1MK9B

Crystal structure of an integrin beta3-talin chimera
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
187
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Integrin Beta3
total genus 54
structure length 187
sequence length 190
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk9B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk9B02
2GJYA 1WVHA 5FI0A 1MIXA 1UNRA 3EPYA 2J0KA 1ZSQA 1BWNA 2XQNM 4DBBA 4BBKA 2DFKA 3PP2A 2MKRA 3AU4A 2UVMA 4HAVB 3PZDA 1HBKA 5D3WA 4HB3B 2ROZB 1WJ1A 3D8FA 5J3QA 1ZVRA 2KUPA 1E5WA 3TW1A 1P3RA 4DX8A 4L6EA 2ZPYA 4YL8A 2P8VA 2P0HA 2AL6A 1DDWA 4ZRJA 2CB8A 3V5WA 2OQBA 2YS1A 1X05A 4IOYX 3GYPA 3QWMA 1QQGA 2RLOA 4WJ7A 1UNPA 2W2XC 1WG7A 1TXDA 2COFA 1V5UA 1Y5OA 5D3YA 3FEHA 1BAKA 2VSZA 4KAXB 5DH9B 3ZDTA 2RGNB 5HE1A 1XODA 3D8EA 1U5DA 1GC6A 1NVLA 3ODXA 2ELAA 4P7IA 2P0DA 3CIKA 3N7CA 4EMOA 2DYNA 3PVUA 2IFSA 1SGHA 1EF1A 1KZ7A 1ZC4B 2Q13A 1Q67A 2RVBB 1K5DB 2CODA 2DKPA 2HE7A 3IVFA 1RJ2A 1BTKA 1FOEA 4GMVA 1M7RA 5IJMA 3KZ1A 5DIFB 2EMTA 3HW2B 1PMSA 2H7DA 1ST7A 1M7EA 2N0YA 1ACAA 1ISNA 3G9WA 5C5BA 1EAZA 1OY2A 3RCPA 5D3XA 3TVVA 4EJNA 1DROA 1UEFA 4HB2B 5LONB 1W1DA 1SHCA 1U29A 3SYXA 2COPA 2K00A 3MDBC 4Z2MB 2LBBA 2HRJA 5C16A 4Z2NA 1XCGA 1GG3A 3NSUA 3TO1A 1UNQA 2CY4A 2QKLA 3BJIA 3HK0A 2J0JA 5LOPB 1Y19B 2GCJA 2MDXA 1H4RA 4MT7A 3PVLA 1DDVA 5C79A 1WGQA 4CHJA 2Z0QA 3A8QA 1KI1B 2D11A 3TCAA 2ADZA 4TKNA 1NTYA 2Y7BA 5JHHA 2E2XA 1UPRA 1XD4A 2LG1A 1IRSA 2ELBA 2AEHA 1TJ6A 4HAWB 1J0WA 3M1IB 2VRWB 2I5CA 4K81A 1EGXA 2DYQA 3AJ4A 2RNRB 3U7DA 4HDOA 1NTIA 2D9XA 3UZTA 4ZRIA 4A6FB 3DXDA 1FGZA 1KZGA 1U2BA 2X18A 2BCJA 2DX1A 1K5GB 4MK0A 2DHKA 2EC1A 5KQ1A 4HHVA 1W1GA 2D9ZA 1TQZA 2COCA 3SNHA 2NZ8B 1WJMA 2DKQA 4A6FA 3ZVRA 1MAIA 1U5FA 2D10A 3ML4A 5D3VA 1FHXA 1HB6A 4F7GA 4TYZA 3AU5A 1X11A 2DN6A 4Y94A 1ZM0A 2Y8GA 1NTVA 3ULCA 3CXBB 2L1CA 4NY0A 4GMXB 1FGYA 1MKEA 3U8ZA 3ULBA 1XR0B 1BTNA 2PZ1A 4H8SA 3VOQA 4B6HA 2D2QA 4KHAA 5KCVA 3WYFB 4WSFA 5L81A 1U5EA 2NMBA 2YT0A 1J19A 1FHOA 2I1JA 2YF0A 2KCJA 3KSYA 4MY6A 1U27A 1MK9B 2LOZA 2YSZA 2LULA 2OTXA 3BINA 3FSSA 4PQ0A 3KRXA 4D0NB 1I7AA 3ODOA 4YONA 5EFXA 3VIAA 1I2HA 1HB8A 1V89A 1X1GA 4WVFB 4K2PA 4DX90 3GYOA 2LYDA 5GOWB 2L2IA 1UPQA 3A98B 4HB4B 2KGXB 4GN1A 4HDQA 1W1HA 2DTCA 2VKIA 3PEGA 4NSWA 1XX0A 4A6KA 3X23A 5CLLB 1FAOA 5D27A 2YVCA 2ROVA 5JLJB 1MK7B 3HQCA 2GS0A 3DXCA 1Z87A 2CAYA 2DX5A 3SUZA 4F7HA 2FDQA 3WA0A 2M14A 2DHJA 5FI1A 3P6AA 1N3HA 4CYEA 1DBHA 1DDMA 1XKEA 1MPHA 1X1FA 2J0MA 2RSGA 1RRPB 4F7UP 5C6RA 1FHWA 1GC7A 4HATB 5CLQB 3PSCA 1WGUA 3PVWA 5JHGA 1V5PA 4CHMA 3FP5A 2ABDA 2COAA 2RQ1A 1LB1A 2D4QA 2UZRA 1U5GA 2IYBA 2LKOA 2GCLA 2MWNB 1V88A 2CRFA 2QKMA 2J59M 2P0FA 5KQ4A 2WH5A 1P6SA 2DLWA 2LOXA 4HB0B 2W2XD 5HE0A 2D9VA 3PG7A 5J3TA 3OANA 3P7ZA 1B55A 1WI1A 4K2OA 3F5RA 5HE2A 1DYNA 1EVHA 1V5MA 5DHAB 3DXEA 1LW3A 2M38A 2H7EA 1ZC3B 4K17A 3QIJA 4KHBB 1FB8A 3SO6A 4GPTB 3FM8C 1NI2A 2I1KA 1V61A 1AWEA 2V76A 2RUKB 4KVGB 3KRWA 2FJLA 2CQUA 2Y8FA 5DHFB 3KY9A 1OMWA 2YT1A 4PNKA 2D9YA 1PLSA 5DI9B 3SV1A 4A6HA 4HAUB 3TFMA 5JP4A 3F0WA 3T06A 1QC6A 4C0AA 4HAXB 2Z0PA 1MIZB 4A5KA 1NU2A 4IFSA 1OQNA 3QBVB 5C5BB 4IAPA 4DXAB 3LJUX 3FLVA 2W2WA 5J3YA 3MPXA 1PFJA 2G35A 2MFQA 4XWXA 2HTHB 1AQCA 3ODWA 2CY5A 2R0DA 2R09A 2YS5A 4HAZB 1P5TA 2EJ8A 2K2UA 2DHIA 4GZUA 2YS3A 4EKUA 1H10A 2Z0OA 2UZSA 3A8PA 2K2JA 2DA0A 2FJ9A 4KHOA 2JP2A 3O96A 2YRYA 1X86A 4GXBA 4ZRKA 2EMSA 2D9WA 2I5FA 4HAYB 3D8DA 2N23A 5HE3A
