1MK9B

Crystal structure of an integrin beta3-talin chimera
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
187
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Integrin Beta3
total genus 54
structure length 187
sequence length 190
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk9B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk9B02
3PZDA 4DX90 1I2HA 5J3QA 4YL8A 2H7EA 4GPTB 2PZ1A 2ADZA 3CXBB 1GC7A 1WVHA 2P0DA 1MPHA 4DBBA 4GXBA 4HB0B 5DHAB 5D3XA 3U7DA 3D8FA 1WJ1A 4ZRIA 1AWEA 2D9VA 4PQ0A 2I1KA 1DBHA 2I1JA 2EMTA 3VOQA 3DXEA 1W1HA 2ROZB 1B55A 2CY5A 4F7UP 1EGXA 2Y7BA 4A6FB 4KHBB 5FI0A 2DHIA 2RGNB 3U8ZA 4GZUA 1ZM0A 1NVLA 5HE3A 2DYQA 1Z87A 1V5PA 3PP2A 1MK9B 2N0YA 1BTNA 1UNQA 3TCAA 5C79A 3P6AA 4F7GA 2Q13A 4P7IA 5EFXA 1P6SA 2RNRB 3SO6A 2I5FA 3F5RA 2DFKA 4DXAB 2HRJA 3ULBA 3P7ZA 1X1GA 4HAVB 1Y5OA 1J0WA 3QBVB 3SNHA 2LKOA 2YS5A 5JP4A 3LJUX 1PLSA 2DYNA 4A6KA 3ODWA 1V61A 4CHMA 2GCJA 1XODA 2EC1A 3G9WA 2K2JA 5HE2A 2K00A 2XQNM 4HDOA 1FGZA 4PNKA 1X1FA 1NU2A 2H7DA 5L81A 3RCPA 3HQCA 3KRXA 3OANA 5LONB 1WGQA 2EMSA 1ST7A 1SHCA 2COCA 4HAWB 3A8PA 1FB8A 2YSZA 1W1GA 1HB8A 1DYNA 3CIKA 1K5DB 5C16A 1DROA 2D9ZA 2LYDA 1SGHA 2ROVA 2YVCA 4GN1A 2COFA 2CAYA 2N23A 3KZ1A 4YONA 1MK7B 1K5GB 1E5WA 1TQZA 1U2BA 2P0HA 3V5WA 2YS1A 4L6EA 2MFQA 1V88A 1H10A 5DIFB 5KCVA 1MKEA 4ZRKA 2Y8FA 4WVFB 1UPQA 4HAXB 1ZSQA 4KHOA 2KGXB 1LB1A 1TXDA 4HAYB 3ZVRA 3ODXA 2OTXA 2KUPA 2Y8GA 4HAUB 1MIXA 2HTHB 1DDMA 3AU5A 1V5MA 2J59M 5DHFB 3VIAA 1DDWA 5LOPB 2P8VA 2FJ9A 4Z2NA 1UNPA 2VSZA 3PG7A 5FI1A 2J0MA 3SYXA 3MDBC 2R0DA 2WH5A 1BAKA 1KI1B 1DDVA 2MKRA 4F7HA 3GYPA 4IOYX 5D3YA 4HAZB 2AL6A 1FAOA 1UPRA 3D8EA 3WA0A 1Q67A 3ZDTA 5J3TA 1WG7A 3TVVA 2GCLA 2RUKB 3SUZA 3SV1A 1ZVRA 3BINA 2R09A 3PSCA 3ULCA 3QIJA 3PVWA 4EJNA 1WGUA 3O96A 4MY6A 2D2QA 4Y94A 2COPA 1V5UA 3F0WA 3DXDA 3IVFA 4EMOA 4CHJA 3M1IB 1MIZB 3HW2B 1W1DA 2FDQA 2J0KA 1AQCA 4KAXB 4GMVA 3KY9A 3HK0A 1U5FA 1X11A 2AEHA 4WJ7A 4TYZA 2RLOA 1BWNA 2YT0A 3MPXA 3PVUA 1HBKA 1U5DA 1KZGA 3ODOA 2GJYA 2K2UA 1EF1A 2D11A 2X18A 5J3YA 1OMWA 2P0FA 1ZC3B 2DX1A 2CB8A 1XKEA 2NMBA 2DX5A 2NZ8B 5DH9B 1PMSA 2Z0OA 3TW1A 2D9YA 2Z0PA 4A6HA 3FP5A 3ML4A 2LULA 3PEGA 4HATB 5KQ1A 2L2IA 4MT7A 1ACAA 4MK0A 4NY0A 2M14A 3BJIA 2LBBA 1U29A 4KHAA 2D4QA 1N3HA 4XWXA 1U5GA 5D3WA 2DHJA 2UVMA 1GG3A 3FEHA 5D3VA 1PFJA 1P3RA 3FLVA 1TJ6A 2YS3A 3PVLA 2CQUA 3QWMA 1U27A 2QKLA 2OQBA 2CODA 3NSUA 3TO1A 3AJ4A 2E2XA 1EVHA 2ZPYA 2DHKA 5KQ4A 3FSSA 3UZTA 1WI1A 2W2XD 2D10A 2MWNB 1V89A 1HB6A 4TKNA 5CLQB 5C5BA 3GYOA 4B6HA 4A5KA 2ABDA 1ZC4B 2DA0A 2RSGA 2UZRA 1LW3A 1FHXA 4K17A 1BTKA 1P5TA 5DI9B 4KVGB 5D27A 1H4RA 5JHGA 4H8SA 2LOZA 1FHOA 2G35A 2Z0QA 3KRWA 4IFSA 2L1CA 4HB3B 1FHWA 5HE1A 1GC6A 1X05A 1OY2A 4GMXB 1NTIA 2M38A 2YF0A 1UEFA 2DKPA 1QQGA 2IFSA 4D0NB 1M7RA 3WYFB 2FJLA 1ISNA 4K2OA 5GOWB 1RJ2A 3A98B 2BCJA 2COAA 2QKMA 1OQNA 1FGYA 1I7AA 4DX8A 2D9WA 3KSYA 2HE7A 1MAIA 1UNRA 4HB4B 2D9XA 4Z2MB 1M7EA 5C5BB 3TFMA 1IRSA 4C0AA 3DXCA 1XX0A 2CY4A 1NI2A 3T06A 2CRFA 2ELAA 1U5EA 2YT1A 1NTVA 4EKUA 2YRYA 2DLWA 2RQ1A 4ZRJA 2GS0A 4K81A 2VRWB 1XR0B 1RRPB 2MDXA 2RVBB 4WSFA 5JHHA 1QC6A 2W2WA 3D8DA 1X86A 3A8QA 2J0JA 1Y19B 2EJ8A 4HHVA 4A6FA 2ELBA 2V76A 2DKQA 4CYEA 1J19A 4BBKA 2VKIA 1XCGA 1FOEA 5JLJB 4K2PA 1KZ7A 4NSWA 2UZSA 3N7CA 3X23A 2IYBA 5C6RA 4HDQA 5IJMA 2DN6A 5CLLB 4IAPA 2JP2A 1WJMA 3AU4A 3EPYA 2KCJA 2DTCA 4HB2B 1NTYA 5HE0A 2W2XC 2I5CA 1EAZA 1XD4A 2LG1A 3FM8C 2LOXA
