4JK8A

Open and closed forms of r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk8A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk8A01
3E9PA 4ILGB 4JKAA 4JKCA 4JKGA 4JK8A 4JKFA 4JKDA 4JKEA 4ILJA 3SBTA 3E9OA 4JK7A 3ENBA 4ILHA 4JKHA 4JKGB 3E9LA 3E66A 4JK9A 4JKBA 3SBGA
chains in the Genus database with same CATH superfamily
4LFCK 3IVFA 4BRFA 4PY5A 1OVQA 1ATNA 1TGOA 3B6OA 1CZBA 4NB4A 3KD5E 1VQON 4IBNA 5IWAK 3CG7A 4X66K 3CM6A 3PUFA 3EKSA 3VEZA 4O44A 1HPZA 3PLAA 1NKCA 4DG1A 4BG8A 4FCYA 3T1AA 4BQZA 4CGGA 1KD1O 5GAGP 4F8RA 3TAEA 3HVTA 3OHRA 4QS8A 5J2NA 4ZRKA 3JS6A 1RTIA 3RR7A 1OH7A 4MFBA 3VEXA 1NK0A 3FZMA 3WXJA 2G8WA 4DHYA 1HNXK 5BRHA 2HBKA 4FW1A 2I5JA 5GAEP 4H0XB 3SJJA 4C8MA 5TKWA 2YHYA 3TTDA 3CC4N 1I39A 3LAMA 2OA8A 1VQ6N 3VGLA 3OYNA 3WEEB 2KZMA 4M41A 4KTQA 2HHTA 2WONA 4JKGA 3LZIA 3HZ6A 1WSJA 4IOAL 4NYFA 5CYQA 4AF1A 2HBLA 4CBUA 3O9QA 2XY7A 1YVUA 3PY8A 3K59A 2CGKA 3K5MA 1SL2A 5ELZA 4DV5K 3ITHA 4AM6A 3IRXA 5CYMA 1W7AA 4M3XA 1ILYA 1LOTB 3PIOL 4FLXA 5EX5A 4UQGA 5KTQA 5BR8K 1W97L 2GWJA 1NGJA 4H5RA 4RW7A 3R8EA 3QERA 2HBMA 1RDWX 4CJTA 2PAVA 1HX1A 4IFYA 1SGHA 3RTVA 3RMBA 4FK2A 4M3UA 3LWMA 5F2RA 3SLCA 1ZBFA 1JLEA 4DV0K 3VEYA 5GIPA 3OBYA 3O1WA 3G0ZA 4Z4EA 3FZFA 3TAQA 5AZIA 4BQLA 3TSPA 1KVAA 5J1EA 4O5FA 4M3TA 1S1UA 2P9PA 3O1BA 1LWCA 1XC9A 4AQYK 4DR4K 4Z4IA 1JKHA 3IKMA 1OKJA 1JCFA 3WXMB 3CJAA 1LV5A 4DSLA 5FLXO 4X62K 2P9LA 3MN7A 4CK2A 3DWLA 4H5VA 3EZWA 3ZSYA 2H3GX 3KKSA 5AQYA 2FXUA 3OS2A 4B9VA 1L3TA 4EAHD 4KB0A 3L0QA 4I6MA 1S3XA 2OPPA 2QWPA 4BR2A 3QEPA 3FFKB 5J2QA 3VF4A 3E01A 4M3WA 4CFBA 2P9KA 4GY2B 4BE2A 4BDPA 4CHZA 2A1RA 2IDOA 4CZEA 3HPHA 4FWSA 1M90O 3TAMA 2CH5A 3MECA 3D2EB 1KLMA 2JGUA 3K5OA 2NRTA 2UU9K 2WC9A 4HUFA 3ULEB 5HL7L 4JAXA 1GLJO 2O8FB 4H03B 3H1QA 1IKWA 4K0KK 4NYNA 1GGOA 2D10A 1KQSM 3SMPA 1QSYA 4BRCA 3DLBA 4Y1DA 5CZ2A 4DSFA 5JLFA 4PWDA 1RDAA 2VG5A 4DFMA 3MN5A 2GWKA 4JKBA 1HMVA 2OZSA 4FJXA 3MX5A 2HB5A 3OTOK 1QTMA 1BIUA 3TTFA 4GVEA 1CZAN 1DT9A 2P9IA 5AQXA 4FLZA 5FPNA 2F8SA 1A5VA 2VGMA 3SBTA 2UUAK 2X78A 1TK5A 5KPZA 4WQ4C 1BA0A 2NRZA 3O6WA 3RMDA 3HK2A 1QHAA 4B3OA 3CFRA 4W5NA 4LC9B 5K14A 3LM2A 1FK9A 1A5XA 1P90A 2D0OA 1NMDA 2YNFA 2QK9A 3SCXA 3CMAN 1WAFA 1NNEA 2FBTA 5C2DA 1RNHA 2Q0UA 4E89A 4BC4A 2KLAA 3UE5A 4WQ5C 2KFZA 3J80O 2E88A 3J7AP 4CGHA 1YT3A 4C8LA 4RW8A 5C10A 5MLCQ 2HSTA 2W6KA 3VQAA 4B3MK 4JK8A 3AVAA 4C8KA 4DR6K 4C23A 4B1VA 3ZT0A 4I9LA 3ATUA 4PUOA 3LDPA 1U2VB 2IIRA 3CCEN 2OPRA 4KHNA 4HDQA 1TKTA 1EKEA 4YOYA 5M1PA 1YJNN 4IDHA 1VSMA 3TU5A 1BUPA 1GLDG 3K0SA 2Q2RA 2WBNA 4NCAA 5LJVA 4DLGA 2P51A 3CI5A 1VSKA 1HUXA 4H0OA 4J2EA 1MIXA 4CESA 1HKCA 5I42A 4JKEA 3CJ1A 4B8AB 3OJUA 3TSUA 4FM0A 2Z1JA 2QWLA 3TANA 3KKRA 3ZT4A 1RT4A 3O08A 3PZDA 3LP0A 4NXNK 2HF3A 1P8ZA 3JSMA 1EQYA 3P5JA 1KAZA 2VG7A 1NK8A 4J2AA 4O4GA 1VRTA 4CD3A 1HYVA 1RCHA 4JHDB 4DQQA 2E2PA 4KHPK 3DLEA 3HPGA 4B3RK 1GOCA 1TKXA 2UXCK 1ZBUA 1VQPN 1JDEA 4CJ7A 1U49A 4B9MA 3T1YK 2IS3A 3ZSXA 2P5OA 3MWPA 2ZPYA 1LW0A 2E2OA 5JS2A 4BROA 2FF6A 3R1XA 3QEXA 1L5UA 4FJNA 5FRNA 3VTIA 3MX2A 3B6PA 3AVGA 3OS1A 3WQUA 4KTZA 5I3UA 1KAYA 3N4QA 2W42A 1DLOA 1TAUA 4DCHA 4NY0A 3VEVA 2F9WA 1C6VA 5DMRA 2FDQA 3AVFA 1IG9A 2AP1A 3E9OA 3M8SA 4CZHA 1TL1A 3OBWA 3LP2A 1N34K 1ZBHA 2B5JA 2F4VK 3IFRA 3AO2A 3VENA 2I1JA 4GKJK 5J2MA 1S1XA 4A2BA 4BRPA 3CQ8A 2VWKA 4EKUA 3VGMA 2ITMA 1RFQA 2WOMA 3CHWA 4CHOA 1RILA 2A5XA 4AHRA 3KWIA 1UWBA 4ICLA 1NGEA 4DR2K 4B9LA 5AQFA 4IKFA 5CY4A 4BRQA 5SZTA 1LCUA 3PX6A 3LM9A 3CCSN 3CMEN 3HO1A 4OO1J 3CPEA 2Z1GA 2E6MA 4WQ5A 2CGJA 5M1OA 3ZX3A 5JS1A 4GNIA 3CJBA 2O8DB 1NVLA 2ZWHA 2KW4A 3HOSA 1Q9YA 3H08A 4B1ZA 1HNWK 4BRNA 1HQEA 3KWGA 3DRRA 5SWMA 1OH5A 1WSGA 1JXEA 3R9PA 1Q9XA 3MEEA 4A57A 3SUQA 5IJMA 1WAJA 3QEVA 3P31A 4GV6A 3BF1A 4CK3A 4E7KA 2QM1A 1HKBA 4OPAA 2W41A 3TAGA 4WQ4A 4Q0BA 5BPLA 1Y97A 2A41A 2RQ1A 4U67L 3A8YA 2DFHA 2JLEA 4JI0K 4FWOA 1RT6A 5AQWA 5B8HA 2GBZA 2HMPA 3P1GA 4Z94A 2YNGA 4OKEA 1IKYA 4PKHA 4DFKA 4KAZA 3IUCA 4CFAA 3WQTA 3K9KA 4HCBA 4AHUA 4FYDA 1GLEG 3ZSRA 5ADXA 4FVUA 1NKEA 3NHGA 4CHYA 2D0AA 1MK7B 2IC3A 3ULEA 3CJ7A 1NG9A 4CZKA 3UKRB 4JEPA 2NRRA 4DTJA 2VCPA 4RWTA 3SQ0A 1O1WA 4G1QA 4GV3A 2YJFA 4FWRA 3ZCMA 4M42A 3C7NA 3IMXA 4ZTFA 5ADXH 4FXDA 1VQKN 4DV2K 5FRMA 1K8KA 3WA0A 3H1VX 3BINA 2ZD1A 4Y1CA 3R6MA 4DFJA 3L8BA 2D0CA 2ZGZA 4YNQA 3DYAA 3TI0A 3LDQA 2PFUA 4O5BA 2Q36A 1HLUA 1RT3A 3BZKA 2X6NA 5HLFA 4FJ7A 3Q7CA 2A3ZA 2E6LA 4BRIA 1KC8O 3NDKA 1RTHA 1DIKA 2E2NA 4NXMK 3THWA 4DTXA 4OGEA 4ILHA 3Q7BA 3RR8A 5AZJA 1XMOK 3CCJN 2FLOA 4AM7A 1T8EA 2F96A 4E0DA 4FWQA 3BUZB 1NK6A 5C25A 4NCBA 5C12A 2OANA 4DTRA 5E26A 2HHVA 3AO4A 2RE2A 3PO5A 5LMUK 1JLFA 1VSLA 3PIPL 3T69A 3CC2N 3RSEA 3DM2A 1TKDA 3M1FA 4XIUA 4FZZA 4OKKA 3PV8A 4KBOA 1BU6O 1BIZA 4TKNA 3EO3A 1DGKN 3AV9A 4DR3K 4CFCA 3AU5A 4WFBL 4FO0A 2CQUA 3NF6A 4BC2A 4CF0A 3AAQA 2ETJA 3VOVA 1SAZA 3G10A 1IH7A 4KFBA 4CJ3A 4CJ4A 1HB8A 1JJ2M 3THWB 1VSJA 3GDQA 1TK8A 1ESVA 1ASVA 4CZGA 1IV0A 3C0BA 5KRTA 4BGBA 1C1BA 2OCEA 4BREA 2PYLA 2VG6A 2UUBK 1L3UA 4JI5K 1W9HA 3V9ZA 3L2QA 4DQ8A 4KV8A 4CECA 4CJUA 1X1PA 1SKWA 1NGIA 4BG9A 4MO5A 3O8MA 3MEGA 4JD2A 5J2PA 3LALA 5F0XA 3OYEA 1J53A 1NLVA 2J0JA 4BR4A 4BRGA 3KLGA 4NCGA 4H0VB 1SL1A 5H1SQ 4C1NK 1C0FA 4HHTA 3UKRA 2G8KA 3OYMA 3T19A 1F21A 1XHXA 1J5EK 1NJYA 3L3UA 1D4XA 1GLBG 4ID1A 4DMNA 3VTHA 1JLQA 1D9DA 2WTUA 4PL8A 4DQPA 1OVYA 4EP4A 1KRPA 1IG8A 3M6GA 5M1NA 1D9FA 4ELVA 1VQMN 3TTCA 3CXCM 4K42A 2QTDA 3S9HA 2EX3A 2E1ZA 3L3VA 1NWKA 3HXMA 4Z4FA 1HKGA 4KTWA 4E7IA 3P39A 3NH1A 4FLYA 5DK5A 3VEOA 4PL7A 2D5RA 3DRSA 4O8UA 1NK4A 2YX6A 3VF6A 3V9UA 3SYZA 3U8ZA 5AQLA 4YOWA 4L3QA 3AA4A 4J2DA 3S3OA 5AQQA 2FSNA 1J6ZA 4DLEA 4CD1A 3HOTA 3HM9A 3KLHA 2GEMA 1NGHA 1VSEA 1IBKK 3GG4A 3X23A 3OYGA 4CJLA 2KHOA 3SK3A 4CZMA 1YJWN 4ZRIA 2O8EA 5JVGL 5FPDA 2QWNA 3OYFA 4CJEA 3PSIA 4FWKA 1RBTA 3V1RA 2PYJA 5KGWA 2YHBA 1S5JA 4OX9K 4IJNA 3NH2A 4FVMA 4DQSA 1BHLA 1RDDA 4JI3K 4B8CA 3H6EA 4IDKA 1HJOA 1LAVA 4HTLA 4FOIA 2O8FA 4H5NA 4CHNA 4DKWA 3S3NA 1E4GT 4BR9A 1ATRA 1C0MA 2CH6A 4FJGA 4QCLA 1BOTO 4JKFA 4DS5A 2HHHK 3NCIA 3CPWM 2RHKA 3D2EA 2QI2A 3MN9A 4Z4GA 5E41A 3V1QA 2PZSA 2XY8A 3SQ1A 1JL2A 4X64K 4Y0WA 1Q7YO 1LWEA 2P9NA 1I94K 3ZYYX 1U48A 3CFOA 3VPZA 4MO4A 3NVKA 4B9TA 3SAFA 4ISFA 1S6PA 2B6AA 3CM5A 5AQHA 3VERA 1GOAA 5KRSA 2QWRA 3O3GA 4IXCA 1QS4A 4FOEA 5M1FA 2HF4A 2WH5A 3V9WA 2EMTA 2DFFA 5BRFA 3BY5A 2WFBA 4JHDA 4FM2A 5KPTA 3UKUB 3L4QA 1ATSA 4CHQA 2RPIA 2P9PB 3DXMB 3V6DA 3AVNA 3O9TA 2J0MA 1C0UA 1B92A 2OZMA 2X0SA 2Q3SA 4B9QA 3G4SN 4FJIA 2O8EB 4KH4A 2VWJA 3QINA 3VA0A 3ENHA 4DR7K 3DLKA 3D45A 3K58A 4PA1A 2F8TA 3MWTA 4R79A 2BTFA 3U6FA 3U7DA 3WXIA 1EWQA 1OH6A 4JK9A 2HNZA 1EWRA 2YHAA 4HWIA 1QHTA 3F9MA 4XEIA 2YVCA 3O3FA 4F9OA 3SAHA 4FLUA 3SI6A 3NMUA 1NK7A 2P1JA 3GOIA 3KD1E 1KFDA 1U2VA 1RTJA 3ULDA 1CXUA 3ENBA 4DR5K 1IBLK 1T05A 2HE7A 1VQLN 2BDPA 1GLAG 3LL3A 4C1NI 