4JKBA

Open and closed forms of v1788d human prp8 rnase h-like domain with bound mg ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
221
structure length
221
Chain Sequence
b'ELFSNQIIWFVDDTNVYRDTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 67
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkbA01
4JK8A 4JK7A 4ILGB 4JKHA 4JKFA 4JKEA 3E9OA 4JKGA 4JKCA 4ILHA 4JKAA 3ENBA 4JKBA 4JKGB 3SBGA 3E66A 4JKDA 3SBTA 3E9PA 4ILJA 3E9LA 4JK9A
chains in the Genus database with same CATH superfamily
2A40A 2A5XA 2ZJRL 4M7YA 4FJXA 3WA0A 4JKGA 2R82A 2FC0A 1KAXA 4FOIA 1VQLN 2KQ2A 5AQVA 4A57A 1NM1A 4DLGA 1C0TA 5C0YA 4F4KA 2ZGYA 4H5NA 3LWMA 4BROA 1CLQA 3U9ZA 4QCLA 2IIRA 4F8RA 4BC5A 2PZSA 3VQ7A 3WEEB 3J7AP 2V51B 2A1RA 4FWMA 4AHUA 2HF4A 4RW9A 1C0GA 1FW6A 3IG1A 3KK1A 2NRRA 1HNIA 2E8AA 1HKCA 5AQYA 4DF4A 1EKEA 2UXDK 5GIPA 5TKWA 4EP5A 1S72N 2D0OA 1W97L 3ATVA 2P9NB 3HXMA 5H1SQ 2GEMA 2KHOA 1TL1A 1RT7A 5FPNA 2FSKA 5AQJA 1YJ9N 4E7HA 1HBKA 1HYVA 3SV4A 4DTOA 2BDPA 2E1ZA 4CZJA 1NG9A 1KFSA 1NGEA 2I7PA 3RTVA 2P9SA 1GGOA 1KSPA 1QHTA 4JAXA 4OLBA 4E0DA 2IDOA 2WFBA 3FR0A 3TTFA 4DR4K 1S6PA 2HBJA 2E5LK 4WFAL 3BY5A 2JLEA 3LP0A 4CZEA 4NB4A 1L5UA 3J8AA 4AM7A 3ITHA 3AU4A 3LDNA 3MK6A 4I6MA 2G8UA 4FYDA 4G1QA 3TSQA 5CHIA 3THWB 4EIAA 4QS7A 3GE1A 4E7IA 2H3GX 4DTMA 2YHBA 4CEQA 3A2FA 3ULDA 3S3OA 1L3VA 4B9QA 4B3MK 3HYFA 3P39A 4BDZA 3HOSA 3ISNC 5SZTA 2WC9A 1SQKA 3KWIA 1WAJA 4CGHA 1IKVA 4M42A 2KKZA 2P5OA 4RCHA 2ZGZA 4F3OA 3E9OA 3HBTA 1S5JA 1WSGA 3GOIA 4CJQA 4KH5A 4FSVA 1YIJN 4AHCA 3FFIA 3LDLA 5FPEA 1ZXOA 3H08A 2BTFA 5CZ1A 4DSEA 2WBNA 3C6HA 3WXLA 2RPIA 3L2WA 1C6VA 2PFUA 3A5NC 4FJMA 1KRPA 4ILGB 3OBWA 4YOWA 3SPYA 3M3ZA 4WQ4A 3OS1A 2O8BA 4W5NA 2E2NA 2WH5A 1EXQA 3IVFA 1DTQA 4H5VA 1SUQA 4O5BA 1VQ4N 3HPOA 1KAYA 1XQSC 4ELVA 4B9NA 4EZ6A 3S3MA 5AQKA 1TKDA 5AQZA 4FWOA 4E3SA 1HQUA 1NGCA 2YHXA 1XHZA 3SBTA 3UB5A 2DTUA 4NYNA 1YHQN 1RCHA 1D4XA 3QETA 3LZJA 4LH4A 2ITGA 2P9IB 3VEOA 4CHYA 1DLOA 1LOTB 1SL1A 3NVKA 1KD1O 5AQIA 3SQ1A 3HP9A 3DRSA 4PL7A 1TKTA 4CJ3A 3BGRA 1KQSM 3AO1A 4IOAL 4FOEA 4V19S 5KQ8A 1ZBIA 1RTJA 1NKBA 4DQSA 5LJWA 4O4GA 4R79A 5CR4A 1T7PA 1L3SA 4AHSA 1I94K 1XC9A 1JLCA 4DUZK 2G8IA 4BRIA 2QWOA 2BH1A 1U2VA 3TABA 3MXIA 2VG5A 3V9XA 5JVHL 3W0LA 3QNNA 4FK2A 5EVZA 1DEJA 2YNGA 3GG4A 2OPRA 1FK9A 1BCOA 3EEQA 2V52B 1NVLA 4XEIA 1X9SA 4BQZA 1RBSA 4EFHA 3V6DA 2CH6A 2ZJQL 4JKDA 4DTRA 3QEIA 3KTQA 4KPYA 3F9MA 5AZJA 2CQUA 3T1HK 4QAGA 1NJXA 3H45C 1BA1A 1WSHA 2P9KB 4CK1A 2HSTA 3UKRA 4FO0A 1B9DA 2D0CA 1NJWA 2CB8A 4B1UB 2XY8A 2VYPA 4H5WA 4A62A 3F73A 3THVA 2QM1A 1J9AA 2IS3A 3HK2A 3AU5A 2GWKA 2QXFA 1HR0K 3H6EA 3V9WA 3DLRA 3FGUA 2AEHA 1O1WA 2OZMA 1IO2A 3LANA 1H4RA 4PY5A 3PIPL 4BE1A 3PV8A 3OYGA 4KV8A 3D2FA 4O0JA 3NGZA 4DTNA 5HBMA 3HJFA 1HB6A 4DU1A 4ILHA 4CECA 3OW2M 4LH5A 3QEPA 3MEGA 5C42A 3TPQA 1WBBA 2IVOA 4CBWA 3HL8A 3RRGA 2CGLA 4B3SK 2KW4A 4BRFA 4ZTFA 3CETA 3BUZB 5FLXO 1QE1A 2J4RA 3VQPA 1BWFO 1G15A 4CFBA 4KI4A 3FZMA 3VTHA 5B8HA 2BANA 1X3NA 2P1JA 4NCGA 4FWLA 2HBMA 3MWTA 1T03A 3D45A 4Z4GA 2HHQA 3HM8A 2DFFA 4NCAA 3MX2A 2W6LA 1GC6A 5BN8A 2HF3A 1QS4A 4FJHA 2HHUA 1HJOA 1KLNA 2F8TA 3U3YA 4M3WA 3SNNA 3NMUA 4X66K 1MWMA 1YITN 4DFKA 3DLHA 3ZX0A 1OKJA 2FF6A 4R5PA 2PYLA 4B9UA 3KLFA 2HOEA 4I6MB 3CHWA 4DTUA 3UIQA 4Y1DA 3LP1A 1SL2A 3HSCA 3LM2A 5BPNA 5KPZA 3THXA 4YL8A 4JRQA 4H5TA 4OJRA 4CF2A 2E2QA 1IKWA 1WOQA 4MO5A 2ZJPL 2E2OA 3GL1A 4B08A 3ID8A 1HJRA 3C7NB 3J80O 4YDUC 1ZBSA 4AH9A 4A5AA 4IOCL 5AR0A 5HRPA 3I0RA 3VESA 1T8EA 1OH7A 1T6DA 2F9WA 3HTVA 3O3FA 4JD2A 4ID1A 5BN9A 3ZSRA 5BR9A 4C8OA 3HPHA 2W6KA 3WNHA 3LDOA 2YNIA 4F3TA 4ISFA 1WSIA 3QDKA 4LF8K 3DM2A 2YJFA 3CJ9A 4A61A 4WFNL 3CQ8A 4CGDA 4CBXA 1K73O 1FKPA 1Z25A 2XY7A 3M8QA 4UQGA 1VSKA 1HYSA 3ZSOA 4BR5A 1U48A 3VQCA 3CG7A 4FJNA 4KTWA 3WEEA 1D9DA 2Z1IA 3R3LA 1EWQA 4QOZB 3QNOA 3QFPA 1VSJA 3T3FA 3CC7N 1T3VA 4FPAA 3J81O 3CERA 3B6PA 1LAWA 4KH6A 4DS5A 1UAXA 4JKCA 3AGRA 3ENBA 2IC3A 1HX1A 2P9UB 2E4LA 3U4LA 3SBGA 1QVGM 2P9NA 4B9TA 3AO5A 4ID5A 1I39A 4JI1K 2NRVA 2RN2A 2HHSA 3LPUA 3AA5X 1LW2A 3J7YP 3CJCA 4E19A 2O4IA 1U2VB 4ZRIA 1ASVA 1JKHA 1BO5O 5AQTA 4MLEA 1VQKN 3OYMA 4B3TK 2HBLA 4KKOA 3O4WA 5DM7L 3V4IA 1TUYA 3SYZA 1MIZB 3CC2N 3CCMN 3VETA 3V1OA 5BRHA 1ISNA 2Q2RA 4DU4A 3CF5L 1GLEG 4IEEA 3TTCA 4PHTX 3NAEA 3BEXA 4I2QA 3O1BA 2O8CB 1TUUA 1UOCA 2A6AA 2IGIA 2ABDA 3D7EO 5J2MA 3THWA 1Y97A 4JI3K 2F8SA 1IBLK 2QKBA 5EU7A 1BISA 4BG9A 4GXBA 4WYBA 3O3HA 4O5FA 4JKAA 4FJGA 4Z4IA 1RT6A 2FLOA 3B6OA 5AQRA 1UWBA 2EMSA 3ZX2A 1VQ9N 5D3GA 5SWMA 2P51A 1GOAA 3ZLJA 3KKSA 2F7TA 2COPA 4FLXA 4BRQA 3C0BA 3K2PA 2DY4A 3O8MA 1O13A 1JLQA 2PAVA 3DJCA 2VG6A 1MA9B 2PBDA 3H1VX 4FVMA 4WQ4C 2G8KA 4BY9C 4JI5K 1XHXA 2Z1JA 1RGIA 4BWJA 2QWLA 2NRZA 4H8KA 1S1TA 1TK0A 5M1NA 3B8AX 1SKWA 4BRLA 2D0BA 3KK7A 3O80A 4IKFA 2HVIA 1VHXA 1EF1A 3AVFA 3MEDA 3RR7A 3JXUA 4PA1A 2B5JA 4OKEA 1N33K 2P9PB 3TSUA 1LWFA 4FM0A 4CFCA 5M1OA 2NRXA 2DIKA 4NY0A 3P83D 3LALA 1CZ9A 4JI6K 3WNEA 1EWRA 3BP8A 4E89A 1VSLA 4MLHA 1HYZA 2P9IA 3CXCM 3ID6A 4TSXA 3VQ5A 4M45A 3IMXA 2X78A 4CJ5A 3NF8A 4CFAA 4GVMA 1RT5A 4KB0A 5GAEP 2RF2A 1N36K 4CJPA 4DSFA 1VQ7N 1ILYA 1S6QA 4CHPA 2DFEA 3WQTA 1CZBA 5C2DA 3OYJA 4FWRA 3LDPA 3OYFA 4DTPA 4A5BA 1BCMA 1DTTA 2V7ZA 4ISEA 5AFUA 4CJRA 4YOUA 3TAMA 5HL7L 4FJJA 3EO3A 1OVYA 2QK9A 3OYDA 4YOTA 1RBRA 4I9LA 2QXLA 1T05A 3C95A 2I1JA 1HQEA 1U47A 2XY5A 3HPGA 1XI1A 1S9EA 4CZGA 1ESVA 2P9KA 4CJVA 4JD2B 4JI8K 4LF5K 4JEPA 1S1WA 5C10A 4EAHD 2YHAA 4DHYA 3H1QA 1OH8A 4B9SA 3OYIA 1ZC6A 3JS6A 4YDUA 3FLCO 4KI6A 5KGXA 1KXPA 4HCCA 2X74A 2OTJN 1DGKN 4M3YA 3PX4A 1NOZA 2ZF5O 4CF8A 3OYLA 4BE2A 3RMAA 4K25A 4K43A 3ZSXA 3S9HA 4LFBK 3QINA 4FWKA 4CJWA 4KB1A 3AVHA 1GLLO 2OPPA 3AO3A 1ATSA 3KWGA 4HCBA 3KLGA 4M3XA 3MX5A 3EKSA 2RKIA 5F2RA 2NUBA 1NBWA 4IO9L 1KCFA 2Q0UA 1R0AA 3WUHA 4JRPA 2BE2A 5AQFA 2F9TA 5AQGA 3NE6A 2FBXA 1Q86O 4CK3A 3I56N 4XH1A 2HNDA 3OS0A 1OH6A 3QEXA 3OYEA 3ZDTA 1NWKA 1ZBHA 1K8AO 4CVNE 4LF9K 3KVGA 2F4VK 3O4QA 4IZ9A 2A41A 2X0SA 4HUEA 1DT9A 4H0OA 3VGMA 3ALYA 3V9ZA 2WONA 4BC4A 3BZKA 3I55N 2EMTA 3ZYYX 3QIJA 3AVNA 3DOLA 1Q7YO 1M1KO 2J0KA 4JI4K 1ZBUA 1J19A 3OYBA 3NBPA 1BGXT 1P8ZA 1NK6A 4CZHA 5M1KA 4K8XA 1NK8A 2UYTA 4Z4HA 3PX0A 3LAMA 3FZHA 1YTUA 1DKGD 2HBKA 4C8LA 4B9LA 4IBNA 4JHDA 4OPKA 4WFBL 1CZAN 2D1KA 3C7NA 5GIOA 4CGGA 1OH5A 5A2QO 4JK8A 2HRJA 3U3GA 3WXKA 1N6QA 3OBYA 3THYB 5HRSA 1U4BA 1SAZA 5J2QA 1B92A 1RT1A 1CXUA 3EE9A 3M6GA 2NRWA 3ATUA 2G8HA 3D6RA 4CGFA 3O9RA 4CJ7A 5K14A 2BGGA 1HNVA 1K6YA 1NK5A 5LMNK 1VSDA 2NZTA 3VGLA 2FJ9A 2W42A 3AVIA 4KHSA 3VEYA 3MXMA 4FJ7A 4M3UA 3L3VA 3T7ZA 4JKFA 1GLBG 4BRKA 1GC7A 1N8RO 2AA4A 3M8PA 4CCHA 4CD1A 4CJTA 4B1YB 3C6UA 4A2BA 3TARA 5JS1A 3SJHA 3C65A 5EY4A 5JICA 5HROA 2HHHK 4OVLA 3BF3A 4J8FA 1WSEA 3D2EA 1HKGA 4JK9A 2GUIA 4KTZA 2X6NA 2EHGA 1S1VA 4GV9A 1C1CA 1ATNA 2UU9K 3PLAA 3QERA 2HHXA 1GLAG 1VSMA 2QWNA 2PY5A 2P9UA 3MDQA 