1MK9B

Crystal structure of an integrin beta3-talin chimera
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
187
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 187
sequence length 190
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk9B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk9B02
3DXDA 5JLJB 1ACAA 4HAYB 1XKEA 2I1KA 4TYZA 1Y5OA 2QKLA 1FGYA 3TW1A 1GC7A 1UNRA 2DHJA 4K17A 1Y19B 3IVFA 4DBBA 3NSUA 2ELBA 4F7UP 3ODXA 1MAIA 1HB6A 2D10A 4HDOA 2LULA 3ZDTA 4A6KA 4YONA 1OQNA 3CIKA 3KZ1A 3PVUA 2UZSA 4WJ7A 1DDMA 2Y7BA 4P7IA 5D3YA 2DYQA 1V89A 2YSZA 1OY2A 1MIXA 2LOZA 2VKIA 2LOXA 4CHJA 2YVCA 2D9VA 1X1FA 2M14A 5DI9B 1U29A 2DFKA 4ZRIA 5JHHA 1MIZB 1V5UA 3SUZA 1RRPB 3U8ZA 1BTKA 1LB1A 2D9WA 2L2IA 2CY5A 3VOQA 1ST7A 2COCA 1UNPA 1X11A 2HTHB 3D8EA 4EMOA 2YRYA 1M7EA 2YS3A 4KHOA 2OTXA 2ROZB 5CLLB 1SGHA 1P5TA 2XQNM 2DX5A 4K2PA 4NY0A 4HB4B 4CHMA 1ISNA 4MY6A 2QKMA 4MK0A 1UNQA 2DLWA 1J19A 2ADZA 1I7AA 3BJIA 1UPRA 1OMWA 4DX90 1U27A 2EJ8A 2GCJA 2MFQA 3AU5A 4ZRJA 2GS0A 2HRJA 3FLVA 3ODOA 2R09A 5DIFB 1Z87A 2N23A 2ZPYA 3MDBC 4HAVB 2Z0PA 5C6RA 2MKRA 3DXCA 2KCJA 1U5GA 3O96A 2AEHA 1XR0B 1QQGA 4A5KA 3AJ4A 4NSWA 4GZUA 2K2JA 4DX8A 5C5BA 1XCGA 1ZSQA 1FOEA 2ROVA 2NZ8B 3SO6A 2PZ1A 4GPTB 2HE7A 5D3VA 3X23A 2CRFA 2EC1A 4GN1A 4A6FA 1E5WA 1FHOA 1B55A 4IAPA 3CXBB 2R0DA 2H7DA 2IFSA 2W2WA 1DROA 2CY4A 5KCVA 2EMTA 2FJ9A 3A8QA 2M38A 1EAZA 3P6AA 4EJNA 5FI0A 1QC6A 2EMSA 3UZTA 1WJ1A 3ODWA 3QWMA 2LG1A 1HBKA 4KAXB 5HE3A 5D3WA 1AWEA 3RCPA 2Y8FA 2AL6A 4HB0B 1AQCA 4H8SA 3GYPA 4YL8A 3VIAA 5IJMA 4WVFB 2OQBA 2W2XC 4F7HA 4PNKA 2FDQA 4ZRKA 4HB2B 1K5GB 5HE0A 2BCJA 1WGUA 4MT7A 2UVMA 1EGXA 3PVLA 1P6SA 3HQCA 5DHAB 2K2UA 3KRXA 3N7CA 3LJUX 2IYBA 4HHVA 5KQ1A 5HE2A 3M1IB 2D9XA 2J0MA 3DXEA 2LBBA 1V61A 2P0FA 3D8FA 1WJMA 3FP5A 5LOPB 3MPXA 2DTCA 3GYOA 1XX0A 3KY9A 2K00A 3WYFB 2J59M 2Z0QA 3PP2A 2ABDA 3QBVB 2D4QA 1Q67A 3ZVRA 2D2QA 4B6HA 4DXAB 2YF0A 5FI1A 2LKOA 1W1GA 1FB8A 1H4RA 1V5MA 1X86A 5J3YA 4A6HA 2COAA 4HAXB 5GOWB 4K2OA 2DYNA 1V5PA 1DYNA 3KSYA 1UEFA 2VRWB 1WVHA 1U5FA 3PZDA 2W2XD 2LYDA 3U7DA 1IRSA 2GJYA 5D27A 3BINA 1I2HA 1KZGA 4GMVA 1PMSA 2CQUA 1PLSA 1TXDA 1UPQA 4HAWB 2V76A 5EFXA 2RUKB 3P7ZA 4D0NB 2Y8GA 2MWNB 2DA0A 2DKQA 1ZM0A 2D9ZA 5C16A 1K5DB 5JP4A 1ZC3B 2CB8A 4KHAA 3PSCA 2I5FA 1NU2A 2Z0OA 1M7RA 1MPHA 4L6EA 4IOYX 1FHXA 5C5BB 1HB8A 4K81A 4KHBB 2RQ1A 1J0WA 2Q13A 4GXBA 4A6FB 2FJLA 1MK9B 3F0WA 3SNHA 1GC6A 1X1GA 4HAZB 2COFA 1BAKA 1WGQA 2NMBA 1MKEA 4Z2NA 1FAOA 3A8PA 2RGNB 1N3HA 2G35A 1U5EA 1GG3A 2KGXB 2RVBB 3TCAA 2YS1A 1TJ6A 3FEHA 3A98B 3SYXA 3T06A 2RSGA 3HK0A 4F7GA 2I5CA 4C0AA 2RLOA 3FSSA 5DHFB 4EKUA 1XD4A 1U5DA 2MDXA 1NTIA 2DKPA 4HATB 1V88A 1EF1A 3TFMA 2P8VA 1TQZA 3KRWA 1NTVA 4HB3B 5J3QA 2X18A 3G9WA 2D9YA 2DX1A 5DH9B 2GCLA 2J0JA 5LONB 3FM8C 1FGZA 1NTYA 3HW2B 2DHKA 1KI1B 3AU4A 2E2XA 2P0HA 1SHCA 4Z2MB 1MK7B 4HAUB 3WA0A 1EVHA 2KUPA 2P0DA 2VSZA 3PG7A 5HE1A 4CYEA 2J0KA 3PEGA 2YS5A 1X05A 1XODA 1LW3A 2JP2A 1FHWA 2COPA 2N0YA 4IFSA 1P3RA 1WG7A 2YT0A 3OANA 1DBHA 3TVVA 2L1CA 2CAYA 2YT1A 1DDVA 2I1JA 3ML4A 4TKNA 1PFJA 5KQ4A 3QIJA 2CODA 4PQ0A 1DDWA 5D3XA 3SV1A 2H7EA 4WSFA 2ELAA 2D11A 4XWXA 4BBKA 1NI2A 4Y94A 4HDQA 2UZRA 5JHGA 2DN6A 1RJ2A 3D8DA 1W1DA 1W1HA 5C79A 3TO1A 2DHIA 1H10A 2RNRB 3V5WA 1BTNA 3ULCA 1U2BA 4KVGB 1ZC4B 3EPYA 5J3TA 1KZ7A 3PVWA 5L81A 1BWNA 1WI1A 3ULBA 3F5RA 5CLQB 1NVLA 4GMXB 1ZVRA 2WH5A