3EEQA 2O8BA 5HOOA 3MCPA 5CR4A 2XY6A 5CHIA 1ST7A 2O8CB 1BCMA 4OKJA 2QWOA 1WB9A 1J54A 5TKYA 3VQ9A 4K8ZA 2YKNA 3GL1A 4RW4A 3JYTA 3RVCA 5C0YA 1YUWA 3QLHA 1KFSA 1X3MA 2FSKA 1TYQA 2ABDA 4NLCA 3ZSZA 4OGCA 4BC5A 1VSHA 4CJPA 1VQNN 1DKGD 3VQEA 2ASOA 3HTVA 2V51B 3CCRN 5EXWA 3LAKA 3NFAA 3ZEUB 3I8DA 5BREA 1JLGA 2V7YA 1ZYQA 2ZE2A 3I33A 4RG8A 1J19A 5I9EB 4DV7K 2LBBA 3QMLA 3WEEA 1BISA 3WT0A 5M1KA 3DLRA 4Q5VA 3NAEA 1NJIO 3H46O 4R5PA 4BRKA 3CCUN 1YI2N 1WNSA 3TSQA 3UKUA 4CGJA 1SV5A 3ID6A 1X3NA 4F7GA 1IKVA 4DSJA 1RBRA 3AA5X 2QKBA 3ZT1A 4GMJB 2Q31A 1R59O 3N4PA 1KTQA 2G8IA 4OPJA 1L3VA 3THXA 4DV1K 5JMVA 3OYHA 1FKPA 1QZ6A 3EE8A 4DTMA 2YHWA 4CFDA 5AFUH 3QEIA 3VQ6A 2HRJA 2LSNA 3KIOA 1GLLO 4LSNA 4B1WB 4KB1A 4MQ3A 3O9UA 3OVNA 4CVNE 3CCMN 1D5AA 5AQJA 1REVA 1Q86O 2UXBK 1BCOA 4ISGA 2VGNA 4DUZK 3L2RA 1SL0A 1S1TA 5AQUA 3ZSWA 4CJ5A 1BL3A 1NGCA 3C65A 2D0PA 1HPMA 4N47A 1K6YA 4FLWA 3CIPA 3DLLL 4IOXA 3A5OC 3FR0A 2G8HA 2A42A 2BUPA 3NGIA 3C6AA 3SUPA 3EE9A 1SZ2A 2WUSA 3DOLA 3K57A 1S1VA 3P4IA 1JCEA 1FW6A 4CHPA 3T3FA 2KZZA 4BE1A 2FC0A 4K41A 4B9UA 3SPZA 5JVLA 4H4MA 4X65K 4AILC 1TUUA 4QOZB 4G9ZA 1KVCA 4JI6K 2HMIA 1J9AA 3S41A 1WBDA 2ZF5O 2I7PA 2FBVA 4BC3A 3AVBA 4HVJA 2HVIA 4CGFA 5GAHP 1XQSC 3O4WA 3ATVA 4H5WA 3O5BA 4YDUA 3LDOA 2Z1HA 4BWJA 3QBXA 2ASMA 4BR7A 4FK0A 1K9MO 2DTUA 3VQ4A 5LL6Z 3VESA 4EZ9A 3WXKA 3MXJA 4KH6A 3FFIA 1G15A 3ZEUA 3AVLA 4BDZA 3ASMA 4DF4A 2DIKA 4BRMA 1G99A 5IT9O 4CZLA 1U04A 5KGXA 4CI6A 5BRDA 1RT2A 3RMCA 3A5NC 4M3YA 5DM6L 3CJ9A 2YV0X 4CJQA 1VQ5N 2UYTA 3MN6A 4JRPA 4OJRA 1K8AO 2O4GA 4XH5A 1V4SA 4FPBA 5KPRA 3QBWA 1U6ZA 4DWIA 4CEOA 3ZETA 1YIJN 4DU1A 2HHQA 1WN7A 1TVRA 1GLFO 3WXLA 4EIAA 2NRVA 4JKHA 4CF8A 3ZDTA 1VHXA 4IWVA 3U9ZA 3ID8A 1TYQB 1MIZB 4FJLA 1HNVA 3SV4A 3THYA 4RW9A 5KQ8A 3OYDA 3VGKA 2GUPA 3QETA 4CZJA 4IO8A 3QFPA 3HBTA 3RMAA 4HUGA 2O8CA 2OPQA 1QQOA 2V52B 4KH5A 3VQBA 4YDUC 3V81A 5DM7L 3HRGA 2O8BB 4F3TA 1ZC6A 3O4QA 2FBYA 4E7HA 1FKOA 4BACA 5AJ3K 5CZ1A 1XNRK 2IVPA 2ZJPL 5BN9A 2QWMA 5AR0A 2KKZA 4ISEA 5HP1A 2ZM6K 3KLFA 2QXFA 3H45C 1JCGA 4EFHA 1FJGK 1ZBIA 1S9GA 2PBDA 1QVGM 3VQ7A 3AARA 4AHVA 2A40A 2QEXN 3CQXA 1KAXA 4I2PA 4BRAA 5CE3A 2QXLA 1ZBLA 4CEQA 3KTQA 3O80A 3AVIA 1XMQK 1Q8IA 2HHUA 1KBLA 1I3AA 4E7JA 3AO5A 4F2SA 3DMJA 4JLHA 5JVHL 3F9KA 4IOCL 3HI0A 1TL3A 4RCHA 3WNHA 4KI6A 3QIPA 4E3SA 3OYLA 1HR0K 3AY9A 3HSCA 1NK5A 1B9FA 3ALYA 5AQPA 1H4RA 3WNEA 3PSFA 2G8UA 4W5QA 2W40A 2YI1A 2DFEA 1EO1A 4I2QA 3AVHA 1TUYA 1MDUB 2GUIA 4M63C 4W5OA 1NOZA 1VAZA 2A1SA 1VSDA 2FSJA 4CF9A 3L2VA 4DTUA 1Q81O 3JAMO 3H3OB 4FW2A 5C42A 1RDUA 2E20A 2YNHA 4JKDA 1YHQN 4F4KA 3SV3A 4DTSA 3TARA 2GTDA 3TR8A 3CD6N 4Z4CA 3MXIA 1K8KB 2HHSA 2P9NB 2UXDK 1TAQA 3DRPA 3K5LA 5EOYA 3E9LA 3OYCA 2NUBA 2Q1NA 4DV4K 1SKRA 3ZLJA 1SS6A 4WCEL 1QQNA 3E9PA 2YHXA 3HJFA 4BRDA 4KHSA 4DR1K 3HSTB 3OS0A 4QAGA 1VQ8N 1YXQA 3VMFB 1ASWA 4JI2K 4H0TB 4N56A 3EZ5A 2DPNA 4OVLA 2D0BA 4CF2A 1WLJA 4OLBA 2IVOA 3FGUA 4DV3K 4LFBK 4CEEA 2Q0RA 3RRHA 1R0AA 3F5TA 1NMNA 4I7FA 3MEDA 3OW2M 4QS7A 4TSXA 4FJ9A 3WUHA 1NTIA 2QW9A 4DF8A 4LH4A 3O9SA 3V9XA 4O8KA 3ZSQA 4DU3A 1N5YA 1Z05A 4JKAA 2JWLA 4FL9A 5FPMA 1ZXOA 3G25A 4CJKA 5HROA 1FXXA 1BG3A 3KLEA 4DSKA 2EWSA 4GXBA 4CGDA 2BE2A 4H5TA 3EKUA 5AZIB 3J81O 4B3SK 4BR0A 4EHTA 4LY7A 3FZLA 4MDBA 4LF4K 4BVPA 3AVMA 4CIEA 3MXMA 3HT3A 5LY3A 5LMNK 2E4LA 3DJCA 4PKIA 1ASUA 1Z6RA 1QQMA 3A5MC 5D3GA 4E1MA 4ELTA 2P9IB 3SMSA 3KK7A 2EMSA 1CZ9A 1NGGA 3VQ5A 2NRHA 2J0KA 3CYMA 3VETA 1NI2A 5GINA 1VBHA 2ITGA 3DAWA 3CCVN 2QWQA 1T03A 4ILJA 3QNNA 3HM8A 1DTQA 4ZTJA 4FZYA 5EVZA 4BE0A 1EXQA 1GG3A 3HP9A 3ZETB 5JICA 2Y1JA 4JKGB 1B9DA 3C6UA 1RT5A 1RGIA 1LWFA 2D2QA 2CB8A 4JV5K 4K25A 3T7ZA 3BZCA 2YKMA 4BRHA 2BANA 4A59A 3QFUA 5HBMA 3OYIA 3QEWA 1N8RO 4DQRA 4JD2B 3G71N 3O4NA 4CCHA 3UB5A 2OTLN 4KI4A 4EZ6A 3D0PA 2Q97A 3VEWA 4IO9L 1VQ7N 3FLCO 4H0YB 2P9LB 4BRLA 2P9UA 1MK9B 4YHHK 3D7EO 4E1NA 4PHTX 5AQZA 1C1AA 3LP1A 4E19A 1RBUA 3OJSA 1YVNA 3NF9A 3QIOA 3R3LA 1O13A 1KVBA 5AQOA 2UUCK 1M1KO 3CERA 4BGAA 3NE6A 4F2RA 3CQYA 3L2WA 2GELA 4I9QA 2JWKA 1HJRA 3WNGA 3KJVA 3RSEB 3FZKA 3BEXA 3NVMA 4B1XB 2V7ZA 4LFAK 4FLTA 2G8FA 2X74A 5A2QO 4JKCA 1X9SA 3NF8A 4DQIA 4YL8A 4OLAA 1WSHA 1UAXA 3OYKA 4IFEA 1LAWA 4J8FA 3AGRA 4QS9A 4CJRA 1CLQA 1DEJA 4YOTA 4LF7K 4GVMA 5LJWA 2D1KA 3NBPA 1TV6A 4LF5K 3AGKA 4FJ8A 4JI4K 3D2FA 4WFAL 3VQDA 3SZ2A 2IGIA 1BI4A 2G8VA 1NJZA 1E3MA 1HBKA 2EHGA 1T44A 1UOCA 3LPTA 1S9EA 1SQKA 3M3ZA 5FDLA 4CF1A 2P5GA 1NGAA 3M8RA 2OTJN 2HOEA 3VN5A 4E1JA 2FBXA 1X9WA 3THVA 1HYZA 4F3OA 5BR9A 1NBWA 5EY4A 1NJXA 4MLEA 3DXKA 4BY9C 4B3TK 3F73A 4OPHA 1HB6A 4JI8K 3U3YA 2E5LK 1V4TA 3IDHA 1WBBA 1T3VA 3KK2A 3SBGA 1Q18A 3LDSA 1XC3A 4DTPA 3TAFA 1BA1A 4OPKA 1VBGA 4M45A 3LZJA 4JRQA 2YJEA 3SPYA 1Y64A 3QDKA 4IEEA 4CGIA 3IS9A 1SUQA 3LWLA 3OYAA 4YOXA 2IVNA 3G9WA 3C94A 3KHYA 3SUOA 1XI1A 1SKSA 4B9NA 4V19S 4N5SA 4N76A 1BWFO 3IG1A 3CFPA 1QZ5A 4NO7A 1GLCG 2IOCA 2OPSA 3ZT3A 4K8XA 3AO1A 1D8YA 1BI4B 4B1YB 1H1VA 1N32K 3TWHA 1KCFA 3DXKB 1GC6A 4EHUA 4A5BA 4CYEA 4CEBA 4LD0A 4YY3K 3OYBA 4FLVA 4FJMA 4CEZA 4CEAA 4FJJA 1ZBSA 4WF9L 1BQNA 3T1HK 3QESA 1RT1A 1S1WA 2E1YA 4IEIA 1NU0A 3FLVA 3MK6A 4H0PA 4JI1K 1WSFA 3AO3A 2O4IA 3ZT2A 3M5RA 2FF3B 2HHXA 2PY5A 3RWUA 2CGLA 4RW6A 3I56N 2VQFK 4KRFA 4KHWA 4L8RB 4ZRJA 1Z26A 3SAGA 3I8BA 1IO2A 4FM1A 1MU2A 2P9KB 4GW6A 5HRPA 4CIGA 3QO9A 4KREA 4FSVA 4I6MB 4WFNL 4C8NA 2E2QA 2AEHA 2F7TA 2KTQA 3BGRA 3ISNC 4P7IA 4LF6K 4JI7K 3EYZA 3EL2A 2RF2A 3E1YA 2ZQBA 4CBWA 1IKXA 2HNDA 1RT7A 1NJWA 3PVLA 4CIFA 5AQRA 3NF7A 1K73O 4CEFA 4H8KA 3HPOA 1X9MA 2KQ2A 4H4OA 4DU4A 1T6DA 3PX4A 2ASPA 1WSIA 2VYPA 3CETA 2VWBA 3ENOA 3TABA 2P9UB 1W2BM 1YITN 5M1QA 3IAYA 2ZJRL 1HRHA 3EPYA 1S22A 1X9JA 2D4WA 4FPAA 1QE1A 5JLHA 2BGGA 4KO0A 2P9SA 3DI6A 4CERA 4A62A 4LH5A 3MMVA 4IG3A 4NLBA 3H3NO 3PO4A 1YAGA 3BDPA 3ZSVA 5AQGA 4KHUA 1KLNA 2HVHA 2X6SA 1RTDA 2HW3A 1A5WA 1ISNA 3C7NB 3AVCA 3KVGA 4W5TA 1T6CA 3EN9A 5AQMA 5F1XA 3THYB 4LF8K 1WOQA 4ELUA 2FJ9A 2A6AA 3BP8A 4FWNA 4A2AA 2NRXA 2QA4N 1N6QA 2AL6A 4CJWA 3WNFA 2NNWA 1GC7A 4IZ9A 4CEDA 3QICA 2F9TA 3HL8A 3SQ4A 4O0JA 1NKBA 2P9SB 3D6RA 4AHSA 4LF9K 3A2FA 4DTNA 1IJJA 3LDNA 4YOUA 1NM1A 1VQ9N 1QSLA 1HNIA 4FWLA 4DSIA 3LANA 3GE1A 1Y19B 1JLBA 4B9SA 1WSEA 3FE1A 3OY9A 1NGFA 1XUPO 3DLGA 1JXBA 3SNNA 3DOKA 4WE1A 5HRSA 3PX0A 3I55N 1YF5L 1E4FT 3O9RA 5GIOA 2D11A 3SQ2A 3U4LA 3J7ZO 4FJHA 4UY8O 3AVJA 4FJKA 1EF1A 4XH4A 4B08A 3KLIA 4AHTA 4N41A 1VSFA 4B1UB 1IBMK 1MWKA 3OA9A 3TPQA 3KK1A 2I1KA 1J5OA 5AZJB 4CW7B 4FJ5A 2R7YA 5HRNA 1NK9A 3VF2A 2OYQA 1OH8A 1N33K 4JS5A 4JN4A 4W5RA 2HHWA 4LSLA 2XRIA 4DTOA 3QB0A 2Y1IA 3CC7N 2AJQA 1RDBA 4KPYA 2AA4A 3V4IA 2VQEK 3B8AX 4MLHA 1QQCA 2Z1IA 5C15A 3U8XA 1EETA 5T7BA 3BF3A 5C2FA 4DS4A 1S6QA 4WYBA 3W3DA 3MDQA 3V9SA 4XH1A 3MAQA 1MA9B 2XY5A 4GKKK 3NH0A 3VQQA 2RKIA 3C95A 4U7BA 5BN8A 3P38A 4RTFD 4K43A 4C8OA 1QSSA 1W0HA 4KHYA 2BH1A 2COPA 3THXB 