1MK9B

Crystal structure of an integrin beta3-talin chimera
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
187
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 54
structure length 187
sequence length 190
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk9B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk9B02
4YONA 3PP2A 3DXDA 1TJ6A 3D8DA 2DTCA 2DN6A 3GYPA 1V5PA 3HW2B 2RUKB 1EVHA 2COAA 5D3XA 2J0KA 3ODWA 2D4QA 1LW3A 3FM8C 4CYEA 1DROA 4TYZA 5HE0A 1UNRA 4C0AA 2COFA 2R09A 4IFSA 2H7EA 4MT7A 4EKUA 3TO1A 2WH5A 2LKOA 1HB6A 4Y94A 1EGXA 2N23A 1V5MA 2LG1A 2FJ9A 2L1CA 4K2PA 4K17A 1TXDA 1W1DA 4CHJA 3AU5A 1UNPA 3TCAA 2VSZA 1OMWA 2D9VA 2UZRA 4KHOA 4WSFA 1P3RA 5FI0A 2AEHA 1XKEA 4ZRIA 2E2XA 1K5DB 4IAPA 3CXBB 2YVCA 3AJ4A 2KUPA 1I2HA 1H4RA 4YL8A 1MK7B 2RGNB 2ABDA 2DHKA 2OQBA 1U5DA 2W2XC 1Y5OA 3CIKA 2YS5A 2ROVA 3MPXA 4ZRJA 2DHJA 4A6FA 2I1JA 2KCJA 4KHAA 3N7CA 4KVGB 1ACAA 1NTYA 1ST7A 1ZSQA 2COPA 1U5EA 1EAZA 4MK0A 1NU2A 3ODOA 5J3QA 2AL6A 4HB2B 2YS1A 1Z87A 4PNKA 4HB3B 2I5FA 2N0YA 5DHAB 3IVFA 4K2OA 2P0HA 3ODXA 2DFKA 2D9ZA 5JLJB 3FP5A 4WVFB 3KRXA 2DHIA 3KSYA 3F0WA 1WGUA 2Z0QA 1FB8A 1PFJA 3AU4A 2GJYA 2DYQA 4HAUB 4HB4B 4HAXB 2D11A 1MIXA 1X05A 2R0DA 1ZM0A 2DX1A 5C16A 3ML4A 2MDXA 3SO6A 3SV1A 3SUZA 1BTNA 1AWEA 1MIZB 3U7DA 2FJLA 1QQGA 5KCVA 2P0FA 1V89A 5J3TA 3T06A 3A8QA 4P7IA 2ZPYA 4B6HA 2ELBA 4L6EA 3FLVA 2EMTA 3A98B 4DBBA 1UPRA 4HAZB 1AQCA 5DH9B 3PSCA 3FSSA 5J3YA 5D3YA 3HQCA 2GCJA 3TFMA 1J0WA 1HBKA 5D3VA 3P6AA 4F7GA 1UPQA 2G35A 3EPYA 5C79A 3PVWA 1FAOA 2YF0A 1WI1A 5EFXA 3HK0A 2CODA 3M1IB 4PQ0A 2CQUA 2MWNB 2Q13A 3BINA 1GC6A 5HE3A 4GZUA 4ZRKA 5DIFB 1ZVRA 4D0NB 2K00A 5CLLB 1SHCA 2IFSA 1MK9B 3PG7A 4NSWA 2V76A 2D9YA 2D9XA 1XX0A 3RCPA 2HRJA 2YRYA 2MFQA 4Z2NA 2J0JA 3NSUA 3A8PA 1W1GA 1FHOA 1WG7A 3ULCA 3U8ZA 2UVMA 3QIJA 2Y8FA 5DI9B 2GS0A 3V5WA 2DKQA 5GOWB 4TKNA 4F7UP 1LB1A 2UZSA 4MY6A 2Z0OA 1WGQA 2FDQA 5JHGA 2RNRB 4DX8A 2GCLA 2OTXA 1ZC4B 2CAYA 1J19A 3O96A 4HDQA 1V61A 1MKEA 2KGXB 4A6KA 1FHWA 1N3HA 4IOYX 1DYNA 5D3WA 2VKIA 5HE1A 1K5GB 4Z2MB 5C5BB 2XQNM 1RRPB 1EF1A 3QWMA 1U5FA 2D2QA 2COCA 3LJUX 1XR0B 4CHMA 3MDBC 2DLWA 3BJIA 5IJMA 1X1GA 4GMXB 1WJMA 5C6RA 1Y19B 3P7ZA 2CRFA 5LOPB 4DXAB 2HTHB 2I1KA 1UEFA 3SNHA 2LULA 1X11A 2Y7BA 1OY2A 1NVLA 1KZGA 1SGHA 1GC7A 4EJNA 1V5UA 2HE7A 2NZ8B 2YS3A 1M7EA 3ZVRA 3X23A 1TQZA 2BCJA 2EJ8A 1FGYA 4DX90 1DDVA 1WJ1A 1U27A 2EC1A 2I5CA 5L81A 1I7AA 3TVVA 2JP2A 5CLQB 2Z0PA 1NI2A 2K2UA 4A6HA 2LYDA 2LBBA 2Y8GA 2QKMA 1ISNA 2EMSA 2DYNA 1P6SA 2P0DA 2LOZA 2L2IA 2D10A 2DA0A 2K2JA 4HATB 2YSZA 1IRSA 1DBHA 5C5BA 2PZ1A 5DHFB 1W1HA 1BAKA 2CY4A 2RVBB 1DDWA 1KI1B 1P5TA 1XODA 2MKRA 3OANA 2RSGA 3WA0A 1HB8A 3UZTA 3VIAA 2CB8A 1BTKA 3F5RA 4XWXA 2J0MA 4K81A 4KHBB 4GPTB 5LONB 1PMSA 1QC6A 1FGZA 1NTVA 1X86A 3ULBA 5KQ4A 2H7DA 1U29A 4HAYB 3KZ1A 3DXEA 5KQ1A 1V88A 5JHHA 1B55A 4WJ7A 1MPHA 3PEGA 4HAWB 3PVLA 1E5WA 2YT1A 2M14A 1H10A 1XD4A 3WYFB 1ZC3B 2RLOA 1WVHA 2ADZA 4GN1A 1OQNA 1KZ7A 3PVUA 2CY5A 2IYBA 4KAXB 1UNQA 2J59M 2QKLA 4NY0A 1DDMA 2D9WA 3VOQA 4HHVA 5HE2A 4GXBA 4F7HA 3D8EA 1MAIA 1X1FA 2X18A 4HDOA 3FEHA 3KY9A 3TW1A 3DXCA 2P8VA 4HB0B 2VRWB 1XCGA 5JP4A 2RQ1A 2DKPA 3ZDTA 4BBKA 1U5GA 1M7RA 2YT0A 4A5KA 4H8SA 3PZDA 1PLSA 1FHXA 2ROZB 3G9WA 3D8FA 4HAVB 2W2XD 2LOXA 1U2BA 2ELAA 1Q67A 5D27A 3QBVB 3GYOA 4GMVA 5FI1A 2DX5A 2NMBA 1BWNA 2M38A 2W2WA 1FOEA 3KRWA 4EMOA 1RJ2A 3SYXA 4A6FB 1GG3A 1NTIA
