4JKBA

Open and closed forms of v1788d human prp8 rnase h-like domain with bound mg ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRDTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 67
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkbA01
4ILHA 3E9PA 4JKEA 4JKAA 3E66A 3SBGA 3SBTA 4JKFA 4JKHA 4JK9A 4JK7A 3E9LA 4ILGB 3E9OA 4JKGA 4JKBA 4JKDA 4JKGB 4JKCA 4ILJA 3ENBA 4JK8A
chains in the Genus database with same CATH superfamily
2OPPA 4DV5K 3NGYA 3T1HK 1N33K 1YHQN 4QOZB 4BC2A 3LWLA 3CPWM 3QERA 1BHLA 4IJAA 1REVA 4CJQA 3VENA 4FWSA 4FWRA 3KLHA 4ILGB 1RNHA 1C1AA 2DFFA 2CH5A 1Q8IA 1V4TA 2DFEA 3NHGA 3OYEA 4KAZA 4XH4A 4JS4A 1K8AO 4EZ6A 2WBNA 1W7AA 1L3VA 3AVGA 5EU7A 4JLHA 1QHAA 1LAWA 4MLEA 1NKBA 2QWOA 3K5LA 3EN9A 1A5XA 2BUPA 4A62A 1C1BA 4E7LA 1KC7A 1VSIA 4G9ZA 3P83D 4BRLA 4B3RK 4C1NK 1NOZA 1DTTA 1HB6A 1GLAG 3CJAA 1GOCA 3CM6A 4OPAA 3VEXA 2YJFA 3KWGA 3ZDTA 5M1PA 2I1JA 4B3MK 1VSFA 3CXCM 1U6ZA 3MX5A 3V9WA 3LDQA 4H5TA 5FDLA 5B8HA 3QBWA 2D10A 3NVMA 4JHDA 3AVAA 4M3YA 4DLEA 1NGBA 3NF9A 3OYGA 2D11A 1X9SA 2KHOA 4EHUA 2W41A 2F9WA 1GG3A 3V81A 1WUAA 1ZBHA 3ZCMA 3J8AA 4YOWA 3NMUA 2D0BA 3G6EN 3F2KA 4I6MA 1NGFA 4B9UA 3KIOA 3MEEA 4KHYA 1FJGK 3O1WA 4FK4A 4CF9A 4XH1A 3L8BA 1NGIA 1VSHA 1K8KB 2NLXA 4CGFA 3SJJA 5AZJB 2CQUA 4FM1A 2X0SA 1RTJA 1VSJA 1SKWA 4EP5A 4CHPA 3I56N 1GLBG 4CJWA 5C15A 4FJGA 3LL3A 3NGZA 4NYFA 5M1FA 2F4VK 2OYQA 4FWMA 1IBLK 2Q97A 4FLTA 1RBRA 3BDPA 1BIUA 4GVEA 1KVCA 4CZMA 2RQ1A 5JVGL 1NBWA 1FK9A 3DXKB 4IFEA 4O5FA 4B1ZA 3OYDA 4BE0A 2ITGA 2XY8A 4M3XA 3HK2A 3H3OB 1KQSM 3O4NA 3D0PA 3HJFA 3LALA 2QM1A 4CJSA 3I33A 5IJMA 2OANA 1P90A 2Q1NA 4F3OA 1JLFA 4CJUA 1KXPA 2X74A 4B08A 4XIUA 3QEIA 4BVPA 4WFAL 2GELA 3L3UA 4GV6A 1MU2A 2O8CB 3DLEA 2JWKA 3OYMA 1JCGA 4DV3K 4YOVA 4DR4K 3R1XA 4DHYA 2QWPA 3FLCO 3ZEUB 4HTUA 3N4QA 3IMXA 1XHXA 5ADXH 2P1JA 4WQ4A 1RBTA 3V9ZA 4PKGA 3K57A 3LDPA 5HRSA 3HM9A 4CVNE 3HBTA 1IBMK 5DMRA 3SBGA 3TAFA 5J2NA 3FP5A 3M8PA 4DFKA 3HSTB 4DR1K 1NJXA 5C12A 1UA1A 3O9TA 4IFVA 4BREA 1X9JA 4JI5K 1WLJA 4OX9K 1VAZA 1Q82O 1JCEA 3VGMA 3QB0A 4E19A 1NGJA 4FM0A 2ABDA 1N34K 2HOEA 3IUCA 5KTQA 3DOLA 1TV6A 4IXCA 4LF4K 3D2FA 4KV8A 4AHRA 3D45A 1KAZA 1KD1O 3WEEB 4J2AA 1EP4A 2FXUA 2VWJA 2KZZA 3CCLN 3LANA 1BQMA 4AILC 4EFHA 3SAGA 3OBYA 1QZ5A 2O8BA 2KZMA 3EL2A 3G0ZA 4YNQA 1KSPA 4E0DA 4CYEA 4P7IA 3U9DA 1BU6O 5BR8K 2Q0RA 3MAQA 3PUFA 2E2OA 4KHQA 2E8AA 4AHCA 2HNDA 5AQFA 3CCQN 4OJRA 3UKRB 3ATVA 2HHQA 1GLDG 2HE7A 3Q7CA 5AQYA 4BACA 4J2BA 1IKYA 1IG8A 4I2QA 4GKKK 1YIJN 2PYLA 5IT9O 4F9OA 1SKRA 2HHHK 3O6WA 4HWIA 2QXFA 4B8CA 4JRPA 3BGRA 3FLVA 3LPTA 1K8KA 2WC9A 4FPBA 4CZLA 3MXMA 3PVLA 2QXLA 3AVFA 4MO5A 2AA4A 1OH5A 3TAGA 2KW4A 2RE2A 2O4IA 2EMTA 3WA0A 1L3SA 4DTXA 1GLFO 4CIFA 1IH7A 1BG3A 5LMNK 2HNZA 2E1ZA 5AR0A 2P51A 1LW2A 4DG1A 4FSVA 4ELUA 5AFUH 1WN7A 1GLLO 1Q9XA 1SL1A 2B6AA 2P9IB 3U3GA 2G8VA 2P9IA 3ID8A 5CE3A 1BDGA 3R3LA 3CCUN 5AQVA 2A1SA 3LPUA 5IWAK 1MK9B 1TKTA 1FW6A 1TUYA 3UIQA 3AVIA 5AQUA 3G10A 2V7ZA 1JL1A 3QIOA 5J2PA 3X23A 5FPEA 1SL0A 1HB8A 1NKEA 4G1QA 1CXQA 4MQ3A 3SUOA 2D0OA 2Q31A 2YKMA 3AVCA 4K0KK 2UXBK 4FWNA 2P9SB 3E1YA 2R82A 5CYQA 1J5OA 3M3ZA 1JKHA 3ULEA 5JS1A 2QWLA 4ZHRA 2J4RA 4M3RA 4Z4IA 4I9QA 2IC3A 4U67L 3TSPA 4FLXA 3K0SA 2QWQA 2J0MA 4A59A 5AZIA 3SBTA 2BANA 3TTDA 1HQEA 1BI4B 3RR8A 2PBDA 4LSLA 2YNFA 3UB5A 4E3SA 2KQ2A 4FOIA 5LJVA 4CJPA 2XY5A 2J0KA 4DU3A 4B1VA 2P9NA 4X66K 2O8EB 2FSJA 2O8EA 3K9KA 3TANA 1HNXK 4Z4HA 1U45A 1NJWA 4KBOA 2V7YA 3OYIA 4IOXA 4TSXA 4YDUA 3VQBA 3L2VA 1ZBFA 4YFUA 2E4LA 4KH6A 4B1WB 3QNNA 3O80A 4Z4EA 3ZX0A 3MN9A 2D2QA 4DQPA 1U48A 4ZRJA 3GG4A 3A5OC 2XY6A 4HCCA 4FCYA 4EAHD 4PA1A 1VSKA 1E3MA 3S3MA 4CJ7A 4Z4FA 4LFAK 1BGXT 1N5YA 3ITHA 4JI0K 4V19S 2I7PA 3HVTA 4ELTA 4DQQA 4HHTA 2VWKA 3DYAA 3VF2A 3PX0A 1VQ8N 3OYNA 2JLEA 2ZJPL 1D9DA 1TK0A 3MN7A 4F2RA 4J2EA 3QEPA 4B8AB 3FZFA 1TAQA 1BO5O 1HNWK 2HRJA 3OYKA 3HI0A 5JLFA 1SGHA 3CJBA 3T1YK 2Z1IA 4AM7A 2PZSA 3PIOL 1NGDA 1VRUA 2A5XA 4B3SK 5AQPA 5LMUK 3ZT2A 2O8DA 5AQTA 3QIJA 4BRPA 4BR5A 2O4GA 1Q81O 5E84A 4WE1A 3VQ4A 1NI2A 5AQRA 4DUYK 4FL9A 3CCVN 4DU4A 3I0SA 2HSTA 3VTHA 3T69A 4YOXA 1NLVA 1MWKA 3QFUA 2QI2A 4NXNK 3GOIA 4A2AA 1ATRA 1WAFA 5GAEP 3PO4A 4CW7B 1GC6A 4DV4K 4LF9K 5KRSA 3AVBA 2CH6A 3SUQA 1I94K 4K8XA 5AZJA 2ZJRL 3AAPA 3SAHA 1TYQA 3QEVA 3PSFA 2HB5A 2FSKA 3SUNA 4U7BA 3M8SA 4DXAB 1C0MA 1XNRK 2LBBA 4ZTFA 2ZJQL 4HVJA 5FRMA 2HBKA 3JAMO 1UWBA 4DR6K 2HMPA 3NF7A 2HBMA 2QK9A 1B9DA 3HZ6A 3G71N 3HPHA 3DLGA 4OVLA 2EWSA 5F2RA 4IFYA 5EY4A 2F96A 5AJ3K 1BUPA 3S9HA 4IDKA 3HL8A 1GGOA 3NE6A 3U6FA 1VSMA 3THYA 2GEMA 5FPDA 3HXMA 3QO9A 4IEEA 3U8XA 1HUXA 2KLAA 1LAVA 2QEXN 3EPYA 1S1XA 4CZEA 4DCHA 4B1YB 2HF3A 4OKEA 1XHZA 3PIPL 1JJ2M 3A5MC 4N76A 1SV5A 4ZRKA 3K5MA 3FZKA 4BQLA 3GE1A 3ID6A 4KTZA 3M8RA 1BIZA 5D3GA 4JD2B 2ASPA 4FPAA 2ZGYA 5F1XA 1HR0K 3ZSZA 3A8YA 3HVRA 4GXBA 1KLMA 3F73A 3FZMA 5GINA 3LAMA 4F3TA 4DTSA 5BPNA 3ZETB 3CMAN 2Q3SA 3BEXA 1HNZK 1VQ4N 3ZT3A 1GLCG 1EWQA 5ELZA 4HDQA 3I0RA 2UXDK 3D2FB 3VF6A 2ZE2A 2WFBA 4F4KA 4R5PA 5BRDA 3ZX3A 3OS2A 4KREA 3Q7BA 4CFAA 5LL6Z 3CM5A 3P5JA 2VYPA 2G8HA 1K9MO 2YV0X 1RDWX 1GC7A 3EKUA 3RVCA 3KK1A 4IG0A 3E01A 4DUZK 4CEFA 4LC9B 4LY7A 4A5AA 3EEQA 4WQ5A 3WT0A 1ZXOA 1E4FT 5JVLA 3AO2A 2VQEK 4FO0A 2IGIA 3EE8A 1XMQK 1KTQA 1R0AA 1X3NA 1OH6A 1L3UA 4B9SA 2VCPA 2KFZA 4E89A 4DV0K 4CIEA 4K25A 1R59O 3KK3A 4B9LA 3E9LA 1JCFA 4QS7A 1C0TA 3ZSXA 3V9XA 1U4BA 4WCEL 1JLQA 4CEOA 5GAHP 1HPMA 5JLHA 4PY5A 5K14A 5LJWA 2D0PA 4NLBA 1KBLA 1KCFA 3K59A 3KD5E 1TK5A 3DXMA 5BPMA 3TI0A 4Z94A 1U04A 3OYJA 3TU5A 2HHUA 5FPNA 2ZWHA 1XQSC 2GWJA 3AO3A 4PL7A 1VQ5N 3U4LA 4H5RA 4E1JA 4H0PA 3O8MA 3ZSWA 1S6QA 4DSIA 3O9QA 2DTUA 4DR7K 1YI2N 4CJEA 3OJSA 4BDZA 1Y64A 1HYZA 3HPOA 3KLFA 1TYQB 4MDBA 1KLNA 3VQQA 1XWLA 4DV1K 3S3NA 4KHSA 1Z26A 4O0JA 3I55N 4K8ZA 4I9LA 3CC7N 1S22A 4DS4A 1J5EK 4H5VA 3N4PA 2P9LA 4CEZA 3THWB 2XRIA 3GDQA 2P9KB 4DR3K 1MK7B 2GV9A 4FJNA 3O08A 1RCHA 4O8KA 3V1OA 3KZBA 3CF5L 1OVQA 4QCLA 4CHQA 4IJNA 2HNYA 1S1TA 3T19A 3P31A 3CCRN 2PY5A 2QKKA 1IKVA 4FZZA 4H0YB 5HRPA 2G8WA 5GIOA 3C7NA 2X78A 2E2PA 3AA2A 3VEOA 4DQ8A 1O13A 3KWIA 3H6EA 2UYTA 1VRTA 3OYFA 3IG1A 2GTDA 3NFAA 3SQ0A 2P9SA 4KHPK 3F5TA 1SZ2A 4AHVA 1LV5A 4CJLA 3FZHA 2P9NB 2IVOA 4PKHA 4EHTA 2HHVA 4E7JA 4DFJA 2HBJA 3HRGA 3L2UA 3QFPA 1EETA 4BVOA 1C1CA 5J1EA 4DKWA 4JI7K 2VGMA 3V9UA 3CCSN 3QNOA 1BWFO 2ASOA 1WSEA 4FOEA 4J8FA 4OLBA 4YDUC 1QVGM 3NH1A 3AU5A 4H4MA 4BRNA 4FJ5A 3L4QA 2HBLA 3NVKA 3WXIA 1NJYA 4IOAL 2ZQBA 3AVHA 5JICA 1Q7YO 2O8BB 2A3ZA 1B92A 1XC3A 2BH1A 3TAMA 2NNWA 2NRVA 4BDYA 1NWKA 3DRRA 4JRQA 2FSNA 1DKGD 4LH4A 3SYZA 1RT3A 3ENHA 4JAXA 3CCEN 3O3GA 4F7GA 1IKWA 2Z1GA 4FLZA 3HSCA 3WUHA 2P5GA 4FWKA 1W97L 1JDEA 4WFNL 3ZT0A 2ZM6K 3NGIA 1W9HA 1RT2A 1RGIA 3BF1A 1S9EA 5I3UA 3LDSA 4NY0A 4CFCA 3S41A 2FBVA 2XY7A 2I5JA 1BCMA 3AVMA 1EF1A 3M8QA 4H5NA 4KB0A 2YHYA 3MK6A 1J19A 1YJ9N 