4JK8A

Open and closed forms of r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
b'LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk8A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk8A01
4JKBA 3SBGA 3E9OA 3E9LA 4JKDA 3E9PA 4JKFA 3SBTA 4JKCA 4ILHA 4JK9A 3ENBA 4JK8A 4ILJA 4JKHA 4JKGB 4JK7A 4JKEA 4JKGA 4JKAA 4ILGB 3E66A
chains in the Genus database with same CATH superfamily
5ADXH 1QS4A 1ZBSA 3H6EA 1SZ2A 1GLEG 2GWJA 2FDQA 1BWFO 1KCFA 4W5OA 3LPUA 3B8AX 3TAQA 3QEIA 1DTQA 3GDQA 3OYLA 3O9TA 1Y64A 4CZHA 3TU5A 3L0QA 2P9PB 3N4PA 2KQ2A 4DTSA 4JHDA 2GV9A 5F2RA 3PSFA 4FJ7A 4IXCA 3OVNA 3O80A 1CZBA 4O44A 4NXNK 3SMPA 4YOWA 1TAQA 3KHYA 2VGNA 1IG9A 3K5LA 1S72N 4C8KA 4DS4A 3U4LA 4KHYA 1YJWN 2P9NB 4DF8A 5E41A 5KRTA 4M42A 2X6SA 3EE8A 2KKZA 4DFPA 1NGDA 4B1WB 3I33A 3MN5A 5JLHA 2NRVA 2RKIA 4GXBA 4CEBA 1XNQK 5E26A 3GE1A 3ZT2A 3A0IX 4HDOA 4W5RA 3LP0A 3AA2A 1N6QA 4YY3K 2E8AA 3ID8A 3M6GA 5C2FA 3NDKA 3KKRA 4M3WA 4K42A 1SKRA 2I7NA 3OYGA 4X65K 3LP1A 3THWA 4Y0WA 2F8TA 3HT3A 2J4RA 4ISFA 4BC4A 4CD3A 3THYA 4B3TK 4KAZA 2OPPA 5BRFA 4JKGA 1LW0A 3E1YA 1BGXT 4H0OA 3ZCMA 4KFBA 1ITGA 2YNIA 3O9QA 4Z4IA 4GVMA 4U7BA 2UYTA 4JKDA 1XQSC 4FOIA 3WUHA 2IIRA 3UKUA 2YNGA 3CJAA 4CJWA 5AQMA 3QIOA 4B1YB 3FZHA 4AH9A 4CK1A 3CF5L 4FWQA 2YX6A 3B6OA 2EWSA 3LZIA 3EPYA 3KLIA 4CIFA 1NGGA 3H1VX 4BDPA 1Q86O 2VWKA 3C6TA 3THXA 4FJMA 3FZKA 1NK0A 2F9WA 2KHOA 4LF4K 2FSKA 4G1QA 1YI2N 1T05A 4AHSA 3NCIA 3QEWA 1VQ6N 3C7NA 4GVEA 5C15A 4IFYA 3ZT0A 4C1NK 2IDOA 3TTCA 4CHZA 3EKSA 4DSEA 1U2VB 1TK5A 3NH1A 3SAHA 1NK8A 3D2EA 2OZSA 4JK9A 3BINA 1VSKA 4DLEA 4JS4A 4XH1A 4ZTFA 5AQZA 3AY9A 3DJCA 3I0SA 4HHTA 3AVLA 2KFZA 4JLHA 3CJ9A 3EL2A 4YDUC 5KGXA 2QI2A 4LF8K 4E1MA 4DR4K 2V7YA 3CPEA 3O6WA 4KKOA 4IDKA 3U9DA 4CJRA 2ZJPL 3O3HA 4JI8K 4KBOA 1WLJA 3WQUA 3P5JA 3CQXA 1VQKN 2G8FA 1BL3A 3VGKA 4Q5VA 4HCBA 2PYLA 4M41A 2XY8A 3G10A 4OKJA 2B5JA 2P5GA 3ZSQA 4JKAA 3IFRA 1FKOA 3C65A 2E2PA 3AA3A 4OPJA 1SV5A 4O0IA 3DOLA 3SQ4A 1QSSA 3HJFA 3TAMA 2EMTA 1HYSA 1HKBA 3ZETA 2FBTA 1YHQN 4J2EA 3HK2A 2D5RA 1KXPA 1GLJO 4K41A 4BR0A 4DV4K 3QETA 2ZE2A 4FO0A 4IOAL 4B9VA 4OGCA 4Z4EA 3HTVA 4I6MA 4FJGA 4I2QA 4JN4A 2VG5A 1WSHA 4A2BA 3CFOA 3LL3A 4NCAA 1HJOA 3ZEUB 3CJBA 3KK3A 4JRQA 4BR4A 2E6MA 4B9NA 1ASVA 4IBNA 3VERA 5SZTA 5HP1A 4RW8A 3AGKA 1HB8A 2FBXA 1XWLA 4ILJA 1S1WA 3D2FB 4CZGA 4K25A 1A5VA 3PIOL 2OYQA 4FK0A 3G9WA 4BRMA 4FVUA 4E7HA 2UUAK 1VSDA 3M3ZA 3BUZB 4HTUA 2ABDA 1RT6A 4JI4K 2YHYA 4Q0BA 5FPMA 4IFEA 3MXIA 4F4KA 2WTUA 3KVGA 4KHUA 2DY4A 4DR7K 3ENBA 2VGMA 4LFAK 4FLXA 2DPNA 3QBWA 4DR5K 3IKMA 1RDBA 1WSGA 4JHDB 4DKWA 4BACA 3CC7N 1LWCA 1K8KA 2JGUA 2BGGA 1O1WA 2YJFA 2BH1A 4QAGA 3BGRA 2HHTA 2IS3A 5LJVA 2X0SA 4LSLA 3Q7BA 3PX0A 2W40A 3C6HA 2A1SA 2F7TA 2ZPYA 4CZLA 3SYZA 4FK2A 2WUSA 3TSQA 3U3YA 2HNDA 4DQ8A 1NGJA 1WN7A 3HPOA 1UAXA 1L5UA 3ATUA 1D9FA 3ID6A 3CM6A 5BR8K 1T3VA 2QWLA 3HVTA 3TPQA 4M63C 1HNZK 4BE2A 3CCVN 4RW4A 1XHXA 3QICA 3TTDA 4IKFA 3THWB 3T7ZA 3QMLA 4KH6A 3T1YK 3THYB 1NNEA 4DMNA 2E20A 4L8RB 2DFFA 4M7XA 4IJNA 4FZYA 3KJVA 3SQ0A 4J2DA 3LDPA 2WOMA 1QZ6A 4JKGB 4JI2K 2D2QA 3SJJA 4LF7K 4JI0K 4PUOA 3DLHA 1D4XA 1N32K 3AVCA 4E7IA 1N8RO 5AQWA 5GADP 3HI0A 4A5BA 3G4SN 3UKUB 1J54A 2E1YA 3ZSXA 3PLAA 1NGHA 5M1KA 4AHRA 1L3VA 3R3LA 2XY6A 1GOBA 1ZBIA 4CGGA 4MLHA 4IZ9A 5JLFA 3SNNA 1NJZA 3THXB 1V4SA 1WAJA 3NVMA 3D6RA 4HUEA 1NBWA 4CFAA 3O9SA 3M8QA 2OZMA 4FJ8A 4CK3A 3IRXA 5AQHA 3ZT4A 3C7NB 1VAZA 5AQNA 3E9LA 3AVGA 3NAEA 2Y1JA 4YOTA 2YCHA 4PQUA 3VQAA 3QFUA 3D2EB 3MWTA 4BWJA 4CHPA 3EYZA 4FW1A 4OPAA 3CYMA 4FJJA 5FPNA 1BU6O 1VSEA 4CGIA 1TAUA 3ZT3A 2YVCA 2UXDK 1ZBUA 2B4JA 1S3XA 1X9JA 2HSTA 1EKEA 1I3AA 1IBKK 1J53A 4ID1A 4L3QA 4ELTA 3VF4A 4IJAA 3U3GA 2EX3A 4H4OA 2ZQBA 1VQPN 1BO5O 1RT5A 3SUPA 3TSPA 5C10A 4KHQA 1OH6A 3E9OA 4PL7A 4H03B 2Q97A 1IO2A 1QE1A 4BE0A 3LWMA 3H08A 3SK3A 3G6EN 4FJNA 3AVMA 3K9JA 1VRTA 5BR9A 2I5JA 4H4MA 3ZETB 1QQMA 4FWKA 1TKZA 3X23A 3FZFA 2F96A 1GC7A 3ZSWA 3LPTA 3ULDA 3BEXA 2OANA 4LFCK 3S9HA 3J81O 4I6MB 1TVRA 3RMBA 2RF2A 4JK7A 1C0TA 1YIJN 1FXXA 1Q18A 2FJ9A 1SKSA 1UWBA 1RT7A 4JNEA 3VGMA 3PUFA 1HUXA 1YJ9N 2GUIA 5I9EB 2Q0RA 3I8BA 1VQ7N 3V9WA 4FLUA 3E9PA 4CZEA 4KHPK 1HBKA 4BR2A 2D11A 4CJFA 3V4IA 1LW2A 3K9KA 3LP2A 2HHXA 5JVLA 1VSMA 1NGAA 1QQCA 1QTMA 5JICA 4MLEA 2A41A 3DAWA 2YHAA 5I3UA 1OH7A 3DXKA 3K2PA 2ITMA 4H0PA 4ZRKA 1HQEA 4LY7A 2QWOA 3AAPA 3SCXA 4IEEA 4CCHA 5CY4A 4J2AA 3QIPA 4H0TB 4FJIA 1RBUA 3WXIA 5CZ2A 3VQCA 4ZTJA 3QLHA 5AQRA 1MIZB 5HRNA 1GLAG 2W6LA 3SI6A 5T7BA 1K8KB 4NB4A 1XI1A 4FWMA 2YV0X 1NGBA 2ZD1A 4OO1J 3BF1A 5AQIA 3R9PA 4B3SK 4UQGA 1C6VA 1VSLA 2BDPA 4V19S 2QK9A 4BC2A 4BRCA 2NUBA 5M1FA 2E4LA 3TAPA 4BC3A 4XH4A 4DSJA 4DR2K 3V9SA 4M3ZA 4LC9B 3CCMN 5AFUA 4DQQA 4JKEA 3DMJA 4CJ3A 1CZAN 2R82A 3I8DA 2O8EA 3DLGA 4Y1CA 4WQ4A 1I94K 3I56N 4H5VA 4HUGA 4CHYA 1G15A 1K9MO 2E6LA 4FLYA 3ZSOA 3VQ4A 4OX9K 3V9ZA 4DQSA 1OVQA 4AM6A 4BRHA 2AL6A 4B1XB 5A2QO 2Z1HA 5AQTA 4BVOA 1VSFA 3PX6A 3AV9A 1ZXOA 3SV4A 2FSNA 3VMFB 2HHHK 4CF9A 4AHUA 3QNOA 5K14A 2NZTA 3V1RA 2UUBK 3EN9A 2DFHA 3AVIA 3BP8A 4DFMA 3T1AA 2D1KA 4A2AA 1P90A 4B9QA 1YVNA 3C6AA 3P4IA 4CI6A 2E88A 1C1AA 4DSKA 1G99A 1MWMA 1GLLO 1QSLA 2GBZA 3VTIA 4YOXA 3AO1A 4DQRA 3VN5A 2QWPA 3OYMA 1W97L 2AP1A 3VF6A 3LZJA 2E2QA 4CHOA 4R79A 1H4RA 4DTRA 4FYDA 3U7DA 1RDAA 5HLFA 2GWKA 3JSMA 4GW6A 3T69A 1NG9A 4E7KA 3GOIA 2RQ1A 2O8BA 2ZJQL 4GV6A 4M7YA 3MN6A 4H0XB 1HNWK 2J0MA 2NRRA 1HYVA 1E5WA 3F73A 3OBYA 1EO1A 3PY8A 1I39A 1VK0A 3H3OB 3L2RA 4E7LA 4LF5K 2QKBA 5AR0A 5TKYA 4BRNA 2VCPA 4CZIA 4NY0A 1RGIA 3KWIA 3VQQA 1JXBA 3B6PA 3BZKA 3VEVA 5GAEP 3OW2M 1NKCA 4B9SA 3O9UA 4QS7A 5EX5A 3CI5A 4NYNA 2QW9A 2X74A 2QXFA 4GMJB 1NI2A 4DTPA 2VWJA 3VQEA 3P31A 3MCAB 4CEFA 2AA4A 2GUPA 3S3NA 3KLEA 5F0XA 1T03A 4Z4GA 1U04A 1Z6RA 4EIAA 2J0KA 4J2BA 3RSEA 2A5XA 4NCGA 3QINA 3L8BA 3H46O 5BPMA 1LOTB 4BGAA 1KLMA 4CEDA 4EHUA 1P8ZA 3QEPA 2KTQA 1IKWA 5IJMA 3VQ6A 3NHGA 4FZXC 2GEMA 2VG6A 4AHTA 4CHNA 1UA1A 2GELA 4E1NA 4C8LA 3NGYA 3AVBA 1XHZA 1EETA 3OYNA 1D8YA 3OYFA 3L2WA 3V9UA 3F9KA 3WXKA 2E5LK 2IVNA 2G8WA 4CJKA 4M3TA 2HHUA 3DXKB 3A2FA 2COPA 4W5QA 3VESA 4EHTA 1TK8A 5AZIA 1T8EA 1KSPA 3HP9A 4RCHA 4PY5A 2I1JA 2V51B 2A1RA 2O4IA 4CJPA 2HF4A 3GL1A 4CEOA 1NJIO 3SUOA 4CGDA 1NK9A 1S1VA 3K0SA 1XNRK 2QEXN 3UB5A 1SL0A 1NOZA 3HZ6A 4CESA 2WC9A 4B3RK 2P9SA 2UU9K 3TABA 3V1OA 1NK5A 1BIUA 4X64K 5AQFA 3MEEA 2KLAA 4X66K 3G25A 4CE9A 3OTOK 3NH2A 4B9TA 4W5NA 3KLFA 1RTIA 4Z4HA 1W2BM 4AQYK 2HHWA 4JK8A 1HQUA 4H5NA 4OKEA 1S9GA 4F2RA 1DIKA 4DUZK 4KO0A 3OY9A 2O8EB 2D0CA 5DM7L 3K5OA 1ASUA 5AQXA 1QSYA 1GGOA 1RT3A 3WT0A 5J2QA 4YORA 1BISA 5C42A 4DR1K 1O13A 3K5NA 1NWKA 5GIPA 1T6DA 3C94A 2ZF5O 1KQSM 1GOAA 4BQZA 3ASMA 4DV7K 3SQ2A 1MDUB 3A5MC 3IS9A 1J5OA 1B92A 2G8VA 4JD2A 4AHCA 1KBLA 1NK4A 5JMVA 4CZJA 3FFKB 3O1WA 4DCHA 3O3GA 4FWRA 3JXUA 3F9MA 3L2VA 3S3MA 4Z4FA 5CZ1A 3VQ8A 1RTHA 3DYAA 