BUP A;  4BRQ A;  3UB5 A;  1BO5 O;  4CZM A;  2IVP A;  1NTI A;  3CCJ N;  1OKJ A;  5F1X A;  2HST A;  3WQU A;  5EVZ A;  3C6H A;  3G71 N;  4BR0 A;  2HF4 A;  3VEX A;  2F7T A;  3AAR A;  5AQF A;  2QW9 A;  2WBN A;  4IOX A;  1VQ9 N;  4H5R A;  4DHY A;  3O08 A;  3O9T A;  3CI5 A;  3MCA B;  4B1U B;  1BA0 A;  5JVG L;  3L4Q A;  1D4X A;  1Y19 B;  3A5L C;  2P9L A;  4FPB A;  4Y0W A;  2NRZ A;  1V4T A;  4FWN A;  3UKR B;  4B1Y B;  1Q7Y O;  2WUS A;  3F5T A;  3ZX0 A;  5C2F A;  3CJB A;  2ZGZ A;  4ZRJ A;  1GLA G;  1X9J A;  1KAY A;  2NRT A;  3AAP A;  3FE1 A;  2ASP A;  5AQL A;  4JKG B;  1DEJ A;  1XUP O;  2YJF A;  4YDU C;  1O13 A;  3GBT A;  1SAZ A;  5AQY A;  4CD1 A;  3CCV N;  3U7D A;  1QZ6 A;  3O9U A;  2DIK A;  3Q7C A;  5FPN A;  2ZWH A;  3DWL A;  3VPZ A;  2YI1 A;  1XQS C;  1ZBS A;  2VGM A;  3J8A A;  1K9M O;  3TSU A;  4BY9 C;  2Q36 A;  2D11 A;  1VQ6 N;  3DXM A;  3TSQ A;  3VOV A;  4GV9 A;  3P39 A;  4H0Y B;  4L3Q A;  5GAE P;  4XH1 A;  3PIO L;  2ITM A;  1Q86 O;  4R79 A;  3HTV A;  1NGA A;  1BDG A;  3VF4 A;  4MDA A;  3WA0 A;  2CH6 A;  5KQD A;  1YIJ N;  2BH1 A;  5AZI B;  3GL1 A;  1YHQ N;  2QEX N;  4JKH A;  1H1V A;  4FWO A;  4WFN L;  1BUP A;  2QWL A;  4GV3 A;  3FZM A;  4RCH A;  4NLB A;  1QHA A;  4YDU A;  3VF6 A;  3IKM A;  4A59 A;  4K25 A;  5C10 A;  4HDQ A;  3EN9 A;  2KLA A;  1P90 A;  1TUU A;  1QQO A;  4WQ4 C;  5F0X A;  1QVF M;  5C15 A;  3SBT A;  4JKB A;  3NMU A;  1GLF O;  1C0G A;  2HE7 A;  4GXB A;  4E1J A;  1VAZ A;  2GEL A;  3E66 A;  2YHY A;  2GEM A;  4IO8 A;  3U9D A;  2HBK A;  3KVG A;  3N4Q A;  4RTF D;  3SMP A;  4AM6 A;  3LDO A;  3QIJ A;  5AZI A;  4B9Q A;  5JMV A;  2NNW A;  1T6D A;  1TUY A;  5AQX A;  5BPL A;  3DLL L;  2I7P A;  2LBB A;  1W97 L;  1G99 A;  3MDQ A;  3CF5 L;  3S41 A;  4MLH A;  3CER A;  1ATR A;  1YJN N;  2GWJ A;  1KC8 O;  3FZK A;  3A0I X;  4DQ8 A;  3DAW A;  2ZPY A;  4U67 L;  2NRX A;  3ZX3 A;  3C6A A;  3SAF A;  1QVG M;  1VQ5 N;  2VWB A;  3MWP A;  5B8H A;  4ILG B;  4IZ9 A;  1WOQ A;  4B1Z A;  2W40 A;  5ADX A;  4IDH A;  3R1X A;  2GWK A;  1Q82 O;  3I8B A;  4QS8 A;  4ZRK A;  3FP5 A;  1MIX A;  3B8A X;  3M5R A;  3KHY A;  3G9W A;  4FO0 A;  4FWK A;  3ATU A;  1YI2 N;  4A61 A;  4IOA L;  