4JK9A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound co ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
219
Chain Sequence
LFSQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 67
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk9A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk9A01
4ILGB 4JKGA 4JK9A 4JK8A 3SBGA 4JKDA 4JK7A 3E66A 4JKCA 3E9LA 3E9OA 4JKGB 4ILHA 4JKHA 4JKEA 3SBTA 4JKAA 4ILJA 3ENBA 4JKBA 4JKFA 3E9PA
chains in the Genus database with same CATH superfamily
1VSIA 3ZX2A 1WBDA 4G9ZA 5LL6Z 2KTQA 5JVHL 1DT9A 2G8HA 1XQSC 4M3ZA 1N34K 3OYGA 1P8ZA 2GV9A 5GAGP 4FLXA 5J2PA 4CHNA 4GV3A 4B08A 1JXEA 1NGHA 4B8AB 1SKWA 3CJAA 1MIZB 2A1RA 4FZXC 4CD3A 1NNEA 4BRFA 2D5RA 1U49A 1YIJN 3OYBA 3TAQA 2ITGA 4DTXA 3EKUA 1OH6A 1S1TA 3G71N 1GOBA 1XWLA 5AQVA 2EWSA 4JK8A 2EX3A 2AL6A 5AQPA 3FLCO 3ZETA 4CF8A 3S3NA 3EO3A 4F8RA 3P39A 4BR4A 4M42A 3AU5A 2Q0RA 4FLUA 4M41A 3UE5A 5CZ2A 1NK6A 4K8XA 4KHYA 2YNGA 3HTVA 3MMVA 3PZDA 1VSDA 1RDAA 3MAQA 2KHOA 1NGAA 3U4LA 3UIQA 1RT4A 3WXKA 3TAGA 3DXKB 4JAXA 4A5AA 3WXJA 4DWIA 4GKKK 1A5WA 2IS3A 3ZSWA 4XH4A 4EP4A 3SQ2A 4WFNL 1YVNA 2R82A 3LP3A 3O3HA 4FL9A 3LDOA 3D2FB 3O6WA 4LFCK 4OKEA 4ISFA 3TWHA 2F8TA 2UUCK 2E2QA 1ATSA 3IAYA 4MQ3A 1HB6A 4DQPA 3HSCA 1NGBA 4BRKA 3NH1A 2BH1A 3DXMA 1D9FA 3U8XA 3M3ZA 3MEDA 4C8KA 1RBSA 4BRIA 3EZ5A 4KBOA 4OPAA 1M90O 4DV6K 3HSTB 3CERA 1SS6A 1TUUA 3KWIA 1OVYA 4DV7K 1SKRA 3CXCM 2ASMA 4FLYA 4GKJK 4W5OA 4CECA 3GDQA 3GG4A 2OPPA 5FDLA 4FWPA 5BPNA 4CHQA 4HDQA 4CHYA 3KKRA 2JWLA 3TAEA 2Q3SA 1ASUA 4FWOA 2OCEA 1LOTB 3HPHA 4K42A 1LAVA 3ZCMA 5IT9O 2QWOA 5JVLA 4B3SK 4FWQA 4ISGA 1OH5A 3EZWA 4CHZA 4YOVA 1MDUB 4CF9A 3F9MA 1W97L 3PX4A 4YDUC 2RHKA 3QEVA 4HUGA 4FJXA 4DUYK 4CBUA 4LF7K 4F2SA 4PL8A 4CJEA 4GMJB 1W9HA 3PO4A 4RW9A 3WXLA 2FBTA 5GINA 3K5MA 1JL1A 1BA0A 2HVHA 2HE7A 1SL2A 3QBWA 1TKZA 2O8EB 4JK9A 1WUAA 4DB3A 4GW6A 4RW7A 4A57A 4OGCA 3NH2A 4C8MA 3QNOA 3MEEA 2FBYA 2ZWHA 3QEIA 4Y0WA 2LBBA 1TAUA 1Q82O 3NHGA 4JEPA 1YITN 3S3MA 2P9IA 3QLHA 4O55A 2ASPA 4R79A 1NGEA 3QIOA 4CJUA 4CZGA 4PKGA 1KFSA 4FLZA 4ICLA 2ZJQL 5AR0A 5AJ3K 3PSFA 4X64K 1VSJA 4WFBL 3AA5X 3OW2M 3SCXA 1C0FA 1VQKN 2F9WA 3DOKA 1KLMA 5M1NA 4IBNA 5CHIA 4WQ5C 1ZBUA 3DM2A 3CCJN 5FROA 1ITGA 1YI2N 5HBMA 5AQKA 1MA9B 1U2VB 2IDOA 5GIOA 4NXMK 2FSJA 4IFVA 1IH7A 3AVJA 5AZJB 4YHHK 3NF9A 1LWCA 3IG1A 3KZBA 1Q9XA 1KCFA 4BWJA 3CJ1A 2KKZA 1O13A 1Y19B 4H4MA 2OPQA 2A42A 3AVFA 4OGEA 1EX4A 5M1PA 5JMVA 3H1QA 2I7PA 3SAFA 3KWGA 3ZSYA 4E7JA 4O44A 2GBZA 2YKMA 5CZ1A 1QQNA 3T69A 3VERA 3D2EB 2RKIA 1NGFA 3R1XA 1SAZA 2YHAA 3VOVA 2G8UA 1NMDA 3EL2A 2I1KA 4DV0K 4B8CA 1VQ5N 1RCHA 2GUIA 3VQ7A 4LSNA 1X3MA 1J9AA 3L2QA 1NJXA 3L2WA 4FWKA 4CZIA 5AFUH 4EKUA 4QCLA 3OTOK 2YKNA 4FCYA 3GE1A 1Z25A 1HMVA 2HHSA 3HL8A 1ILYA 4CGIA 3KD5E 1GGOA 3SBTA 3SQ0A 4E1MA 2WH5A 1NK4A 1E3MA 4DU4A 4FJLA 4CEQA 1Q81O 4JKBA 4JI2K 3VMFB 4CHOA 3RMAA 1VAZA 2JLEA 4RW4A 3MN9A 3SMPA 4A62A 3NDKA 1K8AO 1LWEA 4FWSA 2KZZA 1T6DA 4KB1A 3T19A 3DOLA 3VA3A 3PIOL 1D9DA 1IKYA 2RPIA 2QWPA 1H4RA 2HBKA 3VQ6A 4O0JA 3O3GA 1RDWX 1B9FA 3AAPA 3S3OA 4KPYA 3HM8A 4AH9A 1IKVA 2I5JA 3RMCA 4P7IA 3AGRA 1HNIA 3AO2A 1VQ4N 5AQQA 4XIUA 1L3VA 3VF4A 4E7KA 4AHUA 1VHXA 3AVBA 3I0SA 5AQOA 4OO1J 3ATVA 4QS8A 3QERA 3J7AP 5C2FA 3O9TA 4H0TB 2P9SB 2AP1A 1XNRK 3WNHA 1C1CA 5GAHP 3OA9A 3OS2A 2QK9A 3MWPA 1QSLA 3E01A 2JGUA 5C15A 4LSLA 4LF9K 5CYMA 5M1KA 4CD1A 4CGHA 4DFKA 3L2VA 4CJSA 2KFNA 3EPYA 3CIPA 2QWRA 4BREA 3VEZA 2BUPA 3QESA 4GV6A 3W3DA 4BR7A 5FPMA 1EP4A 3I33A 1MWMA 5EX5A 1ATRA 4WCEL 4QS7A 1DEJA 1HNVA 3AA4A 4MLEA 2HBLA 1TL3A 2PY5A 3A5NC 3FP5A 4B3OA 2ZE2A 4YNQA 4H03B 4IZ9A 4EFHA 5BN8A 2D10A 3D45A 2HB5A 3QINA 3FLVA 4FK2A 2QWMA 1DTQA 5K14A 1NGCA 2ATQA 2QXLA 2GTDA 3HVRA 2F96A 4DR5K 1JJ2M 1U45A 1DGKN 2W40A 2D1KA 3RVCA 3T7ZA 4ZTJA 3THXB 3IVFA 5EXWA 1REVA 1MK9B 3O9UA 4CCHA 4BRAA 1EKEA 3ZEUA 3MCAB 2VYPA 4NLBA 1NOYA 4HCCA 2CGKA 4W5QA 4FW2A 3G9WA 1KVCA 2R7YA 1VSMA 4DV1K 2HMIA 2BTFA 3ASMA 1QTMA 1FKOA 1UA0A 1B92A 2LSNA 4K43A 1JLQA 4EZ6A 2DTUA 3M8RA 4DSFA 1XHXA 4ID5A 2QA4N 3E66A 3NAEA 4M3YA 3PX6A 1CXQA 2GX9A 2V7ZA 2IIRA 4N76A 1WN7A 2Q97A 3LANA 3CJBA 3C6AA 3V4IA 3S41A 2FBVA 2BE2A 4IG3A 2XY6A 4Z4EA 3VQ9A 2Y1IA 1YHQN 1C0GA 4M7YA 4CI6A 4BGBA 4GXBA 3HVTA 4BRMA 4FJ9A 3B6PA 4JHDB 3F73A 3WQTA 3MXIA 5BRHA 3AVNA 2EMSA 4CESA 3SK3A 3A5OC 4O4GA 3RR7A 1U47A 3MN5A 1Z05A 4DV4K 1JLBA 3J7ZO 3EE8A 4FPAA 2AJQA 1G99A 1S1VA 4KFBA 3O4NA 4KHWA 1TUYA 2COPA 1XMOK 1VQ6N 1GG3A 4DFJA 2YNHA 3U3GA 2Q31A 4KHPK 3OHRA 1Z26A 4CK3A 1SL1A 1N36K 2KQ2A 2XY8A 3CQXA 4H0XB 4PA1A 2ZM6K 1NBWA 2HF3A 4CK1A 2UXBK 4PKHA 4FWMA 2E88A 1N6QA 1VQ8N 1K8KB 4BY9C 2W41A 3DAWA 3O1WA 1BCOA 3KTQA 3CHWA 2P9PA 2HSTA 4B1WB 1BG3A 1BHLA 3TI0A 2XHBA 1NG9A 4JI7K 3C0BA 3P31A 3C7NA 4HWIA 3WEEB 1KVAA 1BI4A 5EY4A 2ZJPL 2E8AA 1BOTO 1ZXOA 4N5SA 3QEWA 5GADP 4OJRA 4JI3K 3BUZB 4X65K 3V6DA 3IRXA 3PUFA 4B1XB 3CCSN 4AILC 3R9PA 4JRPA 2XRIA 4LH5A 3QETA 3P5JA 5DM6L 4YOWA 3ZLJA 3X23A 1SKSA 2ZGZA 4H5WA 3K5NA 1L3SA 4B9LA 2HHQA 3AVLA 3CPEA 1RILA 2J4RA 4M63C 4BG8A 1C1BA 4BE0A 3AAQA 1MU2A 2P5OA 4XH5A 4FVUA 2V51B 1SQKA 3DLLL 3NF8A 3NBPA 1ZBHA 2P9KB 3OYEA 4CJ5A 1GLLO 4KRFA 4BRQA 4DTRA 1L3UA 3RSEB 4DSIA 1RTIA 3L6QA 4WFAL 4CEDA 1CLQA 5F2RA 2O8DA 4C1NI 4AQYK 5A2QO 1VQPN 3L4IA 4FO0A 3TU5A 3LAKA 1RBVA 3OYKA 4CE9A 1GLAG 1BA1A 4BC4A 4CJ7A 1EWRA 4PL7A 3FGUA 1Q7YO 4E0DA 2ZJRL 1JLGA 2WOMA 1NK0A 4DQIA 4DTNA 1YJWN 4KHUA 3HT3A 2YHYA 1X9WA 1HX1A 1HYSA 3J81O 2V7YA 4HTLA 3THVA 2DY4A 1NTIA 1JCGA 3HBTA 3WT0A 1QS4A 1BGXT 3ZX0A 2AA4A 3U3YA 1S9EA 5CR4A 3NCIA 1TAQA 1WB9A 3MK6A 3BGRA 4QAGA 3RRGA 5FRMA 4AF1A 3V9UA 3AVIA 4B3MK 1VSFA 3ZSRA 4CJRA 4FJKA 3AVHA 2YVCA 3TSPA 2E6MA 1NOZA 4I6MA 1WOQA 3SMSA 3ULEA 3MCPA 1VQNN 2A3ZA 3SJJA 3A5LC 4IEIA 4AM6A 1S5JA 1NJYA 3OJSA 4BR5A 3MXMA 1HNZK 3ISNC 4DR4K 2PYJA 2ABDA 4E7IA 4V19S 1QSYA 4YOTA 3K58A 5M1QA 4Z4IA 2QWNA 1GLFO 3LWMA 1ATNA 2NLXA 3G25A 1NJIO 4JI5K 1BWFO 2VG6A 4E3SA 1V4TA 4CJQA 3HJFA 1NMNA 2D0CA 1S3XA 3OYJA 3DLRA 4N41A 4A59A 3FZFA 3ZT1A 4FVMA 1NM1A 3THYA 4YORA 3THWA 3F2KA 3UKRA 1VK0A 4JKDA 1RTJA 4H5RA 2XO7A 1U6ZA 3FZMA 3M8QA 3MXJA 4LH4A 4RTFD 2P9NA 2OPSA 3ITHA 3AY9A 1CZAN 2P9LA 4DS5A 1U4BA 2B6AA 1KQSM 4FLTA 3GOIA 1ISNA 2E2NA 1HPZA 3HO1A 3DXMB 3VQDA 1RFQA 4MDAA 1NGJA 2RF2A 3AVCA 2HF4A 2X74A 4CJVA 3VGMA 5IJMA 3CPWM 4FM1A 2YJFA 4CJTA 2VCPA 4B9MA 4CZLA 3F5TA 4FJJA 3I0RA 3VN5A 2CGLA 3KK2A 1IBLK 4FJHA 2YHBA 4CEOA 3OBYA 3MX5A 4E1JA 4NLCA 2GEMA 2Z1GA 1OH8A 3R8EA 3OYIA 5BN9A 2KLAA 4B1UB 4CEBA 4O0IA 4ILGB 1R0AA 1H1VA 3Q7BA 4FWLA 5EVZA 1YTAA 2QWQA 2WUSA 4IO8A 1ESVA 1KVBA 1YTUA 3IMXA 4JD2A 1WNSA 3JS6A 5AQUA 5F1XA 4FJ7A 2YHXA 1S1WA 2HHWA 4FPBA 4JNEA 1DLOA 4FJGA 3SYZA 3M1FA 3I8DA 1YT3A 3OYHA 2CB8A 2QTDA 1T05A 4QOZB 4CEEA 1VQ7N 2QEXN 2EMTA 3OYAA 3SPYA 2P1JA 3DLHA 3MECA 4DF4A 1I94K 2X6SA 4I9LA 3SUOA 1E4GT 4L3QA 1QHAA 1VQLN 1NGDA 