1MK9B

Crystal structure of an integrin beta3-talin chimera
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
187
Chain Sequence
b'PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 54
structure length 187
sequence length 190
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk9B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk9B02
2D2QA 2LYDA 4A6FA 4NSWA 2YVCA 1ST7A 1FHWA 5JHHA 2RQ1A 1XCGA 2L1CA 2HTHB 2AL6A 2IFSA 1X05A 1WI1A 1Z87A 1IRSA 5EFXA 1BWNA 3SYXA 2ROZB 2DFKA 2RUKB 2Z0QA 5C5BA 4KVGB 4GXBA 3PG7A 2ELAA 3M1IB 1TXDA 2MDXA 4DXAB 1DYNA 3LJUX 2EMSA 1MAIA 3FEHA 1W1GA 5DHAB 1WVHA 3DXDA 3X23A 2YRYA 5J3YA 3SNHA 4HAWB 1WJMA 3TCAA 4A6KA 5D27A 1ZSQA 5J3QA 4HAYB 3WYFB 2CAYA 3TO1A 4WVFB 1I2HA 3PEGA 3ML4A 3ODXA 2K2JA 1X11A 2CY4A 5KCVA 1U5EA 3MPXA 1U29A 5LOPB 1V5PA 4D0NB 1EVHA 1N3HA 2YT0A 3QBVB 2M38A 2UZSA 1GC7A 2JP2A 3BJIA 5FI0A 1BTKA 3RCPA 2P0DA 5J3TA 1V61A 1UNRA 1DDWA 2D9YA 2RGNB 1MKEA 1DDVA 4K2PA 3DXEA 4B6HA 4F7HA 1QC6A 4EKUA 4DX8A 3P7ZA 2P0HA 1GC6A 3QWMA 4YL8A 1Q67A 2YT1A 3ULBA 3U8ZA 2COPA 1OY2A 3SV1A 4HB3B 2CB8A 2L2IA 2H7DA 3AU5A 2YSZA 2N23A 1FOEA 2NMBA 4IAPA 1PFJA 2LKOA 1EF1A 1MK7B 1QQGA 5JHGA 2DHJA 2FJLA 1KZGA 3ODWA 2ELBA 4Z2MB 4DBBA 1DDMA 1Y19B 4HB4B 2EMTA 1FGZA 2D10A 1NTVA 2CY5A 4GMVA 5C16A 5C79A 2KGXB 1W1DA 1X1GA 2ADZA 3F0WA 3CIKA 2COCA 1J0WA 2D9VA 5C5BB 1XODA 5CLLB 2D11A 4WJ7A 1U2BA 5CLQB 2R0DA 1WG7A 2VSZA 2D9WA 3HQCA 1U5DA 1ZM0A 4HDQA 5GOWB 3SO6A 3PVWA 2Y8GA 4CHJA 1UPQA 1P5TA 3KRWA 4MY6A 3F5RA 2I1KA 1XD4A 1HB8A 3U7DA 2DTCA 2GCLA 1P3RA 2AEHA 1FB8A 5D3XA 4HAXB 1FHXA 4HAUB 2DYQA 2IYBA 1H10A 1M7EA 4YONA 2OTXA 3PP2A 3GYOA 2YS3A 1NI2A 4ZRIA 2QKMA 4GPTB 3A8PA 2FDQA 1UNQA 4IOYX 4K17A 2P8VA 1NU2A 4K81A 2X18A 1OMWA 1I7AA 3GYPA 5FI1A 2D4QA 5JP4A 2LOZA 2EJ8A 4HB2B 1WJ1A 1X86A 2DA0A 5LONB 2D9ZA 1LW3A 2DKQA 4HB0B 1FHOA 1M7RA 1V5MA 1DROA 4WSFA 1AQCA 4HDOA 2CQUA 4KHBB 1FAOA 4MK0A 2FJ9A 2E2XA 4H8SA 3G9WA 3TW1A 2P0FA 1MK9B 1EAZA 1SHCA 1FGYA 3A98B 5KQ1A 1OQNA 2DKPA 4TKNA 1XR0B 2GJYA 2RNRB 3UZTA 4HAZB 1TQZA 2J0MA 3KRXA 2CRFA 2LOXA 1HB6A 3D8FA 5JLJB 2W2XD 2XQNM 4PNKA 2ZPYA 2LG1A 5KQ4A 5HE0A 1LB1A 3IVFA 4EJNA 4CHMA 2QKLA 2RSGA 4C0AA 3AJ4A 4HAVB 1BAKA 4A6FB 3VOQA 3ZVRA 2YS1A 2H7EA 3ZDTA 1KI1B 4A6HA 5DIFB 1XX0A 5IJMA 1J19A 3PSCA 4IFSA 2UZRA 1KZ7A 3V5WA 4Z2NA 1ZC4B 2YF0A 2MFQA 4F7GA 2COAA 4GMXB 2VRWB 4GN1A 1P6SA 5DHFB 1V5UA 3BINA 4P7IA 2DLWA 1ZVRA 4TYZA 2ABDA 4NY0A 1ZC3B 3FM8C 3O96A 4A5KA 3T06A 4GZUA 1RRPB 2COFA 1UPRA 3SUZA 1HBKA 2EC1A 2LBBA 3HK0A 1WGUA 2VKIA 2D9XA 1GG3A 4HATB 2N0YA 4PQ0A 4CYEA 1V88A 1K5DB 1U27A 2UVMA 2GCJA 1MPHA 2CODA 2R09A 4KHOA 5D3WA 1EGXA 4K2OA 5D3YA 3MDBC 1NTIA 5HE1A 1PMSA 1B55A 4MT7A 4BBKA 2KCJA 3TVVA 1ACAA 1E5WA 2Z0PA 3FP5A 2J59M 1Y5OA 2K00A 2GS0A 2ROVA 3VIAA 3ODOA 4EMOA 1XKEA 2RVBB 2YS5A 2J0JA 5L81A 3PZDA 1U5FA 2M14A 5HE3A 4KHAA 2G35A 1NVLA 1SGHA 3PVLA 1TJ6A 2DHKA 2DYNA 3PVUA 4KAXB 4F7UP 1X1FA 2W2WA 1BTNA 2K2UA 2J0KA 2LULA 2Y7BA 2HE7A 5D3VA 1WGQA 3FSSA 1AWEA 3FLVA 3P6AA 1UEFA 2KUPA 1W1HA 2DX5A 2DX1A 2PZ1A 3A8QA 2V76A 3QIJA 2OQBA 1U5GA 3KSYA 2I1JA 3OANA 2NZ8B 3EPYA 3WA0A 2Z0OA 1H4RA 1K5GB 1MIXA 1MIZB 4DX90 2I5CA 2MWNB 2BCJA 4L6EA 2MKRA 2RLOA 3TFMA 3D8DA 4XWXA 1PLSA 2I5FA 3NSUA 5HE2A 3ULCA 1UNPA 1RJ2A 4HHVA 2Q13A 3N7CA 2W2XC 3DXCA 1DBHA 3D8EA 2DN6A 3HW2B 1ISNA 3AU4A 2DHIA 2WH5A 2HRJA 1V89A 4ZRKA 4Y94A 5DH9B 4ZRJA 3KZ1A 5C6RA 3CXBB 3KY9A 2Y8FA 1NTYA 5DI9B
