2J0MA

Crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
329
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Basis for the Autoinhibition of Focal Adhesion Kinase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 329
sequence length 329
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2j0mA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j0mA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2j0mA01
5CHVC 1WGHA 1WGQA 2RGFA 2N0YA 4GMXB 4NJ6A 5JHAA 1NTIA 2I5FA 4FHKA 1C3TA 3L0WB 5HE3A 2KOXA 4EOYA 1DDMA 1UNPA 4YONA 2JPHA 2J0KA 2XQNM 2VKIA 2DLWA 1E8WA 2MA9B 2MBHA 2YLMA 2RNRB 1P3QU 2BWFA 3TMPB 3Q3JA 1TJ6A 2LGYA 4BKGA 3PG7A 4KZ0A 3B08A 5IAAC 1UGMA 4I6NB 2D3GA 1TGZB 1LB1A 4NQKE 2DX5B 3PP2A 3KH0A 4KDLB 1M94A 2K8HA 2PE9A 4MEMA 4DXAB 2K8BA 3ZTCA 3AU5A 4FJYA 1EAZA 3WALA 1BT0A 2ROVA 4LJOB 4B6HA 2LYDA 2LRWA 3OJ3A 3H7PB 2OTXA 1AWEA 1WJ6A 3VH3B 1IPGA 4PS8A 4AJWA 1X1MA 1X86A 1UBQA 4RM8A 3ZRCA 5JHHA 2KNBA 4IWOA 2JUOA 2DTCA 1WJNA 1OY2A 1WXVA 2BGFA 2RLOA 4AP4C 2CHZA 2DENB 5DHFB 1NU2A 1BAKA 4M8MA 5TR5A 1L7YA 4W9GA 1W1DA 4FHJA 2M38A 3QARA 3I3TB 4DHJD 1U2BA 1HE8A 3IHPC 3PV1A 4W9HA 4HDQA 1V89A 2M17A 2D2QA 5J17A 5D3XA 2NPTA 2LBBA 2MWSB 3DXCA 2DZIA 1YX5B 3WAMA 4NSWA 2CHWA 2KC2A 4M8NA 1TXDA 3JW0X 2J7QB 4A6KA 2L1CA 1W1HA 4AJYB 1BTKA 4HAZB 2FDQA 1WJ1A 3APFA 1PFJA 2I1JA 4NNJB 2DYNA 2HTHA 2FCQA 1UELA 5JH5C 5DPWA 2DZMA 1V61A 1I2HA 4MELA 2M1MA 3SU8X 2C7MB 3UZTA 4IM3A 2JRHA 4GDKA 2KWUB 2COPA 2C7NB 3ZDTA 1WZ0A 1UBIA 2DYMA 2KANA 2N9EB 1Q0WB 3A33B 1KOTA 2N7DA 2DHIA 3JYUA 2LVOA 1WGDA 2DN6A 5CHWA 2R09A 5J18A 2V1YA 1QZEA 4KVGB 4HVBA 2EMSA 3O65B 1J19A 2WX1A 3QBVB 4II2B 5E6OA 2GBNA 5C1ZA 2LG1A 1GUAB 3NZSA 1B55A 2LVPA 4WJNA 5D3YA 3IVFA 1YJ1A 4IWPA 2ZJDA 4ICVA 2JRIB 1YD8U 2N9PC 1K5GB 2DFKA 1EUVB 2YT1A 3HHMA 3L10B 1J0GA 5HE1A 1M7RA 5KHOA 1Y8RC 2JZ3B 5D94A 5DH9B 4H8SA 2BKRB 2PE6B 4WJ7A 3ENEA 3OANA 2ZCCA 4LDTD 4FN2A 3EPYA 4WSFA 3KRXA 1WH3A 3SNHA 3PHWB 2L3ZA 4Y94A 5D7GA 4XZ4A 4ANXA 3ZNHB 1ZM0A 2QKMA 4E74A 1P1AA 3CSTA 4PYUA 1QC6A 3IBEA 2HE7A 2VSZA 4W9KA 3FEHA 2PZ1A 2Y8FA 1S3SG 1IRSA 2H7DA 1H4RA 4CYEA 3UF8A 3LJUX 3GYOA 2HJ8A 1X1GA 3RD2A 3VTWA 4I6PA 4TUUA 2EKEC 4GXBA 2JWZA 2BYEA 1H10A 2LXAA 4BBKA 1WIAA 2PEAA 1FGZA 2LI5A 1P3RA 1DYNA 4GZUA 5FR6A 3M95A 1J8CA 3NHEB 3ZNZB 4A3PA 1ZC3B 3KRWA 3MDBC 2NS5A 4XWXA 3KYDD 3IFWB 3ZNID 4IW0A 3W1YA 3NSUA 2CS4A 3NY5A 5L83A 1NBFC 1WVHA 3PVWA 3PRMB 1ZVRA 4K17A 2DYOA 2KTRA 1DDWA 1K8RB 1CMXB 3A9JA 3ML4A 2KWVB 2IO3B 1XT9B 4WJPA 2K6QA 3EC8A 4A3OA 1EF5A 2L0TA 2CB8A 3SV1A 4K7SA 2MQJA 4HB4B 1XODA 5AEKB 1UEFA 2AWTA 3RZWC 3TO1A 2LJ5A 4IC7B 2BWES 1RLFA 2W2XC 2KJRA 3N30A 4URKA 1AQCA 1PQSA 3L17A 5JLJB 2IZVB 3F5RA 1A5RA 3GYPA 4EUTA 4F1SA 1MK9B 2COCA 4DDGD 2AEHA 1U27A 4YL8A 3B0AA 3VAWA 3VUXA 2XK5B 1HB6A 2DA0A 5C23A 1V88A 2D4QA 1UZXB 5C5BB 4FBJB 2IYBA 2UYZB 3D8EA 2C9WB 2ZNVB 2FIDA 3DBLI 3IG3A 2DAFA 4NY0A 2NBWB 4WJQA 2K25A 2KKCA 5J3YA 1V5OA 4G11A 1GG3A 3M63B 3ECIA 4GGQA 4GPTB 4HAVB 2BCJA 5LLIA 2RQ1A 3ZVRA 2L2IA 2GCJA 1SE9A 2OJRA 4DBGA 2D9WA 2LVQA 4PNKA 1EGXA 3VOQA 1WY8A 3KVFB 1KZGA 2YS1A 1P9DU 1F9JA 3VXWA 4XX5A 3ZDMC 1X1FA 1E7UA 3R7QA 5D2MB 2UZRA 2UWQA 2B3AA 4G0NB 2KX0A 4G50A 4GSWA 1LM8B 2G4SA 2MW5A 3DPDA 3QHTA 4MDKE 1UNRA 2D07B 5DCNA 2KC1A 4B95A 4ICUA 2MP2A 1E7VA 5HE2A 3NS8A 4CHKA 1SHCA 3NOBA 3L08A 2M8SA 3GZNI 1FGYA 3PSEB 3ZNGC 5DPTA 2FIFA 3C0RB 4IWQA 1WM3A 4FJVB 2L8JA 1LXDA 3VTVA 2CKHB 1PLSA 2O6VD 3ODOA 4BOZB 3T9LA 4A6FA 3ULCA 4AOFA 3BINA 2ELAA 2NZ8B 1WJ4A 5KCVA 3TFMA 1UPQA 3PS6A 1Q1OA 3SD5A 3U8ZA 2IO0B 1Q67A 2KN5A 2Z0DB 1KJTA 4HHVA 3TIXA 2KVRA 3ZTDA 3ZUNA 3A1QA 1MAIA 2NBVB 5J2RA 3DVGY 2KQ7A 4FJZA 2N7EA 3TJPA 2VRRB 1FAOA 4HAUB 2O6VA 2RGNB 2P0DA 4MGYE 5GMVA 1I35A 3FLVA 3AI5A 1WR1A 2CU1A 1ZGUB 2Z0QA 3KUDB 3ML8A 4KHOA 2WDTB 4XC2A 5HE0A 2YS5A 3N3KB 1FHXA 3D8FA 1WZ3A 4BKTA 3WIMA 1V5TA 2LKOA 3VHTC 3APDA 1WRDB 3H9DA 2WYQA 1RAXA 4HWIB 1WI1A 3A4RA 1OEYJ 2MP2B 2CY4A 5D3VA 2K00A 1U5FA 3V60A 4W9FA 2D9YA 1Y19B 1WXMA 2ZNVC 5G55A 4CHJA 2CRFA 3PTFC 1BWNA 5IA7A 3TBLD 1V81A 5EDSA 5C79A 4WJOA 4BOSC 1G6JA 4W9CA 4FULA 4F7GA 4DDID 4AUQC 3P2BA 2ZCBA 3RUIB 3TL5A 3UGBB 4ANVA 2YVCA 1EVHA 1UH6A 1TZ1A 2MFQA 1U4AA 5AZFA 3MHSD 2LZ6A 3EHVA 2NCNA 2KJ6A 2C60A 2LRUA 4JLCA 5L81A 1E5WA 4DBBA 1WX9A 3AU4A 4EZKA 2H7EA 5KQ4A 3W1SA 2KQSA 4IUMB 3EFUA 3A8PA 1MG8A 5CLLB 1WMHA 2Z0EB 2ZPNA 3AJ4A 2LUEA 3O96A 2IY0B 5JHGA 4J6IA 5AZGA 4C0AA 2NPTB 2Q13A 2A4ZA 3KY9A 1TQZA 4BKSD 2GBKA 3MTNB 3QA8A 2IYDB 4M0WB 4ANUA 2UVMA 3DBRI 5JHBA 2BPSA 1V2YA 5L95C 3PRZA 2KDEB 2MRPA 1WXAA 4B6WA 1WI0A 2DHZA 1KI1B 4MGKE 1V9JA 3U7DA 3P7ZA 4DHJB 4GDLA 4HK2A 4KAXB 2DZKA 2HTHB 4OVVA 1H8CA 3DBSA 1UNQA 3RT3B 2ZZPB 3DXDA 5KHQA 5D6JB 2KLGA 4GB9A 3CIKA 2K39A 1VCBA 3FSSA 3KUZA 3DBHI 4GDKB 1MPHA 4EJNA 1XKEA 1XR0B 3CXBB 4DHZE 4ASWC 1W1GA 1WM2A 2RR9A 1WMHB 1ZKHA 3V6EB 3N32A 2CQUA 1V6EA 4CO7A 3DQVA 2WH5A 2LGDA 5LXHA 4GMVA 2KJHB 3HK0A 1XX0A 4GIVA 2Y7BA 5LONB 3B1LX 4TYZA 2KCJA 2K2JA 4OVUA 4W9DA 1DROA 2IFSA 4IG7B 2MBBB 2G35A 3QCAA 2BYVE 3DDCB 1BTNA 4WWNA 2C5LC 1FXTB 2DX1A 2LXCA 3HQCA 1U5EA 4W9LA 2KDFB 3PT2B 4A20A 4BVUC 4A6HA 3A9KA 4F7UP 2G3QB 3A98B 1DBHA 4FA6A 3SDLC 4D0NB 3DVGX 2RSGA 4KHAA 1WR6E 4TQ0A 4KDIC 4ZDVA 4MJSA 3NZUA 4MM3A 1V86A 1JRUA 3WAOA 2FCNA 2KGXB 1P98A 4K2OA 1E8YA 2JF5A 2O2VA 3S2AA 2NR2A 3JSVA 2P8VA 2YF0A 5J3QA 2J59M 4MGIE 1FHOA 1V49A 1KM7A 4MSQB 2OQBA 4GN1A 3Q3FA 5FI1A 1S1QB 5JP4A 4EZJA 2M4NA 2FJ9A 4HPLB 3TVVA 2D10A 1UPRA 5D3WA 1RRPB 3VIAA 1FOEA 3G9WA 3OAWA 1R4MI 2DHKA 4KIKA 4HB0B 1YQBA 4NAWA 2MLBA 2QKLA 2P0HA 3PGEA 2GMIC 4DWFA 1E8XA 2JP2A 1LFDA 3RULA 1D3ZA 3VDZA 5JZEB 4WQOB 2EMTA 2LASA 2MX2A 1ZC4B 3HIZA 3WA0A 4WVFB 2D9ZA 4WWOA 3AXCA 3ZRFA 1V5PA 1WGGA 4GOCA 4N9F4 3DXEA 2FUHB 3PPAA 4RMAA 4E3CA 3V6CB 4WWPA 5BO4B 2LWPA 4KSLC 2KTRB 2O2VB 2AL3A 3QIJA 4AWJA 3A9JB 1Z5SB 2XBBC 4TKNA 3PVUA 4ZRKA 1WX8A 4LCDE 2DKQA 3KZ1A 2PPHA 2Y5BB 4HB2B 3VTUA 4II3B 3UINB 3APCA 4IM0A 2DX5A 1GC7A 2K8CA 3BJIA 4JGHB 3QWZB 3HM6X 1QQGA 3H1UA 2XEWA 4NQLB 4A5KA 1T0YA 2CAYA 3QC8B 3L54A 1WJMA 2X18A 3QX1A 3QK0A 4KV2A 3ZLZA 3H7PA 2KFJA 4K1RB 3ZO5B 2KLCA 2GBRA 2K2UA 3QJZA 1SGHA 1MIXA 2KMAA 4W9IA 1ZSQA 2L00B 2KWCA 5EFXA 2GOWA 3UQBA 2C7HA 2MSED 3KW5B 1EO6A 3ONSA 2DYQA 4Z2NA 1YX6B 2IO1B 4G3XB 2GBMA 3ALBA 3UIPB 4BFRA 4ZRJA 2MBEA 4DX8A 2DYBA 3L13A 2KDBA 2N9XA 2EC1A 4NJ7A 1I42A 3LJ3A 2NVUI 2FCSA 3U30A 2MDXA 2LGXA 4PS3A 3P6AA 4EZLA 1I7AA 3ODXA 4FLHA 4PS7A 3R66C 1VD2A 2HRJA 3GOEA 2LD9A 1WJUA 1J0WA 3TCAA 3PVLA 5J3TA 4KHBB 2REXA 2W2XD 1P5TA 3M1IB 5DIFB 2NBUA 4MY6A 2P0FA 3JVZX 5DHAB 2KX3A 3AULA 5KQ1A 2ZPYA 3VH4B 4GU2A 3FM8C 1FHWA 2W9NA 1XD4A 1C1YB 4W9EA 3T8MA 4I6LB 5IJMA 2GCLA 1X11A 4Z2MB 3M3JA 4MT7A 2OOBB 3MJWA 4A6FB 5CTRC 4HCPB 1WGRA 3DVNU 2D11A 4ZRIA 1M7EA 2L76A 2KHWB 1XCGA 3DOWA 2RVBB 2JXXA 3T06A 1TBEA 4NPNA 2V76A 2DHJA 4E71A 1TTNA 3A1QB 2VRWB 3ZIMA 2I5CA 1NTYA 1YIWA 4EMOA 1P6SA 1MK7B 4DX90 2CY5A 1NTVA 2O6VB 1DDVA 3K9OB 4JL9A 1WFYA 2COFA 4K81A 3X0WA 1WE7A 4B9KA 1PMSA 3LDZE 5DPSA 3TW1A 2KXJA 1OEYA 2CHXA 3DCGA 3PLUA 4HXDA 1UD7A 2E2XA 2N1VA 2AL6A 3SYXA 3DVNV 2PJHA 2ADZA 5G2NA 1GJZA 2YT0A 2N4FA 1V5UA 2RPQA 1Y5OA 1OGWA 1U5GA 5C16A 2ZVNA 1Q5WB 2V4LA 3WAPA 1IP9A 1LQBA 1L2NA 4P7IA 3F0WA 1EF1A 3PLVA 2UZSA 1WGYA 4HAXB 1NVLA 5D27A 2CR5A 3A8QA 2WX0A 1WGUA 2YSZA 4EEWA 2R2OA 4KZCA 1WE6A 3ML9A 1ST7A 3WYFB 3MPXA 3RCPA 4MK0A 1FB8A 3PHXB 1XD3B 3CMMB 4BBNC 5HKHA 3D8DA 2IBIB 3RYTA 1P0RA 4BKSA 3OJ4B 2IY1B 2HD5B 3FP5A 3PSCA 2MBOA 2K1FA 4W9JA 1NDDA 3V62A 2CODA 3QWMA 4HPMB 5E6NA 2GBJA 3PREA 4DK5A 3ZW3A 5CX3A 2JY6A 2GS0A 4K7WA 3KSYA 2FNJB 1GNUA 3M62B 2ZVOA 5E6PA 4HCNB 4HJKA 3L16A 5DI9B 1X05A 1WX7A 2QHOA 2YRYA 2L05A 4HAYB 2K6DB 2J0MA 1KZ7A 4HAWB 2MWNB 2NMBA 2L7RA 1U5DA 1AARA 3D32A 3V61A 2Y8GA 2JZZA 2DZJA 5DPRA 1V5MA 3EECA 2FAZA 2KMCA 4MGZE 4HATB 4GDLB 2Z0PA 3N7CA 4EKUA 2FJLA 2ABDA 1K5DB 4IOYX 2RUKB 1LW3A 2M0XA 3PEGA 2XK5A 5FI0A 2KZRA 4TV3A 5C5BA 3R7RA 2G4DB 2KFKA 3K9PB 2FCMA 4LJPB 2MBQA 3OLMD 2D9VA 2I1KA 2KDIA 3CSFA 3V5WA 3H7SA 3PZDA 2A5UA 1RFAA 1RJ2A 2KO3A 1ZW7A 5LXIB 3H6NA 2JT4B 2MCNB 4TQ1A 2KD0A 2N23A 2WWZA 2ELBA 1U29A 3ODWA 1R4NI 3SUZA 4LDTB 4JQWC 4WAAA 4F8CB 4IFSA 5AZHA 3VUWA 1OQNA 2DKPA 3HM3A 2RSUA 2BYFA 3A4SC 1OQYA 4IAPA 5CHFA 1WG7A 2LOXA 2D9XA 2BF8B 2LULA 1HBKA 5LOPB 1N3HA 1WYWB 4RM9A 1HB8A 3R3MA 1WF9A 4X57B 1E90A 4KSKC 2MKRA 3UIOB 2BKFA 4PYZA 1Z2MA 3QQ8B 1OTRB 2LOZA 3A9KB 3WANA 1GC6A 2R0DA 2JVCA 3VUYA 3UQAA 4K7UA 3BY4B 4DHZB 4PQ0A 3VFKA 3VVWB 4HB3B 4ANWA 2RD0A 2M14A 4MJSB 1XQQA 4HLEA 2KK8A 4K2PA 4CHMA 1SIFA 2Z59B 4HDOA 2ASQA 2KFKB 3SO6A 4L6EA 1V80A 4MH0E 2W2WA 1MKEA 4EFOA 5CLQB 3CF6E 1MIZB 2ROZB 3KUCB 3ZKJC 5GOWB 2IO2B 3SHQA 3JSVB 4ZYNA 4F7ZA 2R2QA 3W1SC 3ZVVA 2ZEQA 4F7HA 4BBNF 3PRPB 2Z0OA 3RCZA 1ACAA 2DAJA 1IYFA 2G45B 2COAA 1WXSA 2EJ8A 4KIKB 3X23A 2KUPA 2KTFA 1OMWA 2J0JA 2GJYA 2AYOB 4NAWB 4JIOU 1Z87A 3KYCD 3HW2B 4MSMB 5C6RA 3RZFA 4FADA 3ULBA 3QAQA 1E8ZA 2YS3A 4IM2A 1ISNA 1NI2A 2N1WA 3VQIA 2L0FA 2V3SA 1KLVA 1RRBA
chains in the Genus database with same CATH superfamily