4DTSA 4CJLA 2E1ZA 3HI0A 1C0MA 3VESA 3SAHA 1HPMA 3G6EN 3NVKA 1WSHA 2O8FA 3V1RA 4E7LA 3PX0A 1J5EK 4FJMA 1UOCA 2FSNA 5J2MA 4HUEA 4CEFA 4B1YB 4CFBA 4F3OA 3T1AA 4F9OA 2WBNA 5SZTA 1HLUA 4O8UA 3OYFA 3PVLA 2P9IB 4JKCA 5EU7A 4EAHD 3K59A 4W5RA 4BDYA 3QIPA 3CMEN 4IDKA 2W6KA 1TYQA 4Q0BA 4K0KK 4KI6A 3E1YA 4FZZA 2P9UA 4BVOA 3D2EA 1T6CA 3V9ZA 4JKGA 3QDKA 2G8WA 1DTTA 5F0XA 1TK8A 3HPOA 4W5TA 2DIKA 1ZBIA 2CH5A 3H46O 2NZTA 3WNEA 3AU4A 2FLOA 4CGFA 4ZTFA 4LY7A 3K5OA 4FW1A 3U9DA 4YY3K 3NGIA 2E20A 4M45A 1JLEA 5KQDA 5LMUK 1RBUA 4W5NA 1FW6A 2X6NA 1ZBLA 3CJ9A 1X3NA 3R6MA 2HHUA 3TAFA 3ZYYX 1T44A 2YCHA 3IS9A 2F9TA 4DMNA 4A2AA 4CJ3A 3QEPA 4DSLA 4JI4K 4OLBA 1NGIA 1S6QA 5J1EA 3VENA 5AZIA 4FOIA 5FLXO 3K9KA 5DK5A 3AO4A 5KRSA 3FFKB 4CJPA 1WLJA 4WE1A 1S22A 1S1UA 1ZBFA 3VEYA 1WSFA 4FLVA 4OPJA 4TSXA 2PZSA 3RMDA 1BQMA 1RT6A 2HMPA 3FZHA 1F21A 5AQYA 3SI6A 3K9JA 4IKFA 3ZSOA 4PY5A 3FZLA 3EE9A 2G8VA 1HB8A 1IJJA 4KB0A 1IG8A 4CIFA 3KK3A 4UY8O 1MK7B 3PIPL 4IWVA 4DTMA 2FF6A 5EOYA 1TGOA 3BEXA 3L3VA 3LDLA 4JKFA 1HYVA 5AQNA 1HYZA 1S6PA 1ASWA 4F3TA 3LDQA 1K73O 4BRCA 4Z4CA 3ZDTA 1HR0K 4I9QA 4GNIA 2Z1HA 1NWKA 4CF1A 1C1AA 2ZQBA 2BANA 3CI5A 4IXCA 4EHTA 3VGLA 4LF6K 3DJCA 4EIAA 3AO1A 1M1KO 3KLFA 4HVJA 1WBBA 1LW2A 3AA3A 1WAFA 2WONA 3MDQA 1GC7A 3CQYA 2Q1NA 3FZKA 1RT7A 3VEVA 1UAXA 1KXPA 2NNWA 2PBDA 3JAMO 4C8OA 5KI6A 4BC5A 5T7BA 4FK4A 5HLFA 3NE6A 1QSSA 2HBMA 4RW6A 3KJVA 1N5YA 4DCHA 4DR1K 4FWNA 2NRXA 3ULDA 4JRQA 3O9SA 3T3FA 5HL7L 2GWJA 3PY8A 5BR8K 5AQZA 2IOCA 2VG5A 4L8RB 1TKXA 3VQBA 1Y64A 1IBKK 2NRRA 4CJKA 1D4XA 1RDCA 5KTQA 4B3RK 3M8PA 4AHVA 2YJEA 1RTDA 5AQFA 3O8MA 5HRSA 5FPEA 4RWTA 3WA0A 2Z1JA 4J2BA 3JSMA 4U7BA 1X9MA 1TKDA 4DFMA 1KC8O 3QNNA 4I2PA 2G8KA 3E9PA 4DTJA 1NKBA 3P38A 3KK7A 3VQ5A 3BZKA 3ZT2A 5E84A 2J0JA 3HOTA 3W0LA 1ZYQA 4J2EA 2W42A 3SPZA 3O80A 5CYQA 4ZRJA 1C0TA 5KPRA 5DMRA 1K9MO 1RBRA 1GLCG 4O5BA 4CGGA 5I3UA 3VQCA 5AQGA 3AO3A 1YAGA 4C23A 2HNZA 3I8BA 2I7NA 4B9QA 3O3FA 4GY2B 1KFDA 3KIOA 3NMUA 1DIKA 3LP0A 3HXMA 3OJUA 4B9VA 2HHTA 3O1BA 2DFEA 1C0UA 3DLKA 3NH0A 1OVQA 4K25A 4CFAA 3O4WA 5KPZA 2JWKA 1KTQA 2O8CA 4ID1A 2FBXA 1KD1O 3ZEUB 4I2QA 1OKJA 1HKGA 1Z6RA 1IKXA 2CGJA 3DYAA 5TKYA 4CZKA 5M1FA 3VEOA 3HK2A 2RN2A 2HHVA 1E4FT 1NLVA 1VQMN 4PUOA 3LDSA 5JS2A 3PV8A 1XNQK 3ZSVA 1VRTA 1XC9A 3SV3A 2EHGA 3UKUA 2GUPA 1BISA 1IBMK 3CYMA 3VQEA 4R5PA 2CQUA 5GIPA 2VG7A 1BIUA 1DKGD 2E4LA 5AQSA 4DXAB 2A41A 2OZMA 3DLEA 3D7EO 2BGGA 3H45C 3O9RA 1UA1A 1NKEA 2QWLA 1NGGA 1YVUA 4F2RA 5LJWA 2D11A 3EN9A 3H6EA 3I56N 1L3TA 3TARA 3VTHA 4LFAK 4CK2A 4JS4A 1VBHA 2IVPA 3NFAA 3IUCA 1Q86O 2D0PA 1J53A 3K0SA 1HBKA 4Z4GA 4CEZA 4B3TK 3SJHA 3M5RA 4H0VB 4B9TA 4CERA 1FJGK 4KTWA 2E6LA 5C12A 1Q8IA 3T1YK 2D4WA 2HVIA 4JYAK 4BC3A 3FE1A 4YL8A 5AQLA 4A61A 1NK7A 4ELTA 1W0HA 4TKNA 1VRUA 4M3RA 4F4KA 3AA2A 5HRPA 3DRRA 3N4PA 4N47A 1CZ9A 1W7AA 2Q2RA 3AVAA 4KH6A 2PYLA 4ILJA 3TANA 2O8BA 4BRLA 5ADXA 4H5TA 3O08A 4NB4A 4WF9L 1BIZA 1EWQA 4PHTX 2YHWA 4H5VA 3WUHA 1LW0A 3V9XA 4FYDA 3DLGA 3LZJA 5IWAK 4GV9A 4JV5K 3NF7A 5E41A 1NJWA 1TK5A 5AQTA 1QQMA 4DSJA 3CCUN 1JLFA 3CM6A 3A0IX 3LWLA 1BUPA 1S9GA 3JXUA 2NRHA 3WQUA 1RT1A 3BP8A 4FK0A 3HZ6A 3I55N 2P9PB 2GWKA 3VQPA 2PFUA 3HYFA 1E5WA 5FRNA 1RT3A 1X9SA 2OANA 4PQUA 3PO5A 2I1JA 3C7NB 1T8EA 4I7FA 1NK9A 1BI4B 2ASOA 3DRSA 3QICA 4HTUA 5KRTA 4OVLA 4PKIA 4M3WA 3CC2N 2VWBA 4DTPA 2IGIA 1JCFA 4JI8K 1MWKA 1ZBSA 3L4QA 1C6VA 3H08A 2ETJA 4C8NA 1D8YA 1HJOA 4LF4K 3F9KA 5AQRA 2E5LK 3IFRA 1O1WA 4IFYA 1L5UA 1ASVA 4BDZA 1J19A 4C1NK 3AGKA 5LJVA 1TVRA 3DXKA 4CVNE 1KLNA 3HM9A 4NCBA 3SNNA 5JS1A 3SLCA 4HCBA 4DV2K 1BO5O 3WXIA 4X62K 3AO5A 4F7GA 1OH7A 2O8DB 3QEXA 3CD6N 3IDHA 2F8SA 2OTLN 1KC7A 1VSHA 1NJZA 3VQ8A 5SWMA 4G1QA 1IO2A 4Z0UA 1VSEA 3D2FA 4CZHA 4MO5A 4J8FA 1V4SA 1SL0A 1KAZA 4DR2K 4CYEA 1EF1A 3LL3A 2FXUA 1I3AA 1YF5L 4DQQA 4MDBA 4IEEA 3KLGA 3CCVN 4NCGA 2Q0UA 3ZETB 1A5XA 4YOYA 3RTVA 1NKCA 4BACA 1EQYA 3DMJA 1RNHA 3SV4A 4WQ4A 4H5NA 4FSVA 3HP6A 1MIXA 2HNDA 4AHSA 4Y1DA 3EEQA 3IKMA 4ELUA 5HRRA 2D0OA 4M3UA 2QKBA 4BRPA 2E2PA 4EHUA 2Q36A 2UUAK 3L3UA 3MN7A 2UXDK 1RBTA 3EKSA 4H0PA 5JICA 1YJ9N 2RQ1A 5KPTA 4I6MB 4Q5VA 2WTUA 4QS9A 5M1OA 3H1VX 3ULEB 2W6LA 1BL3A 1TL1A 4B1ZA 3O5BA 1HUXA 3TTFA 3L2UA 1T7PA 4DTUA 1WSIA 4FM0A 2YV0X 1RGIA 1K6YA 3ID8A 4KHQA 2YI1A 4BR2A 4RG8A 4CGJA 4DS4A 3TSQA 3WNFA 4J2DA 2IVNA 2E1YA 3ZX3A 1BQNA 1SGHA 5AQMA 4HHTA 3VF2A 2PAVA 3K2PA 3N4QA 4H0YB 3MX2A 3CCEN 4OPKA 4FJ8A 1XHZA 1YJNN 4ZRIA 4ZHRA 3FFIA 4Z94A 3FR0A 4CJ4A 2O8EA 3OYNA 4NXNK 2HHXA 5HOOA 2IC3A 4XH1A 3OS1A 3LPTA 4K8ZA 3THYB 3TPQA 3S9HA 1GLJO 4IDHA 1ZC6A 3THWB 4JKEA 1BCMA 1HJRA 1QQOA 3UKRB 3SUPA 3VQ4A 3KLEA 5HRNA 2HBJA 5I42A 2P9NB 2P9LB 2NRTA 4KH4A 4OKKA 4DQ8A 3SQ1A 1J54A 3CG7A 4DKWA 2UXCK 3B8AX 2P5GA 3NGZA 4AHRA 4DV3K 2NUBA 3OVNA 2J0KA 3O4QA 4IJNA 3SQ4A 3CCRN 2VQFK 2ITMA 5HROA 3ZT4A 3C6HA 3LAMA 4Z4HA 3SAGA 5FPNA 3DRPA 4IOCL 1KAXA 3VEXA 3VEWA 4ZRKA 4BGAA 1RT5A 2IVOA 3JYTA 5MLCQ 4RW8A 3VGKA 4M3XA 1GOCA 4WYBA 3SZ2A 4IOXA 1JL2A 4GVEA 4KTQA 3DI6A 3E9OA 3C94A 1QQCA 3A2FA 4E89A 4DUZK 1U2VA 4JD2B 3MEGA 1IV0A 3QIJA 5AZJA 1LV5A 1XUPO 2HNYA 2HW3A 3B6OA 2DFFA 1LWFA 4FZYA 2ZF5O 3LP2A 1FKPA 3UB5A 3VQAA 3LDNA 3AV9A 4DSKA 4N56A 2F7TA 2IAJA 2KZMA 2J0MA 4JS5A 1P90A 1JLCA 5C42A 2X78A 5BR9A 4CIGA 2BDPA 4CF2A 3TABA 3OYCA 4BR0A 3SUNA 2VGNA 4MFBA 1VSKA 1D5AA 1Y97A 5KGXA 1EXQA 2O8FB 2O4IA 4RCHA 4X66K 2HHHK 4KO0A 4MLHA 4CW7B 3RR8A 3QFUA 3L8BA 3GBTA 5C24A 4YFUA 1GLDG 1EETA 1KRPA 3A5MC 3CJCA 3D6RA 4DU3A 1W2BM 3TR8A 3MWTA 3EYZA 4YOXA 3L0QA 1HKBA 4A5BA 1VSLA 3VPZA 1LCUA 3ZT3A 1HNWK 1BDGA 5C2DA 2VGMA 1GLEG 5AQHA 4BRDA 1HNXK 1TYQB 2DPNA 2P9UB 1TKTA 5C10A 3VF6A 3RWUA 2OTJN 3HRGA 2OYQA 1VBGA 3A8YA 3LM9A 4JKGB 2WFBA 3BINA 4LD0A 3CCMN 3M6GA 3WNGA 5I9EB 5E26A 4CJFA 1S72N 2FJ9A 5J2QA 1RDUA 2CH6A 2QI2A 3DWLA 1BU6O 1KSPA 3RMBA 4IG0A 1HKCA 4BQLA 2UYTA 1GOAA 3ENOA 1VQ9N 4DTOA 3ZSQA 3CFOA 3ZSZA 1G15A 3VA0A 2YNIA 4U67L 4B9NA 3CCQN 3P1GA 4GVMA 5ELZA 1JDEA 3SUQA 1YXQA 1Q18A 2AEHA 3OS0A 2O4GA 4FM2A 2V52B 4CFCA 3U7DA 5FPDA 4BWMA 3OYLA 4M7XA 2ZGYA 3LPUA 5GAEP 5AZIB 2P9SA 2WC9A 4BE1A 5BPLA 3TTDA 4YOUA 3VTIA 4CZJA 3CFPA 1CXUA 1NK5A 4LF5K 1R59O 4KH5A 3V9SA 5AQXA 1HRHA 1ACAA 4Z4FA 3BY5A 3MN6A 1RDBA 1QZ5A 4LF8K 3CETA 4KKOA 2YNFA 3AVGA 4BRHA 2VWKA 4DLGA 5LY3A 4KTZA 4M3TA 2FSKA 2QM1A 4EZ9A 1TV6A 2OA8A 5H1SQ 5KGWA 3KLHA 2A40A 5KQ8A 3V1OA 3U8ZA 2VWJA 4FOEA 3V9WA 3J8AA 2OZSA 4WQ4C 1HQUA 4ILHA 2XY7A 1N33K 1T03A 3KD1E 5JLHA 2F4VK 1CZBA 4E19A 1XMQK 1U48A 4IO9L 4BQZA 3QMLA 1B9DA 2Z1IA 4DR6K 2NRZA 3KLIA 1TK0A 3KVGA 4CGDA 3ZT0A 3PLAA 3LDPA 3THXA 4KI4A 5AQWA 4BRGA 1XI1A 4DLEA 4FJ5A 2ZD1A 4DQSA 1S1XA 2QXFA 3KHYA 1I39A 3E9LA 3NGYA 1SUQA 2HRJA 4BROA 1KAYA 4DU1A 4IFEA 1N32K 4CHPA 3K5LA 3Q7CA 5ADXH 4CJWA 4H0OA 3TAMA 1YUWA 3TAPA 4FXDA 1ST7A 4JI6K 3J80O 1JLAA 1UWBA 2A5XA 3R3LA 1NU0A 2UU9K 3C6TA 3CMAN 2YX6A 2D2QA 1LAWA 2OPRA 4O8KA 