4JKFA

Open and closed forms of t1791p+r1865a human prp8 rnase h-like domain with bound mg ion
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
220
Chain Sequence
ELFSQIIWFVDDTNVYRVPIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTAKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 68
structure length 220
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkfA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkfA01
4JKHA 3E66A 4JK8A 4JKFA 4JKEA 4JKGA 3E9OA 3ENBA 4ILJA 4JKAA 4JK9A 4ILHA 4JKDA 3E9LA 4JKBA 4JKCA 4JK7A 4ILGB 3SBGA 3E9PA 4JKGB 3SBTA
chains in the Genus database with same CATH superfamily
5AQGA 3MN7A 3LPTA 3HI0A 4KH5A 1OVYA 4B1UB 3NF6A 3CCQN 1MK7B 4FM0A 1FKOA 1QVFM 4A59A 4K0KK 3FLVA 2QWRA 3WXIA 3S41A 1L3UA 1E3MA 1T05A 4ZTFA 3ENHA 1VQ4N 1QQNA 4FYDA 1IG8A 1QTMA 3U3YA 5KRTA 4DSEA 1XC3A 4YDUC 2PY5A 2O8EA 3CFOA 3WXJA 4BG9A 4JI7K 3SMPA 2Y1JA 4CZMA 3ZSRA 4HHTA 1VAZA 5AQTA 4JK8A 1S6PA 2IAJA 4CHQA 1YITN 4LSNA 1YXQA 4CFCA 4IKFA 3ID8A 1NGBA 5HL7L 1S6QA 3NH0A 3NVKA 2ITMA 3ATVA 3OYIA 1VQ8N 4JI8K 4A62A 4FJNA 4BR2A 1Y97A 3LWMA 5JVLA 3B6PA 4B9SA 4H0YB 3KLGA 3SBTA 3ZDTA 3RMCA 4KH6A 3VERA 3ISNC 1T03A 1SS6A 3MWPA 3MAQA 3VQBA 3VGLA 4CZLA 5C24A 5BREA 1P8ZA 2VG5A 3HZ6A 3O3FA 1VSKA 3L2WA 2G8HA 2P9UB 2D5RA 4DCHA 1VSFA 2XRIA 1GLEG 4KB1A 4LF6K 2P9SA 5FPEA 1JKHA 1NLVA 3ITHA 3O4QA 4NCGA 3NDKA 5FLXO 1GLCG 3QICA 1NK6A 1KC7A 1ASUA 1ACAA 1Q18A 1CXQA 4G9ZA 1SAZA 1OH7A 4BE2A 5J2PA 1NU0A 3OA9A 4JKEA 3KLEA 3VQQA 3LDNA 2FF6A 4GMJB 1MDUB 4KB0A 1WSGA 3QINA 3SMSA 1I3AA 1YJNN 3HM8A 1BQMA 3AAPA 4EKUA 3UE5A 4BR9A 3BDPA 3ZCMA 4IOAL 4CJSA 3LP2A 1BA1A 3HBTA 1SKRA 2LSNA 2D0OA 5M1QA 3S3MA 3SAHA 1LCUA 4EZ9A 4DFMA 2KKZA 1EX4A 2E2PA 1X9MA 3CC7N 2F8TA 1XUPO 4PQUA 3VQ9A 4WQ4C 5EVZA 3HPOA 2OCEA 2FDQA 4JK9A 3LDLA 4DV1K 3SNNA 4C8LA 1EWRA 4B9LA 1NKEA 3EZWA 4BRCA 4DUZK 4FW1A 1LWFA 4LY7A 4CIEA 1QQCA 4DF4A 4KTWA 3PX4A 1KBLA 4YOUA 1HX1A 4XH4A 1VQNN 5C0YA 3LL3A 1MK9B 4FLXA 1ZBHA 2X6NA 1C1CA 4JI2K 2E4LA 4CGGA 5E26A 4DV0K 4B3TK 2HHXA 4CYEA 4DTOA 3AA3A 3I56N 3N4QA 3CERA 4BRLA 1XNRK 4OPKA 4CHYA 1RGIA 1VSLA 3OYNA 1RFQA 3DRPA 4KHYA 1IH7A 1KFSA 1Z05A 4KKOA 2DFHA 3CJCA 3NHGA 2P9UA 4BR7A 1HKGA 3UKRB 3VN5A 2ZQBA 3HK2A 1K9MO 5FRNA 2P9LB 4DFKA 2YKMA 4FJKA 5ADXH 4CW7B 1LWCA 4L3QA 1R0AA 4B1XB 1OVQA 4I2PA 4DV4K 1CZ9A 1MWKA 1NJYA 2UUBK 3AO2A 3D2EB 1GOAA 5KQDA 1EF1A 5AQZA 4AH9A 2E8AA 2GELA 3CM6A 1FXXA 4FVMA 3D2FB 1WSFA 1YJWN 5GADP 1HKCA 3MWTA 1WLJA 3N4PA 2IIRA 4N41A 3QEXA 3R3LA 3K5NA 3C94A 4JD2B 3SI6A 3LDSA 4DR3K 4E7IA 2ZJPL 1KLNA 1VQKN 1X1PA 2EMSA 3T1HK 3SQ4A 1J54A 3JXUA 3B8AX 4CERA 3IFRA 4W5RA 3HPHA 3QFUA 5F2RA 5HP1A 1LOTB 4LC9B 4AM7A 4Q5VA 3ASMA 3MXJA 2RPIA 3TARA 3M8RA 4F2SA 1T6DA 3PSFA 1JLEA 4IDHA 1NMNA 1YTUA 3J7ZO 4CJFA 2QXFA 4C1NI 1HPZA 5C10A 1NGIA 1MU2A 2OA8A 3CCUN 5GIPA 2OPSA 3QEIA 4Z4CA 1REVA 3ZSWA 2FBVA 1TVRA 5BRDA 2UYTA 4DQRA 4ZRKA 1K6YA 5F0XA 2P9IA 3AO4A 2YCHA 3MN6A 1KSPA 3PIOL 3QBWA 1ZBIA 4RG8A 3G6EN 4WE1A 4BRQA 3QNOA 1RT4A 4IFEA 2BANA 3EZ5A 3KIOA 1L3SA 1U48A 1NMDA 2HHQA 3EE8A 4FWSA 1WSHA 4DMNA 2DPNA 1HJOA 4R79A 1NK5A 3O9UA 4CK2A 4AHUA 2P9LA 2O8BB 2Y1IA 5FPMA 3MCAB 4FCYA 3AA4A 4HUEA 3EPYA 3V9ZA 3CCRN 4GY2B 2UUAK 3O9TA 3T69A 2J4RA 4HUFA 3LWLA 4Z4HA 4CD1A 3J7AP 3SV3A 4QOZB 2YHXA 3L2QA 4BRNA 3TPQA 3TAGA 3C7NA 2D2QA 1JCEA 2DFFA 1BHLA 3D2FA 3WEEB 3L3UA 2NLXA 4YORA 3VF6A 3L3VA 1NGCA 4JD2A 3NGIA 4NO7A 4RW6A 3QIPA 3D45A 3PO4A 1S72N 4N47A 1GC7A 2HBKA 4M41A 1TK0A 1HB8A 3CQ8A 4WFBL 4DU3A 1FJGK 2OPPA 1X9WA 4B3SK 3LP0A 4CJQA 4K41A 4HDQA 1CXUA 3VGMA 4CJ4A 3K5OA 4IBNA 5LY3A 4HTUA 2OANA 4GV9A 4BDYA 1JDEA 4DS5A 4E1NA 2FJ9A 1MA9B 3NGZA 2G8WA 3ZX3A 4H0TB 4CEBA 4Y1DA 3D7EO 4LD0A 2P1JA 3VQ6A 1DEJA 3O80A 4IEIA 3DLGA 2XY7A 3MXIA 3CJ1A 1HR0K 3P39A 3G10A 4CE9A 2QTDA 1ITGA 1KC8O 4P7IA 3CC2N 1GLLO 3M5RA 3TAPA 4KRFA 2GV9A 2ZJRL 3RR8A 4Z94A 4CVNE 4QCLA 3BINA 1KVBA 5I42A 2QKKA 1YAGA 5AFUA 2ASMA 4JS4A 2VCPA 4W5OA 1DKGD 2V7YA 5HRPA 5AQWA 2KZZA 1Q7YO 4FWQA 1LWEA 3BF3A 3TSPA 1CZBA 4FJJA 1RDBA 4CEZA 3SAGA 2IS3A 2BTFA 4FWMA 1BUPA 4IOXA 4YOWA 2FLOA 1VBHA 4C1NK 4ISFA 3VQPA 3THWA 3MCPA 1ZBFA 4E7HA 2P9PB 4F3OA 3DMJA 3EKUA 2I1KA 5GAGP 3CMEN 1TYQA 1X9JA 3ZSVA 4W5QA 1HJRA 4FLVA 2YNIA 3VQCA 3DLKA 5M1KA 4KREA 3DLHA 3CQXA 1OH8A 5HRNA 2ZE2A 4CJTA 3ATUA 1GC6A 4BRGA 5C2FA 1C0UA 3C6TA 3PV8A 4ZRJA 1BOTO 2ASPA 3CCJN 2WBNA 2E2NA 4PKIA 5I9EB 2QK9A 1KVCA 5AQFA 1BIUA 4Z4IA 1VQPN 2P9KB 5ELZA 3OJSA 4MLHA 3B6OA 1JXBA 4LH4A 2OTJN 4AM6A 2NRTA 2QW9A 1WOQA 1U6ZA 4WF9L 3MX5A 4YY3K 1TKZA 4FLWA 1XI1A 2B4JA 1ATNA 2NRZA 5I3UA 4DR5K 2E1YA 4CFAA 3A2FA 1VSJA 3A0IX 3AVNA 4PA1A 3SUPA 3NF8A 3IG1A 3MEDA 3DLEA 2DTUA 1BL3A 1WN7A 4ISEA 3IMXA 5C15A 4C23A 2KZMA 3E9OA 1NJXA 2CB8A 1J9AA 1VSDA 1TV6A 3F2KA 1ZBUA 3H3OB 1GGOA 3CQYA 4F2RA 3O1WA 3TTDA 5M1FA 5C25A 4E3SA 2CH6A 2NRXA 3FZHA 3I8BA 4IFYA 3VQ8A 2HHVA 3QLHA 4E1MA 4BVPA 2GWJA 4OGCA 3J81O 1WBBA 4YFUA 4DFJA 2HHWA 4CCHA 1N32K 3NH1A 1VRTA 2HB5A 4GV3A 4NCBA 4DXAB 2P9PA 4JI5K 4CGDA 3RRHA 1HKBA 2HNDA 4IXCA 4CHOA 2VQFK 3K9KA 4FK4A 2YX6A 1S1VA 4IDKA 5LL6Z 1A5VA 4KO0A 3PVLA 5A2QO 2D10A 3DWLA 5KGWA 4L8RB 3DRSA 4X65K 3J8AA 3RTVA 4I6MB 3D6RA 2RHKA 4JI1K 1Q86O 3P38A 3LANA 4KTQA 2P9KA 1D8YA 3QIOA 3SBGA 5KPRA 4DS4A 4IJAA 4NB4A 2HMIA 4FJ7A 5LJVA 4FJ5A 2KLAA 3NF9A 2A42A 3P5JA 4OGEA 5LMUK 2I1JA 3OYFA 1Q9YA 3I33A 1BWFO 2LBBA 2CGLA 4GXBA 4FXDA 4AHCA 3V9WA 1SZ2A 2QWQA 3SQ0A 4IO8A 2AA4A 2V7ZA 1B9FA 5AZIA 1O13A 4FLYA 3S9HA 3RMBA 1JLCA 4UQGA 5JLFA 3U6FA 1TL1A 4DR2K 3SPYA 3WNFA 2WOMA 2ETJA 5EXWA 2Z1IA 3U4LA 3ZSQA 2VGMA 1X3MA 4ELUA 4M3TA 1NGGA 1WSIA 2IVOA 1XQSC 1KQSM 4FWKA 5GAEP 3EE9A 1N8RO 3O4WA 3F9MA 5M1NA 1NKCA 3KK2A 1RDAA 5JLHA 2B5JA 1TKDA 4YOTA 4QS9A 3L4QA 3OBWA 2EWSA 4O55A 2P5OA 4B3RK 1BGXT 2D1KA 4KPYA 1C1AA 3AV9A 1U49A 3DLLL 1KFDA 4DFPA 3WT0A 3AVIA 3RWUA 3OYGA 4BRKA 4QAGA 2Z1JA 3DJCA 4A2AA 3NGYA 4CEEA 4LF9K 1JLAA 1C0GA 3KWGA 5SWMA 3T1YK 2HOEA 1U4BA 3U3GA 3TTCA 3HVRA 4XIUA 3NCIA 1KXPA 4I6MA 3I0RA 3EEQA 3H45C 2F4VK 4MFBA 2HHUA 4CIGA 5AQRA 1N34K 1TUYA 4PHTX 3KVGA 5CR4A 2R7YA 3C6HA 1DT9A 4K25A 4YOVA 3THXB 2HBMA 4CEFA 3V1OA 1NG9A 4BRDA 4R5PA 4CZJA 2PZSA 1NGDA 4B9VA 2ZWHA 3T1AA 3VQDA 2VQEK 5AQNA 3G25A 1T7PA 4IZ9A 1UOCA 3HYFA 3Q7CA 3LPUA 1EKEA 3ULEA 1GOCA 4CJKA 1J5OA 2GTDA 4JRPA 4BE1A 2GBZA 1HQUA 2ABDA 3E1YA 1RBTA 1NJZA 1KAYA 1JCFA 3M8SA 4IO9L 1VQON 3KHYA 3C6UA 2IGIA 3H6EA 3F73A 4BVOA 4CI6A 1HYZA 5C12A 3CJ7A 4ID5A 4KV8A 4BRIA 1QZ5A 2PAVA 3VA3A 3HXMA 1E4FT 3ZSYA 2OZMA 3NE6A 5C2DA 5J2QA 4WQ5C 4JI6K 4JKGA 4OO1J 3A5LC 1IBLK 4DR7K 2GWKA 2JWKA 4HCBA 4H0XB 1NVLA 3R9PA 3GBTA 4M63C 1XMOK 1GG3A 3BZKA 4BGAA 2V52B 1NGJA 4K42A 1OH5A 2ITGA 4I9LA 3VQAA 2RQ1A 4B9MA 2HF3A 2P5GA 3FP5A 3VGKA 1WB9A 3QFPA 1DIKA 1RDDA 3NFAA 2E20A 5AFUH 1QE1A 1ZYQA 2P9IB 5DM6L 3EYZA 1Y64A 1TK5A 1C0TA 4MDAA 3CCMN 3V81A 4ELTA 3TAMA 2ZF5O 2HHTA 1S5JA 1BI4A 1A5XA 