1H4RA

Crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERLIN
publication title The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 96
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1h4rA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1h4rA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h4rA01
1B55A 3DOWA 3R66C 1YX5B 3LJ3A 2KZRA 4WWPA 2AYOB 2DZJA 2NZ8B 1X1FA 4TV3A 1Z2MA 2CODA 3IVFA 2AEHA 2DKQA 4AJYB 4NJ6A 5KHOA 2ZEQA 2M8SA 2KWCA 1E5WA 1WRDB 3JYUA 2LBBA 1WF9A 3ML9A 1XQQA 3TBLD 1I35A 1UNRA 4ANUA 1X05A 4B95A 4XZ4A 2V3SA 4W9CA 3ZDMC 3PTFC 1WJNA 4LJPB 1RAXA 3ODWA 3V5WA 5J2RA 3H9DA 3M3JA 2DAJA 1SIFA 2VKIA 1V9JA 5DIFB 2DZIA 1V49A 4IW0A 4FLHA 2N0YA 4F7ZA 3APFA 1DROA 1OY2A 3PHWB 4AJWA 2LUEA 4EOYA 5AZGA 4MJSA 2J0KA 2D9VA 3KY9A 2CHXA 3PS6A 2CB8A 1ZSQA 1FGZA 4HAXB 2C7NB 4HDQA 1WR1A 2UYZB 3VHTC 1Z5SB 1NI2A 4G0NB 2MBEA 3KUCB 4DX8A 1BTKA 2G35A 2NPTA 4NY0A 1Y8RC 1RJ2A 1TTNA 3CIKA 4H8SA 4WJPA 3ZNID 3UZTA 3DVGX 4N9F4 5C23A 1HB6A 3TW1A 2DYBA 2KLGA 2J0MA 1ZC3B 2OQBA 1VCBA 1WG7A 2LKOA 1SHCA 2NMBA 2ASQA 1WX9A 2KD0A 3ZUNA 2E2XA 3CMMB 1GJZA 1DDVA 2RLOA 1P3RA 3CSTA 4ASWC 2DHJA 2MBHA 3PVWA 4C0AA 1WZ0A 1JRUA 1R4MI 2KOXA 1M7EA 3SYXA 2RPQA 4DBGA 4KHBB 3KRXA 4II3B 5D94A 5EFXA 4MGIE 3PREA 4A6FA 2HRJA 3M62B 4GMVA 5JH5C 4GDLA 2KK8A 4WAAA 4EZLA 3WAOA 4OVVA 2LZ6A 4AWJA 4JL9A 2KXJA 2ZVOA 1UBIA 2K39A 3HM3A 2KJ6A 2GOWA 1WM2A 3D8FA 3DBLI 1XX0A 3ZTDA 2NVUI 1Y5OA 5D27A 1UPRA 3OJ4B 3AU5A 4FBJB 3MJWA 2L05A 2RUKB 2MFQA 3ZW3A 2LGXA 1QZEA 1I2HA 1XD4A 2G4SA 4XX5A 2KJHB 4E3CA 4URKA 4DWFA 4CHMA 2FJLA 1WY8A 3L0WB 4TYZA 2KTFA 2DN6A 1PFJA 1UH6A 1WXMA 3NZUA 1MIZB 4IOYX 5JLJB 1V5PA 3IG3A 3PG7A 3UIPB 3AXCA 2N7DA 3ZKJC 4PYUA 2K2UA 4F8CB 1UD7A 3U30A 3D32A 1ZC4B 4GIVA 2HTHA 2BYEA 3HM6X 3A1QA 4OVUA 4ZRKA 1ZGUB 4FN2A 4MGZE 2GBRA 2N23A 4GDKB 2BCJA 5HE3A 3HK0A 2LWPA 1E90A 4DHJB 5CLLB 3V6CB 2FJ9A 3TVVA 2O2VB 2JXXA 2WH5A 2DYMA 1DBHA 2IYBA 4IFSA 3KW5B 2JZZA 4CHJA 4W9LA 4BOZB 1D3ZA 5C79A 5EDSA 3GYPA 4ANVA 1E8XA 2DENB 3PLVA 2H7EA 3KZ1A 4K7UA 5D3YA 3QARA 2MP2B 1OGWA 3FSSA 5CHVC 2I5CA 3QWMA 1TZ1A 2NBWB 4GGQA 1Y19B 3KYCD 2Z0DB 1K5DB 3TMPB 1Q67A 2QKLA 2EJ8A 2LVPA 3ZLZA 4XWXA 1OEYA 2K6QA 3ODOA 2J0JA 4FJZA 1QQGA 2J7QB 3DVGY 4TQ0A 1WMHA 2D2QA 1OQNA 4D0NB 3KRWA 2A4ZA 2KDBA 4FADA 3JSVA 1WX8A 3VTVA 3OJ3A 1U5DA 3IBEA 3EPYA 1GG3A 2DX5B 2Y7BA 3TCAA 3K9PB 2D10A 3IHPC 4GMXB 1WI1A 1FAOA 4HAUB 2KFKA 4MDKE 1GNUA 4YL8A 3HHMA 2KTRB 3ONSA 4E71A 3A9KA 3PV1A 3QHTA 1WGRA 2IO3B 1H4RA 5J3TA 2AL6A 1MG8A 4EZJA 3ECIA 2LRWA 4K2PA 3QX1A 1ZVRA 5HE1A 4HVBA 2DAFA 3QIJA 3ODXA 2P0DA 1EO6A 5C1ZA 1NU2A 4E74A 1UPQA 2ROVA 2LOZA 3ZVVA 3ML4A 2LXAA 2COAA 2ADZA 1DDMA 2FNJB 2V4LA 3RT3B 2D4QA 2D07B 2MX2A 5KCVA 4WSFA 1FOEA 2N9PC 1AQCA 2WDTB 4AOFA 1J19A 2GBJA 2BWFA 4ICVA 2YVCA 4K7WA 4HATB 2KWUB 1V81A 3VIAA 3DVNU 1NBFC 2L8JA 4W9IA 3HQCA 2LYDA 2CAYA 2Y8FA 5C5BB 2COCA 4KAXB 3VTWA 2LGYA 4IAPA 3L10B 1I42A 2K00A 2XK5A 2O6VA 3NZSA 5IJMA 3HW2B 1WXAA 1HE8A 2MBOA 4MGKE 2K25A 1WJUA 4BKGA 2ZJDA 4ICUA 2D9WA 1IP9A 3EFUA 3R7RA 2FIDA 2DYNA 3DXEA 3WANA 1Q1OA 4KVGB 3AI5A 1MK7B 1IYFA 4ZRIA 4GXBA 3FLVA 3WYFB 2N9XA 1LM8B 3RULA 3ZNGC 3I3TB 1LQBA 1UZXB 2X18A 3NHEB 1AARA 3NS8A 4KZ0A 1NDDA 3H6NA 1X86A 3D8EA 4FJYA 4MSQB 4W9HA 1I7AA 4HB3B 4G11A 2D9XA 4I6PA 5FI1A 2KQ7A 2G4DB 1KLVA 4KIKB 1MPHA 2ZPNA 1P9DU 1V61A 2KQSA 2COPA 2IO2B 5LXHA 3SNHA 3DCGA 2HJ8A 2YS3A 3W1SC 5L95C 3PEGA 3QQ8B 2AL3A 3PVLA 3BJIA 5J18A 2W2XC 3SHQA 2W2WA 2CHWA 3AU4A 4FHKA 5BO4B 4M8NA 4WQOB 2L2IA 2KCJA 1UNQA 2KC1A 3R3MA 1S3SG 3LDZE 1W1DA 1EGXA 4IM2A 3MDBC 2KANA 1P3QU 2L3ZA 2MKRA 2MCNB 3TO1A 2CY4A 1E7UA 5JHGA 4Z2NA 2DYQA 1PMSA 4FHJA 2L0TA 3PZDA 3S2AA 1BTNA 3M95A 1OEYJ 1J0WA 2BPSA 2K8HA 2C9WB 1W1GA 4W9EA 4XC2A 3HIZA 2ZVNA 2Q13A 1V2YA 2KKCA 1E8WA 2FCMA 1WZ3A 1MIXA 1WVHA 2R0DA 1FHXA 4BKTA 4DBBA 1TJ6A 4HCPB 2PE9A 2LJ5A 2LG1A 4K7SA 3VH3B 3A9JA 3PLUA 4GSWA 5DHAB 4EJNA 1SE9A 4KV2A 1WGQA 2WX0A 3KSYA 2IYDB 1WGYA 4WJ7A 3NSUA 4ZYNA 3L08A 4AP4C 4HXDA 5D3XA 2K8BA 3SDLC 3A33B 4PS8A 4IUMB 4EZKA 3ZTCA 4NAWA 2FCSA 3L17A 2BYVE 2XBBC 4HPMB 4HHVA 1RRBA 3QBVB 2P0FA 2RVBB 4LDTD 4F1SA 2NS5A 5JHHA 5J17A 1MK9B 1LXDA 4RM9A 2CKHB 2ZPYA 5C6RA 1CMXB 5AZFA 2BWES 3M1IB 3MTNB 5DCNA 2KNBA 3VUXA 4MJSB 2MDXA 2LASA 4A3OA 4DHZE 1V5TA 4HB2B 1FHOA 3UIOB 4KSKC 1V5OA 1WIAA 5CX3A 3JVZX 4A20A 4A3PA 2NPTB 4WWNA 4BOSC 3PP2A 3A8QA 3ZO5B 5IAAC 1H10A 1WM3A 3NOBA 2CY5A 2NBUA 4BVUC 3Q3FA 2MWSB 2RGFA 4HJKA 5C16A 4K1RB 4BKSD 3PGEA 3H1UA 1NTVA 4GZUA 4IM3A 1UEFA 2Z0EB 3H7SA 2MBBB 4ZDVA 5LOPB 3W1YA 1NVLA 4FA6A 2PEAA 4I6LB 2UWQA 2I1JA 1E8YA 4EMOA 2DYOA 3ZNHB 3VUYA 3VOQA 1OQYA 4GDLB 2C60A 3EECA 1YD8U 2M17A 4DK5A 1V89A 2DKPA 1NTIA 3VXWA 5D3VA 4NPNA 2P8VA 2IO0B 1MKEA 2NR2A 1UGMA 3PT2B 4HPLB 5HKHA 1YQBA 5GOWB 2BF8B 2IFSA 1FGYA 5G2NA 2FAZA 2RSGA 2KFJA 3WALA 2RQ1A 4HLEA 2UZSA 1OMWA 1TBEA 1YIWA 3KVFB 3VUWA 2Z0OA 3ZIMA 3H7PA 3T06A 1U27A 3VQIA 1LB1A 2CU1A 4B6WA 3ZRFA 1BAKA 2XEWA 3UQBA 1L2NA 1WJ1A 4M8MA 3UQAA 1FB8A 2YF0A 2KDEB 4JLCA 5DPWA 1LW3A 4PQ0A 3B1LX 3TIXA 5L81A 1T0YA 4P7IA 1V6EA 4HAYB 3ENEA 2KO3A 2KN5A 3PSEB 2HTHB 2VRWB 3DQVA 3SD5A 3A1QB 4ANWA 3T8MA 3UF8A 4BKSA 2ZNVC 2YT1A 4RMAA 2M14A 3GYOA 1SGHA 5CTRC 2ZNVB 3DBHI 5AZHA 2GS0A 4M0WB 5C5BA 1V5UA 2Z0PA 4W9FA 3PRZA 4DDGD 5DH9B 1WGHA 3APDA 3L54A 1XR0B 4NNJB 4K2OA 2K2JA 2JVCA 3VAWA 4TUUA 2BYFA 3DPDA 3FEHA 1KOTA 5D7GA 2LD9A 3L13A 1XODA 2IZVB 4F7GA 3DVNV 1U2BA 1PQSA 2N7EA 2IY0B 2ZCCA 3MPXA 4HK2A 2LRUA 3RZWC 2MLBA 2WWZA 5G55A 3SUZA 1U5FA 2KMAA 3RUIB 5JP4A 5LXIB 2M0XA 2CS4A 2JY6A 3QK0A 3X23A 2BKFA 2G45B 4IWQA 2JT4B 1HBKA 4W9JA 5JZEB 4X57B 1P0RA 2JP2A 3OAWA 1WMHB 2C7HA 1C1YB 2OTXA 4L6EA 2MW5A 2C7MB 1EF5A 4MELA 2D9ZA 3JSVB 3AJ4A 5KQ4A 4W9KA 3UGBB 3ALBA 3VTUA 3CXBB 1BT0A 1WYWB 3DXDA 4W9GA 4G50A 4HWIB 1P98A 1PLSA 3AULA 3PVUA 1WJ6A 3EHVA 2KFKB 1E8ZA 2RD0A 2GMIC 1KZGA 4PS7A 1XKEA 5CHFA 3A9KB 1ISNA 3A4SC 5E6OA 5KHQA 1FHWA 1ZM0A 2AWTA 5CHWA 2NCNA 3GZNI 2KUPA 4HAZB 3DXCA 2DHIA 2FIFA 4DXAB 4WJNA 4WWOA 1TGZB 1WE6A 4BBNF 1W1HA 1GC6A 2L0FA 3UINB 2DLWA 4ZRJA 1H8CA 2M4NA 1V88A 4PS3A 4IWPA 3CSFA 1U4AA 2R2OA 1YJ1A 2LGDA 3RZFA 1GUAB 2N4FA 4A6HA 3RD2A 3G9WA 1UBQA 3N30A 5J3YA 2DZMA 2DFKA 2JRIB 2IBIB 1RFAA 5DI9B 1YX6B 2V76A 3RCZA 2ABDA 4BFRA 5IA7A 2DHZA 1UELA 2XK5B 2O6VB 4I6NB 2C5LC 2CR5A 1NTYA 2M38A 3X0WA 3DDCB 4Z2MB 1KM7A 1WJ4A 1L7YA 1WI0A 1DYNA 2EMTA 2H7DA 2R09A 4DX90 4CO7A 4IG7B 2YRYA 4DHJD 2DA0A 1FXTB 2FUHB 2ELBA 2RGNB 1OTRB 2QHOA 2KMCA 2IO1B 4MT7A 2P0HA 5E6PA 2A5UA 1J0GA 1XCGA 2L7RA 3KYDD 3VDZA 3PRMB 1U29A 5HE2A 3OANA 2DTCA 2D9YA 2YLMA 4FULA 5D6JB 1MAIA 3QAQA 2V1YA 2Z0QA 2LXCA 4MK0A 3C0RB 1G6JA 4JQWC 3ULCA 2ROZB 2N1WA 2G3QB 1KJTA 2UZRA 4HB4B 5J3QA 4YONA 4KHAA 3A8PA 5TR5A 2PZ1A 2VRRB 4IM0A 2DX1A 4MH0E 3PPAA 2R2QA 2LULA 3MHSD 4WVFB 4ANXA 3QWZB 1QC6A 2KDFB 1WGDA 1P6SA 1V86A 3V6EB 5KQ1A 3N3KB 3WIMA 2WYQA 2FDQA 2GJYA 4A5KA 3V60A 2IY1B 5GMVA 1WXVA 2I5FA 2GBNA 3PHXB 4GDKA 2KX3A 4GB9A 5JHAA 2L76A 4EKUA 2KJRA 3P6AA 4CHKA 4RM8A 1ACAA 2ZZPB 1WXSA 1S1QB 2O2VA 2M1MA 3SO6A 2YT0A 2D11A 4WJOA 1ST7A 1E7VA 2K1FA 3A9JB 1UNPA 4GOCA 2JF5A 3FM8C 3VFKA 3EC8A 1WE7A 4BBNC 2LOXA 3U8ZA 3ZNZB 1RLFA 4IWOA 3WAMA 5DPSA 2KGXB 4TQ1A 2MQJA 1X1MA 4NAWB 1EF1A 2MP2A 2HE7A 5HE0A 2MWNB 2PJHA 1WR6E 4A6FB 2N9EB 1XT9B 5JHBA 1F9JA 1KZ7A 5DHFB 2WX1A 3ZVRA 2CHZA 3A4RA 3WAPA 4FJVB 3ZDTA 1X1GA 4HB0B 4LJOB 5LLIA 3RYTA 3QA8A 1WGUA 2YSZA 2KVRA 1IPGA 1N3HA 3VVWB 2JRHA 2NBVB 2OJRA 3JW0X 5E6NA 3V61A 1XD3B 3O96A 2KX0A 4JIOU 3KH0A 3QCAA 4GU2A 2EMSA 3RCPA 3U7DA 5FI0A 1EUVB 4Y94A 4LCDE 2REXA 1EAZA 2N1VA 1IRSA 1WH3A 4KSLC 2DHKA 4II2B 3FP5A 3PSCA 2DX5A 3P2BA 3M63B 4K17A 1WGGA 1U5EA 4HCNB 1WFYA 2K8CA 2RR9A 2B3AA 2I1KA 3DBRI 2GCJA 2KTRA 2KLCA 5AEKB 1V80A 1KI1B 2FCNA 2KWVB 1U5GA 3QJZA 1BWNA 5FR6A 3GOEA 3DBSA 3B08A 4J6IA 4HDOA 3BY4B 4KZCA 1X11A 4DHZB 1Z87A 3F0WA 2O6VD 2L00B 3OLMD 2EKEC 2MBQA 3TJPA 1K8RB 2UVMA 1DDWA 2BGFA 3APCA 2MSED 3Q3JA 2CQUA 3F5RA 2VSZA 3BINA 2W2XD 2HD5B 2CRFA 4MSMB 3R7QA 4KHOA 2LI5A 2W9NA 1TQZA 1WJMA 4KDIC 2L1CA 4HAVB 5DPTA 2KHWB 4EUTA 5D3WA 4LDTB 4F7UP 2GBKA 1R4NI 4WJQA 3K9OB 2JWZA 2Y8GA 2XQNM 1C3TA 4B9KA 3V62A 1J8CA 3H7PB 3T9LA 3N7CA 4NQKE 2PE6B 2K6DB 3KUDB 3VH4B 1M94A 2BKRB 2Z59B 4B6HA 2COFA 4F7HA 1V5MA 5L83A 2J59M 2LVOA 1P1AA 3CF6E 1TXDA 1LFDA 1K5GB 4BBKA 2Y5BB 3KUZA 3PRPB 2KC2A 3IFWB 4NJ7A 1VD2A 1Q5WB 5D2MB 3ZRCA 4W9DA 2RNRB 1GC7A 3NY5A 2DZKA 4HAWB 4A6KA 4GN1A 2GBMA 1HB8A 3TL5A 4GPTB 4EEWA 2YS5A 3QC8B 4KIKA 3ULBA 2LVQA 3ML8A 2QKMA 2PPHA 4G3XB 3A98B 2YS1A 2JZ3B 2RSUA 4JGHB 4CYEA 3D8DA 4MY6A 3LJUX 3B0AA 1AWEA 3W1SA 4PNKA 2KDIA 4EFOA 3SU8X 1M7RA 5LONB 3TFMA 2MRPA 3O65B 4DDID 3L16A 1ZKHA 4NSWA 5CLQB 2EC1A 4K81A 2JPHA 4MGYE 2ELAA 1RRPB 1EVHA 4PYZA 4NQLB 1ZW7A 2D3GA 3N32A 2FCQA 3P7ZA 2ZCBA 2JUOA 1A5RA 2GCLA 1WX7A 1P5TA 2MA9B 2OOBB 4MM3A 1Q0WB 3WA0A 3SV1A 4MEMA 4IC7B 4KDLB 5DPRA 4AUQC 4TKNA
chains in the Genus database with same CATH superfamily