chains in the Genus database with same CATH superfamily
2D2QA 2LYDA 4A6FA 4NSWA 2YVCA 2K49A 1ST7A 1FHWA 5JHHA 2RQ1A 1XCGA 2L1CA 2HTHB 2AL6A 2IFSA 1X05A 1WI1A 1Z87A 1IRSA 5EFXA 1BWNA 3SYXA 2ROZB 2DFKA 2RUKB 2Z0QA 5C5BA 4KVGB 4GXBA 3PG7A 2ELAA 4JKGB 3M1IB 1TXDA 5M4YB 2KIGA 2MDXA 4DXAB 1DYNA 3LJUX 2EMSA 2FJUB 1MAIA 3FEHA 4GOUA 1T77A 1W1GA 2GUMA 5DHAB 1WVHA 3DXDA 3X23A 2YRYA 5J3YA 5I2SA 3SNHA 4HAWB 1WJMA 2KIEA 4JK8A 4ILGB 3TCAA 4A6KA 5D27A 1ZSQA 5J3QA 2R2YA 4HAYB 3WYFB 2CAYA 3TO1A 4WVFB 1I2HA 3PEGA 1VBHA 2ZKMX 3ML4A 3ODXA 2K2JA 1X11A 5JVLA 2CY4A 5KCVA 1U5EA 1MI1A 1U29A 3MPXA 5LOPB 1V5PA 4D0NB 1EVHA 1N3HA 2YT0A 3QBVB 2M38A 2UZSA 1GC7A 2JP2A 3BJIA 5FI0A 1BTKA 3NWDA 3RCPA 2P0DA 5J3TA 3DCXA 1V61A 1UNRA 1DDWA 2D9YA 2K8EA 1MKEA 2RGNB 1DDVA 4K2PA 3DXEA 4B6HA 3ENBA 4F7HA 1QC6A 4EKUA 4DX8A 3P7ZA 2P0HA 1GC6A 3QWMA 4YL8A 5IRSA 1Q67A 4KHBA 2YT1A 3ULBA 1VBGA 1GGOA 2COPA 3U8ZA 4QXAB 1OY2A 3SV1A 4HB3B 2CB8A 2L2IA 2H7DA 4QJ5B 2Z4DA 3AU5A 2YSZA 2N23A 1FOEA 2NMBA 4IAPA 1PFJA 2LKOA 1EF1A 1MK7B 3E9LA 1QQGA 5JHGA 1ZYIA 2DHJA 2FJLA 1KZGA 3ODWA 3OHMB 2ELBA 3FVCA 4Z2MB 4DBBA 1DDMA 1Y19B 4HB4B 2EMTA 1FGZA 2D10A 1NTVA 2CY5A 3NW8A 4GMVA 5C16A 2Z13A 5C79A 2KGXB 4L1RA 1W1DA 3SBTA 1X1GA 2ADZA 2KR0A 3F0WA 3CIKA 2COCA 1J0WA 2D9VA 5C5BB 1XODA 5CLLB 2D11A 4WJ7A 4OT1A 1U2BA 5CLQB 4HSIA 4JK9A 2R0DA 1WG7A 2VSZA 3E9PA 2D9WA 3HQCA 1U5DA 1ZM0A 4QJ3B 4HDQA 5GOWB 3SO6A 3PVWA 2Y8GA 3E9OA 4CHJA 1UPQA 1P5TA 3KRWA 4MY6A 3F5RA 2I1KA 1XD4A 1HB8A 4JKAA 3U7DA 4JKDA 2DTCA 2GCLA 3B77A 1P3RA 2AEHA 1FB8A 5D3XA 4HAXB 1FHXA 4HAUB 2DYQA 2IYBA 1DIKA 1H10A 1M7EA 4YONA 2OTXA 3PP2A 3GYOA 2YS3A 1JDEA 1NI2A 4ZRIA 2QKMA 4GPTB 3A8PA 2FDQA 4JKCA 1UNQA 4IOYX 4K17A 2P8VA 3HSAA 1NU2A 4K81A 2X18A 1OMWA 1I7AA 3GYPA 5FI1A 2D4QA 5JP4A 2LOZA 2EJ8A 4HB2B 1WJ1A 1X86A 2DA0A 5LONB 2D9ZA 1LW3A 4JK7A 2DKQA 4HB0B 1FHOA 1M7RA 1V5MA 1DROA 4WSFA 1AQCA 4DIXA 4HDOA 2CQUA 4KHBB 1FAOA 4MK0A 2FJ9A 2E2XA 4H8SA 3G9WA 3TW1A 2P0FA 1MK9B 1EAZA 1SHCA 1FGYA 3A98B 5KQ1A 1OQNA 4JKEA 2DKPA 4TKNA 3NWAA 1XR0B 2GJYA 2RNRB 3UZTA 2YT2A 4HAZB 1TQZA 2J0MA 1KBLA 3KRXA 2CRFA 2LOXA 1HB6A 3D8FA 5JLJB 2W2XD 2XQNM 4PNKA 2ZPYA 4GNKB 4CSQA 2LG1A 5KQ4A 5HE0A 1LB1A 3IVFA 4EJNA 4CHMA 2QKLA 2RSGA 2Z59A 4C0AA 3AJ4A 4HAVB 1BAKA 4A6FB 3VOQA 3ZVRA 2YS1A 2H7EA 3ZDTA 1KI1B 4A6HA 5LG4B 5DIFB 1XX0A 1J19A 5IJMA 3PSCA 1KC7A 2X0SA 2R82A 4IFSA 2UZRA 1KZ7A 3V5WA 4Z2NA 1ZC4B 2YF0A 2MFQA 4F7GA 2COAA 4GMXB 2VRWB 4GN1A 1P6SA 5DHFB 1V5UA 3BINA 4P7IA 2DLWA 4JKHA 3E66A 1ZVRA 3NWFA 4TYZA 2ABDA 3U12A 4NY0A 1ZC3B 3FM8C 3O96A 4A5KA 3T06A 4GZUA 1RRPB 2COFA 2KUQA 1UPRA 3SUZA 3A58A 1HBKA 2EC1A 4OSNA 2LBBA 3HK0A 1WGUA 2VKIA 2D9XA 1GG3A 4HATB 2N0YA 4PQ0A 4CYEA 1V88A 3SBGA 1K5DB 1U27A 2UVMA 2GCJA 1MPHA 2CODA 2R09A 4QJ4B 4KHOA 5D3WA 1EGXA 4JKFA 4K2OA 5D3YA 3MDBC 1NTIA 5HE1A 4JKBA 1PMSA 1B55A 4MT7A 4ILJA 4BBKA 2KCJA 4JKGA 3TVVA 1ACAA 1E5WA 5I2MA 2Z0PA 3FP5A 2J59M 1Y5OA 2K00A 