chains in the Genus database with same CATH superfamily
2GJYA 1WVHA 3E9PA 5FI0A 1MIXA 1UNRA 3EPYA 2J0KA 1ZSQA 1BWNA 2XQNM 4DBBA 4ILJA 4BBKA 2DFKA 3PP2A 2MKRA 3AU4A 2UVMA 4HAVB 3PZDA 2ZKMX 1HBKA 1ZYIA 3NWFA 5D3WA 4HB3B 2ROZB 1WJ1A 3D8FA 2KIEA 5J3QA 1ZVRA 2KUPA 1E5WA 3TW1A 1P3RA 4DX8A 4L6EA 2ZPYA 4YL8A 4JKHA 2P8VA 2P0HA 2K49A 4HSIA 2AL6A 1DDWA 4ZRJA 2CB8A 3V5WA 2OQBA 2YS1A 1X05A 4IOYX 3GYPA 3QWMA 1QQGA 2RLOA 4WJ7A 1UNPA 2W2XC 5IRSA 1VBGA 1TXDA 1WG7A 2COFA 4KHBA 1V5UA 2KR0A 1Y5OA 5D3YA 3FEHA 1BAKA 2VSZA 4KAXB 3OHMB 1DIKA 3ZDTA 2RGNB 5DH9B 5HE1A 1XODA 3D8EA 1U5DA 1GC6A 1NVLA 3ODXA 2ELAA 4P7IA 2P0DA 2X0SA 1JDEA 3CIKA 3N7CA 4OT1A 4EMOA 2DYNA 3PVUA 2IFSA 1SGHA 4GNKB 1EF1A 1KZ7A 1ZC4B 2Q13A 1Q67A 2RVBB 1K5DB 2CODA 2DKPA 2HE7A 3IVFA 1RJ2A 1BTKA 2YT2A 1KC7A 1GGOA 1FOEA 4GMVA 1M7RA 5IJMA 3E9OA 3KZ1A 2KUQA 5DIFB 2EMTA 3HSAA 3HW2B 1PMSA 5I2MA 2H7DA 1ST7A 2N0YA 1M7EA 2Z4DA 4JKBA 1ACAA 1ISNA 4QJ4B 3G9WA 5C5BA 1EAZA 1OY2A 3RCPA 3B77A 5D3XA 3TVVA 4EJNA 1DROA 1UEFA 4HB2B 5LONB 1W1DA 1SHCA 1U29A 3SYXA 2COPA 2K00A 3MDBC 4Z2MB 2LBBA 2HRJA 5C16A 5M4YB 4Z2NA 1XCGA 1GG3A 4ILHA 3NSUA 3TO1A 1UNQA 2CY4A 2QKLA 3BJIA 3HK0A 2J0JA 5LOPB 1Y19B 2GCJA 2MDXA 1H4RA 4MT7A 4QJ3B 3PVLA 1DDVA 5C79A 1WGQA 4CHJA 2Z0QA 3A8QA 1KI1B 2D11A 3TCAA 2ADZA 2NBVA 4TKNA 1NTYA 2Y7BA 5JHHA 1T77A 2E2XA 1UPRA 1XD4A 2LG1A 1IRSA 2ELBA 3U12A 2AEHA 4JK9A 1TJ6A 4HAWB 1J0WA 3M1IB 2VRWB 2I5CA 4K81A 1EGXA 4JKFA 2DYQA 3AJ4A 2RNRB 3U7DA 4HDOA 1NTIA 2D9XA 3UZTA 4L1RA 4ZRIA 4DIXA 4A6FB 3DXDA 1FGZA 1KZGA 1U2BA 2X18A 2BCJA 2DX1A 1K5GB 4MK0A 2DHKA 2EC1A 3ENBA 5KQ1A 4HHVA 1W1GA 2D9ZA 1TQZA 2COCA 3SNHA 2NZ8B 1WJMA 2DKQA 4A6FA 3ZVRA 1MAIA 1U5FA 2D10A 3ML4A 5D3VA 1FHXA 1HB6A 2DIKA 4F7GA 4TYZA 3AU5A 1X11A 2GUMA 2DN6A 4Y94A 1ZM0A 2Y8GA 3NWDA 1NTVA 3ULCA 3CXBB 2L1CA 4NY0A 4GMXB 1FGYA 1MKEA 3U8ZA 3ULBA 1XR0B 1BTNA 2PZ1A 4H8SA 3VOQA 4B6HA 2D2QA 3SBTA 4KHAA 5KCVA 2Z13A 4JKAA 3WYFB 4WSFA 5L81A 1U5EA 2NMBA 2YT0A 1J19A 1FHOA 5I2SA 2I1JA 3SBGA 2KCJA 2YF0A 3KSYA 4OSNA 4MY6A 3HIEA 1U27A 1MK9B 2LOZA 4JK8A 2YSZA 2LULA 2OTXA 3BINA 3FSSA 4PQ0A 3KRXA 4D0NB 1I7AA 3ODOA 4YONA 5EFXA 3VIAA 1I2HA 1HB8A 1V89A 4JKEA 1X1GA 4WVFB 4K2PA 4DX90 3GYOA 2LYDA 5GOWB 2L2IA 1UPQA 3A98B 4HB4B 2KGXB 4GN1A 1MI1A 4JKCA 4HDQA 1W1HA 2DTCA 2VKIA 3PEGA 4NSWA 1XX0A 4A6KA 3X23A 5CLLB 1FAOA 5D27A 2YVCA 2ROVA 5JLJB 1MK7B 2RRFA 4CSQA 3HQCA 2GS0A 3DXCA 1Z87A 2CAYA 2DX5A 3SUZA 4F7HA 2FDQA 3WA0A 2M14A 4JKGA 2DHJA 5FI1A 3P6AA 1N3HA 4CYEA 1DBHA 1DDMA 1XKEA 1MPHA 1X1FA 2J0MA 2RSGA 1RRPB 4F7UP 5C6RA 1FHWA 1GC7A 4HATB 5CLQB 3PSCA 1WGUA 3PVWA 5JHGA 1V5PA 4CHMA 3FP5A 4JKDA 2ABDA 2COAA 2RQ1A 1LB1A 2D4QA 3NW8A 2UZRA 1U5GA 2IYBA 2LKOA 2Z14A 2GCLA 2FJUB 1KBLA 2MWNB 1V88A 4JK7A 2CRFA 4ILGB 2QKMA 2J59M 2P0FA 5KQ4A 2WH5A 1P6SA 2DLWA 5LG4B 1VBHA 2LOXA 4HB0B 2W2XD 5HE0A 2D9VA 3PG7A 2R2YA 4JKGB 5J3TA 3OANA 3P7ZA 5JVLA 1B55A 3E9LA 1WI1A 4K2OA 3F5RA 5HE2A 1DYNA 