1B55A 3DOWA 3PO0A 3R66C 1YX5B 3LJ3A 2KZRA 4WWPA 2AYOB 1SF0A 2DZJA 2NZ8B 1FNUA 4BZAA 4ITKA 1X1FA 2H89B 4TV3A 2M19A 2PMVA 1Z2MA 2CODA 3IVFA 3NS1A 2AEHA 2DKQA 1SJHD 1F2RC 4AJYB 1N61A 4NJ6A 4C00A 5KHOA 2LHEA 2ZEQA 2DNFA 2M8SA 2KWCA 1ZUD2 4LNNA 1E5WA 5LG4B 1WRDB 2WDQB 3JYUA 2LBBA 1ZYIA 1WF9A 3ML9A 5E6JA 1XQQA 3TBLD 4OSNA 1I35A 3HIEA 2J42A 1UNRA 1XCQL 4ANUA 1X05A 3NRZA 4B95A 4QJ4B 1SE4A 2V3SA 4W9CA 4XZ4A 1I4GA 3ZDMC 3NVVA 3PTFC 2QMTA 3EA6A 2MJ3A 3AEDB 5MPOA 1WJNA 3AECB 4LJPB 1RAXA 3ODWA 3V5WA 1F2RI 1V97A 5J2RA 3AE6B 3B9JA 3H9DA 1IBXB 3M3JA 2DAJA 3W2DA 1T0QC 2WU5B 2X38A 4HKQA 1SIFA 1C4PA 2VKIA 1V9JA 5DIFB 2DZIA 2MH7A 1V49A 2G1EA 4IW0A 4AQ7A 3ABVB 4HPPA 4FLHA 1AW7A 1N63A 2N0YA 4F7ZA 3APFA 1DROA 1OY2A 3PHWB 4HSIA 2LUEA 4AJWA 4EOYA 2AQ1B 5AZGA 1CK1A 2J0KA 2D9VA 1SSNA 1TS3A 4MJSA 3KY9A 2CHXA 3PS6A 2CB8A 1ZSQA 2WDVB 1FGZA 3N1XC 3NVWA 4HAXB 2C7NB 1UGJA 4HDQA 4GOUA 1WR1A 2V0GA 2UYZB 2WXFA 3VHTC 1Z5SB 1F1HA 1NI2A 4G0NB 2MBEA 3KUCB 4DX8A 1BTKA 2V4IB 2RMMA 1FD6A 2G35A 2LGIA 1MG4A 3ZJVA 2NPTA 2LJIA 2IGHA 2NTTA 2L52A 4NY0A 1Y8RC 1TYGB 1RJ2A 4XWTA 1TTNA 3CIKA 4H8SA 1MI0A 5D3DA 1IUEA 4WJPA 2J53A 2OJWA 3ZNID 3UZTA 3DVGX 2JYTA 4N9F4 5C23A 4YTNB 2PTLA 1HB6A 3TW1A 2DYBA 2KLGA 2J0MA 1ZC3B 4QJ3B 2OQBA 1VCBA 1WG7A 4M00A 2LKOA 1R4MB 1SHCA 1TJEA 2NMBA 1STEA 4XE0A 2ASQA 5IO9A 1WX9A 1ZXIA 2KD0A 3ZUNA 2E2XA 3CMMB 1GJZA 1DDVA 2PLPA 2RLOA 1P3RA 3CSTA 4ASWC 2DHJA 2MBHA 1TKEA 3PVWA 4C0AA 1WZ0A 1JRUA 1R4MI 2KOXA 1M7EA 3SYXA 1WGKA 2RPQA 4N6EB 4DBGA 4KHBB 3KRXA 4II3B 5D94A 5EFXA 4MGIE 3PREA 4A6FA 4ARIA 3E9SA 3E66A 3AE3B 4RNAA 3BVMA 2HRJA 3M62B 4GMVA 2WXNA 2V3PA 4HKZE 5JXVA 5JH5C 4GDLA 5BYRA 2KACA 2KK8A 3EFCA 4WAAA 4EZLA 3WAOA 3AEAB 3Q6BA 5T8IA 4OVVA 2LZ6A 4AWJA 1K51A 3DBLB 4JL9A 2KXJA 2ZVOA 1UBIA 1YJJA 2K39A 4GLSC 3FILA 3HM3A 2XNAC 2KJ6A 2GOWA 1PDXA 1WM2A 4N58A 4RGOS 1T5XD 4K3BA 3D8FA 3DBLI 3LXFA 1FCCC 1XX0A 3ZTDA 2NVUI 1Y5OA 5D27A 1UPRA 5TSSA 2WS3B 3OJ4B 3AU5A 4FBJB 3MJWA 2KT7A 1WWTA 2L05A 2RUKB 2MFQA 3ZW3A 2LGXA 1QZEA 1I2HA 1XD4A 2G4SA 4XX5A 2KJHB 3ZQ4A 4E3CA 4URKA 4DWFA 1AN8A 4CHMA 1N5WA 1JWUD 2FJLA 1WY8A 1XEEA 3L0WB 4TYZA 2KTFA 2DN6A 1PFJA 1UH6A 2E3TA 2WXQA 3U2SC 1WXMA 3NZUA 1MIZB 4IOYX 2KWDA 5JLJB 1FCLA 3FC4A 1V5PA 3IG3A 3PG7A 3UIPB 3AXCA 2N7DA 3ZKJC 4PYUA 2K2UA 4F8CB 1UD7A 3U30A 2INPE 3UI3A 5IRSA 3D32A 1ZC4B 4GIVA 1QT9A 2HTHA 2BYEA 3HM6X 3A1QA 1KRHA 4OVUA 1CZPA 5AUIA 4ZRKA 4OZCA 1ZGUB 4FN2A 4MGZE 4HROA 4YTPB 2GBRA 2N23A 4GDKB 4JKHA 2BCJA 5HE3A 4H2AA 1FO4A 3HK0A 4A55A 2LWPA 3NVYA 1YMHE 2IGDA 1E90A 4DHJB 2MJEA 2BS2B 4J3OD 5CLLB 3KQ4A 1J7AA 3V6CB 3E9LA 4M0WA 2FJ9A 4ZRQA 3TVVA 2O2VB 2LMCA 4ZHPA 4ILJA 3V3XA 2JU6X 2LGSA 2JXXA 2WH5A 1QKZA 2DYMA 2W55A 2K8EA 1DBHA 4JK8A 2IYBA 4IFSA 3AEFB 3I9V1 2DWQA 3KW5B 1MFWA 2JZZA 4CHJA 4W9LA 3AN1A 4BOZB 1D3ZA 5C3JB 4QXAB 1UUPA 5C79A 5EDSA 3GYPA 2L83A 2JYEA 4ANVA 1E8XA 2DENB 3PLVA 3ENBA 2H7EA 1K50A 4A90A 1KC7A 3KZ1A 3J9CA 2QDFA 2LHDA 4K7UA 4ZOHC 1EWCA 5D3YA 3QARA 2MP2B 4DQOC 1OGWA 3FSSA 5CHVC 2I5CA 3QWMA 1TZ1A 2NBWB 4GGQA 1Y19B 3KYCD 1YQ3B 1D4BA 2D3BA 2Z0DB 1FNWA 1K5DB 3BZDB 3TMPB 1Q67A 2QKLA 2Z14A 5EE0A 2DIKA 2EJ8A 2LVPA 3ZLZA 4LNIA 5BMGA 4XWXA 2I2YA 1KLGD 1OEYA 1GOZA 3B77A 1BXTA 3I57A 1ZE3D 2K6QA 4USAA 3DWGC 1V1PA 3ODOA 3LB8C 4IDIA 2J0JA 4FJZA 2BB5A 4C80A 1QQGA 2J7QB 3DVGY 1R4NB 4TQ0A 1WMHA 2D2QA 1OQNA 4D0NB 2J52A 1DOYA 3KRWA 2A4ZA 4IOIE 2GB1A 4JKDA 2KDBA 1HZ5A 4FADA 3JSVA 3ZYYX 1N62A 1WX8A 4N59A 3OJ3A 3VTVA 1U5DA 3IBEA 3EPYA 1GG3A 2DX5B 3GS2A 4TSSA 3B2GA 2Y7BA 3TCAA 3K9PB 2D10A 3IHPC 4GMXB 3WCQA 1WI1A 3RNAC 1FAOA 4HAUB 2KFKA 4MDKE 4RGNA 1GNUA 2BTEA 4YL8A 3P42A 1L0XB 2D3CA 3HHMA 3DCXA 3MJ5A 2KTRB 3ONSA 5D3IB 4E71A 3A9KA 4NJCA 3PV1A 3QHTA 1WGRA 2IO3B 1H4RA 5J3TA 2AL6A 1MG8A 3C8YA 4EZJA 3ECIA 2CJOA 1WRIA 3AE7B 1K53A 3U52E 2LRWA 2INDC 4K2PA 3QX1A 1ZVRA 5HE1A 4HVBA 2DAFA 3QIJA 1ZDVA 3BK2A 3ODXA 2P0DA 1EO6A 4EE2A 5C1ZA 1NU2A 4GNKB 4E74A 2QILA 3RPFC 1UPQA 2ROVA 2LOZA 1FPYA 3ZVVA 3ML4A 2LXAA 2COAA 2ADZA 2R61A 1DDMA 2FNJB 2V4LA 3RT3B 2D4QA 2D07B 2MX2A 4DXFA 5KCVA 4WSFA 1VJKA 1FOEA 1XCTL 2N9PC 1AQCA 3OWEB 2WDTB 5HI1A 4AOFA 1J19A 4A9AA 2GBJA 2BWFA 4ICVA 2YVCA 1XLPA 3VR8B 4K7WA 5JVLA 4HATB 2KWUB 1V81A 3VIAA 3DVNU 1NBFC 1QQRA 1CJEA 2L8JA 4W9IA 3HQCA 2LYDA 2CAYA 2Y8FA 5C5BB 2COCA 3Q8AA 4XYCA 4KAXB 3VTWA 2LGYA 4IAPA 3L10B 1I42A 4XGAB 2K00A 2XK5A 2O6VA 3RN9C 1PGXA 1RYJA 2RPVA 3NZSA 2QC8A 5IJMA 2XN9C 3HW2B 4JKGB 1WXAA 1MJDA 1HE8A 2MBOA 4MGKE 2K25A 1WJUA 4BKGA 2WNMA 2MEKA 2ZJDA 1E0ZA 4ICUA 3TEYA 2D9WA 1IP9A 2Q5WD 3EFUA 1L0YB 3R7RA 2AX5A 1SJED 2FIDA 2DYNA 3DXEA 3WANA 1Q1OA 1TIFA 2WXMA 4KVGB 1XXGA 3AI5A 1MK7B 1IYFA 4ZRIA 2Y5CA 3FKYA 4GXBA 4ILGB 3FLVA 1IGDA 3WYFB 2W3RA 2GRIA 2N9XA 1LM8B 3RULA 3ZNGC 3I3TB 1LQBA 1UZXB 1I4HA 2X18A 3NW8A 3NHEB 3P1MA 1FMAD 5EE1A 1HZ6A 1AARA 3NS8A 5BYSA 4KZ0A 1NDDA 3TEWA 1E7PB 3H6NA 1X86A 3D8EA 4FJYA 4MSQB 1L4DB 4W9HA 4WH4A 1I7AA 4HB3B 3AE1B 4G11A 2D9XA 1NENB 4JKCA 2JX5A 4I6PA 5FI1A 2KQ7A 2G4DB 1C77A 1KLVA 1QOBA 1MPHA 4KIKB 3ZXVA 1YOVB 3W5VB 2ZPNA 1P9DU 4MT5A 1YN4A 4WWMA 1V61A 2KQ4X 4C7ZA 2KQSA 2COPA 2IO2B 3MC0B 5I4DA 5LXHA 3SNHA 3DCGA 2HJ8A 1C4CA 2YS3A 3W1SC 4L23A 5L95C 3PEGA 1KF6B 2M56B 3A58A 3QQ8B 1C79A 2AL3A 3P4SB 3PVLA 2KVZA 2KDMA 4OZAA 3BJIA 2IGGA 3NJTA 5FR3A 5J18A 2W2XC 3SHQA 4YSYB 2W2WA 2CHWA 2K9XA 3AU4A 4FHKA 5BO4B 4M8NA 1IGCA 4WQOB 2W3SA 3RNBC 2L2IA 2KCJA 1D5MC 2PVGC 1UNQA 1JMLA 2KC1A 1OQQA 3MHZA 3R3MA 1S3SG 3LDZE 1C78A 3IAS1 1W1DA 1EGXA 4KHBA 2BYTA 4IM2A 4M01A 3MDBC 2KANA 1P3QU 2L3ZA 2MKRA 2MCNB 2RRFA 1VZ6A 3KWLA 2HDEA 3TO1A 2CY4A 1FXAA 1E7UA 5JHGA 4Z2NA 3MC8A 2DYQA 4MM3B 2Z8LA 1TKYA 1PMSA 4FHJA 2L0TA 3PZDA 4L1RA 3S2AA 1BTNA 3M95A 1OEYJ 1J0WA 1I4XA 2BPSA 2PIAA 2K8HA 2C9WB 1W1GA 4W9EA 4XC2A 3HIZA 2ZVNA 4A8XC 2Q13A 2DBYA 3AH7A 1V2YA 2KKCA 1E8WA 2FCMA 1T0SC 1WZ3A 1MIXA 1WVHA 2R0DA 1FHXA 4BKTA 4DBBA 1TJ6A 1D6EC 4HCPB 2PE9A 2LJ5A 2LG1A 4K7SA 3VH3B 4JPSA 3A9JA 3PLUA 4GSWA 5DHAB 4EJNA 1ET9A 1SE9A 2D5GA 1QILA 4KV2A 1WGQA 2WX0A 3KSYA 2IYDB 1WGYA 2YEPB 3GB1A 4WJ7A 3NSUA 2AQ3B 4P1BC 4ZYNA 3L08A 4AP4C 4HXDA 2WXKA 5D3XA 1HQRD 4REZA 2K8BA 3SDLC 5H8YE 1P7FA 3A33B 2HJ1A 4PS8A 4IUMB 2BBCA 4EZKA 1ZPSA 1N6ZA 3ZTCA 4NAWA 2FCSA 1YN3A 3L17A 2BYVE 2XBBC 4HPMB 4HHVA 1RRBA 1I7HA 1HTQA 3QBVB 2P0FA 2RVBB 1KFYB 4LDTD 4F1SA 2D3AA 2NS5A 2WXLA 5JHHA 5J17A 1TT5B 2FJUB 4ACFA 1B9RA 1MK9B 1LXDA 4RM9A 2CKHB 2ZPYA 3AE9B 3LYYA 5C6RA 1CMXB 4OZBA 5AZFA 2BWES 3M1IB 2NBVA 3MTNB 1LO5D 1ET6A 2DLBA 5DCNA 2KNBA 3VUXA 4MJSB 2LASA 2MDXA 1P7EA 4A3OA 4DHZE 1V5TA 4HB2B 4DIXA 1FHOA 3UIOB 4LNFA 2OHFA 4KSKC 3RI7C 1V5OA 2FE8A 3MFGA 1WIAA 5CX3A 3JVZX 4A20A 3W5UB 4A3PA 2X8XX 2NPTB 4WWNA 4BOSC 3PP2A 3A8QA 2WXPA 3ZO5B 5IAAC 1FRDA 1H10A 1WM3A 3NOBA 4QAYA 1FRRA 2CY5A 2K3UA 1C4AA 2NBUA 4BVUC 4KKJA 1E9MA 2N9LA 2MWSB 3Q3FA 1AYFA 2RGFA 4HJKA 5C16A 5C2TB 4K1RB 1I4RA 4YXDB 4BKSD 3PGEA 3H1UA 4ARCA 1NTVA 4GZUA 4RH6A 3R8BA 3Q2AC 4IKGA 4IM3A 1UEFA 2Z0EB 3H7SA 1RFKA 3VR9B 2MBBB 4OHJA 2J4XA 4ZDVA 5LOPB 3W1YA 1NVLA 1TS5A 2Z13A 4FA6A 2PEAA 4I6LB 2UWQA 3H8HA 2I1JA 1E8YA 4EMOA 2DYOA 3ZNHB 2BB6A 1QOFA 3VUYA 1FIQA 3DHGC 3VRAB 3KLSX 1PGBA 3VOQA 1FNVA 1QOGA 1OQYA 1VLBA 1UWMA 1FFUA 2VH2A 2INCC 5EE3A 4GDLB 2C60A 3EECA 1YD8U 2M17A 2KR0A 2PVOD 3SFEB 4DK5A 1SE2A 1VRAB 1V89A 3BVZA 2WXJA 2DKPA 1NTIA 3R2IA 3VXWA 5D3VA 4NPNA 1RM6C 5I2MA 3FAHA 2P8VA 2IO0B 1MKEA 2NR2A 1UGMA 3AEEB 4KGRA 3FILB 3PT2B 4HPLB 5HKHA 1ZP0B 1YQBA 5GOWB 1JQ4A 1YJIA 2BF8B 3PZ8A 1QOAA 2TSSA 2JXTA 2IFSA 1FGYA 5G2NA 2FAZA 2RSGA 2KFJA 2PW9A 3CIRB 4DXGA 4OT1A 3WALA 2RQ1A 4P6VF 4HLEA 2UZSA 1SXTA 3DHHC 1OMWA 1TBEA 1YIWA 3KVFB 3VUWA 1XLOA 2Z0OA 3ZIMA 1PFDA 2EELA 3H7PA 3AE5B 3T06A 1U27A 3VQIA 1LB1A 1RWSA 4K3CA 4P16A 2CU1A 4B6WA 1XLQA 1JWSD 1WSPA 3ZRFA 3Q8BA 1VZ8A 2Z59A 1BAKA 2XEWA 3UQBA 2ON8A 4HJGE 1L2NA 1WJ1A 4M8MA 2BQQA 3UQAA 1FB8A 1NYQA 2YF0A 2WP9B 1UF0A 2KDEB 4C4VA 1ENFA 4JLCA 1ZDXA 3HRDD 5DPWA 4OVZA 1F0ZA 2NTSA 1LW3A 4PQ0A 5FK9C 2WHIA 2Z4DA 3B1LX 3TIXA 5L81A 1T0YA 4R3DA 4P7IA 1V6EA 4HAYB 3ENEA 3DBHB 2KO3A 2KN5A 3PSEB 2HTHB 2VRWB 3DQVA 4MACA 3SD5A 3A1QB 4ANWA 3T8MA 5HG2A 3UF8A 5I2SA 4BKSA 1YQ4B 2ZNVC 2YT1A 4RMAA 2BVCA 2M14A 3GYOA 1OQRA 1VDVA 1K52A 1SGHA 5CTRC 1GGOA 2G9HD 2ZNVB 3DBHI 5AZHA 2GS0A 4QJ5B 4M0WB 5C5BA 1V5UA 2Z0PA 2BT6A 5BYQA 4W9FA 3PRZA 3AV8A 4DDGD 5DH9B 1WGHA 4JX1C 3APDA 2IJ0A 3L54A 1XR0B 1JWBD 4NAMA 5GXGB 4NNJB 4K2OA 1VZ7A 2K2JA 2JVCA 3VAWA 4TUUA 3E9OA 1V8CA 2K5PA 2BYFA 3DPDA 3FEHA 1KOTA 1TY0A 2LEKA 2ICIA 5D7GA 2LD9A 3L13A 1XODA 1DYQA 2IZVB 4F7GA 4AS1A 1V1OA 1J7BA 3DVNV 3N1YC 1U2BA 1PQSA 2N7EA 2IY0B 2ZCCA 3MPXA 4HK2A 1MI1A 2LRUA 3RZWC 2MLBA 2WWZA 5G55A 3SUZA 1U5FA 2KMAA 3RUIB 5JP4A 1L5PA 1DIKA 5LXIB 1L0VB 2M0XA 2CS4A 1PYWD 2JY6A 3QK0A 3X23A 2BKFA 2G45B 4IWQA 2JT4B 1HBKA 1YN5A 2HTME 4HEA1 4LNOA 4W9JA 5JZEB 4X57B 3Q69A 1JW9D 1P0RA 2JP2A 1WXQA 3OAWA 1WMHB 2C7HA 1C1YB 1EWYC 2OTXA 4L6EA 2MW5A 4C56C 2C7MB 1EF5A 1DOIA 1WYGA 4MELA 2D9ZA 3AEGB 3JSVB 3AJ4A 5KQ4A 4W9KA 3NVZA 3UGBB 3ALBA 3VTUA 3CXBB 1BT0A 3L4PA 1WYWB 3DXDA 4D6WA 4W9GA 4G50A 4HWIB 1P98A 1PLSA 3N20C 3AULA 3PVUA 2H88B 1WJ6A 5HFYA 3EHVA 4RF1A 2KFKB 1E8ZA 2RD0A 5IN7A 3GZNB 2GMIC 1KZGA 1TKGA 3ZGZA 1MHXA 4PS7A 1XKEA 4NZLB 5CHFA 3A9KB 1SBBB 4B0EA 1ISNA 3A4SC 5E6OA 2WGSA 4JE3B 5KHQA 1FHWA 1ZM0A 2AWTA 3EUB2 2NCNA 5CHWA 1AWDA 3GZNI 2KUPA 4HAZB 3DXCA 2DHIA 3IXSA 2FIFA 4DXAB 1IBXA 4WJNA 2KMMA 1TGZB 4WWOA 1WE6A 2W82A 1CQVA 4PK1A 1T0RC 3U7ZA 4BBNF 2KIGA 1W1HA 1GC6A 2L0FA 3UINB 1J7CA 2DLWA 1EU3A 2Y5PA 4ZRJA 1LGRA 3GE8C 3N9YC 1H8CA 4YTMB 1A70A 3NUHB 1JWAD 2M4NA 1V88A 4PS3A 3BWUD 4IWPA 3CSFA 1U4AA 2R2OA 1YJ1A 2LGDA 2IDYA 3RZFA 1GUAB 2N4FA 4A6HA 3RD2A 3G9WA 1UBQA 3IT4B 3N30A 3SR6A 5J3YA 2DZMA 1I4PA 4BAXA 2DFKA 2YT2A 1C76A 1GB4A 2JRIB 2IBIB 1RFAA 5DI9B 1YX6B 2V76A 4ZYSA 3TSSA 2KUQA 3E9PA 1MHHE 3RCZA 2ABDA 4BFRA 5IA7A 2DHZA 1UELA 4YSXB 2XK5B 2O6VB 4I6NB 4Q2JA 1C9FA 2C5LC 2CR5A 2WLBA 3OHMB 1NTYA 2M38A 3X0WA 3DDCB 3SEBA 4Z2MB 1DGJA 4ZHOA 1KM7A 1WJ4A 1L7YA 1WI0A 1DYNA 4KKIA 2EMTA 1Q10A 3AE2B 2H7DA 1GPXA 2R09A 4DX90 1ESFA 1PGAA 4CO7A 4IG7B 2YRYA 4DHJD 3VRBB 2DA0A 4S17A 1FXTB 2FUHB 2ELBA 2RGNB 1OTRB 3R2TA 2GLSA 2BS3B 2QHOA 2KMCA 2IO1B 4MT7A 2INNE 1I4QA 2P0HA 1HTOA 4JKEA 5E6PA 1ZOYB 3CWIA 2A5UA 1J0GA 1XCGA 4FXCA 3AE8B 1D5XC 4OW0A 2K49A 2L7RA 3KYDD 1QLBB 4LK0M 2QSDA 3VDZA 3PRMB 1U29A 5G5HA 5LNK1 3T3OA 3HVZA 1GAQB 5HE2A 3OANA 3NWFA 2DTCA 3RNFC 2D9YA 2YLMA 3FVCA 2KN4A 4FULA 5D6JB 1MAIA 2ONQA 2RDGA 3QAQA 1VBHA 2V1YA 2Z0QA 2LXCA 3RFZB 4MK0A 3C0RB 1G6JA 3ULCA 4JQWC 2ROZB 1SIJA 2B76B 4JK7A 2N1WA 2G3QB 4JK9A 3HUIA 1KJTA 2JWUA 2QEJC 2UZRA 1M4VA 4HB4B 5J3QA 4YONA 4KHAA 3A8PA 4RCOA 5TR5A 3SBTA 1EM7A 1E10A 2PZ1A 2VRRB 4IM0A 4D2KA 2DX1A 4MH0E 3AM9A 3PPAA 2R2QA 2JQRB 4B0MA 2LULA 3MHSD 4WVFB 3EGRA 4ANXA 3QWZB 1QC6A 2WXHA 4KGSA 2KDFB 3SFDB 1MPEA 1TS4A 3P4RB 1WGDA 1P6SA 5IOIA 1SEBD 1V86A 1QF6A 3V6EB 5KQ1A 3N3KB 4XDCA 2AQ2B 4S0RA 3SBGA 3RNGC 2L1AA 5IKCM 1TY2A 3WIMA 2WYQA 2FDQA 2GJYA 4A5KA 3BVGA 4WQMA 1NI3A 4O1NA 4US9A 3OG5A 3AB5A 2N7JA 4YT0B 3V60A 2IY1B 3NG0A 5H92C 5GMVA 