1H4RA

Crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
b'KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERLIN
publication title The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 96
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1h4rA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1h4rA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h4rA01
3KRWA 4BVUC 4M8MA 1UEFA 1WGDA 4FHKA 4KZ0A 2ROVA 1LQBA 3VTVA 1XQQA 1E5WA 5D3VA 2CQUA 1V49A 4MGYE 2KZRA 3QCAA 1ZGUB 4EMOA 4F7GA 4NAWA 2MKRA 4ZDVA 4IM3A 4OVUA 1WE7A 4KIKA 4TKNA 1WYWB 3H7PA 2KDEB 4EUTA 3SD5A 4E71A 4FLHA 3L17A 2R2QA 5FR6A 1LW3A 4W9CA 3DCGA 2D07B 3KYDD 3PTFC 1UELA 3PSEB 3V6CB 5C1ZA 1AWEA 1M7RA 3P7ZA 4TQ0A 4I6LB 2G4DB 5D3WA 2L1CA 2B3AA 3QWZB 3ODWA 3V5WA 5JH5C 3ZW3A 2FIDA 2IY0B 4DX8A 2LXAA 4WWNA 1ST7A 2RUKB 4BBNF 4WJQA 3ZRFA 2RSUA 2D11A 5LLIA 3SHQA 2K6DB 3EFUA 2LRUA 3U8ZA 1SIFA 3RT3B 1ZM0A 1U5DA 1FGYA 2AYOB 3PP2A 1WRDB 5DPWA 4K7UA 4TUUA 1M7EA 4HLEA 3LJUX 4F8CB 5J3TA 3QC8B 1XODA 1U5EA 2L0FA 3QWMA 2UWQA 2KDBA 5CLQB 2I5FA 1EUVB 1DDMA 2JY6A 3PLVA 3PPAA 3ZUNA 1EF1A 1GUAB 2WX1A 5DPRA 3ZIMA 4A5KA 4EZLA 4B9KA 1V9JA 3A1QB 3ZTDA 2PZ1A 1VCBA 3X23A 3APDA 4RM9A 1S3SG 3LJ3A 2HD5B 3C0RB 2LRWA 5AZHA 4YL8A 3FLVA 1OY2A 5EFXA 3OJ4B 3NZSA 4GDKB 1WGYA 3PV1A 2JT4B 2ZVOA 2X18A 4M8NA 5DIFB 4N9F4 1WZ3A 3L16A 2DENB 1X86A 4GIVA 4X57B 3EHVA 3IBEA 2A5UA 3L13A 1V6EA 4WVFB 3ULBA 2XK5A 1UNRA 3F0WA 2LJ5A 2XEWA 1MAIA 3UGBB 1WM2A 3DVGY 3VTWA 4HPMB 2MSED 5E6PA 2DHZA 4HB3B 1DROA 2NBWB 2OQBA 2ROZB 2MBQA 4CHJA 2VSZA 3ODXA 2C7NB 4BBKA 3P2BA 2PE6B 1TZ1A 3NS8A 1WX8A 1WG7A 2MP2A 3VXWA 3T8MA 3H9DA 3RUIB 2K2JA 2FCMA 2RLOA 3SU8X 1XCGA 2NS5A 2GBNA 5CHFA 2HTHA 3R3MA 3ONSA 3PRZA 2LVOA 1V5TA 1HE8A 1YJ1A 4KHOA 1KZ7A 4KAXB 4W9LA 2D4QA 4HWIB 4FJZA 3SV1A 4A6HA 4HCNB 1MG8A 4XZ4A 5C23A 2M4NA 3LDZE 2LYDA 4HVBA 2OTXA 3A4SC 1S1QB 3GOEA 4EZJA 3A8PA 3K9PB 1SHCA 1OGWA 1F9JA 1H8CA 2KC2A 2WX0A 1KM7A 2EJ8A 3A9JB 1TGZB 4F7ZA 3DBSA 4K1RB 1RLFA 2UYZB 3RCZA 1SGHA 2DN6A 3QQ8B 4WJNA 4ICVA 2MX2A 2Z59B 3DXDA 2D3GA 4B6HA 2MBHA 4HDQA 2KFKA 2LASA 4ZRJA 2VRWB 2DYMA 2MDXA 2GMIC 4URKA 2DLWA 5JZEB 2CY4A 2XQNM 2J0JA 1X1MA 5IJMA 2BWES 2LVPA 2CRFA 2IO1B 4WJPA 3QX1A 1BWNA 2D9YA 1EGXA 5HE3A 1WMHA 2N23A 2RGNB 1W1HA 3PVLA 4P7IA 1B55A 2JZ3B 1DDWA 4OVVA 2DFKA 4BFRA 2COCA 1LB1A 4GN1A 3TO1A 2P0FA 3L54A 2ABDA 3MDBC 3ZLZA 4AOFA 1NI2A 3VIAA 1RRPB 4B6WA 4A6KA 2COFA 3CXBB 4A6FA 4II2B 1WGGA 5C79A 4KHBB 4GGQA 3MJWA 3KRXA 5J3QA 2LVQA 2RVBB 4RMAA 2KANA 2AL6A 2ELAA 1J19A 3OAWA 1BTNA 4IG7B 3V62A 1FB8A 2KMCA 4IWOA 3A33B 3PRMB 2A4ZA 2O6VA 4GOCA 2LGXA 4NY0A 2BYEA 1YIWA 4W9KA 2C60A 4HATB 2ZCBA 1QQGA 2DYNA 1KOTA 4A20A 4MJSA 2C7HA 2L76A 1WM3A 2DX5B 4EZKA 2NPTB 4HPLB 3W1SC 4HK2A 1FHWA 2K6QA 1TBEA 1P5TA 3AXCA 1Y8RC 2BCJA 2DHKA 3A8QA 3WYFB 2MBEA 4DBGA 3APCA 2MRPA 2V1YA 1NU2A 3M3JA 2KDIA 2LOXA 2Y8GA 4NQKE 1V5PA 2V76A 5IA7A 4IUMB 3Q3FA 2I1JA 4GB9A 3D8DA 1XR0B 1GNUA 4HAZB 1UNPA 5D3YA 1E7UA 2EMSA 4GU2A 2IO0B 5D27A 3TVVA 4XX5A 1BTKA 2ASQA 5DPSA 3DXEA 2C9WB 2REXA 3DQVA 1XD4A 4HAWB 2KTRB 3A9KA 2NZ8B 4L6EA 4WQOB 1ZVRA 2YS5A 4LJOB 3DVNV 2DX1A 1OEYA 2VRRB 4BKTA 5CX3A 2Z0OA 1ACAA 3QHTA 4PS7A 2IYDB 1U5GA 5GMVA 2FJ9A 2Z0DB 3B08A 3IVFA 5HE1A 1BT0A 2LG1A 4EEWA 3PS6A 1WJMA 1KLVA 2HE7A 3PVUA 5FI1A 2ZNVC 4MELA 2RSGA 4HAUB 1X11A 4JLCA 2DAJA 5C5BB 3PEGA 2FUHB 2JF5A 4W9JA 1TJ6A 2DAFA 4TQ1A 4DHJB 1PMSA 4H8SA 1H4RA 1RRBA 2KUPA 4MM3A 3KUDB 4LDTD 4PS3A 2XBBC 5L81A 2GCJA 3FSSA 3VUXA 4HAVB 1KJTA 2R0DA 2LGDA 1WGUA 4DWFA 1WF9A 4HB0B 2RNRB 3M1IB 2JXXA 4K2OA 2UZRA 1YX6B 2PE9A 3VFKA 2ZPNA 1WVHA 1EAZA 4ZYNA 3MPXA 3ZTCA 2L7RA 5HE0A 1J0GA 3RZWC 4ZRIA 4K17A 4GDLA 5JHHA 1E8XA 3VQIA 1K8RB 2D9WA 2JP2A 1U4AA 2JRHA 1WIAA 3T9LA 2JUOA 4A3PA 5EDSA 5CLLB 2L05A 2ZJDA 3ML9A 1L7YA 3K9OB 1WGQA 5DPTA 3VUWA 2MA9B 5AZGA 1C3TA 4K2PA 5CTRC 4JGHB 4NAWB 4EJNA 4GXBA 4GMVA 3U7DA 5D6JB 4KIKB 4ANVA 4F1SA 1U27A 2KKCA 2O6VD 1K5DB 1P3QU 3RYTA 4KZCA 4BKSD 2IY1B 3NSUA 4TV3A 3HM6X 3WAPA 3GYOA 3CMMB 3H7PB 4PS8A 5DHAB 4FULA 4HB2B 5HKHA 5AZFA 2OJRA 3ZVRA 3PT2B 3DBRI 2W2XD 1V86A 2M38A 1XX0A 1ISNA 3S2AA 4CHKA 4E74A 4FJVB 4KSKC 2FAZA 1M94A 3CSFA 2N9EB 4DHJD 3AULA 2AWTA 3QK0A 2KQ7A 2CKHB 3OLMD 4KHAA 1P98A 4DK5A 1GC7A 4IWQA 3I3TB 2O2VA 3JVZX 3H7SA 3M95A 2ZPYA 1ZC3B 3NY5A 3ZDTA 1OTRB 2YT1A 3CF6E 1NTYA 1PLSA 3ULCA 2QKLA 1NTVA 1FHOA 4LJPB 2EKEC 2LUEA 2RD0A 4HB4B 4NPNA 5C16A 3ML8A 2KOXA 2CAYA 3ENEA 2H7EA 2BPSA 4KDLB 3VAWA 2DYOA 4DX90 3B0AA 1UH6A 1WJ1A 4IWPA 4FHJA 1T0YA 3F5RA 2GCLA 2R2OA 4PQ0A 3Q3JA 3ZRCA 3KUZA 1FAOA 3TBLD 2PPHA 2IYBA 2RR9A 1G6JA 2BGFA 5C6RA 2LKOA 1U2BA 2DHIA 1WY8A 2XK5B 3JSVA 4IAPA 3QIJA 1Q0WB 4JL9A 1IPGA 3KW5B 4ANXA 3VDZA 1W1DA 2MQJA 3ALBA 3PHWB 2UVMA 3HQCA 1R4MI 3VUYA 2CS4A 1ZC4B 3V6EB 3L08A 2ADZA 3QARA 3RD2A 4NJ7A 5L95C 4PYZA 3EPYA 3SYXA 4J6IA 3D8FA 1OQNA 2IO2B 5LXIB 1V2YA 2HTHB 5KQ4A 1H10A 5D94A 3SUZA 2VKIA 2UZSA 1Y19B 2CHXA 2L2IA 2KDFB 2KWCA 3ZNHB 3O96A 2NMBA 2COPA 4JQWC 1YX5B 2D9XA 2DKPA 4NNJB 2K25A 1GG3A 3KUCB 3BY4B 4EOYA 3SNHA 2JVCA 1EVHA 2FDQA 1PQSA 2PJHA 2DYBA 4HJKA 2Y8FA 1UD7A 3UQAA 4HAXB 3OANA 3UIOB 2M0XA 3M62B 1V88A 1A5RA 1YQBA 2G45B 4GPTB 4FJYA 1MPHA 2E2XA 3PSCA 2KLCA 1SE9A 1CMXB 3ODOA 2P0HA 3NOBA 2BKFA 1UZXB 1UPQA 2J59M 2MW5A 3HIZA 1WH3A 4ASWC 2K1FA 2NVUI 2CR5A 4W9EA 1P6SA 2YRYA 1OEYJ 2KFKB 2ZZPB 4LDTB 3IG3A 2CHWA 5J2RA 1GJZA 3KSYA 4BKGA 3N30A 3W1SA 3FM8C 1RFAA 1E8WA 3WAOA 3MTNB 3DPDA 4ZRKA 1U29A 2K8HA 3A4RA 3PVWA 3CSTA 4IOYX 5KHQA 4MK0A 1WMHB 2N1VA 3U30A 3B1LX 2DZKA 1X05A 4WJ7A 2NBUA 3JW0X 3R7QA 3VVWB 4IM2A 3G9WA 2DA0A 3D32A 3OJ3A 3TW1A 1LFDA 3TFMA 5HE2A 4DXAB 2QHOA 2KX0A 1P1AA 4PYUA 2N7EA 2LGYA 3ZNZB 1OMWA 3V61A 4AWJA 1XD3B 1WZ0A 5J18A 2DHJA 4A6FB 3ECIA 2R09A 1V5MA 5E6NA 2OOBB 1FGZA 2D10A 3QBVB 3KYCD 4WWOA 2C5LC 4LCDE 2O6VB 2YLMA 5G2NA 2D9VA 3VH4B 1DDVA 3TJPA 2GBRA 2GBJA 3KH0A 3QJZA 3M63B 4Z2NA 1WJ4A 2KC1A 4BBNC 3N7CA 2DZMA 1WI1A 4CO7A 1HB6A 2MWSB 1UGMA 3P6AA 4MJSB 4WSFA 2Y5BB 2BYVE 2GOWA 5JHAA 1AQCA 1P3RA 1Q5WB 1EF5A 4AJWA 1NVLA 3UZTA 2YT0A 4ANWA 3WA0A 1Z5SB 1XT9B 1RJ2A 2DKQA 2KK8A 4NQLB 4KDIC 2LBBA 2J0KA 1WXMA 2AL3A 3HM3A 2N4FA 4MSQB 1Q67A 5BO4B 4WAAA 4YONA 4GMXB 4K7WA 4DDID 3EECA 3DBLI 3WAMA 4BOZB 1D3ZA 4AJYB 1RAXA 4FBJB 2N1WA 1V81A 4FA6A 2L3ZA 2LD9A 1UBIA 1NDDA 3PRPB 1WR1A 3HW2B 5CHWA 4ANUA 1TQZA 5D3XA 4TYZA 2KNBA 5LXHA 1XKEA 2DTCA 5J17A 1V89A 3A9KB 3A1QA 2D9ZA 1WE6A 1Y5OA 1ZSQA 2JWZA 1K5GB 2I5CA 1J0WA 2CODA 3TCAA 2IFSA 3DXCA 4W9IA 5JHGA 3DVGX 2N0YA 2ZNVB 3RULA 2KX3A 4Y94A 4GDKA 4MDKE 4AP4C 2N7DA 1HBKA 2GS0A 3VTUA 2RQ1A 3JYUA 2MWNB 4B95A 3PHXB 2FCQA 5JHBA 1R4NI 4E3CA 5DH9B 4GSWA 2LULA 3IHPC 3QAQA 2H7DA 1JRUA 4CHMA 3L0WB 1UBQA 3PGEA 4NSWA 5IAAC 2PEAA 3ZKJC 1WR6E 3UQBA 1LXDA 2KO3A 2GJYA 4Z2MB 3PZDA 1TXDA 1MKEA 4G0NB 4MGKE 3R66C 2I1KA 3H1UA 2Z0EB 3BINA 1WGHA 2JZZA 1WX9A 4I6NB 4XWXA 3TIXA 2WDTB 2NBVB 1ZKHA 4GDLB 2IZVB 3RZFA 1WJUA 4F7HA 3O65B 3T06A 5DHFB 3N3KB 2Y7BA 5JLJB 2P0DA 2FJLA 3PG7A 2CB8A 2MBOA 3L10B 4KSLC 4K7SA 2GBMA 4WWPA 1EO6A 2J0MA 3VH3B 5AEKB 1I7AA 3NZUA 3PREA 2LWPA 3W1YA 1AARA 4ICUA 4DHZB 1V80A 2KMAA 3SDLC 1P9DU 3UIPB 2KFJA 2K00A 2M8SA 4CYEA 2L8JA 2N9PC 3A98B 2YS3A 4K81A 2BYFA 3A9JA 3QA8A 2LOZA 4AUQC 1YD8U 2CU1A 3ZNGC 4II3B 1X1GA 2EC1A 3GYPA 1IRSA 3TMPB 4HDOA 3WALA 2M14A 2W9NA 5KCVA 1E8YA 2KJHB 4HAYB 4MSMB 5KHOA 4W9DA 1E90A 1BAKA 2JPHA 2G4SA 2NR2A 2RPQA 1V5OA 5D2MB 3RCPA 1E8ZA 1WXVA 4M0WB 1MK7B 5LOPB 2M1MA 5G55A 3WANA 3R7RA 2EMTA 2KN5A 5LONB 3AJ4A 3FP5A 4XC2A 2MFQA 1WXAA 1LM8B 5L83A 2MCNB 2KLGA 2ZCCA 2L00B 2MBBB 2KJ6A 2O2VB 2D2QA 3BJIA 2KJRA 2YSZA 4RM8A 1ZW7A 1WX7A 1C1YB 4C0AA 2HRJA 1KI1B 2W2WA 2KHWB 4G3XB 3ZNID 3FEHA 4F7UP 2Z0QA 2WH5A 1WJ6A 1PFJA 4IC7B 2FCSA 5TR5A 2LI5A 1UNQA 5CHVC 3MHSD 2K8BA 1UPRA 2MP2B 1U5FA 2M17A 1Z2MA 1IP9A 5D7GA 2Z0PA 4MGIE 1L2NA 4PNKA 1WXSA 4DDGD 1HB8A 4NJ6A 1VD2A 4W9FA 2ZVNA 2KTFA 1DYNA 3KY9A 2KGXB 3V60A 1FHXA 1FXTB 4FADA 4MGZE 4MT7A 3APFA 3AU4A 3DVNU 2QKMA 2YF0A 1I2HA 1E7VA 2BWFA 4EFOA 3DDCB 3X0WA 3PLUA 5E6OA 2DYQA 3AU5A 1V5UA 2KCJA 2DX5A 1Q1OA 2NPTA 1WGRA 2KVRA 2NCNA 4MEMA 1WI0A 3JSVB 1QZEA 5JP4A 1MIXA 4WJOA 1MIZB 3H6NA 2WWZA 5J3YA 3CIKA 3N32A 1P0RA 1I35A 2KWVB 3VHTC 1Z87A 1NBFC 1V61A 2K39A 3IFWB 2V3SA 2MLBA 1MK9B 2G35A 3NHEB 2G3QB 1NTIA 2J7QB 4G11A 1FOEA 4A3OA 4MH0E 2IBIB 2K2UA 1QC6A 3D8EA 4GZUA 3WIMA 3ZO5B 5GOWB 2CY5A 5DCNA 4KV2A 3DOWA 3GZNI 2Q13A 3UINB 5KQ1A 1GC6A 2KTRA 1I42A 2LXCA 2FNJB 2JRIB 3ZVVA 4BKSA 2FIFA 2K8CA 4DBBA 3ZDMC 2L0TA 4IM0A 3ML4A 2ELBA 2LZ6A 2DZJA 2BKRB 2COAA 4W9GA 1KZGA 2HJ8A 4W9HA 3KZ1A 2IO3B 3AI5A 5FI0A 1WFYA 2N9XA 1X1FA 2YS1A 2KXJA 4BOSC 3HK0A 5C5BA 1IYFA 1OQYA 2W2XC 1J8CA 2KQSA 1N3HA 1W1GA 3KVFB 2V4LA 2WYQA 2KWUB 4HHVA 3EC8A 1DBHA 3HHMA 2DZIA 4KVGB 2KD0A 2AEHA 2BF8B 4DHZE 4D0NB 2C7MB 3SO6A 4G50A 4FN2A 4HCPB 2FCNA 2YVCA 4EKUA 4MY6A 4IFSA 5DI9B 4IW0A 2RGFA 2ZEQA 1TTNA 2GBKA 3DBHI 4I6PA 4JIOU 2P8VA 1WJNA 3UF8A 3VOQA 4HXDA 3TL5A 2CHZA
chains in the Genus database with same CATH superfamily