3QNOA 3CCLN 3I0SA 4IFVA 3CJCA 4DFPA 1BGXT 1C0GA 2ATQA 1VQ4N 3JXUA 3KZBA 2W6LA 5AQNA 3GBTA 2DY4A 3LP3A 3LDLA 2RN2A 3ZSOA 4EP5A 1JLCA 1NGDA 4GV9A 1TK0A 2NLXA 3A5LC 4AHCA 4CK1A 1RDCA 2QKKA 1KSPA 1QVFM 4Z0UA 4O55A 4ILGB 4YOVA 3AU4A 5E84A 4HUEA 1YTUA 1EP4A 2IAJA 4JS4A 4J2BA 4M3RA 3AA2A 5BPNA 1XNQK 1RBVA 3UIQA 1ITGA 5KI6A 2YNIA 3J7YP 2O8DA 4YFUA 4DB3A 2HBJA 3DLHA 5AFUA 3FP5A 1T7PA 2ZGYA 1E5WA 4BWMA 3AVKA 3V1OA 1XHZA 1Z25A 4ZHRA 4CJVA 4A5AA 3NGZA 1VSIA 3VA3A 1ACAA 3HYFA 4M3ZA 4BDYA 3CF5L 4E7LA 4MDAA 3M8PA 4O0IA 1TKZA 1EX4A 3L6QA 3ZX0A 3C6TA 2J4RA 3K2PA 3C6HA 1YTAA 4DV6K 4CJSA 2ZJQL 2GX9A 4PKGA 4KKOA 3FZHA 3K9JA 3HP6A 3ZX2A 4DSEA 5AQSA 5GADP 3J8AA 1YJ9N 3EY1A 2E8AA 3K5NA 3I0RA 4FWMA 1KC7A 3VQPA 4FK4A 1LW2A 3L2UA 1KXPA 1RBSA 4IG0A 4JYAK 2GV9A 2R82A 4ID5A 1U45A 1JL1A 3G6EN 1GOBA 2HNYA 4CJFA 5BPMA 3CCQN 1NGBA 4HCCA 4CE9A 3NGYA 3W0LA 4FWPA 1UA0A 3DXMA 4YORA 1BO5O 1BQMA 3M8QA 4A61A 1HQUA 5FROA 4IJAA 3P83D 1XWLA 5AQVA 1VK0A 2YCHA 4JNEA 5AQKA 1CXQA 3OYJA 5FPEA 4FZXC 4HDOA 3U3GA 3A0IX 3E66A 5HRRA 1WUAA 4BVOA 3TAPA 4BR5A 1UA1A 1HNZK 5C24A 3SUNA 4Z4HA 1HYSA 3U9DA 1U47A 5AQIA 3S3MA 3LPUA 4CZFA 1BDGA 3O3HA 4M7YA 3L4IA 1MWMA 3F2KA 1N36K 4HTUA 2KFNA 4M7XA 4DXAB 4KHQA 1JLAA 2I7NA 1U4BA 3SJHA 2NZTA 1S72N 3KK3A 5AQTA 3QIJA 3D2FB 4CBXA 3VQ8A 4DUYK 3VQCA 1Q82O 1VRUA 2B4JA 1C0TA 2NRWA 4JK7A 1C1CA 4CZIA 5EU7A 3RRGA 4AH9A 5KQDA 1NOYA 2XO7A 3HVRA 2XHBA 3AA3A 3MCAB 1DTTA 4PQUA 1L3SA 3AAPA
chains in the Genus database with same CATH topology
1QZ5A 1TUUA 4NO7A 3IVFA 1GLCG 4G9ZA 4BRFA 1MK7B 3ULEA 3CJ7A 4CZKA 3UKRB 4JEPA 2NRRA 3S41A 2VCPA 2ZF5O 1H1VA 1ATNA 4B1YB 4RWTA 4GV3A 4GV9A 2I7PA 2YJFA 4FWRA 4NB4A 4BC3A 1VQON 3DXKB 1GC6A 4EHUA 4A5BA 5GAHP 3C7NA 1XQSC 3IMXA 4CYEA 3O4WA 5ADXH 3ATVA 4H5WA 1VQKN 3O5BA 1K8KA 4YDUA 3EKSA 3LDOA 3VEZA 3WA0A 3H1VX 3BINA 1ZBSA 3R6MA 4WF9L 3PLAA 3QBXA 2ZGZA 2ASMA 4BG8A 4BR7A 2E1YA 4IEIA 4BQZA 1K9MO 3LDQA 3FLVA 2PFUA 1KD1O 3MK6A 4H0PA 5GAGP 2Q36A 1HLUA 3VESA 3OHRA 3M5RA 4QS8A 2FF3B 4ZRKA 2A3ZA 3JS6A 3Q7CA 3WXKA 4BRIA 2CGLA 4KH6A 1KC8O 3I56N 3VEXA 3ZEUA 3FZMA 3WXJA 1DIKA 2E2NA 4ZRJA 2DIKA 4DHYA 4BRMA 1G99A 3SAGA 4ILHA 4CZLA 5BRHA 2HBKA 4CI6A 5BRDA 3Q7BA 3I8BA 5AZJA 3A5NC 3CCJN 2FLOA 5GAEP 4AM7A 4H0XB 2P9KB 5DM6L 4FWQA 3BUZB 3CJ9A 1VQ5N 4FSVA 2YHYA 2OANA 5TKWA 4I6MB 2UYTA 3MN6A 3TTDA 5C12A 5E26A 3VGLA 4WFNL 3CC4N 1K8AO 1VQ6N 2E2QA 2AEHA 4XH5A 1V4SA 3WEEB 4FPBA 5KPRA 2RE2A 2F7TA 3QBWA 4JKGA 1U6ZA 4P7IA 3HZ6A 4IOAL 3ZETA 1YIJN 4AF1A 3EL2A 2HBLA 4CBUA 3PIPL 3T69A 3CC2N 3E1YA 3O9QA 3RSEA 4CBWA 1GLFO 3WXLA 3M1FA 4EIAA 2NRVA 2CGKA 4KBOA 4JKHA 1BU6O 3ZDTA 4TKNA 3EO3A 4IWVA 5ELZA 3PVLA 3U9ZA 3ID8A 1DGKN 4AM6A 1TYQB 5AQRA 1MIZB 1K73O 3AU5A 4WFBL 1ILYA 4FO0A 2CQUA 1LOTB 4BC2A 3PIOL 5EX5A 3AAQA 3VOVA 1SAZA 5KQ8A 1W97L 3VGKA 1T6DA 2GUPA 4CZJA 2ASPA 1NGJA 2GWJA 3QFPA 1HB8A 4H5RA 3HBTA 4IO8A 3R8EA 1JJ2M 2VYPA 3GDQA 2V52B 1QQOA 1ESVA 2VWBA 2HBMA 3CETA 3ENOA 4KH5A 2P9UB 1RDWX 4CZGA 3C0BA 2PAVA 4YDUC 5DM7L 1HX1A 4BGBA 1W2BM 4BREA 3HRGA 1YITN 1ZC6A 1SGHA 5M1QA 2ZJRL 5F2RA 3SLCA 1S22A 3EPYA 1X9JA 2D4WA 2IVPA 4FPAA 2ZJPL 5JLHA 5BN9A 2P9SA 2QWMA 5AR0A 2KKZA 3VEYA 4A62A 4DQ8A 4ISEA 3MMVA 5GIPA 4NLBA 3H3NO 3OBYA 1NGIA 1YAGA 3O1WA 4BG9A 4MO5A 5AQGA 3H45C 3FZFA 3O8MA 1JCGA 4EFHA 5AZIA 4BQLA 4JD2A 2PBDA 1QVGM 3TSPA 5F0XA 1ISNA 3AARA 3C7NB 3KVGA 1NLVA 2J0JA 1T6CA 3EN9A 2A40A 4O5FA 5AQMA 4BR4A 4BRGA 5F1XA 2QEXN 1WOQA 2P9PA 3O1BA 3CQXA 1KAXA 4H0VB 2FJ9A 2A6AA 3BP8A 4FWNA 4A2AA 4BRAA 2NRXA 2QXLA 1C0FA 4C1NK 5CE3A 2AL6A 5H1SQ 2QA4N 3UKRA 3O80A 2NNWA 1GC7A 4IZ9A 3IKMA 3QICA 1OKJA 2F9TA 1JCFA 1KBLA 3WXMB 1D4XA 1GLBG 3CJAA 5JVHL 3VTHA 4IOCL 3HI0A 2P9LA 3MN7A 4RCHA 3DWLA 2P9SB 4H5VA 3D6RA 3EZWA 4PL8A 2H3GX 1OVYA 5AQYA 2FXUA 3AY9A 1IG8A 3HSCA 3M6GA 5M1NA 4EAHD 1VQMN 1IJJA 3LDNA 3TTCA 3L0QA 4YOUA 4I6MA 1NM1A 1S3XA 2QWPA 4BR2A 5AQPA 1H4RA 3FFKB 2QTDA 4FWLA 4K42A 3VF4A 3CXCM 2P9KA 2E1ZA 2W40A 4GY2B 3GE1A 1Y19B 1NWKA 2YI1A 1EO1A 1HKGA 1TUYA 4CZEA 3FE1A 4FWSA 1MDUB 4M63C 1M90O 1NGFA 1XUPO 1VAZA 2CH5A 3P39A 2FSJA 3VEOA 4PL7A 4O8UA 3I55N 3D2EB 2YX6A 1YF5L 1E4FT 3VF6A 3O9RA 3U8ZA 5AQLA 4YOWA 1Q81O 4L3QA 2D11A 3H3OB 5GIOA 2NRTA 5AQQA 3U4LA 2FSNA 2WC9A 1J6ZA 3ULEB 1RDUA 2E20A 3J7ZO 4CD1A 3HOTA 5HL7L 4JKDA 1YHQN 2GEMA 1NGHA 3GG4A 3X23A 4UY8O 4JAXA 1EF1A 1GLJO 2GTDA 4H03B 4XH4A 3H1QA 3CD6N 2KHOA 3SK3A 1K8KB 4CZMA 2P9NB 1GGOA 4ZRIA 1YJWN 2D10A 1KQSM 3SMPA 5JVGL 4BRCA 4B1UB 5FPDA 1MWKA 5JLFA 2QWNA 5EOYA 3E9LA 3OA9A 2Q1NA 3TPQA 1SS6A 4FWKA 1QQNA 2I1KA 2GWKA 3MN5A 4WCEL 4JKBA 3MX5A 5AZJB 3E9PA 2YHXA 3TTFA 4GVEA 4BRDA 1CZAN 1DT9A 2P9IA 5AQXA 3VF2A 1VQ8N 1YXQA 5FPNA 3VMFB 4JN4A 4H0TB 2DPNA 4IJNA 2VGMA 3SBTA 2IVOA 3FGUA 2Q0RA 3F5TA 5KPZA 3QB0A 4WQ4C 3OW2M 4QS7A 3CC7N 3H6EA 1BA0A 2AA4A 2NRZA 3WUHA 3B8AX 4MLHA 3O6WA 1NTIA 1HJOA 4HTLA 4FOIA 4H5NA 2QW9A 4DKWA 3O9SA 1QHAA 1E4GT 4O8KA 4BR9A 5C15A 1ATRA 4LC9B 3LM2A 3U8XA 2CH6A 1P90A 2D0OA 1Z05A 3BF3A 4JKAA 1NMDA 2JWLA 4FL9A 5FPMA 5C2FA 1BOTO 1ZXOA 4JKFA 3CMAN 4WYBA 3W3DA 3DLLL 3MDQA 3G25A 5C2DA 4XH1A 3CPWM 2RHKA 1BG3A 3D2EA 2QI2A 2EWSA 2Q0UA 3MN9A 1MA9B 4GXBA 4BC4A 1Q7YO 2KLAA 4H5TA 4Y0WA 3UE5A 4U7BA 2P9NA 3EKUA 4WQ5C 5AZIB 3ZYYX 4BR0A 4EHTA 5BN8A 2E88A 3P38A 4RTFD 4K43A 3VPZA 3FZLA 4MO4A 4MDBA 3NVKA 4BVPA 3SAFA 4ISFA 2BH1A 2COPA 5AQHA 3CCLN 3VERA 5C10A 5MLCQ 5LY3A 2HSTA 4JK8A 3CJCA 2QWRA 4C23A 4B1VA 4IXCA 3DJCA 4FOEA 1C0GA 5M1FA 3ATUA 4PKIA 3LDPA 2HF4A 2WH5A 1U2VB 1VQ4N 2IIRA 3JXUA 3CCEN 3KZBA 2EMTA 5AQNA 1Z6RA 3GBTA 1QQMA 3A5MC 5BRFA 3LDLA 4HDQA 4YOYA 2P9IB 5M1PA 1YJNN 4IDHA 3KK7A 3SMSA 1NGDA 2WFBA 2EMSA 1NGGA 4JHDA 3TU5A 1BUPA 1GLDG 2NLXA 2NRHA 2Q2RA 2WBNA 3A5LC 3UKUB 3L4QA 5KPTA 5LJVA 2J0KA 1ATSA 3CI5A 3VETA 3DXMB 2P9PB 1NI2A 1HUXA 4H0OA 5GINA 3O9TA 2J0MA 1QVFM 1MIXA 1VBHA 2X0SA 4B9QA 3G4SN 1HKCA 4ILGB 3DAWA 3CCVN 2QWQA 4KH4A 4YOVA 3AU4A 4JKEA 4ILJA 3CJ1A 5E84A 3TSUA 3HM8A 2QWLA 3ENHA 5EVZA 5BPNA 1GG3A 3ZETB 3O08A 5JICA 4JKGB 3PZDA 3MWTA 4DB3A 2HF3A 2HBJA 2BTFA 4R79A 1P8ZA 5AFUA 1RGIA 3FP5A 3U7DA 2D2QA 2CB8A 3WXIA 1EQYA 4K25A 3T7ZA 4JK9A 1KAZA 2ZGYA 4BRHA 1E5WA 4HWIA 4CD3A 3QFUA 4A59A 3F9MA 4JHDB 4XEIA 2YVCA 2E2PA 1N8RO 4F9OA 4JD2B 3SAHA 3G71N 3NMUA 4A5AA 1JDEA 1VQPN 3GOIA 4CJ7A 1ACAA 1U2VA 3UB5A 2OTLN 3MWPA 3CF5L 3ENBA 2ZPYA 4MDAA 2E2OA 4BROA 2HE7A 2FF6A 3R1XA 5B8HA 1VQLN 2Q97A 3VEWA 4IO9L 1GLAG 3LL3A 4C1NI 3L6QA 3FLCO 3ZX0A 1VQ7N 4H0YB 3VTIA 2J4RA 2P9LB 3MCPA 5CR4A 3MX2A 4BRLA 3C6HA 5CHIA 5HOOA 1ST7A 3WQUA 2P9UA 2ZJQL 1MK9B 1KAYA 2GX9A 4PKGA 3N4QA 3FZHA 3K9JA 3D7EO 4DCHA 2QWOA 4NY0A 3VEVA 3ZX2A 5TKYA 2F9WA 3GL1A 5AQSA 5AQZA 4PHTX 5GADP 2FDQA 1VQ9N 3J8AA 3RVCA 5C0YA 1YUWA 1YJ9N 1YVNA 2AP1A 2E8AA 3R3LA 3E9OA 1O13A 1X3MA 4FWMA 1KC7A 2FSKA 1TYQA 5AQOA 4CZHA 2ABDA 3CERA 3OBWA 4NLCA 4BC5A 4BGAA 1M1KO 3IFRA 1VQNN 