2QIEB 1WXVA 2I5FA 2GBNA 3PHXB 2VZKB 4GDKA 4M02A 2KX3A 4GB9A 4L1BA 5JHAA 3MC9A 1BMLC 4KGTA 4CSQA 2L76A 4EKUA 2KJRA 3TUOA 3P6AA 1SE3A 3HVDA 4CHKA 1L6VA 4RM8A 2FUG1 2JZPA 1ACAA 2ZZPB 1WXSA 1S1QB 2VH1A 2O2VA 2M1MA 3ETRA 3SO6A 3BK1A 2YT0A 2D11A 3ZXRA 4WJOA 1ST7A 2CJNA 1E7VA 2K1FA 3A9JB 1R7SA 1UNPA 2OEDA 4GOCA 3BIID 2JF5A 3FM8C 4RF0A 3VFKA 3ZJUA 3EC8A 1WE7A 1D5ZC 4BBNC 2LOXA 2KIEA 2L32A 1VR9A 3U8ZA 3ZNZB 2JSVX 1KH0A 1RLFA 1JCKB 4IWOA 2X0SA 1XO3A 3WAMA 5DPSA 2KGXB 2FBWB 3Q8FA 4A6QA 4TQ1A 2GUMA 2MQJA 1X1MA 5BMHA 2RDHA 4NAWB 4WAFA 4ILHA 1EF1A 2MP2A 2HE7A 5HE0A 1UNSA 2MWNB 2PJHA 1WR6E 4A6FB 4PT5A 2N9EB 2Y3AA 1XT9B 5JHBA 3N1ZC 1F9JA 1KZ7A 5DHFB 2WX1A 3ZVRA 1HXYD 2CHZA 3RNEC 3A4RA 3BYTB 3WAPA 4FJVB 1GB1A 3ZDTA 3IT6B 4JWSC 1X1GA 4HB0B 4LJOB 5LLIA 3RYTA 2V3NA 3QA8A 1WGUA 2YSZA 2KVRA 1IPGA 1N3HA 3NWAA 2JRHA 1NEKB 2NBVB 2OJRA 3JW0X 5E6NA 3V61A 1F77A 3VVWB 1XD3B 3O96A 2KX0A 4JIOU 1KBLA 3KH0A 3QCAA 2NMQA 4GU2A 2EMSA 5HHDG 3RCPA 3U7DA 5FI0A 1EUVB 4Y94A 4LCDE 3B2FA 2REXA 1BUIC 1EAZA 2N1VA 1IRSA 1WH3A 4KSLC 2DHKA 3Q3MC 1T3QA 4II2B 3FP5A 3PSCA 2DX5A 3DBRB 3P2BA 3M63B 1ZXHA 1F52A 4K17A 1T77A 2KYWA 1JDEA 2QCZA 3AMZA 4US8A 1WGGA 3T3NA 1ACCA 4P1CC 1U5EA 2QJLA 4LLGM 3Q3NC 4HCNB 2ZW1A 5M4YB 1WFYA 2K8CA 2RR9A 2B3AA 3PZ7A 2I1KA 3DBRI 1PUTA 4LTUA 2GCJA 2KTRA 3KWVA 2KLCA 4LNKA 4RGMA 5AEKB 5BMIA 1V80A 1KI1B 2FCNA 1XLNA 2WU2B 4JKBA 3Q8CA 2GI9A 2KWVB 1U5GA 2WXOA 4RGTA 3QJZA 1KLUD 1BWNA 5FR6A 3GOEA 3DBSA 3B08A 4J6IA 4HDOA 3BY4B 2WDRB 4KZCA 1X11A 1N60A 3I5JC 1Z87A 3URYA 4DHZB 4XWWA 3F0WA 2O6VD 2L00B 3OLMD 2EKEC 2MBQA 1NYRA 2WXGA 1DOXA 4WURA 3TJPA 1K8RB 2UVMA 1DDWA 2BGFA 3Q8EA 3E56A 3APCA 2WXIA 2MSED 1YNTE 2I38A 3Q3JA 1L6UA 2CQUA 3F5RA 1JROA 2VSZA 3BINA 2W2XD 2WQYB 2HD5B 1JWMD 3TEZA 2CRFA 4MSMB 2ACZB 3R7QA 4KHOA 2LFIA 2R2YA 2LI5A 2W9NA 1TQZA 1WJMA 4KDIC 2L1CA 4HAVB 5IP4D 5DPTA 2BW2A 2KHWB 4EUTA 3W9CB 5D3WA 4LDTB 2E6XA 4F7UP 1JALA 1R4NI 2GBKA 4WJQA 3IAM1 3K9OB 4JKGA 2JWZA 2N9KA 2Y8GA 3Q3OC 2XQNM 2MHJA 1C3TA 4B9KA 3V62A 5G5GA 1J8CA 4JKFA 3H7PB 3T9LA 3N7CA 4NQKE 2SAKA 1N5XA 1FFVA 2KAJA 2PE6B 2K6DB 1FM0D 2CU3A 4WIPA 2N0SB 4TMAB 3KUDB 3VH4B 1M94A 3MP9A 1EU4A 2BKRB 2ZKMX 2Z59B 4CQNA 4B6HA 2COFA 2ZW0A 4F7HA 1V5MA 2YEPF 1NVID 4RFBA 1JRPA 3AE4B 4HRSA 5L83A 3P4PB 4ZRPA 1HA5A 2J59M 2LVOA 1P1AA 3BYYB 3CF6E 1TXDA 1LFDA 3P4QB 1K5GB 4BBKA 2Y5BB 3I63C 4C4VB 2BS4B 3GP7A 2PKOA 3KUZA 2EKIA 3PRPB 1TS2A 4KX6B 2KC2A 3IFWB 4NJ7A 1VD2A 1Q5WB 5D2MB 3NZ3A 1V1PB 3ZRCA 4W9DA 4YWGG 2K0PA 2RNRB 5FKAC 1GC7A 4JWUC 2MJDA 3RMKC 4L2YA 3NY5A 2DZKA 3C19A 4HAWB 1L4ZB 1TZOA 1ROEA 3ZJTA 4A6KA 1T6BX 3GE3C 4GN1A 4JKAA 2GBMA 1HB8A 3TL5A 4GPTB 4EEWA 3O13A 2YS5A 3QC8B 4KIKA 3ULBA 2LVQA 3ML8A 2QKMA 2PPHA 4G3XB 3A98B 2YS1A 3RNCC 2JZ3B 2RSUA 3V05A 4JGHB 1B1ZA 4CYEA 3NWDA 3D8DA 3DWMA 4MY6A 3LJUX 3B0AA 1AWEA 1KTKA 3W1SA 4PNKA 1XF5L 2KDIA 1OFFA 4EFOA 3SU8X 1M7RA 1SB3C 3U12A 5LONB 3TFMA 2UU7A 2MRPA 3O65B 4DDID 3L16A 1Y56A 1ZKHA 2VZKD 1FEHA 1MVKA 4NSWA 2LUMA 5CLQB 2R82A 2EC1A 1VBGA 5AUKA 4K81A 4YSZB 1HEZE 2JPHA 2V9HA 4MGYE 2WXRA 4C7YA 3HSAA 2ELAA 1RRPB 1EVHA 4PYZA 1ZW7A 4NQLB 3DHIC 2D3GA 3N32A 2FCQA 3P63A 3Q14C 2IPKD 4XDDA 3P7ZA 2ZCBA 2JUOA 2W54A 1A5RA 2GCLA 4MH8A 1WX7A 1P5TA 2MA9B 2OOBB 3U4EG 2SEBD 5EE9A 4MM3A 1Q0WB 4UDUC 2M0AA 3WA0A 2RDBC 3SV1A 4MEMA 4IC7B 4KDLB 1UWXA 5DPRA 3TEXA 1E6EB 2K22A 1FXIA 4AUQC 3AEBB 4TKNA
chains in the Genus database with same CATH topology
1B55A 3DOWA 3R66C 1YX5B 3LJ3A 2KZRA 4WWPA 2AYOB 2DZJA 2NZ8B 1X1FA 4TV3A 1Z2MA 2CODA 3IVFA 2AEHA 2DKQA 4AJYB 4NJ6A 5KHOA 2ZEQA 2M8SA 2KWCA 1E5WA 1WRDB 3JYUA 2LBBA 1WF9A 3ML9A 1XQQA 3TBLD 1I35A 1UNRA 4ANUA 1X05A 4B95A 4XZ4A 2V3SA 4W9CA 3ZDMC 3PTFC 1WJNA 4LJPB 1RAXA 3ODWA 3V5WA 5J2RA 3H9DA 3M3JA 2DAJA 1SIFA 2VKIA 1V9JA 5DIFB 2DZIA 1V49A 4IW0A 4FLHA 2N0YA 4F7ZA 3APFA 1DROA 1OY2A 3PHWB 4AJWA 2LUEA 4EOYA 5AZGA 4MJSA 2J0KA 2D9VA 3KY9A 2CHXA 3PS6A 2CB8A 1ZSQA 1FGZA 4HAXB 2C7NB 4HDQA 1WR1A 2UYZB 3VHTC 1Z5SB 1NI2A 4G0NB 2MBEA 3KUCB 4DX8A 1BTKA 2G35A 2NPTA 4NY0A 1Y8RC 1RJ2A 1TTNA 3CIKA 4H8SA 4WJPA 3ZNID 3UZTA 3DVGX 4N9F4 5C23A 1HB6A 3TW1A 2DYBA 2KLGA 2J0MA 1ZC3B 2OQBA 1VCBA 1WG7A 2LKOA 1SHCA 2NMBA 2ASQA 1WX9A 2KD0A 3ZUNA 2E2XA 3CMMB 1GJZA 1DDVA 2RLOA 1P3RA 3CSTA 4ASWC 2DHJA 2MBHA 3PVWA 4C0AA 1WZ0A 1JRUA 1R4MI 2KOXA 1M7EA 3SYXA 2RPQA 4DBGA 4KHBB 3KRXA 4II3B 5D94A 5EFXA 4MGIE 3PREA 4A6FA 3E66A 2HRJA 3M62B 4GMVA 5JH5C 4GDLA 2KK8A 4WAAA 4EZLA 3WAOA 4OVVA 2LZ6A 4AWJA 4JL9A 2KXJA 2ZVOA 1UBIA 2K39A 3HM3A 2KJ6A 2GOWA 1WM2A 3D8FA 3DBLI 1XX0A 3ZTDA 2NVUI 1Y5OA 5D27A 1UPRA 3OJ4B 3AU5A 4FBJB 3MJWA 2L05A 2RUKB 2MFQA 3ZW3A 2LGXA 1QZEA 1I2HA 1XD4A 2G4SA 4XX5A 2KJHB 4E3CA 4URKA 4DWFA 4CHMA 2FJLA 1WY8A 3L0WB 4TYZA 2KTFA 2DN6A 1PFJA 1UH6A 1WXMA 3NZUA 1MIZB 4IOYX 5JLJB 1V5PA 3IG3A 3PG7A 3UIPB 3AXCA 2N7DA 3ZKJC 4PYUA 2K2UA 4F8CB 1UD7A 3U30A 3D32A 1ZC4B 4GIVA 2HTHA 2BYEA 3HM6X 3A1QA 4OVUA 4ZRKA 1ZGUB 4FN2A 4MGZE 2GBRA 2N23A 4GDKB 4JKHA 2BCJA 5HE3A 3HK0A 2LWPA 1E90A 4DHJB 5CLLB 3V6CB 3E9LA 2FJ9A 3TVVA 2O2VB 4ILJA 2JXXA 2WH5A 2DYMA 1DBHA 4JK8A 2IYBA 4IFSA 3KW5B 2JZZA 4CHJA 4W9LA 4BOZB 1D3ZA 5C79A 5EDSA 3GYPA 4ANVA 1E8XA 2DENB 3PLVA 3ENBA 2H7EA 1KC7A 3KZ1A 4K7UA 5D3YA 3QARA 2MP2B 1OGWA 3FSSA 5CHVC 2I5CA 3QWMA 1TZ1A 2NBWB 4GGQA 1Y19B 3KYCD 2Z0DB 1K5DB 3TMPB 1Q67A 2QKLA 2DIKA 2EJ8A 2LVPA 3ZLZA 4XWXA 1OEYA 2K6QA 3ODOA 2J0JA 4FJZA 1QQGA 2J7QB 3DVGY 4TQ0A 1WMHA 2D2QA 1OQNA 4D0NB 3KRWA 2A4ZA 4JKDA 2KDBA 4FADA 3JSVA 1WX8A 3OJ3A 3VTVA 1U5DA 3IBEA 3EPYA 1GG3A 2DX5B 2Y7BA 3TCAA 3K9PB 2D10A 3IHPC 4GMXB 1WI1A 1FAOA 4HAUB 2KFKA 4MDKE 1GNUA 4YL8A 3HHMA 2KTRB 3ONSA 4E71A 3A9KA 3PV1A 3QHTA 1WGRA 2IO3B 1H4RA 5J3TA 2AL6A 1MG8A 4EZJA 3ECIA 2LRWA 4K2PA 3QX1A 1ZVRA 5HE1A 4HVBA 2DAFA 3QIJA 3ODXA 2P0DA 1EO6A 5C1ZA 1NU2A 4E74A 1UPQA 2ROVA 2LOZA 3ZVVA 3ML4A 2LXAA 2COAA 2ADZA 1DDMA 2FNJB 2V4LA 3RT3B 2D4QA 2D07B 2MX2A 5KCVA 4WSFA 1FOEA 2N9PC 1AQCA 2WDTB 4AOFA 1J19A 2GBJA 2BWFA 4ICVA 2YVCA 4K7WA 5JVLA 4HATB 2KWUB 1V81A 3VIAA 3DVNU 1NBFC 2L8JA 4W9IA 3HQCA 2LYDA 2CAYA 2Y8FA 5C5BB 2COCA 4KAXB 3VTWA 2LGYA 4IAPA 3L10B 1I42A 2K00A 2XK5A 2O6VA 3NZSA 5IJMA 3HW2B 4JKGB 1WXAA 1HE8A 2MBOA 4MGKE 2K25A 1WJUA 4BKGA 2ZJDA 4ICUA 2D9WA 1IP9A 3EFUA 3R7RA 2FIDA 2DYNA 3DXEA 3WANA 1Q1OA 4KVGB 3AI5A 1MK7B 1IYFA 4ZRIA 4GXBA 4ILGB 3FLVA 3WYFB 2N9XA 1LM8B 3RULA 3ZNGC 3I3TB 1LQBA 1UZXB 2X18A 3NHEB 1AARA 3NS8A 4KZ0A 1NDDA 3H6NA 1X86A 3D8EA 4FJYA 4MSQB 4W9HA 1I7AA 4HB3B 4G11A 2D9XA 4JKCA 4I6PA 5FI1A 2KQ7A 2G4DB 1KLVA 4KIKB 1MPHA 2ZPNA 1P9DU 1V61A 2KQSA 2COPA 2IO2B 5LXHA 3SNHA 3DCGA 2HJ8A 2YS3A 3W1SC 5L95C 3PEGA 3QQ8B 2AL3A 3PVLA 3BJIA 5J18A 2W2XC 3SHQA 2W2WA 2CHWA 3AU4A 4FHKA 5BO4B 4M8NA 4WQOB 2L2IA 2KCJA 1UNQA 2KC1A 3R3MA 1S3SG 3LDZE 1W1DA 1EGXA 4IM2A 3MDBC 2KANA 1P3QU 2L3ZA 2MKRA 2MCNB 3TO1A 2CY4A 1E7UA 5JHGA 4Z2NA 2DYQA 1PMSA 4FHJA 2L0TA 3PZDA 3S2AA 1BTNA 3M95A 1OEYJ 1J0WA 2BPSA 2K8HA 2C9WB 1W1GA 4W9EA 4XC2A 3HIZA 2ZVNA 2Q13A 1V2YA 2KKCA 1E8WA 2FCMA 1WZ3A 1MIXA 1WVHA 2R0DA 1FHXA 4BKTA 4DBBA 1TJ6A 4HCPB 2PE9A 2LJ5A 2LG1A 4K7SA 3VH3B 3A9JA 3PLUA 4GSWA 5DHAB 4EJNA 1SE9A 4KV2A 1WGQA 2WX0A 3KSYA 2IYDB 1WGYA 4WJ7A 3NSUA 4ZYNA 3L08A 4AP4C 4HXDA 5D3XA 2K8BA 3SDLC 3A33B 4PS8A 4IUMB 4EZKA 3ZTCA 4NAWA 2FCSA 3L17A 2BYVE 2XBBC 4HPMB 4HHVA 1RRBA 3QBVB 2P0FA 2RVBB 4LDTD 4F1SA 2NS5A 5JHHA 5J17A 1MK9B 1LXDA 4RM9A 2CKHB 2ZPYA 5C6RA 1CMXB 5AZFA 2BWES 3M1IB 3MTNB 5DCNA 2KNBA 3VUXA 4MJSB 2MDXA 2LASA 4A3OA 4DHZE 1V5TA 4HB2B 1FHOA 3UIOB 4KSKC 1V5OA 1WIAA 5CX3A 3JVZX 4A20A 4A3PA 2NPTB 4WWNA 4BOSC 3PP2A 3A8QA 3ZO5B 5IAAC 1H10A 1WM3A 3NOBA 2CY5A 2NBUA 4BVUC 3Q3FA 2MWSB 2RGFA 4HJKA 5C16A 4K1RB 4BKSD 3PGEA 3H1UA 1NTVA 4GZUA 4IM3A 1UEFA 2Z0EB 3H7SA 2MBBB 4ZDVA 5LOPB 3W1YA 1NVLA 4FA6A 2PEAA 4I6LB 2UWQA 2I1JA 1E8YA 4EMOA 2DYOA 3ZNHB 3VUYA 3VOQA 1OQYA 4GDLB 2C60A 3EECA 1YD8U 2M17A 4DK5A 1V89A 2DKPA 1NTIA 3VXWA 5D3VA 4NPNA 2P8VA 2IO0B 1MKEA 2NR2A 1UGMA 3PT2B 4HPLB 5HKHA 1YQBA 5GOWB 2BF8B 2IFSA 1FGYA 5G2NA 2FAZA 2RSGA 2KFJA 3WALA 2RQ1A 4HLEA 2UZSA 1OMWA 1TBEA 1YIWA 3KVFB 3VUWA 2Z0OA 3ZIMA 3H7PA 3T06A 1U27A 3VQIA 1LB1A 2CU1A 4B6WA 3ZRFA 1BAKA 2XEWA 3UQBA 1L2NA 1WJ1A 4M8MA 3UQAA 1FB8A 2YF0A 2KDEB 4JLCA 5DPWA 1LW3A 4PQ0A 3B1LX 3TIXA 5L81A 1T0YA 4P7IA 1V6EA 4HAYB 3ENEA 2KO3A 2KN5A 3PSEB 2HTHB 2VRWB 3DQVA 3SD5A 3A1QB 4ANWA 3T8MA 3UF8A 4BKSA 2ZNVC 2YT1A 4RMAA 2M14A 3GYOA 1SGHA 5CTRC 1GGOA 2ZNVB 3DBHI 5AZHA 2GS0A 4M0WB 5C5BA 1V5UA 2Z0PA 4W9FA 3PRZA 4DDGD 5DH9B 1WGHA 3APDA 3L54A 1XR0B 4NNJB 4K2OA 2K2JA 2JVCA 3VAWA 4TUUA 3E9OA 2BYFA 3DPDA 3FEHA 1KOTA 5D7GA 2LD9A 3L13A 1XODA 2IZVB 4F7GA 3DVNV 1U2BA 1PQSA 2N7EA 2IY0B 2ZCCA 3MPXA 4HK2A 2LRUA 3RZWC 2MLBA 2WWZA 5G55A 3SUZA 1U5FA 2KMAA 3RUIB 5JP4A 1DIKA 5LXIB 2M0XA 2CS4A 2JY6A 3QK0A 3X23A 2BKFA 2G45B 4IWQA 2JT4B 1HBKA 4W9JA 5JZEB 4X57B 1P0RA 2JP2A 3OAWA 1WMHB 2C7HA 1C1YB 2OTXA 4L6EA 2MW5A 2C7MB 1EF5A 4MELA 2D9ZA 3JSVB 3AJ4A 5KQ4A 4W9KA 3UGBB 3ALBA 3VTUA 3CXBB 1BT0A 1WYWB 3DXDA 4W9GA 4G50A 4HWIB 1P98A 1PLSA 3AULA 3PVUA 1WJ6A 3EHVA 2KFKB 1E8ZA 2RD0A 2GMIC 1KZGA 4PS7A 1XKEA 5CHFA 3A9KB 1ISNA 3A4SC 5E6OA 5KHQA 1FHWA 1ZM0A 2AWTA 5CHWA 2NCNA 3GZNI 2KUPA 4HAZB 3DXCA 2DHIA 2FIFA 4DXAB 4WJNA 4WWOA 1TGZB 1WE6A 4BBNF 1W1HA 1GC6A 2L0FA 3UINB 2DLWA 4ZRJA 1H8CA 2M4NA 1V88A 4PS3A 4IWPA 3CSFA 1U4AA 2R2OA 1YJ1A 2LGDA 3RZFA 1GUAB 2N4FA 4A6HA 3RD2A 3G9WA 1UBQA 3N30A 5J3YA 2DZMA 2DFKA 2JRIB 2IBIB 1RFAA 5DI9B 1YX6B 2V76A 3E9PA 3RCZA 2ABDA 4BFRA 5IA7A 2DHZA 1UELA 2XK5B 2O6VB 4I6NB 2C5LC 2CR5A 1NTYA 2M38A 3X0WA 3DDCB 4Z2MB 1KM7A 1WJ4A 1L7YA 1WI0A 1DYNA 2EMTA 2H7DA 2R09A 4DX90 4CO7A 4IG7B 2YRYA 4DHJD 2DA0A 1FXTB 2FUHB 2ELBA 2RGNB 1OTRB 2QHOA 2KMCA 2IO1B 4MT7A 2P0HA 4JKEA 5E6PA 2A5UA 1J0GA 1XCGA 2L7RA 3KYDD 3VDZA 3PRMB 1U29A 5HE2A 3OANA 2DTCA 2D9YA 2YLMA 4FULA 5D6JB 1MAIA 3QAQA 1VBHA 2V1YA 2Z0QA 2LXCA 4MK0A 3C0RB 1G6JA 4JQWC 3ULCA 2ROZB 4JK7A 2N1WA 2G3QB 4JK9A 1KJTA 2UZRA 4HB4B 5J3QA 4YONA 4KHAA 3A8PA 5TR5A 3SBTA 2PZ1A 2VRRB 4IM0A 2DX1A 