5FROA 4NLCA 3TAPA 4FYDA 4FLVA 2AJQA 4H0TB 3AA3A 1JXBA 3WNEA 4FJLA 3DLKA 5AQMA 3MN5A 4JKGB 2Q2RA 2GX9A 4ID1A 3KLEA 3VF4A 2HHXA 1T44A 4Q5VA 5J2QA 1WAJA 2E5LK 4BRAA 2NRTA 1F21A 4CD1A 1UAXA 2F8TA 1X3MA 3CJ7A 3WQUA 2Q36A 4BG8A 2H3GX 4JKHA 5DM6L 3MEGA 4FWOA 2YX6A 3AV9A 4CHZA 1KVAA 4JKBA 5J2MA 1YTAA 3VESA 3MWPA 1X9WA 5CZ1A 3SUPA 3AVKA 1CZ9A 2F8SA 3AGRA 5AQLA 3AVLA 1BA1A 1HJRA 3ULEB 3OW2M 4DSKA 1E5WA 1KAXA 3RMCA 3O9RA 4HTLA 2HVIA 3CCMN 1BISA 3PY8A 5KI6A 3WNGA 3RR7A 1HBKA 1HNVA 2NRZA 4CBWA 4MLHA 3THYB 4ISEA 4BY9C 4LF6K 4ISGA 2F9TA 2FBYA 1NK0A 1J6ZA 5BPLA 1S6PA 1DTQA 5AQHA 3VQ9A 3SI6A 2OPRA 2VGNA 4WQ5C 3THXA 4BE2A 5EXWA 3LP2A 3L2QA 1SKSA 4CE9A 2HVHA 4NYNA 4PHTX 4N47A 4OPHA 4H03B 3K5OA 4FVMA 3ZSYA 4Z4CA 3DI6A 4WFBL 1N8RO 1VSLA 4FW1A 4ZTJA 5TKYA 3CMEN 3ZSRA 1T03A 5AQOA 3VQ6A 1CZBA 3L4IA 4YL8A 3KK2A 4JKFA 3L2WA 1JLEA 3KTQA 4JD2A 1BOTO 4GVMA 4JKDA 1SQKA 1ATSA 2P9UB 2GWKA 2P9UA 1YITN 1NGHA 2HHTA 1T8EA 4IO8A 3AVJA 5AQWA 3B6OA 1EKEA 4YHHK 4DTUA 4DWIA 3OBWA 2W6KA 1ASVA 4HCBA 4BROA 2WTUA 1IV0A 1HJOA 1VQLN 4OGCA 1S5JA 3CFRA 3O1BA 4AQYK 4RW4A 2YCHA 4KHNA 4IEIA 3UKUB 1G99A 4C8NA 1U47A 4H0OA 3DRSA 3VQ8A 4CGIA 1ASUA 4I2PA 3PX4A 1B9FA 2QWNA 4JYAK 3MCPA 4CHNA 3CQXA 5CZ2A 4CCHA 4OO1J 1RBVA 4E7HA 4DQSA 3NH0A 1ITGA 1ILYA 3GBTA 4FWPA 4CEQA 1VSDA 1KVBA 2E6LA 4JI6K 2UUBK 5GIPA 2Q0UA 3W3DA 1LOTB 2O8FA 3LAKA 3ENOA 3KJVA 2D0CA 3T7ZA 3LZJA 2UXCK 4JI2K 4XH5A 4CJFA 3SJHA 4LFBK 4A2BA 2YHBA 5BN9A 3QIPA 3IDHA 2A42A 2IIRA 3CC2N 3VEVA 3FR0A 4KKOA 4C8LA 3FFIA 5BRFA 1N36K 4FM2A 4CF2A 4FZYA 4H0XB 3K58A 3CJ1A 4B9TA 2OTJN 3A5LC 3QBXA 5M1KA 3HT3A 3HM8A 2E6MA 2R7YA 1WSFA 4RW6A 5ADXA 4OGEA 4ID5A 1QS4A 3DXMB 3LP0A 3BF3A 3HPGA 5SWMA 4L8RB 3IAYA 5BN8A 2WH5A 3C6HA 3CQYA 4YORA 5GAGP 1YXQA 3H08A 4CBUA 3KHYA 4CZHA 2RHKA 3VQEA 1HQUA 5M1OA 1HRHA 5E26A 1MIZB 4FW2A 1LCUA 4N56A 1CZAN 1Q9YA 4GKJK 1QSYA 1K73O 4M63C 3B6PA 4FLUA 5KPTA 1P8ZA 3M6GA 4JS5A 3C0BA 3AA5X 3C7NB 4CEAA 4CGGA 5M1QA 2YKNA 1EXQA 4X65K 1HKBA 3IRXA 3H1VX 5C2DA 4X62K 3AO4A 4CK2A 4IO9L 3J7ZO 3THVA 3PLAA 1VBHA 2EHGA 4DSEA 3I8DA 4CI6A 4LH5A 4H0VB 4CZFA 4IOCL 3V1QA 3VGLA 3M5RA 4B9MA 2CGKA 3DRPA 1XUPO 5AQNA 3ZT4A 4DR5K 3QEWA 1SUQA 1T6DA 1WSIA 4H8KA 3MWTA 4WF9L 3SV4A 2EX3A 3E9PA 1NMDA 2E1YA 4QS8A 4A61A 1RDAA 1KFDA 4KH4A 4NB4A 1VQKN 4BRFA 3SPYA 1J53A 3OYCA 3AU4A 3H3NO 4NCAA 3QESA 4FLWA 3D6RA 3MEDA 3CI5A 1SS6A 3WXMB 1D4XA 2HHWA 1XI1A 1IBKK 4C8KA 5CR4A 5C0YA 1ZBIA 5KPZA 4JI8K 3L2RA 1IG9A 3O9UA 3C94A 1A5VA 3VEWA 3CETA 4MDAA 4W5NA 3VQAA 4FK2A 1VQ9N 3TSUA 2FF6A 2D0AA 3VA0A 3O4WA 3V4IA 1C6VA 3SNNA 1L5UA 1T6CA 2DFHA 3WEEA 1JLGA 1XMOK 3OA9A 4RW8A 4BWJA 3HOTA 5HLFA 3D2EA 5E41A 3BY5A 5AQIA 2YHXA 2FC0A 3VQDA 2YNGA 3ZSOA 2IOCA 3JYTA 4DSJA 1Q18A 2Z1JA 3CQ8A 4BRMA 1LWFA 1RT6A 4RW7A 2VG7A 3CC4N 1QTMA 3TAEA 4RW9A 3TTFA 3TR8A 1J9AA 3MXIA 4DSFA 4M7YA 2O8FB 3VERA 4W5QA 2IVPA 2XHBA 4CHYA 3BP8A 2VG6A 4AF1A 1EX4A 2ZGZA 5HRRA 4C8OA 4DFMA 4DV2K 4BWMA 4NXMK 4CZGA 1NG9A 3LDNA 4CEEA 4Z4GA 5T7BA 3WXKA 1QSSA 3IKMA 4CJVA 2QWRA 3OJUA 1KC8O 1VQ7N 4BRGA 4JI1K 2DY4A 3K2PA 2IAJA 2AP1A 4R79A 1G15A 1OKJA 1TKXA 1NK4A 1H4RA 1DLOA 1N32K 4DV7K 5F0XA 1C0FA 4K41A 3MCAB 2PAVA 4BR2A 3SQ1A 2RF2A 1A5WA 3MX2A 4FJJA 3AO1A 3K9JA 2BGGA 2Y1JA 1D5AA 5EX5A 2G8UA 4MFBA 4FJXA 3LZIA 4KTWA 4NCBA 4FXDA 3NF6A 3A2FA 3UE5A 3G9WA 3OYBA 3ALYA 3SQ2A 3O9SA 2V52B 1QSLA 1RTDA 3IFRA 5LY3A 2DIKA 3O5BA 4FJ7A 1QQMA 3BZCA 3T3FA 4GV3A 4A5BA 1TVRA 3OVNA 2O8CA 2ASMA 2Y1IA 4BG9A 4JV5K 3SQ4A 5I9EB 2D1KA 4K43A 3MXJA 1NGGA 5I42A 4GY2B 1JL2A 1WBDA 3ZEUA 2BTFA 1S9GA 3EZWA 1RDUA 4E7IA 3WQTA 3O4QA 4BRKA 4F8RA 1HKCA 2A1RA 3OYHA 4C8MA 1ZC6A 3DJCA 4IBNA 1NKCA 3QDKA 4B9VA 3TWHA 4AHTA 4KH5A 3OYAA 3AARA 1SAZA 5C10A 1ISNA 3CHWA 1ZBUA 1NJIO 3RWUA 5GADP 3SK3A 3C95A 3CJ9A 5AQGA 4DB3A 3WXJA 1Z05A 4AM6A 3CPEA 3JS6A 1U2VB 4YOUA 4E1NA 3P38A 2HF4A 3PX6A 4KI6A 1GLEG 3THXB 1HYSA 4A57A 3FE1A 4BGAA 1MA9B 1ATNA 3ZSVA 5AQJA 3L0QA 4OPJA 2B5JA 1QHTA 2P5OA 3KKRA 1RBUA 1RT1A 4CEBA 4QS9A 4B9QA 4JKCA 2WOMA 4O5BA 1YUWA 3ZLJA 4HUGA 2W42A 4UY8O 2IDOA 3J80O 1BCOA 1RTIA 4CFDA 1VQNN 2X6NA 2HHSA 3E66A 2OZSA 1NTIA 4EKUA 1RT7A 4JN4A 1SL2A 3DLHA 1ST7A 1NU0A 3EO3A 3L6QA 4IWVA 3B8AX 3AGKA 1L3TA 2UUAK 5H1SQ 3VA3A 1RTHA 3HYFA 3OS1A 4YOYA 3AVNA 1E4GT 2COPA 2G8KA 3VEZA 2E2QA 4HUEA 3SLCA 4ILHA 3G4SN 1TKDA 4O0IA 2ATQA 5HRNA 4BR9A 4CEDA 1IKXA 3W0LA 4I6MB 4BRHA 1OH7A 3RMAA 4CESA 4O44A 1VSEA 4DTMA 3CCJN 3MECA 2E88A 2CB8A 1S72N 2ZD1A 4JI4K 4B3OA 3DOKA 3TSQA 1FKOA 1HNIA 1NOYA 2Z1HA 4B1XB 1VQON 4FJ8A 2AL6A 2O8DB 2YJEA 4Y1DA 1LWEA 4JK8A 2ITMA 3QMLA 3A5NC 3NF8A 4W5OA 4CJKA 1YF5L 3LDOA 1JLBA 5KGWA 4NCGA 1WSJA 3NCIA 1S3XA 3U8ZA 2DPNA 3RSEB 3OHRA 5CHIA 3CFPA 3HP9A 4BRQA 4KPYA 1W0HA 4B9NA 5CY4A 1I3AA 1NGEA 4M42A 1HYVA 4CZJA 2VWBA 4RG8A 3VEYA 5KRTA 4BE1A 4DTPA 4CJ3A 1D9FA 3VMFB 5HBMA 3ZX2A 3VQ7A 3H1QA 4IDHA 3OY9A 4C23A 3U3YA 4BRDA 2NZTA 2YNIA 3KLIA 4O8UA 3C6TA 4CF0A 4BRIA 1GOBA 3V6DA 1KAYA 2UU9K 4GMJB 2GUPA 2FF3B 4FLYA 4KTQA 2G8FA 2A6AA 1CXUA 4DF8A 2P9LB 4CGJA 3NBPA 4FK0A 4BQZA 2NRWA 4DQRA 4J2DA 3HTVA 3QLHA 4WYBA 1QQNA 5AFUA 5TKWA 1WNSA 2YHAA 3DLLL 2I7NA 2NUBA 3FZLA 2IVNA 1WOQA 5BRHA 4DTNA 1BI4A 3CJCA 3ZYYX 3TABA 4UQGA 2I1KA 4OKJA 2ZPYA 1TAUA 1U49A 4RWTA 1MIXA 3QICA 4M3TA 4RCHA 5C25A 1TKZA 2E20A 1NJZA 4DU1A 5AQQA 3VN5A 4M3ZA 1ACAA 3H45C 3HO1A 3J7AP 3HP6A 4JK9A 1N6QA 3G25A 5BR9A 4EP4A 5MLCQ 4L3QA 2V51B 3VTIA 1YJWN 2D4WA 3AY9A 1FKPA 5AQSA 1DIKA 1KFSA 4ILJA 3NAEA 5HROA 3UKUA 4DLGA 1XNQK 3SPZA 2OTLN 4CK3A 5KGXA 3AA4A 5KPRA 5M1NA 1VQPN 1C0GA 3BUZB 3OTOK 4OPKA 2OCEA 4CJTA 2OPQA 4W5TA 4BR4A 3VPZA 3SZ2A 4JK7A 3RRGA 4PQUA 4JHDB 4CF8A 1I39A 2KTQA 3RMDA 4AHUA 5SZTA 4Z0UA 4BC5A 1HPZA 4BC4A 3LP3A 3P39A 2NRXA 4CK1A 4AHSA 4YY3K 4CBXA 1Q86O 1NGCA 1WSGA 5KQ8A 3EKSA 4GV9A 1Z25A 3AO5A 1YTUA 5FLXO 4EIAA 1HX1A 3JXUA 1ZYQA 1Z6RA 4KHWA 4CHOA 4Y0WA 4I7FA 4JKAA 2D5RA 3WNHA 2QKBA 4BDPA 1YAGA 4CZKA 2UUCK 3CG7A 4DTOA 5C2FA 3BZKA 4KHUA 2RN2A 4B1UB 4F2SA 4FVUA 5JMVA 1NNEA 3PV8A 2YNHA 2YVCA 4Y1CA 1NK7A 4CJRA 1CLQA 4H5WA 2WUSA 3WNFA 1ZBLA 1W2BM 3U7DA 5JVHL 1LWCA 2FBXA 4JEPA 1BL3A 1NGAA 1BA0A 3MN6A 3RSEA 4PL8A 5EVZA 1RFQA 3C6AA 4DF4A 5EOYA 3KD1E 3BINA 2ZF5O 1EO1A 2JGUA 1JLAA 2OZMA 1EWRA 3M1FA 4XEIA 3NDKA 3FGUA 1RDCA 3EE9A 4DTRA 3ATUA 3DXKA 3LM9A 1JXEA 1VK0A 3QETA 4LFCK 2YI1A 1M1KO 2A40A 1TGOA 4CJ4A 4DQIA 3LM2A 3VETA 4JKEA 2X6SA 4GNIA 1MWMA 5CYMA 1RDDA 4HDOA 4CF1A 3J7YP 3O3HA 1JLCA 4FWLA 4HUFA 1GOAA 3PZDA 5JS2A 3ISNC 4FZXC 3PO5A 4BRCA 3THWA 2XO7A 2GUIA 3DAWA 1DGKN 2P9KA 4EZ9A 1T05A 3SCXA 3VQPA 3LDLA 1IJJA 1ZBSA 3OYLA 2ETJA 4YOTA 2FDQA 2OA8A 2QTDA 3JSMA 4Q0BA 2W40A 5AQXA 1T7PA 4M7XA 2PYJA 1YT3A 1NK6A 3CYMA 1D8YA 3CIPA 1KRPA 4DV6K 3KKSA 4DSLA 3QEXA 1NK5A 3R9PA 1QZ6A 1MDUB 2FBTA 3V9SA 3DMJA 3R6MA 4E1MA 4W5RA 1U2VA 4NO7A 1WB9A 1DEJA 2KKZA 1VHXA 3CD6N 5HP1A 1QQOA 2A41A 1XC9A 4FJKA 2AEHA 