chains in the Genus database with same CATH superfamily
3DXDA 5JLJB 1ACAA 4HAYB 1XKEA 2I1KA 4TYZA 1Y5OA 4OT1A 2QKLA 1FGYA 3TW1A 1GC7A 1UNRA 2DHJA 4K17A 1Y19B 3IVFA 4DBBA 3NSUA 5I2SA 2ELBA 4F7UP 3ODXA 4D6WA 1MAIA 1HB6A 2D10A 4ILHA 4HDOA 2LULA 3ZDTA 1T77A 4A6KA 4YONA 5M4YB 1OQNA 3CIKA 3KZ1A 3PVUA 2UZSA 4WJ7A 1DDMA 2Y7BA 4P7IA 5D3YA 2DYQA 1V89A 2YSZA 1OY2A 4JKCA 1MIXA 3E9OA 2LOXA 2LOZA 2VKIA 4CHJA 2YVCA 2D9VA 1X1FA 2M14A 5DI9B 5I2MA 2KR0A 1U29A 2Z59A 2DFKA 4JKGA 4HSIA 2Z14A 4ZRIA 5JHHA 1MIZB 1V5UA 3SUZA 1RRPB 3U8ZA 1BTKA 1LB1A 2D9WA 2L2IA 2CY5A 3VOQA 1ST7A 2COCA 1UNPA 1X11A 2HTHB 3D8EA 4EMOA 2ZKMX 2YRYA 1M7EA 3A58A 4JKEA 2YS3A 4KHOA 2K8EA 2OTXA 2R82A 2ROZB 5CLLB 1SGHA 3DCXA 1P5TA 2XQNM 2DX5A 4K2PA 4NY0A 4HB4B 1KC7A 1ISNA 4CHMA 4MY6A 2QKMA 4MK0A 1UNQA 2DLWA 1ZYIA 1J19A 2ADZA 1I7AA 3BJIA 1UPRA 1OMWA 2KIEA 4DX90 1U27A 2EJ8A 2GCJA 2MFQA 3AU5A 4ZRJA 2GS0A 2HRJA 3FLVA 3ODOA 2R09A 5DIFB 1Z87A 2N23A 1DIKA 2ZPYA 3MDBC 4HAVB 2Z0PA 5C6RA 2MKRA 3DXCA 4L1RA 3U12A 2KCJA 1U5GA 3O96A 2AEHA 1XR0B 1QQGA 4A5KA 3AJ4A 4NSWA 4GZUA 2X0SA 2K2JA 4DX8A 5C5BA 1XCGA 1ZSQA 1FOEA 1VBGA 2ROVA 2NZ8B 3SO6A 2PZ1A 5JVLA 4GPTB 4JKAA 2HE7A 5D3VA 3X23A 2CRFA 2EC1A 4GN1A 1KBLA 4A6FA 1E5WA 1FHOA 1B55A 4IAPA 3CXBB 2R0DA 2H7DA 2IFSA 2W2WA 4GNKB 1DROA 2CY4A 5KCVA 2EMTA 2FJ9A 5LG4B 3A8QA 2M38A 1EAZA 3P6AA 4EJNA 5FI0A 1QC6A 3HSAA 2EMSA 3UZTA 1WJ1A 3ODWA 3QWMA 2LG1A 1HBKA 4KAXB 5HE3A 5D3WA 1AWEA 3NWAA 3RCPA 2Y8FA 2AL6A 4HB0B 1AQCA 4H8SA 3GYPA 4YL8A 4CSQA 4QJ4B 3VIAA 5IJMA 4WVFB 2OQBA 2W2XC 3B77A 4F7HA 4PNKA 2FDQA 4ZRKA 4HB2B 1K5GB 4DIXA 5HE0A 2BCJA 1WGUA 4MT7A 2UVMA 1EGXA 3PVLA 1P6SA 3HQCA 5DHAB 2K2UA 3KRXA 3N7CA 3LJUX 3HIEA 2IYBA 4HHVA 5KQ1A 5HE2A 3M1IB 2D9XA 2J0MA 3DXEA 2LBBA 1V61A 2P0FA 3D8FA 1WJMA 3FP5A 5LOPB 3MPXA 2DTCA 3GYOA 3SBGA 2YT2A 1XX0A 3KY9A 2K00A 3WYFB 2J59M 2Z0QA 3PP2A 2ABDA 3QBVB 2D4QA 1Q67A 3SBTA 3ZVRA 2Z13A 2D2QA 4ILGB 4B6HA 4JKGB 4DXAB 2YF0A 2K49A 5IRSA 5FI1A 2LKOA 1W1GA 1FB8A 1H4RA 1V5MA 1X86A 5J3YA 4A6HA 2COAA 4HAXB 5GOWB 4K2OA 4ILJA 2DYNA 3E9LA 1V5PA 1DYNA 3KSYA 1UEFA 2VRWB 1WVHA 1U5FA 3PZDA 2W2XD 2LYDA 3U7DA 1IRSA 2GJYA 5D27A 3BINA 3FVCA 1I2HA 1KZGA 4GMVA 1PMSA 2CQUA 4JKFA 1PLSA 1TXDA 1UPQA 4HAWB 2V76A 5EFXA 2RUKB 3P7ZA 4D0NB 2Y8GA 2MWNB 3ENBA 4JKHA 2DA0A 2DKQA 2RRFA 4GOUA 1ZM0A 2D9ZA 5C16A 1K5DB 2KUQA 5JP4A 1ZC3B 2CB8A 4KHAA 3PSCA 2I5FA 3E66A 1NU2A 2Z0OA 1M7RA 1MPHA 4L6EA 4IOYX 1FHXA 5C5BB 1HB8A 4K81A 4KHBB 1MI1A 2RQ1A 1J0WA 2Q13A 4GXBA 4A6FB 2FJLA 1MK9B 3F0WA 4JK8A 3SNHA 1GC6A 1X1GA 4HAZB 2COFA 1BAKA 1WGQA 2NMBA 4JKDA 1MKEA 4Z2NA 1FAOA 3A8PA 2RGNB 1N3HA 2G35A 1U5EA 1GG3A 2KGXB 2GUMA 2RVBB 3TCAA 2YS1A 1TJ6A 3FEHA 3A98B 3SYXA 3T06A 2RSGA 3HK0A 4F7GA 2I5CA 4C0AA 4JK9A 2RLOA 3FSSA 5DHFB 4EKUA 1XD4A 1U5DA 2MDXA 1NTIA 2DKPA 4HATB 1V88A 1EF1A 3TFMA 2P8VA 1TQZA 3KRWA 1NTVA 4HB3B 3E9PA 5J3QA 2X18A 3G9WA 2D9YA 2DX1A 5DH9B 2GCLA 2J0JA 5LONB 3FM8C 4QXAB 1FGZA 1NTYA 3HW2B 2FJUB 2DHKA 1KI1B 