4JKFA

Open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
220
Chain Sequence
ELFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkfA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkfA01
4ILHA 4JKGA 4JKEA 4JKHA 4JK9A 4ILGB 3E9LA 3E9PA 4JK8A 4JKGB 4JKFA 4JKDA 3E9OA 3SBGA 3E66A 4JK7A 4JKAA 4ILJA 4JKCA 4JKBA 3SBTA 3ENBA
chains in the Genus database with same CATH superfamily
1RT3A 1BCOA 3ALYA 3TR8A 1JCEA 4DUYK 1YJNN 3A8YA 3MEDA 4DWIA 1QVFM 4WCEL 4AILC 3V6DA 1VQ4N 3MWTA 3THXB 1VBGA 4OPJA 3E9LA 2FDQA 5J2QA 3CMAN 1QHTA 4H8KA 1C1CA 4BREA 1RDAA 3QB0A 5J1EA 2HHQA 2QA4N 4YOTA 2P5GA 4W5RA 4ILHA 2GBZA 1J5EK 4FJ5A 4FJ7A 4BRPA 1VQNN 1IBMK 4OLAA 4ZHRA 2FBXA 3A5LC 3PSIA 4WFNL 3LDSA 4BQZA 3LWLA 1NTIA 3P1GA 3WXMB 2G8FA 1X1PA 1EF1A 5AQYA 1S9EA 2E1ZA 4TSXA 3LANA 2YNGA 5F2RA 1NBWA 3LP3A 3KKSA 1CLQA 3C6TA 3QMLA 4DV6K 1NK6A 3CM6A 1QS4A 4B1UB 4FJKA 1VQLN 3ENOA 5M1QA 2YKNA 3OBYA 4R5PA 5LJVA 1NGGA 3QFUA 5JS1A 5KPRA 2X78A 4DFKA 3DLLL 2XY5A 1RBVA 4RW7A 3A5MC 4FWRA 5AQIA 1K9MO 2DTUA 5ADXH 3BY5A 1ACAA 4JS4A 1VSIA 3VMFB 1D9DA 4GKJK 1GGOA 3DXMA 3P39A 3THYA 1KD1O 3JAMO 1NKCA 3DLKA 2GUIA 2EX3A 3C7NA 3WT0A 3CERA 2P9IB 4C8MA 4ISEA 5H1SQ 4QCLA 4EHUA 3R9PA 2Q1NA 2KZZA 1WAFA 1V4TA 3C65A 3QIJA 2EMSA 1VHXA 1DTTA 4B3OA 4DTOA 4B1YB 3ZLJA 1VAZA 2WBNA 3RWUA 1S6QA 5E84A 4FJMA 3CJCA 4NYFA 1JXBA 3AGRA 3HOTA 4IJNA 3OS2A 2PY5A 2KFZA 1GLCG 3U8XA 3NBPA 1GOCA 1E4GT 1YI2N 3VTIA 3CPEA 1VSHA 2A40A 3WA0A 4KKOA 2RF2A 3SZ2A 1M90O 3N4QA 3A5OC 4LF6K 3IMXA 3OYJA 1K8KA 2R82A 4B08A 3CI5A 3O08A 1BGXT 2HVHA 1NGCA 4CHZA 1RBSA 3FP5A 3KLHA 3LPTA 3CG7A 5J2MA 3L2WA 3S3OA 3MX5A 4KAZA 2UXCK 3AVAA 3KLGA 2WTUA 4M45A 3ZETB 4F2RA 2QWQA 3O9RA 1KRPA 1ASUA 2P9NB 2QXFA 4RW6A 3VQCA 2IVNA 3BINA 1TK5A 2OCEA 3ATVA 4CJ4A 2ZQBA 3MECA 4DTSA 4C1NI 3THXA 1KCFA 3AA3A 4YOXA 4HUGA 4M3ZA 1BA1A 3THWB 4ZTFA 3O8MA 4BRIA 1VRTA 1BQNA 4CFCA 3CCEN 4Y1DA 4CBXA 1XMOK 1S22A 4W5NA 1OKJA 1LWCA 3DI6A 1S3XA 3E66A 1NJXA 4EZ6A 4DSLA 5SWMA 4JHDB 2XY7A 3AU5A 1BI4B 3HVRA 4AM6A 4KTQA 5BN9A 1V4SA 4XIUA 3QFPA 3ZSXA 4CGJA 3ULDA 1BL3A 4YDUA 4FPBA 4YORA 2QWLA 1J53A 3O1BA 1Q8IA 5M1FA 2GTDA 2UYTA 1EKEA 2Z1HA 4DS5A 3FFKB 3T1HK 4E0DA 4NO7A 1BCMA 4JAXA 5C2FA 3DXKB 1HKCA 4EHTA 1WSJA 3X23A 3LP0A 3HPHA 3M1FA 2NRXA 4BG9A 4LF8K 3KWIA 3LP2A 4N41A 1LAWA 1U49A 1QQCA 4E3SA 2UUAK 4HTUA 2JGUA 1NMDA 4EFHA 1TUUA 3OYCA 1F21A 2D2QA 1BIUA 2I7PA 4E7JA 2P9IA 1R0AA 4JEPA 3DLBA 2LSNA 4I9QA 1SQKA 4J2DA 3AA4A 1VBHA 3KLIA 1ZBLA 1C0UA 3UKRA 4KHNA 3UE5A 3RSEB 1ATNA 3U3GA 2OPSA 4JLHA 3MX2A 1HPZA 2F8SA 4F3TA 3MDQA 4KHWA 1N32K 2G8UA 3G10A 4OPKA 1RT1A 3ZSYA 4DUZK 4TKNA 4BG8A 3V9XA 3OYAA 2P9LB 2HF3A 1J5OA 2W41A 4KHYA 1YTUA 3W3DA 1GC7A 4CIEA 3L3UA 3NVMA 4DFMA 3CMEN 5I42A 4DS4A 3VF2A 1SS6A 2PAVA 3VPZA 3QIPA 4PKGA 4FYDA 4BWJA 1VRUA 4CJPA 4IEEA 3AVCA 4JKAA 1GLAG 2Z1JA 4CZMA 1QZ6A 1HB8A 1KAZA 3M3ZA 4W5QA 1OH7A 3V1RA 4EAHD 3ZETA 1RT2A 4C8KA 2BANA 2QK9A 2GX9A 2ZF5O 4FJLA 4FOEA 2UU9K 1J9AA 2P9NA 4DTRA 3RRHA 4CK1A 5AFUH 3LAMA 4AHUA 4B9LA 1QQMA 5KRSA 2VG6A 1GLFO 4JKFA 5GAGP 3R8EA 1JLCA 3D45A 4FK4A 1KVBA 3FR0A 3HP9A 3WXLA 4J8FA 3THWA 1TKDA 4P7IA 4LFBK 1K6YA 4DV1K 2KTQA 2GEMA 3AVLA 3A5NC 5BPNA 5K14A 1IG9A 1XI1A 2CQUA 2KW4A 1DTQA 2AJQA 3OJUA 4ZTJA 4FJIA 4JHDA 5LY3A 2WC9A 3D6RA 1X9JA 1BI4A 4C8NA 4IG0A 3IUCA 3VEOA 3OYDA 3F73A 2VG7A 4CHPA 1X3NA 5HOOA 4K41A 5F1XA 1J6ZA 4FM2A 1J54A 4JI0K 3SK3A 4Z4HA 5T7BA 3CCVN 4FM0A 3ZEUB 2ZD1A 2BH1A 3BEXA 1GLBG 1WSIA 4UY8O 1RT5A 2I7NA 4CZEA 3DJCA 3LALA 4WFBL 3PX0A 4OKKA 1L3UA 3RTVA 1S72N 3EE9A 5LMUK 1T6CA 4LC9B 4DQRA 3HM8A 3G0ZA 3I8BA 1WUAA 4JKCA 3DXKA 1KAXA 4I9LA 2NRVA 4JRQA 4FLVA 2YJEA 3ATUA 1YJWN 3I0RA 3T3FA 4Z4IA 5M1PA 1BUPA 2WH5A 2NRTA 4PL8A 3HM9A 3BF1A 4G9ZA 4H5TA 4A62A 4CZFA 4IKFA 4WYBA 5LJWA 3ZT0A 4KBOA 4U7BA 4DTJA 3ZYYX 4FLTA 1IJJA 1HMVA 4XH4A 1MU2A 1IBLK 4LF7K 4CJLA 1RBRA 3FZHA 3VQEA 3RSEA 4H5RA 2VQFK 2ABDA 4B9SA 3TAQA 2WUSA 3ZT4A 4PWDA 2YJFA 2ETJA 4JI7K 3NCIA 1IH7A 3L3VA 4BC4A 5AZJB 3HZ6A 2HNYA 2P9LA 2QXLA 4JK7A 1ZBFA 3QERA 1U45A 4BR0A 3OYMA 4B1XB 1NJWA 3B8AX 1YTAA 4IOCL 3WQTA 3AVIA 3DOKA 3PUFA 1NOYA 2CGLA 2YHWA 3CC4N 4IOAL 4ZRKA 4CD3A 5HL7L 1GOAA 2PYLA 1BQMA 1VQKN 4KREA 4FLUA 2FJ9A 3J7AP 3K0SA 3VQ4A 2V7ZA 3OA9A 4F9OA 4DR3K 2D4WA 4BY9C 4KV8A 4FW2A 5JMVA 4DTXA 3P4IA 1OH5A 3K2PA 3RVCA 2NNWA 4FL9A 3EYZA 3LPUA 3OVNA 3TAFA 2YCHA 4CZIA 3MCPA 1XQSC 3M8QA 3U9DA 3TWHA 3VERA 4FW1A 2E2QA 4DCHA 2OANA 4FWLA 2F8TA 1N34K 5JICA 1JLGA 3UB5A 4FPAA 3LL3A 4JI6K 3AO5A 4DV3K 3OYBA 3QEIA 3WXIA 3ISNC 4CZLA 4F2SA 2CH6A 4KHPK 4DV0K 3CYMA 4CGDA 1NU0A 4IDHA 4DR5K 1ZBSA 2HHWA 2AP1A 2IDOA 3CCMN 1BIZA 3PSFA 2COPA 4E1NA 3VQBA 4IFEA 4J2EA 1RT6A 3K9JA 2O8BB 3WNFA 3O4WA 1RCHA 4NCAA 3QEPA 2OPQA 4BE2A 4PKIA 3ZEUA 2RE2A 3M8RA 1RDBA 2IC3A 3QBXA 4JI1K 2OPRA 3VGKA 5FPDA 2PZSA 1H4RA 4C23A 3F9KA 3VQQA 1VQON 3NH0A 3RR8A 1C0FA 4GVMA 3ULEB 1EWRA 3VENA 2RHKA 1RT7A 3DAWA 5DM6L 1RDDA 1E5WA 2HE7A 2DFFA 2NZTA 2Q3SA 2FBTA 1RBTA 1XHXA 4FVMA 3AVFA 3CJ9A 1NGEA 4U67L 3SQ1A 3TAEA 4HVJA 4M3TA 1NGIA 4JKBA 2OTJN 1Q9XA 4IDKA 5FPMA 2VWJA 1WLJA 2HMPA 3EPYA 5CZ1A 4BC2A 1JLQA 4GV6A 3R1XA 5FPNA 3DLEA 1B9FA 5JVHL 3DYAA 4GNIA 4IO9L 3BP8A 1BOTO 1GLEG 1HNZK 1EXQA 3ZSOA 2X6SA 3SBGA 4BC3A 3DRPA 4IZ9A 3G4SN 5MLCQ 5AQSA 4JI8K 2AEHA 4KHUA 2Q97A 1Z6RA 4BROA 4AQYK 5BR9A 1KC7A 2YHAA 2GV9A 3VQ7A 5AZJA 1T7PA 4CECA 4YOUA 4ID5A 4DXAB 1CZBA 4KH6A 2P9PB 3QEWA 2P1JA 2ATQA 3MN5A 3O9TA 1WSHA 4LSLA 1OVYA 3W0LA 4JKGB 4DV5K 4O8KA 4CEEA 1RDUA 2VG5A 2HBLA 3CCQN 2DY4A 4RW9A 4B9NA 3O3HA 4BR2A 1YVUA 3AO2A 3KD5E 1T03A 3CJAA 5CR4A 1SUQA 1KVCA 2QKBA 1HPMA 4C8LA 4QOZB 2VWBA 4C1NK 4L8RB 3UKUB 1NGBA 4FK2A 3O3FA 3EKSA 3MN7A 4FWOA 1I3AA 1JLEA 3FE1A 2Y1JA 4DV4K 3J7YP 1XWLA 3LDLA 4WQ5C 1FJGK 4BGAA 4GV3A 4KTWA 4KI6A 3NGIA 1NMNA 3L2VA 1GLDG 2E2NA 5BPMA 3CD6N 1FXXA 1SZ2A 1XC3A 2D11A 3I8DA 1ISNA 3FLVA 4WFAL 3AVGA 5TKYA 3VA3A 1S6PA 2NLXA 3MXJA 1KVAA 3EN9A 4Z4CA 3FFIA 3VQ8A 2CB8A 4NCGA 3AGKA 1MK7B 2O8FB 5F0XA 4I6MB 3BGRA 2O8EB 5DMRA 4CJVA 1UA0A 1NKEA 2E6LA 4OGEA 2O8BA 1NGFA 1ITGA 3CCSN 4ID1A 4O0IA 2UUBK 1IBKK 4M3YA 2D10A 2VGMA 3C6AA 4K42A 1C0MA 4AM7A 1DIKA 4J2BA 3E9OA 5GAEP 4CJEA 3VQAA 3ZX2A 4CEAA 2HNZA 1ZBHA 1G15A 5GADP 4MDBA 4A2AA 3AARA 3A2FA 3MN9A 4CBUA 5IT9O 3TANA 1R59O 4M3WA 4X66K 2XHBA 3LZIA 1U4BA 3NMUA 1X3MA 2QWPA 4DSIA 1WSGA 2J0MA 4CFDA 4E7LA 3TABA 3VQ6A 3NVKA 3L2UA 4CEOA 2V7YA 5KGWA 3O3GA 1YHQN 2Q0RA 5KQ8A 3OYHA 4BRHA 5EOYA 5AR0A 4JI2K 1ATRA 1JXEA 4DB3A 4B8AB 1U2VB 1WBDA 3GDQA 4M41A 1REVA 2DFHA 1KBLA 4H5WA 1RBUA 3LDQA 3VQ9A 2YHBA 2P9SB 1QSYA 3SUNA 4JK8A 4BVOA 5ADXA 5C12A 2ZGZA 4JKDA 3QDKA 4NXMK 4N5SA 3AO3A 1J19A 5KPTA 3T1YK 1T44A 3KKRA 2EWSA 1YUWA 1C1AA 3AVHA 1T05A 4B9UA 4DR7K 4DR6K 2P9PA 1G99A 3P5JA 3OTOK 2E4LA 3VEYA 4DQSA 3KWGA 3LDPA 4JKGA 1XNRK 2GELA 5BR8K 4HHTA 1NNEA 1KXPA 1LOTB 4FWQA 1SV5A 4CYEA 4CJTA 4LF5K 