4JK8A

Open and closed forms of r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk8A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk8A01
4ILJA 4JKGB 4JKCA 3SBTA 3E9PA 4JK9A 3E9LA 3E66A 4JK7A 3E9OA 3SBGA 4JKEA 4JKGA 3ENBA 4JKHA 4ILGB 4ILHA 4JK8A 4JKAA 4JKDA 4JKBA 4JKFA
chains in the Genus database with same CATH superfamily
3CQXA 4CFDA 3GDQA 4R5PA 1QZ5A 1ESVA 1T3VA 2VG5A 1BA1A 3LP2A 3EE8A 3OJSA 5BRDA 1I39A 1GGOA 2OTLN 5BR8K 3O3GA 3T3FA 2AL6A 3MX5A 4N56A 1IH7A 3QEVA 3D2FA 4HCBA 3HOTA 1KLMA 1RT4A 1BCMA 5AQPA 4CHZA 4PWDA 1EO1A 1V4TA 3VTIA 4CF0A 4GV3A 3M8SA 4M3WA 1TYQB 2HHTA 4PL7A 4X62K 4KBOA 3ZYYX 1X1PA 1S9EA 4FXDA 3CCLN 1NI2A 4H0OA 3CCQN 4DFKA 1T6DA 4DCHA 2R82A 1TK5A 1TK0A 1ISNA 1M1KO 2WONA 3LANA 3U9DA 1VQ7N 3NFAA 4ELTA 3VERA 3E01A 4PY5A 3J7YP 3AVBA 4BR4A 5EX5A 3T69A 5JICA 2FSJA 2F96A 3JYTA 3BUZB 1HBKA 1A5WA 1IBKK 1IBMK 3ATVA 2EHGA 2NZTA 1GC6A 3ZETA 4BY9C 2NRHA 4CFAA 4I6MA 1VSLA 4BRPA 3SI6A 3LM9A 1ACAA 3TSUA 1QZ6A 4LSNA 1H1VA 4JKFA 1KTQA 2NRVA 4JHDA 4DTJA 5KRSA 2VQEK 1GLBG 5DMRA 3OW2M 3EZ5A 3NDKA 3DLGA 1E5WA 3SQ0A 4BGAA 1XC9A 4M41A 2FF3B 3B8AX 1Q7YO 2KQ2A 4OJRA 4DG1A 1B92A 3TARA 1JKHA 1HB8A 4DTPA 1A5XA 1O13A 3DOLA 3O4NA 4KV8A 4RW8A 5CR4A 4LH5A 4DQSA 3V1RA 1BO5O 4PKGA 1W0HA 1JCGA 3AU4A 3HO1A 2QA4N 4RW4A 4W5RA 1GOAA 4BC3A 3LDSA 3CPEA 3AU5A 3SUQA 4WFNL 4O44A 4LH4A 3SUPA 4WYBA 4E1NA 4DTRA 3AA2A 1VSHA 2FJ9A 2HF3A 2O4GA 4BR0A 1BI4B 3QICA 3VQCA 3BDPA 4PUOA 3DI6A 3V9ZA 1DTQA 4EIAA 2ZE2A 5GINA 3AV9A 3MN7A 5C24A 3I0SA 4X65K 1WN7A 3SJHA 4I9QA 1HKCA 1Q18A 4OPJA 1U4BA 2FC0A 1NM1A 4JI8K 4CJTA 1EWQA 1IKVA 3ZSYA 1I94K 4DR1K 3AGRA 4KI4A 3H46O 1ZBLA 4JI5K 1VQ6N 2E2OA 1BIZA 1IO2A 4H0YB 3HK2A 3KKRA 4AHRA 4F2RA 1YAGA 1GLAG 3EN9A 3HM9A 1TKDA 1WBBA 4CGDA 3RR8A 4EZ6A 3EYZA 4GXBA 3EEQA 3PO4A 4DF4A 1ASUA 3SMSA 2I1KA 1VBHA 3U3YA 2R7YA 1KAXA 3W3DA 4FJ7A 4DTSA 5CE3A 1ZBHA 1TL1A 3DLKA 1GG3A 3AO5A 1NKCA 3UKUB 2KZMA 4JI1K 1NBWA 1HKGA 3CCUN 2OZSA 4B9LA 1RBRA 4OLAA 1SKSA 1T6CA 5EOYA 4AHVA 4OKJA 2YCHA 1NOYA 1GLCG 1S1TA 3V9SA 4NY0A 2P51A 1JCEA 3OYNA 1RTJA 2G8IA 3VQAA 3MXIA 5JVHL 3D45A 5FDLA 4M3TA 5LY3A 1FXXA 4W5OA 3KLGA 4H4MA 5HROA 4ISFA 4KHSA 1XNRK 1VQPN 3E66A 4DS4A 1NGGA 5GIPA 3OYAA 4CJ3A 2E6LA 3SZ2A 5AQZA 5C2DA 2F9TA 3VOVA 4YOWA 4YL8A 1KAZA 4JKDA 3BF1A 1QHAA 3ULDA 3KKSA 3SQ1A 3HJFA 4CK3A 2KFNA 5SWMA 3V6DA 1T8EA 3OBYA 4FK0A 2NRZA 1YJWN 2NRXA 4CF8A 4DTOA 5EU7A 3OHRA 4CZLA 1BISA 3TR8A 1QE1A 4JEPA 4DR5K 2H3GX 2HBMA 1RBVA 2FSNA 2HHHK 4H5WA 4BR9A 1RT3A 1NK8A 2AEHA 3S41A 2VG7A 3LALA 1JL1A 2WUSA 5ADXA 4CZMA 4J2EA 2IIRA 4DV5K 5EVZA 3WQTA 3G71N 2ZJPL 3O80A 2AA4A 4JK9A 3I0RA 3FZLA 1KFSA 3A5NC 4HWIA 4WQ4A 3MN6A 2HBLA 3CM5A 4IDKA 1SAZA 4CECA 1YTAA 4FW2A 1QTMA 3HSCA 3MCPA 3V9XA 1QQOA 4RW9A 3TAPA 5M1PA 4JKBA 1HPZA 3RMBA 1X9JA 5C12A 3RMDA 4BROA 3SQ2A 4KH4A 3A2FA 1EETA 3C65A 3V1OA 3ZT0A 3CFRA 5AQTA 4JS5A 4FVUA 3VQ6A 4WQ4C 3TABA 3H45C 2HVHA 1MWKA 4DTXA 4IBNA 4KFBA 2QWOA 5AQJA 4JI3K 1IKXA 2J0MA 1S5JA 1GLEG 5HRNA 3PSFA 4CEQA 5M1NA 4IWVA 4CE9A 3A5OC 3AA3A 3NF7A 3VQ4A 3RMAA 3SPZA 4M3RA 4EHTA 1J54A 4ISGA 3ISNC 1WLJA 4PL8A 4CGHA 2PFUA 4ZTJA 1NGIA 3SAHA 3KLFA 1LW2A 3U8XA 1MA9B 4LFBK 1NJZA 5KGWA 4K8ZA 3DLEA 3NCIA 1YIJN 3C94A 4DF8A 2OPPA 3BINA 1N34K 5AQVA 2JWLA 3WXKA 1F21A 2CH6A 2Q97A 4B8CA 3ZSVA 1RTHA 1TAQA 3BZKA 3IG1A 5HRRA 1RTIA 4A59A 3L2WA 1N36K 4CW7B 3L2UA 3DXKB 1TGOA 2D5RA 3THWA 2W6KA 3V1QA 4ZRIA 2D11A 3L6QA 3O9QA 4KKOA 3VEXA 3PVLA 2BE2A 3D6RA 5M1FA 2VCPA 1MK7B 4JI6K 4N41A 3L3UA 4B08A 1W7AA 3QBWA 5GAHP 3DXMA 1IG9A 4F3TA 3FZHA 4FPAA 2P9PA 3NF6A 3VA0A 2FF6A 3DWLA 5TKYA 4BRFA 4O5BA 1C1AA 3OYFA 1TV6A 1GC7A 2IVNA 4OPAA 4B1XB 4FLWA 2O8BB 1J9AA 2W41A 3AVKA 1B9FA 2HNZA 4BRLA 3NGZA 2YKMA 4DV4K 1HYVA 3M3ZA 3VENA 1EWRA 3LDOA 4BE2A 3H3OB 4H0PA 2WBNA 3LPTA 1ZYQA 2QTDA 1SKRA 2Q0UA 5CZ1A 3ID8A 3L8BA 3OYGA 4RWTA 3G25A 2FBVA 5AQQA 2RN2A 3DLLL 3RRGA 1NGDA 2QI2A 3IFRA 3F9MA 3GL1A 1LW0A 5C42A 3O8MA 2IGIA 3CC2N 3BF3A 1NG9A 4CZFA 3QLHA 4ID5A 2YHAA 4JNEA 1NJIO 4JD2A 1TL3A 3QFUA 1GLFO 3LDNA 4AH9A 4M3YA 3K57A 2GEMA 4M42A 1NVLA 3WNEA 1SL1A 3VN5A 3S3MA 4DTMA 1HPMA 2YX6A 5GAEP 3P31A 4GVEA 2YNGA 1Z05A 3CJCA 1NGFA 4F9OA 2YNIA 4ILHA 3ZDTA 3MEGA 2UUCK 4JKAA 4JI7K 3AO3A 3HOSA 3DRPA 2PY5A 3TAMA 1XHZA 4JKCA 3WNGA 3KWIA 3T1HK 4Q5VA 4NCAA 4DV2K 3HP9A 1MWMA 4W5TA 2RPIA 3J8AA 3KHYA 2UUAK 2HRJA 2YI1A 1J6ZA 1KAYA 4IDHA 1RDAA 1U47A 2KW4A 1HQUA 2P9SA 4CD1A 4NLCA 4DUZK 4W5NA 4YFUA 1XMOK 4E7KA 1K73O 4OVLA 1VSJA 3LAKA 1OH5A 2YHXA 3S3OA 1X9SA 1LWCA 4PKHA 4H4OA 5E26A 3O9RA 1VQMN 3O08A 4B8AB 3R3LA 4B3RK 3H6EA 1S6QA 2VWKA 2X6SA 1S9GA 4CGGA 1XC3A 1WB9A 1CZAN 1XI1A 1VAZA 2HHQA 4KHYA 4HTUA 1NGHA 2O8BA 1NJWA 1Q82O 4BRQA 1ZBFA 3CF5L 3SQ4A 1K8AO 4QS8A 3HPGA 2QEXN 2X74A 3P4IA 4FZZA 1X9WA 4A5AA 2PYLA 4Z4FA 4DU1A 2P9LA 3CI5A 3VEYA 2CH5A 2VQFK 4B3MK 4AHCA 3OTOK 4B1ZA 3MAQA 2FXUA 3PZDA 4C23A 3VQ9A 3LDLA 3QIJA 2B4JA 3VETA 4JKHA 4KREA 2FDQA 4FJJA 3M5RA 1DIKA 5LL6Z 2ASMA 3MN5A 4NYFA 5KPTA 1T05A 3ZETB 4FWKA 1W9HA 5HLFA 4KH6A 4I6MB 2X6NA 3LPUA 1BQNA 4GV6A 4FZYA 3GOIA 4WFAL 3FR0A 2RKIA 4AHSA 4JHDB 3QFPA 4BG9A 2DIKA 3KK7A 2QWMA 4C8KA 5J2MA 4Y1DA 4WE1A 4J2DA 2E2NA 4BQZA 4B3OA 4KHWA 2O8EA 1TK8A 1SL2A 3R8EA 1J5OA 3J7AP 1BGXT 2A6AA 5AFUA 1C0MA 1NKEA 1QSLA 3C6AA 3C0BA 2YJFA 3OS0A 4CHNA 4FSVA 3I33A 3E1YA 3OYIA 1EF1A 1NNEA 3KD5E 3VEWA 4CEZA 3EL2A 1VRTA 1NK7A 3NF9A 1T7PA 2QK9A 5KPZA 1YVUA 2I5JA 4KI6A 3NH1A 3ZSWA 4M63C 4JYAK 1IG8A 3U3GA 4WFBL 5T7BA 4O4GA 4GMJB 3HL8A 5H1SQ 4M3XA 1YJNN 1KVCA 5AZJB 3KK2A 4OGCA 4YY3K 4H0TB 1DKGD 4IEEA 3DLBA 1M90O 2RE2A 4IFEA 1C6VA 2HHVA 3JAMO 3I55N 3CC4N 4HUFA 1GOBA 2Y1JA 5A2QO 3WEEB 5AQFA 2E6MA 4CZGA 4CEDA 3HYFA 4Z4IA 4BE0A 4BVOA 4XEIA 3OBWA 4F8RA 4LF8K 1SS6A 4DV7K 3FFKB 1KVBA 2Q0RA 1LAWA 4M45A 2GELA 3LAMA 2E20A 4CGFA 3ZX2A 3O1BA 3CCSN 3LL3A 3KLHA 1IKYA 3TAGA 3SCXA 4M7XA 5IWAK 3ENOA 2PBDA 1Z26A 3CCVN 4GV9A 4FJNA 4C1NI 4H5TA 3V81A 5C10A 3G9WA 3C7NA 3MEDA 3BY5A 3SV3A 2G8UA 2Z1GA 3PX4A 1U49A 4IKFA 3R9PA 1RNHA 3QEXA 2W40A 5C2FA 5BN9A 1RGIA 5GAGP 3UIQA 1RDUA 2DFFA 2YKNA 2UXDK 1GLJO 3BP8A 3QERA 4ZRJA 4H03B 3O5BA 4IFVA 1WSJA 1RBSA 1N5YA 2XY7A 4YDUA 3BGRA 3AVMA 1JXEA 4C8LA 4ELVA 2O8CA 4CEAA 1WAFA 1BA0A 4PA1A 4BRKA 5JLHA 4DHYA 4CHQA 3F9KA 1B9DA 2QXFA 1YVNA 4C1NK 4QAGA 1T03A 3FZFA 1L3VA 2G8FA 4DQRA 5LMUK 1Y97A 4GY2B 5KQ8A 1WSIA 4GKKK 4LF7K 1VQLN 3KWGA 1L3SA 4KB1A 4DQ8A 3ASMA 4MQ3A 3THXA 4XIUA 1KSPA 3UB5A 4JK8A 1IBLK 1Z6RA 1Z25A 3SUNA 3NH0A 1QVFM 5AZJA 1HMVA 3VQBA 4EZ9A 4K41A 2YJEA 2I1JA 1S6PA 4ZRKA 2Q1NA 2D0BA 3AA5X 4QS9A 5BPNA 2J0JA 3T7ZA 4L8RB 4FLYA 1JCFA 5JS2A 3WEEA 4Z94A 2OZMA 3DRRA 4JRQA 3ENBA 1HNZK 3U6FA 1NGCA 1VSEA 2ASPA 1L5UA 1JLEA 3TWHA 1RDCA 2DY4A 3AVIA 4W5QA 3Q7BA 3M8RA 3PUFA 1EXQA 4DV1K 3H1QA 1VQ5N 1IKWA 3G10A 4IG0A 2GV9A 4YHHK 4E3SA 3RTVA 3K0SA 2O8FA 1YUWA 2B5JA 3HXMA 3QEIA 1HNXK 