2UU9K 3BEXA 3HTVA 3THXA 3DLBA 4JRQA 4DV5K 1L3VA 4AHSA 3PX0A 3FE1A 4MQ3A 4CF1A 2A1RA 5CYMA 3PO5A 2AL6A 2OYQA 4OKEA 4Z4EA 3MEEA 4JEPA 1UA1A 4M7YA 4K8XA 3S3NA 2FF3B 3OY9A 2KQ2A 4M3UA 2HRJA 1L3TA 1ZBSA 3KJVA 2QKBA 3CYMA 2D0BA 3WXMB 3C7NB 1VSMA 1K8AO 3OJUA 2NRHA 1RT6A 4J2BA 1HPMA 4NXMK 3VF4A 1GLDG 4AQYK 4KH4A 4FWRA 4FLUA 4AILC 3AVCA 3JYTA 3GL1A 4CEAA 4KHUA 4ELVA 4HDOA 4DQQA 4MO4A 3C65A 4CBWA 4J2EA 1ZXOA 3KK1A 1VRUA 3NAEA 3KWIA 4BRPA 3BY5A 3IAYA 1S1XA 3LM2A 5KPTA 3VOVA 1Z25A 4F9OA 3DLRA 2KW4A 1YIJN 4BC2A 1ZC6A 4B8CA 4BR4A 2E88A 3FFKB 3FZFA 4BDPA 1Q81O 3MN5A 1NGHA 1EXQA 4TSXA 3SCXA 2DY4A 3TR8A 1BU6O 1NK8A 2A41A 4EHTA 4J2DA 3UKUA 3WNEA 3RMAA 4Y1CA 2G8IA 1Q9XA 4RTFD 1KTQA 3E01A 3VENA 3LZJA 4LFBK 3O8MA 1H4RA 1IKVA 3LDOA 3KD1E 5AQJA 4U7BA 4PL8A 2PYJA 3ZX0A 2Q31A 4M42A 4DSKA 4ZRIA 3WQUA 3V9XA 4RW4A 2FSJA 2E6MA 4GVEA 4JI3K 5KI6A 4YDUA 1M1KO 1IG9A 1B92A 3F9KA 3LZIA 3K57A 1BCOA 1NM1A 3G9WA 4J8FA 4XEIA 4H5VA 4C8NA 4JKDA 1VBGA 1QS4A 4O44A 4A61A 1T8EA 3K2PA 4BDZA 3ZSZA 4JKBA 5AQUA 3GOIA 2CQUA 3QESA 4LF8K 5CHIA 3QETA 1I39A 4BC5A 4N56A 2EX3A 4IWVA 2G8FA 5CE3A 4DTMA 4GW6A 1ST7A 1GLAG 3ZX2A 1VK0A 4CF0A 4X62K 2J0JA 5IWAK 3THWB 3NH2A 4NCAA 2QWPA 2XO7A 1RDWX 4BGBA 4X64K 2OPRA 2J0MA 1VQLN 1HYSA 1TYQB 3A8YA 1KLMA 3DYAA 4XH1A 3CM5A 2HVHA 5FROA 2YJEA 1EO1A 4YOYA 1RCHA 5D3GA 3AVHA 4CJEA 3VMFB 5HROA 3AO5A 5CZ1A 2X6SA 1MIXA 4DTJA 4FW2A 1YVNA 4CIFA 2QWNA 3TI0A 4U67L 4CFBA 1K8KB 2E2OA 2FC0A 5M1OA 3V4IA 2HSTA 3V1QA 2YNFA 1SL1A 3IS9A 4C8OA 1RT2A 3VEOA 3U8ZA 3DI6A 3U8XA 3OYCA 3LP1A 2WH5A 4CJUA 2COPA 4AHVA 4F7GA 1NJWA 4DV7K 1K73O 4NY0A 4FPAA 2NUBA 4DU1A 5GINA 3QBXA 3H3NO 1JLGA 5KTQA 2I5JA 1YHQN 4CGHA 5AQVA 4GKJK 1BQNA 4BC3A 3WXLA 2X78A 1LAWA 1ZBLA 3L6QA 4H5WA 5CYQA 1HRHA 5HLFA 3Q7BA 3OS2A 5TKWA 3VTIA 4CFDA 3AVKA 4DSJA 3CIPA 4BREA 2VWJA 3TAFA 3W3DA 5AQIA 4EP4A 2HBJA 1NNEA 2WC9A 4DUYK 4GV6A 1YT3A 3THVA 3O9RA 1VQ6N 1EQYA 4KHSA 3V9SA 3H08A 2V51B 1C1BA 1J53A 4CGIA 4DQ8A 5J2MA 2Q2RA 2VYPA 2ZM6K 2W6KA 3ZSXA 4CD3A 3K5LA 1RT7A 2YHWA 4J2AA 4H4OA 3O4NA 1RTJA 4E1JA 5BRFA 3VTHA 1TAUA 1HBKA 1IV0A 3CPEA 2IC3A 3SUNA 1ATRA 3OYKA 1RBRA 4CZIA 3K58A 4HCCA 3VQ5A 2XHBA 2BDPA 4JYAK 4ISGA 1NGAA 4FM2A 1QQOA 3ENOA 5ADXA 3VPZA 2NRVA 1S9GA 4N5SA 1BIZA 3MDQA 1V4SA 1K8KA 1NK9A 1N6QA 2A3ZA 4O8UA 2W42A 4DSFA 2HW3A 4NYFA 4O5BA 5E84A 2XY5A 4O0IA 3AARA 1JJ2M 4KHPK 4NLBA 5AQMA 1SGHA 4H0VB 4CBUA 4B08A 3OYAA 4DU4A 4V19S 3V9UA 4UY8O 4ZHRA 1HYVA 1S9EA 4OPAA 4AHTA 3BF1A 4Q0BA 1Z26A 4FJIA 3OVNA 5JICA 2E1ZA 4DLGA 3M1FA 4M3RA 4JV5K 3T19A 2JLEA 3D0PA 5KRSA 3K5MA 2Q97A 1WSJA 1NOYA 3H1QA 5AZIB 2HF4A 2B6AA 2VG7A 4M7XA 3C6AA 1OH6A 2W40A 2QXLA 3OYBA 4H4MA 4H03B 5IJMA 2ZGZA 4FL9A 3IKMA 1W0HA 3QNNA 1D4XA 2CH5A 5BRHA 4OX9K 1XNQK 5DMRA 1G99A 4OKJA 4DF8A 1VSHA 3ZT4A 2KTQA 3AO1A 3K59A 3TTFA 3PX6A 1NJIO 2NZTA 1ATSA 3CG7A 1IBKK 1D5AA 1WBDA 3DOKA 1KRPA 4BRHA 3MX2A 1NTIA 4CK1A 1JL2A 3SV4A 1Q82O 2R82A 3KK7A 4B9TA 2JWLA 1QSSA 1N33K 1NI2A 3IVFA 1RBVA 3R6MA 3HT3A 1RDCA 4H8KA 3VEXA 5CY4A 5AQPA 4Z0UA 3M3ZA 3WNHA 3G4SN 4CBXA 2WUSA 3MN9A 3AO3A 3KLHA 3MK6A 4GNIA 1N5YA 4LF4K 4I2QA 1T3VA 1ISNA 3VQ7A 2YHBA 3EO3A 4O0JA 2OZSA 1VSIA 5GAHP 1GLBG 1OKJA 1HNWK 3KKSA 2PBDA 2BUPA 4B3OA 1D9DA 2HMPA 3AA5X 4ILGB 4ID1A 1JLQA 4RW9A 1JL1A 3J7YP 3ZETB 2HHHK 4FSVA 4W5TA 4F8RA 3TU5A 5JVHL 4GVMA 4CEQA 1RTIA 4KHWA 5LJWA 3FZMA 2F96A 2YI1A 3VQEA 1KD1O 3K9JA 3TSQA 1SL0A 3ULEB 1QHTA 2HHSA 1DTQA 3FLCO 4FWNA 3AVLA 3VQ4A 3KK3A 4E19A 4DR1K 4W5NA 2FXUA 5E41A 2HNYA 1MIZB 4DTUA 4CJ5A 4CECA 4M3XA 3W0LA 4H5TA 2CGKA 1DLOA 1A5WA 4FLTA 3CJ9A 4I9QA 2IVPA 3AA2A 2VWKA 4WCEL 3ID6A 3S3OA 4JKGB 2FBXA 1TGOA 5AJ3K 2D0CA 1NOZA 3LM9A 5EX5A 3H1VX 1LAVA 3JS6A 3O3GA 3GDQA 3OS1A 5HRRA 1RT3A 3RVCA 2NRRA 5CZ2A 5JMVA 1C0MA 2YNGA 3CCLN 4PY5A 3LDQA 4QS8A 3HVTA 4PL7A 3DOLA 3C95A 5JVGL 4B3MK 5EOYA 5AZJB 1NGEA 4CF2A 1YTAA 1UWBA 3ZEUA 3SUQA 4CJVA 4NLCA 2E5LK 2IDOA 3QDKA 4JKFA 3K0SA 4DTPA 4NYNA 1VSEA 3EN9A 4FJHA 2G8KA 3ZETA 1TKXA 1E5WA 1BI4B 4ILHA 2A1SA 4YHHK 2HE7A 3OBYA 1HNXK 3DXMA 1YUWA 4CJLA 1JXEA 3KLFA 4F4KA 2O8DB 2I7NA 4RW7A 4LH5A 5AQKA 4FOIA 4F3TA 5AQXA 3VEVA 3HP6A 1QSYA 3IDHA 1BCMA 2QWOA 3L2VA 5MLCQ 3BZCA 4AHRA 2WFBA 3CJBA 1IKYA 4BY9C 1U04A 4FZXC 3E66A 4M3WA 4BWJA 5AQYA 1EETA 4CJ7A 3HOTA 2F7TA 4KI6A 4CZGA 1DTTA 4DKWA 4IG0A 1NK0A 4KAZA 3J80O 1EWQA 2VGNA 4EP5A 4HUGA 4OPHA 1NGFA 3VF2A 4KHNA 5AQOA 4DTXA 1ASVA 2GX9A 5J1EA 1I94K 4OLBA 2Q36A 3AVAA 4BRFA 2YKNA 4DTRA 5K14A 1WAFA 4O4GA 1CLQA 1TUUA 4FJXA 1RT5A 3L0QA 4CZFA 2NNWA 4TKNA 3O6WA 2O4IA 2F9WA 3SJJA 2WONA 3EKSA 2DIKA 3P31A 1G15A 1SUQA 2ZJQL 3QO9A 2F8SA 4HVJA 4BRAA 1JLFA 2YNHA 3FR0A 4LF7K 1S22A 3ZT2A 4X66K 3HPGA 4LF5K 2I7PA 2Z1HA 3KZBA 4CESA 1SKWA 2XY6A 3PUFA 4CJWA 5GIOA 4OPJA 4DV2K 5AR0A 3NBPA 4JLHA 1LW2A 5AZJA 2W6LA 1U45A 3UKUB 2A6AA 3LDPA 1GLFO 1HNVA 3R8EA 3IRXA 3OTOK 1QQMA 2RF2A 3P83D 4FOEA 3OYEA 4E7KA 5TKYA 5JS2A 5KGXA 1RTHA 3M8QA 5BR9A 5AQQA 3HJFA 3KKRA 1V4TA 2GEMA 2O8DA 3CHWA 4B1YB 1FW6A 4CZEA 1DGKN 5FDLA 4ZTJA 3WQTA 4PWDA 1HMVA 3T3FA 1RNHA 4IJNA 1UAXA 4DQPA 5DK5A 1XHXA 2Q1NA 4OJRA 4DSIA 1JLBA 4DR4K 4JNEA 1KAZA 2AP1A 4CGFA 1X9SA 3I0SA 1IO2A 3A5OC 4DR6K 3EL2A 3CF5L 3HM9A 2O4GA 4IEEA 3U7DA 4KHQA 4FPBA 3FGUA 2KHOA 4FWPA 3JAMO 2QWMA 1FK9A 4JN4A 3BUZB 2A40A 4JI4K 4O5FA 3KLIA 2NRWA 4FWOA 1Q8IA 2ATQA 2PYLA 1BISA 4DTNA 2X0SA 1TAQA 3TAQA 4Z4GA 4M3YA 3AVFA 3AVMA 1XHZA 3SAFA 1QSLA 3IUCA 3NF7A 4HWIA 1XWLA 1ASWA 4B9UA 3AGRA 2FSKA 1H1VA 2ZD1A 4KBOA 3O08A 2GUIA 3EY1A 3UB5A 4JS5A 5BPMA 2YJFA 3AU4A 2YHYA 3CI5A 3CETA 2F9TA 3C0BA 4H0OA 3U9ZA 3MXMA 3RSEB 1HLUA 4BR0A 5AQLA 4M45A 3NMUA 5BN8A 4GKKK 5F1XA 4CHZA 3VETA 1RTDA 4EZ6A 3TANA 2RKIA 3HO1A 1NK4A 3LP3A 3L4IA 1WAJA 3QERA 2O8FB 1SKSA 1HB6A 4E89A 3QB0A 4A57A 4A5AA 3SQ1A 1BO5O 1VQ7N 3VESA 4CF9A 4IG3A 4B1WB 3QIJA 4KFBA 3LAKA 2KFZA 4DWIA 1T44A 4FO0A 1O1WA 3HP9A 4BC4A 3MECA 4JKHA 3SPZA 4FJLA 3SYZA 1QHAA 1VHXA 1M90O 1RDUA 5KPZA 2E6LA 4CJPA 4BACA 3L8BA 5BPNA 1NK7A 1NWKA 3PY8A 2Q3SA 1IJJA 3M6GA 2DFEA 3O5BA 2A5XA 4B9QA 3UKRA 3KTQA 4DTSA 4CJ3A 3ULDA 1BA0A 2GUPA 5BR8K 4WFAL 4IFVA 1SV5A 4PKGA 2QA4N 1NKBA 3H46O 3HSCA 3D2EA 2ASOA 3TSUA 1CZAN 4RWTA 3HSTB 3CCVN 1W9HA 2O8CB 5M1PA 4DV6K 3O3HA 3L2RA 5EY4A 3WA0A 1ESVA 4DLEA 4FK2A 4AF1A 4FZZA 4BQLA 3E9PA 3AY9A 3DM2A 3GE1A 3CMAN 4PUOA 3X23A 3FZKA 4DHYA 1YF5L 1T6CA 4ICLA 2AEHA 4FZYA 3KD5E 4JKAA 4I7FA 2WTUA 1W2BM 4CF8A 4A5BA 4JI0K 3PIPL 1IBMK 3RSEA 3CC4N 3HOSA 1E4GT 3ZT1A 2UUCK 3BP8A 4CEDA 2RN2A 4G1QA 1N36K 3SJHA 4B1VA 4H0PA 2O8FA 4CJRA 4Z4FA 2BE2A 3L2UA 3P1GA 4WYBA 3CJAA 3LAMA 3CPWM 3RR7A 4XH5A 5BPLA 2KFNA 2EMTA 1MWMA 1TL3A 3HRGA 2ZPYA 3CCEN 3O9SA 4BG8A 2H3GX 1BDGA 2X74A 4EHUA 4WQ5A 4FJGA 1WSEA 4CGJA 3GG4A 3THYB 3U9DA 3MEGA 1D9FA 4WQ4A 4BROA 5LMNK 3ZT0A 4H5RA 4OLAA 5AQSA 4DV3K 2ZGYA 3WNGA 1RBUA 4FWLA 5C42A 4ILJA 2O8BA 1S3XA 4KTZA 2E2QA 3FFIA 3ZLJA 2D11A 4WFNL 2Q0RA 3SK3A 3QEVA 2YV0X 