4GKJK 4KH4A 1YT3A 1K8KA 1XWLA 3G0ZA 1VBHA 4A2AA 4DSIA 4AHTA 1JXEA 2UXBK 4BR7A 4LSLA 3L3UA 4XH4A 3CPEA 3MN7A 4AM6A 3OJSA 4C8KA 1XNQK 1X9MA 4FLWA 2P9LB 5TKYA 3AA2A 3JAMO 3SZ2A 3E9LA 2YCHA 4F9OA 2JWLA 3LP3A 3AGKA 5C2FA 2ZWHA 4CK2A 5IWAK 2JGUA 4BRNA 1XMQK 3RMCA 2I1KA 3KIOA 2A1SA 3L4IA 5AQWA 4CEBA 5ADXA 2NRTA 4ZRKA 1VRUA 3NFAA 3AVBA 4M3ZA 4DQQA 2O8CA 3KLIA 3T1AA 2VGMA 1YI2N 3AA4A 1VQON 1BHLA 3AA3A 3A0IX 3G10A 5IT9O 3A5LC 4K8ZA 1RDAA 4CEZA 2D11A 4OGEA 4FJIA 2E88A 3SK3A 3EKUA 5KPTA 4CEDA 5AQXA 4A59A 4EKUA 4YORA 2O8DB 1JLBA 1KLMA 3UE5A 1JLAA 1RT3A 4N41A 1TL3A 1D9FA 5E26A 3KZBA 3K5LA 4DF8A 1QQNA 3IKMA 4GV6A 1TAUA 3VENA 4AQYK 4KFBA 1RT4A 4OO1J 1SZ2A 2CGKA 2YKMA 3CYMA 4FWSA 3OYCA 1XC3A 3CJAA 2Q36A 5JVGL 5FRNA 3IS9A 2YKNA 3PVLA 2OCEA 2G8WA 1VQNN 4M41A 3VEZA 3HRGA 3K5NA 5CZ2A 4BC3A 3LM9A 2P9PA 3AVLA 1BQNA 3G71N 2E2PA 3U6FA 4DQRA 3VQ8A 4BR2A 4CZLA 3IRXA 4FM1A 4MDBA 2YNFA 2Y1IA 1A5WA 4LC9B 1LWEA 4WCEL 4CI6A 3HVRA 1NGGA 4CESA 4FZYA 3F2KA 3ZCMA 1SGHA 4DSLA 1VRTA 4B8CA 4CHZA 3V1RA 3DRPA 3VEWA 2D0PA 2HMPA 5I9EB 3QBXA 1VQPN 4RWTA 4BR4A 3EYZA 3O6WA 1SV5A 3VF4A 2RQ1A 3OYAA 3O5BA 5AZIB 3PZDA 2O8FB 4O8UA 3G6EN 3ZT1A 3WXMB 1NJZA 2ZE2A 3VA0A 1V4TA 1T6CA 4Z4CA 4LD0A 1KC8O 2QI2A 3M8RA 4FLYA 1RDBA 2UUAK 3O9TA 4H4OA 4IO8A 2AJQA 4JHDB 4FW2A 3CPWM 1G99A 3NGYA 2FSNA 3VTIA 1VSEA 4AHVA 4JS4A 1S22A 4CIFA 3KK3A 5AFUH 1CXQA 5AQUA 3C6TA 5CE3A 3OYHA 3MN6A 5AQQA 1X3MA 3EN9A 3ZT2A 5KGWA 4W5TA 3PIOL 2XY6A 3PX6A 5J2NA 3DYAA 2OPSA 3CCUN 2D2QA 1Y19B 4CD3A 1Y64A 3SMSA 3M1FA 4OKKA 4E1NA 2QWPA 1RBUA 1WB9A 2E6MA 1NGBA 1MIXA 4LFCK 4K41A 4JKEA 4F7GA 2A42A 4M63C 4DWIA 4C8MA 3P5JA 1BDGA 3HO1A 1IG8A 3TU5A 4CHOA 4DUYK 4Z4EA 3K58A 1WNSA 3O4NA 4B9MA 4CEFA 1HKBA 3E01A 1BQMA 3QEVA 3G4SN 3E9PA 2ATQA 1VQ6N 1HRHA 1IH7A 4H0VB 5JS2A 4NXNK 1GLDG 4O44A 2OPQA 1Q82O 1Q9YA 3D2EB 1J6ZA 3EE8A 5GINA 1RTHA 4JNEA 1T44A 5HRNA 1LCUA 4FK0A 3CD6N 3E1YA 1K8KB 2A3ZA 3QFUA 4JN4A 1NK0A 4OKJA 5DM6L 3I8BA 4OGCA 4YY3K 4RW4A 4BVPA 3DXKB 2QKKA 5I3UA 3K5OA 4DTSA 5KRTA 4FVUA 4FJKA 1B9FA 1YVNA 3MXJA 2I5JA 2HMIA 4NLBA 2VGNA 3WNGA 4B1VA 4BRCA 1NGJA 3R9PA 4BG8A 1RILA 3ENHA 4IG0A 1IJJA 3S3NA 4KHYA 3LAKA 1GOBA 4WQ5C 2Z1GA 3TAPA 1RFQA 5C25A 3NF6A 4E7LA 3CCEN 2OA8A 4RG8A 1LV5A 3X23A 3SCXA 2NNWA 4DTJA 3I33A 1IBKK 1ASUA 4ELUA 3HI0A 3P38A 1WLJA 1VQ5N 3KLEA 1FXXA 4EHTA 1LWCA 4YNQA 4BRMA 3QESA 4ZHRA 3ZSVA 3FZFA 3VGKA 4CIEA 1EO1A 2GV9A 2FBVA 3BZCA 3PSFA 5KQDA 3P31A 3THYA 4CHNA 4DSKA 3I8DA 4PKGA 5FROA 5DMRA 1JL2A 1NLVA 3DLKA 3LDQA 4OPAA 1NGDA 3KD1E 5FDLA 2VWKA 4DMNA 3TSPA 1YXQA 1RBVA 5FPMA 5IJMA 3ZETB 3SAGA 2E6LA 4NLCA 3QIPA 4WF9L 3CI5A 4BGAA 4FJ9A 1YF5L 1FJGK 3U8XA 1U45A 4M3RA 4I2PA 3OS2A 1QSLA 1A5VA 4JS5A 3U9DA 3TI0A 1V4SA 1YJNN 1Q9XA 1GLFO 3MEEA 1GLJO 4CJUA 2ASPA 3KLHA 3V9UA 2VWBA 5LMUK 4CGIA 1RDDA 4CZMA 1EX4A 3IAYA 1TAQA 2W40A 3LL3A 4CZIA 3I0SA 5BPLA 2YNHA 5GAHP 5J2PA 3MAQA 2GBZA 4J2EA 1UA0A 3OTOK 3AO4A 4IFYA 2VCPA 3ULEB 3U8ZA 3RRHA 1QSSA 4CJFA 4EP4A 3AVJA 4M7XA 3D0PA 2UXCK 3AVCA 3H46O 2P9LA 1TKXA 5AQHA 1JLFA 1NGIA 5FRMA 1BU6O 4Q0BA 5LY3A 1IKXA 4B1XB 4CJ4A 2KZZA 4BRPA 3ZEUB 4BRAA 1MU2A 2LSNA 4DKWA 4N76A 4GKKK 4AHRA 1TK8A 2CGJA 1RNHA 1YJWN 4DV1K 3TAGA 3HT3A 4MO4A 4E7JA 4FZXC 4HVJA 2XHBA 3NCIA 3ENOA 4J2AA 5LL6Z 3VPZA 1E5WA 3SMPA 3VF2A 1NKEA 3DLGA 2KTQA 4CW7B 4H0YB 1W7AA 4YHHK 1QTMA 4PUOA 2D0AA 4BWMA 5KPRA 1C1BA 5KTQA 3CM5A 3N4QA 4HDQA 4MFBA 1KVCA 3SV3A 3SUOA 3GBTA 2Q3SA 5ADXH 4GMJB 3L2QA 2GELA 3A8YA 3DLLL 1NGHA 2DFHA 3RR8A 2O8DA 3VQ4A 2HNZA 4X64K 3GDQA 3V1QA 1E4FT 3AVAA 1TGOA 1IV0A 4Y0WA 4CJLA 1JCGA 4DR6K 3ZSYA 1A5XA 3ZSWA 1SKRA 3EZ5A 1NK7A 1WSFA 4KHUA 1BIZA 1YVUA 3MCAB 1HNXK 2HHTA 1TYQB 4B9VA 2YI1A 1BI4B 1OVQA 3SI6A 4B8AB 2Q0RA 3EY1A 4AILC 4F2RA 1GOCA 1LAVA 4DG1A 3VQBA 3NHGA 2IOCA 4BR9A 4OPJA 1S1XA 4CEEA 1JLEA 4FJ8A 4E1MA 3VQDA 4CZKA 4PKIA 2Q97A 2YJEA 1WN7A 2D5RA 5E41A 5CY4A 2VG7A 1NGFA 3BDPA 1VSHA 3CCQN 2GX9A 2NRHA 5EOYA 4BDYA 1HUXA 3MN9A 4DR1K 1RTIA 4NCBA 1QHAA 5I42A 2OYQA 1J54A 1HNWK 1QQOA 1E3MA 1C0MA 1FKOA 4JLHA 4JYAK 1VQMN 3FFKB 4BDPA 4E1JA 3O9QA 1VBGA 1QQMA 4ILJA 3V81A 2KLAA 4F2SA 1NI2A 3K9JA 5C24A 1WAFA 1VAZA 5AZIA 4DFPA 2O8FA 5AQSA 3T69A 1GG3A 2HHVA 2KFNA 3CCJN 3OYNA 2QWQA 4CZFA 4B3OA 2D4WA 3CM6A 1MK9B 1W9HA 2CH5A 5AQLA 2AP1A 1TVRA 3VMFB 2ASMA 1JXBA 1H1VA 2ZQBA 3MN5A 4U7BA 1NJYA 1RT2A 4WQ5A 3TTDA 1XMOK 2Z1HA 4FWPA 3NH0A 1J53A 4FWQA 2WTUA 3FLVA 3UKUB 5FPDA 1ZYQA 2ZPYA 3QLHA 3Q7CA 3O3GA 3SQ0A 1NK4A 1D5AA 3OVNA 4N47A 1NMNA 2HHWA 4RW7A 4GY2B 4DU3A 3EL2A 4LF4K 3VQQA 4KHQA 3W3DA 4RW8A 2HE7A 3O9SA 1EP4A 4IXCA 1HLUA 2LBBA 2QTDA 4C1NI 3NDKA 5AQNA 4YOVA 5MLCQ 2Q1NA 2RE2A 4FLTA 3HOTA 1BOTO 3FP5A 4JKHA 3HSTB 1WUAA 3AY9A 4DR7K 3DWLA 5HOOA 4KREA 4IJAA 4IOXA 3CCSN 2OTLN 2BUPA 2YHYA 4BGBA 3LDSA 3VERA 1Q18A 4PKHA 3LP2A 3QICA 2D10A 4CFDA 2R7YA 4CF0A 5EXWA 2NLXA 3CQYA 1KFDA 3L2RA 2E1YA 2OZSA 3RSEB 3ZT0A 1Z05A 4ICLA 4CEAA 3SQ2A 1BUPA 3CCVN 3AARA 1NK9A 5C12A 4DR3K 4KHPK 5AQPA 4JV5K 4GVEA 4O8KA 4CJKA 4HUFA 5GAGP 4K42A 1Z26A 2DPNA 3R8EA 3OJUA 4FCYA 3DXKA 3T19A 2OANA 4Y1CA 3RMBA 4FLZA 3CJBA 4FWNA 4FW1A 2O8EB 4P7IA 2J0JA 3Q7BA 3RVCA 3FE1A 3ZT4A 4E7KA 1SS6A 3TAEA 4IG3A 1KAZA 3SUPA 3H3NO 4BVOA 1GLCG 3G9WA 3QBWA 4DV0K 3QEWA 3O9UA 1ITGA 1N5YA 4J2DA 3HZ6A 4DFMA 2HNYA 1NJIO 1VSFA 1DIKA 4GW6A 1R59O 5E84A 3CMAN 4DB3A 2Q31A 2B6AA 2QWMA 4FL9A 4IFEA 4DXAB 4FLUA 3OY9A 4Z94A 3CFPA 2Y1JA 1IG9A 1N32K 4DV6K 4KBOA 4B3RK 3O08A 3L8BA 3AVMA 1QSYA 4CERA 2FXUA 3WXIA 1VK0A 2GWJA 3MCPA 3PO5A 4TKNA 4CHQA 1QQCA 4H0TB 3H3OB 4HUGA 3ZSZA 1MK7B 3VQAA 1RBTA 3NH2A 3KK2A 1L3TA 1RDWX 3C94A 2O4GA 3WT0A 3PY8A 1KBLA 2AL6A 1C1AA 1MDUB 3ZX3A 2FBYA 3WQUA 3AO2A 4QS8A 5AQOA 3KJVA 1KC7A 4IDKA 2E20A 2WOMA 1C0UA 4NXMK 3VF6A 2QA4N 3CFOA 4JKGB 4O55A 3OHRA 3KHYA 3ZETA 2FBTA 5AJ3K 2UUBK 5J1EA 2J0MA 1NU0A 4DSJA 3K0SA 4CEOA 2I7NA 1QVFM 2ETJA 5ELZA 4EZ9A 2VQEK 1U04A 2G8VA 4H03B 3FZKA 2B4JA 3K5MA 4BACA 4HWIA 1KTQA 4DLEA 1J5EK 3QMLA 4BQLA 4G9ZA 3MMVA 2YVCA 2EWSA 5M1FA 2XRIA 4FK4A 4KTQA 4DV7K 3CIPA 4CGJA 3SAFA 1U49A 4BC2A 5BRFA 3SPZA 3M8SA 1HB8A 3OYKA 2FF3B 4KAZA 5GADP 4B1WB 1RDUA 3L0QA 3O1WA 4FLVA 3ULEA 4K0KK 4IWVA 2VWJA 2QEXN 1EQYA 2VQFK 4W5OA 3F9KA 3K57A 4PQUA 4W5QA 1P90A 4IEIA 4RW6A 2P9SB 4WE1A 2ITMA 4L3QA 3IDHA 1NTIA 3ZEUA 3HM9A 3DMJA 3MWPA 4PWDA 1RTDA 4DCHA 3VA3A 1WBDA 3L2VA 4BR0A 4NO7A 5KRSA 4Z4FA 2JWKA 3FZLA 3CCRN 5DK5A 3AAQA 3DRRA 4MQ3A 3RWUA 2YV0X 3DOKA 3NF9A 3TANA 1Q8IA 4ELTA 4BRGA 1BL3A 3DXMA 3WNFA 1REVA 1VSIA 3N4PA 4LY7A 3L6QA 4YOXA 1K9MO 2W41A 4DR5K 4KHWA 3L4QA 1BA0A 4MDAA 2WUSA 4FJLA 4NYFA 3NH1A 3JYTA 3CJ7A 1JJ2M 3E66A 5F0XA 4H0XB 3CJ1A 2RHKA 3SLCA 2GUPA 2HVHA 4DV4K 4JI0K 3ZSQA 5CYMA 1ST7A 1YAGA 1QZ5A 1TYQA 3SJJA 1KVBA 1BI4A 1W0HA 3VQEA 2F96A 4DQ8A 5JMVA 1HMVA 3SUNA 4HTUA 4LF6K 4ZRJA 3SUQA 3L2UA 3EPYA 3AAPA 5HRRA 2O8BB 4DS4A 4JKBA 1JDEA 3CQXA 1BG3A 4CE9A 4XH5A 3JSMA 4X62K 