4EP4A 3RRHA 3R8EA 1VSJA 3NVKA 4E19A 4PL8A 2QKKA 1JLFA 5EU7A 4CGFA 4H8KA 2HHVA 1HPMA 4DV6K 2FBVA 3VEWA 1EQYA 4EAHD 3ISNC 1S22A 5CHIA 4JRPA 1L3SA 3EZ5A 2O8CA 5D3GA 4B8CA 3TAFA 2PZSA 3ZX3A 3M8RA 1HRHA 4DHYA 2O8BB 1Z05A 3K5MA 1ACAA 4H0VB 1TV6A 3CM5A 4AM7A 4CERA 4C8NA 4BG8A 1RDUA 1QQOA 4XEIA 2HBLA 1WOQA 3MN9A 4WFNL 4MDBA 4FLZA 4I9QA 3WNHA 3CMAN 2OPRA 2QTDA 1CZ9A 1HYZA 4DV0K 1RT2A 2HOEA 3T1HK 1VSIA 4QS8A 3I0RA 4FLWA 5GAGP 4JI5K 4I7FA 5AQYA 1A5WA 3L6QA 4BR5A 1W7AA 1C0FA 4HWIA 1RCHA 3NFAA 1KVCA 1IKVA 1UA0A 5BN8A 4FWLA 2V7ZA 2ASMA 4BRDA 1SGHA 2O8DA 3M1FA 3RMCA 4O4GA 1J5EK 2PFUA 3LAMA 3VQ7A 3P38A 2Q3SA 1HKCA 4NYFA 3RSEB 3AVJA 4KB0A 4JV5K 2XY7A 1YTUA 1EWRA 2IC3A 4JYAK 3O08A 3NBPA 3NGIA 5H1SQ 1GOCA 4KI4A 1JKHA 3ZSZA 4B1UB 2UUCK 3CCLN 4A62A 2Q31A 1NTIA 4FW2A 1QVFM 4O55A 5BN9A 5M1QA 2NRTA 4C23A 1TKDA 4CGHA 4DLGA 2E1ZA 4B1ZA 3K58A 4CK2A 5E84A 1L3TA 5IWAK 2XO7A 5FRMA 1HB6A 4KH4A 1GC6A 1GLDG 1NGFA 4DWIA 4FJ5A 4GV3A 4E89A 3U9ZA 3EZWA 1BQNA 1KFDA 5AZIB 4FK4A 4RW9A 3E66A 4FXDA 1YITN 3N4QA 4CF2A 2P9UA 3SAGA 4QCLA 1N34K 3D0PA 5KI6A 3QERA 3MAQA 2JWLA 4GV9A 3NH0A 4CFCA 1LAVA 3ZSRA 3F5TA 5LMUK 4KH5A 4DFKA 1VQ9N 4F7GA 3TR8A 3FGUA 3K57A 3H1QA 4IO8A 3VQ5A 1K8AO 4DU4A 2J0JA 2P9SB 3GG4A 1NMDA 2XY5A 3DM2A 3HSTB 1JLAA 3FLVA 3DOKA 2DIKA 3MWPA 1Q7YO 3D45A 4CFBA 4WFBL 3CPWM 2RN2A 3MECA 1U4BA 3LP3A 4DF4A 4BDZA 3OHRA 3VENA 3L2UA 5FROA 2F9TA 3CCRN 4TKNA 1JL1A 3MEDA 1ASWA 3THVA 4U67L 5AZJA 3K59A 4CJVA 3IVFA 2ETJA 1TKTA 3WEEA 1LWFA 3CCSN 3CC2N 3TWHA 1VRUA 3NF6A 4DG1A 4JKCA 1X3MA 4FSVA 1YTAA 5JVGL 3OJSA 3VEZA 4MO5A 3M8PA 4M3XA 1H1VA 4O5BA 4CJUA 2JWKA 4JD2B 4DTJA 3WA0A 1X9MA 4DTOA 1EP4A 4YDUA 2Z1JA 3A5LC 5BPLA 4E0DA 4GNIA 3MCPA 4R5PA 2H3GX 4LF6K 1U48A 3IMXA 2O4GA 3CIPA 5JS2A 1T7PA 4MFBA 5BRHA 1REVA 2FF3B 3EKUA 2XHBA 3WXJA 1A5XA 1FK9A 4WF9L 3MN7A 3W0LA 5HL7L 2O8CB 1KAYA 1HJRA 2CGJA 3EY1A 2KZMA 4HDQA 4CZFA 2FSJA 3NF7A 1S9EA 5KGWA 3DLKA 4A59A 3DLLL 3VEOA 2OA8A 1YXQA 4BRPA 5HRRA 1Q8IA 3ZX2A 4YL8A 4BWMA 2YHXA 4YOVA 1JDEA 1DLOA 2VQFK 5F1XA 3HL8A 3ULEA 5IT9O 3CCJN 1RT4A 1VQ5N 4N41A 3AA4A 4KREA 2A6AA 2P9LA 4PKHA 4FJHA 1WSFA 4Z0UA 2X6NA 4CEZA 1JLCA 4OLAA 1IH7A 4CBWA 3A8YA 1QHTA 3J7YP 1EF1A 4CJ7A 4BY9C 2W6KA 1HLUA 4K43A 5CYMA 1JCEA 4FZZA 2HE7A 1NMNA 4K8XA 2PBDA 5AQKA 1NGIA 4IG0A 3WNFA 1TGOA 1TUYA 3V81A 2O8DB 3L4IA 3BZCA 3CFPA 4NXMK 1QHAA 1IV0A 3LDLA 1SUQA 5CR4A 4BR9A 3OYBA 2HHSA 3S41A 2BE2A 2XRIA 3HM8A 3EO3A 3OYHA 1HR0K 4GKKK 3JS6A 5JS1A 4DTXA 3T19A 3W3DA 2IGIA 3AO4A 3FZMA 5ADXA 4Y1DA 5M1NA 3CETA 4WQ5C 3TAEA 3LM2A 3OYDA 4DR3K 1Q9YA 3KLHA 3OJUA 3OYJA 1L3UA 5C12A 2QWMA 3SBGA 1YVUA 3UIQA 3MX5A 4CJTA 3AVKA 4DTMA 5AQUA 3VOVA 4NO7A 4RWTA 3WXLA 1MIXA 4JI1K 3TTFA 1ISNA 4OKKA 3SJHA 4BR7A 4C8OA 1WNSA 1NU0A 3OA9A 2HRJA 3H45C 2QWRA 3CG7A 4DV1K 1CXUA 3FP5A 2PAVA 2P9UB 4M3RA 4RTFD 1Y19B 3PVLA 4WFAL 1C0UA 1BCOA 4IDHA 1D5AA 4ISGA 3VQPA 1M90O 3ZSVA 4FJ9A 3OS0A 3DLBA 4YOYA 2CH6A 3MMVA 1KLNA 2HB5A 3VA0A 3MEGA 1KAZA 3BY5A 4KTWA 2KW4A 3KZBA 4CEEA 3O3FA 3KK7A 4WE1A 4BRGA 4F3OA 1VSHA 2UXBK 4W5TA 1Q9XA 1RBSA 4JS5A 1X1PA 4FJLA 2HNYA 1IBMK 4LD0A 3QBXA 4E1JA 4A61A 2ZJRL 4K8ZA 4YHHK 4CIEA 4ZRIA 3MXMA 1RBVA 3CERA 1C0MA 1J6ZA 4PKGA 4RW7A 1E3MA 1ST7A 3O5BA 1X3NA 1S1XA 4NCBA 3CXCM 4A5AA 4FM2A 1RDCA 3CJCA 5AQVA 1HNXK 1IKYA 5AZJB 4IWVA 5AQSA 4JKBA 1N33K 3GBTA 2W42A 3JYTA 2AJQA 1IJJA 1BI4A 5CYQA 3WEEB 3CC4N 1XMOK 3MXJA 4B3OA 4CYEA 1YF5L 1HX1A 4PKIA 3SAFA 3QNNA 4DV5K 3ZDTA 3DI6A 3A5OC 5JVHL 4DFJA 1N36K 4C8MA 2VG7A 3J7ZO 1WSJA 1R0AA 1ZC6A 3SPYA 5AFUH 3DWLA 4FVMA 3SUNA 4EP5A 1OKJA 1VBGA 5J2MA 4CJ5A 2P51A 2OTLN 2YNHA 2LBBA 2X78A 2PY5A 3RRGA 3VETA 1FKPA 3VEYA 4PHTX 2P9KA 2D0PA 4DSIA 2O8FA 3TANA 4ILGB 3O9RA 4Z94A 1BHLA 3M8SA 1MWKA 4B08A 3O8MA 1BA1A 5AQGA 5LY3A 3DRPA 1ZBLA 2Q36A 4DUYK 3OS2A 4HCCA 2FLOA 4BRQA 4NLCA 4BRFA 4CIGA 2ASOA 1NJXA 2Q0UA 4BC5A 3KWGA 3ULEB 3VF2A 3HVRA 2GTDA 3ZT1A 2P9LB 4N56A 3SV3A 2YHWA 1SS6A 3ZSYA 4BQLA 3OYKA 4B3MK 1ESVA 4B9LA 3SLCA 2VQEK 1KC7A 1JCFA 1J19A 2CGLA 4DV3K 4M3UA 4KHSA 3P39A 1NK7A 1U45A 4KRFA 2DFEA 1TK0A 5HBMA 1ATRA 2ZM6K 4MQ3A 3O4WA 1WUAA 1RFQA 5EVZA 4ELVA 4HVJA 3L3VA 3AA5X 4KPYA 1KVAA 3QDKA 1JLBA 2YKMA 3KIOA 2QWNA 1GLFO 2ASPA 2EMSA 4BE1A 1NLVA 5HOOA 3T3FA 1ZYQA 3KD1E 4RG8A 2BTFA 2VYPA 4AF1A 1BUPA 1BOTO 1KD1O 1TL1A 1VQON 4EZ9A 3WXMB 3J8AA 3TARA 2D4WA 3NE6A 4BDYA 3KD5E 3QB0A 4IOXA 4P7IA 4ICLA 2EHGA 4FPBA 2G8IA 1Z26A 5DM6L 3OYIA 1IG8A 5HRSA 4IOCL 2CH5A 5C2DA 5C0YA 2NRXA 2D0OA 5LL6Z 4FLVA 2OPSA 1CXQA 4DV2K 1LAWA 5BREA 4HUFA 1Q82O 3AAQA 3LDOA 2ATQA 2HMPA 3RMDA 3FFIA 2D0BA 5C25A 2NRHA 1KAXA 2HVHA 1HNVA 3IDHA 1NGCA 4H5RA 1DKGD 4JI6K 2RPIA 4WQ5A 3DLEA 4OPKA 4DSFA 2P5OA 2HVIA 1HPZA 1HNIA 3RMAA 3IAYA 1EXQA 3NF9A 3HM9A 4OJRA 1VQMN 1VQLN 3ATVA 4PA1A 3RR7A 4CF1A 1OH8A 4I9LA 4OPHA 4YFUA 4B9MA 3SBTA 4DXAB 3MX2A 1HKGA 4KB1A 3QIJA 1VQ4N 3AO3A 5EXWA 1JLEA 1NJWA 4DU1A 4H5TA 2A3ZA 4J8FA 1WSEA 4CZMA 3HOTA 1RTJA 1T44A 4H5WA 5LMNK 3ZLJA 2JLEA 3ENOA 3UKRA 1XMQK 1NGEA 4ID5A 3TSUA 3EE9A 5KTQA 1ZBFA 1QVGM 3HO1A 5DMRA 4CEQA 3V9XA 4PWDA 4LH5A 1Y97A 1SAZA 3O4NA 2YJEA 1SL1A 1MK7B 1X9SA 3U6FA 3HOSA 4E7JA 3PX4A 3AVAA 3O1BA 3PIPL 2G8KA 3CCEN 4FPAA 1OH5A 3KK1A 3U8ZA 1BI4B 1RILA 3CJ7A 1NKEA 3AO5A 5M1OA 4DB3A 3HPHA 3VTHA 3SZ2A 4GKJK 1S5JA 4LFBK 5KPTA 1D9DA 2Y1IA 2OTJN 4FL9A 4FM0A 4YOUA 2CQUA 5I42A 2KZZA 1TUUA 5TKWA 2AEHA 1RBRA 2R7YA 1SL2A 4QOZB 1XC9A 5AQLA 3BF3A 3ZYYX 4ZRJA 3VGLA 4Z4CA 4CW7B 3JAMO 2BANA 4BRLA 4BRKA 2Q1NA 2YNFA 3LDQA 4QS9A 4N76A 4O5FA 3VPZA 1ATSA 2CGKA 2P9KB 5BRDA 2O8FB 3LANA 4LH4A 3LALA 4X62K 3DRRA 4TSXA 5EOYA 4F2SA 4FJKA 4WQ4C 3UE5A 1IBLK 4CECA 3FLCO 3PSIA 1N5YA 4C1NI 1RTDA 2B6AA 2VWBA 4B1VA 2ZGZA 1S1TA 4WCEL 3CMEN 3AO2A 4JAXA 2Z1GA 5KRSA 3BDPA 5FPDA 4EZ6A 1HMVA 2I7PA 2Q2RA 4CF0A 1BCMA 2GX9A 5HRPA 1JJ2M 3L4QA 1WSIA 4AHVA 2G8UA 1JL2A 2YI1A 4XH5A 3QO9A 3PO5A 2RHKA 3QEXA 4DR6K 1BA0A 2F4VK 1S1UA 4FOEA 2P9IA 1GLBG 3DXMA 3CD6N 1V4TA 4CD1A 1U6ZA 4IFVA 4O0JA 5EY4A 4GY2B 4CJQA 1C1CA 3D7EO 5AQJA 2P1JA 2F8SA 4CJLA 2FF6A 3C0BA 1BG3A 4G9ZA 4N47A 2IAJA 3CJ1A 1KFSA 4DQPA 5B8HA 5KPRA 3OYCA 3CCUN 4KI6A 3S3OA 3HYFA 4CBXA 1IKXA 3QESA 1VQ8N 1TYQA 4BREA 4CBUA 1B9FA 2WBNA 4O8UA 2OCEA 1QQNA 4JKHA 5J1EA 4DSLA 2NNWA 2W41A 5ELZA 2QXLA 4CEAA 1NM1A 2WH5A 3FZLA 2HHQA 2YHBA 3AVNA 3SMSA 5CE3A 1NKBA 3V6DA 1JLGA 4ZHRA 3TAGA 1DGKN 4OVLA 3L2QA 2HF3A 4XIUA 5GINA 4JI3K 3F2KA 3VA3A 1EWQA 2E2OA 2IVPA 4F3TA 1JXEA 3AVHA 4LSNA 4FWOA 3E01A 3VEXA 1SKWA 3C6UA 4KV8A 2QM1A 4EKUA 3WNEA 3PZDA 3KK2A 2HNZA 1LWEA 1YUWA 1W9HA 2HBJA 3LDSA 1C1BA 1ZBHA 1NK6A 3U8XA 3P83D 2V52B 3IG1A 5HROA 5C24A 4EFHA 3CHWA 3NMUA 5J2NA 3WNGA 1FJGK 3V1QA 1NJYA 2P9PA 4JI7K 2ITGA 3UKRB 3G0ZA 2NRWA 1Q81O 2LSNA 3KKSA 2HMIA 1GG3A 4M3YA 4BG9A 4CJSA 1TKXA 4IEIA 1E4FT 3ENHA 4E3SA 5FDLA 2NLXA 4FWPA 4DS5A 3ZX0A 4B9UA 1BIZA 3TI0A 3L3UA 4OGEA 3DRSA 2P9NA 3HPGA 