4MH0E 3PPAA 2R2QA 2LULA 3MHSD 4WVFB 4ANXA 3QWZB 1QC6A 2KDFB 1WGDA 1P6SA 1V86A 3V6EB 5KQ1A 3N3KB 3SBGA 3WIMA 2WYQA 2FDQA 2GJYA 4A5KA 3V60A 2IY1B 5GMVA 1WXVA 2I5FA 2GBNA 3PHXB 4GDKA 2KX3A 4GB9A 5JHAA 2L76A 4EKUA 2KJRA 3P6AA 4CHKA 4RM8A 1ACAA 2ZZPB 1WXSA 1S1QB 2O2VA 2M1MA 3SO6A 2YT0A 2D11A 4WJOA 1ST7A 1E7VA 2K1FA 3A9JB 1UNPA 4GOCA 2JF5A 3FM8C 3VFKA 3EC8A 1WE7A 4BBNC 2LOXA 3U8ZA 3ZNZB 1RLFA 4IWOA 2X0SA 3WAMA 5DPSA 2KGXB 4TQ1A 2MQJA 1X1MA 4NAWB 4ILHA 1EF1A 2MP2A 2HE7A 5HE0A 2MWNB 2PJHA 1WR6E 4A6FB 2N9EB 1XT9B 5JHBA 1F9JA 1KZ7A 5DHFB 2WX1A 3ZVRA 2CHZA 3A4RA 3WAPA 4FJVB 3ZDTA 1X1GA 4HB0B 4LJOB 5LLIA 3RYTA 3QA8A 1WGUA 2YSZA 2KVRA 1IPGA 1N3HA 2JRHA 2NBVB 2OJRA 3JW0X 5E6NA 3V61A 3VVWB 1XD3B 3O96A 2KX0A 4JIOU 1KBLA 3KH0A 3QCAA 4GU2A 2EMSA 3RCPA 3U7DA 5FI0A 1EUVB 4Y94A 4LCDE 2REXA 1EAZA 2N1VA 1IRSA 1WH3A 4KSLC 2DHKA 4II2B 3FP5A 3PSCA 2DX5A 3P2BA 3M63B 4K17A 1JDEA 1WGGA 1U5EA 4HCNB 1WFYA 2K8CA 2RR9A 2B3AA 2I1KA 3DBRI 2GCJA 2KTRA 2KLCA 5AEKB 1V80A 1KI1B 2FCNA 4JKBA 2KWVB 1U5GA 3QJZA 1BWNA 5FR6A 3GOEA 3DBSA 3B08A 4J6IA 4HDOA 3BY4B 4KZCA 1X11A 4DHZB 1Z87A 3F0WA 2O6VD 2L00B 3OLMD 2EKEC 2MBQA 3TJPA 1K8RB 2UVMA 1DDWA 2BGFA 3APCA 2MSED 3Q3JA 2CQUA 3F5RA 2VSZA 3BINA 2W2XD 2HD5B 2CRFA 4MSMB 3R7QA 4KHOA 2LI5A 2W9NA 1TQZA 1WJMA 4KDIC 2L1CA 4HAVB 5DPTA 2KHWB 4EUTA 5D3WA 4LDTB 4F7UP 2GBKA 1R4NI 4WJQA 3K9OB 4JKGA 2JWZA 2Y8GA 2XQNM 1C3TA 4B9KA 3V62A 1J8CA 4JKFA 3H7PB 3T9LA 3N7CA 4NQKE 2PE6B 2K6DB 3KUDB 3VH4B 1M94A 2BKRB 2Z59B 4B6HA 2COFA 4F7HA 1V5MA 5L83A 2J59M 2LVOA 1P1AA 3CF6E 1TXDA 1LFDA 1K5GB 4BBKA 2Y5BB 3KUZA 3PRPB 2KC2A 3IFWB 4NJ7A 1VD2A 1Q5WB 5D2MB 3ZRCA 4W9DA 2RNRB 1GC7A 3NY5A 2DZKA 4HAWB 4A6KA 4GN1A 4JKAA 2GBMA 1HB8A 3TL5A 4GPTB 4EEWA 2YS5A 3QC8B 4KIKA 3ULBA 2LVQA 3ML8A 2QKMA 2PPHA 4G3XB 3A98B 2YS1A 2JZ3B 2RSUA 4JGHB 4CYEA 3D8DA 4MY6A 3LJUX 3B0AA 1AWEA 3W1SA 4PNKA 2KDIA 4EFOA 3SU8X 1M7RA 5LONB 3TFMA 2MRPA 3O65B 4DDID 3L16A 1ZKHA 4NSWA 5CLQB 2R82A 2EC1A 1VBGA 4K81A 2JPHA 4MGYE 2ELAA 1RRPB 1EVHA 4PYZA 4NQLB 1ZW7A 2D3GA 3N32A 2FCQA 3P7ZA 2ZCBA 2JUOA 1A5RA 2GCLA 1WX7A 1P5TA 2MA9B 2OOBB 4MM3A 1Q0WB 3WA0A 3SV1A 4MEMA 4IC7B 4KDLB 5DPRA 4AUQC 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B55 A;  3DOW A;  3R66 C;  1YX5 B;  3LJ3 A;  2KZR A;  4WWP A;  2AYO B;  2DZJ A;  2NZ8 B;  1X1F A;  4TV3 A;  1Z2M A;  2COD A;  3IVF A;  2AEH A;  2DKQ A;  4AJY B;  4NJ6 A;  5KHO A;  2ZEQ A;  2M8S A;  2KWC A;  1E5W A;  1WRD B;  3JYU A;  2LBB A;  1WF9 A;  3ML9 A;  1XQQ A;  3TBL D;  1I35 A;  1UNR A;  4ANU A;  1X05 A;  4B95 A;  4XZ4 A;  2V3S A;  4W9C A;  3ZDM C;  3PTF C;  1WJN A;  4LJP B;  1RAX A;  3ODW A;  3V5W A;  5J2R A;  3H9D A;  3M3J A;  2DAJ A;  1SIF A;  2VKI A;  1V9J A;  5DIF B;  2DZI A;  1V49 A;  4IW0 A;  4FLH A;  2N0Y A;  4F7Z A;  3APF A;  1DRO A;  1OY2 A;  3PHW B;  4AJW A;  2LUE A;  4EOY A;  5AZG A;  4MJS A;  2J0K A;  2D9V A;  3KY9 A;  2CHX A;  3PS6 A;  2CB8 A;  1ZSQ A;  1FGZ A;  4HAX B;  2C7N B;  4HDQ A;  1WR1 A;  2UYZ B;  3VHT C;  1Z5S B;  1NI2 A;  4G0N B;  2MBE A;  3KUC B;  4DX8 A;  1BTK A;  2G35 A;  2NPT A;  4NY0 A;  1Y8R C;  1RJ2 A;  1TTN A;  3CIK A;  4H8S A;  4WJP A;  3ZNI D;  3UZT A;  3DVG X;  4N9F 4;  5C23 A;  1HB6 A;  3TW1 A;  2DYB A;  2KLG A;  2J0M A;  1ZC3 B;  2OQB A;  1VCB A;  1WG7 A;  2LKO A;  1SHC A;  2NMB A;  2ASQ A;  1WX9 A;  2KD0 A;  3ZUN A;  2E2X A;  3CMM B;  1GJZ A;  1DDV A;  2RLO A;  1P3R A;  3CST A;  4ASW C;  2DHJ A;  2MBH A;  3PVW A;  4C0A A;  1WZ0 A;  1JRU A;  1R4M I;  2KOX A;  1M7E A;  3SYX A;  2RPQ A;  4DBG A;  4KHB B;  3KRX A;  4II3 B;  5D94 A;  5EFX A;  4MGI E;  3PRE A;  4A6F A;  2HRJ A;  3M62 B;  4GMV A;  5JH5 C;  4GDL A;  2KK8 A;  4WAA A;  4EZL A;  3WAO A;  4OVV A;  2LZ6 A;  4AWJ A;  4JL9 A;  2KXJ A;  2ZVO A;  1UBI A;  2K39 A;  3HM3 A;  2KJ6 A;  2GOW A;  1WM2 A;  3D8F A;  3DBL I;  1XX0 A;  3ZTD A;  2NVU I;  1Y5O A;  5D27 A;  1UPR A;  3OJ4 B;  3AU5 A;  4FBJ B;  3MJW A;  2L05 A;  2RUK B;  2MFQ A;  3ZW3 A;  2LGX A;  1QZE A;  1I2H A;  1XD4 A;  2G4S A;  4XX5 A;  2KJH B;  4E3C A;  4URK A;  4DWF A;  4CHM A;  2FJL A;  1WY8 A;  3L0W B;  4TYZ A;  2KTF A;  2DN6 A;  1PFJ A;  1UH6 A;  1WXM A;  3NZU A;  1MIZ B;  4IOY X;  5JLJ B;  1V5P A;  3IG3 A;  3PG7 A;  3UIP B;  3AXC A;  2N7D A;  3ZKJ C;  4PYU A;  2K2U A;  4F8C B;  1UD7 A;  3U30 A;  3D32 A;  1ZC4 B;  4GIV A;  2HTH A;  2BYE A;  3HM6 X;  3A1Q A;  4OVU A;  4ZRK A;  1ZGU B;  4FN2 A;  4MGZ E;  2GBR A;  2N23 A;  4GDK B;  2BCJ A;  5HE3 A;  3HK0 A;  2LWP A;  1E90 A;  4DHJ B;  5CLL B;  3V6C B;  2FJ9 A;  3TVV A;  2O2V B;  2JXX A;  2WH5 A;  2DYM A;  1DBH A;  2IYB A;  4IFS A;  3KW5 B;  2JZZ A;  4CHJ A;  4W9L A;  4BOZ B;  1D3Z A;  5C79 A;  5EDS A;  3GYP A;  4ANV A;  1E8X A;  2DEN B;  3PLV A;  2H7E A;  3KZ1 A;  4K7U A;  5D3Y A;  3QAR A;  2MP2 B;  1OGW A;  3FSS A;  5CHV C;  2I5C A;  3QWM A;  1TZ1 A;  2NBW B;  4GGQ A;  1Y19 B;  3KYC D;  2Z0D B;  1K5D B;  3TMP B;  1Q67 A;  2QKL A;  2EJ8 A;  2LVP A;  3ZLZ A;  4XWX A;  1OEY A;  2K6Q A;  3ODO A;  2J0J A;  4FJZ A;  1QQG A;  2J7Q B;  3DVG Y;  4TQ0 A;  1WMH A;  2D2Q A;  1OQN A;  4D0N B;  3KRW A;  2A4Z A;  2KDB A;  4FAD A;  3JSV A;  1WX8 A;  3VTV A;  3OJ3 A;  1U5D A;  3IBE A;  3EPY A;  1GG3 A;  2DX5 B;  2Y7B A;  3TCA A;  3K9P B;  2D10 A;  3IHP C;  4GMX B;  1WI1 A;  1FAO A;  4HAU B;  2KFK A;  4MDK E;  1GNU A;  4YL8 A;  3HHM A;  2KTR B;  3ONS A;  4E71 A;  3A9K A;  3PV1 A;  3QHT A;  1WGR A;  2IO3 B;  1H4R A;  5J3T A;  2AL6 A;  1MG8 A;  4EZJ A;  3ECI A;  2LRW A;  4K2P A;  3QX1 A;  1ZVR A;  5HE1 A;  4HVB A;  2DAF A;  3QIJ A;  3ODX A;  2P0D A;  1EO6 A;  5C1Z A;  1NU2 A;  4E74 A;  1UPQ A;  2ROV A;  2LOZ A;  3ZVV A;  3ML4 A;  2LXA A;  2COA A;  2ADZ A;  1DDM A;  2FNJ B;  2V4L A;  3RT3 B;  2D4Q A;  2D07 B;  2MX2 A;  5KCV A;  4WSF A;  1FOE A;  2N9P C;  1AQC A;  2WDT B;  4AOF A;  1J19 A;  2GBJ A;  2BWF A;  4ICV A;  2YVC A;  4K7W A;  4HAT B;  2KWU B;  1V81 A;  3VIA A;  3DVN U;  1NBF C;  2L8J A;  4W9I A;  3HQC A;  2LYD A;  2CAY A;  2Y8F A;  5C5B B;  2COC A;  4KAX B;  3VTW A;  2LGY A;  4IAP A;  3L10 B;  1I42 A;  2K00 A;  2XK5 A;  2O6V A;  3NZS A;  5IJM A;  3HW2 B;  1WXA A;  1HE8 A;  2MBO A;  4MGK E;  2K25 A;  1WJU A;  4BKG A;  2ZJD A;  4ICU A;  2D9W A;  1IP9 A;  3EFU A;  3R7R A;  2FID A;  2DYN A;  3DXE A;  3WAN A;  1Q1O A;  4KVG B;  3AI5 A;  1MK7 B;  1IYF A;  4ZRI A;  4GXB A;  3FLV A;  3WYF B;  2N9X A;  1LM8 B;  3RUL A;  3ZNG C;  3I3T B;  1LQB A;  1UZX B;  2X18 A;  3NHE B;  1AAR A;  3NS8 A;  4KZ0 A;  1NDD A;  3H6N A;  1X86 A;  3D8E A;  4FJY A;  4MSQ B;  4W9H A;  1I7A A;  4HB3 B;  4G11 A;  2D9X A;  4I6P A;  5FI1 A;  2KQ7 A;  2G4D B;  1KLV A;  4KIK B;  1MPH A;  2ZPN A;  1P9D U;  1V61 A;  2KQS A;  2COP A;  2IO2 B;  5LXH A;  3SNH A;  3DCG A;  2HJ8 A;  2YS3 A;  3W1S C;  5L95 C;  3PEG A;  3QQ8 B;  2AL3 A;  3PVL A;  3BJI A;  5J18 A;  2W2X C;  3SHQ A;  2W2W A;  2CHW A;  3AU4 A;  4FHK A;  5BO4 B;  4M8N A;  4WQO B;  2L2I A;  2KCJ A;  1UNQ A;  2KC1 A;  3R3M A;  1S3S G;  3LDZ E;  1W1D A;  1EGX A;  4IM2 A;  3MDB C;  2KAN A;  1P3Q U;  2L3Z A;  2MKR A;  2MCN B;  3TO1 A;  2CY4 A;  1E7U A;  5JHG A;  4Z2N A;  2DYQ A;  1PMS A;  4FHJ A;  2L0T A;  3PZD A;  3S2A A;  1BTN A;  3M95 A;  1OEY J;  1J0W A;  2BPS A;  2K8H A;  2C9W B;  1W1G A;  4W9E A;  4XC2 A;  3HIZ A;  2ZVN A;  2Q13 A;  1V2Y A;  2KKC A;  1E8W A;  2FCM A;  1WZ3 A;  1MIX A;  1WVH A;  2R0D A;  1FHX A;  4BKT A;  4DBB A;  1TJ6 A;  4HCP B;  2PE9 A;  2LJ5 A;  2LG1 A;  4K7S A;  3VH3 B;  3A9J A;  3PLU A;  4GSW A;  5DHA B;  4EJN A;  1SE9 A;  4KV2 A;  1WGQ A;  2WX0 A;  3KSY A;  2IYD B;  1WGY A;  4WJ7 A;  3NSU A;  4ZYN A;  3L08 A;  4AP4 C;  4HXD A;  5D3X A;  2K8B A;  3SDL C;  3A33 B;  4PS8 A;  4IUM B;  4EZK A;  3ZTC A;  4NAW A;  2FCS A;  3L17 A;  2BYV E;  2XBB C;  4HPM B;  4HHV A;  1RRB A;  3QBV B;  2P0F A;  2RVB B;  4LDT D;  4F1S A;  2NS5 A;  5JHH A;  5J17 A;  1MK9 B;  1LXD A;  4RM9 A;  2CKH B;  2ZPY A;  5C6R A;  1CMX B;  5AZF A;  2BWE S;  3M1I B;  3MTN B;  5DCN A;  2KNB A;  3VUX A;  4MJS B;  2MDX A;  2LAS A;  4A3O A;  4DHZ E;  1V5T A;  4HB2 B;  1FHO A;  3UIO B;  4KSK C;  1V5O A;  1WIA A;  5CX3 A;  3JVZ X;  4A20 A;  4A3P A;  2NPT B;  4WWN A;  4BOS C;  3PP2 A;  3A8Q A;  3ZO5 B;  5IAA C;  1H10 A;  1WM3 A;  3NOB A;  2CY5 A;  2NBU A;  4BVU C;  3Q3F A;  2MWS B;  2RGF A;  4HJK A;  5C16 A;  4K1R B;  4BKS D;  3PGE A;  3H1U A;  1NTV A;  4GZU A;  4IM3 A;  1UEF A;  2Z0E B;  3H7S A;  2MBB B;  4ZDV A;  5LOP B;  3W1Y A;  1NVL A;  4FA6 A;  2PEA A;  4I6L B;  2UWQ A;  2I1J A;  1E8Y A;  4EMO A;  2DYO A;  3ZNH B;  3VUY A;  3VOQ A;  1OQY A;  4GDL B;  2C60 A;  3EEC A;  1YD8 U;  2M17 A;  4DK5 A;  1V89 A;  2DKP A;  1NTI A;  3VXW A;  5D3V A;  4NPN A;  2P8V A;  2IO0 B;  1MKE A;  2NR2 A;  1UGM A;  3PT2 B;  4HPL B;  5HKH A;  1YQB A;  5GOW B;  2BF8 B;  2IFS A;  1FGY A;  5G2N A;  2FAZ A;  2RSG A;  2KFJ A;  3WAL A;  2RQ1 A;  4HLE A;  2UZS A;  1OMW A;  1TBE A;  1YIW A;  3KVF B;  3VUW A;  2Z0O A;  3ZIM A;  3H7P A;  3T06 A;  1U27 A;  3VQI A;  1LB1 A;  2CU1 A;  4B6W A;  3ZRF A;  1BAK A;  2XEW A;  3UQB A;  1L2N A;  1WJ1 A;  4M8M A;  3UQA A;  1FB8 A;  2YF0 A;  2KDE B;  4JLC A;  5DPW A;  1LW3 A;  4PQ0 A;  3B1L X;  3TIX A;  5L81 A;  1T0Y A;  4P7I A;  1V6E A;  4HAY B;  3ENE A;  2KO3 A;  2KN5 A;  3PSE B;  2HTH B;  2VRW B;  3DQV A;  3SD5 A;  3A1Q B;  4ANW A;  3T8M A;  3UF8 A;  4BKS A;  2ZNV C;  2YT1 A;  4RMA A;  2M14 A;  3GYO A;  1SGH A;  5CTR C;  2ZNV B;  3DBH I;  5AZH A;  2GS0 A;  4M0W B;  5C5B A;  1V5U A;  2Z0P A;  4W9F A;  3PRZ A;  4DDG D;  5DH9 B;  1WGH A;  3APD A;  3L54 A;  1XR0 B;  4NNJ B;  4K2O A;  2K2J A;  2JVC A;  3VAW A;  4TUU A;  2BYF A;  3DPD A;  3FEH A;  1KOT A;  5D7G A;  2LD9 A;  3L13 A;  1XOD A;  2IZV B;  4F7G A;  3DVN V;  1U2B A;  1PQS A;  2N7E A;  2IY0 B;  2ZCC A;  3MPX A;  4HK2 A;  2LRU A;  3RZW C;  2MLB A;  2WWZ A;  5G55 A;  3SUZ A;  1U5F A;  2KMA A;  