4TKNA

Structure of the snx17 ferm domain bound to the second npxf motif of krit1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
256
Chain Sequence
PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
total genus 77
structure length 256
sequence length 276
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4tknA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tknA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4tknA01
4NAWA 1SIFA 3IFWB 2DZMA 3N3KB 1DYNA 2FAZA 3DDCB 1TQZA 3AU4A 2ROVA 2DYOA 3RULA 3K9PB 3H7PA 5LOPB 4HLEA 2G45B 4NJ7A 2QKLA 1CMXB 2BYEA 1SHCA 2LXAA 4II2B 2L7RA 3NS8A 5D7GA 5L81A 2LUEA 2N9XA 3KW5B 4K7WA 2J0KA 2W2WA 1S3SG 5JLJB 3ODOA 2WDTB 3PVUA 3P6AA 3D8EA 1MKEA 2OJRA 2XEWA 3TL5A 4HJKA 4GZUA 2L8JA 2BYFA 2C5LC 4XX5A 5HKHA 2N4FA 4WJ7A 1WR1A 4F7GA 1I35A 4ANUA 4NJ6A 1X11A 3PS6A 3RCZA 4FN2A 1GC7A 2K8HA 2R2QA 2ZNVB 1BAKA 3L08A 2DFKA 2W2XD 3SUZA 2WYQA 4PS8A 3IHPC 2LGXA 1FHOA 4HAWB 4G3XB 2K39A 4DHZE 2KQSA 1RFAA 4MY6A 2BGFA 1E7VA 4EZLA 1R4MI 1RLFA 1EF5A 2GBMA 1WGHA 5E6NA 2LZ6A 3L17A 4KSKC 3AXCA 3KUDB 2L2IA 1XD4A 3TFMA 3ZDTA 2N7EA 1NU2A 2YVCA 2DENB 4TYZA 4DHZB 3DCGA 3EECA 1WM3A 2LVOA 3M62B 2K25A 4ICUA 2GBJA 1YQBA 3Q3FA 1TBEA 5J3QA 3EC8A 4EFOA 3NOBA 2IY1B 2AWTA 2DKQA 2DZJA 2NPTB 1NBFC 3L13A 1RRBA 3OLMD 5DI9B 1M7EA 3UIPB 2BF8B 4WJNA 3VAWA 3ZVVA 3W1SC 1WFYA 2Y7BA 1YX6B 1V5UA 2L05A 2A5UA 3HK0A 4JL9A 1YD8U 2JUOA 3VFKA 3BY4B 3UQAA 5EFXA 4LJOB 3DBHI 5JHAA 4BVUC 2RLOA 1WX7A 4TUUA 3KRWA 3V61A 3A8PA 2BKFA 1ZM0A 2K6QA 2N23A 3X23A 2FCQA 4HAZB 4JLCA 2A4ZA 4KAXB 5J3YA 2ASQA 2LRUA 4AP4C 2MBBB 2DLWA 4XZ4A 3SHQA 1YIWA 2KTRA 4W9FA 2C9WB 1WGDA 4MDKE 4CHKA 4KV2A 3TIXA 5CLQB 1FOEA 1M7RA 1E8WA 1TJ6A 5KQ4A 4IFSA 1OQYA 2L0FA 3VQIA 3O65B 2CU1A 2I5CA 3VH4B 1NTYA 1MK7B 2JWZA 2V1YA 4D0NB 4Y94A 4OVVA 3X0WA 4GDLB 2RR9A 1BWNA 1UGMA 5KCVA 1XKEA 2M38A 3PP2A 4PYUA 2AYOB 5DPSA 4X57B 1FGZA 2YS5A 4WVFB 2DA0A 2PEAA 3L0WB 3KUCB 1TTNA 4RM8A 1ZC3B 2L3ZA 1QC6A 3D32A 2WX0A 1EVHA 4CHJA 3L10B 1V88A 2ZNVC 3M63B 5L95C 3ZTDA 2P0FA 3A1QA 3KRXA 2RSGA 2KANA 3RYTA 3KVFB 2D2QA 2YS1A 2V4LA 2LI5A 1V5PA 1IYFA 3ULCA 3FSSA 2KJ6A 1WMHA 2N9PC 2W9NA 2PE9A 2HJ8A 2LGDA 4NNJB 2NVUI 4IWPA 4DHJD 1VD2A 3PHXB 2COFA 1XR0B 3CXBB 5JHGA 2YLMA 4G50A 3QJZA 1J0WA 2K8BA 3ZLZA 2KFKB 4HDQA 1XX0A 2IYDB 3ULBA 2CHWA 5EDSA 2Z0PA 1B55A 1I7AA 2BWES 3SDLC 3W1SA 2LASA 2M8SA 1WGYA 2KMCA 1W1HA 2MSED 1WXAA 4W9IA 1RJ2A 4GDKB 2JF5A 5E6PA 5BO4B 2VSZA 1P3RA 1UEFA 4DXAB 1U5FA 5JZEB 2BKRB 3CF6E 2DX5B 1S1QB 4FBJB 2OTXA 4K1RB 4B9KA 2L0TA 1V89A 2DZKA 1A5RA 4WAAA 5C79A 3W1YA 1J19A 4FJYA 2K2UA 3RD2A 2FCNA 4NPNA 5J2RA 2Q13A 1K8RB 3U8ZA 1LFDA 2DYMA 2JPHA 1C3TA 2D07B 1PQSA 2KDEB 3A9KB 1ZVRA 1WGRA 2IY0B 2V3SA 4AJWA 4NSWA 2KXJA 1MIZB 2MCNB 3HQCA 2MKRA 3A9JB 3QQ8B 5CX3A 1UNPA 3R7RA 4DK5A 3GOEA 1NDDA 3BJIA 2P8VA 4NQKE 5AZHA 2EMSA 1P0RA 2ZJDA 2UZSA 1U4AA 1Q5WB 1TZ1A 3QHTA 3HM6X 4BBNC 2AL3A 2MWSB 3TJPA 4HPLB 4MELA 2NR2A 2Z0EB 2I1KA 2FIDA 1OMWA 4J6IA 1GC6A 3ML4A 3R66C 1AARA 3VTVA 4IM0A 4BFRA 4M8NA 4URKA 5LLIA 4CHMA 1WXMA 1FHWA 2VRWB 1SGHA 3VHTC 4HCPB 3T8MA 3TCAA 3DVNU 4A6FA 2FNJB 2O2VA 2KMAA 4OVUA 3PTFC 4NQLB 2RNRB 3DVGX 4WQOB 3ZVRA 1RRPB 4W9HA 5C5BB 2ZCBA 3M3JA 3DXEA 1FHXA 1GUAB 2L1CA 1V49A 3HHMA 2LKOA 2KNBA 4IOYX 3ZO5B 2HD5B 4WJOA 4F7HA 4KZ0A 3SD5A 1DBHA 5CHWA 4MH0E 3TBLD 1E8YA 3U30A 1KLVA 1XODA 2XBBC 2KKCA 3A33B 4ZRJA 2YSZA 3ZNHB 3KY9A 5DPRA 1N3HA 2DX1A 1M94A 5D6JB 4F7ZA 2Z59B 4HCNB 3ZKJC 3QARA 4EJNA 2PJHA 4DX90 4HATB 1KI1B 4CYEA 4KIKA 4WWOA 1P98A 2VRRB 2YS3A 4IW0A 3H1UA 4DX8A 3DBLI 2K00A 4B6HA 1WM2A 3OANA 1I42A 1PFJA 3JVZX 1EF1A 1UELA 4EUTA 1WR6E 2LJ5A 3TMPB 1U5GA 4FJVB 1P6SA 1AWEA 1TGZB 4W9EA 2KQ7A 5G55A 2JRHA 1Z87A 2FCMA 5J18A 4NAWB 3WA0A 1YJ1A 2COCA 3V62A 2M17A 3AULA 2JZ3B 4HXDA 1V9JA 2NPTA 2LVPA 3EHVA 4G11A 3RCPA 1MK9B 3H7PB 5J3TA 1U2BA 1C1YB 2Y5BB 4K81A 4F8CB 3S2AA 3PSCA 4HAXB 3QK0A 2PPHA 2MX2A 4WWPA 2CAYA 5AZFA 1ISNA 5DIFB 1WE6A 1Z2MA 4WJPA 1W1DA 1UZXB 2MA9B 3UF8A 4JGHB 2IO0B 1Z5SB 2IO2B 5L83A 2KJHB 4ZRIA 3TO1A 1WGGA 2J7QB 3UQBA 2O6VD 3SU8X 2MP2B 3PZDA 3DVNV 2DKPA 1VCBA 4K7UA 3ALBA 5KQ1A 1QZEA 2QKMA 2KC2A 1V2YA 5CHFA 2BCJA 2QHOA 1WJ6A 4DDGD 3UIOB 2UVMA 2C7MB 2DHKA 1XT9B 4KHOA 2DHZA 2BYVE 2GCLA 2KO3A 4PS3A 1EO6A 5IAAC 4B95A 3TVVA 4HB2B 2Y8GA 1FGYA 5JHBA 2C7HA 2KWVB 2PZ1A 2MFQA 4N9F4 2N1WA 3NZUA 1P1AA 5C1ZA 2KN5A 2MBHA 4GDLA 1WI1A 3MDBC 2LD9A 2DTCA 1OGWA 2MLBA 1WGUA 2HTHB 3QIJA 1IPGA 2G3QB 1P9DU 5KHQA 2DYBA 2NBWB 4HAYB 1WJNA 2DAFA 4PS7A 2MWNB 4MM3A 4IWOA 1GNUA 4GU2A 3PV1A 4ZRKA 4FJZA 4GIVA 1F9JA 2L76A 3JSVA 1DDMA 3MHSD 3NSUA 4TQ0A 5JH5C 1Y8RC 4WJQA 1MIXA 3RT3B 1WX8A 1WZ0A 3KYCD 3V60A 4LDTB 2KWUB 2N7DA 3H6NA 2GCJA 4MGYE 2KZRA 1E5WA 4GMVA 1X05A 2JXXA 4MJSB 1HE8A 3PRZA 3K9OB 1OY2A 4FULA 2CR5A 4BOZB 1IP9A 4BKSD 2KHWB 5LONB 1E8XA 1UBIA 1UNQA 5JHHA 3V5WA 4HB4B 4IM2A 2DZIA 2NBVB 3UINB 3B1LX 2M14A 4M0WB 1X86A 2L00B 2RUKB 3AI5A 5G2NA 1RAXA 1FXTB 4ANVA 3VH3B 1MPHA 3OAWA 4DWFA 5GMVA 3NHEB 2D9XA 4KZCA 2MQJA 4MGIE 3OJ4B 1MAIA 4PYZA 3CSTA 3ZRFA 1SE9A 2RVBB 