2Z1IA 3ZT1A 2OPSA 3ZSRA 5AQYA 4BACA 2OPQA 4LC9B 1VQ4N 1U2VA 1O1WA 3K9JA 1VQ9N 4E7HA 4H5NA 2OYQA 3B6OA 1CXQA 4CBUA 3K2PA 2OPRA 3C95A 4DFJA 2COPA 1LOTB 5AQKA 3HPHA 5IT9O 4A57A 3DOKA 3DYAA 5AQNA 2HNDA 4F3OA 1HQEA 3A5LC 4PQUA 4K8XA 1ZXOA 1KC7A 3DLRA 1VSKA 4X64K 3L4QA 3O6WA 5B8HA 4FW1A 1S22A 3VF4A 2XO7A 2D0AA 3AO2A 3G6EN 3AGKA 4FPBA 2QWQA 3QNNA 1C0FA 3DJCA 3NF8A 5KPRA 4K43A 1BUPA 3SBTA 1XWLA 3THWB 3VMFB 2UXCK 3MMVA 3CJ9A 4L3QA 2HW3A 4OGEA 1HJRA 3HI0A 4NXMK 2A42A 5FPNA 4H8KA 3DXMB 4M7YA 4H5VA 1YI2N 4BREA 1HRHA 3VGKA 3H08A 2UU9K 3CCEN 5J2PA 2P9PB 3MWPA 5FPEA 1JLCA 4FJ5A 2ZWHA 1MU2A 3I56N 1VQON 1SV5A 1IV0A 1A5VA 2ZQBA 5FLXO 3CYMA 5BN8A 2VYPA 1Y19B 1RDDA 1V4SA 3AVHA 2A1SA 3PX6A 1X3NA 4CZEA 5AQHA 4IFYA 2YVCA 4AF1A 1CZ9A 5C25A 1ATRA 4FM2A 3AARA 1ZBUA 1E4FT 1EP4A 3LP3A 3KLEA 3HTVA 3U4LA 2P9NA 5I9EB 4YOVA 5GIOA 3V9WA 2D4WA 4FJXA 3CPWM 1MIZB 4CF2A 5KGXA 3B6PA 4FJLA 4AQYK 4HUGA 2QWRA 4JD2B 1NK6A 4CYEA 2WFBA 3L2QA 4B9VA 5JVGL 4RTFD 3OA9A 3TAEA 2E1YA 3VQEA 1RDBA 3IAYA 1Q9XA 3VQPA 2EX3A 3N4PA 3NE6A 4YOYA 3M8QA 1KLNA 2GX9A 3F2KA 1VQ8N 1CLQA 2XY6A 4WCEL 3TTCA 5ADXH 2HNYA 2A5XA 4C8NA 5LJWA 4DSKA 2RHKA 3C6TA 4CJ7A 4GVMA 3P83D 4DTNA 4A5BA 4CJ4A 4BR5A 4KHPK 3NVMA 4WQ5A 2ZF5O 3O4QA 1XMQK 4B9MA 5KI6A 1Y64A 5KQDA 2P9SB 2HOEA 3RWUA 3HPOA 4AILC 3U9ZA 4O0JA 4DFPA 4FK4A 4XH4A 4ZTFA 3PX0A 1HNWK 5I42A 4RW7A 2HF4A 2QW9A 3R6MA 4LF5K 3QIPA 3OYLA 4WQ5C 1EX4A 4NB4A 3OS1A 1KFDA 5FPMA 1S1XA 1ITGA 5CZ2A 3K58A 1JL2A 1UWBA 4P7IA 3AVFA 4CJPA 2DFEA 3G4SN 1JLAA 4K42A 5SZTA 4BRIA 1QSSA 1BU6O 3DRSA 1D9DA 2FBXA 4DMNA 4CESA 4CEFA 2XHBA 3IKMA 4U7BA 3BZCA 1FKOA 4CFCA 3OYMA 3LZJA 2HBKA 2E2QA 5AQLA 2Q36A 4DWIA 1YF5L 2P9LB 1RT7A 2RF2A 4OO1J 3SAGA 3CM6A 4CBXA 4DR4K 4EAHD 5ELZA 1CXUA 4E0DA 4B1VA 2JWKA 2G8KA 3WXLA 1SGHA 3VEZA 1S1WA 3O9SA 1JXBA 3AA4A 2E88A 3RR7A 3L4IA 4G1QA 3X23A 4CJVA 2ETJA 3LDPA 5TKWA 4CF1A 1T44A 4FWOA 3FLVA 1LV5A 1D9FA 4ILGB 2WOMA 1YITN 1WSFA 4FO0A 4B3SK 4MLEA 4FJMA 4CJEA 4J8FA 3CC7N 3SLCA 4LY7A 5C15A 1BOTO 2F8TA 4FVMA 3D7EO 3QEPA 3U8ZA 4H0XB 4LSLA 4DR2K 5AQWA 2O8EB 4B3TK 4FLZA 3TI0A 3CCJN 4BR7A 2UYTA 1WSGA 5J2NA 3BEXA 1W2BM 1MK9B 3DMJA 1DTTA 2JGUA 1VSFA 3AVNA 4HDQA 3ULEB 1U45A 3E9PA 2G8HA 4KRFA 3RSEB 4OX9K 2A40A 4DSLA 3ZEUB 3CFPA 4TKNA 4FLXA 2VG6A 3O4WA 4J2BA 1J19A 1KBLA 4JV5K 3EY1A 5EXWA 2QKBA 3PIPL 3QEWA 2IVOA 4EKUA 2FSKA 3LWMA 1ZC6A 3FP5A 4CI6A 2O8DA 4BE1A 1WNSA 2LBBA 2YHBA 2GWJA 1XNQK 5K14A 4BGBA 3VA3A 1ASVA 3VTHA 1QVGM 2KHOA 1VHXA 4FWQA 4CIFA 3EO3A 2V7ZA 4H5RA 1NK5A 3K59A 1NMDA 4LF9K 2Z1HA 1JLGA 3CHWA 1RILA 3CJBA 3FLCO 3D0PA 1NTIA 4HUEA 4BRHA 3VGLA 1KRPA 2X0SA 4IOCL 5AQRA 1HLUA 3N4QA 3KLIA 5BPLA 3TAFA 4ICLA 4CEEA 1JJ2M 2DFHA 4OPHA 3NMUA 3KD1E 4CBWA 2NRRA 1DEJA 3OJUA 2ATQA 1JLBA 1BQMA 1RDWX 2IOCA 1FW6A 1KD1O 1BWFO 4PHTX 1RBUA 5E41A 3NVKA 4DV3K 4O8KA 4CIEA 4BWJA 2IVPA 1E4GT 1BCOA 3TAQA 4DQPA 2F9WA 4H0VB 4OPKA 2WTUA 3D2EB 2XY8A 2E5LK 5GADP 1SUQA 1ASWA 3SAFA 4GKJK 4IOAL 4J2AA 1S72N 1LAVA 4R79A 3HT3A 1S1VA 3CG7A 3OYDA 3C7NB 1ATNA 4JK7A 5LJVA 3A0IX 4FZXC 5D3GA 1WOQA 3VQ8A 3QNOA 1VQKN 1HJOA 5DM6L 1DGKN 3O9TA 1RT5A 3AVGA 4RCHA 1TAUA 3AO4A 3SUOA 4QS7A 4FWNA 4B1YB 4Z4GA 2YHWA 1CZBA 5DM7L 3MX2A 1VBGA 4NCGA 4LD0A 4KPYA 3VQ7A 4HVJA 1WBDA 4LF6K 2O8CB 1ILYA 4YOUA 4CFBA 5BR9A 4DU3A 3ZX3A 1OKJA 1SL0A 3L2VA 4CZKA 3ULEA 4E7IA 2DTUA 5F2RA 1EKEA 3RSEA 4FK2A 3O9UA 2WH5A 3ITHA 3S9HA 3ZEUA 3K5LA 4MLHA 3J81O 4OKKA 1ATSA 2PAVA 3AAPA 3THXB 4F4KA 1TKXA 2KLAA 1KQSM 3VEOA 1X3MA 2DPNA 2HMPA 3LP0A 3PO5A 3ZLJA 5AQMA 3CJ7A 2P9IB 2ITGA 2Z1JA 5IJMA 1RBTA 4WF9L 3KTQA 5AR0A 3VPZA 3M6GA 5AZIA 3AO1A 1BHLA 4NXNK 3PLAA 1VK0A 1SZ2A 3F73A 4JI2K 5CHIA 1MDUB 3WXJA 4CERA 4IO8A 4FWLA 4CHOA 3I8BA 4YORA 2P5GA 2F8SA 3AVJA 3WXMB 3ZX0A 5AQUA 3SYZA 3MXJA 2QWPA 5AQXA 4A2BA 3THYB 3ATUA 1RT1A 4QOZB 4N47A 4IJNA 2V7YA 3R1XA 4GW6A 2AJQA 5AFUH 1WSEA 2O8FB 2P1JA 4EP4A 5FRNA 2GUIA 1U2VB 3QMLA 1VRUA 4BWMA 1GLDG 3KK3A 4FJIA 2GWKA 4HCCA 2I7PA 4RG8A 1WUAA 2HHXA 3D2EA 1NK9A 3KIOA 3EE9A 4I9LA 3VQQA 4CZIA 4DV6K 3IRXA 3P1GA 1N8RO 3EKSA 3NHGA 1N33K 3RVCA 1VSMA 1TVRA 2RQ1A 4IXCA 3OS2A 1YXQA 3VGMA 2HE7A 3SJJA 2ZGZA 3CMEN 3AY9A 3S3NA 4N5SA 3P5JA 4AHTA 2KTQA 4AM6A 1TUUA 3TPQA 2P9UA 1K8KA 4DLEA 1P90A 3ENHA 3G0ZA 1C0GA 3C6UA 3ZSOA 5JS1A 2F7TA 5MLCQ 4DKWA 1HUXA 4IZ9A 4JS4A 1NJYA 2E8AA 1HNIA 3K9KA 2UXBK 4IEIA 2EMTA 4B9TA 4X66K 4NCBA 3P39A 1Q9YA 4Z4HA 1I3AA 4UQGA 2VGMA 2BUPA 3O1WA 1N32K 2QWNA 1BDGA 5FRMA 4YDUC 2CQUA 2ZJQL 3A8YA 2KKZA 4BG8A 3MDQA 4FYDA 3L2RA 2P9IA 1IJJA 2D1KA 4I2QA 2IAJA 1OH6A 2P9NB 4CJUA 1HB6A 1HX1A 3HVTA 4ELUA 2Q31A 5BRFA 4B9UA 1NKBA 3OYCA 1W97L 2BGGA 4MO5A 4BRCA 1UA1A 4U67L 1R59O 4FWPA 5CY4A 3NBPA 4DSEA 5CYQA 3THYA 3KK1A 1BG3A 4FLUA 4YOTA 4BDPA 1NLVA 4FJKA 3K5OA 4DR3K 2G8WA 4JI0K 2B6AA 3T19A 4FJGA 1C1CA 2A3ZA 2CB8A 2FBTA 3O3FA 3PSIA 4HDOA 1TYQA 1K9MO 3L3VA 1D4XA 1G15A 3MEEA 1LCUA 4HTLA 3ZSXA 3MK6A 5C0YA 4CHYA 5KRTA 2KZZA 1BIUA 2V52B 2VGNA 3ZCMA 4ID1A 4DR7K 1SKWA 2A1RA 3IUCA 1D5AA 5BPMA 2ABDA 1NWKA 1DT9A 1LWFA 2QKKA 4FL9A 4MDAA 1FKPA 1JLQA 1VQNN 1YJ9N 1QQMA 4XH5A 2D0OA 3DLHA 4AM7A 4CJ5A 3PY8A 3LWLA 4DQQA 2AP1A 1H4RA 2IS3A 3WUHA 4V19S 3HVRA 3E9LA 3GE1A 1U04A 3EKUA 2OCEA 1GOCA 4EFHA 1K6YA 1QSYA 2G8VA 4FJ8A 2NNWA 3VQ5A 1L3TA 4IO9L 3MCAB 2W6LA 5E84A 2HBJA 2ZJRL 3MECA 3TTFA 4BC5A 5JLFA 4YOXA 3OYBA 5F0XA 4F7GA 4E7LA 1G99A 4B9NA 5AQOA 4KHUA 1C1BA 4CJKA 3QESA 1HKBA 5FROA 1QS4A 4CZJA 4O0IA 2O4IA 4B9SA 3M1FA 2E4LA 1NGAA 2BTFA 2CGJA 3IVFA 3MWTA 3CFOA 4Q0BA 2NLXA 1OH8A 4XH1A 2Y1IA 4CK1A 3P38A 1RT6A 3ID6A 1YT3A 5HOOA 4A2AA 4FJHA 3QO9A 2A41A 3V4IA 2QWLA 3M8PA 1MIXA 3NAEA 4NO7A 4A62A 3CMAN 1FK9A 1RCHA 4FM0A 1L3UA 4KH5A 3SPYA 4MDBA 4Y1CA 1BI4A 2D0CA 2D10A 4K25A 1U48A 4CEOA 4FWSA 3VEVA 1NGEA 3QIOA 4LF4K 1YHQN 3QBXA 3J80O 3MN9A 4DLGA 2F4VK 2VWJA 3OYHA 4CJQA 4IJAA 4BQLA 4DB3A 3KZBA 3SNNA 1J5EK 3C6HA 4BR2A 1QQNA 1Q86O 2BANA 4DQIA 4CJLA 4CK2A 3Q7CA 3TANA 3JXUA 3EZWA 5HRPA 3CCRN 3AVLA 2E1ZA 1LWEA 3W0LA 5I3UA 2XRIA 4DSIA 5EY4A 1QHTA 2PZSA 4BRNA 2FBYA 2OTJN 1SQKA 4B1WB 4E1JA 3VF2A 2VWBA 1S3XA 4KTWA 3UKUA 4A61A 3FZMA 5HP1A 1NMNA 5DK5A 2FLOA 4JI4K 2EMSA 4C8MA 2ZD1A 4Z4CA 3T1YK 3RMCA 3IDHA 3RRHA 5FPDA 4ISEA 3SBGA 2OANA 4MO4A 4KO0A 5LMNK 1QQCA 2ZPYA 4O8UA 4CGJA 2CGLA 2O8DB 1JDEA 5M1QA 4B9QA 3JSMA 1X9MA 3I8DA 1EQYA 4EHUA 2W42A 3IS9A 3OYEA 1HNVA 5BRHA 2HHUA 3CQ8A 4RW6A 1OVYA 4CEBA 2IC3A 2UUBK 2P5OA 3AVCA 1WSHA 4FM1A 4C8OA 4KAZA 4BC4A 4O55A 1KVAA 2QXLA 4DS5A 4CJSA 5HRSA 3WXIA 3WQUA 4MFBA 4DSFA 3CQYA 4N76A 3HBTA 3KJVA 3FFIA 3KVGA 2HHSA 1XHXA 1ZBIA 3HRGA 5F1XA 4DTUA 4TSXA 3CD6N 2PYJA 1NK0A 4CHPA 3UE5A 3E9OA 2GTDA 4FWRA 4OKEA 1TKZA 3CETA 4DU4A 1HR0K 1E3MA 4NYNA 2X78A 3ZSQA 1Q81O 3TSPA 4BC2A 4HHTA 1U6ZA 3NGYA 2ZM6K 3SV4A 4FLVA 4DSJA 4E7JA 5AQIA 3CXCM 4FOEA 4E89A 4ILJA 3T1AA 4CIGA 4CF9A 3QB0A 2NRWA 2GUPA 1P8ZA 3ZSZA 3FGUA 4O5FA 