3EFCA 3KRWA 4BVUC 3FC4A 4KX6B 4USAA 4M8MA 1QQRA 1UEFA 1WGDA 4FHKA 4KZ0A 2INDC 2ROVA 1TY0A 1LQBA 3T3OA 4ARCA 4QJ3B 3VTVA 5BYSA 1C79A 3OWEB 4US9A 4JKGB 1XQQA 1E5WA 3NVVA 1C4CA 5D3VA 2CQUA 1V49A 4MGYE 2KZRA 1L0XB 2V3PA 3QCAA 1ZGUB 1JWAD 4EMOA 1WSPA 4GNKB 4F7GA 3UI3A 1SE4A 4NAWA 2MKRA 4ZDVA 4RGOS 4IM3A 4OVUA 1F52A 1WE7A 3HUIA 3P4RB 4KIKA 1UGJA 2INPE 4TKNA 4FXCA 4D6WA 1R4MB 4IKGA 1WYWB 3H7PA 2KDEB 4EUTA 3SD5A 4E71A 4FLHA 3L17A 1T0QC 2R2QA 5FR6A 2V9HA 3FAHA 1LW3A 1DIKA 1QOGA 3AEDB 2KDMA 4W9CA 3DCGA 1E9MA 2D07B 3KYDD 3PTFC 3V3XA 1UELA 4WH4A 1P7FA 3PSEB 3V6CB 5C1ZA 3ZJTA 3NVZA 1AWEA 1M7RA 2MH7A 3P7ZA 4TQ0A 3GS2A 4I6LB 2G4DB 5D3WA 1PUTA 2KYWA 4JKHA 2EELA 2L1CA 2B3AA 3QWZB 2Y5PA 3ODWA 3V5WA 3RNFC 2D3AA 3CIRB 4K3BA 3ZW3A 5JH5C 2FIDA 1L6UA 2IY0B 1QKZA 4DX8A 2LXAA 4WWNA 1LGRA 4L1BA 1ST7A 2RUKB 4BBNF 4WJQA 3ZRFA 2RSUA 2D11A 2WXQA 5BMHA 1ZXHA 5LLIA 3RPFC 3SHQA 2K6DB 2KIGA 3EFUA 2LRUA 3U8ZA 1SIFA 3RT3B 1ZM0A 1U5DA 1FIQA 3VR9B 1FGYA 2AYOB 3PP2A 1WRDB 1AWDA 5DPWA 4K7UA 1KH0A 4TUUA 1ZDXA 1M7EA 3RFZB 4HLEA 3LJUX 2BYTA 4F8CB 5J3TA 3QC8B 4LNFA 2Z4DA 1XODA 1U5EA 2L0FA 3QWMA 2UWQA 4KGTA 4ACFA 5MPOA 2KDBA 3BIID 5CLQB 2I5FA 3B2GA 1EUVB 3Q3OC 1DDMA 2JY6A 3PLVA 4IDIA 3PPAA 4OZCA 1WGKA 3ZUNA 1EF1A 1GUAB 4TSSA 2WX1A 5DPRA 3ZIMA 1KFYB 4A5KA 1SB3C 4EZLA 4CSQA 2BB6A 4B9KA 1V9JA 3A1QB 1I4GA 3ZTDA 2PZ1A 4OSNA 2IGHA 4LNNA 1VCBA 3Q8CA 3X23A 4A55A 3APDA 4RM9A 1S3SG 1T5XD 2AQ3B 3LJ3A 4DXFA 2HD5B 3C0RB 3DHGC 4L23A 2LRWA 5AZHA 4YL8A 1K50A 2JQRB 3AMZA 1PYWD 3FLVA 1OY2A 5EFXA 3OJ4B 3GZNB 3NZSA 4GDKB 1VBGA 3AE4B 1WGYA 3PV1A 2JT4B 2ZVOA 2X18A 4M8NA 1QF6A 4KKJA 4C4VA 5DIFB 4A90A 4N9F4 1WZ3A 3L16A 2DENB 1X86A 4GIVA 4RF1A 4X57B 3EHVA 3IBEA 1TIFA 2A5UA 3L13A 1V6EA 4RCOA 4WVFB 3ULBA 2XK5A 5GXGB 2JZPA 1XCQL 1UNRA 3FILB 3F0WA 4JKEA 2PVGC 1Q10A 1N6ZA 2LJ5A 2XEWA 2YEPB 1MAIA 3UGBB 1WM2A 3DVGY 3VTWA 2HDEA 2W82A 1ESFA 3I9V1 2LJIA 4HPMB 3ZJVA 1GPXA 2CJOA 2MSED 5E6PA 4AS1A 1UUPA 1J7AA 4HB3B 2DHZA 2DNFA 2Z13A 5M4YB 1DROA 2NBWB 2OQBA 2ROZB 2MBQA 4CHJA 2VSZA 3ODXA 2C7NB 4BBKA 3P2BA 2PE6B 4AQ7A 1TZ1A 3NS8A 3Q2AC 1WX8A 1WG7A 2MP2A 1TJEA 3AE7B 2LHEA 3VXWA 3T8MA 3H9DA 3RUIB 2K2JA 5AUIA 2FCMA 4M02A 2L83A 2KVZA 2RLOA 3N1YC 1XEEA 1D5XC 1F1HA 3SU8X 1XCGA 2NS5A 2GBNA 3NJTA 5E6JA 2M19A 5CHFA 2HTHA 3R3MA 3ONSA 3PRZA 2LVOA 1V5TA 1HE8A 1YJ1A 4KHOA 1KZ7A 5HI1A 4KAXB 4W9LA 2V0GA 1YQ4B 3P1MA 4M00A 2D4QA 4HWIB 3SV1A 4FJZA 4A6HA 4HCNB 1MG8A 4XZ4A 3IAM1 1DYQA 5C23A 4YTNB 3DBHB 2M4NA 3LDZE 2LYDA 4HSIA 3AE9B 2JSVX 1TKGA 4HVBA 2OTXA 2WXNA 3A4SC 1FPYA 1JW9D 1NYQA 1S1QB 2I38A 3GOEA 4EZJA 1IBXB 4ILHA 3A8PA 4RNAA 3K9PB 1QLBB 3IT4B 1SHCA 1OGWA 1F9JA 1MVKA 1FM0D 1H8CA 2KC2A 3U2SC 3ZGZA 2WX0A 1KM7A 2EJ8A 2NTTA 3A9JB 1TGZB 4F7ZA 3BWUD 5D3DA 3DBSA 4K1RB 1RLFA 2K3UA 2UYZB 2OEDA 3RCZA 1SGHA 2QCZA 2DN6A 2EKIA 3QQ8B 4WJNA 3RNBC 4ICVA 2MX2A 2Z59B 3DXDA 1TYGB 2D3GA 2JWUA 4B6HA 1DGJA 5IKCM 2MBHA 4HDQA 2KFKA 2LASA 2BVCA 1ENFA 4ZRJA 2VRWB 2DYMA 2MDXA 2GMIC 3W2DA 4URKA 2DLWA 1VJKA 2R2YA 5JZEB 2CY4A 2XQNM 2J0JA 1X1MA 5IJMA 2BWES 2LVPA 2CRFA 2IO1B 2IPKD 1NENB 2KACA 4WJPA 1E7PB 3QX1A 1BWNA 2WXKA 2D9YA 4JK7A 1EGXA 5HE3A 2LGSA 1WMHA 2N23A 2RGNB 2AQ1B 1MPEA 1W1HA 3PVLA 4P7IA 1B55A 2JZ3B 1DDWA 2MHJA 3E9SA 4OVVA 2DFKA 1EWCA 1JWMD 2RDGA 4BFRA 2COCA 1LB1A 4RFBA 4GN1A 1VR9A 2KUQA 2LEKA 3TO1A 3AM9A 2P0FA 3L54A 2ABDA 2WQYB 3MDBC 1FNUA 2AQ2B 3NW8A 2H88B 3ZLZA 1WWTA 4N59A 4AOFA 5TSSA 2J52A 3NUHB 1SIJA 1NI2A 3VIAA 1ZDVA 3J9CA 1RRPB 2PIAA 4B6WA 4A6KA 2YT2A 2COFA 3CXBB 3B77A 2H89B 4A6FA 4II2B 1WGGA 5C79A 3AH7A 1HA5A 4KHBB 4GGQA 3AB5A 1FMAD 3MJWA 3KRXA 4P6VF 3PO0A 4WQMA 5J3QA 4R3DA 2LVQA 2RVBB 1C9FA 4RMAA 2KANA 1E10A 2AL6A 2ZKMX 3IAS1 2IJ0A 2ELAA 1J19A 3OAWA 1BTNA 4IG7B 3V62A 1FB8A 2KMCA 2LFIA 4IWOA 3A33B 3KWLA 3PRMB 3TEZA 4ILJA 2A4ZA 2O6VA 4RGMA 4GOCA 2LGXA 3GE3C 3TSSA 4NY0A 1E6EB 1ZP0B 2AX5A 2BYEA 1JDEA 1YIWA 4W9KA 2C60A 4HATB 2ZCBA 1QQGA 2DYNA 1KOTA 4A20A 4MJSA 2C7HA 2L76A 1WM3A 4C80A 2DX5B 5HG2A 4EZKA 2NPTB 4HPLB 1MFWA 4Q2JA 3W1SC 4JKFA 1FHWA 4HK2A 2K6QA 2W3RA 3MC9A 1WXQA 1TBEA 1P5TA 3AXCA 1CK1A 2VH1A 1Y8RC 2BCJA 2DHKA 3BVMA 5G5HA 2WXFA 2D3BA 3A8QA 3WYFB 2Z8LA 2MBEA 4DBGA 1E0ZA 5HFYA 1JCKB 3AE3B 3BK2A 3APCA 2MRPA 2V1YA 1NU2A 1GB1A 3M3JA 2KDIA 3AEAB 2LOXA 2Y8GA 3NWFA 4NQKE 2J42A 1V5PA 2V76A 5IA7A 3U52E 4IUMB 3Q3FA 2I1JA 2PVOD 3D8DA 4GB9A 1XR0B 1GNUA 2PTLA 4HAZB 4JK9A 1TZOA 1UNPA 5D3YA 1E7UA 3AE5B 3Q8FA 2EMSA 1YJJA 4GU2A 4LNIA 2IO0B 5D27A 3TVVA 4XX5A 3DWGC 1BTKA 3MJ5A 2ASQA 5DPSA 1FCLA 4KGRA 3DXEA 3B9JA 2C9WB 2REXA 2BQQA 2PKOA 3DQVA 1XD4A 4HAWB 2KTRB 3A9KA 4S17A 4C7ZA 1VDVA 2NZ8B 3NVWA 4L6EA 4WQOB 1ZVRA 1HEZE 2YS5A 2MJ3A 4LJOB 3DVNV 1I4HA 2DX1A 1IUEA 1D5MC 2GI9A 1OEYA 2VRRB 4BKTA 5CX3A 2Z0OA 4B0MA 1ACAA 3QHTA 4WURA 4PS7A 2IYDB 1U5GA 2WDQB 3N1ZC 5I2MA 5GMVA 1NYRA 2FJ9A 2Z0DB 3B08A 3IVFA 5HE1A 1BT0A 1WRIA 2LG1A 1JWUD 1SBBB 4EEWA 3SR6A 3PS6A 1WJMA 1KLVA 2HE7A 3PVUA 5FI1A 4H2AA 2ZNVC 4MELA 1V1PA 2RSGA 4HAUB 2IDYA 2MJEA 1X11A 4JLCA 2IGDA 2N9LA 2DAJA 5C5BB 3PEGA 1XCTL 2WXGA 4GLSC 2FUHB 3ZJUA 2JF5A 4W9JA 1TJ6A 2DAFA 4TQ1A 4DHJB 1PMSA 4H8SA 1RYJA 1H4RA 1RRBA 4NJCA 3KWVA 1SE2A 1YOVB 2KUPA 4YXDB 4MM3A 3KUDB 4LDTD 1KLGD 4PS3A 1XLNA 1N60A 2W55A 2XBBC 5L81A 2GCJA 5EE9A 1C4AA 1SF0A 3FSSA 5BMGA 3VUXA 4HAVB 1HZ5A 2R0DA 1KJTA 3E66A 2LGDA 1WGUA 4DWFA 1WF9A 4HB0B 2RNRB 3M1IB 2JXXA 4K2OA 2WLBA 2UZRA 1YX6B 3I57A 2PE9A 3VFKA 2ZPNA 1WVHA 1EAZA 2L32A 4ZYNA 3FVCA 1CQVA 3HSAA 3MPXA 3LYYA 1IGCA 3ZTCA 1KTKA 2L7RA 5HE0A 2NBVA 1J0GA 3RZWC 1STEA 4ZRIA 4NZLB 2KN4A 4K17A 2DWQA 2QEJC 4XWTA 4GDLA 5JHHA 1E8XA 4K3CA 1QOFA 2M0AA 3VQIA 1AW7A 1K8RB 4S0RA 4US8A 2KAJA 2D9WA 3ZXRA 2JP2A 3SEBA 1F0ZA 4QJ4B 2Y5CA 1U4AA 2JRHA 3EUB2 1SXTA 1N5WA 1SEBD 2K8EA 2OJWA 1QOAA 1WIAA 3PZ7A 2WHIA 3T9LA 2K49A 2JUOA 4A3PA 3P4SB 5EDSA 4DIXA 1FFVA 1GGOA 5CLLB 2QIEB 2L05A 2ZJDA 3ML9A 1L7YA 1TS2A 3NZ3A 3L4PA 2I2YA 4OZBA 3K9OB 1WGQA 5DPTA 3VUWA 3SFEB 3E9LA 2MA9B 4JPSA 5AZGA 3HVZA 1C3TA 3E9OA 4K2PA 5CTRC 1XF5L 4JGHB 4NAWB 4EJNA 4C56C 4GXBA 1PFDA 4GMVA 3U7DA 3KLSX 5D6JB 4KIKB 1JROA 4ANVA 4F1SA 1U27A 2KKCA 2O6VD 1K5DB 1P3QU 3P4QB 3RYTA 2QJLA 4KZCA 4BKSD 2IY1B 3NSUA 4TV3A 3HM6X 1NEKB 3WAPA 3TEYA 2BS4B 3GYOA 3CMMB 3H7PB 1ZYIA 4PS8A 2NMQA 3NVYA 1KF6B 3AE8B 3MFGA 5DHAB 1MHHE 3EA6A 3R2TA 4D2KA 4FULA 3RMKC 4HB2B 5HKHA 4P16A 5AZFA 2OJRA 3ZVRA 2RPVA 2VZKD 3PT2B 2CU3A 2WXIA 3DBRI 3GB1A 4JX1C 2W2XD 1V86A 2M38A 1K52A 1PGXA 2WDVB 1TS5A 2BBCA 1XX0A 5I4DA 1PDXA 3IT6B 5JXVA 1ISNA 3S2AA 4CHKA 4E74A 4FJVB 1Y56A 1TT5B 4KSKC 2FAZA 1M94A 4PK1A 4M0WA 2ON8A 3CWIA 3CSFA 1I4QA 2N9EB 4DHJD 3AULA 2AWTA 4A9AA 3EGRA 3N20C 3QK0A 1L4DB 2KQ7A 2CKHB 3OLMD 3AE6B 4KHAA 1P98A 3NWAA 4DK5A 4P1CC 1GC7A 4JKDA 1YN4A 4IWQA 2WXMA 3I3TB 4RGNA 2FBWB 2O2VA 1VRAB 1TKYA 3JVZX 5G5GA 3H7SA 3M95A 1OQRA 1I4XA 2ZPYA 1ZC3B 3NY5A 3ZDTA 1OTRB 2YT1A 3CF6E 1NTYA 1PLSA 3ULCA 2QKLA 2DLBA 1NTVA 1FHOA 4LJPB 2EKEC 2LUEA 2RD0A 2RRFA 4HB4B 4NPNA 5C16A 2N0SB 1CJEA 2MJDA 3DHIC 4QXAB 3ML8A 2KOXA 2CAYA 3ENEA 3U7ZA 2H7EA 4MH8A 2BPSA 4KDLB 1C77A 4WAFA 1HQRD 3VAWA 2DYOA 4DX90 1FO4A 1HXYD 2KR0A 3B0AA 1UH6A 1WJ1A 4JKAA 5BYRA 4C00A 3Q8AA 4IWPA 4FHJA 1FFUA 1T0YA 3F5RA 2GCLA 2R2OA 2V3NA 1IGDA 4PQ0A 3Q3JA 3ZRCA 4ITKA 3KUZA 1FAOA 1UWMA 3TBLD 2PPHA 1ZUD2 2IYBA 2RR9A 3DHHC 1G6JA 3ABVB 3MC8A 1BMLC 4OHJA 2BGFA 1JALA 5C6RA 1EU4A 2ICIA 2LKOA 4N6EB 4REZA 1U2BA 2GUMA 2L1AA 2DHIA 1WY8A 1N63A 5T8IA 2XK5B 3JSVA 2JYEA 4IAPA 1VBHA 4XE0A 3QIJA 1Q0WB 4JL9A 4XGAB 1IPGA 3KW5B 2X0SA 1YNTE 5JVLA 2BS3B 4ANXA 3IXSA 3ZXVA 3VDZA 1W1DA 2MQJA 4YTPB 1D4BA 1T6BX 3ALBA 4ZOHC 4IOIE 3PHWB 2UVMA 3HQCA 2HJ1A 1JWBD 1R4MI 5H8YE 3VUYA 2CS4A 4HJGE 1RFKA 1ZC4B 3V6EB 3L08A 3BYYB 2ADZA 3Q3NC 3OG5A 3Q69A 3QARA 1C76A 3RD2A 4NJ7A 5L95C 4PYZA 3EPYA 3SYXA 4J6IA 3D8FA 2WP9B 1OQNA 2IO2B 5LXIB 4L1RA 1BXTA 5AUKA 1V2YA 2HTHB 1YMHE 1V97A 5KQ4A 1H10A 5D94A 3E9PA 2VKIA 3SUZA 2UZSA 1Y19B 2CHXA 3P63A 2L2IA 2KDFB 2WU5B 2KWCA 2W3SA 3ZNHB 4RF0A 3O96A 2NMBA 2COPA 5C2TB 3GP7A 4JQWC 1YX5B 2D9XA 4LK0M 4L2YA 2DKPA 3U12A 4NNJB 2K25A 1GG3A 3KUCB 3BY4B 2DBYA 4ZRQA 4EOYA 2G1EA 3TEXA 1D5ZC 1MI1A 3SNHA 2JVCA 1EVHA 2FDQA 1PQSA 2PJHA 3I63C 2DYBA 4HJKA 5D3IB 2Y8FA 1UD7A 3UQAA 4HAXB 3OANA 1N5XA 3UIOB 2D3CA 2M0XA 3M62B 1V88A 2ACZB 5IOIA 1A5RA 3AECB 3DCXA 4ZYSA 1YQBA 2G45B 1ZXIA 4KKIA 4GPTB 4FJYA 4RH6A 1MPHA 5FR3A 2E2XA 2BTEA 1C78A 3BYTB 3PSCA 2KLCA 1SE9A 1CMXB 1D6EC 3ODOA 2P0HA 3NOBA 2BKFA 1UZXB 1UPQA 2N9KA 4XYCA 1DOIA 2GRIA 2J59M 2WXJA 2MW5A 3HIZA 1V8CA 3VR8B 1WH3A 4ASWC 2K1FA 2NVUI 2CR5A 4W9EA 1P6SA 2INCC 3TEWA 4A8XC 2YRYA 1OEYJ 2KFKB 3SBTA 2ZZPB 1HZ6A 4LDTB 3I5JC 3IG3A 1GAQB 2CHWA 4QJ5B 4RGTA 5J2RA 1GJZA 2XNAC 3KSYA 5I2SA 4BKGA 3N30A 3W1SA 1K51A 3FM8C 1RFAA 2KWDA 1E8WA 1ZOYB 4ZRPA 3WAOA 3MTNB 4M01A 3DPDA 4ZRKA 1U29A 1JRPA 2K8HA 3A4RA 3PVWA 3CSTA 3DBRB 4IOYX 1OQQA 5KHQA 4MK0A 1WMHB 2N1VA 3U30A 3B1LX 2DZKA 1X05A 4WJ7A 2NBUA 4HROA 3JW0X 3R7QA 3VVWB 4IM2A 3G9WA 1PGBA 3Q14C 2MEKA 1XLQA 3DWMA 1FRRA 4UDUC 1I7HA 2DA0A 4OT1A 3D32A 4HKQA 3OJ3A 1LO5D 3TW1A 3ZYYX 1LFDA 4JKGA 2LHDA 3P42A 3TFMA 5HE2A 4DXAB 2QMTA 1CZPA 2QHOA 2KX0A 1P1AA 3VRAB 4PYUA 3SBGA 2N7EA 3R8BA 3RNAC 4GOUA 2LGYA 3ZNZB 1OMWA 3V61A 2GB1A 5IO9A 4AWJA 1XD3B 1WZ0A 3GE8C 5J18A 3BZDB 2DHJA 4A6FB 1L0YB 5LNK1 4WWMA 2CJNA 4JK8A 3ECIA 2R09A 3U4EG 1V5MA 5E6NA 4A6QA 1OFFA 1VZ7A 2OOBB 1FGZA 4HEA1 2TSSA 2D10A 1NI3A 3Q3MC 2ONQA 3QBVB 3KYCD 4WWOA 2C5LC 4LCDE 4YTMB 2O6VB 1VLBA 1T0SC 2YLMA 5G2NA 4JKCA 2D9VA 2SEBD 3VH4B 1DDVA 3TJPA 2GBRA 2ZW1A 1FCCC 1VZ6A 2GBJA 3RN9C 3KH0A 3QJZA 3M63B 4Z2NA 1WJ4A 2KC1A 4BBNC 1N62A 3N7CA 3C19A 2DZMA 1WI1A 4CO7A 1HB6A 2MWSB 1UGMA 2WXLA 3P6AA 4MJSB 4WSFA 2Y5BB 2BYVE 2GOWA 5JHAA 2D5GA 1AQCA 1P3RA 1Q5WB 3AE2B 4JE3B 2VZKB 2WXRA 1EF5A 4AJWA 1NVLA 3UZTA 2YT0A 4ANWA 3WA0A 1Z5SB 2BT6A 1XT9B 1RJ2A 2DKQA 2KK8A 1F2RC 2QSDA 1RWSA 3C8YA 4NQLB 2LMCA 4KDIC 2LBBA 1TKEA 3BVZA 2J0KA 3O13A 1WXMA 4B0EA 4O1NA 3WCQA 3BK1A 4YT0B 2AL3A 3HM3A 2N4FA 4MSQB 5EE1A 1Q67A 2UU7A 5BO4B 4WAAA 4YONA 4GMXB 1FRDA 2PW9A 2ZW0A 4K7WA 2E6XA 3W9CB 4DDID 1FXIA 3MC0B 4XDDA 2GLSA 3EECA 3DBLI 3RNEC 3URYA 3WAMA 4BOZB 4NAMA 1D3ZA 4AJYB 1RAXA 4FBJB 4HKZE 2N1WA 1KRHA 1V81A 4FA6A 2DIKA 2L3ZA 2LD9A 1UBIA 1NDDA 3PRPB 1WR1A 3HW2B 5CHWA 5C3JB 1EU3A 4LNOA 4ANUA 1TQZA 5D3XA 1YJIA 4TYZA 2KNBA 5LXHA 1XKEA 2DTCA 5J17A 1V89A 3A9KB 3A1QA 1I4RA 2D9ZA 1WE6A 1Y5OA 1ZSQA 2JWZA 1K5GB 2I5CA 1J0WA 2CODA 3TCAA 3W5UB 1FNWA 2QILA 1B9RA 2IFSA 3DXCA 3AEFB 2WGSA 4W9IA 5JHGA 3DVGX 2N0YA 4QAYA 2ZNVB 2Y3AA 1PGAA 2KX3A 3RULA 4Y94A 4GDKA 4MDKE 1B1ZA 2WDRB 3AEBB 4AP4C 2N7DA 1HBKA 1V1PB 2GS0A 3VTUA 2RQ1A 3OHMB 3JYUA 2MWNB 4B95A 4DXGA 3PHXB 2FCQA 5JHBA 1R4NI 2Q5WD 3FILA 4E3CA 5DH9B 1FNVA 4GSWA 2LULA 3IHPC 3QAQA 1JQ4A 5EE3A 2H7DA 1JRUA 4CHMA 2WS3B 3L0WB 4MM3B 1UBQA 3HVDA 3PGEA 3RI7C 4NSWA 2X38A 2PEAA 5IAAC 4HRSA 3ZKJC 1WR6E 3UQBA 2JX5A 1LXDA 2KO3A 2GJYA 4Z2MB 3PZDA 1TXDA 1MKEA 4G0NB 4MGKE 3R66C 2I1KA 3H1UA 2Z0EB 3BINA 1WGHA 3FKYA 2JZZA 1WX9A 2RDHA 4I6NB 4XWXA 3TIXA 2WDTB 3W5VB 3V05A 2NBVB 