4JK9A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound co ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk9A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk9A01
4ILJA 4JKAA 4JKBA 4JKHA 3SBTA 4JKGB 4JKEA 4JK9A 4JK8A 4JKGA 3ENBA 4JKCA 4ILHA 4JKFA 3E9PA 3E9LA 3E66A 3E9OA 4JKDA 4ILGB 4JK7A 3SBGA
chains in the Genus database with same CATH superfamily
4RCHA 5ADXH 4DSKA 5AZJA 3NVKA 3O4WA 2BE2A 4B8AB 4W5TA 1SKSA 3JAMO 2HSTA 3AVIA 2Q2RA 3VQ6A 2P9UA 5T7BA 5B8HA 2F9TA 2I7PA 4I6MB 4B3SK 4DR7K 3AVAA 5BR9A 4B1YB 3VEXA 4CHOA 4OKKA 4CGJA 4M3ZA 3JSMA 4PKGA 3WQTA 4WYBA 4JS5A 1BIZA 2O8BA 4CZLA 4BACA 4CJRA 5HROA 4B08A 3HYFA 4R79A 2D0AA 3UKUA 1FK9A 4CF9A 1J54A 3C7NB 4IJAA 1RTDA 4YOVA 1YI2N 3VQ9A 3SUQA 4U7BA 1Z05A 4OGEA 3J7AP 1W97L 2LBBA 3SV4A 4MLEA 1VQLN 3VMFB 4B3RK 3C6AA 3THYB 3AA5X 2E20A 4JHDA 4CZGA 3A5LC 3OYAA 2E2QA 3AVKA 5AQFA 4HDQA 1DT9A 4A2AA 3V81A 4LF7K 1KAYA 1Z26A 1WUAA 3MEDA 3ZT1A 3PZDA 2ITGA 4E19A 3QICA 2OPRA 4E0DA 4DU3A 1NVLA 3LP2A 5AQSA 4OPHA 2G8FA 3AARA 2IVOA 4WE1A 2E4LA 3WXLA 4DKWA 3K58A 4FZYA 4IDHA 4KB0A 1MK7B 1HB6A 4H4OA 3VEZA 1XQSC 1JXBA 3OW2M 4PUOA 4JKGB 4E7KA 3AU4A 3NHGA 4KAZA 2VCPA 3CCQN 4WQ5A 1NGEA 3VEWA 1ATNA 1WBDA 4CEFA 3GG4A 3ZSRA 3FFKB 3VESA 4KI6A 1LOTB 1XUPO 4FJ9A 4CFDA 1FXXA 4FK4A 1DEJA 2G8IA 3HP9A 2P9PA 4DCHA 4B9UA 4BY9C 2WC9A 2B4JA 4NY0A 4CJ3A 4RW8A 2HMIA 4LFBK 4L3QA 3K9JA 2Q0UA 2OPSA 3CFPA 3N4PA 3VQ8A 2W41A 1KFDA 4CHZA 4A62A 3DXMB 4F7GA 2OANA 3DOKA 4CF8A 4W5RA 4FOEA 3L6QA 1T44A 1CZAN 4JI1K 3VPZA 3NF9A 2GV9A 4OJRA 3TR8A 2O4GA 1JLCA 2QA4N 2BGGA 1KRPA 2FSKA 4C23A 4MQ3A 1YJWN 2Z1JA 4CK1A 3MN5A 4FOIA 1HX1A 3R8EA 1XHZA 4M7YA 4GW6A 4WFNL 3EYZA 1RGIA 4OKEA 5BRHA 1BCMA 1H4RA 4FZZA 3QBXA 2F8SA 4CFAA 3IUCA 1TYQB 4BWMA 5CHIA 4EHUA 3VQBA 1MIXA 4AM6A 3E01A 1NTIA 1S72N 5CE3A 3B6PA 1NGJA 3AVGA 2G8VA 2KTQA 3DLLL 1X9SA 3ENBA 1HMVA 2Y1IA 1SKWA 5J2MA 2O8CB 4K8ZA 5EY4A 1JJ2M 4JI3K 1SQKA 3AU5A 1H1VA 1WSGA 4QS7A 3VA0A 3ZT2A 1IBKK 3S3MA 3ZSZA 2Z1IA 4FWOA 4ZTJA 3VQEA 3T19A 1UA0A 2F7TA 2RPIA 4ZRJA 1S22A 2YNIA 1C1AA 4CK2A 3HO1A 1D4XA 2EMSA 2QXLA 4E89A 1KSPA 2UXBK 4LH5A 3RMCA 1S1XA 1NJWA 3CQ8A 4A61A 1NK4A 5AQHA 1NKCA 2ASOA 1SGHA 2PBDA 1DTQA 4DLGA 5BN9A 4HTUA 2FF6A 1IH7A 4JKAA 1W7AA 1NKEA 1U48A 1UAXA 4IFEA 1VQPN 4BWJA 4DTSA 3ASMA 4Z4IA 1TYQA 2B6AA 5AFUA 3OS1A 1BHLA 1TL1A 5F0XA 1SZ2A 4L8RB 3U9ZA 2KFNA 3ZSYA 1RTJA 3QINA 3VQQA 3LAKA 3WXJA 5HRRA 4K42A 1RBVA 4DTOA 2P9NB 4OVLA 3ALYA 3K2PA 1LWFA 4H03B 3HT3A 1Y64A 1MWMA 2W40A 1LV5A 2GEMA 5JVGL 3S9HA 3TWHA 3ZX2A 3DXKA 3HVRA 1HLUA 4C1NI 5JVHL 3EKUA 3PVLA 1SAZA 4CESA 3E66A 2EMTA 1JL2A 1CZ9A 5AQJA 2ZJRL 4WQ4A 3ZT0A 2UYTA 2P5GA 4LF6K 5LJWA 3ZX3A 3QEVA 1VSMA 3L3VA 3LDSA 3AGRA 4BRDA 3TANA 1NGBA 4A5BA 5C42A 2A41A 4DUZK 4H8KA 2D1KA 4Z4HA 1JL1A 1MK9B 2HNYA 3WXIA 1WBBA 4DTXA 3AAQA 2V51B 2P9SA 3FLVA 1ZXOA 3U3YA 1GOAA 3CM6A 4KHSA 2ITMA 2OPPA 4DR3K 3CFOA 1Y97A 2UU9K 3AVJA 4EIAA 1EKEA 4CHPA 3C95A 2HE7A 1RDCA 3SQ1A 1QS4A 4M41A 4J2BA 3NE6A 4HCCA 4G1QA 4M7XA 5FPEA 4IKFA 4KI4A 4PY5A 2P9NA 1BA1A 3L4IA 2OPQA 2HOEA 4RW9A 3G6EN 3G9WA 4FLZA 3I33A 1HKBA 1GOBA 1F21A 1MWKA 2NRHA 4BRAA 4EZ9A 3SNNA 3CG7A 3J8AA 3DMJA 3V9SA 1OH8A 4CJQA 4OPAA 1J9AA 1ZC6A 1T6DA 4FM2A 1IKYA 3P5JA 5BPMA 4JNEA 4QS8A 4E1NA 3SBTA 3O9UA 4CZJA 4FJJA 2X74A 4CJLA 3LALA 5C24A 4CCHA 1J53A 3KLHA 4GV6A 4NCAA 3T3FA 1OKJA 4CBUA 2BH1A 4MLHA 2IC3A 4DSLA 4IZ9A 4GXBA 1S9GA 1BCOA 1FKOA 5K14A 2Q3SA 4C8NA 4ELVA 4O8KA 1VHXA 3O9SA 4FLVA 1V4SA 3LP1A 3BZCA 3TAPA 1BDGA 3THXB 2OCEA 2GX9A 1ST7A 3HBTA 1U47A 2AJQA 1TK5A 4O44A 1WSJA 5KPZA 4JI6K 4HDOA 2X0SA 3D6RA 3TABA 2IOCA 4O0JA 3SJHA 4ISGA 3WEEB 1VRTA 4E7JA 1WSHA 1B9FA 1DIKA 4RTFD 1NLVA 3DYAA 4EHTA 2A1RA 4FM0A 3O08A 3KVGA 3A0IX 4B3OA 3KK1A 3ENOA 1KCFA 4CJ4A 1VSDA 1NGIA 1NOYA 4M3WA 1GLFO 2AP1A 4NLBA 4H5TA 2QWLA 1CXQA 1U45A 2DFFA 3O1BA 3CCLN 3V4IA 2YNFA 2CQUA 4B9VA 1LAWA 3R3LA 5KGWA 5AQNA 1RBSA 4JK7A 3BP8A 5M1NA 3U8ZA 3WNHA 4OX9K 4YDUC 3OYEA 5KI6A 4Q5VA 1HQUA 4HUGA 4ISFA 4XIUA 1K73O 1CLQA 3ZEUB 3EY1A 4KRFA 3AA3A 2FBXA 4DU1A 2O8DA 3OYDA 1REVA 3UB5A 2GTDA 3BZKA 2Z1HA 3NH1A 3CQXA 2KW4A 3HTVA 1JKHA 2NLXA 4KPYA 4BR4A 3WXKA 4JYAK 4BQLA 2XHBA 3C65A 3S3NA 2O8FB 2FBTA 5AQPA 4IXCA 1ZYQA 3F73A 3JYTA 4OLBA 2A40A 3KK7A 4DWIA 3HPHA 4KV8A 2BDPA 2YI1A 2D0CA 3IMXA 3LDQA 1Z25A 2ZJQL 2VWJA 4CJKA 4BGBA 3QO9A 3EO3A 2KLAA 1HNWK 3SCXA 3DLEA 3CYMA 4KHYA 2W42A 1S1UA 4IOXA 2KQ2A 1TK0A 1RT4A 1Q9YA 1LW2A 4IJNA 4H5RA 2P9KA 1Q82O 2ETJA 2EX3A 4KB1A 5BN8A 1KD1O 5IJMA 5FPDA 5TKYA 5AZIB 4F2RA 3TAQA 3AY9A 5C15A 4GNIA 1NGGA 3OYFA 3KTQA 4BRGA 5F2RA 1XNRK 2QWOA 1L3SA 1G15A 3AVHA 3P31A 5BPLA 1RBRA 2I5JA 2KFZA 2P9LB 2DFHA 3EZWA 3QIOA 4LF4K 3RTVA 2KZZA 2PZSA 3KLIA 2ZWHA 4FJGA 4E7HA 4H5NA 5GADP 3Q7BA 3QLHA 1DLOA 4CF1A 1HBKA 4HTLA 4A2BA 1HYZA 3TPQA 1HNZK 2O4IA 1C1CA 3AO4A 3OYBA 2HHHK 3ATVA 3OVNA 5FRMA 4IOAL 4MO4A 4JV5K 3CCRN 1ACAA 3E9OA 3HL8A 5C10A 1YTUA 1ITGA 3NVMA 1RFQA 3TTFA 4FJ5A 3DLKA 1OH6A 1BO5O 3QIPA 2E1YA 3GE1A 3L4QA 5AQQA 4IEIA 1J5EK 1ZBIA 4IG3A 4OPKA 4CD3A 3CF5L 1VRUA 3AA2A 2NRXA 3NF8A 3THWA 4BRCA 3NAEA 4EZ6A 2J0JA 3H08A 1BU6O 4PL8A 4CJWA 3LDNA 3AVMA 1R0AA 3O5BA 3T69A 1NK0A 4NO7A 4IEEA 1RDBA 4LF8K 1S3XA 3KJVA 4FWQA 3SJJA 2HHQA 4DFPA 2WONA 5C25A 4BRFA 2W6LA 4RWTA 4BE2A 1QSYA 2ZQBA 2HHWA 4IFVA 1ASWA 1KAZA 3ITHA 4BG9A 5FDLA 4I9LA 5FPMA 3AVCA 1EO1A 3NF6A 2Q1NA 4LSLA 4O5BA 2RHKA 4IBNA 3VTIA 3AVBA 1J19A 5JS2A 5JICA 5FROA 4F8RA 2IAJA 4E7LA 4KHPK 3ZETB 4CGDA 1MDUB 2P9IB 4YOXA 1NMNA 3CC2N 3T7ZA 3CMEN 4I9QA 2HRJA 1P8ZA 1HPMA 3H3NO 1QZ6A 4CIEA 3KZBA 4X64K 1HYSA 4KTWA 4CJEA 3QB0A 4CZKA 4YNQA 3QFUA 3U9DA 2ZF5O 1X9WA 1N6QA 3VF4A 4JKEA 4N76A 4BRNA 4NB4A 1NMDA 1A5XA 4I2PA 3ULDA 4ELTA 2QW9A 3VOVA 3ZYYX 3SMPA 3AA4A 4B9NA 3MCPA 4CD1A 3HZ6A 2E2NA 4ELUA 1XWLA 1JLFA 2V52B 4I6MA 2ZGZA 1JLGA 2DTUA 3MN6A 4WCEL 4FWKA 4OLAA 1U2VB 4FJNA 4J8FA 3QBWA 1GLDG 3NF7A 4CFCA 2G8HA 3NGYA 4FJ7A 5KQ8A 4DSJA 2WOMA 3H45C 1S9EA 3EEQA 3TU5A 4CGGA 4LFAK 4PWDA 4XH1A 4H5WA 4YORA 3U6FA 1RT6A 1L5UA 3SLCA 2WH5A 5TKWA 3PO5A 3C7NA 3RRGA 1YJNN 3ZETA 3D2FB 2FDQA 3O3HA 4A5AA 1GGOA 3CQYA 3BF1A 1XMQK 4BE1A 3RMDA 3WUHA 5KRTA 1WAFA 1A5VA 3THYA 4FPBA 3LDOA 2I1JA 4IG0A 4FLTA 3V9ZA 3D0PA 4JRQA 3DLBA 4CGHA 4YFUA 4KHNA 4ID1A 2IIRA 5AQZA 3FZKA 4BRHA 5F1XA 1IJJA 4CEDA 3KK2A 3AV9A 2BUPA 3FZMA 2FJ9A 5HOOA 3HM9A 3ZSQA 4W5QA 1LW0A 2AEHA 1ATSA 4KO0A 1SS6A 4BRQA 3R9PA 1VAZA 1C0MA 4DV5K 1IBLK 2UUBK 4GVMA 5HRPA 4K25A 4JKGA 1KBLA 1JCEA 2OA8A 2PAVA 4X66K 1HYVA 1GC6A 4EP5A 1C1BA 3ZCMA 3I55N 3HPGA 3QERA 3DM2A 4WFAL 1HKCA 2E1ZA 1HRHA 5AQYA 4DTRA 5GIOA 4LFCK 3BDPA 3A5OC 3MX5A 1V4TA 3O9QA 5KGXA 1L3VA 3T1AA 4TSXA 1NNEA 1NGAA 1ZBSA 2GUPA 1WN7A 3OYKA 5AQLA 4GMJB 1BI4B 3K5NA 4B1WB 5GAGP 3AAPA 5AQMA 2NZTA 3CJAA 4LSNA 1T3VA 3AO5A 2PY5A 4DU4A 3IRXA 2D10A 4YY3K 5GIPA 3QMLA 5GINA 3MMVA 3PIOL 1YF5L 3ZT4A 2AL6A 