1H4RA

Crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords MERLIN
total genus 96
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1h4rA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1h4rA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h4rA01
2GBNA 1WXAA 5BO4B 2ZCBA 1S1QB 1RJ2A 3A9KA 4K7UA 2ZCCA 1I35A 1KI1B 1P3RA 1V5UA 3PVWA 2LYDA 3A98B 3L0WB 2LI5A 2MP2A 4HCNB 2P0HA 3NOBA 2IBIB 1H4RA 4HB4B 5LLIA 4BOSC 4A6KA 2L0TA 2J0MA 3EPYA 2YT1A 3A8QA 1P98A 2V76A 1V81A 2WDTB 3KUDB 4HVBA 2YRYA 5HKHA 1A5RA 2NMBA 4GMVA 1BT0A 3TJPA 1N3HA 3JYUA 5D7GA 2MBHA 1H10A 2LG1A 2O6VA 3ALBA 5DPTA 3ZW3A 2G4DB 1SHCA 2ELBA 1XCGA 2M1MA 2KMAA 1CMXB 1F9JA 1WGRA 2D10A 3IVFA 1EO6A 3HIZA 4EZJA 1AQCA 4D0NB 2ZJDA 4TV3A 1HB6A 3V6EB 2AEHA 4BKSA 3MDBC 2L1CA 3ULCA 1U5FA 2MA9B 2N9EB 2NS5A 3NY5A 1FGZA 2GBJA 2LRWA 2G3QB 1RLFA 3PSEB 1P0RA 3UINB 3T9LA 4AP4C 2CRFA 2D3GA 1LXDA 3H7PA 3PPAA 2D9WA 1Q1OA 4JIOU 2CHXA 1XD3B 3SYXA 3VQIA 2DAFA 4BFRA 5C5BA 2MKRA 1XQQA 1YQBA 2W9NA 3VOQA 3PHXB 4LDTB 1WIAA 3F0WA 5LOPB 1XD4A 2LZ6A 3VIAA 3VFKA 4NAWA 5IAAC 1RRBA 2VRRB 3DPDA 3O65B 4W9IA 4ZRJA 4MJSA 4HAXB 1M94A 1MAIA 1V5TA 3PVLA 2DN6A 1WMHB 4II2B 2AYOB 3ZTCA 2LXCA 2GMIC 2Z59B 4W9KA 1MIZB 3I3TB 2KGXB 3NZSA 1MIXA 1Z2MA 3CSTA 3EECA 4G11A 1DBHA 2FDQA 3SNHA 4K7SA 3DVNV 4KIKB 3KYDD 3QX1A 4KV2A 1EUVB 1OQYA 1WGUA 2KK8A 1E5WA 2I1JA 5CLLB 2HTHA 4E71A 4IUMB 2DKQA 2QKLA 4URKA 4MDKE 3ZTDA 2J59M 2WYQA 1V2YA 2M0XA 3MJWA 3LJ3A 3WANA 1X1FA 5IJMA 4IG7B 3RD2A 5IA7A 3KH0A 2YS1A 3O96A 4K81A 5J3TA 3TCAA 1V80A 2EJ8A 3DVGY 3R66C 3ZUNA 2DFKA 2L2IA 4AOFA 3X23A 2RD0A 1KM7A 2BKFA 3WIMA 3U8ZA 3HQCA 1UZXB 2FCNA 5DH9B 3DOWA 1UBIA 1C1YB 3EHVA 4IOYX 5DPWA 4BBNF 4MJSB 3SUZA 1PLSA 2L3ZA 1LW3A 3QWMA 3MTNB 3ONSA 4DX8A 3JW0X 4WJQA 1TBEA 2KJRA 2N9PC 2M14A 3ZNGC 1E8WA 2K8HA 5C5BB 1ZC4B 2RSGA 2K25A 3VXWA 3ZRFA 2D4QA 5G55A 4TQ0A 1P9DU 1I42A 2FCMA 5CX3A 4ICVA 2K2JA 1OMWA 1TQZA 2KLGA 3L54A 4ZRIA 3DQVA 3VAWA 4EOYA 2KJHB 3S2AA 2MP2B 2LVQA 1BTNA 1NTIA 5DI9B 2NPTB 2N0YA 2OQBA 1U5GA 4A3OA 3L13A 1AARA 4WWNA 2NZ8B 2VSZA 4A5KA 4A20A 2G35A 3TIXA 2PJHA 3A8PA 2IZVB 4XZ4A 2IYDB 2KZRA 1KOTA 5JLJB 3VTWA 2JXXA 1VD2A 1NTYA 3LJUX 2K39A 4CHKA 2N7EA 4NPNA 3RZWC 2KD0A 4M8MA 2DZIA 3VUXA 3DBRI 1MK7B 4MM3A 1SE9A 1YX6B 3QARA 4N9F4 4ANVA 2KLCA 4PYZA 2NPTA 1V86A 2KX0A 3RULA 1LQBA 1EF1A 2P8VA 4HLEA 2KC1A 2NBWB 1UD7A 2G45B 1DDMA 5EDSA 4LJOB 3N7CA 3A9JA 1WGHA 3D8FA 2C5LC 4W9CA 5C23A 1HBKA 3CF6E 4GGQA 5L95C 3L10B 3UIPB 3DBSA 2K00A 4PQ0A 2WX0A 2YLMA 4CHJA 5D3WA 2MBEA 3SDLC 2JT4B 3GOEA 1WXVA 3PS6A 4IC7B 3DXEA 4HDQA 1I2HA 2AL3A 2GCLA 2DYOA 1UPRA 3PV1A 1D3ZA 3ZNZB 4DK5A 2L0FA 2KFKA 5D2MB 1UPQA 3D8DA 5LXHA 5CLQB 1WX7A 4EZLA 3ZDTA 5D3VA 1K5GB 1LM8B 1QZEA 2KDBA 2KX3A 4RM9A 1TXDA 3BY4B 4DHZB 4EEWA 1EVHA 3PT2B 2HD5B 3HM3A 4NJ7A 4MGYE 3FP5A 1RAXA 2DYMA 2JVCA 2D9XA 1TZ1A 4MGZE 4FA6A 4KVGB 3EFUA 2IY1B 3L08A 4WAAA 4K7WA 1OY2A 1HE8A 3HHMA 4TQ1A 3NHEB 3RCZA 2DKPA 4GPTB 1V49A 3K9OB 3B1LX 5DHAB 3W1SA 2LBBA 1L2NA 5DIFB 3NSUA 2DZMA 2D9YA 2KDFB 2W2XD 3K9PB 2KTRB 3KRWA 1WI0A 4K2OA 4MGKE 1WM3A 2JRIB 2KJ6A 3ML9A 2RLOA 4BBKA 3SHQA 4HB3B 1WR6E 3EC8A 4MSQB 5JZEB 3R7RA 4M0WB 3APCA 1XKEA 2ZNVC 3CXBB 5HE1A 2LKOA 3ENEA 2A5UA 3PTFC 2ZZPB 4C0AA 2GCJA 3DBHI 4GIVA 4E3CA 4KHBB 4HK2A 2LOXA 1WJ6A 3PLUA 4H8SA 2C9WB 4P7IA 2MWSB 2C7MB 1QC6A 2BYEA 3TBLD 1X1MA 4ASWC 2K2UA 4TYZA 3VH4B 5JHAA 2KCJA 2NVUI 3H1UA 2KOXA 4KZCA 1W1GA 2KNBA 2IY0B 2L05A 5HE3A 3JSVA 2DTCA 1Q67A 2W2WA 2YT0A 3PEGA 2CKHB 2D9ZA 4NQLB 1EAZA 4MT7A 4F7HA 1P3QU 2IYBA 3WA0A 1YIWA 2M8SA 3B08A 1UNPA 5KHOA 1NBFC 2FAZA 1S3SG 1DYNA 3QK0A 2BF8B 4WJPA 4JL9A 4KHOA 3PREA 4ZYNA 4HB0B 2KHWB 5G2NA 4EMOA 2RPQA 1GC7A 2DX5B 1GUAB 1Q0WB 2O6VB 1WGGA 3OLMD 2IFSA 2J0JA 1XT9B 2M17A 2XK5B 3AULA 2MRPA 4KDLB 2REXA 5DPSA 3OJ3A 3VTUA 4RM8A 1HB8A 1IP9A 3RUIB 2KC2A 5E6NA 4HAZB 2GBKA 1Y8RC 3QC8B 1X86A 3VUYA 2JZ3B 2LULA 1FHXA 3QWZB 3A33B 1OEYJ 1P6SA 1TJ6A 4IFSA 2WH5A 1LFDA 2MSED 4MELA 4XC2A 1FOEA 1FHOA 5AZGA 2RR9A 3KYCD 5TR5A 3APFA 5DCNA 1Y5OA 4F1SA 4FADA 3VHTC 1PFJA 2CAYA 2Z0OA 5JHBA 4YL8A 1WH3A 1ISNA 1NU2A 2KANA 1XX0A 2KXJA 3R3MA 1U5DA 2DAJA 2GJYA 2R0DA 2BYVE 4Z2NA 4FJZA 4GOCA 1JRUA 4M8NA 3ZRCA 4DHJD 1IYFA 3H7SA 2MX2A 4DX90 4II3B 4IWQA 1E7VA 2J0KA 1BAKA 2DZJA 5CHFA 2ZVOA 3G9WA 4B95A 1E7UA 2K1FA 4G0NB 3VTVA 1T0YA 3DCGA 2ASQA 5JHGA 2FNJB 4KHAA 2NBVB 3UIOB 1WG7A 1ZW7A 2MFQA 3F5RA 1BWNA 4MH0E 2RGFA 3QQ8B 3DDCB 3N32A 2N1WA 3IG3A 3ZNID 2LGDA 2DYQA 3AXCA 4PS7A 2V4LA 3PG7A 3TL5A 4BKTA 5D6JB 3RYTA 3KSYA 4EKUA 2JF5A 2OJRA 2Z0DB 2GBRA 5AZHA 5J2RA 3LDZE 2JZZA 3QHTA 4A6HA 4F7ZA 2MLBA 4FLHA 2ZEQA 1RRPB 2P0DA 3QAQA 4XX5A 2DZKA 2GBMA 2CHWA 2CQUA 2LXAA 3V62A 3TW1A 4PS8A 1V5MA 2RVBB 3T8MA 2KWUB 1K8RB 1UNRA 2AL6A 5FI1A 2BWES 2EMTA 2Z0QA 5CTRC 4GDLB 2Q13A 3ODOA 4NSWA 1E90A 5J18A 3VUWA 4L6EA 4A3PA 4B6WA 2RNRB 2XQNM 3FSSA 3ODXA 3FM8C 2IO2B 2YSZA 4AWJA 1MPHA 3TVVA 1FXTB 2NCNA 2Z0EB 2DHKA 4GU2A 3ZO5B 5AEKB 1C3TA 2NBUA 3M95A 4MSMB 4MK0A 1W1DA 1GG3A 5C79A 3CIKA 1DROA 3A9KB 4MGIE 1X05A 5HE2A 1V5PA 1WJ1A 2Y8FA 4PNKA 2M4NA 4FJYA 1WXMA 3QBVB 1E8YA 3D32A 2D2QA 2FJ9A 3V6CB 1Z87A 2ROVA 2ZNVB 4HPLB 2N23A 3WYFB 1U5EA 2KN5A 4FN2A 4HPMB 4LCDE 4EZKA 2CHZA 3VH3B 3PGEA 4G50A 4ZRKA 1DDVA 2HRJA 2N9XA 3RZFA 4NY0A 4DHZE 1R4NI 2K8BA 2CODA 1WF9A 4KSLC 2A4ZA 2MWNB 3ODWA 4IM0A 5CHWA 2JPHA 4GZUA 4KSKC 4BKSD 2CY5A 1IRSA 1FAOA 1V5OA 2NR2A 2RGNB 4W9FA 4BKGA 2ZPYA 3UQAA 2YVCA 2LGYA 2R09A 3SO6A 1RFAA 2LRUA 1YX5B 3A1QA 1V88A 5D27A 2XBBC 3A4RA 4WVFB 4WQOB 2IO3B 2KWVB 1J19A 2WX1A 5LXIB 1TGZB 2KFKB 2QKMA 3PLVA 3WAPA 1G6JA 1H8CA 1V89A 2LD9A 4DBGA 3Q3FA 3UF8A 2CS4A 3CMMB 5C16A 1NVLA 1E8ZA 4CO7A 2FCSA 1FHWA 2HTHB 2VKIA 4A6FB 1YJ1A 3P7ZA 1WX8A 2CR5A 2J7QB 3ZVRA 5KCVA 2RSUA 3OJ4B 4W9DA 2YF0A 1UBQA 4GDKA 2COCA 2Y8GA 1WE7A 2LASA 4W9EA 4W9HA 2EMSA 3AU4A 1MG8A 2ABDA 1WJMA 5L81A 1AWEA 1WE6A 2RQ1A 1WR1A 2LJ5A 2UWQA 2UZRA 2X18A 4MY6A 3AI5A 4I6LB 5KHQA 2ELAA 2V3SA 4F7GA 4WJNA 1P5TA 3RCPA 3GZNI 1QQGA 2KVRA 3A4SC 2KTFA 3D8EA 5DPRA 4DDID 4W9GA 4BBNC 1ZKHA 4IM2A 4TUUA 2BYFA 3T06A 2D07B 3IHPC 3JSVB 3R7QA 5L83A 1WM2A 2KWCA 4AJWA 4Y94A 1J0WA 2LVPA 4BOZB 3ZVVA 3PSCA 3RT3B 1KJTA 1V61A 4NNJB 4AUQC 5GOWB 3U30A 2CB8A 4GN1A 3N30A 3W1YA 4HCPB 1WJNA 1XODA 4GXBA 4WJOA 3P6AA 2GOWA 2PPHA 1UGMA 4KAXB 1V9JA 2MBQA 2IO0B 3ECIA 2COAA 3OANA 3V5WA 1Q5WB 2BWFA 2O2VB 2DX1A 2H7DA 3ML8A 4HAVB 4ZDVA 4TKNA 5J3YA 2K6QA 3IBEA 3KY9A 3SV1A 2KTRA 1WZ0A 3MHSD 3QJZA 2QHOA 3ZLZA 4DBBA 1B55A 3X0WA 2DENB 2ADZA 2L76A 2LVOA 2KUPA 2JY6A 3KUZA 4GDLA 3U7DA 1NI2A 3PP2A 2UVMA 2R2OA 1KZ7A 3VVWB 4HATB 1OEYA 4JGHB 2MW5A 2D11A 4I6NB 2N4FA 2UYZB 2EKEC 2CU1A 3Q3JA 3ZKJC 3KRXA 2L8JA 2EC1A 3ZIMA 1MKEA 3C0RB 2PE6B 4AJYB 3IFWB 2B3AA 4ICUA 1UEFA 5JHHA 2VRWB 2DHZA 3PVUA 2O2VA 4KIKA 2D9VA 5J3QA 2MQJA 1WJ4A 4DXAB 1WY8A 2LGXA 2YS3A 4W9LA 4DHJB 4EUTA 4HHVA 2COPA 3ZNHB 3UZTA 5KQ4A 2JUOA 3AU5A 4GDKB 4OVUA 3UGBB 1WMHA 2MCNB 2K6DB 2DYBA 1GJZA 1U27A 2RUKB 4A6FA 4WWPA 1L7YA 3V60A 1BTKA 4MEMA 3OAWA 2BKRB 2KQ7A 1WJUA 2P0FA 2FJLA 4CHMA 2CY4A 2O6VD 5AZFA 3ULBA 3TO1A 4IWOA 4PS3A 3BINA 3HW2B 3AJ4A 2FCQA 1WGYA 2I5CA 1FB8A 1I7AA 1OQNA 1UNQA 3GYOA 2Y7BA 4Z2MB 2BGFA 2N7DA 4X57B 2KDIA 2N1VA 4IM3A 2M38A 2KQSA 3A1QB 3M63B 1X1GA 4G3XB 2Z0PA 3FEHA 2DHJA 3M1IB 5LONB 2DYNA 4WSFA 4W9JA 3KZ1A 2W2XC 1UELA 4HAWB 3QA8A 1KZGA 1OGWA 2PE9A 3B0AA 3W1SC 4E74A 4HAYB 4HWIB 2KO3A 2KFJA 1SIFA 2LWPA 2IO1B 3L17A 4GB9A 3UQBA 4GMXB 2V1YA 2XEWA 3CSFA 2L7RA 3DBLI 2LOZA 3N3KB 4HXDA 4J6IA 3SU8X 4F8CB 4FBJB 5JH5C 1R4MI 4F7UP 2BPSA 2KMCA 5E6OA 1WVHA 4RMAA 1PQSA 2MBOA 4NJ6A 2DHIA 2DX5A 1WGQA 2UZSA 1IPGA 1M7EA 1ZVRA 3GYPA 2G4SA 1EF5A 2KKCA 3A9JB 3QCAA 3BJIA 4KDIC 4FHKA 3FLVA 4IAPA 3DVNU 4KZ0A 1MK9B 3PRPB 3P2BA 4EJNA 5D3XA 3NS8A 3MPXA 4NAWB 1GC6A 5D3YA 1FGYA 3DVGX 3HM6X 4JQWC 4LDTD 1PMSA 5E6PA 3V61A 2H7EA 3KUCB 1X11A 1WXSA 1ZGUB 1YD8U 2KDEB 3APDA 2C60A 3ZDMC 2GS0A 3WALA 5C1ZA 1WYWB 2L00B 1V6EA 1WZ3A 3H7PB 1Y19B 5CHVC 2HE7A 2COFA 2MDXA 3DXCA 2JP2A 4PYUA 5D94A 4LJPB 1NTVA 4HDOA 1VCBA 4FJVB 1U4AA 1NDDA 1J8CA 4FULA 4HB2B 2WWZA 3PRMB 1UH6A 1WFYA 1DDWA 3M62B 4DDGD 2JRHA 4WJ7A 2I1KA 2OTXA 4K1RB 2C7NB 4XWXA 3QIJA 1EGXA 4GSWA 3M3JA 3VDZA 4YONA 5DHFB 4FHJA 2HJ8A 1E8XA 3JVZX 3SD5A 2E2XA 3KW5B 2PZ1A 4K2PA 2ZVNA 3KVFB 1U29A 3ML4A 3L16A 1TTNA 2C7HA 3WAOA 4EFOA 5FI0A 2DA0A 5JP4A 5HE0A 1GNUA 1WGDA 2FIFA 2XK5A 3TFMA 3NZUA 1U2BA 5EFXA 4ANXA 4HAUB 4B6HA 2R2QA 1J0GA 4CYEA 5J17A 1Z5SB 4WWOA 3DXDA 1ZSQA 2I5FA 4ANWA 1M7RA 1XR0B 1ACAA 2MBBB 4K17A 1P1AA 2OOBB 4IWPA 2AWTA 2Y5BB 1WX9A 4IW0A 4DWFA 2BCJA 1WI1A 4I6PA 5FR6A 1OTRB 2K8CA 3TMPB 3PRZA 1LB1A 4B9KA 2PEAA 3HK0A 1ST7A 2ZPNA 4BVUC 2FIDA 3H6NA 1K5DB 2YS5A 1ZC3B 1WRDB 2LUEA 1KLVA 1SGHA 1ZM0A 2JWZA 3H9DA 3WAMA 1W1HA 3PHWB 5GMVA 5KQ1A 5C6RA 2DLWA 2FUHB 4NQKE 4HJKA 4ANUA 3PZDA 4OVVA 4JLCA 2ROZB
chains in the Genus database with same CATH superfamily