3AU4A 2E2XA 2P0HA 2NBVA 1SHCA 4Z2MB 1MK7B 4HAUB 3WA0A 1EVHA 2KUPA 2P0DA 2VSZA 3PG7A 5HE1A 4CYEA 2J0KA 3PEGA 2YS5A 1X05A 1XODA 1LW3A 2JP2A 1FHWA 2COPA 2N0YA 4IFSA 2DIKA 4JK7A 1P3RA 1WG7A 2YT0A 3OANA 1DBHA 3TVVA 2L1CA 2CAYA 2YT1A 1DDVA 2Z4DA 2I1JA 3ML4A 4OSNA 4TKNA 1PFJA 5KQ4A 3QIJA 2CODA 4PQ0A 4QJ5B 1DDWA 5D3XA 1GGOA 3SV1A 2H7EA 3OHMB 4WSFA 2ELAA 2D11A 4XWXA 3NW8A 4BBKA 3NWDA 1NI2A 4JKBA 4Y94A 4HDQA 2R2YA 2UZRA 5JHGA 2DN6A 1RJ2A 3D8DA 1W1DA 1W1HA 5C79A 1VBHA 4KHBA 3TO1A 2DHIA 1H10A 2RNRB 3NWFA 1BTNA 3ULCA 3V5WA 1U2BA 4KVGB 1ZC4B 2KIGA 3EPYA 5J3TA 1KZ7A 3PVWA 5L81A 4QJ3B 1BWNA 1WI1A 3ULBA 3F5RA 5CLQB 1NVLA 4GMXB 1JDEA 1ZVRA 2WH5A
chains in the Genus database with same CATH topology
3DXDA 5JLJB 1ACAA 4HAYB 1XKEA 2I1KA 4TYZA 1Y5OA 2QKLA 1FGYA 3TW1A 1GC7A 1UNRA 2DHJA 4K17A 1Y19B 3IVFA 4DBBA 3NSUA 2ELBA 4F7UP 3ODXA 1MAIA 1HB6A 2D10A 4ILHA 4HDOA 2LULA 3ZDTA 4A6KA 4YONA 1OQNA 3CIKA 3KZ1A 3PVUA 2UZSA 4WJ7A 1DDMA 2Y7BA 4P7IA 5D3YA 2DYQA 1V89A 2YSZA 1OY2A 4JKCA 1MIXA 3E9OA 2LOXA 2LOZA 2VKIA 4CHJA 2YVCA 2D9VA 1X1FA 2M14A 5DI9B 1U29A 2DFKA 4JKGA 4ZRIA 5JHHA 1MIZB 1V5UA 3SUZA 1RRPB 3U8ZA 1BTKA 1LB1A 2D9WA 2L2IA 2CY5A 3VOQA 1ST7A 2COCA 1UNPA 1X11A 2HTHB 3D8EA 4EMOA 2YRYA 1M7EA 4JKEA 2YS3A 4KHOA 2OTXA 2R82A 2ROZB 5CLLB 1SGHA 1P5TA 2XQNM 2DX5A 4K2PA 4NY0A 4HB4B 1KC7A 1ISNA 4CHMA 4MY6A 2QKMA 4MK0A 1UNQA 2DLWA 1J19A 2ADZA 1I7AA 3BJIA 1UPRA 1OMWA 4DX90 1U27A 2EJ8A 2GCJA 2MFQA 3AU5A 4ZRJA 2GS0A 2HRJA 3FLVA 3ODOA 2R09A 5DIFB 1Z87A 2N23A 1DIKA 2ZPYA 3MDBC 4HAVB 2Z0PA 5C6RA 2MKRA 3DXCA 2KCJA 1U5GA 3O96A 2AEHA 1XR0B 1QQGA 4A5KA 3AJ4A 4NSWA 4GZUA 2X0SA 2K2JA 4DX8A 5C5BA 1XCGA 1ZSQA 1FOEA 2ROVA 1VBGA 2NZ8B 3SO6A 2PZ1A 5JVLA 4GPTB 4JKAA 2HE7A 5D3VA 3X23A 2CRFA 2EC1A 4GN1A 1KBLA 4A6FA 1E5WA 1FHOA 1B55A 4IAPA 3CXBB 2R0DA 2H7DA 2IFSA 2W2WA 1DROA 2CY4A 5KCVA 2EMTA 2FJ9A 3A8QA 2M38A 1EAZA 3P6AA 4EJNA 5FI0A 1QC6A 2EMSA 3UZTA 1WJ1A 3ODWA 3QWMA 2LG1A 1HBKA 4KAXB 5HE3A 5D3WA 1AWEA 3RCPA 2Y8FA 2AL6A 4HB0B 1AQCA 4H8SA 3GYPA 4YL8A 3VIAA 5IJMA 4WVFB 2OQBA 2W2XC 4F7HA 4PNKA 2FDQA 4ZRKA 4HB2B 1K5GB 5HE0A 2BCJA 1WGUA 4MT7A 2UVMA 1EGXA 3PVLA 1P6SA 3HQCA 5DHAB 2K2UA 3KRXA 3N7CA 3LJUX 2IYBA 4HHVA 5KQ1A 5HE2A 3M1IB 2D9XA 2J0MA 3DXEA 2LBBA 1V61A 2P0FA 3D8FA 1WJMA 3FP5A 5LOPB 3MPXA 2DTCA 3GYOA 3SBGA 1XX0A 3KY9A 2K00A 3WYFB 2J59M 2Z0QA 3PP2A 2ABDA 3QBVB 2D4QA 1Q67A 3SBTA 3ZVRA 2D2QA 4ILGB 4B6HA 4JKGB 4DXAB 2YF0A 5FI1A 2LKOA 1W1GA 1FB8A 1H4RA 1V5MA 1X86A 5J3YA 4A6HA 2COAA 4HAXB 5GOWB 4K2OA 4ILJA 2DYNA 3E9LA 1V5PA 1DYNA 3KSYA 1UEFA 2VRWB 1WVHA 1U5FA 3PZDA 2W2XD 2LYDA 3U7DA 1IRSA 2GJYA 5D27A 3BINA 1I2HA 1KZGA 4GMVA 1PMSA 2CQUA 4JKFA 1PLSA 1TXDA 1UPQA 4HAWB 2V76A 5EFXA 2RUKB 3P7ZA 4D0NB 2Y8GA 2MWNB 3ENBA 4JKHA 2DA0A 2DKQA 1ZM0A 2D9ZA 5C16A 1K5DB 5JP4A 1ZC3B 2CB8A 4KHAA 3PSCA 2I5FA 3E66A 1NU2A 2Z0OA 1M7RA 1MPHA 4L6EA 4IOYX 1FHXA 5C5BB 1HB8A 4K81A 4KHBB 2RQ1A 1J0WA 2Q13A 4GXBA 4A6FB 2FJLA 1MK9B 3F0WA 4JK8A 3SNHA 1GC6A 1X1GA 4HAZB 2COFA 1BAKA 1WGQA 2NMBA 4JKDA 1MKEA 4Z2NA 1FAOA 3A8PA 2RGNB 1N3HA 2G35A 1U5EA 1GG3A 2KGXB 2RVBB 3TCAA 2YS1A 1TJ6A 3FEHA 3A98B 3SYXA 3T06A 2RSGA 3HK0A 4F7GA 2I5CA 4C0AA 4JK9A 