chains in the Genus database with same CATH superfamily
3PZDA 4DX90 1I2HA 5J3QA 4YL8A 2K49A 2H7EA 4GPTB 2PZ1A 2K8EA 2ADZA 3CXBB 1GC7A 1WVHA 2P0DA 4HSIA 2KIGA 1MPHA 2X0SA 4DBBA 4GXBA 4HB0B 5DHAB 5D3XA 3U7DA 3D8FA 1WJ1A 4ZRIA 1AWEA 2D9VA 4PQ0A 2I1KA 1DBHA 2I1JA 3A58A 4D6WA 4QXAB 2EMTA 2KR0A 3VOQA 3DXEA 1W1HA 2ROZB 1B55A 2CY5A 4F7UP 1EGXA 2Y7BA 4A6FB 4KHBB 5FI0A 2DHIA 2RGNB 4JKBA 3U8ZA 4GZUA 4JK9A 1ZM0A 1NVLA 5HE3A 2DYQA 1Z87A 1V5PA 3PP2A 5I2SA 1MK9B 2N0YA 1BTNA 1UNQA 3TCAA 5C79A 3P6AA 4F7GA 2Q13A 4P7IA 3DCXA 5EFXA 1P6SA 2RNRB 3SO6A 2I5FA 3F5RA 2DFKA 4DXAB 2HRJA 1VBHA 3B77A 3ULBA 3P7ZA 1X1GA 4HAVB 1Y5OA 1J0WA 3QBVB 3SNHA 2LKOA 2YS5A 5JP4A 4JK8A 4JKDA 3LJUX 1PLSA 4QJ3B 2DYNA 4A6KA 3ODWA 1V61A 4CHMA 2GCJA 1XODA 2RRFA 2EC1A 3G9WA 2K2JA 5HE2A 2K00A 2XQNM 4HDOA 1FGZA 4PNKA 3E9OA 1X1FA 1NU2A 2H7DA 2GUMA 5L81A 3RCPA 3HQCA 3KRXA 3OANA 5LONB 1WGQA 2EMSA 1ST7A 3NWAA 1SHCA 2Z4DA 2COCA 4HAWB 3A8PA 1FB8A 2YSZA 1W1GA 1HB8A 1DYNA 3CIKA 1K5DB 5C16A 1DROA 2D9ZA 2LYDA 1SGHA 2ROVA 2YVCA 4GN1A 2COFA 2CAYA 2N23A 5M4YB 3KZ1A 4YONA 1MK7B 1K5GB 1E5WA 1TQZA 1U2BA 2P0HA 3V5WA 2YS1A 4L6EA 2MFQA 1V88A 1H10A 2FJUB 5DIFB 5KCVA 1MKEA 4ZRKA 2Y8FA 4WVFB 1UPQA 4HAXB 1ZSQA 4KHOA 2KGXB 1KBLA 1LB1A 1TXDA 4GNKB 4HAYB 3E9PA 3ZVRA 4JKCA 3ODXA 2OTXA 2KUPA 2Y8GA 4HAUB 1MIXA 2HTHB 1DDMA 3AU5A 1V5MA 2J59M 5DHFB 3VIAA 1DDWA 5LOPB 2P8VA 2FJ9A 4Z2NA 1UNPA 2VSZA 3PG7A 5FI1A 2J0MA 3SYXA 2Z14A 3MDBC 3NW8A 2R0DA 2WH5A 1BAKA 1KI1B 1DDVA 2MKRA 4F7HA 3GYPA 4IOYX 5D3YA 4HAZB 2AL6A 1FAOA 1UPRA 3D8EA 3WA0A 2R2YA 1Q67A 3ZDTA 3NWDA 5J3TA 1WG7A 3TVVA 2GCLA 1KC7A 2RUKB 2Z13A 3SUZA 3SV1A 1ZVRA 3BINA 4JKHA 2R09A 3PSCA 3QIJA 3PVWA 3ULCA 4EJNA 1WGUA 3O96A 4MY6A 2D2QA 4QJ4B 4Y94A 2COPA 1V5UA 3F0WA 1DIKA 3ENBA 3DXDA 3IVFA 4EMOA 4CHJA 3M1IB 1MIZB 3HW2B 4OSNA 1W1DA 2FDQA 2J0KA 1AQCA 4KAXB 4GMVA 3KY9A 3HK0A 1U5FA 1X11A 2AEHA 3E66A 4WJ7A 4TYZA 2RLOA 5I2MA 1BWNA 2YT0A 3MPXA 3PVUA 1HBKA 1U5DA 1KZGA 2DIKA 3ODOA 2GJYA 2K2UA 1EF1A 3NWFA 2D11A 2X18A 5JVLA 5J3YA 1OMWA 2P0FA 1ZC3B 2DX1A 2Z59A 2CB8A 1XKEA 2NMBA 2DX5A 5LG4B 2NZ8B 5DH9B 1PMSA 2Z0OA 3TW1A 2D9YA 2Z0PA 4A6HA 3FP5A 3ML4A 2LULA 3PEGA 1VBGA 4HATB 5KQ1A 4JKFA 4DIXA 4GOUA 2L2IA 4MT7A 1ACAA 4MK0A 1ZYIA 4NY0A 2M14A 3BJIA 2LBBA 1U29A 4KHAA 4OT1A 2D4QA 1N3HA 4XWXA 1U5GA 4JKGB 5D3WA 2DHJA 2UVMA 4ILHA 1GG3A 3FEHA 5D3VA 1PFJA 1JDEA 1P3RA 4KHBA 3FLVA 1TJ6A 2ZKMX 2YS3A 4ILJA 3PVLA 2CQUA 2NBVA 3QWMA 1U27A 2QKLA 2OQBA 2CODA 3NSUA 2R82A 3AJ4A 2E2XA 3TO1A 1EVHA 2ZPYA 1T77A 2DHKA 5KQ4A 3FSSA 3UZTA 1WI1A 2W2XD 3OHMB 2D10A 2MWNB 1V89A 1HB6A 4TKNA 4CSQA 5CLQB 5C5BA 3SBGA 3GYOA 4B6HA 4A5KA 2ABDA 4QJ5B 1ZC4B 2DA0A 2RSGA 2UZRA 1LW3A 1FHXA 4K17A 1BTKA 1P5TA 5DI9B 4KVGB 5D27A 1H4RA 5JHGA 4H8SA 2LOZA 1GGOA 1FHOA 2G35A 2Z0QA 3SBTA 3KRWA 4IFSA 2L1CA 4HB3B 1FHWA 3HSAA 5HE1A 1GC6A 1X05A 1OY2A 4GMXB 1NTIA 2M38A 2YF0A 4JKGA 1MI1A 1UEFA 2DKPA 1QQGA 4JKEA 2IFSA 4D0NB 1M7RA 