1WXAA 2ZCBA 1S1QB 1LGRA 2ON8A 1XCQL 4C4VA 1V5UA 1F52A 1VZ7A 3A98B 3P4SB 2LHDA 4HCNB 3NOBA 1QILA 2IBIB 2L0TA 1V81A 2V76A 3ABVB 1ACCA 4N58A 4GMVA 1TKGA 3AMZA 5D7GA 2LG1A 3ZW3A 1V1PA 3V3XA 3Q3MC 2JSVX 3MDBC 2NS5A 1UNSA 3GP7A 1RLFA 2WXNA 3PSEB 1K50A 1LXDA 3PPAA 1XD3B 3R8BA 1XQQA 2DNFA 3VOQA 5LOPB 1XD4A 4O1NA 3VIAA 5HI1A 3IAS1 5IAAC 2L32A 3O65B 5E6JA 2PMVA 2DN6A 4W9KA 3IAM1 1Z2MA 5BMGA 3CSTA 2FDQA 4EE2A 3QX1A 5TSSA 2DKQA 2QKLA 3WANA 1V2YA 3RD2A 3KH0A 4K81A 3AH7A 1B1ZA 2EJ8A 3RNAC 3HQCA 1UBIA 1C1YB 4BBNF 1LW3A 1TBEA 2K8HA 1VRAB 2D4QA 2V4IB 3R2TA 4EOYA 4JE3B 2KJHB 2MP2B 1GB1A 2LVQA 3AE3B 1NTIA 4JK8A 5DI9B 2PIAA 2N0YA 2GRIA 1U5GA 4A3OA 4M01A 4WWNA 2NZ8B 2G35A 3NRZA 1GAQB 2V0GA 4ARIA 2KZRA 5T8IA 3VTWA 2K39A 1NTYA 3LJUX 2ZW0A 2N7EA 3RZWC 2K5PA 2DZIA 4MM3A 4ANVA 4N9F4 4PYZA 2KX0A 1HTOA 2P8VA 4JKHA 2G45B 1DDMA 3U2SC 5FR3A 3N7CA 1SJED 4W9CA 3D8FA 1DGJA 3L10B 5L95C 4KKIA 3TSSA 3SDLC 2PVOD 2JT4B 2IPKD 1WXVA 2DYOA 2IGDA 3PV1A 2NTTA 3BK1A 5C3JB 2L0FA 2KFKA 3CWIA 5LXHA 3A58A 3TEZA 4US9A 2KX3A 4RM9A 1TXDA 3BY4B 2X8XX 4DHZB 1SE4A 1EVHA 2HD5B 4NJ7A 4MGYE 3FP5A 2DYMA 4MGZE 4WAAA 4KX6B 2KDMA 2M19A 1HEZE 3RCZA 3K9OB 1L2NA 5DHAB 2INCC 4ZRPA 5DIFB 1FIQA 1WI0A 1WM3A 2RLOA 4BBKA 4HB3B 3MFGA 4M0WB 3APCA 2ZNVC 3OHMB 4YXDB 2JU6X 4HK2A 2MWSB 2OJWA 3Q8BA 2BYEA 3TBLD 2WNMA 2K2UA 2WXLA 1SBBB 3EA6A 4YTNB 2W3SA 3TEYA 1NVID 2IY0B 5HE3A 2Y5PA 1FXIA 2CKHB 4NQLB 4F7HA 3HSAA 1I4QA 2FAZA 4AS1A 1HA5A 3KWVA 2O6VB 1WGGA 2FUG1 5IA7A 1XLPA 1KRHA 3RNBC 3QC8B 1J7CA 1X86A 2JZ3B 2LULA 1FEHA 3A33B 2W54A 1LFDA 1T0SC 2RR9A 3KYCD 5TR5A 3APFA 2Z0OA 1IBXA 2GB1A 3R3MA 3CIRB 3UIOB 2R0DA 2BYVE 4US8A 4FJZA 4M8NA 1IYFA 4DXGA 4DX90 1BAKA 1WXQA 2K1FA 3BVGA 3DCGA 4CSQA 3VRBB 1WG7A 2RGFA 2BVCA 1PGAA 2N1WA 2V4LA 4BKTA 2DBYA 4EKUA 3AE9B 2Z0DB 5AZHA 1UWMA 3B2FA 2MLBA 3I57A 3AEAB 2LXAA 3EUB2 3T8MA 1K8RB 1EWYC 2G9HD 5CTRC 4A3PA 2RNRB 3FSSA 3ODXA 2IO2B 1FXTB 1L0VB 3OWEB 3BVZA 4M02A 1RYJA 1I4PA 2N23A 1U5EA 4FN2A 1P7FA 4LCDE 1YN3A 3PGEA 2HRJA 3RZFA 1R4NI 4DIXA 3ODWA 5CHWA 2CJNA 2H88B 4USAA 4BKGA 4JX1C 4BKSD 5JZEB 3A4RA 4WVFB 2IO3B 1J19A 5LXIB 4LLGM 2KFKB 2QKMA 1G6JA 3AN1A 2Z13A 2NMQA 3HUIA 1E8ZA 1FHWA 2HTHB 4A6FB 3H8HA 3OJ4B 3ZVRA 5KCVA 4W9DA 1UBQA 2Y8GA 1WE7A 2EMSA 1MG8A 2ABDA 1AWEA 2JYEA 1WR1A 3AE6B 5KHQA 1VBGA 2V9HA 2V3SA 4ZOHC 1D6EC 1FM0D 3GZNI 1JWMD 5DPRA 2BS4B 5FK9C 4BBNC 1ZKHA 2BYFA 3T06A 4AJWA 4Y94A 1J0WA 5BMHA 3NVWA 4B0EA 1JDEA 3W9CB 3N30A 1XODA 1C76A 2PPHA 1UF0A 1V9JA 3ECIA 3V5WA 2MJDA 2DX1A 4ILHA 3KY9A 2IJ0A 2QHOA 3TUOA 3X0WA 2I2YA 2KUPA 3KUZA 2W3RA 1KZ7A 4PT5A 1OEYA 1WWTA 3KRXA 2EC1A 3KQ4A 3C0RB 4AJYB 3IFWB 2VRWB 1WJ4A 1WY8A 3DHGC 4EUTA 3NG0A 1ZUD2 4HHVA 2EELA 1ZYIA 1XLNA 1YN5A 5M4YB 3ZNHB 1WMHA 2MCNB 1T0QC 1L7YA 1BTKA 2KQ7A 4NZLB 2CY4A 4KGTA 1OQNA 2Y7BA 4XDDA 2KDIA 5GXGB 1X1GA 3FEHA 4WSFA 1JW9D 5HFYA 2W2XC 1DOYA 3NW8A 1UELA 3QA8A 1OGWA 4HAYB 2KFJA 2WXFA 5EE0A 2LWPA 2IO1B 2VZKD 3L17A 4GB9A 3UQBA 4GMXB 2MJ3A 3N3KB 1JWAD 1L6UA 4HEA1 4F7UP 2BPSA 2KMCA 2W82A 4JWSC 1WVHA 1PQSA 1ZVRA 2KKCA 3V62A 4DXFA 1EF5A 3QCAA 1VJKA 4FHKA 1N5XA 4KZ0A 4WH4A 3DWMA 2PVGC 1C4AA 1GC6A 2H7EA 1WXSA 1ZGUB 1TYGB 2KDEB 5EE9A 4P6VF 2KN4A 2L00B 1QOFA 3W5VB 1Y19B 5D94A 3DXCA 2JP2A 2XN9C 4JKGB 1AWDA 1KLUD 4S17A 1UH6A 4DDGD 2IGGA 5C2TB 4GSWA 3M3JA 2HJ8A 1E8XA 2KIGA 2OEDA 4XGAB 2DIKA 4K2PA 1U29A 2X38A 3P4QB 4HKZE 1XXGA 2C7HA 1D4BA 2N9KA 4EFOA 4YT0B 4HAUB 4CYEA 3DBLB 2I5FA 2MBBB 1T3QA 1WX9A 2BCJA 3PRZA 3HK0A 1ST7A 2FIDA 1ZC3B 1WRDB 3N9YC 2LUEA 2LUMA 2INPE 2KR0A 2LHEA 4A90A 1KFYB 5C6RA 1HXYD 4JLCA 4KGSA 4OVVA 2ROZB 2GBNA 5BO4B 4C56C 1I35A 2YEPF 3AE5B 3L0WB 1OQQA 2MP2A 2P0HA 4HB4B 3KUDB 3EPYA 1D5ZC 2YRYA 2NMBA 2MBHA 1H10A 3NWFA 5DPTA 3OG5A 2M1MA 3N20C 1EO6A 4D0NB 2BS3B 3ULCA 2L52A 1FGZA 2GBJA 2G3QB 2CRFA 3UI3A 3H7PA 2CHXA 5C5BA 1YQBA 1I7HA 4IDIA 2RRFA 3L4PA 1WIAA 2LZ6A 3IT6B 4NAWA 1RRBA 4W9IA 4II2B 1WMHB 3ZTCA 3GE3C 4PK1A 2LXCA 2GMIC 3U7ZA 1MIZB 1C79A 2KGXB 3NZSA 2LJIA 3ZYYX 4G11A 4K7SA 3SNHA 4KIKB 1E5WA 5CLLB 2HTHA 1UWXA 4IUMB 2WYQA 1JRPA 1X1FA 5IJMA 4QJ3B 1GGOA 3WIMA 2EKIA 3RNFC 1UZXB 2MH7A 3RN9C 4IOYX 2SAKA 3NVYA 4MJSB 2PLPA 2L3ZA 4DX8A 2JZPA 3JW0X 2BYTA 2KJRA 2GUMA 2M14A 2RSGA 5IP4D 3VXWA 4TQ0A 2LGSA 2J52A 2FCMA 2K2JA 1R4NB 1OMWA 1TQZA 3L54A 4ZRIA 3DQVA 1ZDVA 3ZXVA 4LNNA 3S2AA 1ZP0B 1BTNA 1TS3A 2NPTB 2OQBA 3L13A 4BZAA 2VSZA 1AYFA 4A20A 1C78A 3TIXA 4XZ4A 1PUTA 4ACFA 4J3OD 2IYDB 2RDBC 2JXXA 4CHKA 3P42A 1MK7B 1BXTA 1SE9A 1MPEA 2KLCA 2NPTA 3RULA 1LQBA 2KC1A 4RGNA 3ZJUA 1TZOA 3AEFB 4CHJA 1FRDA 2MBEA 3TEWA 3J9CA 3PS6A 4IC7B 2AL3A 3D8DA 2ACZB 4YSZB 1F2RI 2D9XA 2IDYA 4KVGB 3EFUA 2IY1B 3L08A 5D3DA 3SEBA 4K7WA 3HHMA 4LNOA 1FFVA 1HTQA 1V49A 3B1LX 2WXPA 1SE2A 2LBBA 2WXMA 1E0ZA 1FCCC 3NSUA 2D9YA 5IRSA 2D3CA 3HRDD 4JKFA 3K9PB 4K2OA 2JRIB 1MG4A 4C00A 4MSQB 3CXBB 5HE1A 2LKOA 3ENEA 2ZZPB 4C0AA 3DBHI 4AQ7A 3PLUA 4TMAB 2KCJA 3H1UA 2KOXA 1ZDXA 4KZCA 3O13A 2KNBA 2L05A 2KACA 2DTCA 2YT0A 2OHFA 2D9ZA 2JX5A 1EAZA 4MT7A 5G5HA 2IYBA 2M8SA 3B08A 3QK0A 4ZYNA 1QKZA 3P1MA 4EMOA 1GC7A 1Q0WB 3NJTA 1TY0A 2M17A 2XK5B 3DBRB 2MRPA 3C8YA 5DPSA 3VTUA 2QDFA 1HB8A 3ZJTA 5E6NA 4HAZB 2GBKA 1Y8RC 1P6SA 4MELA 5AZGA 2MSED 1FOEA 1FHOA 1FNUA 1Y5OA 4F1SA 1L0XB 4H2AA 3P4RB 2KXJA 2DAJA 4ILGB 3IXSA 1JRUA 4DHJD 1VZ8A 3SFEB 3H7SA 4IWQA 1RM6C 2J4XA 4G0NB 3Q3OC 2ASQA 3FILB 2MFQA 3F5RA 2QMTA 3QQ8B 3N32A 5IN7A 2LGDA 3PG7A 1A70A 3KSYA 4JPSA 2GBRA 5J2RA 3LDZE 1RRPB 4XX5A 4WIPA 1V1PB 3TW1A 4PS8A 1QOGA 1N5WA 3N1YC 4QXAB 2BWES 3ODOA 1MVKA 5J18A 4RGMA 1I4XA 2JYTA 2FE8A 2YSZA 4AWJA 3TVVA 2DHKA 5C79A 1HQRD 3CIKA 2WXIA 1J7AA 1X05A 5HE2A 1V5PA 4FJYA 2Y8FA 1MHHE 2V3NA 3QBVB 4A55A 1B9RA 3WYFB 2VZKB 3FILA 4HPMB 2CHZA 4ZRKA 2N9XA 3P63A 2WLBA 4DHZE 1NI3A 1WF9A 3MJ5A 2JPHA 1V1OA 4XE0A 1IRSA 1FAOA 1V5OA 2ZPYA 1VLBA 2R09A 3SO6A 3WAOA 3N1XC 1YX5B 1GPXA 5D27A 4MH8A 2D3BA 2WX1A 1TGZB 3AECB 3PZ7A 2LD9A 1KF6B 3Q3FA 4CO7A 2CR5A 1WX8A 1TS5A 1FNVA 2HTME 1R4MB 4GDKA 2COCA 4W9HA 4W9EA 5L81A 2LJ5A 2RQ1A 3AI5A 4S0RA 2ELAA 2J53A 4WJNA 1QQGA 3A4SC 2KTFA 4TUUA 2D07B 3R7QA 3IHPC 1BMLC 1TS2A 4K3BA 2L83A 2KWCA 4LNKA 5G5GA 3AE7B 4RF0A 3ETRA 1CQVA 3GZNB 1F0ZA 4GN1A 4HCPB 1N62A 3P6AA 2Y3AA 1I4HA 4KAXB 2MBQA 5IO9A 2O2VB 2COAA 1KBLA 3RPFC 2K6QA 3FKYA 3IBEA 3SV1A 2KTRA 1WZ0A 3MHSD 1TJEA 4GDLA 4C7YA 3U7DA 1NI2A 3PP2A 3VVWB 1LO5D 3ZQ4A 3AE1B 4I6NB 2EKEC 3Q3JA 3ZKJC 3ZIMA 2Y5CA 2B3AA 2KT7A 1UEFA 4KIKA 2O2VA 3PVUA 2QJLA 2MQJA 4W9LA 4DXAB 2YS3A 1OFFA 1VZ6A 3Q14C 2COPA 5KQ4A 1F1HA 1JWUD 4OVUA 4GDKB 3UGBB 3Q8EA 2K6DB 1DOXA 2DYBA 3HIEA 4YSXB 1WJUA 2KIEA 2P0FA 4CHMA 3TO1A 1MJDA 3BINA 3HW2B 3AJ4A 2I5CA 1FB8A 2N7DA 1FD6A 1UNQA 3GYOA 1JROA 1KTKA 2KQSA 3M63B 4YTPB 4W9JA 1KH0A 3KZ1A 4HJGE 5EE1A 1SJHD 2KO3A 4HWIB 1WYGA 2L7RA 3RI7C 3SU8X 3W5UB 4F8CB 1R4MI 1STEA 4RMAA 2DHIA 1IPGA 1WGQA 3RMKC 3RFZB 1M7EA 3GYPA 2INDC 1KLGD 4IAPA 3DVNU 1HZ6A 1MK9B 4MT5A 4EJNA 3NS8A 4OVZA 2INNE 5D3YA 3DVGX 1FRRA 3HM6X 3V61A 1K51A 1X11A 3NS1A 1YD8U 3APDA 3FAHA 3WALA 3Q69A 3Q3NC 3C19A 3B9JA 3H7PB 5CHVC 5MPOA 2HE7A 2COFA 4PYUA 4WURA 4LJPB 1VBHA 1VCBA 2N7JA 1NDDA 1SEBD 3PRMB 1WFYA 1GB4A 2JRHA 4WJ7A 2I1KA 2OTXA 4K1RB 4XWXA 2WU2B 3VDZA 4YONA 1TIFA 3JVZX 3T3NA 2ZVNA 3L16A 4HPPA 1WGDA 2FIFA 3TFMA 1J0GA 5J17A 1ZSQA 3DXDA 1M7RA 1XR0B 1ACAA 4UDUC 4K17A 1P1AA 4DWFA 4ZHOA 1WI1A 4XYCA 1OTRB 2K8CA 3AM9A 3P4PB 4YWGG 4BVUC 3H6NA 2K49A 1RWSA 1ZM0A 1W1HA 1C77A 3NUHB 5GMVA 3E56A 5KQ1A 1QF6A 1L6VA 4ANUA 2LEKA 1RJ2A 3A9KA 1KC7A 1KI1B 1P3RA 3PVWA 2LYDA 2LI5A 1OQRA 4A6QA 1YQ4B 1H4RA 5LLIA 4BOSC 2J0MA 3A8QA 1P98A 2WDTB 4HVBA 1A5RA 1XF5L 5HKHA 3TJPA 1N3HA 4N59A 1ZE3D 2O6VA 1QQRA 4B0MA 3PO0A 1M4VA 1XCGA 2KMAA 4ZRQA 2D10A 3IVFA 1L0YB 1AQCA 4EZJA 1XCTL 2ZJDA 1YOVB 1HB6A 4BKSA 4JKGA 2N0SB 2N9EB 3NY5A 3MHZA 2LRWA 1P0RA 3R2IA 3T9LA 5BYSA 4JIOU 1I4RA 2DAFA 2MKRA 1SF0A 1XO3A 3PHXB 4LDTB 3AE4B 3F0WA 1L4DB 1NYRA 1QOBA 3VFKA 4ZRJA 1M94A 1MAIA 3PVLA 2M0AA 2E3TA 1D5MC 1MIXA 2R82A 3EECA 1DBHA 1EUVB 1OQYA 1WGUA 2KK8A 2J59M 3MJWA 4IG7B 2QSDA 4KGRA 3O96A 5J3TA 1V80A 2DFKA 2L2IA 3AEGB 2RD0A 4R3DA 2FCNA 1JALA 4ZHPA 3DOWA 3EHVA 2WXHA 1PLSA 3E9PA 3ONSA 3MTNB 1PGXA 2N9PC 1T77A 1ZC4B 5C5BB 1UUPA 3ZRFA 5G55A 1P9DU 1F77A 1I42A 5CX3A 2KLGA 4WWMA 2NTSA 1F2RC 2WXGA 1AARA 1VR9A 3RNGC 2IGHA 4NPNA 2V3PA 2KD0A 4M8MA 3DBRI 1YX6B 3QARA 2JQRB 1SB3C 4A9AA 4LJOB 1D5XC 2BT6A 1HBKA 5C23A 2G1EA 3UIPB 3DBSA 2WX0A 4HSIA 1TKEA 3T3OA 4D2KA 1I2HA 2WP9B 2AQ2B 2ONQA 5D2MB 5CLQB 1WX7A 4EZLA 2ZW1A 4A8XC 5D3VA 1LM8B 1QZEA 2LMCA 4EEWA 5IOIA 1RAXA 1OY2A 2KMMA 2Z8LA 2DKPA 2QILA 3W1SA 3NVVA 2DZMA 2KDFB 5HHDG 2W2XD 4BAXA 2KTRB 4MGKE 3LYYA 2KJ6A 1WR6E 3EC8A 3R7RA 1XKEA 4RH6A 3PZ8A 1E9MA 1ET6A 3PTFC 1ZOYB 4GIVA 4KHBB 1WJ6A 4H8SA 2C9WB 4P7IA 1ZXHA 2C7MB 1QC6A 4ASWC 1X1MA 5JHAA 1IGDA 2NVUI 2NBVA 2QIEB 4DQOC 1Q67A 2W2WA 3PEGA 1P3QU 5KHOA 3WA0A 1NBFC 3MC9A 1S3SG 1DYNA 2YT2A 2BF8B 2K8EA 3PREA 4HB0B 5G2NA 2QCZA 2PW9A 2RPQA 4JKAA 1MFWA 3HVDA 3OLMD 1AN8A 4Q2JA 3AULA 4KDLB 3OJ3A 4RM8A 3RUIB 1YN4A 4C7ZA 3QWZB 1FHXA 2AQ3B 1OEYJ 4IFSA 4OT1A 1N6ZA 4XC2A 4FADA 5I2SA 2CAYA 4XDCA 2RDGA 1WH3A 4QAYA 2KANA 1NU2A 3U4EG 1U5DA 2HJ1A 1NEKB 4GOCA 3URYA 4Z2NA 3ZRCA 1FXAA 2MX2A 1E7VA 2DZJA 4L1RA 5CHFA 1ET9A 1EU3A 3G9WA 4P1BC 5FKAC 3VTVA 2FNJB 4KHAA 2NBVB 2XNAC 1BWNA 3V05A 4MH0E 2Q5WD 2DYQA 1K52A 3TL5A 5D6JB 2JF5A 2OJRA 2JZZA 3QHTA 4A6HA 4FLHA 4N6EB 2ZEQA 2P0DA 2GBMA 2CHWA 2CQUA 1V5MA 2RVBB 1CZPA 1QT9A 3AE8B 3AEDB 5FI1A 2EMTA 2Z0QA 1Y56A 4GDLB 2Q13A 4NSWA 1E90A 2XQNM 1MPHA 5AEKB 1C3TA 2L1AA 4MSMB 2LGIA 4MK0A 1QLBB 1GG3A 5AUKA 2E6XA 1WJ1A 2QEJC 1WXMA 3DHHC 1E8YA 4NJCA 3V6CB 2ROVA 2RDHA 2ZNVB 4HPLB 2KN5A 3VH3B 4L1BA 4G50A 1N63A 4GNKB 1WRIA 2K8BA 2BS2B 4KSLC 2MWNB 4IM0A 4GZUA 4KSKC 1CK1A 2CY5A 2NR2A 2YVCA 2LRUA 1TY2A 1V88A 3AV8A 4WQOB 1RFKA 3WAPA 1H8CA 4JKDA 4DBGA 1N60A 3UF8A 4ILJA 5LG4B 1YJ1A 1SIJA 2K3UA 2J7QB 2YF0A 3AU4A 1WJMA 2UWQA 2UZRA 2X18A 1YJIA 1P5TA 2KVRA 4DDID 1IUEA 4FXCA 3KWLA 1WM2A 5L83A 2LVPA 4BOZB 3PSCA 2R2YA 1KJTA 1V97A 3RT3B 1V61A 4AUQC 3W1YA 1WJNA 4GXBA 4WJOA 1UGMA 3E9LA 2IO0B 3SR6A 2H7DA 3DWGC 4ZDVA 4TKNA 2AQ1B 2PTLA 3QJZA 4L23A 4DBBA 1B55A 2KYWA 2PKOA 2ADZA 4TSSA 2LVOA 2JY6A 2KAJA 2UVMA 2MW5A 2D11A 2CU1A 4K3CA 1MKEA 4OW0A 2PE6B 3NWDA 4ICUA 5JHHA 2DHZA 4KKJA 5J3QA 4DHJB 4WAFA 1HZ5A 1PYWD 3AEBB 3UZTA 3FVCA 1ESFA 3V60A 2WXKA 3OAWA 3RNEC 4LNFA 2KUQA 2FJLA 4GOUA 4OZBA 4WQMA 5AZFA 3ULBA 4D6WA 4IWOA 5BMIA 4PS3A 2JXTA 2HDEA 2FCQA 1WGYA 3LXFA 1ZXIA 4X57B 2BGFA 2JWUA 4IM3A 2M38A 3A1QB 2Z0PA 2DHJA 5LONB 2DYNA 2D3AA 4HAWB 1KZGA 2PE9A 3B0AA 3W1SC 4E74A 2QC8A 1SIFA 2V1YA 1EU4A 2XEWA 5JH5C 2LOZA 4HXDA 4J6IA 4JKEA 2BB5A 4RCOA 1E10A 2MBOA 4NJ6A 2DX5A 2UZSA 3BIID 1T5XD 3A9JB 2G4SA 4KDIC 4LTUA 3FLVA 1E7PB 4YTMB 2ZKMX 5D3XA 4NAWB 4LDTD 3GB1A 3KUCB 1P7EA 3ZDMC 2GS0A 5C1ZA 1V6EA 1AW7A 1YMHE 3Q8FA 2MDXA 1WGKA 4HDOA 5HG2A 1C4CA 3BYYB 3Q8CA 1J8CA 4HB2B 3M62B 2KQ4X 3ZGZA 3QIJA 1EGXA 2VH2A 4FHJA 3SD5A 4C80A 3W2DA 2PZ1A 3ML4A 2LFIA 3DCXA 2H89B 5HE0A 1GNUA 5I4DA 3NZUA 5H92C 5EFXA 4ANXA 2R2QA 4F7ZA 1YNTE 4ANWA 4IWPA 2R61A 4IW0A 5D3IB 1NENB 4I6PA 1DIKA 2PEAA 2ZPNA 3B77A 3U12A 3N1ZC 1KLVA 