3RUI B;  5JP4 A;  5LXI B;  2M0X A;  2CS4 A;  2JY6 A;  3QK0 A;  3X23 A;  2BKF A;  2G45 B;  4IWQ A;  2JT4 B;  1HBK A;  4W9J A;  5JZE B;  4X57 B;  1P0R A;  2JP2 A;  3OAW A;  1WMH B;  2C7H A;  1C1Y B;  2OTX A;  4L6E A;  2MW5 A;  2C7M B;  1EF5 A;  4MEL A;  2D9Z A;  3JSV B;  3AJ4 A;  5KQ4 A;  4W9K A;  3UGB B;  3ALB A;  3VTU A;  3CXB B;  1BT0 A;  1WYW B;  3DXD A;  4W9G A;  4G50 A;  4HWI B;  1P98 A;  1PLS A;  3AUL A;  3PVU A;  1WJ6 A;  3EHV A;  2KFK B;  1E8Z A;  2RD0 A;  2GMI C;  1KZG A;  4PS7 A;  1XKE A;  5CHF A;  3A9K B;  1ISN A;  3A4S C;  5E6O A;  5KHQ A;  1FHW A;  1ZM0 A;  2AWT A;  5CHW A;  2NCN A;  3GZN I;  2KUP A;  4HAZ B;  3DXC A;  2DHI A;  2FIF A;  4DXA B;  4WJN A;  4WWO A;  1TGZ B;  1WE6 A;  4BBN F;  1W1H A;  1GC6 A;  2L0F A;  3UIN B;  2DLW A;  4ZRJ A;  1H8C A;  2M4N A;  1V88 A;  4PS3 A;  4IWP A;  3CSF A;  1U4A A;  2R2O A;  1YJ1 A;  2LGD A;  3RZF A;  1GUA B;  2N4F A;  4A6H A;  3RD2 A;  3G9W A;  1UBQ A;  3N30 A;  5J3Y A;  2DZM A;  2DFK A;  2JRI B;  2IBI B;  1RFA A;  5DI9 B;  1YX6 B;  2V76 A;  3RCZ A;  2ABD A;  4BFR A;  5IA7 A;  2DHZ A;  1UEL A;  2XK5 B;  2O6V B;  4I6N B;  2C5L C;  2CR5 A;  1NTY A;  2M38 A;  3X0W A;  3DDC B;  4Z2M B;  1KM7 A;  1WJ4 A;  1L7Y A;  1WI0 A;  1DYN A;  2EMT A;  2H7D A;  2R09 A;  4DX9 0;  4CO7 A;  4IG7 B;  2YRY A;  4DHJ D;  2DA0 A;  1FXT B;  2FUH B;  2ELB A;  2RGN B;  1OTR B;  2QHO A;  2KMC A;  2IO1 B;  4MT7 A;  2P0H A;  5E6P A;  2A5U A;  1J0G A;  1XCG A;  2L7R A;  3KYD D;  3VDZ A;  3PRM B;  1U29 A;  5HE2 A;  3OAN A;  2DTC A;  2D9Y A;  2YLM A;  4FUL A;  5D6J B;  1MAI A;  3QAQ A;  2V1Y A;  2Z0Q A;  2LXC A;  4MK0 A;  3C0R B;  1G6J A;  4JQW C;  3ULC A;  2ROZ B;  2N1W A;  2G3Q B;  1KJT A;  2UZR A;  4HB4 B;  5J3Q A;  4YON A;  4KHA A;  3A8P A;  5TR5 A;  2PZ1 A;  2VRR B;  4IM0 A;  2DX1 A;  4MH0 E;  3PPA A;  2R2Q A;  2LUL A;  3MHS D;  4WVF B;  4ANX A;  3QWZ B;  1QC6 A;  2KDF B;  1WGD A;  1P6S A;  1V86 A;  3V6E B;  5KQ1 A;  3N3K B;  3WIM A;  2WYQ A;  2FDQ A;  2GJY A;  4A5K A;  3V60 A;  2IY1 B;  5GMV A;  1WXV A;  2I5F A;  2GBN A;  3PHX B;  4GDK A;  2KX3 A;  4GB9 A;  5JHA A;  2L76 A;  4EKU A;  2KJR A;  3P6A A;  4CHK A;  4RM8 A;  1ACA A;  2ZZP B;  1WXS A;  1S1Q B;  2O2V A;  2M1M A;  3SO6 A;  2YT0 A;  2D11 A;  4WJO A;  1ST7 A;  1E7V A;  2K1F A;  3A9J B;  1UNP A;  4GOC A;  2JF5 A;  3FM8 C;  3VFK A;  3EC8 A;  1WE7 A;  4BBN C;  2LOX A;  3U8Z A;  3ZNZ B;  1RLF A;  4IWO A;  3WAM A;  5DPS A;  2KGX B;  4TQ1 A;  2MQJ A;  1X1M A;  4NAW B;  1EF1 A;  2MP2 A;  2HE7 A;  5HE0 A;  2MWN B;  2PJH A;  1WR6 E;  4A6F B;  2N9E B;  1XT9 B;  5JHB A;  1F9J A;  1KZ7 A;  5DHF B;  2WX1 A;  3ZVR A;  2CHZ A;  3A4R A;  3WAP A;  4FJV B;  3ZDT A;  1X1G A;  4HB0 B;  4LJO B;  5LLI A;  3RYT A;  3QA8 A;  1WGU A;  2YSZ A;  2KVR A;  1IPG A;  1N3H A;  3VVW B;  2JRH A;  2NBV B;  2OJR A;  3JW0 X;  5E6N A;  3V61 A;  1XD3 B;  3O96 A;  2KX0 A;  4JIO U;  3KH0 A;  3QCA A;  4GU2 A;  2EMS A;  3RCP A;  3U7D A;  5FI0 A;  1EUV B;  4Y94 A;  4LCD E;  2REX A;  1EAZ A;  2N1V A;  1IRS A;  1WH3 A;  4KSL C;  2DHK A;  4II2 B;  3FP5 A;  3PSC A;  2DX5 A;  3P2B A;  3M63 B;  4K17 A;  1WGG A;  1U5E A;  4HCN B;  1WFY A;  2K8C A;  2RR9 A;  2B3A A;  2I1K A;  3DBR I;  2GCJ A;  2KTR A;  2KLC A;  5AEK B;  1V80 A;  1KI1 B;  2FCN A;  2KWV B;  1U5G A;  3QJZ A;  1BWN A;  5FR6 A;  3GOE A;  3DBS A;  3B08 A;  4J6I A;  4HDO A;  3BY4 B;  4KZC A;  1X11 A;  4DHZ B;  1Z87 A;  3F0W A;  2O6V D;  2L00 B;  3OLM D;  2EKE C;  2MBQ A;  3TJP A;  1K8R B;  2UVM A;  1DDW A;  2BGF A;  3APC A;  2MSE D;  3Q3J A;  2CQU A;  3F5R A;  2VSZ A;  3BIN A;  2W2X D;  2HD5 B;  2CRF A;  4MSM B;  3R7Q A;  4KHO A;  2LI5 A;  2W9N A;  1TQZ A;  1WJM A;  4KDI C;  2L1C A;  4HAV B;  5DPT A;  2KHW B;  4EUT A;  5D3W A;  4LDT B;  4F7U P;  2GBK A;  1R4N I;  4WJQ A;  3K9O B;  2JWZ A;  2Y8G A;  2XQN M;  1C3T A;  4B9K A;  3V62 A;  1J8C A;  3H7P B;  3T9L A;  3N7C A;  4NQK E;  2PE6 B;  2K6D B;  3KUD B;  3VH4 B;  1M94 A;  2BKR B;  2Z59 B;  4B6H A;  2COF A;  4F7H A;  1V5M A;  5L83 A;  2J59 M;  2LVO A;  1P1A A;  3CF6 E;  1TXD A;  1LFD A;  1K5G B;  4BBK A;  2Y5B B;  3KUZ A;  3PRP B;  2KC2 A;  3IFW B;  4NJ7 A;  1VD2 A;  1Q5W B;  5D2M B;  3ZRC A;  4W9D A;  2RNR B;  1GC7 A;  3NY5 A;  2DZK A;  4HAW B;  4A6K A;  4GN1 A;  2GBM A;  1HB8 A;  3TL5 A;  4GPT B;  4EEW A;  2YS5 A;  3QC8 B;  4KIK A;  3ULB A;  2LVQ A;  3ML8 A;  2QKM A;  2PPH A;  4G3X B;  3A98 B;  2YS1 A;  2JZ3 B;  2RSU A;  4JGH B;  4CYE A;  3D8D A;  4MY6 A;  3LJU X;  3B0A A;  1AWE A;  3W1S A;  4PNK A;  2KDI A;  4EFO A;  3SU8 X;  1M7R A;  5LON B;  3TFM A;  2MRP A;  3O65 B;  4DDI D;  3L16 A;  1ZKH A;  4NSW A;  5CLQ B;  2EC1 A;  4K81 A;  2JPH A;  4MGY E;  2ELA A;  1RRP B;  1EVH A;  4PYZ A;  4NQL B;  1ZW7 A;  2D3G A;  3N32 A;  2FCQ A;  3P7Z A;  2ZCB A;  2JUO A;  1A5R A;  2GCL A;  1WX7 A;  1P5T A;  2MA9 B;  2OOB B;  4MM3 A;  1Q0W B;  3WA0 A;  3SV1 A;  4MEM A;  4IC7 B;  4KDL B;  5DPR A;  4AUQ C;  4TKN A; 
#chains in the Genus database with same CATH topology
 1B55 A;  3DOW A;  3PO0 A;  3R66 C;  1YX5 B;  3LJ3 A;  2KZR A;  4WWP A;  2AYO B;  1SF0 A;  2DZJ A;  2NZ8 B;  1FNU A;  4BZA A;  4ITK A;  1X1F A;  2H89 B;  4TV3 A;  2M19 A;  2PMV A;  1Z2M A;  2COD A;  3IVF A;  3NS1 A;  2AEH A;  2DKQ A;  1SJH D;  1F2R C;  4AJY B;  1N61 A;  4NJ6 A;  4C00 A;  5KHO A;  2LHE A;  2ZEQ A;  2DNF A;  2M8S A;  2KWC A;  1ZUD 2;  4LNN A;  1E5W A;  5LG4 B;  1WRD B;  2WDQ B;  3JYU A;  2LBB A;  1ZYI A;  1WF9 A;  3ML9 A;  5E6J A;  1XQQ A;  3TBL D;  4OSN A;  1I35 A;  3HIE A;  2J42 A;  1UNR A;  1XCQ L;  4ANU A;  1X05 A;  3NRZ A;  4B95 A;  4QJ4 B;  1SE4 A;  2V3S A;  4W9C A;  4XZ4 A;  1I4G A;  3ZDM C;  3NVV A;  3PTF C;  2QMT A;  3EA6 A;  2MJ3 A;  3AED B;  5MPO A;  1WJN A;  3AEC B;  4LJP B;  1RAX A;  3ODW A;  3V5W A;  1F2R I;  1V97 A;  5J2R A;  3AE6 B;  3B9J A;  3H9D A;  1IBX B;  3M3J A;  2DAJ A;  3W2D A;  1T0Q C;  2WU5 B;  2X38 A;  4HKQ A;  1SIF A;  1C4P A;  2VKI A;  1V9J A;  5DIF B;  2DZI A;  2MH7 A;  1V49 A;  2G1E A;  4IW0 A;  4AQ7 A;  3ABV B;  4HPP A;  4FLH A;  1AW7 A;  1N63 A;  2N0Y A;  4F7Z A;  3APF A;  1DRO A;  1OY2 A;  3PHW B;  4HSI A;  2LUE A;  4AJW A;  4EOY A;  2AQ1 B;  5AZG A;  1CK1 A;  2J0K A;  2D9V A;  1SSN A;  1TS3 A;  4MJS A;  3KY9 A;  2CHX A;  3PS6 A;  2CB8 A;  1ZSQ A;  2WDV B;  1FGZ A;  3N1X C;  3NVW A;  4HAX B;  2C7N B;  1UGJ A;  4HDQ A;  4GOU A;  1WR1 A;  2V0G A;  2UYZ B;  2WXF A;  3VHT C;  1Z5S B;  1F1H A;  1NI2 A;  4G0N B;  2MBE A;  3KUC B;  4DX8 A;  1BTK A;  2V4I B;  2RMM A;  1FD6 A;  2G35 A;  2LGI A;  1MG4 A;  3ZJV A;  2NPT A;  2LJI A;  2IGH A;  2NTT A;  2L52 A;  4NY0 A;  1Y8R C;  1TYG B;  1RJ2 A;  4XWT A;  1TTN A;  3CIK A;  4H8S A;  1MI0 A;  5D3D A;  1IUE A;  4WJP A;  2J53 A;  2OJW A;  3ZNI D;  3UZT A;  3DVG X;  2JYT A;  4N9F 4;  5C23 A;  4YTN B;  2PTL A;  1HB6 A;  3TW1 A;  2DYB A;  2KLG A;  2J0M A;  1ZC3 B;  4QJ3 B;  2OQB A;  1VCB A;  1WG7 A;  4M00 A;  2LKO A;  1R4M B;  1SHC A;  1TJE A;  2NMB A;  1STE A;  4XE0 A;  2ASQ A;  5IO9 A;  1WX9 A;  1ZXI A;  2KD0 A;  3ZUN A;  2E2X A;  3CMM B;  1GJZ A;  1DDV A;  2PLP A;  2RLO A;  1P3R A;  3CST A;  4ASW C;  2DHJ A;  2MBH A;  1TKE A;  3PVW A;  4C0A A;  1WZ0 A;  1JRU A;  1R4M I;  2KOX A;  1M7E A;  3SYX A;  1WGK A;  2RPQ A;  4N6E B;  4DBG A;  4KHB B;  3KRX A;  4II3 B;  5D94 A;  5EFX A;  4MGI E;  3PRE A;  4A6F A;  4ARI A;  3E9S A;  3E66 A;  3AE3 B;  4RNA A;  3BVM A;  2HRJ A;  3M62 B;  4GMV A;  2WXN A;  2V3P A;  4HKZ E;  5JXV A;  5JH5 C;  4GDL A;  5BYR A;  2KAC A;  2KK8 A;  3EFC A;  4WAA A;  4EZL A;  3WAO A;  3AEA B;  3Q6B A;  5T8I A;  4OVV A;  2LZ6 A;  4AWJ A;  1K51 A;  3DBL B;  4JL9 A;  2KXJ A;  2ZVO A;  1UBI A;  1YJJ A;  2K39 A;  4GLS C;  3FIL A;  3HM3 A;  2XNA C;  2KJ6 A;  2GOW A;  1PDX A;  1WM2 A;  4N58 A;  4RGO S;  1T5X D;  4K3B A;  3D8F A;  3DBL I;  3LXF A;  1FCC C;  1XX0 A;  3ZTD A;  2NVU I;  1Y5O A;  5D27 A;  1UPR A;  5TSS A;  2WS3 B;  3OJ4 B;  3AU5 A;  4FBJ B;  3MJW A;  2KT7 A;  1WWT A;  2L05 A;  2RUK B;  2MFQ A;  3ZW3 A;  2LGX A;  1QZE A;  1I2H A;  1XD4 A;  2G4S A;  4XX5 A;  2KJH B;  3ZQ4 A;  4E3C A;  4URK A;  4DWF A;  1AN8 A;  4CHM A;  1N5W A;  1JWU D;  2FJL A;  1WY8 A;  1XEE A;  3L0W B;  4TYZ A;  2KTF A;  2DN6 A;  1PFJ A;  1UH6 A;  2E3T A;  2WXQ A;  3U2S C;  1WXM A;  3NZU A;  1MIZ B;  4IOY X;  2KWD A;  5JLJ B;  1FCL A;  3FC4 A;  1V5P A;  3IG3 A;  3PG7 A;  3UIP B;  3AXC A;  2N7D A;  3ZKJ C;  4PYU A;  2K2U A;  4F8C B;  1UD7 A;  3U30 A;  2INP E;  3UI3 A;  5IRS A;  3D32 A;  1ZC4 B;  4GIV A;  1QT9 A;  2HTH A;  2BYE A;  3HM6 X;  3A1Q A;  1KRH A;  4OVU A;  1CZP A;  5AUI A;  4ZRK A;  4OZC A;  1ZGU B;  4FN2 A;  4MGZ E;  4HRO A;  4YTP B;  2GBR A;  2N23 A;  4GDK B;  4JKH A;  2BCJ A;  5HE3 A;  4H2A A;  1FO4 A;  3HK0 A;  4A55 A;  2LWP A;  3NVY A;  1YMH E;  2IGD A;  1E90 A;  4DHJ B;  2MJE A;  2BS2 B;  4J3O D;  5CLL B;  3KQ4 A;  1J7A A;  3V6C B;  3E9L A;  4M0W A;  2FJ9 A;  4ZRQ A;  3TVV A;  2O2V B;  2LMC A;  4ZHP A;  4ILJ A;  3V3X A;  2JU6 X;  2LGS A;  2JXX A;  2WH5 A;  1QKZ A;  2DYM A;  2W55 A;  2K8E A;  1DBH A;  4JK8 A;  2IYB A;  4IFS A;  3AEF B;  3I9V 1;  2DWQ A;  3KW5 B;  1MFW A;  2JZZ A;  4CHJ A;  4W9L A;  3AN1 A;  4BOZ B;  1D3Z A;  5C3J B;  4QXA B;  1UUP A;  5C79 A;  5EDS A;  3GYP A;  2L83 A;  2JYE A;  4ANV A;  1E8X A;  2DEN B;  3PLV A;  3ENB A;  2H7E A;  1K50 A;  4A90 A;  1KC7 A;  3KZ1 A;  3J9C A;  2QDF A;  2LHD A;  4K7U A;  4ZOH C;  1EWC A;  5D3Y A;  3QAR A;  2MP2 B;  4DQO C;  1OGW A;  3FSS A;  5CHV C;  2I5C A;  3QWM A;  1TZ1 A;  2NBW B;  4GGQ A;  1Y19 B;  3KYC D;  1YQ3 B;  1D4B A;  2D3B A;  2Z0D B;  1FNW A;  1K5D B;  3BZD B;  3TMP B;  1Q67 A;  2QKL A;  2Z14 A;  5EE0 A;  2DIK A;  2EJ8 A;  2LVP A;  3ZLZ A;  4LNI A;  5BMG A;  4XWX A;  2I2Y A;  1KLG D;  1OEY A;  1GOZ A;  3B77 A;  1BXT A;  3I57 A;  1ZE3 D;  2K6Q A;  4USA A;  3DWG C;  1V1P A;  3ODO A;  