1ZKHA 4GDLB 2IZVB 3RZFA 4LLGM 1WJUA 1KLUD 4F7HA 5IP4D 3O65B 3T06A 5DHFB 3N3KB 4CQNA 1L4ZB 5BMIA 2Y7BA 5JLJB 2P0DA 2WNMA 1MG4A 2FJLA 3ETRA 1L5PA 3PG7A 2CB8A 2LGIA 2MBOA 3L10B 2J4XA 3B2FA 4KSLC 4K7SA 3E56A 2GBMA 4WWPA 1EO6A 3NS1A 2J0MA 3VH3B 2RDBC 5AEKB 1I7AA 3NZUA 1ZE3D 3PREA 2LWPA 3W1YA 1AARA 4ICUA 3ZQ4A 4DHZB 3AEGB 1V80A 2KMAA 4DQOC 3N1XC 2KMMA 3SDLC 4WIPA 1IBXA 2VH2A 3LB8C 1P9DU 2K22A 3UIPB 2KFJA 2K00A 2M8SA 5IRSA 1FXAA 4CYEA 2XN9C 4N58A 4YWGG 1AN8A 2L8JA 2N9PC 1FD6A 1M4VA 3ENBA 3A98B 1P7EA 2R61A 2YS3A 1A70A 1GB4A 4K81A 2BYFA 3A9JA 1MHXA 3QA8A 1GOZA 2LOZA 1T0RC 4AUQC 1YD8U 2CU1A 3ZNGC 4II3B 2HTME 1X1GA 1HTQA 2EC1A 3GYPA 4ARIA 1IRSA 2L52A 3TMPB 1BUIC 4HDOA 3WALA 2M14A 2INNE 2W9NA 5KCVA 1E8YA 2Z59A 3AV8A 2KJHB 1SSNA 2PMVA 4HAYB 4MSMB 5KHOA 2Z14A 1EWYC 4W9DA 1E90A 1BAKA 2JPHA 5EE0A 2G4SA 2NR2A 2RPQA 2YEPF 1V5OA 5D2MB 3RCPA 4YSXB 1E8ZA 1WXVA 4M0WB 1MK7B 3AE1B 4TMAB 5LOPB 2M1MA 4C4VB 3Q8EA 4OZAA 2BW2A 2V4IB 5G55A 3WANA 3R7RA 2EMTA 2KN5A 3NWDA 3AJ4A 5LONB 3FP5A 4XC2A 2MFQA 1WXAA 2JYTA 1LM8B 5L83A 2MCNB 2KLGA 2ZCCA 4BZAA 2L00B 2MBBB 2QDFA 2KJ6A 2RMMA 3H8HA 1F77A 4MACA 2O2VB 2D2QA 3BJIA 2KJRA 2YSZA 4RM8A 2K0PA 1KBLA 1ZW7A 2KT7A 1WX7A 1C1YB 4C0AA 2HRJA 1KI1B 2W2WA 1XXGA 4YSYB 1AYFA 2KHWB 3TUOA 4G3XB 3ZNID 3FEHA 4F7UP 2Z0QA 2WH5A 3Q6BA 1WJ6A 1PFJA 4XWWA 4IC7B 1SJHD 2NTSA 2FCSA 5TR5A 2LI5A 1UNQA 5CHVC 3MHSD 2K8BA 5HHDG 2WXOA 1UPRA 2MP2B 1U5FA 2M17A 1Z2MA 1IP9A 4JKBA 1QILA 2N7JA 5D7GA 1YQ3B 3RNCC 2Z0PA 4MGIE 1T3QA 1L2NA 4PNKA 1L0VB 4KHBA 1HTOA 1WXSA 1HB8A 4DDGD 4NJ6A 4OW0A 1VD2A 3MP9A 1MJDA 4W9FA 2ZVNA 3DBLB 2KTFA 1F2RI 4EE2A 2M56B 2G9HD 1MI0A 3KQ4A 1DYNA 3KY9A 2KGXB 3V60A 1FHXA 3Q8BA 4P1BC 2W54A 1FXTB 1UNSA 2QC8A 1FEHA 4MGZE 4MT7A 3APFA 4FADA 3AU4A 1T77A 3DVNU 4HPPA 2QKMA 2JXTA 2YF0A 3NRZA 2K5PA 1YN5A 1I2HA 1E7VA 2BWFA 4EFOA 1ET6A 3DDCB 3X0WA 3PLUA 5E6OA 2DYQA 3AU5A 1V5UA 2KCJA 5IN7A 2DX5A 1ACCA 1Q1OA 2NPTA 2JU6X 1WGRA 2KVRA 1EM7A 2NCNA 4MEMA 1WI0A 3JSVB 1QZEA 5JP4A 1MIXA 4WJOA 3PZ8A 1MIZB 2B76B 3H6NA 2WWZA 5J3YA 3CIKA 2WU2B 3N32A 1P0RA 1I35A 2IGGA 2KWVB 3VHTC 1Z87A 1TY2A 4JWSC 2R82A 1WYGA 1NBFC 1V61A 2K39A 3IFWB 1ROEA 2V3SA 2MLBA 1MK9B 2G35A 3NHEB 3VRBB 2G3QB 1NTIA 1K53A 2J7QB 4G11A 4J3OD 1FOEA 4A3OA 4MH0E 1QOBA 1R4NB 1I4PA 1ET9A 2IBIB 2K2UA 1QC6A 3D8EA 4GZUA 3WIMA 3ZO5B 4LTUA 3SFDB 5GOWB 2CY5A 1J7BA 5DCNA 1TS3A 2BS2B 4KV2A 3DOWA 3GZNI 3N9YC 2Q13A 2KIEA 3UINB 1JMLA 3AN1A 1VZ8A 5KQ1A 3HRDD 4LNKA 1GC6A 2KTRA 1I42A 2LXCA 1DOYA 2FNJB 2JRIB 2KQ4X 3ZVVA 1L6VA 1C4PA 4BKSA 4ILGB 2FJUB 2FIFA 2K8CA 4DBBA 3NG0A 3ZDMC 1XLOA 2L0TA 5H92C 1SE3A 4XDCA 1SJED 1V1OA 4IM0A 1DOXA 3ML4A 2ELBA 2LZ6A 5BYQA 1XLPA 2OHFA 1QT9A 2DZJA 2SAKA 2BKRB 2COAA 4W9GA 1KZGA 2HJ8A 4W9HA 3KZ1A 2IO3B 3AI5A 5FKAC 3R2IA 5FI0A 1WFYA 2N9XA 1X1FA 2YS1A 2KXJA 4C7YA 4BOSC 3HK0A 2E3TA 5C5BA 4BAXA 5LG4B 1IYFA 2K9XA 1OQYA 3MHZA 2W2XC 1J8CA 2KQSA 1N3HA 1W1GA 3KVFB 4MT5A 2V4LA 2LUMA 2FUG1 2WYQA 1TS4A 1J7CA 1UF0A 2KWUB 4HHVA 3EC8A 3P4PB 4ZHOA 1DBHA 2PLPA 2BB5A 2WXHA 3HHMA 1YN3A 2DZIA 4KVGB 4KGSA 2X8XX 2KD0A 2AEHA 2BF8B 4DHZE 4D0NB 1N61A 2C7MB 2FE8A 3SO6A 1UWXA 2WXPA 4G50A 4FN2A 4HCPB 2FCNA 2YVCA 1R7SA 1ZPSA 3LXFA 4EKUA 4MY6A 1NVID 4IFSA 1RM6C 1XO3A 5DI9B 4IW0A 3T3NA 2RGFA 2ZEQA 4ZHPA 3A58A 3AEEB 4YSZB 1TTNA 2GBKA 5FK9C 4JWUC 3DBHI 4I6PA 1JWSD 3HIEA 3BVGA 4JIOU 4OVZA 2P8VA 1WJNA 3UF8A 3VOQA 2J53A 4HXDA 4PT5A 3RNGC 1KC7A 3TL5A 2CHZA
chains in the Genus database with same CATH topology
3KRWA 4BVUC 4M8MA 1UEFA 1WGDA 4FHKA 4KZ0A 2ROVA 1LQBA 3VTVA 4JKGB 1XQQA 1E5WA 5D3VA 2CQUA 1V49A 4MGYE 2KZRA 3QCAA 1ZGUB 4EMOA 4F7GA 4NAWA 2MKRA 4ZDVA 4IM3A 4OVUA 1WE7A 4KIKA 4TKNA 1WYWB 3H7PA 2KDEB 4EUTA 3SD5A 4E71A 4FLHA 3L17A 2R2QA 5FR6A 1LW3A 1DIKA 4W9CA 3DCGA 2D07B 3KYDD 3PTFC 1UELA 3PSEB 3V6CB 5C1ZA 1AWEA 1M7RA 3P7ZA 4TQ0A 4I6LB 2G4DB 5D3WA 4JKHA 2L1CA 2B3AA 3QWZB 3ODWA 3V5WA 5JH5C 3ZW3A 2FIDA 2IY0B 4DX8A 2LXAA 4WWNA 1ST7A 2RUKB 4BBNF 4WJQA 3ZRFA 2RSUA 2D11A 5LLIA 3SHQA 2K6DB 3EFUA 2LRUA 3U8ZA 1SIFA 3RT3B 1ZM0A 1U5DA 1FGYA 2AYOB 3PP2A 1WRDB 5DPWA 4K7UA 4TUUA 1M7EA 4HLEA 3LJUX 4F8CB 5J3TA 3QC8B 1XODA 1U5EA 2L0FA 3QWMA 2UWQA 2KDBA 5CLQB 2I5FA 1EUVB 1DDMA 2JY6A 3PLVA 3PPAA 3ZUNA 1EF1A 1GUAB 2WX1A 5DPRA 3ZIMA 4A5KA 4EZLA 4B9KA 1V9JA 3A1QB 3ZTDA 2PZ1A 1VCBA 3X23A 3APDA 4RM9A 1S3SG 3LJ3A 2HD5B 3C0RB 2LRWA 5AZHA 4YL8A 3FLVA 1OY2A 5EFXA 3OJ4B 3NZSA 4GDKB 1VBGA 1WGYA 3PV1A 2JT4B 2ZVOA 2X18A 4M8NA 5DIFB 4N9F4 1WZ3A 3L16A 2DENB 1X86A 4GIVA 4X57B 3EHVA 3IBEA 2A5UA 3L13A 1V6EA 4WVFB 3ULBA 2XK5A 1UNRA 3F0WA 4JKEA 2LJ5A 2XEWA 1MAIA 3UGBB 1WM2A 3DVGY 3VTWA 4HPMB 2MSED 5E6PA 2DHZA 4HB3B 1DROA 2NBWB 2OQBA 2ROZB 2MBQA 4CHJA 2VSZA 3ODXA 2C7NB 4BBKA 3P2BA 2PE6B 1TZ1A 3NS8A 1WX8A 1WG7A 2MP2A 3VXWA 3T8MA 3H9DA 3RUIB 2K2JA 2FCMA 2RLOA 3SU8X 1XCGA 2NS5A 2GBNA 5CHFA 2HTHA 3R3MA 3ONSA 3PRZA 2LVOA 1V5TA 1HE8A 1YJ1A 4KHOA 1KZ7A 4KAXB 4W9LA 2D4QA 4HWIB 4FJZA 3SV1A 4A6HA 4HCNB 1MG8A 4XZ4A 5C23A 2M4NA 3LDZE 2LYDA 4HVBA 2OTXA 3A4SC 1S1QB 3GOEA 4EZJA 4ILHA 3A8PA 3K9PB 1SHCA 1OGWA 1F9JA 1H8CA 2KC2A 2WX0A 1KM7A 2EJ8A 3A9JB 1TGZB 4F7ZA 3DBSA 4K1RB 1RLFA 2UYZB 3RCZA 1SGHA 2DN6A 3QQ8B 4WJNA 4ICVA 2MX2A 2Z59B 3DXDA 2D3GA 4B6HA 2MBHA 4HDQA 2KFKA 2LASA 4ZRJA 2VRWB 2DYMA 2MDXA 2GMIC 4URKA 2DLWA 5JZEB 2CY4A 2XQNM 2J0JA 1X1MA 5IJMA 2BWES 2LVPA 2CRFA 2IO1B 4WJPA 3QX1A 1BWNA 2D9YA 4JK7A 1EGXA 5HE3A 1WMHA 2N23A 2RGNB 1W1HA 3PVLA 4P7IA 1B55A 2JZ3B 1DDWA 4OVVA 2DFKA 4BFRA 2COCA 1LB1A 4GN1A 3TO1A 2P0FA 3L54A 2ABDA 3MDBC 3ZLZA 4AOFA 1NI2A 3VIAA 1RRPB 4B6WA 4A6KA 2COFA 3CXBB 4A6FA 4II2B 1WGGA 5C79A 4KHBB 4GGQA 3MJWA 3KRXA 5J3QA 2LVQA 2RVBB 4RMAA 2KANA 2AL6A 2ELAA 1J19A 3OAWA 1BTNA 4IG7B 3V62A 1FB8A 2KMCA 4IWOA 3A33B 3PRMB 4ILJA 2A4ZA 2O6VA 4GOCA 2LGXA 4NY0A 2BYEA 1JDEA 1YIWA 4W9KA 2C60A 4HATB 2ZCBA 1QQGA 2DYNA 1KOTA 4A20A 4MJSA 2C7HA 2L76A 1WM3A 2DX5B 4EZKA 2NPTB 4HPLB 3W1SC 4JKFA 1FHWA 4HK2A 2K6QA 1TBEA 1P5TA 3AXCA 1Y8RC 2BCJA 2DHKA 3A8QA 3WYFB 2MBEA 4DBGA 3APCA 2MRPA 2V1YA 1NU2A 3M3JA 2KDIA 2LOXA 2Y8GA 4NQKE 1V5PA 2V76A 5IA7A 4IUMB 3Q3FA 2I1JA 4GB9A 3D8DA 1XR0B 1GNUA 4HAZB 4JK9A 1UNPA 5D3YA 1E7UA 2EMSA 4GU2A 2IO0B 5D27A 3TVVA 4XX5A 1BTKA 2ASQA 5DPSA 3DXEA 2C9WB 2REXA 3DQVA 1XD4A 4HAWB 2KTRB 3A9KA 2NZ8B 4L6EA 4WQOB 1ZVRA 2YS5A 4LJOB 3DVNV 2DX1A 1OEYA 2VRRB 4BKTA 5CX3A 2Z0OA 1ACAA 3QHTA 4PS7A 2IYDB 1U5GA 5GMVA 2FJ9A 2Z0DB 3B08A 3IVFA 5HE1A 1BT0A 2LG1A 4EEWA 3PS6A 1WJMA 1KLVA 2HE7A 3PVUA 5FI1A 2ZNVC 4MELA 2RSGA 4HAUB 1X11A 4JLCA 2DAJA 5C5BB 3PEGA 2FUHB 2JF5A 4W9JA 1TJ6A 2DAFA 4TQ1A 4DHJB 1PMSA 4H8SA 1H4RA 1RRBA 2KUPA 4MM3A 3KUDB 4LDTD 4PS3A 2XBBC 5L81A 2GCJA 3FSSA 3VUXA 4HAVB 1KJTA 2R0DA 3E66A 2LGDA 1WGUA 4DWFA 1WF9A 4HB0B 2RNRB 3M1IB 2JXXA 4K2OA 2UZRA 1YX6B 2PE9A 3VFKA 2ZPNA 1WVHA 1EAZA 4ZYNA 3MPXA 3ZTCA 2L7RA 5HE0A 1J0GA 3RZWC 4ZRIA 4K17A 4GDLA 5JHHA 1E8XA 3VQIA 1K8RB 2D9WA 2JP2A 1U4AA 2JRHA 1WIAA 3T9LA 2JUOA 4A3PA 5EDSA 1GGOA 5CLLB 2L05A 2ZJDA 3ML9A 1L7YA 3K9OB 1WGQA 5DPTA 3VUWA 3E9LA 2MA9B 5AZGA 1C3TA 3E9OA 4K2PA 5CTRC 4JGHB 4NAWB 4EJNA 4GXBA 4GMVA 3U7DA 5D6JB 4KIKB 4ANVA 4F1SA 1U27A 2KKCA 2O6VD 1K5DB 1P3QU 3RYTA 4KZCA 4BKSD 2IY1B 3NSUA 4TV3A 3HM6X 3WAPA 3GYOA 3CMMB 3H7PB 4PS8A 5DHAB 4FULA 4HB2B 5HKHA 5AZFA 2OJRA 3ZVRA 3PT2B 3DBRI 2W2XD 1V86A 2M38A 1XX0A 1ISNA 3S2AA 4CHKA 4E74A 4FJVB 4KSKC 2FAZA 1M94A 3CSFA 2N9EB 4DHJD 3AULA 2AWTA 3QK0A 2KQ7A 2CKHB 3OLMD 4KHAA 1P98A 4DK5A 1GC7A 4JKDA 4IWQA 3I3TB 2O2VA 3JVZX 3H7SA 3M95A 2ZPYA 1ZC3B 3NY5A 3ZDTA 1OTRB 2YT1A 3CF6E 1NTYA 1PLSA 3ULCA 2QKLA 1NTVA 1FHOA 4LJPB 2EKEC 2LUEA 2RD0A 4HB4B 4NPNA 5C16A 3ML8A 2KOXA 2CAYA 3ENEA 2H7EA 2BPSA 4KDLB 3VAWA 2DYOA 4DX90 3B0AA 1UH6A 1WJ1A 4JKAA 4IWPA 4FHJA 1T0YA 3F5RA 2GCLA 2R2OA 4PQ0A 3Q3JA 3ZRCA 3KUZA 1FAOA 3TBLD 2PPHA 2IYBA 2RR9A 1G6JA 2BGFA 5C6RA 2LKOA 1U2BA 2DHIA 1WY8A 2XK5B 3JSVA 4IAPA 1VBHA 3QIJA 1Q0WB 4JL9A 1IPGA 3KW5B 2X0SA 5JVLA 4ANXA 3VDZA 1W1DA 2MQJA 3ALBA 3PHWB 2UVMA 3HQCA 1R4MI 3VUYA 2CS4A 1ZC4B 3V6EB 3L08A 2ADZA 3QARA 3RD2A 4NJ7A 5L95C 4PYZA 3EPYA 3SYXA 4J6IA 3D8FA 1OQNA 2IO2B 5LXIB 1V2YA 2HTHB 5KQ4A 1H10A 5D94A 3E9PA 2VKIA 3SUZA 2UZSA 1Y19B 2CHXA 2L2IA 2KDFB 2KWCA 3ZNHB 3O96A 2NMBA 2COPA 4JQWC 1YX5B 2D9XA 2DKPA 4NNJB 2K25A 1GG3A 3KUCB 3BY4B 4EOYA 3SNHA 2JVCA 1EVHA 2FDQA 1PQSA 2PJHA 2DYBA 4HJKA 2Y8FA 1UD7A 3UQAA 4HAXB 3OANA 3UIOB 2M0XA 3M62B 1V88A 1A5RA 1YQBA 2G45B 4GPTB 4FJYA 1MPHA 2E2XA 3PSCA 2KLCA 1SE9A 1CMXB 3ODOA 2P0HA 3NOBA 2BKFA 1UZXB 1UPQA 2J59M 2MW5A 3HIZA 1WH3A 4ASWC 2K1FA 2NVUI 2CR5A 4W9EA 1P6SA 2YRYA 1OEYJ 2KFKB 3SBTA 2ZZPB 4LDTB 3IG3A 2CHWA 5J2RA 1GJZA 3KSYA 4BKGA 3N30A 3W1SA 3FM8C 1RFAA 1E8WA 3WAOA 3MTNB 3DPDA 4ZRKA 1U29A 2K8HA 3A4RA 3PVWA 3CSTA 4IOYX 5KHQA 4MK0A 1WMHB 2N1VA 3U30A 3B1LX 2DZKA 1X05A 4WJ7A 2NBUA 3JW0X 3R7QA 3VVWB 4IM2A 3G9WA 2DA0A 3D32A 3OJ3A 3TW1A 1LFDA 4JKGA 3TFMA 5HE2A 4DXAB 2QHOA 2KX0A 1P1AA 4PYUA 3SBGA 2N7EA 2LGYA 3ZNZB 1OMWA 3V61A 4AWJA 1XD3B 1WZ0A 5J18A 2DHJA 4A6FB 4JK8A 3ECIA 2R09A 1V5MA 5E6NA 2OOBB 1FGZA 2D10A 3QBVB 3KYCD 4WWOA 2C5LC 4LCDE 2O6VB 2YLMA 5G2NA 4JKCA 2D9VA 3VH4B 1DDVA 3TJPA 2GBRA 2GBJA 3KH0A 3QJZA 3M63B 4Z2NA 1WJ4A 2KC1A 4BBNC 3N7CA 2DZMA 1WI1A 4CO7A 1HB6A 2MWSB 1UGMA 3P6AA 4MJSB 4WSFA 2Y5BB 2BYVE 2GOWA 5JHAA 1AQCA 1P3RA 1Q5WB 1EF5A 4AJWA 1NVLA 3UZTA 2YT0A 4ANWA 3WA0A 1Z5SB 1XT9B 1RJ2A 2DKQA 2KK8A 4NQLB 4KDIC 2LBBA 2J0KA 1WXMA 2AL3A 3HM3A 2N4FA 4MSQB 1Q67A 5BO4B 4WAAA 4YONA 4GMXB 4K7WA 4DDID 3EECA 3DBLI 3WAMA 4BOZB 1D3ZA 4AJYB 1RAXA 4FBJB 2N1WA 1V81A 4FA6A 2DIKA 2L3ZA 2LD9A 1UBIA 1NDDA 3PRPB 1WR1A 3HW2B 5CHWA 4ANUA 1TQZA 5D3XA 4TYZA 2KNBA 5LXHA 1XKEA 2DTCA 5J17A 1V89A 3A9KB 3A1QA 2D9ZA 1WE6A 1Y5OA 1ZSQA 2JWZA 1K5GB 2I5CA 1J0WA 2CODA 3TCAA 2IFSA 3DXCA 4W9IA 5JHGA 3DVGX 2N0YA 2ZNVB 3RULA 2KX3A 4Y94A 4GDKA 4MDKE 4AP4C 2N7DA 1HBKA 2GS0A 3VTUA 2RQ1A 3JYUA 2MWNB 4B95A 3PHXB 2FCQA 5JHBA 1R4NI 4E3CA 5DH9B 4GSWA 2LULA 3IHPC 3QAQA 2H7DA 1JRUA 4CHMA 3L0WB 1UBQA 3PGEA 4NSWA 5IAAC 2PEAA 3ZKJC 1WR6E 3UQBA 1LXDA 2KO3A 