4JK9A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound co ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 67
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk9A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk9A01
4JKGA 3SBGA 4ILJA 4JKHA 4ILGB 4JK7A 4JKBA 4JKGB 3E9OA 4JKAA 3ENBA 3E9LA 4JK8A 4ILHA 4JKEA 4JKDA 3E66A 4JKFA 4JK9A 3SBTA 4JKCA 3E9PA
chains in the Genus database with same CATH superfamily
5SWMA 4JI3K 4FJ9A 1BU6O 2X6SA 4U67L 2WUSA 3S3MA 4CIEA 3L2VA 4BGAA 1MDUB 4PA1A 4KI4A 1NJWA 4TKNA 3HP9A 2IVNA 3QO9A 4DTRA 3VEYA 1YJWN 4HVJA 4H0TB 4YOTA 2AP1A 4A59A 4I7FA 5DM7L 3TSUA 4DSEA 2E6MA 1LWCA 3C6TA 2NNWA 2D5RA 3QEWA 5AZIB 4G9ZA 4JKCA 3F73A 4KAZA 4JI7K 4CJ3A 3FGUA 5C12A 3NDKA 1HNIA 1NGEA 4KTZA 3QETA 3CJCA 3AGRA 5KPTA 1TUYA 3OBYA 3HI0A 2A6AA 4IJNA 1GLBG 2E2NA 3KLFA 3M6GA 1IKVA 5FPNA 4OPAA 2ZE2A 4DR4K 3S9HA 4W5NA 3MXIA 2JGUA 2D2QA 4BVOA 4LD0A 3TAFA 4H0OA 2E4LA 4FJGA 4FWOA 3MWTA 3MN7A 5FPEA 1IG9A 4CHPA 1BA1A 4CGDA 3K58A 4LF7K 2J0KA 3CQYA 5AQUA 1VQLN 4ELVA 3ENBA 4KREA 1HNXK 2G8UA 3DAWA 5K14A 4B1UB 3CC2N 4DTOA 4BWMA 3J7ZO 4E3SA 2E5LK 4JKFA 3NH0A 3CC4N 1GC7A 3V1RA 4IBNA 4EHUA 4OKKA 3MX5A 1FKPA 1W7AA 1HPMA 3SBGA 4KHQA 2FSKA 2A3ZA 1NOZA 4B9VA 3OY9A 1KC7A 1J9AA 4Y1CA 2HNZA 4DU3A 2P9LA 1C0TA 2QA4N 1A5VA 2RPIA 2W42A 5HRRA 3ZSXA 2COPA 1XC3A 2UXCK 2YHBA 4O55A 3LM2A 4FW1A 1NGDA 3SMPA 4CJSA 5FLXO 1QZ5A 2QWRA 3HTVA 3NF8A 4CZIA 5HRNA 1VQ7N 2OANA 5AQZA 4B1WB 1BOTO 2RF2A 4CFCA 3OW2M 3BDPA 3LWLA 3MXJA 1L3SA 4C8NA 3SQ2A 3CPEA 3QINA 3E01A 3KKSA 1U45A 2NRHA 2P9PB 3MEGA 4UQGA 2O8EA 3MK6A 1FKOA 4JI6K 4CJTA 2HBLA 3WQTA 3O9QA 4K8XA 5LJVA 1WSJA 3WXMB 1WSHA 4JS4A 2BH1A 3ZSWA 1V4TA 2IVPA 3O08A 3PVLA 2YKNA 4GMJB 4YOUA 3FLVA 2B4JA 3GDQA 1BG3A 2QXLA 1LCUA 1UWBA 3S3OA 4IOAL 2VGMA 5JMVA 3SMSA 3FLCO 1RGIA 4M7XA 4YY3K 5GIPA 3NGIA 5KGWA 4FJJA 1GLFO 3DXKB 4E89A 1KFSA 1IH7A 4CBXA 3I55N 4WF9L 3AA4A 3DLGA 3FFKB 1D5AA 1LWFA 1VSEA 2G8VA 1DKGD 2QKKA 2G8IA 4FWRA 4LC9B 3V6DA 2CH5A 1D9FA 3J8AA 3EY1A 3MWPA 1KLNA 3KLIA 1KFDA 3VERA 4JNEA 3NF6A 2QWMA 2XY5A 4BVPA 3CJ9A 4DXAB 4WQ5A 3ZDTA 1RDUA 3DMJA 4KH5A 5BR8K 4JRQA 3IFRA 3JSMA 5FPDA 1QZ6A 3ZSZA 4I6MB 1A5WA 2QI2A 4Z0UA 3OVNA 1QTMA 2DIKA 5F0XA 1J53A 3RMBA 1MIXA 3CCQN 5FRNA 5CZ2A 4W5TA 3EZWA 3WNGA 3RR7A 4AHTA 3ATUA 4CEZA 4BROA 1JKHA 4XH5A 3G71N 4KH6A 3OYNA 1BI4B 3B6OA 1IBLK 2KZZA 3C65A 4CHQA 2HHUA 5C10A 4CJEA 3CERA 3IVFA 1NWKA 1Q8IA 4IZ9A 4NYNA 4XH1A 4NCBA 4XEIA 3PX6A 3OYBA 3WEEA 4NB4A 1WUAA 4FWSA 3VQ4A 5M1OA 2A5XA 3VMFB 4CEFA 4KHWA 3THXA 2ZWHA 3S3NA 4BRNA 1ASUA 1NKBA 1WSIA 3OYCA 1QVGM 1S1UA 2A41A 3HSTB 3D45A 4YDUA 3JXUA 4ILGB 4JKGB 1X9WA 4B9LA 3LDQA 3CMEN 1SV5A 2P9IB 5AQJA 4DB3A 4ZRJA 4HTUA 3O4QA 5LY3A 3OHRA 1FJGK 1TL3A 3BINA 3AVNA 3R9PA 2PZSA 3AVMA 2UYTA 4KH4A 3CCRN 3HVRA 1HJRA 4QOZB 3TR8A 2WBNA 3ZYYX 5J2QA 4M3UA 3VESA 4M3WA 3QEPA 5HRSA 2GEMA 4J2BA 4BC2A 4F3OA 3LM9A 4E1MA 4DF4A 4W5QA 5BPMA 3THYB 5LMUK 2VWKA 1Q7YO 2ZQBA 4BWJA 3UKRA 3E66A 3GL1A 5BRHA 3OS1A 3CYMA 5DK5A 3GOIA 4ISEA 2O4GA 1EO1A 1CZBA 3A0IX 4BR4A 1TYQB 4R79A 3VQ6A 5AQNA 2A1SA 2D4WA 3MN5A 2JWLA 3PIPL 5BN9A 4JD2A 5BREA 2PY5A 1QSSA 4DSIA 2YHWA 4JI1K 5IJMA 3VENA 1NMNA 1JDEA 1S5JA 2ZD1A 3L2RA 3OYJA 2Q0RA 2O8CA 5B8HA 4BRHA 4CIFA 3AAQA 1VQNN 1VSKA 3CFOA 3VQEA 3V9UA 1HKBA 3CJ7A 4H5WA 2IGIA 2ASMA 1OH5A 5EXWA 3D2EB 3G4SN 2UXBK 5KPRA 4DCHA 4CHNA 4DQ8A 4PWDA 3UKUA 3P38A 4DV6K 1RT1A 5AQFA 4J2AA 4A2BA 4N47A 4YOYA 2KQ2A 4IKFA 3I0SA 4CHOA 3SNNA 4CJVA 2Q3SA 1Z26A 4RWTA 2GUIA 4X64K 2P51A 3DXMB 3EO3A 4CGIA 5MLCQ 2OTLN 2GTDA 3VEVA 3HBTA 4FK4A 1JLEA 1YF5L 1HNWK 3AU4A 2RN2A 1HQEA 2PYJA 4DQSA 1TVRA 1WLJA 3TABA 4EAHD 4NLBA 3V9XA 2F8TA 1RTJA 4B8AB 5HOOA 2Q0UA 3CCSN 3ITHA 2F8SA 3NGZA 4AQYK 5IT9O 2HB5A 4F8RA 2YVCA 2ZPYA 5CYMA 1S9EA 4B9QA 3CFPA 5AQKA 4AHSA 3DRPA 5CR4A 1BHLA 4NLCA 1MK7B 4Z94A 1RBTA 3BGRA 3PX0A 3TWHA 3LZIA 1E5WA 3R6MA 3QDKA 4PKGA 5M1FA 1BCOA 2HOEA 4B9MA 4M7YA 4N5SA 1F21A 3V4IA 4PL8A 1NK5A 3ZCMA 4IOCL 4M3YA 2CGLA 4CGFA 3KZBA 5ADXA 2ITMA 3BZKA 3HM9A 3U3GA 2BANA 3HSCA 4LSLA 4E7JA 1NK9A 1JXBA 4DS5A 2R82A 4CF2A 4JI5K 3WXLA 3V1QA 3CMAN 4KHPK 1L3TA 4LFCK 3L4IA 4DF8A 1HQUA 4OGEA 3WUHA 2ZJQL 4B9SA 3T19A 2NUBA 1ASWA 3U8ZA 2IS3A 4DTMA 1S9GA 4K0KK 2R7YA 4E0DA 5J1EA 4EP4A 4IJAA 4MO5A 4FOIA 4CJ4A 2BE2A 3JYTA 2YV0X 3HT3A 3PY8A 4JKEA 3IRXA 4BRLA 1NLVA 4DFJA 2P9SB 1RT4A 4NXMK 5KRSA 1UA0A 3EKUA 3CHWA 4LF4K 1DLOA 2HHHK 3FZFA 2AEHA 4KKOA 5AQSA 4JKBA 4CZHA 3JAMO 1ISNA 4LSNA 1TK0A 4OVLA 3KK3A 1Y19B 1BWFO 4DR2K 3VQQA 2Y1IA 1TV6A 1VHXA 5J2NA 2DPNA 4M63C 1NGIA 4OLBA 3CPWM 4UY8O 2RE2A 4WQ5C 3H1QA 4R5PA 3MECA 3V9WA 4TSXA 4WQ4A 3EYZA 1Q82O 1M90O 2O8BA 1RDCA 2Z1IA 2PBDA 1RILA 3KK2A 4FJHA 1YHQN 3AARA 2P9UB 4JI4K 4CZLA 1VRUA 1QSLA 3RSEB 1S6PA 4MDAA 2GWKA 4FCYA 4MO4A 4RW6A 4JRPA 4CF0A 4EFHA 3SI6A 3C6HA 2J0MA 4Z4EA 2FXUA 1RDWX 1G15A 2Y1JA 3T1YK 5FROA 1VSFA 1SKRA 4M45A 2UUAK 4DSJA 4BQLA 2BTFA 4I2QA 5AQRA 4DV3K 4AH9A 3O1BA 3ULEB 1FXXA 4CJWA 5LL6Z 2P5GA 4QAGA 5GINA 3G6EN 5J2MA 2G8KA 1XHZA 2V7ZA 4Q0BA 4CBWA 3UIQA 3I8DA 3RWUA 1YI2N 2H3GX 1RT3A 3V9SA 3VQDA 4KBOA 1BISA 1K8KA 4O44A 1VRTA 2J4RA 2YCHA 1GLAG 4IEIA 1C0FA 5F2RA 5AFUH 4H0VB 5M1KA 1NNEA 4HCCA 4JKHA 4FJLA 1M1KO 4CVNE 3Q7CA 1HYSA 4FPBA 2B5JA 4YDUC 3SK3A 4BC4A 3O3FA 4IG3A 2ZJRL 3JS6A 3NAEA 4GV3A 1X3MA 1QVFM 4ZTJA 1TL1A 4FWLA 3THWA 3KKRA 4KTQA 4H03B 4CEOA 3EL2A 1VSLA 4NCGA 4GVMA 1S1WA 3KLEA 1OVQA 2XY6A 1CZ9A 1YTAA 1LW0A 2HHSA 2ZJPL 4KO0A 4CJUA 5J2PA 3K59A 1GC6A 1U2VB 5H1SQ 2RKIA 4DU1A 2IAJA 4CK3A 3P1GA 4ISFA 3T1HK 1YXQA 2YI1A 3PZDA 1YVUA 1LWEA 3CI5A 4CBUA 4BC5A 4GY2B 3NGYA 1KVBA 1LAVA 3DLKA 3V9ZA 1NJZA 1TAQA 4MLHA 3HOSA 4KB0A 2WOMA 5LJWA 2QWPA 1N34K 4L3QA 1NJYA 4GKJK 1T05A 2UU9K 3T69A 5A2QO 3AVBA 4I9LA 4Y1DA 2F9TA 3QLHA 4MDBA 2HW3A 4FYDA 3SCXA 3IMXA 4CFBA 4BRGA 1GLJO 3HP6A 2W41A 4IO9L 4CI6A 1TUUA 5AQHA 4K8ZA 4FWNA 4E1NA 1RDDA 1NM1A 4H5VA 4CZFA 5GAHP 4OLAA 4AM6A 1KAXA 1ZBHA 3F5TA 3SAGA 4DTUA 4KHYA 4DMNA 3OYHA 3H3OB 4DLEA 1HBKA 3NHGA 1XWLA 1GLLO 2EMTA 2QWNA 4DFKA 4H5TA 4BRDA 5KI6A 5FPMA 4CZJA 2WFBA 2O8FB 4NY0A 1A5XA 3M3ZA 4FLWA 5AFUA 4H0PA 3TI0A 2KLAA 4IDKA 3G0ZA 2HHWA 2X78A 3UE5A 5AQLA 5C2DA 1G99A 4DTXA 1JCFA 1ESVA 3SJJA 1GOCA 4LH5A 4CZKA 1JLCA 1U47A 2V7YA 5GAEP 1U04A 2P9PA 3IKMA 5GAGP 2HF4A 3AVHA 4FLVA 2XY7A 3J7YP 4CFAA 3DM2A 3ENHA 1HNZK 1QS4A 4H8KA 2DY4A 1R0AA 1P8ZA 4E7IA 5C0YA 4DQRA 4ID5A 3D2FB 4H0YB 3CJ1A 5AR0A 2FC0A 5C2FA 4JAXA 4KB1A 1CLQA 4PUOA 3CFRA 1T03A 3VQCA 3ZLJA 1NK7A 4CEAA 3SLCA 4DR7K 3A5NC 3ZEUA 1N32K 3VEWA 2GUPA 3EZ5A 2HBMA 1IKYA 3FZMA 4CCHA 3LP2A 3H6EA 3ZX3A 4CEBA 3AV9A 4FWPA 4HTLA 4C23A 4ISGA 3CXCM 2E2PA 3DXKA 4HCBA 3TTCA 3CIPA 4WFAL 2X0SA 1LV5A 1WSFA 4CJ7A 2I7NA 3QIJA 4YNQA 3DOLA 3DYAA 3I8BA 4AM7A 2DTUA 3OA9A 1S1XA 4O8KA 5AQYA 2P9KB 2OPQA 3D7EO 3QERA 2IIRA 3PSFA 3KTQA 3QB0A 2HNDA 2A1RA 3QFPA 2IOCA 2ASOA 