1H4RA

Crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERLIN
publication title The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 96
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1h4rA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1h4rA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h4rA01
2N7DA 3T8MA 2IO2B 2N23A 3F0WA 3DQVA 3VVWB 2EKEC 4B6HA 4AUQC 1V86A 1KLVA 4DHZE 1U5FA 1K5GB 2JPHA 4AJWA 4EKUA 1OGWA 4EEWA 4F8CB 3QK0A 3KVFB 3DBLI 2XK5B 3W1YA 5JHBA 2FIFA 1WH3A 5IJMA 2BKFA 2MX2A 3IVFA 4AP4C 2CY5A 5DPRA 1TZ1A 1WR1A 4WQOB 1EUVB 3WIMA 5L81A 3S2AA 4FLHA 2XQNM 2NS5A 4DHZB 3R7QA 2P0HA 2LD9A 3DCGA 3TJPA 3WALA 2K8HA 2DX1A 1H10A 2PJHA 1EO6A 1EF1A 3QARA 4HHVA 1WF9A 2J7QB 1NI2A 3LJUX 2R2OA 5JHAA 2ELAA 2ZJDA 2K8BA 4K7SA 2FNJB 2KWCA 4IFSA 4LDTD 1FGZA 3M3JA 2L7RA 2KFKB 1FOEA 3UQAA 4EOYA 3SV1A 2G4DB 4A6FA 4FJZA 2KWVB 1YJ1A 2N7EA 2ZNVC 1RFAA 3ZW3A 2D4QA 2D9YA 4GPTB 3L10B 4HAZB 3W1SA 2NR2A 5AZFA 1X1GA 3JVZX 2ABDA 1RLFA 4CYEA 3A4SC 5CHVC 2DZMA 2ZPNA 2HRJA 3JYUA 2BYFA 2L8JA 3VUXA 4MJSA 4G3XB 1C1YB 1LFDA 1N3HA 2CODA 3BJIA 3H9DA 4FA6A 5CTRC 5C5BA 4HCPB 2EJ8A 2MBEA 2HE7A 3D8FA 3HIZA 1E90A 1WGYA 1XR0B 1AQCA 3QCAA 1UBIA 1WVHA 2MSED 2MW5A 3VTVA 3V62A 3B1LX 4K1RB 4K7UA 2XEWA 4YL8A 4BFRA 4ANWA 3IHPC 2KFJA 1Z5SB 2W2WA 3KZ1A 1XQQA 3SO6A 4GMXB 4DX90 4CHKA 2COAA 2C7HA 4MSQB 3OJ4B 1OEYA 1K8RB 1P0RA 1P1AA 5D7GA 1GC7A 4IM3A 3HK0A 2QKLA 3P2BA 2HTHB 1U2BA 5D2MB 3V60A 1V88A 1IPGA 3LJ3A 3K9PB 5HE3A 3H7PB 2IYBA 3L16A 1NDDA 4EUTA 3C0RB 4HPLB 3H1UA 1FHOA 5C1ZA 1GUAB 2Y5BB 4K2OA 3RD2A 5LOPB 3OANA 3B0AA 4ZRJA 3DBSA 2FUHB 4HAYB 4HB4B 4NAWA 4OVUA 3X23A 4HDQA 3UQBA 3A1QA 3PGEA 1WR6E 1GC6A 3VH4B 2V4LA 1LXDA 1WXSA 3HQCA 1B55A 3DVGX 2K2UA 2LGYA 4IG7B 1OQYA 5DHFB 5JLJB 4W9FA 2ZVOA 4ANXA 4HB0B 1XODA 3NOBA 4BKTA 1Y5OA 2RGFA 1WG7A 1P3QU 1I42A 5C79A 2I5CA 3H7SA 4A5KA 4KIKA 2UYZB 1Q1OA 1UELA 2JT4B 4II2B 4KZCA 4B9KA 4HAUB 3U8ZA 3ZVVA 2GCLA 4HVBA 2KDBA 2LGDA 2YVCA 4ZDVA 1OEYJ 2C9WB 1E8XA 1PMSA 3RCPA 1XD3B 5J18A 3EPYA 4I6PA 4LDTB 3SYXA 3ZNGC 2G4SA 4F7ZA 2RR9A 2YT1A 1LM8B 2DTCA 1Y8RC 3I3TB 3M62B 1TJ6A 2NMBA 2KKCA 3U7DA 2LRUA 1QZEA 4A6FB 1KZGA 2L3ZA 4KDLB 1WI0A 3N3KB 2FCSA 5KQ4A 1DBHA 3D32A 4ICVA 3SUZA 1UEFA 4LJPB 3Q3FA 4GU2A 2QKMA 2ZZPB 3CMMB 5DHAB 3DOWA 2BWES 1DDMA 1EVHA 4XC2A 3RT3B 3V61A 2WX0A 1UNRA 4MJSB 4TV3A 1F9JA 3GZNI 5LXHA 2ADZA 1GJZA 4K7WA 1NTVA 2NCNA 1MK7B 4MDKE 2JF5A 2CHZA 3ZKJC 1MK9B 5DPTA 3ML8A 1P3RA 2YLMA 1V49A 1LB1A 5G2NA 2R2QA 4DDID 4HLEA 4DDGD 1WMHA 4BKSA 3QQ8B 1J19A 1R4NI 2CAYA 3PP2A 3VOQA 4J6IA 3HM6X 2KDFB 3WAMA 3CSFA 2UZRA 4IOYX 5DI9B 3MDBC 3WANA 2LULA 1WE6A 4TQ0A 5LXIB 2YT0A 1W1HA 3L13A 5FI1A 2D9XA 3KUCB 3TBLD 3AULA 2MBQA 2YSZA 1KOTA 2MP2B 2GCJA 1BAKA 4AJYB 2Y8GA 2LASA 1V5MA 3O65B 2DYNA 2DX5B 4I6LB 4MGKE 4MGIE 2FDQA 3A8PA 1AARA 2KLGA 2MQJA 5J2RA 1Q5WB 2N1WA 1WYWB 2GBJA 2DYMA 3UZTA 3JSVA 4W9HA 3PHWB 5J17A 4NAWB 2W2XD 1V81A 1U27A 1MIXA 2XBBC 1U29A 4II3B 4BVUC 3VDZA 1J0WA 3ML9A 2NPTB 2GJYA 3PRMB 1EGXA 2MDXA 1OMWA 3PRPB 4KV2A 2CR5A 2BWFA 2D9VA 2LVQA 2DHJA 3ZIMA 3GYOA 2MWSB 1PQSA 3PVWA 2BPSA 2MBHA 3DBHI 4IAPA 2KWUB 3K9OB 4HK2A 4CO7A 2EMSA 3TIXA 4GDKA 2KX3A 2M14A 2L05A 4KIKB 3PREA 3D8DA 1V89A 3KW5B 2BKRB 2IFSA 4ANVA 4FBJB 1Y19B 3OJ3A 3AU5A 2LG1A 1IP9A 1RAXA 3M63B 2J0MA 1BTKA 3L0WB 2O6VD 3PZDA 2KOXA 5C6RA 4F7HA 4NJ6A 3WA0A 4BOSC 3N32A 4JLCA 1GNUA 3KUDB 1WGQA 2DENB 3SDLC 4EZLA 2LUEA 2A4ZA 3UINB 5JZEB 4GN1A 1E8ZA 3M95A 3RULA 2DHKA 2WDTB 1WJNA 2M0XA 3IBEA 5TR5A 4E74A 2KDEB 2KN5A 3JW0X 1WZ3A 4TQ1A 4Y94A 1U5DA 4PS3A 3PHXB 4WAAA 4P7IA 2AYOB 3QAQA 2KJ6A 2YS3A 2KMCA 4RMAA 1X1FA 2MKRA 4HAXB 3T9LA 5CLLB 2YRYA 2BYVE 2RQ1A 2FIDA 2DN6A 1E7UA 2HJ8A 4WSFA 1SE9A 1QC6A 2E2XA 3DXDA 3QIJA 2L0FA 3VUWA 5HE2A 1WMHB 2RPQA 4PYZA 3ODXA 3L08A 3ZLZA 2JRHA 4X57B 4M0WB 2K25A 4MEMA 1UD7A 2L1CA 2CRFA 5DPWA 1YD8U 4RM9A 2IO3B 1U5GA 1E7VA 1V61A 2X18A 3WAPA 4DXAB 4HATB 1UZXB 3W1SC 2WWZA 2JWZA 2DLWA 3F5RA 2RVBB 2L0TA 1OTRB 3Q3JA 5CLQB 2LXAA 3ZO5B 3PVUA 3DXCA 4W9EA 3ULBA 3UIOB 2IBIB 4MT7A 5D3VA 4TUUA 3ZNHB 4MY6A 4HAWB 3RCZA 4EZJA 4ICUA 3JSVB 4W9GA 2FCNA 2GMIC 5E6OA 2AL6A 1FHWA 2KK8A 4WJNA 4MH0E 2N0YA 2MFQA 3GOEA 1EAZA 5L95C 3ALBA 2C60A 4IUMB 1V6EA 4F1SA 1ZSQA 1OY2A 2AWTA 2MP2A 1TXDA 3HHMA 3MTNB 2K2JA 2DX5A 3HM3A 2REXA 1BT0A 2D10A 3CSTA 1EF5A 4B95A 2GS0A 3QWZB 3WAOA 1WI1A 4GDKB 3VUYA 2N9PC 4HAVB 2N4FA 2Z59B 2R09A 2M17A 3AI5A 1QQGA 1I35A 2KVRA 2RSUA 2I5FA 1WIAA 2VSZA 2N9XA 4HB3B 4FULA 5LONB 3O96A 2NPTA 1V2YA 2KHWB 2DAJA 1SHCA 1XX0A 3LDZE 1H8CA 3EC8A 2BGFA 2EMTA 3PV1A 3APCA 2KTRB 1K5DB 1ISNA 2YS5A 4L6EA 4MM3A 4BKGA 1WXAA 2D2QA 1WY8A 5IAAC 4PS7A 2DYOA 2ROZB 3A98B 1U4AA 1KM7A 1FB8A 2FCMA 2G45B 4EZKA 4N9F4 3APFA 2BYEA 3PLUA 2J59M 1E8WA 1WJMA 3ZVRA 5D6JB 2RGNB 2KGXB 2D9ZA 4FJVB 4HJKA 3PRZA 2K00A 2NBUA 4WWNA 1Q67A 1P5TA 1X86A 1NBFC 4PYUA 1E8YA 1BWNA 3ODWA 1XKEA 3TMPB 2H7EA 2N1VA 3V5WA 2KLCA 2PPHA 1TBEA 2KZRA 4A3PA 2C7MB 3ULCA 3KUZA 5KHOA 2JP2A 3CXBB 1ZVRA 1GG3A 5DCNA 3R3MA 4IC7B 1YX6B 5AEKB 1X1MA 4DK5A 3FEHA 1XCGA 3TW1A 1WXMA 2JRIB 3G9WA 2VRWB 3VIAA 2COFA 5FR6A 3PT2B 5FI0A 4D0NB 5D27A 3ZRCA 5JH5C 1RRPB 2K6QA 3R66C 4JQWC 2P8VA 3PS6A 4GOCA 3BY4B 2ASQA 4IM2A 4FHJA 3AXCA 4HXDA 2RUKB 4WJQA 1I7AA 2DAFA 5HKHA 3VXWA 4BBNC 1J8CA 2EC1A 3DVNU 4E3CA 2J0KA 5C16A 4ANUA 4Z2NA 2O2VB 2KX0A 1KI1B 1V5TA 3NZSA 5EDSA 1Q0WB 3KH0A 2COCA 3N30A 2V76A 1FXTB 2LJ5A 2Q13A 2DYQA 2NVUI 1I2HA 1BTNA 3A9KA 3VQIA 2KANA 1WXVA 4PNKA 3NHEB 2G35A 1X11A 1WGUA 4NQLB 4JIOU 4MGZE 2UZSA 4MGYE 3PVLA 2LVPA 2V1YA 3QX1A 2Y8FA 4GIVA 3KY9A 4HPMB 1SGHA 4K81A 2KO3A 3KRWA 4NY0A 4BOZB 3QA8A 3CF6E 5CHWA 2MRPA 5KCVA 3V6EB 5J3YA 2WH5A 3APDA 2RD0A 4GXBA 2R0DA 2KTFA 4EJNA 3A9JB 3TVVA 4CHMA 2OTXA 2K8CA 1WFYA 2LOZA 1WJ1A 2M8SA 2UWQA 3V6CB 2CY4A 4MSMB 3EHVA 2PE9A 5J3TA 2FAZA 4C0AA 3FP5A 2G3QB 4M8MA 2Z0PA 5GOWB 5CX3A 3T06A 2M38A 3U30A 2O6VA 2JUOA 2FCQA 1MKEA 3PTFC 4H8SA 2VRRB 4IM0A 2PZ1A 3NY5A 3KYCD 5E6NA 3RUIB 4ZRKA 3H6NA 1FHXA 3KYDD 2FJ9A 1NTYA 1MG8A 2HD5B 1M94A 4A6HA 5AZGA 1SIFA 2COPA 2KTRA 4FADA 1P6SA 2GOWA 2K1FA 3ZDMC 2J0JA 1T0YA 2C5LC 2KC2A 2LWPA 1TQZA 3DDCB 1Z87A 1FGYA 3MHSD 3RZWC 3N7CA 4IWQA 1DDVA 1J0GA 1P98A 2IY1B 1WM3A 2KJHB 2DKPA 2V3SA 5C23A 1H4RA 2GBKA 2CQUA 1MAIA 2K39A 2KQSA 2MCNB 4ASWC 1DDWA 5KQ1A 2D07B 4KSLC 4BBNF 1Z2MA 2JZ3B 5D94A 1RRBA 3SNHA 2FJLA 5IA7A 1VCBA 4IWPA 3FM8C 2KC1A 1RJ2A 4EFOA 2OJRA 5L83A 2KCJA 2DHZA 4XX5A 2DZIA 2H7DA 1WJUA 4GZUA 4WJ7A 4TYZA 2MBBB 1D3ZA 3UGBB 4NNJB 3HW2B 3TFMA 2C7NB 1ZW7A 3L54A 2JZZA 3ZNID 4XWXA 4GDLA 2DKQA 3BINA 2ZEQA 4G11A 1M7RA 2LKOA 5DH9B 2CU1A 3GYPA 3VH3B 4M8NA 4JL9A 3RZFA 4IW0A 3SD5A 4EMOA 2DHIA 2JY6A 3TCAA 2MWNB 3AU4A 2LYDA 5KHQA 3AJ4A 2YF0A 3FLVA 4HWIB 1AWEA 2WYQA 4KZ0A 3A9KB 4WWOA 3P6AA 4PS8A 2RSGA 1JRUA 1KZ7A 2GBRA 5HE1A 3QHTA 1DYNA 4W9JA 4HB2B 1S1QB 2NBVB 4A6KA 1ZC3B 4B6WA 3KSYA 2OQBA 2YS1A 4Z2MB 1WM2A 1UPRA 3ENEA 1KJTA 2IYDB 4RM8A 3ZTDA 2DZKA 4MK0A 2O2VA 2LGXA 1YX5B 2D3GA 3PPAA 5GMVA 2OOBB 1C3TA 4NPNA 5D3YA 4WVFB 3PSEB 4WJOA 4MELA 2D11A 4DWFA 4CHJA 3OLMD 2ZPYA 4KVGB 2BCJA 2LBBA 1G6JA 1WRDB 2ELBA 4FN2A 2M4NA 1E5WA 2O6VB 4NQKE 4KDIC 1S3SG 2LVOA 2M1MA 3ZRFA 2PE6B 2AEHA 1TTNA 2CHWA 4HCNB 4GSWA 2Z0OA 3A4RA 3MPXA 2IO0B 3RYTA 3VTWA 3PEGA 4F7UP 5DIFB 1W1DA 4GB9A 2JXXA 2KDIA 3A9JA 3DPDA 2RNRB 4G50A 1WGRA 4ZYNA 1V5UA 2KJRA 3VTUA 1XD4A 3PG7A 1ST7A 3UIPB 3VFKA 2P0FA 2I1JA 4BBKA 3ZNZB 2A5UA 2P0DA 3ZUNA 4FJYA 2JVCA 4W9IA 2L00B 1UGMA 3VAWA 1ZC4B 1NU2A 3PLVA 1ZGUB 3CIKA 3QBVB 2B3AA 4KHOA 2L76A 4WWPA 4DHJD 1U5EA 3TO1A 1NTIA 1ZM0A 1PFJA 3OAWA 1V9JA 2CKHB 2LXCA 1P9DU 3M1IB 2KXJA 4KSKC 1HE8A 1UPQA 4KHAA 3X0WA 3IFWB 3NS8A 2IY0B 3B08A 3DBRI 1WJ4A 5J3QA 2WX1A 1FAOA 1WGGA 1PLSA 2ZNVB 2MLBA 2AL3A 2ZCCA 3NSUA 2XK5A 5JP4A 4G0NB 1OQNA 1UH6A 5JHHA 4GDLB 3DVGY 2LOXA 5JHGA 2CS4A 4TKNA 5BO4B 2UVMA 1HB8A 3FSSA 2KQ7A 3DXEA 1R4MI 1V5OA 1TGZB 4W9CA 1ZKHA 4NJ7A 2D9WA 4LJOB 2I1KA 2CHXA 1NVLA 3R7RA 4XZ4A 4KHBB 1M7EA 4ZRIA 5AZHA 5EFXA 4W9LA 5D3WA 1MIZB 2Y7BA 5C5BB 2ZCBA 2KFKA 4KAXB 4DX8A 1DROA 3SHQA 1YQBA 3P7ZA 4A3OA 4HDOA 3EFUA 3WYFB 2ZVNA 3ML4A 2LRWA 2LZ6A 2CB8A 4AWJA 2BF8B 3PSCA 1A5RA 1V80A 4BKSD 2ROVA 2VKIA 3TL5A 4F7GA 1W1GA 3ECIA 5LLIA 3D8EA 2Z0EB 4I6NB 4K2PA 3L17A 2GBNA 4DBGA 4A20A 3QC8B 3MJWA 2L2IA 4LCDE 5G55A 1VD2A 3VHTC 2N9EB 2LI5A 1CMXB 4W9KA 2MA9B 2DZJA 4JGHB 4AOFA 4URKA 3EECA 2W2XC 1LW3A 4PQ0A 1IYFA 1V5PA 2QHOA 3ZDTA 4E71A 5HE0A 2KMAA 2GBMA 1ACAA 1XT9B 3QWMA 3A33B 3A8QA 3ZTCA 3ODOA 4GMVA 3A1QB 2NBWB 3KRXA 2Z0DB 2W9NA 3SU8X 4YONA 5D3XA 2K6DB 1YIWA 5DPSA 2DFKA 4WJPA 2PEAA 4K17A 2HTHA 1WZ0A 2KD0A 2MBOA 1LQBA 4FHKA 1IRSA 4DBBA 1L2NA 3H7PA 4GGQA 1WJ6A 1X05A 3DVNV 5E6PA 1HB6A 1UNQA 4DHJB 1UBQA 4NSWA 2IO1B 3ONSA 3QJZA 1WE7A 3NZUA 2NZ8B 4W9DA 1WX7A 5CHFA 3IG3A 1WX9A 2KNBA 2DA0A 1WGHA 2IZVB 3UF8A 4OVVA 2RLOA 2Z0QA 4IWOA 1WGDA 1MPHA 1UNPA 1WX8A 2DYBA 1L7YA 1HBKA 2KUPA
chains in the Genus database with same CATH superfamily