2G35A 4FHJA 1GJZA 3HIZA 3T9LA 2CRFA 2GBRA 3A98B 3BINA 4XC2A 3KSYA 4IM3A 1UBQA 2C60A 1WJ4A 3I3TB 3QC8B 2C7NB 2ZPYA 2MBEA 1XD3B 3KZ1A 1BTNA 2KGXB 2UWQA 4HAUB 1OEYJ 3DVGY 1WG7A 1D3ZA 4BKTA 2D3GA 3SNHA 1PMSA 3ZW3A 1W1GA 4BBNF 1AQCA 2D4QA 4AJYB 4A6KA 2ZZPB 1I2HA 3V6EB 4L6EA 1V86A 5DPWA 2ZEQA 4I6NB 2LOZA 3WAOA 1P3QU 1ZKHA 4W9LA 3Q3JA 4EEWA 3MTNB 3ZNZB 1XQQA 3M1IB 4BOSC 3D8FA 3UZTA 2R2OA 3PREA 2DYQA 1Q67A 5HE2A 3ML9A 1WMHB 4M8MA 4Z2MB 5D3WA 3PGEA 2M4NA 2CKHB 4HHVA 2MBQA 3HM3A 3GYOA 4ZYNA 2FUHB 1K5GB 4K2PA 4HB0B 2O6VA 1LM8B 4MEMA 5D3XA 1ZGUB 2G4SA 2KDBA 2LXCA 4EKUA 5AEKB 4MK0A 3NZSA 4K7SA 2HE7A 4I6LB 2D9VA 4JIOU 4MGZE 3QX1A 2J0JA 2RD0A 2N0YA 2LWPA 4GB9A 1UH6A 1Y19B 3H9DA 4ANWA 5C16A 3SV1A 2KX3A 5FR6A 4E71A 3WANA 2IBIB 3DXDA 3T06A 3DOWA 2MDXA 2H7EA 2YRYA 1WI0A 2N1VA 2WWZA 1LXDA 2LG1A 5D27A 2REXA 5JP4A 1LQBA 4EOYA 3ZUNA 2N9EB 1H4RA 3V6CB 1E8ZA 2D9ZA 3PLUA 4C0AA 3PHWB 2DHIA 2YF0A 2BPSA 5LXIB 4EZJA 2YT1A 3A4RA 1U27A 2XK5B 4I6PA 1H10A 1WJ1A 2JT4B 4A5KA 5C23A 1X1MA 3PT2B 5AZGA 4W9DA 3U7DA 5C6RA 1X1FA 4BBKA 3PPAA 5CTRC 3KUZA 2M0XA 3PRPB 2GJYA 2KCJA 2EKEC 5FI1A 4A20A 3PRMB 3N30A 4B6WA 3GZNI 3ENEA 1X1GA 2IFSA 1Q0WB 2CY4A 2CHZA 2KFJA 2D9YA 4GMXB 4PNKA 2LYDA 3VUXA 1P5TA 4HVBA 1J8CA 1U5DA 4EMOA 2GBNA 1V5MA 1U5EA 3PSEB 3A4SC 4BKGA 4FA6A 4GPTB 2KDFB 4GOCA 2CS4A 1FB8A 2KWCA 5CLLB 2RGFA 4BKSA 4E3CA 2NMBA 5HE1A 2KD0A 3B08A 4A6FB 3QWZB 2O2VB 1UPRA 3N7CA 2IZVB 3G9WA 2B3AA 1T0YA 2AEHA 2KTFA 2MP2A 3APFA 3LJUX 4W9CA 5LXHA 3JW0X 3DBRI 4FHKA 2GMIC 5J17A 4HK2A 2LVQA 3QA8A 3WALA 4W9JA 2M1MA 1WIAA 4HPMB 3R3MA 1NI2A 2I5FA 4H8SA 4YL8A 3QWMA 2RGNB 3NY5A 2Z0DB 3PLVA 3AJ4A 3WIMA 2LULA 2IYBA 4KIKB 4DBBA 3DQVA 1WY8A 2ZVOA 3LJ3A 1L2NA 2DHJA 1JRUA 1WH3A 5IA7A 2ELAA 2JVCA 3ONSA 2KLGA 1LB1A 2HTHA 2J0MA 2BWFA 4K17A 4MSMB 5D94A 4IWQA 2P0HA 2LRWA 1G6JA 4KHBB 2KDIA 5DPTA 1OEYA 1WXVA 4RM9A 2KJRA 4AWJA 3UGBB 5DH9B 5D2MB 3O96A 2W2XC 5D3YA 4A6HA 2KC1A 1ZC4B 2YT0A 5D3VA 2IO3B 1TXDA 1K5DB 2KOXA 2CHXA 2JY6A 3VIAA 2EMTA 1XCGA 4ASWC 1V6EA 5TR5A 4E74A 2G4DB 2J59M 3IVFA 1MG8A 3ML8A 4KDIC 4MJSA 2OQBA 4DHJB 4ANXA 1J0GA 4W9KA 4WSFA 2COAA 1KM7A 3VTUA 2XQNM 1R4NI 3ZTCA 4GN1A 1WJMA 1V5OA 3N32A 1WGQA 2FJLA 2OOBB 4MGKE 4HWIB 1WVHA 2ELBA 4IC7B 2CY5A 2CODA 4A3OA 4II3B 3C0RB 2NBUA 1WZ3A 3OJ3A 4K2OA 2LGYA 3ODWA 4NY0A 1WXSA 3QAQA 5E6OA 1UD7A 1EAZA 3ZIMA 1WE7A 1KZGA 1U29A 1FAOA 2LOXA 4TQ1A 3VTWA 3WAPA 5FI0A 2JRIB 4RMAA 4TV3A 1UNRA 2K6DB 2KFKA 4KHAA 3RZWC 3LDZE 1QQGA 3P2BA 2MRPA 1DDWA 3KH0A 1H8CA 3F5RA 2JP2A 4LJPB 1GG3A 3B0AA 4IUMB 4IG7B 1DDVA 5DCNA 1PLSA 4GDKA 2FCSA 3CIKA 2KTRB 1EUVB 2UZRA 4P7IA 2RPQA 3MPXA 3JSVB 4JQWC 2WX1A 1Y5OA 2DX5A 3SYXA 2P0DA 4CO7A 4DDID 3QBVB 4ZDVA 2I1JA 5CHVC 2IO1B 2KVRA 1WYWB 1E7UA 3QCAA 3F0WA 3ZNID 3GYPA 2NZ8B 1OTRB 3VVWB 3P7ZA 1WX9A 4TKNA 4DBGA 3WAMA 3WYFB 3A9KA 2KLCA 3HW2B 1YX5B 3IBEA 3VXWA 4HDOA 1ZW7A 4YONA 3A9JA 1WF9A 1V80A 1WJUA 2H7DA 3PVLA 2GBKA 3DPDA 2K2JA 2PE6B 2Z0QA 4FADA 3ECIA 3DBSA 3JYUA 4F7UP 3A1QB 3RUIB 2D11A 3ODXA 3L16A 2MBOA 4AUQC 2UYZB 4ICVA 1L7YA 1NTVA 3A8QA 2KUPA 2ZPNA 2K1FA 1BT0A 2RSUA 4AOFA 4LDTD 4HB3B 2GOWA 2ZVNA 4MT7A 3EFUA 4W9GA 2EC1A 3DXCA 2D9WA 2ZCCA 4PQ0A 3ZRCA 2ROZB 3VDZA 3FM8C 1WRDB 2XK5A 1V5TA 2MW5A 2GS0A 2ADZA 5HE0A 3ZNGC 3APCA 3APDA 5C5BA 3D8DA 2R09A 2K8CA 1KZ7A 3R7QA 3PG7A 1V81A 4GGQA 1BTKA 4A3PA 3PVWA 4KVGB 2X18A 3MJWA 5DHFB 5HE3A 4G0NB 1EGXA 3M95A 2VKIA 4IAPA 2E2XA 3AU5A 2Z0OA 2DYNA 3VUWA 1DROA 4XWXA 1ZSQA 2D10A 2JZZA 3TW1A 2V76A 1Q1OA 2KK8A 5DHAB 2FIFA 3VUYA 1LW3A 1OQNA 3SO6A 3ZDMC 4MSQB 1V61A 1IRSA 4GSWA 3CMMB 2Y8FA 3PEGA 3FEHA 1E90A 2EJ8A 3H7SA 1UPQA 2DAJA 3CSFA 4KDLB 1KOTA 3KYDD 3RZFA 1KJTA 3VOQA 2NCNA 4F1SA 3IG3A 3L54A 5GOWB 2AL6A 4WWNA 2KX0A 4LCDE 2DN6A 2NS5A 4KSLC 4EZKA 2R0DA 4HAVB 4FLHA 2O6VB 4GXBA 5KHOA 4Z2NA
chains in the Genus database with same CATH superfamily
4NAWA 1SIFA 2GB1A 3FLVA 3AE1B 3BVZA 3IFWB 2I2YA 4GNKB 2DZMA 1NI3A 3N3KB 3AE5B 1DYNA 3NZ3A 2FAZA 3DDCB 3NVVA 1TQZA 2Q5WD 2X8XX 3AU4A 2ROVA 3B9JA 2DYOA 3RULA 2ZW1A 2EELA 3H7PA 3K9PB 4JKAA 1RFKA 2E3TA 1DGJA 5LOPB 4HLEA 3DBLB 4C56C 2WXKA 2G45B 4NJ7A 2QKLA 1CMXB 2BYEA 1SHCA 2LXAA 4II2B 1WWTA 4DXFA 2L7RA 3NS8A 2HRJA 5D7GA 5L81A 3N9YC 2LUEA 2K9XA 5HFYA 2N9XA 1K51A 3KW5B 4K7WA 2J0KA 2W2WA 4L23A 1S3SG 5JLJB 3OWEB 3ODOA 2WDTB 3KWVA 3PVUA 3P6AA 2YEPF 3D8EA 2CQUA 3ZXRA 1MKEA 3AEGB 3HIEA 2OJRA 2XEWA 3TL5A 4RF0A 4KGTA 4HJKA 2WXOA 4GZUA 1ZOYB 2L8JA 4LTUA 2BYFA 2C5LC 3ZQ4A 3BYYB 4XX5A 4JK9A 5HKHA 2N4FA 4WJ7A 1WR1A 4F7GA 1I35A 4ANUA 4NJ6A 3MJ5A 3P4RB 1X11A 3PS6A 1MVKA 1ENFA 2IGHA 1A70A 2WXQA 3O13A 4JWSC 3RCZA 2B76B 4FN2A 1GC7A 2PIAA 3NVYA 1SE4A 3W9CB 2K8HA 2R2QA 5BMHA 5HHDG 2ZNVB 1BAKA 2INDC 4S17A 1FPYA 3L08A 2DFKA 1N60A 2W2XD 3SUZA 1D5MC 4JKCA 2WYQA 3IHPC 2LGXA 4PS8A 4YWGG 1C4CA 1FHOA 3E56A 4HAWB 1IBXA 4G3XB 5IO9A 1FCCC 4JE3B 2K39A 4DHZE 3AMZA 2KQSA 1RFAA 4MY6A 4ITKA 3Q6BA 2BGFA 1E7VA 4EZLA 1R4MI 2IGDA 1B9RA 1RLFA 4NZLB 1EF5A 3AE3B 2GBMA 4US8A 1WGHA 5E6NA 2LZ6A 3L17A 4KSKC 3AXCA 3KUDB 4HPPA 1WXQA 1EWCA 2AQ1B 2L2IA 