4JKBA

Open and closed forms of v1788d human prp8 rnase h-like domain with bound mg ion
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRDTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkbA01
3E9LA 3E9OA 4JKBA 3E66A 3E9PA 4JKAA 4JKEA 4JK9A 4ILHA 4JKCA 4JKGB 4ILGB 3SBTA 4JKFA 3SBGA 4JK8A 4JKGA 3ENBA 4ILJA 4JK7A 4JKHA 4JKDA
chains in the Genus database with same CATH superfamily
4CFBA 1ACAA 3RR8A 4FWSA 4KFBA 1NGEA 2HHHK 3HSTB 3SQ1A 3FZKA 3A5MC 1WSFA 4FJJA 3QIOA 2OCEA 1FKPA 2BH1A 3UKUB 2O4GA 1T6DA 3G71N 3TSQA 5F1XA 2OZSA 2A1RA 5AQKA 1XMQK 3VEOA 1DGKN 1N6QA 3MX2A 4AH9A 1C1CA 1TYQA 2QWRA 3GDQA 4DB3A 1QQMA 4FWOA 5AQNA 4QOZB 3AGKA 4KB0A 3RSEB 4Q5VA 2E2PA 2FBTA 3DRRA 3PUFA 4F4KA 4OO1J 3A5OC 3NAEA 1S9GA 1D9DA 4CFAA 4CHYA 3PVLA 5C25A 4H4OA 3GE1A 3MN9A 3OYNA 4YOVA 3VTIA 3ID8A 1NK0A 3VGKA 1KC8O 4LC9B 4KH5A 2A1SA 3AVJA 1N34K 5CY4A 4EHUA 5HRNA 1LV5A 1UA0A 1XUPO 1S5JA 2B5JA 1GLEG 4CD1A 4M3UA 3QB0A 1BA1A 4F8RA 5EOYA 1YVUA 4OGEA 1Q82O 4MDAA 1NK8A 1MDUB 3VQ6A 1KD1O 4FPBA 4H4MA 4F9OA 1G99A 3F9MA 5FPMA 1ZBSA 1BCMA 3VF2A 1GG3A 1W0HA 3JXUA 4KHPK 3MWTA 4E1NA 4DR1K 4FJ7A 4CBWA 5GIOA 4KKOA 1ISNA 3ZX2A 4BQLA 1HKGA 3P5JA 3I8BA 3OS2A 4ZTJA 1SV5A 2YNHA 5BPNA 3UE5A 3O9UA 4IG0A 2G8IA 2NRZA 3V4IA 4AM7A 3WXIA 1YF5L 4KHSA 3CPEA 4CCHA 3SAHA 1FKOA 1LWEA 3HM8A 3V6DA 4M3YA 3VQCA 5CYQA 3IS9A 2X0SA 2E2NA 4M45A 4B1YB 2VWJA 5B8HA 1XNRK 4E1MA 3Q7BA 2P9NA 1RBSA 3VTHA 5KGXA 1DIKA 1MIXA 5I42A 2FXUA 4ELVA 4FJ8A 4FWPA 3OA9A 4YNQA 4A2BA 3HP6A 1WNSA 5IJMA 3ULEA 3SAGA 2XY5A 2CB8A 4OPAA 4WQ4C 1WAFA 1EP4A 2YHXA 3VEZA 4CGHA 4JKBA 4BRIA 3CJCA 3DLBA 3CJBA 3KZBA 4OKKA 3AVBA 1KQSM 3THXB 4EFHA 2NRXA 1NJIO 4LSLA 4BRNA 4DQRA 3OTOK 3IAYA 2OANA 2BUPA 3HPOA 1TKXA 4ILJA 5JLHA 2RQ1A 3H6EA 3BF1A 4X64K 2OA8A 4B3MK 1VQNN 2P9IB 2RE2A 4C8KA 2XY7A 4I2PA 3ZSWA 1E4GT 2GEMA 3TR8A 3U8ZA 4CZEA 2Z1IA 1TKDA 1BIZA 3TAEA 1JDEA 4HTUA 3UKRA 3UKUA 4AHRA 1NK9A 3K5OA 4CJWA 4B9SA 2AJQA 1U2VB 4Z4IA 3N4PA 4E3SA 4OPKA 4FWLA 2W6KA 1LWCA 1YHQN 3ZT1A 2OPQA 5JVGL 4NYNA 3H08A 4FJ5A 3SLCA 1EKEA 1S1TA 2Z1HA 4O8KA 4WYBA 3AA5X 4CESA 1JLEA 4HUFA 4K8ZA 4YDUC 1R0AA 2FBXA 1T8EA 3QIJA 1XNQK 2AA4A 3F73A 1RDUA 3QDKA 4NO7A 4CEBA 3ZT0A 2Q2RA 2YCHA 1S9EA 4CERA 4JHDB 3THYA 3EY1A 3VQ8A 3KKRA 4PA1A 3CCSN 2ITGA 3F2KA 3LP3A 1K8KA 4K41A 1VSLA 2E88A 1RCHA 1ATNA 4LF5K 4QCLA 3MEGA 4CF8A 1K73O 3H1VX 1E5WA 3DM2A 4DV1K 4DV4K 3DLHA 2KTQA 4B3RK 4ILGB 1VRUA 5CE3A 2HVIA 4OPHA 2RHKA 3GOIA 1JLGA 4DF4A 1MIZB 3RMCA 4AHVA 2F9TA 3IDHA 1L3TA 2ABDA 5J2MA 4F3OA 1VQMN 4JKHA 2QTDA 3K9JA 1SZ2A 1D9FA 2UXDK 2GWJA 1IV0A 3CJ9A 4EP5A 4DQPA 3SQ0A 1MK7B 2QWOA 4GVMA 4MDBA 2ZGYA 3D45A 4CJPA 4RTFD 1BWFO 4FPAA 1KCFA 3OYLA 1NK5A 3CJ1A 1HQUA 3IUCA 1W2BM 3BY5A 4DLGA 2UYTA 4ZRKA 1Q81O 1GLDG 2O4IA 1VHXA 2W40A 2P9PB 4XEIA 2JLEA 3KD1E 4FK0A 3ITHA 1YT3A 4H5NA 3HPHA 4KBOA 2Z1JA 4J8FA 4N5SA 3PY8A 4C8OA 1FXXA 3EZWA 3E01A 4J2DA 3QETA 4CEEA 2HBMA 3CPWM 3QERA 4M3XA 3JAMO 3AY9A 2NRVA 4PWDA 2I1JA 2ZWHA 1OVYA 4B1WB 3LAKA 4BDZA 4GV6A 1NOZA 4BE0A 4IDKA 1DLOA 1J54A 3IRXA 3O1WA 3OW2M 3NE6A 4H03B 3VQ7A 1RTIA 3AVGA 3QLHA 5C2DA 2IVPA 3VETA 3CFRA 1TKZA 2D0BA 1NMNA 2HNYA 2P9IA 1MA9B 3SAFA 5M1OA 3CM6A 3V9WA 1A5WA 4WFBL 1DTTA 4DUZK 3R8EA 4PY5A 3CCQN 3LDLA 1KVCA 2NRHA 3R3LA 5KPTA 3AO4A 3VOVA 1HJOA 4LSNA 3DLKA 1QSSA 2ATQA 4B3TK 4NCGA 4KHWA 3DLRA 3TAMA 4FLZA 1U2VA 2A6AA 2HHQA 4YFUA 2IDOA 4A62A 4BRQA 2E4LA 4DQIA 4ISFA 1W97L 4GMJB 5DM6L 1C0GA 4KHQA 1RNHA 4XIUA 4B9QA 5AZJB 3KIOA 4IEEA 1N8RO 1QQCA 3TAFA 2Q0UA 3A5NC 3OYIA 4GKJK 1REVA 1RT4A 4QS7A 2O8DB 3ISNC 3DOLA 2ZPYA 1WBBA 1LW0A 2XY6A 4BC5A 1NG9A 4LFCK 3AA2A 5AR0A 2E2OA 4IZ9A 4C8LA 4CJUA 4QS9A 4CHPA 3SNNA 3QO9A 4JI6K 2X74A 1NMDA 1K8AO 4JHDA 2XRIA 4JK7A 1A5XA 5AQOA 1HNWK 1VQLN 4CF1A 3SMSA 3RMAA 4R5PA 4M42A 4PL8A 4J2AA 5BREA 1NWKA 4JKEA 3L3VA 4C8NA 3IKMA 3MXMA 3W3DA 3O3FA 3T3FA 2BTFA 4M3WA 4DR4K 4R79A 2VWBA 3HPGA 1ZBIA 1HYSA 4BACA 4CJKA 4OGCA 2VQFK 3SJJA 4H8KA 1L5UA 1VBHA 4CZGA 2GELA 1QQOA 4YORA 4ELUA 1J5OA 4EHTA 4FYDA 2B4JA 4OX9K 4DFKA 3EKUA 3O3HA 2NLXA 1GLBG 3LANA 1VQ4N 1NOYA 5C10A 2IIRA 3MWPA 2XY8A 4E7HA 3TANA 4GKKK 2IAJA 5C42A 1T7PA 1NGAA 1NGDA 3AGRA 1Q9YA 4BRDA 1UWBA 5CZ2A 3EL2A 1HMVA 4W5NA 3OYEA 3I56N 3LZIA 2P9PA 3FLVA 4UY8O 1WAJA 1TV6A 1GOAA 1I3AA 3MDQA 3RRHA 3VQ4A 1JJ2M 2HRJA 5LY3A 3ZSQA 5ADXH 4BE2A 3O4QA 1S1WA 4CGIA 2ITMA 3L6QA 4CF2A 4ZRIA 4DG1A 1E4FT 1DKGD 3NH0A 1KVBA 3E1YA 1JCFA 1ATSA 4DV0K 3OYCA 4LF8K 1JL1A 3WNHA 4FLUA 2Q97A 4CJ5A 1QE1A 3G25A 5GADP 1IKYA 5EVZA 4EZ6A 5F2RA 1ZBUA 3AVAA 3JYTA 1IBLK 3C7NA 5AQPA 1T3VA 1VBGA 4B1XB 5AQUA 4FJ9A 3NGYA 1X3MA 1IBKK 3PO5A 5KTQA 1EWQA 4GV3A 1NI2A 3SUQA 4KHUA 3DXMB 4FJXA 1ZYQA 1VSEA 1WSGA 4YOTA 1XMOK 1GLCG 4NY0A 3KK2A 2HVHA 3ATUA 4DTOA 3ZETB 3AO3A 1T05A 4GXBA 4I2QA 4RW8A 3H3NO 3BZKA 3EE9A 1NGHA 2F8SA 4F3TA 1ZBLA 1KTQA 1XC3A 4A5AA 3EE8A 4B1VA 1JKHA 3G0ZA 3KK3A 3QESA 1QSLA 1FW6A 3O1BA 2XO7A 5AZJA 2O8EB 5BRHA 2VQEK 2YNIA 3CQYA 4CJLA 1BQMA 3WXLA 4H0YB 4KI6A 1NVLA 3AVKA 4XH1A 2O8DA 2ZF5O 3L2UA 5AQFA 3SBTA 3DLGA 3OY9A 4JNEA 2A42A 1FK9A 1SQKA 3U3YA 3H1QA 3CXCM 4OJRA 1EO1A 3MEDA 3ZT4A 2BGGA 4FVMA 2I5JA 2EX3A 2X78A 5J1EA 1SGHA 1EXQA 3NVMA 4BR0A 4DF8A 5CZ1A 4DFJA 1KLNA 1U48A 1TGOA 3NH1A 4LF7K 2G8WA 4JKAA 1J19A 1Z26A 4HVJA 1SKRA 1J9AA 3GL1A 3VEVA 3O80A 5BR9A 5SZTA 5BPLA 4O5BA 3NHGA 3QICA 5J2QA 3HRGA 3SV4A 4H5VA 1VSHA 3AA4A 3X23A 1MU2A 1YITN 4CEZA 4KI4A 1NGCA 3ZX3A 3VQ5A 3AVMA 4ISGA 1U45A 2PZSA 4DUYK 5AQYA 3WNFA 4AHCA 3HOSA 4FJKA 3MECA 5E26A 1CZBA 3SPYA 3MN5A 3OYJA 4DQQA 5HRRA 4LH5A 3D2EB 4Z0UA 4DV3K 1N32K 3HM9A 2Z1GA 4HUEA 3HZ6A 1BI4B 2D0OA 3E9LA 3WXMB 1WN7A 4KREA 4ID1A 3DOKA 3CJAA 1QVGM 2PYLA 3BUZB 3SJHA 3QINA 2JWLA 2G8HA 5AQRA 2OYQA 3SQ2A 3VQPA 4ZHRA 4B1ZA 2I7PA 1YJNN 1YXQA 4LF4K 4GY2B 4BDYA 1JXBA 4BC4A 4B9MA 5E84A 1RBUA 4CJQA 1IJJA 3H46O 2HNDA 1KFDA 3D0PA 4CJVA 4DSLA 3ZYYX 4IG3A 5M1FA 2V7ZA 1KVAA 3AO5A 3QFPA 1NNEA 4CW7B 2P5OA 1NKEA 3FP5A 3OS0A 4JKCA 1S22A 4RW6A 2V52B 3U3GA 1JLFA 1HNVA 3MK6A 3O4WA 1Z05A 3CMEN 2AEHA 2H3GX 4NB4A 3C65A 3VQDA 3NGIA 5TKWA 1O13A 5BRDA 1IO2A 1HQEA 3AAQA 4KAZA 5AQXA 1FJGK 4YY3K 4I6MB 4CJ7A 1Q9XA 4HCCA 1HR0K 3O5BA 4LFBK 3B6OA 1U04A 4FL9A 4IOAL 2CGLA 3CQXA 4CK3A 3HXMA 3MN7A 3DXMA 4XH4A 5HP1A 3KLHA 4JV5K 3CIPA 1C6VA 1RILA 1VRTA 3WXKA 1NLVA 2E2QA 4FWMA 3ZETA 3M8SA 1VSMA 3MMVA 4I9LA 5J2PA 3VESA 1QZ5A 3C6HA 1BDGA 4JAXA 4CJEA 1BU6O 4A61A 1WSHA 3HSCA 4A57A 4BR2A 1JLBA 2CH5A 3TARA 4CECA 2O8EA 3VQBA 4DR2K 3SQ4A 4H0VB 4N76A 1RT1A 3FZHA 2BDPA 4ILHA 3BP8A 2FBYA 1ZBHA 2FF6A 1LW2A 4FVUA 5AQLA 1S6PA 3RTVA 2UUBK 3ENHA 3QEIA 2HMIA 2QXFA 3B8AX 1VK0A 3K5LA 4LF6K 3HO1A 1LWFA 2A41A 5GIPA 4IXCA 3DLLL 2ZJPL 3DYAA 2PFUA 2QWNA 3CCMN 3W0LA 5KPRA 3KLEA 3MX5A 4DU3A 3TABA 4AILC 3CM5A 2X6SA 2E5LK 4JK8A 2VGNA 2YNGA 5K14A 2E1ZA 3P83D 2DFEA 3SV3A 3CCLN 3DRPA 2KFZA 2Y1IA 4FJMA 4Q0BA 2QEXN 