4JI7K 1IKYA 4KRFA 3CFRA 3TR8A 1L3UA 1NNEA 1S1UA 1N34K 1ACAA 4HHTA 1SL0A 3C6AA 1NGAA 2EX3A 2GTDA 3TAFA 3DAWA 3PUFA 2FDQA 5BR8K 3G25A 4YFUA 1RDCA 4KO0A 3SQ4A 1JCEA 4FXDA 4DV2K 1TK5A 3A5MC 1J5OA 4DTXA 3DLBA 4CF9A 2ASOA 4AF1A 4IFVA 4YOYA 4DQIA 3T1YK 1E4GT 2UUCK 4BE0A 3PO4A 4L8RB 3CC4N 2ZD1A 1ASWA 3S41A 4LSNA 4DV3K 1Z6RA 4OX9K 1XUPO 4H0PA 3VOVA 1WSJA 3P4IA 1HPMA 3ZT3A 5F1XA 1X1PA 2XO7A 1SKSA 5C15A 2IVPA 4JI2K 4B1ZA 4I9QA 3U7DA 3LZIA 3UKUA 4IDHA 3LWLA 1NOYA 4U67L 3WXJA 1JL1A 4W5RA 4OLAA 5AZJB 2KZMA 3VN5A 1EETA 3UKRB 1X9JA 2PYJA 3HP6A 1HNZK 4FJ5A 1I3AA 4LF7K 3KD5E 4DQPA 4BRDA 3QB0A 3R6MA 5BPMA 2P5GA 1YUWA 2V7YA 4CYEA 3NF7A 3TAQA 5T7BA 3R1XA 4CBUA 1S9GA 3DLEA 3AV9A 1KVAA 3OA9A 1NMDA 3V9SA 2FSJA 2HB5A 5EX5A 1XNRK 1F21A 4DFJA 1X9WA 3D2FB 4N56A 4DR2K 4GV3A 4KHNA 2QW9A 4J2BA 3VQ6A 3ASMA 3KKRA 1M90O 1S3XA 2IAJA 4H4MA 3VEVA 1QZ6A 4EHUA 3RMDA 3BINA 3QIOA 3RSEA 5CYQA 4HDOA 3F5TA 1MWKA 3NVMA 3P1GA 1U6ZA 1ZBFA 4CJEA 4CF1A 5BREA 3M5RA 2X6SA 4UY8O 2HW3A 2YX6A 4C1NK 3VQ9A 4LFAK 1UA1A 1JCFA 4M3TA 1VQ8N 1C0FA 1Q81O 3IUCA 2O8EA 3K59A 3K9KA 5M1PA 4I7FA 4DV5K 3AVGA 4C23A 5JLFA 4ISGA 4JK7A 3LPTA 4H5RA 5LJVA 3MECA 3CMEN 3TWHA 3VEXA 1IBMK 4BREA 5AQMA 5BRDA 1LW0A 4Q5VA 4X65K 1BIUA 3AVKA 3PSIA 3QO9A 2QWRA 4ZTJA 2YHWA 2G8FA 4BRHA 4PL8A 2KFZA 4FZZA 5KI6A 3CCLN 1TKZA 4FM2A 1ATRA 4RTFD 3THXB 3DXMB 1TV6A 1HPZA 4FPBA 3NGIA 4Z0UA 5HLFA 4C8NA 4HTLA 4IJNA 5JVLA 1ZBLA 1D8YA 3A5OC 4OPHA 3EZWA 2IVNA 4N5SA 1JLGA 4QS9A 1W2BM 3BF1A 3DI6A 5M1QA 4O0IA 3HVTA 3J7ZO 3IFRA 2ZM6K 4CIGA 5JLHA 1YTAA 4GNIA 4XIUA 5HP1A 3SAHA 4CJSA 1NKCA
chains in the Genus database with same CATH topology
3CCVN 3AARA 2A40A 2A5XA 5C12A 4BR4A 4RWTA 2ZJRL 5AQPA 3O6WA 4GVEA 4M7YA 3VF4A 2RQ1A 4GXBA 3WA0A 4JKGA 4O8KA 2R82A 3O5BA 4JKAA 4O5FA 3PZDA 5AZIB 4FOIA 1KAXA 4O8UA 1VQLN 2FLOA 5AQVA 5GAGP 3G6EN 4K42A 4A57A 1NM1A 3WXMB 5AQRA 2DPNA 2EMSA 3ZX2A 1VQ9N 1V4TA 3R8EA 1T6CA 5C0YA 2ZGYA 2F7TA 2COPA 3DXKA 4H5NA 1KC8O 2QI2A 4BRQA 2OANA 3C0BA 3O9TA 4BROA 3U9ZA 2IIRA 3O8MA 4BC5A 1O13A 3CJBA 4IO8A 4FWNA 3WEEB 4JHDB 2V51B 4P7IA 2J0JA 2PAVA 3DJCA 3Q7BA 4FWMA 3RVCA 1G99A 1MA9B 2PBDA 3FE1A 3H1VX 1SS6A 4WQ4C 1KAZA 2HF4A 4BY9C 2FSNA 1C0GA 3VTIA 3H3NO 4BVOA 1GLCG 1RGIA 3G9WA 1S22A 2QWLA 3QBWA 3O9UA 2NRZA 2NRRA 3HZ6A 5AFUH 5AQUA 1NJIO 4WYBA 1DIKA 2E8AA 1HKCA 1R59O 5CE3A 5E84A 5AQYA 5M1NA 3MN6A 5AQQA 3B8AX 1X3MA 4DB3A 3EN9A 3CMAN 3PIOL 4BRLA 2Q31A 3KK7A 3O80A 5TKWA 5GIPA 1S72N 2D0OA 1W97L 1EF1A 2P9NB 3ATVA 5H1SQ 2GEMA 2KHOA 3CCUN 2D2QA 2QWMA 1Y19B 4CD3A 1Y64A 5FPNA 3M1FA 4FL9A 3SMSA 4IFEA 4DXAB 4Z94A 2FSKA 2QWPA 3JXUA 5AQJA 1YJ9N 1NGBA 1HBKA 4KBOA 1MIXA 3O08A 2P9PB 4K41A 4JKEA 2E1ZA 3TSUA 4CZJA 4F7GA 2A42A 4M63C 1NGEA 5M1OA 2I7PA 2DIKA 4NY0A 1BDGA 2FXUA 1GGOA 1IG8A 2NRXA 2P9SA 4JAXA 2GWJA 3TU5A 3MCPA 2WFBA 3BP8A 3FR0A 4MLHA 4TKNA 2P9IA 3TTFA 3CXCM 3ID6A 1HKBA 4H0TB 3H3OB 1MK7B 2HBJA 3E9PA 3IMXA 3WXIA 4WFAL 3G4SN 1VQ6N 4CZEA 4NB4A 3J8AA 1RDWX 4H0VB 3WT0A 4AM7A 1GLDG 1KBLA 3AU4A 3LDNA 3MK6A 2AL6A 1MDUB 4I6MA 5GAEP 3ZX3A 1Q82O 1VQ7N 3D2EB 3TSQA 5CHIA 1ILYA 3WQUA 4EIAA 1J6ZA 3GE1A 4QS7A 2H3GX 4QS8A 3EE8A 5AQOA 3WQTA 5C2DA 1KC7A 5GINA 4FWRA 2E20A 3LDPA 4JNEA 1T44A 3VF6A 2QA4N 4JKGB 1LCUA 4B9QA 3OHRA 3CD6N 3P39A 4A5BA 3E1YA 2V7ZA 3KHYA 4ISEA 3HOSA 5AFUA 4YOUA 3ZETA 4YOWA 1K8KB 2A3ZA 2WC9A 3QFUA 4JN4A 1SQKA 3KWIA 5DM6L 5HL7L 3I8BA 3EO3A 2J0MA 1OVYA 4BVPA 2I7NA 2KKZA 3DXKB 1QVFM 4YOTA 4RCHA 5ELZA 2ZGZA 4H03B 4FVUA 1YVNA 2QXLA 3FZKA 3E9OA 3HBTA 4HWIA 4NLBA 2VGNA 4B1VA 2I1JA 1NGJA 3GOIA 3QMLA 3R9PA 4BG8A 4BRCA 3ENHA 4KH5A 1IJJA 4BQLA 4G9ZA 3MMVA 2YVCA 2EWSA 5M1FA 4FSVA 1YIJN 3LDLA 5FPEA 1ZXOA 4CZGA 1ESVA 2P9KA 3CIPA 4JD2B 3SAFA 4BC2A 5BRFA 2BTFA 4WQ5C 4JEPA 1RFQA 1HB8A 2WBNA 3C6HA 4EAHD 3WXLA 5C10A 3CCEN 2FF3B 3H1QA 4DHYA 2PFUA 1ZC6A 3A5NC 5GADP 4ILGB 4B1WB 3X23A 1RDUA 3JS6A 3L0QA 3M3ZA 3O1WA 3OBWA 4WQ4A 3ULEA 2NNWA 4IWVA 2QEXN 2E2NA 4YDUA 2WH5A 1EQYA 3FLCO 3I33A 3IVFA 4H5VA 1VQ4N 1KXPA 3HI0A 1P90A 2OTJN 1KAYA 1XQSC 1DGKN 3P38A 4IEIA 1VQ5N 2P9SB 5AQKA 5AQZA 4FWOA 4EHTA 2ITMA 2ZF5O 4L3QA 1NGCA 3IDHA 2YHXA 1NTIA 4BRMA 4K25A 3SBTA 4K43A 3UB5A 1YHQN 1D4XA 3ZEUA 2P9IB 3FZFA 3MWPA 3VEOA 1LOTB 3VGKA 1EO1A 4FWKA 5KQDA 1GLLO 4DCHA 3P31A 1ATSA 3NVKA 1KD1O 4BR0A 3KWGA 5AQIA 4NO7A 3MX5A 3EKSA 5F2RA 4PL7A 4PKGA 2JWKA 3FZLA 1KQSM 3CCRN 4IOAL 1NBWA 4IO9L 4FOEA 1NLVA 5KQ8A 2Q0UA 3AAQA 3LDQA 4OPAA 3WUHA 1NGDA 5LJWA 4R79A 5CR4A 4BRGA 3DXMA 4BRIA 2QWOA 5AQFA 2BH1A 1U2VA 2F9TA 5AQGA 3TSPA 3N4PA 1YXQA 5FPMA 5IJMA 5JVHL 3L6QA 4YOXA 3W0LA 3ZETB 3SAGA 1Q86O 3I56N 4XH1A 4NLCA 4WF9L 3CI5A 5EVZA 2W41A 1DEJA 4BGAA 3ZDTA 1K9MO 1YF5L 1BA0A 3GG4A 1NWKA 3L4QA 3U8XA 4MDAA 3U9DA 1K8AO 1V4SA 2V52B 3KVGA 1YJNN 1GLFO 1NVLA 4XEIA 2WUSA 4IZ9A 1GLJO 2A41A 2ASPA 2X0SA 4BQZA 1DT9A 3CJ7A 4EFHA 1JJ2M 2CH6A 4H0OA 2ZJQL 3VGMA 3E66A 2VWBA 4JKDA 5F0XA 4H0XB 4BC4A 3CJ1A 4CZMA 3I55N 2EMTA 3ZYYX 3QIJA 2RHKA 1Q7YO 3SLCA 3F9MA 2GUPA 5AZJA 2CQUA 2W40A 3H45C 3LL3A 1ST7A 1YAGA 1BA1A 2J0KA 4CZIA 1M1KO 2P9KB 5BPLA 5GAHP 1QZ5A 1TYQA 2HSTA 1J19A 3UKRA 4FO0A 2CB8A 4B1UB 2VYPA 4H5WA 4DQ8A 5JMVA 1P8ZA 4A62A 4CZHA 4ZRJA 5M1KA 3EPYA 2UYTA 3AAPA 2VCPA 3ULEB 3U8ZA 2QM1A 4JKBA 1JDEA 3CQXA 4M7XA 1BG3A 3AU5A 3FZHA 4XH5A 2GWKA 3H46O 1DKGD 2P9LA 2HBKA 5AQHA 3H6EA 4JHDA 3FGUA 4WFBL 1CZAN 1NGIA 2AEHA 2D1KA 3C7NA 5GIOA 1BU6O 1ACAA 1H4RA 5LY3A 3PIPL 4B1XB 3C6AA 4BRPA 3ZEUB 4BRAA 1NGAA 4JK8A 2HRJA 4DKWA 2GTDA 3D2FA 3DAWA 3WXKA 2FDQA 3OBYA 2CGJA 3G25A 1SAZA 1HB6A 1YJWN 4ILHA 3OW2M 4BG9A 4MO4A 3TPQA 2IVOA 4CBWA 1JCEA 3EE9A 2NRWA 3ATUA 3M6GA 3D6RA 2CGLA 4BRFA 3O9RA 3ENOA 4CJ7A 3A5MC 3CETA 3BUZB 3VPZA 2J4RA 1E5WA 3SMPA 2ASOA 1BWFO 3VF2A 4AF1A 2NZTA 3VGLA 2FJ9A 4H0YB 4YOYA 1E4GT 3VEYA 5KPRA 3FZMA 3VTHA 5B8HA 3N4QA 3CC4N 4HDQA 1X3NA 3S41A 3T7ZA 4FWLA 2HBMA 4JKFA 3MWTA 1Z6RA 3GBTA 1XUPO 3HM8A 1GLBG 4H0PA 3VOVA 4BRKA 5ADXH 1GC7A 1HPMA 3P4IA 5F1XA 1N8RO 2AA4A 3MX2A 2GELA 3A8YA 4CD1A 3DLLL 1NGHA 4B1YB 5C15A 1GC6A 4A2BA 5BN8A 2IVPA 3SJHA 3C65A 5EY4A 5JICA 4B1ZA 2HF3A 3U7DA 1HJOA 3GDQA 1E4FT 3BF3A 4J8FA 3UKUA 4IDHA 4Y0WA 3NMUA 1JCGA 3D2EA 4U67L 1HKGA 4JK9A 1MWMA 3WXJA 1YITN 5AZJB 1VQPN 4GV9A 1ATNA 3ZX0A 1OKJA 2FF6A 3PLAA 1GLAG 2QWNA 3MCAB 2P9UA 1TYQB 2YI1A 3MDQA 2HOEA 3UKRB 1X9JA 4KH4A 2Q0RA 4I6MB 1K8KA 3CHWA 4A2AA 1VBHA 4BR7A 3HSCA 4XH4A 4BRDA 3LM2A 3QB0A 3CPEA 3MN7A 3R6MA 4AM6A 4BR9A 5BPMA 5BPNA 5KPZA 4YL8A 1YUWA 2V7YA 4H5TA 4CYEA 2P9LB 2E2QA 5TKYA 1WOQA 3R1XA 4MO5A 4CBUA 4CZKA 4PKIA 2E2OA 3E9LA 2Q97A 2YJEA 3GL1A 2ZJPL 2YCHA 1NGFA 4F9OA 2JWLA 3ID8A 3C7NB 3AGKA 3OA9A 5C2FA 1NMDA 4YDUC 1ZBSA 3CCQN 2GX9A 2FSJA 2ZWHA 2NRHA 5EX5A 4A5AA 4IOCL 4BRNA 5EOYA 5AR0A 3VESA 3D2FB 4GV3A 2I1KA 1HUXA 2QW9A 3MN9A 1T6DA 3L4IA 5AQWA 2F9WA 3HTVA 5ADXA 2NRTA 4JD2A 1S3XA 1M90O 4ZRKA 1QHAA 5BN9A 3VEVA 1QZ6A 4EHUA 1QQOA 3BINA 5BR9A 