4UY8O 1WBBA 3KLGA 2FBYA 3WQTA 5MLCQ 4IO9L 4FWSA 4O8KA 1K73O 3LDNA 2G8HA 1KTQA 2DTUA 1RNHA 3HSCA 4MDAA 1LV5A 3A5NC 1NVLA 1X9WA 3PO4A 3KTQA 2D0AA 4YNQA 3RTVA 4JKFA 2FXUA 4H0YB 3SQ1A 3OYAA 3R6MA 2FC0A 5AQQA 4BROA 3AU5A 1KC8O 1MA9B 1MU2A 5GIOA 5KPZA 3HP6A 1VBHA 4CFDA 2PYJA 3DLRA 3OS1A 1U47A 1WBDA 1UOCA 5AJ3K 2BUPA 5KQDA 3H3NO 4K0KK 3Q7CA 1J9AA 2IOCA 4BGBA 2QA4N 4WYBA 5SWMA 3AGRA 4BVPA 4OLBA 2IVOA 1VHXA 1RDWX 3AARA 3ITHA 4ILHA 3MK6A 4DTNA 1WB9A 1DT9A 5LJWA 3FR0A 1VQNN 1C0GA 4CF8A 5FRNA 4RW6A 2D10A 4NLBA 1RT1A 2CB8A 2YKNA 4KTZA 4CJEA 1U49A 4KTQA 4CJ4A 2HBMA 3AU4A 4CHQA 1NOYA 1R59O 4M45A 1YJNN 4F9OA 5J2PA 3EEQA 5AQPA 3HXMA 1SQKA 1B9DA 1KVBA 4ISEA 3J7AP 4CGJA 1ILYA 2E2NA 2ZGYA 2ZWHA 3LWLA 1K6YA 1U2VA 2WONA 1OVYA 1RBTA 3AVFA 1XC3A 1ATNA 3NF8A 1TL3A 3HBTA 3ALYA 1DEJA 2Z1IA 2A42A 4JEPA 1BQMA 5BPNA 4LF9K 2OPQA 1QZ5A 3P1GA 3CQ8A 3R1XA 1RDDA 1T6CA 2P9IB 2A40A 4IG3A 1F21A 4CVNE 5KQ8A 3PV8A 1DTTA 1JCGA 3DXMB 3RR8A 4FJXA 3CQYA 5FPEA 3G71N 4BRAA 3MDQA 1KRPA 3J80O 4KHNA 3SPZA 2QWQA 1GLCG 3OBWA 4F8RA 1W0HA 3QEVA 2HW3A 3IUCA 2WFBA 4FCYA 3FE1A 1YT3A 5M1PA 4KHWA 2KFNA 3QFPA 3NGZA 3C95A 1FW6A 4DTUA 2I1KA 1TYQB 4AILC 4FLTA 1S6QA 4DQIA 3OYEA 3CFRA 2NRZA 1JLQA 2HBKA 1LCUA 3VQBA 1BDGA 3LAKA 3RWUA 4MO4A 4BRIA 1M1KO 3HRGA 3ZEUA 4FM1A 1Z25A 3VQDA 4CZKA 5GAHP 4DU3A 4A57A 4N5SA 1YAGA 1MK9B 1S6PA 3M5RA 3RVCA 3VQ9A 3SUQA 4ELUA 4FWNA 5DK5A 4HTLA 3CCQN 1EX4A 2RE2A 3LM9A 3I55N 5AQOA 1E4GT 5FLXO 3D2FA 1WAFA 3O4QA 4I2PA 4B8AB 2UXCK 1XUPO 1CLQA
chains in the Genus database with same CATH topology
5ADXH 1YITN 3N4QA 1ZBSA 2QWOA 3H6EA 1SZ2A 1GLEG 3AAPA 2GWJA 2P9UA 4IEEA 3SAGA 1VQMN 2FDQA 1VQLN 1BWFO 3ATVA 4OPHA 3B8AX 4H0TB 3SBTA 4DXAB 3MX2A 3WXIA 2JWLA 4GV9A 1HKGA 3GDQA 3QIJA 1VQ4N 3F5TA 1VQ9N 4KH5A 3O9TA 5EXWA 1Y64A 5AQRA 1MIZB 3TU5A 3L0QA 2A3ZA 4H5TA 4F7GA 1GLAG 4J8FA 4CZMA 3FGUA 1K8KB 2P9PB 3N4PA 1T44A 4NB4A 3HOTA 4FWMA 4H5WA 1NGBA 3H1QA 4IO8A 4JHDA 5F2RA 1K8AO 2J0JA 4OO1J 2P9SB 3BF1A 3ENOA 3O80A 4IXCA 3UKRA 3GG4A 5AQIA 1NGEA 1NMDA 3R9PA 3SMPA 4YOWA 3TSUA 3EE9A 3KHYA 2VGNA 3FLVA 1QVGM 1S72N 4BC2A 4BRCA 2DIKA 3MWPA 5M1FA 1Q7YO 3U4LA 1SAZA 2P9NB 1YJWN 4BC3A 4XH4A 2YJEA 4WFBL 3CPWM 3EE8A 2KKZA 1MK7B 1NGDA 3OHRA 4LC9B 3VENA 4B1WB 3HOSA 3I33A 3MN5A 3CCMN 5AFUA 2F9TA 4JKEA 2NRVA 3O1BA 5JLHA 4GXBA 3PIPL 3CCRN 4TKNA 1ILYA 5E26A 3CCEN 3GE1A 1CZAN 2R82A 4FPAA 3U8ZA 4U67L 5AZJA 4WQ4A 3A0IX 4HDOA 3CJ7A 3IVFA 3I56N 4H5VA 1K9MO 3WEEA 2E8AA 3ID8A 3M6GA 5M1OA 3CCSN 4DB3A 5C2FA 3CC2N 4K42A 2I7NA 4JKCA 1X3MA 3VTHA 4FSVA 5JVGL 4AM6A 4BRHA 5KPTA 4Y0WA 2AL6A 4B1XB 2J4RA 5AQTA 4BVOA 4ISFA 4BC4A 4CD3A 3VEZA 4FL9A 4MO5A 2OTJN 1ZXOA 4YOUA 2FSNA 1H1VA 2CQUA 3VMFB 2JWKA 4JD2B 3WA0A 5BRFA 4JKGA 1TUUA 5TKWA 4YDUA 3A5LC 3E1YA 5BPLA 2AEHA 2NZTA 4GNIA 4H0OA 3O9QA 3MCPA 3EN9A 4CZHA 5AQLA 3BF3A 2H3GX 4ZRJA 3ZYYX 3IMXA 3BP8A 2UYTA 4JKDA 1XQSC 4FOIA 3VGLA 3WUHA 4U7BA 2D1KA 2IIRA 3UKUA 4A2AA 1P90A 3CJAA 4B9QA 1YVNA 3C6AA 5AQMA 4B1YB 3FZHA 3P4IA 2E88A 3CIPA 4CI6A 4BRLA 3CF5L 4BRKA 2Q1NA 4FWQA 3LDQA 4QS9A 2YX6A 5BRHA 1G99A 1MWMA 2EWSA 4O5FA 1GLLO 3EPYA 3VPZA 3VTIA 1ATSA 2CGKA 2FF3B 2P9KB 4YOXA 1NGGA 3H1VX 5BRDA 1Q86O 3EKUA 2QWPA 1W97L 2AP1A 3VF6A 3WXJA 2E2QA 3FZKA 4WF9L 3MN7A 3W0LA 5HL7L 4R79A 1KAYA 2CGJA 5EOYA 2F9WA 2KHOA 1H4RA 2FSKA 4WQ4C 3UE5A 1YI2N 4HDQA 4CZFA 2FSJA 1VQ6N 3U7DA 3C7NA 2GWKA 3FLCO 3T69A 4GVEA 5C15A 4A59A 3DLLL 3VEOA 3GOIA 4C1NI 2RQ1A 1YXQA 2VWBA 3TTCA 4BRPA 4B1VA 4C1NK 2ZJQL 3EKSA 3ZX2A 4GV6A 1U2VB 2ZGZA 4YL8A 4M7YA 2YHXA 3MN6A 1JDEA 4H0XB 3D2EA 4JAXA 4WCEL 4JK9A 5F1XA 3SAHA 2J0MA 3BINA 5FPDA 2NRRA 4XH1A 3ULEA 2I7PA 2Q2RA 3CCJN 1VQ5N 5AQZA 2GX9A 1E5WA 3OBYA 3AY9A 3DJCA 1JJ2M 3L4QA 2A6AA 2P9LA 3CJ9A 1EO1A 3EL2A 4PKHA 2YI1A 3H3OB 4XH5A 4YDUC 2QI2A 2RHKA 1BA0A 4CBWA 2V7YA 5AR0A 3CPEA 5TKYA 4BRNA 3A8YA 2VCPA 4FOEA 4CZIA 3O6WA 1EF1A 2P9IA 4CJ7A 4BY9C 4NY0A 1GLBG 1HLUA 1RGIA 3KWIA 3U9DA 4K43A 5GAEP 3VEVA 3DXMA 3OW2M 3CD6N 2ZJPL 3O9UA 4KBOA 1V4TA 4CD1A 3WQUA 3CQXA 1VQKN 1JCEA 1U6ZA 4QS7A 5EX5A 3CI5A 4YOVA 2HE7A 5EY4A 2QW9A 2PBDA 4GY2B 3VGKA 5AQKA 1NI2A 1NGIA 5AQJA 3D7EO 1TUYA 3P31A 3MCAB 2AA4A 2GUPA 5F0XA 4JKAA 3IFRA 3L4IA 3C65A 2FF6A 3C0BA 2E2PA 1BG3A 1QHAA 4G9ZA 3CJ1A 1Z6RA 4EIAA 3LDLA 5CR4A 2EMTA 2J0KA 4BR9A 1HKBA 5B8HA 3ZETA 1YHQN 3S41A 3RSEA 2A5XA 5KPRA 3HM8A 1KXPA 3CCUN 3EO3A 3H46O 5BPMA 1LOTB 3JS6A 4BGAA 4CBXA 1TYQA 4BREA 4CBUA 4EHUA 1GLJO 2WBNA 4K41A 4O8UA 1P8ZA 4BR0A 3W3DA 4FO0A 5IJMA 4IOAL 1QQNA 4JKHA 3HTVA 2NNWA 2W41A 3FZMA 4I6MA 3CETA 4WQ5C 5ADXA 3LM2A 2QXLA 4JN4A 5ELZA 5M1NA 2GEMA 1NM1A 2WH5A 3FZLA 4A2BA 3LL3A 1HJOA 2GELA 5C12A 3ZEUB 2QWMA 3SMSA 3SBGA 5CE3A 3CJBA 3MX5A 1DGKN 5AQUA 3VOVA 2HF3A 5GINA 3F2KA 4NO7A 4BR4A 4RWTA 2E2OA 2IVPA 3WXLA 1MIXA 3VERA 3AGKA 4FWOA 3TTFA 1ISNA 1HB8A 3VEXA 3WXKA 3SJHA 4BR7A 2IVNA 2QM1A 4ILJA 4EKUA 3D2FB 4CZGA 3DXKB 3OA9A 4K25A 3PIOL 2HRJA 3PZDA 3H45C 2COPA 3G9WA 3VESA 4BRMA 2QWRA 4EHTA 4FVUA 5AZIA 3FP5A 1YUWA 2P9UB 2PAVA 3M3ZA 3BUZB 4RCHA 1Y19B 2ABDA 3PVLA 4RTFD 4WFAL 4IDHA 2HBJA 2YHYA 4ISGA 2I1JA 1M90O 2V51B 5FPMA 4IFEA 4YOYA 2CH6A 3MMVA 3KVGA 2HF4A 3ENBA 1KAZA 3GL1A 3U8XA 3KZBA 2V52B 2VGMA 1NJIO 2DPNA 3KK7A 4BRGA 3QBWA 3IKMA 4EFHA 3CHWA 4JHDB 4DKWA 3CC7N 3NMUA 1K8KA 2P9PA 3UKRB 2QEXN 3UB5A 2NRWA 1Q81O 3HZ6A 2WC9A 2YJFA 2BH1A 1GG3A 2P9SA 4BG9A 3QBXA 4E1JA 5AQFA 4IEIA 4A61A 2ZJRL 2KLAA 5LJVA 2X0SA 1E4FT 3G25A 3ENHA 3Q7BA 4ZRIA 2NLXA 3CERA 4FWPA 2W40A 3C6HA 3ZX0A 1J6ZA 2F7TA 4PKGA 1ST7A 2ZPYA 1X3NA 3O5BA 4CZLA 1W2BM 2P9NA 2WUSA 3TSQA 4UY8O 4JK8A 4H5NA 3CXCM 4DQ8A 1NGJA 4A5AA 1DIKA 3WQTA 5MLCQ 4IO9L 4FWSA 4O8KA 3CJCA 1K73O 5AQVA 3LDNA 5AZJB 3ATUA 3ID6A 4IWVA 5AQSA 1N8RO 5DM7L 4JKBA 3HSCA 3GBTA 4MDAA 5AQXA 1T3VA 1NVLA 2QWLA 1GGOA 3A5NC 3WT0A 1VQ8N 1IJJA 4YORA 3WEEB 3TPQA 4M63C 3CC4N 3CMEN 4CYEA 3CCVN 1YF5L 3QICA 1HX1A 3TTDA 1O13A 4PKIA 1NWKA 4JKFA 5GIPA 3SAFA 1T6DA 2FXUA 3ZDTA 2ZF5O 4H0YB 3T7ZA 1KQSM 3QMLA 3R6MA 4KH6A 4BQZA 3A5OC 5AQQA 5JVHL 4BROA 3AU5A 1MDUB 1KC8O 1MA9B 2E20A 5GIOA 4M7XA 3A5MC 4IJNA 5KPZA 1VBHA 3LDPA 1QZ6A 4JKGB 3J7ZO 2D2QA 4JD2A 1KBLA 5JMVA 4CZJA 1ZC6A 2BUPA 3FFKB 5KQDA 1D4XA 5AFUH 3H3NO 3O1WA 4DCHA 3DWLA 3JXUA 3F9MA 3Q7CA 4FWRA 5AQWA 3HI0A 4A5BA 5GADP 3G4SN 3UKUB 4BGBA 2QA4N 4WYBA 2E1YA 3AGRA 1OKJA 2IVOA 4BVPA 3PLAA 1VBGA 1RDWX 1NGHA 5M1KA 3AARA 3R8EA 4ILHA 3MK6A 2OTLN 3R3LA 1DT9A 3NVKA 5LJWA 3FR0A 4PL8A 1VQNN 1C0GA 2LBBA 4MLHA 2D10A 4IZ9A 5JLFA 3VETA 1HPMA 1V4SA 4NLBA 2P9KA 3VEYA 4PHTX 2D0PA 3D6RA 3NVMA 2CB8A 1NBWA 3O9SA 3VEWA 4ILGB 1EQYA 3O9RA 4EAHD 1S22A 5CHIA 4Z94A 1MWKA 5AQHA 2HBMA 3AU4A 3C7NB 3O8MA 1BA1A 1VAZA 1R59O 5AQNA 5AQGA 5LY3A 1YJNN 4F9OA 2Q36A 3E9LA 5AQPA 3ZX3A 1SQKA 2YCHA 4YOTA 4DHYA 2FLOA 1Z05A 3QFUA 4ISEA 4NLCA 4BRQA 1ACAA 4H0VB 4BRFA 3I55N 3D2EB 2E2NA 2ASOA 2ZGYA 2ZWHA 3MWTA 2Q0UA 4AM7A 