1UA1A 4GVEA 3KLIA 3AV9A 4FO0A 5LL6Z 1TK5A 4NXNK 3M3ZA 3PLAA 3EZ5A 1XWLA 3ENOA 1YJWN 2VG7A 4KV8A 3RSEA 4CJFA 3VMFB 4O0IA 3O8MA 4K0KK 4B8AB 3C6UA 4BWMA 1VSIA 3DXKB 2NRTA 3SBGA 4FWRA 1EX4A 2KW4A 1Y19B 3V9ZA 1EF1A 3PIPL 5AQZA 3CG7A 1YTAA 3U6FA 3VA3A 3CQ8A 3ZLJA 3NCIA 3R1XA 4WQ5A 1Z25A 4DTXA 1OH6A 4JI4K 1ATRA 1OKJA 1KAZA 5AQTA 5FRMA 1VSJA 3PSFA 3C6AA 1HX1A 2WONA 5I3UA 5KRSA 3IG1A 3TAPA 1HJRA 3S3NA 4RW4A 3ZT3A 1YUWA 2HHXA 1HNZK 1J5EK 3QIPA 2F9WA 3AVLA 2ZM6K 5HROA 4EZ9A 3PIOL 4DQ8A 3V81A 5AQGA 4CF0A 1IKXA 4YOUA 1WUAA 2GWKA 4N41A 3K57A 3K9KA 4O0JA 2LBBA 1BL3A 4Z94A 5AQMA 3FZFA 4BRFA 2QWPA 4RCHA 2IGIA 4HCBA 3WNEA 4X62K 3ZSOA 2RKIA 3OYHA 1IG9A 2QWMA 1VQON 5DMRA 4MFBA 4FXDA 2E6LA 3AVNA 1SS6A 2VGMA 4MO5A 4PUOA 5LJVA 1XHZA 4DTJA 3T69A 4CEQA 2KFNA 2UUCK 4DSIA 4V19S 1RTJA 4CEFA 2ETJA 4B1UB 2G8FA 1EETA 1Q8IA 3KWGA 2IC3A 1GC6A 4IJAA 3FFIA 4I6MA 4DSEA 4JI5K 1KXPA 3PX4A 4A5BA 3AVIA 4XH5A 2J4RA 4E7KA 3KHYA 1KAYA 3CF5L 3LAMA 2XHBA 1HRHA 2EHGA 2VCPA 1R59O 3E9PA 5C0YA 1EQYA 2E20A 2I1KA 4CZFA 2KHOA 2VG6A 1KFSA 1MK9B 5MLCQ 3OYKA 3QEVA 3K59A 3SPZA 3CFOA 4BR7A 4BR5A 1JLAA 1TK0A 4CZKA 3THXA 1T03A 3KWIA 1L3VA 1VAZA 4FJNA 4CJ4A 1NKCA 4JI8K 3J80O 5HL7L 5CHIA 1C0FA 1KRPA 2W6LA 4F2RA 3TTCA 4KB1A 3OYDA 5KQDA 1JLCA 4DV5K 3WQUA 4FK2A 3DMJA 1YTUA 2ZE2A 4JD2B 3RMDA 1RDBA 4U67L 4B9LA 4FLXA 3K58A 1EWRA 2ASMA 4L8RB 1LCUA 1VQPN 3VPZA 2FLOA 3KD5E 1VQ6N 1G15A 5BRFA 4BRHA 1HKCA 4O5FA 4CBXA 2FBVA 4BDPA 1RT2A 3GBTA 2GUIA 5GAHP 2Q1NA 5KRTA 5F0XA 4YOYA 3V1OA 1Q86O 3QBWA 1QZ6A 4DR7K 4KO0A 4YOWA 3CCVN 5FRNA 1JCGA 1RBTA 1V4SA 3AVCA 4JI1K 1RT7A 3O4NA 3THVA 3ZEUB 3O9TA 2YHYA 4BRMA 4H5RA 4RW9A 1UOCA 4KHYA 3DXKA 1BISA 3HBTA 4W5TA 4BR9A 3A0IX 2DIKA 3U4LA 3I8DA 3LP0A 4CZHA 4FJHA 4CZLA 2OPRA 4DKWA 3T1AA 3L4IA 3QBXA 3VEXA 3AARA 5AQSA 5LJWA 3TSUA 3NF6A 2P51A 4FLVA 3P31A 1GLLO 1RGIA 2CQUA 4DMNA 3CCEN 5BN8A 1YI2N 2GX9A 2QW9A 2EWSA 4CZIA 2RN2A 5EX5A 3LDNA 4CZMA 3O3GA 5TKYA 4DU4A 5D3GA 2GUPA 1L3SA 2QWLA 1S1VA 3M1FA 4M3TA 3JSMA 1KAXA 1NJYA 5KI6A 3RR7A 3TAQA 3DAWA 1L3UA 4P7IA 3P4IA 1I39A 2LSNA 1CZAN 3NBPA 4CJ3A 1KBLA 1SKSA 4EAHD 4DV7K 4TKNA 4MLEA 3KKSA 3ZSYA 2YHAA 4JN4A 3A8YA 4FCYA 4WFNL 3LM9A 1DTQA 4LY7A 3RWUA 3P38A 4H0TB 3J7AP 2IS3A 4GW6A 3UIQA 3OHRA 4W5OA 1TYQB 4FLWA 4E1JA 3SK3A 4F7GA 1LAWA 3HYFA 4KTWA 1NGGA 1ZXOA 3SUNA 3G6EN 1N33K 1GGOA 1NGFA 4DHYA 1RT6A 2QXLA 3BZCA 3CCJN 4CEOA 4CJRA 1SL1A 3RRGA 1U49A 3KK7A 3VN5A 5H1SQ 3SI6A 3HK2A 3ID6A 3SMPA 2I7NA 5GINA 3K0SA 4EIAA 3M6GA 4IKFA 2QKKA 5AFUH 3ZT2A 3OYAA 5EY4A 4Z4HA 4K42A 2Q36A 1HYZA 2VYPA 1TK8A 4RWTA 4MLHA 4FWKA 1WB9A 1U4BA 1U6ZA 4FM1A 5JVHL 4PKIA 4KTQA 2FF3B 5KPZA 4LF9K 2QM1A 2G8KA 2V7YA 4JD2A 3KJVA 4BRKA 2O8BB 5M1NA 4DR5K 5AQQA 2HBJA 3SUPA 4CD3A 4YOXA 2FC0A 3ASMA 1VQ7N 1BHLA 1BG3A 2HHUA 3VERA 2D5RA 2COPA 4OLBA 3WT0A 3KVGA 4ZRJA 4WFAL 3V9SA 2YI1A 1XHXA 3QNOA 1IG8A 4DR3K 2WTUA 2UXCK 3OYFA 2P9KB 3OVNA 4DS5A 4B9TA 4M41A 3G9WA 4CK1A 3QEWA 3ZEUA 3J7YP 4G9ZA 3AVFA 1O1WA 3BDPA 1JCEA 2YNFA 4JEPA 2O8FB 4FW2A 2HHTA 4AM6A 1M1KO 3C6TA 4M7YA 4FM0A 3VF4A 3HVRA 3NGZA 4YL8A 3SCXA 1XQSC 2AP1A 3LM2A 1BUPA 2OPSA 5AJ3K 4CHNA 1Y97A 3MCAB 4N56A 5FPNA 4CZJA 4WE1A 3LDOA 4U7BA 1HBKA 3GG4A 1NU0A 3K2PA 3HP9A 5HLFA 3EYZA 1B9DA 2YHBA 1KC7A 5ADXA 3HOTA 2KLAA 2D0PA 1VQ8N 2YJFA 1XI1A 2O8CB 1TVRA 3WQTA 4JRPA 1YAGA 3LWLA 2R7YA 2HMPA 2P9SB 4M3RA 3AO1A 1RTHA 1JLQA 1RDCA 1GLJO 2F4VK 2GTDA 4DSKA 4NYFA 4E19A 2HNZA 3C0BA 3ZSZA 2OTLN 4JI7K 5EU7A 3QMLA 4DCHA 1TL1A 3ALYA 4IFVA 3OBWA 4CHQA 4YHHK 3UKRB 1VQ5N 4DU1A 1OH5A 2CGKA 4IJNA 4BWJA 4BGAA 1VSKA 4IBNA 5C2FA 2B6AA 5JMVA 4Z4FA 4OKEA 4FJLA 5HBMA 2DPNA 2FSJA 4ELTA 1S3XA 3WXJA 3NF8A 3LPTA 2E1YA 1YIJN 4Z4GA 4H5WA 1C0MA 3I0SA 2Q0RA 1HPZA 4DLEA 1NJZA 5SWMA 3THWB 3TTFA 2DFFA 2J0MA 1F21A 3CD6N 3IMXA 3MAQA 2W42A 3H45C 3D2FB 3FZLA 4NLBA 1HKBA 4HDOA 3V9UA 4BR4A 1B92A 1X1PA 4O44A 4OVLA 3TAGA 4ICLA 3DI6A 1S1XA 1TAUA 4C1NK 2RF2A 2F8TA 2JWKA 4E7JA 3OBYA 3ZSRA 2EMTA 4OLAA 4B8CA 4NLCA 4X65K 1CXQA 4DV2K 4BGBA 4DQSA 1J53A 3LDQA 3THYB 4IFEA 1RTDA 4JKGB 4DXAB 4H0PA 1NBWA 4HHTA 1HNXK 2WC9A 3J7ZO 4Z4CA 1N5YA 1C0TA 4WQ4A 3ENBA 4H5TA 1K8KB 2HSTA 4ID5A 4BRGA 5M1KA 2O8BA 2ZJRL 2YHWA 4JS4A 2RPIA 2DY4A 3K5MA 2UU9K 5M1PA 4UQGA 1IKVA 1X9JA 5M1QA 2NRWA 3CHWA 1U47A 4O4GA 3CETA 3HT3A 4WCEL 3EO3A 4K25A 4OKJA 1A5VA 4LD0A 3CC7N 3J8AA 2D4WA 3P1GA 2P9KA 2E8AA 2HHSA 2DFHA 3NDKA 5JS1A 1GC7A 2FSNA 3ZX0A 4DFPA 5GAGP 2AL6A 2KQ2A 2ZGZA 1P8ZA 3E9OA 3SUOA 1WBDA 1MWMA 3QFUA 3K5NA 3G10A 2WH5A 3IFRA 5IWAK 1H4RA 3L2RA 2O8FA 3VA0A 2UXBK 3PX0A 3A5LC 3HL8A 4GNIA 3BEXA 3WEEB 5C24A 4RW7A 2IOCA 1MWKA 4BG9A 4IDHA 3EPYA 2BE2A 4L3QA 4BRCA 4B9UA 4CIFA 4JI0K 4EP4A 1VSDA 4AHTA 3T1YK 2D0CA 4JLHA 1ASWA 2FSKA 4CJSA 3M8QA 3RVCA 5JVLA 3ULDA 4BC2A 5FPEA 1C1AA 3TTDA 4FZZA 2OZMA 2D2QA 4JYAK 4KRFA 4JI3K 4CGJA 2KKZA 4CF9A 3ZSVA 1RBVA 4DR6K 5FDLA 4F2SA 2O8CA 3SYZA 4CHZA 5BPMA 3DRSA 3U9DA 3FR0A 1X9WA 2QA4N 1W7AA 4CGDA 1P90A 3CERA 4YDUA 2P9SA 1QQNA 3O08A 1ZC6A 4FJIA 5AQJA 4B3OA 2W41A 4OPJA 2FJ9A 4IWVA 3MN6A 3UB5A 3N4QA 5AZIB 3LZJA 3L4QA 4DSJA 5AQWA 1W9HA 3LP2A 1HYVA 4KTZA 1NJWA 4E0DA 4IOXA 2DTUA 3D2EA 1VSFA 2ZQBA 3BF3A 3NFAA 2HF3A 5HOOA 1BI4A 1HUXA 3L2QA 1BIUA 1E3MA 3HI0A 4IOCL 4BC3A 4B9VA 4FJGA 4KPYA 4Y1DA 3KLFA 2QK9A 1H1VA 4FWNA 3TWHA 4LH4A 3THWA 5A2QO 2P9LB 2PAVA 5HRPA 4NCAA 4TSXA 2E6MA 2D1KA 3EEQA 3FLCO 3WA0A 3TI0A 1HPMA 3FZMA 3D2FA 4JKDA 4JRQA 4O55A 3B6PA 1RT5A 1QS4A 4WF9L 2ZJQL 3S3MA 3AVHA 3QEXA 4IEIA 4LFAK 4NCBA 1ASVA 3WUHA 2HHVA 4CEDA 1IKWA 2BANA 3F9KA 2KZZA 1BCOA 3G4SN 4FW1A 1HB6A 4E7IA 2YX6A 1NGJA 4BY9C 1QSYA 3NVKA 4JKGA 1DT9A 1TL3A 1JL2A 1ST7A 1Q18A 1WSIA 3DLEA 3V9XA 4CBUA 2QWQA 3V1QA 4CFDA 4C8MA 4EKUA 3L2WA 1D5AA 2VG5A 2HF4A 1D4XA 1Z6RA 2PBDA 1OVQA 1X3NA 4HTLA 2D0AA 3LDSA 4WQ5C 3OYGA 1KLMA 3VQ9A 4KH4A 5CR4A 3U8XA 1HLUA 1K6YA 3VENA 1WSJA 1WOQA 4DTNA 5ELZA 3VGMA 2OTJN 3VQAA 4CIGA 3KK1A 2JGUA 3L3UA 1VQ9N 1QHAA 3A2FA 2A40A 4DTUA 3DWLA 3CYMA 4H0XB 3E66A 4O8UA 1Q7YO 3ATVA 5BN9A 2QI2A 3M5RA 2FDQA 3VEYA 1VQKN 4AQYK 3FFKB 4HDQA 2A5XA 4PHTX 3AAPA 4JK9A 3CFPA 3M8PA 3NF7A 2CH6A 4RG8A 2F96A 1LAVA 2PYJA 3WEEA 1QTMA 2GBZA 4M63C 1OH8A 4CJTA 3AA3A 3S3OA 1NGBA 5E41A 5EXWA 3J81O 4DTRA 4C1NI 1UAXA 3MXIA 4CE9A 3D6RA 5DK5A 4AHSA 1NK6A 3CC2N 3IVFA 5C15A 1CLQA 4FOEA 2VWKA 2HOEA 4DSFA 1S6QA 2YKMA 4KHNA 3MEEA 4PKHA 3O9SA 4JS5A 3I55N 3U9ZA 1LOTB 3LALA 4NXMK 2KZMA 4FZYA 4HWIA 1J6ZA 4BRLA 1ASUA 4A2AA 2HHWA 3LWMA 2WUSA 5FLXO 1YJ9N 4DV6K 3L0QA 3LPUA 1BOTO 2EMSA 3C7NB 3I33A 3M8RA 5T7BA 4X66K 4CI6A 3Q7CA 2HBLA 2NUBA 5JLFA 3VQEA 4IO8A 2OPPA 4BREA 5C12A 4JKFA 4K8XA 2Y1JA 4B08A 1RDDA 4CK2A 3T19A 5GAEP 5LMNK 5AZIA 3R6MA 1JXEA 4CGFA 1SAZA 4I9QA 4B3SK 4FLTA 3PSIA 4I7FA 3MXJA 3LDPA 4BRAA 3KLGA 2YVCA 1BA0A 4GV9A 3VQQA 3ZCMA 3TPQA 1NM1A 4BROA 1ILYA 1QHTA 2G8VA 2P9UB 2P9LA 4CFCA 1I94K 2NNWA 4MO4A 3CCUN 1M90O 1K9MO 