3U12A 2ON8A 2E6XA 5CHVC 1WGHA 1WGQA 2RGFA 2N0YA 4GMXB 4NJ6A 5JHAA 1NTIA 2I5FA 1F77A 4FHKA 4ZRPA 1C3TA 4R3DA 3L0WB 2BB5A 2LMCA 4JWUC 5HE3A 2KOXA 4EOYA 1UWMA 2HTME 1V1PB 1DDMA 2YEPB 1ZUD2 1UNPA 1QOGA 4YONA 1FRRA 2JPHA 2J0KA 2BS4B 2XQNM 2VKIA 2DLWA 1E8WA 4EE2A 2MA9B 1KLUD 2MBHA 2YLMA 3Q3OC 4JK7A 2PTLA 1NYRA 1ZDXA 2RNRB 2NTTA 4XE0A 1P3QU 2BWFA 3TMPB 3TUOA 3Q3JA 1PYWD 1TJ6A 2LGYA 4BKGA 5TSSA 4REZA 3PG7A 4C80A 4KZ0A 3B08A 3VR9B 5IAAC 1UGMA 4I6NB 2IDYA 2PKOA 4IKGA 4YXDB 2D3GA 1TGZB 1LB1A 3NWFA 4NQKE 4YSXB 2DX5B 3PP2A 3KH0A 4KDLB 4WURA 1TY0A 1M94A 5MPOA 2K8HA 2PE9A 4MEMA 3RNBC 3MC0B 4DXAB 1TYGB 2K8BA 4N6EB 4QJ4B 3ZTCA 1J7BA 3AU5A 4FJYA 1YQ4B 1EAZA 4S17A 4ZOHC 3WALA 1JALA 2QJLA 4KKIA 1BT0A 3IXSA 1LGRA 2BBCA 2WXKA 2ROVA 4LJOB 4DXGA 4B6HA 2LYDA 1VZ6A 2LRWA 4DXFA 3OJ3A 2EELA 3H7PB 2OTXA 1AWEA 1WJ6A 3VH3B 1IPGA 4PS8A 2PMVA 4AJWA 1X1MA 1X86A 1MI0A 1UBQA 4RM8A 3ZRCA 5JHHA 2KNBA 4IWOA 3N1XC 2JUOA 4OSNA 2DTCA 3IT6B 1WJNA 1OY2A 2CJNA 1WXVA 2BGFA 2H88B 1QOBA 2RLOA 4AP4C 2CHZA 1DYQA 2DENB 5DHFB 3Q69A 1NU2A 1BAKA 4M8MA 5TR5A 1L7YA 4W9GA 1KC7A 1W1DA 4FHJA 2M38A 3QARA 3I3TB 4DHJD 1U2BA 3BYYB 3FILA 1HE8A 3IHPC 3PV1A 4W9HA 2V4IB 4HDQA 1V89A 2M17A 1KF6B 2FBWB 3OWEB 2INCC 3PO0A 1AN8A 4BAXA 2D2QA 4WH4A 5J17A 1ROEA 1TY2A 5D3XA 2NPTA 2LBBA 3IAM1 4J3OD 2MWSB 3DHGC 3DXCA 3DBLB 3RNFC 2DZIA 2QC8A 1YX5B 3WAMA 4NSWA 1PDXA 4M0WA 4QJ5B 4M00A 2CHWA 2KC2A 4M8NA 1TXDA 3JW0X 3P63A 2J7QB 4A6KA 4XYCA 2L1CA 1W1HA 1KBLA 1RWSA 4AJYB 5BYRA 5BMIA 1BTKA 4C4VA 1MHXA 2BS2B 3VRBB 4HAZB 4NZLB 2FDQA 2VZKD 1WJ1A 3APFA 1PFJA 2I1JA 4NNJB 2DYNA 2HTHA 2KACA 2FCQA 1UELA 5JH5C 1T3QA 3U2SC 5T8IA 2Z4DA 5DPWA 2DZMA 1V61A 3SFDB 1I2HA 4MELA 2M1MA 4ILJA 3SU8X 2C7MB 3UZTA 4IM3A 3O13A 2WXJA 2JRHA 4GDKA 4NAMA 2KWUB 2COPA 2C7NB 3ZDTA 1C78A 1WZ0A 3EUB2 1BMLC 1UBIA 2DYMA 2KANA 1N63A 1ZYIA 3BVZA 2N9EB 1Q0WB 4P1CC 3A33B 1C9FA 1KOTA 5FK9C 2N7DA 1EU4A 2DHIA 2IGHA 1DGJA 1CZPA 3JYUA 2LVOA 1WGDA 3FILB 2DN6A 2K0PA 5CHWA 4YTPB 3SFEB 2LHDA 2R09A 3E9SA 5J18A 4PT5A 2V1YA 1HZ5A 1SE3A 1QZEA 4KVGB 3W9CB 1FIQA 1FO4A 4HVBA 2EMSA 3GZNB 3O65B 1ZE3D 1J19A 2WX1A 3QBVB 1JROA 1N5WA 4II2B 5E6OA 2GBNA 3BZDB 5C1ZA 2LG1A 1GUAB 3NZSA 1B55A 2LVPA 5HHDG 4WJNA 4GNKB 5D3YA 3IVFA 3W5VB 4Q2JA 5LG4B 1YJ1A 4IWPA 2ZJDA 2QILA 4LNOA 4ICVA 2JRIB 1YD8U 2N9PC 1K5GB 2DFKA 1EUVB 2YT1A 3HHMA 1TZOA 3L10B 3EGRA 5EE0A 1J0GA 5HE1A 2WU5B 1IBXA 1M7RA 5KHOA 1Y8RC 1AYFA 2JZ3B 5D94A 5DH9B 4H8SA 2BKRB 4ZRQA 2PE6B 4WJ7A 1WSPA 3ENEA 4JKGA 3OANA 2ZCCA 4LDTD 4FN2A 3EPYA 4WSFA 2SEBD 3KRXA 1WH3A 3SNHA 3PHWB 2L3ZA 4Y94A 2WXHA 4JE3B 2BT6A 2JYTA 2INDC 5D7GA 3ETRA 5C2TB 1JCKB 4XZ4A 4ANXA 3ZNHB 1L5PA 1ZM0A 2QKMA 4E74A 1P1AA 3CSTA 4PYUA 3GE8C 1HA5A 1QC6A 4RGTA 3B2GA 3IBEA 4PK1A 2HE7A 1PFDA 1DOIA 2VSZA 1C4CA 4W9KA 3FEHA 3ZYYX 2PZ1A 3SEBA 1Q10A 2Y8FA 1S3SG 1L6VA 3Q14C 5HI1A 3MHZA 3NJTA 3KWLA 1SJED 1IRSA 1XF5L 2JSVX 1KLGD 2H7DA 1H4RA 1TJEA 2CU3A 4CYEA 3UF8A 3URYA 3LJUX 1NENB 1XLPA 3GYOA 2I38A 2HJ8A 3L4PA 1JWUD 1ESFA 1BUIC 1X1GA 3RD2A 1EWCA 1WWTA 2WXGA 2OEDA 3VTWA 4I6PA 4LLGM 4TUUA 2EKEC 4GXBA 2JWZA 2D3AA 2BYEA 3AEAB 1FMAD 1H10A 2LXAA 1EM7A 4BBKA 1WIAA 2N0SB 2PEAA 1FGZA 2LI5A 1P3RA 1DYNA 3HIEA 4GZUA 1ZOYB 5FR6A 3RPFC 3M95A 3ZXVA 4JKAA 3AECB 1J8CA 3NHEB 3ZNZB 3AMZA 5IN7A 2AQ1B 4A3PA 2WU2B 1ZC3B 3KRWA 3MDBC 2NS5A 3BYTB 4XWXA 4IOIE 2J52A 3IFWB 3KYDD 3ZNID 4IW0A 3W1YA 3NSUA 4BZAA 1YQ3B 2CS4A 3NY5A 5L83A 1NBFC 1WVHA 3PVWA 3PRMB 1ZVRA 1I4XA 4K17A 4B0EA 1TKYA 4KX6B 2IGGA 1TS3A 2DYOA 2KTRA 1DDWA 1K8RB 1CMXB 3A9JA 3ML4A 2WDRB 2KWVB 2IO3B 1XT9B 1IGDA 2K6QA 4WJPA 3FC4A 5HG2A 1F52A 3EC8A 4A3OA 1YJJA 1ZDVA 2OJWA 1EF5A 1VLBA 2L0TA 3ZQ4A 2CB8A 3SV1A 2MJ3A 4K7SA 1L0VB 2WHIA 2GLSA 2MQJA 1LO5D 4HB4B 1XODA 1E9MA 2W55A 5AEKB 1UEFA 2AWTA 3RZWC 3TO1A 2LJ5A 4ARCA 2GB1A 2JU6X 4IC7B 2BWES 1RLFA 2W2XC 2X38A 2BTEA 2KJRA 2WLBA 4YSZB 2WGSA 3N30A 1N5XA 4URKA 1AQCA 1PQSA 3L17A 5JLJB 2IZVB 3F5RA 1A5RA 3GYPA 3W2DA 1TKGA 4EUTA 4F1SA 1MK9B 2COCA 4A6QA 4DDGD 2VH2A 2AEHA 2RMMA 4XWWA 4JKBA 1U27A 4YL8A 1SXTA 3B0AA 3VAWA 3VUXA 3DBRB 3VRAB 2XK5B 1HB6A 3E9LA 1FM0D 1XCQL 4RNAA 2DA0A 1P7FA 5C23A 1V88A 1EWYC 1YOVB 2W82A 2D4QA 2K9XA 1UZXB 5C5BB 1NVID 1QILA 2JYEA 4FBJB 2IYBA 2UYZB 3BWUD 2K5PA 1ET9A 3D8EA 1XLOA 2C9WB 3ZJVA 5H92C 5H8YE 2ZNVB 2FIDA 2X0SA 3DBLI 3IG3A 2EKIA 3BK2A 1VBHA 3C8YA 3N9YC 2DAFA 1NYQA 1B9RA 1FCLA 4NY0A 2NBWB 4WJQA 2K25A 2KKCA 5J3YA 1V5OA 5IOIA 4G11A 1GG3A 3M63B 3ECIA 1GGOA 1I7HA 4GGQA 1PGAA 4GPTB 4HAVB 2BCJA 3DBHB 4OZAA 5LLIA 2RQ1A 3ZVRA 2L2IA 2GCJA 1WYGA 1SE9A 2OJRA 2W3SA 2Y3AA 4DBGA 2D9WA 1T77A 2AX5A 4JKDA 2LVQA 4PNKA 1EGXA 3VOQA 4JKFA 1WY8A 3KVFB 1KZGA 2YS1A 1MG4A 1QOAA 1P9DU 1J7CA 1F9JA 3VXWA 4XX5A 3ZDMC 1X1FA 1E7UA 3R7QA 5D2MB 2SAKA 1FFUA 3DHIC 2UZRA 1HTQA 4HKZE 2UWQA 4KHBA 3B2FA 2B3AA 4KGSA 4G0NB 2KX0A 3HUIA 4G50A 4GSWA 1LM8B 4RF1A 2ZW1A 2G4SA 2MW5A 3DPDA 3QHTA 4MDKE 1UNRA 4QAYA 2D07B 5DCNA 2RDGA 4O1NA 4L2YA 2KC1A 1JWMD 4B95A 4ICUA 2JZPA 2MP2A 1E7VA 3R2TA 5HE2A 3NS8A 1TKEA 4CHKA 1SHCA 2KUQA 3NOBA 3L08A 4M01A 2M8SA 3GZNI 1FGYA 3PSEB 3ZNGC 5DPTA 1GPXA 4HROA 2FIFA 4ITKA 3C0RB 4IWQA 1WM3A 4FJVB 2MH7A 2L8JA 3GE3C 1LXDA 3UI3A 3Q8CA 3VTVA 2CKHB 1PLSA 2O6VD 3ODOA 4BOZB 3T9LA 3P4PB 1SEBD 4A6FA 1YN4A 3DHHC 3ULCA 4RFBA 4AOFA 3BINA 3CIRB 2ELAA 2NZ8B 2PW9A 3AEEB 1ENFA 1WJ4A 5KCVA 3TFMA 1UPQA 3PS6A 1Q1OA 3NS1A 5AUIA 3U8ZA 3SD5A 1TT5B 1CJEA 2IO0B 1Q67A 2BS3B 2KN5A 2Z0DB 1KJTA 4HHVA 2WXPA 3TIXA 3RFZB 4D6WA 4HRSA 2KVRA 2L52A 3ZTDA 4ZHOA 2IJ0A 3ZUNA 3E9OA 1MAIA 3A1QA 2NBVB 5J2RA 3DVGY 4H2AA 1UWXA 4JX1C 2KQ7A 4FJZA 2N7EA 3TJPA 2VRRB 3RMKC 1FAOA 4HAUB 2O6VA 2RGNB 2P0DA 4MGYE 5GMVA 2G9HD 1I35A 3FLVA 3AI5A 1WR1A 2KMMA 2K3UA 3TSSA 2CU1A 1ZGUB 2Z0QA 3KWVA 2K8EA 3KUDB 2K22A 3ML8A 4KHOA 2WDTB 4XC2A 5HE0A 3RNGC 2YS5A 3N3KB 3T3OA 3SBTA 1R4MB 1FHXA 3D8FA 1WZ3A 4BKTA 3T3NA 4KGTA 3WIMA 3HVZA 1V5TA 2LKOA 3VHTC 3APDA 2M56B 1WRDB 2DIKA 1T0RC 1WGKA 3H9DA 2WYQA 1RAXA 4HWIB 1WI1A 3A4RA 1DOYA 1OEYJ 2MP2B 2CY4A 4YTMB 5D3VA 4MACA 2K00A 1U5FA 1GOZA 2BVCA 3LB8C 3I57A 3V60A 5C3JB 4W9FA 1XEEA 1FXIA 4JK8A 2D9YA 4UDUC 1PGXA 3NVVA 1Y19B 2JQRB 1WXMA 2ZNVC 1I4PA 5G55A 5G5GA 1YNTE 4CHJA 2CRFA 3PTFC 1BWNA 5IA7A 3TBLD 1V81A 5EDSA 5C79A 4WJOA 4BOSC 1G6JA 4W9CA 2W54A 4FULA 4F7GA 4DDID 1ZP0B 4AUQC 3P2BA 2ZCBA 5GXGB 3RUIB 4P16A 3AV8A 1JWBD 4JPSA 3TL5A 3UGBB 4ANVA 2ACZB 2YVCA 1EVHA 1UH6A 1YMHE 1TZ1A 1PGBA 2MFQA 2QDFA 1U4AA 5AZFA 3MHSD 4N59A 2LZ6A 3AE4B 3NVWA 3SR6A 5I2SA 3EHVA 2NCNA 2KJ6A 2C60A 2LRUA 4ACFA 4RH6A 4JLCA 1F2RC 1AWDA 3Q6BA 4K3CA 5L81A 1E5WA 4DBBA 2KDMA 1F1HA 4XGAB 1WX9A 1UNSA 3FKYA 5JXVA 3AU4A 4EZKA 3E9PA 2N9KA 2H7EA 5KQ4A 3W1SA 2KQSA 3NWDA 4IUMB 2KIGA 3A8PA 2FE8A 3EFUA 2DLBA 1MG8A 5CLLB 1WMHA 2Z0EB 1CQVA 2J42A 4S0RA 2ZPNA 2WP9B 3AJ4A 2LUEA 2R82A 4OZBA 3O96A 2IY0B 2G1EA 5JHGA 1D5ZC 4J6IA 2X8XX 3LXFA 5AZGA 4C0AA 2NPTB 2Q13A 2A4ZA 3KY9A 2WXRA 4ZYSA 1TQZA 4BKSD 2GBKA 3MTNB 3QA8A 2IYDB 1QLBB 4M0WB 3WCQA 4GLSC 4ANUA 2UVMA 3DBRI 2JWUA 5JHBA 2DNFA 2BPSA 1V2YA 5L95C 3PRZA 2KDEB 2MRPA 1WXAA 2BW2A 4QJ3B 2INNE 4WQMA 4US8A 1XO3A 4B6WA 1N62A 1WI0A 2B76B 2DHZA 3DWMA 1KI1B 4MGKE 1FFVA 4C4VB 1V9JA 3P4RB 3U7DA 3P7ZA 3FVCA 4DHJB 4GDLA 3EFCA 4HK2A 4KAXB 2DZKA 2HTHB 2RDHA 4OVVA 3ABVB 1H8CA 3DBSA 1UNQA 3RT3B 2ZZPB 3DXDA 1VRAB 1SE2A 5KHQA 1I4GA 5D6JB 2KLGA 4GB9A 1A70A 3OG5A 3CIKA 1MJDA 2K39A 4LNFA 2INPE 1VCBA 3FSSA 1MI1A 3KUZA 3DCXA 3DBHI 4GDKB 1MPHA 4EJNA 1XKEA 4N58A 3VR8B 5HFYA 2L1AA 1SIJA 3BK1A 1XR0B 1OQQA 3CXBB 4DHZE 4ASWC 1HZ6A 1W1GA 1WM2A 4GOUA 2RR9A 1WMHB 1ZKHA 3V6EB 3N32A 2FUG1 2KIEA 3P4QB 2CQUA 1TIFA 1V6EA 3NZ3A 4CO7A 1F2RI 3DQVA 3BVMA 2WH5A 2LGDA 5LXHA 4GMVA 2KJHB 3HK0A 3KQ4A 1XX0A 1JQ4A 4GIVA 2Y7BA 5IP4D 2PVOD 5LONB 3W5UB 3B1LX 4TYZA 2KCJA 2K2JA 2J53A 3PZ8A 4OVUA 1FCCC 4W9DA 1L0YB 2V0GA 1DROA 2IFSA 4IG7B 3H8HA 2MBBB 2G35A 3QCAA 5G5HA 2BYVE 3DDCB 1BTNA 3BIID 4WWNA 2C5LC 3P1MA 1FXTB 1JWAD 2DX1A 1XXGA 2LXCA 1T0QC 3HQCA 1U5EA 4W9LA 2KDFB 3PT2B 4A20A 4BVUC 4A6HA 3R8BA 3A9KA 4F7UP 2G3QB 4LTUA 1IBXB 3A98B 4KGRA 1DBHA 4FA6A 3SDLC 4D0NB 3DVGX 4D2KA 3GS2A 4AQ7A 2RSGA 4KHAA 1WR6E 2N7JA 4TQ0A 4KDIC 1NEKB 5EE1A 3ZJTA 4ZDVA 4MJSA 2J4XA 3NZUA 4JK9A 1IGCA 2BYTA 1SSNA 3HVDA 4LNKA 2Z59A 4JKGB 2GUMA 1YJIA 3Q8BA 2D3BA 4MM3A 1J7AA 3V05A 1V86A 1VZ8A 1JRUA 3P4SB 1JDEA 3WAOA 1GAQB 2FCNA 2KGXB 1P98A 4K2OA 1E8YA 1C77A 5JVLA 2JF5A 2O2VA 4L1RA 3S2AA 4OHJA 2KT7A 2NR2A 3JSVA 2P8VA 3NG0A 2YF0A 5J3QA 4L23A 2J59M 4MGIE 2QEJC 5I2MA 3FAHA 1FHOA 2Z8LA 1I4HA 1V49A 3J9CA 3TEWA 1KM7A 3NUHB 1D5MC 3RN9C 4MSQB 2OQBA 4GN1A 3Q3FA 1TS5A 1SBBB 5FI1A 1AW7A 1XLNA 1S1QB 3RNCC 5JP4A 4EZJA 2M4NA 2FJ9A 4HPLB 3TVVA 2D10A 1UPRA 5D3WA 1RRPB 3VIAA 4RCOA 1UF0A 1FOEA 1QT9A 3G9WA 3OAWA 1R4MI 2DHKA 3AM9A 4KIKA 4HB0B 1YQBA 2WNMA 3A58A 4NAWA 5D3IB 2MLBA 2QKLA 2P0HA 1NI3A 3PGEA 2GMIC 3N20C 3Q2AC 4DWFA 1I4RA 1E8XA 2JP2A 1LFDA 3AE5B 3AEDB 3RULA 3ZJUA 1D3ZA 3VDZA 5JZEB 4WQOB 1T6BX 1FD6A 2EMTA 2LASA 2MX2A 2WQYB 1ZC4B 1BXTA 3HIZA 3WA0A 2XN9C 1QQRA 3U4EG 4WVFB 4A9AA 2I2YA 4AS1A 2D9ZA 4WWOA 2RPVA 4K3BA 3AXCA 3ZRFA 1V5PA 1WGGA 3IT4B 4GOCA 4N9F4 3NW8A 3DXEA 2FUHB 2VH1A 1V1PA 3AEBB 2MJDA 3PPAA 4RMAA 4E3CA 3V6CB 5EE3A 1L6UA 1C79A 4WWPA 5BO4B 2LWPA 4WAFA 2DBYA 4RF0A 3RI7C 4KSLC 2WXLA 1FEHA 3MFGA 2KTRB 2V9HA 2O2VB 1TS4A 2AL3A 3QIJA 4AWJA 3A9JB 1IUEA 1Z5SB 2XBBC 4TKNA 3PVUA 4ZRKA 1WX8A 4ZHPA 4LCDE 2KVZA 2DKQA 3KZ1A 2PPHA 2Y5BB 4HB2B 3VTUA 2QMTA 4II3B 3UINB 3APCA 2D5GA 4IM0A 2HJ1A 2DX5A 2RRFA 1XCTL 1QOFA 1GC7A 2K8CA 2LGSA 3BJIA 4JGHB 3QWZB 3B9JA 3HM6X 3MC8A 1QQGA 4ILGB 1FNWA 3H1UA 2XEWA 1XLQA 4NQLB 4A5KA 1T0YA 5FR3A 2CAYA 3QC8B 2FJUB 1DOXA 3L54A 3SBGA 1WJMA 2X18A 3QX1A 3QK0A 4OZCA 4KV2A 5IKCM 3ZLZA 3H7PA 4LNNA 2KFJA 4K1RB 2GI9A 3ZO5B 2KLCA 1D5XC 2GBRA 2QCZA 2K2UA 3QJZA 1SGHA 1MIXA 1PUTA 1STEA 2KMAA 4W9IA 1ZSQA 2L00B 2NTSA 2KWCA 2TSSA 2WXOA 1ET6A 5EFXA 2GOWA 3UQBA 3N1ZC 3NVYA 4TMAB 2C7HA 2MSED 3KW5B 1EO6A 2NMQA 1VDVA 3ONSA 2DYQA 3Q8FA 2KAJA 4Z2NA 1YX6B 4OT1A 2IO1B 4G3XB 2GBMA 3AEFB 3N1YC 3ALBA 1RFKA 3UIPB 4BFRA 1SF0A 4ZRJA 3ENBA 1RYJA 1L4DB 2MBEA 4DX8A 2DYBA 3L13A 4XDCA 2WXIA 4RGOS 2KDBA 2N9XA 1C4AA 2EC1A 4NJ7A 1F0ZA 2L83A 1I42A 3LJ3A 2NVUI 1KFYB 2FCSA 3PZ7A 3U30A 4RGMA 4OW0A 2LGXA 2MDXA 3CWIA 1HEZE 1EU3A 2ONQA 4JKEA 4TSSA 4PS3A 3RNEC 3P6AA 4EZLA 4WIPA 5BYSA 1I7AA 3ODXA 2MJEA 4FLHA 4PS7A 3R66C 1E0ZA 1YN3A 1VD2A 2HRJA 3GOEA 1V97A 2LD9A 1R4NB 1WJUA 1J0WA 1E10A 3TCAA 3PVLA 5J3TA 4KHBB 2YT2A 2REXA 2W2XD 1FXAA 1P5TA 3P42A 4HJGE 3M1IB 5DIFB 2HDEA 2NBUA 4MY6A 2P0FA 4LK0M 3Q8EA 1UUPA 3JVZX 5DHAB 2IPKD 2KX3A 5LNK1 3AULA 5KQ1A 3I63C 2ZPYA 3VH4B 4GU2A 4JKHA 3FM8C 3RNAC 2MEKA 1FHWA 2W9NA 2XNAC 1XD4A 1C1YB 4C00A 4W9EA 3T8MA 1D6EC 4HEA1 2H89B 4I6LB 5IJMA 2GCLA 3I9V1 1C4PA 4MH8A 4P6VF 1VZ7A 1X11A 4Z2MB 4US9A 3M3JA 3HSAA 4MT7A 2OOBB 3MJWA 3NVZA 5BMGA 4A6FB 5D3DA 2QSDA 5CTRC 1JWSD 5FKAC 4HCPB 1OFFA 1WGRA 3AEGB 1K52A 2Y5PA 4OVZA 3DVNU 2D11A 3NWAA 4ZRIA 1M7EA 2L76A 2KHWB 1XCGA 3DOWA 2RVBB 2JXXA 3T06A 1TBEA 4NPNA 2V76A 2DHJA 