2RLOA 3FSSA 5DHFB 4EKUA 1XD4A 1U5DA 2MDXA 1NTIA 2DKPA 4HATB 1V88A 1EF1A 3TFMA 2P8VA 1TQZA 3KRWA 1NTVA 4HB3B 3E9PA 5J3QA 2X18A 3G9WA 2D9YA 2DX1A 5DH9B 2GCLA 2J0JA 5LONB 3FM8C 1FGZA 1NTYA 3HW2B 2DHKA 1KI1B 3AU4A 2E2XA 2P0HA 1SHCA 4Z2MB 1MK7B 4HAUB 3WA0A 1EVHA 2KUPA 2P0DA 2VSZA 3PG7A 5HE1A 4CYEA 2J0KA 3PEGA 2YS5A 1X05A 1XODA 1LW3A 2JP2A 1FHWA 2COPA 2N0YA 4IFSA 2DIKA 4JK7A 1P3RA 1WG7A 2YT0A 3OANA 1DBHA 3TVVA 2L1CA 2CAYA 2YT1A 1DDVA 2I1JA 3ML4A 4TKNA 1PFJA 5KQ4A 3QIJA 2CODA 4PQ0A 1DDWA 5D3XA 1GGOA 3SV1A 2H7EA 4WSFA 2ELAA 2D11A 4XWXA 4BBKA 1NI2A 4JKBA 4Y94A 4HDQA 2UZRA 5JHGA 2DN6A 1RJ2A 3D8DA 1W1DA 1W1HA 5C79A 1VBHA 3TO1A 2DHIA 1H10A 2RNRB 3V5WA 1BTNA 3ULCA 1U2BA 4KVGB 1ZC4B 3EPYA 5J3TA 1KZ7A 3PVWA 5L81A 1BWNA 1WI1A 3ULBA 3F5RA 5CLQB 1NVLA 4GMXB 1JDEA 1ZVRA 2WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXD A;  5JLJ B;  1ACA A;  4HAY B;  1XKE A;  2I1K A;  4TYZ A;  1Y5O A;  2QKL A;  1FGY A;  3TW1 A;  1GC7 A;  1UNR A;  2DHJ A;  4K17 A;  1Y19 B;  3IVF A;  4DBB A;  3NSU A;  2ELB A;  4F7U P;  3ODX A;  1MAI A;  1HB6 A;  2D10 A;  4HDO A;  2LUL A;  3ZDT A;  4A6K A;  4YON A;  1OQN A;  3CIK A;  3KZ1 A;  3PVU A;  2UZS A;  4WJ7 A;  1DDM A;  2Y7B A;  4P7I A;  5D3Y A;  2DYQ A;  1V89 A;  2YSZ A;  1OY2 A;  1MIX A;  2LOZ A;  2VKI A;  2LOX A;  4CHJ A;  2YVC A;  2D9V A;  1X1F A;  2M14 A;  5DI9 B;  1U29 A;  2DFK A;  4ZRI A;  5JHH A;  1MIZ B;  1V5U A;  3SUZ A;  1RRP B;  3U8Z A;  1BTK A;  1LB1 A;  2D9W A;  2L2I A;  2CY5 A;  3VOQ A;  1ST7 A;  2COC A;  1UNP A;  1X11 A;  2HTH B;  3D8E A;  4EMO A;  2YRY A;  1M7E A;  2YS3 A;  4KHO A;  2OTX A;  2ROZ B;  5CLL B;  1SGH A;  1P5T A;  2XQN M;  2DX5 A;  4K2P A;  4NY0 A;  4HB4 B;  4CHM A;  1ISN A;  4MY6 A;  2QKM A;  4MK0 A;  1UNQ A;  2DLW A;  1J19 A;  2ADZ A;  1I7A A;  3BJI A;  1UPR A;  1OMW A;  4DX9 0;  1U27 A;  2EJ8 A;  2GCJ A;  2MFQ A;  3AU5 A;  4ZRJ A;  2GS0 A;  2HRJ A;  3FLV A;  3ODO A;  2R09 A;  5DIF B;  1Z87 A;  2N23 A;  2ZPY A;  3MDB C;  4HAV B;  2Z0P A;  5C6R A;  2MKR A;  3DXC A;  2KCJ A;  1U5G A;  3O96 A;  2AEH A;  1XR0 B;  1QQG A;  4A5K A;  3AJ4 A;  4NSW A;  4GZU A;  2K2J A;  4DX8 A;  5C5B A;  1XCG A;  1ZSQ A;  1FOE A;  2ROV A;  2NZ8 B;  3SO6 A;  2PZ1 A;  4GPT B;  2HE7 A;  5D3V A;  3X23 A;  2CRF A;  2EC1 A;  4GN1 A;  4A6F A;  1E5W A;  1FHO A;  1B55 A;  4IAP A;  3CXB B;  2R0D A;  2H7D A;  2IFS A;  2W2W A;  1DRO A;  2CY4 A;  5KCV A;  2EMT A;  2FJ9 A;  3A8Q A;  2M38 A;  1EAZ A;  3P6A A;  4EJN A;  5FI0 A;  1QC6 A;  2EMS A;  3UZT A;  1WJ1 A;  3ODW A;  3QWM A;  2LG1 A;  1HBK A;  4KAX B;  5HE3 A;  5D3W A;  1AWE A;  3RCP A;  2Y8F A;  2AL6 A;  4HB0 B;  1AQC A;  4H8S A;  3GYP A;  4YL8 A;  3VIA A;  5IJM A;  4WVF B;  2OQB A;  2W2X C;  4F7H A;  4PNK A;  2FDQ A;  4ZRK A;  4HB2 B;  1K5G B;  5HE0 A;  2BCJ A;  1WGU A;  4MT7 A;  2UVM A;  1EGX A;  3PVL A;  1P6S A;  3HQC A;  5DHA B;  2K2U A;  3KRX A;  3N7C A;  3LJU X;  2IYB A;  4HHV A;  5KQ1 A;  5HE2 A;  3M1I B;  2D9X A;  2J0M A;  3DXE A;  2LBB A;  1V61 A;  2P0F A;  3D8F A;  1WJM A;  3FP5 A;  5LOP B;  3MPX A;  2DTC A;  3GYO A;  1XX0 A;  3KY9 A;  2K00 A;  3WYF B;  2J59 M;  2Z0Q A;  3PP2 