3C6UA 4FJMA 4DR2K 1OVYA 4IKFA 3NH2A 3QINA 3KLGA 3ZETA 3IVFA 1S1WA 4LD0A 3EZ5A 4FJ9A 3C65A 3CFOA 3T1AA 1NMNA 4WQ4C 1S1VA 4JNEA 3ENBA 1J54A 2E2NA 5AQKA 3J81O 2RKIA 4N5SA 1TL3A 1C0UA 4C1NI 3TARA 4CECA 4JI3K 1HKGA 4ISFA 1NK8A 3D7EO 2EMSA 5HL7L 4DTJA 3RTVA 4M45A 2VQFK 4LF7K 3F9KA 1BQNA 1VBGA 5C24A 1FXXA 3DLBA 3UKRA 3VQ5A 3U9ZA 3OS0A 3MDQA 2F7TA 5FRNA 3TPQA 4K42A 4KO0A 4ELVA 1K6YA 1TK8A 3DLRA 4M3WA 4CFBA 3WXLA 4LF8K 1X9MA 3LWMA 1EQYA 3ASMA 1VQ6N 3VOVA 4PUOA 1QE1A 4GW6A 2CGLA 3D2EB 2GBZA 4AH9A 4OLAA 1QQCA 1HLUA 4BR0A 1YJNN 1IO2A 4B3TK 1LW0A 4CIGA 4QAGA 2WONA 4O55A 3EY1A 5AQZA 4BGBA 1ESVA 5A2QO 3SAFA 4LF5K 2CGJA 1H1VA 4DS5A 2J0JA 1WBBA 1NVLA 1HMVA 2RPIA 3RRHA 1Y19B 3E9OA 1RBSA 3HOSA 4JKGA 5BREA 4BC3A 4CJ5A 1WSHA 5KQDA 1DT9A 4FJHA 3O3FA 2HMIA 1YVUA 3L3VA 2BE2A 3IS9A 3VQCA 5DM7L 3LP1A 4FJIA 1UA0A 3ULDA 4O4GA 3PSIA 4RTFD 4TKNA 3CERA 3KK7A 2HW3A 3P4IA 1V4SA 1Y97A 5HOOA 1S1UA 2PFUA 2QW9A 3I8BA 1T3VA 4KFBA 3TTCA 1OH8A 3K5NA 1VQMN 2P9PA 2P9PB 3S3OA 3KVGA 3SMSA 4X64K 3EYZA 1QVFM 1TL1A 2OPSA 1O1WA 3F9MA 4N41A 1YVNA 4DMNA 3ZSQA 1NK9A 4MO4A 4CD3A 2G8IA 3FFKB 4IZ9A 1RT4A 2FJ9A 4CZIA 5C42A 4KRFA 1X1PA 4IG3A 2LSNA 5FPMA 3TAQA 3AAQA 3DM2A 3MMVA 4CGHA 4BR7A 1RT5A 4ICLA 4M41A 4PWDA 4DFPA 1UOCA 2NRHA 1GLJO 2QA4N 2B4JA 2QWMA 2JWLA 2FLOA 2BDPA 2NRRA 4CGDA 3SV3A 4E7KA 4OKKA 2VG5A 3R8EA 4H4OA 2W6LA 3V1RA 3H46O 4ZRIA 3A0IX 3RMBA 3GL1A 1TUUA 4KI4A 1RILA 3P1GA 2YHWA 3ZT1A 4M3UA 1RDBA 4CERA 1ASWA 3SMPA 4FWQA 3VGKA 1NM1A 5DK5A 2IS3A 4LSNA 5AZIB 4KB1A 1M90O 3DWLA 4PKIA 2KFNA
chains in the Genus database with same CATH topology
1N8RO 2ITMA 3QMLA 3A5NC 1NI2A 5TKYA 3CMEN 1YHQN 5AQRA 1YF5L 4FL9A 3LDOA 4BC2A 3CPWM 3CCVN 4IJAA 2HSTA 5AQOA 3VTHA 3L4IA 3T69A 1S3XA 4YL8A 3U8ZA 1NLVA 2DPNA 1MWKA 3RSEB 3VENA 3OHRA 4FWSA 4JKFA 4YOXA 5CHIA 4FWRA 3QFUA 2QI2A 4BRQA 3GOIA 4JD2A 4A2AA 1BOTO 4ILGB 1ATRA 2CH5A 1V4TA 4JKDA 1SQKA 5GAEP 1ATSA 1GC6A 2P9UB 2GWKA 2P9UA 4XH4A 1YITN 1NGHA 1NGEA 1K8AO 4IO8A 5AQWA 2WBNA 2VWBA 4CZJA 2CH6A 1QHAA 4MLEA 3VEYA 3OBWA 5AZJA 2QWOA 3EN9A 4BROA 3VMFB 2BUPA 3AAPA 3ZX2A 4A62A 1TYQA 3SAHA 2ZJRL 3H1QA 2FSKA 1HJOA 4IDHA 1VQLN 4C23A 4BRDA 2NZTA 1KC7A 4U7BA 3O1BA 4O8UA 4G9ZA 2YCHA 4DXAB 4BRIA 1KAYA 4BRLA 4C1NK 2LBBA 4IEIA 2GUPA 3UKUB 2FF3B 1G99A 1HB6A 1GLAG 4H0OA 2ZJQL 2A6AA 2HBKA 2P9LB 3CJAA 3VEXA 4OPAA 2HMPA 2YJFA 3KWGA 3ZDTA 5M1PA 2I1JA 2HBMA 4BQZA 1U6ZA 2NRWA 3HZ6A 3MX5A 3CXCM 3G71N 3HTVA 3LDQA 4H5TA 4WYBA 1QQNA 5AFUA 2EWSA 5F2RA 2QWNA 5EY4A 3MCPA 5TKWA 3CQXA 3QBWA 5B8HA 3DLLL 2D10A 2I7NA 1BUPA 3NVMA 4JHDA 3FZLA 1GGOA 4OO1J 1NGBA 2IVNA 1WOQA 1ILYA 2D11A 2GEMA 5FPDA 2KHOA 4EHUA 5BRHA 2W41A 4IEEA 3U8XA 1HUXA 3GBTA 2F9WA 1GG3A 2KLAA 3CJCA 4FWPA 3EPYA 3ZYYX 4CZEA 4DCHA 4B1YB 2QEXN 1WUAA 2HF3A 3NMUA 4YOWA 3J8AA 3PIPL 3A5MC 1JJ2M 5GIPA 2Q0UA 2I1KA 3W3DA 3G6EN 2ZPYA 4ZRKA 1LOTB 3F2KA 4I6MA 3FZKA 3ENOA 1NGFA 4BQLA 3GE1A 3ID6A 3T7ZA 3O1WA 1MIXA 4JD2B 4RWTA 2ASPA 3QICA 4XH5A 3SJHA 4RCHA 4A2BA 4FPAA 4XH1A 2ZGYA 2E20A 5F1XA 5BN9A 1NGIA 3IDHA 2A42A 2IIRA 5AQQA 3CC2N 3VEVA 1K8KB 2NLXA 3A8YA 3FR0A 4GXBA 5BRFA 1ACAA 3H45C 3FZMA 5AZJB 4H0XB 2CQUA 4JK9A 3G25A 5BR9A 3CJ1A 5GINA 2OTJN 3A5LC 3QBXA 5MLCQ 2X0SA 5BPNA 4L3QA 5M1KA 2V51B 3HM8A 3VTIA 1YJWN 2D4WA 3ZETB 3CMAN 5ADXA 3AY9A 3BEXA 5AQSA 3DXMB 1VQ4N 1DIKA 3I56N 1GLCG 1GLBG 5ELZA 5C15A 3LL3A 3BF3A 5M1FA 4HDQA 4ILJA 4FWMA 3UKUA 3D2FB 3VF6A 2Q97A 2WFBA 5BRDA 3ZX3A 3Q7BA 2OTLN 4GVEA 5BN8A 2WH5A 4CZMA 5KPRA 5M1NA 1VQPN 3C6HA 3CQYA 4YORA 5GAGP 1C0GA 3BUZB 2RQ1A 1YXQA 2VYPA 4CBUA 5JVGL 1K9MO 3KHYA 4CZHA 2RHKA 1NBWA 1RDWX 4BR4A 3VPZA 3DXKB 4JK7A 4IFEA 4O5FA 4B1ZA 5M1OA 4JHDB 1GC7A 1MIZB 5E26A 3H3OB 1LCUA 3EKUA 3RVCA 1KQSM 4BC5A 4BC4A 1CZAN 3P39A 2NRXA 4LC9B 2QM1A 3I33A 5IJMA 2OANA 4M63C 4CBXA 4A5AA 1NGCA 1P90A 5KPTA 5KQ8A 1P8ZA 2Q1NA 3EKSA 4WQ5A 1ZXOA 3WT0A 1E4FT 5JVLA 3M6GA 3C0BA 3C7NB 4GV9A 1KXPA 4FO0A 5M1QA 4BVPA 1HX1A 3EE8A 4EIAA 4WFAL 2GELA 3JXUA 1HKBA 1Z6RA 4GV6A 1X3NA 4Y0WA 3H1VX 2VCPA 4JKAA 2JWKA 5C2DA 4IO9L 4K25A 1R59O 3J7ZO 1YAGA 1JCGA 3PLAA 4CZKA 3E9LA 4YOVA 1JCFA 1VBHA 3R1XA 4DHYA 4QS7A 2QWPA 5C2FA 4CI6A 3FLCO 3ZEUB 4H0VB 4WCEL 5GAHP 4B1UB 4CZFA 4FVUA 3N4QA 3IMXA 5JMVA 4IOCL 1HPMA 5JLHA 3VGLA 5ADXH 3M5RA 5LJWA 2D0PA 2CGKA 4NLBA 1XUPO 5AQNA 1KBLA 4WQ4A 2YVCA 1T6DA 3MWTA 4WF9L 4H5WA 2WUSA 1W2BM 3U7DA 4PKGA 5JVHL 3LDPA 4JEPA 3DXMA 3E9PA 5BPMA 5HOOA 1NGAA 3HBTA 1BA0A 1NMDA 2E1YA 3MN6A 4Z94A 4QS8A 3SBGA 4A61A 5E84A 3TU5A 5FPNA 4PL8A 3RSEA 5EVZA 4KH4A 2ZWHA 1XQSC 1RFQA 3C6AA 4NB4A 2GWJA 4BRFA 4PL7A 1VQKN 1VQ5N 3FP5A 5EOYA 3BINA 2ZF5O 3U4LA 3AU4A 1EO1A 4H5RA 3H3NO 4E1JA 4H0PA 5C12A 3O9TA 3M1FA 3D6RA 4XEIA 3FGUA 3O8MA 3EE9A 3CI5A 4BREA 1SS6A 1X9JA 3WXMB 1D4XA 3ATUA 3HOSA 3DXKA 3LM9A 5CR4A 5C0YA 2YI1A 3O9QA 5KPZA 1M1KO 1VAZA 2A40A 1Q82O 1JCEA 1YI2N 3O9UA 3VGMA 3QB0A 3VEWA 1NGJA 1Y64A 3LM2A 3CETA 1TYQB 4MDBA 4MDAA 3VETA 2ABDA 4JKEA 2HOEA 3IUCA 4GNIA 1MWMA 1VQ9N 3I55N 4HDOA 4IXCA 3TSUA 3D2FA 2FF6A 4FWLA 3O4WA 3CC7N 1S22A 3PZDA 4H5VA 1KAZA 4BRCA 1T6CA 1KD1O 3N4PA 2P9LA 3WEEA 3DAWA 3GDQA 1DGKN 2P9KB 3WEEB 2FXUA 2P9KA 3OA9A 3CCLN 1MK7B 3HOTA 3O08A 3D2EA 4EFHA 3SAGA 4O8KA 3OBYA 5AQIA 1QZ5A 2YHXA 3KZBA 3CF5L 3EL2A 3LDLA 1IJJA 4IJNA 1ZBSA 4CYEA 3P31A 4P7IA 4YOTA 1Q18A 3U9DA 2FDQA 1BU6O 3CCRN 2QTDA 2Q0RA 4BRMA 2E2OA 2W40A 2E8AA 4H0YB 5AQXA 4M7XA 5AQFA 3CCQN 3CIPA 3UKRB 5GIOA 3CC4N 3C7NA 3ATVA 3TTFA 2E2PA 3VEOA 1GLDG 2HE7A 3Q7CA 1O13A 4DQ8A 5AQYA 3KWIA 4M7YA 3H6EA 2UYTA 3VERA 1IG8A 3R9PA 1QZ6A 1MDUB 2IVPA 1YIJN 4F9OA 3R6MA 2GTDA 5BREA 3BP8A 2P9SA 1U2VA 4NO7A 4AF1A 3O6WA 1DEJA 4HWIA 2ZGZA 2KKZA 3F5TA 3FLVA 1SZ2A 3CD6N 1QQOA 2A41A 3FZHA 1K8KA 2P9NB 2IVOA 4PKHA 2WC9A 4FPBA 2AEHA 4CZGA 4EHTA 3LDNA 4CZLA 3PVLA 2HBJA 2QXLA 4MO5A 1OVYA 2AA4A 3WXKA 2RE2A 3HRGA 3IKMA 2EMTA 3WA0A 2QWRA 3QFPA 1KC8O 1VQ7N 1GLFO 3ZETA 3IVFA 4BRGA 4BVOA 4DKWA 1BG3A 3C65A 2VGMA 3CCSN 4WQ4C 1BWFO 2AP1A 4JNEA 2ASOA 3ENBA 2E1ZA 4FOEA 5AR0A 4J8FA 4R79A 1OKJA 1Q86O 4YDUC 2E2NA 1QVGM 3AU5A 5AQKA 4BRNA 1H4RA 3L4QA 4C1NI 4FSVA 2HBLA 5F0XA 3WXIA 3NVKA 4IOAL 1Q81O 1C0FA 5AFUH 4K41A 1HKGA 2PAVA 3MCAB 4ISFA 4BR2A 5JICA 3MX2A 1Q7YO 3K9JA 3D7EO 2EMSA 1GLLO 2A3ZA 5HL7L 5EX5A 2P9IB 2P9IA 1XC3A 2BH1A 3ID8A 5CE3A 1BDGA 2NNWA 2NRVA 3R3LA 5AQVA 3UE5A 1NWKA 3CCUN 3G9WA 1MK9B 1TUYA 3O9SA 2V52B 5AQUA 2FSNA 1VBGA 1DKGD 3IFRA 5LY3A 2DIKA 3ENHA 4JAXA 2V7ZA 3O5BA 3UKRA 1QQMA 3U9ZA 3MDQA 3X23A 2F7TA 3TPQA 4K42A 5FPEA 3CCEN 1HB8A 4GV3A 3WXLA 4A5BA 4F7GA 3HSCA 3WUHA 4FWKA 2ASMA 1W97L 1JDEA 4BG9A 2D0OA 2Q31A 4WFNL 1EQYA 1VQ6N 3VOVA 5I9EB 2D1KA 2P9SB 4FWNA 1K73O 3E1YA 2R82A 2CGLA 1RGIA 3D2EB 4K43A 3BF1A 1NGGA 4GY2B 3M3ZA 4NY0A 1HLUA 3S41A 2BTFA 3ULEA 3ZEUA 4BR0A 1YJNN 2QWLA 1RDUA 3EZWA 2J4RA 3WQTA 1EF1A 4BRKA 4H5NA 4U67L 1HKCA 2YHYA 3MK6A 3TSPA 1J19A 1ZC6A 3DJCA 5AQZA 4BGBA 1ESVA 