chains in the Genus database with same CATH superfamily
4YONA 3PP2A 3DXDA 1TJ6A 3B77A 3D8DA 2DTCA 2DN6A 3E9LA 3GYPA 1V5PA 3HW2B 2RUKB 3E9OA 1EVHA 2COAA 2YT2A 5D3XA 2J0KA 3ODWA 2D4QA 1LW3A 3FM8C 1DIKA 4CYEA 1DROA 4TYZA 5HE0A 1UNRA 3SBGA 4C0AA 2COFA 2R09A 4IFSA 2H7EA 4MT7A 4EKUA 3TO1A 2WH5A 2LKOA 2X0SA 1HB6A 4Y94A 1EGXA 4QJ5B 2N23A 1V5MA 2LG1A 2FJ9A 4D6WA 2L1CA 4K2PA 1KC7A 4K17A 1TXDA 1W1DA 2K8EA 4CHJA 3AU5A 4CSQA 1UNPA 3TCAA 2VSZA 1OMWA 2D9VA 2UZRA 4KHOA 4WSFA 1P3RA 5FI0A 2AEHA 1XKEA 4ZRIA 2E2XA 1K5DB 4IAPA 3CXBB 2YVCA 3AJ4A 2KUPA 1I2HA 1H4RA 4YL8A 1MK7B 2RGNB 2ABDA 2DHKA 2OQBA 3A58A 3NW8A 1U5DA 2W2XC 1Y5OA 3CIKA 2YS5A 2ROVA 3MPXA 3NWAA 5M4YB 4ZRJA 2DHJA 4A6FA 2I1JA 2KCJA 4KHAA 3N7CA 4KVGB 1ACAA 1NTYA 1ST7A 1ZSQA 2COPA 1U5EA 1EAZA 4MK0A 1NU2A 3ODOA 5J3QA 3HSAA 2AL6A 4HB2B 2YS1A 3E66A 1Z87A 4PNKA 4HB3B 2I5FA 2N0YA 5DHAB 3IVFA 4K2OA 2P0HA 3ODXA 2DFKA 2D9ZA 5JLJB 2KR0A 3FP5A 4WVFB 3KRXA 2DHIA 3KSYA 3F0WA 1WGUA 2Z0QA 1FB8A 1PFJA 3AU4A 2GJYA 1KBLA 2DYQA 4HAUB 4HB4B 4HAXB 4QJ3B 3SBTA 3U12A 2D11A 1MIXA 1X05A 2R0DA 1ZM0A 2DX1A 5C16A 3ML4A 2MDXA 3SO6A 3SV1A 3SUZA 1BTNA 1AWEA 1MIZB 3U7DA 2FJLA 1QQGA 4HSIA 5KCVA 2P0FA 1V89A 5J3TA 3T06A 3NWFA 3A8QA 4P7IA 2ZPYA 4B6HA 2ELBA 4L6EA 4GOUA 3FLVA 2EMTA 3A98B 4DBBA 1UPRA 4JKGB 4HAZB 1AQCA 5DH9B 3PSCA 3FSSA 5J3YA 3HIEA 5D3YA 3HQCA 2GCJA 3TFMA 1J0WA 1HBKA 5D3VA 3P6AA 4F7GA 1UPQA 2G35A 2NBVA 3EPYA 5C79A 4JKCA 3PVWA 1FAOA 2YF0A 1WI1A 5EFXA 3HK0A 2CODA 3M1IB 2DIKA 2Z59A 4PQ0A 2CQUA 2MWNB 2Q13A 5IRSA 4ILGB 3BINA 1GC6A 5HE3A 4GZUA 4ZRKA 5DIFB 1ZVRA 4D0NB 2K00A 4JKEA 5CLLB 1SHCA 2IFSA 1MK9B 3PG7A 4NSWA 2V76A 2Z4DA 2D9YA 2KUQA 2D9XA 1XX0A 3RCPA 2HRJA 2YRYA 2MFQA 4Z2NA 2J0JA 3NSUA 3A8PA 4QXAB 1W1GA 1FHOA 1WG7A 3ULCA 3U8ZA 2UVMA 3QIJA 2Y8FA 5DI9B 2GS0A 3V5WA 2DKQA 5GOWB 4TKNA 4F7UP 1LB1A 2UZSA 4MY6A 2Z0OA 1WGQA 2FDQA 2KIGA 5JHGA 2RNRB 4DX8A 4JKGA 2GCLA 2OTXA 1ZC4B 2CAYA 1J19A 3O96A 4HDQA 1V61A 3DCXA 1MKEA 2KGXB 4A6KA 1FHWA 1N3HA 4IOYX 1DYNA 5D3WA 2VKIA 5HE1A 1K5GB 4JKBA 4Z2MB 2XQNM 5C5BB 1RRPB 1EF1A 3QWMA 4JK8A 1U5FA 2D2QA 2COCA 3LJUX 1XR0B 4CHMA 3MDBC 4ILJA 2DLWA 3BJIA 5IJMA 1X1GA 4GMXB 1WJMA 5C6RA 1Y19B 3P7ZA 2CRFA 2GUMA 5LOPB 4DXAB 2HTHB 2R2YA 2K49A 2I1KA 1UEFA 3SNHA 2LULA 1X11A 2Y7BA 1OY2A 1NVLA 3ENBA 3FVCA 5I2SA 1KZGA 1SGHA 1GC7A 5JVLA 4EJNA 1V5UA 2HE7A 2NZ8B 2YS3A 1M7EA 4L1RA 3ZVRA 3X23A 1TQZA 2BCJA 2EJ8A 5LG4B 1FGYA 4OT1A 4DX90 1ZYIA 1DDVA 4JKDA 1WJ1A 1U27A 3E9PA 2EC1A 2I5CA 4JK7A 5L81A 1I7AA 3TVVA 2JP2A 5CLQB 2Z0PA 1NI2A 2K2UA 4A6HA 2LYDA 2LBBA 2Y8GA 4JKHA 2QKMA 1ISNA 2EMSA 4JKFA 2DYNA 1P6SA 2P0DA 2LOZA 2KIEA 2D10A 2L2IA 2DA0A 1VBHA 2K2JA 4HATB 2ZKMX 1IRSA 2YSZA 1DBHA 5C5BA 2PZ1A 5DHFB 1W1HA 1BAKA 2RRFA 2CY4A 2RVBB 1DDWA 1MI1A 1KI1B 1P5TA 1XODA 2MKRA 3OANA 2RSGA 2R82A 3WA0A 4QJ4B 1HB8A 3UZTA 3VIAA 2CB8A 1BTKA 3F5RA 4XWXA 2J0MA 4K81A 4KHBB 1GGOA 4GPTB 5LONB 4JKAA 1PMSA 1QC6A 1FGZA 1NTVA 1X86A 3ULBA 5KQ4A 2H7DA 1U29A 