1FO4A 1C4PA 3H9DA 3WAMA 2DLWA 2FUHB 3AEEB 3MC0B 2WDVB 4K7UA 2K0PA 2ZCCA 4JK7A 2B76B 2UU7A 3KLSX 4L2YA 4OZCA 4A6KA 2BTEA 2YT1A 3SBTA 5I2MA 1BT0A 3JYUA 3ALBA 2G4DB 1SHCA 3GS2A 2ELBA 3SBGA 1CMXB 1F9JA 1WGRA 3HIZA 4TV3A 2AEHA 3NZ3A 2MA9B 2L1CA 2WHIA 1U5FA 3BZDB 3VR8B 4C4VB 4ARCA 3UINB 4AP4C 2D3GA 1JWBD 1QOAA 4OHJA 2D9WA 1PFDA 1Q1OA 3VQIA 3SYXA 4BFRA 2W9NA 3Q8AA 2VRRB 3DPDA 4P16A 4MJSA 4HAXB 1V5TA 2AYOB 2J42A 2Z59B 3I3TB 3BVMA 1J7BA 3DVNV 3KYDD 4KV2A 3LB8C 4E71A 2I1JA 4URKA 2M56B 4MDKE 3ZTDA 1T0RC 2M0XA 3LJ3A 3E9OA 2YS1A 3DVGY 3TCAA 3R66C 3ZUNA 4AOFA 3X23A 1KM7A 2BKFA 1PGBA 3U8ZA 3E66A 5DH9B 4QJ4B 4HROA 5DPWA 4XWWA 2W55A 3SUZA 3QWMA 3DBHB 4WJQA 3MC8A 3NVZA 3ZNGC 1E8WA 2K25A 4ICVA 3VAWA 2KWDA 4NAMA 4A5KA 2PJHA 3A8PA 2IZVB 2Z4DA 1XLQA 3AB5A 5JXVA 3RNCC 1KOTA 5JLJB 3Q2AC 1VD2A 1ENFA 4RNAA 1YQ3B 1L4ZB 1V86A 2WS3B 1EF1A 4M0WA 4HLEA 2NBWB 1UD7A 5EDSA 3A9JA 1WGHA 2C5LC 1DOIA 3CF6E 4GGQA 2YEPB 2K00A 4PQ0A 2YLMA 5D3WA 4JKCA 3GOEA 3FC4A 5AUIA 2WXJA 4HDQA 3DXEA 2GCLA 1UPRA 1D3ZA 3ZNZB 4DK5A 1UPQA 3ZDTA 1K5GB 2GI9A 2Z59A 2KDBA 1MI1A 2X0SA 3BWUD 3PT2B 2K9XA 3HM3A 2JVCA 1TZ1A 2CU3A 2D5GA 4FA6A 2WGSA 1HE8A 4TQ1A 3NHEB 4GPTB 2I38A 4HRSA 1C9FA 5BYRA 3KRWA 1E6EB 4LNIA 2DLBA 3ML9A 3SHQA 2VH1A 1PDXA 2A5UA 1SSNA 2GCJA 4E3CA 2WDQB 2GLSA 2LOXA 1ROEA 3VUXA 4OZAA 2CJOA 4RF1A 1SXTA 4TYZA 3VH4B 1JCKB 1TT5B 1W1GA 3JSVA 2DWQA 3SFDB 1YIWA 1UNPA 4WJPA 1NYQA 4ITKA 4JL9A 4KHOA 2KHWB 2BQQA 1SE3A 2DX5B 1GUAB 2IFSA 2J0JA 1XT9B 2REXA 1BUIC 1L5PA 1IP9A 2WXQA 2KC2A 2N9LA 3VUYA 4B6WA 1TJ6A 2WH5A 1GOZA 4P1CC 5DCNA 3VHTC 1PFJA 5JHBA 4JKBA 4YL8A 4IKGA 1ISNA 1EWCA 3HVZA 1XX0A 1EM7A 1WSPA 3EFCA 2GJYA 1JMLA 4II3B 2J0KA 4GLSC 2ZVOA 4B95A 1E7UA 1ZPSA 1JWSD 1T0YA 5JHGA 4QJ5B 5H8YE 5JVLA 1ZW7A 4M00A 2KVZA 3DDCB 3IG3A 3ZNID 3AXCA 4PS7A 2MEKA 3RYTA 4RGOS 1MI0A 3MP9A 3QAQA 2DZKA 1XLOA 5EE3A 2KWUB 2MJEA 1FFUA 1UNRA 2AL6A 4RGTA 4YSYB 1JQ4A 3VUWA 4L6EA 1FNWA 3I5JC 3FM8C 3VRAB 4GU2A 2NCNA 2Z0EB 4IOIE 3VR9B 2NBUA 3M95A 1W1DA 3A9KB 1DROA 4MGIE 1N61A 4PNKA 2M4NA 3D32A 2D2QA 2FJ9A 1Z87A 1VDVA 2RPVA 1R7SA 2K22A 1DDVA 4NY0A 2CODA 2A4ZA 3B2GA 4W9FA 3UQAA 2RGNB 2LGYA 3A1QA 1RFAA 2XBBC 2KWVB 3NWAA 3PLVA 4RFBA 2Z14A 1V89A 2CS4A 3CMMB 5C16A 1NVLA 2TSSA 2FCSA 3ZO5B 2VKIA 3P7ZA 2RSUA 2LASA 1MHXA 1WE6A 3BK2A 4MY6A 4I6LB 4F7GA 3WCQA 3RCPA 3Q6BA 3D8EA 4W9GA 4IM2A 4MM3B 3JSVB 2RMMA 4JWUC 2BBCA 3ZVVA 5LNK1 4NNJB 5GOWB 4KHBA 2CB8A 3U30A 5IKCM 3ZJVA 1IGCA 2GOWA 3OANA 1Q5WB 2BWFA 4LK0M 3ML8A 4ZYSA 4HAVB 4JK9A 4REZA 5J3YA 1I4GA 3ZLZA 3ZXRA 2DENB 1DYQA 2L76A 2R2OA 4HATB 4JGHB 2N4FA 2UYZB 1FCLA 2L8JA 2ICIA 2D9VA 2LGXA 2WDRB 3DHIC 3IT4B 2JUOA 3AU5A 1V8CA 1GJZA 1U27A 2RUKB 4A6FA 4WWPA 4MEMA 2BKRB 2O6VD 3I63C 2WXRA 1YJJA 4MACA 1I7AA 4XWTA 5BYQA 4Z2MB 2N1VA 4CQNA 4G3XB 3M1IB 3U52E 3I9V1 1FMAD 3DBLI 3CSFA 4FBJB 5E6OA 1CJEA 1Q10A 3GE8C 2WXOA 3BJIA 3PRPB 3P2BA 3MPXA 2BW2A 4EZKA 1FGYA 5E6PA 2SEBD 4JQWC 1PMSA 3EGRA 2BB6A 3E9SA 2C60A 1WYWB 1WZ3A 2MHJA 2WQYB 1NTVA 2FJUB 4FJVB 1U4AA 4FULA 2WWZA 3ENBA 1DDWA 2C7NB 5DHFB 2E2XA 4OSNA 3KW5B 3KVFB 3AE2B 1TTNA 5FI0A 2DA0A 5JP4A 2XK5A 1FPYA 1U2BA 1TS4A 4B6HA 1XEEA 1Z5SB 2AX5A 1T6BX 4WWOA 2WU5B 3V6EB 4HKQA 2OOBB 1TKYA 2AWTA 2Y5BB 2FBWB 1IBXB 5FR6A 3TMPB 3TEXA 4B9KA 1LB1A 1K5DB 2YS5A 1SGHA 2JWZA 1K53A 3PHWB 3BYTB 4NQKE 4HJKA 1UGJA 3PZDA
chains in the Genus database with same CATH topology
1WXAA 2ZCBA 1S1QB 1V5UA 3A98B 4HCNB 3NOBA 2IBIB 2L0TA 1V81A 2V76A 4GMVA 5D7GA 2LG1A 3ZW3A 3MDBC 2NS5A 1RLFA 3PSEB 1LXDA 3PPAA 1XD3B 1XQQA 3VOQA 5LOPB 1XD4A 3VIAA 5IAAC 3O65B 2DN6A 4W9KA 1Z2MA 3CSTA 2FDQA 3QX1A 2DKQA 2QKLA 3WANA 1V2YA 3RD2A 3KH0A 4K81A 2EJ8A 3HQCA 1UBIA 1C1YB 4BBNF 1LW3A 1TBEA 2K8HA 2D4QA 4EOYA 2KJHB 2MP2B 2LVQA 1NTIA 4JK8A 5DI9B 2N0YA 1U5GA 4A3OA 4WWNA 2NZ8B 2G35A 2KZRA 3VTWA 2K39A 1NTYA 3LJUX 2N7EA 3RZWC 2DZIA 4MM3A 4ANVA 4N9F4 4PYZA 2KX0A 2P8VA 4JKHA 2G45B 1DDMA 3N7CA 4W9CA 3D8FA 5L95C 3L10B 3SDLC 2JT4B 1WXVA 2DYOA 3PV1A 2L0FA 2KFKA 5LXHA 2KX3A 4RM9A 1TXDA 3BY4B 4DHZB 1EVHA 2HD5B 4NJ7A 4MGYE 3FP5A 2DYMA 4MGZE 4WAAA 3RCZA 3K9OB 1L2NA 5DHAB 5DIFB 1WI0A 1WM3A 2RLOA 4BBKA 4HB3B 4M0WB 3APCA 2ZNVC 4HK2A 2MWSB 3TBLD 2BYEA 2K2UA 2IY0B 5HE3A 2CKHB 4NQLB 4F7HA 2FAZA 2O6VB 1WGGA 5IA7A 3QC8B 1X86A 2JZ3B 2LULA 3A33B 1LFDA 2RR9A 3KYCD 5TR5A 3APFA 2Z0OA 3R3MA 3UIOB 2R0DA 2BYVE 4FJZA 4M8NA 1IYFA 4DX90 1BAKA 2K1FA 3DCGA 1WG7A 2RGFA 2N1WA 2V4LA 4BKTA 4EKUA 2Z0DB 5AZHA 2MLBA 2LXAA 3T8MA 1K8RB 5CTRC 4A3PA 2RNRB 3FSSA 3ODXA 2IO2B 1FXTB 2N23A 1U5EA 4FN2A 4LCDE 3PGEA 2HRJA 3RZFA 1R4NI 3ODWA 5CHWA 4BKGA 5JZEB 4BKSD 3A4RA 4WVFB 2IO3B 1J19A 5LXIB 2KFKB 2QKMA 1G6JA 1E8ZA 1FHWA 2HTHB 4A6FB 3OJ4B 3ZVRA 5KCVA 4W9DA 1UBQA 2Y8GA 1WE7A 2EMSA 1MG8A 2ABDA 1AWEA 1WR1A 5KHQA 1VBGA 2V3SA 3GZNI 5DPRA 4BBNC 1ZKHA 2BYFA 3T06A 4AJWA 4Y94A 1J0WA 1JDEA 3N30A 1XODA 2PPHA 1V9JA 3ECIA 3V5WA 2DX1A 4ILHA 3KY9A 2QHOA 3X0WA 2KUPA 3KUZA 1KZ7A 1OEYA 3KRXA 2EC1A 3C0RB 4AJYB 3IFWB 2VRWB 1WJ4A 1WY8A 4EUTA 4HHVA 3ZNHB 1WMHA 2MCNB 1L7YA 1BTKA 2KQ7A 2CY4A 1OQNA 2Y7BA 2KDIA 1X1GA 3FEHA 4WSFA 2W2XC 1UELA 3QA8A 1OGWA 4HAYB 2KFJA 2LWPA 2IO1B 3L17A 4GB9A 3UQBA 4GMXB 3N3KB 4F7UP 2BPSA 2KMCA 1WVHA 1PQSA 3V62A 1ZVRA 2KKCA 1EF5A 3QCAA 4FHKA 4KZ0A 1GC6A 2H7EA 1WXSA 1ZGUB 2KDEB 2L00B 1Y19B 5D94A 3DXCA 2JP2A 4JKGB 1UH6A 4DDGD 4GSWA 3M3JA 2HJ8A 1E8XA 2DIKA 4K2PA 1U29A 2C7HA 4EFOA 4HAUB 4CYEA 2I5FA 2MBBB 1WX9A 2BCJA 3PRZA 3HK0A 1ST7A 2FIDA 1ZC3B 1WRDB 2LUEA 5C6RA 4OVVA 4JLCA 2ROZB 2GBNA 5BO4B 1I35A 3L0WB 2MP2A 2P0HA 4HB4B 3KUDB 3EPYA 2YRYA 2NMBA 2MBHA 1H10A 5DPTA 2M1MA 1EO6A 4D0NB 3ULCA 1FGZA 2GBJA 2G3QB 2CRFA 3H7PA 2CHXA 5C5BA 1YQBA 1WIAA 2LZ6A 4NAWA 1RRBA 4W9IA 4II2B 1WMHB 3ZTCA 2LXCA 2GMIC 1MIZB 2KGXB 3NZSA 4G11A 4K7SA 3SNHA 4KIKB 1E5WA 5CLLB 2HTHA 4IUMB 2WYQA 1X1FA 5IJMA 1GGOA 3WIMA 1UZXB 4IOYX 4MJSB 2L3ZA 4DX8A 3JW0X 2KJRA 2M14A 2RSGA 3VXWA 4TQ0A 2FCMA 2K2JA 1OMWA 1TQZA 3L54A 4ZRIA 3DQVA 3S2AA 1BTNA 2NPTB 2OQBA 3L13A 2VSZA 4A20A 3TIXA 4XZ4A 2IYDB 2JXXA 4CHKA 1MK7B 1SE9A 2KLCA 2NPTA 3RULA 1LQBA 2KC1A 4CHJA 2MBEA 3PS6A 4IC7B 2AL3A 3D8DA 2D9XA 4KVGB 3EFUA 2IY1B 3L08A 4K7WA 3HHMA 1V49A 3B1LX 2LBBA 3NSUA 2D9YA 4JKFA 3K9PB 4K2OA 2JRIB 4MSQB 3CXBB 5HE1A 2LKOA 3ENEA 2ZZPB 4C0AA 3DBHI 3PLUA 2KCJA 3H1UA 2KOXA 4KZCA 2KNBA 2L05A 2DTCA 2YT0A 2D9ZA 1EAZA 4MT7A 2IYBA 2M8SA 3B08A 3QK0A 4ZYNA 4EMOA 1GC7A 1Q0WB 2M17A 2XK5B 2MRPA 5DPSA 3VTUA 1HB8A 5E6NA 4HAZB 2GBKA 1Y8RC 1P6SA 4MELA 5AZGA 2MSED 1FOEA 1FHOA 1Y5OA 4F1SA 2KXJA 2DAJA 4ILGB 1JRUA 4DHJD 3H7SA 4IWQA 4G0NB 2ASQA 2MFQA 3F5RA 3QQ8B 3N32A 2LGDA 3PG7A 3KSYA 2GBRA 5J2RA 3LDZE 1RRPB 4XX5A 3TW1A 4PS8A 2BWES 3ODOA 5J18A 2YSZA 4AWJA 3TVVA 2DHKA 5C79A 3CIKA 1X05A 5HE2A 1V5PA 4FJYA 2Y8FA 3QBVB 3WYFB 4HPMB 2CHZA 4ZRKA 2N9XA 4DHZE 1WF9A 2JPHA 1IRSA 1FAOA 1V5OA 2ZPYA 2R09A 3SO6A 3WAOA 1YX5B 5D27A 2WX1A 1TGZB 2LD9A 3Q3FA 4CO7A 2CR5A 1WX8A 4GDKA 2COCA 4W9HA 4W9EA 5L81A 2LJ5A 2RQ1A 3AI5A 2ELAA 4WJNA 1QQGA 3A4SC 2KTFA 4TUUA 2D07B 3R7QA 3IHPC 2KWCA 4GN1A 4HCPB 3P6AA 4KAXB 2MBQA 2COAA 1KBLA 2O2VB 2K6QA 3IBEA 3SV1A 2KTRA 1WZ0A 3MHSD 4GDLA 3U7DA 1NI2A 3PP2A 3VVWB 4I6NB 2EKEC 3Q3JA 3ZKJC 3ZIMA 2B3AA 1UEFA 4KIKA 2O2VA 3PVUA 2MQJA 4W9LA 4DXAB 2YS3A 2COPA 5KQ4A 4OVUA 4GDKB 3UGBB 2K6DB 2DYBA 1WJUA 2P0FA 4CHMA 3TO1A 3BINA 3HW2B 3AJ4A 2I5CA 1FB8A 2N7DA 1UNQA 3GYOA 2KQSA 3M63B 4W9JA 3KZ1A 4HWIB 2KO3A 2L7RA 3SU8X 4F8CB 1R4MI 4RMAA 2DHIA 1IPGA 1WGQA 1M7EA 3GYPA 4IAPA 3DVNU 1MK9B 4EJNA 3NS8A 5D3YA 3DVGX 3HM6X 3V61A 1X11A 1YD8U 3APDA 3WALA 3H7PB 5CHVC 2HE7A 2COFA 4PYUA 4LJPB 1VBHA 1VCBA 1NDDA 3PRMB 1WFYA 2JRHA 4WJ7A 2I1KA 2OTXA 4K1RB 4XWXA 3VDZA 4YONA 3JVZX 2ZVNA 3L16A 1WGDA 2FIFA 3TFMA 1J0GA 5J17A 1ZSQA 3DXDA 1M7RA 1XR0B 1ACAA 4DWFA 4K17A 1P1AA 1WI1A 1OTRB 2K8CA 4BVUC 3H6NA 1ZM0A 1W1HA 5GMVA 5KQ1A 4ANUA 1RJ2A 3A9KA 1KC7A 1KI1B 1P3RA 3PVWA 2LYDA 2LI5A 1H4RA 5LLIA 4BOSC 2J0MA 3A8QA 1P98A 2WDTB 4HVBA 1A5RA 5HKHA 3TJPA 1N3HA 2O6VA 1XCGA 2KMAA 2D10A 3IVFA 4EZJA 1AQCA 2ZJDA 4BKSA 1HB6A 4JKGA 2N9EB 3NY5A 2LRWA 1P0RA 3T9LA 4JIOU 2DAFA 2MKRA 3PHXB 4LDTB 3F0WA 3VFKA 4ZRJA 1M94A 1MAIA 3PVLA 3PZDA 1MIXA 2R82A 3EECA 1DBHA 1EUVB 1OQYA 1WGUA 2KK8A 2J59M 3MJWA 4IG7B 3O96A 5J3TA 1V80A 2DFKA 2L2IA 2RD0A 2FCNA 3DOWA 3EHVA 1PLSA 3E9PA 3ONSA 3MTNB 2N9PC 5C5BB 1ZC4B 3ZRFA 5G55A 1P9DU 1I42A 5CX3A 2KLGA 1AARA 4NPNA 2KD0A 4M8MA 3DBRI 1YX6B 3QARA 4LJOB 5C23A 1HBKA 3UIPB 3DBSA 2WX0A 1I2HA 5D2MB 5CLQB 1WX7A 4EZLA 5D3VA 1LM8B 1QZEA 4EEWA 1RAXA 1OY2A 2DKPA 3W1SA 2DZMA 2KDFB 2W2XD 2KTRB 4MGKE 2KJ6A 1WR6E 3EC8A 3R7RA 1XKEA 3PTFC 4GIVA 4KHBB 1WJ6A 4H8SA 2C9WB 4P7IA 4ASWC 2C7MB 1QC6A 1X1MA 5JHAA 2NVUI 1Q67A 2W2WA 3PEGA 1P3QU 5KHOA 3WA0A 1NBFC 1S3SG 1DYNA 2BF8B 3PREA 4HB0B 5G2NA 2RPQA 4JKAA 3OLMD 3AULA 4KDLB 3OJ3A 4RM8A 3RUIB 3QWZB 1FHXA 1OEYJ 4IFSA 4XC2A 4FADA 2CAYA 1WH3A 2KANA 1NU2A 1U5DA 4GOCA 4Z2NA 3ZRCA 2MX2A 1E7VA 2DZJA 5CHFA 3G9WA 3VTVA 2FNJB 4KHAA 2NBVB 1BWNA 4MH0E 2DYQA 3TL5A 5D6JB 2JF5A 2OJRA 2JZZA 3QHTA 4A6HA 4FLHA 2ZEQA 2P0DA 2GBMA 2CHWA 2CQUA 1V5MA 2RVBB 5FI1A 2EMTA 2Z0QA 4GDLB 2Q13A 4NSWA 1E90A 2XQNM 1MPHA 5AEKB 1C3TA 4MSMB 4MK0A 1GG3A 1WJ1A 1WXMA 1E8YA 3V6CB 2ROVA 2ZNVB 4HPLB 2KN5A 3VH3B 4G50A 2K8BA 4KSLC 2MWNB 4IM0A 4GZUA 4KSKC 2CY5A 2NR2A 2YVCA 2LRUA 1V88A 4WQOB 3WAPA 1H8CA 4JKDA 4DBGA 3UF8A 4ILJA 1YJ1A 2J7QB 2YF0A 3AU4A 1WJMA 2UWQA 2UZRA 2X18A 1P5TA 2KVRA 4DDID 5L83A 1WM2A 2LVPA 4BOZB 3PSCA 3RT3B 1KJTA 1V61A 4AUQC 3W1YA 1WJNA 4GXBA 4WJOA 1UGMA 3E9LA 2IO0B 2H7DA 4ZDVA 4TKNA 3QJZA 4DBBA 1B55A 2ADZA 2LVOA 2JY6A 2UVMA 2MW5A 2D11A 2CU1A 1MKEA 2PE6B 4ICUA 5JHHA 2DHZA 5J3QA 4DHJB 3UZTA 3V60A 3OAWA 2FJLA 5AZFA 3ULBA 4IWOA 4PS3A 2FCQA 1WGYA 4X57B 2BGFA 4IM3A 2M38A 3A1QB 2Z0PA 2DHJA 5LONB 2DYNA 4HAWB 1KZGA 2PE9A 3B0AA 3W1SC 4E74A 1SIFA 2V1YA 2XEWA 5JH5C 2LOZA 4HXDA 4J6IA 4JKEA 2MBOA 4NJ6A 2DX5A 2UZSA 3A9JB 2G4SA 4KDIC 3FLVA 5D3XA 4NAWB 4LDTD 3KUCB 3ZDMC 2GS0A 5C1ZA 1V6EA 2MDXA 4HDOA 1J8CA 4HB2B 3M62B 3QIJA 1EGXA 4FHJA 3SD5A 2PZ1A 3ML4A 