4JKBA

Open and closed forms of v1788d human prp8 rnase h-like domain with bound mg ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRDTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 67
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkbA01
4JKFA 3E66A 4ILGB 4JKAA 4JKBA 3SBTA 3E9PA 3SBGA 4JKGA 4ILHA 3E9OA 4JK8A 4JKDA 3ENBA 4JK9A 4ILJA 4JKCA 3E9LA 4JK7A 4JKEA 4JKGB 4JKHA
chains in the Genus database with same CATH superfamily
1KCFA 3K58A 1OH8A 4FWSA 3NHGA 3VQ9A 4BDZA 4CJ7A 4BROA 4CJKA 1GC6A 4DUYK 2XO7A 3RSEA 1TL3A 2G8IA 3AVKA 4E7JA 2E8AA 4KKOA 1GG3A 3S3OA 4DQSA 1X9SA 1KBLA 1VAZA 2YHBA 3O1WA 2YI1A 3CERA 4HDOA 3AVBA 4KHUA 1RT2A 3VQDA 1NNEA 1VQKN 4L3QA 3C0BA 4CZJA 1LAVA 2YHAA 1GOAA 4DTSA 4W5NA 4MDAA 2HHXA 3ZYYX 5J2MA 3CCRN 2HOEA 2UU9K 2ITMA 2QM1A 2XY5A 2G8WA 4DQIA 5CR4A 5E84A 2P9PA 1JLCA 2NRVA 1YVNA 4CGHA 4OPHA 2E1YA 4BWJA 1S9GA 1XNQK 3I8DA 2W6LA 4CIEA 1T3VA 4IKFA 2HNDA 2IAJA 3VTHA 3TTCA 4OPAA 5HRRA 4BRCA 1XC9A 2ZM6K 4PWDA 4DTMA 3ZSVA 5C0YA 3CC2N 4HTLA 1Q18A 3K59A 1MIZB 2DFHA 3BY5A 1RBTA 4AM7A 5DK5A 4EZ9A 3ATUA 4JKEA 2X6SA 3KHYA 2NLXA 3MWTA 3AU4A 3BEXA 5CE3A 1XQSC 2X74A 3CM5A 3WXJA 2O8DB 2PZSA 3SBTA 4CEZA 3VEVA 1HB6A 2OTLN 4FXDA 2HVHA 2ASPA 1U47A 3TAMA 3O4WA 4FWKA 1UWBA 2NRTA 2DPNA 2F9TA 3ZT0A 3VQPA 3SQ0A 3B6OA 4KB1A 1C0MA 4IEEA 2EHGA 3AVHA 1OKJA 4JKHA 1IG8A 4WQ4A 5FROA 3SNNA 4B8CA 4BRNA 1E4FT 1A5WA 5KGXA 1HJRA 2RHKA 3CFOA 1VQ6N 3AAPA 1QE1A 2W6KA 3RR7A 4C8KA 4DSIA 3VF4A 3VGMA 4M7YA 3FE1A 4JKGA 1HUXA 3TAEA 3THXA 3HZ6A 3WXKA 4AF1A 4BRPA 5CYMA 2P9UB 3RTVA 3MXJA 1Q8IA 4BDPA 2E6MA 4H0PA 1SL2A 1SUQA 3MK6A 1LW0A 3L3VA 5J2QA 1WB9A 2UYTA 3HP9A 3VERA 1DTTA 4B3TK 4W5TA 3B6PA 1VHXA 1M90O 3V1OA 4FWMA 1UA0A 1EWQA 3I56N 3BZCA 5C2FA 3VQEA 3THXB 3E9PA 2OZMA 4FJJA 1Z6RA 4LD0A 5C12A 4GNIA 3LANA 4FLZA 2AJQA 2O8CA 1EX4A 1TYQB 4CESA 3T1YK 1XHXA 2OTJN 3L8BA 5AQMA 4CF0A 2O4IA 2QXLA 1NG9A 1EETA 2JWKA 2ASMA 5FPEA 1KFSA 3FZLA 3P31A 3VTIA 1NJZA 4E1MA 4FWPA 3CQXA 1YITN 3KK3A 2GV9A 4CEQA 1TKTA 3V9WA 4F3OA 1GOCA 1ATNA 4GKJK 1QQNA 1BO5O 3MAQA 1WSFA 2P9SA 4NYFA 5SZTA 3CM6A 5B8HA 5JMVA 4RW6A 1EXQA 1RT3A 3V6DA 3FGUA 3NF7A 1JLGA 1S22A 3SPYA 1SL1A 1QZ5A 2YNFA 3TSUA 4Z4IA 1WOQA 4GVMA 3SK3A 1HYSA 4CHZA 2P5GA 3CQYA 2BE2A 4B1UB 4M63C 5C24A 2YVCA 3CJ1A 4GMJB 3V9UA 1DKGD 1W97L 4C1NK 5C10A 4DSKA 2B5JA 4DQ8A 3DJCA 4JI8K 3O9TA 1ZBHA 1BDGA 5EOYA 5C25A 2CGLA 2VGNA 4ELUA 3IMXA 4CBUA 4ZHRA 4DSEA 2VG6A 3LAMA 4YOVA 1E3MA 2D4WA 1NMNA 3J7ZO 5FPDA 1BIUA 2D0CA 3SV4A 4O55A 1VQ8N 3QERA 4CGIA 4J2AA 1WSIA 3L4IA 1MK9B 3CCMN 4H5RA 3TTDA 1LV5A 4CZLA 4JHDB 4XH5A 4XEIA 3FFIA 3RRHA 3DLKA 2GX9A 3MN7A 1T44A 4YORA 3EZWA 3O3HA 5C15A 3KVGA 3HT3A 3NH1A 3V9XA 4JI0K 5FDLA 1EP4A 1QSSA 4O4GA 4IWVA 2F8SA 1RDDA 1Y97A 1IO2A 4CZFA 3H1QA 2J0JA 2HF4A 1G15A 3HVRA 4DS5A 1A5VA 4FJMA 4CZEA 1ACAA 3AVMA 2KHOA 4A59A 4WF9L 4ILHA 3FZHA 1BISA 1T6CA 1HNZK 1W9HA 4FVUA 5FPNA 3SAHA 4DU1A 3QINA 4CE9A 2KZZA 3WEEB 1JLBA 3SUPA 4KH5A 4YDUA 1H1VA 2IGIA 4CJTA 5AQHA 5J2PA 4ICLA 1R0AA 5LMNK 2G8KA 3O9RA 4MLHA 3VESA 1D9DA 5D3GA 2ZD1A 4DR6K 1DTQA 2Q97A 3IKMA 3KTQA 3UKUB 4FLYA 1BQNA 1DEJA 3QEIA 2I1JA 1L3VA 4M3YA 3H3OB 4BRDA 3KK2A 1VBGA 2GUIA 3C95A 1ST7A 3M8RA 3ZDTA 1S72N 4GY2B 4FW2A 3Q7CA 3BZKA 1NWKA 1MDUB 3HRGA 5H1SQ 2CH5A 4AHCA 3RWUA 5C2DA 3P4IA 2V52B 1IG9A 1LW2A 4OPKA 4QS8A 3CMAN 2UUBK 3E01A 4F9OA 4M7XA 1NGDA 3O80A 1HPMA 1DT9A 4OLAA 4FL9A 3SYZA 4FJNA 2V7ZA 5F1XA 4WFBL 1S6QA 3I8BA 3TAPA 1QVGM 1X9MA 3SMPA 2P9NB 5HLFA 4N41A 1P90A 1NLVA 3DXKA 5HL7L 4ISGA 3O9SA 1VQON 3U9ZA 1VQLN 1JCEA 4NCAA 4M41A 1ZC6A 1T6DA 3V81A 2QKKA 4ILJA 3KK1A 3CCVN 2GWJA 3I0RA 3GE1A 4Z0UA 4FJ7A 3FZMA 1L3TA 1NGHA 4KO0A 3OBYA 4AHRA 4FWRA 3O08A 5AQZA 1VQ5N 3QESA 3BUZB 1K9MO 3FLCO 1RDAA 2YNGA 3SQ2A 3UKUA 3MX5A 3F73A 3AU5A 3NGIA 4KFBA 1S1UA 3SBGA 1KFDA 3LP1A 2O8FA 4JYAK 2CQUA 3KWIA 1IV0A 1NGJA 1CXUA 2IS3A 4O8KA 3K5OA 4H5TA 1YTUA 1SZ2A 2G8FA 2I7PA 1Z25A 2VWKA 4IBNA 3N4PA 3CQ8A 1TV6A 3QEVA 4KREA 5GINA 5GADP 3L2VA 1KRPA 4H03B 1YJWN 4FJXA 1N6QA 3KLEA 3QB0A 4AQYK 4CK1A 4I6MA 4CJEA 1KAYA 1TK8A 3WNFA 4XH4A 4FJ8A 5SWMA 4OX9K 2R82A 4EHUA 4W5RA 4I6MB 4H5VA 3LZIA 1NVLA 1XI1A 2O8EA 3OS1A 5BPLA 4JD2A 2O8BB 2F9WA 1YTAA 1KVAA 4NLBA 3K5LA 3NDKA 2OCEA 4KPYA 4JLHA 4J8FA 4JI6K 3Q7BA 3SI6A 2ZE2A 3M8SA 3RMBA 2FBXA 4MFBA 2XY8A 1HR0K 3PV8A 4JKFA 3CCSN 3CMEN 3CD6N 1GLEG 1C0UA 1RT5A 4M3UA 3C6TA 4CJQA 4TKNA 3DWLA 4I9QA 3R3LA 3O8MA 3KLFA 3N4QA 4FSVA 1JLEA 4YL8A 1ILYA 1S1VA 4E89A 4Y0WA 4CFBA 4IOCL 1U2VB 3EE8A 1NU0A 3KWGA 2WFBA 4CIFA 1NJYA 4JV5K 4L8RB 1EQYA 2KLAA 3CCJN 3AO4A 1WSHA 3LDQA 3P5JA 3A8YA 4R79A 2WH5A 4FVMA 2RPIA 3EYZA 4JRQA 4YHHK 3TU5A 3UB5A 2YV0X 2HHTA 2WC9A 4NO7A 2HNYA 4OJRA 4QOZB 1X3MA 4I7FA 4CJVA 4PHTX 3OBWA 5JS2A 4KV8A 1HPZA 1N34K 1JLAA 4I9LA 1XMQK 1W0HA 4B1VA 3D7EO 4DQPA 2F7TA 5GAGP 2OYQA 4FLVA 4NB4A 5AZJB 2BANA 4BR2A 4CJUA 1IH7A 4CZGA 1U04A 4CGFA 1QTMA 3OYHA 1EKEA 1NK7A 1HMVA 3NH2A 4IFYA 4BRIA 5JLFA 4B3SK 3E66A 1CZAN 5BRFA 3DLBA 1RT6A 1QSYA 4BR0A 4OKJA 3W0LA 1E4GT 3OW2M 4FK0A 5IWAK 4Z94A 2YCHA 1KC8O 1LCUA 4DSJA 2YNIA 3SJHA 3HBTA 4RW7A 1SKWA 3EY1A 4H0YB 3KJVA 4BE1A 3OHRA 4OLBA 3FZFA 4CIGA 1U2VA 2OPSA 4M3XA 1JXBA 2IIRA 3AY9A 3WQTA 2HHVA 3OY9A 3NGYA 4OGCA 1RBVA 4CBXA 5EXWA 3UKRB 3G4SN 3IUCA 4CK2A 4DV0K 4ZTJA 3KD1E 2CGKA 1S5JA 3ZT4A 1XMOK 5MLCQ 1BIZA 2X78A 5EVZA 4LSLA 3ZSYA 4HTUA 3MX2A 4CF8A 4DU3A 1BG3A 3O6WA 3ULEB 3WEEA 3QBXA 1J54A 4CZIA 1SKRA 4I2QA 3QEXA 1BUPA 1J5OA 1FK9A 5ADXH 5T7BA 4YNQA 2J0KA 3CCQN 3P38A 3K9JA 3LP2A 4N47A 4MLEA 2ZGZA 3AARA 4IG3A 4LF9K 3CJCA 1VSJA 2P9IA 5AQTA 3QNNA 4FK4A 2P9PB 3ISNC 3A5NC 5FPMA 4IJNA 1OVQA 3VEXA 3VENA 2UUAK 4DV7K 1X3NA 3DLLL 4X66K 3CPEA 4CEFA 4FYDA 3K0SA 3LDNA 4HUGA 3NH0A 4E7HA 1SL0A 3HPGA 4KTQA 4CHOA 4A5BA 3ZSWA 4EP4A 3L4QA 3QLHA 2ZJRL 3CC4N 1LWCA 3T69A 3TARA 2HRJA 4CJFA 3EKSA 5I3UA 1C6VA 3SMSA 2LBBA 5BN9A 4KHQA 2JLEA 3WXLA 2BDPA 4FPAA 1YT3A 4RTFD 2Q36A 3HOSA 2KFZA 2ETJA 1HBKA 3CFPA 3CIPA 3W3DA 2GTDA 4YOTA 4C23A 3HVTA 1BU6O 3A5LC 3VF2A 2Q0RA 4DXAB 5HP1A 4CCHA 4C1NI 3OS2A 2G8HA 1BCMA 1K8KA 3OS0A 4CHNA 5CZ1A 2XY7A 3O3GA 3OYMA 1VSKA 3TAFA 2VWJA 1SKSA 2VYPA 4KRFA 4FWOA 4U7BA 3KKRA 3TSQA 2A6AA 2DFEA 3MXIA 1OVYA 3SQ1A 3O9UA 3G25A 1CLQA 4DTPA 1VQ4N 1HNVA 5E41A 3S9HA 3SAGA 3ZSOA 1DIKA 4CD3A 4BVPA 1JJ2M 3K9KA 1BOTO 4C8LA 1A5XA 1Q82O 4CGJA 2A3ZA 4M3WA 3L3UA 3M3ZA 3NMUA 2VQFK 2E2PA 4HUEA 3HYFA 2PY5A 4FJLA 2HB5A 2DFFA 1VSIA 4CHQA 4OVLA 3CXCM 2E2NA 1WNSA 3VN5A 3K2PA 1B9FA 3ZSQA 4DWIA 2YJEA 3IDHA 5M1QA 2E1ZA 1TUUA 5AQSA 5M1OA 3EZ5A 3OJSA 2F96A 1OH6A 4AHTA 4ELVA 3NBPA 1NGCA 4YOYA 4CJWA 2HHQA 4M45A 2YNHA 4K41A 4FLUA 3OVNA 4MQ3A 1M1KO 1KLMA 1KLNA 4ELTA 2G8VA 4PKGA 4R5PA 3HP6A 3K57A 5AQUA 1K8AO 3OYDA 2JGUA 4FCYA 3RMCA 3EO3A 4JI5K 3H08A 1EF1A 3VMFB 4K8ZA 1F21A 2NUBA 5KPZA 3QICA 3MN6A 3ASMA 3THYB 3CFRA 5I9EB 3ALYA 4J2DA 1JL2A 5AQYA 4B1WB 