1KAXA 1YJ9N 4EIAA 2Z1GA 1TKTA 5FPDA 2O8CA 5H1SQ 3QEWA 4K8ZA 1P90A 2EHGA 4CHPA 1SL2A 2VWBA 1WUAA 1FKPA 1RT1A 2D0PA 1XC9A 5FRMA 3WEEA 4FM1A 1U47A 4JHDB 1IKWA 1RBSA 4HTLA 2P51A 3E9LA 4BE0A 4FVUA 3DAWA 3WUHA 3RRGA 2YHAA 2D0AA 2W41A 1C0FA 1R59O 3O1BA 4LSLA 3R1XA 1EP4A 3VEZA 4CZHA 3PLAA 1SQKA 3V6DA 1J19A 4YL8A 4FJ8A 1YI2N 4OVLA 3WXKA 4YOXA 4E7JA 2QM1A 4B9NA 4PKHA 3I55N 3A5NC 4C8MA 1JCGA 1ILYA 4DB3A 3OHRA 3OS0A 5DM7L 3VA0A 1IKXA 3RMDA 1HNZK 4LFAK 3TAEA 4B1ZA 2OPQA 1S1UA 2P9NB 3CXCM 1HQEA 5FPNA 5HRSA 3AVBA 3DXKB 2BGGA 4FLZA 4FK0A 4JK7A 4CEOA 4EAHD 1BG3A 4LFCK 4DQIA 3HL8A 3OYLA 4FJMA 2UXBK 2Q0UA 4CK3A 5J2NA 3DRRA 3THYA 1J5EK 3ENBA 5KQ8A 1U2VB 4H5NA 4O8KA 4B8AB 1XMQK 3QEPA 3NVMA 5IT9O 4A2BA 3OYHA 3TWHA 2OTLN 5BN9A 5T7BA 1L5UA 4RCHA 4BRMA 1S1WA 4N76A 2QEXN 1Z6RA 3V1RA 3AVGA 5HOOA 3T7ZA 4FJ9A 2IOCA 3LALA 3SQ2A 3AGKA 4E0DA 4CZKA 2QWLA 1LV5A 3JSMA 4BWMA 1KCFA 4JKCA 3TABA 2PFUA 4Y0WA 3G71N 3ZT3A 4K43A 1KVAA 1UA0A 3PSIA 3AU5A 5AQHA 2UXCK 5SZTA 1WNSA 4C8KA 4JHDA 1RILA 3ZYYX 1GOBA 3CD6N 1J6ZA 2O8EB 2XY8A 3CCSN 4DQSA 1X3NA 4RW8A 3SZ2A 2QI2A 3ZEUB 2UXDK 3UIQA 2YVCA 4OKKA 3M8PA 1F21A 3CFRA 3QMLA 4KI4A 2IVNA 2AJQA 2HNZA 4IOCL 4MO5A 3CFPA 3PZDA 3G0ZA 4QS7A 3FZLA 2P9NA 2RE2A 4BR5A 1VQMN 3DXMB 3DXKA 5EU7A 4BQZA 1C6VA 3AVJA 4MDBA 3OYJA 3VEWA 2BH1A 1QVGM 1HNIA 1VQ5N 2VG6A 3VEYA 3OW2M 2FBTA 2FSNA 3AAQA 5HBMA 4CHNA 4E7LA 3SUOA 3P4IA 1LW0A 2JGUA 4MLEA 3BGRA 3I8DA 2HVIA 4JAXA 5B8HA 4DSLA 3OYMA 4M3ZA 5JS1A 2G8UA 2G8VA 1NBWA 1U2VA 1YVUA 4NXNK 3F5TA 2CGJA 2P9SB 3OYDA 2J0KA 2FBYA 1HUXA 1GLJO 4EFHA 1VQ9N 3SLCA 4YNQA 2HBLA 1S1TA 2D4WA 3ZSOA 1QZ6A 3MMVA 1B9DA 1TK8A 1W7AA 3A5MC 4DG1A 1Y19B 1W97L 3O9QA 3ALYA
chains in the Genus database with same CATH topology
5AQGA 1VQPN 2P9KB 5ELZA 2GEMA 3MN7A 3HI0A 2J0JA 4KH5A 4MLHA 1OVYA 4B1UB 3CCQN 2OTJN 2QWPA 1MK7B 4AM6A 2NRTA 2QW9A 3CHWA 1WOQA 1U6ZA 4B1YB 3MX5A 4A59A 4WF9L 1RDWX 3FLVA 4BGBA 1QVFM 1VQLN 2J0MA 2QWRA 1ATNA 1DGKN 2NRZA 3S41A 3WXIA 4CZEA 2E1YA 3WQTA 1TYQB 3ENHA 3A0IX 4IJNA 3A8YA 4XH1A 1VQ4N 1QQNA 1IG8A 2YJEA 1EO1A 2Q1NA 1XC3A 4YDUC 4YOYA 3WXJA 4JNEA 4BG9A 1KAZA 3SMPA 4CZMA 1VAZA 5AQTA 2AP1A 3VMFB 4JK8A 1YITN 1MIXA 1YXQA 1YVNA 4ISEA 3IMXA 5C15A 3A5OC 4C23A 3EL2A 2QWNA 3CF5L 3ID8A 1NGBA 5HL7L 3E9OA 4U67L 2CB8A 4IEEA 3U7DA 1K8KB 2E2OA 5M1OA 3F2KA 2HSTA 4FPBA 3FGUA 3NVKA 3H3OB 1GGOA 3CQYA 3ATVA 2KHOA 3O1WA 2ITMA 4FWPA 3TTDA 2QWMA 5M1FA 1VQ8N 4JN4A 2CH6A 2NRXA 3BUZB 3FZHA 3U8ZA 3VEOA 3U8XA 3I8BA 2A40A 4A62A 4BR2A 4O5FA 5JVLA 2NRWA 2WH5A 4BVPA 4FWOA 2COPA 2GWJA 4H0YB 2X0SA 3SBTA 3ZDTA 4F7GA 1K73O 4NY0A 4KH6A 4FPAA 3VERA 1SS6A 3SAFA 5GINA 3MWPA 3IUCA 3QBXA 4HWIA 3H3NO 3VGLA 4CZLA 3AGRA 1YHQN 2FSKA 5BREA 4GV3A 5AQVA 1P8ZA 1H1VA 4DXAB 2P9PA 3HZ6A 4KBOA 1HKBA 3O08A 4BC3A 4IXCA 3WXLA 2P9UB 3L6QA 4H5WA 3UB5A 4DCHA 1GLEG 5BPMA 2YJFA 2P9SA 3K9KA 3AU4A 5FPEA 1NLVA 3Q7BA 2YHYA 5TKWA 3VTIA 3CI5A 1GLCG 3CETA 3QICA 2YX6A 1KC7A 1ACAA 2F9TA 3C0BA 1Q18A 4H0OA 3CIPA 3U9ZA 4BREA 4G9ZA 1SAZA 3W3DA 3PVLA 3RSEB 5AQIA 2D10A 1HLUA 3DWLA 4BR0A 5AQLA 3NMUA 2HBJA 3OA9A 5BN8A 4JKEA 5F1XA 3VETA 3J8AA 2WC9A 3LDNA 2FF6A 4I6MB 4GV6A 1MDUB 3SMSA 3D6RA 2RHKA 3L4IA 1Q86O 3O9RA 1VQ6N 3P38A 1YJNN 1EQYA 1HB6A 2P9KA 3HM8A 3QB0A 3AAPA 2V51B 4A5AA 4A57A 4EKUA 3SBGA 1BO5O 3UE5A 4IJAA 3VESA 4NB4A 4BR9A 4DQ8A 5KPRA 1VQ7N 2Q2RA 3QIJA 1BA1A 2KLAA 4B1WB 5LJVA 2A42A 3HBTA 2VYPA 4CD3A 2D0OA 5M1QA 1T44A 4FO0A 2YHWA 4BC4A 4JKHA 4E1JA 5BRFA 3SAHA 1LCUA 1QHAA 3VTHA 2I1JA 1HBKA 1M90O 1RDUA 2KKZA 2E2PA 3CPEA 3I33A 5KPZA 3CC7N 1XUPO 1ATRA 1BWFO 2LBBA 2CGLA 4CZIA 4GXBA 5BPNA 4WQ4C 5EVZA 1NWKA 2FDQA 1SZ2A 4JK9A 2QWQA 3LDLA 4IO8A 2AA4A 2V7ZA 1IJJA 3EZWA 4ISGA 4BRCA 1NGAA 3M6GA 3O5BA 1QQOA 5AZIA 1O13A 2A5XA 4B9QA 3ENOA 3UKRA 3VPZA 2NRVA 5ADXA 5JLFA 1KBLA 3MDQA 1BA0A 2GUPA 4WFAL 1V4SA 4YOUA 1K8KA 1HX1A 5EXWA 3U4LA 2VGMA 1X3MA 2A3ZA 4O8UA 4XH4A 1VQNN 5C0YA 4PKGA 1NGGA 3LL3A 2QA4N 1MK9B 3H46O 3HSCA 2IVOA 3D2EA 1XQSC 2ASOA 5E84A 3TSUA 5E26A 1CZAN 4RWTA 3AARA 4FWKA 3EE9A 5GAEP 3CCVN 1JJ2M 4NLBA 1KQSM 5AQMA 1SGHA 5M1PA 1N8RO 4CYEA 5EY4A 4H0VB 4CBUA 3WA0A 1ESVA 3O4WA 3F9MA 5M1NA 4UY8O 3I56N 4AF1A 3N4QA 3CERA 4OPAA 4BQLA 4BRLA 5JLHA 3BF1A 3E9PA 4YOTA 5JICA 2E1ZA 3L4QA 1RGIA 3OBWA 2EWSA 4QS9A 3AY9A 5C2FA 1RFQA 3GE1A 3M1FA 3CMAN 3X23A 1Z05A 3FZKA 2D1KA 2Q97A 4DHYA 1YF5L 3H1QA 3CJCA 2HF4A 5AZIB 1T6CA 3DLLL 2P9UA 2AEHA 4BR7A 1HKGA 3UKRB 3WT0A 4M7XA 3C6AA 2W40A 2QXLA 1K9MO 4JKAA 4H03B 5IJMA 2P9LB 2ZGZA 4FL9A 1W2BM 5ADXH 3IKMA 4L3QA 4BRKA 4B1XB 4A5BA 1D4XA 1MWKA 2CH5A 3DJCA 4A2AA 3PIPL 5BRHA 1C0GA 3RSEA 3CC4N 3KWGA 3HOSA 1E4GT 1G99A 2HOEA 3D2EB 5KQDA 3TTCA 3BP8A 1EF1A 5AQZA 3TTFA 1NJIO 1KXPA 2NZTA 4I6MA 1ATSA 2E8AA 3H45C 3SJHA 4B1VA 4H0PA 4BRHA 5AQRA 2GELA 1TUYA 1NTIA 3MX2A 3KVGA 4PHTX 3D2FB 5CR4A 1Q82O 2R82A 3C6HA 1DT9A 3CJAA 3KK7A 4K25A 4WYBA 2JWLA 3CPWM 1YJWN 4XH5A 5BPLA 5GADP 1HKCA 2EMTA 1MWMA 3MWTA 1NI2A 3HRGA 2ZPYA 3N4PA 3IVFA 2IIRA 4YOVA 2HBMA 3CCEN 3O9SA 3R6MA 4BG8A 2H3GX 1BDGA 3R3LA 4EHUA 4BRDA 3VEXA 5AQPA 4JD2B 4WQ5A 4CZJA 1NGDA 3GG4A 3U9DA 3M3ZA 2ZWHA 2ZJPL 1VQKN 4WQ4A 2EMSA 5AQNA 4BROA 4CBXA 3JXUA 3G25A 2WUSA 3B8AX 3G4SN 4IZ9A 3IFRA 3MN9A 3Q7CA 3QFUA 5F2RA 4H5RA 1LOTB 5AQSA 3MK6A 4GNIA 3ULEA 1T3VA 1ISNA 4LC9B 4AM7A 3EO3A 2ZGYA 2GTDA 5GAHP 1T6DA 1GLBG 1OKJA 4FWLA 4IDHA 4ILJA 3J7ZO 2PBDA 2ABDA 3E1YA 2BUPA 1KAYA 1S3XA 4C1NI 2HMPA 1JCFA 4IO9L 5C10A 2E2QA 1NGIA 1VQON 3KHYA 2D11A 4WFNL 2Q0RA 4ILGB 3SK3A 5GIPA 3CCUN 3ZETB 1KAXA 1YJ9N 3H6EA 4FSVA 4BVOA 4EIAA 5BRDA 2UYTA 4CI6A 4ZRKA 5C12A 3CJ7A 3TU5A 5F0XA 5FPDA 5JVHL 4BRIA 1QZ5A 2PAVA 5H1SQ 2P9IA 5LJWA 1E4FT 1P90A 2YCHA 3FZMA 3MN6A 2YI1A 3PIOL 2VWBA 5C2DA 1WUAA 3QBWA 2D0PA 4WQ5C 4JKGA 1KD1O 3K9JA 4OO1J 3G6EN 3TSQA 3WEEA 3A5LC 4JHDB 4BRQA 4HTLA 3E9LA 2GWKA 2JWKA 3ULEB 4FVUA 3DAWA 4H0XB 4IFEA 3WUHA 1NVLA 3R9PA 3FLCO 4FWNA 1NMDA 2W41A 3GBTA 3EE8A 1C0FA 4FWSA 4M63C 1R59O 1GG3A 3O1BA 4BGAA 3R1XA 3VEZA 4CZHA 3PLAA 2V52B 2DPNA 1NGJA 1HJOA 4K42A 1SQKA 4R79A 3O9UA 1J19A 2FXUA 2P9LA 4YL8A 1YI2N 5FPMA 3MCAB 2RQ1A 1MIZB 3WXKA 3EPYA 2QM1A 4YOXA 3CCRN 2HF3A 4PKHA 3A5NC 3W0LA 3I55N 1JCGA 4GY2B 4DB3A 3O9TA 3OHRA 1ILYA 4H5TA 3T69A 5DM7L 3FP5A 2CGKA 3VGKA 2J4RA 3QFPA 4B1ZA 1DIKA 2P9NB 3CXCM 4CD1A 2E20A 5AFUH 2YHXA 3CJ9A 2P9IB 5FPNA 5DM6L 3DXKB 2IVPA 4BRNA 1Y64A 3TPQA 4JK7A 3C7NA 2D2QA 4EAHD 1JCEA 4MDAA 1BG3A 3ID6A 4WCEL 3CCMN 4JKGB 3D2FA 2ZF5O 3WEEB 3BEXA 3LM9A 2NLXA 5EX5A 3H1VX 3HTVA 4YORA 3VF6A 2Q0UA 3JS6A 1NGCA 3GDQA 4JD2A 4NO7A 3FE1A 3ENBA 3RVCA 2NRRA 1S72N 5KQ8A 1U2VB 1GC7A 2AL6A 2HBKA 5JMVA 3CCLN 4H5NA 4O8KA 3LDQA 1HB8A 4JEPA 4M7YA 4QS8A 4PL7A 4WFBL 2FF3B 5JVGL 3NVMA 5EOYA 5AZJB 2HRJA 1NGEA 4A2BA 1ZBSA 2OTLN 5BN9A 3ZEUA 4K41A 4RCHA 4BRMA 4HDQA 3VGMA 3WXMB 4NLCA 2QEXN 1Z6RA 3QDKA 4JKFA 5LY3A 3C7NB 1K8AO 5HOOA 3T7ZA 2OANA 2NRHA 3EN9A 1HPMA 4GV9A 3VF4A 