1XD4A 1T3QA 3TFMA 3ZDTA 3I63C 2N7EA 1NU2A 2W55A 2YVCA 2G1EA 2DENB 3URYA 4TYZA 2M0AA 2DBYA 4DHZB 3DCGA 3EECA 1WM3A 2LVOA 1TS5A 3M62B 2K25A 4ICUA 2GBJA 1YQBA 4RF1A 1SF0A 3Q3FA 1TBEA 5J3QA 5HG2A 3EC8A 4EFOA 3NOBA 2IY1B 4YSXB 2QILA 1HTQA 3V3XA 2AWTA 2DKQA 2DZJA 3A58A 2NPTB 3FILB 1NBFC 3L13A 3DBHB 4IKGA 2FJ9A 1RRBA 3OLMD 5DI9B 1M7EA 3UIPB 2BF8B 4WJNA 3VAWA 3ZVVA 3W1SC 1XCTL 4XGAB 3SFDB 1WFYA 2Y7BA 2JYEA 1YX6B 4OZCA 1V5UA 3EFCA 2L05A 1RWSA 2A5UA 3HK0A 3AE8B 4JL9A 3TSSA 1YD8U 2KIGA 2JUOA 3VFKA 3BY4B 1JWAD 3UQAA 5FK9C 2PLPA 5EFXA 4LJOB 3DBHI 3BWUD 3IAS1 5JHAA 4BVUC 3AE6B 2RLOA 1VRAB 1WX7A 4TUUA 3KRWA 3AEEB 5IKCM 3V61A 1D5ZC 3A8PA 3E9OA 2BKFA 2K8EA 2KIEA 1ZM0A 5BMIA 2K6QA 5BYSA 1UF0A 2XNAC 2NBVA 2N23A 3X23A 1KRHA 2FCQA 4HAZB 1SEBD 1EU4A 5BYRA 4JLCA 3ENBA 2A4ZA 5LG4B 4KAXB 5J3YA 1PGAA 3LYYA 2ASQA 1UWMA 3Q8CA 2QJLA 1F52A 2LRUA 1EWYC 4AP4C 1JWBD 2MBBB 2DLWA 4XZ4A 3PZ8A 1SE2A 3HRDD 3SHQA 1YIWA 2KTRA 4W9FA 4JKGB 2C9WB 1CQVA 1WGDA 1TS2A 2MJEA 4N58A 4MDKE 4CHKA 4KV2A 4QAYA 3TIXA 5CLQB 2WXNA 2OJWA 1FOEA 3AEFB 1M7RA 1E8WA 2WXGA 3RNAC 1TJ6A 5KQ4A 3DWMA 3VR9B 4IFSA 1OQYA 2L0FA 3VQIA 1F0ZA 5I4DA 1ROEA 3O65B 2CU1A 3ZYYX 1QF6A 1QILA 1I4PA 1YN5A 2I5CA 3VH4B 2LGIA 1NTYA 2BT6A 1TYGB 1MK7B 2JWZA 2V1YA 4D0NB 4Y94A 4OVVA 3X0WA 4GDLB 2RR9A 1BWNA 1UGMA 5KCVA 1AWDA 1XKEA 1NTIA 2M38A 5JVLA 3EUB2 3PP2A 4PYUA 2AYOB 5DPSA 4ZRPA 4X57B 1FGZA 2YS5A 4WVFB 2DA0A 2PEAA 4M02A 3L0WB 3KUCB 1IGCA 1TY0A 1TTNA 4RM8A 1ZC3B 2L3ZA 2JX5A 1QC6A 4WQMA 3D32A 2WX0A 1EVHA 5HI1A 3NG0A 4CHJA 3L10B 3GP7A 1V88A 2ZNVC 3M63B 5L95C 3ZTDA 2P0FA 1UNSA 3A1QA 3KRXA 4QXAB 2WXLA 3IT4B 4J3OD 2RSGA 2KANA 3RYTA 3KVFB 2D2QA 2YS1A 2MJDA 2V4LA 2FJUB 2LI5A 1V5PA 1MHHE 1IYFA 4ZHPA 3ULCA 3FSSA 2KJ6A 1WMHA 2N9PC 3BK1A 2W9NA 2PE9A 2HJ8A 3ZGZA 2LGDA 4YTPB 4XE0A 4NNJB 2NVUI 1YOVB 2UU7A 1V97A 4IWPA 4M01A 2GLSA 4DHJD 1VD2A 3PHXB 2COFA 4ARIA 1XR0B 2INNE 1FIQA 3W2DA 2IPKD 3HVDA 4YT0B 3CXBB 5JHGA 1KBLA 2YLMA 4G50A 3QJZA 1J0WA 2K8BA 3ZLZA 2KFKB 4C00A 2WHIA 4HDQA 3P63A 2RQ1A 1XX0A 3E9LA 1JWUD 2IYDB 1V8CA 3ULBA 2CHWA 4IDIA 2Z0PA 5EDSA 1NYRA 3ZJUA 1KLGD 1B55A 1I7AA 1MHXA 2BWES 3SDLC 3W1SA 2LASA 1NVID 2M8SA 3NVZA 1WGYA 2KMCA 2L83A 1W1HA 3Q3NC 2MSED 3E9PA 2TSSA 1WXAA 2RDGA 4W9IA 3PZ7A 1RJ2A 4LNOA 4GDKB 2JF5A 5E6PA 5BO4B 3MC9A 2VSZA 1P3RA 1UEFA 4DXAB 4US9A 1U5FA 4P1CC 5JZEB 2BKRB 3CF6E 2DX5B 3SBGA 5TSSA 1S1QB 4FBJB 1PUTA 2OTXA 4K1RB 1MPEA 4B9KA 2L0TA 1V89A 2DZKA 2WXPA 3SEBA 4N6EB 1A5RA 4WAAA 3UI3A 5C79A 1E10A 3W1YA 1J19A 4FJYA 2K2UA 3RD2A 2FCNA 4LNNA 4NPNA 5J2RA 2E6XA 2Q13A 1K8RB 3U8ZA 1LFDA 1SBBB 4XDDA 2DYMA 1FEHA 2JPHA 1MJDA 1C3TA 2D07B 1PQSA 2KDEB 1T6BX 2JXTA 3A9KB 1ZVRA 1WGRA 2IY0B 5I2SA 4LK0M 2DWQA 2V3SA 4AJWA 4NSWA 2KXJA 3C8YA 1MIZB 2MCNB 4DQOC 3HQCA 2MKRA 3A9JB 3QQ8B 1FXIA 1HZ5A 4RCOA 1P7EA 5CX3A 1UNPA 2BS4B 3R7RA 1N6ZA 4DK5A 3GOEA 1E9MA 1NDDA 3BJIA 2P8VA 4NQKE 5AZHA 5H8YE 2EMSA 1P0RA 2ZJDA 2UZSA 4WURA 1U4AA 4YXDB 1I7HA 3KLSX 1Q5WB 1JW9D 1TZ1A 3QHTA 4KGRA 2FDQA 1NYQA 3HM6X 4BBNC 2KQ4X 2AL3A 2MWSB 3TJPA 4HPLB 4MELA 4L2YA 2NR2A 1CK1A 2Z0EB 4OVZA 2I1KA 2FIDA 2R82A 1YN4A 3P4SB 1OMWA 4J6IA 1GC6A 3ML4A 3R66C 3RMKC 1AARA 4M00A 1WYGA 1ZXIA 3VTVA 4IM0A 4BFRA 4M8NA 4URKA 5LLIA 4CHMA 1WXMA 3FAHA 1JWMD 4LNKA 1FHWA 2VRWB 1SGHA 2HTME 3VHTC 4JWUC 4NAMA 4HCPB 3T8MA 2BQQA 3TCAA 3DVNU 3Q8BA 4A6FA 2FNJB 2O2VA 2PKOA 1L4DB 2KMAA 1ACCA 3GZNB 3IT6B 4OVUA 1QQRA 3PTFC 1GGOA 4NQLB 2KWDA 2RNRB 2GUMA 3DVGX 3Q69A 2R61A 4WQOB 3ZVRA 1RRPB 1V1OA 4W9HA 5C5BB 2ZCBA 3M3JA 3DXEA 2M19A 1FHXA 1GUAB 2L1CA 1V49A 2LHDA 1UGJA 1YJIA 3HHMA 3BZDB 2LKOA 2KACA 2KNBA 4C7YA 3ZJVA 2COPA 4IOYX 3ZO5B 2HD5B 4WJOA 4F7HA 4KZ0A 1CJEA 3RFZB 3SD5A 1DBHA 5CHWA 4MH0E 3TBLD 1E8YA 3U30A 1KLVA 1XODA 2XBBC 3LXFA 2KKCA 2WXIA 3A33B 3SFEB 3KWLA 4ZRJA 2JU6X 2YSZA 3ZNHB 3KY9A 2J4XA 4KKJA 5IN7A 5DPRA 4A6QA 1N3HA 2DX1A 1M94A 5D6JB 4F7ZA 2Z59B 4HCNB 3ZKJC 1XXGA 3QARA 4EJNA 2PJHA 4DX90 1ZYIA 4HATB 2X38A 1KI1B 4CYEA 4KIKA 2WXHA 4WWOA 1P98A 2VRRB 2OHFA 4LNFA 2QSDA 2YS3A 4IW0A 3H1UA 3T3OA 2RDHA 1TS3A 3DBRB 4DX8A 1FO4A 1EU3A 3DBLI 3I5JC 2K00A 4B6HA 1WM2A 2VH1A 3OANA 1FRDA 1I42A 1PFJA 3JVZX 1EF1A 1UELA 4EUTA 1WR6E 2LJ5A 3TMPB 1C77A 1U5GA 4FJVB 3BK2A 2W54A 1P6SA 1QLBB 1AWEA 1F77A 1TGZB 4W9EA 2KQ7A 4MH8A 5G55A 2JRHA 1Z87A 2FCMA 3BVGA 3DHIC 5J18A 3SBTA 2LEKA 4NAWB 3WA0A 1YJ1A 2COCA 4KHBA 3V62A 2M17A 3AULA 3RNBC 2JZ3B 4HXDA 5MPOA 1V9JA 2NPTA 2LVPA 1JALA 5EE0A 4WAFA 3EHVA 4G11A 3FVCA 5GXGB 3RCPA 2R2YA 1MK9B 3H7PB 5AUIA 2PW9A 1K50A 5J3TA 1U2BA 1C1YB 2Y5BB 4K81A 4F8CB 1XCQL 2ZKMX 3S2AA 3PSCA 4HAXB 3QK0A 2PPHA 1TY2A 2MX2A 4WWPA 1ZE3D 4JKBA 2CAYA 4LNIA 2FUG1 5AZFA 1TZOA 2BVCA 3BIID 1ISNA 5DIFB 1WE6A 2LBBA 3R8BA 3J9CA 1Z2MA 4WJPA 1W1DA 1UZXB 2MA9B 2EKIA 3UF8A 4JGHB 2RRFA 2IO0B 1T0QC 1Z5SB 2IO2B 2V4IB 1AYFA 5L83A 2KJHB 4ZRIA 1HTOA 3TO1A 1AN8A 1WGGA 2N7JA 2J7QB 3UQBA 1T77A 1DIKA 4YSYB 2O6VD 3SU8X 2MP2B 3CWIA 2L32A 3PZDA 2KT7A 3DVNV 2DKPA 1V1PB 3RNCC 1VCBA 4K7UA 3AE2B 3ALBA 5KQ1A 2ZW0A 3NS1A 1QZEA 2QKMA 3FKYA 2KC2A 1V2YA 5CHFA 3B2GA 