2J0MA

Crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
329
Chain Sequence
b'GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Basis for the Autoinhibition of Focal Adhesion Kinase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 329
sequence length 329
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2j0mA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j0mA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2j0mA01
2C9WB 2XK5A 3TW1A 1ISNA 2ABDA 5KCVA 4Z2MB 1V5OA 1YIWA 1GNUA 2PJHA 1GC7A 1MPHA 3IVFA 5DCNA 2MBHA 4PS3A 1Q5WB 3PTFC 2RPQA 4JLCA 4W9LA 2UZSA 1LFDA 2DAJA 1GJZA 2YF0A 1WGDA 5D3XA 4PYZA 3W1SA 4TYZA 2I1KA 4KZ0A 2IYBA 2CQUA 5HE2A 2KHWB 1J8CA 2D2QA 3ALBA 4MSQB 3M95A 3L54A 3L10B 4K2PA 3UIPB 2BCJA 2J0KA 1KM7A 2MBEA 5JLJB 2CR5A 4MELA 3LJ3A 5C16A 2GBNA 2K8CA 4NAWB 4I6PA 3P6AA 3ZNZB 4WJ7A 2V4LA 3U7DA 2KCJA 3A1QA 4KVGB 2JRIB 1OTRB 2GJYA 4E71A 2HTHA 2OJRA 2FCSA 3JSVB 1U5DA 3QWZB 4IWOA 4MM3A 2AL6A 2G35A 3FP5A 3IBEA 1BTKA 2YVCA 4M8MA 1X86A 3L08A 2H7EA 3MDBC 3ZDTA 1X1MA 3MHSD 1AWEA 4KDLB 3MPXA 4GXBA 3LDZE 2LD9A 1U5GA 3SV1A 3T8MA 1UPRA 3GZNI 3A9JA 1H4RA 2LRWA 1EGXA 3CF6E 2K8BA 3ZO5B 2KUPA 3ML4A 4P7IA 4TQ1A 2DHKA 1H10A 2KJ6A 1FGZA 4ANWA 1P3RA 4AWJA 2Z0EB 4A6FA 2KQSA 2B3AA 3R66C 4HPLB 3PP2A 2ADZA 2DZIA 4A6HA 1UZXB 3N7CA 3OAWA 1FOEA 3ZUNA 3N32A 2V1YA 1X05A 2KOXA 4I6LB 3KYDD 2M4NA 3BY4B 2EC1A 3QQ8B 2N0YA 1MKEA 1LM8B 3KZ1A 2LASA 5C5BB 2KTRA 2KWCA 3A8QA 3HQCA 4GOCA 3O96A 2DLWA 2RR9A 3HK0A 4YONA 2ELBA 1UPQA 4KV2A 4D0NB 3K9OB 1ZKHA 1WH3A 4HK2A 1YD8U 3C0RB 5HKHA 4YL8A 2BYVE 1WX8A 4HDQA 2EJ8A 1WG7A 3ULBA 2O2VB 2OOBB 3B1LX 3KW5B 4C0AA 4HCPB 1WXMA 1XQQA 5HE0A 2K2JA 3PREA 1IRSA 2KZRA 3OLMD 1L2NA 2NPTA 2VKIA 4B6HA 3TJPA 4KZCA 2IFSA 4DHJB 5JHHA 1FB8A 2HE7A 3JW0X 1V5PA 1MK9B 3Q3JA 3VOQA 1NI2A 3PEGA 2LYDA 2M14A 2KC2A 2EMTA 3CIKA 1CMXB 2XQNM 4W9JA 4F1SA 1KLVA 1RAXA 5LXHA 3AULA 2RQ1A 3VAWA 2V76A 4IOYX 4W9IA 3ZLZA 2N1VA 2QKMA 2JP2A 1V81A 2C5LC 1Y8RC 2Z0DB 2MA9B 2DKQA 4W9GA 2MSED 2XEWA 3A9KA 2BYFA 3S2AA 1WFYA 3DVGY 3PZDA 1I2HA 4NQLB 3PSCA 4W9KA 2HD5B 2J7QB 2O6VB 4JQWC 3L17A 2IO0B 3TCAA 1QZEA 1F9JA 1WXAA 1Q67A 3ZW3A 1WVHA 2KK8A 4HAXB 1TTNA 3QWMA 5JHBA 2ZCBA 2DN6A 4FHKA 4IUMB 5D94A 4WVFB 2DHZA 3V61A 5J2RA 4W9DA 2QHOA 2LOXA 3QAQA 4FJZA 3M62B 4PYUA 2LGYA 2OQBA 5IAAC 3H7PB 3KYCD 2Z0OA 4CHKA 3LJUX 3SUZA 4NY0A 4KHOA 3P2BA 1W1GA 1EVHA 2DYNA 2DYOA 4HDOA 2KJHB 3TVVA 3PRMB 2MP2A 2MDXA 5JP4A 3X23A 4BFRA 2COCA 1U29A 4KHBB 1TBEA 3KY9A 5J3YA 2M17A 4FBJB 5IJMA 2WWZA 2J0JA 1YQBA 3HHMA 3DVNV 1OMWA 4GDKA 3TIXA 3WA0A 2D4QA 1WGRA 4JIOU 4DDID 1DDVA 4NAWA 5DPSA 4FHJA 1WGUA 2I5CA 1WZ3A 2FAZA 3CSTA 2FJ9A 1P3QU 2KC1A 2M1MA 3ECIA 2DX1A 3VQIA 2DKPA 3WALA 4F7HA 3EHVA 5AEKB 3DVNU 1N3HA 2EMSA 2LULA 4Z2NA 3PLUA 1T0YA 2DYQA 5DIFB 2RGNB 4ZRIA 1OEYJ 2MCNB 4XC2A 4MK0A 1UD7A 2L1CA 3A98B 2DFKA 2YS5A 2AWTA 5J17A 3H6NA 2MWSB 1E8ZA 4OVUA 3VHTC 3KVFB 3RT3B 3PSEB 4OVVA 5L81A 2VRWB 1OEYA 2EKEC 4MJSA 2RGFA 3K9PB 1LXDA 2ZNVB 3RULA 2V3SA 4G11A 5C1ZA 3UF8A 4HAUB 5AZGA 1L7YA 4NJ6A 4HCNB 4A3PA 3NY5A 4BKGA 3DPDA 2LUEA 5LLIA 2NZ8B 1DBHA 4MGYE 2KLGA 4GDLB 2KLCA 3AU4A 5C5BA 4J6IA 2KFKA 4X57B 2YS3A 5C6RA 1Z5SB 1V88A 5GOWB 3RZWC 2KANA 2GOWA 5CHFA 1V2YA 1R4NI 4K1RB 4HLEA 4HHVA 2CS4A 3HM3A 4HB4B 3SHQA 5LXIB 2D9WA 2ELAA 3L0WB 2LGDA 3WIMA 4EOYA 3A33B 4KIKA 5D27A 1B55A 4GMVA 4GZUA 3QHTA 3NZUA 3M63B 2J59M 2PE9A 3QJZA 4PS8A 1ZM0A 2AL3A 1J0GA 4BVUC 3VTWA 5D3YA 5J18A 2ZZPB 2KMCA 3N30A 1K5DB 3U30A 3DBRI 2KN5A 3KUCB 1E8XA 4CYEA 1WX9A 2COPA 2RNRB 5CLLB 2N9EB 2KFJA 3PGEA 1U5EA 1RLFA 2KVRA 3DCGA 2KXJA 4HB3B 3BINA 5CLQB 2D07B 2N7DA 2CAYA 3PRZA 2KWVB 2NMBA 3VH3B 4F7ZA 1U27A 2K6DB 4HAVB 3ZVVA 1XD3B 4EUTA 4LDTD 4HVBA 2IO1B 3NSUA 5D3WA 1I42A 3AU5A 4F8CB 4LDTB 2Z0QA 2KGXB 1W1DA 2NBVB 4CHJA 4FULA 1U2BA 2JT4B 3QK0A 3PRPB 2FCQA 2AEHA 4K2OA 5D2MB 2KKCA 2CODA 2N1WA 1X1FA 4W9CA 2YSZA 3GYPA 3RCZA 1ZW7A 5GMVA 3CSFA 2D9YA 5E6OA 2DAFA 2IYDB 4KDIC 2D11A 1AQCA 1ZC4B 3UQAA 3IFWB 3R7QA 2KX0A 2CHXA 1X1GA 1Y5OA 3QA8A 4B95A 5G55A 2K00A 3UGBB 1E8WA 5JHAA 2LXAA 1V61A 2JZZA 3FSSA 2KQ7A 4DX90 4HWIB 2PPHA 4F7GA 4LJPB 2WH5A 4EEWA 1GC6A 2DZKA 2FCMA 4W9EA 1LQBA 3PS6A 3I3TB 5HE3A 3PPAA 3SNHA 3R3MA 1WY8A 2M0XA 1KZ7A 1J19A 4ANUA 3PV1A 2W2WA 1G6JA 3A4SC 2D3GA 3B0AA 1X11A 1SHCA 4IM2A 4GSWA 3HW2B 2GMIC 3SDLC 1TGZB 4WJOA 3D32A 1Q0WB 2NBWB 2KDEB 4RM8A 3EPYA 4GGQA 4EZLA 4TKNA 5D3VA 5JHGA 2GBRA 2IO3B 1XODA 1XR0B 3V60A 4IM3A 3EFUA 3TMPB 1XKEA 1M7EA 4DHJD 3R7RA 2ZCCA 3VDZA 3L16A 2WDTB 1HB6A 3L13A 2RVBB 5EDSA 3ODXA 2DX5A 4HAZB 5TR5A 3ZIMA 2R09A 1NU2A 1H8CA 2NR2A 3TL5A 2DZMA 4FJYA 2KDIA 2LKOA 4HAYB 2KDFB 3D8DA 5JH5C 4WWNA 2Y5BB 2GBJA 1I7AA 2FUHB 1WJ4A 4K7UA 4BKSD 4G0NB 4ANXA 2O6VD 1AARA 4WJQA 2DYMA 1WF9A 1P5TA 3ODWA 4WWOA 3KRXA 1TJ6A 1WIAA 3A1QB 1E8YA 2K2UA 1UH6A 2RD0A 2NBUA 2JZ3B 3ENEA 2IBIB 1E7UA 1P0RA 1OGWA 3NOBA 3U8ZA 1E7VA 3DQVA 3H9DA 2G3QB 3GOEA 1SGHA 4E74A 5IA7A 2UWQA 2LJ5A 4DK5A 4GB9A 2LGXA 2FIDA 1HE8A 4BOSC 2FJLA 1EO6A 2ZNVC 5CTRC 2G4SA 2K6QA 3A9JB 2OTXA 3UINB 3QC8B 4DWFA 2COAA 2BKFA 4TQ0A 5CX3A 4CHMA 2P8VA 4WWPA 4URKA 5DPWA 5LONB 1Z87A 3QX1A 2HJ8A 5EFXA 4AOFA 1V5TA 2W2XC 2DHIA 4A6FB 3DOWA 3MTNB 2JF5A 5J3QA 4JGHB 2G45B 3WYFB 3VUYA 2A5UA 3PG7A 2IO2B 4MH0E 5DPTA 3AXCA 5KHOA 2K25A 3VFKA 3PVUA 2LVOA 3VH4B 4A5KA 1P6SA 2KD0A 2ZEQA 1WR6E 3CMMB 4IWPA 4IM0A 4MGZE 1BAKA 1XD4A 1ZGUB 5DI9B 4RMAA 2FIFA 4DXAB 4I6NB 2ZPNA 3PHWB 4Y94A 1ZVRA 1Y19B 2P0HA 2LVPA 5G2NA 5KHQA 2KO3A 2PZ1A 2JRHA 1RRBA 4EFOA 3JSVA 5E6NA 3NS8A 4ICUA 4NSWA 1NVLA 3A4RA 1DROA 1GG3A 1ACAA 3KUDB 2R2QA 4HJKA 1WI1A 1EF1A 3VUXA 2NPTB 3FEHA 2MBOA 3PLVA 2BPSA 1WXVA 2VSZA 3D8EA 2E2XA 1WI0A 3T06A 2M8SA 3V6EB 2FDQA 3APDA 3P7ZA 2I5FA 3H1UA 3GYOA 3IG3A 3DXEA 1P9DU 2UZRA 3CXBB 3WAOA 2GS0A 2W2XD 4IG7B 4FADA 2GCJA 3V6CB 4ZDVA 2JXXA 3A9KB 1MIZB 1FHXA 2JPHA 3ZNHB 1UNPA 2JWZA 3ML8A 1NTIA 2C60A 2DTCA 2K39A 1BT0A 1V5UA 1KI1B 2MW5A 4IFSA 2RSGA 1V49A 2M38A 2N7EA 2RLOA 4HB2B 4RM9A 2L0FA 4EKUA 2D9VA 4IWQA 3TO1A 1UELA 4ASWC 1WM2A 4WJNA 5LOPB 1FXTB 3NHEB 1FHWA 3RCPA 2CHZA 4HPMB 4TV3A 3V62A 1XX0A 4AUQC 4W9HA 1JRUA 3ZKJC 1S3SG 1SIFA 1DDWA 2KJRA 1E90A 2O2VA 4XWXA 2WYQA 1WGYA 2W9NA 4BBKA 1PFJA 3PVWA 5FI0A 2LBBA 3ZTDA 2LWPA 2N9PC 1WJUA 1P1AA 1V9JA 1YJ1A 1PLSA 2DZJA 5E6PA 2J0MA 2C7MB 2KMAA 5C79A 1MG8A 1WMHB 4XZ4A 4KAXB 2BWFA 2MP2B 1YX5B 3G9WA 2RSUA 5HE1A 2A4ZA 2KWUB 1QC6A 2Z59B 1RFAA 4ICVA 3ULCA 2DYBA 1UBQA 1IYFA 2YS1A 2BKRB 5DPRA 3DBHI 1E5WA 4GDKB 2KDBA 3NZSA 4A3OA 4G50A 1NTYA 4NQKE 2YRYA 3FM8C 3ZVRA 4NNJB 4CO7A 4A6KA 1MAIA 1XCGA 1SE9A 2UVMA 3OJ4B 4BKSA 1EUVB 3X0WA 1WGHA 3M3JA 4WQOB 2O6VA 2I1JA 4AJYB 3SD5A 2Q13A 1K8RB 3SU8X 4EZJA 2KX3A 4FN2A 4EJNA 1OY2A 1YX6B 3APFA 2LRUA 2N23A 5DHAB 4FA6A 4K81A 3V5WA 4G3XB 2IZVB 5DHFB 1HBKA 1P98A 5D6JB 2BF8B 3VVWB 4DBGA 3W1SC 2N9XA 4BOZB 2L3ZA 1WX7A 4L6EA 2ZVNA 1Z2MA 2CU1A 2ROVA 4BBNC 1LW3A 3B08A 2YT0A 4MT7A 1WRDB 3H7PA 3ODOA 2CY5A 4F7UP 3DVGX 4EMOA 4MJSB 3D8FA 4DHZE 3BJIA 4DX8A 2MFQA 1ST7A 3DXDA 1V6EA 3RYTA 2WX1A 4EZKA 1RRPB 3OANA 1U4AA 5JZEB 4BBNF 2QKLA 1NTVA 2IY1B 1WZ0A 3H7SA 2LI5A 4PQ0A 2HRJA 5AZHA 3F0WA 2MBBB 2IY0B 4M0WB 1MIXA 4LJOB 3FLVA 4XX5A 1C3TA 4LCDE 5FI1A 2LXCA 2R0DA 1VCBA 1WJNA 4HB0B 2KFKB 4BKTA 3PVLA 4NJ7A 4ANVA 4FJVB 1WXSA 5L83A 3WAPA 2CHWA 2L00B 4N9F4 3N3KB 2XK5B 4PS7A 2BGFA 5BO4B 2P0DA 1UEFA 3ZRCA 2L05A 4H8SA 4ZYNA 4A20A 2D9XA 1WJ6A 2R2OA 3SO6A 1EF5A 2P0FA 3QBVB 2C7NB 4MGKE 4HATB 1K5GB 2LG1A 2ZJDA 4MEMA 4KIKB 4K7SA 1TQZA 1OQNA 4K17A 2Z0PA 4II3B 4B9KA 3HM6X 3ZRFA 2CKHB 4IAPA 3DXCA 3ZDMC 2DA0A 1VD2A 3PT2B 2Y7BA 1WJ1A 1LB1A 2BYEA 1DYNA 2UYZB 2JVCA 2Y8GA 2D10A 3T9LA 2MWNB 2MX2A 2GBMA 2LZ6A 2JY6A 3APCA 1NDDA 3UZTA 2FNJB 1DDMA 2BWES 4KHAA 1TXDA 4DDGD 5AZFA 4MGIE 1FHOA 2L7RA 2CB8A 2HTHB 3DDCB 4IW0A 4DBBA 1I35A 1R4MI 1XT9B 4FLHA 4B6WA 1FAOA 4GDLA 1QQGA 3VXWA 1IPGA 1EAZA 2CRFA 5DH9B 2ASQA 2KNBA 1WM3A 3QIJA 2K1FA 3QARA 1UGMA 4MSMB 5CHVC 4GN1A 1TZ1A 1S1QB 3KH0A 1RJ2A 2XBBC 4DHZB 4WSFA 2CY4A 4HAWB 3TFMA 1KZGA 1WGQA 1UNRA 3M1IB 5KQ1A 2COFA 2VRRB 3AJ4A 3RD2A 4WJPA 4JL9A 1OQYA 4TUUA 3EC8A 3QCAA 2GCLA 1FGYA 1WYWB 2G4DB 2ZVOA 4HXDA 1WE7A 2N4FA 1PQSA 3AI5A 4GMXB 2MLBA 3KSYA 5L95C 3MJWA 1V5MA 3SYXA 1A5RA 1WMHA 4GPTB 1C1YB 4KSLC 2LVQA 2DHJA 2LOZA 1J0WA 3ZTCA 5C23A 1W1HA 2AYOB 1ZC3B 3RUIB 5J3TA 2NS5A 4ZRJA 4K7WA 2KTRB 1V89A 2WX0A 3ZNID 4KSKC 1WE6A 1BTNA 2GBKA 3TBLD 1WR1A 2MKRA 4NPNA 3VTUA 2L2IA 2X18A 2NCNA 2ZPYA 2Y8FA 2D9ZA 2L76A 1D3ZA 3VTVA 5CHWA 1ZSQA 3OJ3A 1V86A 1WJMA 1NBFC 5D7GA 3UQBA 3Q3FA 4M8NA 3KUZA 2JUOA 4E3CA 3JYUA 2K8HA 4AP4C 1M7RA 1U5FA 2DX5B 4WAAA 1WGGA 1HB8A 4GIVA 5KQ4A 4MDKE 2L0TA 2PEAA 3EECA 1IP9A 1UBIA 2ROZB 2C7HA 4PNKA 3A8PA 2MBQA 1UNQA 4GU2A 1PMSA 3JVZX 3W1YA 2PE6B 3VIAA 2KTFA 3HIZA 3VUWA 3UIOB 3DBLI 4II2B 3KRWA 4AJWA 2FCNA 2H7DA 1MK7B 5FR6A 3ZNGC 2L8JA 3ML9A 2YLMA 1V80A 3IHPC 3ONSA 3WANA 4IC7B 3WAMA 2MRPA 1KJTA 3O65B 2YT1A 1Q1OA 2DENB 2RUKB 3PHXB 1BWNA 1M94A 3DBSA 2MQJA 4ZRKA 3F5RA 4W9FA 3RZFA 1GUAB 2REXA 1KOTA 4MY6A 2NVUI
chains in the Genus database with same CATH superfamily