3ZETA 1E5WA 1JDEA 1GLDG 4ILHA 4KH4A 3AGKA 4FWRA 4CZKA 2QWLA 2HE7A 3OBYA 3GL1A 3DXMA 2FJ9A 1MA9B 1YUWA 4JKCA 2I7NA 2PFUA 4HDOA 4Y0WA 5AQKA 4FOIA 3ZX3A 4H0TB 4K43A 3G71N 4MO4A 5AQXA 3VEVA 3C65A 3IDHA 3D7EO 3AU5A 4CBWA 1ZXOA 5AQHA 2QWOA 5MLCQ 2WFBA 3CJBA 1DEJA 4JHDA 3O80A 4IEIA 4BY9C 3E66A 3KWIA 5AQYA 4BRPA 4CJ7A 3ZYYX 3HOTA 3CD6N 2F7TA 1J6ZA 3CJ1A 3P39A 4CZGA 4DKWA 3CCSN 3LM2A 2QTDA 5KPTA 3VOVA 1X3NA 1KC8O 4P7IA 3CC2N 1GLLO 3M5RA 4F9OA 2QI2A 3ZEUB 2VGNA 1YIJN 4BC2A 2ZJRL 1ZC6A 2YVCA 4OPHA 1NGFA 3VF2A 4BR4A 2E88A 4Z94A 3QMLA 3FFKB 5AQOA 3FZFA 2GX9A 2IVNA 1Q81O 3BINA 3MN5A 4IOCL 1NGHA 1YAGA 4MO5A 5AFUA 3PZDA 2ASMA 4QS7A 2Q36A 1BU6O 2VCPA 3FZLA 4BRFA 2A41A 2P9NA 4EHTA 2RE2A 1DKGD 3UKUA 2V7YA 4BR5A 5AQWA 3DXMB 1VQMN 4RTFD 1Q7YO 1TUUA 4FWQA 3DXKA 4BQZA 3BF3A 3L0QA 3TSPA 4CZFA 2NNWA 4TKNA 4MDBA 3O6WA 3VEWA 2F9WA 3VENA 2BH1A 3SAGA 1QVGM 3EKSA 1VQ5N 2DIKA 2BTFA 3P31A 3VEYA 4FWMA 3OW2M 2FSNA 3AAQA 1BUPA 3O8MA 4IOXA 2FLOA 1H4RA 4YOWA 2ZJQL 1VBHA 3LDOA 3P4IA 4C1NK 4ISFA 5AQJA 4U7BA 3MCPA 4PL8A 3ZX0A 2Q31A 4BRAA 3FR0A 4ZRIA 1S22A 2P9PB 4MLEA 3WQUA 4IOAL 3EKUA 4JAXA 5B8HA 2I7PA 2I1KA 5GAGP 3CMEN 1TYQA 3KZBA 2FSJA 1X9JA 4GVEA 1NBWA 1U2VA 3F5TA 2CGJA 2P9SB 4YDUA 1M1KO 5M1KA 5GIOA 2J0KA 5AR0A 3CQXA 1HUXA 1NM1A 5AZJA 1GLJO 3G9WA 4J8FA 4EFHA 4XEIA 3ATUA 1VQ9N 4H5VA 1GC6A 4JKDA 1VBGA 2A6AA 3LDPA 1GLFO 3SLCA 3UKUB 4A61A 4BRGA 3R8EA 4ZRJA 2HBLA 4JKBA 5AQUA 1QQMA 2CQUA 2D4WA 3GOIA 1QZ6A 1BOTO 3MMVA 2ASPA 3CCJN 2WBNA 2E2NA 4FOEA 3A5MC 5CHIA 4PKIA 5TKYA 4BC5A 5I9EB 1Y19B 4IWVA 5BR9A 5AQQA 1W97L 5AQFA 3O9QA 5CE3A 1ST7A 1GLAG 3ZX2A 1V4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKH A;  3E66 A;  4JK8 A;  4JKF A;  4JKE A;  4JKG A;  3E9O A;  3ENB A;  4ILJ A;  4JKA A;  4JK9 A;  4ILH A;  4JKD A;  3E9L A;  4JKB A;  4JKC A;  4JK7 A;  4ILG B;  3SBG A;  3E9P A;  4JKG B;  3SBT A; 
#chains in the Genus database with same CATH topology
 5AQG A;  3MN7 A;  3LPT A;  3HI0 A;  4KH5 A;  1OVY A;  4B1U B;  3NF6 A;  3CCQ N;  1MK7 B;  4FM0 A;  1FKO A;  1QVF M;  4A59 A;  4K0K K;  3FLV A;  2QWR A;  3WXI A;  3S41 A;  1L3U A;  1E3M A;  1T05 A;  4ZTF A;  3ENH A;  1VQ4 N;  1QQN A;  4FYD A;  1IG8 A;  1QTM A;  3U3Y A;  5KRT A;  4DSE A;  1XC3 A;  4YDU C;  2PY5 A;  2O8E A;  3CFO A;  3WXJ A;  4BG9 A;  4JI7 K;  3SMP A;  2Y1J A;  4CZM A;  3ZSR A;  4HHT A;  1VAZ A;  5AQT A;  4JK8 A;  1S6P A;  2IAJ A;  4CHQ A;  1YIT N;  4LSN A;  1YXQ A;  4CFC A;  4IKF A;  3ID8 A;  1NGB A;  5HL7 L;  1S6Q A;  3NH0 A;  3NVK A;  2ITM A;  3ATV A;  3OYI A;  1VQ8 N;  4JI8 K;  4A62 A;  4FJN A;  4BR2 A;  1Y97 A;  3LWM A;  5JVL A;  3B6P A;  4B9S A;  4H0Y B;  3KLG A;  3SBT A;  3ZDT A;  3RMC A;  4KH6 A;  3VER A;  3ISN C;  1T03 A;  1SS6 A;  3MWP A;  3MAQ A;  3VQB A;  3VGL A;  4CZL A;  5C24 A;  5BRE A;  1P8Z A;  2VG5 A;  3HZ6 A;  3O3F A;  1VSK A;  3L2W A;  2G8H A;  2P9U B;  2D5R A;  4DCH A;  1VSF A;  2XRI A;  1GLE G;  4KB1 A;  4LF6 K;  2P9S A;  5FPE A;  1JKH A;  1NLV A;  3ITH A;  3O4Q A;  4NCG A;  3NDK A;  5FLX O;  1GLC G;  3QIC A;  1NK6 A;  1KC7 A;  1ASU A;  1ACA A;  1Q18 A;  1CXQ A;  4G9Z A;  1SAZ A;  1OH7 A;  4BE2 A;  5J2P A;  1NU0 A;  3OA9 A;  4JKE A;  3KLE A;  3VQQ A;  3LDN A;  2FF6 A;  4GMJ B;  1MDU B;  4KB0 A;  1WSG A;  3QIN A;  3SMS A;  1I3A A;  1YJN N;  3HM8 A;  1BQM A;  3AAP A;  4EKU A;  3UE5 A;  4BR9 A;  3BDP A;  3ZCM A;  4IOA L;  4CJS A;  3LP2 A;  1BA1 A;  3HBT A;  1SKR A;  2LSN A;  2D0O A;  5M1Q A;  3S3M A;  3SAH A;  1LCU A;  4EZ9 A;  4DFM A;  2KKZ A;  1EX4 A;  2E2P A;  1X9M A;  3CC7 N;  2F8T A;  1XUP O;  4PQU A;  3VQ9 A;  4WQ4 C;  5EVZ A;  3HPO A;  2OCE A;  2FDQ A;  4JK9 A;  3LDL A;  4DV1 K;  3SNN A;  4C8L A;  1EWR A;  4B9L A;  1NKE A;  3EZW A;  4BRC A;  4DUZ K;  4FW1 A;  1LWF A;  4LY7 A;  4CIE A;  1QQC A;  4DF4 A;  4KTW A;  3PX4 A;  1KBL A;  4YOU A;  1HX1 A;  4XH4 A;  1VQN N;  5C0Y A;  3LL3 A;  1MK9 B;  4FLX A;  1ZBH A;  2X6N A;  1C1C A;  4JI2 K;  2E4L A;  4CGG A;  5E26 A;  4DV0 K;  4B3T K;  2HHX A;  4CYE A;  4DTO A;  3AA3 A;  3I56 N;  3N4Q A;  3CER A;  4BRL A;  1XNR K;  4OPK A;  4CHY A;  1RGI A;  1VSL A;  3OYN A;  1RFQ A;  3DRP A;  4KHY A;  1IH7 A;  1KFS A;  1Z05 A;  4KKO A;  2DFH A;  3CJC A;  3NHG A;  2P9U A;  4BR7 A;  1HKG A;  3UKR B;  3VN5 A;  2ZQB A;  3HK2 A;  1K9M O;  5FRN A;  2P9L B;  4DFK A;  2YKM A;  4FJK A;  5ADX H;  4CW7 B;  1LWC A;  4L3Q A;  1R0A A;  4B1X B;  1OVQ A;  4I2P A;  4DV4 K;  1CZ9 A;  1MWK A;  1NJY A;  2UUB K;  3AO2 A;  3D2E B;  1GOA A;  5KQD A;  1EF1 A;  5AQZ A;  4AH9 A;  2E8A A;  2GEL A;  3CM6 A;  1FXX A;  4FVM A;  3D2F B;  1WSF A;  1YJW N;  5GAD P;  1HKC A;  3MWT A;  1WLJ A;  3N4P A;  2IIR A;  4N41 A;  3QEX A;  3R3L A;  3K5N A;  3C94 A;  4JD2 B;  3SI6 A;  3LDS A;  4DR3 K;  4E7I A;  2ZJP L;  1KLN A;  1VQK N;  1X1P A;  2EMS A;  3T1H K;  3SQ4 A;  1J54 A;  3JXU A;  3B8A X;  4CER A;  3IFR A;  4W5R A;  3HPH A;  3QFU A;  5F2R A;  5HP1 A;  1LOT B;  4LC9 B;  4AM7 A;  4Q5V A;  3ASM A;  3MXJ A;  2RPI A;  3TAR A;  3M8R A;  4F2S A;  1T6D A;  3PSF A;  1JLE A;  4IDH A;  1NMN A;  1YTU A;  3J7Z O;  4CJF A;  2QXF A;  4C1N I;  1HPZ A;  5C10 A;  1NGI A;  1MU2 A;  2OA8 A;  3CCU N;  5GIP A;  2OPS A;  3QEI A;  4Z4C A;  1REV A;  3ZSW A;  2FBV A;  1TVR A;  5BRD A;  2UYT A;  4DQR A;  4ZRK A;  1K6Y A;  5F0X A;  2P9I A;  3AO4 A;  2YCH A;  3MN6 A;  1KSP A;  3PIO L;  3QBW A;  1ZBI A;  4RG8 A;  3G6E N;  4WE1 A;  4BRQ A;  3QNO A;  1RT4 A;  4IFE A;  2BAN A;  3EZ5 A;  3KIO A;  1L3S A;  1U48 A;  1NMD A;  2HHQ A;  3EE8 A;  4FWS A;  1WSH A;  4DMN A;  2DPN A;  1HJO A;  4R79 A;  1NK5 A;  3O9U A;  4CK2 A;  4AHU A;  2P9L A;  2O8B B;  2Y1I A;  5FPM A;  3MCA B;  4FCY A;  3AA4 A;  4HUE A;  3EPY A;  3V9Z A;  3CCR N;  4GY2 B;  2UUA K;  3O9T A;  3T69 A;  2J4R A;  4HUF A;  3LWL A;  4Z4H A;  4CD1 A;  3J7A P;  3SV3 A;  4QOZ B;  2YHX A;  3L2Q A;  4BRN A;  3TPQ A;  3TAG A;  3C7N A;  2D2Q A;  1JCE A;  2DFF A;  1BHL A;  3D2F A;  3WEE B;  3L3U A;  2NLX A;  4YOR A;  3VF6 A;  3L3V A;  1NGC A;  4JD2 A;  3NGI A;  4NO7 A;  4RW6 A;  3QIP A;  3D45 A;  3PO4 A;  1S72 N;  4N47 A;  1GC7 A;  2HBK A;  4M41 A;  1TK0 A;  1HB8 A;  3CQ8 A;  4WFB L;  4DU3 A;  1FJG K;  2OPP A;  1X9W A;  4B3S K;  3LP0 A;  4CJQ A;  4K41 A;  4HDQ A;  1CXU A;  3VGM A;  4CJ4 A;  3K5O A;  4IBN A;  5LY3 A;  4HTU A;  2OAN A;  4GV9 A;  4BDY A;  1JDE A;  4DS5 A;  4E1N A;  2FJ9 A;  1MA9 B;  3NGZ A;  2G8W A;  3ZX3 A;  4H0T B;  4CEB A;  4Y1D A;  3D7E O;  4LD0 A;  2P1J A;  3VQ6 A;  1DEJ A;  3O80 A;  4IEI A;  3DLG A;  2XY7 A;  3MXI A;  3CJ1 A;  1HR0 K;  3P39 A;  3G10 A;  4CE9 A;  2QTD A;  1ITG A;  1KC8 O;  4P7I A;  3CC2 N;  1GLL O;  3M5R A;  3TAP A;  4KRF A;  2GV9 A;  2ZJR L;  3RR8 A;  4Z94 A;  4CVN E;  4QCL A;  3BIN A;  1KVB A;  5I42 A;  2QKK A;  1YAG A;  5AFU A;  2ASM A;  4JS4 A;  