2GS0A 2ROVA 3VIAA 3ODOA 4EMOA 1XKEA 2RVBB 2YS5A 2J0JA 5L81A 3PZDA 1U5FA 2M14A 2DIKA 5HE3A 4KHAA 2G35A 1NVLA 1SGHA 3PVLA 1TJ6A 2DHKA 2DYNA 3PVUA 4KAXB 4F7UP 1X1FA 2W2WA 1BTNA 2K2UA 2J0KA 2LULA 2Y7BA 2HE7A 5D3VA 1WGQA 3FSSA 1AWEA 3FLVA 2Z14A 3P6AA 1UEFA 2KUPA 1W1HA 2DX5A 2DX1A 2RRFA 2PZ1A 3A8QA 2V76A 3QIJA 3HIEA 2OQBA 4ILHA 1U5GA 3KSYA 2I1JA 3OANA 2NZ8B 3EPYA 3WA0A 2Z0OA 1H4RA 1K5GB 1MIXA 1MIZB 4DX90 2I5CA 2MWNB 2BCJA 4L6EA 2MKRA 2RLOA 3TFMA 3D8DA 4XWXA 1PLSA 2I5FA 3NSUA 5HE2A 3ULCA 1UNPA 1RJ2A 4HHVA 2Q13A 3N7CA 2W2XC 3DXCA 1DBHA 3D8EA 2DN6A 3HW2B 1ISNA 3AU4A 2DHIA 2WH5A 2HRJA 2NBVA 4D6WA 1V89A 4ZRKA 4Y94A 5DH9B 4ZRJA 3KZ1A 5C6RA 3CXBB 3KY9A 2Y8FA 1NTYA 5DI9B
chains in the Genus database with same CATH topology
2D2QA 2LYDA 4A6FA 4NSWA 2YVCA 1ST7A 1FHWA 5JHHA 2RQ1A 1XCGA 2L1CA 2HTHB 2AL6A 2IFSA 1X05A 1WI1A 1Z87A 1IRSA 5EFXA 1BWNA 3SYXA 2ROZB 2DFKA 2RUKB 2Z0QA 5C5BA 4KVGB 4GXBA 3PG7A 2ELAA 4JKGB 3M1IB 1TXDA 2MDXA 4DXAB 1DYNA 3LJUX 2EMSA 1MAIA 3FEHA 1W1GA 5DHAB 1WVHA 3DXDA 3X23A 2YRYA 5J3YA 3SNHA 4HAWB 1WJMA 4JK8A 4ILGB 3TCAA 4A6KA 5D27A 1ZSQA 5J3QA 4HAYB 3WYFB 2CAYA 3TO1A 4WVFB 1I2HA 3PEGA 1VBHA 3ML4A 3ODXA 2K2JA 1X11A 5JVLA 2CY4A 5KCVA 1U5EA 3MPXA 1U29A 5LOPB 1V5PA 4D0NB 1EVHA 1N3HA 2YT0A 3QBVB 2M38A 2UZSA 1GC7A 2JP2A 3BJIA 5FI0A 1BTKA 3RCPA 2P0DA 5J3TA 1V61A 1UNRA 1DDWA 2D9YA 2RGNB 1MKEA 1DDVA 4K2PA 3DXEA 4B6HA 3ENBA 4F7HA 1QC6A 4EKUA 4DX8A 3P7ZA 2P0HA 1GC6A 3QWMA 4YL8A 1Q67A 2YT1A 3ULBA 1VBGA 1GGOA 2COPA 3U8ZA 1OY2A 3SV1A 4HB3B 2CB8A 2L2IA 2H7DA 3AU5A 2YSZA 2N23A 1FOEA 2NMBA 4IAPA 1PFJA 2LKOA 1EF1A 1MK7B 3E9LA 1QQGA 5JHGA 2DHJA 2FJLA 1KZGA 3ODWA 2ELBA 4Z2MB 4DBBA 1DDMA 1Y19B 4HB4B 2EMTA 1FGZA 2D10A 1NTVA 2CY5A 4GMVA 5C16A 5C79A 2KGXB 1W1DA 3SBTA 1X1GA 2ADZA 3F0WA 3CIKA 2COCA 1J0WA 2D9VA 5C5BB 1XODA 5CLLB 2D11A 4WJ7A 1U2BA 5CLQB 4JK9A 2R0DA 1WG7A 2VSZA 3E9PA 2D9WA 3HQCA 1U5DA 1ZM0A 4HDQA 5GOWB 3SO6A 3PVWA 2Y8GA 3E9OA 4CHJA 1UPQA 1P5TA 3KRWA 4MY6A 3F5RA 2I1KA 1XD4A 1HB8A 4JKAA 3U7DA 4JKDA 2DTCA 2GCLA 1P3RA 2AEHA 1FB8A 5D3XA 4HAXB 1FHXA 4HAUB 2DYQA 2IYBA 1DIKA 1H10A 1M7EA 4YONA 2OTXA 3PP2A 3GYOA 2YS3A 1JDEA 1NI2A 4ZRIA 2QKMA 4GPTB 3A8PA 2FDQA 4JKCA 1UNQA 4IOYX 4K17A 2P8VA 1NU2A 4K81A 2X18A 1OMWA 1I7AA 3GYPA 5FI1A 2D4QA 5JP4A 2LOZA 2EJ8A 4HB2B 1WJ1A 1X86A 2DA0A 5LONB 2D9ZA 1LW3A 4JK7A 2DKQA 4HB0B 1FHOA 1M7RA 1V5MA 1DROA 4WSFA 1AQCA 4HDOA 2CQUA 4KHBB 1FAOA 4MK0A 2FJ9A 2E2XA 4H8SA 3G9WA 3TW1A 2P0FA 1MK9B 1EAZA 1SHCA 1FGYA 3A98B 5KQ1A 1OQNA 4JKEA 2DKPA 4TKNA 1XR0B 2GJYA 2RNRB 3UZTA 4HAZB 1TQZA 2J0MA 1KBLA 3KRXA 2CRFA 2LOXA 1HB6A 3D8FA 5JLJB 2W2XD 2XQNM 4PNKA 2ZPYA 2LG1A 5KQ4A 5HE0A 1LB1A 3IVFA 4EJNA 4CHMA 2QKLA 2RSGA 4C0AA 3AJ4A 4HAVB 1BAKA 4A6FB 3VOQA 3ZVRA 2YS1A 2H7EA 3ZDTA 1KI1B 4A6HA 5DIFB 1XX0A 1J19A 5IJMA 3PSCA 1KC7A 2X0SA 2R82A 4IFSA 2UZRA 1KZ7A 3V5WA 4Z2NA 1ZC4B 2YF0A 2MFQA 4F7GA 2COAA 4GMXB 2VRWB 4GN1A 1P6SA 5DHFB 1V5UA 3BINA 4P7IA 2DLWA 4JKHA 3E66A 1ZVRA 4TYZA 2ABDA 4NY0A 1ZC3B 3FM8C 3O96A 4A5KA 3T06A 4GZUA 1RRPB 2COFA 1UPRA 3SUZA 1HBKA 2EC1A 2LBBA 3HK0A 1WGUA 2VKIA 2D9XA 1GG3A 4HATB 2N0YA 4PQ0A 4CYEA 1V88A 3SBGA 1K5DB 1U27A 2UVMA 2GCJA 1MPHA 2CODA 