5HE0A 1GNUA 3NZUA 5EFXA 4ANXA 2R2QA 4F7ZA 4ANWA 4IWPA 4IW0A 4I6PA 1DIKA 2PEAA 2ZPNA 1KLVA 3H9DA 3WAMA 2DLWA 2FUHB 4K7UA 2ZCCA 4JK7A 4A6KA 2YT1A 3SBTA 1BT0A 3JYUA 3ALBA 2G4DB 1SHCA 2ELBA 3SBGA 1CMXB 1F9JA 1WGRA 3HIZA 4TV3A 2AEHA 2MA9B 2L1CA 1U5FA 3UINB 4AP4C 2D3GA 3VQIA 2D9WA 1Q1OA 3SYXA 4BFRA 2W9NA 2VRRB 3DPDA 4MJSA 4HAXB 1V5TA 2AYOB 2Z59B 3I3TB 3DVNV 3KYDD 4KV2A 4E71A 2I1JA 4URKA 4MDKE 3ZTDA 2M0XA 3LJ3A 3E9OA 2YS1A 3DVGY 3TCAA 3R66C 3ZUNA 4AOFA 3X23A 1KM7A 2BKFA 3U8ZA 3E66A 5DH9B 5DPWA 3SUZA 3QWMA 4WJQA 3ZNGC 1E8WA 2K25A 4ICVA 3VAWA 4A5KA 2PJHA 3A8PA 2IZVB 1KOTA 5JLJB 1VD2A 1V86A 1EF1A 4HLEA 2NBWB 1UD7A 5EDSA 3A9JA 1WGHA 2C5LC 3CF6E 4GGQA 2K00A 4PQ0A 2YLMA 5D3WA 4JKCA 3GOEA 4HDQA 3DXEA 2GCLA 1UPRA 1D3ZA 3ZNZB 4DK5A 1UPQA 3ZDTA 1K5GB 2KDBA 2X0SA 3PT2B 3HM3A 2JVCA 1TZ1A 4FA6A 1HE8A 4TQ1A 3NHEB 4GPTB 3KRWA 3ML9A 3SHQA 2A5UA 2GCJA 4E3CA 2LOXA 3VUXA 4TYZA 3VH4B 1W1GA 3JSVA 1YIWA 1UNPA 4WJPA 4JL9A 4KHOA 2KHWB 2DX5B 1GUAB 2IFSA 2J0JA 1XT9B 2REXA 1IP9A 2KC2A 3VUYA 4B6WA 1TJ6A 2WH5A 5DCNA 3VHTC 1PFJA 5JHBA 4JKBA 4YL8A 1ISNA 1XX0A 2GJYA 4II3B 2J0KA 2ZVOA 4B95A 1E7UA 1T0YA 5JHGA 5JVLA 1ZW7A 3DDCB 3IG3A 3ZNID 3AXCA 4PS7A 3RYTA 3QAQA 2DZKA 2KWUB 1UNRA 2AL6A 3VUWA 4L6EA 3FM8C 4GU2A 2NCNA 2Z0EB 2NBUA 3M95A 1W1DA 3A9KB 1DROA 4MGIE 4PNKA 2M4NA 3D32A 2D2QA 2FJ9A 1Z87A 1DDVA 4NY0A 2CODA 2A4ZA 4W9FA 3UQAA 2RGNB 2LGYA 3A1QA 1RFAA 2XBBC 2KWVB 3PLVA 1V89A 2CS4A 3CMMB 5C16A 1NVLA 2FCSA 3ZO5B 2VKIA 3P7ZA 2RSUA 2LASA 1WE6A 4MY6A 4I6LB 4F7GA 3RCPA 3D8EA 4W9GA 4IM2A 3JSVB 3ZVVA 4NNJB 5GOWB 3U30A 2CB8A 2GOWA 3OANA 1Q5WB 2BWFA 3ML8A 4HAVB 4JK9A 5J3YA 3ZLZA 2DENB 2L76A 2R2OA 4HATB 4JGHB 2N4FA 2UYZB 2L8JA 2D9VA 2LGXA 2JUOA 3AU5A 1GJZA 1U27A 2RUKB 4A6FA 4WWPA 4MEMA 2BKRB 2O6VD 1I7AA 4Z2MB 2N1VA 4G3XB 3M1IB 3DBLI 3CSFA 4FBJB 5E6OA 3BJIA 3P2BA 3MPXA 4EZKA 1FGYA 5E6PA 4JQWC 1PMSA 2C60A 1WYWB 1WZ3A 1NTVA 4FJVB 1U4AA 4FULA 2WWZA 3ENBA 1DDWA 2C7NB 5DHFB 2E2XA 3KW5B 3KVFB 1TTNA 5FI0A 2DA0A 5JP4A 2XK5A 1U2BA 4B6HA 1Z5SB 4WWOA 3V6EB 2OOBB 2AWTA 2Y5BB 5FR6A 3TMPB 4B9KA 1LB1A 1K5DB 2YS5A 1SGHA 2JWZA 3PHWB 4NQKE 4HJKA 3PRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBN A;  1WXA A;  5BO4 B;  2ZCB A;  1S1Q B;  1RJ2 A;  3A9K A;  4K7U A;  2ZCC A;  1I35 A;  1KI1 B;  1P3R A;  1V5U A;  3PVW A;  2LYD A;  3A98 B;  3L0W B;  2LI5 A;  2MP2 A;  4HCN B;  2P0H A;  3NOB A;  2IBI B;  1H4R A;  4HB4 B;  5LLI A;  4BOS C;  4A6K A;  2L0T A;  2J0M A;  3EPY A;  2YT1 A;  3A8Q A;  1P98 A;  2V76 A;  1V81 A;  2WDT B;  3KUD B;  4HVB A;  2YRY A;  5HKH A;  1A5R A;  2NMB A;  4GMV A;  1BT0 A;  3TJP A;  1N3H A;  3JYU A;  5D7G A;  2MBH A;  1H10 A;  2LG1 A;  2O6V A;  3ALB A;  5DPT A;  3ZW3 A;  2G4D B;  1SHC A;  2ELB A;  1XCG A;  2M1M A;  2KMA A;  1CMX B;  1F9J A;  1WGR A;  2D10 A;  3IVF A;  1EO6 A;  3HIZ A;  4EZJ A;  1AQC A;  4D0N B;  2ZJD A;  4TV3 A;  1HB6 A;  3V6E B;  2AEH A;  4BKS A;  3MDB C;  2L1C A;  3ULC A;  1U5F A;  2MA9 B;  2N9E B;  2NS5 A;  3NY5 A;  1FGZ A;  2GBJ A;  2LRW A;  2G3Q B;  1RLF A;  3PSE B;  1P0R A;  3UIN B;  3T9L A;  4AP4 C;  2CRF A;  2D3G A;  1LXD A;  3H7P A;  3PPA A;  2D9W A;  1Q1O A;  4JIO U;  2CHX A;  1XD3 B;  3SYX A;  3VQI A;  2DAF A;  4BFR A;  5C5B A;  2MKR A;  1XQQ A;  1YQB A;  2W9N A;  3VOQ A;  3PHX B;  4LDT B;  1WIA A;  3F0W A;  5LOP B;  1XD4 A;  2LZ6 A;  3VIA A;  3VFK A;  4NAW A;  5IAA C;  1RRB A;  2VRR B;  3DPD A;  3O65 B;  4W9I A;  4ZRJ A;  4MJS A;  4HAX B;  1M94 A;  1MAI A;  1V5T A;  3PVL A;  2DN6 A;  1WMH B;  4II2 B;  2AYO B;  3ZTC A;  2LXC A;  2GMI C;  2Z59 B;  4W9K A;  1MIZ B;  3I3T B;  2KGX B;  3NZS A;  1MIX A;  1Z2M A;  3CST A;  3EEC A;  4G11 A;  1DBH A;  2FDQ A;  3SNH A;  4K7S A;  3DVN V;  4KIK B;  3KYD D;  3QX1 A;  4KV2 A;  1EUV B;  1OQY A;  1WGU A;  2KK8 A;  1E5W A;  2I1J A;  5CLL B;  2HTH A;  4E71 A;  4IUM B;  2DKQ A;  2QKL A;  4URK A;  4MDK E;  3ZTD A;  2J59 M;  2WYQ A;  1V2Y A;  2M0X A;  3MJW A;  3LJ3 A;  3WAN A;  1X1F A;  5IJM A;  4IG7 B;  3RD2 A;  5IA7 A;  3KH0 A;  2YS1 A;  3O96 A;  4K81 A;  5J3T A;  3TCA A;  1V80 A;  2EJ8 A;  3DVG Y;  3R66 C;  3ZUN A;  2DFK A;  2L2I A;  4AOF A;  3X23 A;  2RD0 A;  1KM7 A;  2BKF A;  3WIM A;  3U8Z A;  3HQC A;  1UZX B;  2FCN A;  5DH9 B;  3DOW A;  1UBI A;  1C1Y B;  3EHV A;  4IOY X;  5DPW A;  4BBN F;  4MJS B;  3SUZ A;  1PLS A;  2L3Z A;  1LW3 A;  3QWM A;  3MTN B;  3ONS A;  4DX8 A;  3JW0 X;  4WJQ A;  1TBE A;  2KJR A;  2N9P C;  2M14 A;  3ZNG C;  1E8W A;  2K8H A;  5C5B B;  1ZC4 B;  2RSG A;  2K25 A;  3VXW A;  3ZRF A;  2D4Q A;  5G55 A;  4TQ0 A;  1P9D U;  1I42 A;  2FCM A;  5CX3 A;  4ICV A;  2K2J A;  1OMW A;  1TQZ A;  2KLG A;  3L54 A;  4ZRI A;  3DQV A;  3VAW A;  4EOY A;  2KJH B;  3S2A A;  2MP2 B;  2LVQ A;  1BTN A;  1NTI A;  5DI9 B;  2NPT B;  2N0Y A;  2OQB A;  1U5G A;  4A3O A;  3L13 A;  1AAR A;  4WWN A;  2NZ8 B;  2VSZ A;  4A5K A;  4A20 A;  2G35 A;  3TIX A;  2PJH A;  3A8P A;  2IZV B;  4XZ4 A;  2IYD B;  2KZR A;  1KOT A;  5JLJ B;  3VTW A;  2JXX A;  1VD2 A;  1NTY A;  3LJU X;  2K39 A;  4CHK A;  2N7E A;  4NPN A;  3RZW C;  2KD0 A;  4M8M A;  2DZI A;  3VUX A;  3DBR I;  1MK7 B;  4MM3 A;  1SE9 A;  1YX6 B;  3QAR A;  4N9F 4;  4ANV A;  2KLC A;  4PYZ A;  2NPT A;  1V86 A;  2KX0 A;  3RUL A;  1LQB A;  1EF1 A;  2P8V A;  4HLE A;  2KC1 A;  2NBW B;  1UD7 A;  2G45 B;  1DDM A;  5EDS A;  4LJO B;  3N7C A;  3A9J A;  1WGH A;  3D8F A;  2C5L C;  4W9C A;  5C23 A;  1HBK A;  3CF6 E;  4GGQ A;  5L95 C;  3L10 B;  3UIP B;  3DBS A;  2K00 A;  4PQ0 A;  2WX0 A;  2YLM A;  4CHJ A;  5D3W A;  2MBE A;  3SDL C;  2JT4 B;  3GOE A;  1WXV A;  3PS6 A;  4IC7 B;  3DXE A;  4HDQ A;  1I2H A;  2AL3 A;  2GCL A;  2DYO A;  1UPR A;  3PV1 A;  1D3Z A;  3ZNZ B;  4DK5 A;  2L0F A;  2KFK A;  5D2M B;  1UPQ A;  3D8D A;  5LXH A;  5CLQ B;  1WX7 A;  4EZL A;  3ZDT A;  5D3V A;  1K5G B;  1LM8 B;  1QZE A;  2KDB A;  2KX3 A;  4RM9 A;  1TXD A;  3BY4 B;  4DHZ B;  4EEW A;  1EVH A;  3PT2 B;  2HD5 B;  3HM3 A;  4NJ7 A;  4MGY E;  3FP5 A;  1RAX A;  2DYM A;  2JVC A;  2D9X A;  1TZ1 A;  4MGZ E;  4FA6 A;  4KVG B;  3EFU A;  2IY1 B;  3L08 A;  4WAA A;  4K7W A;  1OY2 A;  1HE8 A;  3HHM A;  4TQ1 A;  3NHE B;  3RCZ A;  2DKP A;  4GPT B;  1V49 A;  3K9O B;  3B1L X;  5DHA B;  3W1S A;  2LBB A;  1L2N A;  5DIF B;  3NSU A;  2DZM A;  2D9Y A;  2KDF B;  2W2X D;  3K9P B;  2KTR B;  3KRW A;  1WI0 A;  4K2O A;  4MGK E;  1WM3 A;  2JRI B;  2KJ6 A;  3ML9 A;  2RLO A;  4BBK A;  3SHQ A;  4HB3 B;  1WR6 E;  3EC8 A;  4MSQ B;  5JZE B;  3R7R A;  4M0W B;  3APC A;  1XKE A;  2ZNV C;  3CXB B;  5HE1 A;  2LKO A;  3ENE A;  2A5U A;  3PTF C;  2ZZP B;  4C0A A;  2GCJ A;  3DBH I;  4GIV A;  4E3C A;  4KHB B;  4HK2 A;  2LOX A;  1WJ6 A;  3PLU A;  4H8S A;  2C9W B;  4P7I A;  2MWS B;  2C7M B;  1QC6 A;  2BYE A;  3TBL D;  1X1M A;  4ASW C;  2K2U A;  4TYZ A;  3VH4 B;  5JHA A;  2KCJ A;  2NVU I;  3H1U A;  2KOX A;  4KZC A;  1W1G A;  2KNB A;  2IY0 B;  2L05 A;  5HE3 A;  3JSV A;  2DTC A;  1Q67 A;  2W2W A;  2YT0 A;  3PEG A;  2CKH B;  2D9Z A;  4NQL B;  1EAZ A;  4MT7 A;  4F7H A;  1P3Q U;  2IYB A;  3WA0 A;  1YIW A;  2M8S A;  3B08 A;  1UNP A;  5KHO A;  1NBF C;  2FAZ A;  1S3S G;  1DYN A;  3QK0 A;  2BF8 B;  4WJP A;  4JL9 A;  4KHO A;  3PRE A;  4ZYN A;  4HB0 B;  2KHW B;  5G2N A;  4EMO A;  2RPQ A;  1GC7 A;  2DX5 B;  1GUA B;  1Q0W B;  2O6V B;  1WGG A;  3OLM D;  2IFS A;  2J0J A;  1XT9 B;  2M17 A;  2XK5 B;  3AUL A;  2MRP A;  4KDL B;  2REX A;  5DPS A;  3OJ3 A;  3VTU A;  4RM8 A;  1HB8 A;  1IP9 A;  3RUI B;  2KC2 A;  5E6N A;  4HAZ B;  2GBK A;  1Y8R C;  3QC8 B;  1X86 A;  3VUY A;  2JZ3 B;  2LUL A;  1FHX A;  3QWZ B;  3A33 B;  1OEY J;  1P6S A;  1TJ6 A;  4IFS A;  2WH5 A;  1LFD A;  2MSE D;  4MEL A;  4XC2 A;  1FOE A;  1FHO A;  5AZG A;  2RR9 A;  3KYC D;  5TR5 A;  3APF A;  5DCN A;  1Y5O A;  4F1S A;  4FAD A;  3VHT C;  1PFJ A;  2CAY A;  2Z0O A;  5JHB A;  4YL8 A;  1WH3 A;  1ISN A;  1NU2 A;  2KAN A;  1XX0 A;  2KXJ A;  3R3M A;  1U5D A;  2DAJ A;  2GJY A;  2R0D A;  2BYV E;  4Z2N A;  4FJZ A;  4GOC A;  1JRU A;  4M8N A;  3ZRC A;  4DHJ D;  1IYF A;  3H7S A;  2MX2 A;  4DX9 0;  4II3 B;  4IWQ A;  1E7V A;  2J0K A;  1BAK A;  2DZJ A;  5CHF A;  2ZVO A;  3G9W A;  4B95 A;  1E7U A;  2K1F A;  4G0N B;  3VTV A;  1T0Y A;  3DCG A;  2ASQ A;  5JHG A;  2FNJ B;  4KHA A;  2NBV B;  3UIO B;  1WG7 A;  1ZW7 A;  2MFQ A;  3F5R A;  1BWN A;  4MH0 E;  2RGF A;  3QQ8 B;  3DDC B;  3N32 A;  2N1W A;  3IG3 A;  3ZNI D;  2LGD A;  2DYQ A;  3AXC A;  4PS7 A;  2V4L A;  3PG7 A;  3TL5 A;  4BKT A;  5D6J B;  3RYT A;  3KSY A;  4EKU A;  2JF5 A;  2OJR A;  2Z0D B;  2GBR A;  5AZH A;  5J2R A;  3LDZ E;  2JZZ A;  3QHT A;  4A6H A;  4F7Z A;  2MLB A;  4FLH A;  2ZEQ A;  1RRP B;  2P0D A;  3QAQ A;  4XX5 A;  2DZK A;  2GBM A;  2CHW A;  2CQU A;  2LXA A;  3V62 A;  3TW1 A;  4PS8 A;  1V5M A;  2RVB B;  3T8M A;  2KWU B;  1K8R B;  1UNR A;  2AL6 A;  5FI1 A;  2BWE S;  2EMT A;  2Z0Q A;  5CTR C;  4GDL B;  2Q13 A;  3ODO A;  4NSW A;  1E90 A;  5J18 A;  3VUW A;  4L6E A;  4A3P A;  4B6W A;  2RNR B;  2XQN M;  3FSS A;  3ODX A;  3FM8 C;  2IO2 B;  2YSZ A;  4AWJ A;  1MPH A;  3TVV A;  1FXT B;  2NCN A;  2Z0E B;  2DHK A;  4GU2 A;  3ZO5 B;  5AEK B;  1C3T A;  2NBU A;  3M95 A;  4MSM B;  4MK0 A;  1W1D A;  1GG3 A;  5C79 A;  3CIK A;  1DRO A;  3A9K B;  4MGI E;  1X05 A;  5HE2 A;  1V5P A;  1WJ1 A;  2Y8F A;  4PNK A;  2M4N A;  4FJY A;  1WXM A;  3QBV B;  1E8Y A;  3D32 A;  2D2Q A;  2FJ9 A;  3V6C B;  1Z87 A;  2ROV A;  2ZNV B;  4HPL B;  2N23 A;  3WYF B;  1U5E A;  2KN5 A;  4FN2 A;  4HPM B;  4LCD E;  4EZK A;  2CHZ A;  3VH3 B;  3PGE A;  4G50 A;  4ZRK A;  1DDV A;  2HRJ A;  2N9X A;  3RZF A;  4NY0 A;  4DHZ E;  1R4N I;  2K8B A;  2COD A;  1WF9 A;  4KSL C;  2A4Z A;  2MWN B;  3ODW A;  4IM0 A;  5CHW A;  2JPH A;  4GZU A;  4KSK C;  4BKS D;  2CY5 A;  1IRS A;  1FAO A;  1V5O A;  2NR2 A;  2RGN B;  4W9F A;  4BKG A;  2ZPY A;  3UQA A;  2YVC A;  2LGY A;  2R09 A;  3SO6 A;  1RFA A;  2LRU A;  1YX5 B;  3A1Q A;  1V88 