4JK8A

Open and closed forms of r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk8A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk8A01
4JK8A 4JKGB 4JKHA 4JKFA 3E9PA 4JKBA 4JK9A 3ENBA 3E9LA 4ILJA 4ILGB 4ILHA 4JKEA 4JKCA 4JK7A 4JKAA 3E66A 3E9OA 4JKDA 4JKGA 3SBTA 3SBGA
chains in the Genus database with same CATH superfamily
1BDGA 4H0YB 4DS5A 4JS4A 4CCHA 1TV6A 4CEBA 1NK5A 1QSLA 3HYFA 3PIPL 4A5BA 1HKBA 1NGIA 4Z4HA 3QBWA 4CJKA 5AJ3K 4RWTA 3WA0A 3ATVA 1VQLN 4KHWA 3ZSZA 4DQQA 1NK0A 4FVUA 3LPUA 4FWSA 3OYDA 4FJNA 2PY5A 4OX9K 2IVOA 4BRFA 1C0GA 1TYQA 3IUCA 3DRRA 4CJ4A 3F9MA 2IS3A 4A59A 3EKUA 1ATRA 1XC9A 2Q1NA 2P9SB 4K25A 5AQNA 5AFUA 1OVQA 1BUPA 3KVGA 3ZSRA 4DG1A 1RBTA 1BCMA 3EZ5A 4BDYA 4F2RA 2EMTA 4XIUA 3S3MA 2FDQA 2YHYA 4H5RA 1DIKA 2OTJN 2OTLN 2GELA 3SLCA 2HNYA 4B1UB 2B5JA 3SQ1A 1FW6A 3FZLA 2A3ZA 2XO7A 5EY4A 4FK2A 1KLNA 3LWMA 4OKEA 4FJ5A 1EKEA 4KFBA 3FFKB 4H5VA 2NRVA 1VSLA 5J2PA 2O8DB 3IG1A 1NG9A 5JS1A 3LDQA 2R82A 4CEQA 3T1HK 1HPZA 3EL2A 3KZBA 2XHBA 3SQ2A 1WBDA 3L0QA 3O9TA 1S1VA 4JD2A 2O8FA 4DFPA 3FP5A 4WF9L 1C0UA 3H1QA 3O4QA 5K14A 2G8WA 3TAGA 3CQ8A 5AQOA 1I39A 3AVAA 3SQ4A 2P9PA 2YJEA 3AA5X 4CJLA 4K8ZA 1B9FA 3LDSA 2RKIA 1SL1A 4B9VA 2CGJA 2ETJA 2P9NA 3OYKA 3C94A 2ASMA 3DAWA 3VF2A 3C7NB 4KTZA 4ZRJA 3KLIA 1YUWA 4DQRA 3MX2A 4FLXA 4DTJA 3QERA 3O9SA 3O3GA 1VQNN 1R0AA 3KLGA 4OJRA 4BWMA 3QIOA 4KB1A 4UY8O 3FFIA 3B6OA 5KQ8A 3I0RA 4JI0K 4FL9A 1NK8A 2E2NA 2OZMA 2RQ1A 3H3NO 2NNWA 3NF9A 4NLCA 3TTFA 4I9QA 3CFRA 2QTDA 3SV4A 3UB5A 3WXLA 1IKYA 3AVBA 3DRSA 4CK3A 2DFHA 2KW4A 2GX9A 1RT6A 1MIXA 5SWMA 1H1VA 2RE2A 3CFOA 4BGAA 4N56A 3SAFA 2QKBA 2F4VK 3OYLA 3HP6A 3EZWA 4CZKA 2HF4A 4NYNA 4NCAA 1FXXA 3FZKA 3L3UA 1RBSA 3K5MA 1CZBA 4GV3A 4CJWA 3PSIA 1C1BA 4A57A 3CMEN 1N8RO 3I8BA 3WT0A 4A2AA 1A5VA 1WN7A 1VQKN 1W7AA 3EE8A 3KJVA 3ALYA 4OPJA 2GUIA 1VQMN 4JRPA 2IIRA 4MLEA 2P1JA 4DSLA 1HJOA 4KI4A 1LAWA 1Z05A 4QOZB 3BF3A 4FVMA 2P9UB 4LSNA 1DLOA 3VEZA 2FXUA 3CM5A 3NGYA 1ZBSA 4CZGA 2QEXN 3LDNA 4RW9A 2HHXA 5J2NA 4HUGA 2P9SA 2ZGYA 3CCUN 4FPBA 3ZT4A 3KWIA 2P9LB 3SUOA 4BY9C 3QIJA 4FJ8A 4J2DA 3MEEA 2E6LA 3QEIA 2O8BB 5JVGL 3VA3A 3O4WA 4CHZA 2Z1JA 2IGIA 3T19A 3DXKB 5AR0A 5HRNA 3AGKA 2VWKA 4C8NA 2FLOA 3HRGA 2D5RA 4H4MA 3G6EN 3IKMA 1XWLA 4ZRKA 4FPAA 2ZE2A 3EO3A 1JCFA 2DFEA 4E3SA 2VG5A 1I3AA 4BC5A 3LM9A 3PLAA 2I1JA 3I0SA 5KQDA 1D9DA 3AA2A 4IDHA 3SI6A 2NLXA 4KHSA 3DLLL 3HT3A 1XI1A 4BQLA 4B9LA 3LZJA 1E3MA 4H5NA 4FZYA 4LF8K 3MEGA 2KKZA 2Q36A 2YNGA 5B8HA 5C10A 1N6QA 3UE5A 4KPYA 5JLFA 1GLLO 1U4BA 1RGIA 4CEFA 1BI4B 4JK7A 3KLFA 2A6AA 3C7NA 3I33A 3KK7A 1Q9YA 2E1YA 1RBVA 2HOEA 4GVMA 2D2QA 3NGZA 1GG3A 3B8AX 3QEWA 1GLFO 2E2PA 4O55A 5BRDA 3I55N 3JAMO 4YHHK 1BA0A 2FJ9A 1S6PA 3HOTA 3CCMN 4B9TA 3C6HA 4CW7B 3X23A 1EWQA 4M41A 4JI2K 3SMSA 3TANA 4DXAB 4YOTA 3ULEB 3VQ4A 5ADXA 3HP9A 3K9JA 3K0SA 1YXQA 5CYQA 4DCHA 1T03A 4ID5A 1NTIA 2A42A 4HDQA 2HBKA 4DF4A 4FXDA 3LALA 4NCBA 3SBTA 1KC8O 5HRPA 1QQNA 4I2QA 3KWGA 2NRRA 1EP4A 3V81A 3MCPA 1TKXA 4IG0A 5FPDA 4BC4A 1L3VA 3QESA 1X9MA 4FZXC 4BR0A 3ASMA 2OPQA 1VSEA 1QVFM 1BWFO 5HRSA 4O0JA 3LP2A 3LL3A 1KAXA 3HL8A 5M1NA 3K58A 1JLEA 1XUPO 3A5NC 4OPHA 2HVHA 1HQUA 4GKJK 5DK5A 4JKGB 3VETA 1NJZA 1KVAA 3OYEA 4JKHA 4CHPA 1WSJA 5LJVA 4CGIA 4A61A 1NGEA 5HL7L 1KVBA 1QS4A 5KTQA 3PIOL 1OH6A 4CERA 4KREA 1EXQA 1GLCG 4DTMA 2P9UA 2NUBA 4CEAA 5CHIA 4DR3K 3FZHA 4ZRIA 1RT1A 4H5TA 2CB8A 1C0TA 2VQEK 4W5QA 3WUHA 4XH1A 2VWJA 3HTVA 5JICA 1MWKA 2Q2RA 3ENOA 2P9LA 4GMJB 4AHUA 4QCLA 2E8AA 4WCEL 4C8MA 4FYDA 5AQKA 3WXIA 4B9NA 3ZT0A 3TI0A 2O8BA 1UOCA 1JLCA 1DT9A 1WLJA 3ZX0A 3DXKA 1KQSM 4CD1A 3KKRA 3O4NA 4J2EA 4H8KA 2D0AA 3L4QA 4Z94A 4NCGA 3RMAA 3HZ6A 4CEEA 3VQCA 1VSJA 3OA9A 4JK9A 3V6DA 1IO2A 1VQPN 5E41A 4UQGA 3QO9A 2RHKA 4CJ7A 4E7IA 1EX4A 2HBLA 4O8KA 2AJQA 4BQZA 3U4LA 3O3HA 3QFUA 3V9ZA 4KHNA 1IG8A 1WSIA 2HSTA 1TKTA 2VCPA 3M1FA 1BOTO 3AU4A 4GNIA 2IVPA 3NF8A 2RN2A 4B3MK 1J5EK 3E9PA 2A1SA 4C1NI 3RTVA 2F8SA 2B4JA 1DGKN 4CFBA 4IOAL 4DFKA 1BI4A 1T7PA 3O1WA 3TSUA 4BDZA 1L3SA 2CH6A 2E20A 5KGXA 4ZHRA 1FJGK 3K2PA 4AHRA 4H03B 5AQGA 1VBGA 1XC3A 2A5XA 1X1PA 1ZYQA 3AO2A 1IBMK 4H0VB 4CGDA 4EP5A 4JI3K 2Z1IA 1NOZA 3ZSYA 1FK9A 2IOCA 3H46O 2GBZA 4KKOA 4Q5VA 2OZSA 3CQYA 1YTUA 1TAQA 3F2KA 4JKCA 3A8YA 3RWUA 3PX6A 4E19A 2E1ZA 4MLHA 2FSKA 1GLBG 3KLEA 4DTOA 1S1XA 5I42A 4K41A 5BN8A 2XY5A 3CFPA 1IBLK 1KAZA 3Q7BA 4N5SA 2E4LA 2WUSA 4CZIA 3G25A 1TL3A 4ISGA 4JI4K 2V7ZA 3K59A 4DSFA 4IEEA 3ZSQA 1IJJA 3V9SA 2FBVA 2CGLA 5FDLA 4CECA 4CZHA 4I7FA 5F2RA 3ZLJA 3JS6A 3PX0A 3OBYA 3VEVA 4GW6A 1N34K 3THWB 3AV9A 3VTIA 3ZSWA 1VBHA 5H1SQ 1H4RA 3SPYA 3TARA 2JWLA 3O9UA 3VF4A 2QXFA 2QWMA 1NK4A 4LSLA 2ASPA 2O8FB 1FKPA 4BRCA 5AQYA 3MMVA 5A2QO 4C8KA 4LF4K 2ZWHA 4WE1A 1DEJA 1U04A 5FPMA 5KPRA 3DOKA 4ILHA 1K8KB 3S41A 4FO0A 1GLAG 1NVLA 5HBMA 4E7JA 1QVGM 1ZBUA 3CJCA 4EP4A 1U2VA 2P9IB 1WUAA 4DB3A 4O44A 4WFNL 1ZBLA 2GV9A 4KAZA 4M3ZA 3K5NA 4AQYK 4RTFD 2OPSA 1QQMA 2NRWA 4BR9A 1HMVA 3HI0A 1TK5A 3KIOA 2WC9A 3CJ7A 4OGEA 1TGOA 4DTNA 1ILYA 1KRPA 4M63C 1YJ9N 1XNRK 3BZKA 1XHZA 3WQUA 4J8FA 2FBTA 2XRIA 4OPKA 1ST7A 1K9MO 4PKGA 1ITGA 1VSKA 2IDOA 1UA0A 2WBNA 2X0SA 1KAYA 4JI5K 1S9GA 4EHUA 1NGCA 1RDBA 3V1RA 4JKAA 2ASOA 1QQCA 4N47A 4JRQA 4EKUA 1R59O 5KRSA 4FK0A 1HNIA 2ZM6K 3B6PA 4CJ3A 1VSFA 2BH1A 5AQHA 3SPZA 3CCLN 2D0OA 4BG8A 1GOAA 3CMAN 3HM8A 2NRXA 3E1YA 4M3YA 1VQ6N 3I8DA 5C2DA 2LBBA 3AO4A 2VQFK 4FLZA 1YHQN 3E9OA 4BDPA 4CVNE 1B92A 3GG4A 1RDCA 3VENA 1U49A 3CJAA 2I7PA 4FWOA 4B1ZA 1C6VA 3TSQA 1KLMA 5AQSA 5AQXA 4OO1J 4JKFA 4CZEA 3LDPA 3PX4A 2YHBA 4NXMK 4BREA 1KFDA 2HRJA 4FZZA 2O8CB 3KK3A 3U9DA 2YV0X 5IT9O 4EHTA 4GKKK 3M8QA 1EETA 3T1AA 4IFYA 2QA4N 3S3NA 1WOQA 1KTQA 1XNQK 2BTFA 4B3TK 3W0LA 3DLGA 4K8XA 4PHTX 1TUYA 2YHXA 1HQEA 3DRPA 5HLFA 1YITN 3K5LA 1GLJO 2KLAA 2XY6A 1HNXK 3THWA 3M8PA 1VAZA 4CJUA 4JS5A 4ZTFA 4BRIA 3D0PA 4Z0UA 4JI6K 4IJNA 3RMDA 3ZT2A 3AVHA 1U47A 4XH4A 4H0XB 3QLHA 4FWLA 4KBOA 3TWHA 4JYAK 1LW0A 3TR8A 4DTUA 3TAEA 4AHSA 1K8KA 5D3GA 1ZBHA 1DKGD 1NK7A 3HJFA 5AQQA 1W0HA 3MCAB 4R79A 2P9IA 5JMVA 4W5NA 4HTUA 3SBGA 1REVA 2P5OA 1C1CA 4DSEA 2A1RA 3A2FA 1XMOK 3KTQA 4WQ5C 3MEDA 1YT3A 3WQTA 3CPWM 4Y0WA 2P5GA 3NH2A 3DI6A 4DR1K 4AM6A 3FLVA 4OLAA 1A5XA 3OVNA 3CHWA 4IEIA 4HCCA 4QAGA 4PKIA 1BG3A 3NAEA 4E7HA 4BC2A 4DSKA 3V1OA 3J8AA 1RNHA 4LF5K 4OGCA 2NRTA 2ZJRL 3L2VA 4Z4FA 3U8ZA 4CFDA 3OY9A 4KH4A 2EX3A 2ABDA 4CJRA 3LANA 3ZYYX 3WNHA 4JLHA 4BACA 3NHGA 3A5MC 3H3OB 3S3OA 5AQZA 1D8YA 4L8RB 3TABA 4DR4K 5BRFA 3CJ1A 1VSMA 2FSNA 5EVZA 3CYMA 1NLVA 2HNDA 3CERA 5JVLA 1JKHA 2RPIA 1JLAA 4IFVA 3AO3A 3BZCA 2QKKA 5C42A 4JV5K 3VPZA 4YY3K 3J7ZO 3SNNA 3G4SN 4CBWA 3FLCO 4B3SK 2PAVA 4CZJA 1MU2A 4F9OA 3SK3A 4M3TA 3OJUA 3QEXA 3DYAA 4IO8A 1KCFA 4RW6A 4X66K 4MQ3A 4CGHA 4YDUC 1OKJA 1BISA 3E01A 2DIKA 1DTTA 2HHHK 4E1NA 1JLBA 3LPTA 1NK9A 5AQPA 3U3YA 1G15A 4IBNA 3WNFA 3FE1A 