2GJYA 4Z2MB 3PZDA 1TXDA 1MKEA 4G0NB 4MGKE 3R66C 2I1KA 3H1UA 2Z0EB 3BINA 1WGHA 2JZZA 1WX9A 4I6NB 4XWXA 3TIXA 2WDTB 2NBVB 1ZKHA 4GDLB 2IZVB 3RZFA 1WJUA 4F7HA 3O65B 3T06A 5DHFB 3N3KB 2Y7BA 5JLJB 2P0DA 2FJLA 3PG7A 2CB8A 2MBOA 3L10B 4KSLC 4K7SA 2GBMA 4WWPA 1EO6A 2J0MA 3VH3B 5AEKB 1I7AA 3NZUA 3PREA 2LWPA 3W1YA 1AARA 4ICUA 4DHZB 1V80A 2KMAA 3SDLC 1P9DU 3UIPB 2KFJA 2K00A 2M8SA 4CYEA 2L8JA 2N9PC 3ENBA 3A98B 2YS3A 4K81A 2BYFA 3A9JA 3QA8A 2LOZA 4AUQC 1YD8U 2CU1A 3ZNGC 4II3B 1X1GA 2EC1A 3GYPA 1IRSA 3TMPB 4HDOA 3WALA 2M14A 2W9NA 5KCVA 1E8YA 2KJHB 4HAYB 4MSMB 5KHOA 4W9DA 1E90A 1BAKA 2JPHA 2G4SA 2NR2A 2RPQA 1V5OA 5D2MB 3RCPA 1E8ZA 1WXVA 4M0WB 1MK7B 5LOPB 2M1MA 5G55A 3WANA 3R7RA 2EMTA 2KN5A 5LONB 3AJ4A 3FP5A 4XC2A 2MFQA 1WXAA 1LM8B 5L83A 2MCNB 2KLGA 2ZCCA 2L00B 2MBBB 2KJ6A 2O2VB 2D2QA 3BJIA 2KJRA 2YSZA 4RM8A 1KBLA 1ZW7A 1WX7A 1C1YB 4C0AA 2HRJA 1KI1B 2W2WA 2KHWB 4G3XB 3ZNID 3FEHA 4F7UP 2Z0QA 2WH5A 1WJ6A 1PFJA 4IC7B 2FCSA 5TR5A 2LI5A 1UNQA 5CHVC 3MHSD 2K8BA 1UPRA 2MP2B 1U5FA 2M17A 1Z2MA 1IP9A 4JKBA 5D7GA 2Z0PA 4MGIE 1L2NA 4PNKA 1WXSA 4DDGD 1HB8A 4NJ6A 1VD2A 4W9FA 2ZVNA 2KTFA 1DYNA 3KY9A 2KGXB 3V60A 1FHXA 1FXTB 4FADA 4MGZE 4MT7A 3APFA 3AU4A 3DVNU 2QKMA 2YF0A 1I2HA 1E7VA 2BWFA 4EFOA 3DDCB 3X0WA 3PLUA 5E6OA 2DYQA 3AU5A 1V5UA 2KCJA 2DX5A 1Q1OA 2NPTA 1WGRA 2KVRA 2NCNA 4MEMA 1WI0A 3JSVB 1QZEA 5JP4A 1MIXA 4WJOA 1MIZB 3H6NA 2WWZA 5J3YA 3CIKA 3N32A 1P0RA 1I35A 2KWVB 3VHTC 1Z87A 2R82A 1NBFC 1V61A 2K39A 3IFWB 2V3SA 2MLBA 1MK9B 2G35A 3NHEB 2G3QB 1NTIA 2J7QB 4G11A 1FOEA 4A3OA 4MH0E 2IBIB 2K2UA 1QC6A 3D8EA 4GZUA 3WIMA 3ZO5B 5GOWB 2CY5A 5DCNA 4KV2A 3DOWA 3GZNI 2Q13A 3UINB 5KQ1A 1GC6A 2KTRA 1I42A 2LXCA 2FNJB 2JRIB 3ZVVA 4BKSA 4ILGB 2FIFA 2K8CA 4DBBA 3ZDMC 2L0TA 4IM0A 3ML4A 2ELBA 2LZ6A 2DZJA 2BKRB 2COAA 4W9GA 1KZGA 2HJ8A 4W9HA 3KZ1A 2IO3B 3AI5A 5FI0A 1WFYA 2N9XA 1X1FA 2YS1A 2KXJA 4BOSC 3HK0A 5C5BA 1IYFA 1OQYA 2W2XC 1J8CA 2KQSA 1N3HA 1W1GA 3KVFB 2V4LA 2WYQA 2KWUB 4HHVA 3EC8A 1DBHA 3HHMA 2DZIA 4KVGB 2KD0A 2AEHA 2BF8B 4DHZE 4D0NB 2C7MB 3SO6A 4G50A 4FN2A 4HCPB 2FCNA 2YVCA 4EKUA 4MY6A 4IFSA 5DI9B 4IW0A 2RGFA 2ZEQA 1TTNA 2GBKA 3DBHI 4I6PA 4JIOU 2P8VA 1WJNA 3UF8A 3VOQA 4HXDA 1KC7A 3TL5A 2CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRW A;  4BVU C;  4M8M A;  1UEF A;  1WGD A;  4FHK A;  4KZ0 A;  2ROV A;  1LQB A;  3VTV A;  1XQQ A;  1E5W A;  5D3V A;  2CQU A;  1V49 A;  4MGY E;  2KZR A;  3QCA A;  1ZGU B;  4EMO A;  4F7G A;  4NAW A;  2MKR A;  4ZDV A;  4IM3 A;  4OVU A;  1WE7 A;  4KIK A;  4TKN A;  1WYW B;  3H7P A;  2KDE B;  4EUT A;  3SD5 A;  4E71 A;  4FLH A;  3L17 A;  2R2Q A;  5FR6 A;  1LW3 A;  4W9C A;  3DCG A;  2D07 B;  3KYD D;  3PTF C;  1UEL A;  3PSE B;  3V6C B;  5C1Z A;  1AWE A;  1M7R A;  3P7Z A;  4TQ0 A;  4I6L B;  2G4D B;  5D3W A;  2L1C A;  2B3A A;  3QWZ B;  3ODW A;  3V5W A;  5JH5 C;  3ZW3 A;  2FID A;  2IY0 B;  4DX8 A;  2LXA A;  4WWN A;  1ST7 A;  2RUK B;  4BBN F;  4WJQ A;  3ZRF A;  2RSU A;  2D11 A;  5LLI A;  3SHQ A;  2K6D B;  3EFU A;  2LRU A;  3U8Z A;  1SIF A;  3RT3 B;  1ZM0 A;  1U5D A;  1FGY A;  2AYO B;  3PP2 A;  1WRD B;  5DPW A;  4K7U A;  4TUU A;  1M7E A;  4HLE A;  3LJU X;  4F8C B;  5J3T A;  3QC8 B;  1XOD A;  1U5E A;  2L0F A;  3QWM A;  2UWQ A;  2KDB A;  5CLQ B;  2I5F A;  1EUV B;  1DDM A;  2JY6 A;  3PLV A;  3PPA A;  3ZUN A;  1EF1 A;  1GUA B;  2WX1 A;  5DPR A;  3ZIM A;  4A5K A;  4EZL A;  4B9K A;  1V9J A;  3A1Q B;  3ZTD A;  2PZ1 A;  1VCB A;  3X23 A;  3APD A;  4RM9 A;  1S3S G;  3LJ3 A;  2HD5 B;  3C0R B;  2LRW A;  5AZH A;  4YL8 A;  3FLV A;  1OY2 A;  5EFX A;  3OJ4 B;  3NZS A;  4GDK B;  1WGY A;  3PV1 A;  2JT4 B;  2ZVO A;  2X18 A;  4M8N A;  5DIF B;  4N9F 4;  1WZ3 A;  3L16 A;  2DEN B;  1X86 A;  4GIV A;  4X57 B;  3EHV A;  3IBE A;  2A5U A;  3L13 A;  1V6E A;  4WVF B;  3ULB A;  2XK5 A;  1UNR A;  3F0W A;  2LJ5 A;  2XEW A;  1MAI A;  3UGB B;  1WM2 A;  3DVG Y;  3VTW A;  4HPM B;  2MSE D;  5E6P A;  2DHZ A;  4HB3 B;  1DRO A;  2NBW B;  2OQB A;  2ROZ B;  2MBQ A;  4CHJ A;  2VSZ A;  3ODX A;  2C7N B;  4BBK A;  3P2B A;  2PE6 B;  1TZ1 A;  3NS8 A;  1WX8 A;  1WG7 A;  2MP2 A;  3VXW A;  3T8M A;  3H9D A;  3RUI B;  2K2J A;  2FCM A;  2RLO A;  3SU8 X;  1XCG A;  2NS5 A;  2GBN A;  5CHF A;  2HTH A;  3R3M A;  3ONS A;  3PRZ A;  2LVO A;  1V5T A;  1HE8 A;  1YJ1 A;  4KHO A;  1KZ7 A;  4KAX B;  4W9L A;  2D4Q A;  4HWI B;  4FJZ A;  3SV1 A;  4A6H A;  4HCN B;  1MG8 A;  4XZ4 A;  5C23 A;  2M4N A;  3LDZ E;  2LYD A;  4HVB A;  2OTX A;  3A4S C;  1S1Q B;  3GOE A;  4EZJ A;  3A8P A;  3K9P B;  1SHC A;  1OGW A;  1F9J A;  1H8C A;  2KC2 A;  2WX0 A;  1KM7 A;  2EJ8 A;  3A9J B;  1TGZ B;  4F7Z A;  3DBS A;  4K1R B;  1RLF A;  2UYZ B;  3RCZ A;  1SGH A;  2DN6 A;  3QQ8 B;  4WJN A;  4ICV A;  2MX2 A;  2Z59 B;  3DXD A;  2D3G A;  4B6H A;  2MBH A;  4HDQ A;  2KFK A;  2LAS A;  4ZRJ A;  2VRW B;  2DYM A;  2MDX A;  2GMI C;  4URK A;  2DLW A;  5JZE B;  2CY4 A;  2XQN M;  2J0J A;  1X1M A;  5IJM A;  2BWE S;  2LVP A;  2CRF A;  2IO1 B;  4WJP A;  3QX1 A;  1BWN A;  2D9Y A;  1EGX A;  5HE3 A;  1WMH A;  2N23 A;  2RGN B;  1W1H A;  3PVL A;  4P7I A;  1B55 A;  2JZ3 B;  1DDW A;  4OVV A;  2DFK A;  4BFR A;  2COC A;  1LB1 A;  4GN1 A;  3TO1 A;  2P0F A;  3L54 A;  2ABD A;  3MDB C;  3ZLZ A;  4AOF A;  1NI2 A;  3VIA A;  1RRP B;  4B6W A;  4A6K A;  2COF A;  3CXB B;  4A6F A;  4II2 B;  1WGG A;  5C79 A;  4KHB B;  4GGQ A;  3MJW A;  3KRX A;  5J3Q A;  2LVQ A;  2RVB B;  4RMA A;  2KAN A;  2AL6 A;  2ELA A;  1J19 A;  3OAW A;  1BTN A;  4IG7 B;  3V62 A;  1FB8 A;  2KMC A;  4IWO A;  3A33 B;  3PRM B;  2A4Z A;  2O6V A;  4GOC A;  2LGX A;  4NY0 A;  2BYE A;  1YIW A;  4W9K A;  2C60 A;  4HAT B;  2ZCB A;  1QQG A;  2DYN A;  1KOT A;  4A20 A;  4MJS A;  2C7H A;  2L76 A;  1WM3 A;  2DX5 B;  4EZK A;  2NPT B;  4HPL B;  3W1S C;  4HK2 A;  1FHW A;  2K6Q A;  1TBE A;  1P5T A;  3AXC A;  1Y8R C;  2BCJ A;  2DHK A;  3A8Q A;  3WYF B;  2MBE A;  4DBG A;  3APC A;  2MRP A;  2V1Y A;  1NU2 A;  3M3J A;  2KDI A;  2LOX A;  2Y8G A;  4NQK E;  1V5P A;  2V76 A;  5IA7 A;  4IUM B;  3Q3F A;  2I1J A;  4GB9 A;  3D8D A;  1XR0 B;  1GNU A;  4HAZ B;  1UNP A;  5D3Y A;  1E7U A;  2EMS A;  4GU2 A;  2IO0 B;  5D27 A;  3TVV A;  4XX5 A;  1BTK A;  2ASQ A;  5DPS A;  3DXE A;  2C9W B;  2REX A;  3DQV A;  1XD4 A;  4HAW B;  2KTR B;  3A9K A;  2NZ8 B;  4L6E A;  4WQO B;  1ZVR A;  2YS5 A;  4LJO B;  3DVN V;  2DX1 A;  1OEY A;  2VRR B;  4BKT A;  5CX3 A;  2Z0O A;  1ACA A;  3QHT A;  4PS7 A;  2IYD B;  1U5G A;  5GMV A;  2FJ9 A;  2Z0D B;  3B08 A;  3IVF A;  5HE1 A;  1BT0 A;  2LG1 A;  4EEW A;  3PS6 A;  1WJM A;  1KLV A;  2HE7 A;  3PVU A;  5FI1 A;  2ZNV C;  4MEL A;  2RSG A;  4HAU B;  1X11 A;  4JLC A;  2DAJ A;  5C5B B;  3PEG A;  2FUH B;  2JF5 A;  4W9J A;  1TJ6 A;  2DAF A;  4TQ1 A;  4DHJ B;  1PMS A;  4H8S A;  1H4R A;  1RRB A;  2KUP A;  4MM3 A;  3KUD B;  4LDT D;  4PS3 A;  2XBB C;  5L81 A;  2GCJ A;  3FSS A;  3VUX A;  4HAV B;  1KJT A;  2R0D A;  2LGD A;  1WGU A;  4DWF A;  1WF9 A;  4HB0 B;  2RNR B;  3M1I B;  2JXX A;  4K2O A;  2UZR A;  1YX6 B;  2PE9 A;  3VFK A;  2ZPN A;  1WVH A;  1EAZ A;  4ZYN A;  3MPX A;  3ZTC A;  2L7R A;  5HE0 A;  1J0G A;  3RZW C;  4ZRI A;  4K17 A;  4GDL A;  5JHH A;  1E8X A;  3VQI A;  1K8R B;  2D9W A;  2JP2 A;  1U4A A;  2JRH A;  1WIA A;  3T9L A;  2JUO A;  4A3P A;  5EDS A;  5CLL B;  2L05 A;  2ZJD A;  3ML9 A;  1L7Y A;  3K9O B;  1WGQ A;  5DPT A;  3VUW A;  2MA9 B;  5AZG A;  1C3T A;  4K2P A;  5CTR C;  4JGH B;  4NAW B;  4EJN A;  4GXB A;  4GMV A;  3U7D A;  5D6J B;  4KIK B;  4ANV A;  4F1S A;  1U27 A;  2KKC A;  2O6V D;  1K5D B;  1P3Q U;  3RYT A;  4KZC A;  4BKS D;  2IY1 B;  3NSU A;  4TV3 A;  3HM6 X;  3WAP A;  3GYO A;  3CMM B;  3H7P B;  4PS8 A;  5DHA B;  4FUL A;  4HB2 B;  5HKH A;  5AZF A;  2OJR A;  3ZVR A;  3PT2 B;  3DBR I;  2W2X D;  1V86 A;  2M38 A;  1XX0 A;  1ISN A;  3S2A A;  4CHK A;  4E74 A;  4FJV B;  4KSK C;  2FAZ A;  1M94 A;  3CSF A;  2N9E B;  4DHJ D;  3AUL A;  2AWT A;  3QK0 A;  2KQ7 A;  2CKH B;  3OLM D;  4KHA A;  1P98 A;  4DK5 A;  1GC7 A;  4IWQ A;  3I3T B;  2O2V A;  3JVZ X;  3H7S A;  3M95 A;  2ZPY A;  1ZC3 B;  3NY5 A;  3ZDT A;  1OTR B;  2YT1 A;  3CF6 E;  1NTY A;  1PLS A;  3ULC A;  2QKL A;  1NTV A;  1FHO A;  4LJP B;  2EKE C;  2LUE A;  2RD0 A;  4HB4 B;  4NPN A;  5C16 A;  3ML8 A;  2KOX A;  2CAY A;  3ENE A;  2H7E A;  2BPS A;  4KDL B;  3VAW A;  2DYO A;  4DX9 0;  3B0A A;  1UH6 A;  1WJ1 A;  4IWP A;  4FHJ A;  1T0Y A;  3F5R A;  2GCL A;  2R2O A;  4PQ0 A;  3Q3J A;  3ZRC A;  3KUZ A;  1FAO A;  3TBL D;  2PPH A;  2IYB A;  2RR9 A;  1G6J A;  2BGF A;  5C6R A;  2LKO A;  1U2B A;  2DHI A;  1WY8 A;  2XK5 B;  3JSV A;  4IAP A;  3QIJ A;  1Q0W B;  4JL9 A;  1IPG A;  3KW5 B;  4ANX A;  3VDZ A;  1W1D A;  2MQJ A;  3ALB A;  3PHW B;  2UVM A;  3HQC A;  1R4M I;  3VUY A;  2CS4 A;  1ZC4 B;  3V6E B;  3L08 A;  2ADZ A;  3QAR A;  3RD2 A;  4NJ7 A;  5L95 C;  4PYZ A;  3EPY A;  3SYX A;  4J6I A;  3D8F A;  1OQN A;  2IO2 B;  5LXI B;  1V2Y A;  2HTH B;  5KQ4 A;  1H10 A;  5D94 A;  3SUZ A;  2VKI A;  2UZS A;  1Y19 B;  2CHX A;  2L2I A;  2KDF B;  2KWC A;  3ZNH B;  3O96 A;  2NMB A;  2COP A;  4JQW C;  1YX5 B;  2D9X A;  2DKP A;  4NNJ B;  2K25 A;  1GG3 A;  3KUC B;  3BY4 B;  4EOY A;  3SNH A;  2JVC A;  1EVH A;  2FDQ A;  1PQS A;  2PJH A;  2DYB A;  4HJK A;  2Y8F A;  1UD7 A;  3UQA A;  4HAX B;  3OAN A;  3UIO B;  2M0X A;  3M62 B;  1V88 A;  1A5R A;  1YQB A;  2G45 B;  4GPT B;  4FJY A;  1MPH A;  2E2X A;  3PSC A;  2KLC A;  1SE9 A;  1CMX B;  3ODO A;  2P0H A;  3NOB A;  2BKF A;  1UZX B;  1UPQ A;  2J59 M;  2MW5 A;  3HIZ A;  1WH3 A;  4ASW C;  2K1F A;  2NVU I;  2CR5 A;  4W9E A;  1P6S A;  2YRY A;  1OEY J;  2KFK B;  2ZZP B;  4LDT B;  3IG3 A;  2CHW A;  5J2R A;  1GJZ A;  3KSY A;  4BKG A;  3N30 A;  3W1S A;  3FM8 C;  1RFA A;  1E8W A;  3WAO A;  3MTN B;  3DPD A;  4ZRK A;  1U29 A;  2K8H A;  3A4R A;  3PVW A;  3CST A;  4IOY X;  5KHQ A;  4MK0 A;  1WMH B;  2N1V A;  3U30 A;  3B1L X;  2DZK A;  1X05 A;  4WJ7 A;  2NBU A;  3JW0 X;  