4BC5A 3KWGA 3ULEB 1U2VA 4BG8A 1OVYA 1RDUA 1QQOA 4OPAA 1XC3A 1ATNA 3VF2A 2GTDA 1BU6O 4XEIA 5FPNA 2HBLA 1WOQA 3HBTA 2P9LB 2YHWA 3MN9A 1SS6A 1DEJA 4MDBA 4JEPA 2A42A 5BPNA 4WFNL 4BQLA 3E66A 2YVCA 1ESVA 1QZ5A 3CMAN 3SLCA 2QTDA 1KC7A 3R1XA 1JCFA 1S3XA 1T6CA 1X9JA 2P9IB 2HSTA 2A40A 1J19A 2HOEA 2CGLA 5KQ8A 1JCGA 4L3QA 3DXMB 3P39A 3VF4A 3CQYA 5FPEA 4IJAA 4QS8A 3G71N 4BRAA 5GAGP 1ATRA 3MDQA 5AQYA 3L6QA 4BR5A 3O4WA 1WUAA 1RFQA 2QWQA 5EVZA 1C0FA 1GLCG 4HWIA 3OBWA 1BO5O 1VQPN 3QDKA 3IUCA 2WFBA 3TSPA 2QWNA 1GLFO 2ASPA 5C10A 2EMSA 3FE1A 3E9OA 5M1PA 4H03B 4FWLA 1NLVA 2ASMA 2V7ZA 2Q97A 4BRDA 5BN8A 1SGHA 5HOOA 3M1FA 2PFUA 3SK3A 3G6EN 3P38A 3K9JA 4PL7A 2BTFA 2VYPA 4AF1A 5BR9A 3ZETB 1QQMA 1BUPA 3QFPA 1HKCA 3RSEB 1BOTO 1KD1O 1VQON 3WXMB 3J8AA 4FWKA 2I1KA 3X23A 1TYQB 2D4WA 3FZFA 1GC7A 3QB0A 4IOXA 4P7IA 3BEXA 3O08A 5H1SQ 2OANA 4FPBA 4B1UB 4I6MB 2NRZA 3CCLN 4A62A 2Q31A 1NTIA 5DM6L 4JK7A 1IG8A 1YIJN 2HBKA 1QVFM 1LCUA 1Q18A 2FJ9A 1BDGA 5BN9A 2CH5A 4JNEA 5C2DA 4IOCL 4MO4A 3VGMA 4BRIA 5M1QA 1M1KO 2NRTA 2NRXA 3HRGA 5C0YA 4C23A 1HUXA 1YJ9N 2D0OA 5I9EB 2Q0RA 3I8BA 2E1ZA 3ZEUA 4B1ZA 1VQ7N 3E9PA 5E84A 4CZKA 5BREA 4CZEA 5GAHP 4A57A 1HBKA 4BR2A 2D11A 1Q82O 1YAGA 3AAQA 1HB6A 1MK9B 3K9KA 3LDOA 2HMPA 5JVLA 4KH4A 1GC6A 3M5RA 1NGAA 3RVCA 1GLDG 1NGFA 4FWNA 4HTLA 5JICA 3CCQN 2NRHA 4GV3A 1KAXA 2RE2A 3LM9A 3IDHA 1NGCA 2A41A 1DKGD 3DAWA 4H5RA 4MLEA 5AQOA 1E4GT 3U9ZA 3D2FA 4WQ5A 3EZWA 3DXKA 5AZIB 2ITMA 1XUPO 4H0PA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  3SBG A;  3E9O A;  3E9L A;  4JKD A;  3E9P A;  4JKF A;  3SBT A;  4JKC A;  4ILH A;  4JK9 A;  3ENB A;  4JK8 A;  4ILJ A;  4JKH A;  4JKG B;  4JK7 A;  4JKE A;  4JKG A;  4JKA A;  4ILG B;  3E66 A; 
#chains in the Genus database with same CATH topology
 5ADX H;  1QS4 A;  1ZBS A;  3H6E A;  1SZ2 A;  1GLE G;  2GWJ A;  2FDQ A;  1BWF O;  1KCF A;  4W5O A;  3LPU A;  3B8A X;  3TAQ A;  3QEI A;  1DTQ A;  3GDQ A;  3OYL A;  3O9T A;  1Y64 A;  4CZH A;  3TU5 A;  3L0Q A;  2P9P B;  3N4P A;  2KQ2 A;  4DTS A;  4JHD A;  2GV9 A;  5F2R A;  3PSF A;  4FJ7 A;  4IXC A;  3OVN A;  3O80 A;  1CZB A;  4O44 A;  4NXN K;  3SMP A;  4YOW A;  1TAQ A;  3KHY A;  2VGN A;  1IG9 A;  3K5L A;  1S72 N;  4C8K A;  4DS4 A;  3U4L A;  4KHY A;  1YJW N;  2P9N B;  4DF8 A;  5E41 A;  5KRT A;  4M42 A;  2X6S A;  3EE8 A;  2KKZ A;  4DFP A;  1NGD A;  4B1W B;  3I33 A;  3MN5 A;  5JLH A;  2NRV A;  2RKI A;  4GXB A;  4CEB A;  1XNQ K;  5E26 A;  3GE1 A;  3ZT2 A;  3A0I X;  4HDO A;  4W5R A;  3LP0 A;  3AA2 A;  1N6Q A;  4YY3 K;  2E8A A;  3ID8 A;  3M6G A;  5C2F A;  3NDK A;  3KKR A;  4M3W A;  4K42 A;  1SKR A;  2I7N A;  3OYG A;  4X65 K;  3LP1 A;  3THW A;  4Y0W A;  2F8T A;  3HT3 A;  2J4R A;  4ISF A;  4BC4 A;  4CD3 A;  3THY A;  4B3T K;  4KAZ A;  2OPP A;  5BRF A;  4JKG A;  1LW0 A;  3E1Y A;  1BGX T;  4H0O A;  3ZCM A;  4KFB A;  1ITG A;  2YNI A;  3O9Q A;  4Z4I A;  4GVM A;  4U7B A;  2UYT A;  4JKD A;  1XQS C;  4FOI A;  3WUH A;  2IIR A;  3UKU A;  2YNG A;  3CJA A;  4CJW A;  5AQM A;  3QIO A;  4B1Y B;  3FZH A;  4AH9 A;  4CK1 A;  3CF5 L;  4FWQ A;  2YX6 A;  3B6O A;  2EWS A;  3LZI A;  3EPY A;  3KLI A;  4CIF A;  1NGG A;  3H1V X;  4BDP A;  1Q86 O;  2VWK A;  3C6T A;  3THX A;  4FJM A;  3FZK A;  1NK0 A;  2F9W A;  2KHO A;  4LF4 K;  2FSK A;  4G1Q A;  1YI2 N;  1T05 A;  4AHS A;  3NCI A;  3QEW A;  1VQ6 N;  3C7N A;  4GVE A;  5C15 A;  4IFY A;  3ZT0 A;  4C1N K;  2IDO A;  3TTC A;  4CHZ A;  3EKS A;  4DSE A;  1U2V B;  1TK5 A;  3NH1 A;  3SAH A;  1NK8 A;  3D2E A;  2OZS A;  4JK9 A;  3BIN A;  1VSK A;  4DLE A;  4JS4 A;  4XH1 A;  4ZTF A;  5AQZ A;  3AY9 A;  3DJC A;  3I0S A;  4HHT A;  3AVL A;  2KFZ A;  4JLH A;  3CJ9 A;  3EL2 A;  4YDU C;  5KGX A;  2QI2 A;  4LF8 K;  4E1M A;  4DR4 K;  2V7Y A;  3CPE A;  3O6W A;  4KKO A;  4IDK A;  3U9D A;  4CJR A;  2ZJP L;  3O3H A;  4JI8 K;  4KBO A;  1WLJ A;  3WQU A;  3P5J A;  3CQX A;  1VQK N;  2G8F A;  1BL3 A;  3VGK A;  4Q5V A;  4HCB A;  2PYL A;  4M41 A;  2XY8 A;  3G10 A;  4OKJ A;  2B5J A;  2P5G A;  3ZSQ A;  4JKA A;  3IFR A;  1FKO A;  3C65 A;  2E2P A;  3AA3 A;  4OPJ A;  1SV5 A;  4O0I A;  3DOL A;  3SQ4 A;  1QSS A;  3HJF A;  3TAM A;  2EMT A;  1HYS A;  1HKB A;  3ZET A;  2FBT A;  1YHQ N;  4J2E A;  3HK2 A;  2D5R A;  1KXP A;  1GLJ O;  4K41 A;  4BR0 A;  4DV4 K;  3QET A;  2ZE2 A;  4FO0 A;  4IOA L;  4B9V A;  4OGC A;  4Z4E A;  3HTV A;  4I6M A;  4FJG A;  4I2Q A;  4JN4 A;  2VG5 A;  1WSH A;  4A2B A;  3CFO A;  3LL3 A;  4NCA A;  1HJO A;  3ZEU B;  3CJB A;  3KK3 A;  4JRQ A;  4BR4 A;  2E6M A;  4B9N A;  1ASV A;  4IBN A;  3VER A;  5SZT A;  5HP1 A;  4RW8 A;  3AGK A;  1HB8 A;  2FBX A;  1XWL A;  4ILJ A;  1S1W A;  3D2F B;  4CZG A;  4K25 A;  1A5V A;  3PIO L;  2OYQ A;  4FK0 A;  3G9W A;  4BRM A;  4FVU A;  4E7H A;  2UUA K;  1VSD A;  3M3Z A;  3BUZ B;  4HTU A;  2ABD A;  1RT6 A;  4JI4 K;  2YHY A;  4Q0B A;  5FPM A;  4IFE A;  3MXI A;  4F4K A;  2WTU A;  3KVG A;  4KHU A;  2DY4 A;  4DR7 K;  3ENB A;  2VGM A;  4LFA K;  4FLX A;  2DPN A;  3QBW A;  4DR5 K;  3IKM A;  1RDB A;  1WSG A;  4JHD B;  4DKW A;  4BAC A;  3CC7 N;  1LWC A;  1K8K A;  2JGU A;  2BGG A;  1O1W A;  2YJF A;  2BH1 A;  4QAG A;  3BGR A;  2HHT A;  2IS3 A;  5LJV A;  2X0S A;  4LSL A;  3Q7B A;  3PX0 A;  2W40 A;  3C6H A;  2A1S A;  2F7T A;  2ZPY A;  4CZL A;  3SYZ A;  4FK2 A;  2WUS A;  3TSQ A;  3U3Y A;  2HND A;  4DQ8 A;  1NGJ A;  1WN7 A;  3HPO A;  1UAX A;  1L5U A;  3ATU A;  1D9F A;  3ID6 A;  3CM6 A;  5BR8 K;  1T3V A;  2QWL A;  3HVT A;  3TPQ A;  4M63 C;  1HNZ K;  4BE2 A;  3CCV N;  4RW4 A;  1XHX A;  3QIC A;  3TTD A;  4IKF A;  3THW B;  3T7Z A;  3QML A;  4KH6 A;  3T1Y K;  3THY B;  1NNE A;  4DMN A;  2E20 A;  4L8R B;  2DFF A;  4M7X A;  4IJN A;  4FZY A;  3KJV A;  3SQ0 A;  4J2D A;  3LDP A;  2WOM A;  1QZ6 A;  4JKG B;  4JI2 K;  2D2Q A;  3SJJ A;  4LF7 K;  4JI0 K;  4PUO A;  3DLH A;  1D4X A;  1N32 K;  3AVC A;  4E7I A;  1N8R O;  5AQW A;  5GAD P;  3HI0 A;  4A5B A;  3G4S N;  3UKU B;  1J54 A;  2E1Y A;  3ZSX A;  3PLA A;  1NGH A;  5M1K A;  4AHR A;  1L3V A;  3R3L A;  2XY6 A;  1GOB A;  1ZBI A;  4CGG A;  4MLH A;  4IZ9 A;  5JLF A;  3SNN A;  1NJZ A;  3THX B;  1V4S A;  1WAJ A;  3NVM A;  3D6R A;  4HUE A;  1NBW A;  4CFA A;  3O9S A;  3M8Q A;  2OZM A;  4FJ8 A;  4CK3 A;  3IRX A;  5AQH A;  3ZT4 A;  3C7N B;  1VAZ A;  5AQN A;  3E9L A;  3AVG A;  3NAE A;  2Y1J A;  4YOT A;  2YCH A;  4PQU A;  3VQA A;  3QFU A;  3D2E B;  3MWT A;  4BWJ A;  4CHP A;  3EYZ A;  4FW1 A;  4OPA A;  3CYM A;  4FJJ A;  5FPN A;  1BU6 O;  1VSE A;  4CGI A;  1TAU A;  3ZT3 A;  2YVC A;  2UXD K;  1ZBU A;  2B4J A;  1S3X A;  1X9J A;  2HST A;  1EKE A;  1I3A A;  1IBK K;  1J53 A;  4ID1 A;  4L3Q A;  4ELT A;  3VF4 A;  4IJA A;  3U3G A;  2EX3 A;  4H4O A;  2ZQB A;  1VQP N;  1BO5 O;  1RT5 A;  3SUP A;  3TSP A;  5C10 A;  4KHQ A;  1OH6 A;  3E9O A;  