2R09A 4KHOA 5D3WA 1EGXA 4JKFA 4K2OA 5D3YA 3MDBC 1NTIA 5HE1A 4JKBA 1PMSA 1B55A 4MT7A 4ILJA 4BBKA 2KCJA 4JKGA 3TVVA 1ACAA 1E5WA 2Z0PA 3FP5A 2J59M 1Y5OA 2K00A 2GS0A 2ROVA 3VIAA 3ODOA 4EMOA 1XKEA 2RVBB 2YS5A 2J0JA 5L81A 3PZDA 1U5FA 2M14A 2DIKA 5HE3A 4KHAA 2G35A 1NVLA 1SGHA 3PVLA 1TJ6A 2DHKA 2DYNA 3PVUA 4KAXB 4F7UP 1X1FA 2W2WA 1BTNA 2K2UA 2J0KA 2LULA 2Y7BA 2HE7A 5D3VA 1WGQA 3FSSA 1AWEA 3FLVA 3P6AA 1UEFA 2KUPA 1W1HA 2DX5A 2DX1A 2PZ1A 3A8QA 2V76A 3QIJA 2OQBA 4ILHA 1U5GA 3KSYA 2I1JA 3OANA 2NZ8B 3EPYA 3WA0A 2Z0OA 1H4RA 1K5GB 1MIXA 1MIZB 4DX90 2I5CA 2MWNB 2BCJA 4L6EA 2MKRA 2RLOA 3TFMA 3D8DA 4XWXA 1PLSA 2I5FA 3NSUA 5HE2A 3ULCA 1UNPA 1RJ2A 4HHVA 2Q13A 3N7CA 2W2XC 3DXCA 1DBHA 3D8EA 2DN6A 3HW2B 1ISNA 3AU4A 2DHIA 2WH5A 2HRJA 1V89A 4ZRKA 4Y94A 5DH9B 4ZRJA 3KZ1A 5C6RA 3CXBB 3KY9A 2Y8FA 1NTYA 5DI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2Q A;  2LYD A;  4A6F A;  4NSW A;  2YVC A;  1ST7 A;  1FHW A;  5JHH A;  2RQ1 A;  1XCG A;  2L1C A;  2HTH B;  2AL6 A;  2IFS A;  1X05 A;  1WI1 A;  1Z87 A;  1IRS A;  5EFX A;  1BWN A;  3SYX A;  2ROZ B;  2DFK A;  2RUK B;  2Z0Q A;  5C5B A;  4KVG B;  4GXB A;  3PG7 A;  2ELA A;  3M1I B;  1TXD A;  2MDX A;  4DXA B;  1DYN A;  3LJU X;  2EMS A;  1MAI A;  3FEH A;  1W1G A;  5DHA B;  1WVH A;  3DXD A;  3X23 A;  2YRY A;  5J3Y A;  3SNH A;  4HAW B;  1WJM A;  3TCA A;  4A6K A;  5D27 A;  1ZSQ A;  5J3Q A;  4HAY B;  3WYF B;  2CAY A;  3TO1 A;  4WVF B;  1I2H A;  3PEG A;  3ML4 A;  3ODX A;  2K2J A;  1X11 A;  2CY4 A;  5KCV A;  1U5E A;  3MPX A;  1U29 A;  5LOP B;  1V5P A;  4D0N B;  1EVH A;  1N3H A;  2YT0 A;  3QBV B;  2M38 A;  2UZS A;  1GC7 A;  2JP2 A;  3BJI A;  5FI0 A;  1BTK A;  3RCP A;  2P0D A;  5J3T A;  1V61 A;  1UNR A;  1DDW A;  2D9Y A;  2RGN B;  1MKE A;  1DDV A;  4K2P A;  3DXE A;  4B6H A;  4F7H A;  1QC6 A;  4EKU A;  4DX8 A;  3P7Z A;  2P0H A;  1GC6 A;  3QWM A;  4YL8 A;  1Q67 A;  2YT1 A;  3ULB A;  3U8Z A;  2COP A;  1OY2 A;  3SV1 A;  4HB3 B;  2CB8 A;  2L2I A;  2H7D A;  3AU5 A;  2YSZ A;  2N23 A;  1FOE A;  2NMB A;  4IAP A;  1PFJ A;  2LKO A;  1EF1 A;  1MK7 B;  1QQG A;  5JHG A;  2DHJ A;  2FJL A;  1KZG A;  3ODW A;  2ELB A;  4Z2M B;  4DBB A;  1DDM A;  1Y19 B;  4HB4 B;  2EMT A;  1FGZ A;  2D10 A;  1NTV A;  2CY5 A;  4GMV A;  5C16 A;  5C79 A;  2KGX B;  1W1D A;  1X1G A;  2ADZ A;  3F0W A;  3CIK A;  2COC A;  1J0W A;  2D9V A;  5C5B B;  1XOD A;  5CLL B;  2D11 A;  4WJ7 A;  1U2B A;  5CLQ B;  2R0D A;  1WG7 A;  2VSZ A;  2D9W A;  3HQC A;  1U5D A;  1ZM0 A;  4HDQ A;  5GOW B;  3SO6 A;  3PVW A;  2Y8G A;  4CHJ A;  1UPQ A;  1P5T A;  3KRW A;  4MY6 A;  3F5R A;  2I1K A;  1XD4 A;  1HB8 A;  3U7D A;  2DTC A;  2GCL A;  1P3R A;  2AEH A;  1FB8 A;  5D3X A;  4HAX B;  1FHX A;  4HAU B;  2DYQ A;  2IYB A;  1H10 A;  1M7E A;  4YON A;  2OTX A;  3PP2 A;  3GYO A;  2YS3 A;  1NI2 A;  4ZRI A;  2QKM A;  4GPT B;  3A8P A;  2FDQ A;  1UNQ A;  4IOY X;  4K17 A;  2P8V A;  1NU2 A;  4K81 A;  2X18 A;  1OMW A;  1I7A A;  3GYP A;  5FI1 A;  2D4Q A;  5JP4 A;  2LOZ A;  2EJ8 A;  4HB2 B;  1WJ1 A;  1X86 A;  2DA0 A;  5LON B;  2D9Z A;  1LW3 A;  2DKQ A;  4HB0 B;  1FHO A;  1M7R A;  1V5M A;  1DRO A;  4WSF A;  1AQC A;  4HDO A;  