2J0MA

Crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
329
Chain Sequence
GAMERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Basis for the Autoinhibition of Focal Adhesion Kinase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 329
sequence length 329
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2j0mA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2j0mA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2j0mA01
2KVRA 2GS0A 3VQIA 2BYEA 3U7DA 3WANA 3EFUA 4I6PA 3W1YA 2YS5A 3PTFC 3U30A 2ZJDA 1E90A 4GGQA 2D2QA 2P0DA 2KANA 2N0YA 4ANXA 3KY9A 3HK0A 2DKQA 4HAZB 2W2WA 5L83A 2J0MA 2BF8B 2RGNB 2EKEC 4AOFA 4NAWA 3ZUNA 2C7HA 4DHJD 4EMOA 4PNKA 2FDQA 2AWTA 2LI5A 3A4RA 1TZ1A 1IRSA 2WH5A 4HAXB 1XQQA 1RRBA 2KWCA 1IYFA 2MX2A 1KM7A 3KRWA 3OJ4B 1TTNA 1L7YA 1LQBA 3QX1A 4W9JA 1LW3A 1D3ZA 2D4QA 3NZUA 4DDID 2V1YA 2Z0QA 2ZNVC 5CTRC 2JY6A 4GU2A 2KN5A 2Z0EB 4E3CA 3H7SA 2IZVB 2ZCCA 4LCDE 2O2VB 2D9ZA 1H8CA 3ZVRA 3QJZA 2JF5A 1KOTA 3VH3B 4KDIC 4MT7A 2N9PC 4K17A 4LDTB 4TQ0A 5HE0A 2L7RA 4KSLC 2RPQA 3D8DA 1AARA 5D27A 3UINB 1WGQA 2KUPA 1Q5WB 2K8CA 4TKNA 3MDBC 4Z2NA 2CHZA 4KV2A 1WFYA 1NTYA 3KYDD 1KZ7A 1V5UA 4WWNA 1XD4A 4IAPA 2K6QA 3C0RB 1S3SG 3QK0A 3L10B 3ZVVA 4AWJA 2BPSA 4IUMB 2FIFA 4JL9A 1H10A 3ULCA 2KC2A 3QA8A 1V5OA 1JRUA 3V6EB 2LVOA 1WZ0A 2REXA 2DZJA 2HRJA 4NQKE 3CMMB 2GBNA 4DWFA 4HAUB 1WF9A 4I6LB 2UZSA 2KFJA 4MY6A 1LM8B 2Y5BB 2WDTB 4BOZB 3QHTA 4FBJB 4GDKA 2ASQA 4URKA 3IBEA 2C60A 4Z2MB 2KJHB 1FAOA 4WWPA 4HXDA 5LOPB 3CSTA 4WJNA 1YJ1A 3ZLZA 4IOYX 1WMHA 4OVUA 3A1QA 4KIKB 5DH9B 2CHWA 1KI1B 3WA0A 1TBEA 3RULA 2ZZPB 2HD5B 5IAAC 4A6KA 4AJWA 1Q0WB 1KLVA 2W9NA 1WRDB 3DBHI 4WSFA 2AEHA 4B95A 4GIVA 4BKSD 3RUIB 1OMWA 4II2B 3PG7A 2ZPYA 4HCPB 2D3GA 4HLEA 3WALA 2JRIB 3VUYA 3PREA 3KH0A 2RNRB 4MELA 4FJYA 2KLCA 2MFQA 4G0NB 2MCNB 2DLWA 2FAZA 2O6VD 5L81A 1EAZA 5HKHA 1CMXB 3WAMA 3ZIMA 1N3HA 1EUVB 2ZVNA 1XR0B 2XEWA 4JGHB 2IFSA 2MWNB 4CO7A 3PHXB 1SIFA 2FUHB 4MM3A 4A6FA 1QZEA 4B6WA 3EC8A 1U5EA 4JQWC 3O96A 4HATB 5KQ1A 2DX5A 4F7HA 2KQSA 3TW1A 3OJ3A 4GDLB 3N3KB 2P0FA 3L13A 4DX90 4RMAA 1P0RA 3VVWB 1UD7A 1P6SA 1ISNA 4W9HA 2NR2A 3PV1A 4LJOB 2LGDA 1TXDA 1UZXB 2K00A 4EZJA 3AJ4A 3JSVB 3A33B 2A4ZA 2O6VA 1NDDA 1EF1A 2D10A 2I1KA 3SDLC 4WAAA 4HB2B 1P3RA 1MIXA 1WYWB 1DBHA 1WM3A 1B55A 2C5LC 1Z5SB 4C0AA 4W9GA 4ANWA 1NTVA 4GMXB 2KO3A 3NHEB 3NZSA 3FEHA 2MA9B 1WXAA 1U5GA 3VTUA 2XK5B 3B1LX 3DDCB 3V61A 1AWEA 4M8MA 2L76A 3ZO5B 5C5BA 4FLHA 3VXWA 1BTNA 1TQZA 1XCGA 1MAIA 3A9JB 3DVNU 3ZDMC 3ULBA 4BBKA 2L05A 2WX1A 5D2MB 3GYOA 4HB3B 5J18A 3GYPA 3T06A 4BVUC 2J0KA 3PS6A 2WX0A 1V9JA 2NCNA 4J6IA 2Z0DB 3OANA 4MGKE 2LULA 1WR6E 3ML9A 2K1FA 4RM8A 2W2XC 4MJSB 4CHJA 2JRHA 1EO6A 2B3AA 3TL5A 5IJMA 3M63B 2HTHB 2CS4A 3LJ3A 2G35A 2C7MB 2UYZB 1J0WA 1X11A 1FGZA 1E8XA 4CHKA 2N9EB 2KD0A 1Q1OA 1Y19B 3VOQA 3ECIA 2JP2A 1WGDA 2L0TA 4K7UA 4MH0E 2Y7BA 3L54A 1YIWA 3EHVA 1YX5B 3P2BA 1F9JA 3FSSA 5E6PA 1A5RA 4W9FA 2BKRB 2K8BA 4PS3A 2M0XA 2KTFA 4ZDVA 2PJHA 2LVPA 2JXXA 2KTRA 3NSUA 1V86A 5IA7A 4BBNF 4DXAB 3DXCA 1ACAA 5DPTA 5HE2A 4HHVA 2IO1B 4OVVA 2CHXA 1OQYA 1P98A 3VIAA 1WGRA 4HAYB 2X18A 2MLBA 1ZSQA 4KZCA 4NNJB 1M7EA 1MK9B 2JWZA 4MGZE 2ABDA 2GCLA 2L1CA 3D8FA 2R2OA 4WWOA 3T9LA 2ELAA 1U4AA 1BTKA 2DHKA 1R4MI 5DIFB 3V5WA 3QAQA 5EDSA 2KK8A 4HJKA 2GJYA 2DYQA 1UNRA 2GOWA 5G55A 2MBHA 1BWNA 3RZFA 1WGYA 3ZRCA 1RJ2A 4K1RB 3SD5A 2YLMA 4CYEA 3EPYA 5AZGA 5E6OA 2UZRA 2JZ3B 5CX3A 2DTCA 3HHMA 3TBLD 1LFDA 3N32A 4IM3A 1YD8U 3HQCA 2CY5A 4KAXB 2N4FA 4H8SA 4HVBA 1KJTA 4PYZA 4FHKA 2GBJA 3HM3A 2FCQA 3UZTA 4EJNA 1WJ6A 1HB8A 4K7SA 4IW0A 1GUAB 4NAWB 3I3TB 4PS8A 3RCPA 3RD2A 3DXEA 4XC2A 3DVGX 3OLMD 2VKIA 2V3SA 2MDXA 2DHZA 3VH4B 4HWIB 3LDZE 2KLGA 4WQOB 5GOWB 2LYDA 2IYDB 1MG8A 4FHJA 5D3YA 3ZW3A 1K5DB 2KQ7A 2CB8A 4EEWA 3PLVA 2ROZB 2YS1A 1GC6A 4N9F4 2OTXA 1U27A 2I5CA 2OJRA 1ZGUB 4DHZE 4FA6A 3KYCD 1X1MA 2LRWA 2MQJA 3EECA 4WJPA 1FHXA 2YT0A 4MGIE 1ZW7A 2IO2B 3TO1A 4EOYA 1V49A 4HDOA 4FADA 2KGXB 1WE7A 5KHQA 4WJQA 3F0WA 2KFKA 5D7GA 2ROVA 2DAJA 3GZNI 1P5TA 4W9EA 3W1SC 2DZKA 3VAWA 3T8MA 2KX3A 4B6HA 2COFA 3UIPB 2Z59B 3G9WA 1ZKHA 1SE9A 3ZDTA 3K9OB 2G45B 4JIOU 2Q13A 2LZ6A 2BYFA 3V6CB 2LXAA 2ZCBA 4GB9A 3ZNID 3A4SC 2IY0B 2KDEB 2VSZA 5J3YA 5L95C 2JT4B 3IVFA 1PQSA 3TIXA 2YRYA 2GBKA 2LASA 2CODA 3V62A 3ODWA 5FR6A 2KHWB 3R7RA 4AJYB 4EKUA 5C6RA 2KX0A 4F1SA 5C23A 3ODOA 2M8SA 4GDKB 3QIJA 3UGBB 3P7ZA 3R7QA 3X0WA 2W2XD 3PGEA 3BJIA 2MBEA 4IM2A 2LWPA 2YS3A 5CLQB 2Z0OA 1DROA 2RD0A 3Q3JA 1UNPA 3PRMB 3UQAA 2FCMA 3PRZA 2H7EA 4PS7A 3A1QB 4EFOA 5BO4B 2VRRB 5J3TA 2KDFB 4W9CA 1Y8RC 2K8HA 2LGXA 2IBIB 4WJ7A 4E74A 5CLLB 4Y94A 2GBRA 2G4SA 2D9XA 5KQ4A 1WX8A 2PEAA 4EUTA 2PPHA 1WH3A 3LJUX 1G6JA 4BFRA 3TJPA 2D9WA 3CIKA 1VCBA 2E2XA 5D3XA 1V6EA 5FI1A 2N7DA 1FB8A 2ADZA 3DOWA 3L16A 3DBSA 5C79A 5DPRA 1NVLA 4K81A 1WG7A 2BWFA 2NS5A 4BKGA 1E8WA 1I2HA 4KSKC 2RR9A 2AL6A 1E8ZA 2RSUA 3M62B 2DZMA 5CHFA 2I5FA 2MP2A 2M17A 5D94A 4BKSA 2YVCA 4A6FB 1FXTB 2DYMA 2DX5B 5FI0A 2DA0A 3A98B 5C1ZA 4FN2A 2NBVB 1XD3B 2BCJA 3A9KA 3MPXA 2LUEA 3NY5A 2JZZA 3APCA 4F8CB 1WY8A 2FCSA 3QCAA 3FM8C 2KC1A 2ZPNA 2FNJB 4A5KA 2CRFA 2AL3A 2O6VB 1HBKA 1WJ1A 4YONA 3ZRFA 3PEGA 2IO3B 4M8NA 1X86A 1MK7B 3QC8B 4DHZB 3JYUA 5KCVA 1V2YA 1RAXA 1J19A 1Z87A 3M95A 5LONB 3PSEB 1UGMA 3SO6A 5JHAA 2MBQA 2PZ1A 2XK5A 4BOSC 1IPGA 2ZVOA 2KMAA 2KWUB 3QARA 2K2JA 4MDKE 1LB1A 4DX8A 4GXBA 4TUUA 2V4LA 2PE6B 2KJRA 1NI2A 2LOXA 2L2IA 1TGZB 3DQVA 3PVWA 2L00B 1DDMA 1WM2A 2CQUA 2RGFA 1TJ6A 1ZVRA 1C3TA 1GC7A 2IY1B 3H1UA 1WJUA 2JUOA 2LVQA 2DHJA 2MKRA 4E71A 4DBGA 2EC1A 1RFAA 4AP4C 4MJSA 2J7QB 1U2BA 4MSMB 4ZRJA 3UIOB 1GJZA 5AZFA 1AQCA 3SU8X 2K25A 2CAYA 2KCJA 2KKCA 1XT9B 2M1MA 1Q67A 1P9DU 2NMBA 5TR5A 2N7EA 1V5MA 4IG7B 3AU4A 2K39A 2EMTA 2JVCA 3P6AA 3O65B 3ML4A 1L2NA 2MBOA 5D6JB 1DYNA 4HDQA 1PFJA 4I6NB 2KNBA 1WIAA 3CSFA 2NBWB 4KVGB 2ELBA 1U5FA 2KTRB 1E8YA 4L6EA 4ICUA 5CHWA 2AYOB 1DDVA 2KMCA 3IFWB 2R09A 3AULA 4M0WB 2ZNVB 4WJOA 3TFMA 3Q3FA 2Y8GA 3SYXA 2RVBB 2LGYA 3UF8A 3PRPB 1UEFA 1VD2A 3H7PA 1V88A 4G3XB 1WX9A 3JW0X 5CHVC 2MSED 2D11A 5JHGA 2NPTA 2K2UA 3DBLI 4ZYNA 2DKPA 1YX6B 3ZNGC 1Y5OA 3X23A 3KUZA 4F7GA 4ICVA 3HIZA 2A5UA 1J0GA 2L8JA 2Y8FA 3W1SA 5C16A 3L17A 3TCAA 5HE1A 4KHOA 2GBMA 2P0HA 1WXMA 3WYFB 5AEKB 1BAKA 1WXSA 2IO0B 3BINA 4MGYE 1RRPB 2NVUI 2FJ9A 1ZC4B 1XX0A 1V81A 1NU2A 2LBBA 1HE8A 5AZHA 5D3VA 3DVGY 3VFKA 4NQLB 3ZTDA 2N1WA 1U5DA 4LDTD 1WJMA 1EF5A 4IWPA 3RCZA 1WGUA 2YF0A 1WE6A 3SV1A 2FJLA 1FOEA 3QWMA 3L0WB 2KDIA 1H4RA 4D0NB 2QHOA 1FHWA 3SUZA 4HK2A 2MRPA 3TVVA 4PQ0A 5G2NA 3K9PB 1S1QB 4HB0B 2HE7A 4A3OA 1V5TA 3APDA 3PZDA 4MSQB 3L08A 4II3B 3WAPA 4GMVA 2MBBB 2R0DA 2NBUA 1DDWA 1FGYA 1NBFC 3AXCA 1V61A 2KJ6A 4XX5A 1OQNA 4IWQA 1MIZB 2O2VA 1QQGA 1WI1A 1UPQA 2XQNM 4KHAA 4KZ0A 3VUWA 1OEYJ 4DDGD 1X1FA 1E7VA 2LXCA 1PMSA 3NOBA 2RLOA 5EFXA 4MEMA 1WJ4A 2COCA 3ENEA 3MHSD 4DHJB 1T0YA 3NS8A 2RUKB 4DK5A 1V5PA 2Z0PA 3KSYA 4NY0A 4P7IA 3PP2A 1W1HA 2XBBC 5J3QA 4IM0A 2L0FA 3F5RA 2KFKB 4G50A 4HAWB 1SGHA 3A8PA 2MWSB 4B9KA 5DPWA 5JLJB 1RLFA 1WJNA 3PSCA 4A6HA 2DZIA 3QBVB 2OOBB 4K7WA 3DPDA 1Z2MA 3N7CA 2DFKA 2COPA 4ZRIA 2HJ8A 2LRUA 1KZGA 3H6NA 3GOEA 4MK0A 2N23A 1NTIA 4F7ZA 2LJ5A 5DCNA 1SHCA 4EZKA 1WXVA 4FJVB 3R66C 3APFA 1OTRB 4KIKA 1ST7A 1WMHB 4W9DA 4IFSA 3PPAA 3DVNV 3PT2B 3B0AA 4W9LA 1YQBA 2PE9A 4X57B 2L3ZA 4LJPB 3M1IB 4HAVB 3RZWC 1X05A 3QQ8B 4GSWA 1I35A 4XZ4A 2KXJA 3V60A 2DYOA 2DHIA 4HB4B 1W1GA 1LXDA 3KW5B 4ANVA 2H7DA 3VDZA 1OEYA 4W9KA 4RM9A 1EVHA 1FHOA 3N30A 3D32A 2J59M 2DENB 2K6DB 5LXHA 3H9DA 2UWQA 3ZNZB 1C1YB 5JP4A 1E5WA 1R4NI 5GMVA 4KHBB 2RQ1A 1UNQA 2DYNA 1BT0A 2R2QA 3FLVA 5LXIB 2CKHB 3HW2B 4G11A 3OAWA 5E6NA 1UH6A 3CF6E 3U8ZA 2MP2B 3RYTA 3PHWB 4GDLA 4DBBA 3IG3A 3TMPB 1I42A 2LD9A 1E7UA 4K2OA 4HPLB 2DAFA 1W1DA 2C9WB 3KVFB 1WX7A 1UELA 2BYVE 2DYBA 3MTNB 3ONSA 4GOCA 2NZ8B 2N9XA 3PVUA 3A9KB 2EMSA 1IP9A 3JSVA 2J0JA 5HE3A 4BBNC 3DCGA 1M7RA 4F7UP 3VHTC 1WGGA 1WR1A 2WYQA 1ZM0A 4GPTB 1UPRA 2BGFA 4CHMA 5J17A 2D9VA 2P8VA 1WVHA 4FULA 2LOZA 5LLIA 1MKEA 2KDBA 3AI5A 5KHOA 3ZKJC 2KWVB 2KZRA 3WAOA 4A20A 5DI9B 1P3QU 1V89A 3ODXA 1OGWA 1J8CA 3D8EA 5C5BB 2MW5A 3AU5A 2C7NB 2N1VA 3ZNHB 3A9JA 4WVFB 2DN6A 1EGXA 5DHFB 4ASWC 1I7AA 3R3MA 4JLCA 3ZTCA 3KUCB 2M38A 5DHAB 1P1AA 4ANUA 5JHHA 2VRWB 1XKEA 1K8RB 2BKFA 4FJZA 3SNHA 4KDLB 2COAA 2IYBA 2FCNA 3WIMA 2G4DB 1U29A 4AUQC 3UQBA 1WGHA 3B08A 2M14A 1GG3A 4TQ1A 2QKMA 2HTHA 2M4NA 3VTVA 4TYZA 1UBQA 4K2PA 2CR5A 3PVLA 1QC6A 3KUDB 1HB6A 3ALBA 4PYUA 3IHPC 3KRXA 2LKOA 4NPNA 3A8QA 1WZ3A 3SHQA 3QWZB 2FIDA 4BKTA 1X1GA 3HM6X 2D07B 2GMIC 3M3JA 3RT3B 5J2RA 4HPMB 3VUXA 5JHBA 4GZUA 1MPHA 2CU1A 3ML8A 4NJ7A 2DX1A 2UVMA 3JVZX 3FP5A 2YSZA 2JPHA 4TV3A 2D9YA 2OQBA 4HCNB 4A3PA 1ZC3B 3CXBB 1M94A 3PLUA 3DBRI 2G3QB 2V76A 1OY2A 5JZEB 2BWES 4EZLA 2CY4A 4NSWA 4YL8A 2RSGA 2I1JA 4XWXA 1K5GB 2YT1A 1XODA 3KZ1A 3H7PB 2KOXA 3BY4B 2WWZA 2QKLA 3DXDA 2EJ8A 2NPTB 2LG1A 2GCJA 4W9IA 2ZEQA 5JH5C 3MJWA 3S2AA 3VTWA 4NJ6A 1V80A 1PLSA 1UBIA 4IWOA 4GN1A 4IC7B 4ZRKA 1GNUA 5D3WA 1WI0A 5DPSA
chains in the Genus database with same CATH superfamily