3SAFA 1YJ9N 4NLCA 2CGJA 3QDKA 1H1VA 2QWQA 2J0MA 4A59A 2J0JA 5AZIA 4KH5A 3SBTA 3AARA 1SAZA 5C10A 1NVLA 1ISNA 3TTDA 3CHWA 1NJIO 4H0TB 5GADP 3SK3A 3CJ9A 5AQGA 4DB3A 1Y19B 2PBDA 3WXJA 1Z05A 3E9OA 3MN5A 3CPEA 5AQMA 4JKGA 3UB5A 3JS6A 4AM6A 1U2VB 4JKGB 4BC3A 2Q2RA 4FOIA 4YOUA 1DT9A 2GX9A 5KQDA 5LJVA 3P38A 2HF4A 2J0KA 4B1VA 2P9NA 3VF4A 1T44A 1GLEG 5DM7L 2FSJA 2NRTA 4BRAA 4CD1A 3K9KA 4KBOA 4RTFD 4TKNA 1X3MA 2V7YA 3CERA 3KK7A 3CJ7A 1V4SA 3P4IA 4IOXA 3FE1A 3WQUA 4A57A 4BGAA 1MA9B 1ATNA 2PFUA 2QW9A 5AQJA 4YDUA 3L0QA 2Q36A 4BG8A 2H3GX 4JKHA 1T3VA 3I8BA 3TTCA 5DM6L 4FWOA 2YX6A 4KH6A 4B1WB 1VQMN 3O80A 2P9PA 2P9PB 4JKBA 4QS9A 3KVGA 3VESA 3SMSA 3MWPA 3ZX0A 3MN9A 2D2QA 4B9QA 4JKCA 4ZRJA 1QVFM 3GG4A 3A5OC 3AGRA 3F9MA 4EAHD 1YVNA 5AQLA 1YUWA 4MO4A 1BA1A 4UY8O 4CD3A 4CJ7A 3ULEB 1VQNN 3OW2M 1E5WA 1KAXA 3FFKB 3O9RA 3E66A 4HTLA 4IZ9A 3CCMN 1NTIA 4EKUA 2FJ9A 4JN4A 4CZIA 1ST7A 2I7PA 3EO3A 3L6QA 5FPMA 3AAQA 1HBKA 4IWVA 3B8AX 3MMVA 2NRZA 4BR7A 3AGKA 3VF2A 4CBWA 5H1SQ 1VQ8N 4MLHA 4ISEA 2NRHA 1GLJO 4YOYA 2ZJPL 2QA4N 1E4GT 2COPA 4ISGA 4BY9C 3MN7A 2F9TA 2QWMA 2JWLA 1J6ZA 2FLOA 5BPLA 2NRRA 2E2QA 3VEZA 3SLCA 4ILHA 3G4SN 5AQHA 3R8EA 4BR9A 3FZFA 3W0LA 3H46O 1BO5O 4ZRIA 2VGNA 3A0IX 4I6MB 2HRJA 4BRHA 3HI0A 4WQ5C 5JLFA 3GL1A 1SGHA 1TUUA 3CCJN 3CJBA 5EXWA 2E88A 2CB8A 2YHWA 4AM7A 1S72N 3PIOL 1NGDA 2A5XA 3TSQA 4PHTX 4OPHA 5AQPA 4H03B 4B1XB 1VQON 3SMPA 2AL6A 4FWQA 3VGKA 2YJEA 5AQTA 1NM1A 5AZIB 3QIJA 4WFBL 1M90O 4BRPA 4BR5A 3DWLA 4JK8A 4PKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILH A;  3E9P A;  4JKE A;  4JKA A;  3E66 A;  3SBG A;  3SBT A;  4JKF A;  4JKH A;  4JK9 A;  4JK7 A;  3E9L A;  4ILG B;  3E9O A;  4JKG A;  4JKB A;  4JKD A;  4JKG B;  4JKC A;  4ILJ A;  3ENB A;  4JK8 A; 
#chains in the Genus database with same CATH topology
 2OPP A;  4DV5 K;  3NGY A;  3T1H K;  1N33 K;  1YHQ N;  4QOZ B;  4BC2 A;  3LWL A;  3CPW M;  3QER A;  1BHL A;  4IJA A;  1REV A;  4CJQ A;  3VEN A;  4FWS A;  4FWR A;  3KLH A;  4ILG B;  1RNH A;  1C1A A;  2DFF A;  2CH5 A;  1Q8I A;  1V4T A;  2DFE A;  3NHG A;  3OYE A;  4KAZ A;  4XH4 A;  4JS4 A;  1K8A O;  4EZ6 A;  2WBN A;  1W7A A;  1L3V A;  3AVG A;  5EU7 A;  4JLH A;  1QHA A;  1LAW A;  4MLE A;  1NKB A;  2QWO A;  3K5L A;  3EN9 A;  1A5X A;  2BUP A;  4A62 A;  1C1B A;  4E7L A;  1KC7 A;  1VSI A;  4G9Z A;  3P83 D;  4BRL A;  4B3R K;  4C1N K;  1NOZ A;  1DTT A;  1HB6 A;  1GLA G;  3CJA A;  1GOC A;  3CM6 A;  4OPA A;  3VEX A;  2YJF A;  3KWG A;  3ZDT A;  5M1P A;  2I1J A;  4B3M K;  1VSF A;  3CXC M;  1U6Z A;  3MX5 A;  3V9W A;  3LDQ A;  4H5T A;  5FDL A;  5B8H A;  3QBW A;  2D10 A;  3NVM A;  4JHD A;  3AVA A;  4M3Y A;  4DLE A;  1NGB A;  3NF9 A;  3OYG A;  2D11 A;  1X9S A;  2KHO A;  4EHU A;  2W41 A;  2F9W A;  1GG3 A;  3V81 A;  1WUA A;  1ZBH A;  3ZCM A;  3J8A A;  4YOW A;  3NMU A;  2D0B A;  3G6E N;  3F2K A;  4I6M A;  1NGF A;  4B9U A;  3KIO A;  3MEE A;  4KHY A;  1FJG K;  3O1W A;  4FK4 A;  4CF9 A;  4XH1 A;  3L8B A;  1NGI A;  1VSH A;  1K8K B;  2NLX A;  4CGF A;  3SJJ A;  5AZJ B;  2CQU A;  4FM1 A;  2X0S A;  1RTJ A;  1VSJ A;  1SKW A;  4EP5 A;  4CHP A;  3I56 N;  1GLB G;  4CJW A;  5C15 A;  4FJG A;  3LL3 A;  3NGZ A;  4NYF A;  5M1F A;  2F4V K;  2OYQ A;  4FWM A;  1IBL K;  2Q97 A;  4FLT A;  1RBR A;  3BDP A;  1BIU A;  4GVE A;  1KVC A;  4CZM A;  2RQ1 A;  5JVG L;  1NBW A;  1FK9 A;  3DXK B;  4IFE A;  4O5F A;  4B1Z A;  3OYD A;  4BE0 A;  2ITG A;  2XY8 A;  4M3X A;  3HK2 A;  3H3O B;  1KQS M;  3O4N A;  3D0P A;  3HJF A;  3LAL A;  2QM1 A;  4CJS A;  3I33 A;  5IJM A;  2OAN A;  1P90 A;  2Q1N A;  4F3O A;  1JLF A;  4CJU A;  1KXP A;  2X74 A;  4B08 A;  4XIU A;  3QEI A;  4BVP A;  4WFA L;  2GEL A;  3L3U A;  4GV6 A;  1MU2 A;  2O8C B;  3DLE A;  2JWK A;  3OYM A;  1JCG A;  4DV3 K;  4YOV A;  4DR4 K;  3R1X A;  4DHY A;  2QWP A;  3FLC O;  3ZEU B;  4HTU A;  3N4Q A;  3IMX A;  1XHX A;  5ADX H;  2P1J A;  4WQ4 A;  1RBT A;  3V9Z A;  4PKG A;  3K57 A;  3LDP A;  5HRS A;  3HM9 A;  4CVN E;  3HBT A;  1IBM K;  5DMR A;  3SBG A;  3TAF A;  5J2N A;  3FP5 A;  3M8P A;  4DFK A;  3HST B;  4DR1 K;  1NJX A;  5C12 A;  1UA1 A;  3O9T A;  4IFV A;  4BRE A;  1X9J A;  4JI5 K;  1WLJ A;  4OX9 K;  1VAZ A;  1Q82 O;  1JCE A;  3VGM A;  3QB0 A;  4E19 A;  1NGJ A;  4FM0 A;  2ABD A;  1N34 K;  2HOE A;  3IUC A;  5KTQ A;  3DOL A;  1TV6 A;  4IXC A;  4LF4 K;  3D2F A;  4KV8 A;  4AHR A;  3D45 A;  1KAZ A;  1KD1 O;  3WEE B;  4J2A A;  1EP4 A;  2FXU A;  2VWJ A;  2KZZ A;  3CCL N;  3LAN A;  1BQM A;  4AIL C;  4EFH A;  3SAG A;  3OBY A;  1QZ5 A;  2O8B A;  2KZM A;  3EL2 A;  3G0Z A;  4YNQ A;  1KSP A;  4E0D A;  4CYE A;  4P7I A;  3U9D A;  1BU6 O;  5BR8 K;  2Q0R A;  3MAQ A;  3PUF A;  2E2O A;  4KHQ A;  2E8A A;  4AHC A;  2HND A;  5AQF A;  3CCQ N;  4OJR A;  3UKR B;  3ATV A;  2HHQ A;  1GLD G;  2HE7 A;  3Q7C A;  5AQY A;  4BAC A;  4J2B A;  1IKY A;  1IG8 A;  4I2Q A;  4GKK K;  1YIJ N;  2PYL A;  5IT9 O;  4F9O A;  1SKR A;  2HHH K;  3O6W A;  4HWI A;  2QXF A;  4B8C A;  4JRP A;  3BGR A;  3FLV A;  3LPT A;  1K8K A;  2WC9 A;  4FPB A;  4CZL A;  3MXM A;  3PVL A;  2QXL A;  3AVF A;  4MO5 A;  2AA4 A;  1OH5 A;  3TAG A;  2KW4 A;  2RE2 A;  2O4I A;  2EMT A;  3WA0 A;  1L3S A;  4DTX A;  1GLF O;  4CIF A;  1IH7 A;  1BG3 A;  5LMN K;  2HNZ A;  2E1Z A;  5AR0 A;  2P51 A;  1LW2 A;  4DG1 A;  4FSV A;  4ELU A;  5AFU H;  1WN7 A;  1GLL O;  1Q9X A;  1SL1 A;  2B6A A;  2P9I B;  3U3G A;  2G8V A;  2P9I A;  3ID8 A;  5CE3 A;  1BDG A;  3R3L A;  3CCU N;  5AQV A;  2A1S A;  3LPU A;  5IWA K;  1MK9 B;  1TKT A;  1FW6 A;  1TUY A;  3UIQ A;  3AVI A;  5AQU A;  3G10 A;  2V7Z A;  1JL1 A;  3QIO A;  5J2P A;  3X23 A;  5FPE A;  1SL0 A;  1HB8 A;  1NKE A;  4G1Q A;  1CXQ A;  4MQ3 A;  3SUO A;  2D0O A;  2Q31 A;  2YKM A;  3AVC A;  4K0K K;  2UXB K;  4FWN A;  2P9S B;  3E1Y A;  2R82 A;  5CYQ A;  1J5O A;  3M3Z A;  1JKH A;  3ULE A;  5JS1 A;  2QWL A;  4ZHR A;  2J4R A;  4M3R A;  4Z4I A;  4I9Q A;  2IC3 A;  4U67 L;  3TSP A;  4FLX A;  3K0S A;  2QWQ A;  2J0M A;  4A59 A;  5AZI A;  3SBT A;  2BAN A;  3TTD A;  1HQE A;  1BI4 B;  3RR8 A;  2PBD A;  4LSL A;  2YNF A;  3UB5 A;  4E3S A;  2KQ2 A;  4FOI A;  5LJV A;  4CJP A;  2XY5 A;  2J0K A;  4DU3 A;  4B1V A;  2P9N A;  4X66 K;  2O8E B;  2FSJ A;  2O8E A;  3K9K A;  3TAN A;  1HNX K;  4Z4H A;  1U45 A;  1NJW A;  4KBO A;  2V7Y A;  3OYI A;  4IOX A;  4TSX A;  4YDU A;  3VQB A;  3L2V A;  1ZBF A;  4YFU A;  2E4L A;  4KH6 A;  4B1W B;  3QNN A;  3O80 A;  4Z4E A;  3ZX0 A;  3MN9 A;  2D2Q A;  4DQP A;  1U48 A;  4ZRJ A;  3GG4 A;  3A5O C;  2XY6 A;  4HCC A;  4FCY A;  4EAH D;  4PA1 A;  1VSK A;  1E3M A;  3S3M A;  4CJ7 A;  4Z4F A;  4LFA K;  1BGX T;  1N5Y A;  3ITH A;  4JI0 K;  4V19 S;  2I7P A;  3HVT A;  4ELT A;  4DQQ A;  4HHT A;  2VWK A;  3DYA A;  3VF2 A;  3PX0 A;  1VQ8 N;  3OYN A;  2JLE A;  2ZJP L;  1D9D A;  1TK0 A;  