1H4RA

Crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords MERLIN
publication title The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1h4rA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1h4rA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1h4rA01
2DLWA 3M63B 4WJ7A 1C3TA 3X23A 4BKTA 2DZMA 4D0NB 2J7QB 4A6KA 3PLUA 4W9FA 2C7MB 4XWXA 2Z0OA 4HAUB 2C7NB 2JUOA 2M4NA 4URKA 1TQZA 2COPA 2N7DA 2AEHA 4FN2A 2KFKB 2KFKA 1S1QB 3TCAA 4HXDA 1TGZB 4AOFA 4A5KA 1EAZA 5JLJB 2DX5B 1XT9B 2MRPA 3PLVA 2PE9A 5CLQB 1RLFA 4MSQB 4A20A 1FXTB 3PG7A 2MWNB 3DPDA 2J0KA 1WJMA 2HE7A 1WMHB 1U5GA 2IZVB 4XX5A 3L13A 2UZSA 5C16A 1WGUA 1DBHA 4YL8A 4HK2A 2LUEA 2MCNB 2GCJA 2YRYA 2KTRB 2K8BA 1V81A 3EHVA 3D8DA 4F7ZA 2CB8A 1N3HA 2P0DA 4NJ7A 3UQAA 3V62A 1GJZA 3N7CA 2D2QA 2LD9A 1E7VA 3TJPA 3V60A 3MPXA 3PVLA 1ZKHA 3M62B 2L2IA 2RLOA 2FCNA 2KLGA 2LJ5A 4W9HA 5E6OA 2LOZA 3UZTA 1E8XA 2DAJA 5KHQA 2RSGA 2BYFA 2YSZA 3PT2B 3TIXA 1WY8A 4ASWC 3HM3A 4KIKB 5JHBA 2KQ7A 2GCLA 2ZVNA 3TMPB 1CMXB 4P7IA 4GOCA 4ICVA 1U5DA 5JP4A 3TFMA 2FUHB 5DHAB 5AZFA 2Y8GA 4M8MA 4BBNC 3ZVRA 2N1WA 2N9XA 1WJ6A 2BKFA 4EMOA 3QWZB 3OJ3A 5CHFA 2XK5A 2RGFA 3DVGY 1RJ2A 1W1GA 1WGYA 3CSFA 2REXA 5J17A 2JVCA 2JP2A 3AXCA 4Z2NA 2D9YA 4FBJB 2MLBA 4WJNA 4G50A 3DBSA 2MBHA 4HAWB 3WAOA 3H6NA 3C0RB 4KZ0A 2HRJA 2VRWB 3CSTA 5DPTA 1WH3A 3ZNGC 2FJLA 4B95A 3ZNID 4AJWA 2GOWA 2NS5A 1RRPB 3H7SA 2LGXA 3BINA 3NZSA 2NBUA 1P6SA 1WM3A 1KM7A 3ODWA 4K1RB 3PP2A 2X18A 3ZDTA 2R2QA 2JXXA 3IBEA 3H7PA 2R09A 1IRSA 2WDTB 1ZC3B 3L10B 1RRBA 1X86A 2C7HA 4GDKA 5CX3A 2L05A 1OEYJ 3BY4B 3ZTDA 2YS1A 3EFUA 2FCSA 1ZVRA 2XEWA 2O6VB 1IPGA 4GN1A 1QQGA 2L0FA 3DXEA 4CYEA 2UWQA 4GSWA 4LDTB 2JRIB 3CF6E 1UNPA 1T0YA 3RULA 3ODOA 2DYBA 1Z5SB 1ISNA 4DHJB 4NQKE 1TXDA 5DPWA 1WGGA 4HAXB 1OMWA 2BF8B 2G3QB 1X1GA 1P5TA 3P6AA 1KLVA 2IYDB 5LXIB 5J3QA 3A98B 3NHEB 3VOQA 1SE9A 1QC6A 2COFA 3PTFC 2CQUA 1WX8A 4MGKE 3L16A 1XX0A 3RZFA 1OY2A 2JZZA 3K9PB 2KDBA 2ELBA 1EVHA 3R3MA 3FEHA 1ZM0A 1V89A 5L83A 4FA6A 4MH0E 3ENEA 4GXBA 5J18A 4RM8A 5JZEB 3OLMD 4MGIE 3KY9A 3NY5A 4IWQA 1PMSA 3TO1A 2KHWB 4BFRA 3RYTA 2C60A 2ZPYA 5KCVA 5HE3A 3UF8A 4G0NB 3V61A 4MSMB 3PS6A 4II3B 4PS8A 2KX0A 3U8ZA 1GG3A 3D32A 3OAWA 3APCA 3WALA 1F9JA 4W9DA 2M1MA 4K81A 1S3SG 3AJ4A 2NBVB 3APDA 5AZGA 2LOXA 3ZRFA 2LBBA 4DBGA 3ML9A 2Z0QA 3IG3A 4A6FB 5KHOA 2CODA 1FGZA 2E2XA 2JRHA 3VH4B 1ACAA 3ZO5B 4HAZB 2KUPA 3SV1A 2MKRA 1TJ6A 2ZEQA 1M7RA 3NS8A 4KDIC 3RCPA 4NJ6A 3HIZA 3VHTC 2CKHB 2DAFA 4MDKE 4GB9A 2JPHA 1HBKA 5CLLB 2KFJA 2KC1A 2DKPA 3KRWA 4BBKA 5DIFB 2ZNVB 4LJOB 2MBBB 1U2BA 1TBEA 2HJ8A 1X1MA 1HB8A 1DDWA 3RCZA 3FM8C 5D94A 2MWSB 2KGXB 2K00A 4A3PA 1V86A 2MSED 1OQYA 4WJPA 2WWZA 3DOWA 3UGBB 4WSFA 3HM6X 3WA0A 4FJVB 2K8CA 1E8YA 3QARA 4M8NA 2N7EA 5L95C 2H7DA 4A6HA 4NPNA 1X11A 5D27A 3MTNB 1U5FA 5FR6A 2P8VA 2K6DB 4WWNA 4NQLB 1J19A 2FJ9A 2BYVE 4HPLB 3PPAA 3UIOB 1ZGUB 1DDVA 2I5CA 1WJUA 3PRPB 3WAMA 2ROVA 2N1VA 1WR1A 2PEAA 3APFA 1TTNA 1BTNA 4HLEA 2W2WA 4MY6A 2KCJA 1V80A 1RAXA 3CMMB 2LXAA 4MGYE 1OEYA 2HTHB 2HTHA 2IFSA 3ECIA 3BJIA 4AWJA 3N32A 4GGQA 3B1LX 1Y5OA 4DWFA 1U29A 4HDQA 3A4SC 2GBMA 2DHIA 2RSUA 4WJOA 2BKRB 4W9CA 3L54A 4E71A 3H9DA 4KVGB 1EO6A 4CHJA 1NTIA 5J2RA 3B08A 2NBWB 1SHCA 2Y7BA 1ZW7A 2KJHB 4NSWA 1YX6B 2DTCA 2G4DB 2DX5A 3PSEB 2KWCA 2EMSA 4IM3A 1I7AA 5JHHA 4IWOA 3G9WA 2KDIA 5JHGA 2LRUA 1J0WA 3T9LA 2K39A 2DKQA 4CHMA 5DI9B 4GPTB 3VDZA 2KNBA 1WMHA 4IM0A 2D4QA 1FOEA 3ZTCA 2OQBA 3R7RA 2Q13A 2AL3A 1NDDA 5CTRC 1OGWA 1V5MA 2KJ6A 3DXCA 4RMAA 1FHXA 2KTRA 4W9JA 1U4AA 4ZRIA 2PJHA 1WZ0A 1EUVB 3R7QA 3WYFB 2D07B 1DDMA 1E8ZA 1P98A 4MT7A 2FIFA 3MDBC 2R0DA 1M94A 3KRXA 1WGHA 5C23A 3B0AA 1WZ3A 5D3VA 1UPRA 3HQCA 3D8FA 2WH5A 3VXWA 2O6VD 4WWPA 4LDTD 4YONA 4DX8A 1MK9B 2FNJB 1EF1A 3QCAA 4FULA 2JY6A 2V3SA 1L2NA 3DDCB 2KX3A 4BKGA 4KIKA 4DHJD 3DVNU 2QHOA 1IP9A 2D9VA 2LGYA 1JRUA 3KYDD 1NI2A 2DENB 4FJZA 2YT1A 2ZNVC 2W9NA 1IYFA 4AP4C 1Z87A 2BWES 4B6WA 4RM9A 2GJYA 1H10A 4IOYX 1TZ1A 2UZRA 1UGMA 4FHJA 1YD8U 3QC8B 4KHOA 1WR6E 2CRFA 2GS0A 4BOSC 5D6JB 1Y19B 1UNRA 4MJSB 2G4SA 2K1FA 2LKOA 1DYNA 3IHPC 3A1QB 3ZNZB 3T06A 1I42A 4Z2MB 1E90A 4CHKA 2EKEC 2H7EA 2NPTB 1XKEA 2LASA 3IFWB 3LDZE 2Z0DB 1R4NI 1M7EA 2QKLA 4WAAA 4GZUA 1NVLA 4DX90 2EJ8A 4AUQC 4ICUA 2KXJA 1NBFC 2CY4A 1V9JA 2I5FA 2ZVOA 1MK7B 2V76A 2LRWA 2DYMA 4EKUA 5DCNA 1UELA 3PRMB 4HJKA 2COAA 2Z0EB 4DK5A 2P0FA 4IWPA 5G2NA 4DDID 2ZZPB 3QJZA 4EOYA 2AWTA 5DPSA 1E5WA 4IW0A 4ZYNA 4A3OA 4DBBA 3VTUA 1D3ZA 2W2XC 4JQWC 1YX5B 3X0WA 1HE8A 3RT3B 1FGYA 2LXCA 2O6VA 2IO0B 2OJRA 2KKCA 1WJ1A 2KK8A 1UNQA 3T8MA 3WAPA 4ANWA 4H8SA 1WJ4A 2JZ3B 2FDQA 3RUIB 3M95A 1FB8A 4DHZE 3N30A 1V88A 2RR9A 1J8CA 3D8EA 4HHVA 2CU1A 1Q67A 4F7UP 4GIVA 1H8CA 2M8SA 3GOEA 3ZLZA 4LCDE 4TV3A 4WWOA 4DDGD 4PQ0A 3TL5A 2UYZB 4IFSA 2L0TA 2ROZB 3SUZA 4F1SA 3SYXA 4B6HA 2RUKB 3ULCA 2MQJA 2L3ZA 2MBQA 4HB0B 3W1YA 2QKMA 3KH0A 3OJ4B 3A8PA 2NVUI 4W9KA 4TQ0A 3PGEA 4MELA 1K8RB 2KC2A 4JGHB 3QAQA 4WVFB 5LXHA 2MDXA 3V5WA 4NNJB 1VCBA 1L7YA 2FCMA 2I1KA 3OANA 2M17A 3KVFB 3ZDMC 4Y94A 2GBRA 4ZRKA 2VRRB 1MAIA 2Z59B 1WE6A 3A33B 4MM3A 1WGRA 5G55A 2IYBA 1UBQA 4WQOB 2K8HA 2BCJA 1UEFA 4NAWB 2AYOB 4ZDVA 2ZJDA 5HE0A 2M0XA 2J0MA 3NOBA 3W1SA 3NZUA 3VVWB 1P3QU 3GYOA 1DROA 3P2BA 4HAVB 3NSUA 4A6FA 1FHOA 2C5LC 3SNHA 2W2XD 4KAXB 1AQCA 4HATB 4JL9A 4KV2A 3Q3JA 3JSVB 3PV1A 2O2VB 4FHKA 4K17A 1P0RA 2BWFA 1Q1OA 4I6LB 5IA7A 2CR5A 4LJPB 2D3GA 2KANA 5J3TA 4HB4B 3A9JB 3HW2B 2DYOA 2D9XA 1XD3B 4E3CA 1X1FA 3CIKA 3TBLD 4EEWA 1YIWA 1WIAA 1LB1A 3DBHI 3VQIA 4KSKC 1PFJA 2R2OA 5C79A 2YLMA 2IY0B 1Z2MA 1HB6A 4EJNA 2LULA 2LZ6A 3H1UA 2GMIC 3HK0A 5EDSA 3RZWC 4I6NB 3ZKJC 2DA0A 3EECA 4I6PA 2JT4B 5CHVC 1P3RA 3AULA 1NU2A 1OTRB 2K25A 2LVPA 5BO4B 1KZGA 3VFKA 1U27A 2ZCBA 1WGQA 5DH9B 3V6CB 5J3YA 5C5BB 1E8WA 2ADZA 2ELAA 3PEGA 2VKIA 3ALBA 4HB2B 2RPQA 2KMAA 1R4MI 2DX1A 1WI0A 4GMVA 2KWUB 3CXBB 4PS3A 2L8JA 1Y8RC 1LFDA 1W1DA 3EC8A 5D3XA 1K5GB 2CY5A 4MEMA 4K7UA 2FCQA 4W9EA 2KTFA 4EFOA 4KHAA 2ZCCA 1XD4A 2V1YA 4EZLA 3MJWA 4KSLC 3ULBA 1FAOA 3SU8X 3VH3B 3M1IB 1LM8B 3A8QA 2WYQA 3ML4A 2D9WA 5GOWB 5LOPB 4HCPB 3A4RA 5EFXA 1KOTA 2CHWA 3PHWB 2GBNA 1YQBA 1WXSA 2DZKA 1WXAA 3PVUA 1J0GA 2MW5A 4AJYB 4F7HA 4W9GA 4BBNF 3EPYA 3UQBA 4F8CB 2IBIB 1WGDA 3TW1A 2WX1A 3UINB 4ZRJA 3PRZA 2M14A 4K2PA 1OQNA 5JH5C 3SDLC 4JIOU 1MIXA 2IY1B 3KUDB 2YS5A 1AARA 2PZ1A 4B9KA 4IM2A 1V49A 1Q5WB 4TYZA 2Y5BB 1EF5A 5DHFB 3JVZX 5FI0A 2JF5A 1WXMA 3AI5A 2K2UA 4BOZB 1H4RA 3W1SC 2YS3A 2EMTA 3U7DA 5AZHA 3K9OB 4FADA 3ZRCA 4ANXA 2KOXA 3S2AA 3DBRI 3DQVA 2KD0A 3PSCA 3KZ1A 4PNKA 2KQSA 3QX1A 1MG8A 1KJTA 4DXAB 3VTVA 1WX7A 5HE2A 3GZNI 2LGDA 2A4ZA 1BT0A 1ST7A 5D7GA 4HB3B 4FLHA 3SO6A 3KUZA 4K7SA 1RFAA 2DHZA 1WG7A 2WX0A 4XZ4A 2LI5A 1WRDB 5C1ZA 1ZC4B 5HE1A 3WANA 2D11A 2LVOA 2JWZA 3GYPA 5LLIA 4WJQA 4J6IA 1KZ7A 1YJ1A 2KO3A 2BPSA 2C9WB 4MGZE 3TVVA 4CO7A 2LYDA 2CHXA 2L00B 3PHXB 4KZCA 1Q0WB 2FIDA 3F0WA 4BKSD 1PLSA 1PQSA 2KLCA 3JYUA 1WFYA 4MJSA 4E74A 4W9LA 1X05A 1ZSQA 4PS7A 3ML8A 3A1QA 1WF9A 2PPHA 1WYWB 2XK5B 2DHJA 1V61A 2J59M 3ODXA 2N4FA 2KJRA 3ZNHB 1WM2A 3FP5A 2NPTA 4G3XB 3VAWA 1B55A 3KYCD 1EGXA 1A5RA 1MPHA 2ASQA 1SGHA 4EZJA 2VSZA 1WJNA 2Y8FA 3ZVVA 3SHQA 2CAYA 2KDEB 2MP2B 1QZEA 2MP2A 3MHSD 2RGNB 5E6NA 3SD5A 2L1CA 2N9PC 1GUAB 1LW3A 3U30A 2LG1A 2K6QA 4W9IA 1K5DB 2CHZA 1V5UA 2MBEA 3DXDA 5LONB 1I35A 2DFKA 4KDLB 4TKNA 3FLVA 4GMXB 2V4LA 3H7PB 3VIAA 4N9F4 3Q3FA 4K7WA 3RD2A 2KVRA 3UIPB 2N9EB 2DHKA 5C6RA 1V6EA 4GDKB 4M0WB 5KQ4A 4GDLB 4GDLA 2RD0A 4EUTA 2NMBA 3I3TB 2KMCA 3HHMA 3ZUNA 2J0JA 4HDOA 2MA9B 4NY0A 3O96A 1BAKA 2ZPNA 4OVVA 5AEKB 3JW0X 2FAZA 4IC7B 1XQQA 2DN6A 1P9DU 2LVQA 3QA8A 5IAAC 2N0YA 2RQ1A 4TQ1A 2YT0A 4KHBB 1GNUA 1V5OA 4BKSA 2BGFA 5D2MB 3LJUX 2AL6A 2YF0A 3QWMA 4IAPA 2KDFB 2XQNM 2MX2A 1E7UA 5IJMA 1FHWA 2IO3B 3P7ZA 1XCGA 1XODA 4C0AA 1UBIA 3PVWA 3V6EB 5KQ1A 1WXVA 2HD5B 5HKHA 3KW5B 1LQBA 1GC6A 2M38A 4K2OA 3DVGX 5GMVA 2NCNA 3O65B 1C1YB 4TUUA 4L6EA 3ZIMA 2ABDA 2IO1B 2B3AA 2GBKA 1G6JA 4HAYB 4XC2A 1BTKA 4NAWA 2KZRA 3KUCB 4PYUA 3QBVB 2RVBB 3AU5A 4HPMB 1WX9A 4HCNB 4EZKA 1GC7A 3DBLI 4G11A 4F7GA 2KWVB 5JHAA 3N3KB 2D9ZA 3JSVA 2O2VA 5D3WA 4BVUC 2NR2A 3L08A 2G45B 3R66C 2A5UA 3WIMA 2PE6B 5L81A 1UD7A 1AWEA 4HWIB 2DZJA 1SIFA 3L17A 4HVBA 3ZW3A 4OVUA 4JLCA 4PYZA 2IO2B 1MKEA 2P0HA 3F5RA 1UH6A 3A9JA 2CS4A 1WI1A 3LJ3A 3VTWA 3VUYA 4IG7B 3AU4A 1V5TA 4X57B 1KI1B 2COCA 2RNRB 1VD2A 5TR5A 2MFQA 4DHZB 3VUXA 3VUWA 2G35A 2KN5A 2YVCA 2GBJA 2I1JA 5CHWA 1LXDA 2D10A 2DZIA 3A9KB 2BYEA 4MK0A 3A9KA 2UVMA 3L0WB 4II2B 3IVFA 2Z0PA 1WE7A 2OOBB 3ONSA 3KSYA 1I2HA 3QIJA 2DYNA 1NTYA 1W1HA 2N23A 1V5PA 2DYQA 3FSSA 5C5BA 2MBOA 1MIZB 2L76A 4IUMB 5D3YA 1V2YA 1P1AA 2EC1A 1U5EA 1WVHA 2OTXA 2K2JA 3M3JA 2L7RA 3DVNV 5E6PA 3QK0A 3QQ8B 3PREA 2NZ8B 2XBBC 1BWNA 1XR0B 3QHTA 5FI1A 2LWPA 1UZXB 1UPQA 4ANUA 4FJYA 4ANVA 4GU2A 3DCGA 5DPRA 3PZDA 1NTVA
chains in the Genus database with same CATH superfamily