1EVHA 1V5MA 5DHAB 3DXEA 1LW3A 2M38A 2H7EA 1ZC3B 4K17A 3QIJA 2Z59A 4KHBB 1FB8A 3SO6A 2K8EA 4GPTB 3FM8C 1NI2A 2I1KA 1V61A 1AWEA 2V76A 2RUKB 4KVGB 3KRWA 4GOUA 2FJLA 2CQUA 3E66A 2Y8FA 5DHFB 3KY9A 1OMWA 4D6WA 2YT1A 4PNKA 2D9YA 1PLSA 5DI9B 3SV1A 4A6HA 4HAUB 3TFMA 5JP4A 3F0WA 3T06A 1QC6A 4C0AA 3DCXA 4HAXB 2Z0PA 1MIZB 4A5KA 1NU2A 4IFSA 3NWAA 1OQNA 3QBVB 5C5BB 4IAPA 4DXAB 3LJUX 2R82A 3FLVA 4QJ5B 2W2WA 5J3YA 3A58A 3MPXA 1PFJA 2G35A 2MFQA 4XWXA 2HTHB 1AQCA 3ODWA 2CY5A 2R0DA 2R09A 2YS5A 4HAZB 1P5TA 2EJ8A 2K2UA 2DHIA 4GZUA 2YS3A 2KIGA 4EKUA 1H10A 4QXAB 2Z0OA 2UZSA 2K2JA 3A8PA 2DA0A 2FJ9A 4KHOA 2JP2A 3O96A 2YRYA 1X86A 4GXBA 4ZRKA 2EMSA 2D9WA 3FVCA 2I5FA 4HAYB 3D8DA 2N23A 5HE3A
chains in the Genus database with same CATH topology
2GJYA 1WVHA 3E9PA 5FI0A 1MIXA 1UNRA 3EPYA 2J0KA 1ZSQA 1BWNA 2XQNM 4DBBA 4ILJA 4BBKA 2DFKA 3PP2A 2MKRA 3AU4A 2UVMA 4HAVB 3PZDA 1HBKA 5D3WA 4HB3B 2ROZB 1WJ1A 3D8FA 5J3QA 1ZVRA 2KUPA 1E5WA 3TW1A 1P3RA 4DX8A 4L6EA 2ZPYA 4YL8A 4JKHA 2P8VA 2P0HA 2AL6A 1DDWA 4ZRJA 2CB8A 3V5WA 2OQBA 2YS1A 1X05A 4IOYX 3GYPA 3QWMA 1QQGA 2RLOA 4WJ7A 1UNPA 2W2XC 1VBGA 1TXDA 1WG7A 2COFA 1V5UA 1Y5OA 5D3YA 3FEHA 1BAKA 2VSZA 4KAXB 5DH9B 1DIKA 3ZDTA 2RGNB 5HE1A 1XODA 3D8EA 1U5DA 1GC6A 1NVLA 3ODXA 2ELAA 4P7IA 2P0DA 2X0SA 1JDEA 3CIKA 3N7CA 4EMOA 2DYNA 3PVUA 2IFSA 1SGHA 1EF1A 1KZ7A 1ZC4B 2Q13A 1Q67A 2RVBB 1K5DB 2CODA 2DKPA 2HE7A 3IVFA 1RJ2A 1BTKA 1KC7A 1GGOA 1FOEA 4GMVA 1M7RA 5IJMA 3E9OA 3KZ1A 5DIFB 2EMTA 3HW2B 1PMSA 2H7DA 1ST7A 2N0YA 1M7EA 4JKBA 1ACAA 1ISNA 3G9WA 5C5BA 1EAZA 1OY2A 3RCPA 5D3XA 3TVVA 4EJNA 1DROA 1UEFA 4HB2B 5LONB 1W1DA 1SHCA 1U29A 3SYXA 2COPA 2K00A 3MDBC 4Z2MB 2LBBA 2HRJA 5C16A 4Z2NA 1XCGA 1GG3A 4ILHA 3NSUA 3TO1A 1UNQA 2CY4A 2QKLA 3BJIA 3HK0A 2J0JA 5LOPB 1Y19B 2GCJA 2MDXA 1H4RA 4MT7A 3PVLA 1DDVA 5C79A 1WGQA 4CHJA 2Z0QA 3A8QA 1KI1B 2D11A 3TCAA 2ADZA 4TKNA 1NTYA 2Y7BA 5JHHA 2E2XA 1UPRA 1XD4A 2LG1A 1IRSA 2ELBA 2AEHA 4JK9A 1TJ6A 4HAWB 1J0WA 3M1IB 2VRWB 2I5CA 4K81A 1EGXA 4JKFA 2DYQA 3AJ4A 2RNRB 3U7DA 4HDOA 1NTIA 2D9XA 3UZTA 4ZRIA 4A6FB 3DXDA 1FGZA 1KZGA 1U2BA 2X18A 2BCJA 2DX1A 1K5GB 4MK0A 2DHKA 2EC1A 3ENBA 5KQ1A 4HHVA 1W1GA 2D9ZA 1TQZA 2COCA 3SNHA 2NZ8B 1WJMA 2DKQA 4A6FA 3ZVRA 1MAIA 1U5FA 2D10A 3ML4A 5D3VA 1FHXA 1HB6A 2DIKA 4F7GA 4TYZA 3AU5A 1X11A 2DN6A 4Y94A 1ZM0A 2Y8GA 1NTVA 3ULCA 3CXBB 2L1CA 4NY0A 4GMXB 1FGYA 1MKEA 3U8ZA 3ULBA 1XR0B 1BTNA 2PZ1A 4H8SA 3VOQA 4B6HA 2D2QA 3SBTA 4KHAA 5KCVA 4JKAA 3WYFB 4WSFA 5L81A 1U5EA 2NMBA 2YT0A 1J19A 1FHOA 2I1JA 3SBGA 2KCJA 2YF0A 3KSYA 4MY6A 1U27A 1MK9B 2LOZA 4JK8A 2YSZA 2LULA 2OTXA 3BINA 3FSSA 4PQ0A 3KRXA 4D0NB 1I7AA 3ODOA 4YONA 5EFXA 3VIAA 1I2HA 1HB8A 1V89A 4JKEA 1X1GA 4WVFB 4K2PA 4DX90 3GYOA 2LYDA 5GOWB 2L2IA 1UPQA 3A98B 4HB4B 2KGXB 4GN1A 4JKCA 4HDQA 1W1HA 2DTCA 2VKIA 3PEGA 4NSWA 1XX0A 4A6KA 3X23A 5CLLB 1FAOA 5D27A 2YVCA 2ROVA 5JLJB 1MK7B 3HQCA 2GS0A 3DXCA 1Z87A 2CAYA 2DX5A 3SUZA 4F7HA 2FDQA 3WA0A 2M14A 4JKGA 2DHJA 5FI1A 3P6AA 1N3HA 4CYEA 1DBHA 1DDMA 1XKEA 1MPHA 1X1FA 2J0MA 2RSGA 1RRPB 4F7UP 5C6RA 1FHWA 1GC7A 4HATB 5CLQB 3PSCA 1WGUA 3PVWA 5JHGA 1V5PA 4CHMA 3FP5A 4JKDA 2ABDA 2COAA 2RQ1A 1LB1A 2D4QA 2UZRA 1U5GA 2IYBA 2LKOA 2GCLA 