3MN7 A;  4F2R A;  4J2E A;  3QEP A;  4B8A B;  3FZF A;  1TAQ A;  1BO5 O;  1HNW K;  2HRJ A;  3OYK A;  3HI0 A;  5JLF A;  1SGH A;  3CJB A;  3T1Y K;  2Z1I A;  4AM7 A;  2PZS A;  3PIO L;  1NGD A;  1VRU A;  2A5X A;  4B3S K;  5AQP A;  5LMU K;  3ZT2 A;  2O8D A;  5AQT A;  3QIJ A;  4BRP A;  4BR5 A;  2O4G A;  1Q81 O;  5E84 A;  4WE1 A;  3VQ4 A;  1NI2 A;  5AQR A;  4DUY K;  4FL9 A;  3CCV N;  4DU4 A;  3I0S A;  2HST A;  3VTH A;  3T69 A;  4YOX A;  1NLV A;  1MWK A;  3QFU A;  2QI2 A;  4NXN K;  3GOI A;  4A2A A;  1ATR A;  1WAF A;  5GAE P;  3PO4 A;  4CW7 B;  1GC6 A;  4DV4 K;  4LF9 K;  5KRS A;  3AVB A;  2CH6 A;  3SUQ A;  1I94 K;  4K8X A;  5AZJ A;  2ZJR L;  3AAP A;  3SAH A;  1TYQ A;  3QEV A;  3PSF A;  2HB5 A;  2FSK A;  3SUN A;  4U7B A;  3M8S A;  4DXA B;  1C0M A;  1XNR K;  2LBB A;  4ZTF A;  2ZJQ L;  4HVJ A;  5FRM A;  2HBK A;  3JAM O;  1UWB A;  4DR6 K;  2HMP A;  3NF7 A;  2HBM A;  2QK9 A;  1B9D A;  3HZ6 A;  3G71 N;  3HPH A;  3DLG A;  4OVL A;  2EWS A;  5F2R A;  4IFY A;  5EY4 A;  2F96 A;  5AJ3 K;  1BUP A;  3S9H A;  4IDK A;  3HL8 A;  1GGO A;  3NE6 A;  3U6F A;  1VSM A;  3THY A;  2GEM A;  5FPD A;  3HXM A;  3QO9 A;  4IEE A;  3U8X A;  1HUX A;  2KLA A;  1LAV A;  2QEX N;  3EPY A;  1S1X A;  4CZE A;  4DCH A;  4B1Y B;  2HF3 A;  4OKE A;  1XHZ A;  3PIP L;  1JJ2 M;  3A5M C;  4N76 A;  1SV5 A;  4ZRK A;  3K5M A;  3FZK A;  4BQL A;  3GE1 A;  3ID6 A;  4KTZ A;  3M8R A;  1BIZ A;  5D3G A;  4JD2 B;  2ASP A;  4FPA A;  2ZGY A;  5F1X A;  1HR0 K;  3ZSZ A;  3A8Y A;  3HVR A;  4GXB A;  1KLM A;  3F73 A;  3FZM A;  5GIN A;  3LAM A;  4F3T A;  4DTS A;  5BPN A;  3ZET B;  3CMA N;  2Q3S A;  3BEX A;  1HNZ K;  1VQ4 N;  3ZT3 A;  1GLC G;  1EWQ A;  5ELZ A;  4HDQ A;  3I0R A;  2UXD K;  3D2F B;  3VF6 A;  2ZE2 A;  2WFB A;  4F4K A;  4R5P A;  5BRD A;  3ZX3 A;  3OS2 A;  4KRE A;  3Q7B A;  4CFA A;  5LL6 Z;  3CM5 A;  3P5J A;  2VYP A;  2G8H A;  1K9M O;  2YV0 X;  1RDW X;  1GC7 A;  3EKU A;  3RVC A;  3KK1 A;  4IG0 A;  3E01 A;  4DUZ K;  4CEF A;  4LC9 B;  4LY7 A;  4A5A A;  3EEQ A;  4WQ5 A;  3WT0 A;  1ZXO A;  1E4F T;  5JVL A;  3AO2 A;  2VQE K;  4FO0 A;  2IGI A;  3EE8 A;  1XMQ K;  1KTQ A;  1R0A A;  1X3N A;  1OH6 A;  1L3U A;  4B9S A;  2VCP A;  2KFZ A;  4E89 A;  4DV0 K;  4CIE A;  4K25 A;  1R59 O;  3KK3 A;  4B9L A;  3E9L A;  1JCF A;  4QS7 A;  1C0T A;  3ZSX A;  3V9X A;  1U4B A;  4WCE L;  1JLQ A;  4CEO A;  5GAH P;  1HPM A;  5JLH A;  4PY5 A;  5K14 A;  5LJW A;  2D0P A;  4NLB A;  1KBL A;  1KCF A;  3K59 A;  3KD5 E;  1TK5 A;  3DXM A;  5BPM A;  3TI0 A;  4Z94 A;  1U04 A;  3OYJ A;  3TU5 A;  2HHU A;  5FPN A;  2ZWH A;  1XQS C;  2GWJ A;  3AO3 A;  4PL7 A;  1VQ5 N;  3U4L A;  4H5R A;  4E1J A;  4H0P A;  3O8M A;  3ZSW A;  1S6Q A;  4DSI A;  3O9Q A;  2DTU A;  4DR7 K;  1YI2 N;  4CJE A;  3OJS A;  4BDZ A;  1Y64 A;  1HYZ A;  3HPO A;  3KLF A;  1TYQ B;  4MDB A;  1KLN A;  3VQQ A;  1XWL A;  4DV1 K;  3S3N A;  4KHS A;  1Z26 A;  4O0J A;  3I55 N;  4K8Z A;  4I9L A;  3CC7 N;  1S22 A;  4DS4 A;  1J5E K;  4H5V A;  3N4P A;  2P9L A;  4CEZ A;  3THW B;  2XRI A;  3GDQ A;  2P9K B;  4DR3 K;  1MK7 B;  2GV9 A;  4FJN A;  3O08 A;  1RCH A;  4O8K A;  3V1O A;  3KZB A;  3CF5 L;  1OVQ A;  4QCL A;  4CHQ A;  4IJN A;  2HNY A;  1S1T A;  3T19 A;  3P31 A;  3CCR N;  2PY5 A;  2QKK A;  1IKV A;  4FZZ A;  4H0Y B;  5HRP A;  2G8W A;  5GIO A;  3C7N A;  2X78 A;  2E2P A;  3AA2 A;  3VEO A;  4DQ8 A;  1O13 A;  3KWI A;  3H6E A;  2UYT A;  1VRT A;  3OYF A;  3IG1 A;  2GTD A;  3NFA A;  3SQ0 A;  2P9S A;  4KHP K;  3F5T A;  1SZ2 A;  4AHV A;  1LV5 A;  4CJL A;  3FZH A;  2P9N B;  2IVO A;  4PKH A;  4EHT A;  2HHV A;  4E7J A;  4DFJ A;  2HBJ A;  3HRG A;  3L2U A;  3QFP A;  1EET A;  4BVO A;  1C1C A;  5J1E A;  4DKW A;  4JI7 K;  2VGM A;  3V9U A;  3CCS N;  3QNO A;  1BWF O;  2ASO A;  1WSE A;  4FOE A;  4J8F A;  4OLB A;  4YDU C;  1QVG M;  3NH1 A;  3AU5 A;  4H4M A;  4BRN A;  4FJ5 A;  3L4Q A;  2HBL A;  3NVK A;  3WXI A;  1NJY A;  4IOA L;  2ZQB A;  3AVH A;  5JIC A;  1Q7Y O;  2O8B B;  2A3Z A;  1B92 A;  1XC3 A;  2BH1 A;  3TAM A;  2NNW A;  2NRV A;  4BDY A;  1NWK A;  3DRR A;  4JRQ A;  2FSN A;  1DKG D;  4LH4 A;  3SYZ A;  1RT3 A;  3ENH A;  4JAX A;  3CCE N;  3O3G A;  4F7G A;  1IKW A;  2Z1G A;  4FLZ A;  3HSC A;  3WUH A;  2P5G A;  4FWK A;  1W97 L;  1JDE A;  4WFN L;  3ZT0 A;  2ZM6 K;  3NGI A;  1W9H A;  1RT2 A;  1RGI A;  3BF1 A;  1S9E A;  5I3U A;  3LDS A;  4NY0 A;  4CFC A;  3S41 A;  2FBV A;  2XY7 A;  2I5J A;  1BCM A;  3AVM A;  1EF1 A;  3M8Q A;  4H5N A;  4KB0 A;  2YHY A;  3MK6 A;  1J19 A;  1YJ9 N;  5FRO A;  4NLC A;  3TAP A;  4FYD A;  4FLV A;  2AJQ A;  4H0T B;  3AA3 A;  1JXB A;  3WNE A;  4FJL A;  3DLK A;  5AQM A;  3MN5 A;  4JKG B;  2Q2R A;  2GX9 A;  4ID1 A;  3KLE A;  3VF4 A;  2HHX A;  1T44 A;  4Q5V A;  5J2Q A;  1WAJ A;  2E5L K;  4BRA A;  2NRT A;  1F21 A;  4CD1 A;  1UAX A;  2F8T A;  1X3M A;  3CJ7 A;  3WQU A;  2Q36 A;  4BG8 A;  2H3G X;  4JKH A;  5DM6 L;  3MEG A;  4FWO A;  2YX6 A;  3AV9 A;  4CHZ A;  1KVA A;  4JKB A;  5J2M A;  1YTA A;  3VES A;  3MWP A;  1X9W A;  5CZ1 A;  3SUP A;  3AVK A;  1CZ9 A;  2F8S A;  3AGR A;  5AQL A;  3AVL A;  1BA1 A;  1HJR A;  3ULE B;  3OW2 M;  4DSK A;  1E5W A;  1KAX A;  3RMC A;  3O9R A;  4HTL A;  2HVI A;  3CCM N;  1BIS A;  3PY8 A;  5KI6 A;  3WNG A;  3RR7 A;  1HBK A;  1HNV A;  2NRZ A;  4CBW A;  4MLH A;  3THY B;  4ISE A;  4BY9 C;  4LF6 K;  4ISG A;  2F9T A;  2FBY A;  1NK0 A;  1J6Z A;  5BPL A;  1S6P A;  1DTQ A;  5AQH A;  3VQ9 A;  3SI6 A;  2OPR A;  2VGN A;  4WQ5 C;  3THX A;  4BE2 A;  5EXW A;  3LP2 A;  3L2Q A;  1SKS A;  4CE9 A;  2HVH A;  4NYN A;  4PHT X;  4N47 A;  4OPH A;  4H03 B;  3K5O A;  4FVM A;  3ZSY A;  4Z4C A;  3DI6 A;  4WFB L;  1N8R O;  1VSL A;  4FW1 A;  4ZTJ A;  5TKY A;  3CME N;  3ZSR A;  1T03 A;  5AQO A;  3VQ6 A;  1CZB A;  3L4I A;  4YL8 A;  3KK2 A;  4JKF A;  3L2W A;  1JLE A;  3KTQ A;  4JD2 A;  1BOT O;  4GVM A;  4JKD A;  1SQK A;  1ATS A;  2P9U B;  2GWK A;  2P9U A;  1YIT N;  1NGH A;  2HHT A;  1T8E A;  4IO8 A;  3AVJ A;  5AQW A;  3B6O A;  1EKE A;  4YHH K;  4DTU A;  4DWI A;  3OBW A;  2W6K A;  1ASV A;  4HCB A;  4BRO A;  2WTU A;  1IV0 A;  1HJO A;  1VQL N;  4OGC A;  1S5J A;  3CFR A;  3O1B A;  4AQY K;  4RW4 A;  2YCH A;  4KHN A;  4IEI A;  3UKU B;  1G99 A;  4C8N A;  1U47 A;  4H0O A;  3DRS A;  3VQ8 A;  4CGI A;  1ASU A;  4I2P A;  3PX4 A;  1B9F A;  2QWN A;  4JYA K;  3MCP A;  4CHN A;  3CQX A;  5CZ2 A;  4CCH A;  4OO1 J;  1RBV A;  4E7H A;  4DQS A;  3NH0 A;  1ITG A;  1ILY A;  3GBT A;  4FWP A;  4CEQ A;  1VSD A;  1KVB A;  2E6L A;  4JI6 K;  2UUB K;  5GIP A;  2Q0U A;  3W3D A;  1LOT B;  2O8F A;  3LAK A;  3ENO A;  3KJV A;  2D0C A;  3T7Z A;  3LZJ A;  2UXC K;  4JI2 K;  4XH5 A;  4CJF A;  3SJH A;  4LFB K;  4A2B A;  2YHB A;  5BN9 A;  3QIP A;  3IDH A;  2A42 A;  2IIR A;  3CC2 N;  3VEV A;  3FR0 A;  4KKO A;  4C8L A;  3FFI