3WYFB 2FJLA 1ISNA 4K2OA 3E9LA 1RJ2A 5GOWB 3A98B 2BCJA 2COAA 2QKMA 1OQNA 1FGYA 1I7AA 4DX8A 2D9WA 3KSYA 2HE7A 1MAIA 4JK7A 4JKAA 1UNRA 4HB4B 2D9XA 4Z2MB 1M7EA 2KUQA 5C5BB 3TFMA 1IRSA 4C0AA 3DXCA 1XX0A 2CY4A 1NI2A 2KIEA 3T06A 2CRFA 2ELAA 1U5EA 2YT1A 1NTVA 4EKUA 2YRYA 2DLWA 2RQ1A 4ZRJA 2GS0A 4K81A 2VRWB 1XR0B 1RRPB 2MDXA 2RVBB 4WSFA 5JHHA 1QC6A 2W2WA 3D8DA 1X86A 3A8QA 2J0JA 1Y19B 2EJ8A 4HHVA 4A6FA 2ELBA 2V76A 2DKQA 4CYEA 1J19A 3FVCA 4BBKA 2VKIA 1XCGA 1FOEA 5JLJB 4K2PA 4L1RA 1KZ7A 4NSWA 2UZSA 3N7CA 3X23A 3U12A 4ILGB 2IYBA 5C6RA 4HDQA 5IJMA 2DN6A 5CLLB 4IAPA 3HIEA 2JP2A 1WJMA 3AU4A 3EPYA 2KCJA 2DTCA 4HB2B 1NTYA 5HE0A 2W2XC 2I5CA 2YT2A 1EAZA 1XD4A 5IRSA 2LG1A 3FM8C 2LOXA
chains in the Genus database with same CATH topology
3PZDA 4DX90 1I2HA 5J3QA 4YL8A 2H7EA 4GPTB 2PZ1A 2ADZA 3CXBB 1GC7A 1WVHA 2P0DA 1MPHA 2X0SA 4DBBA 4GXBA 4HB0B 5DHAB 5D3XA 3U7DA 3D8FA 1WJ1A 4ZRIA 1AWEA 2D9VA 4PQ0A 2I1KA 1DBHA 2I1JA 2EMTA 3VOQA 3DXEA 1W1HA 2ROZB 1B55A 2CY5A 4F7UP 1EGXA 2Y7BA 4A6FB 4KHBB 5FI0A 2DHIA 2RGNB 4JKBA 3U8ZA 4GZUA 4JK9A 1ZM0A 1NVLA 5HE3A 2DYQA 1Z87A 1V5PA 3PP2A 1MK9B 2N0YA 1BTNA 1UNQA 3TCAA 5C79A 3P6AA 4F7GA 2Q13A 4P7IA 5EFXA 1P6SA 2RNRB 3SO6A 2I5FA 3F5RA 2DFKA 4DXAB 2HRJA 1VBHA 3ULBA 3P7ZA 1X1GA 4HAVB 1Y5OA 1J0WA 3QBVB 3SNHA 2LKOA 2YS5A 5JP4A 4JK8A 4JKDA 3LJUX 1PLSA 2DYNA 4A6KA 3ODWA 1V61A 4CHMA 2GCJA 1XODA 2EC1A 3G9WA 2K2JA 5HE2A 2K00A 2XQNM 4HDOA 1FGZA 4PNKA 3E9OA 1X1FA 1NU2A 2H7DA 5L81A 3RCPA 3HQCA 3KRXA 3OANA 5LONB 1WGQA 2EMSA 1ST7A 1SHCA 2COCA 4HAWB 3A8PA 1FB8A 2YSZA 1W1GA 1HB8A 1DYNA 3CIKA 1K5DB 5C16A 1DROA 2D9ZA 2LYDA 1SGHA 2ROVA 2YVCA 4GN1A 2COFA 2CAYA 2N23A 3KZ1A 4YONA 1MK7B 1K5GB 1E5WA 1TQZA 1U2BA 2P0HA 3V5WA 2YS1A 4L6EA 2MFQA 1V88A 1H10A 5DIFB 5KCVA 1MKEA 4ZRKA 2Y8FA 4WVFB 1UPQA 4HAXB 1ZSQA 4KHOA 2KGXB 1KBLA 1LB1A 1TXDA 4HAYB 3E9PA 3ZVRA 4JKCA 3ODXA 2OTXA 2KUPA 2Y8GA 4HAUB 1MIXA 2HTHB 1DDMA 3AU5A 1V5MA 2J59M 5DHFB 3VIAA 1DDWA 5LOPB 2P8VA 2FJ9A 4Z2NA 1UNPA 2VSZA 3PG7A 5FI1A 2J0MA 3SYXA 3MDBC 2R0DA 2WH5A 1BAKA 1KI1B 1DDVA 2MKRA 4F7HA 3GYPA 4IOYX 5D3YA 4HAZB 2AL6A 1FAOA 1UPRA 3D8EA 3WA0A 1Q67A 3ZDTA 5J3TA 1WG7A 3TVVA 2GCLA 1KC7A 2RUKB 3SUZA 3SV1A 1ZVRA 3BINA 4JKHA 2R09A 3PSCA 3QIJA 3PVWA 3ULCA 4EJNA 1WGUA 3O96A 4MY6A 2D2QA 4Y94A 2COPA 1V5UA 3F0WA 1DIKA 3ENBA 3DXDA 3IVFA 4EMOA 4CHJA 3M1IB 1MIZB 3HW2B 1W1DA 2FDQA 2J0KA 1AQCA 4KAXB 4GMVA 3KY9A 3HK0A 1U5FA 1X11A 2AEHA 3E66A 4WJ7A 4TYZA 2RLOA 1BWNA 2YT0A 3MPXA 3PVUA 1HBKA 1U5DA 1KZGA 2DIKA 3ODOA 2GJYA 2K2UA 1EF1A 2D11A 2X18A 5JVLA 5J3YA 1OMWA 2P0FA 1ZC3B 2DX1A 2CB8A 1XKEA 2NMBA 2DX5A 2NZ8B 5DH9B 1PMSA 2Z0OA 3TW1A 2D9YA 2Z0PA 4A6HA 3FP5A 3ML4A 2LULA 3PEGA 1VBGA 4HATB 5KQ1A 4JKFA 2L2IA 4MT7A 1ACAA 4MK0A 4NY0A 2M14A 3BJIA 2LBBA 1U29A 4KHAA 2D4QA 1N3HA 4XWXA 1U5GA 4JKGB 5D3WA 2DHJA 2UVMA 4ILHA 1GG3A 3FEHA 5D3VA 1PFJA 1JDEA 1P3RA 3FLVA 1TJ6A 2YS3A 4ILJA 3PVLA 2CQUA 3QWMA 1U27A 2QKLA 2OQBA 2CODA 3NSUA 2R82A 3AJ4A 2E2XA 3TO1A 1EVHA 2ZPYA 2DHKA 5KQ4A 3FSSA 3UZTA 1WI1A 2W2XD 2D10A 2MWNB 1V89A 1HB6A 4TKNA 5CLQB 5C5BA 3SBGA 3GYOA 4B6HA 4A5KA 2ABDA 1ZC4B 2DA0A 2RSGA 2UZRA 1LW3A 1FHXA 4K17A 1BTKA 1P5TA 5DI9B 4KVGB 5D27A 