4JKFA

Open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
220
Chain Sequence
b'ELFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkfA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkfA01
3E9PA 4JK7A 4JK8A 4JKEA 4JKGA 3E9LA 4ILGB 4ILJA 4JKDA 4JKHA 4ILHA 4JKBA 3E66A 4JKAA 4JKGB 4JK9A 4JKCA 3ENBA 3E9OA 3SBGA 3SBTA 4JKFA
chains in the Genus database with same CATH superfamily
2I1JA 3V1RA 4DSJA 4IBNA 1RT7A 2NNWA 3EYZA 4JI8K 4CESA 2DTUA 4BRNA 4ILGB 3CJ7A 3TPQA 3CPWM 4GV9A 4CJWA 1G99A 2B4JA 4FVMA 1K6YA 3C65A 3C6HA 4ZTFA 2RKIA 4LC9B 3K5OA 2HHVA 5AQRA 3CQXA 2KFZA 4I2QA 3BDPA 4Z4EA 3CETA 2HHXA 3H3NO 4CZGA 5BRDA 3DRSA 3NF6A 1VSMA 4WQ4A 1D8YA 5CR4A 2NRXA 3IDHA 4DV3K 3ITHA 2OA8A 5C24A 4ZRKA 1RBSA 2F96A 4JD2B 5KRTA 1EP4A 2P9IA 4ELTA 1DGKN 2FBYA 4CK2A 2HBLA 1ATNA 3EKSA 5AQXA 3TI0A 2BH1A 3OA9A 3QFUA 4RW6A 4BVOA 3TU5A 4CJPA 2R82A 5TKWA 2D2QA 3D2FB 3H46O 4I2PA 4CFDA 5AQTA 4BDZA 4FWQA 2H3GX 3TSUA 1S1UA 1NJZA 1BGXT 1C1AA 4CI6A 2BANA 3NMUA 3AAQA 1LCUA 3VMFB 3I0SA 4FZZA 1GLAG 5E41A 1ATRA 3VESA 2ZPYA 3DXMB 1OH5A 2QEXN 3VERA 4KHUA 4OGCA 3P83D 1EXQA 4CZKA 1KRPA 2F7TA 4BQLA 5AZJB 4FJXA 1S5JA 3E01A 1HPMA 1YTAA 1N5YA 1V4SA 1VAZA 2HSTA 2UYTA 3LM2A 3O1BA 4KAZA 4C23A 3DYAA 4YY3K 3DLRA 5HBMA 3SAHA 2ZD1A 1TAUA 1T6DA 3CC4N 4OKEA 1LWCA 3MXIA 4BR9A 3WXJA 1VQ4N 3K58A 4NCAA 3SLCA 1Z05A 2RPIA 2IAJA 2A1SA 3A5OC 4JRPA 4Z4HA 3FGUA 1WNSA 3SMPA 3TAPA 4DXAB 1W9HA 3OYFA 1TL3A 2AA4A 3W0LA 4PKHA 4CE9A 2KTQA 3LAMA 3THXB 1QHTA 5AQGA 4A59A 3B6OA 4LD0A 4IO9L 4CGJA 3EY1A 3SNNA 4DUYK 2VWJA 1NK0A 3L6QA 2VGNA 2HHSA 1XWLA 3KK7A 3M6GA 4CF2A 3GDQA 2D4WA 3L2UA 2O8CB 2WONA 4H5WA 2UUAK 1XMOK 1L3TA 3HI0A 3OJUA 4DR3K 5AQQA 4J2AA 2UU9K 1C0GA 3PSIA 3SUQA 3K2PA 4W5RA 4KB1A 4FJLA 4WYBA 1HNVA 1WUAA 3CCSN 3V9WA 3KTQA 1YF5L 2W42A 3E9PA 2YCHA 2GBZA 3VENA 1NKBA 4DU4A 3MN5A 3SUPA 3LL3A 4PKIA 2WH5A 1JLEA 1R59O 4IOCL 3UIQA 4LY7A 1WN7A 3P31A 3LAKA 4IOAL 3O5BA 4OLAA 3EKUA 1QS4A 3SBGA 3G0ZA 5FDLA 5KRSA 1VSLA 3ATVA 5AQKA 3HBTA 5AJ3K 4MLEA 3U3GA 3F9KA 1HBKA 2ITMA 4IFYA 3K0SA 4BRLA 4NYFA 2QKKA 2XY5A 4P7IA 1GOAA 2F8SA 4CHZA 4H0TB 2O8BA 1KVCA 3VQDA 3LM9A 3MEEA 2KFNA 4RW8A 1OVYA 1J9AA 1BCOA 2ASMA 1Q8IA 4I9QA 1TKTA 1QVGM 2QWLA 2DIKA 4BDPA 2HHTA 4FPBA 3ZSWA 1SQKA 1VSIA 4JKHA 2FBTA 3HJFA 1VQPN 1NGHA 1BU6O 4A5BA 3J8AA 1QZ6A 3S3NA 1YJ9N 3LWMA 2IVPA 4JKGB 3PUFA 4DTRA 3D2EA 4JI5K 3OVNA 5CY4A 1WSJA 3Q7CA 1RNHA 2FF3B 2P1JA 2Q0UA 4M3UA 1IG8A 2G8VA 4IDHA 4DFPA 3ZEUA 3QICA 1N36K 3G10A 4H8KA 3LP0A 4B3OA 5FROA 3AVCA 1RT1A 3KK1A 1GLFO 3AO1A 4FWNA 4B08A 3S41A 1O1WA 3C6UA 5EXWA 3CPEA 4NO7A 3QINA 2FBXA 3BZKA 1JLFA 4H0OA 3UKUB 1S6QA 3L3VA 4LF8K 1HUXA 1RBRA 1UA1A 3AVBA 3SMSA 4BC4A 4B3RK 3E1YA 1HKCA 4QS7A 3WEEB 3U4LA 3OS2A 1VSJA 2PAVA 3VN5A 2B5JA 3B6PA 1MWMA 2O8EA 3EN9A 3NF9A 2E2QA 4KH5A 1S1WA 3VEOA 4L8RB 3A5NC 1NVLA 3L3UA 4OO1J 4FW1A 2A5XA 1W0HA 2E20A 4JK7A 4Z94A 1HQEA 4QAGA 4JS5A 2VQFK 3BGRA 3QB0A 3OTOK 1KC7A 3SUNA 3RMDA 1JCEA 1VSKA 4E1NA 3AVNA 4U67L 4OKKA 3A5MC 4FWMA 2O8FB 3CQYA 2G8KA 3FE1A 4W5TA 1LW0A 4IFVA 1VSFA 3TTDA 1MIXA 4CEQA 5AZIB 4FL9A 4PHTX 4IO8A 4Q5VA 3AVLA 4A2BA 2UXCK 2HNDA 1VSEA 2Q1NA 2LBBA 4FOIA 4RCHA 3CC2N 4MO5A 3MEGA 1MIZB 1YAGA 3PX6A 2YHAA 2YHBA 2YHYA 1U2VB 3DRRA 5T7BA 4KHYA 4JK9A 4HWIA 2G8FA 2LSNA 4B1XB 3VPZA 3P4IA 2G8HA 4DTMA 1QSYA 4ID5A 2JGUA 3I8BA 5C0YA 5C2FA 1HNWK 3FZMA 1QQMA 2E1ZA 1N6QA 4RW9A 5M1NA 1G15A 2CGKA 2GWJA 1C0TA 1FKPA 5CE3A 4BC2A 1NLVA 4CEOA 3ZDTA 1VQKN 4DR5K 5JVGL 3O3HA 1BIZA 2E2PA 1VQNN 5AQYA 3TTFA 2GV9A 3QBWA 3PIPL 3E9OA 2QA4N 4FJ7A 2CGJA 3CFOA 4YFUA 4YOVA 4JI6K 1F21A 1RT6A 2F8TA 3SAGA 1TK8A 2FSKA 3OBWA 1DIKA 3DMJA 1XHXA 1T3VA 1RTDA 3M5RA 2CH6A 3HPOA 2WC9A 3CM5A 4B3MK 2EMTA 3WXIA 3DXKA 1J53A 1RTIA 3N4PA 3MEDA 1HMVA 2JWLA 1GOBA 3FZKA 1HQUA 1FJGK 3ISNC 2XRIA 3LP1A 4I9LA 4DFMA 2E6LA 3RMCA 3OYBA 1RDAA 1NGCA 4KI6A 1KD1O 4KH4A 1CZAN 3VGMA 3AV9A 4N5SA 1C6VA 3DLGA 2G8WA 4MO4A 2D0CA 1MA9B 1JDEA 4W5NA 1VSDA 2CGLA 2IDOA 3DLBA 1BIUA 1IBMK 4AF1A 2D10A 1TK5A 4ID1A 3M8QA 4FWRA 5JICA 1JLBA 3LP3A 4NCGA 3JXUA 3HO1A 1NMDA 1K8KA 3IKMA 2ZGZA 1I39A 5ELZA 2A42A 3OYDA 1ZBSA 3WXLA 4CBUA 4GXBA 3I55N 1JLCA 2V52B 2ZJQL 5SZTA 5FPMA 5JS1A 3RSEB 2UUCK 2D0BA 1HNXK 4CEEA 4IDKA 1MDUB 5JVHL 1QHAA 1NJIO 1FKOA 2YKMA 5AQNA 4CZLA 3HYFA 3J7AP 5BN8A 1YHQN 1YITN 4KHPK 4DCHA 4DSLA 4H0VB 2O4GA 3ZX3A 1QSSA 1BG3A 1VK0A 1WSEA 3THWA 4CBWA 1LAVA 3VGLA 1ASWA 1TV6A 4DV4K 4KV8A 4CJTA 2RE2A 2ASOA 3V9UA 4DQRA 3DAWA 3HSCA 1RDCA 3NE6A 1OVQA 4LF9K 2KLAA 4PQUA 2J0MA 1JLGA 4AHSA 1BUPA 2GWKA 3TARA 3ZSYA 4DR2K 1YVUA 3V9SA 1TUUA 5CZ1A 1VBGA 3KJVA 1KC8O 3RWUA 1B9FA 1HPZA 4CEFA 2J0JA 4J8FA 4CFAA 4OVLA 5AFUA 5BPLA 4CHNA 3QNOA 3QMLA 1VQ5N 3NF8A 4H5NA 1BWFO 1WBBA 3PO5A 1DEJA 5AQSA 4JKEA 4CJQA 4YHHK 3NH1A 3DLHA 1B9DA 3T3FA 3SJHA 2HHUA 4GW6A 4BRFA 4CZIA 3VEXA 4FLZA 3WT0A 3L0QA 5DM6L 4EAHD 2BE2A 2BTFA 2Q3SA 3TTCA 1Y97A 5SWMA 4DV7K 3AU5A 4BR0A 1WAJA 2V7ZA 1RDDA 1U47A 3G71N 2CB8A 1U48A 4H0XB 3OYKA 3EPYA 3TAQA 3EO3A 4BRQA 4H4MA 4YOWA 3T1HK 1GG3A 3IVFA 4LF5K 2YJFA 2FF6A 4M7XA 2P9LA 3KLIA 4HDQA 1VRTA 4F4KA 1Z26A 3WNHA 3P39A 2ZF5O 4E3SA 4YORA 4Z4IA 1RDUA 4DV5K 1XI1A 2KZMA 4NCBA 4FWSA 1RT2A 2P9UB 3VQAA 2GEMA 4C1NK 4DLEA 5LMUK 3LPTA 3BZCA 3CG7A 3C94A 3LDNA 4PUOA 4FLTA 4FWOA 3IRXA 4FJNA 2Z1JA 3O9RA 4Q0BA 2VG6A 1GLJO 4BR4A 1C0FA 4DHYA 3AA5X 4E7JA 1IBLK 1S9EA 5IWAK 4YL8A 1KBLA 2W6KA 3T69A 1W7AA 4PA1A 2E5LK 4DV6K 3CIPA 3PV8A 3GE1A 4DV0K 4HCBA 3WUHA 2BDPA 1NGGA 1SAZA 1NK7A 4F2RA 4CERA 4B9NA 4CGIA 1BCMA 1NM1A 3H08A 3V1QA 4DG1A 4C8KA 3F9MA 2KQ2A 3HVTA 4H5VA 3JYTA 3VQBA 4WQ5A 1BQMA 3R9PA 3VEZA 4LFCK 3O9TA 1X3NA 3O4QA 1HNZK 4KHSA 1Q18A 3PZDA 4XEIA 1NGBA 4FWLA 4FZYA 2YX6A 2X78A 1J5OA 2AL6A 3RMAA 4O8UA 1E4FT 3THVA 5F1XA 2D5RA 4OGEA 4HTUA 2P9SB 2KZZA 2XO7A 2X6SA 1J6ZA 5KGWA 4B8CA 3BY5A 4Y0WA 3UB5A 3IAYA 4Y1DA 2OCEA 4KFBA 1JXEA 3DM2A 4O5BA 5GADP 4FK0A 3OBYA 3ULDA 1KFDA 2DFFA 4B9UA 3QEVA 1RT3A 1W97L 4JYAK 3AO3A 3CM6A 4WFNL 4FZXC 5AQPA 1HX1A 1N33K 1QZ5A 3CERA 4ZTJA 3CFPA 3WNEA 3SQ2A 1SKWA 4Z0UA 1BHLA 1JJ2M 1JL1A 1KVBA 4E89A 4MDAA 4ZHRA 4JEPA 3CCJN 2OTJN 1ZYQA 3OS1A 1WAFA 4FM2A 2ASPA 2FXUA 3EE9A 4GVEA 3M8RA 3G4SN 3CCRN 3I33A 2OYQA 3KWGA 4B3TK 4BRGA 3D7EO 4DTJA 3TAFA 3BF3A 5KTQA 1WSIA 4X66K 4M7YA 2IVNA 1Q9XA 2HF3A 1IBKK 1TYQB 3L2WA 3D0PA 1YJNN 3AVKA 4M3XA 3GBTA 3ZSOA 4DSKA 3VA0A 2Q36A 1E4GT 4WCEL 2QWQA 2ZE2A 3DLEA 2DY4A 4JKBA 1ZC6A 3PO4A 2Q97A 3HOTA 1DTQA 3T7ZA 1BQNA 4DWIA 1NK4A 4JI4K 4B9QA 4K43A 4WF9L 2HHWA 4BR7A 4BRCA 1IKXA 4JD2A 2VYPA 5D3GA 3NH0A 4J2DA 2P9NB 2O8BB 4YOXA 4CJLA 3A5LC 3THYB 4CECA 1DKGD 4ILJA 2QK9A 2QTDA 2VWBA 4O8KA 3O3GA 3IUCA 3ZT3A 4DQPA 2ETJA 3KLFA 4DSIA 1D9FA 4KH6A 2A1RA 2P9PB 4OKJA 1NTIA 4NYNA 4JI3K 3MN7A 1S1VA 4NY0A 5HL7L 4K8ZA 2HBKA 4RTFD 4DMNA 3NGZA 1U6ZA 1D9DA 5J2QA 3G6EN 3DXMA 3HT3A 3CFRA 4KRFA 3HM8A 4AHVA 3AVMA 4NLBA 