1KBLA 2MWNB 1V88A 4JK7A 2CRFA 4ILGB 2QKMA 2J59M 2P0FA 5KQ4A 2WH5A 1P6SA 2DLWA 1VBHA 2LOXA 4HB0B 2W2XD 5HE0A 2D9VA 3PG7A 4JKGB 5J3TA 3OANA 3P7ZA 5JVLA 1B55A 3E9LA 1WI1A 4K2OA 3F5RA 5HE2A 1DYNA 1EVHA 1V5MA 5DHAB 3DXEA 1LW3A 2M38A 2H7EA 1ZC3B 4K17A 3QIJA 4KHBB 1FB8A 3SO6A 4GPTB 3FM8C 1NI2A 2I1KA 1V61A 1AWEA 2V76A 2RUKB 4KVGB 3KRWA 2FJLA 2CQUA 3E66A 2Y8FA 5DHFB 3KY9A 1OMWA 2YT1A 4PNKA 2D9YA 1PLSA 5DI9B 3SV1A 4A6HA 4HAUB 3TFMA 5JP4A 3F0WA 3T06A 1QC6A 4C0AA 4HAXB 2Z0PA 1MIZB 4A5KA 1NU2A 4IFSA 1OQNA 3QBVB 5C5BB 4IAPA 4DXAB 3LJUX 2R82A 3FLVA 2W2WA 5J3YA 3MPXA 1PFJA 2G35A 2MFQA 4XWXA 2HTHB 1AQCA 3ODWA 2CY5A 2R0DA 2R09A 2YS5A 4HAZB 1P5TA 2EJ8A 2K2UA 2DHIA 4GZUA 2YS3A 4EKUA 1H10A 2Z0OA 2UZSA 3A8PA 2K2JA 2DA0A 2FJ9A 4KHOA 2JP2A 3O96A 2YRYA 1X86A 4GXBA 4ZRKA 2EMSA 2D9WA 2I5FA 4HAYB 3D8DA 2N23A 5HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJY A;  1WVH A;  5FI0 A;  1MIX A;  1UNR A;  3EPY A;  2J0K A;  1ZSQ A;  1BWN A;  2XQN M;  4DBB A;  4BBK A;  2DFK A;  3PP2 A;  2MKR A;  3AU4 A;  2UVM A;  4HAV B;  3PZD A;  1HBK A;  5D3W A;  4HB3 B;  2ROZ B;  1WJ1 A;  3D8F A;  5J3Q A;  1ZVR A;  2KUP A;  1E5W A;  3TW1 A;  1P3R A;  4DX8 A;  4L6E A;  2ZPY A;  4YL8 A;  2P8V A;  2P0H A;  2AL6 A;  1DDW A;  4ZRJ A;  2CB8 A;  3V5W A;  2OQB A;  2YS1 A;  1X05 A;  4IOY X;  3GYP A;  3QWM A;  1QQG A;  2RLO A;  4WJ7 A;  1UNP A;  2W2X C;  1WG7 A;  1TXD A;  2COF A;  1V5U A;  1Y5O A;  5D3Y A;  3FEH A;  1BAK A;  2VSZ A;  4KAX B;  5DH9 B;  3ZDT A;  2RGN B;  5HE1 A;  1XOD A;  3D8E A;  1U5D A;  1GC6 A;  1NVL A;  3ODX A;  2ELA A;  4P7I A;  2P0D A;  3CIK A;  3N7C A;  4EMO A;  2DYN A;  3PVU A;  2IFS A;  1SGH A;  1EF1 A;  1KZ7 A;  1ZC4 B;  2Q13 A;  1Q67 A;  2RVB B;  1K5D B;  2COD A;  2DKP A;  2HE7 A;  3IVF A;  1RJ2 A;  1BTK A;  1FOE A;  4GMV A;  1M7R A;  5IJM A;  3KZ1 A;  5DIF B;  2EMT A;  3HW2 B;  1PMS A;  2H7D A;  1ST7 A;  1M7E A;  2N0Y A;  1ACA A;  1ISN A;  3G9W A;  5C5B A;  1EAZ A;  1OY2 A;  3RCP A;  5D3X A;  3TVV A;  4EJN A;  1DRO A;  1UEF A;  4HB2 B;  5LON B;  1W1D A;  1SHC A;  1U29 A;  3SYX A;  2COP A;  2K00 A;  3MDB C;  4Z2M B;  2LBB A;  2HRJ A;  5C16 A;  4Z2N A;  1XCG A;  1GG3 A;  3NSU A;  3TO1 A;  1UNQ A;  2CY4 A;  2QKL A;  3BJI A;  3HK0 A;  2J0J A;  5LOP B;  1Y19 B;  2GCJ A;  2MDX A;  1H4R A;  4MT7 A;  3PVL A;  1DDV A;  5C79 A;  1WGQ A;  4CHJ A;  2Z0Q A;  3A8Q A;  1KI1 B;  2D11 A;  3TCA A;  2ADZ A;  4TKN A;  1NTY A;  2Y7B A;  5JHH A;  2E2X A;  1UPR A;  1XD4 A;  2LG1 A;  1IRS A;  2ELB A;  2AEH A;  1TJ6 A;  4HAW B;  1J0W A;  3M1I B;  2VRW B;  2I5C A;  4K81 A;  1EGX A;  2DYQ A;  3AJ4 A;  2RNR B;  3U7D A;  4HDO A;  1NTI A;  2D9X A;  3UZT A;  4ZRI A;  4A6F B;  3DXD A;  1FGZ A;  1KZG A;  1U2B A;  2X18 A;  2BCJ A;  2DX1 A;  1K5G B;  4MK0 A;  2DHK A;  2EC1 A;  5KQ1 A;  4HHV A;  1W1G A;  2D9Z A;  1TQZ A;  2COC A;  3SNH A;  2NZ8 B;  1WJM A;  2DKQ A;  4A6F A;  3ZVR A;  1MAI A;  1U5F A;  2D10 A;  3ML4 A;  5D3V A;  1FHX A;  1HB6 A;  4F7G A;  4TYZ A;  3AU5 A;  1X11 A;  2DN6 A;  4Y94 A;  1ZM0 A;  2Y8G A;  1NTV A;  3ULC A;  3CXB B;  2L1C A;  4NY0 A;  4GMX B;  1FGY A;  1MKE A;  3U8Z A;  3ULB A;  1XR0 B;  