1FCCC 2DLWA 1SIJA 3M63B 4WJ7A 3KQ4A 5BMHA 1C3TA 3X23A 1QF6A 4BKTA 2DZMA 4D2KA 1TT5B 4D0NB 2J7QB 4A6KA 3PLUA 3AE2B 4W9FA 3BK1A 2I38A 2C7MB 2BB6A 4XWXA 2Z0OA 5BYQA 3HRDD 4HAUB 4QJ5B 2C7NB 2JUOA 2M4NA 4URKA 1TQZA 2COPA 2N7DA 2AEHA 4FN2A 2KFKB 2KFKA 1S1QB 3TCAA 4HXDA 1TGZB 4AOFA 2IGHA 1V1PA 3DHHC 4A5KA 5IOIA 1EAZA 3NVZA 5JLJB 1WYGA 2DX5B 1XT9B 2MRPA 3PLVA 3IT4B 1SF0A 2PE9A 5CLQB 5TSSA 1RLFA 4MSQB 4A20A 1FXTB 2L32A 3PG7A 2JU6X 1UWXA 2GB1A 2MJEA 3ZXVA 2MWNB 1EU4A 3DPDA 2J0KA 3RPFC 1WJMA 1XCQL 2HE7A 1WMHB 1U5GA 1MFWA 4KGRA 1N62A 1L6VA 2IZVB 4XX5A 1AWDA 4A8XC 3L13A 3P1MA 2UZSA 5C16A 1WGUA 1DBHA 1RM6C 4YL8A 4HK2A 2LUEA 2MCNB 4JKCA 2GCJA 1QLBB 3AE3B 2K22A 4R3DA 2YRYA 4QXAB 2KTRB 1YJJA 3V05A 1T77A 1V81A 2K8BA 3EHVA 4N58A 1VDVA 3D8DA 4F7ZA 2CB8A 3DBLB 1N3HA 2P0DA 1VZ6A 4YTNB 4NJ7A 3UQAA 2WXOA 3AE4B 3V62A 2PVOD 3I57A 1GJZA 3SBTA 3HUIA 3N7CA 2D2QA 2NMQA 1L4ZB 2LD9A 1E7VA 3TJPA 3V60A 3MPXA 3PVLA 1ZKHA 1ZYIA 3M62B 2L2IA 2RLOA 2FCNA 4RCOA 3A58A 2KLGA 2LJ5A 4W9HA 5E6OA 2LOZA 3UZTA 1E8XA 2DAJA 5KHQA 3WCQA 2NTSA 2WP9B 2RSGA 2BYFA 2YSZA 3PT2B 3TIXA 1VZ8A 4JKBA 1WY8A 4CQNA 4ASWC 3HM3A 4JKEA 3DHIC 4KIKB 5JHBA 2KQ7A 1F0ZA 2GCLA 2KVZA 2ZVNA 3TMPB 1CMXB 4P7IA 3H8HA 1KC7A 1MVKA 4GOCA 1T0QC 4ICVA 1U5DA 2WU5B 5JP4A 3TFMA 2FUHB 4IDIA 5DHAB 5AZFA 3Q8CA 2Y8GA 4M8MA 4BBNC 3ZVRA 1GB4A 2N1WA 1FM0D 3AE5B 3P42A 2N9XA 1WJ6A 2BKFA 3N1ZC 1JCKB 1TIFA 4EMOA 2AQ1B 3QWZB 3UI3A 4ITKA 3OJ3A 5CHFA 4QJ4B 2XK5A 3AEDB 2RGFA 3DVGY 1RJ2A 3TEYA 1W1GA 3NVYA 2ONQA 4YSZB 1WGYA 1JWSD 3CSFA 2EELA 2REXA 5J17A 2JVCA 3NG0A 2JP2A 1KRHA 3AXCA 4Z2NA 2D9YA 2IGGA 4FBJB 2MLBA 4WJNA 4G50A 3DBSA 2MBHA 4HAWB 3WAOA 2EKIA 3GE8C 3C0RB 3H6NA 4KZ0A 4Q2JA 2HRJA 2VRWB 1ZDXA 3TEXA 3CSTA 5DPTA 1WH3A 3ZNGC 3NVVA 2KDMA 1CZPA 2FJLA 4B95A 3ZNID 1N63A 4AJWA 1I4HA 1QILA 2GOWA 2NS5A 1RRPB 2IPKD 1TY2A 3H7SA 2LGXA 3BINA 3NZSA 2NBUA 4GOUA 2GI9A 1P6SA 1TS4A 1WM3A 1KM7A 3ODWA 4K1RB 3PP2A 2OEDA 2KN4A 1JWAD 3DWGC 2D3AA 2X18A 1AYFA 3BK2A 3ZDTA 1FXAA 2R2QA 2JXXA 3IBEA 2JXTA 2R09A 1N61A 3H7PA 1IRSA 2WDTB 1ZC3B 3L10B 3FILB 3NWDA 1V97A 3MC9A 3MHZA 1RRBA 1X86A 1HTQA 2NTTA 2C7HA 4GDKA 5CX3A 2L05A 1OEYJ 3BY4B 4M0WA 1MG4A 3ZTDA 4M00A 2YS1A 3EFUA 3N9YC 2FCSA 2GLSA 1ZVRA 2XEWA 1XLOA 2BS2B 1IPGA 2O6VB 4GN1A 1QQGA 2L0FA 3DXEA 4CYEA 2UWQA 2V4IB 4GSWA 4LDTB 2H89B 1TS3A 1MI0A 2JRIB 3CF6E 1UNPA 1T0YA 1I4GA 3RULA 3ODOA 2JWUA 2DYBA 4WQMA 1Z5SB 1ISNA 3T3OA 1ROEA 4DHJB 4NQKE 2DBYA 1TXDA 5DPWA 2BT6A 1WGGA 1C4AA 4HAXB 4P6VF 1OMWA 1PUTA 2BF8B 3NJTA 4XDCA 1YQ4B 2G3QB 1X1GA 2LMCA 2W54A 1P5TA 3P6AA 1KLVA 2IYDB 1QOBA 5LXIB 5J3QA 3A98B 4KHBA 2LJIA 3AEEB 3NHEB 1PGBA 3VOQA 1WGKA 3RNGC 3PZ8A 4S0RA 1JROA 1SE9A 1QC6A 2COFA 4A9AA 3MC8A 3PTFC 2CQUA 1WX8A 4MGKE 3L16A 3NS1A 1XX0A 1P7FA 3RZFA 1OY2A 2JZZA 3NW8A 2WXIA 3K9PB 2M56B 2KDBA 3AE8B 4K3BA 2ELBA 1EVHA 3R3MA 1OQQA 3RN9C 3FEHA 1ZM0A 1V89A 5L83A 4FA6A 1V1OA 1ZOYB 4MH0E 1ACCA 2MHJA 2XNAC 3ENEA 1C76A 4GXBA 5J18A 3BYTB 4RM8A 5JZEB 3OLMD 4MGIE 3KY9A 3NY5A 4IWQA 1SXTA 1PMSA 4JK9A 2MH7A 3TO1A 1TY0A 2KHWB 4BFRA 3RYTA 2C60A 4MM3B 2ZPYA 5KCVA 5HE3A 1B1ZA 1UGJA 2X8XX 3UF8A 4G0NB 5IN7A 1PGXA 3V61A 4MSMB 1CK1A 1T6BX 1FRRA 3PS6A 4II3B 4PS8A 1VBHA 2KX0A 2VZKB 1FD6A 1P7EA 3U8ZA 1GG3A 3D32A 3OAWA 3RNFC 3APCA 4J3OD 3WALA 1F9JA 4NAMA 2YEPF 4W9DA 2M1MA 4K81A 1QOFA 1S3SG 3AJ4A 2NBVB 3APDA 5AZGA 3RFZB 3VR8B 1STEA 2LOXA 3ZRFA 4AS1A 2LBBA 4DBGA 3ML9A 2Z0QA 3IG3A 4A6FB 5KHOA 3GB1A 4LNIA 2CODA 1FGZA 2E2XA 2ACZB 2BYTA 2JRHA 3VH4B 1ACAA 1YNTE 3ZO5B 4HAZB 4DXGA 2KUPA 3SV1A 5I2SA 2MKRA 1TJ6A 4TMAB 4UDUC 2ZEQA 3AE6B 1M7RA 1JDEA 3NS8A 1I4XA 4KDIC 3RCPA 4NJ6A 3HIZA 3VHTC 2CKHB 2WU2B 4YTMB 2DAFA 4MDKE 4GB9A 1F2RI 2JPHA 2WXJA 1HBKA 2XN9C 5CLLB 2KFJA 1XEEA 2D3CA 2FE8A 2KC1A 2DKPA 3KRWA 4BBKA 1XLNA 2BS3B 4JK7A 5DIFB 2ZNVB 1HZ5A 4LJOB 2MBBB 4JKHA 1U2BA 1TBEA 1ET9A 2HJ8A 1PFDA 1X1MA 1L6UA 2ZW1A 1HB8A 1ZE3D 1DDWA 2WXHA 3RCZA 3FM8C 5D94A 2MWSB 4LNOA 2KGXB 2INCC 4A6QA 2K00A 1JQ4A 3ABVB 3Q3OC 2G9HD 4A3PA 1V86A 2E6XA 5E6JA 4ACFA 2MSED 1OQYA 4WJPA 2K0PA 2WWZA 3DOWA 3GS2A 3UGBB 4WSFA 1HA5A 2UU7A 3WA0A 3HM6X 2RMMA 4FJVB 3ZGZA 2K8CA 1E8YA 2BVCA 1DIKA 1TS2A 3AECB 3QARA 1FPYA 2HDEA 4M8NA 2N7EA 5L95C 2H7DA 4A6HA 4NPNA 1X11A 5D27A 3MTNB 4YSXB 1U5FA 5FR6A 2R82A 2P8VA 1XLQA 2K6DB 2WLBA 3EUB2 1EWYC 1UNSA 4WWNA 4NQLB 1J19A 2FJ9A 3GE3C 4C56C 1CQVA 3BVGA 3OHMB 2BYVE 3Q8EA 4HPLB 1KTKA 5HG2A 1ZGUB 3PPAA 1DDVA 3UIOB 2I5CA 1WJUA 4DQOC 3PRPB 2MEKA 2PVGC 2RDBC 3WAMA 2ROVA 2N1VA 1WR1A 2PEAA 2KYWA 5I4DA 3APFA 1TTNA 1BTNA 3U2SC 1BUIC 4HLEA 2W2WA 1SBBB 4MY6A 3V3XA 2KCJA 3TEWA 1V80A 1RAXA 3CMMB 2LXAA 4JPSA 4MGYE 1DOYA 4DXFA 1OEYA 1ZXIA 1UF0A 3U7ZA 3VR9B 2HTHB 2HTHA 2IFSA 3ECIA 1ESFA 4KKJA 3BJIA 2WDQB 4AWJA 3N32A 4GGQA 3B1LX 2ICIA 1Y5OA 4ILJA 4DWFA 4MACA 1U29A 4HDQA 2KWDA 3A4SC 2GBMA 1SJED 2DHIA 2RSUA 4WJOA 2BKRB 4W9CA 3L54A 4E71A 3H9DA 4LK0M 4KVGB 1EO6A 4CHJA 1NTIA 5J2RA 3B08A 2NBWB 2J53A 1SHCA 2Y7BA 4OZCA 1ZW7A 4K3CA 3P63A 2SAKA 3ZQ4A 2KJHB 4NSWA 1FNWA 2WQYB 5MPOA 1ET6A 1XCTL 1YX6B 2DTCA 2G4DB 2DX5A 3PSEB 3Q3NC 5HFYA 1OQRA 2KWCA 2EMSA 4IM3A 2HJ1A 1I7AA 5JHHA 4IWOA 3G9WA 2KDIA 3EFCA 5JHGA 4B0EA 2ZKMX 2KQ4X 2KACA 2LRUA 3NVWA 1J0WA 1PDXA 3T9LA 2K39A 1XO3A 2DKQA 3EA6A 4CHMA 5DI9B 4GPTB 3VDZA 2KNBA 4C7YA 4HRSA 1WMHA 4IM0A 2D4QA 4XWWA 1FOEA 1L0YB 2WXRA 3ZTCA 2K49A 3DWMA 2OQBA 3Q14C 3R7RA 2Q13A 4ARIA 2V0GA 2AL3A 1NDDA 5CTRC 4REZA 1HXYD 3B2FA 1OGWA 1V5MA 2KJ6A 3HIEA 1XXGA 3DXCA 4RMAA 1FHXA 2KTRA 4W9JA 5BYRA 1IBXB 2N9LA 1Q10A 1U4AA 1QOGA 2I2YA 4ZRIA 2PJHA 1WZ0A 1EUVB 3R7QA 3WYFB 2D07B 1DDMA 1E8ZA 1P98A 1C9FA 1N60A 4FXCA 4MT7A 2FIFA 3MDBC 2L1AA 2R0DA 1M94A 2Z13A 4RH6A 3IT6B 4LTUA 3C19A 3KRXA 2FUG1 2N0SB 1WGHA 5C23A 3B0AA 1N5XA 4ZYSA 1WZ3A 5D3VA 1UPRA 3HQCA 4WWMA 3D8FA 2WH5A 1K52A 2AQ2B 2O6VD 3VXWA 4WWPA 1MJDA 4LDTD 4YONA 4DX8A 1MK9B 4RF0A 2FNJB 1EF1A 3QCAA 4FULA 3RNAC 4JKDA 1UWMA 4KGTA 2JY6A 1NYRA 4PT5A 2V3SA 1L2NA 3DDCB 2KX3A 4BKGA 1WRIA 4KIKA 4DHJD 1YN3A 3DVNU 2QHOA 1IP9A 2D9VA 2LFIA 1I4QA 2LGYA 1D4BA 1AW7A 1JRUA 4XDDA 3KYDD 1NI2A 5BMIA 2DENB 2RRFA 4FJZA 2WS3B 1TKYA 2R61A 2YT1A 2ZNVC 4US8A 4RGOS 4YSYB 2W9NA 1AN8A 1QKZA 5EE1A 1IYFA 4AP4C 1Z87A 2KMMA 4QAYA 2BWES 1D6EC 1T5XD 2RDHA 4B6WA 4RM9A 2GJYA 3KWLA 1H10A 4IOYX 4D6WA 2WXNA 3LYYA 1TZ1A 2UZRA 1FFVA 1T3QA 1UGMA 2QSDA 4FHJA 1YD8U 3QC8B 2X0SA 1WR6E 4KHOA 2W55A 2CRFA 2GS0A 4BOSC 5D6JB 1Y19B 1UNRA 4USAA 4MJSB 2J42A 2G4SA 2K1FA 2WDVB 2LKOA 1DYNA 3B9JA 3IAS1 3IHPC 3A1QB 3ZNZB 3T06A 1I42A 4Z2MB 1E90A 1J7AA 4CHKA 2EKEC 4OVZA 3MC0B 2H7EA 1RFKA 1FRDA 5EE3A 2V3PA 1GAQB 1K51A 2NPTB 1XKEA 2LASA 3IFWB 3LDZE 1WSPA 1R4NI 2Z0DB 4S17A 1M7EA 2QKLA 4WAAA 4GZUA 1NVLA 4DX90 2EJ8A 4AUQC 4ICUA 3NUHB 1MHHE 2KXJA 1GOZA 1NBFC 2CY4A 1V9JA 2GRIA 2I5FA 2ZVOA 3URYA 1MK7B 2V76A 2VZKD 1XLPA 2LRWA 3RNEC 2DYMA 4EKUA 5DCNA 1UELA 1JRPA 2WXGA 3PZ7A 3PRMB 4HJKA 2COAA 2N9KA 2Z0EB 4JWSC 4DK5A 2P0FA 2N7JA 4IWPA 5G2NA 4DDID 1T0RC 2ZZPB 3VRAB 2KIGA 3QJZA 3BYYB 3FILA 4EOYA 2AWTA 1Y56A 5DPSA 3NRZA 2J4XA 3SBGA 1E5WA 2MJ3A 3DCXA 4IW0A 1HTOA 4ZYNA 3Q8AA 4A3OA 1KBLA 4DBBA 1DOXA 3SFDB 3VTUA 1D3ZA 1FCLA 2JX5A 3J9CA 2W2XC 4JQWC 1YX5B 3X0WA 1HE8A 3RT3B 1FGYA 2LXCA 2O6VA 2IO0B 2OJRA 2KKCA 2YEPB 1WJ1A 2KK8A 1UNQA 3T8MA 4AQ7A 1C78A 2RDGA 3WAPA 1KF6B 4ANWA 4H8SA 1WJ4A 2JZ3B 3W5UB 1A70A 2FDQA 3RUIB 3M95A 1FB8A 1ZUD2 4DHZE 5FKAC 3N30A 1V88A 2RR9A 3KLSX 1J8CA 3D8EA 3KWVA 4HHVA 1EU3A 2CU1A 1Q67A 3TEZA 4F7UP 4GIVA 1SE4A 4RGNA 1H8CA 2M8SA 2LGIA 3GOEA 3ZLZA 4LCDE 1JALA 4TV3A 4WWOA 4DDGD 4PQ0A 3BVZA 1C4PA 1L0VB 3NWFA 3TL5A 2UYZB 4IFSA 2L0TA 2ROZB 3SUZA 4F1SA 3SYXA 4B6HA 2R2YA 2RUKB 3ULCA 2MQJA 2L3ZA 4JKGB 1KFYB 4JKGA 1D5ZC 2MBQA 3MFGA 4HB0B 2WXMA 3W1YA 2QKMA 1HEZE 4OHJA 3KH0A 3OJ4B 4RF1A 3A8PA 3ETRA 2K5PA 2NVUI 4W9KA 4TQ0A 3PGEA 4MELA 1LGRA 4NZLB 1K8RB 2KC2A 4JGHB 2M0AA 3QAQA 4OT1A 4WVFB 1LO5D 3Q2AC 5LXHA 2WXKA 2D3BA 2Y3AA 2MDXA 3V5WA 3FKYA 4NNJB 2BW2A 1VCBA 4ZHPA 1L7YA 2FCMA 2I1KA 3OANA 2M17A 3KVFB 3P4QB 4Y94A 2GBRA 3ZDMC 4ZRKA 2VRRB 1MAIA 2Z59B 1WE6A 3A33B 4OZBA 4MM3A 1WGRA 4IKGA 5G55A 2IYBA 3R2IA 5C2TB 1UBQA 2L83A 4LNFA 4WQOB 2DNFA 2K8HA 4H2AA 2BCJA 2V9HA 1UEFA 4NAWB 2AYOB 4ZDVA 2ZJDA 5HE0A 2M0XA 2J0MA 3NOBA 3W1SA 3ZJUA 4XYCA 3NZUA 1VJKA 3VVWB 4N59A 1P3QU 3GYOA 1SB3C 3N20C 1DROA 2NBVA 4HKQA 1NYQA 4RGMA 3P2BA 1MPEA 2ON8A 3AEGB 4HAVB 3NSUA 4A6FA 1FHOA 5IO9A 3E9OA 2C5LC 3SNHA 2W2XD 4KAXB 2PKOA 3U52E 4WIPA 1AQCA 4HATB 2LGSA 4JL9A 1L5PA 3Q3JA 4KV2A 4NJCA 5C3JB 3JSVB 1JW9D 5FK9C 3PV1A 2O2VB 4FHKA 4GLSC 4K17A 2LUMA 3BIID 1HQRD 4YT0B 1P0RA 2PIAA 2BWFA 1FO4A 1Q1OA 4I6LB 4BZAA 5IA7A 1RWSA 2CR5A 3Q8FA 3TUOA 4LJPB 2D3GA 3SFEB 4ILHA 2KANA 5J3TA 4HB4B 3A9JB 3HW2B 5JXVA 3ZYYX 1NENB 2DYOA 2D9XA 1XD3B 4E3CA 1X1FA 4TSSA 3CIKA 2W3SA 3DHGC 3TBLD 4EEWA 1YIWA 1WIAA 1GGOA 1LB1A 3DBHI 5G5HA 1E7PB 3VQIA 4KSKC 1PFJA 5JVLA 1CJEA 5C79A 2OHFA 2R2OA 2IY0B 2YLMA 1Z2MA 1HB6A 4EJNA 2LULA 2LZ6A 3H1UA 2GMIC 3HK0A 3ZXRA 5EDSA 3RZWC 4I6NB 3ZKJC 2DA0A 4C4VB 4C4VA 4M01A 3EECA 5LNK1 1F1HA 4I6PA 4OW0A 2JT4B 5CHVC 1P3RA 5T8IA 3U4EG 1E10A 3AULA 1RYJA 1QOAA 1NU2A 1SE3A 1OTRB 1FMAD 4HJGE 2K25A 2LVPA 5BO4B 1KZGA 3CWIA 4P16A 3VFKA 1U27A 2CU3A 3B77A 2JZPA 2ZCBA 1WGQA 2WNMA 5DH9B 3V6CB 5J3YA 5C5BB 1E8WA 2ADZA 2ELAA 3PEGA 2VKIA 3ALBA 4HB2B 2RPQA 2KMAA 1R4MI 2DX1A 2WXQA 1WI0A 4GMVA 4RNAA 2KWUB 4OZAA 2OJWA 4L23A 3SEBA 3MP9A 3CXBB 1C4CA 4PS3A 2L8JA 3PO0A 1Y8RC 1LFDA 5D3IB 2WXPA 1W1DA 3EC8A 5D3XA 1K5GB 2CY5A 4MEMA 1E0ZA 1N5WA 4K7UA 1L4DB 4N6EB 3HVDA 2FCQA 4W9EA 2IGDA 2WHIA 4MH8A 2KTFA 4EFOA 4KHAA 1FNUA 2ZCCA 1XD4A 2V1YA 3FVCA 2VH2A 4EZLA 3MJWA 4KSLC 3ULBA 1FAOA 1NEKB 3Q8BA 3SU8X 3VH3B 3M1IB 1LM8B 4XWTA 3A8QA 1ZXHA 2WYQA 5AUIA 3ML4A 2D9WA 5GOWB 1BMLC 4YTPB 5LOPB 4HCPB 2YT2A 3A4RA 5EFXA 4HKZE 1NVID 1E9MA 1KOTA 2CHWA 3P4RB 3PHWB 2JQRB 1JMLA 2GBNA 1GPXA 1YQBA 1WXSA 2D5GA 4ARCA 2DZKA 3IXSA 1WXAA 4XGAB 2VH1A 5AUKA 1WWTA 3PVUA 1TS5A 2KR0A 1TJEA 1J0GA 1IGCA 3E9LA 1FEHA 2MW5A 4AJYB 3AEBB 4F7HA 5M4YB 1EM7A 2JSVX 4W9GA 3EPYA 4JWUC 4BBNF 4C80A 3UQBA 4F8CB 4L1RA 2IBIB 1JWBD 1WGDA 2LHEA 3TW1A 2FBWB 1YJIA 1PYWD 2BS4B 2WX1A 1M4VA 1V1PB 3UINB 4ZRJA 3PRZA 2M14A 3GP7A 4K2PA 4ZOHC 1OQNA 1IUEA 4QJ3B 5JH5C 2DLBA 3SDLC 2Z4DA 4JIOU 1MIXA 2IY1B 3KUDB 2YS5A 2Z14A 1AARA 2PZ1A 1VR9A 4B9KA 4IM2A 1V49A 1Q5WB 4TYZA 3W5VB 2Y5BB 1R7SA 1EF5A 5DHFB 1T0SC 3JVZX 5FI0A 2JF5A 3AN1A 1WXMA 3AI5A 4LLGM 2K2UA 4BOZB 3ZJTA 1H4RA 3W1SC 1IBXA 2YS3A 2EMTA 3U7DA 2DIKA 5AZHA 4ZHOA 3K9OB 4FADA 2SEBD 3ZRCA 2QEJC 2BBCA 4ANXA 2KOXA 3S2AA 3DBRI 3DQVA 4L2YA 2KD0A 3PSCA 1YQ3B 2WXFA 2KT7A 3KZ1A 4RGTA 3AEAB 4PNKA 2HTME 2KQSA 3QX1A 1MG8A 1KJTA 4HROA 2Y5CA 4DXAB 4HSIA 4MT5A 5FR3A 3VTVA 1MI1A 1WX7A 3EGRA 5HE2A 2DWQA 3GZNI 1HZ6A 1ZP0B 2LGDA 2A4ZA 4WAFA 3E56A 1ENFA 1BT0A 1ST7A 4M02A 5D7GA 4HB3B 1FFUA 4FLHA 3N1XC 3SO6A 2H88B 1SE2A 4DIXA 3KUZA 1IGDA 2PTLA 4XE0A 4K7SA 1RFAA 2BB5A 3AV8A 2DHZA 5H8YE 3HVZA 1WG7A 1K50A 2WX0A 4XZ4A 5HI1A 5EE9A 2WDRB 2BQQA 2LI5A 1WRDB 4CSQA 1ZDVA 5C1ZA 1ZC4B 5HE1A 3WANA 2V3NA 2D11A 2LVOA 2JWZA 3GYPA 3DBHB 5LLIA 4WJQA 1VRAB 1YOVB 4J6IA 1VBGA 4LNKA 1KZ7A 1YJ1A 2KO3A 1KH0A 4ZRPA 