3H3OB 4K43A 4BE1A 3CI5A 4E89A 1NK7A 3OYBA 4BG8A 4PQUA 4QAGA 1GOCA 4G1QA 1NGIA 3ZDTA 3R9PA 3LL3A 4PKGA 2IVNA 5FROA 3AO2A 3L8BA 3AU5A 3PZDA 4ISEA 1ESVA 3MCPA 2QKBA 1BO5O 1C1BA 4DTSA 1C0UA 4CVNE 1OH7A 3VEWA 3T1HK 1RDWX 5AQIA 4Z4EA 3T7ZA 1RT3A 3TU5A 4M3ZA 3L2VA 1D8YA 5IT9O 1X9SA 1NJXA 3CC4N 3ZSXA 4BQZA 4IFYA 4FOIA 4AF1A 4J2EA 2WFBA 4Y0WA 3TSPA 3PX6A 4HUGA 3OJUA 3HTVA 3OYMA 1NKBA 4BVOA 4M7XA 3O9QA 2G8UA 2YJEA 2Q31A 4DFMA 2NRRA 4FWQA 4J2BA 2D11A 1XC9A 3P39A 3PV8A 1BGXT 5HRSA 4AHUA 2NZTA 2Q3SA 4A59A 2D10A 1HNIA 4B9NA 1ZBFA 2HBKA 3QEPA 4BVPA 5AQHA 2V51B 2A3ZA 2J0JA 1TKTA 4Y1CA 1T6CA 3NF9A 1BQNA 2WOMA 3KTQA 5I9EB 4KH6A 4DS4A 1Y64A 3O9RA 4IO9L 3PO4A 5CYMA 3BINA 4FZXC 3F5TA 4W5RA 4QS8A 1YVNA 2IVOA 3CCRN 4DTMA 5BR8K 1NK4A 1S1UA 1GOBA 3VF6A 2ASOA 5JS2A 3U7DA 3C95A 3EKSA 3NH2A 1SL2A 4H0OA 1RDAA 2WBNA 1B9FA 3I0RA 1RBRA 3DJCA 1N36K 1IBMK 3EN9A 3OS1A 1IH7A 1SKWA 4W5QA 1CZ9A 2HB5A 2P5GA 1WLJA 1X9MA 2HW3A 2CGJA 2F7TA 3BGRA 2GV9A 3HJFA 1SUQA 2YKNA 5J2NA 4CIEA 2P9NB 4E7LA 5KGWA 1CXUA 2P1JA 3V1RA 2X6NA 4ZTFA 4C23A 1RFQA 3CMAN 3O6WA 2R82A 4FSVA 1KSPA 3CJ7A 2ZD1A 3D7EO 4FM2A 1GLAG 1WSEA 4MQ3A 4CYEA 1SL0A 3ULEB 3SZ2A 1NTIA 3LP1A 3FGUA 3WNGA 4BRPA 5DM7L 1TAQA 1V4TA 5FPDA 2HE7A 1S72N 2P9UA 5AQVA 2J0KA 3JS6A 3HVTA 4N47A 2PY5A 4CHOA 2YV0X 4CGGA 3RMBA 4FK4A 3S41A 1HB8A 5LMUK 1T44A 3C94A 1QVFM 1TUUA 4JI2K 3S9HA 4FLYA 2UUAK 2ASPA 1DEJA 1GLFO 3QNNA 4PL7A 3FE1A 3OJSA 1TUYA 4DWIA 5JICA 3AU4A 1ITGA 5KQ8A 4DTPA 4CEAA 5AFUA 3NMUA 3VGLA
chains in the Genus database with same CATH topology
4YORA 1ACAA 4EHTA 4FWSA 2FSKA 1NGEA 2VCPA 5JVLA 1R59O 3EKUA 2NLXA 3E9PA 1GLBG 1EQYA 2E20A 2I1KA 4BC2A 3FZKA 2KHOA 4CZFA 5C10A 5FPEA 1MK9B 2IIRA 3MWPA 3A5MC 3TTDA 5MLCQ 2D2QA 2KKZA 4BR7A 2BH1A 1NGAA 3UKUB 1NGDA 1T6DA 4BR5A 3G71N 3AGRA 3TSQA 4BRDA 5F1XA 4CZKA 3KWIA 1S72N 5BPMA 1VAZA 3U9DA 5AQKA 3FR0A 3VEOA 1DGKN 2QA4N 3EL2A 3MX2A 5HL7L 1P90A 3CERA 4YDUA 2P9SA 1C0FA 5CHIA 1QQNA 3I56N 3TTCA 2P9PA 2QWRA 3FLVA 1TYQA 3GDQA 4DB3A 1QQMA 4FWOA 3O08A 1ZC6A 5AQNA 5KQDA 3AGKA 4UY8O 3MDQA 5AQJA 3RSEB 2E2PA 2W41A 3WQUA 4OO1J 1JJ2M 3A5OC 2HRJA 5LY3A 2FJ9A 5ADXH 4IWVA 3PVLA 4JD2B 3MN6A 3UB5A 4U67L 3N4QA 5AZIB 3GE1A 3L4QA 3MN9A 3L6QA 2ITMA 1VQ6N 2ASMA 4ZRIA 1LCUA 4YOVA 3VPZA 2FLOA 1VQPN 5AQWA 3VTIA 1E4FT 1DKGD 3ID8A 5BRFA 3VGKA 4BRHA 3E1YA 1HKCA 1JCFA 1KC8O 4IOXA 4LC9B 4O5FA 1ATSA 4KH5A 4CBXA 3GBTA 3D2EA 5GAHP 2Q1NA 5F0XA 4EHUA 2Q97A 4YOYA 1XUPO 3BF3A 3G25A 5GADP 2HF3A 5HOOA 3QBWA 1HUXA 1Q86O 1GLEG 1QZ6A 5EVZA 3QB0A 4CD1A 1BA1A 4YOWA 5F2RA 3CCVN 3HI0A 4IOCL 1JCGA 5EOYA 4BC3A 1V4SA 1H1VA 3C7NA 4FWNA 1Q82O 5AQPA 1T3VA 4MDAA 1MDUB 1VBGA 4B1XB 5AQUA 1X3MA 2P9LB 3ZEUB 2PAVA 1KD1O 4FPBA 4F9OA 2D1KA 1G99A 3F9MA 2YHYA 3FLCO 3O9TA 4H5RA 5FPMA 4BRMA 4GV3A 1ZBSA 3VF2A 3DXKA 1GG3A 3WA0A 1HPMA 3FZMA 3HBTA 3JXUA 1NI2A 3D2FA 3MWTA 4BR9A 4JKDA 4CBWA 3A0IX 5GIOA 1ISNA 3ZX2A 4WF9L 2ZJQL 2DIKA 3U4LA 4BQLA 1HKGA 3I8BA 4CZHA 4IEIA 4CZLA 5BPNA 3DXMB 4DKWA 3UE5A 3WUHA 4YOTA 3L4IA 1GLCG 3QBXA 4NY0A 3VEXA 3AARA 5AQSA 3G4SN 3O9UA 3ATUA 5LJWA 2NRZA 3ZETB 3TSUA 1HB6A 4GXBA 4AM7A 2YX6A 3WXIA 1NGJA 3H3NO 1YF5L 3EE9A 3P31A 1NGHA 4JKGA 1DT9A 4BY9C 3NVKA 1GLLO 1ST7A 1Q18A 3CPEA 1RGIA 3SAHA 1XC3A 4CBUA 2QWQA 3HM8A 3EE8A 4A5AA 4B1VA 2CQUA 4EKUA 3CCEN 3O1BA 5BN8A 2GX9A 1YI2N 2QW9A 2EWSA 2X0SA 5AZJA 4CZIA 5EX5A 5BRHA 2E2NA 2HF4A 3LDNA 4CZMA 1D4XA 4B1YB 1Z6RA 3CQYA 2PBDA 5B8HA 1X3NA 3Q7BA 4HTLA 2P9NA 2GUPA 5TKYA 3WXLA 4H0YB 1NVLA 4XH1A 3VTHA 1DIKA 1MIXA 4WQ5C 2QWLA 4KH4A 2ZF5O 2FXUA 3M1FA 5CR4A 5AQFA 3U8XA 1HLUA 4FWPA 1KAXA 3SBTA 3OA9A 3VENA 4A2BA 4JNEA 2A42A 3DAWA 1SQKA 1WOQA 3H1QA 4P7IA 3CXCM 5IJMA 3P4IA 5ELZA 3ULEA 1EO1A 3SAGA 2CB8A 4OPAA 3VGMA 1CZAN 4WQ4C 2OTJN 1KBLA 1VQ9N 1QHAA 2A40A 4EAHD 2YHXA 3DWLA 3VEZA 4JKBA 1SGHA 4BRIA 4TKNA 3CJCA 3E66A 3NVMA 4H0XB 4MLEA 4O8UA 3ATVA 4BR0A 1Q7YO 5BN9A 4JN4A 2QI2A 3A8YA 3CJBA 3KZBA 3M5RA 2FDQA 3VEYA 1VQKN 3FFKB 4JKAA 1J19A 4HDQA 2A5XA 4PHTX 4WFNL 3AAPA 1KQSM 4JK9A 3LM9A 4EFHA 2NRXA 1NJIO 3GL1A 3VEVA 3O80A 5BR9A 2CH6A 5BPLA 4BRNA 3QICA 3P38A 4H0TB 3HRGA 3WEEA 4H5VA 5C0YA 3OHRA 1TYQB 2OANA 3X23A 1YITN 4M63C 2BUPA 4E1JA 4ILJA 1NGBA 4F7GA 3SK3A 1NGCA 5EXWA 3ZX3A 4C1NI 5JLHA 2RQ1A 1NGGA 1ZXOA 3H6EA 4ISGA 3BF1A 3D6RA 3CC2N 3G6EN 3IVFA 5C15A 1VQNN 2P9IB 2RE2A 4FOEA 2HOEA 5AQYA 1GGOA 1NGFA 1E4GT 2GEMA 4DHYA 3U8ZA 2QXLA 3HOSA 3CCJN 4PKHA 3O9SA 4CZEA 3I55N 3KK7A 3U9ZA 5H1SQ 5E26A 1LOTB 3ID6A 3MN5A 3SMPA 2I7NA 3D2EB 5GINA 1JDEA 3M6GA 4EIAA 4HWIA 3UKRA 3UKUA 1J6ZA 3HZ6A 5AFUH 4BRLA 5EY4A 4K42A 2Q36A 2D0OA 4A2AA 3E9LA 2VYPA 3WXMB 2WUSA 1U2VB 1YJ9N 4RWTA 4MLHA 3N4PA 4FWKA 3L0QA 1BOTO 2EMSA 3C7NB 3CJAA 3I33A 1QVGM 3BUZB 3SJHA 4FWLA 1U6ZA 4CI6A 2JWLA 3Q7CA 2HBLA 5JVHL 4PKIA 5JLFA 1YHQN 5AQRA 4IO8A 4BREA 5C12A 2FF3B 4JKFA 5KPZA 5JVGL 2QM1A 4B1ZA 2I7PA 2V7YA 4JD2A 1YXQA 4BRKA 1YJNN 5M1NA 4GY2B 5GAEP 5AZIA 3R6MA 3SLCA 5AQQA 2HBJA 1SAZA 4BC4A 4CD3A 4YOXA 1VQ4N 4O8KA 4WYBA 5E84A 1IJJA 3H46O 1VQ7N 1BG3A 3VERA 2COPA 3WT0A 3ZYYX 3KVGA 4YDUC 4ZRJA 5M1FA 4WFAL 2V7ZA 3QFPA 3QIJA 2YI1A 2AA4A 3LDPA 4BRAA 1IG8A 2YVCA 3FP5A 1BA0A 1RDUA 3QDKA 4JKCA 1S22A 4NO7A 4GV9A 2P9KB 2Q2RA 2YCHA 3G9WA 3TPQA 1NM1A 4JHDB 2V52B 4BROA 1ILYA 3MK6A 2P9UB 2P9LA 1Z05A 3O4WA 3ZEUA 3CMEN 4G9ZA 2NNWA 2AEHA 2H3GX 4MO4A 3C65A 4NB4A 5TKWA 3CCUN 3CCSN 1O13A 1M90O 3F2KA 5BRDA 1JCEA 3H3OB 4K43A 4JEPA 1K9MO 1K8KA 4K41A 3CI5A 3AAQA 2E88A 4AM6A 5AQXA 4I6MB 4BG8A 4CJ7A 1M1KO 1ATNA 3O5BA 4M7YA 1K73O 3H1VX 4FL9A 4IOAL 1E5WA 2CGLA 3CQXA 3VF4A 3MN7A 4YL8A 3DXMA 1NGIA 4ILGB 1XQSC 3ZDTA 4XH4A 2AP1A 3LM2A 3R9PA 5CE3A 3LL3A 1BUPA 2RHKA 3CIPA 3GOIA 2IVNA 4OPHA 4PKGA 3WXKA 1NLVA 2E2QA 4FWMA 3ZETA 3AU5A 3PZDA 1MIZB 4ISEA 3MCAB 2F9TA 3IDHA 1ESVA 3MMVA 3MCPA 5FPNA 1BO5O 3VESA 4CZJA 3LDOA 2ABDA 1QZ5A 4U7BA 3C6HA 1HBKA 1BDGA 1VQMN 4JKHA 2QTDA 3GG4A 4JAXA 3VEWA 1BU6O 1RDWX 1SZ2A 3K9JA 2GWJA 5AQIA 3T7ZA 4A61A 3CJ9A 3TU5A 3HSCA 4A57A 4BR2A 2CH5A 1MK7B 2QWOA 4MDBA 2ZGYA 1KC7A 5ADXA 4H0VB 2KLAA 2D0PA 4BQZA 3HOTA 3FZHA 1BWFO 4RTFD 3CC4N 2YJFA 4FOIA 3WQTA 4ILHA 3BP8A 4FPAA 4AF1A 2WFBA 4Y0WA 3TSPA 2FF6A 1YAGA 3CJ1A 3IUCA 3HTVA 1W2BM 4FVUA 4BVOA 1Q81O 2HMPA 2P9SB 4ZRKA 2UYTA 1GLDG 5AQLA 4M7XA 3O9QA 2W40A 3ENHA 1GLJO 2P9PB 2GTDA 2YJEA 3B8AX 2Q31A 2NRRA 4XEIA 3C0BA 4FWQA 2A41A 2OTLN 2D11A 4H5NA 3P39A 5GIPA 4IXCA 3DLLL 2ZJPL 3QMLA 4DCHA 2NZTA 4KBOA 4J8FA 1VQ8N 3EZWA 4A59A 2PFUA 2QWNA 3CCMN 2D10A 3W0LA 5KPRA 3OBWA 2HBMA 3CPWM 3MX5A 2HBKA 3AY9A 3UKRB 5AQHA 4BVPA 1VQ5N 2NRVA 2A3ZA 2CGKA 2V51B 4IJNA 2J0JA 4BGAA 4JK8A 2I1JA 2VGNA 2ZWHA 5C2FA 1T6CA 5JMVA 1OVYA 2E1ZA 4B1WB 3CCLN 2DPNA 2FSJA 1S3XA 4GV6A 3WXJA 2QEXN 5I9EB 2E1YA 4GVEA 4KH6A 1YIJN 1Y64A 3O9RA 4IO9L 4FO0A 4H5WA 3BINA 3F5TA 4QS8A 3O1WA 3OW2M 2Q0RA 1YVNA 4H03B 3M3ZA 3PLAA 3TTFA 5C2DA 2IVPA 3VETA 2IVOA 