2CQU A;  4KHB B;  1FAO A;  4MK0 A;  2FJ9 A;  2E2X A;  4H8S A;  3G9W A;  3TW1 A;  2P0F A;  1MK9 B;  1EAZ A;  1SHC A;  1FGY A;  3A98 B;  5KQ1 A;  1OQN A;  2DKP A;  4TKN A;  1XR0 B;  2GJY A;  2RNR B;  3UZT A;  4HAZ B;  1TQZ A;  2J0M A;  3KRX A;  2CRF A;  2LOX A;  1HB6 A;  3D8F A;  5JLJ B;  2W2X D;  2XQN M;  4PNK A;  2ZPY A;  2LG1 A;  5KQ4 A;  5HE0 A;  1LB1 A;  3IVF A;  4EJN A;  4CHM A;  2QKL A;  2RSG A;  4C0A A;  3AJ4 A;  4HAV B;  1BAK A;  4A6F B;  3VOQ A;  3ZVR A;  2YS1 A;  2H7E A;  3ZDT A;  1KI1 B;  4A6H A;  5DIF B;  1XX0 A;  5IJM A;  1J19 A;  3PSC A;  4IFS A;  2UZR A;  1KZ7 A;  3V5W A;  4Z2N A;  1ZC4 B;  2YF0 A;  2MFQ A;  4F7G A;  2COA A;  4GMX B;  2VRW B;  4GN1 A;  1P6S A;  5DHF B;  1V5U A;  3BIN A;  4P7I A;  2DLW A;  1ZVR A;  4TYZ A;  2ABD A;  4NY0 A;  1ZC3 B;  3FM8 C;  3O96 A;  4A5K A;  3T06 A;  4GZU A;  1RRP B;  2COF A;  1UPR A;  3SUZ A;  1HBK A;  2EC1 A;  2LBB A;  3HK0 A;  1WGU A;  2VKI A;  2D9X A;  1GG3 A;  4HAT B;  2N0Y A;  4PQ0 A;  4CYE A;  1V88 A;  1K5D B;  1U27 A;  2UVM A;  2GCJ A;  1MPH A;  2COD A;  2R09 A;  4KHO A;  5D3W A;  1EGX A;  4K2O A;  5D3Y A;  3MDB C;  1NTI A;  5HE1 A;  1PMS A;  1B55 A;  4MT7 A;  4BBK A;  2KCJ A;  3TVV A;  1ACA A;  1E5W A;  2Z0P A;  3FP5 A;  2J59 M;  1Y5O A;  2K00 A;  2GS0 A;  2ROV A;  3VIA A;  3ODO A;  4EMO A;  1XKE A;  2RVB B;  2YS5 A;  2J0J A;  5L81 A;  3PZD A;  1U5F A;  2M14 A;  5HE3 A;  4KHA A;  2G35 A;  1NVL A;  1SGH A;  3PVL A;  1TJ6 A;  2DHK A;  2DYN A;  3PVU A;  4KAX B;  4F7U P;  1X1F A;  2W2W A;  1BTN A;  2K2U A;  2J0K A;  2LUL A;  2Y7B A;  2HE7 A;  5D3V A;  1WGQ A;  3FSS A;  1AWE A;  3FLV A;  3P6A A;  1UEF A;  2KUP A;  1W1H A;  2DX5 A;  2DX1 A;  2PZ1 A;  3A8Q A;  2V76 A;  3QIJ A;  2OQB A;  1U5G A;  3KSY A;  2I1J A;  3OAN A;  2NZ8 B;  3EPY A;  3WA0 A;  2Z0O A;  1H4R A;  1K5G B;  1MIX A;  1MIZ B;  4DX9 0;  2I5C A;  2MWN B;  2BCJ A;  4L6E A;  2MKR A;  2RLO A;  3TFM A;  3D8D A;  4XWX A;  1PLS A;  2I5F A;  3NSU A;  5HE2 A;  3ULC A;  1UNP A;  1RJ2 A;  4HHV A;  2Q13 A;  3N7C A;  2W2X C;  3DXC A;  1DBH A;  3D8E A;  2DN6 A;  3HW2 B;  1ISN A;  3AU4 A;  2DHI A;  2WH5 A;  2HRJ A;  1V89 A;  4ZRK A;  4Y94 A;  5DH9 B;  4ZRJ A;  3KZ1 A;  5C6R A;  3CXB B;  3KY9 A;  2Y8F A;  1NTY A;  5DI9 B; 
#chains in the Genus database with same CATH topology
 2D2Q A;  2LYD A;  4A6F A;  4NSW A;  2YVC A;  2K49 A;  1ST7 A;  1FHW A;  5JHH A;  2RQ1 A;  1XCG A;  2L1C A;  2HTH B;  2AL6 A;  2IFS A;  1X05 A;  1WI1 A;  1Z87 A;  1IRS A;  5EFX A;  1BWN A;  3SYX A;  2ROZ B;  2DFK A;  2RUK B;  2Z0Q A;  5C5B A;  4KVG B;  4GXB A;  3PG7 A;  2ELA A;  4JKG B;  3M1I B;  1TXD A;  5M4Y B;  2KIG A;  2MDX A;  4DXA B;  1DYN A;  3LJU X;  2EMS A;  2FJU B;  1MAI A;  3FEH A;  4GOU A;  1T77 A;  1W1G A;  2GUM A;  5DHA B;  1WVH A;  3DXD A;  3X23 A;  2YRY A;  5J3Y A;  5I2S A;  3SNH A;  4HAW B;  1WJM A;  2KIE A;  4JK8 A;  4ILG B;  3TCA A;  4A6K A;  5D27 A;  1ZSQ A;  5J3Q A;  2R2Y A;  4HAY B;  3WYF B;  2CAY A;  3TO1 A;  4WVF B;  1I2H A;  3PEG A;  1VBH A;  2ZKM X;  3ML4 A;  3ODX A;  2K2J A;  1X11 A;  5JVL A;  2CY4 A;  5KCV A;  1U5E A;  1MI1 A;  1U29 A;  3MPX A;  5LOP B;  