3RSEA 1VQMN 3FFKB 3LDOA 4HDOA 4E1JA 3F5TA 3O9QA 1VBGA 1QQMA 4ISFA 4ILJA 1MWKA 3NVMA 1U6ZA 3QDKA 2YJFA 2KLAA 3CJ9A 4A61A 1NI2A 4WFNL 3K9JA 2VGMA 5AZIA 1VAZA 1YI2N 5AQSA 3T69A 5BREA 1VQON 1GG3A 4CBXA 1K73O 3M5RA 3CCJN 4UY8O 2QWQA 4CZFA 3A0IX 2YX6A 2D4WA 3A5LC 4C1NK 4BR5A 1MK9B 1JCFA 2CH5A 5AQLA 2D11A 2AP1A 3VMFB 2ASMA 1VQ8N 2E88A 1H1VA 3SK3A 1C0FA 3EKUA 3WEEA 5KPTA 5AQXA 4A59A 3IUCA 1Q81O 4EKUA 3R3LA 4YORA 3MN5A 3K9KA 3UE5A 5M1PA 4U7BA 4WQ5A 3TTDA 4C23A 3QFPA 4FWPA 5JLFA 4FWQA 4ISGA 3FLVA 1T3VA 4FPAA 5E26A 3UKUB 3CC7N 4JK7A 3KZBA 4H5RA 5LJVA 3CERA 5FPDA 3CMEN 4KH6A 1QQNA 2ZPYA 3IKMA 3VEXA 4GV6A 4BREA 3Q7CA 5AQMA 4JKCA 3VENA 3AGRA 3ENBA 5BRDA 1HX1A 2P9UB 3U4LA 4OO1J 1SZ2A 2CGKA 3SBGA 4FWSA 1QVGM 1XC3A 2P9NA 3CJAA 4GY2B 2Q36A 5JVGL 2QWRA 3EL2A 2YHWA 4BRHA 3PVLA 4PL8A 3W3DA 1VQNN 2NRVA 2HE7A 3O9SA 3CCLN 4IXCA 3VEZA 1ATRA 1HLUA 2LBBA 2QTDA 3HRGA 4RTFD 3CJCA 3DXMB 3LM9A 4BC3A 4C1NI 2P9PA 5AQNA 4YOVA 5MLCQ 2Q1NA 1U2VB 2E2PA 4ZRIA 2RE2A 3G71N 1BO5O 5AQTA 4MLEA 4FPBA 1BOTO 3FP5A 4JKHA 4BR2A 4CZLA 1WUAA 3HOTA 1VQKN 4MDBA 2HBLA 3AY9A 3DWLA 5HOOA 4HTLA 4IJNA 4IJAA 4LC9B 3O4WA 4IOXA 5DM7L 3CCSN 4WCEL 5JVLA 2OTLN 1TUYA 2BUPA 2YHYA 4BGBA 1MIZB 3A5OC 4OPHA 1Q18A 3EZWA 3VERA 3VETA 4PKHA 3CCMN 4CI6A 3CC2N 2IVNA 5BRHA 1ISNA 1NGGA 2Q2RA 4QS9A 1W2BM 3CF5L 3BF1A 3QICA 2D10A 3F2KA 1GLEG 4IEEA 3TTCA 5M1QA 4PHTX 1SGHA 5EXWA 2NLXA 3CQYA 3J7ZO 3BEXA 2E1YA 3IFRA 3O1BA 3VEWA 3RSEB 2D0PA 1TUUA 2A6AA 1Z05A 2HMPA 2ABDA 3D7EO 4GNIA 3QBXA 5I9EB 5JLHA 3SAHA 3CPWM 1BUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK8 A;  4JK7 A;  4ILG B;  4JKH A;  4JKF A;  4JKE A;  3E9O A;  4JKG A;  4JKC A;  4ILH A;  4JKA A;  3ENB A;  4JKB A;  4JKG B;  3SBG A;  3E66 A;  4JKD A;  3SBT A;  3E9P A;  4ILJ A;  3E9L A;  4JK9 A; 
#chains in the Genus database with same CATH topology
 2A40 A;  2A5X A;  2ZJR L;  4M7Y A;  4FJX A;  3WA0 A;  4JKG A;  2R82 A;  2FC0 A;  1KAX A;  4FOI A;  1VQL N;  2KQ2 A;  5AQV A;  4A57 A;  1NM1 A;  4DLG A;  1C0T A;  5C0Y A;  4F4K A;  2ZGY A;  4H5N A;  3LWM A;  4BRO A;  1CLQ A;  3U9Z A;  4QCL A;  2IIR A;  4F8R A;  4BC5 A;  2PZS A;  3VQ7 A;  3WEE B;  3J7A P;  2V51 B;  2A1R A;  4FWM A;  4AHU A;  2HF4 A;  4RW9 A;  1C0G A;  1FW6 A;  3IG1 A;  3KK1 A;  2NRR A;  1HNI A;  2E8A A;  1HKC A;  5AQY A;  4DF4 A;  1EKE A;  2UXD K;  5GIP A;  5TKW A;  4EP5 A;  1S72 N;  2D0O A;  1W97 L;  3ATV A;  2P9N B;  3HXM A;  5H1S Q;  2GEM A;  2KHO A;  1TL1 A;  1RT7 A;  5FPN A;  2FSK A;  5AQJ A;  1YJ9 N;  4E7H A;  1HBK A;  1HYV A;  3SV4 A;  4DTO A;  2BDP A;  2E1Z A;  4CZJ A;  1NG9 A;  1KFS A;  1NGE A;  2I7P A;  3RTV A;  2P9S A;  1GGO A;  1KSP A;  1QHT A;  4JAX A;  4OLB A;  4E0D A;  2IDO A;  2WFB A;  3FR0 A;  3TTF A;  4DR4 K;  1S6P A;  2HBJ A;  2E5L K;  4WFA L;  3BY5 A;  2JLE A;  3LP0 A;  4CZE A;  4NB4 A;  1L5U A;  3J8A A;  4AM7 A;  3ITH A;  3AU4 A;  3LDN A;  3MK6 A;  4I6M A;  2G8U A;  4FYD A;  4G1Q A;  3TSQ A;  5CHI A;  3THW B;  4EIA A;  4QS7 A;  3GE1 A;  4E7I A;  2H3G X;  4DTM A;  2YHB A;  4CEQ A;  3A2F A;  3ULD A;  3S3O A;  1L3V A;  4B9Q A;  4B3M K;  3HYF A;  3P39 A;  4BDZ A;  3HOS A;  3ISN C;  5SZT A;  2WC9 A;  1SQK A;  3KWI A;  1WAJ A;  4CGH A;  1IKV A;  4M42 A;  2KKZ A;  2P5O A;  4RCH A;  2ZGZ A;  4F3O A;  3E9O A;  3HBT A;  1S5J A;  1WSG A;  3GOI A;  4CJQ A;  4KH5 A;  4FSV A;  1YIJ N;  4AHC A;  3FFI A;  3LDL A;  5FPE A;  1ZXO A;  3H08 A;  2BTF A;  5CZ1 A;  4DSE A;  2WBN A;  3C6H A;  3WXL A;  2RPI A;  3L2W A;  1C6V A;  2PFU A;  3A5N C;  4FJM A;  1KRP A;  4ILG B;  3OBW A;  4YOW A;  3SPY A;  3M3Z A;  4WQ4 A;  3OS1 A;  2O8B A;  4W5N A;  2E2N A;  2WH5 A;  1EXQ A;  3IVF A;  1DTQ A;  4H5V A;  1SUQ A;  4O5B A;  1VQ4 N;  3HPO A;  1KAY A;  1XQS C;  4ELV A;  4B9N A;  4EZ6 A;  3S3M A;  5AQK A;  1TKD A;  5AQZ A;  4FWO A;  4E3S A;  1HQU A;  1NGC A;  2YHX A;  1XHZ A;  3SBT A;  3UB5 A;  2DTU A;  4NYN A;  1YHQ N;  1RCH A;  1D4X A;  3QET A;  3LZJ A;  4LH4 A;  2ITG A;  2P9I B;  3VEO A;  4CHY A;  1DLO A;  1LOT B;  1SL1 A;  3NVK A;  1KD1 O;  5AQI A;  3SQ1 A;  3HP9 A;  3DRS A;  4PL7 A;  1TKT A;  4CJ3 A;  3BGR A;  1KQS M;  3AO1 A;  4IOA L;  4FOE A;  4V19 S;  5KQ8 A;  1ZBI A;  1RTJ A;  1NKB A;  4DQS A;  5LJW A;  4O4G A;  4R79 A;  5CR4 A;  1T7P A;  1L3S A;  4AHS A;  1I94 K;  1XC9 A;  1JLC A;  4DUZ K;  2G8I A;  4BRI A;  2QWO A;  2BH1 A;  1U2V A;  3TAB A;  3MXI A;  2VG5 A;  3V9X A;  5JVH L;  3W0L A;  3QNN A;  4FK2 A;  5EVZ A;  1DEJ A;  2YNG A;  3GG4 A;  2OPR A;  1FK9 A;  1BCO A;  3EEQ A;  2V52 B;  1NVL A;  4XEI A;  1X9S A;  4BQZ A;  1RBS A;  4EFH A;  3V6D A;  2CH6 A;  2ZJQ L;  4JKD A;  4DTR A;  3QEI A;  3KTQ A;  4KPY A;  3F9M A;  5AZJ A;  2CQU A;  3T1H K;  4QAG A;  1NJX A;  3H45 C;  1BA1 A;  1WSH A;  2P9K B;  4CK1 A;  2HST A;  3UKR A;  4FO0 A;  1B9D A;  2D0C A;  1NJW A;  2CB8 A;  4B1U B;  2XY8 A;  2VYP A;  4H5W A;  4A62 A;  3F73 A;  3THV A;  2QM1 A;  1J9A A;  2IS3 A;  3HK2 A;  3AU5 A;  2GWK A;  2QXF A;  1HR0 K;  3H6E A;  3V9W A;  3DLR A;  3FGU A;  2AEH A;  1O1W A;  2OZM A;  1IO2 A;  3LAN A;  1H4R A;  4PY5 A;  3PIP L;  4BE1 A;  3PV8 A;  3OYG A;  4KV8 A;  3D2F A;  4O0J A;  3NGZ A;  4DTN A;  5HBM A;  3HJF A;  1HB6 A;  4DU1 A;  4ILH A;  4CEC A;  3OW2 M;  4LH5 A;  3QEP A;  3MEG A;  5C42 A;  3TPQ A;  1WBB A;  2IVO A;  4CBW A;  3HL8 A;  3RRG A;  2CGL A;  4B3S K;  2KW4 A;  4BRF A;  4ZTF A;  3CET A;  3BUZ B;  5FLX O;  1QE1 A;  2J4R A;  3VQP A;  1BWF O;  1G15 A;  4CFB A;  4KI4 A;  3FZM A;  3VTH A;  5B8H A;  2BAN A;  1X3N A;  2P1J A;  4NCG A;  4FWL A;  2HBM A;  3MWT A;  1T03 A;  3D45 A;  4Z4G A;  2HHQ A;  3HM8 A;  2DFF A;  4NCA A;  3MX2 A;  2W6L A;  1GC6 A;  5BN8 A;  2HF3 A;  1QS4 A;  4FJH A;  2HHU A;  1HJO A;  1KLN A;  2F8T A;  3U3Y A;  4M3W A;  3SNN A;  3NMU A;  4X66 K;  1MWM A;  1YIT N;  4DFK A;  3DLH A;  3ZX0 A;  1OKJ A;  2FF6 A;  4R5P A;  2PYL A;  4B9U A;  3KLF A;  2HOE A;  4I6M B;  3CHW A;  4DTU A;  3UIQ A;  4Y1D A;  3LP1 A;  1SL2 A;  3HSC A;  3LM2 A;  5BPN A;  5KPZ A;  3THX A;  4YL8 A;  4JRQ A;  4H5T A;  4OJR A;  4CF2 A;  2E2Q A;  1IKW A;  1WOQ A;  4MO5 A;  2ZJP L;  2E2O A;  3GL1 A;  4B08 A;  3ID8 A;  1HJR A;  3C7N B;  3J80 O;  4YDU C;  1ZBS A;  4AH9 A;  4A5A A;  4IOC L;  5AR0 A;  5HRP A;  3I0R A;  3VES A;  1T8E A;  1OH7 A;  1T6D A;  2F9W A;  3HTV A;  3O3F A;  4JD2 A;  4ID1 A;  5BN9 A;  3ZSR A;  5BR9 A;  4C8O A;  3HPH A;  2W6K A;  3WNH A;  3LDO A;  2YNI A;  4F3T A;  4ISF A;  1WSI A;  3QDK A;  4LF8 K;  3DM2 A;  2YJF A;  3CJ9 A;  4A61 A;  4WFN L;  3CQ8 A;  4CGD A;  4CBX A;  1K73 O;  1FKP A;  1Z25 A;  2XY7 A;  3M8Q A;  4UQG A;  1VSK A;  1HYS A;  3ZSO A;  4BR5 A;  1U48 A;  3VQC A;  3CG7 A;  4FJN A;  4KTW A;  3WEE A;  1D9D A;  2Z1I A;  3R3L A;  1EWQ A;  4QOZ B;  3QNO A;  3QFP A;  1VSJ A;  3T3F A;  3CC7 