4JKFA

Open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
220
Chain Sequence
ELFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkfA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkfA01
4JKFA 4JKDA 4JKBA 4ILJA 4JK9A 4JK7A 4JK8A 3E9OA 4JKAA 3SBTA 4JKGB 4JKCA 4JKHA 3ENBA 3E66A 3E9PA 3E9LA 4JKEA 3SBGA 4JKGA 4ILHA 4ILGB
chains in the Genus database with same CATH superfamily
2A1RA 3L0QA 3DWLA 4KREA 2FDQA 2HF3A 2WBNA 1TKXA 3PVLA 1EO1A 3AO2A 3K2PA 1MIXA 2B4JA 1BUPA 4IXCA 1Q9YA 3HPGA 2D5RA 4JKGB 1QQCA 3AVCA 3TU5A 1VQON 1RCHA 4BRQA 2HMIA 5BN8A 2UUCK 3DLBA 4ILHA 3AVMA 2FBXA 4MO4A 3NGYA 4O5BA 5C2FA 4CJLA 3B6OA 5BPMA 5AZJA 4DFKA 3O4NA 3ZSZA 2W6LA 1NI2A 2BE2A 3MCAB 1U6ZA 1OH6A 1RDDA 3A5OC 2ZM6K 3O80A 4BR5A 2E20A 1BQNA 4A5BA 4JKHA 1JLGA 3FE1A 2ASOA 1BA0A 4QS9A 4YOUA 4BRLA 3JSMA 3KTQA 1J54A 2KQ2A 4X62K 4G9ZA 4O0IA 4R79A 4DKWA 1WSIA 3QEXA 3J7ZO 3C95A 4LF6K 3CCEN 3EKSA 2E8AA 5GAHP 2OPQA 4FZYA 1S9GA 5JLHA 1NGBA 4OLBA 4FWLA 4CJ7A 4F2SA 3IKMA 3OYMA 3RTVA 3LANA 4PKGA 1KC7A 2VQFK 3AGKA 3L2VA 4BRIA 3UIQA 1N8RO 3EEQA 5AQZA 4AF1A 3MEGA 4NYNA 1D9DA 4AM7A 3F9KA 4KHPK 4A59A 1HX1A 4YDUC 1JCEA 3ZLJA 3PLAA 1RNHA 1RT4A 1ZXOA 4KHNA 3CFRA 5AFUA 4DXAB 3V9WA 5C25A 4W5OA 4BQZA 2YHYA 5CZ2A 3ULEB 1TYQB 3SPZA 4KTZA 1UAXA 5K14A 4E1MA 4DS4A 3E9PA 1T8EA 5HL7L 3NVMA 2ZE2A 1T6DA 2UXDK 4YY3K 1S6QA 5KRTA 2V51B 2QKBA 4JK9A 3LDLA 2A40A 5H1SQ 1NJIO 3VQPA 1NNEA 1VAZA 2YV0X 2XY7A 3LWLA 1ACAA 4FLTA 2WC9A 1VQMN 1MWKA 1DTTA 2O4GA 1M1KO 3F2KA 4A61A 5GIOA 4C8MA 3CCQN 2GWKA 5KGWA 4CCHA 3MN6A 1ZBFA 5LL6Z 1T44A 3QINA 1CLQA 4H4MA 4PHTX 4ID5A 4IFVA 3ZSOA 4LSNA 4JKDA 5AQRA 1M90O 1ZBUA 3M1FA 5M1OA 3C94A 5CYMA 4A5AA 4M3WA 4ISFA 3FLVA 4RW7A 5FPNA 5M1QA 3CCLN 5JMVA 3J7AP 1W7AA 3ZT0A 2QEXN 3KLFA 3VETA 1QS4A 4WCEL 3QEVA 1RTJA 3CM6A 4JD2B 3SBGA 3CC4N 2FXUA 4GKJK 2E2QA 1HPZA 4LY7A 3MXIA 4FW1A 5AQSA 3ZSRA 4HUEA 1WSGA 1MK7B 2YI1A 4NLBA 5AQNA 3P1GA 4BRHA 3ZT2A 2QI2A 3MK6A 3I55N 2WUSA 3KKRA 1I39A 2O8CB 3I0SA 1NJXA 3ZSWA 3WA0A 4CJWA 4HDQA 1KVAA 3AVAA 1JL1A 5F0XA 2HHTA 1NVLA 3DLLL 4E3SA 1I3AA 1KD1O 5CZ1A 3VEZA 2HHVA 1RBUA 4I7FA 1R0AA 3N4PA 2O8DB 3AA2A 1NK9A 1SKSA 1SS6A 3CJ7A 2QWQA 4E1NA 1RDCA 4M3RA 3NGIA 3PX6A 3BDPA 2G8FA 5AFUH 3H3NO 2NZTA 2YNIA 5KPTA 4FJIA 1NWKA 1BISA 3ASMA 4AHRA 1WNSA 1TV6A 4AHVA 1HQEA 1U48A 2HRJA 3ZCMA 1NJWA 4N41A 3GOIA 1VSIA 3M3ZA 3IDHA 4X65K 4B3RK 4JRQA 4JYAK 3U7DA 1QVGM 1J5OA 2OYQA 3SAGA 3SQ2A 2HBMA 2HNYA 4RW6A 4DFJA 4E0DA 4I9LA 3UE5A 4IEIA 2ZD1A 4CJ4A 2J0JA 5AZJB 4X64K 4FWPA 4M3UA 3KWIA 2VWJA 4BE2A 2HE7A 4FLYA 1Z25A 3AVJA 3FZLA 4JI2K 2YJEA 4QS7A 3G10A 4CIFA 3AAQA 3NH0A 4EHUA 1W97L 3PSIA 5AQUA 4DQ8A 1GLDG 3SCXA 2FBTA 4CGHA 3BF3A 3SAFA 4AILC 2A42A 1IKYA 3C65A 4H4OA 3QBXA 3MN9A 1BU6O 3U8XA 4A57A 4BG8A 2NRTA 5IT9O 3NHGA 4MFBA 3NH1A 4WQ4C 1EWRA 3VGMA 1LV5A 3SBTA 1U49A 4HDOA 3CF5L 1U47A 3ENOA 3QIOA 4GMJB 4M63C 2F8TA 2PFUA 3H6EA 4IZ9A 1X9WA 2KFNA 1KXPA 4KI6A 2A1SA 3AA4A 2D0PA 3O3GA 3P83D 2E6MA 4OKKA 2G8UA 2RE2A 1GLBG 3TARA 4LF5K 3KVGA 3THYB 1Z6RA 4JV5K 2UXCK 4PY5A 3ATVA 4GY2B 4CGGA 4OPHA 3GE1A 4M3TA 1J9AA 5CR4A 4CERA 2KZZA 2OZMA 1NGEA 2BTFA 2WTUA 3NCIA 3TSQA 1U04A 2QXLA 4CJQA 1EF1A 1RT7A 4DV0K 3OA9A 4E7KA 5DK5A 4BY9C 4NY0A 4KH6A 2FBVA 4DR5K 1BI4A 2F7TA 1NOZA 3NF9A 3CCUN 4FZXC 3EYZA 1S5JA 2Q1NA 1GLJO 3S41A 3G71N 5JICA 1J6ZA 4ISGA 4BRPA 1KRPA 4CGFA 2HHHK 4KHSA 4JKEA 2Q0UA 3RMAA 1NK6A 1ATSA 2O8FB 1TUYA 4FJ7A 3THXA 1RTIA 4F4KA 3QMLA 1EETA 2UUBK 4I9QA 1FXXA 2J4RA 4XH1A 4CBUA 4FO0A 3FGUA 1ISNA 2ATQA 4M42A 4QS8A 3TAPA 2IOCA 3CJ9A 4AM6A 4YDUA 1JLBA 3OS2A 1S1VA 3HRGA 1X9MA 5HROA 3VQ9A 1IBLK 1BOTO 4FXDA 3WXJA 2CB8A 1FK9A 4DQSA 4OJRA 1ASUA 1CZAN 3O9QA 1TKZA 3KLEA 4K25A 1QHTA 2GEMA 2P1JA 3SQ0A 4A2BA 3LWMA 1S6PA 1QSYA 4PWDA 3O5BA 4B9NA 2ZGYA 4B1WB 2ITGA 4JS5A 2HW3A 1Q82O 3A5NC 3SUQA 4Y1DA 3K0SA 3SZ2A 4E7LA 1ZBLA 2A6AA 2X74A 4O5FA 4DMNA 5AR0A 4RG8A 2X78A 1GGOA 4CJ5A 1BQMA 3FLCO 3HPOA 1DT9A 2YNFA 1Y97A 2YNHA 3HM9A 2ZWHA 5EVZA 4CIGA 5AQHA 1KSPA 1VSEA 1WOQA 1HBKA 4CVNE 1KTQA 4FWMA 4CFAA 1HB6A 1HKCA 3EE8A 2CGKA 3AVBA 4DLGA 4B3TK 4DU1A 3DI6A 5FROA 5CY4A 3VQCA 2VYPA 3BZKA 2E2OA 1T05A 4JKBA 3K9JA 3LL3A 4FW2A 3E9OA 3D2EA 4JNEA 4FM1A 3ZEUB 3M8QA 4W5TA 4HCBA 5DMRA 1KAYA 1Z05A 2WFBA 4GV3A 3KLHA 1LAVA 2ZJQL 3AO3A 2O8BA 1QE1A 3NF7A 3P38A 2ZPYA 1C1CA 3ZSVA 5JVGL 4BREA 3KZBA 2YHWA 4JI3K 3SMSA 1CXQA 3H1VX 1Q8IA 4I6MB 2IDOA 3HT3A 3KKSA 3U9ZA 1H4RA 2PYLA 5BRDA 2HVHA 1R59O 5MLCQ 3LDSA 3AV9A 3DOKA 3IFRA 2Z1IA 3CM5A 1HUXA 1C0FA 1NOYA 3WNHA 5F2RA 5AJ3K 1Q7YO 4KHQA 2DFHA 3EE9A 5F1XA 1BIZA 4AHUA 3ZT1A 3NAEA 3BF1A 3MEEA 1X3NA 4FZZA 2B5JA 3U3YA 3QEWA 5BPLA 5EXWA 5HLFA 3VN5A 3TR8A 2FBYA 2GV9A 4JHDA 3VENA 3OJUA 3NVKA 1TKDA 3U9DA 4BG9A 3MECA 4CE9A 3O6WA 4DTMA 3WXLA 3CFPA 1U45A 1D9FA 3VOVA 4IG3A 4H0YB 2FSNA 1N5YA 4FJKA 2YHBA 3THWB 3P39A 4XH5A 3Q7BA 4CJSA 3I0RA 4O8KA 1E3MA 2P9IA 3DYAA 1GLFO 3MDQA 4HVJA 3U3GA 4BWMA 1JXEA 3QETA 4CBXA 4KAZA 4ZTJA 2I7NA 3RR7A 4FVUA 5GAEP 1D4XA 1BI4B 2P9KA 3GL1A 3CETA 3ISNC 1ASVA 3RR8A 2E1ZA 3RMCA 4H0TB 3CQXA 4KV8A 4GNIA 3QFUA 4JI4K 4EZ9A 1E4GT 3ZX0A 4Z4EA 3ZT4A 3OYJA 4FK0A 3M6GA 3VF6A 3O08A 3LP3A 1IG8A 5E41A 1IBKK 1HNVA 4FJLA 4CBWA 2IVNA 4B08A 1YVUA 4FJGA 2Q0RA 4WQ4A 3AO5A 4H0XB 1YTAA 4WFBL 1REVA 1RTDA 4GW6A 3DXKA 1S22A 3VF4A 3CCJN 3VTHA 1QQNA 3DLGA 2W41A 4PA1A 1YIJN 3EO3A 2P51A 1OH8A 4FWQA 1VQ5N 4OLAA 4CEQA 3KK7A 3DLHA 2CH6A 4BRKA 3AVGA 4H0PA 4IDHA 3L4QA 5HRSA 1YUWA 1HYZA 1HR0K 4DF4A 4B9QA 4JI0K 5AZIA 4PKHA 4DTRA 4ZTFA 4DV7K 4N76A 4K0KK 3W3DA 4FWKA 3O3FA 2ZF5O 4DS5A 4ID1A 4B1VA 2V7ZA 3OYFA 2OA8A 3EZWA 1UA1A 3VGLA 4CF8A 4X66K 3T1YK 2YJFA 3TAQA 3S9HA 1SGHA 1ST7A 1DKGD 4DCHA 3HM8A 3CERA 1KC8O 3L2UA 1XMQK 3AO1A 4BRAA 1SQKA 1IKVA 2NRXA 1LW2A 2AP1A 3AA3A 4EFHA 4IEEA 2E5LK 4DSLA 1W0HA 4JI1K 1GOBA 3RVCA 4Z4CA 1NK8A 5C15A 1HQUA 5AQMA 5A2QO 4A62A 4N47A 1NLVA 1VQ8N 4ELUA 2JWKA 3LZIA 1NKEA 2X6NA 4DQQA 1YITN 4CK3A 1QHAA 3VEVA 3BGRA 3SV4A 3PY8A 1MIZB 4BROA 4IO9L 3JXUA 2QXFA 4GV6A 1HKBA 3CJAA 3BZCA 3HBTA 3TAEA 1VQNN 3JYTA 5ADXA 4BC5A 5CE3A 2HOEA 3BUZB 4BDZA 1C0UA 1KLMA 4IFYA 5DM7L 1XUPO 3UKUA 1XC9A 1Q9XA 4NLCA 4CF1A 4DHYA 4FOIA 2I1JA 2NLXA 2VWBA 3OYKA 3R3LA 4BGAA 1HNXK 1X9SA 2HHUA 4FLWA 3JAMO 2D11A 4JKAA 4EAHD 1U4BA 3SUNA 2QWNA 2XY6A 4F3TA 1RBRA 2E2PA 3QO9A 4CIEA 3ZSQA 1MDUB 4BGBA 2ZJPL 4DLEA 2B6AA 4OPJA 4CK2A 3B8AX 1YJ9N 3MN5A 2F8SA 4DFPA 3SUPA 4DR7K 1VQLN 2DPNA 1YVNA 1KVBA 3HOTA 1ESVA 3MWTA 2NNWA 4CEBA 1VK0A 4ICLA 4DWIA 3LPTA 3TABA 3G0ZA 3K9KA 3LP0A 4CGJA 3H08A 3VQ5A 4ZRJA 5IJMA 2BGGA 4EP4A 1SZ2A 4FWRA 1TVRA 3TWHA 2QKKA 1KFSA 4KFBA 4FK2A 4Z94A 5JVHL 4BR4A 3WUHA 5CHIA 4I2QA 2KTQA 1VSHA 4DSJA 4GKKK 4HTUA 4B9MA 2ZQBA 4IJNA 1QSLA 3I8DA 4NCBA 1FJGK 3TSUA 2BH1A 1K9MO 3ATUA 1YJWN 4AH9A 4WYBA 3V81A 1VQ6N 4DU3A 1SKWA 1RBVA 3FFKB 4LF4K 1HYSA 3THVA 3V4IA 1WSFA 2Q97A 2PAVA 2P9IB 