A;  5BRF A;  1N36 K;  4FM2 A;  4CF2 A;  4FZY A;  4H0X B;  3K58 A;  3CJ1 A;  4B9T A;  2OTJ N;  3A5L C;  3QBX A;  5M1K A;  3HT3 A;  3HM8 A;  2E6M A;  2R7Y A;  1WSF A;  4RW6 A;  5ADX A;  4OGE A;  4ID5 A;  1QS4 A;  3DXM B;  3LP0 A;  3BF3 A;  3HPG A;  5SWM A;  4L8R B;  3IAY A;  5BN8 A;  2WH5 A;  3C6H A;  3CQY A;  4YOR A;  5GAG P;  1YXQ A;  3H08 A;  4CBU A;  3KHY A;  4CZH A;  2RHK A;  3VQE A;  1HQU A;  5M1O A;  1HRH A;  5E26 A;  1MIZ B;  4FW2 A;  1LCU A;  4N56 A;  1CZA N;  1Q9Y A;  4GKJ K;  1QSY A;  1K73 O;  4M63 C;  3B6P A;  4FLU A;  5KPT A;  1P8Z A;  3M6G A;  4JS5 A;  3C0B A;  3AA5 X;  3C7N B;  4CEA A;  4CGG A;  5M1Q A;  2YKN A;  1EXQ A;  4X65 K;  1HKB A;  3IRX A;  3H1V X;  5C2D A;  4X62 K;  3AO4 A;  4CK2 A;  4IO9 L;  3J7Z O;  3THV A;  3PLA A;  1VBH A;  2EHG A;  4DSE A;  3I8D A;  4CI6 A;  4LH5 A;  4H0V B;  4CZF A;  4IOC L;  3V1Q A;  3VGL A;  3M5R A;  4B9M A;  2CGK A;  3DRP A;  1XUP O;  5AQN A;  3ZT4 A;  4DR5 K;  3QEW A;  1SUQ A;  1T6D A;  1WSI A;  4H8K A;  3MWT A;  4WF9 L;  3SV4 A;  2EX3 A;  3E9P A;  1NMD A;  2E1Y A;  4QS8 A;  4A61 A;  1RDA A;  1KFD A;  4KH4 A;  4NB4 A;  1VQK N;  4BRF A;  3SPY A;  1J53 A;  3OYC A;  3AU4 A;  3H3N O;  4NCA A;  3QES A;  4FLW A;  3D6R A;  3MED A;  3CI5 A;  1SS6 A;  3WXM B;  1D4X A;  2HHW A;  1XI1 A;  1IBK K;  4C8K A;  5CR4 A;  5C0Y A;  1ZBI A;  5KPZ A;  4JI8 K;  3L2R A;  1IG9 A;  3O9U A;  3C94 A;  1A5V A;  3VEW A;  3CET A;  4MDA A;  4W5N A;  3VQA A;  4FK2 A;  1VQ9 N;  3TSU A;  2FF6 A;  2D0A A;  3VA0 A;  3O4W A;  3V4I A;  1C6V A;  3SNN A;  1L5U A;  1T6C A;  2DFH A;  3WEE A;  1JLG A;  1XMO K;  3OA9 A;  4RW8 A;  4BWJ A;  3HOT A;  5HLF A;  3D2E A;  5E41 A;  3BY5 A;  5AQI A;  2YHX A;  2FC0 A;  3VQD A;  2YNG A;  3ZSO A;  2IOC A;  3JYT A;  4DSJ A;  1Q18 A;  2Z1J A;  3CQ8 A;  4BRM A;  1LWF A;  1RT6 A;  4RW7 A;  2VG7 A;  3CC4 N;  1QTM A;  3TAE A;  4RW9 A;  3TTF A;  3TR8 A;  1J9A A;  3MXI A;  4DSF A;  4M7Y A;  2O8F B;  3VER A;  4W5Q A;  2IVP A;  2XHB A;  4CHY A;  3BP8 A;  2VG6 A;  4AF1 A;  1EX4 A;  2ZGZ A;  5HRR A;  4C8O A;  4DFM A;  4DV2 K;  4BWM A;  4NXM K;  4CZG A;  1NG9 A;  3LDN A;  4CEE A;  4Z4G A;  5T7B A;  3WXK A;  1QSS A;  3IKM A;  4CJV A;  2QWR A;  3OJU A;  1KC8 O;  1VQ7 N;  4BRG A;  4JI1 K;  2DY4 A;  3K2P A;  2IAJ A;  2AP1 A;  4R79 A;  1G15 A;  1OKJ A;  1TKX A;  1NK4 A;  1H4R A;  1DLO A;  1N32 K;  4DV7 K;  5F0X A;  1C0F A;  4K41 A;  3MCA B;  2PAV A;  4BR2 A;  3SQ1 A;  2RF2 A;  1A5W A;  3MX2 A;  4FJJ A;  3AO1 A;  3K9J A;  2BGG A;  2Y1J A;  1D5A A;  5EX5 A;  2G8U A;  4MFB A;  4FJX A;  3LZI A;  4KTW A;  4NCB A;  4FXD A;  3NF6 A;  3A2F A;  3UE5 A;  3G9W A;  3OYB A;  3ALY A;  3SQ2 A;  3O9S A;  2V52 B;  1QSL A;  1RTD A;  3IFR A;  5LY3 A;  2DIK A;  3O5B A;  4FJ7 A;  1QQM A;  3BZC A;  3T3F A;  4GV3 A;  4A5B A;  1TVR A;  3OVN A;  2O8C A;  2ASM A;  2Y1I A;  4BG9 A;  4JV5 K;  3SQ4 A;  5I9E B;  2D1K A;  4K43 A;  3MXJ A;  1NGG A;  5I42 A;  4GY2 B;  1JL2 A;  1WBD A;  3ZEU A;  2BTF A;  1S9G A;  3EZW A;  1RDU A;  4E7I A;  3WQT A;  3O4Q A;  4BRK A;  4F8R A;  1HKC A;  2A1R A;  3OYH A;  4C8M A;  1ZC6 A;  3DJC A;  4IBN A;  1NKC A;  3QDK A;  4B9V A;  3TWH A;  4AHT A;  4KH5 A;  3OYA A;  3AAR A;  1SAZ A;  5C10 A;  1ISN A;  3CHW A;  1ZBU A;  1NJI O;  3RWU A;  5GAD P;  3SK3 A;  3C95 A;  3CJ9 A;  5AQG A;  4DB3 A;  3WXJ A;  1Z05 A;  4AM6 A;  3CPE A;  3JS6 A;  1U2V B;  4YOU A;  4E1N A;  3P38 A;  2HF4 A;  3PX6 A;  4KI6 A;  1GLE G;  3THX B;  1HYS A;  4A57 A;  3FE1 A;  4BGA A;  1MA9 B;  1ATN A;  3ZSV A;  5AQJ A;  3L0Q A;  4OPJ A;  2B5J A;  1QHT A;  2P5O A;  3KKR A;  1RBU A;  1RT1 A;  4CEB A;  4QS9 A;  4B9Q A;  4JKC A;  2WOM A;  4O5B A;  1YUW A;  3ZLJ A;  4HUG A;  2W42 A;  4UY8 O;  2IDO A;  3J80 O;  1BCO A;  1RTI A;  4CFD A;  1VQN N;  2X6N A;  2HHS A;  3E66 A;  2OZS A;  1NTI A;  4EKU A;  1RT7 A;  4JN4 A;  1SL2 A;  3DLH A;  1ST7 A;  1NU0 A;  3EO3 A;  3L6Q A;  4IWV A;  3B8A X;  3AGK A;  1L3T A;  2UUA K;  5H1S Q;  3VA3 A;  1RTH A;  3HYF A;  3OS1 A;  4YOY A;  3AVN A;  1E4G T;  2COP A;  2G8K A;  3VEZ A;  2E2Q A;  4HUE A;  3SLC A;  4ILH A;  3G4S N;  1TKD A;  4O0I A;  2ATQ A;  5HRN A;  4BR9 A;  4CED A;  1IKX A;  3W0L A;  4I6M B;  4BRH A;  1OH7 A;  3RMA A;  4CES A;  4O44 A;  1VSE A;  4DTM A;  3CCJ N;  3MEC A;  2E88 A;  2CB8 A;  1S72 N;  2ZD1 A;  4JI4 K;  4B3O A;  3DOK A;  3TSQ A;  1FKO A;  1HNI A;  1NOY A;  2Z1H A;  4B1X B;  1VQO N;  4FJ8 A;  2AL6 A;  2O8D B;  2YJE A;  4Y1D A;  1LWE A;  4JK8 A;  2ITM A;  3QML A;  3A5N C;  3NF8 A;  4W5O A;  4CJK A;  1YF5 L;  3LDO A;  1JLB A;  5KGW A;  4NCG A;  1WSJ A;  3NCI A;  1S3X A;  3U8Z A;  2DPN A;  3RSE B;  3OHR A;  5CHI A;  3CFP A;  3HP9 A;  4BRQ A;  4KPY A;  1W0H A;  4B9N A;  5CY4 A;  1I3A A;  1NGE A;  4M42 A;  1HYV A;  4CZJ A;  2VWB A;  4RG8 A;  3VEY A;  5KRT A;  4BE1 A;  4DTP A;  4CJ3 A;  1D9F A;  3VMF B;  5HBM A;  3ZX2 A;  3VQ7 A;  3H1Q A;  4IDH A;  3OY9 A;  4C23 A;  3U3Y A;  4BRD A;  2NZT A;  2YNI A;  3KLI A;  4O8U A;  3C6T A;  4CF0 A;  4BRI A;  1GOB A;  3V6D A;  1KAY A;  2UU9 K;  4GMJ B;  2GUP A;  2FF3 B;  4FLY A;  4KTQ A;  2G8F A;  2A6A A;  1CXU A;  4DF8 A;  2P9L B;  4CGJ A;  3NBP A;  4FK0 A;  4BQZ A;  2NRW A;  4DQR A;  4J2D A;  3HTV A;  3QLH A;  4WYB A;  1QQN A;  5AFU A;  5TKW A;  1WNS A;  2YHA A;  3DLL L;  2I7N A;  2NUB A;  3FZL A;  2IVN A;  1WOQ A;  5BRH A;  4DTN A;  1BI4 A;  3CJC A;  3ZYY X;  3TAB A;  4UQG A;  2I1K A;  4OKJ A;  2ZPY A;  1TAU A;  1U49 A;  4RWT A;  1MIX A;  3QIC A;  4M3T A;  4RCH A;  5C25 A;  1TKZ A;  2E20 A;  1NJZ A;  4DU1 A;  5AQQ A;  3VN5 A;  4M3Z A;  1ACA A;  3H45 C;  3HO1 A;  3J7A P;  3HP6 A;  4JK9 A;  1N6Q A;  3G25 A;  5BR9 A;  4EP4 A;  5MLC Q;  4L3Q A;  2V51 B;  3VTI A;  1YJW N;  2D4W A;  3AY9 A;  1FKP A;  5AQS A;  1DIK A;  1KFS A;  4ILJ A;  3NAE A;  5HRO A;  3UKU A;  4DLG A;  1XNQ K;  3SPZ A;  2OTL N;  4CK3 A;  5KGX A;  3AA4 A;  5KPR A;  5M1N A;  1VQP N;  1C0G A;  3BUZ B;  3OTO K;  4OPK A;  2OCE A;  4CJT A;  2OPQ A;  4W5T A;  4BR4 A;  3VPZ A;  3SZ2 A;  4JK7 A;  3RRG A;  4PQU A;  4JHD B;  4CF8 A;  1I39 A;  2KTQ A;  3RMD A;  4AHU A;  5SZT A;  4Z0U A;  4BC5 A;  1HPZ A;  4BC4 A;  3LP3 A;  3P39 A;  2NRX A;  4CK1 A;  4AHS A;  4YY3 K;  4CBX A;  1Q86 O;  1NGC A;  1WSG A;  5KQ8 A;  3EKS A;  4GV9 A;  1Z25 A;  3AO5 A;  1YTU A;  5FLX O;  4EIA A;  1HX1 A;  3JXU A;  1ZYQ A;  1Z6R A;  4KHW A;  4CHO A;  4Y0W A;  4I7F A;  4JKA A;  2D5R A;  3WNH A;  2QKB A;  4BDP A;  1YAG A;  4CZK A;  2UUC K;  3CG7 A;  4DTO A;  5C2F A;  3BZK A;  4KHU A;  2RN2 A;  4B1U B;  4F2S A;  4FVU A;  5JMV A;  1NNE A;  3PV8 A;  2YNH A;  2YVC A;  4Y1C A;  1NK7 A;  4CJR A;  1CLQ A;  4H5W A;  2WUS A;  3WNF A;  1ZBL A;  1W2B M;  3U7D A;  5JVH L;  1LWC A;  2FBX A;  4JEP A;  1BL3 A;  1NGA A;  1BA0 A;  