1NVL A;  3ID8 A;  2I1K A;  3IMX A;  5JVL A;  5AQU A;  4H03 B;  4C1N K;  3CJA A;  1LOT B;  3D2E B;  4CZK A;  5JLH A;  3ENO A;  3FLC O;  1Q18 A;  1DKG D;  3CJC A;  4F7G A;  1NGF A;  3FFK B;  3HBT A;  3HM8 A;  5TKW A;  4ISE A;  3U8Z A;  4H0X B;  2HMP A;  4BRI A;  3VET A;  3CJ1 A;  3CQX A;  2NZT A;  4NY0 A;  1KBL A;  4TKN A;  5LJV A;  1HB6 A;  3FR0 A;  2YHW A;  2D10 A;  1T3V A;  3DXM B;  3VEO A;  3HOT A;  4LC9 B;  2A42 A;  4CZF A;  4FWS A;  5AQK A;  5M1Q A;  4BRC A;  2ZGY A;  5HL7 L;  4WFA L;  5KQ8 A;  4B1W B;  4ISF A;  3O1W A;  1YAG A;  1YJ9 N;  2HBL A;  2COP A;  4Z94 A;  1QQN A;  5AQN A;  3CCQ N;  4H0V B;  4A57 A;  5C0Y A;  1HX1 A;  3WXL A;  5EOY A;  1MWM A;  3G4S N;  5GAG P;  1K8K A;  4WFB L;  1VQK N;  1KAZ A;  3EO3 A;  3I33 A;  3W3D A;  2DPN A;  1K8K B;  1E4F T;  4BC4 A;  3CD6 N;  2WH5 A;  2FF6 A;  1MIZ B;  4OPA A;  1EF1 A;  2F9W A;  5HOO A;  1HKG A;  1NGG A;  3CQY A;  1NI2 A;  1KQS M;  2ABD A;  2CGK A;  4H0P A;  3VEY A;  1NJI O;  4FSV A;  2A41 A;  1VQP N;  3CIP A;  5M1O A;  5KPZ A;  3EPY A;  5BN8 A;  4DKW A;  1X3M A;  1DT9 A;  5H1S Q;  3CPW M;  2P9K B;  5KPR A;  5AFU A;  4K42 A;  1VQN N;  4AF1 A;  2AEH A;  3BF3 A;  4BG8 A;  3GDQ A;  3VTH A;  2NRR A;  2NRW A;  3AAQ A;  3D7E O;  3E1Y A;  3ZYY X;  3FZL A;  3AGK A;  4WQ5 C;  3TTD A;  1ATN A;  3G25 A;  4BQL A;  1SS6 A;  3MN9 A;  2E1Y A;  3VES A;  3IUC A;  4OPH A;  2GX9 A;  3D2E A;  1ZXO A;  2A40 A;  3QML A;  1NGI A;  3CC7 N;  1HLU A;  3E9O A;  1IJJ A;  5LY3 A;  2CQU A;  4CZI A;  2GTD A;  2D1K A;  1YIT N;  1XC3 A;  4JEP A;  4FWP A;  3CCL N;  3WXM B;  4BC3 A;  3A8Y A;  3BF1 A;  5IJM A;  2FSJ A;  5E26 A;  4BVP A;  3ENB A;  3P4I A;  3C0B A;  4JNE A;  1GLB G;  3PVL A;  2P9U A;  3VEV A;  4J8F A;  2FSN A;  3SMS A;  4H5V A;  3L6Q A;  3R9P A;  3FGU A;  4BR7 A;  3KZB A;  3AU5 A;  5CR4 A;  3PZD A;  1J6Z A;  4FVU A;  2P9P B;  2VYP A;  2Q2R A;  1BA1 A;  4HDO A;  3H1V X;  5KPT A;  5AQJ A;  3VGL A;  4CD3 A;  3EKS A;  3WT0 A;  5EY4 A;  1NGD A;  1MA9 B;  3C65 A;  5AQH A;  1SGH A;  3DXK A;  3ZEU B;  4BR5 A;  3H46 O;  3MN6 A;  4CBU A;  1HKB A;  3SLC A;  3LDN A;  2ZJP L;  1M1K O;  2PBD A;  3K9J A;  4A2B A;  4BRE A;  3SAH A;  2Q97 