1KXPA 1DKGD 3CQYA 3VENA 2ASOA 3HTVA 2V51B 2I1JA 3CCRN 2GELA 2JWKA 5EXWA 2R82A 4A2BA 3RSEB 3FZKA 4BRPA 3BEXA 3G6EN 3NVMA 4B1XB 3ZEUB 4EKUA 2V7ZA 5BPMA 3VGMA 5BREA 2ITMA 2V7YA 1RFQA 3CCQN 1NGBA 3I33A 1J19A 5I9EB 4JKCA 2LBBA 3QMLA 4YL8A 3CHWA 3WEEA 3W0LA 3WT0A 4FWPA 5M1KA 1NJIO 3H46O 3DXMA 4BRKA 2A5XA 3CCUN 4YORA 3KWIA 4IFEA 1YI2N 1BO5O 4J8FA 3TSQA 3UKUA 4A61A 3AGRA 4QS9A 3ID6A 1X3NA 1DEJA 4YOTA 1NGEA 4F7GA 4IJAA 5LJWA 5AQFA 5AQVA 2YCHA 4BRQA 4JNEA 2D1KA 1LCUA 3AGKA 3LM9A 5AQKA 3CCSN 5FPEA 3CMEN 4OO1J 4HDOA 3D2FA 3A0IX 3CPEA 3E66A 4WFAL 1WUAA 4BVOA 2Q31A 4WQ5A 1R59O 4BR5A 2CGJA 5M1OA 3ZX3A 3N4PA 4GNIA 1HBKA 3CJBA 1NVLA 2ZWHA 3U9DA 3HOSA 5AQIA 1T44A 4B1ZA 4BRNA 1SQKA 3M3ZA 4CZFA 1BDGA 5JMVA 1NGAA 1QZ6A 3KWGA 3EE8A 2OTJN 2HOEA 2YHWA 4M7YA 4E1JA 3L4IA 1MWMA 3R9PA 5AFUH 3F2KA 4A57A 2HRJA 5IJMA 1GLLO 4B1WB 3P31A 5BR9A 4GV6A 3BF1A 1NBWA 2QM1A 1HKBA 5EY4A 4M7XA 4MLEA 4DXAB 3DXKA 3O9UA 4OPAA 4BY9C 3CCMN 4OPHA 1HB6A 5AQJA 2I7NA 2W41A 3SJHA 1Q86O 1V4TA 3IDHA 4WQ4A 5BPLA 1T3VA 2NZTA 3SBGA 1S72N 1Q18A 1XC3A 5AQTA 3QIJA 2A41A 3D2FB 4ISGA 2RQ1A 1BA1A 2VGNA 4CBXA 4U67L 1VBGA 3A8YA 5AQUA 4FWOA 1Q82O 1NGCA 3C65A 2D0PA 1HPMA 2NRWA 2YJEA 5AQWA 1Y64A 3CIPA 4JK7A 2HMPA 4Z94A 4IOXA 3A5OC 3FR0A 4CZIA 2A42A 3QDKA 2BUPA 4IEEA 4PKHA 3C6AA 3IUCA 3EE9A 1SZ2A 3WQTA 2WUSA 2IVNA 4YOXA 5KQDA 3G9WA 3KHYA 3P4IA 3K9KA 1JCEA 3MCAB 1BWFO 1GLEG 4K41A 5ADXA 4FVUA 5JVLA 3AAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9P A;  4ILG B;  4JKA A;  4JKC A;  4JKG A;  4JK8 A;  4JKF A;  4JKD A;  4JKE A;  4ILJ A;  3SBT A;  3E9O A;  4JK7 A;  3ENB A;  4ILH A;  4JKH A;  4JKG B;  3E9L A;  3E66 A;  4JK9 A;  4JKB A;  3SBG A; 
#chains in the Genus database with same CATH topology
 4LFC K;  3IVF A;  4BRF A;  4PY5 A;  1OVQ A;  1ATN A;  1TGO A;  3B6O A;  1CZB A;  4NB4 A;  3KD5 E;  1VQO N;  4IBN A;  5IWA K;  3CG7 A;  4X66 K;  3CM6 A;  3PUF A;  3EKS A;  3VEZ A;  4O44 A;  1HPZ A;  3PLA A;  1NKC A;  4DG1 A;  4BG8 A;  4FCY A;  3T1A A;  4BQZ A;  4CGG A;  1KD1 O;  5GAG P;  4F8R A;  3TAE A;  3HVT A;  3OHR A;  4QS8 A;  5J2N A;  4ZRK A;  3JS6 A;  1RTI A;  3RR7 A;  1OH7 A;  4MFB A;  3VEX A;  1NK0 A;  3FZM A;  3WXJ A;  2G8W A;  4DHY A;  1HNX K;  5BRH A;  2HBK A;  4FW1 A;  2I5J A;  5GAE P;  4H0X B;  3SJJ A;  4C8M A;  5TKW A;  2YHY A;  3TTD A;  3CC4 N;  1I39 A;  3LAM A;  2OA8 A;  1VQ6 N;  3VGL A;  3OYN A;  3WEE B;  2KZM A;  4M41 A;  4KTQ A;  2HHT A;  2WON A;  4JKG A;  3LZI A;  3HZ6 A;  1WSJ A;  4IOA L;  4NYF A;  5CYQ A;  4AF1 A;  2HBL A;  4CBU A;  3O9Q A;  2XY7 A;  1YVU A;  3PY8 A;  3K59 A;  2CGK A;  3K5M A;  1SL2 A;  5ELZ A;  4DV5 K;  3ITH A;  4AM6 A;  3IRX A;  5CYM A;  1W7A A;  4M3X A;  1ILY A;  1LOT B;  3PIO L;  4FLX A;  5EX5 A;  4UQG A;  5KTQ A;  5BR8 K;  1W97 L;  2GWJ A;  1NGJ A;  4H5R A;  4RW7 A;  3R8E A;  3QER A;  2HBM A;  1RDW X;  4CJT A;  2PAV A;  1HX1 A;  4IFY A;  1SGH A;  3RTV A;  3RMB A;  4FK2 A;  4M3U A;  3LWM A;  5F2R A;  3SLC A;  1ZBF A;  1JLE A;  4DV0 K;  3VEY A;  5GIP A;  3OBY A;  3O1W A;  3G0Z A;  4Z4E A;  3FZF A;  3TAQ A;  5AZI A;  4BQL A;  3TSP A;  1KVA A;  5J1E A;  4O5F A;  4M3T A;  1S1U A;  2P9P A;  3O1B A;  1LWC A;  1XC9 A;  4AQY K;  4DR4 K;  4Z4I A;  1JKH A;  3IKM A;  1OKJ A;  1JCF A;  3WXM B;  3CJA A;  1LV5 A;  4DSL A;  5FLX O;  4X62 K;  2P9L A;  3MN7 A;  4CK2 A;  3DWL A;  4H5V A;  3EZW A;  3ZSY A;  2H3G X;  3KKS A;  5AQY A;  2FXU A;  3OS2 A;  4B9V A;  1L3T A;  4EAH D;  4KB0 A;  3L0Q A;  4I6M A;  1S3X A;  2OPP A;  2QWP A;  4BR2 A;  3QEP A;  3FFK B;  5J2Q A;  3VF4 A;  3E01 A;  4M3W A;  4CFB A;  2P9K A;  4GY2 B;  4BE2 A;  4BDP A;  4CHZ A;  2A1R A;  2IDO A;  4CZE A;  3HPH A;  4FWS A;  1M90 O;  3TAM A;  2CH5 A;  3MEC A;  3D2E B;  1KLM A;  2JGU A;  3K5O A;  2NRT A;  2UU9 K;  2WC9 A;  4HUF A;  3ULE B;  5HL7 L;  4JAX A;  1GLJ O;  2O8F B;  4H03 B;  3H1Q A;  1IKW A;  4K0K K;  4NYN A;  1GGO A;  2D10 A;  1KQS M;  3SMP A;  1QSY A;  4BRC A;  3DLB A;  4Y1D A;  5CZ2 A;  4DSF A;  5JLF A;  4PWD A;  1RDA A;  2VG5 A;  4DFM A;  3MN5 A;  2GWK A;  4JKB A;  1HMV A;  2OZS A;  4FJX A;  3MX5 A;  2HB5 A;  3OTO K;  1QTM A;  1BIU A;  3TTF A;  4GVE A;  1CZA N;  1DT9 A;  2P9I A;  5AQX A;  4FLZ A;  5FPN A;  2F8S A;  1A5V A;  2VGM A;  3SBT A;  2UUA K;  2X78 A;  1TK5 A;  5KPZ A;  4WQ4 C;  1BA0 A;  2NRZ A;  3O6W A;  3RMD A;  3HK2 A;  1QHA A;  4B3O A;  3CFR A;  4W5N A;  4LC9 B;  5K14 A;  3LM2 A;  1FK9 A;  1A5X A;  1P90 A;  2D0O A;  1NMD A;  2YNF A;  2QK9 A;  3SCX A;  3CMA N;  1WAF A;  1NNE A;  2FBT A;  5C2D A;  1RNH A;  2Q0U A;  4E89 A;  4BC4 A;  2KLA A;  3UE5 A;  4WQ5 C;  2KFZ A;  3J80 O;  2E88 A;  3J7A P;  4CGH A;  1YT3 A;  4C8L A;  4RW8 A;  5C10 A;  5MLC Q;  2HST A;  2W6K A;  3VQA A;  4B3M K;  4JK8 A;  3AVA A;  4C8K A;  4DR6 K;  4C23 A;  4B1V A;  3ZT0 A;  4I9L A;  3ATU A;  4PUO A;  3LDP A;  1U2V B;  2IIR A;  3CCE N;  2OPR A;  4KHN A;  4HDQ A;  1TKT A;  1EKE A;  4YOY A;  5M1P A;  1YJN N;  4IDH A;  1VSM A;  3TU5 A;  1BUP A;  1GLD G;  3K0S A;  2Q2R A;  2WBN A;  4NCA A;  5LJV A;  4DLG A;  2P51 A;  3CI5 A;  1VSK A;  1HUX A;  4H0O A;  4J2E A;  1MIX A;  4CES A;  1HKC A;  5I42 A;  4JKE A;  3CJ1 A;  4B8A B;  3OJU A;  3TSU A;  4FM0 A;  2Z1J A;  2QWL A;  3TAN A;  3KKR A;  3ZT4 A;  1RT4 A;  3O08 A;  3PZD A;  3LP0 A;  4NXN K;  2HF3 A;  1P8Z A;  3JSM A;  1EQY A;  3P5J A;  1KAZ A;  2VG7 A;  1NK8 A;  4J2A A;  4O4G A;  1VRT A;  4CD3 A;  1HYV A;  1RCH A;  4JHD B;  4DQQ A;  2E2P A;  4KHP K;  3DLE A;  3HPG A;  4B3R K;  1GOC A;  1TKX A;  2UXC K;  1ZBU A;  1VQP N;  1JDE A;  4CJ7 A;  1U49 A;  4B9M A;  3T1Y K;  2IS3 A;  3ZSX A;  2P5O A;  3MWP A;  2ZPY A;  1LW0 A;  2E2O A;  5JS2 A;  4BRO A;  2FF6 A;  3R1X A;  3QEX A;  1L5U A;  4FJN A;  5FRN A;  3VTI A;  3MX2 A;  3B6P A;  3AVG A;  3OS1 A;  3WQU A;  4KTZ A;  5I3U A;  1KAY A;  3N4Q A;  2W42 A;  1DLO A;  1TAU A;  4DCH A;  4NY0 A;  3VEV A;  2F9W A;  1C6V A;  5DMR A;  2FDQ A;  3AVF A;  1IG9 A;  2AP1 A;  3E9O A;  3M8S A;  4CZH A;  1TL1 A;  3OBW A;  3LP2 A;  1N34 K;  1ZBH A;  2B5J A;  2F4V K;  3IFR A;  3AO2 A;  3VEN A;  2I1J A;  4GKJ K;  5J2M A;  1S1X A;  4A2B A;  4BRP A;  3CQ8 A;  2VWK A;  4EKU A;  3VGM A;  2ITM A;  1RFQ A;  2WOM A;  3CHW A;  4CHO A;  1RIL A;  2A5X A;  4AHR A;  3KWI A;  1UWB A;  4ICL A;  1NGE A;  4DR2 K;  4B9L A;  5AQF A;  4IKF A;  5CY4 A;  4BRQ A;  5SZT A;  1LCU A;  3PX6 A;  3LM9 A;  3CCS N;  3CME N;  3HO1 A;  4OO1 J;  3CPE A;  2Z1G A;  2E6M A;  4WQ5 A;  2CGJ A;  5M1O A;  3ZX3 A;  5JS1 A;  4GNI A;  3CJB A;  2O8D B;  1NVL A;  2ZWH A;  2KW4 A;  3HOS A;  1Q9Y A;  3H08 A;  4B1Z A;  1HNW K;  4BRN A;  1HQE A;  3KWG A;  3DRR A;  5SWM A;  1OH5 A;  1WSG A;  1JXE A;  3R9P A;  1Q9X A;  3MEE A;  4A57 A;  3SUQ A;  5IJM A;  1WAJ A;  3QEV A;  3P31 A;  