2J4RA 3ID8A 3ZX3A 2HSTA 3K5NA 5BRHA 4CF1A 4DQQA 5KPTA 4M3ZA 3HI0A 3OTOK 3C6AA 1XNRK 1WAFA 1HX1A 3KLHA 3CHWA 3P83D 4DFPA 1O13A 2A42A 3CJ9A 1KXPA 4F4KA 3LPTA 3EEQA 3E9LA 1QZ6A 3IFRA 1K8KB 4IO9L 1NGGA 2GEMA 1J53A 1GLBG 1WAJA 2RN2A 3R8EA 1TGOA 3LM2A 4KH6A 3IG1A 3ZX0A 3OJUA 3DAWA 1BA0A 2NRXA 1I94K 3RSEB 1RILA 4ZRJA 3OYGA 1S9EA 3KK7A 4DKWA 5DM7L 3MN9A 2O8FB 4CJPA 4PUOA 2Z1JA 4QAGA 4O5FA 3QIPA 3WNHA 3TPQA 4A2BA 4CZHA 3WQUA 1RTJA 5F0XA 2HVIA 4BRFA 3VQ6A 3L0QA 1XUPO 1RCHA 3X23A 1JDEA 3OYFA 3A2FA 4CJ5A 1TUYA 3LPUA 3T19A 1ZYQA 3NF6A 1B9DA 1RDCA 1ATSA 4CGGA 3VF6A 2O8DA 2O8EB 4EP5A 1W2BM 3VETA 4FJHA 3MEGA 1BQMA 5AQWA 4PL8A 4CYEA 3RVCA 4DTRA 2E5LK 2BTFA 4M3TA 4HWIA 2YKMA 1GOBA 3C7NA 4JS4A 3G71N 1SAZA 2R7YA 1E5WA 3CCUN 2RQ1A 5AFUH 3NVKA 1VQ7N 4HHTA 4DV3K 3C7NB 2A1SA 4JKGB 1L3SA 1ISNA 4FJGA 1I3AA 4WQ4C 2V51B 3DRSA 3DMJA 4CW7B 1TAUA 1G99A 3TSPA 4A5AA 2O8CB 4BRQA 2QWRA 4JS5A 2F8TA 1RDUA 3FR0A 5BREA 2AL6A 3T1HK 4DU4A 2ZQBA 3KKSA 3OA9A 4CFCA 5JLHA 3D2EB 4KTWA 1TL1A 3UIQA 3J7YP 2UXDK 2Z1HA 1TVRA 2ZJPL 4JI4K 4C8NA 3IAYA 3RMDA 1U6ZA 3TTFA 2IC3A 4FWLA 3WXMB 3VQQA 3LDSA 3G0ZA 3PIOL 5BPMA 2A5XA 4B9VA 1FXXA 3KIOA 1ASUA 2KZMA 4FO0A 1VSEA 1Q9YA 4ID5A 1WSEA 5AQFA 4BVOA 1XWLA 2QKBA 3HM8A 3O9QA 4F2RA 1KAZA 3G10A 1NJXA 3VQAA 4DV6K 2EWSA 1NTIA 3SUNA 3NF9A 5JVGL 3FLVA 4NXMK 4CZKA 2QWMA 1WSGA 2QXFA 5AFUA 4B9MA 1HYZA 4EZ6A 3G9WA 1RBUA 1UAXA 3DI6A 3DXKB 4WFNL 1S6PA 2ZWHA 3QNOA 5LL6Z 2GELA 3LZJA 1MWMA 3V1RA 1K6YA 5M1NA 3MCAB 1C1BA 4JK7A 3CETA 1NMDA 1ZBIA 4BR5A 3IVFA 3WT0A 3U4LA 3LDLA 4DB3A 2FXUA 5A2QO 4DSLA 1S3XA 4DUZK 3CJ7A 1JLQA 1YVUA 4GVEA 3MECA 1HNXK 4LF5K 1C0FA 1NGBA 2JWLA 3ID6A 5AZJA 3TI0A 1OH5A 4GV3A 4H4MA 4BG8A 4RWTA 1U45A 2D0OA 1JLFA 2HW3A 5AQGA 3GOIA 3MXMA 4FJ5A 4RW4A 1VSHA 1Q9XA 2WTUA 1HNWK 1SGHA 4N56A 4GV6A 2PAVA 2VG5A 3U6FA 4O44A 1KVCA 4CI6A 3VQCA 3OYKA 3LDPA 5EX5A 3LWMA 3CCEN 1MIXA 2B4JA 3H45C 2WBNA 2PYJA 5AQOA 4IG0A 4J2BA 3B8AX 2P9LB 2PYLA 3L2QA 1KC7A 1ZBSA 3OYBA 1P8ZA 2FC0A 4G9ZA 4CJSA 1N36K 3AVFA 2YHYA 4JAXA 3U3GA 1YIJN 3DLRA 5AQKA 3R1XA 2FJ9A 5AJ3K 5M1KA 5M1PA 3SAFA 4GV9A 1J5EK 4H0TB 3TANA 3M8QA 2HE7A 3VPZA 4DLEA 1L5UA 3OYCA 3DLEA 1BHLA 3AAQA 3VEZA 4EFHA 5FRMA 2W41A 1K73O 3R6MA 2NRRA 3V4IA 1VRUA 1HNIA 3SCXA 2D0PA 1BI4B 4BC3A 1RDBA 3V1QA 3U8ZA 5CHIA 3AGRA 3DRPA 3F2KA 4B9SA 1YJNN 2KFNA 1IBMK 1X1PA 1JXEA 3PIPL 1U49A 2Q0UA 3R9PA 4UQGA 3EE9A 4PKIA 4WQ5C 3HK2A 5CY4A 1BWFO 5K14A 3PX4A 2E20A 3HSCA 5KRSA 3QETA 4ISEA 1QQOA 4XIUA 3WA0A 3OYLA 1B92A 1RNHA 1WBBA 5HROA 1KQSM 3ZX2A 3S3MA 3VQ5A 3H1VX 5BN8A 3EPYA 1NK9A 1NKBA 2FLOA 1HYVA 2J0MA 3RR8A 5FLXO 1KVBA 2HBMA 4E1NA 2V7YA 2XRIA 1TK0A 1IBLK 3D2FA 4O5BA 2NRHA 3GG4A 1GLAG 4XH1A 2QWQA 5E26A 1HKCA 1ATRA 4GW6A 2VQEK 1WLJA 2HBKA 3SLCA 5KPRA 3A5OC 1RT4A 4BR7A 1C1CA 1D5AA 4NYNA 4Q5VA 3U8XA 3ULDA 2NNWA 4FPBA 1JKHA 2ZGYA 3VGLA 4DR3K 5HOOA 2KTQA 2P9NA 3QIJA 2UXBK 4Z4GA 2P9KA 4DTNA 3J7AP 3THWA 5J2NA 1KSPA 4LH5A 4C8MA 4B9UA 4H8KA 1U48A 3O4NA 5JVHL 5BR8K 3DM2A 2Z1IA 1GLJO 4O8UA 3ENHA 3PZDA 2QWLA 3LDOA 4U67L 1IBKK 3NVMA 3QFUA 4BG9A 4BC5A 4BC4A 3PUFA 4CJRA 1CZ9A 1L3UA 4DV1K 1YXQA 1J9AA 5I42A 3H46O 3L2RA 3K5MA 3D2FB 2FDQA 1C1AA 4K43A 5LY3A 5ADXA 3VQBA 1REVA 2P9SB 1N33K 4FLTA 1RGIA 3M5RA 4IXCA 4CEEA 3PX0A 4JI7K 3MCPA 1CZBA 4BGBA 3MEEA 2FBYA 4H0VB 2CH6A 2ZF5O 3IRXA 1ASVA 5J1EA 1I39A 1Z05A 4A2AA 4JKDA 1VSFA 1BA1A 5KQ8A 1TAQA 4LSNA 4JI1K 4E19A 3NF8A 3AA4A 1IKWA 3PVLA 2PBDA 3SPZA 5KRTA 3VA0A 1HJOA 2QWOA 4JD2B 1W7AA 2ATQA 4BY9C 3D0PA 1ZXOA 3U9DA 4WYBA 4CF2A 1D4XA 2P1JA 4DR2K 1N32K 3BF1A 5GIPA 2E2OA 2D0BA 3KLIA 3ZT1A 2P5OA 3JAMO 1NK6A 2ZJQL 4A57A 4CGDA 4KHNA 2AP1A 1BCOA 1SS6A 4B9QA 3TABA 4KI6A 3T3FA 1CXQA 3A5MC 1VSLA 5TKWA 1D9FA 4FJKA 5EU7A 3AVGA 4BRMA 4PKHA 4QS9A 4JRPA 3PY8A 1SV5A 4LFCK 4BREA 4CJ4A 5AQPA 1NM1A 3MDQA 3E9OA 2GUPA 3KZBA 5CYQA 2Y1IA 3LP3A 3S3NA 2WOMA 1V4TA 3EKUA 2YHXA 3AVLA 3AVJA 4DHYA 3VA3A 4KH4A 2XY6A 1Y19B 4IDKA 3VQ7A 3WNEA 4Q0BA 4CEOA 3EL2A 4B08A 3NAEA 1NJIO 4DS4A 4LFBK 3FZKA 4WFAL 4Y1CA 4DFJA 5LJWA 4MO4A 4JKCA 1RBSA 4CK3A 1TKDA 4JHDA 1T05A 3AGKA 3VEWA 3QMLA 3CJBA 4BRAA 3F9KA 4FZZA 4DF8A 3QBWA 4A61A 4LC9B 3H6EA 1T8EA 5BPNA 4H0OA 2IVOA 4BRKA 2OPRA 4W5QA 1NOYA 1Y64A 2NRWA 5EY4A 1J19A 4OKEA 1YAGA 5HRNA 2E4LA 4FOEA 1JCFA 2KQ2A 1EWRA 2QTDA 4JK9A 1WN7A 2HHHK 3GBTA 4CECA 3ZETA 3FP5A 4HDQA 1R59O 2HNZA 2NRZA 4FOIA 3OYAA 2UXCK 4PA1A 2BH1A 3CF5L 2IVPA 4GKKK 4E1JA 3U7DA 1NGEA 4TSXA 1TKZA 5KTQA 2D1KA 2D2QA 2P51A 5DM6L 4E3SA 4YY3K 3LM9A 3ZETB 4WQ5A 3OYEA 4Z4FA 2Y1JA 1U4BA 1NK0A 2QK9A 3UKRA 4RW9A 1T7PA 3ITHA 4JEPA 4HCBA 5AQRA 4CEDA 2IVNA 4MO5A 4RW8A 4DR1K 4FZYA 4BR9A 3V9SA 3SUQA 4I2PA 2D0AA 1X9JA 1QHTA 4JKBA 3MWPA 4CVNE 4DFKA 2YJFA 1DGKN 4WE1A 1YI2N 3O4QA 3NFAA 2PFUA 1XC3A 3WNGA 4F8RA 4DCHA 4KAZA 4B1XB 4BRGA 3SV3A 4NCGA 1C0TA 2QI2A 3HXMA 2FBTA 2P9UA 1NK8A 5ELZA 2XHBA 3C6UA 3AVIA 4IDHA 3ZEUA 1J6ZA 4KHPK 1LWFA 3ZT3A 3CG7A 4AH9A 3LL3A 4CEBA 3HSTB 3S41A 3ZCMA 4ILGB 1KTQA 1Q86O 4IOXA 4UY8O 4O0IA 2HBLA 5AQLA 2W42A 4DFMA 1QHAA 3BGRA 1IKXA 2HMIA 3EN9A 3BF3A 1VQ9N 2OA8A 2VCPA 2HHSA 3DXMB 3JYTA 4B3OA 2YKNA 2HBJA 5AQVA 2BGGA 1UOCA 1JCGA 5HRPA 3M1FA 1FW6A 3ENOA 3HL8A 3L2WA 1TKXA 3DLGA 3A0IX 4H5WA 1RT7A 1WBDA 2ASOA 2H3GX 4DMNA 4DV2K 4LF8K 1HB8A 2WONA 3P39A 2WUSA 3VOVA 5AQJA 2O8BA 1IJJA 1HQEA 4P7IA 4B9TA 1FKPA 3OYNA 3KD5E 1QS4A 4IFEA 4YDUC 3VEOA 1GC7A 1YHQN 1GGOA 3PO4A 4F3TA 4B1YB 1O1WA 4YOUA 2FSKA 2FBVA 4JKAA 2P9IB 1RBRA 1UA1A 4RG8A 3D2EA 3QO9A 3TR8A 4CD1A 3C65A 1RTHA 5LJVA 1NI2A 2EMTA 3JS6A 2RE2A 3HJFA 5AR0A 1RTDA 3P1GA 5JS1A 2Q2RA 2OPQA 1MA9B 2A1RA 4V19S 3GDQA 4F2SA 3C6HA 2FF6A 3CJAA 2D10A 1C0GA 3HOTA 4K8XA 4DR4K 2KKZA 3D45A 1NJWA 4NCBA 1FJGK 5LMUK 4OKKA 3OYJA 2CGJA 3SJJA 3TWHA 3PSIA 1RTIA 1FKOA 4N5SA 5CZ2A 3PO5A 3WXIA 4KHYA 1TK5A 4IEIA 2GWKA 4K42A 5AZIB 4IJAA 2E6LA 3ZLJA 4EIAA 3SQ4A 4FW1A 3I55N 2FF3B 3U3YA 4YOXA 4CEAA 3J80O 3NE6A 4E7KA 1ITGA 2I7NA 2Q3SA 2OZSA 1S1XA 4HVJA 5JVLA 4OGEA 2A41A 2ABDA 3AVAA 4QCLA 2DY4A 3CI5A 3AO3A 3THVA 1S1TA 3MN5A 1VQMN 4ID1A 5KGWA 1QSLA 4Z4EA 3NCIA 4CFDA 3OYIA 3ZT2A 1EO1A 4BDYA 1BGXT 4Z4HA 4LH4A 5HRSA 3AVNA 3AA5X 3CYMA 4NY0A 5AQIA 3IS9A 4BRHA 4X62K 5TKYA 4DV5K 3DYAA 4H0XB 4FK2A 1VBHA 4B3MK 3F9MA 1ASWA 1QQMA 2QA4N 4NXNK 5FRNA 1SQKA 2OPPA 4CBWA 4M42A 4HUFA 4LF4K 4KBOA 5IJMA 4E7LA 4ZRIA 4EHTA 4KI4A 2UUCK 3QDKA 4JN4A 3THYA 5F2RA 3L6QA 4IZ9A 4ZRKA 2IDOA 2E2QA 5AQNA 5GAEP 2RKIA 4Y1DA 5AQXA 4DV4K 2Z1GA 4OO1J 4CJLA 4DR7K 1H4RA 5GAHP 3ZSXA 3HM9A 1DLOA 2HHWA 4AHUA 1HKGA 1MU2A 4YFUA 4DTJA 3H3NO 1YJ9N 3VQ4A 4BACA 2QW9A 5BRDA 1NKEA 3PLAA 2HHUA 3DOLA 1LWEA 1IKVA 5M1FA 1QVFM 3DRRA 4FM2A 2I1KA 4PY5A 5GIOA 4K0KK 1NK4A 3VQ8A 3VGKA 2G8UA 5BR9A 2X0SA 4DR5K 3RMAA 4E7IA 4NLCA 2VWBA 4JI2K 3AO1A 3O1BA 5KI6A 4BWMA 1HRHA 4CZMA 2W40A 3QEPA 2DIKA 4FJIA 1LOTB 1WUAA 3PX6A 4KTZA 5C42A 4DLGA 4KHSA 3MEDA 4G1QA 3M6GA 4DTOA 