3ENOA 3CCRN 2J0MA 2P9IA 1YJWN 3RSEA 3CD6N 1MA9B 3IMXA 3O8MA 3RVCA 3VMFB 5M1OA 3SAFA 3DXKB 2NRTA 3SBGA 3H45C 3VF6A 2ASOA 4FWRA 4WFBL 3D2FB 3FZLA 4NLBA 1Y19B 1HKBA 4HDOA 3U7DA 3R8EA 1EF1A 4BR4A 3LDLA 2NRHA 3CCQN 3EKSA 3PIPL 3R3LA 5AQZA 5KPTA 3VOVA 1HJOA 4C1NK 2JWKA 4H0OA 3OBYA 2WBNA 3R1XA 4WQ5A 2EMTA 3DJCA 4NLCA 1ATRA 1OKJA 1U2VA 1KAZA 2A6AA 3EN9A 5AQTA 4A62A 4BGBA 3LDQA 4BRQA 3C6AA 4IFEA 1HX1A 4JKGB 4ISFA 1W97L 4DXAB 4H0PA 1NBWA 5DM6L 1C0GA 2WC9A 3J7ZO 4WQ4A 3NMUA 3ENBA 1YUWA 2CGJA 2F7TA 4H5TA 4B9QA 1K8KB 5AZJB 2HSTA 4BRGA 2F9WA 4IEEA 5M1KA 1N8RO 3PIOL 2YHWA 2Q0UA 2ZJRL 4DQ8A 3A5NC 2P9NB 5AQGA 4QS7A 4YOUA 1WUAA 5M1PA 2GWKA 4C23A 1RFQA 3CMAN 3O6WA 2R82A 3K9KA 2ZPYA 2LBBA 4FSVA 3CJ7A 4Z94A 3D7EO 5AQMA 4BC5A 1GLAG 1X9JA 5M1QA 2NRWA 3CHWA 3FZFA 4BRFA 2QWPA 2E2OA 4IZ9A 5AR0A 3CETA 4CYEA 4RCHA 3ULEB 4WCEL 3EO3A 4K25A 1NTIA 4QS9A 3CC7N 3FGUA 3J8AA 2D4WA 4BRPA 2P9KA 2E8AA 5DM7L 1NMDA 1GC7A 1V4TA 2FSNA 2QWMA 4JHDA 3ZX0A 5FPDA 1K8AO 5GAGP 1VQON 2HE7A 4JK7A 2AL6A 1SS6A 2P9UA 2VGMA 4MO5A 2ZGZA 1P8ZA 5LJVA 5AQOA 5AQVA 3E9OA 2J0KA 1VQLN 3JS6A 3T69A 1MWMA 3QFUA 4BRCA 2WH5A 3SMSA 3IFRA 4B1UB 1H4RA 4PL8A 3S41A 1HB8A 3KWGA 3A5LC 1T44A 5BREA 1NWKA 4JKEA 4GNIA 1TUUA 1QVFM 1GC6A 2ASPA 3IKMA 1DEJA 4I6MA 3BEXA 1GLFO 4IJAA 3W3DA 3WEEB 4PL7A 1KXPA 2BTFA 3FE1A 1TUYA 5JICA 3AU4A 1MWKA 4A5BA 2VWBA 4BG9A 4R79A 4XH5A 2J4RA 4IDHA 5KQ8A 3EPYA 3KHYA 1KAYA 3CF5L 4L3QA 1VBHA 5AFUA 4CZGA 2GELA 3VGLA 1QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9L A;  3E9O A;  4JKB A;  3E66 A;  3E9P A;  4JKA A;  4JKE A;  4JK9 A;  4ILH A;  4JKC A;  4JKG B;  4ILG B;  3SBT A;  4JKF A;  3SBG A;  4JK8 A;  4JKG A;  3ENB A;  4ILJ A;  4JK7 A;  4JKH A;  4JKD A; 
#chains in the Genus database with same CATH topology
 4CFB A;  1ACA A;  3RR8 A;  4FWS A;  4KFB A;  1NGE A;  2HHH K;  3HST B;  3SQ1 A;  3FZK A;  3A5M C;  1WSF A;  4FJJ A;  3QIO A;  2OCE A;  1FKP A;  2BH1 A;  3UKU B;  2O4G A;  1T6D A;  3G71 N;  3TSQ A;  5F1X A;  2OZS A;  2A1R A;  5AQK A;  1XMQ K;  3VEO A;  1DGK N;  1N6Q A;  3MX2 A;  4AH9 A;  1C1C A;  1TYQ A;  2QWR A;  3GDQ A;  4DB3 A;  1QQM A;  4FWO A;  5AQN A;  4QOZ B;  3AGK A;  4KB0 A;  3RSE B;  4Q5V A;  2E2P A;  2FBT A;  3DRR A;  3PUF A;  4F4K A;  4OO1 J;  3A5O C;  3NAE A;  1S9G A;  1D9D A;  4CFA A;  4CHY A;  3PVL A;  5C25 A;  4H4O A;  3GE1 A;  3MN9 A;  3OYN A;  4YOV A;  3VTI A;  3ID8 A;  1NK0 A;  3VGK A;  1KC8 O;  4LC9 B;  4KH5 A;  2A1S A;  3AVJ A;  1N34 K;  5CY4 A;  4EHU A;  5HRN A;  1LV5 A;  1UA0 A;  1XUP O;  1S5J A;  2B5J A;  1GLE G;  4CD1 A;  4M3U A;  3QB0 A;  1BA1 A;  4F8R A;  5EOY A;  1YVU A;  4OGE A;  1Q82 O;  4MDA A;  1NK8 A;  1MDU B;  3VQ6 A;  1KD1 O;  4FPB A;  4H4M A;  4F9O A;  1G99 A;  3F9M A;  5FPM A;  1ZBS A;  1BCM A;  3VF2 A;  1GG3 A;  1W0H A;  3JXU A;  4KHP K;  3MWT A;  4E1N A;  4DR1 K;  4FJ7 A;  4CBW A;  5GIO A;  4KKO A;  1ISN A;  3ZX2 A;  4BQL A;  1HKG A;  3P5J A;  3I8B A;  3OS2 A;  4ZTJ A;  1SV5 A;  2YNH A;  5BPN A;  3UE5 A;  3O9U A;  4IG0 A;  2G8I A;  2NRZ A;  3V4I A;  4AM7 A;  3WXI A;  1YF5 L;  4KHS A;  3CPE A;  4CCH A;  3SAH A;  1FKO A;  1LWE A;  3HM8 A;  3V6D A;  4M3Y A;  3VQC A;  5CYQ A;  3IS9 A;  2X0S A;  2E2N A;  4M45 A;  4B1Y B;  2VWJ A;  5B8H A;  1XNR K;  4E1M A;  3Q7B A;  2P9N A;  1RBS A;  3VTH A;  5KGX A;  1DIK A;  1MIX A;  5I42 A;  2FXU A;  4ELV A;  4FJ8 A;  4FWP A;  3OA9 A;  4YNQ A;  4A2B A;  3HP6 A;  1WNS A;  5IJM A;  3ULE A;  3SAG A;  2XY5 A;  2CB8 A;  4OPA A;  4WQ4 C;  1WAF A;  1EP4 A;  2YHX A;  3VEZ A;  4CGH A;  4JKB A;  4BRI A;  3CJC A;  3DLB A;  3CJB A;  3KZB A;  4OKK A;  3AVB A;  1KQS M;  3THX B;  4EFH A;  2NRX A;  1NJI O;  4LSL A;  4BRN A;  4DQR A;  3OTO K;  3IAY A;  2OAN A;  2BUP A;  3HPO A;  1TKX A;  4ILJ A;  5JLH A;  2RQ1 A;  3H6E A;  3BF1 A;  4X64 K;  2OA8 A;  4B3M K;  1VQN N;  2P9I B;  2RE2 A;  4C8K A;  2XY7 A;  4I2P A;  3ZSW A;  1E4G T;  2GEM A;  3TR8 A;  3U8Z A;  4CZE A;  2Z1I A;  1TKD A;  1BIZ A;  3TAE A;  1JDE A;  4HTU A;  3UKR A;  3UKU A;  4AHR A;  1NK9 A;  3K5O A;  4CJW A;  4B9S A;  2AJQ A;  1U2V B;  4Z4I A;  3N4P A;  4E3S A;  4OPK A;  4FWL A;  2W6K A;  1LWC A;  1YHQ N;  3ZT1 A;  2OPQ A;  5JVG L;  4NYN A;  3H08 A;  4FJ5 A;  3SLC A;  1EKE A;  1S1T A;  2Z1H A;  4O8K A;  4WYB A;  3AA5 X;  4CES A;  1JLE A;  4HUF A;  4K8Z A;  4YDU C;  1R0A A;  2FBX A;  1T8E A;  3QIJ A;  1XNQ K;  2AA4 A;  3F73 A;  1RDU A;  3QDK A;  4NO7 A;  4CEB A;  3ZT0 A;  2Q2R A;  2YCH A;  1S9E A;  4CER A;  4JHD B;  3THY A;  3EY1 A;  3VQ8 A;  3KKR A;  4PA1 A;  3CCS N;  2ITG A;  3F2K A;  3LP3 A;  1K8K A;  4K41 A;  1VSL A;  2E88 A;  1RCH A;  1ATN A;  4LF5 K;  4QCL A;  3MEG A;  4CF8 A;  1K73 O;  3H1V X;  1E5W A;  3DM2 A;  4DV1 K;  4DV4 K;  3DLH A;  2KTQ A;  4B3R K;  4ILG B;  1VRU A;  5CE3 A;  2HVI A;  4OPH A;  2RHK A;  3GOI A;  1JLG A;  4DF4 A;  1MIZ B;  3RMC A;  4AHV A;  2F9T A;  3IDH A;  1L3T A;  2ABD A;  5J2M A;  4F3O A;  1VQM N;  4JKH A;  2QTD A;  3K9J A;  1SZ2 A;  1D9F A;  2UXD K;  2GWJ A;  1IV0 A;  3CJ9 A;  4EP5 A;  4DQP A;  3SQ0 A;  1MK7 B;  2QWO A;  4GVM A;  4MDB A;  2ZGY A;  3D45 A;  4CJP A;  4RTF D;  1BWF O;  4FPA A;  1KCF A;  3OYL A;  1NK5 A;  3CJ1 A;  1HQU A;  3IUC A;  1W2B M;  3BY5 A;  4DLG A;  2UYT A;  4ZRK A;  1Q81 O;  1GLD G;  2O4I A;  1VHX A;  2W40 A;  2P9P B;  4XEI A;  2JLE A;  3KD1 E;  4FK0 A;  3ITH A;  1YT3 A;  4H5N A;  3HPH A;  4KBO A;  2Z1J A;  4J8F A;  4N5S A;  3PY8 A;  4C8O A;  1FXX A;  3EZW A;  3E01 A;  4J2D A;  3QET A;  4CEE A;  2HBM A;  3CPW M;  3QER A;  4M3X A;  3JAM O;  3AY9 A;  2NRV A;  4PWD A;  2I1J A;  2ZWH A;  1OVY A;  4B1W B;  3LAK A;  4BDZ A;  4GV6 A;  1NOZ A;  4BE0 A;  4IDK A;  1DLO A;  1J54 A;  3IRX A;  3O1W A;  3OW2 M;  3NE6 A;  4H03 B;  3VQ7 A;  1RTI A;  3AVG A;  3QLH A;  5C2D A;  2IVP A;  3VET A;  3CFR A;  1TKZ A;  2D0B A;  1NMN A;  2HNY A;  2P9I A;  1MA9 B;  3SAF A;  5M1O A;  3CM6 A;  3V9W A;  1A5W A;  4WFB L;  1DTT A;  4DUZ K;  3R8E A;  4PY5 A;  3CCQ N;  3LDL A;  1KVC A;  2NRH A;  3R3L A;  5KPT A;  3AO4 A;  3VOV A;  1HJO A;  4LSN A;  3DLK A;  1QSS A;  2ATQ A;  4B3T K;  4NCG A;  4KHW A;  3DLR A;  3TAM A;  4FLZ A;  1U2V A;  2A6A A;  2HHQ A;  4YFU A;  2IDO A;  4A62 A;  4BRQ A;  2E4L A;  4DQI A;  4ISF A;  1W97 L;  4GMJ B;  5DM6 L;  1C0G A;  4KHQ A;  1RNH A;  4XIU A;  4B9Q A;  5AZJ B;  3KIO A;  4IEE A;  1N8R O;  1QQC A;  3TAF A;  2Q0U A;  3A5N C;  3OYI A;  4GKJ K;  1REV A;  1RT4 A;  4QS7 A;  2O8D B;  3ISN C;  3DOL A;  2ZPY A;  1WBB A;  1LW0 A;  2XY6 A;  4BC5 A;  1NG9 A;  4LFC K;  3AA2 A;  5AR0 A;  2E2O A;  4IZ9 A;  4C8L A;  4CJU A;  4QS9 A;  4CHP A;  3SNN A;  3QO9 A;  4JI6 K;  2X74 A;  1NMD A;  1K8A O;  4JHD A;  2XRI A;  4JK7 A;  1A5X A;  5AQO A;  1HNW K;  1VQL N;  4CF1 A;  3SMS A;  3RMA A;  4R5P A;  