3DAWA 4LFAK 3LM2A 1TKTA 3SMPA 2E2PA 3HM8A 1HYZA 3OVNA 3ALYA 4JAXA 1OVQA 2I7NA 3ZT4A 1KC8O 2YV0X 2LSNA 2P9KB 3ZT3A 3ZT2A 1D8YA 2J0KA 1C0TA 1NOZA 3LZIA 3VQDA 2XY5A 1KXPA 4OLBA 4BVPA 2GBZA 2HB5A 1TUYA 4FWMA 4BRAA 1OH7A 4Y0WA 1GLLO 2WC9A 2D2QA 1KCFA 1NK4A 5HL7L 4BDZA 1HYSA 3WNFA 4FCYA 1R0AA 4KHNA 4CJRA 4DFMA 4GNIA 4QCLA 4JKGB 2JLEA 4F2SA 1ZBSA 1Q8IA 4CJWA 2IDOA 1NJXA 2Q3SA 1UA0A 1VSIA 2Q2RA 1JLFA 5AZIB 5M1OA 5BREA 3H1VX 4BDYA 3UKRB 2D0PA 5KTQA 3TTDA 4JKEA 1FJGK 2HVIA 5JVLA 4EP5A 1RFQA 3A5MC 3LDQA 4AHUA 2HHWA 3FE1A 3HSTB 2BDPA 3DXKA 4NLBA 3OYKA 3AAQA 2OA8A 4CGIA 3CIPA 1C0UA 2YNFA 4G9ZA 4BRMA 3IMXA 4CZHA 2ZGYA 3D2FB 3OYJA 2NRTA 1BL3A 4ZHRA 4KTQA 1XQSC 4IG3A 1REVA 1UAXA 3JS6A 4JLHA 3WNHA 4IOXA 4I2PA 4LFCK 5J1EA 3VESA 3CCMN 4I7FA 2ASOA 3LP1A 1RT2A 1NU0A 3OY9A 3GBTA 3K5NA 3THVA 2J4RA 2HSTA 1N6QA 3VF6A 4BRDA 1WAJA 3GG4A 3O3HA 3EPYA 3HP6A 3V9UA 1XUPO 3U7DA 1VSDA 3TSQA 4DV0K 5JMVA 4UY8O 4KHQA 4BRGA 2P9UB 5AQSA 3CJ1A 1K8KB 5CYMA 4CD3A 4M3ZA 3FZKA 3J7ZO 2YHYA 3WA0A 3QETA 3CJAA 3MXMA 3CERA 2P9KA 2QM1A 1ST7A 1UOCA 4DUYK 4CCHA 2BH1A 5M1KA 3PV8A 1J53A 2EWSA 4DR6K 2V51B 3AVAA 3SK3A 3NGIA 3DM2A 4PKIA 4Z4EA 3NH2A 2KFZA 1YTUA 4K0KK 3L0QA 1S1UA 1NGJA 4CVNE 4FJ9A 2CGKA 4B1UB 5J2QA 4KB0A 5AJ3K 3H3NO 4YNQA 1NGBA 3WT0A 4M3UA 4JRPA 3QDKA 2NUBA 5AQGA 3F5TA 2HMIA 4JKGA 2YNHA 4E19A 4JN4A 3QINA 4FOIA 3PIOL 3TU5A 4CJFA 4DXAB 4KTZA 2ITMA 4E1MA 4Z0UA 1RTDA 4FLTA 1DLOA 3HZ6A 3UKRA 5HBMA 3K5MA
chains in the Genus database with same CATH topology
3CQXA 3N4PA 4JKCA 3GDQA 1BG3A 3KWIA 4YOTA 4YOYA 1QZ5A 1ESVA 1NLVA 1MWMA 2GX9A 3F2KA 1T3VA 1VQ8N 1BA1A 3EE8A 3J8AA 3KHYA 5BRDA 4WCEL 2HRJA 2YI1A 1J6ZA 3TTCA 5ADXH 1GGOA 2A5XA 1KAYA 4IDHA 2OTLN 5LJWA 2A3ZA 2RHKA 2CB8A 2P9SA 4CJ7A 4CD1A 4NLCA 2AL6A 4A5BA 3MX5A 4BR5A 4HDOA 1TYQA 1K9MO 3NVMA 3D2FA 1D4XA 4WQ5A 1K73O 2ZF5O 4HTLA 1LCUA 5C0YA 3MK6A 3HOTA 1Y64A 5AQPA 2YHXA 5KQDA 2V52B 1EO1A 2VGNA 1V4TA 2P9SB 4PKHA 3VTIA 4GV3A 2HOEA 5E26A 3O9RA 3IUCA 3O08A 1VQMN 3R3LA 3U9ZA 5BPMA 1TYQB 3H6EA 4XH4A 4PL7A 4KBOA 2ABDA 3ZYYX 1NWKA 2HF4A 2QW9A 1DT9A 3R6MA 3CCLN 1NI2A 1XC3A 4H0OA 3CCQN 1T6DA 4FL9A 4MDAA 4DCHA 4WQ5C 1CZAN 2R82A 4NB4A 1ISNA 1M1KO 1VQNN 1VAZA 5FPMA 3U9DA 1YJ9N 1NGHA 1QQMA 2D0OA 4XH5A 1VQ7N 3VERA 1Q82O 4BRQA 4AM7A 4P7IA 3CF5L 1K8AO 4QS8A 4BR4A 2AP1A 2QEXN 1H4RA 5EX5A 3T69A 3P4IA 3WUHA 5JICA 2FSJA 3G4SN 3E9LA 3GE1A 3EKUA 4A5AA 4EFHA 4K42A 3BUZB 1HBKA 2P9LA 2NNWA 4BRIA 4IO9L 3CI5A 3ATVA 3MCAB 1BU6O 3VEYA 5E84A 2HBJA 2NZTA 1GC6A 2CH5A 3ZETA 2ZJRL 4BY9C 4B1ZA 3TTFA 2FXUA 3PZDA 2NRHA 3IKMA 4BC5A 4I6MA 4C23A 5F0XA 5JLFA 4BRPA 4F7GA 4YOXA 3LDLA 4U7BA 3QIJA 3LM9A 1G99A 2HBKA 3VETA 1ACAA 5AQOA 4JKHA 2E2QA 3TSUA 5AQLA 1HKBA 1QZ6A 2Q36A 2FDQA 4CZJA 1YF5L 3M5RA 1DIKA 2ASMA 1H1VA 4JKFA 2P9LB 3MN5A 2NRVA 3SAGA 3M1FA 5KPTA 4JHDA 4OO1J 1NGAA 4CBXA 3ZETB 4FWKA 2BTFA 2CGJA 4EAHD 5ELZA 4KH6A 4B1VA 4I6MB 3IVFA 1GLBG 3MWTA 2NLXA 2JWKA 3OW2M 3WXLA 1SGHA 3VEZA 4GV6A 1E5WA 3O9SA 3GOIA 4BGAA 4WFAL 3FR0A 2E88A 4XH1A 3L4IA 2FF3B 3B8AX 1Q7YO 3P38A 3X23A 4JHDB 3ID6A 3QFPA 3LDPA 5TKWA 1T44A 5HOOA 4FWOA 3FLVA 4A2AA 4BG9A 1HB8A 2DIKA 2A41A 3KK7A 1O13A 2QWLA 1MIXA 2QWMA 4ILGB 5CR4A 4NO7A 1YITN 4A62A 3CMAN 4FO0A 1BO5O 4PKGA 4KH5A 4MLEA 1JCGA 4MDBA 3AU4A 2E2NA 2QA4N 4BQZA 4J8FA 4BC3A 2D10A 3CPEA 3AU5A 4K25A 3R8EA 4FWSA 3CC7N 2A6AA 3SLCA 3VEVA 4WFNL 5AFUA 5C15A 1BOTO 1NGEA 3C6AA 3C0BA 3D7EO 3QBXA 4WYBA 2YJFA 1YHQN 3U8ZA 3MN9A 4H0XB 2FJ9A 2HF3A 5AQWA 4BR0A 4FSVA 3QICA 3I33A 3E1YA 4IJAA 1EF1A 4BQLA 4DB3A 3KZBA 4BR7A 4EIAA 3CCJN 2UYTA 3VEWA 5GINA 3BEXA 3EL2A 3MN7A 3C6HA 1W2BM 1MK9B 4BR2A 3SJHA 1QQNA 1Q86O 1HKCA 1Q18A 4HDQA 3ULEB 5KPZA 3E9PA 1NM1A 4M63C 3Q7CA 3JXUA 1IG8A 3RSEB 3EZWA 4WFBL 2A40A 3CCRN 3AGRA 5H1SQ 3H46O 3ZEUB 2E1ZA 1YJNN 4TKNA 1VQ6N 3W0LA 2E2OA 5AZJB 3O4WA 1J19A 4H0YB 5EY4A 4H0TB 1DKGD 4IEEA 1KBLA 4BRNA 1M90O 2OTJN 1SQKA 2RE2A 1YAGA 5EXWA 3VF2A 4B1WB 4IFEA 4E1JA 1GLAG 2VWBA 3EN9A 3PIPL 3I55N 2IVOA 3CC4N 4EKUA 1S3XA 2FSKA 3UKUA 4A61A 1ZC6A 3FZMA 3FP5A 3WEEB 4GXBA 4CI6A 5AQFA 2LBBA 2GWJA 4CZGA 3SMSA 2I1KA 1VBHA 2FLOA 4BGBA 3VTHA 1KAXA 1QVGM 2EMSA 3W3DA 2KHOA 3IDHA 5CE3A 4FWQA 5FPDA 3EO3A 2V7ZA 4H5RA 4ISEA 3SBGA 1GG3A 2OANA 4MO4A 4BVOA 4XEIA 3OBWA 3UKUB 2ZPYA 1HKGA 1NBWA 4O8UA 3CCUN 2CGLA 1NMDA 1JDEA 1SS6A 5M1QA 4B9QA 3FFKB 2Q0RA 3CHWA 1T6CA 3CJBA 1EQYA 3FLCO 5EOYA 1NTIA 4EHUA 2YCHA 2GELA 1GLCG 4BRHA 3VGLA 4NY0A 1JCEA 5BRHA 2E20A 2X0SA 3ZX2A 4IOCL 5AQRA 1HLUA 3N4QA 5JVHL 5BPLA 3O1BA 1OVYA 5LY3A 3CCSN 3LL3A 1JJ2M 4ISFA 4OPHA 3NMUA 4CBWA 2NRRA 1VQPN 1DEJA 3E66A 4M7XA 1RDWX 3ENOA 4BC4A 1KD1O 1BWFO 1NGGA 2PBDA 5GIPA 4PHTX 3CCVN 4GV9A 2QXLA 3NVKA 4C1NI 4H5TA 4O8KA 3WXIA 5C10A 3WQUA 2IVPA 3CQYA 5AQZA 3HBTA 3G9WA 3C7NA 1E4GT 5C2DA 3KVGA 2F9TA 3VOVA 2F9WA 4YOWA 4H0VB 4YL8A 1KAZA 4JKDA 3BF1A 1QHAA 3D2EB 3R9PA 3HRGA 3OBYA 5F1XA 2NRZA 5GADP 1YJWN 2W40A 5C2FA 2NRXA 5BN9A 3SAFA 4IOAL 3CD6N 1S72N 1RGIA 5GAGP 4R79A 3OHRA 3C7NB 1ATNA 4CZLA 3UE5A 4JK7A 3E9OA 2GTDA 4FWRA 4JEPA 5LJVA 1RDUA 2H3GX 3CETA 1GLJO 2HBMA 3A0IX 3BP8A 4ZRJA 2FSNA 3O5BA 4H03B 1WOQA 4H5WA 4BR9A 3TSPA 1Q81O 2AEHA 1VQKN 4BC2A 1HJOA 3S41A 1U6ZA 4YDUA 5DM6L 1DGKN 5AQIA 3O9TA 2WUSA 4RCHA 3CXCM 4FOEA 1BA0A 4ILJA 5ADXA 4CZMA 4BRKA 2IIRA 3QB0A 5JLHA 4DHYA 5EVZA 3WQTA 2NRWA 4FWNA 4QS7A 3G71N 1YVNA 3O80A 4B1YB 2ZJPL 2GUPA 2YHWA 4C1NK 5DM7L 2AA4A 1P8ZA 4JK9A 3MX2A 3FZFA 1VBGA 3FGUA 3FZLA 4O5FA 3A5NC 4HWIA 4WQ4A 3DAWA 3MN6A 4GY2B 1ILYA 3LM2A 4YOUA 5KQ8A 2HBLA 5BR9A 3SMPA 1VQLN 3ZX3A 2E2PA 1SAZA 1OKJA 3KWGA 4DQ8A 4CZKA 3ULEA 3HM8A 3HSCA 3MCPA 3UB5A 5F2RA 1QQOA 4JAXA 2I7NA 4JK8A 1KC8O 5M1PA 4JKBA 2P9KB 3RSEA 3O9UA 2WH5A 1X9JA 1Z6RA 2J0KA 5C12A 4BROA 3ZEUA 4KH4A 4MLHA 1QVFM 1ATSA 3C65A 2PAVA 5AZJA 3AAPA 5AQTA 1KXPA 4FVUA 4K41A 2YJEA 4WQ4C 1YI2N 3H45C 4BVPA 1MWKA 2I1JA 2KLAA 1KQSM 1TUYA 4FWMA 4ZRKA 3VEOA 4BRAA 2Q1NA 4Y0WA 1X3MA 1GLLO 2QWOA 4QS9A 2WC9A 5AQJA 5BPNA 2D2QA 2DPNA 2J0JA 3T7ZA 2HMPA 1JCFA 5AQMA 2J0MA 3CJ7A 1GLEG 3WEEA 2P9IB 4Z94A 5M1NA 4IWVA 5HL7L 3ENBA 3A5OC 5IJMA 4WF9L 3PLAA 1NGCA 2ASPA 3M6GA 5AR0A 5AZIA 3VPZA 1SZ2A 4EHTA 3Q7BA 4ISGA 5CHIA 4GNIA 1MDUB 4JKGB 3WXJA 3H1QA 4PL8A 1ZBSA 1VQ5N 4IO8A 4FWLA 3I8BA 2PFUA 2Q2RA 4YORA 5AZIB 5M1OA 3WXMB 1NGIA 3H1VX 5BREA 3UKRB 3ZX0A 3SAHA 2D0PA 3U8XA 5AQUA 3TTDA 4JKEA 1YUWA 1MA9B 5AQYA 4LC9B 2QWPA 1VQ4N 1U2VA 3K9JA 5AQXA 4A2BA 3ATUA 1VQ9N 1YIJN 5JVLA 4IJNA 4H5NA 3BINA 4CBUA 1RFQA 2V7YA 3A5MC 2JWLA 3LDQA 3R1XA 5AQVA 3FE1A 3WXKA 5AFUH 2COPA 1LOTB 5AQKA 2CH6A 2Q97A 3DXKA 4NLBA 4A57A 5AQNA 3AAQA 3A5LC 1U2VB 3QMLA 3CIPA 4A59A 1GLDG 4G9ZA 2GWKA 2I7PA 3IMXA 4BRMA 2ZGYA 3D2FB 1ZXOA 4CZHA 1KC7A 1WUAA 2NRTA 3DXKB 3D2EA 3L4QA 1XQSC 3EE9A 4CZIA 3O6WA 5B8HA 4ZRIA 2D11A 1S22A 3L6QA 3O9QA 3VEXA 3PVLA 3VF4A 1N8RO 3EKSA 3JS6A 3D6RA 5M1FA 3G6EN 3AGKA 