4Q0BA 4LFBK 2LSNA 4LH4A 1NGHA 4DQPA 4H0VB 1HJRA 4H0OA 3HI0A 4CZIA 2AL6A 4LH5A 3OYDA 4ELTA 1TUUA 2ABDA 4CF0A 3OBWA 3OBYA 1RFQA 4DQRA 1SL0A 3KLIA 1JCGA 3A5MC 2P9KB 3ID6A 3OYIA 4J2BA 2YKNA 4DR3K 2QW9A 4M3XA 4BE1A 4CEDA 3PO4A 1NMNA 2IGIA 4CEOA 4U7BA 1NMDA 3C6TA 3LAKA 5AQPA 1NK0A 5GIPA 1LCUA 5BRFA 3D0PA 3H1QA 2V7YA 1NGJA 5ADXH 5LMNK 3SYZA 2HNZA 2IIRA 2VWKA 4H5WA 1OH5A 1JL2A 4GVMA 2FC0A 2EMTA 2VG5A 3DXKB 4FJNA 3FZHA 4YOXA 3U6FA 1NK5A 4CZFA 2GWJA 1NJZA 1DEJA 4IOXA 3OYCA 4PQUA 1VRTA 3O8MA 1RT5A 3VERA 3OHRA 5M1NA 4R5PA 2E2NA 5FRMA 2RF2A 2RN2A 4C23A 5AZIB 4KTQA 3I8BA 3V1RA 5BR8K 1YJNN 4Y0WA 1WSHA 1N34K 1QZ6A 3VQEA 2WONA 1CZBA 5DM6L 2UUAK 1T7PA 3LP2A 1JXBA 2YX6A 2BANA 3PX4A 5ELZA 3SJHA 1MK9B 1E4FT 4CJTA 3KD1E 3LALA 3B6PA 2ITMA 3HJFA 4MQ3A 4JI7K 3KIOA 4EZ6A 2HBLA 4OO1J 1VQKN 4BC4A 1X1PA 1C1BA 2IAJA 4KHWA 1K73O 3KWGA 1FKPA 3OTOK 1LAWA 1RILA 5D3GA 5C2DA 3I33A 5GINA 3M8RA 4W5QA 4FLVA 3DLRA 5I42A 1JJ2M 3C7NA 3CC2N 3BP8A 1JLFA 4DFMA 2P9NA 3VA3A 1YXQA 1YTUA 1HJOA 2FJ9A 2NRWA 4E19A 3VQ7A 3ULDA 1DLOA 1RDAA 4O55A 4RW8A 3UKUB 5EOYA 4H03B 3WEEA 3FZMA 5AQQA 1NGAA 3LZJA 1ITGA 4CI6A 2COPA 2OPSA 3MXMA 2OCEA 1X3MA 1RT2A 1SV5A 3AU4A 3ALYA 3TI0A 4NO7A 3DAWA 1KAZA 1B9FA 1F21A 4MDBA 1ATNA 1QQOA 4FWNA 1YF5L 4FCYA 1IBMK 3HSCA 4YHHK 5IWAK 4Z4FA 1JLQA 3N4QA 1EP4A 5C0YA 1TGOA 1IJJA 2OPRA 4IFEA 3CC7N 4Z4HA 4BQLA 4KTWA 2Y1JA 5CYQA 5JS1A 3CI5A 4BRMA 4CJRA 1LWEA 2EHGA 4AHCA 3OYBA 2KHOA 1J53A 3F5TA 3VQ6A 5BREA 3NDKA 1G15A 5SWMA 1I94K 1QQMA 5AQOA 1XHXA 5C42A 2P9UA 4NCGA 4DSFA 1NTIA 1TK8A 4PUOA 2NRHA 5GADP 1Q86O 4FWOA 1CXUA 3M8SA 5AQKA 4Q5VA 3WXKA 1GLEG 4CJKA 3OS1A 3WQTA 4FJJA 5LJVA 5FPDA 1WAJA 4DSEA 2HHWA 1XNQK 3O4WA 3RSEA 1BIUA 4ZRIA 3RMDA 4DTSA 1K6YA 4M41A 3AVIA 3IS9A 4CHZA 3T3FA 4JN4A 1B92A 4BRGA 3S3MA 4H5VA 1BO5O 2ZGZA 4CEAA 2QTDA 1RDUA 3OVNA 1HKGA 4CFDA 2D0AA 3BINA 2ASMA 4WQ5C 1HMVA 2Q36A 2GTDA 3MWPA 3I56N 2RPIA 2EX3A 2KKZA 1A5VA 4EHTA 1WSJA 4FVMA 3MEDA 1BCMA 4BVPA 4WFNL 5J2MA 4DR4K 2VCPA 4QAGA 4YL8A 4RCHA 5HRRA 2QM1A 5HP1A 1VQ4N 1S72N 4F2RA 3K5LA 1EKEA 4DR2K 3LAMA 4JI8K 3DLEA 4FYDA 3J8AA 3LDPA 3CMAN 2D0OA 3L2QA 3G4SN 4TKNA 1BL3A 3S3OA 3AY9A 4J8FA 4K8XA 4J2AA 1NU0A 4BE0A 3VEOA 3E9LA 5JS2A 3EZ5A 1TL1A 1BGXT 2LBBA 2KLAA 1JLCA 3L2WA 1KLNA 3G25A 1XWLA 1WSEA 3L6QA 3WXMB 2HHXA 3UB5A 3D6RA 2IVOA 3M5RA 2HF4A 3PUFA 5EX5A 4O0JA 1QTMA 1HLUA 3FZKA 5TKWA 1WLJA 4LD0A 5JVLA 4HCCA 3MN7A 1YAGA 5C10A 4U67L 2D2QA 2D4WA 2F9WA 3FFIA 3AVNA 1RBTA 4FPAA 2BUPA 1RDWX 1KQSM 2VG6A 4B1YB 2CGJA 4CK1A 4DSIA 4HWIA 2D10A 5J2QA 3C7NB 4CJFA 4CZHA 2G8KA 2P9NB 1QVFM 4FM0A 2FSJA 4LF7K 3EY1A 1KFDA 1ILYA 4WE1A 4KH5A 4NYFA 4BRCA 4B9SA 2W40A 3VQ4A 4KO0A 2YHXA 3WEEB 4HHTA 4NXNK 3QBWA 1U2VA 4BRFA 1ZBIA 3NF8A 4BC2A 2XY8A 3VA0A 3O4QA 2HNDA 3RMBA 1HPMA 1SL1A 1BCOA 3WNFA 4BRNA 3K5MA 1WBDA 1GC7A 2P5OA 4CZKA 1ZYQA 4CJEA 1WAFA 4CZLA 4J2DA 3CHWA 3QIJA 4B1XB 1NGDA 1C0GA 2QWLA 3R8EA 3CXCM 3AO4A 5KPRA 1VSLA 2HBKA 4Z4GA 3DRPA 1UOCA 3MCPA 5M1PA 3HTVA 2GELA 1ASWA 4B9UA 4KRFA 1XQSC 4KH4A 2DFEA 4B9LA 2NRVA 1N36K 2UU9K 4CHYA 3R6MA 3IMXA 1W9HA 2QWMA 4H5TA 2P9UB 5KQ8A 1TK5A 3NF6A 4CYEA 4YNQA 4YORA 2CGLA 5BR9A 3H46O 2YCHA 1LWCA 3ZX3A 1RT6A 4KHUA 2FF3B 2PBDA 1VSDA 4FK4A 4CEEA 5JLFA 4H5NA 4G1QA 3THXB 4JAXA 4OX9K 1A5XA 4OGCA 2O8CA 2G8VA 3A0IX 2YVCA 3RSEB 3SMPA 4B9TA 4BRDA 3WXIA 4BR7A 1NK7A 4FJHA 4JK8A 4FLUA 3ID8A 1LW0A 3PZDA 4DQIA 1OVQA 3MMVA 4CEZA 4A2AA 3OW2M 4OKEA 4OPAA 2QA4N 2QK9A 3MAQA 2YHAA 3QNNA 2O8DA 1Q81O 3QEIA 4IJAA 1NJYA 3AVFA 1NG9A 1VQ7N 4DTUA 1J5EK 5FRNA 3C6UA 3OJSA 2O4IA 2VGNA 2XO7A 5KI6A 3QIPA 5LJWA 3CJBA 1NGFA 2QWOA 1IKXA 3PIOL 3CIPA 3VQBA 3NH2A 1WBBA 4FJ8A 4UY8O 4YOWA 4DUZK 1BHLA 1BG3A 1LWFA 3V9UA 3K5OA 2ETJA 4PL8A 4IWVA 2I5JA 1XC3A 1HRHA 1K8KA 3QLHA 4FLZA 4N56A 4F8RA 4NCAA 3OYGA 4HUFA 2X6SA 1RDBA 4Z4IA 4N5SA 3ENHA 3SLCA 4CGDA 3LM9A 3M8PA 1DTQA 3SJJA 1Y19B 1V4SA 4CHOA 5AQVA 4OPKA 4KB1A 3E01A 3O9UA 5HOOA 3TSPA 3S3NA 4JRPA 1ZC6A 4ISEA 4JI5K 2E4LA 3FP5A 2JWLA 3K57A 4NXMK 1EX4A 3H45C 2G8WA 4LC9B 4E89A 4B3OA 1FKOA 3TTCA 4B1UB 1C1AA 3D2EB 4CF9A 2HHSA 4DTNA 4FWSA 1GLAG 4CW7B 3TAFA 3SK3A 2O8BB 4LF9K 1TAUA 1D8YA 5HRPA 4E7IA 3VMFB 4OGEA 1NGGA 5FDLA 4WQ5A 4MO5A 1JDEA 2R7YA 3OY9A 3QEPA 3HZ6A 4FSVA 1UA0A 5BPNA 3P5JA 2RKIA 4CFCA 3GBTA 4M7YA 5B8HA 4BR2A 1SUQA 3CPWM 1FW6A 4LF8K 4FM2A 4K41A 4RTFD 5AQJA 5AQWA 3K58A 1IO2A 3O1WA 4IBNA 3VQQA 3V6DA 2P9LA 2OANA 4CD3A 4DG1A 3J80O 1SL2A 3THYA 4DR6K 1BWFO 5E26A 4LSLA 3R1XA 1TKTA 3HYFA 4P7IA 4EP5A 3QICA 4DU4A 3PIPL 1T3VA 1VBGA 4MDAA 3VQ8A 1OKJA 4DV6K 3OYHA 4KBOA 1U2VB 4JLHA 3ZETA 5KGXA 4V19S 4L8RB 2D0CA 4JHDB 4CF2A 4LFAK 3T1HK 3T7ZA 4WF9L 4B8AB 4CJVA 2G8HA 3ZYYX 2NUBA 5I9EB 3VTIA 1HYVA 3QNOA 4B1ZA 4GXBA 2P9SA 5FPEA 1L3UA 4M45A 3W0LA 1KBLA 1P90A 3DXMA 4Y1CA 2FF6A 4BR9A 4C8LA 2P9PA 3TTFA 2F9TA 4CD1A 3ITHA 2W42A 2DFFA 4E7JA 1D5AA 3R9PA 5C12A 4B3MK 3AARA 3L4IA 1XMOK 2O8FA 1VSKA 4W5RA 5KPZA 3OYEA 1WN7A 2V52B 3E1YA 2GX9A 3HOSA 3ZSYA 3VQDA 5LY3A 3SI6A 1EQYA 3CPEA 1OH7A 4EIAA 2HMPA 4FJ5A 3L3VA 4CZEA 3CJCA 4IKFA 3MX5A 1YI2N 1GC6A 1L5UA 2F96A 2UXBK 4CECA 1O13A 4GV9A 1JLEA 4QOZB 3TTDA 4CZMA 1N32K 4CESA 1NGIA 1CZ9A 2VG7A 3CCSN 3PSFA 4O44A 2QWPA 3DOLA 4JS4A 3HK2A 3T69A 1S1TA 3GDQA 3A8YA 2I1KA 5KQDA 3EL2A 1O1WA 3RWUA 4B9VA 1VSMA 2GBZA 4JK7A 3A2FA 3O9RA 3QDKA 1SAZA 3VESA 1ATRA 1RT1A 2IC3A 3V9SA 3LDNA 4YOTA 3WNEA 4DTJA 4DUYK 4OVLA 3UKRA 3CCRN 2Z1GA 3DM2A 3NFAA 3VQAA 5KRSA 2P5GA 4RW4A 1S3XA 4I2PA 3G6EN 3V9ZA 4ILGB 2WH5A 1ZBHA 4DTXA 4KPYA 3DMJA 3V1OA 2VGMA 4B3SK 1T03A 2H3GX 5E84A 3QFPA 4BACA 1K8KB 4IOAL 3AVLA 1NK4A 1V4TA 2D0BA 3TAMA 3U4LA 3V9XA 3ZEUA 1H1VA 1WUAA 2OTLN 3ENBA 3X23A 1HB8A 3CG7A 4DB3A 3C6HA 1TL3A 4DV5K 1JLAA 4C8KA 2PY5A 3HXMA 5AQTA 5FPMA 1VQPN 3Q7CA 3SPYA 1Z26A 2DY4A 4TSXA 3PX0A 3C0BA 4FJMA 1NKCA 1VSFA 1N33K 2XY5A 2JLEA 4I6MA 3DLKA 2OZSA 3EKUA 4NB4A 4BR0A 3G9WA 2RQ1A 3GG4A 1TAQA 3D7EO 3HVRA 3DJCA 3V1QA 1GOCA 2DIKA 3KD5E 3K5NA 3SQ1A 5AQGA 4C8OA 1VBHA 3O9SA 1NGCA 2XHBA 2E6LA 2XRIA 1L3TA 2JGUA 4YOVA 1KAXA 1QZ5A 5SZTA 4B8CA 3CQ8A 2HVIA 3O3HA 5FLXO 1XNRK 2O8EA 4CEFA 2J0KA 4JKCA 1Q18A 2HBJA 2HHQA 4Z0UA 3OS0A 3F9MA 3K59A 3VF2A 3VGKA 5BRHA 4DTPA 5AQXA 1NKBA 2GUPA 4O4GA 2PZSA 2P9LB 2Z1JA 5EU7A 4H5RA 3IUCA 1E5WA 3AU5A 4DV3K 1IV0A 3LDOA 3HVTA 3THWA 3QESA 4JI6K 4E1JA 3J7YP 3JS6A 4HUGA 3F73A 3SV3A 3SNNA 1VSJA 3ZETB 4JEPA 4KB0A 1GG3A 3AAPA 5GAGP 2J0MA 2WOMA 3EN9A 4HTLA 4QCLA 1IKWA 4K8ZA 4DV1K 3KK1A 4JKFA 3KJVA 3FR0A 2HSTA 5AQIA 2FSKA 1J19A 4CHQA 1C6VA 1MWMA 2W6KA 4AQYK 3U8ZA 2P9SB 1N6QA 3O9TA 2Z1HA 1TK0A 3CQYA 3P31A 5AQLA 3IG1A 4F7GA 5EY4A 5TKYA 2EWSA 3IVFA 3DXMB 1VQ9N 2P9PB 1VHXA 3D2FA 3DRRA 4BVOA 5M1FA 5J2NA 1NBWA 1YHQN 4CHNA 3HSTB 2VQEK 3HP6A 3NBPA 5AQYA 2AA4A 2E1YA 1Y64A 4PL7A 3BEXA 4YFUA 4RWTA 4CGIA 1LOTB 4CZJA 3CD6N 4K43A 1EXQA 3LM2A 3KHYA 4H8KA 2G8IA 2F4VK 3E66A 2HB5A 3J81O 