2J0MA

Crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
329
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Autoinhibition of Focal Adhesion Kinase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 81
structure length 329
sequence length 329
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2j0mA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j0mA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2j0mA01
2KQ7A 1Y5OA 3M63B 5AZHA 3PGEA 1J0GA 2KC2A 2KZRA 3VH3B 2MWSB 2DHIA 2IO2B 4MGYE 4DHZE 4KAXB 1KJTA 3KUDB 2C60A 5D7GA 3ZNHB 3C0RB 2D9YA 3PVWA 3TL5A 2DFKA 4TUUA 2Y8FA 2ZPYA 3SUZA 2CS4A 1C3TA 4BKSA 2O2VA 2QKLA 1E8WA 3OANA 1LQBA 3H7SA 4FJYA 1N3HA 3SNHA 2FCNA 2I1KA 4G50A 1TQZA 4KHOA 4GDLB 1KLVA 1OEYJ 4MH0E 5KQ4A 2YF0A 1CMXB 1FHWA 3H1UA 3WA0A 2RNRB 5EFXA 3NOBA 2N1WA 3BINA 2JY6A 4AUQC 5J17A 3A8PA 2YVCA 5HE0A 2KHWB 1BAKA 3V5WA 2PJHA 4JQWC 2Y5BB 2M17A 4II2B 4KDLB 1V6EA 5CHFA 5DPSA 4ANUA 2JUOA 2C7MB 4K7SA 4MSQB 2K6DB 4PS7A 3PRMB 4YL8A 3RUIB 3A9KB 5KQ1A 2MFQA 3G9WA 1RLFA 3QJZA 3M1IB 4W9GA 1KI1B 1V61A 4FULA 4BBKA 4KV2A 1Z5SB 1SGHA 2C7NB 5D3WA 3V6CB 1I2HA 1E8XA 4F1SA 3Q3FA 1V80A 3DVGY 4IM2A 1JRUA 4EZKA 5AEKB 4TKNA 2UZRA 4GZUA 5J3TA 5C23A 5LLIA 1I35A 2R0DA 3P7ZA 4FJZA 4G0NB 2ASQA 5JZEB 2MCNB 5D94A 1P3RA 4BBNC 4HDQA 3ODXA 2MLBA 1HB8A 1X11A 2ZNVB 4HCNB 1WZ0A 2KANA 3AI5A 3DBHI 1EF5A 3M95A 3TBLD 2K2UA 4HB0B 2MX2A 4HHVA 3HW2B 4BVUC 2KCJA 3TCAA 3H9DA 5HE3A 2G4DB 1EUVB 1P98A 2L0FA 3KUZA 2IO0B 3DXDA 4F8CB 4K81A 4XWXA 3MTNB 4WWNA 5JHAA 3A9JB 1BWNA 2M1MA 2MSED 2PE6B 2YLMA 5G55A 2NS5A 1LM8B 2IY1B 3KYDD 3FP5A 1W1HA 5J2RA 3X23A 1PLSA 4I6PA 3UINB 3IFWB 5L95C 1PMSA 1W1GA 1UZXB 4TYZA 1RFAA 2N0YA 1EF1A 4MJSB 2LVOA 3N32A 4JGHB 1E8ZA 2CY4A 5CLLB 3O96A 1WYWB 3APFA 3DBSA 3ZW3A 2GJYA 2KX0A 4NY0A 4IM3A 4DDID 2DZMA 1OQNA 1IYFA 2ZPNA 3ML9A 4URKA 2RUKB 4NQKE 2CAYA 2KD0A 1YX5B 2AWTA 1ZW7A 3KVFB 2NMBA 2LRWA 3RZWC 1GC7A 1OQYA 1V5PA 4HPLB 3ZTCA 2K8BA 1R4NI 1K5DB 3A1QA 1WXSA 3DBLI 5E6NA 1ZGUB 4PQ0A 3UIOB 2K2JA 1SE9A 2A5UA 3MDBC 5CHVC 2CB8A 4PYUA 5J18A 2H7DA 4W9LA 1LB1A 1NI2A 5CTRC 4CHKA 4IG7B 2DZIA 3KSYA 4N9F4 4J6IA 1LXDA 1K8RB 3VTWA 4CO7A 4DHZB 4ZDVA 4W9CA 4I6NB 5DPTA 5IA7A 2M38A 3CIKA 3CXBB 2KXJA 3EC8A 2E2XA 2LZ6A 3QQ8B 3PZDA 3MJWA 4Z2MB 3RCPA 3HHMA 4NPNA 2DX5B 4GDKA 4WWPA 2C9WB 5CLQB 2MBBB 2LG1A 2WDTB 3A4SC 4BBNF 4DHJD 4K7WA 1I42A 1WIAA 4F7GA 3QWMA 4FLHA 2KNBA 1WR6E 3ZVVA 2C7HA 2N7DA 3DVNU 2MDXA 1GNUA 4W9EA 3ODWA 3QIJA 4HJKA 4IAPA 1NBFC 2IYDB 2REXA 2ZNVC 3PSEB 2KJHB 2LD9A 3SO6A 1TTNA 3PPAA 3GYPA 4X57B 2O6VB 4KDIC 3VTVA 4GXBA 4F7UP 2G4SA 3TW1A 3K9PB 2DKPA 2YSZA 1WJMA 3PLUA 4HK2A 3PRPB 1YQBA 1P0RA 4HCPB 2FDQA 3CSTA 1UEFA 3DBRI 2L7RA 1A5RA 3DVGX 2KKCA 1Q67A 2JXXA 2KFKB 3HIZA 1WX7A 1U5EA 2KLCA 4DHJB 1PFJA 4XZ4A 3PG7A 4ICUA 2DZJA 2ELBA 4HAYB 1WF9A 4W9DA 4EKUA 1UBQA 3RULA 3A98B 2LVPA 3OAWA 1FB8A 2V76A 3KZ1A 4MEMA 4C0AA 4LCDE 5AZFA 4IWQA 1P6SA 4MGZE 2ZVOA 2D11A 1Y19B 1UNQA 1RRBA 2ADZA 2JZZA 5JLJB 3T06A 1IRSA 1UPQA 3EHVA 1RJ2A 1P1AA 2EMTA 1V2YA 2ROVA 4A6FA 2COPA 4F7HA 1QZEA 2KFJA 2W9NA 2N7EA 4ANXA 2R2OA 3R7QA 5L83A 2GCLA 3ML4A 3DQVA 2M0XA 2L76A 3U30A 1D3ZA 1F9JA 2HTHB 1WX8A 2LASA 2R09A 1WMHB 2L00B 4NJ7A 3WAMA 1MAIA 3ZLZA 1U5DA 4BKTA 2L3ZA 2MP2A 3VUYA 3UIPB 4EZJA 4II3B 3ZRFA 5HE2A 2WH5A 2N1VA 2KN5A 1U4AA 3L08A 2HD5B 1TGZB 1E5WA 2Y7BA 1MIZB 3APCA 1WH3A 2MBEA 2JPHA 2V4LA 2DN6A 3GYOA 4ZYNA 2XBBC 2M8SA 2QHOA 2RPQA 3A1QB 1ZVRA 3DXEA 1DBHA 4IUMB 3L16A 3PP2A 5TR5A 1WGYA 5GMVA 2P0HA 2IO1B 3SHQA 3R7RA 2JRHA 2BYFA 4FHKA 2FIDA 4FADA 4K1RB 1WR1A 1WI1A 1MK9B 1UNPA 2YS3A 3HK0A 1WJNA 2GMIC 1DROA 2KDBA 2KVRA 1J8CA 2ELAA 4B6HA 3QBVB 3W1YA 4HLEA 1XQQA 3DVNV 4G3XB 3EECA 1U27A 5AZGA 4KIKA 3JW0X 3QX1A 4WJOA 4WJQA 4FBJB 3DDCB 2VSZA 3QWZB 1ACAA 4DDGD 1J19A 2D10A 2DHKA 2Z0PA 1AWEA 2XK5B 3PREA 4GB9A 2WYQA 4NAWA 5JH5C 4D0NB 1OY2A 3ENEA 1K5GB 3HM6X 2FAZA 3R3MA 3RCZA 3VAWA 1LFDA 4B6WA 2GS0A 1XT9B 3PHXB 2P0DA 2KTFA 2NVUI 4GU2A 2PZ1A 3VIAA 2K6QA 2I5CA 2GBKA 2OQBA 1FGYA 2DYQA 1MKEA 2YT0A 3DXCA 1QQGA 2W2XD 4GMVA 2K00A 5C5BB 2D3GA 2KWUB 2XEWA 4EFOA 4DBGA 5DIFB 3GOEA 3ZTDA 2J0MA 1YIWA 2D9WA 4K7UA 4LDTB 4HAXB 4E74A 3DOWA 3SV1A 1BTKA 4G11A 3N30A 3VXWA 1WJ4A 2LUEA 1WGUA 4GIVA 3ZNGC 4XX5A 5KCVA 3ML8A 4A6HA 2LOXA 3P2BA 3QK0A 1GG3A 1WM2A 2R2QA 1VD2A 4HVBA 2YS5A 1Q5WB 4JLCA 3AU5A 3WYFB 3PVUA 4A5KA 1KZ7A 1AARA 2FCSA 1WG7A 4WQOB 4A6FB 2NPTA 1YJ1A 4ANVA 2JT4B 1TZ1A 2N4FA 4PS3A 4BFRA 5C5BA 1WRDB 5LXIB 3H7PA 4KVGB 1IP9A 3WAPA 4GN1A 2NR2A 4WJNA 1WGQA 1L2NA 3RT3B 1P9DU 3IHPC 2GBRA 4ZRKA 3RZFA 2CQUA 3KUCB 3UQBA 3MHSD 2CHZA 2P0FA 3ZNZB 3U8ZA 2G35A 1WX9A 4K2OA 2LGDA 1WVHA 3AJ4A 1WY8A 2D07B 1WXVA 2COFA 5DHFB 2DAJA 5D6JB 2P8VA 1E8YA 2MKRA 2G45B 1DYNA 1P3QU 1OEYA 3TVVA 2N9PC 3D8FA 5J3YA 2JF5A 3NZUA 4IW0A 2GBJA 4P7IA 1TBEA 1W1DA 1B55A 3PVLA 4HAZB 2MW5A 3A9JA 2D4QA 5D3YA 2CHWA 2KX3A 2PEAA 2L8JA 2DYBA 5DH9B 4KIKB 1UPRA 1P5TA 3ZUNA 4A3OA 5J3QA 3DCGA 2MBHA 3EFUA 4ZRJA 5FI0A 4EEWA 1V9JA 2VRRB 2LJ5A 4JL9A 1MG8A 2FNJB 2O6VD 3TFMA 3CSFA 1H4RA 2KLGA 3L17A 1MPHA 5D2MB 4AOFA 2CKHB 2D9XA 5DHAB 4MJSA 2KFKA 5KHOA 3W1SC 3DPDA 2EC1A 1M7RA 2N9XA 5HE1A 1Q1OA 2W2XC 3IBEA 4NSWA 1UGMA 4XC2A 4HDOA 4YONA 2V1YA 4B9KA 2D2QA 3AULA 4B95A 3ZDMC 1V89A 3V60A 5D3XA 1UH6A 2GOWA 1U29A 2RR9A 3TIXA 1QC6A 4GPTB 5G2NA 4ANWA 1GJZA 1ZC4B 4GSWA 2BCJA 4GOCA 4W9IA 5DCNA 3PSCA 2MQJA 2K39A 4K17A 3GZNI 4HATB 2CODA 3M62B 4EUTA 1RRPB 2ABDA 2ZEQA 2FCQA 4NNJB 4PYZA 2KQSA 2LXCA 3WALA 5C16A 3LJUX 1S3SG 3ALBA 1WM3A 2MBOA 4HPMB 4OVUA 5BO4B 4BOSC 5FI1A 3BY4B 1FGZA 2JVCA 2D9ZA 4MM3A 3ZNID 3O65B 1I7AA 1XD4A 2RGNB 1KM7A 2K8CA 4KSKC 1WJ1A 1FAOA 1NTIA 2DKQA 3BJIA 2KJ6A 3NZSA 4DX8A 3ZIMA 4KHAA 3ZVRA 1WGHA 2IBIB 3FSSA 2K25A 3SYXA 2RVBB 3UQAA 3NSUA 2EMSA 1BTNA 5DPWA 4HB2B 2NBVB 1J0WA 5JP4A 2DAFA 2DYOA 3LJ3A 3PV1A 4DXAB 2JP2A 2FJ9A 4I6LB 4W9JA 3VDZA 4TV3A 2LBBA 4HAUB 2GBNA 2KGXB 2K8HA 2LULA 3V6EB 3SU8X 5KHQA 1TXDA 3Q3JA 2O6VA 4HWIB 3EPYA 2WWZA 1FXTB 2G3QB 2NPTB 5JHHA 4IWOA 1WE6A 3RD2A 2D9VA 2UWQA 5JHBA 1ZSQA 1FHOA 2LWPA 3H7PB 1ZM0A 4HAWB 4RM8A 2IYBA 1V88A 2CY5A 1Z87A 4IOYX 1S1QB 2DYMA 2KMCA 1MK7B 3KH0A 3OJ3A 4GGQA 4OVVA 3ONSA 2YT1A 2KMAA 2KDFB 3UGBB 3MPXA 2WX1A 1WXAA 4L6EA 2KK8A 3KYCD 3VHTC 3KW5B 2J0JA 1X1MA 2MP2B 2VRWB 3APDA 4ICVA 3W1SA 4EMOA 1NVLA 1X1GA 5JHGA 3CF6E 4BOZB 2J0KA 2DX1A 2IZVB 4LDTD 1ZC3B 2OTXA 1EO6A 2N9EB 1HB6A 4DK5A 2DHJA 1XR0B 3U7DA 2BPSA 5IAAC 3VUWA 2B3AA 1R4MI 1X86A 4KSLC 1NTVA 2UZSA 4W9KA 3WIMA 4NQLB 2IFSA 1GC6A 2DTCA 2DENB 2H7EA 1UBIA 2KTRB 2MRPA 2M14A 2NZ8B 2Z0QA 2KO3A 3OJ4B 2PE9A 4PS8A 2YRYA 1V5OA 2EKEC 1V5UA 3V62A 3L10B 1G6JA 3L54A 2V3SA 2NBUA 3UF8A 3ECIA 5IJMA 4CHJA 5CX3A 1M94A 1X1FA 1XD3B 3QA8A 1WJ6A 4FJVB 2LGYA 4DBBA 2ZJDA 3PHWB 4WAAA 3V61A 3QAQA 2KUPA 4BKGA 4IWPA 2DHZA 4A20A 1C1YB 4EOYA 5LXHA 2Q13A 2L05A 2DZKA 4LJOB 2GBMA 4NAWB 4FA6A 3NS8A 3AU4A 1V81A 1LW3A 2RSUA 2ZCBA 4M8MA 3RYTA 3L0WB 4AWJA 2N23A 2FJLA 2QKMA 3FM8C 1H10A 4KHBB 2KTRA 3ODOA 2Z0DB 3NY5A 3PTFC 4TQ1A 4DWFA 3VOQA 3PRZA 4GMXB 2VKIA 1U5FA 1YD8U 3LDZE 4IFSA 4ASWC 4M8NA 5CHWA 2L0TA 1SHCA 1ZKHA 1ST7A 2RD0A 4HB3B 1T0YA 3A4RA 4A6KA 1U5GA 2BGFA 1UNRA 4CYEA 3HM3A 3TMPB 3AXCA 1SIFA 2BYVE 2BKFA 3ZO5B 5D3VA 1M7EA 2RQ1A 5L81A 1NDDA 4MT7A 2BKRB 2J7QB 4HXDA 3UZTA 2COCA 2JRIB 3VTUA 5C1ZA 1Q0WB 3ULCA 2ROZB 2OJRA 2XQNM 5D27A 2L2IA 1WGRA 3D32A 4NJ6A 1XKEA 4JIOU 3T9LA 5C6RA 2FIFA 2ZZPB 3JYUA 3M3JA 2LVQA 2ZVNA 3JSVB 4MGIE 1WE7A 1E7VA 1Z2MA 4K2PA 4A3PA 2L1CA 3A8QA 4Y94A 2CU1A 2KC1A 4KZCA 1RAXA 3TJPA 3QCAA 2GCJA 3CMMB 1DDMA 4WWOA 5LOPB 3T8MA 1DDVA 2LI5A 2LYDA 4EJNA 2LKOA 2LGXA 2DX5A 2J59M 1VCBA 4GDKB 4W9HA 3S2AA 3HQCA 2RLOA 1WGDA 1YX6B 3B08A 3L13A 1EAZA 5GOWB 4RMAA 4EZLA 2Z59B 3SDLC 4ZRIA 1Y8RC 1UELA 4KZ0A 4MDKE 4MK0A 3WAOA 1OMWA 2Z0OA 3D8EA 3P6AA 3FLVA 1L7YA 4IC7B 3FEHA 3K9OB 3KRWA 1H8CA 1V86A 4M0WB 1XX0A 1WFYA 1WJUA 2ZCCA 2BYEA 4MGKE 2DA0A 4WJPA 3ZKJC 4RM9A 1KZGA 3F5RA 1X05A 5FR6A 1NTYA 1V49A 5C79A 2HJ8A 2NBWB 3A9KA 2IY0B 4LJPB 3PLVA 3SD5A 3PEGA 2O2VB 2A4ZA 2LXAA 3QHTA 4E71A 3KRXA 4MY6A 4WVFB 1OTRB 2BF8B 2K1FA 2NCNA 4GDLA 5DI9B 1BT0A 3B0AA 2Z0EB 1IPGA 4PNKA 2AYOB 2I1JA 3VH4B 3VUXA 5HKHA 5DPRA 3QC8B 3PS6A 1FOEA 3NHEB 3F0WA 3QARA 2CHXA 4Z2NA 2PPHA 2AEHA 3N7CA 4BKSD 3D8DA 3WANA 4CHMA 4HB4B 1E7UA 4TQ0A 2LOZA 2KOXA 1XODA 1FHXA 3JSVA 4WJ7A 4IM0A 1NU2A 1HE8A 2KWCA 3N3KB 2FUHB 1ISNA 1U2BA 2I5FA 4W9FA 3VFKA 4AJYB 1EVHA 1GUAB 2IO3B 1DDWA 2FCMA 3ZDTA 1XCGA 1V5TA 2WX0A 2JWZA 4WSFA 2UYZB 1WI0A 1UD7A 1OGWA 2X18A 3ULBA 2KJRA 2MBQA 3IVFA 4MSMB 3VVWB 4DX90 3ZRCA 2UVMA 4AJWA 1KOTA 2DLWA 2JZ3B 2LRUA 4F7ZA 1AQCA 4AP4C 4MELA 2CRFA 1E90A 3B1LX 5EDSA 3IG3A 2HRJA 1EGXA 2HTHA 1WMHA 1V5MA 3H6NA 2RSGA 2YS1A 2AL6A 2KDIA 3X0WA 2EJ8A 2M4NA 3A33B 2OOBB 4FN2A 4E3CA 3KY9A 2HE7A 1MIXA 2Y8GA 2DYNA 4H8SA 2W2WA 1WXMA 2AL3A 2BWES 2RGFA 3I3TB 3OLMD 1PQSA 2MA9B 5E6PA 1WZ3A 1TJ6A 5E6OA 3VQIA 4HAVB 2BWFA 3JVZX 1WGGA 3TO1A 4FHJA 2XK5A 5LONB 2COAA 2KDEB 3PT2B 1HBKA 3R66C 2CR5A 2C5LC 2MWNB 2KWVB
chains in the Genus database with same CATH superfamily