4PL7 A;  4H03 B;  2Q97 A;  1IO2 A;  1QE1 A;  4BE0 A;  3LWM A;  3H08 A;  3SK3 A;  3G6E N;  4FJN A;  3AVM A;  3K9J A;  1VRT A;  5BR9 A;  2I5J A;  4H4M A;  3ZET B;  1QQM A;  4FWK A;  1TKZ A;  3X23 A;  3FZF A;  2F96 A;  1GC7 A;  3ZSW A;  3LPT A;  3ULD A;  3BEX A;  2OAN A;  4LFC K;  3S9H A;  3J81 O;  4I6M B;  1TVR A;  3RMB A;  2RF2 A;  4JK7 A;  1C0T A;  1YIJ N;  1FXX A;  1Q18 A;  2FJ9 A;  1SKS A;  1UWB A;  1RT7 A;  4JNE A;  3VGM A;  3PUF A;  1HUX A;  1YJ9 N;  2GUI A;  5I9E B;  2Q0R A;  3I8B A;  1VQ7 N;  3V9W A;  4FLU A;  3E9P A;  4CZE A;  4KHP K;  1HBK A;  4BR2 A;  2D11 A;  4CJF A;  3V4I A;  1LW2 A;  3K9K A;  3LP2 A;  2HHX A;  5JVL A;  1VSM A;  1NGA A;  1QQC A;  1QTM A;  5JIC A;  4MLE A;  2A41 A;  3DAW A;  2YHA A;  5I3U A;  1OH7 A;  3DXK A;  3K2P A;  2ITM A;  4H0P A;  4ZRK A;  1HQE A;  4LY7 A;  2QWO A;  3AAP A;  3SCX A;  4IEE A;  4CCH A;  5CY4 A;  4J2A A;  3QIP A;  4H0T B;  4FJI A;  1RBU A;  3WXI A;  5CZ2 A;  3VQC A;  4ZTJ A;  3QLH A;  5AQR A;  1MIZ B;  5HRN A;  1GLA G;  2W6L A;  3SI6 A;  5T7B A;  1K8K B;  4NB4 A;  1XI1 A;  4FWM A;  2YV0 X;  1NGB A;  2ZD1 A;  4OO1 J;  3BF1 A;  5AQI A;  3R9P A;  4B3S K;  4UQG A;  1C6V A;  1VSL A;  2BDP A;  4V19 S;  2QK9 A;  4BC2 A;  4BRC A;  2NUB A;  5M1F A;  2E4L A;  3TAP A;  4BC3 A;  4XH4 A;  4DSJ A;  4DR2 K;  3V9S A;  4M3Z A;  4LC9 B;  3CCM N;  5AFU A;  4DQQ A;  4JKE A;  3DMJ A;  4CJ3 A;  1CZA N;  2R82 A;  3I8D A;  2O8E A;  3DLG A;  4Y1C A;  4WQ4 A;  1I94 K;  3I56 N;  4H5V A;  4HUG A;  4CHY A;  1G15 A;  1K9M O;  2E6L A;  4FLY A;  3ZSO A;  3VQ4 A;  4OX9 K;  3V9Z A;  4DQS A;  1OVQ A;  4AM6 A;  4BRH A;  2AL6 A;  4B1X B;  5A2Q O;  2Z1H A;  5AQT A;  4BVO A;  1VSF A;  3PX6 A;  3AV9 A;  1ZXO A;  3SV4 A;  2FSN A;  3VMF B;  2HHH K;  4CF9 A;  4AHU A;  3QNO A;  5K14 A;  2NZT A;  3V1R A;  2UUB K;  3EN9 A;  2DFH A;  3AVI A;  3BP8 A;  4DFM A;  3T1A A;  2D1K A;  4A2A A;  1P90 A;  4B9Q A;  1YVN A;  3C6A A;  3P4I A;  4CI6 A;  2E88 A;  1C1A A;  4DSK A;  1G99 A;  1MWM A;  1GLL O;  1QSL A;  2GBZ A;  3VTI A;  4YOX A;  3AO1 A;  4DQR A;  3VN5 A;  2QWP A;  3OYM A;  1W97 L;  2AP1 A;  3VF6 A;  3LZJ A;  2E2Q A;  4CHO A;  4R79 A;  1H4R A;  4DTR A;  4FYD A;  3U7D A;  1RDA A;  5HLF A;  2GWK A;  3JSM A;  4GW6 A;  3T69 A;  1NG9 A;  4E7K A;  3GOI A;  2RQ1 A;  2O8B A;  2ZJQ L;  4GV6 A;  4M7Y A;  3MN6 A;  4H0X B;  1HNW K;  2J0M A;  2NRR A;  1HYV A;  1E5W A;  3F73 A;  3OBY A;  1EO1 A;  3PY8 A;  1I39 A;  1VK0 A;  3H3O B;  3L2R A;  4E7L A;  4LF5 K;  2QKB A;  5AR0 A;  5TKY A;  4BRN A;  2VCP A;  4CZI A;  4NY0 A;  1RGI A;  3KWI A;  3VQQ A;  1JXB A;  3B6P A;  3BZK A;  3VEV A;  5GAE P;  3OW2 M;  1NKC A;  4B9S A;  3O9U A;  4QS7 A;  5EX5 A;  3CI5 A;  4NYN A;  2QW9 A;  2X74 A;  2QXF A;  4GMJ B;  1NI2 A;  4DTP A;  2VWJ A;  3VQE A;  3P31 A;  3MCA B;  4CEF A;  2AA4 A;  2GUP A;  3S3N A;  3KLE A;  5F0X A;  1T03 A;  4Z4G A;  1U04 A;  1Z6R A;  4EIA A;  2J0K A;  4J2B A;  3RSE A;  2A5X A;  4NCG A;  3QIN A;  3L8B A;  3H46 O;  5BPM A;  1LOT B;  4BGA A;  1KLM A;  4CED A;  4EHU A;  1P8Z A;  3QEP A;  2KTQ A;  1IKW A;  5IJM A;  3VQ6 A;  3NHG A;  4FZX C;  2GEM A;  2VG6 A;  4AHT A;  4CHN A;  1UA1 A;  2GEL A;  4E1N A;  4C8L A;  3NGY A;  3AVB A;  1XHZ A;  1EET A;  3OYN A;  1D8Y A;  3OYF A;  3L2W A;  3V9U A;  3F9K A;  3WXK A;  2E5L K;  2IVN A;  2G8W A;  4CJK A;  4M3T A;  2HHU A;  3DXK B;  3A2F A;  2COP A;  4W5Q A;  3VES A;  4EHT A;  1TK8 A;  5AZI A;  1T8E A;  1KSP A;  3HP9 A;  4RCH A;  4PY5 A;  2I1J A;  2V51 B;  2A1R A;  2O4I A;  4CJP A;  2HF4 A;  3GL1 A;  4CEO A;  1NJI O;  3SUO A;  4CGD A;  1NK9 A;  1S1V A;  3K0S A;  1XNR K;  2QEX N;  3UB5 A;  1SL0 A;  1NOZ A;  3HZ6 A;  4CES A;  2WC9 A;  4B3R K;  2P9S A;  2UU9 K;  3TAB A;  3V1O A;  1NK5 A;  1BIU A;  4X64 K;  5AQF A;  3MEE A;  2KLA A;  4X66 K;  3G25 A;  4CE9 A;  3OTO K;  3NH2 A;  4B9T A;  4W5N A;  3KLF A;  1RTI A;  4Z4H A;  1W2B M;  4AQY K;  2HHW A;  4JK8 A;  1HQU A;  4H5N A;  4OKE A;  1S9G A;  4F2R A;  1DIK A;  4DUZ K;  4KO0 A;  3OY9 A;  2O8E B;  2D0C A;  5DM7 L;  3K5O A;  1ASU A;  5AQX A;  1QSY A;  1GGO A;  1RT3 A;  3WT0 A;  5J2Q A;  4YOR A;  1BIS A;  5C42 A;  4DR1 K;  1O13 A;  3K5N A;  1NWK A;  5GIP A;  1T6D A;  3C94 A;  2ZF5 O;  1KQS M;  1GOA A;  4BQZ A;  3ASM A;  4DV7 K;  3SQ2 A;  1MDU B;  3A5M C;  3IS9 A;  1J5O A;  1B92 A;  2G8V A;  4JD2 A;  4AHC A;  1KBL A;  1NK4 A;  5JMV A;  4CZJ A;  3FFK B;  3O1W A;  4DCH A;  3O3G A;  4FWR A;  3JXU A;  3F9M A;  3L2V A;  3S3M A;  4Z4F A;  5CZ1 A;  3VQ8 A;  1RTH A;  3DYA A;  4EP4 A;  3RRH A;  3R8E A;  1VSJ A;  3NVK A;  4E19 A;  4PL8 A;  2QKK A;  1JLF A;  5EU7 A;  4CGF A;  4H8K A;  2HHV A;  1HPM A;  4DV6 K;  2FBV A;  3VEW A;  1EQY A;  4EAH D;  3ISN C;  1S22 A;  5CHI A;  4JRP A;  1L3S A;  3EZ5 A;  2O8C A;  5D3G A;  4B8C A;  3TAF A;  2PZS A;  3ZX3 A;  3M8R A;  1HRH A;  4DHY A;  2O8B B;  1Z05 A;  3K5M A;  1ACA A;  4H0V B;  1TV6 A;  3CM5 A;  4AM7 A;  4CER A;  4C8N A;  4BG8 A;  1RDU A;  1QQO A;  4XEI A;  2HBL A;  1WOQ A;  3MN9 A;  4WFN L;  4MDB A;  4FLZ A;  4I9Q A;  3WNH A;  3CMA N;  2OPR A;  2QTD A;  1CZ9 A;  1HYZ A;  4DV0 K;  1RT2 A;  2HOE A;  3T1H K;  1VSI A;  4QS8 A;  3I0R A;  4FLW A;  5GAG P;  4JI5 K;  4I7F A;  5AQY A;  1A5W A;  3L6Q A;  4BR5 A;  1W7A A;  1C0F A;  4HWI A;  1RCH A;  3NFA A;  1KVC A;  1IKV A;  1UA0 A;  5BN8 A;  4FWL A;  2V7Z A;  2ASM A;  4BRD A;  1SGH A;  2O8D A;  3M1F A;  3RMC A;  4O4G A;  1J5E K;  2PFU A;  3LAM A;  3VQ7 A;  3P38 A;  2Q3S A;  1HKC A;  4NYF A;  3RSE B;  3AVJ A;  4KB0 A;  4JV5 K;  2XY7 A;  1YTU A;  1EWR A;  2IC3 A;  4JYA K;  3O08 A;  3NBP A;  3NGI A;  5H1S Q;  1GOC A;  4KI4 A;  1JKH A;  3ZSZ A;  4B1U B;  2UUC K;  3CCL N;  4A62 A;  2Q31 A;  1NTI A;  4FW2 A;  1QVF M;  4O55 A;  5BN9 A;  5M1Q A;  2NRT A;  4C23 A;  1TKD A;  4CGH A;  4DLG A;  2E1Z A;  4B1Z A;  3K58 A;  4CK2 A;  5E84 A;  1L3T A;  5IWA K;  2XO7 A;  5FRM A;  1HB6 A;  4KH4 A;  1GC6 A;  1GLD G;  1NGF A;  4DWI A;  4FJ5 A;  4GV3 A;  4E89 A;  3U9Z A;  3EZW A;  1BQN A;  1KFD A;  5AZI B;  4FK4 A;  4RW9 A;  3E66 A;  4FXD A;  1YIT N;  3N4Q A;  4CF2 A;  2P9U A;  3SAG A;  4QCL A;  1N34 K;  3D0P A;  5KI6 A;  3QER A;  3MAQ A;  2JWL A;  4GV9 A;  3NH0 A;  4CFC A;  1LAV A;  3ZSR A;  3F5T A;  5LMU K;  4KH5 A;  4DFK A;  1VQ9 N;  4F7G A;  3TR8 A;  3FGU A;  3K57 A;  3H1Q A;  4IO8 A;  3VQ5 A;  1K8A O;  4DU4 A;  2J0J A;  2P9S B;  3GG4 A;  1NMD A;  2XY5 A;  3DM2 A;  3HST B;  1JLA A;  3FLV A;  3DOK A;  2DIK A;  3MWP A;  1Q7Y O;  3D45 A;  4CFB A;  4WFB L;  3CPW M;  2RN2 A;  3MEC A;  1U4B A;  3LP3 A;  4DF4 A;  4BDZ A;  3OHR A;  3VEN A;  3L2U A;  5FRO A;  2F9T A;  3CCR N;  4TKN A;  1JL1 A;  3MED A;  1ASW A;  3THV A;  4U67 L;  5AZJ A;  3K59 A;  4CJV A;  3IVF A;  2ETJ A;  1TKT A;  3WEE