4M3YA 4FPBA 5J1EA 5HRNA 4JKGA 5KTQA 4YOYA 1HNIA 4IDKA 3NE6A 3FZFA 2Q3SA 2X0SA 4IG0A 3BY5A 1EWQA 3MX2A 4F9OA 1KVCA 2A3ZA 2FLOA 1JKHA 2NRZA 1W2BM 3WNGA 3DRSA 3HPHA 4E7HA 2CH5A 1GLLO 1G99A 3T19A 4XEIA 1HNWK 1MU2A 5C24A 4CJUA 3WT0A 4IO8A 3KK3A 1VRUA 2KW4A 1HNZK 4ZRKA 3NMUA 2A5XA 4C1NI 3L8BA 1DIKA 1RT3A 3VEYA 4FL9A 4C1NK 3UKRB 1S9EA 3ZT3A 3L2RA 3TPQA 3LP1A 1SKRA 3TAGA 2RHKA 3SUOA 4MLEA 4FJXA 3AA5X 3SQ4A 4C8NA 2I7PA 2EMSA 3HP9A 3VEWA 2PYJA 1IH7A 4PKIA 4ILJA 4M3ZA 1T6CA 1NM1A 2YNGA 3T1AA 1ZBSA 5J2PA 3CYMA 1S1XA 2D1KA 3O1BA 4CFBA 3RRGA 4AHSA 3CMEN 1GLCG 4DF8A 1DGKN 3OYNA 1B9DA 4CHPA 1JCFA 2CQUA 1A5WA 1YT3A 4MLHA 4BDYA 3ZDTA 3ULEA 1TYQA 4CZGA 4O8UA 1WB9A 2ASPA 1P8ZA 2UYTA 3TANA 1X9JA 4ELVA 3L3UA 2ZJRL 3CJ1A 4XIUA 3A5LC 1RBSA 2OPPA 2IS3A 3H3OB 4DTOA 4L3QA 1XI1A 3RRHA 3PV8A 5I3UA 3CCMN 4KKOA 5M1KA 3D45A 2BDPA 3IAYA 4KI4A 3AVHA 5AQFA 4KHYA 3AGRA 1QSSA 1C0MA 2E88A 3VEXA 2GUIA 2O8EB 4BWJA 3QB0A 4EKUA 3OYLA 1RTHA 4IOCL 3HL8A 4BDPA 2IVPA 4CJPA 3SAHA 2NRRA 1GOAA 3C6AA 2Q31A 4J2EA 4XH4A 2Q2RA 3MXJA 1K8AO 2DTUA 1KCFA 2OTJN 3NGZA 3OYAA 5LMUK 4JD2A 1L3VA 3LPUA 4FLXA 4K42A 4FOEA 4CJ3A 3CFOA 3VPZA 5BN9A 3ZSXA 1L3SA 1UWBA 3ZX2A 1OVYA 2AEHA 3KK2A 4LFCK 3WQUA 2KZMA 1C0TA 1S1WA 1RGIA 1S1UA 3AVKA 4DV4K 4ZHRA 2R82A 3P4IA 1BA1A 5T7BA 4RW9A 2YKMA 2A41A 3KLGA 3CCVN 4OKJA 4AHTA 3QERA 4WFAL 4FJ9A 4M7XA 4GVEA 1XHZA 1BDGA 4BC3A 3D2FB 3PO5A 3LDQA 2Y1IA 5HBMA 2KFZA 3HO1A 4W5NA 2QWRA 2AJQA 4UQGA 3EPYA 4F3OA 1MA9B 4DV2K 1IG9A 4DSKA 3IRXA 4DR1K
chains in the Genus database with same CATH topology
3AU4A 2VYPA 3L0QA 3DWLA 1P90A 2FDQA 2E2OA 3DXMA 4JKBA 2HF3A 2FF6A 2WBNA 3DAWA 2P9PA 3K9JA 3LL3A 4NO7A 3TTFA 3PVLA 2F9TA 4BR9A 4CD1A 3E9OA 1EO1A 1KAZA 3D2EA 4JNEA 3ZEUB 3R9PA 5C12A 3AARA 1MIXA 3L4IA 1BUPA 1ATNA 4IXCA 4MDBA 5KPZA 2V52B 3E1YA 1QQOA 4FWNA 1YF5L 1KAYA 4JKGB 1Z05A 2GX9A 2WFBA 3HSCA 5LY3A 3HOSA 2ZJQL 4GV3A 1EQYA 3CPEA 3TU5A 4EIAA 1VQON 2HMPA 3N4QA 4CZEA 3CJCA 3P38A 2ZPYA 3MX5A 4BRQA 1GC6A 5JVGL 1YI2N 1IJJA 5C0YA 4BREA 5BN8A 4IFEA 3CC7N 4ILHA 1O13A 4BQLA 4GV9A 3KZBA 2YHWA 3SMSA 3H1VX 4MO4A 3CI5A 3TTDA 4BRMA 4CZMA 4I6MB 5C2FA 1NGIA 5BPMA 5AZJA 2KHOA 1NI2A 3F5TA 3MCAB 3U9ZA 1U6ZA 1H4RA 3A5OC 3CCSN 3O80A 5BRDA 5BREA 4BR5A 2E20A 1R59O 4A5BA 5MLCQ 4JKHA 1QQMA 5AQOA 3FE1A 2QWPA 2P9UA 2ASOA 3IFRA 1NTIA 1BA0A 4QS9A 4YOUA 1HUXA 3T69A 4BRLA 4G9ZA 1C0FA 2NRHA 3GDQA 3A8YA 5F2RA 5GADP 1Q7YO 1Q86O 4FWOA 2I1KA 4R79A 4DKWA 5AQKA 3J7ZO 5KQDA 3EL2A 3CCEN 3WXKA 1GLEG 3EE9A 3EKSA 5F1XA 3WQTA 2E8AA 5LJVA 4JK7A 5GAHP 3O9RA 3QDKA 5FPDA 5JLHA 1SAZA 3VESA 3BF1A 1ATRA 1X3NA 1NGBA 3O4WA 4FWLA 3RSEA 4CJ7A 5BPLA 5EXWA 4ZRIA 3IKMA 3NVKA 4JHDA 3LDNA 4YOTA 3VENA 4PKGA 3UKRA 3CCRN 1KC7A 3AGKA 4BRIA 4JN4A 3U9DA 1N8RO 4BG9A 3O6WA 3WXLA 4BRGA 1S3XA 3G6EN 3VOVA 4H5VA 1BO5O 4H0YB 4ILGB 2WH5A 5AQZA 2FSNA 4AF1A 2ZGZA 2QTDA 1RDUA 1HKGA 2VGMA 3P39A 3Q7BA 4XH5A 4AM7A 4A59A 2H3GX 3BINA 1HX1A 2ASMA 1JCEA 2P9IA 4O8KA 4WQ5C 4YDUC 5E84A 2Q36A 1GLFO 2GTDA 3MDQA 3PLAA 3QFPA 3MWPA 1ZXOA 3I56N 1K8KB 4IOAL 2KKZA 1V4TA 4DXAB 4EHTA 5AFUA 4BQZA 2YHYA 3U4LA 3ZEUA 4CBXA 1H1VA 1WUAA 3ULEB 1TYQB 2OTLN 3ENBA 3X23A 2I7NA 1HB8A 4BVPA 4FVUA 4DB3A 5GAEP 4WFNL 1D4XA 3E9PA 3C6HA 2P9KA 2VCPA 3GL1A 3CETA 3NVMA 5HL7L 1T6DA 2E1ZA 4YL8A 5AQTA 4H0TB 4RCHA 5FPMA 1VQPN 2QM1A 3CQXA 3Q7CA 1VQ4N 2V51B 4GNIA 1S72N 4JK9A 3LDLA 2A40A 3QFUA 1E4GT 5H1SQ 1NJIO 3C0BA 1VAZA 3ZX0A 1ACAA 2WC9A 3M6GA 3O08A 3VF6A 1VQMN 1MWKA 1IG8A 1M1KO 3J8AA 3LDPA 3F2KA 4I6MA 2D0OA 4A61A 5GIOA 3G4SN 3CMAN 4TKNA 4CBWA 2IVNA 3EKUA 4NB4A 2GWKA 4BR0A 3CCQN 3AY9A 4J8FA 3G9WA 2RQ1A 2Q0RA 3MN6A 3GG4A 4WQ4A 4H0XB 3D7EO 4WFBL 1T44A 3E9LA 3VEOA 3DXKA 1S22A 3VF4A 3DJCA 4PHTX 2DIKA 3CCJN 3VTHA 1QQNA 5AQGA 4JKDA 5AQRA 1M90O 2LBBA 3M1FA 2W41A 5M1OA 1VBHA 3O9SA 1NGCA 2KLAA 4A5AA 1YIJN 3EO3A 4ISFA 3FLVA 4FWQA 3G25A 5FPNA 4YOVA 3L6QA 1KAXA 1QZ5A 5M1QA 3KK7A 3WXMB 1VQ5N 3UB5A 2CH6A 3D6RA 4BRKA 2IVOA 5JMVA 3CCLN 4H0PA 4IDHA 3L4QA 3M5RA 2HF4A 2QEXN 2J0KA 4JKCA 1YUWA 1Q18A 5EX5A 1HLUA 2HBJA 3FZKA 5TKWA 3VETA 4B9QA 5AZIA 4PKHA 3F9MA 4WCEL 5JVLA 4JD2B 3VF2A 3W3DA 4FWKA 3SBGA 3VGKA 5BRHA 3MN7A 1YAGA 3CC4N 5C10A 2FXUA 2ZF5O 2D2QA 2E2QA 4U67L 2D4WA 2F9WA 5AQXA 4B1VA 2GUPA 2V7ZA 2P9LB 5AQSA 3EZWA 4FPAA 2BUPA 3VGLA 1RDWX 4H5RA 3IUCA 1KQSM 2YJFA 4B1YB 1E5WA 1MK7B 1SGHA 1ST7A 3AU5A 2CGJA 1DKGD 3LDOA 2YI1A 4NLBA 3HM8A 5AQNA 3CERA 4BRHA 2QI2A 3MK6A 4HWIA 3I55N 2D10A 4E1JA 1KC8O 3JS6A 2WUSA 4BRAA 1SQKA 3C7NB 2NRXA 2AP1A 3WA0A 3ZETB 4JEPA 4EFHA 4IEEA 4HDQA 4CZHA 1GG3A 2P9NB 3AAPA 3RVCA 5GAGP 2J0MA 5C15A 1QVFM 5AQMA 5F0XA 2FSJA 3EN9A 4A62A 4HTLA 1NLVA 1NVLA 1VQ8N 1ILYA 3DLLL 2JWKA 4JKFA 4KH5A 4BRCA 1KD1O 2W40A 3FR0A 2HSTA 5AQIA 2YHXA 2FSKA 3VEZA 3WEEB 1YITN 1J19A 1QHAA 3VEVA 1MWMA 3N4PA 1MIZB 4BROA 4IO9L 3QBWA 3JXUA 4GV6A 1U2VA 3U8ZA 1HKBA 1SS6A 3CJAA 2P9SB 4BRFA 3CJ7A 3HBTA 3O9TA 3CQYA 2QWQA 3P31A 1VQNN 5AQLA 5EY4A 4F7GA 5TKYA 4BC2A 5ADXA 2EWSA 4BC5A 3IVFA 3DXMB 5CE3A 2HOEA 1VQ9N 3BUZB 2P9PB 5AFUH 3D2FA 1HPMA 2NZTA 3H3NO 4BVOA 5M1FA 5KPTA 1NBWA 1NWKA 1YHQN 4BRNA 1GC7A 4CZKA 5DM7L 1XUPO 3UKUA 5AQYA 2AA4A 4NLCA 2E1YA 2HRJA 4CZLA 1Y64A 4FOIA 4DHYA 2I1JA 3QIJA 2NLXA 2VWBA 3BEXA 3CHWA 3R3LA 4B1XB 1NGDA 4PL7A 4BGAA 3GOIA 1C0GA 2QWLA 3R8EA 3CXCM 3M3ZA 3IDHA 4RWTA 2D11A 4JKAA 5KPRA 4CZJA 1LOTB 2HBKA 4EAHD 3CD6N 2QWNA 3U7DA 1QVGM 3MCPA 4K43A 3LM2A 3SAGA 3KHYA 2E2PA 5M1PA 3HTVA 1MDUB 2GELA 4BGBA 2HBMA 2ZJPL 1XQSC 3UE5A 3E66A 3B8AX 4IEIA 4FPBA 4KH4A 1YJ9N 3MN5A 2J0JA 2NRVA 5AZJB 4JKGA 4FWPA 4YOYA 2DPNA 1VQLN 3KWIA 1YVNA 3R6MA 3IMXA 2HE7A 2QWMA 3HOTA 4H5TA 3FZLA 3FZFA 1ESVA 2X0SA 3MWTA 2NNWA 2P9UB 2YJEA 5KQ8A 3MX2A 4F9OA 4CYEA 4QS7A 4YORA 2A3ZA 2FLOA 2NRZA 2CGLA 3AAQA 5BR9A 3H46O 4EHUA 2YCHA 1W2BM 1W97L 3K9KA 5AQUA 3ZX3A 1GLDG 4DQ8A 4ZRJA 5IJMA 2FF3B 2PBDA 3BF3A 3SAFA 2CH5A 1GLLO 1G99A 1SZ2A 4XEIA 5JLFA 4H5NA 2A42A 4FWRA 3C65A 3WT0A 4IO8A 3QBXA 4JAXA 3MN9A 1BU6O 3U8XA 3A0IX 4A57A 4ZRKA 4BG8A 3NMUA 2A5XA 4Z94A 2YVCA 2NRTA 4C1NI 3RSEB 4BR4A 3SMPA 3WUHA 5CHIA 1DIKA 5JVHL 4BRDA 3WXIA 4BR7A 3VEYA 4JK8A 4FL9A 4IJNA 3UKRB 4C1NK 3ID8A 3PZDA 4WQ4C 3TPQA 3TSUA 2BH1A 1K9MO 3VGMA 3ATUA 3MMVA 2RHKA 4WYBA 4A2AA 1YJWN 1VQ6N 3SBTA 3OW2M 4MLEA 4OPAA 4HDOA 2QA4N 3FFKB 3CF5L 3ENOA 4DCHA 4M63C 2I7PA 1Q81O 2PFUA 3H6EA 4IZ9A 2Q97A 2EMSA 4IJAA 2PAVA 1VQ7N 2P9IB 3VEWA 1KXPA 2VGNA 1NGHA 2D0PA 4H0VB 5LJWA 3CJBA 1NGFA 2QWOA 3HI0A 4H0OA 4PKIA 3PIOL 4ILJA 2AL6A 3CIPA 4CZIA 1T6CA 1NM1A 1TUUA 2ABDA 1GLBG 2RE2A 1ZBSA 3OBWA 3KVGA 3OBYA 1Z6RA 4UY8O 1RFQA 4YOWA 1BG3A 3ATVA 1JCGA 3A5MC 2D1KA 4GY2B 3O1BA 2P9KB 3ID6A 4OPHA 3GE1A 2QW9A 3CMEN 4PL8A 5CR4A 1GLCG 4IWVA 1XC3A 1NGEA 2BTFA 1DGKN 3TSQA 1K8KA 4U7BA 1NMDA 2QXLA 5AQPA 1EF1A 5GIPA 1LCUA 1JCFA 5BRFA 2CQUA 3OA9A 3H1QA 2V7YA 1NGJA 4MLHA 5ADXH 3ZDTA 4NY0A 4BY9C 3ENHA 3ULEA 1TYQA 