4E71A 1TTNA 3A1QB 2VRWB 3ZIMA 2I5CA 1NTYA 1YIWA 1VJKA 1ACCA 4EMOA 1P6SA 3GP7A 1MK7B 4DX90 2CY5A 1NTVA 1JRPA 2O6VB 1DDVA 1CK1A 3K9OB 1T0SC 4JL9A 1WFYA 2COFA 4K81A 1K53A 1WE7A 3X0WA 1VBGA 1UGJA 4B9KA 1PMSA 3LDZE 5DPSA 1SB3C 3TW1A 1WXQA 2KXJA 1OEYA 4YWGG 2CHXA 3DCGA 3PLUA 4HXDA 1UD7A 1JMLA 5EE9A 5IO9A 2LHEA 3AE8B 2E2XA 2N1VA 2KR0A 4C7ZA 2AL6A 2RDBC 3SYXA 1KRHA 3DVNV 3TEXA 2PJHA 2ADZA 1K50A 5G2NA 1GJZA 1MFWA 3LYYA 1N61A 2YT0A 2N4FA 1HTOA 1V5UA 2RPQA 1MHHE 1Y5OA 1OGWA 1SJHD 1U5GA 5C16A 2ZVNA 1Q5WB 2V4LA 1HQRD 3WAPA 1IP9A 1Y56A 1LQBA 1L2NA 4P7IA 2W3RA 3F0WA 2R2YA 3ZGZA 1EF1A 3PLVA 3C19A 2UZSA 1WGYA 4HAXB 2V3PA 2LEKA 1ZXHA 1NVLA 5D27A 2CR5A 3A8QA 2KWDA 3MJ5A 2WX0A 2M19A 2E3TA 1WGUA 2YSZA 4EEWA 2R2OA 4LNIA 2MHJA 4KZCA 1WE6A 2Z13A 1E7PB 3ML9A 2PIAA 1ST7A 1C76A 3WYFB 3MPXA 3B77A 3RCPA 4MK0A 1FB8A 1XD3B 3CMMB 3PHXB 3V3XA 4BBNC 5HKHA 3D8DA 2IBIB 4USAA 4DQOC 1K51A 3RYTA 3AE1B 1P0RA 4BKSA 1DIKA 3MP9A 1P7EA 3TEYA 3OJ4B 2IY1B 2HD5B 3FP5A 3PSCA 3HRDD 4MT5A 1ZXIA 2MBOA 2K1FA 2IGDA 3AE7B 1KH0A 3AE9B 4W9JA 3NRZA 2BB6A 1KTKA 1NDDA 1WRIA 3V62A 4B0MA 2CODA 3QWMA 4HPMB 2VZKB 3AE6B 5E6NA 2GBJA 3PREA 2LGIA 1N60A 4DK5A 3ZW3A 3EA6A 5CX3A 3R2IA 2JY6A 4YSYB 5I4DA 2GS0A 3TEZA 4K7WA 3U7ZA 1D4BA 3KSYA 2FNJB 1GNUA 3M62B 2ZVOA 5E6PA 4HCNB 4HJKA 3L16A 4A55A 1VR9A 5DI9B 2ZKMX 1X05A 1WX7A 2UU7A 1I4QA 2QHOA 2WDVB 2YRYA 2L05A 4HAYB 2WXFA 3ZXRA 4YT0B 2K6DB 3AN1A 2J0MA 2Q5WD 1KZ7A 4XWTA 4HAWB 2MWNB 2AQ2B 2NMBA 1FRDA 2L7RA 1U5DA 1AARA 1JW9D 2KQ4X 3D32A 4JKCA 3V61A 2KN4A 2Y8GA 2JZZA 2DZJA 5DPRA 1V5MA 3AH7A 1FNVA 2FAZA 3EECA 2N9LA 2KMCA 4MGZE 4HATB 4GDLB 2Z0PA 2CJOA 3N7CA 1V8CA 4EKUA 2FJLA 2ABDA 1K5DB 4IOYX 2M0AA 4NJCA 2RUKB 1LW3A 2KYWA 2M0XA 2LJIA 2WXQA 3PEGA 2JXTA 2XK5A 5FI0A 2PVGC 2KZRA 1TS2A 4TV3A 5C5BA 3R7RA 5E6JA 2G4DB 2KFKA 3K9PB 2FCMA 4LJPB 2BQQA 2MBQA 3OLMD 2D9VA 4KKJA 2I1KA 2KDIA 3CSFA 3V5WA 3H7SA 3PZDA 2A5UA 1RFAA 1RJ2A 2KO3A 1ZW7A 5LXIB 3H6NA 2JT4B 2ZW0A 2Z14A 2MCNB 1L4ZB 4TQ1A 2KD0A 2N23A 3E56A 2WWZA 3GB1A 4IDIA 2ELBA 1U29A 4HPPA 1E6EB 1T5XD 3ODWA 1R4NI 2JX5A 1YN5A 3SUZA 4LDTB 1FNUA 4JQWC 4WAAA 2R61A 4F8CB 4IFSA 2WXNA 5AZHA 3VUWA 1OQNA 2DKPA 4C56C 1FPYA 3HM3A 4L1BA 2RSUA 2BYFA 2L32A 1MVKA 3A4SC 1OQYA 4IAPA 5CHFA 1WG7A 2LOXA 2D9XA 2BF8B 2LULA 1HBKA 3BVGA 5LOPB 1N3HA 1WYWB 5AUKA 4RM9A 1HB8A 3Q8AA 3R3MA 1WF9A 2D3CA 4X57B 1E90A 2WXMA 2AQ3B 1QKZA 4KSKC 2MKRA 3UIOB 4ILHA 2BKFA 4PYZA 3OHMB 1Z2MA 5M4YB 1OTRB 2WS3B 3QQ8B 4CQNA 2LOZA 3A9KB 3WANA 1GC6A 2R0DA 2JVCA 3AE3B 3VUYA 3UQAA 3KLSX 4K7UA 3BY4B 1M4VA 2QIEB 4DHZB 4A90A 4PQ0A 3VFKA 3VVWB 4HB3B 4ANWA 3DWGC 2RD0A 2M14A 4MJSB 2ICIA 1XQQA 4HLEA 2KK8A 1RM6C 4K2PA 4CHMA 1SIFA 2Z59B 3IAS1 4HSIA 4HDOA 1B1ZA 2ASQA 4MM3B 2KFKB 3SO6A 4L6EA 2OHFA 3MC9A 4XDDA 1V80A 2GRIA 4MH0E 2W2WA 1MKEA 2V3NA 4WWMA 2DWQA 4RGNA 4EFOA 5CLQB 2PLPA 2LUMA 1SE4A 3CF6E 2YEPF 1MIZB 2ROZB 4JWSC 2Y5CA 3KUCB 3ZKJC 5GOWB 2IO2B 3SHQA 4QXAB 3Q3MC 3JSVB 3U52E 3E66A 4M02A 4ZYNA 1GB1A 4F7ZA 5BMHA 2R2QA 3W1SC 3ZVVA 4FXCA 2ZEQA 3Q3NC 4F7HA 4CSQA 1HXYD 1ZPSA 2WDQB 3I5JC 4BBNF 4ARIA 3PRPB 2Z0OA 3RCZA 1ACAA 4YTNB 1GB4A 2DAJA 1IYFA 2G45B 1L0XB 4A8XC 4HKQA 2COAA 4DIXA 1WXSA 2EJ8A 1OQRA 4P1BC 1MPEA 3AE2B 4KIKB 3X23A 1QF6A 2KUPA 2KTFA 1OMWA 2J0JA 2GJYA 3AB5A 2AYOB 2NBVA 4NAWB 4JIOU 1Z87A 3KYCD 3HW2B 4MSMB 5C6RA 3RZFA 4FADA 3ULBA 3QAQA 1N6ZA 1E8ZA 2YS3A 5IRSA 4IM2A 5BYQA 1ISNA 1NI2A 1R7SA 2N1WA 1V1OA 3VQIA 2LFIA 2L0FA 2V3SA 1KLVA 2K49A 4C7YA 1RRBA
chains in the Genus database with same CATH topology
5CHVC 1WGHA 1WGQA 2RGFA 2N0YA 4GMXB 4NJ6A 5JHAA 1NTIA 2I5FA 4FHKA 1C3TA 3L0WB 5HE3A 2KOXA 4EOYA 1DDMA 1UNPA 4YONA 2JPHA 2J0KA 2XQNM 2VKIA 2DLWA 1E8WA 2MA9B 2MBHA 2YLMA 4JK7A 2RNRB 1P3QU 2BWFA 3TMPB 3Q3JA 1TJ6A 2LGYA 4BKGA 3PG7A 4KZ0A 3B08A 5IAAC 1UGMA 4I6NB 2D3GA 1TGZB 1LB1A 4NQKE 2DX5B 3PP2A 3KH0A 4KDLB 1M94A 2K8HA 2PE9A 4MEMA 4DXAB 2K8BA 3ZTCA 3AU5A 4FJYA 1EAZA 3WALA 1BT0A 2ROVA 4LJOB 4B6HA 2LYDA 2LRWA 3OJ3A 3H7PB 2OTXA 1AWEA 1WJ6A 3VH3B 1IPGA 4PS8A 4AJWA 1X1MA 1X86A 1UBQA 4RM8A 3ZRCA 5JHHA 2KNBA 4IWOA 2JUOA 2DTCA 1WJNA 1OY2A 1WXVA 2BGFA 2RLOA 4AP4C 2CHZA 2DENB 5DHFB 1NU2A 1BAKA 4M8MA 5TR5A 1L7YA 4W9GA 1KC7A 1W1DA 4FHJA 2M38A 3QARA 3I3TB 4DHJD 1U2BA 1HE8A 3IHPC 3PV1A 4W9HA 4HDQA 1V89A 2M17A 2D2QA 5J17A 5D3XA 2NPTA 2LBBA 2MWSB 3DXCA 2DZIA 1YX5B 3WAMA 4NSWA 2CHWA 2KC2A 4M8NA 1TXDA 3JW0X 2J7QB 4A6KA 2L1CA 1W1HA 1KBLA 4AJYB 1BTKA 4HAZB 2FDQA 1WJ1A 3APFA 1PFJA 2I1JA 4NNJB 2DYNA 2HTHA 2FCQA 1UELA 5JH5C 5DPWA 2DZMA 1V61A 1I2HA 4MELA 2M1MA 4ILJA 3SU8X 2C7MB 3UZTA 4IM3A 2JRHA 4GDKA 2KWUB 2COPA 2C7NB 3ZDTA 1WZ0A 1UBIA 2DYMA 2KANA 2N9EB 1Q0WB 3A33B 1KOTA 2N7DA 2DHIA 3JYUA 2LVOA 1WGDA 2DN6A 5CHWA 2R09A 5J18A 2V1YA 1QZEA 4KVGB 4HVBA 2EMSA 3O65B 1J19A 2WX1A 3QBVB 4II2B 5E6OA 2GBNA 5C1ZA 2LG1A 1GUAB 3NZSA 1B55A 2LVPA 4WJNA 5D3YA 3IVFA 1YJ1A 4IWPA 2ZJDA 4ICVA 2JRIB 1YD8U 2N9PC 1K5GB 2DFKA 1EUVB 2YT1A 3HHMA 3L10B 1J0GA 5HE1A 1M7RA 5KHOA 1Y8RC 2JZ3B 5D94A 5DH9B 4H8SA 2BKRB 2PE6B 4WJ7A 3ENEA 4JKGA 3OANA 2ZCCA 4LDTD 4FN2A 3EPYA 4WSFA 3KRXA 1WH3A 3SNHA 3PHWB 2L3ZA 4Y94A 5D7GA 4XZ4A 4ANXA 3ZNHB 1ZM0A 2QKMA 4E74A 1P1AA 3CSTA 4PYUA 1QC6A 3IBEA 2HE7A 2VSZA 4W9KA 3FEHA 2PZ1A 2Y8FA 1S3SG 1IRSA 2H7DA 1H4RA 4CYEA 3UF8A 3LJUX 3GYOA 2HJ8A 1X1GA 3RD2A 3VTWA 4I6PA 4TUUA 2EKEC 4GXBA 2JWZA 2BYEA 1H10A 2LXAA 4BBKA 1WIAA 2PEAA 1FGZA 2LI5A 1P3RA 1DYNA 4GZUA 5FR6A 3M95A 4JKAA 1J8CA 3NHEB 3ZNZB 4A3PA 1ZC3B 3KRWA 3MDBC 2NS5A 4XWXA 3KYDD 3IFWB 3ZNID 4IW0A 3W1YA 3NSUA 2CS4A 3NY5A 5L83A 1NBFC 1WVHA 3PVWA 3PRMB 1ZVRA 4K17A 2DYOA 2KTRA 1DDWA 1K8RB 1CMXB 3A9JA 3ML4A 2KWVB 2IO3B 1XT9B 4WJPA 2K6QA 3EC8A 4A3OA 1EF5A 2L0TA 2CB8A 3SV1A 4K7SA 2MQJA 4HB4B 1XODA 5AEKB 1UEFA 2AWTA 3RZWC 3TO1A 2LJ5A 4IC7B 2BWES 1RLFA 2W2XC 2KJRA 3N30A 4URKA 1AQCA 1PQSA 3L17A 5JLJB 2IZVB 3F5RA 1A5RA 3GYPA 4EUTA 4F1SA 1MK9B 2COCA 4DDGD 2AEHA 4JKBA 1U27A 4YL8A 3B0AA 3VAWA 3VUXA 2XK5B 1HB6A 3E9LA 2DA0A 5C23A 1V88A 2D4QA 1UZXB 5C5BB 4FBJB 2IYBA 2UYZB 3D8EA 2C9WB 2ZNVB 2FIDA 2X0SA 3DBLI 3IG3A 1VBHA 2DAFA 4NY0A 2NBWB 4WJQA 2K25A 2KKCA 5J3YA 1V5OA 4G11A 1GG3A 3M63B 3ECIA 1GGOA 4GGQA 4GPTB 4HAVB 2BCJA 5LLIA 2RQ1A 3ZVRA 2L2IA 2GCJA 1SE9A 2OJRA 4DBGA 2D9WA 4JKDA 2LVQA 4PNKA 1EGXA 3VOQA 4JKFA 1WY8A 3KVFB 1KZGA 2YS1A 1P9DU 1F9JA 3VXWA 4XX5A 3ZDMC 1X1FA 1E7UA 3R7QA 5D2MB 2UZRA 2UWQA 2B3AA 4G0NB 2KX0A 4G50A 4GSWA 1LM8B 2G4SA 2MW5A 3DPDA 3QHTA 4MDKE 1UNRA 2D07B 5DCNA 2KC1A 4B95A 4ICUA 2MP2A 1E7VA 5HE2A 3NS8A 4CHKA 1SHCA 3NOBA 3L08A 2M8SA 3GZNI 1FGYA 3PSEB 3ZNGC 5DPTA 2FIFA 3C0RB 4IWQA 1WM3A 4FJVB 2L8JA 1LXDA 3VTVA 2CKHB 1PLSA 2O6VD 3ODOA 4BOZB 3T9LA 4A6FA 3ULCA 4AOFA 3BINA 2ELAA 2NZ8B 1WJ4A 5KCVA 3TFMA 1UPQA 3PS6A 1Q1OA 3SD5A 3U8ZA 2IO0B 1Q67A 2KN5A 2Z0DB 1KJTA 4HHVA 3TIXA 2KVRA 3ZTDA 3ZUNA 3E9OA 1MAIA 3A1QA 2NBVB 5J2RA 3DVGY 2KQ7A 4FJZA 2N7EA 3TJPA 2VRRB 1FAOA 4HAUB 2O6VA 2RGNB 2P0DA 4MGYE 5GMVA 1I35A 3FLVA 3AI5A 1WR1A 2CU1A 1ZGUB 2Z0QA 3KUDB 3ML8A 4KHOA 2WDTB 4XC2A 5HE0A 2YS5A 3N3KB 3SBTA 1FHXA 3D8FA 1WZ3A 4BKTA 3WIMA 1V5TA 2LKOA 3VHTC 3APDA 1WRDB 2DIKA 3H9DA 2WYQA 1RAXA 4HWIB 1WI1A 3A4RA 1OEYJ 2MP2B 2CY4A 5D3VA 2K00A 1U5FA 3V60A 4W9FA 4JK8A 2D9YA 1Y19B 1WXMA 2ZNVC 5G55A 4CHJA 2CRFA 3PTFC 1BWNA 5IA7A 3TBLD 1V81A 5EDSA 5C79A 4WJOA 4BOSC 1G6JA 4W9CA 4FULA 4F7GA 4DDID 4AUQC 3P2BA 2ZCBA 3RUIB 3TL5A 3UGBB 4ANVA 2YVCA 1EVHA 1UH6A 1TZ1A 2MFQA 1U4AA 5AZFA 3MHSD 2LZ6A 3EHVA 2NCNA 2KJ6A 2C60A 2LRUA 4JLCA 5L81A 1E5WA 4DBBA 1WX9A 3AU4A 4EZKA 3E9PA 2H7EA 5KQ4A 3W1SA 2KQSA 4IUMB 3EFUA 3A8PA 1MG8A 5CLLB 1WMHA 2Z0EB 2ZPNA 3AJ4A 2LUEA 2R82A 3O96A 2IY0B 5JHGA 4J6IA 5AZGA 4C0AA 2NPTB 2Q13A 2A4ZA 3KY9A 1TQZA 4BKSD 2GBKA 3MTNB 3QA8A 2IYDB 4M0WB 4ANUA 2UVMA 3DBRI 5JHBA 2BPSA 1V2YA 5L95C 3PRZA 2KDEB 2MRPA 1WXAA 4B6WA 1WI0A 2DHZA 1KI1B 4MGKE 1V9JA 3U7DA 3P7ZA 4DHJB 4GDLA 4HK2A 4KAXB 2DZKA 2HTHB 4OVVA 1H8CA 3DBSA 1UNQA 3RT3B 2ZZPB 3DXDA 5KHQA 5D6JB 2KLGA 4GB9A 3CIKA 2K39A 1VCBA 3FSSA 3KUZA 3DBHI 4GDKB 1MPHA 4EJNA 1XKEA 1XR0B 3CXBB 4DHZE 4ASWC 1W1GA 1WM2A 2RR9A 1WMHB 1ZKHA 3V6EB 3N32A 2CQUA 1V6EA 4CO7A 3DQVA 2WH5A 2LGDA 5LXHA 4GMVA 2KJHB 3HK0A 1XX0A 4GIVA 2Y7BA 5LONB 3B1LX 4TYZA 2KCJA 2K2JA 4OVUA 4W9DA 1DROA 2IFSA 4IG7B 2MBBB 2G35A 3QCAA 2BYVE 3DDCB 1BTNA 4WWNA 2C5LC 1FXTB 2DX1A 2LXCA 3HQCA 1U5EA 4W9LA 2KDFB 3PT2B 4A20A 4BVUC 4A6HA 3A9KA 4F7UP 2G3QB 3A98B 1DBHA 4FA6A 3SDLC 4D0NB 3DVGX 2RSGA 4KHAA 1WR6E 4TQ0A 4KDIC 4ZDVA 4MJSA 3NZUA 4JK9A 4JKGB 4MM3A 1V86A 1JRUA 1JDEA 3WAOA 2FCNA 2KGXB 1P98A 4K2OA 1E8YA 5JVLA 2JF5A 2O2VA 3S2AA 2NR2A 3JSVA 2P8VA 2YF0A 5J3QA 2J59M 4MGIE 1FHOA 1V49A 1KM7A 4MSQB 2OQBA 4GN1A 3Q3FA 5FI1A 1S1QB 5JP4A 4EZJA 2M4NA 2FJ9A 4HPLB 3TVVA 2D10A 1UPRA 5D3WA 1RRPB 3VIAA 1FOEA 3G9WA 3OAWA 1R4MI 2DHKA 4KIKA 4HB0B 1YQBA 4NAWA 2MLBA 2QKLA 2P0HA 3PGEA 2GMIC 4DWFA 1E8XA 2JP2A 1LFDA 3RULA 1D3ZA 3VDZA 5JZEB 4WQOB 2EMTA 2LASA 2MX2A 1ZC4B 3HIZA 3WA0A 4WVFB 2D9ZA 4WWOA 3AXCA 3ZRFA 1V5PA 1WGGA 4GOCA 4N9F4 3DXEA 2FUHB 3PPAA 4RMAA 4E3CA 3V6CB 4WWPA 5BO4B 2LWPA 4KSLC 2KTRB 2O2VB 2AL3A 3QIJA 4AWJA 3A9JB 1Z5SB 2XBBC 4TKNA 3PVUA 4ZRKA 1WX8A 4LCDE 2DKQA 3KZ1A 2PPHA 2Y5BB 4HB2B 3VTUA 4II3B 3UINB 3APCA 4IM0A 2DX5A 1GC7A 2K8CA 3BJIA 4JGHB 3QWZB 3HM6X 1QQGA 4ILGB 3H1UA 2XEWA 4NQLB 4A5KA 1T0YA 2CAYA 3QC8B 3L54A 3SBGA 1WJMA 2X18A 3QX1A 3QK0A 4KV2A 3ZLZA 3H7PA 2KFJA 4K1RB 3ZO5B 2KLCA 2GBRA 2K2UA 3QJZA 1SGHA 1MIXA 2KMAA 4W9IA 1ZSQA 2L00B 2KWCA 5EFXA 2GOWA 3UQBA 2C7HA 2MSED 3KW5B 1EO6A 3ONSA 2DYQA 4Z2NA 1YX6B 2IO1B 4G3XB 2GBMA 3ALBA 3UIPB 4BFRA 4ZRJA 3ENBA 2MBEA 4DX8A 2DYBA 3L13A 2KDBA 2N9XA 2EC1A 4NJ7A 1I42A 3LJ3A 2NVUI 2FCSA 3U30A 2MDXA 2LGXA 4JKEA 4PS3A 3P6AA 4EZLA 1I7AA 3ODXA 4FLHA 4PS7A 3R66C 1VD2A 2HRJA 3GOEA 2LD9A 1WJUA 1J0WA 3TCAA 3PVLA 5J3TA 4KHBB 2REXA 2W2XD 1P5TA 3M1IB 5DIFB 2NBUA 4MY6A 2P0FA 3JVZX 5DHAB 2KX3A 3AULA 5KQ1A 2ZPYA 3VH4B 4GU2A 4JKHA 3FM8C 1FHWA 2W9NA 1XD4A 1C1YB 4W9EA 3T8MA 4I6LB 5IJMA 2GCLA 1X11A 4Z2MB 3M3JA 4MT7A 2OOBB 3MJWA 4A6FB 5CTRC 4HCPB 1WGRA 3DVNU 2D11A 4ZRIA 