4PK1A 2BPSA 2C9WB 4MGZE 3TVVA 3RMKC 2LYDA 2CHXA 2L00B 3PHXB 4CO7A 4KZCA 1Q0WB 2FIDA 3E9PA 3F0WA 4BKSD 3AE9B 1PLSA 4HPPA 4L1BA 1PQSA 2LEKA 1B9RA 2KLCA 3JYUA 1WFYA 4MJSA 4E74A 4W9LA 1X05A 1ZSQA 4PS7A 3L4PA 3ML8A 3A1QA 1WF9A 2PPHA 2KAJA 1WYWB 2XK5B 2DHJA 5I2MA 4IOIE 1V61A 2J59M 3ODXA 2N4FA 3ZJVA 2KJRA 3ZNHB 1WM2A 3FP5A 2NPTA 4G3XB 3VAWA 1B55A 3KYCD 1EGXA 3I9V1 1A5RA 1R4MB 1MPHA 1ZPSA 1OFFA 2Q5WD 2ASQA 1SGHA 4EZJA 4JX1C 2VSZA 1WJNA 2Y8FA 3AEFB 4KKIA 4YWGG 3BZDB 3ZVVA 2K3UA 3SHQA 3I5JC 2CAYA 2KUQA 3Q6BA 4JKAA 2KDEB 2MP2B 3I63C 1QZEA 2MP2A 2L52A 3MHSD 2RGNB 5E6NA 3SD5A 2L1CA 4A55A 2N9PC 1GUAB 1LW3A 1E6EB 3U30A 5IKCM 2LG1A 2CJOA 1XF5L 2K6QA 4W9IA 1SJHD 3MJ5A 1K5DB 1DGJA 2CHZA 1V5UA 4WH4A 3HSAA 3RI7C 2MBEA 3P4PB 3AB5A 3DXDA 2GUMA 5LONB 1TZOA 1I35A 4WURA 2DFKA 4KDLB 4TKNA 3FLVA 4GMXB 2B76B 2V4LA 3H7PB 3VIAA 4N9F4 5HHDG 2QMTA 3Q3FA 4K7WA 3RD2A 2KVRA 2QDFA 3UIPB 2N9EB 3B2GA 3W2DA 2DHKA 5C6RA 1V6EA 4GDKB 4M0WB 5KQ4A 4JK8A 1TKGA 3O13A 3RNBC 2PW9A 4GDLB 1YMHE 4GDLA 5D3DA 2RD0A 1QQRA 1QT9A 4EUTA 2NMBA 2IDYA 3I3TB 2BTEA 4JKFA 2KMCA 3HHMA 3ZUNA 2J0JA 4HDOA 2MA9B 3E9SA 4NY0A 3O96A 1BAKA 2QC8A 2ZPNA 3OWEB 4C7ZA 4OVVA 5AEKB 1FXIA 3NWAA 3JW0X 2FAZA 1F77A 4IC7B 4OSNA 1XQQA 2DN6A 3FC4A 1P9DU 2LVQA 4O1NA 1I4RA 3QA8A 5IAAC 2N0YA 1DYQA 4US9A 2RQ1A 4TQ1A 3AE7B 2YT0A 4KHBB 1GNUA 1V5OA 4BKSA 2BGFA 5D2MB 3LJUX 2AL6A 2YF0A 3QWMA 4IAPA 2KDFB 2XQNM 2K8EA 2MX2A 1E7UA 5IJMA 1FHWA 2IO3B 3P7ZA 1XCGA 1XODA 4HEA1 4C0AA 3BWUD 1UBIA 3PVWA 3V6EB 5KQ1A 1WXVA 4RFBA 2HD5B 1NI3A 5HKHA 2Y5PA 3KW5B 1LQBA 4JE3B 4KGSA 1GC6A 2M38A 4K2OA 3Q3MC 2Z59A 1C79A 3DVGX 5GMVA 2NCNA 2K9XA 3O65B 1C1YB 1BXTA 3DBRB 4TUUA 4L6EA 3ZIMA 2ABDA 2CJNA 2IO1B 2B3AA 1VLBA 4C00A 3ENBA 3CIRB 1SSNA 2GBKA 1G6JA 4HAYB 4XC2A 4P1CC 1BTKA 4NAWA 3OG5A 2JYTA 2KZRA 3KUCB 2WXLA 2W3RA 3W9CB 4P1BC 4B0MA 3GZNB 4PYUA 4ZRQA 3QBVB 2RVBB 3AU5A 4HPMB 1WX9A 1N6ZA 1J7CA 2FJUB 3N1YC 3AH7A 1J7BA 4HCNB 4EZKA 1GC7A 5EE0A 1F2RC 2INPE 3C8YA 4YXDB 2MJDA 3DBLI 3P4SB 1UUPA 4G11A 3R8BA 4F7GA 2KWVB 5JHAA 3N3KB 5IP4D 2D9ZA 3JSVA 2PLPA 1TYGB 2O2VA 5D3WA 1TKEA 3T3NA 4BVUC 2AQ3B 2NR2A 5H92C 3L08A 2G45B 1K53A 3R66C 2A5UA 3WIMA 3E66A 2PE6B 5L81A 1UD7A 1AWEA 4HWIB 1KLUD 2DZJA 1SIFA 3L17A 4HVBA 3ZW3A 4OVUA 4JLCA 4PYZA 2IO2B 1MKEA 2P0HA 3F5RA 2IJ0A 1UH6A 3RNCC 3A9JA 2W82A 1FIQA 4KX6B 5BMGA 2CS4A 1WI1A 3LJ3A 3VTWA 4A90A 3VUYA 1I4PA 4IG7B 2QJLA 3AU4A 1V5TA 2INNE 1KI1B 2QIEB 3AM9A 4X57B 2X38A 2COCA 2RNRB 2E3TA 1VD2A 5TR5A 2MFQA 4DHZB 3VUXA 3VUWA 2G35A 2KN5A 2YVCA 2GBJA 2I1JA 5CHWA 1DOIA 1D5MC 1LXDA 3U12A 2D10A 2JYEA 2DZIA 3A9KB 1R4NB 2BYEA 4MK0A 2RPVA 3A9KA 3VRBB 2Z8LA 2UVMA 3L0WB 2WGSA 3BVMA 4II2B 2J52A 3IVFA 2Z0PA 1EWCA 1V8CA 1WE7A 2PMVA 3NZ3A 2OOBB 5G5GA 3ONSA 1MHXA 3KSYA 2INDC 2QCZA 1D5XC 1I2HA 1FNVA 3QIJA 2DYNA 1NTYA 1W1HA 3LXFA 2N23A 4ILGB 1V5PA 4EE2A 2DYQA 3FSSA 5C5BA 3SR6A 2MBOA 2G1EA 1MIZB 2L76A 3R2TA 1F52A 4IUMB 5D3YA 1V2YA 5LG4B 1SEBD 2AX5A 1P1AA 1YN4A 1I7HA 3TSSA 2EC1A 1C77A 1U5EA 1KLGD 1YN5A 4BAXA 1WVHA 2TSSA 5GXGB 2OTXA 2K2JA 1PGAA 3M3JA 1VZ7A 2L7RA 4GNKB 2LHDA 3DVNV 3LB8C 1GB1A 5E6PA 3QK0A 3QQ8B 2KIEA 3PREA 2NZ8B 2XBBC 3AE1B 1BWNA 2QILA 1XR0B 3QHTA 5FI1A 2LWPA 1UZXB 1UPQA 5IRSA 4ANUA 3AMZA 5BYSA 3FAHA 4FJYA 2M19A 1L0XB 4ANVA 4GU2A 3DCGA 4LNNA 1WXQA 5DPRA 1JWMD 3Q69A 3PZDA 3IAM1 1JWUD 1NTVA 2ZW0A
chains in the Genus database with same CATH topology
2DLWA 3M63B 4WJ7A 1C3TA 3X23A 4BKTA 2DZMA 4D0NB 2J7QB 4A6KA 3PLUA 4W9FA 2C7MB 4XWXA 2Z0OA 4HAUB 2C7NB 2JUOA 2M4NA 4URKA 1TQZA 2COPA 2N7DA 2AEHA 4FN2A 2KFKB 2KFKA 1S1QB 3TCAA 4HXDA 1TGZB 4AOFA 4A5KA 1EAZA 5JLJB 2DX5B 1XT9B 2MRPA 3PLVA 2PE9A 5CLQB 1RLFA 4MSQB 4A20A 1FXTB 3PG7A 2MWNB 3DPDA 2J0KA 1WJMA 2HE7A 1WMHB 1U5GA 2IZVB 4XX5A 3L13A 2UZSA 5C16A 1WGUA 1DBHA 4YL8A 4HK2A 2LUEA 2MCNB 4JKCA 2GCJA 2YRYA 2KTRB 2K8BA 1V81A 3EHVA 3D8DA 4F7ZA 2CB8A 1N3HA 2P0DA 4NJ7A 3UQAA 3V62A 1GJZA 3SBTA 3N7CA 2D2QA 2LD9A 1E7VA 3TJPA 3V60A 3MPXA 3PVLA 1ZKHA 3M62B 2L2IA 2RLOA 2FCNA 2KLGA 2LJ5A 4W9HA 5E6OA 2LOZA 3UZTA 1E8XA 2DAJA 5KHQA 2RSGA 2BYFA 2YSZA 3PT2B 3TIXA 4JKBA 1WY8A 4ASWC 3HM3A 4JKEA 4KIKB 5JHBA 2KQ7A 2GCLA 2ZVNA 3TMPB 1CMXB 4P7IA 1KC7A 4GOCA 4ICVA 1U5DA 5JP4A 3TFMA 2FUHB 5DHAB 5AZFA 2Y8GA 4M8MA 4BBNC 3ZVRA 2N1WA 2N9XA 1WJ6A 2BKFA 4EMOA 3QWZB 3OJ3A 5CHFA 2XK5A 2RGFA 3DVGY 1RJ2A 1W1GA 1WGYA 3CSFA 2REXA 5J17A 2JVCA 2JP2A 3AXCA 4Z2NA 2D9YA 4FBJB 2MLBA 4WJNA 4G50A 3DBSA 2MBHA 4HAWB 3WAOA 3H6NA 3C0RB 4KZ0A 2HRJA 2VRWB 3CSTA 5DPTA 1WH3A 3ZNGC 2FJLA 4B95A 3ZNID 4AJWA 2GOWA 2NS5A 1RRPB 3H7SA 2LGXA 3BINA 3NZSA 2NBUA 1P6SA 1WM3A 1KM7A 3ODWA 4K1RB 3PP2A 2X18A 3ZDTA 2R2QA 2JXXA 3IBEA 3H7PA 2R09A 1IRSA 2WDTB 1ZC3B 3L10B 1RRBA 1X86A 2C7HA 4GDKA 5CX3A 2L05A 1OEYJ 3BY4B 3ZTDA 2YS1A 3EFUA 2FCSA 1ZVRA 2XEWA 2O6VB 1IPGA 4GN1A 1QQGA 2L0FA 3DXEA 4CYEA 2UWQA 4GSWA 4LDTB 2JRIB 3CF6E 1UNPA 1T0YA 3RULA 3ODOA 2DYBA 1Z5SB 1ISNA 4DHJB 4NQKE 1TXDA 5DPWA 1WGGA 4HAXB 1OMWA 2BF8B 2G3QB 1X1GA 1P5TA 3P6AA 1KLVA 2IYDB 5LXIB 5J3QA 3A98B 3NHEB 3VOQA 1SE9A 1QC6A 2COFA 3PTFC 2CQUA 1WX8A 4MGKE 3L16A 1XX0A 3RZFA 1OY2A 2JZZA 3K9PB 2KDBA 2ELBA 1EVHA 3R3MA 3FEHA 1ZM0A 1V89A 5L83A 4FA6A 4MH0E 3ENEA 4GXBA 5J18A 4RM8A 5JZEB 3OLMD 4MGIE 3KY9A 3NY5A 4IWQA 1PMSA 4JK9A 3TO1A 2KHWB 4BFRA 3RYTA 2C60A 2ZPYA 5KCVA 5HE3A 3UF8A 4G0NB 3V61A 4MSMB 3PS6A 4II3B 4PS8A 1VBHA 2KX0A 3U8ZA 1GG3A 3D32A 3OAWA 3APCA 3WALA 1F9JA 4W9DA 2M1MA 4K81A 1S3SG 3AJ4A 2NBVB 3APDA 5AZGA 2LOXA 3ZRFA 2LBBA 4DBGA 3ML9A 2Z0QA 3IG3A 4A6FB 5KHOA 2CODA 1FGZA 2E2XA 2JRHA 3VH4B 1ACAA 3ZO5B 4HAZB 2KUPA 3SV1A 2MKRA 1TJ6A 2ZEQA 1M7RA 1JDEA 3NS8A 4KDIC 3RCPA 4NJ6A 3HIZA 3VHTC 2CKHB 2DAFA 4MDKE 4GB9A 2JPHA 1HBKA 5CLLB 2KFJA 2KC1A 2DKPA 3KRWA 4BBKA 4JK7A 5DIFB 2ZNVB 4LJOB 2MBBB 4JKHA 1U2BA 1TBEA 2HJ8A 1X1MA 1HB8A 1DDWA 3RCZA 3FM8C 5D94A 2MWSB 2KGXB 2K00A 4A3PA 1V86A 2MSED 1OQYA 4WJPA 2WWZA 3DOWA 3UGBB 4WSFA 3HM6X 3WA0A 4FJVB 2K8CA 1E8YA 1DIKA 3QARA 4M8NA 2N7EA 5L95C 2H7DA 4A6HA 4NPNA 1X11A 5D27A 3MTNB 1U5FA 5FR6A 2R82A 2P8VA 2K6DB 4WWNA 4NQLB 1J19A 2FJ9A 2BYVE 4HPLB 3PPAA 3UIOB 1ZGUB 1DDVA 2I5CA 1WJUA 3PRPB 3WAMA 2ROVA 2N1VA 1WR1A 2PEAA 3APFA 1TTNA 1BTNA 4HLEA 2W2WA 4MY6A 2KCJA 1V80A 1RAXA 3CMMB 2LXAA 4MGYE 1OEYA 2HTHB 2HTHA 2IFSA 3ECIA 3BJIA 4AWJA 3N32A 4GGQA 3B1LX 1Y5OA 4ILJA 4DWFA 1U29A 4HDQA 3A4SC 2GBMA 2DHIA 2RSUA 4WJOA 2BKRB 4W9CA 3L54A 4E71A 3H9DA 4KVGB 1EO6A 4CHJA 1NTIA 5J2RA 3B08A 2NBWB 1SHCA 2Y7BA 1ZW7A 2KJHB 4NSWA 1YX6B 2DTCA 2G4DB 2DX5A 3PSEB 2KWCA 2EMSA 4IM3A 1I7AA 5JHHA 4IWOA 3G9WA 2KDIA 5JHGA 2LRUA 1J0WA 3T9LA 2K39A 2DKQA 4CHMA 5DI9B 4GPTB 3VDZA 2KNBA 1WMHA 4IM0A 2D4QA 1FOEA 3ZTCA 2OQBA 3R7RA 2Q13A 2AL3A 1NDDA 5CTRC 1OGWA 1V5MA 2KJ6A 3DXCA 4RMAA 1FHXA 2KTRA 4W9JA 1U4AA 4ZRIA 2PJHA 1WZ0A 1EUVB 3R7QA 3WYFB 2D07B 1DDMA 1E8ZA 1P98A 4MT7A 2FIFA 3MDBC 2R0DA 1M94A 3KRXA 1WGHA 5C23A 3B0AA 1WZ3A 5D3VA 1UPRA 3HQCA 3D8FA 2WH5A 3VXWA 2O6VD 4WWPA 4LDTD 4YONA 4DX8A 1MK9B 2FNJB 1EF1A 3QCAA 4FULA 4JKDA 2JY6A 2V3SA 1L2NA 3DDCB 2KX3A 4BKGA 4KIKA 4DHJD 3DVNU 2QHOA 1IP9A 2D9VA 2LGYA 1JRUA 3KYDD 1NI2A 2DENB 4FJZA 2YT1A 2ZNVC 2W9NA 1IYFA 4AP4C 1Z87A 2BWES 4B6WA 4RM9A 2GJYA 1H10A 4IOYX 1TZ1A 2UZRA 1UGMA 4FHJA 1YD8U 3QC8B 2X0SA 4KHOA 1WR6E 2CRFA 2GS0A 4BOSC 5D6JB 1Y19B 1UNRA 4MJSB 2G4SA 2K1FA 2LKOA 1DYNA 3IHPC 3A1QB 3ZNZB 3T06A 1I42A 4Z2MB 1E90A 4CHKA 2EKEC 2H7EA 2NPTB 1XKEA 2LASA 3IFWB 3LDZE 2Z0DB 1R4NI 1M7EA 2QKLA 4WAAA 4GZUA 1NVLA 4DX90 2EJ8A 4AUQC 4ICUA 2KXJA 1NBFC 2CY4A 1V9JA 2I5FA 2ZVOA 1MK7B 2V76A 2LRWA 2DYMA 4EKUA 5DCNA 1UELA 3PRMB 4HJKA 2COAA 2Z0EB 4DK5A 2P0FA 4IWPA 5G2NA 4DDID 2ZZPB 3QJZA 4EOYA 2AWTA 5DPSA 3SBGA 1E5WA 4IW0A 4ZYNA 4A3OA 1KBLA 4DBBA 3VTUA 1D3ZA 2W2XC 4JQWC 1YX5B 3X0WA 1HE8A 3RT3B 1FGYA 2LXCA 2O6VA 2IO0B 2OJRA 2KKCA 1WJ1A 2KK8A 1UNQA 3T8MA 3WAPA 4ANWA 4H8SA 1WJ4A 2JZ3B 2FDQA 3RUIB 3M95A 1FB8A 4DHZE 3N30A 1V88A 2RR9A 1J8CA 3D8EA 4HHVA 2CU1A 1Q67A 4F7UP 4GIVA 1H8CA 2M8SA 3GOEA 3ZLZA 4LCDE 4TV3A 4WWOA 4DDGD 4PQ0A 3TL5A 2UYZB 4IFSA 2L0TA 2ROZB 3SUZA 4F1SA 3SYXA 4B6HA 2RUKB 3ULCA 2MQJA 2L3ZA 4JKGB 4JKGA 2MBQA 4HB0B 3W1YA 2QKMA 3KH0A 3OJ4B 3A8PA 2NVUI 4W9KA 4TQ0A 3PGEA 4MELA 1K8RB 2KC2A 4JGHB 3QAQA 4WVFB 5LXHA 2MDXA 3V5WA 4NNJB 1VCBA 1L7YA 2FCMA 2I1KA 3OANA 2M17A 3KVFB 3ZDMC 4Y94A 2GBRA 4ZRKA 2VRRB 1MAIA 2Z59B 1WE6A 3A33B 4MM3A 1WGRA 5G55A 2IYBA 1UBQA 4WQOB 2K8HA 2BCJA 1UEFA 4NAWB 2AYOB 4ZDVA 2ZJDA 5HE0A 2M0XA 2J0MA 3NOBA 3W1SA 3NZUA 3VVWB 1P3QU 3GYOA 1DROA 3P2BA 4HAVB 3NSUA 4A6FA 1FHOA 3E9OA 2C5LC 3SNHA 2W2XD 4KAXB 1AQCA 4HATB 4JL9A 4KV2A 3Q3JA 3JSVB 3PV1A 2O2VB 4FHKA 4K17A 1P0RA 2BWFA 1Q1OA 4I6LB 5IA7A 2CR5A 4LJPB 2D3GA 4ILHA 2KANA 5J3TA 4HB4B 3A9JB 3HW2B 2DYOA 2D9XA 1XD3B 4E3CA 1X1FA 3CIKA 3TBLD 4EEWA 1YIWA 1WIAA 1GGOA 1LB1A 3DBHI 3VQIA 4KSKC 1PFJA 5JVLA 2R2OA 5C79A 2YLMA 2IY0B 1Z2MA 1HB6A 4EJNA 2LULA 2LZ6A 3H1UA 2GMIC 3HK0A 5EDSA 3RZWC 4I6NB 3ZKJC 2DA0A 3EECA 4I6PA 2JT4B 5CHVC 1P3RA 3AULA 1NU2A 1OTRB 2K25A 2LVPA 5BO4B 1KZGA 3VFKA 1U27A 2ZCBA 1WGQA 5DH9B 3V6CB 5J3YA 5C5BB 1E8WA 2ADZA 2ELAA 3PEGA 2VKIA 3ALBA 4HB2B 2RPQA 2KMAA 1R4MI 2DX1A 1WI0A 4GMVA 2KWUB 3CXBB 4PS3A 2L8JA 1Y8RC 1LFDA 1W1DA 3EC8A 5D3XA 1K5GB 2CY5A 4MEMA 4K7UA 2FCQA 4W9EA 2KTFA 4EFOA 4KHAA 2ZCCA 1XD4A 2V1YA 4EZLA 3MJWA 4KSLC 3ULBA 1FAOA 3SU8X 3VH3B 3M1IB 1LM8B 3A8QA 2WYQA 3ML4A 2D9WA 5GOWB 5LOPB 4HCPB 3A4RA 5EFXA 1KOTA 2CHWA 3PHWB 2GBNA 1YQBA 1WXSA 2DZKA 1WXAA 3PVUA 1J0GA 3E9LA 2MW5A 4AJYB 4F7HA 4W9GA 4BBNF 3EPYA 3UQBA 4F8CB 2IBIB 1WGDA 3TW1A 2WX1A 3UINB 4ZRJA 3PRZA 2M14A 4K2PA 1OQNA 5JH5C 3SDLC 4JIOU 1MIXA 2IY1B 3KUDB 2YS5A 1AARA 2PZ1A 4B9KA 4IM2A 1V49A 1Q5WB 4TYZA 2Y5BB 1EF5A 5DHFB 3JVZX 5FI0A 2JF5A 1WXMA 3AI5A 2K2UA 4BOZB 1H4RA 3W1SC 2YS3A 2EMTA 3U7DA 2DIKA 5AZHA 3K9OB 4FADA 3ZRCA 4ANXA 2KOXA 3S2AA 3DBRI 3DQVA 2KD0A 3PSCA 3KZ1A 4PNKA 2KQSA 3QX1A 1MG8A 1KJTA 4DXAB 3VTVA 1WX7A 5HE2A 3GZNI 2LGDA 2A4ZA 1BT0A 1ST7A 5D7GA 4HB3B 4FLHA 3SO6A 3KUZA 4K7SA 1RFAA 2DHZA 1WG7A 2WX0A 4XZ4A 2LI5A 1WRDB 