3SLCA 4CZGA 4O8UA 4KH6A 2ASPA 2F7TA 3LM9A 2IIRA 1P8ZA 2UYTA 4H5WA 1X9JA 1Y19B 1V4SA 3CCUN 5AQVA 2EMTA 2Q1NA 1GLJO 3DXKB 3O9UA 3TSPA 5HOOA 1ZC6A 3CJ1A 3FZHA 3A5LC 4ISEA 3S41A 4YOXA 3G71N 2ZJRL 3H3OB 5JICA 1J6ZA 4ISGA 3FP5A 4L3QA 2JWLA 4BRPA 4CZFA 2GWJA 3H45C 3CCMN 4LC9B 1DEJA 4JKEA 4IOXA 2Q0UA 3TTCA 4B1UB 3D2EB 5M1KA 3O8MA 1ATSA 3VERA 3OHRA 4FWSA 5AQFA 1GLAG 3AGRA 5M1NA 1TUYA 2E88A 3VEXA 2E2NA 3QMLA 3QB0A 3SK3A 4C23A 4EKUA 5AZIB 2J4RA 3I8BA 4XH1A 4CBUA 4IOCL 1YJNN 4FO0A 4Y0WA 3FGUA 1ISNA 2IVPA 1QZ6A 4QS8A 3SAHA 3VMFB 2NRRA 1NGGA 3C6AA 3CJ9A 4AM6A 2Q31A 4YDUA 4WQ5A 4MO5A 4XH4A 2Q2RA 3HRGA 1K8AO 1JDEA 5DM6L 3HZ6A 4FSVA 1BOTO 3WXJA 2CB8A 5BPNA 2YX6A 1CZAN 3O9QA 2OTJN 3GBTA 4K25A 5ELZA 4M7YA 1MK9B 1E4FT 3SJHA 5B8HA 4BR2A 3CPWM 2GEMA 2ITMA 4JD2A 4K41A 4A2BA 4K42A 4RTFD 4FOEA 5AQJA 5AQWA 3VPZA 3O1WA 5BN9A 2HBLA 4OO1J 1VQKN 4BC4A 3O5BA 2ZGYA 3ZX2A 1OVYA 2OANA 2AEHA 2P9LA 3KWGA 4B1WB 4CD3A 3WQUA 1K73O 1Q82O 5C2DA 3A5NC 1BWFO 3I33A 5E26A 3R1XA 5GINA 4P7IA 3QICA 3PIPL 1RGIA 1T3VA 2A6AA 1VBGA 4O5FA 2R82A 3P4IA 1BA1A 1JJ2M 3C7NA 4MDAA 5AR0A 3CC2N 1OKJA 2A41A 4KBOA 1U2VB 3BP8A 3ZETA 3CCVN 1GGOA 2P9NA 4WFAL 4M7XA 3FLCO 1YXQA 4JHDB 4GVEA 1DT9A 1BDGA 1HJOA 2FJ9A 2NRWA 4BC3A 2ZWHA 3D2FB 5EVZA 3T7ZA 4WF9L 5AQHA 3LDQA 1WOQA 3UKUB 5EOYA 2QWRA 4H03B 1HBKA 3WEEA 3ZYYX 3FZMA 5I9EB 5AQQA 4FWMA 3VTIA 1NGAA 3EPYA 4CI6A 2COPA 1MA9B 1HB6A 4B1ZA 1HKCA 3EE8A 4GXBA 2CGKA 2P9SA 5FPEA 1X3MA 3W0LA 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  4JKD A;  4JKB A;  4ILJ A;  4JK9 A;  4JK7 A;  4JK8 A;  3E9O A;  4JKA A;  3SBT A;  4JKG B;  4JKC A;  4JKH A;  3ENB A;  3E66 A;  3E9P A;  3E9L A;  4JKE A;  3SBG A;  4JKG A;  4ILH A;  4ILG B; 
#chains in the Genus database with same CATH topology
 2A1R A;  3L0Q A;  3DWL A;  4KRE A;  2FDQ A;  2HF3 A;  2WBN A;  1TKX A;  3PVL A;  1EO1 A;  3AO2 A;  3K2P A;  1MIX A;  2B4J A;  1BUP A;  4IXC A;  1Q9Y A;  3HPG A;  2D5R A;  4JKG B;  1QQC A;  3AVC A;  3TU5 A;  1VQO N;  1RCH A;  4BRQ A;  2HMI A;  5BN8 A;  2UUC K;  3DLB A;  4ILH A;  3AVM A;  2FBX A;  4MO4 A;  3NGY A;  4O5B A;  5C2F A;  4CJL A;  3B6O A;  5BPM A;  5AZJ A;  4DFK A;  3O4N A;  3ZSZ A;  2W6L A;  1NI2 A;  2BE2 A;  3MCA B;  1U6Z A;  1OH6 A;  1RDD A;  3A5O C;  2ZM6 K;  3O80 A;  4BR5 A;  2E20 A;  1BQN A;  4A5B A;  4JKH A;  1JLG A;  3FE1 A;  2ASO A;  1BA0 A;  4QS9 A;  4YOU A;  4BRL A;  3JSM A;  3KTQ A;  1J54 A;  2KQ2 A;  4X62 K;  4G9Z A;  4O0I A;  4R79 A;  4DKW A;  1WSI A;  3QEX A;  3J7Z O;  3C95 A;  4LF6 K;  3CCE N;  3EKS A;  2E8A A;  5GAH P;  2OPQ A;  4FZY A;  1S9G A;  5JLH A;  1NGB A;  4OLB A;  4FWL A;  4CJ7 A;  4F2S A;  3IKM A;  3OYM A;  3RTV A;  3LAN A;  4PKG A;  1KC7 A;  2VQF K;  3AGK A;  3L2V A;  4BRI A;  3UIQ A;  1N8R O;  3EEQ A;  5AQZ A;  4AF1 A;  3MEG A;  4NYN A;  1D9D A;  4AM7 A;  3F9K A;  4KHP K;  4A59 A;  1HX1 A;  4YDU C;  1JCE A;  3ZLJ A;  3PLA A;  1RNH A;  1RT4 A;  1ZXO A;  4KHN A;  3CFR A;  5AFU A;  4DXA B;  3V9W A;  5C25 A;  4W5O A;  4BQZ A;  2YHY A;  5CZ2 A;  3ULE B;  1TYQ B;  3SPZ A;  4KTZ A;  1UAX A;  5K14 A;  4E1M A;  4DS4 A;  3E9P A;  1T8E A;  5HL7 L;  3NVM A;  2ZE2 A;  1T6D A;  2UXD K;  4YY3 K;  1S6Q A;  5KRT A;  2V51 B;  2QKB A;  4JK9 A;  3LDL A;  2A40 A;  5H1S Q;  1NJI O;  3VQP A;  1NNE A;  1VAZ A;  2YV0 X;  2XY7 A;  3LWL A;  1ACA A;  4FLT A;  2WC9 A;  1VQM N;  1MWK A;  1DTT A;  2O4G A;  1M1K O;  3F2K A;  4A61 A;  5GIO A;  4C8M A;  3CCQ N;  2GWK A;  5KGW A;  4CCH A;  3MN6 A;  1ZBF A;  5LL6 Z;  1T44 A;  3QIN A;  1CLQ A;  4H4M A;  4PHT X;  4ID5 A;  4IFV A;  3ZSO A;  4LSN A;  4JKD A;  5AQR A;  1M90 O;  1ZBU A;  3M1F A;  5M1O A;  3C94 A;  5CYM A;  4A5A A;  4M3W A;  4ISF A;  3FLV A;  4RW7 A;  5FPN A;  5M1Q A;  3CCL N;  5JMV A;  3J7A P;  1W7A A;  3ZT0 A;  2QEX N;  3KLF A;  3VET A;  1QS4 A;  4WCE L;  3QEV A;  1RTJ A;  3CM6 A;  4JD2 B;  3SBG A;  3CC4 N;  2FXU A;  4GKJ K;  2E2Q A;  1HPZ A;  4LY7 A;  3MXI A;  4FW1 A;  5AQS A;  3ZSR A;  4HUE A;  1WSG A;  1MK7 B;  2YI1 A;  4NLB A;  5AQN A;  3P1G A;  4BRH A;  3ZT2 A;  2QI2 A;  3MK6 A;  3I55 N;  2WUS A;  3KKR A;  1I39 A;  2O8C B;  3I0S A;  1NJX A;  3ZSW A;  3WA0 A;  4CJW A;  4HDQ A;  1KVA A;  3AVA A;  1JL1 A;  5F0X A;  2HHT A;  1NVL A;  3DLL L;  4E3S A;  1I3A A;  1KD1 O;  5CZ1 A;  3VEZ A;  2HHV A;  1RBU A;  4I7F A;  1R0A A;  3N4P A;  2O8D B;  3AA2 A;  1NK9 A;  1SKS A;  1SS6 A;  3CJ7 A;  2QWQ A;  4E1N A;  1RDC A;  4M3R A;  3NGI A;  3PX6 A;  3BDP A;  2G8F A;  5AFU H;  3H3N O;  2NZT A;  2YNI A;  5KPT A;  4FJI A;  1NWK A;  1BIS A;  3ASM A;  4AHR A;  1WNS A;  1TV6 A;  4AHV A;  1HQE A;  1U48 A;  2HRJ A;  3ZCM A;  1NJW A;  4N41 A;  3GOI A;  1VSI A;  3M3Z A;  3IDH A;  4X65 K;  4B3R K;  4JRQ A;  4JYA K;  3U7D A;  1QVG M;  1J5O A;  2OYQ A;  3SAG A;  3SQ2 A;  2HBM A;  2HNY A;  4RW6 A;  4DFJ A;  4E0D A;  4I9L A;  3UE5 A;  4IEI A;  2ZD1 A;  4CJ4 A;  2J0J A;  5AZJ B;  4X64 K;  4FWP A;  4M3U A;  3KWI A;  2VWJ A;  4BE2 A;  2HE7 A;  4FLY A;  1Z25 A;  3AVJ A;  3FZL A;  4JI2 K;  2YJE A;  4QS7 A;  3G10 A;  4CIF A;  3AAQ A;  3NH0 A;  4EHU A;  1W97 L;  3PSI A;  5AQU A;  4DQ8 A;  1GLD G;  3SCX A;  2FBT A;  4CGH A;  3BF3 A;  3SAF A;  4AIL C;  2A42 A;  1IKY A;  3C65 A;  4H4O A;  3QBX A;  3MN9 A;  1BU6 O;  3U8X A;  4A57 A;  4BG8 A;  2NRT A;  5IT9 O;  3NHG A;  4MFB A;  3NH1 A;  4WQ4 C;  1EWR A;  3VGM A;  1LV5 A;  3SBT A;  1U49 A;  4HDO A;  3CF5 L;  1U47 A;  3ENO A;  3QIO A;  4GMJ B;  4M63 C;  2F8T A;  2PFU A;  3H6E A;  4IZ9 A;  1X9W A;  2KFN A;  1KXP A;  4KI6 A;  2A1S A;  3AA4 A;  2D0P A;  3O3G A;  3P83 D;  2E6M A;  4OKK A;  2G8U A;  2RE2 A;  1GLB G;  3TAR A;  4LF5 K;  3KVG A;  3THY B;  1Z6R A;  4JV5 K;  2UXC K;  4PY5 A;  3ATV A;  4GY2 B;  4CGG A;  4OPH A;  3GE1 A;  4M3T A;  1J9A A;  5CR4 A;  4CER A;  2KZZ A;  2OZM A;  1NGE A;  2BTF A;  2WTU A;  3NCI A;  3TSQ A;  1U04 A;  2QXL A;  4CJQ A;  1EF1 A;  1RT7 A;  4DV0 K;  3OA9 A;  4E7K A;  5DK5 A;  4BY9 C;  4NY0 A;  4KH6 A;  2FBV A;  4DR5 K;  1BI4 A;  2F7T A;  1NOZ A;  3NF9 A;  3CCU N;  4FZX C;  3EYZ A;  1S5J A;  2Q1N A;  1GLJ O;  3S41 A;  3G71 N;  5JIC A;  1J6Z A;  4ISG A;  4BRP A;  1KRP A;  4CGF A;  2HHH K;  4KHS A;  4JKE A;  2Q0U A;  3RMA A;  1NK6 A;  1ATS A;  2O8F B;  1TUY A;  4FJ7 A;  3THX A;  1RTI A;  4F4K A;  3QML A;  1EET A;  2UUB K;  4I9Q A;  1FXX A;  2J4R A;  4XH1 A;  4CBU A;  4FO0 A;  3FGU A;  1ISN A;  2ATQ A;  4M42 A;  4QS8 A;  3TAP A;  2IOC A;  3CJ9 A;  4AM6 A;  4YDU A;  1JLB A;  3OS2 A;  1S1V A;  3HRG A;  1X9M A;  5HRO A;  3VQ9 A;  1IBL K;  1BOT O;  4FXD A;  3WXJ A;  2CB8 A;  1FK9 A;  4DQS A;  4OJR A;  1ASU A;  1CZA N;  3O9Q A;  1TKZ A;  3KLE A;  4K25 A;  1QHT A;  2GEM A;  2P1J A;  3SQ0 A;  4A2B A;  3LWM A;  1S6P A;  1QSY A;  4PWD A;  3O5B A;  4B9N A;  