A;  1LWF A;  3CCS N;  3CC2 N;  3TWH A;  1VRU A;  3NF6 A;  4DG1 A;  4JKC A;  1X3M A;  4FSV A;  1YTA A;  5JVG L;  3OJS A;  3VEZ A;  4MO5 A;  3M8P A;  4M3X A;  1H1V A;  4O5B A;  4CJU A;  2JWK A;  4JD2 B;  4DTJ A;  3WA0 A;  1X9M A;  4DTO A;  1EP4 A;  4YDU A;  2Z1J A;  3A5L C;  5BPL A;  4E0D A;  4GNI A;  3MCP A;  4R5P A;  2H3G X;  4LF6 K;  1U48 A;  3IMX A;  2O4G A;  3CIP A;  5JS2 A;  1T7P A;  4MFB A;  5BRH A;  1REV A;  2FF3 B;  3EKU A;  2XHB A;  3WXJ A;  1A5X A;  1FK9 A;  4WF9 L;  3MN7 A;  3W0L A;  5HL7 L;  2O8C B;  1KAY A;  1HJR A;  2CGJ A;  3EY1 A;  2KZM A;  4HDQ A;  4CZF A;  2FSJ A;  3NF7 A;  1S9E A;  5KGW A;  3DLK A;  4A59 A;  3DLL L;  3VEO A;  2OA8 A;  1YXQ A;  4BRP A;  5HRR A;  1Q8I A;  3ZX2 A;  4YL8 A;  4BWM A;  2YHX A;  4YOV A;  1JDE A;  1DLO A;  2VQF K;  5F1X A;  3HL8 A;  3ULE A;  5IT9 O;  3CCJ N;  1RT4 A;  1VQ5 N;  4N41 A;  3AA4 A;  4KRE A;  2A6A A;  2P9L A;  4PKH A;  4FJH A;  1WSF A;  4Z0U A;  2X6N A;  4CEZ A;  1JLC A;  4OLA A;  1IH7 A;  4CBW A;  3A8Y A;  1QHT A;  3J7Y P;  1EF1 A;  4CJ7 A;  4BY9 C;  2W6K A;  1HLU A;  4K43 A;  5CYM A;  1JCE A;  4FZZ A;  2HE7 A;  1NMN A;  4K8X A;  2PBD A;  5AQK A;  1NGI A;  4IG0 A;  3WNF A;  1TGO A;  1TUY A;  3V81 A;  2O8D B;  3L4I A;  3BZC A;  3CFP A;  4NXM K;  1QHA A;  1IV0 A;  3LDL A;  1SUQ A;  5CR4 A;  4BR9 A;  3OYB A;  2HHS A;  3S41 A;  2BE2 A;  2XRI A;  3HM8 A;  3EO3 A;  3OYH A;  1HR0 K;  4GKK K;  3JS6 A;  5JS1 A;  4DTX A;  3T19 A;  3W3D A;  2IGI A;  3AO4 A;  3FZM A;  5ADX A;  4Y1D A;  5M1N A;  3CET A;  4WQ5 C;  3TAE A;  3LM2 A;  3OYD A;  4DR3 K;  1Q9Y A;  3KLH A;  3OJU A;  3OYJ A;  1L3U A;  5C12 A;  2QWM A;  3SBG A;  1YVU A;  3UIQ A;  3MX5 A;  4CJT A;  3AVK A;  4DTM A;  5AQU A;  3VOV A;  4NO7 A;  4RWT A;  3WXL A;  1MIX A;  4JI1 K;  3TTF A;  1ISN A;  4OKK A;  3SJH A;  4BR7 A;  4C8O A;  1WNS A;  1NU0 A;  3OA9 A;  2HRJ A;  3H45 C;  2QWR A;  3CG7 A;  4DV1 K;  1CXU A;  3FP5 A;  2PAV A;  2P9U B;  4M3R A;  4RTF D;  1Y19 B;  3PVL A;  4WFA L;  1C0U A;  1BCO A;  4IDH A;  1D5A A;  4ISG A;  3VQP A;  1M90 O;  3ZSV A;  4FJ9 A;  3OS0 A;  3DLB A;  4YOY A;  2CH6 A;  3MMV A;  1KLN A;  2HB5 A;  3VA0 A;  3MEG A;  1KAZ A;  3BY5 A;  4KTW A;  2KW4 A;  3KZB A;  4CEE A;  3O3F A;  3KK7 A;  4WE1 A;  4BRG A;  4F3O A;  1VSH A;  2UXB K;  4W5T A;  1Q9X A;  1RBS A;  4JS5 A;  1X1P A;  4FJL A;  2HNY A;  1IBM K;  4LD0 A;  3QBX A;  4E1J A;  4A61 A;  2ZJR L;  4K8Z A;  4YHH K;  4CIE A;  4ZRI A;  3MXM A;  1RBV A;  3CER A;  1C0M A;  1J6Z A;  4PKG A;  4RW7 A;  1E3M A;  1ST7 A;  3O5B A;  1X3N A;  1S1X A;  4NCB A;  3CXC M;  4A5A A;  4FM2 A;  1RDC A;  3CJC A;  5AQV A;  1HNX K;  1IKY A;  5AZJ B;  4IWV A;  5AQS A;  4JKB A;  1N33 K;  3GBT A;  2W42 A;  3JYT A;  2AJQ A;  1IJJ A;  1BI4 A;  5CYQ A;  3WEE B;  3CC4 N;  1XMO K;  3MXJ A;  4B3O A;  4CYE A;  1YF5 L;  1HX1 A;  4PKI A;  3SAF A;  3QNN A;  4DV5 K;  3ZDT A;  3DI6 A;  3A5O C;  5JVH L;  4DFJ A;  1N36 K;  4C8M A;  2VG7 A;  3J7Z O;  1WSJ A;  1R0A A;  1ZC6 A;  3SPY A;  5AFU H;  3DWL A;  4FVM A;  3SUN A;  4EP5 A;  1OKJ A;  1VBG A;  5J2M A;  4CJ5 A;  2P51 A;  2OTL N;  2YNH A;  2LBB A;  2X78 A;  2PY5 A;  3RRG A;  3VET A;  1FKP A;  3VEY A;  4PHT X;  2P9K A;  2D0P A;  4DSI A;  2O8F A;  3TAN A;  4ILG B;  3O9R A;  4Z94 A;  1BHL A;  3M8S A;  1MWK A;  4B08 A;  3O8M A;  1BA1 A;  5AQG A;  5LY3 A;  3DRP A;  1ZBL A;  2Q36 A;  4DUY K;  3OS2 A;  4HCC A;  2FLO A;  4BRQ A;  4NLC A;  4BRF A;  4CIG A;  2ASO A;  1NJX A;  2Q0U A;  4BC5 A;  3KWG A;  3ULE B;  3VF2 A;  3HVR A;  2GTD A;  3ZT1 A;  2P9L B;  4N56 A;  3SV3 A;  2YHW A;  1SS6 A;  3ZSY A;  4BQL A;  3OYK A;  4B3M K;  1ESV A;  4B9L A;  3SLC A;  2VQE K;  1KC7 A;  1JCF A;  1J19 A;  2CGL A;  4DV3 K;  4M3U A;  4KHS A;  3P39 A;  1NK7 A;  1U45 A;  4KRF A;  2DFE A;  1TK0 A;  5HBM A;  1ATR A;  2ZM6 K;  4MQ3 A;  3O4W A;  1WUA A;  1RFQ A;  5EVZ A;  4ELV A;  4HVJ A;  3L3V A;  3AA5 X;  4KPY A;  1KVA A;  3QDK A;  1JLB A;  2YKM A;  3KIO A;  2QWN A;  1GLF O;  2ASP A;  2EMS A;  4BE1 A;  1NLV A;  5HOO A;  3T3F A;  1ZYQ A;  3KD1 E;  4RG8 A;  2BTF A;  2VYP A;  4AF1 A;  1BUP A;  1BOT O;  1KD1 O;  1TL1 A;  1VQO N;  4EZ9 A;  3WXM B;  3J8A A;  3TAR A;  2D4W A;  3NE6 A;  4BDY A;  3KD5 E;  3QB0 A;  4IOX A;  4P7I A;  4ICL A;  2EHG A;  4FPB A;  2G8I A;  1Z26 A;  5DM6 L;  3OYI A;  1IG8 A;  5HRS A;  4IOC L;  2CH5 A;  5C2D A;  5C0Y A;  2NRX A;  2D0O A;  5LL6 Z;  4FLV A;  2OPS A;  1CXQ A;  4DV2 K;  1LAW A;  5BRE A;  4HUF A;  1Q82 O;  3AAQ A;  3LDO A;  2ATQ A;  2HMP A;  3RMD A;  3FFI A;  2D0B A;  5C25 A;  2NRH A;  1KAX A;  2HVH A;  1HNV A;  3IDH A;  1NGC A;  4H5R A;  1DKG D;  4JI6 K;  2RPI A;  4WQ5 A;  3DLE A;  4OPK A;  4DSF A;  2P5O A;  2HVI A;  1HPZ A;  1HNI A;  3RMA A;  3IAY A;  1EXQ A;  3NF9 A;  3HM9 A;  4OJR A;  1VQM N;  1VQL N;  3ATV A;  4PA1 A;  3RR7 A;  4CF1 A;  1OH8 A;  4I9L A;  4OPH A;  4YFU A;  4B9M A;  3SBT A;  4DXA B;  3MX2 A;  1HKG A;  4KB1 A;  3QIJ A;  1VQ4 N;  3AO3 A;  5EXW A;  1JLE A;  1NJW A;  4DU1 A;  4H5T A;  2A3Z A;  4J8F A;  1WSE A;  4CZM A;  3HOT A;  1RTJ A;  1T44 A;  4H5W A;  5LMN K;  3ZLJ A;  2JLE A;  3ENO A;  3UKR A;  1XMQ K;  1NGE A;  4ID5 A;  3TSU A;  3EE9 A;  5KTQ A;  1ZBF A;  1QVG M;  3HO1 A;  5DMR A;  4CEQ A;  3V9X A;  4PWD A;  4LH5 A;  1Y97 A;  1SAZ A;  3O4N A;  2YJE A;  1SL1 A;  1MK7 B;  1X9S A;  3U6F A;  3HOS A;  4E7J A;  3PX4 A;  3AVA A;  3O1B A;  3PIP L;  2G8K A;  3CCE N;  4FPA A;  1OH5 A;  3KK1 A;  3U8Z A;  1BI4 B;  1RIL A;  3CJ7 A;  1NKE A;  3AO5 A;  5M1O A;  4DB3 A;  3HPH A;  3VTH A;  3SZ2 A;  4GKJ K;  1S5J A;  4LFB K;  5KPT A;  1D9D A;  2Y1I A;  2OTJ N;  4FL9 A;  4FM0 A;  4YOU A;  2CQU A;  5I42 A;  2KZZ A;  1TUU A;  5TKW A;  2AEH A;  1RBR A;  2R7Y A;  1SL2 A;  4QOZ B;  1XC9 A;  5AQL A;  3BF3 A;  3ZYY X;  4ZRJ A;  3VGL A;  4Z4C A;  4CW7 B;  3JAM O;  2BAN A;  4BRL A;  4BRK A;  2Q1N A;  2YNF A;  3LDQ A;  4QS9 A;  4N76 A;  4O5F A;  3VPZ A;  1ATS A;  2CGK A;  2P9K B;  5BRD A;  2O8F B;  3LAN A;  4LH4 A;  3LAL A;  4X62 K;  3DRR A;  4TSX A;  5EOY A;  4F2S A;  4FJK A;  4WQ4 C;  3UE5 A;  1IBL K;  4CEC A;  3FLC O;  3PSI A;  1N5Y A;  4C1N I;  1RTD A;  2B6A A;  2VWB A;  4B1V A;  2ZGZ A;  1S1T A;  4WCE L;  3CME N;  3AO2 A;  4JAX A;  2Z1G A;  5KRS A;  3BDP A;  5FPD A;  4EZ6 A;  1HMV A;  2I7P A;  2Q2R A;  4CF0 A;  1BCM A;  2GX9 A;  5HRP A;  1JJ2 M;  3L4Q A;  1WSI A;  4AHV A;  2G8U A;  1JL2 A;  2YI1 A;  4XH5 A;  3QO9 A;  3PO5 A;  2RHK A;  3QEX A;  4DR6 K;  1BA0 A;  2F4V K;  1S1U A;  4FOE A;  2P9I A;  1GLB G;  3DXM A;  3CD6 N;  1V4T A;  4CD1 A;  1U6Z A;  4IFV A;  4O0J A;  5EY4 A;  4GY2 B;  4CJQ A;  1C1C A;  3D7E O;  5AQJ A;  2P1J A;  2F8S A;  4CJL A;  2FF6 A;  3C0B A;  1BG3 A;  4G9Z A;  4N47 A;  2IAJ A;  3CJ1 A;  1KFS A;  4DQP A;  