1M7EA 2L76A 2KHWB 1XCGA 3DOWA 2RVBB 2JXXA 3T06A 1TBEA 4NPNA 2V76A 2DHJA 4E71A 1TTNA 3A1QB 2VRWB 3ZIMA 2I5CA 1NTYA 1YIWA 4EMOA 1P6SA 1MK7B 4DX90 2CY5A 1NTVA 2O6VB 1DDVA 3K9OB 4JL9A 1WFYA 2COFA 4K81A 3X0WA 1WE7A 1VBGA 4B9KA 1PMSA 3LDZE 5DPSA 3TW1A 2KXJA 1OEYA 2CHXA 3DCGA 3PLUA 4HXDA 1UD7A 2E2XA 2N1VA 2AL6A 3SYXA 3DVNV 2PJHA 2ADZA 5G2NA 1GJZA 2YT0A 2N4FA 1V5UA 2RPQA 1Y5OA 1OGWA 1U5GA 5C16A 2ZVNA 1Q5WB 2V4LA 3WAPA 1IP9A 1LQBA 1L2NA 4P7IA 3F0WA 1EF1A 3PLVA 2UZSA 1WGYA 4HAXB 1NVLA 5D27A 2CR5A 3A8QA 2WX0A 1WGUA 2YSZA 4EEWA 2R2OA 4KZCA 1WE6A 3ML9A 1ST7A 3WYFB 3MPXA 3RCPA 4MK0A 1FB8A 3PHXB 1XD3B 3CMMB 4BBNC 5HKHA 3D8DA 2IBIB 3RYTA 1P0RA 4BKSA 1DIKA 3OJ4B 2IY1B 2HD5B 3FP5A 3PSCA 2MBOA 2K1FA 4W9JA 1NDDA 3V62A 2CODA 3QWMA 4HPMB 5E6NA 2GBJA 3PREA 4DK5A 3ZW3A 5CX3A 2JY6A 2GS0A 4K7WA 3KSYA 2FNJB 1GNUA 3M62B 2ZVOA 5E6PA 4HCNB 4HJKA 3L16A 5DI9B 1X05A 1WX7A 2QHOA 2YRYA 2L05A 4HAYB 2K6DB 2J0MA 1KZ7A 4HAWB 2MWNB 2NMBA 2L7RA 1U5DA 1AARA 3D32A 4JKCA 3V61A 2Y8GA 2JZZA 2DZJA 5DPRA 1V5MA 3EECA 2FAZA 2KMCA 4MGZE 4HATB 4GDLB 2Z0PA 3N7CA 4EKUA 2FJLA 2ABDA 1K5DB 4IOYX 2RUKB 1LW3A 2M0XA 3PEGA 2XK5A 5FI0A 2KZRA 4TV3A 5C5BA 3R7RA 2G4DB 2KFKA 3K9PB 2FCMA 4LJPB 2MBQA 3OLMD 2D9VA 2I1KA 2KDIA 3CSFA 3V5WA 3H7SA 3PZDA 2A5UA 1RFAA 1RJ2A 2KO3A 1ZW7A 5LXIB 3H6NA 2JT4B 2MCNB 4TQ1A 2KD0A 2N23A 2WWZA 2ELBA 1U29A 3ODWA 1R4NI 3SUZA 4LDTB 4JQWC 4WAAA 4F8CB 4IFSA 5AZHA 3VUWA 1OQNA 2DKPA 3HM3A 2RSUA 2BYFA 3A4SC 1OQYA 4IAPA 5CHFA 1WG7A 2LOXA 2D9XA 2BF8B 2LULA 1HBKA 5LOPB 1N3HA 1WYWB 4RM9A 1HB8A 3R3MA 1WF9A 4X57B 1E90A 4KSKC 2MKRA 3UIOB 4ILHA 2BKFA 4PYZA 1Z2MA 3QQ8B 1OTRB 2LOZA 3A9KB 3WANA 1GC6A 2R0DA 2JVCA 3VUYA 3UQAA 4K7UA 3BY4B 4DHZB 4PQ0A 3VFKA 3VVWB 4HB3B 4ANWA 2RD0A 2M14A 4MJSB 1XQQA 4HLEA 2KK8A 4K2PA 4CHMA 1SIFA 2Z59B 4HDOA 2ASQA 2KFKB 3SO6A 4L6EA 1V80A 4MH0E 2W2WA 1MKEA 4EFOA 5CLQB 3CF6E 1MIZB 2ROZB 3KUCB 3ZKJC 5GOWB 2IO2B 3SHQA 3JSVB 3E66A 4ZYNA 4F7ZA 2R2QA 3W1SC 3ZVVA 2ZEQA 4F7HA 4BBNF 3PRPB 2Z0OA 3RCZA 1ACAA 2DAJA 1IYFA 2G45B 2COAA 1WXSA 2EJ8A 4KIKB 3X23A 2KUPA 2KTFA 1OMWA 2J0JA 2GJYA 2AYOB 4NAWB 4JIOU 1Z87A 3KYCD 3HW2B 4MSMB 5C6RA 3RZFA 4FADA 3ULBA 3QAQA 1E8ZA 2YS3A 4IM2A 1ISNA 1NI2A 2N1WA 3VQIA 2L0FA 2V3SA 1KLVA 1RRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHV C;  1WGH A;  1WGQ A;  2RGF A;  2N0Y A;  4GMX B;  4NJ6 A;  5JHA A;  1NTI A;  2I5F A;  4FHK A;  1C3T A;  3L0W B;  5HE3 A;  2KOX A;  4EOY A;  1DDM A;  1UNP A;  4YON A;  2JPH A;  2J0K A;  2XQN M;  2VKI A;  2DLW A;  1E8W A;  2MA9 B;  2MBH A;  2YLM A;  2RNR B;  1P3Q U;  2BWF A;  3TMP B;  3Q3J A;  1TJ6 A;  2LGY A;  4BKG A;  3PG7 A;  4KZ0 A;  3B08 A;  5IAA C;  1UGM A;  4I6N B;  2D3G A;  1TGZ B;  1LB1 A;  4NQK E;  2DX5 B;  3PP2 A;  3KH0 A;  4KDL B;  1M94 A;  2K8H A;  2PE9 A;  4MEM A;  4DXA B;  2K8B A;  3ZTC A;  3AU5 A;  4FJY A;  1EAZ A;  3WAL A;  1BT0 A;  2ROV A;  4LJO B;  4B6H A;  2LYD A;  2LRW A;  3OJ3 A;  3H7P B;  2OTX A;  1AWE A;  1WJ6 A;  3VH3 B;  1IPG A;  4PS8 A;  4AJW A;  1X1M A;  1X86 A;  1UBQ A;  4RM8 A;  3ZRC A;  5JHH A;  2KNB A;  4IWO A;  2JUO A;  2DTC A;  1WJN A;  1OY2 A;  1WXV A;  2BGF A;  2RLO A;  4AP4 C;  2CHZ A;  2DEN B;  5DHF B;  1NU2 A;  1BAK A;  4M8M A;  5TR5 A;  1L7Y A;  4W9G A;  1W1D A;  4FHJ A;  2M38 A;  3QAR A;  3I3T B;  4DHJ D;  1U2B A;  1HE8 A;  3IHP C;  3PV1 A;  4W9H A;  4HDQ A;  1V89 A;  2M17 A;  2D2Q A;  5J17 A;  5D3X A;  2NPT A;  2LBB A;  2MWS B;  3DXC A;  2DZI A;  1YX5 B;  3WAM A;  4NSW A;  2CHW A;  2KC2 A;  4M8N A;  1TXD A;  3JW0 X;  2J7Q B;  4A6K A;  2L1C A;  1W1H A;  4AJY B;  1BTK A;  4HAZ B;  2FDQ A;  1WJ1 A;  3APF A;  1PFJ A;  2I1J A;  4NNJ B;  2DYN A;  2HTH A;  2FCQ A;  1UEL A;  5JH5 C;  5DPW A;  2DZM A;  1V61 A;  1I2H A;  4MEL A;  2M1M A;  3SU8 X;  2C7M B;  3UZT A;  4IM3 A;  2JRH A;  4GDK A;  2KWU B;  2COP A;  2C7N B;  3ZDT A;  1WZ0 A;  1UBI A;  2DYM A;  2KAN A;  2N9E B;  1Q0W B;  3A33 B;  1KOT A;  2N7D A;  2DHI A;  3JYU A;  2LVO A;  1WGD A;  2DN6 A;  5CHW A;  2R09 A;  5J18 A;  2V1Y A;  1QZE A;  4KVG B;  4HVB A;  2EMS A;  3O65 B;  1J19 A;  2WX1 A;  3QBV B;  4II2 B;  5E6O A;  2GBN A;  5C1Z A;  2LG1 A;  1GUA B;  3NZS A;  1B55 A;  2LVP A;  4WJN A;  5D3Y A;  3IVF A;  1YJ1 A;  4IWP A;  2ZJD A;  4ICV A;  2JRI B;  1YD8 U;  2N9P C;  1K5G B;  2DFK A;  1EUV B;  2YT1 A;  3HHM A;  3L10 B;  1J0G A;  5HE1 A;  1M7R A;  5KHO A;  1Y8R C;  2JZ3 B;  5D94 A;  5DH9 B;  4H8S A;  2BKR B;  2PE6 B;  4WJ7 A;  3ENE A;  3OAN A;  2ZCC A;  4LDT D;  4FN2 A;  3EPY A;  4WSF A;  3KRX A;  1WH3 A;  3SNH A;  3PHW B;  2L3Z A;  4Y94 A;  5D7G A;  4XZ4 A;  4ANX A;  3ZNH B;  1ZM0 A;  2QKM A;  4E74 A;  1P1A A;  3CST A;  4PYU A;  1QC6 A;  3IBE A;  2HE7 A;  2VSZ A;  4W9K A;  3FEH A;  2PZ1 A;  2Y8F A;  1S3S G;  1IRS A;  2H7D A;  1H4R A;  4CYE A;  3UF8 A;  3LJU X;  3GYO A;  2HJ8 A;  1X1G A;  3RD2 A;  3VTW A;  4I6P A;  4TUU A;  2EKE C;  4GXB A;  2JWZ A;  2BYE A;  1H10 A;  2LXA A;  4BBK A;  1WIA A;  2PEA A;  1FGZ A;  2LI5 A;  1P3R A;  1DYN A;  4GZU A;  5FR6 A;  3M95 A;  1J8C A;  3NHE B;  3ZNZ B;  4A3P A;  1ZC3 B;  3KRW A;  3MDB C;  2NS5 A;  4XWX A;  3KYD D;  3IFW B;  3ZNI D;  4IW0 A;  3W1Y A;  3NSU A;  2CS4 A;  3NY5 A;  5L83 A;  1NBF C;  1WVH A;  3PVW A;  3PRM B;  1ZVR A;  4K17 A;  2DYO A;  2KTR A;  1DDW A;  1K8R B;  1CMX B;  3A9J A;  3ML4 A;  2KWV B;  2IO3 B;  1XT9 B;  4WJP A;  2K6Q A;  3EC8 A;  4A3O A;  1EF5 A;  2L0T A;  2CB8 A;  3SV1 A;  4K7S A;  2MQJ A;  4HB4 B;  1XOD A;  5AEK B;  1UEF A;  2AWT A;  3RZW C;  3TO1 A;  2LJ5 A;  4IC7 B;  2BWE S;  1RLF A;  2W2X C;  2KJR A;  3N30 A;  4URK A;  1AQC A;  1PQS A;  3L17 A;  5JLJ B;  2IZV B;  3F5R A;  1A5R A;  3GYP A;  4EUT A;  4F1S A;  1MK9 B;  2COC A;  4DDG D;  2AEH A;  1U27 A;  4YL8 A;  3B0A A;  3VAW A;  3VUX A;  2XK5 B;  1HB6 A;  2DA0 A;  5C23 A;  1V88 A;  2D4Q A;  1UZX B;  5C5B B;  4FBJ B;  2IYB A;  2UYZ B;  3D8E A;  2C9W B;  2ZNV B;  2FID A;  3DBL I;  3IG3 A;  2DAF A;  4NY0 A;  2NBW B;  4WJQ A;  2K25 A;  2KKC A;  5J3Y A;  1V5O A;  4G11 A;  1GG3 A;  3M63 B;  3ECI A;  4GGQ A;  4GPT B;  4HAV B;  2BCJ A;  5LLI A;  2RQ1 A;  3ZVR A;  2L2I A;  2GCJ A;  1SE9 A;  2OJR A;  4DBG A;  2D9W A;  2LVQ A;  4PNK A;  1EGX A;  3VOQ A;  1WY8 A;  3KVF B;  1KZG A;  2YS1 A;  1P9D U;  1F9J A;  3VXW A;  4XX5 A;  3ZDM C;  1X1F A;  1E7U A;  3R7Q A;  5D2M B;  2UZR A;  2UWQ A;  2B3A A;  4G0N B;  2KX0 A;  4G50 A;  4GSW A;  1LM8 B;  2G4S A;  2MW5 A;  3DPD A;  3QHT A;  4MDK E;  1UNR A;  2D07 B;  5DCN A;  2KC1 A;  4B95 A;  4ICU A;  2MP2 A;  1E7V A;  5HE2 A;  3NS8 A;  4CHK A;  1SHC A;  3NOB A;  3L08 A;  2M8S A;  3GZN I;  1FGY A;  3PSE B;  3ZNG C;  5DPT A;  2FIF A;  3C0R B;  4IWQ A;  1WM3 A;  4FJV B;  2L8J A;  1LXD A;  3VTV A;  2CKH B;  1PLS A;  2O6V D;  3ODO A;  4BOZ B;  3T9L A;  4A6F A;  3ULC A;  4AOF A;  3BIN A;  2ELA A;  2NZ8 B;  1WJ4 A;  5KCV A;  3TFM A;  1UPQ A;  3PS6 A;  1Q1O A;  3SD5 A;  3U8Z A;  2IO0 B;  1Q67 A;  2KN5 A;  2Z0D B;  1KJT A;  4HHV A;  3TIX A;  2KVR A;  3ZTD A;  3ZUN A;  3A1Q A;  1MAI A;  2NBV B;  5J2R A;  3DVG Y;  2KQ7 A;  4FJZ A;  2N7E A;  3TJP A;  2VRR B;  1FAO A;  4HAU B;  2O6V A;  2RGN B;  2P0D A;  4MGY E;  5GMV A;  1I35 A;  3FLV A;  3AI5 A;  1WR1 A;  2CU1 A;  1ZGU B;  2Z0Q A;  3KUD B;  3ML8 A;  4KHO A;  2WDT B;  4XC2 A;  5HE0 A;  2YS5 A;  3N3K B;  1FHX A;  3D8F A;  1WZ3 A;  4BKT A;  3WIM A;  1V5T A;  2LKO A;  3VHT C;  3APD A;  1WRD B;  3H9D A;  2WYQ A;  1RAX A;  4HWI B;  1WI1 A;  3A4R A;  1OEY J;  2MP2 B;  2CY4 A;  5D3V A;  2K00 A;  1U5F A;  3V60 A;  4W9F A;  2D9Y A;  1Y19 B;  1WXM A;  2ZNV C;  5G55 A;  4CHJ A;  2CRF A;  3PTF C;  1BWN A;  5IA7 A;  3TBL D;  1V81 A;  5EDS A;  5C79 A;  4WJO A;  4BOS C;  1G6J A;  4W9C A;  4FUL A;  4F7G A;  4DDI D;  4AUQ C;  3P2B A;  2ZCB A;  3RUI B;  3TL5 A;  3UGB B;  4ANV A;  2YVC A;  1EVH A;  1UH6 A;  1TZ1 A;  2MFQ A;  1U4A A;  5AZF A;  3MHS D;  2LZ6 A;  3EHV A;  2NCN A;  2KJ6 A;  2C60 A;  2LRU A;  4JLC A;  5L81 A;  1E5W A;  4DBB A;  1WX9 A;  3AU4 A;  4EZK A;  2H7E A;  5KQ4 A;  3W1S A;  2KQS A;  4IUM B;  3EFU A;  3A8P A;  1MG8 A;  5CLL B;  1WMH A;  2Z0E B;  2ZPN A;  3AJ4 A;  2LUE A;  3O96 A;  2IY0 B;  5JHG A;  4J6I A;  5AZG A;  4C0A A;  2NPT B;  2Q13 A;  2A4Z A;  3KY9 A;  1TQZ A;  4BKS D;  2GBK A;  3MTN B;  3QA8 A;  2IYD B;  4M0W B;  4ANU A;  2UVM A;  3DBR I;  5JHB A;  2BPS A;  1V2Y A;  5L95 C;  3PRZ A;  2KDE B;  2MRP A;  1WXA A;  4B6W A;  1WI0 A;  2DHZ A;  1KI1 B;  4MGK E;  1V9J A;  3U7D A;  3P7Z A;  4DHJ B;  4GDL A;  4HK2 A;  4KAX B;  2DZK A;  2HTH B;  4OVV A;  1H8C A;  3DBS A;  1UNQ A;  3RT3 B;  2ZZP B;  3DXD A;  5KHQ A;  5D6J B;  2KLG A;  4GB9 A;  3CIK A;  2K39 A;  1VCB A;  3FSS A;  3KUZ A;  3DBH I;  4GDK B;  1MPH A;  4EJN A;  1XKE A;  1XR0 B;  3CXB B;  4DHZ E;  4ASW C;  1W1G A;  1WM2 A;  2RR9 A;  1WMH B;  1ZKH A;  3V6E B;  3N32 A;  2CQU A;  1V6E A;  4CO7 A;  3DQV A;  2WH5 A;  2LGD A;  5LXH A;  4GMV A;  2KJH B;  3HK0 A;  1XX0 A;  4GIV A;  2Y7B A;  5LON B;  3B1L X;  4TYZ A;  2KCJ A;  2K2J A;  4OVU A;  4W9D A;  1DRO A;  2IFS A;  4IG7 B;  2MBB B;  2G35 A;  3QCA A;  2BYV E;  3DDC B;  1BTN A;  4WWN A;  2C5L C;  1FXT B;  2DX1 A;  2LXC A;  3HQC A;  1U5E A;  4W9L A;  2KDF B;  3PT2 B;  4A20 A;  4BVU C;  4A6H A;  3A9K A;  4F7U P;  2G3Q B;  3A98 B;  1DBH A;  4FA6 A;  3SDL C;  4D0N B;  3DVG X;  2RSG A;  4KHA A;  1WR6 E;  4TQ0 A;  4KDI C;  4ZDV A;  4MJS A;  3NZU A;  4MM3 A;  1V86 A;  1JRU A;  3WAO A;  2FCN A;  2KGX B;  1P98 A;  4K2O A;  1E8Y A;  2JF5 A;  2O2V A;  3S2A A;  2NR2 A;  3JSV A;  2P8V A;  2YF0 A;  5J3Q A;  2J59 M;  4MGI E;  1FHO A;  1V49 A;  1KM7 A;  4MSQ B;  2OQB A;  4GN1 A;  3Q3F A;  5FI1 A;  1S1Q B;  5JP4 A;  4EZJ A;  2M4N A;  2FJ9 A;  4HPL B;  3TVV A;  2D10 A;  1UPR A;  5D3W A;  1RRP B;  3VIA A;  1FOE A;  3G9W A;  3OAW A;  1R4M I;  2DHK A;  4KIK A;  4HB0 B;  1YQB A;  4NAW A;  2MLB A;  2QKL A;  2P0H A;  3PGE A;  2GMI C;  4DWF A;  1E8X