1BTN A;  2PZ1 A;  4H8S A;  3VOQ A;  4B6H A;  2D2Q A;  4KHA A;  5KCV A;  3WYF B;  4WSF A;  5L81 A;  1U5E A;  2NMB A;  2YT0 A;  1J19 A;  1FHO A;  2I1J A;  2YF0 A;  2KCJ A;  3KSY A;  4MY6 A;  1U27 A;  1MK9 B;  2LOZ A;  2YSZ A;  2LUL A;  2OTX A;  3BIN A;  3FSS A;  4PQ0 A;  3KRX A;  4D0N B;  1I7A A;  3ODO A;  4YON A;  5EFX A;  3VIA A;  1I2H A;  1HB8 A;  1V89 A;  1X1G A;  4WVF B;  4K2P A;  4DX9 0;  3GYO A;  2LYD A;  5GOW B;  2L2I A;  1UPQ A;  3A98 B;  4HB4 B;  2KGX B;  4GN1 A;  4HDQ A;  1W1H A;  2DTC A;  2VKI A;  3PEG A;  4NSW A;  1XX0 A;  4A6K A;  3X23 A;  5CLL B;  1FAO A;  5D27 A;  2YVC A;  2ROV A;  5JLJ B;  1MK7 B;  3HQC A;  2GS0 A;  3DXC A;  1Z87 A;  2CAY A;  2DX5 A;  3SUZ A;  4F7H A;  2FDQ A;  3WA0 A;  2M14 A;  2DHJ A;  5FI1 A;  3P6A A;  1N3H A;  4CYE A;  1DBH A;  1DDM A;  1XKE A;  1MPH A;  1X1F A;  2J0M A;  2RSG A;  1RRP B;  4F7U P;  5C6R A;  1FHW A;  1GC7 A;  4HAT B;  5CLQ B;  3PSC A;  1WGU A;  3PVW A;  5JHG A;  1V5P A;  4CHM A;  3FP5 A;  2ABD A;  2COA A;  2RQ1 A;  1LB1 A;  2D4Q A;  2UZR A;  1U5G A;  2IYB A;  2LKO A;  2GCL A;  2MWN B;  1V88 A;  2CRF A;  2QKM A;  2J59 M;  2P0F A;  5KQ4 A;  2WH5 A;  1P6S A;  2DLW A;  2LOX A;  4HB0 B;  2W2X D;  5HE0 A;  2D9V A;  3PG7 A;  5J3T A;  3OAN A;  3P7Z A;  1B55 A;  1WI1 A;  4K2O A;  3F5R A;  5HE2 A;  1DYN A;  1EVH A;  1V5M A;  5DHA B;  3DXE A;  1LW3 A;  2M38 A;  2H7E A;  1ZC3 B;  4K17 A;  3QIJ A;  4KHB B;  1FB8 A;  3SO6 A;  4GPT B;  3FM8 C;  1NI2 A;  2I1K A;  1V61 A;  1AWE A;  2V76 A;  2RUK B;  4KVG B;  3KRW A;  2FJL A;  2CQU A;  2Y8F A;  5DHF B;  3KY9 A;  1OMW A;  2YT1 A;  4PNK A;  2D9Y A;  1PLS A;  5DI9 B;  3SV1 A;  4A6H A;  4HAU B;  3TFM A;  5JP4 A;  3F0W A;  3T06 A;  1QC6 A;  4C0A A;  4HAX B;  2Z0P A;  1MIZ B;  4A5K A;  1NU2 A;  4IFS A;  1OQN A;  3QBV B;  5C5B B;  4IAP A;  4DXA B;  3LJU X;  3FLV A;  2W2W A;  5J3Y A;  3MPX A;  1PFJ A;  2G35 A;  2MFQ A;  4XWX A;  2HTH B;  1AQC A;  3ODW A;  2CY5 A;  2R0D A;  2R09 A;  2YS5 A;  4HAZ B;  1P5T A;  2EJ8 A;  2K2U A;  2DHI A;  4GZU A;  2YS3 A;  4EKU A;  1H10 A;  2Z0O A;  2UZS A;  3A8P A;  2K2J A;  2DA0 A;  2FJ9 A;  4KHO A;  2JP2 A;  3O96 A;  2YRY A;  1X86 A;  4GXB A;  4ZRK A;  2EMS A;  2D9W A;  2I5F A;  4HAY B;  3D8D A;  2N23 A;  5HE3 A; 
#chains in the Genus database with same CATH topology
 2GJY A;  1WVH A;  3E9P A;  5FI0 A;  1MIX A;  1UNR A;  3EPY A;  2J0K A;  1ZSQ A;  1BWN A;  2XQN M;  4DBB A;  4ILJ A;  4BBK A;  2DFK A;  3PP2 A;  2MKR A;  3AU4 A;  2UVM A;  4HAV B;  3PZD A;  2ZKM X;  1HBK A;  1ZYI A;  3NWF A;  5D3W A;  4HB3 B;  2ROZ B;  1WJ1 A;  3D8F A;  2KIE A;  5J3Q A;  1ZVR A;  2KUP A;  1E5W A;  3TW1 A;  1P3R A;  4DX8 A;  4L6E A;  2ZPY A;  4YL8 A;  4JKH A;  2P8V A;  2P0H A;  2K49 A;  4HSI A;  2AL6 A;  1DDW A;  4ZRJ A;  2CB8 A;  3V5W A;  2OQB A;  2YS1 A;  1X05 A;  4IOY X;  3GYP A;  3QWM A;  1QQG A;  2RLO A;  4WJ7 A;  1UNP A;  2W2X C;  5IRS A;  1VBG A;  1TXD A;  1WG7 A;  2COF A;  4KHB A;  1V5U A;  2KR0 A;  1Y5O A;  5D3Y A;  3FEH A;  1BAK A;  2VSZ A;  4KAX B;  3OHM B;  1DIK A;  3ZDT A;  2RGN B;  5DH9 B;  5HE1 A;  1XOD A;  3D8E A;  1U5D A;  1GC6 A;  1NVL A;  3ODX