5C1ZA 1ZC4B 5HE1A 3WANA 2D11A 2LVOA 2JWZA 3GYPA 5LLIA 4WJQA 4J6IA 1VBGA 1KZ7A 1YJ1A 2KO3A 2BPSA 2C9WB 4MGZE 3TVVA 4CO7A 2LYDA 2CHXA 2L00B 3PHXB 4KZCA 1Q0WB 2FIDA 3E9PA 3F0WA 4BKSD 1PLSA 1PQSA 2KLCA 3JYUA 1WFYA 4MJSA 4E74A 4W9LA 1X05A 1ZSQA 4PS7A 3ML8A 3A1QA 1WF9A 2PPHA 1WYWB 2XK5B 2DHJA 1V61A 2J59M 3ODXA 2N4FA 2KJRA 3ZNHB 1WM2A 3FP5A 2NPTA 4G3XB 3VAWA 1B55A 3KYCD 1EGXA 1A5RA 1MPHA 2ASQA 1SGHA 4EZJA 2VSZA 1WJNA 2Y8FA 3ZVVA 3SHQA 2CAYA 4JKAA 2KDEB 2MP2B 1QZEA 2MP2A 3MHSD 2RGNB 5E6NA 3SD5A 2L1CA 2N9PC 1GUAB 1LW3A 3U30A 2LG1A 2K6QA 4W9IA 1K5DB 2CHZA 1V5UA 2MBEA 3DXDA 5LONB 1I35A 2DFKA 4KDLB 4TKNA 3FLVA 4GMXB 2V4LA 3H7PB 3VIAA 4N9F4 3Q3FA 4K7WA 3RD2A 2KVRA 3UIPB 2N9EB 2DHKA 5C6RA 1V6EA 4GDKB 4M0WB 5KQ4A 4JK8A 4GDLB 4GDLA 2RD0A 4EUTA 2NMBA 3I3TB 4JKFA 2KMCA 3HHMA 3ZUNA 2J0JA 4HDOA 2MA9B 4NY0A 3O96A 1BAKA 2ZPNA 4OVVA 5AEKB 3JW0X 2FAZA 4IC7B 1XQQA 2DN6A 1P9DU 2LVQA 3QA8A 5IAAC 2N0YA 2RQ1A 4TQ1A 2YT0A 4KHBB 1GNUA 1V5OA 4BKSA 2BGFA 5D2MB 3LJUX 2AL6A 2YF0A 3QWMA 4IAPA 2KDFB 2XQNM 2MX2A 1E7UA 5IJMA 1FHWA 2IO3B 3P7ZA 1XCGA 1XODA 4C0AA 1UBIA 3PVWA 3V6EB 5KQ1A 1WXVA 2HD5B 5HKHA 3KW5B 1LQBA 1GC6A 2M38A 4K2OA 3DVGX 5GMVA 2NCNA 3O65B 1C1YB 4TUUA 4L6EA 3ZIMA 2ABDA 2IO1B 2B3AA 3ENBA 2GBKA 1G6JA 4HAYB 4XC2A 1BTKA 4NAWA 2KZRA 3KUCB 4PYUA 3QBVB 2RVBB 3AU5A 4HPMB 1WX9A 4HCNB 4EZKA 1GC7A 3DBLI 4G11A 4F7GA 2KWVB 5JHAA 3N3KB 2D9ZA 3JSVA 2O2VA 5D3WA 4BVUC 2NR2A 3L08A 2G45B 3R66C 2A5UA 3WIMA 3E66A 2PE6B 5L81A 1UD7A 1AWEA 4HWIB 2DZJA 1SIFA 3L17A 4HVBA 3ZW3A 4OVUA 4JLCA 4PYZA 2IO2B 1MKEA 2P0HA 3F5RA 1UH6A 3A9JA 2CS4A 1WI1A 3LJ3A 3VTWA 3VUYA 4IG7B 3AU4A 1V5TA 4X57B 1KI1B 2COCA 2RNRB 1VD2A 5TR5A 2MFQA 4DHZB 3VUXA 3VUWA 2G35A 2KN5A 2YVCA 2GBJA 2I1JA 5CHWA 1LXDA 2D10A 2DZIA 3A9KB 2BYEA 4MK0A 3A9KA 2UVMA 3L0WB 4II2B 3IVFA 2Z0PA 1WE7A 2OOBB 3ONSA 3KSYA 1I2HA 3QIJA 2DYNA 1NTYA 1W1HA 2N23A 4ILGB 1V5PA 2DYQA 3FSSA 5C5BA 2MBOA 1MIZB 2L76A 4IUMB 5D3YA 1V2YA 1P1AA 2EC1A 1U5EA 1WVHA 2OTXA 2K2JA 3M3JA 2L7RA 3DVNV 5E6PA 3QK0A 3QQ8B 3PREA 2NZ8B 2XBBC 1BWNA 1XR0B 3QHTA 5FI1A 2LWPA 1UZXB 1UPQA 4ANUA 4FJYA 4ANVA 4GU2A 3DCGA 5DPRA 3PZDA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  3M63 B;  4WJ7 A;  1C3T A;  3X23 A;  4BKT A;  2DZM A;  4D0N B;  2J7Q B;  4A6K A;  3PLU A;  4W9F A;  2C7M B;  4XWX A;  2Z0O A;  4HAU B;  2C7N B;  2JUO A;  2M4N A;  4URK A;  1TQZ A;  2COP A;  2N7D A;  2AEH A;  4FN2 A;  2KFK B;  2KFK A;  1S1Q B;  3TCA A;  4HXD A;  1TGZ B;  4AOF A;  4A5K A;  1EAZ A;  5JLJ B;  2DX5 B;  1XT9 B;  2MRP A;  3PLV A;  2PE9 A;  5CLQ B;  1RLF A;  4MSQ B;  4A20 A;  1FXT B;  3PG7 A;  2MWN B;  3DPD A;  2J0K A;  1WJM A;  2HE7 A;  1WMH B;  1U5G A;  2IZV B;  4XX5 A;  3L13 A;  2UZS A;  5C16 A;  1WGU A;  1DBH A;  4YL8 A;  4HK2 A;  2LUE A;  2MCN B;  2GCJ A;  2YRY A;  2KTR B;  2K8B A;  1V81 A;  3EHV A;  3D8D A;  4F7Z A;  2CB8 A;  1N3H A;  2P0D A;  4NJ7 A;  3UQA A;  3V62 A;  1GJZ A;  3N7C A;  2D2Q A;  2LD9 A;  1E7V A;  3TJP A;  3V60 A;  3MPX A;  3PVL A;  1ZKH A;  3M62 B;  2L2I A;  2RLO A;  2FCN A;  2KLG A;  2LJ5 A;  4W9H A;  5E6O A;  2LOZ A;  3UZT A;  1E8X A;  2DAJ A;  5KHQ A;  2RSG A;  2BYF A;  2YSZ A;  3PT2 B;  3TIX A;  1WY8 A;  4ASW C;  3HM3 A;  4KIK B;  5JHB A;  2KQ7 A;  2GCL A;  2ZVN A;  3TMP B;  1CMX B;  4P7I A;  4GOC A;  4ICV A;  1U5D A;  5JP4 A;  3TFM A;  2FUH B;  5DHA B;  5AZF A;  2Y8G A;  4M8M A;  4BBN C;  3ZVR A;  2N1W A;  2N9X A;  1WJ6 A;  2BKF A;  4EMO A;  3QWZ B;  3OJ3 A;  5CHF A;  2XK5 A;  2RGF A;  3DVG Y;  1RJ2 A;  1W1G A;  1WGY A;  3CSF A;  2REX A;  5J17 A;  2JVC A;  2JP2 A;  3AXC A;  4Z2N A;  2D9Y A;  4FBJ B;  2MLB A;  4WJN A;  4G50 A;  3DBS A;  2MBH A;  4HAW B;  3WAO A;  3H6N A;  3C0R B;  4KZ0 A;  2HRJ A;  2VRW B;  3CST A;  5DPT A;  1WH3 A;  3ZNG C;  2FJL A;  4B95 A;  3ZNI D;  4AJW A;  2GOW A;  2NS5 A;  1RRP B;  3H7S A;  2LGX A;  3BIN A;  3NZS A;  2NBU A;  1P6S A;  1WM3 A;  1KM7 A;  3ODW A;  4K1R B;  3PP2 A;  2X18 A;  3ZDT A;  2R2Q A;  2JXX A;  3IBE A;  3H7P A;  2R09 A;  1IRS A;  2WDT B;  1ZC3 B;  3L10 B;  1RRB A;  1X86 A;  2C7H A;  4GDK A;  5CX3 A;  2L05 A;  1OEY J;  3BY4 B;  3ZTD A;  2YS1 A;  3EFU A;  2FCS A;  1ZVR A;  2XEW A;  2O6V B;  1IPG A;  4GN1 A;  1QQG A;  2L0F A;  3DXE A;  4CYE A;  2UWQ A;  4GSW A;  4LDT B;  2JRI B;  3CF6 E;  1UNP A;  1T0Y A;  3RUL A;  3ODO A;  2DYB A;  1Z5S B;  1ISN A;  4DHJ B;  4NQK E;  1TXD A;  5DPW A;  1WGG A;  4HAX B;  1OMW A;  2BF8 B;  2G3Q B;  1X1G A;  1P5T A;  3P6A A;  1KLV A;  2IYD B;  5LXI B;  5J3Q A;  3A98 B;  3NHE B;  3VOQ A;  1SE9 A;  1QC6 A;  2COF A;  3PTF C;  2CQU A;  1WX8 A;  4MGK E;  3L16 A;  1XX0 A;  3RZF A;  1OY2 A;  2JZZ A;  3K9P B;  2KDB A;  2ELB A;  1EVH A;  3R3M A;  3FEH A;  1ZM0 A;  1V89 A;  5L83 A;  4FA6 A;  4MH0 E;  3ENE A;  4GXB A;  5J18 A;  4RM8 A;  5JZE B;  3OLM D;  4MGI E;  3KY9 A;  3NY5 A;  4IWQ A;  1PMS A;  3TO1 A;  2KHW B;  4BFR A;  3RYT A;  2C60 A;  2ZPY A;  5KCV A;  5HE3 A;  3UF8 A;  4G0N B;  3V61 A;  4MSM B;  3PS6 A;  4II3 B;  4PS8 A;  2KX0 A;  3U8Z A;  1GG3 A;  3D32 A;  3OAW A;  3APC A;  3WAL A;  1F9J A;  4W9D A;  2M1M A;  4K81 A;  1S3S G;  3AJ4 A;  2NBV B;  3APD A;  5AZG A;  2LOX A;  3ZRF A;  2LBB A;  4DBG A;  3ML9 A;  2Z0Q A;  3IG3 A;  4A6F B;  5KHO A;  2COD A;  1FGZ A;  2E2X A;  2JRH A;  3VH4 B;  1ACA A;  3ZO5 B;  4HAZ B;  2KUP A;  3SV1 A;  2MKR A;  1TJ6 A;  2ZEQ A;  1M7R A;  3NS8 A;  4KDI C;  3RCP A;  4NJ6 A;  3HIZ A;  3VHT C;  2CKH B;  2DAF A;  4MDK E;  4GB9 A;  2JPH A;  1HBK A;  5CLL B;  2KFJ A;  2KC1 A;  2DKP A;  3KRW A;  4BBK A;  5DIF B;  2ZNV B;  4LJO B;  2MBB B;  1U2B A;  1TBE A;  2HJ8 A;  1X1M A;  1HB8 A;  1DDW A;  3RCZ A;  3FM8 C;  5D94 A;  2MWS B;  2KGX B;  2K00 A;  4A3P A;  1V86 A;  2MSE D;  1OQY A;  4WJP A;  2WWZ A;  3DOW A;  3UGB B;  4WSF A;  3HM6 X;  3WA0 A;  4FJV B;  2K8C A;  1E8Y A;  3QAR A;  4M8N A;  2N7E A;  5L95 C;  2H7D A;  4A6H A;  4NPN A;  1X11 A;  5D27 A;  3MTN B;  1U5F A;  5FR6 A;  2P8V A;  2K6D B;  4WWN A;  4NQL B;  1J19 A;  2FJ9 A;  2BYV E;  4HPL B;  3PPA A;  3UIO B;  1ZGU B;  1DDV A;  2I5C A;  1WJU A;  3PRP B;  3WAM A;  2ROV A;  2N1V A;  1WR1 A;  2PEA A;  3APF A;  1TTN A;  1BTN A;  4HLE A;  2W2W A;  4MY6 A;  2KCJ A;  1V80 A;  1RAX A;  3CMM B;  2LXA A;  4MGY E;  1OEY A;  2HTH B;  2HTH A;  2IFS A;  3ECI A;  3BJI A;  4AWJ A;  3N32 A;  4GGQ A;  3B1L X;  1Y5O A;  4DWF A;  1U29 A;  4HDQ A;  3A4S C;  2GBM A;  2DHI A;  2RSU A;  4WJO A;  2BKR B;  4W9C A;  3L54 A;  4E71 A;  3H9D A;  4KVG B;  1EO6 A;  4CHJ A;  1NTI A;  5J2R A;  3B08 A;  2NBW B;  1SHC A;  2Y7B A;  1ZW7 A;  2KJH B;  4NSW A;  1YX6 B;  2DTC A;  2G4D B;  2DX5 A;  3PSE B;  2KWC A;  2EMS A;  4IM3 A;  1I7A A;  5JHH A;  4IWO A;  3G9W A;  2KDI A;  5JHG A;  2LRU A;  1J0W A;  3T9L A;  2K39 A;  2DKQ A;  4CHM A;  5DI9 B;  4GPT B;  3VDZ A;  2KNB A;  1WMH A;  4IM0 A;  2D4Q A;  1FOE A;  3ZTC A;  2OQB A;  3R7R A;  2Q13 A;  2AL3 A;  1NDD A;  5CTR C;  1OGW A;  1V5M A;  2KJ6 A;  3DXC A;  4RMA A;  1FHX A;  2KTR A;  4W9J A;  1U4A A;  4ZRI A;  2PJH A;  1WZ0 A;  1EUV B;  3R7Q A;  3WYF B;  2D07 B;  1DDM A;  1E8Z A;  1P98 A;  4MT7 A;  2FIF A;  3MDB C;  2R0D A;  1M94 A;  3KRX A;  1WGH A;  5C23 A;  3B0A A;  1WZ3 A;  5D3V A;  1UPR A;  3HQC A;  3D8F A;  2WH5 A;  3VXW A;  2O6V D;  4WWP A;  4LDT D;  4YON A;  4DX8 A;  1MK9 B;  2FNJ B;  1EF1 A;  3QCA A;  4FUL A;  2JY6 A;  2V3S A;  1L2N A;  3DDC B;  2KX3 A;  4BKG A;  4KIK A;  4DHJ D;  3DVN U;  2QHO A;  1IP9 A;  2D9V A;  2LGY A;  1JRU A;  3KYD D;  1NI2 A;  2DEN B;  4FJZ A;  2YT1 A;  2ZNV C;  2W9N A;  1IYF A;  4AP4 C;  1Z87 A;  2BWE S;  4B6W A;  4RM9 A;  2GJY A;  1H10 A;  4IOY X;  1TZ1 A;  2UZR A;  1UGM A;  4FHJ A;  1YD8 U;  3QC8 B;  4KHO A;  1WR6 E;  2CRF A;  2GS0 A;  4BOS C;  5D6J B;  1Y19 B;  1UNR A;  4MJS B;  2G4S A;  2K1F A;  2LKO A;  1DYN A;  3IHP C;  3A1Q B;  3ZNZ B;  3T06 A;  1I42 A;  4Z2M B;  1E90 A;  4CHK A;  2EKE C;  2H7E A;  2NPT B;  1XKE A;  2LAS A;  3IFW B;  3LDZ E;  2Z0D B;  1R4N I;  1M7E A;  2QKL A;  4WAA A;  4GZU A;  1NVL A;  4DX9 0;  2EJ8 A;  4AUQ C;  4ICU A;  2KXJ A;  1NBF C;  2CY4 A;  1V9J A;  2I5F A;  2ZVO A;  1MK7 B;  2V76 A;  2LRW A;  2DYM A;  4EKU A;  5DCN A;  1UEL A;  3PRM B;  4HJK A;  2COA A;  2Z0E B;  4DK5 A;  2P0F A;  4IWP A;  5G2N A;  4DDI D;  2ZZP B;  3QJZ A;  4EOY A;  2AWT A;  5DPS A;  1E5W A;  4IW0 A;  4ZYN A;  4A3O A;  4DBB A;  3VTU A;  1D3Z A;  2W2X C;  4JQW C;  1YX5 B;  3X0W A;  1HE8 A;  3RT3 B;  1FGY A;  2LXC A;  2O6V A;  2IO0 B;  2OJR A;  2KKC A;  1WJ1 A;  2KK8 A;  1UNQ A;  3T8M A;  3WAP A;  4ANW A;  4H8S A;  1WJ4 A;  2JZ3 B;  2FDQ A;  3RUI B;  3M95 A;  1FB8 A;  4DHZ E;  3N30 A;  1V88 A;  2RR9 A;  1J8C A;  3D8E A;  4HHV A;  2CU1 A;  1Q67 A;  4F7U P;  4GIV A;  1H8C A;  2M8S A;  3GOE A;  3ZLZ A;  4LCD E;  4TV3 A;  4WWO A;  4DDG D;  4PQ0 A;  3TL5 A;  2UYZ B;  4IFS A;  2L0T A;  2ROZ B;  3SUZ A;  4F1S A;  3SYX A;  4B6H A;  2RUK B;  3ULC A;  2MQJ A;  2L3Z A;  2MBQ A;  4HB0 B;  3W1Y A;  2QKM A;  3KH0 A;  3OJ4 B;  3A8P A;  2NVU I;  4W9K A;  4TQ0 A;  3PGE A;  4MEL A;  1K8R B;  2KC2 A;  4JGH B;  3QAQ A;  4WVF B;  5LXH A;  2MDX A;  3V5W A;  4NNJ B;  1VCB A;  1L7Y A;  2FCM A;  2I1K A;  3OAN A;  2M17 A;  3KVF B;  3ZDM C;  4Y94 A;  2GBR A;  4ZRK A;  2VRR B;  1MAI A;  2Z59 B;  1WE6 A;  3A33 B;  4MM3 A;  1WGR A;  5G55 A;  2IYB A;  1UBQ A;  4WQO B;  2K8H A;  2BCJ A;  1UEF A;  4NAW B;  2AYO B;  4ZDV A;  2ZJD A;  5HE0 A;  2M0X A;  2J0M A;  3NOB A;  3W1S A;  3NZU A;  3VVW B;  1P3Q U;  3GYO A;  1DRO A;  3P2B A;  4HAV B;  3NSU A;  4A6F A;  1FHO A;  2C5L C;  3SNH A;  2W2X D;  4KAX B;  1AQC A;  4HAT B;  4JL9 A;  4KV2 A;  3Q3J A;  3JSV B;  3PV1 A;  2O2V B;  4FHK A;  4K17 A;  1P0R A;  2BWF A;  1Q1O A;  4I6L B;  5IA7 A;  2CR5 A;  4LJP B;  2D3G A;  2KAN A;  5J3T A;  4HB4 B;  3A9J B;  3HW2 B;  2DYO A;  2D9X A;  1XD3 B;  4E3C A;  1X1F A;  3CIK A;  3TBL D;  4EEW A;  1YIW