2J0MA

Crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
329
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Basis for the Autoinhibition of Focal Adhesion Kinase.
pubmed doi rcsb
source organism Gallus gallus
total genus 81
structure length 329
sequence length 329
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2j0mA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j0mA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2j0mA01
3D8FA 2LJ5A 3QQ8B 1I7AA 1WF9A 1V49A 1C3TA 2CY4A 4CHKA 2KHWB 3SO6A 1GJZA 3PGEA 2L7RA 4W9LA 4EOYA 3AXCA 3L08A 3A33B 1U5FA 3KZ1A 4F7UP 1K5DB 1S1QB 2FJ9A 1CMXB 4HJKA 2D9XA 2RQ1A 3DPDA 2GS0A 2OTXA 2YSZA 3KUZA 3PEGA 5D7GA 1ZVRA 4GMVA 2NCNA 5DCNA 1ZM0A 3M63B 3DVNV 1WXMA 2JPHA 2X18A 2FIDA 2L76A 1E7UA 3QK0A 1LXDA 3IBEA 2N9EB 3VFKA 5KQ4A 3JVZX 3TW1A 4M8NA 4BKSA 1XX0A 2KJHB 1OEYJ 1IPGA 1TBEA 4LJOB 4KIKA 3APDA 3UZTA 2KX0A 1X1GA 4RMAA 3VOQA 3WALA 4ANVA 3KYDD 2MBEA 3ZKJC 4MGIE 2I1JA 2IYDB 3ZDTA 4K2PA 4DHJB 4DDGD 4TYZA 1EGXA 1U4AA 1MIXA 3PZDA 2DYOA 1MAIA 4GB9A 2KNBA 2IO0B 2BGFA 3JW0X 2K00A 3AU4A 4GGQA 4WJPA 3PLVA 3PRZA 3A98B 3HM3A 4MJSB 3IG3A 4ANWA 3DXEA 1B55A 4ASWC 3U30A 2LGDA 2DA0A 1HB6A 3KUCB 2IY1B 4HHVA 2KMCA 2GJYA 3ZRCA 3HK0A 4EJNA 4HK2A 3RULA 4GDLA 4F7ZA 2IBIB 4F7GA 4Y94A 4GSWA 5JZEB 3ALBA 1YJ1A 2DZMA 4WWNA 1P9DU 2YS3A 4NPNA 1GUAB 1XD4A 4KHBB 4TQ0A 2UWQA 3HHMA 1J19A 1UNQA 4E74A 1OEYA 1DYNA 2LXAA 1WR1A 2D11A 2KXJA 4FJZA 3VDZA 1Y8RC 2AYOB 3VIAA 5C6RA 1WJMA 2Z59B 5DPRA 2D9YA 3QWMA 4YL8A 2WWZA 2JP2A 1UPQA 3VUYA 1EF5A 3M62B 2CR5A 2DAJA 3FP5A 2NBWB 3IHPC 2M8SA 3V6CB 2LOXA 3KRWA 4WWOA 4HAYB 2M38A 2LVOA 1EF1A 5EDSA 2CKHB 1TJ6A 4A20A 2BWES 2Q13A 3QWZB 2ELAA 3G9WA 2ZPNA 2BYFA 2I5CA 3NY5A 3QX1A 2MQJA 1P3QU 1YQBA 1WH3A 4GDKA 1NTYA 5GOWB 2L00B 1P98A 1I42A 3L13A 2CHXA 4DHZB 2LASA 3MDBC 3H7PA 2D4QA 3PLUA 1WXVA 2UVMA 3KVFB 3KRXA 3W1SA 3L16A 1V9JA 1FGYA 1W1GA 4LJPB 1TQZA 1KI1B 5LXHA 2C60A 2JT4B 4EUTA 2UZRA 3EPYA 4H8SA 4DBBA 1H8CA 3M95A 2N7EA 1V5TA 1XT9B 2JY6A 2N1VA 3PPAA 2ZNVC 3LJ3A 1ZKHA 2MA9B 3T9LA 2EKEC 4HB4B 2QKMA 1SHCA 2KZRA 1KJTA 3ML8A 4KSLC 3APCA 2DYNA 1F9JA 2N7DA 2MCNB 3VH3B 3L0WB 3N30A 4ANXA 2LKOA 2JRHA 2ELBA 2AL6A 3S2AA 4IWQA 5J3QA 3PHXB 1S3SG 3JYUA 4DHZE 3V62A 2O6VB 3BJIA 4JLCA 2R2QA 1ZC3B 2MWNB 5KHQA 3I3TB 4NAWA 3TJPA 3WAOA 2CHZA 3ZO5B 2E2XA 2KFKB 4WJOA 1WJNA 2K6DB 3QARA 4LDTD 2EJ8A 2DLWA 2KC2A 5C5BA 4L6EA 3ZNHB 3X23A 1BTNA 4HATB 2BKFA 4PS7A 2KLCA 1E8YA 2M1MA 3QCAA 3A1QB 4HAZB 5IAAC 1X1FA 3A4SC 3ODWA 3LJUX 1FAOA 2KDEB 2IY0B 4A6HA 4EFOA 3N3KB 4WJQA 4IG7B 2W2WA 3ONSA 4CHJA 2COPA 1E5WA 5D2MB 5J18A 5CX3A 4K81A 1XODA 3PG7A 2FUHB 1LB1A 4W9IA 3ZNZB 4WJ7A 1NDDA 2NPTA 3K9OB 4MSQB 4ICUA 2N9PC 1X1MA 2KWCA 3CF6E 3DVNU 2DZKA 4KZ0A 3A9KB 3PRMB 4URKA 4W9HA 4DX8A 2M4NA 2G3QB 1FXTB 3MPXA 2UZSA 5TR5A 2CRFA 3RUIB 3M1IB 1OQNA 2MP2A 3RCZA 2DYQA 3Q3FA 2HTHB 3PHWB 3MJWA 2QKLA 2IO3B 4XX5A 2CU1A 4C0AA 3UGBB 2ZEQA 5CTRC 5DPWA 4D0NB 4IC7B 1VCBA 2BPSA 3CSFA 4K1RB 3FSSA 1WX9A 2FCNA 1W1DA 4LDTB 2AEHA 3R66C 1P5TA 3A8PA 3A4RA 3APFA 2K6QA 2PZ1A 2D07B 4MGYE 2GBJA 2EC1A 4HWIB 1IYFA 1XKEA 1X86A 4MSMB 5E6OA 1UZXB 5DI9B 4IAPA 3WANA 1Q5WB 4DHJD 1WX7A 2GMIC 3RYTA 1TXDA 5LONB 1V5OA 4G0NB 2LRWA 2D9WA 3VTVA 4MEMA 1WE6A 5JLJB 3RCPA 2N1WA 4WAAA 4PNKA 2KDIA 1ACAA 2OJRA 1TZ1A 1E8XA 2PJHA 1WM3A 4XWXA 1Q0WB 2Y7BA 4K7WA 4DBGA 3U7DA 4PYUA 2CQUA 3NHEB 2DHJA 2GCLA 4EMOA 3TVVA 2Z0PA 2DX5A 2R0DA 4DK5A 4WVFB 3FLVA 2ZVNA 3RT3B 3ULBA 4PS3A 5DPSA 2FIFA 3SHQA 3DXCA 2Y5BB 2FDQA 2LI5A 2ZCBA 1TGZB 3C0RB 2YVCA 1P0RA 1WVHA 3BINA 1ST7A 1WE7A 3HW2B 4BKSD 3TIXA 2GOWA 4EKUA 4NJ6A 4FJVB 2EMTA 2C7MB 2PE6B 3N7CA 3N32A 2NBVB 2LG1A 3PS6A 4DDID 4IM3A 2LXCA 2KFJA 1J8CA 2A4ZA 2N23A 4MH0E 3V6EB 2ASQA 4TUUA 2QHOA 5KHOA 5C79A 2K8HA 1C1YB 3ZLZA 1UBIA 3MHSD 2DZIA 2GCJA 2KVRA 1PLSA 3UQAA 2D3GA 4CO7A 5D3WA 3AI5A 2JZ3B 4FBJB 1T0YA 2MBOA 5CLQB 5HE2A 1WI0A 1Z87A 2DHKA 5JHHA 2COAA 2MW5A 4I6PA 2ZJDA 2KN5A 3ZVRA 1H4RA 3DXDA 5KCVA 2VRWB 1AQCA 2ADZA 3D8DA 2V3SA 2MX2A 1WJ4A 2H7DA 1WZ0A 3F5RA 4HPMB 2YF0A 2Z0QA 1SGHA 1ZSQA 2P0HA 3X0WA 4A6KA 3OLMD 4N9F4 4EZJA 4K2OA 3DBSA 2KDBA 2XK5A 4JIOU 2C7NB 2REXA 3JSVA 4JGHB 4MGKE 2DYMA 2VKIA 4HB2B 2J59M 1WIAA 1WXAA 1WMHB 4HPLB 2CODA 2Z0DB 4PYZA 1N3HA 4KDIC 3L10B 5CHWA 3WYFB 1V89A 3OJ3A 2MBBB 1P1AA 1PFJA 2BCJA 4NY0A 5JHBA 1YX6B 4RM8A 1U5DA 1U29A 4JL9A 2YLMA 4GMXB 3PSEB 5JHGA 1FGZA 3DQVA 4K17A 3TMPB 3PTFC 2I1KA 2JZZA 4XC2A 1FHOA 4FADA 4MDKE 3ZDMC 2FNJB 4B6WA 4F7HA 3Q3JA 1V5MA 3ECIA 5L81A 4KZCA 2DTCA 2HE7A 2NZ8B 5HE0A 1RJ2A 2RLOA 5AZGA 1V5UA 2R09A 2O6VD 3TL5A 4B95A 1H10A 3QA8A 1EO6A 1WJ6A 2DFKA 2LZ6A 4Z2NA 1BAKA 3HM6X 2J0JA 1WM2A 3QIJA 4A5KA 4NJ7A 3T06A 1Q1OA 1UGMA 1RLFA 4B6HA 3R7QA 3VAWA 5J3TA 4G50A 5C23A 2NMBA 1ISNA 2LRUA 2FCQA 2KFKA 2WX1A 3NS8A 5LOPB 1V86A 2KTRA 2C7HA 3UF8A 4ZDVA 5JH5C 4HDQA 4AJYB 3K9PB 1OQYA 4W9FA 3RZFA 2CS4A 4GDLB 5FR6A 2ROZB 3F0WA 1MG8A 2K2UA 4GPTB 2CB8A 3A1QA 2RGFA 2HJ8A 3KH0A 2D2QA 1NI2A 2KO3A 5CHVC 3SD5A 1V80A 3NSUA 1WGDA 2NVUI 4NQLB 3DOWA 3PVLA 1DROA 2HD5B 3H6NA 4AJWA 1I2HA 2MBHA 3O96A 4HAVB 4GOCA 2KLGA 3CIKA 1Y19B 1WZ3A 2IFSA 1E7VA 2YS5A 5G2NA 2ZZPB 3CXBB 1PMSA 4I6LB 1NTVA 2K2JA 2J0MA 5E6PA 3EFUA 1EAZA 1P6SA 3UIOB 2KTFA 4NQKE 4FHKA 3D8EA 1WGUA 3AJ4A 3ZTDA 1WI1A 3IFWB 1X05A 1RRPB 1E8ZA 5LXIB 5GMVA 2LBBA 2P8VA 3B08A 4NSWA 4GXBA 2L05A 1J0WA 1U5GA 2ZCCA 2VSZA 2L8JA 2L0FA 2BYEA 3ZW3A 2KWVB 2HTHA 3QHTA 4K7SA 2ABDA 5JHAA 2LULA 4HXDA 4FLHA 4BFRA 1UPRA 4IM2A 1W1HA 1WXSA 1M94A 3ENEA 2GBKA 4FA6A 2CHWA 3KYCD 4AUQC 1M7EA 4GDKB 3TO1A 1RFAA 3UINB 5FI0A 2NR2A 4FN2A 2K25A 2K39A 1FHWA 2D9ZA 2O2VA 1K5GB 1MPHA 2XQNM 2DHZA 4CHMA 1NVLA 2KDFB 2PPHA 3H7PB 3W1YA 5AZFA 1KZGA 2PEAA 3VUXA 1L2NA 2AL3A 4IWOA 2KGXB 1DDVA 2LD9A 3SUZA 4MM3A 3MTNB 2N0YA 4KDLB 5D94A 1MIZB 3KUDB 2DAFA 3AU5A 2KC1A 3SU8X 5BO4B 1V88A 4FJYA 5CHFA 3DBHI 2KQ7A 1M7RA 5D3VA 3R3MA 4IUMB 5DHAB 2VRRB 3VHTC 4ANUA 3ULCA 3ODXA 3ML9A 4BKTA 1J0GA 4PS8A 1WGRA 4AOFA 4FHJA 2KKCA 1L7YA 2N9XA 5G55A 1I35A 3LDZE 2BF8B 3CSTA 4A3OA 4MELA 5HE1A 1AARA 2WYQA 4WSFA 4NAWB 3OANA 1XCGA 2ZVOA 1EVHA 3PSCA 3PREA 2LOZA 4KSKC 2N4FA 4ICVA 3AULA 3EC8A 2M0XA 4HAXB 1AWEA 1GNUA 5D6JB 1IP9A 3VXWA 3SYXA 2DN6A 2AWTA 1RAXA 1BTKA 4XZ4A 2MLBA 4BOZB 2RPQA 3QJZA 2KANA 3TBLD 1SE9A 2LGYA 1MK9B 3ZIMA 3SV1A 2ROVA 4IM0A 4ZYNA 2KUPA 1OY2A 4HAWB 1HB8A 2J0KA 4KHOA 4MT7A 1V6EA 1WGQA 2MBQA 2RSGA 2B3AA 1G6JA 1GC7A 4WQOB 2NPTB 2A5UA 2UYZB 4A6FB 4IWPA 4BBNC 4TQ1A 3A8QA 1WJUA 2C9WB 1WJ1A 4G3XB 2D10A 3A9JB 4K7UA 3H1UA 1KZ7A 4MJSA 4GN1A 2V1YA 2MP2B 2IO1B 5HE3A 4HVBA 2IO2B 2KQSA 1WG7A 3FM8C 4HAUB 1V2YA 1NBFC 2JUOA 1LM8B 5KQ1A 1PQSA 4X57B 3B0AA 2RR9A 2EMSA 5IA7A 1WMHA 2KOXA 2K8CA 1NTIA 4Z2MB 2DYBA 1OGWA 2MSED 1V5PA 3VTUA 3DDCB 5D3YA 1OTRB 3NOBA 1RRBA 4MY6A 2RUKB 3ODOA 2P0DA 3DBRI 3GOEA 3KW5B 1HBKA 4OVVA 1KLVA 5FI1A 2KMAA 3P2BA 2I5FA 4HB3B 5D27A 2FCMA 3CMMB 1MK7B 2FCSA 3SDLC 3H7SA 3QAQA 4BVUC 3M3JA 1D3ZA 1GG3A 4BKGA 1Z2MA 4W9KA 5DH9B 2W2XC 2NBUA 2Z0EB 2M17A 3ZRFA 2IZVB 2XBBC 2FAZA 2LVPA 4F1SA 5IJMA 2DX5B 4HB0B 1VD2A 1Z5SB 2LUEA 2W2XD 2MKRA 2DKQA 4KHAA 4BOSC 3PV1A 3HIZA 1IRSA 4GZUA 5EFXA 3WA0A 3V5WA 5E6NA 4E71A 3OJ4B 3EECA 4LCDE 2DX1A 2YS1A 4HCNB 2D9VA 3T8MA 3GYPA 3UIPB 4KV2A 4DX90 4KIKB 1WX8A 5J17A 3ZUNA 4WJNA 2MDXA 2G4DB 1MKEA 2L1CA 4JQWC 4FULA 3ZNID 2FJLA 4GIVA 1UH6A 3P6AA 4W9EA 2NS5A 2KK8A 3NZUA 4ZRJA 4IOYX 4A3PA 5DHFB 3SNHA 3DCGA 1WR6E 4MK0A 1WGYA 4WWPA 1XD3B 1GC6A 1U27A 1R4NI 3PP2A 3RD2A 1UELA 2V4LA 1WY8A 1Y5OA 1LFDA 4W9JA 3IVFA 2G45B 1V61A 2MRPA 2IYBA 3RZWC 2O6VA 5HKHA 4IW0A 1DDWA 3GZNI 2COCA 2RSUA 3PT2B 2KD0A 1UNRA 2LGXA 3V60A 2DHIA 2LYDA 4G11A 4PQ0A 1YIWA 4TKNA 2XK5B 2RD0A 3JSVB 3W1SC 3UQBA 1WYWB 3WAPA 2JXXA 3L17A 2K1FA 2OQBA 1DDMA 2L0TA 5LLIA 2WDTB 4YONA 4CYEA 1QZEA 4E3CA 3HQCA 2KWUB 2W9NA 1E8WA 1UBQA 5L83A 2V76A 4J6IA 4B9KA 1OMWA 5D3XA 4M8MA 1V81A 3EHVA 1KM7A 2HRJA 1XQQA 2BYVE 3WAMA 4HCPB 1K8RB 1U2BA 3VTWA 3VH4B 2RGNB 3DVGX 4KVGB 4DWFA 2R2OA 3TFMA 3VUWA 2G35A 2Z0OA 3R7RA 3A9KA 1P3RA 3WIMA 1X11A 2CAYA 4BBKA 2BKRB 2JVCA 4I6NB 4EZKA 1E90A 2GBMA 1TTNA 2WX0A 4IFSA 5CLLB 2Y8GA 5J2RA 2YT0A 2RNRB 1BWNA 3VQIA 4AP4C 1Q67A 2K8BA 3ZVVA 2H7EA 4HLEA 4MGZE 4ZRKA 3B1LX 3KY9A 4M0WB 3L54A 3DVGY 1FOEA 2KTRB 4II3B 2COFA 1ZGUB 2OOBB 2JF5A 3DBLI 2LWPA 4W9GA 4TV3A 2Y8FA 4W9CA 1QQGA 1FB8A 3QC8B 1DBHA 3GYOA 1FHXA 1A5RA 3P7ZA 3ZTCA 3FEHA 2KCJA 2KX3A 2DZJA 3PRPB 4OVUA 3NZSA 2P0FA 4NNJB 4P7IA 4W9DA 4HDOA 2GBRA 4AWJA 1BT0A 2MFQA 2DKPA 2J7QB 2MWSB 2PE9A 2LVQA 2XEWA 5AZHA 5L95C 1XR0B 4ZRIA 1UNPA 2CY5A 3PVWA 3PVUA 3O65B 3ZNGC 1LQBA 3ML4A 5C1ZA 4II2B 1LW3A 4A6FA 2KJ6A 2KJRA 1QC6A 1YD8U 2GBNA 2L3ZA 4BBNF 2ZPYA 2L2IA 3H9DA 4F8CB 4EZLA 3A9JA 4DXAB 4RM9A 3QBVB 1WGGA 5C16A 2C5LC 3TCAA 5JP4A 4KAXB 2ZNVB 1U5EA 1UD7A 2G4SA 5J3YA 3VVWB 3BY4B 1ZW7A 4EEWA 2JWZA 1KOTA 4GU2A 5DPTA 1HE8A 5C5BB 1EUVB 2YT1A 3U8ZA 2BWFA 5AEKB 2WH5A 1R4MI 1JRUA 2O2VB 2JRIB 1ZC4B 1YX5B 1UEFA 3KSYA 5DIFB 3OAWA 1SIFA 3V61A 1WFYA 2RVBB 1WRDB 1NU2A 1WGHA 3D32A 2DENB 2M14A 2YRYA
chains in the Genus database with same CATH superfamily