A;  2JP2 A;  1LFD A;  3RUL A;  1D3Z A;  3VDZ A;  5JZE B;  4WQO B;  2EMT A;  2LAS A;  2MX2 A;  1ZC4 B;  3HIZ A;  3WA0 A;  4WVF B;  2D9Z A;  4WWO A;  3AXC A;  3ZRF A;  1V5P A;  1WGG A;  4GOC A;  4N9F 4;  3DXE A;  2FUH B;  3PPA A;  4RMA A;  4E3C A;  3V6C B;  4WWP A;  5BO4 B;  2LWP A;  4KSL C;  2KTR B;  2O2V B;  2AL3 A;  3QIJ A;  4AWJ A;  3A9J B;  1Z5S B;  2XBB C;  4TKN A;  3PVU A;  4ZRK A;  1WX8 A;  4LCD E;  2DKQ A;  3KZ1 A;  2PPH A;  2Y5B B;  4HB2 B;  3VTU A;  4II3 B;  3UIN B;  3APC A;  4IM0 A;  2DX5 A;  1GC7 A;  2K8C A;  3BJI A;  4JGH B;  3QWZ B;  3HM6 X;  1QQG A;  3H1U A;  2XEW A;  4NQL B;  4A5K A;  1T0Y A;  2CAY A;  3QC8 B;  3L54 A;  1WJM A;  2X18 A;  3QX1 A;  3QK0 A;  4KV2 A;  3ZLZ A;  3H7P A;  2KFJ A;  4K1R B;  3ZO5 B;  2KLC A;  2GBR A;  2K2U A;  3QJZ A;  1SGH A;  1MIX A;  2KMA A;  4W9I A;  1ZSQ A;  2L00 B;  2KWC A;  5EFX A;  2GOW A;  3UQB A;  2C7H A;  2MSE D;  3KW5 B;  1EO6 A;  3ONS A;  2DYQ A;  4Z2N A;  1YX6 B;  2IO1 B;  4G3X B;  2GBM A;  3ALB A;  3UIP B;  4BFR A;  4ZRJ A;  2MBE A;  4DX8 A;  2DYB A;  3L13 A;  2KDB A;  2N9X A;  2EC1 A;  4NJ7 A;  1I42 A;  3LJ3 A;  2NVU I;  2FCS A;  3U30 A;  2MDX A;  2LGX A;  4PS3 A;  3P6A A;  4EZL A;  1I7A A;  3ODX A;  4FLH A;  4PS7 A;  3R66 C;  1VD2 A;  2HRJ A;  3GOE A;  2LD9 A;  1WJU A;  1J0W A;  3TCA A;  3PVL A;  5J3T A;  4KHB B;  2REX A;  2W2X D;  1P5T A;  3M1I B;  5DIF B;  2NBU A;  4MY6 A;  2P0F A;  3JVZ X;  5DHA B;  2KX3 A;  3AUL A;  5KQ1 A;  2ZPY A;  3VH4 B;  4GU2 A;  3FM8 C;  1FHW A;  2W9N A;  1XD4 A;  1C1Y B;  4W9E A;  3T8M A;  4I6L B;  5IJM A;  2GCL A;  1X11 A;  4Z2M B;  3M3J A;  4MT7 A;  2OOB B;  3MJW A;  4A6F B;  5CTR C;  4HCP B;  1WGR A;  3DVN U;  2D11 A;  4ZRI A;  1M7E A;  2L76 A;  2KHW B;  1XCG A;  3DOW A;  2RVB B;  2JXX A;  3T06 A;  1TBE A;  4NPN A;  2V76 A;  2DHJ A;  4E71 A;  1TTN A;  3A1Q B;  2VRW B;  3ZIM A;  2I5C A;  1NTY A;  1YIW A;  4EMO A;  1P6S A;  1MK7 B;  4DX9 0;  2CY5 A;  1NTV A;  2O6V B;  1DDV A;  3K9O B;  4JL9 A;  1WFY A;  2COF A;  4K81 A;  3X0W A;  1WE7 A;  4B9K A;  1PMS A;  3LDZ E;  5DPS A;  3TW1 A;  2KXJ A;  1OEY A;  2CHX A;  3DCG A;  3PLU A;  4HXD A;  1UD7 A;  2E2X A;  2N1V A;  2AL6 A;  3SYX A;  3DVN V;  2PJH A;  2ADZ A;  5G2N A;  1GJZ A;  2YT0 A;  2N4F A;  1V5U A;  2RPQ A;  1Y5O A;  1OGW A;  1U5G A;  5C16 A;  2ZVN A;  1Q5W B;  2V4L A;  3WAP A;  1IP9 A;  1LQB A;  1L2N A;  4P7I A;  3F0W A;  1EF1 A;  3PLV A;  2UZS A;  1WGY A;  4HAX B;  1NVL A;  5D27 A;  2CR5 A;  3A8Q A;  2WX0 A;  1WGU A;  2YSZ A;  4EEW A;  2R2O A;  4KZC A;  1WE6 A;  3ML9 A;  1ST7 A;  3WYF B;  3MPX A;  3RCP A;  4MK0 A;  1FB8 A;  3PHX B;  1XD3 B;  3CMM B;  4BBN C;  5HKH A;  3D8D A;  2IBI B;  3RYT A;  1P0R A;  4BKS A;  3OJ4 B;  2IY1 B;  2HD5 B;  3FP5 A;  3PSC A;  2MBO A;  2K1F A;  4W9J A;  1NDD A;  3V62 A;  2COD A;  3QWM A;  4HPM B;  5E6N A;  2GBJ A;  3PRE A;  4DK5 A;  3ZW3 A;  5CX3 A;  2JY6 A;  2GS0 A;  4K7W A;  3KSY A;  2FNJ B;  1GNU A;  3M62 B;  2ZVO A;  5E6P A;  4HCN B;  4HJK A;  3L16 A;  5DI9 B;  1X05 A;  1WX7 A;  2QHO A;  2YRY A;  2L05 A;  4HAY B;  2K6D B;  2J0M A;  1KZ7 A;  4HAW B;  2MWN B;  2NMB A;  2L7R A;  1U5D A;  1AAR A;  3D32 A;  3V61 A;  2Y8G A;  2JZZ A;  2DZJ A;  5DPR A;  1V5M A;  3EEC A;  2FAZ A;  2KMC A;  4MGZ E;  4HAT B;  4GDL B;  2Z0P A;  3N7C A;  4EKU A;  2FJL A;  2ABD A;  1K5D B;  4IOY X;  2RUK B;  1LW3 A;  2M0X A;  3PEG A;  2XK5 A;  5FI0 A;  2KZR A;  4TV3 A;  5C5B A;  3R7R A;  2G4D B;  2KFK A;  3K9P B;  2FCM A;  4LJP B;  2MBQ A;  3OLM D;  2D9V A;  2I1K A;  2KDI A;  3CSF A;  3V5W A;  3H7S A;  3PZD A;  2A5U A;  1RFA A;  1RJ2 A;  2KO3 A;  1ZW7 A;  5LXI B;  3H6N A;  2JT4 B;  2MCN B;  4TQ1 A;  2KD0 A;  2N23 A;  2WWZ A;  2ELB A;  1U29 A;  3ODW A;  1R4N I;  3SUZ A;  4LDT B;  4JQW C;  4WAA A;  4F8C B;  4IFS A;  5AZH A;  3VUW A;  1OQN A;  2DKP A;  3HM3 A;  2RSU A;  2BYF A;  3A4S C;  1OQY A;  4IAP A;  5CHF A;  1WG7 A;  2LOX A;  2D9X A;  2BF8 B;  2LUL A;  1HBK A;  5LOP B;  1N3H A;  1WYW B;  4RM9 A;  1HB8 A;  3R3M A;  1WF9 A;  4X57 B;  1E90 A;  4KSK C;  2MKR A;  3UIO B;  2BKF A;  4PYZ A;  1Z2M A;  3QQ8 B;  1OTR B;  2LOZ A;  3A9K B;  3WAN A;  1GC6 A;  2R0D A;  2JVC A;  3VUY A;  3UQA A;  4K7U A;  3BY4 B;  4DHZ B;  4PQ0 A;  3VFK A;  3VVW B;  4HB3 B;  4ANW A;  2RD0 A;  2M14 A;  4MJS B;  1XQQ A;  4HLE A;  2KK8 A;  4K2P A;  4CHM A;  1SIF A;  2Z59 B;  4HDO A;  2ASQ A;  2KFK B;  3SO6 A;  4L6E A;  1V80 A;  4MH0 E;  2W2W A;  1MKE A;  4EFO A;  5CLQ B;  3CF6 E;  1MIZ B;  2ROZ B;  3KUC B;  3ZKJ C;  5GOW B;  2IO2 B;  3SHQ A;  3JSV B;  4ZYN A;  4F7Z A;  2R2Q A;  3W1S C;  3ZVV A;  2ZEQ A;  4F7H A;  4BBN F;  3PRP B;  2Z0O A;  3RCZ A;  1ACA A;  2DAJ A;  1IYF A;  2G45 B;  2COA A;  1WXS A;  2EJ8 A;  4KIK B;  3X23 A;  2KUP A;  2KTF A;  1OMW A;  2J0J A;  2GJY A;  2AYO B;  4NAW B;  4JIO U;  1Z87 A;  3KYC D;  3HW2 B;  4MSM B;  5C6R A;  3RZF A;  4FAD A;  3ULB A;  3QAQ A;  1E8Z A;  2YS3 A;  4IM2 A;  1ISN A;  1NI2 A;  2N1W A;  3VQI A;  2L0F A;  2V3S A;  1KLV A;  1RRB A; 
#chains in the Genus database with same CATH topology
 3U12 A;  2ON8 A;  2E6X A;  5CHV C;  1WGH A;  1WGQ A;  2RGF A;  2N0Y A;  4GMX B;  4NJ6 A;  5JHA A;  1NTI A;  2I5F A;  1F77 A;  4FHK A;  4ZRP A;  1C3T A;  4R3D A;  3L0W B;  2BB5 A;  2LMC A;  4JWU C;  5HE3 A;  2KOX A;  4EOY A;  1UWM A;  2HTM E;  1V1P B;  1DDM A;  2YEP B;  1ZUD 2;  1UNP A;  1QOG A;  4YON A;  1FRR A;  2JPH A;  2J0K A;  2BS4 B;  2XQN M;  2VKI A;  2DLW A;  1E8W A;  4EE2 A;  2MA9 B;  1KLU D;  2MBH A;  2YLM A;  3Q3O C;  4JK7 A;  2PTL A;  1NYR A;  1ZDX A;  2RNR B;  2NTT A;  4XE0 A;  1P3Q U;  2BWF A;  3TMP B;  3TUO A;  3Q3J A;  1PYW D;  1TJ6 A;  2LGY A;  4BKG A;  5TSS A;  4REZ A;  3PG7 A;  4C80 A;  4KZ0 A;  3B08 A;  3VR9 B;  5IAA C;  1UGM A;  4I6N B;  2IDY A;  2PKO A;  4IKG A;  4YXD B;  2D3G A;  1TGZ B;  1LB1 A;  3NWF A;  4NQK E;  4YSX B;  2DX5 B;  3PP2 A;  3KH0 A;  4KDL B;  4WUR A;  1TY0 A;  1M94 A;  5MPO A;  2K8H A;  2PE9 A;  4MEM A;  3RNB C;  3MC0 B;  4DXA B;  1TYG B;  2K8B A;  4N6E B;  4QJ4 B;  3ZTC A;  1J7B A;  3AU5 A;  4FJY A;  1YQ4 B;  1EAZ A;  4S17 A;  4ZOH C;  3WAL A;  1JAL A;  2QJL A;  4KKI A;  1BT0 A;  3IXS A;  1LGR A;  2BBC A;  2WXK A;  2ROV A;  4LJO B;  4DXG A;  4B6H A;  2LYD A;  1VZ6 A;  2LRW A;  4DXF A;  3OJ3 A;  2EEL A;  3H7P B;  2OTX A;  1AWE A;  1WJ6 A;  3VH3 B;  1IPG A;  4PS8 A;  2PMV A;  4AJW A;  1X1M A;  1X86 A;  1MI0 A;  1UBQ A;  4RM8 A;  3ZRC A;  5JHH A;  2KNB A;  4IWO A;  3N1X C;  2JUO A;  4OSN A;  2DTC A;  3IT6 B;  1WJN A;  1OY2 A;  2CJN A;  1WXV A;  2BGF A;  2H88 B;  1QOB A;  2RLO A;  4AP4 C;  2CHZ A;  1DYQ A;  2DEN B;  5DHF B;  3Q69 A;  1NU2 A;  1BAK A;  4M8M A;  5TR5 A;  1L7Y A;  4W9G A;  1KC7 A;  1W1D A;  4FHJ A;  2M38 A;  3QAR A;  3I3T B;  4DHJ D;  1U2B A;  3BYY B;  3FIL A;  1HE8 A;  3IHP C;  3PV1 A;  4W9H A;  2V4I B;  4HDQ A;  1V89 A;  2M17 A;  1KF6 B;  2FBW B;  3OWE B;  2INC C;  3PO0 A;  1AN8 A;  4BAX A;  2D2Q A;  4WH4 A;  5J17 A;  1ROE A;  1TY2 A;  5D3X A;  2NPT A;  2LBB A;  3IAM 1;  4J3O D;  2MWS B;  3DHG C;  3DXC A;  3DBL B;  3RNF C;  2DZI A;  2QC8 A;  1YX5 B;  3WAM A;  4NSW A;  1PDX A;  4M0W A;  4QJ5 B;  4M00 A;  2CHW A;  2KC2 A;  4M8N A;  1TXD A;  3JW0 X;  3P63 A;  2J7Q B;  4A6K A;  4XYC A;  2L1C A;  1W1H A;  1KBL A;  1RWS A;  4AJY B;  5BYR A;  5BMI A;  1BTK A;  4C4V A;  1MHX A;  2BS2 B;  3VRB B;  4HAZ B;  4NZL B;  2FDQ A;  2VZK D;  1WJ1 A;  3APF A;  1PFJ A;  2I1J A;  4NNJ B;  2DYN A;  2HTH A;  2KAC A;  2FCQ A;  1UEL A;  5JH5 C;  1T3Q A;  3U2S C;  5T8I A;  2Z4D A;  5DPW A;  2DZM A;  1V61 A;  3SFD B;  1I2H A;  4MEL A;  2M1M A;  4ILJ A;  3SU8 X;  2C7M B;  3UZT A;  4IM3 A;  3O13 A;  2WXJ A;  2JRH A;  4GDK A;  4NAM A;  2KWU B;  2COP A;  2C7N B;  3ZDT A;  1C78 A;  1WZ0 A;  3EUB 2;  1BML C;  1UBI A;  2DYM A;  2KAN A;  1N63 A;  1ZYI A;  3BVZ A;  2N9E B;  1Q0W B;  4P1C C;  3A33 B;  1C9F A;  1KOT A;  5FK9 C;  2N7D A;  1EU4 A;  2DHI A;  2IGH A;  1DGJ A;  1CZP A;  3JYU A;  2LVO A;  1WGD A;  3FIL B;  2DN6 A;  2K0P A;  5CHW A;  4YTP B;  3SFE B;  2LHD A;  2R09 A;  3E9S A;  5J18 A;  4PT5 A;  2V1Y A;  1HZ5 A;  1SE3 A;  1QZE A;  4KVG B;  3W9C B;  1FIQ A;  1FO4 A;  4HVB A;  2EMS A;  3GZN B;  3O65 B;  1ZE3 D;  1J19 A;  2WX1 A;  3QBV B;  1JRO A;  1N5W A;  4II2 B;  5E6O A;  2GBN A;  3BZD B;  5C1Z A;  2LG1 A;  1GUA B;  3NZS A;  1B55 A;  2LVP A;  5HHD G;  4WJN A;  4GNK B;  5D3Y A;  3IVF A;  3W5V B;  4Q2J A;  5LG4 B;  1YJ1 A;  4IWP A;  2ZJD A;  2QIL A;  4LNO A;  4ICV A;  2JRI B;  1YD8 U;  2N9P C;  1K5G B;  2DFK A;  1EUV B;  2YT1 A;  3HHM A;  1TZO A;  3L10 B;  3EGR A;  5EE0 A;  1J0G A;  5HE1 A;  2WU5 B;  1IBX A;  1M7R A;  5KHO A;  1Y8R C;  1AYF A;  2JZ3 B;  5D94 A;  5DH9 B;  4H8S A;  2BKR B;  4ZRQ A;  2PE6 B;  4WJ7 A;  1WSP A;  3ENE A;  4JKG A;  3OAN A;  2ZCC A;  4LDT D;  4FN2 A;  3EPY A;  4WSF A;  2SEB D;  3KRX A;  1WH3 A;  3SNH A;  3PHW B;  2L3Z A;  4Y94 A;  2WXH A;  4JE3 B;  2BT6 A;  2JYT A;  2IND C;  5D7G A;  3ETR A;  5C2T B;  1JCK B;  4XZ4 A;  4ANX A;  3ZNH B;  1L5P A;  1ZM0 A;  2QKM A;  4E74 A;  1P1A A;  3CST A;  4PYU A;  3GE8 C;  1HA5 A;  1QC6 A;  4RGT A;  3B2G A;  3IBE A;  4PK1 A;  2HE7 A;  1PFD A;  1DOI A;  2VSZ A;  1C4C A;  4W9K A;  3FEH A;  3ZYY X;  2PZ1 A;  3SEB A;  1Q10 A;  2Y8F A;  1S3S G;  1L6V A;  3Q14 C;  5HI1 A;  3MHZ A;  3NJT A;  3KWL A;  1SJE D;  1IRS A;  1XF5 L;  2JSV X;  1KLG D;  2H7D A;  1H4R A;  1TJE A;  2CU3 A;  4CYE A;  3UF8 A;  3URY A;  3LJU X;  1NEN B;  1XLP A;  3GYO A;  2I38 A;  2HJ8 A;  3L4P A;  1JWU D;  1ESF A;  1BUI C;  1X1G A;  3RD2 A;  1EWC A;  1WWT A;  2WXG A;  2OED A;  3VTW A;  4I6P A;  4LLG M;  4TUU A;  2EKE C;  4GXB A;  2JWZ A;  2D3A A;  2BYE A;  3AEA B;  1FMA D;  1H10 A;  2LXA A;  1EM7 A;  4BBK A;  1WIA A;  2N0S B;  2PEA A;  1FGZ A;  2LI5 A;  1P3R A;  1DYN A;  3HIE A;  4GZU A;  1ZOY B;  5FR6 A;  3RPF C;  3M95 A;  3ZXV A;  4JKA A;  