2YX6A 3A5LC 2QK9A 2FLOA 3AO3A 2NRRA 4BG8A 4F9OA 1RT6A 4IWVA 3LDNA 4DR5K 2BUPA 1SGHA 3VF6A 5I3UA 1NOYA 2ZF5O 4B3TK 3OS0A 4I6MA 4DV2K 1QQCA 2O8DA 4Z4GA 3F9MA 3KIOA 1J19A 3E9PA 2D0OA 4A5AA 1WSEA 4E19A 1VQ8N 3W3DA 4J2DA 1XNRK 3VTHA 2D0PA 5F1XA 1IG8A 1BA0A 4KV8A 3L3UA 1W2BM 3MEEA 3DLHA 1RFQA 5AQQA 2VQEK 3SQ4A 3NVMA 4N76A 4BRMA 3MCAB 3TAEA 2FSNA 1NGAA 3B8AX 1BL3A 3M8QA 3DRSA 3OYMA 1JCEA 1BI4A 1KLMA 4FPAA 5AQVA 3L2WA 4LF6K 3KHYA 3T7ZA 1RTHA 1X1PA 3X23A 4KRFA 5C42A 2OPRA 2Z1JA 2Z1HA 3SYZA 1KC8O 1TKZA 4C8KA 1KAZA 4B3OA 3VQ8A 4CZEA 2YJFA 3J80O 2KKZA 4B1XB 4WQ4C 2FF3B 3OYIA 1T44A 1RBVA 5AQPA 3SV4A 3IDHA 1JLFA 3ASMA 2E1YA 4EHTA 1GLCG 3FE1A 1L3UA 1B92A 3AVGA 1XNQK 1Y97A 3NF7A 4CEDA 4MFBA 1RT2A 3HRGA 4JKGA 2J0JA 3O1WA 4GXBA 4FJ7A 4B08A 3NH1A 4BE2A 4BR9A 3ZT0A 2P9IA 2Z1GA 4JHDB 2P9NB 4HWIA 5GIOA 1O1WA 5JLFA 4BE0A 3EKSA 4JLHA 1N6QA 5BPNA 4BRPA 1UA1A 3TPQA 3M1FA 4EIAA 4DV7K 2VGNA 4F2RA 4FSVA 2QEXN 3THXB 3I56N 4BRCA 1NMDA 3ZT4A 1IO2A 1YUWA 3WNFA 2QXFA 4DR3K 2OTJN 3T3FA 3MCPA 3VPZA 4Z4IA 3VGLA 4OGCA 3V81A 1NKCA 3THYA 3NFAA 2HHQA 4M3RA 4JK8A 2F96A 1GG3A 3VF4A 3LZJA 3THVA 1QHTA 2ZGYA 1T8EA 5EU7A 2G8WA 3NVKA 1WNSA 4I9QA 2DFFA 1VQKN 3CQXA 4BR5A 3QIPA 3DLRA 5ADXH 3VQ5A 3RVCA 4A57A 3CCEN 3QFUA 4IO8A 3ZSVA 3WXIA 3M5RA 1DTTA 1JXEA 3P4IA 4O5BA 4FK2A 4QS7A 3OYLA 4CJKA 3QEVA 4PKHA 1Q86O 4DTSA 4DTJA 3PO5A 3L0QA 1BQMA 3OJUA 5FRMA 1YTUA 4NYFA 4YFUA 2E6LA 4M3TA 5E84A 2LSNA 3VEOA 3D2EA 4HDOA 1MWKA 3O4NA 5CZ1A 4ELTA 2X6NA 3DRRA 4X65K 3DJCA 1DTQA 1D9DA 3LP3A 3ZETB 4DV1K 4BY9C 1TK5A 1MK9B 4OPKA 1WOQA 1SKWA 4FZYA 1NG9A 1KXPA 5TKWA 1RTDA 3VEXA 4QS8A 3H3NO 1D4XA 1OH7A 2O8CB 3DXMA 3VQPA 4EP5A 4GVEA 1K73O 3GBTA 3AGKA 3K0SA 4B9TA 4FLZA 1BCMA 4AHUA 3VQBA 2EHGA 3I33A 3O9TA 4C8LA 1T7PA 1LAWA 3R3LA 3G10A 2AJQA 3CQ8A 4B3SK 4JKDA 1VQ9N 4M42A 4ELUA 4E7KA 3G25A 1WAFA 4CK2A 4DWIA 4FM2A 4B8CA 1SS6A 1QSYA 4PQUA 4BRQA 3QEIA 1D8YA 3PLAA 2QWLA 4DR6K 2O4IA 3FZLA 3M8RA 3AVJA 1GGOA 1L5UA 4DTPA 4KFBA 3ATVA 4CD3A 1KRPA 2OZSA 4A2AA 1RDBA 1LW2A 3PV8A 2WH5A 1DEJA 1C6VA 3MMVA 3A5OC 1X9MA 5KRTA 1NGCA 2NZTA 3AO2A 4BDPA 3LDPA 1WSGA 1P90A 3M8SA 3QBXA 4CJ5A 2VG7A 2RHKA 1KBLA 1EETA 2UUCK 1SAZA 4NO7A 3QESA 1S1TA 2YHYA 1VQ5N 1IKWA 5LMNK 3NMUA 2HVHA 3AO1A 1HKGA 1RBSA 4BRAA 3CM5A 2BDPA 3VGMA 3VA0A 1HB6A 3K5LA 2HBKA 3O5BA 2KFZA 2IC3A 1RDAA 1HX1A 4F7GA 2GBZA 1HLUA 3CCJN 3LPTA 3AVFA 3L2QA 2HMPA 1IKXA 3AVLA 3E1YA 1SUQA 1SL2A 2CGJA 1ZBIA 4FLUA 4RW7A 1HNVA 3C95A 3RMCA 4BG9A 3FFIA 4EZ9A 4A5BA 2P9SA 4KI6A 1MIZB 4CZMA 3A8YA 3RMAA 4LY7A 4FK0A 1C1BA 3C7NB 1YT3A 5EX5A 1TKTA 3TARA 3QNOA 2Q36A 4FJ5A 3VA3A 4A61A 3ZSRA 3MN6A 5EY4A 3AVAA 2E88A 4YOWA 4MLEA 1EF1A 2VG5A 1XMQK 3DLEA 3A2FA 1BGXT 1RT7A 2QWOA 5AZJB 3KJVA 3P5JA 1ST7A 2D10A 4O0JA 3LALA 3TTFA 5JS1A 3KK7A 3ZSQA 1VSDA 1RT5A 2E2QA 1ATSA 1HRHA 2ZM6K 4B1VA 4CF8A 4OKJA 2D0BA 4B1ZA 4CD1A 4FLXA 5DM6L 3OYGA 4CESA 3HPOA 3S41A 4QS9A 3T1AA 3V1OA 1R59O 1HYZA 1S6QA 5KPZA 2P9UA 1J54A 5BRFA 2HHVA 3RSEA 2BGGA 5BR9A 3K2PA 2FBTA 1LOTB 2RQ1A 2VYPA 3C94A 1WBDA 3AA2A 3O9UA 4BRKA 4JI8K 1L3VA 3AA3A 4WYBA 2EWSA 3MEDA 4BACA 4ZHRA 4DUYK 2HMIA 2GWJA 3HPGA 1QHAA 4BC3A 3TAQA 4PL7A 3N4QA 4FLYA 1KSPA 1YVNA 4CGHA 5SZTA 3ULEA 1TGOA 1B9FA 4DSLA 3A5MC 1YAGA 3LP0A 3NE6A 4FZXC 1ILYA 5E41A 3O3GA 3PX4A 4CJFA 4P7IA 1J5OA 3SZ2A 2PYLA 4C1NI 1EWRA 1MWMA 4H5RA 3KWGA 4CJQA 1NK8A 4CHZA 1CXUA 3MDQA 1ACAA 3NBPA 4E7LA 3IUCA 1QE1A 1ZC6A 3SPZA 1NGBA 4H5NA 1YIJN 3CCMN 1J6ZA 3O9SA 1VSHA 1GOBA 1E3MA 1XC9A 1U4BA 5AQTA 2ABDA 3O8MA 5AZIA 3KLGA 3HM8A 3ALYA 3ZT1A 4KHSA 4CGGA 3L6QA 3HVTA 1Z25A 4PKIA 3J7AP 1HJOA 4N56A 4FJMA 3BF3A 2PFUA 1U2VA 1VQ6N 3FZHA 4FWMA 1JLGA 3VGKA 3U8XA 1ATNA 3AVIA 3SUNA 4O8UA 2E2OA 1NGHA 3BF1A 2G8FA 4W5RA 1Q81O 1FK9A 4PY5A 1NBWA 3THWB 1W97L 4LF5K 5E26A 1VBGA 5EVZA 1KTQA 3H1VX 1EXQA 4GNIA 5KTQA 3D6RA 4LH4A 3HXMA 2I1KA 4L8RB 3CG7A 4JKAA 4RCHA 2OZMA 1OVYA 2ETJA 2GV9A 3I0RA 3SV3A 1IV0A 1KVCA 2AA4A 4FW2A 4FJKA 3L4QA 3CCUN 2FBXA 5JICA 5GADP 4OKEA 3KD5E 2PAVA 1I39A 2VCPA 1C1AA 4YOXA 4KPYA 2GELA 1NGFA 1REVA 5BRDA 5I9EB 3KLHA 3BY5A 5AQOA 2NRZA 1EWQA 5CY4A 4BDYA 1O13A 2EX3A 1VSMA 2NLXA 3LL3A 2KHOA 1BIZA 4DR1K 4B9UA 3SQ1A 3CD6N 3CC7N 4RW4A 2B6AA 1H1VA 2YHAA 4Z4FA 2O8FA 3CETA 5JS2A 2E8AA 2NRVA 4H0XB 3PO4A 3WQUA 3LWMA 1YITN 1VSJA 4DQIA 3PSIA 1NTIA 2CQUA 1DT9A 1CZAN 4WFNL 4O4GA 1BUPA 5M1NA 5IWAK 2CH6A 4E7HA 1RBUA 5JVGL 4DFPA 3BUZB 3ENOA 3K9JA 3WXJA 1QQMA 1Q9YA 3CJAA 1TK8A 2A40A 1E4FT 3VEZA 1B9DA 4CF9A 2Q1NA 4OO1J 5AQIA 2P9LB 4KHUA 1UOCA 1ATRA 1GLEG 4G1QA 4EKUA 4DV0K 1RNHA 1N5YA 1QQOA 3LANA 1KQSM 4FO0A 3D2FA 4CYEA 2WONA 1ZXOA 3U4LA 4BE1A 2WC9A 2FJ9A 3BEXA 5HROA 3L3VA 1OH8A 3K57A 3CCVN 3LDSA 4BGBA 4IFEA 1NGGA 2YHXA 3F9KA 3LP1A 1T6DA 1X9SA 4Z4CA 3U6FA 2Q31A 3P31A 3AVKA 1IBMK 2QTDA 1HMVA 3M8PA 3QICA 4CERA 5JLHA 3RRGA 4DG1A 1X3NA 3OYKA 3G9WA 2O8EB 4M41A 1Q18A 5CE3A 2YNHA 3U7DA 1IJJA 1U49A 4RW9A 1JCGA 2P9KA 4FJXA 1WN7A 1XMOK 3SUPA 4WCEL 1EP4A 2XRIA 4YORA 3AU5A 3ZEUB 4ZRIA 3LDLA 1RBRA 1ZBUA 4DTNA 3SQ0A 2P5OA 1JJ2M 1VAZA 4M3XA 5BN8A 2WTUA 3AY9A 4KTWA 1SKSA 2E20A 4K25A 4FJNA 3E9LA 1K6YA 3EE8A 4F4KA 4CF1A 4J2EA 5CHIA 3IAYA 1N36K 1KAYA 3QIOA 3TAPA 1ASVA 1S1VA 2E1ZA 4FM1A 4LF9K 4ILJA 4DQPA 1W0HA 3VN5A 3QEXA 1U48A 1JL1A 3PUFA 5C25A 2YNGA 3LAMA 3QBWA 3O4WA 4V19S 1DGKN 1HB8A 4F3TA 3RR8A 5JVHL 4DQQA 1S72N 4RW8A 1NKEA 4CFDA 3Q7BA 5TKYA 1CXQA 3HK2A 3OYDA 2O8DB 3C6UA 3CM6A 1XHXA 1H4RA 3SAFA 3K5NA 2CGKA 3FR0A 4EZ6A 4IG0A 1JL2A 2HSTA 3FZKA 2D1KA 3EN9A 4FJ8A 1HYVA 3ZSYA 1J5EK 4RTFD 1SQKA 3SAHA 4GKKK 2LBBA 4FLTA 2F4VK 3DOKA 3WNHA 3TAGA 1ITGA 3PIOL 2KTQA 3HZ6A 4FWKA 3HO1A 3U3YA 3UB5A 1XUPO 2ASPA 2W6KA 1KCFA 4FM0A 4JHDA 2JWKA 2P9NA 5AQXA 1N8RO 2KZMA 3KK1A 1C0GA 4FJIA 4GV6A 2OPSA 1BIUA 2HE7A 3MXMA 3BP8A 2W6LA 3LAKA 5M1PA 1VQPN 3WEEB 3WXKA 4CE9A 4YOVA 4H4MA 4FVMA 4Y0WA 1SL0A 1NJXA 1NK0A 4BR7A 1ZBSA 3ID8A 3OJSA 3OYAA 3VQ7A 3C0BA 3ZT2A 3CJBA 4NXNK 1VSIA 2HRJA 5HBMA 3O6WA 5D3GA 2VQFK 5EOYA 4JK7A 1WBBA 3EEQA 1Q9XA 3VETA 5I42A 2P1JA 3LDOA 3ZSOA 2OA8A 2CB8A 4MQ3A 4BQZA 3P83D 1ZBFA 3DLBA 5T7BA 3CCLN 2V51B 4ILHA 2D0CA 5C15A 4CW7B 3TAMA 4DV5K 3KD1E 1NK4A 4AHVA 3HL8A 3TANA 1TYQA 5ELZA 2JLEA 5CYQA 1T6CA 2FBVA 4IFYA 3GE1A 1DIKA 2GX9A 2HVIA 5KGXA 3TSQA 4O0IA 2OYQA 4C1NK 3D0PA 4CEQA 2VG6A 2HBJA 1NK6A 3QMLA 4PHTX 4AHCA 3K9KA 4LFBK 4GW6A 4B1YB 3J81O 3K5MA 3O3HA 2Q97A 1S3XA 4Z4HA 2AL6A 3AO5A 3UKRB 4F2SA 3ZX2A 1NU0A 3KWIA 4ICLA 4LFAK 1FW6A 1NVLA 4C8OA 3HOTA 2QWQA 1BQNA 1SL1A 3ZETA 2NRTA 1RTIA 4CJLA 4JD2B 1I94K 4AHRA 4IEEA 4B3RK 1MA9B 3U9DA 1VBHA 3C6AA 4HUGA 3P39A 3ID6A 5AQMA 3RMDA 2HHXA 4OPHA 1I3AA 2YJEA 4ZRKA 4JN4A 1MU2A 3GG4A 2QW9A 4X62K 1IBKK 4OX9K 4O5FA 4K41A 1XI1A 1X9JA 2XHBA 2YKMA 3VQ9A 3AA5X 4FL9A 3MX2A 3R8EA 3OYFA 4JI0K 2XY8A 3TSPA 3NF9A 3UKUB 4WE1A 1VQON 3ZT3A 1VK0A 4A62A 4AF1A 4DKWA 3L8BA 4M3ZA 4B3MK 2VWBA 3QNNA 3VTIA 4E1JA 