1V5P A;  4D0N B;  1EVH A;  1N3H A;  2YT0 A;  3QBV B;  2M38 A;  2UZS A;  1GC7 A;  2JP2 A;  3BJI A;  5FI0 A;  1BTK A;  3NWD A;  3RCP A;  2P0D A;  5J3T A;  3DCX A;  1V61 A;  1UNR A;  1DDW A;  2D9Y A;  2K8E A;  1MKE A;  2RGN B;  1DDV A;  4K2P A;  3DXE A;  4B6H A;  3ENB A;  4F7H A;  1QC6 A;  4EKU A;  4DX8 A;  3P7Z A;  2P0H A;  1GC6 A;  3QWM A;  4YL8 A;  5IRS A;  1Q67 A;  4KHB A;  2YT1 A;  3ULB A;  1VBG A;  1GGO A;  2COP A;  3U8Z A;  4QXA B;  1OY2 A;  3SV1 A;  4HB3 B;  2CB8 A;  2L2I A;  2H7D A;  4QJ5 B;  2Z4D A;  3AU5 A;  2YSZ A;  2N23 A;  1FOE A;  2NMB A;  4IAP A;  1PFJ A;  2LKO A;  1EF1 A;  1MK7 B;  3E9L A;  1QQG A;  5JHG A;  1ZYI A;  2DHJ A;  2FJL A;  1KZG A;  3ODW A;  3OHM B;  2ELB A;  3FVC A;  4Z2M B;  4DBB A;  1DDM A;  1Y19 B;  4HB4 B;  2EMT A;  1FGZ A;  2D10 A;  1NTV A;  2CY5 A;  3NW8 A;  4GMV A;  5C16 A;  2Z13 A;  5C79 A;  2KGX B;  4L1R A;  1W1D A;  3SBT A;  1X1G A;  2ADZ A;  2KR0 A;  3F0W A;  3CIK A;  2COC A;  1J0W A;  2D9V A;  5C5B B;  1XOD A;  5CLL B;  2D11 A;  4WJ7 A;  4OT1 A;  1U2B A;  5CLQ B;  4HSI A;  4JK9 A;  2R0D A;  1WG7 A;  2VSZ A;  3E9P A;  2D9W A;  3HQC A;  1U5D A;  1ZM0 A;  4QJ3 B;  4HDQ A;  5GOW B;  3SO6 A;  3PVW A;  2Y8G A;  3E9O A;  4CHJ A;  1UPQ A;  1P5T A;  3KRW A;  4MY6 A;  3F5R A;  2I1K A;  1XD4 A;  1HB8 A;  4JKA A;  3U7D A;  4JKD A;  2DTC A;  2GCL A;  3B77 A;  1P3R A;  2AEH A;  1FB8 A;  5D3X A;  4HAX B;  1FHX A;  4HAU B;  2DYQ A;  2IYB A;  1DIK A;  1H10 A;  1M7E A;  4YON A;  2OTX A;  3PP2 A;  3GYO A;  2YS3 A;  1JDE A;  1NI2 A;  4ZRI A;  2QKM A;  4GPT B;  3A8P A;  2FDQ A;  4JKC A;  1UNQ A;  4IOY X;  4K17 A;  2P8V A;  3HSA A;  1NU2 A;  4K81 A;  2X18 A;  1OMW A;  1I7A A;  3GYP A;  5FI1 A;  2D4Q A;  5JP4 A;  2LOZ A;  2EJ8 A;  4HB2 B;  1WJ1 A;  1X86 A;  2DA0 A;  5LON B;  2D9Z A;  1LW3 A;  4JK7 A;  2DKQ A;  4HB0 B;  1FHO A;  1M7R A;  1V5M A;  1DRO A;  4WSF A;  1AQC A;  4DIX A;  4HDO A;  2CQU A;  4KHB B;  1FAO A;  4MK0 A;  2FJ9 A;  2E2X A;  4H8S A;  3G9W A;  3TW1 A;  2P0F A;  1MK9 B;  1EAZ A;  1SHC A;  1FGY A;  3A98 B;  5KQ1 A;  1OQN A;  4JKE A;  2DKP A;  4TKN A;  3NWA A;  1XR0 B;  2GJY A;  2RNR B;  3UZT A;  2YT2 A;  4HAZ B;  1TQZ A;  2J0M A;  1KBL A;  3KRX A;  2CRF A;  2LOX A;  1HB6 A;  3D8F A;  5JLJ B;  2W2X D;  2XQN M;  4PNK A;  2ZPY A;  4GNK B;  4CSQ A;  2LG1 A;  5KQ4 A;  5HE0 A;  1LB1 A;  3IVF A;  4EJN A;  4CHM A;  2QKL A;  2RSG A;  2Z59 A;  4C0A A;  3AJ4 A;  4HAV B;  1BAK A;  4A6F B;  3VOQ A;  3ZVR A;  2YS1 A;  2H7E A;  3ZDT A;  1KI1 B;  4A6H A;  5LG4 B;  5DIF B;  1XX0 A;  1J19 A;  5IJM A;  3PSC A;  1KC7 A;  2X0S A;  2R82 A;  4IFS A;  2UZR A;  1KZ7 A;  3V5W A;  4Z2N A;  1ZC4 B;  2YF0 A;  2MFQ A;  4F7G A;  2COA A;  4GMX B;  2VRW B;  4GN1 A;  1P6S A;  5DHF B;  1V5U A;  3BIN A;  4P7I A;  2DLW A;  4JKH A;  3E66 A;  1ZVR A;  3NWF A;  4TYZ A;  2ABD A;  3U12 A;  4NY0 A;  1ZC3 B;  3FM8 C;  3O96 A;  4A5K A;  3T06 A;  4GZU A;  1RRP B;  2COF A;  2KUQ A;  1UPR A;  3SUZ A;  3A58 A;  1HBK A;  2EC1 A;  4OSN A;  2LBB A;  3HK0 A;  1WGU A;  2VKI A;  2D9X A;  1GG3 A;  4HAT B;  2N0Y A;  4PQ0 A;  4CYE A;  1V88 A;  3SBG A;  1K5D B;  1U27 A;  2UVM