4M42 A;  4PL8 A;  4J2A A;  5BRE A;  1NWK A;  4JKE A;  3L3V A;  4C8N A;  3IKM A;  3MXM A;  3W3D A;  3O3F A;  3T3F A;  2BTF A;  4M3W A;  4DR4 K;  4R79 A;  2VWB A;  3HPG A;  1ZBI A;  1HYS A;  4BAC A;  4CJK A;  4OGC A;  2VQF K;  3SJJ A;  4H8K A;  1L5U A;  1VBH A;  4CZG A;  2GEL A;  1QQO A;  4YOR A;  4ELU A;  1J5O A;  4EHT A;  4FYD A;  2B4J A;  4OX9 K;  4DFK A;  3EKU A;  3O3H A;  2NLX A;  1GLB G;  3LAN A;  1VQ4 N;  1NOY A;  5C10 A;  2IIR A;  3MWP A;  2XY8 A;  4E7H A;  3TAN A;  4GKK K;  2IAJ A;  5C42 A;  1T7P A;  1NGA A;  1NGD A;  3AGR A;  1Q9Y A;  4BRD A;  1UWB A;  5CZ2 A;  3EL2 A;  1HMV A;  4W5N A;  3OYE A;  3I56 N;  3LZI A;  2P9P A;  3FLV A;  4UY8 O;  1WAJ A;  1TV6 A;  1GOA A;  1I3A A;  3MDQ A;  3RRH A;  3VQ4 A;  1JJ2 M;  2HRJ A;  5LY3 A;  3ZSQ A;  5ADX H;  4BE2 A;  3O4Q A;  1S1W A;  4CGI A;  2ITM A;  3L6Q A;  4CF2 A;  4ZRI A;  4DG1 A;  1E4F T;  1DKG D;  3NH0 A;  1KVB A;  3E1Y A;  1JCF A;  1ATS A;  4DV0 K;  3OYC A;  4LF8 K;  1JL1 A;  3WNH A;  4FLU A;  2Q97 A;  4CJ5 A;  1QE1 A;  3G25 A;  5GAD P;  1IKY A;  5EVZ A;  4EZ6 A;  5F2R A;  1ZBU A;  3AVA A;  3JYT A;  1IBL K;  3C7N A;  5AQP A;  1T3V A;  1VBG A;  4B1X B;  5AQU A;  4FJ9 A;  3NGY A;  1X3M A;  1IBK K;  3PO5 A;  5KTQ A;  1EWQ A;  4GV3 A;  1NI2 A;  3SUQ A;  4KHU A;  3DXM B;  4FJX A;  1ZYQ A;  1VSE A;  1WSG A;  4YOT A;  1XMO K;  1GLC G;  4NY0 A;  3KK2 A;  2HVH A;  3ATU A;  4DTO A;  3ZET B;  3AO3 A;  1T05 A;  4GXB A;  4I2Q A;  4RW8 A;  3H3N O;  3BZK A;  3EE9 A;  1NGH A;  2F8S A;  4F3T A;  1ZBL A;  1KTQ A;  1XC3 A;  4A5A A;  3EE8 A;  4B1V A;  1JKH A;  3G0Z A;  3KK3 A;  3QES A;  1QSL A;  1FW6 A;  3O1B A;  2XO7 A;  5AZJ A;  2O8E B;  5BRH A;  2VQE K;  2YNI A;  3CQY A;  4CJL A;  1BQM A;  3WXL A;  4H0Y B;  4KI6 A;  1NVL A;  3AVK A;  4XH1 A;  2O8D A;  2ZF5 O;  3L2U A;  5AQF A;  3SBT A;  3DLG A;  3OY9 A;  4JNE A;  2A42 A;  1FK9 A;  1SQK A;  3U3Y A;  3H1Q A;  3CXC M;  4OJR A;  1EO1 A;  3MED A;  3ZT4 A;  2BGG A;  4FVM A;  2I5J A;  2EX3 A;  2X78 A;  5J1E A;  1SGH A;  1EXQ A;  3NVM A;  4BR0 A;  4DF8 A;  5CZ1 A;  4DFJ A;  1KLN A;  1U48 A;  1TGO A;  3NH1 A;  4LF7 K;  2G8W A;  4JKA A;  1J19 A;  1Z26 A;  4HVJ A;  1SKR A;  1J9A A;  3GL1 A;  3VEV A;  3O80 A;  5BR9 A;  5SZT A;  5BPL A;  4O5B A;  3NHG A;  3QIC A;  5J2Q A;  3HRG A;  3SV4 A;  4H5V A;  1VSH A;  3AA4 A;  3X23 A;  1MU2 A;  1YIT N;  4CEZ A;  4KI4 A;  1NGC A;  3ZX3 A;  3VQ5 A;  3AVM A;  4ISG A;  1U45 A;  2PZS A;  4DUY K;  5AQY A;  3WNF A;  4AHC A;  3HOS A;  4FJK A;  3MEC A;  5E26 A;  1CZB A;  3SPY A;  3MN5 A;  3OYJ A;  4DQQ A;  5HRR A;  4LH5 A;  3D2E B;  4Z0U A;  4DV3 K;  1N32 K;  3HM9 A;  2Z1G A;  4HUE A;  3HZ6 A;  1BI4 B;  2D0O A;  3E9L A;  3WXM B;  1WN7 A;  4KRE A;  4ID1 A;  3DOK A;  3CJA A;  1QVG M;  2PYL A;  3BUZ B;  3SJH A;  3QIN A;  2JWL A;  2G8H A;  5AQR A;  2OYQ A;  3SQ2 A;  3VQP A;  4ZHR A;  4B1Z A;  2I7P A;  1YJN N;  1YXQ A;  4LF4 K;  4GY2 B;  4BDY A;  1JXB A;  4BC4 A;  4B9M A;  5E84 A;  1RBU A;  4CJQ A;  1IJJ A;  3H46 O;  2HND A;  1KFD A;  3D0P A;  4CJV A;  4DSL A;  3ZYY X;  4IG3 A;  5M1F A;  2V7Z A;  1KVA A;  3AO5 A;  3QFP A;  1NNE A;  4CW7 B;  2P5O A;  1NKE A;  3FP5 A;  3OS0 A;  4JKC A;  1S22 A;  4RW6 A;  2V52 B;  3U3G A;  1JLF A;  1HNV A;  3MK6 A;  3O4W A;  1Z05 A;  3CME N;  2AEH A;  2H3G X;  4NB4 A;  3C65 A;  3VQD A;  3NGI A;  5TKW A;  1O13 A;  5BRD A;  1IO2 A;  1HQE A;  3AAQ A;  4KAZ A;  5AQX A;  1FJG K;  4YY3 K;  4I6M B;  4CJ7 A;  1Q9X A;  4HCC A;  1HR0 K;  3O5B A;  4LFB K;  3B6O A;  1U04 A;  4FL9 A;  4IOA L;  2CGL A;  3CQX A;  4CK3 A;  3HXM A;  3MN7 A;  3DXM A;  4XH4 A;  5HP1 A;  3KLH A;  4JV5 K;  3CIP A;  1C6V A;  1RIL A;  1VRT A;  3WXK A;  1NLV A;  2E2Q A;  4FWM A;  3ZET A;  3M8S A;  1VSM A;  3MMV A;  4I9L A;  5J2P A;  3VES A;  1QZ5 A;  3C6H A;  1BDG A;  4JAX A;  4CJE A;  1BU6 O;  4A61 A;  1WSH A;  3HSC A;  4A57 A;  4BR2 A;  1JLB A;  2CH5 A;  3TAR A;  4CEC A;  2O8E A;  3VQB A;  4DR2 K;  3SQ4 A;  4H0V B;  4N76 A;  1RT1 A;  3FZH A;  2BDP A;  4ILH A;  3BP8 A;  2FBY A;  1ZBH A;  2FF6 A;  1LW2 A;  4FVU A;  5AQL A;  1S6P A;  3RTV A;  2UUB K;  3ENH A;  3QEI A;  2HMI A;  2QXF A;  3B8A X;  1VK0 A;  3K5L A;  4LF6 K;  3HO1 A;  1LWF A;  2A41 A;  5GIP A;  4IXC A;  3DLL L;  2ZJP L;  3DYA A;  2PFU A;  2QWN A;  3CCM N;  3W0L A;  5KPR A;  3KLE A;  3MX5 A;  4DU3 A;  3TAB A;  4AIL C;  3CM5 A;  2X6S A;  2E5L K;  4JK8 A;  2VGN A;  2YNG A;  5K14 A;  2E1Z A;  3P83 D;  2DFE A;  3SV3 A;  3CCL N;  3DRP A;  2KFZ A;  2Y1I A;  4FJM A;  4Q0B A;  2QEX N;  1UA1 A;  4GVE A;  3KLI A;  3AV9 A;  4FO0 A;  5LL6 Z;  1TK5 A;  4NXN K;  3M3Z A;  3PLA A;  3EZ5 A;  1XWL A;  3ENO A;  1YJW N;  2VG7 A;  4KV8 A;  3RSE A;  4CJF A;  3VMF B;  4O0I A;  3O8M A;  4K0K K;  4B8A B;  3C6U A;  4BWM A;  1VSI A;  3DXK B;  2NRT A;  3SBG A;  4FWR A;  1EX4 A;  2KW4 A;  1Y19 B;  3V9Z A;  1EF1 A;  3PIP L;  5AQZ A;  3CG7 A;  1YTA A;  3U6F A;  3VA3 A;  3CQ8 A;  3ZLJ A;  3NCI A;  3R1X A;  4WQ5 A;  1Z25 A;  4DTX A;  1OH6 A;  4JI4 K;  1ATR A;  1OKJ A;  1KAZ A;  5AQT A;  5FRM A;  1VSJ A;  3PSF A;  3C6A A;  1HX1 A;  2WON A;  5I3U A;  5KRS A;  3IG1 A;  3TAP A;  1HJR A;  3S3N A;  4RW4 A;  3ZT3 A;  1YUW A;  2HHX A;  1HNZ K;  1J5E K;  3QIP A;  2F9W A;  3AVL A;  2ZM6 K;  5HRO A;  4EZ9 A;  3PIO L;  4DQ8 A;  3V81 A;  5AQG A;  4CF0 A;  1IKX A;  4YOU A;  1WUA A;  2GWK A;  4N41 A;  3K57 A;  3K9K A;  4O0J A;  2LBB A;  1BL3 A;  4Z94 A;  5AQM A;  3FZF A;  4BRF A;  2QWP A;  4RCH A;  2IGI A;  4HCB A;  3WNE A;  4X62 K;  3ZSO A;  2RKI A;  3OYH A;  1IG9 A;  2QWM A;  1VQO N;  5DMR A;  4MFB A;  4FXD A;  2E6L A;  3AVN A;  1SS6 A;  2VGM A;  4MO5 A;  4PUO A;  5LJV A;  1XHZ A;  4DTJ A;  3T69 A;  4CEQ A;  2KFN A;  2UUC K;  4DSI A;  4V19 S;  1RTJ A;  4CEF A;  2ETJ A;  4B1U B;  2G8F A;  1EET A;  1Q8I A;  3KWG A;  2IC3 A;  1GC6 A;  4IJA A;  3FFI A;  4I6M A;  4DSE A;  4JI5 K;  1KXP A;  3PX4 A;  4A5B A;  3AVI A;  4XH5 A;  2J4R A;  4E7K A;  3KHY A;  1KAY A;  3CF5 L;  3LAM A;  2XHB A;  1HRH A;  2EHG A;  2VCP A;  1R59 O;  3E9P A;  5C0Y A;  1EQY A;  2E20 A;  2I1K A;  4CZF A;  2KHO A;  2VG6 A;  1KFS A;  1MK9 B;  5MLC Q;  3OYK A;  3QEV A;  3K59 A;  3SPZ A;  3CFO A;  4BR7 A;  4BR5 A;  1JLA A;  1TK0 A;  4CZK A;  3THX A;  1T03 A;  3KWI A;  1L3V A;  1VAZ A;  4FJN A;  4CJ4 A;  1NKC A;  4JI8 K;  3J80 O;  5HL7 L;  5CHI A;  1C0F A;  1KRP A;  2W6L A;  4F2R A;  3TTC A;  4KB1 A;  3OYD A;  5KQD A;  1JLC A;  4DV5 K;  3WQU A;  4FK2 A;  3DMJ A;  1YTU A;  2ZE2 A;  4JD2 B;  3RMD A;  1RDB A;  4U67 L;  4B9L A;  4FLX A;  3K58 A;  1EWR A;  2ASM A;  4L8R B;  1LCU A;  1VQP N;  3VPZ A;  2FLO A;  3KD5 E;  1VQ6 N;  1G15 A;  5BRF A;  4BRH A;  1HKC A;  4O5F A;  4CBX A;  2FBV A;  4BDP A;  1RT2 A;  3GBT A;  2GUI A;  5GAH P;  2Q1N