A;  1WIA A;  1LB1 A;  3DBH I;  3VQI A;  4KSK C;  1PFJ A;  2R2O A;  5C79 A;  2YLM A;  2IY0 B;  1Z2M A;  1HB6 A;  4EJN A;  2LUL A;  2LZ6 A;  3H1U A;  2GMI C;  3HK0 A;  5EDS A;  3RZW C;  4I6N B;  3ZKJ C;  2DA0 A;  3EEC A;  4I6P A;  2JT4 B;  5CHV C;  1P3R A;  3AUL A;  1NU2 A;  1OTR B;  2K25 A;  2LVP A;  5BO4 B;  1KZG A;  3VFK A;  1U27 A;  2ZCB A;  1WGQ A;  5DH9 B;  3V6C B;  5J3Y A;  5C5B B;  1E8W A;  2ADZ A;  2ELA A;  3PEG A;  2VKI A;  3ALB A;  4HB2 B;  2RPQ A;  2KMA A;  1R4M I;  2DX1 A;  1WI0 A;  4GMV A;  2KWU B;  3CXB B;  4PS3 A;  2L8J A;  1Y8R C;  1LFD A;  1W1D A;  3EC8 A;  5D3X A;  1K5G B;  2CY5 A;  4MEM A;  4K7U A;  2FCQ A;  4W9E A;  2KTF A;  4EFO A;  4KHA A;  2ZCC A;  1XD4 A;  2V1Y A;  4EZL A;  3MJW A;  4KSL C;  3ULB A;  1FAO A;  3SU8 X;  3VH3 B;  3M1I B;  1LM8 B;  3A8Q A;  2WYQ A;  3ML4 A;  2D9W A;  5GOW B;  5LOP B;  4HCP B;  3A4R A;  5EFX A;  1KOT A;  2CHW A;  3PHW B;  2GBN A;  1YQB A;  1WXS A;  2DZK A;  1WXA A;  3PVU A;  1J0G A;  2MW5 A;  4AJY B;  4F7H A;  4W9G A;  4BBN F;  3EPY A;  3UQB A;  4F8C B;  2IBI B;  1WGD A;  3TW1 A;  2WX1 A;  3UIN B;  4ZRJ A;  3PRZ A;  2M14 A;  4K2P A;  1OQN A;  5JH5 C;  3SDL C;  4JIO U;  1MIX A;  2IY1 B;  3KUD B;  2YS5 A;  1AAR A;  2PZ1 A;  4B9K A;  4IM2 A;  1V49 A;  1Q5W B;  4TYZ A;  2Y5B B;  1EF5 A;  5DHF B;  3JVZ X;  5FI0 A;  2JF5 A;  1WXM A;  3AI5 A;  2K2U A;  4BOZ B;  1H4R A;  3W1S C;  2YS3 A;  2EMT A;  3U7D A;  5AZH A;  3K9O B;  4FAD A;  3ZRC A;  4ANX A;  2KOX A;  3S2A A;  3DBR I;  3DQV A;  2KD0 A;  3PSC A;  3KZ1 A;  4PNK A;  2KQS A;  3QX1 A;  1MG8 A;  1KJT A;  4DXA B;  3VTV A;  1WX7 A;  5HE2 A;  3GZN I;  2LGD A;  2A4Z A;  1BT0 A;  1ST7 A;  5D7G A;  4HB3 B;  4FLH A;  3SO6 A;  3KUZ A;  4K7S A;  1RFA A;  2DHZ A;  1WG7 A;  2WX0 A;  4XZ4 A;  2LI5 A;  1WRD B;  5C1Z A;  1ZC4 B;  5HE1 A;  3WAN A;  2D11 A;  2LVO A;  2JWZ A;  3GYP A;  5LLI A;  4WJQ A;  4J6I A;  1KZ7 A;  1YJ1 A;  2KO3 A;  2BPS A;  2C9W B;  4MGZ E;  3TVV A;  4CO7 A;  2LYD A;  2CHX A;  2L00 B;  3PHX B;  4KZC A;  1Q0W B;  2FID A;  3F0W A;  4BKS D;  1PLS A;  1PQS A;  2KLC A;  3JYU A;  1WFY A;  4MJS A;  4E74 A;  4W9L A;  1X05 A;  1ZSQ A;  4PS7 A;  3ML8 A;  3A1Q A;  1WF9 A;  2PPH A;  1WYW B;  2XK5 B;  2DHJ A;  1V61 A;  2J59 M;  3ODX A;  2N4F A;  2KJR A;  3ZNH B;  1WM2 A;  3FP5 A;  2NPT A;  4G3X B;  3VAW A;  1B55 A;  3KYC D;  1EGX A;  1A5R A;  1MPH A;  2ASQ A;  1SGH A;  4EZJ A;  2VSZ A;  1WJN A;  2Y8F A;  3ZVV A;  3SHQ A;  2CAY A;  2KDE B;  2MP2 B;  1QZE A;  2MP2 A;  3MHS D;  2RGN B;  5E6N A;  3SD5 A;  2L1C A;  2N9P C;  1GUA B;  1LW3 A;  3U30 A;  2LG1 A;  2K6Q A;  4W9I A;  1K5D B;  2CHZ A;  1V5U A;  2MBE A;  3DXD A;  5LON B;  1I35 A;  2DFK A;  4KDL B;  4TKN A;  3FLV A;  4GMX B;  2V4L A;  3H7P B;  3VIA A;  4N9F 4;  3Q3F A;  4K7W A;  3RD2 A;  2KVR A;  3UIP B;  2N9E B;  2DHK A;  5C6R A;  1V6E A;  4GDK B;  4M0W B;  5KQ4 A;  4GDL B;  4GDL A;  2RD0 A;  4EUT A;  2NMB A;  3I3T B;  2KMC A;  3HHM A;  3ZUN A;  2J0J A;  4HDO A;  2MA9 B;  4NY0 A;  3O96 A;  1BAK A;  2ZPN A;  4OVV A;  5AEK B;  3JW0 X;  2FAZ A;  4IC7 B;  1XQQ A;  2DN6 A;  1P9D U;  2LVQ A;  3QA8 A;  5IAA C;  2N0Y A;  2RQ1 A;  4TQ1 A;  2YT0 A;  4KHB B;  1GNU A;  1V5O A;  4BKS A;  2BGF A;  5D2M B;  3LJU X;  2AL6 A;  2YF0 A;  3QWM A;  4IAP A;  2KDF B;  2XQN M;  2MX2 A;  1E7U A;  5IJM A;  1FHW A;  2IO3 B;  3P7Z A;  1XCG A;  1XOD A;  4C0A A;  1UBI A;  3PVW A;  3V6E B;  5KQ1 A;  1WXV A;  2HD5 B;  5HKH A;  3KW5 B;  1LQB A;  1GC6 A;  2M38 A;  4K2O A;  3DVG X;  5GMV A;  2NCN A;  3O65 B;  1C1Y B;  4TUU A;  4L6E A;  3ZIM A;  2ABD A;  2IO1 B;  2B3A A;  2GBK A;  1G6J A;  4HAY B;  4XC2 A;  1BTK A;  4NAW A;  2KZR A;  3KUC B;  4PYU A;  3QBV B;  2RVB B;  3AU5 A;  4HPM B;  1WX9 A;  4HCN B;  4EZK A;  1GC7 A;  3DBL I;  4G11 A;  4F7G A;  2KWV B;  5JHA A;  3N3K B;  2D9Z A;  3JSV A;  2O2V A;  5D3W A;  4BVU C;  2NR2 A;  3L08 A;  2G45 B;  3R66 C;  2A5U A;  3WIM A;  2PE6 B;  5L81 A;  1UD7 A;  1AWE A;  4HWI B;  2DZJ A;  1SIF A;  3L17 A;  4HVB A;  3ZW3 A;  4OVU A;  4JLC A;  4PYZ A;  2IO2 B;  1MKE A;  2P0H A;  3F5R A;  1UH6 A;  3A9J A;  2CS4 A;  1WI1 A;  3LJ3 A;  3VTW A;  3VUY A;  4IG7 B;  3AU4 A;  1V5T A;  4X57 B;  1KI1 B;  2COC A;  2RNR B;  1VD2 A;  5TR5 A;  2MFQ A;  4DHZ B;  3VUX A;  3VUW A;  2G35 A;  2KN5 A;  2YVC A;  2GBJ A;  2I1J A;  5CHW A;  1LXD A;  2D10 A;  2DZI A;  3A9K B;  2BYE A;  4MK0 A;  3A9K A;  2UVM A;  3L0W B;  4II2 B;  3IVF A;  2Z0P A;  1WE7 A;  2OOB B;  3ONS A;  3KSY A;  1I2H A;  3QIJ A;  2DYN A;  1NTY A;  1W1H A;  2N23 A;  1V5P A;  2DYQ A;  3FSS A;  5C5B A;  2MBO A;  1MIZ B;  2L76 A;  4IUM B;  5D3Y A;  1V2Y A;  1P1A A;  2EC1 A;  1U5E A;  1WVH A;  2OTX A;  2K2J A;  3M3J A;  2L7R A;  3DVN V;  5E6P A;  3QK0 A;  3QQ8 B;  3PRE A;  2NZ8 B;  2XBB C;  1BWN A;  1XR0 B;  3QHT A;  5FI1 A;  2LWP A;  1UZX B;  1UPQ A;  4ANU A;  4FJY A;  4ANV A;  4GU2 A;  3DCG A;  5DPR A;  3PZD A;  1NTV A; 
#chains in the Genus database with same CATH topology
 1FCC C;  2DLW A;  1SIJ A;  3M63 B;  4WJ7 A;  3KQ4 A;  5BMH A;  1C3T A;  3X23 A;  1QF6 A;  4BKT A;  2DZM A;  4D2K A;  1TT5 B;  4D0N B;  2J7Q B;  4A6K A;  3PLU A;  3AE2 B;  4W9F A;  3BK1 A;  2I38 A;  2C7M B;  2BB6 A;  4XWX A;  2Z0O A;  5BYQ A;  3HRD D;  4HAU B;  4QJ5 B;  2C7N B;  2JUO A;  2M4N A;  4URK A;  1TQZ A;  2COP A;  2N7D A;  2AEH A;  4FN2 A;  2KFK B;  2KFK A;  1S1Q B;  3TCA A;  4HXD A;  1TGZ B;  4AOF A;  2IGH A;  1V1P A;  3DHH C;  4A5K A;  5IOI A;  1EAZ A;  3NVZ A;  5JLJ B;  1WYG A;  2DX5 B;  1XT9 B;  2MRP A;  3PLV A;  3IT4 B;  1SF0 A;  2PE9 A;  5CLQ B;  5TSS A;  1RLF A;  4MSQ B;  4A20 A;  1FXT B;  2L32 A;  3PG7 A;  2JU6 X;  1UWX A;  2GB1 A;  2MJE A;  3ZXV A;  2MWN B;  1EU4 A;  3DPD A;  2J0K A;  3RPF C;  1WJM A;  1XCQ L;  2HE7 A;  1WMH B;  1U5G A;  1MFW A;  4KGR A;  1N62 A;  1L6V A;  2IZV B;  4XX5 A;  1AWD A;  4A8X C;  3L13 A;  3P1M A;  2UZS A;  5C16 A;  1WGU A;  1DBH A;  1RM6 C;  4YL8 A;  4HK2 A;  2LUE A;  2MCN B;  4JKC A;  2GCJ A;  1QLB B;  3AE3 B;  2K22 A;  4R3D A;  2YRY A;  4QXA B;  2KTR B;  1YJJ A;  3V05 A;  1T77 A;  1V81 A;  2K8B A;  3EHV A;  4N58 A;  1VDV A;  3D8D A;  4F7Z A;  2CB8 A;  3DBL B;  1N3H A;  2P0D A;  1VZ6 A;  4YTN B;  4NJ7 A;  3UQA A;  2WXO A;  3AE4 B;  3V62 A;  2PVO D;  3I57 A;  1GJZ A;  3SBT A;  3HUI A;  3N7C A;  2D2Q A;  2NMQ A;  1L4Z B;  2LD9 A;  1E7V A;  3TJP A;  3V60 A;  3MPX A;  3PVL A;  1ZKH A;  1ZYI A;  3M62 B;  2L2I A;  2RLO A;  2FCN A;  4RCO A;  3A58 A;  2KLG A;  2LJ5 A;  4W9H A;  5E6O A;  2LOZ A;  3UZT A;  1E8X A;  2DAJ A;  5KHQ A;  3WCQ A;  2NTS A;  2WP9 B;  2RSG A;  2BYF A;  2YSZ A;  3PT2 B;  3TIX A;  1VZ8 A;  4JKB A;  1WY8 A;  4CQN A;  4ASW C;  3HM3 A;  4JKE A;  3DHI C;  4KIK B;  5JHB A;  2KQ7 A;  1F0Z A;  2GCL A;  2KVZ A;  2ZVN A;  3TMP B;  1CMX B;  4P7I A;  3H8H A;  1KC7 A;  1MVK A;  4GOC A;  1T0Q C;  4ICV A;  1U5D A;  2WU5 B;  5JP4 A;  3TFM A;  2FUH B;  4IDI A;  5DHA B;  5AZF A;  3Q8C A;  2Y8G A;  4M8M A;  4BBN C;  3ZVR A;  1GB4 A;  2N1W A;  1FM0 D;  3AE5 B;  3P42 A;  2N9X A;  1WJ6 A;  2BKF A;  3N1Z C;  1JCK B;  1TIF A;  4EMO A;  2AQ1 B;  3QWZ B;  3UI3 A;  4ITK A;  3OJ3 A;  5CHF A;  4QJ4 B;  2XK5 A;  3AED B;  2RGF A;  3DVG Y;  1RJ2 A;  3TEY A;  1W1G A;  3NVY A;  2ONQ A;  4YSZ B;  1WGY A;  1JWS D;  3CSF A;  2EEL A;  2REX A;  5J17 A;  2JVC A;  3NG0 A;  2JP2 A;  1KRH A;  3AXC A;  4Z2N A;  2D9Y A;  2IGG A;  4FBJ B;  2MLB A;  4WJN A;  4G50 A;  3DBS A;  2MBH A;  4HAW B;  3WAO A;  2EKI A;  3GE8 C;  3C0R B;  3H6N A;  4KZ0 A;  4Q2J A;  2HRJ A;  2VRW B;  1ZDX A;  3TEX A;  3CST A;  5DPT A;  1WH3 A;  3ZNG C;  3NVV A;  2KDM A;  1CZP A;  2FJL A;  4B95 A;  3ZNI D;  1N63 A;  4AJW A;  1I4H A;  1QIL A;  2GOW A;  2NS5 A;  1RRP B;  2IPK D;  1TY2 A;  3H7S A;  2LGX A;  3BIN A;  3NZS A;  2NBU A;  4GOU A;  2GI9 A;  1P6S A;  1TS4 A;  1WM3 A;  1KM7 A;  3ODW A;  4K1R B;  3PP2 A;  2OED A;  2KN4 A;  1JWA D;  3DWG C;  2D3A A;  2X18 A;  1AYF A;  3BK2 A;  3ZDT A;  1FXA A;  2R2Q A;  2JXX A;  3IBE A;  2JXT A;  2R09 A;  1N61 A;  3H7P A;  1IRS A;  2WDT B;  1ZC3 B;  3L10 B;  3FIL B;  3NWD A;  1V97 A;  3MC9 A;  3MHZ A;  1RRB A;  1X86 A;  1HTQ A;  2NTT A;  2C7H A;  4GDK A;  5CX3 A;  2L05 A;  1OEY J;  3BY4 B;  4M0W A;  1MG4 A;  3ZTD A;  4M00 A;  2YS1 A;  3EFU A;  3N9Y C;  2FCS A;  2GLS A;  1ZVR A;  2XEW A;  1XLO A;  2BS2 B;  1IPG A;  2O6V B;  4GN1 A;  1QQG A;  2L0F A;  3DXE A;  4CYE A;  2UWQ A;  2V4I B;  4GSW A;  4LDT B;  2H89 B;  1TS3 A;  1MI0 A;  2JRI B;  3CF6 E;  1UNP A;  1T0Y A;  1I4G A;  3RUL A;  3ODO A;  2JWU A;  2DYB A;  4WQM A;  1Z5S B;  1ISN A;  3T3O A;  1ROE A;  4DHJ B;  4NQK E;  2DBY A;  1TXD A;  5DPW A;  2BT6 A;  1WGG A;  1C4A A;  4HAX B;  4P6V F;  1OMW A;  1PUT A;  2BF8 B;  3NJT A;  4XDC A;  1YQ4 B;  2G3Q B;  1X1G A;  2LMC A;  2W54 A;  1P5T A;  3P6A A;  1KLV A;  2IYD B;  1QOB A;  5LXI B;  5J3Q A;  3A98 B;  4KHB A;  2LJI A;  3AEE B;  3NHE B;  1PGB A;  3VOQ A;  1WGK A;  3RNG C;  3PZ8 A;  4S0R A;  1JRO A;  1SE9 A;  1QC6 A;  2COF A;  4A9A A;  3MC8 A;  3PTF C;  2CQU A;  1WX8 A;  4MGK E;  3L16 A;  3NS1 A;  1XX0 A;  1P7F A;  3RZF A;  1OY2 A;  2JZZ A;  3NW8 A;  2WXI A;  3K9P B;  2M56 B;  2KDB A;  3AE8 B;  4K3B A;  2ELB A;  1EVH A;  3R3M A;  1OQQ A;  3RN9 C;  3FEH A;  1ZM0 A;  1V89 A;  5L83 A;  4FA6 A;  1V1O A;  1ZOY B;  4MH0 E;  1ACC A;  2MHJ A;  2XNA C;  3ENE A;  1C76 A;  4GXB A;  5J18 A;  3BYT B;  4RM8 A;  5JZE B;  3OLM D;  4MGI E;  3KY9 A;  3NY5 A;  4IWQ A;  1SXT A;  1PMS A;  4JK9 A;  2MH7 A;  3TO1 A;  1TY0 A;  2KHW B;  4BFR A;  3RYT A;  2C60 A;  4MM3 B;  2ZPY A;  5KCV A;  5HE3 A;  1B1Z A;  1UGJ A;  2X8X X;  3UF8 A;  4G0N B;  5IN7 A;  1PGX A;  3V61 A;  4MSM B;  1CK1 A;  1T6B X;  1FRR A;  3PS6 A;  4II3 B;  4PS8 A;  1VBH A;  2KX0 A;  2VZK B;  1FD6 A;  1P7E A;  3U8Z A;  1GG3 A;  3D32 A;  3OAW A;  3RNF C;  3APC A;  4J3O D;  3WAL A;  