2HB5A 1FK9A 3KK2A 3ZX0A 3M8PA 1VSDA 2YVCA 3KK3A 1IKVA 1Y97A 4A5AA 3ZCMA 4ILJA 4CJFA 5C25A 2B5JA 2HHVA 4ISGA 4CVNE 3UKUA 2WONA 4FSVA 2YV0X 1YITN 2D5RA 3SJHA 1L3SA 1MK9B 4BE1A 3MXIA 4MO4A 4OJRA 3VEZA 1HNVA 3ITHA 1RTHA 3VESA 2HW3A 2A42A 1W2BM 1RT4A 4H5NA 4A59A 4O5FA 3VF6A 4DSEA 2NRHA 4BR4A 4DF8A 1TYQB 2P9UB 1KLNA 4M42A 1LWEA 3E1YA 3BF3A 5HP1A 4BRNA 4CGFA 3SMSA 3OHRA 1KFDA 3GOIA 4YOYA 1RTIA 4V19S 2P9KB 1QZ5A 5FRNA 4DR4K 4B9MA 1KTQA 1DEJA 1QQNA 4CZHA 2E1YA 4O0JA 3HPOA 3B6PA 5M1KA 2KLAA 4AHVA 2O8FA 1T3VA 4DSJA 4I6MA 3SCXA 5KPZA 2O8EA 3EY1A 4CJWA 2ZGYA 3J7ZO 2ASPA 4FJXA 5AQWA 5C15A 1QSLA 2UXDK 5E26A 2HOEA 1WNSA 2CGKA 4EKUA 3CCLN 3D0PA 4FLYA 3KIOA 3AVBA 4GVEA 3ENHA 2HHTA 3V1OA 1KC8O 4MDAA 2YHXA 4YHHK 2XY6A 2W6LA 5J2NA 2JLEA 2G8HA 4DV7K 1SKSA 5KQDA 3MWPA 2IAJA 5EXWA 1BU6O 4O5BA 1HNWK 5C2DA 3C6UA 1HNXK 2Q0UA 3ZX3A 3C95A 2QI2A 4YY3K 3Q7BA 3CF5L 4CF2A 2GWKA 1KAYA 4I7FA 2E88A 3VQDA 1TK0A 3HO1A 4DFJA 2FXUA 3D2EB 2X74A 5JS2A 2A6AA 3EZWA 2P9SA 3AVNA 3CQXA 2HHHK 4FJJA 4BRQA 4HWIA 4H0VB 4JV5K 3T19A 1OH8A 3WNEA 3BZCA 4M3RA 4HUEA 3G9WA 2OYQA 2CH5A 2HBJA 2NUBA 1BDGA 1S9GA 2IOCA 5AQPA 1DKGD 5SZTA 3FZKA 4FJ8A 3PLAA 1Q82O 2KFNA 1DGKN 3HSCA 4CI6A 3SQ4A 4IXCA 3NGZA 3KHYA 4BDPA 3SV4A 1IV0A 3JXUA 3DLGA 4H4MA 4IFVA 2J0KA 4Z94A 3ZT3A 5FLXO 3KD1E 3QETA 4ELUA 1W0HA 3M5RA 1HRHA 2O4GA 4ILGB 4CHQA 5I3UA 2OA8A 5BRFA 4B8CA 1U04A 4CJUA 4CIFA 2HHXA 3SNNA 3DLHA 4NYNA 4FWNA 2FF6A 2P51A 5ELZA 3HSTB 2ZJRL 3GL1A 1TKZA 4FZXC 4CK3A 2FBYA 4O8UA 4CEZA 3UIQA 2CGJA 4WQ5A 4DF4A 5AZIB 1TKXA 1WB9A 1TYQA 2P9UA 4PUOA 4KTZA 4KH5A 4FLXA 1WSEA 3CC7N 4EP4A 5B8HA 1C1BA 3I33A 3AVMA 2YNFA 4F3OA 4B1WB 4DSFA 4AHCA 2P9KA 1VQMN 4RW4A 4EZ9A 5AQUA 1XNQK 3KVGA 4Y1CA 2OZSA 4DQQA 3G6EN 4F8RA 2A1RA 1K8AO 2QWMA 4CW7B 5AFUA 3KTQA 1A5VA 1NJYA 2F4VK 1HBKA 3AVKA 2HF4A 1HUXA 3D7EO 1X9WA 4M7YA 1NKBA 4A5BA 5KTQA 2O8CB 3JYTA 4BR9A 4NY0A 1NK0A 3LDNA 4HDOA 3CFOA 4NXNK 3S9HA 4IFYA 5CHIA 3NF9A 4IJAA 3I56N 1N33K 4LFAK 4I2PA 5GIPA 2G8VA 5IWAK 4Q5VA 3HTVA 4WQ4A 1NK8A 3NF6A 3HOSA 3SAGA 1S1UA 3OJSA 1HJOA 1ZBUA 2NRZA 2E2PA 4O44A 3CETA 2R7YA 2QWRA 3H45C 3EL2A 1KLMA 3H3NO 4Y0WA 3HPGA 4LF9K 4Z4EA 1WAJA 1MA9B 2IGIA 3P83D 3GE1A 3KZBA 5AQJA 5EVZA 5GINA 1ZBIA 3V1QA 3MEEA 1WOQA 3LP1A 3D2EA 4IBNA 3SUOA 3I55N 2ITGA 1LAVA 4FWKA 3HI0A 5AQFA 4FJNA 5HROA 3KK1A 2YNIA 1TGOA 4IO8A 1TAQA 4E89A 3IVFA 4QAGA 1VQ5N 3J80O 3CJ1A 3VGLA 1GOBA 5AQGA 1YAGA 4BDYA 1IO2A 3FZLA 1HX1A 3P38A 3ZSRA 1BA0A 3CXCM 3K5MA 5C24A 3OW2M 2HBMA 3SPZA 2XY8A 4CF9A 4CZJA 1X9MA 2FC0A 3SUQA 4QS7A 4CGHA 3CFPA 2FBVA 1VSKA 3U7DA 2E8AA 4GV9A 5HBMA 3TAMA 4BRMA 3CPWM 2B4JA 5AQKA 4CJ7A 4MO5A 1U48A 3T69A 3TPQA 3Q7CA 2VCPA 3AV9A 1HYVA 3F2KA 1EO1A 5JVGL 2I1JA 1I39A 4OVLA 4JI5K 2A5XA 4CIGA 1SL0A 3WQUA 2AA4A 2XRIA 4M3XA 4HTLA 5AZIA 2YHYA 4DQ8A 1NGHA 3VN5A 5J2PA 3CCUN 3QEXA 1YF5L 4CEFA 4OKJA 1W7AA 4IOXA 1P8ZA 4YNQA 1M1KO 2BTFA 2Y1IA 1NJZA 3BDPA 4RCHA 4XH1A 5CE3A 1RILA 2Z1GA 1HQEA 1A5XA 3ZSZA 1MWKA 1CZAN 3TTFA 3C7NB 4HDQA 2KQ2A 4FJ9A 1O1WA 3K58A 2VQEK 1Q86O 1U6ZA 1QSSA 4RTFD 1TAUA 5CYMA 3KJVA 3OYNA 1MDUB 4RWTA 1RDWX 2P5OA 4F4KA 3HL8A 5AQOA 4HCBA 3WUHA 4DU4A 3H3OB 3L6QA 3DM2A 4Q0BA 3IKMA 2RKIA 2A41A 3E01A 3NF7A 3H08A 2O8CA 3PV8A 3V9WA 1UOCA 3T7ZA 1H1VA 1XUPO 5BRHA 1CXQA 4DHYA 3QNOA 4A57A 1VK0A 1BO5O 2G8IA 2FLOA 3SQ2A 2Q2RA 2E6MA 4DFPA 4B9TA 2FSJA 3HVTA 3DLRA 5AQVA 1SAZA 1N6QA 4YOWA 2BGGA 4B1ZA 2IVPA 3DRRA 2PFUA 4AHTA 4BC5A 1QHAA 3AVJA 1GLLO 2V51B 3CC2N 2X0SA 3T1AA 3K57A 4I2QA 4CZGA 1BISA 3PO5A 1SL2A 1ASWA 4B3MK 3S3NA 2HBKA 4OPHA 2A1SA 4NLBA 4B1VA 3CCRN 1DLOA 4JD2B 3V9ZA 3TAPA 3BZKA 1Z26A 4NLCA 4BRAA 1ZXOA 1L3TA 1Q81O 1Y64A 3H1QA 1KSPA 4BGBA 5AJ3K 1GG3A 1FKPA 4RW8A 1C0TA 4DG1A 4H0TB 5LMNK 3H6EA 1QQOA 5C42A 1FKOA 3OYEA 3F9MA 1EWQA 4CF1A 4BQLA 1IKYA 4BRGA 2BE2A 5TKWA 1NJIO 4W5TA 2JWLA 2OTLN 3OY9A 2RN2A 3O4NA 5EX5A 4BE0A 4AHSA 4FOIA 3HT3A 4XEIA 4FXDA 2D0PA 1O13A 2W40A 3LAKA 5HRRA 3E9PA 2NRWA 3LWMA 1JJ2M 3V9SA 2GUPA 1A5WA 5AQTA 2FSKA 2VWKA 1SKRA 1JCFA 2WFBA 1VQ7N 1YIJN 3I0SA 1VQ9N 3SAHA 3ID8A 2H3GX 2QWOA 3VQ5A 4LFCK 4HUFA 2UXBK 4E7HA 2W42A 1VSLA 5DK5A 4MLHA 1L5UA 1NGDA 1WBBA 1ILYA 2BUPA 4OLBA 3KLFA 5KGXA 3OS0A 1ST7A 3O80A 5C10A 1HKGA 2F96A 4PY5A 4H5VA 1MIZB 5BREA 4CEQA 3A0IX 5EU7A 3CJBA 2D0BA 2HRJA 3L2RA 2RPIA 3HK2A 1BWFO 4CJQA 1HKBA 1CZ9A 2IS3A 4CJSA 3SBTA 4DU1A 3S41A 4B9VA 1B92A 3VEXA 5A2QO 4R79A 4DQIA 2JWKA 4WQ4C 3ULEA 4CESA 3HXMA 4YL8A 1IG8A 4KB1A 3AU4A 1NOZA 4H0OA 1QVGM 3F5TA 5D3GA 1N5YA 4A61A 2O8DB 2QM1A 3UKRB 5JLHA 2A3ZA 3L4QA 3B6OA 3KK7A 1WN7A 4ISFA 5FROA 2KHOA 1UA1A 4IWVA 3WNHA 4BDZA 4JI4K 4B3TK 3O5BA 3U8ZA 3TI0A 4ZRJA 3SYZA 3EKUA 2OZMA 4GY2B 5AQMA 1IKWA 4OO1J 3QO9A 3SPYA 3CQ8A 3AA5X 4QS8A 3NHGA 3OYGA 1C6VA 3GBTA 4BRCA 1RFQA 4E1JA 4M63C 4KRFA 3ASMA 4CF0A 3J81O 4JNEA 4CEBA 2ZWHA 4FZYA 3ZSWA 5BPLA 5AQRA 4BWMA 4DTPA 1EX4A 4FLZA 2HVIA 1YJ9N 4WE1A 2E20A 3M6GA 4L3QA 4AHRA 3NE6A 3VEVA 4JYAK 4CGGA 3LDOA 4JD2A 2ASOA 4FK0A 3K9KA 5GAHP 3VETA 3G25A 1QE1A 3IDHA 3NFAA 3O4QA 5CZ2A 2V52B 3U9ZA 1N8RO 4J2AA 3TARA 1JL1A 4O55A 2HHUA 3U6FA 1T8EA 1TK8A 4DR2K 1NGAA 2DPNA 3BUZB 3VOVA 1NWKA 3VGMA 3K59A 5KRTA 1JLAA 3QBWA 3D2FB 4FLWA 3PVLA 4CHOA 1WSFA 1HR0K 1TV6A 3QIOA 3V4IA 3PX6A 2HSTA 1S1VA 2G8KA 1HJRA 3LM2A 3MK6A 5IJMA 3N4PA 5AQNA 3RR7A 4NCBA 5AQLA 3ZT1A 5KI6A 1LW2A 5HLFA 1UWBA 3L2QA 2D0AA 1CXUA 3EO3A 2LBBA 4E19A 4PA1A 4H0PA 1S5JA 4K43A 3HJFA 3MCAB 4LD0A 1Q7YO 1XC9A 4CE9A 1IKXA 4A2BA 4BR7A 4GXBA 1RTJA 1GLJO 5JVLA 4C8OA 3WXKA 2O4IA 4QS9A 4CJRA 3TSQA 4HCCA 4ICLA 3PIOL 4K8XA 1JLBA 3TTCA 3MXMA 4DSKA 5M1NA 1LWFA 3MMVA 2FF3B 1TL1A 5I9EB 1VQ6N 2QEXN 2O8DA 4N76A 3FLCO 5HRNA 4KFBA 4IEIA 3HBTA 3R3LA 4DTMA 5FRMA 1Q18A 3H46O 2QKKA 4EP5A 2Q36A 2YX6A 2Q31A 1U47A 4GW6A 4DU3A 3U3YA 3ZDTA 1JL2A 3NGYA 4FZZA 4Z0UA 1U2VA 3VA0A 2G8WA 4OPAA 1TKTA 3IAYA 2J0JA 1D9FA 3SV3A 3RRGA 1MWMA 4JKEA 5EY4A 4JK9A 2E2OA 4CJ3A 1NK4A 3CHWA 3JSMA 2E5LK 1HNIA 3NAEA 4BR5A 3P31A 3ZSVA 4CF8A 3PX4A 2DIKA 3AO1A 3NF8A 4RG8A 4CZKA 5CYQA 1D8YA 1Q9YA 1TUYA 4LF4K 1JLFA 3QINA 2F9WA 1JKHA 1VQPN 4X65K 2ZM6K 2VYPA 4K8ZA 1JDEA 3O9QA 4CERA 3OS1A 1I94K 1X9SA 3OBWA 1YVNA 3NH1A 4CJKA 4FCYA 4BRDA 3VF4A 3M8SA 4DR1K 4N56A 5HRPA 3NDKA 3L0QA 3TTDA 1LV5A 1EETA 2QW9A 3V81A 4E1MA 3C6HA 4BVPA 2ZPYA 5FDLA 4N47A 2Z1IA 3LM9A 4BRKA 4FJHA 4M3UA 5C0YA 2BDPA 3OYFA 2HNDA 2J4RA 3QLHA 3HRGA 2F7TA 4Z4GA 4W5OA 4DTUA 4LH4A 4PL7A 1XMQK 1HLUA 3VTHA 1HB6A 1NGJA 3D2FA 2RQ1A 4AH9A 1OH6A 3K5OA 4CCHA 3HP6A 3MAQA 3TSPA 1NVLA 4B3RK 4CFAA 3IFRA 2HMIA 4O4GA 3SJJA 4X62K 4FWPA 2KKZA 2I1KA 3RMDA 3WEEB 1YXQA 2XO7A 3FZMA 1S1WA 4X64K 3QICA 5E41A 4CBWA 4FWSA 4M7XA 4CEDA 3SLCA 3TU5A 4BACA 1TL3A 1BG3A 4YFUA 1Y19B 1NG9A 2YKMA 4WF9L 1NI2A 4E7IA 1RTDA 3J8AA 5CY4A 2D1KA 3VEWA 3RMAA 4KB0A 3PY8A 4EIAA 1KQSM 1P90A 4AF1A 1L3VA 3V9UA 4G1QA 2AL6A 4CHYA 5GIOA 3AAQA 1E4FT 3OYKA 2ASMA 