2ZGY A;  4B1W B;  2ITG A;  4JS5 A;  2HW3 A;  1Q82 O;  3A5N C;  3SUQ A;  4Y1D A;  3K0S A;  3SZ2 A;  4E7L A;  1ZBL A;  2A6A A;  2X74 A;  4O5F A;  4DMN A;  5AR0 A;  4RG8 A;  2X78 A;  1GGO A;  4CJ5 A;  1BQM A;  3FLC O;  3HPO A;  1DT9 A;  2YNF A;  1Y97 A;  2YNH A;  3HM9 A;  2ZWH A;  5EVZ A;  4CIG A;  5AQH A;  1KSP A;  1VSE A;  1WOQ A;  1HBK A;  4CVN E;  1KTQ A;  4FWM A;  4CFA A;  1HB6 A;  1HKC A;  3EE8 A;  2CGK A;  3AVB A;  4DLG A;  4B3T K;  4DU1 A;  3DI6 A;  5FRO A;  5CY4 A;  3VQC A;  2VYP A;  3BZK A;  2E2O A;  1T05 A;  4JKB A;  3K9J A;  3LL3 A;  4FW2 A;  3E9O A;  3D2E A;  4JNE A;  4FM1 A;  3ZEU B;  3M8Q A;  4W5T A;  4HCB A;  5DMR A;  1KAY A;  1Z05 A;  2WFB A;  4GV3 A;  3KLH A;  1LAV A;  2ZJQ L;  3AO3 A;  2O8B A;  1QE1 A;  3NF7 A;  3P38 A;  2ZPY A;  1C1C A;  3ZSV A;  5JVG L;  4BRE A;  3KZB A;  2YHW A;  4JI3 K;  3SMS A;  1CXQ A;  3H1V X;  1Q8I A;  4I6M B;  2IDO A;  3HT3 A;  3KKS A;  3U9Z A;  1H4R A;  2PYL A;  5BRD A;  2HVH A;  1R59 O;  5MLC Q;  3LDS A;  3AV9 A;  3DOK A;  3IFR A;  2Z1I A;  3CM5 A;  1HUX A;  1C0F A;  1NOY A;  3WNH A;  5F2R A;  5AJ3 K;  1Q7Y O;  4KHQ A;  2DFH A;  3EE9 A;  5F1X A;  1BIZ A;  4AHU A;  3ZT1 A;  3NAE A;  3BF1 A;  3MEE A;  1X3N A;  4FZZ A;  2B5J A;  3U3Y A;  3QEW A;  5BPL A;  5EXW A;  5HLF A;  3VN5 A;  3TR8 A;  2FBY A;  2GV9 A;  4JHD A;  3VEN A;  3OJU A;  3NVK A;  1TKD A;  3U9D A;  4BG9 A;  3MEC A;  4CE9 A;  3O6W A;  4DTM A;  3WXL A;  3CFP A;  1U45 A;  1D9F A;  3VOV A;  4IG3 A;  4H0Y B;  2FSN A;  1N5Y A;  4FJK A;  2YHB A;  3THW B;  3P39 A;  4XH5 A;  3Q7B A;  4CJS A;  3I0R A;  4O8K A;  1E3M A;  2P9I A;  3DYA A;  1GLF O;  3MDQ A;  4HVJ A;  3U3G A;  4BWM A;  1JXE A;  3QET A;  4CBX A;  4KAZ A;  4ZTJ A;  2I7N A;  3RR7 A;  4FVU A;  5GAE P;  1D4X A;  1BI4 B;  2P9K A;  3GL1 A;  3CET A;  3ISN C;  1ASV A;  3RR8 A;  2E1Z A;  3RMC A;  4H0T B;  3CQX A;  4KV8 A;  4GNI A;  3QFU A;  4JI4 K;  4EZ9 A;  1E4G T;  3ZX0 A;  4Z4E A;  3ZT4 A;  3OYJ A;  4FK0 A;  3M6G A;  3VF6 A;  3O08 A;  3LP3 A;  1IG8 A;  5E41 A;  1IBK K;  1HNV A;  4FJL A;  4CBW A;  2IVN A;  4B08 A;  1YVU A;  4FJG A;  2Q0R A;  4WQ4 A;  3AO5 A;  4H0X B;  1YTA A;  4WFB L;  1REV A;  1RTD A;  4GW6 A;  3DXK A;  1S22 A;  3VF4 A;  3CCJ N;  3VTH A;  1QQN A;  3DLG A;  2W41 A;  4PA1 A;  1YIJ N;  3EO3 A;  2P51 A;  1OH8 A;  4FWQ A;  1VQ5 N;  4OLA A;  4CEQ A;  3KK7 A;  3DLH A;  2CH6 A;  4BRK A;  3AVG A;  4H0P A;  4IDH A;  3L4Q A;  5HRS A;  1YUW A;  1HYZ A;  1HR0 K;  4DF4 A;  4B9Q A;  4JI0 K;  5AZI A;  4PKH A;  4DTR A;  4ZTF A;  4DV7 K;  4N76 A;  4K0K K;  3W3D A;  4FWK A;  3O3F A;  2ZF5 O;  4DS5 A;  4ID1 A;  4B1V A;  2V7Z A;  3OYF A;  2OA8 A;  3EZW A;  1UA1 A;  3VGL A;  4CF8 A;  4X66 K;  3T1Y K;  2YJF A;  3TAQ A;  3S9H A;  1SGH A;  1ST7 A;  1DKG D;  4DCH A;  3HM8 A;  3CER A;  1KC8 O;  3L2U A;  1XMQ K;  3AO1 A;  4BRA A;  1SQK A;  1IKV A;  2NRX A;  1LW2 A;  2AP1 A;  3AA3 A;  4EFH A;  4IEE A;  2E5L K;  4DSL A;  1W0H A;  4JI1 K;  1GOB A;  3RVC A;  4Z4C A;  1NK8 A;  5C15 A;  1HQU A;  5AQM A;  5A2Q O;  4A62 A;  4N47 A;  1NLV A;  1VQ8 N;  4ELU A;  2JWK A;  3LZI A;  1NKE A;  2X6N A;  4DQQ A;  1YIT N;  4CK3 A;  1QHA A;  3VEV A;  3BGR A;  3SV4 A;  3PY8 A;  1MIZ B;  4BRO A;  4IO9 L;  3JXU A;  2QXF A;  4GV6 A;  1HKB A;  3CJA A;  3BZC A;  3HBT A;  3TAE A;  1VQN N;  3JYT A;  5ADX A;  4BC5 A;  5CE3 A;  2HOE A;  3BUZ B;  4BDZ A;  1C0U A;  1KLM A;  4IFY A;  5DM7 L;  1XUP O;  3UKU A;  1XC9 A;  1Q9X A;  4NLC A;  4CF1 A;  4DHY A;  4FOI A;  2I1J A;  2NLX A;  2VWB A;  3OYK A;  3R3L A;  4BGA A;  1HNX K;  1X9S A;  2HHU A;  4FLW A;  3JAM O;  2D11 A;  4JKA A;  4EAH D;  1U4B A;  3SUN A;  2QWN A;  2XY6 A;  4F3T A;  1RBR A;  2E2P A;  3QO9 A;  4CIE A;  3ZSQ A;  1MDU B;  4BGB A;  2ZJP L;  4DLE A;  2B6A A;  4OPJ A;  4CK2 A;  3B8A X;  1YJ9 N;  3MN5 A;  2F8S A;  4DFP A;  3SUP A;  4DR7 K;  1VQL N;  2DPN A;  1YVN A;  1KVB A;  3HOT A;  1ESV A;  3MWT A;  2NNW A;  4CEB A;  1VK0 A;  4ICL A;  4DWI A;  3LPT A;  3TAB A;  3G0Z A;  3K9K A;  3LP0 A;  4CGJ A;  3H08 A;  3VQ5 A;  4ZRJ A;  5IJM A;  2BGG A;  4EP4 A;  1SZ2 A;  4FWR A;  1TVR A;  3TWH A;  2QKK A;  1KFS A;  4KFB A;  4FK2 A;  4Z94 A;  5JVH L;  4BR4 A;  3WUH A;  5CHI A;  4I2Q A;  2KTQ A;  1VSH A;  4DSJ A;  4GKK K;  4HTU A;  4B9M A;  2ZQB A;  4IJN A;  1QSL A;  3I8D A;  4NCB A;  1FJG K;  3TSU A;  2BH1 A;  1K9M O;  3ATU A;  1YJW N;  4AH9 A;  4WYB A;  3V81 A;  1VQ6 N;  4DU3 A;  1SKW A;  1RBV A;  3FFK B;  4LF4 K;  1HYS A;  3THV A;  3V4I A;  1WSF A;  2Q97 A;  2PAV A;  2P9I B;  4Q0B A;  4LFB K;  2LSN A;  4LH4 A;  1NGH A;  4DQP A;  4H0V B;  1HJR A;  4H0O A;  3HI0 A;  4CZI A;  2AL6 A;  4LH5 A;  3OYD A;  4ELT A;  1TUU A;  2ABD A;  4CF0 A;  3OBW A;  3OBY A;  1RFQ A;  4DQR A;  1SL0 A;  3KLI A;  1JCG A;  3A5M C;  2P9K B;  3ID6 A;  3OYI A;  4J2B A;  2YKN A;  4DR3 K;  2QW9 A;  4M3X A;  4BE1 A;  4CED A;  3PO4 A;  1NMN A;  2IGI A;  4CEO A;  4U7B A;  1NMD A;  3C6T A;  3LAK A;  5AQP A;  1NK0 A;  5GIP A;  1LCU A;  5BRF A;  3D0P A;  3H1Q A;  2V7Y A;  1NGJ A;  5ADX H;  5LMN K;  3SYZ A;  2HNZ A;  2IIR A;  2VWK A;  4H5W A;  1OH5 A;  1JL2 A;  4GVM A;  2FC0 A;  2EMT A;  2VG5 A;  3DXK B;  4FJN A;  3FZH A;  4YOX A;  3U6F A;  1NK5 A;  4CZF A;  2GWJ A;  1NJZ A;  1DEJ A;  4IOX A;  3OYC A;  4PQU A;  1VRT A;  3O8M A;  1RT5 A;  3VER A;  3OHR A;  5M1N A;  4R5P A;  2E2N A;  5FRM A;  2RF2 A;  2RN2 A;  4C23 A;  5AZI B;  4KTQ A;  3I8B A;  3V1R A;  5BR8 K;  1YJN N;  4Y0W A;  1WSH A;  1N34 K;  1QZ6 A;  3VQE A;  2WON A;  1CZB A;  5DM6 L;  2UUA K;  1T7P A;  3LP2 A;  1JXB A;  2YX6 A;  2BAN A;  3PX4 A;  5ELZ A;  3SJH A;  1MK9 B;  1E4F T;  4CJT A;  3KD1 E;  3LAL A;  3B6P A;  2ITM A;  3HJF A;  4MQ3 A;  4JI7 K;  3KIO A;  4EZ6 A;  2HBL A;  4OO1 J;  1VQK N;  4BC4 A;  1X1P A;  1C1B A;  2IAJ A;  4KHW A;  1K73 O;  3KWG A;  1FKP A;  3OTO K;  1LAW A;  1RIL A;  5D3G A;  5C2D A;  3I33 A;  5GIN A;  3M8R A;  4W5Q A;  4FLV A;  3DLR A;  5I42 A;  1JJ2 M;  3C7N A;  3CC2 N;  3BP8 A;  1JLF A;  4DFM A;  2P9N A;  3VA3 A;  1YXQ A;  1YTU A;  1HJO A;  2FJ9 A;  2NRW A;  4E19 A;  3VQ7 A;  3ULD A;  1DLO A;  1RDA A;  4O55 A;  4RW8 A;  3UKU B;  5EOY A;  4H03 B;  3WEE A;  3FZM A;  5AQQ A;  1NGA A;  3LZJ A;  1ITG A;  4CI6 A;  2COP A;  2OPS A;  3MXM A;  2OCE A;  1X3M A;  1RT2 A;  1SV5 A;  3AU4 A;  3ALY A;  3TI0 A;  4NO7 A;  3DAW A;  1KAZ A;  1B9F A;  1F21 A;  4MDB A;  1ATN A;  1QQO A;  4FWN A;  1YF5 L;  4FCY A;  1IBM K;  3HSC A;  4YHH K;  5IWA K;  4Z4F A;  1JLQ A;  3N4Q A;  1EP4 A;  5C0Y A;  1TGO A;  1IJJ A;  2OPR A;  4IFE A;  3CC7 N;  4Z4H A;  4BQL A;  4KTW A;  2Y1J A;  5CYQ A;  5JS1 A;  3CI5 A;  4BRM A;  4CJR A;  1LWE A;  2EHG A;  4AHC A;  3OYB A;  2KHO A;  1J53 A;  3F5T A;  3VQ6 A;  5BRE A;  3NDK A;  1G15 A;  5SWM