2VCPA 1MK7B 3RVCA 4IOXA 4FPBA 2QWQA 1C0FA 2RQ1A 3DJCA 3QBWA 3DXMA 4IXCA 5KPRA 5GAHP 3VESA 1YXQA 3VGMA 3FZHA 2HE7A 4FPAA 4K43A 2P9PA 1BUPA 3SBTA 3CCMN 3VMFB 2FF6A 2ZGZA 3DWLA 3MMVA 3CJ9A 3AY9A 4L3QA 3CMEN 2ASOA 5TKYA 4BRFA 3GBTA 4AM6A 1TUUA 2J4RA 2P9UA 2HSTA 3TPQA 3HI0A 1K8KA 3VF6A 2A42A 4BRDA 3GG4A 1P90A 3ENHA 1GC7A 2IVNA 3DXMB 4OPAA 3EPYA 1C0GA 2W41A 4H5VA 4M7YA 5FPNA 3VGKA 4B1XB 1XUPO 4BREA 4BRLA 3CCEN 3U7DA 3TSQA 2P9PB 3MWPA 2F7TA 5FPEA 5MLCQ 5JMVA 4UY8O 4DKWA 1HUXA 2ZWHA 3M3ZA 3VENA 4BRGA 3LDOA 3I56N 3H3OB 1VQON 4IZ9A 4H0PA 2P9UB 5AQSA 3CJ1A 1K8KB 2E8AA 2WBNA 3K9KA 4CD3A 2QTDA 5BN8A 2VYPA 1Y19B 3FZKA 2Q0UA 4IEIA 2EMTA 3ID8A 3J7ZO 1V4SA 2YHYA 3P39A 3WA0A 3G25A 4RWTA 5AQQA 3DLLL 3CJAA 1NGDA 2QI2A 3IFRA 1X3NA 3CERA 3F9MA 5AQHA 4CZEA 3GL1A 2YVCA 2P9KA 2QM1A 1ST7A 4AF1A 2VGMA 2BUPA 3O1WA 3O8MA 1ATRA 2BH1A 3CC2N 3AARA 3BF3A 5M1KA 1E4FT 2QWNA 4CZFA 1BDGA 4JNEA 2EWSA 1NJIO 2V51B 3HTVA 3SK3A 3U4LA 4YDUC 2CQUA 2ZJQL 2P9NA 4JD2A 4PKIA 5I9EB 3QFUA 4YOVA 3A8YA 1GLFO 5GIOA 2KKZA 3LDNA 4BG8A 3L0QA 2GEMA 1NGJA 2D4WA 3MDQA 3CPWM 2P9IA 1MIZB 1IJJA 1NVLA 2D1KA 2CGKA 4B1UB 3H3NO 2QWRA 2P9NB 1NGBA 4JD2B 3WT0A 3QDKA 1HB6A 1HPMA 2YX6A 3F5TA 1HX1A 5AQGA 5GAEP 3P31A 4GVEA 4CYEA 2WFBA 4JKGA 3PIOL 4JN4A 2Q31A 4FOIA 5BRFA 3TU5A 1Z05A 5JVGL 4RTFD 3CJCA 4DXAB 3OA9A 1NGFA 2ITMA 2E1YA 4F9OA 1W97L 4ILHA 3ZDTA 3HZ6A 4MO5A 3UKRA 4BRCA 4JKAA 4U67L 1R59O 4FWPA 3HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILJ A;  4JKG B;  4JKC A;  3SBT A;  3E9P A;  4JK9 A;  3E9L A;  3E66 A;  4JK7 A;  3E9O A;  3SBG A;  4JKE A;  4JKG A;  3ENB A;  4JKH A;  4ILG B;  4ILH A;  4JK8 A;  4JKA A;  4JKD A;  4JKB A;  4JKF A; 
#chains in the Genus database with same CATH topology
 3CQX A;  4CFD A;  3GDQ A;  4R5P A;  1QZ5 A;  1ESV A;  1T3V A;  2VG5 A;  1BA1 A;  3LP2 A;  3EE8 A;  3OJS A;  5BRD A;  1I39 A;  1GGO A;  2OTL N;  5BR8 K;  3O3G A;  3T3F A;  2AL6 A;  3MX5 A;  4N56 A;  1IH7 A;  3QEV A;  3D2F A;  4HCB A;  3HOT A;  1KLM A;  1RT4 A;  1BCM A;  5AQP A;  4CHZ A;  4PWD A;  1EO1 A;  1V4T A;  3VTI A;  4CF0 A;  4GV3 A;  3M8S A;  4M3W A;  1TYQ B;  2HHT A;  4PL7 A;  4X62 K;  4KBO A;  3ZYY X;  1X1P A;  1S9E A;  4FXD A;  3CCL N;  1NI2 A;  4H0O A;  3CCQ N;  4DFK A;  1T6D A;  4DCH A;  2R82 A;  1TK5 A;  1TK0 A;  1ISN A;  1M1K O;  2WON A;  3LAN A;  3U9D A;  1VQ7 N;  3NFA A;  4ELT A;  3VER A;  3E01 A;  4PY5 A;  3J7Y P;  3AVB A;  4BR4 A;  5EX5 A;  3T69 A;  5JIC A;  2FSJ A;  2F96 A;  3JYT A;  3BUZ B;  1HBK A;  1A5W A;  1IBK K;  1IBM K;  3ATV A;  2EHG A;  2NZT A;  1GC6 A;  3ZET A;  4BY9 C;  2NRH A;  4CFA A;  4I6M A;  1VSL A;  4BRP A;  3SI6 A;  3LM9 A;  1ACA A;  3TSU A;  1QZ6 A;  4LSN A;  1H1V A;  4JKF A;  1KTQ A;  2NRV A;  4JHD A;  4DTJ A;  5KRS A;  2VQE K;  1GLB G;  5DMR A;  3OW2 M;  3EZ5 A;  3NDK A;  3DLG A;  1E5W A;  3SQ0 A;  4BGA A;  1XC9 A;  4M41 A;  2FF3 B;  3B8A X;  1Q7Y O;  2KQ2 A;  4OJR A;  4DG1 A;  1B92 A;  3TAR A;  1JKH A;  1HB8 A;  4DTP A;  1A5X A;  1O13 A;  3DOL A;  3O4N A;  4KV8 A;  4RW8 A;  5CR4 A;  4LH5 A;  4DQS A;  3V1R A;  1BO5 O;  4PKG A;  1W0H A;  1JCG A;  3AU4 A;  3HO1 A;  2QA4 N;  4RW4 A;  4W5R A;  1GOA A;  4BC3 A;  3LDS A;  3CPE A;  3AU5 A;  3SUQ A;  4WFN L;  4O44 A;  4LH4 A;  3SUP A;  4WYB A;  4E1N A;  4DTR A;  3AA2 A;  1VSH A;  2FJ9 A;  2HF3 A;  2O4G A;  4BR0 A;  1BI4 B;  3QIC A;  3VQC A;  3BDP A;  4PUO A;  3DI6 A;  3V9Z A;  1DTQ A;  4EIA A;  2ZE2 A;  5GIN A;  3AV9 A;  3MN7 A;  5C24 A;  3I0S A;  4X65 K;  1WN7 A;  3SJH A;  4I9Q A;  1HKC A;  1Q18 A;  4OPJ A;  1U4B A;  2FC0 A;  1NM1 A;  4JI8 K;  4CJT A;  1EWQ A;  1IKV A;  3ZSY A;  1I94 K;  4DR1 K;  3AGR A;  4KI4 A;  3H46 O;  1ZBL A;  4JI5 K;  1VQ6 N;  2E2O A;  1BIZ A;  1IO2 A;  4H0Y B;  3HK2 A;  3KKR A;  4AHR A;  4F2R A;  1YAG A;  1GLA G;  3EN9 A;  3HM9 A;  1TKD A;  1WBB A;  4CGD A;  3RR8 A;  4EZ6 A;  3EYZ A;  4GXB A;  3EEQ A;  3PO4 A;  4DF4 A;  1ASU A;  3SMS A;  2I1K A;  1VBH A;  3U3Y A;  2R7Y A;  1KAX A;  3W3D A;  4FJ7 A;  4DTS A;  5CE3 A;  1ZBH A;  1TL1 A;  3DLK A;  1GG3 A;  3AO5 A;  1NKC A;  3UKU B;  2KZM A;  4JI1 K;  1NBW A;  1HKG A;  3CCU N;  2OZS A;  4B9L A;  1RBR A;  4OLA A;  1SKS A;  1T6C A;  5EOY A;  4AHV A;  4OKJ A;  2YCH A;  1NOY A;  1GLC G;  1S1T A;  3V9S A;  4NY0 A;  2P51 A;  1JCE A;  3OYN A;  1RTJ A;  2G8I A;  3VQA A;  3MXI A;  5JVH L;  3D45 A;  5FDL A;  4M3T A;  5LY3 A;  1FXX A;  4W5O A;  3KLG A;  4H4M A;  5HRO A;  4ISF A;  4KHS A;  1XNR K;  1VQP N;  3E66 A;  4DS4 A;  1NGG A;  5GIP A;  3OYA A;  4CJ3 A;  2E6L A;  3SZ2 A;  5AQZ A;  5C2D A;  2F9T A;  3VOV A;  4YOW A;  4YL8 A;  1KAZ A;  4JKD A;  3BF1 A;  1QHA A;  3ULD A;  3KKS A;  3SQ1 A;  3HJF A;  4CK3 A;  2KFN A;  5SWM A;  3V6D A;  1T8E A;  3OBY A;  4FK0 A;  2NRZ A;  1YJW N;  2NRX A;  4CF8 A;  4DTO A;  5EU7 A;  3OHR A;  4CZL A;  1BIS A;  3TR8 A;  1QE1 A;  4JEP A;  4DR5 K;  2H3G X;  2HBM A;  1RBV A;  2FSN A;  2HHH K;  4H5W A;  4BR9 A;  1RT3 A;  1NK8 A;  2AEH A;  3S41 A;  2VG7 A;  3LAL A;  1JL1 A;  2WUS A;  5ADX A;  4CZM A;  4J2E A;  2IIR A;  4DV5 K;  5EVZ A;  3WQT A;  3G71 N;  2ZJP L;  3O80 A;  2AA4 A;  4JK9 A;  3I0R A;  3FZL A;  1KFS A;  3A5N C;  4HWI A;  4WQ4 A;  3MN6 A;  2HBL A;  3CM5 A;  4IDK A;  1SAZ A;  4CEC A;  1YTA A;  4FW2 A;  1QTM A;  3HSC A;  3MCP A;  3V9X A;  1QQO A;  4RW9 A;  3TAP A;  5M1P A;  4JKB A;  1HPZ A;  3RMB A;  1X9J A;  5C12 A;  3RMD A;  4BRO A;  3SQ2 A;  4KH4 A;  3A2F A;  1EET A;  3C65 A;  3V1O A;  3ZT0 A;  3CFR A;  5AQT A;  4JS5 A;  4FVU A;  3VQ6 A;  4WQ4 C;  3TAB A;  3H45 C;  2HVH A;  1MWK A;  4DTX A;  4IBN A;  4KFB A;  2QWO A;  5AQJ A;  4JI3 K;  1IKX A;  2J0M A;  1S5J A;  1GLE G;  5HRN A;  3PSF A;  4CEQ A;  5M1N A;  4IWV A;  4CE9 A;  3A5O C;  3AA3 A;  3NF7 A;  3VQ4 A;  3RMA A;  3SPZ A;  4M3R A;  4EHT A;  1J54 A;  4ISG A;  3ISN C;  1WLJ A;  4PL8 A;  4CGH A;  2PFU A;  4ZTJ A;  1NGI A;  3SAH A;  3KLF A;  1LW2 A;  3U8X A;  1MA9 B;  4LFB K;  1NJZ A;  5KGW A;  4K8Z A;  3DLE A;  3NCI A;  1YIJ N;  3C94 A;  4DF8 A;  2OPP A;  3BIN A;  1N34 K;  5AQV A;  2JWL A;  3WXK A;  1F21 A;  2CH6 A;  2Q97 A;  4B8C A;  3ZSV A;  1RTH A;  1TAQ A;  3BZK A;  3IG1 A;  5HRR A;  1RTI A;  4A59 A;  3L2W A;  1N36 K;  4CW7 B;  3L2U A;  3DXK B;  1TGO A;  2D5R A;  3THW A;  2W6K A;  3V1Q A;  4ZRI A;  2D11 A;  3L6Q A;  3O9Q A;  4KKO A;  3VEX A;  3PVL A;  2BE2 A;  3D6R A;  5M1F A;  2VCP A;  1MK7 B;  4JI6 K;  4N41 A;  3L3U A;  4B08 A;  1W7A A;  3QBW A;  5GAH P;  3DXM A;  1IG9 A;  4F3T A;  3FZH A;  4FPA A;  2P9P A;  3NF6 A;  3VA0 A;  2FF6 A;  3DWL A;  5TKY A;  4BRF A;  4O5B A;  1C1A A;  3OYF A;  1TV6 A;  1GC7 A;  2IVN A;  4OPA A;  4B1X B;  4FLW A;  2O8B B;  1J9A A;  2W41 A;  3AVK A;  1B9F A;  2HNZ A;  4BRL A;  3NGZ A;  2YKM A;  4DV4 K;  1HYV A;  