A;  2ABD A;  3QBV B;  2D4Q A;  1Q67 A;  3ZVR A;  2D2Q A;  4B6H A;  4DXA B;  2YF0 A;  5FI1 A;  2LKO A;  1W1G A;  1FB8 A;  1H4R A;  1V5M A;  1X86 A;  5J3Y A;  4A6H A;  2COA A;  4HAX B;  5GOW B;  4K2O A;  2DYN A;  1V5P A;  1DYN A;  3KSY A;  1UEF A;  2VRW B;  1WVH A;  1U5F A;  3PZD A;  2W2X D;  2LYD A;  3U7D A;  1IRS A;  2GJY A;  5D27 A;  3BIN A;  1I2H A;  1KZG A;  4GMV A;  1PMS A;  2CQU A;  1PLS A;  1TXD A;  1UPQ A;  4HAW B;  2V76 A;  5EFX A;  2RUK B;  3P7Z A;  4D0N B;  2Y8G A;  2MWN B;  2DA0 A;  2DKQ A;  1ZM0 A;  2D9Z A;  5C16 A;  1K5D B;  5JP4 A;  1ZC3 B;  2CB8 A;  4KHA A;  3PSC A;  2I5F A;  1NU2 A;  2Z0O A;  1M7R A;  1MPH A;  4L6E A;  4IOY X;  1FHX A;  5C5B B;  1HB8 A;  4K81 A;  4KHB B;  2RQ1 A;  1J0W A;  2Q13 A;  4GXB A;  4A6F B;  2FJL A;  1MK9 B;  3F0W A;  3SNH A;  1GC6 A;  1X1G A;  4HAZ B;  2COF A;  1BAK A;  1WGQ A;  2NMB A;  1MKE A;  4Z2N A;  1FAO A;  3A8P A;  2RGN B;  1N3H A;  2G35 A;  1U5E A;  1GG3 A;  2KGX B;  2RVB B;  3TCA A;  2YS1 A;  1TJ6 A;  3FEH A;  3A98 B;  3SYX A;  3T06 A;  2RSG A;  3HK0 A;  4F7G A;  2I5C A;  4C0A A;  2RLO A;  3FSS A;  5DHF B;  4EKU A;  1XD4 A;  1U5D A;  2MDX A;  1NTI A;  2DKP A;  4HAT B;  1V88 A;  1EF1 A;  3TFM A;  2P8V A;  1TQZ A;  3KRW A;  1NTV A;  4HB3 B;  5J3Q A;  2X18 A;  3G9W A;  2D9Y A;  2DX1 A;  5DH9 B;  2GCL A;  2J0J A;  5LON B;  3FM8 C;  1FGZ A;  1NTY A;  3HW2 B;  2DHK A;  1KI1 B;  3AU4 A;  2E2X A;  2P0H A;  1SHC A;  4Z2M B;  1MK7 B;  4HAU B;  3WA0 A;  1EVH A;  2KUP A;  2P0D A;  2VSZ A;  3PG7 A;  5HE1 A;  4CYE A;  2J0K A;  3PEG A;  2YS5 A;  1X05 A;  1XOD A;  1LW3 A;  2JP2 A;  1FHW A;  2COP A;  2N0Y A;  4IFS A;  1P3R A;  1WG7 A;  2YT0 A;  3OAN A;  1DBH A;  3TVV A;  2L1C A;  2CAY A;  2YT1 A;  1DDV A;  2I1J A;  3ML4 A;  4TKN A;  1PFJ A;  5KQ4 A;  3QIJ A;  2COD A;  4PQ0 A;  1DDW A;  5D3X A;  3SV1 A;  2H7E A;  4WSF A;  2ELA A;  2D11 A;  4XWX A;  4BBK A;  1NI2 A;  4Y94 A;  4HDQ A;  2UZR A;  5JHG A;  2DN6 A;  1RJ2 A;  3D8D A;  1W1D A;  1W1H A;  5C79 A;  3TO1 A;  2DHI A;  1H10 A;  2RNR B;  3V5W A;  1BTN A;  3ULC A;  1U2B A;  4KVG B;  1ZC4 B;  3EPY A;  5J3T A;  1KZ7 A;  3PVW A;  5L81 A;  1BWN A;  1WI1 A;  3ULB A;  3F5R A;  5CLQ B;  1NVL A;  4GMX B;  1ZVR A;  2WH5 A; 
#chains in the Genus database with same CATH topology
 3DXD A;  5JLJ B;  1ACA A;  4HAY B;  1XKE A;  2I1K A;  4TYZ A;  1Y5O A;  4OT1 A;  2QKL A;  1FGY A;  3TW1 A;  1GC7 A;  1UNR A;  2DHJ A;  4K17 A;  1Y19 B;  3IVF A;  4DBB A;  3NSU A;  5I2S A;  2ELB A;  4F7U P;  3ODX A;  4D6W A;  1MAI A;  1HB6 A;  2D10 A;  4ILH A;  4HDO A;  2LUL A;  3ZDT A;  1T77 A;  4A6K A;  4YON A;  5M4Y B;  1OQN A;  3CIK A;  3KZ1 A;  3PVU A;  2UZS A;  4WJ7 A;  1DDM A;  2Y7B A;  4P7I A;  5D3Y A;  2DYQ A;  1V89 A;  2YSZ A;  1OY2 A;  4JKC A;  1MIX A;  3E9O A;  2LOX A;  2LOZ A;  2VKI A;  4CHJ A;  2YVC A;  2D9V A;  1X1F A;  2M14 A;  5DI9 B;  5I2M A;  2KR0 A;  1U29 A;  2Z59 A;  2DFK A;  4JKG A;  4HSI A;  2Z14 A;  4ZRI A;  5JHH A;  1MIZ B;  1V5U A;  3SUZ A;  1RRP B;  3U8Z A;  1BTK A;  1LB1 A;  2D9W A;  2L2I A;  2CY5 A;  3VOQ A;  1ST7 A;  2COC A;  1UNP A;  1X11 A;  2HTH B;  3D8E A;  4EMO