3M63B 4FXCA 2KZRA 3VH3B 2H88B 2INDC 2IO2B 2WDRB 4KAXB 3MFGA 4HRSA 3C0RB 1ZPSA 2Y8FA 2ZPYA 2K3UA 2O2VA 1N3HA 2FCNA 1KLVA 3AE1B 5KQ4A 1FHWA 4C56C 3WA0A 3KWVA 2N1WA 5J17A 2KHWB 5HE0A 2PJHA 4JQWC 4II2B 4M0WA 2C7MB 4PS7A 3PZ8A 2K6DB 3A9KB 3GS2A 5KQ1A 1XLQA 3BVZA 3G9WA 4JX1C 4FULA 1DOXA 1SGHA 1I2HA 3Q3FA 2BBCA 2BVCA 1JRUA 5AEKB 5C23A 1ZP0B 2HJ1A 2MJ3A 2B76B 2R0DA 1JMLA 4FJZA 3MHZA 3RPFC 1P3RA 2W54A 4HCNB 1OFFA 4YXDB 2K2UA 3U7ZA 4BVUC 3TCAA 1WXQA 4XWXA 3L4PA 3MTNB 2Y3AA 3DWGC 3A9JB 2YLMA 3E9LA 2WXQA 5J2RA 1W1HA 3P4RB 3UINB 3IFWB 1PMSA 1AW7A 1YOVB 1EF1A 1SEBD 1CZPA 2BW2A 1E8ZA 5CLLB 3O96A 1WYWB 1B1ZA 2JXTA 4DDID 4PT5A 2ZPNA 3ML9A 4OHJA 4NQKE 4C7YA 2AWTA 1GC7A 1V5PA 4XYCA 1R4NI 2A5UA 1XLOA 2WXRA 4IG7B 4J6IA 3VTWA 4CO7A 4RGOS 1SF0A 1KLGD 5DPTA 2M38A 1XXGA 3EC8A 2E2XA 2LZ6A 5AUIA 1GAQB 4NPNA 1UWXA 2C9WB 1J7BA 5CLQB 1GB1A 4DHJD 2V3NA 1I42A 1WIAA 3BWUD 3ODWA 4HJKA 3PSEB 2R2YA 3W5VB 3SO6A 1TTNA 2KWDA 3GYPA 4KDIC 3NVZA 4LNKA 4GXBA 4F7UP 4DXGA 3TW1A 1RWSA 4HK2A 2D5GA 4HCPB 2FDQA 4JKGA 1A5RA 2TSSA 1RFKA 1U5EA 3AH7A 4XZ4A 3PG7A 2DZJA 2ELBA 4EKUA 4OZAA 3A98B 2LVPA 2K22A 1T6BX 4C0AA 2ZVOA 2JZZA 1UNQA 2ADZA 1IRSA 4ZYSA 4A6FA 2COPA 2JQRB 2WLBA 2GCLA 3ML4A 5L83A 3DBLB 4EE2A 2J42A 1D3ZA 1F9JA 2M19A 2BTEA 1U5DA 1T0RC 2WXOA 4EZJA 3L08A 2KN5A 4WAFA 1E5WA 3HIEA 5IN7A 1MIZB 1ESFA 2JPHA 2KIEA 2QHOA 3DBHB 1DBHA 1WGYA 3NVVA 1PGBA 1NVID 4C80A 2N0SB 4FADA 4FHKA 2WXMA 4XDCA 2KDBA 3HVDA 2JYTA 2KVRA 2ELAA 2KDMA 3EECA 4G3XB 5EE9A 3JW0X 3DDCB 3QWZB 2XK5B 4ZRPA 4QJ5B 1KRHA 3HM6X 1FMAD 2GB1A 3VAWA 1T3QA 4B6WA 1XT9B 2KTFA 4JKEA 2K6QA 2I5CA 4GMVA 5I2SA 2KWUB 5HG2A 2IPKD 2XEWA 2AX5A 5DIFB 4JKGB 2BQQA 1YIWA 2D9WA 3BZDB 4K7UA 4HAXB 3RI7C 1Q10A 1BTKA 4JKBA 3N30A 3LXFA 1XEEA 1WJ4A 2K8EA 1WGUA 5KCVA 4RH6A 2Z13A 2LOXA 3P2BA 1GG3A 1WM2A 1VD2A 1Q5WB 1FCCC 1AARA 2FCSA 3EGRA 1WG7A 4WQOB 4ANVA 2N4FA 3WAPA 4GN1A 1VZ6A 1T5XD 1ZDXA 2GBRA 3EUB2 2CQUA 3U8ZA 2YEPB 4JKDA 3P63A 4L2YA 5D6JB 1WXVA 2COFA 5DHFB 1E8YA 1XCQL 3BYTB 5JVLA 2G45B 1ROEA 3PVLA 4HAZB 2ZW0A 2DYBA 3EFUA 2WXPA 2VRRB 5FKAC 1MG8A 4ILGB 1DGJA 2OEDA 3TFMA 1QOAA 4WURA 4B0MA 3L17A 4A90A 4AOFA 1UF0A 5DHAB 2LHDA 2KFKA 3DPDA 1N62A 2QC8A 1Q1OA 3IBEA 4NSWA 2ACZB 4HEA1 1V89A 1K51A 5D3XA 1QC6A 4GPTB 1ET6A 2MQJA 2ZEQA 1E7PB 5C16A 4HPMB 4OVUA 4BOSC 3MC8A 4MM3A 3T3OA 1GPXA 1I7AA 1XD4A 1KM7A 2K8CA 2DKQA 3BJIA 3ZIMA 2BS2B 2PVGC 1D4BA 1ZE3D 2RVBB 3AMZA 1HZ6A 1BTNA 5DPWA 1C77A 1I35A 3KQ4A 4I6LB 1QT9A 4HAUB 2GBNA 2WQYB 3SU8X 3EPYA 2WWZA 1FXTB 2G3QB 2MEKA 2NPTB 4IWOA 2D9VA 2UWQA 1ZM0A 4XWTA 3KH0A 4GGQA 1MK7B 1JWUD 1TKGA 2KDFB 3UGBB 1WXAA 3KW5B 2J0JA 3APDA 2VRWB 4EMOA 4JK8A 1KF6B 1NVLA 1X1GA 5JHGA 4BOZB 2N9EB 1HB6A 1E0ZA 2JX5A 3U7DA 1R4MI 2VZKD 2AQ1B 2MRPA 2H7EA 2KTRB 3OJ4B 3V62A 3L54A 3RFZB 2LMCA 5EE1A 4KGRA 5IJMA 4CHJA 1FPYA 3RNFC 1EU4A 1F52A 2N9LA 2DHZA 4EOYA 4LJOB 1T77A 4NAWB 3NS8A 1V81A 1F2RI 4RGNA 4M8MA 2QSDA 2N23A 1JWAD 1P7FA 2WDQB 1H10A 2Z0DB 2Y5PA 2DLBA 4TQ1A 1DYQA 4GMXB 1U5FA 4IFSA 3OG5A 1SHCA 3Q2AC 1T0YA 4KGSA 3I63C 2WXJA 2BGFA 3TMPB 2Z59A 3UZTA 2JSVX 5C1ZA 2FJUB 1Q0WB 3J9CA 3D32A 2FBWB 3T9LA 3JYUA 1WE7A 2JU6X 1MHHE 3V3XA 4A3PA 4D2KA 3QCAA 2GCJA 3CMMB 3Q14C 4WWOA 4C00A 5LOPB 3T8MA 2LYDA 4L23A 2LKOA 2DX5A 2J59M 3S2AA 4EZLA 5TSSA 3SDLC 4ZRIA 4MDKE 3WAOA 1OMWA 3RN9C 1L7YA 3FEHA 4M0WB 4MGKE 1XX0A 1HTOA 4RFBA 4TMAB 1KZGA 5FR6A 1FCLA 1NTYA 3A9KA 1TT5B 4LJPB 4DK5A 3PLVA 1SJHD 3QHTA 4MY6A 1OTRB 5DI9B 1EWYC 2I1JA 1FM0D 5HKHA 4IOIE 3NHEB 3NUHB 2CHXA 1C4PA 2AEHA 1SIJA 1YN5A 3U12A 2LOZA 2FUG1 1XODA 2KWCA 3N3KB 4A9AA 2FUHB 4A55A 2IO3B 1DDWA 2FCMA 3ZDTA 1I7HA 2JWUA 4ILHA 5FK9C 1QOGA 4JKCA 1YN4A 3VVWB 2K5PA 4OSNA 2LRUA 1AQCA 4C7ZA 3B1LX 2SEBD 3IG3A 3NWFA 3H6NA 2YS1A 2JYEA 1FFVA 1TJEA 2M4NA 3A33B 5FR3A 2AL3A 2Y5CA 5C2TB 1UGJA 1TJ6A 1L0VB 3VQIA 4HAVB 2BWFA 4FHJA 1NEKB 3PT2B 2RMMA 1HBKA 1TS4A 1GB4A 3L0WB 2KQ7A 4RGTA 1JDEA 2LGSA 1KJTA 3ZNHB 3PVWA 3AV8A 3SUZA 2QKLA 1E8WA 3OANA 4FJYA 4G50A 4MT5A 4GDLB 1MI1A 1OEYJ 4MH0E 2YF0A 4OZCA 5EFXA 3NOBA 1JWBD 1BXTA 3UQBA 2HDEA 2M17A 2Y5BB 5DPSA 5D3DA 2JUOA 1MFWA 4YL8A 3RUIB 1TYGB 4W9GA 3AEDB 1JWSD 2WU5B 5D3WA 3V6CB 3OHMB 2WS3B 4TKNA 4HSIA 2ASQA 1R4NB 2NMQA 1QLBB 1PGAA 2ZNVB 1WZ0A 3TBLD 3AI5A 1KBLA 2MX2A 4HHVA 3HW2B 4F8CB 1P98A 3AECB 3DXDA 4LLGM 5BMGA 1VZ8A 1QKZA 5G55A 2X0SA 2IY1B 3VRBB 3FP5A 4D6WA 5L95C 3MC9A 1RFAA 4MJSB 2E3TA 1ET9A 2CY4A 3APFA 4NY0A 1Y56A 1IYFA 1YN3A 2CAYA 3E9OA 1K5DB 3DBLI 5E6NA 1QILA 3U2SC 2K2JA 1SE9A 5CHVC 2CB8A 4PYUA 3GE8C 4ZHOA 4GNKB 2Z4DA 1PUTA 4ZDVA 4W9CA 2KXJA 4PS3A 3PZDA 2ZKMX 3FAHA 2WDTB 4BBNF 4C4VA 2N7DA 4M00A 3DVNU 2MJEA 2MDXA 1GNUA 4W9EA 1DOYA 1YJJA 4IAPA 3AEBB 1N60A 3PPAA 5GXGB 2G4SA 1UWMA 1E6EB 3N1YC 3CSTA 3DBRI 2Z14A 2VH2A 1C76A 4W9DA 3SFEB 2RDBC 3OAWA 3HVZA 3U52E 3B77A 1RRBA 5JLJB 1FD6A 1L0YB 2WXKA 1RJ2A 1V2YA 2KFJA 2ROVA 2W9NA 1JRPA 3PZ7A 1HQRD 2N7EA 3R7QA 4LTUA 2M0XA 1I4PA 2HTHB 2LASA 3WAMA 2MP2A 3KLSX 4GLSC 4II3B 3ZRFA 5HE2A 2N1VA 3BIID 1TGZB 2MBEA 2DN6A 2M8SA 2MH7A 1ZVRA 1OQQA 3PP2A 3R7RA 2JRHA 2FIDA 1UNPA 2GMIC 1WJNA 4QJ3B 4HLEA 1NYQA 1L4DB 3NG0A 3AE4B 4WJQA 1HXYD 4DDGD 4B0EA 1J19A 2D10A 2Z0PA 1CK1A 4DQOC 1OY2A 3ENEA 2WP9B 3ZXVA 3PHXB 4GU2A 1FGYA 4AQ7A 1MKEA 2W2XD 1QQGA 2OJRA 2K00A 4DBGA 3ZTDA 2J0MA 3IAM1 3RNEC 3N9YC 3SV1A 4G11A 2LUEA 2VH1A 4XX5A 3AEEB 2R2QA 4JLCA 3BYYB 3WYFB 3PVUA 1CQVA 4HROA 2LFIA 2RDHA 4A6FB 2NPTA 4KVGB 2NR2A 4WJNA 4YTMB 3AEFB 4ZRKA 3ZNZB 2P0FA 1WY8A 3NRZA 5HHDG 3D8FA 3DBRB 1SSNA 3I9V1 2D4QA 3RZWC 1P5TA 4R3DA 4A3OA 5J3QA 1V9JA 4JL9A 2LJ5A 2FNJB 2O6VD 2BS4B 1H4RA 1V1OA 4MJSA 5KHOA 2EC1A 4MM3B 1M7RA 1CJEA 4XC2A 4HDOA 4YONA 2V1YA 3AULA 1N6ZA 3V60A 1UH6A 2GOWA 1U29A 2RR9A 3TIXA 2PKOA 4ANWA 1ZC4B 4A8XC 2WXIA 1VBGA 1MJDA 3PSCA 4YSZB 3NVYA 1RRPB 2FCQA 2KQSA 2LXCA 3LJUX 1TY0A 2WXGA 2HTME 2MBOA 5BO4B 3BY4B 3BVGA 1MVKA 3ZVRA 2IBIB 2W82A 3FSSA 2K25A 3SYXA 3BK2A 3O13A 2EMSA 1P7EA 2NBVB 1J0WA 3LJ3A 2DAFA 2DYOA 2JP2A 2FJ9A 2KGXB 5KHQA 2LULA 2BB6A 4HWIB 3URYA 5JHHA 2KAJA 1LO5D 2IYBA 3AE6B 1FFUA 1V88A 2CY5A 3VUXA 2YT1A 4ARIA 1N5WA 5JXVA 2KK8A 3VHTC 2J53A 3W1SA 4LNOA 3DHIC 1ZC3B 2XN9C 1ENFA 1XR0B 2G9HD 3VUWA 1FXAA 3ENBA 2KVZA 4KSLC 1NTVA 2UZSA 4W9KA 4NQLB 2IFSA 2V9HA 2DENB 3ZGZA 2YRYA 1V5OA 5G5GA 1UUPA 4YTPB 2V3SA 3ECIA 4CQNA 2WU2B 1WJ6A 3PHWB 5HFYA 5E6JA 2KUPA 4BKGA 4IWPA 4A20A 1C1YB 5LXHA 2Q13A 2DZKA 3AU4A 2V3PA 3B9JA 4HPPA 2L1AA 3OWEB 2KTRA 3ODOA 4JWUC 4DWFA 3VOQA 3PRZA 3RNCC 2VKIA 1YD8U 3LDZE 2L0TA 1ST7A 3A4RA 5LG4B 1U5GA 2W3RA 3ZO5B 5JHAA 2RQ1A 2J7QB 5CX3A 4MT7A 3VTUA 2OHFA 3TSSA 4K3CA 3E66A 5D27A 4NJ6A 5M4YB 2LVQA 2WHIA 2ZVNA 3JSVB 2V0GA 1JQ4A 1E7VA 2ONQA 2L1CA 2CU1A 4KZCA 3TJPA 1A70A 3DWMA 1DDMA 1WRIA 1DDVA 1N61A 1N5XA 4EJNA 1VCBA 3HQCA 1YX6B 1J7CA 1EAZA 4ILJA 2Z59B 1Y8RC 1V8CA 3P6AA 2PW9A 3AE5B 3K9OB 1V86A 5J18A 4HKQA 2ZCCA 2BYTA 4JE3B 3SD5A 5C79A 2O2VB 2IDYA 4YTNB 1D5XC 4WVFB 2K1FA 3B0AA 4QAYA 2WGSA 3PS6A 1L2NA 4Z2NA 2PPHA 4BKSD 3D8DA 4TQ0A 1HE8A 1ISNA 1U2BA 2KIGA 3VFKA 4EUTA 2WXNA 2WX0A 1XCGA 1XO3A 2JWZA 2UYZB 3NWDA 1OGWA 4MSMB 4DX90 3BK1A 2JZ3B 4F7ZA 4AP4C 2CRFA 3PO0A 1R4MB 2HTHA 2RSGA 1PDXA 5IP4D 2KDIA 3IAS1 3X0WA 4E3CA 3KY9A 3AE7B 2INPE 1MIXA 2DYNA 4H8SA 3DHGC 3I3TB 3P42A 3R66C 4I6NB 1WYGA 1TS3A 5E6OA 3JVZX 3FILA 4UDUC 3RCZA 3DHHC 2KWVB 5AZHA 3PGEA 1J0GA 1VBHA 1I4QA 2MWSB 2PMVA 4TSSA 5D7GA 2D9YA 3TL5A 2DFKA 4TUUA 4BKSA 3RMKC 1LQBA 2I1KA 1TQZA 4MH8A 2KYWA 2RNRB 3BINA 1VR9A 3A8PA 1PGXA 4DXFA 2XNAC 3V5WA 4KDLB 1XLPA 4ANUA 1V6EA 1FRDA 3AM9A 3HRDD 2MFQA 1VRAB 1KI1B 1V61A 4BBKA 4KV2A 1L4ZB 2WDVB 4XGAB 1E8XA 1V80A 3DVGY 4IM2A 2VZKB 2QIEB 2RDGA 4GZUA 5J3TA 4G0NB 3P7ZA 5IRSA 1FEHA 1ZDVA 2D3BA 5D94A 1V97A 4BBNC 1EF5A 1I4XA 3H9DA 5HE3A 2G4DB 4K81A 1BWNA 2M1MA 2MSED 2PE6B 1K53A 3AE9B 3X23A 4I6PA 1TS2A 3MC0B 1UZXB 4TYZA 4JGHB 3ZW3A 1SE4A 2KX0A 2DZMA 3ZJTA 4URKA 2RUKB 1KH0A 1XF5L 2KD0A 1YX5B 2LRWA 2DWQA 2Q5WD 3GB1A 4HPLB 2K8BA 4JKAA 3A1QA 1WXSA 1ZGUB 4PQ0A 2Z8LA 3MDBC 2INNE 2H7DA 4W9LA 2WXHA 4CHKA 2DZIA 3KSYA 4N9F4 1K8RB 3P4QB 4OW0A 3TEXA 4DHZB 3CXBB 1KFYB 3MJWA 4Z2MB 3RCPA 4WWPA 2DX5B 2LG1A 3A4SC 1YMHE 4P16A 1IBXA 3ZVVA 1WR6E 1T0SC 2C7HA 1ZXIA 2BT6A 1I4HA 2KN4A 3UI3A 3QIJA 1NBFC 2CJOA 2IYDB 2ZNVC 2KJHB 1UNSA 2LD9A 3P4SB 3GZNB 2O6VB 3K9PB 2DKPA 3PLUA 3PRPB 1YQBA 1MHXA 2PTLA 1UEFA 2L7RA 3DVGX 2JXXA 3HIZA 1WX7A 3FVCA 4RGMA 2KLCA 3SEBA 1UBQA 5IOIA 2V76A 4LCDE 5AZFA 3VR8B 1P6SA 1IGDA 5I2MA 1Y19B 1EWCA 1UPQA 3EHVA 1BUIC 4ANXA 4F7HA 2AQ2B 2R2OA 3DQVA 3BVMA 4XWWA 3U30A 4ZOHC 4NJ7A 4BAXA 5BMHA 4BKTA 2DIKA 1ZUD2 2IGHA 4OVZA 3VUYA 1F0ZA 3TEZA 3CWIA 3ZJUA 1WH3A 2V4LA 2KR0A 2DNFA 2XBBC 4C4VB 3DXEA 4IUMB 5TR5A 5GMVA 2IO1B 2BYFA 1WR1A 1WI1A 3HK0A 1DROA 1J8CA 4B6HA 3DVNV 1U27A 1D5MC 4WJOA 3QX1A 5C3JB 2VSZA 1ACAA 1YJIA 1AWEA 2DHKA 1EM7A 2I38A 4NAWA 2WXFA 2FAZA 3R3MA 2GS0A 2H89B 2P0DA 2BS3B 2GBKA 2OQBA 2DYQA 3RNBC 3DXCA 4EFOA 4OZBA 3GOEA 4GOUA 4LDTB 4E74A 3DOWA 3VXWA 4LNFA 1SE3A 4A6HA 4KGTA 3Q8FA 4HVBA 1QOBA 1IUEA 1YJ1A 5LXIB 5C5BA 1WRDB 3H7PA 3SFDB 2KUQA 4K3BA 4NJCA 1P9DU 3RZFA 3KUCB 4NZLB 2G35A 4K2OA 2LGDA 3AJ4A 2DAJA 2P8VA 1P3QU 1OEYA 3TVVA 5J3YA 2JF5A 2GBJA 4P7IA 3Q8CA 3A9JA 2MW5A 3NS1A 2PEAA 2CHWA 4KIKB 5DH9B 1UPRA 2MBHA 5FI0A 4EEWA 4ZRQA 3CSFA 2KLGA 1MPHA 3TEWA 2CKHB 2D9XA 1K50A 5HE1A 4KKIA 2W2XC 1UGMA 2X38A 2D2QA 5G2NA 4PK1A 2BCJA 4GOCA 5BYQA 4W9IA 4MACA 3AEAB 4H2AA 2K39A 4K17A 4HATB 3M62B 1SJED 3GE3C 5H92C 1WM3A 5FI1A 1FGZA 1GOZA 2JVCA 3C8YA 3ZNID 4CSQA 3O65B 2IGDA 2RGNB 1WJ1A 1NENB 1NTIA 1XLNA 2EKIA 3NZSA 1RM6C 1WGHA 2KT7A 4JWSC 1VZ7A 3UQAA 3B2GA 4HB2B 3R8BA 5JP4A 4W9JA 4DXAB 4WQMA 4TV3A 2LBBA 1JCKB 2K8HA 3Q3JA 3EA6A 3NWAA 5JHBA 1WE6A 3RD2A 1F2RC 3H7PB 3AN1A 4RM8A 2LJIA 1S1QB 1Z87A 2KMCA 5I4DA 2KMAA 3MPXA 2WX1A 4L6EA 1BMLC 1X1MA 2MP2B 4ICVA 3TUOA 2IGGA 3CF6E 4N59A 2K49A 4LDTD 2OTXA 1EO6A 2V4IB 1E10A 4KKJA 1WSPA 2QEJC 1MPEA 2BPSA 4USAA 3E56A 2R82A 4YWGG 3WIMA 3P1MA 2DTCA 3GZNI 5LNK1 1UBIA 4KHBA 2Z0QA 2NZ8B 2PE9A 2EKEC 1G6JA 2FE8A 1I4GA 2NBUA 3UF8A 1JROA 1FNUA 2ON8A 2BB5A 3QA8A 1DIKA 2ZJDA 4WAAA 3NZ3A 3V61A 3LB8C 2W3SA 4FA6A 1VJKA 3LYYA 4AWJA 3RYTA 1LW3A 2RSUA 2ZCBA 2FJLA 3ZYYX 2QKMA 3FM8C 3NY5A 4ASWC 1RYJA 4M8NA 5CHWA 2RD0A 1JW9D 4HB3B 4A6KA 4CYEA 3HM3A 3AXCA 2BYVE 3CIRB 2BKFA 5L81A 1M7EA 1FIQA 4HXDA 2JRIB 2COCA 4REZA 2R61A 1HA5A 2L2IA 3WALA 1XKEA 5IO9A 1ZXHA 5C6RA 2FIFA 2LEKA 4P1CC 4MGIE 2L32A 4K2PA 2M0AA 4Y94A 1RAXA 2J52A 2K0PA 2LI5A 2LGXA 1WGDA 4RMAA 3ZQ4A 1UELA 1L0XB 4KZ0A 2INCC 4IC7B 2SAKA 4WJPA 1WFYA 2BYEA 2DA0A 1QQRA 3ZKJC 4RM9A 4RF0A 1V49A 2NBWB 2IY0B 1TY2A 3PEGA 2A4ZA 1M4VA 3AE3B 3NW8A 2NCNA 1BT0A 2Z0EB 4PNKA 2AYOB 3R2IA 1MG4A 3N7CA 3SR6A 4CHMA 3WANA 2KOXA 4WJ7A 1PFDA 1XCTL 1NU2A 4W9FA 5D3IB 1EVHA 3Q3NC 2LUMA 1V5TA 1KLUD 4P6VF 1WI0A 4ACFA 1FNVA 1IBXB 3IVFA 1ZYIA 2DLWA 2D3CA 4MELA 1E90A 3W2DA 1EGXA 1TKEA 1WMHA 2AL6A 2G1EA 2D3AA 2Y8GA 4KX6B 2W2WA 1WXMA 2RGFA 2MA9B 1WZ3A 4LK0M 2KACA 3TO1A 1TS5A 5LONB 2KDEB 2AQ3B 3B2FA 4QXAB 2CR5A 1Y5OA 2KC2A 1IGCA 2DHIA 4MGYE 