4M45A 4MO5A 2O4IA 3MX5A 3T7ZA 3P4IA 4LFBK 4BG9A 4MDAA 5AQLA 2YKMA 3C6AA 2O8CA 1G99A 3J7AP 3HK2A 4OPAA 5BREA 3AAPA 4DV0K 5C25A 5F0XA 3KK2A 4FM2A 4DHYA 5MLCQ 1TK0A 4J2AA 2ZJQL 3KKSA 3G0ZA 3R1XA 3VF6A 1JL2A 4FJGA 3DOLA 4FLTA 3HPHA 4BRKA 3EN9A 2WONA 2X78A 4DV6K 4WQ5A 1NGHA 2YNIA 4Z4IA 3GDQA 1YAGA 4CZLA 3S9HA 3SUQA 4CK1A 2QWNA 4DLEA 2J0JA 4DS4A 3H45C 3PV8A 2VGNA 1J5OA 5AQIA 3F73A 3IFRA 3QICA 3O9QA 1J19A 5AFUH 4M3XA 4F4KA 4DQIA 5E26A 2QK9A 5E84A 4PA1A 4QS8A 2PBDA 2PFUA 3DJCA 4CHNA 4DSJA 1GLDG 3ISNC 2D10A 1W2BM 1NNEA 5FPEA 2BE2A 3SZ2A 3TU5A 3VN5A 3HO1A 4DV2K 1C0MA 1JLQA 4LY7A 3HSTB 1EF1A 5KPZA 3FZFA 4ISFA 4EIAA 4JKBA 3BGRA 3LAMA 3HM9A 4B9MA 4KHPK 3P83D 1SKWA 1ZBIA 4C1NK 1X9JA 1S22A 2WTUA 4OLBA 4CBXA 4YL8A 2QW9A 4DTSA 2E6MA 3HXMA 4KTQA 1Z6RA 4CYEA 1EWRA 3U8XA 5M1KA 4LF7K 4YDUA 2J4RA 3D7EO 1Q81O 3MN5A 1RT7A 4C8OA 4HVJA 3ENHA 4CK2A 2HMIA 1HYVA 3SUNA 2HB5A 5KPTA 2V52B 1WSEA 4KHQA 4DV5K 1XQSC 2IVNA 4QS7A 5JVHL 1KSPA 4AILC 1HJRA 1QTMA 1K8AO 4RW8A 3IMXA 3TTCA 3OYHA 1S1WA 4B8AB 1TUUA 4GY2B 3GBTA 3THVA 1OH7A 2OPPA 4FK4A 2E2QA 5IJMA 2YNFA 5KRTA 5IWAK 2KFNA 3VQ6A 4V19S 1JJ2M 4DQ8A 3ZSVA 2Y1JA 1RBRA 1HX1A 3ZEUB 5AQTA 3IAYA 3C0BA 2HBMA 1U2VB 4IOXA 2I1KA 4O8UA 3OYBA 4BE2A 4BWJA 3DLEA 3NH0A 1CXUA 4ZTJA 4K0KK 1RDAA 4B08A 3J7YP 3RRHA 4A62A 4FJXA 4PWDA 4DFMA 4NB4A 3OS2A 5EOYA 4GVEA 3V4IA 5J2MA 3O5BA 4WQ4C 4KI6A 1VRUA 3TAMA 2KFZA 1CLQA 5LJWA 4YOVA 5KGWA 3NH1A 2PZSA 1Q86O 1SKRA 4JHDB 2DFFA 2F7TA 2BUPA 4B9UA 3LAKA 4PUOA 3OYAA 3L6QA 1HB8A 3VESA 5CE3A 3ZSOA 4F2SA 2AP1A 1S1UA 2OYQA 3U9ZA 1QSYA 3DLHA 3QETA 4YOWA 4IFEA 1TL1A 2FC0A 1D4XA 1CZAN 3P38A 1NI2A 5EU7A 3KD5E 2ZD1A 3AVGA 4BRAA 4CHYA 4KO0A 3QNNA 3ENBA 3SYZA 1JCGA 1T44A 4FLYA 2UUCK 2F96A 2DY4A 1VHXA 4CE9A 4OKKA 3CD6N 3OHRA 3AVLA 3HSCA 4B3OA 3IDHA 4AH9A 3VEOA 3VQDA 2Q0UA 3O9RA 1B9DA 3R8EA 3SUPA 3OJSA 1C1AA 4NY0A 4JAXA 3G9WA 1J53A 4FLWA 1I94K 3L4IA 3L2WA 3AO5A 1JLGA 1NJIO 4Q0BA 5C24A 3MN6A 3NGIA 1KFSA 4JI8K 4IXCA 1BU6O 1NKBA 2F9WA 3IS9A 3TTDA 2ITMA 5AQFA 3ITHA 4WFAL 3VEWA 1WNSA 2OCEA 1RT4A 5HOOA 4IWVA 3DXMA 2BDPA 3NF6A 4LFAK 5LL6Z 1T6DA 4CGFA 4JEPA 1E5WA 3E9LA 3CM6A 4F8RA 1VQ5N 1TKDA 1X3MA 2QM1A 3MN9A 1C0FA 3C65A 4DQPA 3K57A 1L3UA 1LWFA 4KH5A 3BINA 2VGMA 4GXBA 4CJTA 4Z4GA 4JKDA 3P31A 4FM1A 1S5JA 1NGFA 3C6UA 3MK6A 2KZZA 1ZXOA 1SL0A 3N4PA 4WQ4A 1VSIA 4BR2A 1IG9A 3HBTA 2HHUA 5ADXH 4FWQA 3OW2M 1O1WA 3OYFA 2UXBK 4BE0A 3NBPA 4Y1DA 4RW4A 3ZEUA 1Y64A 2OA8A 1JL1A 4LH5A 3VQAA 1N33K 1T6CA 1S6QA 3RR7A 2CGKA 4P7IA 3QFPA 2HHWA 1Q7YO 3UIQA 4PL7A 5M1OA 1ISNA 3AY9A 2DTUA 3A5LC 1SQKA 3AU5A 5TKYA 4FJMA 1EO1A 1D5AA 2HHQA 2PYLA 5AQRA 4HUEA 1OH5A 1Q82O 5HROA 3ATUA 1NMDA 5FRNA 2VG6A 4M3RA 2O8EA 3AVIA 4CFCA 4FWMA 4CI6A 2W6LA 3O8MA 1BCOA 4FWKA 1L3TA 2E2OA 5GINA 4FOIA 4JHDA 3CG7A 4B9SA 3CQXA 1MDUB 4FCYA 3OYGA 3KD1E 3L2RA 3NVMA 5DM6L 2CH5A 1VQ4N 5EX5A 2X6NA 5BN9A 4HWIA 1HUXA 3D2EB 3AA4A 1J54A 3OYJA 5M1PA 3QEVA 3PY8A 3H1VX 3SV3A 5BRHA 5AQMA 4XEIA 4IKFA 1ASWA 2GTDA 4CEZA 4CZMA 4FM0A 5AQJA 4TSXA 1F21A 2NRZA 1W9HA 3MECA 2LSNA 1Z25A 4N41A 3Q7CA 1IKVA 4JKEA 3KHYA 4BROA 3D45A 1HNWK 3QBXA 2KTQA 3OBWA 4QS9A 1S9EA 1VRTA 2YHWA 5I3UA 3QDKA 3MXJA 3D6RA 3VGLA 5TKWA 2HBJA 1LAVA 1TKZA 3CJBA 1YTAA 1QQOA 5CR4A 3VOVA 3FR0A 4W5OA 1ATNA 3L8BA 3CCVN 3BDPA 4KB0A 3SQ0A 1HYSA 4BC3A 4H0OA 2IAJA 3WXKA 1SZ2A 4ELUA 3NMUA 3T1YK 1WSFA 3WXJA 1BIZA 1GGOA 4CHOA 1JCEA 4BR7A 3VQ9A 4DTXA 4KTWA 1J6ZA 2YKNA 1HYZA 4DR6K 3DWLA 2WFBA 1V4TA 1RBUA 3O80A 3OS0A 3M8RA 3L2UA 4BRLA 3F5TA 2NRHA 4G9ZA 4H0TB 3RSEB 1SAZA 1MK7B 4BRNA 2I5JA 1N5YA 2QWQA 3CC4N 4LH4A 2YCHA 3H08A 4JI7K 1IKXA 3TAFA 3CCQN 3V9UA 1NK6A 4Y1CA 3ZT1A 2A41A 3UKRA 3RMCA 4B9QA 4X65K 3RMBA 1VQ8N 2D0PA 4N76A 3CPEA 3UKUB 2UYTA 4CZFA 3JSMA 3VQEA 3WXMB 4DUYK 5M1QA 4H0PA 5C2FA 3OYNA 4FWPA 4BVOA 1LV5A 1A5WA 2Y1IA 2W42A 4EZ6A 4FJ9A 2QWLA 4I9LA 2JGUA 3JXUA 2UUBK 1WSGA 3VGMA 3IVFA 2IC3A 3EPYA 4XH5A 4M42A 2FBXA 1J9AA 4AHCA 4AM7A 2HVIA 4HHTA 4BRDA 4CBUA 3DMJA 3NDKA 3LDLA 2XY8A 3LM2A 5BPNA 4U67L 1LWCA 3IRXA 1GLEG 4L3QA 4H4OA 3ZT3A 3WEEA 4CIGA 1SV5A 2EHGA 5JLHA 2YX6A 4FJKA 4BGBA 4MFBA 4FW1A 3G71N 3MXIA 1BIUA 3M6GA 3FGUA 4HDOA 1VSHA 5KI6A 5BPMA 4CJSA 5J2QA 4KHUA 3BY5A 3L3VA 1WAFA 4CF9A 1SS6A 3TAPA 1BL3A 2X6SA 3CCEN 1GOBA 2HHVA 1RDUA 3W3DA 1VQON 2Q3SA 3D2EA 2I7NA 3K5OA 3SMPA 1IBKK 5C15A 1LW2A 3WNEA 3M5RA 2Q31A 4CF8A 2V51B 1NGDA 1M90O 5DMRA 5CZ1A 5BR9A 3J81O 2D0CA 1GC6A 3MWTA 1TK8A 1ACAA 1JDEA 1RFQA 1FKOA 3O1BA 2HW3A 3V9WA 4B1VA 3O3FA 4B1YB 3THYB 3SAGA 2COPA 3A5OC 1QHAA 1W97L 4BVPA 1UWBA 4DKWA 1NJWA 2EMSA 1MWMA 4HTLA 4DSIA 3VTHA 1NGBA 4BRPA 2ITGA 3OYCA 3H6EA 3JYTA 1N32K 1NKEA 3R6MA 4DFJA 1MA9B 1P8ZA 1TAUA 4X64K 2FBYA 1VSDA 5HP1A 4PL8A 4HCBA 1JXEA 1LOTB 2G8VA 3HVRA 1YVUA 3V1QA 4TKNA 1Q18A 3EE9A 1HBKA 5AZJB 2W41A 2J0MA 2Z1GA 2HNZA 5LMNK 1NKCA 2YVCA 1ESVA 1Z26A 3ZX2A 4ISEA 5GADP 3HPOA 2CQUA 3AARA 3I56N 2Z1HA 5BPLA 4O0IA 2OANA 3AVJA 4EZ9A 2W40A 3RSEA 4B1WB 2G8IA 3N4QA 4DU3A 4K43A 1HKCA 1TVRA 3CCJN 3P39A 4FJIA 1QHTA 4ILJA 2HHSA 4MO4A 3PO5A 4DUZK 1QZ5A 1YF5L 3CC7N 2AL6A 1ZBFA 4CF2A 1BGXT 3CXCM 3CF5L 1M1KO 1BO5O 3UKUA 3PVLA 4FOEA 3KK1A 1HNZK 4R5PA 1ASUA 1NBWA 4CIEA 2KQ2A 4FJHA 3EEQA 2G8UA 4JNEA 4IZ9A 1KVCA 3QMLA 1SGHA 4ELVA 4AHTA 2R7YA 5M1FA 3NE6A 2O8DA 3O6WA 1YIJN 4BRGA 2WOMA 4CJFA 2VWBA 4AHVA 5FROA 2QI2A 3J80O 3PZDA 1O13A 3PSFA 1U45A 2Q0RA 4MDBA 4O5FA 3AA3A 4CGJA 4B3RK 4CESA 3GOIA 4LFCK 1BQNA 2P9KB 1YI2N 4W5TA 3MN7A 3C95A 4U7BA 3AVNA 1RT2A 4DMNA 1S3XA 4Z4CA 4DF8A 1U6ZA 2GWJA 5AQVA 1DTQA 4LD0A 3NF7A 4KHYA 3ZETB 3K9KA 1Q8IA 4E1JA 4YORA 3P1GA 4O4GA 3ID8A 4I6MB 1HPMA 4ELTA 4CIFA 3SAHA 2D4WA 4CF0A 1RT5A 5AZIB 3MAQA 1RTHA 5GAEP 4M3WA 3GE1A 4OVLA 4FJLA 4E0DA 4F3TA 3DXMB 4RG8A 1KBLA 2VG7A 2G8KA 3MDQA 4FSVA 4BRHA 4DQSA 1LCUA 1ASVA 1XHXA 5AQUA 4PY5A 2JWKA 1RILA 4IJAA 3NFAA 4DWIA 3SCXA 2F8TA 4PKHA 4ICLA 2ZGZA 4YFUA 4GV6A 1RDWX 4FWRA 1BQMA 3NVKA 3AVCA 3EY1A 1QSSA 4H5WA 3WNGA 2YI1A 1RCHA 2GUPA 5CYMA 1NU0A 2YHAA 1U48A 3THYA 2YNHA 4KH6A 3FZMA 1HR0K 1KC7A 3VQPA 4DV3K 4DTRA 2ATQA 4E89A 4DR2K 3VEYA 1K6YA 3U7DA 2O4GA 4EFHA 2XY7A 2A40A 4BR4A 4EAHD 3THXB 4M7YA 3F9KA 3ZCMA 4IOCL 3LP1A 1KD1O 4X62K 1D9FA 4M3UA 4CJ5A 1UAXA 1E4FT 1HB6A 1NGAA 3VERA 3LP0A 4B1XB 1RDDA 5C0YA 4LC9B 3O08A 2FSJA 1JLFA 4FWNA 4FLVA 1ATSA 4JI1K 3PO4A 2D0BA 3M8SA 5AZJA 1NGJA 1VQ9N 3TAQA 3ID6A 3VQQA 3QB0A 4CJVA 2E5LK 3HOSA 3KLHA 1L5UA 1IKWA 2FF6A 2O8EB 2ZF5O 3CIPA 4CFAA 4YOYA 4AF1A 3U6FA 5FRMA 1S72N 4CHQA 1NJXA 3RVCA 1N36K 1HKGA 1QE1A 3AVFA 2BGGA 4BRMA 3G10A 4IO9L 5DM7L 1SUQA 3NCIA 4A2BA 1HNVA 2UUAK 2P51A 1MIZB 3MWPA 4NXNK 2WH5A 3CI5A 3DLRA 2Q97A 3PUFA 3U3GA 2G8FA 3SJHA 3R9PA 4B8CA 2PYJA 1K73O 3OYIA 3GL1A 3VA0A 4KV8A 2UXDK 2AEHA 1GOCA 3C6TA 4WYBA 4DU1A 4CF1A 2AA4A 1WAJA 4LF6K 1NWKA 2HF3A 4F3OA 1Y97A 2GWKA 4OKJA 4C23A 1QZ6A 3AVMA 5EXWA 4CJPA 5J1EA 4BRQA 2P9KA 3LZIA 