2YNFA 3U9ZA 3EPYA 3IS9A 3H46O 2F9WA 3DWLA 2G8HA 2ATQA 3N4PA 1YJNN 5AJ3K 1OH6A 2XO7A 5KQ8A 1HKCA 1C1CA 4DU4A 4K42A 4DLGA 2DFEA 5HP1A 1S22A 2D0AA 2W40A 4JK9A 3RTVA 3VOVA 5AQWA 2FDQA 3K5OA 3OS2A 2EMSA 5C24A 4BR0A 1NGJA 4DUZK 2KW4A 2ITGA 3OTOK 3DLLL 3ISNC 4K43A 1JLAA 2Q2RA 1RCHA 3B6PA 1VQMN 1BDGA 2QM1A 1EX4A 3HYFA 4CECA 3DI6A 3HPHA 3BZCA 2OCEA 4JV5K 4XH4A 2I5JA 4BREA 3WA0A 4I2PA 4KHNA 1K9MO 4JEPA 5BPLA 1GLDG 1YJ9N 2NRWA 3MN9A 3SPYA 3AAPA 4N41A 1Y64A 3O9RA 1WAJA 2NRXA 1JLQA 2HHTA 2FSJA 3KVGA 2F7TA 4DHYA 3C7NA 3VF2A 2D11A 3SUOA 4YL8A 4B9NA 1SZ2A 4CJRA 3WT0A 3NH2A 1VQ4N 1ZBLA 2FF6A 3TTDA 4BR2A 4OJRA 3AO4A 4H4OA 3O80A 5AZJA 4U7BA 4DS4A 3F2KA 5KQDA 3OYEA 4J8FA 4HHTA 1HR0K 2UUBK 1U6ZA 1QQNA 2IDOA 4GV9A 2I1JA 1NJIO 4FWQA 4HDQA 3AVCA 4CHYA 2QKBA 3LPUA 4CJPA 3SJHA 4FXDA 1Z6RA 4C8MA 4CK1A 4RG8A 1KVAA 1HPZA 3ZX0A 4X66K 1XQSC 3OBWA 1C0MA 2HF3A 3H45C 4BDZA 4LF8K 2X74A 1TAUA 1EQYA 3RRHA 2A42A 2KFNA 1V4SA 3TU5A 3ULDA 4JS5A 1ZYQA 4QCLA 4Q5VA 2V52B 4WFBL 4JYAK 4ZTFA 3EE9A 1NI2A 3H08A 3SBTA 4ID1A 4HUFA 4AILC 3CF5L 5JVLA 4IDHA 1HUXA 5DMRA 3HJFA 5AQGA 4W5OA 1GOAA 2DFHA 3R1XA 3SUQA 4CGJA 2O8BB 1N33K 4IFVA 1UAXA 2YNIA 4FVUA 4IOXA 4BRIA 4XIUA 4IXCA 5HRPA 1WB9A 4CEEA 4HUEA 1C0UA 3IG1A 1Z05A 2UXDK 2OPPA 5M1QA 5HL7L 4DSFA 1K8AO 4CIGA 4DV4K 4DSKA 2FBYA 5FDLA 4DFMA 3WNEA 4CZGA 4OPJA 1T3VA 1TKXA 3L2UA 3E9OA 1BO5O 2ZGZA 3W0LA 4NCAA 2VWJA 3MAQA 3NCIA 4FOEA 5HLFA 1TKDA 1W9HA 1E4GT 3FP5A 4BRFA 4JI2K 4YHHK 1OKJA 3VQAA 4FZZA 1KD1O 1JLBA 2I7PA 1EKEA 2IVOA 1K8KB 2HNYA
chains in the Genus database with same CATH topology
3KZBA 2OTJN 5ADXA 3MCPA 1BU6O 2ITMA 1X3NA 4U67L 2WUSA 3VPZA 4BGAA 1MDUB 3G9WA 3HSCA 3VGLA 4TKNA 2IVNA 1Q18A 5CE3A 3U7DA 1IJJA 2R82A 1JCGA 3VEYA 2P9KA 1YJWN 4JK8A 3WXLA 4H0TB 1GG3A 4YOTA 3CMAN 2AP1A 4A59A 3VF4A 4WCEL 5DM7L 3TSUA 4YORA 3AU5A 3L4IA 2NNWA 3ZEUB 4ZRIA 2ZGYA 3LDLA 5AZIB 3WUHA 2ZJQL 3NVKA 4G9ZA 4JKCA 3U8ZA 3FGUA 5C12A 1VQKN 3CQXA 1NGEA 4BR5A 5ADXH 1JJ2M 1VAZA 5BN8A 3RVCA 3CJCA 3AGRA 3AY9A 5KPTA 4A57A 1TUYA 4IJAA 3OBYA 3CCEN 2E20A 3QFUA 4MO5A 3HI0A 4FOIA 2A6AA 4IJNA 1GLBG 2E2NA 4IO8A 4K25A 3M6GA 3E9LA 3WXIA 3M5RA 3P4IA 4QS7A 5FPNA 4OPAA 4JKEA 3EE8A 4PKHA 5CHIA 4BVOA 2D2QA 1Q86O 1KAYA 3L0QA 4H0OA 4BRLA 1NLVA 2P9SB 5E84A 4FWOA 3MWTA 3VEOA 2E1ZA 3EKUA 3CHWA 3MN7A 5FPEA 3D2EA 4ILJA 3FZFA 2AEHA 4HDOA 1BA1A 4JKBA 5AQSA 1MWKA 1ISNA 4CZHA 2J0KA 3CQYA 5AQUA 1VQLN 1Y19B 1BWFO 3DJCA 3ENBA 3ZETB 3QBWA 3DAWA 3O4WA 1DGKN 1HB8A 4BY9C 1MK9B 2DPNA 4M63C 4B1UB 5JVHL 1NGIA 1WOQA 1S72N 1KXPA 3CC2N 5TKWA 3CPWM 4UY8O 3VEXA 4QS8A 2RE2A 3J7ZO 3Q7BA 4JKFA 1D4XA 3H1QA 3H3NO 4WQ5C 1GC7A 5TKYA 3CC4N 3DXMA 4EHUA 3MX5A 4GVEA 1K73O 1H4RA 1HPMA 3SBGA 3GBTA 3SAFA 2FSKA 2A3ZA 2CGKA 3AGKA 3FR0A 4WQ4A 1Q82O 1M90O 2HSTA 3FZKA 2PBDA 2D1KA 3EN9A 1YHQN 3AARA 2P9UB 1KC7A 4CZLA 3I33A 3O9TA 4RTFD 3RSEB 4MDAA 1SQKA 3SAHA 2GWKA 2P9LA 2LBBA 4MO4A 3R3LA 4EFHA 2QA4N 3C6HA 2J0MA 3PIOL 3HZ6A 2FXUA 4JKDA 1RDWX 4FWKA 1VQ9N 2COPA 1XC3A 3UB5A 1XUPO 3G25A 2ASPA 3LM2A 1NGDA 4BQLA 2BTFA 4JHDA 2JWKA 2P9NA 5AQXA 3SMPA 1N8RO 1QZ5A 2QWRA 1SS6A 3HTVA 5AQRA 4BRQA 1C0GA 4CZIA 1VQ7N 3PLAA 4GV6A 2OANA 5AQZA 2HE7A 1BOTO 2QWLA 3O1BA 3ULEB 4B1WB 3OW2M 1VQ4N 3BP8A 5GINA 3G6EN 3FZLA 1GGOA 3CPEA 2V7ZA 4CBWA 5M1PA 1VQPN 3WEEB 3ATVA 3WXKA 4CD3A 4Y0WA 4YOVA 1YI2N 2H3GX 4BR7A 4KBOA 4A2AA 1ZBSA 3ID8A 1K8KA 3C0BA 2WH5A 2NRHA 1DEJA 2J4RA 2YCHA 3CJBA 3MMVA 3A5OC 1GLAG 4IEIA 2HRJA 1C0FA 2P9PB 5F2RA 3O6WA 1NGCA 5AFUH 3MK6A 2NZTA 4H0VB 5M1KA 3LDPA 5EOYA 2HBLA 3WQTA 4JKHA 4JK7A 1P90A 3O9QA 3QBXA 3VETA 1M1KO 3Q7CA 2RHKA 5LJVA 3LDOA 1KBLA 3WXMB 4FPBA 1SAZA 4NO7A 4YDUC 2CB8A 3SK3A 4BC4A 4BQZA 2BH1A 2YHYA 1VQ5N 3CCLN 1V4TA 4ILHA 2IVPA 2V51B 3NMUA 3O08A 5C15A 2ZJRL 4BRGA 3JS6A 1HKGA 3PVLA 4GV3A 1X3MA 1QVFM 4BRAA 4YOUA 3FLVA 3VGMA 4FWLA 3GDQA 1HB6A 1BG3A 2QXLA 4H03B 1LCUA 3EL2A 4IOAL 2VGMA 1TYQA 5ELZA 2HBKA 3SMSA 5JMVA 3O5BA 3FLCO 1HX1A 1RGIA 1T6CA 4M7XA 4F7GA 1HLUA 3CCJN 5GIPA 3GE1A 1DIKA 2GX9A 3TSQA 2HMPA 3E1YA 4C1NK 2ZJPL 2CGJA 1GLFO 3DXKB 2HBJA 1GC6A 1U2VB 3QMLA 4PHTX 3K9KA 5H1SQ 4BG9A 4B1YB 4CBXA 3I55N 4A5BA 2P9SA 4WF9L 4ISFA 3FFKB 1MIZB 4CZMA 1YXQA 3A8YA 2YI1A 3PZDA 1DKGD 2Q97A 1S3XA 3C7NB 3CI5A 4FWRA 2AL6A 5EX5A 4BC5A 4CBUA 4LC9B 4GY2B 2CH5A 2Q36A 3UKRB 3J8AA 3ZX2A 3MWPA 4A61A 3MN6A 3KWIA 5EY4A 3VERA 1NVLA 2E88A 4JNEA 4MLHA 4YOWA 2QWQA 3HOSA 4MLEA 3HOTA 5LJWA 1EF1A 2QWPA 2QWMA 3ZETA 4L3QA 4BVPA 2NRTA 2QWOA 3CJ9A 5AZJB 1ST7A 2D10A 3T69A 4DXAB 4JD2B 4WQ5A 3TTFA 3ZDTA 2F9TA 1RDUA 3KK7A 4KH5A 2E2QA 4MDBA 1ATSA 3IMXA 4IEEA 1MA9B 3IFRA 1VBHA 3C6AA 3U9DA 1GLJO 4B1ZA 4B1VA 2W41A 3P39A 3ID6A 5AQMA 4CD1A 1QZ6A 4IO9L 4CI6A 5DM6L 1TUUA 4I6MB 4OPHA 2YJEA 4QS9A 4ZRKA 5AQHA 3S41A 4FWNA 4JN4A 2QI2A 1R59O 3GG4A 2QW9A 1NM1A 4H5VA 5KPZA 2P9UA 2DIKA 4CZFA 4AM6A 5BRFA 5F0XA 5GAHP 1KAXA 1MIXA 4O5FA 3CCQN 4K41A 3RSEA 3F5TA 3SAGA 3EZWA 1X9JA 3H3OB 5BR9A 1HBKA 4FL9A 1LOTB 2RQ1A 3ATUA 3MX2A 2VYPA 3R8EA 1GLLO 3TSPA 3O9UA 4BRKA 2EMTA 2QWNA 4H5TA 4BRDA 3UKUB 4WYBA 4BROA 4XH5A 2EWSA 1VQON 5FPMA 4CZJA 3G71N 4KH6A 2GWJA 2WFBA 4A62A 4AF1A 1QHAA 4BC3A 4NY0A 4DKWA 3M3ZA 2VWBA 5AFUA 4H0PA 3C65A 4PL7A 3N4QA 3VTIA 4E1JA 2KLAA 1YVNA 3ULEA 5C10A 3CERA 3U9ZA 3IVFA 3UE5A 1NWKA 5AQLA 3EPYA 5C2DA 3H46O 2F9WA 3DWLA 4IZ9A 4XH1A 1G99A 3N4PA 1YJNN 4XEIA 1JCFA 3A5MC 1ESVA 3WEEA 4NB4A 1YAGA 1ILYA 1WUAA 4FWSA 4CZKA 5KQ8A 1HKCA 5M1OA 2A5XA 4K42A 3VMFB 4P7IA 1S22A 2V7YA 2ZWHA 5GAEP 2P9PA 5GAGP 3IKMA 4C1NI 2HF4A 2W40A 4BRNA 4JK9A 1MWMA 3VOVA 4H5RA 3KWGA 5AQWA 2FDQA 3ENHA 2EMSA 4BR0A 1NGJA 1QVGM 2A41A 3CMEN 3MDQA 1P8ZA 4YDUA 3JXUA 4ILGB 1ACAA 5C0YA 3DLLL 3IUCA 4JKGB 1ZC6A 3D2FB 3LDQA 4H0YB 4K43A 2Q2RA 1NGBA 3CJ1A 4H5NA 2P9IB 5AQJA 1BDGA 2QM1A 5AR0A 4DB3A 5C2FA 4ZRJA 1YIJN 4JAXA 5LY3A 3CCMN 1J6ZA 3O9SA 3OHRA 3SLCA 3BINA 3A5NC 5AQTA 2ABDA 3O8MA 5AZIA 3ZEUA 3R9PA 3HM8A 2UYTA 4KH4A 3VEWA 4XH4A 3CCRN 2GUPA 3WA0A 4BREA 3L6QA 1K9MO 2HBMA 3FZMA 4PKIA 3H6EA 3ZX3A 2WBNA 3ZYYX 1HJOA 4JEPA 4FWPA 4HTLA 4C23A 3BF3A 5BPLA 3VESA 1GLDG 4ISGA 3CXCM 2E2PA 3DXKA 1YJ9N 2NRWA 2PFUA 2GEMA 3CIPA 3MN9A 3TTCA 3AAPA 1U2VA 2X0SA 1Y64A 4BC2A 4WFAL 1VQ6N 3LM9A 3FZHA 3O9RA 2NRXA 4CJ7A 2I7NA 4FWMA 3QIJA 3VGKA 3I8BA 4AM7A 3U8XA 2FSJA 5BPMA 3OA9A 3KVGA 1ATNA 4O8KA 2F7TA 5AQYA 2P9KB 4DHYA 3C7NA 3VF2A 3D7EO 4O8UA 1Q7YO 2E2OA 2IIRA 2D11A 1NGHA 3BF1A 3UKRA 5BRHA 3E66A 3GL1A 1Q81O 4YL8A 1NBWA 3QB0A 3GOIA 1SZ2A 1W97L 4ISEA 1EO1A 5E26A 1VBGA 5EVZA 3QFPA 3WT0A 3H1VX 3A0IX 2FF6A 3TTDA 4BR4A 1TYQB 2ASOA 2YX6A 4GNIA 3D6RA 5AQNA 3A5LC 4BR2A 4R79A 2D4WA 3MN5A 3O80A 2JWLA 5AZJA 2FLOA 3F2KA 4U7BA 2NRRA 5KQDA 4BG8A 4F9OA 2I1KA 3PIPL 5BN9A 4IWVA 3LDNA 4JD2A 4J8FA 4JKAA 4RCHA 2BUPA 5BREA 1SGHA 1OVYA 2YHWA 3VF6A 1U6ZA 1QQNA 5IJMA 4GV9A 2AA4A 2ZF5O 2I1JA 3L4QA 3CCUN 1NJIO 4FWQA 5JICA 5GADP 3VENA 4HDQA 4I6MA 1JDEA 