2VCP A;  4W5O A;  1DKG D;  2V7Y A;  5HRP A;  5AQW A;  2KZZ A;  1Q7Y O;  4FWQ A;  1LWE A;  3BF3 A;  3TSP A;  1CZB A;  4FJJ A;  1RDB A;  4CEZ A;  3SAG A;  2IS3 A;  2BTF A;  4FWM A;  1BUP A;  4IOX A;  4YOW A;  2FLO A;  1VBH A;  4C1N K;  4ISF A;  3VQP A;  3THW A;  3MCP A;  1ZBF A;  4E7H A;  2P9P B;  4F3O A;  3DMJ A;  3EKU A;  2I1K A;  5GAG P;  3CME N;  1TYQ A;  1X9J A;  3ZSV A;  4W5Q A;  1HJR A;  4FLV A;  2YNI A;  3VQC A;  3DLK A;  5M1K A;  4KRE A;  3DLH A;  3CQX A;  1OH8 A;  5HRN A;  2ZE2 A;  4CJT A;  3ATU A;  1GC6 A;  4BRG A;  5C2F A;  1C0U A;  3C6T A;  3PV8 A;  4ZRJ A;  1BOT O;  2ASP A;  3CCJ N;  2WBN A;  2E2N A;  4PKI A;  5I9E B;  2QK9 A;  1KVC A;  5AQF A;  1BIU A;  4Z4I A;  1VQP N;  2P9K B;  5ELZ A;  3OJS A;  4MLH A;  3B6O A;  1JXB A;  4LH4 A;  2OTJ N;  4AM6 A;  2NRT A;  2QW9 A;  1WOQ A;  1U6Z A;  4WF9 L;  3MX5 A;  4YY3 K;  1TKZ A;  4FLW A;  1XI1 A;  2B4J A;  1ATN A;  2NRZ A;  5I3U A;  4DR5 K;  2E1Y A;  4CFA A;  3A2F A;  1VSJ A;  3A0I X;  3AVN A;  4PA1 A;  3SUP A;  3NF8 A;  3IG1 A;  3MED A;  3DLE A;  2DTU A;  1BL3 A;  1WN7 A;  4ISE A;  3IMX A;  5C15 A;  4C23 A;  2KZM A;  3E9O A;  1NJX A;  2CB8 A;  1J9A A;  1VSD A;  1TV6 A;  3F2K A;  1ZBU A;  3H3O B;  1GGO A;  3CQY A;  4F2R A;  3O1W A;  3TTD A;  5M1F A;  5C25 A;  4E3S A;  2CH6 A;  2NRX A;  3FZH A;  3I8B A;  4IFY A;  3VQ8 A;  2HHV A;  3QLH A;  4E1M A;  4BVP A;  2GWJ A;  4OGC A;  3J81 O;  1WBB A;  4YFU A;  4DFJ A;  2HHW A;  4CCH A;  1N32 K;  3NH1 A;  1VRT A;  2HB5 A;  4GV3 A;  4NCB A;  4DXA B;  2P9P A;  4JI5 K;  4CGD A;  3RRH A;  1HKB A;  2HND A;  4IXC A;  4CHO A;  2VQF K;  3K9K A;  4FK4 A;  2YX6 A;  1S1V A;  4IDK A;  5LL6 Z;  1A5V A;  4KO0 A;  3PVL A;  5A2Q O;  2D10 A;  3DWL A;  5KGW A;  4L8R B;  3DRS A;  4X65 K;  3J8A A;  3RTV A;  4I6M B;  3D6R A;  2RHK A;  4JI1 K;  1Q86 O;  3P38 A;  3LAN A;  4KTQ A;  2P9K A;  1D8Y A;  3QIO A;  3SBG A;  5KPR A;  4DS4 A;  4IJA A;  4NB4 A;  2HMI A;  4FJ7 A;  5LJV A;  4FJ5 A;  2KLA A;  3NF9 A;  2A42 A;  3P5J A;  4OGE A;  5LMU K;  2I1J A;  3OYF A;  1Q9Y A;  3I33 A;  1BWF O;  2LBB A;  2CGL A;  4GXB A;  4FXD A;  4AHC A;  3V9W A;  1SZ2 A;  2QWQ A;  3SQ0 A;  4IO8 A;  2AA4 A;  2V7Z A;  1B9F A;  5AZI A;  1O13 A;  4FLY A;  3S9H A;  3RMB A;  1JLC A;  4UQG A;  5JLF A;  3U6F A;  1TL1 A;  4DR2 K;  3SPY A;  3WNF A;  2WOM A;  2ETJ A;  5EXW A;  2Z1I A;  3U4L A;  3ZSQ A;  2VGM A;  1X3M A;  4ELU A;  4M3T A;  1NGG A;  1WSI A;  2IVO A;  1XQS C;  1KQS M;  4FWK A;  5GAE P;  3EE9 A;  1N8R O;  3O4W A;  3F9M A;  5M1N A;  1NKC A;  3KK2 A;  1RDA A;  5JLH A;  2B5J A;  1TKD A;  4YOT A;  4QS9 A;  3L4Q A;  3OBW A;  2EWS A;  4O55 A;  2P5O A;  4B3R K;  1BGX T;  2D1K A;  4KPY A;  1C1A A;  3AV9 A;  1U49 A;  3DLL L;  1KFD A;  4DFP A;  3WT0 A;  3AVI A;  3RWU A;  3OYG A;  4BRK A;  4QAG A;  2Z1J A;  3DJC A;  4A2A A;  3NGY A;  4CEE A;  4LF9 K;  1JLA A;  1C0G A;  3KWG A;  5SWM A;  3T1Y K;  2HOE A;  1U4B A;  3U3G A;  3TTC A;  3HVR A;  4XIU A;  3NCI A;  1KXP A;  4I6M A;  3I0R A;  3EEQ A;  3H45 C;  2F4V K;  4MFB A;  2HHU A;  4CIG A;  5AQR A;  1N34 K;  1TUY A;  4PHT X;  3KVG A;  5CR4 A;  2R7Y A;  3C6H A;  1DT9 A;  4K25 A;  4YOV A;  3THX B;  2HBM A;  4CEF A;  3V1O A;  1NG9 A;  4BRD A;  4R5P A;  4CZJ A;  2PZS A;  1NGD A;  4B9V A;  2ZWH A;  3T1A A;  3VQD A;  2VQE K;  5AQN A;  3G25 A;  1T7P A;  4IZ9 A;  1UOC A;  3HYF A;  3Q7C A;  3LPU A;  1EKE A;  3ULE A;  1GOC A;  4CJK A;  1J5O A;  2GTD A;  4JRP A;  4BE1 A;  2GBZ A;  1HQU A;  2ABD A;  3E1Y A;  1RBT A;  1NJZ A;  1KAY A;  1JCF A;  3M8S A;  4IO9 L;  1VQO N;  3KHY A;  3C6U A;  2IGI A;  3H6E A;  3F73 A;  4BVO A;  4CI6 A;  1HYZ A;  5C12 A;  3CJ7 A;  4ID5 A;  4KV8 A;  4BRI A;  1QZ5 A;  2PAV A;  3VA3 A;  3HXM A;  1E4F T;  3ZSY A;  2OZM A;  3NE6 A;  5C2D A;  5J2Q A;  4WQ5 C;  4JI6 K;  4JKG A;  4OO1 J;  3A5L C;  1IBL K;  4DR7 K;  2GWK A;  2JWK A;  4HCB A;  4H0X B;  1NVL A;  3R9P A;  3GBT A;  4M63 C;  1XMO K;  1GG3 A;  3BZK A;  4BGA A;  2V52 B;  1NGJ A;  4K42 A;  1OH5 A;  2ITG A;  4I9L A;  3VQA A;  2RQ1 A;  4B9M A;  2HF3 A;  2P5G A;  3FP5 A;  3VGK A;  1WB9 A;  3QFP A;  1DIK A;  1RDD A;  3NFA A;  2E20 A;  5AFU H;  1QE1 A;  1ZYQ A;  2P9I B;  5DM6 L;  3EYZ A;  1Y64 A;  1TK5 A;  1C0T A;  4MDA A;  3CCM N;  3V81 A;  4ELT A;  3TAM A;  2ZF5 O;  2HHT A;  1S5J A;  1BI4 A;  1A5X A;  2UU9 K;  3BEX A;  3HTV A;  3THX A;  3DLB A;  4JRQ A;  4DV5 K;  1L3V A;  4AHS A;  3PX0 A;  3FE1 A;  4MQ3 A;  4CF1 A;  2A1R A;  5CYM A;  3PO5 A;  2AL6 A;  2OYQ A;  4OKE A;  4Z4E A;  3MEE A;  4JEP A;  1UA1 A;  4M7Y A;  4K8X A;  3S3N A;  2FF3 B;  3OY9 A;  2KQ2 A;  4M3U A;  2HRJ A;  1L3T A;  1ZBS A;  3KJV A;  2QKB A;  3CYM A;  2D0B A;  3WXM B;  3C7N B;  1VSM A;  1K8A O;  3OJU A;  2NRH A;  1RT6 A;  4J2B A;  1HPM A;  4NXM K;  3VF4 A;  1GLD G;  4AQY K;  4KH4 A;  4FWR A;  4FLU A;  4AIL C;  3AVC A;  3JYT A;  3GL1 A;  4CEA A;  4KHU A;  4ELV A;  4HDO A;  4DQQ A;  4MO4 A;  3C65 A;  4CBW A;  4J2E A;  1ZXO A;  3KK1 A;  1VRU A;  3NAE A;  3KWI A;  4BRP A;  3BY5 A;  3IAY A;  1S1X A;  3LM2 A;  5KPT A;  3VOV A;  1Z25 A;  4F9O A;  3DLR A;  2KW4 A;  1YIJ N;  4BC2 A;  1ZC6 A;  4B8C A;  4BR4 A;  2E88 A;  3FFK B;  3FZF A;  4BDP A;  1Q81 O;  3MN5 A;  1NGH A;  1EXQ A;  4TSX A;  3SCX A;  2DY4 A;  3TR8 A;  1BU6 O;  1NK8 A;  2A41 A;  4EHT A;  4J2D A;  3UKU A;  3WNE A;  3RMA A;  4Y1C A;  2G8I A;  1Q9X A;  4RTF D;  1KTQ A;  3E01 A;  3VEN A;  3LZJ A;  4LFB K;  3O8M A;  1H4R A;  1IKV A;  3LDO A;  3KD1 E;  5AQJ A;  4U7B A;  4PL8 A;  2PYJ A;  3ZX0 A;  2Q31 A;  4M42 A;  4DSK A;  4ZRI A;  3WQU A;  3V9X A;  4RW4 A;  2FSJ A;  2E6M A;  4GVE A;  4JI3 K;  5KI6 A;  4YDU A;  1M1K O;  1IG9 A;  1B92 A;  3F9K A;  3LZI A;  3K57 A;  1BCO A;  1NM1 A;  3G9W A;  4J8F A;  4XEI A;  4H5V A;  4C8N A;  4JKD A;  1VBG A;  1QS4 A;  4O44 A;  4A61 A;  1T8E A;  3K2P A;  4BDZ A;  3ZSZ A;  4JKB A;  5AQU A;  3GOI A;  2CQU A;  3QES A;  4LF8 K;  5CHI A;  3QET A;  1I39 A;  4BC5 A;  4N56 A;  2EX3 A;  4IWV A;  2G8F A;  5CE3 A;  4DTM A;  4GW6 A;  1ST7 A;  1GLA G;  3ZX2 A;  1VK0 A;  4CF0 A;  4X62 K;  2J0J A;  5IWA K;  3THW B;  3NH2 A;  4NCA A;  2QWP A;  2XO7 A;  1RDW X;  4BGB A;  4X64 K;  2OPR A;  2J0M A;  1VQL N;  1HYS A;  1TYQ B;  3A8Y A;  1KLM A;  3DYA A;  4XH1 A;  3CM5 A;  2HVH A;  5FRO A;  2YJE A;  1EO1 A;  4YOY A;  1RCH A;  5D3G A;  3AVH A;  4CJE A;  3VMF B;  5HRO A;  3AO5 A;  5CZ1 A;  2X6S A;  1MIX A;  4DTJ A;  4FW2 A;  1YVN A;  4CIF A;  2QWN A;  3TI0 A;  4U67 L;  4CFB A;  1K8K B;  2E2O A;  2FC0 A;  5M1O A;  3V4I A;  2HST A;  3V1Q A;  2YNF A;  1SL1 A;  3IS9 A;  4C8O A;  1RT2 A;  3VEO A;  3U8Z A;  3DI6 A;  3U8X A;  3OYC A;  3LP1 A;  2WH5 A;  4CJU A;  2COP A;  4AHV A;  4F7G A;  1NJW A;  4DV7 K;  1K73 O;  4NY0 A;  4FPA A;  2NUB A;  4DU1 A;  5GIN A;  3QBX A;  