1N6ZA 2N7DA 2FJUB 3O13A 3T8MA 2IO2B 2N23A 3F0WA 3DQVA 3VVWB 2EKEC 4B6HA 2WXRA 4AUQC 4N58A 2KUQA 2K9XA 1V86A 2HDEA 3U52E 1KLVA 4DHZE 1U5FA 1NVID 1K5GB 2JPHA 4AJWA 4EKUA 1OGWA 1XCQL 3AMZA 4EEWA 4F8CB 3QK0A 3KVFB 3DBLI 2XK5B 4XDDA 3W1YA 5JHBA 2FIFA 1WH3A 5IJMA 1JWMD 2BKFA 2MX2A 3IVFA 4AP4C 2CY5A 5DPRA 1TZ1A 1WR1A 4WQOB 2JU6X 4US9A 1EUVB 5BMHA 4GNKB 3WIMA 5L81A 2WQYB 3S2AA 3DHIC 4FLHA 2XQNM 2NS5A 4DHZB 1D4BA 3R7QA 1TJEA 2PIAA 2P0HA 3N1YC 5LG4B 1L0VB 2LD9A 3DCGA 3TJPA 4L1BA 3WALA 1VR9A 2K8HA 2M0AA 2DX1A 1H10A 3TEZA 1B1ZA 4PT5A 1HZ5A 2PJHA 1EO6A 1EF1A 3QARA 4HHVA 1WF9A 2J7QB 2JZPA 2WU2B 1NI2A 4OZAA 3DHHC 2IJ0A 2WNMA 3KLSX 3LJUX 2R2OA 1I4QA 5JHAA 2KT7A 2ELAA 2ZJDA 2K8BA 4K7SA 2FNJB 2KWCA 4IFSA 4LDTD 3U12A 1FGZA 3M3JA 2L7RA 4YTNB 2KFKB 1FOEA 3UQAA 4EOYA 2KDMA 3AE8B 3SV1A 2G4DB 4A6FA 4FJZA 2KWVB 1YJ1A 2N7EA 2ZNVC 1RFAA 1YQ3B 3ZW3A 2D4QA 2D9YA 4GPTB 3L10B 4HAZB 1VZ6A 2CJOA 3W1SA 2NR2A 5AZFA 1X1GA 4QJ5B 4JWSC 4A8XC 3JVZX 2ABDA 1RLFA 4CYEA 3A4SC 5CHVC 1YQ4B 1XO3A 2DZMA 5G5GA 2ZPNA 2HRJA 1IUEA 3JYUA 1LGRA 4TMAB 2BYFA 2L8JA 4LLGM 3VUXA 1TIFA 4JKFA 4BZAA 4MJSA 3Q2AC 4G3XB 4CQNA 1C1YB 1LFDA 1N3HA 2CODA 3BJIA 3H9DA 4HEA1 4FA6A 5CTRC 5C5BA 4LNNA 4HCPB 2EJ8A 1YN5A 2MBEA 2HE7A 2TSSA 3D8FA 3HIZA 3AM9A 1E90A 1WGYA 1XR0B 1AQCA 1RYJA 1UBIA 3QCAA 2UU7A 1WVHA 1YMHE 2MSED 2MW5A 3U2SC 3AE2B 3VTVA 4MACA 3V62A 3B1LX 4K1RB 3LB8C 4K7UA 2XEWA 4YL8A 4BFRA 1MG4A 4ANWA 3IHPC 2KFJA 1Z5SB 2W2WA 3KZ1A 1XQQA 3SO6A 4GMXB 4DX90 2AX5A 4CHKA 2J4XA 2COAA 2C7HA 4MSQB 3OJ4B 4OZCA 1SB3C 2JYTA 5BYQA 1OEYA 1K8RB 1P0RA 1VLBA 1P1AA 5D7GA 1GC7A 2R61A 4IM3A 2PLPA 3HK0A 2QKLA 3P2BA 4P1BC 3P4PB 2HTHB 2I2YA 2RRFA 1OQRA 1U2BA 5D2MB 3V60A 1DIKA 1V88A 5I2SA 1IPGA 1IGCA 4NJCA 3LJ3A 3K9PB 3CIRB 5HE3A 3H7PB 3W9CB 3R2IA 3B2FA 2IYBA 3L16A 1DYQA 1MHHE 1NDDA 4EUTA 1JRPA 3C0RB 4HPLB 3H1UA 1FHOA 5C1ZA 2V3NA 1GUAB 4LNFA 3R2TA 2Y5BB 4K2OA 3RD2A 5LOPB 2KACA 3OANA 3B0AA 4ZRJA 1E7PB 1NYRA 1OFFA 3DBSA 2FUHB 1ACCA 4HAYB 4HB4B 1QKZA 5EE0A 3RPFC 2VZKB 4NAWA 2W3SA 1ZUD2 4OVUA 3X23A 1WGKA 4HDQA 1JMLA 3UQBA 3A1QA 3ZGZA 3GP7A 3GE8C 3PGEA 1T3QA 1GC6A 1WR6E 1FNUA 2WXNA 3VH4B 4YT0B 3HRDD 4ZHPA 2FBWB 2V4LA 1V8CA 4LNKA 1LXDA 1WXSA 3HQCA 1B55A 3DVGX 4DIXA 2K2UA 2IDYA 2JYEA 1HZ6A 2LGYA 1ZOYB 4IG7B 1M4VA 2FUG1 3AEFB 3MC0B 1RFKA 3MFGA 1OQYA 2CJNA 5DHFB 5JLJB 1N63A 4W9FA 2ZVOA 4ANXA 4HB0B 1XODA 3NOBA 4BKTA 3AEGB 1Y5OA 2RGFA 1WG7A 1P3QU 1I42A 3AECB 1UWMA 1DOYA 5C79A 2I5CA 3H7SA 2WXKA 1FMAD 4A5KA 2KIEA 4KIKA 5FR3A 4ARIA 4J3OD 2XN9C 1HEZE 2UYZB 3SR6A 1Q1OA 1UELA 2JT4B 4II2B 4KZCA 4B9KA 3ZXVA 4JKBA 4HAUB 1GPXA 3U8ZA 3ZVVA 2GCLA 4HVBA 2ICIA 2KDBA 2LGDA 1XLOA 5H92C 1B9RA 2QSDA 2K8EA 2QEJC 2YVCA 4KKIA 2QILA 1FXAA 4ZDVA 1OEYJ 2C9WB 2K49A 2NMQA 1V97A 1K52A 2MHJA 1E8XA 1PMSA 3RCPA 1XD3B 5J18A 4RGMA 3EPYA 3AEEB 4FXCA 4I6PA 4LDTB 1PUTA 3SYXA 3ZNGC 2G4SA 4WIPA 4GOUA 3BYTB 2MJEA 4F7ZA 2RR9A 2YT1A 1LM8B 1TKYA 2DTCA 3NVZA 2YEPF 5MPOA 1Y8RC 3I3TB 3M62B 1TJ6A 3TEXA 2NMBA 3AH7A 1ZXHA 2KKCA 1ZDVA 2INDC 3GS2A 3U7DA 2LRUA 1QZEA 4A6FB 1KZGA 4ILJA 2L3ZA 4KDLB 5M4YB 1WI0A 1E9MA 3N3KB 2B76B 2FCSA 5KQ4A 1DBHA 3D32A 4ICVA 3KQ4A 3SUZA 1UEFA 1I4HA 2JWUA 4LJPB 4DXFA 3Q3FA 4GU2A 2QKMA 2ZZPB 3CMMB 5DHAB 3DOWA 2BWES 1DDMA 1EU3A 1EVHA 2WHIA 4XC2A 1L0XB 3RT3B 1SJHD 2WX0A 3V61A 4YSZB 1UNRA 4ZRPA 4MJSB 2KR0A 3Q3OC 4TV3A 1YNTE 5BYRA 4Q2JA 1F9JA 3GZNI 5LXHA 2X0SA 2ADZA 3AE9B 1GJZA 4K7WA 1NTVA 2NCNA 1MK7B 2JF5A 4MDKE 2CHZA 3ABVB 3ZKJC 1MK9B 5DPTA 3ML8A 4P16A 1P3RA 2YLMA 3Q8AA 5IO9A 1JQ4A 1V49A 1LB1A 5G2NA 4XE0A 2R2QA 4DDID 3E9PA 4HLEA 2QCZA 3AE7B 4DDGD 1WMHA 4BKSA 3QQ8B 1J19A 1R4NI 3N9YC 3NS1A 5BYSA 1EWYC 2CAYA 3PP2A 3VOQA 4J6IA 3HM6X 2KDFB 3WAMA 4OW0A 2BB5A 3CSFA 2UZRA 3HVZA 4IOYX 5DI9B 3MDBC 3WANA 3WCQA 2LULA 3DBRB 1WE6A 4TQ0A 5LXIB 2YT0A 2QC8A 1W1HA 3L13A 5FI1A 2D9XA 1ZXIA 4L23A 3KUCB 3TBLD 3AULA 2D5GA 2VH1A 4AS1A 2MBQA 2YSZA 1TZOA 1KOTA 2MP2B 2GCJA 1BAKA 1YJIA 4AJYB 2Y8GA 2LASA 1V5MA 3O65B 2DYNA 2DX5B 5IN7A 4I6LB 4MGKE 2V3PA 4MGIE 2FDQA 5IP4D 1R4MB 4LNIA 1TS4A 3A8PA 3Q14C 3NW8A 1AARA 2KLGA 2MQJA 5J2RA 1Q5WB 1D5ZC 1SE3A 2N1WA 1WYWB 2GBJA 2DYMA 3UZTA 2BB6A 3C19A 2KWDA 3JSVA 4W9HA 3PHWB 5J17A 4NAWB 3KWLA 2W2XD 3P63A 1V81A 1U27A 4IDIA 1MIXA 1WRIA 2XBBC 1U29A 4II3B 3LYYA 4BVUC 3VDZA 1J0WA 3ML9A 2NPTB 2ACZB 2GJYA 2M19A 3PRMB 2QIEB 1EGXA 2MDXA 1OMWA 3VRBB 4YSXB 3PRPB 4KV2A 1KH0A 2CR5A 2BWFA 1UF0A 2D9VA 2LVQA 2WXLA 2DHJA 1YJJA 3ZIMA 5HHDG 1FNVA 1NYQA 2KVZA 3GYOA 2MWSB 1PQSA 3PVWA 2BPSA 3SEBA 3TEWA 2YT2A 1FPYA 1BMLC 2LMCA 2MBHA 1F2RC 1KTKA 3DBHI 4GLSC 4IAPA 2KWUB 3K9OB 4HK2A 4CO7A 4BAXA 2EMSA 3NWDA 3TIXA 3ZQ4A 2MEKA 4GDKA 3P1MA 2KX3A 2M14A 2L05A 4KIKB 3PREA 1ET6A 3D8DA 3U7ZA 1V89A 4MM3B 3KW5B 1JWBD 2BKRB 2IFSA 4ANVA 4FBJB 2Z59A 1Y19B 3OJ3A 1AW7A 3AU5A 2LG1A 1IP9A 1RAXA 3M63B 4QJ4B 2J0MA 1BTKA 5EE9A 3L0WB 2O6VD 4JPSA 1RM6C 1UWXA 3PZDA 2KOXA 5C6RA 4F7HA 1HA5A 4NJ6A 3WA0A 3TEYA 1N60A 4BOSC 2E6XA 3N32A 2WLBA 2GLSA 1Q10A 4JLCA 1GNUA 3KUDB 2GUMA 1WGQA 2DENB 3SDLC 4EZLA 2LUEA 2A4ZA 3UINB 5JZEB 2BYTA 3FILB 1D5MC 4GN1A 1FIQA 1E8ZA 3M95A 3MHZA 3RULA 2DHKA 1J7BA 1WJNA 2M0XA 2WDTB 3IBEA 3Q8CA 5TR5A 4E74A 2KDEB 2LJIA 2KN5A 3JW0X 1WZ3A 4TQ1A 4Y94A 1U5DA 1GB4A 4PS3A 4K3BA 3HSAA 4B0EA 3PHXB 2PVOD 3HIEA 4WAAA 4P7IA 3P4QB 2AYOB 3QAQA 4M00A 2PVGC 2KJ6A 2YS3A 4OVZA 2KMCA 2INCC 4MT5A 4RMAA 1X1FA 2MKRA 2PMVA 4JKEA 4HAXB 4DQOC 3T9LA 5CLLB 2YRYA 2BYVE 2RQ1A 4R3DA 2FIDA 1FFVA 1HTOA 2WDRB 1RWSA 1Y56A 2NTSA 2Y3AA 2DN6A 1E7UA 2HJ8A 3N20C 4WSFA 3B2GA 1SE9A 1QC6A 2E2XA 3DXDA 3QIJA 3RNGC 2L0FA 3VUWA 5HE2A 1FO4A 1WMHB 2RPQA 4PYZA 2OJWA 3ODXA 2LGSA 1ET9A 2L52A 3L08A 1PFDA 3ZLZA 2IGGA 2JRHA 4X57B 4M0WB 4RNAA 2K25A 4MEMA 1UD7A 4KX6B 4KGSA 3AE6B 2L1CA 1XEEA 2CRFA 1OQQA 3ZYYX 5DPWA 1YD8U 1YOVB 4RM9A 2IO3B 1FCCC 2J53A 5IOIA 1U5GA 1E7VA 1V61A 2X18A 1I4XA 3NRZA 1XXGA 3WAPA 3CWIA 4DXAB 4HATB 2BS4B 2BTEA 1UZXB 3RNFC 3W1SC 1TY2A 2Z14A 2WWZA 3Q69A 2JWZA 1N5WA 2DLWA 1MPEA 3F5RA 2RVBB 2RDGA 3Q6BA 3NVWA 2L0TA 1OTRB 3Q3JA 5CLQB 2LXAA 3ZO5B 3PVUA 5JVLA 3DXCA 4W9EA 3ULBA 1R7SA 4MH8A 3UIOB 1A70A 1ENFA 2IBIB 2SAKA 4MT7A 1KFYB 5D3VA 3NVYA 1C4PA 3I63C 3EUB2 4TUUA 3ZNHB 2QDFA 4MY6A 3E56A 4XWTA 4HAWB 1GOZA 1PGXA 3BVMA 3RCZA 3FVCA 1E0ZA 3RI7C 4EZJA 3L4PA 1TS2A 4ICUA 5HI1A 4ILHA 3JSVB 4W9GA 2FCNA 2GMIC 5E6OA 3HUIA 2AL6A 1FHWA 2KK8A 2WDVB 4WJNA 4MH0E 2N0YA 2MFQA 2XNAC 2INPE 3ENBA 1T5XD 3BZDB 1N5XA 1T0RC 3GOEA 1EAZA 3AEDB 5L95C 3ALBA 2C60A 4PK1A 4ILGB 4HROA 4IUMB 1V6EA 4REZA 4F1SA 1QOAA 1ZSQA 4C00A 1CZPA 4D6WA 1SE2A 1OY2A 2AWTA 2MP2A 3GE3C 1TXDA 3HHMA 3MTNB 1ZE3D 2K2JA 2DX5A 3HM3A 2KYWA 2REXA 2KQ4X 1TS3A 2WXJA 1BT0A 2D10A 3SBGA 3CSTA 1EF5A 3AN1A 4B95A 4S17A 2GS0A 2BQQA 3QWZB 3WAOA 3J9CA 2WXQA 1WI1A 4GDKB 3VUYA 4ARCA 3NWFA 1KF6B 3PZ8A 2N9PC 3NWAA 4HAVB 2RMMA 4C7ZA 2N4FA 4L2YA 2Z59B 1FEHA 2R09A 2M17A 4TSSA 3AI5A 4YWGG 1QQGA 1I35A 2KVRA 1VRAB 2RSUA 2Z8LA 2I5FA 1WIAA 2VSZA 1V1PA 3SBTA 2N9XA 4HB3B 5BMIA 4FULA 1TS5A 5LONB 4JWUC 3O96A 1QILA 5T8IA 2NPTA 1F0ZA 1V2YA 2AQ3B 2KHWB 3URYA 2DAJA 3ZJUA 1P7FA 1SHCA 1MI0A 4DXGA 4USAA 1XX0A 3LDZE 2HJ1A 1GGOA 1H8CA 3EC8A 2BGFA 3B9JA 4ZHOA 2EMTA 3PV1A 3APCA 2KTRB 1MJDA 4WAFA 5C2TB 1K5DB 1ISNA 3VR8B 2QJLA 2YS5A 1XF5L 4JKGB 4L6EA 1JCKB 4MM3A 4BKGA 1WXAA 5GXGB 3ZJTA 2D2QA 1WY8A 5IAAC 4PS7A 2DYOA 2ON8A 2ROZB 3A98B 1U4AA 4C7YA 4C80A 1KM7A 5FK9C 1FB8A 2FCMA 1IBXB 4HPPA 2G45B 4EZKA 4N9F4 3APFA 2BYEA 3PLUA 1ZDXA 2J59M 1IGDA 4WURA 5C3JB 3V05A 3Q3NC 1E8WA 1WJMA 3ZVRA 5D6JB 4RGOS 1E10A 2RGNB 2KGXB 1N62A 4NZLB 2D9ZA 1DOIA 4FJVB 4HJKA 2ZW0A 3PRZA 2K00A 4B0MA 2NBUA 4WWNA 4XWWA 4HSIA 1Q67A 3IXSA 1P5TA 1C78A 1X86A 1NBFC 1HXYD 4PYUA 4D2KA 1E8YA 1BWNA 3ZJVA 4HRSA 3ODWA 3FILA 1XKEA 3TMPB 2H7EA 1QF6A 2N1VA 2INNE 3V5WA 1QOBA 3NUHB 3BK1A 2KLCA 2PPHA 1TBEA 2KZRA 5FKAC 3C8YA 4A3PA 1BUIC 2V0GA 2C7MB 1SXTA 3DCXA 3ULCA 3RN9C 3FC4A 2V9HA 3U4EG 3KUZA 5KHOA 2JP2A 3CXBB 1ZVRA 1XCTL 2BS2B 1C4AA 1GG3A 5DCNA 3R3MA 4IC7B 1CK1A 1YX6B 5AEKB 2KIGA 4XGAB 3LXFA 1X1MA 4DK5A 2MJDA 3FEHA 1XCGA 2KN4A 4WQMA 3AB5A 3TW1A 1WXMA 2JRIB 3G9WA 2VRWB 3VIAA 3A58A 2COFA 5FR6A 3EGRA 1MHXA 1ZYIA 3PT2B 5FI0A 4D0NB 1QQRA 5D27A 3ZRCA 4LNOA 5JH5C 1RRPB 1FD6A 1MVKA 2K6QA 3R66C 4JQWC 2P8VA 3PS6A 1DOXA 1I4PA 4GOCA 3BY4B 1SE4A 2ASQA 4IM2A 1I4GA 3N1XC 4FHJA 4US8A 4KGRA 3AXCA 4HXDA 2RUKB 2OHFA 2LFIA 4RF0A 2V4IB 4WJQA 1F77A 4M0WA 1XLNA 2LHEA 1I7AA 2DAFA 5HKHA 3VXWA 4QXAB 1J7AA 4BBNC 1K50A 1J8CA 2DWQA 2EC1A 1GAQB 3DVNU 4E3CA 2J0KA 5C16A 1SSNA 4ANUA 2N0SB 4Z2NA 2O2VB 4JKDA 2KX0A 3R8BA 1KI1B 2WXMA 1V5TA 3NZSA 5EDSA 1L6UA 1Q0WB 1L5PA 1L4ZB 1WWTA 2KAJA 2COCA 2WU5B 3KH0A 3N30A 2V76A 3NVVA 1FXTB 2WXOA 2LJ5A 5AUIA 2Q13A 1D5XC 1TY0A 2DYQA 2LUMA 4HKQA 2NVUI 1I2HA 1L0YB 1BTNA 3A9KA 3VQIA 2KANA 1WXVA 4PNKA 3NHEB 3E66A 3MC8A 2G35A 1LO5D 1X11A 1WGUA 4YSYB 4NQLB 4C56C 4JIOU 4MGZE 2UZSA 2X38A 1VBGA 4MGYE 2NBVA 3PVLA 2LVPA 2V1YA 3QX1A 2Y8FA 1L6VA 4GIVA 3KY9A 1KBLA 4HPMB 1SGHA 3AEBB 4K81A 1AN8A 2KO3A 3KRWA 3OG5A 4NY0A 1V1PB 3PO0A 4BOZB 3GZNB 3QA8A 1K53A 2DIKA 4LTUA 3CF6E 2H88B 5CHWA 1GB1A 2MRPA 5KCVA 3V6EB 5J3YA 2WH5A 4YTMB 3APDA 2EKIA 3UI3A 2RD0A 4GXBA 2R0DA 1CQVA 1R4NB 2BT6A 4ITKA 2KTFA 4EJNA 3A9JB 4AQ7A 3TVVA 2MH7A 4CHMA 2OTXA 2K8CA 1WFYA 2LOZA 1WJ1A 2M8SA 2UWQA 3V6CB 2CY4A 4MSMB 5IRSA 3EHVA 3AEAB 2PE9A 5J3TA 2FAZA 4C0AA 3FP5A 1NENB 1WXQA 2G3QB 4YXDB 4UDUC 4WWMA 4M8MA 2Z0PA 5GOWB 5CX3A 3T06A 2M38A 3RMKC 2O6VA 3U30A 2JUOA 2FCQA 1MKEA 3PTFC 3Q8FA 4H8SA 2I38A 2VRRB 2H89B 2PZ1A 4IM0A 3NY5A 3KYCD 1I7HA 5E6NA 3RUIB 4ZRKA 1JWAD 1FRDA 2DNFA 1UGJA 2L83A 2PTLA 1FXIA 2VH2A 3AE5B 3H6NA 1SF0A 4IKGA 5JXVA 1FHXA 4N59A 3KYDD 1FFUA 2BVCA 2EELA 3IAM1 2WXPA 3W2DA 2FJ9A 2RPVA 4HKZE 1NTYA 3NG0A 1MG8A 2HD5B 1M94A 4A6HA 5AZGA 1SIFA 2COPA 2KTRA 2K3UA 2J52A 3P42A 4FADA 1P6SA 2GOWA 2K1FA 2Y5CA 3ZDMC 2J0JA 2VZKD 1T0YA 2C5LC 2KC2A 2LWPA 2K0PA 4JKGA 1AWDA 2N7JA 2D3CA 1TQZA 1EU4A 1Z87A 3DDCB 1FGYA 3MHSD 3HVDA 3RZWC 3N7CA 4IWQA 1DDVA 4P6VF 3OHMB 1J0GA 1P98A 2QMTA 1IBXA 2IY1B 1WM3A 4XDCA 5G5HA 1JROA 2KJHB 4N6EB 1EM7A 2DKPA 2V3SA 4RCOA 5C23A 3RFZB 1H4RA 4IOIE 2HTME 2J42A 2GBKA 2CQUA 2D3BA 1MAIA 2K39A 2KQSA 3RNBC 2MCNB 1MI1A 1QOGA 3DBHB 3Q8EA 4ASWC 2JQRB 1PGBA 1ESFA 1DDWA 1K51A 5KQ1A 2D07B 2N9LA 4JKHA 4KSLC 4BBNF 2BW2A 2SEBD 2WDQB 1Z2MA 2JZ3B 2Z4DA 4JK9A 5D94A 1RRBA 3SNHA 2FJLA 5IA7A 1VCBA 4IWPA 2ZW1A 3FM8C 2KC1A 1RJ2A 1DGJA 2OJRA 4EFOA 5L83A 2KCJA 2DHZA 2L1AA 1TKEA 3MJ5A 1I4RA 4RH6A 4XX5A 2DZIA 2H7DA 1WJUA 4GZUA 4WJ7A 4TYZA 2K5PA 1F2RI 1JWUD 1PYWD 2MBBB 3P4SB 3T3OA 1D3ZA 3UGBB 5I2MA 4NNJB 3HW2B 1SBBB 3TFMA 2C7NB 3FAHA 1ZW7A 3N1ZC 3L54A 2JZZA 3ZNID 4XWXA 4GDLA 2DKQA 1YN4A 3BINA 2ZEQA 4G11A 5D3IB 1M7RA 3BVZA 2LKOA 5DH9B 2OEDA 2CU1A 3GYPA 3VH3B 1KLGD 1FM0D 4M8NA 4JL9A 4OZBA 1C76A 3IT6B 3RZFA 4IW0A 3DBLB 3SD5A 3I9V1 1HTQA 4EMOA 4ZOHC 2DHIA 1CJEA 2JY6A 3TCAA 2MWNB 3AU4A 2LYDA 4KKJA 5KHQA 4A9AA 3AJ4A 2YF0A 3FLVA 4KHBA 4HWIB 1AWEA 2WYQA 2WXHA 3RNCC 2W82A 4KZ0A 3A9KB 4WWOA 3P6AA 4PS8A 4ACFA 2IGHA 2RSGA 1JRUA 4H2AA 1KZ7A 2GBRA 4C4VA 5HE1A 3QHTA 4OT1A 2WP9B 1DYNA 2DBYA 4W9JA 