A;  2GCJ A;  1MPH A;  2COD A;  2R09 A;  4QJ4 B;  4KHO A;  5D3W A;  1EGX A;  4JKF A;  4K2O A;  5D3Y A;  3MDB C;  1NTI A;  5HE1 A;  4JKB A;  1PMS A;  1B55 A;  4MT7 A;  4ILJ A;  4BBK A;  2KCJ A;  4JKG A;  3TVV A;  1ACA A;  1E5W A;  5I2M A;  2Z0P A;  3FP5 A;  2J59 M;  1Y5O A;  2K00 A;  2GS0 A;  2ROV A;  3VIA A;  3ODO A;  4EMO A;  1XKE A;  2RVB B;  2YS5 A;  2J0J A;  5L81 A;  3PZD A;  1U5F A;  2M14 A;  2DIK A;  5HE3 A;  4KHA A;  2G35 A;  1NVL A;  1SGH A;  3PVL A;  1TJ6 A;  2DHK A;  2DYN A;  3PVU A;  4KAX B;  4F7U P;  1X1F A;  2W2W A;  1BTN A;  2K2U A;  2J0K A;  2LUL A;  2Y7B A;  2HE7 A;  5D3V A;  1WGQ A;  3FSS A;  1AWE A;  3FLV A;  2Z14 A;  3P6A A;  1UEF A;  2KUP A;  1W1H A;  2DX5 A;  2DX1 A;  2RRF A;  2PZ1 A;  3A8Q A;  2V76 A;  3QIJ A;  3HIE A;  2OQB A;  4ILH A;  1U5G A;  3KSY A;  2I1J A;  3OAN A;  2NZ8 B;  3EPY A;  3WA0 A;  2Z0O A;  1H4R A;  1K5G B;  1MIX A;  1MIZ B;  4DX9 0;  2I5C A;  2MWN B;  2BCJ A;  4L6E A;  2MKR A;  2RLO A;  3TFM A;  3D8D A;  4XWX A;  1PLS A;  2I5F A;  3NSU A;  5HE2 A;  3ULC A;  1UNP A;  1RJ2 A;  4HHV A;  2Q13 A;  3N7C A;  2W2X C;  3DXC A;  1DBH A;  3D8E A;  2DN6 A;  3HW2 B;  1ISN A;  3AU4 A;  2DHI A;  2WH5 A;  2HRJ A;  2NBV A;  4D6W A;  1V89 A;  4ZRK A;  4Y94 A;  5DH9 B;  4ZRJ A;  3KZ1 A;  5C6R A;  3CXB B;  3KY9 A;  2Y8F A;  1NTY A;  5DI9 B; 
#chains in the Genus database with same CATH homology
 2D2Q A;  2LYD A;  4A6F A;  4NSW A;  2YVC A;  1ST7 A;  1FHW A;  5JHH A;  2RQ1 A;  1XCG A;  2L1C A;  2HTH B;  2AL6 A;  2IFS A;  1X05 A;  1WI1 A;  1Z87 A;  1IRS A;  5EFX A;  1BWN A;  3SYX A;  2ROZ B;  2DFK A;  2RUK B;  2Z0Q A;  5C5B A;  4KVG B;  4GXB A;  3PG7 A;  2ELA A;  4JKG B;  3M1I B;  1TXD A;  2MDX A;  4DXA B;  1DYN A;  3LJU X;  2EMS A;  1MAI A;  3FEH A;  1W1G A;  5DHA B;  1WVH A;  3DXD A;  3X23 A;  2YRY A;  5J3Y A;  3SNH A;  4HAW B;  1WJM A;  4JK8 A;  4ILG B;  3TCA A;  4A6K A;  5D27 A;  1ZSQ A;  5J3Q A;  4HAY B;  3WYF B;  2CAY A;  3TO1 A;  4WVF B;  1I2H A;  3PEG A;  1VBH A;  3ML4 A;  3ODX A;  2K2J A;  1X11 A;  5JVL A;  2CY4 A;  5KCV A;  1U5E A;  3MPX A;  1U29 A;  5LOP B;  1V5P A;  4D0N B;  1EVH A;  1N3H A;  2YT0 A;  3QBV B;  2M38 A;  2UZS A;  1GC7 A;  2JP2 A;  3BJI A;  5FI0 A;  1BTK A;  3RCP A;  2P0D A;  5J3T A;  1V61 A;  1UNR A;  1DDW A;  2D9Y A;  2RGN B;  1MKE A;  1DDV A;  4K2P A;  3DXE A;  4B6H A;  3ENB A;  4F7H A;  1QC6 A;  4EKU A;  4DX8 A;  3P7Z A;  2P0H A;  1GC6 A;  3QWM A;  4YL8 A;  1Q67 A;  2YT1 A;  3ULB A;  1VBG A;  1GGO A;  2COP A;  3U8Z A;  1OY2 A;  3SV1 A;  4HB3 B;  2CB8 A;  2L2I A;  2H7D A;  3AU5 A;  2YSZ A;  2N23 A;  1FOE A;  2NMB A;  4IAP A;  1PFJ A;  2LKO A;  1EF1 A;  1MK7 B;  3E9L A;  1QQG A;  5JHG A;  2DHJ A;  2FJL A;  1KZG A;  3ODW A;  2ELB A;  4Z2M B;  4DBB A;  1DDM A;  1Y19 B;  4HB4 B;  2EMT A;  1FGZ A;  2D10 A;  1NTV A;  2CY5 A;  4GMV A;  5C16 A;  5C79 A;  2KGX B;  1W1D A;  3SBT A;  1X1G A;  2ADZ A;  3F0W A;  3CIK A;  2COC A;  1J0W A;  2D9V A;  5C5B B;  1XOD A;  5CLL B;  2D11 A;  4WJ7 A;  1U2B A;  5CLQ B;  4JK9 A;  2R0D A;  1WG7 A;  2VSZ A;  3E9P A;  2D9W A;  3HQC A;  1U5D A;  1ZM0 A;  4HDQ A;  5GOW B;  3SO6 A;  