3H3N O;  1JLG A;  5KTQ A;  2I5J A;  1YHQ N;  4CGH A;  5AQV A;  4GKJ K;  1BQN A;  4BC3 A;  3WXL A;  2X78 A;  1LAW A;  1ZBL A;  3L6Q A;  4H5W A;  5CYQ A;  1HRH A;  5HLF A;  3Q7B A;  3OS2 A;  5TKW A;  3VTI A;  4CFD A;  3AVK A;  4DSJ A;  3CIP A;  4BRE A;  2VWJ A;  3TAF A;  3W3D A;  5AQI A;  4EP4 A;  2HBJ A;  1NNE A;  2WC9 A;  4DUY K;  4GV6 A;  1YT3 A;  3THV A;  3O9R A;  1VQ6 N;  1EQY A;  4KHS A;  3V9S A;  3H08 A;  2V51 B;  1C1B A;  1J53 A;  4CGI A;  4DQ8 A;  5J2M A;  2Q2R A;  2VYP A;  2ZM6 K;  2W6K A;  3ZSX A;  4CD3 A;  3K5L A;  1RT7 A;  2YHW A;  4J2A A;  4H4O A;  3O4N A;  1RTJ A;  4E1J A;  5BRF A;  3VTH A;  1TAU A;  1HBK A;  1IV0 A;  3CPE A;  2IC3 A;  3SUN A;  1ATR A;  3OYK A;  1RBR A;  4CZI A;  3K58 A;  4HCC A;  3VQ5 A;  2XHB A;  2BDP A;  4JYA K;  4ISG A;  1NGA A;  4FM2 A;  1QQO A;  3ENO A;  5ADX A;  3VPZ A;  2NRV A;  1S9G A;  4N5S A;  1BIZ A;  3MDQ A;  1V4S A;  1K8K A;  1NK9 A;  1N6Q A;  2A3Z A;  4O8U A;  2W42 A;  4DSF A;  2HW3 A;  4NYF A;  4O5B A;  5E84 A;  2XY5 A;  4O0I A;  3AAR A;  1JJ2 M;  4KHP K;  4NLB A;  5AQM A;  1SGH A;  4H0V B;  4CBU A;  4B08 A;  3OYA A;  4DU4 A;  4V19 S;  3V9U A;  4UY8 O;  4ZHR A;  1HYV A;  1S9E A;  4OPA A;  4AHT A;  3BF1 A;  4Q0B A;  1Z26 A;  4FJI A;  3OVN A;  5JIC A;  2E1Z A;  4DLG A;  3M1F A;  4M3R A;  4JV5 K;  3T19 A;  2JLE A;  3D0P A;  5KRS A;  3K5M A;  2Q97 A;  1WSJ A;  1NOY A;  3H1Q A;  5AZI B;  2HF4 A;  2B6A A;  2VG7 A;  4M7X A;  3C6A A;  1OH6 A;  2W40 A;  2QXL A;  3OYB A;  4H4M A;  4H03 B;  5IJM A;  2ZGZ A;  4FL9 A;  3IKM A;  1W0H A;  3QNN A;  1D4X A;  2CH5 A;  5BRH A;  4OX9 K;  1XNQ K;  5DMR A;  1G99 A;  4OKJ A;  4DF8 A;  1VSH A;  3ZT4 A;  2KTQ A;  3AO1 A;  3K59 A;  3TTF A;  3PX6 A;  1NJI O;  2NZT A;  1ATS A;  3CG7 A;  1IBK K;  1D5A A;  1WBD A;  3DOK A;  1KRP A;  4BRH A;  3MX2 A;  1NTI A;  4CK1 A;  1JL2 A;  3SV4 A;  1Q82 O;  2R82 A;  3KK7 A;  4B9T A;  2JWL A;  1QSS A;  1N33 K;  1NI2 A;  3IVF A;  1RBV A;  3R6M A;  3HT3 A;  1RDC A;  4H8K A;  3VEX A;  5CY4 A;  5AQP A;  4Z0U A;  3M3Z A;  3WNH A;  3G4S N;  4CBX A;  2WUS A;  3MN9 A;  3AO3 A;  3KLH A;  3MK6 A;  4GNI A;  1N5Y A;  4LF4 K;  4I2Q A;  1T3V A;  1ISN A;  3VQ7 A;  2YHB A;  3EO3 A;  4O0J A;  2OZS A;  1VSI A;  5GAH P;  1GLB G;  1OKJ A;  1HNW K;  3KKS A;  2PBD A;  2BUP A;  4B3O A;  1D9D A;  2HMP A;  3AA5 X;  4ILG B;  4ID1 A;  1JLQ A;  4RW9 A;  1JL1 A;  3J7Y P;  3ZET B;  2HHH K;  4FSV A;  4W5T A;  4F8R A;  3TU5 A;  5JVH L;  4GVM A;  4CEQ A;  1RTI A;  4KHW A;  5LJW A;  3FZM A;  2F96 A;  2YI1 A;  3VQE A;  1KD1 O;  3K9J A;  3TSQ A;  1SL0 A;  3ULE B;  1QHT A;  2HHS A;  1DTQ A;  3FLC O;  4FWN A;  3AVL A;  3VQ4 A;  3KK3 A;  4E19 A;  4DR1 K;  4W5N A;  2FXU A;  5E41 A;  2HNY A;  1MIZ B;  4DTU A;  4CJ5 A;  4CEC A;  4M3X A;  3W0L A;  4H5T A;  2CGK A;  1DLO A;  1A5W A;  4FLT A;  3CJ9 A;  4I9Q A;  2IVP A;  3AA2 A;  2VWK A;  4WCE L;  3ID6 A;  3S3O A;  4JKG B;  2FBX A;  1TGO A;  5AJ3 K;  2D0C A;  1NOZ A;  3LM9 A;  5EX5 A;  3H1V X;  1LAV A;  3JS6 A;  3O3G A;  3GDQ A;  3OS1 A;  5HRR A;  1RT3 A;  3RVC A;  2NRR A;  5CZ2 A;  5JMV A;  1C0M A;  2YNG A;  3CCL N;  4PY5 A;  3LDQ A;  4QS8 A;  3HVT A;  4PL7 A;  3DOL A;  3C95 A;  5JVG L;  4B3M K;  5EOY A;  5AZJ B;  1NGE A;  4CF2 A;  1YTA A;  1UWB A;  3ZEU A;  3SUQ A;  4CJV A;  4NLC A;  2E5L K;  2IDO A;  3QDK A;  4JKF A;  3K0S A;  4DTP A;  4NYN A;  1VSE A;  3EN9 A;  4FJH A;  2G8K A;  3ZET A;  1TKX A;  1E5W A;  1BI4 B;  4ILH A;  2A1S A;  4YHH K;  2HE7 A;  3OBY A;  1HNX K;  3DXM A;  1YUW A;  4CJL A;  1JXE A;  3KLF A;  4F4K A;  2O8D B;  2I7N A;  4RW7 A;  4LH5 A;  5AQK A;  4FOI A;  4F3T A;  5AQX A;  3VEV A;  3HP6 A;  1QSY A;  3IDH A;  1BCM A;  2QWO A;  3L2V A;  5MLC Q;  3BZC A;  4AHR A;  2WFB A;  3CJB A;  1IKY A;  4BY9 C;  1U04 A;  4FZX C;  3E66 A;  4M3W A;  4BWJ A;  5AQY A;  1EET A;  4CJ7 A;  3HOT A;  2F7T A;  4KI6 A;  4CZG A;  1DTT A;  4DKW A;  4IG0 A;  1NK0 A;  4KAZ A;  3J80 O;  1EWQ A;  2VGN A;  4EP5 A;  4HUG A;  4OPH A;  1NGF A;  3VF2 A;  4KHN A;  5AQO A;  4DTX A;  1ASV A;  2GX9 A;  5J1E A;  1I94 K;  4OLB A;  2Q36 A;  3AVA A;  4BRF A;  2YKN A;  4DTR A;  5K14 A;  1WAF A;  4O4G A;  1CLQ A;  1TUU A;  4FJX A;  1RT5 A;  3L0Q A;  4CZF A;  2NNW A;  4TKN A;  3O6W A;  2O4I A;  2F9W A;  3SJJ A;  2WON A;  3EKS A;  2DIK A;  3P31 A;  1G15 A;  1SUQ A;  2ZJQ L;  3QO9 A;  2F8S A;  4HVJ A;  4BRA A;  1JLF A;  2YNH A;  3FR0 A;  4LF7 K;  1S22 A;  3ZT2 A;  4X66 K;  3HPG A;  4LF5 K;  2I7P A;  2Z1H A;  3KZB A;  4CES A;  1SKW A;  2XY6 A;  3PUF A;  4CJW A;  5GIO A;  4OPJ A;  4DV2 K;  5AR0 A;  3NBP A;  4JLH A;  1LW2 A;  5AZJ A;  2W6L A;  1U45 A;  3UKU B;  2A6A A;  3LDP A;  1GLF O;  1HNV A;  3R8E A;  3IRX A;  3OTO K;  1QQM A;  2RF2 A;  3P83 D;  4FOE A;  3OYE A;  4E7K A;  5TKY A;  5JS2 A;  5KGX A;  1RTH A;  3M8Q A;  5BR9 A;  5AQQ A;  3HJF A;  3KKR A;  1V4T A;  2GEM A;  2O8D A;  3CHW A;  4B1Y B;  1FW6 A;  4CZE A;  1DGK N;  5FDL A;  4ZTJ A;  3WQT A;  4PWD A;  1HMV A;  3T3F A;  1RNH A;  4IJN A;  1UAX A;  4DQP A;  5DK5 A;  1XHX A;  2Q1N A;  4OJR A;  4DSI A;  1JLB A;  4DR4 K;  4JNE A;  1KAZ A;  2AP1 A;  4CGF A;  1X9S A;  3I0S A;  1IO2 A;  3A5O C;  4DR6 K;  3EL2 A;  3CF5 L;  3HM9 A;  2O4G A;  4IEE A;  3U7D A;  4KHQ A;  4FPB A;  3FGU A;  2KHO A;  4FWP A;  3JAM O;  2QWM A;  1FK9 A;  4JN4 A;  3BUZ B;  2A40 A;  4JI4 K;  4O5F A;  3KLI A;  2NRW A;  4FWO A;  1Q8I A;  2ATQ A;  2PYL A;  1BIS A;  4DTN A;  2X0S A;  1TAQ A;  3TAQ A;  4Z4G A;  4M3Y A;  3AVF A;  3AVM A;  1XHZ A;  3SAF A;  1QSL A;  3IUC A;  3NF7 A;  4HWI A;  1XWL A;  1ASW A;  4B9U A;  3AGR A;  2FSK A;  1H1V A;  2ZD1 A;  4KBO A;  3O08 A;  2GUI A;  3EY1 A;  3UB5 A;  4JS5 A;  5BPM A;  2YJF A;  3AU4 A;  2YHY A;  3CI5 A;  3CET A;  2F9T A;  3C0B A;  4H0O A;  3U9Z A;  3MXM A;  3RSE B;  1HLU A;  4BR0 A;  5AQL A;  4M45 A;  3NMU A;  5BN8 A;  4GKK K;  5F1X A;  4CHZ A;  3VET A;  1RTD A;  4EZ6 A;  3TAN A;  2RKI A;  3HO1 A;  1NK4 A;  3LP3 A;  3L4I A;  1WAJ A;  3QER A;  2O8F B;  1SKS A;  1HB6 A;  4E89 A;  3QB0 A;  4A57 A;  4A5A A;  3SQ1 A;  1BO5 O;  1VQ7 N;  3VES A;  4CF9 A;  4IG3 A;  4B1W B;  3QIJ A;  4KFB A;  3LAK A;  2KFZ A;  4DWI A;  1T44 A;  4FO0 A;  1O1W A;  3HP9 A;  4BC4 A;  3MEC A;  4JKH A;  3SPZ A;  4FJL A;  3SYZ A;  1QHA A;  1VHX A;  1M90 O;  1RDU A;  5KPZ A;  2E6L A;  4CJP A;  4BAC A;  3L8B A;  5BPN A;  1NK7 A;  1NWK A;  3PY8 A;  2Q3S A;  1IJJ A;  3M6G A;  2DFE A;  3O5B A;  2A5X A;  4B9Q A;  3UKR A;  3KTQ A;  4DTS A;  4CJ3 A;  3ULD A;  1BA0 A;  2GUP A;  5BR8 K;  4WFA L;  4IFV A;  1SV5 A;  4PKG A;  2QA4 N;  1NKB A;  3H46 O;  3HSC A;  3D2E A;  2ASO A;  3TSU A;  1CZA N;  4RWT A;  3HST B;  3CCV N;  1W9H A;  2O8C B;  5M1P A;  4DV6 K;  3O3H A;  3L2R A;  5EY4 A;  3WA0 A;  1ESV A;  4DLE A;  4FK2 A;  4AF1 A;  4FZZ A;  