4GV6 A;  3BF1 A;  4CK3 A;  4E7K A;  2QM1 A;  1HKB A;  4OPA A;  2W41 A;  3TAG A;  4WQ4 A;  4Q0B A;  5BPL A;  1Y97 A;  2A41 A;  2RQ1 A;  4U67 L;  3A8Y A;  2DFH A;  2JLE A;  4JI0 K;  4FWO A;  1RT6 A;  5AQW A;  5B8H A;  2GBZ A;  2HMP A;  3P1G A;  4Z94 A;  2YNG A;  4OKE A;  1IKY A;  4PKH A;  4DFK A;  4KAZ A;  3IUC A;  4CFA A;  3WQT A;  3K9K A;  4HCB A;  4AHU A;  4FYD A;  1GLE G;  3ZSR A;  5ADX A;  4FVU A;  1NKE A;  3NHG A;  4CHY A;  2D0A A;  1MK7 B;  2IC3 A;  3ULE A;  3CJ7 A;  1NG9 A;  4CZK A;  3UKR B;  4JEP A;  2NRR A;  4DTJ A;  2VCP A;  4RWT A;  3SQ0 A;  1O1W A;  4G1Q A;  4GV3 A;  2YJF A;  4FWR A;  3ZCM A;  4M42 A;  3C7N A;  3IMX A;  4ZTF A;  5ADX H;  4FXD A;  1VQK N;  4DV2 K;  5FRM A;  1K8K A;  3WA0 A;  3H1V X;  3BIN A;  2ZD1 A;  4Y1C A;  3R6M A;  4DFJ A;  3L8B A;  2D0C A;  2ZGZ A;  4YNQ A;  3DYA A;  3TI0 A;  3LDQ A;  2PFU A;  4O5B A;  2Q36 A;  1HLU A;  1RT3 A;  3BZK A;  2X6N A;  5HLF A;  4FJ7 A;  3Q7C A;  2A3Z A;  2E6L A;  4BRI A;  1KC8 O;  3NDK A;  1RTH A;  1DIK A;  2E2N A;  4NXM K;  3THW A;  4DTX A;  4OGE A;  4ILH A;  3Q7B A;  3RR8 A;  5AZJ A;  1XMO K;  3CCJ N;  2FLO A;  4AM7 A;  1T8E A;  2F96 A;  4E0D A;  4FWQ A;  3BUZ B;  1NK6 A;  5C25 A;  4NCB A;  5C12 A;  2OAN A;  4DTR A;  5E26 A;  2HHV A;  3AO4 A;  2RE2 A;  3PO5 A;  5LMU K;  1JLF A;  1VSL A;  3PIP L;  3T69 A;  3CC2 N;  3RSE A;  3DM2 A;  1TKD A;  3M1F A;  4XIU A;  4FZZ A;  4OKK A;  3PV8 A;  4KBO A;  1BU6 O;  1BIZ A;  4TKN A;  3EO3 A;  1DGK N;  3AV9 A;  4DR3 K;  4CFC A;  3AU5 A;  4WFB L;  4FO0 A;  2CQU A;  3NF6 A;  4BC2 A;  4CF0 A;  3AAQ A;  2ETJ A;  3VOV A;  1SAZ A;  3G10 A;  1IH7 A;  4KFB A;  4CJ3 A;  4CJ4 A;  1HB8 A;  1JJ2 M;  3THW B;  1VSJ A;  3GDQ A;  1TK8 A;  1ESV A;  1ASV A;  4CZG A;  1IV0 A;  3C0B A;  5KRT A;  4BGB A;  1C1B A;  2OCE A;  4BRE A;  2PYL A;  2VG6 A;  2UUB K;  1L3U A;  4JI5 K;  1W9H A;  3V9Z A;  3L2Q A;  4DQ8 A;  4KV8 A;  4CEC A;  4CJU A;  1X1P A;  1SKW A;  1NGI A;  4BG9 A;  4MO5 A;  3O8M A;  3MEG A;  4JD2 A;  5J2P A;  3LAL A;  5F0X A;  3OYE A;  1J53 A;  1NLV A;  2J0J A;  4BR4 A;  4BRG A;  3KLG A;  4NCG A;  4H0V B;  1SL1 A;  5H1S Q;  4C1N K;  1C0F A;  4HHT A;  3UKR A;  2G8K A;  3OYM A;  3T19 A;  1F21 A;  1XHX A;  1J5E K;  1NJY A;  3L3U A;  1D4X A;  1GLB G;  4ID1 A;  4DMN A;  3VTH A;  1JLQ A;  1D9D A;  2WTU A;  4PL8 A;  4DQP A;  1OVY A;  4EP4 A;  1KRP A;  1IG8 A;  3M6G A;  5M1N A;  1D9F A;  4ELV A;  1VQM N;  3TTC A;  3CXC M;  4K42 A;  2QTD A;  3S9H A;  2EX3 A;  2E1Z A;  3L3V A;  1NWK A;  3HXM A;  4Z4F A;  1HKG A;  4KTW A;  4E7I A;  3P39 A;  3NH1 A;  4FLY A;  5DK5 A;  3VEO A;  4PL7 A;  2D5R A;  3DRS A;  4O8U A;  1NK4 A;  2YX6 A;  3VF6 A;  3V9U A;  3SYZ A;  3U8Z A;  5AQL A;  4YOW A;  4L3Q A;  3AA4 A;  4J2D A;  3S3O A;  5AQQ A;  2FSN A;  1J6Z A;  4DLE A;  4CD1 A;  3HOT A;  3HM9 A;  3KLH A;  2GEM A;  1NGH A;  1VSE A;  1IBK K;  3GG4 A;  3X23 A;  3OYG A;  4CJL A;  2KHO A;  3SK3 A;  4CZM A;  1YJW N;  4ZRI A;  2O8E A;  5JVG L;  5FPD A;  2QWN A;  3OYF A;  4CJE A;  3PSI A;  4FWK A;  1RBT A;  3V1R A;  2PYJ A;  5KGW A;  2YHB A;  1S5J A;  4OX9 K;  4IJN A;  3NH2 A;  4FVM A;  4DQS A;  1BHL A;  1RDD A;  4JI3 K;  4B8C A;  3H6E A;  4IDK A;  1HJO A;  1LAV A;  4HTL A;  4FOI A;  2O8F A;  4H5N A;  4CHN A;  4DKW A;  3S3N A;  1E4G T;  4BR9 A;  1ATR A;  1C0M A;  2CH6 A;  4FJG A;  4QCL A;  1BOT O;  4JKF A;  4DS5 A;  2HHH K;  3NCI A;  3CPW M;  2RHK A;  3D2E A;  2QI2 A;  3MN9 A;  4Z4G A;  5E41 A;  3V1Q A;  2PZS A;  2XY8 A;  3SQ1 A;  1JL2 A;  4X64 K;  4Y0W A;  1Q7Y O;  1LWE A;  2P9N A;  1I94 K;  3ZYY X;  1U48 A;  3CFO A;  3VPZ A;  4MO4 A;  3NVK A;  4B9T A;  3SAF A;  4ISF A;  1S6P A;  2B6A A;  3CM5 A;  5AQH A;  3VER A;  1GOA A;  5KRS A;  2QWR A;  3O3G A;  4IXC A;  1QS4 A;  4FOE A;  5M1F A;  2HF4 A;  2WH5 A;  3V9W A;  2EMT A;  2DFF A;  5BRF A;  3BY5 A;  2WFB A;  4JHD A;  4FM2 A;  5KPT A;  3UKU B;  3L4Q A;  1ATS A;  4CHQ A;  2RPI A;  2P9P B;  3DXM B;  3V6D A;  3AVN A;  3O9T A;  2J0M A;  1C0U A;  1B92 A;  2OZM A;  2X0S A;  2Q3S A;  4B9Q A;  3G4S N;  4FJI A;  2O8E B;  4KH4 A;  2VWJ A;  3QIN A;  3VA0 A;  3ENH A;  4DR7 K;  3DLK A;  3D45 A;  3K58 A;  4PA1 A;  2F8T A;  3MWT A;  4R79 A;  2BTF A;  3U6F A;  3U7D A;  3WXI A;  1EWQ A;  1OH6 A;  4JK9 A;  2HNZ A;  1EWR A;  2YHA A;  4HWI A;  1QHT A;  3F9M A;  4XEI A;  2YVC A;  3O3F A;  4F9O A;  3SAH A;  4FLU A;  3SI6 A;  3NMU A;  1NK7 A;  2P1J A;  3GOI A;  3KD1 E;  1KFD A;  1U2V A;  1RTJ A;  3ULD A;  1CXU A;  3ENB A;  4DR5 K;  1IBL K;  1T05 A;  2HE7 A;  1VQL N;  2BDP A;  1GLA G;  3LL3 A;  4C1N I;  3EEQ A;  2O8B A;  5HOO A;  3MCP A;  5CR4 A;  2XY6 A;  5CHI A;  1ST7 A;  2O8C B;  1BCM A;  4OKJ A;  2QWO A;  1WB9 A;  1J54 A;  5TKY A;  3VQ9 A;  4K8Z A;  2YKN A;  3GL1 A;  4RW4 A;  3JYT A;  3RVC A;  5C0Y A;  1YUW A;  3QLH A;  1KFS A;  1X3M A;  2FSK A;  1TYQ A;  2ABD A;  4NLC A;  3ZSZ A;  4OGC A;  4BC5 A;  1VSH A;  4CJP A;  1VQN N;  1DKG D;  3VQE A;  2ASO A;  3HTV A;  2V51 B;  3CCR N;  5EXW A;  3LAK A;  3NFA A;  3ZEU B;  3I8D A;  5BRE A;  1JLG A;  2V7Y A;  1ZYQ A;  2ZE2 A;  3I33 A;  4RG8 A;  1J19 A;  5I9E B;  4DV7 K;  2LBB A;  3QML A;  3WEE A;  1BIS A;  3WT0 A;  5M1K A;  3DLR A;  4Q5V A;  3NAE A;  1NJI O;  3H46 O;  4R5P A;  4BRK A;  3CCU N;  1YI2 N;  1WNS A;  3TSQ A;  3UKU A;  4CGJ A;  1SV5 A;  3ID6 A;  1X3N A;  4F7G A;  1IKV A;  4DSJ A;  1RBR A;  3AA5 X;  2QKB A;  3ZT1 A;  4GMJ B;  2Q31 A;  1R59 O;  3N4P A;  1KTQ A;  2G8I A;  4OPJ A;  1L3V A;  3THX A;  4DV1 K;  5JMV A;  3OYH A;  1FKP A;  1QZ6 A;  3EE8 A;  4DTM A;  2YHW A;  4CFD A;  5AFU H;  3QEI A;  3VQ6 A;  2HRJ A;  2LSN A;  3KIO A;  1GLL O;  4LSN A;  4B1W B;  4KB1 A;  4MQ3 A;  3O9U A;  3OVN A;  4CVN E;  3CCM N;  1D5A A;  5AQJ A;  1REV A;  1Q86 O;  2UXB K;  1BCO A;  4ISG A;  2VGN A;  4DUZ K;  3L2R A;  1SL0 A;  1S1T A;  5AQU A;  3ZSW A;  4CJ5 A;  1BL3 A;  1NGC A;  3C65 A;  2D0P A;  1HPM A;  4N47 A;  1K6Y A;  4FLW A;  3CIP A;  3DLL L;  4IOX A;  3A5O C;  3FR0 A;  2G8H A;  2A42 A;  2BUP A;  3NGI A;  3C6A A;  3SUP A;  3EE9 A;  1SZ2 A;  2WUS A;  3DOL A;  3K57 A;  1S1V A;  3P4I A;  1JCE A;  1FW6 A;  4CHP A;  3T3F A;  2KZZ A;  4BE1 A;  2FC0 A;  4K41 A;  4B9U A;  3SPZ A;  5JVL A;  4H4M A;  4X65 K;  4AIL C;  1TUU A;  4QOZ B;  4G9Z A;  1KVC A;  4JI6 K;  2HMI A;  1J9A A;  3S41 A;  1WBD A;  2ZF5 O;  2I7P A;  2FBV A;  4BC3 A;  3AVB A;  4HVJ A;  2HVI A;  4CGF A;  5GAH P;  1XQS C;  3O4W A;  3ATV A;  4H5W A;  3O5B A;  4YDU A;  3LDO A;  2Z1H A;  4BWJ A;  3QBX A;  2ASM A;  4BR7 A;  4FK0 A;  1K9M O;  2DTU A;  3VQ4 A;  5LL6 Z;  3VES A;  4EZ9 A;  3WXK A;  3MXJ A;  4KH6 A;  3FFI A;  1G15 A;  3ZEU A;  3AVL A;  4BDZ A;  3ASM A;  4DF4 A;  2DIK A;  4BRM A;  1G99 A;  5IT9 O;  4CZL A;  1U04 A;  5KGX A;  