4DHZE 3KUDB 2C60A 1C3TA 2CS4A 3H7SA 3NJTA 4RF1A 3SNHA 4KHOA 2RRFA 1B9RA 1CMXB 3H1UA 4P1BC 2W55A 1WWTA 2JY6A 4AUQC 3I5JC 2YVCA 1BAKA 3ABVB 2YT2A 5CHFA 3FC4A 4O1NA 4K7SA 4MSQB 3PRMB 2EELA 3QJZA 1RLFA 3M1IB 1Z5SB 2C7NB 1JALA 4EZKA 2UZRA 5LLIA 2KMMA 4J3OD 2MCNB 3V05A 3Q8AA 4HDQA 3ODXA 2MLBA 1HB8A 1X11A 2KANA 1V1PB 3M95A 3DBHI 4HB0B 1FXIA 2KCJA 3GP7A 3KUZA 1E9MA 2L0FA 1EUVB 2IO0B 4WWNA 4YT0B 2NS5A 1LM8B 5H8YE 3KYDD 1C79A 5G5HA 1PLSA 3Q8EA 4WH4A 1W1GA 2N0YA 2LVOA 2WNMA 3N32A 2LHEA 3TEYA 3DBSA 3HSAA 2GJYA 2E6XA 4IM3A 1L6UA 1OQNA 1SBBB 1ZW7A 3KVFB 2NMBA 4YSXB 1OQYA 3ZTCA 1EU3A 1R7SA 3UIOB 5CTRC 1LB1A 1NI2A 1D6EC 1V1PA 1LXDA 3AB5A 4XDDA 5IA7A 3CIKA 3QQ8B 3HHMA 4JKFA 4GDKA 2MBBB 2WXLA 4K7WA 4F7GA 3QWMA 3AE2B 4FLHA 2KNBA 4Q2JA 1C4CA 2REXA 3AEGB 4JKHA 3N20C 1NYRA 3VTVA 4OT1A 4X57B 2YSZA 1WJMA 1P0RA 1HZ5A 1NI3A 1TIFA 2GRIA 2KKCA 1Q67A 2KFKB 4DHJB 1PFJA 4ICUA 4HAYB 1WF9A 3WCQA 1FO4A 3RULA 1FB8A 3KZ1A 4MEMA 5T8IA 4IWQA 4MGZE 2D11A 3T06A 1P1AA 2EMTA 3C19A 1QZEA 2YEPF 3FKYA 3KWLA 2L76A 5AUKA 1WX8A 2R09A 1WMHB 2L00B 1MAIA 3ZLZA 2L3ZA 3UIPB 2WH5A 1U4AA 2HD5B 2Y7BA 3I57A 3APCA 1LGRA 1SE2A 4ZYNA 3GYOA 2RPQA 2GI9A 3A1QB 3L16A 2NTSA 2P0HA 3ZJVA 3SHQA 4IKGA 4K1RB 3B08A 1MK9B 2YS3A 4DIXA 3W1YA 3QBVB 1XQQA 1YQ4B 4QJ4B 3FILB 5AZGA 4KIKA 4FBJB 4JK7A 4N6EB 4ZHPA 5BMIA 1VDVA 2X8XX 3PREA 3DCXA 4GB9A 2WYQA 2PIAA 5JH5C 4D0NB 2L52A 4L1RA 1K5GB 1LFDA 2IJ0A 1HEZE 2NVUI 2QJLA 2PZ1A 3Q69A 3VIAA 1FNWA 5C5BB 2D3GA 2YT0A 2RPVA 1T0QC 3Q8BA 1OQRA 2PVOD 4GIVA 3ZNGC 2K9XA 3ML8A 3QK0A 1DOIA 3E9PA 2YS5A 3AU5A 4A5KA 1KZ7A 2KQ4X 3Q3OC 4BFRA 2JT4B 1TZ1A 2N9KA 1TZOA 1IP9A 4BZAA 1WGQA 1C78A 3IHPC 3MJ5A 3MHSD 2CHZA 1WX9A 1WVHA 2D07B 2MKRA 1DYNA 3Q6BA 2N9PC 2GLSA 3NZUA 4IW0A 4ARCA 1N63A 1TBEA 1W1DA 1B55A 4LNNA 2QMTA 5D3YA 2KX3A 2L8JA 3ZUNA 3DCGA 4ZRJA 3RNAC 5D2MB 3T3NA 3A58A 3W1SC 2N9XA 3MP9A 2I2YA 4B9KA 4B95A 3ZDMC 2LGIA 4RCOA 1GJZA 1C9FA 1QOFA 5DCNA 1TKYA 2CODA 2ABDA 4NNJB 4S0RA 4PYZA 1S3SG 2JZPA 3ALBA 4S17A 2D9ZA 4KSKC 1FAOA 2L83A 2KJ6A 4WIPA 4DX8A 4KHAA 1KC7A 3NSUA 3U4EG 3W9CB 4YSYB 5EE3A 3PV1A 3RNGC 3VDZA 3V6EB 4M02A 3SBTA 1TXDA 2O6VA 2QILA 3W5UB 1ZSQA 1FHOA 2LWPA 4HAWB 1D5ZC 2OJWA 2DYMA 4IOYX 4GSWA 4OVVA 3OJ3A 5JZEB 4N58A 3ONSA 1SB3C 4RNAA 1I4RA 3HUIA 3KYCD 1FRRA 3R2TA 3IT6B 2GUMA 3N1ZC 5MPOA 2J0KA 2DX1A 5HI1A 2IZVB 3P4PB 1AWDA 2DHJA 5IAAC 1AN8A 2B3AA 4US8A 1X86A 3IXSA 5BYSA 3ZXRA 3Q3MC 2CU3A 5EE0A 1GC6A 3RT3B 2QCZA 2M14A 1K52A 2KO3A 4PS8A 2NTTA 2J4XA 3SBGA 1V5UA 3L10B 3E9SA 3N1XC 1ZOYB 4WWMA 1M94A 1X1FA 1XD3B 4FJVB 1AYFA 2LGYA 4DBBA 4LNIA 3QAQA 4HKZE 2L05A 2GBMA 1YQ3B 1YNTE 1VLBA 1F1HA 4KHBB 1JWMD 2DBYA 2UU7A 3PTFC 3H8HA 1ZKHA 4AS1A 1UNRA 1HTQA 1SIFA 5D3VA 1NDDA 4JPSA 2BKRB 3ETRA 3ULCA 2ROZB 1C4AA 2XQNM 1WGRA 1STEA 1SXTA 4JIOU 3M3JA 2ZZPB 3VR9B 1Z2MA 3A8QA 5BYRA 2KC1A 1J7AA 2CJNA 4W9HA 1L5PA 4GDKB 2RLOA 3L13A 5GOWB 4MK0A 4NAMA 3D8EA 2Z0OA 3FLVA 3KRWA 5IKCM 1H8CA 1WJUA 3F5RA 1X05A 2HJ8A 4US9A 3AE8B 2LXAA 4IDIA 3EFCA 4E71A 3KRXA 3NVWA 4GDLA 2M56B 2BF8B 3VH4B 1IPGA 5DPRA 3QC8B 1FOEA 3QARA 3F0WA 1MI0A 2NBVA 4HB4B 1E7UA 1FHXA 3JSVA 4IM0A 1PYWD 1GGOA 4AJYB 2I5FA 1WGKA 4F1SA 4M01A 2QDFA 1GUAB 1QF6A 3VRAB 4XE0A 4A6QA 4WSFA 2ZW1A 2MBQA 1UD7A 2KJRA 2N7JA 2X18A 3ULBA 3ZRCA 1KOTA 4AJWA 1ACCA 2UVMA 3IT4B 2PLPA 5EDSA 2HRJA 2MJDA 1V5MA 4ITKA 4JK9A 4L1BA 2EJ8A 4FN2A 2OOBB 2HE7A 2MHJA 1L6VA 1KTKA 2BWES 3OLMD 4HJGE 5E6PA 1PQSA 2ICIA 1WGGA 2XK5A 2COAA 1F77A 2C5LC 2MWNB
chains in the Genus database with same CATH topology
3M63B 2KZRA 3VH3B 2IO2B 4KAXB 3C0RB 2Y8FA 2ZPYA 2O2VA 1N3HA 2FCNA 1KLVA 5KQ4A 1FHWA 3WA0A 2N1WA 5J17A 2KHWB 5HE0A 2PJHA 4JQWC 4II2B 2C7MB 4PS7A 2K6DB 3A9KB 5KQ1A 3G9WA 4FULA 1SGHA 1I2HA 3Q3FA 1JRUA 5AEKB 5C23A 2R0DA 4FJZA 1P3RA 4HCNB 2K2UA 4BVUC 3TCAA 4XWXA 3MTNB 3A9JB 2YLMA 3E9LA 5J2RA 1W1HA 3UINB 3IFWB 1PMSA 1EF1A 1E8ZA 5CLLB 3O96A 1WYWB 4DDID 2ZPNA 3ML9A 4NQKE 2AWTA 1GC7A 1V5PA 1R4NI 2A5UA 4IG7B 4J6IA 3VTWA 4CO7A 5DPTA 2M38A 3EC8A 2E2XA 2LZ6A 4NPNA 2C9WB 5CLQB 4DHJD 1I42A 1WIAA 3ODWA 4HJKA 3PSEB 3SO6A 1TTNA 3GYPA 4KDIC 4GXBA 4F7UP 3TW1A 4HK2A 4HCPB 2FDQA 4JKGA 1A5RA 1U5EA 4XZ4A 3PG7A 2DZJA 2ELBA 4EKUA 3A98B 2LVPA 4C0AA 2ZVOA 2JZZA 1UNQA 2ADZA 1IRSA 4A6FA 2COPA 5L83A 2GCLA 3ML4A 1D3ZA 1F9JA 1U5DA 4EZJA 3L08A 2KN5A 1E5WA 1MIZB 2JPHA 2QHOA 1DBHA 1WGYA 4FADA 4FHKA 2KDBA 2KVRA 2ELAA 4G3XB 3EECA 3JW0X 3DDCB 3QWZB 2XK5B 3HM6X 3VAWA 4B6WA 1XT9B 2KTFA 4JKEA 2K6QA 2I5CA 4GMVA 2KWUB 2XEWA 5DIFB 4JKGB 1YIWA 2D9WA 4K7UA 4HAXB 1BTKA 4JKBA 3N30A 1WJ4A 1WGUA 5KCVA 2LOXA 3P2BA 1GG3A 1WM2A 1VD2A 1Q5WB 1AARA 2FCSA 1WG7A 4WQOB 4ANVA 2N4FA 3WAPA 4GN1A 2GBRA 2CQUA 3U8ZA 4JKDA 5D6JB 1WXVA 2COFA 5DHFB 1E8YA 5JVLA 2G45B 3PVLA 4HAZB 2DYBA 3EFUA 2VRRB 1MG8A 4ILGB 3TFMA 3L17A 4AOFA 5DHAB 2KFKA 3DPDA 1Q1OA 3IBEA 4NSWA 1V89A 5D3XA 1QC6A 4GPTB 2MQJA 2ZEQA 5C16A 4HPMB 4OVUA 4BOSC 4MM3A 1I7AA 1XD4A 1KM7A 2K8CA 2DKQA 3BJIA 3ZIMA 2RVBB 1BTNA 5DPWA 1I35A 4I6LB 4HAUB 2GBNA 3SU8X 3EPYA 2WWZA 1FXTB 2G3QB 2NPTB 4IWOA 2D9VA 2UWQA 1ZM0A 3KH0A 4GGQA 1MK7B 2KDFB 3UGBB 1WXAA 3KW5B 2J0JA 3APDA 2VRWB 4EMOA 4JK8A 1NVLA 1X1GA 5JHGA 4BOZB 2N9EB 1HB6A 3U7DA 1R4MI 2MRPA 2H7EA 2KTRB 3OJ4B 3V62A 3L54A 5IJMA 4CHJA 2DHZA 4EOYA 4LJOB 4NAWB 3NS8A 1V81A 4M8MA 2N23A 1H10A 2Z0DB 4TQ1A 4GMXB 1U5FA 4IFSA 1SHCA 1T0YA 2BGFA 3TMPB 3UZTA 5C1ZA 1Q0WB 3D32A 3T9LA 3JYUA 1WE7A 4A3PA 3QCAA 2GCJA 3CMMB 4WWOA 5LOPB 3T8MA 2LYDA 2LKOA 2DX5A 2J59M 3S2AA 4EZLA 3SDLC 4ZRIA 4MDKE 3WAOA 1OMWA 1L7YA 3FEHA 4M0WB 4MGKE 1XX0A 1KZGA 5FR6A 1NTYA 4DK5A 3A9KA 4LJPB 3PLVA 3QHTA 4MY6A 1OTRB 5DI9B 2I1JA 5HKHA 3NHEB 2CHXA 2AEHA 2LOZA 1XODA 2KWCA 3N3KB 2FUHB 2IO3B 1DDWA 2FCMA 3ZDTA 4ILHA 4JKCA 3VVWB 2LRUA 1AQCA 3B1LX 3IG3A 3H6NA 2YS1A 2M4NA 3A33B 2AL3A 1TJ6A 3VQIA 4HAVB 2BWFA 4FHJA 3PT2B 1HBKA 3L0WB 2KQ7A 1JDEA 1KJTA 3ZNHB 3PVWA 3SUZA 2QKLA 1E8WA 3OANA 4FJYA 4G50A 4GDLB 1OEYJ 4MH0E 2YF0A 5EFXA 3NOBA 3UQBA 2Y5BB 2M17A 5DPSA 2JUOA 4YL8A 3RUIB 4W9GA 5D3WA 3V6CB 4TKNA 2ASQA 2ZNVB 1WZ0A 3TBLD 3AI5A 1KBLA 2MX2A 4HHVA 3HW2B 4F8CB 1P98A 3DXDA 5G55A 2X0SA 2IY1B 3FP5A 5L95C 1RFAA 4MJSB 2CY4A 3APFA 4NY0A 1IYFA 2CAYA 3E9OA 1K5DB 3DBLI 5E6NA 2K2JA 1SE9A 5CHVC 2CB8A 4PYUA 4ZDVA 4W9CA 2KXJA 4PS3A 3PZDA 2WDTB 4BBNF 2N7DA 3DVNU 2MDXA 1GNUA 4W9EA 4IAPA 3PPAA 2G4SA 3CSTA 3DBRI 4W9DA 3OAWA 1RRBA 5JLJB 1RJ2A 1V2YA 2KFJA 2ROVA 2W9NA 2N7EA 3R7QA 2M0XA 2HTHB 2LASA 3WAMA 2MP2A 4II3B 3ZRFA 5HE2A 2N1VA 1TGZB 2MBEA 2DN6A 2M8SA 1ZVRA 3PP2A 3R7RA 2JRHA 2FIDA 1UNPA 2GMIC 1WJNA 4HLEA 4WJQA 4DDGD 1J19A 2D10A 2Z0PA 1OY2A 3ENEA 3PHXB 4GU2A 1FGYA 1MKEA 2W2XD 1QQGA 2OJRA 2K00A 4DBGA 3ZTDA 2J0MA 3SV1A 4G11A 2LUEA 4XX5A 2R2QA 4JLCA 3WYFB 3PVUA 4A6FB 2NPTA 4KVGB 2NR2A 4WJNA 4ZRKA 3ZNZB 2P0FA 1WY8A 3D8FA 3RZWC 2D4QA 1P5TA 4A3OA 5J3QA 1V9JA 4JL9A 2LJ5A 2FNJB 2O6VD 1H4RA 4MJSA 5KHOA 2EC1A 1M7RA 4XC2A 4HDOA 4YONA 2V1YA 3AULA 3V60A 1UH6A 2GOWA 1U29A 2RR9A 3TIXA 4ANWA 1ZC4B 1VBGA 3PSCA 1RRPB 2FCQA 2KQSA 2LXCA 3LJUX 2MBOA 3BY4B 3ZVRA 2IBIB 3FSSA 2K25A 3SYXA 2EMSA 2NBVB 1J0WA 3LJ3A 2DAFA 2DYOA 2JP2A 2FJ9A 2KGXB 5KHQA 2LULA 4HWIB 5JHHA 2IYBA 1V88A 2CY5A 3VUXA 2YT1A 2KK8A 3VHTC 3W1SA 1ZC3B 1XR0B 3VUWA 3ENBA 4KSLC 1NTVA 2UZSA 4W9KA 4NQLB 2IFSA 2DENB 2YRYA 1V5OA 2V3SA 3ECIA 1WJ6A 3PHWB 2KUPA 4BKGA 4IWPA 4A20A 1C1YB 5LXHA 2Q13A 2DZKA 3AU4A 2KTRA 3ODOA 4DWFA 3VOQA 3PRZA 2VKIA 1YD8U 3LDZE 2L0TA 1ST7A 3A4RA 1U5GA 3ZO5B 5JHAA 5CX3A 2RQ1A 2J7QB 4MT7A 3VTUA 3E66A 5D27A 4NJ6A 2LVQA 2ZVNA 3JSVB 1E7VA 2L1CA 2CU1A 4KZCA 3TJPA 1DDMA 1DDVA 4EJNA 1VCBA 3HQCA 1YX6B 1EAZA 4ILJA 2Z59B 1Y8RC 3P6AA 3K9OB 5J18A 1V86A 2ZCCA 3SD5A 5C79A 2O2VB 4WVFB 2K1FA 3B0AA 3PS6A 1L2NA 4Z2NA 2PPHA 4BKSD 3D8DA 4TQ0A 1HE8A 1ISNA 4EUTA 1U2BA 3VFKA 2WX0A 1XCGA 2JWZA 2UYZB 1OGWA 4MSMB 4DX90 2JZ3B 4F7ZA 4AP4C 2CRFA 2HTHA 2RSGA 2KDIA 3X0WA 4E3CA 3KY9A 1MIXA 3R66C 4I6NB 2DYNA 4H8SA 3I3TB 5E6OA 3JVZX 3RCZA 2KWVB 5AZHA 3PGEA 1J0GA 1VBHA 2MWSB 5D7GA 2D9YA 3TL5A 2DFKA 4TUUA 4BKSA 1LQBA 2I1KA 1TQZA 2RNRB 3BINA 3A8PA 3V5WA 4KDLB 4ANUA 1V6EA 2MFQA 1KI1B 1V61A 4BBKA 4KV2A 1E8XA 1V80A 3DVGY 4IM2A 4GZUA 5J3TA 4G0NB 3P7ZA 5D94A 4BBNC 1EF5A 3H9DA 5HE3A 2G4DB 4K81A 1BWNA 2M1MA 2MSED 2PE6B 3X23A 4I6PA 1UZXB 4TYZA 4JGHB 3ZW3A 2KX0A 2DZMA 4URKA 2RUKB 2KD0A 1YX5B 2LRWA 4HPLB 2K8BA 4JKAA 3A1QA 1WXSA 1ZGUB 4PQ0A 3MDBC 2H7DA 4W9LA 4CHKA 2DZIA 3KSYA 4N9F4 1K8RB 4DHZB 3CXBB 3MJWA 4Z2MB 3RCPA 4WWPA 2DX5B 2LG1A 3A4SC 3ZVVA 1WR6E 2C7HA 3QIJA 1NBFC 2IYDB 2ZNVC 2KJHB 2LD9A 2O6VB 3K9PB 2DKPA 3PLUA 3PRPB 1YQBA 1UEFA 2L7RA 3DVGX 2JXXA 3HIZA 1WX7A 2KLCA 1UBQA 2V76A 4LCDE 5AZFA 1P6SA 1Y19B 1UPQA 3EHVA 4ANXA 4F7HA 2R2OA 3DQVA 3U30A 4NJ7A 4BKTA 2DIKA 3VUYA 1WH3A 2V4LA 2XBBC 3DXEA 4IUMB 5TR5A 5GMVA 2IO1B 2BYFA 1WR1A 1WI1A 3HK0A 1DROA 1J8CA 4B6HA 3DVNV 1U27A 4WJOA 3QX1A 2VSZA 1ACAA 1AWEA 2DHKA 4NAWA 2FAZA 3R3MA 2GS0A 2P0DA 2GBKA 2OQBA 2DYQA 3DXCA 4EFOA 3GOEA 4LDTB 4E74A 3DOWA 3VXWA 4A6HA 4HVBA 1YJ1A 5LXIB 5C5BA 1WRDB 3H7PA 1P9DU 3RZFA 3KUCB 2G35A 4K2OA 2LGDA 3AJ4A 2DAJA 2P8VA 1P3QU 1OEYA 3TVVA 5J3YA 2JF5A 2GBJA 4P7IA 3A9JA 2MW5A 2PEAA 2CHWA 4KIKB 5DH9B 1UPRA 2MBHA 5FI0A 4EEWA 3CSFA 2KLGA 1MPHA 2CKHB 2D9XA 5HE1A 2W2XC 1UGMA 2D2QA 5G2NA 2BCJA 4GOCA 4W9IA 2K39A 4K17A 4HATB 3M62B 1WM3A 5FI1A 1FGZA 2JVCA 3ZNID 3O65B 2RGNB 1WJ1A 1NTIA 3NZSA 1WGHA 3UQAA 4HB2B 5JP4A 4W9JA 4DXAB 4TV3A 2LBBA 2K8HA 3Q3JA 5JHBA 1WE6A 3RD2A 3H7PB 4RM8A 1S1QB 1Z87A 2KMCA 2KMAA 3MPXA 2WX1A 4L6EA 1X1MA 2MP2B 4ICVA 3CF6E 4LDTD 2OTXA 1EO6A 2BPSA 2R82A 3WIMA 3GZNI 2DTCA 1UBIA 2Z0QA 2NZ8B 2PE9A 2EKEC 1G6JA 2NBUA 3UF8A 3QA8A 1DIKA 2ZJDA 4WAAA 3V61A 4FA6A 4AWJA 3RYTA 1LW3A 2RSUA 2ZCBA 2FJLA 2QKMA 3FM8C 3NY5A 4ASWC 4M8NA 5CHWA 2RD0A 4HB3B 4A6KA 4CYEA 3HM3A 3AXCA 2BYVE 2BKFA 5L81A 1M7EA 4HXDA 2JRIB 2COCA 2L2IA 3WALA 1XKEA 5C6RA 2FIFA 4MGIE 4K2PA 4Y94A 1RAXA 2LI5A 2LGXA 1WGDA 4RMAA 1UELA 4KZ0A 4IC7B 4WJPA 1WFYA 2BYEA 2DA0A 3ZKJC 4RM9A 1V49A 2NBWB 2IY0B 3PEGA 2A4ZA 2NCNA 1BT0A 2Z0EB 4PNKA 2AYOB 3N7CA 3WANA 4CHMA 2KOXA 4WJ7A 