2KVRA 2GS0A 3VQIA 2BYEA 3U7DA 3WANA 3EFUA 2RRFA 4L2YA 4XDDA 3BYTB 4OW0A 2WXHA 4I6PA 3W1YA 3FVCA 2JYTA 2YS5A 3PTFC 1ZPSA 3NVZA 2Z8LA 3URYA 3U30A 4JK9A 2ZJDA 1E90A 3GB1A 4GGQA 3AE9B 3Q3MC 2D2QA 2P0DA 2KANA 4XWWA 2WXQA 2N0YA 4ANXA 3KY9A 3HK0A 2DKQA 4L1RA 4HAZB 2BQQA 2W2WA 5L83A 2J52A 1TS5A 2W54A 3IAS1 3UI3A 2J0MA 2BF8B 2RGNB 2EKEC 4AOFA 4NAWA 3ZUNA 2C7HA 1VZ7A 4DHJD 3U12A 4EMOA 4PNKA 2FDQA 2X8XX 1ZE3D 2AWTA 2BS3B 2LI5A 3A4RA 1TZ1A 1IRSA 2WH5A 4WH4A 2LHDA 3Q3OC 4HAXB 1XQQA 3MJ5A 4WURA 1RRBA 2KWCA 1IYFA 2MX2A 1KM7A 3KRWA 3H8HA 1ZYIA 1MI1A 1C79A 3OJ4B 1TTNA 1L7YA 1LQBA 3QX1A 4W9JA 1LW3A 1D3ZA 2D4QA 3NZUA 2M19A 4DDID 1STEA 2V1YA 2Z0QA 2ZNVC 5CTRC 2JY6A 4GU2A 3DCXA 1N61A 3BZDB 1L5PA 2KN5A 4YXDB 1N6ZA 1DIKA 2Z0EB 4E3CA 3H7SA 2IZVB 2B76B 1HTQA 1A70A 4A90A 2AQ3B 2ZCCA 4LCDE 2O2VB 2D9ZA 1H8CA 3ZVRA 1TZOA 3QJZA 2JF5A 1J7CA 1KOTA 3VH3B 4KDIC 2BS2B 2DWQA 3RNGC 2DLBA 4MT7A 1JROA 2N9PC 4K17A 4LDTB 4TQ0A 5BMGA 5HE0A 2L7RA 2PKOA 1IUEA 2X0SA 4KSLC 2RPQA 3D8DA 1AARA 5D27A 3UINB 1L4ZB 1D5ZC 2V3PA 1WGQA 4WAFA 2KUPA 1Q5WB 2K8CA 4TKNA 3MDBC 4Z2NA 2CHZA 2QSDA 1MI0A 3I63C 4KV2A 1WFYA 1NTYA 3KYDD 2BB6A 1KZ7A 1V5UA 4WWNA 2WXMA 1XD4A 4IAPA 2K6QA 2WXRA 2Z59A 3C0RB 1S3SG 3QK0A 3L10B 3VRBB 3ZVVA 1HEZE 4AWJA 4R3DA 2KVZA 3FKYA 3NW8A 2BPSA 4IUMB 2FIFA 3BYYB 4JL9A 1I4RA 1IBXB 1H10A 3ULCA 2KC2A 3QA8A 1SJED 1FXIA 2YT2A 1WWTA 2JXTA 3LB8C 4FXCA 1ACCA 1V5OA 2Y5CA 4C80A 3ZGZA 1JWSD 1JRUA 4JWUC 3V6EB 2LVOA 1WZ0A 2REXA 1XLOA 4HSIA 2DZJA 2HRJA 4NQKE 3CMMB 4RNAA 2GBNA 4DWFA 3Q14C 3R8BA 1T77A 4HAUB 1QT9A 1WF9A 3DHHC 4I6LB 2UZSA 2KFJA 4MY6A 4ZRPA 1LM8B 2Y5BB 2WDTB 3HVZA 4BOZB 3QHTA 3AE3B 2HTME 1BXTA 4FBJB 4GDKA 2ASQA 4URKA 3IBEA 4US8A 2C60A 4Z2MB 2KJHB 2WDRB 1FAOA 4WWPA 2LFIA 3E66A 5LOPB 4HXDA 3CSTA 5G5HA 2WU2B 4WJNA 1YJ1A 2JYEA 4IOYX 3ZLZA 1WMHA 4OVUA 1JQ4A 1PGXA 3A1QA 3FILB 1V97A 4KIKB 5DH9B 2CHWA 1KI1B 3WA0A 1IGCA 2KAJA 1TBEA 3RULA 1WYGA 2ZZPB 2HD5B 5IAAC 1NENB 4BZAA 4S17A 2W82A 4A6KA 4AJWA 1Q0WB 1KLVA 2BS4B 2W9NA 1WRDB 3DBHI 5I2MA 4WSFA 2AEHA 4B95A 4GIVA 4BKSD 3RUIB 1OMWA 1YJIA 4II2B 3PG7A 2D3AA 4YTNB 4JKHA 2ZPYA 1B9RA 4HCPB 1T0RC 2D3GA 4XGAB 4LNIA 4HLEA 3WALA 2JRIB 3VUYA 3PREA 3KH0A 2RNRB 5BMIA 4MELA 4FJYA 2KLCA 5LNK1 2MFQA 5M4YB 4G0NB 2MCNB 2DLWA 2FAZA 2O6VD 5IKCM 5L81A 1QOAA 3NWDA 1EAZA 5HKHA 1CMXB 3ZQ4A 3NWFA 3WAMA 1F2RI 3AE6B 1FEHA 3ZIMA 4KHBA 1N3HA 1EUVB 1JWBD 2ZVNA 5FKAC 2QILA 1PGAA 1XR0B 2EKIA 1FNUA 2XEWA 3AM9A 2KYWA 4JGHB 2IFSA 2MWNB 3ZXVA 4CO7A 3PHXB 1SIFA 2FUHB 4MM3A 2INNE 3EGRA 4JKDA 5BYSA 4A6FA 3MC8A 4MACA 1QZEA 4B6WA 1JWMD 3NUHB 3Q69A 2M56B 3EC8A 1U5EA 4JQWC 3U2SC 1JCKB 3O96A 4HATB 5KQ1A 2DX5A 4F7HA 3ZJTA 2KQSA 3TW1A 3MC0B 3RNCC 3OJ3A 2RPVA 4GDLB 1FFUA 2LUMA 2MJEA 2P0FA 3N3KB 3L13A 4DX90 4RMAA 1HZ5A 3NWAA 1P0RA 3VVWB 1UD7A 1P6SA 3P4QB 2K5PA 4EE2A 1ISNA 4W9HA 2NR2A 3PV1A 3N9YC 4LJOB 2LGDA 1TXDA 4B0MA 1UZXB 3O13A 2RMMA 1YJJA 2K00A 5GXGB 4EZJA 4D6WA 4HEA1 3AJ4A 3JSVB 3A33B 2A4ZA 2O6VA 5IOIA 2IGDA 2Z13A 4IDIA 4ARCA 1NDDA 1EF1A 2GUMA 2D10A 2I1KA 3SDLC 4WAAA 1SB3C 2R82A 5LG4B 4HB2B 1P3RA 1MIXA 1WYWB 1DBHA 2NTTA 1WM3A 1B55A 4WIPA 2KT7A 2C5LC 1Z5SB 1VLBA 4C0AA 4W9GA 4ANWA 1M4VA 2OJWA 2G9HD 1NTVA 3Q3NC 5I4DA 2INCC 4CSQA 2OEDA 2KMMA 4LNKA 4GMXB 2KO3A 3NHEB 3NZSA 3FEHA 2MA9B 3Q8EA 4KGRA 3BIID 1YN4A 1WXAA 1U5GA 3VTUA 2XK5B 3B1LX 3DDCB 3V61A 1AWEA 3RFZB 4KGTA 2WXJA 1TS2A 4RF1A 4M8MA 4DQOC 2L76A 3ZO5B 3AMZA 5C5BA 4FLHA 3VXWA 1BTNA 1TQZA 3J9CA 1UNSA 1XCGA 1MAIA 3A9JB 3DVNU 5I2SA 3ZDMC 4S0RA 1L4DB 3ULBA 4BBKA 2L05A 2WX1A 2QJLA 5D2MB 3GYOA 4DXFA 4XWTA 3AEDB 2IGGA 4HB3B 5J18A 3GYPA 2L32A 1K52A 4P16A 3T06A 4BVUC 2J0KA 3PS6A 2WX0A 1V9JA 2NCNA 4J6IA 2Z0DB 1F1HA 3OANA 4MGKE 1SEBD 3B2FA 3DBLB 2LULA 1WR6E 3ML9A 2K1FA 4RM8A 2W2XC 1WSPA 4MJSB 4CHJA 2JRHA 4JKGA 1EO6A 3RNBC 2B3AA 3TL5A 5IJMA 3M63B 2HTHB 2CS4A 3LJ3A 2G35A 1ENFA 2C7MB 5C2TB 2UYZB 1J0WA 1X11A 2MJDA 1FGZA 1E8XA 1L0YB 2VZKD 4CHKA 2Z14A 4LLGM 2N9EB 2KD0A 1D4BA 3CWIA 1Q1OA 1Y19B 3VOQA 1AN8A 4ILJA 3ECIA 2JP2A 1WGDA 2L0TA 2KUQA 4K7UA 4MH0E 4YTPB 2Y7BA 3AE5B 2LMCA 1YIWA 3L54A 2BT6A 3EHVA 1OQQA 1YX5B 3P2BA 1F9JA 3FSSA 3IXSA 3BVZA 1D5XC 5E6PA 1A5RA 4W9FA 2BKRB 2K8BA 4PS3A 4JKAA 2M0XA 4QJ5B 2KTFA 3FAHA 2NTSA 4ZDVA 5FR3A 2PJHA 1R7SA 2LVPA 2JXXA 1XCTL 2KTRA 3NSUA 1V86A 2Y3AA 5IA7A 3E9PA 4BBNF 4B0EA 4M0WA 4DXAB 3DXCA 1KLUD 1N5WA 5IRSA 1ACAA 1YQ4B 5DPTA 5HE2A 4HHVA 2DIKA 1C77A 1HXYD 2IO1B 1B1ZA 2FUG1 4OVVA 2CHXA 2MHJA 1FFVA 1OQYA 5HFYA 2H88B 1P98A 2JWUA 3VIAA 4QJ3B 4KKIA 4JKFA 3AEAB 4N6EB 1SXTA 1BMLC 3E56A 2DBYA 1WGRA 4HAYB 2X18A 2MLBA 1ZSQA 4KZCA 4NNJB 1M7EA 1TY2A 1ZP0B 2V4IB 1MK9B 2JWZA 4MGZE 2ACZB 4YTMB 2ABDA 3AE1B 2GCLA 4L23A 2L1CA 3D8FA 3OWEB 2R2OA 4WWOA 1VR9A 4ZOHC 4BAXA 2V0GA 3T9LA 3P4RB 1K53A 2ELAA 4XE0A 1U4AA 1BTKA 2DHKA 1XCQL 4N59A 1R4MI 2LEKA 5DIFB 1T3QA 3E9SA 3V5WA 3QAQA 2WP9B 5EDSA 2KK8A 4HJKA 2GJYA 2DYQA 1UNRA 2PVOD 2WXKA 2GOWA 3AEEB 5G55A 2MBHA 1BWNA 1WRIA 3RZFA 1WGYA 3ZRCA 1RJ2A 1N62A 1TJEA 4K1RB 3SD5A 3TEZA 2KDMA 3BVGA 1MHXA 2YLMA 5MPOA 4CYEA 1Y56A 3EPYA 5AZGA 3AEGB 3DWMA 5E6OA 3N1ZC 2UZRA 2JZ3B 5CX3A 2DTCA 3HHMA 3TBLD 1LFDA 2HDEA 3N32A 4IM3A 1FXAA 5D3DA 1YD8U 3HQCA 2CY5A 4KAXB 2N4FA 1QKZA 4H8SA 4LTUA 4HVBA 1E6EB 1KJTA 2XN9C 2E3TA 4FHKA 4PYZA 3VR8B 2GBJA 3HM3A 2K0PA 1PDXA 2FCQA 1GPXA 1C4PA 2YEPF 3UZTA 4TSSA 1FO4A 5FK9C 4EJNA 1WJ6A 1HB8A 4K7SA 4KGSA 4IW0A 1GUAB 4NAWB 3I3TB 3IAM1 1T6BX 3RCPA 2KWDA 4PS8A 3RD2A 3DXEA 4XC2A 3SBTA 3DVGX 3OLMD 2VKIA 2V3SA 2MDXA 2DHZA 3VH4B 2WXLA 4HWIB 3LDZE 2KLGA 4WQOB 2INDC 2GLSA 5GOWB 1YN3A 2LYDA 2IYDB 1MG8A 4FHJA 5D3YA 3Q8CA 2MJ3A 3A58A 3W2DA 3ZW3A 1K5DB 2KQ7A 2CB8A 1FMAD 3AE8B 4EEWA 3PLVA 2ROZB 2YS1A 1T5XD 4HJGE 1GC6A 1SE2A 2PVGC 4N9F4 2OTXA 4RFBA 3C8YA 1RFKA 3AE2B 1T0SC 1U27A 2I5CA 2OJRA 1NYQA 1ZGUB 1VRAB 4DHZE 4FA6A 3KYCD 1RM6C 1X1MA 2LRWA 2MQJA 4ZRQA 1ZXIA 1ZDXA 3EECA 3R2IA 4WJPA 2D3BA 1L6UA 1FHXA 2YT0A 2WS3B 2SAKA 4MGIE 5IP4D 1ZW7A 2IO2B 3WCQA 3TO1A 4PK1A 3CIRB 3Q2AC 3RN9C 1N60A 3RMKC 4EOYA 1V49A 4RGTA 4HDOA 2D3CA 4FADA 2KGXB 3BK1A 1WE7A 5KHQA 4WJQA 3F0WA 2QC8A 3AEFB 2KFKA 5D7GA 1QILA 5E6JA 1MG4A 2ROVA 2DAJA 3GZNI 1P5TA 4W9EA 2IGHA 3MP9A 1F77A 1VJKA 2DZKA 3VAWA 3W1SC 3T8MA 2KX3A 4B6HA 2COFA 2X38A 3UIPB 1XEEA 2Z59B 4RH6A 3G9WA 1VZ6A 1EM7A 1ZKHA 3I9V1 1SE9A 4WWMA 3ZDTA 3K9OB 2G45B 4JIOU 2Q13A 4ZHOA 4C7ZA 1TS4A 2LZ6A 2BYFA 3V6CB 2LXAA 2ZCBA 4A8XC 4YT0B 3N20C 4GB9A 3ZNID 4RCOA 3A4SC 2G1EA 2IY0B 1R4NB 1YN5A 2KDEB 1ROEA 4P6VF 4QAYA 2H89B 2VSZA 5J3YA 2VH1A 5L95C 2JT4B 3HSAA 3IVFA 1PQSA 5AUIA 3AH7A 3TIXA 1NI3A 2YRYA 2GBKA 2LASA 2CODA 3V62A 3ODWA 5FR6A 1KFYB 2KHWB 3MHZA 3R7RA 4AJYB 4EKUA 5C6RA 2KX0A 4F1SA 3ODOA 1HZ6A 2M8SA 4GDKB 5C23A 4ACFA 3QIJA 3UGBB 3P7ZA 3R7QA 5EE3A 2FJUB 3U52E 3X0WA 2W2XD 1UUPA 3PGEA 3BJIA 3P4SB 1SF0A 2MBEA 4IM2A 2LWPA 2YS3A 5CLQB 2ICIA 2Z0OA 3FILA 2JQRB 1DROA 1JWAD 2RD0A 3Q3JA 1UNPA 3PRMB 3UQAA 2FCMA 3PRZA 2H7EA 1HQRD 4PS7A 3A1QB 4EFOA 4AQ7A 2GRIA 5BO4B 4DXGA 1YMHE 2VRRB 5J3TA 2KDFB 4W9CA 3VR9B 4MT5A 1Y8RC 2K8HA 2LGXA 2IBIB 4WJ7A 3W5VB 4E74A 5CLLB 2GBRA 4Y94A 2G4SA 2D9XA 5KQ4A 1WX8A 2PEAA 4EUTA 2PPHA 4UDUC 2KR0A 3Q8BA 1HA5A 5H92C 1WH3A 3LJUX 1G6JA 3OG5A 4BFRA 3TJPA 2D9WA 3CIKA 3I5JC 1VCBA 1AWDA 2E2XA 4GNKB 5D3XA 1V6EA 5FI1A 2WXPA 1F0ZA 2N7DA 4OHJA 1FB8A 1JW9D 2ADZA 1SBBB 3DOWA 1EU3A 2BTEA 3L16A 4ITKA 3DBSA 2KQ4X 4C7YA 5C79A 5DPRA 4HPPA 1NVLA 4K81A 1WG7A 1P7EA 2BWFA 2NS5A 4JK7A 4BKGA 3NS1A 1E8WA 1I2HA 4KSKC 2RR9A 2AL6A 1E8ZA 2RSUA 2D5GA 3Q8FA 4HKZE 2W55A 3M62B 2DZMA 4OZCA 1GB4A 5CHFA 2RDBC 3ZYYX 2I5FA 2MP2A 1ZOYB 2M17A 4YSZB 4MM3B 5D94A 4BKSA 2YVCA 4A6FB 1FXTB 1EU4A 1JALA 2VH2A 1ET9A 4QXAB 1DOIA 2WXIA 4A55A 2DYMA 2DX5B 4QJ4B 5FI0A 2DA0A 3A98B 5C1ZA 4FN2A 2NBVB 3LYYA 1XD3B 2BCJA 1TIFA 3A9KA 3MC9A 3HUIA 3MPXA 2LUEA 4N58A 3NY5A 2JZZA 3APCA 4F8CB 1WY8A 4A6QA 1UF0A 1YOVB 2FCSA 3QCAA 3FM8C 3ABVB 2KC1A 2ZPNA 2FNJB 4JE3B 5BYRA 4A5KA 4YSYB 1FRDA 2CRFA 5BMHA 2AL3A 2O6VB 3RNAC 1JWUD 1HBKA 1WJ1A 1ET6A 4YONA 1RYJA 3ZRFA 3PEGA 2IO3B 4M8NA 2BYTA 1X86A 1MK7B 3QC8B 3NVYA 4YWGG 4DHZB 2N9LA 3JYUA 5KCVA 1V2YA 1RAXA 1J19A 1Z87A 2Q5WD 3M95A 5LONB 3PSEB 3AE7B 1UGMA 1V8CA 2OHFA 3SO6A 5JHAA 2MBQA 2PZ1A 3GE8C 2N7JA 2XK5A 4BOSC 1NVID 1I4PA 1IPGA 2ZVOA 4TMAB 2KMAA 2KWUB 3DBRB 3SBGA 3QARA 1UWMA 2K2JA 4MDKE 3PZ7A 1SJHD 1LB1A 4DX8A 4GXBA 4TUUA 1TS3A 2V4LA 2PE6B 2KJRA 1NI2A 2LOXA 1QOFA 2L2IA 1TGZB 3DQVA 3PVWA 4P1BC 4M01A 1JRPA 1V1OA 2L00B 1TYGB 1DDMA 3R2TA 4PT5A 1WM2A 5TSSA 2CQUA 2RGFA 1TJ6A 1ZVRA 1C3TA 1GC7A 2IY1B 3NJTA 3H1UA 1FIQA 1WJUA 2JUOA 2LVQA 2DHJA 2WDVB 2MKRA 4E71A 4DBGA 2EC1A 4M02A 1RFAA 4AP4C 4MJSA 2J7QB 1U2BA 4MSMB 4ZRJA 3UIOB 1GJZA 5AZFA 1AQCA 2N9KA 3SU8X 4ZHPA 4JKGB 2K25A 4HROA 3VRAB 2CAYA 2KCJA 2KKCA 1V1PA 3B77A 2N0SB 3LXFA 1FRRA 1XT9B 2M1MA 1Q67A 3NRZA 4JWSC 1P9DU 2NMBA 5TR5A 2N7EA 5AUKA 1V5MA 4IG7B 1E7PB 3AU4A 2K39A 3GP7A 4NZLB 1K50A 2EMTA 2JVCA 3P6AA 1IGDA 3O65B 4D2KA 3ML4A 1L2NA 2MBOA 4ARIA 5D6JB 1DYNA 4HDQA 1PFJA 4I6NB 1AW7A 2KNBA 4RGNA 1FD6A 1WIAA 3CSFA 3C19A 3B2GA 3TEXA 2WNMA 4YSXB 2NBWB 4KVGB 2ELBA 1U5FA 2KTRB 1E8YA 4L6EA 4C00A 4ICUA 2WQYB 5CHWA 2AYOB 1DDVA 3NVWA 2KMCA 3IFWB 4C4VA 2R09A 3AULA 4M0WB 2ZNVB 4WJOA 4A9AA 3TFMA 1I4XA 3Q3FA 1BUIC 2Y8GA 2M0AA 3SYXA 2RVBB 4JKEA 1YQ3B 2LGYA 3UF8A 3PRPB 1UEFA 1VD2A 2SEBD 3H7PA 1V88A 4G3XB 1WX9A 3JW0X 1MFWA 1D6EC 5CHVC 2MSED 2D11A 5JHGA 2NPTA 2VZKB 3L4PA 2K2UA 3BVMA 1CK1A 2KIGA 1KLGD 3DBLI 1QF6A 4ZYNA 2DKPA 1YX6B 1XF5L 3ZNGC 1Y5OA 3X23A 3KUZA 4F7GA 4ICVA 1AYFA 4AS1A 4Q2JA 3HIZA 1KF6B 1KRHA 2A5UA 1J0GA 3SR6A 2L8JA 2Y8FA 3AN1A 3W1SA 5C16A 3L17A 1FCCC 3TCAA 2K3UA 3P4PB 5HE1A 1QOBA 3TEYA 2QIEB 4KHOA 3AE4B 2GBMA 2P0HA 2WDQB 1WXMA 3WYFB 5AEKB 1BAKA 3EFCA 3I57A 1GOZA 1WXSA 4NAMA 2RDGA 5T8IA 2IO0B 3BINA 3KQ4A 4MGYE 2BB5A 1RRPB 2NVUI 4USAA 2FJ9A 1ZC4B 1XX0A 1PGBA 1V81A 1NU2A 1MPEA 4RGMA 1E9MA 2W3RA 3V05A 2LBBA 3BK2A 1SIJA 1HE8A 3GE3C 5AZHA 5D3VA 3DVGY 3VFKA 4NQLB 3KLSX 3ZTDA 2N1WA 1U5DA 4LDTD 2WHIA 1WJMA 1EF5A 2L1AA 2BVCA 4IWPA 3GZNB 3RCZA 1WGUA 2YF0A 1DGJA 1OQRA 1WE6A 1FPYA 3SV1A 1P7FA 3EUB2 1E10A 2FJLA 1FOEA 4JK8A 3QWMA 4HRSA 1L6VA 2KDIA 3L0WB 1H4RA 4D0NB 4H2AA 2QHOA 1FHWA 2IPKD 3SUZA 4HK2A 2MRPA 2BW2A 3TVVA 4PQ0A 3P1MA 5G2NA 3K9PB 1S1QB 4HB0B 1MJDA 2HE7A 4A3OA 1V5TA 3APDA 3PZDA 1F52A 4MSQB 3L08A 4II3B 4JPSA 5EE0A 3WAPA 4GMVA 1TT5B 2MBBB 1J7AA 2R0DA 2NBUA 2WXGA 1DDWA 2CJOA 1FGYA 3HIEA 1NBFC 3AXCA 1V61A 2KJ6A 3W5UB 4GLSC 2WLBA 2XNAC 4XX5A 3W9CB 2JU6X 1XLQA 2KN4A 1OQNA 4JKBA 1MIZB 4IWQA 2O2VA 1QQGA 1WI1A 1UPQA 2XQNM 2CJNA 4KHAA 4KZ0A 3VUWA 1OEYJ 4DDGD 1X1FA 1E7VA 3E9OA 1SE4A 3FC4A 2LXCA 2WGSA 2AQ1B 1PMSA 3NOBA 2RLOA 5EFXA 4MEMA 1WJ4A 2LHEA 2COCA 3ENEA 3MHSD 4DHJB 1T0YA 2JSVX 1DOXA 3NS8A 2RUKB 4DK5A 2L83A 4LK0M 2NMQA 1V5PA 2WU5B 1TKYA 2Z0PA 1D5MC 3DBHB 2PLPA 1ZDVA 2KIEA 3MFGA 3KSYA 4NY0A 4P7IA 3PP2A 1W1HA 2UU7A 2XBBC 5J3QA 1UGJA 1E0ZA 4IM0A 2L0FA 3F5RA 4WQMA 2WXNA 3NZ3A 2KFKB 4G50A 3ZXRA 5G5GA 2JZPA 4HAWB 1SGHA 3T3OA 3A8PA 