A;  5KRT A;  5F0X A;  4YOY A;  3V1O A;  1Q86 O;  3QBW A;  1QZ6 A;  4DR7 K;  4KO0 A;  4YOW A;  3CCV N;  5FRN A;  1JCG A;  1RBT A;  1V4S A;  3AVC A;  4JI1 K;  1RT7 A;  3O4N A;  3THV A;  3ZEU B;  3O9T A;  2YHY A;  4BRM A;  4H5R A;  4RW9 A;  1UOC A;  4KHY A;  3DXK A;  1BIS A;  3HBT A;  4W5T A;  4BR9 A;  3A0I X;  2DIK A;  3U4L A;  3I8D A;  3LP0 A;  4CZH A;  4FJH A;  4CZL A;  2OPR A;  4DKW A;  3T1A A;  3L4I A;  3QBX A;  3VEX A;  3AAR A;  5AQS A;  5LJW A;  3TSU A;  3NF6 A;  2P51 A;  4FLV A;  3P31 A;  1GLL O;  1RGI A;  2CQU A;  4DMN A;  3CCE N;  5BN8 A;  1YI2 N;  2GX9 A;  2QW9 A;  2EWS A;  4CZI A;  2RN2 A;  5EX5 A;  3LDN A;  4CZM A;  3O3G A;  5TKY A;  4DU4 A;  5D3G A;  2GUP A;  1L3S A;  2QWL A;  1S1V A;  3M1F A;  4M3T A;  3JSM A;  1KAX A;  1NJY A;  5KI6 A;  3RR7 A;  3TAQ A;  3DAW A;  1L3U A;  4P7I A;  3P4I A;  1I39 A;  2LSN A;  1CZA N;  3NBP A;  4CJ3 A;  1KBL A;  1SKS A;  4EAH D;  4DV7 K;  4TKN A;  4MLE A;  3KKS A;  3ZSY A;  2YHA A;  4JN4 A;  3A8Y A;  4FCY A;  4WFN L;  3LM9 A;  1DTQ A;  4LY7 A;  3RWU A;  3P38 A;  4H0T B;  3J7A P;  2IS3 A;  4GW6 A;  3UIQ A;  3OHR A;  4W5O A;  1TYQ B;  4FLW A;  4E1J A;  3SK3 A;  4F7G A;  1LAW A;  3HYF A;  4KTW A;  1NGG A;  1ZXO A;  3SUN A;  3G6E N;  1N33 K;  1GGO A;  1NGF A;  4DHY A;  1RT6 A;  2QXL A;  3BZC A;  3CCJ N;  4CEO A;  4CJR A;  1SL1 A;  3RRG A;  1U49 A;  3KK7 A;  3VN5 A;  5H1S Q;  3SI6 A;  3HK2 A;  3ID6 A;  3SMP A;  2I7N A;  5GIN A;  3K0S A;  4EIA A;  3M6G A;  4IKF A;  2QKK A;  5AFU H;  3ZT2 A;  3OYA A;  5EY4 A;  4Z4H A;  4K42 A;  2Q36 A;  1HYZ A;  2VYP A;  1TK8 A;  4RWT A;  4MLH A;  4FWK A;  1WB9 A;  1U4B A;  1U6Z A;  4FM1 A;  5JVH L;  4PKI A;  4KTQ A;  2FF3 B;  5KPZ A;  4LF9 K;  2QM1 A;  2G8K A;  2V7Y A;  4JD2 A;  3KJV A;  4BRK A;  2O8B B;  5M1N A;  4DR5 K;  5AQQ A;  2HBJ A;  3SUP A;  4CD3 A;  4YOX A;  2FC0 A;  3ASM A;  1VQ7 N;  1BHL A;  1BG3 A;  2HHU A;  3VER A;  2D5R A;  2COP A;  4OLB A;  3WT0 A;  3KVG A;  4ZRJ A;  4WFA L;  3V9S A;  2YI1 A;  1XHX A;  3QNO A;  1IG8 A;  4DR3 K;  2WTU A;  2UXC K;  3OYF A;  2P9K B;  3OVN A;  4DS5 A;  4B9T A;  4M41 A;  3G9W A;  4CK1 A;  3QEW A;  3ZEU A;  3J7Y P;  4G9Z A;  3AVF A;  1O1W A;  3BDP A;  1JCE A;  2YNF A;  4JEP A;  2O8F B;  4FW2 A;  2HHT A;  4AM6 A;  1M1K O;  3C6T A;  4M7Y A;  4FM0 A;  3VF4 A;  3HVR A;  3NGZ A;  4YL8 A;  3SCX A;  1XQS C;  2AP1 A;  3LM2 A;  1BUP A;  2OPS A;  5AJ3 K;  4CHN A;  1Y97 A;  3MCA B;  4N56 A;  5FPN A;  4CZJ A;  4WE1 A;  3LDO A;  4U7B A;  1HBK A;  3GG4 A;  1NU0 A;  3K2P A;  3HP9 A;  5HLF A;  3EYZ A;  1B9D A;  2YHB A;  1KC7 A;  5ADX A;  3HOT A;  2KLA A;  2D0P A;  1VQ8 N;  2YJF A;  1XI1 A;  2O8C B;  1TVR A;  3WQT A;  4JRP A;  1YAG A;  3LWL A;  2R7Y A;  2HMP A;  2P9S B;  4M3R A;  3AO1 A;  1RTH A;  1JLQ A;  1RDC A;  1GLJ O;  2F4V K;  2GTD A;  4DSK A;  4NYF A;  4E19 A;  2HNZ A;  3C0B A;  3ZSZ A;  2OTL N;  4JI7 K;  5EU7 A;  3QML A;  4DCH A;  1TL1 A;  3ALY A;  4IFV A;  3OBW A;  4CHQ A;  4YHH K;  3UKR B;  1VQ5 N;  4DU1 A;  1OH5 A;  2CGK A;  4IJN A;  4BWJ A;  4BGA A;  1VSK A;  4IBN A;  5C2F A;  2B6A A;  5JMV A;  4Z4F A;  4OKE A;  4FJL A;  5HBM A;  2DPN A;  2FSJ A;  4ELT A;  1S3X A;  3WXJ A;  3NF8 A;  3LPT A;  2E1Y A;  1YIJ N;  4Z4G A;  4H5W A;  1C0M A;  3I0S A;  2Q0R A;  1HPZ A;  4DLE A;  1NJZ A;  5SWM A;  3THW B;  3TTF A;  2DFF A;  2J0M A;  1F21 A;  3CD6 N;  3IMX A;  3MAQ A;  2W42 A;  3H45 C;  3D2F B;  3FZL A;  4NLB A;  1HKB A;  4HDO A;  3V9U A;  4BR4 A;  1B92 A;  1X1P A;  4O44 A;  4OVL A;  3TAG A;  4ICL A;  3DI6 A;  1S1X A;  1TAU A;  4C1N K;  2RF2 A;  2F8T A;  2JWK A;  4E7J A;  3OBY A;  3ZSR A;  2EMT A;  4OLA A;  4B8C A;  4NLC A;  4X65 K;  1CXQ A;  4DV2 K;  4BGB A;  4DQS A;  1J53 A;  3LDQ A;  3THY B;  4IFE A;  1RTD A;  4JKG B;  4DXA B;  4H0P A;  1NBW A;  4HHT A;  1HNX K;  2WC9 A;  3J7Z O;  4Z4C A;  1N5Y A;  1C0T A;  4WQ4 A;  3ENB A;  4H5T A;  1K8K B;  2HST A;  4ID5 A;  4BRG A;  5M1K A;  2O8B A;  2ZJR L;  2YHW A;  4JS4 A;  2RPI A;  2DY4 A;  3K5M A;  2UU9 K;  5M1P A;  4UQG A;  1IKV A;  1X9J A;  5M1Q A;  2NRW A;  3CHW A;  1U47 A;  4O4G A;  3CET A;  3HT3 A;  4WCE L;  3EO3 A;  4K25 A;  4OKJ A;  1A5V A;  4LD0 A;  3CC7 N;  3J8A A;  2D4W A;  3P1G A;  2P9K A;  2E8A A;  2HHS A;  2DFH A;  3NDK A;  5JS1 A;  1GC7 A;  2FSN A;  3ZX0 A;  4DFP A;  5GAG P;  2AL6 A;  2KQ2 A;  2ZGZ A;  1P8Z A;  3E9O A;  3SUO A;  1WBD A;  1MWM A;  3QFU A;  3K5N A;  3G10 A;  2WH5 A;  3IFR A;  5IWA K;  1H4R A;  3L2R A;  2O8F A;  3VA0 A;  2UXB K;  3PX0 A;  3A5L C;  3HL8 A;  4GNI A;  3BEX A;  3WEE B;  5C24 A;  4RW7 A;  2IOC A;  1MWK A;  4BG9 A;  4IDH A;  3EPY A;  2BE2 A;  4L3Q A;  4BRC A;  4B9U A;  4CIF A;  4JI0 K;  4EP4 A;  1VSD A;  4AHT A;  3T1Y K;  2D0C A;  4JLH A;  1ASW A;  2FSK A;  4CJS A;  3M8Q A;  3RVC A;  5JVL A;  3ULD A;  4BC2 A;  5FPE A;  1C1A A;  3TTD A;  4FZZ A;  2OZM A;  2D2Q A;  4JYA K;  4KRF A;  4JI3 K;  4CGJ A;  2KKZ A;  4CF9 A;  3ZSV A;  1RBV A;  4DR6 K;  5FDL A;  4F2S A;  2O8C A;  3SYZ A;  4CHZ A;  5BPM A;  3DRS A;  3U9D A;  3FR0 A;  1X9W A;  2QA4 N;  1W7A A;  4CGD A;  1P90 A;  3CER A;  4YDU A;  2P9S A;  1QQN A;  3O08 A;  1ZC6 A;  4FJI A;  5AQJ A;  4B3O A;  2W41 A;  4OPJ A;  2FJ9 A;  4IWV A;  3MN6 A;  3UB5 A;  3N4Q A;  5AZI B;  3LZJ A;  3L4Q A;  4DSJ A;  5AQW A;  1W9H A;  3LP2 A;  1HYV A;  4KTZ A;  1NJW A;  4E0D A;  4IOX A;  2DTU A;  3D2E A;  1VSF A;  2ZQB A;  3BF3 A;  3NFA A;  2HF3 A;  5HOO A;  1BI4 A;  1HUX A;  3L2Q A;  1BIU A;  1E3M A;  3HI0 A;  4IOC L;  4BC3 A;  4B9V A;  4FJG A;  4KPY A;  4Y1D A;  3KLF A;  2QK9 A;  1H1V A;  4FWN A;  3TWH A;  4LH4 A;  3THW A;  5A2Q O;  2P9L B;  2PAV A;  5HRP A;  4NCA A;  4TSX A;  2E6M A;  2D1K A;  3EEQ A;  3FLC O;  3WA0 A;  3TI0 A;  1HPM A;  3FZM A;  3D2F A;  4JKD A;  4JRQ A;  4O55 A;  3B6P A;  1RT5 A;  1QS4 A;  4WF9 L;  2ZJQ L;  3S3M A;  3AVH A;  3QEX A;  4IEI A;  4LFA K;  4NCB A;  1ASV A;  3WUH A;  2HHV A;  4CED A;  1IKW A;  2BAN A;  3F9K A;  2KZZ A;  1BCO A;  3G4S N;  4FW1 A;  1HB6 A;  4E7I A;  2YX6 A;  1NGJ A;  4BY9 C;  1QSY A;  3NVK A;  4JKG A;  1DT9 A;  1TL3 A;  1JL2 A;  1ST7 A;  1Q18 A;  1WSI A;  3DLE A;  3V9X A;  4CBU A;  2QWQ A;  3V1Q A;  4CFD A;  4C8M A;  4EKU A;  3L2W A;  1D5A A;  2VG5 A;  2HF4 A;  1D4X A;  1Z6R A;  2PBD A;  1OVQ A;  1X3N A;  4HTL A;  2D0A A;  3LDS A;  4WQ5 C;  3OYG A;  1KLM A;  3VQ9 A;  4KH4 A;  5CR4 A;  3U8X A;  1HLU A;  1K6Y A;  3VEN A;  1WSJ A;  1WOQ A;  4DTN A;  5ELZ A;  3VGM A;  2OTJ N;  3VQA A;  4CIG A;  3KK1 A;  2JGU A;  3L3U A;  1VQ9 N;  1QHA A;  3A2F A;  2A40 A;  4DTU A;  3DWL A;  3CYM A;  4H0X B;  3E66 A;  4O8U A;  1Q7Y O;  3ATV A;  5BN9 A;  2QI2 A;  3M5R A;  2FDQ A;  3VEY A;  1VQK N;  4AQY K;  3FFK B;  4HDQ A;  2A5X A;  4PHT X;  3AAP A;  4JK9 A;  3CFP A;  