1NU2A 4W9FA 1EVHA 1V5TA 1WI0A 3IVFA 2DLWA 4MELA 1E90A 1EGXA 1WMHA 2AL6A 2Y8GA 2W2WA 1WXMA 2RGFA 2MA9B 1WZ3A 3TO1A 5LONB 2KDEB 2CR5A 1Y5OA 2KC2A 2DHIA 4MGYE 4DHZE 3KUDB 2C60A 1C3TA 2CS4A 3H7SA 3SNHA 4KHOA 1CMXB 3H1UA 2JY6A 4AUQC 2YVCA 1BAKA 5CHFA 4K7SA 4MSQB 3PRMB 3QJZA 1RLFA 3M1IB 1Z5SB 2C7NB 4EZKA 2UZRA 5LLIA 2MCNB 4HDQA 3ODXA 2MLBA 1HB8A 1X11A 2KANA 3M95A 3DBHI 4HB0B 2KCJA 3KUZA 2L0FA 1EUVB 2IO0B 4WWNA 2NS5A 1LM8B 3KYDD 1PLSA 1W1GA 2N0YA 2LVOA 3N32A 3DBSA 2GJYA 4IM3A 1OQNA 1ZW7A 3KVFB 2NMBA 1OQYA 3ZTCA 3UIOB 5CTRC 1LB1A 1NI2A 1LXDA 5IA7A 3CIKA 3QQ8B 3HHMA 4JKFA 4GDKA 2MBBB 4K7WA 4F7GA 3QWMA 4FLHA 2KNBA 2REXA 4JKHA 3VTVA 4X57B 2YSZA 1WJMA 1P0RA 2KKCA 1Q67A 2KFKB 4DHJB 1PFJA 4ICUA 4HAYB 1WF9A 3RULA 1FB8A 3KZ1A 4MEMA 4IWQA 4MGZE 2D11A 3T06A 1P1AA 2EMTA 1QZEA 2L76A 1WX8A 2R09A 1WMHB 2L00B 1MAIA 3ZLZA 2L3ZA 3UIPB 2WH5A 1U4AA 2HD5B 2Y7BA 3APCA 4ZYNA 3GYOA 2RPQA 3A1QB 3L16A 2P0HA 3SHQA 4K1RB 3B08A 1MK9B 2YS3A 3W1YA 3QBVB 1XQQA 5AZGA 4KIKA 4FBJB 4JK7A 3PREA 4GB9A 2WYQA 5JH5C 4D0NB 1K5GB 1LFDA 2NVUI 2PZ1A 3VIAA 5C5BB 2D3GA 2YT0A 4GIVA 3ZNGC 3ML8A 3QK0A 3E9PA 2YS5A 3AU5A 4A5KA 1KZ7A 4BFRA 2JT4B 1TZ1A 1IP9A 1WGQA 3IHPC 3MHSD 2CHZA 1WX9A 1WVHA 2D07B 2MKRA 1DYNA 2N9PC 3NZUA 4IW0A 1TBEA 1W1DA 1B55A 5D3YA 2KX3A 2L8JA 3ZUNA 3DCGA 4ZRJA 5D2MB 3W1SC 2N9XA 4B9KA 4B95A 3ZDMC 1GJZA 5DCNA 2CODA 2ABDA 4NNJB 4PYZA 1S3SG 3ALBA 2D9ZA 4KSKC 1FAOA 2KJ6A 4DX8A 4KHAA 1KC7A 3NSUA 3PV1A 3VDZA 3V6EB 3SBTA 1TXDA 2O6VA 1ZSQA 1FHOA 2LWPA 4HAWB 4GSWA 4IOYX 2DYMA 4OVVA 5JZEB 3OJ3A 3ONSA 3KYCD 2J0KA 2DX1A 2IZVB 2DHJA 5IAAC 2B3AA 1X86A 1GC6A 3RT3B 2M14A 2KO3A 4PS8A 3SBGA 1V5UA 3L10B 1M94A 1X1FA 1XD3B 4FJVB 2LGYA 4DBBA 3QAQA 2L05A 2GBMA 4KHBB 3PTFC 1ZKHA 1UNRA 1SIFA 5D3VA 1NDDA 2BKRB 3ULCA 2ROZB 2XQNM 1WGRA 4JIOU 3M3JA 2ZZPB 1Z2MA 3A8QA 2KC1A 4W9HA 4GDKB 2RLOA 3L13A 5GOWB 4MK0A 3D8EA 2Z0OA 3FLVA 3KRWA 1H8CA 1WJUA 3F5RA 1X05A 2HJ8A 2LXAA 4E71A 3KRXA 4GDLA 2BF8B 3VH4B 1IPGA 5DPRA 3QC8B 1FOEA 3QARA 3F0WA 4HB4B 1E7UA 1FHXA 3JSVA 4IM0A 1GGOA 4AJYB 2I5FA 4F1SA 1GUAB 4WSFA 2MBQA 1UD7A 2KJRA 2X18A 3ULBA 3ZRCA 1KOTA 4AJWA 2UVMA 5EDSA 2HRJA 1V5MA 4JK9A 2EJ8A 4FN2A 2OOBB 2HE7A 2BWES 3OLMD 5E6PA 1PQSA 1WGGA 2XK5A 2COAA 5BO4B 2C5LC 2MWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ7 A;  1Y5O A;  3M63 B;  5AZH A;  3PGE A;  1J0G A;  2KC2 A;  2KZR A;  3VH3 B;  2MWS B;  2DHI A;  2IO2 B;  4MGY E;  4DHZ E;  4KAX B;  1KJT A;  3KUD B;  2C60 A;  5D7G A;  3ZNH B;  3C0R B;  2D9Y A;  3PVW A;  3TL5 A;  2DFK A;  4TUU A;  2Y8F A;  2ZPY A;  3SUZ A;  2CS4 A;  1C3T A;  4BKS A;  2O2V A;  2QKL A;  1E8W A;  3OAN A;  1LQB A;  3H7S A;  4FJY A;  1N3H A;  3SNH A;  2FCN A;  2I1K A;  4G50 A;  1TQZ A;  4KHO A;  4GDL B;  1KLV A;  1OEY J;  4MH0 E;  5KQ4 A;  2YF0 A;  1CMX B;  1FHW A;  3H1U A;  3WA0 A;  2RNR B;  5EFX A;  3NOB A;  2N1W A;  3BIN A;  2JY6 A;  4AUQ C;  5J17 A;  3A8P A;  2YVC A;  5HE0 A;  2KHW B;  1BAK A;  3V5W A;  2PJH A;  4JQW C;  2Y5B B;  2M17 A;  4II2 B;  4KDL B;  1V6E A;  5CHF A;  5DPS A;  4ANU A;  2JUO A;  2C7M B;  4K7S A;  4MSQ B;  2K6D B;  4PS7 A;  3PRM B;  4YL8 A;  3RUI B;  3A9K B;  5KQ1 A;  2MFQ A;  3G9W A;  1RLF A;  3QJZ A;  3M1I B;  4W9G A;  1KI1 B;  1V61 A;  4FUL A;  4BBK A;  4KV2 A;  1Z5S B;  1SGH A;  2C7N B;  5D3W A;  3V6C B;  1I2H A;  1E8X A;  4F1S A;  3Q3F A;  1V80 A;  3DVG Y;  4IM2 A;  1JRU A;  4EZK A;  5AEK B;  4TKN A;  2UZR A;  4GZU A;  5J3T A;  5C23 A;  5LLI A;  1I35 A;  2R0D A;  3P7Z A;  4FJZ A;  4G0N B;  2ASQ A;  5JZE B;  2MCN B;  5D94 A;  1P3R A;  4BBN C;  4HDQ A;  3ODX A;  2MLB A;  1HB8 A;  1X11 A;  2ZNV B;  4HCN B;  1WZ0 A;  2KAN A;  3AI5 A;  3DBH I;  1EF5 A;  3M95 A;  3TBL D;  2K2U A;  4HB0 B;  2MX2 A;  4HHV A;  3HW2 B;  4BVU C;  2KCJ A;  3TCA A;  3H9D A;  5HE3 A;  2G4D B;  1EUV B;  1P98 A;  2L0F A;  3KUZ A;  2IO0 B;  3DXD A;  4F8C B;  4K81 A;  4XWX A;  3MTN B;  4WWN A;  5JHA A;  3A9J B;  1BWN A;  2M1M A;  2MSE D;  2PE6 B;  2YLM A;  5G55 A;  2NS5 A;  1LM8 B;  2IY1 B;  3KYD D;  3FP5 A;  1W1H A;  5J2R A;  3X23 A;  1PLS A;  4I6P A;  3UIN B;  3IFW B;  5L95 C;  1PMS A;  1W1G A;  1UZX B;  4TYZ A;  1RFA A;  2N0Y A;  1EF1 A;  4MJS B;  2LVO A;  3N32 A;  4JGH B;  1E8Z A;  2CY4 A;  5CLL B;  3O96 A;  1WYW B;  3APF A;  3DBS A;  3ZW3 A;  2GJY A;  2KX0 A;  4NY0 A;  4IM3 A;  4DDI D;  2DZM A;  1OQN A;  1IYF A;  2ZPN A;  3ML9 A;  4URK A;  2RUK B;  4NQK E;  2CAY A;  2KD0 A;  1YX5 B;  2AWT A;  1ZW7 A;  3KVF B;  2NMB A;  2LRW A;  3RZW C;  1GC7 A;  1OQY A;  1V5P A;  4HPL B;  3ZTC A;  2K8B A;  1R4N I;  1K5D B;  3A1Q A;  1WXS A;  3DBL I;  5E6N A;  1ZGU B;  4PQ0 A;  3UIO B;  2K2J A;  1SE9 A;  2A5U A;  3MDB C;  5CHV C;  2CB8 A;  4PYU A;  5J18 A;  2H7D A;  4W9L A;  1LB1 A;  1NI2 A;  5CTR C;  4CHK A;  4IG7 B;  2DZI A;  3KSY A;  4N9F 4;  4J6I A;  1LXD A;  1K8R B;  3VTW A;  4CO7 A;  4DHZ B;  4ZDV A;  4W9C A;  4I6N B;  5DPT A;  5IA7 A;  2M38 A;  3CIK A;  3CXB B;  2KXJ A;  3EC8 A;  2E2X A;  2LZ6 A;  3QQ8 B;  3PZD A;  3MJW A;  4Z2M B;  3RCP A;  3HHM A;  4NPN A;  2DX5 B;  4GDK A;  4WWP A;  2C9W B;  5CLQ B;  2MBB B;  2LG1 A;  2WDT B;  3A4S C;  4BBN F;  4DHJ D;  4K7W A;  1I42 A;  1WIA A;  4F7G A;  3QWM A;  4FLH A;  2KNB A;  1WR6 E;  3ZVV A;  2C7H A;  2N7D A;  3DVN U;  2MDX A;  1GNU A;  4W9E A;  3ODW A;  3QIJ A;  4HJK A;  4IAP A;  1NBF C;  2IYD B;  2REX A;  2ZNV C;  3PSE B;  2KJH B;  2LD9 A;  3SO6 A;  1TTN A;  3PPA A;  3GYP A;  4X57 B;  2O6V B;  4KDI C;  3VTV A;  4GXB A;  4F7U P;  2G4S A;  3TW1 A;  3K9P B;  2DKP A;  2YSZ A;  1WJM A;  3PLU A;  4HK2 A;  3PRP B;  1YQB A;  1P0R A;  4HCP B;  2FDQ A;  3CST A;  1UEF A;  3DBR I;  2L7R A;  1A5R A;  3DVG X;  2KKC A;  1Q67 A;  2JXX A;  2KFK B;  3HIZ A;  1WX7 A;  1U5E A;  2KLC A;  4DHJ B;  1PFJ A;  4XZ4 A;  3PG7 A;  4ICU A;  2DZJ A;  2ELB A;  4HAY B;  1WF9 A;  4W9D A;  4EKU A;  1UBQ A;  3RUL A;  3A98 B;  2LVP A;  3OAW A;  1FB8 A;  2V76 A;  3KZ1 A;  4MEM A;  4C0A A;  4LCD E;  5AZF A;  4IWQ A;  1P6S A;  4MGZ E;  2ZVO A;  2D11 A;  1Y19 B;  1UNQ A;  1RRB A;  2ADZ A;  2JZZ A;  5JLJ B;  3T06 A;  1IRS A;  1UPQ A;  3EHV A;  1RJ2 A;  1P1A A;  2EMT A;  1V2Y A;  2ROV A;  4A6F A;  2COP A;  4F7H A;  1QZE A;  2KFJ A;  2W9N A;  2N7E A;  4ANX A;  2R2O A;  3R7Q A;  5L83 A;  2GCL A;  3ML4 A;  3DQV A;  2M0X A;  2L76 A;  3U30 A;  1D3Z A;  1F9J A;  2HTH B;  1WX8 A;  2LAS A;  2R09 A;  1WMH B;  2L00 B;  4NJ7 A;  3WAM A;  1MAI A;  3ZLZ A;  1U5D A;  4BKT A;  2L3Z A;  2MP2 A;  3VUY A;  3UIP B;  4EZJ A;  4II3 B;  3ZRF A;  5HE2 A;  2WH5 A;  2N1V A;  2KN5 A;  1U4A A;  3L08 A;  2HD5 B;  1TGZ B;  1E5W A;  2Y7B A;  1MIZ B;  3APC A;  1WH3 A;  2MBE A;  2JPH A;  2V4L A;  2DN6 A;  3GYO A;  4ZYN A;  2XBB C;  2M8S A;  2QHO A;  2RPQ A;  3A1Q B;  1ZVR A;  3DXE A;  1DBH A;  4IUM B;  3L16 A;  3PP2 A;  5TR5 A;  1WGY A;  5GMV A;  2P0H A;  2IO1 B;  3SHQ A;  3R7R A;  2JRH A;  2BYF A;  4FHK A;  2FID A;  4FAD A;  4K1R B;  1WR1 A;  1WI1 A;  1MK9 B;  1UNP A;  2YS3 A;  3HK0 A;  1WJN A;  2GMI C;  1DRO A;  2KDB A;  2KVR A;  1J8C A;  2ELA A;  4B6H A;  3QBV B;  3W1Y A;  4HLE A;  1XQQ A;  3DVN V;  4G3X B;  3EEC A;  1U27 A;  5AZG A;  4KIK A;  3JW0 X;  3QX1 A;  4WJO A;  4WJQ A;  4FBJ B;  3DDC B;  2VSZ A;  3QWZ B;  1ACA A;  4DDG D;  1J19 A;  2D10 A;  2DHK A;  2Z0P A;  1AWE A;  2XK5 B;  3PRE A;  4GB9 A;  2WYQ A;  4NAW A;  5JH5 C;  4D0N B;  1OY2 A;  3ENE A;  1K5G B;  3HM6 X;  2FAZ A;  3R3M A;  3RCZ A;  3VAW A;  1LFD A;  4B6W A;  2GS0 A;  1XT9 B;  3PHX B;  2P0D A;  2KTF A;  2NVU I;  4GU2 A;  2PZ1 A;  3VIA A;  2K6Q A;  2I5C A;  2GBK A;  2OQB A;  1FGY A;  2DYQ A;  1MKE A;  2YT0 A;  3DXC A;  1QQG A;  2W2X D;  4GMV A;  2K00 A;  5C5B B;  2D3G A;  2KWU B;  2XEW A;  4EFO A;  4DBG A;  5DIF B;  3GOE A;  3ZTD A;  2J0M A;  1YIW A;  2D9W A;  4K7U A;  4LDT B;  4HAX B;  4E74 A;  3DOW A;  3SV1 A;  1BTK A;  4G11 A;  3N30 A;  3VXW A;  1WJ4 A;  2LUE A;  1WGU A;  4GIV A;  3ZNG C;  4XX5 A;  5KCV A;  3ML8 A;  4A6H A;  2LOX A;  3P2B A;  3QK0 A;  1GG3 A;  1WM2 A;  2R2Q A;  1VD2 A;  4HVB A;  2YS5 A;  1Q5W B;  4JLC A;  3AU5 A;  3WYF B;  3PVU A;  4A5K A;  1KZ7 A;  1AAR A;  2FCS A;  1WG7 A;  4WQO B;  4A6F B;  2NPT A;  1YJ1 A;  4ANV A;  2JT4 B;  1TZ1 A;  2N4F A;  4PS3 A;  4BFR A;  5C5B A;  1WRD B;  5LXI B;  3H7P A;  4KVG B;  1IP9 A;  3WAP A;  4GN1 A;  2NR2 A;  4WJN A;  1WGQ A;  1L2N A;  3RT3 B;  1P9D U;  3IHP C;  2GBR A;  4ZRK A;  3RZF A;  2CQU A;  3KUC B;  3UQB A;  3MHS D;  2CHZ A;  2P0F A;  3ZNZ B;  3U8Z A;  2G35 A;  1WX9 A;  4K2O A;  2LGD A;  1WVH A;  3AJ4 A;  1WY8 A;  2D07 B;  1WXV A;  2COF A;  5DHF B;  2DAJ A;  5D6J B;  2P8V A;  1E8Y A;  2MKR A;  2G45 B;  1DYN A;  1P3Q U;  1OEY A;  3TVV A;  2N9P C;  3D8F A;  5J3Y A;  2JF5 A;  3NZU A;  4IW0 A;  2GBJ A;  4P7I A;  1TBE A;  1W1D A;  1B55 A;  3PVL A;  4HAZ B;  2MW5 A;  3A9J A;  2D4Q A;  5D3Y A;  2CHW A;  2KX3 A;  2PEA A;  2L8J A;  2DYB A;  5DH9 B;  4KIK B;  1UPR A;  1P5T A;  3ZUN A;  4A3O A;  5J3Q A;  3DCG A;  2MBH A;  3EFU A;  4ZRJ A;  5FI0 A;  4EEW A;  1V9J A;  2VRR B;  2LJ5 A;  4JL9 A;  1MG8 A;  2FNJ B;  2O6V D;  3TFM A;  3CSF A;  1H4R A;  2KLG A;  3L17 A;  1MPH A;  5D2M B;  4AOF A;  2CKH B;  2D9X A;  5DHA B;  4MJS A;  2KFK A;  5KHO A;  3W1S C;  3DPD A;  2EC1 A;  1M7R A;  2N9X A;  5HE1 A;  1Q1O A;  2W2X C;  3IBE A;  4NSW A;  1UGM A;  4XC2 A;  4HDO A;  4YON A;  2V1Y A;  4B9K A;  2D2Q A;  3AUL A;  4B95 A;  3ZDM C;  1V89 A;  3V60 A;  5D3X A;  1UH6 A;  2GOW A;  1U29 A;  2RR9 A;  3TIX A;  1QC6 A;  4GPT B;  5G2N A;  4ANW A;  1GJZ A;  1ZC4 B;  4GSW A;  2BCJ A;  4GOC A;  4W9I A;  5DCN A;  3PSC A;  2MQJ A;  2K39 A;  4K17 A;  3GZN I;  4HAT B;  2COD A;  3M62 B;  4EUT A;  1RRP B;  2ABD A;  2ZEQ A;  2FCQ A;  4NNJ B;  4PYZ A;  2KQS A;  2LXC A;  3WAL A;  5C16 A;  3LJU X;  1S3S G;  3ALB A;  1WM3 A;  2MBO A;  4HPM B;  4OVU A;  5BO4 B;  4BOS C;  5FI1 A;  3BY4 B;  1FGZ A;  2JVC A;  2D9Z A;  4MM3 A;  3ZNI D;  3O65 