3AARA 2H3GX 2X0SA 5D3GA 4NYNA 4CF0A 4IOAL 3G0ZA 4B9UA 4OPHA 4JLHA 1VQON 4O5FA 2QW9A 5AQJA 3V1QA 4FJNA 1GC6A 4BG9A 2KW4A 4CZMA 4NO7A 1X9JA 1SV5A 1XC3A 3QFPA 5AQIA 5J2NA 1JCEA 3TTCA 2DFHA 3SBGA 5BREA 1FXXA 3U6FA 4JK7A 3G4SN 5AFUA 1IG9A 1WSJA 3U9ZA 3H3NO 4OX9K 4B1VA 4YDUA 3VQQA 5JVGL 4UQGA 3H3OB 5HP1A 5TKWA 2G8IA 4DHYA 4JKHA 3C6UA 4JHDA 1QVGM 1QHTA 3T1HK 2RE2A 4E1NA 4CBXA 4DG1A 4ISEA 3L2RA 4B9SA 3QO9A 5DM7L 3DLBA 1RDDA 3ATUA 4A2BA 2E2OA 4J2AA 4BDPA 4DV5K 1SZ2A 5LMNK 2Y1JA 4BC2A 4AHCA 1GLBG 4LC9B 1Q9YA 4C8LA 4EP5A 3LM2A 4DFPA 5C0YA 3C95A 2FF3B 4DQRA 4CZFA 3LZIA 4HDOA 3PSIA 4OKJA 3BDPA 3OBWA 4JN4A 1KBLA 4Y1CA 1QVFM 3OYDA 1X1PA 4JKAA 3CF5L 3KK1A 4ELVA 4JI1K 3GL1A 4BRNA 4HUFA 5CE3A 4FWRA 3LP1A 3QB0A 1NK8A 4KHSA 1QZ6A 3AVMA 2KFZA 2O8CB 4NCAA 3P83D 4DR7K 2B5JA 3ENHA 2A6AA 5BRDA 1IKWA 1K8KA 3BZCA 1FK9A 4KAZA 4NYFA 4AM7A 5CY4A 1A5VA 3V81A 5C25A 4CIEA 3CFRA 4LFBK 3KKSA 3D0PA 3G10A 3OY9A 3NF6A 4CFDA 3UKUB 3ZSXA 3BF3A 5BRFA 3CJ7A 3WEEA 3VETA 1RTHA 1NI2A 4KREA 1WSEA 3K57A 1WAJA 4JI0K 3EY1A 1N8RO 3NVMA 2D0AA 4BVPA 4IJAA 2XY5A 1QE1A 2QKKA 4BR9A 3LALA 4WQ5A 2UUBK 3WXMB 2GELA 3CM5A 4CZEA 4H8KA 4MO4A 2FC0A 4DF8A 4CBWA 1J6ZA 3CQ8A 4DSEA 1U04A 1JXBA 2P51A 3C65A 5JLFA 1WSGA 1HQEA 3ID6A 4FJIA 3HPGA 2P9KA 3BF1A 4H4OA 1JKHA 2HOEA 2G8FA 3RSEA 4FLWA 4XEIA 2FDQA 2ZPYA 4BE2A 3CCLN 3AVKA 3QBXA 2D0BA 3J7YP 4CEAA 1J5OA 1RT2A 1EO1A 3RRHA 2VQEK 3O9QA 2O8BB 4DR3K 3CC7N 1T3VA 3HOSA 3CC4N 4KV8A 2NRWA 5BPMA 4NY0A 2NRVA 4K41A 3HP9A 2A1SA 4KHNA 4E7HA 3M8SA 1NVLA 5B8HA 3ENBA 4OLAA 3TSUA 3OYMA 3P4IA 2B4JA 4PWDA 4AHTA 3ALYA
chains in the Genus database with same CATH topology
3VEYA 3ZX2A 2P9LB 2NRTA 4KH4A 4DQ8A 4G9ZA 4DKWA 3B8AX 5JVHL 1DT9A 2QA4N 1XQSC 3E66A 2HMPA 3FZHA 1P8ZA 5GAGP 5AQYA 3K9JA 4GV3A 2J0KA 1NGHA 4IJNA 2GX9A 2V7ZA 3EE9A 3FZLA 2IIRA 3CCRN 1HB8A 2ITMA 1IJJA 3CJAA 1MIZB 2Q97A 3CJBA 3C6HA 3SAGA 1IG8A 3C6AA 5FPNA 4CD3A 4UY8O 1MK7B 4BRFA 3S41A 4IWVA 3PIPL 4IOCL 1KAXA 2FF6A 5EOYA 3VEXA 3BEXA 1YIJN 3LDLA 4JKFA 5AQNA 4ZRKA 3VEWA 4BGAA 2IVOA 1YHQN 3LDQA 1C0GA 3EKUA 4M7YA 4BGBA 4CI6A 5MLCQ 3G71N 4BRCA 1K73O 3ZDTA 3DLLL 4GXBA 5AQVA 4BRMA 2EWSA 4JK8A 5AQPA 2AL6A 4GNIA 3FLCO 3VGKA 3ZETA 3EO3A 4JHDB 3WQTA 1NWKA 5BRHA 2EMSA 4WYBA 3P39A 3SK3A 4BR4A 3A5OC 4IOXA 3CI5A 3MN5A 4IXCA 1Z05A 4GVEA 4EHTA 3AU5A 3E9OA 3VGLA 2Q0RA 3UE5A 3J7ZO 3EE8A 4FPAA 3DJCA 3HTVA 3MMVA 3PZDA 4EIAA 1U2VA 1M1KO 4JD2B 2KHOA 1NGAA 1G99A 3QIJA 5AZJA 3U4LA 3MDQA 1XUPO 1GC7A 3WXKA 3DXKB 4JAXA 3CQYA 4A5AA 2Q1NA 3FZKA 3WXJA 1TUYA 2COPA 1VQ6N 1GG3A 3VEVA 1KXPA 2NNWA 2PBDA 2ZF5O 2Q31A 4BC5A 3UB5A 4XH4A 3LDNA 4WFNL 3OHRA 2HBMA 1YVNA 2R82A 2F7TA 2J0MA 4DCHA 1P90A 3LDOA 4FL9A 3CQXA 4H0XB 4FWNA 2NRXA 3D2FB 3O6WA 1NBWA 2HF3A 3O9SA 4PKHA 4FWMA 4ISFA 5BR9A 2E88A 5HL7L 2GWJA 1VQ8N 1K8KB 4BY9C 2E2QA 1ATSA 2W41A 5AQZA 3DAWA 3O1WA 1HB6A 4BR0A 2VGNA 1Y64A 3HSCA 1NGBA 4BRKA 2NRRA 3CHWA 2BH1A 3DXMA 2P9PA 3U8XA 1D4XA 2HSTA 3M3ZA 4B1WB 1BG3A 4RCHA 4BRIA 2YJEA 3C0BA 5AQFA 4KBOA 4OPAA 3O8MA 1M90O 3P31A 3C7NA 4MLHA 4HWIA 5FPEA 3WEEB 3QFUA 4RWTA 5EY4A 3WA0A 3CERA 3GBTA 2E8AA 1SS6A 2ZJPL 1GLDG 1TUUA 3KWIA 1OVYA 3A5MC 4U7BA 3CJCA 1BOTO 2ASMA 3CXCM 1KC8O 3D6RA 3GDQA 1W2BM 1ZXOA 3GG4A 3MWTA 4YOXA 3E9PA 5GADP 3L0QA 1HKBA 4FWPA 5BPNA 4HDQA 3BUZB 4A5BA 3VPZA 1VQON 1LCUA 3P38A 3KK7A 1BDGA 5C2DA 4B1XB 2JWLA 1GLEG 2VGMA 3CCSN 5AQHA 5E84A 4FWOA 2J0JA 3R9PA 3W0LA 4BRDA 1LOTB 3HOTA 1TYQB 4K42A 2DPNA 2P9UB 5DM6L 3O80A 5C10A 3VF6A 2OTJN 3HRGA 4YOWA 1VBGA 4ZRJA 3X23A 2QWOA 3A8YA 5JVLA 2ZGZA 3LM9A 4H5WA 5KPRA 1K9MO 4JKGB 2WFBA 3BINA 4FWQA 3CCMN 3CPEA 3M6GA 1GLCG 2J4RA 4ISGA 3EZWA 4M63C 4BG8A 4YOVA 3AAQA 1MDUB 5I9EB 5E26A 5AQGA 4XH5A 3F9MA 1S72N 2FJ9A 4FVUA 1RDUA 1W97L 1SQKA 1YAGA 2CH6A 2QI2A 2V51B 3DWLA 3I8BA 1BU6O 2I7NA 4B9QA 4C23A 4GY2B 4YDUC 2P9KB 3NMUA 1HKCA 1DIKA 2RHKA 2UYTA 4BQLA 1GLLO 3ENOA 1VQ9N 4BRQA 3O1BA 3RSEB 3L6QA 4WFAL 5F2RA 4U67L 4C1NI 3CCQN 4CBUA 4K25A 4PL8A 1VQPN 5ELZA 1JDEA 3O4WA 3WXLA 1YXQA 5GINA 3L4IA 4FO0A 5KPZA 2JWKA 1Q18A 3TU5A 2AEHA 1BA0A 1KD1O 2HE7A 1GLAG 3ZEUB 2V52B 1OKJA 3U7DA 1BA1A 1HKGA 1Z6RA 4BC4A 2CGJA 5TKYA 4CZKA 4CJ7A 5FPDA 3QBWA 3VEOA 4M7XA 5M1FA 4PL7A 3FGUA 1Q7YO 1E4FT 1NLVA 2ZJRL 2ZGYA 4JK9A 1VQMN 1WUAA 4DB3A 5GAEP 5AZIB 2P9SA 1YJWN 2WC9A 4A57A 5BPLA 2YHYA 3TTDA 1HX1A 3UKUA 2GUPA 4YOUA 3VTIA 4CZJA 2V7YA 1R59O 4HTLA 4KH5A 2ZWHA 1NTIA 5AQXA 4Y0WA 1JCGA 2CQUA 2LBBA 1ACAA 3HBTA 5GIPA 1DKGD 3WT0A 5AQSA 3MN6A 4DXAB 2A41A 3ZX0A 1QZ5A 1Q82O 2AA4A 3CETA 3D7EO 4JEPA 1YITN 3H45C 3O9RA 2P9IA 5CR4A 4BRHA 2QWLA 1NGGA 5LJWA 2D11A 2ASPA 5LY3A 3EN9A 4R79A 1NGEA 3MK6A 4CZGA 4PKGA 3H6EA 3I56N 2FSKA 4AF1A 2ZJQL 5AR0A 2QM1A 3VTHA 2YVCA 3TSPA 1VBHA 5H1SQ 2IVPA 2A40A 5KQ8A 3U8ZA 4I6MA 1WOQA 4FOEA 3IUCA 1Q86O 2D0PA 3SMSA 4WFBL 3J8AA 3ULEA 4WQ4C 3MCPA 3OW2M 1VQNN 1HBKA 4ILHA 2A3ZA 1C0FA 3SJHA 3A5LC 4IEIA 4AM6A 5JLHA 1VQKN 2F9WA 4IO9L 4BQZA 3M5RA 4BR5A 4H0VB 3QMLA 5M1NA 2NRZA 2ABDA 5C12A 3KVGA 5CHIA 2D4WA 3PLAA 4WQ5C 4YOTA 3LDPA 4BC3A 3CCJN 5M1QA 3FE1A 4YL8A 1YI2N 5AQLA 5AQWA 2QWNA 4A61A 4BRGA 1GLFO 5AQKA 1ATNA 1MA9B 4TKNA 1U2VB 2NLXA 5GIOA 3G25A 1NJIO 2FSJA 1BWFO 3KHYA 3E9LA 5AZJB 1V4TA 3KZBA 2HRJA 3N4PA 4BROA 2Q2RA 4KH6A 1KAYA 4ILJA 4IFEA 4BRLA 5ADXA 4H5TA 1S3XA 3O08A 3CJ1A 3Q7CA 4NB4A 4WF9L 4A59A 5ADXH 4H0OA 3FZFA 1NM1A 2KKZA 1O13A 1YUWA 4PHTX 1Y19B 2YHWA 4H5VA 1ST7A 4YORA 3WUHA 2A5XA 3F2KA 3R3LA 2A42A 3UKRA 3CMAN 4JKDA 4GV9A 2YX6A 2D2QA 4H5RA 5M1PA 1U6ZA 3FZMA 4O8KA 5JMVA 3H1QA 2I7PA 4RTFD 2P9NA 3KWGA 3SAFA 5AQTA 1QQMA 3AY9A 3CCUN 3A0IX 3AARA 1CZAN 2X0SA 2H3GX 2P9LA 1BUPA 3JXUA 1KQSM 4IOAL 2NRHA 1QQNA 3T69A 3WQUA 3BP8A 3VERA 3D2EB 3GOIA 1NGFA 3HZ6A 1ISNA 2E2NA 3R1XA 1SAZA 4OPHA 4O5FA 2QW9A 5AQJA 3VOVA 3I55N 1NMDA 3EL2A 3DXMB 2I1KA 2P9PB 2GWKA 1VQ5N 2PFUA 1RFQA 1GC6A 4BG9A 4MDAA 1NGJA 1E5WA 4CZMA 4NO7A 2OANA 2HF4A 1X9JA 1XC3A 3QFPA 5AQIA 1JCEA 2I1JA 1X3MA 3C7NB 3TTCA 5BREA 3SBGA 2ASOA 4JK7A 3VGMA 3QICA 3G4SN 5IJMA 4FWKA 3CPWM 5AFUA 4PKIA 3CC2N 2YJFA 3U9ZA 4CZIA 2VCPA 4EKUA 3H3NO 5AFUH 4B1VA 2VWBA 3F5TA 4YDUA 4CZLA 1JCFA 3GE1A 5JVGL 3H3OB 2CGLA 5TKWA 1MWKA 4DHYA 1ILYA 1ZBSA 4JKHA 4JHDA 1QVGM 3L4QA 1GGOA 3SBTA 2WH5A 2RE2A 3OBYA 4CBXA 3MX5A 4E1JA 4ISEA 4NLCA 2GEMA 1Q81O 4JKBA 3VMFB 3R8EA 5DM7L 5BN9A 1HJOA 2KLAA 4B1UB 1VAZA 4ILGB 3ATUA 1H1VA 3Q7BA 4FWLA 5EVZA 5AQRA 4A2BA 2E2OA 2QWQA 2WUSA 3IFRA 1SZ2A 3MN9A 3SMPA 4A62A 1K8AO 4BC2A 1J19A 4IO8A 1GLBG 4FWSA 1ESVA 4LC9B 3AGKA 3IMXA 4JD2A 5AQUA 3JS6A 4C1NK 5F1XA 5LJVA 2YHXA 1T6DA 3LM2A 4FPBA 4JNEA 5C0YA 2FF3B 4CZFA 4HDOA 3PIOL 3M1FA 3DXKA 3OBWA 4JN4A 2CB8A 1KBLA 2QTDA 1H4RA 2HBKA 2QWPA 1QVFM 1RDWX 4JKAA 3SLCA 1VQ7N 3CF5L 2QEXN 1BO5O 2EMTA 3GL1A 3AAPA 3WXIA 4F7GA 4BRNA 3HM8A 3CD6N 5CE3A 3IDHA 3QB0A 4FWRA 2OTLN 1KC7A 4P7IA 3AGRA 1QZ6A 1VQ4N 5AQQA 1E4GT 4L3QA 3D2FA 4CZHA 1QHAA 3VF4A 