N;  1T3V A;  4FPA A;  3J81 O;  3CER A;  3B6P A;  1LAW A;  4KH6 A;  4DS5 A;  1UAX A;  4JKC A;  3AGR A;  3ENB A;  2IC3 A;  1HX1 A;  2P9U B;  2E4L A;  3U4L A;  3SBG A;  1QVG M;  2P9N A;  4B9T A;  3AO5 A;  4ID5 A;  1I39 A;  4JI1 K;  2NRV A;  2RN2 A;  2HHS A;  3LPU A;  3AA5 X;  1LW2 A;  3J7Y P;  3CJC A;  4E19 A;  2O4I A;  1U2V B;  4ZRI A;  1ASV A;  1JKH A;  1BO5 O;  5AQT A;  4MLE A;  1VQK N;  3OYM A;  4B3T K;  2HBL A;  4KKO A;  3O4W A;  5DM7 L;  3V4I A;  1TUY A;  3SYZ A;  1MIZ B;  3CC2 N;  3CCM N;  3VET A;  3V1O A;  5BRH A;  1ISN A;  2Q2R A;  4DU4 A;  3CF5 L;  1GLE G;  4IEE A;  3TTC A;  4PHT X;  3NAE A;  3BEX A;  4I2Q A;  3O1B A;  2O8C B;  1TUU A;  1UOC A;  2A6A A;  2IGI A;  2ABD A;  3D7E O;  5J2M A;  3THW A;  1Y97 A;  4JI3 K;  2F8S A;  1IBL K;  2QKB A;  5EU7 A;  1BIS A;  4BG9 A;  4GXB A;  4WYB A;  3O3H A;  4O5F A;  4JKA A;  4FJG A;  4Z4I A;  1RT6 A;  2FLO A;  3B6O A;  5AQR A;  1UWB A;  2EMS A;  3ZX2 A;  1VQ9 N;  5D3G A;  5SWM A;  2P51 A;  1GOA A;  3ZLJ A;  3KKS A;  2F7T A;  2COP A;  4FLX A;  4BRQ A;  3C0B A;  3K2P A;  2DY4 A;  3O8M A;  1O13 A;  1JLQ A;  2PAV A;  3DJC A;  2VG6 A;  1MA9 B;  2PBD A;  3H1V X;  4FVM A;  4WQ4 C;  2G8K A;  4BY9 C;  4JI5 K;  1XHX A;  2Z1J A;  1RGI A;  4BWJ A;  2QWL A;  2NRZ A;  4H8K A;  1S1T A;  1TK0 A;  5M1N A;  3B8A X;  1SKW A;  4BRL A;  2D0B A;  3KK7 A;  3O80 A;  4IKF A;  2HVI A;  1VHX A;  1EF1 A;  3AVF A;  3MED A;  3RR7 A;  3JXU A;  4PA1 A;  2B5J A;  4OKE A;  1N33 K;  2P9P B;  3TSU A;  1LWF A;  4FM0 A;  4CFC A;  5M1O A;  2NRX A;  2DIK A;  4NY0 A;  3P83 D;  3LAL A;  1CZ9 A;  4JI6 K;  3WNE A;  1EWR A;  3BP8 A;  4E89 A;  1VSL A;  4MLH A;  1HYZ A;  2P9I A;  3CXC M;  3ID6 A;  4TSX A;  3VQ5 A;  4M45 A;  3IMX A;  2X78 A;  4CJ5 A;  3NF8 A;  4CFA A;  4GVM A;  1RT5 A;  4KB0 A;  5GAE P;  2RF2 A;  1N36 K;  4CJP A;  4DSF A;  1VQ7 N;  1ILY A;  1S6Q A;  4CHP A;  2DFE A;  3WQT A;  1CZB A;  5C2D A;  3OYJ A;  4FWR A;  3LDP A;  3OYF A;  4DTP A;  4A5B A;  1BCM A;  1DTT A;  2V7Z A;  4ISE A;  5AFU A;  4CJR A;  4YOU A;  3TAM A;  5HL7 L;  4FJJ A;  3EO3 A;  1OVY A;  2QK9 A;  3OYD A;  4YOT A;  1RBR A;  4I9L A;  2QXL A;  1T05 A;  3C95 A;  2I1J A;  1HQE A;  1U47 A;  2XY5 A;  3HPG A;  1XI1 A;  1S9E A;  4CZG A;  1ESV A;  2P9K A;  4CJV A;  4JD2 B;  4JI8 K;  4LF5 K;  4JEP A;  1S1W A;  5C10 A;  4EAH D;  2YHA A;  4DHY A;  3H1Q A;  1OH8 A;  4B9S A;  3OYI A;  1ZC6 A;  3JS6 A;  4YDU A;  3FLC O;  4KI6 A;  5KGX A;  1KXP A;  4HCC A;  2X74 A;  2OTJ N;  1DGK N;  4M3Y A;  3PX4 A;  1NOZ A;  2ZF5 O;  4CF8 A;  3OYL A;  4BE2 A;  3RMA A;  4K25 A;  4K43 A;  3ZSX A;  3S9H A;  4LFB K;  3QIN A;  4FWK A;  4CJW A;  4KB1 A;  3AVH A;  1GLL O;  2OPP A;  3AO3 A;  1ATS A;  3KWG A;  4HCB A;  3KLG A;  4M3X A;  3MX5 A;  3EKS A;  2RKI A;  5F2R A;  2NUB A;  1NBW A;  4IO9 L;  1KCF A;  2Q0U A;  1R0A A;  3WUH A;  4JRP A;  2BE2 A;  5AQF A;  2F9T A;  5AQG A;  3NE6 A;  2FBX A;  1Q86 O;  4CK3 A;  3I56 N;  4XH1 A;  2HND A;  3OS0 A;  1OH6 A;  3QEX A;  3OYE A;  3ZDT A;  1NWK A;  1ZBH A;  1K8A O;  4CVN E;  4LF9 K;  3KVG A;  2F4V K;  3O4Q A;  4IZ9 A;  2A41 A;  2X0S A;  4HUE A;  1DT9 A;  4H0O A;  3VGM A;  3ALY A;  3V9Z A;  2WON A;  4BC4 A;  3BZK A;  3I55 N;  2EMT A;  3ZYY X;  3QIJ A;  3AVN A;  3DOL A;  1Q7Y O;  1M1K O;  2J0K A;  4JI4 K;  1ZBU A;  1J19 A;  3OYB A;  3NBP A;  1BGX T;  1P8Z A;  1NK6 A;  4CZH A;  5M1K A;  4K8X A;  1NK8 A;  2UYT A;  4Z4H A;  3PX0 A;  3LAM A;  3FZH A;  1YTU A;  1DKG D;  2HBK A;  4C8L A;  4B9L A;  4IBN A;  4JHD A;  4OPK A;  4WFB L;  1CZA N;  2D1K A;  3C7N A;  5GIO A;  4CGG A;  1OH5 A;  5A2Q O;  4JK8 A;  2HRJ A;  3U3G A;  3WXK A;  1N6Q A;  3OBY A;  3THY B;  5HRS A;  1U4B A;  1SAZ A;  5J2Q A;  1B92 A;  1RT1 A;  1CXU A;  3EE9 A;  3M6G A;  2NRW A;  3ATU A;  2G8H A;  3D6R A;  4CGF A;  3O9R A;  4CJ7 A;  5K14 A;  2BGG A;  1HNV A;  1K6Y A;  1NK5 A;  5LMN K;  1VSD A;  2NZT A;  3VGL A;  2FJ9 A;  2W42 A;  3AVI A;  4KHS A;  3VEY A;  3MXM A;  4FJ7 A;  4M3U A;  3L3V A;  3T7Z A;  4JKF A;  1GLB G;  4BRK A;  1GC7 A;  1N8R O;  2AA4 A;  3M8P A;  4CCH A;  4CD1 A;  4CJT A;  4B1Y B;  3C6U A;  4A2B A;  3TAR A;  5JS1 A;  3SJH A;  3C65 A;  5EY4 A;  5JIC A;  5HRO A;  2HHH K;  4OVL A;  3BF3 A;  4J8F A;  1WSE A;  3D2E A;  1HKG A;  4JK9 A;  2GUI A;  4KTZ A;  2X6N A;  2EHG A;  1S1V A;  4GV9 A;  1C1C A;  1ATN A;  2UU9 K;  3PLA A;  3QER A;  2HHX A;  1GLA G;  1VSM A;  2QWN A;  2PY5 A;  2P9U A;  3MDQ A;  4GKJ K;  4KH4 A;  1YT3 A;  1K8K A;  1XWL A;  3G0Z A;  1VBH A;  4A2A A;  4DSI A;  4AHT A;  1JXE A;  2UXB K;  4BR7 A;  4LSL A;  3L3U A;  4XH4 A;  3CPE A;  3MN7 A;  4AM6 A;  3OJS A;  4C8K A;  1XNQ K;  1X9M A;  4FLW A;  2P9L B;  5TKY A;  3AA2 A;  3JAM O;  3SZ2 A;  3E9L A;  2YCH A;  4F9O A;  2JWL A;  3LP3 A;  3AGK A;  5C2F A;  2ZWH A;  4CK2 A;  5IWA K;  2JGU A;  4BRN A;  1XMQ K;  3RMC A;  2I1K A;  3KIO A;  2A1S A;  3L4I A;  5AQW A;  4CEB A;  5ADX A;  2NRT A;  4ZRK A;  1VRU A;  3NFA A;  3AVB A;  4M3Z A;  4DQQ A;  2O8C A;  3KLI A;  3T1A A;  2VGM A;  1YI2 N;  3AA4 A;  1VQO N;  1BHL A;  3AA3 A;  3A0I X;  3G10 A;  5IT9 O;  3A5L C;  4K8Z A;  1RDA A;  4CEZ A;  2D11 A;  4OGE A;  4FJI A;  2E88 A;  3SK3 A;  3EKU A;  5KPT A;  4CED A;  5AQX A;  4A59 A;  4EKU A;  4YOR A;  2O8D B;  1JLB A;  1KLM A;  3UE5 A;  1JLA A;  1RT3 A;  4N41 A;  1TL3 A;  1D9F A;  5E26 A;  3KZB A;  3K5L A;  4DF8 A;  1QQN A;  3IKM A;  4GV6 A;  1TAU A;  3VEN A;  4AQY K;  4KFB A;  1RT4 A;  4OO1 J;  1SZ2 A;  2CGK A;  2YKM A;  3CYM A;  4FWS A;  3OYC A;  1XC3 A;  3CJA A;  2Q36 A;  5JVG L;  5FRN A;  3IS9 A;  2YKN A;  3PVL A;  2OCE A;  2G8W A;  1VQN N;  4M41 A;  3VEZ A;  3HRG A;  3K5N A;  5CZ2 A;  4BC3 A;  3LM9 A;  2P9P A;  3AVL A;  1BQN A;  3G71 N;  2E2P A;  3U6F A;  4DQR A;  3VQ8 A;  4BR2 A;  4CZL A;  3IRX A;  4FM1 A;  4MDB A;  2YNF A;  2Y1I A;  1A5W A;  4LC9 B;  1LWE A;  4WCE L;  4CI6 A;  3HVR A;  1NGG A;  4CES A;  4FZY A;  3F2K A;  3ZCM A;  1SGH A;  4DSL A;  1VRT A;  4B8C A;  4CHZ A;  3V1R A;  3DRP A;  3VEW A;  2D0P A;  2HMP A;  5I9E B;  3QBX A;  1VQP N;  4RWT A;  4BR4 A;  3EYZ A;  3O6W A;  1SV5 A;  3VF4 A;  2RQ1 A;  3OYA A;  3O5B A;  5AZI B;  3PZD A;  2O8F B;  4O8U A;  3G6E N;  3ZT1 A;  3WXM B;  1NJZ A;  2ZE2 A;  3VA0 A;  1V4T A;  1T6C A;  4Z4C A;  4LD0 A;  1KC8 O;  2QI2 A;  3M8R A;  4FLY A;  1RDB A;  2UUA K;  3O9T A;  4H4O A;  4IO8 A;  2AJQ A;  4JHD B;  4FW2 A;  3CPW M;  1G99 A;  3NGY A;  2FSN A;  3VTI A;  1VSE A;  4AHV A;  4JS4 A;  1S22 A;  4CIF A;  3KK3 A;  5AFU H;  1CXQ A;  5AQU A;  3C6T A;  5CE3 A;  3OYH A;  3MN6 A;  5AQQ A;  1X3M A;  3EN9 A;  3ZT2 A;  5KGW A;  4W5T A;  3PIO L;  2XY6 A;  3PX6 A;  5J2N A;  3DYA A;  2OPS A;  3CCU N;  2D2Q A;  1Y19 B;  4CD3 A;  1Y64 A;  3SMS A;  3M1F A;  4OKK A;  4E1N A;  2QWP A;  1RBU A;  