A;  2ELA A;  4P7I A;  2P0D A;  2X0S A;  1JDE A;  3CIK A;  3N7C A;  4OT1 A;  4EMO A;  2DYN A;  3PVU A;  2IFS A;  1SGH A;  4GNK B;  1EF1 A;  1KZ7 A;  1ZC4 B;  2Q13 A;  1Q67 A;  2RVB B;  1K5D B;  2COD A;  2DKP A;  2HE7 A;  3IVF A;  1RJ2 A;  1BTK A;  2YT2 A;  1KC7 A;  1GGO A;  1FOE A;  4GMV A;  1M7R A;  5IJM A;  3E9O A;  3KZ1 A;  2KUQ A;  5DIF B;  2EMT A;  3HSA A;  3HW2 B;  1PMS A;  5I2M A;  2H7D A;  1ST7 A;  2N0Y A;  1M7E A;  2Z4D A;  4JKB A;  1ACA A;  1ISN A;  4QJ4 B;  3G9W A;  5C5B A;  1EAZ A;  1OY2 A;  3RCP A;  3B77 A;  5D3X A;  3TVV A;  4EJN A;  1DRO A;  1UEF A;  4HB2 B;  5LON B;  1W1D A;  1SHC A;  1U29 A;  3SYX A;  2COP A;  2K00 A;  3MDB C;  4Z2M B;  2LBB A;  2HRJ A;  5C16 A;  5M4Y B;  4Z2N A;  1XCG A;  1GG3 A;  4ILH A;  3NSU A;  3TO1 A;  1UNQ A;  2CY4 A;  2QKL A;  3BJI A;  3HK0 A;  2J0J A;  5LOP B;  1Y19 B;  2GCJ A;  2MDX A;  1H4R A;  4MT7 A;  4QJ3 B;  3PVL A;  1DDV A;  5C79 A;  1WGQ A;  4CHJ A;  2Z0Q A;  3A8Q A;  1KI1 B;  2D11 A;  3TCA A;  2ADZ A;  2NBV A;  4TKN A;  1NTY A;  2Y7B A;  5JHH A;  1T77 A;  2E2X A;  1UPR A;  1XD4 A;  2LG1 A;  1IRS A;  2ELB A;  3U12 A;  2AEH A;  4JK9 A;  1TJ6 A;  4HAW B;  1J0W A;  3M1I B;  2VRW B;  2I5C A;  4K81 A;  1EGX A;  4JKF A;  2DYQ A;  3AJ4 A;  2RNR B;  3U7D A;  4HDO A;  1NTI A;  2D9X A;  3UZT A;  4L1R A;  4ZRI A;  4DIX A;  4A6F B;  3DXD A;  1FGZ A;  1KZG A;  1U2B A;  2X18 A;  2BCJ A;  2DX1 A;  1K5G B;  4MK0 A;  2DHK A;  2EC1 A;  3ENB A;  5KQ1 A;  4HHV A;  1W1G A;  2D9Z A;  1TQZ A;  2COC A;  3SNH A;  2NZ8 B;  1WJM A;  2DKQ A;  4A6F A;  3ZVR A;  1MAI A;  1U5F A;  2D10 A;  3ML4 A;  5D3V A;  1FHX A;  1HB6 A;  2DIK A;  4F7G A;  4TYZ A;  3AU5 A;  1X11 A;  2GUM A;  2DN6 A;  4Y94 A;  1ZM0 A;  2Y8G A;  3NWD A;  1NTV A;  3ULC A;  3CXB B;  2L1C A;  4NY0 A;  4GMX B;  1FGY A;  1MKE A;  3U8Z A;  3ULB A;  1XR0 B;  1BTN A;  2PZ1 A;  4H8S A;  3VOQ A;  4B6H A;  2D2Q A;  3SBT A;  4KHA A;  5KCV A;  2Z13 A;  4JKA A;  3WYF B;  4WSF A;  5L81 A;  1U5E A;  2NMB A;  2YT0 A;  1J19 A;  1FHO A;  5I2S A;  2I1J A;  3SBG A;  2KCJ A;  2YF0 A;  3KSY A;  4OSN A;  4MY6 A;  3HIE A;  1U27 A;  1MK9 B;  2LOZ A;  4JK8 A;  2YSZ A;  2LUL A;  2OTX A;  3BIN A;  3FSS A;  4PQ0 A;  3KRX A;  4D0N B;  1I7A A;  3ODO A;  4YON A;  5EFX A;  3VIA A;  1I2H A;  1HB8 A;  1V89 A;  4JKE A;  1X1G A;  4WVF B;  4K2P A;  4DX9 0;  3GYO A;  2LYD A;  5GOW B;  2L2I A;  1UPQ A;  3A98 B;  4HB4 B;  2KGX B;  4GN1 A;  1MI1 A;  4JKC A;  4HDQ A;  1W1H A;  2DTC A;  2VKI A;  3PEG A;  4NSW A;  1XX0 A;  4A6K A;  3X23 A;  5CLL B;  1FAO A;  5D27 A;  2YVC A;  2ROV A;  5JLJ B;  1MK7 B;  2RRF A;  4CSQ A;  3HQC A;  2GS0 A;  3DXC A;  1Z87 A;  2CAY A;  2DX5 A;  3SUZ A;  4F7H A;  2FDQ A;  3WA0 A;  2M14 A;  4JKG A;  2DHJ A;  5FI1 A;  3P6A A;  1N3H A;  4CYE A;  1DBH A;  1DDM A;  1XKE A;  1MPH A;  1X1F A;  2J0M A;  2RSG A;  1RRP B;  4F7U P;  5C6R A;  1FHW A;  1GC7 A;  4HAT B;  5CLQ B;  3PSC A;  1WGU A;  3PVW A;  5JHG A;  1V5P A;  4CHM A;  3FP5 A;  4JKD A;  2ABD A;  2COA A;  2RQ1 A;  1LB1 A;  2D4Q A;  3NW8 A;  2UZR A;  1U5G A;  2IYB A;  2LKO A;  2Z14 A;  2GCL A;  2FJU B;  1KBL A;  2MWN B;  1V88 A;  