4HAYB 3KZ1A 3DXEA 5KQ1A 4JK9A 1V88A 5JHHA 1B55A 4WJ7A 1MPHA 3PEGA 4HAWB 3PVLA 1E5WA 2YT1A 4OSNA 1VBGA 3OHMB 2M14A 1H10A 1XD4A 3WYFB 1ZC3B 2RLOA 1WVHA 2ADZA 4GN1A 2Z14A 1OQNA 1KZ7A 3PVUA 2CY5A 2IYBA 4KAXB 1UNQA 2J59M 2QKLA 1JDEA 4NY0A 1DDMA 2D9WA 3VOQA 4HHVA 5HE2A 4GXBA 4F7HA 3D8EA 1MAIA 2FJUB 1X1FA 2X18A 4HDOA 3FEHA 3KY9A 3TW1A 3DXCA 2P8VA 4HB0B 4GNKB 2VRWB 1XCGA 5JP4A 2RQ1A 2DKPA 3ZDTA 4BBKA 1U5GA 1M7RA 2YT0A 4A5KA 4H8SA 3PZDA 1PLSA 1FHXA 3NWDA 2ROZB 1T77A 4KHBA 3G9WA 3D8FA 4HAVB 2W2XD 2LOXA 1U2BA 2ELAA 1Q67A 5D27A 3QBVB 3GYOA 4GMVA 5FI1A 2DX5A 2NMBA 1BWNA 4ILHA 5I2MA 2M38A 4DIXA 2W2WA 2Z13A 1FOEA 3KRWA 4EMOA 1RJ2A 3SYXA 4A6FB 1GG3A 1NTIA
chains in the Genus database with same CATH topology
4YONA 3PP2A 3DXDA 1TJ6A 3D8DA 2DTCA 2DN6A 3E9LA 3GYPA 1V5PA 3HW2B 2RUKB 3E9OA 1EVHA 2COAA 5D3XA 2J0KA 3ODWA 2D4QA 1LW3A 3FM8C 1DIKA 4CYEA 1DROA 4TYZA 5HE0A 1UNRA 3SBGA 4C0AA 2COFA 2R09A 4IFSA 2H7EA 4MT7A 4EKUA 3TO1A 2WH5A 2LKOA 2X0SA 1HB6A 4Y94A 1EGXA 2N23A 1V5MA 2LG1A 2FJ9A 2L1CA 4K2PA 1KC7A 4K17A 1TXDA 1W1DA 4CHJA 3AU5A 1UNPA 3TCAA 2VSZA 1OMWA 2D9VA 2UZRA 4KHOA 4WSFA 1P3RA 5FI0A 2AEHA 1XKEA 4ZRIA 2E2XA 1K5DB 4IAPA 3CXBB 2YVCA 3AJ4A 2KUPA 1I2HA 1H4RA 4YL8A 1MK7B 2RGNB 2ABDA 2DHKA 2OQBA 1U5DA 2W2XC 1Y5OA 3CIKA 2YS5A 2ROVA 3MPXA 4ZRJA 2DHJA 4A6FA 2I1JA 2KCJA 4KHAA 3N7CA 4KVGB 1ACAA 1NTYA 1ST7A 1ZSQA 2COPA 1U5EA 1EAZA 4MK0A 1NU2A 3ODOA 5J3QA 2AL6A 4HB2B 2YS1A 3E66A 1Z87A 4PNKA 4HB3B 2I5FA 2N0YA 5DHAB 3IVFA 4K2OA 2P0HA 3ODXA 2DFKA 2D9ZA 5JLJB 3FP5A 4WVFB 3KRXA 2DHIA 3KSYA 3F0WA 1WGUA 2Z0QA 1FB8A 1PFJA 3AU4A 2GJYA 1KBLA 2DYQA 4HAUB 4HB4B 4HAXB 3SBTA 2D11A 1MIXA 1X05A 2R0DA 1ZM0A 2DX1A 5C16A 3ML4A 2MDXA 3SO6A 3SV1A 3SUZA 1BTNA 1AWEA 1MIZB 3U7DA 2FJLA 1QQGA 5KCVA 2P0FA 1V89A 5J3TA 3T06A 3A8QA 4P7IA 2ZPYA 4B6HA 2ELBA 4L6EA 3FLVA 2EMTA 3A98B 4DBBA 1UPRA 4JKGB 4HAZB 1AQCA 5DH9B 3PSCA 3FSSA 5J3YA 5D3YA 3HQCA 2GCJA 3TFMA 1J0WA 1HBKA 5D3VA 3P6AA 4F7GA 1UPQA 2G35A 3EPYA 5C79A 4JKCA 3PVWA 1FAOA 2YF0A 1WI1A 5EFXA 3HK0A 2CODA 3M1IB 2DIKA 4PQ0A 2CQUA 2MWNB 2Q13A 4ILGB 3BINA 1GC6A 5HE3A 4GZUA 4ZRKA 5DIFB 1ZVRA 4D0NB 2K00A 4JKEA 5CLLB 1SHCA 2IFSA 1MK9B 3PG7A 4NSWA 2V76A 2D9YA 2D9XA 1XX0A 3RCPA 2HRJA 2YRYA 2MFQA 4Z2NA 2J0JA 3NSUA 3A8PA 1W1GA 1FHOA 1WG7A 3ULCA 3U8ZA 2UVMA 3QIJA 2Y8FA 5DI9B 2GS0A 3V5WA 2DKQA 5GOWB 4TKNA 4F7UP 1LB1A 2UZSA 4MY6A 2Z0OA 1WGQA 2FDQA 5JHGA 2RNRB 4DX8A 4JKGA 2GCLA 2OTXA 1ZC4B 2CAYA 1J19A 3O96A 4HDQA 1V61A 1MKEA 2KGXB 4A6KA 1FHWA 1N3HA 4IOYX 1DYNA 5D3WA 2VKIA 5HE1A 1K5GB 4JKBA 4Z2MB 2XQNM 5C5BB 1RRPB 1EF1A 3QWMA 4JK8A 1U5FA 2D2QA 2COCA 3LJUX 1XR0B 4CHMA 3MDBC 4ILJA 2DLWA 3BJIA 5IJMA 1X1GA 4GMXB 1WJMA 5C6RA 1Y19B 3P7ZA 2CRFA 5LOPB 4DXAB 2HTHB 2I1KA 1UEFA 3SNHA 2LULA 1X11A 2Y7BA 1OY2A 1NVLA 3ENBA 1KZGA 1SGHA 1GC7A 5JVLA 4EJNA 1V5UA 2HE7A 2NZ8B 2YS3A 1M7EA 3ZVRA 3X23A 1TQZA 2BCJA 2EJ8A 1FGYA 4DX90 1DDVA 4JKDA 1WJ1A 1U27A 3E9PA 2EC1A 2I5CA 4JK7A 5L81A 1I7AA 3TVVA 2JP2A 5CLQB 2Z0PA 1NI2A 2K2UA 4A6HA 2LYDA 2LBBA 2Y8GA 4JKHA 2QKMA 1ISNA 2EMSA 4JKFA 2DYNA 1P6SA 2P0DA 2LOZA 2L2IA 2D10A 2DA0A 1VBHA 2K2JA 4HATB 1IRSA 2YSZA 1DBHA 5C5BA 2PZ1A 5DHFB 1W1HA 1BAKA 2CY4A 