3TAEA 1CXUA 2GBZA 4FLUA 3DXMA 1WB9A 3O3GA 4BQZA 1VSFA 3UKRB 1YIJN 4NCBA 4K43A 3OTOK 3MAQA 1QSLA 3PSFA 2BTFA 5LJVA 3KWGA 4M45A 3SAGA 5GAEP 2QK9A 4FWLA 3W3DA 1BL3A 4V19S 1G99A 2HBJA 3QFPA 3V9UA 1JLBA 3M3ZA 1Q81O 3TSUA 1SL1A 3O3FA 1ASVA 2YHWA 4OKJA 4H0YB 1RNHA 3NFAA 3K57A 4FJKA 2O8EB 3LWLA 1W9HA 1RT7A 2FC0A 4FWPA 3ENHA 5LL6Z 5HLFA 1N5YA 5D3GA 4BR5A 1ILYA 3O8MA 3O9RA 3VGLA 2V7ZA 2HHXA 1OVYA 4CYEA 4DQPA 3HRGA 4FVMA 3LDLA 4JKFA 3W0LA 2O8CA 4Z4EA 1U4BA 3GDQA 1UOCA 1W2BM 3HOTA 2DPNA 3OHRA 4YOUA 1S6QA 4CW7B 1NK5A 2IGIA 5FPNA 1NGCA 2RN2A 5EU7A 1E3MA 3PSIA 1OH7A 4FK0A 1U04A 1RT5A 3RRHA 1N33K 3LWMA 2NNWA 2QXFA 1S6PA 4DSEA 2D5RA 5HRSA 1NJZA 4CJSA 3FGUA 1KQSM 4FYDA 4ZRIA 5BR8K 4CJTA 2GWKA 3DWLA 5MLCQ 2A42A 1KAXA 3LZIA 1NK6A 2VG7A 3RMBA 4B9TA 3ZX0A 4DR5K 3EL2A 4J2DA 4NYFA 2V7YA 2NRVA 3U4LA 3VQAA 3DLGA 3ZT3A 3RR7A 1QQMA 1BQMA 5IT9O 1DTTA 1E4GT 2WBNA 3RMAA 3HJFA 3BUZB 3SUNA 1EETA 3CERA 3B6OA 2J0KA 3J7YP 1K9MO 5M1QA 4RW7A 4B3TK 2YHBA 3P1GA 1VSHA 1TGOA 4A57A 3NH2A 2R7YA 4XEIA 2VWKA 4KTZA 5I42A 3L2QA 2FSJA 3MXJA 4LH4A 4NLCA 5AR0A 2YKMA 4H0XB 3D2EB 1VBHA 4FW2A 4DXAB 4CGFA 2NUBA 4B1UB 5JS1A 4MFBA 4JI2K 4M63C 3CETA 4O55A 3CJBA 3GOIA 2HBLA 1DKGD 1KFSA 4M3XA 1JLAA 4JEPA 5LY3A 1IV0A 4F3OA 1FJGK 1K8KB 1X3MA 3DLRA 4CZIA 1TV6A 2RKIA 2F9WA 1VQMN 1YT3A 4BE0A 2GELA 1VSLA 3DRPA 3P38A 4U67L 1O13A 5LMNK 4RW6A 4CJFA 4IOCL 1Q18A 1TAQA 2A5XA 3BGRA 2PYLA 1YAGA 3VERA 1N8RO 3VQCA 1NJIO 1I94K 4JI8K 4JS4A 5AQTA 4JLHA 4AH9A 2A6AA 4NXMK 3DRRA 5CZ1A 4H0OA 3QDKA 1D9FA 2ABDA 3AO2A 3CIPA 5AQGA 2D11A 4C8OA 4CJ5A 3DRSA 1NK7A 3DOLA 4DTNA 4BROA 3CC4N 5CYMA 3D2EA 3EE8A 1Y19B 3SQ4A 1I3AA 2OTJN 2QKBA 4MDBA 1GG3A 1B92A 1NJYA 1NBWA 5J2QA 3HVTA 1T7PA 5SWMA 2UUCK 4DV3K 4KHUA 1D5AA 4YOTA 2ASPA 3MDQA 4DV2K 4FM1A 1RCHA 2HBKA 4DQIA 3OYLA 3THXA 2HNZA 3M1FA 3TAFA 5LMUK 1EWQA 3AO3A 3C94A 1QHAA 4KH6A 4F9OA 2A1SA 4IFYA 1YVUA 3H3OB 1XC3A 2Q31A 1WLJA 3NBPA 3KLGA 4DV1K 4AILC 1QZ5A 1K8AO 3WEEA 4ISEA 1YITN 4DV4K 4FLXA 4P7IA 4DV7K 3V6DA 4CHQA 4IDKA 5E41A 4DR4K 4Z4FA 3OJUA 2ZD1A 4JKCA 1JXEA 1W0HA 4M42A 4DQ8A 4K41A 4CEQA 3F9MA 4BRLA 2ZGYA 1YXQA 2YCHA 2QM1A 1NKBA 2E8AA 3RSEB 4BVPA 3ZDTA 1Q9XA 2YJEA 2P5OA 2QI2A 2CH5A 2OYQA 3R6MA 2D2QA 3L8BA 1NOZA 2Y1JA 3V9WA 1NGFA 3FP5A 2NRTA 3ZEUA 3VF2A 2HB5A 4E3SA 1BISA 1SKRA 5ADXA 4DR1K 3JS6A 1NWKA 2ZJPL 4ILJA 3MWTA 2ZE2A 3ULEB 1VQ7N 4FPAA 2DIKA 4JD2B 1GLBG 1T8EA 4B9MA 1QSSA 3IS9A 3VEYA 3P83D 4CZEA 3X23A 4F2SA 4BDZA 3EE9A 2UXDK 4TKNA 2O8FA 1XNQK 3OYCA 4CEZA 4NXNK 1EXQA 4CFBA 3J7ZO 2E6LA 4FWNA 3KD1E 3SQ0A 2E88A 3FE1A 4EP4A 4AHSA 1NU0A 1WOQA 1JLEA 3LPUA 3MEEA 1NG9A 3QETA 1VQ9N 1X3NA 5C0YA 4UY8O 3KKSA 5AJ3K 3SMSA 2F8TA 3EPYA 4CHYA 4B1XB 1RT1A 2FBVA 2FBYA 1RBUA 2D4WA 4CVNE 3WNFA 1QQOA 4FVUA 1BG3A 3NDKA 2VGNA 5HRNA 2WUSA 5KTQA 1HB8A 4B9LA 1VBGA 2ASMA 3G0ZA 4BC2A 4E1MA 5AZJB 3KLFA 4DS5A 1HNIA 4BRIA 5A2QO 2P9UB 4AHCA 1RDDA 2X6NA 4BRKA 2EWSA 2A3ZA 5AZIA 1MA9B 3TTDA 2E2PA 3H6EA 3HXMA 2Q36A 4O8UA 5AQWA 5FLXO 4KHWA 5EOYA 1VQ5N 3PX0A 4YOWA 3O6WA 1NGHA 2O8BB 1KXPA 4M3YA 3LP3A 2GUIA 1X9MA 1ASUA 2P9LA 4PQUA 4JI7K 3UKUB 4FXDA 4WQ4C 1ISNA 1N34K 2QWQA 3ZLJA 4GKJK 4JAXA 4PA1A 1X9JA 4CJPA 2BANA 1K6YA 4JHDB 2FSNA 1Q7YO 3KKRA 3KHYA 2QEXN 3FLCO 3CI5A 4HUEA 4BGAA 2HMPA 3O80A 1LWEA 2QWRA 3IAYA 1GLAG 5AQXA 3M8RA 2XRIA 2E2OA 5CY4A 2OTLN 4GY2B 3A5MC 3A5NC 4JK8A 2HHVA 4BR7A 4DS4A 4HCBA 1SUQA 3CJ1A 2QWPA 4BDPA 2FF3B 3QEIA 5ELZA 4KKOA 4CZHA 3EZ5A 1YTAA 3M8QA 3FZLA 4AHRA 1RBTA 3T1YK 1QVGM 3M8SA 4CF2A 5BPNA 3PUFA 1BOTO 2ZPYA 4I2QA 5AQVA 4B8CA 4J2AA 3UE5A 5AQUA 4K8XA 3PV8A 2VQFK 2IDOA 3K5LA 5C2DA 3PX6A 4JK9A 4LC9B 1JDEA 3DJCA 1T6CA 1XHXA 4XH4A 3B8AX 3MN7A 4Y1CA 1KLMA 4B9SA 2HF3A 3ZSWA 2P51A 2CGLA 1XC9A 3SQ2A 4IO9L 2P9PB 3M6GA 1IKXA 4DHYA 3NH0A 2RF2A 3BEXA 3BINA 4XH5A 4B9QA 4CJVA 3F5TA 5HP1A 4Z4GA 4NYNA 1NJXA 2PYJA 1KLNA 3BY5A 5C12A 4DSFA 4DTJA 4QCLA 1MU2A 4PL7A 5KRSA 5GAHP 3K5MA 4CEBA 2P9IA 3M8PA 4FWMA 4FJLA 3HPOA 1IG8A 3A2FA 4KREA 5DK5A 4IO8A 1EWRA 4UQGA 1E5WA 3AVFA 2CB8A 3CJCA 2CGKA 3N4QA 3P4IA 2JLEA 1IKVA 3LAMA 3I8BA 3NMUA 1RTHA 4DF8A 2YVCA 1JCGA 4KHQA 3AO1A 3L3UA 4CI6A 3SPZA 4AHTA 1HNXK 5E26A 1NK8A 1WSEA 4YDUA 1ESVA 3LL3A 2G8KA 1VQNN 4DFMA 3ISNC 1U2VA 3TAMA 2NRZA 1WAJA 3PLAA 3KWIA 3L2WA 2CH6A 4DR6K 4OO1J 1TUYA 3CC7N 4DF4A 5JVLA 1XMOK 3JXUA 3PY8A 3TTCA 3L2VA 4YHHK 3U3GA 2HHUA 4EFHA 3D2FA 3MXIA 1VQ6N 3EKSA 1U49A 3U7DA 3CJ9A 3HI0A 2NRWA 3I8DA 4F4KA 1TUUA 1IG9A 3M5RA 2NRRA 3IFRA 2I7NA 4M3TA 1GLJO 1NGDA 3SYZA 1HR0K 2G8WA 1HNVA 4FWSA 4N5SA 4C8LA 4ID5A 5DM7L 5BRDA 1RT3A 1TKTA 4KFBA 3OJSA 3EN9A 5HL7L 3D7EO 3HSCA 1C0TA 1M90O 5H1SQ 4J2EA 4DLEA 2F4VK 2DFEA 2GWJA 4YL8A 1JCFA 4Y1DA 1VSJA 3ID6A 3WNEA 1T03A 3SI6A 2HHSA 4DQRA 4FLYA 5JMVA 1YVNA 3C6UA 1TVRA 3GL1A 4G9ZA 5JLFA 1D9DA 3WNGA 4HWIA 4CERA 1SL2A 4W5NA 2RE2A 3K0SA 1UWBA 4FZXC 1NI2A 1BA0A 4AQYK 1TL3A 3DXKB 4ZHRA 3P39A 1A5WA 5EVZA 1QTMA 3L0QA 5DMRA 3OYHA 1OVQA 2Z1GA 1BI4A 3H1QA 3WT0A 3V1QA 4BVOA 4X65K 2CGJA 3K9KA 2FLOA 1ZBFA 4Q0BA 1N36K 2UXCK 2I1KA 1KC8O 4FJ8A 2QWNA 3IVFA 1HUXA 2IVNA 4JKHA 3KIOA 1S5JA 4FL9A 5BREA 1YHQN 4DG1A 5HBMA 2QTDA 4JI5K 1U6ZA 3VTHA 1C0UA 1NK9A 2EHGA 5J2NA 4K0KK 2P9SB 2X6SA 1GLCG 3FR0A 3MXMA 4BR0A 1VK0A 5AQIA 2VG6A 2YV0X 3SK3A 1GOCA 3UKRA 3CCUN 2D0PA 5KPRA 4PHTX 3MN9A 5M1OA 3G25A 3TARA 4ILGB 3NGZA 3HSTB 3OBYA 3ATUA 1XI1A 3O4NA 1HPZA 3NCIA 4FLWA 2OZMA 4AHUA 3F2KA 4CIGA 3VQ4A 5J2PA 2VYPA 4RG8A 3I56N 3WXMB 3CPWM 4H0VB 3KD5E 3L2UA 2O8EA 3NGIA 1IKWA 3HK2A 3VGMA 3E9LA 1LCUA 3CM5A 4OPJA 3J81O 4MO5A 3R1XA 3CXCM 3DAWA 3SBGA 1X1PA 2YHAA 4CF0A 1WSFA 4C8KA 1I39A 4KTQA 4EAHD 4FCYA 3VQ5A 4H4MA 2HF4A 4C1NK 2D0OA 3O4QA 4DQSA 4H5VA 4BR9A 3OYGA 3OYIA 3UIQA 4CGIA 3E9PA 1GLLO 1LAVA 3C6TA 3IKMA 4CZFA 3TAGA 1KTQA 1RTIA 3RVCA 3PO4A 3FFIA 2XO7A 3O1WA 3VN5A 4CBWA 3ZSXA 3G71N 1RDWX 1ZBHA 1TAUA 1RDAA 1C0GA 4M3RA 4RW4A 1EF1A 4KH5A 1FW6A 2F96A 1BWFO 1SL0A 2VQEK 1C6VA 4BRMA 3WQUA 1JLQA 2JWKA 4CJUA 3VETA 3C6HA 3S3OA 2COPA 4NCGA 5KQDA 5I3UA 3SAHA 5AFUH 4B1ZA 3RWUA 4X62K 4JKDA 1VSIA 3QEXA 3SUOA 4DB3A 3OS2A 3E1YA 4JN4A 1CZBA 1RILA 3MECA 4R5PA 1ZBUA 4CJ7A 2H3GX 4DV0K 3LZJA 3CHWA 1IBMK 4LD0A 4BG8A 4FWRA 1VSKA 5BRFA 3PX4A 1WSIA 2FXUA 2ZM6K 3VQPA 5AQOA 3FZHA 4FSVA 3I0RA 3TI0A 2KZMA 3G4SN 4DMNA 3CCSN 4DTUA 4Z4CA 2YKNA 3CCJN 4JKBA 3VEOA 3V1OA 1RDUA 4GV3A 5EXWA 3AGKA 2QWMA 2VGMA 4WFBL 5M1FA 2O8DB 1FKPA 4O0IA 3IG1A 2XY5A 2XY6A 5EX5A 3HM8A 2JWLA 3G10A 5CYQA 4WQ5C 2PFUA 3OYJA 2P1JA 4DFJA 4EKUA 1WNSA 4AHVA 3VQDA 3SUPA 4BC3A 1IO2A 1Q8IA 4CEEA 3IDHA 1R59O 1BQNA 4DFKA 1TKDA 1QQCA 3OBWA 2HNDA 2VWBA 3OYMA 3QNOA 1BGXT 3TSQA 1Z6RA 4A59A 3HP6A 1QQNA 3K5OA 1L3TA 2G8UA 3DI6A 3VF6A 3SV3A 2YNGA 2YNHA 1K8KA 1EX4A 1VSEA 3U8XA 3CCMN 4FK2A 1VQ4N 2KKZA 2ATQA 3ZSVA 1KVCA 1S1WA 2J0MA 2DY4A 2JGUA 3I0SA 2HVIA 2HW3A 2E5LK 4DUYK 4FJHA 1TKZA 3VGKA 1YUWA 2D0BA 4IWVA 4CEOA 3O9TA 