1H4RA 5JHGA 4H8SA 2LOZA 1GGOA 1FHOA 2G35A 2Z0QA 3SBTA 3KRWA 4IFSA 2L1CA 4HB3B 1FHWA 5HE1A 1GC6A 1X05A 1OY2A 4GMXB 1NTIA 2M38A 2YF0A 4JKGA 1UEFA 2DKPA 1QQGA 4JKEA 2IFSA 4D0NB 1M7RA 3WYFB 2FJLA 1ISNA 4K2OA 3E9LA 1RJ2A 5GOWB 3A98B 2BCJA 2COAA 2QKMA 1OQNA 1FGYA 1I7AA 4DX8A 2D9WA 3KSYA 2HE7A 1MAIA 4JK7A 4JKAA 1UNRA 4HB4B 2D9XA 4Z2MB 1M7EA 5C5BB 3TFMA 1IRSA 4C0AA 3DXCA 1XX0A 2CY4A 1NI2A 3T06A 2CRFA 2ELAA 1U5EA 2YT1A 1NTVA 4EKUA 2YRYA 2DLWA 2RQ1A 4ZRJA 2GS0A 4K81A 2VRWB 1XR0B 1RRPB 2MDXA 2RVBB 4WSFA 5JHHA 1QC6A 2W2WA 3D8DA 1X86A 3A8QA 2J0JA 1Y19B 2EJ8A 4HHVA 4A6FA 2ELBA 2V76A 2DKQA 4CYEA 1J19A 4BBKA 2VKIA 1XCGA 1FOEA 5JLJB 4K2PA 1KZ7A 4NSWA 2UZSA 3N7CA 3X23A 4ILGB 2IYBA 5C6RA 4HDQA 5IJMA 2DN6A 5CLLB 4IAPA 2JP2A 1WJMA 3AU4A 3EPYA 2KCJA 2DTCA 4HB2B 1NTYA 5HE0A 2W2XC 2I5CA 1EAZA 1XD4A 2LG1A 3FM8C 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  4DX9 0;  1I2H A;  5J3Q A;  4YL8 A;  2H7E A;  4GPT B;  2PZ1 A;  2ADZ A;  3CXB B;  1GC7 A;  1WVH A;  2P0D A;  1MPH A;  4DBB A;  4GXB A;  4HB0 B;  5DHA B;  5D3X A;  3U7D A;  3D8F A;  1WJ1 A;  4ZRI A;  1AWE A;  2D9V A;  4PQ0 A;  2I1K A;  1DBH A;  2I1J A;  2EMT A;  3VOQ A;  3DXE A;  1W1H A;  2ROZ B;  1B55 A;  2CY5 A;  4F7U P;  1EGX A;  2Y7B A;  4A6F B;  4KHB B;  5FI0 A;  2DHI A;  2RGN B;  3U8Z A;  4GZU A;  1ZM0 A;  1NVL A;  5HE3 A;  2DYQ A;  1Z87 A;  1V5P A;  3PP2 A;  1MK9 B;  2N0Y A;  1BTN A;  1UNQ A;  3TCA A;  5C79 A;  3P6A A;  4F7G A;  2Q13 A;  4P7I A;  5EFX A;  1P6S A;  2RNR B;  3SO6 A;  2I5F A;  3F5R A;  2DFK A;  4DXA B;  2HRJ A;  3ULB A;  3P7Z A;  1X1G A;  4HAV B;  1Y5O A;  1J0W A;  3QBV B;  3SNH A;  2LKO A;  2YS5 A;  5JP4 A;  3LJU X;  1PLS A;  2DYN A;  4A6K A;  3ODW A;  1V61 A;  4CHM A;  2GCJ A;  1XOD A;  2EC1 A;  3G9W A;  2K2J A;  5HE2 A;  2K00 A;  2XQN M;  4HDO A;  1FGZ A;  4PNK A;  1X1F A;  1NU2 A;  2H7D A;  5L81 A;  3RCP A;  3HQC A;  3KRX A;  3OAN A;  5LON B;  1WGQ A;  2EMS A;  1ST7 A;  1SHC A;  2COC A;  4HAW B;  3A8P A;  1FB8 A;  2YSZ A;  1W1G A;  1HB8 A;  1DYN A;  3CIK A;  1K5D B;  5C16 A;  1DRO A;  2D9Z A;  2LYD A;  1SGH A;  2ROV A;  2YVC A;  4GN1 A;  2COF A;  2CAY A;  2N23 A;  3KZ1 A;  4YON A;  1MK7 B;  1K5G B;  1E5W A;  1TQZ A;  1U2B A;  2P0H A;  3V5W A;  2YS1 A;  4L6E A;  2MFQ A;  1V88 A;  1H10 A;  5DIF B;  5KCV A;  1MKE A;  4ZRK A;  2Y8F A;  4WVF B;  1UPQ A;  4HAX B;  1ZSQ A;  4KHO A;  2KGX B;  1LB1 A;  1TXD A;  4HAY B;  3ZVR A;  3ODX A;  2OTX A;  2KUP A;  2Y8G A;  4HAU B;  1MIX A;  2HTH B;  1DDM A;  3AU5 A;  1V5M A;  2J59 M;  5DHF B;  3VIA A;  1DDW A;  5LOP B;  2P8V A;  2FJ9 A;  4Z2N A;  1UNP A;  2VSZ A;  3PG7 A;  5FI1 A;  2J0M A;  3SYX A;  3MDB C;  2R0D A;  2WH5 A;  1BAK A;  1KI1 B;  1DDV A;  2MKR A;  4F7H A;  3GYP A;  4IOY X;  5D3Y A;  4HAZ B;  2AL6 A;  1FAO A;  1UPR A;  3D8E A;  3WA0 A;  1Q67 A;  3ZDT A;  5J3T A;  1WG7 A;  3TVV A;  2GCL A;  2RUK B;  3SUZ A;  3SV1 A;  1ZVR A;  3BIN A;  2R09 A;  3PSC A;  3ULC A;  3QIJ A;  3PVW A;  4EJN A;  1WGU A;  3O96 A;  4MY6 A;  2D2Q A;  4Y94 A;  2COP A;  1V5U A;  3F0W A;  3DXD A;  3IVF A;  4EMO A;  4CHJ A;  3M1I B;  1MIZ B;  3HW2 B;  1W1D A;  2FDQ A;  2J0K A;  