3MN6 A;  3RSE A;  4PL8 A;  5EVZ A;  1RFQ A;  3C6A A;  4DF4 A;  5EOY A;  3KD1 E;  3BIN A;  2ZF5 O;  1EO1 A;  2JGU A;  1JLA A;  2OZM A;  1EWR A;  3M1F A;  4XEI A;  3NDK A;  3FGU A;  1RDC A;  3EE9 A;  4DTR A;  3ATU A;  3DXK A;  3LM9 A;  1JXE A;  1VK0 A;  3QET A;  4LFC K;  2YI1 A;  1M1K O;  2A40 A;  1TGO A;  4CJ4 A;  4DQI A;  3LM2 A;  3VET A;  4JKE A;  2X6S A;  4GNI A;  1MWM A;  5CYM A;  1RDD A;  4HDO A;  4CF1 A;  3J7Y P;  3O3H A;  1JLC A;  4FWL A;  4HUF A;  1GOA A;  3PZD A;  5JS2 A;  3ISN C;  4FZX C;  3PO5 A;  4BRC A;  3THW A;  2XO7 A;  2GUI A;  3DAW A;  1DGK N;  2P9K A;  4EZ9 A;  1T05 A;  3SCX A;  3VQP A;  3LDL A;  1IJJ A;  1ZBS A;  3OYL A;  2ETJ A;  4YOT A;  2FDQ A;  2OA8 A;  2QTD A;  3JSM A;  4Q0B A;  2W40 A;  5AQX A;  1T7P A;  4M7X A;  2PYJ A;  1YT3 A;  1NK6 A;  3CYM A;  1D8Y A;  3CIP A;  1KRP A;  4DV6 K;  3KKS A;  4DSL A;  3QEX A;  1NK5 A;  3R9P A;  1QZ6 A;  1MDU B;  2FBT A;  3V9S A;  3DMJ A;  3R6M A;  4E1M A;  4W5R A;  1U2V A;  4NO7 A;  1WB9 A;  1DEJ A;  2KKZ A;  1VHX A;  3CD6 N;  5HP1 A;  1QQO A;  2A41 A;  1XC9 A;  4FJK A;  2AEH A;  3C6U A;  4FJM A;  4DR2 K;  1OVY A;  4IKF A;  3NH2 A;  3QIN A;  3KLG A;  3ZET A;  3IVF A;  1S1W A;  4LD0 A;  3EZ5 A;  4FJ9 A;  3C65 A;  3CFO A;  3T1A A;  1NMN A;  4WQ4 C;  1S1V A;  4JNE A;  3ENB A;  1J54 A;  2E2N A;  5AQK A;  3J81 O;  2RKI A;  4N5S A;  1TL3 A;  1C0U A;  4C1N I;  3TAR A;  4CEC A;  4JI3 K;  1HKG A;  4ISF A;  1NK8 A;  3D7E O;  2EMS A;  5HL7 L;  4DTJ A;  3RTV A;  4M45 A;  2VQF K;  4LF7 K;  3F9K A;  1BQN A;  1VBG A;  5C24 A;  1FXX A;  3DLB A;  3UKR A;  3VQ5 A;  3U9Z A;  3OS0 A;  3MDQ A;  2F7T A;  5FRN A;  3TPQ A;  4K42 A;  4KO0 A;  4ELV A;  1K6Y A;  1TK8 A;  3DLR A;  4M3W A;  4CFB A;  3WXL A;  4LF8 K;  1X9M A;  3LWM A;  1EQY A;  3ASM A;  1VQ6 N;  3VOV A;  4PUO A;  1QE1 A;  4GW6 A;  2CGL A;  3D2E B;  2GBZ A;  4AH9 A;  4OLA A;  1QQC A;  1HLU A;  4BR0 A;  1YJN N;  1IO2 A;  4B3T K;  1LW0 A;  4CIG A;  4QAG A;  2WON A;  4O55 A;  3EY1 A;  5AQZ A;  4BGB A;  1ESV A;  5A2Q O;  3SAF A;  4LF5 K;  2CGJ A;  1H1V A;  4DS5 A;  2J0J A;  1WBB A;  1NVL A;  1HMV A;  2RPI A;  3RRH A;  1Y19 B;  3E9O A;  1RBS A;  3HOS A;  4JKG A;  5BRE A;  4BC3 A;  4CJ5 A;  1WSH A;  5KQD A;  1DT9 A;  4FJH A;  3O3F A;  2HMI A;  1YVU A;  3L3V A;  2BE2 A;  3IS9 A;  3VQC A;  5DM7 L;  3LP1 A;  4FJI A;  1UA0 A;  3ULD A;  4O4G A;  3PSI A;  4RTF D;  4TKN A;  3CER A;  3KK7 A;  2HW3 A;  3P4I A;  1V4S A;  1Y97 A;  5HOO A;  1S1U A;  2PFU A;  2QW9 A;  3I8B A;  1T3V A;  4KFB A;  3TTC A;  1OH8 A;  3K5N A;  1VQM N;  2P9P A;  2P9P B;  3S3O A;  3KVG A;  3SMS A;  4X64 K;  3EYZ A;  1QVF M;  1TL1 A;  2OPS A;  1O1W A;  3F9M A;  4N41 A;  1YVN A;  4DMN A;  3ZSQ A;  1NK9 A;  4MO4 A;  4CD3 A;  2G8I A;  3FFK B;  4IZ9 A;  1RT4 A;  2FJ9 A;  4CZI A;  5C42 A;  4KRF A;  1X1P A;  4IG3 A;  2LSN A;  5FPM A;  3TAQ A;  3AAQ A;  3DM2 A;  3MMV A;  4CGH A;  4BR7 A;  1RT5 A;  4ICL A;  4M41 A;  4PWD A;  4DFP A;  1UOC A;  2NRH A;  1GLJ O;  2QA4 N;  2B4J A;  2QWM A;  2JWL A;  2FLO A;  2BDP A;  2NRR A;  4CGD A;  3SV3 A;  4E7K A;  4OKK A;  2VG5 A;  3R8E A;  4H4O A;  2W6L A;  3V1R A;  3H46 O;  4ZRI A;  3A0I X;  3RMB A;  3GL1 A;  1TUU A;  4KI4 A;  1RIL A;  3P1G A;  2YHW A;  3ZT1 A;  4M3U A;  1RDB A;  4CER A;  1ASW A;  3SMP A;  4FWQ A;  3VGK A;  1NM1 A;  5DK5 A;  2IS3 A;  4LSN A;  5AZI B;  4KB1 A;  1M90 O;  3DWL A;  4PKI A;  2KFN A; 
#chains in the Genus database with same CATH homology
 1N8R O;  2ITM A;  3QML A;  3A5N C;  1NI2 A;  5TKY A;  3CME N;  1YHQ N;  5AQR A;  1YF5 L;  4FL9 A;  3LDO A;  4BC2 A;  3CPW M;  3CCV N;  4IJA A;  2HST A;  5AQO A;  3VTH A;  3L4I A;  3T69 A;  1S3X A;  4YL8 A;  3U8Z A;  1NLV A;  2DPN A;  1MWK A;  3RSE B;  3VEN A;  3OHR A;  4FWS A;  4JKF A;  4YOX A;  5CHI A;  4FWR A;  3QFU A;  2QI2 A;  4BRQ A;  3GOI A;  4JD2 A;  4A2A A;  1BOT O;  4ILG B;  1ATR A;  2CH5 A;  1V4T A;  4JKD A;  1SQK A;  5GAE P;  1ATS A;  1GC6 A;  2P9U B;  2GWK A;  2P9U A;  4XH4 A;  1YIT N;  1NGH A;  1NGE A;  1K8A O;  4IO8 A;  5AQW A;  2WBN A;  2VWB A;  4CZJ A;  2CH6 A;  1QHA A;  4MLE A;  3VEY A;  3OBW A;  5AZJ A;  2QWO A;  3EN9 A;  4BRO A;  3VMF B;  2BUP A;  3AAP A;  3ZX2 A;  4A62 A;  1TYQ A;  3SAH A;  2ZJR L;  3H1Q A;  2FSK A;  1HJO A;  4IDH A;  1VQL N;  4C23 A;  4BRD A;  2NZT A;  1KC7 A;  4U7B A;  3O1B A;  4O8U A;  4G9Z A;  2YCH A;  4DXA B;  4BRI A;  1KAY A;  4BRL A;  4C1N K;  2LBB A;  4IEI A;  2GUP A;  3UKU B;  2FF3 B;  1G99 A;  1HB6 A;  1GLA G;  4H0O A;  2ZJQ L;  2A6A A;  2HBK A;  2P9L B;  3CJA A;  3VEX A;  4OPA A;  2HMP A;  2YJF A;  3KWG A;  3ZDT A;  5M1P A;  2I1J A;  2HBM A;  4BQZ A;  1U6Z A;  2NRW A;  3HZ6 A;  3MX5 A;  3CXC M;  3G71 N;  3HTV A;  3LDQ A;  4H5T A;  4WYB A;  1QQN A;  5AFU A;  2EWS A;  5F2R A;  2QWN A;  5EY4 A;  3MCP A;  5TKW A;  3CQX A;  3QBW A;  5B8H A;  3DLL L;  2D10 A;  2I7N A;  1BUP A;  3NVM A;  4JHD A;  3FZL A;  1GGO A;  4OO1 J;  1NGB A;  2IVN A;  1WOQ A;  1ILY A;  2D11 A;  2GEM A;  5FPD A;  2KHO A;  4EHU A;  5BRH A;  2W41 A;  4IEE A;  3U8X A;  1HUX A;  3GBT A;  2F9W A;  1GG3 A;  2KLA A;  3CJC A;  4FWP A;  3EPY A;  3ZYY X;  4CZE A;  4DCH A;  4B1Y B;  2QEX N;  1WUA A;  2HF3 A;  3NMU A;  4YOW A;  3J8A A;  3PIP L;  3A5M C;  1JJ2 M;  5GIP A;  2Q0U A;  2I1K A;  3W3D A;  3G6E N;  2ZPY A;  4ZRK A;  1LOT B;  3F2K A;  4I6M A;  3FZK A;  3ENO A;  1NGF A;  4BQL A;  3GE1 A;  3ID6 A;  3T7Z A;  3O1W A;  1MIX A;  4JD2 B;  4RWT A;  2ASP A;  3QIC A;  4XH5 A;  3SJH A;  4RCH A;  4A2B A;  4FPA A;  4XH1 A;  2ZGY A;  2E20 A;  5F1X A;  5BN9 A;  1NGI A;  3IDH A;  2A42 A;  2IIR A;  5AQQ A;  3CC2 N;  3VEV A;  1K8K B;  2NLX A;  3A8Y A;  3FR0 A;  4GXB A;  5BRF A;  1ACA A;  3H45 C;  3FZM A;  5AZJ B;  4H0X B;  2CQU A;  4JK9 A;  3G25 A;  5BR9 A;  3CJ1 A;  5GIN A;  2OTJ N;  3A5L C;  3QBX A;  5MLC Q;  2X0S A;  5BPN A;  4L3Q A;  5M1K A;  2V51 B;  3HM8 A;  3VTI A;  1YJW N;  2D4W A;  3ZET B;  3CMA N;  5ADX A;  3AY9 A;  3BEX A;  5AQS A;  3DXM B;  1VQ4 N;  1DIK A;  3I56 N;  1GLC G;  1GLB G;  5ELZ A;  5C15 A;  3LL3 A;  3BF3 A;  5M1F A;  4HDQ A;  4ILJ A;  4FWM A;  3UKU A;  3D2F B;  3VF6 A;  2Q97 A;  2WFB A;  5BRD A;  3ZX3 A;  3Q7B A;  2OTL N;  4GVE A;  5BN8 A;  2WH5 A;  4CZM A;  5KPR A;  5M1N A;  1VQP N;  3C6H A;  3CQY A;  4YOR A;  5GAG P;  1C0G A;  3BUZ B;  2RQ1 A;  1YXQ A;  2VYP A;  4CBU A;  5JVG L;  1K9M O;  3KHY A;  4CZH A;  2RHK A;  1NBW A;  1RDW X;  4BR4 A;  3VPZ A;  3DXK B;  4JK7 A;  4IFE A;  4O5F A;  4B1Z A;  5M1O A;  4JHD B;  1GC7 A;  1MIZ B;  5E26 A;  3H3O B;  1LCU A;  3EKU A;  3RVC A;  1KQS M;  4BC5 A;  4BC4 A;  1CZA N;  3P39 A;  2NRX A;  4LC9 B;  2QM1 A;  3I33 A;  5IJM A;  2OAN A;  4M63 C;  4CBX A;  4A5A A;  1NGC A;  1P90 A;  5KPT A;  5KQ8 A;  1P8Z A;  2Q1N A;  