2C9WB 5EE1A 2XK5A 3DBLB 3TW1A 3Q8CA 3ZJTA 1ISNA 2ABDA 1CK1A 5BYRA 2HTME 3AEDB 5KCVA 4Z2MB 1V5OA 1YIWA 1GNUA 2PJHA 1GC7A 1MPHA 3IVFA 5DCNA 1C76A 3W5UB 1HTOA 2NMQA 2MBHA 1OQRA 4PS3A 1Q5WB 1BXTA 3PTFC 2RPQA 5D3IB 4D6WA 4JLCA 4W9LA 3FILA 2UZSA 1LFDA 1LGRA 2DAJA 2MH7A 1GJZA 3P42A 2YF0A 1WGDA 2G1EA 3NW8A 5D3XA 4PYZA 2WXIA 1FMAD 3W1SA 3IAS1 4TYZA 2I1KA 1ESFA 4KZ0A 2IYBA 2CQUA 1FNVA 5HE2A 2KHWB 2VH2A 1J8CA 2D2QA 3ALBA 4MSQB 1L6VA 3M95A 2FE8A 3L54A 3L10B 4K2PA 5IO9A 3UIPB 2BCJA 2J0KA 5GXGB 1PYWD 4AS1A 4S0RA 1KM7A 3FAHA 5BYQA 2MBEA 5JLJB 2CR5A 4MELA 2BQQA 2LJIA 3LJ3A 5C16A 2GBNA 2K8CA 4NAWB 4I6PA 3P6AA 3ZNZB 4WJ7A 2MHJA 2WU2B 1UUPA 2V4LA 3U7DA 2KCJA 1C78A 1I4HA 3A1QA 2V9HA 4KVGB 2JRIB 1OTRB 2GJYA 2WXGA 4E71A 1PGXA 2HTHA 2OJRA 2FCSA 3JSVB 4NJCA 5LNK1 3BVGA 1U5DA 1N5XA 2PIAA 3QWZB 4IWOA 4MM3A 2AL6A 2G35A 1YJJA 3FP5A 3IBEA 1BTKA 2YVCA 4M8MA 1X86A 3L08A 2H7EA 3SFEB 3MDBC 2WXJA 3C8YA 3ZDTA 1X1MA 3MHSD 3DBHB 1AWEA 4KDLB 4REZA 3MPXA 4GXBA 3LDZE 2LD9A 2Z8LA 1U5GA 3SV1A 2G9HD 1UPRA 2QC8A 3T8MA 3GZNI 1YN3A 1K51A 3A9JA 1H4RA 2I38A 2K49A 2E6XA 1UGJA 4D2KA 2LRWA 1EGXA 2K8BA 3CF6E 3FVCA 3ZO5B 2KUPA 3ML4A 1WYGA 3GS2A 4P7IA 4JK9A 4QAYA 1MFWA 2DHKA 4TQ1A 3RNAC 3SBTA 1H10A 1JWMD 2KJ6A 1FGZA 2BVCA 4ANWA 1P3RA 5HFYA 4AWJA 2NTTA 2Z0EB 4A6FA 5BMGA 1FXAA 2KQSA 1N6ZA 1V1PA 1M4VA 2B3AA 3R66C 4HPLB 3PP2A 3DHIC 1XLOA 2ADZA 1T0QC 4A6HA 2DZIA 1L4ZB 1K50A 4KGTA 1UZXB 1TJEA 2IJ0A 3N7CA 3B2GA 3OAWA 1FOEA 1TKGA 3ZUNA 3HVZA 1L4DB 3N32A 2BB5A 1RYJA 2V1YA 2YT2A 1X05A 2KOXA 4EE2A 4I6LB 4ZHPA 2M4NA 3KYDD 3BY4B 2EC1A 3IT6B 3Q3MC 3QQ8B 2QJLA 2N0YA 2JWUA 2QDFA 1MKEA 1LM8B 3GP7A 3KZ1A 4OZBA 2LASA 3PZ8A 5C5BB 2MJEA 2PMVA 2KTRA 2KWCA 3A8QA 3HQCA 4GOCA 3O96A 2DLWA 2RR9A 2WXNA 1VJKA 2GRIA 3HK0A 4YONA 2ELBA 1UPQA 4KV2A 4D0NB 3AE4B 2VZKD 3K9OB 2WXPA 1ZKHA 3LXFA 4YSZB 1WH3A 4HK2A 1TS4A 1YD8U 2BB6A 3EFCA 3C0RB 5HKHA 2PVGC 4YL8A 2BYVE 4RFBA 1WX8A 4HDQA 2EJ8A 4CQNA 1WG7A 3ULBA 1QOBA 2O2VB 2OOBB 4KKIA 3P4SB 3B1LX 4M01A 3KW5B 3Q8FA 3C19A 1RFKA 4C0AA 4HCPB 1WXMA 3N1XC 1XQQA 5HE0A 4RGMA 2KR0A 3SFDB 1B9RA 2K2JA 1FEHA 3AE3B 1E6EB 3PREA 1IRSA 3KWLA 2BTEA 2KZRA 4YTMB 3OLMD 1L2NA 5G5GA 2NPTA 2VKIA 4B6HA 2IPKD 3TJPA 4KZCA 2IFSA 3NVVA 4DHJB 2YEPB 5JHHA 3Q2AC 1FB8A 2HE7A 3JW0X 1V5PA 2KACA 1MK9B 3Q3JA 4HROA 3VOQA 1JWBD 1NI2A 1ET9A 3PEGA 2QEJC 2LYDA 2WXRA 2M14A 1QT9A 2KC2A 3CIRB 3TSSA 2EMTA 3CIKA 1FIQA 1CMXB 3MHZA 1ZPSA 2XQNM 3DWGC 4W9JA 4JKGB 4F1SA 2ACZB 2L32A 2R61A 1KLVA 1RAXA 3E9PA 5I2SA 5LXHA 3AULA 3EUB2 3P4QB 4JWUC 4UDUC 2RQ1A 3VAWA 2V76A 5E6JA 1C79A 2QIEB 4IOYX 4W9IA 3ZLZA 2N1VA 2QKMA 2JP2A 1V81A 4US9A 2C5LC 1Y8RC 2Z0DB 4QXAB 2DKQA 2MA9B 1IBXA 4W9GA 2R2YA 2MSED 2XEWA 4YSXB 3A9KA 2BYFA 3S2AA 1WFYA 3DVGY 1F0ZA 3PZDA 1I2HA 4NQLB 3PSCA 2N0SB 4W9KA 2BW2A 4DIXA 1XXGA 2HD5B 1SJHD 4ZRPA 2J7QB 2O6VB 4JQWC 1SSNA 2IO0B 3IXSA 3L17A 4HRSA 3TCAA 4YTNB 3AEAB 1QZEA 1F9JA 1WXAA 1TY0A 2DIKA 1Q67A 2J42A 3ZW3A 3E66A 1WVHA 1QF6A 2KK8A 4HAXB 3EA6A 3P4RB 4IKGA 1TTNA 3I9V1 3QWMA 2W54A 5JHBA 2ZCBA 4LTUA 3NG0A 2DN6A 4FHKA 3HVDA 4IUMB 5D94A 4WVFB 2DHZA 3V61A 5J2RA 2WS3B 2KT7A 4W9DA 1XEEA 1XCQL 1GOZA 2QHOA 2LOXA 3QAQA 2WDRB 4FJZA 3M62B 4PYUA 2LGYA 2OQBA 5IAAC 4ARCA 3H7PB 1FCLA 3VR9B 3KYCD 4LNNA 2Z0OA 2AQ2B 4CHKA 3LJUX 3SUZA 4NY0A 1YN5A 1ZOYB 4KHOA 1R4MB 2KWDA 3P2BA 1W1GA 1EVHA 2Z4DA 2DYNA 2PW9A 2DYOA 4P16A 4HDOA 4ARIA 2KJHB 4P6VF 3TVVA 2WXMA 3PRMB 2MP2A 2MDXA 5JP4A 4HSIA 3X23A 1EWYC 1K52A 1N61A 2Z59A 4BFRA 4ZHOA 2COCA 1U29A 3P1MA 4KHBB 3NWAA 1TBEA 3KY9A 5J3YA 2M17A 4FBJB 5IJMA 2WWZA 1UWMA 2J0JA 1YQBA 3HHMA 3DVNV 1OMWA 1FFVA 4GDKA 3TIXA 3WA0A 2D4QA 1XO3A 4P1CC 1VZ7A 1WGRA 3AEBB 4JIOU 4DDID 1DDVA 5FR3A 3W2DA 3ENBA 3NWFA 1KC7A 4NAWA 2V4IB 5DPSA 2J4XA 4FHJA 2Y5CA 4WQMA 1WGUA 2I5CA 1WZ3A 3BVMA 2FAZA 2BS4B 2JYTA 3CSTA 2FJ9A 1P3QU 2KC1A 2M1MA 4PT5A 3ECIA 2DX1A 3VQIA 4N59A 2DKPA 2K9XA 4F7HA 3WALA 2JX5A 3LYYA 3EHVA 1RWSA 5AEKB 3DVNU 1I7HA 1N3HA 2EMSA 2LULA 1GAQB 4Z2NA 2LUMA 3PLUA 1YN4A 1T0YA 2DYQA 5DIFB 2RGNB 3R2TA 2ONQA 4ZRIA 1OEYJ 2MCNB 2WQYB 4XC2A 4MK0A 3VRBB 1MPEA 1UD7A 1MI1A 2L1CA 2DNFA 2ZW0A 3A98B 2DFKA 2YS5A 1SE2A 2AWTA 5J17A 2KVZA 4J3OD 1JW9D 3H6NA 2GB1A 2MWSB 1E8ZA 4OVUA 3VHTC 1UNSA 1DOYA 3KVFB 2XN9C 3PSEB 3RT3B 4OVVA 5L81A 1DYQA 2VRWB 1OEYA 5IOIA 4JX1C 2EKEC 4MJSA 2RGFA 3K9PB 1LXDA 1C77A 3O13A 2ZNVB 3RULA 2V3PA 1R7SA 5D3DA 4JKBA 4LLGM 2V3SA 4M00A 5IN7A 2IGGA 1TIFA 4G11A 4WIPA 5C1ZA 3SR6A 4HAUB 5AZGA 3UF8A 4LNFA 1L7YA 4NJ6A 3B77A 4HCNB 1D5ZC 2GUMA 4A3PA 3NY5A 4BKGA 3DPDA 2LUEA 1DGJA 5LLIA 3TUOA 1KTKA 1PGBA 2HDEA 2NZ8B 4CSQA 4M0WA 1P7EA 1DBHA 2CJNA 2WXLA 3HRDD 1TS5A 2JQRB 4MGYE 2BBCA 1MI0A 3ZXVA 1TKEA 1GB1A 3AE8B 2KLGA 4GDLB 2WHIA 1V97A 2KLCA 3AU4A 5C5BA 4J6IA 2WDVB 2KFKA 2KN4A 2Q5WD 2WU5B 4X57B 2YS3A 2I2YA 2OEDA 5C6RA 1Z5SB 1V88A 2FUG1 1YNTE 5GOWB 3RZWC 2KANA 3UI3A 2GOWA 1N63A 1VZ6A 3L4PA 4XDCA 1V2YA 5CHFA 1R4NI 4K1RB 4HLEA 4HHVA 2CS4A 3HM3A 4HB4B 3SHQA 5LXIB 2D9WA 2ELAA 3L0WB 2KAJA 3Q8AA 2LGDA 3WIMA 4EOYA 4HPPA 1I4GA 3TEZA 3A33B 4KIKA 5D27A 1B55A 4GMVA 2B76B 4GZUA 3QHTA 3NZUA 3BK1A 3M63B 2J59M 2PE9A 2IGDA 1D6EC 1XCTL 3P4PB 3QJZA 4PS8A 1ZM0A 2CJOA 2AL3A 3BK2A 3I5JC 1J0GA 4BVUC 3HIEA 4L1RA 3VTWA 1QOAA 5D3YA 2WXOA 5J18A 2ZZPB 2KMCA 3N30A 5IKCM 1K5DB 4KKJA 1EM7A 3U30A 4JKGA 4B0MA 3DBRI 2KN5A 3KWVA 1R4NB 3KUCB 1E8XA 4CYEA 1F52A 1WX9A 2RMMA 3AN1A 2COPA 2PKOA 4HKZE 2RNRB 5CLLB 2N9EB 2KFJA 3PGEA 1I4RA 1U5EA 1RLFA 2KVRA 3DCGA 2KXJA 4YSYB 4HB3B 3BINA 5AUIA 1WWTA 4L23A 5I4DA 5CLQB 2D07B 2N7DA 2CAYA 3PRZA 2KWVB 1SIJA 2NMBA 3VH3B 4F7ZA 1U27A 1QLBB 2GLSA 2K6DB 4HAVB 3ZVVA 1XD3B 3OWEB 4EUTA 4R3DA 3AH7A 4LDTD 4HVBA 1T77A 4XGAB 2IO1B 3NSUA 5D3WA 1I42A 1IGCA 3BIID 3AU5A 3AE5B 2EKIA 4F8CB 4LDTB 2Z0QA 2KGXB 4JKDA 4ZOHC 1W1DA 2NBVB 4CHJA 4JKHA 4FULA 4XWTA 1U2BA 2JT4B 3QK0A 3PRPB 2FCQA 2QSDA 2KMMA 2AEHA 4K2OA 3AV8A 5D2MB 2KKCA 2CODA 2N1WA 1X1FA 4W9CA 2YSZA 3GYPA 3RCZA 1ZW7A 5GMVA 3CSFA 2D9YA 5E6OA 1SE4A 2DAFA 2IYDB 4KDIC 2D11A 1I4PA 1JQ4A 1AQCA 1ZC4B 3UQAA 3IFWB 3R7QA 3RI7C 2DLBA 2KX0A 2YEPF 2CHXA 1X1GA 4YTPB 3Q8BA 1Y5OA 3QA8A 1HXYD 4B95A 1WSPA 5G55A 2RDHA 4ZRQA 2K00A 3T3OA 3UGBB 1E8WA 5JHAA 3Q14C 2LXAA 1V61A 1E9MA 5JVLA 2JZZA 4O1NA 4WAFA 3FSSA 2KQ7A 4DX90 2QCZA 1RM6C 4HWIB 2PPHA 1FRDA 4F7GA 4LJPB 2WH5A 4EEWA 1GC6A 2DZKA 2FCMA 3E56A 4W9EA 1LQBA 3PS6A 1ET6A 3I3TB 5HE3A 3PPAA 3SNHA 3R3MA 1WY8A 3GZNB 4XYCA 3RNGC 4KHBA 4HKQA 2M0XA 1KZ7A 1WGKA 1J7CA 1J19A 4RGNA 4ANUA 3PV1A 2W2WA 1XF5L 1BUIC 1ZE3D 1G6JA 3KLSX 3A4SC 1JROA 2ZW1A 2D3GA 3B0AA 4MH8A 1CJEA 1X11A 1SHCA 4IM2A 2AQ3B 4GSWA 3HW2B 2GMIC 3SDLC 4YWGG 4LNIA 1TGZB 4WJOA 3D32A 1Q0WB 2NBWB 2KDEB 4HJGE 1YOVB 4RM8A 1JMLA 3EPYA 1I4QA 4GGQA 4EZLA 4TKNA 5D3VA 5JHGA 2GBRA 1ZXHA 2IO3B 1XODA 1JWAD 1XR0B 3V60A 4JKCA 4JK8A 3GE8C 4IM3A 3EFUA 3TMPB 2H89B 1XKEA 2M0AA 1HA5A 3AMZA 1M7EA 4DHJD 2ZCCA 3L16A 3R7RA 3VDZA 4US8A 2WDTB 1HB6A 2J52A 4GLSC 3L13A 2RVBB 5EDSA 1L6UA 3FILB 3ODXA 2DX5A 4HAZB 5TR5A 1YQ3B 3ZIMA 1I4XA 4TMAB 3NRZA 3TEYA 3U52E 1MG4A 2R09A 1KLUD 1NU2A 1H8CA 2NR2A 3TL5A 2DZMA 4FJYA 2W82A 3HUIA 2KDIA 2OHFA 4S17A 2LKOA 2N9LA 4HAYB 2KDFB 2XNAC 3CWIA 3D8DA 5JH5C 1KLGD 1VZ8A 4WWNA 2Y5BB 4JWSC 2GBJA 5M4YB 1I7AA 2FUHB 1WJ4A 4K7UA 4BKSD 4G0NB 4ANXA 1K53A 5EE3A 2O6VD 1AARA 4WJQA 2DYMA 4A90A 2LGIA 1VR9A 1WF9A 1P5TA 2MJDA 3ODWA 4WWOA 3NS1A 3GB1A 2L83A 3KRXA 1TJ6A 4H2AA 1WIAA 3A1QB 5HHDG 1E8YA 1CQVA 2K2UA 1UH6A 2RD0A 5FKAC 2RRFA 1PUTA 2NBUA 2JZ3B 3AE7B 2KIEA 3ENEA 2PVOD 3E9SA 2IBIB 3NVWA 3PZ7A 1E0ZA 1E7UA 1P0RA 2LFIA 1OGWA 1EWCA 3NOBA 3U8ZA 1E7VA 1T0SC 3DQVA 3H9DA 4MM3B 2G3QB 3GOEA 1SGHA 4E74A 4OVZA 4WURA 5IA7A 4QJ4B 4GNKB 1WRIA 2UWQA 4LNKA 2LJ5A 4DK5A 4GB9A 2LGXA 5I2MA 3BVZA 2FIDA 1HE8A 1D4BA 4BOSC 4ACFA 2FJLA 1EO6A 2ZNVC 2Z13A 5CTRC 1L0XB 2G4SA 3WCQA 2K6QA 3A9JB 2OTXA 1XLNA 2AX5A 3UINB 1NYRA 2PTLA 2MJ3A 3QC8B 4DWFA 1NEKB 1FFUA 2COAA 2BKFA 4TQ0A 1KBLA 2ON8A 5CX3A 4CHMA 2P8VA 4WWPA 2X0SA 4URKA 5DPWA 5LONB 2BYTA 1Z87A 3QX1A 1Y56A 1PGAA 2HJ8A 5EFXA 1TKYA 3IT4B 4AOFA 1V5TA 2W2XC 2DHIA 4A6FB 1QQRA 1L0YB 3DOWA 3MTNB 1V1PB 2JF5A 1FCCC 5J3QA 4JGHB 2BT6A 2G45B 4DQOC 3WYFB 3VUYA 1JRPA 4C56C 3MP9A 2A5UA 3SBGA 3PG7A 1TYGB 2IO2B 4MH0E 5DPTA 4ILJA 4TSSA 1AWDA 3AXCA 5KHOA 2K25A 3VFKA 3PVUA 1T0RC 2LVOA 2WXQA 3VH4B 3OG5A 5IP4D 4A5KA 1P6SA 1QKZA 2KD0A 2ZEQA 1WR6E 3CMMB 1SBBB 4IWPA 4IM0A 2GI9A 4MGZE 1BAKA 3MC8A 1XD4A 1ZGUB 5DI9B 3RNCC 4KGSA 4WWMA 4JKEA 4M02A 4RMAA 2FIFA 4DXAB 4QJ5B 4I6NB 2ZPNA 3PHWB 1J7BA 1KH0A 4Y94A 3VRAB 1ZVRA 1IUEA 1Y19B 3BYTB 2P0HA 1OFFA 1TT5B 2LVPA 5G2NA 5KHQA 2KO3A 2WXKA 2PZ1A 2K8EA 2JRHA 1V8CA 1RRBA 4EFOA 2HJ1A 3JSVA 5E6NA 1QOFA 3NS8A 4ICUA 4NSWA 3NUHB 5JXVA 4BAXA 1NVLA 3AEEB 3A4RA 3RNEC 1DROA 2K5PA 4IOIE 4A55A 1GG3A 2NBVA 1E7PB 1VBGA 1ACAA 3KUDB 2R2QA 4HJKA 2WXFA 1WI1A 4ILHA 1EF1A 1SB3C 3VUXA 2NPTB 3FEHA 1D5XC 2MBOA 1F2RI 4ITKA 3PLVA 3I57A 2BPSA 2RDBC 1WXVA 4LK0M 2INPE 2VSZA 3D8EA 2E2XA 1WI0A 3T06A 1PDXA 1KRHA 2M8SA 3V6EB 1DOIA 3HSAA 2FDQA 3LB8C 3APDA 1L5PA 3P7ZA 2I5FA 3H1UA 3GYOA 3IG3A 2Z14A 2M56B 3DXEA 2H88B 1P9DU 1D5MC 2UZRA 3CXBB 3DHHC 1Q10A 3WAOA 2GS0A 2QILA 2W2XD 4IG7B 4FADA 2GCJA 2AQ1B 3V6CB 1IBXB 5LG4B 4ZDVA 2JXXA 2FJUB 3A9KB 1MIZB 1B1ZA 1FHXA 1PFDA 2WLBA 2JPHA 3ZNHB 1UNPA 2JWZA 3ML8A 1NTIA 2C60A 2DTCA 3NJTA 2K39A 4K3BA 1BT0A 1V5UA 1KI1B 3U2SC 2KQ4X 2MW5A 1SE3A 4IFSA 3AEGB 1HZ5A 2RSGA 1V49A 2K22A 2M38A 2N7EA 2RLOA 3TEXA 4HB2B 2INNE 2OJWA 4RM9A 2L0FA 4EKUA 5HG2A 2D9VA 4IWQA 3TO1A 3B2FA 1SXTA 1UELA 4ASWC 1WM2A 4WJNA 4Q2JA 3IAM1 5LOPB 1JWSD 2SAKA 1FXTB 3NHEB 1FHWA 3RCPA 5G5HA 2CHZA 4HPMB 4TV3A 3V62A 1XX0A 4AUQC 2X38A 4W9HA 1JRUA 3ZKJC 1S3SG 3ZYYX 1SIFA 1DDWA 2KJRA 2FBWB 1E90A 3MFGA 2O2VA 4XWXA 2ZKMX 2WYQA 1WGYA 2W9NA 1F1HA 4BBKA 3OHMB 1PFJA 3PVWA 5FI0A 2ICIA 2WGSA 1UF0A 2LBBA 5IRSA 4OSNA 2LWPA 2N9PC 3ZTDA 1WJUA 1P1AA 4XDDA 1C4AA 1DIKA 4C00A 1ROEA 1V9JA 3T3NA 4DXGA 1YJIA 4OT1A 1YJ1A 1PLSA 2DZJA 5E6PA 1VRAB 2J0MA 2C7MB 2KMAA 5C79A 1MG8A 3ZJVA 1WMHB 5BYSA 4XZ4A 4KAXB 2BWFA 3P63A 2MP2B 1YX5B 3G9WA 2RSUA 4C4VB 5HE1A 2A4ZA 2KWUB 2W3RA 1QC6A 2Z59B 1RFAA 4ICVA 3ULCA 1E10A 2NTSA 2DYBA 1UBQA 3NVYA 4WH4A 1IYFA 2YS1A 1QILA 2BKRB 2WP9B 5DPRA 3BWUD 2KYWA 3E9OA 3DBHI 1E5WA 4QJ3B 4GDKB 2R82A 2KDBA 5BMIA 3NZSA 3URYA 4A3OA 4RCOA 4G50A 1JALA 1HZ6A 1NTYA 1IGDA 1VLBA 4NQKE 2YRYA 3FM8C 2WNMA 3ZVRA 4NNJB 4CO7A 4A6KA 1SE9A 1MAIA 1XCGA 4A8XC 2UVMA 4C80A 3OJ4B 4BKSA 1EUVB 3X0WA 1WGHA 3M3JA 4WQOB 2O6VA 1FD6A 2I1JA 4AJYB 3SD5A 4A9AA 1MHXA 2Q13A 2KUQA 1K8RB 3SU8X 4EZJA 2KX3A 3ZXRA 4FN2A 4EJNA 4OW0A 1OY2A 1SJED 1YX6B 3APFA 2LRUA 2N23A 5DHAB 1WXQA 1GPXA 4FA6A 2DBYA 1TS2A 2BS2B 3Q3OC 1AYFA 4K81A 3E9LA 3V5WA 1OQQA 4G3XB 2IZVB 5DHFB 1HBKA 1P98A 5D6JB 4DXFA 3V05A 2BF8B 3VVWB 2WXHA 4DBGA 5H92C 3DBRB 3W1SC 4USAA 2N9XA 4BOZB 2L3ZA 1FRRA 1TY2A 1WX7A 1MJDA 4RNAA 4L6EA 2ZVNA 4BZAA 3N20C 1Z2MA 2CU1A 2ROVA 1JDEA 1NENB 4BBNC 1LW3A 3B08A 1SEBD 4C7YA 2E3TA 3U7ZA 1C9FA 2YT0A 4MT7A 1WRDB 3H7PA 4JKAA 3ODOA 3Q69A 2MEKA 1EU4A 