3M8P A;  3NF7 A;  2CH6 A;  4RG8 A;  2F96 A;  1LAV A;  2PYJ A;  3WEE A;  1QTM A;  2GBZ A;  4M63 C;  1OH8 A;  4CJT A;  3AA3 A;  3S3O A;  1NGB A;  5E41 A;  5EXW A;  3J81 O;  4DTR A;  4C1N I;  1UAX A;  3MXI A;  4CE9 A;  3D6R A;  5DK5 A;  4AHS A;  1NK6 A;  3CC2 N;  3IVF A;  5C15 A;  1CLQ A;  4FOE A;  2VWK A;  2HOE A;  4DSF A;  1S6Q A;  2YKM A;  4KHN A;  3MEE A;  4PKH A;  3O9S A;  4JS5 A;  3I55 N;  3U9Z A;  1LOT B;  3LAL A;  4NXM K;  2KZM A;  4FZY A;  4HWI A;  1J6Z A;  4BRL A;  1ASU A;  4A2A A;  2HHW A;  3LWM A;  2WUS A;  5FLX O;  1YJ9 N;  4DV6 K;  3L0Q A;  3LPU A;  1BOT O;  2EMS A;  3C7N B;  3I33 A;  3M8R A;  5T7B A;  4X66 K;  4CI6 A;  3Q7C A;  2HBL A;  2NUB A;  5JLF A;  3VQE A;  4IO8 A;  2OPP A;  4BRE A;  5C12 A;  4JKF A;  4K8X A;  2Y1J A;  4B08 A;  1RDD A;  4CK2 A;  3T19 A;  5GAE P;  5LMN K;  5AZI A;  3R6M A;  1JXE A;  4CGF A;  1SAZ A;  4I9Q A;  4B3S K;  4FLT A;  3PSI A;  4I7F A;  3MXJ A;  3LDP A;  4BRA A;  3KLG A;  2YVC A;  1BA0 A;  4GV9 A;  3VQQ A;  3ZCM A;  3TPQ A;  1NM1 A;  4BRO A;  1ILY A;  1QHT A;  2G8V A;  2P9U B;  2P9L A;  4CFC A;  1I94 K;  2NNW A;  4MO4 A;  3CCU N;  1M90 O;  1K9M O;  3H3O B;  4K43 A;  4BE1 A;  3CI5 A;  4E89 A;  1NK7 A;  3OYB A;  4BG8 A;  4PQU A;  4QAG A;  1GOC A;  4G1Q A;  1NGI A;  3ZDT A;  3R9P A;  3LL3 A;  4PKG A;  2IVN A;  5FRO A;  3AO2 A;  3L8B A;  3AU5 A;  3PZD A;  4ISE A;  1ESV A;  3MCP A;  2QKB A;  1BO5 O;  1C1B A;  4DTS A;  1C0U A;  4CVN E;  1OH7 A;  3VEW A;  3T1H K;  1RDW X;  5AQI A;  4Z4E A;  3T7Z A;  1RT3 A;  3TU5 A;  4M3Z A;  3L2V A;  1D8Y A;  5IT9 O;  1X9S A;  1NJX A;  3CC4 N;  3ZSX A;  4BQZ A;  4IFY A;  4FOI A;  4AF1 A;  4J2E A;  2WFB A;  4Y0W A;  3TSP A;  3PX6 A;  4HUG A;  3OJU A;  3HTV A;  3OYM A;  1NKB A;  4BVO A;  4M7X A;  3O9Q A;  2G8U A;  2YJE A;  2Q31 A;  4DFM A;  2NRR A;  4FWQ A;  4J2B A;  2D11 A;  1XC9 A;  3P39 A;  3PV8 A;  1BGX T;  5HRS A;  4AHU A;  2NZT A;  2Q3S A;  4A59 A;  2D10 A;  1HNI A;  4B9N A;  1ZBF A;  2HBK A;  3QEP A;  4BVP A;  5AQH A;  2V51 B;  2A3Z A;  2J0J A;  1TKT A;  4Y1C A;  1T6C A;  3NF9 A;  1BQN A;  2WOM A;  3KTQ A;  5I9E B;  4KH6 A;  4DS4 A;  1Y64 A;  3O9R A;  4IO9 L;  3PO4 A;  5CYM A;  3BIN A;  4FZX C;  3F5T A;  4W5R A;  4QS8 A;  1YVN A;  2IVO A;  3CCR N;  4DTM A;  5BR8 K;  1NK4 A;  1S1U A;  1GOB A;  3VF6 A;  2ASO A;  5JS2 A;  3U7D A;  3C95 A;  3EKS A;  3NH2 A;  1SL2 A;  4H0O A;  1RDA A;  2WBN A;  1B9F A;  3I0R A;  1RBR A;  3DJC A;  1N36 K;  1IBM K;  3EN9 A;  3OS1 A;  1IH7 A;  1SKW A;  4W5Q A;  1CZ9 A;  2HB5 A;  2P5G A;  1WLJ A;  1X9M A;  2HW3 A;  2CGJ A;  2F7T A;  3BGR A;  2GV9 A;  3HJF A;  1SUQ A;  2YKN A;  5J2N A;  4CIE A;  2P9N B;  4E7L A;  5KGW A;  1CXU A;  2P1J A;  3V1R A;  2X6N A;  4ZTF A;  4C23 A;  1RFQ A;  3CMA N;  3O6W A;  2R82 A;  4FSV A;  1KSP A;  3CJ7 A;  2ZD1 A;  3D7E O;  4FM2 A;  1GLA G;  1WSE A;  4MQ3 A;  4CYE A;  1SL0 A;  3ULE B;  3SZ2 A;  1NTI A;  3LP1 A;  3FGU A;  3WNG A;  4BRP A;  5DM7 L;  1TAQ A;  1V4T A;  5FPD A;  2HE7 A;  1S72 N;  2P9U A;  5AQV A;  2J0K A;  3JS6 A;  3HVT A;  4N47 A;  2PY5 A;  4CHO A;  2YV0 X;  4CGG A;  3RMB A;  4FK4 A;  3S41 A;  1HB8 A;  5LMU K;  1T44 A;  3C94 A;  1QVF M;  1TUU A;  4JI2 K;  3S9H A;  4FLY A;  2UUA K;  2ASP A;  1DEJ A;  1GLF O;  3QNN A;  4PL7 A;  3FE1 A;  3OJS A;  1TUY A;  4DWI A;  5JIC A;  3AU4 A;  1ITG A;  5KQ8 A;  4DTP A;  4CEA A;  5AFU A;  3NMU A;  3VGL A; 
#chains in the Genus database with same CATH homology
 4YOR A;  1ACA A;  4EHT A;  4FWS A;  2FSK A;  1NGE A;  2VCP A;  5JVL A;  1R59 O;  3EKU A;  2NLX A;  3E9P A;  1GLB G;  1EQY A;  2E20 A;  2I1K A;  4BC2 A;  3FZK A;  2KHO A;  4CZF A;  5C10 A;  5FPE A;  1MK9 B;  2IIR A;  3MWP A;  3A5M C;  3TTD A;  5MLC Q;  2D2Q A;  2KKZ A;  4BR7 A;  2BH1 A;  1NGA A;  3UKU B;  1NGD A;  1T6D A;  4BR5 A;  3G71 N;  3AGR A;  3TSQ A;  4BRD A;  5F1X A;  4CZK A;  3KWI A;  1S72 N;  5BPM A;  1VAZ A;  3U9D A;  5AQK A;  3FR0 A;  3VEO A;  1DGK N;  2QA4 N;  3EL2 A;  3MX2 A;  5HL7 L;  1P90 A;  3CER A;  4YDU A;  2P9S A;  1C0F A;  5CHI A;  1QQN A;  3I56 N;  3TTC A;  2P9P A;  2QWR A;  3FLV A;  1TYQ A;  3GDQ A;  4DB3 A;  1QQM A;  4FWO A;  3O08 A;  1ZC6 A;  5AQN A;  5KQD A;  3AGK A;  4UY8 O;  3MDQ A;  5AQJ A;  3RSE B;  2E2P A;  2W41 A;  3WQU A;  4OO1 J;  1JJ2 M;  3A5O C;  2HRJ A;  5LY3 A;  2FJ9 A;  5ADX H;  4IWV A;  3PVL A;  4JD2 B;  3MN6 A;  3UB5 A;  4U67 L;  3N4Q A;  5AZI B;  3GE1 A;  3L4Q A;  3MN9 A;  3L6Q A;  2ITM A;  1VQ6 N;  2ASM A;  4ZRI A;  1LCU A;  4YOV A;  3VPZ A;  2FLO A;  1VQP N;  5AQW A;  3VTI A;  1E4F T;  1DKG D;  3ID8 A;  5BRF A;  3VGK A;  4BRH A;  3E1Y A;  1HKC A;  1JCF A;  1KC8 O;  4IOX A;  4LC9 B;  4O5F A;  1ATS A;  4KH5 A;  4CBX A;  3GBT A;  3D2E A;  5GAH P;  2Q1N A;  5F0X A;  4EHU A;  2Q97 A;  4YOY A;  1XUP O;  3BF3 A;  3G25 A;  5GAD P;  2HF3 A;  5HOO A;  3QBW A;  1HUX A;  1Q86 O;  1GLE G;  1QZ6 A;  5EVZ A;  3QB0 A;  4CD1 A;  1BA1 A;  4YOW A;  5F2R A;  3CCV N;  3HI0 A;  4IOC L;  1JCG A;  5EOY A;  4BC3 A;  1V4S A;  1H1V A;  3C7N A;  4FWN A;  1Q82 O;  5AQP A;  1T3V A;  4MDA A;  1MDU B;  1VBG A;  4B1X B;  5AQU A;  1X3M A;  2P9L B;  3ZEU B;  2PAV A;  1KD1 O;  4FPB A;  4F9O A;  2D1K A;  1G99 A;  3F9M A;  2YHY A;  3FLC O;  3O9T A;  4H5R A;  5FPM A;  4BRM A;  4GV3 A;  1ZBS A;  3VF2 A;  3DXK A;  1GG3 A;  3WA0 A;  1HPM A;  3FZM A;  3HBT A;  3JXU A;  1NI2 A;  3D2F A;  3MWT A;  4BR9 A;  4JKD A;  4CBW A;  3A0I X;  5GIO A;  1ISN A;  3ZX2 A;  4WF9 L;  2ZJQ L;  2DIK A;  3U4L A;  4BQL A;  1HKG A;  3I8B A;  4CZH A;  4IEI A;  4CZL A;  5BPN A;  3DXM B;  4DKW A;  3UE5 A;  3WUH A;  4YOT A;  3L4I A;  1GLC G;  3QBX A;  4NY0 A;  3VEX A;  3AAR A;  5AQS A;  3G4S N;  3O9U A;  3ATU A;  5LJW A;  2NRZ A;  3ZET B;  3TSU A;  1HB6 A;  4GXB A;  4AM7 A;  2YX6 A;  3WXI A;  1NGJ A;  3H3N O;  1YF5 L;  3EE9 A;  3P31 A;  1NGH A;  4JKG A;  1DT9 A;  4BY9 C;  3NVK A;  1GLL O;  1ST7 A;  1Q18 A;  3CPE A;  1RGI A;  3SAH A;  1XC3 A;  4CBU A;  2QWQ A;  3HM8 A;  3EE8 A;  4A5A A;  4B1V A;  2CQU A;  4EKU A;  3CCE N;  3O1B A;  5BN8 A;  2GX9 A;  1YI2 N;  2QW9 A;  2EWS A;  2X0S A;  5AZJ A;  4CZI A;  5EX5 A;  5BRH A;  2E2N A;  2HF4 A;  3LDN A;  4CZM A;  1D4X A;  4B1Y B;  1Z6R A;  3CQY A;  2PBD A;  5B8H A;  1X3N A;  3Q7B A;  4HTL A;  2P9N A;  2GUP A;  5TKY A;  3WXL A;  4H0Y B;  1NVL A;  4XH1 A;  3VTH A;  1DIK A;  1MIX A;  4WQ5 C;  2QWL A;  4KH4 A;  2ZF5 O;  2FXU A;  3M1F A;  5CR4 A;  5AQF A;  3U8X A;  1HLU A;  4FWP A;  1KAX A;  3SBT A;  3OA9 A;  3VEN A;  4A2B A;  4JNE A;  2A42 A;  3DAW A;  1SQK A;  1WOQ A;  3H1Q A;  4P7I A;  3CXC M;  5IJM A;  3P4I A;  5ELZ A;  3ULE A;  1EO1 A;  3SAG A;  2CB8 A;  4OPA A;  3VGM A;  1CZA N;  4WQ4 C;  2OTJ N;  1KBL A;  1VQ9 N;  1QHA A;  2A40 A;  4EAH D;  2YHX A;  3DWL A;  