3M3Z A;  3VEN A;  1EWR A;  3LDO A;  4BE2 A;  3H3O B;  4H0P A;  2WBN A;  3LPT A;  1ZYQ A;  2QTD A;  1SKR A;  2Q0U A;  5CZ1 A;  3ID8 A;  3L8B A;  3OYG A;  4RWT A;  3G25 A;  2FBV A;  5AQQ A;  2RN2 A;  3DLL L;  3RRG A;  1NGD A;  2QI2 A;  3IFR A;  3F9M A;  3GL1 A;  1LW0 A;  5C42 A;  3O8M A;  2IGI A;  3CC2 N;  3BF3 A;  1NG9 A;  4CZF A;  3QLH A;  4ID5 A;  2YHA A;  4JNE A;  1NJI O;  4JD2 A;  1TL3 A;  3QFU A;  1GLF O;  3LDN A;  4AH9 A;  4M3Y A;  3K57 A;  2GEM A;  4M42 A;  1NVL A;  3WNE A;  1SL1 A;  3VN5 A;  3S3M A;  4DTM A;  1HPM A;  2YX6 A;  5GAE P;  3P31 A;  4GVE A;  2YNG A;  1Z05 A;  3CJC A;  1NGF A;  4F9O A;  2YNI A;  4ILH A;  3ZDT A;  3MEG A;  2UUC K;  4JKA A;  4JI7 K;  3AO3 A;  3HOS A;  3DRP A;  2PY5 A;  3TAM A;  1XHZ A;  4JKC A;  3WNG A;  3KWI A;  3T1H K;  4Q5V A;  4NCA A;  4DV2 K;  3HP9 A;  1MWM A;  4W5T A;  2RPI A;  3J8A A;  3KHY A;  2UUA K;  2HRJ A;  2YI1 A;  1J6Z A;  1KAY A;  4IDH A;  1RDA A;  1U47 A;  2KW4 A;  1HQU A;  2P9S A;  4CD1 A;  4NLC A;  4DUZ K;  4W5N A;  4YFU A;  1XMO K;  4E7K A;  1K73 O;  4OVL A;  1VSJ A;  3LAK A;  1OH5 A;  2YHX A;  3S3O A;  1X9S A;  1LWC A;  4PKH A;  4H4O A;  5E26 A;  3O9R A;  1VQM N;  3O08 A;  4B8A B;  3R3L A;  4B3R K;  3H6E A;  1S6Q A;  2VWK A;  2X6S A;  1S9G A;  4CGG A;  1XC3 A;  1WB9 A;  1CZA N;  1XI1 A;  1VAZ A;  2HHQ A;  4KHY A;  4HTU A;  1NGH A;  2O8B A;  1NJW A;  1Q82 O;  4BRQ A;  1ZBF A;  3CF5 L;  3SQ4 A;  1K8A O;  4QS8 A;  3HPG A;  2QEX N;  2X74 A;  3P4I A;  4FZZ A;  1X9W A;  4A5A A;  2PYL A;  4Z4F A;  4DU1 A;  2P9L A;  3CI5 A;  3VEY A;  2CH5 A;  2VQF K;  4B3M K;  4AHC A;  3OTO K;  4B1Z A;  3MAQ A;  2FXU A;  3PZD A;  4C23 A;  3VQ9 A;  3LDL A;  3QIJ A;  2B4J A;  3VET A;  4JKH A;  4KRE A;  2FDQ A;  4FJJ A;  3M5R A;  1DIK A;  5LL6 Z;  2ASM A;  3MN5 A;  4NYF A;  5KPT A;  1T05 A;  3ZET B;  4FWK A;  1W9H A;  5HLF A;  4KH6 A;  4I6M B;  2X6N A;  3LPU A;  1BQN A;  4GV6 A;  4FZY A;  3GOI A;  4WFA L;  3FR0 A;  2RKI A;  4AHS A;  4JHD B;  3QFP A;  4BG9 A;  2DIK A;  3KK7 A;  2QWM A;  4C8K A;  5J2M A;  4Y1D A;  4WE1 A;  4J2D A;  2E2N A;  4BQZ A;  4B3O A;  4KHW A;  2O8E A;  1TK8 A;  1SL2 A;  3R8E A;  1J5O A;  3J7A P;  1BGX T;  2A6A A;  5AFU A;  1C0M A;  1NKE A;  1QSL A;  3C6A A;  3C0B A;  2YJF A;  3OS0 A;  4CHN A;  4FSV A;  3I33 A;  3E1Y A;  3OYI A;  1EF1 A;  1NNE A;  3KD5 E;  3VEW A;  4CEZ A;  3EL2 A;  1VRT A;  1NK7 A;  3NF9 A;  1T7P A;  2QK9 A;  5KPZ A;  1YVU A;  2I5J A;  4KI6 A;  3NH1 A;  3ZSW A;  4M63 C;  4JYA K;  1IG8 A;  3U3G A;  4WFB L;  5T7B A;  4O4G A;  4GMJ B;  3HL8 A;  5H1S Q;  4M3X A;  1YJN N;  1KVC A;  5AZJ B;  3KK2 A;  4OGC A;  4YY3 K;  4H0T B;  1DKG D;  4IEE A;  3DLB A;  1M90 O;  2RE2 A;  4IFE A;  1C6V A;  2HHV A;  3JAM O;  3I55 N;  3CC4 N;  4HUF A;  1GOB A;  2Y1J A;  5A2Q O;  3WEE B;  5AQF A;  2E6M A;  4CZG A;  4CED A;  3HYF A;  4Z4I A;  4BE0 A;  4BVO A;  4XEI A;  3OBW A;  4F8R A;  4LF8 K;  1SS6 A;  4DV7 K;  3FFK B;  1KVB A;  2Q0R A;  1LAW A;  4M45 A;  2GEL A;  3LAM A;  2E20 A;  4CGF A;  3ZX2 A;  3O1B A;  3CCS N;  3LL3 A;  3KLH A;  1IKY A;  3TAG A;  3SCX A;  4M7X A;  5IWA K;  3ENO A;  2PBD A;  1Z26 A;  3CCV N;  4GV9 A;  4FJN A;  4C1N I;  4H5T A;  3V81 A;  5C10 A;  3G9W A;  3C7N A;  3MED A;  3BY5 A;  3SV3 A;  2G8U A;  2Z1G A;  3PX4 A;  1U49 A;  4IKF A;  3R9P A;  1RNH A;  3QEX A;  2W40 A;  5C2F A;  5BN9 A;  1RGI A;  5GAG P;  3UIQ A;  1RDU A;  2DFF A;  2YKN A;  2UXD K;  1GLJ O;  3BP8 A;  3QER A;  4ZRJ A;  4H03 B;  3O5B A;  4IFV A;  1WSJ A;  1RBS A;  1N5Y A;  2XY7 A;  4YDU A;  3BGR A;  3AVM A;  1JXE A;  4C8L A;  4ELV A;  2O8C A;  4CEA A;  1WAF A;  1BA0 A;  4PA1 A;  4BRK A;  5JLH A;  4DHY A;  4CHQ A;  3F9K A;  1B9D A;  2QXF A;  1YVN A;  4C1N K;  4QAG A;  1T03 A;  3FZF A;  1L3V A;  2G8F A;  4DQR A;  5LMU K;  1Y97 A;  4GY2 B;  5KQ8 A;  1WSI A;  4GKK K;  4LF7 K;  1VQL N;  3KWG A;  1L3S A;  4KB1 A;  4DQ8 A;  3ASM A;  4MQ3 A;  3THX A;  4XIU A;  1KSP A;  3UB5 A;  4JK8 A;  1IBL K;  1Z6R A;  1Z25 A;  3SUN A;  3NH0 A;  1QVF M;  5AZJ A;  1HMV A;  3VQB A;  4EZ9 A;  4K41 A;  2YJE A;  2I1J A;  1S6P A;  4ZRK A;  2Q1N A;  2D0B A;  3AA5 X;  4QS9 A;  5BPN A;  2J0J A;  3T7Z A;  4L8R B;  4FLY A;  1JCF A;  5JS2 A;  3WEE A;  4Z94 A;  2OZM A;  3DRR A;  4JRQ A;  3ENB A;  1HNZ K;  3U6F A;  1NGC A;  1VSE A;  2ASP A;  1L5U A;  1JLE A;  3TWH A;  1RDC A;  2DY4 A;  3AVI A;  4W5Q A;  3Q7B A;  3M8R A;  3PUF A;  1EXQ A;  4DV1 K;  3H1Q A;  1VQ5 N;  1IKW A;  3G10 A;  4IG0 A;  2GV9 A;  4YHH K;  4E3S A;  3RTV A;  3K0S A;  2O8F A;  1YUW A;  2B5J A;  3HXM A;  3QEI A;  1HNX K;  2Z1I A;  3ZT1 A;  2OPS A;  3ZSR A;  5AQY A;  4BAC A;  2OPQ A;  4LC9 B;  1VQ4 N;  1U2V A;  1O1W A;  3K9J A;  1VQ9 N;  4E7H A;  4H5N A;  2OYQ A;  3B6O A;  1CXQ A;  4CBU A;  3K2P A;  2OPR A;  3C95 A;  4DFJ A;  2COP A;  1LOT B;  5AQK A;  3HPH A;  5IT9 O;  4A57 A;  3DOK A;  3DYA A;  5AQN A;  2HND A;  4F3O A;  1HQE A;  3A5L C;  4PQU A;  4K8X A;  1ZXO A;  1KC7 A;  3DLR A;  1VSK A;  4X64 K;  3L4Q A;  3O6W A;  5B8H A;  4FW1 A;  1S22 A;  3VF4 A;  2XO7 A;  2D0A A;  3AO2 A;  3G6E N;  3AGK A;  4FPB A;  2QWQ A;  3QNN A;  1C0F A;  3DJC A;  3NF8 A;  5KPR A;  4K43 A;  1BUP A;  3SBT A;  1XWL A;  3THW B;  3VMF B;  2UXC K;  3MMV A;  3CJ9 A;  4L3Q A;  2HW3 A;  4OGE A;  1HJR A;  3HI0 A;  4NXM K;  2A42 A;  5FPN A;  4H8K A;  3DXM B;  4M7Y A;  4H5V A;  1YI2 N;  4BRE A;  1HRH A;  3VGK A;  3H08 A;  2UU9 K;  3CCE N;  5J2P A;  2P9P B;  3MWP A;  5FPE A;  1JLC A;  4FJ5 A;  2ZWH A;  1MU2 A;  3I56 N;  1VQO N;  1SV5 A;  1IV0 A;  1A5V A;  2ZQB A;  5FLX O;  3CYM A;  5BN8 A;  2VYP A;  1Y19 B;  1RDD A;  1V4S A;  3AVH A;  2A1S A;  3PX6 A;  1X3N A;  4CZE A;  5AQH A;  4IFY A;  2YVC A;  4AF1 A;  1CZ9 A;  5C25 A;  1ATR A;  4FM2 A;  3AAR A;  1ZBU A;  1E4F T;  1EP4 A;  3LP3 A;  3KLE A;  3HTV A;  3U4L A;  2P9N A;  5I9E B;  4YOV A;  5GIO A;  3V9W A;  2D4W A;  4FJX A;  3CPW M;  1MIZ B;  4CF2 A;  5KGX A;  3B6P A;  4FJL A;  4AQY K;  4HUG A;  2QWR A;  4JD2 B;  1NK6 A;  4CYE A;  2WFB A;  3L2Q A;  4B9V A;  5JVG L;  4RTF D;  3OA9 A;  3TAE A;  2E1Y A;  3VQE A;  1RDB A;  3IAY A;  1Q9X A;  3VQP A;  2EX3 A;  3N4P A;  3NE6 A;  4YOY A;  3M8Q A;  1KLN A;  2GX9 A;  3F2K A;  1VQ8 N;  1CLQ A;  2XY6 A;  4WCE L;  3TTC A;  5ADX H;  2HNY A;  2A5X A;  4C8N A;  5LJW A;  4DSK A;  2RHK A;  3C6T A;  4CJ7 A;  4GVM A;  3P83 D;  4DTN A;  4A5B A;  4CJ4 A;  4BR5 A;  4KHP K;  3NVM A;  4WQ5 A;  2ZF5 O;  3O4Q A;  1XMQ K;  4B9M A;  5KI6 A;  1Y64 A;  5KQD A;  2P9S B;  2HOE A;  3RWU A;  3HPO A;  4AIL C;  3U9Z A;  4O0J A;  4DFP A;  4FK4 A;  4XH4 A;  4ZTF A;  3PX0 A;  1HNW K;  5I42 A;  4RW7 A;  2HF4 A;  2QW9 A;  3R6M A;  4LF5 K;  3QIP A;  3OYL A;  4WQ5 C;  1EX4 A;  4NB4 A;  3OS1 A;  1KFD A;  5FPM A;  1S1X A;  