4CHNA 1HYZA 1XHZA 3S3MA 1RGIA 1S1TA 3AO4A 3C94A 4H0YB 4Z4FA 3PO4A 3AA2A 3WXJA 1ZYQA 1EP4A 2PYJA 3DWLA 2OPPA 3CIPA 3DMJA 4FVUA 2GWJA 1N36K 3ENBA 4IG3A 4KHSA 4NB4A 4YOVA 5BN8A 1W97L 3ID6A 4CK2A 3VQPA 4ELVA 3O9SA 4DV2K 3C0BA 3NH2A 5JLFA 1SL1A 3IS9A 1LCUA 3O9UA 4KHQA 4CGIA 3SQ0A 1NLVA 3QESA 5BRDA 4FM1A 4GKKK 3K5LA 3R6MA 1D5AA 4B9QA 2W6KA 4ZRIA 3MEGA 1QTMA 1B9DA 4LSNA 3OYLA 4PHTX 2QTDA 4KPYA 4KO0A 3L4IA 3THVA 4OGCA 3TSUA 3CFRA 2ZJPL 2FSNA 4E7KA 4MLEA 3CCJN 2HHSA 1W9HA 1NM1A 1UAXA 1VSJA 2D0CA 2EMTA 2D0OA 4ELTA 3IRXA 1ZC6A 1ASVA 4JI3K 1VSFA 4LY7A 4K0KK 1ATSA 3TAGA 3JS6A 4YDUC 3ZSQA 3K5NA 1BHLA 4CFBA 5M1OA 1DT9A 4PKHA 3LZJA 4GMJB 3KLEA 3HYFA 3U4LA 3G71N 3QEVA 4H0XB 3EE8A 1ESVA 1NK5A 2YNHA 3CQYA 5LL6Z 4MFBA 1TVRA 1VSEA 4H4OA 1GC6A 1E3MA 3OYIA 1Z25A 2ITMA 1D4XA 2YI1A 3L8BA 3GG4A 4BRLA 4FWMA 4FO0A 1JCGA 3SAFA 2VGNA 1VSMA 1NK9A 4OKEA 3CJ7A 5AQHA 3DXMB 2EHGA 3CM5A 1NK7A 4MQ3A 4KH4A 1SGHA 1LW0A 3AY9A 3THYB 3RMBA 2UUCK 5HRSA 1C0GA 2I5JA 1HQUA 3PIPL 1RDCA 4B3SK 3WEEA 4DQPA 5AQZA 5AQQA 3WNGA 4OX9K 4JS5A 4LH5A 1OVQA 3SUPA 3H1VX 3RMCA 1Z05A 3DRSA 2F9TA 2IIRA 3QNNA 1YT3A 1S1XA 2IVOA 3AAPA 3O6WA 4XH5A 1K73O 4JRPA 4JKHA 3FGUA 4FJGA 4JN4A 2QWNA 4BRFA 1VQ8N 1MIXA 2KZMA 2WOMA 4H03B 1SKWA 4DKWA 2B6AA 4DLGA 2PBDA 4DLEA 4DTNA 3FZFA 2X6NA 4DMNA 4KI4A 3EZ5A 3EEQA 2ZJQL 4K25A 1K8KB 1FW6A 1RNHA 3MN6A 3DOLA 4UQGA 2NRRA 4CD1A 5FPEA 1HYSA 3SI6A 1T6DA 3PZDA 3ZT2A 1EQYA 3O1WA 5AQXA 3IG1A 2ZE2A 4F7GA 5DM7L 4PQUA 3SMPA 1KFSA 2DFEA 4CJ5A
chains in the Genus database with same CATH topology
2A6AA 2ZWHA 4IOCL 3EZWA 3WQTA 5BPLA 2CGLA 2P9SA 5AQRA 1JCEA 2YHWA 3CC4N 1YJNN 4ZRKA 3A8YA 3CQXA 4CD3A 1QVFM 4IOAL 5HL7L 4BRQA 4WCEL 1YJ9N 4HWIA 4H0VB 1VQ4N 3MWTA 1VQKN 2E20A 3M6GA 1VBGA 4L3QA 2FJ9A 3E9LA 3G9WA 2FDQA 3VEVA 2CH5A 3CMAN 2HBJA 3LDOA 1BDGA 5AQPA 1DKGD 2V7ZA 3OA9A 4JD2A 3FZKA 2ASOA 4F9OA 3PLAA 1Q82O 1DGKN 2D4WA 4BY9C 3HSCA 4BREA 3QB0A 3K9KA 4CI6A 3VETA 4IXCA 3G25A 4YOTA 5GAHP 3KHYA 3IDHA 5JMVA 2QA4N 3P4IA 3JXUA 4ILHA 3RVCA 2NNWA 4FL9A 2V52B 3U9ZA 1N8RO 2J0KA 4BRPA 4Z94A 2YCHA 4CZIA 1VQNN 3MCPA 3M5RA 4WFNL 3A5LC 1XQSC 3U9DA 4ILGB 3VERA 5BRFA 2E2QA 1NGAA 4DCHA 2OANA 4BQZA 2DPNA 3BUZB 4FWLA 4FWNA 3VOVA 1NWKA 3VGMA 1NTIA 2FF6A 5JICA 3WXMB 5ELZA 3UB5A 1EF1A 4FPAA 2E1ZA 3LL3A 5AQYA 3GL1A 3QBWA 2ZJRL 3D2FB 5F2RA 3PVLA 3WXIA 1NBWA 4CZLA 2CH6A 3QMLA 2HSTA 4O8UA 3LM2A 2CGJA 3MK6A 4WQ5A 4B1UB 5IJMA 3N4PA 5AQNA 5AZIB 4IDHA 5AQLA 1ZBSA 3ENOA 1TYQA 3OBYA 2P9UA 5M1QA 5LJVA 1VQLN 2AP1A 4KH5A 3CCMN 1NGGA 3QFUA 5KPRA 2COPA 3DLLL 3CC7N 4IFEA 5B8HA 3A5MC 4FWRA 5AQIA 3K9JA 3I33A 1K9MO 5ADXH 4B1WB 3EO3A 2LBBA 3O4WA 1ACAA 3VMFB 2P9KA 4H0PA 4PKIA 4K43A 1VQMN 3ZEUA 2RE2A 1GGOA 3DXMA 3QBXA 3P39A 5AQUA 3MCAB 3KVGA 3VGKA 5FPDA 3G6EN 1Q7YO 1KD1O 1H4RA 4C23A 4A2BA 1K8AO 4BR7A 2QWMA 3C7NA 5AFUA 4GXBA 1VQON 1C0FA 3WT0A 3CERA 1GLJO 2P9IB 4ISEA 2RHKA 3ULEB 3VENA 5H1SQ 3DAWA 5DM6L 4EHUA 1HBKA 1E5WA 2HE7A 5JVLA 2NZTA 2HF4A 2Q1NA 3R9PA 3WXKA 1V4TA 1HUXA 3C65A 3QIJA 4QS9A 3CJ9A 3TSQA 1NGEA 3D7EO 2EMSA 4U67L 3PIOL 3TTCA 4M7YA 4B1YB 5M1NA 1VAZA 1NGIA 4A5BA 4JKBA 2OTJN 3MMVA 2FF3B 2WBNA 5FPMA 5I9EB 1VQ6N 2HMPA 5E84A 4BR9A 4NY0A 2QEXN 3EPYA 3CJCA 3LDNA 4HDOA 4BC2A 3AGRA 5CHIA 3FLCO 3HOTA 4IJAA 4IJNA 3I56N 1GLCG 4IEIA 3U8XA 4GV6A 3R1XA 3HBTA 1YI2N 1E4GT 3R3LA 5FPNA 5GIPA 3VTIA 3CPEA 1Q18A 3H46O 3HTVA 4WQ4A 5JVHL 2A40A 4GNIA 4IO9L 2Q36A 3WA0A 1BOTO 2YX6A 3BP8A 3HOSA 2Q31A 1GLEG 3SAGA 3ZDTA 1M90O 3SBGA 3N4QA 3A5OC 4BC3A 3IMXA 1HJOA 4IZ9A 3G4SN 2NRZA 1K8KA 2E2PA 2R82A 5MLCQ 3CI5A 1U2VA 3O08A 3CETA 5AQSA 2AEHA 4OPAA 2Q97A 1NGCA 1Z6RA 4BROA 2QWRA 3H45C 3EL2A 3FP5A 2J0JA 3H3NO 4Y0WA 5BR9A 1KC7A 1MWMA 5AZJA 3MX5A 4JKEA 1MA9B 4YOUA 5EY4A 4JK9A 2E2OA 3CHWA 4DXAB 4KH6A 3GE1A 2P9PB 3KZBA 5AQJA 5EVZA 3ZETB 5GINA 3MN5A 3O9TA 2QWQA 1OVYA 1WOQA 3W0LA 4BR5A 4JKGB 3D2EA 3O9RA 4O8KA 2P9NB 3P31A 3I55N 2IVNA 1RDUA 3BINA 2HBLA 4FWKA 2DIKA 3CCQN 3ATVA 3HI0A 5AQFA 4CZKA 1TUYA 4IO8A 4BR2A 2F9WA 4C1NI 1VQPN 3IVFA 3CJAA 2VYPA 5CR4A 1VQ5N 4YOXA 3CJ1A 1JDEA 3O9QA 3VGLA 5AQGA 1BA1A 3O8MA 1HPMA 1YAGA 3OBWA 1YVNA 4BRIA 2VWBA 4C1NK 3UKUB 3FZLA 4BRDA 3VF4A 1HX1A 1NGBA 3P38A 1BA0A 3EKSA 3MN7A 4CBXA 3CXCM 4FWOA 3FE1A 1S22A 3L0QA 1OKJA 3TTDA 3OW2M 2QW9A 3C6HA 2HBMA 3LDLA 1S3XA 4WQ5C 3E66A 4BVPA 2ZPYA 4BGAA 4CZJA 4GV3A 3LM9A 4BRKA 5C0YA 4JHDB 3AU5A 4QS7A 2J4RA 3U7DA 2E8AA 4GV9A 1GLDG 2E2NA 5BPMA 3HRGA 4BRMA 2F7TA 3CPWM 1SZ2A 3CD6N 1XC3A 2D11A 4AM6A 5AQKA 5BN9A 1V4SA 4MO5A 4CJ7A 1ISNA 4PL7A 3QFPA 3T69A 3FLVA 1HLUA 2VCPA 3Q7CA 1HB6A 1NGJA 3TPQA 3D2FA 2RQ1A 3VTHA 4WFAL 3F2KA 4YDUA 5JVGL 1EO1A 2I1JA 5TKYA 4FPBA 2A5XA 2NLXA 4YORA 2QWLA 3TSPA 1NVLA 3O1BA 5M1FA 3IFRA 3EN9A 2GTDA 2UYTA 3WQUA 2AA4A 4HTLA 2CB8A 5AZIA 3AGKA 2YHYA 1MK7B 4DQ8A 5F0XA 3FFKB 1NGHA 4FWPA 4I6MB 2KKZA 3CCUN 1YF5L 4NO7A 2I1KA 3WEEB 1YXQA 3FZMA 1P8ZA 4IOXA 4JAXA 1M1KO 5C2FA 2BTFA 3DXKB 1HKCA 3QICA 4RCHA 4XH1A 4EHTA 3X23A 4CBWA 4FWSA 4M7XA 1NGFA 3M1FA 2NRXA 3SLCA 4BG9A 5CE3A 3CCSN 3CCEN 3TU5A 3KWIA 1BG3A 1Y19B 1MWKA 2D10A 1CZAN 3TTFA 2VGMA 3C7NB 3C6AA 4HDQA 4K42A 4WF9L 4AM7A 1DIKA 3E9OA 1NI2A 5GAEP 3J8AA 1NMDA 2D1KA 3VEWA 4EFHA 1TUUA 1Q86O 1U6ZA 4EIAA 3ZX2A 4RTFD 2D2QA 1KQSM 1P90A 4AF1A 5GADP 2I7PA 1MDUB 4MDBA 2P9IA 4RWTA 4JEPA 2AL6A 4A2AA 1RDWX 3AARA 5AQOA 1SQKA 5GIOA 3AAQA 1E4FT 1VBHA 3MN9A 3WUHA 2ASMA 3H3OB 4CBUA 3UKRA 3L6QA 3UE5A 1R59O 3RSEB 3IKMA 1ATNA 2A41A 1RGIA 3NMUA 1X3MA 4H0YB 2QWPA 3MX2A 3T7ZA 1H1VA 2J0MA 3MDQA 3WXJA 3NVKA 3DWLA 5BRHA 3CIPA 4DHYA 4A57A 4FVUA 2V7YA 2GWJA 1YHQN 3ENBA 1BO5O 2Q0RA 5KQ8A 4TKNA 2FLOA 4BRHA 5EOYA 5AR0A 4BG8A 1ATRA 2P9LB 2HF3A 4NB4A 2Q2RA 4DB3A 4YOVA 2FSJA 2W41A 1U2VB 1W97L 3ID6A 5AQVA 1SAZA 3GDQA 5BN8A 4YOWA 3O9SA 1GC7A 3W3DA 3C0BA 1KBLA 3NVMA 4H5WA 4B1ZA 5JLFA 3CMEN 2IVPA 2PFUA 3VF2A 4BC5A 1QHAA 3LDQA 1GLLO 1LCUA 2V51B 1SS6A 3O9UA 2P9SB 2X0SA 2PAVA 3VPZA 3CC2N 4JK8A 4BVOA 5ADXA 5C12A 1NLVA 2ZGZA 4PKGA 4JKDA 3QDKA 4CZGA 5BRDA 4IEEA 1J19A 5KPTA 1T44A 4JKAA 3R6MA 1GLAG 2EWSA 1YUWA 2HBKA 4B9QA 4OPHA 1QZ6A 4CZMA 4ZRIA 1HB8A 1KAZA 3M3ZA 4NLBA 4B1VA 2P9PA 3CCRN 1G99A 4JD2B 4EAHD 4PHTX 2QTDA 3ZETA 3VEYA 3L4IA 4NLCA 3KWGA 4BRAA 1ZXOA 2GX9A 4JKGA 3LDPA 2ZF5O 1Q81O 1Y64A 2GELA 4FOEA 3H1QA 3TSUA 2ZJPL 2P9NA 2FSNA 1KXPA 1LOTB 4MLEA 3CCJN 4FWQA 5AFUH 4BGBA 1NM1A 4CYEA 1QQMA 2EMTA 2D0OA 1GG3A 1GLFO 4JKFA 5GAGP 4H0TB 3R8EA 3ZX0A 1ZC6A 3H6EA 1QQOA 2YVCA 3F9MA 4A5AA 4BQLA 4ILJA 4BRGA 3FR0A 3WXLA 4J8FA 5TKWA 4P7IA 1ATSA 1NJIO 3JS6A 2JWLA 2OTLN 4ISGA 2GEMA 4YDUC 3UKUA 3A5NC 5M1OA 5BPNA 4FSVA 5EX5A 1DT9A 4PKHA 4FOIA 3SJHA 1YITN 2CQUA 1MK9B 4XEIA 3U4LA 3G71N 2D0PA 4MO4A 4H0XB 1O13A 3VEZA 2W40A 3EE8A 3VESA 1ESVA 2A42A 1W2BM 3E9PA 4JHDA 4H5NA 2NRWA 4A59A 4O5FA 2WC9A 3VF6A 5LY3A 3CQYA 1JJ2M 3D6RA 2NRHA 1X9JA 4BR4A 2GUPA 2FSKA 3IUCA 5AQTA 3VEOA 1TYQB 