4BQL A;  3E9P A;  3AY9 A;  3DM2 A;  3GE1 A;  3CMA N;  4PUO A;  3X23 A;  3FZK A;  4DHY A;  1YF5 L;  1T6C A;  4ICL A;  2AEH A;  4FZY A;  3KD5 E;  4JKA A;  4I7F A;  2WTU A;  1W2B M;  4CF8 A;  4A5B A;  4JI0 K;  3PIP L;  1IBM K;  3RSE A;  3CC4 N;  3HOS A;  1E4G T;  3ZT1 A;  2UUC K;  3BP8 A;  4CED A;  2RN2 A;  4G1Q A;  1N36 K;  3SJH A;  4B1V A;  4H0P A;  2O8F A;  4CJR A;  4Z4F A;  2BE2 A;  3L2U A;  3P1G A;  4WYB A;  3CJA A;  3LAM A;  3CPW M;  3RR7 A;  4XH5 A;  5BPL A;  2KFN A;  2EMT A;  1MWM A;  1TL3 A;  3HRG A;  2ZPY A;  3CCE N;  3O9S A;  4BG8 A;  2H3G X;  1BDG A;  2X74 A;  4EHU A;  4WQ5 A;  4FJG A;  1WSE A;  4CGJ A;  3GG4 A;  3THY B;  3U9D A;  3MEG A;  1D9F A;  4WQ4 A;  4BRO A;  5LMN K;  3ZT0 A;  4H5R A;  4OLA A;  5AQS A;  4DV3 K;  2ZGY A;  3WNG A;  1RBU A;  4FWL A;  5C42 A;  4ILJ A;  2O8B A;  1S3X A;  4KTZ A;  2E2Q A;  3FFI A;  3ZLJ A;  2D11 A;  4WFN L;  2Q0R A;  3SK3 A;  3QEV A;  2YV0 X;  1KAX A;  1YJ9 N;  4EIA A;  2Z1G A;  1TKT A;  5FPD A;  2O8C A;  5H1S Q;  3QEW A;  4K8Z A;  1P90 A;  2EHG A;  4CHP A;  1SL2 A;  2VWB A;  1WUA A;  1FKP A;  1RT1 A;  2D0P A;  1XC9 A;  5FRM A;  3WEE A;  4FM1 A;  1U47 A;  4JHD B;  1IKW A;  1RBS A;  4HTL A;  2P51 A;  3E9L A;  4BE0 A;  4FVU A;  3DAW A;  3WUH A;  3RRG A;  2YHA A;  2D0A A;  2W41 A;  1C0F A;  1R59 O;  3O1B A;  4LSL A;  3R1X A;  1EP4 A;  3VEZ A;  4CZH A;  3PLA A;  1SQK A;  3V6D A;  1J19 A;  4YL8 A;  4FJ8 A;  1YI2 N;  4OVL A;  3WXK A;  4YOX A;  4E7J A;  2QM1 A;  4B9N A;  4PKH A;  3I55 N;  3A5N C;  4C8M A;  1JCG A;  1ILY A;  4DB3 A;  3OHR A;  3OS0 A;  5DM7 L;  3VA0 A;  1IKX A;  3RMD A;  1HNZ K;  4LFA K;  3TAE A;  4B1Z A;  2OPQ A;  1S1U A;  2P9N B;  3CXC M;  1HQE A;  5FPN A;  5HRS A;  3AVB A;  3DXK B;  2BGG A;  4FLZ A;  4FK0 A;  4JK7 A;  4CEO A;  4EAH D;  1BG3 A;  4LFC K;  4DQI A;  3HL8 A;  3OYL A;  4FJM A;  2UXB K;  2Q0U A;  4CK3 A;  5J2N A;  3DRR A;  3THY A;  1J5E K;  3ENB A;  5KQ8 A;  1U2V B;  4H5N A;  4O8K A;  4B8A B;  1XMQ K;  3QEP A;  3NVM A;  5IT9 O;  4A2B A;  3OYH A;  3TWH A;  2OTL N;  5BN9 A;  5T7B A;  1L5U A;  4RCH A;  4BRM A;  1S1W A;  4N76 A;  2QEX N;  1Z6R A;  3V1R A;  3AVG A;  5HOO A;  3T7Z A;  4FJ9 A;  2IOC A;  3LAL A;  3SQ2 A;  3AGK A;  4E0D A;  4CZK A;  2QWL A;  1LV5 A;  3JSM A;  4BWM A;  1KCF A;  4JKC A;  3TAB A;  2PFU A;  4Y0W A;  3G71 N;  3ZT3 A;  4K43 A;  1KVA A;  1UA0 A;  3PSI A;  3AU5 A;  5AQH A;  2UXC K;  5SZT A;  1WNS A;  4C8K A;  4JHD A;  1RIL A;  3ZYY X;  1GOB A;  3CD6 N;  1J6Z A;  2O8E B;  2XY8 A;  3CCS N;  4DQS A;  1X3N A;  4RW8 A;  3SZ2 A;  2QI2 A;  3ZEU B;  2UXD K;  3UIQ A;  2YVC A;  4OKK A;  3M8P A;  1F21 A;  3CFR A;  3QML A;  4KI4 A;  2IVN A;  2AJQ A;  2HNZ A;  4IOC L;  4MO5 A;  3CFP A;  3PZD A;  3G0Z A;  4QS7 A;  3FZL A;  2P9N A;  2RE2 A;  4BR5 A;  1VQM N;  3DXM B;  3DXK A;  5EU7 A;  4BQZ A;  1C6V A;  3AVJ A;  4MDB A;  3OYJ A;  3VEW A;  2BH1 A;  1QVG M;  1HNI A;  1VQ5 N;  2VG6 A;  3VEY A;  3OW2 M;  2FBT A;  2FSN A;  3AAQ A;  5HBM A;  4CHN A;  4E7L A;  3SUO A;  3P4I A;  1LW0 A;  2JGU A;  4MLE A;  3BGR A;  3I8D A;  2HVI A;  4JAX A;  5B8H A;  4DSL A;  3OYM A;  4M3Z A;  5JS1 A;  2G8U A;  2G8V A;  1NBW A;  1U2V A;  1YVU A;  4NXN K;  3F5T A;  2CGJ A;  2P9S B;  3OYD A;  2J0K A;  2FBY A;  1HUX A;  1GLJ O;  4EFH A;  1VQ9 N;  3SLC A;  4YNQ A;  2HBL A;  1S1T A;  2D4W A;  3ZSO A;  1QZ6 A;  3MMV A;  1B9D A;  1TK8 A;  1W7A A;  3A5M C;  4DG1 A;  1Y19 B;  1W97 L;  3O9Q A;  3ALY A; 
#chains in the Genus database with same CATH homology
 5AQG A;  1VQP N;  2P9K B;  5ELZ A;  2GEM A;  3MN7 A;  3HI0 A;  2J0J A;  4KH5 A;  4MLH A;  1OVY A;  4B1U B;  3CCQ N;  2OTJ N;  2QWP A;  1MK7 B;  4AM6 A;  2NRT A;  2QW9 A;  3CHW A;  1WOQ A;  1U6Z A;  4B1Y B;  3MX5 A;  4A59 A;  4WF9 L;  1RDW X;  3FLV A;  4BGB A;  1QVF M;  1VQL N;  2J0M A;  2QWR A;  1ATN A;  1DGK N;  2NRZ A;  3S41 A;  3WXI A;  4CZE A;  2E1Y A;  3WQT A;  1TYQ B;  3ENH A;  3A0I X;  4IJN A;  3A8Y A;  4XH1 A;  1VQ4 N;  1QQN A;  1IG8 A;  2YJE A;  1EO1 A;  2Q1N A;  1XC3 A;  4YDU C;  4YOY A;  3WXJ A;  4JNE A;  4BG9 A;  1KAZ A;  3SMP A;  4CZM A;  1VAZ A;  5AQT A;  2AP1 A;  3VMF B;  4JK8 A;  1YIT N;  1MIX A;  1YXQ A;  1YVN A;  4ISE A;  3IMX A;  5C15 A;  3A5O C;  4C23 A;  3EL2 A;  2QWN A;  3CF5 L;  3ID8 A;  1NGB A;  5HL7 L;  3E9O A;  4U67 L;  2CB8 A;  4IEE A;  3U7D A;  1K8K B;  2E2O A;  5M1O A;  3F2K A;  2HST A;  4FPB A;  3FGU A;  3NVK A;  3H3O B;  1GGO A;  3CQY A;  3ATV A;  2KHO A;  3O1W A;  2ITM A;  4FWP A;  3TTD A;  2QWM A;  5M1F A;  1VQ8 N;  4JN4 A;  2CH6 A;  2NRX A;  3BUZ B;  3FZH A;  3U8Z A;  3VEO A;  3U8X A;  3I8B A;  2A40 A;  4A62 A;  4BR2 A;  4O5F A;  5JVL A;  2NRW A;  2WH5 A;  4BVP A;  4FWO A;  2COP A;  2GWJ A;  4H0Y B;  2X0S A;  3SBT A;  3ZDT A;  4F7G A;  1K73 O;  4NY0 A;  4KH6 A;  4FPA A;  3VER A;  1SS6 A;  3SAF A;  5GIN A;  3MWP A;  3IUC A;  3QBX A;  4HWI A;  3H3N O;  3VGL A;  4CZL A;  3AGR A;  1YHQ N;  2FSK A;  5BRE A;  4GV3 A;  5AQV A;  1P8Z A;  1H1V A;  4DXA B;  2P9P A;  3HZ6 A;  4KBO A;  1HKB A;  3O08 A;  4BC3 A;  4IXC A;  3WXL A;  2P9U B;  3L6Q A;  4H5W A;  3UB5 A;  4DCH A;  1GLE G;  5BPM A;  2YJF A;  2P9S A;  3K9K A;  3AU4 A;  5FPE A;  1NLV A;  3Q7B A;  2YHY A;  5TKW A;  3VTI A;  3CI5 A;  1GLC G;  3CET A;  3QIC A;  2YX6 A;  1KC7 A;  1ACA A;  2F9T A;  3C0B A;  1Q18 A;  4H0O A;  3CIP A;  3U9Z A;  4BRE A;  4G9Z A;  1SAZ A;  3W3D A;  3PVL A;  3RSE B;  5AQI A;  2D10 A;  1HLU A;  3DWL A;  4BR0 A;  5AQL A;  3NMU A;  2HBJ A;  3OA9 A;  5BN8 A;  4JKE A;  5F1X A;  3VET A;  3J8A A;  2WC9 A;  3LDN A;  2FF6 A;  4I6M B;  4GV6 A;  1MDU B;  3SMS A;  3D6R A;  2RHK A;  3L4I A;  1Q86 O;  3O9R A;  1VQ6 N;  3P38 A;  1YJN N;  1EQY A;  1HB6 A;  2P9K A;  3HM8 A;  3QB0 A;  3AAP A;  2V51 B;  4A5A A;  4A57 A;  4EKU A;  3SBG A;  1BO5 O;  3UE5 A;  4IJA A;  3VES A;  4NB4 A;  4BR9 A;  4DQ8 A;  5KPR A;  1VQ7 N;  2Q2R A;  3QIJ A;  1BA1 A;  2KLA A;  4B1W B;  5LJV A;  2A42 A;  3HBT A;  2VYP A;  4CD3 A;  2D0O A;  5M1Q A;  1T44 A;  4FO0 A;  2YHW A;  4BC4 A;  4JKH A;  4E1J A;  5BRF A;  3SAH A;  1LCU A;  1QHA A;  3VTH A;  2I1J A;  1HBK A;  1M90 O;  1RDU A;  2KKZ A;  2E2P A;  3CPE A;  3I33 A;  5KPZ A;  3CC7 N;  1XUP O;  1ATR A;  1BWF O;  2LBB A;  2CGL A;  4CZI A;  4GXB A;  5BPN A;  4WQ4 C;  5EVZ A;  1NWK A;  2FDQ A;  1SZ2 A;  4JK9 A;  2QWQ A;  3LDL A;  4IO8 A;  2AA4 A;  2V7Z A;  1IJJ A;  3EZW A;  4ISG A;  4BRC A;  1NGA A;  3M6G A;  3O5B A;  1QQO A;  5AZI A;  1O13 A;  2A5X A;  4B9Q A;  3ENO A;  3UKR A;  3VPZ A;  2NRV A;  5ADX A;  5JLF A;  1KBL A;  3MDQ A;  1BA0 A;  2GUP A;  4WFA L;  1V4S A;  4YOU A;  1K8K A;  1HX1 A;  5EXW A;  3U4L A;  2VGM A;  1X3M A;  2A3Z A;  4O8U A;  4XH4 A;  1VQN N;  5C0Y A;  4PKG A;  1NGG A;  3LL3 A;  2QA4 N;  1MK9 B;  3H46 O;  3HSC A;  2IVO