2CY5A 4F7UP 3DVGX 4EMOA 4MJSB 3D8FA 2D5GA 4DHZE 3BJIA 4DX8A 2MFQA 1FM0D 3V3XA 4K3CA 1TZOA 1ST7A 3DXDA 1FPYA 1V6EA 3RYTA 2WX1A 2INDC 4RH6A 4EZKA 1RRPB 3OANA 1U4AA 3ETRA 4PK1A 5JZEB 4BBNF 4JE3B 2QKLA 3AM9A 1NTVA 4L2YA 3ZGZA 2D3BA 1DOXA 2IY1B 4RGTA 1WZ0A 4RF0A 3H7SA 3AE9B 2LI5A 1ACCA 4L1BA 1MVKA 1P7FA 4PQ0A 2HRJA 5AZHA 3AE6B 3F0WA 2MBBB 2IY0B 4M0WB 1MIXA 4LJOB 5H8YE 1ZDXA 3FLVA 3N1YC 4XX5A 4JK7A 4GOUA 3KQ4A 4XWWA 1C3TA 1UWXA 4LCDE 5FI1A 3VR8B 1NI3A 1JWUD 2LXCA 2J53A 2R0DA 4P1BC 3N1ZC 1VCBA 1WJNA 4HB0B 2KFKB 4BKTA 3PVLA 1KFYB 4NJ7A 4ANVA 3MC0B 4FJVB 1WXSA 5L83A 3WAPA 2CHWA 2L00B 4HEA1 1BMLC 4N9F4 3N3KB 2XK5B 4PS7A 2BGFA 5BO4B 4MT5A 1XLPA 2P0DA 3RNFC 1HEZE 1UEFA 2LMCA 2VZKB 2L52A 4XE0A 2UU7A 3B9JA 3ZRCA 3DHGC 1T6BX 2EELA 1T3QA 4OZAA 2L05A 4H8SA 5EE9A 4ZYNA 4A20A 2D9XA 3AECB 1WJ6A 2R2OA 3SO6A 1EF5A 2P0FA 3QBVB 2C7NB 4MGKE 4HATB 1K5GB 2LG1A 1EU3A 2ZJDA 2LHEA 4MEMA 4KIKB 4K7SA 1TQZA 1OQNA 4K17A 5HI1A 2Z0PA 4II3B 2JXTA 3FC4A 3AE1B 2D3AA 4B9KA 1N5WA 3HM6X 3ZRFA 3TEWA 3H8HA 2CKHB 4IAPA 3DXCA 3NZ3A 3ZDMC 4MACA 3MJ5A 1FO4A 3FKYA 1L0VB 4NZLB 1GGOA 2DA0A 1VD2A 1LO5D 3PT2B 2Y7BA 1WJ1A 1LB1A 2BYEA 1DYNA 4B0EA 1T5XD 2D3CA 2UYZB 2JVCA 2Y8GA 2D10A 3T9LA 2W55A 2MWNB 2MX2A 2GBMA 1XLQA 2LZ6A 2JY6A 3APCA 1NDDA 3UZTA 2FNJB 2BS3B 4NAMA 1DDMA 1F77A 2BWES 3AE2B 4KX6B 4KHAA 3NWDA 1TXDA 4DDGD 5AZFA 1ZXIA 4MGIE 1FHOA 1HTQA 2L7RA 2CB8A 2INCC 2HTHB 3DDCB 3DWMA 1YQ4B 4IW0A 4DBBA 3MC9A 1I35A 1R4MI 1XT9B 4FLHA 2N7JA 1FAOA 4B6WA 4GDLA 1QQGA 4N58A 3VXWA 1IPGA 1EAZA 2CRFA 5DH9B 2ASQA 2KNBA 1WM3A 3Q6BA 3NVZA 3QIJA 3DCXA 2K1FA 3QARA 1UGMA 1ZDVA 4MSMB 2LEKA 5CHVC 3Q3NC 3J9CA 1V1OA 1CZPA 2TSSA 4GN1A 1TZ1A 1S1QB 3KH0A 2PLPA 2V0GA 1RJ2A 1N60A 2XBBC 3R8BA 4DHZB 5C2TB 3ZQ4A 4ILGB 4WSFA 2CY4A 4HAWB 3TFMA 1KZGA 4RF1A 1WGQA 1UNRA 4JKFA 3M1IB 5KQ1A 1FNWA 2COFA 2VRRB 3AJ4A 4RGOS 3RD2A 1VDVA 1STEA 4JL9A 1OQYA 2KIGA 4TUUA 4WJPA 2VH1A 3Q8EA 3EC8A 3QCAA 1AW7A 3ZJUA 2GCLA 3PO0A 1FGYA 1WYWB 2G4DB 5C3JB 2ZVOA 4HXDA 1WE7A 2N4FA 1PQSA 3AI5A 4GMXB 2Y5PA 2JYEA 2MLBA 1C4PA 3KSYA 5L95C 2V3NA 5AUKA 3MJWA 1V5MA 1F2RC 5FK9C 3SYXA 1A5RA 1WMHA 4GPTB 1C1YB 4C7ZA 4KSLC 3A58A 2LVQA 2DHJA 4C4VA 2LOZA 2N9KA 3SEBA 3U12A 1J0WA 1YMHE 3ZTCA 5C23A 3W5VB 1W1HA 2AYOB 1ZC3B 3RUIB 5J3TA 2NS5A 1A70A 4ZRJA 4K7WA 2KTRB 1FXIA 1AN8A 5EE0A 1V89A 2WX0A 3ZNID 4KSKC 4AQ7A 2JU6X 1WE6A 1BTNA 2GBKA 1GB4A 1C4CA 1VBHA 3TBLD 1WR1A 2MKRA 2IGHA 4NPNA 3VTUA 2L2IA 2X18A 2NCNA 2ZPYA 2Y8FA 2D9ZA 2L76A 1D3ZA 1FNUA 3VTVA 3EGRA 2Y3AA 5CHWA 1ZSQA 3OJ3A 3ABVB 1V86A 1WJMA 1NBFC 1JCKB 3GE3C 2W3SA 3U4EG 3RN9C 5D7GA 2X8XX 3UQBA 3Q3FA 4M8NA 4FXCA 3KUZA 2JUOA 4E3CA 3JYUA 2K8HA 4AP4C 1M7RA 1HQRD 3I63C 1ZUD2 1U5FA 3R2IA 2DX5B 4LNOA 4WAAA 1WGGA 5MPOA 1HB8A 3AB5A 2JZPA 4GIVA 5KQ4A 4MDKE 1ENFA 2KDMA 2L0TA 2PEAA 1TS3A 3EECA 4YXDB 1IP9A 3BZDB 1J7AA 1UBIA 2ROZB 2C7HA 4OZCA 4PNKA 3A8PA 2MBQA 1UNQA 1NYQA 4GU2A 5TSSA 1PMSA 3JVZX 2K0PA 4KGRA 3W1YA 2PE6B 3VIAA 2KTFA 3RPFC 1SF0A 3BYYB 3HIZA 3VUWA 3UIOB 1QOGA 3DBLI 4II2B 3AEFB 3KRWA 4AJWA 2FCNA 4YT0B 2H7DA 4JPSA 1MK7B 2RPVA 5FR6A 3ZNGC 2IDYA 2L8JA 3ML9A 2YLMA 2QMTA 2LHDA 1V80A 3IHPC 3RFZB 1MHHE 3ONSA 1ZYIA 4OHJA 4IDIA 3WANA 4IC7B 5BMHA 3WAMA 2MRPA 3RNBC 1KJTA 2JSVX 3O65B 1KF6B 2YT1A 1Q1OA 2DENB 2K3UA 2RDGA 2RUKB 3PHXB 1BWNA 2M19A 2L1AA 1M94A 3N9YC 2LGSA 3DBSA 3RMKC 1N62A 2MQJA 4ZRKA 3F5RA 4A6QA 4W9FA 5T8IA 3RZFA 2SEBD 1GUAB 1NVID 2REXA 1ZP0B 4N6EB 1KOTA 2DWQA 4MY6A 2NVUI 4ZYSA 2CU3A 2WDQB 3W9CB
chains in the Genus database with same CATH topology
2C9WB 2XK5A 3TW1A 1ISNA 2ABDA 5KCVA 4Z2MB 1V5OA 1YIWA 1GNUA 2PJHA 1GC7A 1MPHA 3IVFA 5DCNA 2MBHA 4PS3A 1Q5WB 3PTFC 2RPQA 4JLCA 4W9LA 2UZSA 1LFDA 2DAJA 1GJZA 2YF0A 1WGDA 5D3XA 4PYZA 3W1SA 4TYZA 2I1KA 4KZ0A 2IYBA 2CQUA 5HE2A 2KHWB 1J8CA 2D2QA 3ALBA 4MSQB 3M95A 3L54A 3L10B 4K2PA 3UIPB 2BCJA 2J0KA 1KM7A 2MBEA 5JLJB 2CR5A 4MELA 3LJ3A 5C16A 2GBNA 2K8CA 4NAWB 4I6PA 3P6AA 3ZNZB 4WJ7A 2V4LA 3U7DA 2KCJA 3A1QA 4KVGB 2JRIB 1OTRB 2GJYA 4E71A 2HTHA 2OJRA 2FCSA 3JSVB 1U5DA 3QWZB 4IWOA 4MM3A 2AL6A 2G35A 3FP5A 3IBEA 1BTKA 2YVCA 4M8MA 1X86A 3L08A 2H7EA 3MDBC 3ZDTA 1X1MA 3MHSD 1AWEA 4KDLB 3MPXA 4GXBA 3LDZE 2LD9A 1U5GA 3SV1A 3T8MA 1UPRA 3GZNI 3A9JA 1H4RA 2LRWA 1EGXA 3CF6E 2K8BA 3ZO5B 2KUPA 3ML4A 4P7IA 4JK9A 4TQ1A 2DHKA 3SBTA 1H10A 2KJ6A 1FGZA 4ANWA 1P3RA 4AWJA 2Z0EB 4A6FA 2KQSA 2B3AA 3R66C 4HPLB 3PP2A 2ADZA 2DZIA 4A6HA 1UZXB 3N7CA 3OAWA 1FOEA 3ZUNA 3N32A 2V1YA 1X05A 2KOXA 4I6LB 3KYDD 2M4NA 3BY4B 2EC1A 3QQ8B 2N0YA 1MKEA 1LM8B 3KZ1A 2LASA 5C5BB 2KTRA 2KWCA 3A8QA 3HQCA 4GOCA 3O96A 2DLWA 2RR9A 3HK0A 4YONA 2ELBA 1UPQA 4KV2A 4D0NB 3K9OB 1ZKHA 1WH3A 4HK2A 1YD8U 3C0RB 5HKHA 4YL8A 2BYVE 1WX8A 4HDQA 2EJ8A 1WG7A 3ULBA 2O2VB 2OOBB 3B1LX 3KW5B 4C0AA 4HCPB 1WXMA 1XQQA 5HE0A 2K2JA 3PREA 1IRSA 2KZRA 3OLMD 1L2NA 2NPTA 2VKIA 4B6HA 3TJPA 4KZCA 2IFSA 4DHJB 5JHHA 1FB8A 2HE7A 3JW0X 1V5PA 1MK9B 3Q3JA 3VOQA 1NI2A 3PEGA 2LYDA 2M14A 2KC2A 2EMTA 3CIKA 1CMXB 2XQNM 4W9JA 4JKGB 4F1SA 1KLVA 1RAXA 3E9PA 5LXHA 3AULA 2RQ1A 3VAWA 2V76A 4IOYX 4W9IA 3ZLZA 2N1VA 2QKMA 2JP2A 1V81A 2C5LC 1Y8RC 2Z0DB 2MA9B 2DKQA 4W9GA 2MSED 2XEWA 3A9KA 2BYFA 3S2AA 1WFYA 3DVGY 3PZDA 1I2HA 4NQLB 3PSCA 4W9KA 2HD5B 2J7QB 2O6VB 4JQWC 3L17A 2IO0B 3TCAA 1QZEA 1F9JA 1WXAA 2DIKA 1Q67A 3ZW3A 3E66A 1WVHA 2KK8A 4HAXB 1TTNA 3QWMA 5JHBA 2ZCBA 2DN6A 4FHKA 4IUMB 5D94A 4WVFB 2DHZA 3V61A 5J2RA 4W9DA 2QHOA 2LOXA 3QAQA 4FJZA 3M62B 4PYUA 2LGYA 2OQBA 5IAAC 3H7PB 3KYCD 2Z0OA 4CHKA 3LJUX 3SUZA 4NY0A 4KHOA 3P2BA 1W1GA 1EVHA 2DYNA 2DYOA 4HDOA 2KJHB 3TVVA 3PRMB 2MP2A 2MDXA 5JP4A 3X23A 4BFRA 2COCA 1U29A 4KHBB 1TBEA 3KY9A 5J3YA 2M17A 4FBJB 5IJMA 2WWZA 2J0JA 1YQBA 3HHMA 3DVNV 1OMWA 4GDKA 3TIXA 3WA0A 2D4QA 1WGRA 4JIOU 4DDID 1DDVA 3ENBA 1KC7A 4NAWA 5DPSA 4FHJA 1WGUA 2I5CA 1WZ3A 2FAZA 3CSTA 2FJ9A 1P3QU 2KC1A 2M1MA 3ECIA 2DX1A 3VQIA 2DKPA 3WALA 4F7HA 3EHVA 5AEKB 3DVNU 1N3HA 2EMSA 2LULA 4Z2NA 3PLUA 1T0YA 2DYQA 5DIFB 2RGNB 4ZRIA 1OEYJ 2MCNB 4XC2A 4MK0A 1UD7A 2L1CA 3A98B 2DFKA 2YS5A 2AWTA 5J17A 3H6NA 2MWSB 1E8ZA 4OVUA 3VHTC 3KVFB 3RT3B 3PSEB 4OVVA 5L81A 2VRWB 1OEYA 2EKEC 4MJSA 2RGFA 3K9PB 1LXDA 2ZNVB 3RULA 4JKBA 2V3SA 4G11A 5C1ZA 3UF8A 4HAUB 5AZGA 1L7YA 4NJ6A 4HCNB 4A3PA 3NY5A 4BKGA 3DPDA 2LUEA 5LLIA 2NZ8B 1DBHA 4MGYE 2KLGA 4GDLB 2KLCA 3AU4A 5C5BA 4J6IA 2KFKA 4X57B 2YS3A 5C6RA 1Z5SB 1V88A 5GOWB 3RZWC 2KANA 2GOWA 5CHFA 1V2YA 1R4NI 4K1RB 4HLEA 4HHVA 2CS4A 3HM3A 4HB4B 3SHQA 5LXIB 2D9WA 2ELAA 3L0WB 2LGDA 3WIMA 4EOYA 3A33B 4KIKA 5D27A 1B55A 4GMVA 4GZUA 3QHTA 3NZUA 3M63B 2J59M 2PE9A 3QJZA 4PS8A 1ZM0A 2AL3A 1J0GA 4BVUC 3VTWA 5D3YA 5J18A 2ZZPB 2KMCA 3N30A 1K5DB 3U30A 4JKGA 3DBRI 2KN5A 3KUCB 1E8XA 4CYEA 1WX9A 2COPA 2RNRB 5CLLB 2N9EB 2KFJA 3PGEA 1U5EA 1RLFA 2KVRA 3DCGA 2KXJA 4HB3B 3BINA 5CLQB 2D07B 2N7DA 2CAYA 3PRZA 2KWVB 2NMBA 3VH3B 4F7ZA 1U27A 2K6DB 4HAVB 3ZVVA 1XD3B 4EUTA 4LDTD 4HVBA 2IO1B 3NSUA 5D3WA 1I42A 3AU5A 4F8CB 4LDTB 2Z0QA 2KGXB 4JKDA 1W1DA 2NBVB 4CHJA 4JKHA 4FULA 1U2BA 2JT4B 3QK0A 3PRPB 2FCQA 2AEHA 4K2OA 5D2MB 2KKCA 2CODA 2N1WA 1X1FA 4W9CA 2YSZA 3GYPA 3RCZA 1ZW7A 5GMVA 3CSFA 2D9YA 5E6OA 2DAFA 2IYDB 4KDIC 2D11A 1AQCA 1ZC4B 3UQAA 3IFWB 3R7QA 2KX0A 2CHXA 1X1GA 1Y5OA 3QA8A 4B95A 5G55A 2K00A 3UGBB 1E8WA 5JHAA 2LXAA 1V61A 5JVLA 2JZZA 3FSSA 2KQ7A 4DX90 4HWIB 2PPHA 4F7GA 4LJPB 2WH5A 4EEWA 1GC6A 2DZKA 2FCMA 4W9EA 1LQBA 3PS6A 3I3TB 5HE3A 3PPAA 3SNHA 3R3MA 1WY8A 2M0XA 1KZ7A 1J19A 4ANUA 3PV1A 2W2WA 1G6JA 3A4SC 2D3GA 3B0AA 1X11A 1SHCA 4IM2A 4GSWA 3HW2B 2GMIC 3SDLC 1TGZB 4WJOA 3D32A 1Q0WB 2NBWB 2KDEB 4RM8A 3EPYA 4GGQA 4EZLA 4TKNA 5D3VA 5JHGA 2GBRA 2IO3B 1XODA 1XR0B 3V60A 4JKCA 4JK8A 4IM3A 3EFUA 3TMPB 1XKEA 1M7EA 4DHJD 3R7RA 2ZCCA 3L16A 3VDZA 2WDTB 1HB6A 3L13A 2RVBB 5EDSA 3ODXA 2DX5A 4HAZB 5TR5A 3ZIMA 2R09A 1NU2A 1H8CA 2NR2A 3TL5A 2DZMA 4FJYA 2KDIA 2LKOA 4HAYB 2KDFB 3D8DA 5JH5C 4WWNA 2Y5BB 2GBJA 1I7AA 2FUHB 1WJ4A 4K7UA 4BKSD 4G0NB 4ANXA 2O6VD 1AARA 4WJQA 2DYMA 1WF9A 1P5TA 3ODWA 4WWOA 3KRXA 1TJ6A 1WIAA 3A1QB 1E8YA 2K2UA 1UH6A 2RD0A 2NBUA 2JZ3B 3ENEA 2IBIB 1E7UA 1P0RA 1OGWA 3NOBA 3U8ZA 1E7VA 3DQVA 3H9DA 2G3QB 3GOEA 1SGHA 4E74A 5IA7A 2UWQA 2LJ5A 4DK5A 4GB9A 2LGXA 2FIDA 1HE8A 4BOSC 2FJLA 1EO6A 2ZNVC 5CTRC 2G4SA 2K6QA 3A9JB 2OTXA 3UINB 3QC8B 4DWFA 2COAA 2BKFA 4TQ0A 1KBLA 5CX3A 4CHMA 2P8VA 4WWPA 2X0SA 4URKA 5DPWA 5LONB 1Z87A 3QX1A 2HJ8A 5EFXA 4AOFA 1V5TA 2W2XC 2DHIA 4A6FB 3DOWA 3MTNB 2JF5A 5J3QA 4JGHB 2G45B 3WYFB 3VUYA 2A5UA 3SBGA 3PG7A 2IO2B 4MH0E 5DPTA 4ILJA 3AXCA 5KHOA 2K25A 3VFKA 3PVUA 2LVOA 3VH4B 4A5KA 1P6SA 2KD0A 2ZEQA 1WR6E 3CMMB 4IWPA 4IM0A 4MGZE 1BAKA 1XD4A 1ZGUB 5DI9B 4JKEA 4RMAA 2FIFA 4DXAB 4I6NB 2ZPNA 3PHWB 4Y94A 1ZVRA 1Y19B 2P0HA 2LVPA 5G2NA 5KHQA 2KO3A 2PZ1A 2JRHA 1RRBA 4EFOA 3JSVA 5E6NA 3NS8A 4ICUA 4NSWA 1NVLA 3A4RA 1DROA 1GG3A 1VBGA 1ACAA 3KUDB 2R2QA 4HJKA 1WI1A 4ILHA 1EF1A 3VUXA 2NPTB 3FEHA 2MBOA 3PLVA 2BPSA 1WXVA 2VSZA 3D8EA 2E2XA 1WI0A 3T06A 2M8SA 3V6EB 2FDQA 3APDA 3P7ZA 2I5FA 3H1UA 3GYOA 3IG3A 3DXEA 1P9DU 2UZRA 3CXBB 3WAOA 2GS0A 2W2XD 4IG7B 4FADA 2GCJA 3V6CB 4ZDVA 2JXXA 3A9KB 1MIZB 1FHXA 2JPHA 3ZNHB 1UNPA 2JWZA 3ML8A 1NTIA 2C60A 2DTCA 2K39A 1BT0A 1V5UA 1KI1B 2MW5A 4IFSA 2RSGA 1V49A 2M38A 2N7EA 2RLOA 4HB2B 4RM9A 2L0FA 4EKUA 2D9VA 4IWQA 3TO1A 1UELA 4ASWC 1WM2A 4WJNA 5LOPB 1FXTB 3NHEB 1FHWA 3RCPA 2CHZA 4HPMB 4TV3A 3V62A 1XX0A 4AUQC 4W9HA 1JRUA 3ZKJC 1S3SG 1SIFA 1DDWA 2KJRA 1E90A 2O2VA 4XWXA 2WYQA 1WGYA 2W9NA 4BBKA 1PFJA 3PVWA 5FI0A 2LBBA 3ZTDA 2LWPA 2N9PC 1WJUA 1P1AA 1DIKA 1V9JA 1YJ1A 1PLSA 2DZJA 5E6PA 2J0MA 2C7MB 2KMAA 5C79A 1MG8A 1WMHB 4XZ4A 4KAXB 2BWFA 2MP2B 1YX5B 3G9WA 2RSUA 5HE1A 2A4ZA 2KWUB 1QC6A 2Z59B 1RFAA 4ICVA 3ULCA 2DYBA 1UBQA 1IYFA 2YS1A 2BKRB 5DPRA 3E9OA 3DBHI 1E5WA 4GDKB 2R82A 2KDBA 3NZSA 4A3OA 4G50A 1NTYA 4NQKE 2YRYA 3FM8C 3ZVRA 4NNJB 4CO7A 4A6KA 1MAIA 1XCGA 1SE9A 2UVMA 3OJ4B 4BKSA 1EUVB 3X0WA 1WGHA 3M3JA 4WQOB 2O6VA 2I1JA 4AJYB 3SD5A 2Q13A 1K8RB 3SU8X 4EZJA 2KX3A 4FN2A 4EJNA 1OY2A 1YX6B 3APFA 2LRUA 2N23A 5DHAB 4FA6A 4K81A 3E9LA 3V5WA 4G3XB 2IZVB 5DHFB 1HBKA 