1JCFA 1GC6A 2P9UB 2WFBA 3E1YA 3BF3A 1YIJN 1VQ7N 1X3NA 4BRNA 1VQ9N 3SAHA 3ID8A 2H3GX 2QWOA 4K41A 5F1XA 2ITMA 5HOOA 1J6ZA 1D4XA 2YI1A 4MLHA 3SMSA 1NGDA 3OHRA 3GG4A 4BRLA 4FWMA 3SK3A 4FO0A 1JCGA 3SAFA 2VGNA 3GOIA 4YOYA 3CCVN 1ILYA 2BUPA 2P9KB 1QZ5A 3CJ7A 3ZEUB 1ST7A 2BH1A 5AQHA 3BEXA 1DEJA 1GLBG 1QQNA 3DXMB 2E1YA 1HKGA 3O80A 4CZHA 5C10A 4UY8O 4H5VA 4KH4A 1MIZB 2I7NA 3DJCA 4CZEA 1SGHA 3AY9A 5M1KA 2KLAA 4WFBL 5BREA 1C0GA 1T3VA 1S72N 3EE9A 3A0IX 4I6MA 3CJBA 3PIPL 1T6CA 2HRJA 4LC9B 3HM8A 3WEEA 1BWFO 5AQZA 5AQQA 3I8BA 5KPZA 1HKBA 1WUAA 4JKCA 3DXKA 3H1VX 1KAXA 2ZGYA 3J7ZO 3SBTA 1Z05A 2ASPA 3S41A 2F9TA 2IIRA 2NRVA 1YJWN 3VEXA 2YJEA 3ATUA 4R79A 2JWKA 4WQ4C 5AQWA 3ULEA 2IVOA 3AAPA 5M1PA 1BUPA 5C15A 3O6WA 2WH5A 2NRTA 2HOEA 4PL8A 4XH5A 5E26A 1K73O 3BF1A 4YL8A 2CGKA 4JKHA 1IG8A 3FGUA 4EKUA 3CCLN 4G9ZA 4JN4A 3AU4A 4H5TA 2QWNA 4H0OA 1QVGM 4BRFA 1VQ8N 3F5TA 4A62A 4CZFA 1MIXA 4GVEA 4A61A 4H03B 4WYBA 5LJWA 3ENHA 2QM1A 4KBOA 3UKRB 4U7BA 5JLHA 2A3ZA 3L4QA 1KC8O 4MDAA 3ZYYX 2YHXA 1IJJA 4DKWA 3KK7A 4XH4A 2PBDA 4ISFA 3FZFA 2KHOA 4IWVA 3FZHA 3O5BA 5KQDA 3MWPA 3RSEA 3U8ZA 4H5RA 4ZRJA 2ZJQL 2ABDA 3EKUA 4K25A 4GY2B 5EXWA 1K8KB 2WUSA 1BU6O 5AQMA 4OO1J 3MN6A 5C2DA 2Q0UA 2YJFA 3ZX3A 2NRRA 2QI2A 4CD1A 5FPEA 4QS8A 3Q7BA 3CF5L 1T6DA 3GBTA 2GWKA 4BC4A 1KAYA 3PZDA 5AZJB 4BRCA 1EQYA 1RFQA 3HZ6A 4E1JA 3O1WA 4M63C 5AQXA 2E88A 2P9LA 2QXLA 4JK7A 4F7GA 5DM7L 4BR0A 3SMPA 2FXUA 3D2EB 4B1XB 1XUPO 4JNEA 3B8AX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILH A;  4JKG A;  4JKE A;  4JKH A;  4JK9 A;  4ILG B;  3E9L A;  3E9P A;  4JK8 A;  4JKG B;  4JKF A;  4JKD A;  3E9O A;  3SBG A;  3E66 A;  4JK7 A;  4JKA A;  4ILJ A;  4JKC A;  4JKB A;  3SBT A;  3ENB A; 
#chains in the Genus database with same CATH topology
 1RT3 A;  1BCO A;  3ALY A;  3TR8 A;  1JCE A;  4DUY K;  1YJN N;  3A8Y A;  3MED A;  4DWI A;  1QVF M;  4WCE L;  4AIL C;  3V6D A;  1VQ4 N;  3MWT A;  3THX B;  1VBG A;  4OPJ A;  3E9L A;  2FDQ A;  5J2Q A;  3CMA N;  1QHT A;  4H8K A;  1C1C A;  4BRE A;  1RDA A;  3QB0 A;  5J1E A;  2HHQ A;  2QA4 N;  4YOT A;  2P5G A;  4W5R A;  4ILH A;  2GBZ A;  1J5E K;  4FJ5 A;  4FJ7 A;  4BRP A;  1VQN N;  1IBM K;  4OLA A;  4ZHR A;  2FBX A;  3A5L C;  3PSI A;  4WFN L;  3LDS A;  4BQZ A;  3LWL A;  1NTI A;  3P1G A;  3WXM B;  2G8F A;  1X1P A;  1EF1 A;  5AQY A;  1S9E A;  2E1Z A;  4TSX A;  3LAN A;  2YNG A;  5F2R A;  1NBW A;  3LP3 A;  3KKS A;  1CLQ A;  3C6T A;  3QML A;  4DV6 K;  1NK6 A;  3CM6 A;  1QS4 A;  4B1U B;  4FJK A;  1VQL N;  3ENO A;  5M1Q A;  2YKN A;  3OBY A;  4R5P A;  5LJV A;  1NGG A;  3QFU A;  5JS1 A;  5KPR A;  2X78 A;  4DFK A;  3DLL L;  2XY5 A;  1RBV A;  4RW7 A;  3A5M C;  4FWR A;  5AQI A;  1K9M O;  2DTU A;  5ADX H;  3BY5 A;  1ACA A;  4JS4 A;  1VSI A;  3VMF B;  1D9D A;  4GKJ K;  1GGO A;  3DXM A;  3P39 A;  3THY A;  1KD1 O;  3JAM O;  1NKC A;  3DLK A;  2GUI A;  2EX3 A;  3C7N A;  3WT0 A;  3CER A;  2P9I B;  4C8M A;  4ISE A;  5H1S Q;  4QCL A;  4EHU A;  3R9P A;  2Q1N A;  2KZZ A;  1WAF A;  1V4T A;  3C65 A;  3QIJ A;  2EMS A;  1VHX A;  1DTT A;  4B3O A;  4DTO A;  4B1Y B;  3ZLJ A;  1VAZ A;  2WBN A;  3RWU A;  1S6Q A;  5E84 A;  4FJM A;  3CJC A;  4NYF A;  1JXB A;  3AGR A;  3HOT A;  4IJN A;  3OS2 A;  2PY5 A;  2KFZ A;  1GLC G;  3U8X A;  3NBP A;  1GOC A;  1E4G T;  1YI2 N;  3VTI A;  3CPE A;  1VSH A;  2A40 A;  3WA0 A;  4KKO A;  2RF2 A;  3SZ2 A;  1M90 O;  3N4Q A;  3A5O C;  4LF6 K;  3IMX A;  3OYJ A;  1K8K A;  2R82 A;  4B08 A;  3CI5 A;  3O08 A;  1BGX T;  2HVH A;  1NGC A;  4CHZ A;  1RBS A;  3FP5 A;  3KLH A;  3LPT A;  3CG7 A;  5J2M A;  3L2W A;  3S3O A;  3MX5 A;  4KAZ A;  2UXC K;  3AVA A;  3KLG A;  2WTU A;  4M45 A;  3ZET B;  4F2R A;  2QWQ A;  3O9R A;  1KRP A;  1ASU A;  2P9N B;  2QXF A;  4RW6 A;  3VQC A;  2IVN A;  3BIN A;  1TK5 A;  2OCE A;  3ATV A;  4CJ4 A;  2ZQB A;  3MEC A;  4DTS A;  4C1N I;  3THX A;  1KCF A;  3AA3 A;  4YOX A;  4HUG A;  4M3Z A;  1BA1 A;  3THW B;  4ZTF A;  3O8M A;  4BRI A;  1VRT A;  1BQN A;  4CFC A;  3CCE N;  4Y1D A;  4CBX A;  1XMO K;  1S22 A;  4W5N A;  1OKJ A;  1LWC A;  3DI6 A;  1S3X A;  3E66 A;  1NJX A;  4EZ6 A;  4DSL A;  5SWM A;  4JHD B;  2XY7 A;  3AU5 A;  1BI4 B;  3HVR A;  4AM6 A;  4KTQ A;  5BN9 A;  1V4S A;  4XIU A;  3QFP A;  3ZSX A;  4CGJ A;  3ULD A;  1BL3 A;  4YDU A;  4FPB A;  4YOR A;  2QWL A;  1J53 A;  3O1B A;  1Q8I A;  5M1F A;  2GTD A;  2UYT A;  1EKE A;  2Z1H A;  4DS5 A;  3FFK B;  3T1H K;  4E0D A;  4NO7 A;  1BCM A;  4JAX A;  5C2F A;  3DXK B;  1HKC A;  4EHT A;  1WSJ A;  3X23 A;  3LP0 A;  3HPH A;  3M1F A;  2NRX A;  4BG9 A;  4LF8 K;  3KWI A;  3LP2 A;  4N41 A;  1LAW A;  1U49 A;  1QQC A;  4E3S A;  2UUA K;  4HTU A;  2JGU A;  1NMD A;  4EFH A;  1TUU A;  3OYC A;  1F21 A;  2D2Q A;  1BIU A;  2I7P A;  4E7J A;  2P9I A;  1R0A A;  4JEP A;  3DLB A;  2LSN A;  4I9Q A;  1SQK A;  4J2D A;  3AA4 A;  1VBH A;  3KLI A;  1ZBL A;  1C0U A;  3UKR A;  4KHN A;  3UE5 A;  3RSE B;  1ATN A;  3U3G A;  2OPS A;  4JLH A;  3MX2 A;  1HPZ A;  2F8S A;  4F3T A;  3MDQ A;  4KHW A;  1N32 K;  2G8U A;  3G10 A;  4OPK A;  1RT1 A;  3ZSY A;  4DUZ K;  4TKN A;  4BG8 A;  3V9X A;  3OYA A;  2P9L B;  2HF3 A;  1J5O A;  2W41 A;  4KHY A;  1YTU A;  3W3D A;  1GC7 A;  4CIE A;  3L3U A;  3NVM A;  4DFM A;  3CME N;  5I42 A;  4DS4 A;  3VF2 A;  1SS6 A;  2PAV A;  3VPZ A;  3QIP A;  4PKG A;  4FYD A;  4BWJ A;  1VRU A;  4CJP A;  4IEE A;  3AVC A;  4JKA A;  1GLA G;  2Z1J A;  4CZM A;  1QZ6 A;  1HB8 A;  1KAZ A;  3M3Z A;  4W5Q A;  1OH7 A;  3V1R A;  4EAH D;  3ZET A;  1RT2 A;  4C8K A;  2BAN A;  2QK9 A;  2GX9 A;  2ZF5 O;  4FJL A;  4FOE A;  2UU9 K;  1J9A A;  2P9N A;  4DTR A;  3RRH A;  4CK1 A;  5AFU H;  3LAM A;  4AHU A;  4B9L A;  1QQM A;  5KRS A;  2VG6 A;  1GLF O;  4JKF A;  5GAG P;  3R8E A;  1JLC A;  3D45 A;  4FK4 A;  1KVB A;  3FR0 A;  3HP9 A;  3WXL A;  4J8F A;  3THW A;  1TKD A;  4P7I A;  4LFB K;  1K6Y A;  4DV1 K;  2KTQ A;  2GEM A;  3AVL A;  3A5N C;  5BPN A;  5K14 A;  1IG9 A;  1XI1 A;  2CQU A;  2KW4 A;  1DTQ A;  2AJQ A;  3OJU A;  4ZTJ A;  4FJI A;  4JHD A;  5LY3 A;  2WC9 A;  3D6R A;  1X9J A;  1BI4 A;  4C8N A;  4IG0 A;  3IUC A;  3VEO A;  3OYD A;  3F73 A;  2VG7 A;  4CHP A;  1X3N A;  5HOO A;  4K41 A;  5F1X A;  1J6Z A;  4FM2 A;  1J54 A;  4JI0 K;  3SK3 A;  4Z4H A;  5T7B A;  3CCV N;  4FM0 A;  3ZEU B;  2ZD1 A;  2BH1 A;  3BEX A;  1GLB G;  1WSI A;  4UY8 O;  1RT5 A;  2I7N A;  4CZE A;  3DJC A;  3LAL A;  4WFB L;  3PX0 A;  4OKK A;  1L3U A;  3RTV A;  1S72 N;  3EE9 A;  5LMU K;  1T6C A;  4LC9 B;  4DQR A;  3HM8 A;  3G0Z A;  3I8B A;  1WUA A;  4JKC A;  3DXK A;  1KAX A;  4I9L A;  2NRV A;  4JRQ A;  4FLV A;  2YJE A;  3ATU A;  1YJW N;  3I0R A;  3T3F A;  4Z4I A;  5M1P A;  1BUP A;  2WH5 A;  2NRT A;  4PL8 A;  3HM9 A;  3BF1 A;  4G9Z A;  4H5T A;  4A62 A;  4CZF A;  4IKF A;  4WYB A;  5LJW A;  