B;  1I7A A;  1XD4 A;  2RGN B;  1KM7 A;  2K8C A;  4KSK C;  1WJ1 A;  1FAO A;  1NTI A;  2DKQ A;  3BJI A;  2KJ6 A;  3NZS A;  4DX8 A;  3ZIM A;  4KHA A;  3ZVR A;  1WGH A;  2IBI B;  3FSS A;  2K25 A;  3SYX A;  2RVB B;  3UQA A;  3NSU A;  2EMS A;  1BTN A;  5DPW A;  4HB2 B;  2NBV B;  1J0W A;  5JP4 A;  2DAF A;  2DYO A;  3LJ3 A;  3PV1 A;  4DXA B;  2JP2 A;  2FJ9 A;  4I6L B;  4W9J A;  3VDZ A;  4TV3 A;  2LBB A;  4HAU B;  2GBN A;  2KGX B;  2K8H A;  2LUL A;  3V6E B;  3SU8 X;  5KHQ A;  1TXD A;  3Q3J A;  2O6V A;  4HWI B;  3EPY A;  2WWZ A;  1FXT B;  2G3Q B;  2NPT B;  5JHH A;  4IWO A;  1WE6 A;  3RD2 A;  2D9V A;  2UWQ A;  5JHB A;  1ZSQ A;  1FHO A;  2LWP A;  3H7P B;  1ZM0 A;  4HAW B;  4RM8 A;  2IYB A;  1V88 A;  2CY5 A;  1Z87 A;  4IOY X;  1S1Q B;  2DYM A;  2KMC A;  1MK7 B;  3KH0 A;  3OJ3 A;  4GGQ A;  4OVV A;  3ONS A;  2YT1 A;  2KMA A;  2KDF B;  3UGB B;  3MPX A;  2WX1 A;  1WXA A;  4L6E A;  2KK8 A;  3KYC D;  3VHT C;  3KW5 B;  2J0J A;  1X1M A;  2MP2 B;  2VRW B;  3APD A;  4ICV A;  3W1S A;  4EMO A;  1NVL A;  1X1G A;  5JHG A;  3CF6 E;  4BOZ B;  2J0K A;  2DX1 A;  2IZV B;  4LDT D;  1ZC3 B;  2OTX A;  1EO6 A;  2N9E B;  1HB6 A;  4DK5 A;  2DHJ A;  1XR0 B;  3U7D A;  2BPS A;  5IAA C;  3VUW A;  2B3A A;  1R4M I;  1X86 A;  4KSL C;  1NTV A;  2UZS A;  4W9K A;  3WIM A;  4NQL B;  2IFS A;  1GC6 A;  2DTC A;  2DEN B;  2H7E A;  1UBI A;  2KTR B;  2MRP A;  2M14 A;  2NZ8 B;  2Z0Q A;  2KO3 A;  3OJ4 B;  2PE9 A;  4PS8 A;  2YRY A;  1V5O A;  2EKE C;  1V5U A;  3V62 A;  3L10 B;  1G6J A;  3L54 A;  2V3S A;  2NBU A;  3UF8 A;  3ECI A;  5IJM A;  4CHJ A;  5CX3 A;  1M94 A;  1X1F A;  1XD3 B;  3QA8 A;  1WJ6 A;  4FJV B;  2LGY A;  4DBB A;  2ZJD A;  3PHW B;  4WAA A;  3V61 A;  3QAQ A;  2KUP A;  4BKG A;  4IWP A;  2DHZ A;  4A20 A;  1C1Y B;  4EOY A;  5LXH A;  2Q13 A;  2L05 A;  2DZK A;  4LJO B;  2GBM A;  4NAW B;  4FA6 A;  3NS8 A;  3AU4 A;  1V81 A;  1LW3 A;  2RSU A;  2ZCB A;  4M8M A;  3RYT A;  3L0W B;  4AWJ A;  2N23 A;  2FJL A;  2QKM A;  3FM8 C;  1H10 A;  4KHB B;  2KTR A;  3ODO A;  2Z0D B;  3NY5 A;  3PTF C;  4TQ1 A;  4DWF A;  3VOQ A;  3PRZ A;  4GMX B;  2VKI A;  1U5F A;  1YD8 U;  3LDZ E;  4IFS A;  4ASW C;  4M8N A;  5CHW A;  2L0T A;  1SHC A;  1ZKH A;  1ST7 A;  2RD0 A;  4HB3 B;  1T0Y A;  3A4R A;  4A6K A;  1U5G A;  2BGF A;  1UNR A;  4CYE A;  3HM3 A;  3TMP B;  3AXC A;  1SIF A;  2BYV E;  2BKF A;  3ZO5 B;  5D3V A;  1M7E A;  2RQ1 A;  5L81 A;  1NDD A;  4MT7 A;  2BKR B;  2J7Q B;  4HXD A;  3UZT A;  2COC A;  2JRI B;  3VTU A;  5C1Z A;  1Q0W B;  3ULC A;  2ROZ B;  2OJR A;  2XQN M;  5D27 A;  2L2I A;  1WGR A;  3D32 A;  4NJ6 A;  1XKE A;  4JIO U;  3T9L A;  5C6R A;  2FIF A;  2ZZP B;  3JYU A;  3M3J A;  2LVQ A;  2ZVN A;  3JSV B;  4MGI E;  1WE7 A;  1E7V A;  1Z2M A;  4K2P A;  4A3P A;  2L1C A;  3A8Q A;  4Y94 A;  2CU1 A;  2KC1 A;  4KZC A;  1RAX A;  3TJP A;  3QCA A;  2GCJ A;  3CMM B;  1DDM A;  4WWO A;  5LOP B;  3T8M A;  1DDV A;  2LI5 A;  2LYD A;  4EJN A;  2LKO A;  2LGX A;  2DX5 A;  2J59 M;  1VCB A;  4GDK B;  4W9H A;  3S2A A;  3HQC A;  2RLO A;  1WGD A;  1YX6 B;  3B08 A;  3L13 A;  1EAZ A;  5GOW B;  4RMA A;  4EZL A;  2Z59 B;  3SDL C;  4ZRI A;  1Y8R C;  1UEL A;  4KZ0 A;  4MDK E;  4MK0 A;  3WAO A;  1OMW A;  2Z0O A;  3D8E A;  3P6A A;  3FLV A;  1L7Y A;  4IC7 B;  3FEH A;  3K9O B;  3KRW A;  1H8C A;  1V86 A;  4M0W B;  1XX0 A;  1WFY A;  1WJU A;  2ZCC A;  2BYE A;  4MGK E;  2DA0 A;  4WJP A;  3ZKJ C;  4RM9 A;  1KZG A;  3F5R A;  1X05 A;  5FR6 A;  1NTY A;  1V49 A;  5C79 A;  2HJ8 A;  2NBW B;  3A9K A;  2IY0 B;  4LJP B;  3PLV A;  3SD5 A;  3PEG A;  2O2V B;  2A4Z A;  2LXA A;  3QHT A;  4E71 A;  3KRX A;  4MY6 A;  4WVF B;  1OTR B;  2BF8 B;  2K1F A;  2NCN A;  4GDL A;  5DI9 B;  1BT0 A;  3B0A A;  2Z0E B;  1IPG A;  4PNK A;  2AYO B;  2I1J A;  3VH4 B;  3VUX A;  5HKH A;  5DPR A;  3QC8 B;  3PS6 A;  1FOE A;  3NHE B;  3F0W A;  3QAR A;  2CHX A;  4Z2N A;  2PPH A;  2AEH A;  3N7C A;  4BKS D;  3D8D A;  3WAN A;  4CHM A;  4HB4 B;  1E7U A;  4TQ0 A;  2LOZ A;  2KOX A;  1XOD A;  1FHX A;  3JSV A;  4WJ7 A;  4IM0 A;  1NU2 A;  1HE8 A;  2KWC A;  3N3K B;  2FUH B;  1ISN A;  1U2B A;  2I5F A;  4W9F A;  3VFK A;  4AJY B;  1EVH A;  1GUA B;  2IO3 B;  1DDW A;  2FCM A;  3ZDT A;  1XCG A;  1V5T A;  2WX0 A;  2JWZ A;  4WSF A;  2UYZ B;  1WI0 A;  1UD7 A;  1OGW A;  2X18 A;  3ULB A;  2KJR A;  2MBQ A;  3IVF A;  4MSM B;  3VVW B;  4DX9 0;  3ZRC A;  2UVM A;  4AJW A;  1KOT A;  2DLW A;  2JZ3 B;  2LRU A;  4F7Z A;  1AQC A;  4AP4 C;  4MEL A;  2CRF A;  1E90 A;  3B1L X;  5EDS A;  3IG3 A;  2HRJ A;  1EGX A;  2HTH A;  1WMH A;  1V5M A;  3H6N A;  2RSG A;  2YS1 A;  2AL6 A;  2KDI A;  3X0W A;  2EJ8 A;  2M4N A;  3A33 B;  2OOB B;  4FN2 A;  4E3C A;  3KY9 A;  2HE7 A;  1MIX A;  2Y8G A;  2DYN A;  4H8S A;  2W2W A;  1WXM A;  2AL3 A;  2BWE S;  2RGF A;  3I3T B;  3OLM D;  1PQS A;  2MA9 B;  5E6P A;  1WZ3 A;  1TJ6 A;  5E6O A;  3VQI A;  4HAV B;  2BWF A;  3JVZ X;  1WGG A;  3TO1 A;  4FHJ A;  2XK5 A;  5LON B;  2COA A;  2KDE B;  3PT2 B;  1HBK A;  3R66 C;  2CR5 A;  2C5L C;  2MWN B;  2KWV B; 
#chains in the Genus database with same CATH topology
 3M63 B;  4FXC A;  2KZR A;  3VH3 B;  2H88 B;  2IND C;  2IO2 B;  2WDR B;  4KAX B;  3MFG A;  4HRS A;  3C0R B;  1ZPS A;  2Y8F A;  2ZPY A;  2K3U A;  2O2V A;  1N3H A;  2FCN A;  1KLV A;  3AE1 B;  5KQ4 A;  1FHW A;  4C56 C;  3WA0 A;  3KWV A;  2N1W A;  5J17 A;  2KHW B;  5HE0 A;  2PJH A;  4JQW C;  4II2 B;  4M0W A;  2C7M B;  4PS7 A;  3PZ8 A;  2K6D B;  3A9K B;  3GS2 A;  5KQ1 A;  1XLQ A;  3BVZ A;  3G9W A;  4JX1 C;  4FUL A;  1DOX A;  1SGH A;  1I2H A;  3Q3F A;  2BBC A;  2BVC A;  1JRU A;  5AEK B;  5C23 A;  1ZP0 B;  2HJ1 A;  2MJ3 A;  2B76 B;  2R0D A;  1JML A;  4FJZ A;  3MHZ A;  3RPF C;  1P3R A;  2W54 A;  4HCN B;  1OFF A;  4YXD B;  2K2U A;  3U7Z A;  4BVU C;  3TCA A;  1WXQ A;  4XWX A;  3L4P A;  3MTN B;  2Y3A A;  3DWG C;  3A9J B;  2YLM A;  3E9L A;  2WXQ A;  5J2R A;  1W1H A;  3P4R B;  3UIN B;  3IFW B;  1PMS A;  1AW7 A;  1YOV B;  1EF1 A;  1SEB D;  1CZP A;  2BW2 A;  1E8Z A;  5CLL B;  3O96 A;  1WYW B;  1B1Z A;  2JXT A;  4DDI D;  4PT5 A;  2ZPN A;  3ML9 A;  4OHJ A;  4NQK E;  4C7Y A;  2AWT A;  1GC7 A;  1V5P A;  4XYC A;  1R4N I;  2A5U A;  1XLO A;  2WXR A;  4IG7 B;  4J6I A;  3VTW A;  4CO7 A;  4RGO S;  1SF0 A;  1KLG D;  5DPT A;  2M38 A;  1XXG A;  3EC8 A;  2E2X A;  2LZ6 A;  5AUI A;  1GAQ B;  4NPN A;  1UWX A;  2C9W B;  1J7B A;  5CLQ B;  1GB1 A;  4DHJ D;  2V3N A;  1I42 A;  1WIA A;  3BWU D;  3ODW A;  4HJK A;  3PSE B;  2R2Y A;  3W5V B;  3SO6 A;  1TTN A;  2KWD A;  3GYP A;  4KDI C;  3NVZ A;  4LNK A;  4GXB A;  4F7U P;  4DXG A;  3TW1 A;  1RWS A;  4HK2 A;  2D5G A;  4HCP B;  2FDQ A;  4JKG A;  1A5R A;  2TSS A;  1RFK A;  1U5E A;  3AH7 A;  4XZ4 A;  3PG7 A;  2DZJ A;  2ELB A;  4EKU A;  4OZA A;  3A98 B;  2LVP A;  2K22 A;  1T6B X;  4C0A A;  2ZVO A;  2JZZ A;  1UNQ A;  2ADZ A;  1IRS A;  4ZYS A;  4A6F A;  2COP A;  2JQR B;  2WLB A;  2GCL A;  3ML4 A;  5L83 A;  3DBL B;  4EE2 A;  2J42 A;  1D3Z A;  1F9J A;  2M19 A;  2BTE A;  1U5D A;  1T0R C;  2WXO A;  4EZJ A;  3L08 A;  2KN5 A;  4WAF A;  1E5W A;  3HIE A;  5IN7 A;  1MIZ B;  1ESF A;  2JPH A;  2KIE A;  2QHO A;  3DBH B;  1DBH A;  1WGY A;  3NVV A;  1PGB A;  1NVI D;  4C80 A;  2N0S B;  4FAD A;  4FHK A;  2WXM A;  4XDC A;  2KDB A;  3HVD A;  2JYT A;  2KVR A;  2ELA A;  2KDM A;  3EEC A;  4G3X B;  5EE9 A;  3JW0 X;  3DDC B;  3QWZ B;  2XK5 B;  4ZRP A;  4QJ5 B;  1KRH A;  3HM6 X;  1FMA D;  2GB1 A;  3VAW A;  1T3Q A;  4B6W A;  1XT9 B;  2KTF A;  4JKE A;  2K6Q A;  2I5C A;  4GMV A;  5I2S A;  2KWU B;  5HG2 A;  2IPK D;  2XEW A;  2AX5 A;  5DIF B;  4JKG B;  2BQQ A;  1YIW A;  2D9W A;  3BZD B;  4K7U A;  4HAX B;  3RI7 C;  1Q10 A;  1BTK A;  4JKB A;  3N30 A;  3LXF A;  1XEE A;  1WJ4 A;  2K8E A;  1WGU A;  5KCV A;  4RH6 A;  2Z13 A;  2LOX A;  3P2B A;  1GG3 A;  1WM2 A;  1VD2 A;  1Q5W B;  1FCC C;  1AAR A;  2FCS A;  3EGR A;  1WG7 A;  4WQO B;  4ANV A;  2N4F A;  3WAP A;  4GN1 A;  1VZ6 A;  1T5X D;  1ZDX A;  2GBR A;  3EUB 2;  2CQU A;  3U8Z A;  2YEP B;  4JKD A;  3P63 A;  4L2Y A;  5D6J B;  1WXV A;  2COF A;  5DHF B;  1E8Y A;  1XCQ L;  3BYT B;  5JVL A;  2G45 B;  1ROE A;  3PVL A;  4HAZ B;  2ZW0 A;  2DYB A;  3EFU A;  2WXP A;  2VRR B;  5FKA C;  1MG8 A;  4ILG B;  1DGJ A;  2OED A;  3TFM A;  1QOA A;  4WUR A;  4B0M A;  3L17 A;  4A90 A;  4AOF A;  1UF0 A;  5DHA B;  2LHD A;  2KFK A;  3DPD A;  1N62 A;  2QC8 A;  1Q1O A;  3IBE A;  4NSW A;  2ACZ B;  4HEA 1;  1V89 A;  1K51 A;  5D3X A;  1QC6 A;  4GPT B;  1ET6 A;  2MQJ A;  2ZEQ A;  1E7P B;  5C16 A;  4HPM B;  4OVU A;  4BOS C;  3MC8 A;  4MM3 A;  3T3O A;  1GPX A;  1I7A A;  1XD4 A;  1KM7 A;  2K8C A;  2DKQ A;  3BJI A;  3ZIM A;  2BS2 B;  2PVG C;  1D4B A;  1ZE3 D;  2RVB B;  3AMZ A;  1HZ6 A;  1BTN A;  5DPW A;  1C77 A;  1I35 A;  3KQ4 A;  4I6L B;  1QT9 A;  4HAU B;  2GBN A;  2WQY B;  3SU8 X;  3EPY A;  2WWZ A;  1FXT B;  2G3Q B;  2MEK A;  2NPT B;  4IWO A;  2D9V A;  2UWQ A;  1ZM0 A;  4XWT A;  3KH0 A;  4GGQ A;  1MK7 B;  1JWU D;  1TKG A;  2KDF B;  3UGB B;  1WXA A;  3KW5 B;  2J0J A;  3APD A;  2VRW B;  4EMO A;  4JK8 A;  1KF6 B;  1NVL A;  1X1G A;  5JHG A;  4BOZ B;  2N9E B;  1HB6 A;  1E0Z A;  2JX5 A;  3U7D A;  1R4M I;  2VZK D;  2AQ1 B;  2MRP A;  2H7E A;  2KTR B;  3OJ4 B;  3V62 A;  3L54 A;  3RFZ B;  2LMC A;  5EE1 A;  4KGR A;  5IJM A;  4CHJ A;  1FPY A;  3RNF C;  1EU4 A;  1F52 A;  2N9L A;  2DHZ A;  4EOY A;  4LJO B;  1T77 A;  4NAW B;  3NS8 A;  1V81 A;  1F2R I;  4RGN A;  4M8M A;  2QSD A;  2N23 A;  1JWA D;  1P7F A;  2WDQ B;  1H10 A;  2Z0D B;  2Y5P A;  2DLB A;  4TQ1 A;  1DYQ A;  4GMX B;  1U5F A;  4IFS A;  3OG5 A;  1SHC A;  3Q2A C;  1T0Y A;  4KGS A;  3I63 C;  2WXJ A;  2BGF A;  3TMP B;  2Z59 A;  3UZT A;  2JSV X;  5C1Z A;  2FJU B;  1Q0W B;  3J9C A;  3D32 A;  2FBW B;  3T9L A;  3JYU A;  1WE7 A;  2JU6 X;  1MHH E;  3V3X A;  4A3P A;  4D2K A;  3QCA A;  2GCJ A;  3CMM B;  3Q14 C;  4WWO A;  4C00 A;  5LOP B;  3T8M A;  2LYD A;  4L23 A;  2LKO