4CI6 A;  5BRD A;  1RT2 A;  3RMC A;  3A5N C;  4M3Y A;  5DM6 L;  3CJ9 A;  2YV0 X;  4CJQ A;  1VQ5 N;  2UYT A;  3MN6 A;  4JRP A;  4OJR A;  1K8A O;  2O4G A;  4XH5 A;  1V4S A;  4FPB A;  5KPR A;  3QBW A;  1U6Z A;  4DWI A;  4CEO A;  3ZET A;  1YIJ N;  4DU1 A;  2HHQ A;  1WN7 A;  1TVR A;  1GLF O;  3WXL A;  4EIA A;  2NRV A;  4JKH A;  4CF8 A;  3ZDT A;  1VHX A;  4IWV A;  3U9Z A;  3ID8 A;  1TYQ B;  1MIZ B;  4FJL A;  1HNV A;  3SV4 A;  3THY A;  4RW9 A;  5KQ8 A;  3OYD A;  3VGK A;  2GUP A;  3QET A;  4CZJ A;  4IO8 A;  3QFP A;  3HBT A;  3RMA A;  4HUG A;  2O8C A;  2OPQ A;  1QQO A;  2V52 B;  4KH5 A;  3VQB A;  4YDU C;  3V81 A;  5DM7 L;  3HRG A;  2O8B B;  4F3T A;  1ZC6 A;  3O4Q A;  2FBY A;  4E7H A;  1FKO A;  4BAC A;  5AJ3 K;  5CZ1 A;  1XNR K;  2IVP A;  2ZJP L;  5BN9 A;  2QWM A;  5AR0 A;  2KKZ A;  4ISE A;  5HP1 A;  2ZM6 K;  3KLF A;  2QXF A;  3H45 C;  1JCG A;  4EFH A;  1FJG K;  1ZBI A;  1S9G A;  2PBD A;  1QVG M;  3VQ7 A;  3AAR A;  4AHV A;  2A40 A;  2QEX N;  3CQX A;  1KAX A;  4I2P A;  4BRA A;  5CE3 A;  2QXL A;  1ZBL A;  4CEQ A;  3KTQ A;  3O80 A;  3AVI A;  1XMQ K;  1Q8I A;  2HHU A;  1KBL A;  1I3A A;  4E7J A;  3AO5 A;  4F2S A;  3DMJ A;  4JLH A;  5JVH L;  3F9K A;  4IOC L;  3HI0 A;  1TL3 A;  4RCH A;  3WNH A;  4KI6 A;  3QIP A;  4E3S A;  3OYL A;  1HR0 K;  3AY9 A;  3HSC A;  1NK5 A;  1B9F A;  3ALY A;  5AQP A;  1H4R A;  3WNE A;  3PSF A;  2G8U A;  4W5Q A;  2W40 A;  2YI1 A;  2DFE A;  1EO1 A;  4I2Q A;  3AVH A;  1TUY A;  1MDU B;  2GUI A;  4M63 C;  4W5O A;  1NOZ A;  1VAZ A;  2A1S A;  1VSD A;  2FSJ A;  4CF9 A;  3L2V A;  4DTU A;  1Q81 O;  3JAM O;  3H3O B;  4FW2 A;  5C42 A;  1RDU A;  2E20 A;  2YNH A;  4JKD A;  1YHQ N;  4F4K A;  3SV3 A;  4DTS A;  3TAR A;  2GTD A;  3TR8 A;  3CD6 N;  4Z4C A;  3MXI A;  1K8K B;  2HHS A;  2P9N B;  2UXD K;  1TAQ A;  3DRP A;  3K5L A;  5EOY A;  3E9L A;  3OYC A;  2NUB A;  2Q1N A;  4DV4 K;  1SKR A;  3ZLJ A;  1SS6 A;  4WCE L;  1QQN A;  3E9P A;  2YHX A;  3HJF A;  4BRD A;  4KHS A;  4DR1 K;  3HST B;  3OS0 A;  4QAG A;  1VQ8 N;  1YXQ A;  3VMF B;  1ASW A;  4JI2 K;  4H0T B;  4N56 A;  3EZ5 A;  2DPN A;  4OVL A;  2D0B A;  4CF2 A;  1WLJ A;  4OLB A;  2IVO A;  3FGU A;  4DV3 K;  4LFB K;  4CEE A;  2Q0R A;  3RRH A;  1R0A A;  3F5T A;  1NMN A;  4I7F A;  3MED A;  3OW2 M;  4QS7 A;  4TSX A;  4FJ9 A;  3WUH A;  1NTI A;  2QW9 A;  4DF8 A;  4LH4 A;  3O9S A;  3V9X A;  4O8K A;  3ZSQ A;  4DU3 A;  1N5Y A;  1Z05 A;  4JKA A;  2JWL A;  4FL9 A;  5FPM A;  1ZXO A;  3G25 A;  4CJK A;  5HRO A;  1FXX A;  1BG3 A;  3KLE A;  4DSK A;  2EWS A;  4GXB A;  4CGD A;  2BE2 A;  4H5T A;  3EKU A;  5AZI B;  3J81 O;  4B3S K;  4BR0 A;  4EHT A;  4LY7 A;  3FZL A;  4MDB A;  4LF4 K;  4BVP A;  3AVM A;  4CIE A;  3MXM A;  3HT3 A;  5LY3 A;  5LMN K;  2E4L A;  3DJC A;  4PKI A;  1ASU A;  1Z6R A;  1QQM A;  3A5M C;  5D3G A;  4E1M A;  4ELT A;  2P9I B;  3SMS A;  3KK7 A;  2EMS A;  1CZ9 A;  1NGG A;  3VQ5 A;  2NRH A;  2J0K A;  3CYM A;  3VET A;  1NI2 A;  5GIN A;  1VBH A;  2ITG A;  3DAW A;  3CCV N;  2QWQ A;  1T03 A;  4ILJ A;  3QNN A;  3HM8 A;  1DTQ A;  4ZTJ A;  4FZY A;  5EVZ A;  4BE0 A;  1EXQ A;  1GG3 A;  3HP9 A;  3ZET B;  5JIC A;  2Y1J A;  4JKG B;  1B9D A;  3C6U A;  1RT5 A;  1RGI A;  1LWF A;  2D2Q A;  2CB8 A;  4JV5 K;  4K25 A;  3T7Z A;  3BZC A;  2YKM A;  4BRH A;  2BAN A;  4A59 A;  3QFU A;  5HBM A;  3OYI A;  3QEW A;  1N8R O;  4DQR A;  4JD2 B;  3G71 N;  3O4N A;  4CCH A;  3UB5 A;  2OTL N;  4KI4 A;  4EZ6 A;  3D0P A;  2Q97 A;  3VEW A;  4IO9 L;  1VQ7 N;  3FLC O;  4H0Y B;  2P9L B;  4BRL A;  2P9U A;  1MK9 B;  4YHH K;  3D7E O;  4E1N A;  4PHT X;  5AQZ A;  1C1A A;  3LP1 A;  4E19 A;  1RBU A;  3OJS A;  1YVN A;  3NF9 A;  3QIO A;  3R3L A;  1O13 A;  1KVB A;  5AQO A;  2UUC K;  1M1K O;  3CER A;  4BGA A;  3NE6 A;  4F2R A;  3CQY A;  3L2W A;  2GEL A;  4I9Q A;  2JWK A;  1HJR A;  3WNG A;  3KJV A;  3RSE B;  3FZK A;  3BEX A;  3NVM A;  4B1X B;  2V7Z A;  4LFA K;  4FLT A;  2G8F A;  2X74 A;  5A2Q O;  4JKC A;  1X9S A;  3NF8 A;  4DQI A;  4YL8 A;  4OLA A;  1WSH A;  1UAX A;  3OYK A;  4IFE A;  1LAW A;  4J8F A;  3AGR A;  4QS9 A;  4CJR A;  1CLQ A;  1DEJ A;  4YOT A;  4LF7 K;  4GVM A;  5LJW A;  2D1K A;  3NBP A;  1TV6 A;  4LF5 K;  3AGK A;  4FJ8 A;  4JI4 K;  3D2F A;  4WFA L;  3VQD A;  3SZ2 A;  2IGI A;  1BI4 A;  2G8V A;  1NJZ A;  1E3M A;  1HBK A;  2EHG A;  1T44 A;  1UOC A;  3LPT A;  1S9E A;  1SQK A;  3M3Z A;  5FDL A;  4CF1 A;  2P5G A;  1NGA A;  3M8R A;  2OTJ N;  2HOE A;  3VN5 A;  4E1J A;  2FBX A;  1X9W A;  3THV A;  1HYZ A;  4F3O A;  5BR9 A;  1NBW A;  5EY4 A;  1NJX A;  4MLE A;  3DXK A;  4BY9 C;  4B3T K;  3F73 A;  4OPH A;  1HB6 A;  4JI8 K;  3U3Y A;  2E5L K;  1V4T A;  3IDH A;  1WBB A;  1T3V A;  3KK2 A;  3SBG A;  1Q18 A;  3LDS A;  1XC3 A;  4DTP A;  3TAF A;  1BA1 A;  4OPK A;  1VBG A;  4M45 A;  3LZJ A;  4JRQ A;  2YJE A;  3SPY A;  1Y64 A;  3QDK A;  4IEE A;  4CGI A;  3IS9 A;  1SUQ A;  3LWL A;  3OYA A;  4YOX A;  2IVN A;  3G9W A;  3C94 A;  3KHY A;  3SUO A;  1XI1 A;  1SKS A;  4B9N A;  4V19 S;  4N5S A;  4N76 A;  1BWF O;  3IG1 A;  3CFP A;  1QZ5 A;  4NO7 A;  1GLC G;  2IOC A;  2OPS A;  3ZT3 A;  4K8X A;  3AO1 A;  1D8Y A;  1BI4 B;  4B1Y B;  1H1V A;  1N32 K;  3TWH A;  1KCF A;  3DXK B;  1GC6 A;  4EHU A;  4A5B A;  4CYE A;  4CEB A;  4LD0 A;  4YY3 K;  3OYB A;  4FLV A;  4FJM A;  4CEZ A;  4CEA A;  4FJJ A;  1ZBS A;  4WF9 L;  1BQN A;  3T1H K;  3QES A;  1RT1 A;  1S1W A;  2E1Y A;  4IEI A;  1NU0 A;  3FLV A;  3MK6 A;  4H0P A;  4JI1 K;  1WSF A;  3AO3 A;  2O4I A;  3ZT2 A;  3M5R A;  2FF3 B;  2HHX A;  2PY5 A;  3RWU A;  2CGL A;  4RW6 A;  3I56 N;  2VQF K;  4KRF A;  4KHW A;  4L8R B;  4ZRJ A;  1Z26 A;  3SAG A;  3I8B A;  1IO2 A;  4FM1 A;  1MU2 A;  2P9K B;  4GW6 A;  5HRP A;  4CIG A;  3QO9 A;  4KRE A;  4FSV A;  4I6M B;  4WFN L;  4C8N A;  2E2Q A;  2AEH A;  2F7T A;  2KTQ A;  3BGR A;  3ISN C;  4P7I A;  4LF6 K;  4JI7 K;  3EYZ A;  3EL2 A;  2RF2 A;  3E1Y A;  2ZQB A;  4CBW A;  1IKX A;  2HND A;  1RT7 A;  1NJW A;  3PVL A;  4CIF A;  5AQR A;  3NF7 A;  1K73 O;  4CEF A;  4H8K A;  3HPO A;  1X9M A;  2KQ2 A;  4H4O A;  4DU4 A;  1T6D A;  3PX4 A;  2ASP A;  1WSI A;  2VYP A;  3CET A;  2VWB A;  3ENO A;  3TAB A;  2P9U B;  1W2B M;  1YIT N;  5M1Q A;  3IAY A;  2ZJR L;  1HRH A;  3EPY A;  1S22 A;  1X9J A;  2D4W A;  4FPA A;  1QE1 A;  5JLH A;  2BGG A;  4KO0 A;  2P9S A;  3DI6 A;  4CER A;  4A62 A;  4LH5 A;  3MMV A;  4IG3 A;  4NLB A;  3H3N O;  3PO4 A;  1YAG A;  3BDP A;  3ZSV A;  5AQG A;  4KHU A;  1KLN A;  2HVH A;  2X6S A;  1RTD A;  2HW3 A;  1A5W A;  1ISN A;  3C7N B;  3AVC A;  3KVG A;  4W5T A;  1T6C A;  3EN9 A;  5AQM A;  5F1X A;  3THY B;  4LF8 K;  1WOQ A;  4ELU A;  2FJ9 A;  2A6A A;  3BP8 A;  4FWN A;  4A2A A;  2NRX A;  2QA4 N;  1N6Q A;  2AL6 A;  4CJW A;  3WNF A;  2NNW A;  1GC7 A;  4IZ9 A;  4CED A;  3QIC A;  