3ZT0 A;  4KBO A;  4U7B A;  4DTJ A;  3ZYY X;  4FLT A;  1IJJ A;  1HMV A;  4XH4 A;  1MU2 A;  1IBL K;  4LF7 K;  4CJL A;  1RBR A;  3FZH A;  3VQE A;  3RSE A;  4H5R A;  2VQF K;  2ABD A;  4B9S A;  3TAQ A;  2WUS A;  3ZT4 A;  4PWD A;  2YJF A;  2ETJ A;  4JI7 K;  3NCI A;  1IH7 A;  3L3V A;  4BC4 A;  5AZJ B;  3HZ6 A;  2HNY A;  2P9L A;  2QXL A;  4JK7 A;  1ZBF A;  3QER A;  1U45 A;  4BR0 A;  3OYM A;  4B1X B;  1NJW A;  3B8A X;  1YTA A;  4IOC L;  3WQT A;  3AVI A;  3DOK A;  3PUF A;  1NOY A;  2CGL A;  2YHW A;  3CC4 N;  4IOA L;  4ZRK A;  4CD3 A;  5HL7 L;  1GOA A;  2PYL A;  1BQM A;  1VQK N;  4KRE A;  4FLU A;  2FJ9 A;  3J7A P;  3K0S A;  3VQ4 A;  2V7Z A;  3OA9 A;  4F9O A;  4DR3 K;  2D4W A;  4BY9 C;  4KV8 A;  4FW2 A;  5JMV A;  4DTX A;  3P4I A;  1OH5 A;  3K2P A;  3RVC A;  2NNW A;  4FL9 A;  3EYZ A;  3LPU A;  3OVN A;  3TAF A;  2YCH A;  4CZI A;  3MCP A;  1XQS C;  3M8Q A;  3U9D A;  3TWH A;  3VER A;  4FW1 A;  2E2Q A;  4DCH A;  2OAN A;  4FWL A;  2F8T A;  1N34 K;  5JIC A;  1JLG A;  3UB5 A;  4FPA A;  3LL3 A;  4JI6 K;  3AO5 A;  4DV3 K;  3OYB A;  3QEI A;  3WXI A;  3ISN C;  4CZL A;  4F2S A;  2CH6 A;  4KHP K;  4DV0 K;  3CYM A;  4CGD A;  1NU0 A;  4IDH A;  4DR5 K;  1ZBS A;  2HHW A;  2AP1 A;  2IDO A;  3CCM N;  1BIZ A;  3PSF A;  2COP A;  4E1N A;  3VQB A;  4IFE A;  4J2E A;  1RT6 A;  3K9J A;  2O8B B;  3WNF A;  3O4W A;  1RCH A;  4NCA A;  3QEP A;  2OPQ A;  4BE2 A;  4PKI A;  3ZEU A;  2RE2 A;  3M8R A;  1RDB A;  2IC3 A;  3QBX A;  4JI1 K;  2OPR A;  3VGK A;  5FPD A;  2PZS A;  1H4R A;  4C23 A;  3F9K A;  3VQQ A;  1VQO N;  3NH0 A;  3RR8 A;  1C0F A;  4GVM A;  3ULE B;  1EWR A;  3VEN A;  2RHK A;  1RT7 A;  3DAW A;  5DM6 L;  1RDD A;  1E5W A;  2HE7 A;  2DFF A;  2NZT A;  2Q3S A;  2FBT A;  1RBT A;  1XHX A;  4FVM A;  3AVF A;  3CJ9 A;  1NGE A;  4U67 L;  3SQ1 A;  3TAE A;  4HVJ A;  4M3T A;  1NGI A;  4JKB A;  2OTJ N;  1Q9X A;  4IDK A;  5FPM A;  2VWJ A;  1WLJ A;  2HMP A;  3EPY A;  5CZ1 A;  4BC2 A;  1JLQ A;  4GV6 A;  3R1X A;  5FPN A;  3DLE A;  1B9F A;  5JVH L;  3DYA A;  4GNI A;  4IO9 L;  3BP8 A;  1BOT O;  1GLE G;  1HNZ K;  1EXQ A;  3ZSO A;  2X6S A;  3SBG A;  4BC3 A;  3DRP A;  4IZ9 A;  3G4S N;  5MLC Q;  5AQS A;  4JI8 K;  2AEH A;  4KHU A;  2Q97 A;  1Z6R A;  4BRO A;  4AQY K;  5BR9 A;  1KC7 A;  2YHA A;  2GV9 A;  3VQ7 A;  5AZJ A;  1T7P A;  4CEC A;  4YOU A;  4ID5 A;  4DXA B;  1CZB A;  4KH6 A;  2P9P B;  3QEW A;  2P1J A;  2ATQ A;  3MN5 A;  3O9T A;  1WSH A;  4LSL A;  1OVY A;  3W0L A;  4JKG B;  4DV5 K;  4O8K A;  4CEE A;  1RDU A;  2VG5 A;  2HBL A;  3CCQ N;  2DY4 A;  4RW9 A;  4B9N A;  3O3H A;  4BR2 A;  1YVU A;  3AO2 A;  3KD5 E;  1T03 A;  3CJA A;  5CR4 A;  1SUQ A;  1KVC A;  2QKB A;  1HPM A;  4C8L A;  4QOZ B;  2VWB A;  4C1N K;  4L8R B;  3UKU B;  1NGB A;  4FK2 A;  3O3F A;  3EKS A;  3MN7 A;  4FWO A;  1I3A A;  1JLE A;  3FE1 A;  2Y1J A;  4DV4 K;  3J7Y P;  1XWL A;  3LDL A;  4WQ5 C;  1FJG K;  4BGA A;  4GV3 A;  4KTW A;  4KI6 A;  3NGI A;  1NMN A;  3L2V A;  1GLD G;  2E2N A;  5BPM A;  3CD6 N;  1FXX A;  1SZ2 A;  1XC3 A;  2D11 A;  3I8D A;  1ISN A;  3FLV A;  4WFA L;  3AVG A;  5TKY A;  3VA3 A;  1S6P A;  2NLX A;  3MXJ A;  1KVA A;  3EN9 A;  4Z4C A;  3FFI A;  3VQ8 A;  2CB8 A;  4NCG A;  3AGK A;  1MK7 B;  2O8F B;  5F0X A;  4I6M B;  3BGR A;  2O8E B;  5DMR A;  4CJV A;  1UA0 A;  1NKE A;  2E6L A;  4OGE A;  2O8B A;  1NGF A;  1ITG A;  3CCS N;  4ID1 A;  4O0I A;  2UUB K;  1IBK K;  4M3Y A;  2D10 A;  2VGM A;  3C6A A;  4K42 A;  1C0M A;  4AM7 A;  1DIK A;  4J2B A;  3E9O A;  5GAE P;  4CJE A;  3VQA A;  3ZX2 A;  4CEA A;  2HNZ A;  1ZBH A;  1G15 A;  5GAD P;  4MDB A;  4A2A A;  3AAR A;  3A2F A;  3MN9 A;  4CBU A;  5IT9 O;  3TAN A;  1R59 O;  4M3W A;  4X66 K;  2XHB A;  3LZI A;  1U4B A;  3NMU A;  1X3M A;  2QWP A;  4DSI A;  1WSG A;  2J0M A;  4CFD A;  4E7L A;  3TAB A;  3VQ6 A;  3NVK A;  3L2U A;  4CEO A;  2V7Y A;  5KGW A;  3O3G A;  1YHQ N;  2Q0R A;  5KQ8 A;  3OYH A;  4BRH A;  5EOY A;  5AR0 A;  4JI2 K;  1ATR A;  1JXE A;  4DB3 A;  4B8A B;  1U2V B;  1WBD A;  3GDQ A;  4M41 A;  1REV A;  2DFH A;  1KBL A;  4H5W A;  1RBU A;  3LDQ A;  3VQ9 A;  2YHB A;  2P9S B;  1QSY A;  3SUN A;  4JK8 A;  4BVO A;  5ADX A;  5C12 A;  2ZGZ A;  4JKD A;  3QDK A;  4NXM K;  4N5S A;  3AO3 A;  1J19 A;  5KPT A;  3T1Y K;  1T44 A;  3KKR A;  2EWS A;  1YUW A;  1C1A A;  3AVH A;  1T05 A;  4B9U A;  4DR7 K;  4DR6 K;  2P9P A;  1G99 A;  3P5J A;  3OTO K;  2E4L A;  3VEY A;  4DQS A;  3KWG A;  3LDP A;  4JKG A;  1XNR K;  2GEL A;  5BR8 K;  4HHT A;  1NNE A;  1KXP A;  1LOT B;  4FWQ A;  1SV5 A;  4CYE A;  4CJT A;  4LF5 K;  2HB5 A;  1FK9 A;  3KK2 A;  3ZX0 A;  3M8P A;  1VSD A;  2YVC A;  3KK3 A;  1IKV A;  1Y97 A;  4A5A A;  3ZCM A;  4ILJ A;  4CJF A;  5C25 A;  2B5J A;  2HHV A;  4ISG A;  4CVN E;  3UKU A;  2WON A;  4FSV A;  2YV0 X;  1YIT N;  2D5R A;  3SJH A;  1L3S A;  1MK9 B;  4BE1 A;  3MXI A;  4MO4 A;  4OJR A;  3VEZ A;  1HNV A;  3ITH A;  1RTH A;  3VES A;  2HW3 A;  2A42 A;  1W2B M;  1RT4 A;  4H5N A;  4A59 A;  4O5F A;  3VF6 A;  4DSE A;  2NRH A;  4BR4 A;  4DF8 A;  1TYQ B;  2P9U B;  1KLN A;  4M42 A;  1LWE A;  3E1Y A;  3BF3 A;  5HP1 A;  4BRN A;  4CGF A;  3SMS A;  3OHR A;  1KFD A;  3GOI A;  4YOY A;  1RTI A;  4V19 S;  2P9K B;  1QZ5 A;  5FRN A;  4DR4 K;  4B9M A;  1KTQ A;  1DEJ A;  1QQN A;  4CZH A;  2E1Y A;  4O0J A;  3HPO A;  3B6P A;  5M1K A;  2KLA A;  4AHV A;  2O8F A;  1T3V A;  4DSJ A;  4I6M A;  3SCX A;  5KPZ A;  2O8E A;  3EY1 A;  4CJW A;  2ZGY A;  3J7Z O;  2ASP A;  4FJX A;  5AQW A;  5C15 A;  1QSL A;  2UXD K;  5E26 A;  2HOE A;  1WNS A;  2CGK A;  4EKU A;  3CCL N;  3D0P A;  4FLY A;  3KIO A;  3AVB A;  4GVE A;  3ENH A;  2HHT A;  3V1O A;  1KC8 O;  4MDA A;  2YHX A;  4YHH K;  2XY6 A;  2W6L A;  5J2N A;  2JLE A;  2G8H A;  4DV7 K;  1SKS A;  5KQD A;  3MWP A;  2IAJ A;  5EXW A;  1BU6 O;  4O5B A;  1HNW K;  5C2D A;  3C6U A;  1HNX K;  2Q0U A;  3ZX3 A;  3C95 A;  2QI2 A;  4YY3 K;  3Q7B A;  3CF5 L;  4CF2 A;  2GWK A;  1KAY A;  4I7F A;  2E88 A;  3VQD A;  1TK0 A;  3HO1 A;  4DFJ A;  2FXU A;  3D2E B;  2X74 A;  5JS2 A;  2A6A A;  3EZW A;  2P9S A;  3AVN A;  3CQX A;  2HHH K;  4FJJ A;  4BRQ A;  4HWI A;  4H0V B;  4JV5 K;  3T19 A;  1OH8 A;  3WNE A;  3BZC A;  4M3R A;  4HUE A;  3G9W A;  2OYQ A;  2CH5 A;  2HBJ A;  2NUB A;  1BDG A;  1S9G A;  2IOC A;  5AQP A;  1DKG D;  5SZT A;  3FZK A;  4FJ8 A;  3PLA A;  1Q82 O;  2KFN A;  1DGK N;  3HSC A;  4CI6 A;  3SQ4 A;  4IXC A;  3NGZ A;  3KHY A;  4BDP A;  3SV4 A;  1IV0 A;  3JXU A;  3DLG A;  4H4M A;  4IFV A;  2J0K A;  4Z94 A;  3ZT3 A;  5FLX O;  3KD1 E;  3QET A;  4ELU A;  1W0H A;  3M5R A;  1HRH A;  2O4G A;  4ILG B;  4CHQ A;  5I3U A;  2OA8 A;  5BRF A;  4B8C A;  1U04 A;  4CJU A;  4CIF A;  2HHX A;  3SNN A;  3DLH A;  4NYN A;  4FWN A;  2FF6 A;  2P51 A;  5ELZ A;  3HST B;  2ZJR L;  3GL1 A;  1TKZ A;  4FZX