3R7Q A;  3VVW B;  4IM2 A;  3G9W A;  2DA0 A;  3D32 A;  3OJ3 A;  3TW1 A;  1LFD A;  3TFM A;  5HE2 A;  4DXA B;  2QHO A;  2KX0 A;  1P1A A;  4PYU A;  2N7E A;  2LGY A;  3ZNZ B;  1OMW A;  3V61 A;  4AWJ A;  1XD3 B;  1WZ0 A;  5J18 A;  2DHJ A;  4A6F B;  3ECI A;  2R09 A;  1V5M A;  5E6N A;  2OOB B;  1FGZ A;  2D10 A;  3QBV B;  3KYC D;  4WWO A;  2C5L C;  4LCD E;  2O6V B;  2YLM A;  5G2N A;  2D9V A;  3VH4 B;  1DDV A;  3TJP A;  2GBR A;  2GBJ A;  3KH0 A;  3QJZ A;  3M63 B;  4Z2N A;  1WJ4 A;  2KC1 A;  4BBN C;  3N7C A;  2DZM A;  1WI1 A;  4CO7 A;  1HB6 A;  2MWS B;  1UGM A;  3P6A A;  4MJS B;  4WSF A;  2Y5B B;  2BYV E;  2GOW A;  5JHA A;  1AQC A;  1P3R A;  1Q5W B;  1EF5 A;  4AJW A;  1NVL A;  3UZT A;  2YT0 A;  4ANW A;  3WA0 A;  1Z5S B;  1XT9 B;  1RJ2 A;  2DKQ A;  2KK8 A;  4NQL B;  4KDI C;  2LBB A;  2J0K A;  1WXM A;  2AL3 A;  3HM3 A;  2N4F A;  4MSQ B;  1Q67 A;  5BO4 B;  4WAA A;  4YON A;  4GMX B;  4K7W A;  4DDI D;  3EEC A;  3DBL I;  3WAM A;  4BOZ B;  1D3Z A;  4AJY B;  1RAX A;  4FBJ B;  2N1W A;  1V81 A;  4FA6 A;  2L3Z A;  2LD9 A;  1UBI A;  1NDD A;  3PRP B;  1WR1 A;  3HW2 B;  5CHW A;  4ANU A;  1TQZ A;  5D3X A;  4TYZ A;  2KNB A;  5LXH A;  1XKE A;  2DTC A;  5J17 A;  1V89 A;  3A9K B;  3A1Q A;  2D9Z A;  1WE6 A;  1Y5O A;  1ZSQ A;  2JWZ A;  1K5G B;  2I5C A;  1J0W A;  2COD A;  3TCA A;  2IFS A;  3DXC A;  4W9I A;  5JHG A;  3DVG X;  2N0Y A;  2ZNV B;  3RUL A;  2KX3 A;  4Y94 A;  4GDK A;  4MDK E;  4AP4 C;  2N7D A;  1HBK A;  2GS0 A;  3VTU A;  2RQ1 A;  3JYU A;  2MWN B;  4B95 A;  3PHX B;  2FCQ A;  5JHB A;  1R4N I;  4E3C A;  5DH9 B;  4GSW A;  2LUL A;  3IHP C;  3QAQ A;  2H7D A;  1JRU A;  4CHM A;  3L0W B;  1UBQ A;  3PGE A;  4NSW A;  5IAA C;  2PEA A;  3ZKJ C;  1WR6 E;  3UQB A;  1LXD A;  2KO3 A;  2GJY A;  4Z2M B;  3PZD A;  1TXD A;  1MKE A;  4G0N B;  4MGK E;  3R66 C;  2I1K A;  3H1U A;  2Z0E B;  3BIN A;  1WGH A;  2JZZ A;  1WX9 A;  4I6N B;  4XWX A;  3TIX A;  2WDT B;  2NBV B;  1ZKH A;  4GDL B;  2IZV B;  3RZF A;  1WJU A;  4F7H A;  3O65 B;  3T06 A;  5DHF B;  3N3K B;  2Y7B A;  5JLJ B;  2P0D A;  2FJL A;  3PG7 A;  2CB8 A;  2MBO A;  3L10 B;  4KSL C;  4K7S A;  2GBM A;  4WWP A;  1EO6 A;  2J0M A;  3VH3 B;  5AEK B;  1I7A A;  3NZU A;  3PRE A;  2LWP A;  3W1Y A;  1AAR A;  4ICU A;  4DHZ B;  1V80 A;  2KMA A;  3SDL C;  1P9D U;  3UIP B;  2KFJ A;  2K00 A;  2M8S A;  4CYE A;  2L8J A;  2N9P C;  3A98 B;  2YS3 A;  4K81 A;  2BYF A;  3A9J A;  3QA8 A;  2LOZ A;  4AUQ C;  1YD8 U;  2CU1 A;  3ZNG C;  4II3 B;  1X1G A;  2EC1 A;  3GYP A;  1IRS A;  3TMP B;  4HDO A;  3WAL A;  2M14 A;  2W9N A;  5KCV A;  1E8Y A;  2KJH B;  4HAY B;  4MSM B;  5KHO A;  4W9D A;  1E90 A;  1BAK A;  2JPH A;  2G4S A;  2NR2 A;  2RPQ A;  1V5O A;  5D2M B;  3RCP A;  1E8Z A;  1WXV A;  4M0W B;  1MK7 B;  5LOP B;  2M1M A;  5G55 A;  3WAN A;  3R7R A;  2EMT A;  2KN5 A;  5LON B;  3AJ4 A;  3FP5 A;  4XC2 A;  2MFQ A;  1WXA A;  1LM8 B;  5L83 A;  2MCN B;  2KLG A;  2ZCC A;  2L00 B;  2MBB B;  2KJ6 A;  2O2V B;  2D2Q A;  3BJI A;  2KJR A;  2YSZ A;  4RM8 A;  1ZW7 A;  1WX7 A;  1C1Y B;  4C0A A;  2HRJ A;  1KI1 B;  2W2W A;  2KHW B;  4G3X B;  3ZNI D;  3FEH A;  4F7U P;  2Z0Q A;  2WH5 A;  1WJ6 A;  1PFJ A;  4IC7 B;  2FCS A;  5TR5 A;  2LI5 A;  1UNQ A;  5CHV C;  3MHS D;  2K8B A;  1UPR A;  2MP2 B;  1U5F A;  2M17 A;  1Z2M A;  1IP9 A;  5D7G A;  2Z0P A;  4MGI E;  1L2N A;  4PNK A;  1WXS A;  4DDG D;  1HB8 A;  4NJ6 A;  1VD2 A;  4W9F A;  2ZVN A;  2KTF A;  1DYN A;  3KY9 A;  2KGX B;  3V60 A;  1FHX A;  1FXT B;  4FAD A;  4MGZ E;  4MT7 A;  3APF A;  3AU4 A;  3DVN U;  2QKM A;  2YF0 A;  1I2H A;  1E7V A;  2BWF A;  4EFO A;  3DDC B;  3X0W A;  3PLU A;  5E6O A;  2DYQ A;  3AU5 A;  1V5U A;  2KCJ A;  2DX5 A;  1Q1O A;  2NPT A;  1WGR A;  2KVR A;  2NCN A;  4MEM A;  1WI0 A;  3JSV B;  1QZE A;  5JP4 A;  1MIX A;  4WJO A;  1MIZ B;  3H6N A;  2WWZ A;  5J3Y A;  3CIK A;  3N32 A;  1P0R A;  1I35 A;  2KWV B;  3VHT C;  1Z87 A;  1NBF C;  1V61 A;  2K39 A;  3IFW B;  2V3S A;  2MLB A;  1MK9 B;  2G35 A;  3NHE B;  2G3Q B;  1NTI A;  2J7Q B;  4G11 A;  1FOE A;  4A3O A;  4MH0 E;  2IBI B;  2K2U A;  1QC6 A;  3D8E A;  4GZU A;  3WIM A;  3ZO5 B;  5GOW B;  2CY5 A;  5DCN A;  4KV2 A;  3DOW A;  3GZN I;  2Q13 A;  3UIN B;  5KQ1 A;  1GC6 A;  2KTR A;  1I42 A;  2LXC A;  2FNJ B;  2JRI B;  3ZVV A;  4BKS A;  2FIF A;  2K8C A;  4DBB A;  3ZDM C;  2L0T A;  4IM0 A;  3ML4 A;  2ELB A;  2LZ6 A;  2DZJ A;  2BKR B;  2COA A;  4W9G A;  1KZG A;  2HJ8 A;  4W9H A;  3KZ1 A;  2IO3 B;  3AI5 A;  5FI0 A;  1WFY A;  2N9X A;  1X1F A;  2YS1 A;  2KXJ A;  4BOS C;  3HK0 A;  5C5B A;  1IYF A;  1OQY A;  2W2X C;  1J8C A;  2KQS A;  1N3H A;  1W1G A;  3KVF B;  2V4L A;  2WYQ A;  2KWU B;  4HHV A;  3EC8 A;  1DBH A;  3HHM A;  2DZI A;  4KVG B;  2KD0 A;  2AEH A;  2BF8 B;  4DHZ E;  4D0N B;  2C7M B;  3SO6 A;  4G50 A;  4FN2 A;  4HCP B;  2FCN A;  2YVC A;  4EKU A;  4MY6 A;  4IFS A;  5DI9 B;  4IW0 A;  2RGF A;  2ZEQ A;  1TTN A;  2GBK A;  3DBH I;  4I6P A;  4JIO U;  2P8V A;  1WJN A;  3UF8 A;  3VOQ A;  4HXD A;  3TL5 A;  2CHZ A; 
#chains in the Genus database with same CATH topology
 3EFC A;  3KRW A;  4BVU C;  3FC4 A;  4KX6 B;  4USA A;  4M8M A;  1QQR A;  1UEF A;  1WGD A;  4FHK A;  4KZ0 A;  2IND C;  2ROV A;  1TY0 A;  1LQB A;  3T3O A;  4ARC A;  4QJ3 B;  3VTV A;  5BYS A;  1C79 A;  3OWE B;  4US9 A;  4JKG B;  1XQQ A;  1E5W A;  3NVV A;  1C4C A;  5D3V A;  2CQU A;  1V49 A;  4MGY E;  2KZR A;  1L0X B;  2V3P A;  3QCA A;  1ZGU B;  1JWA D;  4EMO A;  1WSP A;  4GNK B;  4F7G A;  3UI3 A;  1SE4 A;  4NAW A;  2MKR A;  4ZDV A;  4RGO S;  4IM3 A;  4OVU A;  1F52 A;  1WE7 A;  3HUI A;  3P4R B;  4KIK A;  1UGJ A;  2INP E;  4TKN A;  4FXC A;  4D6W A;  1R4M B;  4IKG A;  1WYW B;  3H7P A;  2KDE B;  4EUT A;  3SD5 A;  4E71 A;  4FLH A;  3L17 A;  1T0Q C;  2R2Q A;  5FR6 A;  2V9H A;  3FAH A;  1LW3 A;  1DIK A;  1QOG A;  3AED B;  2KDM A;  4W9C A;  3DCG A;  1E9M A;  2D07 B;  3KYD D;  3PTF C;  3V3X A;  1UEL A;  4WH4 A;  1P7F A;  3PSE B;  3V6C B;  5C1Z A;  3ZJT A;  3NVZ A;  1AWE A;  1M7R A;  2MH7 A;  3P7Z A;  4TQ0 A;  3GS2 A;  4I6L B;  2G4D B;  5D3W A;  1PUT A;  2KYW A;  4JKH A;  2EEL A;  2L1C A;  2B3A A;  3QWZ B;  2Y5P A;  3ODW A;  3V5W A;  3RNF C;  2D3A A;  3CIR B;  4K3B A;  3ZW3 A;  5JH5 C;  2FID A;  1L6U A;  2IY0 B;  1QKZ A;  4DX8 A;  2LXA A;  4WWN A;  1LGR A;  4L1B A;  1ST7 A;  2RUK B;  4BBN F;  4WJQ A;  3ZRF A;  2RSU A;  2D11 A;  2WXQ A;  5BMH A;  1ZXH A;  5LLI A;  3RPF C;  3SHQ A;  2K6D B;  2KIG A;  3EFU A;  2LRU A;  3U8Z A;  1SIF A;  3RT3 B;  1ZM0 A;  1U5D A;  1FIQ A;  3VR9 B;  1FGY A;  2AYO B;  3PP2 A;  1WRD B;  1AWD A;  5DPW A;  4K7U A;  1KH0 A;  4TUU A;  1ZDX A;  1M7E A;  3RFZ B;  4HLE A;  3LJU X;  2BYT A;  4F8C B;  5J3T A;  3QC8 B;  4LNF A;  2Z4D A;  1XOD A;  1U5E A;  2L0F A;  3QWM A;  2UWQ A;  4KGT A;  4ACF A;  5MPO A;  2KDB A;  3BII D;  5CLQ B;  2I5F A;  3B2G A;  1EUV B;  3Q3O C;  1DDM A;  2JY6 A;  3PLV A;  4IDI A;  3PPA A;  4OZC A;  1WGK A;  3ZUN A;  1EF1 A;  1GUA B;  4TSS A;  2WX1 A;  5DPR A;  3ZIM A;  1KFY B;  4A5K A;  1SB3 C;  4EZL A;  4CSQ A;  2BB6 A;  4B9K A;  1V9J A;  3A1Q B;  1I4G A;  3ZTD A;  2PZ1 A;  4OSN A;  2IGH A;  4LNN A;  1VCB A;  3Q8C A;  3X23 A;  4A55 A;  3APD A;  4RM9 A;  1S3S G;  1T5X D;  2AQ3 B;  3LJ3 A;  4DXF A;  2HD5 B;  3C0R B;  3DHG C;  4L23 A;  2LRW A;  5AZH A;  4YL8 A;  1K50 A;  2JQR B;  3AMZ A;  1PYW D;  3FLV A;  1OY2 A;  5EFX A;  3OJ4 B;  3GZN B;  3NZS A;  4GDK B;  1VBG A;  3AE4 B;  1WGY A;  3PV1 A;  2JT4 B;  2ZVO A;  2X18 A;  4M8N A;  1QF6 A;  4KKJ A;  4C4V A;  5DIF B;  4A90 A;  4N9F 4;  1WZ3 A;  3L16 A;  2DEN B;  1X86 A;  4GIV A;  4RF1 A;  4X57 B;  3EHV A;  3IBE A;  1TIF A;  2A5U A;  3L13 A;  1V6E A;  4RCO A;  4WVF B;  3ULB A;  2XK5 A;  5GXG B;  2JZP A;  1XCQ L;  1UNR A;  3FIL B;  3F0W A;  4JKE A;  2PVG C;  1Q10 A;  1N6Z A;  2LJ5 A;  2XEW A;  2YEP B;  1MAI A;  3UGB B;  1WM2 A;  3DVG Y;  3VTW A;  2HDE A;  2W82 A;  1ESF A;  3I9V 1;  2LJI A;  4HPM B;  3ZJV A;  1GPX A;  2CJO A;  2MSE D;  5E6P A;  4AS1 A;  1UUP A;  1J7A A;  4HB3 B;  2DHZ A;  2DNF A;  2Z13 A;  5M4Y B;  1DRO A;  2NBW B;  2OQB A;  2ROZ B;  2MBQ A;  4CHJ A;  2VSZ A;  3ODX A;  2C7N B;  4BBK A;  3P2B A;  2PE6 B;  4AQ7 A;  1TZ1 A;  3NS8 A;  3Q2A C;  1WX8 A;  1WG7 A;  2MP2 A;  1TJE A;  3AE7 B;  2LHE A;  3VXW A;  3T8M A;  3H9D A;  3RUI B;  2K2J A;  5AUI A;  2FCM A;  4M02 A;  2L83 A;  2KVZ A;  2RLO A;  3N1Y C;  1XEE A;  1D5X C;  1F1H A;  3SU8 X;  1XCG A;  2NS5 A;  2GBN A;  3NJT A;  5E6J A;  2M19 A;  5CHF A;  2HTH A;  3R3M A;  3ONS A;  3PRZ A;  2LVO A;  1V5T A;  1HE8 A;  1YJ1 A;  4KHO A;  1KZ7 A;  5HI1 A;  4KAX B;  4W9L A;  2V0G A;  1YQ4 B;  3P1M A;  4M00 A;  2D4Q A;  4HWI B;  3SV1 A;  4FJZ A;  4A6H A;  4HCN B;  1MG8 A;  4XZ4 A;  3IAM 1;  1DYQ A;  5C23 A;  4YTN B;  3DBH B;  2M4N A;  3LDZ E;  2LYD A;  4HSI A;  3AE9 B;  2JSV X;  1TKG A;  4HVB A;  2OTX A;  2WXN A;  3A4S C;  1FPY A;  1JW9 D;  1NYQ A;  1S1Q B;  2I38 A;  3GOE A;  4EZJ A;  1IBX B;  4ILH A;  3A8P A;  4RNA A;  3K9P B;  1QLB B;  3IT4 B;  1SHC A;  1OGW A;  1F9J A;  1MVK A;  1FM0 D;  1H8C A;  2KC2 A;  3U2S C;  3ZGZ A;  2WX0 A;  1KM7 A;  2EJ8 A;  2NTT A;  3A9J B;  1TGZ B;  4F7Z A;  3BWU D;  5D3D A;  3DBS A;  4K1R B;  1RLF A;  2K3U A;  2UYZ B;  2OED A;  3RCZ A;  1SGH A;  2QCZ A;  2DN6 A;  2EKI A;  3QQ8 B;  4WJN A;  3RNB C;  4ICV A;  2MX2 A;  2Z59 B;  3DXD A;  1TYG B;  2D3G A;  2JWU A;  4B6H A;  1DGJ A;  5IKC M;  2MBH A;  4HDQ A;  2KFK A;  2LAS A;  2BVC A;  1ENF A;  4ZRJ A;  2VRW B;  2DYM A;  2MDX A;  2GMI C;  3W2D A;  4URK A;  2DLW A;  1VJK A;  2R2Y A;  5JZE B;  2CY4 A;  2XQN M;  2J0J A;  1X1M A;  5IJM A;  2BWE S;  2LVP A;  2CRF A;  2IO1 B;  2IPK D;  1NEN B;  2KAC A;  4WJP A;  1E7P B;  3QX1 A;  1BWN A;  2WXK A;  2D9Y A;  4JK7 A;  1EGX A;  5HE3 A;  2LGS A;  1WMH A;  2N23 A;  2RGN B;  2AQ1 B;  1MPE A;  1W1H A;  3PVL A;  4P7I A;  1B55 A;  2JZ3 B;  1DDW A;  2MHJ A;  3E9S A;  4OVV