2F9T A;  3HL8 A;  3SQ4 A;  4O0J A;  1NKB A;  2P9S B;  3D6R A;  4AHS A;  4LF9 K;  3A2F A;  4DTN A;  1IJJ A;  3LDN A;  4YOU A;  1NM1 A;  1VQ9 N;  1QSL A;  1HNI A;  4FWL A;  4DSI A;  3LAN A;  3GE1 A;  1Y19 B;  1JLB A;  4B9S A;  1WSE A;  3FE1 A;  3OY9 A;  1NGF A;  1XUP O;  3DLG A;  1JXB A;  3SNN A;  3DOK A;  4WE1 A;  5HRS A;  3PX0 A;  3I55 N;  1YF5 L;  1E4F T;  3O9R A;  5GIO A;  2D11 A;  3SQ2 A;  3U4L A;  3J7Z O;  4FJH A;  4UY8 O;  3AVJ A;  4FJK A;  1EF1 A;  4XH4 A;  4B08 A;  3KLI A;  4AHT A;  4N41 A;  1VSF A;  4B1U B;  1IBM K;  1MWK A;  3OA9 A;  3TPQ A;  3KK1 A;  2I1K A;  1J5O A;  5AZJ B;  4CW7 B;  4FJ5 A;  2R7Y A;  5HRN A;  1NK9 A;  3VF2 A;  2OYQ A;  1OH8 A;  1N33 K;  4JS5 A;  4JN4 A;  4W5R A;  2HHW A;  4LSL A;  2XRI A;  4DTO A;  3QB0 A;  2Y1I A;  3CC7 N;  2AJQ A;  1RDB A;  4KPY A;  2AA4 A;  3V4I A;  2VQE K;  3B8A X;  4MLH A;  1QQC A;  2Z1I A;  5C15 A;  3U8X A;  1EET A;  5T7B A;  3BF3 A;  5C2F A;  4DS4 A;  1S6Q A;  4WYB A;  3W3D A;  3MDQ A;  3V9S A;  4XH1 A;  3MAQ A;  1MA9 B;  2XY5 A;  4GKK K;  3NH0 A;  3VQQ A;  2RKI A;  3C95 A;  4U7B A;  5BN8 A;  3P38 A;  4RTF D;  4K43 A;  4C8O A;  1QSS A;  1W0H A;  4KHY A;  2BH1 A;  2COP A;  3THX B;  3QNO A;  3CCL N;  3I0S A;  4IFV A;  3CJC A;  4DFP A;  1BGX T;  1C0G A;  2ATQ A;  1VQ4 N;  3JXU A;  3KZB A;  2W6L A;  5AQN A;  3GBT A;  2DY4 A;  3LP3 A;  3LDL A;  2RN2 A;  3ZSO A;  4EP5 A;  1JLC A;  1NGD A;  4GV9 A;  1TK0 A;  2NLX A;  3A5L C;  4AHC A;  4CK1 A;  1RDC A;  2QKK A;  1KSP A;  1QVF M;  4Z0U A;  4O55 A;  4ILG B;  4YOV A;  3AU4 A;  5E84 A;  4HUE A;  1YTU A;  1EP4 A;  2IAJ A;  4JS4 A;  4J2B A;  4M3R A;  3AA2 A;  5BPN A;  1XNQ K;  1RBV A;  3UIQ A;  1ITG A;  5KI6 A;  2YNI A;  3J7Y P;  2O8D A;  4YFU A;  4DB3 A;  2HBJ A;  3DLH A;  5AFU A;  3FP5 A;  1T7P A;  2ZGY A;  1E5W A;  4BWM A;  3AVK A;  3V1O A;  1XHZ A;  1Z25 A;  4ZHR A;  4CJV A;  4A5A A;  3NGZ A;  1VSI A;  3VA3 A;  1ACA A;  3HYF A;  4M3Z A;  4BDY A;  3CF5 L;  4E7L A;  4MDA A;  3M8P A;  4O0I A;  1TKZ A;  1EX4 A;  3L6Q A;  3ZX0 A;  3C6T A;  2J4R A;  3K2P A;  3C6H A;  1YTA A;  4DV6 K;  4CJS A;  2ZJQ L;  2GX9 A;  4PKG A;  4KKO A;  3FZH A;  3K9J A;  3HP6 A;  3ZX2 A;  4DSE A;  5AQS A;  5GAD P;  3J8A A;  1YJ9 N;  3EY1 A;  2E8A A;  3K5N A;  3I0R A;  4FWM A;  1KC7 A;  3VQP A;  4FK4 A;  1LW2 A;  3L2U A;  1KXP A;  1RBS A;  4IG0 A;  4JYA K;  2GV9 A;  2R82 A;  4ID5 A;  1U45 A;  1JL1 A;  3G6E N;  1GOB A;  2HNY A;  4CJF A;  5BPM A;  3CCQ N;  1NGB A;  4HCC A;  4CE9 A;  3NGY A;  3W0L A;  4FWP A;  1UA0 A;  3DXM A;  4YOR A;  1BO5 O;  1BQM A;  3M8Q A;  4A61 A;  1HQU A;  5FRO A;  4IJA A;  3P83 D;  1XWL A;  5AQV A;  1VK0 A;  2YCH A;  4JNE A;  5AQK A;  1CXQ A;  3OYJ A;  5FPE A;  4FZX C;  4HDO A;  3U3G A;  3A0I X;  3E66 A;  5HRR A;  1WUA A;  4BVO A;  3TAP A;  4BR5 A;  1UA1 A;  1HNZ K;  5C24 A;  3SUN A;  4Z4H A;  1HYS A;  3U9D A;  1U47 A;  5AQI A;  3S3M A;  3LPU A;  4CZF A;  1BDG A;  3O3H A;  4M7Y A;  3L4I A;  1MWM A;  3F2K A;  1N36 K;  4HTU A;  2KFN A;  4M7X A;  4DXA B;  4KHQ A;  1JLA A;  2I7N A;  1U4B A;  3SJH A;  2NZT A;  1S72 N;  3KK3 A;  5AQT A;  3QIJ A;  3D2F B;  4CBX A;  3VQ8 A;  4DUY K;  3VQC A;  1Q82 O;  1VRU A;  2B4J A;  1C0T A;  2NRW A;  4JK7 A;  1C1C A;  4CZI A;  5EU7 A;  3RRG A;  4AH9 A;  5KQD A;  1NOY A;  2XO7 A;  3HVR A;  2XHB A;  3AA3 A;  3MCA B;  1DTT A;  4PQU A;  1L3S A;  3AAP A; 
#chains in the Genus database with same CATH homology
 1QZ5 A;  1TUU A;  4NO7 A;  3IVF A;  1GLC G;  4G9Z A;  4BRF A;  1MK7 B;  3ULE A;  3CJ7 A;  4CZK A;  3UKR B;  4JEP A;  2NRR A;  3S41 A;  2VCP A;  2ZF5 O;  1H1V A;  1ATN A;  4B1Y B;  4RWT A;  4GV3 A;  4GV9 A;  2I7P A;  2YJF A;  4FWR A;  4NB4 A;  4BC3 A;  1VQO N;  3DXK B;  1GC6 A;  4EHU A;  4A5B A;  5GAH P;  3C7N A;  1XQS C;  3IMX A;  4CYE A;  3O4W A;  5ADX H;  3ATV A;  4H5W A;  1VQK N;  3O5B A;  1K8K A;  4YDU A;  3EKS A;  3LDO A;  3VEZ A;  3WA0 A;  3H1V X;  3BIN A;  1ZBS A;  3R6M A;  4WF9 L;  3PLA A;  3QBX A;  2ZGZ A;  2ASM A;  4BG8 A;  4BR7 A;  2E1Y A;  4IEI A;  4BQZ A;  1K9M O;  3LDQ A;  3FLV A;  2PFU A;  1KD1 O;  3MK6 A;  4H0P A;  5GAG P;  2Q36 A;  1HLU A;  3VES A;  3OHR A;  3M5R A;  4QS8 A;  2FF3 B;  4ZRK A;  2A3Z A;  3JS6 A;  3Q7C A;  3WXK A;  4BRI A;  2CGL A;  4KH6 A;  1KC8 O;  3I56 N;  3VEX A;  3ZEU A;  3FZM A;  3WXJ A;  1DIK A;  2E2N A;  4ZRJ A;  2DIK A;  4DHY A;  4BRM A;  1G99 A;  3SAG A;  4ILH A;  4CZL A;  5BRH A;  2HBK A;  4CI6 A;  5BRD A;  3Q7B A;  3I8B A;  5AZJ A;  3A5N C;  3CCJ N;  2FLO A;  5GAE P;  4AM7 A;  4H0X B;  2P9K B;  5DM6 L;  4FWQ A;  3BUZ B;  3CJ9 A;  1VQ5 N;  4FSV A;  2YHY A;  2OAN A;  5TKW A;  4I6M B;  2UYT A;  3MN6 A;  3TTD A;  5C12 A;  5E26 A;  3VGL A;  4WFN L;  3CC4 N;  1K8A O;  1VQ6 N;  2E2Q A;  2AEH A;  4XH5 A;  1V4S A;  3WEE B;  4FPB A;  5KPR A;  2RE2 A;  2F7T A;  3QBW A;  4JKG A;  1U6Z A;  4P7I A;  3HZ6 A;  4IOA L;  3ZET A;  1YIJ N;  4AF1 A;  3EL2 A;  2HBL A;  4CBU A;  3PIP L;  3T69 A;  3CC2 N;  3E1Y A;  3O9Q A;  3RSE A;  4CBW A;  1GLF O;  3WXL A;  3M1F A;  4EIA A;  2NRV A;  2CGK A;  4KBO A;  4JKH A;  1BU6 O;  3ZDT A;  4TKN A;  3EO3 A;  4IWV A;  5ELZ A;  3PVL A;  3U9Z A;  3ID8 A;  1DGK N;  4AM6 A;  1TYQ B;  5AQR A;  1MIZ B;  1K73 O;  3AU5 A;  4WFB L;  1ILY A;  4FO0 A;  2CQU A;  1LOT B;  4BC2 A;  3PIO L;  5EX5 A;  3AAQ A;  3VOV A;  1SAZ A;  5KQ8 A;  1W97 L;  3VGK A;  1T6D A;  2GUP A;  4CZJ A;  2ASP A;  1NGJ A;  2GWJ A;  3QFP A;  1HB8 A;  4H5R A;  3HBT A;  4IO8 A;  3R8E A;  1JJ2 M;  2VYP A;  3GDQ A;  2V52 B;  1QQO A;  1ESV A;  2VWB A;  2HBM A;  3CET A;  3ENO A;  4KH5 A;  2P9U B;  1RDW X;  4CZG A;  3C0B A;  2PAV A;  4YDU C;  5DM7 L;  1HX1 A;  4BGB A;  1W2B M;  4BRE A;  3HRG A;  1YIT N;  1ZC6 A;  1SGH A;  5M1Q A;  2ZJR L;  5F2R A;  3SLC A;  1S22 A;  3EPY A;  1X9J A;  2D4W A;  2IVP A;  4FPA A;  2ZJP L;  5JLH A;  5BN9 A;  2P9S A;  2QWM A;  5AR0 A;  2KKZ A;  3VEY A;  4A62 A;  4DQ8 A;  4ISE A;  3MMV A;  5GIP A;  4NLB A;  3H3N O;  3OBY A;  1NGI A;  1YAG A;  3O1W A;  4BG9 A;  4MO5 A;  5AQG A;  3H45 C;  3FZF A;  3O8M A;  1JCG A;  4EFH A;  5AZI A;  4BQL A;  4JD2 A;  2PBD A;  1QVG M;  3TSP A;  5F0X A;  1ISN A;  3AAR A;  3C7N B;  3KVG A;  1NLV A;  2J0J A;  1T6C A;  3EN9 A;  2A40 A;  4O5F A;  5AQM A;  4BR4 A;  4BRG A;  5F1X A;  2QEX N;  1WOQ A;  2P9P A;  3O1B A;  3CQX A;  1KAX A;  4H0V B;  2FJ9 A;  2A6A A;  3BP8 A;  4FWN A;  4A2A A;  4BRA A;  2NRX A;  2QXL A;  1C0F A;  4C1N K;  5CE3 A;  2AL6 A;  5H1S Q;  2QA4 N;  3UKR A;  3O80 A;  2NNW A;  1GC7 A;  4IZ9 A;  3IKM A;  3QIC A;  1OKJ A;  2F9T A;  1JCF A;  1KBL A;  3WXM B;  1D4X A;  1GLB G;  3CJA A;  5JVH L;  3VTH A;  4IOC L;  3HI0 A;  2P9L A;  3MN7 A;  4RCH A;  3DWL A;  2P9S B;  4H5V A;  3D6R A;  3EZW A;  4PL8 A;  2H3G