A;  2ZKM X;  2YRY A;  1M7E A;  3A58 A;  4JKE A;  2YS3 A;  4KHO A;  2K8E A;  2OTX A;  2R82 A;  2ROZ B;  5CLL B;  1SGH A;  3DCX A;  1P5T A;  2XQN M;  2DX5 A;  4K2P A;  4NY0 A;  4HB4 B;  1KC7 A;  1ISN A;  4CHM A;  4MY6 A;  2QKM A;  4MK0 A;  1UNQ A;  2DLW A;  1ZYI A;  1J19 A;  2ADZ A;  1I7A A;  3BJI A;  1UPR A;  1OMW A;  2KIE A;  4DX9 0;  1U27 A;  2EJ8 A;  2GCJ A;  2MFQ A;  3AU5 A;  4ZRJ A;  2GS0 A;  2HRJ A;  3FLV A;  3ODO A;  2R09 A;  5DIF B;  1Z87 A;  2N23 A;  1DIK A;  2ZPY A;  3MDB C;  4HAV B;  2Z0P A;  5C6R A;  2MKR A;  3DXC A;  4L1R A;  3U12 A;  2KCJ A;  1U5G A;  3O96 A;  2AEH A;  1XR0 B;  1QQG A;  4A5K A;  3AJ4 A;  4NSW A;  4GZU A;  2X0S A;  2K2J A;  4DX8 A;  5C5B A;  1XCG A;  1ZSQ A;  1FOE A;  1VBG A;  2ROV A;  2NZ8 B;  3SO6 A;  2PZ1 A;  5JVL A;  4GPT B;  4JKA A;  2HE7 A;  5D3V A;  3X23 A;  2CRF A;  2EC1 A;  4GN1 A;  1KBL A;  4A6F A;  1E5W A;  1FHO A;  1B55 A;  4IAP A;  3CXB B;  2R0D A;  2H7D A;  2IFS A;  2W2W A;  4GNK B;  1DRO A;  2CY4 A;  5KCV A;  2EMT A;  2FJ9 A;  5LG4 B;  3A8Q A;  2M38 A;  1EAZ A;  3P6A A;  4EJN A;  5FI0 A;  1QC6 A;  3HSA A;  2EMS A;  3UZT A;  1WJ1 A;  3ODW A;  3QWM A;  2LG1 A;  1HBK A;  4KAX B;  5HE3 A;  5D3W A;  1AWE A;  3NWA A;  3RCP A;  2Y8F A;  2AL6 A;  4HB0 B;  1AQC A;  4H8S A;  3GYP A;  4YL8 A;  4CSQ A;  4QJ4 B;  3VIA A;  5IJM A;  4WVF B;  2OQB A;  2W2X C;  3B77 A;  4F7H A;  4PNK A;  2FDQ A;  4ZRK A;  4HB2 B;  1K5G B;  4DIX A;  5HE0 A;  2BCJ A;  1WGU A;  4MT7 A;  2UVM A;  1EGX A;  3PVL A;  1P6S A;  3HQC A;  5DHA B;  2K2U A;  3KRX A;  3N7C A;  3LJU X;  3HIE A;  2IYB A;  4HHV A;  5KQ1 A;  5HE2 A;  3M1I B;  2D9X A;  2J0M A;  3DXE A;  2LBB A;  1V61 A;  2P0F A;  3D8F A;  1WJM A;  3FP5 A;  5LOP B;  3MPX A;  2DTC A;  3GYO A;  3SBG A;  2YT2 A;  1XX0 A;  3KY9 A;  2K00 A;  3WYF B;  2J59 M;  2Z0Q A;  3PP2 A;  2ABD A;  3QBV B;  2D4Q A;  1Q67 A;  3SBT A;  3ZVR A;  2Z13 A;  2D2Q A;  4ILG B;  4B6H A;  4JKG B;  4DXA B;  2YF0 A;  2K49 A;  5IRS A;  5FI1 A;  2LKO A;  1W1G A;  1FB8 A;  1H4R A;  1V5M A;  1X86 A;  5J3Y A;  4A6H A;  2COA A;  4HAX B;  5GOW B;  4K2O A;  4ILJ A;  2DYN A;  3E9L A;  1V5P A;  1DYN A;  3KSY A;  1UEF A;  2VRW B;  1WVH A;  1U5F A;  3PZD A;  2W2X D;  2LYD A;  3U7D A;  1IRS A;  2GJY A;  5D27 A;  3BIN A;  3FVC A;  1I2H A;  1KZG A;  4GMV A;  1PMS A;  2CQU A;  4JKF A;  1PLS A;  1TXD A;  1UPQ A;  4HAW B;  2V76 A;  5EFX A;  2RUK B;  3P7Z A;  4D0N B;  2Y8G A;  2MWN B;  3ENB A;  4JKH A;  2DA0 A;  2DKQ A;  2RRF A;  4GOU A;  1ZM0 A;  2D9Z A;  5C16 A;  1K5D B;  2KUQ A;  5JP4 A;  1ZC3 B;  2CB8 A;  4KHA A;  3PSC A;  2I5F A;  3E66 A;  1NU2 A;  2Z0O A;  1M7R A;  1MPH A;  4L6E A;  4IOY X;  1FHX A;  5C5B B;  1HB8 A;  4K81 A;  4KHB B;  1MI1 A;  2RQ1 A;  1J0W A;  2Q13 A;  4GXB A;  4A6F B;  2FJL A;  1MK9 B;  3F0W A;  4JK8 A;  3SNH A;  1GC6 A;  1X1G A;  4HAZ B;  2COF A;  1BAK A;  1WGQ A;  2NMB A;  4JKD A;  1MKE A;  4Z2N A;  1FAO A;  3A8P A;  2RGN B;  1N3H A;  2G35 A;  1U5E A;  1GG3 A;  2KGX B;  2GUM A;  2RVB B;  3TCA A;  2YS1 A;  1TJ6 A;  3FEH A;  3A98 B;  3SYX A;  3T06 A;  2RSG A;  3HK0 A;  4F7G A;  2I5C A;  4C0A A;  4JK9 A;  2RLO