2PAVA 2VCPA 2Q0RA 5B8HA 4BRHA 3F9MA 3AAQA 4YOXA 1VQNN 2GELA 1NGFA 3SJHA 1J19A 3E9PA 2D0OA 4A5AA 1VQ8N 1Z6RA 3W3DA 5BRDA 5I9EB 1HKBA 3VTHA 5AQOA 3ZX0A 2D0PA 3CJ7A 4H5WA 5F1XA 2ASMA 1IG8A 1XQSC 2NRZA 1BA0A 2HF3A 3D2EB 3OBWA 5EXWA 1O13A 3H45C 3G4SN 5KPRA 1W2BM 2NLXA 3LL3A 4DCHA 1RFQA 5AQQA 2KHOA 1EQYA 4DQ8A 3UKUA 3P38A 3NVMA 4BRMA 3MCAB 2A42A 3CD6N 1V4SA 5AQFA 3TU5A 2FSNA 1NGAA 3B8AX 4A2BA 3CC7N 1H1VA 4YOYA 1JCEA 4FPAA 1VQMN 2V52B 3CETA 5AQVA 4WFBL 2E8AA 2NRVA 4H0XB 3KHYA 3EE9A 1NI2A 3T7ZA 3WQUA 1YITN 3SBTA 3X23A 3CF5L 1NTIA 4RWTA 5JVLA 2CQUA 1DT9A 4IDHA 3DXMB 1KC8O 1HUXA 1CZAN 4WFNL 3EO3A 1KAZA 5AQGA 1BUPA 5M1NA 2CH6A 4CZEA 5MLCQ 3R1XA 2OTLN 5JVGL 2GTDA 2YJFA 3VEVA 3BUZB 3ENOA 3HBTA 3K9JA 3WXJA 2KKZA 4B1XB 1YF5L 1QQMA 3AU4A 2FF3B 3CJAA 4WQ4C 4FVUA 2A40A 4IOXA 1E4FT 3VEZA 1T44A 4BRIA 5AQPA 4IXCA 2Q1NA 4OO1J 3IDHA 5AQIA 2E1YA 2P9LB 4EAHD 4EHTA 4NLBA 1ATRA 1GLEG 1GLCG 1Z05A 3FE1A 5M1QA 5HOOA 5HL7L 4EKUA 1K8AO 2Q0UA 3CCSN 1QQOA 4JKGA 2J0JA 3HRGA 3O1WA 1KQSM 4GXBA 4CZGA 4FO0A 3D2FA 4BR9A 1T3VA 4CYEA 5FPDA 2YVCA 2ZPYA 1ZXOA 2P9IA 2WC9A 4JHDB 3U4LA 2FJ9A 4B9QA 3E9OA 2P9NB 1BO5O 5AQKA 4HWIA 3BEXA 2ZGZA 3W0LA 5GIOA 5JLFA 3EKSA 5BPNA 5CR4A 4BRPA 4FOEA 4NLCA 3CCVN 1MK7B 4Z94A 3TPQA 3M1FA 4EIAA 4BGBA 2VGNA 1E4GT 1E5WA 3FP5A 1NGGA 3QDKA 3R6MA 4IFEA 4PKGA 2YHXA 4FSVA 2HOEA 4BRFA 5M1FA 1OKJA 1T6DA 2QEXN 2Q31A 3P31A 4M7YA 4BRCA 2I7PA 1NMDA 3I56N 2QTDA 1KD1O 4PL8A 3QICA 4IOCL 2IVOA 1YUWA 1K8KB 5JLHA 2CGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKG A;  3SBG A;  4ILJ A;  4JKH A;  4ILG B;  4JK7 A;  4JKB A;  4JKG B;  3E9O A;  4JKA A;  3ENB A;  3E9L A;  4JK8 A;  4ILH A;  4JKE A;  4JKD A;  3E66 A;  4JKF A;  4JK9 A;  3SBT A;  4JKC A;  3E9P A; 
#chains in the Genus database with same CATH topology
 5SWM A;  4JI3 K;  4FJ9 A;  1BU6 O;  2X6S A;  4U67 L;  2WUS A;  3S3M A;  4CIE A;  3L2V A;  4BGA A;  1MDU B;  4PA1 A;  4KI4 A;  1NJW A;  4TKN A;  3HP9 A;  2IVN A;  3QO9 A;  4DTR A;  3VEY A;  1YJW N;  4HVJ A;  4H0T B;  4YOT A;  2AP1 A;  4A59 A;  4I7F A;  5DM7 L;  3TSU A;  4DSE A;  2E6M A;  1LWC A;  3C6T A;  2NNW A;  2D5R A;  3QEW A;  5AZI B;  4G9Z A;  4JKC A;  3F73 A;  4KAZ A;  4JI7 K;  4CJ3 A;  3FGU A;  5C12 A;  3NDK A;  1HNI A;  1NGE A;  4KTZ A;  3QET A;  3CJC A;  3AGR A;  5KPT A;  1TUY A;  3OBY A;  3HI0 A;  2A6A A;  4IJN A;  1GLB G;  2E2N A;  3KLF A;  3M6G A;  1IKV A;  5FPN A;  4OPA A;  2ZE2 A;  4DR4 K;  3S9H A;  4W5N A;  3MXI A;  2JGU A;  2D2Q A;  4BVO A;  4LD0 A;  3TAF A;  4H0O A;  2E4L A;  4FJG A;  4FWO A;  3MWT A;  3MN7 A;  5FPE A;  1IG9 A;  4CHP A;  1BA1 A;  4CGD A;  3K58 A;  4LF7 K;  2J0K A;  3CQY A;  5AQU A;  1VQL N;  4ELV A;  3ENB A;  4KRE A;  1HNX K;  2G8U A;  3DAW A;  5K14 A;  4B1U B;  3CC2 N;  4DTO A;  4BWM A;  3J7Z O;  4E3S A;  2E5L K;  4JKF A;  3NH0 A;  3CC4 N;  1GC7 A;  3V1R A;  4IBN A;  4EHU A;  4OKK A;  3MX5 A;  1FKP A;  1W7A A;  1HPM A;  3SBG A;  4KHQ A;  2FSK A;  2A3Z A;  1NOZ A;  4B9V A;  3OY9 A;  1KC7 A;  1J9A A;  4Y1C A;  2HNZ A;  4DU3 A;  2P9L A;  1C0T A;  2QA4 N;  1A5V A;  2RPI A;  2W42 A;  5HRR A;  3ZSX A;  2COP A;  1XC3 A;  2UXC K;  2YHB A;  4O55 A;  3LM2 A;  4FW1 A;  1NGD A;  3SMP A;  4CJS A;  5FLX O;  1QZ5 A;  2QWR A;  3HTV A;  3NF8 A;  4CZI A;  5HRN A;  1VQ7 N;  2OAN A;  5AQZ A;  4B1W B;  1BOT O;  2RF2 A;  4CFC A;  3OW2 M;  3BDP A;  3LWL A;  3MXJ A;  1L3S A;  4C8N A;  3SQ2 A;  3CPE A;  3QIN A;  3E01 A;  3KKS A;  1U45 A;  2NRH A;  2P9P B;  3MEG A;  4UQG A;  2O8E A;  3MK6 A;  1FKO A;  4JI6 K;  4CJT A;  2HBL A;  3WQT A;  3O9Q A;  4K8X A;  5LJV A;  1WSJ A;  3WXM B;  1WSH A;  4JS4 A;  2BH1 A;  3ZSW A;  1V4T A;  2IVP A;  3O08 A;  3PVL A;  2YKN A;  4GMJ B;  4YOU A;  3FLV A;  2B4J A;  3GDQ A;  1BG3 A;  2QXL A;  1LCU A;  1UWB A;  3S3O A;  4IOA L;  2VGM A;  5JMV A;  3SMS A;  3FLC O;  1RGI A;  4M7X A;  4YY3 K;  5GIP A;  3NGI A;  5KGW A;  4FJJ A;  1GLF O;  3DXK B;  4E89 A;  1KFS A;  1IH7 A;  4CBX A;  3I55 N;  4WF9 L;  3AA4 A;  3DLG A;  3FFK B;  1D5A A;  1LWF A;  1VSE A;  2G8V A;  1DKG D;  2QKK A;  2G8I A;  4FWR A;  4LC9 B;  3V6D A;  2CH5 A;  1D9F A;  3J8A A;  3EY1 A;  3MWP A;  1KLN A;  3KLI A;  1KFD A;  3VER A;  4JNE A;  3NF6 A;  2QWM A;  2XY5 A;  4BVP A;  3CJ9 A;  4DXA B;  4WQ5 A;  3ZDT A;  1RDU A;  3DMJ A;  4KH5 A;  5BR8 K;  4JRQ A;  3IFR A;  3JSM A;  5FPD A;  1QZ6 A;  3ZSZ A;  4I6M B;  1A5W A;  2QI2 A;  4Z0U A;  3OVN A;  1QTM A;  2DIK A;  5F0X A;  1J53 A;  3RMB A;  1MIX A;  3CCQ N;  5FRN A;  5CZ2 A;  4W5T A;  3EZW A;  3WNG A;  3RR7 A;  4AHT A;  3ATU A;  4CEZ A;  4BRO A;  1JKH A;  4XH5 A;  3G71 N;  4KH6 A;  3OYN A;  1BI4 B;  3B6O A;  1IBL K;  2KZZ A;  3C65 A;  4CHQ A;  2HHU A;  5C10 A;  4CJE A;  3CER A;  3IVF A;  1NWK A;  1Q8I A;  4IZ9 A;  4NYN A;  4XH1 A;  4NCB A;  4XEI A;  3PX6 A;  3OYB A;  3WEE A;  4NB4 A;  1WUA A;  4FWS A;  3VQ4 A;  5M1O A;  2A5X A;  3VMF B;  4CEF A;  4KHW A;  3THX A;  2ZWH A;  3S3N A;  4BRN A;  1ASU A;  1NKB A;  1WSI A;  3OYC A;  1QVG M;  1S1U A;  2A41 A;  3HST B;  3D45 A;  4YDU A;  3JXU A;  4ILG B;  4JKG B;  1X9W A;  4B9L A;  3LDQ A;  3CME N;  1SV5 A;  2P9I B;  5AQJ A;  4DB3 A;  4ZRJ A;  4HTU A;  3O4Q A;  5LY3 A;  3OHR A;  1FJG K;  1TL3 A;  3BIN A;  3AVN A;  3R9P A;  2PZS A;  3AVM A;  2UYT A;  4KH4 A;  3CCR N;  3HVR A;  1HJR A;  4QOZ B;  3TR8 A;  2WBN A;  3ZYY X;  5J2Q A;  4M3U A;  3VES A;  4M3W A;  3QEP A;  5HRS A;  2GEM A;  4J2B A;  4BC2 A;  4F3O A;  3LM9 A;  4E1M A;  4DF4 A;  4W5Q A;  5BPM A;  3THY B;  5LMU K;  2VWK A;  1Q7Y O;  2ZQB A;  4BWJ A;  3UKR A;  3E66 A;  3GL1 A;  5BRH A;  3OS1 A;  3CYM A;  5DK5 A;  3GOI A;  4ISE A;  2O4G A;  1EO1 A;  1CZB A;  3A0I X;  4BR4 A;  1TYQ B;  4R79 A;  3VQ6 A;  5AQN A;  2A1S A;  2D4W A;  3MN5 A;  2JWL A;  3PIP L;  5BN9 A;  4JD2 A;  5BRE A;  2PY5 A;  1QSS A;  4DSI A;  2YHW A;  4JI1 K;  5IJM A;  3VEN A;  1NMN A;  1JDE A;  1S5J A;  2ZD1 A;  3L2R A;  3OYJ A;  2Q0R A;  2O8C A;  5B8H A;  4BRH A;  4CIF A;  3AAQ A;  1VQN N;  1VSK A;  3CFO A;  3VQE A;  3V9U A;  1HKB A;  3CJ7 A;  4H5W A;  2IGI A;  2ASM A;  1OH5 A;  5EXW A;  3D2E B;  3G4S N;  2UXB K;  5KPR A;  4DCH A;  4CHN A;  4DQ8 A;  4PWD A;  3UKU A;  3P38 A;  4DV6 K;  1RT1 A;  5AQF A;  4J2A A;  4A2B A;  4N47 A;  4YOY A;  2KQ2 A;  4IKF A;  3I0S A;  4CHO A;  3SNN A;  4CJV A;  2Q3S A;  1Z26 A;  4RWT A;  2GUI A;  4X64 K;  2P51 A;  3DXM B;  3EO3 A;  4CGI A;  5MLC Q;  2OTL N;  2GTD A;  3VEV A;  3HBT A;  4FK4 A;  1JLE A;  1YF5 L;  1HNW K;  3AU4 A;  2RN2 A;  1HQE A;  2PYJ A;  4DQS A;  1TVR A;  1WLJ A;  3TAB A;  4EAH D;  4NLB A;  3V9X A;  2F8T A;  1RTJ A;  4B8A B;  5HOO A;  2Q0U A;  3CCS N;  3ITH A;  2F8S A;  3NGZ A;  4AQY K;  5IT9 O;  2HB5 A;  4F8R A;  2YVC A;  2ZPY A;  5CYM A;  1S9E A;  4B9Q A;  3CFP A;  5AQK A;  