3KWVA 1I4QA 1NYRA 2MWSB 4B9KA 1IBXA 5DPWA 5JLJB 1RLFA 1PUTA 4CQNA 1WJNA 3PSCA 4A6HA 1XLPA 2DZIA 3QBVB 3TUOA 5IN7A 3ZJVA 2OOBB 4K7WA 2K22A 2AX5A 3DPDA 1Z2MA 3IT6B 3N7CA 2DFKA 2COPA 2ON8A 1N63A 4ZRIA 2HJ8A 2LRUA 3OHMB 1KZGA 1TKEA 2INPE 3H6NA 3GOEA 2J42A 4MK0A 2N23A 1NTIA 4F7ZA 2LJ5A 1N5XA 5DCNA 2ZW1A 1SHCA 3HRDD 4J3OD 4M00A 4IKGA 2LGIA 3AB5A 1YNTE 2IDYA 3Q6BA 1WXVA 4EZKA 4FJVB 3R66C 3U4EG 3APFA 1KBLA 4KX6B 2V3NA 1OTRB 4KIKA 1ST7A 1WMHB 4W9DA 3DWGC 3TEWA 4IFSA 3PPAA 3DVNV 3PT2B 3B0AA 4W9LA 1YQBA 2MEKA 2PE9A 4X57B 2L3ZA 2L52A 4LJPB 3AEBB 3M1IB 4HAVB 1C76A 3RPFC 3RZWC 1X05A 3QQ8B 4GSWA 3E9LA 1I35A 2QMTA 4GOUA 4JX1C 4O1NA 1VDVA 4XZ4A 2KXJA 3V60A 2DYOA 4LNFA 3SFEB 2DHIA 4HB4B 1W1GA 1LXDA 4OT1A 1SE3A 3KW5B 2DNFA 4ANVA 4JKCA 2EELA 5HHDG 4OZBA 2H7DA 3GS2A 3VDZA 1OEYA 2ZKMX 4W9KA 1K51A 4RM9A 2V9HA 1EVHA 1XO3A 1FHOA 3HVDA 5BYQA 3NVVA 2ONQA 1I7HA 3N30A 3D32A 1QQRA 1FNVA 4ILHA 2J59M 1LGRA 2GB1A 2DENB 1QOGA 2K6DB 5LXHA 2Z4DA 1C4AA 3H9DA 2UWQA 3ZNZB 2LJIA 2PTLA 2WXOA 4XDCA 1C1YB 4ZYSA 5JP4A 1C78A 1E5WA 1R4NI 2W3SA 5GMVA 3P42A 4KHBB 5EE1A 2RQ1A 1UNQA 2CU3A 2K9XA 4P1CC 2DYNA 1BT0A 2R2QA 3FLVA 4K3BA 5LXIB 4OSNA 2CKHB 2FBWB 3HW2B 5JVLA 2YEPB 4G11A 2J4XA 3OAWA 1TY0A 5E6NA 1FM0D 1UH6A 2KACA 3CF6E 1C9FA 3U8ZA 2MP2B 4IOIE 2QEJC 3RYTA 3PHWB 4GDLA 4DBBA 1JDEA 3IG3A 3TMPB 1I42A 2LD9A 1CJEA 1E7UA 4K2OA 1DYQA 4HPLB 2K49A 4US9A 2DAFA 1W1DA 1LO5D 1KTKA 2C9WB 1WX7A 3KVFB 2NBVA 2I38A 1UELA 2BYVE 2DYBA 3MTNB 3ONSA 1F2RC 2PW9A 1MHHE 1QLBB 2NZ8B 4GOCA 2N9XA 5HI1A 3PVUA 3ENBA 3A9KB 2EMSA 1IP9A 4HKQA 3JSVA 2J0JA 5HE3A 3Q8AA 4BBNC 3DCGA 1M7RA 4F7UP 2WXFA 3VHTC 1WGGA 1WR1A 3BWUD 2WYQA 3B9JA 1ZM0A 1Q10A 1HTOA 4GPTB 1UPRA 2BGFA 4CHMA 2I2YA 5J17A 2D9VA 1FNWA 1L0XB 2P8VA 2PMVA 5IO9A 1WVHA 1XXGA 1RWSA 2LOZA 4FULA 3IT4B 4RGOS 2MH7A 5LLIA 1MKEA 1L0VB 2KDBA 3AI5A 5KHOA 3ZKJC 2KWVB 2HJ1A 2KZRA 2LGSA 4LNNA 5JXVA 3WAOA 4A20A 5DI9B 1SSNA 1C4CA 1P3QU 1V89A 3ODXA 5H8YE 1FCLA 3DHIC 1OGWA 1VZ8A 3D8EA 1J8CA 5C5BB 1UWXA 2MW5A 4RF0A 3AU5A 2C7NB 2N1VA 3ZNHB 3A9JA 4WVFB 3RNFC 1CZPA 2DN6A 2GI9A 3V3XA 1EGXA 5DHFB 1MVKA 4ASWC 1I7AA 1XLNA 3R3MA 1OFFA 1VBHA 4JLCA 3ZTCA 3KUCB 2M38A 5DHAB 1P1AA 4ANUA 4MH8A 2R2YA 2VRWB 1XKEA 5JHHA 4LNOA 1K8RB 2BKFA 4FJZA 3U7ZA 3SNHA 1VBGA 2TSSA 4C56C 3RI7C 4KDLB 2COAA 2IYBA 2FCNA 4NJCA 3WIMA 1PFDA 2IJ0A 2G4DB 1U29A 2FE8A 4AUQC 3UQBA 1WGHA 3AECB 3NG0A 3RNEC 4OVZA 3EA6A 3B08A 2ZW0A 3P63A 2M14A 1GG3A 4TQ1A 2QKMA 2HTHA 1DOYA 2M4NA 4XYCA 1R4MB 5D3IB 3VTVA 4TYZA 4L1BA 1UBQA 4K2PA 2CR5A 3PVLA 2AQ2B 1QC6A 3KUDB 1HB6A 2K8EA 3ALBA 4PYUA 1KH0A 3IHPC 3KRXA 2LKOA 4NPNA 3A8QA 2J53A 1WZ3A 1V1PB 3SHQA 1EWYC 3N1XC 2R61A 1GAQB 4ILGB 1ZXHA 4OZAA 3QWZB 2FIDA 4BKTA 1X1GA 3DHGC 1I4HA 3HM6X 3T3NA 2D07B 2GMIC 3TSSA 4REZA 3M3JA 5C3JB 3RT3B 5J2RA 4HPMB 4K3CA 3VUXA 5JHBA 4GZUA 1MPHA 2CU1A 3ML8A 3SFDB 3PO0A 4NJ7A 1GGOA 3SEBA 2DX1A 2UVMA 3JVZX 3FP5A 2YSZA 1ZUD2 2JPHA 4TV3A 2D9YA 2OQBA 1J7BA 5EE9A 4HCNB 4A3PA 1ZC3B 1PYWD 3CXBB 1M94A 3PLUA 3DBRI 2G3QB 2V76A 1I4GA 2E6XA 1OY2A 4DIXA 5JZEB 4C4VB 2BWES 3AV8A 2JX5A 4EZLA 2CY4A 3ZJUA 2QCZA 1KC7A 4NSWA 4YL8A 2RSGA 2I1JA 4XWXA 1K5GB 2YT1A 1WXQA 3ETRA 1XODA 1CQVA 3KZ1A 2RDHA 2KOXA 3BY4B 3H7PB 3N1YC 2WWZA 3KWLA 2QKLA 5HG2A 3DXDA 2EJ8A 3PZ8A 2PIAA 2QDFA 1JMLA 2NPTB 2LG1A 2GCJA 4W9IA 1EWCA 2ZEQA 5JH5C 3MJWA 3S2AA 1TKGA 1GB1A 1ESFA 3VTWA 4NJ6A 1V80A 1WGKA 1PLSA 1UBIA 4IWOA 4GN1A 4IC7B 4ZRKA 1NEKB 2Y5PA 1GNUA 4KKJA 1T0QC 2BBCA 5D3WA 1WI0A 5DPSA
chains in the Genus database with same CATH topology
2KVRA 2GS0A 3VQIA 2BYEA 3U7DA 3WANA 3EFUA 4I6PA 3W1YA 2YS5A 3PTFC 3U30A 4JK9A 2ZJDA 1E90A 4GGQA 2D2QA 2P0DA 2KANA 2N0YA 4ANXA 3KY9A 3HK0A 2DKQA 4HAZB 2W2WA 5L83A 2J0MA 2BF8B 2RGNB 2EKEC 4AOFA 4NAWA 3ZUNA 2C7HA 4DHJD 4EMOA 4PNKA 2FDQA 2AWTA 2LI5A 3A4RA 1TZ1A 1IRSA 2WH5A 4HAXB 1XQQA 1RRBA 2KWCA 1IYFA 2MX2A 1KM7A 3KRWA 3OJ4B 1TTNA 1L7YA 1LQBA 3QX1A 4W9JA 1LW3A 1D3ZA 2D4QA 3NZUA 4DDID 2V1YA 2Z0QA 2ZNVC 5CTRC 2JY6A 4GU2A 2KN5A 1DIKA 2Z0EB 4E3CA 3H7SA 2IZVB 2ZCCA 4LCDE 2O2VB 2D9ZA 1H8CA 3ZVRA 3QJZA 2JF5A 1KOTA 3VH3B 4KDIC 4MT7A 2N9PC 4K17A 4LDTB 4TQ0A 5HE0A 2L7RA 2X0SA 4KSLC 2RPQA 3D8DA 1AARA 5D27A 3UINB 1WGQA 2KUPA 1Q5WB 2K8CA 4TKNA 3MDBC 4Z2NA 2CHZA 4KV2A 1WFYA 1NTYA 3KYDD 1KZ7A 1V5UA 4WWNA 1XD4A 4IAPA 2K6QA 3C0RB 1S3SG 3QK0A 3L10B 3ZVVA 4AWJA 2BPSA 4IUMB 2FIFA 4JL9A 1H10A 3ULCA 2KC2A 3QA8A 1V5OA 1JRUA 3V6EB 2LVOA 1WZ0A 2REXA 2DZJA 2HRJA 4NQKE 3CMMB 2GBNA 4DWFA 4HAUB 1WF9A 4I6LB 2UZSA 2KFJA 4MY6A 1LM8B 2Y5BB 2WDTB 4BOZB 3QHTA 4FBJB 4GDKA 2ASQA 4URKA 3IBEA 2C60A 4Z2MB 2KJHB 1FAOA 4WWPA 4HXDA 3E66A 5LOPB 3CSTA 4WJNA 1YJ1A 3ZLZA 4IOYX 1WMHA 4OVUA 3A1QA 4KIKB 5DH9B 2CHWA 1KI1B 3WA0A 1TBEA 3RULA 2ZZPB 2HD5B 5IAAC 4A6KA 4AJWA 1Q0WB 1KLVA 2W9NA 1WRDB 3DBHI 4WSFA 2AEHA 4B95A 4GIVA 4BKSD 3RUIB 1OMWA 4II2B 3PG7A 4JKHA 2ZPYA 4HCPB 2D3GA 4HLEA 3WALA 2JRIB 3VUYA 3PREA 3KH0A 2RNRB 4MELA 4FJYA 2KLCA 2MFQA 4G0NB 2MCNB 2DLWA 2FAZA 2O6VD 5L81A 1EAZA 5HKHA 1CMXB 3WAMA 3ZIMA 1N3HA 1EUVB 2ZVNA 1XR0B 2XEWA 4JGHB 2IFSA 2MWNB 4CO7A 3PHXB 1SIFA 2FUHB 4MM3A 4JKDA 4A6FA 1QZEA 4B6WA 3EC8A 1U5EA 4JQWC 3O96A 4HATB 5KQ1A 2DX5A 4F7HA 2KQSA 3TW1A 3OJ3A 4GDLB 3N3KB 2P0FA 3L13A 4DX90 4RMAA 1P0RA 3VVWB 1UD7A 1P6SA 1ISNA 4W9HA 2NR2A 3PV1A 4LJOB 2LGDA 1TXDA 1UZXB 2K00A 4EZJA 3AJ4A 3JSVB 3A33B 2A4ZA 2O6VA 1NDDA 1EF1A 2D10A 2I1KA 3SDLC 4WAAA 2R82A 4HB2B 1P3RA 1MIXA 1WYWB 1DBHA 1WM3A 1B55A 2C5LC 1Z5SB 4C0AA 4W9GA 4ANWA 1NTVA 4GMXB 2KO3A 3NHEB 3NZSA 3FEHA 2MA9B 1WXAA 1U5GA 3VTUA 2XK5B 3B1LX 3DDCB 3V61A 1AWEA 4M8MA 2L76A 3ZO5B 5C5BA 4FLHA 3VXWA 1BTNA 1TQZA 1XCGA 1MAIA 3A9JB 3DVNU 3ZDMC 3ULBA 4BBKA 2L05A 2WX1A 5D2MB 3GYOA 4HB3B 5J18A 3GYPA 3T06A 4BVUC 2J0KA 3PS6A 2WX0A 1V9JA 2NCNA 4J6IA 2Z0DB 3OANA 4MGKE 2LULA 1WR6E 3ML9A 2K1FA 4RM8A 2W2XC 4MJSB 4CHJA 2JRHA 4JKGA 1EO6A 2B3AA 3TL5A 5IJMA 3M63B 2HTHB 2CS4A 3LJ3A 2G35A 2C7MB 2UYZB 1J0WA 1X11A 1FGZA 1E8XA 4CHKA 2N9EB 2KD0A 1Q1OA 1Y19B 3VOQA 3ECIA 4ILJA 2JP2A 1WGDA 2L0TA 4K7UA 4MH0E 2Y7BA 3L54A 1YIWA 3EHVA 1YX5B 3P2BA 1F9JA 3FSSA 5E6PA 1A5RA 4W9FA 2BKRB 2K8BA 4PS3A 4JKAA 2M0XA 2KTFA 4ZDVA 2PJHA 2LVPA 2JXXA 2KTRA 3NSUA 1V86A 5IA7A 3E9PA 4BBNF 4DXAB 3DXCA 1ACAA 5DPTA 5HE2A 4HHVA 2DIKA 2IO1B 4OVVA 2CHXA 1OQYA 1P98A 3VIAA 4JKFA 1WGRA 4HAYB 2X18A 2MLBA 1ZSQA 4KZCA 4NNJB 1M7EA 1MK9B 2JWZA 4MGZE 2ABDA 2GCLA 2L1CA 3D8FA 2R2OA 4WWOA 3T9LA 2ELAA 1U4AA 1BTKA 2DHKA 1R4MI 5DIFB 3V5WA 3QAQA 5EDSA 2KK8A 4HJKA 2GJYA 2DYQA 1UNRA 2GOWA 5G55A 2MBHA 1BWNA 3RZFA 1WGYA 3ZRCA 1RJ2A 4K1RB 3SD5A 2YLMA 4CYEA 3EPYA 5AZGA 5E6OA 2UZRA 2JZ3B 5CX3A 2DTCA 3HHMA 3TBLD 1LFDA 3N32A 4IM3A 1YD8U 3HQCA 2CY5A 4KAXB 2N4FA 4H8SA 4HVBA 1KJTA 4PYZA 4FHKA 2GBJA 3HM3A 2FCQA 3UZTA 4EJNA 1WJ6A 1HB8A 4K7SA 4IW0A 1GUAB 4NAWB 3I3TB 4PS8A 3RCPA 3RD2A 3DXEA 4XC2A 3SBTA 3DVGX 3OLMD 2VKIA 2V3SA 2MDXA 2DHZA 3VH4B 4HWIB 3LDZE 2KLGA 4WQOB 5GOWB 2LYDA 2IYDB 1MG8A 4FHJA 5D3YA 3ZW3A 1K5DB 2KQ7A 2CB8A 4EEWA 3PLVA 2ROZB 2YS1A 1GC6A 4N9F4 2OTXA 1U27A 2I5CA 2OJRA 1ZGUB 4DHZE 4FA6A 3KYCD 1X1MA 2LRWA 2MQJA 3EECA 4WJPA 1FHXA 2YT0A 4MGIE 1ZW7A 2IO2B 3TO1A 4EOYA 1V49A 4HDOA 4FADA 2KGXB 1WE7A 5KHQA 4WJQA 3F0WA 2KFKA 5D7GA 2ROVA 2DAJA 3GZNI 1P5TA 4W9EA 3W1SC 2DZKA 3VAWA 3T8MA 2KX3A 4B6HA 2COFA 3UIPB 2Z59B 3G9WA 1ZKHA 1SE9A 3ZDTA 3K9OB 2G45B 4JIOU 2Q13A 2LZ6A 2BYFA 3V6CB 2LXAA 2ZCBA 4GB9A 3ZNID 3A4SC 2IY0B 2KDEB 2VSZA 5J3YA 5L95C 2JT4B 3IVFA 1PQSA 3TIXA 2YRYA 2GBKA 2LASA 2CODA 3V62A 3ODWA 5FR6A 2KHWB 3R7RA 4AJYB 4EKUA 5C6RA 2KX0A 4F1SA 5C23A 3ODOA 2M8SA 4GDKB 3QIJA 3UGBB 3P7ZA 3R7QA 3X0WA 2W2XD 3PGEA 3BJIA 2MBEA 4IM2A 2LWPA 2YS3A 5CLQB 2Z0OA 1DROA 2RD0A 3Q3JA 1UNPA 3PRMB 3UQAA 2FCMA 3PRZA 2H7EA 4PS7A 3A1QB 4EFOA 5BO4B 2VRRB 5J3TA 2KDFB 4W9CA 1Y8RC 2K8HA 2LGXA 2IBIB 4WJ7A 4E74A 5CLLB 4Y94A 2GBRA 2G4SA 2D9XA 5KQ4A 1WX8A 2PEAA 4EUTA 2PPHA 1WH3A 3LJUX 1G6JA 4BFRA 3TJPA 2D9WA 3CIKA 1VCBA 2E2XA 5D3XA 1V6EA 5FI1A 2N7DA 1FB8A 2ADZA 3DOWA 3L16A 3DBSA 5C79A 5DPRA 1NVLA 4K81A 1WG7A 2BWFA 2NS5A 4JK7A 4BKGA 1E8WA 1I2HA 4KSKC 2RR9A 2AL6A 1E8ZA 2RSUA 3M62B 2DZMA 5CHFA 2I5FA 2MP2A 2M17A 5D94A 4BKSA 2YVCA 4A6FB 1FXTB 2DYMA 2DX5B 5FI0A 2DA0A 3A98B 5C1ZA 4FN2A 2NBVB 1XD3B 2BCJA 3A9KA 3MPXA 2LUEA 3NY5A 2JZZA 3APCA 4F8CB 1WY8A 2FCSA 3QCAA 3FM8C 2KC1A 2ZPNA 2FNJB 4A5KA 2CRFA 2AL3A 2O6VB 1HBKA 1WJ1A 4YONA 3ZRFA 3PEGA 2IO3B 4M8NA 1X86A 1MK7B 3QC8B 4DHZB 3JYUA 5KCVA 1V2YA 1RAXA 1J19A 1Z87A 3M95A 5LONB 3PSEB 1UGMA 3SO6A 5JHAA 2MBQA 2PZ1A 2XK5A 4BOSC 1IPGA 2ZVOA 2KMAA 2KWUB 3SBGA 3QARA 2K2JA 4MDKE 1LB1A 4DX8A 4GXBA 4TUUA 2V4LA 2PE6B 2KJRA 1NI2A 2LOXA 2L2IA 1TGZB 3DQVA 3PVWA 2L00B 1DDMA 1WM2A 2CQUA 2RGFA 1TJ6A 1ZVRA 1C3TA 1GC7A 2IY1B 3H1UA 1WJUA 2JUOA 2LVQA 2DHJA 2MKRA 4E71A 4DBGA 2EC1A 1RFAA 4AP4C 4MJSA 2J7QB 1U2BA 4MSMB 4ZRJA 3UIOB 1GJZA 5AZFA 1AQCA 3SU8X 4JKGB 2K25A 2CAYA 2KCJA 2KKCA 1XT9B 2M1MA 1Q67A 1P9DU 2NMBA 5TR5A 2N7EA 1V5MA 4IG7B 3AU4A 2K39A 2EMTA 2JVCA 3P6AA 3O65B 3ML4A 1L2NA 2MBOA 5D6JB 1DYNA 4HDQA 1PFJA 4I6NB 2KNBA 1WIAA 3CSFA 2NBWB 4KVGB 2ELBA 1U5FA 2KTRB 1E8YA 4L6EA 4ICUA 5CHWA 2AYOB 1DDVA 2KMCA 3IFWB 2R09A 3AULA 4M0WB 2ZNVB 4WJOA 3TFMA 3Q3FA 2Y8GA 3SYXA 2RVBB 4JKEA 2LGYA 3UF8A 3PRPB 1UEFA 1VD2A 3H7PA 1V88A 4G3XB 1WX9A 3JW0X 5CHVC 2MSED 2D11A 5JHGA 2NPTA 2K2UA 3DBLI 4ZYNA 2DKPA 1YX6B 3ZNGC 1Y5OA 3X23A 3KUZA 4F7GA 4ICVA 3HIZA 2A5UA 1J0GA 2L8JA 2Y8FA 3W1SA 5C16A 3L17A 3TCAA 5HE1A 4KHOA 2GBMA 2P0HA 1WXMA 3WYFB 5AEKB 1BAKA 1WXSA 2IO0B 3BINA 4MGYE 1RRPB 2NVUI 2FJ9A 1ZC4B 1XX0A 1V81A 1NU2A 2LBBA 1HE8A 5AZHA 5D3VA 3DVGY 3VFKA 4NQLB 3ZTDA 2N1WA 1U5DA 4LDTD 1WJMA 1EF5A 4IWPA 3RCZA 1WGUA 2YF0A 1WE6A 3SV1A 2FJLA 1FOEA 4JK8A 3QWMA 3L0WB 2KDIA 1H4RA 4D0NB 2QHOA 1FHWA 3SUZA 4HK2A 2MRPA 3TVVA 4PQ0A 5G2NA 3K9PB 1S1QB 4HB0B 2HE7A 4A3OA 1V5TA 3APDA 3PZDA 4MSQB 3L08A 4II3B 3WAPA 4GMVA 2MBBB 2R0DA 2NBUA 1DDWA 1FGYA 1NBFC 3AXCA 1V61A 2KJ6A 4XX5A 1OQNA 4JKBA 1MIZB 4IWQA 2O2VA 1QQGA 1WI1A 1UPQA 2XQNM 4KHAA 4KZ0A 3VUWA 1OEYJ 4DDGD 1X1FA 1E7VA 3E9OA 2LXCA 1PMSA 3NOBA 