3MK6A 3RR8A 4DSIA 4HHTA 3LPTA 5CZ2A 2YHXA 2P9KB 1VQ8N 3MX2A 3F9KA 2Q0RA 2WFBA 1S1TA 3SZ2A 3AVLA 1L3UA 3KLEA 2QKKA 1J5OA 4WF9L 4BC5A 4CK3A 1KC7A 2AA4A 4E7IA 3LANA 1P90A 3CPEA 1SV5A 1TKXA 4HVJA 5J1EA 2IS3A 3CFRA 5KPTA 4Z0UA 3A8YA 1D8YA 3CCVN 4BDYA 3LDPA 2Q97A 1BIUA 1EQYA 1HJOA 4CBXA 3QESA 1QHTA 4ICLA 4GVEA 3THVA 4LF5K 4ZRKA 1KVBA 4FO0A 2HVHA 5AQKA 1E4FT 3BF3A 4C8MA 5E84A 5C2FA 4ZTFA 4FJXA 5AQRA 5M1PA 4ILHA 3QIJA 2R82A 2YJFA 3OA9A 4BREA 4GV9A 2IVPA 4KBOA 3ID8A 4LY7A 3L2RA 4Z94A 4QAGA 3VA3A 3AVNA 1YJ9N 1T05A 3H46O 5I9EB 3LM9A 2J4RA 2HBMA 3LP0A 4QS9A 1UA1A 4CIFA 4B3MK 4B1VA 5IWAK 4W5OA 1QVFM 4FJMA 3QEPA 3MEGA 4H0TB 4DQQA 3SAFA 3VEVA 3MCAB 1HKGA 3CMAN 3S41A 2HHTA 3H1VX 1Q86O 4LF9K 2B5JA 4QOZB 3RSEA 3V1RA 2YX6A 4DV6K 2WTUA 1LWCA 4FW1A 1BUPA 3THWB 3DLHA 1TK8A 2W6KA 4CHNA 3K59A 4DTPA 3CCEN 2UUAK 4GKKK 1HQEA 4Y0WA 1OH5A 3OS0A 1M1KO 3CD6N 1B9DA 1S1VA 4BC4A 4OGCA 1QE1A 3MWPA 3WA0A 3HOSA 3V9XA 5M1KA 1NM1A 5CR4A 4AM7A 1GLEG 3QEWA 3QNNA 2XY7A 3T1HK 1J6ZA 2XY8A 3Q7CA 3ULEA 4E1JA 1MIZB 5JLHA 3PIPL 4N41A 4M3UA 4JD2A 4FJIA 4PKIA 4AF1A 3FZFA 3LM2A 1C0FA 3KK3A 1ATRA 3SPYA 4BR2A 5FRNA 3CJ7A 4MDAA 4CE9A 4BRPA 3OYNA 1HJRA 4H0PA 1VQKN 2KHOA 4DR2K 4KH4A 1O1WA 4O4GA 4F3TA 4O5FA 3J80O 4N56A 2OZSA 3D45A 3ZSOA 1ZBLA 1RT2A 2YHYA 5DM6L 4CZMA 2LSNA 4CECA 3OY9A 4I7FA 1KVAA 1EP4A 3C0BA 4JI4K 1N32K 4YOYA 4N47A 1DGKN 2X78A 3VENA 3GBTA 3VQ7A 3TSPA 1GC7A 5SZTA 2RQ1A 4JRPA 1VQON 2E6MA 4CEAA 4PKHA 2VG5A 4HUFA 4DTMA 4JI0K
chains in the Genus database with same CATH topology
3EL2A 4RCHA 3TTCA 1VQ4N 3CQXA 2V7YA 2NRVA 3U4LA 5ADXH 3HTVA 4EFHA 3D2FA 2NLXA 4BR4A 3WXKA 3EKSA 4BQLA 5AZJA 1VQ6N 3NVKA 3O4WA 3U7DA 3CJ9A 3C65A 2HSTA 3HI0A 2Q2RA 5AQPA 2P9UA 4IXCA 1QQMA 5B8HA 2NRWA 2F9TA 2I7PA 4I6MB 1TUUA 2A40A 3KK7A 5BR9A 4B1YB 3VEXA 1E4GT 2WBNA 2YI1A 3M5RA 3IMXA 3BUZB 3LDQA 2NRRA 3IFRA 2ZJQL 2I7NA 3CERA 4BGBA 2J0KA 1GLJO 1NGDA 4PKGA 5M1QA 4WYBA 4FWSA 3WQTA 1K9MO 4CZLA 3EO3A 2KLAA 5DM7L 5BRDA 4A57A 3EN9A 4XEIA 5HL7L 3D7EO 3HSCA 4R79A 4IOAL 2FSJA 3UKUA 4NLCA 5AR0A 3C7NB 4IJAA 1M90O 4H0XB 5H1SQ 4YOVA 4IOXA 1YI2N 3D2EB 1VBHA 4DXAB 2GWJA 4B1UB 4YL8A 4U7BA 1Z05A 1JCFA 1W97L 2LBBA 3ID6A 4IJNA 4H5RA 2P9KA 4M63C 5JMVA 1Q82O 1YVNA 3CETA 4MLEA 1VQLN 3VMFB 5BN8A 3C6AA 1KD1O 5IJMA 3CJBA 5FPDA 3GOIA 2HBLA 1DKGD 2E20A 3GL1A 4JHDA 5TKYA 4CZGA 4G9ZA 3A5LC 5AZIB 2E2QA 5JLFA 5AQFA 4HDQA 4JEPA 5LY3A 3AY9A 4HWIA 1DT9A 2RE2A 4A2AA 5C15A 1K8KB 1KAYA 1X3MA 1NGGA 4GNIA 1WUAA 4CZIA 1NI2A 1BA0A 4BRGA 2F9WA 3DXKB 3PZDA 3P39A 5F2RA 1VQMN 5EVZA 2QWOA 3QICA 2GELA 3P38A 3P31A 4U67L 1NVLA 5BPLA 1O13A 3L0QA 5AQSA 4OPHA 2P9LB 3AARA 4IOCL 3H1QA 3WT0A 4BVOA 3EZWA 2IVOA 1Q18A 2CGJA 3K9KA 3WXLA 4DKWA 4IDHA 2FLOA 2A5XA 1MK7B 1YAGA 1HB6A 3VEZA 1XQSC 3VERA 1N8RO 2I1KA 1KC8O 2ZWHA 2QWNA 1NJIO 4H5NA 5GADP 3IVFA 3Q7BA 3OW2M 1HUXA 2IVNA 4JKHA 5AQTA 4JKGB 4FL9A 5BREA 1YHQN 3AU4A 2QTDA 2VCPA 1U6ZA 3VTHA 1HBKA 2A6AA 3CCQN 4WQ5A 4HTLA 4A2BA 4H0OA 3QDKA 1NGEA 3TPQA 2ABDA 2P9SB 3CIPA 5AQGA 3VEWA 1GLCG 1ATNA 2D11A 3FR0A 4BR0A 5AQIA 4BROA 3ATVA 3GG4A 3SK3A 3CC4N 3FFKB 3UKRA 3CCUN 2D0PA 3D2EA 3VESA 3EE8A 1Y19B 1LOTB 3MN9A 4MO4A 4PHTX 5KPRA 3CCRN 1ACAA 3E9OA 5M1OA 5C10A 2OTJN 1XUPO 1GG3A 3G25A 4MDBA 1NBWA 4ILGB 3NVMA 1RFQA 3OBYA 3TTFA 3ATUA 1DEJA 2P9PA 4YOTA 4DCHA 1BO5O 4BY9C 2ASPA 2WC9A 3MDQA 3F2KA 4NY0A 2HBKA 2E1YA 2VYPA 3GE1A 3L4QA 5AQQA 3M1FA 4IEIA 3I56N 4CD3A 4L3QA 3K9JA 4H0VB 3WXMB 3CPWM 3CF5L 2Q0UA 1QHAA 2NRXA 4KH6A 4F9OA 3N4PA 3H3OB 3VGMA 3E9LA 1LCUA 1XC3A 2Q31A 2W41A 4MO5A 3R1XA 3CXCM 4A62A 4BRCA 3DAWA 3DXMB 1QZ5A 2J0JA 3SBGA 3WEEA 4F7GA 1BU6O 2OANA 4PL8A 1K8AO 3LDNA 4ISEA 1YITN 4FOEA 3L6QA 3O5BA 1T44A 3T69A 1CZAN 3VPZA 4NO7A 4IEEA 4P7IA 2QA4N 1S3XA 4FWQA 4EAHD 2HF4A 2FSKA 4C23A 4C1NK 1YJWN 2D0OA 3MN5A 4H5VA 4FOIA 4BR9A 1HX1A 4JKCA 4BRFA 3R8EA 4RWTA 4DQ8A 4M7YA 4WFNL 4K41A 3E9PA 1GLLO 3F9MA 1RGIA 3IKMA 4CZFA 5BRHA 4BRLA 2ZGYA 1YXQA 1H4RA 2YCHA 1KAZA 3QBXA 3RVCA 2QM1A 2E8AA 3RSEB 3IUCA 4BG9A 1TYQB 4BVPA 3O1WA 5FPMA 4CBWA 4EHUA 5CHIA 3G71N 1MIXA 4AM6A 3ZDTA 2Q1NA 1EO1A 1RDWX 1NTIA 5JICA 3VTIA 2RHKA 2YJEA 1J19A 1C0GA 2QI2A 2CH5A 1S72N 5CE3A 1EF1A 4KH5A 3R6MA 2D2QA 1BWFO 1NGJA 3DLLL 3ENBA 3WQUA 3ZETB 4BRMA 2JWKA 1MDUB 1NGFA 2P9IB 3VETA 3C6HA 4YOXA 2COPA 3T7ZA 5KQDA 3CC2N 3CMEN 3FP5A 2HRJA 1P8ZA 2NRTA 3VF2A 5EY4A 3ZEUA 5AFUH 1SQKA 3SAHA 1JJ2M 1HPMA 3H3NO 5ADXA 3AU5A 1H1VA 4QS7A 4B1ZA 1QZ6A 4JKDA 3JS6A 3KZBA 4DB3A 3QB0A 1NWKA 3E1YA 4CZKA 4FWOA 2ZJPL 4JN4A 4ILJA 3QFUA 3MWTA 3U9DA 2F7TA 2ZF5O 4ZRJA 1S22A 3VF4A 4JKEA 3ULEB 4BRNA 4NB4A 1NMDA 4FPAA 2DIKA 2EMSA 1D4XA 2QXLA 1VQ7N 2QW9A 1GLBG 4JD2B 3VOVA 3ZYYX 4CJ7A 2H3GX 3VEYA 4CZEA 3CHWA 3SMPA 3X23A 3MCPA 3EE9A 4A61A 4TKNA 5AQHA 4CD1A 4BG8A 4FWRA 3HZ6A 3J7ZO 2E2NA 5BRFA 2ASOA 2FXUA 4FWNA 1SGHA 5AQOA 2V52B 3FZHA 4FSVA 4I6MA 2PBDA 3G4SN 2E88A 2ZGZA 3FE1A 3MN6A 4WCEL 4FWKA 3CCSN 1U2VB 5BN9A 3CCJN 2FF6A 4JKAA 4JKBA 1WOQA 3VEOA 4GV3A 1RDUA 4J8FA 3QBWA 5EXWA 3AGKA 2QWMA 1GLDG 2VGMA 4IFEA 4WFBL 1VQPN 1VQ9N 5M1FA 1X3NA 5C0YA 4UY8O 3SMSA 1TYQA 5KQ8A 3EPYA 4B1XB 3H45C 5EX5A 5AFUA 3HM8A 2JWLA 3TU5A 4XH1A 4H5WA 4YORA 4WQ5C 2D4WA 2PFUA 5F0XA 1QQOA 3SLCA 4EKUA 4FVUA 2WH5A 1BG3A 2VGNA 1SZ2A 5TKWA 3C7NA 3U9ZA 2WUSA 1YJNN 4BC3A 1HB8A 3ZETA 3D2FB 2FDQA 1VBGA 2ASMA 1GGOA 4A5AA 4BC2A 5AZJB 3IDHA 1R59O 3CQYA 3WXJA 3BF1A 4K42A 4BRIA 2P9UB 3OBWA 2P9NB 2VWBA 4BRKA 3WUHA 2EWSA 4H03B 3TSQA 1Z6RA 2A3ZA 4FPBA 4A59A 1QQNA 3LDOA 5AZIA 1MA9B 3TTDA 2I1JA 1Y64A 2E2PA 3H6EA 1MWMA 3VF6A 2Q36A 2W40A 4O8UA 2GEMA 5AQWA 5JVGL 1K8KA 5EOYA 1VQ5N 3U8XA 3CCMN 2IIRA 3O6WA 4YOWA 1NGHA 3FZKA 2KKZA 3DXKA 5AQZA 1IJJA 1HLUA 3ZX2A 4BRHA 1KXPA 4C1NI 5F1XA 3EKUA 5JVHL 3PVLA 1SAZA 3E66A 2J0MA 2BUPA 2EMTA 3FZMA 2FJ9A 5HOOA 5AQJA 2ZJRL 4WQ4A 2P9LA 2UYTA 2AEHA 1ATSA 3UKUB 1SS6A 4WQ4C 4BRQA 3R9PA 1YUWA 3VGKA 1ISNA 1VAZA 4IWVA 3O9TA 5LJWA 2QWQA 3MK6A 3ZX3A 4JAXA 2YHXA 3AGRA 2P9KB 1VQ8N 4BRDA 3MX2A 1X9JA 2Q0RA 2WFBA 4K25A 1NGBA 4A5BA 4JKGA 1KBLA 2A41A 1JCEA 2D1KA 1MK9B 2PAVA 4JHDB 3WXIA 4WF9L 1GC6A 2FSNA 4BC5A 3AAQA 1Q7YO 2V51B 3KHYA 1KC7A 2QEXN 2AA4A 2P9SA 3FLVA 1ZXOA 3CI5A 3FLCO 3I55N 2ITMA 4BGAA 1P90A 3CPEA 4WFAL 1HKCA 2E1ZA 2HMPA 3O80A 5AQYA 2QWRA 5GIOA 3A5OC 3MX5A 4EIAA 1V4TA 1GLAG 5KPTA 3O9QA 3A8YA 5AQXA 3CCVN 2HE7A 3LDPA 2Q97A 2E2OA 1NGAA 2OTLN 1EQYA 4GY2B 1HJOA 3A5MC 1ZBSA 4JK8A 2GUPA 3A5NC 4BR7A 4M7XA 4CBXA 5AQLA 5FPEA 3CJ1A 2P9NA 1BA1A 2FF3B 2QWPA 5ELZA 4B1WB 4CZHA 3L4IA 2HOEA 4GVEA 5GAGP 3AAPA 3G6EN 4ZRKA 4FO0A 3G9WA 5AQKA 2NZTA 3FZLA 1E4FT 3CJAA 1T3VA 3I33A 5AQMA 3BF3A 1HKBA 2D10A 1MWKA 2NRHA 5E84A 4BRAA 5BPNA 5GIPA 3J8AA 3QMLA 5C2FA 5GINA 1BOTO 2ZPYA 4OPAA 5AQRA 3MMVA 1ZC6A 1T6DA 5AQVA 5M1PA 3PIOL 4ILHA 1YF5L 3QIJA 2R82A 5BPMA 3UE5A 5AQUA 2AL6A 2YJFA 3OA9A 4BREA 4JNEA 4QS8A 4GV9A 3SBTA 3O9UA 2IVPA 4CZJA 