4JK7 A;  2CRF A;  4ILG B;  2QKM A;  2J59 M;  2P0F A;  5KQ4 A;  2WH5 A;  1P6S A;  2DLW A;  5LG4 B;  1VBH A;  2LOX A;  4HB0 B;  2W2X D;  5HE0 A;  2D9V A;  3PG7 A;  2R2Y A;  4JKG B;  5J3T A;  3OAN A;  3P7Z A;  5JVL A;  1B55 A;  3E9L A;  1WI1 A;  4K2O A;  3F5R A;  5HE2 A;  1DYN A;  1EVH A;  1V5M A;  5DHA B;  3DXE A;  1LW3 A;  2M38 A;  2H7E A;  1ZC3 B;  4K17 A;  3QIJ A;  2Z59 A;  4KHB B;  1FB8 A;  3SO6 A;  2K8E A;  4GPT B;  3FM8 C;  1NI2 A;  2I1K A;  1V61 A;  1AWE A;  2V76 A;  2RUK B;  4KVG B;  3KRW A;  4GOU A;  2FJL A;  2CQU A;  3E66 A;  2Y8F A;  5DHF B;  3KY9 A;  1OMW A;  4D6W A;  2YT1 A;  4PNK A;  2D9Y A;  1PLS A;  5DI9 B;  3SV1 A;  4A6H A;  4HAU B;  3TFM A;  5JP4 A;  3F0W A;  3T06 A;  1QC6 A;  4C0A A;  3DCX A;  4HAX B;  2Z0P A;  1MIZ B;  4A5K A;  1NU2 A;  4IFS A;  3NWA A;  1OQN A;  3QBV B;  5C5B B;  4IAP A;  4DXA B;  3LJU X;  2R82 A;  3FLV A;  4QJ5 B;  2W2W A;  5J3Y A;  3A58 A;  3MPX A;  1PFJ A;  2G35 A;  2MFQ A;  4XWX A;  2HTH B;  1AQC A;  3ODW A;  2CY5 A;  2R0D A;  2R09 A;  2YS5 A;  4HAZ B;  1P5T A;  2EJ8 A;  2K2U A;  2DHI A;  4GZU A;  2YS3 A;  2KIG A;  4EKU A;  1H10 A;  4QXA B;  2Z0O A;  2UZS A;  2K2J A;  3A8P A;  2DA0 A;  2FJ9 A;  4KHO A;  2JP2 A;  3O96 A;  2YRY A;  1X86 A;  4GXB A;  4ZRK A;  2EMS A;  2D9W A;  3FVC A;  2I5F A;  4HAY B;  3D8D A;  2N23 A;  5HE3 A; 
#chains in the Genus database with same CATH homology
 2GJY A;  1WVH A;  3E9P A;  5FI0 A;  1MIX A;  1UNR A;  3EPY A;  2J0K A;  1ZSQ A;  1BWN A;  2XQN M;  4DBB A;  4ILJ A;  4BBK A;  2DFK A;  3PP2 A;  2MKR A;  3AU4 A;  2UVM A;  4HAV B;  3PZD A;  1HBK A;  5D3W A;  4HB3 B;  2ROZ B;  1WJ1 A;  3D8F A;  5J3Q A;  1ZVR A;  2KUP A;  1E5W A;  3TW1 A;  1P3R A;  4DX8 A;  4L6E A;  2ZPY A;  4YL8 A;  4JKH A;  2P8V A;  2P0H A;  2AL6 A;  1DDW A;  4ZRJ A;  2CB8 A;  3V5W A;  2OQB A;  2YS1 A;  1X05 A;  4IOY X;  3GYP A;  3QWM A;  1QQG A;  2RLO A;  4WJ7 A;  1UNP A;  2W2X C;  1VBG A;  1TXD A;  1WG7 A;  2COF A;  1V5U A;  1Y5O A;  5D3Y A;  3FEH A;  1BAK A;  2VSZ A;  4KAX B;  5DH9 B;  1DIK A;  3ZDT A;  2RGN B;  5HE1 A;  1XOD A;  3D8E A;  1U5D A;  1GC6 A;  1NVL A;  3ODX A;  2ELA A;  4P7I A;  2P0D A;  2X0S A;  1JDE A;  3CIK A;  3N7C A;  4EMO A;  2DYN A;  3PVU A;  2IFS A;  1SGH A;  1EF1 A;  1KZ7 A;  1ZC4 B;  2Q13 A;  1Q67 A;  2RVB B;  1K5D B;  2COD A;  2DKP A;  2HE7 A;  3IVF A;  1RJ2 A;  1BTK A;  1KC7 A;  1GGO A;  1FOE A;  4GMV A;  1M7R A;  5IJM A;  3E9O A;  3KZ1 A;  5DIF B;  2EMT A;  3HW2 B;  1PMS A;  2H7D A;  1ST7 A;  2N0Y A;  1M7E A;  4JKB A;  1ACA A;  1ISN A;  3G9W A;  5C5B A;  1EAZ A;  1OY2 A;  3RCP A;  5D3X A;  3TVV A;  4EJN A;  1DRO A;  1UEF A;  4HB2 B;  5LON B;  1W1D A;  1SHC A;  1U29 A;  3SYX A;  2COP A;  2K00 A;  3MDB C;  4Z2M B;  2LBB A;  2HRJ A;  5C16 A;  4Z2N A;  1XCG A;  1GG3 A;  4ILH A;  3NSU A;  3TO1 A;  1UNQ A;  2CY4 A;  2QKL A;  3BJI A;  3HK0 A;  2J0J A;  5LOP B;  1Y19 B;  2GCJ A;  2MDX A;  1H4R A;  4MT7 A;  3PVL A;  1DDV A;  5C79 A;  1WGQ A;  4CHJ A;  2Z0Q A;  3A8Q A;  1KI1 B;  2D11 A;  3TCA A;  2ADZ A;  4TKN A;  1NTY A;  2Y7B A;  5JHH A;  2E2X A;  1UPR A;  1XD4 A;  2LG1 A;  1IRS A;  2ELB A;  2AEH