2RLOA 5EFXA 4MEMA 1WJ4A 2COCA 3ENEA 3MHSD 4DHJB 1T0YA 3NS8A 2RUKB 4DK5A 1V5PA 2Z0PA 3KSYA 4NY0A 4P7IA 3PP2A 1W1HA 2XBBC 5J3QA 4IM0A 2L0FA 3F5RA 2KFKB 4G50A 4HAWB 1SGHA 3A8PA 2MWSB 4B9KA 5DPWA 5JLJB 1RLFA 1WJNA 3PSCA 4A6HA 2DZIA 3QBVB 2OOBB 4K7WA 3DPDA 1Z2MA 3N7CA 2DFKA 2COPA 4ZRIA 2HJ8A 2LRUA 1KZGA 3H6NA 3GOEA 4MK0A 2N23A 1NTIA 4F7ZA 2LJ5A 5DCNA 1SHCA 4EZKA 1WXVA 4FJVB 3R66C 3APFA 1KBLA 1OTRB 4KIKA 1ST7A 1WMHB 4W9DA 4IFSA 3PPAA 3DVNV 3PT2B 3B0AA 4W9LA 1YQBA 2PE9A 4X57B 2L3ZA 4LJPB 3M1IB 4HAVB 3RZWC 1X05A 3QQ8B 4GSWA 3E9LA 1I35A 4XZ4A 2KXJA 3V60A 2DYOA 2DHIA 4HB4B 1W1GA 1LXDA 3KW5B 4ANVA 4JKCA 2H7DA 3VDZA 1OEYA 4W9KA 4RM9A 1EVHA 1FHOA 3N30A 3D32A 4ILHA 2J59M 2DENB 2K6DB 5LXHA 3H9DA 2UWQA 3ZNZB 1C1YB 5JP4A 1E5WA 1R4NI 5GMVA 4KHBB 2RQ1A 1UNQA 2DYNA 1BT0A 2R2QA 3FLVA 5LXIB 2CKHB 3HW2B 5JVLA 4G11A 3OAWA 5E6NA 1UH6A 3CF6E 3U8ZA 2MP2B 3RYTA 3PHWB 4GDLA 4DBBA 1JDEA 3IG3A 3TMPB 1I42A 2LD9A 1E7UA 4K2OA 4HPLB 2DAFA 1W1DA 2C9WB 3KVFB 1WX7A 1UELA 2BYVE 2DYBA 3MTNB 3ONSA 4GOCA 2NZ8B 2N9XA 3PVUA 3ENBA 3A9KB 2EMSA 1IP9A 3JSVA 2J0JA 5HE3A 4BBNC 3DCGA 1M7RA 4F7UP 3VHTC 1WGGA 1WR1A 2WYQA 1ZM0A 4GPTB 1UPRA 2BGFA 4CHMA 5J17A 2D9VA 2P8VA 1WVHA 4FULA 2LOZA 5LLIA 1MKEA 2KDBA 3AI5A 5KHOA 3ZKJC 2KWVB 2KZRA 3WAOA 4A20A 5DI9B 1P3QU 1V89A 3ODXA 1OGWA 1J8CA 3D8EA 5C5BB 2MW5A 3AU5A 2C7NB 2N1VA 3ZNHB 3A9JA 4WVFB 2DN6A 1EGXA 5DHFB 4ASWC 1I7AA 3R3MA 1VBHA 4JLCA 3ZTCA 3KUCB 2M38A 5DHAB 1P1AA 4ANUA 5JHHA 2VRWB 1XKEA 1K8RB 2BKFA 4FJZA 3SNHA 1VBGA 4KDLB 2COAA 2IYBA 2FCNA 3WIMA 2G4DB 1U29A 4AUQC 3UQBA 1WGHA 3B08A 2M14A 1GG3A 4TQ1A 2QKMA 2HTHA 2M4NA 3VTVA 4TYZA 1UBQA 4K2PA 2CR5A 3PVLA 1QC6A 3KUDB 1HB6A 3ALBA 4PYUA 3IHPC 3KRXA 2LKOA 4NPNA 3A8QA 1WZ3A 3SHQA 4ILGB 3QWZB 2FIDA 4BKTA 1X1GA 3HM6X 2D07B 2GMIC 3M3JA 3RT3B 5J2RA 4HPMB 3VUXA 5JHBA 4GZUA 1MPHA 2CU1A 3ML8A 4NJ7A 1GGOA 2DX1A 2UVMA 3JVZX 3FP5A 2YSZA 2JPHA 4TV3A 2D9YA 2OQBA 4HCNB 4A3PA 1ZC3B 3CXBB 1M94A 3PLUA 3DBRI 2G3QB 2V76A 1OY2A 5JZEB 2BWES 4EZLA 2CY4A 1KC7A 4NSWA 4YL8A 2RSGA 2I1JA 4XWXA 1K5GB 2YT1A 1XODA 3KZ1A 3H7PB 2KOXA 3BY4B 2WWZA 2QKLA 3DXDA 2EJ8A 2NPTB 2LG1A 2GCJA 4W9IA 2ZEQA 5JH5C 3MJWA 3S2AA 3VTWA 4NJ6A 1V80A 1PLSA 1UBIA 4IWOA 4GN1A 4IC7B 4ZRKA 1GNUA 5D3WA 1WI0A 5DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVR A;  2GS0 A;  3VQI A;  2BYE A;  3U7D A;  3WAN A;  3EFU A;  4I6P A;  3W1Y A;  2YS5 A;  3PTF C;  3U30 A;  2ZJD A;  1E90 A;  4GGQ A;  2D2Q A;  2P0D A;  2KAN A;  2N0Y A;  4ANX A;  3KY9 A;  3HK0 A;  2DKQ A;  4HAZ B;  2W2W A;  5L83 A;  2J0M A;  2BF8 B;  2RGN B;  2EKE C;  4AOF A;  4NAW A;  3ZUN A;  2C7H A;  4DHJ D;  4EMO A;  4PNK A;  2FDQ A;  2AWT A;  2LI5 A;  3A4R A;  1TZ1 A;  1IRS A;  2WH5 A;  4HAX B;  1XQQ A;  1RRB A;  2KWC A;  1IYF A;  2MX2 A;  1KM7 A;  3KRW A;  3OJ4 B;  1TTN A;  1L7Y A;  1LQB A;  3QX1 A;  4W9J A;  1LW3 A;  1D3Z A;  2D4Q A;  3NZU A;  4DDI D;  2V1Y A;  2Z0Q A;  2ZNV C;  5CTR C;  2JY6 A;  4GU2 A;  2KN5 A;  2Z0E B;  4E3C A;  3H7S A;  2IZV B;  2ZCC A;  4LCD E;  2O2V B;  2D9Z A;  1H8C A;  3ZVR A;  3QJZ A;  2JF5 A;  1KOT A;  3VH3 B;  4KDI C;  4MT7 A;  2N9P C;  4K17 A;  4LDT B;  4TQ0 A;  5HE0 A;  2L7R A;  4KSL C;  2RPQ A;  3D8D A;  1AAR A;  5D27 A;  3UIN B;  1WGQ A;  2KUP A;  1Q5W B;  2K8C A;  4TKN A;  3MDB C;  4Z2N A;  2CHZ A;  4KV2 A;  1WFY A;  1NTY A;  3KYD D;  1KZ7 A;  1V5U A;  4WWN A;  1XD4 A;  4IAP A;  2K6Q A;  3C0R B;  1S3S G;  3QK0 A;  3L10 B;  3ZVV A;  4AWJ A;  2BPS A;  4IUM B;  2FIF A;  4JL9 A;  1H10 A;  3ULC A;  2KC2 A;  3QA8 A;  1V5O A;  1JRU A;  3V6E B;  2LVO A;  1WZ0 A;  2REX A;  2DZJ A;  2HRJ A;  4NQK E;  3CMM B;  2GBN A;  4DWF A;  4HAU B;  1WF9 A;  4I6L B;  2UZS A;  2KFJ A;  4MY6 A;  1LM8 B;  2Y5B B;  2WDT B;  4BOZ B;  3QHT A;  4FBJ B;  4GDK A;  2ASQ A;  4URK A;  3IBE A;  2C60 A;  4Z2M B;  2KJH B;  1FAO A;  4WWP A;  4HXD A;  5LOP B;  3CST A;  4WJN A;  1YJ1 A;  3ZLZ A;  4IOY X;  1WMH A;  4OVU A;  3A1Q A;  4KIK B;  5DH9 B;  2CHW A;  1KI1 B;  3WA0 A;  1TBE A;  3RUL A;  2ZZP B;  2HD5 B;  5IAA C;  4A6K A;  4AJW A;  1Q0W B;  1KLV A;  2W9N A;  1WRD B;  3DBH I;  4WSF A;  2AEH A;  4B95 A;  4GIV A;  4BKS D;  3RUI B;  1OMW A;  4II2 B;  3PG7 A;  2ZPY A;  4HCP B;  2D3G A;  4HLE A;  3WAL A;  2JRI B;  3VUY A;  3PRE A;  3KH0 A;  2RNR B;  4MEL A;  4FJY A;  2KLC A;  2MFQ A;  4G0N B;  2MCN B;  2DLW A;  2FAZ A;  2O6V D;  5L81 A;  1EAZ A;  5HKH A;  1CMX B;  3WAM A;  3ZIM A;  1N3H A;  1EUV B;  2ZVN A;  1XR0 B;  2XEW A;  4JGH B;  2IFS A;  2MWN B;  4CO7 A;  3PHX B;  1SIF A;  2FUH B;  4MM3 A;  4A6F A;  1QZE A;  4B6W A;  3EC8 A;  1U5E A;  4JQW C;  3O96 A;  4HAT B;  5KQ1 A;  2DX5 A;  4F7H A;  2KQS A;  3TW1 A;  3OJ3 A;  4GDL B;  3N3K B;  2P0F A;  3L13 A;  4DX9 0;  4RMA A;  1P0R A;  3VVW B;  1UD7 A;  1P6S A;  1ISN A;  4W9H A;  2NR2 A;  3PV1 A;  4LJO B;  2LGD A;  1TXD A;  1UZX B;  2K00 A;  4EZJ A;  3AJ4 A;  3JSV B;  3A33 B;  2A4Z A;  2O6V A;  1NDD A;  1EF1 A;  2D10 A;  2I1K A;  3SDL C;  4WAA A;  4HB2 B;  1P3R A;  1MIX A;  1WYW B;  1DBH A;  1WM3 A;  1B55 A;  2C5L C;  1Z5S B;  4C0A A;  4W9G A;  4ANW A;  1NTV A;  4GMX B;  2KO3 A;  3NHE B;  3NZS A;  3FEH A;  2MA9 B;  1WXA A;  1U5G A;  3VTU A;  2XK5 B;  3B1L X;  3DDC B;  3V61 A;  1AWE A;  4M8M A;  2L76 A;  3ZO5 B;  5C5B A;  4FLH A;  3VXW A;  1BTN A;  1TQZ A;  1XCG A;  1MAI A;  3A9J B;  3DVN U;  3ZDM C;  3ULB A;  4BBK A;  2L05 A;  2WX1 A;  5D2M B;  3GYO A;  4HB3 B;  5J18 A;  3GYP A;  3T06 A;  4BVU C;  2J0K A;  3PS6 A;  2WX0 A;  1V9J A;  2NCN A;  4J6I A;  2Z0D B;  3OAN A;  4MGK E;  2LUL A;  1WR6 E;  3ML9 A;  2K1F A;  4RM8 A;  2W2X C;  4MJS B;  4CHJ A;  2JRH A;  1EO6 A;  2B3A A;  3TL5 A;  5IJM A;  3M63 B;  2HTH B;  2CS4 A;  3LJ3 A;  2G35 A;  2C7M B;  2UYZ B;  1J0W A;  1X11 A;  1FGZ A;  1E8X A;  4CHK A;  2N9E B;  2KD0 A;  1Q1O A;  1Y19 B;  3VOQ A;  3ECI A;  2JP2 A;  1WGD A;  2L0T A;  4K7U A;  4MH0 E;  2Y7B A;  3L54 A;  1YIW A;  3EHV A;  1YX5 B;  3P2B A;  1F9J A;  3FSS A;  5E6P A;  1A5R A;  4W9F A;  2BKR B;  2K8B A;  4PS3 A;  2M0X A;  2KTF A;  4ZDV A;  2PJH A;  2LVP A;  2JXX A;  2KTR A;  3NSU A;  1V86 A;  5IA7 A;  4BBN F;  4DXA B;  3DXC A;  1ACA A;  5DPT A;  5HE2 A;  4HHV A;  2IO1 B;  4OVV A;  2CHX A;  1OQY A;  1P98 A;  3VIA A;  1WGR A;  4HAY B;  2X18 A;  2MLB A;  1ZSQ A;  4KZC A;  4NNJ B;  1M7E A;  1MK9 B;  2JWZ A;  4MGZ E;  2ABD A;  2GCL A;  2L1C A;  3D8F A;  2R2O A;  4WWO A;  3T9L A;  2ELA A;  1U4A A;  1BTK A;  2DHK A;  1R4M I;  5DIF B;  3V5W A;  3QAQ A;  5EDS A;  2KK8 A;  4HJK A;  2GJY A;  2DYQ A;  1UNR A;  2GOW A;  5G55 A;  2MBH A;  1BWN A;  3RZF A;  1WGY A;  3ZRC A;  1RJ2 A;  4K1R B;  3SD5 A;  2YLM A;  4CYE A;  3EPY A;  5AZG A;  5E6O A;  2UZR A;  2JZ3 B;  5CX3 A;  2DTC A;  3HHM A;  3TBL D;  1LFD A;  3N32 A;  4IM3 A;  1YD8 U;  3HQC A;  2CY5 A;  4KAX B;  2N4F A;  4H8S A;  4HVB A;  1KJT A;  4PYZ A;  4FHK A;  2GBJ A;  3HM3 A;  2FCQ A;  3UZT A;  4EJN A;  1WJ6 A;  1HB8 A;  4K7S A;  4IW0 A;  1GUA B;  4NAW B;  3I3T B;  4PS8 A;  3RCP A;  3RD2 A;  3DXE A;  4XC2 A;  3DVG X;  3OLM D;  2VKI A;  2V3S A;  2MDX A;  2DHZ A;  3VH4 B;  4HWI B;  3LDZ E;  2KLG A;  4WQO B;  5GOW B;  2LYD A;  2IYD B;  1MG8 A;  4FHJ A;  5D3Y A;  3ZW3 A;  1K5D B;  2KQ7 A;  2CB8 A;  4EEW A;  3PLV A;  2ROZ B;  2YS1 A;  1GC6 A;  4N9F 4;  2OTX A;  1U27 A;  2I5C A;  2OJR A;  1ZGU B;  4DHZ E;  4FA6 A;  3KYC D;  1X1M A;  2LRW A;  2MQJ A;  3EEC A;  4WJP A;  1FHX A;  2YT0 A;  4MGI E;  1ZW7 A;  2IO2 B;  3TO1 A;  4EOY A;  1V49 A;  4HDO A;  4FAD A;  2KGX B;  1WE7 A;  5KHQ A;  4WJQ A;  3F0W A;  2KFK A;  5D7G A;  2ROV A;  2DAJ A;  3GZN I;  1P5T A;  4W9E A;  3W1S C;  2DZK A;  3VAW A;  3T8M A;  2KX3 A;  4B6H A;  2COF A;  3UIP B;  2Z59 B;  3G9W A;  1ZKH A;  1SE9 A;  3ZDT A;  3K9O B;  2G45 B;  4JIO U;  2Q13 A;  2LZ6 A;  2BYF A;  3V6C B;  2LXA A;  2ZCB A;  4GB9 A;  3ZNI D;  3A4S C;  2IY0 B;  2KDE B;  2VSZ A;  5J3Y A;  5L95 C;  2JT4 B;  3IVF A;  1PQS A;  3TIX A;  2YRY A;  2GBK A;  2LAS A;  2COD A;  3V62 A;  3ODW A;  5FR6 A;  2KHW B;  3R7R A;  4AJY B;  4EKU A;  5C6R A;  2KX0 A;  4F1S A;  5C23 A;  3ODO A;  2M8S A;  4GDK B;  3QIJ A;  3UGB B;  3P7Z A;  3R7Q A;  3X0W A;  2W2X D;  3PGE A;  3BJI A;  2MBE A;  4IM2 A;  2LWP A;  2YS3 A;  5CLQ B;  2Z0O A;  1DRO A;  2RD0 A;  3Q3J A;  1UNP A;  3PRM B;  3UQA A;  2FCM A;  3PRZ A;  2H7E A;  4PS7 A;  3A1Q B;  4EFO A;  5BO4 B;  2VRR B;  5J3T A;  2KDF B;  4W9C A;  1Y8R C;  2K8H A;  2LGX A;  2IBI B;  4WJ7 A;  4E74 A;  5CLL B;  4Y94 A;  2GBR A;  2G4S A;  2D9X A;  5KQ4 A;  1WX8 A;  2PEA A;  4EUT A;  2PPH A;  1WH3 A;  3LJU X;  1G6J A;  4BFR A;  3TJP A;  2D9W A;  3CIK A;  1VCB A;  2E2X A;  5D3X A;  1V6E A;  5FI1 A;  2N7D A;  1FB8 A;  2ADZ A;  3DOW A;  3L16 A;  3DBS A;  5C79 A;  5DPR A;  1NVL A;  4K81 A;  1WG7 A;  2BWF A;  2NS5 A;  4BKG A;  1E8W A;  1I2H A;  4KSK C;  2RR9 A;  2AL6 A;  1E8Z A;  2RSU A;  3M62 B;  2DZM A;  5CHF A;  2I5F A;  2MP2 A;  2M17 A;  5D94 A;  4BKS A;  2YVC A;  4A6F B;  1FXT B;  2DYM A;  2DX5 B;  5FI0 A;  2DA0 A;  3A98 B;  5C1Z A;  4FN2 A;  2NBV B;  1XD3 B;  2BCJ A;  3A9K A;  3MPX A;  2LUE A;  3NY5 A;  2JZZ A;  3APC A;  4F8C B;  1WY8 A;  2FCS A;  3QCA A;  3FM8 C;  2KC1 A;  2ZPN A;  2FNJ B;  4A5K A;  2CRF A;  2AL3 A;  2O6V B;  1HBK A;  1WJ1 A;  4YON A;  3ZRF A;  3PEG A;  2IO3 B;  4M8N A;  1X86 A;  1MK7 B;  3QC8 B;  4DHZ B;  3JYU A;  5KCV A;  1V2Y A;  1RAX A;  1J19 A;  1Z87 A;  3M95 A;  5LON B;  3PSE B;  1UGM A;  3SO6 A;  5JHA A;  2MBQ A;  2PZ1 A;  2XK5 A;  4BOS C;  1IPG A;  2ZVO A;  2KMA A;  2KWU B;  3QAR A;  2K2J A;  4MDK E;  1LB1 A;  4DX8 A;  4GXB A;  4TUU A;  2V4L A;  2PE6 B;  2KJR A;  1NI2 A;  2LOX A;  2L2I A;  1TGZ B;  3DQV A;  3PVW A;  2L00 B;  1DDM A;  1WM2 A;  2CQU A;  2RGF A;  1TJ6 A;  1ZVR A;  1C3T A;  1GC7 A;  2IY1 B;  3H1U A;  1WJU A;  2JUO A;  2LVQ A;  2DHJ A;  2MKR A;  4E71 A;  4DBG A;  2EC1 A;  1RFA A;  4AP4 C;  4MJS A;  2J7Q B;  1U2B A;  4MSM