5C2DA 4KBOA 4JK9A 4LC9B 3ID8A 3DXMA 4Z94A 4BQZA 1JDEA 4GV6A 3DJCA 1T6CA 3UKRB 1YIJN 4K43A 1YJ9N 4XH4A 3H46O 1OKJA 4CBUA 2BH1A 3B8AX 3MN7A 4MLHA 5I9EB 3LM9A 2J4RA 4IZ9A 2BTFA 4GXBA 2HBMA 4QS9A 5LJVA 2HF3A 3KWGA 3SAGA 5GAEP 4FWLA 3W3DA 4B1VA 2CGLA 1G99A 2HBJA 3QFPA 4IO9L 2P9PB 3M6GA 1QVFM 3M3ZA 4O8KA 4DHYA 3O9SA 1V4SA 1Q81O 4H0TB 3TSUA 3SAFA 3VEVA 3MCAB 1HKGA 2YHWA 3BEXA 3CMAN 3S41A 3BINA 1BDGA 4XH5A 3H1VX 4B9QA 4H0YB 2GX9A 1ST7A 1Q86O 3HBTA 3RSEA 3F5TA 2YX6A 5KPZA 4HDOA 2X0SA 1BUPA 3D6RA 4FWPA 3ENHA 4BR5A 3SJHA 5C12A 4ISGA 3CCEN 3WEEB 1ILYA 3O8MA 3O9RA 3VGLA 2V7ZA 4PL7A 1OVYA 4CYEA 5GAHP 3HRGA 4Y0WA 3LDLA 1M1KO 2P9IA 4FWMA 3CD6N 4JKFA 3W0LA 1IG8A 4BC4A 1DIKA 4RTFD 1NLVA 3GDQA 3MWPA 4IO8A 3WA0A 4EHTA 3HOSA 5M1KA 1NM1A 5CR4A 1E5WA 3O08A 3KVGA 3A0IX 1GLEG 4AM7A 3HOTA 1W2BM 2DPNA 2CB8A 1J6ZA 3ENOA 3OHRA 4YOUA 3CJCA 2CGKA 1NGIA 3Q7CA 3N4QA 3P4IA 1GLFO 5FPNA 1MIZB 3ULEA 1NGCA 4E1JA 5JLHA 3PIPL 2AP1A 4JD2A 4NLBA 3I8BA 4PKIA 4AF1A 3FZFA 3NMUA 3LM2A 1C0FA 2QWLA 4H5TA 1ATRA 3O1BA 4BR2A 3CCLN 3CJ7A 2NNWA 2CQUA 4MDAA 2YVCA 1JCGA 3R3LA 4CI6A 5AQNA 4JK7A 5E26A 3BP8A 4BRPA 5M1NA 4H0PA 4YDUA 3U8ZA 2KHOA 1VQKN 1ESVA 4KH4A 3LL3A 3FGUA 4YDUC 1VQNN 4O5FA 4ISFA 1U2VA 2YHYA 5DM6L 1KQSM 2NRZA 1K73O 4CZMA 4ZRIA 3ZEUB 3PLAA 3KWIA 3C0BA 4YOYA 2GWKA 2CH6A 1DGKN 3DWLA 5MLCQ 4OO1J 3VENA 2A42A 3GBTA 1KAXA 3TSPA 3UB5A 1GC7A 1TUYA 2RQ1A 2GTDA 1VQON 3CC7N 4PKHA 5JVLA 1QVGM 3ZX0A 3JXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILJ A;  4JKA A;  4JKB A;  4JKH A;  3SBT A;  4JKG B;  4JKE A;  4JK9 A;  4JK8 A;  4JKG A;  3ENB A;  4JKC A;  4ILH A;  4JKF A;  3E9P A;  3E9L A;  3E66 A;  3E9O A;  4JKD A;  4ILG B;  4JK7 A;  3SBG A; 
#chains in the Genus database with same CATH topology
 4RCH A;  5ADX H;  4DSK A;  5AZJ A;  3NVK A;  3O4W A;  2BE2 A;  4B8A B;  4W5T A;  1SKS A;  3JAM O;  2HST A;  3AVI A;  2Q2R A;  3VQ6 A;  2P9U A;  5T7B A;  5B8H A;  2F9T A;  2I7P A;  4I6M B;  4B3S K;  4DR7 K;  3AVA A;  5BR9 A;  4B1Y B;  3VEX A;  4CHO A;  4OKK A;  4CGJ A;  4M3Z A;  3JSM A;  4PKG A;  3WQT A;  4WYB A;  4JS5 A;  1BIZ A;  2O8B A;  4CZL A;  4BAC A;  4CJR A;  5HRO A;  4B08 A;  3HYF A;  4R79 A;  2D0A A;  3UKU A;  1FK9 A;  4CF9 A;  1J54 A;  3C7N B;  4IJA A;  1RTD A;  4YOV A;  1YI2 N;  3VQ9 A;  3SUQ A;  4U7B A;  1Z05 A;  4OGE A;  3J7A P;  1W97 L;  2LBB A;  3SV4 A;  4MLE A;  1VQL N;  3VMF B;  4B3R K;  3C6A A;  3THY B;  3AA5 X;  2E20 A;  4JHD A;  4CZG A;  3A5L C;  3OYA A;  2E2Q A;  3AVK A;  5AQF A;  4HDQ A;  1DT9 A;  4A2A A;  3V81 A;  4LF7 K;  1KAY A;  1Z26 A;  1WUA A;  3MED A;  3ZT1 A;  3PZD A;  2ITG A;  4E19 A;  3QIC A;  2OPR A;  4E0D A;  4DU3 A;  1NVL A;  3LP2 A;  5AQS A;  4OPH A;  2G8F A;  3AAR A;  2IVO A;  4WE1 A;  2E4L A;  3WXL A;  4DKW A;  3K58 A;  4FZY A;  4IDH A;  4KB0 A;  1MK7 B;  1HB6 A;  4H4O A;  3VEZ A;  1XQS C;  1JXB A;  3OW2 M;  4PUO A;  4JKG B;  4E7K A;  3AU4 A;  3NHG A;  4KAZ A;  2VCP A;  3CCQ N;  4WQ5 A;  1NGE A;  3VEW A;  1ATN A;  1WBD A;  4CEF A;  3GG4 A;  3ZSR A;  3FFK B;  3VES A;  4KI6 A;  1LOT B;  1XUP O;  4FJ9 A;  4CFD A;  1FXX A;  4FK4 A;  1DEJ A;  2G8I A;  3HP9 A;  2P9P A;  4DCH A;  4B9U A;  4BY9 C;  2WC9 A;  2B4J A;  4NY0 A;  4CJ3 A;  4RW8 A;  2HMI A;  4LFB K;  4L3Q A;  3K9J A;  2Q0U A;  2OPS A;  3CFP A;  3N4P A;  3VQ8 A;  2W41 A;  1KFD A;  4CHZ A;  4A62 A;  3DXM B;  4F7G A;  2OAN A;  3DOK A;  4CF8 A;  4W5R A;  4FOE A;  3L6Q A;  1T44 A;  1CZA N;  4JI1 K;  3VPZ A;  3NF9 A;  2GV9 A;  4OJR A;  3TR8 A;  2O4G A;  1JLC A;  2QA4 N;  2BGG A;  1KRP A;  2FSK A;  4C23 A;  4MQ3 A;  1YJW N;  2Z1J A;  4CK1 A;  3MN5 A;  4FOI A;  1HX1 A;  3R8E A;  1XHZ A;  4M7Y A;  4GW6 A;  4WFN L;  3EYZ A;  1RGI A;  4OKE A;  5BRH A;  1BCM A;  1H4R A;  4FZZ A;  3QBX A;  2F8S A;  4CFA A;  3IUC A;  1TYQ B;  4BWM A;  5CHI A;  4EHU A;  3VQB A;  1MIX A;  4AM6 A;  3E01 A;  1NTI A;  1S72 N;  5CE3 A;  3B6P A;  1NGJ A;  3AVG A;  2G8V A;  2KTQ A;  3DLL L;  1X9S A;  3ENB A;  1HMV A;  2Y1I A;  1SKW A;  5J2M A;  2O8C B;  4K8Z A;  5EY4 A;  1JJ2 M;  4JI3 K;  1SQK A;  3AU5 A;  1H1V A;  1WSG A;  4QS7 A;  3VA0 A;  3ZT2 A;  1IBK K;  3S3M A;  3ZSZ A;  2Z1I A;  4FWO A;  4ZTJ A;  3VQE A;  3T19 A;  1UA0 A;  2F7T A;  2RPI A;  4ZRJ A;  1S22 A;  2YNI A;  1C1A A;  4CK2 A;  3HO1 A;  1D4X A;  2EMS A;  2QXL A;  4E89 A;  1KSP A;  2UXB K;  4LH5 A;  3RMC A;  1S1X A;  1NJW A;  3CQ8 A;  4A61 A;  1NK4 A;  5AQH A;  1NKC A;  2ASO A;  1SGH A;  2PBD A;  1DTQ A;  4DLG A;  5BN9 A;  4HTU A;  2FF6 A;  1IH7 A;  4JKA A;  1W7A A;  1NKE A;  1U48 A;  1UAX A;  4IFE A;  1VQP N;  4BWJ A;  4DTS A;  3ASM A;  4Z4I A;  1TYQ A;  2B6A A;  5AFU A;  3OS1 A;  1BHL A;  1TL1 A;  5F0X A;  1SZ2 A;  4L8R B;  3U9Z A;  2KFN A;  3ZSY A;  1RTJ A;  3QIN A;  3VQQ A;  3LAK A;  3WXJ A;  5HRR A;  4K42 A;  1RBV A;  4DTO A;  2P9N B;  4OVL A;  3ALY A;  3K2P A;  1LWF A;  4H03 B;  3HT3 A;  1Y64 A;  1MWM A;  2W40 A;  1LV5 A;  2GEM A;  5JVG L;  3S9H A;  3TWH A;  3ZX2 A;  3DXK A;  3HVR A;  1HLU A;  4C1N I;  5JVH L;  3EKU A;  3PVL A;  1SAZ A;  4CES A;  3E66 A;  2EMT A;  1JL2 A;  1CZ9 A;  5AQJ A;  2ZJR L;  4WQ4 A;  3ZT0 A;  2UYT A;  2P5G A;  4LF6 K;  5LJW A;  3ZX3 A;  3QEV A;  1VSM A;  3L3V A;  3LDS A;  3AGR A;  4BRD A;  3TAN A;  1NGB A;  4A5B A;  5C42 A;  2A41 A;  4DUZ K;  4H8K A;  2D1K A;  4Z4H A;  1JL1 A;  1MK9 B;  2HNY A;  3WXI A;  1WBB A;  4DTX A;  3AAQ A;  2V51 B;  2P9S A;  3FLV A;  1ZXO A;  3U3Y A;  1GOA A;  3CM6 A;  4KHS A;  2ITM A;  2OPP A;  4DR3 K;  3CFO A;  1Y97 A;  2UU9 K;  3AVJ A;  4EIA A;  1EKE A;  4CHP A;  3C95 A;  2HE7 A;  1RDC A;  3SQ1 A;  1QS4 A;  4M41 A;  4J2B A;  3NE6 A;  4HCC A;  4G1Q A;  4M7X A;  5FPE A;  4IKF A;  4KI4 A;  4PY5 A;  2P9N A;  1BA1 A;  3L4I A;  2OPQ A;  2HOE A;  4RW9 A;  3G6E N;  3G9W A;  4FLZ A;  3I33 A;  1HKB A;  1GOB A;  1F21 A;  1MWK A;  2NRH A;  4BRA A;  4EZ9 A;  3SNN A;  3CG7 A;  3J8A A;  3DMJ A;  3V9S A;  1OH8 A;  4CJQ A;  4OPA A;  1J9A A;  1ZC6 A;  1T6D A;  4FM2 A;  1IKY A;  3P5J A;  5BPM A;  4JNE A;  4QS8 A;  4E1N A;  3SBT A;  3O9U A;  4CZJ A;  4FJJ A;  2X74 A;  4CJL A;  3LAL A;  5C24 A;  4CCH A;  1J53 A;  3KLH A;  4GV6 A;  4NCA A;  3T3F A;  1OKJ A;  4CBU A;  2BH1 A;  4MLH A;  2IC3 A;  4DSL A;  4IZ9 A;  4GXB A;  1S9G A;  1BCO A;  1FKO A;  5K14 A;  2Q3S A;  4C8N A;  4ELV A;  4O8K A;  1VHX A;  3O9S A;  4FLV A;  1V4S A;  3LP1 A;  3BZC A;  3TAP A;  1BDG A;  3THX B;  2OCE A;  2GX9 A;  1ST7 A;  3HBT A;  1U47 A;  2AJQ A;  1TK5 A;  4O44 A;  1WSJ A;  5KPZ A;  4JI6 K;  4HDO A;  2X0S A;  3D6R A;  3TAB A;  2IOC A;  4O0J A;  3SJH A;  4ISG A;  3WEE B;  1VRT A;  4E7J A;  1WSH A;  1B9F A;  1DIK A;  4RTF D;  1NLV A;  3DYA A;  4EHT A;  2A1R A;  4FM0 A;  3O08 A;  3KVG A;  3A0I X;  4B3O A;  3KK1 A;  3ENO A;  1KCF A;  