C;  4CK3 A;  2FBY A;  4O8U A;  4CEZ A;  3UIQ A;  2CGJ A;  4WQ5 A;  4DF4 A;  5AZI B;  1TKX A;  1WB9 A;  1TYQ A;  2P9U A;  4PUO A;  4KTZ A;  4KH5 A;  4FLX A;  1WSE A;  3CC7 N;  4EP4 A;  5B8H A;  1C1B A;  3I33 A;  3AVM A;  2YNF A;  4F3O A;  4B1W B;  4DSF A;  4AHC A;  2P9K A;  1VQM N;  4RW4 A;  4EZ9 A;  5AQU A;  1XNQ K;  3KVG A;  4Y1C A;  2OZS A;  4DQQ A;  3G6E N;  4F8R A;  2A1R A;  1K8A O;  2QWM A;  4CW7 B;  5AFU A;  3KTQ A;  1A5V A;  1NJY A;  2F4V K;  1HBK A;  3AVK A;  2HF4 A;  1HUX A;  3D7E O;  1X9W A;  4M7Y A;  1NKB A;  4A5B A;  5KTQ A;  2O8C B;  3JYT A;  4BR9 A;  4NY0 A;  1NK0 A;  3LDN A;  4HDO A;  3CFO A;  4NXN K;  3S9H A;  4IFY A;  5CHI A;  3NF9 A;  4IJA A;  3I56 N;  1N33 K;  4LFA K;  4I2P A;  5GIP A;  2G8V A;  5IWA K;  4Q5V A;  3HTV A;  4WQ4 A;  1NK8 A;  3NF6 A;  3HOS A;  3SAG A;  1S1U A;  3OJS A;  1HJO A;  1ZBU A;  2NRZ A;  2E2P A;  4O44 A;  3CET A;  2R7Y A;  2QWR A;  3H45 C;  3EL2 A;  1KLM A;  3H3N O;  4Y0W A;  3HPG A;  4LF9 K;  4Z4E A;  1WAJ A;  1MA9 B;  2IGI A;  3P83 D;  3GE1 A;  3KZB A;  5AQJ A;  5EVZ A;  5GIN A;  1ZBI A;  3V1Q A;  3MEE A;  1WOQ A;  3LP1 A;  3D2E A;  4IBN A;  3SUO A;  3I55 N;  2ITG A;  1LAV A;  4FWK A;  3HI0 A;  5AQF A;  4FJN A;  5HRO A;  3KK1 A;  2YNI A;  1TGO A;  4IO8 A;  1TAQ A;  4E89 A;  3IVF A;  4QAG A;  1VQ5 N;  3J80 O;  3CJ1 A;  3VGL A;  1GOB A;  5AQG A;  1YAG A;  4BDY A;  1IO2 A;  3FZL A;  1HX1 A;  3P38 A;  3ZSR A;  1BA0 A;  3CXC M;  3K5M A;  5C24 A;  3OW2 M;  2HBM A;  3SPZ A;  2XY8 A;  4CF9 A;  4CZJ A;  1X9M A;  2FC0 A;  3SUQ A;  4QS7 A;  4CGH A;  3CFP A;  2FBV A;  1VSK A;  3U7D A;  2E8A A;  4GV9 A;  5HBM A;  3TAM A;  4BRM A;  3CPW M;  2B4J A;  5AQK A;  4CJ7 A;  4MO5 A;  1U48 A;  3T69 A;  3TPQ A;  3Q7C A;  2VCP A;  3AV9 A;  1HYV A;  3F2K A;  1EO1 A;  5JVG L;  2I1J A;  1I39 A;  4OVL A;  4JI5 K;  2A5X A;  4CIG A;  1SL0 A;  3WQU A;  2AA4 A;  2XRI A;  4M3X A;  4HTL A;  5AZI A;  2YHY A;  4DQ8 A;  1NGH A;  3VN5 A;  5J2P A;  3CCU N;  3QEX A;  1YF5 L;  4CEF A;  4OKJ A;  1W7A A;  4IOX A;  1P8Z A;  4YNQ A;  1M1K O;  2BTF A;  2Y1I A;  1NJZ A;  3BDP A;  4RCH A;  4XH1 A;  5CE3 A;  1RIL A;  2Z1G A;  1HQE A;  1A5X A;  3ZSZ A;  1MWK A;  1CZA N;  3TTF A;  3C7N B;  4HDQ A;  2KQ2 A;  4FJ9 A;  1O1W A;  3K58 A;  2VQE K;  1Q86 O;  1U6Z A;  1QSS A;  4RTF D;  1TAU A;  5CYM A;  3KJV A;  3OYN A;  1MDU B;  4RWT A;  1RDW X;  2P5O A;  4F4K A;  3HL8 A;  5AQO A;  4HCB A;  3WUH A;  4DU4 A;  3H3O B;  3L6Q A;  3DM2 A;  4Q0B A;  3IKM A;  2RKI A;  2A41 A;  3E01 A;  3NF7 A;  3H08 A;  2O8C A;  3PV8 A;  3V9W A;  1UOC A;  3T7Z A;  1H1V A;  1XUP O;  5BRH A;  1CXQ A;  4DHY A;  3QNO A;  4A57 A;  1VK0 A;  1BO5 O;  2G8I A;  2FLO A;  3SQ2 A;  2Q2R A;  2E6M A;  4DFP A;  4B9T A;  2FSJ A;  3HVT A;  3DLR A;  5AQV A;  1SAZ A;  1N6Q A;  4YOW A;  2BGG A;  4B1Z A;  2IVP A;  3DRR A;  2PFU A;  4AHT A;  4BC5 A;  1QHA A;  3AVJ A;  1GLL O;  2V51 B;  3CC2 N;  2X0S A;  3T1A A;  3K57 A;  4I2Q A;  4CZG A;  1BIS A;  3PO5 A;  1SL2 A;  1ASW A;  4B3M K;  3S3N A;  2HBK A;  4OPH A;  2A1S A;  4NLB A;  4B1V A;  3CCR N;  1DLO A;  4JD2 B;  3V9Z A;  3TAP A;  3BZK A;  1Z26 A;  4NLC A;  4BRA A;  1ZXO A;  1L3T A;  1Q81 O;  1Y64 A;  3H1Q A;  1KSP A;  4BGB A;  5AJ3 K;  1GG3 A;  1FKP A;  4RW8 A;  1C0T A;  4DG1 A;  4H0T B;  5LMN K;  3H6E A;  1QQO A;  5C42 A;  1FKO A;  3OYE A;  3F9M A;  1EWQ A;  4CF1 A;  4BQL A;  1IKY A;  4BRG A;  2BE2 A;  5TKW A;  1NJI O;  4W5T A;  2JWL A;  2OTL N;  3OY9 A;  2RN2 A;  3O4N A;  5EX5 A;  4BE0 A;  4AHS A;  4FOI A;  3HT3 A;  4XEI A;  4FXD A;  2D0P A;  1O13 A;  2W40 A;  3LAK A;  5HRR A;  3E9P A;  2NRW A;  3LWM A;  1JJ2 M;  3V9S A;  2GUP A;  1A5W A;  5AQT A;  2FSK A;  2VWK A;  1SKR A;  1JCF A;  2WFB A;  1VQ7 N;  1YIJ N;  3I0S A;  1VQ9 N;  3SAH A;  3ID8 A;  2H3G X;  2QWO A;  3VQ5 A;  4LFC K;  4HUF A;  2UXB K;  4E7H A;  2W42 A;  1VSL A;  5DK5 A;  4MLH A;  1L5U A;  1NGD A;  1WBB A;  1ILY A;  2BUP A;  4OLB A;  3KLF A;  5KGX A;  3OS0 A;  1ST7 A;  3O80 A;  5C10 A;  1HKG A;  2F96 A;  4PY5 A;  4H5V A;  1MIZ B;  5BRE A;  4CEQ A;  3A0I X;  5EU7 A;  3CJB A;  2D0B A;  2HRJ A;  3L2R A;  2RPI A;  3HK2 A;  1BWF O;  4CJQ A;  1HKB A;  1CZ9 A;  2IS3 A;  4CJS A;  3SBT A;  4DU1 A;  3S41 A;  4B9V A;  1B92 A;  3VEX A;  5A2Q O;  4R79 A;  4DQI A;  2JWK A;  4WQ4 C;  3ULE A;  4CES A;  3HXM A;  4YL8 A;  1IG8 A;  4KB1 A;  3AU4 A;  1NOZ A;  4H0O A;  1QVG M;  3F5T A;  5D3G A;  1N5Y A;  4A61 A;  2O8D B;  2QM1 A;  3UKR B;  5JLH A;  2A3Z A;  3L4Q A;  3B6O A;  3KK7 A;  1WN7 A;  4ISF A;  5FRO A;  2KHO A;  1UA1 A;  4IWV A;  3WNH A;  4BDZ A;  4JI4 K;  4B3T K;  3O5B A;  3U8Z A;  3TI0 A;  4ZRJ A;  3SYZ A;  3EKU A;  2OZM A;  4GY2 B;  5AQM A;  1IKW A;  4OO1 J;  3QO9 A;  3SPY A;  3CQ8 A;  3AA5 X;  4QS8 A;  3NHG A;  3OYG A;  1C6V A;  3GBT A;  4BRC A;  1RFQ A;  4E1J A;  4M63 C;  4KRF A;  3ASM A;  4CF0 A;  3J81 O;  4JNE A;  4CEB A;  2ZWH A;  4FZY A;  3ZSW A;  5BPL A;  5AQR A;  4BWM A;  4DTP A;  1EX4 A;  4FLZ A;  2HVI A;  1YJ9 N;  4WE1 A;  2E20 A;  3M6G A;  4L3Q A;  4AHR A;  3NE6 A;  3VEV A;  4JYA K;  4CGG A;  3LDO A;  4JD2 A;  2ASO A;  4FK0 A;  3K9K A;  5GAH P;  3VET A;  3G25 A;  1QE1 A;  3IDH A;  3NFA A;  3O4Q A;  5CZ2 A;  2V52 B;  3U9Z A;  1N8R O;  4J2A A;  3TAR A;  1JL1 A;  4O55 A;  2HHU A;  3U6F A;  1T8E A;  1TK8 A;  4DR2 K;  1NGA A;  2DPN A;  3BUZ B;  3VOV A;  1NWK A;  3VGM A;  3K59 A;  5KRT A;  1JLA A;  3QBW A;  3D2F B;  4FLW A;  3PVL A;  4CHO A;  1WSF A;  1HR0 K;  1TV6 A;  3QIO A;  3V4I A;  3PX6 A;  2HST A;  1S1V A;  2G8K A;  1HJR A;  3LM2 A;  3MK6 A;  5IJM A;  3N4P A;  5AQN A;  3RR7 A;  4NCB A;  5AQL A;  3ZT1 A;  5KI6 A;  1LW2 A;  5HLF A;  1UWB A;  3L2Q A;  2D0A A;  1CXU A;  3EO3 A;  2LBB A;  4E19 A;  4PA1 A;  4H0P A;  1S5J A;  4K43 A;  3HJF A;  3MCA B;  4LD0 A;  1Q7Y O;  1XC9 A;  4CE9 A;  1IKX A;  4A2B A;  4BR7 A;  4GXB A;  1RTJ A;  1GLJ O;  5JVL A;  4C8O A;  3WXK A;  2O4I A;  4QS9 A;  4CJR A;  3TSQ A;  4HCC A;  4ICL A;  3PIO L;  4K8X A;  1JLB A;  3TTC A;  3MXM A;  4DSK A;  5M1N A;  1LWF A;  3MMV A;  2FF3 B;  1TL1 A;  5I9E B;  1VQ6 N;  2QEX N;  2O8D A;  4N76 A;  3FLC O;  5HRN A;  4KFB A;  4IEI A;  3HBT A;  3R3L A;  4DTM A;  5FRM A;  1Q18 A;  3H46 O;  2QKK A;  4EP5 A;  2Q36 A;  2YX6 A;  2Q31 A;  1U47 A;  4GW6 A;  4DU3 A;  3U3Y A;  3ZDT A;  1JL2 A;  3NGY A;  4FZZ A;  4Z0U A;  1U2V A;  3VA0 A;  2G8W A;  4OPA A;  1TKT A;  3IAY A;  2J0J A;  1D9F A;  3SV3 A;  3RRG A;  1MWM A;  4JKE A;  5EY4 A;  4JK9 A;  2E2O A;  4CJ3 A;  1NK4 A;  3CHW A;  3JSM A;  2E5L K;  1HNI A;  3NAE A;  4BR5 A;  3P31 A;  3ZSV A;  4CF8 A;  3PX4 A;  2DIK A;  3AO1 A;  3NF8 A;  4RG8 A;  4CZK A;  5CYQ A;  1D8Y A;  1Q9Y A;  1TUY A;  4LF4 K;  1JLF A;  3QIN A;  2F9W A;  1JKH A;  1VQP N;  4X65 K;  2ZM6 