1ITG A;  5CZ2 A;  3K58 A;  1JL2 A;  1UWB A;  4P7I A;  3AVF A;  4CJP A;  2DFE A;  3G4S N;  1JLA A;  4K42 A;  5SZT A;  4BRI A;  1QSS A;  1BU6 O;  3DRS A;  1D9D A;  2FBX A;  4DMN A;  4CES A;  4CEF A;  2XHB A;  3IKM A;  4U7B A;  3BZC A;  1FKO A;  4CFC A;  3OYM A;  3LZJ A;  2HBK A;  2E2Q A;  5AQL A;  2Q36 A;  4DWI A;  1YF5 L;  2P9L B;  1RT7 A;  2RF2 A;  4OO1 J;  3SAG A;  3CM6 A;  4CBX A;  4DR4 K;  4EAH D;  5ELZ A;  1CXU A;  4E0D A;  4B1V A;  2JWK A;  2G8K A;  3WXL A;  1SGH A;  3VEZ A;  1S1W A;  3O9S A;  1JXB A;  3AA4 A;  2E88 A;  3RR7 A;  3L4I A;  4G1Q A;  3X23 A;  4CJV A;  2ETJ A;  3LDP A;  5TKW A;  4CF1 A;  1T44 A;  4FWO A;  3FLV A;  1LV5 A;  1D9F A;  4ILG B;  2WOM A;  1YIT N;  1WSF A;  4FO0 A;  4B3S K;  4MLE A;  4FJM A;  4CJE A;  4J8F A;  3CC7 N;  3SLC A;  4LY7 A;  5C15 A;  1BOT O;  2F8T A;  4FVM A;  3D7E O;  3QEP A;  3U8Z A;  4H0X B;  4LSL A;  4DR2 K;  5AQW A;  2O8E B;  4B3T K;  4FLZ A;  3TI0 A;  3CCJ N;  4BR7 A;  2UYT A;  1WSG A;  5J2N A;  3BEX A;  1W2B M;  1MK9 B;  3DMJ A;  1DTT A;  2JGU A;  1VSF A;  3AVN A;  4HDQ A;  3ULE B;  1U45 A;  3E9P A;  2G8H A;  4KRF A;  3RSE B;  4OX9 K;  2A40 A;  4DSL A;  3ZEU B;  3CFP A;  4TKN A;  4FLX A;  2VG6 A;  3O4W A;  4J2B A;  1J19 A;  1KBL A;  4JV5 K;  3EY1 A;  5EXW A;  2QKB A;  3PIP L;  3QEW A;  2IVO A;  4EKU A;  2FSK A;  3LWM A;  1ZC6 A;  3FP5 A;  4CI6 A;  2O8D A;  4BE1 A;  1WNS A;  2LBB A;  2YHB A;  2GWJ A;  1XNQ K;  5K14 A;  4BGB A;  3VA3 A;  1ASV A;  3VTH A;  1QVG M;  2KHO A;  1VHX A;  4FWQ A;  4CIF A;  3EO3 A;  2V7Z A;  4H5R A;  1NK5 A;  3K59 A;  1NMD A;  4LF9 K;  2Z1H A;  1JLG A;  3CHW A;  1RIL A;  3CJB A;  3FLC O;  3D0P A;  1NTI A;  4HUE A;  4BRH A;  3VGL A;  1KRP A;  2X0S A;  4IOC L;  5AQR A;  1HLU A;  3N4Q A;  3KLI A;  5BPL A;  3TAF A;  4ICL A;  4CEE A;  1JJ2 M;  2DFH A;  4OPH A;  3NMU A;  3KD1 E;  4CBW A;  2NRR A;  1DEJ A;  3OJU A;  2ATQ A;  1JLB A;  1BQM A;  1RDW X;  2IOC A;  1FW6 A;  1KD1 O;  1BWF O;  4PHT X;  1RBU A;  5E41 A;  3NVK A;  4DV3 K;  4O8K A;  4CIE A;  4BWJ A;  2IVP A;  1E4G T;  1BCO A;  3TAQ A;  4DQP A;  2F9W A;  4H0V B;  4OPK A;  2WTU A;  3D2E B;  2XY8 A;  2E5L K;  5GAD P;  1SUQ A;  1ASW A;  3SAF A;  4GKJ K;  4IOA L;  4J2A A;  1S72 N;  1LAV A;  4R79 A;  3HT3 A;  1S1V A;  3CG7 A;  3OYD A;  3C7N B;  1ATN A;  4JK7 A;  5LJV A;  3A0I X;  4FZX C;  5D3G A;  1WOQ A;  3VQ8 A;  3QNO A;  1VQK N;  1HJO A;  5DM6 L;  1DGK N;  3O9T A;  1RT5 A;  3AVG A;  4RCH A;  1TAU A;  3AO4 A;  3SUO A;  4QS7 A;  4FWN A;  4B1Y B;  4Z4G A;  2YHW A;  1CZB A;  5DM7 L;  3MX2 A;  1VBG A;  4NCG A;  4LD0 A;  4KPY A;  3VQ7 A;  4HVJ A;  1WBD A;  4LF6 K;  2O8C B;  1ILY A;  4YOU A;  4CFB A;  5BR9 A;  4DU3 A;  3ZX3 A;  1OKJ A;  1SL0 A;  3L2V A;  4CZK A;  3ULE A;  4E7I A;  2DTU A;  5F2R A;  1EKE A;  3RSE A;  4FK2 A;  3O9U A;  2WH5 A;  3ITH A;  3S9H A;  3ZEU A;  3K5L A;  4MLH A;  3J81 O;  4OKK A;  1ATS A;  2PAV A;  3AAP A;  3THX B;  4F4K A;  1TKX A;  2KLA A;  1KQS M;  3VEO A;  1X3M A;  2DPN A;  2HMP A;  3LP0 A;  3PO5 A;  3ZLJ A;  5AQM A;  3CJ7 A;  2P9I B;  2ITG A;  2Z1J A;  5IJM A;  1RBT A;  4WF9 L;  3KTQ A;  5AR0 A;  3VPZ A;  3M6G A;  5AZI A;  3AO1 A;  1BHL A;  4NXN K;  3PLA A;  1VK0 A;  1SZ2 A;  3F73 A;  4JI2 K;  5CHI A;  1MDU B;  3WXJ A;  4CER A;  4IO8 A;  4FWL A;  4CHO A;  3I8B A;  4YOR A;  2P5G A;  2F8S A;  3AVJ A;  3WXM B;  3ZX0 A;  5AQU A;  3SYZ A;  3MXJ A;  2QWP A;  5AQX A;  4A2B A;  3THY B;  3ATU A;  1RT1 A;  4QOZ B;  4N47 A;  4IJN A;  2V7Y A;  3R1X A;  4GW6 A;  2AJQ A;  5AFU H;  1WSE A;  2O8F B;  2P1J A;  4EP4 A;  5FRN A;  2GUI A;  1U2V B;  3QML A;  1VRU A;  4BWM A;  1GLD G;  3KK3 A;  4FJI A;  2GWK A;  4HCC A;  2I7P A;  4RG8 A;  1WUA A;  2HHX A;  3D2E A;  1NK9 A;  3KIO A;  3EE9 A;  4I9L A;  3VQQ A;  4CZI A;  4DV6 K;  3IRX A;  3P1G A;  1N8R O;  3EKS A;  3NHG A;  1N33 K;  3RVC A;  1VSM A;  1TVR A;  2RQ1 A;  4IXC A;  3OS2 A;  1YXQ A;  3VGM A;  2HE7 A;  3SJJ A;  2ZGZ A;  3CME N;  3AY9 A;  3S3N A;  4N5S A;  3P5J A;  4AHT A;  2KTQ A;  4AM6 A;  1TUU A;  3TPQ A;  2P9U A;  1K8K A;  4DLE A;  1P90 A;  3ENH A;  3G0Z A;  1C0G A;  3C6U A;  3ZSO A;  5JS1 A;  2F7T A;  5MLC Q;  4DKW A;  1HUX A;  4IZ9 A;  4JS4 A;  1NJY A;  2E8A A;  1HNI A;  3K9K A;  2UXB K;  4IEI A;  2EMT A;  4B9T A;  4X66 K;  4NCB A;  3P39 A;  1Q9Y A;  4Z4H A;  1I3A A;  4UQG A;  2VGM A;  2BUP A;  3O1W A;  1N32 K;  2QWN A;  1BDG A;  5FRM A;  4YDU C;  2CQU A;  2ZJQ L;  3A8Y A;  2KKZ A;  4BG8 A;  3MDQ A;  4FYD A;  3L2R A;  2P9I A;  1IJJ A;  2D1K A;  4I2Q A;  2IAJ A;  1OH6 A;  2P9N B;  4CJU A;  1HB6 A;  1HX1 A;  3HVT A;  4ELU A;  2Q31 A;  5BRF A;  4B9U A;  1NKB A;  3OYC A;  1W97 L;  2BGG A;  4MO5 A;  4BRC A;  1UA1 A;  4U67 L;  1R59 O;  4FWP A;  5CY4 A;  3NBP A;  4DSE A;  5CYQ A;  3THY A;  3KK1 A;  1BG3 A;  4FLU A;  4YOT A;  4BDP A;  1NLV A;  4FJK A;  3K5O A;  4DR3 K;  2G8W A;  4JI0 K;  2B6A A;  3T19 A;  4FJG A;  1C1C A;  2A3Z A;  2CB8 A;  2FBT A;  3O3F A;  3PSI A;  4HDO A;  1TYQ A;  1K9M O;  3L3V A;  1D4X A;  1G15 A;  3MEE A;  1LCU A;  4HTL A;  3ZSX A;  3MK6 A;  5C0Y A;  4CHY A;  5KRT A;  2KZZ A;  1BIU A;  2V52 B;  2VGN A;  3ZCM A;  4ID1 A;  4DR7 K;  1SKW A;  2A1R A;  3IUC A;  1D5A A;  5BPM A;  2ABD A;  1NWK A;  1DT9 A;  1LWF A;  2QKK A;  4FL9 A;  4MDA A;  1FKP A;  1JLQ A;  1VQN N;  1YJ9 N;  1QQM A;  4XH5 A;  2D0O A;  3DLH A;  4AM7 A;  4CJ5 A;  3PY8 A;  3LWL A;  4DQQ A;  2AP1 A;  1H4R A;  2IS3 A;  3WUH A;  4V19 S;  3HVR A;  3E9L A;  3GE1 A;  1U04 A;  3EKU A;  2OCE A;  1GOC A;  4EFH A;  1K6Y A;  1QSY A;  2G8V A;  4FJ8 A;  2NNW A;  3VQ5 A;  1L3T A;  4IO9 L;  3MCA B;  2W6L A;  5E84 A;  2HBJ A;  2ZJR L;  3MEC A;  3TTF A;  4BC5 A;  5JLF A;  4YOX A;  3OYB A;  5F0X A;  4F7G A;  4E7L A;  1G99 A;  4B9N A;  5AQO A;  4KHU A;  1C1B A;  4CJK A;  3QES A;  1HKB A;  5FRO A;  1QS4 A;  4CZJ A;  4O0I A;  2O4I A;  4B9S A;  3M1F A;  2E4L A;  1NGA A;  2BTF A;  2CGJ A;  3IVF A;  3MWT A;  3CFO A;  4Q0B A;  2NLX A;  1OH8 A;  4XH1 A;  2Y1I A;  4CK1 A;  3P38 A;  1RT6 A;  3ID6 A;  1YT3 A;  5HOO A;  4A2A A;  4FJH A;  3QO9 A;  2A41 A;  3V4I A;  2QWL A;  3M8P A;  1MIX A;  3NAE A;  4NO7 A;  4A62 A;  3CMA N;  1FK9 A;  1RCH A;  4FM0 A;  1L3U A;  4KH5 A;  3SPY A;  4MDB A;  4Y1C A;  1BI4 A;  2D0C A;  2D10 A;  4K25 A;  1U48 A;  4CEO A;  4FWS A;  3VEV A;  1NGE A;  3QIO A;  4LF4 K;  1YHQ N;  3QBX A;  3J80 O;  3MN9 A;  4DLG A;  2F4V K;  2VWJ A;  3OYH A;  4CJQ A;  4IJA A;  4BQL A;  4DB3 A;  3KZB A;  3SNN A;  1J5E K;  3C6H A;  4BR2 A;  1QQN A;  1Q86 O;  2BAN A;  4DQI A;  4CJL A;  4CK2 A;  3Q7C A;  3TAN A;  3JXU A;  3EZW A;  5HRP A;  3CCR N;  3AVL A;  2E1Z A;  1LWE A;  3W0L A;  5I3U A;  2XRI A;  4DSI A;  5EY4 A;  1QHT A;  2PZS A;  4BRN A;  2FBY A;  2OTJ N;  1SQK