4CJ4 A;  1VSD A;  1NGI A;  1NOY A;  4M3W A;  1GLF O;  2AP1 A;  4NLB A;  4H5T A;  2QWL A;  1CXQ A;  1U45 A;  2DFF A;  3O1B A;  3CCL N;  3V4I A;  2YNF A;  2CQU A;  4B9V A;  1LAW A;  3R3L A;  5KGW A;  5AQN A;  1RBS A;  4JK7 A;  3BP8 A;  5M1N A;  3U8Z A;  3WNH A;  4OX9 K;  4YDU C;  3OYE A;  5KI6 A;  4Q5V A;  1HQU A;  4HUG A;  4ISF A;  4XIU A;  1K73 O;  1CLQ A;  3ZEU B;  3EY1 A;  4KRF A;  3AA3 A;  2FBX A;  4DU1 A;  2O8D A;  3OYD A;  1REV A;  3UB5 A;  2GTD A;  3BZK A;  2Z1H A;  3NH1 A;  3CQX A;  2KW4 A;  3HTV A;  1JKH A;  2NLX A;  4KPY A;  4BR4 A;  3WXK A;  4JYA K;  4BQL A;  2XHB A;  3C65 A;  3S3N A;  2O8F B;  2FBT A;  5AQP A;  4IXC A;  1ZYQ A;  3F73 A;  3JYT A;  4OLB A;  2A40 A;  3KK7 A;  4DWI A;  3HPH A;  4KV8 A;  2BDP A;  2YI1 A;  2D0C A;  3IMX A;  3LDQ A;  1Z25 A;  2ZJQ L;  2VWJ A;  4CJK A;  4BGB A;  3QO9 A;  3EO3 A;  2KLA A;  1HNW K;  3SCX A;  3DLE A;  3CYM A;  4KHY A;  2W42 A;  1S1U A;  4IOX A;  2KQ2 A;  1TK0 A;  1RT4 A;  1Q9Y A;  1LW2 A;  4IJN A;  4H5R A;  2P9K A;  1Q82 O;  2ETJ A;  2EX3 A;  4KB1 A;  5BN8 A;  1KD1 O;  5IJM A;  5FPD A;  5TKY A;  5AZI B;  4F2R A;  3TAQ A;  3AY9 A;  5C15 A;  4GNI A;  1NGG A;  3OYF A;  3KTQ A;  4BRG A;  5F2R A;  1XNR K;  2QWO A;  1L3S A;  1G15 A;  3AVH A;  3P31 A;  5BPL A;  1RBR A;  2I5J A;  2KFZ A;  2P9L B;  2DFH A;  3EZW A;  3QIO A;  4LF4 K;  3RTV A;  2KZZ A;  2PZS A;  3KLI A;  2ZWH A;  4FJG A;  4E7H A;  4H5N A;  5GAD P;  3Q7B A;  3QLH A;  1DLO A;  4CF1 A;  1HBK A;  4HTL A;  4A2B A;  1HYZ A;  3TPQ A;  1HNZ K;  2O4I A;  1C1C A;  3AO4 A;  3OYB A;  2HHH K;  3ATV A;  3OVN A;  5FRM A;  4IOA L;  4MO4 A;  4JV5 K;  3CCR N;  1ACA A;  3E9O A;  3HL8 A;  5C10 A;  1YTU A;  1ITG A;  3NVM A;  1RFQ A;  3TTF A;  4FJ5 A;  3DLK A;  1OH6 A;  1BO5 O;  3QIP A;  2E1Y A;  3GE1 A;  3L4Q A;  5AQQ A;  4IEI A;  1J5E K;  1ZBI A;  4IG3 A;  4OPK A;  4CD3 A;  3CF5 L;  1VRU A;  3AA2 A;  2NRX A;  3NF8 A;  3THW A;  4BRC A;  3NAE A;  4EZ6 A;  2J0J A;  3H08 A;  1BU6 O;  4PL8 A;  4CJW A;  3LDN A;  3AVM A;  1R0A A;  3O5B A;  3T69 A;  1NK0 A;  4NO7 A;  4IEE A;  1RDB A;  4LF8 K;  1S3X A;  3KJV A;  4FWQ A;  3SJJ A;  2HHQ A;  4DFP A;  2WON A;  5C25 A;  4BRF A;  2W6L A;  4RWT A;  4BE2 A;  1QSY A;  2ZQB A;  2HHW A;  4IFV A;  1ASW A;  1KAZ A;  3ITH A;  4BG9 A;  5FDL A;  4I9L A;  5FPM A;  3AVC A;  1EO1 A;  3NF6 A;  2Q1N A;  4LSL A;  4O5B A;  2RHK A;  4IBN A;  3VTI A;  3AVB A;  1J19 A;  5JS2 A;  5JIC A;  5FRO A;  4F8R A;  2IAJ A;  4E7L A;  4KHP K;  3ZET B;  4CGD A;  1MDU B;  2P9I B;  4YOX A;  1NMN A;  3CC2 N;  3T7Z A;  3CME N;  4I9Q A;  2HRJ A;  1P8Z A;  1HPM A;  3H3N O;  1QZ6 A;  4CIE A;  3KZB A;  4X64 K;  1HYS A;  4KTW A;  4CJE A;  3QB0 A;  4CZK A;  4YNQ A;  3QFU A;  3U9D A;  2ZF5 O;  1X9W A;  1N6Q A;  3VF4 A;  4JKE A;  4N76 A;  4BRN A;  4NB4 A;  1NMD A;  1A5X A;  4I2P A;  3ULD A;  4ELT A;  2QW9 A;  3VOV A;  3ZYY X;  3SMP A;  3AA4 A;  4B9N A;  3MCP A;  4CD1 A;  3HZ6 A;  2E2N A;  4ELU A;  1XWL A;  1JLF A;  2V52 B;  4I6M A;  2ZGZ A;  1JLG A;  2DTU A;  3MN6 A;  4WCE L;  4FWK A;  4OLA A;  1U2V B;  4FJN A;  4J8F A;  3QBW A;  1GLD G;  3NF7 A;  4CFC A;  2G8H A;  3NGY A;  4FJ7 A;  5KQ8 A;  4DSJ A;  2WOM A;  3H45 C;  1S9E A;  3EEQ A;  3TU5 A;  4CGG A;  4LFA K;  4PWD A;  4XH1 A;  4H5W A;  4YOR A;  3U6F A;  1RT6 A;  1L5U A;  3SLC A;  2WH5 A;  5TKW A;  3PO5 A;  3C7N A;  3RRG A;  1YJN N;  3ZET A;  3D2F B;  2FDQ A;  3O3H A;  4A5A A;  1GGO A;  3CQY A;  3BF1 A;  1XMQ K;  4BE1 A;  3RMD A;  3WUH A;  5KRT A;  1WAF A;  1A5V A;  3THY A;  4FPB A;  3LDO A;  2I1J A;  4IG0 A;  4FLT A;  3V9Z A;  3D0P A;  4JRQ A;  3DLB A;  4CGH A;  4YFU A;  4KHN A;  4ID1 A;  2IIR A;  5AQZ A;  3FZK A;  4BRH A;  5F1X A;  1IJJ A;  4CED A;  3KK2 A;  3AV9 A;  2BUP A;  3FZM A;  2FJ9 A;  5HOO A;  3HM9 A;  3ZSQ A;  4W5Q A;  1LW0 A;  2AEH A;  1ATS A;  4KO0 A;  1SS6 A;  4BRQ A;  3R9P A;  1VAZ A;  1C0M A;  4DV5 K;  1IBL K;  2UUB K;  4GVM A;  5HRP A;  4K25 A;  4JKG A;  1KBL A;  1JCE A;  2OA8 A;  2PAV A;  4X66 K;  1HYV A;  1GC6 A;  4EP5 A;  1C1B A;  3ZCM A;  3I55 N;  3HPG A;  3QER A;  3DM2 A;  4WFA L;  1HKC A;  2E1Z A;  1HRH A;  5AQY A;  4DTR A;  5GIO A;  4LFC K;  3BDP A;  3A5O C;  3MX5 A;  1V4T A;  3O9Q A;  5KGX A;  1L3V A;  3T1A A;  4TSX A;  1NNE A;  1NGA A;  1ZBS A;  2GUP A;  1WN7 A;  3OYK A;  5AQL A;  4GMJ B;  1BI4 B;  3K5N A;  4B1W B;  5GAG P;  3AAP A;  5AQM A;  2NZT A;  3CJA A;  4LSN A;  1T3V A;  3AO5 A;  2PY5 A;  4DU4 A;  3IRX A;  2D10 A;  4YY3 K;  5GIP A;  3QML A;  5GIN A;  3MMV A;  3PIO L;  1YF5 L;  3ZT4 A;  2AL6 A;  3TAE A;  1CXU A;  2GBZ A;  4FLU A;  3DXM A;  1WB9 A;  3O3G A;  4BQZ A;  1VSF A;  3UKR B;  1YIJ N;  4NCB A;  4K43 A;  3OTO K;  3MAQ A;  1QSL A;  3PSF A;  2BTF A;  5LJV A;  3KWG A;  4M45 A;  3SAG A;  5GAE P;  2QK9 A;  4FWL A;  3W3D A;  1BL3 A;  4V19 S;  1G99 A;  2HBJ A;  3QFP A;  3V9U A;  1JLB A;  3M3Z A;  1Q81 O;  3TSU A;  1SL1 A;  3O3F A;  1ASV A;  2YHW A;  4OKJ A;  4H0Y B;  1RNH A;  3NFA A;  3K57 A;  4FJK A;  2O8E B;  3LWL A;  1W9H A;  1RT7 A;  2FC0 A;  4FWP A;  3ENH A;  5LL6 Z;  5HLF A;  1N5Y A;  5D3G A;  4BR5 A;  1ILY A;  3O8M A;  3O9R A;  3VGL A;  2V7Z A;  2HHX A;  1OVY A;  4CYE A;  4DQP A;  3HRG A;  4FVM A;  3LDL A;  4JKF A;  3W0L A;  2O8C A;  4Z4E A;  1U4B A;  3GDQ A;  1UOC A;  1W2B M;  3HOT A;  2DPN A;  3OHR A;  4YOU A;  1S6Q A;  4CW7 B;  1NK5 A;  2IGI A;  5FPN A;  1NGC A;  2RN2 A;  5EU7 A;  1E3M A;  3PSI A;  1OH7 A;  4FK0 A;  1U04 A;  1RT5 A;  3RRH A;  1N33 K;  3LWM A;  2NNW A;  2QXF A;  1S6P A;  4DSE A;  2D5R A;  5HRS A;  1NJZ A;  4CJS A;  3FGU A;  1KQS M;  4FYD A;  4ZRI A;  5BR8 K;  4CJT A;  2GWK A;  3DWL A;  5MLC Q;  2A42 A;  1KAX A;  3LZI A;  1NK6 A;  2VG7 A;  3RMB A;  4B9T A;  3ZX0 A;  4DR5 K;  3EL2 A;  4J2D A;  4NYF A;  2V7Y A;  2NRV A;  3U4L A;  3VQA A;  3DLG A;  3ZT3 A;  3RR7 A;  1QQM A;  1BQM A;  5IT9 O;  1DTT A;  1E4G T;  2WBN A;  3RMA A;  3HJF A;  3BUZ B;  3SUN A;  1EET A;  3CER A;  3B6O A;  2J0K A;  3J7Y P;  1K9M O;  5M1Q A;  4RW7 A;  4B3T K;  2YHB A;  3P1G A;  1VSH A;  1TGO A;  4A57 A;  3NH2 A;  2R7Y A;  4XEI A;  2VWK A;  4KTZ A;  5I42 A;  3L2Q A;  2FSJ A;  3MXJ A;  4LH4 A;  4NLC A;  5AR0 A;  2YKM A;  4H0X B;  3D2E B;  1VBH A;  4FW2 A;  4DXA B;  4CGF A;  2NUB A;  4B1U B;  5JS1 A;  4MFB A;  4JI2 K;  4M63 C;  3CET A;  4O55 A;  3CJB A;  3GOI A;  2HBL A;  1DKG D;  1KFS A;  4M3X A;  1JLA A;  4JEP A;  5LY3 A;  1IV0 A;  4F3O A;  1FJG K;  1K8K B;  1X3M A;  3DLR A;  4CZI A;  1TV6 A;  2RKI A;  2F9W A;  1VQM N;  1YT3 A;  4BE0 A;  2GEL A;  1VSL A;  3DRP A;  3P38 A;  4U67 L;  1O13 A;  5LMN K;  4RW6 A;  4CJF A;  4IOC L;  1Q18 A;  1TAQ A;  2A5X A;  3BGR A;  2PYL A;  1YAG A;  3VER A;  1N8R O;  3VQC A;  1NJI O;  1I94 K;  4JI8 K;  4JS4 A;  5AQT