4AHS A;  3DRP A;  5CR4 A;  1BHL A;  4NLC A;  1MK7 B;  4Z94 A;  1RBT A;  3BGR A;  3PX0 A;  3TWH A;  3LZI A;  1E5W A;  3R6M A;  3QDK A;  4PKG A;  5M1F A;  1BCO A;  2HOE A;  4B9M A;  4M7Y A;  4N5S A;  1F21 A;  3V4I A;  4PL8 A;  1NK5 A;  3ZCM A;  4IOC L;  4M3Y A;  2CGL A;  4CGF A;  3KZB A;  5ADX A;  2ITM A;  3BZK A;  3HM9 A;  3U3G A;  2BAN A;  3HSC A;  4LSL A;  4E7J A;  1NK9 A;  1JXB A;  4DS5 A;  2R82 A;  4CF2 A;  4JI5 K;  3WXL A;  3V1Q A;  3CMA N;  4KHP K;  1L3T A;  4LFC K;  3L4I A;  4DF8 A;  1HQU A;  4OGE A;  3WUH A;  2ZJQ L;  4B9S A;  3T19 A;  2NUB A;  1ASW A;  3U8Z A;  2IS3 A;  4DTM A;  1S9G A;  4K0K K;  2R7Y A;  4E0D A;  5J1E A;  4EP4 A;  4IJA A;  4MO5 A;  4FOI A;  4CJ4 A;  2BE2 A;  3JYT A;  2YV0 X;  3HT3 A;  3PY8 A;  4JKE A;  3IRX A;  4BRL A;  1NLV A;  4DFJ A;  2P9S B;  1RT4 A;  4NXM K;  5KRS A;  1UA0 A;  3EKU A;  3CHW A;  4LF4 K;  1DLO A;  2HHH K;  3FZF A;  2AEH A;  4KKO A;  5AQS A;  4JKB A;  4CZH A;  3JAM O;  1ISN A;  4LSN A;  1TK0 A;  4OVL A;  3KK3 A;  1Y19 B;  1BWF O;  4DR2 K;  3VQQ A;  2Y1I A;  1TV6 A;  1VHX A;  5J2N A;  2DPN A;  4M63 C;  1NGI A;  4OLB A;  3CPW M;  4UY8 O;  2RE2 A;  4WQ5 C;  3H1Q A;  4R5P A;  3MEC A;  3V9W A;  4TSX A;  4WQ4 A;  3EYZ A;  1Q82 O;  1M90 O;  2O8B A;  1RDC A;  2Z1I A;  2PBD A;  1RIL A;  3KK2 A;  4FJH A;  1YHQ N;  3AAR A;  2P9U B;  4JI4 K;  4CZL A;  1VRU A;  1QSL A;  3RSE B;  1S6P A;  4MDA A;  2GWK A;  4FCY A;  4MO4 A;  4RW6 A;  4JRP A;  4CF0 A;  4EFH A;  3SI6 A;  3C6H A;  2J0M A;  4Z4E A;  2FXU A;  1RDW X;  1G15 A;  2Y1J A;  3T1Y K;  5FRO A;  1VSF A;  1SKR A;  4M45 A;  2UUA K;  4DSJ A;  4BQL A;  2BTF A;  4I2Q A;  5AQR A;  4DV3 K;  4AH9 A;  3O1B A;  3ULE B;  1FXX A;  4CJW A;  5LL6 Z;  2P5G A;  4QAG A;  5GIN A;  3G6E N;  5J2M A;  2G8K A;  1XHZ A;  2V7Z A;  4Q0B A;  4CBW A;  3UIQ A;  3I8D A;  3RWU A;  1YI2 N;  2H3G X;  1RT3 A;  3V9S A;  3VQD A;  4KBO A;  1BIS A;  1K8K A;  4O44 A;  1VRT A;  2J4R A;  2YCH A;  1GLA G;  4IEI A;  1C0F A;  5F2R A;  5AFU H;  4H0V B;  5M1K A;  1NNE A;  4HCC A;  4JKH A;  4FJL A;  1M1K O;  4CVN E;  3Q7C A;  1HYS A;  4FPB A;  2B5J A;  4YDU C;  3SK3 A;  4BC4 A;  3O3F A;  4IG3 A;  2ZJR L;  3JS6 A;  3NAE A;  4GV3 A;  1X3M A;  1QVF M;  4ZTJ A;  1TL1 A;  4FWL A;  3THW A;  3KKR A;  4KTQ A;  4H03 B;  4CEO A;  3EL2 A;  1VSL A;  4NCG A;  4GVM A;  1S1W A;  3KLE A;  1OVQ A;  2XY6 A;  1CZ9 A;  1YTA A;  1LW0 A;  2HHS A;  2ZJP L;  4KO0 A;  4CJU A;  5J2P A;  3K59 A;  1GC6 A;  1U2V B;  5H1S Q;  2RKI A;  4DU1 A;  2IAJ A;  4CK3 A;  3P1G A;  4ISF A;  3T1H K;  1YXQ A;  2YI1 A;  3PZD A;  1YVU A;  1LWE A;  3CI5 A;  4CBU A;  4BC5 A;  4GY2 B;  3NGY A;  1KVB A;  1LAV A;  3DLK A;  3V9Z A;  1NJZ A;  1TAQ A;  4MLH A;  3HOS A;  4KB0 A;  2WOM A;  5LJW A;  2QWP A;  1N34 K;  4L3Q A;  1NJY A;  4GKJ K;  1T05 A;  2UU9 K;  3T69 A;  5A2Q O;  3AVB A;  4I9L A;  4Y1D A;  2F9T A;  3QLH A;  4MDB A;  2HW3 A;  4FYD A;  3SCX A;  3IMX A;  4CFB A;  4BRG A;  1GLJ O;  3HP6 A;  2W41 A;  4IO9 L;  4CI6 A;  1TUU A;  5AQH A;  4K8Z A;  4FWN A;  4E1N A;  1RDD A;  1NM1 A;  4H5V A;  4CZF A;  5GAH P;  4OLA A;  4AM6 A;  1KAX A;  1ZBH A;  3F5T A;  3SAG A;  4DTU A;  4KHY A;  4DMN A;  3OYH A;  3H3O B;  4DLE A;  1HBK A;  3NHG A;  1XWL A;  1GLL O;  2EMT A;  2QWN A;  4DFK A;  4H5T A;  4BRD A;  5KI6 A;  5FPM A;  4CZJ A;  2WFB A;  2O8F B;  4NY0 A;  1A5X A;  3M3Z A;  4FLW A;  5AFU A;  4H0P A;  3TI0 A;  2KLA A;  4IDK A;  3G0Z A;  2HHW A;  2X78 A;  3UE5 A;  5AQL A;  5C2D A;  1G99 A;  4DTX A;  1JCF A;  1ESV A;  3SJJ A;  1GOC A;  4LH5 A;  4CZK A;  1JLC A;  1U47 A;  2V7Y A;  5GAE P;  1U04 A;  2P9P A;  3IKM A;  5GAG P;  2HF4 A;  3AVH A;  4FLV A;  2XY7 A;  3J7Y P;  4CFA A;  3DM2 A;  3ENH A;  1HNZ K;  1QS4 A;  4H8K A;  2DY4 A;  1R0A A;  1P8Z A;  4E7I A;  5C0Y A;  4DQR A;  4ID5 A;  3D2F B;  4H0Y B;  3CJ1 A;  5AR0 A;  2FC0 A;  5C2F A;  4JAX A;  4KB1 A;  1CLQ A;  4PUO A;  3CFR A;  1T03 A;  3VQC A;  3ZLJ A;  1NK7 A;  4CEA A;  3SLC A;  4DR7 K;  3A5N C;  3ZEU A;  1N32 K;  3VEW A;  2GUP A;  3EZ5 A;  2HBM A;  1IKY A;  3FZM A;  4CCH A;  3LP2 A;  3H6E A;  3ZX3 A;  4CEB A;  3AV9 A;  4FWP A;  4HTL A;  4C23 A;  4ISG A;  3CXC M;  2E2P A;  3DXK A;  4HCB A;  3TTC A;  3CIP A;  4WFA L;  2X0S A;  1LV5 A;  1WSF A;  4CJ7 A;  2I7N A;  3QIJ A;  4YNQ A;  3DOL A;  3DYA A;  3I8B A;  4AM7 A;  2DTU A;  3OA9 A;  1S1X A;  4O8K A;  5AQY A;  2P9K B;  2OPQ A;  3D7E O;  3QER A;  2IIR A;  3PSF A;  3KTQ A;  3QB0 A;  2HND A;  2A1R A;  3QFP A;  2IOC A;  2ASO A;  2YX6 A;  3A5L C;  2QK9 A;  2FLO A;  3AO3 A;  2NRR A;  4BG8 A;  4F9O A;  1RT6 A;  4IWV A;  3LDN A;  4DR5 K;  2BUP A;  1SGH A;  3VF6 A;  5I3U A;  1NOY A;  2ZF5 O;  4B3T K;  3OS0 A;  4I6M A;  4DV2 K;  1QQC A;  2O8D A;  4Z4G A;  3F9M A;  3KIO A;  1J19 A;  3E9P A;  2D0O A;  4A5A A;  1WSE A;  4E19 A;  1VQ8 N;  3W3D A;  4J2D A;  1XNR K;  3VTH A;  2D0P A;  5F1X A;  1IG8 A;  1BA0 A;  4KV8 A;  3L3U A;  1W2B M;  3MEE A;  3DLH A;  1RFQ A;  5AQQ A;  2VQE K;  3SQ4 A;  3NVM A;  4N76 A;  4BRM A;  3MCA B;  3TAE A;  2FSN A;  1NGA A;  3B8A X;  1BL3 A;  3M8Q A;  3DRS A;  3OYM A;  1JCE A;  1BI4 A;  1KLM A;  4FPA A;  5AQV A;  3L2W A;  4LF6 K;  3KHY A;  3T7Z A;  1RTH A;  1X1P A;  3X23 A;  4KRF A;  5C42 A;  2OPR A;  2Z1J A;  2Z1H A;  3SYZ A;  1KC8 O;  1TKZ A;  4C8K A;  1KAZ A;  4B3O A;  3VQ8 A;  4CZE A;  2YJF A;  3J80 O;  2KKZ A;  4B1X B;  4WQ4 C;  2FF3 B;  3OYI A;  1T44 A;  1RBV A;  5AQP A;  3SV4 A;  3IDH A;  1JLF A;  3ASM A;  2E1Y A;  4EHT A;  1GLC G;  3FE1 A;  1L3U A;  1B92 A;  3AVG A;  1XNQ K;  1Y97 A;  3NF7 A;  4CED A;  4MFB A;  1RT2 A;  3HRG A;  4JKG A;  2J0J A;  3O1W A;  4GXB A;  4FJ7 A;  4B08 A;  3NH1 A;  4BE2 A;  4BR9 A;  3ZT0 A;  2P9I A;  2Z1G A;  4JHD B;  2P9N B;  4HWI A;  5GIO A;  1O1W A;  5JLF A;  4BE0 A;  3EKS A;  4JLH A;  1N6Q A;  5BPN A;  4BRP A;  1UA1 A;  3TPQ A;  3M1F A;  4EIA A;  4DV7 K;  2VGN A;  4F2R A;  4FSV A;  2QEX N;  3THX B;  3I56 N;  4BRC A;  1NMD A;  3ZT4 A;  1IO2 A;  1YUW A;  3WNF A;  2QXF A;  4DR3 K;  2OTJ N;  3T3F A;  3MCP A;  3VPZ A;  4Z4I A;  3VGL A;  4OGC A;  3V81 A;  1NKC A;  3THY A;  3NFA A;  2HHQ A;  4M3R A;  4JK8 A;  2F96 A;  1GG3 A;  3VF4 A;  3LZJ A;  3THV A;  1QHT A;  2ZGY A;  1T8E A;  5EU7 A;  2G8W A;  3NVK A;  1WNS A;  4I9Q A;  2DFF A;  1VQK N;  3CQX A;  4BR5 A;  3QIP A;  3DLR A;  5ADX H;  3VQ5 A;  3RVC A;  4A57 A;  3CCE N;  3QFU A;  4IO8 A;  3ZSV A;  3WXI A;  3M5R A;  1DTT A;  1JXE A;  3P4I A;  4O5B A;  4FK2 A;  4QS7 A;  3OYL A;  4CJK A;  3QEV A;  4PKH A;  1Q86 O;  4DTS A;  4DTJ A;  3PO5 A;  3L0Q A;  1BQM A;  3OJU A;  5FRM A;  1YTU A;  4NYF A;  4YFU A;  2E6L A;  4M3T A;  5E84 A;  2LSN A;  3VEO A;  3D2E A;  4HDO A;  1MWK A;  3O4N A;  5CZ1 A;  4ELT A;  2X6N A;  3DRR A;  4X65 K;  3DJC A;  