1P98A 5D6JB 2BF8B 3VVWB 4DBGA 3W1SC 2N9XA 4BOZB 2L3ZA 1WX7A 4L6EA 2ZVNA 1Z2MA 2CU1A 2ROVA 1JDEA 4BBNC 1LW3A 3B08A 2YT0A 4MT7A 1WRDB 3H7PA 4JKAA 3ODOA 2CY5A 4F7UP 3DVGX 4EMOA 4MJSB 3D8FA 4DHZE 3BJIA 4DX8A 2MFQA 1ST7A 3DXDA 1V6EA 3RYTA 2WX1A 4EZKA 1RRPB 3OANA 1U4AA 5JZEB 4BBNF 2QKLA 1NTVA 2IY1B 1WZ0A 3H7SA 2LI5A 4PQ0A 2HRJA 5AZHA 3F0WA 2MBBB 2IY0B 4M0WB 1MIXA 4LJOB 3FLVA 4XX5A 4JK7A 1C3TA 4LCDE 5FI1A 2LXCA 2R0DA 1VCBA 1WJNA 4HB0B 2KFKB 4BKTA 3PVLA 4NJ7A 4ANVA 4FJVB 1WXSA 5L83A 3WAPA 2CHWA 2L00B 4N9F4 3N3KB 2XK5B 4PS7A 2BGFA 5BO4B 2P0DA 1UEFA 3ZRCA 2L05A 4H8SA 4ZYNA 4A20A 2D9XA 1WJ6A 2R2OA 3SO6A 1EF5A 2P0FA 3QBVB 2C7NB 4MGKE 4HATB 1K5GB 2LG1A 2ZJDA 4MEMA 4KIKB 4K7SA 1TQZA 1OQNA 4K17A 2Z0PA 4II3B 4B9KA 3HM6X 3ZRFA 2CKHB 4IAPA 3DXCA 3ZDMC 1GGOA 2DA0A 1VD2A 3PT2B 2Y7BA 1WJ1A 1LB1A 2BYEA 1DYNA 2UYZB 2JVCA 2Y8GA 2D10A 3T9LA 2MWNB 2MX2A 2GBMA 2LZ6A 2JY6A 3APCA 1NDDA 3UZTA 2FNJB 1DDMA 2BWES 4KHAA 1TXDA 4DDGD 5AZFA 4MGIE 1FHOA 2L7RA 2CB8A 2HTHB 3DDCB 4IW0A 4DBBA 1I35A 1R4MI 1XT9B 4FLHA 4B6WA 1FAOA 4GDLA 1QQGA 3VXWA 1IPGA 1EAZA 2CRFA 5DH9B 2ASQA 2KNBA 1WM3A 3QIJA 2K1FA 3QARA 1UGMA 4MSMB 5CHVC 4GN1A 1TZ1A 1S1QB 3KH0A 1RJ2A 2XBBC 4DHZB 4ILGB 4WSFA 2CY4A 4HAWB 3TFMA 1KZGA 1WGQA 1UNRA 4JKFA 3M1IB 5KQ1A 2COFA 2VRRB 3AJ4A 3RD2A 4WJPA 4JL9A 1OQYA 4TUUA 3EC8A 3QCAA 2GCLA 1FGYA 1WYWB 2G4DB 2ZVOA 4HXDA 1WE7A 2N4FA 1PQSA 3AI5A 4GMXB 2MLBA 3KSYA 5L95C 3MJWA 1V5MA 3SYXA 1A5RA 1WMHA 4GPTB 1C1YB 4KSLC 2LVQA 2DHJA 2LOZA 1J0WA 3ZTCA 5C23A 1W1HA 2AYOB 1ZC3B 3RUIB 5J3TA 2NS5A 4ZRJA 4K7WA 2KTRB 1V89A 2WX0A 3ZNID 4KSKC 1WE6A 1BTNA 2GBKA 1VBHA 3TBLD 1WR1A 2MKRA 4NPNA 3VTUA 2L2IA 2X18A 2NCNA 2ZPYA 2Y8FA 2D9ZA 2L76A 1D3ZA 3VTVA 5CHWA 1ZSQA 3OJ3A 1V86A 1WJMA 1NBFC 5D7GA 3UQBA 3Q3FA 4M8NA 3KUZA 2JUOA 4E3CA 3JYUA 2K8HA 4AP4C 1M7RA 1U5FA 2DX5B 4WAAA 1WGGA 1HB8A 4GIVA 5KQ4A 4MDKE 2L0TA 2PEAA 3EECA 1IP9A 1UBIA 2ROZB 2C7HA 4PNKA 3A8PA 2MBQA 1UNQA 4GU2A 1PMSA 3JVZX 3W1YA 2PE6B 3VIAA 2KTFA 3HIZA 3VUWA 3UIOB 3DBLI 4II2B 3KRWA 4AJWA 2FCNA 2H7DA 1MK7B 5FR6A 3ZNGC 2L8JA 3ML9A 2YLMA 1V80A 3IHPC 3ONSA 3WANA 4IC7B 3WAMA 2MRPA 1KJTA 3O65B 2YT1A 1Q1OA 2DENB 2RUKB 3PHXB 1BWNA 1M94A 3DBSA 2MQJA 4ZRKA 3F5RA 4W9FA 3RZFA 1GUAB 2REXA 1KOTA 4MY6A 2NVUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9W B;  2XK5 A;  3TW1 A;  1ISN A;  2ABD A;  5KCV A;  4Z2M B;  1V5O A;  1YIW A;  1GNU A;  2PJH A;  1GC7 A;  1MPH A;  3IVF A;  5DCN A;  2MBH A;  4PS3 A;  1Q5W B;  3PTF C;  2RPQ A;  4JLC A;  4W9L A;  2UZS A;  1LFD A;  2DAJ A;  1GJZ A;  2YF0 A;  1WGD A;  5D3X A;  4PYZ A;  3W1S A;  4TYZ A;  2I1K A;  4KZ0 A;  2IYB A;  2CQU A;  5HE2 A;  2KHW B;  1J8C A;  2D2Q A;  3ALB A;  4MSQ B;  3M95 A;  3L54 A;  3L10 B;  4K2P A;  3UIP B;  2BCJ A;  2J0K A;  1KM7 A;  2MBE A;  5JLJ B;  2CR5 A;  4MEL A;  3LJ3 A;  5C16 A;  2GBN A;  2K8C A;  4NAW B;  4I6P A;  3P6A A;  3ZNZ B;  4WJ7 A;  2V4L A;  3U7D A;  2KCJ A;  3A1Q A;  4KVG B;  2JRI B;  1OTR B;  2GJY A;  4E71 A;  2HTH A;  2OJR A;  2FCS A;  3JSV B;  1U5D A;  3QWZ B;  4IWO A;  4MM3 A;  2AL6 A;  2G35 A;  3FP5 A;  3IBE A;  1BTK A;  2YVC A;  4M8M A;  1X86 A;  3L08 A;  2H7E A;  3MDB C;  3ZDT A;  1X1M A;  3MHS D;  1AWE A;  4KDL B;  3MPX A;  4GXB A;  3LDZ E;  2LD9 A;  1U5G A;  3SV1 A;  3T8M A;  1UPR A;  3GZN I;  3A9J A;  1H4R A;  2LRW A;  1EGX A;  3CF6 E;  2K8B A;  3ZO5 B;  2KUP A;  3ML4 A;  4P7I A;  4TQ1 A;  2DHK A;  1H10 A;  2KJ6 A;  1FGZ A;  4ANW A;  1P3R A;  4AWJ A;  2Z0E B;  4A6F A;  2KQS A;  2B3A A;  3R66 C;  4HPL B;  3PP2 A;  2ADZ A;  2DZI A;  4A6H A;  1UZX B;  3N7C A;  3OAW A;  1FOE A;  3ZUN A;  3N32 A;  2V1Y A;  1X05 A;  2KOX A;  4I6L B;  3KYD D;  2M4N A;  3BY4 B;  2EC1 A;  3QQ8 B;  2N0Y A;  1MKE A;  1LM8 B;  3KZ1 A;  2LAS A;  5C5B B;  2KTR A;  2KWC A;  3A8Q A;  3HQC A;  4GOC A;  3O96 A;  2DLW A;  2RR9 A;  3HK0 A;  4YON A;  2ELB A;  1UPQ A;  4KV2 A;  4D0N B;  3K9O B;  1ZKH A;  1WH3 A;  4HK2 A;  1YD8 U;  3C0R B;  5HKH A;  4YL8 A;  2BYV E;  1WX8 A;  4HDQ A;  2EJ8 A;  1WG7 A;  3ULB A;  2O2V B;  2OOB B;  3B1L X;  3KW5 B;  4C0A A;  4HCP B;  1WXM A;  1XQQ A;  5HE0 A;  2K2J A;  3PRE A;  1IRS A;  2KZR A;  3OLM D;  1L2N A;  2NPT A;  2VKI A;  4B6H A;  3TJP A;  4KZC A;  2IFS A;  4DHJ B;  5JHH A;  1FB8 A;  2HE7 A;  3JW0 X;  1V5P A;  1MK9 B;  3Q3J A;  3VOQ A;  1NI2 A;  3PEG A;  2LYD A;  2M14 A;  2KC2 A;  2EMT A;  3CIK A;  1CMX B;  2XQN M;  4W9J A;  4F1S A;  1KLV A;  1RAX A;  5LXH A;  3AUL A;  2RQ1 A;  3VAW A;  2V76 A;  4IOY X;  4W9I A;  3ZLZ A;  2N1V A;  2QKM A;  2JP2 A;  1V81 A;  2C5L C;  1Y8R C;  2Z0D B;  2MA9 B;  2DKQ A;  4W9G A;  2MSE D;  2XEW A;  3A9K A;  2BYF A;  3S2A A;  1WFY A;  3DVG Y;  3PZD A;  1I2H A;  4NQL B;  3PSC A;  4W9K A;  2HD5 B;  2J7Q B;  2O6V B;  4JQW C;  3L17 A;  2IO0 B;  3TCA A;  1QZE A;  1F9J A;  1WXA A;  1Q67 A;  3ZW3 A;  1WVH A;  2KK8 A;  4HAX B;  1TTN A;  3QWM A;  5JHB A;  2ZCB A;  2DN6 A;  4FHK A;  4IUM B;  5D94 A;  4WVF B;  2DHZ A;  3V61 A;  5J2R A;  4W9D A;  2QHO A;  2LOX A;  3QAQ A;  4FJZ A;  3M62 B;  4PYU A;  2LGY A;  2OQB A;  5IAA C;  3H7P B;  3KYC D;  2Z0O A;  4CHK A;  3LJU X;  3SUZ A;  4NY0 A;  4KHO A;  3P2B A;  1W1G A;  1EVH A;  2DYN A;  2DYO A;  4HDO A;  2KJH B;  3TVV A;  3PRM B;  2MP2 A;  2MDX A;  5JP4 A;  3X23 A;  4BFR A;  2COC A;  1U29 A;  4KHB B;  1TBE A;  3KY9 A;  5J3Y A;  2M17 A;  4FBJ B;  5IJM A;  2WWZ A;  2J0J A;  1YQB A;  3HHM A;  3DVN V;  1OMW A;  4GDK A;  3TIX A;  3WA0 A;  2D4Q A;  1WGR A;  4JIO U;  4DDI D;  1DDV A;  4NAW A;  5DPS A;  4FHJ A;  1WGU A;  2I5C A;  1WZ3 A;  2FAZ A;  3CST A;  2FJ9 A;  1P3Q U;  2KC1 A;  2M1M A;  3ECI A;  2DX1 A;  3VQI A;  2DKP A;  3WAL A;  4F7H A;  3EHV A;  5AEK B;  3DVN U;  1N3H A;  2EMS A;  2LUL A;  4Z2N A;  3PLU A;  1T0Y A;  2DYQ A;  5DIF B;  2RGN B;  4ZRI A;  1OEY J;  2MCN B;  4XC2 A;  4MK0 A;  1UD7 A;  2L1C A;  3A98 B;  2DFK A;  2YS5 A;  2AWT A;  5J17 A;  3H6N A;  2MWS B;  1E8Z A;  4OVU A;  3VHT C;  3KVF B;  3RT3 B;  3PSE B;  4OVV A;  5L81 A;  2VRW B;  1OEY A;  2EKE C;  4MJS A;  2RGF A;  3K9P B;  1LXD A;  2ZNV B;  3RUL A;  2V3S A;  4G11 A;  5C1Z A;  3UF8 A;  4HAU B;  5AZG A;  1L7Y A;  4NJ6 A;  4HCN B;  4A3P A;  3NY5 A;  4BKG A;  3DPD A;  2LUE A;  5LLI A;  2NZ8 B;  1DBH A;  4MGY E;  2KLG A;  4GDL B;  2KLC A;  3AU4 A;  5C5B A;  4J6I A;  2KFK A;  4X57 B;  2YS3 A;  5C6R A;  1Z5S B;  1V88 A;  5GOW B;  3RZW C;  2KAN A;  2GOW A;  5CHF A;  1V2Y A;  1R4N I;  4K1R B;  4HLE A;  4HHV A;  2CS4 A;  3HM3 A;  4HB4 B;  3SHQ A;  5LXI B;  2D9W A;  2ELA A;  3L0W B;  2LGD A;  3WIM A;  4EOY A;  3A33 B;  4KIK A;  5D27 A;  1B55 A;  4GMV A;  4GZU A;  3QHT A;  3NZU A;  3M63 B;  2J59 M;  2PE9 A;  3QJZ A;  4PS8 A;  1ZM0 A;  2AL3 A;  1J0G A;  4BVU C;  3VTW A;  5D3Y A;  5J18 A;  2ZZP B;  2KMC A;  3N30 A;  1K5D B;  3U30 A;  3DBR I;  2KN5 A;  3KUC B;  1E8X A;  4CYE A;  1WX9 A;  2COP A;  2RNR B;  5CLL B;  2N9E B;  2KFJ A;  3PGE A;  1U5E A;  1RLF A;  2KVR A;  3DCG A;  2KXJ A;  4HB3 B;  3BIN A;  5CLQ B;  2D07 B;  2N7D A;  2CAY A;  3PRZ A;  2KWV B;  2NMB A;  3VH3 B;  4F7Z A;  1U27 A;  2K6D B;  4HAV B;  3ZVV A;  1XD3 B;  4EUT A;  4LDT D;  4HVB A;  2IO1 B;  3NSU A;  5D3W A;  1I42 A;  3AU5 A;  4F8C B;  4LDT B;  2Z0Q A;  2KGX B;  1W1D A;  2NBV B;  4CHJ A;  4FUL A;  1U2B A;  2JT4 B;  3QK0 A;  3PRP B;  2FCQ A;  2AEH A;  4K2O A;  5D2M B;  2KKC A;  2COD A;  2N1W A;  1X1F A;  4W9C A;  2YSZ A;  3GYP A;  3RCZ A;  1ZW7 A;  5GMV A;  3CSF A;  2D9Y A;  5E6O A;  2DAF A;  2IYD B;  4KDI C;  2D11 A;  1AQC A;  1ZC4 B;  3UQA A;  3IFW B;  3R7Q A;  2KX0 A;  2CHX A;  1X1G A;  1Y5O A;  3QA8 A;  4B95 A;  5G55 A;  2K00 A;  3UGB B;  1E8W A;  5JHA A;  2LXA A;  1V61 A;  2JZZ A;  3FSS A;  2KQ7 A;  4DX9 0;  4HWI B;  2PPH A;  4F7G A;  4LJP B;  2WH5 A;  4EEW A;  1GC6 A;  2DZK A;  2FCM A;  4W9E A;  1LQB A;  3PS6 A;  3I3T B;  5HE3 A;  3PPA A;  3SNH A;  3R3M A;  1WY8 A;  2M0X A;  1KZ7 A;  1J19 A;  4ANU A;  3PV1 A;  2W2W A;  1G6J A;  3A4S C;  2D3G A;  3B0A A;  1X11 A;  1SHC A;  4IM2 A;  4GSW A;  3HW2 B;  2GMI C;  3SDL C;  1TGZ B;  4WJO A;  3D32 A;  1Q0W B;  2NBW B;  2KDE B;  4RM8 A;  3EPY A;  4GGQ A;  4EZL A;  4TKN A;  5D3V A;  5JHG A;  2GBR A;  2IO3 B;  1XOD A;  1XR0 B;  3V60 A;  4IM3 A;  3EFU A;  3TMP B;  1XKE A;  1M7E A;  4DHJ D;  3R7R A;  2ZCC A;  3VDZ A;  3L16 A;  2WDT B;  1HB6 A;  3L13 A;  2RVB B;  5EDS A;  3ODX A;  2DX5 A;  4HAZ B;  5TR5 A;  3ZIM A;  2R09 A;  1NU2 A;  1H8C A;  2NR2 A;  3TL5 A;  2DZM A;  4FJY A;  2KDI A;  2LKO A;  4HAY B;  2KDF B;  3D8D A;  5JH5 C;  4WWN A;  2Y5B B;  2GBJ A;  1I7A A;  2FUH B;  1WJ4 A;  4K7U A;  4BKS D;  4G0N B;  4ANX A;  2O6V D;  1AAR A;  4WJQ A;  2DYM A;  1WF9 A;  1P5T A;  3ODW A;  4WWO A;  3KRX A;  1TJ6 A;  1WIA A;  3A1Q B;  1E8Y A;  2K2U A;  1UH6 A;  2RD0 A;  2NBU A;  2JZ3 B;  3ENE A;  2IBI B;  1E7U A;  1P0R A;  1OGW A;  3NOB A;  3U8Z A;  1E7V A;  3DQV A;  3H9D A;  2G3Q B;  3GOE A;  1SGH A;  4E74 A;  5IA7 A;  2UWQ A;  2LJ5 A;  4DK5 A;  4GB9 A;  2LGX A;  2FID A;  1HE8 A;  4BOS C;  2FJL A;  1EO6 A;  2ZNV C;  5CTR C;  2G4S A;  2K6Q A;  3A9J B;  2OTX A;  3UIN B;  3QC8 B;  4DWF A;  2COA A;  2BKF A;  4TQ0 A;  5CX3 A;  4CHM A;  2P8V A;  4WWP A;  4URK A;  5DPW A;  5LON B;  1Z87 A;  3QX1 A;  2HJ8 A;  5EFX A;  4AOF A;  1V5T A;  2W2X C;  2DHI A;  4A6F B;  3DOW A;  3MTN B;  2JF5 A;  5J3Q A;  4JGH B;  2G45 B;  3WYF B;  3VUY A;  2A5U A;  3PG7 A;  2IO2 B;  4MH0 E;  5DPT A;  3AXC A;  5KHO A;  2K25 A;  3VFK A;  3PVU A;  2LVO A;  3VH4 B;  4A5K A;  1P6S A;  2KD0 A;  2ZEQ A;  1WR6 E;  3CMM B;  4IWP A;  4IM0 A;  4MGZ E;  1BAK A;  1XD4 A;  1ZGU B;  5DI9 B;  4RMA A;  2FIF A;  4DXA B;  4I6N B;  2ZPN A;  3PHW B;  4Y94 A;  1ZVR A;  1Y19 B;  2P0H A;  2LVP A;  5G2N A;  5KHQ A;  2KO3 A;  2PZ1 A;  2JRH A;  1RRB A;  4EFO A;  3JSV A;  5E6N A;  3NS8 A;  4ICU A;  4NSW A;  1NVL A;  3A4R A;  1DRO A;  1GG3 A;  1ACA A;  3KUD B;  2R2Q A;  4HJK A;  1WI1 A;  1EF1 