2RVBB 1DDWA 1KI1B 1P5TA 1XODA 2MKRA 3OANA 2RSGA 2R82A 3WA0A 1HB8A 3UZTA 3VIAA 2CB8A 1BTKA 3F5RA 4XWXA 2J0MA 4K81A 4KHBB 1GGOA 4GPTB 5LONB 4JKAA 1PMSA 1QC6A 1FGZA 1NTVA 1X86A 3ULBA 5KQ4A 2H7DA 1U29A 4HAYB 3KZ1A 3DXEA 5KQ1A 4JK9A 1V88A 5JHHA 1B55A 4WJ7A 1MPHA 3PEGA 4HAWB 3PVLA 1E5WA 2YT1A 1VBGA 2M14A 1H10A 1XD4A 3WYFB 1ZC3B 2RLOA 1WVHA 2ADZA 4GN1A 1OQNA 1KZ7A 3PVUA 2CY5A 2IYBA 4KAXB 1UNQA 2J59M 2QKLA 1JDEA 4NY0A 1DDMA 2D9WA 3VOQA 4HHVA 5HE2A 4GXBA 4F7HA 3D8EA 1MAIA 1X1FA 2X18A 4HDOA 3FEHA 3KY9A 3TW1A 3DXCA 2P8VA 4HB0B 2VRWB 1XCGA 5JP4A 2RQ1A 2DKPA 3ZDTA 4BBKA 1U5GA 1M7RA 2YT0A 4A5KA 4H8SA 3PZDA 1PLSA 1FHXA 2ROZB 3G9WA 3D8FA 4HAVB 2W2XD 2LOXA 1U2BA 2ELAA 1Q67A 5D27A 3QBVB 3GYOA 4GMVA 5FI1A 2DX5A 2NMBA 1BWNA 4ILHA 2M38A 2W2WA 1FOEA 3KRWA 4EMOA 1RJ2A 3SYXA 4A6FB 1GG3A 1NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YON A;  3PP2 A;  3DXD A;  1TJ6 A;  3D8D A;  2DTC A;  2DN6 A;  3GYP A;  1V5P A;  3HW2 B;  2RUK B;  1EVH A;  2COA A;  5D3X A;  2J0K A;  3ODW A;  2D4Q A;  1LW3 A;  3FM8 C;  4CYE A;  1DRO A;  4TYZ A;  5HE0 A;  1UNR A;  4C0A A;  2COF A;  2R09 A;  4IFS A;  2H7E A;  4MT7 A;  4EKU A;  3TO1 A;  2WH5 A;  2LKO A;  1HB6 A;  4Y94 A;  1EGX A;  2N23 A;  1V5M A;  2LG1 A;  2FJ9 A;  2L1C A;  4K2P A;  4K17 A;  1TXD A;  1W1D A;  4CHJ A;  3AU5 A;  1UNP A;  3TCA A;  2VSZ A;  1OMW A;  2D9V A;  2UZR A;  4KHO A;  4WSF A;  1P3R A;  5FI0 A;  2AEH A;  1XKE A;  4ZRI A;  2E2X A;  1K5D B;  4IAP A;  3CXB B;  2YVC A;  3AJ4 A;  2KUP A;  1I2H A;  1H4R A;  4YL8 A;  1MK7 B;  2RGN B;  2ABD A;  2DHK A;  2OQB A;  1U5D A;  2W2X C;  1Y5O A;  3CIK A;  2YS5 A;  2ROV A;  3MPX A;  4ZRJ A;  2DHJ A;  4A6F A;  2I1J A;  2KCJ A;  4KHA A;  3N7C A;  4KVG B;  1ACA A;  1NTY A;  1ST7 A;  1ZSQ A;  2COP A;  1U5E A;  1EAZ A;  4MK0 A;  1NU2 A;  3ODO A;  5J3Q A;  2AL6 A;  4HB2 B;  2YS1 A;  1Z87 A;  4PNK A;  4HB3 B;  2I5F A;  2N0Y A;  5DHA B;  3IVF A;  4K2O A;  2P0H A;  3ODX A;  2DFK A;  2D9Z A;  5JLJ B;  3FP5 A;  4WVF B;  3KRX A;  2DHI A;  3KSY A;  3F0W A;  1WGU A;  2Z0Q A;  1FB8 A;  1PFJ A;  3AU4 A;  2GJY A;  2DYQ A;  4HAU B;  4HB4 B;  4HAX B;  2D11 A;  1MIX A;  1X05 A;  2R0D A;  1ZM0 A;  2DX1 A;  5C16 A;  3ML4 A;  2MDX A;  3SO6 A;  3SV1 A;  3SUZ A;  1BTN A;  1AWE A;  1MIZ B;  3U7D A;  2FJL A;  1QQG A;  5KCV A;  2P0F A;  1V89 A;  5J3T A;  3T06 A;  3A8Q A;  4P7I A;  2ZPY A;  4B6H A;  2ELB A;  4L6E A;  3FLV A;  2EMT A;  3A98 B;  4DBB A;  1UPR A;  4HAZ B;  1AQC A;  5DH9 B;  3PSC A;  3FSS A;  5J3Y A;  5D3Y A;  3HQC A;  2GCJ A;  3TFM A;  1J0W A;  1HBK A;  5D3V A;  3P6A A;  4F7G A;  1UPQ A;  2G35 A;  3EPY A;  5C79 A;  3PVW A;  1FAO A;  2YF0 A;  1WI1 A;  5EFX A;  3HK0 A;  2COD A;  3M1I B;  4PQ0 A;  2CQU A;  2MWN B;  2Q13 A;  3BIN A;  1GC6 A;  5HE3 A;  4GZU A;  4ZRK A;  5DIF B;  1ZVR A;  4D0N B;  2K00 A;  5CLL B;  1SHC A;  2IFS A;  1MK9 B;  3PG7 A;  4NSW A;  2V76 A;  2D9Y A;  2D9X A;  1XX0 A;  3RCP A;  2HRJ A;  2YRY A;  2MFQ A;  4Z2N A;  2J0J A;  3NSU A;  3A8P A;  1W1G A;  1FHO A;  1WG7 A;  3ULC A;  3U8Z A;  2UVM A;  3QIJ A;  2Y8F A;  5DI9 B;  2GS0 A;  3V5W A;  2DKQ A;  5GOW B;  4TKN A;  4F7U P;  