5B8H A;  5KPR A;  3OYC A;  3CCU N;  4KI6 A;  3S3O A;  3HYF A;  4CBX A;  1IKX A;  3QES A;  1VQ8 N;  1TYQ A;  4BRE A;  4CBU A;  1B9F A;  2WBN A;  4O8U A;  2OCE A;  1QQN A;  4JKH A;  5J1E A;  4DSL A;  2NNW A;  2W41 A;  5ELZ A;  2QXL A;  4CEA A;  1NM1 A;  2WH5 A;  3FZL A;  2HHQ A;  2YHB A;  3AVN A;  3SMS A;  5CE3 A;  1NKB A;  3V6D A;  1JLG A;  4ZHR A;  3TAG A;  1DGK N;  4OVL A;  3L2Q A;  2HF3 A;  4XIU A;  5GIN A;  4JI3 K;  3F2K A;  3VA3 A;  1EWQ A;  2E2O A;  2IVP A;  4F3T A;  1JXE A;  3AVH A;  4LSN A;  4FWO A;  3E01 A;  3VEX A;  1SKW A;  3C6U A;  4KV8 A;  2QM1 A;  4EKU A;  3WNE A;  3PZD A;  3KK2 A;  2HNZ A;  1LWE A;  1YUW A;  1W9H A;  2HBJ A;  3LDS A;  1C1B A;  1ZBH A;  1NK6 A;  3U8X A;  3P83 D;  2V52 B;  3IG1 A;  5HRO A;  5C24 A;  4EFH A;  3CHW A;  3NMU A;  5J2N A;  3WNG A;  1FJG K;  3V1Q A;  1NJY A;  2P9P A;  4JI7 K;  2ITG A;  3UKR B;  3G0Z A;  2NRW A;  1Q81 O;  2LSN A;  3KKS A;  2HMI A;  1GG3 A;  4M3Y A;  4BG9 A;  4CJS A;  1TKX A;  4IEI A;  1E4F T;  3ENH A;  4E3S A;  5FDL A;  2NLX A;  4FWP A;  4DS5 A;  3ZX0 A;  4B9U A;  1BIZ A;  3TI0 A;  3L3U A;  4OGE A;  3DRS A;  2P9N A;  3HPG A;  4UY8 O;  1WBB A;  3KLG A;  2FBY A;  3WQT A;  5MLC Q;  4IO9 L;  4FWS A;  4O8K A;  1K73 O;  3LDN A;  2G8H A;  1KTQ A;  2DTU A;  1RNH A;  3HSC A;  4MDA A;  1LV5 A;  3A5N C;  1NVL A;  1X9W A;  3PO4 A;  3KTQ A;  2D0A A;  4YNQ A;  3RTV A;  4JKF A;  2FXU A;  4H0Y B;  3SQ1 A;  3OYA A;  3R6M A;  2FC0 A;  5AQQ A;  4BRO A;  3AU5 A;  1KC8 O;  1MA9 B;  1MU2 A;  5GIO A;  5KPZ A;  3HP6 A;  1VBH A;  4CFD A;  2PYJ A;  3DLR A;  3OS1 A;  1U47 A;  1WBD A;  1UOC A;  5AJ3 K;  2BUP A;  5KQD A;  3H3N O;  4K0K K;  3Q7C A;  1J9A A;  2IOC A;  4BGB A;  2QA4 N;  4WYB A;  5SWM A;  3AGR A;  4BVP A;  4OLB A;  2IVO A;  1VHX A;  1RDW X;  3AAR A;  3ITH A;  4ILH A;  3MK6 A;  4DTN A;  1WB9 A;  1DT9 A;  5LJW A;  3FR0 A;  1VQN N;  1C0G A;  4CF8 A;  5FRN A;  4RW6 A;  2D10 A;  4NLB A;  1RT1 A;  2CB8 A;  2YKN A;  4KTZ A;  4CJE A;  1U49 A;  4KTQ A;  4CJ4 A;  2HBM A;  3AU4 A;  4CHQ A;  1NOY A;  1R59 O;  4M45 A;  1YJN N;  4F9O A;  5J2P A;  3EEQ A;  5AQP A;  3HXM A;  1SQK A;  1B9D A;  1KVB A;  4ISE A;  3J7A P;  4CGJ A;  1ILY A;  2E2N A;  2ZGY A;  2ZWH A;  3LWL A;  1K6Y A;  1U2V A;  2WON A;  1OVY A;  1RBT A;  3AVF A;  1XC3 A;  1ATN A;  3NF8 A;  1TL3 A;  3HBT A;  3ALY A;  1DEJ A;  2Z1I A;  2A42 A;  4JEP A;  1BQM A;  5BPN A;  4LF9 K;  2OPQ A;  1QZ5 A;  3P1G A;  3CQ8 A;  3R1X A;  1RDD A;  1T6C A;  2P9I B;  2A40 A;  4IG3 A;  1F21 A;  4CVN E;  5KQ8 A;  3PV8 A;  1DTT A;  1JCG A;  3DXM B;  3RR8 A;  4FJX A;  3CQY A;  5FPE A;  3G71 N;  4BRA A;  3MDQ A;  1KRP A;  3J80 O;  4KHN A;  3SPZ A;  2QWQ A;  1GLC G;  3OBW A;  4F8R A;  1W0H A;  3QEV A;  2HW3 A;  3IUC A;  2WFB A;  4FCY A;  3FE1 A;  1YT3 A;  5M1P A;  4KHW A;  2KFN A;  3QFP A;  3NGZ A;  3C95 A;  1FW6 A;  4DTU A;  2I1K A;  1TYQ B;  4AIL C;  4FLT A;  1S6Q A;  4DQI A;  3OYE A;  3CFR A;  2NRZ A;  1JLQ A;  2HBK A;  1LCU A;  3VQB A;  1BDG A;  3LAK A;  3RWU A;  4MO4 A;  4BRI A;  1M1K O;  3HRG A;  3ZEU A;  4FM1 A;  1Z25 A;  3VQD A;  4CZK A;  5GAH P;  4DU3 A;  4A57 A;  4N5S A;  1YAG A;  1MK9 B;  1S6P A;  3M5R A;  3RVC A;  3VQ9 A;  3SUQ A;  4ELU A;  4FWN A;  5DK5 A;  4HTL A;  3CCQ N;  1EX4 A;  2RE2 A;  3LM9 A;  3I55 N;  5AQO A;  1E4G T;  5FLX O;  3D2F A;  1WAF A;  3O4Q A;  4I2P A;  4B8A B;  2UXC K;  1XUP O;  1CLQ A; 
#chains in the Genus database with same CATH homology
 5ADX H;  1YIT N;  3N4Q A;  1ZBS A;  2QWO A;  3H6E A;  1SZ2 A;  1GLE G;  3AAP A;  2GWJ A;  2P9U A;  4IEE A;  3SAG A;  1VQM N;  2FDQ A;  1VQL N;  1BWF O;  3ATV A;  4OPH A;  3B8A X;  4H0T B;  3SBT A;  4DXA B;  3MX2 A;  3WXI A;  2JWL A;  4GV9 A;  1HKG A;  3GDQ A;  3QIJ A;  1VQ4 N;  3F5T A;  1VQ9 N;  4KH5 A;  3O9T A;  5EXW A;  1Y64 A;  5AQR A;  1MIZ B;  3TU5 A;  3L0Q A;  2A3Z A;  4H5T A;  4F7G A;  1GLA G;  4J8F A;  4CZM A;  3FGU A;  1K8K B;  2P9P B;  3N4P A;  1T44 A;  4NB4 A;  3HOT A;  4FWM A;  4H5W A;  1NGB A;  3H1Q A;  4IO8 A;  4JHD A;  5F2R A;  1K8A O;  2J0J A;  4OO1 J;  2P9S B;  3BF1 A;  3ENO A;  3O80 A;  4IXC A;  3UKR A;  3GG4 A;  5AQI A;  1NGE A;  1NMD A;  3R9P A;  3SMP A;  4YOW A;  3TSU A;  3EE9 A;  3KHY A;  2VGN A;  3FLV A;  1QVG M;  1S72 N;  4BC2 A;  4BRC A;  2DIK A;  3MWP A;  5M1F A;  1Q7Y O;  3U4L A;  1SAZ A;  2P9N B;  1YJW N;  4BC3 A;  4XH4 A;  2YJE A;  4WFB L;  3CPW M;  3EE8 A;  2KKZ A;  1MK7 B;  1NGD A;  3OHR A;  4LC9 B;  3VEN A;  4B1W B;  3HOS A;  3I33 A;  3MN5 A;  3CCM N;  5AFU A;  2F9T A;  4JKE A;  2NRV A;  3O1B A;  5JLH A;  4GXB A;  3PIP L;  3CCR N;  4TKN A;  1ILY A;  5E26 A;  3CCE N;  3GE1 A;  1CZA N;  2R82 A;  4FPA A;  3U8Z A;  4U67 L;  5AZJ A;  4WQ4 A;  3A0I X;  4HDO A;  3CJ7 A;  3IVF A;  3I56 N;  4H5V A;  1K9M O;  3WEE A;  2E8A A;  3ID8 A;  3M6G A;  5M1O A;  3CCS N;  4DB3 A;  5C2F A;  3CC2 N;  4K42 A;  2I7N A;  4JKC A;  1X3M A;  3VTH A;  4FSV A;  5JVG L;  4AM6 A;  4BRH A;  5KPT A;  4Y0W A;  2AL6 A;  4B1X B;  2J4R A;  5AQT A;  4BVO A;  4ISF A;  4BC4 A;  4CD3 A;  3VEZ A;  4FL9 A;  4MO5 A;  2OTJ N;  1ZXO A;  4YOU A;  2FSN A;  1H1V A;  2CQU A;  3VMF B;  2JWK A;  4JD2 B;  3WA0 A;  5BRF A;  4JKG A;  1TUU A;  5TKW A;  4YDU A;  3A5L C;  3E1Y A;  5BPL A;  2AEH A;  2NZT A;  4GNI A;  4H0O A;  3O9Q A;  3MCP A;  3EN9 A;  4CZH A;  5AQL A;  3BF3 A;  2H3G X;  4ZRJ A;  3ZYY X;  3IMX A;  3BP8 A;  2UYT A;  4JKD A;  1XQS C;  4FOI A;  3VGL A;  3WUH A;  4U7B A;  2D1K A;  2IIR A;  3UKU A;  4A2A A;  1P90 A;  3CJA A;  4B9Q A;  1YVN A;  3C6A A;  5AQM A;  4B1Y B;  3FZH A;  3P4I A;  2E88 A;  3CIP A;  4CI6 A;  4BRL A;  3CF5 L;  4BRK A;  2Q1N A;  4FWQ A;  3LDQ A;  4QS9 A;  2YX6 A;  5BRH A;  1G99 A;  1MWM A;  2EWS A;  4O5F A;  1GLL O;  3EPY A;  3VPZ A;  3VTI A;  1ATS A;  2CGK A;  2FF3 B;  2P9K B;  4YOX A;  1NGG A;  3H1V X;  5BRD A;  1Q86 O;  3EKU A;  2QWP A;  1W97 L;  2AP1 A;  3VF6 A;  3WXJ A;  2E2Q A;  3FZK A;  4WF9 L;  3MN7 A;  3W0L A;  5HL7 L;  4R79 A;  1KAY A;  2CGJ A;  5EOY A;  2F9W A;  2KHO A;  1H4R A;  2FSK A;  4WQ4 C;  3UE5 A;  1YI2 N;  4HDQ A;  4CZF A;  2FSJ A;  1VQ6 N;  3U7D A;  3C7N A;  2GWK A;  3FLC O;  3T69 A;  4GVE A;  5C15 A;  4A59 A;  3DLL L;  3VEO A;  3GOI A;  4C1N I;  2RQ1 A;  1YXQ A;  2VWB A;  3TTC A;  4BRP A;  4B1V A;  4C1N K;  2ZJQ L;  3EKS A;  3ZX2 A;  4GV6 A;  1U2V B;  2ZGZ A;  4YL8 A;  4M7Y A;  2YHX A;  3MN6 A;  1JDE A;  4H0X B;  3D2E A;  4JAX A;  4WCE L;  4JK9 A;  5F1X A;  3SAH A;  2J0M A;  3BIN A;  5FPD A;  2NRR A;  4XH1 A;  3ULE A;  2I7P A;  2Q2R A;  3CCJ N;  1VQ5 N;  5AQZ A;  2GX9 A;  1E5W A;  3OBY A;  3AY9 A;  3DJC A;  1JJ2 M;  3L4Q A;  2A6A A;  2P9L A;  3CJ9 A;  1EO1 A;  3EL2 A;  4PKH A;  2YI1 A;  3H3O B;  4XH5 A;  4YDU C;  2QI2 A;  2RHK A;  1BA0 A;  4CBW