A;  2DFK A;  1EWC A;  1JWM D;  2RDG A;  4BFR A;  2COC A;  1LB1 A;  4RFB A;  4GN1 A;  1VR9 A;  2KUQ A;  2LEK A;  3TO1 A;  3AM9 A;  2P0F A;  3L54 A;  2ABD A;  2WQY B;  3MDB C;  1FNU A;  2AQ2 B;  3NW8 A;  2H88 B;  3ZLZ A;  1WWT A;  4N59 A;  4AOF A;  5TSS A;  2J52 A;  3NUH B;  1SIJ A;  1NI2 A;  3VIA A;  1ZDV A;  3J9C A;  1RRP B;  2PIA A;  4B6W A;  4A6K A;  2YT2 A;  2COF A;  3CXB B;  3B77 A;  2H89 B;  4A6F A;  4II2 B;  1WGG A;  5C79 A;  3AH7 A;  1HA5 A;  4KHB B;  4GGQ A;  3AB5 A;  1FMA D;  3MJW A;  3KRX A;  4P6V F;  3PO0 A;  4WQM A;  5J3Q A;  4R3D A;  2LVQ A;  2RVB B;  1C9F A;  4RMA A;  2KAN A;  1E10 A;  2AL6 A;  2ZKM X;  3IAS 1;  2IJ0 A;  2ELA A;  1J19 A;  3OAW A;  1BTN A;  4IG7 B;  3V62 A;  1FB8 A;  2KMC A;  2LFI A;  4IWO A;  3A33 B;  3KWL A;  3PRM B;  3TEZ A;  4ILJ A;  2A4Z A;  2O6V A;  4RGM A;  4GOC A;  2LGX A;  3GE3 C;  3TSS A;  4NY0 A;  1E6E B;  1ZP0 B;  2AX5 A;  2BYE A;  1JDE A;  1YIW A;  4W9K A;  2C60 A;  4HAT B;  2ZCB A;  1QQG A;  2DYN A;  1KOT A;  4A20 A;  4MJS A;  2C7H A;  2L76 A;  1WM3 A;  4C80 A;  2DX5 B;  5HG2 A;  4EZK A;  2NPT B;  4HPL B;  1MFW A;  4Q2J A;  3W1S C;  4JKF A;  1FHW A;  4HK2 A;  2K6Q A;  2W3R A;  3MC9 A;  1WXQ A;  1TBE A;  1P5T A;  3AXC A;  1CK1 A;  2VH1 A;  1Y8R C;  2BCJ A;  2DHK A;  3BVM A;  5G5H A;  2WXF A;  2D3B A;  3A8Q A;  3WYF B;  2Z8L A;  2MBE A;  4DBG A;  1E0Z A;  5HFY A;  1JCK B;  3AE3 B;  3BK2 A;  3APC A;  2MRP A;  2V1Y A;  1NU2 A;  1GB1 A;  3M3J A;  2KDI A;  3AEA B;  2LOX A;  2Y8G A;  3NWF A;  4NQK E;  2J42 A;  1V5P A;  2V76 A;  5IA7 A;  3U52 E;  4IUM B;  3Q3F A;  2I1J A;  2PVO D;  3D8D A;  4GB9 A;  1XR0 B;  1GNU A;  2PTL A;  4HAZ B;  4JK9 A;  1TZO A;  1UNP A;  5D3Y A;  1E7U A;  3AE5 B;  3Q8F A;  2EMS A;  1YJJ A;  4GU2 A;  4LNI A;  2IO0 B;  5D27 A;  3TVV A;  4XX5 A;  3DWG C;  1BTK A;  3MJ5 A;  2ASQ A;  5DPS A;  1FCL A;  4KGR A;  3DXE A;  3B9J A;  2C9W B;  2REX A;  2BQQ A;  2PKO A;  3DQV A;  1XD4 A;  4HAW B;  2KTR B;  3A9K A;  4S17 A;  4C7Z A;  1VDV A;  2NZ8 B;  3NVW A;  4L6E A;  4WQO B;  1ZVR A;  1HEZ E;  2YS5 A;  2MJ3 A;  4LJO B;  3DVN V;  1I4H A;  2DX1 A;  1IUE A;  1D5M C;  2GI9 A;  1OEY A;  2VRR B;  4BKT A;  5CX3 A;  2Z0O A;  4B0M A;  1ACA A;  3QHT A;  4WUR A;  4PS7 A;  2IYD B;  1U5G A;  2WDQ B;  3N1Z C;  5I2M A;  5GMV A;  1NYR A;  2FJ9 A;  2Z0D B;  3B08 A;  3IVF A;  5HE1 A;  1BT0 A;  1WRI A;  2LG1 A;  1JWU D;  1SBB B;  4EEW A;  3SR6 A;  3PS6 A;  1WJM A;  1KLV A;  2HE7 A;  3PVU A;  5FI1 A;  4H2A A;  2ZNV C;  4MEL A;  1V1P A;  2RSG A;  4HAU B;  2IDY A;  2MJE A;  1X11 A;  4JLC A;  2IGD A;  2N9L A;  2DAJ A;  5C5B B;  3PEG A;  1XCT L;  2WXG A;  4GLS C;  2FUH B;  3ZJU A;  2JF5 A;  4W9J A;  1TJ6 A;  2DAF A;  4TQ1 A;  4DHJ B;  1PMS A;  4H8S A;  1RYJ A;  1H4R A;  1RRB A;  4NJC A;  3KWV A;  1SE2 A;  1YOV B;  2KUP A;  4YXD B;  4MM3 A;  3KUD B;  4LDT D;  1KLG D;  4PS3 A;  1XLN A;  1N60 A;  2W55 A;  2XBB C;  5L81 A;  2GCJ A;  5EE9 A;  1C4A A;  1SF0 A;  3FSS A;  5BMG A;  3VUX A;  4HAV B;  1HZ5 A;  2R0D A;  1KJT A;  3E66 A;  2LGD A;  1WGU A;  4DWF A;  1WF9 A;  4HB0 B;  2RNR B;  3M1I B;  2JXX A;  4K2O A;  2WLB A;  2UZR A;  1YX6 B;  3I57 A;  2PE9 A;  3VFK A;  2ZPN A;  1WVH A;  1EAZ A;  2L32 A;  4ZYN A;  3FVC A;  1CQV A;  3HSA A;  3MPX A;  3LYY A;  1IGC A;  3ZTC A;  1KTK A;  2L7R A;  5HE0 A;  2NBV A;  1J0G A;  3RZW C;  1STE A;  4ZRI A;  4NZL B;  2KN4 A;  4K17 A;  2DWQ A;  2QEJ C;  4XWT A;  4GDL A;  5JHH A;  1E8X A;  4K3C A;  1QOF A;  2M0A A;  3VQI A;  1AW7 A;  1K8R B;  4S0R A;  4US8 A;  2KAJ A;  2D9W A;  3ZXR A;  2JP2 A;  3SEB A;  1F0Z A;  4QJ4 B;  2Y5C A;  1U4A A;  2JRH A;  3EUB 2;  1SXT A;  1N5W A;  1SEB D;  2K8E A;  2OJW A;  1QOA A;  1WIA A;  3PZ7 A;  2WHI A;  3T9L A;  2K49 A;  2JUO A;  4A3P A;  3P4S B;  5EDS A;  4DIX A;  1FFV A;  1GGO A;  5CLL B;  2QIE B;  2L05 A;  2ZJD A;  3ML9 A;  1L7Y A;  1TS2 A;  3NZ3 A;  3L4P A;  2I2Y A;  4OZB A;  3K9O B;  1WGQ A;  5DPT A;  3VUW A;  3SFE B;  3E9L A;  2MA9 B;  4JPS A;  5AZG A;  3HVZ A;  1C3T A;  3E9O A;  4K2P A;  5CTR C;  1XF5 L;  4JGH B;  4NAW B;  4EJN A;  4C56 C;  4GXB A;  1PFD A;  4GMV A;  3U7D A;  3KLS X;  5D6J B;  4KIK B;  1JRO A;  4ANV A;  4F1S A;  1U27 A;  2KKC A;  2O6V D;  1K5D B;  1P3Q U;  3P4Q B;  3RYT A;  2QJL A;  4KZC A;  4BKS D;  2IY1 B;  3NSU A;  4TV3 A;  3HM6 X;  1NEK B;  3WAP A;  3TEY A;  2BS4 B;  3GYO A;  3CMM B;  3H7P B;  1ZYI A;  4PS8 A;  2NMQ A;  3NVY A;  1KF6 B;  3AE8 B;  3MFG A;  5DHA B;  1MHH E;  3EA6 A;  3R2T A;  4D2K A;  4FUL A;  3RMK C;  4HB2 B;  5HKH A;  4P16 A;  5AZF A;  2OJR A;  3ZVR A;  2RPV A;  2VZK D;  3PT2 B;  2CU3 A;  2WXI A;  3DBR I;  3GB1 A;  4JX1 C;  2W2X D;  1V86 A;  2M38 A;  1K52 A;  1PGX A;  2WDV B;  1TS5 A;  2BBC A;  1XX0 A;  5I4D A;  1PDX A;  3IT6 B;  5JXV A;  1ISN A;  3S2A A;  4CHK A;  4E74 A;  4FJV B;  1Y56 A;  1TT5 B;  4KSK C;  2FAZ A;  1M94 A;  4PK1 A;  4M0W A;  2ON8 A;  3CWI A;  3CSF A;  1I4Q A;  2N9E B;  4DHJ D;  3AUL A;  2AWT A;  4A9A A;  3EGR A;  3N20 C;  3QK0 A;  1L4D B;  2KQ7 A;  2CKH B;  3OLM D;  3AE6 B;  4KHA A;  1P98 A;  3NWA A;  4DK5 A;  4P1C C;  1GC7 A;  4JKD A;  1YN4 A;  4IWQ A;  2WXM A;  3I3T B;  4RGN A;  2FBW B;  2O2V A;  1VRA B;  1TKY A;  3JVZ X;  5G5G A;  3H7S A;  3M95 A;  1OQR A;  1I4X A;  2ZPY A;  1ZC3 B;  3NY5 A;  3ZDT A;  1OTR B;  2YT1 A;  3CF6 E;  1NTY A;  1PLS A;  3ULC A;  2QKL A;  2DLB A;  1NTV A;  1FHO A;  4LJP B;  2EKE C;  2LUE A;  2RD0 A;  2RRF A;  4HB4 B;  4NPN A;  5C16 A;  2N0S B;  1CJE A;  2MJD A;  3DHI C;  4QXA B;  3ML8 A;  2KOX A;  2CAY A;  3ENE A;  3U7Z A;  2H7E A;  4MH8 A;  2BPS A;  4KDL B;  1C77 A;  4WAF A;  1HQR D;  3VAW A;  2DYO A;  4DX9 0;  1FO4 A;  1HXY D;  2KR0 A;  3B0A A;  1UH6 A;  1WJ1 A;  4JKA A;  5BYR A;  4C00 A;  3Q8A A;  4IWP A;  4FHJ A;  1FFU A;  1T0Y A;  3F5R A;  2GCL A;  2R2O A;  2V3N A;  1IGD A;  4PQ0 A;  3Q3J A;  3ZRC A;  4ITK A;  3KUZ A;  1FAO A;  1UWM A;  3TBL D;  2PPH A;  1ZUD 2;  2IYB A;  2RR9 A;  3DHH C;  1G6J A;  3ABV B;  3MC8 A;  1BML C;  4OHJ A;  2BGF A;  1JAL A;  5C6R A;  1EU4 A;  2ICI A;  2LKO A;  4N6E B;  4REZ A;  1U2B A;  2GUM A;  2L1A A;  2DHI A;  1WY8 A;  1N63 A;  5T8I A;  2XK5 B;  3JSV A;  2JYE A;  4IAP A;  1VBH A;  4XE0 A;  3QIJ A;  1Q0W B;  4JL9 A;  4XGA B;  1IPG A;  3KW5 B;  2X0S A;  1YNT E;  5JVL A;  2BS3 B;  4ANX A;  3IXS A;  3ZXV A;  3VDZ A;  1W1D A;  2MQJ A;  4YTP B;  1D4B A;  1T6B X;  3ALB A;  4ZOH C;  4IOI E;  3PHW B;  2UVM A;  3HQC A;  2HJ1 A;  1JWB D;  1R4M I;  5H8Y E;  3VUY A;  2CS4 A;  4HJG E;  1RFK A;  1ZC4 B;  3V6E B;  3L08 A;  3BYY B;  2ADZ A;  3Q3N C;  3OG5 A;  3Q69 A;  3QAR A;  1C76 A;  3RD2 A;  4NJ7 A;  5L95 C;  4PYZ A;  3EPY A;  3SYX A;  4J6I A;  3D8F A;  2WP9 B;  1OQN A;  2IO2 B;  5LXI B;  4L1R A;  1BXT A;  5AUK A;  1V2Y A;  2HTH B;  1YMH E;  1V97 A;  5KQ4 A;  1H10 A;  5D94 A;  3E9P A;  2VKI A;  3SUZ A;  2UZS A;  1Y19 B;  2CHX A;  3P63 A;  2L2I A;  2KDF B;  2WU5 B;  2KWC A;  2W3S A;  3ZNH B;  4RF0 A;  3O96 A;  2NMB A;  2COP A;  5C2T B;  3GP7 A;  4JQW C;  1YX5 B;  2D9X A;  4LK0 M;  4L2Y A;  2DKP A;  3U12 A;  4NNJ B;  2K25 A;  1GG3 A;  3KUC B;  3BY4 B;  2DBY A;  4ZRQ A;  4EOY A;  2G1E A;  3TEX A;  1D5Z C;  1MI1 A;  3SNH A;  2JVC A;  1EVH A;  2FDQ A;  1PQS A;  2PJH A;  3I63 C;  2DYB A;  4HJK A;  5D3I B;  2Y8F A;  1UD7 A;  3UQA A;  4HAX B;  3OAN A;  1N5X A;  3UIO B;  2D3C A;  2M0X A;  3M62 B;  1V88 A;  2ACZ B;  5IOI A;  1A5R A;  3AEC B;  3DCX A;  4ZYS A;  1YQB A;  2G45 B;  1ZXI A;  4KKI A;  4GPT B;  4FJY A;  4RH6 A;  1MPH A;  5FR3 A;  2E2X A;  2BTE A;  1C78 A;  3BYT B;  3PSC A;  2KLC A;  1SE9 A;  1CMX B;  1D6E C;  3ODO A;  2P0H A;  3NOB A;  2BKF A;  1UZX B;  1UPQ A;  2N9K A;  4XYC A;  1DOI A;  2GRI A;  2J59 M;  2WXJ A;  2MW5 A;  3HIZ A;  1V8C A;  3VR8 B;  1WH3 A;  4ASW C;  2K1F A;  2NVU I;  2CR5 A;  4W9E A;  1P6S A;  2INC C;  3TEW A;  4A8X C;  2YRY A;  1OEY J;  2KFK B;  3SBT A;  2ZZP B;  1HZ6 A;  4LDT B;  3I5J C;  3IG3 A;  1GAQ B;  2CHW A;  4QJ5 B;  4RGT A;  5J2R A;  1GJZ A;  2XNA C;  3KSY A;  5I2S A;  4BKG A;  3N30 A;  3W1S A;  1K51 A;  3FM8 C;  1RFA A;  2KWD A;  1E8W A;  1ZOY B;  4ZRP A;  3WAO A;  3MTN B;  4M01 A;  3DPD A;  4ZRK A;  1U29 A;  1JRP A;  2K8H A;  3A4R A;  3PVW A;  3CST A;  3DBR B;  4IOY X;  1OQQ A;  5KHQ A;  4MK0 A;  1WMH B;  2N1V A;  3U30 A;  3B1L X;  2DZK A;  1X05 A;  4WJ7 A;  2NBU A;  4HRO A;  3JW0 X;  3R7Q A;  3VVW B;  4IM2 A;  3G9W A;  1PGB A;  3Q14 C;  2MEK A;  1XLQ A;  3DWM A;  1FRR A;  4UDU C;  1I7H A;  2DA0 A;  4OT1 A;  3D32 A;  4HKQ A;  3OJ3 A;  1LO5 D;  3TW1 A;  3ZYY X;  1LFD A;  4JKG A;  2LHD A;  3P42 A;  3TFM A;  5HE2 A;  4DXA B;  2QMT A;  1CZP A;  2QHO A;  2KX0 A;  1P1A A;  3VRA B;  4PYU A;  3SBG A;  2N7E A;  3R8B A;  3RNA C;  4GOU A;  2LGY A;  3ZNZ B;  1OMW A;  3V61 A;  2GB1 A;  5IO9 A;  4AWJ A;  1XD3 B;  1WZ0 A;  3GE8 C;  5J18 A;  3BZD B;  2DHJ A;  4A6F B;  1L0Y B;  5LNK 1;  4WWM A;  2CJN A;  4JK8 A;  3ECI A;  2R09 A;  3U4E G;  1V5M A;  5E6N A;  4A6Q A;  1OFF A;  1VZ7 A;  2OOB B;  1FGZ A;  4HEA 1;  2TSS A;  2D10 A;  1NI3 A;  3Q3M C;  2ONQ A;  3QBV B;  3KYC D;  4WWO A;  2C5L C;  4LCD E;  4YTM B;  2O6V B;  1VLB A;  1T0S C;  2YLM A;  5G2N A;  4JKC A;  2D9V A;  2SEB D;  3VH4 B;  1DDV A;  3TJP A;  2GBR A;  2ZW1 A;  1FCC C;  1VZ6 A;  2GBJ A;  3RN9 C;  3KH0 A;  3QJZ A;  3M63 B;  4Z2N A;  1WJ4 A;  2KC1 A;  4BBN C;  1N62 A;  3N7C A;  3C19 A;  2DZM A;  1WI1 A;  4CO7 A;  1HB6 A;  2MWS B;  1UGM A;  2WXL A;  3P6A A;  4MJS B;  4WSF A;  2Y5B B;  2BYV E;  2GOW A;  5JHA A;  2D5G A;  1AQC A;  1P3R A;  1Q5W B;  3AE2 B;  4JE3 B;  2VZK B;  2WXR A;  1EF5 A;  4AJW A;  1NVL A;  3UZT A;  2YT0 A;  4ANW A;  3WA0 A;  1Z5S B;  2BT6 A;  1XT9 B;  1RJ2 A;  2DKQ A;  2KK8 A;  1F2R C;  2QSD A;  1RWS A;  3C8Y A;  4NQL B;  2LMC A;  4KDI C;  2LBB A;  1TKE A;  3BVZ A;  2J0K A;  3O13 A;  1WXM A;  4B0E A;  4O1N A;  3WCQ A;  3BK1 A;  4YT0 