2FJUB 3D8FA 2LJ5A 3QQ8B 1I7AA 1WF9A 1V49A 2V0GA 4MM3B 3O13A 4P1BC 3RNEC 1C3TA 2CY4A 4CHKA 1PYWD 4A9AA 2KHWB 2DNFA 3SO6A 1GJZA 3PGEA 2GB1A 2LHEA 1L0XB 2L7RA 4W9LA 4EOYA 4KKJA 4LNKA 3AXCA 3L08A 3A33B 1U5FA 3KZ1A 4F7UP 1K5DB 1S1QB 3ZJVA 2FJ9A 1CMXB 5AUIA 4HJKA 2D9XA 1NI3A 2RQ1A 3DPDA 4KGTA 2GS0A 3I57A 2OTXA 2IJ0A 4RGMA 2YSZA 2IGHA 4JKGB 3KUZA 3PEGA 5D7GA 1ZVRA 4GMVA 1UF0A 2NCNA 5DCNA 2CJNA 1ZM0A 3M63B 5EE9A 3DVNV 3U12A 1WXMA 1PUTA 1ROEA 3BVMA 2JPHA 1FMAD 2BQQA 2X18A 1YJIA 2FIDA 2L76A 1E7UA 1DIKA 3AEDB 4JWSC 3RNAC 3QK0A 1LXDA 3VR8B 3U2SC 3IBEA 4JK8A 2N9EB 3FAHA 4N6EB 3VFKA 4L2YA 5KQ4A 1SSNA 3JVZX 4C7YA 4BAXA 2PW9A 3TW1A 4M8NA 4BKSA 1XX0A 2Z13A 2KJHB 1OEYJ 1IPGA 1TBEA 4LNNA 4LJOB 4XWWA 4KIKA 1F77A 3APDA 3UZTA 4WURA 4JKAA 4IOIE 3HUIA 2KX0A 1X1GA 2PKOA 4RMAA 4OHJA 4PK1A 3VOQA 3WALA 4ANVA 3KYDD 1XEEA 1JWMD 3TEXA 2MBEA 1F1HA 3ZKJC 1TIFA 4MGIE 2I1JA 2IYDB 3ZDTA 3BZDB 4K2PA 4DHJB 4DDGD 4TYZA 1QQRA 4JKFA 2FE8A 3P4PB 1EGXA 2R61A 2K0PA 4NZLB 2FBWB 1U4AA 1MIXA 3PZDA 1P7EA 4M01A 2DYOA 1MAIA 4GB9A 4JKEA 2KNBA 2IO0B 3FVCA 2BGFA 4J3OD 3JW0X 1GB1A 2K00A 3Q2AC 3AU4A 4GGQA 4WJPA 3PLVA 3PRZA 3A98B 3HM3A 4MJSB 4JK9A 3IG3A 4ANWA 3IAM1 3DXEA 2QMTA 1B55A 4ASWC 3U30A 2LGDA 2DA0A 1F52A 1HA5A 1HB6A 3KUCB 5IRSA 2IY1B 4LK0M 4HHVA 4TSSA 2KMCA 2QDFA 2GJYA 3ZRCA 2IDYA 3HK0A 4EJNA 4HK2A 3RULA 1TKGA 4GDLA 4F7ZA 2PIAA 2IBIB 4F7GA 4Y94A 4GSWA 4RCOA 2BW2A 2KVZA 5JZEB 2QCZA 3ALBA 5G5GA 1YJ1A 2DZMA 4EE2A 4REZA 3NW8A 3Q8BA 3T3NA 4WWNA 1P9DU 3ZJTA 1ENFA 2YS3A 1I4XA 4NPNA 1GUAB 4M00A 1XD4A 2PVOD 4XE0A 4KHBB 3WCQA 4TQ0A 1AN8A 2UWQA 3HHMA 3TSSA 4A8XC 4S0RA 4ACFA 1J19A 1UNQA 4E74A 1OEYA 5G5HA 1VZ8A 2W3SA 1DYNA 2LXAA 1WR1A 1KBLA 2D11A 2KXJA 2RRFA 4FJZA 3VDZA 1Y8RC 1HXYD 2AYOB 3VRAB 3VIAA 5C6RA 2OJWA 1WJMA 1N5WA 2Z59B 1ZUD2 5DPRA 2D9YA 3ZXRA 2M19A 3QWMA 3AE2B 4YL8A 2WWZA 2JP2A 2Y5PA 2V4IB 1UPQA 3VUYA 3OWEB 2XN9C 1EF5A 3M62B 4YWGG 3OHMB 4QJ4B 2CR5A 2DAJA 1SE2A 3FP5A 4GNKB 1EWYC 1R4NB 5EE3A 2NBWB 4OZAA 3IHPC 3MP9A 2M8SA 3LYYA 4C4VB 3V6CB 2LOXA 1N61A 3KRWA 4WWOA 4HAYB 2M38A 2WXRA 3FILB 2LVOA 1EF1A 2PVGC 1TJEA 5EDSA 2CKHB 1TJ6A 4A20A 2BWES 2WU5B 2Q13A 3QWZB 1RFKA 2ELAA 2JZPA 5C3JB 2LEKA 3G9WA 2ZPNA 2K49A 2BYFA 2I5CA 1WYGA 3NY5A 3QX1A 2MQJA 1P3QU 1YQBA 1C78A 1WH3A 4GDKA 3SBTA 1NTYA 5GOWB 4QJ5B 4M0WA 4A90A 1FCLA 1BMLC 1FCCC 2Z8LA 2L00B 1P98A 2KYWA 1I42A 3L13A 1M4VA 1TS5A 2CHXA 1TKYA 4DHZB 4HKQA 2LASA 2HJ1A 3MDBC 2YT2A 3H7PA 1HEZE 4LNFA 2D4QA 3PLUA 4JKHA 4D6WA 3DCXA 1FEHA 1WXVA 1FXIA 1OQQA 2WXPA 3SBGA 2UVMA 5FKAC 3KVFB 1L6UA 2VZKB 3KRXA 3AE9B 1WRIA 3W1SA 3L16A 1V9JA 1XXGA 5LNK1 4IDIA 1FGYA 1W1GA 4LJPB 1TQZA 1KI1B 5LXHA 2C60A 2JT4B 4EUTA 2UZRA 3RNCC 3EPYA 2BS4B 4H8SA 4DBBA 4XDDA 4USAA 1H8CA 3M95A 2N7EA 2JX5A 2L1AA 1V5TA 1XT9B 2JY6A 1TZOA 2N1VA 3PPAA 2ZNVC 1ZOYB 3LJ3A 1JW9D 4LTUA 1ZKHA 4C7ZA 2R82A 2MA9B 3T9LA 2EKEC 1YJJA 4HB4B 2QKMA 2V3PA 1SHCA 2KZRA 3DHHC 1XLOA 1KJTA 4NAMA 4R3DA 3ML8A 4KSLC 3APCA 5EE1A 2DYNA 1F9JA 2N7DA 1ZPSA 2MCNB 3VH3B 2E6XA 3L0WB 1GAQB 2N9KA 3N30A 4ANXA 2LKOA 1NYRA 2JRHA 2ELBA 2AL6A 3S2AA 2LJIA 3IT4B 4IWQA 5J3QA 4YSXB 3ZYYX 3PHXB 1S3SG 3JYUA 4DHZE 4LNIA 3V62A 4DXFA 2O6VB 3DHGC 3BJIA 4JLCA 1VRAB 2ZW0A 1D5ZC 2BVCA 2R2QA 1ZC3B 2MWNB 5KHQA 3I3TB 4NAWA 2N0SB 3TJPA 1I4GA 3WAOA 2CHZA 3ZO5B 2E2XA 2QSDA 2KFKB 4WJOA 1D5XC 1WJNA 2WDQB 2K6DB 3QARA 4LDTD 3Q3OC 2KR0A 2D3AA 2EJ8A 2DLWA 2INNE 2V9HA 2KC2A 4HJGE 5C5BA 1GOZA 4ZRPA 4L6EA 1VZ6A 2UU7A 3ABVB 3ZNHB 3X23A 1BTNA 4HATB 2BKFA 4PS7A 3N1ZC 3SFDB 2KLCA 1E8YA 1Y56A 5IOIA 2M1MA 3QCAA 3A1QB 4HAZB 2DIKA 1T5XD 5IAAC 1X1FA 2WLBA 3A4SC 3ODWA 1E10A 3LJUX 1FAOA 1XO3A 1ZE3D 2KDEB 3V3XA 2IY0B 4A6HA 4EFOA 3N3KB 4WJQA 4IG7B 2LMCA 2DWQA 2W2WA 3ONSA 2KUQA 1ZDVA 4CHJA 3GB1A 2COPA 4HPPA 1E5WA 5D2MB 5J18A 5CX3A 4K81A 1V1PA 1XODA 3N9YC 3Q8EA 3SR6A 3PG7A 2FUHB 1L4DB 1I4HA 1FXAA 1LB1A 4W9IA 3ZNZB 4K3CA 4WJ7A 1NDDA 2NPTA 3K9OB 4MSQB 4ICUA 1IBXB 2N9PC 1X1MA 2KWCA 3CF6E 4ITKA 3W9CB 3DVNU 2EKIA 3P4SB 2DZKA 4KZ0A 1KLUD 1T6BX 3A9KB 3PRMB 4URKA 4W9HA 4DX8A 2M4NA 2G3QB 1E9MA 1FXTB 5IP4D 3BIID 3MPXA 4JE3B 3E9SA 2UZSA 2H88B 2ACZB 5TR5A 1E0ZA 2CRFA 3RUIB 3M1IB 1OQNA 2MP2A 3RCZA 2DYQA 4XWTA 3Q3FA 2HTHB 1CJEA 3PHWB 3MJWA 2QKLA 4JKGA 3A58A 5GXGB 2IO3B 4XX5A 2CU1A 4C0AA 2LFIA 3UGBB 1E6EB 3NWDA 2ZEQA 5CTRC 5BYSA 1WSPA 5DPWA 2IGDA 3B2FA 1QT9A 4D0NB 1ACCA 4IC7B 1VCBA 4NJCA 2BPSA 1F2RI 3CSFA 4K1RB 3FSSA 1WX9A 5I4DA 1QOAA 3AE5B 2FCNA 1W1DA 4KGSA 4LDTB 2AEHA 1KLGD 2I38A 3Q8FA 3R66C 1P5TA 3B9JA 3A8PA 3L4PA 3A4RA 2WHIA 3APFA 2IGGA 2K6QA 2PZ1A 2D07B 3MC9A 4MGYE 2BT6A 5BYQA 2GBJA 2EC1A 4HWIB 1DOIA 1IYFA 1XKEA 1X86A 4MSMB 1VBHA 1K53A 3Q69A 5E6OA 1UZXB 3TEZA 1IGDA 4RGNA 5BMGA 5DI9B 4IAPA 3WANA 1Q5WB 3P4RB 4P16A 2RMMA 3DHIC 4DHJD 1WX7A 2GMIC 3RYTA 1TXDA 5LONB 1V5OA 4G0NB 2Z14A 2LRWA 1LO5D 1T77A 2D9WA 3VTVA 4MEMA 1WE6A 4RGOS 5JLJB 4H2AA 3RCPA 2DLBA 2N1WA 4WAAA 2BBCA 4PNKA 2KDIA 1YOVB 1ACAA 2OJRA 3NVVA 1KRHA 1TZ1A 1E8XA 2PJHA 2I2YA 3Q3MC 1WM3A 4XWXA 1Q0WB 2Y7BA 4K7WA 4DBGA 3U7DA 4PYUA 2CQUA 3NHEB 2DHJA 1VLBA 2GCLA 2BB6A 3IT6B 4EMOA 1JWUD 5M4YB 3TVVA 1F0ZA 2Z0PA 2DX5A 2R0DA 3AV8A 3IXSA 1ZXIA 2N7JA 1WGKA 4DK5A 4QXAB 2W54A 4WVFB 3FLVA 2ZVNA 2ZKMX 1YQ4B 3RT3B 2XNAC 3ULBA 4PS3A 4ILHA 5DPSA 1NVID 2CU3A 4A6QA 4C56C 2FIFA 3SHQA 1OFFA 2BB5A 4C00A 3DXCA 2CJOA 2Y5BB 2FDQA 2LI5A 2ZCBA 2WGSA 1TGZB 2GUMA 3C0RB 2YVCA 1P0RA 1WVHA 3SEBA 1SE3A 3BINA 1ST7A 1WE7A 3HW2B 3N20C 4BKSD 3TIXA 2GOWA 4EKUA 4NJ6A 4FJVB 1IGCA 2EMTA 1JWSD 4ILJA 2K22A 2C7MB 2PE6B 3N7CA 3N32A 1DYQA 2NBVB 2LG1A 3PS6A 4DDID 1QKZA 4IM3A 2LXCA 1ZXHA 4RFBA 2KFJA 1J8CA 2A4ZA 3DBRB 2B76B 2N23A 3LB8C 5D3DA 3ETRA 4MH0E 3V6EB 2ASQA 4TUUA 2QHOA 5KHOA 5C79A 1MFWA 1MVKA 1FO4A 3CWIA 2K8HA 1C1YB 3E9OA 1SEBD 4N58A 3ZLZA 3R8BA 1UBIA 3MHSD 2RDHA 1TY0A 1LGRA 2WQYB 5D3IB 2DZIA 2GCJA 2KVRA 2AQ2B 4GOUA 1PLSA 3UQAA 2D3GA 4CO7A 5D3WA 3AI5A 2JZ3B 4FBJB 1T0YA 2MBOA 1HZ5A 5CLQB 5HE2A 1WI0A 1RYJA 2JWUA 1Z87A 2DHKA 5JHHA 1XLQA 1L0YB 2COAA 2MW5A 4I6PA 2ZJDA 1SIJA 1XLPA 2KN5A 3ZVRA 1H4RA 1D4BA 3DXDA 1YN4A 3MC8A 5KCVA 1EU4A 2GI9A 3P1MA 2VRWB 4WH4A 4B0EA 1AQCA 4KGRA 2ADZA 3D8DA 2WXGA 2V3SA 2MX2A 3EA6A 2D3BA 1WJ4A 3AECB 2H7DA 1WZ0A 3F5RA 2WXIA 4HPMB 4DQOC 4ILGB 2YF0A 2Z0QA 1L4ZB 4YXDB 1SGHA 1ZSQA 1CQVA 2P0HA 3X0WA 4A6KA 3OLMD 4N9F4 4EZJA 3AEFB 4K2OA 1FPYA 3DBSA 2MJDA 2KDBA 1JMLA 1GGOA 2XK5A 4JIOU 2C7NB 2REXA 1UWXA 3JSVA 4JGHB 4MGKE 2DYMA 2VKIA 3TUOA 4HB2B 2J59M 2EELA 4C80A 5HI1A 1N5XA 1D6EC 1WIAA 4DIXA 1WXAA 1YN3A 2G1EA 1WMHB 4HPLB 2VH1A 2CODA 1SJHD 2Z0DB 4PYZA 1N3HA 4M02A 4KDIC 1L5PA 3L10B 5CHWA 1L6VA 3WYFB 2WXFA 4L1BA 2VH2A 2ICIA 2VZKD 3MJ5A 1V89A 2WS3B 3OJ3A 3PO0A 2MBBB 1P1AA 1PFJA 2BCJA 4NY0A 5JHBA 1YX6B 2W3RA 1VBGA 4RM8A 4PT5A 3T3OA 4XYCA 2ONQA 1U5DA 1U29A 1C4AA 1I7HA 4JL9A 3NWFA 2YLMA 2LUMA 4GMXB 3PSEB 5JHGA 1FGZA 3DQVA 4K17A 3TMPB 3ZGZA 3PTFC 1HZ6A 2I1KA 2JZZA 4XC2A 5IKCM 1FHOA 4FADA 4MDKE 3ZDMC 2FNJB 2SEBD 4B6WA 4F7HA 3Q3JA 1V5MA 3ECIA 4HROA 1ZYIA 5L81A 2MHJA 4KZCA 3BWUD 2DTCA 2HE7A 2NZ8B 5HE0A 1RJ2A 2RLOA 5AZGA 1V5UA 5HG2A 2R09A 5BYRA 2O6VD 3TL5A 1XCQL 1H10A 4B95A 3QA8A 1EO6A 1WJ6A 3NG0A 2DFKA 2LZ6A 1TKEA 2KIGA 4Z2NA 1BAKA 3HM6X 2J0JA 2QIEB 1B9RA 1WM2A 3QIJA 4A5KA 1NENB 4NJ7A 4RF1A 3T06A 1PGXA 3GZNB 3Q14C 1Q1OA 1UGMA 1RLFA 4B6HA 3HIEA 3EGRA 3R7QA 3VAWA 5J3TA 4L23A 4G50A 5C23A 2NMBA 1ISNA 2LRUA 2FCQA 2KFKA 2WX1A 3NS8A 3VRBB 5LOPB 1V86A 1A70A 2KTRA 2C7HA 3UF8A 4ZDVA 5JH5C 2G9HD 4HDQA 4AJYB 3K9PB 1OQYA 2D5GA 4KX6B 4W9FA 3RZFA 2CS4A 3FKYA 4GDLB 5FR6A 1MI0A 2ROZB 3PZ8A 3F0WA 1MG8A 2K2UA 1SE4A 2AX5A 3RPFC 4GPTB 4ARCA 2CB8A 1YNTE 3BVGA 3A1QA 2RGFA 1OQRA 2HJ8A 3KH0A 2D2QA 1NI2A 2KO3A 5CHVC 3SD5A 1V80A 3NSUA 1WGDA 2WXNA 2NVUI 3NVWA 4NQLB 5I2MA 3DOWA 3AMZA 5T8IA 3PVLA 1DROA 1AWDA 2HD5B 3H6NA 4AJWA 3RFZB 1HTOA 1I2HA 3B2GA 1QOGA 3O96A 2MBHA 4HAVB 4GOCA 2KLGA 1T3QA 3CIKA 1Y19B 1WZ3A 2IFSA 4LLGM 1E7VA 2YS5A 5G2NA 2ZZPB 3CXBB 2KIEA 1PMSA 4I6LB 1J7CA 1NTVA 2QC8A 2K2JA 2BS2B 2J0MA 1E7PB 4WIPA 5E6PA 3EFUA 1EAZA 1DGJA 2Q5WD 1P6SA 3UIOB 4FXCA 1GB4A 2KTFA 4NQKE 4FHKA 3D8EA 1WGUA 3AJ4A 1IBXA 1SB3C 4LNOA 2LHDA 1V8CA 3ZTDA 1WI1A 2Y5CA 3IFWB 1P7FA 3I9V1 1X05A 1RRPB 1IUEA 1E8ZA 5LXIB 5GMVA 3NVYA 4JKBA 3NUHB 2LBBA 2P8VA 3B08A 1JCKB 1SF0A 4NSWA 1JROA 4GXBA 1ZP0B 2L05A 1J0WA 1I4QA 1U5GA 1R7SA 1MI1A 2ZCCA 2VSZA 2L8JA 2L0FA 2BYEA 3AN1A 3ZW3A 2KWVB 2HTHA 3QHTA 1NEKB 4K7SA 5H8YE 4ZHPA 2ABDA 2WXQA 3U4EG 3RN9C 3BYTB 5JHAA 2LGIA 2LULA 4HXDA 4FLHA 4BFRA 1UPRA 4IM2A 1W1HA 4DXGA 1WXSA 2J4XA 1M94A 1Q10A 5BMHA 3ENEA 2GBKA 3HVZA 4FA6A 2V3NA 2CHWA 3KYCD 1C77A 4AUQC 1MJDA 2BS3B 1M7EA 4GDKB 3DBLB 2L32A 1AYFA 3RI7C 3TO1A 1RFAA 3UINB 1C9FA 2JXTA 5FI0A 2NR2A 5IN7A 4FN2A 2K25A 3P42A 2K39A 1FHWA 3NS1A 2D9ZA 2O2VA 1K5GB 1MPHA 4P1CC 2XQNM 2M56B 3W5UB 2DHZA 4CHMA 1NVLA 2KDFB 1YQ3B 2PPHA 3N1YC 3W2DA 1BXTA 3H7PB 3W1YA 3KQ4A 5AZFA 3E9LA 1KZGA 2PEAA 3VUXA 1L2NA 2AL3A 4IWOA 2KGXB 1DDVA 2LD9A 3SUZA 4MM3A 3NWAA 3U52E 3MTNB 2N0YA 4KDLB 5D94A 2WXKA 5AUKA 1MIZB 3W5VB 3KUDB 2DAFA 3AU5A 1KH0A 1UUPA 2KC1A 3SU8X 2WDVB 5BO4B 3GS2A 1V88A 4FJYA 5CHFA 3DBHI 2KQ7A 1M7RA 5D3VA 4HSIA 4YSZB 3R3MA 4IUMB 5DHAB 2VRRB 3VHTC 4ANUA 3ULCA 4WWMA 3ODXA 3ML9A 4BKTA 2NMQA 2MJ3A 1J0GA 1DOXA 1QF6A 4PS8A 3AH7A 2J52A 1WGRA 4AOFA 1SJED 4FHJA 2KKCA 1JDEA 1T0QC 1L7YA 3C19A 2N9XA 5G55A 1I35A 1FNVA 3LDZE 2BF8B 3CSTA 4A3OA 4MELA 4S17A 3C8YA 5HE1A 1AARA 1QOFA 2WYQA 4WSFA 4NAWB 2AQ3B 3OANA 2PLPA 1XCGA 2ZVOA 1EVHA 3PSCA 1K51A 3PREA 2LOZA 4KSKC 2N4FA 4ICVA 4TMAB 3AULA 3EC8A 2M0XA 4HAXB 1AWEA 1GNUA 5D6JB 1IP9A 3VXWA 1R4MB 3SYXA 2DN6A 2INDC 2AWTA 1RAXA 1J7AA 1ET6A 5TSSA 1BTKA 1TT5B 4XZ4A 3Q8CA 2MLBA 3Q3NC 4BOZB 3RNBC 1KTKA 2RPQA 3QJZA 2KANA 1KF6B 3TBLD 2RDGA 3AEGB 3ZQ4A 1PGBA 2K5PA 2PMVA 2L52A 3KWVA 1SE9A 2LGYA 1I4PA 1MK9B 3IAS1 3ZIMA 3SV1A 3E66A 2K9XA 3ENBA 3BYYB 2ROVA 4O1NA 4IM0A 4IKGA 4P6VF 1FRRA 4ZYNA 2KUPA 1OY2A 4HAWB 1HB8A 2J0KA 4KHOA 4MT7A 2WDRB 3BK1A 1V6EA 1WGQA 2MBQA 2RSGA 3AE6B 2B3AA 1G6JA 1GC7A 3N1XC 4WQOB 2MEKA 2NPTB 3I5JC 2A5UA 3KLSX 2UYZB 2JU6X 4A6FB 3U7ZA 4IWPA 2L83A 4BBNC 1TS3A 4TQ1A 3A8QA 3Q6BA 1WJUA 2C9WB 1I4RA 1WJ1A 4G3XB 1T0SC 2D10A 3A9JB 4K7UA 3H1UA 1KZ7A 2RPVA 4MJSA 2PTLA 2HDEA 4GN1A 2V1YA 2MP2B 4Q2JA 5HHDG 4JK7A 2IO1B 1JRPA 2BTEA 2KACA 1XLNA 2WXJA 5HE3A 4HVBA 2IO2B 2KQSA 2YEPB 2KQ4X 1WG7A 1K52A 1FIQA 3FM8C 1C76A 4WQMA 5IO9A 3NVZA 4HAUB 1V2YA 1NBFC 2JUOA 1TS4A 1LM8B 5KQ1A 1MHXA 1PQSA 2M0AA 4X57B 3B0AA 2RR9A 2EMSA 5IA7A 4YTMB 1WMHA 2W82A 2KOXA 2K8CA 1L0VB 4CSQA 2RDBC 1EU3A 1YMHE 1NTIA 1WWTA 4ARIA 2JQRB 3FC4A 4Z2MB 2DYBA 4UDUC 3TEWA 1OGWA 2MSED 1V5PA 4KHBA 3DDCB 3VTUA 5D3YA 2OHFA 1OTRB 2K3UA 1JWAD 3NOBA 1RRBA 3ZXVA 2DBYA 4MY6A 4JPSA 2RUKB 3ODOA 2P0DA 3DBRI 3SFEB 3AB5A 3GOEA 2QJLA 3KW5B 1HBKA 5JVLA 4OVVA 1KLVA 5FI1A 2KMAA 3P2BA 3URYA 3AE8B 4CQNA 2I5FA 1YN5A 2WXMA 4WAFA 3EUB2 3P4QB 2Z59A 4OZBA 4BZAA 4HB3B 5D27A 2FCMA 3CMMB 2FCSA 1MK7B 3SDLC 2QILA 5HFYA 2GLSA 3H7SA 3AE4B 3QAQA 4OSNA 1VJKA 4BVUC 3M3JA 