1GC7A 2F4VK 5AZJA 5DK5A 4FVUA 5GIPA 1H1VA 4ISGA 4ELVA 1ACAA 3ZEUB 2NRRA 3F5TA 1LOTB 4G1QA 1VQON 5I9EB 1WLJA 4FJ5A 4MLHA 1KAXA 1QSLA 1IV0A 4Z4GA 5JVLA 4M45A 3IS9A 4LF4K 3GG4A 5E84A 1RBTA 3FZLA 2HMIA 1NJXA 4BRPA 5FRMA 3FLVA 3CI5A 4YNQA 3QIPA 3L8BA 3ALYA 4JKCA 2EX3A 1CLQA 1TAQA 2A40A 4FJJA 2D11A 5GIOA 3MN9A 2J4RA 3LANA 3MXJA 3AVAA 5BREA 1TL1A 2RHKA 3QETA 3SQ4A 3BP8A 3AO4A 3QNNA 2A41A 4CYEA 4O0IA 4DSFA 2J0KA 1IKYA 1C0MA 1YT3A 1ISNA 1Q86O 3H1VX 3ZETB 4NXNK 5B8HA 1SL2A 3K57A 3V9ZA 3GOIA 4CJUA 4JN4A 3C0BA 2ATQA 5DMRA 1X9WA 3WNGA 4LF6K 4L3QA 3KIOA 3HM9A 3DLKA 4BR2A 2VQEK 4DKWA 3FR0A 1WSFA 2NRWA 4J2BA 4IG3A 3V4IA 4BROA 4N41A 4CF1A 4ILHA 4KTWA 4BG8A 4A61A 5LY3A 2HMPA 3EZ5A 3QESA 2UUBK 1C1CA 4QCLA 2GUIA 4JKAA 1VSHA 3ZT0A 1HRHA 4HDOA 1FXXA 2QM1A 3MX2A 2FSJA 4DQSA 2I1KA 3KK3A 3HPGA 4AHRA 2UXDK 4B1UB 3ZSQA 3TAMA 1X9MA 1JXBA 3ZLJA 5KPZA 3VOVA 2ZJPL 1CZ9A 1U4BA 3SYZA 4E7IA 2NRVA 4KHWA 5GAEP 4E1MA 1HYZA 3OYEA 4OPHA 2FDQA 1Y19B 2PBDA 3Q7BA 3PIOL 1YXQA 3O4WA 4AHTA 3NCIA 2OPPA 4OX9K 3GL1A 2ZQBA 3O8MA 4F9OA 3I56N 1VQLN 1SL0A 3K5MA 5BRFA 2XY8A 3RMBA 4CZEA 4DU3A 2YVCA 4E0DA 5EY4A 1BI4B 3J7ZO 1TGOA 1T6CA 4OPJA 1VQ9N 5BRHA 4E1JA 5AFUH 3T19A 3ZT1A 3MCAB 3AAPA 3ULEB 1EO1A 4AM7A 3CC7N 3VETA 3VF6A 3N4QA 4FLYA 1T7PA 1UA0A 1XMQK 1RILA 3K5LA 4DS4A 5C25A 2PFUA 1NKCA 2B6AA 2YHWA 3O1WA 3VEYA 1DT9A 2Z1IA 3BUZB 2YNHA 5HP1A 1XHZA 4BGBA 1NK9A 1KVAA 5FRNA 2YKNA 4DF4A 3E9LA 4IJAA 3CJBA 4OJRA 1U45A 3QLHA 4I6MB 1ASUA 3WQUA 4KHQA 3VA3A 4H0YB 4JNEA 4O0JA 3UKUA 4M3YA 4CW7B 5EVZA 2E2OA 2HRJA 4K42A 3U7DA 3OYMA 4CHOA 2OANA 4E7KA 4FLWA 1Q82O 4BRAA 3TSPA 3LZJA 3WEEA 5GAHP 3X23A 3ZSRA 4DTSA 2O8DB 4TKNA 3A0IX 4A2AA 3ZSZA 2DFEA 4DUZK 2QWOA 1YJWN 4FW2A 3KWIA 1QTMA 4CZHA 3SV3A 4YOUA 3QFPA 4CIGA 2Y1JA 1WOQA 2I5JA 4FCYA 1W2BM 1B92A 2QWPA 4W5QA 3CCQN 3M8SA 3QEXA 4BWMA 5LL6Z 3TAGA 5HRPA 5BPNA 1BA0A 4CFCA 4FJGA 4B9MA 3HSTB 2O8FA 1UOCA 1GLBG 1KLNA 3PSFA 1RT4A 3PVLA 3H3OB 4IOXA 1WBDA 2P9KB 4CF9A 4EZ6A 4XH1A 3NF7A 4LF7K 3VEWA 4YOYA 3FP5A 3L4QA 3SK3A 3MAQA 4X64K 3CJCA 3TSQA 3P38A 1XUPO 1HNIA 4BC5A 3ZX2A 4CHYA 1VBHA 1U2VA 4KPYA 4A57A 1ST7A 3KKSA 2P51A 3AGKA 4FM0A 4BR5A 5EX5A 3TANA 4PL7A 2NRTA 1VRUA 3U9DA 2UXBK 5AQWA 1HJOA 3DOLA 3V9XA 5HROA 1QQCA 2HVHA 4FXDA 5KGXA 4H5RA 4ZRIA 1A5WA 1H4RA 5AQMA 3LWLA 2Y1IA 5I42A 3SQ1A 1KFSA 1KQSM 2F9TA 1CZBA 2HB5A 1QQOA 3CCLN 4B9SA 4CBXA 4XH5A 3OYAA 1YVNA 1M90O 4CJ4A 5AQFA 3H45C 5C12A 1EWQA 4DLGA 4GV6A 2OPQA 1L5UA 4Y1CA 4BRMA 4DQIA 1VHXA 2E2NA 1MK9B 4H03B 4LSLA 4Z4CA 5HRNA 3MECA 4MFBA 5K14A 5J1EA 2KHOA 3LDQA 1S3XA 4BY9C 1ZBHA 1NBWA 4EZ9A 3DLLL 3KLGA 3SV4A 2FSNA 2Q2RA 4C8MA 1FW6A 4IXCA 3TWHA 4KB0A 4GVMA 5HRSA 4BRDA 1KXPA 4EHTA 3U8XA 3WA0A 1KCFA 2G8IA 4QS9A 1SL1A 4LSNA 3O3FA 4DF8A 4DTXA 4M3TA 3LZIA 1HYVA 3C6AA 4CGFA 3O9SA 1L3VA 4K0KK 5GAGP 4BREA 1S1XA 1SV5A 1Q9YA 1KTQA 2E88A 3NBPA 1VQ6N 4U7BA 4M3RA 3VQCA 2WOMA 4YDUC 4BE2A 1M1KO 3G9WA 3HVRA 1DTTA 4JHDA 3ZT2A 4B1VA 4NLCA 5BPMA 4CF0A 1RTJA 4IEIA 1SUQA 3L2QA 1EETA 5EU7A 4EKUA 1E5WA 1KLMA 1S1TA 5EOYA 4CVNE 5KQDA 3NHGA 1XQSC 2P9IB 4HUGA 4F7GA 4JAXA 3C7NA 3RSEA 4JI0K 3R1XA 3MCPA 3M3ZA 2X6NA 3L4IA 4NXMK 4H0PA 5M1KA 1NGEA 4G9ZA 3K9KA 1ZXOA 1IKVA 2ZM6K 3NFAA 4KHNA 4BRIA 3O4NA 4B9TA 3VQ4A 4WFAL 1BISA 1RTHA 2FJ9A 2E4LA 5GINA 3R3LA 2QXLA 4WQ4C 3IMXA 2OZMA 4RG8A 2D1KA 5J2NA 3QERA 1JCGA 3AVHA 3OYJA 3KHYA 3O6WA 4CJEA 2RF2A 1X9JA 4MDBA 4O5FA 3MMVA 3RTVA 4BVPA 5AQVA 1BOTO 1NG9A 3SZ2A 3AA4A 2YI1A 3O80A 2IIRA 4JKFA 1XC3A 4H5TA 1GC6A 3ZCMA 4CIFA 1L3SA 3CYMA 3EZWA 4HVJA 4XIUA 4GV3A 3FFIA 3KK2A 5LJWA 1EF1A 4RW4A 3HP6A 3J80O 1EX4A 3KLEA 3MN6A 1HB8A 3T1AA 3UKRA 4JV5K 3K9JA 3G25A 3O08A 2W6LA 2JWKA 1JKHA 3PLAA 2I7PA 1ZBFA 1RGIA 3VF2A 2NUBA 3AA3A 4F3TA 2OPRA 4HUFA 3SUOA 1NJYA 2HBJA 1OH6A 5LJVA 4CHPA 5BN9A 2BUPA 4CFBA 4E7HA 1MU2A 1UAXA 4YOTA 3AU4A 5AQHA 4CD1A 1LV5A 3R8EA 4R5PA 3DOKA 3AY9A 3OYLA 3H1QA 4B9VA 5JS2A 1ASVA 1QVFM 4JK8A 2ZWHA 3QDKA 3WXKA 1NJWA 2P9UA 5ADXA 4LH5A 1RBUA 4IG0A 4CJKA 1E3MA 1XNQK 3JS6A 1JL2A 3KLHA 2IVOA 4DU1A 1RFQA 2RN2A 4BRKA 4FLXA 5HRRA 3LPUA 4EIAA 3SPYA 3MX5A 3IG1A 4FK2A 4O44A 1TKZA 1S72N 1NK5A 3SQ0A 2QWRA 3J7YP 3RVCA 4FWKA 4BG9A 3HXMA 3D6RA 4GNIA 3OYNA 4F3OA 4JI7K 1SZ2A 4CGGA 2OPSA 5HOOA 2F9WA 3NDKA 3OJSA 4AILC 3ATUA 2BGGA 3AO5A 5IT9O 3W3DA 4E19A 1Q81O 3HL8A 4DTNA 1NGIA 3QEPA 3OYCA 3CD6N 1K8AO 2G8UA 1ATSA 1GLLO 3OW2M 4ISFA 4FO0A 1S22A 1VQMN 3NGIA 2E6MA 4UY8O 3RR8A 4RWTA 2ITGA 2VGMA 4NB4A 3MWPA 4CJRA 2P9SA 4O55A 4DR6K 1C0UA 3ZT4A 1YIJN 3AVIA 4AHCA 4CF8A 1I3AA 3MWTA 5F2RA 4K41A 3WNFA 4FJ8A 3D2FA 3C6TA 3ZX0A 4BE1A 3QIJA 3ASMA 1SS6A 1IO2A 1CXQA 2KW4A 3CJAA 4QS8A 3P5JA 3NAEA 4JI2K 3RR7A 3IFRA 3CCMN 3VTHA 4KTQA 4CJ3A 2PZSA 1OH7A 5AR0A 1OH8A 2AJQA 4JI1K 3D2EB 5CZ2A 3NVMA 5M1PA 4CJFA 3VQQA 4ZRJA 4F2SA 3TR8A 3NGYA 1RDWX 4DQQA 3A8YA 4OPAA 1NMNA 2VWKA 2QWNA 3KZBA 5DM7L 3U6FA 2IOCA 5M1QA 3HP9A 4N56A 1KAZA 1TYQA 1MK7B 3V6DA 1NGDA 3CJ9A 1GLCG 1GLDG 1WSHA 3MXMA 4DS5A 3H6EA 4MQ3A 5FPNA 3PX4A 4CJ7A 4CHQA 3THXA 1T44A 4M41A 3HPHA 1TUYA 1Y64A 5C42A 3SJJA 3TAEA 4JRQA 2O8EB 4CCHA 2IS3A 2AEHA 1ZBLA 1XNRK 3M1FA 3PX0A 3HTVA 1S6PA 2IC3A 4W5OA 3U9ZA 2P9NA 1N8RO 2RQ1A 1N32K 3THYA 3OYIA 4C1NI 2ZGYA 3BEXA 3OS0A 4DFKA 2O8CA 5KI6A 4M42A 4WFBL 1YUWA 4FSVA 1BO5O 4KBOA 3EL2A 2HW3A 3R6MA 4HTLA 4IWVA 4HHTA 2P9PA 3OYGA 1T8EA 3S3OA 4FYDA 4B8AB 3F2KA 3MK6A 3SI6A 2E1YA 2ABDA 4FOEA 4DV2K 4KO0A 2XHBA 4B9LA 1REVA 3WQTA 2WFBA 1TK0A 2D0OA 2QI2A 2NRZA 3L2VA 2CH5A 3DJCA 3VTIA 5KPRA 3FZFA 4GKKK 4AQYK 3C95A 5CHIA 1S9GA 3CCUN 3LDOA 3VQ8A 3T1YK 2GELA 3ZYYX 1D4XA 3RRGA 2CQUA 4LFAK 3ID8A 1GOCA 2Z1HA 3CQ8A 1SGHA 3CF5L 3CMAN 1HYSA 1GGOA 1LWFA 5C2DA 2Q31A 5JMVA 4EP5A 3U8ZA 2PYLA 1Q7YO 4FJ9A 3J81O 3HRGA 1YTUA 3NH2A 4FK4A 2IGIA 3VQ7A 2HOEA 5AQOA 5CYMA 4OLBA 3AVGA 4BQZA 1NOZA 3CCVN 5H1SQ 4AH9A 3EEQA 1SKRA 5I3UA 3JSMA 4ELUA 5KPTA 5M1FA 4JLHA 3ENBA 4GMJB 4PL8A 3S3MA 3SBTA 3V81A 4EFHA 3PY8A 3ZETA 3B8AX 1Z25A 2GTDA 4LFBK 1ITGA 2Q0RA 4JKGA 4LH4A 2A3ZA 4M3ZA 3DXKB 2PY5A 4F8RA 4BC3A 1UWBA 4DV1K 1ESVA 2EWSA 1J19A 4N47A 3VEVA 3OY9A 3LALA 1HKBA 3ID6A 4FLUA 2COPA 2I7NA 3AGRA 4PKGA 4AHUA 2R7YA 1EKEA 3S9HA 1HR0K 1IH7A 3VQ5A 2P5GA 2HVIA 4C8NA 2VG5A 4JS4A 3O9UA 1WSGA 3LDLA 1P8ZA 3ENHA 3U3YA 4DB3A 4BE0A 2D0AA 1MWKA 2YNGA 4CJ5A 4IJNA 1X1PA 3CMEN 3VQEA 1HJRA 4JKDA 4DTPA 1L3UA 1LW2A 3HOSA 4DTUA 5FPDA 2DPNA 3VF4A 4B1ZA 1RBVA 4B3SK 4CZMA 3DI6A 1JLAA 2W40A 2WTUA 3M8PA 1K8KB 4CD3A 1BDGA 4FLVA 3HZ6A 3QIOA 2YHXA 3LP2A 1EWRA 3K5NA 1RCHA 2HHHK 3VQPA 5CYQA 2FBVA 4DFJA 3CCEN 4EHUA 1BL3A 1NU0A 1U04A 2HNYA 1NOYA 4UQGA 3LDSA 3ENOA 3D45A 4OPKA 1ILYA 4CZFA 4DTOA 2QKBA 1BI4A 4CJVA 3F73A 1KAYA 4O4GA 4IEEA 1X9SA 4FJHA 3CJ1A 3O9QA 1I94K 3OHRA 1HB6A 2A6AA 1D5AA 4KKOA 2X74A 3ULEA 4M3WA 3AARA 5FPEA 3THWB 5AZIA 1X3MA 2P5OA 3K59A 5J2PA 5A2QO 3E66A 3FFKB 5AQUA 2HNZA 2XY6A 1O13A 3ZSVA 1ZBIA 4IKFA 