A;  5D27 A;  2XBB C;  3A4R A;  4WVF B;  4WQO B;  2IO3 B;  2KWV B;  1J19 A;  2WX1 A;  5LXI B;  1TGZ B;  2KFK B;  2QKM A;  3PLV A;  3WAP A;  1G6J A;  1H8C A;  1V89 A;  2LD9 A;  4DBG A;  3Q3F A;  3UF8 A;  2CS4 A;  3CMM B;  5C16 A;  1NVL A;  1E8Z A;  4CO7 A;  2FCS A;  1FHW A;  2HTH B;  2VKI A;  4A6F B;  1YJ1 A;  3P7Z A;  1WX8 A;  2CR5 A;  2J7Q B;  3ZVR A;  5KCV A;  2RSU A;  3OJ4 B;  4W9D A;  2YF0 A;  1UBQ A;  4GDK A;  2COC A;  2Y8G A;  1WE7 A;  2LAS A;  4W9E A;  4W9H A;  2EMS A;  3AU4 A;  1MG8 A;  2ABD A;  1WJM A;  5L81 A;  1AWE A;  1WE6 A;  2RQ1 A;  1WR1 A;  2LJ5 A;  2UWQ A;  2UZR A;  2X18 A;  4MY6 A;  3AI5 A;  4I6L B;  5KHQ A;  2ELA A;  2V3S A;  4F7G A;  4WJN A;  1P5T A;  3RCP A;  3GZN I;  1QQG A;  2KVR A;  3A4S C;  2KTF A;  3D8E A;  5DPR A;  4DDI D;  4W9G A;  4BBN C;  1ZKH A;  4IM2 A;  4TUU A;  2BYF A;  3T06 A;  2D07 B;  3IHP C;  3JSV B;  3R7Q A;  5L83 A;  1WM2 A;  2KWC A;  4AJW A;  4Y94 A;  1J0W A;  2LVP A;  4BOZ B;  3ZVV A;  3PSC A;  3RT3 B;  1KJT A;  1V61 A;  4NNJ B;  4AUQ C;  5GOW B;  3U30 A;  2CB8 A;  4GN1 A;  3N30 A;  3W1Y A;  4HCP B;  1WJN A;  1XOD A;  4GXB A;  4WJO A;  3P6A A;  2GOW A;  2PPH A;  1UGM A;  4KAX B;  1V9J A;  2MBQ A;  2IO0 B;  3ECI A;  2COA A;  3OAN A;  3V5W A;  1Q5W B;  2BWF A;  2O2V B;  2DX1 A;  2H7D A;  3ML8 A;  4HAV B;  4ZDV A;  4TKN A;  5J3Y A;  2K6Q A;  3IBE A;  3KY9 A;  3SV1 A;  2KTR A;  1WZ0 A;  3MHS D;  3QJZ A;  2QHO A;  3ZLZ A;  4DBB A;  1B55 A;  3X0W A;  2DEN B;  2ADZ A;  2L76 A;  2LVO A;  2KUP A;  2JY6 A;  3KUZ A;  4GDL A;  3U7D A;  1NI2 A;  3PP2 A;  2UVM A;  2R2O A;  1KZ7 A;  3VVW B;  4HAT B;  1OEY A;  4JGH B;  2MW5 A;  2D11 A;  4I6N B;  2N4F A;  2UYZ B;  2EKE C;  2CU1 A;  3Q3J A;  3ZKJ C;  3KRX A;  2L8J A;  2EC1 A;  3ZIM A;  1MKE A;  3C0R B;  2PE6 B;  4AJY B;  3IFW B;  2B3A A;  4ICU A;  1UEF A;  5JHH A;  2VRW B;  2DHZ A;  3PVU A;  2O2V A;  4KIK A;  2D9V A;  5J3Q A;  2MQJ A;  1WJ4 A;  4DXA B;  1WY8 A;  2LGX A;  2YS3 A;  4W9L A;  4DHJ B;  4EUT A;  4HHV A;  2COP A;  3ZNH B;  3UZT A;  5KQ4 A;  2JUO A;  3AU5 A;  4GDK B;  4OVU A;  3UGB B;  1WMH A;  2MCN B;  2K6D B;  2DYB A;  1GJZ A;  1U27 A;  2RUK B;  4A6F A;  4WWP A;  1L7Y A;  3V60 A;  1BTK A;  4MEM A;  3OAW A;  2BKR B;  2KQ7 A;  1WJU A;  2P0F A;  2FJL A;  4CHM A;  2CY4 A;  2O6V D;  5AZF A;  3ULB A;  3TO1 A;  4IWO A;  4PS3 A;  3BIN A;  3HW2 B;  3AJ4 A;  2FCQ A;  1WGY A;  2I5C A;  1FB8 A;  1I7A A;  1OQN A;  1UNQ A;  3GYO A;  2Y7B A;  4Z2M B;  2BGF A;  2N7D A;  4X57 B;  2KDI A;  2N1V A;  4IM3 A;  2M38 A;  2KQS A;  3A1Q B;  3M63 B;  1X1G A;  4G3X B;  2Z0P A;  3FEH A;  2DHJ A;  3M1I B;  5LON B;  2DYN A;  4WSF A;  4W9J A;  3KZ1 A;  2W2X C;  1UEL A;  4HAW B;  3QA8 A;  1KZG A;  1OGW A;  2PE9 A;  3B0A A;  3W1S C;  4E74 A;  4HAY B;  4HWI B;  2KO3 A;  2KFJ A;  1SIF A;  2LWP A;  2IO1 B;  3L17 A;  4GB9 A;  3UQB A;  4GMX B;  2V1Y A;  2XEW A;  3CSF A;  2L7R A;  3DBL I;  2LOZ A;  3N3K B;  4HXD A;  4J6I A;  3SU8 X;  4F8C B;  4FBJ B;  5JH5 C;  1R4M I;  4F7U P;  2BPS A;  2KMC A;  5E6O A;  1WVH A;  4RMA A;  1PQS A;  2MBO A;  4NJ6 A;  2DHI A;  2DX5 A;  1WGQ A;  2UZS A;  1IPG A;  1M7E A;  1ZVR A;  3GYP A;  2G4S A;  1EF5 A;  2KKC A;  3A9J B;  3QCA A;  3BJI A;  4KDI C;  4FHK A;  3FLV A;  4IAP A;  3DVN U;  4KZ0 A;  1MK9 B;  3PRP B;  3P2B A;  4EJN A;  5D3X A;  3NS8 A;  3MPX A;  4NAW B;  1GC6 A;  5D3Y A;  1FGY A;  3DVG X;  3HM6 X;  4JQW C;  4LDT D;  1PMS A;  5E6P A;  3V61 A;  2H7E A;  3KUC B;  1X11 A;  1WXS A;  1ZGU B;  1YD8 U;  2KDE B;  3APD A;  2C60 A;  3ZDM C;  2GS0 A;  3WAL A;  5C1Z A;  1WYW B;  2L00 B;  1V6E A;  1WZ3 A;  3H7P B;  1Y19 B;  5CHV C;  2HE7 A;  2COF A;  2MDX A;  3DXC A;  2JP2 A;  4PYU A;  5D94 A;  4LJP B;  1NTV A;  4HDO A;  1VCB A;  4FJV B;  1U4A A;  1NDD A;  1J8C A;  4FUL A;  4HB2 B;  2WWZ A;  3PRM B;  1UH6 A;  1WFY A;  1DDW A;  3M62 B;  4DDG D;  2JRH A;  4WJ7 A;  2I1K A;  2OTX A;  4K1R B;  2C7N B;  4XWX A;  3QIJ A;  1EGX A;  4GSW A;  3M3J A;  3VDZ A;  4YON A;  5DHF B;  4FHJ A;  2HJ8 A;  1E8X A;  3JVZ X;  3SD5 A;  2E2X A;  3KW5 B;  2PZ1 A;  4K2P A;  2ZVN A;  3KVF B;  1U29 A;  3ML4 A;  3L16 A;  1TTN A;  2C7H A;  3WAO A;  4EFO A;  5FI0 A;  2DA0 A;  5JP4 A;  5HE0 A;  1GNU A;  1WGD A;  2FIF A;  2XK5 A;  3TFM A;  3NZU A;  1U2B A;  5EFX A;  4ANX A;  4HAU B;  4B6H A;  2R2Q A;  1J0G A;  4CYE A;  5J17 A;  1Z5S B;  4WWO A;  3DXD A;  1ZSQ A;  2I5F A;  4ANW A;  1M7R A;  1XR0 B;  1ACA A;  2MBB B;  4K17 A;  1P1A A;  2OOB B;  4IWP A;  2AWT A;  2Y5B B;  1WX9 A;  4IW0 A;  4DWF A;  2BCJ A;  1WI1 A;  4I6P A;  5FR6 A;  1OTR B;  2K8C A;  3TMP B;  3PRZ A;  1LB1 A;  4B9K A;  2PEA A;  3HK0 A;  1ST7 A;  2ZPN A;  4BVU C;  2FID A;  3H6N A;  1K5D B;  2YS5 A;  1ZC3 B;  1WRD B;  2LUE A;  1KLV A;  1SGH A;  1ZM0 A;  2JWZ A;  3H9D A;  3WAM A;  1W1H A;  3PHW B;  5GMV A;  5KQ1 A;  5C6R A;  2DLW A;  2FUH B;  4NQK E;  4HJK A;  4ANU A;  3PZD A;  4OVV A;  4JLC A;  2ROZ B; 
#chains in the Genus database with same CATH topology
 1WXA A;  2ZCB A;  1S1Q B;  1LGR A;  2ON8 A;  1XCQ L;  4C4V A;  1V5U A;  1F52 A;  1VZ7 A;  3A98 B;  3P4S B;  2LHD A;  4HCN B;  3NOB A;  1QIL A;  2IBI B;  2L0T A;  1V81 A;  2V76 A;  3ABV B;  1ACC A;  4N58 A;  4GMV A;  1TKG A;  3AMZ A;  5D7G A;  2LG1 A;  3ZW3 A;  1V1P A;  3V3X A;  3Q3M C;  2JSV X;  3MDB C;  2NS5 A;  1UNS A;  3GP7 A;  1RLF A;  2WXN A;  3PSE B;  1K50 A;  1LXD A;  3PPA A;  1XD3 B;  3R8B A;  1XQQ A;  2DNF A;  3VOQ A;  5LOP B;  1XD4 A;  4O1N A;  3VIA A;  5HI1 A;  3IAS 1;  5IAA C;  2L32 A;  3O65 B;  5E6J A;  2PMV A;  2DN6 A;  4W9K A;  3IAM 1;  1Z2M A;  5BMG A;  3CST A;  2FDQ A;  4EE2 A;  3QX1 A;  5TSS A;  2DKQ A;  2QKL A;  3WAN A;  1V2Y A;  3RD2 A;  3KH0 A;  4K81 A;  3AH7 A;  1B1Z A;  2EJ8 A;  3RNA C;  3HQC A;  1UBI A;  1C1Y B;  4BBN F;  1LW3 A;  1TBE A;  2K8H A;  1VRA B;  2D4Q A;  2V4I B;  3R2T A;  4EOY A;  4JE3 B;  2KJH B;  2MP2 B;  1GB1 A;  2LVQ A;  3AE3 B;  1NTI A;  4JK8 A;  5DI9 B;  2PIA A;  2N0Y A;  2GRI A;  1U5G A;  4A3O A;  4M01 A;  4WWN A;  2NZ8 B;  2G35 A;  3NRZ A;  1GAQ B;  2V0G A;  4ARI A;  2KZR A;  5T8I A;  3VTW A;  2K39 A;  1NTY A;  3LJU X;  2ZW0 A;  2N7E A;  3RZW C;  2K5P A;  2DZI A;  4MM3 A;  4ANV A;  4N9F 4;  4PYZ A;  2KX0 A;  1HTO A;  2P8V A;  4JKH A;  2G45 B;  1DDM A;  3U2S C;  5FR3 A;  3N7C A;  1SJE D;  4W9C A;  3D8F A;  1DGJ A;  3L10 B;  5L95 C;  4KKI A;  3TSS A;  3SDL C;  2PVO D;  2JT4 B;  2IPK D;  1WXV A;  2DYO A;  2IGD A;  3PV1 A;  2NTT A;  3BK1 A;  5C3J B;  2L0F A;  2KFK A;  3CWI A;  5LXH A;  3A58 A;  3TEZ A;  4US9 A;  2KX3 A;  4RM9 A;  1TXD A;  3BY4 B;  2X8X X;  4DHZ B;  1SE4 A;  1EVH A;  2HD5 B;  4NJ7 A;  4MGY E;  3FP5 A;  2DYM A;  4MGZ E;  4WAA A;  4KX6 B;  2KDM A;  2M19 A;  1HEZ E;  3RCZ A;  3K9O B;  1L2N A;  5DHA B;  2INC C;  4ZRP A;  5DIF B;  1FIQ A;  1WI0 A;  1WM3 A;  2RLO A;  4BBK A;  4HB3 B;  3MFG A;  4M0W B;  3APC A;  2ZNV C;  3OHM B;  4YXD B;  2JU6 X;  4HK2 A;  2MWS B;  2OJW A;  3Q8B A;  2BYE A;  3TBL D;  2WNM A;  2K2U A;  2WXL A;  1SBB B;  3EA6 A;  4YTN B;  2W3S A;  3TEY A;  1NVI D;  2IY0 B;  5HE3 A;  2Y5P A;  1FXI A;  2CKH B;  4NQL B;  4F7H A;  3HSA A;  1I4Q A;  2FAZ A;  4AS1 A;  1HA5 A;  3KWV A;  2O6V B;  1WGG A;  2FUG 1;  5IA7 A;  1XLP A;  1KRH A;  3RNB C;  3QC8 B;  1J7C A;  1X86 A;  2JZ3 B;  2LUL A;  1FEH A;  3A33 B;  2W54 A;  1LFD A;  1T0S C;  2RR9 A;  3KYC D;  5TR5 A;  3APF A;  2Z0O A;  1IBX A;  2GB1 A;  3R3M A;  3CIR B;  3UIO B;  2R0D A;  2BYV E;  4US8 A;  4FJZ A;  4M8N A;  1IYF A;  4DXG A;  4DX9 0;  1BAK A;  1WXQ A;  2K1F A;  3BVG A;  3DCG A;  4CSQ A;  3VRB B;  1WG7 A;  2RGF A;  2BVC A;  1PGA A;  2N1W A;  2V4L A;  4BKT A;  2DBY A;  4EKU A;  3AE9 B;  2Z0D B;  5AZH A;  1UWM A;  3B2F A;  2MLB A;  3I57 A;  3AEA B;  2LXA A;  3EUB 2;  3T8M A;  1K8R B;  1EWY C;  2G9H D;  5CTR C;  4A3P A;  2RNR B;  3FSS A;  3ODX A;  2IO2 B;  1FXT B;  1L0V B;  3OWE B;  3BVZ A;  4M02 A;  1RYJ A;  1I4P A;  2N23 A;  1U5E A;  4FN2 A;  1P7F A;  4LCD E;  1YN3 A;  3PGE A;  2HRJ A;  3RZF A;  1R4N I;  4DIX A;  3ODW A;  5CHW A;  2CJN A;  2H88 B;  4USA A;  4BKG A;  4JX1 C;  4BKS D;  5JZE B;  3A4R A;  4WVF B;  2IO3 B;  1J19 A;  5LXI B;  4LLG M;  2KFK B;  2QKM A;  1G6J A;  3AN1 A;  2Z13 A;  2NMQ A;  3HUI A;  1E8Z A;  1FHW A;  2HTH B;  4A6F B;  3H8H A;  3OJ4 B;  3ZVR A;  5KCV A;  4W9D A;  1UBQ A;  2Y8G A;  1WE7 A;  2EMS A;  1MG8 A;  2ABD A;  1AWE A;  2JYE A;  1WR1 A;  3AE6 B;  5KHQ A;  1VBG A;  2V9H A;  2V3S A;  4ZOH C;  1D6E C;  1FM0 D;  3GZN I;  1JWM D;  5DPR A;  2BS4 B;  5FK9 C;  4BBN C;  1ZKH A;  2BYF A;  3T06 A;  4AJW A;  4Y94 A;  1J0W A;  5BMH A;  3NVW A;  4B0E A;  1JDE A;  3W9C B;  3N30 A;  1XOD A;  1C76 A;  2PPH A;  1UF0 A;  1V9J A;  3ECI A;  3V5W A;  2MJD A;  2DX1 A;  4ILH A;  3KY9 A;  2IJ0 A;  2QHO A;  3TUO A;  3X0W A;  2I2Y A;  2KUP A;  3KUZ A;  2W3R A;  1KZ7 A;  4PT5 A;  1OEY A;  1WWT A;  3KRX A;  2EC1 A;  3KQ4 A;  3C0R B;  4AJY B;  3IFW B;  2VRW B;  1WJ4 A;  1WY8 A;  3DHG C;  4EUT A;  3NG0 A;  1ZUD 2;  4HHV A;  2EEL A;  1ZYI A;  1XLN A;  1YN5 A;  5M4Y B;  3ZNH B;  1WMH A;  2MCN B;  1T0Q C;  1L7Y A;  1BTK A;  2KQ7 A;  4NZL B;  2CY4 A;  4KGT A;  1OQN A;  2Y7B A;  4XDD A;  2KDI A;  5GXG B;  1X1G A;  3FEH A;  4WSF A;  1JW9 D;  5HFY A;  2W2X C;  1DOY A;  3NW8 A;  1UEL A;  3QA8 A;  1OGW A;  4HAY B;  2KFJ A;  2WXF A;  5EE0 A;  2LWP A;  2IO1 B;  2VZK D;  3L17 A;  4GB9 A;  3UQB A;  4GMX B;  2MJ3 A;  3N3K B;  1JWA D;  1L6U A;  4HEA 1;  4F7U P;  2BPS A;  2KMC A;  2W82 A;  4JWS C;  1WVH A;  1PQS A;  1ZVR A;  2KKC A;  3V62 A;  4DXF A;  1EF5 A;  3QCA A;  1VJK A;  4FHK A;  1N5X A;  4KZ0 A;  4WH4 A;  3DWM A;  2PVG C;  1C4A A;  1GC6 A;  2H7E A;  1WXS A;  1ZGU B;  1TYG B;  2KDE B;  5EE9 A;  4P6V F;  2KN4 A;  2L00 B;  1QOF A;  3W5V B;  1Y19 B;  5D94 A;  3DXC A;  2JP2 A;  2XN9 C;  4JKG B;  1AWD A;  1KLU D;  4S17 A;  1UH6 A;  4DDG D;  2IGG