4HB2B 1QLBB 1S1QB 2NBVB 4A6KA 1ZC3B 2GI9A 3P4RB 4B6WA 3KSYA 2OQBA 4RF1A 4QJ3B 2YS1A 4Z2MB 2NTTA 1WM2A 2RDHA 1UPRA 2PKOA 1KRHA 3ENEA 2AQ2B 1JWSD 1KJTA 2IYDB 4RM8A 1FRRA 2WXGA 3ZTDA 2DZKA 4MK0A 2KMMA 2O2VA 2LGXA 1YX5B 1KC7A 2D3GA 3E9OA 2WS3B 3PPAA 5GMVA 3VRAB 4A6QA 2OOBB 2IPKD 1C3TA 3H8HA 4NPNA 5D3YA 4WVFB 3PSEB 4WJOA 3DHGC 4MELA 4JE3B 1SJED 2AQ1B 2D11A 2D3AA 4DWFA 3W5VB 4CHJA 1T0QC 3OLMD 2ZPYA 4KVGB 4WH4A 2BCJA 2LBBA 1TKGA 2RDBC 1G6JA 1WRDB 3AE1B 2ELBA 4FN2A 5EE1A 2M4NA 1E5WA 2BBCA 2O6VB 4NQKE 5I4DA 4KDIC 1S3SG 2E3TA 2LVOA 3DWMA 2M1MA 3ZRFA 2PE6B 2AEHA 2MJ3A 1TTNA 2CHWA 4HCNB 4GSWA 2K22A 2Z0OA 1T6BX 3A4RA 3MPXA 2IO0B 3OWEB 3RYTA 3VTWA 3PEGA 4F7UP 5DIFB 1W1DA 4GB9A 2JXXA 2GRIA 2KDIA 3A9JA 3DPDA 1BXTA 2RNRB 2PW9A 4LK0M 4G50A 1WGRA 4ZYNA 1V5UA 3BYYB 4JK8A 2KJRA 2G9HD 3VTUA 1XD4A 3PG7A 2CU3A 1ST7A 3UIPB 4ZRQA 1VZ7A 3VFKA 2P0FA 2I1JA 4BBKA 3ZNZB 2WGSA 4JK7A 1F1HA 2P0DA 2A5UA 3ZUNA 2R2YA 4O1NA 4FJYA 2LHDA 2JVCA 4W9IA 3BVGA 2L00B 1UGMA 4OSNA 3VAWA 1ZC4B 1NU2A 3TUOA 3PLVA 1ZGUB 1WSPA 3TSSA 3CIKA 3QBVB 2B3AA 4KHOA 1C4CA 2L76A 4A55A 4WWPA 4RGTA 4DHJD 1SEBD 1U5EA 1NEKB 3TO1A 1EWCA 2W55A 1J7CA 4OHJA 1NTIA 1V1OA 1ZM0A 1PFJA 4P1CC 3W5UB 3EA6A 3OAWA 1TT5B 1V9JA 2CKHB 2LXCA 1P9DU 1ZPSA 3M1IB 2KXJA 1VBHA 4KSKC 1HE8A 5AUKA 1UPQA 4KHAA 3ETRA 3X0WA 3IFWB 3NS8A 2IY0B 4EE2A 3B08A 3I5JC 3DBRI 5TSSA 1WJ4A 5J3QA 2WX1A 1FAOA 1WGGA 1UUPA 1PLSA 2ZNVB 3FKYA 2MLBA 4M01A 2AL3A 4JKAA 2ZCCA 3NSUA 2XK5A 1VZ8A 5JP4A 4G0NB 1OQNA 2JSVX 1UH6A 5JHHA 5D3DA 5H8YE 4GDLB 4CSQA 3DVGY 4QAYA 3NJTA 4XYCA 2LOXA 5JHGA 2CS4A 1ROEA 4TKNA 1QOFA 2YEPB 5BO4B 2UVMA 1HB8A 3BIID 3FSSA 2KQ7A 3DXEA 2ONQA 1R4MI 1V5OA 1TGZB 4W9CA 1ZKHA 3PZ7A 4NJ7A 2D9WA 1N61A 4LJOB 1C79A 2FE8A 2I1KA 3V3XA 1QT9A 5HFYA 2CHXA 2ZKMX 1HQRD 1NVLA 3R7RA 4XZ4A 2G1EA 4KHBB 1M7EA 4ZRIA 1C9FA 4S0RA 5AZHA 5EFXA 4W9LA 4KGTA 5IKCM 5D3WA 1MIZB 4C4VB 2Y7BA 1D6EC 5C5BB 3KWVA 2W3RA 2BS3B 2ZCBA 3E9LA 3B77A 3EFCA 1T77A 2KFKA 2LEKA 4KAXB 4DX8A 1DROA 2R82A 3SHQA 1C77A 1YQBA 3P7ZA 4A3OA 4HDOA 4RGNA 3EFUA 3WYFB 2ZVNA 3ML4A 2LRWA 2LZ6A 2CB8A 4AWJA 2BF8B 3PSCA 1A5RA 1XLQA 1V80A 1JDEA 4BKSD 2ROVA 2VKIA 3AE4B 2X8XX 4F7GA 3TL5A 1W1GA 5BMGA 2L32A 1SIJA 3ECIA 2GB1A 1FCLA 5LLIA 3D8EA 2Z0EB 4I6NB 1JALA 4K2PA 3L17A 2GBNA 2JX5A 1YN3A 4DBGA 4A20A 3AE3B 3RNEC 1E6EB 4A90A 1JW9D 3QC8B 1STEA 3MJWA 4YTPB 2L2IA 1NI3A 3BWUD 1VD2A 4LCDE 5G55A 3VHTC 3Q3MC 1P7EA 2N9EB 5HG2A 3SFDB 2LI5A 1CMXB 2WXIA 3AV8A 1FNWA 4W9KA 2MA9B 3Q8BA 2DZJA 4JGHB 4AOFA 1VDVA 4URKA 3EECA 2W2XC 4K3CA 1LW3A 4PQ0A 1IYFA 1V5PA 3NZ3A 2Y5PA 2QHOA 3DWGC 3ZDTA 5E6JA 2N9KA 5EE3A 4E71A 1UNSA 3I57A 1XLPA 5HE0A 2KMAA 2IGDA 2GBMA 1ACAA 2WXFA 1XT9B 3QWMA 3IT4B 1ZP0B 3A33B 3A8QA 3ZTCA 3ODOA 4GMVA 3A1QB 2NBWB 3KRXA 2Z0DB 2W9NA 3SU8X 4YONA 4NAMA 2Z13A 5D3XA 2JXTA 2K6DB 1YIWA 5DPSA 2DFKA 4WJPA 1KLUD 2PEAA 4K17A 4JX1C 2HTHA 1WZ0A 4M02A 2KD0A 3MP9A 3ZXRA 2MBOA 4JKCA 1LQBA 4FHKA 1IRSA 1PDXA 4DBBA 3IAS1 1L2NA 3H7PA 2LGIA 4GGQA 1WJ6A 1AYFA 1X05A 1TYGB 2W54A 2M56B 1HB6A 3DVNV 1UNQA 5E6PA 4DHJB 1VJKA 1UBQA 4NSWA 4HJGE 2IO1B 3ONSA 1T0SC 3GB1A 3QJZA 4ZYSA 1WE7A 3NZUA 1L4DB 1MFWA 1WYGA 2NZ8B 5LNK1 3SFEB 4W9DA 1WX7A 5CHFA 2DLBA 3IG3A 1WX9A 2KNBA 2DA0A 1WGHA 2IZVB 3UF8A 2Q5WD 4OVVA 2RLOA 2Z0QA 1F52A 4IWOA 1WGDA 1MPHA 1UNPA 3RNAC 1WX8A 3T3NA 2DYBA 4L1RA 3BK2A 3VR9B 1L7YA 4RFBA 1HBKA 3MC9A 3E9SA 1PGAA 2KUPA
chains in the Genus database with same CATH topology
2N7DA 3T8MA 2IO2B 2N23A 3F0WA 3DQVA 3VVWB 2EKEC 4B6HA 4AUQC 1V86A 1KLVA 4DHZE 1U5FA 1K5GB 2JPHA 4AJWA 4EKUA 1OGWA 4EEWA 4F8CB 3QK0A 3KVFB 3DBLI 2XK5B 3W1YA 5JHBA 2FIFA 1WH3A 5IJMA 2BKFA 2MX2A 3IVFA 4AP4C 2CY5A 5DPRA 1TZ1A 1WR1A 4WQOB 1EUVB 3WIMA 5L81A 3S2AA 4FLHA 2XQNM 2NS5A 4DHZB 3R7QA 2P0HA 2LD9A 3DCGA 3TJPA 3WALA 2K8HA 2DX1A 1H10A 2PJHA 1EO6A 1EF1A 3QARA 4HHVA 1WF9A 2J7QB 1NI2A 3LJUX 2R2OA 5JHAA 2ELAA 2ZJDA 2K8BA 4K7SA 2FNJB 2KWCA 4IFSA 4LDTD 1FGZA 3M3JA 2L7RA 2KFKB 1FOEA 3UQAA 4EOYA 3SV1A 2G4DB 4A6FA 4FJZA 2KWVB 1YJ1A 2N7EA 2ZNVC 1RFAA 3ZW3A 2D4QA 2D9YA 4GPTB 3L10B 4HAZB 3W1SA 2NR2A 5AZFA 1X1GA 3JVZX 2ABDA 1RLFA 4CYEA 3A4SC 5CHVC 2DZMA 2ZPNA 2HRJA 3JYUA 2BYFA 2L8JA 3VUXA 4JKFA 4MJSA 4G3XB 1C1YB 1LFDA 1N3HA 2CODA 3BJIA 3H9DA 4FA6A 5CTRC 5C5BA 4HCPB 2EJ8A 2MBEA 2HE7A 3D8FA 3HIZA 1E90A 1WGYA 1XR0B 1AQCA 3QCAA 1UBIA 1WVHA 2MSED 2MW5A 3VTVA 3V62A 3B1LX 4K1RB 4K7UA 2XEWA 4YL8A 4BFRA 4ANWA 3IHPC 2KFJA 1Z5SB 2W2WA 3KZ1A 1XQQA 3SO6A 4GMXB 4DX90 4CHKA 2COAA 2C7HA 4MSQB 3OJ4B 1OEYA 1K8RB 1P0RA 1P1AA 5D7GA 1GC7A 4IM3A 3HK0A 2QKLA 3P2BA 2HTHB 1U2BA 5D2MB 3V60A 1DIKA 1V88A 1IPGA 3LJ3A 3K9PB 5HE3A 3H7PB 2IYBA 3L16A 1NDDA 4EUTA 3C0RB 4HPLB 3H1UA 1FHOA 5C1ZA 1GUAB 2Y5BB 4K2OA 3RD2A 5LOPB 3OANA 3B0AA 4ZRJA 3DBSA 2FUHB 4HAYB 4HB4B 4NAWA 4OVUA 3X23A 4HDQA 3UQBA 3A1QA 3PGEA 1WR6E 1GC6A 3VH4B 2V4LA 1LXDA 1WXSA 3HQCA 1B55A 3DVGX 2K2UA 2LGYA 4IG7B 1OQYA 5DHFB 5JLJB 4W9FA 2ZVOA 4ANXA 4HB0B 1XODA 3NOBA 4BKTA 1Y5OA 2RGFA 1WG7A 1P3QU 1I42A 5C79A 2I5CA 3H7SA 4A5KA 4KIKA 2UYZB 1Q1OA 1UELA 2JT4B 4II2B 4KZCA 4B9KA 4JKBA 4HAUB 3U8ZA 3ZVVA 2GCLA 4HVBA 2KDBA 2LGDA 2YVCA 4ZDVA 1OEYJ 2C9WB 1E8XA 1PMSA 3RCPA 1XD3B 5J18A 3EPYA 4I6PA 4LDTB 3SYXA 3ZNGC 2G4SA 4F7ZA 2RR9A 2YT1A 1LM8B 2DTCA 1Y8RC 3I3TB 3M62B 1TJ6A 2NMBA 2KKCA 3U7DA 2LRUA 1QZEA 4A6FB 1KZGA 4ILJA 2L3ZA 4KDLB 1WI0A 3N3KB 2FCSA 5KQ4A 1DBHA 3D32A 4ICVA 3SUZA 1UEFA 4LJPB 3Q3FA 4GU2A 2QKMA 2ZZPB 3CMMB 5DHAB 3DOWA 2BWES 1DDMA 1EVHA 4XC2A 3RT3B 3V61A 2WX0A 1UNRA 4MJSB 4TV3A 1F9JA 3GZNI 5LXHA 2X0SA 2ADZA 1GJZA 4K7WA 1NTVA 2NCNA 1MK7B 4MDKE 2JF5A 2CHZA 3ZKJC 1MK9B 5DPTA 3ML8A 1P3RA 2YLMA 1V49A 1LB1A 5G2NA 2R2QA 4DDID 3E9PA 4HLEA 4DDGD 1WMHA 4BKSA 3QQ8B 1J19A 1R4NI 2CAYA 3PP2A 3VOQA 4J6IA 3HM6X 2KDFB 3WAMA 3CSFA 2UZRA 4IOYX 5DI9B 3MDBC 3WANA 2LULA 1WE6A 4TQ0A 5LXIB 2YT0A 1W1HA 3L13A 5FI1A 2D9XA 3KUCB 3TBLD 3AULA 2MBQA 2YSZA 1KOTA 2MP2B 2GCJA 1BAKA 4AJYB 2Y8GA 2LASA 1V5MA 3O65B 2DYNA 2DX5B 4I6LB 4MGKE 4MGIE 2FDQA 3A8PA 1AARA 2KLGA 2MQJA 5J2RA 1Q5WB 2N1WA 1WYWB 2GBJA 2DYMA 3UZTA 3JSVA 4W9HA 3PHWB 5J17A 4NAWB 2W2XD 1V81A 1U27A 1MIXA 2XBBC 1U29A 4II3B 4BVUC 3VDZA 1J0WA 3ML9A 2NPTB 2GJYA 3PRMB 1EGXA 2MDXA 1OMWA 3PRPB 4KV2A 2CR5A 2BWFA 2D9VA 2LVQA 2DHJA 3ZIMA 3GYOA 2MWSB 1PQSA 3PVWA 2BPSA 2MBHA 3DBHI 4IAPA 2KWUB 3K9OB 4HK2A 4CO7A 2EMSA 3TIXA 4GDKA 2KX3A 2M14A 2L05A 4KIKB 3PREA 3D8DA 1V89A 3KW5B 2BKRB 2IFSA 4ANVA 4FBJB 1Y19B 3OJ3A 3AU5A 2LG1A 1IP9A 1RAXA 3M63B 2J0MA 1BTKA 3L0WB 2O6VD 3PZDA 2KOXA 5C6RA 4F7HA 4NJ6A 3WA0A 4BOSC 3N32A 4JLCA 1GNUA 3KUDB 1WGQA 2DENB 3SDLC 4EZLA 2LUEA 2A4ZA 3UINB 5JZEB 4GN1A 1E8ZA 3M95A 3RULA 2DHKA 2WDTB 1WJNA 2M0XA 3IBEA 5TR5A 4E74A 2KDEB 2KN5A 3JW0X 1WZ3A 4TQ1A 4Y94A 1U5DA 4PS3A 3PHXB 4WAAA 4P7IA 2AYOB 3QAQA 2KJ6A 2YS3A 2KMCA 4RMAA 1X1FA 2MKRA 4JKEA 4HAXB 3T9LA 5CLLB 2YRYA 2BYVE 2RQ1A 2FIDA 2DN6A 1E7UA 2HJ8A 4WSFA 1SE9A 1QC6A 2E2XA 3DXDA 3QIJA 2L0FA 3VUWA 5HE2A 1WMHB 2RPQA 4PYZA 3ODXA 3L08A 3ZLZA 2JRHA 4X57B 4M0WB 2K25A 4MEMA 1UD7A 2L1CA 2CRFA 5DPWA 1YD8U 4RM9A 2IO3B 1U5GA 1E7VA 1V61A 2X18A 3WAPA 4DXAB 4HATB 1UZXB 3W1SC 2WWZA 2JWZA 2DLWA 3F5RA 2RVBB 2L0TA 1OTRB 3Q3JA 5CLQB 2LXAA 3ZO5B 3PVUA 5JVLA 3DXCA 4W9EA 3ULBA 3UIOB 2IBIB 4MT7A 5D3VA 4TUUA 3ZNHB 4MY6A 4HAWB 3RCZA 4EZJA 4ICUA 4ILHA 3JSVB 4W9GA 2FCNA 2GMIC 5E6OA 2AL6A 1FHWA 2KK8A 4WJNA 4MH0E 2N0YA 2MFQA 3ENBA 3GOEA 1EAZA 5L95C 3ALBA 2C60A 4ILGB 4IUMB 1V6EA 4F1SA 1ZSQA 1OY2A 2AWTA 2MP2A 1TXDA 3HHMA 3MTNB 2K2JA 2DX5A 3HM3A 2REXA 1BT0A 2D10A 3SBGA 3CSTA 1EF5A 4B95A 2GS0A 3QWZB 3WAOA 1WI1A 4GDKB 3VUYA 2N9PC 4HAVB 2N4FA 2Z59B 2R09A 2M17A 3AI5A 1QQGA 1I35A 2KVRA 2RSUA 2I5FA 1WIAA 2VSZA 3SBTA 2N9XA 4HB3B 4FULA 5LONB 3O96A 2NPTA 1V2YA 2KHWB 2DAJA 1SHCA 1XX0A 3LDZE 1GGOA 1H8CA 3EC8A 2BGFA 2EMTA 3PV1A 3APCA 2KTRB 1K5DB 1ISNA 2YS5A 4JKGB 4L6EA 4MM3A 4BKGA 1WXAA 2D2QA 1WY8A 5IAAC 4PS7A 2DYOA 2ROZB 3A98B 1U4AA 1KM7A 1FB8A 2FCMA 2G45B 4EZKA 4N9F4 3APFA 2BYEA 3PLUA 2J59M 1E8WA 1WJMA 3ZVRA 5D6JB 2RGNB 2KGXB 2D9ZA 4FJVB 4HJKA 3PRZA 2K00A 2NBUA 4WWNA 1Q67A 1P5TA 1X86A 1NBFC 4PYUA 1E8YA 1BWNA 3ODWA 1XKEA 3TMPB 2H7EA 2N1VA 3V5WA 2KLCA 2PPHA 1TBEA 2KZRA 4A3PA 2C7MB 3ULCA 3KUZA 5KHOA 2JP2A 3CXBB 1ZVRA 1GG3A 5DCNA 3R3MA 4IC7B 1YX6B 5AEKB 1X1MA 4DK5A 3FEHA 1XCGA 3TW1A 1WXMA 2JRIB 3G9WA 2VRWB 3VIAA 2COFA 5FR6A 3PT2B 5FI0A 4D0NB 5D27A 3ZRCA 5JH5C 1RRPB 2K6QA 3R66C 4JQWC 2P8VA 3PS6A 4GOCA 3BY4B 2ASQA 4IM2A 4FHJA 3AXCA 4HXDA 2RUKB 4WJQA 1I7AA 2DAFA 5HKHA 3VXWA 4BBNC 1J8CA 2EC1A 3DVNU 4E3CA 2J0KA 5C16A 4ANUA 4Z2NA 2O2VB 4JKDA 2KX0A 1KI1B 1V5TA 3NZSA 5EDSA 1Q0WB 3KH0A 2COCA 3N30A 2V76A 1FXTB 2LJ5A 2Q13A 2DYQA 2NVUI 1I2HA 1BTNA 3A9KA 3VQIA 2KANA 1WXVA 4PNKA 3NHEB 3E66A 2G35A 1X11A 1WGUA 4NQLB 4JIOU 4MGZE 2UZSA 1VBGA 4MGYE 3PVLA 2LVPA 2V1YA 3QX1A 2Y8FA 4GIVA 3KY9A 1KBLA 4HPMB 1SGHA 4K81A 2KO3A 3KRWA 4NY0A 4BOZB 3QA8A 2DIKA 3CF6E 5CHWA 2MRPA 5KCVA 3V6EB 5J3YA 2WH5A 3APDA 2RD0A 4GXBA 2R0DA 2KTFA 4EJNA 3A9JB 3TVVA 4CHMA 2OTXA 2K8CA 1WFYA 2LOZA 1WJ1A 2M8SA 2UWQA 3V6CB 2CY4A 4MSMB 3EHVA 2PE9A 5J3TA 2FAZA 4C0AA 3FP5A 2G3QB 4M8MA 2Z0PA 5GOWB 5CX3A 3T06A 2M38A 3U30A 2O6VA 2JUOA 2FCQA 1MKEA 3PTFC 4H8SA 2VRRB 4IM0A 2PZ1A 3NY5A 3KYCD 5E6NA 3RUIB 4ZRKA 3H6NA 1FHXA 3KYDD 2FJ9A 1NTYA 1MG8A 2HD5B 1M94A 4A6HA 5AZGA 1SIFA 2COPA 2KTRA 4FADA 1P6SA 2GOWA 2K1FA 3ZDMC 2J0JA 1T0YA 2C5LC 2KC2A 2LWPA 4JKGA 1TQZA 3DDCB 1Z87A 1FGYA 3MHSD 3RZWC 3N7CA 4IWQA 1DDVA 1J0GA 1P98A 2IY1B 1WM3A 2KJHB 2DKPA 2V3SA 5C23A 1H4RA 2GBKA 2CQUA 1MAIA 2K39A 2KQSA 2MCNB 4ASWC 1DDWA 5KQ1A 2D07B 4JKHA 4KSLC 4BBNF 1Z2MA 2JZ3B 4JK9A 5D94A 1RRBA 3SNHA 2FJLA 5IA7A 1VCBA 4IWPA 3FM8C 2KC1A 1RJ2A 4EFOA 2OJRA 5L83A 2KCJA 2DHZA 4XX5A 2DZIA 2H7DA 1WJUA 4GZUA 4WJ7A 4TYZA 2MBBB 1D3ZA 3UGBB 4NNJB 3HW2B 3TFMA 2C7NB 1ZW7A 3L54A 2JZZA 3ZNID 4XWXA 4GDLA 2DKQA 3BINA 2ZEQA 4G11A 1M7RA 2LKOA 5DH9B 2CU1A 3GYPA 3VH3B 4M8NA 4JL9A 3RZFA 4IW0A 3SD5A 4EMOA 2DHIA 2JY6A 3TCAA 2MWNB 3AU4A 2LYDA 5KHQA 3AJ4A 2YF0A 3FLVA 4HWIB 1AWEA 2WYQA 4KZ0A 3A9KB 4WWOA 