A;  3VUX A;  2NPT B;  3FEH A;  2MBO A;  3PLV A;  2BPS A;  1WXV A;  2VSZ A;  3D8E A;  2E2X A;  1WI0 A;  3T06 A;  2M8S A;  3V6E B;  2FDQ A;  3APD A;  3P7Z A;  2I5F A;  3H1U A;  3GYO A;  3IG3 A;  3DXE A;  1P9D U;  2UZR A;  3CXB B;  3WAO A;  2GS0 A;  2W2X D;  4IG7 B;  4FAD A;  2GCJ A;  3V6C B;  4ZDV A;  2JXX A;  3A9K B;  1MIZ B;  1FHX A;  2JPH A;  3ZNH B;  1UNP A;  2JWZ A;  3ML8 A;  1NTI A;  2C60 A;  2DTC A;  2K39 A;  1BT0 A;  1V5U A;  1KI1 B;  2MW5 A;  4IFS A;  2RSG A;  1V49 A;  2M38 A;  2N7E A;  2RLO A;  4HB2 B;  4RM9 A;  2L0F A;  4EKU A;  2D9V A;  4IWQ A;  3TO1 A;  1UEL A;  4ASW C;  1WM2 A;  4WJN A;  5LOP B;  1FXT B;  3NHE B;  1FHW A;  3RCP A;  2CHZ A;  4HPM B;  4TV3 A;  3V62 A;  1XX0 A;  4AUQ C;  4W9H A;  1JRU A;  3ZKJ C;  1S3S G;  1SIF A;  1DDW A;  2KJR A;  1E90 A;  2O2V A;  4XWX A;  2WYQ A;  1WGY A;  2W9N A;  4BBK A;  1PFJ A;  3PVW A;  5FI0 A;  2LBB A;  3ZTD A;  2LWP A;  2N9P C;  1WJU A;  1P1A A;  1V9J A;  1YJ1 A;  1PLS A;  2DZJ A;  5E6P A;  2J0M A;  2C7M B;  2KMA A;  5C79 A;  1MG8 A;  1WMH B;  4XZ4 A;  4KAX B;  2BWF A;  2MP2 B;  1YX5 B;  3G9W A;  2RSU A;  5HE1 A;  2A4Z A;  2KWU B;  1QC6 A;  2Z59 B;  1RFA A;  4ICV A;  3ULC A;  2DYB A;  1UBQ A;  1IYF A;  2YS1 A;  2BKR B;  5DPR A;  3DBH I;  1E5W A;  4GDK B;  2KDB A;  3NZS A;  4A3O A;  4G50 A;  1NTY A;  4NQK E;  2YRY A;  3FM8 C;  3ZVR A;  4NNJ B;  4CO7 A;  4A6K A;  1MAI A;  1XCG A;  1SE9 A;  2UVM A;  3OJ4 B;  4BKS A;  1EUV B;  3X0W A;  1WGH A;  3M3J A;  4WQO B;  2O6V A;  2I1J A;  4AJY B;  3SD5 A;  2Q13 A;  1K8R B;  3SU8 X;  4EZJ A;  2KX3 A;  4FN2 A;  4EJN A;  1OY2 A;  1YX6 B;  3APF A;  2LRU A;  2N23 A;  5DHA B;  4FA6 A;  4K81 A;  3V5W A;  4G3X B;  2IZV B;  5DHF B;  1HBK A;  1P98 A;  5D6J B;  2BF8 B;  3VVW B;  4DBG A;  3W1S C;  2N9X A;  4BOZ B;  2L3Z A;  1WX7 A;  4L6E A;  2ZVN A;  1Z2M A;  2CU1 A;  2ROV A;  4BBN C;  1LW3 A;  3B08 A;  2YT0 A;  4MT7 A;  1WRD B;  3H7P A;  3ODO A;  2CY5 A;  4F7U P;  3DVG X;  4EMO A;  4MJS B;  3D8F A;  4DHZ E;  3BJI A;  4DX8 A;  2MFQ A;  1ST7 A;  3DXD A;  1V6E A;  3RYT A;  2WX1 A;  4EZK A;  1RRP B;  3OAN A;  1U4A A;  5JZE B;  4BBN F;  2QKL A;  1NTV A;  2IY1 B;  1WZ0 A;  3H7S A;  2LI5 A;  4PQ0 A;  2HRJ A;  5AZH A;  3F0W A;  2MBB B;  2IY0 B;  4M0W B;  1MIX A;  4LJO B;  3FLV A;  4XX5 A;  1C3T A;  4LCD E;  5FI1 A;  2LXC A;  2R0D A;  1VCB A;  1WJN A;  4HB0 B;  2KFK B;  4BKT A;  3PVL A;  4NJ7 A;  4ANV A;  4FJV B;  1WXS A;  5L83 A;  3WAP A;  2CHW A;  2L00 B;  4N9F 4;  3N3K B;  2XK5 B;  4PS7 A;  2BGF A;  5BO4 B;  2P0D A;  1UEF A;  3ZRC A;  2L05 A;  4H8S A;  4ZYN A;  4A20 A;  2D9X A;  1WJ6 A;  2R2O A;  3SO6 A;  1EF5 A;  2P0F A;  3QBV B;  2C7N B;  4MGK E;  4HAT B;  1K5G B;  2LG1 A;  2ZJD A;  4MEM A;  4KIK B;  4K7S A;  1TQZ A;  1OQN A;  4K17 A;  2Z0P A;  4II3 B;  4B9K A;  3HM6 X;  3ZRF A;  2CKH B;  4IAP A;  3DXC A;  3ZDM C;  2DA0 A;  1VD2 A;  3PT2 B;  2Y7B A;  1WJ1 A;  1LB1 A;  2BYE A;  1DYN A;  2UYZ B;  2JVC A;  2Y8G A;  2D10 A;  3T9L A;  2MWN B;  2MX2 A;  2GBM A;  2LZ6 A;  2JY6 A;  3APC A;  1NDD A;  3UZT A;  2FNJ B;  1DDM A;  2BWE S;  4KHA A;  1TXD A;  4DDG D;  5AZF A;  4MGI E;  1FHO A;  2L7R A;  2CB8 A;  2HTH B;  3DDC B;  4IW0 A;  4DBB A;  1I35 A;  1R4M I;  1XT9 B;  4FLH A;  4B6W A;  1FAO A;  4GDL A;  1QQG A;  3VXW A;  1IPG A;  1EAZ A;  2CRF A;  5DH9 B;  2ASQ A;  2KNB A;  1WM3 A;  3QIJ A;  2K1F A;  3QAR A;  1UGM A;  4MSM B;  5CHV C;  4GN1 A;  1TZ1 A;  1S1Q B;  3KH0 A;  1RJ2 A;  2XBB C;  4DHZ B;  4WSF A;  2CY4 A;  4HAW B;  3TFM A;  1KZG A;  1WGQ A;  1UNR A;  3M1I B;  5KQ1 A;  2COF A;  2VRR B;  3AJ4 A;  3RD2 A;  4WJP A;  4JL9 A;  1OQY A;  4TUU A;  3EC8 A;  3QCA A;  2GCL A;  1FGY A;  1WYW B;  2G4D B;  2ZVO A;  4HXD A;  1WE7 A;  2N4F A;  1PQS A;  3AI5 A;  4GMX B;  2MLB A;  3KSY A;  5L95 C;  3MJW A;  1V5M A;  3SYX A;  1A5R A;  1WMH A;  4GPT B;  1C1Y B;  4KSL C;  2LVQ A;  2DHJ A;  2LOZ A;  1J0W A;  3ZTC A;  5C23 A;  1W1H A;  2AYO B;  1ZC3 B;  3RUI B;  5J3T A;  2NS5 A;  4ZRJ A;  4K7W A;  2KTR B;  1V89 A;  2WX0 A;  3ZNI D;  4KSK C;  1WE6 A;  1BTN A;  2GBK A;  3TBL D;  1WR1 A;  2MKR A;  4NPN A;  3VTU A;  2L2I A;  2X18 A;  2NCN A;  2ZPY A;  2Y8F A;  2D9Z A;  2L76 A;  1D3Z A;  3VTV A;  5CHW A;  1ZSQ A;  3OJ3 A;  1V86 A;  1WJM A;  1NBF C;  5D7G A;  3UQB A;  3Q3F A;  4M8N A;  3KUZ A;  2JUO A;  4E3C A;  3JYU A;  2K8H A;  4AP4 C;  1M7R A;  1U5F A;  2DX5 B;  4WAA A;  1WGG A;  1HB8 A;  4GIV A;  5KQ4 A;  4MDK E;  2L0T A;  2PEA A;  3EEC A;  1IP9 A;  1UBI A;  2ROZ B;  2C7H A;  4PNK A;  3A8P A;  2MBQ A;  1UNQ A;  4GU2 A;  1PMS A;  3JVZ X;  3W1Y A;  2PE6 B;  3VIA A;  2KTF A;  3HIZ A;  3VUW A;  3UIO B;  3DBL I;  4II2 B;  3KRW A;  4AJW A;  2FCN A;  2H7D A;  1MK7 B;  5FR6 A;  3ZNG C;  2L8J A;  3ML9 A;  2YLM A;  1V80 A;  3IHP C;  3ONS A;  3WAN A;  4IC7 B;  3WAM A;  2MRP A;  1KJT A;  3O65 B;  2YT1 A;  1Q1O A;  2DEN B;  2RUK B;  3PHX B;  1BWN A;  1M94 A;  3DBS A;  2MQJ A;  4ZRK A;  3F5R A;  4W9F A;  3RZF A;  1GUA B;  2REX A;  1KOT A;  4MY6 A;  2NVU I; 
#chains in the Genus database with same CATH topology
 2C9W B;  5EE1 A;  2XK5 A;  3DBL B;  3TW1 A;  3Q8C A;  3ZJT A;  1ISN A;  2ABD A;  1CK1 A;  5BYR A;  2HTM E;  3AED B;  5KCV A;  4Z2M B;  1V5O A;  1YIW A;  1GNU A;  2PJH A;  1GC7 A;  1MPH A;  3IVF A;  5DCN A;  1C76 A;  3W5U B;  1HTO A;  2NMQ A;  2MBH A;  1OQR A;  4PS3 A;  1Q5W B;  1BXT A;  3PTF C;  2RPQ A;  5D3I B;  4D6W A;  4JLC A;  4W9L A;  3FIL A;  2UZS A;  1LFD A;  1LGR A;  2DAJ A;  2MH7 A;  1GJZ A;  3P42 A;  2YF0 A;  1WGD A;  2G1E A;  3NW8 A;  5D3X A;  4PYZ A;  2WXI A;  1FMA D;  3W1S A;  3IAS 1;  4TYZ A;  2I1K A;  1ESF A;  4KZ0 A;  2IYB A;  2CQU A;  1FNV A;  5HE2 A;  2KHW B;  2VH2 A;  1J8C A;  2D2Q A;  3ALB A;  4MSQ B;  1L6V A;  3M95 A;  2FE8 A;  3L54 A;  3L10 B;  4K2P A;  5IO9 A;  3UIP B;  2BCJ A;  2J0K A;  5GXG B;  1PYW D;  4AS1 A;  4S0R A;  1KM7 A;  3FAH A;  5BYQ A;  2MBE A;  5JLJ B;  2CR5 A;  4MEL A;  2BQQ A;  2LJI A;  3LJ3 A;  5C16 A;  2GBN A;  2K8C A;  4NAW B;  4I6P A;  3P6A A;  3ZNZ B;  4WJ7 A;  2MHJ A;  2WU2 B;  1UUP A;  2V4L A;  3U7D A;  2KCJ A;  1C78 A;  1I4H A;  3A1Q A;  2V9H A;  4KVG B;  2JRI B;  1OTR B;  2GJY A;  2WXG A;  4E71 A;  1PGX A;  2HTH A;  2OJR A;  2FCS A;  3JSV B;  4NJC A;  5LNK 1;  3BVG A;  1U5D A;  1N5X A;  2PIA A;  3QWZ B;  4IWO A;  4MM3 A;  2AL6 A;  2G35 A;  1YJJ A;  3FP5 A;  3IBE A;  1BTK A;  2YVC A;  4M8M A;  1X86 A;  3L08 A;  2H7E A;  3SFE B;  3MDB C;  2WXJ A;  3C8Y A;  3ZDT A;  1X1M A;  3MHS D;  3DBH B;  1AWE A;  4KDL B;  4REZ A;  3MPX A;  4GXB A;  3LDZ E;  2LD9 A;  2Z8L A;  1U5G A;  3SV1 A;  2G9H D;  1UPR A;  2QC8 A;  3T8M A;  3GZN I;  1YN3 A;  1K51 A;  3A9J A;  1H4R A;  2I38 A;  2K49 A;  2E6X A;  1UGJ A;  4D2K A;  2LRW A;  1EGX A;  2K8B A;  3CF6 E;  3FVC A;  3ZO5 B;  2KUP A;  3ML4 A;  1WYG A;  3GS2 A;  4P7I A;  4JK9 A;  4QAY A;  1MFW A;  2DHK A;  4TQ1 A;  3RNA C;  3SBT A;  1H10 A;  1JWM D;  2KJ6 A;  1FGZ A;  2BVC A;  4ANW A;  1P3R A;  5HFY A;  4AWJ A;  2NTT A;  2Z0E B;  4A6F A;  5BMG A;  1FXA A;  2KQS A;  1N6Z A;  1V1P A;  1M4V A;  2B3A A;  3R66 C;  4HPL B;  3PP2 A;  3DHI C;  1XLO A;  2ADZ A;  1T0Q C;  4A6H A;  2DZI A;  1L4Z B;  1K50 A;  4KGT A;  1UZX B;  1TJE A;  2IJ0 A;  3N7C A;  3B2G A;  3OAW A;  1FOE A;  1TKG A;  3ZUN A;  3HVZ A;  1L4D B;  3N32 A;  2BB5 A;  1RYJ A;  2V1Y A;  2YT2 A;  1X05 A;  2KOX A;  4EE2 A;  4I6L B;  4ZHP A;  2M4N A;  3KYD D;  3BY4 B;  2EC1 A;  3IT6 B;  3Q3M C;  3QQ8 B;  2QJL A;  2N0Y A;  2JWU A;  2QDF A;  1MKE A;  1LM8 B;  3GP7 A;  3KZ1 A;  4OZB A;  2LAS A;  3PZ8 A;  5C5B B;  2MJE A;  2PMV A;  2KTR A;  2KWC A;  3A8Q A;  3HQC A;  4GOC A;  3O96 A;  2DLW A;  2RR9 A;  2WXN A;  1VJK A;  2GRI A;  3HK0 A;  4YON A;  2ELB A;  1UPQ A;  4KV2 A;  4D0N B;  3AE4 B;  2VZK D;  3K9O B;  2WXP A;  1ZKH A;  3LXF A;  4YSZ B;  1WH3 A;  4HK2 A;  1TS4 A;  1YD8 U;  2BB6 A;  3EFC A;  3C0R B;  5HKH A;  2PVG C;  4YL8 A;  2BYV E;  4RFB A;  1WX8 A;  4HDQ A;  2EJ8 A;  4CQN A;  1WG7 A;  3ULB A;  1QOB A;  2O2V B;  2OOB B;  4KKI A;  3P4S B;  3B1L X;  4M01 A;  3KW5 B;  3Q8F A;  3C19 A;  1RFK A;  4C0A A;  4HCP B;  1WXM A;  3N1X C;  1XQQ A;  5HE0 A;  4RGM A;  2KR0 A;  3SFD B;  1B9R A;  2K2J A;  1FEH A;  3AE3 B;  1E6E B;  3PRE A;  1IRS A;  3KWL A;  2BTE A;  2KZR A;  4YTM B;  3OLM D;  1L2N A;  5G5G A;  2NPT A;  2VKI A;  4B6H A;  2IPK D;  3TJP A;  4KZC A;  2IFS A;  3NVV A;  4DHJ B;  2YEP B;  5JHH A;  3Q2A C;  1FB8 A;  2HE7 A;  3JW0 X;  1V5P A;  2KAC A;  1MK9 B;  3Q3J A;  4HRO A;  3VOQ A;  1JWB D;  1NI2 A;  1ET9 A;  3PEG A;  2QEJ C;  2LYD A;  2WXR A;  2M14 A;  1QT9 A;  2KC2 A;  3CIR B;  3TSS A;  2EMT A;  3CIK A;  1FIQ A;  1CMX B;  3MHZ A;  1ZPS A;  2XQN M;  3DWG C;  4W9J A;  4JKG B;  4F1S A;  2ACZ B;  2L32 A;  2R61 A;  1KLV A;  1RAX A;  3E9P A;  5I2S A;  5LXH A;  3AUL A;  3EUB 2;  3P4Q B;  4JWU C;  4UDU C;  2RQ1 A;  3VAW A;  2V76 A;  5E6J A;  1C79 A;  2QIE B;  4IOY X;  4W9I A;  3ZLZ A;  2N1V A;  2QKM A;  2JP2 A;  1V81 A;  4US9 A;  2C5L C;  1Y8R C;  2Z0D B;  4QXA B;  2DKQ A;  2MA9 B;  1IBX A;  4W9G A;  2R2Y A;  2MSE D;  2XEW A;  4YSX B;  3A9K A;  2BYF A;  3S2A A;  1WFY A;  3DVG Y;  1F0Z A;  3PZD A;  1I2H A;  4NQL B;  3PSC A;  2N0S B;  4W9K A;  2BW2 A;  4DIX A;  1XXG A;  2HD5 B;  1SJH D;  4ZRP A;  2J7Q B;  2O6V B;  4JQW C;  1SSN A;  2IO0 B;  3IXS A;  3L17 A;  4HRS A;  3TCA A;  4YTN B;  3AEA B;  1QZE A;  1F9J A;  1WXA A;  1TY0 A;  2DIK A;  1Q67 A;  2J42 A;  3ZW3 A;  3E66 A;  1WVH A;  1QF6 A;  2KK8 A;  4HAX B;  3EA6 A;  3P4R B;  4IKG A;  1TTN A;  3I9V 1;  3QWM A;  2W54 A;  5JHB A;  2ZCB A;  4LTU A;  3NG0 A;  2DN6 A;  4FHK A;  3HVD A;  4IUM B;  5D94 A;  4WVF B;  2DHZ A;  3V61 A;  5J2R A;  2WS3 B;  2KT7 A;  4W9D A;  1XEE A;  1XCQ L;  1GOZ A;  2QHO A;  2LOX A;  3QAQ A;  2WDR B;  4FJZ A;  3M62 B;  4PYU A;  2LGY A;  2OQB A;  5IAA C;  4ARC A;  3H7P B;  1FCL A;  3VR9 B;  