A;  3D2E A;  1XQS C;  2ASO A;  5E84 A;  3TSU A;  5E26 A;  1CZA N;  4RWT A;  3AAR A;  4FWK A;  3EE9 A;  5GAE P;  3CCV N;  1JJ2 M;  4NLB A;  1KQS M;  5AQM A;  1SGH A;  5M1P A;  1N8R O;  4CYE A;  5EY4 A;  4H0V B;  4CBU A;  3WA0 A;  1ESV A;  3O4W A;  3F9M A;  5M1N A;  4UY8 O;  3I56 N;  4AF1 A;  3N4Q A;  3CER A;  4OPA A;  4BQL A;  4BRL A;  5JLH A;  3BF1 A;  3E9P A;  4YOT A;  5JIC A;  2E1Z A;  3L4Q A;  1RGI A;  3OBW A;  2EWS A;  4QS9 A;  3AY9 A;  5C2F A;  1RFQ A;  3GE1 A;  3M1F A;  3CMA N;  3X23 A;  1Z05 A;  3FZK A;  2D1K A;  2Q97 A;  4DHY A;  1YF5 L;  3H1Q A;  3CJC A;  2HF4 A;  5AZI B;  1T6C A;  3DLL L;  2P9U A;  2AEH A;  4BR7 A;  1HKG A;  3UKR B;  3WT0 A;  4M7X A;  3C6A A;  2W40 A;  2QXL A;  1K9M O;  4JKA A;  4H03 B;  5IJM A;  2P9L B;  2ZGZ A;  4FL9 A;  1W2B M;  5ADX H;  3IKM A;  4L3Q A;  4BRK A;  4B1X B;  4A5B A;  1D4X A;  1MWK A;  2CH5 A;  3DJC A;  4A2A A;  3PIP L;  5BRH A;  1C0G A;  3RSE A;  3CC4 N;  3KWG A;  3HOS A;  1E4G T;  1G99 A;  2HOE A;  3D2E B;  5KQD A;  3TTC A;  3BP8 A;  1EF1 A;  5AQZ A;  3TTF A;  1NJI O;  1KXP A;  2NZT A;  4I6M A;  1ATS A;  2E8A A;  3H45 C;  3SJH A;  4B1V A;  4H0P A;  4BRH A;  5AQR A;  2GEL A;  1TUY A;  1NTI A;  3MX2 A;  3KVG A;  4PHT X;  3D2F B;  5CR4 A;  1Q82 O;  2R82 A;  3C6H A;  1DT9 A;  3CJA A;  3KK7 A;  4K25 A;  4WYB A;  2JWL A;  3CPW M;  1YJW N;  4XH5 A;  5BPL A;  5GAD P;  1HKC A;  2EMT A;  1MWM A;  3MWT A;  1NI2 A;  3HRG A;  2ZPY A;  3N4P A;  3IVF A;  2IIR A;  4YOV A;  2HBM A;  3CCE N;  3O9S A;  3R6M A;  4BG8 A;  2H3G X;  1BDG A;  3R3L A;  4EHU A;  4BRD A;  3VEX A;  5AQP A;  4JD2 B;  4WQ5 A;  4CZJ A;  1NGD A;  3GG4 A;  3U9D A;  3M3Z A;  2ZWH A;  2ZJP L;  1VQK N;  4WQ4 A;  2EMS A;  5AQN A;  4BRO A;  4CBX A;  3JXU A;  3G25 A;  2WUS A;  3B8A X;  3G4S N;  4IZ9 A;  3IFR A;  3MN9 A;  3Q7C A;  3QFU A;  5F2R A;  4H5R A;  1LOT B;  5AQS A;  3MK6 A;  4GNI A;  3ULE A;  1T3V A;  1ISN A;  4LC9 B;  4AM7 A;  3EO3 A;  2ZGY A;  2GTD A;  5GAH P;  1T6D A;  1GLB G;  1OKJ A;  4FWL A;  4IDH A;  4ILJ A;  3J7Z O;  2PBD A;  2ABD A;  3E1Y A;  2BUP A;  1KAY A;  1S3X A;  4C1N I;  2HMP A;  1JCF A;  4IO9 L;  5C10 A;  2E2Q A;  1NGI A;  1VQO N;  3KHY A;  2D11 A;  4WFN L;  2Q0R A;  4ILG B;  3SK3 A;  5GIP A;  3CCU N;  3ZET B;  1KAX A;  1YJ9 N;  3H6E A;  4FSV A;  4BVO A;  4EIA A;  5BRD A;  2UYT A;  4CI6 A;  4ZRK A;  5C12 A;  3CJ7 A;  3TU5 A;  5F0X A;  5FPD A;  5JVH L;  4BRI A;  1QZ5 A;  2PAV A;  5H1S Q;  2P9I A;  5LJW A;  1E4F T;  1P90 A;  2YCH A;  3FZM A;  3MN6 A;  2YI1 A;  3PIO L;  2VWB A;  5C2D A;  1WUA A;  3QBW A;  2D0P A;  4WQ5 C;  4JKG A;  1KD1 O;  3K9J A;  4OO1 J;  3G6E N;  3TSQ A;  3WEE A;  3A5L C;  4JHD B;  4BRQ A;  4HTL A;  3E9L A;  2GWK A;  2JWK A;  3ULE B;  4FVU A;  3DAW A;  4H0X B;  4IFE A;  3WUH A;  1NVL A;  3R9P A;  3FLC O;  4FWN A;  1NMD A;  2W41 A;  3GBT A;  3EE8 A;  1C0F A;  4FWS A;  4M63 C;  1R59 O;  1GG3 A;  3O1B A;  4BGA A;  3R1X A;  3VEZ A;  4CZH A;  3PLA A;  2V52 B;  2DPN A;  1NGJ A;  1HJO A;  4K42 A;  1SQK A;  4R79 A;  3O9U A;  1J19 A;  2FXU A;  2P9L A;  4YL8 A;  1YI2 N;  5FPM A;  3MCA B;  2RQ1 A;  1MIZ B;  3WXK A;  3EPY A;  2QM1 A;  4YOX A;  3CCR N;  2HF3 A;  4PKH A;  3A5N C;  3W0L A;  3I55 N;  1JCG A;  4GY2 B;  4DB3 A;  3O9T A;  3OHR A;  1ILY A;  4H5T A;  3T69 A;  5DM7 L;  3FP5 A;  2CGK A;  3VGK A;  2J4R A;  3QFP A;  4B1Z A;  1DIK A;  2P9N B;  3CXC M;  4CD1 A;  2E20 A;  5AFU H;  2YHX A;  3CJ9 A;  2P9I B;  5FPN A;  5DM6 L;  3DXK B;  2IVP A;  4BRN A;  1Y64 A;  3TPQ A;  4JK7 A;  3C7N A;  2D2Q A;  4EAH D;  1JCE A;  4MDA A;  1BG3 A;  3ID6 A;  4WCE L;  3CCM N;  4JKG B;  3D2F A;  2ZF5 O;  3WEE B;  3BEX A;  3LM9 A;  2NLX A;  5EX5 A;  3H1V X;  3HTV A;  4YOR A;  3VF6 A;  2Q0U A;  3JS6 A;  1NGC A;  3GDQ A;  4JD2 A;  4NO7 A;  3FE1 A;  3ENB A;  3RVC A;  2NRR A;  1S72 N;  5KQ8 A;  1U2V B;  1GC7 A;  2AL6 A;  2HBK A;  5JMV A;  3CCL N;  4H5N A;  4O8K A;  3LDQ A;  1HB8 A;  4JEP A;  4M7Y A;  4QS8 A;  4PL7 A;  4WFB L;  2FF3 B;  5JVG L;  3NVM A;  5EOY A;  5AZJ B;  2HRJ A;  1NGE A;  4A2B A;  1ZBS A;  2OTL N;  5BN9 A;  3ZEU A;  4K41 A;  4RCH A;  4BRM A;  4HDQ A;  3VGM A;  3WXM B;  4NLC A;  2QEX N;  1Z6R A;  3QDK A;  4JKF A;  5LY3 A;  3C7N B;  1K8A O;  5HOO A;  3T7Z A;  2OAN A;  2NRH A;  3EN9 A;  1HPM A;  4GV9 A;  3VF4 A;  3ZET A;  1E5W A;  1JDE A;  1GLD G;  4ILH A;  4KH4 A;  3AGK A;  4FWR A;  4CZK A;  2QWL A;  2HE7 A;  3OBY A;  3GL1 A;  3DXM A;  2FJ9 A;  1MA9 B;  1YUW A;  4JKC A;  2I7N A;  2PFU A;  4HDO A;  4Y0W A;  5AQK A;  4FOI A;  3ZX3 A;  4H0T B;  4K43 A;  3G71 N;  4MO4 A;  5AQX A;  3VEV A;  3C65 A;  3IDH A;  3D7E O;  3AU5 A;  4CBW A;  1ZXO A;  5AQH A;  2QWO A;  5MLC Q;  2WFB A;  3CJB A;  1DEJ A;  4JHD A;  3O80 A;  4IEI A;  4BY9 C;  3E66 A;  3KWI A;  5AQY A;  4BRP A;  4CJ7 A;  3ZYY X;  3HOT A;  3CD6 N;  2F7T A;  1J6Z A;  3CJ1 A;  3P39 A;  4CZG A;  4DKW A;  3CCS N;  3LM2 A;  2QTD A;  5KPT A;  3VOV A;  1X3N A;  1KC8 O;  4P7I A;  3CC2 N;  1GLL O;  3M5R A;  4F9O A;  2QI2 A;  3ZEU B;  2VGN A;  1YIJ N;  4BC2 A;  2ZJR L;  1ZC6 A;  2YVC A;  4OPH A;  1NGF A;  3VF2 A;  4BR4 A;  2E88 A;  4Z94 A;  3QML A;  3FFK B;  5AQO A;  3FZF A;  2GX9 A;  2IVN A;  1Q81 O;  3BIN A;  3MN5 A;  4IOC L;  1NGH A;  1YAG A;  4MO5 A;  5AFU A;  3PZD A;  2ASM A;  4QS7 A;  2Q36 A;  1BU6 O;  2VCP A;  3FZL A;  4BRF A;  2A41 A;  2P9N A;  4EHT A;  2RE2 A;  1DKG D;  3UKU A;  2V7Y A;  4BR5 A;  5AQW A;  3DXM B;  1VQM N;  4RTF D;  1Q7Y O;  1TUU A;  4FWQ A;  3DXK A;  4BQZ A;  3BF3 A;  3L0Q A;  3TSP A;  4CZF A;  2NNW A;  4TKN A;  4MDB A;  3O6W A;  3VEW A;  2F9W A;  3VEN A;  2BH1 A;  3SAG A;  1QVG M;  3EKS A;  1VQ5 N;  2DIK A;  2BTF A;  3P31 A;  3VEY A;  4FWM A;  3OW2 M;  2FSN A;  3AAQ A;  1BUP A;  3O8M A;  4IOX A;  2FLO A;  1H4R A;  4YOW A;  2ZJQ L;  1VBH A;  3LDO A;  3P4I A;  4C1N K;  4ISF A;  5AQJ A;  4U7B A;  3MCP A;  4PL8 A;  3ZX0 A;  2Q31 A;  4BRA A;  3FR0 A;  4ZRI A;  1S22 A;  2P9P B;  4MLE A;  3WQU A;  4IOA L;  3EKU A;  4JAX A;  5B8H A;  2I7P A;  2I1K A;  5GAG P;  3CME N;  1TYQ A;  3KZB A;  2FSJ A;  1X9J A;  4GVE A;  1NBW A;  1U2V A;  3F5T A;  2CGJ A;  2P9S B;  4YDU A;  1M1K O;  5M1K A;  5GIO A;  2J0K A;  5AR0 A;  3CQX A;  1HUX A;  1NM1 A;  5AZJ A;  1GLJ O;  3G9W A;  4J8F A;  4EFH A;  4XEI A;  3ATU A;  1VQ9 N;  4H5V A;  1GC6 A;  4JKD A;  1VBG A;  2A6A A;  3LDP A;  1GLF O;  3SLC A;  3UKU B;  4A61 A;  4BRG A;  3R8E A;  4ZRJ A;  2HBL A;  4JKB A;  5AQU A;  1QQM A;  2CQU A;  2D4W A;  3GOI A;  1QZ6 A;  1BOT O;  3MMV A;  2ASP A;  3CCJ N;  2WBN A;  2E2N A;  4FOE A;  3A5M C;  5CHI A;  4PKI A;  5TKY A;  4BC5 A;  5I9E B;  1Y19 B;  4IWV A;  5BR9 A;  5AQQ A;  1W97 L;  5AQF A;  3O9Q A;  5CE3 A;  1ST7 A;  1GLA G;  3ZX2 A;  1V4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...