1LB1 A;  2UZS A;  4MY6 A;  2Z0O A;  1WGQ A;  2FDQ A;  5JHG A;  2RNR B;  4DX8 A;  2GCL A;  2OTX A;  1ZC4 B;  2CAY A;  1J19 A;  3O96 A;  4HDQ A;  1V61 A;  1MKE A;  2KGX B;  4A6K A;  1FHW A;  1N3H A;  4IOY X;  1DYN A;  5D3W A;  2VKI A;  5HE1 A;  1K5G B;  4Z2M B;  5C5B B;  2XQN M;  1RRP B;  1EF1 A;  3QWM A;  1U5F A;  2D2Q A;  2COC A;  3LJU X;  1XR0 B;  4CHM A;  3MDB C;  2DLW A;  3BJI A;  5IJM A;  1X1G A;  4GMX B;  1WJM A;  5C6R A;  1Y19 B;  3P7Z A;  2CRF A;  5LOP B;  4DXA B;  2HTH B;  2I1K A;  1UEF A;  3SNH A;  2LUL A;  1X11 A;  2Y7B A;  1OY2 A;  1NVL A;  1KZG A;  1SGH A;  1GC7 A;  4EJN A;  1V5U A;  2HE7 A;  2NZ8 B;  2YS3 A;  1M7E A;  3ZVR A;  3X23 A;  1TQZ A;  2BCJ A;  2EJ8 A;  1FGY A;  4DX9 0;  1DDV A;  1WJ1 A;  1U27 A;  2EC1 A;  2I5C A;  5L81 A;  1I7A A;  3TVV A;  2JP2 A;  5CLQ B;  2Z0P A;  1NI2 A;  2K2U A;  4A6H A;  2LYD A;  2LBB A;  2Y8G A;  2QKM A;  1ISN A;  2EMS A;  2DYN A;  1P6S A;  2P0D A;  2LOZ A;  2L2I A;  2D10 A;  2DA0 A;  2K2J A;  4HAT B;  2YSZ A;  1IRS A;  1DBH A;  5C5B A;  2PZ1 A;  5DHF B;  1W1H A;  1BAK A;  2CY4 A;  2RVB B;  1DDW A;  1KI1 B;  1P5T A;  1XOD A;  2MKR A;  3OAN A;  2RSG A;  3WA0 A;  1HB8 A;  3UZT A;  3VIA A;  2CB8 A;  1BTK A;  3F5R A;  4XWX A;  2J0M A;  4K81 A;  4KHB B;  4GPT B;  5LON B;  1PMS A;  1QC6 A;  1FGZ A;  1NTV A;  1X86 A;  3ULB A;  5KQ4 A;  2H7D A;  1U29 A;  4HAY B;  3KZ1 A;  3DXE A;  5KQ1 A;  1V88 A;  5JHH A;  1B55 A;  4WJ7 A;  1MPH A;  3PEG A;  4HAW B;  3PVL A;  1E5W A;  2YT1 A;  2M14 A;  1H10 A;  1XD4 A;  3WYF B;  1ZC3 B;  2RLO A;  1WVH A;  2ADZ A;  4GN1 A;  1OQN A;  1KZ7 A;  3PVU A;  2CY5 A;  2IYB A;  4KAX B;  1UNQ A;  2J59 M;  2QKL A;  4NY0 A;  1DDM A;  2D9W A;  3VOQ A;  4HHV A;  5HE2 A;  4GXB A;  4F7H A;  3D8E A;  1MAI A;  1X1F A;  2X18 A;  4HDO A;  3FEH A;  3KY9 A;  3TW1 A;  3DXC A;  2P8V A;  4HB0 B;  2VRW B;  1XCG A;  5JP4 A;  2RQ1 A;  2DKP A;  3ZDT A;  4BBK A;  1U5G A;  1M7R A;  2YT0 A;  4A5K A;  4H8S A;  3PZD A;  1PLS A;  1FHX A;  2ROZ B;  3G9W A;  3D8F A;  4HAV B;  2W2X D;  2LOX A;  1U2B A;  2ELA A;  1Q67 A;  5D27 A;  3QBV B;  3GYO A;  4GMV A;  5FI1 A;  2DX5 A;  2NMB A;  1BWN A;  2M38 A;  2W2W A;  1FOE A;  3KRW A;  4EMO A;  1RJ2 A;  3SYX A;  4A6F B;  1GG3 A;  1NTI A; 
#chains in the Genus database with same CATH topology
 4YON A;  3PP2 A;  3DXD A;  1TJ6 A;  3B77 A;  3D8D A;  2DTC A;  2DN6 A;  3E9L A;  3GYP A;  1V5P A;  3HW2 B;  2RUK B;  3E9O A;  1EVH A;  2COA A;  2YT2 A;  5D3X A;  2J0K A;  3ODW A;  2D4Q A;  1LW3 A;  3FM8 C;  1DIK A;  4CYE A;  1DRO A;  4TYZ A;  5HE0 A;  1UNR A;  3SBG A;  4C0A A;  2COF A;  2R09 A;  4IFS A;  2H7E A;  4MT7 A;  4EKU A;  3TO1 A;  2WH5 A;  2LKO A;  2X0S A;  1HB6 A;  4Y94 A;  1EGX A;  4QJ5 B;  2N23 A;  1V5M A;  2LG1 A;  2FJ9 A;  4D6W A;  2L1C A;  4K2P A;  1KC7 A;  4K17 A;  1TXD A;  1W1D A;  2K8E A;  4CHJ A;  3AU5 A;  4CSQ A;  1UNP A;  3TCA A;  2VSZ A;  1OMW A;  2D9V A;  2UZR A;  4KHO A;  4WSF A;  1P3R A;  5FI0 A;  2AEH A;  1XKE A;  4ZRI A;  2E2X A;  1K5D B;  4IAP A;  3CXB B;  2YVC A;  3AJ4 A;  2KUP A;  1I2H A;  1H4R A;  4YL8 A;  1MK7 B;  2RGN B;  2ABD A;  2DHK A;  2OQB A;  3A58 