1V4SA 3D2FB 4DV7K 3TSPA 3T69A 1NM1A 3DLBA 3VQ7A 4FJJA 3VGKA 2D11A 4JK8A 1EQYA 1NGGA 4A5AA 1T3VA 3QIPA 3P5JA 5BR8K 4Z4EA 3DM2A 3OS1A 3ZETA 5GIOA 1X9WA 5C12A 4PQUA 4I6MA 3EKSA 1ZC6A 5ELZA 1S1TA 3AGRA 5AZIA 2KHOA 4M7XA 4HUFA 4YNQA 4C8LA 4YOXA 2B6AA 1TYQB 1X3NA 5I9EB 4RW7A 4WFBL 1LWEA 4G1QA 5CZ2A 2G8HA 3ULDA 2UXCK 5GAHP 1GC7A 3ULEA 4ID1A 3HPGA 5FLXO 5CY4A 4NO7A 4BE1A 3V9XA 3VQ5A 4J2BA 1YVNA 1E4GT 4DU4A 4IDKA 2X74A 1Q9XA 1RTDA 3VEXA 5GIPA 2NZTA 3EYZA 3UKRB 2YJFA 4NLBA 4F7GA 3AO1A 4FW2A 1VK0A 2J0KA 2HE7A 3HVTA 1VQ7N 3QINA 3R3LA 1X9SA 1CXQA 3LDOA 3AAQA 3RRGA 3CC2N 1HLUA 3MXMA 4LF9K 3CCRN 5HRRA 2BANA 3BUZB 3VQBA 2VYPA 4CEOA 2QWOA 3OYMA 4CJEA 3THXA 1UA1A 1CZ9A 3TPQA 4DV4K 1OH8A 3CCSN 4BR5A 1WSHA 4RCHA 3BF1A 3M3ZA 4NYFA 4JKGA 5T7BA 4E7LA 4JD2B 3VQ8A 2QWPA 4O5BA 4KRFA 3OTOK 3A0IX 3BEXA 1BHLA 3DLKA 1XMQK 4JN4A 3LP3A 4DR5K 1WBBA 2F9TA 2P9PB 2H3GX 4E1MA 1T8EA 3SJJA 2P9NB 3WEEB 1IV0A 5LY3A 5FPNA 3ZDTA 2KZMA 5AQWA 3CJ9A 2JLEA 1T05A 4DR7K 2D1KA 2DPNA 1JXBA 2RF2A 5JS2A 4DV1K 5LMUK 2QXLA 1IH7A 5F1XA 4E7KA 2ZJPL 1OVYA 1P90A 3ZSXA 4W5RA 1YJWN 2ZPYA 3BP8A 5GAGP 1YJNN 4GV9A 2V7YA 4I2PA 4CGGA 4FJ7A 2GEMA 2FF3B 1BA1A 1NOYA 1HRHA 1WB9A 4IG3A 2HHTA 4DLGA 3LWLA 2OPRA 1SKSA 1Y19B 2EWSA 3L2QA 3VMFB 4CJQA 4K42A 1NMNA 4CEDA 1MK9B 2W6KA 1RT3A 2HMPA 2E88A 3QEPA 4DTPA 4CD3A 1RTJA 4FLUA 4ILGB 1RTIA 4YOUA 3CETA 3ZX3A 3AVKA 3RR8A 3QNOA 3D2FA 2ZQBA 3E66A 3T3FA 2QWRA 2UU9K 1NJYA 5SZTA 1SL2A 1KXPA
chains in the Genus database with same CATH topology
1BDGA 2Q31A 4H0YB 2V51B 4H0VB 1NGDA 2J4RA 3D7EO 4BROA 1M90O 5BR9A 1Q81O 1GC6A 3MN5A 3MWTA 1ACAA 1JDEA 1RFQA 3O1BA 3ENHA 3PIPL 4A5BA 1HKBA 1NGIA 3QBWA 4B1VA 4B1YB 3H46O 5KPTA 2V52B 3CQYA 3SAGA 2COPA 3WA0A 3A5OC 4JKCA 3A8YA 1QHAA 1W97L 3ATVA 1XQSC 2E1ZA 2IVNA 4QS7A 4BVPA 4MLHA 2FSKA 5JVHL 4DKWA 4FVUA 2EMSA 1GLBG 1MWMA 4FWSA 1K8AO 2IVOA 4BRFA 4HTLA 1C0GA 3VTHA 4K41A 5BN8A 1TYQA 1NGBA 4BRPA 3IMXA 3IUCA 3TTCA 3H6EA 3F9MA 4A59A 1TUUA 1KAZA 3R6MA 3EKUA 1ATRA 3GBTA 3Q7BA 4GY2B 2Q1NA 2WUSA 1MA9B 2P9SB 4CZIA 4K25A 5AQNA 3G25A 1P8ZA 4ISGA 5AFUA 2V7ZA 4PL8A 2E2QA 5IJMA 1BUPA 3KVGA 4IEEA 1LOTB 1IJJA 2EMTA 2CGLA 2FDQA 4CZHA 5F2RA 2YHYA 3JS6A 4H5RA 1DIKA 3OBYA 3VEVA 2OTJN 2OTLN 1JJ2M 4TKNA 3VTIA 1Q18A 2GELA 3EE9A 1VBHA 3SLCA 4DQ8A 1HBKA 4B1UB 5H1SQ 5AZJB 2W41A 2J0MA 1H4RA 2YVCA 1ESVA 3FZLA 2A3ZA 1HX1A 2JWLA 3O9UA 3ZEUB 5AQTA 4ISEA 3VF4A 3ZX2A 2QWMA 5GADP 2CQUA 3AARA 2HBMA 3C0BA 1U2VB 3I56N 4IOXA 5EY4A 2I1KA 2ASPA 4O8UA 5BPLA 2OANA 4BRCA 5AQYA 3MMVA 2W40A 3RSEA 4B1WB 3N4QA 4K43A 1HKCA 3FFKB 3CCJN 2ZWHA 3P39A 4H5VA 2NRVA 4ILJA 1DEJA 5FPMA 5KPRA 4A62A 4ILHA 1K8KB 3S41A 4MO4A 4FO0A 1GLAG 3LDQA 1NVLA 2R82A 1QZ5A 1QVGM 1YF5L 3CC7N 2AL6A 3EL2A 3CXCM 4NB4A 3CF5L 1M1KO 3CJCA 3KZBA 5EOYA 4GVEA 1BO5O 3UKUA 3PVLA 1U2VA 3L0QA 3O9TA 2P9IB 4FOEA 1WUAA 4JD2A 3FP5A 1NBWA 3O5BA 4WQ4C 4DB3A 4WF9L 4WFNL 3H1QA 4JNEA 5LJWA 4IZ9A 5AQOA 4YOVA 3QMLA 1SGHA 2P9PA 2YJEA 5M1FA 3O6WA 4RTFD 4BRGA 1YIJN 1Q86O 2VWBA 1QQMA 2F7TA 2NRWA 2BUPA 4JHDB 2CGJA 2P9NA 2QI2A 4BR9A 3HI0A 3PZDA 2ASMA 1O13A 3L6QA 1HB8A 3VESA 2WC9A 2Q0RA 3CJ7A 3DAWA 4MDBA 5CE3A 4O5FA 3VF2A 3C7NB 2AP1A 4ZRJA 1YUWA 3GOIA 2P9KB 1ILYA 3U9ZA 3MX2A 1YI2N 4M63C 1YJ9N 4YOWA 3O9SA 3MN7A 4IFEA 3WQUA 1D4XA 1CZAN 4U7BA 4J8FA 1VQNN 3P38A 1NI2A 1ST7A 1S3XA 4UY8O 4BRAA 1K9MO 4PKGA 5KQ8A 1U6ZA 3ENBA 2GWJA 5AQVA 1JCGA 1T44A 2WBNA 4FL9A 2X0SA 2E2NA 3ZETB 3K9KA 2RQ1A 1KAYA 3H3NO 2NNWA 4NLCA 4E1JA 4YORA 3TTFA 4EHUA 3ID8A 1NGCA 4I6MB 1HPMA 3CD6N 3SAHA 2QTDA 3OHRA 3UB5A 2D4WA 3WXLA 4JKAA 3HSCA 5AZIB 2ASOA 3IDHA 3VEOA 2Q0UA 2GX9A 3O9RA 3R8EA 5GAEP 4EKUA 1MIXA 1R59O 1H1VA 2RE2A 4BGAA 4NY0A 3GE1A 4JAXA 3G9WA 3SAFA 3DXMB 1KBLA 3EZWA 4CZKA 3L4IA 2HF4A 3MDQA 4FSVA 2BH1A 1NJIO 3FZKA 4BRHA 5AQHA 3MN6A 3CCLN 2D0OA 1LCUA 4BG8A 3CMAN 5AQUA 1BU6O 3HM8A 2JWKA 2NRXA 3E1YA 2F9WA 4IJAA 4IXCA 3TTDA 1VQ6N 2ITMA 4GV3A 5C2DA 2LBBA 5AQFA 4PKHA 4WFAL 4A57A 3VEWA 1YHQN 1N8RO 3I8BA 3CMEN 3WT0A 4A2AA 3E9OA 2ZGZA 4GV6A 1RDWX 4FWRA 3NVKA 3GG4A 3VENA 3CJAA 1VQKN 5HOOA 2I7PA 3EE8A 4FWOA 4IWVA 4B1ZA 3DXMA 4H5WA 2YI1A 3TSQA 5AQSA 5AQXA 1VQMN 1T6DA 4OO1J 4JKFA 5JICA 2GUPA 4CZEA 2IIRA 4MLEA 3LDPA 4JEPA 4BREA 1E5WA 3E9LA 4KH6A 3FZMA 2HRJA 1VQ5N 1KC7A 1X3MA 2QM1A 3U9DA 3MN9A 1C0FA 3C65A 1HJOA 3VEYA 1Z05A 3U7DA 4EFHA 2A40A 3BF3A 4EHTA 2P9UB 4BR4A 3VEZA 4EAHD 2QA4N 4M7YA 4KH5A 3BINA 2VGMA 5M1KA 4GXBA 2FXUA 1WOQA 4IOCL 4JKDA 1KD1O 3P31A 4CZGA 1ZBSA 2BTFA 1NGFA 2QEXN 3LDNA 3MK6A 3W0LA 2P9SA 1ZXOA 1TUYA 2YHXA 2ZGYA 3N4PA 4WQ4A 4PHTX 3CCUN 4FPBA 4BR2A 1YITN 1E4FT 1HB6A 3HBTA 1NGAA 3F2KA 3VERA 3KWIA 1GLJO 5ADXH 2P9LB 4B1XB 5C0YA 2KLAA 3O08A 2FSJA 3QIJA 4LC9B 4FWQA 4BY9C 3OW2M 4FWNA 1ATSA 1VAZA 5JVGL 3O4WA 5AZJA 1NGJA 1VQ9N 3ID6A 3DXKB 4BRIA 3QB0A 5AR0A 3ZEUA 1Y64A 3AGKA 4IJNA 2FLOA 4XH4A 3HRGA 4H0XB 3HOSA 1T6CA 2CGKA 4P7IA 3QFPA 2FF6A 1Q7YO 2ZF5O 3CIPA 4FWLA 4KBOA 4YOYA 3G6EN 4AF1A 4PL7A 5M1OA 1S72N 3IKMA 1ISNA 3RVCA 3AY9A 4ZRKA 1HKGA 4FPAA 1K8KA 3EO3A 3A5LC 4BRMA 1JCFA 1SQKA 1DKGD 3AU5A 5TKYA 4IO9L 1EO1A 5DM7L 4BC5A 5AQQA 4A2BA 3LM9A 5AQRA 1MIZB 3PLAA 3MWPA 2I1JA 3MCAB 2P9IA 4R79A 1Q82O 3ATUA 5KQDA 1NMDA 5JMVA 1VQLN 2WH5A 3CI5A 2Q97A 4IDHA 3SBGA 2NLXA 3R9PA 3SJHA 3DLLL 1K73O 4BQLA 4FWMA 3GL1A 4H5NA 4CI6A 4WQ5C 3O8MA 4FWKA 2E2OA 2AEHA 3WQTA 2KKZA 2Q36A 4WYBA 4FOIA 5C10A 4Y0WA 4JHDA 5B8HA 3UE5A 5GINA 3CPWM 4AM6A 2AA4A 5JLFA 1GLLO 1RGIA 3CQXA 1NWKA 3FLVA 1MDUB 2HF3A 2GWKA 3CHWA 4C23A 4IEIA 4JK7A 3NVMA 1QZ6A 2CH5A 5DM6L 5EXWA 2A6AA 5EX5A 3C7NA 3I33A 3KK7A 1VQ4N 5BN9A 4BRQA 2E1YA 4HWIA 4PKIA 2HOEA 1HUXA 2P9KA 3D2EB 1V4SA 3D2FB 5M1PA 1BG3A 3TSPA 4BC2A 2D2QA 1GG3A 3T69A 3B8AX 3J8AA 1NM1A 3H1VX 1GLFO 2E2PA 5BRHA 5AQMA 4XEIA 5BRDA 3VGKA 3I55N 2D11A 4JK8A 1EQYA 1NGGA 1BA0A 2GTDA 4A5AA 4CZMA 2FJ9A 1T3VA 2NRTA 5AQJA 3HOTA 2ZJRL 3CCMN 3C6HA 3U8ZA 3X23A 4KH4A 2NRZA 3ZETA 2ABDA 5GIOA 3SMSA 4DXAB 4YOTA 3ULEB 3ZYYX 5C12A 3Q7CA 5ADXA 3K9JA 4JKEA 1ZC6A 3EKSA 3KHYA 1YXQA 3A5MC 3H3OB 4I6MA 5ELZA 5AQZA 4DCHA 3QBXA 5BRFA 3AGRA 3CJ1A 5AZIA 1NTIA 2A42A 4HDQA 2HBKA 2KHOA 3OBWA 4QS9A 4M7XA 2YHWA 4YOXA 2FSNA 3QDKA 3D6RA 3VGLA 5TKWA 5EVZA 2HBJA 1NLVA 1TYQB 3SBTA 1X3NA 3CJBA 5I9EB 1KC8O 4WFBL 1QQOA 3CERA 1QQNA 5CR4A 5JVLA 3VOVA 3FR0A 3KWGA 2NRRA 1ATNA 5GAHP 3MCPA 3CCVN 1GC7A 5FPDA 3ULEA 4BC4A 4BC3A 4H0OA 3WXKA 3VPZA 3J7ZO 1SZ2A 3G4SN 4CBWA 3FLCO 4NO7A 4BR0A 2PAVA 3NMUA 4CZJA 1QVFM 3WXJA 1YVNA 4F9OA 3SK3A 1BWFO 1E4GT 1GGOA 4IO8A 3LL3A 1JCEA 3VEXA 1KAXA 4BR7A 5M1NA 5GIPA 2NZTA 3UKRB 2YJFA 4YDUC 4F7GA 1OKJA 4NLBA 1J6ZA 2DIKA 1XUPO 3A5NC 4OPHA 2J0KA 2HE7A 3DWLA 2WFBA 4JKGB 3VETA 1V4TA 3O80A 1VQ7N 4JKHA 5AQPA 3R3LA 4BRLA 3FE1A 3F5TA 2NRHA 4A61A 4H0TB 4MO5A 5LJVA 3LDOA 3AAQA 3RSEB 4G9ZA 3CC2N 1SAZA 1MK7B 1NGEA 3MX5A 1HLUA 3P4IA 4MDAA 5AQLA 2QWQA 3C6AA 3T7ZA 1G99A 