A;  4B1W B;  4E1J A;  3VF2 A;  2VWB A;  1S3X A;  4KTW A;  3UKU A;  4A61 A;  3FZM A;  5HP1 A;  1NMN A;  5DK5 A;  2FLO A;  4JI4 K;  2EMS A;  4C8M A;  2ZD1 A;  4Z4C A;  3T1Y K;  3RMC A;  3IDH A;  3RRH A;  5FPD A;  4ISE A;  3SBG A;  2OAN A;  4MO4 A;  4KO0 A;  5LMN K;  1QQC A;  2ZPY A;  4O8U A;  4CGJ A;  2CGL A;  2O8D B;  1JDE A;  5M1Q A;  4B9Q A;  3JSM A;  1X9M A;  3I8D A;  1EQY A;  4EHU A;  2W42 A;  3IS9 A;  3OYE A;  1HNV A;  5BRH A;  2HHU A;  3CQ8 A;  4RW6 A;  1OVY A;  4CEB A;  2IC3 A;  2UUB K;  2P5O A;  3AVC A;  1WSH A;  4FM1 A;  4C8O A;  4KAZ A;  4BC4 A;  4O55 A;  1KVA A;  2QXL A;  4DS5 A;  4CJS A;  5HRS A;  3WXI A;  3WQU A;  4MFB A;  4DSF A;  3CQY A;  4N76 A;  3HBT A;  3KJV A;  3FFI A;  3KVG A;  2HHS A;  1XHX A;  1ZBI A;  3HRG A;  5F1X A;  4DTU A;  4TSX A;  3CD6 N;  2PYJ A;  1NK0 A;  4CHP A;  3UE5 A;  3E9O A;  2GTD A;  4FWR A;  4OKE A;  1TKZ A;  3CET A;  4DU4 A;  1HR0 K;  1E3M A;  4NYN A;  2X78 A;  3ZSQ A;  1Q81 O;  3TSP A;  4BC2 A;  4HHT A;  1U6Z A;  3NGY A;  2ZM6 K;  3SV4 A;  4FLV A;  4DSJ A;  4E7J A;  5AQI A;  3CXC M;  4FOE A;  4E89 A;  4ILJ A;  3T1A A;  4CIG A;  4CF9 A;  3QB0 A;  2NRW A;  2GUP A;  1P8Z A;  3ZSZ A;  3FGU A;  4O5F A;  3DAW A;  4LFA K;  3LM2 A;  1TKT A;  3SMP A;  2E2P A;  3HM8 A;  1HYZ A;  3OVN A;  3ALY A;  4JAX A;  1OVQ A;  2I7N A;  3ZT4 A;  1KC8 O;  2YV0 X;  2LSN A;  2P9K B;  3ZT3 A;  3ZT2 A;  1D8Y A;  2J0K A;  1C0T A;  1NOZ A;  3LZI A;  3VQD A;  2XY5 A;  1KXP A;  4OLB A;  4BVP A;  2GBZ A;  2HB5 A;  1TUY A;  4FWM A;  4BRA A;  1OH7 A;  4Y0W A;  1GLL O;  2WC9 A;  2D2Q A;  1KCF A;  1NK4 A;  5HL7 L;  4BDZ A;  1HYS A;  3WNF A;  4FCY A;  1R0A A;  4KHN A;  4CJR A;  4DFM A;  4GNI A;  4QCL A;  4JKG B;  2JLE A;  4F2S A;  1ZBS A;  1Q8I A;  4CJW A;  2IDO A;  1NJX A;  2Q3S A;  1UA0 A;  1VSI A;  2Q2R A;  1JLF A;  5AZI B;  5M1O A;  5BRE A;  3H1V X;  4BDY A;  3UKR B;  2D0P A;  5KTQ A;  3TTD A;  4JKE A;  1FJG K;  2HVI A;  5JVL A;  4EP5 A;  1RFQ A;  3A5M C;  3LDQ A;  4AHU A;  2HHW A;  3FE1 A;  3HST B;  2BDP A;  3DXK A;  4NLB A;  3OYK A;  3AAQ A;  2OA8 A;  4CGI A;  3CIP A;  1C0U A;  2YNF A;  4G9Z A;  4BRM A;  3IMX A;  4CZH A;  2ZGY A;  3D2F B;  3OYJ A;  2NRT A;  1BL3 A;  4ZHR A;  4KTQ A;  1XQS C;  4IG3 A;  1REV A;  1UAX A;  3JS6 A;  4JLH A;  3WNH A;  4IOX A;  4I2P A;  4LFC K;  5J1E A;  3VES A;  3CCM N;  4I7F A;  2ASO A;  3LP1 A;  1RT2 A;  1NU0 A;  3OY9 A;  3GBT A;  3K5N A;  3THV A;  2J4R A;  2HST A;  1N6Q A;  3VF6 A;  4BRD A;  1WAJ A;  3GG4 A;  3O3H A;  3EPY A;  3HP6 A;  3V9U A;  1XUP O;  3U7D A;  1VSD A;  3TSQ A;  4DV0 K;  5JMV A;  4UY8 O;  4KHQ A;  4BRG A;  2P9U B;  5AQS A;  3CJ1 A;  1K8K B;  5CYM A;  4CD3 A;  4M3Z A;  3FZK A;  3J7Z O;  2YHY A;  3WA0 A;  3QET A;  3CJA A;  3MXM A;  3CER A;  2P9K A;  2QM1 A;  1ST7 A;  1UOC A;  4DUY K;  4CCH A;  2BH1 A;  5M1K A;  3PV8 A;  1J53 A;  2EWS A;  4DR6 K;  2V51 B;  3AVA A;  3SK3 A;  3NGI A;  3DM2 A;  4PKI A;  4Z4E A;  3NH2 A;  2KFZ A;  1YTU A;  4K0K K;  3L0Q A;  1S1U A;  1NGJ A;  4CVN E;  4FJ9 A;  2CGK A;  4B1U B;  5J2Q A;  4KB0 A;  5AJ3 K;  3H3N O;  4YNQ A;  1NGB A;  3WT0 A;  4M3U A;  4JRP A;  3QDK A;  2NUB A;  5AQG A;  3F5T A;  2HMI A;  4JKG A;  2YNH A;  4E19 A;  4JN4 A;  3QIN A;  4FOI A;  3PIO L;  3TU5 A;  4CJF A;  4DXA B;  4KTZ A;  2ITM A;  4E1M A;  4Z0U A;  1RTD A;  4FLT A;  1DLO A;  3HZ6 A;  3UKR A;  5HBM A;  3K5M A; 
#chains in the Genus database with same CATH homology
 3CQX A;  3N4P A;  4JKC A;  3GDQ A;  1BG3 A;  3KWI A;  4YOT A;  4YOY A;  1QZ5 A;  1ESV A;  1NLV A;  1MWM A;  2GX9 A;  3F2K A;  1T3V A;  1VQ8 N;  1BA1 A;  3EE8 A;  3J8A A;  3KHY A;  5BRD A;  4WCE L;  2HRJ A;  2YI1 A;  1J6Z A;  3TTC A;  5ADX H;  1GGO A;  2A5X A;  1KAY A;  4IDH A;  2OTL N;  5LJW A;  2A3Z A;  2RHK A;  2CB8 A;  2P9S A;  4CJ7 A;  4CD1 A;  4NLC A;  2AL6 A;  4A5B A;  3MX5 A;  4BR5 A;  4HDO A;  1TYQ A;  1K9M O;  3NVM A;  3D2F A;  1D4X A;  4WQ5 A;  1K73 O;  2ZF5 O;  4HTL A;  1LCU A;  5C0Y A;  3MK6 A;  3HOT A;  1Y64 A;  5AQP A;  2YHX A;  5KQD A;  2V52 B;  1EO1 A;  2VGN A;  1V4T A;  2P9S B;  4PKH A;  3VTI A;  4GV3 A;  2HOE A;  5E26 A;  3O9R A;  3IUC A;  3O08 A;  1VQM N;  3R3L A;  3U9Z A;  5BPM A;  1TYQ B;  3H6E A;  4XH4 A;  4PL7 A;  4KBO A;  2ABD A;  3ZYY X;  1NWK A;  2HF4 A;  2QW9 A;  1DT9 A;  3R6M A;  3CCL N;  1NI2 A;  1XC3 A;  4H0O A;  3CCQ N;  1T6D A;  4FL9 A;  4MDA A;  4DCH A;  4WQ5 C;  1CZA N;  2R82 A;  4NB4 A;  1ISN A;  1M1K O;  1VQN N;  1VAZ A;  5FPM A;  3U9D A;  1YJ9 N;  1NGH A;  1QQM A;  2D0O A;  4XH5 A;  1VQ7 N;  3VER A;  1Q82 O;  4BRQ A;  4AM7 A;  4P7I A;  3CF5 L;  1K8A O;  4QS8 A;  4BR4 A;  2AP1 A;  2QEX N;  1H4R A;  5EX5 A;  3T69 A;  3P4I A;  3WUH A;  5JIC A;  2FSJ A;  3G4S N;  3E9L A;  3GE1 A;  3EKU A;  4A5A A;  4EFH A;  4K42 A;  3BUZ B;  1HBK A;  2P9L A;  2NNW A;  4BRI A;  4IO9 L;  3CI5 A;  3ATV A;  3MCA B;  1BU6 O;  3VEY A;  5E84 A;  2HBJ A;  2NZT A;  1GC6 A;  2CH5 A;  3ZET A;  2ZJR L;  4BY9 C;  4B1Z A;  3TTF A;  2FXU A;  3PZD A;  2NRH A;  3IKM A;  4BC5 A;  4I6M A;  4C23 A;  5F0X A;  5JLF A;  4BRP A;  4F7G A;  4YOX A;  3LDL A;  4U7B A;  3QIJ A;  3LM9 A;  1G99 A;  2HBK A;  3VET A;  1ACA A;  5AQO A;  4JKH A;  2E2Q A;  3TSU A;  5AQL A;  1HKB A;  1QZ6 A;  2Q36 A;  2FDQ A;  4CZJ A;  1YF5 L;  3M5R A;  1DIK A;  2ASM A;  1H1V A;  4JKF A;  2P9L B;  3MN5 A;  2NRV A;  3SAG A;  3M1F A;  5KPT A;  4JHD A;  4OO1 J;  1NGA A;  4CBX A;  3ZET B;  4FWK A;  2BTF A;  2CGJ A;  4EAH D;  5ELZ A;  4KH6 A;  4B1V A;  4I6M B;  3IVF A;  1GLB G;  3MWT A;  2NLX A;  2JWK A;  3OW2 M;  3WXL A;  1SGH A;  3VEZ A;  4GV6 A;  1E5W A;  3O9S A;  3GOI A;  4BGA A;  4WFA L;  3FR0 A;  2E88 A;  4XH1 A;  3L4I A;  2FF3 B;  3B8A X;  1Q7Y O;  3P38 A;  3X23 A;  4JHD B;  3ID6 A;  3QFP A;  3LDP A;  5TKW A;  1T44 A;  5HOO A;  4FWO A;  3FLV A;  4A2A A;  4BG9 A;  1HB8 A;  2DIK A;  2A41 A;  3KK7 A;  1O13 A;  2QWL A;  1MIX A;  2QWM A;  4ILG B;  5CR4 A;  4NO7 A;  1YIT N;  4A62 A;  3CMA N;  4FO0 A;  1BO5 O;  4PKG A;  4KH5 A;  4MLE A;  1JCG A;  4MDB A;  3AU4 A;  2E2N A;  2QA4 N;  4BQZ A;  4J8F A;  4BC3 A;  2D10 A;  3CPE A;  3AU5 A;  4K25 A;  3R8E A;  4FWS A;  3CC7 N;  2A6A A;  3SLC A;  3VEV A;  4WFN L;  5AFU A;  5C15 A;  1BOT O;  1NGE A;  3C6A A;  3C0B A;  3D7E O;  3QBX A;  4WYB A;  2YJF A;  1YHQ N;  3U8Z A;  3MN9 A;  4H0X B;  2FJ9 A;  2HF3 A;  5AQW A;  4BR0 A;  4FSV A;  3QIC A;  3I33 A;  3E1Y A;  4IJA A;  1EF1 A;  4BQL A;  4DB3 A;  3KZB A;  4BR7 A;  4EIA A;  3CCJ N;  2UYT A;  3VEW A;  5GIN A;  3BEX A;  3EL2 A;  3MN7 A;  3C6H A;  1W2B M;  1MK9 B;  4BR2 A;  3SJH A;  1QQN A;  1Q86 O;  1HKC A;  1Q18 A;  4HDQ A;  3ULE B;  5KPZ A;  3E9P A;  1NM1 A;  4M63 C;  3Q7C A;  3JXU A;  1IG8 A;  3RSE B;  3EZW A;  4WFB L;  2A40 A;  3CCR