3KYC D;  4LNN A;  2Z0O A;  2AQ2 B;  4CHK A;  3LJU X;  3SUZ A;  4NY0 A;  1YN5 A;  1ZOY B;  4KHO A;  1R4M B;  2KWD A;  3P2B A;  1W1G A;  1EVH A;  2Z4D A;  2DYN A;  2PW9 A;  2DYO A;  4P16 A;  4HDO A;  4ARI A;  2KJH B;  4P6V F;  3TVV A;  2WXM A;  3PRM B;  2MP2 A;  2MDX A;  5JP4 A;  4HSI A;  3X23 A;  1EWY C;  1K52 A;  1N61 A;  2Z59 A;  4BFR A;  4ZHO A;  2COC A;  1U29 A;  3P1M A;  4KHB B;  3NWA A;  1TBE A;  3KY9 A;  5J3Y A;  2M17 A;  4FBJ B;  5IJM A;  2WWZ A;  1UWM A;  2J0J A;  1YQB A;  3HHM A;  3DVN V;  1OMW A;  1FFV A;  4GDK A;  3TIX A;  3WA0 A;  2D4Q A;  1XO3 A;  4P1C C;  1VZ7 A;  1WGR A;  3AEB B;  4JIO U;  4DDI D;  1DDV A;  5FR3 A;  3W2D A;  3ENB A;  3NWF A;  1KC7 A;  4NAW A;  2V4I B;  5DPS A;  2J4X A;  4FHJ A;  2Y5C A;  4WQM A;  1WGU A;  2I5C A;  1WZ3 A;  3BVM A;  2FAZ A;  2BS4 B;  2JYT A;  3CST A;  2FJ9 A;  1P3Q U;  2KC1 A;  2M1M A;  4PT5 A;  3ECI A;  2DX1 A;  3VQI A;  4N59 A;  2DKP A;  2K9X A;  4F7H A;  3WAL A;  2JX5 A;  3LYY A;  3EHV A;  1RWS A;  5AEK B;  3DVN U;  1I7H A;  1N3H A;  2EMS A;  2LUL A;  1GAQ B;  4Z2N A;  2LUM A;  3PLU A;  1YN4 A;  1T0Y A;  2DYQ A;  5DIF B;  2RGN B;  3R2T A;  2ONQ A;  4ZRI A;  1OEY J;  2MCN B;  2WQY B;  4XC2 A;  4MK0 A;  3VRB B;  1MPE A;  1UD7 A;  1MI1 A;  2L1C A;  2DNF A;  2ZW0 A;  3A98 B;  2DFK A;  2YS5 A;  1SE2 A;  2AWT A;  5J17 A;  2KVZ A;  4J3O D;  1JW9 D;  3H6N A;  2GB1 A;  2MWS B;  1E8Z A;  4OVU A;  3VHT C;  1UNS A;  1DOY A;  3KVF B;  2XN9 C;  3PSE B;  3RT3 B;  4OVV A;  5L81 A;  1DYQ A;  2VRW B;  1OEY A;  5IOI A;  4JX1 C;  2EKE C;  4MJS A;  2RGF A;  3K9P B;  1LXD A;  1C77 A;  3O13 A;  2ZNV B;  3RUL A;  2V3P A;  1R7S A;  5D3D A;  4JKB A;  4LLG M;  2V3S A;  4M00 A;  5IN7 A;  2IGG A;  1TIF A;  4G11 A;  4WIP A;  5C1Z A;  3SR6 A;  4HAU B;  5AZG A;  3UF8 A;  4LNF A;  1L7Y A;  4NJ6 A;  3B77 A;  4HCN B;  1D5Z C;  2GUM A;  4A3P A;  3NY5 A;  4BKG A;  3DPD A;  2LUE A;  1DGJ A;  5LLI A;  3TUO A;  1KTK A;  1PGB A;  2HDE A;  2NZ8 B;  4CSQ A;  4M0W A;  1P7E A;  1DBH A;  2CJN A;  2WXL A;  3HRD D;  1TS5 A;  2JQR B;  4MGY E;  2BBC A;  1MI0 A;  3ZXV A;  1TKE A;  1GB1 A;  3AE8 B;  2KLG A;  4GDL B;  2WHI A;  1V97 A;  2KLC A;  3AU4 A;  5C5B A;  4J6I A;  2WDV B;  2KFK A;  2KN4 A;  2Q5W D;  2WU5 B;  4X57 B;  2YS3 A;  2I2Y A;  2OED A;  5C6R A;  1Z5S B;  1V88 A;  2FUG 1;  1YNT E;  5GOW B;  3RZW C;  2KAN A;  3UI3 A;  2GOW A;  1N63 A;  1VZ6 A;  3L4P A;  4XDC A;  1V2Y A;  5CHF A;  1R4N I;  4K1R B;  4HLE A;  4HHV A;  2CS4 A;  3HM3 A;  4HB4 B;  3SHQ A;  5LXI B;  2D9W A;  2ELA A;  3L0W B;  2KAJ A;  3Q8A A;  2LGD A;  3WIM A;  4EOY A;  4HPP A;  1I4G A;  3TEZ A;  3A33 B;  4KIK A;  5D27 A;  1B55 A;  4GMV A;  2B76 B;  4GZU A;  3QHT A;  3NZU A;  3BK1 A;  3M63 B;  2J59 M;  2PE9 A;  2IGD A;  1D6E C;  1XCT L;  3P4P B;  3QJZ A;  4PS8 A;  1ZM0 A;  2CJO A;  2AL3 A;  3BK2 A;  3I5J C;  1J0G A;  4BVU C;  3HIE A;  4L1R A;  3VTW A;  1QOA A;  5D3Y A;  2WXO A;  5J18 A;  2ZZP B;  2KMC A;  3N30 A;  5IKC M;  1K5D B;  4KKJ A;  1EM7 A;  3U30 A;  4JKG A;  4B0M A;  3DBR I;  2KN5 A;  3KWV A;  1R4N B;  3KUC B;  1E8X A;  4CYE A;  1F52 A;  1WX9 A;  2RMM A;  3AN1 A;  2COP A;  2PKO A;  4HKZ E;  2RNR B;  5CLL B;  2N9E B;  2KFJ A;  3PGE A;  1I4R A;  1U5E A;  1RLF A;  2KVR A;  3DCG A;  2KXJ A;  4YSY B;  4HB3 B;  3BIN A;  5AUI A;  1WWT A;  4L23 A;  5I4D A;  5CLQ B;  2D07 B;  2N7D A;  2CAY A;  3PRZ A;  2KWV B;  1SIJ A;  2NMB A;  3VH3 B;  4F7Z A;  1U27 A;  1QLB B;  2GLS A;  2K6D B;  4HAV B;  3ZVV A;  1XD3 B;  3OWE B;  4EUT A;  4R3D A;  3AH7 A;  4LDT D;  4HVB A;  1T77 A;  4XGA B;  2IO1 B;  3NSU A;  5D3W A;  1I42 A;  1IGC A;  3BII D;  3AU5 A;  3AE5 B;  2EKI A;  4F8C B;  4LDT B;  2Z0Q A;  2KGX B;  4JKD A;  4ZOH C;  1W1D A;  2NBV B;  4CHJ A;  4JKH A;  4FUL A;  4XWT A;  1U2B A;  2JT4 B;  3QK0 A;  3PRP B;  2FCQ A;  2QSD A;  2KMM A;  2AEH A;  4K2O A;  3AV8 A;  5D2M B;  2KKC A;  2COD A;  2N1W A;  1X1F A;  4W9C A;  2YSZ A;  3GYP A;  3RCZ A;  1ZW7 A;  5GMV A;  3CSF A;  2D9Y A;  5E6O A;  1SE4 A;  2DAF A;  2IYD B;  4KDI C;  2D11 A;  1I4P A;  1JQ4 A;  1AQC A;  1ZC4 B;  3UQA A;  3IFW B;  3R7Q A;  3RI7 C;  2DLB A;  2KX0 A;  2YEP F;  2CHX A;  1X1G A;  4YTP B;  3Q8B A;  1Y5O A;  3QA8 A;  1HXY D;  4B95 A;  1WSP A;  5G55 A;  2RDH A;  4ZRQ A;  2K00 A;  3T3O A;  3UGB B;  1E8W A;  5JHA A;  3Q14 C;  2LXA A;  1V61 A;  1E9M A;  5JVL A;  2JZZ A;  4O1N A;  4WAF A;  3FSS A;  2KQ7 A;  4DX9 0;  2QCZ A;  1RM6 C;  4HWI B;  2PPH A;  1FRD A;  4F7G A;  4LJP B;  2WH5 A;  4EEW A;  1GC6 A;  2DZK A;  2FCM A;  3E56 A;  4W9E A;  1LQB A;  3PS6 A;  1ET6 A;  3I3T B;  5HE3 A;  3PPA A;  3SNH A;  3R3M A;  1WY8 A;  3GZN B;  4XYC A;  3RNG C;  4KHB A;  4HKQ A;  2M0X A;  1KZ7 A;  1WGK A;  1J7C A;  1J19 A;  4RGN A;  4ANU A;  3PV1 A;  2W2W A;  1XF5 L;  1BUI C;  1ZE3 D;  1G6J A;  3KLS X;  3A4S C;  1JRO A;  2ZW1 A;  2D3G A;  3B0A A;  4MH8 A;  1CJE A;  1X11 A;  1SHC A;  4IM2 A;  2AQ3 B;  4GSW A;  3HW2 B;  2GMI C;  3SDL C;  4YWG G;  4LNI A;  1TGZ B;  4WJO A;  3D32 A;  1Q0W B;  2NBW B;  2KDE B;  4HJG E;  1YOV B;  4RM8 A;  1JML A;  3EPY A;  1I4Q A;  4GGQ A;  4EZL A;  4TKN A;  5D3V A;  5JHG A;  2GBR A;  1ZXH A;  2IO3 B;  1XOD A;  1JWA D;  1XR0 B;  3V60 A;  4JKC A;  4JK8 A;  3GE8 C;  4IM3 A;  3EFU A;  3TMP B;  2H89 B;  1XKE A;  2M0A A;  1HA5 A;  3AMZ A;  1M7E A;  4DHJ D;  2ZCC A;  3L16 A;  3R7R A;  3VDZ A;  4US8 A;  2WDT B;  1HB6 A;  2J52 A;  4GLS C;  3L13 A;  2RVB B;  5EDS A;  1L6U A;  3FIL B;  3ODX A;  2DX5 A;  4HAZ B;  5TR5 A;  1YQ3 B;  3ZIM A;  1I4X A;  4TMA B;  3NRZ A;  3TEY A;  3U52 E;  1MG4 A;  2R09 A;  1KLU D;  1NU2 A;  1H8C A;  2NR2 A;  3TL5 A;  2DZM A;  4FJY A;  2W82 A;  3HUI A;  2KDI A;  2OHF A;  4S17 A;  2LKO A;  2N9L A;  4HAY B;  2KDF B;  2XNA C;  3CWI A;  3D8D A;  5JH5 C;  1KLG D;  1VZ8 A;  4WWN A;  2Y5B B;  4JWS C;  2GBJ A;  5M4Y B;  1I7A A;  2FUH B;  1WJ4 A;  4K7U A;  4BKS D;  4G0N B;  4ANX A;  1K53 A;  5EE3 A;  2O6V D;  1AAR A;  4WJQ A;  2DYM A;  4A90 A;  2LGI A;  1VR9 A;  1WF9 A;  1P5T A;  2MJD A;  3ODW A;  4WWO A;  3NS1 A;  3GB1 A;  2L83 A;  3KRX A;  1TJ6 A;  4H2A A;  1WIA A;  3A1Q B;  5HHD G;  1E8Y A;  1CQV A;  2K2U A;  1UH6 A;  2RD0 A;  5FKA C;  2RRF A;  1PUT A;  2NBU A;  2JZ3 B;  3AE7 B;  2KIE A;  3ENE A;  2PVO D;  3E9S A;  2IBI B;  3NVW A;  3PZ7 A;  1E0Z A;  1E7U A;  1P0R A;  2LFI A;  1OGW A;  1EWC A;  3NOB A;  3U8Z A;  1E7V A;  1T0S C;  3DQV A;  3H9D A;  4MM3 B;  2G3Q B;  3GOE A;  1SGH A;  4E74 A;  4OVZ A;  4WUR A;  5IA7 A;  4QJ4 B;  4GNK B;  1WRI A;  2UWQ A;  4LNK A;  2LJ5 A;  4DK5 A;  4GB9 A;  2LGX A;  5I2M A;  3BVZ A;  2FID A;  1HE8 A;  1D4B A;  4BOS C;  4ACF A;  2FJL A;  1EO6 A;  2ZNV C;  2Z13 A;  5CTR C;  1L0X B;  2G4S A;  3WCQ A;  2K6Q A;  3A9J B;  2OTX A;  1XLN A;  2AX5 A;  3UIN B;  1NYR A;  2PTL A;  2MJ3 A;  3QC8 B;  4DWF A;  1NEK B;  1FFU A;  2COA A;  2BKF A;  4TQ0 A;  1KBL A;  2ON8 A;  5CX3 A;  4CHM A;  2P8V A;  4WWP A;  2X0S A;  4URK A;  5DPW A;  5LON B;  2BYT A;  1Z87 A;  3QX1 A;  1Y56 A;  1PGA A;  2HJ8 A;  5EFX A;  1TKY A;  3IT4 B;  4AOF A;  1V5T A;  2W2X C;  2DHI A;  4A6F B;  1QQR A;  1L0Y B;  3DOW A;  3MTN B;  1V1P B;  2JF5 A;  1FCC C;  5J3Q A;  4JGH B;  2BT6 A;  2G45 B;  4DQO C;  3WYF B;  3VUY A;  1JRP A;  4C56 C;  3MP9 A;  2A5U A;  3SBG A;  3PG7 A;  1TYG B;  2IO2 B;  4MH0 E;  5DPT A;  4ILJ A;  4TSS A;  1AWD A;  3AXC A;  5KHO A;  2K25 A;  3VFK A;  3PVU A;  1T0R C;  2LVO A;  2WXQ A;  3VH4 B;  3OG5 A;  5IP4 D;  4A5K A;  1P6S A;  1QKZ A;  2KD0 A;  2ZEQ A;  1WR6 E;  3CMM B;  1SBB B;  4IWP A;  4IM0 A;  2GI9 A;  4MGZ E;  1BAK A;  3MC8 A;  1XD4 A;  1ZGU B;  5DI9 B;  3RNC C;  4KGS A;  4WWM A;  4JKE A;  4M02 A;  4RMA A;  2FIF A;  4DXA B;  4QJ5 B;  4I6N B;  2ZPN A;  3PHW B;  1J7B A;  1KH0 A;  4Y94 A;  3VRA B;  1ZVR A;  1IUE A;  1Y19 B;  3BYT B;  2P0H A;  1OFF A;  1TT5 B;  2LVP A;  5G2N A;  5KHQ A;  2KO3 A;  2WXK A;  2PZ1 A;  2K8E A;  2JRH A;  1V8C A;  1RRB A;  4EFO A;  2HJ1 A;  3JSV A;  5E6N A;  1QOF A;  3NS8 A;  4ICU A;  4NSW A;  3NUH B;  5JXV A;  4BAX A;  1NVL A;  3AEE B;  3A4R A;  3RNE C;  1DRO A;  2K5P A;  4IOI E;  4A55 A;  1GG3 A;  2NBV A;  1E7P B;  1VBG A;  1ACA A;  3KUD B;  2R2Q A;  4HJK A;  2WXF A;  1WI1 A;  4ILH A;  1EF1 A;  1SB3 C;  3VUX A;  2NPT B;  3FEH A;  1D5X C;  2MBO A;  1F2R I;  4ITK A;  3PLV A;  3I57 A;  2BPS A;  2RDB C;  1WXV A;  4LK0 M;  2INP E;  2VSZ A;  3D8E A;  2E2X A;  1WI0 A;  3T06 A;  1PDX A;  1KRH A;  2M8S A;  3V6E B;  1DOI A;  3HSA A;  2FDQ A;  3LB8 C;  3APD A;  1L5P A;  3P7Z A;  2I5F A;  3H1U A;  3GYO A;  3IG3 A;  2Z14 A;  2M56 B;  3DXE A;  2H88 B;  1P9D U;  1D5M C;  2UZR A;  3CXB B;  3DHH C;  1Q10 A;  3WAO A;  2GS0 A;  2QIL A;  2W2X D;  4IG7 B;  4FAD A;  2GCJ A;  2AQ1 B;  3V6C B;  1IBX B;  5LG4 B;  4ZDV A;  2JXX A;  2FJU B;  3A9K B;  1MIZ B;  1B1Z A;  1FHX A;  1PFD A;  2WLB A;  2JPH A;  3ZNH B;  1UNP A;  2JWZ A;  3ML8 A;  1NTI A;  2C60 A;  2DTC A;  3NJT A;  2K39 A;  4K3B A;  1BT0 A;  1V5U A;  1KI1 B;  3U2S C;  2KQ4 X;  2MW5 A;  1SE3 A;  4IFS A;  3AEG B;  1HZ5 A;  2RSG A;  1V49 A;  2K22 A;  2M38 A;  2N7E A;  2RLO A;  3TEX A;  4HB2 B;  2INN E;  2OJW A;  4RM9 A;  2L0F A;  4EKU A;  5HG2 A;  2D9V A;  4IWQ A;  3TO1 A;  3B2F A;  1SXT A;  1UEL A;  4ASW C;  1WM2 A;  4WJN A;  4Q2J A;  3IAM 1;  5LOP B;  1JWS D;  2SAK A;  1FXT B;  3NHE B;  1FHW A;  3RCP A;  5G5H A;  2CHZ A;  4HPM B;  4TV3 A;  3V62 A;  1XX0 A;  4AUQ C;  2X38 A;  4W9H A;  1JRU A;  3ZKJ C;  1S3S G;  3ZYY X;  1SIF A;  1DDW A;  2KJR A;  2FBW B;  1E90 A;  3MFG A;  2O2V A;  4XWX A;  2ZKM X;  2WYQ A;  1WGY A;  2W9N A;  1F1H A;  4BBK A;  3OHM B;  1PFJ A;  3PVW A;  5FI0 A;  2ICI A;  2WGS A;  1UF0 A;  2LBB A;  5IRS A;  4OSN A;  2LWP A;  2N9P C;  3ZTD A;  1WJU A;  1P1A A;  4XDD A;  1C4A A;  1DIK A;  4C00 A;  1ROE A;  1V9J A;  3T3N A;  4DXG A;  1YJI A;  4OT1 A;  1YJ1 A;  1PLS A;  2DZJ A;  5E6P A;  1VRA B;  2J0M