B;  2AL3 A;  3HM3 A;  2N4F A;  4MSQ B;  5EE1 A;  1Q67 A;  2UU7 A;  5BO4 B;  4WAA A;  4YON A;  4GMX B;  1FRD A;  2PW9 A;  2ZW0 A;  4K7W A;  2E6X A;  3W9C B;  4DDI D;  1FXI A;  3MC0 B;  4XDD A;  2GLS A;  3EEC A;  3DBL I;  3RNE C;  3URY A;  3WAM A;  4BOZ B;  4NAM A;  1D3Z A;  4AJY B;  1RAX A;  4FBJ B;  4HKZ E;  2N1W A;  1KRH A;  1V81 A;  4FA6 A;  2DIK A;  2L3Z A;  2LD9 A;  1UBI A;  1NDD A;  3PRP B;  1WR1 A;  3HW2 B;  5CHW A;  5C3J B;  1EU3 A;  4LNO A;  4ANU A;  1TQZ A;  5D3X A;  1YJI A;  4TYZ A;  2KNB A;  5LXH A;  1XKE A;  2DTC A;  5J17 A;  1V89 A;  3A9K B;  3A1Q A;  1I4R A;  2D9Z A;  1WE6 A;  1Y5O A;  1ZSQ A;  2JWZ A;  1K5G B;  2I5C A;  1J0W A;  2COD A;  3TCA A;  3W5U B;  1FNW A;  2QIL A;  1B9R A;  2IFS A;  3DXC A;  3AEF B;  2WGS A;  4W9I A;  5JHG A;  3DVG X;  2N0Y A;  4QAY A;  2ZNV B;  2Y3A A;  1PGA A;  2KX3 A;  3RUL A;  4Y94 A;  4GDK A;  4MDK E;  1B1Z A;  2WDR B;  3AEB B;  4AP4 C;  2N7D A;  1HBK A;  1V1P B;  2GS0 A;  3VTU A;  2RQ1 A;  3OHM B;  3JYU A;  2MWN B;  4B95 A;  4DXG A;  3PHX B;  2FCQ A;  5JHB A;  1R4N I;  2Q5W D;  3FIL A;  4E3C A;  5DH9 B;  1FNV A;  4GSW A;  2LUL A;  3IHP C;  3QAQ A;  1JQ4 A;  5EE3 A;  2H7D A;  1JRU A;  4CHM A;  2WS3 B;  3L0W B;  4MM3 B;  1UBQ A;  3HVD A;  3PGE A;  3RI7 C;  4NSW A;  2X38 A;  2PEA A;  5IAA C;  4HRS A;  3ZKJ C;  1WR6 E;  3UQB A;  2JX5 A;  1LXD A;  2KO3 A;  2GJY A;  4Z2M B;  3PZD A;  1TXD A;  1MKE A;  4G0N B;  4MGK E;  3R66 C;  2I1K A;  3H1U A;  2Z0E B;  3BIN A;  1WGH A;  3FKY A;  2JZZ A;  1WX9 A;  2RDH A;  4I6N B;  4XWX A;  3TIX A;  2WDT B;  3W5V B;  3V05 A;  2NBV B;  1ZKH A;  4GDL B;  2IZV B;  3RZF A;  4LLG M;  1WJU A;  1KLU D;  4F7H A;  5IP4 D;  3O65 B;  3T06 A;  5DHF B;  3N3K B;  4CQN A;  1L4Z B;  5BMI A;  2Y7B A;  5JLJ B;  2P0D A;  2WNM A;  1MG4 A;  2FJL A;  3ETR A;  1L5P A;  3PG7 A;  2CB8 A;  2LGI A;  2MBO A;  3L10 B;  2J4X A;  3B2F A;  4KSL C;  4K7S A;  3E56 A;  2GBM A;  4WWP A;  1EO6 A;  3NS1 A;  2J0M A;  3VH3 B;  2RDB C;  5AEK B;  1I7A A;  3NZU A;  1ZE3 D;  3PRE A;  2LWP A;  3W1Y A;  1AAR A;  4ICU A;  3ZQ4 A;  4DHZ B;  3AEG B;  1V80 A;  2KMA A;  4DQO C;  3N1X C;  2KMM A;  3SDL C;  4WIP A;  1IBX A;  2VH2 A;  3LB8 C;  1P9D U;  2K22 A;  3UIP B;  2KFJ A;  2K00 A;  2M8S A;  5IRS A;  1FXA A;  4CYE A;  2XN9 C;  4N58 A;  4YWG G;  1AN8 A;  2L8J A;  2N9P C;  1FD6 A;  1M4V A;  3ENB A;  3A98 B;  1P7E A;  2R61 A;  2YS3 A;  1A70 A;  1GB4 A;  4K81 A;  2BYF A;  3A9J A;  1MHX A;  3QA8 A;  1GOZ A;  2LOZ A;  1T0R C;  4AUQ C;  1YD8 U;  2CU1 A;  3ZNG C;  4II3 B;  2HTM E;  1X1G A;  1HTQ A;  2EC1 A;  3GYP A;  4ARI A;  1IRS A;  2L52 A;  3TMP B;  1BUI C;  4HDO A;  3WAL A;  2M14 A;  2INN E;  2W9N A;  5KCV A;  1E8Y A;  2Z59 A;  3AV8 A;  2KJH B;  1SSN A;  2PMV A;  4HAY B;  4MSM B;  5KHO A;  2Z14 A;  1EWY C;  4W9D A;  1E90 A;  1BAK A;  2JPH A;  5EE0 A;  2G4S A;  2NR2 A;  2RPQ A;  2YEP F;  1V5O A;  5D2M B;  3RCP A;  4YSX B;  1E8Z A;  1WXV A;  4M0W B;  1MK7 B;  3AE1 B;  4TMA B;  5LOP B;  2M1M A;  4C4V B;  3Q8E A;  4OZA A;  2BW2 A;  2V4I B;  5G55 A;  3WAN A;  3R7R A;  2EMT A;  2KN5 A;  3NWD A;  3AJ4 A;  5LON B;  3FP5 A;  4XC2 A;  2MFQ A;  1WXA A;  2JYT A;  1LM8 B;  5L83 A;  2MCN B;  2KLG A;  2ZCC A;  4BZA A;  2L00 B;  2MBB B;  2QDF A;  2KJ6 A;  2RMM A;  3H8H A;  1F77 A;  4MAC A;  2O2V B;  2D2Q A;  3BJI A;  2KJR A;  2YSZ A;  4RM8 A;  2K0P A;  1KBL A;  1ZW7 A;  2KT7 A;  1WX7 A;  1C1Y B;  4C0A A;  2HRJ A;  1KI1 B;  2W2W A;  1XXG A;  4YSY B;  1AYF A;  2KHW B;  3TUO A;  4G3X B;  3ZNI D;  3FEH A;  4F7U P;  2Z0Q A;  2WH5 A;  3Q6B A;  1WJ6 A;  1PFJ A;  4XWW A;  4IC7 B;  1SJH D;  2NTS A;  2FCS A;  5TR5 A;  2LI5 A;  1UNQ A;  5CHV C;  3MHS D;  2K8B A;  5HHD G;  2WXO A;  1UPR A;  2MP2 B;  1U5F A;  2M17 A;  1Z2M A;  1IP9 A;  4JKB A;  1QIL A;  2N7J A;  5D7G A;  1YQ3 B;  3RNC C;  2Z0P A;  4MGI E;  1T3Q A;  1L2N A;  4PNK A;  1L0V B;  4KHB A;  1HTO A;  1WXS A;  1HB8 A;  4DDG D;  4NJ6 A;  4OW0 A;  1VD2 A;  3MP9 A;  1MJD A;  4W9F A;  2ZVN A;  3DBL B;  2KTF A;  1F2R I;  4EE2 A;  2M56 B;  2G9H D;  1MI0 A;  3KQ4 A;  1DYN A;  3KY9 A;  2KGX B;  3V60 A;  1FHX A;  3Q8B A;  4P1B C;  2W54 A;  1FXT B;  1UNS A;  2QC8 A;  1FEH A;  4MGZ E;  4MT7 A;  3APF A;  4FAD A;  3AU4 A;  1T77 A;  3DVN U;  4HPP A;  2QKM A;  2JXT A;  2YF0 A;  3NRZ A;  2K5P A;  1YN5 A;  1I2H A;  1E7V A;  2BWF A;  4EFO A;  1ET6 A;  3DDC B;  3X0W A;  3PLU A;  5E6O A;  2DYQ A;  3AU5 A;  1V5U A;  2KCJ A;  5IN7 A;  2DX5 A;  1ACC A;  1Q1O A;  2NPT A;  2JU6 X;  1WGR A;  2KVR A;  1EM7 A;  2NCN A;  4MEM A;  1WI0 A;  3JSV B;  1QZE A;  5JP4 A;  1MIX A;  4WJO A;  3PZ8 A;  1MIZ B;  2B76 B;  3H6N A;  2WWZ A;  5J3Y A;  3CIK A;  2WU2 B;  3N32 A;  1P0R A;  1I35 A;  2IGG A;  2KWV B;  3VHT C;  1Z87 A;  1TY2 A;  4JWS C;  2R82 A;  1WYG A;  1NBF C;  1V61 A;  2K39 A;  3IFW B;  1ROE A;  2V3S A;  2MLB A;  1MK9 B;  2G35 A;  3NHE B;  3VRB B;  2G3Q B;  1NTI A;  1K53 A;  2J7Q B;  4G11 A;  4J3O D;  1FOE A;  4A3O A;  4MH0 E;  1QOB A;  1R4N B;  1I4P A;  1ET9 A;  2IBI B;  2K2U A;  1QC6 A;  3D8E A;  4GZU A;  3WIM A;  3ZO5 B;  4LTU A;  3SFD B;  5GOW B;  2CY5 A;  1J7B A;  5DCN A;  1TS3 A;  2BS2 B;  4KV2 A;  3DOW A;  3GZN I;  3N9Y C;  2Q13 A;  2KIE A;  3UIN B;  1JML A;  3AN1 A;  1VZ8 A;  5KQ1 A;  3HRD D;  4LNK A;  1GC6 A;  2KTR A;  1I42 A;  2LXC A;  1DOY A;  2FNJ B;  2JRI B;  2KQ4 X;  3ZVV A;  1L6V A;  1C4P A;  4BKS A;  4ILG B;  2FJU B;  2FIF A;  2K8C A;  4DBB A;  3NG0 A;  3ZDM C;  1XLO A;  2L0T A;  5H92 C;  1SE3 A;  4XDC A;  1SJE D;  1V1O A;  4IM0 A;  1DOX A;  3ML4 A;  2ELB A;  2LZ6 A;  5BYQ A;  1XLP A;  2OHF A;  1QT9 A;  2DZJ A;  2SAK A;  2BKR B;  2COA A;  4W9G A;  1KZG A;  2HJ8 A;  4W9H A;  3KZ1 A;  2IO3 B;  3AI5 A;  5FKA C;  3R2I A;  5FI0 A;  1WFY A;  2N9X A;  1X1F A;  2YS1 A;  2KXJ A;  4C7Y A;  4BOS C;  3HK0 A;  2E3T A;  5C5B A;  4BAX A;  5LG4 B;  1IYF A;  2K9X A;  1OQY A;  3MHZ A;  2W2X C;  1J8C A;  2KQS A;  1N3H A;  1W1G A;  3KVF B;  4MT5 A;  2V4L A;  2LUM A;  2FUG 1;  2WYQ A;  1TS4 A;  1J7C A;  1UF0 A;  2KWU B;  4HHV A;  3EC8 A;  3P4P B;  4ZHO A;  1DBH A;  2PLP A;  2BB5 A;  2WXH A;  3HHM A;  1YN3 A;  2DZI A;  4KVG B;  4KGS A;  2X8X X;  2KD0 A;  2AEH A;  2BF8 B;  4DHZ E;  4D0N B;  1N61 A;  2C7M B;  2FE8 A;  3SO6 A;  1UWX A;  2WXP A;  4G50 A;  4FN2 A;  4HCP B;  2FCN A;  2YVC A;  1R7S A;  1ZPS A;  3LXF A;  4EKU A;  4MY6 A;  1NVI D;  4IFS A;  1RM6 C;  1XO3 A;  5DI9 B;  4IW0 A;  3T3N A;  2RGF A;  2ZEQ A;  4ZHP A;  3A58 A;  3AEE B;  4YSZ B;  1TTN A;  2GBK A;  5FK9 C;  4JWU C;  3DBH I;  4I6P A;  1JWS D;  3HIE A;  3BVG A;  4JIO U;  4OVZ A;  2P8V A;  1WJN A;  3UF8 A;  3VOQ A;  2J53 A;  4HXD A;  4PT5 A;  3RNG C;  1KC7 A;  3TL5 A;  2CHZ A; 
#chains in the Genus database with same CATH homology
 3KRW A;  4BVU C;  4M8M A;  1UEF A;  1WGD A;  4FHK A;  4KZ0 A;  2ROV A;  1LQB A;  3VTV A;  4JKG B;  1XQQ A;  1E5W A;  5D3V A;  2CQU A;  1V49 A;  4MGY E;  2KZR A;  3QCA A;  1ZGU B;  4EMO A;  4F7G A;  4NAW A;  2MKR A;  4ZDV A;  4IM3 A;  4OVU A;  1WE7 A;  4KIK A;  4TKN A;  1WYW B;  3H7P A;  2KDE B;  4EUT A;  3SD5 A;  4E71 A;  4FLH A;  3L17 A;  2R2Q A;  5FR6 A;  1LW3 A;  1DIK A;  4W9C A;  3DCG A;  2D07 B;  3KYD D;  3PTF C;  1UEL A;  3PSE B;  3V6C B;  5C1Z A;  1AWE A;  1M7R A;  3P7Z A;  4TQ0 A;  4I6L B;  2G4D B;  5D3W A;  4JKH A;  2L1C A;  2B3A A;  3QWZ B;  3ODW A;  3V5W A;  5JH5 C;  3ZW3 A;  2FID A;  2IY0 B;  4DX8 A;  2LXA A;  4WWN A;  1ST7 A;  2RUK B;  4BBN F;  4WJQ A;  3ZRF A;  2RSU A;  2D11 A;  5LLI A;  3SHQ A;  2K6D B;  3EFU A;  2LRU A;  3U8Z A;  1SIF A;  3RT3 B;  1ZM0 A;  1U5D A;  1FGY A;  2AYO B;  3PP2 A;  1WRD B;  5DPW A;  4K7U A;  4TUU A;  1M7E A;  4HLE A;  3LJU X;  4F8C B;  5J3T A;  3QC8 B;  1XOD A;  1U5E A;  2L0F A;  3QWM A;  2UWQ A;  2KDB A;  5CLQ B;  2I5F A;  1EUV B;  1DDM A;  2JY6 A;  3PLV A;  3PPA A;  3ZUN A;  1EF1 A;  1GUA B;  2WX1 A;  5DPR A;  3ZIM A;  4A5K A;  4EZL A;  4B9K A;  1V9J A;  3A1Q B;  3ZTD A;  2PZ1 A;  1VCB A;  3X23 A;  3APD A;  4RM9 A;  1S3S G;  3LJ3 A;  2HD5 B;  3C0R B;  2LRW A;  5AZH A;  4YL8 A;  3FLV A;  1OY2 A;  5EFX A;  3OJ4 B;  3NZS A;  4GDK B;  1VBG A;  1WGY A;  3PV1 A;  2JT4 B;  2ZVO A;  2X18 A;  4M8N A;  5DIF B;  4N9F 4;  1WZ3 A;  3L16 A;  2DEN B;  1X86 A;  4GIV A;  4X57 B;  3EHV A;  3IBE A;  2A5U A;  3L13 A;  1V6E A;  4WVF B;  3ULB A;  2XK5 A;  1UNR A;  3F0W A;  4JKE A;  2LJ5 A;  2XEW A;  1MAI A;  3UGB B;  1WM2 A;  3DVG Y;  3VTW A;  4HPM B;  2MSE D;  5E6P A;  2DHZ A;  4HB3 B;  1DRO A;  2NBW B;  2OQB A;  2ROZ B;  2MBQ A;  4CHJ A;  2VSZ A;  3ODX A;  2C7N B;  4BBK A;  3P2B A;  2PE6 B;  1TZ1 A;  3NS8 A;  1WX8 A;  1WG7 A;  2MP2 A;  3VXW A;  3T8M A;  3H9D A;  3RUI B;  2K2J A;  2FCM A;  2RLO A;  3SU8 X;  1XCG A;  2NS5 A;  2GBN A;  5CHF A;  2HTH A;  3R3M A;  3ONS A;  3PRZ A;  2LVO A;  1V5T A;  1HE8 A;  1YJ1 A;  4KHO A;  1KZ7 A;  4KAX B;  4W9L A;  2D4Q A;  4HWI B;  4FJZ A;  3SV1 A;  4A6H A;  4HCN B;  1MG8 A;  4XZ4 A;  5C23 A;  2M4N A;  3LDZ E;  2LYD A;  4HVB A;  2OTX A;  3A4S C;  1S1Q B;  3GOE A;  4EZJ A;  4ILH A;  3A8P A;  3K9P B;  1SHC A;  1OGW A;  1F9J A;  1H8C A;  2KC2 A;  2WX0 A;  1KM7 A;  2EJ8 A;  3A9J B;  1TGZ B;  4F7Z A;  3DBS A;  4K1R B;  1RLF A;  2UYZ B;  3RCZ A;  1SGH A;  2DN6 A;  3QQ8 B;  4WJN A;  4ICV A;  2MX2 A;  2Z59 B;  3DXD A;  2D3G A;  4B6H A;  2MBH A;  4HDQ A;  2KFK A;  2LAS A;  4ZRJ A;  2VRW B;  2DYM A;  2MDX A;  2GMI C;  4URK A;  2DLW A;  5JZE B;  2CY4 A;  2XQN M;  2J0J A;  1X1M A;  5IJM A;  2BWE S;  2LVP A;  2CRF A;  2IO1 B;  4WJP A;  3QX1 A;  1BWN A;  2D9Y A;  4JK7 A;  1EGX A;  5HE3 A;  1WMH A;  2N23 A;  2RGN B;  1W1H A;  3PVL A;  4P7I A;  1B55 A;  2JZ3 B;  1DDW A;  4OVV A;  2DFK A;  4BFR A;  2COC A;  1LB1 A;  4GN1 A;  3TO1 A;  2P0F A;  3L54 A;  2ABD A;  3MDB C;  3ZLZ A;  4AOF A;  1NI2 A;  3VIA A;  1RRP B;  4B6W A;  4A6K A;  2COF A;  3CXB B;  4A6F A;  4II2 B;  