1D3ZA 2E3TA 1GG3A 1FNUA 4BKGA 1Z2MA 2SAKA 4W9KA 5DH9B 2W2XC 2N9LA 3E56A 4C4VA 2NBUA 2Z0EB 2M17A 3ZRFA 2IZVB 2XBBC 3FILA 2FAZA 2LVPA 4F1SA 5IJMA 4ZHOA 4US8A 2DX5B 4HB0B 1VD2A 2FUG1 1Z5SB 2KDMA 2LUEA 2W2XD 3ZJUA 2MKRA 2OEDA 3H8HA 2DKQA 4KHAA 1FFVA 4BOSC 3PV1A 2R2YA 1MHHE 3HIZA 1IRSA 1SXTA 4GZUA 5EFXA 1RM6C 3WA0A 3V5WA 5E6NA 4E71A 1MPEA 1EM7A 4GLSC 3OJ4B 1QOBA 4HRSA 2KT7A 2INCC 2X0SA 3DWMA 3EECA 4LCDE 2GRIA 2DX1A 2YS1A 4HCNB 3NJTA 4JWUC 2D9VA 4MT5A 3T8MA 3GYPA 3UIPB 5LG4B 1ESFA 3Q8AA 4DX90 4KV2A 2LGSA 4KIKB 1WX8A 3NRZA 5J17A 3ZUNA 3V05A 4WJNA 2MDXA 2G4DB 1MKEA 2L1CA 4JQWC 3R2TA 4FULA 3ZNID 2FJLA 1C4PA 4GIVA 1UH6A 3P6AA 4W9EA 2NS5A 2KK8A 4JX1C 2INPE 1JQ4A 3NZUA 4ZRJA 1QILA 4IOYX 4A3PA 5DHFB 1KC7A 2W55A 3SNHA 2WNMA 1V97A 1ZDXA 3DCGA 4AQ7A 4RNAA 3BVZA 1WR6E 4MK0A 1WGYA 4WWPA 1XD3B 1GC6A 1U27A 1R4NI 3PP2A 3RD2A 2KMMA 4JKCA 1UELA 2JYEA 2V4LA 1WY8A 2BYTA 1Y5OA 1LFDA 4W9JA 3IVFA 2G45B 1V61A 3AE7B 2MRPA 3BK2A 3LXFA 2IYBA 3AE3B 2O6VA 2J42A 2ZW1A 4RF0A 3RZWC 5HKHA 1D5MC 3MFGA 4IW0A 4ZYSA 1DDWA 4B0MA 3GZNI 2COCA 3GE3C 1HQRD 2RSUA 3PT2B 2KD0A 1UNRA 2LGXA 3V60A 2DHIA 1BUIC 2LYDA 2HTME 4G11A 4PQ0A 1YIWA 1N63A 4TKNA 2XK5B 2RD0A 3JSVB 3W1SC 3UQBA 1WYWB 3WAPA 2JXXA 1TYGB 3L17A 4ZOHC 1FD6A 4QAYA 2K1FA 2OQBA 1DDMA 2L0TA 5LLIA 2WDTB 4HEA1 4YONA 4N59A 4A55A 4CYEA 1QZEA 4E3CA 3HQCA 2KWUB 2W9NA 1KFYB 1E8WA 1UBQA 5L83A 5C2TB 2V76A 4OT1A 4J6IA 4B9KA 3AM9A 1OMWA 3PZ7A 5D3XA 3GE8C 4M8MA 1V81A 3EHVA 4YTPB 5FK9C 1KM7A 2WXLA 1MG4A 4YTNB 2HRJA 1XQQA 3MC0B 3AEAB 2BYVE 1RWSA 2K8EA 3WAMA 4HCPB 4XDCA 1JWBD 1K8RB 1U2BA 3VTWA 2WU2B 3VH4B 1FFUA 2RGNB 3RMKC 1N6ZA 3DVGX 4KVGB 3E9PA 4DWFA 3J9CA 1B1ZA 2R2OA 3TFMA 3VUWA 1UNSA 1HTQA 2G35A 2ON8A 4L1RA 3MHZA 2Z0OA 3R7RA 3A9KA 1VR9A 1P3RA 3WIMA 1T0RC 1X11A 2CAYA 4BBKA 1PGAA 2BKRB 2JVCA 2YEPF 4I6NB 4EZKA 1E90A 4KKIA 1F2RC 2GBMA 1TTNA 2WX0A 4IFSA 5CLLB 1AW7A 2Y8GA 5J2RA 2YT0A 1PFDA 2RNRB 1BWNA 3VQIA 4D2KA 2TSSA 3UI3A 4AP4C 1Q67A 2K8BA 1TS2A 3ZVVA 1TY2A 2H7EA 1N62A 4OZCA 1SBBB 4HLEA 4MGZE 4ZRKA 4US9A 5BMIA 3B1LX 2H89B 3HSAA 3KY9A 4M0WB 3L54A 4K3BA 4MACA 3DVGY 1CK1A 1FOEA 4RGTA 2KTRB 4II3B 2COFA 2D3CA 5MPOA 1QLBB 1ZGUB 2OOBB 3GP7A 2JF5A 3DBLI 5FR3A 2LWPA 4W9GA 2MH7A 4TV3A 1DOYA 2Y8FA 4W9CA 3HRDD 1QQGA 1FB8A 3QC8B 1DBHA 3GYOA 1C79A 2JYTA 1FHXA 2Y3AA 4AS1A 1A5RA 3P7ZA 3ZTCA 3FEHA 3OG5A 2KCJA 2KX3A 1UWMA 2DZJA 2Z4DA 1JALA 3PRPB 4OVUA 4XGAB 4HKZE 3NZSA 3AEBB 2P0FA 4NNJB 4P7IA 4W9DA 3R2IA 4HDOA 2GBRA 1EWCA 4AWJA 1BT0A 2MFQA 2DKPA 2J7QB 2MJEA 1CZPA 2MWSB 2PE9A 2LVQA 1XF5L 2XEWA 4OW0A 1J7BA 5AZHA 5L95C 1XR0B 4ZRIA 1UNPA 2CY5A 3PVWA 3PVUA 3O65B 4ZRQA 3KWLA 3NZ3A 3ZNGC 1STEA 1LQBA 3ML4A 5C1ZA 4II2B 1LW3A 4A6FA 1ET9A 2KJ6A 2KJRA 1QC6A 1YD8U 2GBNA 2L3ZA 1PDXA 4BBNF 2ZPYA 1GPXA 2L2IA 3H9DA 3DBHB 4F8CB 1VZ7A 2X8XX 4RH6A 4YT0B 4EZLA 3CIRB 3A9JA 4DXAB 4RM9A 3QBVB 2X38A 1FNWA 3DWGC 1WGGA 5C16A 1NYQA 2KAJA 2WXHA 2C5LC 3TCAA 3B77A 1N60A 5JP4A 3AEEB 5E6JA 4KAXB 2ZNVB 1U5EA 1UD7A 3VR9B 5JXVA 2G4SA 5J3YA 1XCTL 2JSVX 4MH8A 3BY4B 1K50A 5EE0A 1ZW7A 3VVWB 2IPKD 4EEWA 4JKDA 1FM0D 2J53A 2JWZA 2NTSA 1KOTA 4GU2A 5DPTA 1HE8A 5C5BB 3P63A 1EUVB 1VDVA 2YT1A 2AQ1B 5H92C 3U8ZA 4OVZA 2BWFA 5AEKB 2WH5A 3RNGC 2NBVA 1R4MI 1C4CA 3EFCA 1JRUA 4YSYB 2O2VB 2JRIB 2KWDA 1ZC4B 3I63C 2NTTA 1YX5B 3AE1B 3HVDA 3TEYA 1FRDA 1UEFA 3RNFC 3KSYA 5I2SA 5DIFB 3OAWA 2QEJC 1SIFA 3V61A 1WXQA 2WP9B 1UGJA 1WFYA 2RVBB 4QJ3B 1V1OA 1WRDB 2KN4A 1NU2A 1V1PB 1WGHA 3D32A 2WXOA 2DENB 2M14A 2YRYA
chains in the Genus database with same CATH topology
3D8FA 2LJ5A 3QQ8B 1I7AA 1WF9A 1V49A 1C3TA 2CY4A 4CHKA 2KHWB 3SO6A 1GJZA 3PGEA 2L7RA 4W9LA 4EOYA 3AXCA 3L08A 3A33B 1U5FA 3KZ1A 4F7UP 1K5DB 1S1QB 2FJ9A 1CMXB 4HJKA 2D9XA 2RQ1A 3DPDA 2GS0A 2OTXA 2YSZA 4JKGB 3KUZA 3PEGA 5D7GA 1ZVRA 4GMVA 2NCNA 5DCNA 1ZM0A 3M63B 3DVNV 1WXMA 2JPHA 2X18A 2FIDA 2L76A 1E7UA 1DIKA 3QK0A 1LXDA 3IBEA 4JK8A 2N9EB 3VFKA 5KQ4A 3JVZX 3TW1A 4M8NA 4BKSA 1XX0A 2KJHB 1OEYJ 1IPGA 1TBEA 4LJOB 4KIKA 3APDA 3UZTA 4JKAA 2KX0A 1X1GA 4RMAA 3VOQA 3WALA 4ANVA 3KYDD 2MBEA 3ZKJC 4MGIE 2I1JA 2IYDB 3ZDTA 4K2PA 4DHJB 4DDGD 4TYZA 4JKFA 1EGXA 1U4AA 1MIXA 3PZDA 2DYOA 1MAIA 4GB9A 4JKEA 2KNBA 2IO0B 2BGFA 3JW0X 2K00A 3AU4A 4GGQA 4WJPA 3PLVA 3PRZA 3A98B 3HM3A 4MJSB 4JK9A 3IG3A 4ANWA 3DXEA 1B55A 4ASWC 3U30A 2LGDA 2DA0A 1HB6A 3KUCB 2IY1B 4HHVA 2KMCA 2GJYA 3ZRCA 3HK0A 4EJNA 4HK2A 3RULA 4GDLA 4F7ZA 2IBIB 4F7GA 4Y94A 4GSWA 5JZEB 3ALBA 1YJ1A 2DZMA 4WWNA 1P9DU 2YS3A 4NPNA 1GUAB 1XD4A 4KHBB 4TQ0A 2UWQA 3HHMA 1J19A 1UNQA 4E74A 1OEYA 1DYNA 2LXAA 1WR1A 1KBLA 2D11A 2KXJA 4FJZA 3VDZA 1Y8RC 2AYOB 3VIAA 5C6RA 1WJMA 2Z59B 5DPRA 2D9YA 3QWMA 4YL8A 2WWZA 2JP2A 1UPQA 3VUYA 1EF5A 3M62B 2CR5A 2DAJA 3FP5A 2NBWB 3IHPC 2M8SA 3V6CB 2LOXA 3KRWA 4WWOA 4HAYB 2M38A 2LVOA 1EF1A 5EDSA 2CKHB 1TJ6A 4A20A 2BWES 2Q13A 3QWZB 2ELAA 3G9WA 2ZPNA 2BYFA 2I5CA 3NY5A 3QX1A 2MQJA 1P3QU 1YQBA 1WH3A 4GDKA 3SBTA 1NTYA 5GOWB 2L00B 1P98A 1I42A 3L13A 2CHXA 4DHZB 2LASA 3MDBC 3H7PA 2D4QA 3PLUA 4JKHA 1WXVA 3SBGA 2UVMA 3KVFB 3KRXA 3W1SA 3L16A 1V9JA 1FGYA 1W1GA 4LJPB 1TQZA 1KI1B 5LXHA 2C60A 2JT4B 4EUTA 2UZRA 3EPYA 4H8SA 4DBBA 1H8CA 3M95A 2N7EA 1V5TA 1XT9B 2JY6A 2N1VA 3PPAA 2ZNVC 3LJ3A 1ZKHA 2R82A 2MA9B 3T9LA 2EKEC 4HB4B 2QKMA 1SHCA 2KZRA 1KJTA 3ML8A 4KSLC 3APCA 2DYNA 1F9JA 2N7DA 2MCNB 3VH3B 3L0WB 3N30A 4ANXA 2LKOA 2JRHA 2ELBA 2AL6A 3S2AA 4IWQA 5J3QA 3PHXB 1S3SG 3JYUA 4DHZE 3V62A 2O6VB 3BJIA 4JLCA 2R2QA 1ZC3B 2MWNB 5KHQA 3I3TB 4NAWA 3TJPA 3WAOA 2CHZA 3ZO5B 2E2XA 2KFKB 4WJOA 1WJNA 2K6DB 3QARA 4LDTD 2EJ8A 2DLWA 2KC2A 5C5BA 4L6EA 3ZNHB 3X23A 1BTNA 4HATB 2BKFA 4PS7A 2KLCA 1E8YA 2M1MA 3QCAA 3A1QB 4HAZB 2DIKA 5IAAC 1X1FA 3A4SC 3ODWA 3LJUX 1FAOA 2KDEB 2IY0B 4A6HA 4EFOA 3N3KB 4WJQA 4IG7B 2W2WA 3ONSA 4CHJA 2COPA 1E5WA 5D2MB 5J18A 5CX3A 4K81A 1XODA 3PG7A 2FUHB 1LB1A 4W9IA 3ZNZB 4WJ7A 1NDDA 2NPTA 3K9OB 4MSQB 4ICUA 2N9PC 1X1MA 2KWCA 3CF6E 3DVNU 2DZKA 4KZ0A 3A9KB 3PRMB 4URKA 4W9HA 4DX8A 2M4NA 2G3QB 1FXTB 3MPXA 2UZSA 5TR5A 2CRFA 3RUIB 3M1IB 1OQNA 2MP2A 3RCZA 2DYQA 3Q3FA 2HTHB 3PHWB 3MJWA 2QKLA 4JKGA 2IO3B 4XX5A 2CU1A 4C0AA 3UGBB 2ZEQA 5CTRC 5DPWA 4D0NB 4IC7B 1VCBA 2BPSA 3CSFA 4K1RB 3FSSA 1WX9A 2FCNA 1W1DA 4LDTB 2AEHA 3R66C 1P5TA 3A8PA 3A4RA 3APFA 2K6QA 2PZ1A 2D07B 4MGYE 2GBJA 2EC1A 4HWIB 1IYFA 1XKEA 1X86A 4MSMB 1VBHA 5E6OA 1UZXB 5DI9B 4IAPA 3WANA 1Q5WB 4DHJD 1WX7A 2GMIC 3RYTA 1TXDA 5LONB 1V5OA 4G0NB 2LRWA 2D9WA 3VTVA 4MEMA 1WE6A 5JLJB 3RCPA 2N1WA 4WAAA 4PNKA 2KDIA 1ACAA 2OJRA 1TZ1A 1E8XA 2PJHA 1WM3A 4XWXA 1Q0WB 2Y7BA 4K7WA 4DBGA 3U7DA 4PYUA 2CQUA 3NHEB 2DHJA 2GCLA 4EMOA 3TVVA 2Z0PA 2DX5A 2R0DA 4DK5A 4WVFB 3FLVA 2ZVNA 3RT3B 3ULBA 4PS3A 4ILHA 5DPSA 2FIFA 3SHQA 3DXCA 2Y5BB 2FDQA 2LI5A 2ZCBA 1TGZB 3C0RB 2YVCA 1P0RA 1WVHA 3BINA 1ST7A 1WE7A 3HW2B 4BKSD 3TIXA 2GOWA 4EKUA 4NJ6A 4FJVB 2EMTA 4ILJA 2C7MB 2PE6B 3N7CA 3N32A 2NBVB 2LG1A 3PS6A 4DDID 4IM3A 2LXCA 2KFJA 1J8CA 2A4ZA 2N23A 4MH0E 3V6EB 2ASQA 4TUUA 2QHOA 5KHOA 5C79A 2K8HA 1C1YB 3E9OA 3ZLZA 1UBIA 3MHSD 2DZIA 2GCJA 2KVRA 1PLSA 3UQAA 2D3GA 4CO7A 5D3WA 3AI5A 2JZ3B 4FBJB 1T0YA 2MBOA 5CLQB 5HE2A 1WI0A 1Z87A 2DHKA 5JHHA 2COAA 2MW5A 4I6PA 2ZJDA 2KN5A 3ZVRA 1H4RA 3DXDA 5KCVA 2VRWB 1AQCA 2ADZA 3D8DA 2V3SA 2MX2A 1WJ4A 2H7DA 1WZ0A 3F5RA 4HPMB 4ILGB 2YF0A 2Z0QA 1SGHA 1ZSQA 2P0HA 3X0WA 4A6KA 3OLMD 4N9F4 4EZJA 4K2OA 3DBSA 2KDBA 1GGOA 2XK5A 4JIOU 2C7NB 2REXA 3JSVA 4JGHB 4MGKE 2DYMA 2VKIA 4HB2B 2J59M 1WIAA 1WXAA 1WMHB 4HPLB 2CODA 2Z0DB 4PYZA 1N3HA 4KDIC 3L10B 5CHWA 3WYFB 1V89A 3OJ3A 2MBBB 1P1AA 1PFJA 2BCJA 4NY0A 5JHBA 1YX6B 1VBGA 4RM8A 1U5DA 1U29A 4JL9A 2YLMA 4GMXB 3PSEB 5JHGA 1FGZA 3DQVA 4K17A 3TMPB 3PTFC 2I1KA 2JZZA 4XC2A 1FHOA 4FADA 4MDKE 3ZDMC 2FNJB 4B6WA 4F7HA 3Q3JA 1V5MA 3ECIA 5L81A 4KZCA 2DTCA 2HE7A 2NZ8B 5HE0A 1RJ2A 2RLOA 5AZGA 1V5UA 2R09A 2O6VD 3TL5A 4B95A 1H10A 3QA8A 1EO6A 1WJ6A 2DFKA 2LZ6A 4Z2NA 1BAKA 3HM6X 2J0JA 1WM2A 3QIJA 4A5KA 4NJ7A 3T06A 1Q1OA 1UGMA 1RLFA 4B6HA 3R7QA 3VAWA 5J3TA 4G50A 5C23A 2NMBA 1ISNA 2LRUA 2FCQA 2KFKA 2WX1A 3NS8A 5LOPB 1V86A 2KTRA 2C7HA 3UF8A 4ZDVA 5JH5C 4HDQA 4AJYB 3K9PB 1OQYA 4W9FA 3RZFA 2CS4A 4GDLB 5FR6A 2ROZB 3F0WA 1MG8A 2K2UA 4GPTB 2CB8A 3A1QA 2RGFA 2HJ8A 3KH0A 2D2QA 1NI2A 2KO3A 5CHVC 3SD5A 1V80A 3NSUA 1WGDA 2NVUI 4NQLB 3DOWA 3PVLA 1DROA 2HD5B 3H6NA 4AJWA 1I2HA 2MBHA 3O96A 4HAVB 4GOCA 2KLGA 3CIKA 1Y19B 1WZ3A 2IFSA 1E7VA 2YS5A 5G2NA 2ZZPB 3CXBB 1PMSA 4I6LB 1NTVA 2K2JA 2J0MA 5E6PA 3EFUA 1EAZA 1P6SA 3UIOB 2KTFA 4NQKE 4FHKA 3D8EA 1WGUA 3AJ4A 3ZTDA 1WI1A 3IFWB 1X05A 1RRPB 1E8ZA 5LXIB 5GMVA 4JKBA 2LBBA 2P8VA 3B08A 4NSWA 4GXBA 2L05A 1J0WA 1U5GA 2ZCCA 2VSZA 2L8JA 2L0FA 2BYEA 3ZW3A 2KWVB 2HTHA 3QHTA 4K7SA 2ABDA 5JHAA 2LULA 4HXDA 4FLHA 4BFRA 1UPRA 4IM2A 1W1HA 1WXSA 1M94A 3ENEA 2GBKA 4FA6A 2CHWA 3KYCD 4AUQC 1M7EA 4GDKB 3TO1A 1RFAA 3UINB 5FI0A 2NR2A 4FN2A 2K25A 2K39A 1FHWA 2D9ZA 2O2VA 1K5GB 1MPHA 2XQNM 2DHZA 4CHMA 1NVLA 2KDFB 2PPHA 3H7PB 3W1YA 5AZFA 3E9LA 1KZGA 2PEAA 3VUXA 1L2NA 2AL3A 4IWOA 2KGXB 1DDVA 2LD9A 3SUZA 4MM3A 3MTNB 2N0YA 4KDLB 5D94A 1MIZB 3KUDB 2DAFA 3AU5A 2KC1A 3SU8X 5BO4B 1V88A 4FJYA 5CHFA 3DBHI 2KQ7A 1M7RA 5D3VA 3R3MA 4IUMB 5DHAB 2VRRB 3VHTC 4ANUA 3ULCA 3ODXA 3ML9A 4BKTA 1J0GA 4PS8A 1WGRA 4AOFA 4FHJA 2KKCA 1JDEA 1L7YA 2N9XA 5G55A 1I35A 3LDZE 2BF8B 3CSTA 4A3OA 4MELA 5HE1A 1AARA 2WYQA 4WSFA 4NAWB 3OANA 1XCGA 2ZVOA 1EVHA 3PSCA 3PREA 2LOZA 4KSKC 2N4FA 4ICVA 3AULA 3EC8A 2M0XA 4HAXB 1AWEA 1GNUA 5D6JB 1IP9A 3VXWA 3SYXA 2DN6A 2AWTA 1RAXA 1BTKA 4XZ4A 2MLBA 4BOZB 2RPQA 3QJZA 2KANA 3TBLD 1SE9A 2LGYA 1MK9B 3ZIMA 3SV1A 3E66A 3ENBA 2ROVA 4IM0A 4ZYNA 2KUPA 1OY2A 4HAWB 1HB8A 2J0KA 4KHOA 4MT7A 1V6EA 1WGQA 2MBQA 2RSGA 2B3AA 1G6JA 1GC7A 4WQOB 2NPTB 2A5UA 2UYZB 4A6FB 4IWPA 4BBNC 4TQ1A 3A8QA 1WJUA 2C9WB 1WJ1A 4G3XB 2D10A 3A9JB 4K7UA 3H1UA 1KZ7A 4MJSA 4GN1A 2V1YA 2MP2B 4JK7A 2IO1B 5HE3A 4HVBA 2IO2B 2KQSA 1WG7A 3FM8C 4HAUB 1V2YA 1NBFC 2JUOA 1LM8B 5KQ1A 1PQSA 4X57B 3B0AA 2RR9A 2EMSA 5IA7A 1WMHA 2KOXA 2K8CA 1NTIA 4Z2MB 2DYBA 1OGWA 2MSED 1V5PA 3VTUA 3DDCB 5D3YA 1OTRB 3NOBA 1RRBA 4MY6A 