3EKS A;  4WQ5 A;  1ZXO A;  3WT0 A;  1E4F T;  5JVL A;  3M6G A;  3C0B A;  3C7N B;  4GV9 A;  1KXP A;  4FO0 A;  5M1Q A;  4BVP A;  1HX1 A;  3EE8 A;  4EIA A;  4WFA L;  2GEL A;  3JXU A;  1HKB A;  1Z6R A;  4GV6 A;  1X3N A;  4Y0W A;  3H1V X;  2VCP A;  4JKA A;  2JWK A;  5C2D A;  4IO9 L;  4K25 A;  1R59 O;  3J7Z O;  1YAG A;  1JCG A;  3PLA A;  4CZK A;  3E9L A;  4YOV A;  1JCF A;  1VBH A;  3R1X A;  4DHY A;  4QS7 A;  2QWP A;  5C2F A;  4CI6 A;  3FLC O;  3ZEU B;  4H0V B;  4WCE L;  5GAH P;  4B1U B;  4CZF A;  4FVU A;  3N4Q A;  3IMX A;  5JMV A;  4IOC L;  1HPM A;  5JLH A;  3VGL A;  5ADX H;  3M5R A;  5LJW A;  2D0P A;  2CGK A;  4NLB A;  1XUP O;  5AQN A;  1KBL A;  4WQ4 A;  2YVC A;  1T6D A;  3MWT A;  4WF9 L;  4H5W A;  2WUS A;  1W2B M;  3U7D A;  4PKG A;  5JVH L;  3LDP A;  4JEP A;  3DXM A;  3E9P A;  5BPM A;  5HOO A;  1NGA A;  3HBT A;  1BA0 A;  1NMD A;  2E1Y A;  3MN6 A;  4Z94 A;  4QS8 A;  3SBG A;  4A61 A;  5E84 A;  3TU5 A;  5FPN A;  4PL8 A;  3RSE A;  5EVZ A;  4KH4 A;  2ZWH A;  1XQS C;  1RFQ A;  3C6A A;  4NB4 A;  2GWJ A;  4BRF A;  4PL7 A;  1VQK N;  1VQ5 N;  3FP5 A;  5EOY A;  3BIN A;  2ZF5 O;  3U4L A;  3AU4 A;  1EO1 A;  4H5R A;  3H3N O;  4E1J A;  4H0P A;  5C12 A;  3O9T A;  3M1F A;  3D6R A;  4XEI A;  3FGU A;  3O8M A;  3EE9 A;  3CI5 A;  4BRE A;  1SS6 A;  1X9J A;  3WXM B;  1D4X A;  3ATU A;  3HOS A;  3DXK A;  3LM9 A;  5CR4 A;  5C0Y A;  2YI1 A;  3O9Q A;  5KPZ A;  1M1K O;  1VAZ A;  2A40 A;  1Q82 O;  1JCE A;  1YI2 N;  3O9U A;  3VGM A;  3QB0 A;  3VEW A;  1NGJ A;  1Y64 A;  3LM2 A;  3CET A;  1TYQ B;  4MDB A;  4MDA A;  3VET A;  2ABD A;  4JKE A;  2HOE A;  3IUC A;  4GNI A;  1MWM A;  1VQ9 N;  3I55 N;  4HDO A;  4IXC A;  3TSU A;  3D2F A;  2FF6 A;  4FWL A;  3O4W A;  3CC7 N;  1S22 A;  3PZD A;  4H5V A;  1KAZ A;  4BRC A;  1T6C A;  1KD1 O;  3N4P A;  2P9L A;  3WEE A;  3DAW A;  3GDQ A;  1DGK N;  2P9K B;  3WEE B;  2FXU A;  2P9K A;  3OA9 A;  3CCL N;  1MK7 B;  3HOT A;  3O08 A;  3D2E A;  4EFH A;  3SAG A;  4O8K A;  3OBY A;  5AQI A;  1QZ5 A;  2YHX A;  3KZB A;  3CF5 L;  3EL2 A;  3LDL A;  1IJJ A;  4IJN A;  1ZBS A;  4CYE A;  3P31 A;  4P7I A;  4YOT A;  1Q18 A;  3U9D A;  2FDQ A;  1BU6 O;  3CCR N;  2QTD A;  2Q0R A;  4BRM A;  2E2O A;  2W40 A;  2E8A A;  4H0Y B;  5AQX A;  4M7X A;  5AQF A;  3CCQ N;  3CIP A;  3UKR B;  5GIO A;  3CC4 N;  3C7N A;  3ATV A;  3TTF A;  2E2P A;  3VEO A;  1GLD G;  2HE7 A;  3Q7C A;  1O13 A;  4DQ8 A;  5AQY A;  3KWI A;  4M7Y A;  3H6E A;  2UYT A;  3VER A;  1IG8 A;  3R9P A;  1QZ6 A;  1MDU B;  2IVP A;  1YIJ N;  4F9O A;  3R6M A;  2GTD A;  5BRE A;  3BP8 A;  2P9S A;  1U2V A;  4NO7 A;  4AF1 A;  3O6W A;  1DEJ A;  4HWI A;  2ZGZ A;  2KKZ A;  3F5T A;  3FLV A;  1SZ2 A;  3CD6 N;  1QQO A;  2A41 A;  3FZH A;  1K8K A;  2P9N B;  2IVO A;  4PKH A;  2WC9 A;  4FPB A;  2AEH A;  4CZG A;  4EHT A;  3LDN A;  4CZL A;  3PVL A;  2HBJ A;  2QXL A;  4MO5 A;  1OVY A;  2AA4 A;  3WXK A;  2RE2 A;  3HRG A;  3IKM A;  2EMT A;  3WA0 A;  2QWR A;  3QFP A;  1KC8 O;  1VQ7 N;  1GLF O;  3ZET A;  3IVF A;  4BRG A;  4BVO A;  4DKW A;  1BG3 A;  3C65 A;  2VGM A;  3CCS N;  4WQ4 C;  1BWF O;  2AP1 A;  4JNE A;  2ASO A;  3ENB A;  2E1Z A;  4FOE A;  5AR0 A;  4J8F A;  4R79 A;  1OKJ A;  1Q86 O;  4YDU C;  2E2N A;  1QVG M;  3AU5 A;  5AQK A;  4BRN A;  1H4R A;  3L4Q A;  4C1N I;  4FSV A;  2HBL A;  5F0X A;  3WXI A;  3NVK A;  4IOA L;  1Q81 O;  1C0F A;  5AFU H;  4K41 A;  1HKG A;  2PAV A;  3MCA B;  4ISF A;  4BR2 A;  5JIC A;  3MX2 A;  1Q7Y O;  3K9J A;  3D7E O;  2EMS A;  1GLL O;  2A3Z A;  5HL7 L;  5EX5 A;  2P9I B;  2P9I A;  1XC3 A;  2BH1 A;  3ID8 A;  5CE3 A;  1BDG A;  2NNW A;  2NRV A;  3R3L A;  5AQV A;  3UE5 A;  1NWK A;  3CCU N;  3G9W A;  1MK9 B;  1TUY A;  3O9S A;  2V52 B;  5AQU A;  2FSN A;  1VBG A;  1DKG D;  3IFR A;  5LY3 A;  2DIK A;  3ENH A;  4JAX A;  2V7Z A;  3O5B A;  3UKR A;  1QQM A;  3U9Z A;  3MDQ A;  3X23 A;  2F7T A;  3TPQ A;  4K42 A;  5FPE A;  3CCE N;  1HB8 A;  4GV3 A;  3WXL A;  4A5B A;  4F7G A;  3HSC A;  3WUH A;  4FWK A;  2ASM A;  1W97 L;  1JDE A;  4BG9 A;  2D0O A;  2Q31 A;  4WFN L;  1EQY A;  1VQ6 N;  3VOV A;  5I9E B;  2D1K A;  2P9S B;  4FWN A;  1K73 O;  3E1Y A;  2R82 A;  2CGL A;  1RGI A;  3D2E B;  4K43 A;  3BF1 A;  1NGG A;  4GY2 B;  3M3Z A;  4NY0 A;  1HLU A;  3S41 A;  2BTF A;  3ULE A;  3ZEU A;  4BR0 A;  1YJN N;  2QWL A;  1RDU A;  3EZW A;  2J4R A;  3WQT A;  1EF1 A;  4BRK A;  4H5N A;  4U67 L;  1HKC A;  2YHY A;  3MK6 A;  3TSP A;  1J19 A;  1ZC6 A;  3DJC A;  5AQZ A;  4BGB A;  1ESV A;  3SAF A;  1YJ9 N;  4NLC A;  2CGJ A;  3QDK A;  1H1V A;  2QWQ A;  2J0M A;  4A59 A;  2J0J A;  5AZI A;  4KH5 A;  3SBT A;  3AAR A;  1SAZ A;  5C10 A;  1NVL A;  1ISN A;  3TTD A;  3CHW A;  1NJI O;  4H0T B;  5GAD P;  3SK3 A;  3CJ9 A;  5AQG A;  4DB3 A;  1Y19 B;  2PBD A;  3WXJ A;  1Z05 A;  3E9O A;  3MN5 A;  3CPE A;  5AQM A;  4JKG A;  3UB5 A;  3JS6 A;  4AM6 A;  1U2V B;  4JKG B;  4BC3 A;  2Q2R A;  4FOI A;  4YOU A;  1DT9 A;  2GX9 A;  5KQD A;  5LJV A;  3P38 A;  2HF4 A;  2J0K A;  4B1V A;  2P9N A;  3VF4 A;  1T44 A;  1GLE G;  5DM7 L;  2FSJ A;  2NRT A;  4BRA A;  4CD1 A;  3K9K A;  4KBO A;  4RTF D;  4TKN A;  1X3M A;  2V7Y A;  3CER A;  3KK7 A;  3CJ7 A;  1V4S A;  3P4I A;  4IOX A;  3FE1 A;  3WQU A;  4A57 A;  4BGA A;  1MA9 B;  1ATN A;  2PFU A;  2QW9 A;  5AQJ A;  4YDU A;  3L0Q A;  2Q36 A;  4BG8 A;  2H3G X;  4JKH A;  1T3V A;  3I8B A;  3TTC A;  5DM6 L;  4FWO A;  2YX6 A;  4KH6 A;  4B1W B;  1VQM N;  3O80 A;  2P9P A;  2P9P B;  4JKB A;  4QS9 A;  3KVG A;  3VES A;  3SMS A;  3MWP A;  3ZX0 A;  3MN9 A;  2D2Q A;  4B9Q A;  4JKC A;  4ZRJ A;  1QVF M;  3GG4 A;  3A5O C;  3AGR A;  3F9M A;  4EAH D;  1YVN A;  5AQL A;  1YUW A;  4MO4 A;  1BA1 A;  4UY8 O;  4CD3 A;  4CJ7 A;  3ULE B;  1VQN N;  3OW2 M;  1E5W A;  1KAX A;  3FFK B;  3O9R A;  3E66 A;  4HTL A;  4IZ9 A;  3CCM N;  1NTI A;  4EKU A;  2FJ9 A;  4JN4 A;  4CZI A;  1ST7 A;  2I7P A;  3EO3 A;  3L6Q A;  5FPM A;  3AAQ A;  1HBK A;  4IWV A;  3B8A X;  3MMV A;  2NRZ A;  4BR7 A;  3AGK A;  3VF2 A;  4CBW A;  5H1S Q;  1VQ8 N;  4MLH A;  4ISE A;  2NRH A;  1GLJ O;  4YOY A;  2ZJP L;  2QA4 N;  1E4G T;  2COP A;  4ISG A;  4BY9 C;  3MN7 A;  2F9T A;  2QWM A;  2JWL A;  1J6Z A;  2FLO A;  5BPL A;  2NRR A;  2E2Q A;  3VEZ A;  3SLC A;  4ILH A;  3G4S N;  5AQH A;  3R8E A;  4BR9 A;  3FZF A;  3W0L A;  3H46 O;  1BO5 O;  4ZRI A;  2VGN A;  3A0I X;  4I6M B;  2HRJ A;  4BRH A;  3HI0 A;  4WQ5 C;  5JLF A;  3GL1 A;  1SGH A;  1TUU A;  3CCJ N;  3CJB A;  5EXW A;  2E88 A;  2CB8 A;  2YHW A;  4AM7 A;  1S72 N;  3PIO L;  1NGD A;  2A5X A;  3TSQ A;  4PHT X;  4OPH A;  5AQP A;  4H03 B;  4B1X B;  1VQO N;  3SMP A;  2AL6 A;  4FWQ A;  3VGK A;  2YJE A;  5AQT A;  1NM1 A;  5AZI B;  3QIJ A;  4WFB L;  1M90 O;  4BRP A;  4BR5 A;  3DWL A;  4JK8 A;  4PKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...