4B1WB 1IJJA 4HUEA 1T03A 5J2MA 2YV0X 1J5EK 4DR7K 2W41A 4K25A 1ZBUA 1GLEG 5AQZA 2OTLN 4IFEA 2NLXA 1FK9A 3LDPA 5BR8K 1N34K 1QQNA 4K8XA 3TABA 3KKRA 2D0PA 2EMSA 1DLOA 4IZ9A 1RT5A 3OYHA 2VCPA 4I6MA 1U49A 1C1BA 1LAWA 2YJEA 2FLOA 4PY5A 4CIEA 5AQLA 3WXMB 4CEDA 1R0AA 1EQYA 4BDYA 5E26A 4PWDA 5ADXH 4FJIA 1IKWA 2E8AA 5F0XA 4J2EA 4KI4A 4JHDB 2O8DA 4BWJA 5M1OA 1VQ8N 4CZJA 4CGDA 4EP4A 1HLUA 1SKSA 3CHWA 3VQ9A 2HF4A 1KSPA 3CXCM 2DFHA 5HLFA 2P9LB 2QW9A 1NNEA 3KD1E 4B1YB 4R79A 4CGHA 1JLQA 2NRHA 3C7NB 4FM1A 5TKYA 2YNFA 1A5VA 4ISEA 1NGJA 4RW7A 3EE8A 3P1GA 4CEBA 5C10A 1CXUA 3FLCO 2OZSA 4BACA 2WBNA 4DR1K 1K73O 5BR9A 1NWKA 3ZSXA 2XY7A 2HHQA 5FLXO 4N76A 2V7YA 3BINA 4FJKA 2Z1GA 5KQ8A 2ZJRL 1VQ7N 3I8DA 4KTZA 4C8OA 2P9KA 3AVFA 2O4IA 5JLFA 3QEIA 4E7LA 4FJMA 4HCCA 3NVKA 4A62A 3UE5A 2YNIA 4ICLA 4V19S 2QXFA 3HK2A 3SAFA 2NZTA 4Z4FA 4WE1A 4GY2B 5LMNK 3AA2A 2AP1A 2EHGA 3AVJA 1LWEA 3I0RA 3JAMO 4CEZA 4I7FA 2HE7A 2V51B 3MDQA 3V1OA 1Z6RA 2X0SA 4A5AA 1K9MO 1NKEA 1A5XA 1HKGA 4DQ8A 4CJSA 1TKXA 4H4OA 5AQIA 4CK3A 3DWLA 4CEAA 4GKJK 5AQJA 4DSEA 3VGKA 2WUSA 4KREA 1NI2A 2KKZA 3A2FA 2VG7A 4DR4K 3KVGA 3SCXA 3VQ6A 1V4TA 3UKRB 2QWMA 1JCFA 4X65K 2JLEA 5JLHA 3L2RA 4M63C 1XC9A 1TKDA 3QBXA 3DRPA 3BF1A 3QO9A 4TSXA 1WB9A 4AM6A 3KD5E 4WQ5C 4BRHA 5IJMA 3FZHA 1TVRA 1IG9A 2HBMA 4XH4A 3RRHA 1P90A 1NK8A 3SPZA 1NGAA 4BGAA 1J54A 1QE1A 3QEWA 1NGFA 5C15A 2GUPA 2GX9A 4CK1A 1YI2N 4QOZB 4FPAA 4YDUA 3AO2A 4C8LA 4FWPA 5MLCQ 1OKJA 1T05A 1RDBA 1NK6A 2PYJA 1BA1A 2FC0A 4X62K
chains in the Genus database with same CATH topology
2I1JA 4AF1A 2D10A 3GL1A 2NNWA 3O8MA 3IFRA 4F9OA 3I56N 3CCMN 1VQLN 3VTHA 4BRNA 4ILGB 4FWRA 5BRFA 5JICA 3CJ7A 3TPQA 3CPWM 4CZEA 5AR0A 4GV9A 3JXUA 1NMDA 1K8KA 3D2EB 3IKMA 1G99A 2ZGZA 2YVCA 3NVMA 5M1PA 5EY4A 5ELZA 2A42A 3J7ZO 1VQ9N 1T6CA 3C65A 3C6HA 5BRHA 1ZBSA 4E1JA 3WXLA 4ZRJA 4GXBA 4CBUA 3I55N 5AFUH 2V52B 4LC9B 2ZJQL 3MCAB 5FPMA 1RDWX 3AAPA 3A8YA 4OPAA 3CQXA 5AQRA 3ULEB 3RSEB 2QWNA 3KZBA 5DM7L 1EO1A 4AM7A 3CETA 5M1QA 3VETA 3VF6A 3CC7N 3H3NO 4CZGA 3N4QA 1MDUB 5BRDA 5JVHL 4WQ4A 5CR4A 2NRXA 3IDHA 1QHAA 1NJIO 2PFUA 1KAZA 1TYQA 5AQNA 4CZLA 2YHWA 3O1WA 5BN8A 1YHQN 1MK7B 1YITN 3VEYA 4DCHA 4ZRKA 4JD2B 1NGDA 1DT9A 3CJ9A 1GLCG 4H0VB 3BUZB 1GLDG 2P9IA 1DGKN 3ZX3A 1BG3A 2HBLA 1ATNA 3EKSA 5AQXA 4CBWA 3H6EA 2BH1A 3OA9A 3QFUA 5FPNA 4BGBA 3TU5A 4BVOA 2R82A 5TKWA 2D2QA 3D2FB 3H46O 3VGLA 4CJ7A 5AQTA 3E9LA 1T44A 4IJAA 2RE2A 2ASOA 3CJBA 1TUYA 1Y64A 3DAWA 3HSCA 2H3GX 4FWQA 4I6MB 3TSUA 2AEHA 3WQUA 3M1FA 2KLAA 4CI6A 4H0YB 3AAQA 4JNEA 3UKUA 3HTVA 2J0MA 3NMUA 1LCUA 5EVZA 1BUPA 2GWKA 2P9NA 3U9ZA 3VMFB 1N8RO 2E2OA 2HRJA 4K42A 3U7DA 1GLAG 2RQ1A 2OANA 4C1NI 1ATRA 3VESA 2ZPYA 1TUUA 2ZGYA 3BEXA 4BRAA 3TSPA 1VBGA 3DXMB 3WEEA 5GAHP 3X23A 3VERA 1KC8O 2QEXN 2J0JA 4J8FA 4CZKA 1YUWA 4WFBL 2F7TA 5AFUA 4TKNA 3A0IX 4FSVA 4A2AA 1BO5O 3QMLA 4BQLA 4KBOA 5BPLA 5AZJB 1YJWN 2QWOA 4H5NA 1VQ5N 3KWIA 1BWFO 3EL2A 4CZHA 1DEJA 5AQSA 4JKEA 1HPMA 4YOUA 3R6MA 3QFPA 4HTLA 1V4SA 1VAZA 2HSTA 2P9PA 2UYTA 4IWVA 3LM2A 3SJHA 3F2KA 3O1BA 4BRFA 4CZIA 3MK6A 3VEXA 2E1YA 1WOQA 3WT0A 3L0QA 5DM6L 4C23A 2ABDA 4EAHD 1W2BM 2BTFA 4FOEA 2QWPA 3TTCA 3SAHA 3AU5A 1T6DA 3CCQN 4BR0A 2V7ZA 3CC4N 4BR9A 2CB8A 2WFBA 3WQTA 3G71N 2D0OA 4H0XB 3WXJA 1VQ4N 2QI2A 3EPYA 2NRZA 5BPNA 1BA0A 3EO3A 4BRQA 3SLCA 4YOWA 1Z05A 2CH5A 3DJCA 3VTIA 1GG3A 3IVFA 5KPRA 3FZFA 1GLBG 2YJFA 2FF6A 4M7XA 2P9LA 3A5OC 4HDQA 5CHIA 3PVLA 3H3OB 4IOXA 3CCUN 3FGUA 3P39A 3SMPA 2P9KB 3LDOA 2ZF5O 4XH1A 4DXAB 2GELA 1D4XA 4YORA 3ZYYX 2CQUA 1RDUA 3ID8A 2AA4A 3Q7BA 4PKHA 3VEWA 3W0LA 4YOYA 3FP5A 3PIOL 3L4QA 3SK3A 4FWSA 1SGHA 3CJCA 3TSQA 3CF5L 2P9UB 2GEMA 4C1NK 3P38A 3CMAN 5AQGA 4A59A 1XUPO 4BC5A 4IO9L 1GGOA 3ZX2A 5C2DA 2Q31A 1VBHA 3LDNA 5JMVA 3U8ZA 4FWOA 3L6QA 1U2VA 1Q7YO 2VGNA 3O9RA 1ST7A 4A57A 3HRGA 1GLJO 3AGKA 3KK7A 3M6GA 1C0FA 5EX5A 2HOEA 3GDQA 5AQOA 4BR4A 4BR5A 4DHYA 4PL7A 2D4WA 4BQZA 4YL8A 1KBLA 3T69A 4H5WA 2NRTA 3U9DA 3HI0A 3CCVN 5AQQA 5AQWA 5H1SQ 1HJOA 3CIPA 3GE1A 1C0GA 3WUHA 5KPTA 5M1FA 4WYBA 4H5RA 1NGGA 1SAZA 1WUAA 3CCSN 4ZRIA 3ENBA 4PL8A 1H4RA 3SBTA 5AQMA 4EFHA 3ZETA 3B8AX 1NM1A 1YF5L 3E9PA 2YCHA 2GTDA 3F9MA 1KQSM 3VENA 2F9TA 4H5VA 2Q0RA 4JKGA 1QQOA 3CCLN 4WQ5A 2A3ZA 4CBXA 3R9PA 4XH5A 3VEZA 3DXKB 3O9TA 1YVNA 3MN5A 4BC3A 1M90O 1X3NA 1ESVA 2EWSA 1Q18A 3LL3A 3PZDA 4XEIA 1NGBA 1J19A 3H45C 4FWLA 4PKIA 2WH5A 1R59O 5AQFA 3VEVA 4IOCL 5C12A 2YX6A 4GV6A 1HKBA 3ID6A 2COPA 2I7NA 3AGRA 2AL6A 4PKGA 4O8UA 1E4FT 3P31A 5F1XA 4BRMA 4IOAL 2P9SB 3O5BA 3EKUA 3SBGA 1J6ZA 2E2NA 1MK9B 3O9UA 4H03B 4Y0WA 3UB5A 3LDLA 3ATVA 1P8ZA 3ENHA 5AQKA 3HBTA 4DB3A 4MLEA 1MWKA 5GADP 1Q82O 3OBYA 2KHOA 1HBKA 3LDQA 1S3XA 4IJNA 2ITMA 4BY9C 1NBWA 3CMEN 3DLLL 1W97L 4JKDA 2FSNA 2Q2RA 4BRLA 4WFNL 5AQPA 3HOSA 1HX1A 4P7IA 4IXCA 1QZ5A 5FPDA 3CERA 2DPNA 4H0TB 3VF4A 4B1ZA 4BRDA 3LM9A 1KXPA 4CZMA 4EHTA 3U8XA 3WA0A 4QS9A 1OVYA 2ASMA 2W40A 1K8KB 4CD3A 1JJ2M 1BDGA 3C6AA 3HZ6A 3O9SA 4MDAA 1QVGM 5GAGP 2QWLA 4JEPA 4BREA 3CCJN 2YHXA 2OTJN 2DIKA 2E88A 4FPBA 1SQKA 1VQ6N 4U7BA 4JKHA 1VQPN 1NGHA 2ASPA 1BU6O 2FXUA 3EE9A 4GVEA 4A5BA 3J8AA 1QZ6A 4EHUA 3I33A 3G4SN 3CCRN 3KWGA 1YJ9N 2IVPA 4YDUC 1M1KO 3G9WA 4JKGB 4BRGA 3ENOA 3D7EO 4JHDA 3D2EA 4CZFA 1ILYA 4B1VA 3BF3A 4NLCA 5BPMA 4M7YA 2IVNA 1KAYA 2HF3A 3Q7CA 4IEIA 4IEEA 2FF3B 2Q0UA 1TYQB 1IG8A 3CJ1A 1YJNN 4IDHA 4EKUA 1E5WA 3CJAA 3O9QA 3ZEUA 5EOYA 3OHRA 3QICA 1HB6A 2A6AA 5KQDA 3GBTA 1XQSC 2P9IB 2Q36A 1E4GT 4F7GA 4JAXA 3C7NA 3RSEA 3ULEA 3AARA 4WCEL 5FPEA 5AZIA 3R1XA 2QWQA 1X3MA 3MCPA 4JKBA 3M3ZA 1ZC6A 3L4IA 5M1KA 1GLFO 4FWNA 4H0PA 3E66A 1NGEA 3FFKB 2Q97A 5AQUA 3K9KA 3HOTA 3S41A 1O13A 4G9ZA 1ZXOA 3T7ZA 5EXWA 3CPEA 4NO7A 4B9QA 4BRIA 4K43A 4B1WB 4WFAL 1IJJA 4WF9L 4BR7A 4H0OA 4BRCA 2FJ9A 4JD2A 5GINA 2VYPA 3UKUB 3R3LA 2W41A 1HUXA 4K25A 2P9NB 1GLEG 2QXLA 4WQ4C 5AQZA 4YOXA 3IMXA 3SMSA 3A5LC 4BC4A 2OTLN 3E1YA 2NLXA 1DKGD 2D1KA 3LDPA 1HKCA 1QQNA 4IFEA 4ILJA 4QS7A 3WEEB 1JCGA 3U4LA 2QTDA 3KHYA 3O6WA 2VWBA 2D0PA 2PAVA 4O8KA 2EMSA 1X9JA 4MDBA 4O5FA 4IZ9A 3MMVA 2VCPA 3IUCA 1MWMA 4BVPA 4I6MA 5AQVA 1BOTO 4KH6A 2YJEA 2FLOA 3EN9A 2P9PB 5AQLA 3WXMB 1NTIA 2E2QA 2YI1A 4KH5A 3VEOA 3O80A 2IIRA 3A5NC 4JKFA 1XC3A 1EQYA 3MN7A 1NVLA 4NY0A 5E26A 4OO1J 2A5XA 2E20A 4JK7A 4H5TA 2HBKA 4RTFD 4Z94A 1GC6A 5ADXH 5HL7L 1U6ZA 3G6EN 2E8AA 3DXMA 5F0XA 3HM8A 3EZWA 4NLBA 4JHDB 1GC7A 3QB0A 1KC7A 5M1OA 1VQ8N 4CZJA 1JCEA 5AZJA 4GV3A 4FVUA 5GIPA 1HLUA 4U67L 3CHWA 2HF4A 3A5MC 4FWMA 1H1VA 5LJWA 1EF1A 3CQYA 4ISGA 3FE1A 1ACAA 3CXCM 3ZEUB 2NRRA 3F5TA 2P9LB 2QW9A 1LOTB 1VQON 4B1YB 4R79A 5I9EB 3TTDA 4MLHA 1KAXA 2NRHA 1MIXA 3C7NB 5JVLA 5AZIB 3MN6A 4FL9A 1HB8A 4PHTX 4IO8A 3UKRA 5TKYA 3K9JA 4A2BA 3GG4A 1NGJA 4ISEA 3EE8A 3G25A 3O08A 5E84A 5C10A 2Q1NA 2LBBA 3FLCO 4FOIA 2JWKA 4RCHA 2WBNA 2I7PA 1K73O 3PLAA 1RGIA 3FZLA 3VF2A 3CC2N 3CCEN 4MO5A 4BRPA 