A;  3FSS A;  5DHF B;  4EKU A;  1XD4 A;  1U5D A;  2MDX A;  1NTI A;  2DKP A;  4HAT B;  1V88 A;  1EF1 A;  3TFM A;  2P8V A;  1TQZ A;  3KRW A;  1NTV A;  4HB3 B;  3E9P A;  5J3Q A;  2X18 A;  3G9W A;  2D9Y A;  2DX1 A;  5DH9 B;  2GCL A;  2J0J A;  5LON B;  3FM8 C;  4QXA B;  1FGZ A;  1NTY A;  3HW2 B;  2FJU B;  2DHK A;  1KI1 B;  3AU4 A;  2E2X A;  2P0H A;  2NBV A;  1SHC A;  4Z2M B;  1MK7 B;  4HAU B;  3WA0 A;  1EVH A;  2KUP A;  2P0D A;  2VSZ A;  3PG7 A;  5HE1 A;  4CYE A;  2J0K A;  3PEG A;  2YS5 A;  1X05 A;  1XOD A;  1LW3 A;  2JP2 A;  1FHW A;  2COP A;  2N0Y A;  4IFS A;  2DIK A;  4JK7 A;  1P3R A;  1WG7 A;  2YT0 A;  3OAN A;  1DBH A;  3TVV A;  2L1C A;  2CAY A;  2YT1 A;  1DDV A;  2Z4D A;  2I1J A;  3ML4 A;  4OSN A;  4TKN A;  1PFJ A;  5KQ4 A;  3QIJ A;  2COD A;  4PQ0 A;  4QJ5 B;  1DDW A;  5D3X A;  1GGO A;  3SV1 A;  2H7E A;  3OHM B;  4WSF A;  2ELA A;  2D11 A;  4XWX A;  3NW8 A;  4BBK A;  3NWD A;  1NI2 A;  4JKB A;  4Y94 A;  4HDQ A;  2R2Y A;  2UZR A;  5JHG A;  2DN6 A;  1RJ2 A;  3D8D A;  1W1D A;  1W1H A;  5C79 A;  1VBH A;  4KHB A;  3TO1 A;  2DHI A;  1H10 A;  2RNR B;  3NWF A;  1BTN A;  3ULC A;  3V5W A;  1U2B A;  4KVG B;  1ZC4 B;  2KIG A;  3EPY A;  5J3T A;  1KZ7 A;  3PVW A;  5L81 A;  4QJ3 B;  1BWN A;  1WI1 A;  3ULB A;  3F5R A;  5CLQ B;  1NVL A;  4GMX B;  1JDE A;  1ZVR A;  2WH5 A; 
#chains in the Genus database with same CATH homology
 3DXD A;  5JLJ B;  1ACA A;  4HAY B;  1XKE A;  2I1K A;  4TYZ A;  1Y5O A;  2QKL A;  1FGY A;  3TW1 A;  1GC7 A;  1UNR A;  2DHJ A;  4K17 A;  1Y19 B;  3IVF A;  4DBB A;  3NSU A;  2ELB A;  4F7U P;  3ODX A;  1MAI A;  1HB6 A;  2D10 A;  4ILH A;  4HDO A;  2LUL A;  3ZDT A;  4A6K A;  4YON A;  1OQN A;  3CIK A;  3KZ1 A;  3PVU A;  2UZS A;  4WJ7 A;  1DDM A;  2Y7B A;  4P7I A;  5D3Y A;  2DYQ A;  1V89 A;  2YSZ A;  1OY2 A;  4JKC A;  1MIX A;  3E9O A;  2LOX A;  2LOZ A;  2VKI A;  4CHJ A;  2YVC A;  2D9V A;  1X1F A;  2M14 A;  5DI9 B;  1U29 A;  2DFK A;  4JKG A;  4ZRI A;  5JHH A;  1MIZ B;  1V5U A;  3SUZ A;  1RRP B;  3U8Z A;  1BTK A;  1LB1 A;  2D9W A;  2L2I A;  2CY5 A;  3VOQ A;  1ST7 A;  2COC A;  1UNP A;  1X11 A;  2HTH B;  3D8E A;  4EMO A;  2YRY A;  1M7E A;  4JKE A;  2YS3 A;  4KHO A;  2OTX A;  2R82 A;  2ROZ B;  5CLL B;  1SGH A;  1P5T A;  2XQN M;  2DX5 A;  4K2P A;  4NY0 A;  4HB4 B;  1KC7 A;  1ISN A;  4CHM A;  4MY6 A;  2QKM A;  4MK0 A;  1UNQ A;  2DLW A;  1J19 A;  2ADZ A;  1I7A A;  3BJI A;  1UPR A;  1OMW A;  4DX9 0;  1U27 A;  2EJ8 A;  2GCJ A;  2MFQ A;  3AU5 A;  4ZRJ A;  2GS0 A;  2HRJ A;  3FLV A;  3ODO A;  2R09 A;  5DIF B;  1Z87 A;  2N23 A;  1DIK A;  2ZPY A;  3MDB C;  4HAV B;  2Z0P A;  5C6R A;  2MKR A;  3DXC A;  2KCJ A;  1U5G A;  3O96 A;  2AEH A;  1XR0 B;  1QQG A;  4A5K A;  3AJ4 A;  4NSW A;  4GZU A;  2X0S A;  2K2J A;  4DX8 A;  5C5B A;  1XCG A;  1ZSQ A;  1FOE A;  2ROV A;  1VBG A;  2NZ8 B;  3SO6 A;  2PZ1 A;  5JVL A;  4GPT B;  4JKA A;  2HE7 A;  5D3V A;  3X23 A;  2CRF A;  2EC1 A;  4GN1 A;  1KBL A;  4A6F A;  1E5W A;  1FHO A;  1B55 A;  4IAP A;  3CXB B;  2R0D A;  2H7D A;  2IFS A;  2W2W A;  1DRO A;  2CY4 A;  5KCV A;  2EMT A;  2FJ9 A;  3A8Q A;  2M38 A;  1EAZ A;  3P6A A;  4EJN A;  5FI0 