4F7GA 4IOAL 2P9LA 4PL7A 4MDBA 1VSDA 4O0JA 3KLGA 1BI4A 2NZTA 1HLUA 3TAGA 2QWNA 1VRTA 1MWKA 4BC2A 1NKCA 3BP8A 4BQLA 2YX6A 3V9ZA 4FZXC 1ZBUA 4DQRA 3CC7N 4J2EA 3QFPA 4N76A 3LP0A 2COPA 1GLCG 2VG7A 4DTUA 1VK0A 1NOZA 4B9NA 3ENBA 4DF4A 3NGZA 5KQDA 3LAKA 3T1AA 3WUHA 4AHVA 4BRLA 4DSFA 1XHZA 3CCLN 3DOKA 4DG1A 3L2UA 1Q7YO 4AHSA 3FFKB 1HQUA 3LALA 4FM0A 4CERA 1ZBLA 4X64K 3AA2A 2O4GA 4HCCA 3JSMA 3DXMA 3CPWM 1NGFA 4A62A 2OANA 3ULEA 3AVCA 3RRGA 1YF5L 4B3RK 4LF7K 1NGIA 4IFVA 2Q31A 3AO2A 4QS7A 3HPOA 4WCEL 1RDWX 4LY7A 1LAWA 1VSMA 3AA3A 3AV9A 3QIOA 3BDPA 3J81O 2VGMA 3SZ2A 1GLDG 4ISFA 5AZIA 3I33A 3O5BA 2D5RA 5IT9O 3M8PA 3ZSZA 2BUPA 1VQNN 1D8YA 3PSFA 4IO8A 4BGAA 1ZBFA 4AM6A 3C94A 4JK8A 3UE5A 1MK7B 2QWPA 4B9LA 1S1WA 1RT1A 1N8RO 1X9WA 5DMRA 1HKBA 2HMPA 4K25A 3TAQA 2RF2A 3GL1A 4FM1A 2EX3A 4BE2A 1QQCA 5AQQA 4OPJA 3O3FA 3LWLA 1GLFO 2FSNA 4EAHD 4W5OA 1NGAA 4GXBA 3BINA 2D11A 3MMVA 4BR4A 2AEHA 4FWNA 3HO1A 4LFAK 4FWQA 2X6NA 2QEXN 3ATVA 1OH7A 2A40A 3ZEUB 2I5JA 2ITGA 4JNEA 1Q81O 3SUOA 1KAXA 2Q1NA 4DTXA 1WSJA 4YOWA 1N5YA 2YHWA 2EMSA 1JL1A 3VEYA 3F5TA 1BL3A 4FLXA 4PQUA 1TYQA 4Z4CA 3JXUA 4ZTFA 4RCHA 3G6EN 3J8AA 3I0SA 4KHWA 2KW4A 4BE0A 2P9KB 5HBMA 3DLHA 4BQZA 4LF6K 4H4OA 4CHYA 4E0DA 1GLLO 4CJ3A 4CFAA 5JICA 2ZPYA 3QEWA 4JI3K 1ESVA 4KB0A 4B1ZA 4CHPA 3E1YA 2LSNA 3D6RA 2CB8A 2E88A 4EKUA 4X65K 1IKYA 4CF9A 4C8OA 2AA4A 3ZSRA 1KD1O 2DTUA 4M3RA 3AO5A 1NBWA 3HPHA 1T03A 2GBZA 2IOCA 3T7ZA 4B8AB 2F4VK 1Z26A 2B6AA 1VQPN 2HF3A 3HTVA 3THWB 1RFQA 2FSJA 4AILC 1V4SA 4H5NA 1NK5A 1YUWA 4FJ9A 4FLWA
chains in the Genus database with same CATH topology
4WQ4C 4MO5A 2V51B 2R82A 4EHUA 1G99A 3TSPA 4A5AA 4BR9A 4BRQA 4I6MB 4FWSA 4H5VA 1NVLA 1X9JA 4CJ7A 4BROA 4JKBA 2QWRA 1GC6A 3MWPA 2YJFA 1DGKN 5BPLA 4JD2A 3RSEA 1YI2N 2F9WA 1RDUA 3FR0A 2PFUA 1XC3A 2AL6A 2E8AA 5BREA 1GG3A 4NLBA 3OA9A 5JLHA 4DCHA 1KBLA 1VAZA 3D2EB 4B1XB 3O1WA 2YI1A 3CERA 4BRGA 4HDOA 2QI2A 4J8FA 2P9UA 5ELZA 1VQKN 3Q7BA 4L3QA 2ZJPL 4IDHA 3C0BA 3ZEUA 1J6ZA 4CZJA 1U6ZA 4JKFA 3TTFA 4FWLA 3WXMB 3CCSN 3CMEN 3CD6N 1GLEG 3LL3A 3PIOL 5BPMA 2A5XA 4MDAA 3ZYYX 3S41A 4ILGB 4TKNA 3DWLA 2HOEA 4IOXA 3CCRN 1Q86O 4UY8O 3R3LA 4FO0A 3O8MA 2ITMA 2HBLA 2QM1A 5AQLA 3N4QA 4FSVA 5CR4A 4YL8A 5E84A 5AQFA 1ILYA 1QHAA 4BVOA 3HM8A 3EN9A 3BF3A 3O9QA 1VQ9N 2VCPA 1KAZA 2P9PA 4Y0WA 3DXMB 4IOCL 1U2VB 2NRVA 1YVNA 3EE8A 4OPHA 2EWSA 2HBJA 2E1YA 1NTIA 2WFBA 3KWGA 5AQVA 1EQYA 5JVGL 3FLVA 1JCGA 2KLAA 3M1FA 4CZKA 3ENOA 3CCJN 2QWMA 1T3VA 5AFUA 3LDQA 3A8YA 3VTHA 3TTCA 1EO1A 4OPAA 4R79A 3A0IX 3G9WA 2WH5A 3DXKB 4H5WA 4BRCA 4WFNL 2ASOA 2H3GX 5C0YA 3CC2N 1HB8A 4HTLA 3TU5A 3UB5A 1Q18A 2ZWHA 3P39A 1MIZB 2WUSA 3VOVA 5AQJA 2GELA 1MWMA 2WC9A 5M1NA 1IJJA 4NO7A 3MCAB 4AM7A 4P7IA 4JK7A 1X3MA 3CETA 4PHTX 3ATUA 4JKEA 3OBWA 1NMDA 3KHYA 3IVFA 3WT0A 4IFEA 2NLXA 3MWTA 3AU4A 4YDUC 3U4LA 3LDLA 4DB3A 2FXUA 3BEXA 3VEOA 5CE3A 1S3XA 1GC7A 1YHQN 1XQSC 3CJ7A 1GGOA 3WXJA 4B1YB 4YOUA 4GVEA 2FSKA 4B1VA 4JKAA 2P9IB 3D7EO 3SBTA 1C0FA 3VEVA 1HB6A 1NGBA 2F7TA 2JWLA 3D2EA 3ID6A 5GAGP 2ASPA 5AZJA 3O4WA 4BG8A 4CD1A 3C65A 4RWTA 4NB4A 4GV3A 5LJVA 4FWKA 5AZJB 4BR2A 2D0OA 2NRTA 1NI2A 2DPNA 2F9TA 2EMTA 4CZGA 3JS6A 5AQGA 3GOIA 2RE2A 4BR5A 5AR0A 4IEEA 2Q2RA 1OKJA 4JKHA 1IG8A 4WQ4A 4BRIA 1MA9B 1SGHA 1E4FT 3GDQA 4BRNA 2RHKA 5JLFA 1VQ6N 3E66A 2FF6A 3AAPA 3C6HA 2D10A 2PAVA 3CJAA 1C0GA 3HOTA 4GV6A 1CZAN 2KKZA 5BRFA 4BR0A 3VF4A 3VGMA 4CI6A 3LDPA 4M7YA 5EX5A 3CCEN 3W0LA 1MIXA 2CGJA 3FE1A 3H45C 1E4GT 2WBNA 3OW2M 4JKGA 1HUXA 3HZ6A 5AQOA 3WXKA 4AF1A 2YCHA 3B8AX 4Z94A 1KC8O 1LCUA 3WXIA 4BRPA 2P9LB 2P9UB 4IEIA 1KC7A 1ZBSA 3SJHA 2GWKA 3HBTA 1P8ZA 4K42A 4H0PA 4G9ZA 5AZIB 4IJAA 2YHYA 4JAXA 1YIJN 3MK6A 4H0YB 5AQKA 3R1XA 4EIAA 2FJ9A 3OHRA 5M1KA 5M1PA 3FZFA 2UYTA 3I55N 1U2VA 2FF3B 3VERA 3SAFA 4YOXA 4GV9A 4H0TB 2IIRA 1M90O 4FWMA 3AY9A 3I56N 2I7NA 3WQTA 5C2FA 2HE7A 3E9PA 3VPZA 1Z6RA 5C12A 5JVLA 4CBXA 5EXWA 3AAQA 3VEZA 3UKRB 3G4SN 4EFHA 4GNIA 3IUCA 2A41A 2ABDA 2W41A 2CGKA 3CI5A 1K73O 3R6MA 3MN5A 1VQMN 5MLCQ 1TYQB 2NRRA 2OTJN 5EVZA 5AQMA 3MX2A 2D0PA 4BC3A 1BG3A 2QXLA 2JWKA 3U8ZA 2ASMA 3O6WA 3ULEB 3WEEA 5CHIA 3QBXA 3AGRA 3F2KA 4CZIA 5FPEA 3FZLA 3P31A 1BUPA 3VTIA 1YJNN 4NY0A 5AQIA 4FWPA 3CQXA 4BRHA 1YITN 5TKYA 5ADXH 3CCQN 2J0KA 3PIPL 3P38A 3K9JA 2Q0UA 4MLEA 3R9PA 4H0XB 1ATNA 2ZGZA 1QQNA 1VBHA 3AARA 1BO5O 3EE9A 3CJCA 4PKIA 4WQ5C 2P9IA 3F9MA 5AQTA 1BWFO 1QQMA 2QA4N 2P9SA 2P9PB 1SQKA 2E20A 3A5NC 5FPMA 3HSCA 5B8HA 5JMVA 4ISEA 4CBWA 1QQOA 3WA0A 3FGUA 4IJNA 3VEXA 3VENA 4KBOA 1KQSM 5IJMA 1S22A 3ZX2A 1QZ5A 3H1VX 1X3NA 4ZRIA 4EHTA 5BN8A 3TSUA 3EPYA 3DLLL 2FLOA 1WOQA 3CPEA 2J0MA 3SK3A 3QDKA 4JN4A 5F2RA 3L6QA 4IZ9A 2HBMA 3CQYA 4B1UB 4ZRKA 2V7YA 3LDNA 2E2QA 5AQNA 4M63C 5GAEP 3D2FA 4A5BA 5AQXA 2YVCA 3CJ1A 3L4QA 2NRHA 3GG4A 2ZJRL 3CC4N 1GLAG 4XH1A 4OO1J 2QWQA 1DKGD 3T69A 5E26A 2HRJA 1HKCA 1W97L 1H4RA 1ATRA 5GAHP 3EKSA 4C1NK 2HBKA 5C10A 3SLCA 3SMSA 3A5OC 2LBBA 3DJCA 4DQ8A 5KPRA 4BR7A 3O9TA 1HKGA 5BN9A 1BDGA 5EOYA 4XH4A 2CGLA 2VGNA 3U8XA 3H3NO 1YJ9N 2NNWA 4FPBA 3IMXA 3WXLA 3VGLA 2ZGYA 4CBUA 5HOOA 2QW9A 4FPAA 5BRDA 3PLAA 2P9NA 3QIJA 4RTFD 4YOVA 2D4WA 2Q36A 3HOSA 3J7ZO 5FPDA 2P9KA 5M1FA 1HBKA 1QVFM 3CIPA 3W3DA 1VQ8N 2I1KA 5GIOA 2GTDA 4YOTA 4C23A 1BU6O 3VGKA 3L4IA 3A5LC 5BR9A 3VF2A 2X0SA 1MK9B 5JVHL 2Q0RA 4DXAB 4NLCA 3CCMN 4H5RA 2VWBA 3TTDA 4C1NI 4CZLA 1GLJO 3O1BA 1K8KA 4JHDB 4O8UA 4XH5A 3ENHA 3PZDA 4XEIA 2QWLA 3LDOA 4U67L 4CZMA 2W40A 3NVMA 3QFUA 2DIKA 4BG9A 4BC5A 2VYPA 4BC4A 4FWOA 4U7BA 1LOTB 2GX9A 3TSQA 3MN7A 2A6AA 1WUAA 1OVYA 1T44A 3O9UA 1YXQA 4YORA 3EZWA 3G25A 3H46O 3M6GA 4F7GA 5C15A 4IOAL 2P9LA 4PL7A 3KVGA 1VQ4N 3D2FB 4MDBA 2FDQA 4K43A 3SAGA 2NZTA 1DIKA 5LY3A 5ADXA 4CD3A 1HLUA 2QWNA 4BVPA 1MWKA 4BC2A 1JJ2M 4IWVA 2P9SB 3K9KA 3BP8A 4BQLA 2YX6A 1BOTO 1RGIA 3M5RA 4CZFA 3H1QA 4IXCA 2J0JA 2HF4A 3CC7N 3QFPA 3MCPA 1Q82O 2COPA 4BGBA 1GLCG 4CZEA 1ACAA 4H0VB 2KHOA 4A59A 2A3ZA 4ILHA 2CH6A 4WF9L 2ZF5O 1T6CA 3FZHA 1Z05A 3M3ZA 4FVUA 5FPNA 4A2AA 3SAHA 3NMUA 4JKDA 2E2PA 3ENBA 1BA1A 5KQ8A 5KQDA 3WUHA 4BRLA 3WEEB 3CCLN 3CXCM 2E2NA 1Q7YO 3FFKB 4KH5A 4YDUA 3PVLA 1H1VA 2PBDA 5AQHA 1HJOA 2QWOA 4JD2B 3O9RA 4MLHA 4BY9C 2YJEA 3DXMA 3IDHA 2E1ZA 5M1QA 3VESA 1TUUA 1NGFA 3CPWM 5AQSA 5M1OA 4A62A 1ZXOA 2OANA 3ULEA 3U9DA 4WYBA 1D4XA 2Q97A 1YF5L 3IKMA 1NGCA 3BF1A 4YOYA 1NGIA 5GIPA 2E2OA 2Q31A 4K41A 4QS7A 3UKUB 1DEJA 4WCEL 1RDWX 1M1KO 2I1JA 3H3OB 4BRDA 4PKGA 2ZJQL 1VBGA 2VGMA 4A57A 1ST7A 1GLDG 3ZDTA 2AP1A 4ISFA 1S72N 1SS6A 4GY2B 4B9QA 5AZIA 5AQUA 3A5MC 3I33A 3O5BA 3Q7CA 5TKWA 1K8AO 1NWKA 4BRMA 1MDUB 3HRGA 4PKHA 4QS9A 3EO3A 5H1SQ 2CH5A 2BUPA 5C2DA 1EF1A 2V52B 3P4IA 1VQNN 4BREA 3VMFB 4IO8A 4QS8A 5AQPA 3CMAN 4BGAA 5KPZA 1NM1A 3QICA 3MN6A 3MDQA 3E9OA 4M7XA 4F9OA 4AM6A 2GUPA 3KZBA 4JK8A 1NGDA 3O80A 3UE5A 5I9EB 1MK7B 1HPMA 2QWPA 1DT9A 4FL9A 5AQYA 2OTLN 2V7ZA 5F1XA 4B1WB 1N8RO 