A;  2DX5 A;  2J59 M;  3S2A A;  4EZL A;  5TSS A;  3SDL C;  4ZRI A;  4MDK E;  3WAO A;  1OMW A;  3RN9 C;  1L7Y A;  3FEH A;  4M0W B;  4MGK E;  1XX0 A;  1HTO A;  4RFB A;  4TMA B;  1KZG A;  5FR6 A;  1FCL A;  1NTY A;  3A9K A;  1TT5 B;  4LJP B;  4DK5 A;  3PLV A;  1SJH D;  3QHT A;  4MY6 A;  1OTR B;  5DI9 B;  1EWY C;  2I1J A;  1FM0 D;  5HKH A;  4IOI E;  3NHE B;  3NUH B;  2CHX A;  1C4P A;  2AEH A;  1SIJ A;  1YN5 A;  3U12 A;  2LOZ A;  2FUG 1;  1XOD A;  2KWC A;  3N3K B;  4A9A A;  2FUH B;  4A55 A;  2IO3 B;  1DDW A;  2FCM A;  3ZDT A;  1I7H A;  2JWU A;  4ILH A;  5FK9 C;  1QOG A;  4JKC A;  1YN4 A;  3VVW B;  2K5P A;  4OSN A;  2LRU A;  1AQC A;  4C7Z A;  3B1L X;  2SEB D;  3IG3 A;  3NWF A;  3H6N A;  2YS1 A;  2JYE A;  1FFV A;  1TJE A;  2M4N A;  3A33 B;  5FR3 A;  2AL3 A;  2Y5C A;  5C2T B;  1UGJ A;  1TJ6 A;  1L0V B;  3VQI A;  4HAV B;  2BWF A;  4FHJ A;  1NEK B;  3PT2 B;  2RMM A;  1HBK A;  1TS4 A;  1GB4 A;  3L0W B;  2KQ7 A;  4RGT A;  1JDE A;  2LGS A;  1KJT A;  3ZNH B;  3PVW A;  3AV8 A;  3SUZ A;  2QKL A;  1E8W A;  3OAN A;  4FJY A;  4G50 A;  4MT5 A;  4GDL B;  1MI1 A;  1OEY J;  4MH0 E;  2YF0 A;  4OZC A;  5EFX A;  3NOB A;  1JWB D;  1BXT A;  3UQB A;  2HDE A;  2M17 A;  2Y5B B;  5DPS A;  5D3D A;  2JUO A;  1MFW A;  4YL8 A;  3RUI B;  1TYG B;  4W9G A;  3AED B;  1JWS D;  2WU5 B;  5D3W A;  3V6C B;  3OHM B;  2WS3 B;  4TKN A;  4HSI A;  2ASQ A;  1R4N B;  2NMQ A;  1QLB B;  1PGA A;  2ZNV B;  1WZ0 A;  3TBL D;  3AI5 A;  1KBL A;  2MX2 A;  4HHV A;  3HW2 B;  4F8C B;  1P98 A;  3AEC B;  3DXD A;  4LLG M;  5BMG A;  1VZ8 A;  1QKZ A;  5G55 A;  2X0S A;  2IY1 B;  3VRB B;  3FP5 A;  4D6W A;  5L95 C;  3MC9 A;  1RFA A;  4MJS B;  2E3T A;  1ET9 A;  2CY4 A;  3APF A;  4NY0 A;  1Y56 A;  1IYF A;  1YN3 A;  2CAY A;  3E9O A;  1K5D B;  3DBL I;  5E6N A;  1QIL A;  3U2S C;  2K2J A;  1SE9 A;  5CHV C;  2CB8 A;  4PYU A;  3GE8 C;  4ZHO A;  4GNK B;  2Z4D A;  1PUT A;  4ZDV A;  4W9C A;  2KXJ A;  4PS3 A;  3PZD A;  2ZKM X;  3FAH A;  2WDT B;  4BBN F;  4C4V A;  2N7D A;  4M00 A;  3DVN U;  2MJE A;  2MDX A;  1GNU A;  4W9E A;  1DOY A;  1YJJ A;  4IAP A;  3AEB B;  1N60 A;  3PPA A;  5GXG B;  2G4S A;  1UWM A;  1E6E B;  3N1Y C;  3CST A;  3DBR I;  2Z14 A;  2VH2 A;  1C76 A;  4W9D A;  3SFE B;  2RDB C;  3OAW A;  3HVZ A;  3U52 E;  3B77 A;  1RRB A;  5JLJ B;  1FD6 A;  1L0Y B;  2WXK A;  1RJ2 A;  1V2Y A;  2KFJ A;  2ROV A;  2W9N A;  1JRP A;  3PZ7 A;  1HQR D;  2N7E A;  3R7Q A;  4LTU A;  2M0X A;  1I4P A;  2HTH B;  2LAS A;  3WAM A;  2MP2 A;  3KLS X;  4GLS C;  4II3 B;  3ZRF A;  5HE2 A;  2N1V A;  3BII D;  1TGZ B;  2MBE A;  2DN6 A;  2M8S A;  2MH7 A;  1ZVR A;  1OQQ A;  3PP2 A;  3R7R A;  2JRH A;  2FID A;  1UNP A;  2GMI C;  1WJN A;  4QJ3 B;  4HLE A;  1NYQ A;  1L4D B;  3NG0 A;  3AE4 B;  4WJQ A;  1HXY D;  4DDG D;  4B0E A;  1J19 A;  2D10 A;  2Z0P A;  1CK1 A;  4DQO C;  1OY2 A;  3ENE A;  2WP9 B;  3ZXV A;  3PHX B;  4GU2 A;  1FGY A;  4AQ7 A;  1MKE A;  2W2X D;  1QQG A;  2OJR A;  2K00 A;  4DBG A;  3ZTD A;  2J0M A;  3IAM 1;  3RNE C;  3N9Y C;  3SV1 A;  4G11 A;  2LUE A;  2VH1 A;  4XX5 A;  3AEE B;  2R2Q A;  4JLC A;  3BYY B;  3WYF B;  3PVU A;  1CQV A;  4HRO A;  2LFI A;  2RDH A;  4A6F B;  2NPT A;  4KVG B;  2NR2 A;  4WJN A;  4YTM B;  3AEF B;  4ZRK A;  3ZNZ B;  2P0F A;  1WY8 A;  3NRZ A;  5HHD G;  3D8F A;  3DBR B;  1SSN A;  3I9V 1;  2D4Q A;  3RZW C;  1P5T A;  4R3D A;  4A3O A;  5J3Q A;  1V9J A;  4JL9 A;  2LJ5 A;  2FNJ B;  2O6V D;  2BS4 B;  1H4R A;  1V1O A;  4MJS A;  5KHO A;  2EC1 A;  4MM3 B;  1M7R A;  1CJE A;  4XC2 A;  4HDO A;  4YON A;  2V1Y A;  3AUL A;  1N6Z A;  3V60 A;  1UH6 A;  2GOW A;  1U29 A;  2RR9 A;  3TIX A;  2PKO A;  4ANW A;  1ZC4 B;  4A8X C;  2WXI A;  1VBG A;  1MJD A;  3PSC A;  4YSZ B;  3NVY A;  1RRP B;  2FCQ A;  2KQS A;  2LXC A;  3LJU X;  1TY0 A;  2WXG A;  2HTM E;  2MBO A;  5BO4 B;  3BY4 B;  3BVG A;  1MVK A;  3ZVR A;  2IBI B;  2W82 A;  3FSS A;  2K25 A;  3SYX A;  3BK2 A;  3O13 A;  2EMS A;  1P7E A;  2NBV B;  1J0W A;  3LJ3 A;  2DAF A;  2DYO A;  2JP2 A;  2FJ9 A;  2KGX B;  5KHQ A;  2LUL A;  2BB6 A;  4HWI B;  3URY A;  5JHH A;  2KAJ A;  1LO5 D;  2IYB A;  3AE6 B;  1FFU A;  1V88 A;  2CY5 A;  3VUX A;  2YT1 A;  4ARI A;  1N5W A;  5JXV A;  2KK8 A;  3VHT C;  2J53 A;  3W1S A;  4LNO A;  3DHI C;  1ZC3 B;  2XN9 C;  1ENF A;  1XR0 B;  2G9H D;  3VUW A;  1FXA A;  3ENB A;  2KVZ A;  4KSL C;  1NTV A;  2UZS A;  4W9K A;  4NQL B;  2IFS A;  2V9H A;  2DEN B;  3ZGZ A;  2YRY A;  1V5O A;  5G5G A;  1UUP A;  4YTP B;  2V3S A;  3ECI A;  4CQN A;  2WU2 B;  1WJ6 A;  3PHW B;  5HFY A;  5E6J A;  2KUP A;  4BKG A;  4IWP A;  4A20 A;  1C1Y B;  5LXH A;  2Q13 A;  2DZK A;  3AU4 A;  2V3P A;  3B9J A;  4HPP A;  2L1A A;  3OWE B;  2KTR A;  3ODO A;  4JWU C;  4DWF A;  3VOQ A;  3PRZ A;  3RNC C;  2VKI A;  1YD8 U;  3LDZ E;  2L0T A;  1ST7 A;  3A4R A;  5LG4 B;  1U5G A;  2W3R A;  3ZO5 B;  5JHA A;  2RQ1 A;  2J7Q B;  5CX3 A;  4MT7 A;  3VTU A;  2OHF A;  3TSS A;  4K3C A;  3E66 A;  5D27 A;  4NJ6 A;  5M4Y B;  2LVQ A;  2WHI A;  2ZVN A;  3JSV B;  2V0G A;  1JQ4 A;  1E7V A;  2ONQ A;  2L1C A;  2CU1 A;  4KZC A;  3TJP A;  1A70 A;  3DWM A;  1DDM A;  1WRI A;  1DDV A;  1N61 A;  1N5X A;  4EJN A;  1VCB A;  3HQC A;  1YX6 B;  1J7C A;  1EAZ A;  4ILJ A;  2Z59 B;  1Y8R C;  1V8C A;  3P6A A;  2PW9 A;  3AE5 B;  3K9O B;  1V86 A;  5J18 A;  4HKQ A;  2ZCC A;  2BYT A;  4JE3 B;  3SD5 A;  5C79 A;  2O2V B;  2IDY A;  4YTN B;  1D5X C;  4WVF B;  2K1F A;  3B0A A;  4QAY A;  2WGS A;  3PS6 A;  1L2N A;  4Z2N A;  2PPH A;  4BKS D;  3D8D A;  4TQ0 A;  1HE8 A;  1ISN A;  1U2B A;  2KIG A;  3VFK A;  4EUT A;  2WXN A;  2WX0 A;  1XCG A;  1XO3 A;  2JWZ A;  2UYZ B;  3NWD A;  1OGW A;  4MSM B;  4DX9 0;  3BK1 A;  2JZ3 B;  4F7Z A;  4AP4 C;  2CRF A;  3PO0 A;  1R4M B;  2HTH A;  2RSG A;  1PDX A;  5IP4 D;  2KDI A;  3IAS 1;  3X0W A;  4E3C A;  3KY9 A;  3AE7 B;  2INP E;  1MIX A;  2DYN A;  4H8S A;  3DHG C;  3I3T B;  3P42 A;  3R66 C;  4I6N B;  1WYG A;  1TS3 A;  5E6O A;  3JVZ X;  3FIL A;  4UDU C;  3RCZ A;  3DHH C;  2KWV B;  5AZH A;  3PGE A;  1J0G A;  1VBH A;  1I4Q A;  2MWS B;  2PMV A;  4TSS A;  5D7G A;  2D9Y A;  3TL5 A;  2DFK A;  4TUU A;  4BKS A;  3RMK C;  1LQB A;  2I1K A;  1TQZ A;  4MH8 A;  2KYW A;  2RNR B;  3BIN A;  1VR9 A;  3A8P A;  1PGX A;  4DXF A;  2XNA C;  3V5W A;  4KDL B;  1XLP A;  4ANU A;  1V6E A;  1FRD A;  3AM9 A;  3HRD D;  2MFQ A;  1VRA B;  1KI1 B;  1V61 A;  4BBK A;  4KV2 A;  1L4Z B;  2WDV B;  4XGA B;  1E8X A;  1V80 A;  3DVG Y;  4IM2 A;  2VZK B;  2QIE B;  2RDG A;  4GZU A;  5J3T A;  4G0N B;  3P7Z A;  5IRS A;  1FEH A;  1ZDV A;  2D3B A;  5D94 A;  1V97 A;  4BBN C;  1EF5 A;  1I4X A;  3H9D A;  5HE3 A;  2G4D B;  4K81 A;  1BWN A;  2M1M A;  2MSE D;  2PE6 B;  1K53 A;  3AE9 B;  3X23 A;  4I6P A;  1TS2 A;  3MC0 B;  1UZX B;  4TYZ A;  4JGH B;  3ZW3 A;  1SE4 A;  2KX0 A;  2DZM A;  3ZJT A;  4URK A;  2RUK B;  1KH0 A;  1XF5 L;  2KD0 A;  1YX5 B;  2LRW A;  2DWQ A;  2Q5W D;  3GB1 A;  4HPL B;  2K8B A;  4JKA A;  3A1Q A;  1WXS A;  1ZGU B;  4PQ0 A;  2Z8L A;  3MDB C;  2INN E;  2H7D A;  4W9L A;  2WXH A;  4CHK A;  2DZI A;  3KSY A;  4N9F 4;  1K8R B;  3P4Q B;  4OW0 A;  3TEX A;  4DHZ B;  3CXB B;  1KFY B;  3MJW A;  4Z2M B;  3RCP A;  4WWP A;  2DX5 B;  2LG1 A;  3A4S C;  1YMH E;  4P16 A;  1IBX A;  3ZVV A;  1WR6 E;  1T0S C;  2C7H A;  1ZXI A;  2BT6 A;  1I4H A;  2KN4 A;  3UI3 A;  3QIJ A;  1NBF C;  2CJO A;  2IYD B;  2ZNV C;  2KJH B;  1UNS A;  2LD9 A;  3P4S B;  3GZN B;  2O6V B;  3K9P B;  2DKP A;  3PLU A;  3PRP B;  1YQB A;  1MHX A;  2PTL A;  1UEF A;  2L7R A;  3DVG X;  2JXX A;  3HIZ A;  1WX7 A;  3FVC A;  4RGM A;  2KLC A;  3SEB A;  1UBQ A;  5IOI A;  2V76 A;  4LCD E;  5AZF A;  3VR8 B;  1P6S A;  1IGD A;  5I2M A;  1Y19 B;  1EWC A;  1UPQ A;  3EHV A;  1BUI C;  4ANX A;  4F7H A;  2AQ2 B;  2R2O A;  3DQV A;  3BVM A;  4XWW A;  3U30 A;  4ZOH C;  4NJ7 A;  4BAX A;  5BMH A;  4BKT A;  2DIK A;  1ZUD 2;  2IGH A;  4OVZ A;  3VUY A;  1F0Z A;  3TEZ A;  3CWI A;  3ZJU A;  1WH3 A;  2V4L A;  2KR0 A;  2DNF A;  2XBB C;  4C4V B;  3DXE A;  4IUM B;  5TR5 A;  5GMV A;  2IO1 B;  2BYF A;  1WR1 A;  1WI1 A;  3HK0 A;  1DRO A;  1J8C A;  4B6H A;  3DVN V;  1U27 A;  1D5M C;  4WJO A;  3QX1 A;  5C3J B;  2VSZ A;  1ACA A;  1YJI A;  1AWE A;  2DHK A;  1EM7 A;  2I38 A;  4NAW A;  2WXF A;  2FAZ A;  3R3M A;  2GS0 A;  2H89 B;  2P0D A;  2BS3 B;  2GBK A;  2OQB A;  2DYQ A;  3RNB C;  3DXC A;  4EFO A;  4OZB A;  3GOE A;  4GOU A;  4LDT B;  4E74 A;  3DOW A;  3VXW A;  4LNF A;  1SE3 A;  4A6H A;  4KGT A;  3Q8F A;  4HVB A;  1QOB A;  1IUE A;  1YJ1 A;  5LXI B;  5C5B A;  1WRD B;  3H7P A;  3SFD B;  2KUQ A;  4K3B A;  4NJC A;  1P9D U;  3RZF A;  3KUC B;  4NZL B;  2G35 A;  4K2O A;  2LGD A;  3AJ4 A;  2DAJ A;  2P8V A;  1P3Q U;  1OEY A;  3TVV A;  5J3Y A;  2JF5 A;  2GBJ A;  4P7I A;  3Q8C A;  3A9J A;  2MW5 A;  3NS1 A;  2PEA A;  2CHW A;  4KIK B;  5DH9 B;  1UPR A;  2MBH A;  5FI0 A;  4EEW A;  4ZRQ A;  3CSF A;  2KLG A;  1MPH A;  3TEW A;  2CKH B;  2D9X A;  1K50 A;  5HE1 A;  4KKI A;  2W2X C;  1UGM A;  2X38 A;  2D2Q A;  5G2N A;  4PK1 A;  2BCJ A;  4GOC A;  5BYQ A;  4W9I A;  4MAC A;  3AEA B;  4H2A A;  2K39 A;  4K17 A;  4HAT B;  3M62 B;  1SJE D;  3GE3 C;  5H92 C;  1WM3 A;  5FI1 A;  1FGZ A;  1GOZ A;  2JVC A;  3C8Y A;  3ZNI D;  4CSQ A;  3O65 B;  2IGD A;  2RGN B;  1WJ1 A;  1NEN B;  1NTI A;  1XLN A;  2EKI A;  3NZS A;  1RM6 C;  1WGH A;  2KT7 A;  4JWS C;  1VZ7 A;  3UQA A;  3B2G A;  4HB2 B;  3R8B A;  5JP4 A;  4W9J A;  4DXA B;  4WQM A;  4TV3 A;  2LBB A;  1JCK B;  2K8H A;  3Q3J A;  3EA6 A;  3NWA A;  5JHB A;  1WE6 A;  3RD2 A;  1F2R C;  3H7P B;  3AN1 A;  4RM8 A;  2LJI A;  1S1Q B;  1Z87 A;  2KMC A;  5I4D A;  2KMA A;  3MPX A;  2WX1 A;  4L6E A;  1BML C;  1X1M A;  2MP2 B;  4ICV A;  3TUO A;  2IGG A;  3CF6 E;  4N59 A;  2K49 A;  4LDT D;  2OTX A;  1EO6 A;  2V4I B;  1E10 A;  4KKJ A;  1WSP A;  2QEJ C;  1MPE A;  2BPS A;  4USA A;  3E56 A;  2R82 A;  4YWG G;  3WIM A;  3P1M A;  2DTC A;  3GZN I;  5LNK 1;  1UBI A;  