A;  3NW8 A;  1U5D A;  2W2X C;  1Y5O A;  3CIK A;  2YS5 A;  2ROV A;  3MPX A;  3NWA A;  5M4Y B;  4ZRJ A;  2DHJ A;  4A6F A;  2I1J A;  2KCJ A;  4KHA A;  3N7C A;  4KVG B;  1ACA A;  1NTY A;  1ST7 A;  1ZSQ A;  2COP A;  1U5E A;  1EAZ A;  4MK0 A;  1NU2 A;  3ODO A;  5J3Q A;  3HSA A;  2AL6 A;  4HB2 B;  2YS1 A;  3E66 A;  1Z87 A;  4PNK A;  4HB3 B;  2I5F A;  2N0Y A;  5DHA B;  3IVF A;  4K2O A;  2P0H A;  3ODX A;  2DFK A;  2D9Z A;  5JLJ B;  2KR0 A;  3FP5 A;  4WVF B;  3KRX A;  2DHI A;  3KSY A;  3F0W A;  1WGU A;  2Z0Q A;  1FB8 A;  1PFJ A;  3AU4 A;  2GJY A;  1KBL A;  2DYQ A;  4HAU B;  4HB4 B;  4HAX B;  4QJ3 B;  3SBT A;  3U12 A;  2D11 A;  1MIX A;  1X05 A;  2R0D A;  1ZM0 A;  2DX1 A;  5C16 A;  3ML4 A;  2MDX A;  3SO6 A;  3SV1 A;  3SUZ A;  1BTN A;  1AWE A;  1MIZ B;  3U7D A;  2FJL A;  1QQG A;  4HSI A;  5KCV A;  2P0F A;  1V89 A;  5J3T A;  3T06 A;  3NWF A;  3A8Q A;  4P7I A;  2ZPY A;  4B6H A;  2ELB A;  4L6E A;  4GOU A;  3FLV A;  2EMT A;  3A98 B;  4DBB A;  1UPR A;  4JKG B;  4HAZ B;  1AQC A;  5DH9 B;  3PSC A;  3FSS A;  5J3Y A;  3HIE A;  5D3Y A;  3HQC A;  2GCJ A;  3TFM A;  1J0W A;  1HBK A;  5D3V A;  3P6A A;  4F7G A;  1UPQ A;  2G35 A;  2NBV A;  3EPY A;  5C79 A;  4JKC A;  3PVW A;  1FAO A;  2YF0 A;  1WI1 A;  5EFX A;  3HK0 A;  2COD A;  3M1I B;  2DIK A;  2Z59 A;  4PQ0 A;  2CQU A;  2MWN B;  2Q13 A;  5IRS A;  4ILG B;  3BIN A;  1GC6 A;  5HE3 A;  4GZU A;  4ZRK A;  5DIF B;  1ZVR A;  4D0N B;  2K00 A;  4JKE A;  5CLL B;  1SHC A;  2IFS A;  1MK9 B;  3PG7 A;  4NSW A;  2V76 A;  2Z4D A;  2D9Y A;  2KUQ A;  2D9X A;  1XX0 A;  3RCP A;  2HRJ A;  2YRY A;  2MFQ A;  4Z2N A;  2J0J A;  3NSU A;  3A8P A;  4QXA B;  1W1G A;  1FHO A;  1WG7 A;  3ULC A;  3U8Z A;  2UVM A;  3QIJ A;  2Y8F A;  5DI9 B;  2GS0 A;  3V5W A;  2DKQ A;  5GOW B;  4TKN A;  4F7U P;  1LB1 A;  2UZS A;  4MY6 A;  2Z0O A;  1WGQ A;  2FDQ A;  2KIG A;  5JHG A;  2RNR B;  4DX8 A;  4JKG A;  2GCL A;  2OTX A;  1ZC4 B;  2CAY A;  1J19 A;  3O96 A;  4HDQ A;  1V61 A;  3DCX A;  1MKE A;  2KGX B;  4A6K A;  1FHW A;  1N3H A;  4IOY X;  1DYN A;  5D3W A;  2VKI A;  5HE1 A;  1K5G B;  4JKB A;  4Z2M B;  2XQN M;  5C5B B;  1RRP B;  1EF1 A;  3QWM A;  4JK8 A;  1U5F A;  2D2Q A;  2COC A;  3LJU X;  1XR0 B;  4CHM A;  3MDB C;  4ILJ A;  2DLW A;  3BJI A;  5IJM A;  1X1G A;  4GMX B;  1WJM A;  5C6R A;  1Y19 B;  3P7Z A;  2CRF A;  2GUM A;  5LOP B;  4DXA B;  2HTH B;  2R2Y A;  2K49 A;  2I1K A;  1UEF A;  3SNH A;  2LUL A;  1X11 A;  2Y7B A;  1OY2 A;  1NVL A;  3ENB A;  3FVC A;  5I2S A;  1KZG A;  1SGH A;  1GC7 A;  5JVL A;  4EJN A;  1V5U A;  2HE7 A;  2NZ8 B;  2YS3 A;  1M7E A;  4L1R A;  3ZVR A;  3X23 A;  1TQZ A;  2BCJ A;  2EJ8 A;  5LG4 B;  1FGY A;  4OT1 A;  4DX9 0;  1ZYI A;  1DDV A;  4JKD A;  1WJ1 A;  1U27 A;  3E9P A;  2EC1 A;  2I5C A;  4JK7 A;  5L81 A;  1I7A A;  3TVV A;  2JP2 A;  5CLQ B;  2Z0P A;  1NI2 A;  2K2U A;  4A6H A;  2LYD A;  2LBB A;  2Y8G A;  4JKH A;  2QKM A;  1ISN A;  2EMS A;  4JKF A;  2DYN A;  1P6S A;  2P0D A;  2LOZ A;  2KIE A;  2D10 A;  2L2I A;  2DA0 A;  1VBH A;  2K2J A;  4HAT B;  2ZKM X;  1IRS A;  2YSZ A;  1DBH A;  5C5B A;  2PZ1 A;  5DHF B;  1W1H A;  1BAK A;  2RRF A;  2CY4 A;  2RVB B;  