3PVW A;  2Y8G A;  3E9O A;  4CHJ A;  1UPQ A;  1P5T A;  3KRW A;  4MY6 A;  3F5R A;  2I1K A;  1XD4 A;  1HB8 A;  4JKA A;  3U7D A;  4JKD A;  2DTC A;  2GCL A;  1P3R A;  2AEH A;  1FB8 A;  5D3X A;  4HAX B;  1FHX A;  4HAU B;  2DYQ A;  2IYB A;  1DIK A;  1H10 A;  1M7E A;  4YON A;  2OTX A;  3PP2 A;  3GYO A;  2YS3 A;  1JDE A;  1NI2 A;  4ZRI A;  2QKM A;  4GPT B;  3A8P A;  2FDQ A;  4JKC A;  1UNQ A;  4IOY X;  4K17 A;  2P8V A;  1NU2 A;  4K81 A;  2X18 A;  1OMW A;  1I7A A;  3GYP A;  5FI1 A;  2D4Q A;  5JP4 A;  2LOZ A;  2EJ8 A;  4HB2 B;  1WJ1 A;  1X86 A;  2DA0 A;  5LON B;  2D9Z A;  1LW3 A;  4JK7 A;  2DKQ A;  4HB0 B;  1FHO A;  1M7R A;  1V5M A;  1DRO A;  4WSF A;  1AQC A;  4HDO A;  2CQU A;  4KHB B;  1FAO A;  4MK0 A;  2FJ9 A;  2E2X A;  4H8S A;  3G9W A;  3TW1 A;  2P0F A;  1MK9 B;  1EAZ A;  1SHC A;  1FGY A;  3A98 B;  5KQ1 A;  1OQN A;  4JKE A;  2DKP A;  4TKN A;  1XR0 B;  2GJY A;  2RNR B;  3UZT A;  4HAZ B;  1TQZ A;  2J0M A;  1KBL A;  3KRX A;  2CRF A;  2LOX A;  1HB6 A;  3D8F A;  5JLJ B;  2W2X D;  2XQN M;  4PNK A;  2ZPY A;  2LG1 A;  5KQ4 A;  5HE0 A;  1LB1 A;  3IVF A;  4EJN A;  4CHM A;  2QKL A;  2RSG A;  4C0A A;  3AJ4 A;  4HAV B;  1BAK A;  4A6F B;  3VOQ A;  3ZVR A;  2YS1 A;  2H7E A;  3ZDT A;  1KI1 B;  4A6H A;  5DIF B;  1XX0 A;  1J19 A;  5IJM A;  3PSC A;  1KC7 A;  2X0S A;  2R82 A;  4IFS A;  2UZR A;  1KZ7 A;  3V5W A;  4Z2N A;  1ZC4 B;  2YF0 A;  2MFQ A;  4F7G A;  2COA A;  4GMX B;  2VRW B;  4GN1 A;  1P6S A;  5DHF B;  1V5U A;  3BIN A;  4P7I A;  2DLW A;  4JKH A;  3E66 A;  1ZVR A;  4TYZ A;  2ABD A;  4NY0 A;  1ZC3 B;  3FM8 C;  3O96 A;  4A5K A;  3T06 A;  4GZU A;  1RRP B;  2COF A;  1UPR A;  3SUZ A;  1HBK A;  2EC1 A;  2LBB A;  3HK0 A;  1WGU A;  2VKI A;  2D9X A;  1GG3 A;  4HAT B;  2N0Y A;  4PQ0 A;  4CYE A;  1V88 A;  3SBG A;  1K5D B;  1U27 A;  2UVM A;  2GCJ A;  1MPH A;  2COD A;  2R09 A;  4KHO A;  5D3W A;  1EGX A;  4JKF A;  4K2O A;  5D3Y A;  3MDB C;  1NTI A;  5HE1 A;  4JKB A;  1PMS A;  1B55 A;  4MT7 A;  4ILJ A;  4BBK A;  2KCJ A;  4JKG A;  3TVV A;  1ACA A;  1E5W A;  2Z0P A;  3FP5 A;  2J59 M;  1Y5O A;  2K00 A;  2GS0 A;  2ROV A;  3VIA A;  3ODO A;  4EMO A;  1XKE A;  2RVB B;  2YS5 A;  2J0J A;  5L81 A;  3PZD A;  1U5F A;  2M14 A;  2DIK A;  5HE3 A;  4KHA A;  2G35 A;  1NVL A;  1SGH A;  3PVL A;  1TJ6 A;  2DHK A;  2DYN A;  3PVU A;  4KAX B;  4F7U P;  1X1F A;  2W2W A;  1BTN A;  2K2U A;  2J0K A;  2LUL A;  2Y7B A;  2HE7 A;  5D3V A;  1WGQ A;  3FSS A;  1AWE A;  3FLV A;  3P6A A;  1UEF A;  2KUP A;  1W1H A;  2DX5 A;  2DX1 A;  2PZ1 A;  3A8Q A;  2V76 A;  3QIJ A;  2OQB A;  4ILH A;  1U5G A;  3KSY A;  2I1J A;  3OAN A;  2NZ8 B;  3EPY A;  3WA0 A;  2Z0O A;  1H4R A;  1K5G B;  1MIX A;  1MIZ B;  4DX9 0;  2I5C A;  2MWN B;  2BCJ A;  4L6E A;  2MKR A;  2RLO A;  3TFM A;  3D8D A;  4XWX A;  1PLS A;  2I5F A;  3NSU A;  5HE2 A;  3ULC A;  1UNP A;  1RJ2 A;  4HHV A;  2Q13 A;  3N7C A;  2W2X C;  3DXC A;  1DBH A;  3D8E A;  2DN6 A;  3HW2 B;  1ISN A;  3AU4 A;  2DHI A;  2WH5 A;  2HRJ A;  1V89 A;  4ZRK A;  4Y94 A;  5DH9 B;  4ZRJ A;  3KZ1 A;  5C6R A;  3CXB B;  3KY9 A;  2Y8F A;  1NTY A;  5DI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...