K;  2VYP A;  4K8Z A;  1JDE A;  3O9Q A;  4CER A;  3OS1 A;  1I94 K;  1X9S A;  3OBW A;  1YVN A;  3NH1 A;  4CJK A;  4FCY A;  4BRD A;  3VF4 A;  3M8S A;  4DR1 K;  4N56 A;  5HRP A;  3NDK A;  3L0Q A;  3TTD A;  1LV5 A;  1EET A;  2QW9 A;  3V81 A;  4E1M A;  3C6H A;  4BVP A;  2ZPY A;  5FDL A;  4N47 A;  2Z1I A;  3LM9 A;  4BRK A;  4FJH A;  4M3U A;  5C0Y A;  2BDP A;  3OYF A;  2HND A;  2J4R A;  3QLH A;  3HRG A;  2F7T A;  4Z4G A;  4W5O A;  4DTU A;  4LH4 A;  4PL7 A;  1XMQ K;  1HLU A;  3VTH A;  1HB6 A;  1NGJ A;  3D2F A;  2RQ1 A;  4AH9 A;  1OH6 A;  3K5O A;  4CCH A;  3HP6 A;  3MAQ A;  3TSP A;  1NVL A;  4B3R K;  4CFA A;  3IFR A;  2HMI A;  4O4G A;  3SJJ A;  4X62 K;  4FWP A;  2KKZ A;  2I1K A;  3RMD A;  3WEE B;  1YXQ A;  2XO7 A;  3FZM A;  1S1W A;  4X64 K;  3QIC A;  5E41 A;  4CBW A;  4FWS A;  4M7X A;  4CED A;  3SLC A;  3TU5 A;  4BAC A;  1TL3 A;  1BG3 A;  4YFU A;  1Y19 B;  1NG9 A;  2YKM A;  4WF9 L;  1NI2 A;  4E7I A;  1RTD A;  3J8A A;  5CY4 A;  2D1K A;  3VEW A;  3RMA A;  4KB0 A;  3PY8 A;  4EIA A;  1KQS M;  1P90 A;  4AF1 A;  1L3V A;  3V9U A;  4G1Q A;  2AL6 A;  4CHY A;  5GIO A;  3AAQ A;  1E4F T;  3OYK A;  2ASM A;  4CHN A;  1HYZ A;  1XHZ A;  3S3M A;  1RGI A;  1S1T A;  3AO4 A;  3C94 A;  4H0Y B;  4Z4F A;  3PO4 A;  3AA2 A;  3WXJ A;  1ZYQ A;  1EP4 A;  2PYJ A;  3DWL A;  2OPP A;  3CIP A;  3DMJ A;  4FVU A;  2GWJ A;  1N36 K;  3ENB A;  4IG3 A;  4KHS A;  4NB4 A;  4YOV A;  5BN8 A;  1W97 L;  3ID6 A;  4CK2 A;  3VQP A;  4ELV A;  3O9S A;  4DV2 K;  3C0B A;  3NH2 A;  5JLF A;  1SL1 A;  3IS9 A;  1LCU A;  3O9U A;  4KHQ A;  4CGI A;  3SQ0 A;  1NLV A;  3QES A;  5BRD A;  4FM1 A;  4GKK K;  3K5L A;  3R6M A;  1D5A A;  4B9Q A;  2W6K A;  4ZRI A;  3MEG A;  1QTM A;  1B9D A;  4LSN A;  3OYL A;  4PHT X;  2QTD A;  4KPY A;  4KO0 A;  3L4I A;  3THV A;  4OGC A;  3TSU A;  3CFR A;  2ZJP L;  2FSN A;  4E7K A;  4MLE A;  3CCJ N;  2HHS A;  1W9H A;  1NM1 A;  1UAX A;  1VSJ A;  2D0C A;  2EMT A;  2D0O A;  4ELT A;  3IRX A;  1ZC6 A;  1ASV A;  4JI3 K;  1VSF A;  4LY7 A;  4K0K K;  1ATS A;  3TAG A;  3JS6 A;  4YDU C;  3ZSQ A;  3K5N A;  1BHL A;  4CFB A;  5M1O A;  1DT9 A;  4PKH A;  3LZJ A;  4GMJ B;  3KLE A;  3HYF A;  3U4L A;  3G71 N;  3QEV A;  4H0X B;  3EE8 A;  1ESV A;  1NK5 A;  2YNH A;  3CQY A;  5LL6 Z;  4MFB A;  1TVR A;  1VSE A;  4H4O A;  1GC6 A;  1E3M A;  3OYI A;  1Z25 A;  2ITM A;  1D4X A;  2YI1 A;  3L8B A;  3GG4 A;  4BRL A;  4FWM A;  4FO0 A;  1JCG A;  3SAF A;  2VGN A;  1VSM A;  1NK9 A;  4OKE A;  3CJ7 A;  5AQH A;  3DXM B;  2EHG A;  3CM5 A;  1NK7 A;  4MQ3 A;  4KH4 A;  1SGH A;  1LW0 A;  3AY9 A;  3THY B;  3RMB A;  2UUC K;  5HRS A;  1C0G A;  2I5J A;  1HQU A;  3PIP L;  1RDC A;  4B3S K;  3WEE A;  4DQP A;  5AQZ A;  5AQQ A;  3WNG A;  4OX9 K;  4JS5 A;  4LH5 A;  1OVQ A;  3SUP A;  3H1V X;  3RMC A;  1Z05 A;  3DRS A;  2F9T A;  2IIR A;  3QNN A;  1YT3 A;  1S1X A;  2IVO A;  3AAP A;  3O6W A;  4XH5 A;  1K73 O;  4JRP A;  4JKH A;  3FGU A;  4FJG A;  4JN4 A;  2QWN A;  4BRF A;  1VQ8 N;  1MIX A;  2KZM A;  2WOM A;  4H03 B;  1SKW A;  4DKW A;  2B6A A;  4DLG A;  2PBD A;  4DLE A;  4DTN A;  3FZF A;  2X6N A;  4DMN A;  4KI4 A;  3EZ5 A;  3EEQ A;  2ZJQ L;  4K25 A;  1K8K B;  1FW6 A;  1RNH A;  3MN6 A;  3DOL A;  4UQG A;  2NRR A;  4CD1 A;  5FPE A;  1HYS A;  3SI6 A;  1T6D A;  3PZD A;  3ZT2 A;  1EQY A;  3O1W A;  5AQX A;  3IG1 A;  2ZE2 A;  4F7G A;  5DM7 L;  4PQU A;  3SMP A;  1KFS A;  2DFE A;  4CJ5 A; 
#chains in the Genus database with same CATH homology
 2A6A A;  2ZWH A;  4IOC L;  3EZW A;  3WQT A;  5BPL A;  2CGL A;  2P9S A;  5AQR A;  1JCE A;  2YHW A;  3CC4 N;  1YJN N;  4ZRK A;  3A8Y A;  3CQX A;  4CD3 A;  1QVF M;  4IOA L;  5HL7 L;  4BRQ A;  4WCE L;  1YJ9 N;  4HWI A;  4H0V B;  1VQ4 N;  3MWT A;  1VQK N;  2E20 A;  3M6G A;  1VBG A;  4L3Q A;  2FJ9 A;  3E9L A;  3G9W A;  2FDQ A;  3VEV A;  2CH5 A;  3CMA N;  2HBJ A;  3LDO A;  1BDG A;  5AQP A;  1DKG D;  2V7Z A;  3OA9 A;  4JD2 A;  3FZK A;  2ASO A;  4F9O A;  3PLA A;  1Q82 O;  1DGK N;  2D4W A;  4BY9 C;  3HSC A;  4BRE A;  3QB0 A;  3K9K A;  4CI6 A;  3VET A;  4IXC A;  3G25 A;  4YOT A;  5GAH P;  3KHY A;  3IDH A;  5JMV A;  2QA4 N;  3P4I A;  3JXU A;  4ILH A;  3RVC A;  2NNW A;  4FL9 A;  2V52 B;  3U9Z A;  1N8R O;  2J0K A;  4BRP A;  4Z94 A;  2YCH A;  4CZI A;  1VQN N;  3MCP A;  3M5R A;  4WFN L;  3A5L C;  1XQS C;  3U9D A;  4ILG B;  3VER A;  5BRF A;  2E2Q A;  1NGA A;  4DCH A;  2OAN A;  4BQZ A;  2DPN A;  3BUZ B;  4FWL A;  4FWN A;  3VOV A;  1NWK A;  3VGM A;  1NTI A;  2FF6 A;  5JIC A;  3WXM B;  5ELZ A;  3UB5 A;  1EF1 A;  4FPA A;  2E1Z A;  3LL3 A;  5AQY A;  3GL1 A;  3QBW A;  2ZJR L;  3D2F B;  5F2R A;  3PVL A;  3WXI A;  1NBW A;  4CZL A;  2CH6 A;  3QML A;  2HST A;  4O8U A;  3LM2 A;  2CGJ A;  3MK6 A;  4WQ5 A;  4B1U B;  5IJM A;  3N4P A;  5AQN A;  5AZI B;  4IDH A;  5AQL A;  1ZBS A;  3ENO A;  1TYQ A;  3OBY A;  2P9U A;  5M1Q A;  5LJV A;  1VQL N;  2AP1 A;  4KH5 A;  3CCM N;  1NGG A;  3QFU A;  5KPR A;  2COP A;  3DLL L;  3CC7 N;  4IFE A;  5B8H A;  3A5M C;  4FWR A;  5AQI A;  3K9J A;  3I33 A;  1K9M O;  5ADX H;  4B1W B;  3EO3 A;  2LBB A;  3O4W A;  1ACA A;  3VMF B;  2P9K A;  4H0P A;  4PKI A;  4K43 A;  1VQM N;  3ZEU A;  2RE2 A;  1GGO A;  3DXM A;  3QBX A;  3P39 A;  5AQU A;  3MCA B;  3KVG A;  3VGK A;  5FPD A;  3G6E N;  1Q7Y O;  1KD1 O;  1H4R A;  4C23 A;  4A2B A;  1K8A O;  4BR7 A;  2QWM A;  3C7N A;  5AFU A;  4GXB A;  1VQO N;  1C0F A;  3WT0 A;  3CER A;  1GLJ O;  2P9I B;  4ISE A;  2RHK A;  3ULE B;  3VEN A;  5H1S Q;  3DAW A;  5DM6 L;  4EHU A;  1HBK A;  1E5W A;  2HE7 A;  5JVL A;  2NZT A;  2HF4 A;  2Q1N A;  3R9P A;  3WXK A;  1V4T A;  1HUX A;  3C65 A;  3QIJ A;  4QS9 A;  3CJ9 A;  3TSQ A;  1NGE A;  3D7E O;  2EMS A;  4U67 L;  3PIO L;  3TTC A;  4M7Y A;  4B1Y B;  5M1N A;  1VAZ A;  1NGI A;  4A5B A;  4JKB A;  2OTJ N;  3MMV A;  2FF3 B;  2WBN A;  5FPM A;  5I9E B;  1VQ6 N;  2HMP A;  5E84 A;  4BR9 A;  4NY0 A;  2QEX N;  3EPY A;  3CJC A;  3LDN A;  4HDO A;  4BC2 A;  3AGR A;  5CHI A;  3FLC O;  3HOT A;  4IJA A;  4IJN A;  3I56 N;  1GLC G;  4IEI A;  3U8X A;  4GV6 A;  3R1X A;  3HBT A;  1YI2 N;  1E4G T;  3R3L A;  5FPN A;  5GIP A;  3VTI A;  3CPE A;  1Q18 A;  3H46 O;  3HTV A;  4WQ4 A;  5JVH L;  2A40 A;  4GNI A;  4IO9 L;  2Q36 A;  3WA0 A;  1BOT O;  2YX6 A;  3BP8 A;  3HOS A;  2Q31 A;  1GLE G;  3SAG A;  3ZDT A;  1M90 O;  3SBG A;  3N4Q A;  3A5O C;  4BC3 A;  3IMX A;  1HJO A;  4IZ9 A;  3G4S N;  2NRZ A;  1K8K A;  2E2P A;  2R82 A;  5MLC Q;  3CI5 A;  1U2V A;  3O08 A;  3CET A;  5AQS A;  2AEH A;  4OPA A;  2Q97 A;  1NGC A;  1Z6R A;  4BRO A;  2QWR A;  3H45 C;  3EL2 A;  3FP5 A;  2J0J A;  3H3N O;  4Y0W A;  5BR9 A;  1KC7 A;  1MWM A;  5AZJ A;  3MX5 A;  4JKE A;  1MA9 B;  4YOU A;  5EY4 A;  4JK9 A;  2E2O A;  3CHW A;  4DXA B;  4KH6 A;  3GE1 A;  2P9P B;  3KZB A;  5AQJ A;  