1HKBA 2HMPA 4WFBL 3I8BA 1V4TA 4K25A 1QVGM 3GL1A 3EKUA 2J4RA 3ID8A 3SMPA 3ZX3A 2P9NB 2YHXA 5AQQA 4DHYA 1P90A 2HSTA 4KH4A 5BRHA 1GLFO 1Y19B 2FSNA 1NLVA 3DXKA 1NGAA 4EAHD 5KPTA 4GXBA 5HL7L 4ISGA 3O9SA 3HI0A 3BINA 2D11A 1VQON 3MMVA 3U9ZA 4BR4A 2AEHA 1VQLN 3C6AA 4FWNA 1HX1A 1JCEA 3EL2A 4FWQA 2QEXN 3ATVA 1NJIO 3CHWA 1O13A 1ZC6A 2A40A 1T6DA 3FZKA 3ZEUB 2A42A 4WFAL 4JNEA 3CJ9A 5LJWA 1KXPA 4MO4A 1Q81O 4JKCA 4ILJA 1KAXA 3E9LA 1QZ6A 2Q1NA 1K8KB 3IFRA 4JHDA 1NGGA 2GEMA 4YOWA 4IO9L 1GLBG 2YHWA 2GWJA 3AGKA 3GE1A 3VEWA 3CCVN 3R8EA 3QMLA 3CJBA 3LM2A 2EMSA 3FZMA 4KH6A 3ZX0A 4BRAA 3QBWA 1NGHA 3DAWA 3F5TA 3VEYA 4A61A 3OBYA 4LC9B 1BA0A 3H6EA 1TYQA 2NRXA 3O08A 4FWRA 4H0OA 3RSEB 5BPNA 2IVOA 4BRKA 5AQZA 4ZRJA 1VQ5N 3JXUA 3BUZB 4RCHA 1Y64A 3FLCO 3G6EN 1K9MO 2NRWA 3KK7A 3J8AA 5EY4A 3UKUA 4DKWA 1J19A 3MX5A 3MN9A 5DM7L 3AU5A 2P9KB 4O5FA 3SBGA 1YAGA 4BQZA 3TPQA 4FOEA 4A2BA 4CZHA 1JCFA 3WQUA 2CQUA 3KWIA 5F0XA 2QTDA 4BRFA 1GLLO 4JK9A 3L0QA 1XUPO 1NGJA 3GBTA 3ZETA 5JICA 2ZPYA 3FP5A 4HDQA 1R59O 2NRZA 4FOIA 3X23A 1JDEA 1ESVA 4B1ZA 3E1YA 2BH1A 3CF5L 2IVPA 3D6RA 2CB8A 2E88A 1TUYA 4O8KA 4EKUA 4H5TA 4E1JA 3U7DA 1NGEA 1ATSA 2AA4A 1SZ2A 3VF6A 2I7PA 1KD1O 1NBWA 1W2BM 3N4PA 3VETA 3T7ZA 5AQWA 4PL8A 4CYEA 3RVCA 5GINA 5GADP 2BTFA 2D1KA 4HWIA 2D2QA 5DM6L 3C7NA 4H03B 3G71N 1SAZA 3LM9A 1E5WA 3ZETB 1YJWN 4WQ5A 3CCUN 1VQPN 2HF3A 3HTVA 3QB0A 2RQ1A 5AFUH 3NVKA 1RFQA 2FSJA 1VQ7N 4I6MA 1KAYA 3UKRA 1V4SA 3C7NB 4H5NA 4JEPA 4JKGB 1YUWA 1ISNA 5AQRA 2IVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  3E66 A;  4ILG B;  4JKA A;  4JKB A;  3SBT A;  3E9P A;  3SBG A;  4JKG A;  4ILH A;  3E9O A;  4JK8 A;  4JKD A;  3ENB A;  4JK9 A;  4ILJ A;  4JKC A;  3E9L A;  4JK7 A;  4JKE A;  4JKG B;  4JKH A; 
#chains in the Genus database with same CATH topology
 1KCF A;  3K58 A;  1OH8 A;  4FWS A;  3NHG A;  3VQ9 A;  4BDZ A;  4CJ7 A;  4BRO A;  4CJK A;  1GC6 A;  4DUY K;  2XO7 A;  3RSE A;  1TL3 A;  2G8I A;  3AVK A;  4E7J A;  2E8A A;  4KKO A;  1GG3 A;  3S3O A;  4DQS A;  1X9S A;  1KBL A;  1VAZ A;  2YHB A;  3O1W A;  2YI1 A;  3CER A;  4HDO A;  3AVB A;  4KHU A;  1RT2 A;  3VQD A;  1NNE A;  1VQK N;  4L3Q A;  3C0B A;  4CZJ A;  1LAV A;  2YHA A;  1GOA A;  4DTS A;  4W5N A;  4MDA A;  2HHX A;  3ZYY X;  5J2M A;  3CCR N;  2HOE A;  2UU9 K;  2ITM A;  2QM1 A;  2XY5 A;  2G8W A;  4DQI A;  5CR4 A;  5E84 A;  2P9P A;  1JLC A;  2NRV A;  1YVN A;  4CGH A;  4OPH A;  2E1Y A;  4BWJ A;  1S9G A;  1XNQ K;  3I8D A;  2W6L A;  4CIE A;  1T3V A;  4IKF A;  2HND A;  2IAJ A;  3VTH A;  3TTC A;  4OPA A;  5HRR A;  4BRC A;  1XC9 A;  2ZM6 K;  4PWD A;  4DTM A;  3ZSV A;  5C0Y A;  3CC2 N;  4HTL A;  1Q18 A;  3K59 A;  1MIZ B;  2DFH A;  3BY5 A;  1RBT A;  4AM7 A;  5DK5 A;  4EZ9 A;  3ATU A;  4JKE A;  2X6S A;  3KHY A;  2NLX A;  3MWT A;  3AU4 A;  3BEX A;  5CE3 A;  1XQS C;  2X74 A;  3CM5 A;  3WXJ A;  2O8D B;  2PZS A;  3SBT A;  4CEZ A;  3VEV A;  1HB6 A;  2OTL N;  4FXD A;  2HVH A;  2ASP A;  1U47 A;  3TAM A;  3O4W A;  4FWK A;  1UWB A;  2NRT A;  2DPN A;  2F9T A;  3ZT0 A;  3VQP A;  3SQ0 A;  3B6O A;  4KB1 A;  1C0M A;  4IEE A;  2EHG A;  3AVH A;  1OKJ A;  4JKH A;  1IG8 A;  4WQ4 A;  5FRO A;  3SNN A;  4B8C A;  4BRN A;  1E4F T;  1A5W A;  5KGX A;  1HJR A;  2RHK A;  3CFO A;  1VQ6 N;  3AAP A;  1QE1 A;  2W6K A;  3RR7 A;  4C8K A;  4DSI A;  3VF4 A;  3VGM A;  4M7Y A;  3FE1 A;  4JKG A;  1HUX A;  3TAE A;  3THX A;  3HZ6 A;  3WXK A;  4AF1 A;  4BRP A;  5CYM A;  2P9U B;  3RTV A;  3MXJ A;  1Q8I A;  4BDP A;  2E6M A;  4H0P A;  1SL2 A;  1SUQ A;  3MK6 A;  1LW0 A;  3L3V A;  5J2Q A;  1WB9 A;  2UYT A;  3HP9 A;  3VER A;  1DTT A;  4B3T K;  4W5T A;  3B6P A;  1VHX A;  1M90 O;  3V1O A;  4FWM A;  1UA0 A;  1EWQ A;  3I56 N;  3BZC A;  5C2F A;  3VQE A;  3THX B;  3E9P A;  2OZM A;  4FJJ A;  1Z6R A;  4LD0 A;  5C12 A;  4GNI A;  3LAN A;  4FLZ A;  2AJQ A;  2O8C A;  1EX4 A;  1TYQ B;  4CES A;  3T1Y K;  1XHX A;  2OTJ N;  3L8B A;  5AQM A;  4CF0 A;  2O4I A;  2QXL A;  1NG9 A;  1EET A;  2JWK A;  2ASM A;  5FPE A;  1KFS A;  3FZL A;  3P31 A;  3VTI A;  1NJZ A;  4E1M A;  4FWP A;  3CQX A;  1YIT N;  3KK3 A;  2GV9 A;  4CEQ A;  1TKT A;  3V9W A;  4F3O A;  1GOC A;  1ATN A;  4GKJ K;  1QQN A;  1BO5 O;  3MAQ A;  1WSF A;  2P9S A;  4NYF A;  5SZT A;  3CM6 A;  5B8H A;  5JMV A;  4RW6 A;  1EXQ A;  1RT3 A;  3V6D A;  3FGU A;  3NF7 A;  1JLG A;  1S22 A;  3SPY A;  1SL1 A;  1QZ5 A;  2YNF A;  3TSU A;  4Z4I A;  1WOQ A;  4GVM A;  3SK3 A;  1HYS A;  4CHZ A;  2P5G A;  3CQY A;  2BE2 A;  4B1U B;  4M63 C;  5C24 A;  2YVC A;  3CJ1 A;  4GMJ B;  3V9U A;  1DKG D;  1W97 L;  4C1N K;  5C10 A;  4DSK A;  2B5J A;  4DQ8 A;  3DJC A;  4JI8 K;  3O9T A;  1ZBH A;  1BDG A;  5EOY A;  5C25 A;  2CGL A;  2VGN A;  4ELU A;  3IMX A;  4CBU A;  4ZHR A;  4DSE A;  2VG6 A;  3LAM A;  4YOV A;  1E3M A;  2D4W A;  1NMN A;  3J7Z O;  5FPD A;  1BIU A;  2D0C A;  3SV4 A;  4O55 A;  1VQ8 N;  3QER A;  4CGI A;  4J2A A;  1WSI A;  3L4I A;  1MK9 B;  3CCM N;  4H5R A;  3TTD A;  1LV5 A;  4CZL A;  4JHD B;  4XH5 A;  4XEI A;  3FFI A;  3RRH A;  3DLK A;  2GX9 A;  3MN7 A;  1T44 A;  4YOR A;  3EZW A;  3O3H A;  5C15 A;  3KVG A;  3HT3 A;  3NH1 A;  3V9X A;  4JI0 K;  5FDL A;  1EP4 A;  1QSS A;  4O4G A;  4IWV A;  2F8S A;  1RDD A;  1Y97 A;  1IO2 A;  4CZF A;  3H1Q A;  2J0J A;  2HF4 A;  1G15 A;  3HVR A;  4DS5 A;  1A5V A;  4FJM A;  4CZE A;  1ACA A;  3AVM A;  2KHO A;  4A59 A;  4WF9 L;  4ILH A;  3FZH A;  1BIS A;  1T6C A;  1HNZ K;  1W9H A;  4FVU A;  5FPN A;  3SAH A;  4DU1 A;  3QIN A;  4CE9 A;  2KZZ A;  3WEE B;  1JLB A;  3SUP A;  4KH5 A;  4YDU A;  1H1V A;  2IGI A;  4CJT A;  5AQH A;  5J2P A;  4ICL A;  1R0A A;  5LMN K;  2G8K A;  3O9R A;  4MLH A;  3VES A;  1D9D A;  5D3G A;  2ZD1 A;  4DR6 K;  1DTQ A;  2Q97 A;  3IKM A;  3KTQ A;  3UKU B;  4FLY A;  1BQN A;  1DEJ A;  3QEI A;  2I1J A;  1L3V A;  4M3Y A;  3H3O B;  4BRD A;  3KK2 A;  1VBG A;  2GUI A;  3C95 A;  1ST7 A;  3M8R A;  3ZDT A;  1S72 N;  4GY2 B;  4FW2 A;  3Q7C A;  3BZK A;  1NWK A;  1MDU B;  3HRG A;  5H1S Q;  2CH5 A;  4AHC A;  3RWU A;  5C2D A;  3P4I A;  2V52 B;  1IG9 A;  1LW2 A;  4OPK A;  4QS8 A;  3CMA N;  2UUB K;  3E01 A;  4F9O A;  4M7X A;  1NGD A;  3O80 A;  1HPM A;  1DT9 A;  4OLA A;  4FL9 A;  3SYZ A;  4FJN A;  2V7Z A;  5F1X A;  4WFB L;  1S6Q A;  3I8B A;  3TAP A;  1QVG M;  1X9M A;  3SMP A;  2P9N B;  5HLF A;  4N41 A;  1P90 A;  1NLV A;  3DXK A;  5HL7 L;  4ISG A;  3O9S A;  1VQO N;  3U9Z A;  1VQL N;  1JCE A;  4NCA A;  4M41 A;  1ZC6 A;  1T6D A;  3V81 A;  2QKK A;  4ILJ A;  3KK1 A;  3CCV N;  2GWJ A;  3I0R A;  3GE1 A;  4Z0U A;  4FJ7 A;  3FZM A;  1L3T A;  1NGH A;  4KO0 A;  3OBY A;  4AHR A;  4FWR A;  3O08 A;  5AQZ A;  1VQ5 N;  3QES A;  3BUZ B;  1K9M O;  3FLC O;  1RDA A;  2YNG A;  3SQ2 A;  3UKU A;  3MX5 A;  3F73 A;  3AU5 A;  3NGI A;  4KFB A;  1S1U A;  3SBG A;  