2BCJA 2QHOA 1WJ6A 4DDGD 3RN9C 3V05A 1C9FA 3UIOB 2UVMA 2H88B 3AE9B 2C7MB 2DHKA 4JK7A 3ZXVA 2PMVA 3I57A 1SSNA 4ARCA 1XT9B 4JKGA 4KHOA 3N1XC 1IBXB 1WRIA 2DHZA 2K5PA 2BYVE 4HROA 2GCLA 1FD6A 2KO3A 1FNUA 4PS3A 1EO6A 5IAAC 4B95A 2NTTA 3GE3C 3TVVA 4HB2B 2Y8GA 1FGYA 5JHBA 2C7HA 3E9SA 1JDEA 2KWVB 2LHEA 2PZ1A 2H89B 3Q8AA 2DNFA 2MFQA 4N9F4 2N1WA 2K22A 1XLOA 3NZUA 2G9HD 2WXMA 2WXJA 1B1ZA 1P1AA 1CZPA 5C1ZA 3IAM1 4CQNA 2KN5A 1GAQB 2LGSA 2MBHA 5H92C 4GDLA 1WI1A 3MDBC 4A55A 2LD9A 2DTCA 1ZUD2 1MI0A 1OGWA 2MLBA 1WGUA 2HTHB 3QIJA 1IPGA 1SB3C 2G3QB 3MC0B 1FFUA 1P9DU 5KHQA 2DYBA 2NBWB 4HAYB 1WJNA 2DAFA 4PS7A 2MWNB 4MM3A 1PYWD 4IWOA 1GNUA 4GU2A 1RM6C 3PV1A 4ZRKA 4FJZA 1K52A 4GIVA 1F9JA 2L76A 3JSVA 1DDMA 3MHSD 4PT5A 2J53A 2D5GA 1K53A 3NSUA 4TQ0A 5JH5C 1Y8RC 4WJQA 1MIXA 3RT3B 5EE1A 1WX8A 1KFYB 3NWDA 1WZ0A 4HEA1 3KYCD 3V60A 4LDTB 5IJMA 2KWUB 3Q8FA 2N7DA 5G5HA 2BBCA 3H6NA 2GCJA 4MGYE 2KZRA 5D3IB 1E5WA 4GMVA 5T8IA 4HKQA 5IOIA 1X05A 2JXXA 4MJSB 1HE8A 3PRZA 3K9OB 1OY2A 4FULA 1ESFA 5JXVA 2CR5A 4BOZB 1IP9A 1TJEA 4BKSD 2KHWB 1L5PA 5LONB 1E8XA 1SJHD 1UBIA 1UNQA 1ZDVA 5JHHA 4HKZE 3V5WA 1VZ8A 3TEWA 4HB4B 1XLQA 4IM2A 4QJ5B 4RFBA 2DZIA 2NBVB 3UINB 1HA5A 3B1LX 2M14A 1E6EB 2QMTA 3GB1A 4M0WB 1X86A 2L00B 1UUPA 2RUKB 1SJED 3AI5A 5G2NA 2HJ1A 1RAXA 1FXTB 4ANVA 2NTSA 3VH3B 4XYCA 4AS1A 3AE4B 4LLGM 1MPHA 2LJIA 2AQ2B 3OAWA 4DWFA 5GMVA 3RI7C 3NHEB 4B0MA 2D9XA 5FR3A 4KZCA 1MI1A 1QKZA 1N62A 2ABDA 4JKEA 2MQJA 1I4QA 4MGIE 2V3PA 3OJ4B 2ICIA 1MAIA 4PYZA 3CSTA 3ZRFA 1SE9A 2RVBB 2G35A 4FHJA 2IJ0A 3H8HA 2VZKD 1GJZA 3HIZA 3T9LA 1KLUD 2CRFA 2JQRB 2GBRA 5FKAC 3TEYA 1N61A 3BINA 3A98B 3C19A 4XC2A 1PGXA 3KSYA 4IM3A 1UBQA 2C60A 1T0RC 1WJ4A 3I3TB 4EE2A 3QC8B 2BYTA 2AX5A 1JRPA 2C7NB 4JK8A 1QT9A 2ZPYA 2MBEA 3Q14C 4JX1C 1XD3B 3KZ1A 1NENB 1BTNA 2KGXB 2UWQA 4HAUB 1OEYJ 2BTEA 3DVGY 1WG7A 3TUOA 4RGTA 1D3ZA 4BKTA 2D3GA 3SNHA 4K3BA 1PMSA 3ZW3A 1W1GA 4BBNF 2W3SA 1AQCA 1HXYD 2D4QA 4KX6B 4YSZB 3MP9A 4KKIA 4AJYB 4A6KA 2W82A 2ZZPB 1I2HA 3V6EB 1WGKA 4L6EA 3NJTA 1V86A 1ZXHA 5DPWA 2ZEQA 1P7FA 4I6NB 2LOZA 3WAOA 1P3QU 1ZKHA 4C4VB 4L1RA 1PDXA 4W9LA 3Q3JA 4EEWA 3MTNB 1OQQA 3ZNZB 1L6VA 1OFFA 1XQQA 3M1IB 3LB8C 4BOSC 3D8FA 3UZTA 2R2OA 3PREA 2DYQA 2N0SB 1Q67A 5HE2A 3ML9A 1WMHB 4M8MA 4Z2MB 5D3WA 2YEPB 3PGEA 4ZHOA 2M4NA 2CKHB 4HHVA 2MBQA 3HM3A 3GYOA 4ZYNA 2KAJA 1KH0A 2FUHB 1K5GB 4K2PA 1J7CA 4HB0B 2O6VA 1LM8B 1DOXA 3VRBB 4MEMA 5D3XA 4RGMA 1ZGUB 2G4SA 4TMAB 3AEBB 2RMMA 1BXTA 2KDBA 2LXCA 4EKUA 2X0SA 5AEKB 4MK0A 3NZSA 3GE8C 4K7SA 2M56B 4WH4A 2HE7A 2W3RA 4I6LB 2SEBD 2D9VA 4JIOU 2WS3B 4MGZE 2JZPA 3QX1A 4DXGA 2J0JA 2WLBA 2RD0A 2N0YA 2LWPA 4GB9A 4DIXA 4RGNA 1UH6A 2CJNA 1XF5L 1Y19B 3AECB 3H9DA 3B2FA 5C16A 3NVWA 3OHMB 4ANWA 3DWGC 3SV1A 1PGBA 2KX3A 1VLBA 5FR6A 1D6EC 1FNVA 3RPFC 4E71A 3WANA 2IBIB 3DXDA 3T06A 3DOWA 2MDXA 2H7EA 1QOGA 2YRYA 1WI0A 2N1VA 1ET6A 2WWZA 1LXDA 1KTKA 2LG1A 5D27A 2REXA 1GB4A 5JP4A 1LQBA 4S0RA 4EOYA 1HBKA 3ZUNA 4P1BC 3ETRA 4TSSA 2Z59A 3NW8A 2N9EB 1H4RA 3V6CB 1E8ZA 1QOFA 2D9ZA 2L52A 3PLUA 4C0AA 3PHWB 2DHIA 1JCKB 1XO3A 3W5UB 2YF0A 4R3DA 2LFIA 2BPSA 5LXIB 4EZJA 2YT1A 3A4RA 3AV8A 1U27A 2XK5B 3SR6A 3HUIA 4I6PA 2AQ3B 1H10A 1WJ1A 1EM7A 2JT4B 4A5KA 5C23A 2D3AA 1X1MA 3W5VB 2JSVX 2WU5B 2KR0A 3PT2B 5AZGA 4W9DA 3U7DA 2V9HA 5C6RA 1X1FA 2V3NA 3MC8A 5C2TB 4BBKA 3PPAA 5CTRC 3KUZA 3IXSA 2M0XA 4HSIA 3PRPB 2GJYA 2KCJA 2EKEC 5FI1A 4A20A 3PRMB 3N30A 4B6WA 3GZNI 3ENEA 3P1MA 1X1GA 3I9V1 2IFSA 1J7BA 1Q0WB 3U7ZA 2Z4DA 2CY4A 2CHZA 1J7AA 2KFJA 2D9YA 1ST7A 4GMXB 4PNKA 2LYDA 3VUXA 1P5TA 4HVBA 3CIRB 1J8CA 1U5DA 4EMOA 2GBNA 1V5MA 4JKHA 1U5EA 3PSEB 3A4SC 1T5XD 4BKGA 1HZ6A 4FA6A 4GPTB 1LGRA 2KDFB 5EE9A 1VBHA 4GOCA 2CS4A 4XWWA 1FB8A 2KWCA 1TKGA 5CLLB 3AN1A 2RGFA 3VRAB 4BKSA 4E3CA 2NMBA 5HE1A 2KD0A 3B08A 1VZ7A 4A6FB 3QWZB 2O2VB 1UPRA 2K3UA 1SE3A 4AQ7A 1ET9A 3N7CA 2ACZB 3U12A 2IZVB 3G9WA 1I4XA 2B3AA 1T0YA 2MEKA 1XLPA 2AEHA 1R4MB 1TIFA 2INCC 2MP2A 2KTFA 1TT5B 1YMHE 3APFA 5IP4D 1V1PA 4WWMA 3LJUX 1L4ZB 3AE7B 1JROA 4W9CA 3FP5A 5LXHA 3FILA 3JW0X 1GB1A 1I4HA 3DBRI 4FHKA 3MFGA 2GRIA 2GMIC 3B77A 5M4YB 5J17A 4HK2A 2LVQA 3QA8A 3WALA 4W9JA 2M1MA 2QC8A 1WIAA 4HPMB 3R3MA 1NI2A 2I5FA 2KN4A 2Z14A 4YL8A 4H8SA 1KF6B 3QWMA 2MHJA 5C3JB 3N1ZC 3TEZA 2MJ3A 3ZJTA 2KUQA 2PVOD 2KMMA 2RGNB 3NY5A 1FFVA 2Z0DB 2WNMA 1MFWA 1FM0D 3PLVA 3AJ4A 4N59A 3WIMA 2LULA 2IYBA 4KIKB 1L6UA 4MACA 4DBBA 2HDEA 1ZP0B 2PTLA 3DQVA 2WXFA 1WY8A 2ZVOA 3LJ3A 1JQ4A 1L2NA 3DHHC 4P16A 2DHJA 1JRUA 2I38A 1WH3A 1LO5D 4OT1A 5IA7A 3EA6A 1NVLA 2ELAA 5D3DA 1VR9A 4YTMB 2JVCA 3ONSA 4BZAA 2KLGA 2BB6A 1KC7A 1LB1A 2QCZA 2HTHA 2J0MA 4ILHA 2BWFA 3PO0A 4K17A 2FBWB 3FC4A 2V0GA 2CJOA 3GS2A 1DOIA 1JWSD 4MSMB 5D94A 2WDQB 4IWQA 1F2RI 4MT5A 2P0HA 2LRWA 1G6JA 4KHBB 2KDIA 5DPTA 1OEYA 1WXVA 4RM9A 1QOBA 2KJRA 4AWJA 3UGBB 4H2AA 5DH9B 3E66A 1TS4A 5D2MB 3O96A 1FXAA 2W2XC 3RNFC 1TKEA 5D3YA 1F1HA 1R4NB 4A6HA 4JKDA 4ZOHC 2KC1A 3R2TA 1ZC4B 2WQYB 2YT0A 5D3VA 2IO3B 1YN3A 2SAKA 1TXDA 1K5DB 2KOXA 2CHXA 1E0ZA 2JY6A 3MHZA 3VIAA 2EMTA 4GOUA 1XCGA 4ASWC 1V6EA 5TR5A 4Q2JA 