1DTQ A;  1D9D A;  3LP3 A;  3ZET B;  4DV1 K;  4BY9 C;  1TK5 A;  1MK9 B;  4OPK A;  1WOQ A;  1SKW A;  4FZY A;  1NG9 A;  1KXP A;  5TKW A;  1RTD A;  3VEX A;  4QS8 A;  3H3N O;  1D4X A;  1OH7 A;  2O8C B;  3DXM A;  3VQP A;  4EP5 A;  4GVE A;  1K73 O;  3GBT A;  3AGK A;  3K0S A;  4B9T A;  4FLZ A;  1BCM A;  4AHU A;  3VQB A;  2EHG A;  3I33 A;  3O9T A;  4C8L A;  1T7P A;  1LAW A;  3R3L A;  3G10 A;  2AJQ A;  3CQ8 A;  4B3S K;  4JKD A;  1VQ9 N;  4M42 A;  4ELU A;  4E7K A;  3G25 A;  1WAF A;  4CK2 A;  4DWI A;  4FM2 A;  4B8C A;  1SS6 A;  1QSY A;  4PQU A;  4BRQ A;  3QEI A;  1D8Y A;  3PLA A;  2QWL A;  4DR6 K;  2O4I A;  3FZL A;  3M8R A;  3AVJ A;  1GGO A;  1L5U A;  4DTP A;  4KFB A;  3ATV A;  4CD3 A;  1KRP A;  2OZS A;  4A2A A;  1RDB A;  1LW2 A;  3PV8 A;  2WH5 A;  1DEJ A;  1C6V A;  3MMV A;  3A5O C;  1X9M A;  5KRT A;  1NGC A;  2NZT A;  3AO2 A;  4BDP A;  3LDP A;  1WSG A;  1P90 A;  3M8S A;  3QBX A;  4CJ5 A;  2VG7 A;  2RHK A;  1KBL A;  1EET A;  2UUC K;  1SAZ A;  4NO7 A;  3QES A;  1S1T A;  2YHY A;  1VQ5 N;  1IKW A;  5LMN K;  3NMU A;  2HVH A;  3AO1 A;  1HKG A;  1RBS A;  4BRA A;  3CM5 A;  2BDP A;  3VGM A;  3VA0 A;  1HB6 A;  3K5L A;  2HBK A;  3O5B A;  2KFZ A;  2IC3 A;  1RDA A;  1HX1 A;  4F7G A;  2GBZ A;  1HLU A;  3CCJ N;  3LPT A;  3AVF A;  3L2Q A;  2HMP A;  1IKX A;  3AVL A;  3E1Y A;  1SUQ A;  1SL2 A;  2CGJ A;  1ZBI A;  4FLU A;  4RW7 A;  1HNV A;  3C95 A;  3RMC A;  4BG9 A;  3FFI A;  4EZ9 A;  4A5B A;  2P9S A;  4KI6 A;  1MIZ B;  4CZM A;  3A8Y A;  3RMA A;  4LY7 A;  4FK0 A;  1C1B A;  3C7N B;  1YT3 A;  5EX5 A;  1TKT A;  3TAR A;  3QNO A;  2Q36 A;  4FJ5 A;  3VA3 A;  4A61 A;  3ZSR A;  3MN6 A;  5EY4 A;  3AVA A;  2E88 A;  4YOW A;  4MLE A;  1EF1 A;  2VG5 A;  1XMQ K;  3DLE A;  3A2F A;  1BGX T;  1RT7 A;  2QWO A;  5AZJ B;  3KJV A;  3P5J A;  1ST7 A;  2D10 A;  4O0J A;  3LAL A;  3TTF A;  5JS1 A;  3KK7 A;  3ZSQ A;  1VSD A;  1RT5 A;  2E2Q A;  1ATS A;  1HRH A;  2ZM6 K;  4B1V A;  4CF8 A;  4OKJ A;  2D0B A;  4B1Z A;  4CD1 A;  4FLX A;  5DM6 L;  3OYG A;  4CES A;  3HPO A;  3S41 A;  4QS9 A;  3T1A A;  3V1O A;  1R59 O;  1HYZ A;  1S6Q A;  5KPZ A;  2P9U A;  1J54 A;  5BRF A;  2HHV A;  3RSE A;  2BGG A;  5BR9 A;  3K2P A;  2FBT A;  1LOT B;  2RQ1 A;  2VYP A;  3C94 A;  1WBD A;  3AA2 A;  3O9U A;  4BRK A;  4JI8 K;  1L3V A;  3AA3 A;  4WYB A;  2EWS A;  3MED A;  4BAC A;  4ZHR A;  4DUY K;  2HMI A;  2GWJ A;  3HPG A;  1QHA A;  4BC3 A;  3TAQ A;  4PL7 A;  3N4Q A;  4FLY A;  1KSP A;  1YVN A;  4CGH A;  5SZT A;  3ULE A;  1TGO A;  1B9F A;  4DSL A;  3A5M C;  1YAG A;  3LP0 A;  3NE6 A;  4FZX C;  1ILY A;  5E41 A;  3O3G A;  3PX4 A;  4CJF A;  4P7I A;  1J5O A;  3SZ2 A;  2PYL A;  4C1N I;  1EWR A;  1MWM A;  4H5R A;  3KWG A;  4CJQ A;  1NK8 A;  4CHZ A;  1CXU A;  3MDQ A;  1ACA A;  3NBP A;  4E7L A;  3IUC A;  1QE1 A;  1ZC6 A;  3SPZ A;  1NGB A;  4H5N A;  1YIJ N;  3CCM N;  1J6Z A;  3O9S A;  1VSH A;  1GOB A;  1E3M A;  1XC9 A;  1U4B A;  5AQT A;  2ABD A;  3O8M A;  5AZI A;  3KLG A;  3HM8 A;  3ALY A;  3ZT1 A;  4KHS A;  4CGG A;  3L6Q A;  3HVT A;  1Z25 A;  4PKI A;  3J7A P;  1HJO A;  4N56 A;  4FJM A;  3BF3 A;  2PFU A;  1U2V A;  1VQ6 N;  3FZH A;  4FWM A;  1JLG A;  3VGK A;  3U8X A;  1ATN A;  3AVI A;  3SUN A;  4O8U A;  2E2O A;  1NGH A;  3BF1 A;  2G8F A;  4W5R A;  1Q81 O;  1FK9 A;  4PY5 A;  1NBW A;  3THW B;  1W97 L;  4LF5 K;  5E26 A;  1VBG A;  5EVZ A;  1KTQ A;  3H1V X;  1EXQ A;  4GNI A;  5KTQ A;  3D6R A;  4LH4 A;  3HXM A;  2I1K A;  4L8R B;  3CG7 A;  4JKA A;  4RCH A;  2OZM A;  1OVY A;  2ETJ A;  2GV9 A;  3I0R A;  3SV3 A;  1IV0 A;  1KVC A;  2AA4 A;  4FW2 A;  4FJK A;  3L4Q A;  3CCU N;  2FBX A;  5JIC A;  5GAD P;  4OKE A;  3KD5 E;  2PAV A;  1I39 A;  2VCP A;  1C1A A;  4YOX A;  4KPY A;  2GEL A;  1NGF A;  1REV A;  5BRD A;  5I9E B;  3KLH A;  3BY5 A;  5AQO A;  2NRZ A;  1EWQ A;  5CY4 A;  4BDY A;  1O13 A;  2EX3 A;  1VSM A;  2NLX A;  3LL3 A;  2KHO A;  1BIZ A;  4DR1 K;  4B9U A;  3SQ1 A;  3CD6 N;  3CC7 N;  4RW4 A;  2B6A A;  1H1V A;  2YHA A;  4Z4F A;  2O8F A;  3CET A;  5JS2 A;  2E8A A;  2NRV A;  4H0X B;  3PO4 A;  3WQU A;  3LWM A;  1YIT N;  1VSJ A;  4DQI A;  3PSI A;  1NTI A;  2CQU A;  1DT9 A;  1CZA N;  4WFN L;  4O4G A;  1BUP A;  5M1N A;  5IWA K;  2CH6 A;  4E7H A;  1RBU A;  5JVG L;  4DFP A;  3BUZ B;  3ENO A;  3K9J A;  3WXJ A;  1QQM A;  1Q9Y A;  3CJA A;  1TK8 A;  2A40 A;  1E4F T;  3VEZ A;  1B9D A;  4CF9 A;  2Q1N A;  4OO1 J;  5AQI A;  2P9L B;  4KHU A;  1UOC A;  1ATR A;  1GLE G;  4G1Q A;  4EKU A;  4DV0 K;  1RNH A;  1N5Y A;  1QQO A;  3LAN A;  1KQS M;  4FO0 A;  3D2F A;  4CYE A;  2WON A;  1ZXO A;  3U4L A;  4BE1 A;  2WC9 A;  2FJ9 A;  3BEX A;  5HRO A;  3L3V A;  1OH8 A;  3K57 A;  3CCV N;  3LDS A;  4BGB A;  4IFE A;  1NGG A;  2YHX A;  3F9K A;  3LP1 A;  1T6D A;  1X9S A;  4Z4C A;  3U6F A;  2Q31 A;  3P31 A;  3AVK A;  1IBM K;  2QTD A;  1HMV A;  3M8P A;  3QIC A;  4CER A;  5JLH A;  3RRG A;  4DG1 A;  1X3N A;  3OYK A;  3G9W A;  2O8E B;  4M41 A;  1Q18 A;  5CE3 A;  2YNH A;  3U7D A;  1IJJ A;  1U49 A;  4RW9 A;  1JCG A;  2P9K A;  4FJX A;  1WN7 A;  1XMO K;  3SUP A;  4WCE L;  1EP4 A;  2XRI A;  4YOR A;  3AU5 A;  3ZEU B;  4ZRI A;  3LDL A;  1RBR A;  1ZBU A;  4DTN A;  3SQ0 A;  2P5O A;  1JJ2 M;  1VAZ A;  4M3X A;  5BN8 A;  2WTU A;  3AY9 A;  4KTW A;  1SKS A;  2E20 A;  4K25 A;  4FJN A;  3E9L A;  1K6Y A;  3EE8 A;  4F4K A;  4CF1 A;  4J2E A;  5CHI A;  3IAY A;  1N36 K;  1KAY A;  3QIO A;  3TAP A;  1ASV A;  1S1V A;  2E1Z A;  4FM1 A;  4LF9 K;  4ILJ A;  4DQP A;  1W0H A;  3VN5 A;  3QEX A;  1U48 A;  1JL1 A;  3PUF A;  5C25 A;  2YNG A;  3LAM A;  3QBW A;  3O4W A;  4V19 S;  1DGK N;  1HB8 A;  4F3T A;  3RR8 A;  5JVH L;  4DQQ A;  1S72 N;  4RW8 A;  1NKE A;  4CFD A;  3Q7B A;  5TKY A;  1CXQ A;  3HK2 A;  3OYD A;  2O8D B;  3C6U A;  3CM6 A;  1XHX A;  1H4R A;  3SAF A;  3K5N A;  2CGK A;  3FR0 A;  4EZ6 A;  4IG0 A;  1JL2 A;  2HST A;  3FZK A;  2D1K A;  3EN9 A;  4FJ8 A;  1HYV A;  3ZSY A;  1J5E K;  4RTF D;  1SQK A;  3SAH A;  4GKK K;  2LBB A;  4FLT A;  2F4V K;  3DOK A;  3WNH A;  3TAG A;  1ITG A;  3PIO L;  2KTQ A;  3HZ6 A;  4FWK A;  3HO1 A;  3U3Y A;  3UB5 A;  1XUP O;  2ASP A;  2W6K A;  1KCF A;  4FM0 A;  4JHD A;  2JWK A;  2P9N A;  5AQX A;  1N8R O;  2KZM A;  3KK1 A;  1C0G A;  4FJI A;  4GV6 A;  2OPS A;  1BIU A;  2HE7 A;  3MXM A;  3BP8 A;  2W6L A;  3LAK A;  5M1P A;  1VQP N;  3WEE B;  3WXK A;  4CE9 A;  4YOV A;  4H4M A;  4FVM A;  4Y0W A;  1SL0 A;  1NJX A;  1NK0 A;  4BR7 A;  1ZBS A;  3ID8 A;  3OJS A;  3OYA A;  3VQ7 A;  3C0B A;  3ZT2 A;  3CJB A;  4NXN K;  1VSI A;  2HRJ A;  5HBM A;  3O6W A;  5D3G A;  2VQF K;  5EOY A;  4JK7 A;  1WBB A;  3EEQ A;  1Q9X A;  3VET A;  5I42 A;  2P1J A;  3LDO A;  3ZSO A;  2OA8 A;  2CB8 A;  4MQ3 A;  4BQZ A;  3P83 D;  1ZBF A;  3DLB A;  5T7B A;  3CCL N;  2V51 B;  4ILH A;  2D0C A;  5C15 A;  4CW7 