1KFD A;  3LP1 A;  2O8F A;  4JYA K;  2CQU A;  3KWI A;  1IV0 A;  1NGJ A;  1CXU A;  2IS3 A;  4O8K A;  3K5O A;  4H5T A;  1YTU A;  1SZ2 A;  2G8F A;  2I7P A;  1Z25 A;  2VWK A;  4IBN A;  3N4P A;  3CQ8 A;  1TV6 A;  3QEV A;  4KRE A;  5GIN A;  5GAD P;  3L2V A;  1KRP A;  4H03 B;  1YJW N;  4FJX A;  1N6Q A;  3KLE A;  3QB0 A;  4AQY K;  4CK1 A;  4I6M A;  4CJE A;  1KAY A;  1TK8 A;  3WNF A;  4XH4 A;  4FJ8 A;  5SWM A;  4OX9 K;  2R82 A;  4EHU A;  4W5R A;  4I6M B;  4H5V A;  3LZI A;  1NVL A;  1XI1 A;  2O8E A;  3OS1 A;  5BPL A;  4JD2 A;  2O8B B;  2F9W A;  1YTA A;  1KVA A;  4NLB A;  3K5L A;  3NDK A;  2OCE A;  4KPY A;  4JLH A;  4J8F A;  4JI6 K;  3Q7B A;  3SI6 A;  2ZE2 A;  3M8S A;  3RMB A;  2FBX A;  4MFB A;  2XY8 A;  1HR0 K;  3PV8 A;  4JKF A;  3CCS N;  3CME N;  3CD6 N;  1GLE G;  1C0U A;  1RT5 A;  4M3U A;  3C6T A;  4CJQ A;  4TKN A;  3DWL A;  4I9Q A;  3R3L A;  3O8M A;  3KLF A;  3N4Q A;  4FSV A;  1JLE A;  4YL8 A;  1ILY A;  1S1V A;  4E89 A;  4Y0W A;  4CFB A;  4IOC L;  1U2V B;  3EE8 A;  1NU0 A;  3KWG A;  2WFB A;  4CIF A;  1NJY A;  4JV5 K;  4L8R B;  1EQY A;  2KLA A;  3CCJ N;  3AO4 A;  1WSH A;  3LDQ A;  3P5J A;  3A8Y A;  4R79 A;  2WH5 A;  4FVM A;  2RPI A;  3EYZ A;  4JRQ A;  4YHH K;  3TU5 A;  3UB5 A;  2YV0 X;  2HHT A;  2WC9 A;  4NO7 A;  2HNY A;  4OJR A;  4QOZ B;  1X3M A;  4I7F A;  4CJV A;  4PHT X;  3OBW A;  5JS2 A;  4KV8 A;  1HPZ A;  1N34 K;  1JLA A;  4I9L A;  1XMQ K;  1W0H A;  4B1V A;  3D7E O;  4DQP A;  2F7T A;  5GAG P;  2OYQ A;  4FLV A;  4NB4 A;  5AZJ B;  2BAN A;  4BR2 A;  4CJU A;  1IH7 A;  4CZG A;  1U04 A;  4CGF A;  1QTM A;  3OYH A;  1EKE A;  1NK7 A;  1HMV A;  3NH2 A;  4IFY A;  4BRI A;  5JLF A;  4B3S K;  3E66 A;  1CZA N;  5BRF A;  3DLB A;  1RT6 A;  1QSY A;  4BR0 A;  4OKJ A;  3W0L A;  1E4G T;  3OW2 M;  4FK0 A;  5IWA K;  4Z94 A;  2YCH A;  1KC8 O;  1LCU A;  4DSJ A;  2YNI A;  3SJH A;  3HBT A;  4RW7 A;  1SKW A;  3EY1 A;  4H0Y B;  3KJV A;  4BE1 A;  3OHR A;  4OLB A;  3FZF A;  4CIG A;  1U2V A;  2OPS A;  4M3X A;  1JXB A;  2IIR A;  3AY9 A;  3WQT A;  2HHV A;  3OY9 A;  3NGY A;  4OGC A;  1RBV A;  4CBX A;  5EXW A;  3UKR B;  3G4S N;  3IUC A;  4CK2 A;  4DV0 K;  4ZTJ A;  3KD1 E;  2CGK A;  1S5J A;  3ZT4 A;  1XMO K;  5MLC Q;  1BIZ A;  2X78 A;  5EVZ A;  4LSL A;  3ZSY A;  4HTU A;  3MX2 A;  4CF8 A;  4DU3 A;  1BG3 A;  3O6W A;  3ULE B;  3WEE A;  3QBX A;  1J54 A;  4CZI A;  1SKR A;  4I2Q A;  3QEX A;  1BUP A;  1J5O A;  1FK9 A;  5ADX H;  5T7B A;  4YNQ A;  2J0K A;  3CCQ N;  3P38 A;  3K9J A;  3LP2 A;  4N47 A;  4MLE A;  2ZGZ A;  3AAR A;  4IG3 A;  4LF9 K;  3CJC A;  1VSJ A;  2P9I A;  5AQT A;  3QNN A;  4FK4 A;  2P9P B;  3ISN C;  3A5N C;  5FPM A;  4IJN A;  1OVQ A;  3VEX A;  3VEN A;  2UUA K;  4DV7 K;  1X3N A;  3DLL L;  4X66 K;  3CPE A;  4CEF A;  4FYD A;  3K0S A;  3LDN A;  4HUG A;  3NH0 A;  4E7H A;  1SL0 A;  3HPG A;  4KTQ A;  4CHO A;  4A5B A;  3ZSW A;  4EP4 A;  3L4Q A;  3QLH A;  2ZJR L;  3CC4 N;  1LWC A;  3T69 A;  3TAR A;  2HRJ A;  4CJF A;  3EKS A;  5I3U A;  1C6V A;  3SMS A;  2LBB A;  5BN9 A;  4KHQ A;  2JLE A;  3WXL A;  2BDP A;  4FPA A;  1YT3 A;  4RTF D;  2Q36 A;  3HOS A;  2KFZ A;  2ETJ A;  1HBK A;  3CFP A;  3CIP A;  3W3D A;  2GTD A;  4YOT A;  4C23 A;  3HVT A;  1BU6 O;  3A5L C;  3VF2 A;  2Q0R A;  4DXA B;  5HP1 A;  4CCH A;  4C1N I;  3OS2 A;  2G8H A;  1BCM A;  1K8K A;  3OS0 A;  4CHN A;  5CZ1 A;  2XY7 A;  3O3G A;  3OYM A;  1VSK A;  3TAF A;  2VWJ A;  1SKS A;  2VYP A;  4KRF A;  4FWO A;  4U7B A;  3KKR A;  3TSQ A;  2A6A A;  2DFE A;  3MXI A;  1OVY A;  3SQ1 A;  3O9U A;  3G25 A;  1CLQ A;  4DTP A;  1VQ4 N;  1HNV A;  5E41 A;  3S9H A;  3SAG A;  3ZSO A;  1DIK A;  4CD3 A;  4BVP A;  1JJ2 M;  3K9K A;  1BOT O;  4C8L A;  1A5X A;  1Q82 O;  4CGJ A;  2A3Z A;  4M3W A;  3L3U A;  3M3Z A;  3NMU A;  2VQF K;  2E2P A;  4HUE A;  3HYF A;  2PY5 A;  4FJL A;  2HB5 A;  2DFF A;  1VSI A;  4CHQ A;  4OVL A;  3CXC M;  2E2N A;  1WNS A;  3VN5 A;  3K2P A;  1B9F A;  3ZSQ A;  4DWI A;  2YJE A;  3IDH A;  5M1Q A;  2E1Z A;  1TUU A;  5AQS A;  5M1O A;  3EZ5 A;  3OJS A;  2F96 A;  1OH6 A;  4AHT A;  4ELV A;  3NBP A;  1NGC A;  4YOY A;  4CJW A;  2HHQ A;  4M45 A;  2YNH A;  4K41 A;  4FLU A;  3OVN A;  4MQ3 A;  1M1K O;  1KLM A;  1KLN A;  4ELT A;  2G8V A;  4PKG A;  4R5P A;  3HP6 A;  3K57 A;  5AQU A;  1K8A O;  3OYD A;  2JGU A;  4FCY A;  3RMC A;  3EO3 A;  4JI5 K;  3H08 A;  1EF1 A;  3VMF B;  4K8Z A;  1F21 A;  2NUB A;  5KPZ A;  3QIC A;  3MN6 A;  3ASM A;  3THY B;  3CFR A;  5I9E B;  3ALY A;  4J2D A;  1JL2 A;  5AQY A;  4B1W B;  2J4R A;  3ID8 A;  3ZX3 A;  2HST A;  3K5N A;  5BRH A;  4CF1 A;  4DQQ A;  5KPT A;  4M3Z A;  3HI0 A;  3OTO K;  3C6A A;  1XNR K;  1WAF A;  1HX1 A;  3KLH A;  3CHW A;  3P83 D;  4DFP A;  1O13 A;  2A42 A;  3CJ9 A;  1KXP A;  4F4K A;  3LPT A;  3EEQ A;  3E9L A;  1QZ6 A;  3IFR A;  1K8K B;  4IO9 L;  1NGG A;  2GEM A;  1J53 A;  1GLB G;  1WAJ A;  2RN2 A;  3R8E A;  1TGO A;  3LM2 A;  4KH6 A;  3IG1 A;  3ZX0 A;  3OJU A;  3DAW A;  1BA0 A;  2NRX A;  1I94 K;  3RSE B;  1RIL A;  4ZRJ A;  3OYG A;  1S9E A;  3KK7 A;  4DKW A;  5DM7 L;  3MN9 A;  2O8F B;  4CJP A;  4PUO A;  2Z1J A;  4QAG A;  4O5F A;  3QIP A;  3WNH A;  3TPQ A;  4A2B A;  4CZH A;  3WQU A;  1RTJ A;  5F0X A;  2HVI A;  4BRF A;  3VQ6 A;  3L0Q A;  1XUP O;  1RCH A;  3X23 A;  1JDE A;  3OYF A;  3A2F A;  4CJ5 A;  1TUY A;  3LPU A;  3T19 A;  1ZYQ A;  3NF6 A;  1B9D A;  1RDC A;  1ATS A;  4CGG A;  3VF6 A;  2O8D A;  2O8E B;  4EP5 A;  1W2B M;  3VET A;  4FJH A;  3MEG A;  1BQM A;  5AQW A;  4PL8 A;  4CYE A;  3RVC A;  4DTR A;  2E5L K;  2BTF A;  4M3T A;  4HWI A;  2YKM A;  1GOB A;  3C7N A;  4JS4 A;  3G71 N;  1SAZ A;  2R7Y A;  1E5W A;  3CCU N;  2RQ1 A;  5AFU H;  3NVK A;  1VQ7 N;  4HHT A;  4DV3 K;  3C7N B;  2A1S A;  4JKG B;  1L3S A;  1ISN A;  4FJG A;  1I3A A;  4WQ4 C;  2V51 B;  3DRS A;  3DMJ A;  4CW7 B;  1TAU A;  1G99 A;  3TSP A;  4A5A A;  2O8C B;  4BRQ A;  2QWR A;  4JS5 A;  2F8T A;  1RDU A;  3FR0 A;  5BRE A;  2AL6 A;  3T1H K;  4DU4 A;  2ZQB A;  3KKS A;  3OA9 A;  4CFC A;  5JLH A;  3D2E B;  4KTW A;  1TL1 A;  3UIQ A;  3J7Y P;  2UXD K;  2Z1H A;  1TVR A;  2ZJP L;  4JI4 K;  4C8N A;  3IAY A;  3RMD A;  1U6Z A;  3TTF A;  2IC3 A;  4FWL A;  3WXM B;  3VQQ A;  3LDS A;  3G0Z A;  3PIO L;  5BPM A;  2A5X A;  4B9V A;  1FXX A;  3KIO A;  1ASU A;  2KZM A;  4FO0 A;  1VSE A;  1Q9Y A;  4ID5 A;  1WSE A;  5AQF A;  4BVO A;  1XWL A;  2QKB A;  3HM8 A;  3O9Q A;  4F2R A;  1KAZ A;  3G10 A;  1NJX A;  3VQA A;  4DV6 K;  2EWS A;  1NTI A;  3SUN A;  3NF9 A;  5JVG L;  3FLV A;  4NXM K;  4CZK A;  2QWM A;  1WSG A;  2QXF A;  5AFU A;  4B9M A;  1HYZ A;  4EZ6 A;  3G9W A;  1RBU A;  1UAX A;  3DI6 A;  3DXK B;  4WFN L;  1S6P A;  2ZWH A;  3QNO A;  5LL6 Z;  2GEL A;  3LZJ A;  1MWM A;  3V1R A;  1K6Y A;  5M1N A;  3MCA B;  1C1B A;  4JK7 A;  3CET A;  1NMD A;  1ZBI