4BG9A 4BRNA 5HL7L 2YCHA 3CC4N 3CCRN 4OPAA 5BREA 3BUZB 3PIOL 2VYPA 2QWOA 1GLCG 3CCQN 3AAPA 2P9UA 5CHIA 4RWTA 3FZHA 3TPQA 4ZRIA 5F0XA 2A41A 3UKRA 4H5TA 2CB8A 4B9QA 4BR5A 4DHYA 5MLCQ 3CCSN 1VQ8N 4RCHA 2ZJQL 2D0PA 3BF1A 3CPEA 3M3ZA 3UKUB 4JKGA 3R1XA 3WUHA 2UYTA 3VF6A 4CZFA 4XH1A 4JD2B 3HTVA 2QWPA 3WXMB 4BRKA 3EN9A 1MWKA 2Q2RA 3ENOA 2P9LA 3A0IX 3BEXA 4H0PA 5M1QA 5C2FA 2E8AA 4WCEL 4WQ5A 4JN4A 4FWPA 4BVOA 5AQKA 1NGHA 3WXIA 2F9TA 2P9PB 2QWLA 2H3GX 3GDQA 1YAGA 3JXUA 1DT9A 2P9NB 4CZLA 3ZX0A 3DXKA 3WEEB 1KQSM 2QWNA 3IVFA 3VGMA 4CD1A 2J0JA 3H45C 5LY3A 5FPNA 3ZDTA 3EPYA 4XH5A 2VGNA 3CJ9A 5AQWA 5AQIA 2D1KA 3IFRA 3L4QA 3QICA 3O9QA 2DPNA 4Z94A 1J19A 5AFUH 4AM7A 2QXLA 3HZ6A 5F1XA 4BRDA 5E26A 2ZJPL 1OVYA 1P90A 3OA9A 4CBUA 1YJWN 5E84A 4JK9A 4QS8A 2PBDA 3LDLA 2ZPYA 1VQPN 3BP8A 2PFUA 3DJCA 3LM2A 5BPNA 1GLDG 4U67L 5GAGP 1GLEG 4L3QA 2D10A 1YJNN 2V7YA 3WEEA 1W2BM 4GV9A 2RHKA 4CJ7A 2GEMA 2FF3B 1BA1A 5FPEA 2HBLA 4O8KA 5JLHA 4BQZA 2YX6A 3U4LA 3QFUA 4BGBA 1IG8A 2HSTA 3TU5A 2VCPA 1Y19B 3G71N 2EWSA 3M1FA 3M6GA 3FGUA 3VMFB 1BOTO 4HDOA 3AU4A 4K42A 4GNIA 5BPMA 2IVPA 1MK9B 1EF1A 5KPZA 2HMPA 2E88A 3FZFA 4ISFA 4EIAA 3E9PA 4JKBA 4C1NI 1SS6A 4CD3A 1DGKN 3CCEN 4C1NK 4IOAL 1X9JA 4ILGB 4YOUA 1S22A 3CETA 3O1WA 3TSUA 1RDUA 3W3DA 3ZX3A 1VQON 4CBXA 2CH6A 2E20A 3D2EA 4YL8A 3D2FA 2I7NA 2QW9A 3SMPA 3E66A 1Z6RA 2QWRA 5C15A 4H03B 5AQGA 4CYEA 1VBGA 1XC3A 2A5XA 3M5RA 3U8XA 1KXPA 4YDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK8 A;  4JKG B;  4JKH A;  4JKF A;  3E9P A;  4JKB A;  4JK9 A;  3ENB A;  3E9L A;  4ILJ A;  4ILG B;  4ILH A;  4JKE A;  4JKC A;  4JK7 A;  4JKA A;  3E66 A;  3E9O A;  4JKD A;  4JKG A;  3SBT A;  3SBG A; 
#chains in the Genus database with same CATH topology
 1BDG A;  4H0Y B;  4DS5 A;  4JS4 A;  4CCH A;  1TV6 A;  4CEB A;  1NK5 A;  1QSL A;  3HYF A;  3PIP L;  4A5B A;  1HKB A;  1NGI A;  4Z4H A;  3QBW A;  4CJK A;  5AJ3 K;  4RWT A;  3WA0 A;  3ATV A;  1VQL N;  4KHW A;  3ZSZ A;  4DQQ A;  1NK0 A;  4FVU A;  3LPU A;  4FWS A;  3OYD A;  4FJN A;  2PY5 A;  4OX9 K;  2IVO A;  4BRF A;  1C0G A;  1TYQ A;  3IUC A;  3DRR A;  4CJ4 A;  3F9M A;  2IS3 A;  4A59 A;  3EKU A;  1ATR A;  1XC9 A;  2Q1N A;  2P9S B;  4K25 A;  5AQN A;  5AFU A;  1OVQ A;  1BUP A;  3KVG A;  3ZSR A;  4DG1 A;  1RBT A;  1BCM A;  3EZ5 A;  4BDY A;  4F2R A;  2EMT A;  4XIU A;  3S3M A;  2FDQ A;  2YHY A;  4H5R A;  1DIK A;  2OTJ N;  2OTL N;  2GEL A;  3SLC A;  2HNY A;  4B1U B;  2B5J A;  3SQ1 A;  1FW6 A;  3FZL A;  2A3Z A;  2XO7 A;  5EY4 A;  4FK2 A;  1KLN A;  3LWM A;  4OKE A;  4FJ5 A;  1EKE A;  4KFB A;  3FFK B;  4H5V A;  2NRV A;  1VSL A;  5J2P A;  2O8D B;  3IG1 A;  1NG9 A;  5JS1 A;  3LDQ A;  2R82 A;  4CEQ A;  3T1H K;  1HPZ A;  3EL2 A;  3KZB A;  2XHB A;  3SQ2 A;  1WBD A;  3L0Q A;  3O9T A;  1S1V A;  4JD2 A;  2O8F A;  4DFP A;  3FP5 A;  4WF9 L;  1C0U A;  3H1Q A;  3O4Q A;  5K14 A;  2G8W A;  3TAG A;  3CQ8 A;  5AQO A;  1I39 A;  3AVA A;  3SQ4 A;  2P9P A;  2YJE A;  3AA5 X;  4CJL A;  4K8Z A;  1B9F A;  3LDS A;  2RKI A;  1SL1 A;  4B9V A;  2CGJ A;  2ETJ A;  2P9N A;  3OYK A;  3C94 A;  2ASM A;  3DAW A;  3VF2 A;  3C7N B;  4KTZ A;  4ZRJ A;  3KLI A;  1YUW A;  4DQR A;  3MX2 A;  4FLX A;  4DTJ A;  3QER A;  3O9S A;  3O3G A;  1VQN N;  1R0A A;  3KLG A;  4OJR A;  4BWM A;  3QIO A;  4KB1 A;  4UY8 O;  3FFI A;  3B6O A;  5KQ8 A;  3I0R A;  4JI0 K;  4FL9 A;  1NK8 A;  2E2N A;  2OZM A;  2RQ1 A;  3H3N O;  2NNW A;  3NF9 A;  4NLC A;  3TTF A;  4I9Q A;  3CFR A;  2QTD A;  3SV4 A;  3UB5 A;  3WXL A;  1IKY A;  3AVB A;  3DRS A;  4CK3 A;  2DFH A;  2KW4 A;  2GX9 A;  1RT6 A;  1MIX A;  5SWM A;  1H1V A;  2RE2 A;  3CFO A;  4BGA A;  4N56 A;  3SAF A;  2QKB A;  2F4V K;  3OYL A;  3HP6 A;  3EZW A;  4CZK A;  2HF4 A;  4NYN A;  4NCA A;  1FXX A;  3FZK A;  3L3U A;  1RBS A;  3K5M A;  1CZB A;  4GV3 A;  4CJW A;  3PSI A;  1C1B A;  4A57 A;  3CME N;  1N8R O;  3I8B A;  3WT0 A;  4A2A A;  1A5V A;  1WN7 A;  1VQK N;  1W7A A;  3EE8 A;  3KJV A;  3ALY A;  4OPJ A;  2GUI A;  1VQM N;  4JRP A;  2IIR A;  4MLE A;  2P1J A;  4DSL A;  1HJO A;  4KI4 A;  1LAW A;  1Z05 A;  4QOZ B;  3BF3 A;  4FVM A;  2P9U B;  4LSN A;  1DLO A;  3VEZ A;  2FXU A;  3CM5 A;  3NGY A;  1ZBS A;  4CZG A;  2QEX N;  3LDN A;  4RW9 A;  2HHX A;  5J2N A;  4HUG A;  2P9S A;  2ZGY A;  3CCU N;  4FPB A;  3ZT4 A;  3KWI A;  2P9L B;  3SUO A;  4BY9 C;  3QIJ A;  4FJ8 A;  4J2D A;  3MEE A;  2E6L A;  3QEI A;  2O8B B;  5JVG L;  3VA3 A;  3O4W A;  4CHZ A;  2Z1J A;  2IGI A;  3T19 A;  3DXK B;  5AR0 A;  5HRN A;  3AGK A;  2VWK A;  4C8N A;  2FLO A;  3HRG A;  2D5R A;  4H4M A;  3G6E N;  3IKM A;  1XWL A;  4ZRK A;  4FPA A;  2ZE2 A;  3EO3 A;  1JCF A;  2DFE A;  4E3S A;  2VG5 A;  1I3A A;  4BC5 A;  3LM9 A;  3PLA A;  2I1J A;  3I0S A;  5KQD A;  1D9D A;  3AA2 A;  4IDH A;  3SI6 A;  2NLX A;  4KHS A;  3DLL L;  3HT3 A;  1XI1 A;  4BQL A;  4B9L A;  3LZJ A;  1E3M A;  4H5N A;  4FZY A;  4LF8 K;  3MEG A;  2KKZ A;  2Q36 A;  2YNG A;  5B8H A;  5C10 A;  1N6Q A;  3UE5 A;  4KPY A;  5JLF A;  1GLL O;  1U4B A;  1RGI A;  4CEF A;  1BI4 B;  4JK7 A;  3KLF A;  2A6A A;  3C7N A;  3I33 A;  3KK7 A;  1Q9Y A;  2E1Y A;  1RBV A;  2HOE A;  4GVM A;  2D2Q A;  3NGZ A;  1GG3 A;  3B8A X;  3QEW A;  1GLF O;  2E2P A;  4O55 A;  5BRD A;  3I55 N;  3JAM O;  4YHH K;  1BA0 A;  2FJ9 A;  1S6P A;  3HOT A;  3CCM N;  4B9T A;  3C6H A;  4CW7 B;  3X23 A;  1EWQ A;  4M41 A;  4JI2 K;  3SMS A;  3TAN A;  4DXA B;  4YOT A;  3ULE B;  3VQ4 A;  5ADX A;  3HP9 A;  3K9J A;  3K0S A;  1YXQ A;  5CYQ A;  4DCH A;  1T03 A;  4ID5 A;  1NTI A;  2A42 A;  4HDQ A;  2HBK A;  4DF4 A;  4FXD A;  3LAL A;  4NCB A;  3SBT A;  1KC8 O;  5HRP A;  1QQN A;  4I2Q A;  3KWG A;  2NRR A;  1EP4 A;  3V81 A;  3MCP A;  1TKX A;  4IG0 A;  5FPD A;  4BC4 A;  1L3V A;  3QES A;  1X9M A;  4FZX C;  4BR0 A;  3ASM A;  2OPQ A;  1VSE A;  1QVF M;  1BWF O;  5HRS A;  4O0J A;  3LP2 A;  3LL3 A;  1KAX A;  3HL8 A;  5M1N A;  3K58 A;  1JLE A;  1XUP O;  3A5N C;  4OPH A;  2HVH A;  1HQU A;  4GKJ K;  5DK5 A;  4JKG B;  3VET A;  1NJZ A;  1KVA A;  3OYE A;  4JKH A;  4CHP A;  1WSJ A;  5LJV A;  4CGI A;  4A61 A;  1NGE A;  5HL7 L;  1KVB A;  1QS4 A;  5KTQ A;  3PIO L;  1OH6 A;  4CER A;  4KRE A;  1EXQ A;  1GLC G;  4DTM A;  2P9U A;  2NUB A;  4CEA A;  5CHI A;  4DR3 K;  3FZH A;  4ZRI A;  1RT1 A;  4H5T A;  2CB8 A;  1C0T A;  2VQE K;  4W5Q A;  3WUH A;  4XH1 A;  2VWJ A;  3HTV A;  5JIC A;  1MWK A;  2Q2R A;  3ENO A;  2P9L A;  4GMJ B;  4AHU A;  4QCL A;  2E8A A;  4WCE L;  4C8M A;  4FYD A;  5AQK A;  3WXI A;  4B9N A;  3ZT0 A;  3TI0 A;  2O8B A;  1UOC A;  1JLC A;  1DT9 A;  1WLJ A;  3ZX0 A;  3DXK A;  1KQS M;  4CD1 A;  3KKR A;  3O4N A;  4J2E A;  4H8K A;  2D0A A;  3L4Q A;  4Z94 A;  4NCG A;  3RMA A;  3HZ6 A;  4CEE A;  3VQC A;  1VSJ A;  3OA9 A;  4JK9 A;  3V6D A;  1IO2 A;  1VQP N;  5E41 A;  4UQG A;  