A;  4JLH A;  4AH9 A;  2A6A A;  4NXM K;  3DRR A;  5CZ1 A;  4H0O A;  3QDK A;  1D9F A;  2ABD A;  3AO2 A;  3CIP A;  5AQG A;  2D11 A;  4C8O A;  4CJ5 A;  3DRS A;  1NK7 A;  3DOL A;  4DTN A;  4BRO A;  3CC4 N;  5CYM A;  3D2E A;  3EE8 A;  1Y19 B;  3SQ4 A;  1I3A A;  2OTJ N;  2QKB A;  4MDB A;  1GG3 A;  1B92 A;  1NJY A;  1NBW A;  5J2Q A;  3HVT A;  1T7P A;  5SWM A;  2UUC K;  4DV3 K;  4KHU A;  1D5A A;  4YOT A;  2ASP A;  3MDQ A;  4DV2 K;  4FM1 A;  1RCH A;  2HBK A;  4DQI A;  3OYL A;  3THX A;  2HNZ A;  3M1F A;  3TAF A;  5LMU K;  1EWQ A;  3AO3 A;  3C94 A;  1QHA A;  4KH6 A;  4F9O A;  2A1S A;  4IFY A;  1YVU A;  3H3O B;  1XC3 A;  2Q31 A;  1WLJ A;  3NBP A;  3KLG A;  4DV1 K;  4AIL C;  1QZ5 A;  1K8A O;  3WEE A;  4ISE A;  1YIT N;  4DV4 K;  4FLX A;  4P7I A;  4DV7 K;  3V6D A;  4CHQ A;  4IDK A;  5E41 A;  4DR4 K;  4Z4F A;  3OJU A;  2ZD1 A;  4JKC A;  1JXE A;  1W0H A;  4M42 A;  4DQ8 A;  4K41 A;  4CEQ A;  3F9M A;  4BRL A;  2ZGY A;  1YXQ A;  2YCH A;  2QM1 A;  1NKB A;  2E8A A;  3RSE B;  4BVP A;  3ZDT A;  1Q9X A;  2YJE A;  2P5O A;  2QI2 A;  2CH5 A;  2OYQ A;  3R6M A;  2D2Q A;  3L8B A;  1NOZ A;  2Y1J A;  3V9W A;  1NGF A;  3FP5 A;  2NRT A;  3ZEU A;  3VF2 A;  2HB5 A;  4E3S A;  1BIS A;  1SKR A;  5ADX A;  4DR1 K;  3JS6 A;  1NWK A;  2ZJP L;  4ILJ A;  3MWT A;  2ZE2 A;  3ULE B;  1VQ7 N;  4FPA A;  2DIK A;  4JD2 B;  1GLB G;  1T8E A;  4B9M A;  1QSS A;  3IS9 A;  3VEY A;  3P83 D;  4CZE A;  3X23 A;  4F2S A;  4BDZ A;  3EE9 A;  2UXD K;  4TKN A;  2O8F A;  1XNQ K;  3OYC A;  4CEZ A;  4NXN K;  1EXQ A;  4CFB A;  3J7Z O;  2E6L A;  4FWN A;  3KD1 E;  3SQ0 A;  2E88 A;  3FE1 A;  4EP4 A;  4AHS A;  1NU0 A;  1WOQ A;  1JLE A;  3LPU A;  3MEE A;  1NG9 A;  3QET A;  1VQ9 N;  1X3N A;  5C0Y A;  4UY8 O;  3KKS A;  5AJ3 K;  3SMS A;  2F8T A;  3EPY A;  4CHY A;  4B1X B;  1RT1 A;  2FBV A;  2FBY A;  1RBU A;  2D4W A;  4CVN E;  3WNF A;  1QQO A;  4FVU A;  1BG3 A;  3NDK A;  2VGN A;  5HRN A;  2WUS A;  5KTQ A;  1HB8 A;  4B9L A;  1VBG A;  2ASM A;  3G0Z A;  4BC2 A;  4E1M A;  5AZJ B;  3KLF A;  4DS5 A;  1HNI A;  4BRI A;  5A2Q O;  2P9U B;  4AHC A;  1RDD A;  2X6N A;  4BRK A;  2EWS A;  2A3Z A;  5AZI A;  1MA9 B;  3TTD A;  2E2P A;  3H6E A;  3HXM A;  2Q36 A;  4O8U A;  5AQW A;  5FLX O;  4KHW A;  5EOY A;  1VQ5 N;  3PX0 A;  4YOW A;  3O6W A;  1NGH A;  2O8B B;  1KXP A;  4M3Y A;  3LP3 A;  2GUI A;  1X9M A;  1ASU A;  2P9L A;  4PQU A;  4JI7 K;  3UKU B;  4FXD A;  4WQ4 C;  1ISN A;  1N34 K;  2QWQ A;  3ZLJ A;  4GKJ K;  4JAX A;  4PA1 A;  1X9J A;  4CJP A;  2BAN A;  1K6Y A;  4JHD B;  2FSN A;  1Q7Y O;  3KKR A;  3KHY A;  2QEX N;  3FLC O;  3CI5 A;  4HUE A;  4BGA A;  2HMP A;  3O80 A;  1LWE A;  2QWR A;  3IAY A;  1GLA G;  5AQX A;  3M8R A;  2XRI A;  2E2O A;  5CY4 A;  2OTL N;  4GY2 B;  3A5M C;  3A5N C;  4JK8 A;  2HHV A;  4BR7 A;  4DS4 A;  4HCB A;  1SUQ A;  3CJ1 A;  2QWP A;  4BDP A;  2FF3 B;  3QEI A;  5ELZ A;  4KKO A;  4CZH A;  3EZ5 A;  1YTA A;  3M8Q A;  3FZL A;  4AHR A;  1RBT A;  3T1Y K;  1QVG M;  3M8S A;  4CF2 A;  5BPN A;  3PUF A;  1BOT O;  2ZPY A;  4I2Q A;  5AQV A;  4B8C A;  4J2A A;  3UE5 A;  5AQU A;  4K8X A;  3PV8 A;  2VQF K;  2IDO A;  3K5L A;  5C2D A;  3PX6 A;  4JK9 A;  4LC9 B;  1JDE A;  3DJC A;  1T6C A;  1XHX A;  4XH4 A;  3B8A X;  3MN7 A;  4Y1C A;  1KLM A;  4B9S A;  2HF3 A;  3ZSW A;  2P51 A;  2CGL A;  1XC9 A;  3SQ2 A;  4IO9 L;  2P9P B;  3M6G A;  1IKX A;  4DHY A;  3NH0 A;  2RF2 A;  3BEX A;  3BIN A;  4XH5 A;  4B9Q A;  4CJV A;  3F5T A;  5HP1 A;  4Z4G A;  4NYN A;  1NJX A;  2PYJ A;  1KLN A;  3BY5 A;  5C12 A;  4DSF A;  4DTJ A;  4QCL A;  1MU2 A;  4PL7 A;  5KRS A;  5GAH P;  3K5M A;  4CEB A;  2P9I A;  3M8P A;  4FWM A;  4FJL A;  3HPO A;  1IG8 A;  3A2F A;  4KRE A;  5DK5 A;  4IO8 A;  1EWR A;  4UQG A;  1E5W A;  3AVF A;  2CB8 A;  3CJC A;  2CGK A;  3N4Q A;  3P4I A;  2JLE A;  1IKV A;  3LAM A;  3I8B A;  3NMU A;  1RTH A;  4DF8 A;  2YVC A;  1JCG A;  4KHQ A;  3AO1 A;  3L3U A;  4CI6 A;  3SPZ A;  4AHT A;  1HNX K;  5E26 A;  1NK8 A;  1WSE A;  4YDU A;  1ESV A;  3LL3 A;  2G8K A;  1VQN N;  4DFM A;  3ISN C;  1U2V A;  3TAM A;  2NRZ A;  1WAJ A;  3PLA A;  3KWI A;  3L2W A;  2CH6 A;  4DR6 K;  4OO1 J;  1TUY A;  3CC7 N;  4DF4 A;  5JVL A;  1XMO K;  3JXU A;  3PY8 A;  3TTC A;  3L2V A;  4YHH K;  3U3G A;  2HHU A;  4EFH A;  3D2F A;  3MXI A;  1VQ6 N;  3EKS A;  1U49 A;  3U7D A;  3CJ9 A;  3HI0 A;  2NRW A;  3I8D A;  4F4K A;  1TUU A;  1IG9 A;  3M5R A;  2NRR A;  3IFR A;  2I7N A;  4M3T A;  1GLJ O;  1NGD A;  3SYZ A;  1HR0 K;  2G8W A;  1HNV A;  4FWS A;  4N5S A;  4C8L A;  4ID5 A;  5DM7 L;  5BRD A;  1RT3 A;  1TKT A;  4KFB A;  3OJS A;  3EN9 A;  5HL7 L;  3D7E O;  3HSC A;  1C0T A;  1M90 O;  5H1S Q;  4J2E A;  4DLE A;  2F4V K;  2DFE A;  2GWJ A;  4YL8 A;  1JCF A;  4Y1D A;  1VSJ A;  3ID6 A;  3WNE A;  1T03 A;  3SI6 A;  2HHS A;  4DQR A;  4FLY A;  5JMV A;  1YVN A;  3C6U A;  1TVR A;  3GL1 A;  4G9Z A;  5JLF A;  1D9D A;  3WNG A;  4HWI A;  4CER A;  1SL2 A;  4W5N A;  2RE2 A;  3K0S A;  1UWB A;  4FZX C;  1NI2 A;  1BA0 A;  4AQY K;  1TL3 A;  3DXK B;  4ZHR A;  3P39 A;  1A5W A;  5EVZ A;  1QTM A;  3L0Q A;  5DMR A;  3OYH A;  1OVQ A;  2Z1G A;  1BI4 A;  3H1Q A;  3WT0 A;  3V1Q A;  4BVO A;  4X65 K;  2CGJ A;  3K9K A;  2FLO A;  1ZBF A;  4Q0B A;  1N36 K;  2UXC K;  2I1K A;  1KC8 O;  4FJ8 A;  2QWN A;  3IVF A;  1HUX A;  2IVN A;  4JKH A;  3KIO A;  1S5J A;  4FL9 A;  5BRE A;  1YHQ N;  4DG1 A;  5HBM A;  2QTD A;  4JI5 K;  1U6Z A;  3VTH A;  1C0U A;  1NK9 A;  2EHG A;  5J2N A;  4K0K K;  2P9S B;  2X6S A;  1GLC G;  3FR0 A;  3MXM A;  4BR0 A;  1VK0 A;  5AQI A;  2VG6 A;  2YV0 X;  3SK3 A;  1GOC A;  3UKR A;  3CCU N;  2D0P A;  5KPR A;  4PHT X;  3MN9 A;  5M1O A;  3G25 A;  3TAR A;  4ILG B;  3NGZ A;  3HST B;  3OBY A;  3ATU A;  1XI1 A;  3O4N A;  1HPZ A;  3NCI A;  4FLW A;  2OZM A;  4AHU A;  3F2K A;  4CIG A;  3VQ4 A;  5J2P A;  2VYP A;  4RG8 A;  3I56 N;  3WXM B;  3CPW M;  4H0V B;  3KD5 E;  3L2U A;  2O8E A;  3NGI A;  1IKW A;  3HK2 A;  3VGM A;  3E9L A;  1LCU A;  3CM5 A;  4OPJ A;  3J81 O;  4MO5 A;  3R1X A;  3CXC M;  3DAW A;  3SBG A;  1X1P A;  2YHA A;  4CF0 A;  1WSF A;  4C8K A;  1I39 A;  4KTQ A;  4EAH D;  4FCY A;  3VQ5 A;  4H4M A;  2HF4 A;  4C1N K;  2D0O A;  3O4Q A;  4DQS A;  4H5V A;  4BR9 A;  3OYG A;  3OYI A;  3UIQ A;  4CGI A;  3E9P A;  1GLL O;  1LAV A;  3C6T A;  3IKM A;  4CZF A;  3TAG A;  1KTQ A;  1RTI A;  3RVC A;  3PO4 A;  3FFI A;  2XO7 A;  3O1W A;  3VN5 A;  4CBW A;  3ZSX A;  3G71 N;  1RDW X;  1ZBH A;  1TAU A;  1RDA A;  1C0G A;  4M3R A;  4RW4 A;  1EF1 A;  4KH5 A;  1FW6 A;  2F96 A;  1BWF O;  1SL0 A;  2VQE K;  1C6V A;  4BRM A;  3WQU A;  1JLQ A;  2JWK A;  4CJU A;  3VET A;  3C6H A;  3S3O A;  2COP A;  4NCG A;  5KQD A;  5I3U A;  3SAH A;  5AFU H;  4B1Z A;  3RWU A;  4X62 K;  4JKD A;  1VSI A;  3QEX A;  3SUO A;  4DB3 A;  3OS2 A;  