A;  4BR5 A;  3IVF A;  3WT0 A;  3U4L A;  3LDL A;  4DB3 A;  2FXU A;  5A2Q O;  4DSL A;  1S3X A;  4DUZ K;  3CJ7 A;  1JLQ A;  1YVU A;  4GVE A;  3MEC A;  1HNX K;  4LF5 K;  1C0F A;  1NGB A;  2JWL A;  3ID6 A;  5AZJ A;  3TI0 A;  1OH5 A;  4GV3 A;  4H4M A;  4BG8 A;  4RWT A;  1U45 A;  2D0O A;  1JLF A;  2HW3 A;  5AQG A;  3GOI A;  3MXM A;  4FJ5 A;  4RW4 A;  1VSH A;  1Q9X A;  2WTU A;  1HNW K;  1SGH A;  4N56 A;  4GV6 A;  2PAV A;  2VG5 A;  3U6F A;  4O44 A;  1KVC A;  4CI6 A;  3VQC A;  3OYK A;  3LDP A;  5EX5 A;  3LWM A;  3CCE N;  1MIX A;  2B4J A;  3H45 C;  2WBN A;  2PYJ A;  5AQO A;  4IG0 A;  4J2B A;  3B8A X;  2P9L B;  2PYL A;  3L2Q A;  1KC7 A;  1ZBS A;  3OYB A;  1P8Z A;  2FC0 A;  4G9Z A;  4CJS A;  1N36 K;  3AVF A;  2YHY A;  4JAX A;  3U3G A;  1YIJ N;  3DLR A;  5AQK A;  3R1X A;  2FJ9 A;  5AJ3 K;  5M1K A;  5M1P A;  3SAF A;  4GV9 A;  1J5E K;  4H0T B;  3TAN A;  3M8Q A;  2HE7 A;  3VPZ A;  4DLE A;  1L5U A;  3OYC A;  3DLE A;  1BHL A;  3AAQ A;  3VEZ A;  4EFH A;  5FRM A;  2W41 A;  1K73 O;  3R6M A;  2NRR A;  3V4I A;  1VRU A;  1HNI A;  3SCX A;  2D0P A;  1BI4 B;  4BC3 A;  1RDB A;  3V1Q A;  3U8Z A;  5CHI A;  3AGR A;  3DRP A;  3F2K A;  4B9S A;  1YJN N;  2KFN A;  1IBM K;  1X1P A;  1JXE A;  3PIP L;  1U49 A;  2Q0U A;  3R9P A;  4UQG A;  3EE9 A;  4PKI A;  4WQ5 C;  3HK2 A;  5CY4 A;  1BWF O;  5K14 A;  3PX4 A;  2E20 A;  3HSC A;  5KRS A;  3QET A;  4ISE A;  1QQO A;  4XIU A;  3WA0 A;  3OYL A;  1B92 A;  1RNH A;  1WBB A;  5HRO A;  1KQS M;  3ZX2 A;  3S3M A;  3VQ5 A;  3H1V X;  5BN8 A;  3EPY A;  1NK9 A;  1NKB A;  2FLO A;  1HYV A;  2J0M A;  3RR8 A;  5FLX O;  1KVB A;  2HBM A;  4E1N A;  2V7Y A;  2XRI A;  1TK0 A;  1IBL K;  3D2F A;  4O5B A;  2NRH A;  3GG4 A;  1GLA G;  4XH1 A;  2QWQ A;  5E26 A;  1HKC A;  1ATR A;  4GW6 A;  2VQE K;  1WLJ A;  2HBK A;  3SLC A;  5KPR A;  3A5O C;  1RT4 A;  4BR7 A;  1C1C A;  1D5A A;  4NYN A;  4Q5V A;  3U8X A;  3ULD A;  2NNW A;  4FPB A;  1JKH A;  2ZGY A;  3VGL A;  4DR3 K;  5HOO A;  2KTQ A;  2P9N A;  3QIJ A;  2UXB K;  4Z4G A;  2P9K A;  4DTN A;  3J7A P;  3THW A;  5J2N A;  1KSP A;  4LH5 A;  4C8M A;  4B9U A;  4H8K A;  1U48 A;  3O4N A;  5JVH L;  5BR8 K;  3DM2 A;  2Z1I A;  1GLJ O;  4O8U A;  3ENH A;  3PZD A;  2QWL A;  3LDO A;  4U67 L;  1IBK K;  3NVM A;  3QFU A;  4BG9 A;  4BC5 A;  4BC4 A;  3PUF A;  4CJR A;  1CZ9 A;  1L3U A;  4DV1 K;  1YXQ A;  1J9A A;  5I42 A;  3H46 O;  3L2R A;  3K5M A;  3D2F B;  2FDQ A;  1C1A A;  4K43 A;  5LY3 A;  5ADX A;  3VQB A;  1REV A;  2P9S B;  1N33 K;  4FLT A;  1RGI A;  3M5R A;  4IXC A;  4CEE A;  3PX0 A;  4JI7 K;  3MCP A;  1CZB A;  4BGB A;  3MEE A;  2FBY A;  4H0V B;  2CH6 A;  2ZF5 O;  3IRX A;  1ASV A;  5J1E A;  1I39 A;  1Z05 A;  4A2A A;  4JKD A;  1VSF A;  1BA1 A;  5KQ8 A;  1TAQ A;  4LSN A;  4JI1 K;  4E19 A;  3NF8 A;  3AA4 A;  1IKW A;  3PVL A;  2PBD A;  3SPZ A;  5KRT A;  3VA0 A;  1HJO A;  2QWO A;  4JD2 B;  1W7A A;  2ATQ A;  4BY9 C;  3D0P A;  1ZXO A;  3U9D A;  4WYB A;  4CF2 A;  1D4X A;  2P1J A;  4DR2 K;  1N32 K;  3BF1 A;  5GIP A;  2E2O A;  2D0B A;  3KLI A;  3ZT1 A;  2P5O A;  3JAM O;  1NK6 A;  2ZJQ L;  4A57 A;  4CGD A;  4KHN A;  2AP1 A;  1BCO A;  1SS6 A;  4B9Q A;  3TAB A;  4KI6 A;  3T3F A;  1CXQ A;  3A5M C;  1VSL A;  5TKW A;  1D9F A;  4FJK A;  5EU7 A;  3AVG A;  4BRM A;  4PKH A;  4QS9 A;  4JRP A;  3PY8 A;  1SV5 A;  4LFC K;  4BRE A;  4CJ4 A;  5AQP A;  1NM1 A;  3MDQ A;  3E9O A;  2GUP A;  3KZB A;  5CYQ A;  2Y1I A;  3LP3 A;  3S3N A;  2WOM A;  1V4T A;  3EKU A;  2YHX A;  3AVL A;  3AVJ A;  4DHY A;  3VA3 A;  4KH4 A;  2XY6 A;  1Y19 B;  4IDK A;  3VQ7 A;  3WNE A;  4Q0B A;  4CEO A;  3EL2 A;  4B08 A;  3NAE A;  1NJI O;  4DS4 A;  4LFB K;  3FZK A;  4WFA L;  4Y1C A;  4DFJ A;  5LJW A;  4MO4 A;  4JKC A;  1RBS A;  4CK3 A;  1TKD A;  4JHD A;  1T05 A;  3AGK A;  3VEW A;  3QML A;  3CJB A;  4BRA A;  3F9K A;  4FZZ A;  4DF8 A;  3QBW A;  4A61 A;  4LC9 B;  3H6E A;  1T8E A;  5BPN A;  4H0O A;  2IVO A;  4BRK A;  2OPR A;  4W5Q A;  1NOY A;  1Y64 A;  2NRW A;  5EY4 A;  1J19 A;  4OKE A;  1YAG A;  5HRN A;  2E4L A;  4FOE A;  1JCF A;  2KQ2 A;  1EWR A;  2QTD A;  4JK9 A;  1WN7 A;  2HHH K;  3GBT A;  4CEC A;  3ZET A;  3FP5 A;  4HDQ A;  1R59 O;  2HNZ A;  2NRZ A;  4FOI A;  3OYA A;  2UXC K;  4PA1 A;  2BH1 A;  3CF5 L;  2IVP A;  4GKK K;  4E1J A;  3U7D A;  1NGE A;  4TSX A;  1TKZ A;  5KTQ A;  2D1K A;  2D2Q A;  2P51 A;  5DM6 L;  4E3S A;  4YY3 K;  3LM9 A;  3ZET B;  4WQ5 A;  3OYE A;  4Z4F A;  2Y1J A;  1U4B A;  1NK0 A;  2QK9 A;  3UKR A;  4RW9 A;  1T7P A;  3ITH A;  4JEP A;  4HCB A;  5AQR A;  4CED A;  2IVN A;  4MO5 A;  4RW8 A;  4DR1 K;  4FZY A;  4BR9 A;  3V9S A;  3SUQ A;  4I2P A;  2D0A A;  1X9J A;  1QHT A;  4JKB A;  3MWP A;  4CVN E;  4DFK A;  2YJF A;  1DGK N;  4WE1 A;  1YI2 N;  3O4Q A;  3NFA A;  2PFU A;  1XC3 A;  3WNG A;  4F8R A;  4DCH A;  4KAZ A;  4B1X B;  4BRG A;  3SV3 A;  4NCG A;  1C0T A;  2QI2 A;  3HXM A;  2FBT A;  2P9U A;  1NK8 A;  5ELZ A;  2XHB A;  3C6U A;  3AVI A;  4IDH A;  3ZEU A;  1J6Z A;  4KHP K;  1LWF A;  3ZT3 A;  3CG7 A;  4AH9 A;  3LL3 A;  4CEB A;  3HST B;  3S41 A;  3ZCM A;  4ILG B;  1KTQ A;  1Q86 O;  4IOX A;  4UY8 O;  4O0I A;  2HBL A;  5AQL A;  2W42 A;  4DFM A;  1QHA A;  3BGR A;  1IKX A;  2HMI A;  3EN9 A;  3BF3 A;  1VQ9 N;  2OA8 A;  2VCP A;  2HHS A;  3DXM B;  3JYT A;  4B3O A;  2YKN A;  2HBJ A;  5AQV A;  2BGG A;  1UOC A;  1JCG A;  5HRP A;  3M1F A;  1FW6 A;  3ENO A;  3HL8 A;  3L2W A;  1TKX A;  3DLG A;  3A0I X;  4H5W A;  1RT7 A;  1WBD A;  2ASO A;  2H3G X;  4DMN A;  4DV2 K;  4LF8 K;  1HB8 A;  2WON A;  3P39 A;  2WUS A;  3VOV A;  5AQJ A;  2O8B A;  1IJJ A;  1HQE A;  4P7I A;  4B9T A;  1FKP A;  3OYN A;  3KD5 E;  1QS4 A;  4IFE A;  4YDU C;  3VEO A;  1GC7 A;  1YHQ N;  1GGO A;  3PO4 A;  4F3T A;  4B1Y B;  1O1W A;  4YOU A;  2FSK A;  2FBV A;  4JKA A;  2P9I B;  1RBR A;  1UA1 A;  4RG8 A;  3D2E A;  3QO9 A;  3TR8 A;  4CD1 A;  3C65 A;  1RTH A;  5LJV A;  1NI2 A;  2EMT A;  3JS6 A;  2RE2 A;  3HJF A;  5AR0 A;  1RTD A;  3P1G A;  5JS1 A;  2Q2R A;  2OPQ A;  1MA9 B;  2A1R A;  4V19 S;  3GDQ A;  4F2S A;  3C6H A;  2FF6 A;  3CJA A;  2D10 A;  1C0G A;  3HOT A;  4K8X A;  4DR4 K;  2KKZ A;  3D45 A;  1NJW A;  4NCB A;  1FJG K;  5LMU K;  4OKK A;  3OYJ A;  2CGJ A;  3SJJ A;  3TWH A;  3PSI A;  1RTI A;  1FKO A;  4N5S A;  5CZ2 A;  3PO5 A;  3WXI A;  4KHY A;  1TK5 A;  4IEI A;  2GWK A;  4K42 A;  5AZI B;  4IJA A;  2E6L A;  3ZLJ A;  4EIA A;  3SQ4 A;  4FW1 A;  3I55 N;  2FF3 B;  3U3Y A;  4YOX A;  4CEA A;  3J80 O;  3NE6 A;  4E7K A;  1ITG A;  2I7N A;  2Q3S A;  2OZS A;  1S1X A;  4HVJ A;  5JVL A;  4OGE A;  2A41 A;  2ABD A;  3AVA A;  4QCL A;  2DY4 A;  3CI5 A;  3AO3 A;  3THV A;  1S1T A;  3MN5 A;  1VQM N;  4ID1 A;  5KGW A;  1QSL A;  4Z4E A;  3NCI A;  4CFD A;  3OYI A;  3ZT2 A;  1EO1 A;  4BDY A;  1BGX T;  4Z4H A;  4LH4 A;  5HRS A;  