3QO9 A;  2RHK A;  4CJ7 A;  4E7I A;  1EX4 A;  2HBL A;  4O8K A;  2AJQ A;  4BQZ A;  3U4L A;  3O3H A;  3QFU A;  3V9Z A;  4KHN A;  1IG8 A;  1WSI A;  2HST A;  1TKT A;  2VCP A;  3M1F A;  1BOT O;  3AU4 A;  4GNI A;  2IVP A;  3NF8 A;  2RN2 A;  4B3M K;  1J5E K;  3E9P A;  2A1S A;  4C1N I;  3RTV A;  2F8S A;  2B4J A;  1DGK N;  4CFB A;  4IOA L;  4DFK A;  1BI4 A;  1T7P A;  3O1W A;  3TSU A;  4BDZ A;  1L3S A;  2CH6 A;  2E20 A;  5KGX A;  4ZHR A;  1FJG K;  3K2P A;  4AHR A;  4H03 B;  5AQG A;  1VBG A;  1XC3 A;  2A5X A;  1X1P A;  1ZYQ A;  3AO2 A;  1IBM K;  4H0V B;  4CGD A;  4EP5 A;  4JI3 K;  2Z1I A;  1NOZ A;  3ZSY A;  1FK9 A;  2IOC A;  3H46 O;  2GBZ A;  4KKO A;  4Q5V A;  2OZS A;  3CQY A;  1YTU A;  1TAQ A;  3F2K A;  4JKC A;  3A8Y A;  3RWU A;  3PX6 A;  4E19 A;  2E1Z A;  4MLH A;  2FSK A;  1GLB G;  3KLE A;  4DTO A;  1S1X A;  5I42 A;  4K41 A;  5BN8 A;  2XY5 A;  3CFP A;  1IBL K;  1KAZ A;  3Q7B A;  4N5S A;  2E4L A;  2WUS A;  4CZI A;  3G25 A;  1TL3 A;  4ISG A;  4JI4 K;  2V7Z A;  3K59 A;  4DSF A;  4IEE A;  3ZSQ A;  1IJJ A;  3V9S A;  2FBV A;  2CGL A;  5FDL A;  4CEC A;  4CZH A;  4I7F A;  5F2R A;  3ZLJ A;  3JS6 A;  3PX0 A;  3OBY A;  3VEV A;  4GW6 A;  1N34 K;  3THW B;  3AV9 A;  3VTI A;  3ZSW A;  1VBH A;  5H1S Q;  1H4R A;  3SPY A;  3TAR A;  2JWL A;  3O9U A;  3VF4 A;  2QXF A;  2QWM A;  1NK4 A;  4LSL A;  2ASP A;  2O8F B;  1FKP A;  4BRC A;  5AQY A;  3MMV A;  5A2Q O;  4C8K A;  4LF4 K;  2ZWH A;  4WE1 A;  1DEJ A;  1U04 A;  5FPM A;  5KPR A;  3DOK A;  4ILH A;  1K8K B;  3S41 A;  4FO0 A;  1GLA G;  1NVL A;  5HBM A;  4E7J A;  1QVG M;  1ZBU A;  3CJC A;  4EP4 A;  1U2V A;  2P9I B;  1WUA A;  4DB3 A;  4O44 A;  4WFN L;  1ZBL A;  2GV9 A;  4KAZ A;  4M3Z A;  3K5N A;  4AQY K;  4RTF D;  2OPS A;  1QQM A;  2NRW A;  4BR9 A;  1HMV A;  3HI0 A;  1TK5 A;  3KIO A;  2WC9 A;  3CJ7 A;  4OGE A;  1TGO A;  4DTN A;  1ILY A;  1KRP A;  4M63 C;  1YJ9 N;  1XNR K;  3BZK A;  1XHZ A;  3WQU A;  4J8F A;  2FBT A;  2XRI A;  4OPK A;  1ST7 A;  1K9M O;  4PKG A;  1ITG A;  1VSK A;  2IDO A;  1UA0 A;  2WBN A;  2X0S A;  1KAY A;  4JI5 K;  1S9G A;  4EHU A;  1NGC A;  1RDB A;  3V1R A;  4JKA A;  2ASO A;  1QQC A;  4N47 A;  4JRQ A;  4EKU A;  1R59 O;  5KRS A;  4FK0 A;  1HNI A;  2ZM6 K;  3B6P A;  4CJ3 A;  1VSF A;  2BH1 A;  5AQH A;  3SPZ A;  3CCL N;  2D0O A;  4BG8 A;  1GOA A;  3CMA N;  3HM8 A;  2NRX A;  3E1Y A;  4M3Y A;  1VQ6 N;  3I8D A;  5C2D A;  2LBB A;  3AO4 A;  2VQF K;  4FLZ A;  1YHQ N;  3E9O A;  4BDP A;  4CVN E;  1B92 A;  3GG4 A;  1RDC A;  3VEN A;  1U49 A;  3CJA A;  2I7P A;  4FWO A;  4B1Z A;  1C6V A;  3TSQ A;  1KLM A;  5AQS A;  5AQX A;  4OO1 J;  4JKF A;  4CZE A;  3LDP A;  3PX4 A;  2YHB A;  4NXM K;  4BRE A;  1KFD A;  2HRJ A;  4FZZ A;  2O8C B;  3KK3 A;  3U9D A;  2YV0 X;  5IT9 O;  4EHT A;  4GKK K;  3M8Q A;  1EET A;  3T1A A;  4IFY A;  2QA4 N;  3S3N A;  1WOQ A;  1KTQ A;  1XNQ K;  2BTF A;  4B3T K;  3W0L A;  3DLG A;  4K8X A;  4PHT X;  1TUY A;  2YHX A;  1HQE A;  3DRP A;  5HLF A;  1YIT N;  3K5L A;  1GLJ O;  2KLA A;  2XY6 A;  1HNX K;  3THW A;  3M8P A;  1VAZ A;  4CJU A;  4JS5 A;  4ZTF A;  4BRI A;  3D0P A;  4Z0U A;  4JI6 K;  4IJN A;  3RMD A;  3ZT2 A;  3AVH A;  1U47 A;  4XH4 A;  4H0X B;  3QLH A;  4FWL A;  4KBO A;  3TWH A;  4JYA K;  1LW0 A;  3TR8 A;  4DTU A;  3TAE A;  4AHS A;  1K8K A;  5D3G A;  1ZBH A;  1DKG D;  1NK7 A;  3HJF A;  5AQQ A;  1W0H A;  3MCA B;  4R79 A;  2P9I A;  5JMV A;  4W5N A;  4HTU A;  3SBG A;  1REV A;  2P5O A;  1C1C A;  4DSE A;  2A1R A;  3A2F A;  1XMO K;  3KTQ A;  4WQ5 C;  3MED A;  1YT3 A;  3WQT A;  3CPW M;  4Y0W A;  2P5G A;  3NH2 A;  3DI6 A;  4DR1 K;  4AM6 A;  3FLV A;  4OLA A;  1A5X A;  3OVN A;  3CHW A;  4IEI A;  4HCC A;  4QAG A;  4PKI A;  1BG3 A;  3NAE A;  4E7H A;  4BC2 A;  4DSK A;  3V1O A;  3J8A A;  1RNH A;  4LF5 K;  4OGC A;  2NRT A;  2ZJR L;  3L2V A;  4Z4F A;  3U8Z A;  4CFD A;  3OY9 A;  4KH4 A;  2EX3 A;  2ABD A;  4CJR A;  3LAN A;  3ZYY X;  3WNH A;  4JLH A;  4BAC A;  3NHG A;  3A5M C;  3H3O B;  3S3O A;  5AQZ A;  1D8Y A;  4L8R B;  3TAB A;  4DR4 K;  5BRF A;  3CJ1 A;  1VSM A;  2FSN A;  5EVZ A;  3CYM A;  1NLV A;  2HND A;  3CER A;  5JVL A;  1JKH A;  2RPI A;  1JLA A;  4IFV A;  3AO3 A;  3BZC A;  2QKK A;  5C42 A;  4JV5 K;  3VPZ A;  4YY3 K;  3J7Z O;  3SNN A;  3G4S N;  4CBW A;  3FLC O;  4B3S K;  2PAV A;  4CZJ A;  1MU2 A;  4F9O A;  3SK3 A;  4M3T A;  3OJU A;  3QEX A;  3DYA A;  4IO8 A;  1KCF A;  4RW6 A;  4X66 K;  4MQ3 A;  4CGH A;  4YDU C;  1OKJ A;  1BIS A;  3E01 A;  2DIK A;  1DTT A;  2HHH K;  4E1N A;  1JLB A;  3LPT A;  1NK9 A;  5AQP A;  3U3Y A;  1G15 A;  4IBN A;  3WNF A;  3FE1 A;  4M45 A;  4MO5 A;  2O4I A;  3MX5 A;  3T7Z A;  3P4I A;  4LFB K;  4BG9 A;  4MDA A;  5AQL A;  2YKM A;  3C6A A;  2O8C A;  1G99 A;  3J7A P;  3HK2 A;  4OPA A;  5BRE A;  3AAP A;  4DV0 K;  5C25 A;  5F0X A;  3KK2 A;  4FM2 A;  4DHY A;  5MLC Q;  1TK0 A;  4J2A A;  2ZJQ L;  3KKS A;  3G0Z A;  3R1X A;  3VF6 A;  1JL2 A;  4FJG A;  3DOL A;  4FLT A;  3HPH A;  4BRK A;  3EN9 A;  2WON A;  2X78 A;  4DV6 K;  4WQ5 A;  1NGH A;  2YNI A;  4Z4I A;  3GDQ A;  1YAG A;  4CZL A;  3S9H A;  3SUQ A;  4CK1 A;  2QWN A;  4DLE A;  2J0J A;  4DS4 A;  3H45 C;  3PV8 A;  2VGN A;  1J5O A;  5AQI A;  3F73 A;  3IFR A;  3QIC A;  3O9Q A;  1J19 A;  5AFU H;  4M3X A;  4F4K A;  4DQI A;  5E26 A;  2QK9 A;  5E84 A;  4PA1 A;  4QS8 A;  2PBD A;  2PFU A;  3DJC A;  4CHN A;  4DSJ A;  1GLD G;  3ISN C;  2D10 A;  1W2B M;  1NNE A;  5FPE A;  2BE2 A;  3SZ2 A;  3TU5 A;  3VN5 A;  3HO1 A;  4DV2 K;  1C0M A;  1JLQ A;  4LY7 A;  3HST B;  1EF1 A;  5KPZ A;  3FZF A;  4ISF A;  4EIA A;  4JKB A;  3BGR A;  3LAM A;  3HM9 A;  4B9M A;  4KHP K;  3P83 D;  1SKW A;  1ZBI A;  4C1N K;  1X9J A;  1S22 A;  2WTU A;  4OLB A;  4CBX A;  4YL8 A;  2QW9 A;  4DTS A;  2E6M A;  3HXM A;  4KTQ A;  1Z6R A;  4CYE A;  1EWR A;  3U8X A;  5M1K A;  4LF7 K;  4YDU A;  2J4R A;  3D7E O;  1Q81 O;  3MN5 A;  1RT7 A;  4C8O A;  4HVJ A;  3ENH A;  4CK2 A;  2HMI A;  1HYV A;  3SUN A;  2HB5 A;  5KPT A;  2V52 B;  1WSE A;  4KHQ A;  4DV5 K;  1XQS C;  2IVN A;  4QS7 A;  5JVH L;  1KSP A;  4AIL C;  1HJR A;  1QTM A;  1K8A O;  4RW8 A;  3IMX A;  3TTC A;  3OYH A;  1S1W A;  4B8A B;  1TUU A;  4GY2 B;  3GBT A;  3THV A;  1OH7 A;  2OPP A;  4FK4 A;  2E2Q A;  5IJM A;  2YNF A;  5KRT A;  5IWA K;  2KFN A;  3VQ6 A;  4V19 S;  1JJ2 M;  4DQ8 A;  3ZSV A;  2Y1J A;  1RBR A;  1HX1 A;  3ZEU B;  5AQT A;  3IAY A;  3C0B A;  2HBM A;  1U2V B;  4IOX A;  2I1K A;  4O8U A;  3OYB A;  4BE2 A;  4BWJ A;  3DLE A;  3NH0 A;  1CXU A;  4ZTJ A;  4K0K K;  1RDA A;  4B08 A;  3J7Y P;  3RRH A;  4A62 A;  4FJX A;  4PWD A;  4DFM A;  4NB4 A;  3OS2 A;  5EOY A;  4GVE A;  3V4I A;  5J2M A;  3O5B A;  4WQ4 C;  4KI6 A;  1VRU A;  3TAM A;  2KFZ A;  1CLQ A;  5LJW A;  4YOV A;  5KGW A;  3NH1 A;  2PZS A;  1Q86 O;  1SKR A;  