4KHB A;  2Z0Q A;  2NZ8 B;  2PE9 A;  2EKE C;  1G6J A;  2FE8 A;  1I4G A;  2NBU A;  3UF8 A;  1JRO A;  1FNU A;  2ON8 A;  2BB5 A;  3QA8 A;  1DIK A;  2ZJD A;  4WAA A;  3NZ3 A;  3V61 A;  3LB8 C;  2W3S A;  4FA6 A;  1VJK A;  3LYY A;  4AWJ A;  3RYT A;  1LW3 A;  2RSU A;  2ZCB A;  2FJL A;  3ZYY X;  2QKM A;  3FM8 C;  3NY5 A;  4ASW C;  1RYJ A;  4M8N A;  5CHW A;  2RD0 A;  1JW9 D;  4HB3 B;  4A6K A;  4CYE A;  3HM3 A;  3AXC A;  2BYV E;  3CIR B;  2BKF A;  5L81 A;  1M7E A;  1FIQ A;  4HXD A;  2JRI B;  2COC A;  4REZ A;  2R61 A;  1HA5 A;  2L2I A;  3WAL A;  1XKE A;  5IO9 A;  1ZXH A;  5C6R A;  2FIF A;  2LEK A;  4P1C C;  4MGI E;  2L32 A;  4K2P A;  2M0A A;  4Y94 A;  1RAX A;  2J52 A;  2K0P A;  2LI5 A;  2LGX A;  1WGD A;  4RMA A;  3ZQ4 A;  1UEL A;  1L0X B;  4KZ0 A;  2INC C;  4IC7 B;  2SAK A;  4WJP A;  1WFY A;  2BYE A;  2DA0 A;  1QQR A;  3ZKJ C;  4RM9 A;  4RF0 A;  1V49 A;  2NBW B;  2IY0 B;  1TY2 A;  3PEG A;  2A4Z A;  1M4V A;  3AE3 B;  3NW8 A;  2NCN A;  1BT0 A;  2Z0E B;  4PNK A;  2AYO B;  3R2I A;  1MG4 A;  3N7C A;  3SR6 A;  4CHM A;  3WAN A;  2KOX A;  4WJ7 A;  1PFD A;  1XCT L;  1NU2 A;  4W9F A;  5D3I B;  1EVH A;  3Q3N C;  2LUM A;  1V5T A;  1KLU D;  4P6V F;  1WI0 A;  4ACF A;  1FNV A;  1IBX B;  3IVF A;  1ZYI A;  2DLW A;  2D3C A;  4MEL A;  1E90 A;  3W2D A;  1EGX A;  1TKE A;  1WMH A;  2AL6 A;  2G1E A;  2D3A A;  2Y8G A;  4KX6 B;  2W2W A;  1WXM A;  2RGF A;  2MA9 B;  1WZ3 A;  4LK0 M;  2KAC A;  3TO1 A;  1TS5 A;  5LON B;  2KDE B;  2AQ3 B;  3B2F A;  4QXA B;  2CR5 A;  1Y5O A;  2KC2 A;  1IGC A;  2DHI A;  4MGY E;  4DHZ E;  3KUD B;  2C60 A;  1C3T A;  2CS4 A;  3H7S A;  3NJT A;  4RF1 A;  3SNH A;  4KHO A;  2RRF A;  1B9R A;  1CMX B;  3H1U A;  4P1B C;  2W55 A;  1WWT A;  2JY6 A;  4AUQ C;  3I5J C;  2YVC A;  1BAK A;  3ABV B;  2YT2 A;  5CHF A;  3FC4 A;  4O1N A;  4K7S A;  4MSQ B;  3PRM B;  2EEL A;  3QJZ A;  1RLF A;  3M1I B;  1Z5S B;  2C7N B;  1JAL A;  4EZK A;  2UZR A;  5LLI A;  2KMM A;  4J3O D;  2MCN B;  3V05 A;  3Q8A A;  4HDQ A;  3ODX A;  2MLB A;  1HB8 A;  1X11 A;  2KAN A;  1V1P B;  3M95 A;  3DBH I;  4HB0 B;  1FXI A;  2KCJ A;  3GP7 A;  3KUZ A;  1E9M A;  2L0F A;  1EUV B;  2IO0 B;  4WWN A;  4YT0 B;  2NS5 A;  1LM8 B;  5H8Y E;  3KYD D;  1C79 A;  5G5H A;  1PLS A;  3Q8E A;  4WH4 A;  1W1G A;  2N0Y A;  2LVO A;  2WNM A;  3N32 A;  2LHE A;  3TEY A;  3DBS A;  3HSA A;  2GJY A;  2E6X A;  4IM3 A;  1L6U A;  1OQN A;  1SBB B;  1ZW7 A;  3KVF B;  2NMB A;  4YSX B;  1OQY A;  3ZTC A;  1EU3 A;  1R7S A;  3UIO B;  5CTR C;  1LB1 A;  1NI2 A;  1D6E C;  1V1P A;  1LXD A;  3AB5 A;  4XDD A;  5IA7 A;  3CIK A;  3QQ8 B;  3HHM A;  4JKF A;  4GDK A;  2MBB B;  2WXL A;  4K7W A;  4F7G A;  3QWM A;  3AE2 B;  4FLH A;  2KNB A;  4Q2J A;  1C4C A;  2REX A;  3AEG B;  4JKH A;  3N20 C;  1NYR A;  3VTV A;  4OT1 A;  4X57 B;  2YSZ A;  1WJM A;  1P0R A;  1HZ5 A;  1NI3 A;  1TIF A;  2GRI A;  2KKC A;  1Q67 A;  2KFK B;  4DHJ B;  1PFJ A;  4ICU A;  4HAY B;  1WF9 A;  3WCQ A;  1FO4 A;  3RUL A;  1FB8 A;  3KZ1 A;  4MEM A;  5T8I A;  4IWQ A;  4MGZ E;  2D11 A;  3T06 A;  1P1A A;  2EMT A;  3C19 A;  1QZE A;  2YEP F;  3FKY A;  3KWL A;  2L76 A;  5AUK A;  1WX8 A;  2R09 A;  1WMH B;  2L00 B;  1MAI A;  3ZLZ A;  2L3Z A;  3UIP B;  2WH5 A;  1U4A A;  2HD5 B;  2Y7B A;  3I57 A;  3APC A;  1LGR A;  1SE2 A;  4ZYN A;  3GYO A;  2RPQ A;  2GI9 A;  3A1Q B;  3L16 A;  2NTS A;  2P0H A;  3ZJV A;  3SHQ A;  4IKG A;  4K1R B;  3B08 A;  1MK9 B;  2YS3 A;  4DIX A;  3W1Y A;  3QBV B;  1XQQ A;  1YQ4 B;  4QJ4 B;  3FIL B;  5AZG A;  4KIK A;  4FBJ B;  4JK7 A;  4N6E B;  4ZHP A;  5BMI A;  1VDV A;  2X8X X;  3PRE A;  3DCX A;  4GB9 A;  2WYQ A;  2PIA A;  5JH5 C;  4D0N B;  2L52 A;  4L1R A;  1K5G B;  1LFD A;  2IJ0 A;  1HEZ E;  2NVU I;  2QJL A;  2PZ1 A;  3Q69 A;  3VIA A;  1FNW A;  5C5B B;  2D3G A;  2YT0 A;  2RPV A;  1T0Q C;  3Q8B A;  1OQR A;  2PVO D;  4GIV A;  3ZNG C;  2K9X A;  3ML8 A;  3QK0 A;  1DOI A;  3E9P A;  2YS5 A;  3AU5 A;  4A5K A;  1KZ7 A;  2KQ4 X;  3Q3O C;  4BFR A;  2JT4 B;  1TZ1 A;  2N9K A;  1TZO A;  1IP9 A;  4BZA A;  1WGQ A;  1C78 A;  3IHP C;  3MJ5 A;  3MHS D;  2CHZ A;  1WX9 A;  1WVH A;  2D07 B;  2MKR A;  1DYN A;  3Q6B A;  2N9P C;  2GLS A;  3NZU A;  4IW0 A;  4ARC A;  1N63 A;  1TBE A;  1W1D A;  1B55 A;  4LNN A;  2QMT A;  5D3Y A;  2KX3 A;  2L8J A;  3ZUN A;  3DCG A;  4ZRJ A;  3RNA C;  5D2M B;  3T3N A;  3A58 A;  3W1S C;  2N9X A;  3MP9 A;  2I2Y A;  4B9K A;  4B95 A;  3ZDM C;  2LGI A;  4RCO A;  1GJZ A;  1C9F A;  1QOF A;  5DCN A;  1TKY A;  2COD A;  2ABD A;  4NNJ B;  4S0R A;  4PYZ A;  1S3S G;  2JZP A;  3ALB A;  4S17 A;  2D9Z A;  4KSK C;  1FAO A;  2L83 A;  2KJ6 A;  4WIP A;  4DX8 A;  4KHA A;  1KC7 A;  3NSU A;  3U4E G;  3W9C B;  4YSY B;  5EE3 A;  3PV1 A;  3RNG C;  3VDZ A;  3V6E B;  4M02 A;  3SBT A;  1TXD A;  2O6V A;  2QIL A;  3W5U B;  1ZSQ A;  1FHO A;  2LWP A;  4HAW B;  1D5Z C;  2OJW A;  2DYM A;  4IOY X;  4GSW A;  4OVV A;  3OJ3 A;  5JZE B;  4N58 A;  3ONS A;  1SB3 C;  4RNA A;  1I4R A;  3HUI A;  3KYC D;  1FRR A;  3R2T A;  3IT6 B;  2GUM A;  3N1Z C;  5MPO A;  2J0K A;  2DX1 A;  5HI1 A;  2IZV B;  3P4P B;  1AWD A;  2DHJ A;  5IAA C;  1AN8 A;  2B3A A;  4US8 A;  1X86 A;  3IXS A;  5BYS A;  3ZXR A;  3Q3M C;  2CU3 A;  5EE0 A;  1GC6 A;  3RT3 B;  2QCZ A;  2M14 A;  1K52 A;  2KO3 A;  4PS8 A;  2NTT A;  2J4X A;  3SBG A;  1V5U A;  3L10 B;  3E9S A;  3N1X C;  1ZOY B;  4WWM A;  1M94 A;  1X1F A;  1XD3 B;  4FJV B;  1AYF A;  2LGY A;  4DBB A;  4LNI A;  3QAQ A;  4HKZ E;  2L05 A;  2GBM A;  1YQ3 B;  1YNT E;  1VLB A;  1F1H A;  4KHB B;  1JWM D;  2DBY A;  2UU7 A;  3PTF C;  3H8H A;  1ZKH A;  4AS1 A;  1UNR A;  1HTQ A;  1SIF A;  5D3V A;  1NDD A;  4JPS A;  2BKR B;  3ETR A;  3ULC A;  2ROZ B;  1C4A A;  2XQN M;  1WGR A;  1STE A;  1SXT A;  4JIO U;  3M3J A;  2ZZP B;  3VR9 B;  1Z2M A;  3A8Q A;  5BYR A;  2KC1 A;  1J7A A;  2CJN A;  4W9H A;  1L5P A;  4GDK B;  2RLO A;  3L13 A;  5GOW B;  4MK0 A;  4NAM A;  3D8E A;  2Z0O A;  3FLV A;  3KRW A;  5IKC M;  1H8C A;  1WJU A;  3F5R A;  1X05 A;  2HJ8 A;  4US9 A;  3AE8 B;  2LXA A;  4IDI A;  3EFC A;  4E71 A;  3KRX A;  3NVW A;  4GDL A;  2M56 B;  2BF8 B;  3VH4 B;  1IPG A;  5DPR A;  3QC8 B;  1FOE A;  3QAR A;  3F0W A;  1MI0 A;  2NBV A;  4HB4 B;  1E7U A;  1FHX A;  3JSV A;  4IM0 A;  1PYW D;  1GGO A;  4AJY B;  2I5F A;  1WGK A;  4F1S A;  4M01 A;  2QDF A;  1GUA B;  1QF6 A;  3VRA B;  4XE0 A;  4A6Q A;  4WSF A;  2ZW1 A;  2MBQ A;  1UD7 A;  2KJR A;  2N7J A;  2X18 A;  3ULB A;  3ZRC A;  1KOT A;  4AJW A;  1ACC A;  2UVM A;  3IT4 B;  2PLP A;  5EDS A;  2HRJ A;  2MJD A;  1V5M A;  4ITK A;  4JK9 A;  4L1B A;  2EJ8 A;  4FN2 A;  2OOB B;  2HE7 A;  2MHJ A;  1L6V A;  1KTK A;  2BWE S;  3OLM D;  4HJG E;  5E6P A;  1PQS A;  2ICI A;  1WGG A;  2XK5 A;  2COA A;  1F77 A;  2C5L C;  2MWN B; 
#chains in the Genus database with same CATH homology
 3M63 B;  2KZR A;  3VH3 B;  2IO2 B;  4KAX B;  3C0R B;  2Y8F A;  2ZPY A;  2O2V A;  1N3H A;  2FCN A;  1KLV A;  5KQ4 A;  1FHW A;  3WA0 A;  2N1W A;  5J17 A;  2KHW B;  5HE0 A;  2PJH A;  4JQW C;  4II2 B;  2C7M B;  4PS7 A;  2K6D B;  3A9K B;  5KQ1 A;  3G9W A;  4FUL A;  1SGH A;  1I2H A;  3Q3F A;  1JRU A;  5AEK B;  5C23 A;  2R0D A;  4FJZ A;  1P3R A;  4HCN B;  2K2U A;  4BVU C;  3TCA A;  4XWX A;  3MTN B;  3A9J B;  2YLM A;  3E9L A;  5J2R A;  1W1H A;  3UIN B;  3IFW B;  1PMS A;  1EF1 A;  1E8Z A;  5CLL B;  3O96 A;  1WYW B;  4DDI D;  2ZPN A;  3ML9 A;  4NQK E;  2AWT A;  1GC7 A;  1V5P A;  1R4N I;  2A5U A;  4IG7 B;  4J6I A;  3VTW A;  4CO7 A;  5DPT A;  2M38 A;  3EC8 A;  2E2X A;  2LZ6 A;  4NPN A;  2C9W B;  5CLQ B;  4DHJ D;  1I42 A;  1WIA A;  3ODW A;  4HJK A;  3PSE B;  3SO6 A;  1TTN A;  3GYP A;  4KDI C;  4GXB A;  4F7U P;  3TW1 A;  4HK2 A;  4HCP B;  2FDQ A;  4JKG A;  1A5R A;  1U5E A;  4XZ4 A;  3PG7 A;  2DZJ A;  2ELB A;  4EKU A;  3A98 B;  2LVP A;  4C0A A;  2ZVO A;  2JZZ A;  1UNQ A;  2ADZ A;  1IRS A;  4A6F A;  2COP A;  5L83 A;  2GCL A;  3ML4 A;  1D3Z A;  1F9J A;  1U5D A;  4EZJ A;  3L08 A;  2KN5 A;  1E5W A;  1MIZ B;  2JPH A;  2QHO A;  1DBH A;  1WGY A;  4FAD A;  4FHK A;  2KDB A;  2KVR A;  2ELA A;  4G3X B;  3EEC A;  3JW0 X;  3DDC B;  3QWZ B;  2XK5 B;  3HM6 X;  3VAW A;  4B6W A;  1XT9 B;  2KTF A;  4JKE A;  2K6Q A;  2I5C A;  4GMV A;  2KWU B;  2XEW A;  5DIF B;  4JKG B;  1YIW A;  2D9W A;  4K7U A;  4HAX B;  1BTK A;  4JKB A;  3N30 A;  1WJ4 A;  1WGU A;  5KCV A;  2LOX A;  3P2B A;  1GG3 A;  1WM2 A;  1VD2 A;  1Q5W B;  1AAR A;  2FCS A;  1WG7 A;  4WQO B;  4ANV A;  2N4F A;  3WAP A;  4GN1 A;  2GBR A;  2CQU A;  3U8Z A;  4JKD A;  5D6J B;  1WXV A;  2COF A;  5DHF B;  1E8Y A;  5JVL A;  2G45 B;  3PVL A;  4HAZ B;  2DYB A;  3EFU A;  2VRR B;  1MG8 A;  4ILG B;  3TFM A;  3L17 A;  4AOF A;  5DHA B;  2KFK A;  3DPD A;  1Q1O A;  3IBE A;  4NSW A;  1V89 A;  5D3X A;  1QC6 A;  4GPT B;  2MQJ A;  2ZEQ A;  5C16 A;  4HPM B;  4OVU A;  4BOS C;  4MM3 A;  1I7A A;  1XD4 A;  1KM7 A;  2K8C A;  2DKQ A;  3BJI A;  3ZIM A;  2RVB B;  1BTN A;  5DPW A;  1I35 A;  4I6L B;  4HAU B;  2GBN A;  3SU8 X;  3EPY A;  2WWZ A;  1FXT B;  2G3Q B;  2NPT B;  4IWO A;  2D9V A;  2UWQ A;  1ZM0 A;  3KH0 A;  4GGQ A;  1MK7 B;  2KDF B;  3UGB B;  1WXA A;  3KW5 B;  2J0J A;  3APD A;  2VRW B;  4EMO A;  4JK8 A;  1NVL A;  1X1G A;  5JHG A;  4BOZ B;  2N9E B;  1HB6 A;  3U7D A;  1R4M I;  2MRP A;  2H7E A;  2KTR B;  3OJ4 B;  3V62 A;  3L54 A;  5IJM A;  4CHJ A;  2DHZ A;  4EOY A;  4LJO B;  4NAW B;  3NS8 A;  1V81 A;  4M8M A;  2N23 A;  1H10 A;  2Z0D B;  4TQ1 A;  4GMX B;  1U5F A;  4IFS A;  1SHC A;  1T0Y A;  2BGF A;  3TMP B;  3UZT A;  5C1Z A;  1Q0W B;  3D32 A;  3T9L A;  3JYU A;  1WE7 A;  4A3P A;  3QCA A;  2GCJ A;  3CMM B;  4WWO A;  5LOP B;  3T8M A;  2LYD A;  2LKO A;  2DX5 A;  2J59 M;  3S2A A;  4EZL A;  3SDL C;  4ZRI A;  4MDK E;  3WAO A;  1OMW A;  1L7Y A;  3FEH A;  4M0W B;  4MGK E;  1XX0 A;  1KZG A;  5FR6 A;  1NTY A;  4DK5 A;  3A9K A;  4LJP B;  3PLV A;  3QHT A;  4MY6 A;  1OTR B;  5DI9 B;  2I1J A;  5HKH A;  3NHE B;  2CHX A;  