B;  3TAM A;  4DV5 K;  3KD1 E;  1NK4 A;  4AHV A;  3HL8 A;  3TAN A;  1TYQ A;  5ELZ A;  2JLE A;  5CYQ A;  1T6C A;  2FBV A;  4IFY A;  3GE1 A;  1DIK A;  2GX9 A;  2HVI A;  5KGX A;  3TSQ A;  4O0I A;  2OYQ A;  4C1N K;  3D0P A;  4CEQ A;  2VG6 A;  2HBJ A;  1NK6 A;  3QML A;  4PHT X;  4AHC A;  3K9K A;  4LFB K;  4GW6 A;  4B1Y B;  3J81 O;  3K5M A;  3O3H A;  2Q97 A;  1S3X A;  4Z4H A;  2AL6 A;  3AO5 A;  3UKR B;  4F2S A;  3ZX2 A;  1NU0 A;  3KWI A;  4ICL A;  4LFA K;  1FW6 A;  1NVL A;  4C8O A;  3HOT A;  2QWQ A;  1BQN A;  1SL1 A;  3ZET A;  2NRT A;  1RTI A;  4CJL A;  4JD2 B;  1I94 K;  4AHR A;  4IEE A;  4B3R K;  1MA9 B;  3U9D A;  1VBH A;  3C6A A;  4HUG A;  3P39 A;  3ID6 A;  5AQM A;  3RMD A;  2HHX A;  4OPH A;  1I3A A;  2YJE A;  4ZRK A;  4JN4 A;  1MU2 A;  3GG4 A;  2QW9 A;  4X62 K;  1IBK K;  4OX9 K;  4O5F A;  4K41 A;  1XI1 A;  1X9J A;  2XHB A;  2YKM A;  3VQ9 A;  3AA5 X;  4FL9 A;  3MX2 A;  3R8E A;  3OYF A;  4JI0 K;  2XY8 A;  3TSP A;  3NF9 A;  3UKU B;  4WE1 A;  1VQO N;  3ZT3 A;  1VK0 A;  4A62 A;  4AF1 A;  4DKW A;  3L8B A;  4M3Z A;  4B3M K;  2VWB A;  3QNN A;  3VTI A;  4E1J A;  2YNF A;  3U9Z A;  3EPY A;  3IS9 A;  3H46 O;  2F9W A;  3DWL A;  2G8H A;  2ATQ A;  3N4P A;  1YJN N;  5AJ3 K;  1OH6 A;  2XO7 A;  5KQ8 A;  1HKC A;  1C1C A;  4DU4 A;  4K42 A;  4DLG A;  2DFE A;  5HP1 A;  1S22 A;  2D0A A;  2W40 A;  4JK9 A;  3RTV A;  3VOV A;  5AQW A;  2FDQ A;  3K5O A;  3OS2 A;  2EMS A;  5C24 A;  4BR0 A;  1NGJ A;  4DUZ K;  2KW4 A;  2ITG A;  3OTO K;  3DLL L;  3ISN C;  4K43 A;  1JLA A;  2Q2R A;  1RCH A;  3B6P A;  1VQM N;  1BDG A;  2QM1 A;  1EX4 A;  3HYF A;  4CEC A;  3DI6 A;  3HPH A;  3BZC A;  2OCE A;  4JV5 K;  4XH4 A;  2I5J A;  4BRE A;  3WA0 A;  4I2P A;  4KHN A;  1K9M O;  4JEP A;  5BPL A;  1GLD G;  1YJ9 N;  2NRW A;  3MN9 A;  3SPY A;  3AAP A;  4N41 A;  1Y64 A;  3O9R A;  1WAJ A;  2NRX A;  1JLQ A;  2HHT A;  2FSJ A;  3KVG A;  2F7T A;  4DHY A;  3C7N A;  3VF2 A;  2D11 A;  3SUO A;  4YL8 A;  4B9N A;  1SZ2 A;  4CJR A;  3WT0 A;  3NH2 A;  1VQ4 N;  1ZBL A;  2FF6 A;  3TTD A;  4BR2 A;  4OJR A;  3AO4 A;  4H4O A;  3O80 A;  5AZJ A;  4U7B A;  4DS4 A;  3F2K A;  5KQD A;  3OYE A;  4J8F A;  4HHT A;  1HR0 K;  2UUB K;  1U6Z A;  1QQN A;  2IDO A;  4GV9 A;  2I1J A;  1NJI O;  4FWQ A;  4HDQ A;  3AVC A;  4CHY A;  2QKB A;  3LPU A;  4CJP A;  3SJH A;  4FXD A;  1Z6R A;  4C8M A;  4CK1 A;  4RG8 A;  1KVA A;  1HPZ A;  3ZX0 A;  4X66 K;  1XQS C;  3OBW A;  1C0M A;  2HF3 A;  3H45 C;  4BDZ A;  4LF8 K;  2X74 A;  1TAU A;  1EQY A;  3RRH A;  2A42 A;  2KFN A;  1V4S A;  3TU5 A;  3ULD A;  4JS5 A;  1ZYQ A;  4QCL A;  4Q5V A;  2V52 B;  4WFB L;  4JYA K;  4ZTF A;  3EE9 A;  1NI2 A;  3H08 A;  3SBT A;  4ID1 A;  4HUF A;  4AIL C;  3CF5 L;  5JVL A;  4IDH A;  1HUX A;  5DMR A;  3HJF A;  5AQG A;  4W5O A;  1GOA A;  2DFH A;  3R1X A;  3SUQ A;  4CGJ A;  2O8B B;  1N33 K;  4IFV A;  1UAX A;  2YNI A;  4FVU A;  4IOX A;  4BRI A;  4XIU A;  4IXC A;  5HRP A;  1WB9 A;  4CEE A;  4HUE A;  1C0U A;  3IG1 A;  1Z05 A;  2UXD K;  2OPP A;  5M1Q A;  5HL7 L;  4DSF A;  1K8A O;  4CIG A;  4DV4 K;  4DSK A;  2FBY A;  5FDL A;  4DFM A;  3WNE A;  4CZG A;  4OPJ A;  1T3V A;  1TKX A;  3L2U A;  3E9O A;  1BO5 O;  2ZGZ A;  3W0L A;  4NCA A;  2VWJ A;  3MAQ A;  3NCI A;  4FOE A;  5HLF A;  1TKD A;  1W9H A;  1E4G T;  3FP5 A;  4BRF A;  4JI2 K;  4YHH K;  1OKJ A;  3VQA A;  4FZZ A;  1KD1 O;  1JLB A;  2I7P A;  1EKE A;  2IVO A;  1K8K B;  2HNY A; 
#chains in the Genus database with same CATH homology
 3KZB A;  2OTJ N;  5ADX A;  3MCP A;  1BU6 O;  2ITM A;  1X3N A;  4U67 L;  2WUS A;  3VPZ A;  4BGA A;  1MDU B;  3G9W A;  3HSC A;  3VGL A;  4TKN A;  2IVN A;  1Q18 A;  5CE3 A;  3U7D A;  1IJJ A;  2R82 A;  1JCG A;  3VEY A;  2P9K A;  1YJW N;  4JK8 A;  3WXL A;  4H0T B;  1GG3 A;  4YOT A;  3CMA N;  2AP1 A;  4A59 A;  3VF4 A;  4WCE L;  5DM7 L;  3TSU A;  4YOR A;  3AU5 A;  3L4I A;  2NNW A;  3ZEU B;  4ZRI A;  2ZGY A;  3LDL A;  5AZI B;  3WUH A;  2ZJQ L;  3NVK A;  4G9Z A;  4JKC A;  3U8Z A;  3FGU A;  5C12 A;  1VQK N;  3CQX A;  1NGE A;  4BR5 A;  5ADX H;  1JJ2 M;  1VAZ A;  5BN8 A;  3RVC A;  3CJC A;  3AGR A;  3AY9 A;  5KPT A;  4A57 A;  1TUY A;  4IJA A;  3OBY A;  3CCE N;  2E20 A;  3QFU A;  4MO5 A;  3HI0 A;  4FOI A;  2A6A A;  4IJN A;  1GLB G;  2E2N A;  4IO8 A;  4K25 A;  3M6G A;  3E9L A;  3WXI A;  3M5R A;  3P4I A;  4QS7 A;  5FPN A;  4OPA A;  4JKE A;  3EE8 A;  4PKH A;  5CHI A;  4BVO A;  2D2Q A;  1Q86 O;  1KAY A;  3L0Q A;  4H0O A;  4BRL A;  1NLV A;  2P9S B;  5E84 A;  4FWO A;  3MWT A;  3VEO A;  2E1Z A;  3EKU A;  3CHW A;  3MN7 A;  5FPE A;  3D2E A;  4ILJ A;  3FZF A;  2AEH A;  4HDO A;  1BA1 A;  4JKB A;  5AQS A;  1MWK A;  1ISN A;  4CZH A;  2J0K A;  3CQY A;  5AQU A;  1VQL N;  1Y19 B;  1BWF O;  3DJC A;  3ENB A;  3ZET B;  3QBW A;  3DAW A;  3O4W A;  1DGK N;  1HB8 A;  4BY9 C;  1MK9 B;  2DPN A;  4M63 C;  4B1U B;  5JVH L;  1NGI A;  1WOQ A;  1S72 N;  1KXP A;  3CC2 N;  5TKW A;  3CPW M;  4UY8 O;  3VEX A;  4QS8 A;  2RE2 A;  3J7Z O;  3Q7B A;  4JKF A;  1D4X A;  3H1Q A;  3H3N O;  4WQ5 C;  1GC7 A;  5TKY A;  3CC4 N;  3DXM A;  4EHU A;  3MX5 A;  4GVE A;  1K73 O;  1H4R A;  1HPM A;  3SBG A;  3GBT A;  3SAF A;  2FSK A;  2A3Z A;  2CGK A;  3AGK A;  3FR0 A;  4WQ4 A;  1Q82 O;  1M90 O;  2HST A;  3FZK A;  2PBD A;  2D1K A;  3EN9 A;  1YHQ N;  3AAR A;  2P9U B;  1KC7 A;  4CZL A;  3I33 A;  3O9T A;  4RTF D;  3RSE B;  4MDA A;  1SQK A;  3SAH A;  2GWK A;  2P9L A;  2LBB A;  4MO4 A;  3R3L A;  4EFH A;  2QA4 N;  3C6H A;  2J0M A;  3PIO L;  3HZ6 A;  2FXU A;  4JKD A;  1RDW X;  4FWK A;  1VQ9 N;  2COP A;  1XC3 A;  3UB5 A;  1XUP O;  3G25 A;  2ASP A;  3LM2 A;  1NGD A;  4BQL A;  2BTF A;  4JHD A;  2JWK A;  2P9N A;  5AQX A;  3SMP A;  1N8R O;  1QZ5 A;  2QWR A;  1SS6 A;  3HTV A;  5AQR A;  4BRQ A;  1C0G A;  4CZI A;  1VQ7 N;  3PLA A;  4GV6 A;  2OAN A;  5AQZ A;  2HE7 A;  1BOT O;  2QWL A;  3O1B A;  3ULE B;  4B1W B;  3OW2 M;  1VQ4 N;  3BP8 A;  5GIN A;  3G6E N;  3FZL A;  1GGO A;  3CPE A;  2V7Z A;  4CBW A;  5M1P A;  1VQP N;  3WEE B;  3ATV A;  3WXK A;  4CD3 A;  4Y0W A;  4YOV A;  1YI2 N;  2H3G X;  4BR7 A;  4KBO A;  4A2A A;  1ZBS A;  3ID8 A;  1K8K A;  3C0B A;  2WH5 A;  2NRH A;  1DEJ A;  2J4R A;  2YCH A;  3CJB A;  3MMV A;  3A5O C;  1GLA G;  4IEI A;  2HRJ A;  1C0F A;  2P9P B;  5F2R A;  3O6W A;  1NGC A;  5AFU H;  3MK6 A;  2NZT A;  4H0V B;  5M1K A;  3LDP A;  5EOY A;  2HBL A;  3WQT A;  4JKH A;  4JK7 A;  1P90 A;  3O9Q A;  3QBX A;  3VET A;  1M1K O;  3Q7C A;  2RHK A;  5LJV A;  3LDO A;  1KBL A;  3WXM B;  4FPB A;  1SAZ A;  4NO7 A;  4YDU C;  2CB8 A;  3SK3 A;  4BC4 A;  4BQZ A;  2BH1 A;  2YHY A;  1VQ5 N;  3CCL N;  1V4T A;  4ILH A;  2IVP A;  2V51 B;  3NMU A;  3O08 A;  5C15 A;  2ZJR L;  4BRG A;  3JS6 A;  1HKG A;  3PVL A;  4GV3 A;  1X3M A;  1QVF M;  4BRA A;  4YOU A;  3FLV A;  3VGM