2RUKB 3ODOA 2P0DA 3DBRI 3GOEA 3KW5B 1HBKA 5JVLA 4OVVA 1KLVA 5FI1A 2KMAA 3P2BA 2I5FA 4HB3B 5D27A 2FCMA 3CMMB 1MK7B 2FCSA 3SDLC 3H7SA 3QAQA 4BVUC 3M3JA 1D3ZA 1GG3A 4BKGA 1Z2MA 4W9KA 5DH9B 2W2XC 2NBUA 2Z0EB 2M17A 3ZRFA 2IZVB 2XBBC 2FAZA 2LVPA 4F1SA 5IJMA 2DX5B 4HB0B 1VD2A 1Z5SB 2LUEA 2W2XD 2MKRA 2DKQA 4KHAA 4BOSC 3PV1A 3HIZA 1IRSA 4GZUA 5EFXA 3WA0A 3V5WA 5E6NA 4E71A 3OJ4B 2X0SA 3EECA 4LCDE 2DX1A 2YS1A 4HCNB 2D9VA 3T8MA 3GYPA 3UIPB 4KV2A 4DX90 4KIKB 1WX8A 5J17A 3ZUNA 4WJNA 2MDXA 2G4DB 1MKEA 2L1CA 4JQWC 4FULA 3ZNID 2FJLA 4GIVA 1UH6A 3P6AA 4W9EA 2NS5A 2KK8A 3NZUA 4ZRJA 4IOYX 4A3PA 5DHFB 1KC7A 3SNHA 3DCGA 1WR6E 4MK0A 1WGYA 4WWPA 1XD3B 1GC6A 1U27A 1R4NI 3PP2A 3RD2A 4JKCA 1UELA 2V4LA 1WY8A 1Y5OA 1LFDA 4W9JA 3IVFA 2G45B 1V61A 2MRPA 2IYBA 3RZWC 2O6VA 5HKHA 4IW0A 1DDWA 3GZNI 2COCA 2RSUA 3PT2B 2KD0A 1UNRA 2LGXA 3V60A 2DHIA 2LYDA 4G11A 4PQ0A 1YIWA 4TKNA 2XK5B 2RD0A 3JSVB 3W1SC 3UQBA 1WYWB 3WAPA 2JXXA 3L17A 2K1FA 2OQBA 1DDMA 2L0TA 5LLIA 2WDTB 4YONA 4CYEA 1QZEA 4E3CA 3HQCA 2KWUB 2W9NA 1E8WA 1UBQA 5L83A 2V76A 4J6IA 4B9KA 1OMWA 5D3XA 4M8MA 1V81A 3EHVA 1KM7A 2HRJA 1XQQA 2BYVE 3WAMA 4HCPB 1K8RB 1U2BA 3VTWA 3VH4B 2RGNB 3DVGX 4KVGB 3E9PA 4DWFA 2R2OA 3TFMA 3VUWA 2G35A 2Z0OA 3R7RA 3A9KA 1P3RA 3WIMA 1X11A 2CAYA 4BBKA 2BKRB 2JVCA 4I6NB 4EZKA 1E90A 2GBMA 1TTNA 2WX0A 4IFSA 5CLLB 2Y8GA 5J2RA 2YT0A 2RNRB 1BWNA 3VQIA 4AP4C 1Q67A 2K8BA 3ZVVA 2H7EA 4HLEA 4MGZE 4ZRKA 3B1LX 3KY9A 4M0WB 3L54A 3DVGY 1FOEA 2KTRB 4II3B 2COFA 1ZGUB 2OOBB 2JF5A 3DBLI 2LWPA 4W9GA 4TV3A 2Y8FA 4W9CA 1QQGA 1FB8A 3QC8B 1DBHA 3GYOA 1FHXA 1A5RA 3P7ZA 3ZTCA 3FEHA 2KCJA 2KX3A 2DZJA 3PRPB 4OVUA 3NZSA 2P0FA 4NNJB 4P7IA 4W9DA 4HDOA 2GBRA 4AWJA 1BT0A 2MFQA 2DKPA 2J7QB 2MWSB 2PE9A 2LVQA 2XEWA 5AZHA 5L95C 1XR0B 4ZRIA 1UNPA 2CY5A 3PVWA 3PVUA 3O65B 3ZNGC 1LQBA 3ML4A 5C1ZA 4II2B 1LW3A 4A6FA 2KJ6A 2KJRA 1QC6A 1YD8U 2GBNA 2L3ZA 4BBNF 2ZPYA 2L2IA 3H9DA 4F8CB 4EZLA 3A9JA 4DXAB 4RM9A 3QBVB 1WGGA 5C16A 2C5LC 3TCAA 5JP4A 4KAXB 2ZNVB 1U5EA 1UD7A 2G4SA 5J3YA 3VVWB 3BY4B 1ZW7A 4EEWA 4JKDA 2JWZA 1KOTA 4GU2A 5DPTA 1HE8A 5C5BB 1EUVB 2YT1A 3U8ZA 2BWFA 5AEKB 2WH5A 1R4MI 1JRUA 2O2VB 2JRIB 1ZC4B 1YX5B 1UEFA 3KSYA 5DIFB 3OAWA 1SIFA 3V61A 1WFYA 2RVBB 1WRDB 1NU2A 1WGHA 3D32A 2DENB 2M14A 2YRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8F A;  2LJ5 A;  3QQ8 B;  1I7A A;  1WF9 A;  1V49 A;  1C3T A;  2CY4 A;  4CHK A;  2KHW B;  3SO6 A;  1GJZ A;  3PGE A;  2L7R A;  4W9L A;  4EOY A;  3AXC A;  3L08 A;  3A33 B;  1U5F A;  3KZ1 A;  4F7U P;  1K5D B;  1S1Q B;  2FJ9 A;  1CMX B;  4HJK A;  2D9X A;  2RQ1 A;  3DPD A;  2GS0 A;  2OTX A;  2YSZ A;  3KUZ A;  3PEG A;  5D7G A;  1ZVR A;  4GMV A;  2NCN A;  5DCN A;  1ZM0 A;  3M63 B;  3DVN V;  1WXM A;  2JPH A;  2X18 A;  2FID A;  2L76 A;  1E7U A;  3QK0 A;  1LXD A;  3IBE A;  2N9E B;  3VFK A;  5KQ4 A;  3JVZ X;  3TW1 A;  4M8N A;  4BKS A;  1XX0 A;  2KJH B;  1OEY J;  1IPG A;  1TBE A;  4LJO B;  4KIK A;  3APD A;  3UZT A;  2KX0 A;  1X1G A;  4RMA A;  3VOQ A;  3WAL A;  4ANV A;  3KYD D;  2MBE A;  3ZKJ C;  4MGI E;  2I1J A;  2IYD B;  3ZDT A;  4K2P A;  4DHJ B;  4DDG D;  4TYZ A;  1EGX A;  1U4A A;  1MIX A;  3PZD A;  2DYO A;  1MAI A;  4GB9 A;  2KNB A;  2IO0 B;  2BGF A;  3JW0 X;  2K00 A;  3AU4 A;  4GGQ A;  4WJP A;  3PLV A;  3PRZ A;  3A98 B;  3HM3 A;  4MJS B;  3IG3 A;  4ANW A;  3DXE A;  1B55 A;  4ASW C;  3U30 A;  2LGD A;  2DA0 A;  1HB6 A;  3KUC B;  2IY1 B;  4HHV A;  2KMC A;  2GJY A;  3ZRC A;  3HK0 A;  4EJN A;  4HK2 A;  3RUL A;  4GDL A;  4F7Z A;  2IBI B;  4F7G A;  4Y94 A;  4GSW A;  5JZE B;  3ALB A;  1YJ1 A;  2DZM A;  4WWN A;  1P9D U;  2YS3 A;  4NPN A;  1GUA B;  1XD4 A;  4KHB B;  4TQ0 A;  2UWQ A;  3HHM A;  1J19 A;  1UNQ A;  4E74 A;  1OEY A;  1DYN A;  2LXA A;  1WR1 A;  2D11 A;  2KXJ A;  4FJZ A;  3VDZ A;  1Y8R C;  2AYO B;  3VIA A;  5C6R A;  1WJM A;  2Z59 B;  5DPR A;  2D9Y A;  3QWM A;  4YL8 A;  2WWZ A;  2JP2 A;  1UPQ A;  3VUY A;  1EF5 A;  3M62 B;  2CR5 A;  2DAJ A;  3FP5 A;  2NBW B;  3IHP C;  2M8S A;  3V6C B;  2LOX A;  3KRW A;  4WWO A;  4HAY B;  2M38 A;  2LVO A;  1EF1 A;  5EDS A;  2CKH B;  1TJ6 A;  4A20 A;  2BWE S;  2Q13 A;  3QWZ B;  2ELA A;  3G9W A;  2ZPN A;  2BYF A;  2I5C A;  3NY5 A;  3QX1 A;  2MQJ A;  1P3Q U;  1YQB A;  1WH3 A;  4GDK A;  1NTY A;  5GOW B;  2L00 B;  1P98 A;  1I42 A;  3L13 A;  2CHX A;  4DHZ B;  2LAS A;  3MDB C;  3H7P A;  2D4Q A;  3PLU A;  1WXV A;  2UVM A;  3KVF B;  3KRX A;  3W1S A;  3L16 A;  1V9J A;  1FGY A;  1W1G A;  4LJP B;  1TQZ A;  1KI1 B;  5LXH A;  2C60 A;  2JT4 B;  4EUT A;  2UZR A;  3EPY A;  4H8S A;  4DBB A;  1H8C A;  3M95 A;  2N7E A;  1V5T A;  1XT9 B;  2JY6 A;  2N1V A;  3PPA A;  2ZNV C;  3LJ3 A;  1ZKH A;  2MA9 B;  3T9L A;  2EKE C;  4HB4 B;  2QKM A;  1SHC A;  2KZR A;  1KJT A;  3ML8 A;  4KSL C;  3APC A;  2DYN A;  1F9J A;  2N7D A;  2MCN B;  3VH3 B;  3L0W B;  3N30 A;  4ANX A;  2LKO A;  2JRH A;  2ELB A;  2AL6 A;  3S2A A;  4IWQ A;  5J3Q A;  3PHX B;  1S3S G;  3JYU A;  4DHZ E;  3V62 A;  2O6V B;  3BJI A;  4JLC A;  2R2Q A;  1ZC3 B;  2MWN B;  5KHQ A;  3I3T B;  4NAW A;  3TJP A;  3WAO A;  2CHZ A;  3ZO5 B;  2E2X A;  2KFK B;  4WJO A;  1WJN A;  2K6D B;  3QAR A;  4LDT D;  2EJ8 A;  2DLW A;  2KC2 A;  5C5B A;  4L6E A;  3ZNH B;  3X23 A;  1BTN A;  4HAT B;  2BKF A;  4PS7 A;  2KLC A;  1E8Y A;  2M1M A;  3QCA A;  3A1Q B;  4HAZ B;  5IAA C;  1X1F A;  3A4S C;  3ODW A;  3LJU X;  1FAO A;  2KDE B;  2IY0 B;  4A6H A;  4EFO A;  3N3K B;  4WJQ A;  4IG7 B;  2W2W A;  3ONS A;  4CHJ A;  2COP A;  1E5W A;  5D2M B;  5J18 A;  5CX3 A;  4K81 A;  1XOD A;  3PG7 A;  2FUH B;  1LB1 A;  4W9I A;  3ZNZ B;  4WJ7 A;  1NDD A;  2NPT A;  3K9O B;  4MSQ B;  4ICU A;  2N9P C;  1X1M A;  2KWC A;  3CF6 E;  3DVN U;  2DZK A;  4KZ0 A;  3A9K B;  3PRM B;  4URK A;  4W9H A;  4DX8 A;  2M4N A;  2G3Q B;  1FXT B;  3MPX A;  2UZS A;  5TR5 A;  2CRF A;  3RUI B;  3M1I B;  1OQN A;  2MP2 A;  3RCZ A;  2DYQ A;  3Q3F A;  2HTH B;  3PHW B;  3MJW A;  2QKL A;  2IO3 B;  4XX5 A;  2CU1 A;  4C0A A;  3UGB B;  2ZEQ A;  5CTR C;  5DPW A;  4D0N B;  4IC7 B;  1VCB A;  2BPS A;  3CSF A;  4K1R B;  3FSS A;  1WX9 A;  2FCN A;  1W1D A;  4LDT B;  2AEH A;  3R66 C;  1P5T A;  3A8P A;  3A4R A;  3APF A;  2K6Q A;  2PZ1 A;  2D07 B;  4MGY E;  2GBJ A;  2EC1 A;  4HWI B;  1IYF A;  1XKE A;  1X86 A;  4MSM B;  5E6O A;  1UZX B;  5DI9 B;  4IAP A;  3WAN A;  1Q5W B;  4DHJ D;  1WX7 A;  2GMI C;  3RYT A;  1TXD A;  5LON B;  1V5O A;  4G0N B;  2LRW A;  2D9W A;  3VTV A;  4MEM A;  1WE6 A;  5JLJ B;  3RCP A;  2N1W A;  4WAA A;  4PNK A;  2KDI A;  1ACA A;  2OJR A;  1TZ1 A;  1E8X A;  2PJH A;  1WM3 A;  4XWX A;  1Q0W B;  2Y7B A;  4K7W A;  4DBG A;  3U7D A;  4PYU A;  2CQU A;  3NHE B;  2DHJ A;  2GCL A;  4EMO A;  3TVV A;  2Z0P A;  2DX5 A;  2R0D A;  4DK5 A;  4WVF B;  3FLV A;  2ZVN A;  3RT3 B;  3ULB A;  4PS3 A;  5DPS A;  2FIF A;  3SHQ A;  3DXC A;  2Y5B B;  2FDQ A;  2LI5 A;  2ZCB A;  1TGZ B;  3C0R B;  2YVC A;  1P0R A;  1WVH A;  3BIN A;  1ST7 A;  1WE7 A;  3HW2 B;  4BKS D;  3TIX A;  2GOW A;  4EKU A;  4NJ6 A;  4FJV B;  2EMT A;  2C7M B;  2PE6 B;  3N7C A;  3N32 A;  2NBV B;  2LG1 A;  3PS6 A;  4DDI D;  4IM3 A;  2LXC A;  2KFJ A;  1J8C A;  2A4Z A;  2N23 A;  4MH0 E;  3V6E B;  2ASQ A;  4TUU A;  2QHO A;  5KHO A;  5C79 A;  2K8H A;  1C1Y B;  3ZLZ A;  1UBI A;  3MHS D;  2DZI A;  2GCJ A;  2KVR A;  1PLS A;  3UQA A;  2D3G A;  4CO7 A;  5D3W A;  3AI5 A;  2JZ3 B;  4FBJ B;  1T0Y A;  2MBO A;  5CLQ B;  5HE2 A;  1WI0 A;  1Z87 A;  2DHK A;  5JHH A;  2COA A;  2MW5 A;  4I6P A;  2ZJD A;  2KN5 A;  3ZVR A;  1H4R A;  3DXD A;  5KCV A;  2VRW B;  1AQC A;  2ADZ A;  3D8D A;  2V3S A;  2MX2 A;  1WJ4 A;  2H7D A;  1WZ0 A;  3F5R A;  4HPM B;  2YF0 A;  2Z0Q A;  1SGH A;  1ZSQ A;  2P0H A;  3X0W A;  4A6K A;  3OLM D;  4N9F 4;  4EZJ A;  4K2O A;  3DBS A;  2KDB A;  2XK5 A;  4JIO U;  2C7N B;  2REX A;  3JSV A;  4JGH B;  4MGK E;  2DYM A;  2VKI A;  4HB2 B;  2J59 M;  1WIA A;  1WXA A;  1WMH B;  4HPL B;  2COD A;  2Z0D B;  4PYZ A;  1N3H A;  4KDI C;  3L10 B;  5CHW A;  3WYF B;  1V89 A;  3OJ3 A;  2MBB B;  1P1A A;  1PFJ A;  2BCJ A;  4NY0 A;  5JHB A;  1YX6 B;  4RM8 A;  1U5D A;  1U29 A;  4JL9 A;  2YLM A;  4GMX B;  3PSE B;  5JHG A;  1FGZ A;  3DQV A;  4K17 A;  3TMP B;  3PTF C;  2I1K A;  2JZZ A;  4XC2 A;  1FHO A;  4FAD A;  4MDK E;  3ZDM C;  2FNJ B;  4B6W A;  4F7H A;  3Q3J A;  1V5M A;  3ECI A;  5L81 A;  4KZC A;  2DTC A;  2HE7 A;  2NZ8 B;  5HE0 A;  1RJ2 A;  2RLO A;  5AZG A;  1V5U A;  2R09 A;  2O6V D;  3TL5 A;  4B95 A;  1H10 A;  3QA8 A;  1EO6 A;  1WJ6 A;  2DFK A;  2LZ6 A;  4Z2N A;  1BAK A;  3HM6 X;  2J0J A;  1WM2 A;  3QIJ A;  4A5K A;  4NJ7 A;  3T06 A;  1Q1O A;  1UGM A;  1RLF A;  4B6H A;  3R7Q A;  3VAW A;  5J3T A;  4G50 A;  5C23 A;  2NMB A;  1ISN A;  2LRU A;  2FCQ A;  2KFK A;  2WX1 A;  3NS8 A;  5LOP B;  1V86 A;  2KTR A;  2C7H A;  3UF8 A;  4ZDV A;  5JH5 C;  4HDQ A;  4AJY B;  3K9P B;  1OQY A;  4W9F A;  3RZF A;  2CS4 A;  4GDL B;  5FR6 A;  2ROZ B;  3F0W A;  1MG8 A;  2K2U A;  4GPT B;  2CB8 A;  3A1Q A;  2RGF A;  2HJ8 A;  3KH0 A;  2D2Q A;  1NI2 A;  2KO3 A;  5CHV C;  3SD5 A;  1V80 A;  3NSU A;  1WGD A;  2NVU I;  4NQL B;  3DOW A;  3PVL A;  1DRO A;  2HD5 B;  3H6N A;  4AJW A;  1I2H A;  2MBH A;  3O96 A;  4HAV B;  4GOC A;  2KLG A;  3CIK A;  1Y19 B;  1WZ3 A;  2IFS A;  1E7V A;  2YS5 A;  5G2N A;  2ZZP B;  3CXB B;  1PMS A;  4I6L B;  1NTV A;  2K2J A;  2J0M A;  5E6P A;  3EFU A;  1EAZ A;  1P6S A;  3UIO B;  2KTF A;  4NQK E;  4FHK A;  3D8E A;  1WGU A;  3AJ4 A;  3ZTD A;  1WI1 A;  3IFW B;  1X05 A;  1RRP B;  1E8Z A;  5LXI B;  5GMV A;  2LBB A;  2P8V A;  3B08 A;  4NSW A;  4GXB A;  2L05 A;  1J0W A;  1U5G A;  2ZCC A;  2VSZ A;  2L8J A;  2L0F A;  2BYE A;  3ZW3 A;  2KWV B;  2HTH A;  3QHT A;  4K7S A;  2ABD A;  5JHA A;  2LUL A;  4HXD A;  4FLH A;  4BFR A;  1UPR A;  4IM2 A;  1W1H A;  1WXS A;  1M94 A;  3ENE A;  2GBK A;  4FA6 A;  2CHW A;  3KYC D;  4AUQ C;  1M7E A;  4GDK B;  3TO1 A;  1RFA A;  3UIN B;  5FI0 A;  2NR2 A;  4FN2 A;  2K25 A;  2K39 A;  1FHW A;  