4MO5A 4J8FA 1VQLN 1V4SA 1NGDA 3ENHA 2A6AA 5BRDA 1KAZA 1K8KA 5AQOA 4OO1J 4CYEA 4AM7A 3ATVA 1EF1A 3LL3A 4QS8A 2FXUA 2E1ZA 3HI0A 3VESA 1YF5L 3SAHA 1HPMA 5C2FA 3G6EN 3NVKA 3O9TA 4MDBA 4H0TB 2P9SB 4IEEA 3CCVN 2AP1A 2Q0UA 3ZETB 5GAHP 3OA9A 4YOYA 3UKUB 3MWPA 1EQYA 2FSNA 3BF3A 5BRFA 3CJ7A 3WEEA 5C15A 3VETA 4WQ4A 4B1YB 1NI2A 5M1KA 4H5NA 4CD1A 4FSVA 4F9OA 1MIXA 2WBNA 1HLUA 4O8UA 1N8RO 3NVMA 4BVPA 3EPYA 3PVLA 3CIPA 2P9IB 2QWRA 4JKCA 3IKMA 4IJAA 4BREA 4EAHD 3VEZA 2D0OA 2BUPA 4GV6A 3W3DA 4BR7A 5FPMA 4BRPA 2E2PA 4BR9A 3CMEN 4EHUA 4WQ5A 3I33A 1MWMA 2Q36A 5EX5A 1ATRA 1TYQA 3MN7A 4WCEL 3WXMB 2GELA 3EKSA 3E1YA 4H0PA 2P9UA 5JICA 4CZEA 4BVOA 1YJ9N 4QS7A 2RQ1A 3D2EA 5KPTA 4MO4A 1T6CA 4JKGA 3QDKA 1DEJA 4I6MB 4CBWA 5F0XA 1J6ZA 4MLEA 2HBLA 3H1VX 4QS9A 3A5NC 3FP5A 2DIKA 5M1OA 3ULEB 4B1ZA 2CH5A 3H46O 2NZTA 3O5BA 3AU4A 1HUXA 3C65A 2FLOA 4H03B 5JLFA 4IZ9A 3TTFA 3ID6A 4EFHA 5BN8A 2D10A 3U9DA 2P9KA 3BF1A 3FLVA 2E20A 1RGIA 2QWMA 5KQDA 3ID8A 1NGCA 2HOEA 2YI1A 2QXLA 4BR2A 3RSEA 3TSQA 2GTDA 2IVNA 2E1YA 3ZX3A 4XEIA 2FDQA 3CJ9A 1X3NA 1SGHA 1DGKN 2ZPYA 3R6MA 5AQMA 1JJ2M 2W40A 2D1KA 3RVCA 3T7ZA 3VF2A 3IVFA 2PAVA 5EXWA 1MK9B 3ZYYX 3CCLN 3N4QA 1T44A 3QBXA 4H0YB 3MX2A 2YCHA 3O9UA 3CCEN 4BRAA 2F9TA 1EO1A 3ZEUA 4A2AA 1YJNN 3MCAB 4ZRIA 2VYPA 4NLBA 4Z94A 3O9QA 2CGKA 1NGIA 3FR0A 3CC7N 1T3VA 3G9WA 3HOSA 3CC4N 5BPMA 2NRWA 5HOOA 4XH1A 4NY0A 3VENA 2NRVA 5AZIA 3TPQA 4K41A 4FOIA 1GLJO 4IDHA 2BTFA 1ZC6A 4JKEA 3K9KA 1NVLA 1QQOA 3UKRB 3FFKB 5B8HA 3ENBA 2HBJA 3TSUA 1S22A 3P4IA 2P9NB 4K43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILG B;  4JKG A;  4JK9 A;  4JK8 A;  3SBG A;  4JKD A;  4JK7 A;  3E66 A;  4JKC A;  3E9L A;  3E9O A;  4JKG B;  4ILH A;  4JKH A;  4JKE A;  3SBT A;  4JKA A;  4ILJ A;  3ENB A;  4JKB A;  4JKF A;  3E9P A; 
#chains in the Genus database with same CATH topology
 1VSI A;  3ZX2 A;  1WBD A;  4G9Z A;  5LL6 Z;  2KTQ A;  5JVH L;  1DT9 A;  2G8H A;  1XQS C;  4M3Z A;  1N34 K;  3OYG A;  1P8Z A;  2GV9 A;  5GAG P;  4FLX A;  5J2P A;  4CHN A;  4GV3 A;  4B08 A;  1JXE A;  1NGH A;  4B8A B;  1SKW A;  3CJA A;  1MIZ B;  2A1R A;  4FZX C;  4CD3 A;  1NNE A;  4BRF A;  2D5R A;  1U49 A;  1YIJ N;  3OYB A;  3TAQ A;  2ITG A;  4DTX A;  3EKU A;  1OH6 A;  1S1T A;  3G71 N;  1GOB A;  1XWL A;  5AQV A;  2EWS A;  4JK8 A;  2EX3 A;  2AL6 A;  5AQP A;  3FLC O;  3ZET A;  4CF8 A;  3S3N A;  3EO3 A;  4F8R A;  3P39 A;  4BR4 A;  4M42 A;  3AU5 A;  2Q0R A;  4FLU A;  4M41 A;  3UE5 A;  5CZ2 A;  1NK6 A;  4K8X A;  4KHY A;  2YNG A;  3HTV A;  3MMV A;  3PZD A;  1VSD A;  1RDA A;  3MAQ A;  2KHO A;  1NGA A;  3U4L A;  3UIQ A;  1RT4 A;  3WXK A;  3TAG A;  3DXK B;  4JAX A;  4A5A A;  3WXJ A;  4DWI A;  4GKK K;  1A5W A;  2IS3 A;  3ZSW A;  4XH4 A;  4EP4 A;  3SQ2 A;  4WFN L;  1YVN A;  2R82 A;  3LP3 A;  3O3H A;  4FL9 A;  3LDO A;  3D2F B;  3O6W A;  4LFC K;  4OKE A;  4ISF A;  3TWH A;  2F8T A;  2UUC K;  2E2Q A;  1ATS A;  3IAY A;  4MQ3 A;  1HB6 A;  4DQP A;  3HSC A;  1NGB A;  4BRK A;  3NH1 A;  2BH1 A;  3DXM A;  1D9F A;  3U8X A;  3M3Z A;  3MED A;  4C8K A;  1RBS A;  4BRI A;  3EZ5 A;  4KBO A;  4OPA A;  1M90 O;  4DV6 K;  3HST B;  3CER A;  1SS6 A;  1TUU A;  3KWI A;  1OVY A;  4DV7 K;  1SKR A;  3CXC M;  2ASM A;  4FLY A;  4GKJ K;  4W5O A;  4CEC A;  3GDQ A;  3GG4 A;  2OPP A;  5FDL A;  4FWP A;  5BPN A;  4CHQ A;  4HDQ A;  4CHY A;  3KKR A;  2JWL A;  3TAE A;  2Q3S A;  1ASU A;  4FWO A;  2OCE A;  1LOT B;  3HPH A;  4K42 A;  1LAV A;  3ZCM A;  5IT9 O;  2QWO A;  5JVL A;  4B3S K;  4FWQ A;  4ISG A;  1OH5 A;  3EZW A;  4CHZ A;  4YOV A;  1MDU B;  4CF9 A;  3F9M A;  1W97 L;  3PX4 A;  4YDU C;  2RHK A;  3QEV A;  4HUG A;  4FJX A;  4DUY K;  4CBU A;  4LF7 K;  4F2S A;  4PL8 A;  4CJE A;  4GMJ B;  1W9H A;  3PO4 A;  4RW9 A;  3WXL A;  2FBT A;  5GIN A;  3K5M A;  1JL1 A;  1BA0 A;  2HVH A;  2HE7 A;  1SL2 A;  3QBW A;  1TKZ A;  2O8E B;  4JK9 A;  1WUA A;  4DB3 A;  4GW6 A;  4RW7 A;  4A57 A;  4OGC A;  3NH2 A;  4C8M A;  3QNO A;  3MEE A;  2FBY A;  2ZWH A;  3QEI A;  4Y0W A;  2LBB A;  1TAU A;  1Q82 O;  3NHG A;  4JEP A;  1YIT N;  3S3M A;  2P9I A;  3QLH A;  4O55 A;  2ASP A;  4R79 A;  1NGE A;  3QIO A;  4CJU A;  4CZG A;  4PKG A;  1KFS A;  4FLZ A;  4ICL A;  2ZJQ L;  5AR0 A;  5AJ3 K;  3PSF A;  4X64 K;  1VSJ A;  4WFB L;  3AA5 X;  3OW2 M;  3SCX A;  1C0F A;  1VQK N;  2F9W A;  3DOK A;  1KLM A;  5M1N A;  4IBN A;  5CHI A;  4WQ5 C;  1ZBU A;  3DM2 A;  3CCJ N;  5FRO A;  1ITG A;  1YI2 N;  5HBM A;  5AQK A;  1MA9 B;  1U2V B;  2IDO A;  5GIO A;  4NXM K;  2FSJ A;  4IFV A;  1IH7 A;  3AVJ A;  5AZJ B;  4YHH K;  3NF9 A;  1LWC A;  3IG1 A;  3KZB A;  1Q9X A;  1KCF A;  4BWJ A;  3CJ1 A;  2KKZ A;  1O13 A;  1Y19 B;  4H4M A;  2OPQ A;  2A42 A;  3AVF A;  4OGE A;  1EX4 A;  5M1P A;  5JMV A;  3H1Q A;  2I7P A;  3SAF A;  3KWG A;  3ZSY A;  4E7J A;  4O44 A;  2GBZ A;  2YKM A;  5CZ1 A;  1QQN A;  3T69 A;  3VER A;  3D2E B;  2RKI A;  1NGF A;  3R1X A;  1SAZ A;  2YHA A;  3VOV A;  2G8U A;  1NMD A;  3EL2 A;  2I1K A;  4DV0 K;  4B8C A;  1VQ5 N;  1RCH A;  2GUI A;  3VQ7 A;  4LSN A;  1X3M A;  1J9A A;  3L2Q A;  1NJX A;  3L2W A;  4FWK A;  4CZI A;  5AFU H;  4EKU A;  4QCL A;  3OTO K;  2YKN A;  4FCY A;  3GE1 A;  1Z25 A;  1HMV A;  2HHS A;  3HL8 A;  1ILY A;  4CGI A;  3KD5 E;  1GGO A;  3SBT A;  3SQ0 A;  4E1M A;  2WH5 A;  1NK4 A;  1E3M A;  4DU4 A;  4FJL A;  4CEQ A;  1Q81 O;  4JKB A;  4JI2 K;  3VMF B;  4CHO A;  3RMA A;  1VAZ A;  2JLE A;  4RW4 A;  3MN9 A;  3SMP A;  4A62 A;  3NDK A;  1K8A O;  1LWE A;  4FWS A;  2KZZ A;  1T6D A;  4KB1 A;  3T19 A;  3DOL A;  3VA3 A;  3PIO L;  1D9D A;  1IKY A;  2RPI A;  2QWP A;  1H4R A;  2HBK A;  3VQ6 A;  4O0J A;  3O3G A;  1RDW X;  1B9F A;  3AAP A;  3S3O A;  4KPY A;  3HM8 A;  4AH9 A;  1IKV A;  2I5J A;  3RMC A;  4P7I A;  3AGR A;  1HNI A;  3AO2 A;  1VQ4 N;  5AQQ A;  4XIU A;  1L3V A;  3VF4 A;  4E7K A;  4AHU A;  1VHX A;  3AVB A;  3I0S A;  5AQO A;  4OO1 J;  3ATV A;  4QS8 A;  3QER A;  3J7A P;  5C2F A;  3O9T A;  4H0T B;  2P9S B;  2AP1 A;  1XNR K;  3WNH A;  1C1C A;  5GAH P;  3OA9 A;  3OS2 A;  2QK9 A;  3MWP A;  1QSL A;  3E01 A;  2JGU A;  5C15 A;  4LSL A;  4LF9 K;  5CYM A;  5M1K A;  4CD1 A;  4CGH A;  4DFK A;  3L2V A;  4CJS A;  2KFN A;  3EPY A;  3CIP A;  2QWR A;  4BRE A;  3VEZ A;  2BUP A;  3QES A;  4GV6 A;  3W3D A;  4BR7 A;  5FPM A;  1EP4 A;  3I33 A;  1MWM A;  5EX5 A;  1ATR A;  4WCE L;  4QS7 A;  1DEJ A;  1HNV A;  3AA4 A;  4MLE A;  2HBL A;  1TL3 A;  2PY5 A;  3A5N C;  3FP5 A;  4B3O A;  2ZE2 A;  4YNQ A;  4H03 B;  4IZ9 A;  4EFH A;  5BN8 A;  2D10 A;  3D45 A;  2HB5 A;  3QIN A;  3FLV A;  4FK2 A;  2QWM A;  1DTQ A;  5K14 A;  1NGC A;  2ATQ A;  2QXL A;  2GTD A;  3HVR A;  2F96 A;  4DR5 K;  1JJ2 M;  1U45 A;  1DGK N;  2W40 A;  2D1K A;  3RVC A;  3T7Z A;  4ZTJ A;  3THX B;  3IVF A;  5EXW A;  1REV A;  1MK9 B;  3O9U A;  4CCH A;  4BRA