A;  2C7M B;  2KMA A;  5C79 A;  1MG8 A;  3ZJV A;  1WMH B;  5BYS A;  4XZ4 A;  4KAX B;  2BWF A;  3P63 A;  2MP2 B;  1YX5 B;  3G9W A;  2RSU A;  4C4V B;  5HE1 A;  2A4Z A;  2KWU B;  2W3R A;  1QC6 A;  2Z59 B;  1RFA A;  4ICV A;  3ULC A;  1E10 A;  2NTS A;  2DYB A;  1UBQ A;  3NVY A;  4WH4 A;  1IYF A;  2YS1 A;  1QIL A;  2BKR B;  2WP9 B;  5DPR A;  3BWU D;  2KYW A;  3E9O A;  3DBH I;  1E5W A;  4QJ3 B;  4GDK B;  2R82 A;  2KDB A;  5BMI A;  3NZS A;  3URY A;  4A3O A;  4RCO A;  4G50 A;  1JAL A;  1HZ6 A;  1NTY A;  1IGD A;  1VLB A;  4NQK E;  2YRY A;  3FM8 C;  2WNM A;  3ZVR A;  4NNJ B;  4CO7 A;  4A6K A;  1SE9 A;  1MAI A;  1XCG A;  4A8X C;  2UVM A;  4C80 A;  3OJ4 B;  4BKS A;  1EUV B;  3X0W A;  1WGH A;  3M3J A;  4WQO B;  2O6V A;  1FD6 A;  2I1J A;  4AJY B;  3SD5 A;  4A9A A;  1MHX A;  2Q13 A;  2KUQ A;  1K8R B;  3SU8 X;  4EZJ A;  2KX3 A;  3ZXR A;  4FN2 A;  4EJN A;  4OW0 A;  1OY2 A;  1SJE D;  1YX6 B;  3APF A;  2LRU A;  2N23 A;  5DHA B;  1WXQ A;  1GPX A;  4FA6 A;  2DBY A;  1TS2 A;  2BS2 B;  3Q3O C;  1AYF A;  4K81 A;  3E9L A;  3V5W A;  1OQQ A;  4G3X B;  2IZV B;  5DHF B;  1HBK A;  1P98 A;  5D6J B;  4DXF A;  3V05 A;  2BF8 B;  3VVW B;  2WXH A;  4DBG A;  5H92 C;  3DBR B;  3W1S C;  4USA A;  2N9X A;  4BOZ B;  2L3Z A;  1FRR A;  1TY2 A;  1WX7 A;  1MJD A;  4RNA A;  4L6E A;  2ZVN A;  4BZA A;  3N20 C;  1Z2M A;  2CU1 A;  2ROV A;  1JDE A;  1NEN B;  4BBN C;  1LW3 A;  3B08 A;  1SEB D;  4C7Y A;  2E3T A;  3U7Z A;  1C9F A;  2YT0 A;  4MT7 A;  1WRD B;  3H7P A;  4JKA A;  3ODO A;  3Q69 A;  2MEK A;  1EU4 A;  2CY5 A;  4F7U P;  3DVG X;  4EMO A;  4MJS B;  3D8F A;  2D5G A;  4DHZ E;  3BJI A;  4DX8 A;  2MFQ A;  1FM0 D;  3V3X A;  4K3C A;  1TZO A;  1ST7 A;  3DXD A;  1FPY A;  1V6E A;  3RYT A;  2WX1 A;  2IND C;  4RH6 A;  4EZK A;  1RRP B;  3OAN A;  1U4A A;  3ETR A;  4PK1 A;  5JZE B;  4BBN F;  4JE3 B;  2QKL A;  3AM9 A;  1NTV A;  4L2Y A;  3ZGZ A;  2D3B A;  1DOX A;  2IY1 B;  4RGT A;  1WZ0 A;  4RF0 A;  3H7S A;  3AE9 B;  2LI5 A;  1ACC A;  4L1B A;  1MVK A;  1P7F A;  4PQ0 A;  2HRJ A;  5AZH A;  3AE6 B;  3F0W A;  2MBB B;  2IY0 B;  4M0W B;  1MIX A;  4LJO B;  5H8Y E;  1ZDX A;  3FLV A;  3N1Y C;  4XX5 A;  4JK7 A;  4GOU A;  3KQ4 A;  4XWW A;  1C3T A;  1UWX A;  4LCD E;  5FI1 A;  3VR8 B;  1NI3 A;  1JWU D;  2LXC A;  2J53 A;  2R0D A;  4P1B C;  3N1Z C;  1VCB A;  1WJN A;  4HB0 B;  2KFK B;  4BKT A;  3PVL A;  1KFY B;  4NJ7 A;  4ANV A;  3MC0 B;  4FJV B;  1WXS A;  5L83 A;  3WAP A;  2CHW A;  2L00 B;  4HEA 1;  1BML C;  4N9F 4;  3N3K B;  2XK5 B;  4PS7 A;  2BGF A;  5BO4 B;  4MT5 A;  1XLP A;  2P0D A;  3RNF C;  1HEZ E;  1UEF A;  2LMC A;  2VZK B;  2L52 A;  4XE0 A;  2UU7 A;  3B9J A;  3ZRC A;  3DHG C;  1T6B X;  2EEL A;  1T3Q A;  4OZA A;  2L05 A;  4H8S A;  5EE9 A;  4ZYN A;  4A20 A;  2D9X A;  3AEC B;  1WJ6 A;  2R2O A;  3SO6 A;  1EF5 A;  2P0F A;  3QBV B;  2C7N B;  4MGK E;  4HAT B;  1K5G B;  2LG1 A;  1EU3 A;  2ZJD A;  2LHE A;  4MEM A;  4KIK B;  4K7S A;  1TQZ A;  1OQN A;  4K17 A;  5HI1 A;  2Z0P A;  4II3 B;  2JXT A;  3FC4 A;  3AE1 B;  2D3A A;  4B9K A;  1N5W A;  3HM6 X;  3ZRF A;  3TEW A;  3H8H A;  2CKH B;  4IAP A;  3DXC A;  3NZ3 A;  3ZDM C;  4MAC A;  3MJ5 A;  1FO4 A;  3FKY A;  1L0V B;  4NZL B;  1GGO A;  2DA0 A;  1VD2 A;  1LO5 D;  3PT2 B;  2Y7B A;  1WJ1 A;  1LB1 A;  2BYE A;  1DYN A;  4B0E A;  1T5X D;  2D3C A;  2UYZ B;  2JVC A;  2Y8G A;  2D10 A;  3T9L A;  2W55 A;  2MWN B;  2MX2 A;  2GBM A;  1XLQ A;  2LZ6 A;  2JY6 A;  3APC A;  1NDD A;  3UZT A;  2FNJ B;  2BS3 B;  4NAM A;  1DDM A;  1F77 A;  2BWE S;  3AE2 B;  4KX6 B;  4KHA A;  3NWD A;  1TXD A;  4DDG D;  5AZF A;  1ZXI A;  4MGI E;  1FHO A;  1HTQ A;  2L7R A;  2CB8 A;  2INC C;  2HTH B;  3DDC B;  3DWM A;  1YQ4 B;  4IW0 A;  4DBB A;  3MC9 A;  1I35 A;  1R4M I;  1XT9 B;  4FLH A;  2N7J A;  1FAO A;  4B6W A;  4GDL A;  1QQG A;  4N58 A;  3VXW A;  1IPG A;  1EAZ A;  2CRF A;  5DH9 B;  2ASQ A;  2KNB A;  1WM3 A;  3Q6B A;  3NVZ A;  3QIJ A;  3DCX A;  2K1F A;  3QAR A;  1UGM A;  1ZDV A;  4MSM B;  2LEK A;  5CHV C;  3Q3N C;  3J9C A;  1V1O A;  1CZP A;  2TSS A;  4GN1 A;  1TZ1 A;  1S1Q B;  3KH0 A;  2PLP A;  2V0G A;  1RJ2 A;  1N60 A;  2XBB C;  3R8B A;  4DHZ B;  5C2T B;  3ZQ4 A;  4ILG B;  4WSF A;  2CY4 A;  4HAW B;  3TFM A;  1KZG A;  4RF1 A;  1WGQ A;  1UNR A;  4JKF A;  3M1I B;  5KQ1 A;  1FNW A;  2COF A;  2VRR B;  3AJ4 A;  4RGO S;  3RD2 A;  1VDV A;  1STE A;  4JL9 A;  1OQY A;  2KIG A;  4TUU A;  4WJP A;  2VH1 A;  3Q8E A;  3EC8 A;  3QCA A;  1AW7 A;  3ZJU A;  2GCL A;  3PO0 A;  1FGY A;  1WYW B;  2G4D B;  5C3J B;  2ZVO A;  4HXD A;  1WE7 A;  2N4F A;  1PQS A;  3AI5 A;  4GMX B;  2Y5P A;  2JYE A;  2MLB A;  1C4P A;  3KSY A;  5L95 C;  2V3N A;  5AUK A;  3MJW A;  1V5M A;  1F2R C;  5FK9 C;  3SYX A;  1A5R A;  1WMH A;  4GPT B;  1C1Y B;  4C7Z A;  4KSL C;  3A58 A;  2LVQ A;  2DHJ A;  4C4V A;  2LOZ A;  2N9K A;  3SEB A;  3U12 A;  1J0W A;  1YMH E;  3ZTC A;  5C23 A;  3W5V B;  1W1H A;  2AYO B;  1ZC3 B;  3RUI B;  5J3T A;  2NS5 A;  1A70 A;  4ZRJ A;  4K7W A;  2KTR B;  1FXI A;  1AN8 A;  5EE0 A;  1V89 A;  2WX0 A;  3ZNI D;  4KSK C;  4AQ7 A;  2JU6 X;  1WE6 A;  1BTN A;  2GBK A;  1GB4 A;  1C4C A;  1VBH A;  3TBL D;  1WR1 A;  2MKR A;  2IGH A;  4NPN A;  3VTU A;  2L2I A;  2X18 A;  2NCN A;  2ZPY A;  2Y8F A;  2D9Z A;  2L76 A;  1D3Z A;  1FNU A;  3VTV A;  3EGR A;  2Y3A A;  5CHW A;  1ZSQ A;  3OJ3 A;  3ABV B;  1V86 A;  1WJM A;  1NBF C;  1JCK B;  3GE3 C;  2W3S A;  3U4E G;  3RN9 C;  5D7G A;  2X8X X;  3UQB A;  3Q3F A;  4M8N A;  4FXC A;  3KUZ A;  2JUO A;  4E3C A;  3JYU A;  2K8H A;  4AP4 C;  1M7R A;  1HQR D;  3I63 C;  1ZUD 2;  1U5F A;  3R2I A;  2DX5 B;  4LNO A;  4WAA A;  1WGG A;  5MPO A;  1HB8 A;  3AB5 A;  2JZP A;  4GIV A;  5KQ4 A;  4MDK E;  1ENF A;  2KDM A;  2L0T A;  2PEA A;  1TS3 A;  3EEC A;  4YXD B;  1IP9 A;  3BZD B;  1J7A A;  1UBI A;  2ROZ B;  2C7H A;  4OZC A;  4PNK A;  3A8P A;  2MBQ A;  1UNQ A;  1NYQ A;  4GU2 A;  5TSS A;  1PMS A;  3JVZ X;  2K0P A;  4KGR A;  3W1Y A;  2PE6 B;  3VIA A;  2KTF A;  3RPF C;  1SF0 A;  3BYY B;  3HIZ A;  3VUW A;  3UIO B;  1QOG A;  3DBL I;  4II2 B;  3AEF B;  3KRW A;  4AJW A;  2FCN A;  4YT0 B;  2H7D A;  4JPS A;  1MK7 B;  2RPV A;  5FR6 A;  3ZNG C;  2IDY A;  2L8J A;  3ML9 A;  2YLM A;  2QMT A;  2LHD A;  1V80 A;  3IHP C;  3RFZ B;  1MHH E;  3ONS A;  1ZYI A;  4OHJ A;  4IDI A;  3WAN A;  4IC7 B;  5BMH A;  3WAM A;  2MRP A;  3RNB C;  1KJT A;  2JSV X;  3O65 B;  1KF6 B;  2YT1 A;  1Q1O A;  2DEN B;  2K3U A;  2RDG A;  2RUK B;  3PHX B;  1BWN A;  2M19 A;  2L1A A;  1M94 A;  3N9Y C;  2LGS A;  3DBS A;  3RMK C;  1N62 A;  2MQJ A;  4ZRK A;  3F5R A;  4A6Q A;  4W9F A;  5T8I A;  3RZF A;  2SEB D;  1GUA B;  1NVI D;  2REX A;  1ZP0 B;  4N6E B;  1KOT A;  2DWQ A;  4MY6 A;  2NVU I;  4ZYS A;  2CU3 A;  2WDQ B;  3W9C B; 
#chains in the Genus database with same CATH homology
 2C9W B;  2XK5 A;  3TW1 A;  1ISN A;  2ABD A;  5KCV A;  4Z2M B;  1V5O A;  1YIW A;  1GNU A;  2PJH A;  1GC7 A;  1MPH A;  3IVF A;  5DCN A;  2MBH A;  4PS3 A;  1Q5W B;  3PTF C;  2RPQ A;  4JLC A;  4W9L A;  2UZS A;  1LFD A;  2DAJ A;  1GJZ A;  2YF0 A;  1WGD A;  5D3X A;  4PYZ A;  3W1S A;  4TYZ A;  2I1K A;  4KZ0 A;  2IYB A;  2CQU A;  5HE2 A;  2KHW B;  1J8C A;  2D2Q A;  3ALB A;  4MSQ B;  3M95 A;  3L54 A;  3L10 B;  4K2P A;  3UIP B;  2BCJ A;  2J0K A;  1KM7 A;  2MBE A;  5JLJ B;  2CR5 A;  4MEL A;  3LJ3 A;  5C16 A;  2GBN A;  2K8C A;  4NAW B;  4I6P A;  3P6A A;  3ZNZ B;  4WJ7 A;  2V4L A;  3U7D A;  2KCJ A;  3A1Q A;  4KVG B;  2JRI B;  1OTR B;  2GJY A;  4E71 A;  2HTH A;  2OJR A;  2FCS A;  3JSV B;  1U5D A;  3QWZ B;  4IWO A;  4MM3 A;  2AL6 A;  2G35 A;  3FP5 A;  3IBE A;  1BTK A;  2YVC A;  4M8M A;  1X86 A;  3L08 A;  2H7E A;  3MDB C;  3ZDT A;  1X1M A;  3MHS D;  1AWE A;  4KDL B;  3MPX A;  4GXB A;  3LDZ E;  2LD9 A;  1U5G A;  3SV1 A;  3T8M A;  1UPR A;  3GZN I;  3A9J A;  1H4R A;  2LRW A;  1EGX A;  3CF6 E;  2K8B A;  3ZO5 B;  2KUP A;  3ML4 A;  4P7I A;  4JK9 A;  4TQ1 A;  2DHK A;  3SBT A;  1H10 A;  2KJ6 A;  1FGZ A;  4ANW A;  1P3R A;  4AWJ A;  2Z0E B;  4A6F A;  2KQS A;  2B3A A;  3R66 C;  4HPL B;  3PP2 A;  2ADZ A;  2DZI A;  4A6H A;  1UZX B;  3N7C A;  3OAW A;  1FOE A;  3ZUN A;  3N32 A;  2V1Y A;  1X05 A;  2KOX A;  4I6L B;  3KYD D;  2M4N A;  3BY4 B;  2EC1 A;  3QQ8 B;  2N0Y A;  1MKE A;  1LM8 B;  3KZ1 A;  2LAS A;  5C5B B;  2KTR A;  2KWC A;  3A8Q A;  3HQC A;  4GOC A;  3O96 A;  2DLW A;  2RR9 A;  3HK0 A;  4YON A;  2ELB A;  1UPQ A;  4KV2 A;  4D0N B;  3K9O B;  1ZKH A;  1WH3 A;  4HK2 A;  1YD8 U;  3C0R B;  5HKH A;  4YL8 A;  2BYV E;  1WX8 A;  4HDQ A;  2EJ8 A;  1WG7 A;  3ULB A;  2O2V B;  2OOB B;  3B1L X;  3KW5 B;  4C0A A;  4HCP B;  1WXM A;  1XQQ A;  5HE0 A;  2K2J A;  3PRE A;  1IRS A;  2KZR A;  3OLM D;  1L2N A;  2NPT A;  2VKI A;  4B6H A;  3TJP A;  4KZC A;  2IFS A;  4DHJ B;  5JHH A;  1FB8 A;  2HE7 A;  3JW0 X;  1V5P A;  1MK9 B;  3Q3J A;  3VOQ A;  1NI2 A;  3PEG A;  2LYD A;  2M14 A;  2KC2 A;  2EMT A;  3CIK A;  1CMX B;  2XQN M;  4W9J A;  4JKG B;  4F1S A;  1KLV A;  1RAX A;  3E9P A;  5LXH A;  3AUL A;  2RQ1 A;  3VAW A;  2V76 A;  4IOY X;  4W9I A;  3ZLZ A;  2N1V A;  2QKM A;  2JP2 A;  1V81 A;  2C5L C;  1Y8R C;  2Z0D B;  2MA9 B;  2DKQ A;  4W9G A;  2MSE D;  2XEW A;  3A9K A;  2BYF A;  3S2A A;  1WFY A;  3DVG Y;  3PZD A;  1I2H A;  4NQL B;  3PSC A;  4W9K A;  2HD5 B;  2J7Q B;  2O6V B;  4JQW C;  3L17 A;  2IO0 B;  3TCA A;  1QZE A;  1F9J A;  1WXA A;  2DIK A;  1Q67 A;  3ZW3 A;  3E66 A;  1WVH A;  2KK8 A;  4HAX B;  1TTN A;  3QWM A;  5JHB A;  2ZCB A;  2DN6 A;  4FHK A;  4IUM B;  5D94 A;  4WVF B;  2DHZ A;  3V61 A;  5J2R A;  4W9D A;  2QHO A;  2LOX A;  3QAQ A;  4FJZ A;  3M62 B;  4PYU A;  2LGY A;  2OQB A;  5IAA C;  3H7P B;  3KYC D;  2Z0O A;  4CHK A;  3LJU X;  3SUZ A;  4NY0 A;  4KHO A;  3P2B A;  1W1G A;  1EVH A;  2DYN A;  2DYO A;  4HDO A;  2KJH B;  3TVV A;  3PRM B;  2MP2 A;  2MDX A;  5JP4 A;  3X23 A;  4BFR A;  2COC A;  1U29 A;  4KHB B;  1TBE A;  3KY9 A;  5J3Y A;  2M17 A;  4FBJ B;  