2D9Z A;  2O2V A;  1K5G B;  1MPH A;  2XQN M;  2DHZ A;  4CHM A;  1NVL A;  2KDF B;  2PPH A;  3H7P B;  3W1Y A;  5AZF A;  1KZG A;  2PEA A;  3VUX A;  1L2N A;  2AL3 A;  4IWO A;  2KGX B;  1DDV A;  2LD9 A;  3SUZ A;  4MM3 A;  3MTN B;  2N0Y A;  4KDL B;  5D94 A;  1MIZ B;  3KUD B;  2DAF A;  3AU5 A;  2KC1 A;  3SU8 X;  5BO4 B;  1V88 A;  4FJY A;  5CHF A;  3DBH I;  2KQ7 A;  1M7R A;  5D3V A;  3R3M A;  4IUM B;  5DHA B;  2VRR B;  3VHT C;  4ANU A;  3ULC A;  3ODX A;  3ML9 A;  4BKT A;  1J0G A;  4PS8 A;  1WGR A;  4AOF A;  4FHJ A;  2KKC A;  1L7Y A;  2N9X A;  5G55 A;  1I35 A;  3LDZ E;  2BF8 B;  3CST A;  4A3O A;  4MEL A;  5HE1 A;  1AAR A;  2WYQ A;  4WSF A;  4NAW B;  3OAN A;  1XCG A;  2ZVO A;  1EVH A;  3PSC A;  3PRE A;  2LOZ A;  4KSK C;  2N4F A;  4ICV A;  3AUL A;  3EC8 A;  2M0X A;  4HAX B;  1AWE A;  1GNU A;  5D6J B;  1IP9 A;  3VXW A;  3SYX A;  2DN6 A;  2AWT A;  1RAX A;  1BTK A;  4XZ4 A;  2MLB A;  4BOZ B;  2RPQ A;  3QJZ A;  2KAN A;  3TBL D;  1SE9 A;  2LGY A;  1MK9 B;  3ZIM A;  3SV1 A;  2ROV A;  4IM0 A;  4ZYN A;  2KUP A;  1OY2 A;  4HAW B;  1HB8 A;  2J0K A;  4KHO A;  4MT7 A;  1V6E A;  1WGQ A;  2MBQ A;  2RSG A;  2B3A A;  1G6J A;  1GC7 A;  4WQO B;  2NPT B;  2A5U A;  2UYZ B;  4A6F B;  4IWP A;  4BBN C;  4TQ1 A;  3A8Q A;  1WJU A;  2C9W B;  1WJ1 A;  4G3X B;  2D10 A;  3A9J B;  4K7U A;  3H1U A;  1KZ7 A;  4MJS A;  4GN1 A;  2V1Y A;  2MP2 B;  2IO1 B;  5HE3 A;  4HVB A;  2IO2 B;  2KQS A;  1WG7 A;  3FM8 C;  4HAU B;  1V2Y A;  1NBF C;  2JUO A;  1LM8 B;  5KQ1 A;  1PQS A;  4X57 B;  3B0A A;  2RR9 A;  2EMS A;  5IA7 A;  1WMH A;  2KOX A;  2K8C A;  1NTI A;  4Z2M B;  2DYB A;  1OGW A;  2MSE D;  1V5P A;  3VTU A;  3DDC B;  5D3Y A;  1OTR B;  3NOB A;  1RRB A;  4MY6 A;  2RUK B;  3ODO A;  2P0D A;  3DBR I;  3GOE A;  3KW5 B;  1HBK A;  4OVV A;  1KLV A;  5FI1 A;  2KMA A;  3P2B A;  2I5F A;  4HB3 B;  5D27 A;  2FCM A;  3CMM B;  1MK7 B;  2FCS A;  3SDL C;  3H7S A;  3QAQ A;  4BVU C;  3M3J A;  1D3Z A;  1GG3 A;  4BKG A;  1Z2M A;  4W9K A;  5DH9 B;  2W2X C;  2NBU A;  2Z0E B;  2M17 A;  3ZRF A;  2IZV B;  2XBB C;  2FAZ A;  2LVP A;  4F1S A;  5IJM A;  2DX5 B;  4HB0 B;  1VD2 A;  1Z5S B;  2LUE A;  2W2X D;  2MKR A;  2DKQ A;  4KHA A;  4BOS C;  3PV1 A;  3HIZ A;  1IRS A;  4GZU A;  5EFX A;  3WA0 A;  3V5W A;  5E6N A;  4E71 A;  3OJ4 B;  3EEC A;  4LCD E;  2DX1 A;  2YS1 A;  4HCN B;  2D9V A;  3T8M A;  3GYP A;  3UIP B;  4KV2 A;  4DX9 0;  4KIK B;  1WX8 A;  5J17 A;  3ZUN A;  4WJN A;  2MDX A;  2G4D B;  1MKE A;  2L1C A;  4JQW C;  4FUL A;  3ZNI D;  2FJL A;  4GIV A;  1UH6 A;  3P6A A;  4W9E A;  2NS5 A;  2KK8 A;  3NZU A;  4ZRJ A;  4IOY X;  4A3P A;  5DHF B;  3SNH A;  3DCG A;  1WR6 E;  4MK0 A;  1WGY A;  4WWP A;  1XD3 B;  1GC6 A;  1U27 A;  1R4N I;  3PP2 A;  3RD2 A;  1UEL A;  2V4L A;  1WY8 A;  1Y5O A;  1LFD A;  4W9J A;  3IVF A;  2G45 B;  1V61 A;  2MRP A;  2IYB A;  3RZW C;  2O6V A;  5HKH A;  4IW0 A;  1DDW A;  3GZN I;  2COC A;  2RSU A;  3PT2 B;  2KD0 A;  1UNR A;  2LGX A;  3V60 A;  2DHI A;  2LYD A;  4G11 A;  4PQ0 A;  1YIW A;  4TKN A;  2XK5 B;  2RD0 A;  3JSV B;  3W1S C;  3UQB A;  1WYW B;  3WAP A;  2JXX A;  3L17 A;  2K1F A;  2OQB A;  1DDM A;  2L0T A;  5LLI A;  2WDT B;  4YON A;  4CYE A;  1QZE A;  4E3C A;  3HQC A;  2KWU B;  2W9N A;  1E8W A;  1UBQ A;  5L83 A;  2V76 A;  4J6I A;  4B9K A;  1OMW A;  5D3X A;  4M8M A;  1V81 A;  3EHV A;  1KM7 A;  2HRJ A;  1XQQ A;  2BYV E;  3WAM A;  4HCP B;  1K8R B;  1U2B A;  3VTW A;  3VH4 B;  2RGN B;  3DVG X;  4KVG B;  4DWF A;  2R2O A;  3TFM A;  3VUW A;  2G35 A;  2Z0O A;  3R7R A;  3A9K A;  1P3R A;  3WIM A;  1X11 A;  2CAY A;  4BBK A;  2BKR B;  2JVC A;  4I6N B;  4EZK A;  1E90 A;  2GBM A;  1TTN A;  2WX0 A;  4IFS A;  5CLL B;  2Y8G A;  5J2R A;  2YT0 A;  2RNR B;  1BWN A;  3VQI A;  4AP4 C;  1Q67 A;  2K8B A;  3ZVV A;  2H7E A;  4HLE A;  4MGZ E;  4ZRK A;  3B1L X;  3KY9 A;  4M0W B;  3L54 A;  3DVG Y;  1FOE A;  2KTR B;  4II3 B;  2COF A;  1ZGU B;  2OOB B;  2JF5 A;  3DBL I;  2LWP A;  4W9G A;  4TV3 A;  2Y8F A;  4W9C A;  1QQG A;  1FB8 A;  3QC8 B;  1DBH A;  3GYO A;  1FHX A;  1A5R A;  3P7Z A;  3ZTC A;  3FEH A;  2KCJ A;  2KX3 A;  2DZJ A;  3PRP B;  4OVU A;  3NZS A;  2P0F A;  4NNJ B;  4P7I A;  4W9D A;  4HDO A;  2GBR A;  4AWJ A;  1BT0 A;  2MFQ A;  2DKP A;  2J7Q B;  2MWS B;  2PE9 A;  2LVQ A;  2XEW A;  5AZH A;  5L95 C;  1XR0 B;  4ZRI A;  1UNP A;  2CY5 A;  3PVW A;  3PVU A;  3O65 B;  3ZNG C;  1LQB A;  3ML4 A;  5C1Z A;  4II2 B;  1LW3 A;  4A6F A;  2KJ6 A;  2KJR A;  1QC6 A;  1YD8 U;  2GBN A;  2L3Z A;  4BBN F;  2ZPY A;  2L2I A;  3H9D A;  4F8C B;  4EZL A;  3A9J A;  4DXA B;  4RM9 A;  3QBV B;  1WGG A;  5C16 A;  2C5L C;  3TCA A;  5JP4 A;  4KAX B;  2ZNV B;  1U5E A;  1UD7 A;  2G4S A;  5J3Y A;  3VVW B;  3BY4 B;  1ZW7 A;  4EEW A;  2JWZ A;  1KOT A;  4GU2 A;  5DPT A;  1HE8 A;  5C5B B;  1EUV B;  2YT1 A;  3U8Z A;  2BWF A;  5AEK B;  2WH5 A;  1R4M I;  1JRU A;  2O2V B;  2JRI B;  1ZC4 B;  1YX5 B;  1UEF A;  3KSY A;  5DIF B;  3OAW A;  1SIF A;  3V61 A;  1WFY A;  2RVB B;  1WRD B;  1NU2 A;  1WGH A;  3D32 A;  2DEN B;  2M14 A;  2YRY A; 
#chains in the Genus database with same CATH topology
 2FJU B;  3D8F A;  2LJ5 A;  3QQ8 B;  1I7A A;  1WF9 A;  1V49 A;  2V0G A;  4MM3 B;  3O13 A;  4P1B C;  3RNE C;  1C3T A;  2CY4 A;  4CHK A;  1PYW D;  4A9A A;  2KHW B;  2DNF A;  3SO6 A;  1GJZ A;  3PGE A;  2GB1 A;  2LHE A;  1L0X B;  2L7R A;  4W9L A;  4EOY A;  4KKJ A;  4LNK A;  3AXC A;  3L08 A;  3A33 B;  1U5F A;  3KZ1 A;  4F7U P;  1K5D B;  1S1Q B;  3ZJV A;  2FJ9 A;  1CMX B;  5AUI A;  4HJK A;  2D9X A;  1NI3 A;  2RQ1 A;  3DPD A;  4KGT A;  2GS0 A;  3I57 A;  2OTX A;  2IJ0 A;  4RGM A;  2YSZ A;  2IGH A;  4JKG B;  3KUZ A;  3PEG A;  5D7G A;  1ZVR A;  4GMV A;  1UF0 A;  2NCN A;  5DCN A;  2CJN A;  1ZM0 A;  3M63 B;  5EE9 A;  3DVN V;  3U12 A;  1WXM A;  1PUT A;  1ROE A;  3BVM A;  2JPH A;  1FMA D;  2BQQ A;  2X18 A;  1YJI A;  2FID A;  2L76 A;  1E7U A;  1DIK A;  3AED B;  4JWS C;  3RNA C;  3QK0 A;  1LXD A;  3VR8 B;  3U2S C;  3IBE A;  4JK8 A;  2N9E B;  3FAH A;  4N6E B;  3VFK A;  4L2Y A;  5KQ4 A;  1SSN A;  3JVZ X;  4C7Y A;  4BAX A;  2PW9 A;  3TW1 A;  4M8N A;  4BKS A;  1XX0 A;  2Z13 A;  2KJH B;  1OEY J;  1IPG A;  1TBE A;  4LNN A;  4LJO B;  4XWW A;  4KIK A;  1F77 A;  3APD A;  3UZT A;  4WUR A;  4JKA A;  4IOI E;  3HUI A;  2KX0 A;  1X1G A;  2PKO A;  4RMA A;  4OHJ A;  4PK1 A;  3VOQ A;  3WAL A;  4ANV A;  3KYD D;  1XEE A;  1JWM D;  3TEX A;  2MBE A;  1F1H A;  3ZKJ C;  1TIF A;  4MGI E;  2I1J A;  2IYD B;  3ZDT A;  3BZD B;  4K2P A;  4DHJ B;  4DDG D;  4TYZ A;  1QQR A;  4JKF A;  2FE8 A;  3P4P B;  1EGX A;  2R61 A;  2K0P A;  4NZL B;  2FBW B;  1U4A A;  1MIX A;  3PZD A;  1P7E A;  4M01 A;  2DYO A;  1MAI A;  4GB9 A;  4JKE A;  2KNB A;  2IO0 B;  3FVC A;  2BGF A;  4J3O D;  3JW0 X;  1GB1 A;  2K00 A;  3Q2A C;  3AU4 A;  4GGQ A;  4WJP A;  3PLV A;  3PRZ A;  3A98 B;  3HM3 A;  4MJS B;  4JK9 A;  3IG3 A;  4ANW A;  3IAM 1;  3DXE A;  2QMT A;  1B55 A;  4ASW C;  3U30 A;  2LGD A;  2DA0 A;  1F52 A;  1HA5 A;  1HB6 A;  3KUC B;  5IRS A;  2IY1 B;  4LK0 M;  4HHV A;  4TSS A;  2KMC A;  2QDF A;  2GJY A;  3ZRC A;  2IDY A;  3HK0 A;  4EJN A;  4HK2 A;  3RUL A;  1TKG A;  4GDL A;  4F7Z A;  2PIA A;  2IBI B;  4F7G A;  4Y94 A;  4GSW A;  4RCO A;  2BW2 A;  2KVZ A;  5JZE B;  2QCZ A;  3ALB A;  5G5G A;  1YJ1 A;  2DZM A;  4EE2 A;  4REZ A;  3NW8 A;  3Q8B A;  3T3N A;  4WWN A;  1P9D U;  3ZJT A;  1ENF A;  2YS3 A;  1I4X A;  4NPN A;  1GUA B;  4M00 A;  1XD4 A;  2PVO D;  4XE0 A;  4KHB B;  3WCQ A;  4TQ0 A;  1AN8 A;  2UWQ A;  3HHM A;  3TSS A;  4A8X C;  4S0R A;  4ACF A;  1J19 A;  1UNQ A;  4E74 A;  1OEY A;  5G5H A;  1VZ8 A;  2W3S A;  1DYN A;  2LXA A;  1WR1 A;  1KBL A;  2D11 A;  2KXJ A;  2RRF A;  4FJZ A;  3VDZ A;  1Y8R C;  1HXY D;  2AYO B;  3VRA B;  3VIA A;  5C6R A;  2OJW A;  1WJM A;  1N5W A;  2Z59 B;  1ZUD 2;  5DPR A;  2D9Y A;  3ZXR A;  2M19 A;  3QWM A;  3AE2 B;  4YL8 A;  2WWZ A;  2JP2 A;  2Y5P A;  2V4I B;  1UPQ A;  3VUY A;  3OWE B;  2XN9 C;  1EF5 A;  3M62 B;  4YWG G;  3OHM B;  4QJ4 B;  2CR5 A;  2DAJ A;  1SE2 A;  3FP5 A;  4GNK B;  1EWY C;  1R4N B;  5EE3 A;  2NBW B;  4OZA A;  3IHP C;  3MP9 A;  2M8S A;  3LYY A;  4C4V B;  3V6C B;  2LOX A;  1N61 A;  3KRW A;  4WWO A;  4HAY B;  2M38 A;  2WXR A;  3FIL B;  2LVO A;  1EF1 A;  2PVG C;  1TJE A;  5EDS A;  2CKH B;  1TJ6 A;  4A20 A;  2BWE S;  2WU5 B;  2Q13 A;  3QWZ B;  1RFK A;  2ELA A;  2JZP A;  5C3J B;  2LEK A;  3G9W A;  2ZPN A;  2K49 A;  2BYF A;  2I5C A;  1WYG A;  3NY5 A;  3QX1 A;  2MQJ A;  1P3Q U;  1YQB A;  1C78 A;  1WH3 A;  4GDK A;  3SBT A;  1NTY A;  5GOW B;  4QJ5 B;  4M0W A;  4A90 A;  1FCL A;  1BML C;  1FCC C;  2Z8L A;  2L00 B;  1P98 A;  2KYW A;  1I42 A;  3L13 A;  1M4V A;  1TS5 A;  2CHX A;  1TKY A;  4DHZ B;  4HKQ A;  2LAS A;  2HJ1 A;  3MDB C;  2YT2 A;  3H7P A;  1HEZ E;  4LNF A;  2D4Q A;  3PLU A;  4JKH A;  4D6W A;  3DCX A;  1FEH A;  1WXV A;  1FXI A;  1OQQ A;  2WXP A;  3SBG A;  2UVM A;  5FKA C;  3KVF B;  1L6U A;  2VZK B;  3KRX A;  3AE9 B;  1WRI A;  3W1S A;  3L16 A;  1V9J A;  1XXG A;  5LNK 1;  4IDI A;  1FGY A;  1W1G A;  4LJP B;  1TQZ A;  1KI1 B;  5LXH A;  2C60 A;  2JT4 B;  4EUT A;  2UZR A;  3RNC C;  3EPY A;  2BS4 B;  4H8S A;  4DBB A;  4XDD A;  4USA A;  1H8C A;  3M95 A;  2N7E A;  2JX5 A;  2L1A A;  1V5T A;  1XT9 B;  2JY6 A;  1TZO A;  2N1V A;  3PPA A;  2ZNV C;  1ZOY B;  3LJ3 A;  1JW9 D;  4LTU A;  1ZKH A;  4C7Z A;  2R82 A;  2MA9 B;  3T9L A;  2EKE C;  1YJJ A;  4HB4 B;  2QKM A;  2V3P A;  1SHC A;  2KZR A;  3DHH C;  1XLO A;  1KJT A;  4NAM A;  4R3D A;  3ML8 A;  4KSL C;  3APC A;  5EE1 A;  2DYN A;  1F9J A;  2N7D A;  1ZPS A;  2MCN B;  3VH3 B;  2E6X A;  3L0W B;  1GAQ B;  2N9K A;  3N30 A;  4ANX A;  2LKO A;  1NYR A;  2JRH A;  2ELB A;  2AL6 A;  3S2A A;  2LJI A;  3IT4 B;  4IWQ A;  5J3Q A;  4YSX B;  3ZYY X;  3PHX B;  1S3S G;  3JYU A;  4DHZ E;  4LNI A;  3V62 A;  4DXF A;  2O6V B;  3DHG C;  3BJI A;  4JLC A;  1VRA B;  2ZW0 A;  1D5Z C;  2BVC A;  2R2Q A;  1ZC3 