1DDW A;  1MI1 A;  1KI1 B;  1P5T A;  1XOD A;  2MKR A;  3OAN A;  2RSG A;  2R82 A;  3WA0 A;  4QJ4 B;  1HB8 A;  3UZT A;  3VIA A;  2CB8 A;  1BTK A;  3F5R A;  4XWX A;  2J0M A;  4K81 A;  4KHB B;  1GGO A;  4GPT B;  5LON B;  4JKA A;  1PMS A;  1QC6 A;  1FGZ A;  1NTV A;  1X86 A;  3ULB A;  5KQ4 A;  2H7D A;  1U29 A;  4HAY B;  3KZ1 A;  3DXE A;  5KQ1 A;  4JK9 A;  1V88 A;  5JHH A;  1B55 A;  4WJ7 A;  1MPH A;  3PEG A;  4HAW B;  3PVL A;  1E5W A;  2YT1 A;  4OSN A;  1VBG A;  3OHM B;  2M14 A;  1H10 A;  1XD4 A;  3WYF B;  1ZC3 B;  2RLO A;  1WVH A;  2ADZ A;  4GN1 A;  2Z14 A;  1OQN A;  1KZ7 A;  3PVU A;  2CY5 A;  2IYB A;  4KAX B;  1UNQ A;  2J59 M;  2QKL A;  1JDE A;  4NY0 A;  1DDM A;  2D9W A;  3VOQ A;  4HHV A;  5HE2 A;  4GXB A;  4F7H A;  3D8E A;  1MAI A;  2FJU B;  1X1F A;  2X18 A;  4HDO A;  3FEH A;  3KY9 A;  3TW1 A;  3DXC A;  2P8V A;  4HB0 B;  4GNK B;  2VRW B;  1XCG A;  5JP4 A;  2RQ1 A;  2DKP A;  3ZDT A;  4BBK A;  1U5G A;  1M7R A;  2YT0 A;  4A5K A;  4H8S A;  3PZD A;  1PLS A;  1FHX A;  3NWD A;  2ROZ B;  1T77 A;  4KHB A;  3G9W A;  3D8F A;  4HAV B;  2W2X D;  2LOX A;  1U2B A;  2ELA A;  1Q67 A;  5D27 A;  3QBV B;  3GYO A;  4GMV A;  5FI1 A;  2DX5 A;  2NMB A;  1BWN A;  4ILH A;  5I2M A;  2M38 A;  4DIX A;  2W2W A;  2Z13 A;  1FOE A;  3KRW A;  4EMO A;  1RJ2 A;  3SYX A;  4A6F B;  1GG3 A;  1NTI A; 
#chains in the Genus database with same CATH homology
 4YON A;  3PP2 A;  3DXD A;  1TJ6 A;  3D8D A;  2DTC A;  2DN6 A;  3E9L A;  3GYP A;  1V5P A;  3HW2 B;  2RUK B;  3E9O A;  1EVH A;  2COA A;  5D3X A;  2J0K A;  3ODW A;  2D4Q A;  1LW3 A;  3FM8 C;  1DIK A;  4CYE A;  1DRO A;  4TYZ A;  5HE0 A;  1UNR A;  3SBG A;  4C0A A;  2COF A;  2R09 A;  4IFS A;  2H7E A;  4MT7 A;  4EKU A;  3TO1 A;  2WH5 A;  2LKO A;  2X0S A;  1HB6 A;  4Y94 A;  1EGX A;  2N23 A;  1V5M A;  2LG1 A;  2FJ9 A;  2L1C A;  4K2P A;  1KC7 A;  4K17 A;  1TXD A;  1W1D A;  4CHJ A;  3AU5 A;  1UNP A;  3TCA A;  2VSZ A;  1OMW A;  2D9V A;  2UZR A;  4KHO A;  4WSF A;  1P3R A;  5FI0 A;  2AEH A;  1XKE A;  4ZRI A;  2E2X A;  1K5D B;  4IAP A;  3CXB B;  2YVC A;  3AJ4 A;  2KUP A;  1I2H A;  1H4R A;  4YL8 A;  1MK7 B;  2RGN B;  2ABD A;  2DHK A;  2OQB A;  1U5D A;  2W2X C;  1Y5O A;  3CIK A;  2YS5 A;  2ROV A;  3MPX A;  4ZRJ A;  2DHJ A;  4A6F A;  2I1J A;  2KCJ A;  4KHA A;  3N7C A;  4KVG B;  1ACA A;  1NTY A;  1ST7 A;  1ZSQ A;  2COP A;  1U5E A;  1EAZ A;  4MK0 A;  1NU2 A;  3ODO A;  5J3Q A;  2AL6 A;  4HB2 B;  2YS1 A;  3E66 A;  1Z87 A;  4PNK A;  4HB3 B;  2I5F A;  2N0Y A;  5DHA B;  3IVF A;  4K2O A;  2P0H A;  3ODX A;  2DFK A;  2D9Z A;  5JLJ B;  3FP5 A;  4WVF B;  3KRX A;  2DHI A;  3KSY A;  3F0W A;  1WGU A;  2Z0Q A;  1FB8 A;  1PFJ A;  3AU4 A;  2GJY A;  1KBL A;  2DYQ A;  4HAU B;  4HB4 B;  4HAX B;  3SBT A;  2D11 A;  1MIX A;  1X05 A;  2R0D A;  1ZM0 A;  2DX1 A;  5C16 A;  3ML4 A;  2MDX A;  3SO6 A;  3SV1 A;  3SUZ A;  1BTN A;  1AWE A;  1MIZ B;  3U7D A;  2FJL A;  1QQG A;  5KCV A;  2P0F A;  1V89 A;  5J3T A;  3T06 A;  3A8Q A;  4P7I A;  2ZPY A;  4B6H A;  2ELB A;  4L6E A;  3FLV A;  2EMT A;  3A98 B;  4DBB A;  1UPR A;  4JKG B;  4HAZ B;  1AQC A;  5DH9 B;  3PSC A;  3FSS A;  5J3Y A;  5D3Y A;  