A;  1EKE A;  3ZEU A;  3MCA B;  2VYP A;  4NLB A;  1NOY A;  4HCC A;  2CGK A;  4W5Q A;  4FW2 A;  3G9W A;  1KVC A;  2R7Y A;  1VSM A;  4DV1 K;  2HMI A;  2BTF A;  3ASM A;  1QTM A;  1FKO A;  1UA0 A;  1B92 A;  2LSN A;  4K43 A;  1JLQ A;  4EZ6 A;  2DTU A;  3M8R A;  4DSF A;  1XHX A;  4ID5 A;  2QA4 N;  3E66 A;  3NAE A;  4M3Y A;  3PX6 A;  1CXQ A;  2GX9 A;  2V7Z A;  2IIR A;  4N76 A;  1WN7 A;  2Q97 A;  3LAN A;  3CJB A;  3C6A A;  3V4I A;  3S41 A;  2FBV A;  2BE2 A;  4IG3 A;  2XY6 A;  4Z4E A;  3VQ9 A;  2Y1I A;  1YHQ N;  1C0G A;  4M7Y A;  4CI6 A;  4BGB A;  4GXB A;  3HVT A;  4BRM A;  4FJ9 A;  3B6P A;  4JHD B;  3F73 A;  3WQT A;  3MXI A;  5BRH A;  3AVN A;  2EMS A;  4CES A;  3SK3 A;  3A5O C;  4O4G A;  3RR7 A;  1U47 A;  3MN5 A;  1Z05 A;  4DV4 K;  1JLB A;  3J7Z O;  3EE8 A;  4FPA A;  2AJQ A;  1G99 A;  1S1V A;  4KFB A;  3O4N A;  4KHW A;  1TUY A;  2COP A;  1XMO K;  1VQ6 N;  1GG3 A;  4DFJ A;  2YNH A;  3U3G A;  2Q31 A;  4KHP K;  3OHR A;  1Z26 A;  4CK3 A;  1SL1 A;  1N36 K;  2KQ2 A;  2XY8 A;  3CQX A;  4H0X B;  4PA1 A;  2ZM6 K;  1NBW A;  2HF3 A;  4CK1 A;  2UXB K;  4PKH A;  4FWM A;  2E88 A;  1N6Q A;  1VQ8 N;  1K8K B;  4BY9 C;  2W41 A;  3DAW A;  3O1W A;  1BCO A;  3KTQ A;  3CHW A;  2P9P A;  2HST A;  4B1W B;  1BG3 A;  1BHL A;  3TI0 A;  2XHB A;  1NG9 A;  4JI7 K;  3C0B A;  3P31 A;  3C7N A;  4HWI A;  3WEE B;  1KVA A;  1BI4 A;  5EY4 A;  2ZJP L;  2E8A A;  1BOT O;  1ZXO A;  4N5S A;  3QEW A;  5GAD P;  4OJR A;  4JI3 K;  3BUZ B;  4X65 K;  3V6D A;  3IRX A;  3PUF A;  4B1X B;  3CCS N;  4AIL C;  3R9P A;  4JRP A;  2XRI A;  4LH5 A;  3QET A;  3P5J A;  5DM6 L;  4YOW A;  3ZLJ A;  3X23 A;  1SKS A;  2ZGZ A;  4H5W A;  3K5N A;  1L3S A;  4B9L A;  2HHQ A;  3AVL A;  3CPE A;  1RIL A;  2J4R A;  4M63 C;  4BG8 A;  1C1B A;  4BE0 A;  3AAQ A;  1MU2 A;  2P5O A;  4XH5 A;  4FVU A;  2V51 B;  1SQK A;  3DLL L;  3NF8 A;  3NBP A;  1ZBH A;  2P9K B;  3OYE A;  4CJ5 A;  1GLL O;  4KRF A;  4BRQ A;  4DTR A;  1L3U A;  3RSE B;  4DSI A;  1RTI A;  3L6Q A;  4WFA L;  4CED A;  1CLQ A;  5F2R A;  2O8D A;  4C1N I;  4AQY K;  5A2Q O;  1VQP N;  3L4I A;  4FO0 A;  3TU5 A;  3LAK A;  1RBV A;  3OYK A;  4CE9 A;  1GLA G;  1BA1 A;  4BC4 A;  4CJ7 A;  1EWR A;  4PL7 A;  3FGU A;  1Q7Y O;  4E0D A;  2ZJR L;  1JLG A;  2WOM A;  1NK0 A;  4DQI A;  4DTN A;  1YJW N;  4KHU A;  3HT3 A;  2YHY A;  1X9W A;  1HX1 A;  1HYS A;  3J81 O;  2V7Y A;  4HTL A;  3THV A;  2DY4 A;  1NTI A;  1JCG A;  3HBT A;  3WT0 A;  1QS4 A;  1BGX T;  3ZX0 A;  2AA4 A;  3U3Y A;  1S9E A;  5CR4 A;  3NCI A;  1TAQ A;  1WB9 A;  3MK6 A;  3BGR A;  4QAG A;  3RRG A;  5FRM A;  4AF1 A;  3V9U A;  3AVI A;  4B3M K;  1VSF A;  3ZSR A;  4CJR A;  4FJK A;  3AVH A;  2YVC A;  3TSP A;  2E6M A;  1NOZ A;  4I6M A;  1WOQ A;  3SMS A;  3ULE A;  3MCP A;  1VQN N;  2A3Z A;  3SJJ A;  3A5L C;  4IEI A;  4AM6 A;  1S5J A;  1NJY A;  3OJS A;  4BR5 A;  3MXM A;  1HNZ K;  3ISN C;  4DR4 K;  2PYJ A;  2ABD A;  4E7I A;  4V19 S;  1QSY A;  4YOT A;  3K58 A;  5M1Q A;  4Z4I A;  2QWN A;  1GLF O;  3LWM A;  1ATN A;  2NLX A;  3G25 A;  1NJI O;  4JI5 K;  1BWF O;  2VG6 A;  4E3S A;  1V4T A;  4CJQ A;  3HJF A;  1NMN A;  2D0C A;  1S3X A;  3OYJ A;  3DLR A;  4N41 A;  4A59 A;  3FZF A;  3ZT1 A;  4FVM A;  1NM1 A;  3THY A;  4YOR A;  3THW A;  3F2K A;  3UKR A;  1VK0 A;  4JKD A;  1RTJ A;  4H5R A;  2XO7 A;  1U6Z A;  3FZM A;  3M8Q A;  3MXJ A;  4LH4 A;  4RTF D;  2P9N A;  2OPS A;  3ITH A;  3AY9 A;  1CZA N;  2P9L A;  4DS5 A;  1U4B A;  2B6A A;  1KQS M;  4FLT A;  3GOI A;  1ISN A;  2E2N A;  1HPZ A;  3HO1 A;  3DXM B;  3VQD A;  1RFQ A;  4MDA A;  1NGJ A;  2RF2 A;  3AVC A;  2HF4 A;  2X74 A;  4CJV A;  3VGM A;  5IJM A;  3CPW M;  4FM1 A;  2YJF A;  4CJT A;  2VCP A;  4B9M A;  4CZL A;  3F5T A;  4FJJ A;  3I0R A;  3VN5 A;  2CGL A;  3KK2 A;  1IBL K;  4FJH A;  2YHB A;  4CEO A;  3OBY A;  3MX5 A;  4E1J A;  4NLC A;  2GEM A;  2Z1G A;  1OH8 A;  3R8E A;  3OYI A;  5BN9 A;  2KLA A;  4B1U B;  4CEB A;  4O0I A;  4ILG B;  1R0A A;  1H1V A;  3Q7B A;  4FWL A;  5EVZ A;  1YTA A;  2QWQ A;  2WUS A;  4IO8 A;  1ESV A;  1KVB A;  1YTU A;  3IMX A;  4JD2 A;  1WNS A;  3JS6 A;  5AQU A;  5F1X A;  4FJ7 A;  2YHX A;  1S1W A;  2HHW A;  4FPB A;  4JNE A;  1DLO A;  4FJG A;  3SYZ A;  3M1F A;  3I8D A;  1YT3 A;  3OYH A;  2CB8 A;  2QTD A;  1T05 A;  4QOZ B;  4CEE A;  1VQ7 N;  2QEX N;  2EMT A;  3OYA A;  3SPY A;  2P1J A;  3DLH A;  3MEC A;  4DF4 A;  1I94 K;  2X6S A;  4I9L A;  3SUO A;  1E4G T;  4L3Q A;  1QHA A;  1VQL N;  1NGD A;  4DTS A;  4CJL A;  2E1Z A;  3HI0 A;  1C0M A;  3VES A;  3SAH A;  1HPM A;  3G6E N;  3NVK A;  1WSH A;  2O8F A;  3V1R A;  4E7L A;  3PX0 A;  1J5E K;  4FJM A;  1UOC A;  2FSN A;  5J2M A;  4HUE A;  4CEF A;  4B1Y B;  4CFB A;  4F3O A;  3T1A A;  4F9O A;  2WBN A;  5SZT A;  1HLU A;  4O8U A;  3OYF A;  3PVL A;  2P9I B;  4JKC A;  5EU7 A;  4EAH D;  3K59 A;  4W5R A;  4BDY A;  3QIP A;  3CME N;  4IDK A;  2W6K A;  1TYQ A;  4Q0B A;  4K0K K;  4KI6 A;  3E1Y A;  4FZZ A;  2P9U A;  4BVO A;  3D2E A;  1T6C A;  3V9Z A;  4JKG A;  3QDK A;  2G8W A;  1DTT A;  5F0X A;  1TK8 A;  3HPO A;  4W5T A;  2DIK A;  1ZBI A;  2CH5 A;  3H46 O;  2NZT A;  3WNE A;  3AU4 A;  2FLO A;  4CGF A;  4ZTF A;  4LY7 A;  3K5O A;  4FW1 A;  3U9D A;  4YY3 K;  3NGI A;  2E20 A;  4M45 A;  1JLE A;  5KQD A;  5LMU K;  1RBU A;  4W5N A;  1FW6 A;  2X6N A;  1ZBL A;  3CJ9 A;  1X3N A;  3R6M A;  2HHU A;  3TAF A;  3ZYY X;  1T44 A;  2YCH A;  3IS9 A;  2F9T A;  4DMN A;  4A2A A;  4CJ3 A;  3QEP A;  4DSL A;  4JI4 K;  4OLB A;  1NGI A;  1S6Q A;  5J1E A;  3VEN A;  5AZI A;  4FOI A;  5FLX O;  3K9K A;  5DK5 A;  3AO4 A;  5KRS A;  3FFK B;  4CJP A;  1WLJ A;  4WE1 A;  1S22 A;  1S1U A;  1ZBF A;  3VEY A;  1WSF A;  4FLV A;  4OPJ A;  4TSX A;  2PZS A;  3RMD A;  1BQM A;  1RT6 A;  2HMP A;  3FZH A;  1F21 A;  5AQY A;  3SI6 A;  3K9J A;  4IKF A;  3ZSO A;  4PY5 A;  3FZL A;  3EE9 A;  2G8V A;  1HB8 A;  1IJJ A;  4KB0 A;  1IG8 A;  4CIF A;  3KK3 A;  4UY8 O;  1MK7 B;  3PIP L;  4IWV A;  4DTM A;  2FF6 A;  5EOY A;  1TGO A;  3BEX A;  3L3V A;  3LDL A;  4JKF A;  1HYV A;  5AQN A;  1HYZ A;  1S6P A;  1ASW A;  4F3T A;  3LDQ A;  1K73 O;  4BRC A;  4Z4C A;  3ZDT A;  1HR0 K;  4I9Q A;  4GNI A;  2Z1H A;  1NWK A;  4CF1 A;  1C1A A;  2ZQB A;  2BAN A;  3CI5 A;  4IXC A;  4EHT A;  3VGL A;  4LF6 K;  3DJC A;  4EIA A;  3AO1 A;  1M1K O;  3KLF A;  4HVJ A;  1WBB A;  1LW2 A;  3AA3 A;  1WAF A;  2WON A;  3MDQ A;  1GC7 A;  3CQY A;  2Q1N A;  3FZK A;  1RT7 A;  3VEV A;  1UAX A;  1KXP A;  2NNW A;  2PBD A;  3JAM O;  4C8O A;  5KI6 A;  4BC5 A;  5T7B A;  4FK4 A;  5HLF A;  3NE6 A;  1QSS A;  2HBM A;  4RW6 A;  3KJV A;  1N5Y A;  4DCH A;  4DR1 K;  4FWN A;  2NRX A;  3ULD A;  4JRQ A;  3O9S A;  3T3F A;  5HL7 L;  2GWJ A;  3PY8 A;  5BR8 K;  5AQZ A;  2IOC A;  2VG5 A;  4L8R B;  1TKX A;  3VQB A;  1Y64 A;  1IBK K;  2NRR A;  4CJK A;  1D4X A;  