A;  1QC6 A;  2EMS A;  3UZT A;  1WJ1 A;  3ODW A;  3QWM A;  2LG1 A;  1HBK A;  4KAX B;  5HE3 A;  5D3W A;  1AWE A;  3RCP A;  2Y8F A;  2AL6 A;  4HB0 B;  1AQC A;  4H8S A;  3GYP A;  4YL8 A;  3VIA A;  5IJM A;  4WVF B;  2OQB A;  2W2X C;  4F7H A;  4PNK A;  2FDQ A;  4ZRK A;  4HB2 B;  1K5G B;  5HE0 A;  2BCJ A;  1WGU A;  4MT7 A;  2UVM A;  1EGX A;  3PVL A;  1P6S A;  3HQC A;  5DHA B;  2K2U A;  3KRX A;  3N7C A;  3LJU X;  2IYB A;  4HHV A;  5KQ1 A;  5HE2 A;  3M1I B;  2D9X A;  2J0M A;  3DXE A;  2LBB A;  1V61 A;  2P0F A;  3D8F A;  1WJM A;  3FP5 A;  5LOP B;  3MPX A;  2DTC A;  3GYO A;  3SBG A;  1XX0 A;  3KY9 A;  2K00 A;  3WYF B;  2J59 M;  2Z0Q A;  3PP2 A;  2ABD A;  3QBV B;  2D4Q A;  1Q67 A;  3SBT A;  3ZVR A;  2D2Q A;  4ILG B;  4B6H A;  4JKG B;  4DXA B;  2YF0 A;  5FI1 A;  2LKO A;  1W1G A;  1FB8 A;  1H4R A;  1V5M A;  1X86 A;  5J3Y A;  4A6H A;  2COA A;  4HAX B;  5GOW B;  4K2O A;  4ILJ A;  2DYN A;  3E9L A;  1V5P A;  1DYN A;  3KSY A;  1UEF A;  2VRW B;  1WVH A;  1U5F A;  3PZD A;  2W2X D;  2LYD A;  3U7D A;  1IRS A;  2GJY A;  5D27 A;  3BIN A;  1I2H A;  1KZG A;  4GMV A;  1PMS A;  2CQU A;  4JKF A;  1PLS A;  1TXD A;  1UPQ A;  4HAW B;  2V76 A;  5EFX A;  2RUK B;  3P7Z A;  4D0N B;  2Y8G A;  2MWN B;  3ENB A;  4JKH A;  2DA0 A;  2DKQ A;  1ZM0 A;  2D9Z A;  5C16 A;  1K5D B;  5JP4 A;  1ZC3 B;  2CB8 A;  4KHA A;  3PSC A;  2I5F A;  3E66 A;  1NU2 A;  2Z0O A;  1M7R A;  1MPH A;  4L6E A;  4IOY X;  1FHX A;  5C5B B;  1HB8 A;  4K81 A;  4KHB B;  2RQ1 A;  1J0W A;  2Q13 A;  4GXB A;  4A6F B;  2FJL A;  1MK9 B;  3F0W A;  4JK8 A;  3SNH A;  1GC6 A;  1X1G A;  4HAZ B;  2COF A;  1BAK A;  1WGQ A;  2NMB A;  4JKD A;  1MKE A;  4Z2N A;  1FAO A;  3A8P A;  2RGN B;  1N3H A;  2G35 A;  1U5E A;  1GG3 A;  2KGX B;  2RVB B;  3TCA A;  2YS1 A;  1TJ6 A;  3FEH A;  3A98 B;  3SYX A;  3T06 A;  2RSG A;  3HK0 A;  4F7G A;  2I5C A;  4C0A A;  4JK9 A;  2RLO A;  3FSS A;  5DHF B;  4EKU A;  1XD4 A;  1U5D A;  2MDX A;  1NTI A;  2DKP A;  4HAT B;  1V88 A;  1EF1 A;  3TFM A;  2P8V A;  1TQZ A;  3KRW A;  1NTV A;  4HB3 B;  3E9P A;  5J3Q A;  2X18 A;  3G9W A;  2D9Y A;  2DX1 A;  5DH9 B;  2GCL A;  2J0J A;  5LON B;  3FM8 C;  1FGZ A;  1NTY A;  3HW2 B;  2DHK A;  1KI1 B;  3AU4 A;  2E2X A;  2P0H A;  1SHC A;  4Z2M B;  1MK7 B;  4HAU B;  3WA0 A;  1EVH A;  2KUP A;  2P0D A;  2VSZ A;  3PG7 A;  5HE1 A;  4CYE A;  2J0K A;  3PEG A;  2YS5 A;  1X05 A;  1XOD A;  1LW3 A;  2JP2 A;  1FHW A;  2COP A;  2N0Y A;  4IFS A;  2DIK A;  4JK7 A;  1P3R A;  1WG7 A;  2YT0 A;  3OAN A;  1DBH A;  3TVV A;  2L1C A;  2CAY A;  2YT1 A;  1DDV A;  2I1J A;  3ML4 A;  4TKN A;  1PFJ A;  5KQ4 A;  3QIJ A;  2COD A;  4PQ0 A;  1DDW A;  5D3X A;  1GGO A;  3SV1 A;  2H7E A;  4WSF A;  2ELA A;  2D11 A;  4XWX A;  4BBK A;  1NI2 A;  4JKB A;  4Y94 A;  4HDQ A;  2UZR A;  5JHG A;  2DN6 A;  1RJ2 A;  3D8D A;  1W1D A;  1W1H A;  5C79 A;  1VBH A;  3TO1 A;  2DHI A;  1H10 A;  2RNR B;  3V5W A;  1BTN A;  3ULC A;  1U2B A;  4KVG B;  1ZC4 B;  3EPY A;  5J3T A;  1KZ7 A;  3PVW A;  5L81 A;  1BWN A;  1WI1 A;  3ULB A;  3F5R A;  5CLQ B;  1NVL A;  4GMX B;  1JDE A;  1ZVR A;  2WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...