3HQC A;  2GCJ A;  3TFM A;  1J0W A;  1HBK A;  5D3V A;  3P6A A;  4F7G A;  1UPQ A;  2G35 A;  3EPY A;  5C79 A;  4JKC A;  3PVW A;  1FAO A;  2YF0 A;  1WI1 A;  5EFX A;  3HK0 A;  2COD A;  3M1I B;  2DIK A;  4PQ0 A;  2CQU A;  2MWN B;  2Q13 A;  4ILG B;  3BIN A;  1GC6 A;  5HE3 A;  4GZU A;  4ZRK A;  5DIF B;  1ZVR A;  4D0N B;  2K00 A;  4JKE A;  5CLL B;  1SHC A;  2IFS A;  1MK9 B;  3PG7 A;  4NSW A;  2V76 A;  2D9Y A;  2D9X A;  1XX0 A;  3RCP A;  2HRJ A;  2YRY A;  2MFQ A;  4Z2N A;  2J0J A;  3NSU A;  3A8P A;  1W1G A;  1FHO A;  1WG7 A;  3ULC A;  3U8Z A;  2UVM A;  3QIJ A;  2Y8F A;  5DI9 B;  2GS0 A;  3V5W A;  2DKQ A;  5GOW B;  4TKN A;  4F7U P;  1LB1 A;  2UZS A;  4MY6 A;  2Z0O A;  1WGQ A;  2FDQ A;  5JHG A;  2RNR B;  4DX8 A;  4JKG A;  2GCL A;  2OTX A;  1ZC4 B;  2CAY A;  1J19 A;  3O96 A;  4HDQ A;  1V61 A;  1MKE A;  2KGX B;  4A6K A;  1FHW A;  1N3H A;  4IOY X;  1DYN A;  5D3W A;  2VKI A;  5HE1 A;  1K5G B;  4JKB A;  4Z2M B;  2XQN M;  5C5B B;  1RRP B;  1EF1 A;  3QWM A;  4JK8 A;  1U5F A;  2D2Q A;  2COC A;  3LJU X;  1XR0 B;  4CHM A;  3MDB C;  4ILJ A;  2DLW A;  3BJI A;  5IJM A;  1X1G A;  4GMX B;  1WJM A;  5C6R A;  1Y19 B;  3P7Z A;  2CRF A;  5LOP B;  4DXA B;  2HTH B;  2I1K A;  1UEF A;  3SNH A;  2LUL A;  1X11 A;  2Y7B A;  1OY2 A;  1NVL A;  3ENB A;  1KZG A;  1SGH A;  1GC7 A;  5JVL A;  4EJN A;  1V5U A;  2HE7 A;  2NZ8 B;  2YS3 A;  1M7E A;  3ZVR A;  3X23 A;  1TQZ A;  2BCJ A;  2EJ8 A;  1FGY A;  4DX9 0;  1DDV A;  4JKD A;  1WJ1 A;  1U27 A;  3E9P A;  2EC1 A;  2I5C A;  4JK7 A;  5L81 A;  1I7A A;  3TVV A;  2JP2 A;  5CLQ B;  2Z0P A;  1NI2 A;  2K2U A;  4A6H A;  2LYD A;  2LBB A;  2Y8G A;  4JKH A;  2QKM A;  1ISN A;  2EMS A;  4JKF A;  2DYN A;  1P6S A;  2P0D A;  2LOZ A;  2L2I A;  2D10 A;  2DA0 A;  1VBH A;  2K2J A;  4HAT B;  1IRS A;  2YSZ A;  1DBH A;  5C5B A;  2PZ1 A;  5DHF B;  1W1H A;  1BAK A;  2CY4 A;  2RVB B;  1DDW A;  1KI1 B;  1P5T A;  1XOD A;  2MKR A;  3OAN A;  2RSG A;  2R82 A;  3WA0 A;  1HB8 A;  3UZT A;  3VIA A;  2CB8 A;  1BTK A;  3F5R A;  4XWX A;  2J0M A;  4K81 A;  4KHB B;  1GGO A;  4GPT B;  5LON B;  4JKA A;  1PMS A;  1QC6 A;  1FGZ A;  1NTV A;  1X86 A;  3ULB A;  5KQ4 A;  2H7D A;  1U29 A;  4HAY B;  3KZ1 A;  3DXE A;  5KQ1 A;  4JK9 A;  1V88 A;  5JHH A;  1B55 A;  4WJ7 A;  1MPH A;  3PEG A;  4HAW B;  3PVL A;  1E5W A;  2YT1 A;  1VBG A;  2M14 A;  1H10 A;  1XD4 A;  3WYF B;  1ZC3 B;  2RLO A;  1WVH A;  2ADZ A;  4GN1 A;  1OQN A;  1KZ7 A;  3PVU A;  2CY5 A;  2IYB A;  4KAX B;  1UNQ A;  2J59 M;  2QKL A;  1JDE A;  4NY0 A;  1DDM A;  2D9W A;  3VOQ A;  4HHV A;  5HE2 A;  4GXB A;  4F7H A;  3D8E A;  1MAI A;  1X1F A;  2X18 A;  4HDO A;  3FEH A;  3KY9 A;  3TW1 A;  3DXC A;  2P8V A;  4HB0 B;  2VRW B;  1XCG A;  5JP4 A;  2RQ1 A;  2DKP A;  3ZDT A;  4BBK A;  1U5G A;  1M7R A;  2YT0 A;  4A5K A;  4H8S A;  3PZD A;  1PLS A;  1FHX A;  2ROZ B;  3G9W A;  3D8F A;  4HAV B;  2W2X D;  2LOX A;  1U2B A;  2ELA A;  1Q67 A;  5D27 A;  3QBV B;  3GYO A;  4GMV A;  5FI1 A;  2DX5 A;  2NMB A;  1BWN A;  4ILH A;  2M38 A;  2W2W A;  1FOE A;  3KRW A;  4EMO A;  1RJ2 A;  3SYX A;  4A6F B;  1GG3 A;  1NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...