1RDC A;  5KTQ A;  4B3R K;  3M8P A;  4AHV A;  2YJE A;  1RTD A;  5AQF A;  3O8M A;  5HRS A;  5FPE A;  4RWT A;  3WA0 A;  2Z1J A;  4J2B A;  3JSM A;  4U7B A;  1X9M A;  1TKD A;  4DFM A;  1KC8 O;  3QNN A;  4I2P A;  2G8K A;  3E9P A;  4DTJ A;  1NKB A;  3P38 A;  3KK7 A;  3VQ5 A;  3BZK A;  3ZT2 A;  5E84 A;  2J0J A;  3HOT A;  3W0L A;  1ZYQ A;  4J2E A;  2W42 A;  3SPZ A;  3O80 A;  5CYQ A;  4ZRJ A;  1C0T A;  5KPR A;  5DMR A;  1K9M O;  1RBR A;  1GLC G;  4O5B A;  4CGG A;  5I3U A;  3VQC A;  5AQG A;  3AO3 A;  1YAG A;  4C23 A;  2HNZ A;  3I8B A;  2I7N A;  4B9Q A;  3O3F A;  4GY2 B;  1KFD A;  3KIO A;  3NMU A;  1DIK A;  3LP0 A;  3HXM A;  3OJU A;  4B9V A;  2HHT A;  3O1B A;  2DFE A;  1C0U A;  3DLK A;  3NH0 A;  1OVQ A;  4K25 A;  4CFA A;  3O4W A;  5KPZ A;  2JWK A;  1KTQ A;  2O8C A;  4ID1 A;  2FBX A;  1KD1 O;  3ZEU B;  4I2Q A;  1OKJ A;  1HKG A;  1Z6R A;  1IKX A;  2CGJ A;  3DYA A;  5TKY A;  4CZK A;  5M1F A;  3VEO A;  3HK2 A;  2RN2 A;  2HHV A;  1E4F T;  1NLV A;  1VQM N;  4PUO A;  3LDS A;  5JS2 A;  3PV8 A;  1XNQ K;  3ZSV A;  1VRT A;  1XC9 A;  3SV3 A;  2EHG A;  3UKU A;  2GUP A;  1BIS A;  1IBM K;  3CYM A;  3VQE A;  4R5P A;  2CQU A;  5GIP A;  2VG7 A;  1BIU A;  1DKG D;  2E4L A;  5AQS A;  4DXA B;  2A41 A;  2OZM A;  3DLE A;  3D7E O;  2BGG A;  3H45 C;  3O9R A;  1UA1 A;  1NKE A;  2QWL A;  1NGG A;  1YVU A;  4F2R A;  5LJW A;  2D11 A;  3EN9 A;  3H6E A;  3I56 N;  1L3T A;  3TAR A;  3VTH A;  4LFA K;  4CK2 A;  4JS4 A;  1VBH A;  2IVP A;  3NFA A;  3IUC A;  1Q86 O;  2D0P A;  1J53 A;  3K0S A;  1HBK A;  4Z4G A;  4CEZ A;  4B3T K;  3SJH A;  3M5R A;  4H0V B;  4B9T A;  4CER A;  1FJG K;  4KTW A;  2E6L A;  5C12 A;  1Q8I A;  3T1Y K;  2D4W A;  2HVI A;  4JYA K;  4BC3 A;  3FE1 A;  4YL8 A;  5AQL A;  4A61 A;  1NK7 A;  4ELT A;  1W0H A;  4TKN A;  1VRU A;  4M3R A;  4F4K A;  3AA2 A;  5HRP A;  3DRR A;  3N4P A;  4N47 A;  1CZ9 A;  1W7A A;  2Q2R A;  3AVA A;  4KH6 A;  2PYL A;  4ILJ A;  3TAN A;  2O8B A;  4BRL A;  5ADX A;  4H5T A;  3O08 A;  4NB4 A;  4WF9 L;  1BIZ A;  1EWQ A;  4PHT X;  2YHW A;  4H5V A;  3WUH A;  1LW0 A;  3V9X A;  4FYD A;  3DLG A;  3LZJ A;  5IWA K;  4GV9 A;  4JV5 K;  3NF7 A;  5E41 A;  1NJW A;  1TK5 A;  5AQT A;  1QQM A;  4DSJ A;  3CCU N;  1JLF A;  3CM6 A;  3A0I X;  3LWL A;  1BUP A;  1S9G A;  3JXU A;  2NRH A;  3WQU A;  1RT1 A;  3BP8 A;  4FK0 A;  3HZ6 A;  3I55 N;  2P9P B;  2GWK A;  3VQP A;  2PFU A;  3HYF A;  1E5W A;  5FRN A;  1RT3 A;  1X9S A;  2OAN A;  4PQU A;  3PO5 A;  2I1J A;  3C7N B;  1T8E A;  4I7F A;  1NK9 A;  1BI4 B;  2ASO A;  3DRS A;  3QIC A;  4HTU A;  5KRT A;  4OVL A;  4PKI A;  4M3W A;  3CC2 N;  2VWB A;  4DTP A;  2IGI A;  1JCF A;  4JI8 K;  1MWK A;  1ZBS A;  3L4Q A;  1C6V A;  3H08 A;  2ETJ A;  4C8N A;  1D8Y A;  1HJO A;  4LF4 K;  3F9K A;  5AQR A;  2E5L K;  3IFR A;  1O1W A;  4IFY A;  1L5U A;  1ASV A;  4BDZ A;  1J19 A;  4C1N K;  3AGK A;  5LJV A;  1TVR A;  3DXK A;  4CVN E;  1KLN A;  3HM9 A;  4NCB A;  3SNN A;  5JS1 A;  3SLC A;  4HCB A;  4DV2 K;  1BO5 O;  3WXI A;  4X62 K;  3AO5 A;  4F7G A;  1OH7 A;  2O8D B;  3QEX A;  3CD6 N;  3IDH A;  2F8S A;  2OTL N;  1KC7 A;  1VSH A;  1NJZ A;  3VQ8 A;  5SWM A;  4G1Q A;  1IO2 A;  4Z0U A;  1VSE A;  3D2F A;  4CZH A;  4MO5 A;  4J8F A;  1V4S A;  1SL0 A;  1KAZ A;  4DR2 K;  4CYE A;  1EF1 A;  3LL3 A;  2FXU A;  1I3A A;  1YF5 L;  4DQQ A;  4MDB A;  4IEE A;  3KLG A;  3CCV N;  4NCG A;  2Q0U A;  3ZET B;  1A5X A;  4YOY A;  3RTV A;  1NKC A;  4BAC A;  1EQY A;  3DMJ A;  1RNH A;  3SV4 A;  4WQ4 A;  4H5N A;  4FSV A;  3HP6 A;  1MIX A;  2HND A;  4AHS A;  4Y1D A;  3EEQ A;  3IKM A;  4ELU A;  5HRR A;  2D0O A;  4M3U A;  2QKB A;  4BRP A;  2E2P A;  4EHU A;  2Q36 A;  2UUA K;  3L3U A;  3MN7 A;  2UXD K;  1RBT A;  3EKS A;  4H0P A;  5JIC A;  1YJ9 N;  2RQ1 A;  5KPT A;  4I6M B;  4Q5V A;  2WTU A;  4QS9 A;  5M1O A;  3H1V X;  3ULE B;  2W6L A;  1BL3 A;  1TL1 A;  4B1Z A;  3O5B A;  1HUX A;  3TTF A;  3L2U A;  1T7P A;  4DTU A;  1WSI A;  4FM0 A;  2YV0 X;  1RGI A;  1K6Y A;  3ID8 A;  4KHQ A;  2YI1 A;  4BR2 A;  4RG8 A;  4CGJ A;  4DS4 A;  3TSQ A;  3WNF A;  4J2D A;  2IVN A;  2E1Y A;  3ZX3 A;  1BQN A;  1SGH A;  5AQM A;  4HHT A;  3VF2 A;  2PAV A;  3K2P A;  3N4Q A;  4H0Y B;  3MX2 A;  3CCE N;  4OPK A;  4FJ8 A;  1XHZ A;  1YJN N;  4ZRI A;  4ZHR A;  3FFI A;  4Z94 A;  3FR0 A;  4CJ4 A;  2O8E A;  3OYN A;  4NXN K;  2HHX A;  5HOO A;  2IC3 A;  4XH1 A;  3OS1 A;  3LPT A;  4K8Z A;  3THY B;  3TPQ A;  3S9H A;  1GLJ O;  4IDH A;  1ZC6 A;  3THW B;  4JKE A;  1BCM A;  1HJR A;  1QQO A;  3UKR B;  3SUP A;  3VQ4 A;  3KLE A;  5HRN A;  2HBJ A;  5I42 A;  2P9N B;  2P9L B;  2NRT A;  4KH4 A;  4OKK A;  4DQ8 A;  3SQ1 A;  1J54 A;  3CG7 A;  4DKW A;  2UXC K;  3B8A X;  2P5G A;  3NGZ A;  4AHR A;  4DV3 K;  2NUB A;  3OVN A;  2J0K A;  3O4Q A;  4IJN A;  3SQ4 A;  3CCR N;  2VQF K;  2ITM A;  5HRO A;  3ZT4 A;  3C6H A;  3LAM A;  4Z4H A;  3SAG A;  5FPN A;  3DRP A;  4IOC L;  1KAX A;  3VEX A;  3VEW A;  4ZRK A;  4BGA A;  1RT5 A;  2IVO A;  3JYT A;  5MLC Q;  4RW8 A;  3VGK A;  4M3X A;  1GOC A;  4WYB A;  3SZ2 A;  4IOX A;  1JL2 A;  4GVE A;  4KTQ A;  3DI6 A;  3E9O A;  3C94 A;  1QQC A;  3A2F A;  4E89 A;  4DUZ K;  1U2V A;  4JD2 B;  3MEG A;  1IV0 A;  3QIJ A;  5AZJ A;  1LV5 A;  1XUP O;  2HNY A;  2HW3 A;  3B6O A;  2DFF A;  1LWF A;  4FZY A;  2ZF5 O;  3LP2 A;  1FKP A;  3UB5 A;  3VQA A;  3LDN A;  3AV9 A;  4DSK A;  4N56 A;  2F7T A;  2IAJ A;  2KZM A;  2J0M A;  4JS5 A;  1P90 A;  1JLC A;  5C42 A;  2X78 A;  5BR9 A;  4CIG A;  2BDP A;  4CF2 A;  3TAB A;  3OYC A;  4BR0 A;  3SUN A;  2VGN A;  4MFB A;  1VSK A;  1D5A A;  1Y97 A;  5KGX A;  1EXQ A;  2O8F B;  2O4I A;  4RCH A;  4X66 K;  2HHH K;  4KO0 A;  4MLH A;  4CW7 B;  3RR8 A;  3QFU A;  3L8B A;  3GBT A;  5C24 A;  4YFU A;  1GLD G;  1EET A;  1KRP A;  3A5M C;  3CJC A;  3D6R A;  4DU3 A;  1W2B M;  3TR8 A;  3MWT A;  3EYZ A;  4YOX A;  3L0Q A;  1HKB A;  4A5B A;  1VSL A;  3VPZ A;  1LCU A;  3ZT3 A;  1HNW K;  1BDG A;  5C2D A;  2VGM A;  1GLE G;  5AQH A;  4BRD A;  1HNX K;  1TYQ B;  2DPN A;  2P9U B;  1TKT A;  5C10 A;  3VF6 A;  3RWU A;  2OTJ N;  3HRG A;  2OYQ A;  1VBG A;  3A8Y A;  3LM9 A;  4JKG B;  2WFB A;  3BIN A;  4LD0 A;  3CCM N;  3M6G A;  3WNG A;  5I9E B;  5E26 A;  4CJF A;  1S72 N;  2FJ9 A;  5J2Q A;  1RDU A;  2CH6 A;  2QI2 A;  3DWL A;  1BU6 O;  1KSP A;  3RMB A;  4IG0 A;  1HKC A;  4BQL A;  2UYT A;  1GOA A;  3ENO A;  1VQ9 N;  4DTO A;  3ZSQ A;  3CFO A;  3ZSZ A;  1G15 A;  3VA0 A;  2YNI A;  4U67 L;  4B9N A;  3CCQ N;  3P1G A;  4GVM A;  5ELZ A;  1JDE A;  3SUQ A;  1YXQ A;  1Q18 A;  2AEH A;  3OS0 A;  2O4G A;  4FM2 A;  2V52 B;  4CFC A;  3U7D A;  5FPD A;  4BWM A;  3OYL A;  4M7X A;  2ZGY A;  3LPU A;  5GAE P;  5AZI B;  2P9S A;  2WC9 A;  4BE1 A;  5BPL A;  3TTD A;  4YOU A;  3VTI A;  4CZJ A;  3CFP A;  1CXU A;  1NK5 A;  4LF5 K;  1R59 O;  4KH5 A;  