2AEH A;  2LOZ A;  1XOD A;  2KWC A;  3N3K B;  2FUH B;  2IO3 B;  1DDW A;  2FCM A;  3ZDT A;  4ILH A;  4JKC A;  3VVW B;  2LRU A;  1AQC A;  3B1L X;  3IG3 A;  3H6N A;  2YS1 A;  2M4N A;  3A33 B;  2AL3 A;  1TJ6 A;  3VQI A;  4HAV B;  2BWF A;  4FHJ A;  3PT2 B;  1HBK A;  3L0W B;  2KQ7 A;  1JDE A;  1KJT A;  3ZNH B;  3PVW A;  3SUZ A;  2QKL A;  1E8W A;  3OAN A;  4FJY A;  4G50 A;  4GDL B;  1OEY J;  4MH0 E;  2YF0 A;  5EFX A;  3NOB A;  3UQB A;  2Y5B B;  2M17 A;  5DPS A;  2JUO A;  4YL8 A;  3RUI B;  4W9G A;  5D3W A;  3V6C B;  4TKN A;  2ASQ A;  2ZNV B;  1WZ0 A;  3TBL D;  3AI5 A;  1KBL A;  2MX2 A;  4HHV A;  3HW2 B;  4F8C B;  1P98 A;  3DXD A;  5G55 A;  2X0S A;  2IY1 B;  3FP5 A;  5L95 C;  1RFA A;  4MJS B;  2CY4 A;  3APF A;  4NY0 A;  1IYF A;  2CAY A;  3E9O A;  1K5D B;  3DBL I;  5E6N A;  2K2J A;  1SE9 A;  5CHV C;  2CB8 A;  4PYU A;  4ZDV A;  4W9C A;  2KXJ A;  4PS3 A;  3PZD A;  2WDT B;  4BBN F;  2N7D A;  3DVN U;  2MDX A;  1GNU A;  4W9E A;  4IAP A;  3PPA A;  2G4S A;  3CST A;  3DBR I;  4W9D A;  3OAW A;  1RRB A;  5JLJ B;  1RJ2 A;  1V2Y A;  2KFJ A;  2ROV A;  2W9N A;  2N7E A;  3R7Q A;  2M0X A;  2HTH B;  2LAS A;  3WAM A;  2MP2 A;  4II3 B;  3ZRF A;  5HE2 A;  2N1V A;  1TGZ B;  2MBE A;  2DN6 A;  2M8S A;  1ZVR A;  3PP2 A;  3R7R A;  2JRH A;  2FID A;  1UNP A;  2GMI C;  1WJN A;  4HLE A;  4WJQ A;  4DDG D;  1J19 A;  2D10 A;  2Z0P A;  1OY2 A;  3ENE A;  3PHX B;  4GU2 A;  1FGY A;  1MKE A;  2W2X D;  1QQG A;  2OJR A;  2K00 A;  4DBG A;  3ZTD A;  2J0M A;  3SV1 A;  4G11 A;  2LUE A;  4XX5 A;  2R2Q A;  4JLC A;  3WYF B;  3PVU A;  4A6F B;  2NPT A;  4KVG B;  2NR2 A;  4WJN A;  4ZRK A;  3ZNZ B;  2P0F A;  1WY8 A;  3D8F A;  3RZW C;  2D4Q A;  1P5T A;  4A3O A;  5J3Q A;  1V9J A;  4JL9 A;  2LJ5 A;  2FNJ B;  2O6V D;  1H4R A;  4MJS A;  5KHO A;  2EC1 A;  1M7R A;  4XC2 A;  4HDO A;  4YON A;  2V1Y A;  3AUL A;  3V60 A;  1UH6 A;  2GOW A;  1U29 A;  2RR9 A;  3TIX A;  4ANW A;  1ZC4 B;  1VBG A;  3PSC A;  1RRP B;  2FCQ A;  2KQS A;  2LXC A;  3LJU X;  2MBO A;  3BY4 B;  3ZVR A;  2IBI B;  3FSS A;  2K25 A;  3SYX A;  2EMS A;  2NBV B;  1J0W A;  3LJ3 A;  2DAF A;  2DYO A;  2JP2 A;  2FJ9 A;  2KGX B;  5KHQ A;  2LUL A;  4HWI B;  5JHH A;  2IYB A;  1V88 A;  2CY5 A;  3VUX A;  2YT1 A;  2KK8 A;  3VHT C;  3W1S A;  1ZC3 B;  1XR0 B;  3VUW A;  3ENB A;  4KSL C;  1NTV A;  2UZS A;  4W9K A;  4NQL B;  2IFS A;  2DEN B;  2YRY A;  1V5O A;  2V3S A;  3ECI A;  1WJ6 A;  3PHW B;  2KUP A;  4BKG A;  4IWP A;  4A20 A;  1C1Y B;  5LXH A;  2Q13 A;  2DZK A;  3AU4 A;  2KTR A;  3ODO A;  4DWF A;  3VOQ A;  3PRZ A;  2VKI A;  1YD8 U;  3LDZ E;  2L0T A;  1ST7 A;  3A4R A;  1U5G A;  3ZO5 B;  5JHA A;  5CX3 A;  2RQ1 A;  2J7Q B;  4MT7 A;  3VTU A;  3E66 A;  5D27 A;  4NJ6 A;  2LVQ A;  2ZVN A;  3JSV B;  1E7V A;  2L1C A;  2CU1 A;  4KZC A;  3TJP A;  1DDM A;  1DDV A;  4EJN A;  1VCB A;  3HQC A;  1YX6 B;  1EAZ A;  4ILJ A;  2Z59 B;  1Y8R C;  3P6A A;  3K9O B;  5J18 A;  1V86 A;  2ZCC A;  3SD5 A;  5C79 A;  2O2V B;  4WVF B;  2K1F A;  3B0A A;  3PS6 A;  1L2N A;  4Z2N A;  2PPH A;  4BKS D;  3D8D A;  4TQ0 A;  1HE8 A;  1ISN A;  4EUT A;  1U2B A;  3VFK A;  2WX0 A;  1XCG A;  2JWZ A;  2UYZ B;  1OGW A;  4MSM B;  4DX9 0;  2JZ3 B;  4F7Z A;  4AP4 C;  2CRF A;  2HTH A;  2RSG A;  2KDI A;  3X0W A;  4E3C A;  3KY9 A;  1MIX A;  3R66 C;  4I6N B;  2DYN A;  4H8S A;  3I3T B;  5E6O A;  3JVZ X;  3RCZ A;  2KWV B;  5AZH A;  3PGE A;  1J0G A;  1VBH A;  2MWS B;  5D7G A;  2D9Y A;  3TL5 A;  2DFK A;  4TUU A;  4BKS A;  1LQB A;  2I1K A;  1TQZ A;  2RNR B;  3BIN A;  3A8P A;  3V5W A;  4KDL B;  4ANU A;  1V6E A;  2MFQ A;  1KI1 B;  1V61 A;  4BBK A;  4KV2 A;  1E8X A;  1V80 A;  3DVG Y;  4IM2 A;  4GZU A;  5J3T A;  4G0N B;  3P7Z A;  5D94 A;  4BBN C;  1EF5 A;  3H9D A;  5HE3 A;  2G4D B;  4K81 A;  1BWN A;  2M1M A;  2MSE D;  2PE6 B;  3X23 A;  4I6P A;  1UZX B;  4TYZ A;  4JGH B;  3ZW3 A;  2KX0 A;  2DZM A;  4URK A;  2RUK B;  2KD0 A;  1YX5 B;  2LRW A;  4HPL B;  2K8B A;  4JKA A;  3A1Q A;  1WXS A;  1ZGU B;  4PQ0 A;  3MDB C;  2H7D A;  4W9L A;  4CHK A;  2DZI A;  3KSY A;  4N9F 4;  1K8R B;  4DHZ B;  3CXB B;  3MJW A;  4Z2M B;  3RCP A;  4WWP A;  2DX5 B;  2LG1 A;  3A4S C;  3ZVV A;  1WR6 E;  2C7H A;  3QIJ A;  1NBF C;  2IYD B;  2ZNV C;  2KJH B;  2LD9 A;  2O6V B;  3K9P B;  2DKP A;  3PLU A;  3PRP B;  1YQB A;  1UEF A;  2L7R A;  3DVG X;  2JXX A;  3HIZ A;  1WX7 A;  2KLC A;  1UBQ A;  2V76 A;  4LCD E;  5AZF A;  1P6S A;  1Y19 B;  1UPQ A;  3EHV A;  4ANX A;  4F7H A;  2R2O A;  3DQV A;  3U30 A;  4NJ7 A;  4BKT A;  2DIK A;  3VUY A;  1WH3 A;  2V4L A;  2XBB C;  3DXE A;  4IUM B;  5TR5 A;  5GMV A;  2IO1 B;  2BYF A;  1WR1 A;  1WI1 A;  3HK0 A;  1DRO A;  1J8C A;  4B6H A;  3DVN V;  1U27 A;  4WJO A;  3QX1 A;  2VSZ A;  1ACA A;  1AWE A;  2DHK A;  4NAW A;  2FAZ A;  3R3M A;  2GS0 A;  2P0D A;  2GBK A;  2OQB A;  2DYQ A;  3DXC A;  4EFO A;  3GOE A;  4LDT B;  4E74 A;  3DOW A;  3VXW A;  4A6H A;  4HVB A;  1YJ1 A;  5LXI B;  5C5B A;  1WRD B;  3H7P A;  1P9D U;  3RZF A;  3KUC B;  2G35 A;  4K2O A;  2LGD A;  3AJ4 A;  2DAJ A;  2P8V A;  1P3Q U;  1OEY A;  3TVV A;  5J3Y A;  2JF5 A;  2GBJ A;  4P7I A;  3A9J A;  2MW5 A;  2PEA A;  2CHW A;  4KIK B;  5DH9 B;  1UPR A;  2MBH A;  5FI0 A;  4EEW A;  3CSF A;  2KLG A;  1MPH A;  2CKH B;  2D9X A;  5HE1 A;  2W2X C;  1UGM A;  2D2Q A;  5G2N A;  2BCJ A;  4GOC A;  4W9I A;  2K39 A;  4K17 A;  4HAT B;  3M62 B;  1WM3 A;  5FI1 A;  1FGZ A;  2JVC A;  3ZNI D;  3O65 B;  2RGN B;  1WJ1 A;  1NTI A;  3NZS A;  1WGH A;  3UQA A;  4HB2 B;  5JP4 A;  4W9J A;  4DXA B;  4TV3 A;  2LBB A;  2K8H A;  3Q3J A;  5JHB A;  1WE6 A;  3RD2 A;  3H7P B;  4RM8 A;  1S1Q B;  1Z87 A;  2KMC A;  2KMA A;  3MPX A;  2WX1 A;  4L6E A;  1X1M A;  2MP2 B;  4ICV A;  3CF6 E;  4LDT D;  2OTX A;  1EO6 A;  2BPS A;  2R82 A;  3WIM A;  3GZN I;  2DTC A;  1UBI A;  2Z0Q A;  2NZ8 B;  2PE9 A;  2EKE C;  1G6J A;  2NBU A;  3UF8 A;  3QA8 A;  1DIK A;  2ZJD A;  4WAA A;  3V61 A;  4FA6 A;  4AWJ A;  3RYT A;  1LW3 A;  2RSU A;  2ZCB A;  2FJL A;  2QKM A;  3FM8 C;  3NY5 A;  4ASW C;  4M8N A;  5CHW A;  2RD0 A;  4HB3 B;  4A6K A;  4CYE A;  3HM3 A;  3AXC A;  2BYV E;  2BKF A;  5L81 A;  1M7E A;  4HXD A;  2JRI B;  2COC A;  2L2I A;  3WAL A;  1XKE A;  5C6R A;  2FIF A;  4MGI E;  4K2P A;  4Y94 A;  1RAX A;  2LI5 A;  2LGX A;  1WGD A;  4RMA A;  1UEL A;  4KZ0 A;  4IC7 B;  4WJP A;  1WFY A;  2BYE A;  2DA0 A;  3ZKJ C;  4RM9 A;  1V49 A;  2NBW B;  2IY0 B;  3PEG A;  2A4Z A;  2NCN A;  1BT0 A;  2Z0E B;  4PNK A;  2AYO B;  3N7C A;  3WAN A;  4CHM A;  2KOX A;  4WJ7 A;  1NU2 A;  4W9F A;  1EVH A;  1V5T A;  1WI0 A;  3IVF A;  2DLW A;  4MEL A;  1E90 A;  1EGX A;  1WMH A;  2AL6 A;  2Y8G A;  2W2W A;  1WXM A;  2RGF A;  2MA9 B;  1WZ3 A;  3TO1 A;  5LON B;  2KDE B;  2CR5 A;  1Y5O A;  2KC2 A;  2DHI A;  4MGY E;  4DHZ E;  3KUD B;  2C60 A;  1C3T A;  2CS4 A;  3H7S A;  3SNH A;  4KHO A;  1CMX B;  3H1U A;  2JY6 A;  4AUQ C;  2YVC A;  1BAK A;  5CHF A;  4K7S A;  4MSQ B;  3PRM B;  3QJZ A;  1RLF A;  3M1I B;  1Z5S B;  2C7N B;  4EZK A;  2UZR A;  5LLI A;  2MCN B;  4HDQ A;  3ODX A;  2MLB A;  1HB8 A;  1X11 A;  2KAN A;  3M95 A;  3DBH I;  4HB0 B;  2KCJ A;  3KUZ A;  2L0F A;  1EUV B;  2IO0 B;  4WWN A;  2NS5 A;  1LM8 B;  3KYD D;  1PLS A;  1W1G A;  2N0Y A;  2LVO A;  3N32 A;  3DBS A;  2GJY A;  4IM3 A;  1OQN A;  1ZW7 A;  3KVF B;  2NMB A;  1OQY A;  3ZTC A;  3UIO B;  5CTR C;  1LB1 A;  1NI2 A;  1LXD A;  5IA7 A;  3CIK A;  3QQ8 B;  3HHM A;  4JKF A;  4GDK A;  2MBB B;  4K7W A;  4F7G A;  3QWM A;  4FLH A;  2KNB A;  2REX A;  4JKH A;  3VTV A;  4X57 B;  2YSZ A;  1WJM A;  1P0R A;  2KKC A;  1Q67 A;  2KFK B;  4DHJ B;  1PFJ A;  4ICU A;  4HAY B;  1WF9 A;  3RUL A;  1FB8 A;  3KZ1 A;  4MEM A;  4IWQ A;  4MGZ E;  2D11 A;  3T06 A;  1P1A A;  2EMT A;  1QZE A;  2L76 A;  1WX8 A;  2R09 A;  1WMH B;  2L00 B;  1MAI A;  3ZLZ A;  2L3Z A;  3UIP B;  2WH5 A;  1U4A A;  2HD5 B;  2Y7B A;  3APC A;  4ZYN A;  3GYO A;  2RPQ A;  3A1Q B;  3L16 A;  2P0H A;  3SHQ A;  4K1R B;  3B08 A;  1MK9 B;  2YS3 A;  3W1Y A;  3QBV B;  1XQQ A;  5AZG A;  4KIK A;  4FBJ B;  4JK7 A;  3PRE A;  4GB9 A;  2WYQ A;  5JH5 C;  4D0N B;  1K5G B;  1LFD A;  2NVU I;  2PZ1 A;  3VIA A;  5C5B B;  2D3G A;  2YT0 A;  4GIV A;  3ZNG C;  3ML8 A;  3QK0 A;  3E9P A;  2YS5 A;  3AU5 A;  4A5K A;  1KZ7 A;  4BFR A;  2JT4 B;  1TZ1 A;  1IP9 A;  1WGQ A;  3IHP C;  3MHS D;  2CHZ A;  1WX9 A;  1WVH A;  2D07 B;  2MKR A;  1DYN A;  2N9P C;  3NZU A;  4IW0 A;  1TBE A;  1W1D A;  1B55 A;  5D3Y A;  2KX3 A;  2L8J A;  3ZUN A;  3DCG A;  4ZRJ A;  5D2M B;  3W1S C;  2N9X A;  4B9K A;  4B95 A;  3ZDM C;  1GJZ A;  5DCN A;  2COD A;  2ABD A;  4NNJ B;  4PYZ A;  1S3S G;  3ALB A;  2D9Z A;  4KSK C;  1FAO A;  2KJ6 A;  4DX8 A;  4KHA A;  1KC7 A;  3NSU A;  3PV1 A;  3VDZ A;  3V6E B;  3SBT A;  1TXD A;  2O6V A;  1ZSQ A;  1FHO A;  2LWP A;  4HAW B;  4GSW A;  4IOY X;  2DYM A;  4OVV A;  5JZE B;  3OJ3 A;  3ONS A;  3KYC D;  2J0K A;  2DX1 A;  2IZV B;  2DHJ A;  5IAA C;  2B3A A;  1X86 A;  1GC6 A;  3RT3 B;  2M14 A;  2KO3 A;  4PS8 A;  3SBG A;  1V5U A;  3L10 B;  1M94 A;  1X1F A;  1XD3 B;  4FJV B;  2LGY A;  4DBB A;  3QAQ A;  2L05 A;  2GBM A;  4KHB B;  3PTF C;  1ZKH A;  1UNR A;  1SIF A;  5D3V A;  1NDD A;  2BKR B;  3ULC A;  2ROZ B;  2XQN M;  1WGR A;  4JIO U;  3M3J A;  2ZZP B;  1Z2M A;  3A8Q A;  2KC1 A;  4W9H A;  4GDK B;  2RLO A;  3L13 A;  5GOW B;  4MK0 A;  3D8E A;  2Z0O A;  3FLV A;  3KRW A;  1H8C A;  1WJU A;  3F5R A;  1X05 A;  2HJ8 A;  2LXA A;  4E71 A;  3KRX A;  4GDL A;  2BF8 B;  3VH4 B;  1IPG A;  5DPR A;  3QC8 B;  1FOE A;  3QAR A;  3F0W A;  4HB4 B;  1E7U A;  1FHX A;  3JSV A;  4IM0 A;  1GGO A;  4AJY B;  2I5F A;  4F1S A;  1GUA B;  4WSF A;  2MBQ A;  1UD7 A;  2KJR A;  2X18 A;  3ULB A;  3ZRC A;  1KOT A;  4AJW A;  2UVM A;  5EDS A;  2HRJ A;  1V5M A;  4JK9 A;  2EJ8 A;  4FN2 A;  2OOB B;  2HE7 A;  2BWE S;  3OLM D;  5E6P A;  1PQS A;  1WGG A;  2XK5 A;  2COA A;  5BO4 B;  2C5L C;  2MWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...