3LB8 C;  4IDI A;  2J0J A;  4FJZ A;  2BB5 A;  4C80 A;  1QQG A;  2J7Q B;  3DVG Y;  1R4N B;  4TQ0 A;  1WMH A;  2D2Q A;  1OQN A;  4D0N B;  2J52 A;  1DOY A;  3KRW A;  2A4Z A;  4IOI E;  2GB1 A;  4JKD A;  2KDB A;  1HZ5 A;  4FAD A;  3JSV A;  3ZYY X;  1N62 A;  1WX8 A;  4N59 A;  3OJ3 A;  3VTV A;  1U5D A;  3IBE A;  3EPY A;  1GG3 A;  2DX5 B;  3GS2 A;  4TSS A;  3B2G A;  2Y7B A;  3TCA A;  3K9P B;  2D10 A;  3IHP C;  4GMX B;  3WCQ A;  1WI1 A;  3RNA C;  1FAO A;  4HAU B;  2KFK A;  4MDK E;  4RGN A;  1GNU A;  2BTE A;  4YL8 A;  3P42 A;  1L0X B;  2D3C A;  3HHM A;  3DCX A;  3MJ5 A;  2KTR B;  3ONS A;  5D3I B;  4E71 A;  3A9K A;  4NJC A;  3PV1 A;  3QHT A;  1WGR A;  2IO3 B;  1H4R A;  5J3T A;  2AL6 A;  1MG8 A;  3C8Y A;  4EZJ A;  3ECI A;  2CJO A;  1WRI A;  3AE7 B;  1K53 A;  3U52 E;  2LRW A;  2IND C;  4K2P A;  3QX1 A;  1ZVR A;  5HE1 A;  4HVB A;  2DAF A;  3QIJ A;  1ZDV A;  3BK2 A;  3ODX A;  2P0D A;  1EO6 A;  4EE2 A;  5C1Z A;  1NU2 A;  4GNK B;  4E74 A;  2QIL A;  3RPF C;  1UPQ A;  2ROV A;  2LOZ A;  1FPY A;  3ZVV A;  3ML4 A;  2LXA A;  2COA A;  2ADZ A;  2R61 A;  1DDM A;  2FNJ B;  2V4L A;  3RT3 B;  2D4Q A;  2D07 B;  2MX2 A;  4DXF A;  5KCV A;  4WSF A;  1VJK A;  1FOE A;  1XCT L;  2N9P C;  1AQC A;  3OWE B;  2WDT B;  5HI1 A;  4AOF A;  1J19 A;  4A9A A;  2GBJ A;  2BWF A;  4ICV A;  2YVC A;  1XLP A;  3VR8 B;  4K7W A;  5JVL A;  4HAT B;  2KWU B;  1V81 A;  3VIA A;  3DVN U;  1NBF C;  1QQR A;  1CJE A;  2L8J A;  4W9I A;  3HQC A;  2LYD A;  2CAY A;  2Y8F A;  5C5B B;  2COC A;  3Q8A A;  4XYC A;  4KAX B;  3VTW A;  2LGY A;  4IAP A;  3L10 B;  1I42 A;  4XGA B;  2K00 A;  2XK5 A;  2O6V A;  3RN9 C;  1PGX A;  1RYJ A;  2RPV A;  3NZS A;  2QC8 A;  5IJM A;  2XN9 C;  3HW2 B;  4JKG B;  1WXA A;  1MJD A;  1HE8 A;  2MBO A;  4MGK E;  2K25 A;  1WJU A;  4BKG A;  2WNM A;  2MEK A;  2ZJD A;  1E0Z A;  4ICU A;  3TEY A;  2D9W A;  1IP9 A;  2Q5W D;  3EFU A;  1L0Y B;  3R7R A;  2AX5 A;  1SJE D;  2FID A;  2DYN A;  3DXE A;  3WAN A;  1Q1O A;  1TIF A;  2WXM A;  4KVG B;  1XXG A;  3AI5 A;  1MK7 B;  1IYF A;  4ZRI A;  2Y5C A;  3FKY A;  4GXB A;  4ILG B;  3FLV A;  1IGD A;  3WYF B;  2W3R A;  2GRI A;  2N9X A;  1LM8 B;  3RUL A;  3ZNG C;  3I3T B;  1LQB A;  1UZX B;  1I4H A;  2X18 A;  3NW8 A;  3NHE B;  3P1M A;  1FMA D;  5EE1 A;  1HZ6 A;  1AAR A;  3NS8 A;  5BYS A;  4KZ0 A;  1NDD A;  3TEW A;  1E7P B;  3H6N A;  1X86 A;  3D8E A;  4FJY A;  4MSQ B;  1L4D B;  4W9H A;  4WH4 A;  1I7A A;  4HB3 B;  3AE1 B;  4G11 A;  2D9X A;  1NEN B;  4JKC A;  2JX5 A;  4I6P A;  5FI1 A;  2KQ7 A;  2G4D B;  1C77 A;  1KLV A;  1QOB A;  1MPH A;  4KIK B;  3ZXV A;  1YOV B;  3W5V B;  2ZPN A;  1P9D U;  4MT5 A;  1YN4 A;  4WWM A;  1V61 A;  2KQ4 X;  4C7Z A;  2KQS A;  2COP A;  2IO2 B;  3MC0 B;  5I4D A;  5LXH A;  3SNH A;  3DCG A;  2HJ8 A;  1C4C A;  2YS3 A;  3W1S C;  4L23 A;  5L95 C;  3PEG A;  1KF6 B;  2M56 B;  3A58 A;  3QQ8 B;  1C79 A;  2AL3 A;  3P4S B;  3PVL A;  2KVZ A;  2KDM A;  4OZA A;  3BJI A;  2IGG A;  3NJT A;  5FR3 A;  5J18 A;  2W2X C;  3SHQ A;  4YSY B;  2W2W A;  2CHW A;  2K9X A;  3AU4 A;  4FHK A;  5BO4 B;  4M8N A;  1IGC A;  4WQO B;  2W3S A;  3RNB C;  2L2I A;  2KCJ A;  1D5M C;  2PVG C;  1UNQ A;  1JML A;  2KC1 A;  1OQQ A;  3MHZ A;  3R3M A;  1S3S G;  3LDZ E;  1C78 A;  3IAS 1;  1W1D A;  1EGX A;  4KHB A;  2BYT A;  4IM2 A;  4M01 A;  3MDB C;  2KAN A;  1P3Q U;  2L3Z A;  2MKR A;  2MCN B;  2RRF A;  1VZ6 A;  3KWL A;  2HDE A;  3TO1 A;  2CY4 A;  1FXA A;  1E7U A;  5JHG A;  4Z2N A;  3MC8 A;  2DYQ A;  4MM3 B;  2Z8L A;  1TKY A;  1PMS A;  4FHJ A;  2L0T A;  3PZD A;  4L1R A;  3S2A A;  1BTN A;  3M95 A;  1OEY J;  1J0W A;  1I4X A;  2BPS A;  2PIA A;  2K8H A;  2C9W B;  1W1G A;  4W9E A;  4XC2 A;  3HIZ A;  2ZVN A;  4A8X C;  2Q13 A;  2DBY A;  3AH7 A;  1V2Y A;  2KKC A;  1E8W A;  2FCM A;  1T0S C;  1WZ3 A;  1MIX A;  1WVH A;  2R0D A;  1FHX A;  4BKT A;  4DBB A;  1TJ6 A;  1D6E C;  4HCP B;  2PE9 A;  2LJ5 A;  2LG1 A;  4K7S A;  3VH3 B;  4JPS A;  3A9J A;  3PLU A;  4GSW A;  5DHA B;  4EJN A;  1ET9 A;  1SE9 A;  2D5G A;  1QIL A;  4KV2 A;  1WGQ A;  2WX0 A;  3KSY A;  2IYD B;  1WGY A;  2YEP B;  3GB1 A;  4WJ7 A;  3NSU A;  2AQ3 B;  4P1B C;  4ZYN A;  3L08 A;  4AP4 C;  4HXD A;  2WXK A;  5D3X A;  1HQR D;  4REZ A;  2K8B A;  3SDL C;  5H8Y E;  1P7F A;  3A33 B;  2HJ1 A;  4PS8 A;  4IUM B;  2BBC A;  4EZK A;  1ZPS A;  1N6Z A;  3ZTC A;  4NAW A;  2FCS A;  1YN3 A;  3L17 A;  2BYV E;  2XBB C;  4HPM B;  4HHV A;  1RRB A;  1I7H A;  1HTQ A;  3QBV B;  2P0F A;  2RVB B;  1KFY B;  4LDT D;  4F1S A;  2D3A A;  2NS5 A;  2WXL A;  5JHH A;  5J17 A;  1TT5 B;  2FJU B;  4ACF A;  1B9R A;  1MK9 B;  1LXD A;  4RM9 A;  2CKH B;  2ZPY A;  3AE9 B;  3LYY A;  5C6R A;  1CMX B;  4OZB A;  5AZF A;  2BWE S;  3M1I B;  2NBV A;  3MTN B;  1LO5 D;  1ET6 A;  2DLB A;  5DCN A;  2KNB A;  3VUX A;  4MJS B;  2LAS A;  2MDX A;  1P7E A;  4A3O A;  4DHZ E;  1V5T A;  4HB2 B;  4DIX A;  1FHO A;  3UIO B;  4LNF A;  2OHF A;  4KSK C;  3RI7 C;  1V5O A;  2FE8 A;  3MFG A;  1WIA A;  5CX3 A;  3JVZ X;  4A20 A;  3W5U B;  4A3P A;  2X8X X;  2NPT B;  4WWN A;  4BOS C;  3PP2 A;  3A8Q A;  2WXP A;  3ZO5 B;  5IAA C;  1FRD A;  1H10 A;  1WM3 A;  3NOB A;  4QAY A;  1FRR A;  2CY5 A;  2K3U A;  1C4A A;  2NBU A;  4BVU C;  4KKJ A;  1E9M A;  2N9L A;  2MWS B;  3Q3F A;  1AYF A;  2RGF A;  4HJK A;  5C16 A;  5C2T B;  4K1R B;  1I4R A;  4YXD B;  4BKS D;  3PGE A;  3H1U A;  4ARC A;  1NTV A;  4GZU A;  4RH6 A;  3R8B A;  3Q2A C;  4IKG A;  4IM3 A;  1UEF A;  2Z0E B;  3H7S A;  1RFK A;  3VR9 B;  2MBB B;  4OHJ A;  2J4X A;  4ZDV A;  5LOP B;  3W1Y A;  1NVL A;  1TS5 A;  2Z13 A;  4FA6 A;  2PEA A;  4I6L B;  2UWQ A;  3H8H A;  2I1J A;  1E8Y A;  4EMO A;  2DYO A;  3ZNH B;  2BB6 A;  1QOF A;  3VUY A;  1FIQ A;  3DHG C;  3VRA B;  3KLS X;  1PGB A;  3VOQ A;  1FNV A;  1QOG A;  1OQY A;  1VLB A;  1UWM A;  1FFU A;  2VH2 A;  2INC C;  5EE3 A;  4GDL B;  2C60 A;  3EEC A;  1YD8 U;  2M17 A;  2KR0 A;  2PVO D;  3SFE B;  4DK5 A;  1SE2 A;  1VRA B;  1V89 A;  3BVZ A;  2WXJ A;  2DKP A;  1NTI A;  3R2I A;  3VXW A;  5D3V A;  4NPN A;  1RM6 C;  5I2M A;  3FAH A;  2P8V A;  2IO0 B;  1MKE A;  2NR2 A;  1UGM A;  3AEE B;  4KGR A;  3FIL B;  3PT2 B;  4HPL B;  5HKH A;  1ZP0 B;  1YQB A;  5GOW B;  1JQ4 A;  1YJI A;  2BF8 B;  3PZ8 A;  1QOA A;  2TSS A;  2JXT A;  2IFS A;  1FGY A;  5G2N A;  2FAZ A;  2RSG A;  2KFJ A;  2PW9 A;  3CIR B;  4DXG A;  4OT1 A;  3WAL A;  2RQ1 A;  4P6V F;  4HLE A;  2UZS A;  1SXT A;  3DHH C;  1OMW A;  1TBE A;  1YIW A;  3KVF B;  3VUW A;  1XLO A;  2Z0O A;  3ZIM A;  1PFD A;  2EEL A;  3H7P A;  3AE5 B;  3T06 A;  1U27 A;  3VQI A;  1LB1 A;  1RWS A;  4K3C A;  4P16 A;  2CU1 A;  4B6W A;  1XLQ A;  1JWS D;  1WSP A;  3ZRF A;  3Q8B A;  1VZ8 A;  2Z59 A;  1BAK A;  2XEW A;  3UQB A;  2ON8 A;  4HJG E;  1L2N A;  1WJ1 A;  4M8M A;  2BQQ A;  3UQA A;  1FB8 A;  1NYQ A;  2YF0 A;  2WP9 B;  1UF0 A;  2KDE B;  4C4V A;  1ENF A;  4JLC A;  1ZDX A;  3HRD D;  5DPW A;  4OVZ A;  1F0Z A;  2NTS A;  1LW3 A;  4PQ0 A;  5FK9 C;  2WHI A;  2Z4D A;  3B1L X;  3TIX A;  5L81 A;  1T0Y A;  4R3D A;  4P7I A;  1V6E A;  4HAY B;  3ENE A;  3DBH B;  2KO3 A;  2KN5 A;  3PSE B;  2HTH B;  2VRW B;  3DQV A;  4MAC A;  3SD5 A;  3A1Q B;  4ANW A;  3T8M A;  5HG2 A;  3UF8 A;  5I2S A;  4BKS A;  1YQ4 B;  2ZNV C;  2YT1 A;  4RMA A;  2BVC A;  2M14 A;  3GYO A;  1OQR A;  1VDV A;  1K52 A;  1SGH A;  5CTR C;  1GGO A;  2G9H D;  2ZNV B;  3DBH I;  5AZH A;  2GS0 A;  4QJ5 B;  4M0W B;  5C5B A;  1V5U A;  2Z0P A;  2BT6 A;  5BYQ A;  4W9F A;  3PRZ A;  3AV8 A;  4DDG D;  5DH9 B;  1WGH A;  4JX1 C;  3APD A;  2IJ0 A;  3L54 A;  1XR0 B;  1JWB D;  4NAM A;  5GXG B;  4NNJ B;  4K2O A;  1VZ7 A;  2K2J A;  2JVC A;  3VAW A;  4TUU A;  3E9O A;  1V8C A;  2K5P A;  2BYF A;  3DPD A;  3FEH A;  1KOT A;  1TY0 A;  2LEK A;  2ICI A;  5D7G A;  2LD9 A;  3L13 A;  1XOD A;  1DYQ A;  2IZV B;  4F7G A;  4AS1 A;  1V1O A;  1J7B A;  3DVN V;  3N1Y C;  1U2B A;  1PQS A;  2N7E A;  2IY0 B;  2ZCC A;  3MPX A;  4HK2 A;  1MI1 A;  2LRU A;  3RZW C;  2MLB A;  2WWZ A;  5G55 A;  3SUZ A;  1U5F A;  2KMA A;  3RUI B;  5JP4 A;  1L5P A;  1DIK A;  5LXI B;  1L0V B;  2M0X A;  2CS4 A;  1PYW D;  2JY6 A;  3QK0 A;  3X23 A;  2BKF A;  2G45 B;  4IWQ A;  2JT4 B;  1HBK A;  1YN5 A;  2HTM E;  4HEA 1;  4LNO A;  4W9J A;  5JZE B;  4X57 B;  3Q69 A;  1JW9 D;  1P0R A;  2JP2 A;  1WXQ A;  3OAW A;  1WMH B;  2C7H A;  1C1Y B;  1EWY C;  2OTX A;  4L6E A;  2MW5 A;  4C56 C;  2C7M B;  1EF5 A;  1DOI A;  1WYG A;  4MEL A;  2D9Z A;  3AEG B;  3JSV B;  3AJ4 A;  5KQ4 A;  4W9K A;  3NVZ A;  3UGB B;  3ALB A;  3VTU A;  3CXB B;  1BT0 A;  3L4P A;  1WYW B;  3DXD A;  4D6W A;  4W9G A;  4G50 A;  4HWI B;  1P98 A;  1PLS A;  3N20 C;  3AUL A;  3PVU A;  2H88 B;  1WJ6 A;  5HFY A;  3EHV A;  4RF1 A;  2KFK B;  1E8Z A;  2RD0 A;  5IN7 A;  3GZN B;  2GMI C;  1KZG A;  1TKG A;  3ZGZ A;  1MHX A;  4PS7 A;  1XKE A;  4NZL B;  5CHF A;  3A9K B;  1SBB B;  4B0E A;  1ISN A;  3A4S C;  5E6O A;  2WGS A;  4JE3 B;  5KHQ A;  1FHW A;  1ZM0 A;  2AWT A;  3EUB 2;  2NCN A;  5CHW A;  1AWD A;  3GZN I;  2KUP A;  4HAZ B;  3DXC A;  2DHI A;  3IXS A;  2FIF A;  4DXA B;  1IBX A;  4WJN A;  2KMM A;  1TGZ B;  4WWO A;  1WE6 A;  2W82 A;  1CQV A;  4PK1 A;  1T0R C;  3U7Z A;  4BBN F;  2KIG A;  1W1H A;  1GC6 A;  2L0F A;  3UIN B;  1J7C A;  2DLW A;  1EU3 A;  2Y5P A;  4ZRJ A;  1LGR A;  3GE8 C;  3N9Y C;  1H8C A;  4YTM B;  1A70 A;  3NUH B;  1JWA D;  2M4N A;  1V88 A;  4PS3 A;  3BWU D;  4IWP A;  3CSF A;  1U4A A;  2R2O A;  1YJ1 A;  2LGD A;  2IDY A;  3RZF A;  1GUA B;  2N4F A;  4A6H A;  3RD2 A;  3G9W A;  1UBQ A;  3IT4 B;  3N30 A;  3SR6 A;  5J3Y A;  2DZM A;  1I4P A;  4BAX A;  2DFK A;  2YT2 A;  1C76 A;  1GB4 A;  2JRI B;  2IBI B;  1RFA A;  5DI9 B;  1YX6 B;  2V76 A;  4ZYS A;  3TSS A;  2KUQ A;  3E9P A;  1MHH E;  3RCZ A;  2ABD A;  4BFR A;  5IA7 A;  2DHZ A;  1UEL A;  4YSX B;  2XK5 B;  2O6V B;  4I6N B;  4Q2J A;  1C9F A;  2C5L C;  2CR5 A;  2WLB A;  3OHM B;  1NTY A;  2M38 A;  3X0W A;  3DDC