3V9S A;  5AQX A;  1HRH A;  1ACA A;  4Z4F A;  3BY5 A;  3MN6 A;  1RDB A;  1QZ5 A;  4LF8 K;  3CET A;  4KKO A;  2YNF A;  3AVG A;  4BRH A;  2VWK A;  4DLG A;  5LY3 A;  4KTZ A;  4M3T A;  2FSK A;  2QM1 A;  4EZ9 A;  1TV6 A;  2OA8 A;  5H1S Q;  5KGW A;  3KLH A;  2A40 A;  5KQ8 A;  3V1O A;  3U8Z A;  2VWJ A;  4FOE A;  3V9W A;  3J8A A;  2OZS A;  4WQ4 C;  1HQU A;  4ILH A;  2XY7 A;  1N33 K;  1T03 A;  3KD1 E;  5JLH A;  2F4V K;  1CZB A;  4E19 A;  1XMQ K;  1U48 A;  4IO9 L;  4BQZ A;  3QML A;  1B9D A;  2Z1I A;  4DR6 K;  2NRZ A;  3KLI A;  1TK0 A;  3KVG A;  4CGD A;  3ZT0 A;  3PLA A;  3LDP A;  3THX A;  4KI4 A;  5AQW A;  4BRG A;  1XI1 A;  4DLE A;  4FJ5 A;  2ZD1 A;  4DQS A;  1S1X A;  2QXF A;  3KHY A;  1I39 A;  3E9L A;  3NGY A;  1SUQ A;  2HRJ A;  4BRO A;  1KAY A;  4DU1 A;  4IFE A;  1N32 K;  4CHP A;  3K5L A;  3Q7C A;  5ADX H;  4CJW A;  4H0O A;  3TAM A;  1YUW A;  3TAP A;  4FXD A;  1ST7 A;  4JI6 K;  3J80 O;  1JLA A;  1UWB A;  2A5X A;  3R3L A;  1NU0 A;  2UU9 K;  3C6T A;  3CMA N;  2YX6 A;  2D2Q A;  1LAW A;  2OPR A;  4O8K A;  3AAR A;  2H3G X;  2X0S A;  5D3G A;  4NYN A;  4CF0 A;  4IOA L;  3G0Z A;  4B9U A;  4OPH A;  4JLH A;  1VQO N;  4O5F A;  2QW9 A;  5AQJ A;  3V1Q A;  4FJN A;  1GC6 A;  4BG9 A;  2KW4 A;  4CZM A;  4NO7 A;  1X9J A;  1SV5 A;  1XC3 A;  3QFP A;  5AQI A;  5J2N A;  1JCE A;  3TTC A;  2DFH A;  3SBG A;  5BRE A;  1FXX A;  3U6F A;  4JK7 A;  3G4S N;  5AFU A;  1IG9 A;  1WSJ A;  3U9Z A;  3H3N O;  4OX9 K;  4B1V A;  4YDU A;  3VQQ A;  5JVG L;  4UQG A;  3H3O B;  5HP1 A;  5TKW A;  2G8I A;  4DHY A;  4JKH A;  3C6U A;  4JHD A;  1QVG M;  1QHT A;  3T1H K;  2RE2 A;  4E1N A;  4CBX A;  4DG1 A;  4ISE A;  3L2R A;  4B9S A;  3QO9 A;  5DM7 L;  3DLB A;  1RDD A;  3ATU A;  4A2B A;  2E2O A;  4J2A A;  4BDP A;  4DV5 K;  1SZ2 A;  5LMN K;  2Y1J A;  4BC2 A;  4AHC A;  1GLB G;  4LC9 B;  1Q9Y A;  4C8L A;  4EP5 A;  3LM2 A;  4DFP A;  5C0Y A;  3C95 A;  2FF3 B;  4DQR A;  4CZF A;  3LZI A;  4HDO A;  3PSI A;  4OKJ A;  3BDP A;  3OBW A;  4JN4 A;  1KBL A;  4Y1C A;  1QVF M;  3OYD A;  1X1P A;  4JKA A;  3CF5 L;  3KK1 A;  4ELV A;  4JI1 K;  3GL1 A;  4BRN A;  4HUF A;  5CE3 A;  4FWR A;  3LP1 A;  3QB0 A;  1NK8 A;  4KHS A;  1QZ6 A;  3AVM A;  2KFZ A;  2O8C B;  4NCA A;  3P83 D;  4DR7 K;  2B5J A;  3ENH A;  2A6A A;  5BRD A;  1IKW A;  1K8K A;  3BZC A;  1FK9 A;  4KAZ A;  4NYF A;  4AM7 A;  5CY4 A;  1A5V A;  3V81 A;  5C25 A;  4CIE A;  3CFR A;  4LFB K;  3KKS A;  3D0P A;  3G10 A;  3OY9 A;  3NF6 A;  4CFD A;  3UKU B;  3ZSX A;  3BF3 A;  5BRF A;  3CJ7 A;  3WEE A;  3VET A;  1RTH A;  1NI2 A;  4KRE A;  1WSE A;  3K57 A;  1WAJ A;  4JI0 K;  3EY1 A;  1N8R O;  3NVM A;  2D0A A;  4BVP A;  4IJA A;  2XY5 A;  1QE1 A;  2QKK A;  4BR9 A;  3LAL A;  4WQ5 A;  2UUB K;  3WXM B;  2GEL A;  3CM5 A;  4CZE A;  4H8K A;  4MO4 A;  2FC0 A;  4DF8 A;  4CBW A;  1J6Z A;  3CQ8 A;  4DSE A;  1U04 A;  1JXB A;  2P51 A;  3C65 A;  5JLF A;  1WSG A;  1HQE A;  3ID6 A;  4FJI A;  3HPG A;  2P9K A;  3BF1 A;  4H4O A;  1JKH A;  2HOE A;  2G8F A;  3RSE A;  4FLW A;  4XEI A;  2FDQ A;  2ZPY A;  4BE2 A;  3CCL N;  3AVK A;  3QBX A;  2D0B A;  3J7Y P;  4CEA A;  1J5O A;  1RT2 A;  1EO1 A;  3RRH A;  2VQE K;  3O9Q A;  2O8B B;  4DR3 K;  3CC7 N;  1T3V A;  3HOS A;  3CC4 N;  4KV8 A;  2NRW A;  5BPM A;  4NY0 A;  2NRV A;  4K41 A;  3HP9 A;  2A1S A;  4KHN A;  4E7H A;  3M8S A;  1NVL A;  5B8H A;  3ENB A;  4OLA A;  3TSU A;  3OYM A;  3P4I A;  2B4J A;  4PWD A;  4AHT A;  3ALY A; 
#chains in the Genus database with same CATH homology
 3VEY A;  3ZX2 A;  2P9L B;  2NRT A;  4KH4 A;  4DQ8 A;  4G9Z A;  4DKW A;  3B8A X;  5JVH L;  1DT9 A;  2QA4 N;  1XQS C;  3E66 A;  2HMP A;  3FZH A;  1P8Z A;  5GAG P;  5AQY A;  3K9J A;  4GV3 A;  2J0K A;  1NGH A;  4IJN A;  2GX9 A;  2V7Z A;  3EE9 A;  3FZL A;  2IIR A;  3CCR N;  1HB8 A;  2ITM A;  1IJJ A;  3CJA A;  1MIZ B;  2Q97 A;  3CJB A;  3C6H A;  3SAG A;  1IG8 A;  3C6A A;  5FPN A;  4CD3 A;  4UY8 O;  1MK7 B;  4BRF A;  3S41 A;  4IWV A;  3PIP L;  4IOC L;  1KAX A;  2FF6 A;  5EOY A;  3VEX A;  3BEX A;  1YIJ N;  3LDL A;  4JKF A;  5AQN A;  4ZRK A;  3VEW A;  4BGA A;  2IVO A;  1YHQ N;  3LDQ A;  1C0G A;  3EKU A;  4M7Y A;  4BGB A;  4CI6 A;  5MLC Q;  3G71 N;  4BRC A;  1K73 O;  3ZDT A;  3DLL L;  4GXB A;  5AQV A;  4BRM A;  2EWS A;  4JK8 A;  5AQP A;  2AL6 A;  4GNI A;  3FLC O;  3VGK A;  3ZET A;  3EO3 A;  4JHD B;  3WQT A;  1NWK A;  5BRH A;  2EMS A;  4WYB A;  3P39 A;  3SK3 A;  4BR4 A;  3A5O C;  4IOX A;  3CI5 A;  3MN5 A;  4IXC A;  1Z05 A;  4GVE A;  4EHT A;  3AU5 A;  3E9O A;  3VGL A;  2Q0R A;  3UE5 A;  3J7Z O;  3EE8 A;  4FPA A;  3DJC A;  3HTV A;  3MMV A;  3PZD A;  4EIA A;  1U2V A;  1M1K O;  4JD2 B;  2KHO A;  1NGA A;  1G99 A;  3QIJ A;  5AZJ A;  3U4L A;  3MDQ A;  1XUP O;  1GC7 A;  3WXK A;  3DXK B;  4JAX A;  3CQY A;  4A5A A;  2Q1N A;  3FZK A;  3WXJ A;  1TUY A;  2COP A;  1VQ6 N;  1GG3 A;  3VEV A;  1KXP A;  2NNW A;  2PBD A;  2ZF5 O;  2Q31 A;  4BC5 A;  3UB5 A;  4XH4 A;  3LDN A;  4WFN L;  3OHR A;  2HBM A;  1YVN A;  2R82 A;  2F7T A;  2J0M A;  4DCH A;  1P90 A;  3LDO A;  4FL9 A;  3CQX A;  4H0X B;  4FWN A;  2NRX A;  3D2F B;  3O6W A;  1NBW A;  2HF3 A;  3O9S A;  4PKH A;  4FWM A;  4ISF A;  5BR9 A;  2E88 A;  5HL7 L;  2GWJ A;  1VQ8 N;  1K8K B;  4BY9 C;  2E2Q A;  1ATS A;  2W41 A;  5AQZ A;  3DAW A;  3O1W A;  1HB6 A;  4BR0 A;  2VGN A;  1Y64 A;  3HSC A;  1NGB A;  4BRK A;  2NRR A;  3CHW A;  2BH1 A;  3DXM A;  2P9P A;  3U8X A;  1D4X A;  2HST A;  3M3Z A;  4B1W B;  1BG3 A;  4RCH A;  4BRI A;  2YJE A;  3C0B A;  5AQF A;  4KBO A;  4OPA A;  3O8M A;  1M90 O;  3P31 A;  3C7N A;  4MLH A;  4HWI A;  5FPE A;  3WEE B;  3QFU A;  4RWT A;  5EY4 A;  3WA0 A;  3CER A;  3GBT A;  2E8A A;  1SS6 A;  2ZJP L;  1GLD G;  1TUU A;  3KWI A;  1OVY A;  3A5M C;  4U7B A;  3CJC A;  1BOT O;  2ASM A;  3CXC M;  1KC8 O;  3D6R A;  3GDQ A;  1W2B M;  1ZXO A;  3GG4 A;  3MWT A;  4YOX A;  3E9P A;  5GAD P;  3L0Q A;  1HKB A;  4FWP A;  5BPN A;  4HDQ A;  3BUZ B;  4A5B A;  3VPZ A;  1VQO N;  1LCU A;  3P38 A;  3KK7 A;  1BDG A;  5C2D A;  4B1X B;  2JWL A;  1GLE G;  2VGM A;  3CCS N;  5AQH A;  5E84 A;  4FWO A;  2J0J A;  3R9P A;  3W0L A;  4BRD A;  1LOT B;  3HOT A;  1TYQ B;  4K42 A;  2DPN A;  2P9U B;  5DM6 L;  3O80 A;  5C10 A;  3VF6 A;  2OTJ N;  3HRG A;  4YOW A;  1VBG A;  4ZRJ A;  3X23 A;  2QWO A;  3A8Y A;  5JVL A;  2ZGZ A;  3LM9 A;  4H5W A;  5KPR A;  1K9M O;  4JKG B;  2WFB A;  3BIN A;  4FWQ A;  3CCM N;  3CPE A;  3M6G A;  1GLC G;  2J4R A;  4ISG A;  3EZW A;  4M63 C;  4BG8 A;  4YOV A;  3AAQ A;  1MDU B;  5I9E B;  5E26 A;  5AQG A;  4XH5 A;  3F9M A;  1S72 N;  2FJ9 A;  4FVU A;  1RDU A;  1W97 L;  1SQK A;  1YAG A;  2CH6 A;  2QI2 A;  2V51 B;  3DWL A;  3I8B A;  1BU6 O;  2I7N A;  4B9Q A;  4C23 A;  4GY2 B;  4YDU C;  2P9K B;  3NMU A;  1HKC A;  1DIK A;  2RHK A;  2UYT A;  4BQL A;  1GLL