1F9J A;  4NAM A;  2YEP F;  4W9D A;  2M1M A;  4K81 A;  1QOF A;  1S3S G;  3AJ4 A;  2NBV B;  3APD A;  5AZG A;  3RFZ B;  3VR8 B;  1STE A;  2LOX A;  3ZRF A;  4AS1 A;  2LBB A;  4DBG A;  3ML9 A;  2Z0Q A;  3IG3 A;  4A6F B;  5KHO A;  3GB1 A;  4LNI A;  2COD A;  1FGZ A;  2E2X A;  2ACZ B;  2BYT A;  2JRH A;  3VH4 B;  1ACA A;  1YNT E;  3ZO5 B;  4HAZ B;  4DXG A;  2KUP A;  3SV1 A;  5I2S A;  2MKR A;  1TJ6 A;  4TMA B;  4UDU C;  2ZEQ A;  3AE6 B;  1M7R A;  1JDE A;  3NS8 A;  1I4X A;  4KDI C;  3RCP A;  4NJ6 A;  3HIZ A;  3VHT C;  2CKH B;  2WU2 B;  4YTM B;  2DAF A;  4MDK E;  4GB9 A;  1F2R I;  2JPH A;  2WXJ A;  1HBK A;  2XN9 C;  5CLL B;  2KFJ A;  1XEE A;  2D3C A;  2FE8 A;  2KC1 A;  2DKP A;  3KRW A;  4BBK A;  1XLN A;  2BS3 B;  4JK7 A;  5DIF B;  2ZNV B;  1HZ5 A;  4LJO B;  2MBB B;  4JKH A;  1U2B A;  1TBE A;  1ET9 A;  2HJ8 A;  1PFD A;  1X1M A;  1L6U A;  2ZW1 A;  1HB8 A;  1ZE3 D;  1DDW A;  2WXH A;  3RCZ A;  3FM8 C;  5D94 A;  2MWS B;  4LNO A;  2KGX B;  2INC C;  4A6Q A;  2K00 A;  1JQ4 A;  3ABV B;  3Q3O C;  2G9H D;  4A3P A;  1V86 A;  2E6X A;  5E6J A;  4ACF A;  2MSE D;  1OQY A;  4WJP A;  2K0P A;  2WWZ A;  3DOW A;  3GS2 A;  3UGB B;  4WSF A;  1HA5 A;  2UU7 A;  3WA0 A;  3HM6 X;  2RMM A;  4FJV B;  3ZGZ A;  2K8C A;  1E8Y A;  2BVC A;  1DIK A;  1TS2 A;  3AEC B;  3QAR A;  1FPY A;  2HDE A;  4M8N A;  2N7E A;  5L95 C;  2H7D A;  4A6H A;  4NPN A;  1X11 A;  5D27 A;  3MTN B;  4YSX B;  1U5F A;  5FR6 A;  2R82 A;  2P8V A;  1XLQ A;  2K6D B;  2WLB A;  3EUB 2;  1EWY C;  1UNS A;  4WWN A;  4NQL B;  1J19 A;  2FJ9 A;  3GE3 C;  4C56 C;  1CQV A;  3BVG A;  3OHM B;  2BYV E;  3Q8E A;  4HPL B;  1KTK A;  5HG2 A;  1ZGU B;  3PPA A;  1DDV A;  3UIO B;  2I5C A;  1WJU A;  4DQO C;  3PRP B;  2MEK A;  2PVG C;  2RDB C;  3WAM A;  2ROV A;  2N1V A;  1WR1 A;  2PEA A;  2KYW A;  5I4D A;  3APF A;  1TTN A;  1BTN A;  3U2S C;  1BUI C;  4HLE A;  2W2W A;  1SBB B;  4MY6 A;  3V3X A;  2KCJ A;  3TEW A;  1V80 A;  1RAX A;  3CMM B;  2LXA A;  4JPS A;  4MGY E;  1DOY A;  4DXF A;  1OEY A;  1ZXI A;  1UF0 A;  3U7Z A;  3VR9 B;  2HTH B;  2HTH A;  2IFS A;  3ECI A;  1ESF A;  4KKJ A;  3BJI A;  2WDQ B;  4AWJ A;  3N32 A;  4GGQ A;  3B1L X;  2ICI A;  1Y5O A;  4ILJ A;  4DWF A;  4MAC A;  1U29 A;  4HDQ A;  2KWD A;  3A4S C;  2GBM A;  1SJE D;  2DHI A;  2RSU A;  4WJO A;  2BKR B;  4W9C A;  3L54 A;  4E71 A;  3H9D A;  4LK0 M;  4KVG B;  1EO6 A;  4CHJ A;  1NTI A;  5J2R A;  3B08 A;  2NBW B;  2J53 A;  1SHC A;  2Y7B A;  4OZC A;  1ZW7 A;  4K3C A;  3P63 A;  2SAK A;  3ZQ4 A;  2KJH B;  4NSW A;  1FNW A;  2WQY B;  5MPO A;  1ET6 A;  1XCT L;  1YX6 B;  2DTC A;  2G4D B;  2DX5 A;  3PSE B;  3Q3N C;  5HFY A;  1OQR A;  2KWC A;  2EMS A;  4IM3 A;  2HJ1 A;  1I7A A;  5JHH A;  4IWO A;  3G9W A;  2KDI A;  3EFC A;  5JHG A;  4B0E A;  2ZKM X;  2KQ4 X;  2KAC A;  2LRU A;  3NVW A;  1J0W A;  1PDX A;  3T9L A;  2K39 A;  1XO3 A;  2DKQ A;  3EA6 A;  4CHM A;  5DI9 B;  4GPT B;  3VDZ A;  2KNB A;  4C7Y A;  4HRS A;  1WMH A;  4IM0 A;  2D4Q A;  4XWW A;  1FOE A;  1L0Y B;  2WXR A;  3ZTC A;  2K49 A;  3DWM A;  2OQB A;  3Q14 C;  3R7R A;  2Q13 A;  4ARI A;  2V0G A;  2AL3 A;  1NDD A;  5CTR C;  4REZ A;  1HXY D;  3B2F A;  1OGW A;  1V5M A;  2KJ6 A;  3HIE A;  1XXG A;  3DXC A;  4RMA A;  1FHX A;  2KTR A;  4W9J A;  5BYR A;  1IBX B;  2N9L A;  1Q10 A;  1U4A A;  1QOG A;  2I2Y A;  4ZRI A;  2PJH A;  1WZ0 A;  1EUV B;  3R7Q A;  3WYF B;  2D07 B;  1DDM A;  1E8Z A;  1P98 A;  1C9F A;  1N60 A;  4FXC A;  4MT7 A;  2FIF A;  3MDB C;  2L1A A;  2R0D A;  1M94 A;  2Z13 A;  4RH6 A;  3IT6 B;  4LTU A;  3C19 A;  3KRX A;  2FUG 1;  2N0S B;  1WGH A;  5C23 A;  3B0A A;  1N5X A;  4ZYS A;  1WZ3 A;  5D3V A;  1UPR A;  3HQC A;  4WWM A;  3D8F A;  2WH5 A;  1K52 A;  2AQ2 B;  2O6V D;  3VXW A;  4WWP A;  1MJD A;  4LDT D;  4YON A;  4DX8 A;  1MK9 B;  4RF0 A;  2FNJ B;  1EF1 A;  3QCA A;  4FUL A;  3RNA C;  4JKD A;  1UWM A;  4KGT A;  2JY6 A;  1NYR A;  4PT5 A;  2V3S A;  1L2N A;  3DDC B;  2KX3 A;  4BKG A;  1WRI A;  4KIK A;  4DHJ D;  1YN3 A;  3DVN U;  2QHO A;  1IP9 A;  2D9V A;  2LFI A;  1I4Q A;  2LGY A;  1D4B A;  1AW7 A;  1JRU A;  4XDD A;  3KYD D;  1NI2 A;  5BMI A;  2DEN B;  2RRF A;  4FJZ A;  2WS3 B;  1TKY A;  2R61 A;  2YT1 A;  2ZNV C;  4US8 A;  4RGO S;  4YSY B;  2W9N A;  1AN8 A;  1QKZ A;  5EE1 A;  1IYF A;  4AP4 C;  1Z87 A;  2KMM A;  4QAY A;  2BWE S;  1D6E C;  1T5X D;  2RDH A;  4B6W A;  4RM9 A;  2GJY A;  3KWL A;  1H10 A;  4IOY X;  4D6W A;  2WXN A;  3LYY A;  1TZ1 A;  2UZR A;  1FFV A;  1T3Q A;  1UGM A;  2QSD A;  4FHJ A;  1YD8 U;  3QC8 B;  2X0S A;  1WR6 E;  4KHO A;  2W55 A;  2CRF A;  2GS0 A;  4BOS C;  5D6J B;  1Y19 B;  1UNR A;  4USA A;  4MJS B;  2J42 A;  2G4S A;  2K1F A;  2WDV B;  2LKO A;  1DYN A;  3B9J A;  3IAS 1;  3IHP C;  3A1Q B;  3ZNZ B;  3T06 A;  1I42 A;  4Z2M B;  1E90 A;  1J7A A;  4CHK A;  2EKE C;  4OVZ A;  3MC0 B;  2H7E A;  1RFK A;  1FRD A;  5EE3 A;  2V3P A;  1GAQ B;  1K51 A;  2NPT B;  1XKE A;  2LAS A;  3IFW B;  3LDZ E;  1WSP A;  1R4N I;  2Z0D B;  4S17 A;  1M7E A;  2QKL A;  4WAA A;  4GZU A;  1NVL A;  4DX9 0;  2EJ8 A;  4AUQ C;  4ICU A;  3NUH B;  1MHH E;  2KXJ A;  1GOZ A;  1NBF C;  2CY4 A;  1V9J A;  2GRI A;  2I5F A;  2ZVO A;  3URY A;  1MK7 B;  2V76 A;  2VZK D;  1XLP A;  2LRW A;  3RNE C;  2DYM A;  4EKU A;  5DCN A;  1UEL A;  1JRP A;  2WXG A;  3PZ7 A;  3PRM B;  4HJK A;  2COA A;  2N9K A;  2Z0E B;  4JWS C;  4DK5 A;  2P0F A;  2N7J A;  4IWP A;  5G2N A;  4DDI D;  1T0R C;  2ZZP B;  3VRA B;  2KIG A;  3QJZ A;  3BYY B;  3FIL A;  4EOY A;  2AWT A;  1Y56 A;  5DPS A;  3NRZ A;  2J4X A;  3SBG A;  1E5W A;  2MJ3 A;  3DCX A;  4IW0 A;  1HTO A;  4ZYN A;  3Q8A A;  4A3O A;  1KBL A;  4DBB A;  1DOX A;  3SFD B;  3VTU A;  1D3Z A;  1FCL A;  2JX5 A;  3J9C A;  2W2X C;  4JQW C;  1YX5 B;  3X0W A;  1HE8 A;  3RT3 B;  1FGY A;  2LXC A;  2O6V A;  2IO0 B;  2OJR A;  2KKC A;  2YEP B;  1WJ1 A;  2KK8 A;  1UNQ A;  3T8M A;  4AQ7 A;  1C78 A;  2RDG A;  3WAP A;  1KF6 B;  4ANW A;  4H8S A;  1WJ4 A;  2JZ3 B;  3W5U B;  1A70 A;  2FDQ A;  3RUI B;  3M95 A;  1FB8 A;  1ZUD 2;  4DHZ E;  5FKA C;  3N30 A;  1V88 A;  2RR9 A;  3KLS X;  1J8C A;  3D8E A;  3KWV A;  4HHV A;  1EU3 A;  2CU1 A;  1Q67 A;  3TEZ A;  4F7U P;  4GIV A;  1SE4 A;  4RGN A;  1H8C A;  2M8S A;  2LGI A;  3GOE A;  3ZLZ A;  4LCD E;  1JAL A;  4TV3 A;  4WWO A;  4DDG D;  4PQ0 A;  3BVZ A;  1C4P A;  1L0V B;  3NWF A;  3TL5 A;  2UYZ B;  4IFS A;  2L0T A;  2ROZ B;  3SUZ A;  4F1S A;  3SYX A;  4B6H A;  2R2Y A;  2RUK B;  3ULC A;  2MQJ A;  2L3Z A;  4JKG B;  1KFY B;  4JKG A;  1D5Z C;  2MBQ A;  3MFG A;  4HB0 B;  2WXM A;  3W1Y A;  2QKM A;  1HEZ E;  4OHJ A;  3KH0 A;  3OJ4 B;  4RF1 A;  3A8P A;  3ETR A;  2K5P A;  2NVU I;  4W9K A;  4TQ0 A;  3PGE A;  4MEL A;  1LGR A;  4NZL B;  1K8R B;  2KC2 A;  4JGH B;  2M0A A;  3QAQ A;  4OT1 A;  4WVF B;  1LO5 D;  3Q2A C;  5LXH A;  2WXK A;  2D3B A;  2Y3A A;  2MDX A;  3V5W A;  3FKY A;  4NNJ B;  2BW2 A;  1VCB A;  4ZHP A;  1L7Y A;  2FCM A;  2I1K A;  3OAN A;  2M17 A;  3KVF B;  3P4Q B;  4Y94 A;  2GBR A;  3ZDM C;  4ZRK A;  2VRR B;  1MAI A;  2Z59 B;  1WE6 A;  3A33 B;  4OZB A;  4MM3 A;  1WGR A;  4IKG A;  5G55 A;  2IYB A;  3R2I A;  5C2T B;  1UBQ A;  2L83 A;  4LNF A;  4WQO B;  2DNF A;  2K8H A;  4H2A A;  2BCJ A;  2V9H A;  1UEF A;  4NAW B;  2AYO B;  4ZDV A;  2ZJD A;  5HE0 A;  2M0X A;  2J0M A;  3NOB A;  3W1S A;  3ZJU A;  4XYC A;  3NZU A;  1VJK A;  3VVW B;  4N59 A;  1P3Q U;  3GYO A;  1SB3 C;  3N20 C;  1DRO A;  2NBV A;  4HKQ A;  1NYQ A;  4RGM A;  3P2B A;  1MPE A;  2ON8 A;  3AEG B;  4HAV B;  3NSU A;  4A6F A;  1FHO A;  5IO9 A;  3E9O A;  2C5L C;  3SNH A;  2W2X D;  4KAX B;  2PKO A;  3U52 E;  4WIP A;  1AQC A;  4HAT B;  2LGS A;  4JL9 A;  1L5P A;  3Q3J A;  4KV2 A;  4NJC A;  5C3J B;  3JSV B;  1JW9 D;  5FK9 C;  3PV1 A;  2O2V B;  4FHK A;  4GLS C;  4K17 A;  2LUM A;  3BII D;  1HQR D;  4YT0 B;  1P0R A;  2PIA A;  2BWF A;  1FO4 A;  1Q1O A;  4I6L B;  4BZA A;  5IA7 A;  1RWS A;  2CR5 A;  3Q8F A;  3TUO A;  4LJP B;  2D3G A;  3SFE B;  4ILH A;  2KAN A;  5J3T A;  4HB4 B;  3A9J B;  3HW2 B;  5JXV A;  3ZYY X;  1NEN B;  2DYO A;  2D9X A;  1XD3 B;  4E3C A;  1X1F A;  4TSS A;  3CIK A;  2W3S A;  3DHG C;  3TBL D;  4EEW A;  1YIW A;  1WIA A;  1GGO A;  1LB1 A;  3DBH I;  5G5H A;  1E7P B;  3VQI A;  4KSK C;  1PFJ A;  5JVL A;  1CJE A;  5C79 A;  2OHF A;  2R2O A;  2IY0 B;  2YLM A;  1Z2M A;  1HB6 A;  4EJN A;  2LUL A;  2LZ6 A;  3H1U A;  2GMI C;  3HK0 A;  3ZXR A;  5EDS A;  3RZW C;  4I6N B;  3ZKJ C;  2DA0 A;  4C4V B;  4C4V A;  4M01 A;  3EEC A;  5LNK 1;  1F1H A;  4I6P A;  4OW0 A;  2JT4 B;  5CHV C;  1P3R A;  5T8I A;  3U4E G;  1E10 A;  3AUL A;  1RYJ A;  1QOA A;  1NU2 A;  1SE3 A;  1OTR B;  1FMA D;  4HJG E;  2K25 A;  2LVP A;  5BO4 B;  1KZG A;  3CWI A;  4P16 A;  3VFK A;  1U27 A;  2CU3 A;  3B77 A;  2JZP A;  2ZCB A;  1WGQ A;  2WNM A;  5DH9 B;  3V6C B;  5J3Y A;  5C5B B;  1E8W A;  2ADZ A;  2ELA A;  3PEG A;  2VKI A;  3ALB A;  4HB2 B;  2RPQ A;  2KMA A;  1R4M I;  2DX1 A;  2WXQ A;  1WI0 A;  4GMV A;  4RNA A;  2KWU B;  4OZA A;  2OJW A;  4L23 A;  3SEB A;  3MP9 A;  3CXB B;  1C4C A;  4PS3 A;  2L8J A;  3PO0 A;  1Y8R C;  1LFD A;  5D3I B;  2WXP A;  1W1D A;  3EC8 A;  5D3X A;  1K5G B;  2CY5 A;  4MEM A;  1E0Z A;  1N5W A;  4K7U A;  1L4D B;  4N6E B;  3HVD A;  2FCQ A;  4W9E A;  2IGD A;  2WHI A;  4MH8 A;  2KTF A;  4EFO A;  4KHA A;  1FNU A;  2ZCC A;  1XD4 A;  2V1Y A;  3FVC A;  2VH2 A;  4EZL A;  3MJW A;  4KSL C;  3ULB A;  1FAO A;  1NEK B;  3Q8B A;  3SU8 X;  3VH3 B;  3M1I B;  1LM8 B;  4XWT A;  3A8Q A;  1ZXH A;  2WYQ A;  5AUI A;  3ML4 A;  2D9W A;  5GOW B;  1BML C;  4YTP B;  5LOP B;  4HCP B;  2YT2 A;  3A4R A;  5EFX A;  4HKZ E;  1NVI D;  1E9M A;  1KOT A;  2CHW A;  3P4R B;  3PHW B;  2JQR B;  1JML A;  2GBN A;  1GPX A;  1YQB A;  1WXS A;  2D5G A;  4ARC A;  2DZK A;  3IXS A;  1WXA A;  4XGA B;  2VH1 A;  5AUK A;  1WWT A;  3PVU A;  1TS5 A;  2KR0 A;  1TJE A;  1J0G A;  1IGC A;  3E9L A;  1FEH A;  2MW5 A;  4AJY B;  