B;  4ZRJ A;  3UIO B;  1GJZ A;  5AZF A;  1AQC A;  3SU8 X;  2K25 A;  2CAY A;  2KCJ A;  2KKC A;  1XT9 B;  2M1M A;  1Q67 A;  1P9D U;  2NMB A;  5TR5 A;  2N7E A;  1V5M A;  4IG7 B;  3AU4 A;  2K39 A;  2EMT A;  2JVC A;  3P6A A;  3O65 B;  3ML4 A;  1L2N A;  2MBO A;  5D6J B;  1DYN A;  4HDQ A;  1PFJ A;  4I6N B;  2KNB A;  1WIA A;  3CSF A;  2NBW B;  4KVG B;  2ELB A;  1U5F A;  2KTR B;  1E8Y A;  4L6E A;  4ICU A;  5CHW A;  2AYO B;  1DDV A;  2KMC A;  3IFW B;  2R09 A;  3AUL A;  4M0W B;  2ZNV B;  4WJO A;  3TFM A;  3Q3F A;  2Y8G A;  3SYX A;  2RVB B;  2LGY A;  3UF8 A;  3PRP B;  1UEF A;  1VD2 A;  3H7P A;  1V88 A;  4G3X B;  1WX9 A;  3JW0 X;  5CHV C;  2MSE D;  2D11 A;  5JHG A;  2NPT A;  2K2U A;  3DBL I;  4ZYN A;  2DKP A;  1YX6 B;  3ZNG C;  1Y5O A;  3X23 A;  3KUZ A;  4F7G A;  4ICV A;  3HIZ A;  2A5U A;  1J0G A;  2L8J A;  2Y8F A;  3W1S A;  5C16 A;  3L17 A;  3TCA A;  5HE1 A;  4KHO A;  2GBM A;  2P0H A;  1WXM A;  3WYF B;  5AEK B;  1BAK A;  1WXS A;  2IO0 B;  3BIN A;  4MGY E;  1RRP B;  2NVU I;  2FJ9 A;  1ZC4 B;  1XX0 A;  1V81 A;  1NU2 A;  2LBB A;  1HE8 A;  5AZH A;  5D3V A;  3DVG Y;  3VFK A;  4NQL B;  3ZTD A;  2N1W A;  1U5D A;  4LDT D;  1WJM A;  1EF5 A;  4IWP A;  3RCZ A;  1WGU A;  2YF0 A;  1WE6 A;  3SV1 A;  2FJL A;  1FOE A;  3QWM A;  3L0W B;  2KDI A;  1H4R A;  4D0N B;  2QHO A;  1FHW A;  3SUZ A;  4HK2 A;  2MRP A;  3TVV A;  4PQ0 A;  5G2N A;  3K9P B;  1S1Q B;  4HB0 B;  2HE7 A;  4A3O A;  1V5T A;  3APD A;  3PZD A;  4MSQ B;  3L08 A;  4II3 B;  3WAP A;  4GMV A;  2MBB B;  2R0D A;  2NBU A;  1DDW A;  1FGY A;  1NBF C;  3AXC A;  1V61 A;  2KJ6 A;  4XX5 A;  1OQN A;  4IWQ A;  1MIZ B;  2O2V A;  1QQG A;  1WI1 A;  1UPQ A;  2XQN M;  4KHA A;  4KZ0 A;  3VUW A;  1OEY J;  4DDG D;  1X1F A;  1E7V A;  2LXC A;  1PMS A;  3NOB A;  2RLO A;  5EFX A;  4MEM A;  1WJ4 A;  2COC A;  3ENE A;  3MHS D;  4DHJ B;  1T0Y A;  3NS8 A;  2RUK B;  4DK5 A;  1V5P A;  2Z0P A;  3KSY A;  4NY0 A;  4P7I A;  3PP2 A;  1W1H A;  2XBB C;  5J3Q A;  4IM0 A;  2L0F A;  3F5R A;  2KFK B;  4G50 A;  4HAW B;  1SGH A;  3A8P A;  2MWS B;  4B9K A;  5DPW A;  5JLJ B;  1RLF A;  1WJN A;  3PSC A;  4A6H A;  2DZI A;  3QBV B;  2OOB B;  4K7W A;  3DPD A;  1Z2M A;  3N7C A;  2DFK A;  2COP A;  4ZRI A;  2HJ8 A;  2LRU A;  1KZG A;  3H6N A;  3GOE A;  4MK0 A;  2N23 A;  1NTI A;  4F7Z A;  2LJ5 A;  5DCN A;  1SHC A;  4EZK A;  1WXV A;  4FJV B;  3R66 C;  3APF A;  1OTR B;  4KIK A;  1ST7 A;  1WMH B;  4W9D A;  4IFS A;  3PPA A;  3DVN V;  3PT2 B;  3B0A A;  4W9L A;  1YQB A;  2PE9 A;  4X57 B;  2L3Z A;  4LJP B;  3M1I B;  4HAV B;  3RZW C;  1X05 A;  3QQ8 B;  4GSW A;  1I35 A;  4XZ4 A;  2KXJ A;  3V60 A;  2DYO A;  2DHI A;  4HB4 B;  1W1G A;  1LXD A;  3KW5 B;  4ANV A;  2H7D A;  3VDZ A;  1OEY A;  4W9K A;  4RM9 A;  1EVH A;  1FHO A;  3N30 A;  3D32 A;  2J59 M;  2DEN B;  2K6D B;  5LXH A;  3H9D A;  2UWQ A;  3ZNZ B;  1C1Y B;  5JP4 A;  1E5W A;  1R4N I;  5GMV A;  4KHB B;  2RQ1 A;  1UNQ A;  2DYN A;  1BT0 A;  2R2Q A;  3FLV A;  5LXI B;  2CKH B;  3HW2 B;  4G11 A;  3OAW A;  5E6N A;  1UH6 A;  3CF6 E;  3U8Z A;  2MP2 B;  3RYT A;  3PHW B;  4GDL A;  4DBB A;  3IG3 A;  3TMP B;  1I42 A;  2LD9 A;  1E7U A;  4K2O A;  4HPL B;  2DAF A;  1W1D A;  2C9W B;  3KVF B;  1WX7 A;  1UEL A;  2BYV E;  2DYB A;  3MTN B;  3ONS A;  4GOC A;  2NZ8 B;  2N9X A;  3PVU A;  3A9K B;  2EMS A;  1IP9 A;  3JSV A;  2J0J A;  5HE3 A;  4BBN C;  3DCG A;  1M7R A;  4F7U P;  3VHT C;  1WGG A;  1WR1 A;  2WYQ A;  1ZM0 A;  4GPT B;  1UPR A;  2BGF A;  4CHM A;  5J17 A;  2D9V A;  2P8V A;  1WVH A;  4FUL A;  2LOZ A;  5LLI A;  1MKE A;  2KDB A;  3AI5 A;  5KHO A;  3ZKJ C;  2KWV B;  2KZR A;  3WAO A;  4A20 A;  5DI9 B;  1P3Q U;  1V89 A;  3ODX A;  1OGW A;  1J8C A;  3D8E A;  5C5B B;  2MW5 A;  3AU5 A;  2C7N B;  2N1V A;  3ZNH B;  3A9J A;  4WVF B;  2DN6 A;  1EGX A;  5DHF B;  4ASW C;  1I7A A;  3R3M A;  4JLC A;  3ZTC A;  3KUC B;  2M38 A;  5DHA B;  1P1A A;  4ANU A;  5JHH A;  2VRW B;  1XKE A;  1K8R B;  2BKF A;  4FJZ A;  3SNH A;  4KDL B;  2COA A;  2IYB A;  2FCN A;  3WIM A;  2G4D B;  1U29 A;  4AUQ C;  3UQB A;  1WGH A;  3B08 A;  2M14 A;  1GG3 A;  4TQ1 A;  2QKM A;  2HTH A;  2M4N A;  3VTV A;  4TYZ A;  1UBQ A;  4K2P A;  2CR5 A;  3PVL A;  1QC6 A;  3KUD B;  1HB6 A;  3ALB A;  4PYU A;  3IHP C;  3KRX A;  2LKO A;  4NPN A;  3A8Q A;  1WZ3 A;  3SHQ A;  3QWZ B;  2FID A;  4BKT A;  1X1G A;  3HM6 X;  2D07 B;  2GMI C;  3M3J A;  3RT3 B;  5J2R A;  4HPM B;  3VUX A;  5JHB A;  4GZU A;  1MPH A;  2CU1 A;  3ML8 A;  4NJ7 A;  2DX1 A;  2UVM A;  3JVZ X;  3FP5 A;  2YSZ A;  2JPH A;  4TV3 A;  2D9Y A;  2OQB A;  4HCN B;  4A3P A;  1ZC3 B;  3CXB B;  1M94 A;  3PLU A;  3DBR I;  2G3Q B;  2V76 A;  1OY2 A;  5JZE B;  2BWE S;  4EZL A;  2CY4 A;  4NSW A;  4YL8 A;  2RSG A;  2I1J A;  4XWX A;  1K5G B;  2YT1 A;  1XOD A;  3KZ1 A;  3H7P B;  2KOX A;  3BY4 B;  2WWZ A;  2QKL A;  3DXD A;  2EJ8 A;  2NPT B;  2LG1 A;  2GCJ A;  4W9I A;  2ZEQ A;  5JH5 C;  3MJW A;  3S2A A;  3VTW A;  4NJ6 A;  1V80 A;  1PLS A;  1UBI A;  4IWO A;  4GN1 A;  4IC7 B;  4ZRK A;  1GNU A;  5D3W A;  1WI0 A;  5DPS A; 
#chains in the Genus database with same CATH topology
 2KVR A;  2GS0 A;  3VQI A;  2BYE A;  3U7D A;  3WAN A;  3EFU A;  2RRF A;  4L2Y A;  4XDD A;  3BYT B;  4OW0 A;  2WXH A;  4I6P A;  3W1Y A;  3FVC A;  2JYT A;  2YS5 A;  3PTF C;  1ZPS A;  3NVZ A;  2Z8L A;  3URY A;  3U30 A;  4JK9 A;  2ZJD A;  1E90 A;  3GB1 A;  4GGQ A;  3AE9 B;  3Q3M C;  2D2Q A;  2P0D A;  2KAN A;  4XWW A;  2WXQ A;  2N0Y A;  4ANX A;  3KY9 A;  3HK0 A;  2DKQ A;  4L1R A;  4HAZ B;  2BQQ A;  2W2W A;  5L83 A;  2J52 A;  1TS5 A;  2W54 A;  3IAS 1;  3UI3 A;  2J0M A;  2BF8 B;  2RGN B;  2EKE C;  4AOF A;  4NAW A;  3ZUN A;  2C7H A;  1VZ7 A;  4DHJ D;  3U12 A;  4EMO A;  4PNK A;  2FDQ A;  2X8X X;  1ZE3 D;  2AWT A;  2BS3 B;  2LI5 A;  3A4R A;  1TZ1 A;  1IRS A;  2WH5 A;  4WH4 A;  2LHD A;  3Q3O C;  4HAX B;  1XQQ A;  3MJ5 A;  4WUR A;  1RRB A;  2KWC A;  1IYF A;  2MX2 A;  1KM7 A;  3KRW A;  3H8H A;  1ZYI A;  1MI1 A;  1C79 A;  3OJ4 B;  1TTN A;  1L7Y A;  1LQB A;  3QX1 A;  4W9J A;  1LW3 A;  1D3Z A;  2D4Q A;  3NZU A;  2M19 A;  4DDI D;  1STE A;  2V1Y A;  2Z0Q A;  2ZNV C;  5CTR C;  2JY6 A;  4GU2 A;  3DCX A;  1N61 A;  3BZD B;  1L5P A;  2KN5 A;  4YXD B;  1N6Z A;  1DIK A;  2Z0E B;  4E3C A;  3H7S A;  2IZV B;  2B76 B;  1HTQ A;  1A70 A;  4A90 A;  2AQ3 B;  2ZCC A;  4LCD E;  2O2V B;  2D9Z A;  1H8C A;  3ZVR A;  1TZO A;  3QJZ A;  2JF5 A;  1J7C A;  1KOT A;  3VH3 B;  4KDI C;  2BS2 B;  2DWQ A;  3RNG C;  2DLB A;  4MT7 A;  1JRO A;  2N9P C;  4K17 A;  4LDT B;  4TQ0 A;  5BMG A;  5HE0 A;  2L7R A;  2PKO A;  1IUE A;  2X0S A;  4KSL C;  2RPQ A;  3D8D A;  1AAR A;  5D27 A;  3UIN B;  1L4Z B;  1D5Z C;  2V3P A;  1WGQ A;  4WAF A;  2KUP A;  1Q5W B;  2K8C A;  4TKN A;  3MDB C;  4Z2N A;  2CHZ A;  2QSD A;  1MI0 A;  3I63 C;  4KV2 A;  1WFY A;  1NTY A;  3KYD D;  2BB6 A;  1KZ7 A;  1V5U A;  4WWN A;  2WXM A;  1XD4 A;  4IAP A;  2K6Q A;  2WXR A;  2Z59 A;  3C0R B;  1S3S G;  3QK0 A;  3L10 B;  3VRB B;  3ZVV A;  1HEZ E;  4AWJ A;  4R3D A;  2KVZ A;  3FKY A;  3NW8 A;  2BPS A;  4IUM B;  2FIF A;  3BYY B;  4JL9 A;  1I4R A;  1IBX B;  1H10 A;  3ULC A;  2KC2 A;  3QA8 A;  1SJE D;  1FXI A;  2YT2 A;  1WWT A;  2JXT A;  3LB8 C;  4FXC A;  1ACC A;  1V5O A;  2Y5C A;  4C80 A;  3ZGZ A;  1JWS D;  1JRU A;  4JWU C;  3V6E B;  2LVO A;  1WZ0 A;  2REX A;  1XLO A;  4HSI A;  2DZJ A;  2HRJ A;  4NQK E;  3CMM B;  4RNA A;  2GBN A;  4DWF A;  3Q14 C;  3R8B A;  1T77 A;  4HAU B;  1QT9 A;  1WF9 A;  3DHH C;  4I6L B;  2UZS A;  2KFJ A;  4MY6 A;  4ZRP A;  1LM8 B;  2Y5B B;  2WDT B;  3HVZ A;  4BOZ B;  3QHT A;  3AE3 B;  2HTM E;  1BXT A;  4FBJ B;  4GDK A;  2ASQ A;  4URK A;  3IBE A;  4US8 A;  2C60 A;  4Z2M B;  2KJH B;  2WDR B;  1FAO A;  4WWP A;  2LFI A;  3E66 A;  5LOP B;  4HXD A;  3CST A;  5G5H A;  2WU2 B;  4WJN A;  1YJ1 A;  2JYE A;  4IOY X;  3ZLZ A;  1WMH A;  4OVU A;  1JQ4 A;  1PGX A;  3A1Q A;  3FIL B;  1V97 A;  4KIK B;  5DH9 B;  2CHW A;  1KI1 B;  3WA0 A;  1IGC A;  2KAJ A;  1TBE A;  3RUL A;  1WYG A;  2ZZP B;  2HD5 B;  5IAA C;  1NEN B;  4BZA A;  4S17 A;  2W82 A;  4A6K A;  4AJW A;  1Q0W B;  1KLV A;  2BS4 B;  2W9N A;  1WRD B;  3DBH I;  5I2M A;  4WSF A;  2AEH A;  4B95 A;  4GIV A;  4BKS D;  3RUI B;  1OMW A;  1YJI A;  4II2 B;  3PG7 A;  2D3A A;  4YTN B;  4JKH A;  2ZPY A;  1B9R A;  4HCP B;  1T0R C;  2D3G A;  4XGA B;  4LNI A;  4HLE A;  3WAL A;  2JRI B;  3VUY A;  3PRE A;  3KH0 A;  2RNR B;  5BMI A;  4MEL A;  4FJY A;  2KLC A;  5LNK 1;  2MFQ A;  5M4Y B;  4G0N B;  2MCN B;  2DLW A;  2FAZ A;  2O6V D;  5IKC M;  5L81 A;  1QOA A;  3NWD A;  1EAZ A;  5HKH A;  1CMX B;  3ZQ4 A;  3NWF A;  3WAM A;  1F2R I;  3AE6 B;  1FEH A;  3ZIM A;  4KHB A;  1N3H A;  1EUV B;  1JWB D;  2ZVN A;  5FKA C;  2QIL A;  1PGA A;  1XR0 B;  2EKI A;  1FNU A;  2XEW A;  3AM9 A;  2KYW A;  4JGH B;  2IFS A;  2MWN B;  3ZXV A;  4CO7 A;  3PHX B;  1SIF A;  2FUH B;  4MM3 A;  2INN E;  3EGR A;  4JKD A;  5BYS A;  4A6F A;  3MC8 A;  4MAC A;  1QZE A;  4B6W A;  1JWM D;  3NUH B;  3Q69 A;  2M56 B;  3EC8 A;  1U5E A;  4JQW C;  3U2S C;  1JCK B;  3O96 A;  4HAT B;  5KQ1 A;  2DX5 A;  4F7H A;  3ZJT A;  2KQS A;  3TW1 A;  3MC0 B;  3RNC C;  3OJ3 A;  2RPV A;  4GDL B;  1FFU A;  2LUM A;  2MJE A;  2P0F A;  3N3K B;  3L13 A;  4DX9 0;  4RMA A;  1HZ5 A;  3NWA A;  1P0R A;  3VVW B;  1UD7 A;  1P6S A;  3P4Q B;  2K5P A;  4EE2 A;  1ISN A;  4W9H A;  2NR2 A;  3PV1 A;  3N9Y C;  4LJO B;  2LGD A;  1TXD A;  4B0M A;  1UZX B;  3O13 A;  2RMM A;  1YJJ A;  2K00 A;  5GXG B;  4EZJ A;  4D6W A;  4HEA 1;  3AJ4 A;  3JSV B;  3A33 B;  2A4Z A;  2O6V A;  5IOI A;  2IGD A;  2Z13 A;  4IDI A;  4ARC A;  1NDD A;  1EF1 A;  2GUM A;  2D10 A;  2I1K A;  3SDL C;  4WAA A;  1SB3 C;  2R82 A;  5LG4 B;  4HB2 B;  1P3R A;  1MIX A;  1WYW B;  1DBH A;  2NTT A;  1WM3 A;  1B55 A;  4WIP A;  2KT7 A;  2C5L C;  1Z5S B;  1VLB A;  4C0A A;  4W9G A;  4ANW A;  1M4V A;  2OJW A;  2G9H D;  1NTV A;  3Q3N C;  5I4D A;  2INC C;  4CSQ A;  2OED A;  