B;  3SEB A;  4Z2M B;  1DGJ A;  4ZHO A;  1KM7 A;  1WJ4 A;  1L7Y A;  1WI0 A;  1DYN A;  4KKI A;  2EMT A;  1Q10 A;  3AE2 B;  2H7D A;  1GPX A;  2R09 A;  4DX9 0;  1ESF A;  1PGA A;  4CO7 A;  4IG7 B;  2YRY A;  4DHJ D;  3VRB B;  2DA0 A;  4S17 A;  1FXT B;  2FUH B;  2ELB A;  2RGN B;  1OTR B;  3R2T A;  2GLS A;  2BS3 B;  2QHO A;  2KMC A;  2IO1 B;  4MT7 A;  2INN E;  1I4Q A;  2P0H A;  1HTO A;  4JKE A;  5E6P A;  1ZOY B;  3CWI A;  2A5U A;  1J0G A;  1XCG A;  4FXC A;  3AE8 B;  1D5X C;  4OW0 A;  2K49 A;  2L7R A;  3KYD D;  1QLB B;  4LK0 M;  2QSD A;  3VDZ A;  3PRM B;  1U29 A;  5G5H A;  5LNK 1;  3T3O A;  3HVZ A;  1GAQ B;  5HE2 A;  3OAN A;  3NWF A;  2DTC A;  3RNF C;  2D9Y A;  2YLM A;  3FVC A;  2KN4 A;  4FUL A;  5D6J B;  1MAI A;  2ONQ A;  2RDG A;  3QAQ A;  1VBH A;  2V1Y A;  2Z0Q A;  2LXC A;  3RFZ B;  4MK0 A;  3C0R B;  1G6J A;  3ULC A;  4JQW C;  2ROZ B;  1SIJ A;  2B76 B;  4JK7 A;  2N1W A;  2G3Q B;  4JK9 A;  3HUI A;  1KJT A;  2JWU A;  2QEJ C;  2UZR A;  1M4V A;  4HB4 B;  5J3Q A;  4YON A;  4KHA A;  3A8P A;  4RCO A;  5TR5 A;  3SBT A;  1EM7 A;  1E10 A;  2PZ1 A;  2VRR B;  4IM0 A;  4D2K A;  2DX1 A;  4MH0 E;  3AM9 A;  3PPA A;  2R2Q A;  2JQR B;  4B0M A;  2LUL A;  3MHS D;  4WVF B;  3EGR A;  4ANX A;  3QWZ B;  1QC6 A;  2WXH A;  4KGS A;  2KDF B;  3SFD B;  1MPE A;  1TS4 A;  3P4R B;  1WGD A;  1P6S A;  5IOI A;  1SEB D;  1V86 A;  1QF6 A;  3V6E B;  5KQ1 A;  3N3K B;  4XDC A;  2AQ2 B;  4S0R A;  3SBG A;  3RNG C;  2L1A A;  5IKC M;  1TY2 A;  3WIM A;  2WYQ A;  2FDQ A;  2GJY A;  4A5K A;  3BVG A;  4WQM A;  1NI3 A;  4O1N A;  4US9 A;  3OG5 A;  3AB5 A;  2N7J A;  4YT0 B;  3V60 A;  2IY1 B;  3NG0 A;  5H92 C;  5GMV A;  2QIE B;  1WXV A;  2I5F A;  2GBN A;  3PHX B;  2VZK B;  4GDK A;  4M02 A;  2KX3 A;  4GB9 A;  4L1B A;  5JHA A;  3MC9 A;  1BML C;  4KGT A;  4CSQ A;  2L76 A;  4EKU A;  2KJR A;  3TUO A;  3P6A A;  1SE3 A;  3HVD A;  4CHK A;  1L6V A;  4RM8 A;  2FUG 1;  2JZP A;  1ACA A;  2ZZP B;  1WXS A;  1S1Q B;  2VH1 A;  2O2V A;  2M1M A;  3ETR A;  3SO6 A;  3BK1 A;  2YT0 A;  2D11 A;  3ZXR A;  4WJO A;  1ST7 A;  2CJN A;  1E7V A;  2K1F A;  3A9J B;  1R7S A;  1UNP A;  2OED A;  4GOC A;  3BII D;  2JF5 A;  3FM8 C;  4RF0 A;  3VFK A;  3ZJU A;  3EC8 A;  1WE7 A;  1D5Z C;  4BBN C;  2LOX A;  2KIE A;  2L32 A;  1VR9 A;  3U8Z A;  3ZNZ B;  2JSV X;  1KH0 A;  1RLF A;  1JCK B;  4IWO A;  2X0S A;  1XO3 A;  3WAM A;  5DPS A;  2KGX B;  2FBW B;  3Q8F A;  4A6Q A;  4TQ1 A;  2GUM A;  2MQJ A;  1X1M A;  5BMH A;  2RDH A;  4NAW B;  4WAF A;  4ILH A;  1EF1 A;  2MP2 A;  2HE7 A;  5HE0 A;  1UNS A;  2MWN B;  2PJH A;  1WR6 E;  4A6F B;  4PT5 A;  2N9E B;  2Y3A A;  1XT9 B;  5JHB A;  3N1Z C;  1F9J A;  1KZ7 A;  5DHF B;  2WX1 A;  3ZVR A;  1HXY D;  2CHZ A;  3RNE C;  3A4R A;  3BYT B;  3WAP A;  4FJV B;  1GB1 A;  3ZDT A;  3IT6 B;  4JWS C;  1X1G A;  4HB0 B;  4LJO B;  5LLI A;  3RYT A;  2V3N A;  3QA8 A;  1WGU A;  2YSZ A;  2KVR A;  1IPG A;  1N3H A;  3NWA A;  2JRH A;  1NEK B;  2NBV B;  2OJR A;  3JW0 X;  5E6N A;  3V61 A;  1F77 A;  3VVW B;  1XD3 B;  3O96 A;  2KX0 A;  4JIO U;  1KBL A;  3KH0 A;  3QCA A;  2NMQ A;  4GU2 A;  2EMS A;  5HHD G;  3RCP A;  3U7D A;  5FI0 A;  1EUV B;  4Y94 A;  4LCD E;  3B2F A;  2REX A;  1BUI C;  1EAZ A;  2N1V A;  1IRS A;  1WH3 A;  4KSL C;  2DHK A;  3Q3M C;  1T3Q A;  4II2 B;  3FP5 A;  3PSC A;  2DX5 A;  3DBR B;  3P2B A;  3M63 B;  1ZXH A;  1F52 A;  4K17 A;  1T77 A;  2KYW A;  1JDE A;  2QCZ A;  3AMZ A;  4US8 A;  1WGG A;  3T3N A;  1ACC A;  4P1C C;  1U5E A;  2QJL A;  4LLG M;  3Q3N C;  4HCN B;  2ZW1 A;  5M4Y B;  1WFY A;  2K8C A;  2RR9 A;  2B3A A;  3PZ7 A;  2I1K A;  3DBR I;  1PUT A;  4LTU A;  2GCJ A;  2KTR A;  3KWV A;  2KLC A;  4LNK A;  4RGM A;  5AEK B;  5BMI A;  1V80 A;  1KI1 B;  2FCN A;  1XLN A;  2WU2 B;  4JKB A;  3Q8C A;  2GI9 A;  2KWV B;  1U5G A;  2WXO A;  4RGT A;  3QJZ A;  1KLU D;  1BWN A;  5FR6 A;  3GOE A;  3DBS A;  3B08 A;  4J6I A;  4HDO A;  3BY4 B;  2WDR B;  4KZC A;  1X11 A;  1N60 A;  3I5J C;  1Z87 A;  3URY A;  4DHZ B;  4XWW A;  3F0W A;  2O6V D;  2L00 B;  3OLM D;  2EKE C;  2MBQ A;  1NYR A;  2WXG A;  1DOX A;  4WUR A;  3TJP A;  1K8R B;  2UVM A;  1DDW A;  2BGF A;  3Q8E A;  3E56 A;  3APC A;  2WXI A;  2MSE D;  1YNT E;  2I38 A;  3Q3J A;  1L6U A;  2CQU A;  3F5R A;  1JRO A;  2VSZ A;  3BIN A;  2W2X D;  2WQY B;  2HD5 B;  1JWM D;  3TEZ A;  2CRF A;  4MSM B;  2ACZ B;  3R7Q A;  4KHO A;  2LFI A;  2R2Y A;  2LI5 A;  2W9N A;  1TQZ A;  1WJM A;  4KDI C;  2L1C A;  4HAV B;  5IP4 D;  5DPT A;  2BW2 A;  2KHW B;  4EUT A;  3W9C B;  5D3W A;  4LDT B;  2E6X A;  4F7U P;  1JAL A;  1R4N I;  2GBK A;  4WJQ A;  3IAM 1;  3K9O B;  4JKG A;  2JWZ A;  2N9K A;  2Y8G A;  3Q3O C;  2XQN M;  2MHJ A;  1C3T A;  4B9K A;  3V62 A;  5G5G A;  1J8C A;  4JKF A;  3H7P B;  3T9L A;  3N7C A;  4NQK E;  2SAK A;  1N5X A;  1FFV A;  2KAJ A;  2PE6 B;  2K6D B;  1FM0 D;  2CU3 A;  4WIP A;  2N0S B;  4TMA B;  3KUD B;  3VH4 B;  1M94 A;  3MP9 A;  1EU4 A;  2BKR B;  2ZKM X;  2Z59 B;  4CQN A;  4B6H A;  2COF A;  2ZW0 A;  4F7H A;  1V5M A;  2YEP F;  1NVI D;  4RFB A;  1JRP A;  3AE4 B;  4HRS A;  5L83 A;  3P4P B;  4ZRP A;  1HA5 A;  2J59 M;  2LVO A;  1P1A A;  3BYY B;  3CF6 E;  1TXD A;  1LFD A;  3P4Q B;  1K5G B;  4BBK A;  2Y5B B;  3I63 C;  4C4V B;  2BS4 B;  3GP7 A;  2PKO A;  3KUZ A;  2EKI A;  3PRP B;  1TS2 A;  4KX6 B;  2KC2 A;  3IFW B;  4NJ7 A;  1VD2 A;  1Q5W B;  5D2M B;  3NZ3 A;  1V1P B;  3ZRC A;  4W9D A;  4YWG G;  2K0P A;  2RNR B;  5FKA C;  1GC7 A;  4JWU C;  2MJD A;  3RMK C;  4L2Y A;  3NY5 A;  2DZK A;  3C19 A;  4HAW B;  1L4Z B;  1TZO A;  1ROE A;  3ZJT A;  4A6K A;  1T6B X;  3GE3 C;  4GN1 A;  4JKA A;  2GBM A;  1HB8 A;  3TL5 A;  4GPT B;  4EEW A;  3O13 A;  2YS5 A;  3QC8 B;  4KIK A;  3ULB A;  2LVQ A;  3ML8 A;  2QKM A;  2PPH A;  4G3X B;  3A98 B;  2YS1 A;  3RNC C;  2JZ3 B;  2RSU A;  3V05 A;  4JGH B;  1B1Z A;  4CYE A;  3NWD A;  3D8D A;  3DWM A;  4MY6 A;  3LJU X;  3B0A A;  1AWE A;  1KTK A;  3W1S A;  4PNK A;  1XF5 L;  2KDI A;  1OFF A;  4EFO A;  3SU8 X;  1M7R A;  1SB3 C;  3U12 A;  5LON B;  3TFM A;  2UU7 A;  2MRP A;  3O65 B;  4DDI D;  3L16 A;  1Y56 A;  1ZKH A;  2VZK D;  1FEH A;  1MVK A;  4NSW A;  2LUM A;  5CLQ B;  2R82 A;  2EC1 A;  1VBG A;  5AUK A;  4K81 A;  4YSZ B;  1HEZ E;  2JPH A;  2V9H A;  4MGY E;  2WXR A;  4C7Y A;  3HSA A;  2ELA A;  1RRP B;  1EVH A;  4PYZ A;  1ZW7 A;  4NQL B;  3DHI C;  2D3G A;  3N32 A;  2FCQ A;  3P63 A;  3Q14 C;  2IPK D;  4XDD A;  3P7Z A;  2ZCB A;  2JUO A;  2W54 A;  1A5R A;  2GCL A;  4MH8 A;  1WX7 A;  1P5T A;  2MA9 B;  2OOB B;  3U4E G;  2SEB D;  5EE9 A;  4MM3 A;  1Q0W B;  4UDU C;  2M0A A;  3WA0 A;  2RDB C;  3SV1 A;  4MEM A;  4IC7 B;  4KDL B;  1UWX A;  5DPR A;  3TEX A;  1E6E B;  2K22 A;  1FXI A;  4AUQ C;  3AEB B;  4TKN A; 
#chains in the Genus database with same CATH homology
 1B55 A;  3DOW A;  3R66 C;  1YX5 B;  3LJ3 A;  2KZR A;  4WWP A;  2AYO B;  2DZJ A;  2NZ8 B;  1X1F A;  4TV3 A;  1Z2M A;  2COD A;  3IVF A;  2AEH A;  2DKQ A;  4AJY B;  4NJ6 A;  5KHO A;  2ZEQ A;  2M8S A;  2KWC A;  1E5W A;  1WRD B;  3JYU A;  2LBB A;  1WF9 A;  3ML9 A;  1XQQ A;  3TBL D;  1I35 A;  1UNR A;  4ANU A;  1X05 A;  4B95 A;  4XZ4 A;  2V3S A;  4W9C A;  3ZDM C;  3PTF C;  1WJN A;  4LJP B;  1RAX A;  3ODW A;  3V5W A;  5J2R A;  3H9D A;  3M3J A;  2DAJ A;  1SIF A;  2VKI A;  1V9J A;  5DIF B;  2DZI A;  1V49 A;  4IW0 A;  4FLH A;  2N0Y A;  4F7Z A;  3APF A;  1DRO A;  1OY2 A;  3PHW B;  4AJW A;  2LUE A;  4EOY A;  5AZG A;  4MJS A;  2J0K A;  2D9V A;  3KY9 A;  2CHX A;  3PS6 A;  2CB8 A;  1ZSQ A;  1FGZ A;  4HAX B;  2C7N B;  4HDQ A;  1WR1 A;  2UYZ B;  3VHT C;  1Z5S B;  1NI2 A;  4G0N B;  2MBE A;  3KUC B;  4DX8 A;  1BTK A;  2G35 A;  2NPT A;  4NY0 A;  1Y8R C;  1RJ2 A;  1TTN A;  3CIK A;  4H8S A;  4WJP A;  3ZNI D;  3UZT A;  3DVG X;  4N9F 4;  5C23 A;  1HB6 A;  3TW1 A;  2DYB A;  2KLG A;  2J0M A;  1ZC3 B;  2OQB A;  1VCB A;  1WG7 A;  2LKO A;  1SHC A;  2NMB A;  2ASQ A;  1WX9 A;  2KD0 A;  3ZUN A;  2E2X A;  3CMM B;  1GJZ A;  1DDV A;  2RLO A;  1P3R A;  3CST A;  4ASW C;  2DHJ A;  2MBH A;  3PVW A;  4C0A A;  1WZ0 A;  1JRU A;  1R4M I;  2KOX A;  1M7E A;  3SYX A;  2RPQ A;  4DBG A;  4KHB B;  3KRX A;  4II3 B;  5D94 A;  5EFX A;  4MGI E;  3PRE A;  4A6F A;  3E66 A;  2HRJ A;  3M62 B;  4GMV A;  5JH5 C;  4GDL A;  2KK8 A;  4WAA A;  4EZL A;  3WAO A;  4OVV A;  2LZ6 A;  4AWJ A;  4JL9 A;  2KXJ A;  2ZVO A;  1UBI A;  2K39 A;  3HM3 A;  2KJ6 A;  2GOW A;  1WM2 A;  3D8F A;  3DBL I;  1XX0 A;  3ZTD A;  2NVU I;  1Y5O A;  5D27 A;  1UPR A;  3OJ4 B;  3AU5 A;  4FBJ B;  3MJW A;  2L05 A;  2RUK B;  2MFQ A;  3ZW3 A;  2LGX A;  1QZE A;  1I2H A;  1XD4 A;  2G4S A;  4XX5 A;  2KJH B;  4E3C A;  4URK A;  4DWF A;  4CHM A;  2FJL A;  1WY8 A;  3L0W B;  4TYZ A;  2KTF A;  2DN6 A;  1PFJ A;  1UH6 A;  1WXM A;  3NZU A;  1MIZ B;  4IOY X;  5JLJ B;  1V5P A;  3IG3 A;  3PG7 A;  3UIP B;  3AXC A;  2N7D A;  3ZKJ C;  4PYU A;  2K2U A;  4F8C B;  1UD7 A;  3U30 A;  3D32 A;  1ZC4 B;  4GIV A;  2HTH A;  2BYE A;  3HM6 X;  3A1Q A;  4OVU A;  4ZRK A;  1ZGU B;  4FN2 A;  4MGZ E;  2GBR A;  2N23 A;  4GDK B;  4JKH A;  2BCJ A;  5HE3 A;  3HK0 A;  2LWP A;  1E90 A;  4DHJ B;  5CLL B;  3V6C B;  3E9L A;  2FJ9 A;  3TVV A;  2O2V B;  4ILJ A;  2JXX A;  2WH5 A;  2DYM A;  1DBH A;  4JK8 A;  2IYB A;  4IFS A;  3KW5 B;  2JZZ A;  4CHJ A;  4W9L A;  4BOZ B;  1D3Z A;  5C79 A;  5EDS A;  3GYP A;  4ANV A;  1E8X A;  2DEN B;  3PLV A;  3ENB A;  2H7E A;  1KC7 A;  3KZ1 A;  4K7U A;  5D3Y A;  3QAR A;  2MP2 B;  1OGW A;  3FSS A;  5CHV C;  2I5C A;  3QWM A;  1TZ1 A;  2NBW B;  4GGQ A;  1Y19 B;  3KYC D;  2Z0D B;  1K5D B;  3TMP B;  1Q67 A;  2QKL A;  2DIK A;  2EJ8 A;  2LVP A;  3ZLZ A;  4XWX A;  1OEY A;  2K6Q A;  3ODO A;  2J0J A;  4FJZ A;  1QQG A;  2J7Q B;  3DVG Y;  4TQ0 A;  1WMH A;  2D2Q A;  1OQN A;  4D0N B;  3KRW A;  2A4Z A;  4JKD A;  2KDB A;  4FAD A;  3JSV A;  1WX8 A;  3OJ3 A;  3VTV A;  1U5D A;  3IBE A;  3EPY A;  1GG3 A;  2DX5 B;  2Y7B A;  3TCA A;  3K9P B;  