N;  3AGR A;  5H1S Q;  3H46 O;  3ZEU B;  2E1Z A;  1YJN N;  4TKN A;  1VQ6 N;  3W0L A;  2E2O A;  5AZJ B;  3O4W A;  1J19 A;  4H0Y B;  5EY4 A;  4H0T B;  1DKG D;  4IEE A;  1KBL A;  4BRN A;  1M90 O;  2OTJ N;  1SQK A;  2RE2 A;  1YAG A;  5EXW A;  3VF2 A;  4B1W B;  4IFE A;  4E1J A;  1GLA G;  2VWB A;  3EN9 A;  3PIP L;  3I55 N;  2IVO A;  3CC4 N;  4EKU A;  1S3X A;  2FSK A;  3UKU A;  4A61 A;  1ZC6 A;  3FZM A;  3FP5 A;  3WEE B;  4GXB A;  4CI6 A;  5AQF A;  2LBB A;  2GWJ A;  4CZG A;  3SMS A;  2I1K A;  1VBH A;  2FLO A;  4BGB A;  3VTH A;  1KAX A;  1QVG M;  2EMS A;  3W3D A;  2KHO A;  3IDH A;  5CE3 A;  4FWQ A;  5FPD A;  3EO3 A;  2V7Z A;  4H5R A;  4ISE A;  3SBG A;  1GG3 A;  2OAN A;  4MO4 A;  4BVO A;  4XEI A;  3OBW A;  3UKU B;  2ZPY A;  1HKG A;  1NBW A;  4O8U A;  3CCU N;  2CGL A;  1NMD A;  1JDE A;  1SS6 A;  5M1Q A;  4B9Q A;  3FFK B;  2Q0R A;  3CHW A;  1T6C A;  3CJB A;  1EQY A;  3FLC O;  5EOY A;  1NTI A;  4EHU A;  2YCH A;  2GEL A;  1GLC G;  4BRH A;  3VGL A;  4NY0 A;  1JCE A;  5BRH A;  2E20 A;  2X0S A;  3ZX2 A;  4IOC L;  5AQR A;  1HLU A;  3N4Q A;  5JVH L;  5BPL A;  3O1B A;  1OVY A;  5LY3 A;  3CCS N;  3LL3 A;  1JJ2 M;  4ISF A;  4OPH A;  3NMU A;  4CBW A;  2NRR A;  1VQP N;  1DEJ A;  3E66 A;  4M7X A;  1RDW X;  3ENO A;  4BC4 A;  1KD1 O;  1BWF O;  1NGG A;  2PBD A;  5GIP A;  4PHT X;  3CCV N;  4GV9 A;  2QXL A;  3NVK A;  4C1N I;  4H5T A;  4O8K A;  3WXI A;  5C10 A;  3WQU A;  2IVP A;  3CQY A;  5AQZ A;  3HBT A;  3G9W A;  3C7N A;  1E4G T;  5C2D A;  3KVG A;  2F9T A;  3VOV A;  2F9W A;  4YOW A;  4H0V B;  4YL8 A;  1KAZ A;  4JKD A;  3BF1 A;  1QHA A;  3D2E B;  3R9P A;  3HRG A;  3OBY A;  5F1X A;  2NRZ A;  5GAD P;  1YJW N;  2W40 A;  5C2F A;  2NRX A;  5BN9 A;  3SAF A;  4IOA L;  3CD6 N;  1S72 N;  1RGI A;  5GAG P;  4R79 A;  3OHR A;  3C7N B;  1ATN A;  4CZL A;  3UE5 A;  4JK7 A;  3E9O A;  2GTD A;  4FWR A;  4JEP A;  5LJV A;  1RDU A;  2H3G X;  3CET A;  1GLJ O;  2HBM A;  3A0I X;  3BP8 A;  4ZRJ A;  2FSN A;  3O5B A;  4H03 B;  1WOQ A;  4H5W A;  4BR9 A;  3TSP A;  1Q81 O;  2AEH A;  1VQK N;  4BC2 A;  1HJO A;  3S41 A;  1U6Z A;  4YDU A;  5DM6 L;  1DGK N;  5AQI A;  3O9T A;  2WUS A;  4RCH A;  3CXC M;  4FOE A;  1BA0 A;  4ILJ A;  5ADX A;  4CZM A;  4BRK A;  2IIR A;  3QB0 A;  5JLH A;  4DHY A;  5EVZ A;  3WQT A;  2NRW A;  4FWN A;  4QS7 A;  3G71 N;  1YVN A;  3O80 A;  4B1Y B;  2ZJP L;  2GUP A;  2YHW A;  4C1N K;  5DM7 L;  2AA4 A;  1P8Z A;  4JK9 A;  3MX2 A;  3FZF A;  1VBG A;  3FGU A;  3FZL A;  4O5F A;  3A5N C;  4HWI A;  4WQ4 A;  3DAW A;  3MN6 A;  4GY2 B;  1ILY A;  3LM2 A;  4YOU A;  5KQ8 A;  2HBL A;  5BR9 A;  3SMP A;  1VQL N;  3ZX3 A;  2E2P A;  1SAZ A;  1OKJ A;  3KWG A;  4DQ8 A;  4CZK A;  3ULE A;  3HM8 A;  3HSC A;  3MCP A;  3UB5 A;  5F2R A;  1QQO A;  4JAX A;  2I7N A;  4JK8 A;  1KC8 O;  5M1P A;  4JKB A;  2P9K B;  3RSE A;  3O9U A;  2WH5 A;  1X9J A;  1Z6R A;  2J0K A;  5C12 A;  4BRO A;  3ZEU A;  4KH4 A;  4MLH A;  1QVF M;  1ATS A;  3C65 A;  2PAV A;  5AZJ A;  3AAP A;  5AQT A;  1KXP A;  4FVU A;  4K41 A;  2YJE A;  4WQ4 C;  1YI2 N;  3H45 C;  4BVP A;  1MWK A;  2I1J A;  2KLA A;  1KQS M;  1TUY A;  4FWM A;  4ZRK A;  3VEO A;  4BRA A;  2Q1N A;  4Y0W A;  1X3M A;  1GLL O;  2QWO A;  4QS9 A;  2WC9 A;  5AQJ A;  5BPN A;  2D2Q A;  2DPN A;  2J0J A;  3T7Z A;  2HMP A;  1JCF A;  5AQM A;  2J0M A;  3CJ7 A;  1GLE G;  3WEE A;  2P9I B;  4Z94 A;  5M1N A;  4IWV A;  5HL7 L;  3ENB A;  3A5O C;  5IJM A;  4WF9 L;  3PLA A;  1NGC A;  2ASP A;  3M6G A;  5AR0 A;  5AZI A;  3VPZ A;  1SZ2 A;  4EHT A;  3Q7B A;  4ISG A;  5CHI A;  4GNI A;  1MDU B;  4JKG B;  3WXJ A;  3H1Q A;  4PL8 A;  1ZBS A;  1VQ5 N;  4IO8 A;  4FWL A;  3I8B A;  2PFU A;  2Q2R A;  4YOR A;  5AZI B;  5M1O A;  3WXM B;  1NGI A;  3H1V X;  5BRE A;  3UKR B;  3ZX0 A;  3SAH A;  2D0P A;  3U8X A;  5AQU A;  3TTD A;  4JKE A;  1YUW A;  1MA9 B;  5AQY A;  4LC9 B;  2QWP A;  1VQ4 N;  1U2V A;  3K9J A;  5AQX A;  4A2B A;  3ATU A;  1VQ9 N;  1YIJ N;  5JVL A;  4IJN A;  4H5N A;  3BIN A;  4CBU A;  1RFQ A;  2V7Y A;  3A5M C;  2JWL A;  3LDQ A;  3R1X A;  5AQV A;  3FE1 A;  3WXK A;  5AFU H;  2COP A;  1LOT B;  5AQK A;  2CH6 A;  2Q97 A;  3DXK A;  4NLB A;  4A57 A;  5AQN A;  3AAQ A;  3A5L C;  1U2V B;  3QML A;  3CIP A;  4A59 A;  1GLD G;  4G9Z A;  2GWK A;  2I7P A;  3IMX A;  4BRM A;  2ZGY A;  3D2F B;  1ZXO A;  4CZH A;  1KC7 A;  1WUA A;  2NRT A;  3DXK B;  3D2E A;  3L4Q A;  1XQS C;  3EE9 A;  4CZI A;  3O6W A;  5B8H A;  4ZRI A;  2D11 A;  1S22 A;  3L6Q A;  3O9Q A;  3VEX A;  3PVL A;  3VF4 A;  1N8R O;  3EKS A;  3JS6 A;  3D6R A;  5M1F A;  3G6E N;  3AGK A;  2VCP A;  1MK7 B;  3RVC A;  4IOX A;  4FPB A;  2QWQ A;  1C0F A;  2RQ1 A;  3DJC A;  3QBW A;  3DXM A;  4IXC A;  5KPR A;  5GAH P;  3VES A;  1YXQ A;  3VGM A;  3FZH A;  2HE7 A;  4FPA A;  4K43 A;  2P9P A;  1BUP A;  3SBT A;  3CCM N;  3VMF B;  2FF6 A;  2ZGZ A;  3DWL A;  3MMV A;  3CJ9 A;  3AY9 A;  4L3Q A;  3CME N;  2ASO A;  5TKY A;  4BRF A;  3GBT A;  4AM6 A;  1TUU A;  2J4R A;  2P9U A;  2HST A;  3TPQ A;  3HI0 A;  1K8K A;  3VF6 A;  2A42 A;  4BRD A;  3GG4 A;  1P90 A;  3ENH A;  1GC7 A;  2IVN A;  3DXM B;  4OPA A;  3EPY A;  1C0G A;  2W41 A;  4H5V A;  4M7Y A;  5FPN A;  3VGK A;  4B1X B;  1XUP O;  4BRE A;  4BRL A;  3CCE N;  3U7D A;  3TSQ A;  2P9P B;  3MWP A;  2F7T A;  5FPE A;  5MLC Q;  5JMV A;  4UY8 O;  4DKW A;  1HUX A;  2ZWH A;  3M3Z A;  3VEN A;  4BRG A;  3LDO A;  3I56 N;  3H3O B;  1VQO N;  4IZ9 A;  4H0P A;  2P9U B;  5AQS A;  3CJ1 A;  1K8K B;  2E8A A;  2WBN A;  3K9K A;  4CD3 A;  2QTD A;  5BN8 A;  2VYP A;  1Y19 B;  3FZK A;  2Q0U A;  4IEI A;  2EMT A;  3ID8 A;  3J7Z O;  1V4S A;  2YHY A;  3P39 A;  3WA0 A;  3G25 A;  4RWT A;  5AQQ A;  3DLL L;  3CJA A;  1NGD A;  2QI2 A;  3IFR A;  1X3N A;  3CER A;  3F9M A;  5AQH A;  4CZE A;  3GL1 A;  2YVC A;  2P9K A;  2QM1 A;  1ST7 A;  4AF1 A;  2VGM A;  2BUP A;  3O1W A;  3O8M A;  1ATR A;  2BH1 A;  3CC2 N;  3AAR A;  3BF3 A;  5M1K A;  1E4F T;  2QWN A;  4CZF A;  1BDG A;  4JNE A;  2EWS A;  1NJI O;  2V51 B;  3HTV A;  3SK3 A;  3U4L A;  4YDU C;  2CQU A;  2ZJQ L;  2P9N A;  4JD2 A;  4PKI A;  5I9E B;  3QFU A;  4YOV A;  3A8Y A;  1GLF O;  5GIO A;  2KKZ A;  3LDN A;  4BG8 A;  3L0Q A;  2GEM A;  1NGJ A;  2D4W A;  3MDQ A;  3CPW M;  2P9I A;  1MIZ B;  1IJJ A;  1NVL A;  2D1K A;  2CGK A;  4B1U B;  3H3N O;  2QWR A;  2P9N B;  1NGB A;  4JD2 B;  3WT0 A;  3QDK A;  1HB6 A;  1HPM A;  2YX6 A;  3F5T A;  1HX1 A;  5AQG A;  5GAE P;  3P31 A;  4GVE A;  4CYE A;  2WFB A;  4JKG A;  3PIO L;  4JN4 A;  2Q31 A;  4FOI A;  5BRF A;  3TU5 A;  1Z05 A;  5JVG L;  4RTF D;  3CJC A;  4DXA B;  3OA9 A;  1NGF A;  2ITM A;  2E1Y A;  4F9O A;  1W97 L;  4ILH A;  3ZDT A;  3HZ6 A;  4MO5 A;  3UKR A;  4BRC A;  4JKA A;  4U67 L;  1R59 O;  4FWP A;  3HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...