1AQC A;  4KAX B;  4GMV A;  3KY9 A;  3HK0 A;  1U5F A;  1X11 A;  2AEH A;  4WJ7 A;  4TYZ A;  2RLO A;  1BWN A;  2YT0 A;  3MPX A;  3PVU A;  1HBK A;  1U5D A;  1KZG A;  3ODO A;  2GJY A;  2K2U A;  1EF1 A;  2D11 A;  2X18 A;  5J3Y A;  1OMW A;  2P0F A;  1ZC3 B;  2DX1 A;  2CB8 A;  1XKE A;  2NMB A;  2DX5 A;  2NZ8 B;  5DH9 B;  1PMS A;  2Z0O A;  3TW1 A;  2D9Y A;  2Z0P A;  4A6H A;  3FP5 A;  3ML4 A;  2LUL A;  3PEG A;  4HAT B;  5KQ1 A;  2L2I A;  4MT7 A;  1ACA A;  4MK0 A;  4NY0 A;  2M14 A;  3BJI A;  2LBB A;  1U29 A;  4KHA A;  2D4Q A;  1N3H A;  4XWX A;  1U5G A;  5D3W A;  2DHJ A;  2UVM A;  1GG3 A;  3FEH A;  5D3V A;  1PFJ A;  1P3R A;  3FLV A;  1TJ6 A;  2YS3 A;  3PVL A;  2CQU A;  3QWM A;  1U27 A;  2QKL A;  2OQB A;  2COD A;  3NSU A;  3TO1 A;  3AJ4 A;  2E2X A;  1EVH A;  2ZPY A;  2DHK A;  5KQ4 A;  3FSS A;  3UZT A;  1WI1 A;  2W2X D;  2D10 A;  2MWN B;  1V89 A;  1HB6 A;  4TKN A;  5CLQ B;  5C5B A;  3GYO A;  4B6H A;  4A5K A;  2ABD A;  1ZC4 B;  2DA0 A;  2RSG A;  2UZR A;  1LW3 A;  1FHX A;  4K17 A;  1BTK A;  1P5T A;  5DI9 B;  4KVG B;  5D27 A;  1H4R A;  5JHG A;  4H8S A;  2LOZ A;  1FHO A;  2G35 A;  2Z0Q A;  3KRW A;  4IFS A;  2L1C A;  4HB3 B;  1FHW A;  5HE1 A;  1GC6 A;  1X05 A;  1OY2 A;  4GMX B;  1NTI A;  2M38 A;  2YF0 A;  1UEF A;  2DKP A;  1QQG A;  2IFS A;  4D0N B;  1M7R A;  3WYF B;  2FJL A;  1ISN A;  4K2O A;  5GOW B;  1RJ2 A;  3A98 B;  2BCJ A;  2COA A;  2QKM A;  1OQN A;  1FGY A;  1I7A A;  4DX8 A;  2D9W A;  3KSY A;  2HE7 A;  1MAI A;  1UNR A;  4HB4 B;  2D9X A;  4Z2M B;  1M7E A;  5C5B B;  3TFM A;  1IRS A;  4C0A A;  3DXC A;  1XX0 A;  2CY4 A;  1NI2 A;  3T06 A;  2CRF A;  2ELA A;  1U5E A;  2YT1 A;  1NTV A;  4EKU A;  2YRY A;  2DLW A;  2RQ1 A;  4ZRJ A;  2GS0 A;  4K81 A;  2VRW B;  1XR0 B;  1RRP B;  2MDX A;  2RVB B;  4WSF A;  5JHH A;  1QC6 A;  2W2W A;  3D8D A;  1X86 A;  3A8Q A;  2J0J A;  1Y19 B;  2EJ8 A;  4HHV A;  4A6F A;  2ELB A;  2V76 A;  2DKQ A;  4CYE A;  1J19 A;  4BBK A;  2VKI A;  1XCG A;  1FOE A;  5JLJ B;  4K2P A;  1KZ7 A;  4NSW A;  2UZS A;  3N7C A;  3X23 A;  2IYB A;  5C6R A;  4HDQ A;  5IJM A;  2DN6 A;  5CLL B;  4IAP A;  2JP2 A;  1WJM A;  3AU4 A;  3EPY A;  2KCJ A;  2DTC A;  4HB2 B;  1NTY A;  5HE0 A;  2W2X C;  2I5C A;  1EAZ A;  1XD4 A;  2LG1 A;  3FM8 C;  2LOX A; 
#chains in the Genus database with same CATH topology
 3PZD A;  4DX9 0;  1I2H A;  5J3Q A;  4YL8 A;  2K49 A;  2H7E A;  4GPT B;  2PZ1 A;  2K8E A;  2ADZ A;  3CXB B;  1GC7 A;  1WVH A;  2P0D A;  4HSI A;  2KIG A;  1MPH A;  2X0S A;  4DBB A;  4GXB A;  4HB0 B;  5DHA B;  5D3X A;  3U7D A;  3D8F A;  1WJ1 A;  4ZRI A;  1AWE A;  2D9V A;  4PQ0 A;  2I1K A;  1DBH A;  2I1J A;  3A58 A;  4D6W A;  4QXA B;  2EMT A;  2KR0 A;  3VOQ A;  3DXE A;  1W1H A;  2ROZ B;  1B55 A;  2CY5 A;  4F7U P;  1EGX A;  2Y7B A;  4A6F B;  4KHB B;  5FI0 A;  2DHI A;  2RGN B;  4JKB A;  3U8Z A;  4GZU A;  4JK9 A;  1ZM0 A;  1NVL A;  5HE3 A;  2DYQ A;  1Z87 A;  1V5P A;  3PP2 A;  5I2S A;  1MK9 B;  2N0Y A;  1BTN A;  1UNQ A;  3TCA A;  5C79 A;  3P6A A;  4F7G A;  2Q13 A;  4P7I A;  3DCX A;  5EFX A;  1P6S A;  2RNR B;  3SO6 A;  2I5F A;  3F5R A;  2DFK A;  4DXA B;  2HRJ A;  1VBH A;  3B77 A;  3ULB