4JHD B;  2DFF A;  2F7T A;  2BUP A;  4B9U A;  3LAK A;  4PUO A;  3OYA A;  3L6Q A;  1HB8 A;  3VES A;  5CE3 A;  3ZSO A;  4F2S A;  2AP1 A;  1S1U A;  2OYQ A;  3U9Z A;  1QSY A;  3DLH A;  3QET A;  4YOW A;  4IFE A;  1TL1 A;  2FC0 A;  1D4X A;  1CZA N;  3P38 A;  1NI2 A;  5EU7 A;  3KD5 E;  2ZD1 A;  3AVG A;  4BRA A;  4CHY A;  4KO0 A;  3QNN A;  3ENB A;  3SYZ A;  1JCG A;  1T44 A;  4FLY A;  2UUC K;  2F96 A;  2DY4 A;  1VHX A;  4CE9 A;  4OKK A;  3CD6 N;  3OHR A;  3AVL A;  3HSC A;  4B3O A;  3IDH A;  4AH9 A;  3VEO A;  3VQD A;  2Q0U A;  3O9R A;  1B9D A;  3R8E A;  3SUP A;  3OJS A;  1C1A A;  4NY0 A;  4JAX A;  3G9W A;  1J53 A;  4FLW A;  1I94 K;  3L4I A;  3L2W A;  3AO5 A;  1JLG A;  1NJI O;  4Q0B A;  5C24 A;  3MN6 A;  3NGI A;  1KFS A;  4JI8 K;  4IXC A;  1BU6 O;  1NKB A;  2F9W A;  3IS9 A;  3TTD A;  2ITM A;  5AQF A;  3ITH A;  4WFA L;  3VEW A;  1WNS A;  2OCE A;  1RT4 A;  5HOO A;  4IWV A;  3DXM A;  2BDP A;  3NF6 A;  4LFA K;  5LL6 Z;  1T6D A;  4CGF A;  4JEP A;  1E5W A;  3E9L A;  3CM6 A;  4F8R A;  1VQ5 N;  1TKD A;  1X3M A;  2QM1 A;  3MN9 A;  1C0F A;  3C65 A;  4DQP A;  3K57 A;  1L3U A;  1LWF A;  4KH5 A;  3BIN A;  2VGM A;  4GXB A;  4CJT A;  4Z4G A;  4JKD A;  3P31 A;  4FM1 A;  1S5J A;  1NGF A;  3C6U A;  3MK6 A;  2KZZ A;  1ZXO A;  1SL0 A;  3N4P A;  4WQ4 A;  1VSI A;  4BR2 A;  1IG9 A;  3HBT A;  2HHU A;  5ADX H;  4FWQ A;  3OW2 M;  1O1W A;  3OYF A;  2UXB K;  4BE0 A;  3NBP A;  4Y1D A;  4RW4 A;  3ZEU A;  1Y64 A;  2OA8 A;  1JL1 A;  4LH5 A;  3VQA A;  1N33 K;  1T6C A;  1S6Q A;  3RR7 A;  2CGK A;  4P7I A;  3QFP A;  2HHW A;  1Q7Y O;  3UIQ A;  4PL7 A;  5M1O A;  1ISN A;  3AY9 A;  2DTU A;  3A5L C;  1SQK A;  3AU5 A;  5TKY A;  4FJM A;  1EO1 A;  1D5A A;  2HHQ A;  2PYL A;  5AQR A;  4HUE A;  1OH5 A;  1Q82 O;  5HRO A;  3ATU A;  1NMD A;  5FRN A;  2VG6 A;  4M3R A;  2O8E A;  3AVI A;  4CFC A;  4FWM A;  4CI6 A;  2W6L A;  3O8M A;  1BCO A;  4FWK A;  1L3T A;  2E2O A;  5GIN A;  4FOI A;  4JHD A;  3CG7 A;  4B9S A;  3CQX A;  1MDU B;  4FCY A;  3OYG A;  3KD1 E;  3L2R A;  3NVM A;  5DM6 L;  2CH5 A;  1VQ4 N;  5EX5 A;  2X6N A;  5BN9 A;  4HWI A;  1HUX A;  3D2E B;  3AA4 A;  1J54 A;  3OYJ A;  5M1P A;  3QEV A;  3PY8 A;  3H1V X;  3SV3 A;  5BRH A;  5AQM A;  4XEI A;  4IKF A;  1ASW A;  2GTD A;  4CEZ A;  4CZM A;  4FM0 A;  5AQJ A;  4TSX A;  1F21 A;  2NRZ A;  1W9H A;  3MEC A;  2LSN A;  1Z25 A;  4N41 A;  3Q7C A;  1IKV A;  4JKE A;  3KHY A;  4BRO A;  3D45 A;  1HNW K;  3QBX A;  2KTQ A;  3OBW A;  4QS9 A;  1S9E A;  1VRT A;  2YHW A;  5I3U A;  3QDK A;  3MXJ A;  3D6R A;  3VGL A;  5TKW A;  2HBJ A;  1LAV A;  1TKZ A;  3CJB A;  1YTA A;  1QQO A;  5CR4 A;  3VOV A;  3FR0 A;  4W5O A;  1ATN A;  3L8B A;  3CCV N;  3BDP A;  4KB0 A;  3SQ0 A;  1HYS A;  4BC3 A;  4H0O A;  2IAJ A;  3WXK A;  1SZ2 A;  4ELU A;  3NMU A;  3T1Y K;  1WSF A;  3WXJ A;  1BIZ A;  1GGO A;  4CHO A;  1JCE A;  4BR7 A;  3VQ9 A;  4DTX A;  4KTW A;  1J6Z A;  2YKN A;  1HYZ A;  4DR6 K;  3DWL A;  2WFB A;  1V4T A;  1RBU A;  3O80 A;  3OS0 A;  3M8R A;  3L2U A;  4BRL A;  3F5T A;  2NRH A;  4G9Z A;  4H0T B;  3RSE B;  1SAZ A;  1MK7 B;  4BRN A;  2I5J A;  1N5Y A;  2QWQ A;  3CC4 N;  4LH4 A;  2YCH A;  3H08 A;  4JI7 K;  1IKX A;  3TAF A;  3CCQ N;  3V9U A;  1NK6 A;  4Y1C A;  3ZT1 A;  2A41 A;  3UKR A;  3RMC A;  4B9Q A;  4X65 K;  3RMB A;  1VQ8 N;  2D0P A;  4N76 A;  3CPE A;  3UKU B;  2UYT A;  4CZF A;  3JSM A;  3VQE A;  3WXM B;  4DUY K;  5M1Q A;  4H0P A;  5C2F A;  3OYN A;  4FWP A;  4BVO A;  1LV5 A;  1A5W A;  2Y1I A;  2W42 A;  4EZ6 A;  4FJ9 A;  2QWL A;  4I9L A;  2JGU A;  3JXU A;  2UUB K;  1WSG A;  3VGM A;  3IVF A;  2IC3 A;  3EPY A;  4XH5 A;  4M42 A;  2FBX A;  1J9A A;  4AHC A;  4AM7 A;  2HVI A;  4HHT A;  4BRD A;  4CBU A;  3DMJ A;  3NDK A;  3LDL A;  2XY8 A;  3LM2 A;  5BPN A;  4U67 L;  1LWC A;  3IRX A;  1GLE G;  4L3Q A;  4H4O A;  3ZT3 A;  3WEE A;  4CIG A;  1SV5 A;  2EHG A;  5JLH A;  2YX6 A;  4FJK A;  4BGB A;  4MFB A;  4FW1 A;  3G71 N;  3MXI A;  1BIU A;  3M6G A;  3FGU A;  4HDO A;  1VSH A;  5KI6 A;  5BPM A;  4CJS A;  5J2Q A;  4KHU A;  3BY5 A;  3L3V A;  1WAF A;  4CF9 A;  1SS6 A;  3TAP A;  1BL3 A;  2X6S A;  3CCE N;  1GOB A;  2HHV A;  1RDU A;  3W3D A;  1VQO N;  2Q3S A;  3D2E A;  2I7N A;  3K5O A;  3SMP A;  1IBK K;  5C15 A;  1LW2 A;  3WNE A;  3M5R A;  2Q31 A;  4CF8 A;  2V51 B;  1NGD A;  1M90 O;  5DMR A;  5CZ1 A;  5BR9 A;  3J81 O;  2D0C A;  1GC6 A;  3MWT A;  1TK8 A;  1ACA A;  1JDE A;  1RFQ A;  1FKO A;  3O1B A;  2HW3 A;  3V9W A;  4B1V A;  3O3F A;  4B1Y B;  3THY B;  3SAG A;  2COP A;  3A5O C;  1QHA A;  1W97 L;  4BVP A;  1UWB A;  4DKW A;  1NJW A;  2EMS A;  1MWM A;  4HTL A;  4DSI A;  3VTH A;  1NGB A;  4BRP A;  2ITG A;  3OYC A;  3H6E A;  3JYT A;  1N32 K;  1NKE A;  3R6M A;  4DFJ A;  1MA9 B;  1P8Z A;  1TAU A;  4X64 K;  2FBY A;  1VSD A;  5HP1 A;  4PL8 A;  4HCB A;  1JXE A;  1LOT B;  2G8V A;  3HVR A;  1YVU A;  3V1Q A;  4TKN A;  1Q18 A;  3EE9 A;  1HBK A;  5AZJ B;  2W41 A;  2J0M A;  2Z1G A;  2HNZ A;  5LMN K;  1NKC A;  2YVC A;  1ESV A;  1Z26 A;  3ZX2 A;  4ISE A;  5GAD P;  3HPO A;  2CQU A;  3AAR A;  3I56 N;  2Z1H A;  5BPL A;  4O0I A;  2OAN A;  3AVJ A;  4EZ9 A;  2W40 A;  3RSE A;  4B1W B;  2G8I A;  3N4Q A;  4DU3 A;  4K43 A;  1HKC A;  1TVR A;  3CCJ N;  3P39 A;  4FJI A;  1QHT A;  4ILJ A;  2HHS A;  4MO4 A;  3PO5 A;  4DUZ K;  1QZ5 A;  1YF5 L;  3CC7 N;  2AL6 A;  1ZBF A;  4CF2 A;  1BGX T;  3CXC M;  3CF5 L;  1M1K O;  1BO5 O;  3UKU A;  3PVL A;  4FOE A;  3KK1 A;  1HNZ K;  4R5P A;  1ASU A;  1NBW A;  4CIE A;  2KQ2 A;  4FJH A;  3EEQ A;  2G8U A;  4JNE A;  4IZ9 A;  1KVC A;  3QML A;  1SGH A;  4ELV A;  4AHT A;  2R7Y A;  5M1F A;  3NE6 A;  2O8D A;  3O6W A;  1YIJ N;  4BRG A;  2WOM A;  4CJF A;  2VWB A;  4AHV A;  5FRO A;  2QI2 A;  3J80 O;  3PZD A;  1O13 A;  3PSF A;  1U45 A;  2Q0R A;  4MDB A;  4O5F A;  3AA3 A;  4CGJ A;  4B3R K;  4CES A;  3GOI A;  4LFC K;  1BQN A;  2P9K B;  1YI2 N;  4W5T A;  3MN7 A;  3C95 A;  4U7B A;  3AVN A;  1RT2 A;  4DMN A;  1S3X A;  4Z4C A;  4DF8 A;  1U6Z A;  2GWJ A;  5AQV A;  1DTQ A;  4LD0 A;  3NF7 A;  4KHY A;  3ZET B;  3K9K A;  1Q8I A;  4E1J A;  4YOR A;  3P1G A;  4O4G A;  3ID8 A;  4I6M B;  1HPM A;  4ELT A;  4CIF A;  3SAH A;  2D4W A;  4CF0 A;  1RT5 A;  5AZI B;  3MAQ A;  1RTH A;  5GAE P;  4M3W A;  3GE1 A;  4OVL A;  4FJL A;  4E0D A;  4F3T A;  3DXM B;  4RG8 A;  1KBL A;  2VG7 A;  2G8K A;  3MDQ A;  4FSV A;  4BRH A;  4DQS A;  1LCU A;  1ASV A;  1XHX A;  5AQU A;  4PY5 A;  2JWK A;  1RIL A;  4IJA A;  3NFA A;  4DWI A;  3SCX A;  2F8T A;  4PKH A;  4ICL A;  2ZGZ A;  4YFU A;  4GV6 A;  1RDW X;  4FWR A;  1BQM A;  3NVK A;  3AVC A;  3EY1 A;  1QSS A;  4H5W A;  3WNG A;  2YI1 A;  1RCH A;  2GUP A;  5CYM A;  1NU0 A;  2YHA A;  1U48 A;  3THY A;  2YNH A;  4KH6 A;  3FZM A;  1HR0 K;  1KC7 A;  3VQP A;  4DV3 K;  4DTR A;  