1MIZB 5BR9A 3FLVA 1NWKA 1YAGA 2HBJA 5LJVA 2V7YA 2YHYA 3CI5A 1U2VB 3BINA 5BN9A 2BUPA 5KQ8A 2ZJRL 1VQ7N 4JK9A 4YOTA 4HWIA 4JKCA 2P9KA 3AU4A 5AQHA 4B1XB 4CD1A 5JLFA 3R8EA 3VPZA 2A40A 3P4IA 3AY9A 4A62A 2D11A 3H1QA 3UE5A 3NVKA 5GIOA 3I8BA 5C0YA 1QVFM 3MN9A 5C2FA 2J4RA 4JK8A 2ZWHA 3QDKA 3FZMA 3WXKA 1QQMA 5BREA 2E1ZA 2P9UA 2RHKA 5M1NA 3BP8A 5ADXA 2CGKA 3SAFA 2A41A 4CYEA 2GWJA 2NZTA 2J0KA 5CE3A 3JS6A 4GY2B 4BC2A 1ISNA 1NLVA 2IVOA 2AP1A 3ZDTA 1RFQA 3H1VX 3ZETB 1Q86O 5B8HA 1VQKN 4BRKA 5JVGL 2HE7A 2E2PA 2V51B 3GOIA 1VQNN 3MDQA 4EIAA 1Z6RA 2X0SA 4JN4A 3MX5A 5AQYA 3QBWA 3TTFA 3E9OA 4A5AA 3PIPL 1K9MO 3C0BA 1HKGA 2QA4N 1S72N 2CGJA 2QWRA 4L3QA 4YOVA 3RVCA 4DQ8A 4FWKA 4BG9A 3D6RA 5AQIA 3DWLA 4GNIA 3SAGA 4BR2A 5AQJA 2FSKA 4DKWA 3OBWA 1SZ2A 3FR0A 1DIKA 2WUSA 3VGKA 2NRWA 1NI2A 5HOOA 2F9WA 2KKZA 4BROA 4ILHA 5LY3A 4BG8A 4A61A 3ATUA 2HMPA 1T3VA 3KVGA 1V4TA 2CH6A 3M5RA 3W3DA 2WC9A 3UKRB 1Q81O 2EMTA 4JKAA 2QWMA 1JCFA 3DXKA 3N4PA 3WXIA 5JLHA 1NGIA 4M63C 4HDOA 2JWLA 3MX2A 2QM1A 3QBXA 3FZKA 2FSJA 1K8AO 3CD6N 2I1KA 1ATSA 1GLLO 3OW2M 3BF1A 4FO0A 4ISFA 1S22A 1VQMN 4AM6A 4UY8O 4RWTA 4B1UB 2VGMA 4NB4A 4WQ5C 3MWPA 2P9SA 4BRHA 5IJMA 3FZHA 5KPZA 1YIJN 2HBMA 4XH4A 3VOVA 1P90A 2ZJPL 1NGCA 3MWTA 5F2RA 4K41A 1KD1O 1NGAA 2NRVA 4KH4A 4BGAA 1CZAN 3D2FA 3VGMA 1NGFA 5GAEP 3ZX0A 5C15A 2GUPA 3QIJA 2GX9A 1SS6A 1YI2N 4FPAA 4YDUA 4MO4A 4FWPA 4OPHA 5MLCQ 1OKJA 1MA9B 2FDQA 1JDEA 1Y19B 2PBDA 1BA1A 2CGLA 4QS8A 1YXQA 3O4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9P A;  4JK7 A;  4JK8 A;  4JKE A;  4JKG A;  3E9L A;  4ILG B;  4ILJ A;  4JKD A;  4JKH A;  4ILH A;  4JKB A;  3E66 A;  4JKA A;  4JKG B;  4JK9 A;  4JKC A;  3ENB A;  3E9O A;  3SBG A;  3SBT A;  4JKF A; 
#chains in the Genus database with same CATH topology
 2I1J A;  3V1R A;  4DSJ A;  4IBN A;  1RT7 A;  2NNW A;  3EYZ A;  4JI8 K;  4CES A;  2DTU A;  4BRN A;  4ILG B;  3CJ7 A;  3TPQ A;  3CPW M;  4GV9 A;  4CJW A;  1G99 A;  2B4J A;  4FVM A;  1K6Y A;  3C65 A;  3C6H A;  4ZTF A;  2RKI A;  4LC9 B;  3K5O A;  2HHV A;  5AQR A;  3CQX A;  2KFZ A;  4I2Q A;  3BDP A;  4Z4E A;  3CET A;  2HHX A;  3H3N O;  4CZG A;  5BRD A;  3DRS A;  3NF6 A;  1VSM A;  4WQ4 A;  1D8Y A;  5CR4 A;  2NRX A;  3IDH A;  4DV3 K;  3ITH A;  2OA8 A;  5C24 A;  4ZRK A;  1RBS A;  2F96 A;  4JD2 B;  5KRT A;  1EP4 A;  2P9I A;  4ELT A;  1DGK N;  2FBY A;  4CK2 A;  2HBL A;  1ATN A;  3EKS A;  5AQX A;  3TI0 A;  2BH1 A;  3OA9 A;  3QFU A;  4RW6 A;  4BVO A;  3TU5 A;  4CJP A;  2R82 A;  5TKW A;  2D2Q A;  3D2F B;  3H46 O;  4I2P A;  4CFD A;  5AQT A;  4BDZ A;  4FWQ A;  2H3G X;  3TSU A;  1S1U A;  1NJZ A;  1BGX T;  1C1A A;  4CI6 A;  2BAN A;  3NMU A;  3AAQ A;  1LCU A;  3VMF B;  3I0S A;  4FZZ A;  1GLA G;  5E41 A;  1ATR A;  3VES A;  2ZPY A;  3DXM B;  1OH5 A;  2QEX N;  3VER A;  4KHU A;  4OGC A;  3P83 D;  1EXQ A;  4CZK A;  1KRP A;  2F7T A;  4BQL A;  5AZJ B;  4FJX A;  1S5J A;  3E01 A;  1HPM A;  1YTA A;  1N5Y A;  1V4S A;  1VAZ A;  2HST A;  2UYT A;  3LM2 A;  3O1B A;  4KAZ A;  4C23 A;  3DYA A;  4YY3 K;  3DLR A;  5HBM A;  3SAH A;  2ZD1 A;  1TAU A;  1T6D A;  3CC4 N;  4OKE A;  1LWC A;  3MXI A;  4BR9 A;  3WXJ A;  1VQ4 N;  3K58 A;  4NCA A;  3SLC A;  1Z05 A;  2RPI A;  2IAJ A;  2A1S A;  3A5O C;  4JRP A;  4Z4H A;  3FGU A;  1WNS A;  3SMP A;  3TAP A;  4DXA B;  1W9H A;  3OYF A;  1TL3 A;  2AA4 A;  3W0L A;  4PKH A;  4CE9 A;  2KTQ A;  3LAM A;  3THX B;  1QHT A;  5AQG A;  4A59 A;  3B6O A;  4LD0 A;  4IO9 L;  4CGJ A;  3EY1 A;  3SNN A;  4DUY K;  2VWJ A;  1NK0 A;  3L6Q A;  2VGN A;  2HHS A;  1XWL A;  3KK7 A;  3M6G A;  4CF2 A;  3GDQ A;  2D4W A;  3L2U A;  2O8C B;  2WON A;  4H5W A;  2UUA K;  1XMO K;  1L3T A;  3HI0 A;  3OJU A;  4DR3 K;  5AQQ A;  4J2A A;  2UU9 K;  1C0G A;  3PSI A;  3SUQ A;  3K2P A;  4W5R A;  4KB1 A;  4FJL A;  4WYB A;  1HNV A;  1WUA A;  3CCS N;  3V9W A;  3KTQ A;  1YF5 L;  2W42 A;  3E9P A;  2YCH A;  2GBZ A;  3VEN A;  1NKB A;  4DU4 A;  3MN5 A;  3SUP A;  3LL3 A;  4PKI A;  2WH5 A;  1JLE A;  1R59 O;  4IOC L;  3UIQ A;  4LY7 A;  1WN7 A;  3P31 A;  3LAK A;  4IOA L;  3O5B A;  4OLA A;  3EKU A;  1QS4 A;  3SBG A;  3G0Z A;  5FDL A;  5KRS A;  1VSL A;  3ATV A;  5AQK A;  3HBT A;  5AJ3 K;  4MLE A;  3U3G A;  3F9K A;  1HBK A;  2ITM A;  4IFY A;  3K0S A;  4BRL A;  4NYF A;  2QKK A;  2XY5 A;  4P7I A;  1GOA A;  2F8S A;  4CHZ A;  4H0T B;  2O8B A;  1KVC A;  3VQD A;  3LM9 A;  3MEE A;  2KFN A;  4RW8 A;  1OVY A;  1J9A A;  1BCO A;  2ASM A;  1Q8I A;  4I9Q A;  1TKT A;  1QVG M;  2QWL A;  2DIK A;  4BDP A;  2HHT A;  4FPB A;  3ZSW A;  1SQK A;  1VSI A;  4JKH A;  2FBT A;  3HJF A;  1VQP N;  1NGH A;  1BU6 O;  4A5B A;  3J8A A;  1QZ6 A;  3S3N A;  1YJ9 N;  3LWM A;  2IVP A;  4JKG B;  3PUF A;  4DTR A;  3D2E A;  4JI5 K;  3OVN A;  5CY4 A;  1WSJ A;  3Q7C A;  1RNH A;  2FF3 B;  2P1J A;  2Q0U A;  4M3U A;  1IG8 A;  2G8V A;  4IDH A;  4DFP A;  3ZEU A;  3QIC A;  1N36 K;  3G10 A;  4H8K A;  3LP0 A;  4B3O A;  5FRO A;  3AVC A;  1RT1 A;  3KK1 A;  1GLF O;  3AO1 A;  4FWN A;  4B08 A;  3S41 A;  1O1W A;  3C6U A;  5EXW A;  3CPE A;  4NO7 A;  3QIN A;  2FBX A;  3BZK A;  1JLF A;  4H0O A;  3UKU B;  1S6Q A;  3L3V A;  4LF8 K;  1HUX A;  1RBR A;  1UA1 A;  3AVB A;  3SMS A;  4BC4 A;  4B3R K;  3E1Y A;  1HKC A;  4QS7 A;  3WEE B;  3U4L A;  3OS2 A;  1VSJ A;  2PAV A;  3VN5 A;  2B5J A;  3B6P A;  1MWM A;  2O8E A;  3EN9 A;  3NF9 A;  2E2Q A;  4KH5 A;  1S1W A;  3VEO A;  4L8R B;  3A5N C;  1NVL A;  3L3U A;  4OO1 J;  4FW1 A;  2A5X A;  1W0H A;  2E20 A;  4JK7 A;  4Z94 A;  1HQE A;  4QAG A;  4JS5 A;  2VQF K;  3BGR A;  3QB0 A;  3OTO K;  1KC7 A;  3SUN A;  3RMD A;  1JCE A;  1VSK A;  4E1N A;  3AVN A;  4U67 L;  4OKK A;  3A5M C;  4FWM A;  2O8F B;  3CQY A;  2G8K A;  3FE1 A;  4W5T A;  1LW0 A;  4IFV A;  1VSF A;  3TTD A;  1MIX A;  4CEQ A;  5AZI B;  4FL9 A;  4PHT X;  4IO8 A;  4Q5V A;  3AVL A;  4A2B A;  2UXC K;  2HND A;  1VSE A;  2Q1N A;  2LBB A;  4FOI A;  4RCH A;  3CC2 N;  4MO5 A;  3MEG A;  1MIZ B;  1YAG A;  3PX6 A;  2YHA A;  2YHB A;  2YHY A;  1U2V B;  3DRR A;  5T7B A;  4KHY A;  4JK9 A;  4HWI A;  2G8F A;  2LSN A;  4B1X B;  3VPZ A;  3P4I A;  2G8H A;  4DTM A;  1QSY A;  4ID5 A;  2JGU A;  3I8B A;  5C0Y A;  5C2F A;  1HNW K;  3FZM A;  1QQM A;  2E1Z A;  1N6Q A;  4RW9 A;  5M1N A;  1G15 A;  2CGK A;  2GWJ A;  1C0T A;  1FKP A;  5CE3 A;  4BC2 A;  1NLV A;  4CEO A;  3ZDT A;  1VQK N;  4DR5 K;  5JVG L;  3O3H A;  1BIZ A;  2E2P A;  1VQN N;  5AQY A;  3TTF A;  2GV9 A;  3QBW A;  3PIP L;  3E9O A;  2QA4 N;  4FJ7 A;  2CGJ A;  3CFO A;  4YFU A;  4YOV A;  4JI6 K;  1F21 A;  1RT6 A;  2F8T A;  3SAG A;  1TK8 A;  2FSK A;  3OBW A;  1DIK A;  3DMJ A;  1XHX A;  1T3V A;  1RTD A;  3M5R A;  2CH6 A;  3HPO A;  2WC9 A;  3CM5 A;  4B3M K;  2EMT A;  3WXI A;  3DXK A;  1J53 A;  1RTI A;  3N4P A;  3MED A;  1HMV A;  2JWL A;  1GOB A;  3FZK A;  