B;  2MWN B;  5KHQ A;  3I3T B;  4NAW A;  2N0S B;  3TJP A;  1I4G A;  3WAO A;  2CHZ A;  3ZO5 B;  2E2X A;  2QSD A;  2KFK B;  4WJO A;  1D5X C;  1WJN A;  2WDQ B;  2K6D B;  3QAR A;  4LDT D;  3Q3O C;  2KR0 A;  2D3A A;  2EJ8 A;  2DLW A;  2INN E;  2V9H A;  2KC2 A;  4HJG E;  5C5B A;  1GOZ A;  4ZRP A;  4L6E A;  1VZ6 A;  2UU7 A;  3ABV B;  3ZNH B;  3X23 A;  1BTN A;  4HAT B;  2BKF A;  4PS7 A;  3N1Z C;  3SFD B;  2KLC A;  1E8Y A;  1Y56 A;  5IOI A;  2M1M A;  3QCA A;  3A1Q B;  4HAZ B;  2DIK A;  1T5X D;  5IAA C;  1X1F A;  2WLB A;  3A4S C;  3ODW A;  1E10 A;  3LJU X;  1FAO A;  1XO3 A;  1ZE3 D;  2KDE B;  3V3X A;  2IY0 B;  4A6H A;  4EFO A;  3N3K B;  4WJQ A;  4IG7 B;  2LMC A;  2DWQ A;  2W2W A;  3ONS A;  2KUQ A;  1ZDV A;  4CHJ A;  3GB1 A;  2COP A;  4HPP A;  1E5W A;  5D2M B;  5J18 A;  5CX3 A;  4K81 A;  1V1P A;  1XOD A;  3N9Y C;  3Q8E A;  3SR6 A;  3PG7 A;  2FUH B;  1L4D B;  1I4H A;  1FXA A;  1LB1 A;  4W9I A;  3ZNZ B;  4K3C A;  4WJ7 A;  1NDD A;  2NPT A;  3K9O B;  4MSQ B;  4ICU A;  1IBX B;  2N9P C;  1X1M A;  2KWC A;  3CF6 E;  4ITK A;  3W9C B;  3DVN U;  2EKI A;  3P4S B;  2DZK A;  4KZ0 A;  1KLU D;  1T6B X;  3A9K B;  3PRM B;  4URK A;  4W9H A;  4DX8 A;  2M4N A;  2G3Q B;  1E9M A;  1FXT B;  5IP4 D;  3BII D;  3MPX A;  4JE3 B;  3E9S A;  2UZS A;  2H88 B;  2ACZ B;  5TR5 A;  1E0Z A;  2CRF A;  3RUI B;  3M1I B;  1OQN A;  2MP2 A;  3RCZ A;  2DYQ A;  4XWT A;  3Q3F A;  2HTH B;  1CJE A;  3PHW B;  3MJW A;  2QKL A;  4JKG A;  3A58 A;  5GXG B;  2IO3 B;  4XX5 A;  2CU1 A;  4C0A A;  2LFI A;  3UGB B;  1E6E B;  3NWD A;  2ZEQ A;  5CTR C;  5BYS A;  1WSP A;  5DPW A;  2IGD A;  3B2F A;  1QT9 A;  4D0N B;  1ACC A;  4IC7 B;  1VCB A;  4NJC A;  2BPS A;  1F2R I;  3CSF A;  4K1R B;  3FSS A;  1WX9 A;  5I4D A;  1QOA A;  3AE5 B;  2FCN A;  1W1D A;  4KGS A;  4LDT B;  2AEH A;  1KLG D;  2I38 A;  3Q8F A;  3R66 C;  1P5T A;  3B9J A;  3A8P A;  3L4P A;  3A4R A;  2WHI A;  3APF A;  2IGG A;  2K6Q A;  2PZ1 A;  2D07 B;  3MC9 A;  4MGY E;  2BT6 A;  5BYQ A;  2GBJ A;  2EC1 A;  4HWI B;  1DOI A;  1IYF A;  1XKE A;  1X86 A;  4MSM B;  1VBH A;  1K53 A;  3Q69 A;  5E6O A;  1UZX B;  3TEZ A;  1IGD A;  4RGN A;  5BMG A;  5DI9 B;  4IAP A;  3WAN A;  1Q5W B;  3P4R B;  4P16 A;  2RMM A;  3DHI C;  4DHJ D;  1WX7 A;  2GMI C;  3RYT A;  1TXD A;  5LON B;  1V5O A;  4G0N B;  2Z14 A;  2LRW A;  1LO5 D;  1T77 A;  2D9W A;  3VTV A;  4MEM A;  1WE6 A;  4RGO S;  5JLJ B;  4H2A A;  3RCP A;  2DLB A;  2N1W A;  4WAA A;  2BBC A;  4PNK A;  2KDI A;  1YOV B;  1ACA A;  2OJR A;  3NVV A;  1KRH A;  1TZ1 A;  1E8X A;  2PJH A;  2I2Y A;  3Q3M C;  1WM3 A;  4XWX A;  1Q0W B;  2Y7B A;  4K7W A;  4DBG A;  3U7D A;  4PYU A;  2CQU A;  3NHE B;  2DHJ A;  1VLB A;  2GCL A;  2BB6 A;  3IT6 B;  4EMO A;  1JWU D;  5M4Y B;  3TVV A;  1F0Z A;  2Z0P A;  2DX5 A;  2R0D A;  3AV8 A;  3IXS A;  1ZXI A;  2N7J A;  1WGK A;  4DK5 A;  4QXA B;  2W54 A;  4WVF B;  3FLV A;  2ZVN A;  2ZKM X;  1YQ4 B;  3RT3 B;  2XNA C;  3ULB A;  4PS3 A;  4ILH A;  5DPS A;  1NVI D;  2CU3 A;  4A6Q A;  4C56 C;  2FIF A;  3SHQ A;  1OFF A;  2BB5 A;  4C00 A;  3DXC A;  2CJO A;  2Y5B B;  2FDQ A;  2LI5 A;  2ZCB A;  2WGS A;  1TGZ B;  2GUM A;  3C0R B;  2YVC A;  1P0R A;  1WVH A;  3SEB A;  1SE3 A;  3BIN A;  1ST7 A;  1WE7 A;  3HW2 B;  3N20 C;  4BKS D;  3TIX A;  2GOW A;  4EKU A;  4NJ6 A;  4FJV B;  1IGC A;  2EMT A;  1JWS D;  4ILJ A;  2K22 A;  2C7M B;  2PE6 B;  3N7C A;  3N32 A;  1DYQ A;  2NBV B;  2LG1 A;  3PS6 A;  4DDI D;  1QKZ A;  4IM3 A;  2LXC A;  1ZXH A;  4RFB A;  2KFJ A;  1J8C A;  2A4Z A;  3DBR B;  2B76 B;  2N23 A;  3LB8 C;  5D3D A;  3ETR A;  4MH0 E;  3V6E B;  2ASQ A;  4TUU A;  2QHO A;  5KHO A;  5C79 A;  1MFW A;  1MVK A;  1FO4 A;  3CWI A;  2K8H A;  1C1Y B;  3E9O A;  1SEB D;  4N58 A;  3ZLZ A;  3R8B A;  1UBI A;  3MHS D;  2RDH A;  1TY0 A;  1LGR A;  2WQY B;  5D3I B;  2DZI A;  2GCJ A;  2KVR A;  2AQ2 B;  4GOU A;  1PLS A;  3UQA A;  2D3G A;  4CO7 A;  5D3W A;  3AI5 A;  2JZ3 B;  4FBJ B;  1T0Y A;  2MBO A;  1HZ5 A;  5CLQ B;  5HE2 A;  1WI0 A;  1RYJ A;  2JWU A;  1Z87 A;  2DHK A;  5JHH A;  1XLQ A;  1L0Y B;  2COA A;  2MW5 A;  4I6P A;  2ZJD A;  1SIJ A;  1XLP A;  2KN5 A;  3ZVR A;  1H4R A;  1D4B A;  3DXD A;  1YN4 A;  3MC8 A;  5KCV A;  1EU4 A;  2GI9 A;  3P1M A;  2VRW B;  4WH4 A;  4B0E A;  1AQC A;  4KGR A;  2ADZ A;  3D8D A;  2WXG A;  2V3S A;  2MX2 A;  3EA6 A;  2D3B A;  1WJ4 A;  3AEC B;  2H7D A;  1WZ0 A;  3F5R A;  2WXI A;  4HPM B;  4DQO C;  4ILG B;  2YF0 A;  2Z0Q A;  1L4Z B;  4YXD B;  1SGH A;  1ZSQ A;  1CQV A;  2P0H A;  3X0W A;  4A6K A;  3OLM D;  4N9F 4;  4EZJ A;  3AEF B;  4K2O A;  1FPY A;  3DBS A;  2MJD A;  2KDB A;  1JML A;  1GGO A;  2XK5 A;  4JIO U;  2C7N B;  2REX A;  1UWX A;  3JSV A;  4JGH B;  4MGK E;  2DYM A;  2VKI A;  3TUO A;  4HB2 B;  2J59 M;  2EEL A;  4C80 A;  5HI1 A;  1N5X A;  1D6E C;  1WIA A;  4DIX A;  1WXA A;  1YN3 A;  2G1E A;  1WMH B;  4HPL B;  2VH1 A;  2COD A;  1SJH D;  2Z0D B;  4PYZ A;  1N3H A;  4M02 A;  4KDI C;  1L5P A;  3L10 B;  5CHW A;  1L6V A;  3WYF B;  2WXF A;  4L1B A;  2VH2 A;  2ICI A;  2VZK D;  3MJ5 A;  1V89 A;  2WS3 B;  3OJ3 A;  3PO0 A;  2MBB B;  1P1A A;  1PFJ A;  2BCJ A;  4NY0 A;  5JHB A;  1YX6 B;  2W3R A;  1VBG A;  4RM8 A;  4PT5 A;  3T3O A;  4XYC A;  2ONQ A;  1U5D A;  1U29 A;  1C4A A;  1I7H A;  4JL9 A;  3NWF A;  2YLM A;  2LUM A;  4GMX B;  3PSE B;  5JHG A;  1FGZ A;  3DQV A;  4K17 A;  3TMP B;  3ZGZ A;  3PTF C;  1HZ6 A;  2I1K A;  2JZZ A;  4XC2 A;  5IKC M;  1FHO A;  4FAD A;  4MDK E;  3ZDM C;  2FNJ B;  2SEB D;  4B6W A;  4F7H A;  3Q3J A;  1V5M A;  3ECI A;  4HRO A;  1ZYI A;  5L81 A;  2MHJ A;  4KZC A;  3BWU D;  2DTC A;  2HE7 A;  2NZ8 B;  5HE0 A;  1RJ2 A;  2RLO A;  5AZG A;  1V5U A;  5HG2 A;  2R09 A;  5BYR A;  2O6V D;  3TL5 A;  1XCQ L;  1H10 A;  4B95 A;  3QA8 A;  1EO6 A;  1WJ6 A;  3NG0 A;  2DFK A;  2LZ6 A;  1TKE A;  2KIG A;  4Z2N A;  1BAK A;  3HM6 X;  2J0J A;  2QIE B;  1B9R A;  1WM2 A;  3QIJ A;  4A5K A;  1NEN B;  4NJ7 A;  4RF1 A;  3T06 A;  1PGX A;  3GZN B;  3Q14 C;  1Q1O A;  1UGM A;  1RLF A;  4B6H A;  3HIE A;  3EGR A;  3R7Q A;  3VAW A;  5J3T A;  4L23 A;  4G50 A;  5C23 A;  2NMB A;  1ISN A;  2LRU A;  2FCQ A;  2KFK A;  2WX1 A;  3NS8 A;  3VRB B;  5LOP B;  1V86 A;  1A70 A;  2KTR A;  2C7H A;  3UF8 A;  4ZDV A;  5JH5 C;  2G9H D;  4HDQ A;  4AJY B;  3K9P B;  1OQY A;  2D5G A;  4KX6 B;  4W9F A;  3RZF A;  2CS4 A;  3FKY A;  4GDL B;  5FR6 A;  1MI0 A;  2ROZ B;  3PZ8 A;  3F0W A;  1MG8 A;  2K2U A;  1SE4 A;  2AX5 A;  3RPF C;  4GPT B;  4ARC A;  2CB8 A;  1YNT E;  3BVG A;  3A1Q A;  2RGF A;  1OQR A;  2HJ8 A;  3KH0 A;  2D2Q A;  1NI2 A;  2KO3 A;  5CHV C;  3SD5 A;  1V80 A;  3NSU A;  1WGD A;  2WXN A;  2NVU I;  3NVW A;  4NQL B;  5I2M A;  3DOW A;  3AMZ A;  5T8I A;  3PVL A;  1DRO A;  1AWD A;  2HD5 B;  3H6N A;  4AJW A;  3RFZ B;  1HTO A;  1I2H A;  3B2G A;  1QOG A;  3O96 A;  2MBH A;  4HAV B;  4GOC A;  2KLG A;  1T3Q A;  3CIK A;  1Y19 B;  1WZ3 A;  2IFS A;  4LLG M;  1E7V A;  2YS5 A;  5G2N A;  2ZZP B;  3CXB B;  2KIE A;  1PMS A;  4I6L B;  1J7C A;  1NTV A;  2QC8 A;  2K2J A;  2BS2 B;  2J0M A;  1E7P B;  4WIP A;  5E6P A;  3EFU A;  1EAZ A;  1DGJ A;  2Q5W D;  1P6S A;  3UIO B;  4FXC A;  1GB4 A;  2KTF A;  4NQK E;  4FHK A;  3D8E A;  1WGU A;  3AJ4 A;  1IBX A;  1SB3 C;  4LNO A;  2LHD A;  1V8C A;  3ZTD A;  1WI1 A;  2Y5C A;  3IFW B;  1P7F A;  3I9V 1;  1X05 A;  1RRP B;  1IUE A;  1E8Z A;  5LXI B;  5GMV A;  3NVY A;  4JKB A;  3NUH B;  2LBB A;  2P8V A;  3B08 A;  1JCK B;  1SF0 A;  4NSW A;  1JRO A;  4GXB A;  1ZP0 B;  2L05 A;  1J0W A;  1I4Q A;  1U5G A;  1R7S A;  1MI1 A;  2ZCC A;  2VSZ A;  2L8J A;  2L0F A;  2BYE A;  3AN1 A;  3ZW3 A;  2KWV B;  2HTH A;  3QHT A;  1NEK B;  4K7S A;  5H8Y E;  4ZHP A;  2ABD A;  2WXQ A;  3U4E G;  3RN9 C;  3BYT B;  5JHA A;  2LGI A;  2LUL A;  4HXD A;  4FLH A;  4BFR A;  1UPR A;  4IM2 A;  1W1H A;  4DXG A;  1WXS A;  2J4X A;  1M94 A;  1Q10 A;  5BMH A;  3ENE A;  2GBK A;  3HVZ A;  4FA6 A;  2V3N A;  2CHW A;  3KYC D;  1C77 A;  4AUQ C;  1MJD A;  2BS3 B;  1M7E A;  4GDK B;  3DBL B;  2L32 A;  1AYF A;  3RI7 C;  3TO1 A;  1RFA A;  3UIN B;  1C9F A;  2JXT A;  5FI0 A;  2NR2 A;  5IN7 A;  4FN2 A;  2K25 A;  3P42 A;  2K39 A;  1FHW A;  3NS1 A;  2D9Z A;  2O2V A;  1K5G B;  1MPH A;  4P1C C;  2XQN M;  2M56 B;  3W5U B;  2DHZ A;  4CHM A;  1NVL A;  2KDF B;  1YQ3 B;  2PPH A;  3N1Y C;  3W2D A;  1BXT A;  3H7P B;  3W1Y A;  3KQ4 A;  5AZF A;  3E9L A;  1KZG A;  2PEA A;  3VUX A;  1L2N A;  2AL3 A;  4IWO A;  2KGX B;  1DDV A;  2LD9 A;  3SUZ A;  4MM3 A;  3NWA A;  3U52 E;  3MTN B;  2N0Y A;  4KDL B;  5D94 A;  2WXK A;  5AUK A;  1MIZ B;  3W5V B;  3KUD B;  2DAF A;  3AU5 A;  1KH0 A;  1UUP A;  2KC1 A;  3SU8 X;  2WDV B;  5BO4 B;  3GS2 A;  1V88 A;  4FJY A;  5CHF A;  3DBH I;  2KQ7 A;  1M7R A;  5D3V A;  4HSI A;  4YSZ B;  3R3M A;  4IUM B;  5DHA B;  2VRR B;  3VHT C;  4ANU A;  3ULC A;  4WWM A;  3ODX A;  3ML9 A;  4BKT A;  2NMQ A;  2MJ3 A;  1J0G A;  1DOX A;  1QF6 A;  4PS8 A;  3AH7 A;  2J52 A;  1WGR A;  4AOF A;  1SJE D;  4FHJ A;  2KKC A;  1JDE A;  1T0Q C;  1L7Y A;  3C19 A;  2N9X A;  5G55 A;  1I35 A;  1FNV A;  3LDZ E;  2BF8 B;  3CST A;  4A3O A;  4MEL A;  4S17 A;  3C8Y A;  5HE1 A;  1AAR A;  1QOF A;  2WYQ A;  4WSF A;  4NAW B;  2AQ3 B;  3OAN A;  2PLP A;  1XCG A;  2ZVO A;  1EVH A;  3PSC A;  1K51 A;  3PRE A;  2LOZ A;  4KSK C;  2N4F A;  4ICV A;  4TMA B;  3AUL A;  3EC8 A;  2M0X A;  4HAX B;  1AWE A;  1GNU A;  5D6J B;  1IP9 A;  3VXW A;  1R4M B;  3SYX A;  2DN6 A;  2IND C;  2AWT A;  1RAX A;  1J7A A;  1ET6 A;  5TSS A;  1BTK A;  1TT5 B;  4XZ4 A;  3Q8C A;  2MLB A;  3Q3N C;  4BOZ B;  3RNB C;  1KTK A;  2RPQ A;  3QJZ A;  2KAN A;  1KF6 B;  3TBL D;  2RDG A;  3AEG B;  3ZQ4 A;  1PGB A;  2K5P A;  2PMV A;  2L52 A;  3KWV A;  1SE9 A;  2LGY A;  1I4P A;  1MK9 B;  3IAS 1;  3ZIM A;  3SV1 A;  3E66 A;  2K9X A;  3ENB A;  3BYY B;  2ROV A;  4O1N A;  4IM0 A;  4IKG A;  4P6V F;  1FRR A;  4ZYN A;  2KUP A;  1OY2 A;  4HAW B;  1HB8 A;  2J0K A;  4KHO A;  4MT7 A;  2WDR B;  3BK1 A;  1V6E A;  1WGQ A;  2MBQ A;  2RSG A;  3AE6 B;  2B3A A;  1G6J A;  1GC7 A;  3N1X C;  4WQO B;  2MEK A;  2NPT B;  3I5J C;  2A5U A;  3KLS X;  2UYZ B;  2JU6 X;  4A6F B;  3U7Z A;  4IWP A;  2L83 A;  4BBN C;  1TS3 A;  4TQ1 A;  3A8Q A;  3Q6B A;  1WJU A;  2C9W B;  1I4R A;  1WJ1 A;  4G3X B;  1T0S C;  2D10 A;  3A9J B;  4K7U A;  3H1U A;  1KZ7 A;  2RPV A;  4MJS A;  2PTL A;  2HDE A;  4GN1 A;  2V1Y A;  2MP2 B;  4Q2J A;  5HHD G;  4JK7 A;  2IO1 B;  1JRP A;  2BTE A;  2KAC A;  1XLN A;  2WXJ A;  5HE3 A;  4HVB A;  2IO2 B;  2KQS A;  2YEP B;  2KQ4 X;  1WG7 A;  1K52 A;  1FIQ A;  3FM8 C;  1C76 A;  4WQM A;  5IO9 A;  3NVZ A;  4HAU B;  1V2Y A;  1NBF C;  2JUO A;  1TS4 A;  1LM8 B;  5KQ1 A;  1MHX A;  1PQS A;  2M0A A;  4X57 B;  3B0A A;  2RR9 A;  2EMS A;  5IA7 A;  4YTM B;  1WMH A;  2W82 A;  2KOX A;  2K8C A;  1L0V B;  4CSQ A;  2RDB C;  1EU3 A;  1YMH E;  1NTI A;  1WWT A;  4ARI A;  2JQR B;  3FC4 A;  4Z2M B;  2DYB A;  4UDU C;  3TEW A;  1OGW A;  2MSE D;  1V5P A;  4KHB A;  3DDC B;  3VTU A;  5D3Y A;  2OHF A;  1OTR B;  2K3U A;  1JWA D;  3NOB A;  1RRB A;  3ZXV A;  2DBY A;  4MY6 A;  4JPS A;  2RUK B;  3ODO A;  2P0D A;  3DBR I;  3SFE B;  3AB5 A;  3GOE A;  2QJL A;  3KW5 B;  1HBK A;  5JVL A;  4OVV A;  1KLV A;  5FI1 A;  2KMA A;  3P2B A;  3URY A;  3AE8 B;  4CQN A;  2I5F A;  1YN5 A;  2WXM A;  4WAF A;  3EUB 2;  3P4Q B;  2Z59 A;  4OZB A;  4BZA A;  4HB3 B;  5D27 A;  2FCM A;  3CMM B;  2FCS A;  1MK7 B;  3SDL C;  2QIL A;  5HFY A;  2GLS A;  3H7S A;  3AE4 B;  3QAQ A;  4OSN A;  1VJK A;  4BVU C;  3M3J A;  1D3Z A;  2E3T A;  1GG3 A;  1FNU A;  4BKG A;  1Z2M A;  2SAK A;  4W9K A;  5DH9 B;  2W2X C;  2N9L A;  3E56 A;  4C4V A;  2NBU A;  2Z0E B;  2M17 A;  3ZRF A;  2IZV B;  2XBB C;  3FIL A;  2FAZ A;  2LVP A;  4F1S A;  5IJM A;  4ZHO A;  4US8 A;  2DX5 B;  4HB0 B;  1VD2 A;  2FUG 1;  1Z5S B;  2KDM A;  2LUE A;  2W2X D;  3ZJU A;  2MKR A;  2OED A;  3H8H A;  2DKQ A;  4KHA A;  1FFV A;  4BOS C;  3PV1 A;  2R2Y A;  1MHH E;  3HIZ A;  1IRS A;  1SXT A;  4GZU A;  5EFX A;  1RM6 C;  3WA0 A;  3V5W A;  5E6N A;  4E71 A;  1MPE A;  1EM7 A;  4GLS C;  3OJ4 B;  1QOB A;  4HRS A;  2KT7 A;  2INC C;  2X0S A;  3DWM A;  3EEC A;  4LCD E;  2GRI A;  2DX1 A;  2YS1 A;  4HCN B;  3NJT A;  4JWU C;  2D9V A;  4MT5 A;  3T8M A;  3GYP A;  3UIP B;  5LG4 B;  1ESF A;  3Q8A A;  4DX9 0;  4KV2 A;  2LGS A;  4KIK B;  1WX8 A;  3NRZ A;  5J17 A;  3ZUN A;  3V05 A;  4WJN A;  2MDX A;  2G4D B;  1MKE A;  2L1C A;  4JQW C;  3R2T A;  4FUL A;  3ZNI D;  2FJL A;  1C4P A;  4GIV A;  1UH6 A;  3P6A A;  4W9E A;  2NS5 A;  2KK8 A;  4JX1 C;  2INP E;  1JQ4 A;  3NZU A;  4ZRJ A;  1QIL A;  4IOY X;  4A3P A;  5DHF B;  1KC7 A;  2W55 A;  3SNH A;  2WNM A;  1V97 A;  1ZDX A;  3DCG A;  4AQ7 A;  4RNA A;  3BVZ A;  1WR6 E;  4MK0 A;  1WGY A;  4WWP A;  1XD3 B;  1GC6 A;  1U27 A;  1R4N I;  3PP2 A;  3RD2 A;  2KMM A;  4JKC A;  1UEL A;  2JYE A;  2V4L A;  1WY8 A;  2BYT A;  1Y5O A;  1LFD A;  4W9J A;  3IVF A;  2G45 B;  1V61 A;  3AE7 B;  2MRP A;  3BK2 A;  3LXF A;  2IYB A;  3AE3 B;  2O6V A;  2J42 A;  2ZW1 A;  4RF0 A;  3RZW C;  5HKH A;  1D5M C;  3MFG A;  4IW0 A;  4ZYS A;  1DDW A;  4B0M A;  3GZN I;  2COC A;  3GE3 C;  1HQR D;  2RSU A;  3PT2 B;  2KD0 A;  1UNR A;  2LGX A;  3V60 A;  2DHI A;  1BUI C;  2LYD A;  2HTM E;  4G11 A;  4PQ0 A;  1YIW A;  1N63 A;  4TKN A;  2XK5 B;  2RD0 A;  3JSV B;  3W1S C;  3UQB A;  1WYW B;  3WAP A;  2JXX A;  1TYG B;  3L17 A;  4ZOH C;  1FD6 A;  4QAY A;  2K1F A;  2OQB A;  1DDM A;  2L0T A;  5LLI A;  2WDT B;  4HEA 1;  4YON A;  4N59 A;  4A55 A;  4CYE A;  1QZE A;  4E3C A;  3HQC A;  2KWU B;  2W9N A;  1KFY B;  1E8W A;  1UBQ A;  5L83 A;  5C2T B;  2V76 A;  4OT1 A;  4J6I A;  4B9K A;  3AM9 A;  1OMW A;  3PZ7 A;  5D3X A;  3GE8 C;  4M8M A;  1V81 A;  3EHV A;  4YTP B;  5FK9 C;  1KM7 A;  2WXL A;  1MG4 A;  4YTN B;  2HRJ A;  1XQQ A;  3MC0 B;  3AEA B;  2BYV E;  1RWS A;  2K8E A;  3WAM A;  4HCP B;  4XDC A;  1JWB D;  1K8R B;  1U2B A;  3VTW A;  2WU2 B;  3VH4 B;  1FFU A;  2RGN B;  3RMK C;  1N6Z A;  3DVG X;  4KVG B;  3E9P A;  4DWF A;  3J9C A;  1B1Z A;  2R2O A;  3TFM A;  3VUW A;  1UNS A;  1HTQ A;  2G35 A;  2ON8 A;  4L1R A;  3MHZ A;  2Z0O A;  3R7R A;  3A9K A;  1VR9 A;  1P3R A;  3WIM A;  1T0R C;  1X11 A;  2CAY A;  4BBK A;  1PGA A;  2BKR B;  2JVC A;  2YEP F;  4I6N B;  4EZK A;  1E90 A;  4KKI A;  1F2R C;  2GBM A;  1TTN A;  2WX0 A;  4IFS A;  5CLL B;  1AW7 A;  2Y8G A;  5J2R A;  2YT0 A;  1PFD A;  2RNR B;  1BWN A;  3VQI A;  4D2K A;  2TSS A;  3UI3 A;  4AP4 C;  1Q67 A;  2K8B A;  1TS2 A;  3ZVV A;  1TY2 A;  2H7E A;  1N62 A;  4OZC A;  1SBB B;  4HLE A;  4MGZ E;  4ZRK A;  4US9 A;  5BMI A;  3B1L X;  2H89 B;  3HSA A;  3KY9 A;  4M0W B;  3L54 A;  4K3B A;  4MAC A;  3DVG Y;  1CK1 A;  1FOE A;  4RGT A;  2KTR B;  4II3 B;  2COF A;  2D3C A;  5MPO A;  1QLB B;  1ZGU B;  2OOB B;  3GP7 A;  2JF5 A;  3DBL I;  5FR3 A;  2LWP A;  4W9G A;  2MH7 A;  4TV3 A;  1DOY A;  2Y8F A;  4W9C A;  3HRD D;  1QQG A;  1FB8 A;  3QC8 B;  1DBH A;  3GYO A;  1C79 A;  2JYT A;  1FHX A;  2Y3A A;  4AS1 A;  1A5R A;  3P7Z A;  3ZTC A;  3FEH A;  3OG5 A;  2KCJ A;  2KX3 A;  1UWM A;  2DZJ A;  2Z4D A;  1JAL A;  3PRP B;  4OVU A;  4XGA B;  4HKZ E;  3NZS A;  3AEB B;  2P0F A;  4NNJ B;  4P7I A;  4W9D A;  3R2I A;  4HDO A;  2GBR A;  1EWC A;  4AWJ A;  1BT0 A;  2MFQ A;  2DKP A;  2J7Q B;  2MJE A;  1CZP A;  2MWS B;  2PE9 A;  2LVQ A;  1XF5 L;  2XEW A;  4OW0 A;  1J7B A;  5AZH A;  5L95 C;  1XR0 B;  4ZRI A;  1UNP A;  2CY5 A;  3PVW A;  3PVU A;  3O65 B;  4ZRQ A;  3KWL A;  3NZ3 A;  3ZNG C;  1STE A;  1LQB A;  3ML4 A;  5C1Z A;  4II2 B;  1LW3 A;  4A6F A;  1ET9 A;  2KJ6 A;  2KJR A;  1QC6 A;  1YD8 U;  2GBN A;  2L3Z A;  1PDX A;  4BBN F;  2ZPY A;  1GPX A;  2L2I A;  3H9D A;  3DBH B;  4F8C B;  1VZ7 A;  2X8X X;  4RH6 A;  4YT0 B;  4EZL A;  3CIR B;  3A9J A;  4DXA B;  4RM9 A;  3QBV B;  2X38 A;  1FNW A;  3DWG C;  1WGG A;  5C16 A;  1NYQ A;  2KAJ A;  2WXH A;  2C5L C;  3TCA A;  3B77 A;  1N60 A;  5JP4 A;  3AEE B;  5E6J A;  4KAX B;  2ZNV B;  1U5E A;  1UD7 A;  3VR9 B;  5JXV A;  2G4S A;  5J3Y A;  1XCT L;  2JSV X;  4MH8 A;  3BY4 B;  1K50 A;  5EE0 A;  1ZW7 A;  3VVW B;  2IPK D;  4EEW A;  4JKD A;  1FM0 D;  2J53 A;  2JWZ A;  2NTS A;  1KOT A;  4GU2 A;  5DPT A;  1HE8 A;  5C5B B;  3P63 A;  1EUV B;  1VDV A;  2YT1 A;  2AQ1 B;  5H92 C;  3U8Z A;  4OVZ A;  2BWF A;  5AEK B;  2WH5 A;  3RNG C;  2NBV A;  1R4M I;  1C4C A;  3EFC A;  1JRU A;  4YSY B;  2O2V B;  2JRI B;  2KWD A;  1ZC4 B;  3I63 C;  2NTT A;  1YX5 B;  3AE1 B;  3HVD A;  3TEY A;  1FRD A;  1UEF A;  3RNF C;  3KSY A;  5I2S A;  5DIF B;  3OAW A;  2QEJ C;  1SIF A;  3V61 A;  1WXQ A;  2WP9 B;  1UGJ A;  1WFY A;  2RVB B;  4QJ3 B;  1V1O A;  1WRD B;  2KN4 A;  1NU2 A;  1V1P B;  1WGH A;  3D32 A;  2WXO A;  2DEN B;  2M14 A;  2YRY A; 
#chains in the Genus database with same CATH homology
 3D8F A;  2LJ5 A;  3QQ8 B;  1I7A A;  1WF9 A;  1V49 A;  1C3T A;  2CY4 A;  4CHK A;  2KHW B;  3SO6 A;  1GJZ A;  3PGE A;  2L7R A;  4W9L A;  4EOY A;  3AXC A;  3L08 A;  3A33 B;  1U5F A;  3KZ1 A;  4F7U P;  1K5D B;  1S1Q B;  2FJ9 A;  1CMX B;  4HJK A;  2D9X A;  2RQ1 A;  3DPD A;  2GS0 A;  2OTX A;  2YSZ A;  4JKG B;  3KUZ A;  3PEG A;  5D7G A;  1ZVR A;  4GMV A;  2NCN A;  5DCN A;  1ZM0 A;  3M63 B;  3DVN V;  1WXM A;  2JPH A;  2X18 A;  2FID A;  2L76 A;  1E7U A;  1DIK A;  3QK0 A;  1LXD A;  3IBE A;  4JK8 A;  2N9E B;  3VFK A;  5KQ4 A;  3JVZ X;  3TW1 A;  4M8N A;  4BKS A;  1XX0 A;  2KJH B;  1OEY J;  1IPG A;  1TBE A;  4LJO B;  4KIK A;  3APD A;  3UZT A;  4JKA A;  2KX0 A;  1X1G A;  4RMA A;  3VOQ A;  3WAL A;  4ANV A;  3KYD D;  2MBE A;  3ZKJ C;  4MGI E;  2I1J A;  2IYD B;  3ZDT A;  4K2P A;  4DHJ B;  4DDG D;  4TYZ A;  4JKF A;  1EGX A;  1U4A A;  1MIX A;  3PZD A;  2DYO A;  1MAI A;  4GB9 A;  4JKE A;  2KNB A;  2IO0 B;  2BGF A;  3JW0 X;  2K00 A;  3AU4 A;  4GGQ A;  4WJP A;  3PLV A;  3PRZ A;  3A98 B;  3HM3 A;  4MJS B;  4JK9 A;  3IG3 A;  4ANW A;  3DXE A;  1B55 A;  4ASW C;  3U30 A;  2LGD A;  2DA0 A;  1HB6 A;  3KUC B;  2IY1 B;  4HHV A;  2KMC A;  2GJY A;  3ZRC A;  3HK0 A;  4EJN A;  4HK2 A;  3RUL A;  4GDL A;  4F7Z A;  2IBI B;  4F7G A;  4Y94 A;  4GSW A;  5JZE B;  3ALB A;  1YJ1 A;  2DZM A;  4WWN A;  1P9D U;  2YS3 A;  4NPN A;  1GUA B;  1XD4 A;  4KHB B;  4TQ0 A;  2UWQ A;  3HHM A;  1J19 A;  1UNQ A;  4E74 A;  1OEY A;  1DYN A;  2LXA A;  1WR1 A;  1KBL A;  2D11 A;  2KXJ A;  4FJZ A;  3VDZ A;  1Y8R C;  2AYO B;  3VIA A;  5C6R A;  1WJM A;  2Z59 B;  5DPR A;  2D9Y A;  3QWM A;  4YL8 A;  2WWZ A;  2JP2 A;  1UPQ A;  3VUY A;  1EF5 A;  3M62 B;  2CR5 A;  2DAJ A;  3FP5 A;  2NBW B;  3IHP C;  2M8S A;  3V6C B;  2LOX A;  3KRW A;  4WWO A;  4HAY B;  2M38 A;  2LVO A;  1EF1 A;  5EDS A;  2CKH B;  1TJ6 A;  4A20 A;  2BWE S;  2Q13 A;  3QWZ B;  2ELA A;  3G9W A;  2ZPN A;  2BYF A;  2I5C A;  3NY5 A;  3QX1 A;  2MQJ A;  1P3Q U;  1YQB A;  1WH3 A;  4GDK A;  3SBT A;  1NTY A;  5GOW B;  2L00 B;  1P98 A;  1I42 A;  3L13 A;  2CHX A;  4DHZ B;  2LAS A;  3MDB C;  3H7P A;  2D4Q A;  3PLU A;  4JKH A;  1WXV A;  3SBG A;  2UVM A;  3KVF B;  3KRX A;  3W1S A;  3L16 A;  1V9J A;  1FGY A;  1W1G A;  4LJP B;  1TQZ A;  1KI1 B;  5LXH A;  2C60 A;  2JT4 B;  4EUT A;  2UZR A;  3EPY A;  4H8S A;  4DBB A;  1H8C A;  3M95 A;  2N7E A;  1V5T A;  1XT9 B;  2JY6 A;  2N1V A;  3PPA A;  2ZNV C;  3LJ3 A;  1ZKH A;  2R82 A;  2MA9 B;  3T9L A;  2EKE C;  4HB4 B;  2QKM A;  1SHC A;  2KZR A;  1KJT A;  3ML8 A;  4KSL C;  3APC A;  2DYN A;  1F9J A;  2N7D A;  2MCN B;  3VH3 B;  3L0W B;  3N30 A;  4ANX A;  2LKO A;  2JRH A;  2ELB A;  2AL6 A;  3S2A A;  4IWQ A;  5J3Q A;  3PHX B;  1S3S G;  3JYU A;  4DHZ E;  3V62 A;  2O6V B;  3BJI A;  4JLC A;  2R2Q A;  1ZC3 B;  2MWN B;  5KHQ A;  3I3T B;  4NAW A;  3TJP A;  3WAO A;  2CHZ A;  3ZO5 B;  2E2X A;  2KFK B;  4WJO A;  1WJN A;  2K6D B;  3QAR A;  4LDT D;  2EJ8 A;  2DLW A;  2KC2 A;  5C5B A;  4L6E A;  3ZNH B;  3X23 A;  1BTN A;  4HAT B;  2BKF A;  4PS7 A;  2KLC A;  1E8Y A;  2M1M A;  3QCA A;  3A1Q B;  4HAZ B;  