3E1Y A;  4JN4 A;  1CZB A;  1RIL A;  3MEC A;  4R5P A;  1ZBU A;  4CJ7 A;  2H3G X;  4DV0 K;  3LZJ A;  3CHW A;  1IBM K;  4LD0 A;  4BG8 A;  4FWR A;  1VSK A;  5BRF A;  3PX4 A;  1WSI A;  2FXU A;  2ZM6 K;  3VQP A;  5AQO A;  3FZH A;  4FSV A;  3I0R A;  3TI0 A;  2KZM A;  3G4S N;  4DMN A;  3CCS N;  4DTU A;  4Z4C A;  2YKN A;  3CCJ N;  4JKB A;  3VEO A;  3V1O A;  1RDU A;  4GV3 A;  5EXW A;  3AGK A;  2QWM A;  2VGM A;  4WFB L;  5M1F A;  2O8D B;  1FKP A;  4O0I A;  3IG1 A;  2XY5 A;  2XY6 A;  5EX5 A;  3HM8 A;  2JWL A;  3G10 A;  5CYQ A;  4WQ5 C;  2PFU A;  3OYJ A;  2P1J A;  4DFJ A;  4EKU A;  1WNS A;  4AHV A;  3VQD A;  3SUP A;  4BC3 A;  1IO2 A;  1Q8I A;  4CEE A;  3IDH A;  1R59 O;  1BQN A;  4DFK A;  1TKD A;  1QQC A;  3OBW A;  2HND A;  2VWB A;  3OYM A;  3QNO A;  1BGX T;  3TSQ A;  1Z6R A;  4A59 A;  3HP6 A;  1QQN A;  3K5O A;  1L3T A;  2G8U A;  3DI6 A;  3VF6 A;  3SV3 A;  2YNG A;  2YNH A;  1K8K A;  1EX4 A;  1VSE A;  3U8X A;  3CCM N;  4FK2 A;  1VQ4 N;  2KKZ A;  2ATQ A;  3ZSV A;  1KVC A;  1S1W A;  2J0M A;  2DY4 A;  2JGU A;  3I0S A;  2HVI A;  2HW3 A;  2E5L K;  4DUY K;  4FJH A;  1TKZ A;  3VGK A;  1YUW A;  2D0B A;  4IWV A;  4CEO A;  3O9T A;  3MK6 A;  3RR8 A;  4DSI A;  4HHT A;  3LPT A;  5CZ2 A;  2YHX A;  2P9K B;  1VQ8 N;  3MX2 A;  3F9K A;  2Q0R A;  2WFB A;  1S1T A;  3SZ2 A;  3AVL A;  1L3U A;  3KLE A;  2QKK A;  1J5O A;  4WF9 L;  4BC5 A;  4CK3 A;  1KC7 A;  2AA4 A;  4E7I A;  3LAN A;  1P90 A;  3CPE A;  1SV5 A;  1TKX A;  4HVJ A;  5J1E A;  2IS3 A;  3CFR A;  5KPT A;  4Z0U A;  3A8Y A;  1D8Y A;  3CCV N;  4BDY A;  3LDP A;  2Q97 A;  1BIU A;  1EQY A;  1HJO A;  4CBX A;  3QES A;  1QHT A;  4ICL A;  4GVE A;  3THV A;  4LF5 K;  4ZRK A;  1KVB A;  4FO0 A;  2HVH A;  5AQK A;  1E4F T;  3BF3 A;  4C8M A;  5E84 A;  5C2F A;  4ZTF A;  4FJX A;  5AQR A;  5M1P A;  4ILH A;  3QIJ A;  2R82 A;  2YJF A;  3OA9 A;  4BRE A;  4GV9 A;  2IVP A;  4KBO A;  3ID8 A;  4LY7 A;  3L2R A;  4Z94 A;  4QAG A;  3VA3 A;  3AVN A;  1YJ9 N;  1T05 A;  3H46 O;  5I9E B;  3LM9 A;  2J4R A;  2HBM A;  3LP0 A;  4QS9 A;  1UA1 A;  4CIF A;  4B3M K;  4B1V A;  5IWA K;  4W5O A;  1QVF M;  4FJM A;  3QEP A;  3MEG A;  4H0T B;  4DQQ A;  3SAF A;  3VEV A;  3MCA B;  1HKG A;  3CMA N;  3S41 A;  2HHT A;  3H1V X;  1Q86 O;  4LF9 K;  2B5J A;  4QOZ B;  3RSE A;  3V1R A;  2YX6 A;  4DV6 K;  2WTU A;  1LWC A;  4FW1 A;  1BUP A;  3THW B;  3DLH A;  1TK8 A;  2W6K A;  4CHN A;  3K59 A;  4DTP A;  3CCE N;  2UUA K;  4GKK K;  1HQE A;  4Y0W A;  1OH5 A;  3OS0 A;  1M1K O;  3CD6 N;  1B9D A;  1S1V A;  4BC4 A;  4OGC A;  1QE1 A;  3MWP A;  3WA0 A;  3HOS A;  3V9X A;  5M1K A;  1NM1 A;  5CR4 A;  4AM7 A;  1GLE G;  3QEW A;  3QNN A;  2XY7 A;  3T1H K;  1J6Z A;  2XY8 A;  3Q7C A;  3ULE A;  4E1J A;  1MIZ B;  5JLH A;  3PIP L;  4N41 A;  4M3U A;  4JD2 A;  4FJI A;  4PKI A;  4AF1 A;  3FZF A;  3LM2 A;  1C0F A;  3KK3 A;  1ATR A;  3SPY A;  4BR2 A;  5FRN A;  3CJ7 A;  4MDA A;  4CE9 A;  4BRP A;  3OYN A;  1HJR A;  4H0P A;  1VQK N;  2KHO A;  4DR2 K;  4KH4 A;  1O1W A;  4O4G A;  4F3T A;  4O5F A;  3J80 O;  4N56 A;  2OZS A;  3D45 A;  3ZSO A;  1ZBL A;  1RT2 A;  2YHY A;  5DM6 L;  4CZM A;  2LSN A;  4CEC A;  3OY9 A;  4I7F A;  1KVA A;  1EP4 A;  3C0B A;  4JI4 K;  1N32 K;  4YOY A;  4N47 A;  1DGK N;  2X78 A;  3VEN A;  3GBT A;  3VQ7 A;  3TSP A;  1GC7 A;  5SZT A;  2RQ1 A;  4JRP A;  1VQO N;  2E6M A;  4CEA A;  4PKH A;  2VG5 A;  4HUF A;  4DTM A;  4JI0 K; 
#chains in the Genus database with same CATH homology
 3EL2 A;  4RCH A;  3TTC A;  1VQ4 N;  3CQX A;  2V7Y A;  2NRV A;  3U4L A;  5ADX H;  3HTV A;  4EFH A;  3D2F A;  2NLX A;  4BR4 A;  3WXK A;  3EKS A;  4BQL A;  5AZJ A;  1VQ6 N;  3NVK A;  3O4W A;  3U7D A;  3CJ9 A;  3C65 A;  2HST A;  3HI0 A;  2Q2R A;  5AQP A;  2P9U A;  4IXC A;  1QQM A;  5B8H A;  2NRW A;  2F9T A;  2I7P A;  4I6M B;  1TUU A;  2A40 A;  3KK7 A;  5BR9 A;  4B1Y B;  3VEX A;  1E4G T;  2WBN A;  2YI1 A;  3M5R A;  3IMX A;  3BUZ B;  3LDQ A;  2NRR A;  3IFR A;  2ZJQ L;  2I7N A;  3CER A;  4BGB A;  2J0K A;  1GLJ O;  1NGD A;  4PKG A;  5M1Q A;  4WYB A;  4FWS A;  3WQT A;  1K9M O;  4CZL A;  3EO3 A;  2KLA A;  5DM7 L;  5BRD A;  4A57 A;  3EN9 A;  4XEI A;  5HL7 L;  3D7E O;  3HSC A;  4R79 A;  4IOA L;  2FSJ A;  3UKU A;  4NLC A;  5AR0 A;  3C7N B;  4IJA A;  1M90 O;  4H0X B;  5H1S Q;  4YOV A;  4IOX A;  1YI2 N;  3D2E B;  1VBH A;  4DXA B;  2GWJ A;  4B1U B;  4YL8 A;  4U7B A;  1Z05 A;  1JCF A;  1W97 L;  2LBB A;  3ID6 A;  4IJN A;  4H5R A;  2P9K A;  4M63 C;  5JMV A;  1Q82 O;  1YVN A;  3CET A;  4MLE A;  1VQL N;  3VMF B;  5BN8 A;  3C6A A;  1KD1 O;  5IJM A;  3CJB A;  5FPD A;  3GOI A;  2HBL A;  1DKG D;  2E20 A;  3GL1 A;  4JHD A;  5TKY A;  4CZG A;  4G9Z A;  3A5L C;  5AZI B;  2E2Q A;  5JLF A;  5AQF A;  4HDQ A;  4JEP A;  5LY3 A;  3AY9 A;  4HWI A;  1DT9 A;  2RE2 A;  4A2A A;  5C15 A;  1K8K B;  1KAY A;  1X3M A;  1NGG A;  4GNI A;  1WUA A;  4CZI A;  1NI2 A;  1BA0 A;  4BRG A;  2F9W A;  3DXK B;  3PZD A;  3P39 A;  5F2R A;  1VQM N;  5EVZ A;  2QWO A;  3QIC A;  2GEL A;  3P38 A;  3P31 A;  4U67 L;  1NVL A;  5BPL A;  1O13 A;  3L0Q A;  5AQS A;  4OPH A;  2P9L B;  3AAR A;  4IOC L;  3H1Q A;  3WT0 A;  4BVO A;  3EZW A;  2IVO A;  1Q18 A;  2CGJ A;  3K9K A;  3WXL A;  4DKW A;  4IDH A;  2FLO A;  2A5X A;  1MK7 B;  1YAG A;  1HB6 A;  3VEZ A;  1XQS C;  3VER A;  1N8R O;  2I1K A;  1KC8 O;  2ZWH A;  2QWN A;  1NJI O;  4H5N A;  5GAD P;  3IVF A;  3Q7B A;  3OW2 M;  1HUX A;  2IVN A;  4JKH A;  5AQT A;  4JKG B;  4FL9 A;  5BRE A;  1YHQ N;  3AU4 A;  2QTD A;  2VCP A;  1U6Z A;  3VTH A;  1HBK A;  2A6A A;  3CCQ N;  4WQ5 A;  4HTL A;  4A2B A;  4H0O A;  3QDK A;  1NGE A;  3TPQ A;  2ABD A;  2P9S B;  3CIP A;  5AQG A;  3VEW A;  1GLC G;  1ATN A;  2D11 A;  3FR0 A;  4BR0 A;  5AQI A;  4BRO A;  3ATV A;  3GG4 A;  3SK3 A;  3CC4 N;  3FFK B;  3UKR A;  3CCU N;  2D0P A;  3D2E A;  3VES A;  3EE8 A;  1Y19 B;  1LOT B;  3MN9 A;  4MO4 A;  4PHT X;  5KPR A;  3CCR N;  1ACA A;  3E9O A;  5M1O A;  5C10 A;  2OTJ N;  1XUP O;  1GG3 A;  3G25 A;  4MDB A;  1NBW A;  4ILG B;  3NVM A;  1RFQ A;  3OBY A;  3TTF A;  3ATU A;  1DEJ A;  2P9P A;  4YOT A;  4DCH A;  1BO5 O;  4BY9 C;  2ASP A;  2WC9 A;  3MDQ A;  3F2K A;  4NY0 A;  2HBK A;  2E1Y A;  2VYP A;  3GE1 A;  3L4Q A;  5AQQ A;  3M1F A;  4IEI A;  3I56 N;  4CD3 A;  4L3Q A;  3K9J A;  4H0V B;  3WXM B;  3CPW M;  3CF5 L;  2Q0U A;  1QHA A;  2NRX A;  4KH6 A;  4F9O A;  3N4P A;  3H3O B;  3VGM A;  3E9L A;  1LCU A;  1XC3 A;  2Q31 A;  2W41 A;  4MO5 A;  3R1X A;  3CXC M;  4A62 A;  4BRC A;  3DAW A;  3DXM B;  1QZ5 A;  2J0J A;  3SBG A;  3WEE A;  4F7G A;  1BU6 O;  2OAN A;  4PL8 A;  1K8A O;  3LDN A;  4ISE A;  1YIT N;  4FOE A;  3L6Q A;  3O5B A;  1T44 A;  3T69 A;  1CZA N;  3VPZ A;  4NO7 A;  4IEE A;  4P7I A;  2QA4 N;  1S3X A;  4FWQ A;  4EAH D;  2HF4 A;  2FSK A;  4C23 A;  