4E74A 4ZRQA 2G4DB 4ILJA 2J59M 3IVFA 2VZKB 1MG8A 1HEZE 1N5WA 2KYWA 4GLSC 4JPSA 3ML8A 1FNWA 3RNGC 4KDIC 3NUHB 4MJSA 2OQBA 4XDCA 4DHJB 4OHJA 4ANXA 1XEEA 1J0GA 4QJ4B 3BVMA 4W9KA 4WSFA 2COAA 1KM7A 3AEAB 2WH5A 2VH2A 3VTUA 3AB5A 2XQNM 2CU3A 5IRSA 1R4NI 3ZTCA 4GN1A 1WJMA 1V5OA 2BW2A 3N32A 1WGQA 2FJLA 1HB8A 2OOBB 4MGKE 4HWIB 4QJ3B 2Z13A 1WVHA 2ELBA 4IC7B 4L1BA 2CY5A 1VDVA 2CODA 4A3OA 4M0WA 5LNK1 4II3B 4FXCA 3C0RB 2NBUA 1NEKB 3U2SC 3VR8B 1WZ3A 1DYQA 2ONQA 5G5GA 1GOZA 1UWXA 3T3NA 3OJ3A 4K2OA 1QOAA 3AEDB 2RDBC 2WDRB 2LGYA 2FE8A 3ODWA 1MG4A 3Q3OC 4NY0A 1WXSA 4RNAA 1GPXA 2WXRA 3QAQA 1FCLA 5E6OA 2N9LA 4B0EA 3L4PA 1UD7A 1EAZA 3ZIMA 3AH7A 1WE7A 1KZGA 1U29A 1FAOA 3Q2AC 1E7PB 2JWUA 3TEXA 2LOXA 4TQ1A 2INPE 3VTWA 2LUMA 3WAPA 5FI0A 1M4VA 5I2MA 1FMAD 2JRIB 4RMAA 4TV3A 1HQRD 1UNRA 2KVZA 1YQ3B 1AW7A 1VBGA 2K6DB 1XLNA 2KFKA 3EGRA 4KHAA 1YQ4B 3RZWC 3LDZE 2Y5CA 1QQGA 2NMQA 3P2BA 1L0VB 2MRPA 3Q8EA 1DDWA 3KH0A 1C4AA 1H8CA 3NWFA 3BYTB 3F5RA 2JP2A 4LJPB 1GG3A 3B0AA 1D5XC 1SXTA 4IUMB 1OQRA 4IG7B 1I4GA 3KQ4A 1DDVA 2PVGC 5DCNA 1PLSA 4GDKA 2FCSA 3CIKA 2KTRB 1EUVB 2UZRA 1C78A 4MM3B 4P7IA 2RPQA 3MPXA 1L0YB 3JSVB 4JQWC 1N5XA 1IUEA 2WX1A 1Y5OA 2DX5A 2K49A 2P0DA 3SYXA 4C4VA 4CO7A 4DDID 3QBVB 1HB6A 1PFDA 3U4EG 4ZDVA 2I1JA 5E6JA 3EPYA 1BUIC 5EE3A 4A8XC 1VZ6A 4ILGB 2IDYA 5CHVC 2IO1B 1C79A 2KVRA 1L0XB 2RPVA 2D3CA 1WYWB 1E7UA 3QCAA 3F0WA 3ZNID 3GYPA 1DOYA 2NZ8B 1OTRB 3VVWB 3P7ZA 1IGDA 1I4RA 2Z8LA 1WX9A 3HVZA 3P4PB 4TKNA 4RGOS 4DBGA 3WAMA 3WYFB 3A9KA 2KLCA 3HW2B 4D2KA 1F2RC 2BS3B 1YX5B 3IBEA 1Q10A 2N9KA 3VXWA 3RNEC 4HDOA 1ZW7A 4YONA 2YT2A 1ZPSA 3A9JA 2LMCA 2J52A 4O1NA 1WF9A 1V80A 1WJUA 2H7DA 4YTNB 4D6WA 3PVLA 2DIKA 2GBKA 3DPDA 2K2JA 2PE6B 2Z0QA 4FADA 2K0PA 3ECIA 2QDFA 1T0SC 3DBSA 3JYUA 4KGSA 4ZYSA 4F7UP 3A1QB 4XWTA 3RUIB 1SIJA 2D11A 3ODXA 1JMLA 3L16A 2MBOA 4BAXA 4AUQC 2UYZB 4ICVA 2L1AA 3DCXA 1L7YA 5BYQA 1NTVA 3A8QA 2KUPA 2ZPNA 1YNTE 2K1FA 1BT0A 2QIEB 2RSUA 4AOFA 4LDTD 5AUKA 4HB3B 4C7ZA 2GOWA 4USAA 2IGGA 2ZVNA 3ABVB 4OSNA 4PK1A 4MT7A 3EFUA 4HRSA 4W9GA 4C80A 2EC1A 5BMGA 3P42A 3DXCA 1C4PA 2J42A 4OW0A 2D9WA 2ZCCA 4PQ0A 2ON8A 2DLBA 4JKFA 3ZRCA 2ROZB 1VJKA 1ZDXA 3VDZA 4OZBA 3FM8C 4REZA 1C76A 1WSPA 1WRDB 2XK5A 1V5TA 2MW5A 3U52E 4NJCA 2GS0A 2ADZA 2CB8A 5HE0A 3ZNGC 3APCA 1R7SA 3APDA 5C5BA 4A90A 3DHGC 4HJGE 4WIPA 2BB5A 2D3BA 3D8DA 2R09A 2K8CA 1KZ7A 3R7QA 3PG7A 1V81A 4GGQA 2MH7A 1YJJA 1BTKA 3AM9A 4A3PA 3PVWA 4ACFA 3NRZA 4KVGB 2X18A 3MJWA 5DHFB 1FRRA 2BS2B 5HE3A 4G0NB 2WDVB 1EGXA 3M95A 2VKIA 4IAPA 2OEDA 3R2IA 2E2XA 2WU2B 3NWAA 2KDMA 3AU5A 2JYTA 2Z0OA 2DYNA 3VUWA 1DROA 2QEJC 4XWXA 2D10A 1ZSQA 2JZZA 3TW1A 2V76A 1Q1OA 2GI9A 2KK8A 3P4QB 5DHAB 4P6VF 2FIFA 4CSQA 3VUYA 1LW3A 1OQNA 3SO6A 3ZDMC 4MSQB 2Y3AA 1V61A 1D4BA 1IRSA 2XN9C 4GSWA 3CMMB 2Y8FA 3PEGA 3FEHA 3OG5A 1E90A 1BMLC 2EJ8A 1N63A 3H7SA 1RYJA 1UPQA 2DAJA 2WP9B 3CSFA 4KDLB 1KOTA 3KYDD 3RZFA 4OZAA 1KJTA 3VOQA 2NCNA 4A9AA 4F1SA 3IG3A 3L54A 5GOWB 4UDUC 2AL6A 1ACAA 1STEA 3N20C 4WWNA 2KX0A 4LCDE 2DN6A 2NS5A 4KSLC 2WGSA 4IOIE 1TKYA 1Y56A 4K3CA 4EZKA 3HSAA 2R0DA 4HAVB 4RH6A 3Q3MC 4FLHA 2O6VB 4GXBA 2Y5PA 5KHOA 3N1YC 4Z2NA 3WCQA
chains in the Genus database with same CATH topology
4NAWA 1SIFA 3FLVA 3IFWB 2DZMA 3N3KB 1DYNA 2FAZA 3DDCB 1TQZA 3AU4A 2ROVA 2DYOA 3RULA 3K9PB 3H7PA 4JKAA 5LOPB 4HLEA 2G45B 4NJ7A 2QKLA 1CMXB 2BYEA 1SHCA 2LXAA 4II2B 2L7RA 3NS8A 2HRJA 5D7GA 5L81A 2LUEA 2N9XA 3KW5B 4K7WA 2J0KA 2W2WA 1S3SG 5JLJB 3ODOA 2WDTB 3PVUA 3P6AA 3D8EA 2CQUA 1MKEA 2OJRA 2XEWA 3TL5A 4HJKA 4GZUA 2L8JA 2BYFA 2C5LC 4XX5A 4JK9A 5HKHA 2N4FA 4WJ7A 1WR1A 4F7GA 1I35A 4ANUA 4NJ6A 1X11A 3PS6A 3RCZA 4FN2A 1GC7A 2K8HA 2R2QA 2ZNVB 1BAKA 3L08A 2DFKA 2W2XD 3SUZA 2WYQA 4JKCA 3IHPC 4PS8A 2LGXA 1FHOA 4HAWB 4G3XB 2K39A 4DHZE 2KQSA 1RFAA 4MY6A 2BGFA 1E7VA 4EZLA 1R4MI 1RLFA 1EF5A 2GBMA 1WGHA 5E6NA 2LZ6A 3L17A 4KSKC 3AXCA 3KUDB 2L2IA 1XD4A 3TFMA 3ZDTA 2N7EA 1NU2A 2YVCA 2DENB 4TYZA 4DHZB 3DCGA 3EECA 1WM3A 2LVOA 3M62B 2K25A 4ICUA 2GBJA 1YQBA 3Q3FA 1TBEA 5J3QA 3EC8A 4EFOA 3NOBA 2IY1B 2AWTA 2DKQA 2DZJA 2NPTB 1NBFC 3L13A 2FJ9A 1RRBA 3OLMD 5DI9B 1M7EA 3UIPB 2BF8B 4WJNA 3VAWA 3ZVVA 3W1SC 1WFYA 2Y7BA 1YX6B 1V5UA 2L05A 2A5UA 3HK0A 4JL9A 1YD8U 2JUOA 3VFKA 3BY4B 3UQAA 5EFXA 4LJOB 3DBHI 5JHAA 4BVUC 2RLOA 1WX7A 4TUUA 3KRWA 3V61A 3A8PA 3E9OA 2BKFA 1ZM0A 2K6QA 2N23A 3X23A 2FCQA 4HAZB 4JLCA 3ENBA 2A4ZA 4KAXB 5J3YA 2ASQA 2LRUA 4AP4C 2MBBB 2DLWA 4XZ4A 3SHQA 1YIWA 2KTRA 4W9FA 4JKGB 2C9WB 1WGDA 4MDKE 4CHKA 4KV2A 3TIXA 5CLQB 1FOEA 1M7RA 1E8WA 1TJ6A 5KQ4A 4IFSA 1OQYA 2L0FA 3VQIA 3O65B 2CU1A 2I5CA 3VH4B 1NTYA 1MK7B 2JWZA 2V1YA 4D0NB 4Y94A 4OVVA 3X0WA 4GDLB 2RR9A 1BWNA 1UGMA 5KCVA 1XKEA 1NTIA 2M38A 5JVLA 3PP2A 4PYUA 2AYOB 5DPSA 4X57B 1FGZA 2YS5A 4WVFB 2DA0A 2PEAA 3L0WB 3KUCB 1TTNA 4RM8A 1ZC3B 2L3ZA 1QC6A 3D32A 2WX0A 1EVHA 4CHJA 3L10B 1V88A 2ZNVC 3M63B 5L95C 3ZTDA 2P0FA 3A1QA 3KRXA 2RSGA 2KANA 3RYTA 3KVFB 2D2QA 2YS1A 2V4LA 2LI5A 1V5PA 1IYFA 3ULCA 3FSSA 2KJ6A 1WMHA 2N9PC 2W9NA 2PE9A 2HJ8A 2LGDA 4NNJB 2NVUI 4IWPA 4DHJD 1VD2A 3PHXB 2COFA 