3AVN A;  3AA5 X;  3CYM A;  4NY0 A;  5AQI A;  3IS9 A;  4BRH A;  4X62 K;  5TKY A;  4DV5 K;  3DYA A;  4H0X B;  4FK2 A;  1VBH A;  4B3M K;  3F9M A;  1ASW A;  1QQM A;  2QA4 N;  4NXN K;  5FRN A;  1SQK A;  2OPP A;  4CBW A;  4M42 A;  4HUF A;  4LF4 K;  4KBO A;  5IJM A;  4E7L A;  4ZRI A;  4EHT A;  4KI4 A;  2UUC K;  3QDK A;  4JN4 A;  3THY A;  5F2R A;  3L6Q A;  4IZ9 A;  4ZRK A;  2IDO A;  2E2Q A;  5AQN A;  5GAE P;  2RKI A;  4Y1D A;  5AQX A;  4DV4 K;  2Z1G A;  4OO1 J;  4CJL A;  4DR7 K;  1H4R A;  5GAH P;  3ZSX A;  3HM9 A;  1DLO A;  2HHW A;  4AHU A;  1HKG A;  1MU2 A;  4YFU A;  4DTJ A;  3H3N O;  1YJ9 N;  3VQ4 A;  4BAC A;  2QW9 A;  5BRD A;  1NKE A;  3PLA A;  2HHU A;  3DOL A;  1LWE A;  1IKV A;  5M1F A;  1QVF M;  3DRR A;  4FM2 A;  2I1K A;  4PY5 A;  5GIO A;  4K0K K;  1NK4 A;  3VQ8 A;  3VGK A;  2G8U A;  5BR9 A;  2X0S A;  4DR5 K;  3RMA A;  4E7I A;  4NLC A;  2VWB A;  4JI2 K;  3AO1 A;  3O1B A;  5KI6 A;  4BWM A;  1HRH A;  4CZM A;  2W40 A;  3QEP A;  2DIK A;  4FJI A;  1LOT B;  1WUA A;  3PX6 A;  4KTZ A;  5C42 A;  4DLG A;  4KHS A;  3MED A;  4G1Q A;  3M6G A;  4DTO A;  4F7G A;  4IOA L;  2P9L A;  4PL7 A;  4MDB A;  1VSD A;  4O0J A;  3KLG A;  1BI4 A;  2NZT A;  1HLU A;  3TAG A;  2QWN A;  1VRT A;  1MWK A;  4BC2 A;  1NKC A;  3BP8 A;  4BQL A;  2YX6 A;  3V9Z A;  4FZX C;  1ZBU A;  4DQR A;  3CC7 N;  4J2E A;  3QFP A;  4N76 A;  3LP0 A;  2COP A;  1GLC G;  2VG7 A;  4DTU A;  1VK0 A;  1NOZ A;  4B9N A;  3ENB A;  4DF4 A;  3NGZ A;  5KQD A;  3LAK A;  3T1A A;  3WUH A;  4AHV A;  4BRL A;  4DSF A;  1XHZ A;  3CCL N;  3DOK A;  4DG1 A;  3L2U A;  1Q7Y O;  4AHS A;  3FFK B;  1HQU A;  3LAL A;  4FM0 A;  4CER A;  1ZBL A;  4X64 K;  3AA2 A;  2O4G A;  4HCC A;  3JSM A;  3DXM A;  3CPW M;  1NGF A;  4A62 A;  2OAN A;  3ULE A;  3AVC A;  3RRG A;  1YF5 L;  4B3R K;  4LF7 K;  1NGI A;  4IFV A;  2Q31 A;  3AO2 A;  4QS7 A;  3HPO A;  4WCE L;  1RDW X;  4LY7 A;  1LAW A;  1VSM A;  3AA3 A;  3AV9 A;  3QIO A;  3BDP A;  3J81 O;  2VGM A;  3SZ2 A;  1GLD G;  4ISF A;  5AZI A;  3I33 A;  3O5B A;  2D5R A;  5IT9 O;  3M8P A;  3ZSZ A;  2BUP A;  1VQN N;  1D8Y A;  3PSF A;  4IO8 A;  4BGA A;  1ZBF A;  4AM6 A;  3C94 A;  4JK8 A;  3UE5 A;  1MK7 B;  2QWP A;  4B9L A;  1S1W A;  1RT1 A;  1N8R O;  1X9W A;  5DMR A;  1HKB A;  2HMP A;  4K25 A;  3TAQ A;  2RF2 A;  3GL1 A;  4FM1 A;  2EX3 A;  4BE2 A;  1QQC A;  5AQQ A;  4OPJ A;  3O3F A;  3LWL A;  1GLF O;  2FSN A;  4EAH D;  4W5O A;  1NGA A;  4GXB A;  3BIN A;  2D11 A;  3MMV A;  4BR4 A;  2AEH A;  4FWN A;  3HO1 A;  4LFA K;  4FWQ A;  2X6N A;  2QEX N;  3ATV A;  1OH7 A;  2A40 A;  3ZEU B;  2I5J A;  2ITG A;  4JNE A;  1Q81 O;  3SUO A;  1KAX A;  2Q1N A;  4DTX A;  1WSJ A;  4YOW A;  1N5Y A;  2YHW A;  2EMS A;  1JL1 A;  3VEY A;  3F5T A;  1BL3 A;  4FLX A;  4PQU A;  1TYQ A;  4Z4C A;  3JXU A;  4ZTF A;  4RCH A;  3G6E N;  3J8A A;  3I0S A;  4KHW A;  2KW4 A;  4BE0 A;  2P9K B;  5HBM A;  3DLH A;  4BQZ A;  4LF6 K;  4H4O A;  4CHY A;  4E0D A;  1GLL O;  4CJ3 A;  4CFA A;  5JIC A;  2ZPY A;  3QEW A;  4JI3 K;  1ESV A;  4KB0 A;  4B1Z A;  4CHP A;  3E1Y A;  2LSN A;  3D6R A;  2CB8 A;  2E88 A;  4EKU A;  4X65 K;  1IKY A;  4CF9 A;  4C8O A;  2AA4 A;  3ZSR A;  1KD1 O;  2DTU A;  4M3R A;  3AO5 A;  1NBW A;  3HPH A;  1T03 A;  2GBZ A;  2IOC A;  3T7Z A;  4B8A B;  2F4V K;  1Z26 A;  2B6A A;  1VQP N;  2HF3 A;  3HTV A;  3THW B;  1RFQ A;  2FSJ A;  4AIL C;  1V4S A;  4H5N A;  1NK5 A;  1YUW A;  4FJ9 A;  4FLW A; 
#chains in the Genus database with same CATH homology
 4WQ4 C;  4MO5 A;  2V51 B;  2R82 A;  4EHU A;  1G99 A;  3TSP A;  4A5A A;  4BR9 A;  4BRQ A;  4I6M B;  4FWS A;  4H5V A;  1NVL A;  1X9J A;  4CJ7 A;  4BRO A;  4JKB A;  2QWR A;  1GC6 A;  3MWP A;  2YJF A;  1DGK N;  5BPL A;  4JD2 A;  3RSE A;  1YI2 N;  2F9W A;  1RDU A;  3FR0 A;  2PFU A;  1XC3 A;  2AL6 A;  2E8A A;  5BRE A;  1GG3 A;  4NLB A;  3OA9 A;  5JLH A;  4DCH A;  1KBL A;  1VAZ A;  3D2E B;  4B1X B;  3O1W A;  2YI1 A;  3CER A;  4BRG A;  4HDO A;  2QI2 A;  4J8F A;  2P9U A;  5ELZ A;  1VQK N;  3Q7B A;  4L3Q A;  2ZJP L;  4IDH A;  3C0B A;  3ZEU A;  1J6Z A;  4CZJ A;  1U6Z A;  4JKF A;  3TTF A;  4FWL A;  3WXM B;  3CCS N;  3CME N;  3CD6 N;  1GLE G;  3LL3 A;  3PIO L;  5BPM A;  2A5X A;  4MDA A;  3ZYY X;  3S41 A;  4ILG B;  4TKN A;  3DWL A;  2HOE A;  4IOX A;  3CCR N;  1Q86 O;  4UY8 O;  3R3L A;  4FO0 A;  3O8M A;  2ITM A;  2HBL A;  2QM1 A;  5AQL A;  3N4Q A;  4FSV A;  5CR4 A;  4YL8 A;  5E84 A;  5AQF A;  1ILY A;  1QHA A;  4BVO A;  3HM8 A;  3EN9 A;  3BF3 A;  3O9Q A;  1VQ9 N;  2VCP A;  1KAZ A;  2P9P A;  4Y0W A;  3DXM B;  4IOC L;  1U2V B;  2NRV A;  1YVN A;  3EE8 A;  4OPH A;  2EWS A;  2HBJ A;  2E1Y A;  1NTI A;  2WFB A;  3KWG A;  5AQV A;  1EQY A;  5JVG L;  3FLV A;  1JCG A;  2KLA A;  3M1F A;  4CZK A;  3ENO A;  3CCJ N;  2QWM A;  1T3V A;  5AFU A;  3LDQ A;  3A8Y A;  3VTH A;  3TTC A;  1EO1 A;  4OPA A;  4R79 A;  3A0I X;  3G9W A;  2WH5 A;  3DXK B;  4H5W A;  4BRC A;  4WFN L;  2ASO A;  2H3G X;  5C0Y A;  3CC2 N;  1HB8 A;  4HTL A;  3TU5 A;  3UB5 A;  1Q18 A;  2ZWH A;  3P39 A;  1MIZ B;  2WUS A;  3VOV A;  5AQJ A;  2GEL A;  1MWM A;  2WC9 A;  5M1N A;  1IJJ A;  4NO7 A;  3MCA B;  4AM7 A;  4P7I A;  4JK7 A;  1X3M A;  3CET A;  4PHT X;  3ATU A;  4JKE A;  3OBW A;  1NMD A;  3KHY A;  3IVF A;  3WT0 A;  4IFE A;  2NLX A;  3MWT A;  3AU4 A;  4YDU C;  3U4L A;  3LDL A;  4DB3 A;  2FXU A;  3BEX A;  3VEO A;  5CE3 A;  1S3X A;  1GC7 A;  1YHQ N;  1XQS C;  3CJ7 A;  1GGO A;  3WXJ A;  4B1Y B;  4YOU A;  4GVE A;  2FSK A;  4B1V A;  4JKA A;  2P9I B;  3D7E O;  3SBT A;  1C0F A;  3VEV A;  1HB6 A;  1NGB A;  2F7T A;  2JWL A;  3D2E A;  3ID6 A;  5GAG P;  2ASP A;  5AZJ A;  3O4W A;  4BG8 A;  4CD1 A;  3C65 A;  4RWT A;  4NB4 A;  4GV3 A;  5LJV A;  4FWK A;  5AZJ B;  4BR2 A;  2D0O A;  2NRT A;  1NI2 A;  2DPN A;  2F9T A;  2EMT A;  4CZG A;  3JS6 A;  5AQG A;  3GOI A;  2RE2 A;  4BR5 A;  5AR0 A;  4IEE A;  2Q2R A;  1OKJ A;  4JKH A;  1IG8 A;  4WQ4 A;  4BRI A;  1MA9 B;  1SGH A;  1E4F T;  3GDQ A;  4BRN A;  2RHK A;  5JLF A;  1VQ6 N;  3E66 A;  2FF6 A;  3AAP A;  3C6H A;  2D10 A;  2PAV A;  3CJA A;  1C0G A;  3HOT A;  4GV6 A;  1CZA N;  2KKZ A;  5BRF A;  4BR0 A;  3VF4 A;  3VGM A;  4CI6 A;  3LDP A;  4M7Y A;  5EX5 A;  3CCE N;  3W0L A;  1MIX A;  2CGJ A;  3FE1 A;  3H45 C;  1E4G T;  2WBN A;  3OW2 M;  4JKG A;  1HUX A;  3HZ6 A;  5AQO A;  3WXK A;  4AF1 A;  2YCH A;  3B8A X;  4Z94 A;  1KC8 O;  1LCU A;  3WXI A;  4BRP A;  2P9L B;  2P9U B;  4IEI A;  1KC7 A;  1ZBS A;  3SJH A;  2GWK A;  3HBT A;  1P8Z A;  4K42 A;  4H0P A;  4G9Z A;  5AZI B;  4IJA A;  2YHY A;  4JAX A;  1YIJ N;  3MK6 A;  4H0Y B;  5AQK A;  3R1X A;  4EIA A;  2FJ9 A;  3OHR A;  5M1K A;  5M1P A;  3FZF A;  2UYT A;  3I55 N;  1U2V A;  2FF3 B;  3VER A;  3SAF A;  4YOX A;  4GV9 A;  4H0T B;  2IIR A;  1M90 O;  4FWM A;  3AY9 A;  3I56 N;  