A;  3P7Z A;  1X1G A;  4HAV B;  1Y5O A;  1J0W A;  3QBV B;  3SNH A;  2LKO A;  2YS5 A;  5JP4 A;  4JK8 A;  4JKD A;  3LJU X;  1PLS A;  4QJ3 B;  2DYN A;  4A6K A;  3ODW A;  1V61 A;  4CHM A;  2GCJ A;  1XOD A;  2RRF A;  2EC1 A;  3G9W A;  2K2J A;  5HE2 A;  2K00 A;  2XQN M;  4HDO A;  1FGZ A;  4PNK A;  3E9O A;  1X1F A;  1NU2 A;  2H7D A;  2GUM A;  5L81 A;  3RCP A;  3HQC A;  3KRX A;  3OAN A;  5LON B;  1WGQ A;  2EMS A;  1ST7 A;  3NWA A;  1SHC A;  2Z4D A;  2COC A;  4HAW B;  3A8P A;  1FB8 A;  2YSZ A;  1W1G A;  1HB8 A;  1DYN A;  3CIK A;  1K5D B;  5C16 A;  1DRO A;  2D9Z A;  2LYD A;  1SGH A;  2ROV A;  2YVC A;  4GN1 A;  2COF A;  2CAY A;  2N23 A;  5M4Y B;  3KZ1 A;  4YON A;  1MK7 B;  1K5G B;  1E5W A;  1TQZ A;  1U2B A;  2P0H A;  3V5W A;  2YS1 A;  4L6E A;  2MFQ A;  1V88 A;  1H10 A;  2FJU B;  5DIF B;  5KCV A;  1MKE A;  4ZRK A;  2Y8F A;  4WVF B;  1UPQ A;  4HAX B;  1ZSQ A;  4KHO A;  2KGX B;  1KBL A;  1LB1 A;  1TXD A;  4GNK B;  4HAY B;  3E9P A;  3ZVR A;  4JKC A;  3ODX A;  2OTX A;  2KUP A;  2Y8G A;  4HAU B;  1MIX A;  2HTH B;  1DDM A;  3AU5 A;  1V5M A;  2J59 M;  5DHF B;  3VIA A;  1DDW A;  5LOP B;  2P8V A;  2FJ9 A;  4Z2N A;  1UNP A;  2VSZ A;  3PG7 A;  5FI1 A;  2J0M A;  3SYX A;  2Z14 A;  3MDB C;  3NW8 A;  2R0D A;  2WH5 A;  1BAK A;  1KI1 B;  1DDV A;  2MKR A;  4F7H A;  3GYP A;  4IOY X;  5D3Y A;  4HAZ B;  2AL6 A;  1FAO A;  1UPR A;  3D8E A;  3WA0 A;  2R2Y A;  1Q67 A;  3ZDT A;  3NWD A;  5J3T A;  1WG7 A;  3TVV A;  2GCL A;  1KC7 A;  2RUK B;  2Z13 A;  3SUZ A;  3SV1 A;  1ZVR A;  3BIN A;  4JKH A;  2R09 A;  3PSC A;  3QIJ A;  3PVW A;  3ULC A;  4EJN A;  1WGU A;  3O96 A;  4MY6 A;  2D2Q A;  4QJ4 B;  4Y94 A;  2COP A;  1V5U A;  3F0W A;  1DIK A;  3ENB A;  3DXD A;  3IVF A;  4EMO A;  4CHJ A;  3M1I B;  1MIZ B;  3HW2 B;  4OSN A;  1W1D A;  2FDQ A;  2J0K A;  1AQC A;  4KAX B;  4GMV A;  3KY9 A;  3HK0 A;  1U5F A;  1X11 A;  2AEH A;  3E66 A;  4WJ7 A;  4TYZ A;  2RLO A;  5I2M A;  1BWN A;  2YT0 A;  3MPX A;  3PVU A;  1HBK A;  1U5D A;  1KZG A;  2DIK A;  3ODO A;  2GJY A;  2K2U A;  1EF1 A;  3NWF A;  2D11 A;  2X18 A;  5JVL A;  5J3Y A;  1OMW A;  2P0F A;  1ZC3 B;  2DX1 A;  2Z59 A;  2CB8 A;  1XKE A;  2NMB A;  2DX5 A;  5LG4 B;  2NZ8 B;  5DH9 B;  1PMS A;  2Z0O A;  3TW1 A;  2D9Y A;  2Z0P A;  4A6H A;  3FP5 A;  3ML4 A;  2LUL A;  3PEG A;  1VBG A;  4HAT B;  5KQ1 A;  4JKF A;  4DIX A;  4GOU A;  2L2I A;  4MT7 A;  1ACA A;  4MK0 A;  1ZYI A;  4NY0 A;  2M14 A;  3BJI A;  2LBB A;  1U29 A;  4KHA A;  4OT1 A;  2D4Q A;  1N3H A;  4XWX A;  1U5G A;  4JKG B;  5D3W A;  2DHJ A;  2UVM A;  4ILH A;  1GG3 A;  3FEH A;  5D3V A;  1PFJ A;  1JDE A;  1P3R A;  4KHB A;  3FLV A;  1TJ6 A;  2ZKM X;  2YS3 A;  4ILJ A;  3PVL A;  2CQU A;  2NBV A;  3QWM A;  1U27 A;  2QKL A;  2OQB A;  2COD A;  3NSU A;  2R82 A;  3AJ4 A;  2E2X A;  3TO1 A;  1EVH A;  2ZPY A;  1T77 A;  2DHK A;  5KQ4 A;  3FSS A;  3UZT A;  1WI1 A;  2W2X D;  3OHM B;  2D10 A;  2MWN B;  1V89 A;  1HB6 A;  4TKN A;  4CSQ A;  5CLQ B;  5C5B A;  3SBG A;  3GYO A;  4B6H A;  4A5K A;  2ABD A;  4QJ5 B;  1ZC4 B;  2DA0 A;  2RSG A;  2UZR A;  1LW3 A;  1FHX A;  4K17 A;  1BTK A;  1P5T A;  5DI9 B;  4KVG B;  5D27 A;  1H4R A;  