1XR0B 3CXBB 5JHGA 1KBLA 2YLMA 4G50A 3QJZA 1J0WA 2K8BA 3ZLZA 2KFKB 4HDQA 2RQ1A 1XX0A 3E9LA 2IYDB 3ULBA 2CHWA 5EDSA 2Z0PA 1B55A 1I7AA 2BWES 3SDLC 3W1SA 2LASA 2M8SA 1WGYA 2KMCA 1W1HA 2MSED 3E9PA 1WXAA 4W9IA 1RJ2A 4GDKB 2JF5A 5E6PA 5BO4B 2VSZA 1P3RA 1UEFA 4DXAB 1U5FA 5JZEB 2BKRB 3CF6E 2DX5B 3SBGA 1S1QB 4FBJB 2OTXA 4K1RB 4B9KA 2L0TA 1V89A 2DZKA 1A5RA 4WAAA 5C79A 3W1YA 1J19A 4FJYA 2K2UA 3RD2A 2FCNA 4NPNA 5J2RA 2Q13A 1K8RB 3U8ZA 1LFDA 2DYMA 2JPHA 1C3TA 2D07B 1PQSA 2KDEB 3A9KB 1ZVRA 1WGRA 2IY0B 2V3SA 4AJWA 4NSWA 2KXJA 1MIZB 2MCNB 3HQCA 2MKRA 3A9JB 3QQ8B 5CX3A 1UNPA 3R7RA 4DK5A 3GOEA 1NDDA 3BJIA 2P8VA 4NQKE 5AZHA 2EMSA 1P0RA 2ZJDA 2UZSA 1U4AA 1Q5WB 1TZ1A 3QHTA 2FDQA 3HM6X 4BBNC 2AL3A 2MWSB 3TJPA 4HPLB 4MELA 2NR2A 2Z0EB 2I1KA 2FIDA 2R82A 1OMWA 4J6IA 1GC6A 3ML4A 3R66C 1AARA 3VTVA 4IM0A 4BFRA 4M8NA 4URKA 5LLIA 4CHMA 1WXMA 1FHWA 2VRWB 1SGHA 3VHTC 4HCPB 3T8MA 3TCAA 3DVNU 4A6FA 2FNJB 2O2VA 2KMAA 4OVUA 3PTFC 1GGOA 4NQLB 2RNRB 3DVGX 4WQOB 3ZVRA 1RRPB 4W9HA 5C5BB 2ZCBA 3M3JA 3DXEA 1FHXA 1GUAB 2L1CA 1V49A 3HHMA 2LKOA 2KNBA 2COPA 4IOYX 3ZO5B 2HD5B 4WJOA 4F7HA 4KZ0A 3SD5A 1DBHA 5CHWA 4MH0E 3TBLD 1E8YA 3U30A 1KLVA 1XODA 2XBBC 2KKCA 3A33B 4ZRJA 2YSZA 3ZNHB 3KY9A 5DPRA 1N3HA 2DX1A 1M94A 5D6JB 4F7ZA 2Z59B 4HCNB 3ZKJC 3QARA 4EJNA 2PJHA 4DX90 4HATB 1KI1B 4CYEA 4KIKA 4WWOA 1P98A 2VRRB 2YS3A 4IW0A 3H1UA 4DX8A 3DBLI 2K00A 4B6HA 1WM2A 3OANA 1I42A 1PFJA 3JVZX 1EF1A 1UELA 4EUTA 1WR6E 2LJ5A 3TMPB 1U5GA 4FJVB 1P6SA 1AWEA 1TGZB 4W9EA 2KQ7A 5G55A 2JRHA 1Z87A 2FCMA 5J18A 3SBTA 4NAWB 3WA0A 1YJ1A 2COCA 3V62A 2M17A 3AULA 2JZ3B 4HXDA 1V9JA 2NPTA 2LVPA 3EHVA 4G11A 3RCPA 1MK9B 3H7PB 5J3TA 1U2BA 1C1YB 2Y5BB 4K81A 4F8CB 3S2AA 3PSCA 4HAXB 3QK0A 2PPHA 2MX2A 4WWPA 4JKBA 2CAYA 5AZFA 1ISNA 5DIFB 1WE6A 2LBBA 1Z2MA 4WJPA 1W1DA 1UZXB 2MA9B 3UF8A 4JGHB 2IO0B 1Z5SB 2IO2B 5L83A 2KJHB 4ZRIA 3TO1A 1WGGA 2J7QB 3UQBA 1DIKA 2O6VD 3SU8X 2MP2B 3PZDA 3DVNV 2DKPA 1VCBA 4K7UA 3ALBA 5KQ1A 1QZEA 2QKMA 2KC2A 1V2YA 5CHFA 2BCJA 2QHOA 1WJ6A 4DDGD 3UIOB 2UVMA 2C7MB 2DHKA 4JK7A 1XT9B 4JKGA 4KHOA 2DHZA 2BYVE 2GCLA 2KO3A 4PS3A 1EO6A 5IAAC 4B95A 3TVVA 4HB2B 2Y8GA 1FGYA 5JHBA 2C7HA 1JDEA 2KWVB 2PZ1A 2MFQA 4N9F4 2N1WA 3NZUA 1P1AA 5C1ZA 2KN5A 2MBHA 4GDLA 1WI1A 3MDBC 2LD9A 2DTCA 1OGWA 2MLBA 1WGUA 2HTHB 3QIJA 1IPGA 2G3QB 1P9DU 5KHQA 2DYBA 2NBWB 4HAYB 1WJNA 2DAFA 4PS7A 2MWNB 4MM3A 4IWOA 1GNUA 4GU2A 3PV1A 4ZRKA 4FJZA 4GIVA 1F9JA 2L76A 3JSVA 1DDMA 3MHSD 3NSUA 4TQ0A 5JH5C 1Y8RC 4WJQA 1MIXA 3RT3B 1WX8A 1WZ0A 3KYCD 3V60A 4LDTB 5IJMA 2KWUB 2N7DA 3H6NA 2GCJA 4MGYE 2KZRA 1E5WA 4GMVA 1X05A 2JXXA 4MJSB 1HE8A 3PRZA 3K9OB 1OY2A 4FULA 2CR5A 4BOZB 1IP9A 4BKSD 2KHWB 5LONB 1E8XA 1UBIA 1UNQA 5JHHA 3V5WA 4HB4B 4IM2A 2DZIA 2NBVB 3UINB 3B1LX 2M14A 4M0WB 1X86A 2L00B 2RUKB 3AI5A 5G2NA 1RAXA 1FXTB 4ANVA 3VH3B 1MPHA 3OAWA 4DWFA 5GMVA 3NHEB 2D9XA 4KZCA 2ABDA 4JKEA 2MQJA 4MGIE 3OJ4B 1MAIA 4PYZA 3CSTA 3ZRFA 1SE9A 2RVBB 2G35A 4FHJA 1GJZA 3HIZA 3T9LA 2CRFA 2GBRA 3BINA 3A98B 4XC2A 3KSYA 4IM3A 1UBQA 2C60A 1WJ4A 3I3TB 3QC8B 2C7NB 4JK8A 2ZPYA 2MBEA 1XD3B 3KZ1A 1BTNA 2KGXB 2UWQA 4HAUB 1OEYJ 3DVGY 1WG7A 1D3ZA 4BKTA 2D3GA 3SNHA 1PMSA 3ZW3A 1W1GA 4BBNF 1AQCA 2D4QA 4AJYB 4A6KA 2ZZPB 1I2HA 3V6EB 4L6EA 1V86A 5DPWA 2ZEQA 4I6NB 2LOZA 3WAOA 1P3QU 1ZKHA 4W9LA 3Q3JA 4EEWA 3MTNB 3ZNZB 1XQQA 3M1IB 4BOSC 3D8FA 3UZTA 2R2OA 3PREA 2DYQA 1Q67A 5HE2A 3ML9A 1WMHB 4M8MA 4Z2MB 5D3WA 3PGEA 2M4NA 2CKHB 4HHVA 2MBQA 3HM3A 3GYOA 4ZYNA 2FUHB 1K5GB 4K2PA 4HB0B 2O6VA 1LM8B 4MEMA 5D3XA 1ZGUB 2G4SA 2KDBA 2LXCA 4EKUA 2X0SA 5AEKB 4MK0A 3NZSA 4K7SA 2HE7A 4I6LB 2D9VA 4JIOU 4MGZE 3QX1A 2J0JA 2RD0A 2N0YA 2LWPA 4GB9A 1UH6A 1Y19B 3H9DA 4ANWA 5C16A 3SV1A 2KX3A 5FR6A 4E71A 3WANA 2IBIB 3DXDA 3T06A 3DOWA 2MDXA 2H7EA 2YRYA 1WI0A 2N1VA 2WWZA 1LXDA 2LG1A 5D27A 2REXA 5JP4A 1LQBA 4EOYA 1HBKA 3ZUNA 2N9EB 1H4RA 3V6CB 1E8ZA 2D9ZA 3PLUA 4C0AA 3PHWB 2DHIA 2YF0A 2BPSA 5LXIB 4EZJA 2YT1A 3A4RA 1U27A 2XK5B 4I6PA 1H10A 1WJ1A 2JT4B 4A5KA 5C23A 1X1MA 3PT2B 5AZGA 4W9DA 3U7DA 5C6RA 1X1FA 4BBKA 3PPAA 5CTRC 3KUZA 2M0XA 3PRPB 2GJYA 2KCJA 2EKEC 5FI1A 4A20A 3PRMB 3N30A 4B6WA 3GZNI 3ENEA 1X1GA 2IFSA 1Q0WB 2CY4A 2CHZA 2KFJA 2D9YA 1ST7A 4GMXB 4PNKA 2LYDA 3VUXA 1P5TA 4HVBA 1J8CA 1U5DA 4EMOA 2GBNA 1V5MA 4JKHA 1U5EA 3PSEB 3A4SC 4BKGA 4FA6A 4GPTB 2KDFB 1VBHA 4GOCA 2CS4A 1FB8A 2KWCA 5CLLB 2RGFA 4BKSA 4E3CA 2NMBA 5HE1A 2KD0A 3B08A 4A6FB 3QWZB 2O2VB 1UPRA 3N7CA 2IZVB 3G9WA 2B3AA 1T0YA 2AEHA 2KTFA 2MP2A 3APFA 3LJUX 4W9CA 3FP5A 5LXHA 3JW0X 3DBRI 4FHKA 2GMIC 5J17A 4HK2A 2LVQA 3QA8A 3WALA 4W9JA 2M1MA 1WIAA 4HPMB 3R3MA 1NI2A 2I5FA 4YL8A 4H8SA 3QWMA 2RGNB 3NY5A 2Z0DB 3PLVA 3AJ4A 3WIMA 2LULA 2IYBA 4KIKB 4DBBA 3DQVA 1WY8A 2ZVOA 3LJ3A 1L2NA 2DHJA 1JRUA 1WH3A 5IA7A 1NVLA 2ELAA 2JVCA 3ONSA 2KLGA 1KC7A 1LB1A 2HTHA 2J0MA 4ILHA 2BWFA 4K17A 4MSMB 5D94A 4IWQA 2P0HA 2LRWA 1G6JA 4KHBB 2KDIA 5DPTA 1OEYA 1WXVA 4RM9A 2KJRA 4AWJA 3UGBB 5DH9B 3E66A 5D2MB 3O96A 2W2XC 5D3YA 4A6HA 4JKDA 2KC1A 1ZC4B 2YT0A 5D3VA 2IO3B 1TXDA 1K5DB 2KOXA 2CHXA 2JY6A 3VIAA 2EMTA 1XCGA 4ASWC 1V6EA 