A;  1ATS A;  2NLX A;  3UE5 A;  3R8E A;  2IIR A;  3CCS N;  2RHK A;  1QZ5 A;  3QFU A;  4M7Y A;  3JS6 A;  4JKE A;  3GOI A;  3FLV A;  2D0O A;  3MN7 A;  2OTJ N;  4JK9 A;  2QWN A;  4ILH A;  3MMV A;  4H5W A;  2Q0U A;  4ZRI A;  4PKI A;  5M1F A;  2KKZ A;  3LM2 A;  4ISG A;  4WYB A;  3ZET B;  3CCR N;  2EWS A;  5MLC Q;  1RDW X;  2QXL A;  1E4G T;  4BRA A;  3CMA N;  5DM7 L;  1GG3 A;  4CBW A;  1GLJ O;  3K9K A;  2HBJ A;  3J7Z O;  4BGB A;  2J0K A;  1HPM A;  3O8M A;  3LDP A;  4IEE A;  3H3N O;  1KXP A;  4EHT A;  3O80 A;  3JXU A;  4FWQ A;  4WF9 L;  3ZEU A;  3OW2 M;  5C2D A;  3GE1 A;  4H5N A;  4K43 A;  4MO5 A;  4FOE A;  3G6E N;  3WEE A;  4P7I A;  2YVC A;  1NGE A;  2RE2 A;  1JJ2 M;  1TYQ A;  4CZH A;  1Z6R A;  2E20 A;  4KH6 A;  4BR2 A;  5BR9 A;  4JD2 A;  2AL6 A;  3O9Q A;  3LDL A;  2FDQ A;  3EE9 A;  4IWV A;  5GAD P;  4IEI A;  2NRH A;  3ULE B;  2CGL A;  3QBW A;  5CHI A;  2A3Z A;  3VTI A;  5GIP A;  1JCF A;  2ASO A;  4GNI A;  4IOC L;  4YOY A;  3AY9 A;  5AQS A;  1HUX A;  4A62 A;  4FWM A;  4KBO A;  4XH4 A;  1EQY A;  3RSE A;  1VQ8 N;  3A5N C;  2X0S A;  2H3G X;  3M6G A;  5AQT A;  5M1P A;  3SK3 A;  3WXK A;  2P9L B;  5BRF A;  1IG8 A;  1S22 A;  3VEW A;  5C12 A;  2E1Z A;  3CCE N;  3AGR A;  1E5W A;  2V7Z A;  3GG4 A;  1BG3 A;  5AQQ A;  2HOE A;  2YCH A;  3O6W A;  3MX2 A;  3MX5 A;  3CC2 N;  3A5O C;  2OAN A;  4HWI A;  4IJN A;  4IXC A;  3C7N A;  3R6M A;  4G9Z A;  4KH4 A;  4BRK A;  4FOI A;  4MO4 A;  3DJC A;  3ZX2 A;  5FPD A;  1MK7 B;  4NB4 A;  5EXW A;  4BRO A;  4BVO A;  5BRE A;  3CET A;  4MDB A;  1NGH A;  1LCU A;  1S3X A;  3VGM A;  5AZJ A;  1T6C A;  4DB3 A;  2KHO A;  4CBX A;  1NM1 A;  3NVK A;  4XH5 A;  4OO1 J;  1U2V B;  2A5X A;  1BOT O;  3L0Q A;  5M1N A;  4JKC A;  4JHD A;  1C0F A;  2YHX A;  5E84 A;  1NBW A;  3H45 C;  1N8R O;  4YOV A;  1M90 O;  4B1X B;  2ZJQ L;  3ID6 A;  3FZH A;  1ZC6 A;  3DXK B;  3OHR A;  4ILJ A;  2ASM A;  2E2Q A;  4HTL A;  5TKY A;  3KWG A;  1S72 N;  4IJA A;  2F9T A;  3BIN A;  3FZF A;  5BRH A;  3I56 N;  2J4R A;  1HBK A;  1W2B M;  1X3N A;  3HI0 A;  1QQM A;  4H0T B;  3C7N B;  3BUZ B;  3MK6 A;  5F2R A;  3VER A;  4BR9 A;  1DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...