1HQU A;  1FJG K;  3ISN C;  2XRI A;  3LP1 A;  4I9L A;  4DFM A;  2E6L A;  3RMC A;  3OYB A;  1RDA A;  1NGC A;  4KI6 A;  1KD1 O;  4KH4 A;  1CZA N;  3VGM A;  3AV9 A;  4N5S A;  1C6V A;  3DLG A;  2G8W A;  4MO4 A;  2D0C A;  1MA9 B;  1JDE A;  4W5N A;  1VSD A;  2CGL A;  2IDO A;  3DLB A;  1BIU A;  1IBM K;  4AF1 A;  2D10 A;  1TK5 A;  4ID1 A;  3M8Q A;  4FWR A;  5JIC A;  1JLB A;  3LP3 A;  4NCG A;  3JXU A;  3HO1 A;  1NMD A;  1K8K A;  3IKM A;  2ZGZ A;  1I39 A;  5ELZ A;  2A42 A;  3OYD A;  1ZBS A;  3WXL A;  4CBU A;  4GXB A;  3I55 N;  1JLC A;  2V52 B;  2ZJQ L;  5SZT A;  5FPM A;  5JS1 A;  3RSE B;  2UUC K;  2D0B A;  1HNX K;  4CEE A;  4IDK A;  1MDU B;  5JVH L;  1QHA A;  1NJI O;  1FKO A;  2YKM A;  5AQN A;  4CZL A;  3HYF A;  3J7A P;  5BN8 A;  1YHQ N;  1YIT N;  4KHP K;  4DCH A;  4DSL A;  4H0V B;  2O4G A;  3ZX3 A;  1QSS A;  1BG3 A;  1VK0 A;  1WSE A;  3THW A;  4CBW A;  1LAV A;  3VGL A;  1ASW A;  1TV6 A;  4DV4 K;  4KV8 A;  4CJT A;  2RE2 A;  2ASO A;  3V9U A;  4DQR A;  3DAW A;  3HSC A;  1RDC A;  3NE6 A;  1OVQ A;  4LF9 K;  2KLA A;  4PQU A;  2J0M A;  1JLG A;  4AHS A;  1BUP A;  2GWK A;  3TAR A;  3ZSY A;  4DR2 K;  1YVU A;  3V9S A;  1TUU A;  5CZ1 A;  1VBG A;  3KJV A;  1KC8 O;  3RWU A;  1B9F A;  1HPZ A;  4CEF A;  2J0J A;  4J8F A;  4CFA A;  4OVL A;  5AFU A;  5BPL A;  4CHN A;  3QNO A;  3QML A;  1VQ5 N;  3NF8 A;  4H5N A;  1BWF O;  1WBB A;  3PO5 A;  1DEJ A;  5AQS A;  4JKE A;  4CJQ A;  4YHH K;  3NH1 A;  3DLH A;  1B9D A;  3T3F A;  3SJH A;  2HHU A;  4GW6 A;  4BRF A;  4CZI A;  3VEX A;  4FLZ A;  3WT0 A;  3L0Q A;  5DM6 L;  4EAH D;  2BE2 A;  2BTF A;  2Q3S A;  3TTC A;  1Y97 A;  5SWM A;  4DV7 K;  3AU5 A;  4BR0 A;  1WAJ A;  2V7Z A;  1RDD A;  1U47 A;  3G71 N;  2CB8 A;  1U48 A;  4H0X B;  3OYK A;  3EPY A;  3TAQ A;  3EO3 A;  4BRQ A;  4H4M A;  4YOW A;  3T1H K;  1GG3 A;  3IVF A;  4LF5 K;  2YJF A;  2FF6 A;  4M7X A;  2P9L A;  3KLI A;  4HDQ A;  1VRT A;  4F4K A;  1Z26 A;  3WNH A;  3P39 A;  2ZF5 O;  4E3S A;  4YOR A;  4Z4I A;  1RDU A;  4DV5 K;  1XI1 A;  2KZM A;  4NCB A;  4FWS A;  1RT2 A;  2P9U B;  3VQA A;  2GEM A;  4C1N K;  4DLE A;  5LMU K;  3LPT A;  3BZC A;  3CG7 A;  3C94 A;  3LDN A;  4PUO A;  4FLT A;  4FWO A;  3IRX A;  4FJN A;  2Z1J A;  3O9R A;  4Q0B A;  2VG6 A;  1GLJ O;  4BR4 A;  1C0F A;  4DHY A;  3AA5 X;  4E7J A;  1IBL K;  1S9E A;  5IWA K;  4YL8 A;  1KBL A;  2W6K A;  3T69 A;  1W7A A;  4PA1 A;  2E5L K;  4DV6 K;  3CIP A;  3PV8 A;  3GE1 A;  4DV0 K;  4HCB A;  3WUH A;  2BDP A;  1NGG A;  1SAZ A;  1NK7 A;  4F2R A;  4CER A;  4B9N A;  4CGI A;  1BCM A;  1NM1 A;  3H08 A;  3V1Q A;  4DG1 A;  4C8K A;  3F9M A;  2KQ2 A;  3HVT A;  4H5V A;  3JYT A;  3VQB A;  4WQ5 A;  1BQM A;  3R9P A;  3VEZ A;  4LFC K;  3O9T A;  1X3N A;  3O4Q A;  1HNZ K;  4KHS A;  1Q18 A;  3PZD A;  4XEI A;  1NGB A;  4FWL A;  4FZY A;  2YX6 A;  2X78 A;  1J5O A;  2AL6 A;  3RMA A;  4O8U A;  1E4F T;  3THV A;  5F1X A;  2D5R A;  4OGE A;  4HTU A;  2P9S B;  2KZZ A;  2XO7 A;  2X6S A;  1J6Z A;  5KGW A;  4B8C A;  3BY5 A;  4Y0W A;  3UB5 A;  3IAY A;  4Y1D A;  2OCE A;  4KFB A;  1JXE A;  3DM2 A;  4O5B A;  5GAD P;  4FK0 A;  3OBY A;  3ULD A;  1KFD A;  2DFF A;  4B9U A;  3QEV A;  1RT3 A;  1W97 L;  4JYA K;  3AO3 A;  3CM6 A;  4WFN L;  4FZX C;  5AQP A;  1HX1 A;  1N33 K;  1QZ5 A;  3CER A;  4ZTJ A;  3CFP A;  3WNE A;  3SQ2 A;  1SKW A;  4Z0U A;  1BHL A;  1JJ2 M;  1JL1 A;  1KVB A;  4E89 A;  4MDA A;  4ZHR A;  4JEP A;  3CCJ N;  2OTJ N;  1ZYQ A;  3OS1 A;  1WAF A;  4FM2 A;  2ASP A;  2FXU A;  3EE9 A;  4GVE A;  3M8R A;  3G4S N;  3CCR N;  3I33 A;  2OYQ A;  3KWG A;  4B3T K;  4BRG A;  3D7E O;  4DTJ A;  3TAF A;  3BF3 A;  5KTQ A;  1WSI A;  4X66 K;  4M7Y A;  2IVN A;  1Q9X A;  2HF3 A;  1IBK K;  1TYQ B;  3L2W A;  3D0P A;  1YJN N;  3AVK A;  4M3X A;  3GBT A;  3ZSO A;  4DSK A;  3VA0 A;  2Q36 A;  1E4G T;  4WCE L;  2QWQ A;  2ZE2 A;  3DLE A;  2DY4 A;  4JKB A;  1ZC6 A;  3PO4 A;  2Q97 A;  3HOT A;  1DTQ A;  3T7Z A;  1BQN A;  4DWI A;  1NK4 A;  4JI4 K;  4B9Q A;  4K43 A;  4WF9 L;  2HHW A;  4BR7 A;  4BRC A;  1IKX A;  4JD2 A;  2VYP A;  5D3G A;  3NH0 A;  4J2D A;  2P9N B;  2O8B B;  4YOX A;  4CJL A;  3A5L C;  3THY B;  4CEC A;  1DKG D;  4ILJ A;  2QK9 A;  2QTD A;  2VWB A;  4O8K A;  3O3G A;  3IUC A;  3ZT3 A;  4DQP A;  2ETJ A;  3KLF A;  4DSI A;  1D9F A;  4KH6 A;  2A1R A;  2P9P B;  4OKJ A;  1NTI A;  4NYN A;  4JI3 K;  3MN7 A;  1S1V A;  4NY0 A;  5HL7 L;  4K8Z A;  2HBK A;  4RTF D;  4DMN A;  3NGZ A;  1U6Z A;  1D9D A;  5J2Q A;  3G6E N;  3DXM A;  3HT3 A;  3CFR A;  4KRF A;  3HM8 A;  4AHV A;  3AVM A;  4NLB A;  1GC7 A;  2F4V K;  5AZJ A;  5DK5 A;  4FVU A;  5GIP A;  1H1V A;  4ISG A;  4ELV A;  1ACA A;  3ZEU B;  2NRR A;  3F5T A;  1LOT B;  4G1Q A;  1VQO N;  5I9E B;  1WLJ A;  4FJ5 A;  4MLH A;  1KAX A;  1QSL A;  1IV0 A;  4Z4G A;  5JVL A;  4M45 A;  3IS9 A;  4LF4 K;  3GG4 A;  5E84 A;  1RBT A;  3FZL A;  2HMI A;  1NJX A;  4BRP A;  5FRM A;  3FLV A;  3CI5 A;  4YNQ A;  3QIP A;  3L8B A;  3ALY A;  4JKC A;  2EX3 A;  1CLQ A;  1TAQ A;  2A40 A;  4FJJ A;  2D11 A;  5GIO A;  3MN9 A;  2J4R A;  3LAN A;  3MXJ A;  3AVA A;  5BRE A;  1TL1 A;  2RHK A;  3QET A;  3SQ4 A;  3BP8 A;  3AO4 A;  3QNN A;  2A41 A;  4CYE A;  4O0I A;  4DSF A;  2J0K A;  1IKY A;  1C0M A;  1YT3 A;  1ISN A;  1Q86 O;  3H1V X;  3ZET B;  4NXN K;  5B8H A;  1SL2 A;  3K57 A;  3V9Z A;  3GOI A;  4CJU A;  4JN4 A;  3C0B A;  2ATQ A;  5DMR A;  1X9W A;  3WNG A;  4LF6 K;  4L3Q A;  3KIO A;  3HM9 A;  3DLK A;  4BR2 A;  2VQE K;  4DKW A;  3FR0 A;  1WSF A;  2NRW A;  4J2B A;  4IG3 A;  3V4I A;  4BRO A;  4N41 A;  4CF1 A;  4ILH A;  4KTW A;  4BG8 A;  4A61 A;  5LY3 A;  2HMP A;  3EZ5 A;  3QES A;  2UUB K;  1C1C A;  4QCL A;  2GUI A;  4JKA A;  1VSH A;  3ZT0 A;  1HRH A;  4HDO A;  1FXX A;  2QM1 A;  3MX2 A;  2FSJ A;  4DQS A;  2I1K A;  3KK3 A;  3HPG A;  4AHR A;  2UXD K;  4B1U B;  3ZSQ A;  3TAM A;  1X9M A;  1JXB A;  3ZLJ A;  5KPZ A;  3VOV A;  2ZJP L;  1CZ9 A;  1U4B A;  3SYZ A;  4E7I A;  2NRV A;  4KHW A;  5GAE P;  4E1M A;  1HYZ A;  3OYE A;  4OPH A;  2FDQ A;  1Y19 B;  2PBD A;  3Q7B A;  3PIO L;  1YXQ A;  3O4W A;  4AHT A;  3NCI A;  2OPP A;  4OX9 K;  3GL1 A;  2ZQB A;  3O8M A;  4F9O A;  3I56 N;  1VQL N;  1SL0 A;  3K5M A;  5BRF A;  2XY8 A;  3RMB A;  4CZE A;  4DU3 A;  2YVC A;  4E0D A;  5EY4 A;  1BI4 B;  3J7Z O;  1TGO A;  1T6C A;  4OPJ A;  1VQ9 N;  5BRH A;  4E1J A;  5AFU H;  3T19 A;  3ZT1 A;  3MCA B;  3AAP A;  3ULE B;  1EO1 A;  4AM7 A;  3CC7 N;  3VET A;  3VF6 A;  3N4Q A;  4FLY A;  1T7P A;  1UA0 A;  1XMQ K;  1RIL A;  3K5L A;  4DS4 A;  5C25 A;  2PFU A;  1NKC A;  2B6A A;  2YHW A;  3O1W A;  3VEY A;  1DT9 A;  2Z1I A;  3BUZ B;  2YNH A;  5HP1 A;  1XHZ A;  4BGB A;  1NK9 A;  1KVA A;  5FRN A;  2YKN A;  4DF4 A;  3E9L A;  4IJA A;  3CJB A;  4OJR A;  1U45 A;  3QLH A;  4I6M B;  1ASU A;  3WQU A;  4KHQ A;  3VA3 A;  4H0Y B;  4JNE A;  4O0J A;  3UKU A;  4M3Y A;  4CW7 B;  5EVZ A;  2E2O A;  2HRJ A;  4K42 A;  3U7D A;  3OYM A;  4CHO A;  2OAN A;  4E7K A;  4FLW A;  1Q82 O;  4BRA A;  3TSP A;  3LZJ A;  3WEE A;  5GAH P;  3X23 A;  3ZSR A;  4DTS A;  2O8D B;  4TKN A;  3A0I X;  4A2A A;  3ZSZ A;  2DFE A;  4DUZ K;  2QWO A;  1YJW N;  4FW2 A;  3KWI A;  1QTM A;  4CZH A;  3SV3 A;  4YOU A;  3QFP A;  4CIG A;  2Y1J A;  1WOQ A;  2I5J A;  4FCY A;  1W2B M;  1B92 A;  2QWP A;  4W5Q A;  3CCQ N;  3M8S A;  3QEX A;  4BWM A;  5LL6 Z;  3TAG A;  5HRP A;  5BPN A;  1BA0 A;  4CFC A;  4FJG A;  4B9M A;  3HST B;  2O8F A;  1UOC A;  1GLB G;  1KLN A;  3PSF A;  1RT4 A;  3PVL A;  3H3O B;  4IOX A;  1WBD A;  2P9K B;  4CF9 A;  4EZ6 A;  4XH1 A;  3NF7 A;  4LF7 K;  3VEW A;  4YOY A;  3FP5 A;  3L4Q A;  3SK3 A;  3MAQ A;  4X64 K;  3CJC A;  3TSQ A;  3P38 A;  1XUP O;  1HNI A;  4BC5 A;  3ZX2 A;  4CHY A;  1VBH A;  1U2V A;  4KPY A;  4A57 A;  1ST7 A;  3KKS A;  2P51 A;  3AGK A;  4FM0 A;  4BR5 A;  5EX5 A;  3TAN A;  4PL7 A;  2NRT A;  1VRU A;  3U9D A;  2UXB K;  5AQW A;  1HJO A;  3DOL A;  3V9X A;  5HRO A;  1QQC A;  2HVH A;  4FXD A;  5KGX A;  4H5R A;  4ZRI A;  1A5W A;  1H4R A;  5AQM A;  3LWL A;  2Y1I A;  5I42 A;  3SQ1 A;  1KFS A;  1KQS M;  2F9T A;  1CZB A;  2HB5 A;  1QQO A;  3CCL N;  4B9S A;  4CBX A;  4XH5 A;  3OYA A;  1YVN A;  1M90 O;  4CJ4 A;  5AQF A;  3H45 C;  5C12 A;  1EWQ A;  4DLG A;  4GV6 A;  2OPQ A;  1L5U A;  4Y1C A;  4BRM A;  4DQI A;  1VHX A;  2E2N A;  1MK9 B;  4H03 B;  4LSL A;  4Z4C A;  5HRN A;  3MEC A;  4MFB A;  5K14 A;  5J1E A;  2KHO A;  3LDQ A;  1S3X A;  4BY9 C;  1ZBH A;  1NBW A;  4EZ9 A;  3DLL L;  3KLG A;  3SV4 A;  2FSN A;  2Q2R A;  4C8M A;  1FW6 A;  4IXC A;  3TWH A;  4KB0 A;  4GVM A;  5HRS A;  4BRD A;  1KXP A;  4EHT A;  3U8X A;  3WA0 A;  1KCF A;  2G8I A;  4QS9 A;  1SL1 A;  4LSN A;  3O3F A;  4DF8 A;  4DTX A;  4M3T A;  3LZI A;  1HYV A;  3C6A A;  4CGF A;  3O9S A;  1L3V A;  4K0K K;  5GAG P;  4BRE A;  1S1X A;  1SV5 A;  1Q9Y A;  1KTQ A;  2E88 A;  3NBP A;  1VQ6 N;  4U7B A;  4M3R A;  3VQC A;  2WOM A;  4YDU C;  4BE2 A;  1M1K O;  3G9W A;  3HVR A;  1DTT A;  4JHD A;  3ZT2 A;  4B1V A;  4NLC A;  5BPM A;  4CF0 A;  1RTJ A;  4IEI A;  1SUQ A;  3L2Q A;  1EET A;  5EU7 A;  4EKU A;  1E5W A;  1KLM A;  1S1T A;  5EOY A;  4CVN E;  5KQD A;  3NHG A;  1XQS C;  2P9I B;  4HUG A;  4F7G A;  4JAX A;  3C7N A;  3RSE A;  4JI0 K;  3R1X A;  3MCP A;  3M3Z A;  2X6N A;  3L4I A;  4NXM K;  4H0P A;  5M1K A;  1NGE A;  4G9Z A;  3K9K A;  1ZXO A;  1IKV A;  2ZM6 K;  3NFA A;  4KHN A;  4BRI A;  3O4N A;  4B9T A;  3VQ4 A;  4WFA L;  1BIS A;  1RTH A;  2FJ9 A;  2E4L A;  5GIN A;  3R3L A;  2QXL A;  4WQ4 C;  3IMX A;  2OZM A;  4RG8 A;  2D1K A;  5J2N A;  3QER A;  1JCG A;  3AVH A;  3OYJ A;  3KHY A;  3O6W A;  4CJE A;  2RF2 A;  1X9J A;  4MDB A;  4O5F A;  3MMV A;  3RTV A;  4BVP A;  5AQV A;  1BOT O;  1NG9 A;  3SZ2 A;  3AA4 A;  2YI1 A;  3O80 A;  2IIR A;  4JKF A;  1XC3 A;  4H5T A;  1GC6 A;  3ZCM A;  4CIF A;  1L3S A;  3CYM A;  3EZW A;  4HVJ A;  4XIU A;  4GV3 A;  3FFI A;  3KK2 A;  5LJW A;  1EF1 A;  4RW4 A;  3HP6 A;  3J80 O;  1EX4 A;  3KLE A;  3MN6 A;  1HB8 A;  3T1A A;  3UKR A;  4JV5 K;  3K9J A;  3G25 A;  3O08 A;  2W6L A;  2JWK A;  1JKH A;  3PLA A;  2I7P A;  1ZBF A;  1RGI A;  3VF2 A;  2NUB A;  3AA3 A;  4F3T A;  2OPR A;  4HUF A;  3SUO A;  1NJY A;  2HBJ A;  1OH6 A;  5LJV A;  4CHP A;  5BN9 A;  2BUP A;  4CFB A;  4E7H A;  1MU2 A;  1UAX A;  4YOT A;  3AU4 A;  5AQH A;  4CD1 A;  1LV5 A;  3R8E A;  4R5P A;  3DOK A;  3AY9 A;  3OYL A;  3H1Q A;  4B9V A;  5JS2 A;  1ASV A;  1QVF M;  4JK8 A;  2ZWH A;  3QDK A;  3WXK A;  1NJW A;  2P9U A;  5ADX A;  4LH5 A;  1RBU A;  4IG0 A;  4CJK A;  1E3M A;  1XNQ K;  3JS6 A;  1JL2 A;  3KLH A;  2IVO A;  4DU1 A;  1RFQ A;  2RN2 A;  4BRK A;  4FLX A;  5HRR A;  3LPU A;  4EIA A;  3SPY A;  3MX5 A;  3IG1 A;  4FK2 A;  4O44 A;  1TKZ A;  1S72 N;  1NK5 A;  3SQ0 A;  2QWR A;  3J7Y P;  3RVC A;  4FWK A;  4BG9 A;  3HXM A;  3D6R A;  4GNI A;  3OYN A;  4F3O A;  4JI7 K;  1SZ2 A;  4CGG A;  2OPS A;  5HOO A;  2F9W A;  3NDK A;  3OJS A;  4AIL C;  3ATU A;  2BGG A;  3AO5 A;  5IT9 O;  3W3D A;  4E19 A;  1Q81 O;  3HL8 A;  4DTN A;  1NGI A;  3QEP A;  3OYC A;  3CD6 N;  1K8A O;  2G8U A;  1ATS A;  1GLL O;  3OW2 M;  4ISF A;  4FO0 A;  1S22 A;  1VQM N;  3NGI A;  2E6M A;  4UY8 O;  3RR8 A;  4RWT A;  2ITG A;  2VGM A;  4NB4 A;  3MWP A;  4CJR A;  2P9S A;  4O55 A;  4DR6 K;  1C0U A;  3ZT4 A;  1YIJ N;  3AVI A;  4AHC A;  4CF8 A;  1I3A A;  3MWT A;  5F2R A;  4K41 A;  3WNF A;  4FJ8 A;  3D2F A;  3C6T A;  3ZX0 A;  4BE1 A;  3QIJ A;  3ASM A;  1SS6 A;  1IO2 A;  1CXQ A;  2KW4 A;  3CJA A;  4QS8 A;  3P5J A;  3NAE A;  4JI2 K;  3RR7 A;  3IFR A;  3CCM N;  3VTH A;  4KTQ A;  4CJ3 A;  2PZS A;  1OH7 A;  5AR0 A;  1OH8 A;  2AJQ A;  4JI1 K;  3D2E B;  5CZ2 A;  3NVM A;  5M1P A;  4CJF A;  3VQQ A;  4ZRJ A;  4F2S A;  3TR8 A;  3NGY A;  1RDW X;  4DQQ A;  3A8Y A;  4OPA A;  1NMN A;  2VWK A;  2QWN A;  3KZB A;  5DM7 L;  3U6F A;  2IOC A;  5M1Q A;  3HP9 A;  4N56 A;  1KAZ A;  1TYQ A;  1MK7 B;  3V6D A;  1NGD A;  3CJ9 A;  1GLC G;  1GLD G;  1WSH A;  3MXM A;  4DS5 A;  3H6E A;  4MQ3 A;  5FPN A;  3PX4 A;  4CJ7 A;  4CHQ A;  3THX A;  1T44 A;  4M41 A;  3HPH A;  1TUY A;  1Y64 A;  5C42 A;  3SJJ A;  3TAE A;  4JRQ A;  2O8E B;  4CCH A;  2IS3 A;  2AEH A;  1ZBL A;  1XNR K;  3M1F A;  3PX0 A;  3HTV A;  1S6P A;  2IC3 A;  4W5O A;  3U9Z A;  2P9N A;  1N8R O;  2RQ1 A;  1N32 K;  3THY A;  3OYI A;  4C1N I;  2ZGY A;  3BEX A;  3OS0 A;  4DFK A;  2O8C A;  5KI6 A;  4M42 A;  4WFB L;  1YUW A;  4FSV A;  1BO5 O;  4KBO A;  3EL2 A;  2HW3 A;  3R6M A;  4HTL A;  4IWV A;  4HHT A;  2P9P A;  3OYG A;  1T8E A;  3S3O A;  4FYD A;  4B8A B;  3F2K A;  3MK6 A;  3SI6 A;  2E1Y A;  2ABD A;  4FOE A;  4DV2 K;  4KO0 A;  2XHB A;  4B9L A;  1REV A;  3WQT A;  2WFB A;  1TK0 A;  2D0O A;  2QI2 A;  2NRZ A;  3L2V A;  2CH5 A;  3DJC A;  3VTI A;  5KPR A;  3FZF A;  4GKK K;  4AQY K;  3C95 A;  5CHI A;  1S9G A;  3CCU N;  3LDO A;  3VQ8 A;  3T1Y K;  2GEL A;  3ZYY X;  1D4X A;  3RRG A;  2CQU A;  4LFA K;  3ID8 A;  1GOC A;  2Z1H A;  3CQ8 A;  1SGH A;  3CF5 L;  3CMA N;  1HYS A;  1GGO A;  1LWF A;  5C2D A;  2Q31 A;  5JMV A;  4EP5 A;  3U8Z A;  2PYL A;  1Q7Y O;  4FJ9 A;  3J81 O;  3HRG A;  1YTU A;  3NH2 A;  4FK4 A;  2IGI A;  3VQ7 A;  2HOE A;  5AQO A;  5CYM A;  4OLB A;  3AVG A;  4BQZ A;  1NOZ A;  3CCV N;  5H1S Q;  4AH9 A;  3EEQ A;  1SKR A;  5I3U A;  3JSM A;  4ELU A;  5KPT A;  5M1F A;  4JLH A;  3ENB A;  4GMJ B;  4PL8 A;  3S3M A;  3SBT A;  3V81 A;  4EFH A;  3PY8 A;  3ZET A;  3B8A X;  1Z25 A;  2GTD A;  4LFB K;  1ITG A;  2Q0R A;  4JKG A;  4LH4 A;  2A3Z A;  4M3Z A;  3DXK B;  2PY5 A;  4F8R A;  4BC3 A;  1UWB A;  4DV1 K;  1ESV A;  2EWS A;  1J19 A;  4N47 A;  3VEV A;  3OY9 A;  3LAL A;  