5TR5A 4E74A 2G4DB 4ILJA 2J59M 3IVFA 1MG8A 3ML8A 4KDIC 4MJSA 2OQBA 4DHJB 4ANXA 1J0GA 4W9KA 4WSFA 2COAA 1KM7A 2WH5A 3VTUA 2XQNM 1R4NI 3ZTCA 4GN1A 1WJMA 1V5OA 3N32A 1WGQA 2FJLA 1HB8A 2OOBB 4MGKE 4HWIB 1WVHA 2ELBA 4IC7B 2CY5A 2CODA 4A3OA 4II3B 3C0RB 2NBUA 1WZ3A 3OJ3A 4K2OA 2LGYA 3ODWA 4NY0A 1WXSA 3QAQA 5E6OA 1UD7A 1EAZA 3ZIMA 1WE7A 1KZGA 1U29A 1FAOA 2LOXA 4TQ1A 3VTWA 3WAPA 5FI0A 2JRIB 4RMAA 4TV3A 1UNRA 1VBGA 2K6DB 2KFKA 4KHAA 3RZWC 3LDZE 1QQGA 3P2BA 2MRPA 1DDWA 3KH0A 1H8CA 3F5RA 2JP2A 4LJPB 1GG3A 3B0AA 4IUMB 4IG7B 1DDVA 5DCNA 1PLSA 4GDKA 2FCSA 3CIKA 2KTRB 1EUVB 2UZRA 4P7IA 2RPQA 3MPXA 3JSVB 4JQWC 2WX1A 1Y5OA 2DX5A 3SYXA 2P0DA 4CO7A 4DDID 3QBVB 1HB6A 4ZDVA 2I1JA 3EPYA 4ILGB 5CHVC 2IO1B 2KVRA 1WYWB 1E7UA 3QCAA 3F0WA 3ZNID 3GYPA 2NZ8B 1OTRB 3VVWB 3P7ZA 1WX9A 4TKNA 4DBGA 3WAMA 3WYFB 3A9KA 2KLCA 3HW2B 1YX5B 3IBEA 3VXWA 4HDOA 1ZW7A 4YONA 3A9JA 1WF9A 1V80A 1WJUA 2H7DA 3PVLA 2DIKA 2GBKA 3DPDA 2K2JA 2PE6B 2Z0QA 4FADA 3ECIA 3DBSA 3JYUA 4F7UP 3A1QB 3RUIB 2D11A 3ODXA 3L16A 2MBOA 4AUQC 2UYZB 4ICVA 1L7YA 1NTVA 3A8QA 2KUPA 2ZPNA 2K1FA 1BT0A 2RSUA 4AOFA 4LDTD 4HB3B 2GOWA 2ZVNA 4MT7A 3EFUA 4W9GA 2EC1A 3DXCA 2D9WA 2ZCCA 4PQ0A 4JKFA 3ZRCA 2ROZB 3VDZA 3FM8C 1WRDB 2XK5A 1V5TA 2MW5A 2GS0A 2ADZA 2CB8A 5HE0A 3ZNGC 3APCA 3APDA 5C5BA 3D8DA 2R09A 2K8CA 1KZ7A 3R7QA 3PG7A 1V81A 4GGQA 1BTKA 4A3PA 3PVWA 4KVGB 2X18A 3MJWA 5DHFB 5HE3A 4G0NB 1EGXA 3M95A 2VKIA 4IAPA 2E2XA 3AU5A 2Z0OA 2DYNA 3VUWA 1DROA 4XWXA 2D10A 1ZSQA 2JZZA 3TW1A 2V76A 1Q1OA 2KK8A 5DHAB 2FIFA 3VUYA 1LW3A 1OQNA 3SO6A 3ZDMC 4MSQB 1V61A 1IRSA 4GSWA 3CMMB 2Y8FA 3PEGA 3FEHA 1E90A 2EJ8A 3H7SA 1UPQA 2DAJA 3CSFA 4KDLB 1KOTA 3KYDD 3RZFA 1KJTA 3VOQA 2NCNA 4F1SA 3IG3A 3L54A 5GOWB 2AL6A 1ACAA 4WWNA 2KX0A 4LCDE 2DN6A 2NS5A 4KSLC 4EZKA 2R0DA 4HAVB 4FLHA 2O6VB 4GXBA 5KHOA 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAW A;  1SIF A;  3IFW B;  2DZM A;  3N3K B;  1DYN A;  2FAZ A;  3DDC B;  1TQZ A;  3AU4 A;  2ROV A;  2DYO A;  3RUL A;  3K9P B;  3H7P A;  5LOP B;  4HLE A;  2G45 B;  4NJ7 A;  2QKL A;  1CMX B;  2BYE A;  1SHC A;  2LXA A;  4II2 B;  2L7R A;  3NS8 A;  5D7G A;  5L81 A;  2LUE A;  2N9X A;  3KW5 B;  4K7W A;  2J0K A;  2W2W A;  1S3S G;  5JLJ B;  3ODO A;  2WDT B;  3PVU A;  3P6A A;  3D8E A;  1MKE A;  2OJR A;  2XEW A;  3TL5 A;  4HJK A;  4GZU A;  2L8J A;  2BYF A;  2C5L C;  4XX5 A;  5HKH A;  2N4F A;  4WJ7 A;  1WR1 A;  4F7G A;  1I35 A;  4ANU A;  4NJ6 A;  1X11 A;  3PS6 A;  3RCZ A;  4FN2 A;  1GC7 A;  2K8H A;  2R2Q A;  2ZNV B;  1BAK A;  3L08 A;  2DFK A;  2W2X D;  3SUZ A;  2WYQ A;  4PS8 A;  3IHP C;  2LGX A;  1FHO A;  4HAW B;  4G3X B;  2K39 A;  4DHZ E;  2KQS A;  1RFA A;  4MY6 A;  2BGF A;  1E7V A;  4EZL A;  1R4M I;  1RLF A;  1EF5 A;  2GBM A;  1WGH A;  5E6N A;  2LZ6 A;  3L17 A;  4KSK C;  3AXC A;  3KUD B;  2L2I A;  1XD4 A;  3TFM A;  3ZDT A;  2N7E A;  1NU2 A;  2YVC A;  2DEN B;  4TYZ A;  4DHZ B;  3DCG A;  3EEC A;  1WM3 A;  2LVO A;  3M62 B;  2K25 A;  4ICU A;  2GBJ A;  1YQB A;  3Q3F A;  1TBE A;  5J3Q A;  3EC8 A;  4EFO A;  3NOB A;  2IY1 B;  2AWT A;  2DKQ A;  2DZJ A;  2NPT B;  1NBF C;  3L13 A;  1RRB A;  3OLM D;  5DI9 B;  1M7E A;  3UIP B;  2BF8 B;  4WJN A;  3VAW A;  3ZVV A;  3W1S C;  1WFY A;  2Y7B A;  1YX6 B;  1V5U A;  2L05 A;  2A5U A;  3HK0 A;  4JL9 A;  1YD8 U;  2JUO A;  3VFK A;  3BY4 B;  3UQA A;  5EFX A;  4LJO B;  3DBH I;  5JHA A;  4BVU C;  2RLO A;  1WX7 A;  4TUU A;  3KRW A;  3V61 A;  3A8P A;  2BKF A;  1ZM0 A;  2K6Q A;  2N23 A;  3X23 A;  2FCQ A;  4HAZ B;  4JLC A;  2A4Z A;  4KAX B;  5J3Y A;  2ASQ A;  2LRU A;  4AP4 C;  2MBB B;  2DLW A;  4XZ4 A;  3SHQ A;  1YIW A;  2KTR A;  4W9F A;  2C9W B;  1WGD A;  4MDK E;  4CHK A;  4KV2 A;  3TIX A;  5CLQ B;  1FOE A;  1M7R A;  1E8W A;  1TJ6 A;  5KQ4 A;  4IFS A;  1OQY A;  2L0F A;  3VQI A;  3O65 B;  2CU1 A;  2I5C A;  3VH4 B;  1NTY A;  1MK7 B;  2JWZ A;  2V1Y A;  4D0N B;  4Y94 A;  4OVV A;  3X0W A;  4GDL B;  2RR9 A;  1BWN A;  1UGM A;  5KCV A;  1XKE A;  2M38 A;  3PP2 A;  4PYU A;  2AYO B;  5DPS A;  4X57 B;  1FGZ A;  2YS5 A;  4WVF B;  2DA0 A;  2PEA A;  3L0W B;  3KUC B;  1TTN A;  4RM8 A;  1ZC3 B;  2L3Z A;  1QC6 A;  3D32 A;  2WX0 A;  1EVH A;  4CHJ A;  3L10 B;  1V88 A;  2ZNV C;  3M63 B;  5L95 C;  3ZTD A;  2P0F A;  3A1Q A;  3KRX A;  2RSG A;  2KAN A;  3RYT A;  3KVF B;  2D2Q A;  2YS1 A;  2V4L A;  2LI5 A;  1V5P A;  1IYF A;  3ULC A;  3FSS A;  2KJ6 A;  1WMH A;  2N9P C;  2W9N A;  2PE9 A;  2HJ8 A;  2LGD A;  4NNJ B;  2NVU I;  4IWP A;  4DHJ D;  1VD2 A;  3PHX B;  2COF A;  1XR0 B;  3CXB B;  5JHG A;  2YLM A;  4G50 A;  3QJZ A;  1J0W A;  2K8B A;  3ZLZ A;  2KFK B;  4HDQ A;  1XX0 A;  2IYD B;  3ULB A;  2CHW A;  5EDS A;  2Z0P A;  1B55 A;  1I7A A;  2BWE S;  3SDL C;  3W1S A;  2LAS A;  2M8S A;  1WGY A;  2KMC A;  1W1H A;  2MSE D;  1WXA A;  4W9I A;  1RJ2 A;  4GDK B;  2JF5 A;  5E6P A;  5BO4 B;  2VSZ A;  1P3R A;  1UEF A;  4DXA B;  1U5F A;  5JZE B;  2BKR B;  3CF6 E;  2DX5 B;  1S1Q B;  4FBJ B;  2OTX A;  4K1R B;  4B9K A;  2L0T A;  1V89 A;  2DZK A;  1A5R A;  4WAA