3AEB B;  4F7H A;  5M4Y B;  1EM7 A;  2JSV X;  4W9G A;  3EPY A;  4JWU C;  4BBN F;  4C80 A;  3UQB A;  4F8C B;  4L1R A;  2IBI B;  1JWB D;  1WGD A;  2LHE A;  3TW1 A;  2FBW B;  1YJI A;  1PYW D;  2BS4 B;  2WX1 A;  1M4V A;  1V1P B;  3UIN B;  4ZRJ A;  3PRZ A;  2M14 A;  3GP7 A;  4K2P A;  4ZOH C;  1OQN A;  1IUE A;  4QJ3 B;  5JH5 C;  2DLB A;  3SDL C;  2Z4D A;  4JIO U;  1MIX A;  2IY1 B;  3KUD B;  2YS5 A;  2Z14 A;  1AAR A;  2PZ1 A;  1VR9 A;  4B9K A;  4IM2 A;  1V49 A;  1Q5W B;  4TYZ A;  3W5V B;  2Y5B B;  1R7S A;  1EF5 A;  5DHF B;  1T0S C;  3JVZ X;  5FI0 A;  2JF5 A;  3AN1 A;  1WXM A;  3AI5 A;  4LLG M;  2K2U A;  4BOZ B;  3ZJT A;  1H4R A;  3W1S C;  1IBX A;  2YS3 A;  2EMT A;  3U7D A;  2DIK A;  5AZH A;  4ZHO A;  3K9O B;  4FAD A;  2SEB D;  3ZRC A;  2QEJ C;  2BBC A;  4ANX A;  2KOX A;  3S2A A;  3DBR I;  3DQV A;  4L2Y A;  2KD0 A;  3PSC A;  1YQ3 B;  2WXF A;  2KT7 A;  3KZ1 A;  4RGT A;  3AEA B;  4PNK A;  2HTM E;  2KQS A;  3QX1 A;  1MG8 A;  1KJT A;  4HRO A;  2Y5C A;  4DXA B;  4HSI A;  4MT5 A;  5FR3 A;  3VTV A;  1MI1 A;  1WX7 A;  3EGR A;  5HE2 A;  2DWQ A;  3GZN I;  1HZ6 A;  1ZP0 B;  2LGD A;  2A4Z A;  4WAF A;  3E56 A;  1ENF A;  1BT0 A;  1ST7 A;  4M02 A;  5D7G A;  4HB3 B;  1FFU A;  4FLH A;  3N1X C;  3SO6 A;  2H88 B;  1SE2 A;  4DIX A;  3KUZ A;  1IGD A;  2PTL A;  4XE0 A;  4K7S A;  1RFA A;  2BB5 A;  3AV8 A;  2DHZ A;  5H8Y E;  3HVZ A;  1WG7 A;  1K50 A;  2WX0 A;  4XZ4 A;  5HI1 A;  5EE9 A;  2WDR B;  2BQQ A;  2LI5 A;  1WRD B;  4CSQ A;  1ZDV A;  5C1Z A;  1ZC4 B;  5HE1 A;  3WAN A;  2V3N A;  2D11 A;  2LVO A;  2JWZ A;  3GYP A;  3DBH B;  5LLI A;  4WJQ A;  1VRA B;  1YOV B;  4J6I A;  1VBG A;  4LNK A;  1KZ7 A;  1YJ1 A;  2KO3 A;  1KH0 A;  4ZRP A;  4PK1 A;  2BPS A;  2C9W B;  4MGZ E;  3TVV A;  3RMK C;  2LYD A;  2CHX A;  2L00 B;  3PHX B;  4CO7 A;  4KZC A;  1Q0W B;  2FID A;  3E9P A;  3F0W A;  4BKS D;  3AE9 B;  1PLS A;  4HPP A;  4L1B A;  1PQS A;  2LEK A;  1B9R A;  2KLC A;  3JYU A;  1WFY A;  4MJS A;  4E74 A;  4W9L A;  1X05 A;  1ZSQ A;  4PS7 A;  3L4P A;  3ML8 A;  3A1Q A;  1WF9 A;  2PPH A;  2KAJ A;  1WYW B;  2XK5 B;  2DHJ A;  5I2M A;  4IOI E;  1V61 A;  2J59 M;  3ODX A;  2N4F A;  3ZJV A;  2KJR A;  3ZNH B;  1WM2 A;  3FP5 A;  2NPT A;  4G3X B;  3VAW A;  1B55 A;  3KYC D;  1EGX A;  3I9V 1;  1A5R A;  1R4M B;  1MPH A;  1ZPS A;  1OFF A;  2Q5W D;  2ASQ A;  1SGH A;  4EZJ A;  4JX1 C;  2VSZ A;  1WJN A;  2Y8F A;  3AEF B;  4KKI A;  4YWG G;  3BZD B;  3ZVV A;  2K3U A;  3SHQ A;  3I5J C;  2CAY A;  2KUQ A;  3Q6B A;  4JKA A;  2KDE B;  2MP2 B;  3I63 C;  1QZE A;  2MP2 A;  2L52 A;  3MHS D;  2RGN B;  5E6N A;  3SD5 A;  2L1C A;  4A55 A;  2N9P C;  1GUA B;  1LW3 A;  1E6E B;  3U30 A;  5IKC M;  2LG1 A;  2CJO A;  1XF5 L;  2K6Q A;  4W9I A;  1SJH D;  3MJ5 A;  1K5D B;  1DGJ A;  2CHZ A;  1V5U A;  4WH4 A;  3HSA A;  3RI7 C;  2MBE A;  3P4P B;  3AB5 A;  3DXD A;  2GUM A;  5LON B;  1TZO A;  1I35 A;  4WUR A;  2DFK A;  4KDL B;  4TKN A;  3FLV A;  4GMX B;  2B76 B;  2V4L A;  3H7P B;  3VIA A;  4N9F 4;  5HHD G;  2QMT A;  3Q3F A;  4K7W A;  3RD2 A;  2KVR A;  2QDF A;  3UIP B;  2N9E B;  3B2G A;  3W2D A;  2DHK A;  5C6R A;  1V6E A;  4GDK B;  4M0W B;  5KQ4 A;  4JK8 A;  1TKG A;  3O13 A;  3RNB C;  2PW9 A;  4GDL B;  1YMH E;  4GDL A;  5D3D A;  2RD0 A;  1QQR A;  1QT9 A;  4EUT A;  2NMB A;  2IDY A;  3I3T B;  2BTE A;  4JKF A;  2KMC A;  3HHM A;  3ZUN A;  2J0J A;  4HDO A;  2MA9 B;  3E9S A;  4NY0 A;  3O96 A;  1BAK A;  2QC8 A;  2ZPN A;  3OWE B;  4C7Z A;  4OVV A;  5AEK B;  1FXI A;  3NWA A;  3JW0 X;  2FAZ A;  1F77 A;  4IC7 B;  4OSN A;  1XQQ A;  2DN6 A;  3FC4 A;  1P9D U;  2LVQ A;  4O1N A;  1I4R A;  3QA8 A;  5IAA C;  2N0Y A;  1DYQ A;  4US9 A;  2RQ1 A;  4TQ1 A;  3AE7 B;  2YT0 A;  4KHB B;  1GNU A;  1V5O A;  4BKS A;  2BGF A;  5D2M B;  3LJU X;  2AL6 A;  2YF0 A;  3QWM A;  4IAP A;  2KDF B;  2XQN M;  2K8E A;  2MX2 A;  1E7U A;  5IJM A;  1FHW A;  2IO3 B;  3P7Z A;  1XCG A;  1XOD A;  4HEA 1;  4C0A A;  3BWU D;  1UBI A;  3PVW A;  3V6E B;  5KQ1 A;  1WXV A;  4RFB A;  2HD5 B;  1NI3 A;  5HKH A;  2Y5P A;  3KW5 B;  1LQB A;  4JE3 B;  4KGS A;  1GC6 A;  2M38 A;  4K2O A;  3Q3M C;  2Z59 A;  1C79 A;  3DVG X;  5GMV A;  2NCN A;  2K9X A;  3O65 B;  1C1Y B;  1BXT A;  3DBR B;  4TUU A;  4L6E A;  3ZIM A;  2ABD A;  2CJN A;  2IO1 B;  2B3A A;  1VLB A;  4C00 A;  3ENB A;  3CIR B;  1SSN A;  2GBK A;  1G6J A;  4HAY B;  4XC2 A;  4P1C C;  1BTK A;  4NAW A;  3OG5 A;  2JYT A;  2KZR A;  3KUC B;  2WXL A;  2W3R A;  3W9C B;  4P1B C;  4B0M A;  3GZN B;  4PYU A;  4ZRQ A;  3QBV B;  2RVB B;  3AU5 A;  4HPM B;  1WX9 A;  1N6Z A;  1J7C A;  2FJU B;  3N1Y C;  3AH7 A;  1J7B A;  4HCN B;  4EZK A;  1GC7 A;  5EE0 A;  1F2R C;  2INP E;  3C8Y A;  4YXD B;  2MJD A;  3DBL I;  3P4S B;  1UUP A;  4G11 A;  3R8B A;  4F7G A;  2KWV B;  5JHA A;  3N3K B;  5IP4 D;  2D9Z A;  3JSV A;  2PLP A;  1TYG B;  2O2V A;  5D3W A;  1TKE A;  3T3N A;  4BVU C;  2AQ3 B;  2NR2 A;  5H92 C;  3L08 A;  2G45 B;  1K53 A;  3R66 C;  2A5U A;  3WIM A;  3E66 A;  2PE6 B;  5L81 A;  1UD7 A;  1AWE A;  4HWI B;  1KLU D;  2DZJ A;  1SIF A;  3L17 A;  4HVB A;  3ZW3 A;  4OVU A;  4JLC A;  4PYZ A;  2IO2 B;  1MKE A;  2P0H A;  3F5R A;  2IJ0 A;  1UH6 A;  3RNC C;  3A9J A;  2W82 A;  1FIQ A;  4KX6 B;  5BMG A;  2CS4 A;  1WI1 A;  3LJ3 A;  3VTW A;  4A90 A;  3VUY A;  1I4P A;  4IG7 B;  2QJL A;  3AU4 A;  1V5T A;  2INN E;  1KI1 B;  2QIE B;  3AM9 A;  4X57 B;  2X38 A;  2COC A;  2RNR B;  2E3T A;  1VD2 A;  5TR5 A;  2MFQ A;  4DHZ B;  3VUX A;  3VUW A;  2G35 A;  2KN5 A;  2YVC A;  2GBJ A;  2I1J A;  5CHW A;  1DOI A;  1D5M C;  1LXD A;  3U12 A;  2D10 A;  2JYE A;  2DZI A;  3A9K B;  1R4N B;  2BYE A;  4MK0 A;  2RPV A;  3A9K A;  3VRB B;  2Z8L A;  2UVM A;  3L0W B;  2WGS A;  3BVM A;  4II2 B;  2J52 A;  3IVF A;  2Z0P A;  1EWC A;  1V8C A;  1WE7 A;  2PMV A;  3NZ3 A;  2OOB B;  5G5G A;  3ONS A;  1MHX A;  3KSY A;  2IND C;  2QCZ A;  1D5X C;  1I2H A;  1FNV A;  3QIJ A;  2DYN A;  1NTY A;  1W1H A;  3LXF A;  2N23 A;  4ILG B;  1V5P A;  4EE2 A;  2DYQ A;  3FSS A;  5C5B A;  3SR6 A;  2MBO A;  2G1E A;  1MIZ B;  2L76 A;  3R2T A;  1F52 A;  4IUM B;  5D3Y A;  1V2Y A;  5LG4 B;  1SEB D;  2AX5 A;  1P1A A;  1YN4 A;  1I7H A;  3TSS A;  2EC1 A;  1C77 A;  1U5E A;  1KLG D;  1YN5 A;  4BAX A;  1WVH A;  2TSS A;  5GXG B;  2OTX A;  2K2J A;  1PGA A;  3M3J A;  1VZ7 A;  2L7R A;  4GNK B;  2LHD A;  3DVN V;  3LB8 C;  1GB1 A;  5E6P A;  3QK0 A;  3QQ8 B;  2KIE A;  3PRE A;  2NZ8 B;  2XBB C;  3AE1 B;  1BWN A;  2QIL A;  1XR0 B;  3QHT A;  5FI1 A;  2LWP A;  1UZX B;  1UPQ A;  5IRS A;  4ANU A;  3AMZ A;  5BYS A;  3FAH A;  4FJY A;  2M19 A;  1L0X B;  4ANV A;  4GU2 A;  3DCG A;  4LNN A;  1WXQ A;  5DPR A;  1JWM D;  3Q69 A;  3PZD A;  3IAM 1;  1JWU D;  1NTV A;  2ZW0 A; 
#chains in the Genus database with same CATH homology
 2DLW A;  3M63 B;  4WJ7 A;  1C3T A;  3X23 A;  4BKT A;  2DZM A;  4D0N B;  2J7Q B;  4A6K A;  3PLU A;  4W9F A;  2C7M B;  4XWX A;  2Z0O A;  4HAU B;  2C7N B;  2JUO A;  2M4N A;  4URK A;  1TQZ A;  2COP A;  2N7D A;  2AEH A;  4FN2 A;  2KFK B;  2KFK A;  1S1Q B;  3TCA A;  4HXD A;  1TGZ B;  4AOF A;  4A5K A;  1EAZ A;  5JLJ B;  2DX5 B;  1XT9 B;  2MRP A;  3PLV A;  2PE9 A;  5CLQ B;  1RLF A;  4MSQ B;  4A20 A;  1FXT B;  3PG7 A;  2MWN B;  3DPD A;  2J0K A;  1WJM A;  2HE7 A;  1WMH B;  1U5G A;  2IZV B;  4XX5 A;  3L13 A;  2UZS A;  5C16 A;  1WGU A;  1DBH A;  4YL8 A;  4HK2 A;  2LUE A;  2MCN B;  4JKC A;  2GCJ A;  2YRY A;  2KTR B;  2K8B A;  1V81 A;  3EHV A;  3D8D A;  4F7Z A;  2CB8 A;  1N3H A;  2P0D A;  4NJ7 A;  3UQA A;  3V62 A;  1GJZ A;  3SBT A;  3N7C A;  2D2Q A;  2LD9 A;  1E7V A;  3TJP A;  3V60 A;  3MPX A;  3PVL A;  1ZKH A;  3M62 B;  2L2I A;  2RLO A;  2FCN A;  2KLG A;  2LJ5 A;  4W9H A;  5E6O A;  2LOZ A;  3UZT A;  1E8X A;  2DAJ A;  5KHQ A;  2RSG A;  2BYF A;  2YSZ A;  3PT2 B;  3TIX A;  4JKB A;  1WY8 A;  4ASW C;  3HM3 A;  4JKE A;  4KIK B;  5JHB A;  2KQ7 A;  2GCL A;  2ZVN A;  3TMP B;  1CMX B;  4P7I A;  1KC7 A;  4GOC A;  4ICV A;  1U5D A;  5JP4 A;  3TFM A;  2FUH B;  5DHA B;  5AZF A;  2Y8G A;  4M8M A;  4BBN C;  3ZVR A;  2N1W A;  2N9X A;  1WJ6 A;  2BKF A;  4EMO A;  3QWZ B;  3OJ3 A;  5CHF A;  2XK5 A;  2RGF A;  3DVG Y;  1RJ2 A;  1W1G A;  1WGY A;  3CSF A;  2REX A;  5J17 A;  2JVC A;  2JP2 A;  3AXC A;  4Z2N A;  2D9Y A;  4FBJ B;  2MLB A;  4WJN A;  4G50 A;  3DBS A;  2MBH A;  4HAW B;  3WAO A;  3H6N A;  3C0R B;  4KZ0 A;  2HRJ A;  2VRW B;  3CST A;  5DPT A;  1WH3 A;  3ZNG C;  2FJL A;  4B95 A;  3ZNI D;  4AJW A;  2GOW A;  2NS5 A;  1RRP B;  3H7S A;  2LGX A;  3BIN A;  3NZS A;  2NBU A;  1P6S A;  1WM3 A;  1KM7 A;  3ODW A;  4K1R B;  3PP2 A;  2X18 A;  3ZDT A;  2R2Q A;  2JXX A;  3IBE A;  3H7P A;  2R09 A;  1IRS A;  2WDT B;  1ZC3 B;  3L10 B;  1RRB A;  1X86 A;  2C7H A;  4GDK A;  5CX3 A;  2L05 A;  1OEY J;  3BY4 B;  3ZTD A;  2YS1 A;  3EFU A;  2FCS A;  1ZVR A;  2XEW A;  2O6V B;  1IPG A;  4GN1 A;  1QQG A;  2L0F A;  3DXE A;  4CYE A;  2UWQ A;  4GSW A;  4LDT B;  2JRI B;  3CF6 E;  1UNP A;  1T0Y A;  3RUL A;  3ODO A;  2DYB A;  1Z5S B;  1ISN A;  4DHJ B;  4NQK E;  1TXD A;  5DPW A;  1WGG A;  4HAX B;  1OMW A;  2BF8 B;  2G3Q B;  1X1G A;  1P5T A;  3P6A A;  1KLV A;  2IYD B;  5LXI B;  5J3Q A;  3A98 B;  3NHE B;  3VOQ A;  1SE9 A;  1QC6 A;  2COF A;  3PTF C;  2CQU A;  1WX8 A;  4MGK E;  3L16 A;  1XX0 A;  3RZF A;  1OY2 A;  2JZZ A;  3K9P B;  2KDB A;  2ELB A;  1EVH A;  3R3M A;  3FEH A;  1ZM0 A;  1V89 A;  5L83 A;  4FA6 A;  4MH0 E;  3ENE A;  4GXB A;  5J18 A;  4RM8 A;  5JZE B;  3OLM D;  4MGI E;  3KY9 A;  3NY5 A;  4IWQ A;  1PMS A;  4JK9 A;  3TO1 A;  2KHW B;  4BFR A;  3RYT A;  2C60 A;  2ZPY A;  5KCV A;  5HE3 A;  3UF8 A;  4G0N B;  3V61 A;  4MSM B;  3PS6 A;  4II3 B;  4PS8 A;  1VBH A;  2KX0 A;  3U8Z A;  1GG3 A;  3D32 A;  3OAW A;  3APC A;  3WAL A;  1F9J A;  4W9D A;  2M1M A;  4K81 A;  1S3S G;  3AJ4 A;  2NBV B;  3APD A;  5AZG A;  2LOX A;  3ZRF A;  2LBB A;  4DBG A;  3ML9 A;  2Z0Q A;  3IG3 A;  4A6F B;  5KHO A;  