2KMM A;  4LNK A;  4GMX B;  2KO3 A;  3NHE B;  3NZS A;  3FEH A;  2MA9 B;  3Q8E A;  4KGR A;  3BII D;  1YN4 A;  1WXA A;  1U5G A;  3VTU A;  2XK5 B;  3B1L X;  3DDC B;  3V61 A;  1AWE A;  3RFZ B;  4KGT A;  2WXJ A;  1TS2 A;  4RF1 A;  4M8M A;  4DQO C;  2L76 A;  3ZO5 B;  3AMZ A;  5C5B A;  4FLH A;  3VXW A;  1BTN A;  1TQZ A;  3J9C A;  1UNS A;  1XCG A;  1MAI A;  3A9J B;  3DVN U;  5I2S A;  3ZDM C;  4S0R A;  1L4D B;  3ULB A;  4BBK A;  2L05 A;  2WX1 A;  2QJL A;  5D2M B;  3GYO A;  4DXF A;  4XWT A;  3AED B;  2IGG A;  4HB3 B;  5J18 A;  3GYP A;  2L32 A;  1K52 A;  4P16 A;  3T06 A;  4BVU C;  2J0K A;  3PS6 A;  2WX0 A;  1V9J A;  2NCN A;  4J6I A;  2Z0D B;  1F1H A;  3OAN A;  4MGK E;  1SEB D;  3B2F A;  3DBL B;  2LUL A;  1WR6 E;  3ML9 A;  2K1F A;  4RM8 A;  2W2X C;  1WSP A;  4MJS B;  4CHJ A;  2JRH A;  4JKG A;  1EO6 A;  3RNB C;  2B3A A;  3TL5 A;  5IJM A;  3M63 B;  2HTH B;  2CS4 A;  3LJ3 A;  2G35 A;  1ENF A;  2C7M B;  5C2T B;  2UYZ B;  1J0W A;  1X11 A;  2MJD A;  1FGZ A;  1E8X A;  1L0Y B;  2VZK D;  4CHK A;  2Z14 A;  4LLG M;  2N9E B;  2KD0 A;  1D4B A;  3CWI A;  1Q1O A;  1Y19 B;  3VOQ A;  1AN8 A;  4ILJ A;  3ECI A;  2JP2 A;  1WGD A;  2L0T A;  2KUQ A;  4K7U A;  4MH0 E;  4YTP B;  2Y7B A;  3AE5 B;  2LMC A;  1YIW A;  3L54 A;  2BT6 A;  3EHV A;  1OQQ A;  1YX5 B;  3P2B A;  1F9J A;  3FSS A;  3IXS A;  3BVZ A;  1D5X C;  5E6P A;  1A5R A;  4W9F A;  2BKR B;  2K8B A;  4PS3 A;  4JKA A;  2M0X A;  4QJ5 B;  2KTF A;  3FAH A;  2NTS A;  4ZDV A;  5FR3 A;  2PJH A;  1R7S A;  2LVP A;  2JXX A;  1XCT L;  2KTR A;  3NSU A;  1V86 A;  2Y3A A;  5IA7 A;  3E9P A;  4BBN F;  4B0E A;  4M0W A;  4DXA B;  3DXC A;  1KLU D;  1N5W A;  5IRS A;  1ACA A;  1YQ4 B;  5DPT A;  5HE2 A;  4HHV A;  2DIK A;  1C77 A;  1HXY D;  2IO1 B;  1B1Z A;  2FUG 1;  4OVV A;  2CHX A;  2MHJ A;  1FFV A;  1OQY A;  5HFY A;  2H88 B;  1P98 A;  2JWU A;  3VIA A;  4QJ3 B;  4KKI A;  4JKF A;  3AEA B;  4N6E B;  1SXT A;  1BML C;  3E56 A;  2DBY A;  1WGR A;  4HAY B;  2X18 A;  2MLB A;  1ZSQ A;  4KZC A;  4NNJ B;  1M7E A;  1TY2 A;  1ZP0 B;  2V4I B;  1MK9 B;  2JWZ A;  4MGZ E;  2ACZ B;  4YTM B;  2ABD A;  3AE1 B;  2GCL A;  4L23 A;  2L1C A;  3D8F A;  3OWE B;  2R2O A;  4WWO A;  1VR9 A;  4ZOH C;  4BAX A;  2V0G A;  3T9L A;  3P4R B;  1K53 A;  2ELA A;  4XE0 A;  1U4A A;  1BTK A;  2DHK A;  1XCQ L;  4N59 A;  1R4M I;  2LEK A;  5DIF B;  1T3Q A;  3E9S A;  3V5W A;  3QAQ A;  2WP9 B;  5EDS A;  2KK8 A;  4HJK A;  2GJY A;  2DYQ A;  1UNR A;  2PVO D;  2WXK A;  2GOW A;  3AEE B;  5G55 A;  2MBH A;  1BWN A;  1WRI A;  3RZF A;  1WGY A;  3ZRC A;  1RJ2 A;  1N62 A;  1TJE A;  4K1R B;  3SD5 A;  3TEZ A;  2KDM A;  3BVG A;  1MHX A;  2YLM A;  5MPO A;  4CYE A;  1Y56 A;  3EPY A;  5AZG A;  3AEG B;  3DWM A;  5E6O A;  3N1Z C;  2UZR A;  2JZ3 B;  5CX3 A;  2DTC A;  3HHM A;  3TBL D;  1LFD A;  2HDE A;  3N32 A;  4IM3 A;  1FXA A;  5D3D A;  1YD8 U;  3HQC A;  2CY5 A;  4KAX B;  2N4F A;  1QKZ A;  4H8S A;  4LTU A;  4HVB A;  1E6E B;  1KJT A;  2XN9 C;  2E3T A;  4FHK A;  4PYZ A;  3VR8 B;  2GBJ A;  3HM3 A;  2K0P A;  1PDX A;  2FCQ A;  1GPX A;  1C4P A;  2YEP F;  3UZT A;  4TSS A;  1FO4 A;  5FK9 C;  4EJN A;  1WJ6 A;  1HB8 A;  4K7S A;  4KGS A;  4IW0 A;  1GUA B;  4NAW B;  3I3T B;  3IAM 1;  1T6B X;  3RCP A;  2KWD A;  4PS8 A;  3RD2 A;  3DXE A;  4XC2 A;  3SBT A;  3DVG X;  3OLM D;  2VKI A;  2V3S A;  2MDX A;  2DHZ A;  3VH4 B;  2WXL A;  4HWI B;  3LDZ E;  2KLG A;  4WQO B;  2IND C;  2GLS A;  5GOW B;  1YN3 A;  2LYD A;  2IYD B;  1MG8 A;  4FHJ A;  5D3Y A;  3Q8C A;  2MJ3 A;  3A58 A;  3W2D A;  3ZW3 A;  1K5D B;  2KQ7 A;  2CB8 A;  1FMA D;  3AE8 B;  4EEW A;  3PLV A;  2ROZ B;  2YS1 A;  1T5X D;  4HJG E;  1GC6 A;  1SE2 A;  2PVG C;  4N9F 4;  2OTX A;  4RFB A;  3C8Y A;  1RFK A;  3AE2 B;  1T0S C;  1U27 A;  2I5C A;  2OJR A;  1NYQ A;  1ZGU B;  1VRA B;  4DHZ E;  4FA6 A;  3KYC D;  1RM6 C;  1X1M A;  2LRW A;  2MQJ A;  4ZRQ A;  1ZXI A;  1ZDX A;  3EEC A;  3R2I A;  4WJP A;  2D3B A;  1L6U A;  1FHX A;  2YT0 A;  2WS3 B;  2SAK A;  4MGI E;  5IP4 D;  1ZW7 A;  2IO2 B;  3WCQ A;  3TO1 A;  4PK1 A;  3CIR B;  3Q2A C;  3RN9 C;  1N60 A;  3RMK C;  4EOY A;  1V49 A;  4RGT A;  4HDO A;  2D3C A;  4FAD A;  2KGX B;  3BK1 A;  1WE7 A;  5KHQ A;  4WJQ A;  3F0W A;  2QC8 A;  3AEF B;  2KFK A;  5D7G A;  1QIL A;  5E6J A;  1MG4 A;  2ROV A;  2DAJ A;  3GZN I;  1P5T A;  4W9E A;  2IGH A;  3MP9 A;  1F77 A;  1VJK A;  2DZK A;  3VAW A;  3W1S C;  3T8M A;  2KX3 A;  4B6H A;  2COF A;  2X38 A;  3UIP B;  1XEE A;  2Z59 B;  4RH6 A;  3G9W A;  1VZ6 A;  1EM7 A;  1ZKH A;  3I9V 1;  1SE9 A;  4WWM A;  3ZDT A;  3K9O B;  2G45 B;  4JIO U;  2Q13 A;  4ZHO A;  4C7Z A;  1TS4 A;  2LZ6 A;  2BYF A;  3V6C B;  2LXA A;  2ZCB A;  4A8X C;  4YT0 B;  3N20 C;  4GB9 A;  3ZNI D;  4RCO A;  3A4S C;  2G1E A;  2IY0 B;  1R4N B;  1YN5 A;  2KDE B;  1ROE A;  4P6V F;  4QAY A;  2H89 B;  2VSZ A;  5J3Y A;  2VH1 A;  5L95 C;  2JT4 B;  3HSA A;  3IVF A;  1PQS A;  5AUI A;  3AH7 A;  3TIX A;  1NI3 A;  2YRY A;  2GBK A;  2LAS A;  2COD A;  3V62 A;  3ODW A;  5FR6 A;  1KFY B;  2KHW B;  3MHZ A;  3R7R A;  4AJY B;  4EKU A;  5C6R A;  2KX0 A;  4F1S A;  3ODO A;  1HZ6 A;  2M8S A;  4GDK B;  5C23 A;  4ACF A;  3QIJ A;  3UGB B;  3P7Z A;  3R7Q A;  5EE3 A;  2FJU B;  3U52 E;  3X0W A;  2W2X D;  1UUP A;  3PGE A;  3BJI A;  3P4S B;  1SF0 A;  2MBE A;  4IM2 A;  2LWP A;  2YS3 A;  5CLQ B;  2ICI A;  2Z0O A;  3FIL A;  2JQR B;  1DRO A;  1JWA D;  2RD0 A;  3Q3J A;  1UNP A;  3PRM B;  3UQA A;  2FCM A;  3PRZ A;  2H7E A;  1HQR D;  4PS7 A;  3A1Q B;  4EFO A;  4AQ7 A;  2GRI A;  5BO4 B;  4DXG A;  1YMH E;  2VRR B;  5J3T A;  2KDF B;  4W9C A;  3VR9 B;  4MT5 A;  1Y8R C;  2K8H A;  2LGX A;  2IBI B;  4WJ7 A;  3W5V B;  4E74 A;  5CLL B;  2GBR A;  4Y94 A;  2G4S A;  2D9X A;  5KQ4 A;  1WX8 A;  2PEA A;  4EUT A;  2PPH A;  4UDU C;  2KR0 A;  3Q8B A;  1HA5 A;  5H92 C;  1WH3 A;  3LJU X;  1G6J A;  3OG5 A;  4BFR A;  3TJP A;  2D9W A;  3CIK A;  3I5J C;  1VCB A;  1AWD A;  2E2X A;  4GNK B;  5D3X A;  1V6E A;  5FI1 A;  2WXP A;  1F0Z A;  2N7D A;  4OHJ A;  1FB8 A;  1JW9 D;  2ADZ A;  1SBB B;  3DOW A;  1EU3 A;  2BTE A;  3L16 A;  4ITK A;  3DBS A;  2KQ4 X;  4C7Y A;  5C79 A;  5DPR A;  4HPP A;  1NVL A;  4K81 A;  1WG7 A;  1P7E A;  2BWF A;  2NS5 A;  4JK7 A;  4BKG A;  3NS1 A;  1E8W A;  1I2H A;  4KSK C;  2RR9 A;  2AL6 A;  1E8Z A;  2RSU A;  2D5G A;  3Q8F A;  4HKZ E;  2W55 A;  3M62 B;  2DZM A;  4OZC A;  1GB4 A;  5CHF A;  2RDB C;  3ZYY X;  2I5F A;  2MP2 A;  1ZOY B;  2M17 A;  4YSZ B;  4MM3 B;  5D94 A;  4BKS A;  2YVC A;  4A6F B;  1FXT B;  1EU4 A;  1JAL A;  2VH2 A;  1ET9 A;  4QXA B;  1DOI A;  2WXI A;  4A55 A;  2DYM A;  2DX5 B;  4QJ4 B;  5FI0 A;  2DA0 A;  3A98 B;  5C1Z A;  4FN2 A;  2NBV B;  3LYY A;  1XD3 B;  2BCJ A;  1TIF A;  3A9K A;  3MC9 A;  3HUI A;  3MPX A;  2LUE A;  4N58 A;  3NY5 A;  2JZZ A;  3APC A;  4F8C B;  1WY8 A;  4A6Q A;  1UF0 A;  1YOV B;  2FCS A;  3QCA A;  3FM8 C;  3ABV B;  2KC1 A;  2ZPN A;  2FNJ B;  4JE3 B;  5BYR A;  4A5K A;  4YSY B;  1FRD A;  2CRF A;  5BMH A;  2AL3 A;  2O6V B;  3RNA C;  1JWU D;  1HBK A;  1WJ1 A;  1ET6 A;  4YON A;  1RYJ A;  3ZRF A;  3PEG A;  2IO3 B;  4M8N A;  2BYT A;  1X86 A;  1MK7 B;  3QC8 B;  3NVY A;  4YWG G;  4DHZ B;  2N9L A;  3JYU A;  5KCV A;  1V2Y A;  1RAX A;  1J19 A;  1Z87 A;  2Q5W D;  3M95 A;  5LON B;  3PSE B;  3AE7 B;  1UGM A;  1V8C A;  2OHF A;  3SO6 A;  5JHA A;  2MBQ A;  2PZ1 A;  3GE8 C;  2N7J A;  2XK5 A;  4BOS C;  1NVI D;  1I4P A;  1IPG A;  2ZVO A;  4TMA B;  2KMA A;  2KWU B;  3DBR B;  3SBG A;  3QAR A;  1UWM A;  2K2J A;  4MDK E;  3PZ7 A;  1SJH D;  1LB1 A;  4DX8 A;  4GXB A;  4TUU A;  1TS3 A;  2V4L A;  2PE6 B;  2KJR A;  1NI2 A;  2LOX A;  1QOF A;  2L2I A;  1TGZ B;  3DQV A;  3PVW A;  4P1B C;  4M01 A;  1JRP A;  1V1O A;  2L00 B;  1TYG B;  1DDM A;  3R2T A;  4PT5 A;  1WM2 A;  5TSS A;  2CQU A;  2RGF A;  1TJ6 A;  1ZVR A;  1C3T A;  1GC7 A;  2IY1 B;  3NJT A;  3H1U A;  1FIQ A;  1WJU A;  2JUO A;  2LVQ A;  2DHJ A;  2WDV B;  2MKR A;  4E71 A;  4DBG A;  2EC1 A;  4M02 A;  1RFA A;  4AP4 C;  4MJS A;  2J7Q B;  1U2B A;  4MSM B;  4ZRJ A;  3UIO B;  1GJZ A;  5AZF A;  1AQC A;  2N9K A;  3SU8 X;  4ZHP A;  4JKG B;  2K25 A;  4HRO A;  3VRA B;  2CAY A;  2KCJ A;  2KKC A;  1V1P A;  3B77 A;  2N0S B;  3LXF A;  1FRR A;  1XT9 B;  2M1M A;  1Q67 A;  3NRZ A;  4JWS C;  1P9D U;  2NMB A;  5TR5 A;  2N7E A;  5AUK A;  1V5M A;  4IG7 B;  1E7P B;  3AU4 A;  2K39 A;  3GP7 A;  4NZL B;  1K50 A;  2EMT A;  2JVC A;  3P6A A;  1IGD A;  3O65 B;  4D2K A;  3ML4 A;  1L2N A;  2MBO A;  4ARI A;  5D6J B;  1DYN A;  4HDQ A;  1PFJ A;  4I6N B;  1AW7 A;  2KNB A;  4RGN A;  1FD6 A;  1WIA A;  3CSF A;  3C19 A;  3B2G A;  3TEX A;  2WNM A;  4YSX B;  2NBW B;  4KVG B;  2ELB A;  1U5F A;  2KTR B;  1E8Y A;  4L6E A;  4C00 A;  4ICU A;  2WQY B;  5CHW A;  2AYO B;  1DDV A;  3NVW A;  2KMC A;  3IFW B;  4C4V A;  2R09 A;  3AUL A;  4M0W B;  2ZNV B;  4WJO A;  4A9A A;  3TFM A;  1I4X A;  3Q3F A;  1BUI C;  2Y8G A;  2M0A A;  3SYX A;  2RVB B;  4JKE A;  1YQ3 B;  2LGY A;  3UF8 A;  3PRP B;  1UEF A;  1VD2 A;  2SEB D;  3H7P A;  1V88 A;  4G3X B;  1WX9 A;  3JW0 X;  1MFW A;  1D6E C;  5CHV C;  2MSE D;  2D11 A;  5JHG A;  2NPT A;  2VZK B;  3L4P A;  2K2U A;  3BVM A;  1CK1 A;  2KIG A;  1KLG D;  3DBL I;  1QF6 A;  4ZYN A;  2DKP A;  1YX6 B;  1XF5 L;  3ZNG C;  1Y5O A;  3X23 A;  3KUZ A;  4F7G A;  4ICV A;  1AYF A;  4AS1 A;  4Q2J A;  3HIZ A;  1KF6 B;  1KRH A;  2A5U A;  1J0G A;  3SR6 A;  2L8J A;  2Y8F A;  3AN1 A;  3W1S A;  5C16 A;  3L17 A;  1FCC C;  3TCA A;  2K3U A;  3P4P B;  5HE1 A;  1QOB A;  3TEY A;  2QIE B;  4KHO A;  3AE4 B;  2GBM A;  2P0H A;  2WDQ B;  1WXM A;  3WYF B;  5AEK B;  1BAK A;  3EFC A;  3I57 A;  1GOZ A;  1WXS A;  4NAM A;  2RDG A;  5T8I A;  2IO0 B;  3BIN A;  3KQ4 A;  4MGY E;  2BB5 A;  1RRP B;  2NVU I;  4USA A;  2FJ9 A;  1ZC4 B;  1XX0 A;  1PGB A;  1V81 A;  1NU2 A;  1MPE A;  4RGM A;  1E9M A;  2W3R A;  3V05 A;  2LBB A;  3BK2 A;  1SIJ A;  1HE8 A;  3GE3 C;  5AZH A;  5D3V A;  3DVG Y;  3VFK