3P6AA 4PS8A 2RSGA 1JRUA 1KZ7A 2GBRA 5HE1A 3QHTA 1DYNA 4W9JA 4HB2B 1S1QB 2NBVB 4A6KA 1ZC3B 4B6WA 3KSYA 2OQBA 2YS1A 4Z2MB 1WM2A 1UPRA 3ENEA 1KJTA 2IYDB 4RM8A 3ZTDA 2DZKA 4MK0A 2O2VA 2LGXA 1YX5B 1KC7A 2D3GA 3E9OA 3PPAA 5GMVA 2OOBB 1C3TA 4NPNA 5D3YA 4WVFB 3PSEB 4WJOA 4MELA 2D11A 4DWFA 4CHJA 3OLMD 2ZPYA 4KVGB 2BCJA 2LBBA 1G6JA 1WRDB 2ELBA 4FN2A 2M4NA 1E5WA 2O6VB 4NQKE 4KDIC 1S3SG 2LVOA 2M1MA 3ZRFA 2PE6B 2AEHA 1TTNA 2CHWA 4HCNB 4GSWA 2Z0OA 3A4RA 3MPXA 2IO0B 3RYTA 3VTWA 3PEGA 4F7UP 5DIFB 1W1DA 4GB9A 2JXXA 2KDIA 3A9JA 3DPDA 2RNRB 4G50A 1WGRA 4ZYNA 1V5UA 4JK8A 2KJRA 3VTUA 1XD4A 3PG7A 1ST7A 3UIPB 3VFKA 2P0FA 2I1JA 4BBKA 3ZNZB 4JK7A 2A5UA 2P0DA 3ZUNA 4FJYA 2JVCA 4W9IA 2L00B 1UGMA 3VAWA 1ZC4B 1NU2A 3PLVA 1ZGUB 3CIKA 3QBVB 2B3AA 4KHOA 2L76A 4WWPA 4DHJD 1U5EA 3TO1A 1NTIA 1ZM0A 1PFJA 3OAWA 1V9JA 2CKHB 2LXCA 1P9DU 3M1IB 2KXJA 1VBHA 4KSKC 1HE8A 1UPQA 4KHAA 3X0WA 3IFWB 3NS8A 2IY0B 3B08A 3DBRI 1WJ4A 5J3QA 2WX1A 1FAOA 1WGGA 1PLSA 2ZNVB 2MLBA 2AL3A 4JKAA 2ZCCA 3NSUA 2XK5A 5JP4A 4G0NB 1OQNA 1UH6A 5JHHA 4GDLB 3DVGY 2LOXA 5JHGA 2CS4A 4TKNA 5BO4B 2UVMA 1HB8A 3FSSA 2KQ7A 3DXEA 1R4MI 1V5OA 1TGZB 4W9CA 1ZKHA 4NJ7A 2D9WA 4LJOB 2I1KA 2CHXA 1NVLA 3R7RA 4XZ4A 4KHBB 1M7EA 4ZRIA 5AZHA 5EFXA 4W9LA 5D3WA 1MIZB 2Y7BA 5C5BB 2ZCBA 3E9LA 2KFKA 4KAXB 4DX8A 1DROA 2R82A 3SHQA 1YQBA 3P7ZA 4A3OA 4HDOA 3EFUA 3WYFB 2ZVNA 3ML4A 2LRWA 2LZ6A 2CB8A 4AWJA 2BF8B 3PSCA 1A5RA 1V80A 1JDEA 4BKSD 2ROVA 2VKIA 3TL5A 4F7GA 1W1GA 3ECIA 5LLIA 3D8EA 2Z0EB 4I6NB 4K2PA 3L17A 2GBNA 4DBGA 4A20A 3QC8B 3MJWA 2L2IA 4LCDE 5G55A 1VD2A 3VHTC 2N9EB 2LI5A 1CMXB 4W9KA 2MA9B 2DZJA 4JGHB 4AOFA 4URKA 3EECA 2W2XC 1LW3A 4PQ0A 1IYFA 1V5PA 2QHOA 3ZDTA 4E71A 5HE0A 2KMAA 2GBMA 1ACAA 1XT9B 3QWMA 3A33B 3A8QA 3ZTCA 3ODOA 4GMVA 3A1QB 2NBWB 3KRXA 2Z0DB 2W9NA 3SU8X 4YONA 5D3XA 2K6DB 1YIWA 5DPSA 2DFKA 4WJPA 2PEAA 4K17A 2HTHA 1WZ0A 2KD0A 2MBOA 4JKCA 1LQBA 4FHKA 1IRSA 4DBBA 1L2NA 3H7PA 4GGQA 1WJ6A 1X05A 3DVNV 5E6PA 1HB6A 1UNQA 4DHJB 1UBQA 4NSWA 2IO1B 3ONSA 3QJZA 1WE7A 3NZUA 2NZ8B 4W9DA 1WX7A 5CHFA 3IG3A 1WX9A 2KNBA 2DA0A 1WGHA 2IZVB 3UF8A 4OVVA 2RLOA 2Z0QA 4IWOA 1WGDA 1MPHA 1UNPA 1WX8A 2DYBA 1L7YA 1HBKA 2KUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7D A;  3T8M A;  2IO2 B;  2N23 A;  3F0W A;  3DQV A;  3VVW B;  2EKE C;  4B6H A;  4AUQ C;  1V86 A;  1KLV A;  4DHZ E;  1U5F A;  1K5G B;  2JPH A;  4AJW A;  4EKU A;  1OGW A;  4EEW A;  4F8C B;  3QK0 A;  3KVF B;  3DBL I;  2XK5 B;  3W1Y A;  5JHB A;  2FIF A;  1WH3 A;  5IJM A;  2BKF A;  2MX2 A;  3IVF A;  4AP4 C;  2CY5 A;  5DPR A;  1TZ1 A;  1WR1 A;  4WQO B;  1EUV B;  3WIM A;  5L81 A;  3S2A A;  4FLH A;  2XQN M;  2NS5 A;  4DHZ B;  3R7Q A;  2P0H A;  2LD9 A;  3DCG A;  3TJP A;  3WAL A;  2K8H A;  2DX1 A;  1H10 A;  2PJH A;  1EO6 A;  1EF1 A;  3QAR A;  4HHV A;  1WF9 A;  2J7Q B;  1NI2 A;  3LJU X;  2R2O A;  5JHA A;  2ELA A;  2ZJD A;  2K8B A;  4K7S A;  2FNJ B;  2KWC A;  4IFS A;  4LDT D;  1FGZ A;  3M3J A;  2L7R A;  2KFK B;  1FOE A;  3UQA A;  4EOY A;  3SV1 A;  2G4D B;  4A6F A;  4FJZ A;  2KWV B;  1YJ1 A;  2N7E A;  2ZNV C;  1RFA A;  3ZW3 A;  2D4Q A;  2D9Y A;  4GPT B;  3L10 B;  4HAZ B;  3W1S A;  2NR2 A;  5AZF A;  1X1G A;  3JVZ X;  2ABD A;  1RLF A;  4CYE A;  3A4S C;  5CHV C;  2DZM A;  2ZPN A;  2HRJ A;  3JYU A;  2BYF A;  2L8J A;  3VUX A;  4MJS A;  4G3X B;  1C1Y B;  1LFD A;  1N3H A;  2COD A;  3BJI A;  3H9D A;  4FA6 A;  5CTR C;  5C5B A;  4HCP B;  2EJ8 A;  2MBE A;  2HE7 A;  3D8F A;  3HIZ A;  1E90 A;  1WGY A;  1XR0 B;  1AQC A;  3QCA A;  1UBI A;  1WVH A;  2MSE D;  2MW5 A;  3VTV A;  3V62 A;  3B1L X;  4K1R B;  4K7U A;  2XEW A;  4YL8 A;  4BFR A;  4ANW A;  3IHP C;  2KFJ A;  1Z5S B;  2W2W A;  3KZ1 A;  1XQQ A;  3SO6 A;  4GMX B;  4DX9 0;  4CHK A;  2COA A;  2C7H A;  4MSQ B;  3OJ4 B;  1OEY A;  1K8R B;  1P0R A;  1P1A A;  5D7G A;  1GC7 A;  4IM3 A;  3HK0 A;  2QKL A;  3P2B A;  2HTH B;  1U2B A;  5D2M B;  3V60 A;  1V88 A;  1IPG A;  3LJ3 A;  3K9P B;  5HE3 A;  3H7P B;  2IYB A;  3L16 A;  1NDD A;  4EUT A;  3C0R B;  4HPL B;  3H1U A;  1FHO A;  5C1Z A;  1GUA B;  2Y5B B;  4K2O A;  3RD2 A;  5LOP B;  3OAN A;  3B0A A;  4ZRJ A;  3DBS A;  2FUH B;  4HAY B;  4HB4 B;  4NAW A;  4OVU A;  3X23 A;  4HDQ A;  3UQB A;  3A1Q A;  3PGE A;  1WR6 E;  1GC6 A;  3VH4 B;  2V4L A;  1LXD A;  1WXS A;  3HQC A;  1B55 A;  3DVG X;  2K2U A;  2LGY A;  4IG7 B;  1OQY A;  5DHF B;  5JLJ B;  4W9F A;  2ZVO A;  4ANX A;  4HB0 B;  1XOD A;  3NOB A;  4BKT A;  1Y5O A;  2RGF A;  1WG7 A;  1P3Q U;  1I42 A;  5C79 A;  2I5C A;  3H7S A;  4A5K A;  4KIK A;  2UYZ B;  1Q1O A;  1UEL A;  2JT4 B;  4II2 B;  4KZC A;  4B9K A;  4HAU B;  3U8Z A;  3ZVV A;  2GCL A;  4HVB A;  2KDB A;  2LGD A;  2YVC A;  4ZDV A;  1OEY J;  2C9W B;  1E8X A;  1PMS A;  3RCP A;  1XD3 B;  5J18 A;  3EPY A;  4I6P A;  4LDT B;  3SYX A;  3ZNG C;  2G4S A;  4F7Z A;  2RR9 A;  2YT1 A;  1LM8 B;  2DTC A;  1Y8R C;  3I3T B;  3M62 B;  1TJ6 A;  2NMB A;  2KKC A;  3U7D A;  2LRU A;  1QZE A;  4A6F B;  1KZG A;  2L3Z A;  4KDL B;  1WI0 A;  3N3K B;  2FCS A;  5KQ4 A;  1DBH A;  3D32 A;  4ICV A;  3SUZ A;  1UEF A;  4LJP B;  3Q3F A;  4GU2 A;  2QKM A;  2ZZP B;  3CMM B;  5DHA B;  3DOW A;  2BWE S;  1DDM A;  1EVH A;  4XC2 A;  3RT3 B;  3V61 A;  2WX0 A;  1UNR A;  4MJS B;  4TV3 A;  1F9J A;  3GZN I;  5LXH A;  2ADZ A;  1GJZ A;  4K7W A;  1NTV A;  2NCN A;  1MK7 B;  4MDK E;  2JF5 A;  2CHZ A;  3ZKJ C;  1MK9 B;  5DPT A;  3ML8 A;  1P3R A;  2YLM A;  1V49 A;  1LB1 A;  5G2N A;  2R2Q A;  4DDI D;  4HLE A;  4DDG D;  1WMH A;  4BKS A;  3QQ8 B;  1J19 A;  1R4N I;  2CAY A;  3PP2 A;  3VOQ A;  4J6I A;  3HM6 X;  2KDF B;  3WAM A;  3CSF A;  2UZR A;  4IOY X;  5DI9 B;  3MDB C;  3WAN A;  2LUL A;  1WE6 A;  4TQ0 A;  5LXI B;  2YT0 A;  1W1H A;  3L13 A;  5FI1 A;  2D9X A;  3KUC B;  3TBL D;  3AUL A;  2MBQ A;  2YSZ A;  1KOT A;  2MP2 B;  2GCJ A;  1BAK A;  4AJY B;  2Y8G A;  2LAS A;  1V5M A;  3O65 B;  2DYN A;  2DX5 B;  4I6L B;  4MGK E;  4MGI E;  2FDQ A;  3A8P A;  1AAR A;  2KLG A;  2MQJ A;  5J2R A;  1Q5W B;  2N1W A;  1WYW B;  2GBJ A;  2DYM A;  3UZT A;  3JSV A;  4W9H A;  3PHW B;  5J17 A;  4NAW B;  2W2X D;  1V81 A;  1U27 A;  1MIX A;  2XBB C;  1U29 A;  4II3 B;  4BVU C;  3VDZ A;  1J0W A;  3ML9 A;  2NPT B;  2GJY A;  3PRM B;  1EGX A;  2MDX A;  1OMW A;  3PRP B;  4KV2 A;  2CR5 A;  2BWF A;  2D9V A;  2LVQ A;  2DHJ A;  3ZIM A;  3GYO A;  2MWS B;  1PQS A;  3PVW A;  2BPS A;  2MBH A;  3DBH I;  4IAP A;  2KWU B;  3K9O B;  4HK2 A;  4CO7 A;  2EMS A;  3TIX A;  4GDK A;  2KX3 A;  2M14 A;  2L05 A;  4KIK B;  3PRE A;  3D8D A;  1V89 A;  3KW5 B;  2BKR B;  2IFS A;  4ANV A;  4FBJ B;  1Y19 B;  3OJ3 A;  3AU5 A;  2LG1 A;  1IP9 A;  1RAX A;  3M63 B;  2J0M A;  1BTK A;  3L0W B;  2O6V D;  3PZD A;  2KOX A;  5C6R A;  4F7H A;  4NJ6 A;  3WA0 A;  4BOS C;  3N32 A;  4JLC A;  1GNU A;  3KUD B;  1WGQ A;  2DEN B;  3SDL C;  4EZL A;  2LUE A;  2A4Z A;  3UIN B;  5JZE B;  4GN1 A;  1E8Z A;  3M95 A;  3RUL A;  2DHK A;  2WDT B;  1WJN A;  2M0X A;  3IBE A;  5TR5 A;  4E74 A;  2KDE B;  2KN5 A;  3JW0 X;  1WZ3 A;  4TQ1 A;  4Y94 A;  1U5D A;  4PS3 A;  3PHX B;  4WAA A;  4P7I A;  2AYO B;  3QAQ A;  2KJ6 A;  2YS3 A;  2KMC A;  4RMA A;  1X1F A;  2MKR A;  4HAX B;  3T9L A;  5CLL B;  2YRY A;  2BYV E;  2RQ1 A;  2FID A;  2DN6 A;  1E7U A;  2HJ8 A;  4WSF A;  1SE9 A;  1QC6 A;  2E2X A;  3DXD A;  3QIJ A;  2L0F A;  3VUW A;  5HE2 A;  1WMH B;  2RPQ A;  4PYZ A;  3ODX A;  3L08 A;  3ZLZ A;  2JRH A;  4X57 B;  4M0W B;  2K25 A;  4MEM A;  1UD7 A;  2L1C A;  2CRF A;  5DPW A;  1YD8 U;  4RM9 A;  2IO3 B;  1U5G A;  1E7V A;  1V61 A;  2X18 A;  3WAP A;  4DXA B;  4HAT B;  1UZX B;  3W1S C;  2WWZ A;  2JWZ A;  2DLW A;  3F5R A;  2RVB B;  2L0T A;  1OTR B;  3Q3J A;  5CLQ B;  2LXA A;  3ZO5 B;  3PVU A;  3DXC A;  4W9E A;  3ULB A;  3UIO B;  2IBI B;  4MT7 A;  5D3V A;  4TUU A;  3ZNH B;  4MY6 A;  4HAW B;  3RCZ A;  4EZJ A;  4ICU A;  3JSV B;  4W9G A;  2FCN A;  2GMI C;  5E6O A;  2AL6 A;  1FHW A;  2KK8 A;  4WJN A;  4MH0 E;  2N0Y A;  2MFQ A;  3GOE A;  1EAZ A;  5L95 C;  3ALB A;  2C60 A;  4IUM B;  1V6E A;  4F1S A;  1ZSQ A;  1OY2 A;  2AWT A;  2MP2 A;  1TXD A;  3HHM A;  3MTN B;  2K2J A;  2DX5 A;  3HM3 A;  2REX A;  1BT0 A;  2D10 A;  3CST A;  1EF5 A;  4B95 A;  2GS0 A;  3QWZ B;  3WAO A;  1WI1 A;  4GDK B;  3VUY A;  2N9P C;  4HAV B;  2N4F A;  2Z59 B;  2R09 A;  2M17 A;  3AI5 A;  1QQG A;  1I35 A;  2KVR A;  2RSU A;  2I5F A;  1WIA A;  2VSZ A;  2N9X A;  4HB3 B;  4FUL A;  5LON B;  3O96 A;  2NPT A;  1V2Y A;  2KHW B;  2DAJ A;  1SHC A;  1XX0 A;  3LDZ E;  1H8C A;  3EC8 A;  2BGF A;  2EMT A;  3PV1 A;  3APC A;  2KTR B;  1K5D B;  1ISN A;  2YS5 A;  4L6E A;  4MM3 A;  4BKG A;  1WXA A;  2D2Q A;  1WY8 A;  5IAA C;  4PS7 A;  2DYO A;  2ROZ B;  3A98 B;  1U4A A;  1KM7 A;  1FB8 A;  2FCM A;  2G45 B;  4EZK A;  4N9F 4;  3APF A;  2BYE A;  3PLU A;  2J59 M;  1E8W A;  1WJM A;  3ZVR A;  5D6J B;  2RGN B;  2KGX B;  2D9Z A;  4FJV B;  4HJK A;  3PRZ A;  2K00 A;  2NBU A;  4WWN A;  1Q67 A;  1P5T A;  1X86 A;  1NBF C;  4PYU A;  1E8Y A;  1BWN A;  3ODW A;  1XKE A;  3TMP B;  2H7E A;  2N1V A;  3V5W A;  2KLC A;  2PPH A;  1TBE A;  2KZR A;  4A3P A;  2C7M B;  3ULC A;  3KUZ A;  5KHO A;  2JP2 A;  3CXB B;  1ZVR A;  1GG3 A;  5DCN A;  3R3M A;  4IC7 B;  1YX6 B;  5AEK B;  1X1M A;  4DK5 A;  3FEH A;  1XCG A;  3TW1 A;  1WXM A;  2JRI B;  3G9W A;  2VRW B;  3VIA A;  2COF A;  5FR6 A;  3PT2 B;  5FI0 A;  4D0N B;  5D27 A;  3ZRC A;  5JH5 C;  1RRP B;  2K6Q A;  3R66 C;  4JQW C;  2P8V A;  3PS6 A;  4GOC A;  3BY4 B;  2ASQ A;  4IM2 A;  4FHJ A;  3AXC A;  4HXD A;  2RUK B;  4WJQ A;  1I7A A;  2DAF A;  5HKH A;  3VXW A;  4BBN C;  1J8C A;  2EC1 A;  3DVN U;  4E3C A;  2J0K A;  5C16 A;  4ANU A;  4Z2N A;  2O2V B;  2KX0 A;  1KI1 B;  1V5T A;  3NZS A;  5EDS A;  1Q0W B;  3KH0 A;  2COC A;  3N30 A;  2V76 A;  1FXT B;  2LJ5 A;  2Q13 A;  2DYQ A;  2NVU I;  1I2H A;  1BTN A;  3A9K A;  3VQI A;  2KAN A;  1WXV A;  4PNK A;  3NHE B;  2G35 A;  1X11 A;  1WGU A;  4NQL B;  4JIO U;  4MGZ E;  2UZS