2D10 A;  3IHP C;  4GMX B;  1WI1 A;  1FAO A;  4HAU B;  2KFK A;  4MDK E;  1GNU A;  4YL8 A;  3HHM A;  2KTR B;  3ONS A;  4E71 A;  3A9K A;  3PV1 A;  3QHT A;  1WGR A;  2IO3 B;  1H4R A;  5J3T A;  2AL6 A;  1MG8 A;  4EZJ A;  3ECI A;  2LRW A;  4K2P A;  3QX1 A;  1ZVR A;  5HE1 A;  4HVB A;  2DAF A;  3QIJ A;  3ODX A;  2P0D A;  1EO6 A;  5C1Z A;  1NU2 A;  4E74 A;  1UPQ A;  2ROV A;  2LOZ A;  3ZVV A;  3ML4 A;  2LXA A;  2COA A;  2ADZ A;  1DDM A;  2FNJ B;  2V4L A;  3RT3 B;  2D4Q A;  2D07 B;  2MX2 A;  5KCV A;  4WSF A;  1FOE A;  2N9P C;  1AQC A;  2WDT B;  4AOF A;  1J19 A;  2GBJ A;  2BWF A;  4ICV A;  2YVC A;  4K7W A;  5JVL A;  4HAT B;  2KWU B;  1V81 A;  3VIA A;  3DVN U;  1NBF C;  2L8J A;  4W9I A;  3HQC A;  2LYD A;  2CAY A;  2Y8F A;  5C5B B;  2COC A;  4KAX B;  3VTW A;  2LGY A;  4IAP A;  3L10 B;  1I42 A;  2K00 A;  2XK5 A;  2O6V A;  3NZS A;  5IJM A;  3HW2 B;  4JKG B;  1WXA A;  1HE8 A;  2MBO A;  4MGK E;  2K25 A;  1WJU A;  4BKG A;  2ZJD A;  4ICU A;  2D9W A;  1IP9 A;  3EFU A;  3R7R A;  2FID A;  2DYN A;  3DXE A;  3WAN A;  1Q1O A;  4KVG B;  3AI5 A;  1MK7 B;  1IYF A;  4ZRI A;  4GXB A;  4ILG B;  3FLV A;  3WYF B;  2N9X A;  1LM8 B;  3RUL A;  3ZNG C;  3I3T B;  1LQB A;  1UZX B;  2X18 A;  3NHE B;  1AAR A;  3NS8 A;  4KZ0 A;  1NDD A;  3H6N A;  1X86 A;  3D8E A;  4FJY A;  4MSQ B;  4W9H A;  1I7A A;  4HB3 B;  4G11 A;  2D9X A;  4JKC A;  4I6P A;  5FI1 A;  2KQ7 A;  2G4D B;  1KLV A;  4KIK B;  1MPH A;  2ZPN A;  1P9D U;  1V61 A;  2KQS A;  2COP A;  2IO2 B;  5LXH A;  3SNH A;  3DCG A;  2HJ8 A;  2YS3 A;  3W1S C;  5L95 C;  3PEG A;  3QQ8 B;  2AL3 A;  3PVL A;  3BJI A;  5J18 A;  2W2X C;  3SHQ A;  2W2W A;  2CHW A;  3AU4 A;  4FHK A;  5BO4 B;  4M8N A;  4WQO B;  2L2I A;  2KCJ A;  1UNQ A;  2KC1 A;  3R3M A;  1S3S G;  3LDZ E;  1W1D A;  1EGX A;  4IM2 A;  3MDB C;  2KAN A;  1P3Q U;  2L3Z A;  2MKR A;  2MCN B;  3TO1 A;  2CY4 A;  1E7U A;  5JHG A;  4Z2N A;  2DYQ A;  1PMS A;  4FHJ A;  2L0T A;  3PZD A;  3S2A A;  1BTN A;  3M95 A;  1OEY J;  1J0W A;  2BPS A;  2K8H A;  2C9W B;  1W1G A;  4W9E A;  4XC2 A;  3HIZ A;  2ZVN A;  2Q13 A;  1V2Y A;  2KKC A;  1E8W A;  2FCM A;  1WZ3 A;  1MIX A;  1WVH A;  2R0D A;  1FHX A;  4BKT A;  4DBB A;  1TJ6 A;  4HCP B;  2PE9 A;  2LJ5 A;  2LG1 A;  4K7S A;  3VH3 B;  3A9J A;  3PLU A;  4GSW A;  5DHA B;  4EJN A;  1SE9 A;  4KV2 A;  1WGQ A;  2WX0 A;  3KSY A;  2IYD B;  1WGY A;  4WJ7 A;  3NSU A;  4ZYN A;  3L08 A;  4AP4 C;  4HXD A;  5D3X A;  2K8B A;  3SDL C;  3A33 B;  4PS8 A;  4IUM B;  4EZK A;  3ZTC A;  4NAW A;  2FCS A;  3L17 A;  2BYV E;  2XBB C;  4HPM B;  4HHV A;  1RRB A;  3QBV B;  2P0F A;  2RVB B;  4LDT D;  4F1S A;  2NS5 A;  5JHH A;  5J17 A;  1MK9 B;  1LXD A;  4RM9 A;  2CKH B;  2ZPY A;  5C6R A;  1CMX B;  5AZF A;  2BWE S;  3M1I B;  3MTN B;  5DCN A;  2KNB A;  3VUX A;  4MJS B;  2MDX A;  2LAS A;  4A3O A;  4DHZ E;  1V5T A;  4HB2 B;  1FHO A;  3UIO B;  4KSK C;  1V5O A;  1WIA A;  5CX3 A;  3JVZ X;  4A20 A;  4A3P A;  2NPT B;  4WWN A;  4BOS C;  3PP2 A;  3A8Q A;  3ZO5 B;  5IAA C;  1H10 A;  1WM3 A;  3NOB A;  2CY5 A;  2NBU A;  4BVU C;  3Q3F A;  2MWS B;  2RGF A;  4HJK A;  5C16 A;  4K1R B;  4BKS D;  3PGE A;  3H1U A;  1NTV A;  4GZU A;  4IM3 A;  1UEF A;  2Z0E B;  3H7S A;  2MBB B;  4ZDV A;  5LOP B;  3W1Y A;  1NVL A;  4FA6 A;  2PEA A;  4I6L B;  2UWQ A;  2I1J A;  1E8Y A;  4EMO A;  2DYO A;  3ZNH B;  3VUY A;  3VOQ A;  1OQY A;  4GDL B;  2C60 A;  3EEC A;  1YD8 U;  2M17 A;  4DK5 A;  1V89 A;  2DKP A;  1NTI A;  3VXW A;  5D3V A;  4NPN A;  2P8V A;  2IO0 B;  1MKE A;  2NR2 A;  1UGM A;  3PT2 B;  4HPL B;  5HKH A;  1YQB A;  5GOW B;  2BF8 B;  2IFS A;  1FGY A;  5G2N A;  2FAZ A;  2RSG A;  2KFJ A;  3WAL A;  2RQ1 A;  4HLE A;  2UZS A;  1OMW A;  1TBE A;  1YIW A;  3KVF B;  3VUW A;  2Z0O A;  3ZIM A;  3H7P A;  3T06 A;  1U27 A;  3VQI A;  1LB1 A;  2CU1 A;  4B6W A;  3ZRF A;  1BAK A;  2XEW A;  3UQB A;  1L2N A;  1WJ1 A;  4M8M A;  3UQA A;  1FB8 A;  2YF0 A;  2KDE B;  4JLC A;  5DPW A;  1LW3 A;  4PQ0 A;  3B1L X;  3TIX A;  5L81 A;  1T0Y A;  4P7I A;  1V6E A;  4HAY B;  3ENE A;  2KO3 A;  2KN5 A;  3PSE B;  2HTH B;  2VRW B;  3DQV A;  3SD5 A;  3A1Q B;  4ANW A;  3T8M A;  3UF8 A;  4BKS A;  2ZNV C;  2YT1 A;  4RMA A;  2M14 A;  3GYO A;  1SGH A;  5CTR C;  1GGO A;  2ZNV B;  3DBH I;  5AZH A;  2GS0 A;  4M0W B;  5C5B A;  1V5U A;  2Z0P A;  4W9F A;  3PRZ A;  4DDG D;  5DH9 B;  1WGH A;  3APD A;  3L54 A;  1XR0 B;  4NNJ B;  4K2O A;  2K2J A;  2JVC A;  3VAW A;  4TUU A;  3E9O A;  2BYF A;  3DPD A;  3FEH A;  1KOT A;  5D7G A;  2LD9 A;  3L13 A;  1XOD A;  2IZV B;  4F7G A;  3DVN V;  1U2B A;  1PQS A;  2N7E A;  2IY0 B;  2ZCC A;  3MPX A;  4HK2 A;  2LRU A;  3RZW C;  2MLB A;  2WWZ A;  5G55 A;  3SUZ A;  1U5F A;  2KMA A;  3RUI B;  5JP4 A;  1DIK A;  5LXI B;  2M0X A;  2CS4 A;  2JY6 A;  3QK0 A;  3X23 A;  2BKF A;  2G45 B;  4IWQ A;  2JT4 B;  1HBK A;  4W9J A;  5JZE B;  4X57 B;  1P0R A;  2JP2 A;  3OAW A;  1WMH B;  2C7H A;  1C1Y B;  2OTX A;  4L6E A;  2MW5 A;  2C7M B;  1EF5 A;  4MEL A;  2D9Z A;  3JSV B;  3AJ4 A;  5KQ4 A;  4W9K A;  3UGB B;  3ALB A;  3VTU A;  3CXB B;  1BT0 A;  1WYW B;  3DXD A;  4W9G A;  4G50 A;  4HWI B;  1P98 A;  1PLS A;  3AUL A;  3PVU A;  1WJ6 A;  3EHV A;  2KFK B;  1E8Z A;  2RD0 A;  2GMI C;  1KZG A;  4PS7 A;  1XKE A;  5CHF A;  3A9K B;  1ISN A;  3A4S C;  5E6O A;  5KHQ A;  1FHW A;  1ZM0 A;  2AWT A;  5CHW A;  2NCN A;  3GZN I;  2KUP A;  4HAZ B;  3DXC A;  2DHI A;  2FIF A;  4DXA B;  4WJN A;  4WWO A;  1TGZ B;  1WE6 A;  4BBN F;  1W1H A;  1GC6 A;  2L0F A;  3UIN B;  2DLW A;  4ZRJ A;  1H8C A;  2M4N A;  1V88 A;  4PS3 A;  4IWP A;  3CSF A;  1U4A A;  2R2O A;  1YJ1 A;  2LGD A;  3RZF A;  1GUA B;  2N4F A;  4A6H A;  3RD2 A;  3G9W A;  1UBQ A;  3N30 A;  5J3Y A;  2DZM A;  2DFK A;  2JRI B;  2IBI B;  1RFA A;  5DI9 B;  1YX6 B;  2V76 A;  3E9P A;  3RCZ A;  2ABD A;  4BFR A;  5IA7 A;  2DHZ A;  1UEL A;  2XK5 B;  2O6V B;  4I6N B;  2C5L C;  2CR5 A;  1NTY A;  2M38 A;  3X0W A;  3DDC B;  4Z2M B;  1KM7 A;  1WJ4 A;  1L7Y A;  1WI0 A;  1DYN A;  2EMT A;  2H7D A;  2R09 A;  4DX9 0;  4CO7 A;  4IG7 B;  2YRY A;  4DHJ D;  2DA0 A;  1FXT B;  2FUH B;  2ELB A;  2RGN B;  1OTR B;  2QHO A;  2KMC A;  2IO1 B;  4MT7 A;  2P0H A;  4JKE A;  5E6P A;  2A5U A;  1J0G A;  1XCG A;  2L7R A;  3KYD D;  3VDZ A;  3PRM B;  1U29 A;  5HE2 A;  3OAN A;  2DTC A;  2D9Y A;  2YLM A;  4FUL A;  5D6J B;  1MAI A;  3QAQ A;  1VBH A;  2V1Y A;  2Z0Q A;  2LXC A;  4MK0 A;  3C0R B;  1G6J A;  4JQW C;  3ULC A;  2ROZ B;  4JK7 A;  2N1W A;  2G3Q B;  4JK9 A;  1KJT A;  2UZR A;  4HB4 B;  5J3Q A;  4YON A;  4KHA A;  3A8P A;  5TR5 A;  3SBT A;  2PZ1 A;  2VRR B;  4IM0 A;  2DX1 A;  4MH0 E;  3PPA A;  2R2Q A;  2LUL A;  3MHS D;  4WVF B;  4ANX A;  3QWZ B;  1QC6 A;  2KDF B;  1WGD A;  1P6S A;  1V86 A;  3V6E B;  5KQ1 A;  3N3K B;  3SBG A;  3WIM A;  2WYQ A;  2FDQ A;  2GJY A;  4A5K A;  3V60 A;  2IY1 B;  5GMV A;  1WXV A;  2I5F A;  2GBN A;  3PHX B;  4GDK A;  2KX3 A;  4GB9 A;  5JHA A;  2L76 A;  4EKU A;  2KJR A;  3P6A A;  4CHK A;  4RM8 A;  1ACA A;  2ZZP B;  1WXS A;  1S1Q B;  2O2V A;  2M1M A;  3SO6 A;  2YT0 A;  2D11 A;  4WJO A;  1ST7 A;  1E7V A;  2K1F A;  3A9J B;  1UNP A;  4GOC A;  2JF5 A;  3FM8 C;  3VFK A;  3EC8 A;  1WE7 A;  4BBN C;  2LOX A;  3U8Z A;  3ZNZ B;  1RLF A;  4IWO A;  2X0S A;  3WAM A;  5DPS A;  2KGX B;  4TQ1 A;  2MQJ A;  1X1M A;  4NAW B;  4ILH A;  1EF1 A;  2MP2 A;  2HE7 A;  5HE0 A;  2MWN B;  2PJH A;  1WR6 E;  4A6F B;  2N9E B;  1XT9 B;  5JHB A;  1F9J A;  1KZ7 A;  5DHF B;  2WX1 A;  3ZVR A;  2CHZ A;  3A4R A;  3WAP A;  4FJV B;  3ZDT A;  1X1G A;  4HB0 B;  4LJO B;  5LLI A;  3RYT A;  3QA8 A;  1WGU A;  2YSZ A;  2KVR A;  1IPG A;  1N3H A;  2JRH A;  2NBV B;  2OJR A;  3JW0 X;  5E6N A;  3V61 A;  3VVW B;  1XD3 B;  3O96 A;  2KX0 A;  4JIO U;  1KBL A;  3KH0 A;  3QCA A;  4GU2 A;  2EMS A;  3RCP A;  3U7D A;  5FI0 A;  1EUV B;  4Y94 A;  4LCD E;  2REX A;  1EAZ A;  2N1V A;  1IRS A;  1WH3 A;  4KSL C;  2DHK A;  4II2 B;  3FP5 A;  3PSC A;  2DX5 A;  3P2B A;  3M63 B;  4K17 A;  1JDE A;  1WGG A;  1U5E A;  4HCN B;  1WFY A;  2K8C A;  2RR9 A;  2B3A A;  2I1K A;  3DBR I;  2GCJ A;  2KTR A;  2KLC A;  5AEK B;  1V80 A;  1KI1 B;  2FCN A;  4JKB A;  2KWV B;  1U5G A;  3QJZ A;  1BWN A;  5FR6 A;  3GOE A;  3DBS A;  3B08 A;  4J6I A;  4HDO A;  3BY4 B;  4KZC A;  1X11 A;  4DHZ B;  1Z87 A;  3F0W A;  2O6V D;  2L00 B;  3OLM D;  2EKE C;  2MBQ A;  3TJP A;  1K8R B;  2UVM A;  1DDW A;  2BGF A;  3APC A;  2MSE D;  3Q3J A;  2CQU A;  3F5R A;  2VSZ A;  3BIN A;  2W2X D;  2HD5 B;  2CRF A;  4MSM B;  3R7Q A;  4KHO A;  2LI5 A;  2W9N A;  1TQZ A;  1WJM A;  4KDI C;  2L1C A;  4HAV B;  5DPT A;  2KHW B;  4EUT A;  5D3W A;  4LDT B;  4F7U P;  2GBK A;  1R4N I;  4WJQ A;  3K9O B;  4JKG A;  2JWZ A;  2Y8G A;  2XQN M;  1C3T A;  4B9K A;  3V62 A;  1J8C A;  4JKF A;  3H7P B;  3T9L A;  3N7C A;  4NQK E;  2PE6 B;  2K6D B;  3KUD B;  3VH4 B;  1M94 A;  2BKR B;  2Z59 B;  4B6H A;  2COF A;  4F7H A;  1V5M A;  5L83 A;  2J59 M;  2LVO A;  1P1A A;  3CF6 E;  1TXD A;  1LFD A;  1K5G B;  4BBK A;  2Y5B B;  3KUZ A;  3PRP B;  2KC2 A;  3IFW B;  4NJ7 A;  1VD2 A;  1Q5W B;  5D2M B;  3ZRC A;  4W9D A;  2RNR B;  1GC7 A;  3NY5 A;  2DZK A;  4HAW B;  4A6K A;  4GN1 A;  4JKA A;  2GBM A;  1HB8 A;  3TL5 A;  4GPT B;  4EEW A;  2YS5 A;  3QC8 B;  4KIK A;  3ULB A;  2LVQ A;  3ML8 A;  2QKM A;  2PPH A;  4G3X B;  3A98 B;  2YS1 A;  2JZ3 B;  2RSU A;  4JGH B;  4CYE A;  3D8D A;  4MY6 A;  3LJU X;  3B0A A;  1AWE A;  3W1S A;  4PNK A;  2KDI A;  4EFO A;  3SU8 X;  1M7R A;  5LON B;  3TFM A;  2MRP A;  3O65 B;  4DDI D;  3L16 A;  1ZKH A;  4NSW A;  5CLQ B;  2R82 A;  2EC1 A;  1VBG A;  4K81 A;  2JPH A;  4MGY E;  2ELA A;  1RRP B;  1EVH A;  4PYZ A;  4NQL B;  1ZW7 A;  2D3G A;  3N32 A;  2FCQ A;  3P7Z A;  2ZCB A;  2JUO A;  1A5R A;  2GCL A;  1WX7 A;  1P5T A;  2MA9 B;  2OOB B;  4MM3 A;  1Q0W B;  3WA0 A;  3SV1 A;  4MEM A;  4IC7 B;  4KDL B;  5DPR A;  4AUQ C;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...