1WB9 A;  2E6M A;  1NGB A;  1MIX A;  4LFC K;  4K41 A;  4JKE A;  4F7G A;  2A42 A;  4M63 C;  4DWI A;  4C8M A;  3P5J A;  1BDG A;  3HO1 A;  1IG8 A;  3TU5 A;  4CHO A;  4DUY K;  4Z4E A;  3K58 A;  1WNS A;  3O4N A;  4B9M A;  4CEF A;  1HKB A;  3E01 A;  1BQM A;  3QEV A;  3G4S N;  3E9P A;  2ATQ A;  1VQ6 N;  1HRH A;  1IH7 A;  4H0V B;  5JS2 A;  4NXN K;  1GLD G;  4O44 A;  2OPQ A;  1Q82 O;  1Q9Y A;  3D2E B;  1J6Z A;  3EE8 A;  5GIN A;  1RTH A;  4JNE A;  1T44 A;  5HRN A;  1LCU A;  4FK0 A;  3CD6 N;  3E1Y A;  1K8K B;  2A3Z A;  3QFU A;  4JN4 A;  1NK0 A;  4OKJ A;  5DM6 L;  3I8B A;  4OGC A;  4YY3 K;  4RW4 A;  4BVP A;  3DXK B;  2QKK A;  5I3U A;  3K5O A;  4DTS A;  5KRT A;  4FVU A;  4FJK A;  1B9F A;  1YVN A;  3MXJ A;  2I5J A;  2HMI A;  4NLB A;  2VGN A;  3WNG A;  4B1V A;  4BRC A;  1NGJ A;  3R9P A;  4BG8 A;  1RIL A;  3ENH A;  4IG0 A;  1IJJ A;  3S3N A;  4KHY A;  3LAK A;  1GOB A;  4WQ5 C;  2Z1G A;  3TAP A;  1RFQ A;  5C25 A;  3NF6 A;  4E7L A;  3CCE N;  2OA8 A;  4RG8 A;  1LV5 A;  3X23 A;  3SCX A;  2NNW A;  4DTJ A;  3I33 A;  1IBK K;  1ASU A;  4ELU A;  3HI0 A;  3P38 A;  1WLJ A;  1VQ5 N;  3KLE A;  1FXX A;  4EHT A;  1LWC A;  4YNQ A;  4BRM A;  3QES A;  4ZHR A;  3ZSV A;  3FZF A;  3VGK A;  4CIE A;  1EO1 A;  2GV9 A;  2FBV A;  3BZC A;  3PSF A;  5KQD A;  3P31 A;  3THY A;  4CHN A;  4DSK A;  3I8D A;  4PKG A;  5FRO A;  5DMR A;  1JL2 A;  1NLV A;  3DLK A;  3LDQ A;  4OPA A;  1NGD A;  3KD1 E;  5FDL A;  2VWK A;  4DMN A;  3TSP A;  1YXQ A;  1RBV A;  5FPM A;  5IJM A;  3ZET B;  3SAG A;  2E6L A;  4NLC A;  3QIP A;  4WF9 L;  3CI5 A;  4BGA A;  4FJ9 A;  1YF5 L;  1FJG K;  3U8X A;  1U45 A;  4M3R A;  4I2P A;  3OS2 A;  1QSL A;  1A5V A;  4JS5 A;  3U9D A;  3TI0 A;  1V4S A;  1YJN N;  1Q9X A;  1GLF O;  3MEE A;  1GLJ O;  4CJU A;  2ASP A;  3KLH A;  3V9U A;  2VWB A;  5LMU K;  4CGI A;  1RDD A;  4CZM A;  1EX4 A;  3IAY A;  1TAQ A;  2W40 A;  3LL3 A;  4CZI A;  3I0S A;  5BPL A;  2YNH A;  5GAH P;  5J2P A;  3MAQ A;  2GBZ A;  4J2E A;  1UA0 A;  3OTO K;  3AO4 A;  4IFY A;  2VCP A;  3ULE B;  3U8Z A;  3RRH A;  1QSS A;  4CJF A;  4EP4 A;  3AVJ A;  4M7X A;  3D0P A;  2UXC K;  3AVC A;  3H46 O;  2P9L A;  1TKX A;  5AQH A;  1JLF A;  1NGI A;  5FRM A;  1BU6 O;  4Q0B A;  5LY3 A;  1IKX A;  4B1X B;  4CJ4 A;  2KZZ A;  4BRP A;  3ZEU B;  4BRA A;  1MU2 A;  2LSN A;  4DKW A;  4N76 A;  4GKK K;  4AHR A;  1TK8 A;  2CGJ A;  1RNH A;  1YJW N;  4DV1 K;  3TAG A;  3HT3 A;  4MO4 A;  4E7J A;  4FZX C;  4HVJ A;  2XHB A;  3NCI A;  3ENO A;  4J2A A;  5LL6 Z;  3VPZ A;  1E5W A;  3SMP A;  3VF2 A;  1NKE A;  3DLG A;  2KTQ A;  4CW7 B;  4H0Y B;  1W7A A;  4YHH K;  1QTM A;  4PUO A;  2D0A A;  4BWM A;  5KPR A;  1C1B A;  5KTQ A;  3CM5 A;  3N4Q A;  4HDQ A;  4MFB A;  1KVC A;  3SV3 A;  3SUO A;  3GBT A;  2Q3S A;  5ADX H;  4GMJ B;  3L2Q A;  2GEL A;  3A8Y A;  3DLL L;  1NGH A;  2DFH A;  3RR8 A;  2O8D A;  3VQ4 A;  2HNZ A;  4X64 K;  3GDQ A;  3V1Q A;  1E4F T;  3AVA A;  1TGO A;  1IV0 A;  4Y0W A;  4CJL A;  1JCG A;  4DR6 K;  3ZSY A;  1A5X A;  3ZSW A;  1SKR A;  3EZ5 A;  1NK7 A;  1WSF A;  4KHU A;  1BIZ A;  1YVU A;  3MCA B;  1HNX K;  2HHT A;  1TYQ B;  4B9V A;  2YI1 A;  1BI4 B;  1OVQ A;  3SI6 A;  4B8A B;  2Q0R A;  3EY1 A;  4AIL C;  4F2R A;  1GOC A;  1LAV A;  4DG1 A;  3VQB A;  3NHG A;  2IOC A;  4BR9 A;  4OPJ A;  1S1X A;  4CEE A;  1JLE A;  4FJ8 A;  4E1M A;  3VQD A;  4CZK A;  4PKI A;  2Q97 A;  2YJE A;  1WN7 A;  2D5R A;  5E41 A;  5CY4 A;  2VG7 A;  1NGF A;  3BDP A;  1VSH A;  3CCQ N;  2GX9 A;  2NRH A;  5EOY A;  4BDY A;  1HUX A;  3MN9 A;  4DR1 K;  1RTI A;  4NCB A;  1QHA A;  5I42 A;  2OYQ A;  1J54 A;  1HNW K;  1QQO A;  1E3M A;  1C0M A;  1FKO A;  4JLH A;  4JYA K;  1VQM N;  3FFK B;  4BDP A;  4E1J A;  3O9Q A;  1VBG A;  1QQM A;  4ILJ A;  3V81 A;  2KLA A;  4F2S A;  1NI2 A;  3K9J A;  5C24 A;  1WAF A;  1VAZ A;  5AZI A;  4DFP A;  2O8F A;  5AQS A;  3T69 A;  1GG3 A;  2HHV A;  2KFN A;  3CCJ N;  3OYN A;  2QWQ A;  4CZF A;  4B3O A;  2D4W A;  3CM6 A;  1MK9 B;  1W9H A;  2CH5 A;  5AQL A;  2AP1 A;  1TVR A;  3VMF B;  2ASM A;  1JXB A;  1H1V A;  2ZQB A;  3MN5 A;  4U7B A;  1NJY A;  1RT2 A;  4WQ5 A;  3TTD A;  1XMO K;  2Z1H A;  4FWP A;  3NH0 A;  1J53 A;  4FWQ A;  2WTU A;  3FLV A;  3UKU B;  5FPD A;  1ZYQ A;  2ZPY A;  3QLH A;  3Q7C A;  3O3G A;  3SQ0 A;  1NK4 A;  1D5A A;  3OVN A;  4N47 A;  1NMN A;  2HHW A;  4RW7 A;  4GY2 B;  4DU3 A;  3EL2 A;  4LF4 K;  3VQQ A;  4KHQ A;  3W3D A;  4RW8 A;  2HE7 A;  3O9S A;  1EP4 A;  4IXC A;  1HLU A;  2LBB A;  2QTD A;  4C1N I;  3NDK A;  5AQN A;  4YOV A;  5MLC Q;  2Q1N A;  2RE2 A;  4FLT A;  3HOT A;  1BOT O;  3FP5 A;  4JKH A;  3HST B;  1WUA A;  3AY9 A;  4DR7 K;  3DWL A;  5HOO A;  4KRE A;  4IJA A;  4IOX A;  3CCS N;  2OTL N;  2BUP A;  2YHY A;  4BGB A;  3LDS A;  3VER A;  1Q18 A;  4PKH A;  3LP2 A;  3QIC A;  2D10 A;  4CFD A;  2R7Y A;  4CF0 A;  5EXW A;  2NLX A;  3CQY A;  1KFD A;  3L2R A;  2E1Y A;  2OZS A;  3RSE B;  3ZT0 A;  1Z05 A;  4ICL A;  4CEA A;  3SQ2 A;  1BUP A;  3CCV N;  3AAR A;  1NK9 A;  5C12 A;  4DR3 K;  4KHP K;  5AQP A;  4JV5 K;  4GVE A;  4O8K A;  4CJK A;  4HUF A;  5GAG P;  4K42 A;  1Z26 A;  2DPN A;  3R8E A;  3OJU A;  4FCY A;  3DXK A;  3T19 A;  2OAN A;  4Y1C A;  3RMB A;  4FLZ A;  3CJB A;  4FWN A;  4FW1 A;  2O8E B;  4P7I A;  2J0J A;  3Q7B A;  3RVC A;  3FE1 A;  3ZT4 A;  4E7K A;  1SS6 A;  3TAE A;  4IG3 A;  1KAZ A;  3SUP A;  3H3N O;  4BVO A;  1GLC G;  3G9W A;  3QBW A;  4DV0 K;  3QEW A;  3O9U A;  1ITG A;  1N5Y A;  4J2D A;  3HZ6 A;  4DFM A;  2HNY A;  1NJI O;  1VSF A;  1DIK A;  4GW6 A;  1R59 O;  5E84 A;  3CMA N;  4DB3 A;  2Q31 A;  2B6A A;  2QWM A;  4FL9 A;  4IFE A;  4DXA B;  4FLU A;  3OY9 A;  4Z94 A;  3CFP A;  2Y1J A;  1IG9 A;  1N32 K;  4DV6 K;  4KBO A;  4B3R K;  3O08 A;  3L8B A;  3AVM A;  1QSY A;  4CER A;  2FXU A;  3WXI A;  1VK0 A;  2GWJ A;  3MCP A;  3PO5 A;  4TKN A;  4CHQ A;  1QQC A;  4H0T B;  3H3O B;  4HUG A;  3ZSZ A;  1MK7 B;  3VQA A;  1RBT A;  3NH2 A;  3KK2 A;  1L3T A;  1RDW X;  3C94 A;  2O4G A;  3WT0 A;  3PY8 A;  1KBL A;  2AL6 A;  1C1A A;  1MDU B;  3ZX3 A;  2FBY A;  3WQU A;  3AO2 A;  4QS8 A;  5AQO A;  3KJV A;  1KC7 A;  4IDK A;  2E20 A;  2WOM A;  1C0U A;  4NXM K;  3VF6 A;  2QA4 N;  3CFO A;  4JKG B;  4O55 A;  3OHR A;  3KHY A;  3ZET A;  2FBT A;  5AJ3 K;  2UUB K;  5J1E A;  2J0M A;  1NU0 A;  4DSJ A;  3K0S A;  4CEO A;  2I7N A;  1QVF M;  2ETJ A;  5ELZ A;  4EZ9 A;  2VQE K;  1U04 A;  2G8V A;  4H03 B;  3FZK A;  2B4J A;  3K5M A;  4BAC A;  4HWI A;  1KTQ A;  4DLE A;  1J5E K;  3QML A;  4BQL A;  4G9Z A;  3MMV A;  2YVC A;  2EWS A;  5M1F A;  2XRI A;  4FK4 A;  4KTQ A;  4DV7 K;  3CIP A;  4CGJ A;  3SAF A;  1U49 A;  4BC2 A;  5BRF A;  3SPZ A;  3M8S A;  1HB8 A;  3OYK A;  2FF3 B;  4KAZ A;  5GAD P;  4B1W B;  1RDU A;  3L0Q A;  3O1W A;  4FLV A;  3ULE A;  4K0K K;  4IWV A;  2VWJ A;  2QEX N;  