2COD A;  1FGZ A;  2E2X A;  2JRH A;  3VH4 B;  1ACA A;  3ZO5 B;  4HAZ B;  2KUP A;  3SV1 A;  2MKR A;  1TJ6 A;  2ZEQ A;  1M7R A;  1JDE A;  3NS8 A;  4KDI C;  3RCP A;  4NJ6 A;  3HIZ A;  3VHT C;  2CKH B;  2DAF A;  4MDK E;  4GB9 A;  2JPH A;  1HBK A;  5CLL B;  2KFJ A;  2KC1 A;  2DKP A;  3KRW A;  4BBK A;  4JK7 A;  5DIF B;  2ZNV B;  4LJO B;  2MBB B;  4JKH A;  1U2B A;  1TBE A;  2HJ8 A;  1X1M A;  1HB8 A;  1DDW A;  3RCZ A;  3FM8 C;  5D94 A;  2MWS B;  2KGX B;  2K00 A;  4A3P A;  1V86 A;  2MSE D;  1OQY A;  4WJP A;  2WWZ A;  3DOW A;  3UGB B;  4WSF A;  3HM6 X;  3WA0 A;  4FJV B;  2K8C A;  1E8Y A;  1DIK A;  3QAR A;  4M8N A;  2N7E A;  5L95 C;  2H7D A;  4A6H A;  4NPN A;  1X11 A;  5D27 A;  3MTN B;  1U5F A;  5FR6 A;  2R82 A;  2P8V A;  2K6D B;  4WWN A;  4NQL B;  1J19 A;  2FJ9 A;  2BYV E;  4HPL B;  3PPA A;  3UIO B;  1ZGU B;  1DDV A;  2I5C A;  1WJU A;  3PRP B;  3WAM A;  2ROV A;  2N1V A;  1WR1 A;  2PEA A;  3APF A;  1TTN A;  1BTN A;  4HLE A;  2W2W A;  4MY6 A;  2KCJ A;  1V80 A;  1RAX A;  3CMM B;  2LXA A;  4MGY E;  1OEY A;  2HTH B;  2HTH A;  2IFS A;  3ECI A;  3BJI A;  4AWJ A;  3N32 A;  4GGQ A;  3B1L X;  1Y5O A;  4ILJ A;  4DWF A;  1U29 A;  4HDQ A;  3A4S C;  2GBM A;  2DHI A;  2RSU A;  4WJO A;  2BKR B;  4W9C A;  3L54 A;  4E71 A;  3H9D A;  4KVG B;  1EO6 A;  4CHJ A;  1NTI A;  5J2R A;  3B08 A;  2NBW B;  1SHC A;  2Y7B A;  1ZW7 A;  2KJH B;  4NSW A;  1YX6 B;  2DTC A;  2G4D B;  2DX5 A;  3PSE B;  2KWC A;  2EMS A;  4IM3 A;  1I7A A;  5JHH A;  4IWO A;  3G9W A;  2KDI A;  5JHG A;  2LRU A;  1J0W A;  3T9L A;  2K39 A;  2DKQ A;  4CHM A;  5DI9 B;  4GPT B;  3VDZ A;  2KNB A;  1WMH A;  4IM0 A;  2D4Q A;  1FOE A;  3ZTC A;  2OQB A;  3R7R A;  2Q13 A;  2AL3 A;  1NDD A;  5CTR C;  1OGW A;  1V5M A;  2KJ6 A;  3DXC A;  4RMA A;  1FHX A;  2KTR A;  4W9J A;  1U4A A;  4ZRI A;  2PJH A;  1WZ0 A;  1EUV B;  3R7Q A;  3WYF B;  2D07 B;  1DDM A;  1E8Z A;  1P98 A;  4MT7 A;  2FIF A;  3MDB C;  2R0D A;  1M94 A;  3KRX A;  1WGH A;  5C23 A;  3B0A A;  1WZ3 A;  5D3V A;  1UPR A;  3HQC A;  3D8F A;  2WH5 A;  3VXW A;  2O6V D;  4WWP A;  4LDT D;  4YON A;  4DX8 A;  1MK9 B;  2FNJ B;  1EF1 A;  3QCA A;  4FUL A;  4JKD A;  2JY6 A;  2V3S A;  1L2N A;  3DDC B;  2KX3 A;  4BKG A;  4KIK A;  4DHJ D;  3DVN U;  2QHO A;  1IP9 A;  2D9V A;  2LGY A;  1JRU A;  3KYD D;  1NI2 A;  2DEN B;  4FJZ A;  2YT1 A;  2ZNV C;  2W9N A;  1IYF A;  4AP4 C;  1Z87 A;  2BWE S;  4B6W A;  4RM9 A;  2GJY A;  1H10 A;  4IOY X;  1TZ1 A;  2UZR A;  1UGM A;  4FHJ A;  1YD8 U;  3QC8 B;  2X0S A;  4KHO A;  1WR6 E;  2CRF A;  2GS0 A;  4BOS C;  5D6J B;  1Y19 B;  1UNR A;  4MJS B;  2G4S A;  2K1F A;  2LKO A;  1DYN A;  3IHP C;  3A1Q B;  3ZNZ B;  3T06 A;  1I42 A;  4Z2M B;  1E90 A;  4CHK A;  2EKE C;  2H7E A;  2NPT B;  1XKE A;  2LAS A;  3IFW B;  3LDZ E;  2Z0D B;  1R4N I;  1M7E A;  2QKL A;  4WAA A;  4GZU A;  1NVL A;  4DX9 0;  2EJ8 A;  4AUQ C;  4ICU A;  2KXJ A;  1NBF C;  2CY4 A;  1V9J A;  2I5F A;  2ZVO A;  1MK7 B;  2V76 A;  2LRW A;  2DYM A;  4EKU A;  5DCN A;  1UEL A;  3PRM B;  4HJK A;  2COA A;  2Z0E B;  4DK5 A;  2P0F A;  4IWP A;  5G2N A;  4DDI D;  2ZZP B;  3QJZ A;  4EOY A;  2AWT A;  5DPS A;  3SBG A;  1E5W A;  4IW0 A;  4ZYN A;  4A3O A;  1KBL A;  4DBB A;  3VTU A;  1D3Z A;  2W2X C;  4JQW C;  1YX5 B;  3X0W A;  1HE8 A;  3RT3 B;  1FGY A;  2LXC A;  2O6V A;  2IO0 B;  2OJR A;  2KKC A;  1WJ1 A;  2KK8 A;  1UNQ A;  3T8M A;  3WAP A;  4ANW A;  4H8S A;  1WJ4 A;  2JZ3 B;  2FDQ A;  3RUI B;  3M95 A;  1FB8 A;  4DHZ E;  3N30 A;  1V88 A;  2RR9 A;  1J8C A;  3D8E A;  4HHV A;  2CU1 A;  1Q67 A;  4F7U P;  4GIV A;  1H8C A;  2M8S A;  3GOE A;  3ZLZ A;  4LCD E;  4TV3 A;  4WWO A;  4DDG D;  4PQ0 A;  3TL5 A;  2UYZ B;  4IFS A;  2L0T A;  2ROZ B;  3SUZ A;  4F1S A;  3SYX A;  4B6H A;  2RUK B;  3ULC A;  2MQJ A;  2L3Z A;  4JKG B;  4JKG A;  2MBQ A;  4HB0 B;  3W1Y A;  2QKM A;  3KH0 A;  3OJ4 B;  3A8P A;  2NVU I;  4W9K A;  4TQ0 A;  3PGE A;  4MEL A;  1K8R B;  2KC2 A;  4JGH B;  3QAQ A;  4WVF B;  5LXH A;  2MDX A;  3V5W A;  4NNJ B;  1VCB A;  1L7Y A;  2FCM A;  2I1K A;  3OAN A;  2M17 A;  3KVF B;  3ZDM C;  4Y94 A;  2GBR A;  4ZRK A;  2VRR B;  1MAI A;  2Z59 B;  1WE6 A;  3A33 B;  4MM3 A;  1WGR A;  5G55 A;  2IYB A;  1UBQ A;  4WQO B;  2K8H A;  2BCJ A;  1UEF A;  4NAW B;  2AYO B;  4ZDV A;  2ZJD A;  5HE0 A;  2M0X A;  2J0M A;  3NOB A;  3W1S A;  3NZU A;  3VVW B;  1P3Q U;  3GYO A;  1DRO A;  3P2B A;  4HAV B;  3NSU A;  4A6F A;  1FHO A;  3E9O A;  2C5L C;  3SNH A;  2W2X D;  4KAX B;  1AQC A;  4HAT B;  4JL9 A;  4KV2 A;  3Q3J A;  3JSV B;  3PV1 A;  2O2V B;  4FHK A;  4K17 A;  1P0R A;  2BWF A;  1Q1O A;  4I6L B;  5IA7 A;  2CR5 A;  4LJP B;  2D3G A;  4ILH A;  2KAN A;  5J3T A;  4HB4 B;  3A9J B;  3HW2 B;  2DYO A;  2D9X A;  1XD3 B;  4E3C A;  1X1F A;  3CIK A;  3TBL D;  4EEW A;  1YIW A;  1WIA A;  1GGO A;  1LB1 A;  3DBH I;  3VQI A;  4KSK C;  1PFJ A;  5JVL A;  2R2O A;  5C79 A;  2YLM A;  2IY0 B;  1Z2M A;  1HB6 A;  4EJN A;  2LUL A;  2LZ6 A;  3H1U A;  2GMI C;  3HK0 A;  5EDS A;  3RZW C;  4I6N B;  3ZKJ C;  2DA0 A;  3EEC A;  4I6P A;  2JT4 B;  5CHV C;  1P3R A;  3AUL A;  1NU2 A;  1OTR B;  2K25 A;  2LVP A;  5BO4 B;  1KZG A;  3VFK A;  1U27 A;  2ZCB A;  1WGQ A;  5DH9 B;  3V6C B;  5J3Y A;  5C5B B;  1E8W A;  2ADZ A;  2ELA A;  3PEG A;  2VKI A;  3ALB A;  4HB2 B;  2RPQ A;  2KMA A;  1R4M I;  2DX1 A;  1WI0 A;  4GMV A;  2KWU B;  3CXB B;  4PS3 A;  2L8J A;  1Y8R C;  1LFD A;  1W1D A;  3EC8 A;  5D3X A;  1K5G B;  2CY5 A;  4MEM A;  4K7U A;  2FCQ A;  4W9E A;  2KTF A;  4EFO A;  4KHA A;  2ZCC A;  1XD4 A;  2V1Y A;  4EZL A;  3MJW A;  4KSL C;  3ULB A;  1FAO A;  3SU8 X;  3VH3 B;  3M1I B;  1LM8 B;  3A8Q A;  2WYQ A;  3ML4 A;  2D9W A;  5GOW B;  5LOP B;  4HCP B;  3A4R A;  5EFX A;  1KOT A;  2CHW A;  3PHW B;  2GBN A;  1YQB A;  1WXS A;  2DZK A;  1WXA A;  3PVU A;  1J0G A;  3E9L A;  2MW5 A;  4AJY B;  4F7H A;  4W9G A;  4BBN F;  3EPY A;  3UQB A;  4F8C B;  2IBI B;  1WGD A;  3TW1 A;  2WX1 A;  3UIN B;  4ZRJ A;  3PRZ A;  2M14 A;  4K2P A;  1OQN A;  5JH5 C;  3SDL C;  4JIO U;  1MIX A;  2IY1 B;  3KUD B;  2YS5 A;  1AAR A;  2PZ1 A;  4B9K A;  4IM2 A;  1V49 A;  1Q5W B;  4TYZ A;  2Y5B B;  1EF5 A;  5DHF B;  3JVZ X;  5FI0 A;  2JF5 A;  1WXM A;  3AI5 A;  2K2U A;  4BOZ B;  1H4R A;  3W1S C;  2YS3 A;  2EMT A;  3U7D A;  2DIK A;  5AZH A;  3K9O B;  4FAD A;  3ZRC A;  4ANX A;  2KOX A;  3S2A A;  3DBR I;  3DQV A;  2KD0 A;  3PSC A;  3KZ1 A;  4PNK A;  2KQS A;  3QX1 A;  1MG8 A;  1KJT A;  4DXA B;  3VTV A;  1WX7 A;  5HE2 A;  3GZN I;  2LGD A;  2A4Z A;  1BT0 A;  1ST7 A;  5D7G A;  4HB3 B;  4FLH A;  3SO6 A;  3KUZ A;  4K7S A;  1RFA A;  2DHZ A;  1WG7 A;  2WX0 A;  4XZ4 A;  2LI5 A;  1WRD B;  5C1Z A;  1ZC4 B;  5HE1 A;  3WAN A;  2D11 A;  2LVO A;  2JWZ A;  3GYP A;  5LLI A;  4WJQ A;  4J6I A;  1VBG A;  1KZ7 A;  1YJ1 A;  2KO3 A;  2BPS A;  2C9W B;  4MGZ E;  3TVV A;  4CO7 A;  2LYD A;  2CHX A;  2L00 B;  3PHX B;  4KZC A;  1Q0W B;  2FID A;  3E9P A;  3F0W A;  4BKS D;  1PLS A;  1PQS A;  2KLC A;  3JYU A;  1WFY A;  4MJS A;  4E74 A;  4W9L A;  1X05 A;  1ZSQ A;  4PS7 A;  3ML8 A;  3A1Q A;  1WF9 A;  2PPH A;  1WYW B;  2XK5 B;  2DHJ A;  1V61 A;  2J59 M;  3ODX A;  2N4F A;  2KJR A;  3ZNH B;  1WM2 A;  3FP5 A;  2NPT A;  4G3X B;  3VAW A;  1B55 A;  3KYC D;  1EGX A;  1A5R A;  1MPH A;  2ASQ A;  1SGH A;  4EZJ A;  2VSZ A;  1WJN A;  2Y8F A;  3ZVV A;  3SHQ A;  2CAY A;  4JKA A;  2KDE B;  2MP2 B;  1QZE A;  2MP2 A;  3MHS D;  2RGN B;  5E6N A;  3SD5 A;  2L1C A;  2N9P C;  1GUA B;  1LW3 A;  3U30 A;  2LG1 A;  2K6Q A;  4W9I A;  1K5D B;  2CHZ A;  1V5U A;  2MBE A;  3DXD A;  5LON B;  1I35 A;  2DFK A;  4KDL B;  4TKN A;  3FLV A;  4GMX B;  2V4L A;  3H7P B;  3VIA A;  4N9F 4;  3Q3F A;  4K7W A;  3RD2 A;  2KVR A;  3UIP B;  2N9E B;  2DHK A;  5C6R A;  1V6E A;  4GDK B;  4M0W B;  5KQ4 A;  4JK8 A;  4GDL B;  4GDL A;  2RD0 A;  4EUT A;  2NMB A;  3I3T B;  4JKF A;  2KMC A;  3HHM A;  3ZUN A;  2J0J A;  4HDO A;  2MA9 B;  4NY0 A;  3O96 A;  1BAK A;  2ZPN A;  4OVV A;  5AEK B;  3JW0 X;  2FAZ A;  4IC7 B;  1XQQ A;  2DN6 A;  1P9D U;  2LVQ A;  3QA8 A;  5IAA C;  2N0Y A;  2RQ1 A;  4TQ1 A;  2YT0 A;  4KHB B;  1GNU A;  1V5O A;  4BKS A;  2BGF A;  5D2M B;  3LJU X;  2AL6 A;  2YF0 A;  3QWM A;  4IAP A;  2KDF B;  2XQN M;  2MX2 A;  1E7U A;  5IJM A;  1FHW A;  2IO3 B;  3P7Z A;  1XCG A;  1XOD A;  4C0A A;  1UBI A;  3PVW A;  3V6E B;  5KQ1 A;  1WXV A;  2HD5 B;  5HKH A;  3KW5 B;  1LQB A;  1GC6 A;  2M38 A;  4K2O A;  3DVG X;  5GMV A;  2NCN A;  3O65 B;  1C1Y B;  4TUU A;  4L6E A;  3ZIM A;  2ABD A;  2IO1 B;  2B3A A;  3ENB A;  2GBK A;  1G6J A;  4HAY B;  4XC2 A;  1BTK A;  4NAW A;  2KZR A;  3KUC B;  4PYU A;  3QBV B;  2RVB B;  3AU5 A;  4HPM B;  1WX9 A;  4HCN B;  4EZK A;  1GC7 A;  3DBL I;  4G11 A;  4F7G A;  2KWV B;  5JHA A;  3N3K B;  2D9Z A;  3JSV A;  2O2V A;  5D3W A;  4BVU C;  2NR2 A;  3L08 A;  2G45 B;  3R66 C;  2A5U A;  3WIM A;  3E66 A;  2PE6 B;  5L81 A;  1UD7 A;  1AWE A;  4HWI B;  2DZJ A;  1SIF A;  3L17 A;  4HVB A;  3ZW3 A;  4OVU A;  4JLC A;  4PYZ A;  2IO2 B;  1MKE A;  2P0H A;  3F5R A;  1UH6 A;  3A9J A;  2CS4 A;  1WI1 A;  3LJ3 A;  3VTW A;  3VUY A;  4IG7 B;  3AU4 A;  1V5T A;  4X57 B;  1KI1 B;  2COC A;  2RNR B;  1VD2 A;  5TR5 A;  2MFQ A;  4DHZ B;  3VUX A;  3VUW A;  2G35 A;  2KN5 A;  2YVC A;  2GBJ A;  2I1J A;  5CHW A;  1LXD A;  2D10 A;  2DZI A;  3A9K B;  2BYE A;  4MK0 A;  3A9K A;  2UVM A;  3L0W B;  4II2 B;  3IVF A;  2Z0P A;  1WE7 A;  2OOB B;  3ONS A;  3KSY A;  1I2H A;  3QIJ A;  2DYN A;  1NTY A;  1W1H A;  2N23 A;  4ILG B;  1V5P A;  2DYQ A;  3FSS A;  5C5B A;  2MBO A;  1MIZ B;  2L76 A;  4IUM B;  5D3Y A;  1V2Y A;  1P1A A;  2EC1 A;  1U5E A;  1WVH A;  2OTX A;  2K2J A;  3M3J A;  2L7R A;  3DVN V;  5E6P A;  3QK0 A;  3QQ8 B;  3PRE A;  2NZ8 B;  2XBB C;  1BWN A;  1XR0 B;  3QHT A;  5FI1 A;  2LWP A;  1UZX B;  1UPQ A;  4ANU A;  4FJY A;  4ANV A;  4GU2 A;  3DCG A;  5DPR A;  3PZD A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...