5IJM A;  2WWZ A;  2J0J A;  1YQB A;  3HHM A;  3DVN V;  1OMW A;  4GDK A;  3TIX A;  3WA0 A;  2D4Q A;  1WGR A;  4JIO U;  4DDI D;  1DDV A;  3ENB A;  1KC7 A;  4NAW A;  5DPS A;  4FHJ A;  1WGU A;  2I5C A;  1WZ3 A;  2FAZ A;  3CST A;  2FJ9 A;  1P3Q U;  2KC1 A;  2M1M A;  3ECI A;  2DX1 A;  3VQI A;  2DKP A;  3WAL A;  4F7H A;  3EHV A;  5AEK B;  3DVN U;  1N3H A;  2EMS A;  2LUL A;  4Z2N A;  3PLU A;  1T0Y A;  2DYQ A;  5DIF B;  2RGN B;  4ZRI A;  1OEY J;  2MCN B;  4XC2 A;  4MK0 A;  1UD7 A;  2L1C A;  3A98 B;  2DFK A;  2YS5 A;  2AWT A;  5J17 A;  3H6N A;  2MWS B;  1E8Z A;  4OVU A;  3VHT C;  3KVF B;  3RT3 B;  3PSE B;  4OVV A;  5L81 A;  2VRW B;  1OEY A;  2EKE C;  4MJS A;  2RGF A;  3K9P B;  1LXD A;  2ZNV B;  3RUL A;  4JKB A;  2V3S A;  4G11 A;  5C1Z A;  3UF8 A;  4HAU B;  5AZG A;  1L7Y A;  4NJ6 A;  4HCN B;  4A3P A;  3NY5 A;  4BKG A;  3DPD A;  2LUE A;  5LLI A;  2NZ8 B;  1DBH A;  4MGY E;  2KLG A;  4GDL B;  2KLC A;  3AU4 A;  5C5B A;  4J6I A;  2KFK A;  4X57 B;  2YS3 A;  5C6R A;  1Z5S B;  1V88 A;  5GOW B;  3RZW C;  2KAN A;  2GOW A;  5CHF A;  1V2Y A;  1R4N I;  4K1R B;  4HLE A;  4HHV A;  2CS4 A;  3HM3 A;  4HB4 B;  3SHQ A;  5LXI B;  2D9W A;  2ELA A;  3L0W B;  2LGD A;  3WIM A;  4EOY A;  3A33 B;  4KIK A;  5D27 A;  1B55 A;  4GMV A;  4GZU A;  3QHT A;  3NZU A;  3M63 B;  2J59 M;  2PE9 A;  3QJZ A;  4PS8 A;  1ZM0 A;  2AL3 A;  1J0G A;  4BVU C;  3VTW A;  5D3Y A;  5J18 A;  2ZZP B;  2KMC A;  3N30 A;  1K5D B;  3U30 A;  4JKG A;  3DBR I;  2KN5 A;  3KUC B;  1E8X A;  4CYE A;  1WX9 A;  2COP A;  2RNR B;  5CLL B;  2N9E B;  2KFJ A;  3PGE A;  1U5E A;  1RLF A;  2KVR A;  3DCG A;  2KXJ A;  4HB3 B;  3BIN A;  5CLQ B;  2D07 B;  2N7D A;  2CAY A;  3PRZ A;  2KWV B;  2NMB A;  3VH3 B;  4F7Z A;  1U27 A;  2K6D B;  4HAV B;  3ZVV A;  1XD3 B;  4EUT A;  4LDT D;  4HVB A;  2IO1 B;  3NSU A;  5D3W A;  1I42 A;  3AU5 A;  4F8C B;  4LDT B;  2Z0Q A;  2KGX B;  4JKD A;  1W1D A;  2NBV B;  4CHJ A;  4JKH A;  4FUL A;  1U2B A;  2JT4 B;  3QK0 A;  3PRP B;  2FCQ A;  2AEH A;  4K2O A;  5D2M B;  2KKC A;  2COD A;  2N1W A;  1X1F A;  4W9C A;  2YSZ A;  3GYP A;  3RCZ A;  1ZW7 A;  5GMV A;  3CSF A;  2D9Y A;  5E6O A;  2DAF A;  2IYD B;  4KDI C;  2D11 A;  1AQC A;  1ZC4 B;  3UQA A;  3IFW B;  3R7Q A;  2KX0 A;  2CHX A;  1X1G A;  1Y5O A;  3QA8 A;  4B95 A;  5G55 A;  2K00 A;  3UGB B;  1E8W A;  5JHA A;  2LXA A;  1V61 A;  5JVL A;  2JZZ A;  3FSS A;  2KQ7 A;  4DX9 0;  4HWI B;  2PPH A;  4F7G A;  4LJP B;  2WH5 A;  4EEW A;  1GC6 A;  2DZK A;  2FCM A;  4W9E A;  1LQB A;  3PS6 A;  3I3T B;  5HE3 A;  3PPA A;  3SNH A;  3R3M A;  1WY8 A;  2M0X A;  1KZ7 A;  1J19 A;  4ANU A;  3PV1 A;  2W2W A;  1G6J A;  3A4S C;  2D3G A;  3B0A A;  1X11 A;  1SHC A;  4IM2 A;  4GSW A;  3HW2 B;  2GMI C;  3SDL C;  1TGZ B;  4WJO A;  3D32 A;  1Q0W B;  2NBW B;  2KDE B;  4RM8 A;  3EPY A;  4GGQ A;  4EZL A;  4TKN A;  5D3V A;  5JHG A;  2GBR A;  2IO3 B;  1XOD A;  1XR0 B;  3V60 A;  4JKC A;  4JK8 A;  4IM3 A;  3EFU A;  3TMP B;  1XKE A;  1M7E A;  4DHJ D;  3R7R A;  2ZCC A;  3L16 A;  3VDZ A;  2WDT B;  1HB6 A;  3L13 A;  2RVB B;  5EDS A;  3ODX A;  2DX5 A;  4HAZ B;  5TR5 A;  3ZIM A;  2R09 A;  1NU2 A;  1H8C A;  2NR2 A;  3TL5 A;  2DZM A;  4FJY A;  2KDI A;  2LKO A;  4HAY B;  2KDF B;  3D8D A;  5JH5 C;  4WWN A;  2Y5B B;  2GBJ A;  1I7A A;  2FUH B;  1WJ4 A;  4K7U A;  4BKS D;  4G0N B;  4ANX A;  2O6V D;  1AAR A;  4WJQ A;  2DYM A;  1WF9 A;  1P5T A;  3ODW A;  4WWO A;  3KRX A;  1TJ6 A;  1WIA A;  3A1Q B;  1E8Y A;  2K2U A;  1UH6 A;  2RD0 A;  2NBU A;  2JZ3 B;  3ENE A;  2IBI B;  1E7U A;  1P0R A;  1OGW A;  3NOB A;  3U8Z A;  1E7V A;  3DQV A;  3H9D A;  2G3Q B;  3GOE A;  1SGH A;  4E74 A;  5IA7 A;  2UWQ A;  2LJ5 A;  4DK5 A;  4GB9 A;  2LGX A;  2FID A;  1HE8 A;  4BOS C;  2FJL A;  1EO6 A;  2ZNV C;  5CTR C;  2G4S A;  2K6Q A;  3A9J B;  2OTX A;  3UIN B;  3QC8 B;  4DWF A;  2COA A;  2BKF A;  4TQ0 A;  1KBL A;  5CX3 A;  4CHM A;  2P8V A;  4WWP A;  2X0S A;  4URK A;  5DPW A;  5LON B;  1Z87 A;  3QX1 A;  2HJ8 A;  5EFX A;  4AOF A;  1V5T A;  2W2X C;  2DHI A;  4A6F B;  3DOW A;  3MTN B;  2JF5 A;  5J3Q A;  4JGH B;  2G45 B;  3WYF B;  3VUY A;  2A5U A;  3SBG A;  3PG7 A;  2IO2 B;  4MH0 E;  5DPT A;  4ILJ A;  3AXC A;  5KHO A;  2K25 A;  3VFK A;  3PVU A;  2LVO A;  3VH4 B;  4A5K A;  1P6S A;  2KD0 A;  2ZEQ A;  1WR6 E;  3CMM B;  4IWP A;  4IM0 A;  4MGZ E;  1BAK A;  1XD4 A;  1ZGU B;  5DI9 B;  4JKE A;  4RMA A;  2FIF A;  4DXA B;  4I6N B;  2ZPN A;  3PHW B;  4Y94 A;  1ZVR A;  1Y19 B;  2P0H A;  2LVP A;  5G2N A;  5KHQ A;  2KO3 A;  2PZ1 A;  2JRH A;  1RRB A;  4EFO A;  3JSV A;  5E6N A;  3NS8 A;  4ICU A;  4NSW A;  1NVL A;  3A4R A;  1DRO A;  1GG3 A;  1VBG A;  1ACA A;  3KUD B;  2R2Q A;  4HJK A;  1WI1 A;  4ILH A;  1EF1 A;  3VUX A;  2NPT B;  3FEH A;  2MBO A;  3PLV A;  2BPS A;  1WXV A;  2VSZ A;  3D8E A;  2E2X A;  1WI0 A;  3T06 A;  2M8S A;  3V6E B;  2FDQ A;  3APD A;  3P7Z A;  2I5F A;  3H1U A;  3GYO A;  3IG3 A;  3DXE A;  1P9D U;  2UZR A;  3CXB B;  3WAO A;  2GS0 A;  2W2X D;  4IG7 B;  4FAD A;  2GCJ A;  3V6C B;  4ZDV A;  2JXX A;  3A9K B;  1MIZ B;  1FHX A;  2JPH A;  3ZNH B;  1UNP A;  2JWZ A;  3ML8 A;  1NTI A;  2C60 A;  2DTC A;  2K39 A;  1BT0 A;  1V5U A;  1KI1 B;  2MW5 A;  4IFS A;  2RSG A;  1V49 A;  2M38 A;  2N7E A;  2RLO A;  4HB2 B;  4RM9 A;  2L0F A;  4EKU A;  2D9V A;  4IWQ A;  3TO1 A;  1UEL A;  4ASW C;  1WM2 A;  4WJN A;  5LOP B;  1FXT B;  3NHE B;  1FHW A;  3RCP A;  2CHZ A;  4HPM B;  4TV3 A;  3V62 A;  1XX0 A;  4AUQ C;  4W9H A;  1JRU A;  3ZKJ C;  1S3S G;  1SIF A;  1DDW A;  2KJR A;  1E90 A;  2O2V A;  4XWX A;  2WYQ A;  1WGY A;  2W9N A;  4BBK A;  1PFJ A;  3PVW A;  5FI0 A;  2LBB A;  3ZTD A;  2LWP A;  2N9P C;  1WJU A;  1P1A A;  1DIK A;  1V9J A;  1YJ1 A;  1PLS A;  2DZJ A;  5E6P A;  2J0M A;  2C7M B;  2KMA A;  5C79 A;  1MG8 A;  1WMH B;  4XZ4 A;  4KAX B;  2BWF A;  2MP2 B;  1YX5 B;  3G9W A;  2RSU A;  5HE1 A;  2A4Z A;  2KWU B;  1QC6 A;  2Z59 B;  1RFA A;  4ICV A;  3ULC A;  2DYB A;  1UBQ A;  1IYF A;  2YS1 A;  2BKR B;  5DPR A;  3E9O A;  3DBH I;  1E5W A;  4GDK B;  2R82 A;  2KDB A;  3NZS A;  4A3O A;  4G50 A;  1NTY A;  4NQK E;  2YRY A;  3FM8 C;  3ZVR A;  4NNJ B;  4CO7 A;  4A6K A;  1MAI A;  1XCG A;  1SE9 A;  2UVM A;  3OJ4 B;  4BKS A;  1EUV B;  3X0W A;  1WGH A;  3M3J A;  4WQO B;  2O6V A;  2I1J A;  4AJY B;  3SD5 A;  2Q13 A;  1K8R B;  3SU8 X;  4EZJ A;  2KX3 A;  4FN2 A;  4EJN A;  1OY2 A;  1YX6 B;  3APF A;  2LRU A;  2N23 A;  5DHA B;  4FA6 A;  4K81 A;  3E9L A;  3V5W A;  4G3X B;  2IZV B;  5DHF B;  1HBK A;  1P98 A;  5D6J B;  2BF8 B;  3VVW B;  4DBG A;  3W1S C;  2N9X A;  4BOZ B;  2L3Z A;  1WX7 A;  4L6E A;  2ZVN A;  1Z2M A;  2CU1 A;  2ROV A;  1JDE A;  4BBN C;  1LW3 A;  3B08 A;  2YT0 A;  4MT7 A;  1WRD B;  3H7P A;  4JKA A;  3ODO A;  2CY5 A;  4F7U P;  3DVG X;  4EMO A;  4MJS B;  3D8F A;  4DHZ E;  3BJI A;  4DX8 A;  2MFQ A;  1ST7 A;  3DXD A;  1V6E A;  3RYT A;  2WX1 A;  4EZK A;  1RRP B;  3OAN A;  1U4A A;  5JZE B;  4BBN F;  2QKL A;  1NTV A;  2IY1 B;  1WZ0 A;  3H7S A;  2LI5 A;  4PQ0 A;  2HRJ A;  5AZH A;  3F0W A;  2MBB B;  2IY0 B;  4M0W B;  1MIX A;  4LJO B;  3FLV A;  4XX5 A;  4JK7 A;  1C3T A;  4LCD E;  5FI1 A;  2LXC A;  2R0D A;  1VCB A;  1WJN A;  4HB0 B;  2KFK B;  4BKT A;  3PVL A;  4NJ7 A;  4ANV A;  4FJV B;  1WXS A;  5L83 A;  3WAP A;  2CHW A;  2L00 B;  4N9F 4;  3N3K B;  2XK5 B;  4PS7 A;  2BGF A;  5BO4 B;  2P0D A;  1UEF A;  3ZRC A;  2L05 A;  4H8S A;  4ZYN A;  4A20 A;  2D9X A;  1WJ6 A;  2R2O A;  3SO6 A;  1EF5 A;  2P0F A;  3QBV B;  2C7N B;  4MGK E;  4HAT B;  1K5G B;  2LG1 A;  2ZJD A;  4MEM A;  4KIK B;  4K7S A;  1TQZ A;  1OQN A;  4K17 A;  2Z0P A;  4II3 B;  4B9K A;  3HM6 X;  3ZRF A;  2CKH B;  4IAP A;  3DXC A;  3ZDM C;  1GGO A;  2DA0 A;  1VD2 A;  3PT2 B;  2Y7B A;  1WJ1 A;  1LB1 A;  2BYE A;  1DYN A;  2UYZ B;  2JVC A;  2Y8G A;  2D10 A;  3T9L A;  2MWN B;  2MX2 A;  2GBM A;  2LZ6 A;  2JY6 A;  3APC A;  1NDD A;  3UZT A;  2FNJ B;  1DDM A;  2BWE S;  4KHA A;  1TXD A;  4DDG D;  5AZF A;  4MGI E;  1FHO A;  2L7R A;  2CB8 A;  2HTH B;  3DDC B;  4IW0 A;  4DBB A;  1I35 A;  1R4M I;  1XT9 B;  4FLH A;  4B6W A;  1FAO A;  4GDL A;  1QQG A;  3VXW A;  1IPG A;  1EAZ A;  2CRF A;  5DH9 B;  2ASQ A;  2KNB A;  1WM3 A;  3QIJ A;  2K1F A;  3QAR A;  1UGM A;  4MSM B;  5CHV C;  4GN1 A;  1TZ1 A;  1S1Q B;  3KH0 A;  1RJ2 A;  2XBB C;  4DHZ B;  4ILG B;  4WSF A;  2CY4 A;  4HAW B;  3TFM A;  1KZG A;  1WGQ A;  1UNR A;  4JKF A;  3M1I B;  5KQ1 A;  2COF A;  2VRR B;  3AJ4 A;  3RD2 A;  4WJP A;  4JL9 A;  1OQY A;  4TUU A;  3EC8 A;  3QCA A;  2GCL A;  1FGY A;  1WYW B;  2G4D B;  2ZVO A;  4HXD A;  1WE7 A;  2N4F A;  1PQS A;  3AI5 A;  4GMX B;  2MLB A;  3KSY A;  5L95 C;  3MJW A;  1V5M A;  3SYX A;  1A5R A;  1WMH A;  4GPT B;  1C1Y B;  4KSL C;  2LVQ A;  2DHJ A;  2LOZ A;  1J0W A;  3ZTC A;  5C23 A;  1W1H A;  2AYO B;  1ZC3 B;  3RUI B;  5J3T A;  2NS5 A;  4ZRJ A;  4K7W A;  2KTR B;  1V89 A;  2WX0 A;  3ZNI D;  4KSK C;  1WE6 A;  1BTN A;  2GBK A;  1VBH A;  3TBL D;  1WR1 A;  2MKR A;  4NPN A;  3VTU A;  2L2I A;  2X18 A;  2NCN A;  2ZPY A;  2Y8F A;  2D9Z A;  2L76 A;  1D3Z A;  3VTV A;  5CHW A;  1ZSQ A;  3OJ3 A;  1V86 A;  1WJM A;  1NBF C;  5D7G A;  3UQB A;  3Q3F A;  4M8N A;  3KUZ A;  2JUO A;  4E3C A;  3JYU A;  2K8H A;  4AP4 C;  1M7R A;  1U5F A;  2DX5 B;  4WAA A;  1WGG A;  1HB8 A;  4GIV A;  5KQ4 A;  4MDK E;  2L0T A;  2PEA A;  3EEC A;  1IP9 A;  1UBI A;  2ROZ B;  2C7H A;  4PNK A;  3A8P A;  2MBQ A;  1UNQ A;  4GU2 A;  1PMS A;  3JVZ X;  3W1Y A;  2PE6 B;  3VIA A;  2KTF A;  3HIZ A;  3VUW A;  3UIO B;  3DBL I;  4II2 B;  3KRW A;  4AJW A;  2FCN A;  2H7D A;  1MK7 B;  5FR6 A;  3ZNG C;  2L8J A;  3ML9 A;  2YLM A;  1V80 A;  3IHP C;  3ONS A;  3WAN A;  4IC7 B;  3WAM A;  2MRP A;  1KJT A;  3O65 B;  2YT1 A;  1Q1O A;  2DEN B;  2RUK B;  3PHX B;  1BWN A;  1M94 A;  3DBS A;  2MQJ A;  4ZRK A;  3F5R A;  4W9F A;  3RZF A;  1GUA B;  2REX A;  1KOT A;  4MY6 A;  2NVU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...