A;  1I94 K;  1QQM A;  5AQO A;  1XHX A;  5C42 A;  2P9U A;  4NCG A;  4DSF A;  1NTI A;  1TK8 A;  4PUO A;  2NRH A;  5GAD P;  1Q86 O;  4FWO A;  1CXU A;  3M8S A;  5AQK A;  4Q5V A;  3WXK A;  1GLE G;  4CJK A;  3OS1 A;  3WQT A;  4FJJ A;  5LJV A;  5FPD A;  1WAJ A;  4DSE A;  2HHW A;  1XNQ K;  3O4W A;  3RSE A;  1BIU A;  4ZRI A;  3RMD A;  4DTS A;  1K6Y A;  4M41 A;  3AVI A;  3IS9 A;  4CHZ A;  3T3F A;  4JN4 A;  1B92 A;  4BRG A;  3S3M A;  4H5V A;  1BO5 O;  2ZGZ A;  4CEA A;  2QTD A;  1RDU A;  3OVN A;  1HKG A;  4CFD A;  2D0A A;  3BIN A;  2ASM A;  4WQ5 C;  1HMV A;  2Q36 A;  2GTD A;  3MWP A;  3I56 N;  2RPI A;  2EX3 A;  2KKZ A;  1A5V A;  4EHT A;  1WSJ A;  4FVM A;  3MED A;  1BCM A;  4BVP A;  4WFN L;  5J2M A;  4DR4 K;  2VCP A;  4QAG A;  4YL8 A;  4RCH A;  5HRR A;  2QM1 A;  5HP1 A;  1VQ4 N;  1S72 N;  4F2R A;  3K5L A;  1EKE A;  4DR2 K;  3LAM A;  4JI8 K;  3DLE A;  4FYD A;  3J8A A;  3LDP A;  3CMA N;  2D0O A;  3L2Q A;  3G4S N;  4TKN A;  1BL3 A;  3S3O A;  3AY9 A;  4J8F A;  4K8X A;  4J2A A;  1NU0 A;  4BE0 A;  3VEO A;  3E9L A;  5JS2 A;  3EZ5 A;  1TL1 A;  1BGX T;  2LBB A;  2KLA A;  1JLC A;  3L2W A;  1KLN A;  3G25 A;  1XWL A;  1WSE A;  3L6Q A;  3WXM B;  2HHX A;  3UB5 A;  3D6R A;  2IVO A;  3M5R A;  2HF4 A;  3PUF A;  5EX5 A;  4O0J A;  1QTM A;  1HLU A;  3FZK A;  5TKW A;  1WLJ A;  4LD0 A;  5JVL A;  4HCC A;  3MN7 A;  1YAG A;  5C10 A;  4U67 L;  2D2Q A;  2D4W A;  2F9W A;  3FFI A;  3AVN A;  1RBT A;  4FPA A;  2BUP A;  1RDW X;  1KQS M;  2VG6 A;  4B1Y B;  2CGJ A;  4CK1 A;  4DSI A;  4HWI A;  2D10 A;  5J2Q A;  3C7N B;  4CJF A;  4CZH A;  2G8K A;  2P9N B;  1QVF M;  4FM0 A;  2FSJ A;  4LF7 K;  3EY1 A;  1KFD A;  1ILY A;  4WE1 A;  4KH5 A;  4NYF A;  4BRC A;  4B9S A;  2W40 A;  3VQ4 A;  4KO0 A;  2YHX A;  3WEE B;  4HHT A;  4NXN K;  3QBW A;  1U2V A;  4BRF A;  1ZBI A;  3NF8 A;  4BC2 A;  2XY8 A;  3VA0 A;  3O4Q A;  2HND A;  3RMB A;  1HPM A;  1SL1 A;  1BCO A;  3WNF A;  4BRN A;  3K5M A;  1WBD A;  1GC7 A;  2P5O A;  4CZK A;  1ZYQ A;  4CJE A;  1WAF A;  4CZL A;  4J2D A;  3CHW A;  3QIJ A;  4B1X B;  1NGD A;  1C0G A;  2QWL A;  3R8E A;  3CXC M;  3AO4 A;  5KPR A;  1VSL A;  2HBK A;  4Z4G A;  3DRP A;  1UOC A;  3MCP A;  5M1P A;  3HTV A;  2GEL A;  1ASW A;  4B9U A;  4KRF A;  1XQS C;  4KH4 A;  2DFE A;  4B9L A;  2NRV A;  1N36 K;  2UU9 K;  4CHY A;  3R6M A;  3IMX A;  1W9H A;  2QWM A;  4H5T A;  2P9U B;  5KQ8 A;  1TK5 A;  3NF6 A;  4CYE A;  4YNQ A;  4YOR A;  2CGL A;  5BR9 A;  3H46 O;  2YCH A;  1LWC A;  3ZX3 A;  1RT6 A;  4KHU A;  2FF3 B;  2PBD A;  1VSD A;  4FK4 A;  4CEE A;  5JLF A;  4H5N A;  4G1Q A;  3THX B;  4JAX A;  4OX9 K;  1A5X A;  4OGC A;  2O8C A;  2G8V A;  3A0I X;  2YVC A;  3RSE B;  3SMP A;  4B9T A;  4BRD A;  3WXI A;  4BR7 A;  1NK7 A;  4FJH A;  4JK8 A;  4FLU A;  3ID8 A;  1LW0 A;  3PZD A;  4DQI A;  1OVQ A;  3MMV A;  4CEZ A;  4A2A A;  3OW2 M;  4OKE A;  4OPA A;  2QA4 N;  2QK9 A;  3MAQ A;  2YHA A;  3QNN A;  2O8D A;  1Q81 O;  3QEI A;  4IJA A;  1NJY A;  3AVF A;  1NG9 A;  1VQ7 N;  4DTU A;  1J5E K;  5FRN A;  3C6U A;  3OJS A;  2O4I A;  2VGN A;  2XO7 A;  5KI6 A;  3QIP A;  5LJW A;  3CJB A;  1NGF A;  2QWO A;  1IKX A;  3PIO L;  3CIP A;  3VQB A;  3NH2 A;  1WBB A;  4FJ8 A;  4UY8 O;  4YOW A;  4DUZ K;  1BHL A;  1BG3 A;  1LWF A;  3V9U A;  3K5O A;  2ETJ A;  4PL8 A;  4IWV A;  2I5J A;  1XC3 A;  1HRH A;  1K8K A;  3QLH A;  4FLZ A;  4N56 A;  4F8R A;  4NCA A;  3OYG A;  4HUF A;  2X6S A;  1RDB A;  4Z4I A;  4N5S A;  3ENH A;  3SLC A;  4CGD A;  3LM9 A;  3M8P A;  1DTQ A;  3SJJ A;  1Y19 B;  1V4S A;  4CHO A;  5AQV A;  4OPK A;  4KB1 A;  3E01 A;  3O9U A;  5HOO A;  3TSP A;  3S3N A;  4JRP A;  1ZC6 A;  4ISE A;  4JI5 K;  2E4L A;  3FP5 A;  2JWL A;  3K57 A;  4NXM K;  1EX4 A;  3H45 C;  2G8W A;  4LC9 B;  4E89 A;  4B3O A;  1FKO A;  3TTC A;  4B1U B;  1C1A A;  3D2E B;  4CF9 A;  2HHS A;  4DTN A;  4FWS A;  1GLA G;  4CW7 B;  3TAF A;  3SK3 A;  2O8B B;  4LF9 K;  1TAU A;  1D8Y A;  5HRP A;  4E7I A;  3VMF B;  4OGE A;  1NGG A;  5FDL A;  4WQ5 A;  4MO5 A;  1JDE A;  2R7Y A;  3OY9 A;  3QEP A;  3HZ6 A;  4FSV A;  1UA0 A;  5BPN A;  3P5J A;  2RKI A;  4CFC A;  3GBT A;  4M7Y A;  5B8H A;  4BR2 A;  1SUQ A;  3CPW M;  1FW6 A;  4LF8 K;  4FM2 A;  4K41 A;  4RTF D;  5AQJ A;  5AQW A;  3K58 A;  1IO2 A;  3O1W A;  4IBN A;  3VQQ A;  3V6D A;  2P9L A;  2OAN A;  4CD3 A;  4DG1 A;  3J80 O;  1SL2 A;  3THY A;  4DR6 K;  1BWF O;  5E26 A;  4LSL A;  3R1X A;  1TKT A;  3HYF A;  4P7I A;  4EP5 A;  3QIC A;  4DU4 A;  3PIP L;  1T3V A;  1VBG A;  4MDA A;  3VQ8 A;  1OKJ A;  4DV6 K;  3OYH A;  4KBO A;  1U2V B;  4JLH A;  3ZET A;  5KGX A;  4V19 S;  4L8R B;  2D0C A;  4JHD B;  4CF2 A;  4LFA K;  3T1H K;  3T7Z A;  4WF9 L;  4B8A B;  4CJV A;  2G8H A;  3ZYY X;  2NUB A;  5I9E B;  3VTI A;  1HYV A;  3QNO A;  4B1Z A;  4GXB A;  2P9S A;  5FPE A;  1L3U A;  4M45 A;  3W0L A;  1KBL A;  1P90 A;  3DXM A;  4Y1C A;  2FF6 A;  4BR9 A;  4C8L A;  2P9P A;  3TTF A;  2F9T A;  4CD1 A;  3ITH A;  2W42 A;  2DFF A;  4E7J A;  1D5A A;  3R9P A;  5C12 A;  4B3M K;  3AAR A;  3L4I A;  1XMO K;  2O8F A;  1VSK A;  4W5R A;  5KPZ A;  3OYE A;  1WN7 A;  2V52 B;  3E1Y A;  2GX9 A;  3HOS A;  3ZSY A;  3VQD A;  5LY3 A;  3SI6 A;  1EQY A;  3CPE A;  1OH7 A;  4EIA A;  2HMP A;  4FJ5 A;  3L3V A;  4CZE A;  3CJC A;  4IKF A;  3MX5 A;  1YI2 N;  1GC6 A;  1L5U A;  2F96 A;  2UXB K;  4CEC A;  1O13 A;  4GV9 A;  1JLE A;  4QOZ B;  3TTD A;  4CZM A;  1N32 K;  4CES A;  1NGI A;  1CZ9 A;  2VG7 A;  3CCS N;  3PSF A;  4O44 A;  2QWP A;  3DOL A;  4JS4 A;  3HK2 A;  3T69 A;  1S1T A;  3GDQ A;  3A8Y A;  2I1K A;  5KQD A;  3EL2 A;  1O1W A;  3RWU A;  4B9V A;  1VSM A;  2GBZ A;  4JK7 A;  3A2F A;  3O9R A;  3QDK A;  1SAZ A;  3VES A;  1ATR A;  1RT1 A;  2IC3 A;  3V9S A;  3LDN A;  4YOT A;  3WNE A;  4DTJ A;  4DUY K;  4OVL A;  3UKR A;  3CCR N;  2Z1G A;  3DM2 A;  3NFA A;  3VQA A;  5KRS A;  2P5G A;  4RW4 A;  1S3X A;  4I2P A;  3G6E N;  3V9Z A;  4ILG B;  2WH5 A;  1ZBH A;  4DTX A;  4KPY A;  3DMJ A;  3V1O A;  2VGM A;  4B3S K;  1T03 A;  2H3G X;  5E84 A;  3QFP A;  4BAC A;  1K8K B;  4IOA L;  3AVL A;  1NK4 A;  1V4T A;  2D0B A;  3TAM A;  3U4L A;  3V9X A;  3ZEU A;  1H1V A;  1WUA A;  2OTL N;  3ENB A;  3X23 A;  1HB8 A;  3CG7 A;  4DB3 A;  3C6H A;  1TL3 A;  4DV5 K;  1JLA A;  4C8K A;  2PY5 A;  3HXM A;  5AQT A;  5FPM A;  1VQP N;  3Q7C A;  3SPY A;  1Z26 A;  2DY4 A;  4TSX A;  3PX0 A;  3C0B A;  4FJM A;  1NKC A;  1VSF A;  1N33 K;  2XY5 A;  2JLE A;  4I6M A;  3DLK A;  2OZS A;  3EKU A;  4NB4 A;  4BR0 A;  3G9W A;  2RQ1 A;  3GG4 A;  1TAQ A;  3D7E O;  3HVR A;  3DJC A;  3V1Q A;  1GOC A;  2DIK A;  3KD5 E;  3K5N A;  3SQ1 A;  5AQG A;  4C8O A;  1VBH A;  3O9S A;  1NGC A;  2XHB A;  2E6L A;  2XRI A;  1L3T A;  2JGU A;  4YOV A;  1KAX A;  1QZ5 A;  5SZT A;  4B8C A;  3CQ8 A;  2HVI A;  3O3H A;  5FLX O;  1XNR K;  