5JHG A;  4H8S A;  2LOZ A;  1GGO A;  1FHO A;  2G35 A;  2Z0Q A;  3SBT A;  3KRW A;  4IFS A;  2L1C A;  4HB3 B;  1FHW A;  3HSA A;  5HE1 A;  1GC6 A;  1X05 A;  1OY2 A;  4GMX B;  1NTI A;  2M38 A;  2YF0 A;  4JKG A;  1MI1 A;  1UEF A;  2DKP A;  1QQG A;  4JKE A;  2IFS A;  4D0N B;  1M7R A;  3WYF B;  2FJL A;  1ISN A;  4K2O A;  3E9L A;  1RJ2 A;  5GOW B;  3A98 B;  2BCJ A;  2COA A;  2QKM A;  1OQN A;  1FGY A;  1I7A A;  4DX8 A;  2D9W A;  3KSY A;  2HE7 A;  1MAI A;  4JK7 A;  4JKA A;  1UNR A;  4HB4 B;  2D9X A;  4Z2M B;  1M7E A;  2KUQ A;  5C5B B;  3TFM A;  1IRS A;  4C0A A;  3DXC A;  1XX0 A;  2CY4 A;  1NI2 A;  2KIE A;  3T06 A;  2CRF A;  2ELA A;  1U5E A;  2YT1 A;  1NTV A;  4EKU A;  2YRY A;  2DLW A;  2RQ1 A;  4ZRJ A;  2GS0 A;  4K81 A;  2VRW B;  1XR0 B;  1RRP B;  2MDX A;  2RVB B;  4WSF A;  5JHH A;  1QC6 A;  2W2W A;  3D8D A;  1X86 A;  3A8Q A;  2J0J A;  1Y19 B;  2EJ8 A;  4HHV A;  4A6F A;  2ELB A;  2V76 A;  2DKQ A;  4CYE A;  1J19 A;  3FVC A;  4BBK A;  2VKI A;  1XCG A;  1FOE A;  5JLJ B;  4K2P A;  4L1R A;  1KZ7 A;  4NSW A;  2UZS A;  3N7C A;  3X23 A;  3U12 A;  4ILG B;  2IYB A;  5C6R A;  4HDQ A;  5IJM A;  2DN6 A;  5CLL B;  4IAP A;  3HIE A;  2JP2 A;  1WJM A;  3AU4 A;  3EPY A;  2KCJ A;  2DTC A;  4HB2 B;  1NTY A;  5HE0 A;  2W2X C;  2I5C A;  2YT2 A;  1EAZ A;  1XD4 A;  5IRS A;  2LG1 A;  3FM8 C;  2LOX A; 
#chains in the Genus database with same CATH homology
 3PZD A;  4DX9 0;  1I2H A;  5J3Q A;  4YL8 A;  2H7E A;  4GPT B;  2PZ1 A;  2ADZ A;  3CXB B;  1GC7 A;  1WVH A;  2P0D A;  1MPH A;  2X0S A;  4DBB A;  4GXB A;  4HB0 B;  5DHA B;  5D3X A;  3U7D A;  3D8F A;  1WJ1 A;  4ZRI A;  1AWE A;  2D9V A;  4PQ0 A;  2I1K A;  1DBH A;  2I1J A;  2EMT A;  3VOQ A;  3DXE A;  1W1H A;  2ROZ B;  1B55 A;  2CY5 A;  4F7U P;  1EGX A;  2Y7B A;  4A6F B;  4KHB B;  5FI0 A;  2DHI A;  2RGN B;  4JKB A;  3U8Z A;  4GZU A;  4JK9 A;  1ZM0 A;  1NVL A;  5HE3 A;  2DYQ A;  1Z87 A;  1V5P A;  3PP2 A;  1MK9 B;  2N0Y A;  1BTN A;  1UNQ A;  3TCA A;  5C79 A;  3P6A A;  4F7G A;  2Q13 A;  4P7I A;  5EFX A;  1P6S A;  2RNR B;  3SO6 A;  2I5F A;  3F5R A;  2DFK A;  4DXA B;  2HRJ A;  1VBH A;  3ULB A;  3P7Z A;  1X1G A;  4HAV B;  1Y5O A;  1J0W A;  3QBV B;  3SNH A;  2LKO A;  2YS5 A;  5JP4 A;  4JK8 A;  4JKD A;  3LJU X;  1PLS A;  2DYN A;  4A6K A;  3ODW A;  1V61 A;  4CHM A;  2GCJ A;  1XOD A;  2EC1 A;  3G9W A;  2K2J A;  5HE2 A;  2K00 A;  2XQN M;  4HDO A;  1FGZ A;  4PNK A;  3E9O A;  1X1F A;  1NU2 A;  2H7D A;  5L81 A;  3RCP A;  3HQC A;  3KRX A;  3OAN A;  5LON B;  1WGQ A;  2EMS A;  1ST7 A;  1SHC A;  2COC A;  4HAW B;  3A8P A;  1FB8 A;  2YSZ A;  1W1G A;  1HB8 A;  1DYN A;  3CIK A;  1K5D B;  5C16 A;  1DRO A;  2D9Z A;  2LYD A;  1SGH A;  2ROV A;  2YVC A;  4GN1 A;  2COF A;  2CAY A;  2N23 A;  3KZ1 A;  4YON A;  1MK7 B;  1K5G B;  1E5W A;  1TQZ A;  1U2B A;  2P0H A;  3V5W A;  2YS1 A;  4L6E A;  2MFQ A;  1V88 A;  1H10 A;  5DIF B;  5KCV A;  1MKE A;  4ZRK A;  2Y8F A;  4WVF B;  1UPQ A;  4HAX B;  1ZSQ A;  4KHO A;  2KGX B;  1KBL A;  1LB1 A;  1TXD A;  4HAY B;  3E9P A;  3ZVR A;  4JKC A;  3ODX A;  2OTX A;  2KUP A;  2Y8G A;  4HAU B;  1MIX A;  2HTH B;  1DDM A;  3AU5 A;  1V5M A;  2J59 