2DIK A;  5IAA C;  1X1F A;  3A4S C;  3ODW A;  3LJU X;  1FAO A;  2KDE B;  2IY0 B;  4A6H A;  4EFO A;  3N3K B;  4WJQ A;  4IG7 B;  2W2W A;  3ONS A;  4CHJ A;  2COP A;  1E5W A;  5D2M B;  5J18 A;  5CX3 A;  4K81 A;  1XOD A;  3PG7 A;  2FUH B;  1LB1 A;  4W9I A;  3ZNZ B;  4WJ7 A;  1NDD A;  2NPT A;  3K9O B;  4MSQ B;  4ICU A;  2N9P C;  1X1M A;  2KWC A;  3CF6 E;  3DVN U;  2DZK A;  4KZ0 A;  3A9K B;  3PRM B;  4URK A;  4W9H A;  4DX8 A;  2M4N A;  2G3Q B;  1FXT B;  3MPX A;  2UZS A;  5TR5 A;  2CRF A;  3RUI B;  3M1I B;  1OQN A;  2MP2 A;  3RCZ A;  2DYQ A;  3Q3F A;  2HTH B;  3PHW B;  3MJW A;  2QKL A;  4JKG A;  2IO3 B;  4XX5 A;  2CU1 A;  4C0A A;  3UGB B;  2ZEQ A;  5CTR C;  5DPW A;  4D0N B;  4IC7 B;  1VCB A;  2BPS A;  3CSF A;  4K1R B;  3FSS A;  1WX9 A;  2FCN A;  1W1D A;  4LDT B;  2AEH A;  3R66 C;  1P5T A;  3A8P A;  3A4R A;  3APF A;  2K6Q A;  2PZ1 A;  2D07 B;  4MGY E;  2GBJ A;  2EC1 A;  4HWI B;  1IYF A;  1XKE A;  1X86 A;  4MSM B;  1VBH A;  5E6O A;  1UZX B;  5DI9 B;  4IAP A;  3WAN A;  1Q5W B;  4DHJ D;  1WX7 A;  2GMI C;  3RYT A;  1TXD A;  5LON B;  1V5O A;  4G0N B;  2LRW A;  2D9W A;  3VTV A;  4MEM A;  1WE6 A;  5JLJ B;  3RCP A;  2N1W A;  4WAA A;  4PNK A;  2KDI A;  1ACA A;  2OJR A;  1TZ1 A;  1E8X A;  2PJH A;  1WM3 A;  4XWX A;  1Q0W B;  2Y7B A;  4K7W A;  4DBG A;  3U7D A;  4PYU A;  2CQU A;  3NHE B;  2DHJ A;  2GCL A;  4EMO A;  3TVV A;  2Z0P A;  2DX5 A;  2R0D A;  4DK5 A;  4WVF B;  3FLV A;  2ZVN A;  3RT3 B;  3ULB A;  4PS3 A;  4ILH A;  5DPS A;  2FIF A;  3SHQ A;  3DXC A;  2Y5B B;  2FDQ A;  2LI5 A;  2ZCB A;  1TGZ B;  3C0R B;  2YVC A;  1P0R A;  1WVH A;  3BIN A;  1ST7 A;  1WE7 A;  3HW2 B;  4BKS D;  3TIX A;  2GOW A;  4EKU A;  4NJ6 A;  4FJV B;  2EMT A;  4ILJ A;  2C7M B;  2PE6 B;  3N7C A;  3N32 A;  2NBV B;  2LG1 A;  3PS6 A;  4DDI D;  4IM3 A;  2LXC A;  2KFJ A;  1J8C A;  2A4Z A;  2N23 A;  4MH0 E;  3V6E B;  2ASQ A;  4TUU A;  2QHO A;  5KHO A;  5C79 A;  2K8H A;  1C1Y B;  3E9O A;  3ZLZ A;  1UBI A;  3MHS D;  2DZI A;  2GCJ A;  2KVR A;  1PLS A;  3UQA A;  2D3G A;  4CO7 A;  5D3W A;  3AI5 A;  2JZ3 B;  4FBJ B;  1T0Y A;  2MBO A;  5CLQ B;  5HE2 A;  1WI0 A;  1Z87 A;  2DHK A;  5JHH A;  2COA A;  2MW5 A;  4I6P A;  2ZJD A;  2KN5 A;  3ZVR A;  1H4R A;  3DXD A;  5KCV A;  2VRW B;  1AQC A;  2ADZ A;  3D8D A;  2V3S A;  2MX2 A;  1WJ4 A;  2H7D A;  1WZ0 A;  3F5R A;  4HPM B;  4ILG B;  2YF0 A;  2Z0Q A;  1SGH A;  1ZSQ A;  2P0H A;  3X0W A;  4A6K A;  3OLM D;  4N9F 4;  4EZJ A;  4K2O A;  3DBS A;  2KDB A;  1GGO A;  2XK5 A;  4JIO U;  2C7N B;  2REX A;  3JSV A;  4JGH B;  4MGK E;  2DYM A;  2VKI A;  4HB2 B;  2J59 M;  1WIA A;  1WXA A;  1WMH B;  4HPL B;  2COD A;  2Z0D B;  4PYZ A;  1N3H A;  4KDI C;  3L10 B;  5CHW A;  3WYF B;  1V89 A;  3OJ3 A;  2MBB B;  1P1A A;  1PFJ A;  2BCJ A;  4NY0 A;  5JHB A;  1YX6 B;  1VBG A;  4RM8 A;  1U5D A;  1U29 A;  4JL9 A;  2YLM A;  4GMX B;  3PSE B;  5JHG A;  1FGZ A;  3DQV A;  4K17 A;  3TMP B;  3PTF C;  2I1K A;  2JZZ A;  4XC2 A;  1FHO A;  4FAD A;  4MDK E;  3ZDM C;  2FNJ B;  4B6W A;  4F7H A;  3Q3J A;  1V5M A;  3ECI A;  5L81 A;  4KZC A;  2DTC A;  2HE7 A;  2NZ8 B;  5HE0 A;  1RJ2 A;  2RLO A;  5AZG A;  1V5U A;  2R09 A;  2O6V D;  3TL5 A;  4B95 A;  1H10 A;  3QA8 A;  1EO6 A;  1WJ6 A;  2DFK A;  2LZ6 A;  4Z2N A;  1BAK A;  3HM6 X;  2J0J A;  1WM2 A;  3QIJ A;  4A5K A;  4NJ7 A;  3T06 A;  1Q1O A;  1UGM A;  1RLF A;  4B6H A;  3R7Q A;  3VAW A;  5J3T A;  4G50 A;  5C23 A;  2NMB A;  1ISN A;  2LRU A;  2FCQ A;  2KFK A;  2WX1 A;  3NS8 A;  5LOP B;  1V86 A;  2KTR A;  2C7H A;  3UF8 A;  4ZDV A;  5JH5 C;  4HDQ A;  4AJY B;  3K9P B;  1OQY A;  4W9F A;  3RZF A;  2CS4 A;  4GDL B;  5FR6 A;  2ROZ B;  3F0W A;  1MG8 A;  2K2U A;  4GPT B;  2CB8 A;  3A1Q A;  2RGF A;  2HJ8 A;  3KH0 A;  2D2Q A;  1NI2 A;  2KO3 A;  5CHV C;  3SD5 A;  1V80 A;  3NSU A;  1WGD A;  2NVU I;  4NQL B;  3DOW A;  3PVL A;  1DRO A;  2HD5 B;  3H6N A;  4AJW A;  1I2H A;  2MBH A;  3O96 A;  4HAV B;  4GOC A;  2KLG A;  3CIK A;  1Y19 B;  1WZ3 A;  2IFS A;  1E7V A;  2YS5 A;  5G2N A;  2ZZP B;  3CXB B;  1PMS A;  4I6L B;  1NTV A;  2K2J A;  2J0M A;  5E6P A;  3EFU A;  1EAZ A;  1P6S A;  3UIO B;  2KTF A;  4NQK E;  4FHK A;  3D8E A;  1WGU A;  3AJ4 A;  3ZTD A;  1WI1 A;  3IFW B;  1X05 A;  1RRP B;  1E8Z A;  5LXI B;  5GMV A;  4JKB A;  2LBB A;  2P8V A;  3B08 A;  4NSW A;  4GXB A;  2L05 A;  1J0W A;  1U5G A;  2ZCC A;  2VSZ A;  2L8J A;  2L0F A;  2BYE A;  3ZW3 A;  2KWV B;  2HTH A;  3QHT A;  4K7S A;  2ABD A;  5JHA A;  2LUL A;  4HXD A;  4FLH A;  4BFR A;  1UPR A;  4IM2 A;  1W1H A;  1WXS A;  1M94 A;  3ENE A;  2GBK A;  4FA6 A;  2CHW A;  3KYC D;  4AUQ C;  1M7E A;  4GDK B;  3TO1 A;  1RFA A;  3UIN B;  5FI0 A;  2NR2 A;  4FN2 A;  2K25 A;  2K39 A;  1FHW A;  2D9Z A;  2O2V A;  1K5G B;  1MPH A;  2XQN M;  2DHZ A;  4CHM A;  1NVL A;  2KDF B;  2PPH A;  3H7P B;  3W1Y A;  5AZF A;  3E9L A;  1KZG A;  2PEA A;  3VUX A;  1L2N A;  2AL3 A;  4IWO A;  2KGX B;  1DDV A;  2LD9 A;  3SUZ A;  4MM3 A;  3MTN B;  2N0Y A;  4KDL B;  5D94 A;  1MIZ B;  3KUD B;  2DAF A;  3AU5 A;  2KC1 A;  3SU8 X;  5BO4 B;  1V88 A;  4FJY A;  5CHF A;  3DBH I;  2KQ7 A;  1M7R A;  5D3V A;  3R3M A;  4IUM B;  5DHA B;  2VRR B;  3VHT C;  4ANU A;  3ULC A;  3ODX A;  3ML9 A;  4BKT A;  1J0G A;  4PS8 A;  1WGR A;  4AOF A;  4FHJ A;  2KKC A;  1JDE A;  1L7Y A;  2N9X A;  5G55 A;  1I35 A;  3LDZ E;  2BF8 B;  3CST A;  4A3O A;  4MEL A;  5HE1 A;  1AAR A;  2WYQ A;  4WSF A;  4NAW B;  3OAN A;  1XCG A;  2ZVO A;  1EVH A;  3PSC A;  3PRE A;  2LOZ A;  4KSK C;  2N4F A;  4ICV A;  3AUL A;  3EC8 A;  2M0X A;  4HAX B;  1AWE A;  1GNU A;  5D6J B;  1IP9 A;  3VXW A;  3SYX A;  2DN6 A;  2AWT A;  1RAX A;  1BTK A;  4XZ4 A;  2MLB A;  4BOZ B;  2RPQ A;  3QJZ A;  2KAN A;  3TBL D;  1SE9 A;  2LGY A;  1MK9 B;  3ZIM A;  3SV1 A;  3E66 A;  3ENB A;  2ROV A;  4IM0 A;  4ZYN A;  2KUP A;  1OY2 A;  4HAW B;  1HB8 A;  2J0K A;  4KHO A;  4MT7 A;  1V6E A;  1WGQ A;  2MBQ A;  2RSG A;  2B3A A;  1G6J A;  1GC7 A;  4WQO B;  2NPT B;  2A5U A;  2UYZ B;  4A6F B;  4IWP A;  4BBN C;  4TQ1 A;  3A8Q A;  1WJU A;  2C9W B;  1WJ1 A;  4G3X B;  2D10 A;  3A9J B;  4K7U A;  3H1U A;  1KZ7 A;  4MJS A;  4GN1 A;  2V1Y A;  2MP2 B;  4JK7 A;  2IO1 B;  5HE3 A;  4HVB A;  2IO2 B;  2KQS A;  1WG7 A;  3FM8 C;  4HAU B;  1V2Y A;  1NBF C;  2JUO A;  1LM8 B;  5KQ1 A;  1PQS A;  4X57 B;  3B0A A;  2RR9 A;  2EMS A;  5IA7 A;  1WMH A;  2KOX A;  2K8C A;  1NTI A;  4Z2M B;  2DYB A;  1OGW A;  2MSE D;  1V5P A;  3VTU A;  3DDC B;  5D3Y A;  1OTR B;  3NOB A;  1RRB A;  4MY6 A;  2RUK B;  3ODO A;  2P0D A;  3DBR I;  3GOE A;  3KW5 B;  1HBK A;  5JVL A;  4OVV A;  1KLV A;  5FI1 A;  2KMA A;  3P2B A;  2I5F A;  4HB3 B;  5D27 A;  2FCM A;  3CMM B;  1MK7 B;  2FCS A;  3SDL C;  3H7S A;  3QAQ A;  4BVU C;  3M3J A;  1D3Z A;  1GG3 A;  4BKG A;  1Z2M A;  4W9K A;  5DH9 B;  2W2X C;  2NBU A;  2Z0E B;  2M17 A;  3ZRF A;  2IZV B;  2XBB C;  2FAZ A;  2LVP A;  4F1S A;  5IJM A;  2DX5 B;  4HB0 B;  1VD2 A;  1Z5S B;  2LUE A;  2W2X D;  2MKR A;  2DKQ A;  4KHA A;  4BOS C;  3PV1 A;  3HIZ A;  1IRS A;  4GZU A;  5EFX A;  3WA0 A;  3V5W A;  5E6N A;  4E71 A;  3OJ4 B;  2X0S A;  3EEC A;  4LCD E;  2DX1 A;  2YS1 A;  4HCN B;  2D9V A;  3T8M A;  3GYP A;  3UIP B;  4KV2 A;  4DX9 0;  4KIK B;  1WX8 A;  5J17 A;  3ZUN A;  4WJN A;  2MDX A;  2G4D B;  1MKE A;  2L1C A;  4JQW C;  4FUL A;  3ZNI D;  2FJL A;  4GIV A;  1UH6 A;  3P6A A;  4W9E A;  2NS5 A;  2KK8 A;  3NZU A;  4ZRJ A;  4IOY X;  4A3P A;  5DHF B;  1KC7 A;  3SNH A;  3DCG A;  1WR6 E;  4MK0 A;  1WGY A;  4WWP A;  1XD3 B;  1GC6 A;  1U27 A;  1R4N I;  3PP2 A;  3RD2 A;  4JKC A;  1UEL A;  2V4L A;  1WY8 A;  1Y5O A;  1LFD A;  4W9J A;  3IVF A;  2G45 B;  1V61 A;  2MRP A;  2IYB A;  3RZW C;  2O6V A;  5HKH A;  4IW0 A;  1DDW A;  3GZN I;  2COC A;  2RSU A;  3PT2 B;  2KD0 A;  1UNR A;  2LGX A;  3V60 A;  2DHI A;  2LYD A;  4G11 A;  4PQ0 A;  1YIW A;  4TKN A;  2XK5 B;  2RD0 A;  3JSV B;  3W1S C;  3UQB A;  1WYW B;  3WAP A;  2JXX A;  3L17 A;  2K1F A;  2OQB A;  1DDM A;  2L0T A;  5LLI A;  2WDT B;  4YON A;  4CYE A;  1QZE A;  4E3C A;  3HQC A;  2KWU B;  2W9N A;  1E8W A;  1UBQ A;  5L83 A;  2V76 A;  4J6I A;  4B9K A;  1OMW A;  5D3X A;  4M8M A;  1V81 A;  3EHV A;  1KM7 A;  2HRJ A;  1XQQ A;  2BYV E;  3WAM A;  4HCP B;  1K8R B;  1U2B A;  3VTW A;  3VH4 B;  2RGN B;  3DVG X;  4KVG B;  3E9P A;  4DWF A;  2R2O A;  3TFM A;  3VUW A;  2G35 A;  2Z0O A;  3R7R A;  3A9K A;  1P3R A;  3WIM A;  1X11 A;  2CAY A;  4BBK A;  2BKR B;  2JVC A;  4I6N B;  4EZK A;  1E90 A;  2GBM A;  1TTN A;  2WX0 A;  4IFS A;  5CLL B;  2Y8G A;  5J2R A;  2YT0 A;  2RNR B;  1BWN A;  3VQI A;  4AP4 C;  1Q67 A;  2K8B A;  3ZVV A;  2H7E A;  4HLE A;  4MGZ E;  4ZRK A;  3B1L X;  3KY9 A;  4M0W B;  3L54 A;  3DVG Y;  1FOE A;  2KTR B;  4II3 B;  2COF A;  1ZGU B;  2OOB B;  2JF5 A;  3DBL I;  2LWP A;  4W9G A;  4TV3 A;  2Y8F A;  4W9C A;  1QQG A;  1FB8 A;  3QC8 B;  1DBH A;  3GYO A;  1FHX A;  1A5R A;  3P7Z A;  3ZTC A;  3FEH A;  2KCJ A;  2KX3 A;  2DZJ A;  3PRP B;  4OVU A;  3NZS A;  2P0F A;  4NNJ B;  4P7I A;  4W9D A;  4HDO A;  2GBR A;  4AWJ A;  1BT0 A;  2MFQ A;  2DKP A;  2J7Q B;  2MWS B;  2PE9 A;  2LVQ A;  2XEW A;  5AZH A;  5L95 C;  1XR0 B;  4ZRI A;  1UNP A;  2CY5 A;  3PVW A;  3PVU A;  3O65 B;  3ZNG C;  1LQB A;  3ML4 A;  5C1Z A;  4II2 B;  1LW3 A;  4A6F A;  2KJ6 A;  2KJR A;  1QC6 A;  1YD8 U;  2GBN A;  2L3Z A;  4BBN F;  2ZPY A;  2L2I A;  3H9D A;  4F8C B;  4EZL A;  3A9J A;  4DXA B;  4RM9 A;  3QBV B;  1WGG A;  5C16 A;  2C5L C;  3TCA A;  5JP4 A;  4KAX B;  2ZNV B;  1U5E A;  1UD7 A;  2G4S A;  5J3Y A;  3VVW B;  3BY4 B;  1ZW7 A;  4EEW A;  4JKD A;  2JWZ A;  1KOT A;  4GU2 A;  5DPT A;  1HE8 A;  5C5B B;  1EUV B;  2YT1 A;  3U8Z A;  2BWF A;  5AEK B;  2WH5 A;  1R4M I;  1JRU A;  2O2V B;  2JRI B;  1ZC4 B;  1YX5 B;  1UEF A;  3KSY A;  5DIF B;  3OAW A;  1SIF A;  3V61 A;  1WFY A;  2RVB B;  1WRD B;  1NU2 A;  1WGH A;  3D32 A;  2DEN B;  2M14 A;  2YRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...