3AEC B;  1J8C A;  3NHE B;  3ZNZ B;  3AMZ A;  5IN7 A;  2AQ1 B;  4A3P A;  2WU2 B;  1ZC3 B;  3KRW A;  3MDB C;  2NS5 A;  3BYT B;  4XWX A;  4IOI E;  2J52 A;  3IFW B;  3KYD D;  3ZNI D;  4IW0 A;  3W1Y A;  3NSU A;  4BZA A;  1YQ3 B;  2CS4 A;  3NY5 A;  5L83 A;  1NBF C;  1WVH A;  3PVW A;  3PRM B;  1ZVR A;  1I4X A;  4K17 A;  4B0E A;  1TKY A;  4KX6 B;  2IGG A;  1TS3 A;  2DYO A;  2KTR A;  1DDW A;  1K8R B;  1CMX B;  3A9J A;  3ML4 A;  2WDR B;  2KWV B;  2IO3 B;  1XT9 B;  1IGD A;  2K6Q A;  4WJP A;  3FC4 A;  5HG2 A;  1F52 A;  3EC8 A;  4A3O A;  1YJJ A;  1ZDV A;  2OJW A;  1EF5 A;  1VLB A;  2L0T A;  3ZQ4 A;  2CB8 A;  3SV1 A;  2MJ3 A;  4K7S A;  1L0V B;  2WHI A;  2GLS A;  2MQJ A;  1LO5 D;  4HB4 B;  1XOD A;  1E9M A;  2W55 A;  5AEK B;  1UEF A;  2AWT A;  3RZW C;  3TO1 A;  2LJ5 A;  4ARC A;  2GB1 A;  2JU6 X;  4IC7 B;  2BWE S;  1RLF A;  2W2X C;  2X38 A;  2BTE A;  2KJR A;  2WLB A;  4YSZ B;  2WGS A;  3N30 A;  1N5X A;  4URK A;  1AQC A;  1PQS A;  3L17 A;  5JLJ B;  2IZV B;  3F5R A;  1A5R A;  3GYP A;  3W2D A;  1TKG A;  4EUT A;  4F1S A;  1MK9 B;  2COC A;  4A6Q A;  4DDG D;  2VH2 A;  2AEH A;  2RMM A;  4XWW A;  4JKB A;  1U27 A;  4YL8 A;  1SXT A;  3B0A A;  3VAW A;  3VUX A;  3DBR B;  3VRA B;  2XK5 B;  1HB6 A;  3E9L A;  1FM0 D;  1XCQ L;  4RNA A;  2DA0 A;  1P7F A;  5C23 A;  1V88 A;  1EWY C;  1YOV B;  2W82 A;  2D4Q A;  2K9X A;  1UZX B;  5C5B B;  1NVI D;  1QIL A;  2JYE A;  4FBJ B;  2IYB A;  2UYZ B;  3BWU D;  2K5P A;  1ET9 A;  3D8E A;  1XLO A;  2C9W B;  3ZJV A;  5H92 C;  5H8Y E;  2ZNV B;  2FID A;  2X0S A;  3DBL I;  3IG3 A;  2EKI A;  3BK2 A;  1VBH A;  3C8Y A;  3N9Y C;  2DAF A;  1NYQ A;  1B9R A;  1FCL A;  4NY0 A;  2NBW B;  4WJQ A;  2K25 A;  2KKC A;  5J3Y A;  1V5O A;  5IOI A;  4G11 A;  1GG3 A;  3M63 B;  3ECI A;  1GGO A;  1I7H A;  4GGQ A;  1PGA A;  4GPT B;  4HAV B;  2BCJ A;  3DBH B;  4OZA A;  5LLI A;  2RQ1 A;  3ZVR A;  2L2I A;  2GCJ A;  1WYG A;  1SE9 A;  2OJR A;  2W3S A;  2Y3A A;  4DBG A;  2D9W A;  1T77 A;  2AX5 A;  4JKD A;  2LVQ A;  4PNK A;  1EGX A;  3VOQ A;  4JKF A;  1WY8 A;  3KVF B;  1KZG A;  2YS1 A;  1MG4 A;  1QOA A;  1P9D U;  1J7C A;  1F9J A;  3VXW A;  4XX5 A;  3ZDM C;  1X1F A;  1E7U A;  3R7Q A;  5D2M B;  2SAK A;  1FFU A;  3DHI C;  2UZR A;  1HTQ A;  4HKZ E;  2UWQ A;  4KHB A;  3B2F A;  2B3A A;  4KGS A;  4G0N B;  2KX0 A;  3HUI A;  4G50 A;  4GSW A;  1LM8 B;  4RF1 A;  2ZW1 A;  2G4S A;  2MW5 A;  3DPD A;  3QHT A;  4MDK E;  1UNR A;  4QAY A;  2D07 B;  5DCN A;  2RDG A;  4O1N A;  4L2Y A;  2KC1 A;  1JWM D;  4B95 A;  4ICU A;  2JZP A;  2MP2 A;  1E7V A;  3R2T A;  5HE2 A;  3NS8 A;  1TKE A;  4CHK A;  1SHC A;  2KUQ A;  3NOB A;  3L08 A;  4M01 A;  2M8S A;  3GZN I;  1FGY A;  3PSE B;  3ZNG C;  5DPT A;  1GPX A;  4HRO A;  2FIF A;  4ITK A;  3C0R B;  4IWQ A;  1WM3 A;  4FJV B;  2MH7 A;  2L8J A;  3GE3 C;  1LXD A;  3UI3 A;  3Q8C A;  3VTV A;  2CKH B;  1PLS A;  2O6V D;  3ODO A;  4BOZ B;  3T9L A;  3P4P B;  1SEB D;  4A6F A;  1YN4 A;  3DHH C;  3ULC A;  4RFB A;  4AOF A;  3BIN A;  3CIR B;  2ELA A;  2NZ8 B;  2PW9 A;  3AEE B;  1ENF A;  1WJ4 A;  5KCV A;  3TFM A;  1UPQ A;  3PS6 A;  1Q1O A;  3NS1 A;  5AUI A;  3U8Z A;  3SD5 A;  1TT5 B;  1CJE A;  2IO0 B;  1Q67 A;  2BS3 B;  2KN5 A;  2Z0D B;  1KJT A;  4HHV A;  2WXP A;  3TIX A;  3RFZ B;  4D6W A;  4HRS A;  2KVR A;  2L52 A;  3ZTD A;  4ZHO A;  2IJ0 A;  3ZUN A;  3E9O A;  1MAI A;  3A1Q A;  2NBV B;  5J2R A;  3DVG Y;  4H2A A;  1UWX A;  4JX1 C;  2KQ7 A;  4FJZ A;  2N7E A;  3TJP A;  2VRR B;  3RMK C;  1FAO A;  4HAU B;  2O6V A;  2RGN B;  2P0D A;  4MGY E;  5GMV A;  2G9H D;  1I35 A;  3FLV A;  3AI5 A;  1WR1 A;  2KMM A;  2K3U A;  3TSS A;  2CU1 A;  1ZGU B;  2Z0Q A;  3KWV A;  2K8E A;  3KUD B;  2K22 A;  3ML8 A;  4KHO A;  2WDT B;  4XC2 A;  5HE0 A;  3RNG C;  2YS5 A;  3N3K B;  3T3O A;  3SBT A;  1R4M B;  1FHX A;  3D8F A;  1WZ3 A;  4BKT A;  3T3N A;  4KGT A;  3WIM A;  3HVZ A;  1V5T A;  2LKO A;  3VHT C;  3APD A;  2M56 B;  1WRD B;  2DIK A;  1T0R C;  1WGK A;  3H9D A;  2WYQ A;  1RAX A;  4HWI B;  1WI1 A;  3A4R A;  1DOY A;  1OEY J;  2MP2 B;  2CY4 A;  4YTM B;  5D3V A;  4MAC A;  2K00 A;  1U5F A;  1GOZ A;  2BVC A;  3LB8 C;  3I57 A;  3V60 A;  5C3J B;  4W9F A;  1XEE A;  1FXI A;  4JK8 A;  2D9Y A;  4UDU C;  1PGX A;  3NVV A;  1Y19 B;  2JQR B;  1WXM A;  2ZNV C;  1I4P A;  5G55 A;  5G5G A;  1YNT E;  4CHJ A;  2CRF A;  3PTF C;  1BWN A;  5IA7 A;  3TBL D;  1V81 A;  5EDS A;  5C79 A;  4WJO A;  4BOS C;  1G6J A;  4W9C A;  2W54 A;  4FUL A;  4F7G A;  4DDI D;  1ZP0 B;  4AUQ C;  3P2B A;  2ZCB A;  5GXG B;  3RUI B;  4P16 A;  3AV8 A;  1JWB D;  4JPS A;  3TL5 A;  3UGB B;  4ANV A;  2ACZ B;  2YVC A;  1EVH A;  1UH6 A;  1YMH E;  1TZ1 A;  1PGB A;  2MFQ A;  2QDF A;  1U4A A;  5AZF A;  3MHS D;  4N59 A;  2LZ6 A;  3AE4 B;  3NVW A;  3SR6 A;  5I2S A;  3EHV A;  2NCN A;  2KJ6 A;  2C60 A;  2LRU A;  4ACF A;  4RH6 A;  4JLC A;  1F2R C;  1AWD A;  3Q6B A;  4K3C A;  5L81 A;  1E5W A;  4DBB A;  2KDM A;  1F1H A;  4XGA B;  1WX9 A;  1UNS A;  3FKY A;  5JXV A;  3AU4 A;  4EZK A;  3E9P A;  2N9K A;  2H7E A;  5KQ4 A;  3W1S A;  2KQS A;  3NWD A;  4IUM B;  2KIG A;  3A8P A;  2FE8 A;  3EFU A;  2DLB A;  1MG8 A;  5CLL B;  1WMH A;  2Z0E B;  1CQV A;  2J42 A;  4S0R A;  2ZPN A;  2WP9 B;  3AJ4 A;  2LUE A;  2R82 A;  4OZB A;  3O96 A;  2IY0 B;  2G1E A;  5JHG A;  1D5Z C;  4J6I A;  2X8X X;  3LXF A;  5AZG A;  4C0A A;  2NPT B;  2Q13 A;  2A4Z A;  3KY9 A;  2WXR A;  4ZYS A;  1TQZ A;  4BKS D;  2GBK A;  3MTN B;  3QA8 A;  2IYD B;  1QLB B;  4M0W B;  3WCQ A;  4GLS C;  4ANU A;  2UVM A;  3DBR I;  2JWU A;  5JHB A;  2DNF A;  2BPS A;  1V2Y A;  5L95 C;  3PRZ A;  2KDE B;  2MRP A;  1WXA A;  2BW2 A;  4QJ3 B;  2INN E;  4WQM A;  4US8 A;  1XO3 A;  4B6W A;  1N62 A;  1WI0 A;  2B76 B;  2DHZ A;  3DWM A;  1KI1 B;  4MGK E;  1FFV A;  4C4V B;  1V9J A;  3P4R B;  3U7D A;  3P7Z A;  3FVC A;  4DHJ B;  4GDL A;  3EFC A;  4HK2 A;  4KAX B;  2DZK A;  2HTH B;  2RDH A;  4OVV A;  3ABV B;  1H8C A;  3DBS A;  1UNQ A;  3RT3 B;  2ZZP B;  3DXD A;  1VRA B;  1SE2 A;  5KHQ A;  1I4G A;  5D6J B;  2KLG A;  4GB9 A;  1A70 A;  3OG5 A;  3CIK A;  1MJD A;  2K39 A;  4LNF A;  2INP E;  1VCB A;  3FSS A;  1MI1 A;  3KUZ A;  3DCX A;  3DBH I;  4GDK B;  1MPH A;  4EJN A;  1XKE A;  4N58 A;  3VR8 B;  5HFY A;  2L1A A;  1SIJ A;  3BK1 A;  1XR0 B;  1OQQ A;  3CXB B;  4DHZ E;  4ASW C;  1HZ6 A;  1W1G A;  1WM2 A;  4GOU A;  2RR9 A;  1WMH B;  1ZKH A;  3V6E B;  3N32 A;  2FUG 1;  2KIE A;  3P4Q B;  2CQU A;  1TIF A;  1V6E A;  3NZ3 A;  4CO7 A;  1F2R I;  3DQV A;  3BVM A;  2WH5 A;  2LGD A;  5LXH A;  4GMV A;  2KJH B;  3HK0 A;  3KQ4 A;  1XX0 A;  1JQ4 A;  4GIV A;  2Y7B A;  5IP4 D;  2PVO D;  5LON B;  3W5U B;  3B1L X;  4TYZ A;  2KCJ A;  2K2J A;  2J53 A;  3PZ8 A;  4OVU A;  1FCC C;  4W9D A;  1L0Y B;  2V0G A;  1DRO A;  2IFS A;  4IG7 B;  3H8H A;  2MBB B;  2G35 A;  3QCA A;  5G5H A;  2BYV E;  3DDC B;  1BTN A;  3BII D;  4WWN A;  2C5L C;  3P1M A;  1FXT B;  1JWA D;  2DX1 A;  1XXG A;  2LXC A;  1T0Q C;  3HQC A;  1U5E A;  4W9L A;  2KDF B;  3PT2 B;  4A20 A;  4BVU C;  4A6H A;  3R8B A;  3A9K A;  4F7U P;  2G3Q B;  4LTU A;  1IBX B;  3A98 B;  4KGR A;  1DBH A;  4FA6 A;  3SDL C;  4D0N B;  3DVG X;  4D2K A;  3GS2 A;  4AQ7 A;  2RSG A;  4KHA A;  1WR6 E;  2N7J A;  4TQ0 A;  4KDI C;  1NEK B;  5EE1 A;  3ZJT A;  4ZDV A;  4MJS A;  2J4X A;  3NZU A;  4JK9 A;  1IGC A;  2BYT A;  1SSN A;  3HVD A;  4LNK A;  2Z59 A;  4JKG B;  2GUM A;  1YJI A;  3Q8B A;  2D3B A;  4MM3 A;  1J7A A;  3V05 A;  1V86 A;  1VZ8 A;  1JRU A;  3P4S B;  1JDE A;  3WAO A;  1GAQ B;  2FCN A;  2KGX B;  1P98 A;  4K2O A;  1E8Y A;  1C77 A;  5JVL A;  2JF5 A;  2O2V A;  4L1R A;  3S2A A;  4OHJ A;  2KT7 A;  2NR2 A;  3JSV A;  2P8V A;  3NG0 A;  2YF0 A;  5J3Q A;  4L23 A;  2J59 M;  4MGI E;  2QEJ C;  5I2M A;  3FAH A;  1FHO A;  2Z8L A;  1I4H A;  1V49 A;  3J9C A;  3TEW A;  1KM7 A;  3NUH B;  1D5M C;  3RN9 C;  4MSQ B;  2OQB A;  4GN1 A;  3Q3F A;  1TS5 A;  1SBB B;  5FI1 A;  1AW7 A;  1XLN A;  1S1Q B;  3RNC C;  5JP4 A;  4EZJ A;  2M4N A;  2FJ9 A;  4HPL B;  3TVV A;  2D10 A;  1UPR A;  5D3W A;  1RRP B;  3VIA A;  4RCO A;  1UF0 A;  1FOE A;  1QT9 A;  3G9W A;  3OAW A;  1R4M I;  2DHK A;  3AM9 A;  4KIK A;  4HB0 B;  1YQB A;  2WNM A;  3A58 A;  4NAW A;  5D3I B;  2MLB A;  2QKL A;  2P0H A;  1NI3 A;  3PGE A;  2GMI C;  3N20 C;  3Q2A C;  4DWF A;  1I4R A;  1E8X A;  2JP2 A;  1LFD A;  3AE5 B;  3AED B;  3RUL A;  3ZJU A;  1D3Z A;  3VDZ A;  5JZE B;  4WQO B;  1T6B X;  1FD6 A;  2EMT A;  2LAS A;  2MX2 A;  2WQY B;  1ZC4 B;  1BXT A;  3HIZ A;  3WA0 A;  2XN9 C;  1QQR A;  3U4E G;  4WVF B;  4A9A A;  2I2Y A;  4AS1 A;  2D9Z A;  4WWO A;  2RPV A;  4K3B A;  3AXC A;  3ZRF A;  1V5P A;  1WGG A;  3IT4 B;  4GOC A;  4N9F 4;  3NW8 A;  3DXE A;  2FUH B;  2VH1 A;  1V1P A;  3AEB B;  2MJD A;  3PPA A;  4RMA A;  4E3C A;  3V6C B;  5EE3 A;  1L6U A;  1C79 A;  4WWP A;  5BO4 B;  2LWP A;  4WAF A;  2DBY A;  4RF0 A;  3RI7 C;  4KSL C;  2WXL A;  1FEH A;  3MFG A;  2KTR B;  2V9H A;  2O2V B;  1TS4 A;  2AL3 A;  3QIJ A;  4AWJ A;  3A9J B;  1IUE A;  1Z5S B;  2XBB C;  4TKN A;  3PVU A;  4ZRK A;  1WX8 A;  4ZHP A;  4LCD E;  2KVZ A;  2DKQ A;  3KZ1 A;  2PPH A;  2Y5B B;  4HB2 B;  3VTU A;  2QMT A;  4II3 B;  3UIN B;  3APC A;  2D5G A;  4IM0 A;  2HJ1 A;  2DX5 A;  2RRF A;  1XCT L;  1QOF A;  1GC7 A;  2K8C A;  2LGS A;  3BJI A;  4JGH B;  3QWZ B;  3B9J A;  3HM6 X;  3MC8 A;  1QQG A;  4ILG B;  1FNW A;  3H1U A;  2XEW A;  1XLQ A;  4NQL B;  4A5K A;  1T0Y A;  5FR3 A;  2CAY A;  3QC8 B;  2FJU B;  1DOX A;  3L54 A;  3SBG A;  1WJM A;  2X18 A;  3QX1 A;  3QK0 A;  4OZC A;  4KV2 A;  5IKC M;  3ZLZ A;  3H7P A;  4LNN A;  2KFJ A;  4K1R B;  2GI9 A;  3ZO5 B;  2KLC A;  1D5X C;  2GBR A;  2QCZ A;  2K2U A;  3QJZ A;  1SGH A;  1MIX A;  1PUT A;  1STE A;  2KMA A;  4W9I A;  1ZSQ A;  2L00 B;  2NTS A;  2KWC A;  2TSS A;  2WXO A;  1ET6 A;  5EFX A;  2GOW A;  3UQB A;  3N1Z C;  3NVY A;  4TMA B;  2C7H A;  2MSE D;  3KW5 B;  1EO6 A;  2NMQ A;  1VDV A;  3ONS A;  2DYQ A;  