A;  4MGY E;  3PVL A;  2LVP A;  2V1Y A;  3QX1 A;  2Y8F A;  4GIV A;  3KY9 A;  4HPM B;  1SGH A;  4K81 A;  2KO3 A;  3KRW A;  4NY0 A;  4BOZ B;  3QA8 A;  3CF6 E;  5CHW A;  2MRP A;  5KCV A;  3V6E B;  5J3Y A;  2WH5 A;  3APD A;  2RD0 A;  4GXB A;  2R0D A;  2KTF A;  4EJN A;  3A9J B;  3TVV A;  4CHM A;  2OTX A;  2K8C A;  1WFY A;  2LOZ A;  1WJ1 A;  2M8S A;  2UWQ A;  3V6C B;  2CY4 A;  4MSM B;  3EHV A;  2PE9 A;  5J3T A;  2FAZ A;  4C0A A;  3FP5 A;  2G3Q B;  4M8M A;  2Z0P A;  5GOW B;  5CX3 A;  3T06 A;  2M38 A;  3U30 A;  2O6V A;  2JUO A;  2FCQ A;  1MKE A;  3PTF C;  4H8S A;  2VRR B;  4IM0 A;  2PZ1 A;  3NY5 A;  3KYC D;  5E6N A;  3RUI B;  4ZRK A;  3H6N A;  1FHX A;  3KYD D;  2FJ9 A;  1NTY A;  1MG8 A;  2HD5 B;  1M94 A;  4A6H A;  5AZG A;  1SIF A;  2COP A;  2KTR A;  4FAD A;  1P6S A;  2GOW A;  2K1F A;  3ZDM C;  2J0J A;  1T0Y A;  2C5L C;  2KC2 A;  2LWP A;  1TQZ A;  3DDC B;  1Z87 A;  1FGY A;  3MHS D;  3RZW C;  3N7C A;  4IWQ A;  1DDV A;  1J0G A;  1P98 A;  2IY1 B;  1WM3 A;  2KJH B;  2DKP A;  2V3S A;  5C23 A;  1H4R A;  2GBK A;  2CQU A;  1MAI A;  2K39 A;  2KQS A;  2MCN B;  4ASW C;  1DDW A;  5KQ1 A;  2D07 B;  4KSL C;  4BBN F;  1Z2M A;  2JZ3 B;  5D94 A;  1RRB A;  3SNH A;  2FJL A;  5IA7 A;  1VCB A;  4IWP A;  3FM8 C;  2KC1 A;  1RJ2 A;  4EFO A;  2OJR A;  5L83 A;  2KCJ A;  2DHZ A;  4XX5 A;  2DZI A;  2H7D A;  1WJU A;  4GZU A;  4WJ7 A;  4TYZ A;  2MBB B;  1D3Z A;  3UGB B;  4NNJ B;  3HW2 B;  3TFM A;  2C7N B;  1ZW7 A;  3L54 A;  2JZZ A;  3ZNI D;  4XWX A;  4GDL A;  2DKQ A;  3BIN A;  2ZEQ A;  4G11 A;  1M7R A;  2LKO A;  5DH9 B;  2CU1 A;  3GYP A;  3VH3 B;  4M8N A;  4JL9 A;  3RZF A;  4IW0 A;  3SD5 A;  4EMO A;  2DHI A;  2JY6 A;  3TCA A;  2MWN B;  3AU4 A;  2LYD A;  5KHQ A;  3AJ4 A;  2YF0 A;  3FLV A;  4HWI B;  1AWE A;  2WYQ A;  4KZ0 A;  3A9K B;  4WWO A;  3P6A A;  4PS8 A;  2RSG A;  1JRU A;  1KZ7 A;  2GBR A;  5HE1 A;  3QHT A;  1DYN A;  4W9J A;  4HB2 B;  1S1Q B;  2NBV B;  4A6K A;  1ZC3 B;  4B6W A;  3KSY A;  2OQB A;  2YS1 A;  4Z2M B;  1WM2 A;  1UPR A;  3ENE A;  1KJT A;  2IYD B;  4RM8 A;  3ZTD A;  2DZK A;  4MK0 A;  2O2V A;  2LGX A;  1YX5 B;  2D3G A;  3PPA A;  5GMV A;  2OOB B;  1C3T A;  4NPN A;  5D3Y A;  4WVF B;  3PSE B;  4WJO A;  4MEL A;  2D11 A;  4DWF A;  4CHJ A;  3OLM D;  2ZPY A;  4KVG B;  2BCJ A;  2LBB A;  1G6J A;  1WRD B;  2ELB A;  4FN2 A;  2M4N A;  1E5W A;  2O6V B;  4NQK E;  4KDI C;  1S3S G;  2LVO A;  2M1M A;  3ZRF A;  2PE6 B;  2AEH A;  1TTN A;  2CHW A;  4HCN B;  4GSW A;  2Z0O A;  3A4R A;  3MPX A;  2IO0 B;  3RYT A;  3VTW A;  3PEG A;  4F7U P;  5DIF B;  1W1D A;  4GB9 A;  2JXX A;  2KDI A;  3A9J A;  3DPD A;  2RNR B;  4G50 A;  1WGR A;  4ZYN A;  1V5U A;  2KJR A;  3VTU A;  1XD4 A;  3PG7 A;  1ST7 A;  3UIP B;  3VFK A;  2P0F A;  2I1J A;  4BBK A;  3ZNZ B;  2A5U A;  2P0D A;  3ZUN A;  4FJY A;  2JVC A;  4W9I A;  2L00 B;  1UGM A;  3VAW A;  1ZC4 B;  1NU2 A;  3PLV A;  1ZGU B;  3CIK A;  3QBV B;  2B3A A;  4KHO A;  2L76 A;  4WWP A;  4DHJ D;  1U5E A;  3TO1 A;  1NTI A;  1ZM0 A;  1PFJ A;  3OAW A;  1V9J A;  2CKH B;  2LXC A;  1P9D U;  3M1I B;  2KXJ A;  4KSK C;  1HE8 A;  1UPQ A;  4KHA A;  3X0W A;  3IFW B;  3NS8 A;  2IY0 B;  3B08 A;  3DBR I;  1WJ4 A;  5J3Q A;  2WX1 A;  1FAO A;  1WGG A;  1PLS A;  2ZNV B;  2MLB A;  2AL3 A;  2ZCC A;  3NSU A;  2XK5 A;  5JP4 A;  4G0N B;  1OQN A;  1UH6 A;  5JHH A;  4GDL B;  3DVG Y;  2LOX A;  5JHG A;  2CS4 A;  4TKN A;  5BO4 B;  2UVM A;  1HB8 A;  3FSS A;  2KQ7 A;  3DXE A;  1R4M I;  1V5O A;  1TGZ B;  4W9C A;  1ZKH A;  4NJ7 A;  2D9W A;  4LJO B;  2I1K A;  2CHX A;  1NVL A;  3R7R A;  4XZ4 A;  4KHB B;  1M7E A;  4ZRI A;  5AZH A;  5EFX A;  4W9L A;  5D3W A;  1MIZ B;  2Y7B A;  5C5B B;  2ZCB A;  2KFK A;  4KAX B;  4DX8 A;  1DRO A;  3SHQ A;  1YQB A;  3P7Z A;  4A3O A;  4HDO A;  3EFU A;  3WYF B;  2ZVN A;  3ML4 A;  2LRW A;  2LZ6 A;  2CB8 A;  4AWJ A;  2BF8 B;  3PSC A;  1A5R A;  1V80 A;  4BKS D;  2ROV A;  2VKI A;  3TL5 A;  4F7G A;  1W1G A;  3ECI A;  5LLI A;  3D8E A;  2Z0E B;  4I6N B;  4K2P A;  3L17 A;  2GBN A;  4DBG A;  4A20 A;  3QC8 B;  3MJW A;  2L2I A;  4LCD E;  5G55 A;  1VD2 A;  3VHT C;  2N9E B;  2LI5 A;  1CMX B;  4W9K A;  2MA9 B;  2DZJ A;  4JGH B;  4AOF A;  4URK A;  3EEC A;  2W2X C;  1LW3 A;  4PQ0 A;  1IYF A;  1V5P A;  2QHO A;  3ZDT A;  4E71 A;  5HE0 A;  2KMA A;  2GBM A;  1ACA A;  1XT9 B;  3QWM A;  3A33 B;  3A8Q A;  3ZTC A;  3ODO A;  4GMV A;  3A1Q B;  2NBW B;  3KRX A;  2Z0D B;  2W9N A;  3SU8 X;  4YON A;  5D3X A;  2K6D B;  1YIW A;  5DPS A;  2DFK A;  4WJP A;  2PEA A;  4K17 A;  2HTH A;  1WZ0 A;  2KD0 A;  2MBO A;  1LQB A;  4FHK A;  1IRS A;  4DBB A;  1L2N A;  3H7P A;  4GGQ A;  1WJ6 A;  1X05 A;  3DVN V;  5E6P A;  1HB6 A;  1UNQ A;  4DHJ B;  1UBQ A;  4NSW A;  2IO1 B;  3ONS A;  3QJZ A;  1WE7 A;  3NZU A;  2NZ8 B;  4W9D A;  1WX7 A;  5CHF A;  3IG3 A;  1WX9 A;  2KNB A;  2DA0 A;  1WGH A;  2IZV B;  3UF8 A;  4OVV A;  2RLO A;  2Z0Q A;  4IWO A;  1WGD A;  1MPH A;  1UNP A;  1WX8 A;  2DYB A;  1L7Y A;  1HBK A;  2KUP A; 
#chains in the Genus database with same CATH topology
 1N6Z A;  2N7D A;  2FJU B;  3O13 A;  3T8M A;  2IO2 B;  2N23 A;  3F0W A;  3DQV A;  3VVW B;  2EKE C;  4B6H A;  2WXR A;  4AUQ C;  4N58 A;  2KUQ A;  2K9X A;  1V86 A;  2HDE A;  3U52 E;  1KLV A;  4DHZ E;  1U5F A;  1NVI D;  1K5G B;  2JPH A;  4AJW A;  4EKU A;  1OGW A;  1XCQ L;  3AMZ A;  4EEW A;  4F8C B;  3QK0 A;  3KVF B;  3DBL I;  2XK5 B;  4XDD A;  3W1Y A;  5JHB A;  2FIF A;  1WH3 A;  5IJM A;  1JWM D;  2BKF A;  2MX2 A;  3IVF A;  4AP4 C;  2CY5 A;  5DPR A;  1TZ1 A;  1WR1 A;  4WQO B;  2JU6 X;  4US9 A;  1EUV B;  5BMH A;  4GNK B;  3WIM A;  5L81 A;  2WQY B;  3S2A A;  3DHI C;  4FLH A;  2XQN M;  2NS5 A;  4DHZ B;  1D4B A;  3R7Q A;  1TJE A;  2PIA A;  2P0H A;  3N1Y C;  5LG4 B;  1L0V B;  2LD9 A;  3DCG A;  3TJP A;  4L1B A;  3WAL A;  1VR9 A;  2K8H A;  2M0A A;  2DX1 A;  1H10 A;  3TEZ A;  1B1Z A;  4PT5 A;  1HZ5 A;  2PJH A;  1EO6 A;  1EF1 A;  3QAR A;  4HHV A;  1WF9 A;  2J7Q B;  2JZP A;  2WU2 B;  1NI2 A;  4OZA A;  3DHH C;  2IJ0 A;  2WNM A;  3KLS X;  3LJU X;  2R2O A;  1I4Q A;  5JHA A;  2KT7 A;  2ELA A;  2ZJD A;  2K8B A;  4K7S A;  2FNJ B;  2KWC A;  4IFS A;  4LDT D;  3U12 A;  1FGZ A;  3M3J A;  2L7R A;  4YTN B;  2KFK B;  1FOE A;  3UQA A;  4EOY A;  2KDM A;  3AE8 B;  3SV1 A;  2G4D B;  4A6F A;  4FJZ A;  2KWV B;  1YJ1 A;  2N7E A;  2ZNV C;  1RFA A;  1YQ3 B;  3ZW3 A;  2D4Q A;  2D9Y A;  4GPT B;  3L10 B;  4HAZ B;  1VZ6 A;  2CJO A;  3W1S A;  2NR2 A;  5AZF A;  1X1G A;  4QJ5 B;  4JWS C;  4A8X C;  3JVZ X;  2ABD A;  1RLF A;  4CYE A;  3A4S C;  5CHV C;  1YQ4 B;  1XO3 A;  2DZM A;  5G5G A;  2ZPN A;  2HRJ A;  1IUE A;  3JYU A;  1LGR A;  4TMA B;  2BYF A;  2L8J A;  4LLG M;  3VUX A;  1TIF A;  4JKF A;  4BZA A;  4MJS A;  3Q2A C;  4G3X B;  4CQN A;  1C1Y B;  1LFD A;  1N3H A;  2COD A;  3BJI A;  3H9D A;  4HEA 1;  4FA6 A;  5CTR C;  5C5B A;  4LNN A;  4HCP B;  2EJ8 A;  1YN5 A;  2MBE A;  2HE7 A;  2TSS A;  3D8F A;  3HIZ A;  3AM9 A;  1E90 A;  1WGY A;  1XR0 B;  1AQC A;  1RYJ A;  1UBI A;  3QCA A;  2UU7 A;  1WVH A;  1YMH E;  2MSE D;  2MW5 A;  3U2S C;  3AE2 B;  3VTV A;  4MAC A;  3V62 A;  3B1L X;  4K1R B;  3LB8 C;  4K7U A;  2XEW A;  4YL8 A;  4BFR A;  1MG4 A;  4ANW A;  3IHP C;  2KFJ A;  1Z5S B;  2W2W A;  3KZ1 A;  1XQQ A;  3SO6 A;  4GMX B;  4DX9 0;  2AX5 A;  4CHK A;  2J4X A;  2COA A;  2C7H A;  4MSQ B;  3OJ4 B;  4OZC A;  1SB3 C;  2JYT A;  5BYQ A;  1OEY A;  1K8R B;  1P0R A;  1VLB A;  1P1A A;  5D7G A;  1GC7 A;  2R61 A;  4IM3 A;  2PLP A;  3HK0 A;  2QKL A;  3P2B A;  4P1B C;  3P4P B;  2HTH B;  2I2Y A;  2RRF A;  1OQR A;  1U2B A;  5D2M B;  3V60 A;  1DIK A;  1V88 A;  5I2S A;  1IPG A;  1IGC A;  4NJC A;  3LJ3 A;  3K9P B;  3CIR B;  5HE3 A;  3H7P B;  3W9C B;  3R2I A;  3B2F A;  2IYB A;  3L16 A;  1DYQ A;  1MHH E;  1NDD A;  4EUT A;  1JRP A;  3C0R B;  4HPL B;  3H1U A;  1FHO A;  5C1Z A;  2V3N A;  1GUA B;  4LNF A;  3R2T A;  2Y5B B;  4K2O A;  3RD2 A;  5LOP B;  2KAC A;  3OAN A;  3B0A A;  4ZRJ A;  1E7P B;  1NYR A;  1OFF A;  3DBS A;  2FUH B;  1ACC A;  4HAY B;  4HB4 B;  1QKZ A;  5EE0 A;  3RPF C;  2VZK B;  4NAW A;  2W3S A;  1ZUD 2;  4OVU A;  3X23 A;  1WGK A;  4HDQ A;  1JML A;  3UQB A;  3A1Q A;  3ZGZ A;  3GP7 A;  3GE8 C;  3PGE A;  1T3Q A;  1GC6 A;  1WR6 E;  1FNU A;  2WXN A;  3VH4 B;  4YT0 B;  3HRD D;  4ZHP A;  2FBW B;  2V4L A;  1V8C A;  4LNK A;  1LXD A;  1WXS A;  3HQC A;  1B55 A;  3DVG X;  4DIX A;  2K2U A;  2IDY A;  2JYE A;  1HZ6 A;  2LGY A;  1ZOY B;  4IG7 B;  1M4V A;  2FUG 1;  3AEF B;  3MC0 B;  1RFK A;  3MFG A;  1OQY A;  2CJN A;  5DHF B;  5JLJ B;  1N63 A;  4W9F A;  2ZVO A;  4ANX A;  4HB0 B;  1XOD A;  3NOB A;  4BKT A;  3AEG B;  1Y5O A;  2RGF A;  1WG7 A;  1P3Q U;  1I42 A;  3AEC B;  1UWM A;  1DOY A;  5C79 A;  2I5C A;  3H7S A;  2WXK A;  1FMA D;  4A5K A;  2KIE A;  4KIK A;  5FR3 A;  4ARI A;  4J3O D;  2XN9 C;  1HEZ E;  2UYZ B;  3SR6 A;  1Q1O A;  1UEL A;  2JT4 B;  4II2 B;  4KZC A;  4B9K A;  3ZXV A;  4JKB A;  4HAU B;  1GPX A;  3U8Z A;  3ZVV A;  2GCL A;  4HVB A;  2ICI A;  2KDB A;  2LGD A;  1XLO A;  5H92 C;  1B9R A;  2QSD A;  2K8E A;  2QEJ C;  2YVC A;  4KKI A;  2QIL A;  1FXA A;  4ZDV A;  1OEY J;  2C9W B;  2K49 A;  2NMQ A;  1V97 A;  1K52 A;  2MHJ A;  1E8X A;  1PMS A;  3RCP A;  1XD3 B;  5J18 A;  4RGM A;  3EPY A;  3AEE B;  4FXC A;  4I6P A;  4LDT B;  1PUT A;  3SYX A;  3ZNG C;  2G4S A;  4WIP A;  4GOU A;  3BYT B;  2MJE A;  4F7Z A;  2RR9 A;  2YT1 A;  1LM8 B;  1TKY A;  2DTC A;  3NVZ A;  2YEP F;  5MPO A;  1Y8R C;  3I3T B;  3M62 B;  1TJ6 A;  3TEX A;  2NMB A;  3AH7 A;  1ZXH A;  2KKC A;  1ZDV A;  2IND C;  3GS2 A;  3U7D A;  2LRU A;  1QZE A;  4A6F B;  1KZG A;  4ILJ A;  2L3Z A;  4KDL B;  5M4Y B;  1WI0 A;  1E9M A;  3N3K B;  2B76 B;  2FCS A;  5KQ4 A;  1DBH A;  3D32 A;  4ICV A;  3KQ4 A;  3SUZ A;  1UEF A;  1I4H A;  2JWU A;  4LJP B;  4DXF A;  3Q3F A;  4GU2 A;  2QKM A;  2ZZP B;  3CMM B;  5DHA B;  3DOW A;  2BWE S;  1DDM A;  1EU3 A;  1EVH A;  2WHI A;  