A;  2V7Y A;  5AR0 A;  3CPE A;  5TKY A;  4BRN A;  3A8Y A;  2VCP A;  4FOE A;  4CZI A;  3O6W A;  1EF1 A;  2P9I A;  4CJ7 A;  4BY9 C;  4NY0 A;  1GLB G;  1HLU A;  1RGI A;  3KWI A;  3U9D A;  4K43 A;  5GAE P;  3VEV A;  3DXM A;  3OW2 M;  3CD6 N;  2ZJP L;  3O9U A;  4KBO A;  1V4T A;  4CD1 A;  3WQU A;  3CQX A;  1VQK N;  1JCE A;  1U6Z A;  4QS7 A;  5EX5 A;  3CI5 A;  4YOV A;  2HE7 A;  5EY4 A;  2QW9 A;  2PBD A;  4GY2 B;  3VGK A;  5AQK A;  1NI2 A;  1NGI A;  5AQJ A;  3D7E O;  1TUY A;  3P31 A;  3MCA B;  2AA4 A;  2GUP A;  5F0X A;  4JKA A;  3IFR A;  3L4I A;  3C65 A;  2FF6 A;  3C0B A;  2E2P A;  1BG3 A;  1QHA A;  4G9Z A;  3CJ1 A;  1Z6R A;  4EIA A;  3LDL A;  5CR4 A;  2EMT A;  2J0K A;  4BR9 A;  1HKB A;  5B8H A;  3ZET A;  1YHQ N;  3S41 A;  3RSE A;  2A5X A;  5KPR A;  3HM8 A;  1KXP A;  3CCU N;  3EO3 A;  3H46 O;  5BPM A;  1LOT B;  3JS6 A;  4BGA A;  4CBX A;  1TYQ A;  4BRE A;  4CBU A;  4EHU A;  1GLJ O;  2WBN A;  4K41 A;  4O8U A;  1P8Z A;  4BR0 A;  3W3D A;  4FO0 A;  5IJM A;  4IOA L;  1QQN A;  4JKH A;  3HTV A;  2NNW A;  2W41 A;  3FZM A;  4I6M A;  3CET A;  4WQ5 C;  5ADX A;  3LM2 A;  2QXL A;  4JN4 A;  5ELZ A;  5M1N A;  2GEM A;  1NM1 A;  2WH5 A;  3FZL A;  4A2B A;  3LL3 A;  1HJO A;  2GEL A;  5C12 A;  3ZEU B;  2QWM A;  3SMS A;  3SBG A;  5CE3 A;  3CJB A;  3MX5 A;  1DGK N;  5AQU A;  3VOV A;  2HF3 A;  5GIN A;  3F2K A;  4NO7 A;  4BR4 A;  4RWT A;  2E2O A;  2IVP A;  3WXL A;  1MIX A;  3VER A;  3AGK A;  4FWO A;  3TTF A;  1ISN A;  1HB8 A;  3VEX A;  3WXK A;  3SJH A;  4BR7 A;  2IVN A;  2QM1 A;  4ILJ A;  4EKU A;  3D2F B;  4CZG A;  3DXK B;  3OA9 A;  4K25 A;  3PIO L;  2HRJ A;  3PZD A;  3H45 C;  2COP A;  3G9W A;  3VES A;  4BRM A;  2QWR A;  4EHT A;  4FVU A;  5AZI A;  3FP5 A;  1YUW A;  2P9U B;  2PAV A;  3M3Z A;  3BUZ B;  4RCH A;  1Y19 B;  2ABD A;  3PVL A;  4RTF D;  4WFA L;  4IDH A;  2HBJ A;  2YHY A;  4ISG A;  2I1J A;  1M90 O;  2V51 B;  5FPM A;  4IFE A;  4YOY A;  2CH6 A;  3MMV A;  3KVG A;  2HF4 A;  3ENB A;  1KAZ A;  3GL1 A;  3U8X A;  3KZB A;  2V52 B;  2VGM A;  1NJI O;  2DPN A;  3KK7 A;  4BRG A;  3QBW A;  3IKM A;  4EFH A;  3CHW A;  4JHD B;  4DKW A;  3CC7 N;  3NMU A;  1K8K A;  2P9P A;  3UKR B;  2QEX N;  3UB5 A;  2NRW A;  1Q81 O;  3HZ6 A;  2WC9 A;  2YJF A;  2BH1 A;  1GG3 A;  2P9S A;  4BG9 A;  3QBX A;  4E1J A;  5AQF A;  4IEI A;  4A61 A;  2ZJR L;  2KLA A;  5LJV A;  2X0S A;  1E4F T;  3G25 A;  3ENH A;  3Q7B A;  4ZRI A;  2NLX A;  3CER A;  4FWP A;  2W40 A;  3C6H A;  3ZX0 A;  1J6Z A;  2F7T A;  4PKG A;  1ST7 A;  2ZPY A;  1X3N A;  3O5B A;  4CZL A;  1W2B M;  2P9N A;  2WUS A;  3TSQ A;  4UY8 O;  4JK8 A;  4H5N A;  3CXC M;  4DQ8 A;  1NGJ A;  4A5A A;  1DIK A;  3WQT A;  5MLC Q;  4IO9 L;  4FWS A;  4O8K A;  3CJC A;  1K73 O;  5AQV A;  3LDN A;  5AZJ B;  3ATU A;  3ID6 A;  4IWV A;  5AQS A;  1N8R O;  5DM7 L;  4JKB A;  3HSC A;  3GBT A;  4MDA A;  5AQX A;  1T3V A;  1NVL A;  2QWL A;  1GGO A;  3A5N C;  3WT0 A;  1VQ8 N;  1IJJ A;  4YOR A;  3WEE B;  3TPQ A;  4M63 C;  3CC4 N;  3CME N;  4CYE A;  3CCV N;  1YF5 L;  3QIC A;  1HX1 A;  3TTD A;  1O13 A;  4PKI A;  1NWK A;  4JKF A;  5GIP A;  3SAF A;  1T6D A;  2FXU A;  3ZDT A;  2ZF5 O;  4H0Y B;  3T7Z A;  1KQS M;  3QML A;  3R6M A;  4KH6 A;  4BQZ A;  3A5O C;  5AQQ A;  5JVH L;  4BRO A;  3AU5 A;  1MDU B;  1KC8 O;  1MA9 B;  2E20 A;  5GIO A;  4M7X A;  3A5M C;  4IJN A;  5KPZ A;  1VBH A;  3LDP A;  1QZ6 A;  4JKG B;  3J7Z O;  2D2Q A;  4JD2 A;  1KBL A;  5JMV A;  4CZJ A;  1ZC6 A;  2BUP A;  3FFK B;  5KQD A;  1D4X A;  5AFU H;  3H3N O;  3O1W A;  4DCH A;  3DWL A;  3JXU A;  3F9M A;  3Q7C A;  4FWR A;  5AQW A;  3HI0 A;  4A5B A;  5GAD P;  3G4S N;  3UKU B;  4BGB A;  2QA4 N;  4WYB A;  2E1Y A;  3AGR A;  1OKJ A;  2IVO A;  4BVP A;  3PLA A;  1VBG A;  1RDW X;  1NGH A;  5M1K A;  3AAR A;  3R8E A;  4ILH A;  3MK6 A;  2OTL N;  3R3L A;  1DT9 A;  3NVK A;  5LJW A;  3FR0 A;  4PL8 A;  1VQN N;  1C0G A;  2LBB A;  4MLH A;  2D10 A;  4IZ9 A;  5JLF A;  3VET A;  1HPM A;  1V4S A;  4NLB A;  2P9K A;  3VEY A;  4PHT X;  2D0P A;  3D6R A;  3NVM A;  2CB8 A;  1NBW A;  3O9S A;  3VEW A;  4ILG B;  1EQY A;  3O9R A;  4EAH D;  1S22 A;  5CHI A;  4Z94 A;  1MWK A;  5AQH A;  2HBM A;  3AU4 A;  3C7N B;  3O8M A;  1BA1 A;  1VAZ A;  1R59 O;  5AQN A;  5AQG A;  5LY3 A;  1YJN N;  4F9O A;  2Q36 A;  3E9L A;  5AQP A;  3ZX3 A;  1SQK A;  2YCH A;  4YOT A;  4DHY A;  2FLO A;  1Z05 A;  3QFU A;  4ISE A;  4NLC A;  4BRQ A;  1ACA A;  4H0V B;  4BRF A;  3I55 N;  3D2E B;  2E2N A;  2ASO A;  2ZGY A;  2ZWH A;  3MWT A;  2Q0U A;  4AM7 A;  4BC5 A;  3KWG A;  3ULE B;  1U2V A;  4BG8 A;  1OVY A;  1RDU A;  1QQO A;  4OPA A;  1XC3 A;  1ATN A;  3VF2 A;  2GTD A;  1BU6 O;  4XEI A;  5FPN A;  2HBL A;  1WOQ A;  3HBT A;  2P9L B;  2YHW A;  3MN9 A;  1SS6 A;  1DEJ A;  4MDB A;  4JEP A;  2A42 A;  5BPN A;  4WFN L;  4BQL A;  3E66 A;  2YVC A;  1ESV A;  1QZ5 A;  3CMA N;  3SLC A;  2QTD A;  1KC7 A;  3R1X A;  1JCF A;  1S3X A;  1T6C A;  1X9J A;  2P9I B;  2HST A;  2A40 A;  1J19 A;  2HOE A;  2CGL A;  5KQ8 A;  1JCG A;  4L3Q A;  3DXM B;  3P39 A;  3VF4 A;  3CQY A;  5FPE A;  4IJA A;  4QS8 A;  3G71 N;  4BRA A;  5GAG P;  1ATR A;  3MDQ A;  5AQY A;  3L6Q A;  4BR5 A;  3O4W A;  1WUA A;  1RFQ A;  2QWQ A;  5EVZ A;  1C0F A;  1GLC G;  4HWI A;  3OBW A;  1BO5 O;  1VQP N;  3QDK A;  3IUC A;  2WFB A;  3TSP A;  2QWN A;  1GLF O;  2ASP A;  5C10 A;  2EMS A;  3FE1 A;  3E9O A;  5M1P A;  4H03 B;  4FWL A;  1NLV A;  2ASM A;  2V7Z A;  2Q97 A;  4BRD A;  5BN8 A;  1SGH A;  5HOO A;  3M1F A;  2PFU A;  3SK3 A;  3G6E N;  3P38 A;  3K9J A;  4PL7 A;  2BTF A;  2VYP A;  4AF1 A;  5BR9 A;  3ZET B;  1QQM A;  1BUP A;  3QFP A;  1HKC A;  3RSE B;  1BOT O;  1KD1 O;  1VQO N;  3WXM B;  3J8A A;  4FWK A;  2I1K A;  3X23 A;  1TYQ B;  2D4W A;  3FZF A;  1GC7 A;  3QB0 A;  4IOX A;  4P7I A;  3BEX A;  3O08 A;  5H1S Q;  2OAN A;  4FPB A;  4B1U B;  4I6M B;  2NRZ A;  3CCL N;  4A62 A;  2Q31 A;  1NTI A;  5DM6 L;  4JK7 A;  1IG8 A;  1YIJ N;  2HBK A;  1QVF M;  1LCU A;  1Q18 A;  2FJ9 A;  1BDG A;  5BN9 A;  2CH5 A;  4JNE A;  5C2D A;  4IOC L;  4MO4 A;  3VGM A;  4BRI A;  5M1Q A;  1M1K O;  2NRT A;  2NRX A;  3HRG A;  5C0Y A;  4C23 A;  1HUX A;  1YJ9 N;  2D0O A;  5I9E B;  2Q0R A;  3I8B A;  2E1Z A;  3ZEU A;  4B1Z A;  1VQ7 N;  3E9P A;  5E84 A;  4CZK A;  5BRE A;  4CZE A;  5GAH P;  4A57 A;  1HBK A;  4BR2 A;  2D11 A;  1Q82 O;  1YAG A;  3AAQ A;  1HB6 A;  1MK9 B;  3K9K A;  3LDO A;  2HMP A;  5JVL A;  4KH4 A;  1GC6 A;  3M5R A;  1NGA A;  3RVC A;  1GLD G;  1NGF A;  4FWN A;  4HTL A;  5JIC A;  3CCQ N;  2NRH A;  4GV3 A;  1KAX A;  2RE2 A;  3LM9 A;  3IDH A;  1NGC A;  2A41 A;  1DKG D;  3DAW A;  4H5R A;  4MLE A;  5AQO A;  1E4G T;  3U9Z A;  3D2F A;  4WQ5 A;  3EZW A;  3DXK A;  5AZI B;  2ITM A;  1XUP O;  4H0P A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...