A;  5C2T B;  4GSW A;  3M3J A;  2HJ8 A;  1E8X A;  2KIG A;  2OED A;  4XGA B;  2DIK A;  4K2P A;  1U29 A;  2X38 A;  3P4Q B;  4HKZ E;  1XXG A;  2C7H A;  1D4B A;  2N9K A;  4EFO A;  4YT0 B;  4HAU B;  4CYE A;  3DBL B;  2I5F A;  2MBB B;  1T3Q A;  1WX9 A;  2BCJ A;  3PRZ A;  3HK0 A;  1ST7 A;  2FID A;  1ZC3 B;  1WRD B;  3N9Y C;  2LUE A;  2LUM A;  2INP E;  2KR0 A;  2LHE A;  4A90 A;  1KFY B;  5C6R A;  1HXY D;  4JLC A;  4KGS A;  4OVV A;  2ROZ B;  2GBN A;  5BO4 B;  4C56 C;  1I35 A;  2YEP F;  3AE5 B;  3L0W B;  1OQQ A;  2MP2 A;  2P0H A;  4HB4 B;  3KUD B;  3EPY A;  1D5Z C;  2YRY A;  2NMB A;  2MBH A;  1H10 A;  3NWF A;  5DPT A;  3OG5 A;  2M1M A;  3N20 C;  1EO6 A;  4D0N B;  2BS3 B;  3ULC A;  2L52 A;  1FGZ A;  2GBJ A;  2G3Q B;  2CRF A;  3UI3 A;  3H7P A;  2CHX A;  5C5B A;  1YQB A;  1I7H A;  4IDI A;  2RRF A;  3L4P A;  1WIA A;  2LZ6 A;  3IT6 B;  4NAW A;  1RRB A;  4W9I A;  4II2 B;  1WMH B;  3ZTC A;  3GE3 C;  4PK1 A;  2LXC A;  2GMI C;  3U7Z A;  1MIZ B;  1C79 A;  2KGX B;  3NZS A;  2LJI A;  3ZYY X;  4G11 A;  4K7S A;  3SNH A;  4KIK B;  1E5W A;  5CLL B;  2HTH A;  1UWX A;  4IUM B;  2WYQ A;  1JRP A;  1X1F A;  5IJM A;  4QJ3 B;  1GGO A;  3WIM A;  2EKI A;  3RNF C;  1UZX B;  2MH7 A;  3RN9 C;  4IOY X;  2SAK A;  3NVY A;  4MJS B;  2PLP A;  2L3Z A;  4DX8 A;  2JZP A;  3JW0 X;  2BYT A;  2KJR A;  2GUM A;  2M14 A;  2RSG A;  5IP4 D;  3VXW A;  4TQ0 A;  2LGS A;  2J52 A;  2FCM A;  2K2J A;  1R4N B;  1OMW A;  1TQZ A;  3L54 A;  4ZRI A;  3DQV A;  1ZDV A;  3ZXV A;  4LNN A;  3S2A A;  1ZP0 B;  1BTN A;  1TS3 A;  2NPT B;  2OQB A;  3L13 A;  4BZA A;  2VSZ A;  1AYF A;  4A20 A;  1C78 A;  3TIX A;  4XZ4 A;  1PUT A;  4ACF A;  4J3O D;  2IYD B;  2RDB C;  2JXX A;  4CHK A;  3P42 A;  1MK7 B;  1BXT A;  1SE9 A;  1MPE A;  2KLC A;  2NPT A;  3RUL A;  1LQB A;  2KC1 A;  4RGN A;  3ZJU A;  1TZO A;  3AEF B;  4CHJ A;  1FRD A;  2MBE A;  3TEW A;  3J9C A;  3PS6 A;  4IC7 B;  2AL3 A;  3D8D A;  2ACZ B;  4YSZ B;  1F2R I;  2D9X A;  2IDY A;  4KVG B;  3EFU A;  2IY1 B;  3L08 A;  5D3D A;  3SEB A;  4K7W A;  3HHM A;  4LNO A;  1FFV A;  1HTQ A;  1V49 A;  3B1L X;  2WXP A;  1SE2 A;  2LBB A;  2WXM A;  1E0Z A;  1FCC C;  3NSU A;  2D9Y A;  5IRS A;  2D3C A;  3HRD D;  4JKF A;  3K9P B;  4K2O A;  2JRI B;  1MG4 A;  4C00 A;  4MSQ B;  3CXB B;  5HE1 A;  2LKO A;  3ENE A;  2ZZP B;  4C0A A;  3DBH I;  4AQ7 A;  3PLU A;  4TMA B;  2KCJ A;  3H1U A;  2KOX A;  1ZDX A;  4KZC A;  3O13 A;  2KNB A;  2L05 A;  2KAC A;  2DTC A;  2YT0 A;  2OHF A;  2D9Z A;  2JX5 A;  1EAZ A;  4MT7 A;  5G5H A;  2IYB A;  2M8S A;  3B08 A;  3QK0 A;  4ZYN A;  1QKZ A;  3P1M A;  4EMO A;  1GC7 A;  1Q0W B;  3NJT A;  1TY0 A;  2M17 A;  2XK5 B;  3DBR B;  2MRP A;  3C8Y A;  5DPS A;  3VTU A;  2QDF A;  1HB8 A;  3ZJT A;  5E6N A;  4HAZ B;  2GBK A;  1Y8R C;  1P6S A;  4MEL A;  5AZG A;  2MSE D;  1FOE A;  1FHO A;  1FNU A;  1Y5O A;  4F1S A;  1L0X B;  4H2A A;  3P4R B;  2KXJ A;  2DAJ A;  4ILG B;  3IXS A;  1JRU A;  4DHJ D;  1VZ8 A;  3SFE B;  3H7S A;  4IWQ A;  1RM6 C;  2J4X A;  4G0N B;  3Q3O C;  2ASQ A;  3FIL B;  2MFQ A;  3F5R A;  2QMT A;  3QQ8 B;  3N32 A;  5IN7 A;  2LGD A;  3PG7 A;  1A70 A;  3KSY A;  4JPS A;  2GBR A;  5J2R A;  3LDZ E;  1RRP B;  4XX5 A;  4WIP A;  1V1P B;  3TW1 A;  4PS8 A;  1QOG A;  1N5W A;  3N1Y C;  4QXA B;  2BWE S;  3ODO A;  1MVK A;  5J18 A;  4RGM A;  1I4X A;  2JYT A;  2FE8 A;  2YSZ A;  4AWJ A;  3TVV A;  2DHK A;  5C79 A;  1HQR D;  3CIK A;  2WXI A;  1J7A A;  1X05 A;  5HE2 A;  1V5P A;  4FJY A;  2Y8F A;  1MHH E;  2V3N A;  3QBV B;  4A55 A;  1B9R A;  3WYF B;  2VZK B;  3FIL A;  4HPM B;  2CHZ A;  4ZRK A;  2N9X A;  3P63 A;  2WLB A;  4DHZ E;  1NI3 A;  1WF9 A;  3MJ5 A;  2JPH A;  1V1O A;  4XE0 A;  1IRS A;  1FAO A;  1V5O A;  2ZPY A;  1VLB A;  2R09 A;  3SO6 A;  3WAO A;  3N1X C;  1YX5 B;  1GPX A;  5D27 A;  4MH8 A;  2D3B A;  2WX1 A;  1TGZ B;  3AEC B;  3PZ7 A;  2LD9 A;  1KF6 B;  3Q3F A;  4CO7 A;  2CR5 A;  1WX8 A;  1TS5 A;  1FNV A;  2HTM E;  1R4M B;  4GDK A;  2COC A;  4W9H A;  4W9E A;  5L81 A;  2LJ5 A;  2RQ1 A;  3AI5 A;  4S0R A;  2ELA A;  2J53 A;  4WJN A;  1QQG A;  3A4S C;  2KTF A;  4TUU A;  2D07 B;  3R7Q A;  3IHP C;  1BML C;  1TS2 A;  4K3B A;  2L83 A;  2KWC A;  4LNK A;  5G5G A;  3AE7 B;  4RF0 A;  3ETR A;  1CQV A;  3GZN B;  1F0Z A;  4GN1 A;  4HCP B;  1N62 A;  3P6A A;  2Y3A A;  1I4H A;  4KAX B;  2MBQ A;  5IO9 A;  2O2V B;  2COA A;  1KBL A;  3RPF C;  2K6Q A;  3FKY A;  3IBE A;  3SV1 A;  2KTR A;  1WZ0 A;  3MHS D;  1TJE A;  4GDL A;  4C7Y A;  3U7D A;  1NI2 A;  3PP2 A;  3VVW B;  1LO5 D;  3ZQ4 A;  3AE1 B;  4I6N B;  2EKE C;  3Q3J A;  3ZKJ C;  3ZIM A;  2Y5C A;  2B3A A;  2KT7 A;  1UEF A;  4KIK A;  2O2V A;  3PVU A;  2QJL A;  2MQJ A;  4W9L A;  4DXA B;  2YS3 A;  1OFF A;  1VZ6 A;  3Q14 C;  2COP A;  5KQ4 A;  1F1H A;  1JWU D;  4OVU A;  4GDK B;  3UGB B;  3Q8E A;  2K6D B;  1DOX A;  2DYB A;  3HIE A;  4YSX B;  1WJU A;  2KIE A;  2P0F A;  4CHM A;  3TO1 A;  1MJD A;  3BIN A;  3HW2 B;  3AJ4 A;  2I5C A;  1FB8 A;  2N7D A;  1FD6 A;  1UNQ A;  3GYO A;  1JRO A;  1KTK A;  2KQS A;  3M63 B;  4YTP B;  4W9J A;  1KH0 A;  3KZ1 A;  4HJG E;  5EE1 A;  1SJH D;  2KO3 A;  4HWI B;  1WYG A;  2L7R A;  3RI7 C;  3SU8 X;  3W5U B;  4F8C B;  1R4M I;  1STE A;  4RMA A;  2DHI A;  1IPG A;  1WGQ A;  3RMK C;  3RFZ B;  1M7E A;  3GYP A;  2IND C;  1KLG D;  4IAP A;  3DVN U;  1HZ6 A;  1MK9 B;  4MT5 A;  4EJN A;  3NS8 A;  4OVZ A;  2INN E;  5D3Y A;  3DVG X;  1FRR A;  3HM6 X;  3V61 A;  1K51 A;  1X11 A;  3NS1 A;  1YD8 U;  3APD A;  3FAH A;  3WAL A;  3Q69 A;  3Q3N C;  3C19 A;  3B9J A;  3H7P B;  5CHV C;  5MPO A;  2HE7 A;  2COF A;  4PYU A;  4WUR A;  4LJP B;  1VBH A;  1VCB A;  2N7J A;  1NDD A;  1SEB D;  3PRM B;  1WFY A;  1GB4 A;  2JRH A;  4WJ7 A;  2I1K A;  2OTX A;  4K1R B;  4XWX A;  2WU2 B;  3VDZ A;  4YON A;  1TIF A;  3JVZ X;  3T3N A;  2ZVN A;  3L16 A;  4HPP A;  1WGD A;  2FIF A;  3TFM A;  1J0G A;  5J17 A;  1ZSQ A;  3DXD A;  1M7R A;  1XR0 B;  1ACA A;  4UDU C;  4K17 A;  1P1A A;  4DWF A;  4ZHO A;  1WI1 A;  4XYC A;  1OTR B;  2K8C A;  3AM9 A;  3P4P B;  4YWG G;  4BVU C;  3H6N A;  2K49 A;  1RWS A;  1ZM0 A;  1W1H A;  1C77 A;  3NUH B;  5GMV A;  3E56 A;  5KQ1 A;  1QF6 A;  1L6V A;  4ANU A;  2LEK A;  1RJ2 A;  3A9K A;  1KC7 A;  1KI1 B;  1P3R A;  3PVW A;  2LYD A;  2LI5 A;  1OQR A;  4A6Q A;  1YQ4 B;  1H4R A;  5LLI A;  4BOS C;  2J0M A;  3A8Q A;  1P98 A;  2WDT B;  4HVB A;  1A5R A;  1XF5 L;  5HKH A;  3TJP A;  1N3H A;  4N59 A;  1ZE3 D;  2O6V A;  1QQR A;  4B0M A;  3PO0 A;  1M4V A;  1XCG A;  2KMA A;  4ZRQ A;  2D10 A;  3IVF A;  1L0Y B;  1AQC A;  4EZJ A;  1XCT L;  2ZJD A;  1YOV B;  1HB6 A;  4BKS A;  4JKG A;  2N0S B;  2N9E B;  3NY5 A;  3MHZ A;  2LRW A;  1P0R A;  3R2I A;  3T9L A;  5BYS A;  4JIO U;  1I4R A;  2DAF A;  2MKR A;  1SF0 A;  1XO3 A;  3PHX B;  4LDT B;  3AE4 B;  3F0W A;  1L4D B;  1NYR A;  1QOB A;  3VFK A;  4ZRJ A;  1M94 A;  1MAI A;  3PVL A;  2M0A A;  2E3T A;  1D5M C;  1MIX A;  2R82 A;  3EEC A;  1DBH A;  1EUV B;  1OQY A;  1WGU A;  2KK8 A;  2J59 M;  3MJW A;  4IG7 B;  2QSD A;  4KGR A;  3O96 A;  5J3T A;  1V80 A;  2DFK A;  2L2I A;  3AEG B;  2RD0 A;  4R3D A;  2FCN A;  1JAL A;  4ZHP A;  3DOW A;  3EHV A;  2WXH A;  1PLS A;  3E9P A;  3ONS A;  3MTN B;  1PGX A;  2N9P C;  1T77 A;  1ZC4 B;  5C5B B;  1UUP A;  3ZRF A;  5G55 A;  1P9D U;  1F77 A;  1I42 A;  5CX3 A;  2KLG A;  4WWM A;  2NTS A;  1F2R C;  2WXG A;  1AAR A;  1VR9 A;  3RNG C;  2IGH A;  4NPN A;  2V3P A;  2KD0 A;  4M8M A;  3DBR I;  1YX6 B;  3QAR A;  2JQR B;  1SB3 C;  4A9A A;  4LJO B;  1D5X C;  2BT6 A;  1HBK A;  5C23 A;  2G1E A;  3UIP B;  3DBS A;  2WX0 A;  4HSI A;  1TKE A;  3T3O A;  4D2K A;  1I2H A;  2WP9 B;  2AQ2 B;  2ONQ A;  5D2M B;  5CLQ B;  1WX7 A;  4EZL A;  2ZW1 A;  4A8X C;  5D3V A;  1LM8 B;  1QZE A;  2LMC A;  4EEW A;  5IOI A;  1RAX A;  1OY2 A;  2KMM A;  2Z8L A;  2DKP A;  2QIL A;  3W1S A;  3NVV A;  2DZM A;  2KDF B;  5HHD G;  2W2X D;  4BAX A;  2KTR B;  4MGK E;  3LYY A;  2KJ6 A;  1WR6 E;  3EC8 A;  3R7R A;  1XKE A;  4RH6 A;  3PZ8 A;  1E9M A;  1ET6 A;  3PTF C;  1ZOY B;  4GIV A;  4KHB B;  1WJ6 A;  4H8S A;  2C9W B;  4P7I A;  1ZXH A;  2C7M B;  1QC6 A;  4ASW C;  1X1M A;  5JHA A;  1IGD A;  2NVU I;  2NBV A;  2QIE B;  4DQO C;  1Q67 A;  2W2W A;  3PEG A;  1P3Q U;  5KHO A;  3WA0 A;  1NBF C;  3MC9 A;  1S3S G;  1DYN A;  2YT2 A;  2BF8 B;  2K8E A;  3PRE A;  4HB0 B;  5G2N A;  2QCZ A;  2PW9 A;  2RPQ A;  4JKA A;  1MFW A;  3HVD A;  3OLM D;  1AN8 A;  4Q2J A;  3AUL A;  4KDL B;  3OJ3 A;  4RM8 A;  3RUI B;  1YN4 A;  4C7Z A;  3QWZ B;  1FHX A;  2AQ3 B;  1OEY J;  4IFS A;  4OT1 A;  1N6Z A;  4XC2 A;  4FAD A;  5I2S A;  2CAY A;  4XDC A;  2RDG A;  1WH3 A;  4QAY A;  2KAN A;  1NU2 A;  3U4E G;  1U5D A;  2HJ1 A;  1NEK B;  4GOC A;  3URY A;  4Z2N A;  3ZRC A;  1FXA A;  2MX2 A;  1E7V A;  2DZJ A;  4L1R A;  5CHF A;  1ET9 A;  1EU3 A;  3G9W A;  4P1B C;  5FKA C;  3VTV A;  2FNJ B;  4KHA A;  2NBV B;  2XNA C;  1BWN A;  3V05 A;  4MH0 E;  2Q5W D;  2DYQ A;  1K52 A;  3TL5 A;  5D6J B;  2JF5 A;  2OJR A;  2JZZ A;  3QHT A;  4A6H A;  4FLH A;  4N6E B;  2ZEQ A;  2P0D A;  2GBM A;  2CHW A;  2CQU A;  1V5M A;  2RVB B;  1CZP A;  1QT9 A;  3AE8 B;  3AED B;  5FI1 A;  2EMT A;  2Z0Q A;  1Y56 A;  4GDL B;  2Q13 A;  4NSW A;  1E90 A;  2XQN M;  1MPH A;  5AEK B;  1C3T A;  2L1A A;  4MSM B;  2LGI A;  4MK0 A;  1QLB B;  1GG3 A;  5AUK A;  2E6X A;  1WJ1 A;  2QEJ C;  1WXM A;  3DHH C;  1E8Y A;  4NJC A;  3V6C B;  2ROV A;  2RDH A;  2ZNV B;  4HPL B;  2KN5 A;  3VH3 B;  4L1B A;  4G50 A;  1N63 A;  4GNK B;  1WRI A;  2K8B A;  2BS2 B;  4KSL C;  2MWN B;  4IM0 A;  4GZU A;  4KSK C;  1CK1 A;  2CY5 A;  2NR2 A;  2YVC A;  2LRU A;  1TY2 A;  1V88 A;  3AV8 A;  4WQO B;  1RFK A;  3WAP A;  1H8C A;  4JKD A;  4DBG A;  1N60 A;  3UF8 A;  4ILJ A;  5LG4 B;  1YJ1 A;  1SIJ A;  2K3U A;  2J7Q B;  2YF0 A;  3AU4 A;  1WJM A;  2UWQ A;  2UZR A;  2X18 A;  1YJI A;  1P5T A;  2KVR A;  4DDI D;  1IUE A;  4FXC A;  3KWL A;  1WM2 A;  5L83 A;  2LVP