4XC2 A;  1L0X B;  3RT3 B;  1SJH D;  2WX0 A;  3V61 A;  4YSZ B;  1UNR A;  4ZRP A;  4MJS B;  2KR0 A;  3Q3O C;  4TV3 A;  1YNT E;  5BYR A;  4Q2J A;  1F9J A;  3GZN I;  5LXH A;  2X0S A;  2ADZ A;  3AE9 B;  1GJZ A;  4K7W A;  1NTV A;  2NCN A;  1MK7 B;  2JF5 A;  4MDK E;  2CHZ A;  3ABV B;  3ZKJ C;  1MK9 B;  5DPT A;  3ML8 A;  4P16 A;  1P3R A;  2YLM A;  3Q8A A;  5IO9 A;  1JQ4 A;  1V49 A;  1LB1 A;  5G2N A;  4XE0 A;  2R2Q A;  4DDI D;  3E9P A;  4HLE A;  2QCZ A;  3AE7 B;  4DDG D;  1WMH A;  4BKS A;  3QQ8 B;  1J19 A;  1R4N I;  3N9Y C;  3NS1 A;  5BYS A;  1EWY C;  2CAY A;  3PP2 A;  3VOQ A;  4J6I A;  3HM6 X;  2KDF B;  3WAM A;  4OW0 A;  2BB5 A;  3CSF A;  2UZR A;  3HVZ A;  4IOY X;  5DI9 B;  3MDB C;  3WAN A;  3WCQ A;  2LUL A;  3DBR B;  1WE6 A;  4TQ0 A;  5LXI B;  2YT0 A;  2QC8 A;  1W1H A;  3L13 A;  5FI1 A;  2D9X A;  1ZXI A;  4L23 A;  3KUC B;  3TBL D;  3AUL A;  2D5G A;  2VH1 A;  4AS1 A;  2MBQ A;  2YSZ A;  1TZO A;  1KOT A;  2MP2 B;  2GCJ A;  1BAK A;  1YJI A;  4AJY B;  2Y8G A;  2LAS A;  1V5M A;  3O65 B;  2DYN A;  2DX5 B;  5IN7 A;  4I6L B;  4MGK E;  2V3P A;  4MGI E;  2FDQ A;  5IP4 D;  1R4M B;  4LNI A;  1TS4 A;  3A8P A;  3Q14 C;  3NW8 A;  1AAR A;  2KLG A;  2MQJ A;  5J2R A;  1Q5W B;  1D5Z C;  1SE3 A;  2N1W A;  1WYW B;  2GBJ A;  2DYM A;  3UZT A;  2BB6 A;  3C19 A;  2KWD A;  3JSV A;  4W9H A;  3PHW B;  5J17 A;  4NAW B;  3KWL A;  2W2X D;  3P63 A;  1V81 A;  1U27 A;  4IDI A;  1MIX A;  1WRI A;  2XBB C;  1U29 A;  4II3 B;  3LYY A;  4BVU C;  3VDZ A;  1J0W A;  3ML9 A;  2NPT B;  2ACZ B;  2GJY A;  2M19 A;  3PRM B;  2QIE B;  1EGX A;  2MDX A;  1OMW A;  3VRB B;  4YSX B;  3PRP B;  4KV2 A;  1KH0 A;  2CR5 A;  2BWF A;  1UF0 A;  2D9V A;  2LVQ A;  2WXL A;  2DHJ A;  1YJJ A;  3ZIM A;  5HHD G;  1FNV A;  1NYQ A;  2KVZ A;  3GYO A;  2MWS B;  1PQS A;  3PVW A;  2BPS A;  3SEB A;  3TEW A;  2YT2 A;  1FPY A;  1BML C;  2LMC A;  2MBH A;  1F2R C;  1KTK A;  3DBH I;  4GLS C;  4IAP A;  2KWU B;  3K9O B;  4HK2 A;  4CO7 A;  4BAX A;  2EMS A;  3NWD A;  3TIX A;  3ZQ4 A;  2MEK A;  4GDK A;  3P1M A;  2KX3 A;  2M14 A;  2L05 A;  4KIK B;  3PRE A;  1ET6 A;  3D8D A;  3U7Z A;  1V89 A;  4MM3 B;  3KW5 B;  1JWB D;  2BKR B;  2IFS A;  4ANV A;  4FBJ B;  2Z59 A;  1Y19 B;  3OJ3 A;  1AW7 A;  3AU5 A;  2LG1 A;  1IP9 A;  1RAX A;  3M63 B;  4QJ4 B;  2J0M A;  1BTK A;  5EE9 A;  3L0W B;  2O6V D;  4JPS A;  1RM6 C;  1UWX A;  3PZD A;  2KOX A;  5C6R A;  4F7H A;  1HA5 A;  4NJ6 A;  3WA0 A;  3TEY A;  1N60 A;  4BOS C;  2E6X A;  3N32 A;  2WLB A;  2GLS A;  1Q10 A;  4JLC A;  1GNU A;  3KUD B;  2GUM A;  1WGQ A;  2DEN B;  3SDL C;  4EZL A;  2LUE A;  2A4Z A;  3UIN B;  5JZE B;  2BYT A;  3FIL B;  1D5M C;  4GN1 A;  1FIQ A;  1E8Z A;  3M95 A;  3MHZ A;  3RUL A;  2DHK A;  1J7B A;  1WJN A;  2M0X A;  2WDT B;  3IBE A;  3Q8C A;  5TR5 A;  4E74 A;  2KDE B;  2LJI A;  2KN5 A;  3JW0 X;  1WZ3 A;  4TQ1 A;  4Y94 A;  1U5D A;  1GB4 A;  4PS3 A;  4K3B A;  3HSA A;  4B0E A;  3PHX B;  2PVO D;  3HIE A;  4WAA A;  4P7I A;  3P4Q B;  2AYO B;  3QAQ A;  4M00 A;  2PVG C;  2KJ6 A;  2YS3 A;  4OVZ A;  2KMC A;  2INC C;  4MT5 A;  4RMA A;  1X1F A;  2MKR A;  2PMV A;  4JKE A;  4HAX B;  4DQO C;  3T9L A;  5CLL B;  2YRY A;  2BYV E;  2RQ1 A;  4R3D A;  2FID A;  1FFV A;  1HTO A;  2WDR B;  1RWS A;  1Y56 A;  2NTS A;  2Y3A A;  2DN6 A;  1E7U A;  2HJ8 A;  3N20 C;  4WSF A;  3B2G A;  1SE9 A;  1QC6 A;  2E2X A;  3DXD A;  3QIJ A;  3RNG C;  2L0F A;  3VUW A;  5HE2 A;  1FO4 A;  1WMH B;  2RPQ A;  4PYZ A;  2OJW A;  3ODX A;  2LGS A;  1ET9 A;  2L52 A;  3L08 A;  1PFD A;  3ZLZ A;  2IGG A;  2JRH A;  4X57 B;  4M0W B;  4RNA A;  2K25 A;  4MEM A;  1UD7 A;  4KX6 B;  4KGS A;  3AE6 B;  2L1C A;  1XEE A;  2CRF A;  1OQQ A;  3ZYY X;  5DPW A;  1YD8 U;  1YOV B;  4RM9 A;  2IO3 B;  1FCC C;  2J53 A;  5IOI A;  1U5G A;  1E7V A;  1V61 A;  2X18 A;  1I4X A;  3NRZ A;  1XXG A;  3WAP A;  3CWI A;  4DXA B;  4HAT B;  2BS4 B;  2BTE A;  1UZX B;  3RNF C;  3W1S C;  1TY2 A;  2Z14 A;  2WWZ A;  3Q69 A;  2JWZ A;  1N5W A;  2DLW A;  1MPE A;  3F5R A;  2RVB B;  2RDG A;  3Q6B A;  3NVW A;  2L0T A;  1OTR B;  3Q3J A;  5CLQ B;  2LXA A;  3ZO5 B;  3PVU A;  5JVL A;  3DXC A;  4W9E A;  3ULB A;  1R7S A;  4MH8 A;  3UIO B;  1A70 A;  1ENF A;  2IBI B;  2SAK A;  4MT7 A;  1KFY B;  5D3V A;  3NVY A;  1C4P A;  3I63 C;  3EUB 2;  4TUU A;  3ZNH B;  2QDF A;  4MY6 A;  3E56 A;  4XWT A;  4HAW B;  1GOZ A;  1PGX A;  3BVM A;  3RCZ A;  3FVC A;  1E0Z A;  3RI7 C;  4EZJ A;  3L4P A;  1TS2 A;  4ICU A;  5HI1 A;  4ILH A;  3JSV B;  4W9G A;  2FCN A;  2GMI C;  5E6O A;  3HUI A;  2AL6 A;  1FHW A;  2KK8 A;  2WDV B;  4WJN A;  4MH0 E;  2N0Y A;  2MFQ A;  2XNA C;  2INP E;  3ENB A;  1T5X D;  3BZD B;  1N5X A;  1T0R C;  3GOE A;  1EAZ A;  3AED B;  5L95 C;  3ALB A;  2C60 A;  4PK1 A;  4ILG B;  4HRO A;  4IUM B;  1V6E A;  4REZ A;  4F1S A;  1QOA A;  1ZSQ A;  4C00 A;  1CZP A;  4D6W A;  1SE2 A;  1OY2 A;  2AWT A;  2MP2 A;  3GE3 C;  1TXD A;  3HHM A;  3MTN B;  1ZE3 D;  2K2J A;  2DX5 A;  3HM3 A;  2KYW A;  2REX A;  2KQ4 X;  1TS3 A;  2WXJ A;  1BT0 A;  2D10 A;  3SBG A;  3CST A;  1EF5 A;  3AN1 A;  4B95 A;  4S17 A;  2GS0 A;  2BQQ A;  3QWZ B;  3WAO A;  3J9C A;  2WXQ A;  1WI1 A;  4GDK B;  3VUY A;  4ARC A;  3NWF A;  1KF6 B;  3PZ8 A;  2N9P C;  3NWA A;  4HAV B;  2RMM A;  4C7Z A;  2N4F A;  4L2Y A;  2Z59 B;  1FEH A;  2R09 A;  2M17 A;  4TSS A;  3AI5 A;  4YWG G;  1QQG A;  1I35 A;  2KVR A;  1VRA B;  2RSU A;  2Z8L A;  2I5F A;  1WIA A;  2VSZ A;  1V1P A;  3SBT A;  2N9X A;  4HB3 B;  5BMI A;  4FUL A;  1TS5 A;  5LON B;  4JWU C;  3O96 A;  1QIL A;  5T8I A;  2NPT A;  1F0Z A;  1V2Y A;  2AQ3 B;  2KHW B;  3URY A;  2DAJ A;  3ZJU A;  1P7F A;  1SHC A;  1MI0 A;  4DXG A;  4USA A;  1XX0 A;  3LDZ E;  2HJ1 A;  1GGO A;  1H8C A;  3EC8 A;  2BGF A;  3B9J A;  4ZHO A;  2EMT A;  3PV1 A;  3APC A;  2KTR B;  1MJD A;  4WAF A;  5C2T B;  1K5D B;  1ISN A;  3VR8 B;  2QJL A;  2YS5 A;  1XF5 L;  4JKG B;  4L6E A;  1JCK B;  4MM3 A;  4BKG A;  1WXA A;  5GXG B;  3ZJT A;  2D2Q A;  1WY8 A;  5IAA C;  4PS7 A;  2DYO A;  2ON8 A;  2ROZ B;  3A98 B;  1U4A A;  4C7Y A;  4C80 A;  1KM7 A;  5FK9 C;  1FB8 A;  2FCM A;  1IBX B;  4HPP A;  2G45 B;  4EZK A;  4N9F 4;  3APF A;  2BYE A;  3PLU A;  1ZDX A;  2J59 M;  1IGD A;  4WUR A;  5C3J B;  3V05 A;  3Q3N C;  1E8W A;  1WJM A;  3ZVR A;  5D6J B;  4RGO S;  1E10 A;  2RGN B;  2KGX B;  1N62 A;  4NZL B;  2D9Z A;  1DOI A;  4FJV B;  4HJK A;  2ZW0 A;  3PRZ A;  2K00 A;  4B0M A;  2NBU A;  4WWN A;  4XWW A;  4HSI A;  1Q67 A;  3IXS A;  1P5T A;  1C78 A;  1X86 A;  1NBF C;  1HXY D;  4PYU A;  4D2K A;  1E8Y A;  1BWN A;  3ZJV A;  4HRS A;  3ODW A;  3FIL A;  1XKE A;  3TMP B;  2H7E A;  1QF6 A;  2N1V A;  2INN E;  3V5W A;  1QOB A;  3NUH B;  3BK1 A;  2KLC A;  2PPH A;  1TBE A;  2KZR A;  5FKA C;  3C8Y A;  4A3P A;  1BUI C;  2V0G A;  2C7M B;  1SXT A;  3DCX A;  3ULC A;  3RN9 C;  3FC4 A;  2V9H A;  3U4E G;  3KUZ A;  5KHO A;  2JP2 A;  3CXB B;  1ZVR A;  1XCT L;  2BS2 B;  1C4A A;  1GG3 A;  5DCN A;  3R3M A;  4IC7 B;  1CK1 A;  1YX6 B;  5AEK B;  2KIG A;  4XGA B;  3LXF A;  1X1M A;  4DK5 A;  2MJD A;  3FEH A;  1XCG A;  2KN4 A;  4WQM A;  3AB5 A;  3TW1 A;  1WXM A;  2JRI B;  3G9W A;  2VRW B;  3VIA A;  3A58 A;  2COF A;  5FR6 A;  3EGR A;  1MHX A;  1ZYI A;  3PT2 B;  5FI0 A;  4D0N B;  1QQR A;  5D27 A;  3ZRC A;  4LNO A;  5JH5 C;  1RRP B;  1FD6 A;  1MVK A;  2K6Q A;  3R66 C;  4JQW C;  2P8V A;  3PS6 A;  1DOX A;  1I4P A;  4GOC A;  3BY4 B;  1SE4 A;  2ASQ A;  4IM2 A;  1I4G A;  3N1X C;  4FHJ A;  4US8 A;  4KGR A;  3AXC A;  4HXD A;  2RUK B;  2OHF A;  2LFI A;  4RF0 A;  2V4I B;  4WJQ A;  1F77 A;  4M0W A;  1XLN A;  2LHE A;  1I7A A;  2DAF A;  5HKH A;  3VXW A;  4QXA B;  1J7A A;  4BBN C;  1K50 A;  1J8C A;  2DWQ A;  2EC1 A;  1GAQ B;  3DVN U;  4E3C A;  2J0K A;  5C16 A;  1SSN A;  4ANU A;  2N0S B;  4Z2N A;  2O2V B;  4JKD A;  2KX0 A;  3R8B A;  1KI1 B;  2WXM A;  1V5T A;  3NZS A;  5EDS A;  1L6U A;  1Q0W B;  1L5P A;  1L4Z B;  1WWT A;  2KAJ A;  2COC A;  2WU5 B;  3KH0 A;  3N30 A;  2V76 A;  3NVV A;  1FXT B;  2WXO A;  2LJ5 A;  5AUI A;  2Q13 A;  1D5X C;  1TY0 A;  2DYQ A;  2LUM A;  4HKQ A;  2NVU I;  1I2H A;  1L0Y B;  1BTN A;  3A9K A;  3VQI A;  2KAN A;  1WXV A;  4PNK A;  3NHE B;  3E66 A;  3MC8 A;  2G35 A;  1LO5 D;  1X11 A;  1WGU A;  4YSY B;  4NQL B;  4C56 C;  4JIO U;  4MGZ E;  2UZS A;  2X38 A;  1VBG A;  4MGY E;  2NBV A;  3PVL A;  2LVP A;  2V1Y A;  3QX1 A;  2Y8F A;  1L6V A;  4GIV A;  3KY9 A;  1KBL A;  4HPM B;  1SGH A;  3AEB B;  4K81 A;  1AN8 A;  2KO3 A;  3KRW A;  3OG5 A;  4NY0 A;  1V1P B;  3PO0 A;  4BOZ B;  3GZN B;  3QA8 A;  1K53 A;  2DIK A;  4LTU A;  3CF6 E;  2H88 B;  5CHW A;  1GB1 A;  2MRP A;  5KCV A;  3V6E B;  5J3Y A;  2WH5 A;  4YTM B;  3APD A;  2EKI A;  3UI3 A;  2RD0 A;  4GXB A;  2R0D A;  1CQV A;  1R4N B;  2BT6 A;  4ITK A;  2KTF A;  4EJN A;  3A9J B;  4AQ7 A;  3TVV A;  2MH7 A;  4CHM A;  2OTX A;  2K8C A;  1WFY A;  2LOZ A;  1WJ1 A;  2M8S A;  2UWQ A;  3V6C B;  2CY4 A;  4MSM B;  5IRS A;  3EHV A;  3AEA B;  2PE9 A;  5J3T A;  2FAZ A;  4C0A A;  3FP5 A;  1NEN B;  1WXQ A;  2G3Q B;  4YXD B;  4UDU C;  4WWM A;  4M8M A;  2Z0P A;  5GOW B;  5CX3 A;  3T06 A;  2M38 A;  3RMK C;  2O6V A;  3U30 A;  2JUO A;  2FCQ A;  1MKE A;  3PTF C;  3Q8F A;  4H8S A;  2I38 A;  2VRR B;  2H89 B;  2PZ1 A;  4IM0 A;  3NY5 A;  3KYC D;  1I7H A;  5E6N A;  3RUI B;  4ZRK A;  1JWA D;  1FRD A;  2DNF A;  1UGJ A;  2L83 A;  2PTL A;  1FXI A;  2VH2 A;  3AE5 B;  3H6N A;  1SF0 A;  4IKG A;  5JXV A;  1FHX A;  4N59 A;  3KYD D;  1FFU A;  2BVC A;  2EEL A;  3IAM 1;  2WXP A;  3W2D A;  2FJ9 A;  2RPV A;  4HKZ E;  1NTY A;  3NG0 A;  1MG8 A;  2HD5 B;  1M94 A;  4A6H A;  5AZG A;  1SIF A;  2COP A;  2KTR A;  2K3U A;  2J52 A;  3P42 A;  4FAD A;  1P6S A;  2GOW A;  2K1F A;  2Y5C A;  3ZDM C;  2J0J A;  2VZK D;  1T0Y A;  2C5L C;  2KC2 A;  2LWP A;  2K0P A;  4JKG A;  1AWD A;  2N7J A;  2D3C A;  1TQZ A;  1EU4 A;  1Z87 A;  3DDC B;  1FGY A;  3MHS D;  3HVD A;  3RZW C;  3N7C A;  4IWQ A;  