1EQY A;  2VQF K;  4W5O A;  3F9K A;  3K57 A;  4PQU A;  4W5Q A;  1P90 A;  4IEI A;  4RW6 A;  2P9S B;  4WE1 A;  2ITM A;  4L3Q A;  3IDH A;  1NTI A;  3ZEU A;  3HM9 A;  3DMJ A;  3MWP A;  4PWD A;  1RTD A;  4DCH A;  3VA3 A;  1WBD A;  3L2V A;  4BR0 A;  4NO7 A;  5KRS A;  4Z4F A;  2JWK A;  3FZL A;  3CCR N;  5DK5 A;  3AAQ A;  3DRR A;  4MQ3 A;  3RWU A;  2YV0 X;  3DOK A;  3NF9 A;  3TAN A;  1Q8I A;  4ELT A;  4BRG A;  1BL3 A;  3DXM A;  3WNF A;  1REV A;  1VSI A;  3N4P A;  4LY7 A;  3L6Q A;  4YOX A;  1K9M O;  2W41 A;  4DR5 K;  4KHW A;  3L4Q A;  1BA0 A;  4MDA A;  2WUS A;  4FJL A;  4NYF A;  3NH1 A;  3JYT A;  3CJ7 A;  1JJ2 M;  3E66 A;  5F0X A;  4H0X B;  3CJ1 A;  2RHK A;  3SLC A;  2GUP A;  2HVH A;  4DV4 K;  4JI0 K;  3ZSQ A;  5CYM A;  1ST7 A;  1YAG A;  1QZ5 A;  1TYQ A;  3SJJ A;  1KVB A;  1BI4 A;  1W0H A;  3VQE A;  2F96 A;  4DQ8 A;  5JMV A;  1HMV A;  3SUN A;  4HTU A;  4LF6 K;  4ZRJ A;  3SUQ A;  3L2U A;  3EPY A;  3AAP A;  5HRR A;  2O8B B;  4DS4 A;  4JKB A;  1JDE A;  3CQX A;  1BG3 A;  4CE9 A;  4XH5 A;  3JSM A;  4X62 K;  4JI7 K;  1IKY A;  4KRF A;  3CFR A;  3TR8 A;  1L3U A;  1NNE A;  1S1U A;  1N34 K;  1ACA A;  4HHT A;  1SL0 A;  3C6A A;  1NGA A;  2EX3 A;  2GTD A;  3TAF A;  3DAW A;  3PUF A;  2FDQ A;  5BR8 K;  3G25 A;  4YFU A;  1RDC A;  4KO0 A;  3SQ4 A;  1JCE A;  4FXD A;  4DV2 K;  1TK5 A;  3A5M C;  1J5O A;  4DTX A;  3DLB A;  4CF9 A;  2ASO A;  4AF1 A;  4IFV A;  4YOY A;  4DQI A;  3T1Y K;  1E4G T;  2UUC K;  4BE0 A;  3PO4 A;  4L8R B;  3CC4 N;  2ZD1 A;  1ASW A;  3S41 A;  4LSN A;  4DV3 K;  1Z6R A;  4OX9 K;  1XUP O;  4H0P A;  3VOV A;  1WSJ A;  3P4I A;  1HPM A;  3ZT3 A;  5F1X A;  1X1P A;  2XO7 A;  1SKS A;  5C15 A;  2IVP A;  4JI2 K;  4B1Z A;  4I9Q A;  3U7D A;  3LZI A;  3UKU A;  4IDH A;  3LWL A;  1NOY A;  4U67 L;  3WXJ A;  1JL1 A;  4W5R A;  4OLA A;  5AZJ B;  2KZM A;  3VN5 A;  1EET A;  3UKR B;  1X9J A;  2PYJ A;  3HP6 A;  1HNZ K;  4FJ5 A;  1I3A A;  4LF7 K;  3KD5 E;  4DQP A;  4BRD A;  3QB0 A;  3R6M A;  5BPM A;  2P5G A;  1YUW A;  2V7Y A;  4CYE A;  3NF7 A;  3TAQ A;  5T7B A;  3R1X A;  4CBU A;  1S9G A;  3DLE A;  3AV9 A;  1KVA A;  3OA9 A;  1NMD A;  3V9S A;  2FSJ A;  2HB5 A;  5EX5 A;  1XNR K;  1F21 A;  4DFJ A;  1X9W A;  3D2F B;  4N56 A;  4DR2 K;  4GV3 A;  4KHN A;  2QW9 A;  4J2B A;  3VQ6 A;  3ASM A;  3KKR A;  1M90 O;  1S3X A;  2IAJ A;  4H4M A;  3VEV A;  1QZ6 A;  4EHU A;  3RMD A;  3BIN A;  3QIO A;  3RSE A;  5CYQ A;  4HDO A;  3F5T A;  1MWK A;  3NVM A;  3P1G A;  1U6Z A;  1ZBF A;  4CJE A;  4CF1 A;  5BRE A;  3M5R A;  2X6S A;  4UY8 O;  2HW3 A;  2YX6 A;  4C1N K;  3VQ9 A;  4LFA K;  1UA1 A;  1JCF A;  4M3T A;  1VQ8 N;  1C0F A;  1Q81 O;  3IUC A;  2O8E A;  3K59 A;  3K9K A;  5M1P A;  4I7F A;  4DV5 K;  3AVG A;  4C23 A;  5JLF A;  4ISG A;  4JK7 A;  3LPT A;  4H5R A;  5LJV A;  3MEC A;  3CME N;  3TWH A;  3VEX A;  1IBM K;  4BRE A;  5AQM A;  5BRD A;  1LW0 A;  4Q5V A;  4X65 K;  1BIU A;  3AVK A;  3PSI A;  3QO9 A;  2QWR A;  4ZTJ A;  2YHW A;  2G8F A;  4BRH A;  4PL8 A;  2KFZ A;  4FZZ A;  5KI6 A;  3CCL N;  1TKZ A;  4FM2 A;  1ATR A;  4RTF D;  3THX B;  3DXM B;  1TV6 A;  1HPZ A;  4FPB A;  3NGI A;  4Z0U A;  5HLF A;  4C8N A;  4HTL A;  4IJN A;  5JVL A;  1ZBL A;  1D8Y A;  3A5O C;  4OPH A;  3EZW A;  2IVN A;  4N5S A;  1JLG A;  4QS9 A;  1W2B M;  3BF1 A;  3DI6 A;  5M1Q A;  4O0I A;  3HVT A;  3J7Z O;  3IFR A;  2ZM6 K;  4CIG A;  5JLH A;  1YTA A;  4GNI A;  4XIU A;  5HP1 A;  3SAH A;  4CJS A;  1NKC A; 
#chains in the Genus database with same CATH homology
 3CCV N;  3AAR A;  2A40 A;  2A5X A;  5C12 A;  4BR4 A;  4RWT A;  2ZJR L;  5AQP A;  3O6W A;  4GVE A;  4M7Y A;  3VF4 A;  2RQ1 A;  4GXB A;  3WA0 A;  4JKG A;  4O8K A;  2R82 A;  3O5B A;  4JKA A;  4O5F A;  3PZD A;  5AZI B;  4FOI A;  1KAX A;  4O8U A;  1VQL N;  2FLO A;  5AQV A;  5GAG P;  3G6E N;  4K42 A;  4A57 A;  1NM1 A;  3WXM B;  5AQR A;  2DPN A;  2EMS A;  3ZX2 A;  1VQ9 N;  1V4T A;  3R8E A;  1T6C A;  5C0Y A;  2ZGY A;  2F7T A;  2COP A;  3DXK A;  4H5N A;  1KC8 O;  2QI2 A;  4BRQ A;  2OAN A;  3C0B A;  3O9T A;  4BRO A;  3U9Z A;  2IIR A;  3O8M A;  4BC5 A;  1O13 A;  3CJB A;  4IO8 A;  4FWN A;  3WEE B;  4JHD B;  2V51 B;  4P7I A;  2J0J A;  2PAV A;  3DJC A;  3Q7B A;  4FWM A;  3RVC A;  1G99 A;  1MA9 B;  2PBD A;  3FE1 A;  3H1V X;  1SS6 A;  4WQ4 C;  1KAZ A;  2HF4 A;  4BY9 C;  2FSN A;  1C0G A;  3VTI A;  3H3N O;  4BVO A;  1GLC G;  1RGI A;  3G9W A;  1S22 A;  2QWL A;  3QBW A;  3O9U A;  2NRZ A;  2NRR A;  3HZ6 A;  5AFU H;  5AQU A;  1NJI O;  4WYB A;  1DIK A;  2E8A A;  1HKC A;  1R59 O;  5CE3 A;  5E84 A;  5AQY A;  5M1N A;  3MN6 A;  5AQQ A;  3B8A X;  1X3M A;  4DB3 A;  3EN9 A;  3CMA N;  3PIO L;  4BRL A;  2Q31 A;  3KK7 A;  3O80 A;  5TKW A;  5GIP A;  1S72 N;  2D0O A;  1W97 L;  1EF1 A;  2P9N B;  3ATV A;  5H1S Q;  2GEM A;  2KHO A;  3CCU N;  2D2Q A;  2QWM A;  1Y19 B;  4CD3 A;  1Y64 A;  5FPN A;  3M1F A;  4FL9 A;  3SMS A;  4IFE A;  4DXA B;  4Z94 A;  2FSK A;  2QWP A;  3JXU A;  5AQJ A;  1YJ9 N;  1NGB A;  1HBK A;  4KBO A;  1MIX A;  3O08 A;  2P9P B;  4K41 A;  4JKE A;  2E1Z A;  3TSU A;  4CZJ A;  4F7G A;  2A42 A;  4M63 C;  1NGE A;  5M1O A;  2I7P A;  2DIK A;  4NY0 A;  1BDG A;  2FXU A;  1GGO A;  1IG8 A;  2NRX A;  2P9S A;  4JAX A;  2GWJ A;  3TU5 A;  3MCP A;  2WFB A;  3BP8 A;  3FR0 A;  4MLH A;  4TKN A;  2P9I A;  3TTF A;  3CXC M;  3ID6 A;  1HKB A;  4H0T B;  3H3O B;  1MK7 B;  2HBJ A;  3E9P A;  3IMX A;  3WXI A;  4WFA L;  3G4S N;  1VQ6 N;  4CZE A;  4NB4 A;  3J8A A;  1RDW X;  4H0V B;  3WT0 A;  4AM7 A;  1GLD G;  1KBL A;  3AU4 A;  3LDN A;  3MK6 A;  2AL6 A;  1MDU B;  4I6M A;  5GAE P;  3ZX3 A;  1Q82 O;  1VQ7 N;  3D2E B;  3TSQ A;  5CHI A;  1ILY A;  3WQU A;  4EIA A;  1J6Z A;  3GE1 A;  4QS7 A;  2H3G X;  4QS8 A;  3EE8 A;  5AQO A;  3WQT A;  5C2D A;  1KC7 A;  5GIN A;  4FWR A;  2E20 A;  3LDP A;  4JNE A;  1T44 A;  3VF6 A;  2QA4 N;  4JKG B;  1LCU A;  4B9Q A;  3OHR A;  3CD6 N;  3P39 A;  4A5B A;  3E1Y A;  2V7Z A;  3KHY A;  4ISE A;  3HOS A;  5AFU A;  4YOU A;  3ZET A;  4YOW A;  1K8K B;  2A3Z A;  2WC9 A;  3QFU A;  4JN4 A;  1SQK A;  3KWI A;  5DM6 L;  5HL7 L;  3I8B A;  3EO3 A;  2J0M A;  1OVY A;  4BVP A;  2I7N A;  2KKZ A;  3DXK B;  1QVF M;  4YOT A;  4RCH A;  5ELZ A;  2ZGZ A;  4H03 B;  4FVU A;  1YVN A;  2QXL A;  3FZK A;  3E9O A;  3HBT A;  4HWI A;  4NLB A;  2VGN A;  4B1V A;  2I1J A;  1NGJ A;  3GOI A;  3QML A;  3R9P A;  4BG8 A;  4BRC A;  3ENH A;  4KH5 A;  1IJJ A;  4BQL A;  4G9Z A;  3MMV A;  2YVC A;  2EWS A;  5M1F A;  4FSV A;  1YIJ N;  3LDL A;  5FPE A;  1ZXO A;  4CZG A;  1ESV A;  2P9K A;  3CIP A;  4JD2 B;  3SAF A;  4BC2 A;  5BRF A;  2BTF A;  4WQ5 C;  4JEP A;  1RFQ A;  1HB8 A;  2WBN A;  3C6H A;  4EAH D;  3WXL A;  5C10 A;  3CCE N;  2FF3 B;  3H1Q A;  4DHY A;  2PFU A;  1ZC6 A;  3A5N C;  5GAD P;  4ILG B;  4B1W B;  3X23 A;  1RDU A;  3JS6 A;  3L0Q