3Q8F A;  2KAJ A;  4Z2N A;  1YX6 B;  4OT1 A;  2IO1 B;  4G3X B;  2GBM A;  3AEF B;  3N1Y C;  3ALB A;  1RFK A;  3UIP B;  4BFR A;  1SF0 A;  4ZRJ A;  3ENB A;  1RYJ A;  1L4D B;  2MBE A;  4DX8 A;  2DYB A;  3L13 A;  4XDC A;  2WXI A;  4RGO S;  2KDB A;  2N9X A;  1C4A A;  2EC1 A;  4NJ7 A;  1F0Z A;  2L83 A;  1I42 A;  3LJ3 A;  2NVU I;  1KFY B;  2FCS A;  3PZ7 A;  3U30 A;  4RGM A;  4OW0 A;  2LGX A;  2MDX A;  3CWI A;  1HEZ E;  1EU3 A;  2ONQ A;  4JKE A;  4TSS A;  4PS3 A;  3RNE C;  3P6A A;  4EZL A;  4WIP A;  5BYS A;  1I7A A;  3ODX A;  2MJE A;  4FLH A;  4PS7 A;  3R66 C;  1E0Z A;  1YN3 A;  1VD2 A;  2HRJ A;  3GOE A;  1V97 A;  2LD9 A;  1R4N B;  1WJU A;  1J0W A;  1E10 A;  3TCA A;  3PVL A;  5J3T A;  4KHB B;  2YT2 A;  2REX A;  2W2X D;  1FXA A;  1P5T A;  3P42 A;  4HJG E;  3M1I B;  5DIF B;  2HDE A;  2NBU A;  4MY6 A;  2P0F A;  4LK0 M;  3Q8E A;  1UUP A;  3JVZ X;  5DHA B;  2IPK D;  2KX3 A;  5LNK 1;  3AUL A;  5KQ1 A;  3I63 C;  2ZPY A;  3VH4 B;  4GU2 A;  4JKH A;  3FM8 C;  3RNA C;  2MEK A;  1FHW A;  2W9N A;  2XNA C;  1XD4 A;  1C1Y B;  4C00 A;  4W9E A;  3T8M A;  1D6E C;  4HEA 1;  2H89 B;  4I6L B;  5IJM A;  2GCL A;  3I9V 1;  1C4P A;  4MH8 A;  4P6V F;  1VZ7 A;  1X11 A;  4Z2M B;  4US9 A;  3M3J A;  3HSA A;  4MT7 A;  2OOB B;  3MJW A;  3NVZ A;  5BMG A;  4A6F B;  5D3D A;  2QSD A;  5CTR C;  1JWS D;  5FKA C;  4HCP B;  1OFF A;  1WGR A;  3AEG B;  1K52 A;  2Y5P A;  4OVZ A;  3DVN U;  2D11 A;  3NWA A;  4ZRI A;  1M7E A;  2L76 A;  2KHW B;  1XCG A;  3DOW A;  2RVB B;  2JXX A;  3T06 A;  1TBE A;  4NPN A;  2V76 A;  2DHJ A;  4E71 A;  1TTN A;  3A1Q B;  2VRW B;  3ZIM A;  2I5C A;  1NTY A;  1YIW A;  1VJK A;  1ACC A;  4EMO A;  1P6S A;  3GP7 A;  1MK7 B;  4DX9 0;  2CY5 A;  1NTV A;  1JRP A;  2O6V B;  1DDV A;  1CK1 A;  3K9O B;  1T0S C;  4JL9 A;  1WFY A;  2COF A;  4K81 A;  1K53 A;  1WE7 A;  3X0W A;  1VBG A;  1UGJ A;  4B9K A;  1PMS A;  3LDZ E;  5DPS A;  1SB3 C;  3TW1 A;  1WXQ A;  2KXJ A;  1OEY A;  4YWG G;  2CHX A;  3DCG A;  3PLU A;  4HXD A;  1UD7 A;  1JML A;  5EE9 A;  5IO9 A;  2LHE A;  3AE8 B;  2E2X A;  2N1V A;  2KR0 A;  4C7Z A;  2AL6 A;  2RDB C;  3SYX A;  1KRH A;  3DVN V;  3TEX A;  2PJH A;  2ADZ A;  1K50 A;  5G2N A;  1GJZ A;  1MFW A;  3LYY A;  1N61 A;  2YT0 A;  2N4F A;  1HTO A;  1V5U A;  2RPQ A;  1MHH E;  1Y5O A;  1OGW A;  1SJH D;  1U5G A;  5C16 A;  2ZVN A;  1Q5W B;  2V4L A;  1HQR D;  3WAP A;  1IP9 A;  1Y56 A;  1LQB A;  1L2N A;  4P7I A;  2W3R A;  3F0W A;  2R2Y A;  3ZGZ A;  1EF1 A;  3PLV A;  3C19 A;  2UZS A;  1WGY A;  4HAX B;  2V3P A;  2LEK A;  1ZXH A;  1NVL A;  5D27 A;  2CR5 A;  3A8Q A;  2KWD A;  3MJ5 A;  2WX0 A;  2M19 A;  2E3T A;  1WGU A;  2YSZ A;  4EEW A;  2R2O A;  4LNI A;  2MHJ A;  4KZC A;  1WE6 A;  2Z13 A;  1E7P B;  3ML9 A;  2PIA A;  1ST7 A;  1C76 A;  3WYF B;  3MPX A;  3B77 A;  3RCP A;  4MK0 A;  1FB8 A;  1XD3 B;  3CMM B;  3PHX B;  3V3X A;  4BBN C;  5HKH A;  3D8D A;  2IBI B;  4USA A;  4DQO C;  1K51 A;  3RYT A;  3AE1 B;  1P0R A;  4BKS A;  1DIK A;  3MP9 A;  1P7E A;  3TEY A;  3OJ4 B;  2IY1 B;  2HD5 B;  3FP5 A;  3PSC A;  3HRD D;  4MT5 A;  1ZXI A;  2MBO A;  2K1F A;  2IGD A;  3AE7 B;  1KH0 A;  3AE9 B;  4W9J A;  3NRZ A;  2BB6 A;  1KTK A;  1NDD A;  1WRI A;  3V62 A;  4B0M A;  2COD A;  3QWM A;  4HPM B;  2VZK B;  3AE6 B;  5E6N A;  2GBJ A;  3PRE A;  2LGI A;  1N60 A;  4DK5 A;  3ZW3 A;  3EA6 A;  5CX3 A;  3R2I A;  2JY6 A;  4YSY B;  5I4D A;  2GS0 A;  3TEZ A;  4K7W A;  3U7Z A;  1D4B A;  3KSY A;  2FNJ B;  1GNU A;  3M62 B;  2ZVO A;  5E6P A;  4HCN B;  4HJK A;  3L16 A;  4A55 A;  1VR9 A;  5DI9 B;  2ZKM X;  1X05 A;  1WX7 A;  2UU7 A;  1I4Q A;  2QHO A;  2WDV B;  2YRY A;  2L05 A;  4HAY B;  2WXF A;  3ZXR A;  4YT0 B;  2K6D B;  3AN1 A;  2J0M A;  2Q5W D;  1KZ7 A;  4XWT A;  4HAW B;  2MWN B;  2AQ2 B;  2NMB A;  1FRD A;  2L7R A;  1U5D A;  1AAR A;  1JW9 D;  2KQ4 X;  3D32 A;  4JKC A;  3V61 A;  2KN4 A;  2Y8G A;  2JZZ A;  2DZJ A;  5DPR A;  1V5M A;  3AH7 A;  1FNV A;  2FAZ A;  3EEC A;  2N9L A;  2KMC A;  4MGZ E;  4HAT B;  4GDL B;  2Z0P A;  2CJO A;  3N7C A;  1V8C A;  4EKU A;  2FJL A;  2ABD A;  1K5D B;  4IOY X;  2M0A A;  4NJC A;  2RUK B;  1LW3 A;  2KYW A;  2M0X A;  2LJI A;  2WXQ A;  3PEG A;  2JXT A;  2XK5 A;  5FI0 A;  2PVG C;  2KZR A;  1TS2 A;  4TV3 A;  5C5B A;  3R7R A;  5E6J A;  2G4D B;  2KFK A;  3K9P B;  2FCM A;  4LJP B;  2BQQ A;  2MBQ A;  3OLM D;  2D9V A;  4KKJ A;  2I1K A;  2KDI A;  3CSF A;  3V5W A;  3H7S A;  3PZD A;  2A5U A;  1RFA A;  1RJ2 A;  2KO3 A;  1ZW7 A;  5LXI B;  3H6N A;  2JT4 B;  2ZW0 A;  2Z14 A;  2MCN B;  1L4Z B;  4TQ1 A;  2KD0 A;  2N23 A;  3E56 A;  2WWZ A;  3GB1 A;  4IDI A;  2ELB A;  1U29 A;  4HPP A;  1E6E B;  1T5X D;  3ODW A;  1R4N I;  2JX5 A;  1YN5 A;  3SUZ A;  4LDT B;  1FNU A;  4JQW C;  4WAA A;  2R61 A;  4F8C B;  4IFS A;  2WXN A;  5AZH A;  3VUW A;  1OQN A;  2DKP A;  4C56 C;  1FPY A;  3HM3 A;  4L1B A;  2RSU A;  2BYF A;  2L32 A;  1MVK A;  3A4S C;  1OQY A;  4IAP A;  5CHF A;  1WG7 A;  2LOX A;  2D9X A;  2BF8 B;  2LUL A;  1HBK A;  3BVG A;  5LOP B;  1N3H A;  1WYW B;  5AUK A;  4RM9 A;  1HB8 A;  3Q8A A;  3R3M A;  1WF9 A;  2D3C A;  4X57 B;  1E90 A;  2WXM A;  2AQ3 B;  1QKZ A;  4KSK C;  2MKR A;  3UIO B;  4ILH A;  2BKF A;  4PYZ A;  3OHM B;  1Z2M A;  5M4Y B;  1OTR B;  2WS3 B;  3QQ8 B;  4CQN A;  2LOZ A;  3A9K B;  3WAN A;  1GC6 A;  2R0D A;  2JVC A;  3AE3 B;  3VUY A;  3UQA A;  3KLS X;  4K7U A;  3BY4 B;  1M4V A;  2QIE B;  4DHZ B;  4A90 A;  4PQ0 A;  3VFK A;  3VVW B;  4HB3 B;  4ANW A;  3DWG C;  2RD0 A;  2M14 A;  4MJS B;  2ICI A;  1XQQ A;  4HLE A;  2KK8 A;  1RM6 C;  4K2P A;  4CHM A;  1SIF A;  2Z59 B;  3IAS 1;  4HSI A;  4HDO A;  1B1Z A;  2ASQ A;  4MM3 B;  2KFK B;  3SO6 A;  4L6E A;  2OHF A;  3MC9 A;  4XDD A;  1V80 A;  2GRI A;  4MH0 E;  2W2W A;  1MKE A;  2V3N A;  4WWM A;  2DWQ A;  4RGN A;  4EFO A;  5CLQ B;  2PLP A;  2LUM A;  1SE4 A;  3CF6 E;  2YEP F;  1MIZ B;  2ROZ B;  4JWS C;  2Y5C A;  3KUC B;  3ZKJ C;  5GOW B;  2IO2 B;  3SHQ A;  4QXA B;  3Q3M C;  3JSV B;  3U52 E;  3E66 A;  4M02 A;  4ZYN A;  1GB1 A;  4F7Z A;  5BMH A;  2R2Q A;  3W1S C;  3ZVV A;  4FXC A;  2ZEQ A;  3Q3N C;  4F7H A;  4CSQ A;  1HXY D;  1ZPS A;  2WDQ B;  3I5J C;  4BBN F;  4ARI A;  3PRP B;  2Z0O A;  3RCZ A;  1ACA A;  4YTN B;  1GB4 A;  2DAJ A;  1IYF A;  2G45 B;  1L0X B;  4A8X C;  4HKQ A;  2COA A;  4DIX A;  1WXS A;  2EJ8 A;  1OQR A;  4P1B C;  1MPE A;  3AE2 B;  4KIK B;  3X23 A;  1QF6 A;  2KUP A;  2KTF A;  1OMW A;  2J0J A;  2GJY A;  3AB5 A;  2AYO B;  2NBV A;  4NAW B;  4JIO U;  1Z87 A;  3KYC D;  3HW2 B;  4MSM B;  5C6R A;  3RZF A;  4FAD A;  3ULB A;  3QAQ A;  1N6Z A;  1E8Z A;  2YS3 A;  5IRS A;  4IM2 A;  5BYQ A;  1ISN A;  1NI2 A;  1R7S A;  2N1W A;  1V1O A;  3VQI A;  2LFI A;  2L0F A;  2V3S A;  1KLV A;  2K49 A;  4C7Y A;  1RRB A; 
#chains in the Genus database with same CATH homology
 5CHV C;  1WGH A;  1WGQ A;  2RGF A;  2N0Y A;  4GMX B;  4NJ6 A;  5JHA A;  1NTI A;  2I5F A;  4FHK A;  1C3T A;  3L0W B;  5HE3 A;  2KOX A;  4EOY A;  1DDM A;  1UNP A;  4YON A;  2JPH A;  2J0K A;  2XQN M;  2VKI A;  2DLW A;  1E8W A;  2MA9 B;  2MBH A;  2YLM A;  4JK7 A;  2RNR B;  1P3Q U;  2BWF A;  3TMP B;  3Q3J A;  1TJ6 A;  2LGY A;  4BKG A;  3PG7 A;  4KZ0 A;  3B08 A;  5IAA C;  1UGM A;  4I6N B;  2D3G A;  1TGZ B;  1LB1 A;  4NQK E;  2DX5 B;  3PP2 A;  3KH0 A;  4KDL B;  1M94 A;  2K8H A;  2PE9 A;  4MEM A;  4DXA B;  2K8B A;  3ZTC A;  3AU5 A;  4FJY A;  1EAZ A;  3WAL A;  1BT0 A;  2ROV A;  4LJO B;  4B6H A;  2LYD A;  2LRW A;  3OJ3 A;  3H7P B;  2OTX A;  1AWE A;  1WJ6 A;  3VH3 B;  1IPG A;  4PS8 A;  4AJW A;  1X1M A;  1X86 A;  1UBQ A;  4RM8 A;  3ZRC A;  5JHH A;  2KNB A;  4IWO A;  2JUO A;  2DTC A;  1WJN A;  1OY2 A;  1WXV A;  2BGF A;  2RLO A;  4AP4 C;  2CHZ A;  2DEN B;  5DHF B;  1NU2 A;  1BAK A;  4M8M A;  5TR5 A;  1L7Y A;  4W9G A;  1KC7 A;  1W1D A;  4FHJ A;  2M38 A;  3QAR A;  3I3T B;  4DHJ D;  1U2B A;  1HE8 A;  3IHP C;  3PV1 A;  4W9H A;  4HDQ A;  1V89 A;  2M17 A;  2D2Q A;  5J17 A;  5D3X A;  2NPT A;  2LBB A;  2MWS B;  3DXC A;  2DZI A;  1YX5 B;  3WAM A;  4NSW A;  2CHW A;  2KC2 A;  4M8N A;  1TXD A;  3JW0 X;  2J7Q B;  4A6K A;  2L1C A;  1W1H A;  1KBL A;  4AJY B;  1BTK A;  4HAZ B;  2FDQ A;  1WJ1 A;  3APF A;  1PFJ A;  2I1J A;  4NNJ B;  2DYN A;  2HTH A;  2FCQ A;  1UEL A;  5JH5 C;  5DPW A;  2DZM A;  1V61 A;  1I2H A;  4MEL A;  2M1M A;  4ILJ A;  3SU8 X;  2C7M B;  3UZT A;  4IM3 A;  2JRH A;  4GDK A;  2KWU B;  2COP A;  2C7N B;  3ZDT A;  1WZ0 A;  1UBI A;  2DYM A;  2KAN A;  2N9E B;  1Q0W B;  3A33 B;  1KOT A;  2N7D A;  2DHI A;  3JYU A;  2LVO A;  1WGD A;  2DN6 A;  5CHW A;  2R09 A;  5J18 A;  2V1Y A;  1QZE A;  4KVG B;  4HVB A;  2EMS A;  3O65 B;  1J19 A;  2WX1 A;  3QBV B;  4II2 B;  5E6O A;  2GBN A;  5C1Z A;  2LG1 A;  1GUA B;  3NZS A;  1B55 A;  2LVP A;  4WJN A;  5D3Y A;  3IVF A;  1YJ1 A;  4IWP A;  2ZJD A;  4ICV A;  2JRI B;  1YD8 U;  2N9P C;  1K5G B;  2DFK A;  1EUV B;  2YT1 A;  3HHM A;  3L10 B;  1J0G A;  5HE1 A;  1M7R A;  5KHO A;  1Y8R C;  2JZ3 B;  5D94 A;  5DH9 B;  4H8S A;  2BKR B;  2PE6 B;  4WJ7 A;  3ENE A;  4JKG A;  3OAN A;  2ZCC A;  4LDT D;  4FN2 A;  3EPY A;  4WSF A;  3KRX A;  1WH3 A;  3SNH A;  3PHW B;  2L3Z A;  4Y94 A;  5D7G A;  4XZ4 A;  4ANX A;  3ZNH B;  1ZM0 A;  2QKM A;  4E74 A;  1P1A A;  3CST A;  4PYU A;  1QC6 A;  3IBE A;  2HE7 A;  2VSZ A;  4W9K A;  3FEH A;  2PZ1 A;  2Y8F A;  1S3S G;  1IRS A;  2H7D A;  1H4R A;  4CYE A;  3UF8 A;  3LJU X;  3GYO A;  2HJ8 A;  1X1G A;  3RD2 A;  3VTW A;  4I6P A;  4TUU A;  2EKE C;  4GXB A;  2JWZ A;  2BYE A;  1H10 A;  2LXA A;  4BBK A;  1WIA A;  2PEA A;  1FGZ A;  2LI5 A;  1P3R A;  1DYN A;  4GZU A;  5FR6 A;  3M95 A;  4JKA A;  1J8C A;  3NHE B;  3ZNZ B;  4A3P A;  1ZC3 B;  3KRW A;  3MDB C;  2NS5 A;  4XWX A;  3KYD D;  3IFW B;  3ZNI D;  4IW0 A;  3W1Y A;  3NSU A;  2CS4 A;  3NY5 A;  5L83 A;  1NBF C;  1WVH A;  3PVW A;  3PRM B;  1ZVR A;  4K17 A;  2DYO A;  2KTR A;  1DDW A;  1K8R B;  1CMX B;  3A9J A;  3ML4 A;  2KWV B;  2IO3 B;  