2O8E A;  4CEF A;  2J0K A;  4JKC A;  1Q18 A;  2HBJ A;  2HHQ A;  4Z0U A;  3OS0 A;  3F9M A;  3K59 A;  3VF2 A;  3VGK A;  5BRH A;  4DTP A;  5AQX A;  1NKB A;  2GUP A;  4O4G A;  2PZS A;  2P9L B;  2Z1J A;  5EU7 A;  4H5R A;  3IUC A;  1E5W A;  3AU5 A;  4DV3 K;  1IV0 A;  3LDO A;  3HVT A;  3THW A;  3QES A;  4JI6 K;  4E1J A;  3J7Y P;  3JS6 A;  4HUG A;  3F73 A;  3SV3 A;  3SNN A;  1VSJ A;  3ZET B;  4JEP A;  4KB0 A;  1GG3 A;  3AAP A;  5GAG P;  2J0M A;  2WOM A;  3EN9 A;  4HTL A;  4QCL A;  1IKW A;  4K8Z A;  4DV1 K;  3KK1 A;  4JKF A;  3KJV A;  3FR0 A;  2HST A;  5AQI A;  2FSK A;  1J19 A;  4CHQ A;  1C6V A;  1MWM A;  2W6K A;  4AQY K;  3U8Z A;  2P9S B;  1N6Q A;  3O9T A;  2Z1H A;  1TK0 A;  3CQY A;  3P31 A;  5AQL A;  3IG1 A;  4F7G A;  5EY4 A;  5TKY A;  2EWS A;  3IVF A;  3DXM B;  1VQ9 N;  2P9P B;  1VHX A;  3D2F A;  3DRR A;  4BVO A;  5M1F A;  5J2N A;  1NBW A;  1YHQ N;  4CHN A;  3HST B;  2VQE K;  3HP6 A;  3NBP A;  5AQY A;  2AA4 A;  2E1Y A;  1Y64 A;  4PL7 A;  3BEX A;  4YFU A;  4RWT A;  4CGI A;  1LOT B;  4CZJ A;  3CD6 N;  4K43 A;  1EXQ A;  3LM2 A;  3KHY A;  4H8K A;  2G8I A;  2F4V K;  3E66 A;  2HB5 A;  3J81 O;  4M3Y A;  4FPB A;  5J1E A;  5HRN A;  4JKG A;  5KTQ A;  4YOY A;  1HNI A;  4IDK A;  3NE6 A;  3FZF A;  2Q3S A;  2X0S A;  4IG0 A;  3BY5 A;  1EWQ A;  3MX2 A;  4F9O A;  1KVC A;  2A3Z A;  2FLO A;  1JKH A;  2NRZ A;  1W2B M;  3WNG A;  3DRS A;  3HPH A;  4E7H A;  2CH5 A;  1GLL O;  1G99 A;  3T19 A;  4XEI A;  1HNW K;  1MU2 A;  5C24 A;  4CJU A;  3WT0 A;  4IO8 A;  3KK3 A;  1VRU A;  2KW4 A;  1HNZ K;  4ZRK A;  3NMU A;  2A5X A;  4C1N I;  3L8B A;  1DIK A;  1RT3 A;  3VEY A;  4FL9 A;  4C1N K;  3UKR B;  1S9E A;  3ZT3 A;  3L2R A;  3TPQ A;  3LP1 A;  1SKR A;  3TAG A;  2RHK A;  3SUO A;  4MLE A;  4FJX A;  3AA5 X;  3SQ4 A;  4C8N A;  2I7P A;  2EMS A;  3HP9 A;  3VEW A;  2PYJ A;  1IH7 A;  4PKI A;  4ILJ A;  4M3Z A;  1T6C A;  1NM1 A;  2YNG A;  3T1A A;  1ZBS A;  5J2P A;  3CYM A;  1S1X A;  2D1K A;  3O1B A;  4CFB A;  3RRG A;  4AHS A;  3CME N;  1GLC G;  4DF8 A;  1DGK N;  3OYN A;  1B9D A;  4CHP A;  1JCF A;  2CQU A;  1A5W A;  1YT3 A;  4MLH A;  4BDY A;  3ZDT A;  3ULE A;  1TYQ A;  4CZG A;  4O8U A;  1WB9 A;  2ASP A;  1P8Z A;  2UYT A;  3TAN A;  1X9J A;  4ELV A;  3L3U A;  2ZJR L;  3CJ1 A;  4XIU A;  3A5L C;  1RBS A;  2OPP A;  2IS3 A;  3H3O B;  4DTO A;  4L3Q A;  1XI1 A;  3RRH A;  3PV8 A;  5I3U A;  3CCM N;  4KKO A;  5M1K A;  3D45 A;  2BDP A;  3IAY A;  4KI4 A;  3AVH A;  5AQF A;  4KHY A;  3AGR A;  1QSS A;  1C0M A;  2E88 A;  3VEX A;  2GUI A;  2O8E B;  4BWJ A;  3QB0 A;  4EKU A;  3OYL A;  1RTH A;  4IOC L;  3HL8 A;  4BDP A;  2IVP A;  4CJP A;  3SAH A;  2NRR A;  1GOA A;  3C6A A;  2Q31 A;  4J2E A;  4XH4 A;  2Q2R A;  3MXJ A;  1K8A O;  2DTU A;  1KCF A;  2OTJ N;  3NGZ A;  3OYA A;  5LMU K;  4JD2 A;  1L3V A;  3LPU A;  4FLX A;  4K42 A;  4FOE A;  4CJ3 A;  3CFO A;  3VPZ A;  5BN9 A;  3ZSX A;  1L3S A;  1UWB A;  3ZX2 A;  1OVY A;  2AEH A;  3KK2 A;  4LFC K;  3WQU A;  2KZM A;  1C0T A;  1S1W A;  1RGI A;  1S1U A;  3AVK A;  4DV4 K;  4ZHR A;  2R82 A;  3P4I A;  1BA1 A;  5T7B A;  4RW9 A;  2YKM A;  2A41 A;  3KLG A;  3CCV N;  4OKJ A;  4AHT A;  3QER A;  4WFA L;  4FJ9 A;  4M7X A;  4GVE A;  1XHZ A;  1BDG A;  4BC3 A;  3D2F B;  3PO5 A;  3LDQ A;  2Y1I A;  5HBM A;  2KFZ A;  3HO1 A;  4W5N A;  2QWR A;  2AJQ A;  4UQG A;  3EPY A;  4F3O A;  1MA9 B;  4DV2 K;  1IG9 A;  4DSK A;  3IRX A;  4DR1 K; 
#chains in the Genus database with same CATH homology
 3AU4 A;  2VYP A;  3L0Q A;  3DWL A;  1P90 A;  2FDQ A;  2E2O A;  3DXM A;  4JKB A;  2HF3 A;  2FF6 A;  2WBN A;  3DAW A;  2P9P A;  3K9J A;  3LL3 A;  4NO7 A;  3TTF A;  3PVL A;  2F9T A;  4BR9 A;  4CD1 A;  3E9O A;  1EO1 A;  1KAZ A;  3D2E A;  4JNE A;  3ZEU B;  3R9P A;  5C12 A;  3AAR A;  1MIX A;  3L4I A;  1BUP A;  1ATN A;  4IXC A;  4MDB A;  5KPZ A;  2V52 B;  3E1Y A;  1QQO A;  4FWN A;  1YF5 L;  1KAY A;  4JKG B;  1Z05 A;  2GX9 A;  2WFB A;  3HSC A;  5LY3 A;  3HOS A;  2ZJQ L;  4GV3 A;  1EQY A;  3CPE A;  3TU5 A;  4EIA A;  1VQO N;  2HMP A;  3N4Q A;  4CZE A;  3CJC A;  3P38 A;  2ZPY A;  3MX5 A;  4BRQ A;  1GC6 A;  5JVG L;  1YI2 N;  1IJJ A;  5C0Y A;  4BRE A;  5BN8 A;  4IFE A;  3CC7 N;  4ILH A;  1O13 A;  4BQL A;  4GV9 A;  3KZB A;  2YHW A;  3SMS A;  3H1V X;  4MO4 A;  3CI5 A;  3TTD A;  4BRM A;  4CZM A;  4I6M B;  5C2F A;  1NGI A;  5BPM A;  5AZJ A;  2KHO A;  1NI2 A;  3F5T A;  3MCA B;  3U9Z A;  1U6Z A;  1H4R A;  3A5O C;  3CCS N;  3O80 A;  5BRD A;  5BRE A;  4BR5 A;  2E20 A;  1R59 O;  4A5B A;  5MLC Q;  4JKH A;  1QQM A;  5AQO A;  3FE1 A;  2QWP A;  2P9U A;  2ASO A;  3IFR A;  1NTI A;  1BA0 A;  4QS9 A;  4YOU A;  1HUX A;  3T69 A;  4BRL A;  4G9Z A;  1C0F A;  2NRH A;  3GDQ A;  3A8Y A;  5F2R A;  5GAD P;  1Q7Y O;  1Q86 O;  4FWO A;  2I1K A;  4R79 A;  4DKW A;  5AQK A;  3J7Z O;  5KQD A;  3EL2 A;  3CCE N;  3WXK A;  1GLE G;  3EE9 A;  3EKS A;  5F1X A;  3WQT A;  2E8A A;  5LJV A;  4JK7 A;  5GAH P;  3O9R A;  3QDK A;  5FPD A;  5JLH A;  1SAZ A;  3VES A;  3BF1 A;  1ATR A;  1X3N A;  1NGB A;  3O4W A;  4FWL A;  3RSE A;  4CJ7 A;  5BPL A;  5EXW A;  4ZRI A;  3IKM A;  3NVK A;  4JHD A;  3LDN A;  4YOT A;  3VEN A;  4PKG A;  3UKR A;  3CCR N;  1KC7 A;  3AGK A;  4BRI A;  4JN4 A;  3U9D A;  1N8R O;  4BG9 A;  3O6W A;  3WXL A;  4BRG A;  1S3X A;  3G6E N;  3VOV A;  4H5V A;  1BO5 O;  4H0Y B;  4ILG B;  2WH5 A;  5AQZ A;  2FSN A;  4AF1 A;  2ZGZ A;  2QTD A;  1RDU A;  1HKG A;  2VGM A;  3P39 A;  3Q7B A;  4XH5 A;  4AM7 A;  4A59 A;  2H3G X;  3BIN A;  1HX1 A;  2ASM A;  1JCE A;  2P9I A;  4O8K A;  4WQ5 C;  4YDU C;  5E84 A;  2Q36 A;  1GLF O;  2GTD A;  3MDQ A;  3PLA A;  3QFP A;  3MWP A;  1ZXO A;  3I56 N;  1K8K B;  4IOA L;  2KKZ A;  1V4T A;  4DXA B;  4EHT A;  5AFU A;  4BQZ A;  2YHY A;  3U4L A;  3ZEU A;  4CBX A;  1H1V A;  1WUA A;  3ULE B;  1TYQ B;  2OTL N;  3ENB A;  3X23 A;  2I7N A;  1HB8 A;  4BVP A;  4FVU A;  4DB3 A;  5GAE P;  4WFN L;  1D4X A;  3E9P A;  3C6H A;  2P9K A;  2VCP A;  3GL1 A;  3CET A;  3NVM A;  5HL7 L;  1T6D A;  2E1Z A;  4YL8 A;  5AQT A;  4H0T B;  4RCH A;  5FPM A;  1VQP N;  2QM1 A;  3CQX A;  3Q7C A;  1VQ4 N;  2V51 B;  4GNI A;  1S72 N;  4JK9 A;  3LDL A;  2A40 A;  3QFU A;  1E4G T;  5H1S Q;  1NJI O;  3C0B A;  1VAZ A;  3ZX0 A;  1ACA A;  2WC9 A;  3M6G A;  3O08 A;  3VF6 A;  1VQM N;  1MWK A;  1IG8 A;  1M1K O;  3J8A A;  3LDP A;  3F2K A;  4I6M A;  2D0O A;  4A61 A;  5GIO A;  3G4S N;  3CMA N;  4TKN A;  4CBW A;  2IVN A;  3EKU A;  4NB4 A;  2GWK A;  4BR0 A;  3CCQ N;  3AY9 A;  4J8F A;  3G9W A;  2RQ1 A;  2Q0R A;  3MN6 A;  3GG4 A;  4WQ4 A;  4H0X B;  3D7E O;  4WFB L;  1T44 A;  3E9L A;  3VEO A;  3DXK A;  1S22 A;  3VF4 A;  3DJC A;  4PHT X;  2DIK A;  3CCJ N;  3VTH A;  1QQN A;  5AQG A;  4JKD A;  5AQR A;  1M90 O;  2LBB A;  3M1F A;  2W41 A;  5M1O A;  1VBH A;  3O9S