A;  3M3Z A;  3O1W A;  3OBW A;  4WQ4 A;  3ULE A;  2NNW A;  4IWV A;  2QEX N;  2E2N A;  4YDU A;  2WH5 A;  1EQY A;  3FLC O;  3I33 A;  3IVF A;  4H5V A;  1VQ4 N;  1KXP A;  3HI0 A;  1P90 A;  2OTJ N;  1KAY A;  1XQS C;  1DGK N;  3P38 A;  4IEI A;  1VQ5 N;  2P9S B;  5AQK A;  5AQZ A;  4FWO A;  4EHT A;  2ITM A;  2ZF5 O;  4L3Q A;  1NGC A;  3IDH A;  2YHX A;  1NTI A;  4BRM A;  4K25 A;  3SBT A;  4K43 A;  3UB5 A;  1YHQ N;  1D4X A;  3ZEU A;  2P9I B;  3FZF A;  3MWP A;  3VEO A;  1LOT B;  3VGK A;  1EO1 A;  4FWK A;  5KQD A;  1GLL O;  4DCH A;  3P31 A;  1ATS A;  3NVK A;  1KD1 O;  4BR0 A;  3KWG A;  5AQI A;  4NO7 A;  3MX5 A;  3EKS A;  5F2R A;  4PL7 A;  4PKG A;  2JWK A;  3FZL A;  1KQS M;  3CCR N;  4IOA L;  1NBW A;  4IO9 L;  4FOE A;  1NLV A;  5KQ8 A;  2Q0U A;  3AAQ A;  3LDQ A;  4OPA A;  3WUH A;  1NGD A;  5LJW A;  4R79 A;  5CR4 A;  4BRG A;  3DXM A;  4BRI A;  2QWO A;  5AQF A;  2BH1 A;  1U2V A;  2F9T A;  5AQG A;  3TSP A;  3N4P A;  1YXQ A;  5FPM A;  5IJM A;  5JVH L;  3L6Q A;  4YOX A;  3W0L A;  3ZET B;  3SAG A;  1Q86 O;  3I56 N;  4XH1 A;  4NLC A;  4WF9 L;  3CI5 A;  5EVZ A;  2W41 A;  1DEJ A;  4BGA A;  3ZDT A;  1K9M O;  1YF5 L;  1BA0 A;  3GG4 A;  1NWK A;  3L4Q A;  3U8X A;  4MDA A;  3U9D A;  1K8A O;  1V4S A;  2V52 B;  3KVG A;  1YJN N;  1GLF O;  1NVL A;  4XEI A;  2WUS A;  4IZ9 A;  1GLJ O;  2A41 A;  2ASP A;  2X0S A;  4BQZ A;  1DT9 A;  3CJ7 A;  4EFH A;  1JJ2 M;  2CH6 A;  4H0O A;  2ZJQ L;  3VGM A;  3E66 A;  2VWB A;  4JKD A;  5F0X A;  4H0X B;  4BC4 A;  3CJ1 A;  4CZM A;  3I55 N;  2EMT A;  3ZYY X;  3QIJ A;  2RHK A;  1Q7Y O;  3SLC A;  3F9M A;  2GUP A;  5AZJ A;  2CQU A;  2W40 A;  3H45 C;  3LL3 A;  1ST7 A;  1YAG A;  1BA1 A;  2J0K A;  4CZI A;  1M1K O;  2P9K B;  5BPL A;  5GAH P;  1QZ5 A;  1TYQ A;  2HST A;  1J19 A;  3UKR A;  4FO0 A;  2CB8 A;  4B1U B;  2VYP A;  4H5W A;  4DQ8 A;  5JMV A;  1P8Z A;  4A62 A;  4CZH A;  4ZRJ A;  5M1K A;  3EPY A;  2UYT A;  3AAP A;  2VCP A;  3ULE B;  3U8Z A;  2QM1 A;  4JKB A;  1JDE A;  3CQX A;  4M7X A;  1BG3 A;  3AU5 A;  3FZH A;  4XH5 A;  2GWK A;  3H46 O;  1DKG D;  2P9L A;  2HBK A;  5AQH A;  3H6E A;  4JHD A;  3FGU A;  4WFB L;  1CZA N;  1NGI A;  2AEH A;  2D1K A;  3C7N A;  5GIO A;  1BU6 O;  1ACA A;  1H4R A;  5LY3 A;  3PIP L;  4B1X B;  3C6A A;  4BRP A;  3ZEU B;  4BRA A;  1NGA A;  4JK8 A;  2HRJ A;  4DKW A;  2GTD A;  3D2F A;  3DAW A;  3WXK A;  2FDQ A;  3OBY A;  2CGJ A;  3G25 A;  1SAZ A;  1HB6 A;  1YJW N;  4ILH A;  3OW2 M;  4BG9 A;  4MO4 A;  3TPQ A;  2IVO A;  4CBW A;  1JCE A;  3EE9 A;  2NRW A;  3ATU A;  3M6G A;  3D6R A;  2CGL A;  4BRF A;  3O9R A;  3ENO A;  4CJ7 A;  3A5M C;  3CET A;  3BUZ B;  3VPZ A;  2J4R A;  1E5W A;  3SMP A;  2ASO A;  1BWF O;  3VF2 A;  4AF1 A;  2NZT A;  3VGL A;  2FJ9 A;  4H0Y B;  4YOY A;  1E4G T;  3VEY A;  5KPR A;  3FZM A;  3VTH A;  5B8H A;  3N4Q A;  3CC4 N;  4HDQ A;  1X3N A;  3S41 A;  3T7Z A;  4FWL A;  2HBM A;  4JKF A;  3MWT A;  1Z6R A;  3GBT A;  1XUP O;  3HM8 A;  1GLB G;  4H0P A;  3VOV A;  4BRK A;  5ADX H;  1GC7 A;  1HPM A;  3P4I A;  5F1X A;  1N8R O;  2AA4 A;  3MX2 A;  2GEL A;  3A8Y A;  4CD1 A;  3DLL L;  1NGH A;  4B1Y B;  5C15 A;  1GC6 A;  4A2B A;  5BN8 A;  2IVP A;  3SJH A;  3C65 A;  5EY4 A;  5JIC A;  4B1Z A;  2HF3 A;  3U7D A;  1HJO A;  3GDQ A;  1E4F T;  3BF3 A;  4J8F A;  3UKU A;  4IDH A;  4Y0W A;  3NMU A;  1JCG A;  3D2E A;  4U67 L;  1HKG A;  4JK9 A;  1MWM A;  3WXJ A;  1YIT N;  5AZJ B;  1VQP N;  4GV9 A;  1ATN A;  3ZX0 A;  1OKJ A;  2FF6 A;  3PLA A;  1GLA G;  2QWN A;  3MCA B;  2P9U A;  1TYQ B;  2YI1 A;  3MDQ A;  2HOE A;  3UKR B;  1X9J A;  4KH4 A;  2Q0R A;  4I6M B;  1K8K A;  3CHW A;  4A2A A;  1VBH A;  4BR7 A;  3HSC A;  4XH4 A;  4BRD A;  3LM2 A;  3QB0 A;  3CPE A;  3MN7 A;  3R6M A;  4AM6 A;  4BR9 A;  5BPM A;  5BPN A;  5KPZ A;  4YL8 A;  1YUW A;  2V7Y A;  4H5T A;  4CYE A;  2P9L B;  2E2Q A;  5TKY A;  1WOQ A;  3R1X A;  4MO5 A;  4CBU A;  4CZK A;  4PKI A;  2E2O A;  3E9L A;  2Q97 A;  2YJE A;  3GL1 A;  2ZJP L;  2YCH A;  1NGF A;  4F9O A;  2JWL A;  3ID8 A;  3C7N B;  3AGK A;  3OA9 A;  5C2F A;  1NMD A;  4YDU C;  1ZBS A;  3CCQ N;  2GX9 A;  2FSJ A;  2ZWH A;  2NRH A;  5EX5 A;  4A5A A;  4IOC L;  4BRN A;  5EOY A;  5AR0 A;  3VES A;  3D2F B;  4GV3 A;  2I1K A;  1HUX A;  2QW9 A;  3MN9 A;  1T6D A;  3L4I A;  5AQW A;  2F9W A;  3HTV A;  5ADX A;  2NRT A;  4JD2 A;  1S3X A;  1M90 O;  4ZRK A;  1QHA A;  5BN9 A;  3VEV A;  1QZ6 A;  4EHU A;  1QQO A;  3BIN A;  5BR9 A;  3RSE A;  1VQM N;  3FFK B;  3LDO A;  4HDO A;  4E1J A;  3F5T A;  3O9Q A;  1VBG A;  1QQM A;  4ISF A;  4ILJ A;  1MWK A;  3NVM A;  1U6Z A;  3QDK A;  2YJF A;  2KLA A;  3CJ9 A;  4A61 A;  1NI2 A;  4WFN L;  3K9J A;  2VGM A;  5AZI A;  1VAZ A;  1YI2 N;  5AQS A;  3T69 A;  5BRE A;  1VQO N;  1GG3 A;  4CBX A;  1K73 O;  3M5R A;  3CCJ N;  4UY8 O;  2QWQ A;  4CZF A;  3A0I X;  2YX6 A;  2D4W A;  3A5L C;  4C1N K;  4BR5 A;  1MK9 B;  1JCF A;  2CH5 A;  5AQL A;  2D11 A;  2AP1 A;  3VMF B;  2ASM A;  1VQ8 N;  2E88 A;  1H1V A;  3SK3 A;  1C0F A;  3EKU A;  3WEE A;  5KPT A;  5AQX A;  4A59 A;  3IUC A;  1Q81 O;  4EKU A;  3R3L A;  4YOR A;  3MN5 A;  3K9K A;  3UE5 A;  5M1P A;  4U7B A;  4WQ5 A;  3TTD A;  4C23 A;  3QFP A;  4FWP A;  5JLF A;  4FWQ A;  4ISG A;  3FLV A;  1T3V A;  4FPA A;  5E26 A;  3UKU B;  3CC7 N;  4JK7 A;  3KZB A;  4H5R A;  5LJV A;  3CER A;  5FPD A;  3CME N;  4KH6 A;  1QQN A;  2ZPY A;  3IKM A;  3VEX A;  4GV6 A;  4BRE A;  3Q7C A;  5AQM A;  4JKC A;  3VEN A;  3AGR A;  3ENB A;  5BRD A;  1HX1 A;  2P9U B;  3U4L A;  4OO1 J;  1SZ2 A;  2CGK A;  3SBG A;  4FWS A;  1QVG M;  1XC3 A;  2P9N A;  3CJA A;  4GY2 B;  2Q36 A;  5JVG L;  2QWR A;  3EL2 A;  2YHW A;  4BRH A;  3PVL A;  4PL8 A;  3W3D A;  1VQN N;  2NRV A;  2HE7 A;  3O9S A;  3CCL N;  4IXC A;  3VEZ A;  1ATR A;  1HLU A;  2LBB A;  2QTD A;  3HRG A;  4RTF D;  3CJC A;  3DXM B;  3LM9 A;  4BC3 A;  4C1N I;  2P9P A;  5AQN A;  4YOV A;  5MLC Q;  2Q1N A;  1U2V B;  2E2P A;  4ZRI A;  2RE2 A;  3G71 N;  1BO5 O;  5AQT A;  4MLE A;  4FPB A;  1BOT O;  3FP5 A;  4JKH A;  4BR2 A;  4CZL A;  1WUA A;  3HOT A;  1VQK N;  4MDB A;  2HBL A;  3AY9 A;  3DWL A;  5HOO A;  4HTL A;  4IJN A;  4IJA A;  4LC9 B;  3O4W A;  4IOX A;  5DM7 L;  3CCS N;  4WCE L;  5JVL A;  2OTL N;  1TUY A;  2BUP A;  2YHY A;  4BGB A;  1MIZ B;  3A5O C;  4OPH A;  1Q18 A;  3EZW A;  3VER A;  3VET A;  4PKH A;  3CCM N;  4CI6 A;  3CC2 N;  2IVN A;  5BRH A;  1ISN A;  1NGG A;  2Q2R A;  4QS9 A;  1W2B M;  3CF5 L;  3BF1 A;  3QIC A;  2D10 A;  3F2K A;  1GLE G;  4IEE A;  3TTC A;  5M1Q A;  4PHT X;  1SGH A;  5EXW A;  2NLX A;  3CQY A;  3J7Z O;  3BEX A;  2E1Y A;  3IFR A;  3O1B A;  3VEW A;  3RSE B;  2D0P A;  1TUU A;  2A6A A;  1Z05 A;  2HMP A;  2ABD A;  3D7E O;  4GNI A;  3QBX A;  5I9E B;  5JLH A;  3SAH A;  3CPW M;  1BUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...