1DDV A;  4P6V F;  3OHM B;  1J0G A;  1P98 A;  2QMT A;  1IBX A;  2IY1 B;  1WM3 A;  4XDC A;  5G5H A;  1JRO A;  2KJH B;  4N6E B;  1EM7 A;  2DKP A;  2V3S A;  4RCO A;  5C23 A;  3RFZ B;  1H4R A;  4IOI E;  2HTM E;  2J42 A;  2GBK A;  2CQU A;  2D3B A;  1MAI A;  2K39 A;  2KQS A;  3RNB C;  2MCN B;  1MI1 A;  1QOG A;  3DBH B;  3Q8E A;  4ASW C;  2JQR B;  1PGB A;  1ESF A;  1DDW A;  1K51 A;  5KQ1 A;  2D07 B;  2N9L A;  4JKH A;  4KSL C;  4BBN F;  2BW2 A;  2SEB D;  2WDQ B;  1Z2M A;  2JZ3 B;  2Z4D A;  4JK9 A;  5D94 A;  1RRB A;  3SNH A;  2FJL A;  5IA7 A;  1VCB A;  4IWP A;  2ZW1 A;  3FM8 C;  2KC1 A;  1RJ2 A;  1DGJ A;  2OJR A;  4EFO A;  5L83 A;  2KCJ A;  2DHZ A;  2L1A A;  1TKE A;  3MJ5 A;  1I4R A;  4RH6 A;  4XX5 A;  2DZI A;  2H7D A;  1WJU A;  4GZU A;  4WJ7 A;  4TYZ A;  2K5P A;  1F2R I;  1JWU D;  1PYW D;  2MBB B;  3P4S B;  3T3O A;  1D3Z A;  3UGB B;  5I2M A;  4NNJ B;  3HW2 B;  1SBB B;  3TFM A;  2C7N B;  3FAH A;  1ZW7 A;  3N1Z C;  3L54 A;  2JZZ A;  3ZNI D;  4XWX A;  4GDL A;  2DKQ A;  1YN4 A;  3BIN A;  2ZEQ A;  4G11 A;  5D3I B;  1M7R A;  3BVZ A;  2LKO A;  5DH9 B;  2OED A;  2CU1 A;  3GYP A;  3VH3 B;  1KLG D;  1FM0 D;  4M8N A;  4JL9 A;  4OZB A;  1C76 A;  3IT6 B;  3RZF A;  4IW0 A;  3DBL B;  3SD5 A;  3I9V 1;  1HTQ A;  4EMO A;  4ZOH C;  2DHI A;  1CJE A;  2JY6 A;  3TCA A;  2MWN B;  3AU4 A;  2LYD A;  4KKJ A;  5KHQ A;  4A9A A;  3AJ4 A;  2YF0 A;  3FLV A;  4KHB A;  4HWI B;  1AWE A;  2WYQ A;  2WXH A;  3RNC C;  2W82 A;  4KZ0 A;  3A9K B;  4WWO A;  3P6A A;  4PS8 A;  4ACF A;  2IGH A;  2RSG A;  1JRU A;  4H2A A;  1KZ7 A;  2GBR A;  4C4V A;  5HE1 A;  3QHT A;  4OT1 A;  2WP9 B;  1DYN A;  2DBY A;  4W9J A;  4HB2 B;  1QLB B;  1S1Q B;  2NBV B;  4A6K A;  1ZC3 B;  2GI9 A;  3P4R B;  4B6W A;  3KSY A;  2OQB A;  4RF1 A;  4QJ3 B;  2YS1 A;  4Z2M B;  2NTT A;  1WM2 A;  2RDH A;  1UPR A;  2PKO A;  1KRH A;  3ENE A;  2AQ2 B;  1JWS D;  1KJT A;  2IYD B;  4RM8 A;  1FRR A;  2WXG A;  3ZTD A;  2DZK A;  4MK0 A;  2KMM A;  2O2V A;  2LGX A;  1YX5 B;  1KC7 A;  2D3G A;  3E9O A;  2WS3 B;  3PPA A;  5GMV A;  3VRA B;  4A6Q A;  2OOB B;  2IPK D;  1C3T A;  3H8H A;  4NPN A;  5D3Y A;  4WVF B;  3PSE B;  4WJO A;  3DHG C;  4MEL A;  4JE3 B;  1SJE D;  2AQ1 B;  2D11 A;  2D3A A;  4DWF A;  3W5V B;  4CHJ A;  1T0Q C;  3OLM D;  2ZPY A;  4KVG B;  4WH4 A;  2BCJ A;  2LBB A;  1TKG A;  2RDB C;  1G6J A;  1WRD B;  3AE1 B;  2ELB A;  4FN2 A;  5EE1 A;  2M4N A;  1E5W A;  2BBC A;  2O6V B;  4NQK E;  5I4D A;  4KDI C;  1S3S G;  2E3T A;  2LVO A;  3DWM A;  2M1M A;  3ZRF A;  2PE6 B;  2AEH A;  2MJ3 A;  1TTN A;  2CHW A;  4HCN B;  4GSW A;  2K22 A;  2Z0O A;  1T6B X;  3A4R A;  3MPX A;  2IO0 B;  3OWE B;  3RYT A;  3VTW A;  3PEG A;  4F7U P;  5DIF B;  1W1D A;  4GB9 A;  2JXX A;  2GRI A;  2KDI A;  3A9J A;  3DPD A;  1BXT A;  2RNR B;  2PW9 A;  4LK0 M;  4G50 A;  1WGR A;  4ZYN A;  1V5U A;  3BYY B;  4JK8 A;  2KJR A;  2G9H D;  3VTU A;  1XD4 A;  3PG7 A;  2CU3 A;  1ST7 A;  3UIP B;  4ZRQ A;  1VZ7 A;  3VFK A;  2P0F A;  2I1J A;  4BBK A;  3ZNZ B;  2WGS A;  4JK7 A;  1F1H A;  2P0D A;  2A5U A;  3ZUN A;  2R2Y A;  4O1N A;  4FJY A;  2LHD A;  2JVC A;  4W9I A;  3BVG A;  2L00 B;  1UGM A;  4OSN A;  3VAW A;  1ZC4 B;  1NU2 A;  3TUO A;  3PLV A;  1ZGU B;  1WSP A;  3TSS A;  3CIK A;  3QBV B;  2B3A A;  4KHO A;  1C4C A;  2L76 A;  4A55 A;  4WWP A;  4RGT A;  4DHJ D;  1SEB D;  1U5E A;  1NEK B;  3TO1 A;  1EWC A;  2W55 A;  1J7C A;  4OHJ A;  1NTI A;  1V1O A;  1ZM0 A;  1PFJ A;  4P1C C;  3W5U B;  3EA6 A;  3OAW A;  1TT5 B;  1V9J A;  2CKH B;  2LXC A;  1P9D U;  1ZPS A;  3M1I B;  2KXJ A;  1VBH A;  4KSK C;  1HE8 A;  5AUK A;  1UPQ A;  4KHA A;  3ETR A;  3X0W A;  3IFW B;  3NS8 A;  2IY0 B;  4EE2 A;  3B08 A;  3I5J C;  3DBR I;  5TSS A;  1WJ4 A;  5J3Q A;  2WX1 A;  1FAO A;  1WGG A;  1UUP A;  1PLS A;  2ZNV B;  3FKY A;  2MLB A;  4M01 A;  2AL3 A;  4JKA A;  2ZCC A;  3NSU A;  2XK5 A;  1VZ8 A;  5JP4 A;  4G0N B;  1OQN A;  2JSV X;  1UH6 A;  5JHH A;  5D3D A;  5H8Y E;  4GDL B;  4CSQ A;  3DVG Y;  4QAY A;  3NJT A;  4XYC A;  2LOX A;  5JHG A;  2CS4 A;  1ROE A;  4TKN A;  1QOF A;  2YEP B;  5BO4 B;  2UVM A;  1HB8 A;  3BII D;  3FSS A;  2KQ7 A;  3DXE A;  2ONQ A;  1R4M I;  1V5O A;  1TGZ B;  4W9C A;  1ZKH A;  3PZ7 A;  4NJ7 A;  2D9W A;  1N61 A;  4LJO B;  1C79 A;  2FE8 A;  2I1K A;  3V3X A;  1QT9 A;  5HFY A;  2CHX A;  2ZKM X;  1HQR D;  1NVL A;  3R7R A;  4XZ4 A;  2G1E A;  4KHB B;  1M7E A;  4ZRI A;  1C9F A;  4S0R A;  5AZH A;  5EFX A;  4W9L A;  4KGT A;  5IKC M;  5D3W A;  1MIZ B;  4C4V B;  2Y7B A;  1D6E C;  5C5B B;  3KWV A;  2W3R A;  2BS3 B;  2ZCB A;  3E9L A;  3B77 A;  3EFC A;  1T77 A;  2KFK A;  2LEK A;  4KAX B;  4DX8 A;  1DRO A;  2R82 A;  3SHQ A;  1C77 A;  1YQB A;  3P7Z A;  4A3O A;  4HDO A;  4RGN A;  3EFU A;  3WYF B;  2ZVN A;  3ML4 A;  2LRW A;  2LZ6 A;  2CB8 A;  4AWJ A;  2BF8 B;  3PSC A;  1A5R A;  1XLQ A;  1V80 A;  1JDE A;  4BKS D;  2ROV A;  2VKI A;  3AE4 B;  2X8X X;  4F7G A;  3TL5 A;  1W1G A;  5BMG A;  2L32 A;  1SIJ A;  3ECI A;  2GB1 A;  1FCL A;  5LLI A;  3D8E A;  2Z0E B;  4I6N B;  1JAL A;  4K2P A;  3L17 A;  2GBN A;  2JX5 A;  1YN3 A;  4DBG A;  4A20 A;  3AE3 B;  3RNE C;  1E6E B;  4A90 A;  1JW9 D;  3QC8 B;  1STE A;  3MJW A;  4YTP B;  2L2I A;  1NI3 A;  3BWU D;  1VD2 A;  4LCD E;  5G55 A;  3VHT C;  3Q3M C;  1P7E A;  2N9E B;  5HG2 A;  3SFD B;  2LI5 A;  1CMX B;  2WXI A;  3AV8 A;  1FNW A;  4W9K A;  2MA9 B;  3Q8B A;  2DZJ A;  4JGH B;  4AOF A;  1VDV A;  4URK A;  3EEC A;  2W2X C;  4K3C A;  1LW3 A;  4PQ0 A;  1IYF A;  1V5P A;  3NZ3 A;  2Y5P A;  2QHO A;  3DWG C;  3ZDT A;  5E6J A;  2N9K A;  5EE3 A;  4E71 A;  1UNS A;  3I57 A;  1XLP A;  5HE0 A;  2KMA A;  2IGD A;  2GBM A;  1ACA A;  2WXF A;  1XT9 B;  3QWM A;  3IT4 B;  1ZP0 B;  3A33 B;  3A8Q A;  3ZTC A;  3ODO A;  4GMV A;  3A1Q B;  2NBW B;  3KRX A;  2Z0D B;  2W9N A;  3SU8 X;  4YON A;  4NAM A;  2Z13 A;  5D3X A;  2JXT A;  2K6D B;  1YIW A;  5DPS A;  2DFK A;  4WJP A;  1KLU D;  2PEA A;  4K17 A;  4JX1 C;  2HTH A;  1WZ0 A;  4M02 A;  2KD0 A;  3MP9 A;  3ZXR A;  2MBO A;  4JKC A;  1LQB A;  4FHK A;  1IRS A;  1PDX A;  4DBB A;  3IAS 1;  1L2N A;  3H7P A;  2LGI A;  4GGQ A;  1WJ6 A;  1AYF A;  1X05 A;  1TYG B;  2W54 A;  2M56 B;  1HB6 A;  3DVN V;  1UNQ A;  5E6P A;  4DHJ B;  1VJK A;  1UBQ A;  4NSW A;  4HJG E;  2IO1 B;  3ONS A;  1T0S C;  3GB1 A;  3QJZ A;  4ZYS A;  1WE7 A;  3NZU A;  1L4D B;  1MFW A;  1WYG A;  2NZ8 B;  5LNK 1;  3SFE B;  4W9D A;  1WX7 A;  5CHF A;  2DLB A;  3IG3 A;  1WX9 A;  2KNB A;  2DA0 A;  1WGH A;  2IZV B;  3UF8 A;  2Q5W D;  4OVV A;  2RLO A;  2Z0Q A;  1F52 A;  4IWO A;  1WGD A;  1MPH A;  1UNP A;  3RNA C;  1WX8 A;  3T3N A;  2DYB A;  4L1R A;  3BK2 A;  3VR9 B;  1L7Y A;  4RFB A;  1HBK A;  3MC9 A;  3E9S A;  1PGA A;  2KUP A; 
#chains in the Genus database with same CATH homology
 2N7D A;  3T8M A;  2IO2 B;  2N23 A;  3F0W A;  3DQV A;  3VVW B;  2EKE C;  4B6H A;  4AUQ C;  1V86 A;  1KLV A;  4DHZ E;  1U5F A;  1K5G B;  2JPH A;  4AJW A;  4EKU A;  1OGW A;  4EEW A;  4F8C B;  3QK0 A;  3KVF B;  3DBL I;  2XK5 B;  3W1Y A;  5JHB A;  2FIF A;  1WH3 A;  5IJM A;  2BKF A;  2MX2 A;  3IVF A;  4AP4 C;  2CY5 A;  5DPR A;  1TZ1 A;  1WR1 A;  4WQO B;  1EUV B;  3WIM A;  5L81 A;  3S2A A;  4FLH A;  2XQN M;  2NS5 A;  4DHZ B;  3R7Q A;  2P0H A;  2LD9 A;  3DCG A;  3TJP A;  3WAL A;  2K8H A;  2DX1 A;  1H10 A;  2PJH A;  1EO6 A;  1EF1 A;  3QAR A;  4HHV A;  1WF9 A;  2J7Q B;  1NI2 A;  3LJU X;  2R2O A;  5JHA A;  2ELA A;  2ZJD A;  2K8B A;  4K7S A;  2FNJ B;  2KWC A;  4IFS A;  4LDT D;  1FGZ A;  3M3J A;  2L7R A;  2KFK B;  1FOE A;  3UQA A;  4EOY A;  3SV1 A;  2G4D B;  4A6F A;  4FJZ A;  2KWV B;  1YJ1 A;  2N7E A;  2ZNV C;  1RFA A;  3ZW3 A;  2D4Q A;  2D9Y A;  4GPT B;  3L10 B;  4HAZ B;  3W1S A;  2NR2 A;  5AZF A;  1X1G A;  3JVZ X;  2ABD A;  1RLF A;  4CYE A;  3A4S C;  5CHV C;  2DZM A;  2ZPN A;  2HRJ A;  3JYU A;  2BYF A;  2L8J A;  3VUX A;  4JKF A;  4MJS A;  4G3X B;  1C1Y B;  1LFD A;  1N3H A;  2COD A;  3BJI A;  3H9D A;  4FA6 A;  5CTR C;  5C5B A;  4HCP B;  2EJ8 A;  2MBE A;  2HE7 A;  3D8F A;  3HIZ A;  1E90 A;  1WGY A;  1XR0 B;  1AQC A;  3QCA A;  1UBI A;  1WVH A;  2MSE D;  2MW5 A;  3VTV A;  3V62 A;  3B1L X;  4K1R B;  4K7U A;  2XEW A;  4YL8 A;  4BFR A;  4ANW A;  3IHP C;  2KFJ A;  1Z5S B;  2W2W A;  3KZ1 A;  1XQQ A;  3SO6 A;  4GMX B;  4DX9 0;  4CHK A;  2COA A;  2C7H A;  4MSQ B;  3OJ4 B;  1OEY A;  1K8R B;  1P0R A;  1P1A A;  5D7G A;  1GC7 A;  4IM3 A;  3HK0 A;  2QKL A;  3P2B A;  2HTH B;  1U2B A;  5D2M B;  3V60 A;  1DIK A;  1V88 A;  1IPG A;  3LJ3 A;  3K9P B;  5HE3 A;  3H7P B;  2IYB A;  3L16 A;  1NDD A;  4EUT A;  3C0R B;  4HPL B;  3H1U A;  1FHO A;  5C1Z A;  1GUA B;  2Y5B B;  4K2O A;  3RD2 A;  5LOP B;  3OAN A;  3B0A A;  4ZRJ A;  3DBS A;  2FUH B;  4HAY B;  4HB4 B;  4NAW A;  4OVU A;  3X23 A;  4HDQ A;  3UQB A;  3A1Q A;  3PGE A;  1WR6 E;  1GC6 A;  3VH4 B;  2V4L A;  1LXD A;  1WXS A;  3HQC A;  1B55 A;  3DVG X;  2K2U A;  2LGY A;  4IG7 B;  1OQY A;  5DHF B;  5JLJ B;  4W9F A;  2ZVO A;  4ANX A;  4HB0 B;  1XOD A;  3NOB A;  4BKT A;  1Y5O A;  2RGF A;  1WG7 A;  1P3Q U;  1I42 A;  5C79 A;  2I5C A;  3H7S A;  4A5K A;  4KIK A;  2UYZ B;  1Q1O A;  1UEL A;  2JT4 B;  4II2 B;  4KZC A;  4B9K A;  4JKB A;  4HAU B;  3U8Z A;  3ZVV A;  2GCL A;  4HVB A;  2KDB A;  2LGD A;  2YVC A;  4ZDV A;  1OEY J;  2C9W B;  1E8X A;  1PMS A;  3RCP A;  1XD3 B;  5J18 A;  3EPY A;  4I6P A;  4LDT B;  3SYX A;  3ZNG C;  2G4S A;  4F7Z A;  2RR9 A;  2YT1 A;  1LM8 B;  2DTC A;  1Y8R C;  3I3T B;  3M62 B;  1TJ6 A;  2NMB A;  2KKC A;  3U7D A;  2LRU A;  1QZE A;  4A6F B;  1KZG A;  4ILJ A;  2L3Z A;  4KDL B;  1WI0 A;  3N3K B;  2FCS A;  5KQ4 A;  1DBH A;  3D32 A;  4ICV A;  3SUZ A;  1UEF A;  4LJP B;  3Q3F A;  4GU2 A;  2QKM A;  2ZZP B;  3CMM B;  5DHA B;  3DOW A;  2BWE S;  1DDM A;  1EVH A;  4XC2 A;  3RT3 B;  3V61 A;  2WX0 A;  1UNR A;  4MJS B;  4TV3 A;  1F9J A;  3GZN I;  5LXH A;  2X0S A;  2ADZ A;  1GJZ A;  4K7W A;  1NTV A;  2NCN