2I7N A;  3WQT A;  5C2F A;  2HE7 A;  3E9P A;  3VPZ A;  1Z6R A;  5C12 A;  5JVL A;  4CBX A;  5EXW A;  3AAQ A;  3VEZ A;  3UKR B;  3G4S N;  4EFH A;  4GNI A;  3IUC A;  2A41 A;  2ABD A;  2W41 A;  2CGK A;  3CI5 A;  1K73 O;  3R6M A;  3MN5 A;  1VQM N;  5MLC Q;  1TYQ B;  2NRR A;  2OTJ N;  5EVZ A;  5AQM A;  3MX2 A;  2D0P A;  4BC3 A;  1BG3 A;  2QXL A;  2JWK A;  3U8Z A;  2ASM A;  3O6W A;  3ULE B;  3WEE A;  5CHI A;  3QBX A;  3AGR A;  3F2K A;  4CZI A;  5FPE A;  3FZL A;  3P31 A;  1BUP A;  3VTI A;  1YJN N;  4NY0 A;  5AQI A;  4FWP A;  3CQX A;  4BRH A;  1YIT N;  5TKY A;  5ADX H;  3CCQ N;  2J0K A;  3PIP L;  3P38 A;  3K9J A;  2Q0U A;  4MLE A;  3R9P A;  4H0X B;  1ATN A;  2ZGZ A;  1QQN A;  1VBH A;  3AAR A;  1BO5 O;  3EE9 A;  3CJC A;  4PKI A;  4WQ5 C;  2P9I A;  3F9M A;  5AQT A;  1BWF O;  1QQM A;  2QA4 N;  2P9S A;  2P9P B;  1SQK A;  2E20 A;  3A5N C;  5FPM A;  3HSC A;  5B8H A;  5JMV A;  4ISE A;  4CBW A;  1QQO A;  3WA0 A;  3FGU A;  4IJN A;  3VEX A;  3VEN A;  4KBO A;  1KQS M;  5IJM A;  1S22 A;  3ZX2 A;  1QZ5 A;  3H1V X;  1X3N A;  4ZRI A;  4EHT A;  5BN8 A;  3TSU A;  3EPY A;  3DLL L;  2FLO A;  1WOQ A;  3CPE A;  2J0M A;  3SK3 A;  3QDK A;  4JN4 A;  5F2R A;  3L6Q A;  4IZ9 A;  2HBM A;  3CQY A;  4B1U B;  4ZRK A;  2V7Y A;  3LDN A;  2E2Q A;  5AQN A;  4M63 C;  5GAE P;  3D2F A;  4A5B A;  5AQX A;  2YVC A;  3CJ1 A;  3L4Q A;  2NRH A;  3GG4 A;  2ZJR L;  3CC4 N;  1GLA G;  4XH1 A;  4OO1 J;  2QWQ A;  1DKG D;  3T69 A;  5E26 A;  2HRJ A;  1HKC A;  1W97 L;  1H4R A;  1ATR A;  5GAH P;  3EKS A;  4C1N K;  2HBK A;  5C10 A;  3SLC A;  3SMS A;  3A5O C;  2LBB A;  3DJC A;  4DQ8 A;  5KPR A;  4BR7 A;  3O9T A;  1HKG A;  5BN9 A;  1BDG A;  5EOY A;  4XH4 A;  2CGL A;  2VGN A;  3U8X A;  3H3N O;  1YJ9 N;  2NNW A;  4FPB A;  3IMX A;  3WXL A;  3VGL A;  2ZGY A;  4CBU A;  5HOO A;  2QW9 A;  4FPA A;  5BRD A;  3PLA A;  2P9N A;  3QIJ A;  4RTF D;  4YOV A;  2D4W A;  2Q36 A;  3HOS A;  3J7Z O;  5FPD A;  2P9K A;  5M1F A;  1HBK A;  1QVF M;  3CIP A;  3W3D A;  1VQ8 N;  2I1K A;  5GIO A;  2GTD A;  4YOT A;  4C23 A;  1BU6 O;  3VGK A;  3L4I A;  3A5L C;  5BR9 A;  3VF2 A;  2X0S A;  1MK9 B;  5JVH L;  2Q0R A;  4DXA B;  4NLC A;  3CCM N;  4H5R A;  2VWB A;  3TTD A;  4C1N I;  4CZL A;  1GLJ O;  3O1B A;  1K8K A;  4JHD B;  4O8U A;  4XH5 A;  3ENH A;  3PZD A;  4XEI A;  2QWL A;  3LDO A;  4U67 L;  4CZM A;  2W40 A;  3NVM A;  3QFU A;  2DIK A;  4BG9 A;  4BC5 A;  2VYP A;  4BC4 A;  4FWO A;  4U7B A;  1LOT B;  2GX9 A;  3TSQ A;  3MN7 A;  2A6A A;  1WUA A;  1OVY A;  1T44 A;  3O9U A;  1YXQ A;  4YOR A;  3EZW A;  3G25 A;  3H46 O;  3M6G A;  4F7G A;  5C15 A;  4IOA L;  2P9L A;  4PL7 A;  3KVG A;  1VQ4 N;  3D2F B;  4MDB A;  2FDQ A;  4K43 A;  3SAG A;  2NZT A;  1DIK A;  5LY3 A;  5ADX A;  4CD3 A;  1HLU A;  2QWN A;  4BVP A;  1MWK A;  4BC2 A;  1JJ2 M;  4IWV A;  2P9S B;  3K9K A;  3BP8 A;  4BQL A;  2YX6 A;  1BOT O;  1RGI A;  3M5R A;  4CZF A;  3H1Q A;  4IXC A;  2J0J A;  2HF4 A;  3CC7 N;  3QFP A;  3MCP A;  1Q82 O;  2COP A;  4BGB A;  1GLC G;  4CZE A;  1ACA A;  4H0V B;  2KHO A;  4A59 A;  2A3Z A;  4ILH A;  2CH6 A;  4WF9 L;  2ZF5 O;  1T6C A;  3FZH A;  1Z05 A;  3M3Z A;  4FVU A;  5FPN A;  4A2A A;  3SAH A;  3NMU A;  4JKD A;  2E2P A;  3ENB A;  1BA1 A;  5KQ8 A;  5KQD A;  3WUH A;  4BRL A;  3WEE B;  3CCL N;  3CXC M;  2E2N A;  1Q7Y O;  3FFK B;  4KH5 A;  4YDU A;  3PVL A;  1H1V A;  2PBD A;  5AQH A;  1HJO A;  2QWO A;  4JD2 B;  3O9R A;  4MLH A;  4BY9 C;  2YJE A;  3DXM A;  3IDH A;  2E1Z A;  5M1Q A;  3VES A;  1TUU A;  1NGF A;  3CPW M;  5AQS A;  5M1O A;  4A62 A;  1ZXO A;  2OAN A;  3ULE A;  3U9D A;  4WYB A;  1D4X A;  2Q97 A;  1YF5 L;  3IKM A;  1NGC A;  3BF1 A;  4YOY A;  1NGI A;  5GIP A;  2E2O A;  2Q31 A;  4K41 A;  4QS7 A;  3UKU B;  1DEJ A;  4WCE L;  1RDW X;  1M1K O;  2I1J A;  3H3O B;  4BRD A;  4PKG A;  2ZJQ L;  1VBG A;  2VGM A;  4A57 A;  1ST7 A;  1GLD G;  3ZDT A;  2AP1 A;  4ISF A;  1S72 N;  1SS6 A;  4GY2 B;  4B9Q A;  5AZI A;  5AQU A;  3A5M C;  3I33 A;  3O5B A;  3Q7C A;  5TKW A;  1K8A O;  1NWK A;  4BRM A;  1MDU B;  3HRG A;  4PKH A;  4QS9 A;  3EO3 A;  5H1S Q;  2CH5 A;  2BUP A;  5C2D A;  1EF1 A;  2V52 B;  3P4I A;  1VQN N;  4BRE A;  3VMF B;  4IO8 A;  4QS8 A;  5AQP A;  3CMA N;  4BGA A;  5KPZ A;  1NM1 A;  3QIC A;  3MN6 A;  3MDQ A;  3E9O A;  4M7X A;  4F9O A;  4AM6 A;  2GUP A;  3KZB A;  4JK8 A;  1NGD A;  3O80 A;  3UE5 A;  5I9E B;  1MK7 B;  1HPM A;  2QWP A;  1DT9 A;  4FL9 A;  5AQY A;  2OTL N;  2V7Z A;  5F1X A;  4B1W B;  1N8R O;  1HKB A;  2HMP A;  4WFB L;  3I8B A;  1V4T A;  4K25 A;  1QVG M;  3GL1 A;  3EKU A;  2J4R A;  3ID8 A;  3SMP A;  3ZX3 A;  2P9N B;  2YHX A;  5AQQ A;  4DHY A;  1P90 A;  2HST A;  4KH4 A;  5BRH A;  1GLF O;  1Y19 B;  2FSN A;  1NLV A;  3DXK A;  1NGA A;  4EAH D;  5KPT A;  4GXB A;  5HL7 L;  4ISG A;  3O9S A;  3HI0 A;  3BIN A;  2D11 A;  1VQO N;  3MMV A;  3U9Z A;  4BR4 A;  2AEH A;  1VQL N;  3C6A A;  4FWN A;  1HX1 A;  1JCE A;  3EL2 A;  4FWQ A;  2QEX N;  3ATV A;  1NJI O;  3CHW A;  1O13 A;  1ZC6 A;  2A40 A;  1T6D A;  3FZK A;  3ZEU B;  2A42 A;  4WFA L;  4JNE A;  3CJ9 A;  5LJW A;  1KXP A;  4MO4 A;  1Q81 O;  4JKC A;  4ILJ A;  1KAX A;  3E9L A;  1QZ6 A;  2Q1N A;  1K8K B;  3IFR A;  4JHD A;  1NGG A;  2GEM A;  4YOW A;  4IO9 L;  1GLB G;  2YHW A;  2GWJ A;  3AGK A;  3GE1 A;  3VEW A;  3CCV N;  3R8E A;  3QML A;  3CJB A;  3LM2 A;  2EMS A;  3FZM A;  4KH6 A;  3ZX0 A;  4BRA A;  3QBW A;  1NGH A;  3DAW A;  3F5T A;  3VEY A;  4A61 A;  3OBY A;  4LC9 B;  1BA0 A;  3H6E A;  1TYQ A;  2NRX A;  3O08 A;  4FWR A;  4H0O A;  3RSE B;  5BPN A;  2IVO A;  4BRK A;  5AQZ A;  4ZRJ A;  1VQ5 N;  3JXU A;  3BUZ B;  4RCH A;  1Y64 A;  3FLC O;  3G6E N;  1K9M O;  2NRW A;  3KK7 A;  3J8A A;  5EY4 A;  3UKU A;  4DKW A;  1J19 A;  3MX5 A;  3MN9 A;  5DM7 L;  3AU5 A;  2P9K B;  4O5F A;  3SBG A;  1YAG A;  4BQZ A;  3TPQ A;  4FOE A;  4A2B A;  4CZH A;  1JCF A;  3WQU A;  2CQU A;  3KWI A;  5F0X A;  2QTD A;  4BRF A;  1GLL O;  4JK9 A;  3L0Q A;  1XUP O;  1NGJ A;  3GBT A;  3ZET A;  5JIC A;  2ZPY A;  3FP5 A;  4HDQ A;  1R59 O;  2NRZ A;  4FOI A;  3X23 A;  1JDE A;  1ESV A;  4B1Z A;  3E1Y A;  2BH1 A;  3CF5 L;  2IVP A;  3D6R A;  2CB8 A;  2E88 A;  1TUY A;  4O8K A;  4EKU A;  4H5T A;  4E1J A;  3U7D A;  1NGE A;  1ATS A;  2AA4 A;  1SZ2 A;  3VF6 A;  2I7P A;  1KD1 O;  1NBW A;  1W2B M;  3N4P A;  3VET A;  3T7Z A;  5AQW A;  4PL8 A;  4CYE A;  3RVC A;  5GIN A;  5GAD P;  2BTF A;  2D1K A;  4HWI A;  2D2Q A;  5DM6 L;  3C7N A;  4H03 B;  3G71 N;  1SAZ A;  3LM9 A;  1E5W A;  3ZET B;  1YJW N;  4WQ5 A;  3CCU N;  1VQP N;  2HF3 A;  3HTV A;  3QB0 A;  2RQ1 A;  5AFU H;  3NVK A;  1RFQ A;  2FSJ A;  1VQ7 N;  4I6M A;  1KAY A;  3UKR A;  1V4S A;  3C7N B;  4H5N A;  4JEP A;  4JKG B;  1YUW A;  1ISN A;  5AQR A;  2IVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...