1XT9 B;  4WJP A;  2K6Q A;  3EC8 A;  4A3O A;  1EF5 A;  2L0T A;  2CB8 A;  3SV1 A;  4K7S A;  2MQJ A;  4HB4 B;  1XOD A;  5AEK B;  1UEF A;  2AWT A;  3RZW C;  3TO1 A;  2LJ5 A;  4IC7 B;  2BWE S;  1RLF A;  2W2X C;  2KJR A;  3N30 A;  4URK A;  1AQC A;  1PQS A;  3L17 A;  5JLJ B;  2IZV B;  3F5R A;  1A5R A;  3GYP A;  4EUT A;  4F1S A;  1MK9 B;  2COC A;  4DDG D;  2AEH A;  4JKB A;  1U27 A;  4YL8 A;  3B0A A;  3VAW A;  3VUX A;  2XK5 B;  1HB6 A;  3E9L A;  2DA0 A;  5C23 A;  1V88 A;  2D4Q A;  1UZX B;  5C5B B;  4FBJ B;  2IYB A;  2UYZ B;  3D8E A;  2C9W B;  2ZNV B;  2FID A;  2X0S A;  3DBL I;  3IG3 A;  1VBH A;  2DAF A;  4NY0 A;  2NBW B;  4WJQ A;  2K25 A;  2KKC A;  5J3Y A;  1V5O A;  4G11 A;  1GG3 A;  3M63 B;  3ECI A;  1GGO A;  4GGQ A;  4GPT B;  4HAV B;  2BCJ A;  5LLI A;  2RQ1 A;  3ZVR A;  2L2I A;  2GCJ A;  1SE9 A;  2OJR A;  4DBG A;  2D9W A;  4JKD A;  2LVQ A;  4PNK A;  1EGX A;  3VOQ A;  4JKF A;  1WY8 A;  3KVF B;  1KZG A;  2YS1 A;  1P9D U;  1F9J A;  3VXW A;  4XX5 A;  3ZDM C;  1X1F A;  1E7U A;  3R7Q A;  5D2M B;  2UZR A;  2UWQ A;  2B3A A;  4G0N B;  2KX0 A;  4G50 A;  4GSW A;  1LM8 B;  2G4S A;  2MW5 A;  3DPD A;  3QHT A;  4MDK E;  1UNR A;  2D07 B;  5DCN A;  2KC1 A;  4B95 A;  4ICU A;  2MP2 A;  1E7V A;  5HE2 A;  3NS8 A;  4CHK A;  1SHC A;  3NOB A;  3L08 A;  2M8S A;  3GZN I;  1FGY A;  3PSE B;  3ZNG C;  5DPT A;  2FIF A;  3C0R B;  4IWQ A;  1WM3 A;  4FJV B;  2L8J A;  1LXD A;  3VTV A;  2CKH B;  1PLS A;  2O6V D;  3ODO A;  4BOZ B;  3T9L A;  4A6F A;  3ULC A;  4AOF A;  3BIN A;  2ELA A;  2NZ8 B;  1WJ4 A;  5KCV A;  3TFM A;  1UPQ A;  3PS6 A;  1Q1O A;  3SD5 A;  3U8Z A;  2IO0 B;  1Q67 A;  2KN5 A;  2Z0D B;  1KJT A;  4HHV A;  3TIX A;  2KVR A;  3ZTD A;  3ZUN A;  3E9O A;  1MAI A;  3A1Q A;  2NBV B;  5J2R A;  3DVG Y;  2KQ7 A;  4FJZ A;  2N7E A;  3TJP A;  2VRR B;  1FAO A;  4HAU B;  2O6V A;  2RGN B;  2P0D A;  4MGY E;  5GMV A;  1I35 A;  3FLV A;  3AI5 A;  1WR1 A;  2CU1 A;  1ZGU B;  2Z0Q A;  3KUD B;  3ML8 A;  4KHO A;  2WDT B;  4XC2 A;  5HE0 A;  2YS5 A;  3N3K B;  3SBT A;  1FHX A;  3D8F A;  1WZ3 A;  4BKT A;  3WIM A;  1V5T A;  2LKO A;  3VHT C;  3APD A;  1WRD B;  2DIK A;  3H9D A;  2WYQ A;  1RAX A;  4HWI B;  1WI1 A;  3A4R A;  1OEY J;  2MP2 B;  2CY4 A;  5D3V A;  2K00 A;  1U5F A;  3V60 A;  4W9F A;  4JK8 A;  2D9Y A;  1Y19 B;  1WXM A;  2ZNV C;  5G55 A;  4CHJ A;  2CRF A;  3PTF C;  1BWN A;  5IA7 A;  3TBL D;  1V81 A;  5EDS A;  5C79 A;  4WJO A;  4BOS C;  1G6J A;  4W9C A;  4FUL A;  4F7G A;  4DDI D;  4AUQ C;  3P2B A;  2ZCB A;  3RUI B;  3TL5 A;  3UGB B;  4ANV A;  2YVC A;  1EVH A;  1UH6 A;  1TZ1 A;  2MFQ A;  1U4A A;  5AZF A;  3MHS D;  2LZ6 A;  3EHV A;  2NCN A;  2KJ6 A;  2C60 A;  2LRU A;  4JLC A;  5L81 A;  1E5W A;  4DBB A;  1WX9 A;  3AU4 A;  4EZK A;  3E9P A;  2H7E A;  5KQ4 A;  3W1S A;  2KQS A;  4IUM B;  3EFU A;  3A8P A;  1MG8 A;  5CLL B;  1WMH A;  2Z0E B;  2ZPN A;  3AJ4 A;  2LUE A;  2R82 A;  3O96 A;  2IY0 B;  5JHG A;  4J6I A;  5AZG A;  4C0A A;  2NPT B;  2Q13 A;  2A4Z A;  3KY9 A;  1TQZ A;  4BKS D;  2GBK A;  3MTN B;  3QA8 A;  2IYD B;  4M0W B;  4ANU A;  2UVM A;  3DBR I;  5JHB A;  2BPS A;  1V2Y A;  5L95 C;  3PRZ A;  2KDE B;  2MRP A;  1WXA A;  4B6W A;  1WI0 A;  2DHZ A;  1KI1 B;  4MGK E;  1V9J A;  3U7D A;  3P7Z A;  4DHJ B;  4GDL A;  4HK2 A;  4KAX B;  2DZK A;  2HTH B;  4OVV A;  1H8C A;  3DBS A;  1UNQ A;  3RT3 B;  2ZZP B;  3DXD A;  5KHQ A;  5D6J B;  2KLG A;  4GB9 A;  3CIK A;  2K39 A;  1VCB A;  3FSS A;  3KUZ A;  3DBH I;  4GDK B;  1MPH A;  4EJN A;  1XKE A;  1XR0 B;  3CXB B;  4DHZ E;  4ASW C;  1W1G A;  1WM2 A;  2RR9 A;  1WMH B;  1ZKH A;  3V6E B;  3N32 A;  2CQU A;  1V6E A;  4CO7 A;  3DQV A;  2WH5 A;  2LGD A;  5LXH A;  4GMV A;  2KJH B;  3HK0 A;  1XX0 A;  4GIV A;  2Y7B A;  5LON B;  3B1L X;  4TYZ A;  2KCJ A;  2K2J A;  4OVU A;  4W9D A;  1DRO A;  2IFS A;  4IG7 B;  2MBB B;  2G35 A;  3QCA A;  2BYV E;  3DDC B;  1BTN A;  4WWN A;  2C5L C;  1FXT B;  2DX1 A;  2LXC A;  3HQC A;  1U5E A;  4W9L A;  2KDF B;  3PT2 B;  4A20 A;  4BVU C;  4A6H A;  3A9K A;  4F7U P;  2G3Q B;  3A98 B;  1DBH A;  4FA6 A;  3SDL C;  4D0N B;  3DVG X;  2RSG A;  4KHA A;  1WR6 E;  4TQ0 A;  4KDI C;  4ZDV A;  4MJS A;  3NZU A;  4JK9 A;  4JKG B;  4MM3 A;  1V86 A;  1JRU A;  1JDE A;  3WAO A;  2FCN A;  2KGX B;  1P98 A;  4K2O A;  1E8Y A;  5JVL A;  2JF5 A;  2O2V A;  3S2A A;  2NR2 A;  3JSV A;  2P8V A;  2YF0 A;  5J3Q A;  2J59 M;  4MGI E;  1FHO A;  1V49 A;  1KM7 A;  4MSQ B;  2OQB A;  4GN1 A;  3Q3F A;  5FI1 A;  1S1Q B;  5JP4 A;  4EZJ A;  2M4N A;  2FJ9 A;  4HPL B;  3TVV A;  2D10 A;  1UPR A;  5D3W A;  1RRP B;  3VIA A;  1FOE A;  3G9W A;  3OAW A;  1R4M I;  2DHK A;  4KIK A;  4HB0 B;  1YQB A;  4NAW A;  2MLB A;  2QKL A;  2P0H A;  3PGE A;  2GMI C;  4DWF A;  1E8X A;  2JP2 A;  1LFD A;  3RUL A;  1D3Z A;  3VDZ A;  5JZE B;  4WQO B;  2EMT A;  2LAS A;  2MX2 A;  1ZC4 B;  3HIZ A;  3WA0 A;  4WVF B;  2D9Z A;  4WWO A;  3AXC A;  3ZRF A;  1V5P A;  1WGG A;  4GOC A;  4N9F 4;  3DXE A;  2FUH B;  3PPA A;  4RMA A;  4E3C A;  3V6C B;  4WWP A;  5BO4 B;  2LWP A;  4KSL C;  2KTR B;  2O2V B;  2AL3 A;  3QIJ A;  4AWJ A;  3A9J B;  1Z5S B;  2XBB C;  4TKN A;  3PVU A;  4ZRK A;  1WX8 A;  4LCD E;  2DKQ A;  3KZ1 A;  2PPH A;  2Y5B B;  4HB2 B;  3VTU A;  4II3 B;  3UIN B;  3APC A;  4IM0 A;  2DX5 A;  1GC7 A;  2K8C A;  3BJI A;  4JGH B;  3QWZ B;  3HM6 X;  1QQG A;  4ILG B;  3H1U A;  2XEW A;  4NQL B;  4A5K A;  1T0Y A;  2CAY A;  3QC8 B;  3L54 A;  3SBG A;  1WJM A;  2X18 A;  3QX1 A;  3QK0 A;  4KV2 A;  3ZLZ A;  3H7P A;  2KFJ A;  4K1R B;  3ZO5 B;  2KLC A;  2GBR A;  2K2U A;  3QJZ A;  1SGH A;  1MIX A;  2KMA A;  4W9I A;  1ZSQ A;  2L00 B;  2KWC A;  5EFX A;  2GOW A;  3UQB A;  2C7H A;  2MSE D;  3KW5 B;  1EO6 A;  3ONS A;  2DYQ A;  4Z2N A;  1YX6 B;  2IO1 B;  4G3X B;  2GBM A;  3ALB A;  3UIP B;  4BFR A;  4ZRJ A;  3ENB A;  2MBE A;  4DX8 A;  2DYB A;  3L13 A;  2KDB A;  2N9X A;  2EC1 A;  4NJ7 A;  1I42 A;  3LJ3 A;  2NVU I;  2FCS A;  3U30 A;  2MDX A;  2LGX A;  4JKE A;  4PS3 A;  3P6A A;  4EZL A;  1I7A A;  3ODX A;  4FLH A;  4PS7 A;  3R66 C;  1VD2 A;  2HRJ A;  3GOE A;  2LD9 A;  1WJU A;  1J0W A;  3TCA A;  3PVL A;  5J3T A;  4KHB B;  2REX A;  2W2X D;  1P5T A;  3M1I B;  5DIF B;  2NBU A;  4MY6 A;  2P0F A;  3JVZ X;  5DHA B;  2KX3 A;  3AUL A;  5KQ1 A;  2ZPY A;  3VH4 B;  4GU2 A;  4JKH A;  3FM8 C;  1FHW A;  2W9N A;  1XD4 A;  1C1Y B;  4W9E A;  3T8M A;  4I6L B;  5IJM A;  2GCL A;  1X11 A;  4Z2M B;  3M3J A;  4MT7 A;  2OOB B;  3MJW A;  4A6F B;  5CTR C;  4HCP B;  1WGR A;  3DVN U;  2D11 A;  4ZRI A;  1M7E A;  2L76 A;  2KHW B;  1XCG A;  3DOW A;  2RVB B;  2JXX A;  3T06 A;  1TBE A;  4NPN A;  2V76 A;  2DHJ A;  4E71 A;  1TTN A;  3A1Q B;  2VRW B;  3ZIM A;  2I5C A;  1NTY A;  1YIW A;  4EMO A;  1P6S A;  1MK7 B;  4DX9 0;  2CY5 A;  1NTV A;  2O6V B;  1DDV A;  3K9O B;  4JL9 A;  1WFY A;  2COF A;  4K81 A;  3X0W A;  1WE7 A;  1VBG A;  4B9K A;  1PMS A;  3LDZ E;  5DPS A;  3TW1 A;  2KXJ A;  1OEY A;  2CHX A;  3DCG A;  3PLU A;  4HXD A;  1UD7 A;  2E2X A;  2N1V A;  2AL6 A;  3SYX A;  3DVN V;  2PJH A;  2ADZ A;  5G2N A;  1GJZ A;  2YT0 A;  2N4F A;  1V5U A;  2RPQ A;  1Y5O A;  1OGW A;  1U5G A;  5C16 A;  2ZVN A;  1Q5W B;  2V4L A;  3WAP A;  1IP9 A;  1LQB A;  1L2N A;  4P7I A;  3F0W A;  1EF1 A;  3PLV A;  2UZS A;  1WGY A;  4HAX B;  1NVL A;  5D27 A;  2CR5 A;  3A8Q A;  2WX0 A;  1WGU A;  2YSZ A;  4EEW A;  2R2O A;  4KZC A;  1WE6 A;  3ML9 A;  1ST7 A;  3WYF B;  3MPX A;  3RCP A;  4MK0 A;  1FB8 A;  3PHX B;  1XD3 B;  3CMM B;  4BBN C;  5HKH A;  3D8D A;  2IBI B;  3RYT A;  1P0R A;  4BKS A;  1DIK A;  3OJ4 B;  2IY1 B;  2HD5 B;  3FP5 A;  3PSC A;  2MBO A;  2K1F A;  4W9J A;  1NDD A;  3V62 A;  2COD A;  3QWM A;  4HPM B;  5E6N A;  2GBJ A;  3PRE A;  4DK5 A;  3ZW3 A;  5CX3 A;  2JY6 A;  2GS0 A;  4K7W A;  3KSY A;  2FNJ B;  1GNU A;  3M62 B;  2ZVO A;  5E6P A;  4HCN B;  4HJK A;  3L16 A;  5DI9 B;  1X05 A;  1WX7 A;  2QHO A;  2YRY A;  2L05 A;  4HAY B;  2K6D B;  2J0M A;  1KZ7 A;  4HAW B;  2MWN B;  2NMB A;  2L7R A;  1U5D A;  1AAR A;  3D32 A;  4JKC A;  3V61 A;  2Y8G A;  2JZZ A;  2DZJ A;  5DPR A;  1V5M A;  3EEC A;  2FAZ A;  2KMC A;  4MGZ E;  4HAT B;  4GDL B;  2Z0P A;  3N7C A;  4EKU A;  2FJL A;  2ABD A;  1K5D B;  4IOY X;  2RUK B;  1LW3 A;  2M0X A;  3PEG A;  2XK5 A;  5FI0 A;  2KZR A;  4TV3 A;  5C5B A;  3R7R A;  2G4D B;  2KFK A;  3K9P B;  2FCM A;  4LJP B;  2MBQ A;  3OLM D;  2D9V A;  2I1K A;  2KDI A;  3CSF A;  3V5W A;  3H7S A;  3PZD A;  2A5U A;  1RFA A;  1RJ2 A;  2KO3 A;  1ZW7 A;  5LXI B;  3H6N A;  2JT4 B;  2MCN B;  4TQ1 A;  2KD0 A;  2N23 A;  2WWZ A;  2ELB A;  1U29 A;  3ODW A;  1R4N I;  3SUZ A;  4LDT B;  4JQW C;  4WAA A;  4F8C B;  4IFS A;  5AZH A;  3VUW A;  1OQN A;  2DKP A;  3HM3 A;  2RSU A;  2BYF A;  3A4S C;  1OQY A;  4IAP A;  5CHF A;  1WG7 A;  2LOX A;  2D9X A;  2BF8 B;  2LUL A;  1HBK A;  5LOP B;  1N3H A;  1WYW B;  4RM9 A;  1HB8 A;  3R3M A;  1WF9 A;  4X57 B;  1E90 A;  4KSK C;  2MKR A;  3UIO B;  4ILH A;  2BKF A;  4PYZ A;  1Z2M A;  3QQ8 B;  1OTR B;  2LOZ A;  3A9K B;  3WAN A;  1GC6 A;  2R0D A;  2JVC A;  3VUY A;  3UQA A;  4K7U A;  3BY4 B;  4DHZ B;  4PQ0 A;  3VFK A;  3VVW B;  4HB3 B;  4ANW A;  2RD0 A;  2M14 A;  4MJS B;  1XQQ A;  4HLE A;  2KK8 A;  4K2P A;  4CHM A;  1SIF A;  2Z59 B;  4HDO A;  2ASQ A;  2KFK B;  3SO6 A;  4L6E A;  1V80 A;  4MH0 E;  2W2W A;  1MKE A;  4EFO A;  5CLQ B;  3CF6 E;  1MIZ B;  2ROZ B;  3KUC B;  3ZKJ C;  5GOW B;  2IO2 B;  3SHQ A;  3JSV B;  3E66 A;  4ZYN A;  4F7Z A;  2R2Q A;  3W1S C;  3ZVV A;  2ZEQ A;  4F7H A;  4BBN F;  3PRP B;  2Z0O A;  3RCZ A;  1ACA A;  2DAJ A;  1IYF A;  2G45 B;  2COA A;  1WXS A;  2EJ8 A;  4KIK B;  3X23 A;  2KUP A;  2KTF A;  1OMW A;  2J0J A;  2GJY A;  2AYO B;  4NAW B;  4JIO U;  1Z87 A;  3KYC D;  3HW2 B;  4MSM B;  5C6R A;  3RZF A;  4FAD A;  3ULB A;  3QAQ A;  1E8Z A;  2YS3 A;  4IM2 A;  1ISN A;  1NI2 A;  2N1W A;  3VQI A;  2L0F A;  2V3S A;  1KLV A;  1RRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...