X;  1OVY A;  5AQY A;  2FXU A;  3AY9 A;  1IG8 A;  3HSC A;  3M6G A;  5M1N A;  4EAH D;  1VQM N;  1IJJ A;  3LDN A;  3TTC A;  3L0Q A;  4YOU A;  4I6M A;  1NM1 A;  1S3X A;  2QWP A;  4BR2 A;  5AQP A;  1H4R A;  3FFK B;  2QTD A;  4FWL A;  4K42 A;  3VF4 A;  3CXC M;  2P9K A;  2E1Z A;  2W40 A;  4GY2 B;  3GE1 A;  1Y19 B;  1NWK A;  2YI1 A;  1EO1 A;  1HKG A;  1TUY A;  4CZE A;  3FE1 A;  4FWS A;  1MDU B;  4M63 C;  1M90 O;  1NGF A;  1XUP O;  1VAZ A;  2CH5 A;  3P39 A;  2FSJ A;  3VEO A;  4PL7 A;  4O8U A;  3I55 N;  3D2E B;  2YX6 A;  1YF5 L;  1E4F T;  3VF6 A;  3O9R A;  3U8Z A;  5AQL A;  4YOW A;  1Q81 O;  4L3Q A;  2D11 A;  3H3O B;  5GIO A;  2NRT A;  5AQQ A;  3U4L A;  2FSN A;  2WC9 A;  1J6Z A;  3ULE B;  1RDU A;  2E20 A;  3J7Z O;  4CD1 A;  3HOT A;  5HL7 L;  4JKD A;  1YHQ N;  2GEM A;  1NGH A;  3GG4 A;  3X23 A;  4UY8 O;  4JAX A;  1EF1 A;  1GLJ O;  2GTD A;  4H03 B;  4XH4 A;  3H1Q A;  3CD6 N;  2KHO A;  3SK3 A;  1K8K B;  4CZM A;  2P9N B;  1GGO A;  4ZRI A;  1YJW N;  2D10 A;  1KQS M;  3SMP A;  5JVG L;  4BRC A;  4B1U B;  5FPD A;  1MWK A;  5JLF A;  2QWN A;  5EOY A;  3E9L A;  3OA9 A;  2Q1N A;  3TPQ A;  1SS6 A;  4FWK A;  1QQN A;  2I1K A;  2GWK A;  3MN5 A;  4WCE L;  4JKB A;  3MX5 A;  5AZJ B;  3E9P A;  2YHX A;  3TTF A;  4GVE A;  4BRD A;  1CZA N;  1DT9 A;  2P9I A;  5AQX A;  3VF2 A;  1VQ8 N;  1YXQ A;  5FPN A;  3VMF B;  4JN4 A;  4H0T B;  2DPN A;  4IJN A;  2VGM A;  3SBT A;  2IVO A;  3FGU A;  2Q0R A;  3F5T A;  5KPZ A;  3QB0 A;  4WQ4 C;  3OW2 M;  4QS7 A;  3CC7 N;  3H6E A;  1BA0 A;  2AA4 A;  2NRZ A;  3WUH A;  3B8A X;  4MLH A;  3O6W A;  1NTI A;  1HJO A;  4HTL A;  4FOI A;  4H5N A;  2QW9 A;  4DKW A;  3O9S A;  1QHA A;  1E4G T;  4O8K A;  4BR9 A;  5C15 A;  1ATR A;  4LC9 B;  3LM2 A;  3U8X A;  2CH6 A;  1P90 A;  2D0O A;  1Z05 A;  3BF3 A;  4JKA A;  1NMD A;  2JWL A;  4FL9 A;  5FPM A;  5C2F A;  1BOT O;  1ZXO A;  4JKF A;  3CMA N;  4WYB A;  3W3D A;  3DLL L;  3MDQ A;  3G25 A;  5C2D A;  4XH1 A;  3CPW M;  2RHK A;  1BG3 A;  3D2E A;  2QI2 A;  2EWS A;  2Q0U A;  3MN9 A;  1MA9 B;  4GXB A;  4BC4 A;  1Q7Y O;  2KLA A;  4H5T A;  4Y0W A;  3UE5 A;  4U7B A;  2P9N A;  3EKU A;  4WQ5 C;  5AZI B;  3ZYY X;  4BR0 A;  4EHT A;  5BN8 A;  2E88 A;  3P38 A;  4RTF D;  4K43 A;  3VPZ A;  3FZL A;  4MO4 A;  4MDB A;  3NVK A;  4BVP A;  3SAF A;  4ISF A;  2BH1 A;  2COP A;  5AQH A;  3CCL N;  3VER A;  5C10 A;  5MLC Q;  5LY3 A;  2HST A;  4JK8 A;  3CJC A;  2QWR A;  4C23 A;  4B1V A;  4IXC A;  3DJC A;  4FOE A;  1C0G A;  5M1F A;  3ATU A;  4PKI A;  3LDP A;  2HF4 A;  2WH5 A;  1U2V B;  1VQ4 N;  2IIR A;  3JXU A;  3CCE N;  3KZB A;  2EMT A;  5AQN A;  1Z6R A;  3GBT A;  1QQM A;  3A5M C;  5BRF A;  3LDL A;  4HDQ A;  4YOY A;  2P9I B;  5M1P A;  1YJN N;  4IDH A;  3KK7 A;  3SMS A;  1NGD A;  2WFB A;  2EMS A;  1NGG A;  4JHD A;  3TU5 A;  1BUP A;  1GLD G;  2NLX A;  2NRH A;  2Q2R A;  2WBN A;  3A5L C;  3UKU B;  3L4Q A;  5KPT A;  5LJV A;  2J0K A;  1ATS A;  3CI5 A;  3VET A;  3DXM B;  2P9P B;  1NI2 A;  1HUX A;  4H0O A;  5GIN A;  3O9T A;  2J0M A;  1QVF M;  1MIX A;  1VBH A;  2X0S A;  4B9Q A;  3G4S N;  1HKC A;  4ILG B;  3DAW A;  3CCV N;  2QWQ A;  4KH4 A;  4YOV A;  3AU4 A;  4JKE A;  4ILJ A;  3CJ1 A;  5E84 A;  3TSU A;  3HM8 A;  2QWL A;  3ENH A;  5EVZ A;  5BPN A;  1GG3 A;  3ZET B;  3O08 A;  5JIC A;  4JKG B;  3PZD A;  3MWT A;  4DB3 A;  2HF3 A;  2HBJ A;  2BTF A;  4R79 A;  1P8Z A;  5AFU A;  1RGI A;  3FP5 A;  3U7D A;  2D2Q A;  2CB8 A;  3WXI A;  1EQY A;  4K25 A;  3T7Z A;  4JK9 A;  1KAZ A;  2ZGY A;  4BRH A;  1E5W A;  4HWI A;  4CD3 A;  3QFU A;  4A59 A;  3F9M A;  4JHD B;  4XEI A;  2YVC A;  2E2P A;  1N8R O;  4F9O A;  4JD2 B;  3SAH A;  3G71 N;  3NMU A;  4A5A A;  1JDE A;  1VQP N;  3GOI A;  4CJ7 A;  1ACA A;  1U2V A;  3UB5 A;  2OTL N;  3MWP A;  3CF5 L;  3ENB A;  2ZPY A;  4MDA A;  2E2O A;  4BRO A;  2HE7 A;  2FF6 A;  3R1X A;  5B8H A;  1VQL N;  2Q97 A;  3VEW A;  4IO9 L;  1GLA G;  3LL3 A;  4C1N I;  3L6Q A;  3FLC O;  3ZX0 A;  1VQ7 N;  4H0Y B;  3VTI A;  2J4R A;  2P9L B;  3MCP A;  5CR4 A;  3MX2 A;  4BRL A;  3C6H A;  5CHI A;  5HOO A;  1ST7 A;  3WQU A;  2P9U A;  2ZJQ L;  1MK9 B;  1KAY A;  2GX9 A;  4PKG A;  3N4Q A;  3FZH A;  3K9J A;  3D7E O;  4DCH A;  2QWO A;  4NY0 A;  3VEV A;  3ZX2 A;  5TKY A;  2F9W A;  3GL1 A;  5AQS A;  5AQZ A;  4PHT X;  5GAD P;  2FDQ A;  1VQ9 N;  3J8A A;  3RVC A;  5C0Y A;  1YUW A;  1YJ9 N;  1YVN A;  2AP1 A;  2E8A A;  3R3L A;  3E9O A;  1O13 A;  1X3M A;  4FWM A;  1KC7 A;  2FSK A;  1TYQ A;  5AQO A;  4CZH A;  2ABD A;  3CER A;  3OBW A;  4NLC A;  4BC5 A;  4BGA A;  1M1K O;  3IFR A;  1VQN N;  1KXP A;  1DKG D;  3CQY A;  3VEN A;  2ASO A;  3HTV A;  2V51 B;  2I1J A;  3CCR N;  2GEL A;  2JWK A;  5EXW A;  2R82 A;  4A2B A;  3RSE B;  3FZK A;  4BRP A;  3BEX A;  3G6E N;  3NVM A;  4B1X B;  3ZEU B;  4EKU A;  2V7Z A;  5BPM A;  3VGM A;  5BRE A;  2ITM A;  2V7Y A;  1RFQ A;  3CCQ N;  1NGB A;  3I33 A;  1J19 A;  5I9E B;  4JKC A;  2LBB A;  3QML A;  4YL8 A;  3CHW A;  3WEE A;  3W0L A;  3WT0 A;  4FWP A;  5M1K A;  1NJI O;  3H46 O;  3DXM A;  4BRK A;  2A5X A;  3CCU N;  4YOR A;  3KWI A;  4IFE A;  1YI2 N;  1BO5 O;  4J8F A;  3TSQ A;  3UKU A;  4A61 A;  3AGR A;  4QS9 A;  3ID6 A;  1X3N A;  1DEJ A;  4YOT A;  1NGE A;  4F7G A;  4IJA A;  5LJW A;  5AQF A;  5AQV A;  2YCH A;  4BRQ A;  4JNE A;  2D1K A;  1LCU A;  3AGK A;  3LM9 A;  5AQK A;  3CCS N;  5FPE A;  3CME N;  4OO1 J;  4HDO A;  3D2F A;  3A0I X;  3CPE A;  3E66 A;  4WFA L;  1WUA A;  4BVO A;  2Q31 A;  4WQ5 A;  1R59 O;  4BR5 A;  2CGJ A;  5M1O A;  3ZX3 A;  3N4P A;  4GNI A;  1HBK A;  3CJB A;  1NVL A;  2ZWH A;  3U9D A;  3HOS A;  5AQI A;  1T44 A;  4B1Z A;  4BRN A;  1SQK A;  3M3Z A;  4CZF A;  1BDG A;  5JMV A;  1NGA A;  1QZ6 A;  3KWG A;  3EE8 A;  2OTJ N;  2HOE A;  2YHW A;  4M7Y A;  4E1J A;  3L4I A;  1MWM A;  3R9P A;  5AFU H;  3F2K A;  4A57 A;  2HRJ A;  5IJM A;  1GLL O;  4B1W B;  3P31 A;  5BR9 A;  4GV6 A;  3BF1 A;  1NBW A;  2QM1 A;  1HKB A;  5EY4 A;  4M7X A;  4MLE A;  4DXA B;  3DXK A;  3O9U A;  4OPA A;  4BY9 C;  3CCM N;  4OPH A;  1HB6 A;  5AQJ A;  2I7N A;  2W41 A;  3SJH A;  1Q86 O;  1V4T A;  3IDH A;  4WQ4 A;  5BPL A;  1T3V A;  2NZT A;  3SBG A;  1S72 N;  1Q18 A;  1XC3 A;  5AQT A;  3QIJ A;  2A41 A;  3D2F B;  4ISG A;  2RQ1 A;  1BA1 A;  2VGN A;  4CBX A;  4U67 L;  1VBG A;  3A8Y A;  5AQU A;  4FWO A;  1Q82 O;  1NGC A;  3C65 A;  2D0P A;  1HPM A;  2NRW A;  2YJE A;  5AQW A;  1Y64 A;  3CIP A;  4JK7 A;  2HMP A;  4Z94 A;  4IOX A;  3A5O C;  3FR0 A;  4CZI A;  2A42 A;  3QDK A;  2BUP A;  4IEE A;  4PKH A;  3C6A A;  3IUC A;  3EE9 A;  1SZ2 A;  3WQT A;  2WUS A;  2IVN A;  4YOX A;  5KQD A;  3G9W A;  3KHY A;  3P4I A;  3K9K A;  1JCE A;  3MCA B;  1BWF O;  1GLE G;  4K41 A;  5ADX A;  4FVU A;  5JVL A;  3AAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...