A;  4FWL A;  3GDQ A;  1HB6 A;  1BG3 A;  2QXL A;  4H03 B;  1LCU A;  3EL2 A;  4IOA L;  2VGM A;  1TYQ A;  5ELZ A;  2HBK A;  3SMS A;  5JMV A;  3O5B A;  3FLC O;  1HX1 A;  1RGI A;  1T6C A;  4M7X A;  4F7G A;  1HLU A;  3CCJ N;  5GIP A;  3GE1 A;  1DIK A;  2GX9 A;  3TSQ A;  2HMP A;  3E1Y A;  4C1N K;  2ZJP L;  2CGJ A;  1GLF O;  3DXK B;  2HBJ A;  1GC6 A;  1U2V B;  3QML A;  4PHT X;  3K9K A;  5H1S Q;  4BG9 A;  4B1Y B;  4CBX A;  3I55 N;  4A5B A;  2P9S A;  4WF9 L;  4ISF A;  3FFK B;  1MIZ B;  4CZM A;  1YXQ A;  3A8Y A;  2YI1 A;  3PZD A;  1DKG D;  2Q97 A;  1S3X A;  3C7N B;  3CI5 A;  4FWR A;  2AL6 A;  5EX5 A;  4BC5 A;  4CBU A;  4LC9 B;  4GY2 B;  2CH5 A;  2Q36 A;  3UKR B;  3J8A A;  3ZX2 A;  3MWP A;  4A61 A;  3MN6 A;  3KWI A;  5EY4 A;  3VER A;  1NVL A;  2E88 A;  4JNE A;  4MLH A;  4YOW A;  2QWQ A;  3HOS A;  4MLE A;  3HOT A;  5LJW A;  1EF1 A;  2QWP A;  2QWM A;  3ZET A;  4L3Q A;  4BVP A;  2NRT A;  2QWO A;  3CJ9 A;  5AZJ B;  1ST7 A;  2D10 A;  3T69 A;  4DXA B;  4JD2 B;  4WQ5 A;  3TTF A;  3ZDT A;  2F9T A;  1RDU A;  3KK7 A;  4KH5 A;  2E2Q A;  4MDB A;  1ATS A;  3IMX A;  4IEE A;  1MA9 B;  3IFR A;  1VBH A;  3C6A A;  3U9D A;  1GLJ O;  4B1Z A;  4B1V A;  2W41 A;  3P39 A;  3ID6 A;  5AQM A;  4CD1 A;  1QZ6 A;  4IO9 L;  4CI6 A;  5DM6 L;  1TUU A;  4I6M B;  4OPH A;  2YJE A;  4QS9 A;  4ZRK A;  5AQH A;  3S41 A;  4FWN A;  4JN4 A;  2QI2 A;  1R59 O;  3GG4 A;  2QW9 A;  1NM1 A;  4H5V A;  5KPZ A;  2P9U A;  2DIK A;  4CZF A;  4AM6 A;  5BRF A;  5F0X A;  5GAH P;  1KAX A;  1MIX A;  4O5F A;  3CCQ N;  4K41 A;  3RSE A;  3F5T A;  3SAG A;  3EZW A;  1X9J A;  3H3O B;  5BR9 A;  1HBK A;  4FL9 A;  1LOT B;  2RQ1 A;  3ATU A;  3MX2 A;  2VYP A;  3R8E A;  1GLL O;  3TSP A;  3O9U A;  4BRK A;  2EMT A;  2QWN A;  4H5T A;  4BRD A;  3UKU B;  4WYB A;  4BRO A;  4XH5 A;  2EWS A;  1VQO N;  5FPM A;  4CZJ A;  3G71 N;  4KH6 A;  2GWJ A;  2WFB A;  4A62 A;  4AF1 A;  1QHA A;  4BC3 A;  4NY0 A;  4DKW A;  3M3Z A;  2VWB A;  5AFU A;  4H0P A;  3C65 A;  4PL7 A;  3N4Q A;  3VTI A;  4E1J A;  2KLA A;  1YVN A;  3ULE A;  5C10 A;  3CER A;  3U9Z A;  3IVF A;  3UE5 A;  1NWK A;  5AQL A;  3EPY A;  5C2D A;  3H46 O;  2F9W A;  3DWL A;  4IZ9 A;  4XH1 A;  1G99 A;  3N4P A;  1YJN N;  4XEI A;  1JCF A;  3A5M C;  1ESV A;  3WEE A;  4NB4 A;  1YAG A;  1ILY A;  1WUA A;  4FWS A;  4CZK A;  5KQ8 A;  1HKC A;  5M1O A;  2A5X A;  4K42 A;  3VMF B;  4P7I A;  1S22 A;  2V7Y A;  2ZWH A;  5GAE P;  2P9P A;  5GAG P;  3IKM A;  4C1N I;  2HF4 A;  2W40 A;  4BRN A;  4JK9 A;  1MWM A;  3VOV A;  4H5R A;  3KWG A;  5AQW A;  2FDQ A;  3ENH A;  2EMS A;  4BR0 A;  1NGJ A;  1QVG M;  2A41 A;  3CME N;  3MDQ A;  1P8Z A;  4YDU A;  3JXU A;  4ILG B;  1ACA A;  5C0Y A;  3DLL L;  3IUC A;  4JKG B;  1ZC6 A;  3D2F B;  3LDQ A;  4H0Y B;  4K43 A;  2Q2R A;  1NGB A;  3CJ1 A;  4H5N A;  2P9I B;  5AQJ A;  1BDG A;  2QM1 A;  5AR0 A;  4DB3 A;  5C2F A;  4ZRJ A;  1YIJ N;  4JAX A;  5LY3 A;  3CCM N;  1J6Z A;  3O9S A;  3OHR A;  3SLC A;  3BIN A;  3A5N C;  5AQT A;  2ABD A;  3O8M A;  5AZI A;  3ZEU A;  3R9P A;  3HM8 A;  2UYT A;  4KH4 A;  3VEW A;  4XH4 A;  3CCR N;  2GUP A;  3WA0 A;  4BRE A;  3L6Q A;  1K9M O;  2HBM A;  3FZM A;  4PKI A;  3H6E A;  3ZX3 A;  2WBN A;  3ZYY X;  1HJO A;  4JEP A;  4FWP A;  4HTL A;  4C23 A;  3BF3 A;  5BPL A;  3VES A;  1GLD G;  4ISG A;  3CXC M;  2E2P A;  3DXK A;  1YJ9 N;  2NRW A;  2PFU A;  2GEM A;  3CIP A;  3MN9 A;  3TTC A;  3AAP A;  1U2V A;  2X0S A;  1Y64 A;  4BC2 A;  4WFA L;  1VQ6 N;  3LM9 A;  3FZH A;  3O9R A;  2NRX A;  4CJ7 A;  2I7N A;  4FWM A;  3QIJ A;  3VGK A;  3I8B A;  4AM7 A;  3U8X A;  2FSJ A;  5BPM A;  3OA9 A;  3KVG A;  1ATN A;  4O8K A;  2F7T A;  5AQY A;  2P9K B;  4DHY A;  3C7N A;  3VF2 A;  3D7E O;  4O8U A;  1Q7Y O;  2E2O A;  2IIR A;  2D11 A;  1NGH A;  3BF1 A;  3UKR A;  5BRH A;  3E66 A;  3GL1 A;  1Q81 O;  4YL8 A;  1NBW A;  3QB0 A;  3GOI A;  1SZ2 A;  1W97 L;  4ISE A;  1EO1 A;  5E26 A;  1VBG A;  5EVZ A;  3QFP A;  3WT0 A;  3H1V X;  3A0I X;  2FF6 A;  3TTD A;  4BR4 A;  1TYQ B;  2ASO A;  2YX6 A;  4GNI A;  3D6R A;  5AQN A;  3A5L C;  4BR2 A;  4R79 A;  2D4W A;  3MN5 A;  3O80 A;  2JWL A;  5AZJ A;  2FLO A;  3F2K A;  4U7B A;  2NRR A;  5KQD A;  4BG8 A;  4F9O A;  2I1K A;  3PIP L;  5BN9 A;  4IWV A;  3LDN A;  4JD2 A;  4J8F A;  4JKA A;  4RCH A;  2BUP A;  5BRE A;  1SGH A;  1OVY A;  2YHW A;  3VF6 A;  1U6Z A;  1QQN A;  5IJM A;  4GV9 A;  2AA4 A;  2ZF5 O;  2I1J A;  3L4Q A;  3CCU N;  1NJI O;  4FWQ A;  5JIC A;  5GAD P;  3VEN A;  4HDQ A;  4I6M A;  1JDE A;  2PAV A;  2VCP A;  2Q0R A;  5B8H A;  4BRH A;  3F9M A;  3AAQ A;  4YOX A;  1VQN N;  2GEL A;  1NGF A;  3SJH A;  1J19 A;  3E9P A;  2D0O A;  4A5A A;  1VQ8 N;  1Z6R A;  3W3D A;  5BRD A;  5I9E B;  1HKB A;  3VTH A;  5AQO A;  3ZX0 A;  2D0P A;  3CJ7 A;  4H5W A;  5F1X A;  2ASM A;  1IG8 A;  1XQS C;  2NRZ A;  1BA0 A;  2HF3 A;  3D2E B;  3OBW A;  5EXW A;  1O13 A;  3H45 C;  3G4S N;  5KPR A;  1W2B M;  2NLX A;  3LL3 A;  4DCH A;  1RFQ A;  5AQQ A;  2KHO A;  1EQY A;  4DQ8 A;  3UKU A;  3P38 A;  3NVM A;  4BRM A;  3MCA B;  2A42 A;  3CD6 N;  1V4S A;  5AQF A;  3TU5 A;  2FSN A;  1NGA A;  3B8A X;  4A2B A;  3CC7 N;  1H1V A;  4YOY A;  1JCE A;  4FPA A;  1VQM N;  2V52 B;  3CET A;  5AQV A;  4WFB L;  2E8A A;  2NRV A;  4H0X B;  3KHY A;  3EE9 A;  1NI2 A;  3T7Z A;  3WQU A;  1YIT N;  3SBT A;  3X23 A;  3CF5 L;  1NTI A;  4RWT A;  5JVL A;  2CQU A;  1DT9 A;  4IDH A;  3DXM B;  1KC8 O;  1HUX A;  1CZA N;  4WFN L;  3EO3 A;  1KAZ A;  5AQG A;  1BUP A;  5M1N A;  2CH6 A;  4CZE A;  5MLC Q;  3R1X A;  2OTL N;  5JVG L;  2GTD A;  2YJF A;  3VEV A;  3BUZ B;  3ENO A;  3HBT A;  3K9J A;  3WXJ A;  2KKZ A;  4B1X B;  1YF5 L;  1QQM A;  3AU4 A;  2FF3 B;  3CJA A;  4WQ4 C;  4FVU A;  2A40 A;  4IOX A;  1E4F T;  3VEZ A;  1T44 A;  4BRI A;  5AQP A;  4IXC A;  2Q1N A;  4OO1 J;  3IDH A;  5AQI A;  2E1Y A;  2P9L B;  4EAH D;  4EHT A;  4NLB A;  1ATR A;  1GLE G;  1GLC G;  1Z05 A;  3FE1 A;  5M1Q A;  5HOO A;  5HL7 L;  4EKU A;  1K8A O;  2Q0U A;  3CCS N;  1QQO A;  4JKG A;  2J0J A;  3HRG A;  3O1W A;  1KQS M;  4GXB A;  4CZG A;  4FO0 A;  3D2F A;  4BR9 A;  1T3V A;  4CYE A;  5FPD A;  2YVC A;  2ZPY A;  1ZXO A;  2P9I A;  2WC9 A;  4JHD B;  3U4L A;  2FJ9 A;  4B9Q A;  3E9O A;  2P9N B;  1BO5 O;  5AQK A;  4HWI A;  3BEX A;  2ZGZ A;  3W0L A;  5GIO A;  5JLF A;  3EKS A;  5BPN A;  5CR4 A;  4BRP A;  4FOE A;  4NLC A;  3CCV N;  1MK7 B;  4Z94 A;  3TPQ A;  3M1F A;  4EIA A;  4BGB A;  2VGN A;  1E4G T;  1E5W A;  3FP5 A;  1NGG A;  3QDK A;  3R6M A;  4IFE A;  4PKG A;  2YHX A;  4FSV A;  2HOE A;  4BRF A;  5M1F A;  1OKJ A;  1T6D A;  2QEX N;  2Q31 A;  3P31 A;  4M7Y A;  4BRC A;  2I7P A;  1NMD A;  3I56 N;  2QTD A;  1KD1 O;  4PL8 A;  3QIC A;  4IOC L;  2IVO A;  1YUW A;  1K8K B;  5JLH A;  2CGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...