2ATQ A;  4E89 A;  4DR2 K;  3VEY A;  1K6Y A;  3U7D A;  2O4G A;  4EFH A;  2XY7 A;  2A40 A;  4BR4 A;  4EAH D;  3THX B;  4M7Y A;  3F9K A;  3ZCM A;  4IOC L;  3LP1 A;  1KD1 O;  4X62 K;  1D9F A;  4M3U A;  4CJ5 A;  1UAX A;  1E4F T;  1HB6 A;  1NGA A;  3VER A;  3LP0 A;  4B1X B;  1RDD A;  5C0Y A;  4LC9 B;  3O08 A;  2FSJ A;  1JLF A;  4FWN A;  4FLV A;  1ATS A;  4JI1 K;  3PO4 A;  2D0B A;  3M8S A;  5AZJ A;  1NGJ A;  1VQ9 N;  3TAQ A;  3ID6 A;  3VQQ A;  3QB0 A;  4CJV A;  2E5L K;  3HOS A;  3KLH A;  1L5U A;  1IKW A;  2FF6 A;  2O8E B;  2ZF5 O;  3CIP A;  4CFA A;  4YOY A;  4AF1 A;  3U6F A;  5FRM A;  1S72 N;  4CHQ A;  1NJX A;  3RVC A;  1N36 K;  1HKG A;  1QE1 A;  3AVF A;  2BGG A;  4BRM A;  3G10 A;  4IO9 L;  5DM7 L;  1SUQ A;  3NCI A;  4A2B A;  1HNV A;  2UUA K;  2P51 A;  1MIZ B;  3MWP A;  4NXN K;  2WH5 A;  3CI5 A;  3DLR A;  2Q97 A;  3PUF A;  3U3G A;  2G8F A;  3SJH A;  3R9P A;  4B8C A;  2PYJ A;  1K73 O;  3OYI A;  3GL1 A;  3VA0 A;  4KV8 A;  2UXD K;  2AEH A;  1GOC A;  3C6T A;  4WYB A;  4DU1 A;  4CF1 A;  2AA4 A;  1WAJ A;  4LF6 K;  1NWK A;  2HF3 A;  4F3O A;  1Y97 A;  2GWK A;  4OKJ A;  4C23 A;  1QZ6 A;  3AVM A;  5EXW A;  4CJP A;  5J1E A;  4BRQ A;  2P9K A;  3LZI A;  1V4S A;  3D2F B;  4DV7 K;  3TSP A;  3T69 A;  1NM1 A;  3DLB A;  3VQ7 A;  4FJJ A;  3VGK A;  2D11 A;  4JK8 A;  1EQY A;  1NGG A;  4A5A A;  1T3V A;  3QIP A;  3P5J A;  5BR8 K;  4Z4E A;  3DM2 A;  3OS1 A;  3ZET A;  5GIO A;  1X9W A;  5C12 A;  4PQU A;  4I6M A;  3EKS A;  1ZC6 A;  5ELZ A;  1S1T A;  3AGR A;  5AZI A;  2KHO A;  4M7X A;  4HUF A;  4YNQ A;  4C8L A;  4YOX A;  2B6A A;  1TYQ B;  1X3N A;  5I9E B;  4RW7 A;  4WFB L;  1LWE A;  4G1Q A;  5CZ2 A;  2G8H A;  3ULD A;  2UXC K;  5GAH P;  1GC7 A;  3ULE A;  4ID1 A;  3HPG A;  5FLX O;  5CY4 A;  4NO7 A;  4BE1 A;  3V9X A;  3VQ5 A;  4J2B A;  1YVN A;  1E4G T;  4DU4 A;  4IDK A;  2X74 A;  1Q9X A;  1RTD A;  3VEX A;  5GIP A;  2NZT A;  3EYZ A;  3UKR B;  2YJF A;  4NLB A;  4F7G A;  3AO1 A;  4FW2 A;  1VK0 A;  2J0K A;  2HE7 A;  3HVT A;  1VQ7 N;  3QIN A;  3R3L A;  1X9S A;  1CXQ A;  3LDO A;  3AAQ A;  3RRG A;  3CC2 N;  1HLU A;  3MXM A;  4LF9 K;  3CCR N;  5HRR A;  2BAN A;  3BUZ B;  3VQB A;  2VYP A;  4CEO A;  2QWO A;  3OYM A;  4CJE A;  3THX A;  1UA1 A;  1CZ9 A;  3TPQ A;  4DV4 K;  1OH8 A;  3CCS N;  4BR5 A;  1WSH A;  4RCH A;  3BF1 A;  3M3Z A;  4NYF A;  4JKG A;  5T7B A;  4E7L A;  4JD2 B;  3VQ8 A;  2QWP A;  4O5B A;  4KRF A;  3OTO K;  3A0I X;  3BEX A;  1BHL A;  3DLK A;  1XMQ K;  4JN4 A;  3LP3 A;  4DR5 K;  1WBB A;  2F9T A;  2P9P B;  2H3G X;  4E1M A;  1T8E A;  3SJJ A;  2P9N B;  3WEE B;  1IV0 A;  5LY3 A;  5FPN A;  3ZDT A;  2KZM A;  5AQW A;  3CJ9 A;  2JLE A;  1T05 A;  4DR7 K;  2D1K A;  2DPN A;  1JXB A;  2RF2 A;  5JS2 A;  4DV1 K;  5LMU K;  2QXL A;  1IH7 A;  5F1X A;  4E7K A;  2ZJP L;  1OVY A;  1P90 A;  3ZSX A;  4W5R A;  1YJW N;  2ZPY A;  3BP8 A;  5GAG P;  1YJN N;  4GV9 A;  2V7Y A;  4I2P A;  4CGG A;  4FJ7 A;  2GEM A;  2FF3 B;  1BA1 A;  1NOY A;  1HRH A;  1WB9 A;  4IG3 A;  2HHT A;  4DLG A;  3LWL A;  2OPR A;  1SKS A;  1Y19 B;  2EWS A;  3L2Q A;  3VMF B;  4CJQ A;  4K42 A;  1NMN A;  4CED A;  1MK9 B;  2W6K A;  1RT3 A;  2HMP A;  2E88 A;  3QEP A;  4DTP A;  4CD3 A;  1RTJ A;  4FLU A;  4ILG B;  1RTI A;  4YOU A;  3CET A;  3ZX3 A;  3AVK A;  3RR8 A;  3QNO A;  3D2F A;  2ZQB A;  3E66 A;  3T3F A;  2QWR A;  2UU9 K;  1NJY A;  5SZT A;  1SL2 A;  1KXP A; 
#chains in the Genus database with same CATH homology
 1BDG A;  2Q31 A;  4H0Y B;  2V51 B;  4H0V B;  1NGD A;  2J4R A;  3D7E O;  4BRO A;  1M90 O;  5BR9 A;  1Q81 O;  1GC6 A;  3MN5 A;  3MWT A;  1ACA A;  1JDE A;  1RFQ A;  3O1B A;  3ENH A;  3PIP L;  4A5B A;  1HKB A;  1NGI A;  3QBW A;  4B1V A;  4B1Y B;  3H46 O;  5KPT A;  2V52 B;  3CQY A;  3SAG A;  2COP A;  3WA0 A;  3A5O C;  4JKC A;  3A8Y A;  1QHA A;  1W97 L;  3ATV A;  1XQS C;  2E1Z A;  2IVN A;  4QS7 A;  4BVP A;  4MLH A;  2FSK A;  5JVH L;  4DKW A;  4FVU A;  2EMS A;  1GLB G;  1MWM A;  4FWS A;  1K8A O;  2IVO A;  4BRF A;  4HTL A;  1C0G A;  3VTH A;  4K41 A;  5BN8 A;  1TYQ A;  1NGB A;  4BRP A;  3IMX A;  3IUC A;  3TTC A;  3H6E A;  3F9M A;  4A59 A;  1TUU A;  1KAZ A;  3R6M A;  3EKU A;  1ATR A;  3GBT A;  3Q7B A;  4GY2 B;  2Q1N A;  2WUS A;  1MA9 B;  2P9S B;  4CZI A;  4K25 A;  5AQN A;  3G25 A;  1P8Z A;  4ISG A;  5AFU A;  2V7Z A;  4PL8 A;  2E2Q A;  5IJM A;  1BUP A;  3KVG A;  4IEE A;  1LOT B;  1IJJ A;  2EMT A;  2CGL A;  2FDQ A;  4CZH A;  5F2R A;  2YHY A;  3JS6 A;  4H5R A;  1DIK A;  3OBY A;  3VEV A;  2OTJ N;  2OTL N;  1JJ2 M;  4TKN A;  3VTI A;  1Q18 A;  2GEL A;  3EE9 A;  1VBH A;  3SLC A;  4DQ8 A;  1HBK A;  4B1U B;  5H1S Q;  5AZJ B;  2W41 A;  2J0M A;  1H4R A;  2YVC A;  1ESV A;  3FZL A;  2A3Z A;  1HX1 A;  2JWL A;  3O9U A;  3ZEU B;  5AQT A;  4ISE A;  3VF4 A;  3ZX2 A;  2QWM A;  5GAD P;  2CQU A;  3AAR A;  2HBM A;  3C0B A;  1U2V B;  3I56 N;  4IOX A;  5EY4 A;  2I1K A;  2ASP A;  4O8U A;  5BPL A;  2OAN A;  4BRC A;  5AQY A;  3MMV A;  2W40 A;  3RSE A;  4B1W B;  3N4Q A;  4K43 A;  1HKC A;  3FFK B;  3CCJ N;  2ZWH A;  3P39 A;  4H5V A;  2NRV A;  4ILJ A;  1DEJ A;  5FPM A;  5KPR A;  4A62 A;  4ILH A;  1K8K B;  3S41 A;  4MO4 A;  4FO0 A;  1GLA G;  3LDQ A;  1NVL A;  2R82 A;  1QZ5 A;  1QVG M;  1YF5 L;  3CC7 N;  2AL6 A;  3EL2 A;  3CXC M;  4NB4 A;  3CF5 L;  1M1K O;  3CJC A;  3KZB A;  5EOY A;  4GVE A;  1BO5 O;  3UKU A;  3PVL A;  1U2V A;  3L0Q A;  3O9T A;  2P9I B;  4FOE A;  1WUA A;  4JD2 A;  3FP5 A;  1NBW A;  3O5B A;  4WQ4 C;  4DB3 A;  4WF9 L;  4WFN L;  3H1Q A;  4JNE A;  5LJW A;  4IZ9 A;  5AQO A;  4YOV A;  3QML A;  1SGH A;  2P9P A;  2YJE A;  5M1F A;  3O6W A;  4RTF D;  4BRG A;  1YIJ N;  1Q86 O;  2VWB A;  1QQM A;  2F7T A;  2NRW A;  2BUP A;  4JHD B;  2CGJ A;  2P9N A;  2QI2 A;  4BR9 A;  3HI0 A;  3PZD A;  2ASM A;  1O13 A;  3L6Q A;  1HB8 A;  3VES A;  2WC9 A;  2Q0R A;  3CJ7 A;  3DAW A;  4MDB A;  5CE3 A;  4O5F A;  3VF2 A;  3C7N B;  2AP1 A;  4ZRJ A;  1YUW A;  3GOI A;  2P9K B;  1ILY A;  3U9Z A;  3MX2 A;  1YI2 N;  4M63 C;  1YJ9 N;  4YOW A;  3O9S A;  3MN7 A;  4IFE A;  3WQU A;  1D4X A;  1CZA N;  4U7B A;  4J8F A;  1VQN N;  3P38 A;  1NI2 A;  1ST7 A;  1S3X A;  4UY8 O;  4BRA A;  1K9M O;  4PKG A;  5KQ8 A;  1U6Z A;  3ENB A;  2GWJ A;  5AQV A;  1JCG A;  1T44 A;  2WBN A;  4FL9 A;  2X0S A;  2E2N A;  3ZET B;  3K9K A;  2RQ1 A;  1KAY A;  3H3N O;  2NNW A;  4NLC A;  4E1J A;  4YOR A;  3TTF A;  4EHU A;  3ID8 A;  1NGC A;  4I6M B;  1HPM A;  3CD6 N;  3SAH A;  2QTD A;  3OHR A;  3UB5 A;  2D4W A;  3WXL A;  4JKA A;  3HSC A;  5AZI B;  2ASO A;  3IDH A;  3VEO A;  2Q0U A;  2GX9 A;  3O9R A;  3R8E A;  5GAE P;  4EKU A;  1MIX A;  1R59 O;  1H1V A;  2RE2 A;  4BGA A;  4NY0 A;  3GE1 A;  4JAX A;  3G9W A;  3SAF A;  3DXM B;  1KBL A;  3EZW A;  4CZK A;  3L4I A;  2HF4 A;  3MDQ A;  4FSV