O;  3ENO A;  1VQ9 N;  4BRQ A;  3O1B A;  3RSE B;  3L6Q A;  4WFA L;  5F2R A;  4U67 L;  4C1N I;  3CCQ N;  4CBU A;  4K25 A;  4PL8 A;  1VQP N;  5ELZ A;  1JDE A;  3O4W A;  3WXL A;  1YXQ A;  5GIN A;  3L4I A;  4FO0 A;  5KPZ A;  2JWK A;  1Q18 A;  3TU5 A;  2AEH A;  1BA0 A;  1KD1 O;  2HE7 A;  1GLA G;  3ZEU B;  2V52 B;  1OKJ A;  3U7D A;  1BA1 A;  1HKG A;  1Z6R A;  4BC4 A;  2CGJ A;  5TKY A;  4CZK A;  4CJ7 A;  5FPD A;  3QBW A;  3VEO A;  4M7X A;  5M1F A;  4PL7 A;  3FGU A;  1Q7Y O;  1E4F T;  1NLV A;  2ZJR L;  2ZGY A;  4JK9 A;  1VQM N;  1WUA A;  4DB3 A;  5GAE P;  5AZI B;  2P9S A;  1YJW N;  2WC9 A;  4A57 A;  5BPL A;  2YHY A;  3TTD A;  1HX1 A;  3UKU A;  2GUP A;  4YOU A;  3VTI A;  4CZJ A;  2V7Y A;  1R59 O;  4HTL A;  4KH5 A;  2ZWH A;  1NTI A;  5AQX A;  4Y0W A;  1JCG A;  2CQU A;  2LBB A;  1ACA A;  3HBT A;  5GIP A;  1DKG D;  3WT0 A;  5AQS A;  3MN6 A;  4DXA B;  2A41 A;  3ZX0 A;  1QZ5 A;  1Q82 O;  2AA4 A;  3CET A;  3D7E O;  4JEP A;  1YIT N;  3H45 C;  3O9R A;  2P9I A;  5CR4 A;  4BRH A;  2QWL A;  1NGG A;  5LJW A;  2D11 A;  2ASP A;  5LY3 A;  3EN9 A;  4R79 A;  1NGE A;  3MK6 A;  4CZG A;  4PKG A;  3H6E A;  3I56 N;  2FSK A;  4AF1 A;  2ZJQ L;  5AR0 A;  2QM1 A;  3VTH A;  2YVC A;  3TSP A;  1VBH A;  5H1S Q;  2IVP A;  2A40 A;  5KQ8 A;  3U8Z A;  4I6M A;  1WOQ A;  4FOE A;  3IUC A;  1Q86 O;  2D0P A;  3SMS A;  4WFB L;  3J8A A;  3ULE A;  4WQ4 C;  3MCP A;  3OW2 M;  1VQN N;  1HBK A;  4ILH A;  2A3Z A;  1C0F A;  3SJH A;  3A5L C;  4IEI A;  4AM6 A;  5JLH A;  1VQK N;  2F9W A;  4IO9 L;  4BQZ A;  3M5R A;  4BR5 A;  4H0V B;  3QML A;  5M1N A;  2NRZ A;  2ABD A;  5C12 A;  3KVG A;  5CHI A;  2D4W A;  3PLA A;  4WQ5 C;  4YOT A;  3LDP A;  4BC3 A;  3CCJ N;  5M1Q A;  3FE1 A;  4YL8 A;  1YI2 N;  5AQL A;  5AQW A;  2QWN A;  4A61 A;  4BRG A;  1GLF O;  5AQK A;  1ATN A;  1MA9 B;  4TKN A;  1U2V B;  2NLX A;  5GIO A;  3G25 A;  1NJI O;  2FSJ A;  1BWF O;  3KHY A;  3E9L A;  5AZJ B;  1V4T A;  3KZB A;  2HRJ A;  3N4P A;  4BRO A;  2Q2R A;  4KH6 A;  1KAY A;  4ILJ A;  4IFE A;  4BRL A;  5ADX A;  4H5T A;  1S3X A;  3O08 A;  3CJ1 A;  3Q7C A;  4NB4 A;  4WF9 L;  4A59 A;  5ADX H;  4H0O A;  3FZF A;  1NM1 A;  2KKZ A;  1O13 A;  1YUW A;  4PHT X;  1Y19 B;  2YHW A;  4H5V A;  1ST7 A;  4YOR A;  3WUH A;  2A5X A;  3F2K A;  3R3L A;  2A42 A;  3UKR A;  3CMA N;  4JKD A;  4GV9 A;  2YX6 A;  2D2Q A;  4H5R A;  5M1P A;  1U6Z A;  3FZM A;  4O8K A;  5JMV A;  3H1Q A;  2I7P A;  4RTF D;  2P9N A;  3KWG A;  3SAF A;  5AQT A;  1QQM A;  3AY9 A;  3CCU N;  3A0I X;  3AAR A;  1CZA N;  2X0S A;  2H3G X;  2P9L A;  1BUP A;  3JXU A;  1KQS M;  4IOA L;  2NRH A;  1QQN A;  3T69 A;  3WQU A;  3BP8 A;  3VER A;  3D2E B;  3GOI A;  1NGF A;  3HZ6 A;  1ISN A;  2E2N A;  3R1X A;  1SAZ A;  4OPH A;  4O5F A;  2QW9 A;  5AQJ A;  3VOV A;  3I55 N;  1NMD A;  3EL2 A;  3DXM B;  2I1K A;  2P9P B;  2GWK A;  1VQ5 N;  2PFU A;  1RFQ A;  1GC6 A;  4BG9 A;  4MDA A;  1NGJ A;  1E5W A;  4CZM A;  4NO7 A;  2OAN A;  2HF4 A;  1X9J A;  1XC3 A;  3QFP A;  5AQI A;  1JCE A;  2I1J A;  1X3M A;  3C7N B;  3TTC A;  5BRE A;  3SBG A;  2ASO A;  4JK7 A;  3VGM A;  3QIC A;  3G4S N;  5IJM A;  4FWK A;  3CPW M;  5AFU A;  4PKI A;  3CC2 N;  2YJF A;  3U9Z A;  4CZI A;  2VCP A;  4EKU A;  3H3N O;  5AFU H;  4B1V A;  2VWB A;  3F5T A;  4YDU A;  4CZL A;  1JCF A;  3GE1 A;  5JVG L;  3H3O B;  2CGL A;  5TKW A;  1MWK A;  4DHY A;  1ILY A;  1ZBS A;  4JKH A;  4JHD A;  1QVG M;  3L4Q A;  1GGO A;  3SBT A;  2WH5 A;  2RE2 A;  3OBY A;  4CBX A;  3MX5 A;  4E1J A;  4ISE A;  4NLC A;  2GEM A;  1Q81 O;  4JKB A;  3VMF B;  3R8E A;  5DM7 L;  5BN9 A;  1HJO A;  2KLA A;  4B1U B;  1VAZ A;  4ILG B;  3ATU A;  1H1V A;  3Q7B A;  4FWL A;  5EVZ A;  5AQR A;  4A2B A;  2E2O A;  2QWQ A;  2WUS A;  3IFR A;  1SZ2 A;  3MN9 A;  3SMP A;  4A62 A;  1K8A O;  4BC2 A;  1J19 A;  4IO8 A;  1GLB G;  4FWS A;  1ESV A;  4LC9 B;  3AGK A;  3IMX A;  4JD2 A;  5AQU A;  3JS6 A;  4C1N K;  5F1X A;  5LJV A;  2YHX A;  1T6D A;  3LM2 A;  4FPB A;  4JNE A;  5C0Y A;  2FF3 B;  4CZF A;  4HDO A;  3PIO L;  3M1F A;  3DXK A;  3OBW A;  4JN4 A;  2CB8 A;  1KBL A;  2QTD A;  1H4R A;  2HBK A;  2QWP A;  1QVF M;  1RDW X;  4JKA A;  3SLC A;  1VQ7 N;  3CF5 L;  2QEX N;  1BO5 O;  2EMT A;  3GL1 A;  3AAP A;  3WXI A;  4F7G A;  4BRN A;  3HM8 A;  3CD6 N;  5CE3 A;  3IDH A;  3QB0 A;  4FWR A;  2OTL N;  1KC7 A;  4P7I A;  3AGR A;  1QZ6 A;  1VQ4 N;  5AQQ A;  1E4G T;  4L3Q A;  3D2F A;  4CZH A;  1QHA A;  3VF4 A;  4MO5 A;  4J8F A;  1VQL N;  1V4S A;  1NGD A;  3ENH A;  2A6A A;  5BRD A;  1KAZ A;  1K8K A;  5AQO A;  4OO1 J;  4CYE A;  4AM7 A;  3ATV A;  1EF1 A;  3LL3 A;  4QS8 A;  2FXU A;  2E1Z A;  3HI0 A;  3VES A;  1YF5 L;  3SAH A;  1HPM A;  5C2F A;  3G6E N;  3NVK A;  3O9T A;  4MDB A;  4H0T B;  2P9S B;  4IEE A;  3CCV N;  2AP1 A;  2Q0U A;  3ZET B;  5GAH P;  3OA9 A;  4YOY A;  3UKU B;  3MWP A;  1EQY A;  2FSN A;  3BF3 A;  5BRF A;  3CJ7 A;  3WEE A;  5C15 A;  3VET A;  4WQ4 A;  4B1Y B;  1NI2 A;  5M1K A;  4H5N A;  4CD1 A;  4FSV A;  4F9O A;  1MIX A;  2WBN A;  1HLU A;  4O8U A;  1N8R O;  3NVM A;  4BVP A;  3EPY A;  3PVL A;  3CIP A;  2P9I B;  2QWR A;  4JKC A;  3IKM A;  4IJA A;  4BRE A;  4EAH D;  3VEZ A;  2D0O A;  2BUP A;  4GV6 A;  3W3D A;  4BR7 A;  5FPM A;  4BRP A;  2E2P A;  4BR9 A;  3CME N;  4EHU A;  4WQ5 A;  3I33 A;  1MWM A;  2Q36 A;  5EX5 A;  1ATR A;  1TYQ A;  3MN7 A;  4WCE L;  3WXM B;  2GEL A;  3EKS A;  3E1Y A;  4H0P A;  2P9U A;  5JIC A;  4CZE A;  4BVO A;  1YJ9 N;  4QS7 A;  2RQ1 A;  3D2E A;  5KPT A;  4MO4 A;  1T6C A;  4JKG A;  3QDK A;  1DEJ A;  4I6M B;  4CBW A;  5F0X A;  1J6Z A;  4MLE A;  2HBL A;  3H1V X;  4QS9 A;  3A5N C;  3FP5 A;  2DIK A;  5M1O A;  3ULE B;  4B1Z A;  2CH5 A;  3H46 O;  2NZT A;  3O5B A;  3AU4 A;  1HUX A;  3C65 A;  2FLO A;  4H03 B;  5JLF A;  4IZ9 A;  3TTF A;  3ID6 A;  4EFH A;  5BN8 A;  2D10 A;  3U9D A;  2P9K A;  3BF1 A;  3FLV A;  2E20 A;  1RGI A;  2QWM A;  5KQD A;  3ID8 A;  1NGC A;  2HOE A;  2YI1 A;  2QXL A;  4BR2 A;  3RSE A;  3TSQ A;  2GTD A;  2IVN A;  2E1Y A;  3ZX3 A;  4XEI A;  2FDQ A;  3CJ9 A;  1X3N A;  1SGH A;  1DGK N;  2ZPY A;  3R6M A;  5AQM A;  1JJ2 M;  2W40 A;  2D1K A;  3RVC A;  3T7Z A;  3VF2 A;  3IVF A;  2PAV A;  5EXW A;  1MK9 B;  3ZYY X;  3CCL N;  3N4Q A;  1T44 A;  3QBX A;  4H0Y B;  3MX2 A;  2YCH A;  3O9U A;  3CCE N;  4BRA A;  2F9T A;  1EO1 A;  3ZEU A;  4A2A A;  1YJN N;  3MCA B;  4ZRI A;  2VYP A;  4NLB A;  4Z94 A;  3O9Q A;  2CGK A;  1NGI A;  3FR0 A;  3CC7 N;  1T3V A;  3G9W A;  3HOS A;  3CC4 N;  5BPM A;  2NRW A;  5HOO A;  4XH1 A;  4NY0 A;  3VEN A;  2NRV A;  5AZI A;  3TPQ A;  4K41 A;  4FOI A;  1GLJ O;  4IDH A;  2BTF A;  1ZC6 A;  4JKE A;  3K9K A;  1NVL A;  1QQO A;  3UKR B;  3FFK B;  5B8H A;  3ENB A;  2HBJ A;  3TSU A;  1S22 A;  3P4I A;  2P9N B;  4K43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...