4C1N K;  1YJW N;  2D0O A;  3MN5 A;  4H5V A;  4FOI A;  4BR9 A;  1HX1 A;  4JKC A;  4BRF A;  3R8E A;  4RWT A;  4DQ8 A;  4M7Y A;  4WFN L;  4K41 A;  3E9P A;  1GLL O;  3F9M A;  1RGI A;  3IKM A;  4CZF A;  5BRH A;  4BRL A;  2ZGY A;  1YXQ A;  1H4R A;  2YCH A;  1KAZ A;  3QBX A;  3RVC A;  2QM1 A;  2E8A A;  3RSE B;  3IUC A;  4BG9 A;  1TYQ B;  4BVP A;  3O1W A;  5FPM A;  4CBW A;  4EHU A;  5CHI A;  3G71 N;  1MIX A;  4AM6 A;  3ZDT A;  2Q1N A;  1EO1 A;  1RDW X;  1NTI A;  5JIC A;  3VTI A;  2RHK A;  2YJE A;  1J19 A;  1C0G A;  2QI2 A;  2CH5 A;  1S72 N;  5CE3 A;  1EF1 A;  4KH5 A;  3R6M A;  2D2Q A;  1BWF O;  1NGJ A;  3DLL L;  3ENB A;  3WQU A;  3ZET B;  4BRM A;  2JWK A;  1MDU B;  1NGF A;  2P9I B;  3VET A;  3C6H A;  4YOX A;  2COP A;  3T7Z A;  5KQD A;  3CC2 N;  3CME N;  3FP5 A;  2HRJ A;  1P8Z A;  2NRT A;  3VF2 A;  5EY4 A;  3ZEU A;  5AFU H;  1SQK A;  3SAH A;  1JJ2 M;  1HPM A;  3H3N O;  5ADX A;  3AU5 A;  1H1V A;  4QS7 A;  4B1Z A;  1QZ6 A;  4JKD A;  3JS6 A;  3KZB A;  4DB3 A;  3QB0 A;  1NWK A;  3E1Y A;  4CZK A;  4FWO A;  2ZJP L;  4JN4 A;  4ILJ A;  3QFU A;  3MWT A;  3U9D A;  2F7T A;  2ZF5 O;  4ZRJ A;  1S22 A;  3VF4 A;  4JKE A;  3ULE B;  4BRN A;  4NB4 A;  1NMD A;  4FPA A;  2DIK A;  2EMS A;  1D4X A;  2QXL A;  1VQ7 N;  2QW9 A;  1GLB G;  4JD2 B;  3VOV A;  3ZYY X;  4CJ7 A;  2H3G X;  3VEY A;  4CZE A;  3CHW A;  3SMP A;  3X23 A;  3MCP A;  3EE9 A;  4A61 A;  4TKN A;  5AQH A;  4CD1 A;  4BG8 A;  4FWR A;  3HZ6 A;  3J7Z O;  2E2N A;  5BRF A;  2ASO A;  2FXU A;  4FWN A;  1SGH A;  5AQO A;  2V52 B;  3FZH A;  4FSV A;  4I6M A;  2PBD A;  3G4S N;  2E88 A;  2ZGZ A;  3FE1 A;  3MN6 A;  4WCE L;  4FWK A;  3CCS N;  1U2V B;  5BN9 A;  3CCJ N;  2FF6 A;  4JKA A;  4JKB A;  1WOQ A;  3VEO A;  4GV3 A;  1RDU A;  4J8F A;  3QBW A;  5EXW A;  3AGK A;  2QWM A;  1GLD G;  2VGM A;  4IFE A;  4WFB L;  1VQP N;  1VQ9 N;  5M1F A;  1X3N A;  5C0Y A;  4UY8 O;  3SMS A;  1TYQ A;  5KQ8 A;  3EPY A;  4B1X B;  3H45 C;  5EX5 A;  5AFU A;  3HM8 A;  2JWL A;  3TU5 A;  4XH1 A;  4H5W A;  4YOR A;  4WQ5 C;  2D4W A;  2PFU A;  5F0X A;  1QQO A;  3SLC A;  4EKU A;  4FVU A;  2WH5 A;  1BG3 A;  2VGN A;  1SZ2 A;  5TKW A;  3C7N A;  3U9Z A;  2WUS A;  1YJN N;  4BC3 A;  1HB8 A;  3ZET A;  3D2F B;  2FDQ A;  1VBG A;  2ASM A;  1GGO A;  4A5A A;  4BC2 A;  5AZJ B;  3IDH A;  1R59 O;  3CQY A;  3WXJ A;  3BF1 A;  4K42 A;  4BRI A;  2P9U B;  3OBW A;  2P9N B;  2VWB A;  4BRK A;  3WUH A;  2EWS A;  4H03 B;  3TSQ A;  1Z6R A;  2A3Z A;  4FPB A;  4A59 A;  1QQN A;  3LDO A;  5AZI A;  1MA9 B;  3TTD A;  2I1J A;  1Y64 A;  2E2P A;  3H6E A;  1MWM A;  3VF6 A;  2Q36 A;  2W40 A;  4O8U A;  2GEM A;  5AQW A;  5JVG L;  1K8K A;  5EOY A;  1VQ5 N;  3U8X A;  3CCM N;  2IIR A;  3O6W A;  4YOW A;  1NGH A;  3FZK A;  2KKZ A;  3DXK A;  5AQZ A;  1IJJ A;  1HLU A;  3ZX2 A;  4BRH A;  1KXP A;  4C1N I;  5F1X A;  3EKU A;  5JVH L;  3PVL A;  1SAZ A;  3E66 A;  2J0M A;  2BUP A;  2EMT A;  3FZM A;  2FJ9 A;  5HOO A;  5AQJ A;  2ZJR L;  4WQ4 A;  2P9L A;  2UYT A;  2AEH A;  1ATS A;  3UKU B;  1SS6 A;  4WQ4 C;  4BRQ A;  3R9P A;  1YUW A;  3VGK A;  1ISN A;  1VAZ A;  4IWV A;  3O9T A;  5LJW A;  2QWQ A;  3MK6 A;  3ZX3 A;  4JAX A;  2YHX A;  3AGR A;  2P9K B;  1VQ8 N;  4BRD A;  3MX2 A;  1X9J A;  2Q0R A;  2WFB A;  4K25 A;  1NGB A;  4A5B A;  4JKG A;  1KBL A;  2A41 A;  1JCE A;  2D1K A;  1MK9 B;  2PAV A;  4JHD B;  3WXI A;  4WF9 L;  1GC6 A;  2FSN A;  4BC5 A;  3AAQ A;  1Q7Y O;  2V51 B;  3KHY A;  1KC7 A;  2QEX N;  2AA4 A;  2P9S A;  3FLV A;  1ZXO A;  3CI5 A;  3FLC O;  3I55 N;  2ITM A;  4BGA A;  1P90 A;  3CPE A;  4WFA L;  1HKC A;  2E1Z A;  2HMP A;  3O80 A;  5AQY A;  2QWR A;  5GIO A;  3A5O C;  3MX5 A;  4EIA A;  1V4T A;  1GLA G;  5KPT A;  3O9Q A;  3A8Y A;  5AQX A;  3CCV N;  2HE7 A;  3LDP A;  2Q97 A;  2E2O A;  1NGA A;  2OTL N;  1EQY A;  4GY2 B;  1HJO A;  3A5M C;  1ZBS A;  4JK8 A;  2GUP A;  3A5N C;  4BR7 A;  4M7X A;  4CBX A;  5AQL A;  5FPE A;  3CJ1 A;  2P9N A;  1BA1 A;  2FF3 B;  2QWP A;  5ELZ A;  4B1W B;  4CZH A;  3L4I A;  2HOE A;  4GVE A;  5GAG P;  3AAP A;  3G6E N;  4ZRK A;  4FO0 A;  3G9W A;  5AQK A;  2NZT A;  3FZL A;  1E4F T;  3CJA A;  1T3V A;  3I33 A;  5AQM A;  3BF3 A;  1HKB A;  2D10 A;  1MWK A;  2NRH A;  5E84 A;  4BRA A;  5BPN A;  5GIP A;  3J8A A;  3QML A;  5C2F A;  5GIN A;  1BOT O;  2ZPY A;  4OPA A;  5AQR A;  3MMV A;  1ZC6 A;  1T6D A;  5AQV A;  5M1P A;  3PIO L;  4ILH A;  1YF5 L;  3QIJ A;  2R82 A;  5BPM A;  3UE5 A;  5AQU A;  2AL6 A;  2YJF A;  3OA9 A;  4BRE A;  4JNE A;  4QS8 A;  4GV9 A;  3SBT A;  3O9U A;  2IVP A;  4CZJ A;  5C2D A;  4KBO A;  4JK9 A;  4LC9 B;  3ID8 A;  3DXM A;  4Z94 A;  4BQZ A;  1JDE A;  4GV6 A;  3DJC A;  1T6C A;  3UKR B;  1YIJ N;  4K43 A;  1YJ9 N;  4XH4 A;  3H46 O;  1OKJ A;  4CBU A;  2BH1 A;  3B8A X;  3MN7 A;  4MLH A;  5I9E B;  3LM9 A;  2J4R A;  4IZ9 A;  2BTF A;  4GXB A;  2HBM A;  4QS9 A;  5LJV A;  2HF3 A;  3KWG A;  3SAG A;  5GAE P;  4FWL A;  3W3D A;  4B1V A;  2CGL A;  1G99 A;  2HBJ A;  3QFP A;  4IO9 L;  2P9P B;  3M6G A;  1QVF M;  3M3Z A;  4O8K A;  4DHY A;  3O9S A;  1V4S A;  1Q81 O;  4H0T B;  3TSU A;  3SAF A;  3VEV A;  3MCA B;  1HKG A;  2YHW A;  3BEX A;  3CMA N;  3S41 A;  3BIN A;  1BDG A;  4XH5 A;  3H1V X;  4B9Q A;  4H0Y B;  2GX9 A;  1ST7 A;  1Q86 O;  3HBT A;  3RSE A;  3F5T A;  2YX6 A;  5KPZ A;  4HDO A;  2X0S A;  1BUP A;  3D6R A;  4FWP A;  3ENH A;  4BR5 A;  3SJH A;  5C12 A;  4ISG A;  3CCE N;  3WEE B;  1ILY A;  3O8M A;  3O9R A;  3VGL A;  2V7Z A;  4PL7 A;  1OVY A;  4CYE A;  5GAH P;  3HRG A;  4Y0W A;  3LDL A;  1M1K O;  2P9I A;  4FWM A;  3CD6 N;  4JKF A;  3W0L A;  1IG8 A;  4BC4 A;  1DIK A;  4RTF D;  1NLV A;  3GDQ A;  3MWP A;  4IO8 A;  3WA0 A;  4EHT A;  3HOS A;  5M1K A;  1NM1 A;  5CR4 A;  1E5W A;  3O08 A;  3KVG A;  3A0I X;  1GLE G;  4AM7 A;  3HOT A;  1W2B M;  2DPN A;  2CB8 A;  1J6Z A;  3ENO A;  3OHR A;  4YOU A;  3CJC A;  2CGK A;  1NGI A;  3Q7C A;  3N4Q A;  3P4I A;  1GLF O;  5FPN A;  1MIZ B;  3ULE A;  1NGC A;  4E1J A;  5JLH A;  3PIP L;  2AP1 A;  4JD2 A;  4NLB A;  3I8B A;  4PKI A;  4AF1 A;  3FZF A;  3NMU A;  3LM2 A;  1C0F A;  2QWL A;  4H5T A;  1ATR A;  3O1B A;  4BR2 A;  3CCL N;  3CJ7 A;  2NNW A;  2CQU A;  4MDA A;  2YVC A;  1JCG A;  3R3L A;  4CI6 A;  5AQN A;  4JK7 A;  5E26 A;  3BP8 A;  4BRP A;  5M1N A;  4H0P A;  4YDU A;  3U8Z A;  2KHO A;  1VQK N;  1ESV A;  4KH4 A;  3LL3 A;  3FGU A;  4YDU C;  1VQN N;  4O5F A;  4ISF A;  1U2V A;  2YHY A;  5DM6 L;  1KQS M;  2NRZ A;  1K73 O;  4CZM A;  4ZRI A;  3ZEU B;  3PLA A;  3KWI A;  3C0B A;  4YOY A;  2GWK A;  2CH6 A;  1DGK N;  3DWL A;  5MLC Q;  4OO1 J;  3VEN A;  2A42 A;  3GBT A;  1KAX A;  3TSP A;  3UB5 A;  1GC7 A;  1TUY A;  2RQ1 A;  2GTD A;  1VQO N;  3CC7 N;  4PKH A;  5JVL A;  1QVG M;  3ZX0 A;  3JXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...