1HKB A;  3ID6 A;  4FLU A;  2COP A;  2I7N A;  3AGR A;  4PKG A;  4AHU A;  2R7Y A;  1EKE A;  3S9H A;  1HR0 K;  1IH7 A;  3VQ5 A;  2P5G A;  2HVI A;  4C8N A;  2VG5 A;  4JS4 A;  3O9U A;  1WSG A;  3LDL A;  1P8Z A;  3ENH A;  3U3Y A;  4DB3 A;  4BE0 A;  2D0A A;  1MWK A;  2YNG A;  4CJ5 A;  4IJN A;  1X1P A;  3CME N;  3VQE A;  1HJR A;  4JKD A;  4DTP A;  1L3U A;  1LW2 A;  3HOS A;  4DTU A;  5FPD A;  2DPN A;  3VF4 A;  4B1Z A;  1RBV A;  4B3S K;  4CZM A;  3DI6 A;  1JLA A;  2W40 A;  2WTU A;  3M8P A;  1K8K B;  4CD3 A;  1BDG A;  4FLV A;  3HZ6 A;  3QIO A;  2YHX A;  3LP2 A;  1EWR A;  3K5N A;  1RCH A;  2HHH K;  3VQP A;  5CYQ A;  2FBV A;  4DFJ A;  3CCE N;  4EHU A;  1BL3 A;  1NU0 A;  1U04 A;  2HNY A;  1NOY A;  4UQG A;  3LDS A;  3ENO A;  3D45 A;  4OPK A;  1ILY A;  4CZF A;  4DTO A;  2QKB A;  1BI4 A;  4CJV A;  3F73 A;  1KAY A;  4O4G A;  4IEE A;  1X9S A;  4FJH A;  3CJ1 A;  3O9Q A;  1I94 K;  3OHR A;  1HB6 A;  2A6A A;  1D5A A;  4KKO A;  2X74 A;  3ULE A;  4M3W A;  3AAR A;  5FPE A;  3THW B;  5AZI A;  1X3M A;  2P5O A;  3K59 A;  5J2P A;  5A2Q O;  3E66 A;  3FFK B;  5AQU A;  2HNZ A;  2XY6 A;  1O13 A;  3ZSV A;  1ZBI A;  4IKF A;  4B1W B;  1IJJ A;  4HUE A;  1T03 A;  5J2M A;  2YV0 X;  1J5E K;  4DR7 K;  2W41 A;  4K25 A;  1ZBU A;  1GLE G;  5AQZ A;  2OTL N;  4IFE A;  2NLX A;  1FK9 A;  3LDP A;  5BR8 K;  1N34 K;  1QQN A;  4K8X A;  3TAB A;  3KKR A;  2D0P A;  2EMS A;  1DLO A;  4IZ9 A;  1RT5 A;  3OYH A;  2VCP A;  4I6M A;  1U49 A;  1C1B A;  1LAW A;  2YJE A;  2FLO A;  4PY5 A;  4CIE A;  5AQL A;  3WXM B;  4CED A;  1R0A A;  1EQY A;  4BDY A;  5E26 A;  4PWD A;  5ADX H;  4FJI A;  1IKW A;  2E8A A;  5F0X A;  4J2E A;  4KI4 A;  4JHD B;  2O8D A;  4BWJ A;  5M1O A;  1VQ8 N;  4CZJ A;  4CGD A;  4EP4 A;  1HLU A;  1SKS A;  3CHW A;  3VQ9 A;  2HF4 A;  1KSP A;  3CXC M;  2DFH A;  5HLF A;  2P9L B;  2QW9 A;  1NNE A;  3KD1 E;  4B1Y B;  4R79 A;  4CGH A;  1JLQ A;  2NRH A;  3C7N B;  4FM1 A;  5TKY A;  2YNF A;  1A5V A;  4ISE A;  1NGJ A;  4RW7 A;  3EE8 A;  3P1G A;  4CEB A;  5C10 A;  1CXU A;  3FLC O;  2OZS A;  4BAC A;  2WBN A;  4DR1 K;  1K73 O;  5BR9 A;  1NWK A;  3ZSX A;  2XY7 A;  2HHQ A;  5FLX O;  4N76 A;  2V7Y A;  3BIN A;  4FJK A;  2Z1G A;  5KQ8 A;  2ZJR L;  1VQ7 N;  3I8D A;  4KTZ A;  4C8O A;  2P9K A;  3AVF A;  2O4I A;  5JLF A;  3QEI A;  4E7L A;  4FJM A;  4HCC A;  3NVK A;  4A62 A;  3UE5 A;  2YNI A;  4ICL A;  4V19 S;  2QXF A;  3HK2 A;  3SAF A;  2NZT A;  4Z4F A;  4WE1 A;  4GY2 B;  5LMN K;  3AA2 A;  2AP1 A;  2EHG A;  3AVJ A;  1LWE A;  3I0R A;  3JAM O;  4CEZ A;  4I7F A;  2HE7 A;  2V51 B;  3MDQ A;  3V1O A;  1Z6R A;  2X0S A;  4A5A A;  1K9M O;  1NKE A;  1A5X A;  1HKG A;  4DQ8 A;  4CJS A;  1TKX A;  4H4O A;  5AQI A;  4CK3 A;  3DWL A;  4CEA A;  4GKJ K;  5AQJ A;  4DSE A;  3VGK A;  2WUS A;  4KRE A;  1NI2 A;  2KKZ A;  3A2F A;  2VG7 A;  4DR4 K;  3KVG A;  3SCX A;  3VQ6 A;  1V4T A;  3UKR B;  2QWM A;  1JCF A;  4X65 K;  2JLE A;  5JLH A;  3L2R A;  4M63 C;  1XC9 A;  1TKD A;  3QBX A;  3DRP A;  3BF1 A;  3QO9 A;  4TSX A;  1WB9 A;  4AM6 A;  3KD5 E;  4WQ5 C;  4BRH A;  5IJM A;  3FZH A;  1TVR A;  1IG9 A;  2HBM A;  4XH4 A;  3RRH A;  1P90 A;  1NK8 A;  3SPZ A;  1NGA A;  4BGA A;  1J54 A;  1QE1 A;  3QEW A;  1NGF A;  5C15 A;  2GUP A;  2GX9 A;  4CK1 A;  1YI2 N;  4QOZ B;  4FPA A;  4YDU A;  3AO2 A;  4C8L A;  4FWP A;  5MLC Q;  1OKJ A;  1T05 A;  1RDB A;  1NK6 A;  2PYJ A;  1BA1 A;  2FC0 A;  4X62 K; 
#chains in the Genus database with same CATH homology
 2I1J A;  4AF1 A;  2D10 A;  3GL1 A;  2NNW A;  3O8M A;  3IFR A;  4F9O A;  3I56 N;  3CCM N;  1VQL N;  3VTH A;  4BRN A;  4ILG B;  4FWR A;  5BRF A;  5JIC A;  3CJ7 A;  3TPQ A;  3CPW M;  4CZE A;  5AR0 A;  4GV9 A;  3JXU A;  1NMD A;  1K8K A;  3D2E B;  3IKM A;  1G99 A;  2ZGZ A;  2YVC A;  3NVM A;  5M1P A;  5EY4 A;  5ELZ A;  2A42 A;  3J7Z O;  1VQ9 N;  1T6C A;  3C65 A;  3C6H A;  5BRH A;  1ZBS A;  4E1J A;  3WXL A;  4ZRJ A;  4GXB A;  4CBU A;  3I55 N;  5AFU H;  2V52 B;  4LC9 B;  2ZJQ L;  3MCA B;  5FPM A;  1RDW X;  3AAP A;  3A8Y A;  4OPA A;  3CQX A;  5AQR A;  3ULE B;  3RSE B;  2QWN A;  3KZB A;  5DM7 L;  1EO1 A;  4AM7 A;  3CET A;  5M1Q A;  3VET A;  3VF6 A;  3CC7 N;  3H3N O;  4CZG A;  3N4Q A;  1MDU B;  5BRD A;  5JVH L;  4WQ4 A;  5CR4 A;  2NRX A;  3IDH A;  1QHA A;  1NJI O;  2PFU A;  1KAZ A;  1TYQ A;  5AQN A;  4CZL A;  2YHW A;  3O1W A;  5BN8 A;  1YHQ N;  1MK7 B;  1YIT N;  3VEY A;  4DCH A;  4ZRK A;  4JD2 B;  1NGD A;  1DT9 A;  3CJ9 A;  1GLC G;  4H0V B;  3BUZ B;  1GLD G;  2P9I A;  1DGK N;  3ZX3 A;  1BG3 A;  2HBL A;  1ATN A;  3EKS A;  5AQX A;  4CBW A;  3H6E A;  2BH1 A;  3OA9 A;  3QFU A;  5FPN A;  4BGB A;  3TU5 A;  4BVO A;  2R82 A;  5TKW A;  2D2Q A;  3D2F B;  3H46 O;  3VGL A;  4CJ7 A;  5AQT A;  3E9L A;  1T44 A;  4IJA A;  2RE2 A;  2ASO A;  3CJB A;  1TUY A;  1Y64 A;  3DAW A;  3HSC A;  2H3G X;  4FWQ A;  4I6M B;  3TSU A;  2AEH A;  3WQU A;  3M1F A;  2KLA A;  4CI6 A;  4H0Y B;  3AAQ A;  4JNE A;  3UKU A;  3HTV A;  2J0M A;  3NMU A;  1LCU A;  5EVZ A;  1BUP A;  2GWK A;  2P9N A;  3U9Z A;  3VMF B;  1N8R O;  2E2O A;  2HRJ A;  4K42 A;  3U7D A;  1GLA G;  2RQ1 A;  2OAN A;  4C1N I;  1ATR A;  3VES A;  2ZPY A;  1TUU A;  2ZGY A;  3BEX A;  4BRA A;  3TSP A;  1VBG A;  3DXM B;  3WEE A;  5GAH P;  3X23 A;  3VER A;  1KC8 O;  2QEX N;  2J0J A;  4J8F A;  4CZK A;  1YUW A;  4WFB L;  2F7T A;  5AFU A;  4TKN A;  3A0I X;  4FSV A;  4A2A A;  1BO5 O;  3QML A;  4BQL A;  4KBO A;  5BPL A;  5AZJ B;  1YJW N;  2QWO A;  4H5N A;  1VQ5 N;  3KWI A;  1BWF O;  3EL2 A;  4CZH A;  1DEJ A;  5AQS A;  4JKE A;  1HPM A;  4YOU A;  3R6M A;  3QFP A;  4HTL A;  1V4S A;  1VAZ A;  2HST A;  2P9P A;  2UYT A;  4IWV A;  3LM2 A;  3SJH A;  3F2K A;  3O1B A;  4BRF A;  4CZI A;  3MK6 A;  3VEX A;  2E1Y A;  1WOQ A;  3WT0 A;  3L0Q A;  5DM6 L;  4C23 A;  2ABD A;  4EAH D;  1W2B M;  2BTF A;  4FOE A;  2QWP A;  3TTC A;  3SAH A;  3AU5 A;  1T6D A;  3CCQ N;  4BR0 A;  2V7Z A;  3CC4 N;  4BR9 A;  2CB8 A;  2WFB A;  3WQT A;  3G71 N;  2D0O A;  4H0X B;  3WXJ A;  1VQ4 N;  2QI2 A;  3EPY A;  2NRZ A;  5BPN A;  1BA0 A;  3EO3 A;  4BRQ A;  3SLC A;  4YOW A;  1Z05 A;  2CH5 A;  3DJC A;  3VTI A;  1GG3 A;  3IVF A;  5KPR A;  3FZF A;  1GLB G;  2YJF A;  2FF6 A;  4M7X A;  2P9L A;  3A5O C;  4HDQ A;  5CHI A;  3PVL A;  3H3O B;  4IOX A;  3CCU N;  3FGU A;  3P39 A;  3SMP A;  2P9K B;  3LDO A;  2ZF5 O;  4XH1 A;  4DXA B;  2GEL A;  1D4X A;  4YOR A;  3ZYY X;  2CQU A;  1RDU A;  3ID8 A;  2AA4 A;  3Q7B A;  4PKH A;  3VEW A;  3W0L A;  4YOY A;  3FP5 A;  3PIO L;  3L4Q A;  3SK3 A;  4FWS A;  1SGH A;  3CJC A;  3TSQ A;  3CF5 L;  2P9U B;  2GEM A;  4C1N K;  3P38 A;  3CMA N;  5AQG A;  4A59 A;  1XUP O;  4BC5 A;  4IO9 L;  1GGO A;  3ZX2 A;  5C2D A;  2Q31 A;  1VBH A;  3LDN A;  5JMV A;  3U8Z A;  4FWO A;  3L6Q A;  1U2V A;  1Q7Y O;  2VGN A;  