1WGG A;  5C79 A;  4KHB B;  4GGQ A;  3MJW A;  3KRX A;  5J3Q A;  2LVQ A;  2RVB B;  4RMA A;  2KAN A;  2AL6 A;  2ELA A;  1J19 A;  3OAW A;  1BTN A;  4IG7 B;  3V62 A;  1FB8 A;  2KMC A;  4IWO A;  3A33 B;  3PRM B;  4ILJ A;  2A4Z A;  2O6V A;  4GOC A;  2LGX A;  4NY0 A;  2BYE A;  1JDE A;  1YIW A;  4W9K A;  2C60 A;  4HAT B;  2ZCB A;  1QQG A;  2DYN A;  1KOT A;  4A20 A;  4MJS A;  2C7H A;  2L76 A;  1WM3 A;  2DX5 B;  4EZK A;  2NPT B;  4HPL B;  3W1S C;  4JKF A;  1FHW A;  4HK2 A;  2K6Q A;  1TBE A;  1P5T A;  3AXC A;  1Y8R C;  2BCJ A;  2DHK A;  3A8Q A;  3WYF B;  2MBE A;  4DBG A;  3APC A;  2MRP A;  2V1Y A;  1NU2 A;  3M3J A;  2KDI A;  2LOX A;  2Y8G A;  4NQK E;  1V5P A;  2V76 A;  5IA7 A;  4IUM B;  3Q3F A;  2I1J A;  4GB9 A;  3D8D A;  1XR0 B;  1GNU A;  4HAZ B;  4JK9 A;  1UNP A;  5D3Y A;  1E7U A;  2EMS A;  4GU2 A;  2IO0 B;  5D27 A;  3TVV A;  4XX5 A;  1BTK A;  2ASQ A;  5DPS A;  3DXE A;  2C9W B;  2REX A;  3DQV A;  1XD4 A;  4HAW B;  2KTR B;  3A9K A;  2NZ8 B;  4L6E A;  4WQO B;  1ZVR A;  2YS5 A;  4LJO B;  3DVN V;  2DX1 A;  1OEY A;  2VRR B;  4BKT A;  5CX3 A;  2Z0O A;  1ACA A;  3QHT A;  4PS7 A;  2IYD B;  1U5G A;  5GMV A;  2FJ9 A;  2Z0D B;  3B08 A;  3IVF A;  5HE1 A;  1BT0 A;  2LG1 A;  4EEW A;  3PS6 A;  1WJM A;  1KLV A;  2HE7 A;  3PVU A;  5FI1 A;  2ZNV C;  4MEL A;  2RSG A;  4HAU B;  1X11 A;  4JLC A;  2DAJ A;  5C5B B;  3PEG A;  2FUH B;  2JF5 A;  4W9J A;  1TJ6 A;  2DAF A;  4TQ1 A;  4DHJ B;  1PMS A;  4H8S A;  1H4R A;  1RRB A;  2KUP A;  4MM3 A;  3KUD B;  4LDT D;  4PS3 A;  2XBB C;  5L81 A;  2GCJ A;  3FSS A;  3VUX A;  4HAV B;  1KJT A;  2R0D A;  3E66 A;  2LGD A;  1WGU A;  4DWF A;  1WF9 A;  4HB0 B;  2RNR B;  3M1I B;  2JXX A;  4K2O A;  2UZR A;  1YX6 B;  2PE9 A;  3VFK A;  2ZPN A;  1WVH A;  1EAZ A;  4ZYN A;  3MPX A;  3ZTC A;  2L7R A;  5HE0 A;  1J0G A;  3RZW C;  4ZRI A;  4K17 A;  4GDL A;  5JHH A;  1E8X A;  3VQI A;  1K8R B;  2D9W A;  2JP2 A;  1U4A A;  2JRH A;  1WIA A;  3T9L A;  2JUO A;  4A3P A;  5EDS A;  1GGO A;  5CLL B;  2L05 A;  2ZJD A;  3ML9 A;  1L7Y A;  3K9O B;  1WGQ A;  5DPT A;  3VUW A;  3E9L A;  2MA9 B;  5AZG A;  1C3T A;  3E9O A;  4K2P A;  5CTR C;  4JGH B;  4NAW B;  4EJN A;  4GXB A;  4GMV A;  3U7D A;  5D6J B;  4KIK B;  4ANV A;  4F1S A;  1U27 A;  2KKC A;  2O6V D;  1K5D B;  1P3Q U;  3RYT A;  4KZC A;  4BKS D;  2IY1 B;  3NSU A;  4TV3 A;  3HM6 X;  3WAP A;  3GYO A;  3CMM B;  3H7P B;  4PS8 A;  5DHA B;  4FUL A;  4HB2 B;  5HKH A;  5AZF A;  2OJR A;  3ZVR A;  3PT2 B;  3DBR I;  2W2X D;  1V86 A;  2M38 A;  1XX0 A;  1ISN A;  3S2A A;  4CHK A;  4E74 A;  4FJV B;  4KSK C;  2FAZ A;  1M94 A;  3CSF A;  2N9E B;  4DHJ D;  3AUL A;  2AWT A;  3QK0 A;  2KQ7 A;  2CKH B;  3OLM D;  4KHA A;  1P98 A;  4DK5 A;  1GC7 A;  4JKD A;  4IWQ A;  3I3T B;  2O2V A;  3JVZ X;  3H7S A;  3M95 A;  2ZPY A;  1ZC3 B;  3NY5 A;  3ZDT A;  1OTR B;  2YT1 A;  3CF6 E;  1NTY A;  1PLS A;  3ULC A;  2QKL A;  1NTV A;  1FHO A;  4LJP B;  2EKE C;  2LUE A;  2RD0 A;  4HB4 B;  4NPN A;  5C16 A;  3ML8 A;  2KOX A;  2CAY A;  3ENE A;  2H7E A;  2BPS A;  4KDL B;  3VAW A;  2DYO A;  4DX9 0;  3B0A A;  1UH6 A;  1WJ1 A;  4JKA A;  4IWP A;  4FHJ A;  1T0Y A;  3F5R A;  2GCL A;  2R2O A;  4PQ0 A;  3Q3J A;  3ZRC A;  3KUZ A;  1FAO A;  3TBL D;  2PPH A;  2IYB A;  2RR9 A;  1G6J A;  2BGF A;  5C6R A;  2LKO A;  1U2B A;  2DHI A;  1WY8 A;  2XK5 B;  3JSV A;  4IAP A;  1VBH A;  3QIJ A;  1Q0W B;  4JL9 A;  1IPG A;  3KW5 B;  2X0S A;  5JVL A;  4ANX A;  3VDZ A;  1W1D A;  2MQJ A;  3ALB A;  3PHW B;  2UVM A;  3HQC A;  1R4M I;  3VUY A;  2CS4 A;  1ZC4 B;  3V6E B;  3L08 A;  2ADZ A;  3QAR A;  3RD2 A;  4NJ7 A;  5L95 C;  4PYZ A;  3EPY A;  3SYX A;  4J6I A;  3D8F A;  1OQN A;  2IO2 B;  5LXI B;  1V2Y A;  2HTH B;  5KQ4 A;  1H10 A;  5D94 A;  3E9P A;  2VKI A;  3SUZ A;  2UZS A;  1Y19 B;  2CHX A;  2L2I A;  2KDF B;  2KWC A;  3ZNH B;  3O96 A;  2NMB A;  2COP A;  4JQW C;  1YX5 B;  2D9X A;  2DKP A;  4NNJ B;  2K25 A;  1GG3 A;  3KUC B;  3BY4 B;  4EOY A;  3SNH A;  2JVC A;  1EVH A;  2FDQ A;  1PQS A;  2PJH A;  2DYB A;  4HJK A;  2Y8F A;  1UD7 A;  3UQA A;  4HAX B;  3OAN A;  3UIO B;  2M0X A;  3M62 B;  1V88 A;  1A5R A;  1YQB A;  2G45 B;  4GPT B;  4FJY A;  1MPH A;  2E2X A;  3PSC A;  2KLC A;  1SE9 A;  1CMX B;  3ODO A;  2P0H A;  3NOB A;  2BKF A;  1UZX B;  1UPQ A;  2J59 M;  2MW5 A;  3HIZ A;  1WH3 A;  4ASW C;  2K1F A;  2NVU I;  2CR5 A;  4W9E A;  1P6S A;  2YRY A;  1OEY J;  2KFK B;  3SBT A;  2ZZP B;  4LDT B;  3IG3 A;  2CHW A;  5J2R A;  1GJZ A;  3KSY A;  4BKG A;  3N30 A;  3W1S A;  3FM8 C;  1RFA A;  1E8W A;  3WAO A;  3MTN B;  3DPD A;  4ZRK A;  1U29 A;  2K8H A;  3A4R A;  3PVW A;  3CST A;  4IOY X;  5KHQ A;  4MK0 A;  1WMH B;  2N1V A;  3U30 A;  3B1L X;  2DZK A;  1X05 A;  4WJ7 A;  2NBU A;  3JW0 X;  3R7Q A;  3VVW B;  4IM2 A;  3G9W A;  2DA0 A;  3D32 A;  3OJ3 A;  3TW1 A;  1LFD A;  4JKG A;  3TFM A;  5HE2 A;  4DXA B;  2QHO A;  2KX0 A;  1P1A A;  4PYU A;  3SBG A;  2N7E A;  2LGY A;  3ZNZ B;  1OMW A;  3V61 A;  4AWJ A;  1XD3 B;  1WZ0 A;  5J18 A;  2DHJ A;  4A6F B;  4JK8 A;  3ECI A;  2R09 A;  1V5M A;  5E6N A;  2OOB B;  1FGZ A;  2D10 A;  3QBV B;  3KYC D;  4WWO A;  2C5L C;  4LCD E;  2O6V B;  2YLM A;  5G2N A;  4JKC A;  2D9V A;  3VH4 B;  1DDV A;  3TJP A;  2GBR A;  2GBJ A;  3KH0 A;  3QJZ A;  3M63 B;  4Z2N A;  1WJ4 A;  2KC1 A;  4BBN C;  3N7C A;  2DZM A;  1WI1 A;  4CO7 A;  1HB6 A;  2MWS B;  1UGM A;  3P6A A;  4MJS B;  4WSF A;  2Y5B B;  2BYV E;  2GOW A;  5JHA A;  1AQC A;  1P3R A;  1Q5W B;  1EF5 A;  4AJW A;  1NVL A;  3UZT A;  2YT0 A;  4ANW A;  3WA0 A;  1Z5S B;  1XT9 B;  1RJ2 A;  2DKQ A;  2KK8 A;  4NQL B;  4KDI C;  2LBB A;  2J0K A;  1WXM A;  2AL3 A;  3HM3 A;  2N4F A;  4MSQ B;  1Q67 A;  5BO4 B;  4WAA A;  4YON A;  4GMX B;  4K7W A;  4DDI D;  3EEC A;  3DBL I;  3WAM A;  4BOZ B;  1D3Z A;  4AJY B;  1RAX A;  4FBJ B;  2N1W A;  1V81 A;  4FA6 A;  2DIK A;  2L3Z A;  2LD9 A;  1UBI A;  1NDD A;  3PRP B;  1WR1 A;  3HW2 B;  5CHW A;  4ANU A;  1TQZ A;  5D3X A;  4TYZ A;  2KNB A;  5LXH A;  1XKE A;  2DTC A;  5J17 A;  1V89 A;  3A9K B;  3A1Q A;  2D9Z A;  1WE6 A;  1Y5O A;  1ZSQ A;  2JWZ A;  1K5G B;  2I5C A;  1J0W A;  2COD A;  3TCA A;  2IFS A;  3DXC A;  4W9I A;  5JHG A;  3DVG X;  2N0Y A;  2ZNV B;  3RUL A;  2KX3 A;  4Y94 A;  4GDK A;  4MDK E;  4AP4 C;  2N7D A;  1HBK A;  2GS0 A;  3VTU A;  2RQ1 A;  3JYU A;  2MWN B;  4B95 A;  3PHX B;  2FCQ A;  5JHB A;  1R4N I;  4E3C A;  5DH9 B;  4GSW A;  2LUL A;  3IHP C;  3QAQ A;  2H7D A;  1JRU A;  4CHM A;  3L0W B;  1UBQ A;  3PGE A;  4NSW A;  5IAA C;  2PEA A;  3ZKJ C;  1WR6 E;  3UQB A;  1LXD A;  2KO3 A;  2GJY A;  4Z2M B;  3PZD A;  1TXD A;  1MKE A;  4G0N B;  4MGK E;  3R66 C;  2I1K A;  3H1U A;  2Z0E B;  3BIN A;  1WGH A;  2JZZ A;  1WX9 A;  4I6N B;  4XWX A;  3TIX A;  2WDT B;  2NBV B;  1ZKH A;  4GDL B;  2IZV B;  3RZF A;  1WJU A;  4F7H A;  3O65 B;  3T06 A;  5DHF B;  3N3K B;  2Y7B A;  5JLJ B;  2P0D A;  2FJL A;  3PG7 A;  2CB8 A;  2MBO A;  3L10 B;  4KSL C;  4K7S A;  2GBM A;  4WWP A;  1EO6 A;  2J0M A;  3VH3 B;  5AEK B;  1I7A A;  3NZU A;  3PRE A;  2LWP A;  3W1Y A;  1AAR A;  4ICU A;  4DHZ B;  1V80 A;  2KMA A;  3SDL C;  1P9D U;  3UIP B;  2KFJ A;  2K00 A;  2M8S A;  4CYE A;  2L8J A;  2N9P C;  3ENB A;  3A98 B;  2YS3 A;  4K81 A;  2BYF A;  3A9J A;  3QA8 A;  2LOZ A;  4AUQ C;  1YD8 U;  2CU1 A;  3ZNG C;  4II3 B;  1X1G A;  2EC1 A;  3GYP A;  1IRS A;  3TMP B;  4HDO A;  3WAL A;  2M14 A;  2W9N A;  5KCV A;  1E8Y A;  2KJH B;  4HAY B;  4MSM B;  5KHO A;  4W9D A;  1E90 A;  1BAK A;  2JPH A;  2G4S A;  2NR2 A;  2RPQ A;  1V5O A;  5D2M B;  3RCP A;  1E8Z A;  1WXV A;  4M0W B;  1MK7 B;  5LOP B;  2M1M A;  5G55 A;  3WAN A;  3R7R A;  2EMT A;  2KN5 A;  5LON B;  3AJ4 A;  3FP5 A;  4XC2 A;  2MFQ A;  1WXA A;  1LM8 B;  5L83 A;  2MCN B;  2KLG A;  2ZCC A;  2L00 B;  2MBB B;  2KJ6 A;  2O2V B;  2D2Q A;  3BJI A;  2KJR A;  2YSZ A;  4RM8 A;  1KBL A;  1ZW7 A;  1WX7 A;  1C1Y B;  4C0A A;  2HRJ A;  1KI1 B;  2W2W A;  2KHW B;  4G3X B;  3ZNI D;  3FEH A;  4F7U P;  2Z0Q A;  2WH5 A;  1WJ6 A;  1PFJ A;  4IC7 B;  2FCS A;  5TR5 A;  2LI5 A;  1UNQ A;  5CHV C;  3MHS D;  2K8B A;  1UPR A;  2MP2 B;  1U5F A;  2M17 A;  1Z2M A;  1IP9 A;  4JKB A;  5D7G A;  2Z0P A;  4MGI E;  1L2N A;  4PNK A;  1WXS A;  4DDG D;  1HB8 A;  4NJ6 A;  1VD2 A;  4W9F A;  2ZVN A;  2KTF A;  1DYN A;  3KY9 A;  2KGX B;  3V60 A;  1FHX A;  1FXT B;  4FAD A;  4MGZ E;  4MT7 A;  3APF A;  3AU4 A;  3DVN U;  2QKM A;  2YF0 A;  1I2H A;  1E7V A;  2BWF A;  4EFO A;  3DDC B;  3X0W A;  3PLU A;  5E6O A;  2DYQ A;  3AU5 A;  1V5U A;  2KCJ A;  2DX5 A;  1Q1O A;  2NPT A;  1WGR A;  2KVR A;  2NCN A;  4MEM A;  1WI0 A;  3JSV B;  1QZE A;  5JP4 A;  1MIX A;  4WJO A;  1MIZ B;  3H6N A;  2WWZ A;  5J3Y A;  3CIK A;  3N32 A;  1P0R A;  1I35 A;  2KWV B;  3VHT C;  1Z87 A;  2R82 A;  1NBF C;  1V61 A;  2K39 A;  3IFW B;  2V3S A;  2MLB A;  1MK9 B;  2G35 A;  3NHE B;  2G3Q B;  1NTI A;  2J7Q B;  4G11 A;  1FOE A;  4A3O A;  4MH0 E;  2IBI B;  2K2U A;  1QC6 A;  3D8E A;  4GZU A;  3WIM A;  3ZO5 B;  5GOW B;  2CY5 A;  5DCN A;  4KV2 A;  3DOW A;  3GZN I;  2Q13 A;  3UIN B;  5KQ1 A;  1GC6 A;  2KTR A;  1I42 A;  2LXC A;  2FNJ B;  2JRI B;  3ZVV A;  4BKS A;  4ILG B;  2FIF A;  2K8C A;  4DBB A;  3ZDM C;  2L0T A;  4IM0 A;  3ML4 A;  2ELB A;  2LZ6 A;  2DZJ A;  2BKR B;  2COA A;  4W9G A;  1KZG A;  2HJ8 A;  4W9H A;  3KZ1 A;  2IO3 B;  3AI5 A;  5FI0 A;  1WFY A;  2N9X A;  1X1F A;  2YS1 A;  2KXJ A;  4BOS C;  3HK0 A;  5C5B A;  1IYF A;  1OQY A;  2W2X C;  1J8C A;  2KQS A;  1N3H A;  1W1G A;  3KVF B;  2V4L A;  2WYQ A;  2KWU B;  4HHV A;  3EC8 A;  1DBH A;  3HHM A;  2DZI A;  4KVG B;  2KD0 A;  2AEH A;  2BF8 B;  4DHZ E;  4D0N B;  2C7M B;  3SO6 A;  4G50 A;  4FN2 A;  4HCP B;  2FCN A;  2YVC A;  4EKU A;  4MY6 A;  4IFS A;  5DI9 B;  4IW0 A;  2RGF A;  2ZEQ A;  1TTN A;  2GBK A;  3DBH I;  4I6P A;  4JIO U;  2P8V A;  1WJN A;  3UF8 A;  3VOQ A;  4HXD A;  1KC7 A;  3TL5 A;  2CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...