5EVZ A;  3ZET B;  5GIN A;  3MN5 A;  3O9T A;  2QWQ A;  1OVY A;  1WOQ A;  3W0L A;  4BR5 A;  4JKG B;  3D2E A;  3O9R A;  4O8K A;  2P9N B;  3P31 A;  3I55 N;  2IVN A;  1RDU A;  3BIN A;  2HBL A;  4FWK A;  2DIK A;  3CCQ N;  3ATV A;  3HI0 A;  5AQF A;  4CZK A;  1TUY A;  4IO8 A;  4BR2 A;  2F9W A;  4C1N I;  1VQP N;  3IVF A;  3CJA A;  2VYP A;  5CR4 A;  1VQ5 N;  4YOX A;  3CJ1 A;  1JDE A;  3O9Q A;  3VGL A;  5AQG A;  1BA1 A;  3O8M A;  1HPM A;  1YAG A;  3OBW A;  1YVN A;  4BRI A;  2VWB A;  4C1N K;  3UKU B;  3FZL A;  4BRD A;  3VF4 A;  1HX1 A;  1NGB A;  3P38 A;  1BA0 A;  3EKS A;  3MN7 A;  4CBX A;  3CXC M;  4FWO A;  3FE1 A;  1S22 A;  3L0Q A;  1OKJ A;  3TTD A;  3OW2 M;  2QW9 A;  3C6H A;  2HBM A;  3LDL A;  1S3X A;  4WQ5 C;  3E66 A;  4BVP A;  2ZPY A;  4BGA A;  4CZJ A;  4GV3 A;  3LM9 A;  4BRK A;  5C0Y A;  4JHD B;  3AU5 A;  4QS7 A;  2J4R A;  3U7D A;  2E8A A;  4GV9 A;  1GLD G;  2E2N A;  5BPM A;  3HRG A;  4BRM A;  2F7T A;  3CPW M;  1SZ2 A;  3CD6 N;  1XC3 A;  2D11 A;  4AM6 A;  5AQK A;  5BN9 A;  1V4S A;  4MO5 A;  4CJ7 A;  1ISN A;  4PL7 A;  3QFP A;  3T69 A;  3FLV A;  1HLU A;  2VCP A;  3Q7C A;  1HB6 A;  1NGJ A;  3TPQ A;  3D2F A;  2RQ1 A;  3VTH A;  4WFA L;  3F2K A;  4YDU A;  5JVG L;  1EO1 A;  2I1J A;  5TKY A;  4FPB A;  2A5X A;  2NLX A;  4YOR A;  2QWL A;  3TSP A;  1NVL A;  3O1B A;  5M1F A;  3IFR A;  3EN9 A;  2GTD A;  2UYT A;  3WQU A;  2AA4 A;  4HTL A;  2CB8 A;  5AZI A;  3AGK A;  2YHY A;  1MK7 B;  4DQ8 A;  5F0X A;  3FFK B;  1NGH A;  4FWP A;  4I6M B;  2KKZ A;  3CCU N;  1YF5 L;  4NO7 A;  2I1K A;  3WEE B;  1YXQ A;  3FZM A;  1P8Z A;  4IOX A;  4JAX A;  1M1K O;  5C2F A;  2BTF A;  3DXK B;  1HKC A;  3QIC A;  4RCH A;  4XH1 A;  4EHT A;  3X23 A;  4CBW A;  4FWS A;  4M7X A;  1NGF A;  3M1F A;  2NRX A;  3SLC A;  4BG9 A;  5CE3 A;  3CCS N;  3CCE N;  3TU5 A;  3KWI A;  1BG3 A;  1Y19 B;  1MWK A;  2D10 A;  1CZA N;  3TTF A;  2VGM A;  3C7N B;  3C6A A;  4HDQ A;  4K42 A;  4WF9 L;  4AM7 A;  1DIK A;  3E9O A;  1NI2 A;  5GAE P;  3J8A A;  1NMD A;  2D1K A;  3VEW A;  4EFH A;  1TUU A;  1Q86 O;  1U6Z A;  4EIA A;  3ZX2 A;  4RTF D;  2D2Q A;  1KQS M;  1P90 A;  4AF1 A;  5GAD P;  2I7P A;  1MDU B;  4MDB A;  2P9I A;  4RWT A;  4JEP A;  2AL6 A;  4A2A A;  1RDW X;  3AAR A;  5AQO A;  1SQK A;  5GIO A;  3AAQ A;  1E4F T;  1VBH A;  3MN9 A;  3WUH A;  2ASM A;  3H3O B;  4CBU A;  3UKR A;  3L6Q A;  3UE5 A;  1R59 O;  3RSE B;  3IKM A;  1ATN A;  2A41 A;  1RGI A;  3NMU A;  1X3M A;  4H0Y B;  2QWP A;  3MX2 A;  3T7Z A;  1H1V A;  2J0M A;  3MDQ A;  3WXJ A;  3NVK A;  3DWL A;  5BRH A;  3CIP A;  4DHY A;  4A57 A;  4FVU A;  2V7Y A;  2GWJ A;  1YHQ N;  3ENB A;  1BO5 O;  2Q0R A;  5KQ8 A;  4TKN A;  2FLO A;  4BRH A;  5EOY A;  5AR0 A;  4BG8 A;  1ATR A;  2P9L B;  2HF3 A;  4NB4 A;  2Q2R A;  4DB3 A;  4YOV A;  2FSJ A;  2W41 A;  1U2V B;  1W97 L;  3ID6 A;  5AQV A;  1SAZ A;  3GDQ A;  5BN8 A;  4YOW A;  3O9S A;  1GC7 A;  3W3D A;  3C0B A;  1KBL A;  3NVM A;  4H5W A;  4B1Z A;  5JLF A;  3CME N;  2IVP A;  2PFU A;  3VF2 A;  4BC5 A;  1QHA A;  3LDQ A;  1GLL O;  1LCU A;  2V51 B;  1SS6 A;  3O9U A;  2P9S B;  2X0S A;  2PAV A;  3VPZ A;  3CC2 N;  4JK8 A;  4BVO A;  5ADX A;  5C12 A;  1NLV A;  2ZGZ A;  4PKG A;  4JKD A;  3QDK A;  4CZG A;  5BRD A;  4IEE A;  1J19 A;  5KPT A;  1T44 A;  4JKA A;  3R6M A;  1GLA G;  2EWS A;  1YUW A;  2HBK A;  4B9Q A;  4OPH A;  1QZ6 A;  4CZM A;  4ZRI A;  1HB8 A;  1KAZ A;  3M3Z A;  4NLB A;  4B1V A;  2P9P A;  3CCR N;  1G99 A;  4JD2 B;  4EAH D;  4PHT X;  2QTD A;  3ZET A;  3VEY A;  3L4I A;  4NLC A;  3KWG A;  4BRA A;  1ZXO A;  2GX9 A;  4JKG A;  3LDP A;  2ZF5 O;  1Q81 O;  1Y64 A;  2GEL A;  4FOE A;  3H1Q A;  3TSU A;  2ZJP L;  2P9N A;  2FSN A;  1KXP A;  1LOT B;  4MLE A;  3CCJ N;  4FWQ A;  5AFU H;  4BGB A;  1NM1 A;  4CYE A;  1QQM A;  2EMT A;  2D0O A;  1GG3 A;  1GLF O;  4JKF A;  5GAG P;  4H0T B;  3R8E A;  3ZX0 A;  1ZC6 A;  3H6E A;  1QQO A;  2YVC A;  3F9M A;  4A5A A;  4BQL A;  4ILJ A;  4BRG A;  3FR0 A;  3WXL A;  4J8F A;  5TKW A;  4P7I A;  1ATS A;  1NJI O;  3JS6 A;  2JWL A;  2OTL N;  4ISG A;  2GEM A;  4YDU C;  3UKU A;  3A5N C;  5M1O A;  5BPN A;  4FSV A;  5EX5 A;  1DT9 A;  4PKH A;  4FOI A;  3SJH A;  1YIT N;  2CQU A;  1MK9 B;  4XEI A;  3U4L A;  3G71 N;  2D0P A;  4MO4 A;  4H0X B;  1O13 A;  3VEZ A;  2W40 A;  3EE8 A;  3VES A;  1ESV A;  2A42 A;  1W2B M;  3E9P A;  4JHD A;  4H5N A;  2NRW A;  4A59 A;  4O5F A;  2WC9 A;  3VF6 A;  5LY3 A;  3CQY A;  1JJ2 M;  3D6R A;  2NRH A;  1X9J A;  4BR4 A;  2GUP A;  2FSK A;  3IUC A;  5AQT A;  3VEO A;  1TYQ B;  1JCF A;  1GC6 A;  2P9U B;  2WFB A;  3E1Y A;  3BF3 A;  1YIJ N;  1VQ7 N;  1X3N A;  4BRN A;  1VQ9 N;  3SAH A;  3ID8 A;  2H3G X;  2QWO A;  4K41 A;  5F1X A;  2ITM A;  5HOO A;  1J6Z A;  1D4X A;  2YI1 A;  4MLH A;  3SMS A;  1NGD A;  3OHR A;  3GG4 A;  4BRL A;  4FWM A;  3SK3 A;  4FO0 A;  1JCG A;  3SAF A;  2VGN A;  3GOI A;  4YOY A;  3CCV N;  1ILY A;  2BUP A;  2P9K B;  1QZ5 A;  3CJ7 A;  3ZEU B;  1ST7 A;  2BH1 A;  5AQH A;  3BEX A;  1DEJ A;  1GLB G;  1QQN A;  3DXM B;  2E1Y A;  1HKG A;  3O80 A;  4CZH A;  5C10 A;  4UY8 O;  4H5V A;  4KH4 A;  1MIZ B;  2I7N A;  3DJC A;  4CZE A;  1SGH A;  3AY9 A;  5M1K A;  2KLA A;  4WFB L;  5BRE A;  1C0G A;  1T3V A;  1S72 N;  3EE9 A;  3A0I X;  4I6M A;  3CJB A;  3PIP L;  1T6C A;  2HRJ A;  4LC9 B;  3HM8 A;  3WEE A;  1BWF O;  5AQZ A;  5AQQ A;  3I8B A;  5KPZ A;  1HKB A;  1WUA A;  4JKC A;  3DXK A;  3H1V X;  1KAX A;  2ZGY A;  3J7Z O;  3SBT A;  1Z05 A;  2ASP A;  3S41 A;  2F9T A;  2IIR A;  2NRV A;  1YJW N;  3VEX A;  2YJE A;  3ATU A;  4R79 A;  2JWK A;  4WQ4 C;  5AQW A;  3ULE A;  2IVO A;  3AAP A;  5M1P A;  1BUP A;  5C15 A;  3O6W A;  2WH5 A;  2NRT A;  2HOE A;  4PL8 A;  4XH5 A;  5E26 A;  1K73 O;  3BF1 A;  4YL8 A;  2CGK A;  4JKH A;  1IG8 A;  3FGU A;  4EKU A;  3CCL N;  4G9Z A;  4JN4 A;  3AU4 A;  4H5T A;  2QWN A;  4H0O A;  1QVG M;  4BRF A;  1VQ8 N;  3F5T A;  4A62 A;  4CZF A;  1MIX A;  4GVE A;  4A61 A;  4H03 B;  4WYB A;  5LJW A;  3ENH A;  2QM1 A;  4KBO A;  3UKR B;  4U7B A;  5JLH A;  2A3Z A;  3L4Q A;  1KC8 O;  4MDA A;  3ZYY X;  2YHX A;  1IJJ A;  4DKW A;  3KK7 A;  4XH4 A;  2PBD A;  4ISF A;  3FZF A;  2KHO A;  4IWV A;  3FZH A;  3O5B A;  5KQD A;  3MWP A;  3RSE A;  3U8Z A;  4H5R A;  4ZRJ A;  2ZJQ L;  2ABD A;  3EKU A;  4K25 A;  4GY2 B;  5EXW A;  1K8K B;  2WUS A;  1BU6 O;  5AQM A;  4OO1 J;  3MN6 A;  5C2D A;  2Q0U A;  2YJF A;  3ZX3 A;  2NRR A;  2QI2 A;  4CD1 A;  5FPE A;  4QS8 A;  3Q7B A;  3CF5 L;  1T6D A;  3GBT A;  2GWK A;  4BC4 A;  1KAY A;  3PZD A;  5AZJ B;  4BRC A;  1EQY A;  1RFQ A;  3HZ6 A;  4E1J A;  3O1W A;  4M63 C;  5AQX A;  2E88 A;  2P9L A;  2QXL A;  4JK7 A;  4F7G A;  5DM7 L;  4BR0 A;  3SMP A;  2FXU A;  3D2E B;  4B1X B;  1XUP O;  4JNE A;  3B8A X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...