A;  4BOZ B;  3PSC A;  2R2Y A;  1KJT A;  1V97 A;  3RT3 B;  1V61 A;  4AUQ C;  3W1Y A;  1WJN A;  4GXB A;  4WJO A;  1UGM A;  3E9L A;  2IO0 B;  3SR6 A;  2H7D A;  3DWG C;  4ZDV A;  4TKN A;  2AQ1 B;  2PTL A;  3QJZ A;  4L23 A;  4DBB A;  1B55 A;  2KYW A;  2PKO A;  2ADZ A;  4TSS A;  2LVO A;  2JY6 A;  2KAJ A;  2UVM A;  2MW5 A;  2D11 A;  2CU1 A;  4K3C A;  1MKE A;  4OW0 A;  2PE6 B;  3NWD A;  4ICU A;  5JHH A;  2DHZ A;  4KKJ A;  5J3Q A;  4DHJ B;  4WAF A;  1HZ5 A;  1PYW D;  3AEB B;  3UZT A;  3FVC A;  1ESF A;  3V60 A;  2WXK A;  3OAW A;  3RNE C;  4LNF A;  2KUQ A;  2FJL A;  4GOU A;  4OZB A;  4WQM A;  5AZF A;  3ULB A;  4D6W A;  4IWO A;  5BMI A;  4PS3 A;  2JXT A;  2HDE A;  2FCQ A;  1WGY A;  3LXF A;  1ZXI A;  4X57 B;  2BGF A;  2JWU A;  4IM3 A;  2M38 A;  3A1Q B;  2Z0P A;  2DHJ A;  5LON B;  2DYN A;  2D3A A;  4HAW B;  1KZG A;  2PE9 A;  3B0A A;  3W1S C;  4E74 A;  2QC8 A;  1SIF A;  2V1Y A;  1EU4 A;  2XEW A;  5JH5 C;  2LOZ A;  4HXD A;  4J6I A;  4JKE A;  2BB5 A;  4RCO A;  1E10 A;  2MBO A;  4NJ6 A;  2DX5 A;  2UZS A;  3BII D;  1T5X D;  3A9J B;  2G4S A;  4KDI C;  4LTU A;  3FLV A;  1E7P B;  4YTM B;  2ZKM X;  5D3X A;  4NAW B;  4LDT D;  3GB1 A;  3KUC B;  1P7E A;  3ZDM C;  2GS0 A;  5C1Z A;  1V6E A;  1AW7 A;  1YMH E;  3Q8F A;  2MDX A;  1WGK A;  4HDO A;  5HG2 A;  1C4C A;  3BYY B;  3Q8C A;  1J8C A;  4HB2 B;  3M62 B;  2KQ4 X;  3ZGZ A;  3QIJ A;  1EGX A;  2VH2 A;  4FHJ A;  3SD5 A;  4C80 A;  3W2D A;  2PZ1 A;  3ML4 A;  2LFI A;  3DCX A;  2H89 B;  5HE0 A;  1GNU A;  5I4D A;  3NZU A;  5H92 C;  5EFX A;  4ANX A;  2R2Q A;  4F7Z A;  1YNT E;  4ANW A;  4IWP A;  2R61 A;  4IW0 A;  5D3I B;  1NEN B;  4I6P A;  1DIK A;  2PEA A;  2ZPN A;  3B77 A;  3U12 A;  3N1Z C;  1KLV A;  1FO4 A;  1C4P A;  3H9D A;  3WAM A;  2DLW A;  2FUH B;  3AEE B;  3MC0 B;  2WDV B;  4K7U A;  2K0P A;  2ZCC A;  4JK7 A;  2B76 B;  2UU7 A;  3KLS X;  4L2Y A;  4OZC A;  4A6K A;  2BTE A;  2YT1 A;  3SBT A;  5I2M A;  1BT0 A;  3JYU A;  3ALB A;  2G4D B;  1SHC A;  3GS2 A;  2ELB A;  3SBG A;  1CMX B;  1F9J A;  1WGR A;  3HIZ A;  4TV3 A;  2AEH A;  3NZ3 A;  2MA9 B;  2L1C A;  2WHI A;  1U5F A;  3BZD B;  3VR8 B;  4C4V B;  4ARC A;  3UIN B;  4AP4 C;  2D3G A;  1JWB D;  1QOA A;  4OHJ A;  2D9W A;  1PFD A;  1Q1O A;  3VQI A;  3SYX A;  4BFR A;  2W9N A;  3Q8A A;  2VRR B;  3DPD A;  4P16 A;  4MJS A;  4HAX B;  1V5T A;  2AYO B;  2J42 A;  2Z59 B;  3I3T B;  3BVM A;  1J7B A;  3DVN V;  3KYD D;  4KV2 A;  3LB8 C;  4E71 A;  2I1J A;  4URK A;  2M56 B;  4MDK E;  3ZTD A;  1T0R C;  2M0X A;  3LJ3 A;  3E9O A;  2YS1 A;  3DVG Y;  3TCA A;  3R66 C;  3ZUN A;  4AOF A;  3X23 A;  1KM7 A;  2BKF A;  1PGB A;  3U8Z A;  3E66 A;  5DH9 B;  4QJ4 B;  4HRO A;  5DPW A;  4XWW A;  2W55 A;  3SUZ A;  3QWM A;  3DBH B;  4WJQ A;  3MC8 A;  3NVZ A;  3ZNG C;  1E8W A;  2K25 A;  4ICV A;  3VAW A;  2KWD A;  4NAM A;  4A5K A;  2PJH A;  3A8P A;  2IZV B;  2Z4D A;  1XLQ A;  3AB5 A;  5JXV A;  3RNC C;  1KOT A;  5JLJ B;  3Q2A C;  1VD2 A;  1ENF A;  4RNA A;  1YQ3 B;  1L4Z B;  1V86 A;  2WS3 B;  1EF1 A;  4M0W A;  4HLE A;  2NBW B;  1UD7 A;  5EDS A;  3A9J A;  1WGH A;  2C5L C;  1DOI A;  3CF6 E;  4GGQ A;  2YEP B;  2K00 A;  4PQ0 A;  2YLM A;  5D3W A;  4JKC A;  3GOE A;  3FC4 A;  5AUI A;  2WXJ A;  4HDQ A;  3DXE A;  2GCL A;  1UPR A;  1D3Z A;  3ZNZ B;  4DK5 A;  1UPQ A;  3ZDT A;  1K5G B;  2GI9 A;  2Z59 A;  2KDB A;  1MI1 A;  2X0S A;  3BWU D;  3PT2 B;  2K9X A;  3HM3 A;  2JVC A;  1TZ1 A;  2CU3 A;  2D5G A;  4FA6 A;  2WGS A;  1HE8 A;  4TQ1 A;  3NHE B;  4GPT B;  2I38 A;  4HRS A;  1C9F A;  5BYR A;  3KRW A;  1E6E B;  4LNI A;  2DLB A;  3ML9 A;  3SHQ A;  2VH1 A;  1PDX A;  2A5U A;  1SSN A;  2GCJ A;  4E3C A;  2WDQ B;  2GLS A;  2LOX A;  1ROE A;  3VUX A;  4OZA A;  2CJO A;  4RF1 A;  1SXT A;  4TYZ A;  3VH4 B;  1JCK B;  1TT5 B;  1W1G A;  3JSV A;  2DWQ A;  3SFD B;  1YIW A;  1UNP A;  4WJP A;  1NYQ A;  4ITK A;  4JL9 A;  4KHO A;  2KHW B;  2BQQ A;  1SE3 A;  2DX5 B;  1GUA B;  2IFS A;  2J0J A;  1XT9 B;  2REX A;  1BUI C;  1L5P A;  1IP9 A;  2WXQ A;  2KC2 A;  2N9L A;  3VUY A;  4B6W A;  1TJ6 A;  2WH5 A;  1GOZ A;  4P1C C;  5DCN A;  3VHT C;  1PFJ A;  5JHB A;  4JKB A;  4YL8 A;  4IKG A;  1ISN A;  1EWC A;  3HVZ A;  1XX0 A;  1EM7 A;  1WSP A;  3EFC A;  2GJY A;  1JML A;  4II3 B;  2J0K A;  4GLS C;  2ZVO A;  4B95 A;  1E7U A;  1ZPS A;  1JWS D;  1T0Y A;  5JHG A;  4QJ5 B;  5H8Y E;  5JVL A;  1ZW7 A;  4M00 A;  2KVZ A;  3DDC B;  3IG3 A;  3ZNI D;  3AXC A;  4PS7 A;  2MEK A;  3RYT A;  4RGO S;  1MI0 A;  3MP9 A;  3QAQ A;  2DZK A;  1XLO A;  5EE3 A;  2KWU B;  2MJE A;  1FFU A;  1UNR A;  2AL6 A;  4RGT A;  4YSY B;  1JQ4 A;  3VUW A;  4L6E A;  1FNW A;  3I5J C;  3FM8 C;  3VRA B;  4GU2 A;  2NCN A;  2Z0E B;  4IOI E;  3VR9 B;  2NBU A;  3M95 A;  1W1D A;  3A9K B;  1DRO A;  4MGI E;  1N61 A;  4PNK A;  2M4N A;  3D32 A;  2D2Q A;  2FJ9 A;  1Z87 A;  1VDV A;  2RPV A;  1R7S A;  2K22 A;  1DDV A;  4NY0 A;  2COD A;  2A4Z A;  3B2G A;  4W9F A;  3UQA A;  2RGN B;  2LGY A;  3A1Q A;  1RFA A;  2XBB C;  2KWV B;  3NWA A;  3PLV A;  4RFB A;  2Z14 A;  1V89 A;  2CS4 A;  3CMM B;  5C16 A;  1NVL A;  2TSS A;  2FCS A;  3ZO5 B;  2VKI A;  3P7Z A;  2RSU A;  2LAS A;  1MHX A;  1WE6 A;  3BK2 A;  4MY6 A;  4I6L B;  4F7G A;  3WCQ A;  3RCP A;  3Q6B A;  3D8E A;  4W9G A;  4IM2 A;  4MM3 B;  3JSV B;  2RMM A;  4JWU C;  2BBC A;  3ZVV A;  5LNK 1;  4NNJ B;  5GOW B;  4KHB A;  2CB8 A;  3U30 A;  5IKC M;  3ZJV A;  1IGC A;  2GOW A;  3OAN A;  1Q5W B;  2BWF A;  4LK0 M;  3ML8 A;  4ZYS A;  4HAV B;  4JK9 A;  4REZ A;  5J3Y A;  1I4G A;  3ZLZ A;  3ZXR A;  2DEN B;  1DYQ A;  2L76 A;  2R2O A;  4HAT B;  4JGH B;  2N4F A;  2UYZ B;  1FCL A;  2L8J A;  2ICI A;  2D9V A;  2LGX A;  2WDR B;  3DHI C;  3IT4 B;  2JUO A;  3AU5 A;  1V8C A;  1GJZ A;  1U27 A;  2RUK B;  4A6F A;  4WWP A;  4MEM A;  2BKR B;  2O6V D;  3I63 C;  2WXR A;  1YJJ A;  4MAC A;  1I7A A;  4XWT A;  5BYQ A;  4Z2M B;  2N1V A;  4CQN A;  4G3X B;  3M1I B;  3U52 E;  3I9V 1;  1FMA D;  3DBL I;  3CSF A;  4FBJ B;  5E6O A;  1CJE A;  1Q10 A;  3GE8 C;  2WXO A;  3BJI A;  3PRP B;  3P2B A;  3MPX A;  2BW2 A;  4EZK A;  1FGY A;  5E6P A;  2SEB D;  4JQW C;  1PMS A;  3EGR A;  2BB6 A;  3E9S A;  2C60 A;  1WYW B;  1WZ3 A;  2MHJ A;  2WQY B;  1NTV A;  2FJU B;  4FJV B;  1U4A A;  4FUL A;  2WWZ A;  3ENB A;  1DDW A;  2C7N B;  5DHF B;  2E2X A;  4OSN A;  3KW5 B;  3KVF B;  3AE2 B;  1TTN A;  5FI0 A;  2DA0 A;  5JP4 A;  2XK5 A;  1FPY A;  1U2B A;  1TS4 A;  4B6H A;  1XEE A;  1Z5S B;  2AX5 A;  1T6B X;  4WWO A;  2WU5 B;  3V6E B;  4HKQ A;  2OOB B;  1TKY A;  2AWT A;  2Y5B B;  2FBW B;  1IBX B;  5FR6 A;  3TMP B;  3TEX A;  4B9K A;  1LB1 A;  1K5D B;  2YS5 A;  1SGH A;  2JWZ A;  1K53 A;  3PHW B;  3BYT B;  4NQK E;  4HJK A;  1UGJ A;  3PZD A; 
#chains in the Genus database with same CATH homology
 1WXA A;  2ZCB A;  1S1Q B;  1V5U A;  3A98 B;  4HCN B;  3NOB A;  2IBI B;  2L0T A;  1V81 A;  2V76 A;  4GMV A;  5D7G A;  2LG1 A;  3ZW3 A;  3MDB C;  2NS5 A;  1RLF A;  3PSE B;  1LXD A;  3PPA A;  1XD3 B;  1XQQ A;  3VOQ A;  5LOP B;  1XD4 A;  3VIA A;  5IAA C;  3O65 B;  2DN6 A;  4W9K A;  1Z2M A;  3CST A;  2FDQ A;  3QX1 A;  2DKQ A;  2QKL A;  3WAN A;  1V2Y A;  3RD2 A;  3KH0 A;  4K81 A;  2EJ8 A;  3HQC A;  1UBI A;  1C1Y B;  4BBN F;  1LW3 A;  1TBE A;  2K8H A;  2D4Q A;  4EOY A;  2KJH B;  2MP2 B;  2LVQ A;  1NTI A;  4JK8 A;  5DI9 B;  2N0Y A;  1U5G A;  4A3O A;  4WWN A;  2NZ8 B;  2G35 A;  2KZR A;  3VTW A;  2K39 A;  1NTY A;  3LJU X;  2N7E A;  3RZW C;  2DZI A;  4MM3 A;  4ANV A;  4N9F 4;  4PYZ A;  2KX0 A;  2P8V A;  4JKH A;  2G45 B;  1DDM A;  3N7C A;  4W9C A;  3D8F A;  5L95 C;  3L10 B;  3SDL C;  2JT4 B;  1WXV A;  2DYO A;  3PV1 A;  2L0F A;  2KFK A;  5LXH A;  2KX3 A;  4RM9 A;  1TXD A;  3BY4 B;  4DHZ B;  1EVH A;  2HD5 B;  4NJ7 A;  4MGY E;  3FP5 A;  2DYM A;  4MGZ E;  4WAA A;  3RCZ A;  3K9O B;  1L2N A;  5DHA B;  5DIF B;  1WI0 A;  1WM3 A;  2RLO A;  4BBK A;  4HB3 B;  4M0W B;  3APC A;  2ZNV C;  4HK2 A;  2MWS B;  3TBL D;  2BYE A;  2K2U A;  2IY0 B;  5HE3 A;  2CKH B;  4NQL B;  4F7H A;  2FAZ A;  2O6V B;  1WGG A;  5IA7 A;  3QC8 B;  1X86 A;  2JZ3 B;  2LUL A;  3A33 B;  1LFD A;  2RR9 A;  3KYC D;  5TR5 A;  3APF A;  2Z0O A;  3R3M A;  3UIO B;  2R0D A;  2BYV E;  4FJZ A;  4M8N A;  1IYF A;  4DX9 0;  1BAK A;  2K1F A;  3DCG A;  1WG7 A;  2RGF A;  2N1W A;  2V4L A;  4BKT A;  4EKU A;  2Z0D B;  5AZH A;  2MLB A;  2LXA A;  3T8M A;  1K8R B;  5CTR C;  4A3P A;  2RNR B;  3FSS A;  3ODX A;  2IO2 B;  1FXT B;  2N23 A;  1U5E A;  4FN2 A;  4LCD E;  3PGE A;  2HRJ A;  3RZF A;  1R4N I;  3ODW A;  5CHW A;  4BKG A;  5JZE B;  4BKS D;  3A4R A;  4WVF B;  2IO3 B;  1J19 A;  5LXI B;  2KFK B;  2QKM A;  1G6J A;  1E8Z A;  1FHW A;  2HTH B;  4A6F B;  3OJ4 B;  3ZVR A;  5KCV A;  4W9D A;  1UBQ A;  2Y8G A;  1WE7 A;  2EMS A;  1MG8 A;  2ABD A;  1AWE A;  1WR1 A;  5KHQ A;  1VBG A;  2V3S A;  3GZN I;  5DPR A;  4BBN C;  1ZKH A;  2BYF A;  3T06 A;  4AJW A;  4Y94 A;  1J0W A;  1JDE A;  3N30 A;  1XOD A;  2PPH A;  1V9J A;  3ECI A;  3V5W A;  2DX1 A;  4ILH A;  3KY9 A;  2QHO A;  3X0W A;  2KUP A;  3KUZ A;  1KZ7 A;  1OEY A;  3KRX A;  2EC1 A;  3C0R B;  4AJY B;  3IFW B;  2VRW B;  1WJ4 A;  1WY8 A;  4EUT A;  4HHV A;  3ZNH B;  1WMH A;  2MCN B;  1L7Y A;  1BTK A;  2KQ7 A;  2CY4 A;  1OQN A;  2Y7B A;  2KDI A;  1X1G A;  3FEH A;  4WSF A;  2W2X C;  1UEL A;  3QA8 A;  1OGW A;  4HAY B;  2KFJ A;  2LWP A;  2IO1 B;  3L17 A;  4GB9 A;  3UQB A;  4GMX B;  3N3K B;  4F7U P;  2BPS A;  2KMC A;  1WVH A;  1PQS A;  3V62 A;  1ZVR A;  2KKC A;  1EF5 A;  3QCA A;  4FHK A;  4KZ0 A;  1GC6 A;  2H7E A;  1WXS A;  1ZGU B;  2KDE B;  2L00 B;  1Y19 B;  5D94 A;  3DXC A;  2JP2 A;  4JKG B;  1UH6 A;  4DDG D;  4GSW A;  3M3J A;  2HJ8 A;  1E8X A;  2DIK A;  4K2P A;  1U29 A;  2C7H A;  4EFO A;  4HAU B;  4CYE A;  2I5F A;  2MBB B;  1WX9 A;  2BCJ A;  3PRZ A;  3HK0 A;  1ST7 A;  2FID A;  1ZC3 B;  1WRD B;  2LUE A;  5C6R A;  4OVV A;  4JLC A;  2ROZ B;  2GBN A;  5BO4 B;  1I35 A;  3L0W