A;  4NQL B;  3KLS X;  3ZTD A;  2N1W A;  1U5D A;  4LDT D;  2WHI A;  1WJM A;  1EF5 A;  2L1A A;  2BVC A;  4IWP A;  3GZN B;  3RCZ A;  1WGU A;  2YF0 A;  1DGJ A;  1OQR A;  1WE6 A;  1FPY A;  3SV1 A;  1P7F A;  3EUB 2;  1E10 A;  2FJL A;  1FOE A;  4JK8 A;  3QWM A;  4HRS A;  1L6V A;  2KDI A;  3L0W B;  1H4R A;  4D0N B;  4H2A A;  2QHO A;  1FHW A;  2IPK D;  3SUZ A;  4HK2 A;  2MRP A;  2BW2 A;  3TVV A;  4PQ0 A;  3P1M A;  5G2N A;  3K9P B;  1S1Q B;  4HB0 B;  1MJD A;  2HE7 A;  4A3O A;  1V5T A;  3APD A;  3PZD A;  1F52 A;  4MSQ B;  3L08 A;  4II3 B;  4JPS A;  5EE0 A;  3WAP A;  4GMV A;  1TT5 B;  2MBB B;  1J7A A;  2R0D A;  2NBU A;  2WXG A;  1DDW A;  2CJO A;  1FGY A;  3HIE A;  1NBF C;  3AXC A;  1V61 A;  2KJ6 A;  3W5U B;  4GLS C;  2WLB A;  2XNA C;  4XX5 A;  3W9C B;  2JU6 X;  1XLQ A;  2KN4 A;  1OQN A;  4JKB A;  1MIZ B;  4IWQ A;  2O2V A;  1QQG A;  1WI1 A;  1UPQ A;  2XQN M;  2CJN A;  4KHA A;  4KZ0 A;  3VUW A;  1OEY J;  4DDG D;  1X1F A;  1E7V A;  3E9O A;  1SE4 A;  3FC4 A;  2LXC A;  2WGS A;  2AQ1 B;  1PMS A;  3NOB A;  2RLO A;  5EFX A;  4MEM A;  1WJ4 A;  2LHE A;  2COC A;  3ENE A;  3MHS D;  4DHJ B;  1T0Y A;  2JSV X;  1DOX A;  3NS8 A;  2RUK B;  4DK5 A;  2L83 A;  4LK0 M;  2NMQ A;  1V5P A;  2WU5 B;  1TKY A;  2Z0P A;  1D5M C;  3DBH B;  2PLP A;  1ZDV A;  2KIE A;  3MFG A;  3KSY A;  4NY0 A;  4P7I A;  3PP2 A;  1W1H A;  2UU7 A;  2XBB C;  5J3Q A;  1UGJ A;  1E0Z A;  4IM0 A;  2L0F A;  3F5R A;  4WQM A;  2WXN A;  3NZ3 A;  2KFK B;  4G50 A;  3ZXR A;  5G5G A;  2JZP A;  4HAW B;  1SGH A;  3T3O A;  3A8P A;  3KWV A;  1I4Q A;  1NYR A;  2MWS B;  4B9K A;  1IBX A;  5DPW A;  5JLJ B;  1RLF A;  1PUT A;  4CQN A;  1WJN A;  3PSC A;  4A6H A;  1XLP A;  2DZI A;  3QBV B;  3TUO A;  5IN7 A;  3ZJV A;  2OOB B;  4K7W A;  2K22 A;  2AX5 A;  3DPD A;  1Z2M A;  3IT6 B;  3N7C A;  2DFK A;  2COP A;  2ON8 A;  1N63 A;  4ZRI A;  2HJ8 A;  2LRU A;  3OHM B;  1KZG A;  1TKE A;  2INP E;  3H6N A;  3GOE A;  2J42 A;  4MK0 A;  2N23 A;  1NTI A;  4F7Z A;  2LJ5 A;  1N5X A;  5DCN A;  2ZW1 A;  1SHC A;  3HRD D;  4J3O D;  4M00 A;  4IKG A;  2LGI A;  3AB5 A;  1YNT E;  2IDY A;  3Q6B A;  1WXV A;  4EZK A;  4FJV B;  3R66 C;  3U4E G;  3APF A;  1KBL A;  4KX6 B;  2V3N A;  1OTR B;  4KIK A;  1ST7 A;  1WMH B;  4W9D A;  3DWG C;  3TEW A;  4IFS A;  3PPA A;  3DVN V;  3PT2 B;  3B0A A;  4W9L A;  1YQB A;  2MEK A;  2PE9 A;  4X57 B;  2L3Z A;  2L52 A;  4LJP B;  3AEB B;  3M1I B;  4HAV B;  1C76 A;  3RPF C;  3RZW C;  1X05 A;  3QQ8 B;  4GSW A;  3E9L A;  1I35 A;  2QMT A;  4GOU A;  4JX1 C;  4O1N A;  1VDV A;  4XZ4 A;  2KXJ A;  3V60 A;  2DYO A;  4LNF A;  3SFE B;  2DHI A;  4HB4 B;  1W1G A;  1LXD A;  4OT1 A;  1SE3 A;  3KW5 B;  2DNF A;  4ANV A;  4JKC A;  2EEL A;  5HHD G;  4OZB A;  2H7D A;  3GS2 A;  3VDZ A;  1OEY A;  2ZKM X;  4W9K A;  1K51 A;  4RM9 A;  2V9H A;  1EVH A;  1XO3 A;  1FHO A;  3HVD A;  5BYQ A;  3NVV A;  2ONQ A;  1I7H A;  3N30 A;  3D32 A;  1QQR A;  1FNV A;  4ILH A;  2J59 M;  1LGR A;  2GB1 A;  2DEN B;  1QOG A;  2K6D B;  5LXH A;  2Z4D A;  1C4A A;  3H9D A;  2UWQ A;  3ZNZ B;  2LJI A;  2PTL A;  2WXO A;  4XDC A;  1C1Y B;  4ZYS A;  5JP4 A;  1C78 A;  1E5W A;  1R4N I;  2W3S A;  5GMV A;  3P42 A;  4KHB B;  5EE1 A;  2RQ1 A;  1UNQ A;  2CU3 A;  2K9X A;  4P1C C;  2DYN A;  1BT0 A;  2R2Q A;  3FLV A;  4K3B A;  5LXI B;  4OSN A;  2CKH B;  2FBW B;  3HW2 B;  5JVL A;  2YEP B;  4G11 A;  2J4X A;  3OAW A;  1TY0 A;  5E6N A;  1FM0 D;  1UH6 A;  2KAC A;  3CF6 E;  1C9F A;  3U8Z A;  2MP2 B;  4IOI E;  2QEJ C;  3RYT A;  3PHW B;  4GDL A;  4DBB A;  1JDE A;  3IG3 A;  3TMP B;  1I42 A;  2LD9 A;  1CJE A;  1E7U A;  4K2O A;  1DYQ A;  4HPL B;  2K49 A;  4US9 A;  2DAF A;  1W1D A;  1LO5 D;  1KTK A;  2C9W B;  1WX7 A;  3KVF B;  2NBV A;  2I38 A;  1UEL A;  2BYV E;  2DYB A;  3MTN B;  3ONS A;  1F2R C;  2PW9 A;  1MHH E;  1QLB B;  2NZ8 B;  4GOC A;  2N9X A;  5HI1 A;  3PVU A;  3ENB A;  3A9K B;  2EMS A;  1IP9 A;  4HKQ A;  3JSV A;  2J0J A;  5HE3 A;  3Q8A A;  4BBN C;  3DCG A;  1M7R A;  4F7U P;  2WXF A;  3VHT C;  1WGG A;  1WR1 A;  3BWU D;  2WYQ A;  3B9J A;  1ZM0 A;  1Q10 A;  1HTO A;  4GPT B;  1UPR A;  2BGF A;  4CHM A;  2I2Y A;  5J17 A;  2D9V A;  1FNW A;  1L0X B;  2P8V A;  2PMV A;  5IO9 A;  1WVH A;  1XXG A;  1RWS A;  2LOZ A;  4FUL A;  3IT4 B;  4RGO S;  2MH7 A;  5LLI A;  1MKE A;  1L0V B;  2KDB A;  3AI5 A;  5KHO A;  3ZKJ C;  2KWV B;  2HJ1 A;  2KZR A;  2LGS A;  4LNN A;  5JXV A;  3WAO A;  4A20 A;  5DI9 B;  1SSN A;  1C4C A;  1P3Q U;  1V89 A;  3ODX A;  5H8Y E;  1FCL A;  3DHI C;  1OGW A;  1VZ8 A;  3D8E A;  1J8C A;  5C5B B;  1UWX A;  2MW5 A;  4RF0 A;  3AU5 A;  2C7N B;  2N1V A;  3ZNH B;  3A9J A;  4WVF B;  3RNF C;  1CZP A;  2DN6 A;  2GI9 A;  3V3X A;  1EGX A;  5DHF B;  1MVK A;  4ASW C;  1I7A A;  1XLN A;  3R3M A;  1OFF A;  1VBH A;  4JLC A;  3ZTC A;  3KUC B;  2M38 A;  5DHA B;  1P1A A;  4ANU A;  4MH8 A;  2R2Y A;  2VRW B;  1XKE A;  5JHH A;  4LNO A;  1K8R B;  2BKF A;  4FJZ A;  3U7Z A;  3SNH A;  1VBG A;  2TSS A;  4C56 C;  3RI7 C;  4KDL B;  2COA A;  2IYB A;  2FCN A;  4NJC A;  3WIM A;  1PFD A;  2IJ0 A;  2G4D B;  1U29 A;  2FE8 A;  4AUQ C;  3UQB A;  1WGH A;  3AEC B;  3NG0 A;  3RNE C;  4OVZ A;  3EA6 A;  3B08 A;  2ZW0 A;  3P63 A;  2M14 A;  1GG3 A;  4TQ1 A;  2QKM A;  2HTH A;  1DOY A;  2M4N A;  4XYC A;  1R4M B;  5D3I B;  3VTV A;  4TYZ A;  4L1B A;  1UBQ A;  4K2P A;  2CR5 A;  3PVL A;  2AQ2 B;  1QC6 A;  3KUD B;  1HB6 A;  2K8E A;  3ALB A;  4PYU A;  1KH0 A;  3IHP C;  3KRX A;  2LKO A;  4NPN A;  3A8Q A;  2J53 A;  1WZ3 A;  1V1P B;  3SHQ A;  1EWY C;  3N1X C;  2R61 A;  1GAQ B;  4ILG B;  1ZXH A;  4OZA A;  3QWZ B;  2FID A;  4BKT A;  1X1G A;  3DHG C;  1I4H A;  3HM6 X;  3T3N A;  2D07 B;  2GMI C;  3TSS A;  4REZ A;  3M3J A;  5C3J B;  3RT3 B;  5J2R A;  4HPM B;  4K3C A;  3VUX A;  5JHB A;  4GZU A;  1MPH A;  2CU1 A;  3ML8 A;  3SFD B;  3PO0 A;  4NJ7 A;  1GGO A;  3SEB A;  2DX1 A;  2UVM A;  3JVZ X;  3FP5 A;  2YSZ A;  1ZUD 2;  2JPH A;  4TV3 A;  2D9Y A;  2OQB A;  1J7B A;  5EE9 A;  4HCN B;  4A3P A;  1ZC3 B;  1PYW D;  3CXB B;  1M94 A;  3PLU A;  3DBR I;  2G3Q B;  2V76 A;  1I4G A;  2E6X A;  1OY2 A;  4DIX A;  5JZE B;  4C4V B;  2BWE S;  3AV8 A;  2JX5 A;  4EZL A;  2CY4 A;  3ZJU A;  2QCZ A;  1KC7 A;  4NSW A;  4YL8 A;  2RSG A;  2I1J A;  4XWX A;  1K5G B;  2YT1 A;  1WXQ A;  3ETR A;  1XOD A;  1CQV A;  3KZ1 A;  2RDH A;  2KOX A;  3BY4 B;  3H7P B;  3N1Y C;  2WWZ A;  3KWL A;  2QKL A;  5HG2 A;  3DXD A;  2EJ8 A;  3PZ8 A;  2PIA A;  2QDF A;  1JML A;  2NPT B;  2LG1 A;  2GCJ A;  4W9I A;  1EWC A;  2ZEQ A;  5JH5 C;  3MJW A;  3S2A A;  1TKG A;  1GB1 A;  1ESF A;  3VTW A;  4NJ6 A;  1V80 A;  1WGK A;  1PLS A;  1UBI A;  4IWO A;  4GN1 A;  4IC7 B;  4ZRK A;  1NEK B;  2Y5P A;  1GNU A;  4KKJ A;  1T0Q C;  2BBC A;  5D3W A;  1WI0 A;  5DPS A; 
#chains in the Genus database with same CATH homology
 2KVR A;  2GS0 A;  3VQI A;  2BYE A;  3U7D A;  3WAN A;  3EFU A;  4I6P A;  3W1Y A;  2YS5 A;  3PTF C;  3U30 A;  4JK9 A;  2ZJD A;  1E90 A;  4GGQ A;  2D2Q A;  2P0D A;  2KAN A;  2N0Y A;  4ANX A;  3KY9 A;  3HK0 A;  2DKQ A;  4HAZ B;  2W2W A;  5L83 A;  2J0M A;  2BF8 B;  2RGN B;  2EKE C;  4AOF A;  4NAW A;  3ZUN A;  2C7H A;  4DHJ D;  4EMO A;  4PNK A;  2FDQ A;  2AWT A;  2LI5 A;  3A4R A;  1TZ1 A;  1IRS A;  2WH5 A;  4HAX B;  1XQQ A;  1RRB A;  2KWC A;  1IYF A;  2MX2 A;  1KM7 A;  3KRW A;  3OJ4 B;  1TTN A;  1L7Y A;  1LQB A;  3QX1 A;  4W9J A;  1LW3 A;  1D3Z A;  2D4Q A;  3NZU A;  4DDI D;  2V1Y A;  2Z0Q A;  2ZNV C;  5CTR C;  2JY6 A;  4GU2 A;  2KN5 A;  1DIK A;  2Z0E B;  4E3C A;  3H7S A;  2IZV B;  2ZCC A;  4LCD E;  2O2V B;  2D9Z A;  1H8C A;  3ZVR A;  3QJZ A;  2JF5 A;  1KOT A;  3VH3 B;  4KDI C;  4MT7 A;  2N9P C;  4K17 A;  4LDT B;  4TQ0 A;  5HE0 A;  2L7R A;  2X0S A;  4KSL C;  2RPQ A;  3D8D A;  1AAR A;  5D27 A;  3UIN B;  1WGQ A;  2KUP A;  1Q5W B;  2K8C A;  4TKN A;  3MDB C;  4Z2N A;  2CHZ A;  4KV2 A;  1WFY A;  1NTY A;  3KYD D;  1KZ7 A;  1V5U A;  4WWN A;  1XD4 A;  4IAP A;  2K6Q A;  3C0R B;  1S3S G;  3QK0 A;  3L10 B;  3ZVV A;  4AWJ A;  2BPS A;  4IUM B;  2FIF A;  4JL9 A;  1H10 A;  3ULC A;  2KC2 A;  3QA8 A;  1V5O A;  1JRU A;  3V6E B;  2LVO A;  1WZ0 A;  2REX A;  2DZJ A;  2HRJ A;  4NQK E;  3CMM B;  2GBN A;  4DWF A;  4HAU B;  1WF9 A;  4I6L B;  2UZS A;  2KFJ A;  4MY6 A;  1LM8 B;  2Y5B B;  2WDT B;  4BOZ B;  3QHT A;  4FBJ B;  4GDK A;  2ASQ A;  4URK A;  3IBE A;  2C60 A;  4Z2M B;  2KJH B;  1FAO A;  4WWP A;  4HXD A;  3E66 A;  5LOP B;  3CST A;  4WJN A;  1YJ1 A;  3ZLZ A;  4IOY X;  1WMH A;  4OVU A;  3A1Q A;  4KIK B;  5DH9 B;  2CHW A;  1KI1 B;  3WA0 A;  1TBE A;  3RUL A;  2ZZP B;  2HD5 B;  5IAA C;  4A6K A;  4AJW A;  1Q0W B;  1KLV A;  2W9N A;  1WRD B;  3DBH I;  4WSF A;  2AEH A;  4B95 A;  4GIV A;  4BKS D;  3RUI B;  1OMW A;  4II2 B;  3PG7 A;  4JKH A;  2ZPY A;  4HCP B;  2D3G A;  4HLE A;  3WAL A;  2JRI B;  3VUY A;  3PRE A;  3KH0 A;  2RNR B;  4MEL A;  4FJY A;  2KLC A;  2MFQ A;  4G0N B;  2MCN B;  2DLW A;  2FAZ A;  2O6V D;  5L81 A;  1EAZ A;  5HKH A;  1CMX B;  3WAM A;  3ZIM A;  1N3H A;  1EUV B;  2ZVN A;  1XR0 B;  2XEW A;  4JGH B;  2IFS A;  2MWN B;  4CO7 A;  3PHX B;  1SIF A;  2FUH B;  4MM3 A;  4JKD A;  4A6F A;  1QZE A;  4B6W A;  3EC8 A;  1U5E A;  4JQW C;  3O96 A;  4HAT B;  5KQ1 A;  2DX5 A;  4F7H A;  2KQS A;  3TW1 A;  3OJ3 A;  4GDL B;  3N3K B;  2P0F A;  3L13 A;  4DX9 0;  4RMA A;  1P0R A;  3VVW B;  1UD7 A;  1P6S A;  1ISN A;  4W9H A;  2NR2 A;  3PV1 A;  4LJO B;  2LGD A;  1TXD A;  1UZX B;  2K00 A;  4EZJ A;  3AJ4 A;  3JSV B;  3A33 B;  2A4Z A;  2O6V A;  1NDD A;  1EF1 A;  2D10 A;  2I1K A;  3SDL C;  4WAA A;  2R82 A;  4HB2 B;  1P3R A;  1MIX A;  1WYW B;  1DBH A;  1WM3 A;  1B55 A;  2C5L C;  1Z5S B;  4C0A A;  4W9G A;  4ANW A;  1NTV A;  4GMX B;  2KO3 A;  3NHE B;  3NZS A;  3FEH A;  2MA9 B;  1WXA A;  1U5G A;  3VTU A;  2XK5 B;  3B1L X;  3DDC B;  3V61 A;  1AWE A;  4M8M A;  2L76 A;  3ZO5 B;  5C5B A;  4FLH A;  3VXW A;  1BTN A;  1TQZ A;  1XCG A;  1MAI A;  3A9J B;  3DVN U;  