A;  1MK7 B;  4MDK E;  2JF5 A;  2CHZ A;  3ZKJ C;  1MK9 B;  5DPT A;  3ML8 A;  1P3R A;  2YLM A;  1V49 A;  1LB1 A;  5G2N A;  2R2Q A;  4DDI D;  3E9P A;  4HLE A;  4DDG D;  1WMH A;  4BKS A;  3QQ8 B;  1J19 A;  1R4N I;  2CAY A;  3PP2 A;  3VOQ A;  4J6I A;  3HM6 X;  2KDF B;  3WAM A;  3CSF A;  2UZR A;  4IOY X;  5DI9 B;  3MDB C;  3WAN A;  2LUL A;  1WE6 A;  4TQ0 A;  5LXI B;  2YT0 A;  1W1H A;  3L13 A;  5FI1 A;  2D9X A;  3KUC B;  3TBL D;  3AUL A;  2MBQ A;  2YSZ A;  1KOT A;  2MP2 B;  2GCJ A;  1BAK A;  4AJY B;  2Y8G A;  2LAS A;  1V5M A;  3O65 B;  2DYN A;  2DX5 B;  4I6L B;  4MGK E;  4MGI E;  2FDQ A;  3A8P A;  1AAR A;  2KLG A;  2MQJ A;  5J2R A;  1Q5W B;  2N1W A;  1WYW B;  2GBJ A;  2DYM A;  3UZT A;  3JSV A;  4W9H A;  3PHW B;  5J17 A;  4NAW B;  2W2X D;  1V81 A;  1U27 A;  1MIX A;  2XBB C;  1U29 A;  4II3 B;  4BVU C;  3VDZ A;  1J0W A;  3ML9 A;  2NPT B;  2GJY A;  3PRM B;  1EGX A;  2MDX A;  1OMW A;  3PRP B;  4KV2 A;  2CR5 A;  2BWF A;  2D9V A;  2LVQ A;  2DHJ A;  3ZIM A;  3GYO A;  2MWS B;  1PQS A;  3PVW A;  2BPS A;  2MBH A;  3DBH I;  4IAP A;  2KWU B;  3K9O B;  4HK2 A;  4CO7 A;  2EMS A;  3TIX A;  4GDK A;  2KX3 A;  2M14 A;  2L05 A;  4KIK B;  3PRE A;  3D8D A;  1V89 A;  3KW5 B;  2BKR B;  2IFS A;  4ANV A;  4FBJ B;  1Y19 B;  3OJ3 A;  3AU5 A;  2LG1 A;  1IP9 A;  1RAX A;  3M63 B;  2J0M A;  1BTK A;  3L0W B;  2O6V D;  3PZD A;  2KOX A;  5C6R A;  4F7H A;  4NJ6 A;  3WA0 A;  4BOS C;  3N32 A;  4JLC A;  1GNU A;  3KUD B;  1WGQ A;  2DEN B;  3SDL C;  4EZL A;  2LUE A;  2A4Z A;  3UIN B;  5JZE B;  4GN1 A;  1E8Z A;  3M95 A;  3RUL A;  2DHK A;  2WDT B;  1WJN A;  2M0X A;  3IBE A;  5TR5 A;  4E74 A;  2KDE B;  2KN5 A;  3JW0 X;  1WZ3 A;  4TQ1 A;  4Y94 A;  1U5D A;  4PS3 A;  3PHX B;  4WAA A;  4P7I A;  2AYO B;  3QAQ A;  2KJ6 A;  2YS3 A;  2KMC A;  4RMA A;  1X1F A;  2MKR A;  4JKE A;  4HAX B;  3T9L A;  5CLL B;  2YRY A;  2BYV E;  2RQ1 A;  2FID A;  2DN6 A;  1E7U A;  2HJ8 A;  4WSF A;  1SE9 A;  1QC6 A;  2E2X A;  3DXD A;  3QIJ A;  2L0F A;  3VUW A;  5HE2 A;  1WMH B;  2RPQ A;  4PYZ A;  3ODX A;  3L08 A;  3ZLZ A;  2JRH A;  4X57 B;  4M0W B;  2K25 A;  4MEM A;  1UD7 A;  2L1C A;  2CRF A;  5DPW A;  1YD8 U;  4RM9 A;  2IO3 B;  1U5G A;  1E7V A;  1V61 A;  2X18 A;  3WAP A;  4DXA B;  4HAT B;  1UZX B;  3W1S C;  2WWZ A;  2JWZ A;  2DLW A;  3F5R A;  2RVB B;  2L0T A;  1OTR B;  3Q3J A;  5CLQ B;  2LXA A;  3ZO5 B;  3PVU A;  5JVL A;  3DXC A;  4W9E A;  3ULB A;  3UIO B;  2IBI B;  4MT7 A;  5D3V A;  4TUU A;  3ZNH B;  4MY6 A;  4HAW B;  3RCZ A;  4EZJ A;  4ICU A;  4ILH A;  3JSV B;  4W9G A;  2FCN A;  2GMI C;  5E6O A;  2AL6 A;  1FHW A;  2KK8 A;  4WJN A;  4MH0 E;  2N0Y A;  2MFQ A;  3ENB A;  3GOE A;  1EAZ A;  5L95 C;  3ALB A;  2C60 A;  4ILG B;  4IUM B;  1V6E A;  4F1S A;  1ZSQ A;  1OY2 A;  2AWT A;  2MP2 A;  1TXD A;  3HHM A;  3MTN B;  2K2J A;  2DX5 A;  3HM3 A;  2REX A;  1BT0 A;  2D10 A;  3SBG A;  3CST A;  1EF5 A;  4B95 A;  2GS0 A;  3QWZ B;  3WAO A;  1WI1 A;  4GDK B;  3VUY A;  2N9P C;  4HAV B;  2N4F A;  2Z59 B;  2R09 A;  2M17 A;  3AI5 A;  1QQG A;  1I35 A;  2KVR A;  2RSU A;  2I5F A;  1WIA A;  2VSZ A;  3SBT A;  2N9X A;  4HB3 B;  4FUL A;  5LON B;  3O96 A;  2NPT A;  1V2Y A;  2KHW B;  2DAJ A;  1SHC A;  1XX0 A;  3LDZ E;  1GGO A;  1H8C A;  3EC8 A;  2BGF A;  2EMT A;  3PV1 A;  3APC A;  2KTR B;  1K5D B;  1ISN A;  2YS5 A;  4JKG B;  4L6E A;  4MM3 A;  4BKG A;  1WXA A;  2D2Q A;  1WY8 A;  5IAA C;  4PS7 A;  2DYO A;  2ROZ B;  3A98 B;  1U4A A;  1KM7 A;  1FB8 A;  2FCM A;  2G45 B;  4EZK A;  4N9F 4;  3APF A;  2BYE A;  3PLU A;  2J59 M;  1E8W A;  1WJM A;  3ZVR A;  5D6J B;  2RGN B;  2KGX B;  2D9Z A;  4FJV B;  4HJK A;  3PRZ A;  2K00 A;  2NBU A;  4WWN A;  1Q67 A;  1P5T A;  1X86 A;  1NBF C;  4PYU A;  1E8Y A;  1BWN A;  3ODW A;  1XKE A;  3TMP B;  2H7E A;  2N1V A;  3V5W A;  2KLC A;  2PPH A;  1TBE A;  2KZR A;  4A3P A;  2C7M B;  3ULC A;  3KUZ A;  5KHO A;  2JP2 A;  3CXB B;  1ZVR A;  1GG3 A;  5DCN A;  3R3M A;  4IC7 B;  1YX6 B;  5AEK B;  1X1M A;  4DK5 A;  3FEH A;  1XCG A;  3TW1 A;  1WXM A;  2JRI B;  3G9W A;  2VRW B;  3VIA A;  2COF A;  5FR6 A;  3PT2 B;  5FI0 A;  4D0N B;  5D27 A;  3ZRC A;  5JH5 C;  1RRP B;  2K6Q A;  3R66 C;  4JQW C;  2P8V A;  3PS6 A;  4GOC A;  3BY4 B;  2ASQ A;  4IM2 A;  4FHJ A;  3AXC A;  4HXD A;  2RUK B;  4WJQ A;  1I7A A;  2DAF A;  5HKH A;  3VXW A;  4BBN C;  1J8C A;  2EC1 A;  3DVN U;  4E3C A;  2J0K A;  5C16 A;  4ANU A;  4Z2N A;  2O2V B;  4JKD A;  2KX0 A;  1KI1 B;  1V5T A;  3NZS A;  5EDS A;  1Q0W B;  3KH0 A;  2COC A;  3N30 A;  2V76 A;  1FXT B;  2LJ5 A;  2Q13 A;  2DYQ A;  2NVU I;  1I2H A;  1BTN A;  3A9K A;  3VQI A;  2KAN A;  1WXV A;  4PNK A;  3NHE B;  3E66 A;  2G35 A;  1X11 A;  1WGU A;  4NQL B;  4JIO U;  4MGZ E;  2UZS A;  1VBG A;  4MGY E;  3PVL A;  2LVP A;  2V1Y A;  3QX1 A;  2Y8F A;  4GIV A;  3KY9 A;  1KBL A;  4HPM B;  1SGH A;  4K81 A;  2KO3 A;  3KRW A;  4NY0 A;  4BOZ B;  3QA8 A;  2DIK A;  3CF6 E;  5CHW A;  2MRP A;  5KCV A;  3V6E B;  5J3Y A;  2WH5 A;  3APD A;  2RD0 A;  4GXB A;  2R0D A;  2KTF A;  4EJN A;  3A9J B;  3TVV A;  4CHM A;  2OTX A;  2K8C A;  1WFY A;  2LOZ A;  1WJ1 A;  2M8S A;  2UWQ A;  3V6C B;  2CY4 A;  4MSM B;  3EHV A;  2PE9 A;  5J3T A;  2FAZ A;  4C0A A;  3FP5 A;  2G3Q B;  4M8M A;  2Z0P A;  5GOW B;  5CX3 A;  3T06 A;  2M38 A;  3U30 A;  2O6V A;  2JUO A;  2FCQ A;  1MKE A;  3PTF C;  4H8S A;  2VRR B;  4IM0 A;  2PZ1 A;  3NY5 A;  3KYC D;  5E6N A;  3RUI B;  4ZRK A;  3H6N A;  1FHX A;  3KYD D;  2FJ9 A;  1NTY A;  1MG8 A;  2HD5 B;  1M94 A;  4A6H A;  5AZG A;  1SIF A;  2COP A;  2KTR A;  4FAD A;  1P6S A;  2GOW A;  2K1F A;  3ZDM C;  2J0J A;  1T0Y A;  2C5L C;  2KC2 A;  2LWP A;  4JKG A;  1TQZ A;  3DDC B;  1Z87 A;  1FGY A;  3MHS D;  3RZW C;  3N7C A;  4IWQ A;  1DDV A;  1J0G A;  1P98 A;  2IY1 B;  1WM3 A;  2KJH B;  2DKP A;  2V3S A;  5C23 A;  1H4R A;  2GBK A;  2CQU A;  1MAI A;  2K39 A;  2KQS A;  2MCN B;  4ASW C;  1DDW A;  5KQ1 A;  2D07 B;  4JKH A;  4KSL C;  4BBN F;  1Z2M A;  2JZ3 B;  4JK9 A;  5D94 A;  1RRB A;  3SNH A;  2FJL A;  5IA7 A;  1VCB A;  4IWP A;  3FM8 C;  2KC1 A;  1RJ2 A;  4EFO A;  2OJR A;  5L83 A;  2KCJ A;  2DHZ A;  4XX5 A;  2DZI A;  2H7D A;  1WJU A;  4GZU A;  4WJ7 A;  4TYZ A;  2MBB B;  1D3Z A;  3UGB B;  4NNJ B;  3HW2 B;  3TFM A;  2C7N B;  1ZW7 A;  3L54 A;  2JZZ A;  3ZNI D;  4XWX A;  4GDL A;  2DKQ A;  3BIN A;  2ZEQ A;  4G11 A;  1M7R A;  2LKO A;  5DH9 B;  2CU1 A;  3GYP A;  3VH3 B;  4M8N A;  4JL9 A;  3RZF A;  4IW0 A;  3SD5 A;  4EMO A;  2DHI A;  2JY6 A;  3TCA A;  2MWN B;  3AU4 A;  2LYD A;  5KHQ A;  3AJ4 A;  2YF0 A;  3FLV A;  4HWI B;  1AWE A;  2WYQ A;  4KZ0 A;  3A9K B;  4WWO A;  3P6A A;  4PS8 A;  2RSG A;  1JRU A;  1KZ7 A;  2GBR A;  5HE1 A;  3QHT A;  1DYN A;  4W9J A;  4HB2 B;  1S1Q B;  2NBV B;  4A6K A;  1ZC3 B;  4B6W A;  3KSY A;  2OQB A;  2YS1 A;  4Z2M B;  1WM2 A;  1UPR A;  3ENE A;  1KJT A;  2IYD B;  4RM8 A;  3ZTD A;  2DZK A;  4MK0 A;  2O2V A;  2LGX A;  1YX5 B;  1KC7 A;  2D3G A;  3E9O A;  3PPA A;  5GMV A;  2OOB B;  1C3T A;  4NPN A;  5D3Y A;  4WVF B;  3PSE B;  4WJO A;  4MEL A;  2D11 A;  4DWF A;  4CHJ A;  3OLM D;  2ZPY A;  4KVG B;  2BCJ A;  2LBB A;  1G6J A;  1WRD B;  2ELB A;  4FN2 A;  2M4N A;  1E5W A;  2O6V B;  4NQK E;  4KDI C;  1S3S G;  2LVO A;  2M1M A;  3ZRF A;  2PE6 B;  2AEH A;  1TTN A;  2CHW A;  4HCN B;  4GSW A;  2Z0O A;  3A4R A;  3MPX A;  2IO0 B;  3RYT A;  3VTW A;  3PEG A;  4F7U P;  5DIF B;  1W1D A;  4GB9 A;  2JXX A;  2KDI A;  3A9J A;  3DPD A;  2RNR B;  4G50 A;  1WGR A;  4ZYN A;  1V5U A;  4JK8 A;  2KJR A;  3VTU A;  1XD4 A;  3PG7 A;  1ST7 A;  3UIP B;  3VFK A;  2P0F A;  2I1J A;  4BBK A;  3ZNZ B;  4JK7 A;  2A5U A;  2P0D A;  3ZUN A;  4FJY A;  2JVC A;  4W9I A;  2L00 B;  1UGM A;  3VAW A;  1ZC4 B;  1NU2 A;  3PLV A;  1ZGU B;  3CIK A;  3QBV B;  2B3A A;  4KHO A;  2L76 A;  4WWP A;  4DHJ D;  1U5E A;  3TO1 A;  1NTI A;  1ZM0 A;  1PFJ A;  3OAW A;  1V9J A;  2CKH B;  2LXC A;  1P9D U;  3M1I B;  2KXJ A;  1VBH A;  4KSK C;  1HE8 A;  1UPQ A;  4KHA A;  3X0W A;  3IFW B;  3NS8 A;  2IY0 B;  3B08 A;  3DBR I;  1WJ4 A;  5J3Q A;  2WX1 A;  1FAO A;  1WGG A;  1PLS A;  2ZNV B;  2MLB A;  2AL3 A;  4JKA A;  2ZCC A;  3NSU A;  2XK5 A;  5JP4 A;  4G0N B;  1OQN A;  1UH6 A;  5JHH A;  4GDL B;  3DVG Y;  2LOX A;  5JHG A;  2CS4 A;  4TKN A;  5BO4 B;  2UVM A;  1HB8 A;  3FSS A;  2KQ7 A;  3DXE A;  1R4M I;  1V5O A;  1TGZ B;  4W9C A;  1ZKH A;  4NJ7 A;  2D9W A;  4LJO B;  2I1K A;  2CHX A;  1NVL A;  3R7R A;  4XZ4 A;  4KHB B;  1M7E A;  4ZRI A;  5AZH A;  5EFX A;  4W9L A;  5D3W A;  1MIZ B;  2Y7B A;  5C5B B;  2ZCB A;  3E9L A;  2KFK A;  4KAX B;  4DX8 A;  1DRO A;  2R82 A;  3SHQ A;  1YQB A;  3P7Z A;  4A3O A;  4HDO A;  3EFU A;  3WYF B;  2ZVN A;  3ML4 A;  2LRW A;  2LZ6 A;  2CB8 A;  4AWJ A;  2BF8 B;  3PSC A;  1A5R A;  1V80 A;  1JDE A;  4BKS D;  2ROV A;  2VKI A;  3TL5 A;  4F7G A;  1W1G A;  3ECI A;  5LLI A;  3D8E A;  2Z0E B;  4I6N B;  4K2P A;  3L17 A;  2GBN A;  4DBG A;  4A20 A;  3QC8 B;  3MJW A;  2L2I A;  4LCD E;  5G55 A;  1VD2 A;  3VHT C;  2N9E B;  2LI5 A;  1CMX B;  4W9K A;  2MA9 B;  2DZJ A;  4JGH B;  4AOF A;  4URK A;  3EEC A;  2W2X C;  1LW3 A;  4PQ0 A;  1IYF A;  1V5P A;  2QHO A;  3ZDT A;  4E71 A;  5HE0 A;  2KMA A;  2GBM A;  1ACA A;  1XT9 B;  3QWM A;  3A33 B;  3A8Q A;  3ZTC A;  3ODO A;  4GMV A;  3A1Q B;  2NBW B;  3KRX A;  2Z0D B;  2W9N A;  3SU8 X;  4YON A;  5D3X A;  2K6D B;  1YIW A;  5DPS A;  2DFK A;  4WJP A;  2PEA A;  4K17 A;  2HTH A;  1WZ0 A;  2KD0 A;  2MBO A;  4JKC A;  1LQB A;  4FHK A;  1IRS A;  4DBB A;  1L2N A;  3H7P A;  4GGQ A;  1WJ6 A;  1X05 A;  3DVN V;  5E6P A;  1HB6 A;  1UNQ A;  4DHJ B;  1UBQ A;  4NSW A;  2IO1 B;  3ONS A;  3QJZ A;  1WE7 A;  3NZU A;  2NZ8 B;  4W9D A;  1WX7 A;  5CHF A;  3IG3 A;  1WX9 A;  2KNB A;  2DA0 A;  1WGH A;  2IZV B;  3UF8 A;  4OVV A;  2RLO A;  2Z0Q A;  4IWO A;  1WGD A;  1MPH A;  1UNP A;  1WX8 A;  2DYB A;  1L7Y A;  1HBK A;  2KUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...