A;  4JK9 A;  1TJ6 A;  4HAW B;  1J0W A;  3M1I B;  2VRW B;  2I5C A;  4K81 A;  1EGX A;  4JKF A;  2DYQ A;  3AJ4 A;  2RNR B;  3U7D A;  4HDO A;  1NTI A;  2D9X A;  3UZT A;  4ZRI A;  4A6F B;  3DXD A;  1FGZ A;  1KZG A;  1U2B A;  2X18 A;  2BCJ A;  2DX1 A;  1K5G B;  4MK0 A;  2DHK A;  2EC1 A;  3ENB A;  5KQ1 A;  4HHV A;  1W1G A;  2D9Z A;  1TQZ A;  2COC A;  3SNH A;  2NZ8 B;  1WJM A;  2DKQ A;  4A6F A;  3ZVR A;  1MAI A;  1U5F A;  2D10 A;  3ML4 A;  5D3V A;  1FHX A;  1HB6 A;  2DIK A;  4F7G A;  4TYZ A;  3AU5 A;  1X11 A;  2DN6 A;  4Y94 A;  1ZM0 A;  2Y8G A;  1NTV A;  3ULC A;  3CXB B;  2L1C A;  4NY0 A;  4GMX B;  1FGY A;  1MKE A;  3U8Z A;  3ULB A;  1XR0 B;  1BTN A;  2PZ1 A;  4H8S A;  3VOQ A;  4B6H A;  2D2Q A;  3SBT A;  4KHA A;  5KCV A;  4JKA A;  3WYF B;  4WSF A;  5L81 A;  1U5E A;  2NMB A;  2YT0 A;  1J19 A;  1FHO A;  2I1J A;  3SBG A;  2KCJ A;  2YF0 A;  3KSY A;  4MY6 A;  1U27 A;  1MK9 B;  2LOZ A;  4JK8 A;  2YSZ A;  2LUL A;  2OTX A;  3BIN A;  3FSS A;  4PQ0 A;  3KRX A;  4D0N B;  1I7A A;  3ODO A;  4YON A;  5EFX A;  3VIA A;  1I2H A;  1HB8 A;  1V89 A;  4JKE A;  1X1G A;  4WVF B;  4K2P A;  4DX9 0;  3GYO A;  2LYD A;  5GOW B;  2L2I A;  1UPQ A;  3A98 B;  4HB4 B;  2KGX B;  4GN1 A;  4JKC A;  4HDQ A;  1W1H A;  2DTC A;  2VKI A;  3PEG A;  4NSW A;  1XX0 A;  4A6K A;  3X23 A;  5CLL B;  1FAO A;  5D27 A;  2YVC A;  2ROV A;  5JLJ B;  1MK7 B;  3HQC A;  2GS0 A;  3DXC A;  1Z87 A;  2CAY A;  2DX5 A;  3SUZ A;  4F7H A;  2FDQ A;  3WA0 A;  2M14 A;  4JKG A;  2DHJ A;  5FI1 A;  3P6A A;  1N3H A;  4CYE A;  1DBH A;  1DDM A;  1XKE A;  1MPH A;  1X1F A;  2J0M A;  2RSG A;  1RRP B;  4F7U P;  5C6R A;  1FHW A;  1GC7 A;  4HAT B;  5CLQ B;  3PSC A;  1WGU A;  3PVW A;  5JHG A;  1V5P A;  4CHM A;  3FP5 A;  4JKD A;  2ABD A;  2COA A;  2RQ1 A;  1LB1 A;  2D4Q A;  2UZR A;  1U5G A;  2IYB A;  2LKO A;  2GCL A;  1KBL A;  2MWN B;  1V88 A;  4JK7 A;  2CRF A;  4ILG B;  2QKM A;  2J59 M;  2P0F A;  5KQ4 A;  2WH5 A;  1P6S A;  2DLW A;  1VBH A;  2LOX A;  4HB0 B;  2W2X D;  5HE0 A;  2D9V A;  3PG7 A;  4JKG B;  5J3T A;  3OAN A;  3P7Z A;  5JVL A;  1B55 A;  3E9L A;  1WI1 A;  4K2O A;  3F5R A;  5HE2 A;  1DYN A;  1EVH A;  1V5M A;  5DHA B;  3DXE A;  1LW3 A;  2M38 A;  2H7E A;  1ZC3 B;  4K17 A;  3QIJ A;  4KHB B;  1FB8 A;  3SO6 A;  4GPT B;  3FM8 C;  1NI2 A;  2I1K A;  1V61 A;  1AWE A;  2V76 A;  2RUK B;  4KVG B;  3KRW A;  2FJL A;  2CQU A;  3E66 A;  2Y8F A;  5DHF B;  3KY9 A;  1OMW A;  2YT1 A;  4PNK A;  2D9Y A;  1PLS A;  5DI9 B;  3SV1 A;  4A6H A;  4HAU B;  3TFM A;  5JP4 A;  3F0W A;  3T06 A;  1QC6 A;  4C0A A;  4HAX B;  2Z0P A;  1MIZ B;  4A5K A;  1NU2 A;  4IFS A;  1OQN A;  3QBV B;  5C5B B;  4IAP A;  4DXA B;  3LJU X;  2R82 A;  3FLV A;  2W2W A;  5J3Y A;  3MPX A;  1PFJ A;  2G35 A;  2MFQ A;  4XWX A;  2HTH B;  1AQC A;  3ODW A;  2CY5 A;  2R0D A;  2R09 A;  2YS5 A;  4HAZ B;  1P5T A;  2EJ8 A;  2K2U A;  2DHI A;  4GZU A;  2YS3 A;  4EKU A;  1H10 A;  2Z0O A;  2UZS A;  3A8P A;  2K2J A;  2DA0 A;  2FJ9 A;  4KHO A;  2JP2 A;  3O96 A;  2YRY A;  1X86 A;  4GXB A;  4ZRK A;  2EMS A;  2D9W A;  2I5F A;  4HAY B;  3D8D A;  2N23 A;  5HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...