B;  2MP2 A;  2P0H A;  4HB4 B;  3KUD B;  3EPY A;  2YRY A;  2NMB A;  2MBH A;  1H10 A;  5DPT A;  2M1M A;  1EO6 A;  4D0N B;  3ULC A;  1FGZ A;  2GBJ A;  2G3Q B;  2CRF A;  3H7P A;  2CHX A;  5C5B A;  1YQB A;  1WIA A;  2LZ6 A;  4NAW A;  1RRB A;  4W9I A;  4II2 B;  1WMH B;  3ZTC A;  2LXC A;  2GMI C;  1MIZ B;  2KGX B;  3NZS A;  4G11 A;  4K7S A;  3SNH A;  4KIK B;  1E5W A;  5CLL B;  2HTH A;  4IUM B;  2WYQ A;  1X1F A;  5IJM A;  1GGO A;  3WIM A;  1UZX B;  4IOY X;  4MJS B;  2L3Z A;  4DX8 A;  3JW0 X;  2KJR A;  2M14 A;  2RSG A;  3VXW A;  4TQ0 A;  2FCM A;  2K2J A;  1OMW A;  1TQZ A;  3L54 A;  4ZRI A;  3DQV A;  3S2A A;  1BTN A;  2NPT B;  2OQB A;  3L13 A;  2VSZ A;  4A20 A;  3TIX A;  4XZ4 A;  2IYD B;  2JXX A;  4CHK A;  1MK7 B;  1SE9 A;  2KLC A;  2NPT A;  3RUL A;  1LQB A;  2KC1 A;  4CHJ A;  2MBE A;  3PS6 A;  4IC7 B;  2AL3 A;  3D8D A;  2D9X A;  4KVG B;  3EFU A;  2IY1 B;  3L08 A;  4K7W A;  3HHM A;  1V49 A;  3B1L X;  2LBB A;  3NSU A;  2D9Y A;  4JKF A;  3K9P B;  4K2O A;  2JRI B;  4MSQ B;  3CXB B;  5HE1 A;  2LKO A;  3ENE A;  2ZZP B;  4C0A A;  3DBH I;  3PLU A;  2KCJ A;  3H1U A;  2KOX A;  4KZC A;  2KNB A;  2L05 A;  2DTC A;  2YT0 A;  2D9Z A;  1EAZ A;  4MT7 A;  2IYB A;  2M8S A;  3B08 A;  3QK0 A;  4ZYN A;  4EMO A;  1GC7 A;  1Q0W B;  2M17 A;  2XK5 B;  2MRP A;  5DPS A;  3VTU A;  1HB8 A;  5E6N A;  4HAZ B;  2GBK A;  1Y8R C;  1P6S A;  4MEL A;  5AZG A;  2MSE D;  1FOE A;  1FHO A;  1Y5O A;  4F1S A;  2KXJ A;  2DAJ A;  4ILG B;  1JRU A;  4DHJ D;  3H7S A;  4IWQ A;  4G0N B;  2ASQ A;  2MFQ A;  3F5R A;  3QQ8 B;  3N32 A;  2LGD A;  3PG7 A;  3KSY A;  2GBR A;  5J2R A;  3LDZ E;  1RRP B;  4XX5 A;  3TW1 A;  4PS8 A;  2BWE S;  3ODO A;  5J18 A;  2YSZ A;  4AWJ A;  3TVV A;  2DHK A;  5C79 A;  3CIK A;  1X05 A;  5HE2 A;  1V5P A;  4FJY A;  2Y8F A;  3QBV B;  3WYF B;  4HPM B;  2CHZ A;  4ZRK A;  2N9X A;  4DHZ E;  1WF9 A;  2JPH A;  1IRS A;  1FAO A;  1V5O A;  2ZPY A;  2R09 A;  3SO6 A;  3WAO A;  1YX5 B;  5D27 A;  2WX1 A;  1TGZ B;  2LD9 A;  3Q3F A;  4CO7 A;  2CR5 A;  1WX8 A;  4GDK A;  2COC A;  4W9H A;  4W9E A;  5L81 A;  2LJ5 A;  2RQ1 A;  3AI5 A;  2ELA A;  4WJN A;  1QQG A;  3A4S C;  2KTF A;  4TUU A;  2D07 B;  3R7Q A;  3IHP C;  2KWC A;  4GN1 A;  4HCP B;  3P6A A;  4KAX B;  2MBQ A;  2COA A;  1KBL A;  2O2V B;  2K6Q A;  3IBE A;  3SV1 A;  2KTR A;  1WZ0 A;  3MHS D;  4GDL A;  3U7D A;  1NI2 A;  3PP2 A;  3VVW B;  4I6N B;  2EKE C;  3Q3J A;  3ZKJ C;  3ZIM A;  2B3A A;  1UEF A;  4KIK A;  2O2V A;  3PVU A;  2MQJ A;  4W9L A;  4DXA B;  2YS3 A;  2COP A;  5KQ4 A;  4OVU A;  4GDK B;  3UGB B;  2K6D B;  2DYB A;  1WJU A;  2P0F A;  4CHM A;  3TO1 A;  3BIN A;  3HW2 B;  3AJ4 A;  2I5C A;  1FB8 A;  2N7D A;  1UNQ A;  3GYO A;  2KQS A;  3M63 B;  4W9J A;  3KZ1 A;  4HWI B;  2KO3 A;  2L7R A;  3SU8 X;  4F8C B;  1R4M I;  4RMA A;  2DHI A;  1IPG A;  1WGQ A;  1M7E A;  3GYP A;  4IAP A;  3DVN U;  1MK9 B;  4EJN A;  3NS8 A;  5D3Y A;  3DVG X;  3HM6 X;  3V61 A;  1X11 A;  1YD8 U;  3APD A;  3WAL A;  3H7P B;  5CHV C;  2HE7 A;  2COF A;  4PYU A;  4LJP B;  1VBH A;  1VCB A;  1NDD A;  3PRM B;  1WFY A;  2JRH A;  4WJ7 A;  2I1K A;  2OTX A;  4K1R B;  4XWX A;  3VDZ A;  4YON A;  3JVZ X;  2ZVN A;  3L16 A;  1WGD A;  2FIF A;  3TFM A;  1J0G A;  5J17 A;  1ZSQ A;  3DXD A;  1M7R A;  1XR0 B;  1ACA A;  4DWF A;  4K17 A;  1P1A A;  1WI1 A;  1OTR B;  2K8C A;  4BVU C;  3H6N A;  1ZM0 A;  1W1H A;  5GMV A;  5KQ1 A;  4ANU A;  1RJ2 A;  3A9K A;  1KC7 A;  1KI1 B;  1P3R A;  3PVW A;  2LYD A;  2LI5 A;  1H4R A;  5LLI A;  4BOS C;  2J0M A;  3A8Q A;  1P98 A;  2WDT B;  4HVB A;  1A5R A;  5HKH A;  3TJP A;  1N3H A;  2O6V A;  1XCG A;  2KMA A;  2D10 A;  3IVF A;  4EZJ A;  1AQC A;  2ZJD A;  4BKS A;  1HB6 A;  4JKG A;  2N9E B;  3NY5 A;  2LRW A;  1P0R A;  3T9L A;  4JIO U;  2DAF A;  2MKR A;  3PHX B;  4LDT B;  3F0W A;  3VFK A;  4ZRJ A;  1M94 A;  1MAI A;  3PVL A;  3PZD A;  1MIX A;  2R82 A;  3EEC A;  1DBH A;  1EUV B;  1OQY A;  1WGU A;  2KK8 A;  2J59 M;  3MJW A;  4IG7 B;  3O96 A;  5J3T A;  1V80 A;  2DFK A;  2L2I A;  2RD0 A;  2FCN A;  3DOW A;  3EHV A;  1PLS A;  3E9P A;  3ONS A;  3MTN B;  2N9P C;  5C5B B;  1ZC4 B;  3ZRF A;  5G55 A;  1P9D U;  1I42 A;  5CX3 A;  2KLG A;  1AAR A;  4NPN A;  2KD0 A;  4M8M A;  3DBR I;  1YX6 B;  3QAR A;  4LJO B;  5C23 A;  1HBK A;  3UIP B;  3DBS A;  2WX0 A;  1I2H A;  5D2M B;  5CLQ B;  1WX7 A;  4EZL A;  5D3V A;  1LM8 B;  1QZE A;  4EEW A;  1RAX A;  1OY2 A;  2DKP A;  3W1S A;  2DZM A;  2KDF B;  2W2X D;  2KTR B;  4MGK E;  2KJ6 A;  1WR6 E;  3EC8 A;  3R7R A;  1XKE A;  3PTF C;  4GIV A;  4KHB B;  1WJ6 A;  4H8S A;  2C9W B;  4P7I A;  4ASW C;  2C7M B;  1QC6 A;  1X1M A;  5JHA A;  2NVU I;  1Q67 A;  2W2W A;  3PEG A;  1P3Q U;  5KHO A;  3WA0 A;  1NBF C;  1S3S G;  1DYN A;  2BF8 B;  3PRE A;  4HB0 B;  5G2N A;  2RPQ A;  4JKA A;  3OLM D;  3AUL A;  4KDL B;  3OJ3 A;  4RM8 A;  3RUI B;  3QWZ B;  1FHX A;  1OEY J;  4IFS A;  4XC2 A;  4FAD A;  2CAY A;  1WH3 A;  2KAN A;  1NU2 A;  1U5D A;  4GOC A;  4Z2N A;  3ZRC A;  2MX2 A;  1E7V A;  2DZJ A;  5CHF A;  3G9W A;  3VTV A;  2FNJ B;  4KHA A;  2NBV B;  1BWN A;  4MH0 E;  2DYQ A;  3TL5 A;  5D6J B;  2JF5 A;  2OJR A;  2JZZ A;  3QHT A;  4A6H A;  4FLH A;  2ZEQ A;  2P0D A;  2GBM A;  2CHW A;  2CQU A;  1V5M A;  2RVB B;  5FI1 A;  2EMT A;  2Z0Q A;  4GDL B;  2Q13 A;  4NSW A;  1E90 A;  2XQN M;  1MPH A;  5AEK B;  1C3T A;  4MSM B;  4MK0 A;  1GG3 A;  1WJ1 A;  1WXM A;  1E8Y A;  3V6C B;  2ROV A;  2ZNV B;  4HPL B;  2KN5 A;  3VH3 B;  4G50 A;  2K8B A;  4KSL C;  2MWN B;  4IM0 A;  4GZU A;  4KSK C;  2CY5 A;  2NR2 A;  2YVC A;  2LRU A;  1V88 A;  4WQO B;  3WAP A;  1H8C A;  4JKD A;  4DBG A;  3UF8 A;  4ILJ A;  1YJ1 A;  2J7Q B;  2YF0 A;  3AU4 A;  1WJM A;  2UWQ A;  2UZR A;  2X18 A;  1P5T A;  2KVR A;  4DDI D;  5L83 A;  1WM2 A;  2LVP A;  4BOZ B;  3PSC A;  3RT3 B;  1KJT A;  1V61 A;  4AUQ C;  3W1Y A;  1WJN A;  4GXB A;  4WJO A;  1UGM A;  3E9L A;  2IO0 B;  2H7D A;  4ZDV A;  4TKN A;  3QJZ A;  4DBB A;  1B55 A;  2ADZ A;  2LVO A;  2JY6 A;  2UVM A;  2MW5 A;  2D11 A;  2CU1 A;  1MKE A;  2PE6 B;  4ICU A;  5JHH A;  2DHZ A;  5J3Q A;  4DHJ B;  3UZT A;  3V60 A;  3OAW A;  2FJL A;  5AZF A;  3ULB A;  4IWO A;  4PS3 A;  2FCQ A;  1WGY A;  4X57 B;  2BGF A;  4IM3 A;  2M38 A;  3A1Q B;  2Z0P A;  2DHJ A;  5LON B;  2DYN A;  4HAW B;  1KZG A;  2PE9 A;  3B0A A;  3W1S C;  4E74 A;  1SIF A;  2V1Y A;  2XEW A;  5JH5 C;  2LOZ A;  4HXD A;  4J6I A;  4JKE A;  2MBO A;  4NJ6 A;  2DX5 A;  2UZS A;  3A9J B;  2G4S A;  4KDI C;  3FLV A;  5D3X A;  4NAW B;  4LDT D;  3KUC B;  3ZDM C;  2GS0 A;  5C1Z A;  1V6E A;  2MDX A;  4HDO A;  1J8C A;  4HB2 B;  3M62 B;  3QIJ A;  1EGX A;  4FHJ A;  3SD5 A;  2PZ1 A;  3ML4 A;  5HE0 A;  1GNU A;  3NZU A;  5EFX A;  4ANX A;  2R2Q A;  4F7Z A;  4ANW A;  4IWP A;  4IW0 A;  4I6P A;  1DIK A;  2PEA A;  2ZPN A;  1KLV A;  3H9D A;  3WAM A;  2DLW A;  2FUH B;  4K7U A;  2ZCC A;  4JK7 A;  4A6K A;  2YT1 A;  3SBT A;  1BT0 A;  3JYU A;  3ALB A;  2G4D B;  1SHC A;  2ELB A;  3SBG A;  1CMX B;  1F9J A;  1WGR A;  3HIZ A;  4TV3 A;  2AEH A;  2MA9 B;  2L1C A;  1U5F A;  3UIN B;  4AP4 C;  2D3G A;  3VQI A;  2D9W A;  1Q1O A;  3SYX A;  4BFR A;  2W9N A;  2VRR B;  3DPD A;  4MJS A;  4HAX B;  1V5T A;  2AYO B;  2Z59 B;  3I3T B;  3DVN V;  3KYD D;  4KV2 A;  4E71 A;  2I1J A;  4URK A;  4MDK E;  3ZTD A;  2M0X A;  3LJ3 A;  3E9O A;  2YS1 A;  3DVG Y;  3TCA A;  3R66 C;  3ZUN A;  4AOF A;  3X23 A;  1KM7 A;  2BKF A;  3U8Z A;  3E66 A;  5DH9 B;  5DPW A;  3SUZ A;  3QWM A;  4WJQ A;  3ZNG C;  1E8W A;  2K25 A;  4ICV A;  3VAW A;  4A5K A;  2PJH A;  3A8P A;  2IZV B;  1KOT A;  5JLJ B;  1VD2 A;  1V86 A;  1EF1 A;  4HLE A;  2NBW B;  1UD7 A;  5EDS A;  3A9J A;  1WGH A;  2C5L C;  3CF6 E;  4GGQ A;  2K00 A;  4PQ0 A;  2YLM A;  5D3W A;  4JKC A;  3GOE A;  4HDQ A;  3DXE A;  2GCL A;  1UPR A;  1D3Z A;  3ZNZ B;  4DK5 A;  1UPQ A;  3ZDT A;  1K5G B;  2KDB A;  2X0S A;  3PT2 B;  3HM3 A;  2JVC A;  1TZ1 A;  4FA6 A;  1HE8 A;  4TQ1 A;  3NHE B;  4GPT B;  3KRW A;  3ML9 A;  3SHQ A;  2A5U A;  2GCJ A;  4E3C A;  2LOX A;  3VUX A;  4TYZ A;  3VH4 B;  1W1G A;  3JSV A;  1YIW A;  1UNP A;  4WJP A;  4JL9 A;  4KHO A;  2KHW B;  2DX5 B;  1GUA B;  2IFS A;  2J0J A;  1XT9 B;  2REX A;  1IP9 A;  2KC2 A;  3VUY A;  4B6W A;  1TJ6 A;  2WH5 A;  5DCN A;  3VHT C;  1PFJ A;  5JHB A;  4JKB A;  4YL8 A;  1ISN A;  1XX0 A;  2GJY A;  4II3 B;  2J0K A;  2ZVO A;  4B95 A;  1E7U A;  1T0Y A;  5JHG A;  5JVL A;  1ZW7 A;  3DDC B;  3IG3 A;  3ZNI D;  3AXC A;  4PS7 A;  3RYT A;  3QAQ A;  2DZK A;  2KWU B;  1UNR A;  2AL6 A;  3VUW A;  4L6E A;  3FM8 C;  4GU2 A;  2NCN A;  2Z0E B;  2NBU A;  3M95 A;  1W1D A;  3A9K B;  1DRO A;  4MGI E;  4PNK A;  2M4N A;  3D32 A;  2D2Q A;  2FJ9 A;  1Z87 A;  1DDV A;  4NY0 A;  2COD A;  2A4Z A;  4W9F A;  3UQA A;  2RGN B;  2LGY A;  3A1Q A;  1RFA A;  2XBB C;  2KWV B;  3PLV A;  1V89 A;  2CS4 A;  3CMM B;  5C16 A;  1NVL A;  2FCS A;  3ZO5 B;  2VKI A;  3P7Z A;  2RSU A;  2LAS A;  1WE6 A;  4MY6 A;  4I6L B;  4F7G A;  3RCP A;  3D8E A;  4W9G A;  4IM2 A;  3JSV B;  3ZVV A;  4NNJ B;  5GOW B;  3U30 A;  2CB8 A;  2GOW A;  3OAN A;  1Q5W B;  2BWF A;  3ML8 A;  4HAV B;  4JK9 A;  5J3Y A;  3ZLZ A;  2DEN B;  2L76 A;  2R2O A;  4HAT B;  4JGH B;  2N4F A;  2UYZ B;  2L8J A;  2D9V A;  2LGX A;  2JUO A;  3AU5 A;  1GJZ A;  1U27 A;  2RUK B;  4A6F A;  4WWP A;  4MEM A;  2BKR B;  2O6V D;  1I7A A;  4Z2M B;  2N1V A;  4G3X B;  3M1I B;  3DBL I;  3CSF A;  4FBJ B;  5E6O A;  3BJI A;  3P2B A;  3MPX A;  4EZK A;  1FGY A;  5E6P A;  4JQW C;  1PMS A;  2C60 A;  1WYW B;  1WZ3 A;  1NTV A;  4FJV B;  1U4A A;  4FUL A;  2WWZ A;  3ENB A;  1DDW A;  2C7N B;  5DHF B;  2E2X A;  3KW5 B;  3KVF B;  1TTN A;  5FI0 A;  2DA0 A;  5JP4 A;  2XK5 A;  1U2B A;  4B6H A;  1Z5S B;  4WWO A;  3V6E B;  2OOB B;  2AWT A;  2Y5B B;  5FR6 A;  3TMP B;  4B9K A;  1LB1 A;  1K5D B;  2YS5 A;  1SGH A;  2JWZ A;  3PHW B;  4NQK E;  4HJK A;  3PRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...