A;  1NGC A;  2KLA A;  4A5A A;  1YIJ N;  3EO3 A;  4ISF A;  3FLV A;  4FWQ A;  3G25 A;  5FPN A;  4YOV A;  3L6Q A;  1KAX A;  1QZ5 A;  5M1Q A;  3KK7 A;  3WXM B;  1VQ5 N;  3UB5 A;  2CH6 A;  3D6R A;  4BRK A;  2IVO A;  5JMV A;  3CCL N;  4H0P A;  4IDH A;  3L4Q A;  3M5R A;  2HF4 A;  2QEX N;  2J0K A;  4JKC A;  1YUW A;  1Q18 A;  5EX5 A;  1HLU A;  2HBJ A;  3FZK A;  5TKW A;  3VET A;  4B9Q A;  5AZI A;  4PKH A;  3F9M A;  4WCE L;  5JVL A;  4JD2 B;  3VF2 A;  3W3D A;  4FWK A;  3SBG A;  3VGK A;  5BRH A;  3MN7 A;  1YAG A;  3CC4 N;  5C10 A;  2FXU A;  2ZF5 O;  2D2Q A;  2E2Q A;  4U67 L;  2D4W A;  2F9W A;  5AQX A;  4B1V A;  2GUP A;  2V7Z A;  2P9L B;  5AQS A;  3EZW A;  4FPA A;  2BUP A;  3VGL A;  1RDW X;  4H5R A;  3IUC A;  1KQS M;  2YJF A;  4B1Y B;  1E5W A;  1MK7 B;  1SGH A;  1ST7 A;  3AU5 A;  2CGJ A;  1DKG D;  3LDO A;  2YI1 A;  4NLB A;  3HM8 A;  5AQN A;  3CER A;  4BRH A;  2QI2 A;  3MK6 A;  4HWI A;  3I55 N;  2D10 A;  4E1J A;  1KC8 O;  3JS6 A;  2WUS A;  4BRA A;  1SQK A;  3C7N B;  2NRX A;  2AP1 A;  3WA0 A;  3ZET B;  4JEP A;  4EFH A;  4IEE A;  4HDQ A;  4CZH A;  1GG3 A;  2P9N B;  3AAP A;  3RVC A;  5GAG P;  2J0M A;  5C15 A;  1QVF M;  5AQM A;  5F0X A;  2FSJ A;  3EN9 A;  4A62 A;  4HTL A;  1NLV A;  1NVL A;  1VQ8 N;  1ILY A;  3DLL L;  2JWK A;  4JKF A;  4KH5 A;  4BRC A;  1KD1 O;  2W40 A;  3FR0 A;  2HST A;  5AQI A;  2YHX A;  2FSK A;  3VEZ A;  3WEE B;  1YIT N;  1J19 A;  1QHA A;  3VEV A;  1MWM A;  3N4P A;  1MIZ B;  4BRO A;  4IO9 L;  3QBW A;  3JXU A;  4GV6 A;  1U2V A;  3U8Z A;  1HKB A;  1SS6 A;  3CJA A;  2P9S B;  4BRF A;  3CJ7 A;  3HBT A;  3O9T A;  3CQY A;  2QWQ A;  3P31 A;  1VQN N;  5AQL A;  5EY4 A;  4F7G A;  5TKY A;  4BC2 A;  5ADX A;  2EWS A;  4BC5 A;  3IVF A;  3DXM B;  5CE3 A;  2HOE A;  1VQ9 N;  3BUZ B;  2P9P B;  5AFU H;  3D2F A;  1HPM A;  2NZT A;  3H3N O;  4BVO A;  5M1F A;  5KPT A;  1NBW A;  1NWK A;  1YHQ N;  4BRN A;  1GC7 A;  4CZK A;  5DM7 L;  1XUP O;  3UKU A;  5AQY A;  2AA4 A;  4NLC A;  2E1Y A;  2HRJ A;  4CZL A;  1Y64 A;  4FOI A;  4DHY A;  2I1J A;  3QIJ A;  2NLX A;  2VWB A;  3BEX A;  3CHW A;  3R3L A;  4B1X B;  1NGD A;  4PL7 A;  4BGA A;  3GOI A;  1C0G A;  2QWL A;  3R8E A;  3CXC M;  3M3Z A;  3IDH A;  4RWT A;  2D11 A;  4JKA A;  5KPR A;  4CZJ A;  1LOT B;  2HBK A;  4EAH D;  3CD6 N;  2QWN A;  3U7D A;  1QVG M;  3MCP A;  4K43 A;  3LM2 A;  3SAG A;  3KHY A;  2E2P A;  5M1P A;  3HTV A;  1MDU B;  2GEL A;  4BGB A;  2HBM A;  2ZJP L;  1XQS C;  3UE5 A;  3E66 A;  3B8A X;  4IEI A;  4FPB A;  4KH4 A;  1YJ9 N;  3MN5 A;  2J0J A;  2NRV A;  5AZJ B;  4JKG A;  4FWP A;  4YOY A;  2DPN A;  1VQL N;  3KWI A;  1YVN A;  3R6M A;  3IMX A;  2HE7 A;  2QWM A;  3HOT A;  4H5T A;  3FZL A;  3FZF A;  1ESV A;  2X0S A;  3MWT A;  2NNW A;  2P9U B;  2YJE A;  5KQ8 A;  3MX2 A;  4F9O A;  4CYE A;  4QS7 A;  4YOR A;  2A3Z A;  2FLO A;  2NRZ A;  2CGL A;  3AAQ A;  5BR9 A;  3H46 O;  4EHU A;  2YCH A;  1W2B M;  1W97 L;  3K9K A;  5AQU A;  3ZX3 A;  1GLD G;  4DQ8 A;  4ZRJ A;  5IJM A;  2FF3 B;  2PBD A;  3BF3 A;  3SAF A;  2CH5 A;  1GLL O;  1G99 A;  1SZ2 A;  4XEI A;  5JLF A;  4H5N A;  2A42 A;  4FWR A;  3C65 A;  3WT0 A;  4IO8 A;  3QBX A;  4JAX A;  3MN9 A;  1BU6 O;  3U8X A;  3A0I X;  4A57 A;  4ZRK A;  4BG8 A;  3NMU A;  2A5X A;  4Z94 A;  2YVC A;  2NRT A;  4C1N I;  3RSE B;  4BR4 A;  3SMP A;  3WUH A;  5CHI A;  1DIK A;  5JVH L;  4BRD A;  3WXI A;  4BR7 A;  3VEY A;  4JK8 A;  4FL9 A;  4IJN A;  3UKR B;  4C1N K;  3ID8 A;  3PZD A;  4WQ4 C;  3TPQ A;  3TSU A;  2BH1 A;  1K9M O;  3VGM A;  3ATU A;  3MMV A;  2RHK A;  4WYB A;  4A2A A;  1YJW N;  1VQ6 N;  3SBT A;  3OW2 M;  4MLE A;  4OPA A;  4HDO A;  2QA4 N;  3FFK B;  3CF5 L;  3ENO A;  4DCH A;  4M63 C;  2I7P A;  1Q81 O;  2PFU A;  3H6E A;  4IZ9 A;  2Q97 A;  2EMS A;  4IJA A;  2PAV A;  1VQ7 N;  2P9I B;  3VEW A;  1KXP A;  2VGN A;  1NGH A;  2D0P A;  4H0V B;  5LJW A;  3CJB A;  1NGF A;  2QWO A;  3HI0 A;  4H0O A;  4PKI A;  3PIO L;  4ILJ A;  2AL6 A;  3CIP A;  4CZI A;  1T6C A;  1NM1 A;  1TUU A;  2ABD A;  1GLB G;  2RE2 A;  1ZBS A;  3OBW A;  3KVG A;  3OBY A;  1Z6R A;  4UY8 O;  1RFQ A;  4YOW A;  1BG3 A;  3ATV A;  1JCG A;  3A5M C;  2D1K A;  4GY2 B;  3O1B A;  2P9K B;  3ID6 A;  4OPH A;  3GE1 A;  2QW9 A;  3CME N;  4PL8 A;  5CR4 A;  1GLC G;  4IWV A;  1XC3 A;  1NGE A;  2BTF A;  1DGK N;  3TSQ A;  1K8K A;  4U7B A;  1NMD A;  2QXL A;  5AQP A;  1EF1 A;  5GIP A;  1LCU A;  1JCF A;  5BRF A;  2CQU A;  3OA9 A;  3H1Q A;  2V7Y A;  1NGJ A;  4MLH A;  5ADX H;  3ZDT A;  4NY0 A;  4BY9 C;  3ENH A;  3ULE A;  1TYQ A;  3SLC A;  4CZG A;  4O8U A;  4KH6 A;  2ASP A;  2F7T A;  3LM9 A;  2IIR A;  1P8Z A;  2UYT A;  4H5W A;  1X9J A;  1Y19 B;  1V4S A;  3CCU N;  5AQV A;  2EMT A;  2Q1N A;  1GLJ O;  3DXK B;  3O9U A;  3TSP A;  5HOO A;  1ZC6 A;  3CJ1 A;  3FZH A;  3A5L C;  4ISE A;  3S41 A;  4YOX A;  3G71 N;  2ZJR L;  3H3O B;  5JIC A;  1J6Z A;  4ISG A;  3FP5 A;  4L3Q A;  2JWL A;  4BRP A;  4CZF A;  2GWJ A;  3H45 C;  3CCM N;  4LC9 B;  1DEJ A;  4JKE A;  4IOX A;  2Q0U A;  3TTC A;  4B1U B;  3D2E B;  5M1K A;  3O8M A;  1ATS A;  3VER A;  3OHR A;  4FWS A;  5AQF A;  1GLA G;  3AGR A;  5M1N A;  1TUY A;  2E88 A;  3VEX A;  2E2N A;  3QML A;  3QB0 A;  3SK3 A;  4C23 A;  4EKU A;  5AZI B;  2J4R A;  3I8B A;  4XH1 A;  4CBU A;  4IOC L;  1YJN N;  4FO0 A;  4Y0W A;  3FGU A;  1ISN A;  2IVP A;  1QZ6 A;  4QS8 A;  3SAH A;  3VMF B;  2NRR A;  1NGG A;  3C6A A;  3CJ9 A;  4AM6 A;  2Q31 A;  4YDU A;  4WQ5 A;  4MO5 A;  4XH4 A;  2Q2R A;  3HRG A;  1K8A O;  1JDE A;  5DM6 L;  3HZ6 A;  4FSV A;  1BOT O;  3WXJ A;  2CB8 A;  5BPN A;  2YX6 A;  1CZA N;  3O9Q A;  2OTJ N;  3GBT A;  4K25 A;  5ELZ A;  4M7Y A;  1MK9 B;  1E4F T;  3SJH A;  5B8H A;  4BR2 A;  3CPW M;  2GEM A;  2ITM A;  4JD2 A;  4K41 A;  4A2B A;  4K42 A;  4RTF D;  4FOE A;  5AQJ A;  5AQW A;  3VPZ A;  3O1W A;  5BN9 A;  2HBL A;  4OO1 J;  1VQK N;  4BC4 A;  3O5B A;  2ZGY A;  3ZX2 A;  1OVY A;  2OAN A;  2AEH A;  2P9L A;  3KWG A;  4B1W B;  4CD3 A;  3WQU A;  1K73 O;  1Q82 O;  5C2D A;  3A5N C;  1BWF O;  3I33 A;  5E26 A;  3R1X A;  5GIN A;  4P7I A;  3QIC A;  3PIP L;  1RGI A;  1T3V A;  2A6A A;  1VBG A;  4O5F A;  2R82 A;  3P4I A;  1BA1 A;  1JJ2 M;  3C7N A;  4MDA A;  5AR0 A;  3CC2 N;  1OKJ A;  2A41 A;  4KBO A;  1U2V B;  3BP8 A;  3ZET A;  3CCV N;  1GGO A;  2P9N A;  4WFA L;  4M7X A;  3FLC O;  1YXQ A;  4JHD B;  4GVE A;  1DT9 A;  1BDG A;  1HJO A;  2FJ9 A;  2NRW A;  4BC3 A;  2ZWH A;  3D2F B;  5EVZ A;  3T7Z A;  4WF9 L;  5AQH A;  3LDQ A;  1WOQ A;  3UKU B;  5EOY A;  2QWR A;  4H03 B;  1HBK A;  3WEE A;  3ZYY X;  3FZM A;  5I9E B;  5AQQ A;  4FWM A;  3VTI A;  1NGA A;  3EPY A;  4CI6 A;  2COP A;  1MA9 B;  1HB6 A;  4B1Z A;  1HKC A;  3EE8 A;  4GXB A;  2CGK A;  2P9S A;  5FPE A;  1X3M A;  3W0L A;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...