A;  2BH1 A;  1NJI O;  3FZK A;  4BRH A;  5AQH A;  3MN6 A;  3CCL N;  2D0O A;  1LCU A;  4BG8 A;  3CMA N;  5AQU A;  1BU6 O;  3HM8 A;  2JWK A;  2NRX A;  3E1Y A;  2F9W A;  4IJA A;  4IXC A;  3TTD A;  1VQ6 N;  2ITM A;  4GV3 A;  5C2D A;  2LBB A;  5AQF A;  4PKH A;  4WFA L;  4A57 A;  3VEW A;  1YHQ N;  1N8R O;  3I8B A;  3CME N;  3WT0 A;  4A2A A;  3E9O A;  2ZGZ A;  4GV6 A;  1RDW X;  4FWR A;  3NVK A;  3GG4 A;  3VEN A;  3CJA A;  1VQK N;  5HOO A;  2I7P A;  3EE8 A;  4FWO A;  4IWV A;  4B1Z A;  3DXM A;  4H5W A;  2YI1 A;  3TSQ A;  5AQS A;  5AQX A;  1VQM N;  1T6D A;  4OO1 J;  4JKF A;  5JIC A;  2GUP A;  4CZE A;  2IIR A;  4MLE A;  3LDP A;  4JEP A;  4BRE A;  1E5W A;  3E9L A;  4KH6 A;  3FZM A;  2HRJ A;  1VQ5 N;  1KC7 A;  1X3M A;  2QM1 A;  3U9D A;  3MN9 A;  1C0F A;  3C65 A;  1HJO A;  3VEY A;  1Z05 A;  3U7D A;  4EFH A;  2A40 A;  3BF3 A;  4EHT A;  2P9U B;  4BR4 A;  3VEZ A;  4EAH D;  2QA4 N;  4M7Y A;  4KH5 A;  3BIN A;  2VGM A;  5M1K A;  4GXB A;  2FXU A;  1WOQ A;  4IOC L;  4JKD A;  1KD1 O;  3P31 A;  4CZG A;  1ZBS A;  2BTF A;  1NGF A;  2QEX N;  3LDN A;  3MK6 A;  3W0L A;  2P9S A;  1ZXO A;  1TUY A;  2YHX A;  2ZGY A;  3N4P A;  4WQ4 A;  4PHT X;  3CCU N;  4FPB A;  4BR2 A;  1YIT N;  1E4F T;  1HB6 A;  3HBT A;  1NGA A;  3F2K A;  3VER A;  3KWI A;  1GLJ O;  5ADX H;  2P9L B;  4B1X B;  5C0Y A;  2KLA A;  3O08 A;  2FSJ A;  3QIJ A;  4LC9 B;  4FWQ A;  4BY9 C;  3OW2 M;  4FWN A;  1ATS A;  1VAZ A;  5JVG L;  3O4W A;  5AZJ A;  1NGJ A;  1VQ9 N;  3ID6 A;  3DXK B;  4BRI A;  3QB0 A;  5AR0 A;  3ZEU A;  1Y64 A;  3AGK A;  4IJN A;  2FLO A;  4XH4 A;  3HRG A;  4H0X B;  3HOS A;  1T6C A;  2CGK A;  4P7I A;  3QFP A;  2FF6 A;  1Q7Y O;  2ZF5 O;  3CIP A;  4FWL A;  4KBO A;  4YOY A;  3G6E N;  4AF1 A;  4PL7 A;  5M1O A;  1S72 N;  3IKM A;  1ISN A;  3RVC A;  3AY9 A;  4ZRK A;  1HKG A;  4FPA A;  1K8K A;  3EO3 A;  3A5L C;  4BRM A;  1JCF A;  1SQK A;  1DKG D;  3AU5 A;  5TKY A;  4IO9 L;  1EO1 A;  5DM7 L;  4BC5 A;  5AQQ A;  4A2B A;  3LM9 A;  5AQR A;  1MIZ B;  3PLA A;  3MWP A;  2I1J A;  3MCA B;  2P9I A;  4R79 A;  1Q82 O;  3ATU A;  5KQD A;  1NMD A;  5JMV A;  1VQL N;  2WH5 A;  3CI5 A;  2Q97 A;  4IDH A;  3SBG A;  2NLX A;  3R9P A;  3SJH A;  3DLL L;  1K73 O;  4BQL A;  4FWM A;  3GL1 A;  4H5N A;  4CI6 A;  4WQ5 C;  3O8M A;  4FWK A;  2E2O A;  2AEH A;  3WQT A;  2KKZ A;  2Q36 A;  4WYB A;  4FOI A;  5C10 A;  4Y0W A;  4JHD A;  5B8H A;  3UE5 A;  5GIN A;  3CPW M;  4AM6 A;  2AA4 A;  5JLF A;  1GLL O;  1RGI A;  3CQX A;  1NWK A;  3FLV A;  1MDU B;  2HF3 A;  2GWK A;  3CHW A;  4C23 A;  4IEI A;  4JK7 A;  3NVM A;  1QZ6 A;  2CH5 A;  5DM6 L;  5EXW A;  2A6A A;  5EX5 A;  3C7N A;  3I33 A;  3KK7 A;  1VQ4 N;  5BN9 A;  4BRQ A;  2E1Y A;  4HWI A;  4PKI A;  2HOE A;  1HUX A;  2P9K A;  3D2E B;  1V4S A;  3D2F B;  5M1P A;  1BG3 A;  3TSP A;  4BC2 A;  2D2Q A;  1GG3 A;  3T69 A;  3B8A X;  3J8A A;  1NM1 A;  3H1V X;  1GLF O;  2E2P A;  5BRH A;  5AQM A;  4XEI A;  5BRD A;  3VGK A;  3I55 N;  2D11 A;  4JK8 A;  1EQY A;  1NGG A;  1BA0 A;  2GTD A;  4A5A A;  4CZM A;  2FJ9 A;  1T3V A;  2NRT A;  5AQJ A;  3HOT A;  2ZJR L;  3CCM N;  3C6H A;  3U8Z A;  3X23 A;  4KH4 A;  2NRZ A;  3ZET A;  2ABD A;  5GIO A;  3SMS A;  4DXA B;  4YOT A;  3ULE B;  3ZYY X;  5C12 A;  3Q7C A;  5ADX A;  3K9J A;  4JKE A;  1ZC6 A;  3EKS A;  3KHY A;  1YXQ A;  3A5M C;  3H3O B;  4I6M A;  5ELZ A;  5AQZ A;  4DCH A;  3QBX A;  5BRF A;  3AGR A;  3CJ1 A;  5AZI A;  1NTI A;  2A42 A;  4HDQ A;  2HBK A;  2KHO A;  3OBW A;  4QS9 A;  4M7X A;  2YHW A;  4YOX A;  2FSN A;  3QDK A;  3D6R A;  3VGL A;  5TKW A;  5EVZ A;  2HBJ A;  1NLV A;  1TYQ B;  3SBT A;  1X3N A;  3CJB A;  5I9E B;  1KC8 O;  4WFB L;  1QQO A;  3CER A;  1QQN A;  5CR4 A;  5JVL A;  3VOV A;  3FR0 A;  3KWG A;  2NRR A;  1ATN A;  5GAH P;  3MCP A;  3CCV N;  1GC7 A;  5FPD A;  3ULE A;  4BC4 A;  4BC3 A;  4H0O A;  3WXK A;  3VPZ A;  3J7Z O;  1SZ2 A;  3G4S N;  4CBW A;  3FLC O;  4NO7 A;  4BR0 A;  2PAV A;  3NMU A;  4CZJ A;  1QVF M;  3WXJ A;  1YVN A;  4F9O A;  3SK3 A;  1BWF O;  1E4G T;  1GGO A;  4IO8 A;  3LL3 A;  1JCE A;  3VEX A;  1KAX A;  4BR7 A;  5M1N A;  5GIP A;  2NZT A;  3UKR B;  2YJF A;  4YDU C;  4F7G A;  1OKJ A;  4NLB A;  1J6Z A;  2DIK A;  1XUP O;  3A5N C;  4OPH A;  2J0K A;  2HE7 A;  3DWL A;  2WFB A;  4JKG B;  3VET A;  1V4T A;  3O80 A;  1VQ7 N;  4JKH A;  5AQP A;  3R3L A;  4BRL A;  3FE1 A;  3F5T A;  2NRH A;  4A61 A;  4H0T B;  4MO5 A;  5LJV A;  3LDO A;  3AAQ A;  3RSE B;  4G9Z A;  3CC2 N;  1SAZ A;  1MK7 B;  1NGE A;  3MX5 A;  1HLU A;  3P4I A;  4MDA A;  5AQL A;  2QWQ A;  3C6A A;  3T7Z A;  1G99 A;  4BG9 A;  4BRN A;  5HL7 L;  2YCH A;  3CC4 N;  3CCR N;  4OPA A;  5BRE A;  3BUZ B;  3PIO L;  2VYP A;  2QWO A;  1GLC G;  3CCQ N;  3AAP A;  2P9U A;  5CHI A;  4RWT A;  3FZH A;  3TPQ A;  4ZRI A;  5F0X A;  2A41 A;  3UKR A;  4H5T A;  2CB8 A;  4B9Q A;  4BR5 A;  4DHY A;  5MLC Q;  3CCS N;  1VQ8 N;  4RCH A;  2ZJQ L;  2D0P A;  3BF1 A;  3CPE A;  3M3Z A;  3UKU B;  4JKG A;  3R1X A;  3WUH A;  2UYT A;  3VF6 A;  4CZF A;  4XH1 A;  4JD2 B;  3HTV A;  2QWP A;  3WXM B;  4BRK A;  3EN9 A;  1MWK A;  2Q2R A;  3ENO A;  2P9L A;  3A0I X;  3BEX A;  4H0P A;  5M1Q A;  5C2F A;  2E8A A;  4WCE L;  4WQ5 A;  4JN4 A;  4FWP A;  4BVO A;  5AQK A;  1NGH A;  3WXI A;  2F9T A;  2P9P B;  2QWL A;  2H3G X;  3GDQ A;  1YAG A;  3JXU A;  1DT9 A;  2P9N B;  4CZL A;  3ZX0 A;  3DXK A;  3WEE B;  1KQS M;  2QWN A;  3IVF A;  3VGM A;  4CD1 A;  2J0J A;  3H45 C;  5LY3 A;  5FPN A;  3ZDT A;  3EPY A;  4XH5 A;  2VGN A;  3CJ9 A;  5AQW A;  5AQI A;  2D1K A;  3IFR A;  3L4Q A;  3QIC A;  3O9Q A;  2DPN A;  4Z94 A;  1J19 A;  5AFU H;  4AM7 A;  2QXL A;  3HZ6 A;  5F1X A;  4BRD A;  5E26 A;  2ZJP L;  1OVY A;  1P90 A;  3OA9 A;  4CBU A;  1YJW N;  5E84 A;  4JK9 A;  4QS8 A;  2PBD A;  3LDL A;  2ZPY A;  1VQP N;  3BP8 A;  2PFU A;  3DJC A;  3LM2 A;  5BPN A;  1GLD G;  4U67 L;  5GAG P;  1GLE G;  4L3Q A;  2D10 A;  1YJN N;  2V7Y A;  3WEE A;  1W2B M;  4GV9 A;  2RHK A;  4CJ7 A;  2GEM A;  2FF3 B;  1BA1 A;  5FPE A;  2HBL A;  4O8K A;  5JLH A;  4BQZ A;  2YX6 A;  3U4L A;  3QFU A;  4BGB A;  1IG8 A;  2HST A;  3TU5 A;  2VCP A;  1Y19 B;  3G71 N;  2EWS A;  3M1F A;  3M6G A;  3FGU A;  3VMF B;  1BOT O;  4HDO A;  3AU4 A;  4K42 A;  4GNI A;  5BPM A;  2IVP A;  1MK9 B;  1EF1 A;  5KPZ A;  2HMP A;  2E88 A;  3FZF A;  4ISF A;  4EIA A;  3E9P A;  4JKB A;  4C1N I;  1SS6 A;  4CD3 A;  1DGK N;  3CCE N;  4C1N K;  4IOA L;  1X9J A;  4ILG B;  4YOU A;  1S22 A;  3CET A;  3O1W A;  3TSU A;  1RDU A;  3W3D A;  3ZX3 A;  1VQO N;  4CBX A;  2CH6 A;  2E20 A;  3D2E A;  4YL8 A;  3D2F A;  2I7N A;  2QW9 A;  3SMP A;  3E66 A;  1Z6R A;  2QWR A;  5C15 A;  4H03 B;  5AQG A;  4CYE A;  1VBG A;  1XC3 A;  2A5X A;  3M5R A;  3U8X A;  1KXP A;  4YDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...