3VEZ A;  4JKB A;  1SGH A;  4BRI A;  4TKN A;  3CJC A;  3E66 A;  3NVM A;  4H0X B;  4MLE A;  4O8U A;  3ATV A;  4BR0 A;  1Q7Y O;  5BN9 A;  4JN4 A;  2QI2 A;  3A8Y A;  3CJB A;  3KZB A;  3M5R A;  2FDQ A;  3VEY A;  1VQK N;  3FFK B;  4JKA A;  1J19 A;  4HDQ A;  2A5X A;  4PHT X;  4WFN L;  3AAP A;  1KQS M;  4JK9 A;  3LM9 A;  4EFH A;  2NRX A;  1NJI O;  3GL1 A;  3VEV A;  3O80 A;  5BR9 A;  2CH6 A;  5BPL A;  4BRN A;  3QIC A;  3P38 A;  4H0T B;  3HRG A;  3WEE A;  4H5V A;  5C0Y A;  3OHR A;  1TYQ B;  2OAN A;  3X23 A;  1YIT N;  4M63 C;  2BUP A;  4E1J A;  4ILJ A;  1NGB A;  4F7G A;  3SK3 A;  1NGC A;  5EXW A;  3ZX3 A;  4C1N I;  5JLH A;  2RQ1 A;  1NGG A;  1ZXO A;  3H6E A;  4ISG A;  3BF1 A;  3D6R A;  3CC2 N;  3G6E N;  3IVF A;  5C15 A;  1VQN N;  2P9I B;  2RE2 A;  4FOE A;  2HOE A;  5AQY A;  1GGO A;  1NGF A;  1E4G T;  2GEM A;  4DHY A;  3U8Z A;  2QXL A;  3HOS A;  3CCJ N;  4PKH A;  3O9S A;  4CZE A;  3I55 N;  3KK7 A;  3U9Z A;  5H1S Q;  5E26 A;  1LOT B;  3ID6 A;  3MN5 A;  3SMP A;  2I7N A;  3D2E B;  5GIN A;  1JDE A;  3M6G A;  4EIA A;  4HWI A;  3UKR A;  3UKU A;  1J6Z A;  3HZ6 A;  5AFU H;  4BRL A;  5EY4 A;  4K42 A;  2Q36 A;  2D0O A;  4A2A A;  3E9L A;  2VYP A;  3WXM B;  2WUS A;  1U2V B;  1YJ9 N;  4RWT A;  4MLH A;  3N4P A;  4FWK A;  3L0Q A;  1BOT O;  2EMS A;  3C7N B;  3CJA A;  3I33 A;  1QVG M;  3BUZ B;  3SJH A;  4FWL A;  1U6Z A;  4CI6 A;  2JWL A;  3Q7C A;  2HBL A;  5JVH L;  4PKI A;  5JLF A;  1YHQ N;  5AQR A;  4IO8 A;  4BRE A;  5C12 A;  2FF3 B;  4JKF A;  5KPZ A;  5JVG L;  2QM1 A;  4B1Z A;  2I7P A;  2V7Y A;  4JD2 A;  1YXQ A;  4BRK A;  1YJN N;  5M1N A;  4GY2 B;  5GAE P;  5AZI A;  3R6M A;  3SLC A;  5AQQ A;  2HBJ A;  1SAZ A;  4BC4 A;  4CD3 A;  4YOX A;  1VQ4 N;  4O8K A;  4WYB A;  5E84 A;  1IJJ A;  3H46 O;  1VQ7 N;  1BG3 A;  3VER A;  2COP A;  3WT0 A;  3ZYY X;  3KVG A;  4YDU C;  4ZRJ A;  5M1F A;  4WFA L;  2V7Z A;  3QFP A;  3QIJ A;  2YI1 A;  2AA4 A;  3LDP A;  4BRA A;  1IG8 A;  2YVC A;  3FP5 A;  1BA0 A;  1RDU A;  3QDK A;  4JKC A;  1S22 A;  4NO7 A;  4GV9 A;  2P9K B;  2Q2R A;  2YCH A;  3G9W A;  3TPQ A;  1NM1 A;  4JHD B;  2V52 B;  4BRO A;  1ILY A;  3MK6 A;  2P9U B;  2P9L A;  1Z05 A;  3O4W A;  3ZEU A;  3CME N;  4G9Z A;  2NNW A;  2AEH A;  2H3G X;  4MO4 A;  3C65 A;  4NB4 A;  5TKW A;  3CCU N;  3CCS N;  1O13 A;  1M90 O;  3F2K A;  5BRD A;  1JCE A;  3H3O B;  4K43 A;  4JEP A;  1K9M O;  1K8K A;  4K41 A;  3CI5 A;  3AAQ A;  2E88 A;  4AM6 A;  5AQX A;  4I6M B;  4BG8 A;  4CJ7 A;  1M1K O;  1ATN A;  3O5B A;  4M7Y A;  1K73 O;  3H1V X;  4FL9 A;  4IOA L;  1E5W A;  2CGL A;  3CQX A;  3VF4 A;  3MN7 A;  4YL8 A;  3DXM A;  1NGI A;  4ILG B;  1XQS C;  3ZDT A;  4XH4 A;  2AP1 A;  3LM2 A;  3R9P A;  5CE3 A;  3LL3 A;  1BUP A;  2RHK A;  3CIP A;  3GOI A;  2IVN A;  4OPH A;  4PKG A;  3WXK A;  1NLV A;  2E2Q A;  4FWM A;  3ZET A;  3AU5 A;  3PZD A;  1MIZ B;  4ISE A;  3MCA B;  2F9T A;  3IDH A;  1ESV A;  3MMV A;  3MCP A;  5FPN A;  1BO5 O;  3VES A;  4CZJ A;  3LDO A;  2ABD A;  1QZ5 A;  4U7B A;  3C6H A;  1HBK A;  1BDG A;  1VQM N;  4JKH A;  2QTD A;  3GG4 A;  4JAX A;  3VEW A;  1BU6 O;  1RDW X;  1SZ2 A;  3K9J A;  2GWJ A;  5AQI A;  3T7Z A;  4A61 A;  3CJ9 A;  3TU5 A;  3HSC A;  4A57 A;  4BR2 A;  2CH5 A;  1MK7 B;  2QWO A;  4MDB A;  2ZGY A;  1KC7 A;  5ADX A;  4H0V B;  2KLA A;  2D0P A;  4BQZ A;  3HOT A;  3FZH A;  1BWF O;  4RTF D;  3CC4 N;  2YJF A;  4FOI A;  3WQT A;  4ILH A;  3BP8 A;  4FPA A;  4AF1 A;  2WFB A;  4Y0W A;  3TSP A;  2FF6 A;  1YAG A;  3CJ1 A;  3IUC A;  3HTV A;  1W2B M;  4FVU A;  4BVO A;  1Q81 O;  2HMP A;  2P9S B;  4ZRK A;  2UYT A;  1GLD G;  5AQL A;  4M7X A;  3O9Q A;  2W40 A;  3ENH A;  1GLJ O;  2P9P B;  2GTD A;  2YJE A;  3B8A X;  2Q31 A;  2NRR A;  4XEI A;  3C0B A;  4FWQ A;  2A41 A;  2OTL N;  2D11 A;  4H5N A;  3P39 A;  5GIP A;  4IXC A;  3DLL L;  2ZJP L;  3QML A;  4DCH A;  2NZT A;  4KBO A;  4J8F A;  1VQ8 N;  3EZW A;  4A59 A;  2PFU A;  2QWN A;  3CCM N;  2D10 A;  3W0L A;  5KPR A;  3OBW A;  2HBM A;  3CPW M;  3MX5 A;  2HBK A;  3AY9 A;  3UKR B;  5AQH A;  4BVP A;  1VQ5 N;  2NRV A;  2A3Z A;  2CGK A;  2V51 B;  4IJN A;  2J0J A;  4BGA A;  4JK8 A;  2I1J A;  2VGN A;  2ZWH A;  5C2F A;  1T6C A;  5JMV A;  1OVY A;  2E1Z A;  4B1W B;  3CCL N;  2DPN A;  2FSJ A;  1S3X A;  4GV6 A;  3WXJ A;  2QEX N;  5I9E B;  2E1Y A;  4GVE A;  4KH6 A;  1YIJ N;  1Y64 A;  3O9R A;  4IO9 L;  4FO0 A;  4H5W A;  3BIN A;  3F5T A;  4QS8 A;  3O1W A;  3OW2 M;  2Q0R A;  1YVN A;  4H03 B;  3M3Z A;  3PLA A;  3TTF A;  5C2D A;  2IVP A;  3VET A;  2IVO A;  3ENO A;  3CCR N;  2J0M A;  2P9I A;  1YJW N;  3RSE A;  3CD6 N;  1MA9 B;  3IMX A;  3O8M A;  3RVC A;  3VMF B;  5M1O A;  3SAF A;  3DXK B;  2NRT A;  3SBG A;  3H45 C;  3VF6 A;  2ASO A;  4FWR A;  4WFB L;  3D2F B;  3FZL A;  4NLB A;  1Y19 B;  1HKB A;  4HDO A;  3U7D A;  3R8E A;  1EF1 A;  4BR4 A;  3LDL A;  2NRH A;  3CCQ N;  3EKS A;  3PIP L;  3R3L A;  5AQZ A;  5KPT A;  3VOV A;  1HJO A;  4C1N K;  2JWK A;  4H0O A;  3OBY A;  2WBN A;  3R1X A;  4WQ5 A;  2EMT A;  3DJC A;  4NLC A;  1ATR A;  1OKJ A;  1U2V A;  1KAZ A;  2A6A A;  3EN9 A;  5AQT A;  4A62 A;  4BGB A;  3LDQ A;  4BRQ A;  3C6A A;  4IFE A;  1HX1 A;  4JKG B;  4ISF A;  1W97 L;  4DXA B;  4H0P A;  1NBW A;  5DM6 L;  1C0G A;  2WC9 A;  3J7Z O;  4WQ4 A;  3NMU A;  3ENB A;  1YUW A;  2CGJ A;  2F7T A;  4H5T A;  4B9Q A;  1K8K B;  5AZJ B;  2HST A;  4BRG A;  2F9W A;  4IEE A;  5M1K A;  1N8R O;  3PIO L;  2YHW A;  2Q0U A;  2ZJR L;  4DQ8 A;  3A5N C;  2P9N B;  5AQG A;  4QS7 A;  4YOU A;  1WUA A;  5M1P A;  2GWK A;  4C23 A;  1RFQ A;  3CMA N;  3O6W A;  2R82 A;  3K9K A;  2ZPY A;  2LBB A;  4FSV A;  3CJ7 A;  4Z94 A;  3D7E O;  5AQM A;  4BC5 A;  1GLA G;  1X9J A;  5M1Q A;  2NRW A;  3CHW A;  3FZF A;  4BRF A;  2QWP A;  2E2O A;  4IZ9 A;  5AR0 A;  3CET A;  4CYE A;  4RCH A;  3ULE B;  4WCE L;  3EO3 A;  4K25 A;  1NTI A;  4QS9 A;  3CC7 N;  3FGU A;  3J8A A;  2D4W A;  4BRP A;  2P9K A;  2E8A A;  5DM7 L;  1NMD A;  1GC7 A;  1V4T A;  2FSN A;  2QWM A;  4JHD A;  3ZX0 A;  5FPD A;  1K8A O;  5GAG P;  1VQO N;  2HE7 A;  4JK7 A;  2AL6 A;  1SS6 A;  2P9U A;  2VGM A;  4MO5 A;  2ZGZ A;  1P8Z A;  5LJV A;  5AQO A;  5AQV A;  3E9O A;  2J0K A;  1VQL N;  3JS6 A;  3T69 A;  1MWM A;  3QFU A;  4BRC A;  2WH5 A;  3SMS A;  3IFR A;  4B1U B;  1H4R A;  4PL8 A;  3S41 A;  1HB8 A;  3KWG A;  3A5L C;  1T44 A;  5BRE A;  1NWK A;  4JKE A;  4GNI A;  1TUU A;  1QVF M;  1GC6 A;  2ASP A;  3IKM A;  1DEJ A;  4I6M A;  3BEX A;  1GLF O;  4IJA A;  3W3D A;  3WEE B;  4PL7 A;  1KXP A;  2BTF A;  3FE1 A;  1TUY A;  5JIC A;  3AU4 A;  1MWK A;  4A5B A;  2VWB A;  4BG9 A;  4R79 A;  4XH5 A;  2J4R A;  4IDH A;  5KQ8 A;  3EPY A;  3KHY A;  1KAY A;  3CF5 L;  4L3Q A;  1VBH A;  5AFU A;  4CZG A;  2GEL A;  3VGL A;  1QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...