3ZDM C;  3ULB A;  4BBK A;  2L05 A;  2WX1 A;  5D2M B;  3GYO A;  4HB3 B;  5J18 A;  3GYP A;  3T06 A;  4BVU C;  2J0K A;  3PS6 A;  2WX0 A;  1V9J A;  2NCN A;  4J6I A;  2Z0D B;  3OAN A;  4MGK E;  2LUL A;  1WR6 E;  3ML9 A;  2K1F A;  4RM8 A;  2W2X C;  4MJS B;  4CHJ A;  2JRH A;  4JKG A;  1EO6 A;  2B3A A;  3TL5 A;  5IJM A;  3M63 B;  2HTH B;  2CS4 A;  3LJ3 A;  2G35 A;  2C7M B;  2UYZ B;  1J0W A;  1X11 A;  1FGZ A;  1E8X A;  4CHK A;  2N9E B;  2KD0 A;  1Q1O A;  1Y19 B;  3VOQ A;  3ECI A;  4ILJ A;  2JP2 A;  1WGD A;  2L0T A;  4K7U A;  4MH0 E;  2Y7B A;  3L54 A;  1YIW A;  3EHV A;  1YX5 B;  3P2B A;  1F9J A;  3FSS A;  5E6P A;  1A5R A;  4W9F A;  2BKR B;  2K8B A;  4PS3 A;  4JKA A;  2M0X A;  2KTF A;  4ZDV A;  2PJH A;  2LVP A;  2JXX A;  2KTR A;  3NSU A;  1V86 A;  5IA7 A;  3E9P A;  4BBN F;  4DXA B;  3DXC A;  1ACA A;  5DPT A;  5HE2 A;  4HHV A;  2DIK A;  2IO1 B;  4OVV A;  2CHX A;  1OQY A;  1P98 A;  3VIA A;  4JKF A;  1WGR A;  4HAY B;  2X18 A;  2MLB A;  1ZSQ A;  4KZC A;  4NNJ B;  1M7E A;  1MK9 B;  2JWZ A;  4MGZ E;  2ABD A;  2GCL A;  2L1C A;  3D8F A;  2R2O A;  4WWO A;  3T9L A;  2ELA A;  1U4A A;  1BTK A;  2DHK A;  1R4M I;  5DIF B;  3V5W A;  3QAQ A;  5EDS A;  2KK8 A;  4HJK A;  2GJY A;  2DYQ A;  1UNR A;  2GOW A;  5G55 A;  2MBH A;  1BWN A;  3RZF A;  1WGY A;  3ZRC A;  1RJ2 A;  4K1R B;  3SD5 A;  2YLM A;  4CYE A;  3EPY A;  5AZG A;  5E6O A;  2UZR A;  2JZ3 B;  5CX3 A;  2DTC A;  3HHM A;  3TBL D;  1LFD A;  3N32 A;  4IM3 A;  1YD8 U;  3HQC A;  2CY5 A;  4KAX B;  2N4F A;  4H8S A;  4HVB A;  1KJT A;  4PYZ A;  4FHK A;  2GBJ A;  3HM3 A;  2FCQ A;  3UZT A;  4EJN A;  1WJ6 A;  1HB8 A;  4K7S A;  4IW0 A;  1GUA B;  4NAW B;  3I3T B;  4PS8 A;  3RCP A;  3RD2 A;  3DXE A;  4XC2 A;  3SBT A;  3DVG X;  3OLM D;  2VKI A;  2V3S A;  2MDX A;  2DHZ A;  3VH4 B;  4HWI B;  3LDZ E;  2KLG A;  4WQO B;  5GOW B;  2LYD A;  2IYD B;  1MG8 A;  4FHJ A;  5D3Y A;  3ZW3 A;  1K5D B;  2KQ7 A;  2CB8 A;  4EEW A;  3PLV A;  2ROZ B;  2YS1 A;  1GC6 A;  4N9F 4;  2OTX A;  1U27 A;  2I5C A;  2OJR A;  1ZGU B;  4DHZ E;  4FA6 A;  3KYC D;  1X1M A;  2LRW A;  2MQJ A;  3EEC A;  4WJP A;  1FHX A;  2YT0 A;  4MGI E;  1ZW7 A;  2IO2 B;  3TO1 A;  4EOY A;  1V49 A;  4HDO A;  4FAD A;  2KGX B;  1WE7 A;  5KHQ A;  4WJQ A;  3F0W A;  2KFK A;  5D7G A;  2ROV A;  2DAJ A;  3GZN I;  1P5T A;  4W9E A;  3W1S C;  2DZK A;  3VAW A;  3T8M A;  2KX3 A;  4B6H A;  2COF A;  3UIP B;  2Z59 B;  3G9W A;  1ZKH A;  1SE9 A;  3ZDT A;  3K9O B;  2G45 B;  4JIO U;  2Q13 A;  2LZ6 A;  2BYF A;  3V6C B;  2LXA A;  2ZCB A;  4GB9 A;  3ZNI D;  3A4S C;  2IY0 B;  2KDE B;  2VSZ A;  5J3Y A;  5L95 C;  2JT4 B;  3IVF A;  1PQS A;  3TIX A;  2YRY A;  2GBK A;  2LAS A;  2COD A;  3V62 A;  3ODW A;  5FR6 A;  2KHW B;  3R7R A;  4AJY B;  4EKU A;  5C6R A;  2KX0 A;  4F1S A;  5C23 A;  3ODO A;  2M8S A;  4GDK B;  3QIJ A;  3UGB B;  3P7Z A;  3R7Q A;  3X0W A;  2W2X D;  3PGE A;  3BJI A;  2MBE A;  4IM2 A;  2LWP A;  2YS3 A;  5CLQ B;  2Z0O A;  1DRO A;  2RD0 A;  3Q3J A;  1UNP A;  3PRM B;  3UQA A;  2FCM A;  3PRZ A;  2H7E A;  4PS7 A;  3A1Q B;  4EFO A;  5BO4 B;  2VRR B;  5J3T A;  2KDF B;  4W9C A;  1Y8R C;  2K8H A;  2LGX A;  2IBI B;  4WJ7 A;  4E74 A;  5CLL B;  4Y94 A;  2GBR A;  2G4S A;  2D9X A;  5KQ4 A;  1WX8 A;  2PEA A;  4EUT A;  2PPH A;  1WH3 A;  3LJU X;  1G6J A;  4BFR A;  3TJP A;  2D9W A;  3CIK A;  1VCB A;  2E2X A;  5D3X A;  1V6E A;  5FI1 A;  2N7D A;  1FB8 A;  2ADZ A;  3DOW A;  3L16 A;  3DBS A;  5C79 A;  5DPR A;  1NVL A;  4K81 A;  1WG7 A;  2BWF A;  2NS5 A;  4JK7 A;  4BKG A;  1E8W A;  1I2H A;  4KSK C;  2RR9 A;  2AL6 A;  1E8Z A;  2RSU A;  3M62 B;  2DZM A;  5CHF A;  2I5F A;  2MP2 A;  2M17 A;  5D94 A;  4BKS A;  2YVC A;  4A6F B;  1FXT B;  2DYM A;  2DX5 B;  5FI0 A;  2DA0 A;  3A98 B;  5C1Z A;  4FN2 A;  2NBV B;  1XD3 B;  2BCJ A;  3A9K A;  3MPX A;  2LUE A;  3NY5 A;  2JZZ A;  3APC A;  4F8C B;  1WY8 A;  2FCS A;  3QCA A;  3FM8 C;  2KC1 A;  2ZPN A;  2FNJ B;  4A5K A;  2CRF A;  2AL3 A;  2O6V B;  1HBK A;  1WJ1 A;  4YON A;  3ZRF A;  3PEG A;  2IO3 B;  4M8N A;  1X86 A;  1MK7 B;  3QC8 B;  4DHZ B;  3JYU A;  5KCV A;  1V2Y A;  1RAX A;  1J19 A;  1Z87 A;  3M95 A;  5LON B;  3PSE B;  1UGM A;  3SO6 A;  5JHA A;  2MBQ A;  2PZ1 A;  2XK5 A;  4BOS C;  1IPG A;  2ZVO A;  2KMA A;  2KWU B;  3SBG A;  3QAR A;  2K2J A;  4MDK E;  1LB1 A;  4DX8 A;  4GXB A;  4TUU A;  2V4L A;  2PE6 B;  2KJR A;  1NI2 A;  2LOX A;  2L2I A;  1TGZ B;  3DQV A;  3PVW A;  2L00 B;  1DDM A;  1WM2 A;  2CQU A;  2RGF A;  1TJ6 A;  1ZVR A;  1C3T A;  1GC7 A;  2IY1 B;  3H1U A;  1WJU A;  2JUO A;  2LVQ A;  2DHJ A;  2MKR A;  4E71 A;  4DBG A;  2EC1 A;  1RFA A;  4AP4 C;  4MJS A;  2J7Q B;  1U2B A;  4MSM B;  4ZRJ A;  3UIO B;  1GJZ A;  5AZF A;  1AQC A;  3SU8 X;  4JKG B;  2K25 A;  2CAY A;  2KCJ A;  2KKC A;  1XT9 B;  2M1M A;  1Q67 A;  1P9D U;  2NMB A;  5TR5 A;  2N7E A;  1V5M A;  4IG7 B;  3AU4 A;  2K39 A;  2EMT A;  2JVC A;  3P6A A;  3O65 B;  3ML4 A;  1L2N A;  2MBO A;  5D6J B;  1DYN A;  4HDQ A;  1PFJ A;  4I6N B;  2KNB A;  1WIA A;  3CSF A;  2NBW B;  4KVG B;  2ELB A;  1U5F A;  2KTR B;  1E8Y A;  4L6E A;  4ICU A;  5CHW A;  2AYO B;  1DDV A;  2KMC A;  3IFW B;  2R09 A;  3AUL A;  4M0W B;  2ZNV B;  4WJO A;  3TFM A;  3Q3F A;  2Y8G A;  3SYX A;  2RVB B;  4JKE A;  2LGY A;  3UF8 A;  3PRP B;  1UEF A;  1VD2 A;  3H7P A;  1V88 A;  4G3X B;  1WX9 A;  3JW0 X;  5CHV C;  2MSE D;  2D11 A;  5JHG A;  2NPT A;  2K2U A;  3DBL I;  4ZYN A;  2DKP A;  1YX6 B;  3ZNG C;  1Y5O A;  3X23 A;  3KUZ A;  4F7G A;  4ICV A;  3HIZ A;  2A5U A;  1J0G A;  2L8J A;  2Y8F A;  3W1S A;  5C16 A;  3L17 A;  3TCA A;  5HE1 A;  4KHO A;  2GBM A;  2P0H A;  1WXM A;  3WYF B;  5AEK B;  1BAK A;  1WXS A;  2IO0 B;  3BIN A;  4MGY E;  1RRP B;  2NVU I;  2FJ9 A;  1ZC4 B;  1XX0 A;  1V81 A;  1NU2 A;  2LBB A;  1HE8 A;  5AZH A;  5D3V A;  3DVG Y;  3VFK A;  4NQL B;  3ZTD A;  2N1W A;  1U5D A;  4LDT D;  1WJM A;  1EF5 A;  4IWP A;  3RCZ A;  1WGU A;  2YF0 A;  1WE6 A;  3SV1 A;  2FJL A;  1FOE A;  4JK8 A;  3QWM A;  3L0W B;  2KDI A;  1H4R A;  4D0N B;  2QHO A;  1FHW A;  3SUZ A;  4HK2 A;  2MRP A;  3TVV A;  4PQ0 A;  5G2N A;  3K9P B;  1S1Q B;  4HB0 B;  2HE7 A;  4A3O A;  1V5T A;  3APD A;  3PZD A;  4MSQ B;  3L08 A;  4II3 B;  3WAP A;  4GMV A;  2MBB B;  2R0D A;  2NBU A;  1DDW A;  1FGY A;  1NBF C;  3AXC A;  1V61 A;  2KJ6 A;  4XX5 A;  1OQN A;  4JKB A;  1MIZ B;  4IWQ A;  2O2V A;  1QQG A;  1WI1 A;  1UPQ A;  2XQN M;  4KHA A;  4KZ0 A;  3VUW A;  1OEY J;  4DDG D;  1X1F A;  1E7V A;  3E9O A;  2LXC A;  1PMS A;  3NOB A;  2RLO A;  5EFX A;  4MEM A;  1WJ4 A;  2COC A;  3ENE A;  3MHS D;  4DHJ B;  1T0Y A;  3NS8 A;  2RUK B;  4DK5 A;  1V5P A;  2Z0P A;  3KSY A;  4NY0 A;  4P7I A;  3PP2 A;  1W1H A;  2XBB C;  5J3Q A;  4IM0 A;  2L0F A;  3F5R A;  2KFK B;  4G50 A;  4HAW B;  1SGH A;  3A8P A;  2MWS B;  4B9K A;  5DPW A;  5JLJ B;  1RLF A;  1WJN A;  3PSC A;  4A6H A;  2DZI A;  3QBV B;  2OOB B;  4K7W A;  3DPD A;  1Z2M A;  3N7C A;  2DFK A;  2COP A;  4ZRI A;  2HJ8 A;  2LRU A;  1KZG A;  3H6N A;  3GOE A;  4MK0 A;  2N23 A;  1NTI A;  4F7Z A;  2LJ5 A;  5DCN A;  1SHC A;  4EZK A;  1WXV A;  4FJV B;  3R66 C;  3APF A;  1KBL A;  1OTR B;  4KIK A;  1ST7 A;  1WMH B;  4W9D A;  4IFS A;  3PPA A;  3DVN V;  3PT2 B;  3B0A A;  4W9L A;  1YQB A;  2PE9 A;  4X57 B;  2L3Z A;  4LJP B;  3M1I B;  4HAV B;  3RZW C;  1X05 A;  3QQ8 B;  4GSW A;  3E9L A;  1I35 A;  4XZ4 A;  2KXJ A;  3V60 A;  2DYO A;  2DHI A;  4HB4 B;  1W1G A;  1LXD A;  3KW5 B;  4ANV A;  4JKC A;  2H7D A;  3VDZ A;  1OEY A;  4W9K A;  4RM9 A;  1EVH A;  1FHO A;  3N30 A;  3D32 A;  4ILH A;  2J59 M;  2DEN B;  2K6D B;  5LXH A;  3H9D A;  2UWQ A;  3ZNZ B;  1C1Y B;  5JP4 A;  1E5W A;  1R4N I;  5GMV A;  4KHB B;  2RQ1 A;  1UNQ A;  2DYN A;  1BT0 A;  2R2Q A;  3FLV A;  5LXI B;  2CKH B;  3HW2 B;  5JVL A;  4G11 A;  3OAW A;  5E6N A;  1UH6 A;  3CF6 E;  3U8Z A;  2MP2 B;  3RYT A;  3PHW B;  4GDL A;  4DBB A;  1JDE A;  3IG3 A;  3TMP B;  1I42 A;  2LD9 A;  1E7U A;  4K2O A;  4HPL B;  2DAF A;  1W1D A;  2C9W B;  3KVF B;  1WX7 A;  1UEL A;  2BYV E;  2DYB A;  3MTN B;  3ONS A;  4GOC A;  2NZ8 B;  2N9X A;  3PVU A;  3ENB A;  3A9K B;  2EMS A;  1IP9 A;  3JSV A;  2J0J A;  5HE3 A;  4BBN C;  3DCG A;  1M7R A;  4F7U P;  3VHT C;  1WGG A;  1WR1 A;  2WYQ A;  1ZM0 A;  4GPT B;  1UPR A;  2BGF A;  4CHM A;  5J17 A;  2D9V A;  2P8V A;  1WVH A;  4FUL A;  2LOZ A;  5LLI A;  1MKE A;  2KDB A;  3AI5 A;  5KHO A;  3ZKJ C;  2KWV B;  2KZR A;  3WAO A;  4A20 A;  5DI9 B;  1P3Q U;  1V89 A;  3ODX A;  1OGW A;  1J8C A;  3D8E A;  5C5B B;  2MW5 A;  3AU5 A;  2C7N B;  2N1V A;  3ZNH B;  3A9J A;  4WVF B;  2DN6 A;  1EGX A;  5DHF B;  4ASW C;  1I7A A;  3R3M A;  1VBH A;  4JLC A;  3ZTC A;  3KUC B;  2M38 A;  5DHA B;  1P1A A;  4ANU A;  5JHH A;  2VRW B;  1XKE A;  1K8R B;  2BKF A;  4FJZ A;  3SNH A;  1VBG A;  4KDL B;  2COA A;  2IYB A;  2FCN A;  3WIM A;  2G4D B;  1U29 A;  4AUQ C;  3UQB A;  1WGH A;  3B08 A;  2M14 A;  1GG3 A;  4TQ1 A;  2QKM A;  2HTH A;  2M4N A;  3VTV A;  4TYZ A;  1UBQ A;  4K2P A;  2CR5 A;  3PVL A;  1QC6 A;  3KUD B;  1HB6 A;  3ALB A;  4PYU A;  3IHP C;  3KRX A;  2LKO A;  4NPN A;  3A8Q A;  1WZ3 A;  3SHQ A;  4ILG B;  3QWZ B;  2FID A;  4BKT A;  1X1G A;  3HM6 X;  2D07 B;  2GMI C;  3M3J A;  3RT3 B;  5J2R A;  4HPM B;  3VUX A;  5JHB A;  4GZU A;  1MPH A;  2CU1 A;  3ML8 A;  4NJ7 A;  1GGO A;  2DX1 A;  2UVM A;  3JVZ X;  3FP5 A;  2YSZ A;  2JPH A;  4TV3 A;  2D9Y A;  2OQB A;  4HCN B;  4A3P A;  1ZC3 B;  3CXB B;  1M94 A;  3PLU A;  3DBR I;  2G3Q B;  2V76 A;  1OY2 A;  5JZE B;  2BWE S;  4EZL A;  2CY4 A;  1KC7 A;  4NSW A;  4YL8 A;  2RSG A;  2I1J A;  4XWX A;  1K5G B;  2YT1 A;  1XOD A;  3KZ1 A;  3H7P B;  2KOX A;  3BY4 B;  2WWZ A;  2QKL A;  3DXD A;  2EJ8 A;  2NPT B;  2LG1 A;  2GCJ A;  4W9I A;  2ZEQ A;  5JH5 C;  3MJW A;  3S2A A;  3VTW A;  4NJ6 A;  1V80 A;  1PLS A;  1UBI A;  4IWO A;  4GN1 A;  4IC7 B;  4ZRK A;  1GNU A;  5D3W A;  1WI0 A;  5DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...