M;  5DHF B;  3VIA A;  1DDW A;  5LOP B;  2P8V A;  2FJ9 A;  4Z2N A;  1UNP A;  2VSZ A;  3PG7 A;  5FI1 A;  2J0M A;  3SYX A;  3MDB C;  2R0D A;  2WH5 A;  1BAK A;  1KI1 B;  1DDV A;  2MKR A;  4F7H A;  3GYP A;  4IOY X;  5D3Y A;  4HAZ B;  2AL6 A;  1FAO A;  1UPR A;  3D8E A;  3WA0 A;  1Q67 A;  3ZDT A;  5J3T A;  1WG7 A;  3TVV A;  2GCL A;  1KC7 A;  2RUK B;  3SUZ A;  3SV1 A;  1ZVR A;  3BIN A;  4JKH A;  2R09 A;  3PSC A;  3QIJ A;  3PVW A;  3ULC A;  4EJN A;  1WGU A;  3O96 A;  4MY6 A;  2D2Q A;  4Y94 A;  2COP A;  1V5U A;  3F0W A;  1DIK A;  3ENB A;  3DXD A;  3IVF A;  4EMO A;  4CHJ A;  3M1I B;  1MIZ B;  3HW2 B;  1W1D A;  2FDQ A;  2J0K A;  1AQC A;  4KAX B;  4GMV A;  3KY9 A;  3HK0 A;  1U5F A;  1X11 A;  2AEH A;  3E66 A;  4WJ7 A;  4TYZ A;  2RLO A;  1BWN A;  2YT0 A;  3MPX A;  3PVU A;  1HBK A;  1U5D A;  1KZG A;  2DIK A;  3ODO A;  2GJY A;  2K2U A;  1EF1 A;  2D11 A;  2X18 A;  5JVL A;  5J3Y A;  1OMW A;  2P0F A;  1ZC3 B;  2DX1 A;  2CB8 A;  1XKE A;  2NMB A;  2DX5 A;  2NZ8 B;  5DH9 B;  1PMS A;  2Z0O A;  3TW1 A;  2D9Y A;  2Z0P A;  4A6H A;  3FP5 A;  3ML4 A;  2LUL A;  3PEG A;  1VBG A;  4HAT B;  5KQ1 A;  4JKF A;  2L2I A;  4MT7 A;  1ACA A;  4MK0 A;  4NY0 A;  2M14 A;  3BJI A;  2LBB A;  1U29 A;  4KHA A;  2D4Q A;  1N3H A;  4XWX A;  1U5G A;  4JKG B;  5D3W A;  2DHJ A;  2UVM A;  4ILH A;  1GG3 A;  3FEH A;  5D3V A;  1PFJ A;  1JDE A;  1P3R A;  3FLV A;  1TJ6 A;  2YS3 A;  4ILJ A;  3PVL A;  2CQU A;  3QWM A;  1U27 A;  2QKL A;  2OQB A;  2COD A;  3NSU A;  2R82 A;  3AJ4 A;  2E2X A;  3TO1 A;  1EVH A;  2ZPY A;  2DHK A;  5KQ4 A;  3FSS A;  3UZT A;  1WI1 A;  2W2X D;  2D10 A;  2MWN B;  1V89 A;  1HB6 A;  4TKN A;  5CLQ B;  5C5B A;  3SBG A;  3GYO A;  4B6H A;  4A5K A;  2ABD A;  1ZC4 B;  2DA0 A;  2RSG A;  2UZR A;  1LW3 A;  1FHX A;  4K17 A;  1BTK A;  1P5T A;  5DI9 B;  4KVG B;  5D27 A;  1H4R A;  5JHG A;  4H8S A;  2LOZ A;  1GGO A;  1FHO A;  2G35 A;  2Z0Q A;  3SBT A;  3KRW A;  4IFS A;  2L1C A;  4HB3 B;  1FHW A;  5HE1 A;  1GC6 A;  1X05 A;  1OY2 A;  4GMX B;  1NTI A;  2M38 A;  2YF0 A;  4JKG A;  1UEF A;  2DKP A;  1QQG A;  4JKE A;  2IFS A;  4D0N B;  1M7R A;  3WYF B;  2FJL A;  1ISN A;  4K2O A;  3E9L A;  1RJ2 A;  5GOW B;  3A98 B;  2BCJ A;  2COA A;  2QKM A;  1OQN A;  1FGY A;  1I7A A;  4DX8 A;  2D9W A;  3KSY A;  2HE7 A;  1MAI A;  4JK7 A;  4JKA A;  1UNR A;  4HB4 B;  2D9X A;  4Z2M B;  1M7E A;  5C5B B;  3TFM A;  1IRS A;  4C0A A;  3DXC A;  1XX0 A;  2CY4 A;  1NI2 A;  3T06 A;  2CRF A;  2ELA A;  1U5E A;  2YT1 A;  1NTV A;  4EKU A;  2YRY A;  2DLW A;  2RQ1 A;  4ZRJ A;  2GS0 A;  4K81 A;  2VRW B;  1XR0 B;  1RRP B;  2MDX A;  2RVB B;  4WSF A;  5JHH A;  1QC6 A;  2W2W A;  3D8D A;  1X86 A;  3A8Q A;  2J0J A;  1Y19 B;  2EJ8 A;  4HHV A;  4A6F A;  2ELB A;  2V76 A;  2DKQ A;  4CYE A;  1J19 A;  4BBK A;  2VKI A;  1XCG A;  1FOE A;  5JLJ B;  4K2P A;  1KZ7 A;  4NSW A;  2UZS A;  3N7C A;  3X23 A;  4ILG B;  2IYB A;  5C6R A;  4HDQ A;  5IJM A;  2DN6 A;  5CLL B;  4IAP A;  2JP2 A;  1WJM A;  3AU4 A;  3EPY A;  2KCJ A;  2DTC A;  4HB2 B;  1NTY A;  5HE0 A;  2W2X C;  2I5C A;  1EAZ A;  1XD4 A;  2LG1 A;  3FM8 C;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...