3O9R A;  1ST7 A;  4A57 A;  3HRG A;  1GLJ O;  3AGK A;  3KK7 A;  3M6G A;  1C0F A;  5EX5 A;  2HOE A;  3GDQ A;  5AQO A;  4BR4 A;  4BR5 A;  4DHY A;  4PL7 A;  2D4W A;  4BQZ A;  4YL8 A;  1KBL A;  3T69 A;  4H5W A;  2NRT A;  3U9D A;  3HI0 A;  3CCV N;  5AQQ A;  5AQW A;  5H1S Q;  1HJO A;  3CIP A;  3GE1 A;  1C0G A;  3WUH A;  5KPT A;  5M1F A;  4WYB A;  4H5R A;  1NGG A;  1SAZ A;  1WUA A;  3CCS N;  4ZRI A;  3ENB A;  4PL8 A;  1H4R A;  3SBT A;  5AQM A;  4EFH A;  3ZET A;  3B8A X;  1NM1 A;  1YF5 L;  3E9P A;  2YCH A;  2GTD A;  3F9M A;  1KQS M;  3VEN A;  2F9T A;  4H5V A;  2Q0R A;  4JKG A;  1QQO A;  3CCL N;  4WQ5 A;  2A3Z A;  4CBX A;  3R9P A;  4XH5 A;  3VEZ A;  3DXK B;  3O9T A;  1YVN A;  3MN5 A;  4BC3 A;  1M90 O;  1X3N A;  1ESV A;  2EWS A;  1Q18 A;  3LL3 A;  3PZD A;  4XEI A;  1NGB A;  1J19 A;  3H45 C;  4FWL A;  4PKI A;  2WH5 A;  1R59 O;  5AQF A;  3VEV A;  4IOC L;  5C12 A;  2YX6 A;  4GV6 A;  1HKB A;  3ID6 A;  2COP A;  2I7N A;  3AGR A;  2AL6 A;  4PKG A;  4O8U A;  1E4F T;  3P31 A;  5F1X A;  4BRM A;  4IOA L;  2P9S B;  3O5B A;  3EKU A;  3SBG A;  1J6Z A;  2E2N A;  1MK9 B;  3O9U A;  4H03 B;  4Y0W A;  3UB5 A;  3LDL A;  3ATV A;  1P8Z A;  3ENH A;  5AQK A;  3HBT A;  4DB3 A;  4MLE A;  1MWK A;  5GAD P;  1Q82 O;  3OBY A;  2KHO A;  1HBK A;  3LDQ A;  1S3X A;  4IJN A;  2ITM A;  4BY9 C;  1NBW A;  3CME N;  3DLL L;  1W97 L;  4JKD A;  2FSN A;  2Q2R A;  4BRL A;  4WFN L;  5AQP A;  3HOS A;  1HX1 A;  4P7I A;  4IXC A;  1QZ5 A;  5FPD A;  3CER A;  2DPN A;  4H0T B;  3VF4 A;  4B1Z A;  4BRD A;  3LM9 A;  1KXP A;  4CZM A;  4EHT A;  3U8X A;  3WA0 A;  4QS9 A;  1OVY A;  2ASM A;  2W40 A;  1K8K B;  4CD3 A;  1JJ2 M;  1BDG A;  3C6A A;  3HZ6 A;  3O9S A;  4MDA A;  1QVG M;  5GAG P;  2QWL A;  4JEP A;  4BRE A;  3CCJ N;  2YHX A;  2OTJ N;  2DIK A;  2E88 A;  4FPB A;  1SQK A;  1VQ6 N;  4U7B A;  4JKH A;  1VQP N;  1NGH A;  2ASP A;  1BU6 O;  2FXU A;  3EE9 A;  4GVE A;  4A5B A;  3J8A A;  1QZ6 A;  4EHU A;  3I33 A;  3G4S N;  3CCR N;  3KWG A;  1YJ9 N;  2IVP A;  4YDU C;  1M1K O;  3G9W A;  4JKG B;  4BRG A;  3ENO A;  3D7E O;  4JHD A;  3D2E A;  4CZF A;  1ILY A;  4B1V A;  3BF3 A;  4NLC A;  5BPM A;  4M7Y A;  2IVN A;  1KAY A;  2HF3 A;  3Q7C A;  4IEI A;  4IEE A;  2FF3 B;  2Q0U A;  1TYQ B;  1IG8 A;  3CJ1 A;  1YJN N;  4IDH A;  4EKU A;  1E5W A;  3CJA A;  3O9Q A;  3ZEU A;  5EOY A;  3OHR A;  3QIC A;  1HB6 A;  2A6A A;  5KQD A;  3GBT A;  1XQS C;  2P9I B;  2Q36 A;  1E4G T;  4F7G A;  4JAX A;  3C7N A;  3RSE A;  3ULE A;  3AAR A;  4WCE L;  5FPE A;  5AZI A;  3R1X A;  2QWQ A;  1X3M A;  3MCP A;  4JKB A;  3M3Z A;  1ZC6 A;  3L4I A;  5M1K A;  1GLF O;  4FWN A;  4H0P A;  3E66 A;  1NGE A;  3FFK B;  2Q97 A;  5AQU A;  3K9K A;  3HOT A;  3S41 A;  1O13 A;  4G9Z A;  1ZXO A;  3T7Z A;  5EXW A;  3CPE A;  4NO7 A;  4B9Q A;  4BRI A;  4K43 A;  4B1W B;  4WFA L;  1IJJ A;  4WF9 L;  4BR7 A;  4H0O A;  4BRC A;  2FJ9 A;  4JD2 A;  5GIN A;  2VYP A;  3UKU B;  3R3L A;  2W41 A;  1HUX A;  4K25 A;  2P9N B;  1GLE G;  2QXL A;  4WQ4 C;  5AQZ A;  4YOX A;  3IMX A;  3SMS A;  3A5L C;  4BC4 A;  2OTL N;  3E1Y A;  2NLX A;  1DKG D;  2D1K A;  3LDP A;  1HKC A;  1QQN A;  4IFE A;  4ILJ A;  4QS7 A;  3WEE B;  1JCG A;  3U4L A;  2QTD A;  3KHY A;  3O6W A;  2VWB A;  2D0P A;  2PAV A;  4O8K A;  2EMS A;  1X9J A;  4MDB A;  4O5F A;  4IZ9 A;  3MMV A;  2VCP A;  3IUC A;  1MWM A;  4BVP A;  4I6M A;  5AQV A;  1BOT O;  4KH6 A;  2YJE A;  2FLO A;  3EN9 A;  2P9P B;  5AQL A;  3WXM B;  1NTI A;  2E2Q A;  2YI1 A;  4KH5 A;  3VEO A;  3O80 A;  2IIR A;  3A5N C;  4JKF A;  1XC3 A;  1EQY A;  3MN7 A;  1NVL A;  4NY0 A;  5E26 A;  4OO1 J;  2A5X A;  2E20 A;  4JK7 A;  4H5T A;  2HBK A;  4RTF D;  4Z94 A;  1GC6 A;  5ADX H;  5HL7 L;  1U6Z A;  3G6E N;  2E8A A;  3DXM A;  5F0X A;  3HM8 A;  3EZW A;  4NLB A;  4JHD B;  1GC7 A;  3QB0 A;  1KC7 A;  5M1O A;  1VQ8 N;  4CZJ A;  1JCE A;  5AZJ A;  4GV3 A;  4FVU A;  5GIP A;  1HLU A;  4U67 L;  3CHW A;  2HF4 A;  3A5M C;  4FWM A;  1H1V A;  5LJW A;  1EF1 A;  3CQY A;  4ISG A;  3FE1 A;  1ACA A;  3CXC M;  3ZEU B;  2NRR A;  3F5T A;  2P9L B;  2QW9 A;  1LOT B;  1VQO N;  4B1Y B;  4R79 A;  5I9E B;  3TTD A;  4MLH A;  1KAX A;  2NRH A;  1MIX A;  3C7N B;  5JVL A;  5AZI B;  3MN6 A;  4FL9 A;  1HB8 A;  4PHT X;  4IO8 A;  3UKR A;  5TKY A;  3K9J A;  4A2B A;  3GG4 A;  1NGJ A;  4ISE A;  3EE8 A;  3G25 A;  3O08 A;  5E84 A;  5C10 A;  2Q1N A;  2LBB A;  3FLC O;  4FOI A;  2JWK A;  4RCH A;  2WBN A;  2I7P A;  1K73 O;  3PLA A;  1RGI A;  3FZL A;  3VF2 A;  3CC2 N;  3CCE N;  4MO5 A;  4BRP A;  1MIZ B;  5BR9 A;  3FLV A;  1NWK A;  1YAG A;  2HBJ A;  5LJV A;  2V7Y A;  2YHY A;  3CI5 A;  1U2V B;  3BIN A;  5BN9 A;  2BUP A;  5KQ8 A;  2ZJR L;  1VQ7 N;  4JK9 A;  4YOT A;  4HWI A;  4JKC A;  2P9K A;  3AU4 A;  5AQH A;  4B1X B;  4CD1 A;  5JLF A;  3R8E A;  3VPZ A;  2A40 A;  3P4I A;  3AY9 A;  4A62 A;  2D11 A;  3H1Q A;  3UE5 A;  3NVK A;  5GIO A;  3I8B A;  5C0Y A;  1QVF M;  3MN9 A;  5C2F A;  2J4R A;  4JK8 A;  2ZWH A;  3QDK A;  3FZM A;  3WXK A;  1QQM A;  5BRE A;  2E1Z A;  2P9U A;  2RHK A;  5M1N A;  3BP8 A;  5ADX A;  2CGK A;  3SAF A;  2A41 A;  4CYE A;  2GWJ A;  2NZT A;  2J0K A;  5CE3 A;  3JS6 A;  4GY2 B;  4BC2 A;  1ISN A;  1NLV A;  2IVO A;  2AP1 A;  3ZDT A;  1RFQ A;  3H1V X;  3ZET B;  1Q86 O;  5B8H A;  1VQK N;  4BRK A;  5JVG L;  2HE7 A;  2E2P A;  2V51 B;  3GOI A;  1VQN N;  3MDQ A;  4EIA A;  1Z6R A;  2X0S A;  4JN4 A;  3MX5 A;  5AQY A;  3QBW A;  3TTF A;  3E9O A;  4A5A A;  3PIP L;  1K9M O;  3C0B A;  1HKG A;  2QA4 N;  1S72 N;  2CGJ A;  2QWR A;  4L3Q A;  4YOV A;  3RVC A;  4DQ8 A;  4FWK A;  4BG9 A;  3D6R A;  5AQI A;  3DWL A;  4GNI A;  3SAG A;  4BR2 A;  5AQJ A;  2FSK A;  4DKW A;  3OBW A;  1SZ2 A;  3FR0 A;  1DIK A;  2WUS A;  3VGK A;  2NRW A;  1NI2 A;  5HOO A;  2F9W A;  2KKZ A;  4BRO A;  4ILH A;  5LY3 A;  4BG8 A;  4A61 A;  3ATU A;  2HMP A;  1T3V A;  3KVG A;  1V4T A;  2CH6 A;  3M5R A;  3W3D A;  2WC9 A;  3UKR B;  1Q81 O;  2EMT A;  4JKA A;  2QWM A;  1JCF A;  3DXK A;  3N4P A;  3WXI A;  5JLH A;  1NGI A;  4M63 C;  4HDO A;  2JWL A;  3MX2 A;  2QM1 A;  3QBX A;  3FZK A;  2FSJ A;  1K8A O;  3CD6 N;  2I1K A;  1ATS A;  1GLL O;  3OW2 M;  3BF1 A;  4FO0 A;  4ISF A;  1S22 A;  1VQM N;  4AM6 A;  4UY8 O;  4RWT A;  4B1U B;  2VGM A;  4NB4 A;  4WQ5 C;  3MWP A;  2P9S A;  4BRH A;  5IJM A;  3FZH A;  5KPZ A;  1YIJ N;  2HBM A;  4XH4 A;  3VOV A;  1P90 A;  2ZJP L;  1NGC A;  3MWT A;  5F2R A;  4K41 A;  1KD1 O;  1NGA A;  2NRV A;  4KH4 A;  4BGA A;  1CZA N;  3D2F A;  3VGM A;  1NGF A;  5GAE P;  3ZX0 A;  5C15 A;  2GUP A;  3QIJ A;  2GX9 A;  1SS6 A;  1YI2 N;  4FPA A;  4YDU A;  4MO4 A;  4FWP A;  4OPH A;  5MLC Q;  1OKJ A;  1MA9 B;  2FDQ A;  1JDE A;  1Y19 B;  2PBD A;  1BA1 A;  2CGL A;  4QS8 A;  1YXQ A;  3O4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...