A;  5C79 A;  3W1Y A;  1J19 A;  4FJY A;  2K2U A;  3RD2 A;  2FCN A;  4NPN A;  5J2R A;  2Q13 A;  1K8R B;  3U8Z A;  1LFD A;  2DYM A;  2JPH A;  1C3T A;  2D07 B;  1PQS A;  2KDE B;  3A9K B;  1ZVR A;  1WGR A;  2IY0 B;  2V3S A;  4AJW A;  4NSW A;  2KXJ A;  1MIZ B;  2MCN B;  3HQC A;  2MKR A;  3A9J B;  3QQ8 B;  5CX3 A;  1UNP A;  3R7R A;  4DK5 A;  3GOE A;  1NDD A;  3BJI A;  2P8V A;  4NQK E;  5AZH A;  2EMS A;  1P0R A;  2ZJD A;  2UZS A;  1U4A A;  1Q5W B;  1TZ1 A;  3QHT A;  3HM6 X;  4BBN C;  2AL3 A;  2MWS B;  3TJP A;  4HPL B;  4MEL A;  2NR2 A;  2Z0E B;  2I1K A;  2FID A;  1OMW A;  4J6I A;  1GC6 A;  3ML4 A;  3R66 C;  1AAR A;  3VTV A;  4IM0 A;  4BFR A;  4M8N A;  4URK A;  5LLI A;  4CHM A;  1WXM A;  1FHW A;  2VRW B;  1SGH A;  3VHT C;  4HCP B;  3T8M A;  3TCA A;  3DVN U;  4A6F A;  2FNJ B;  2O2V A;  2KMA A;  4OVU A;  3PTF C;  4NQL B;  2RNR B;  3DVG X;  4WQO B;  3ZVR A;  1RRP B;  4W9H A;  5C5B B;  2ZCB A;  3M3J A;  3DXE A;  1FHX A;  1GUA B;  2L1C A;  1V49 A;  3HHM A;  2LKO A;  2KNB A;  4IOY X;  3ZO5 B;  2HD5 B;  4WJO A;  4F7H A;  4KZ0 A;  3SD5 A;  1DBH A;  5CHW A;  4MH0 E;  3TBL D;  1E8Y A;  3U30 A;  1KLV A;  1XOD A;  2XBB C;  2KKC A;  3A33 B;  4ZRJ A;  2YSZ A;  3ZNH B;  3KY9 A;  5DPR A;  1N3H A;  2DX1 A;  1M94 A;  5D6J B;  4F7Z A;  2Z59 B;  4HCN B;  3ZKJ C;  3QAR A;  4EJN A;  2PJH A;  4DX9 0;  4HAT B;  1KI1 B;  4CYE A;  4KIK A;  4WWO A;  1P98 A;  2VRR B;  2YS3 A;  4IW0 A;  3H1U A;  4DX8 A;  3DBL I;  2K00 A;  4B6H A;  1WM2 A;  3OAN A;  1I42 A;  1PFJ A;  3JVZ X;  1EF1 A;  1UEL A;  4EUT A;  1WR6 E;  2LJ5 A;  3TMP B;  1U5G A;  4FJV B;  1P6S A;  1AWE A;  1TGZ B;  4W9E A;  2KQ7 A;  5G55 A;  2JRH A;  1Z87 A;  2FCM A;  5J18 A;  4NAW B;  3WA0 A;  1YJ1 A;  2COC A;  3V62 A;  2M17 A;  3AUL A;  2JZ3 B;  4HXD A;  1V9J A;  2NPT A;  2LVP A;  3EHV A;  4G11 A;  3RCP A;  1MK9 B;  3H7P B;  5J3T A;  1U2B A;  1C1Y B;  2Y5B B;  4K81 A;  4F8C B;  3S2A A;  3PSC A;  4HAX B;  3QK0 A;  2PPH A;  2MX2 A;  4WWP A;  2CAY A;  5AZF A;  1ISN A;  5DIF B;  1WE6 A;  1Z2M A;  4WJP A;  1W1D A;  1UZX B;  2MA9 B;  3UF8 A;  4JGH B;  2IO0 B;  1Z5S B;  2IO2 B;  5L83 A;  2KJH B;  4ZRI A;  3TO1 A;  1WGG A;  2J7Q B;  3UQB A;  2O6V D;  3SU8 X;  2MP2 B;  3PZD A;  3DVN V;  2DKP A;  1VCB A;  4K7U A;  3ALB A;  5KQ1 A;  1QZE A;  2QKM A;  2KC2 A;  1V2Y A;  5CHF A;  2BCJ A;  2QHO A;  1WJ6 A;  4DDG D;  3UIO B;  2UVM A;  2C7M B;  2DHK A;  1XT9 B;  4KHO A;  2DHZ A;  2BYV E;  2GCL A;  2KO3 A;  4PS3 A;  1EO6 A;  5IAA C;  4B95 A;  3TVV A;  4HB2 B;  2Y8G A;  1FGY A;  5JHB A;  2C7H A;  2KWV B;  2PZ1 A;  2MFQ A;  4N9F 4;  2N1W A;  3NZU A;  1P1A A;  5C1Z A;  2KN5 A;  2MBH A;  4GDL A;  1WI1 A;  3MDB C;  2LD9 A;  2DTC A;  1OGW A;  2MLB A;  1WGU A;  2HTH B;  3QIJ A;  1IPG A;  2G3Q B;  1P9D U;  5KHQ A;  2DYB A;  2NBW B;  4HAY B;  1WJN A;  2DAF A;  4PS7 A;  2MWN B;  4MM3 A;  4IWO A;  1GNU A;  4GU2 A;  3PV1 A;  4ZRK A;  4FJZ A;  4GIV A;  1F9J A;  2L76 A;  3JSV A;  1DDM A;  3MHS D;  3NSU A;  4TQ0 A;  5JH5 C;  1Y8R C;  4WJQ A;  1MIX A;  3RT3 B;  1WX8 A;  1WZ0 A;  3KYC D;  3V60 A;  4LDT B;  2KWU B;  2N7D A;  3H6N A;  2GCJ A;  4MGY E;  2KZR A;  1E5W A;  4GMV A;  1X05 A;  2JXX A;  4MJS B;  1HE8 A;  3PRZ A;  3K9O B;  1OY2 A;  4FUL A;  2CR5 A;  4BOZ B;  1IP9 A;  4BKS D;  2KHW B;  5LON B;  1E8X A;  1UBI A;  1UNQ A;  5JHH A;  3V5W A;  4HB4 B;  4IM2 A;  2DZI A;  2NBV B;  3UIN B;  3B1L X;  2M14 A;  4M0W B;  1X86 A;  2L00 B;  2RUK B;  3AI5 A;  5G2N A;  1RAX A;  1FXT B;  4ANV A;  3VH3 B;  1MPH A;  3OAW A;  4DWF A;  5GMV A;  3NHE B;  2D9X A;  4KZC A;  2MQJ A;  4MGI E;  3OJ4 B;  1MAI A;  4PYZ A;  3CST A;  3ZRF A;  1SE9 A;  2RVB B;  2G35 A;  4FHJ A;  1GJZ A;  3HIZ A;  3T9L A;  2CRF A;  2GBR A;  3A98 B;  3BIN A;  4XC2 A;  3KSY A;  4IM3 A;  1UBQ A;  2C60 A;  1WJ4 A;  3I3T B;  3QC8 B;  2C7N B;  2ZPY A;  2MBE A;  1XD3 B;  3KZ1 A;  1BTN A;  2KGX B;  2UWQ A;  4HAU B;  1OEY J;  3DVG Y;  1WG7 A;  1D3Z A;  4BKT A;  2D3G A;  3SNH A;  1PMS A;  3ZW3 A;  1W1G A;  4BBN F;  1AQC A;  2D4Q A;  4AJY B;  4A6K A;  2ZZP B;  1I2H A;  3V6E B;  4L6E A;  1V86 A;  5DPW A;  2ZEQ A;  4I6N B;  2LOZ A;  3WAO A;  1P3Q U;  1ZKH A;  4W9L A;  3Q3J A;  4EEW A;  3MTN B;  3ZNZ B;  1XQQ A;  3M1I B;  4BOS C;  3D8F A;  3UZT A;  2R2O A;  3PRE A;  2DYQ A;  1Q67 A;  5HE2 A;  3ML9 A;  1WMH B;  4M8M A;  4Z2M B;  5D3W A;  3PGE A;  2M4N A;  2CKH B;  4HHV A;  2MBQ A;  3HM3 A;  3GYO A;  4ZYN A;  2FUH B;  1K5G B;  4K2P A;  4HB0 B;  2O6V A;  1LM8 B;  4MEM A;  5D3X A;  1ZGU B;  2G4S A;  2KDB A;  2LXC A;  4EKU A;  5AEK B;  4MK0 A;  3NZS A;  4K7S A;  2HE7 A;  4I6L B;  2D9V A;  4JIO U;  4MGZ E;  3QX1 A;  2J0J A;  2RD0 A;  2N0Y A;  2LWP A;  4GB9 A;  1UH6 A;  1Y19 B;  3H9D A;  4ANW A;  5C16 A;  3SV1 A;  2KX3 A;  5FR6 A;  4E71 A;  3WAN A;  2IBI B;  3DXD A;  3T06 A;  3DOW A;  2MDX A;  2H7E A;  2YRY A;  1WI0 A;  2N1V A;  2WWZ A;  1LXD A;  2LG1 A;  5D27 A;  2REX A;  5JP4 A;  1LQB A;  4EOY A;  3ZUN A;  2N9E B;  1H4R A;  3V6C B;  1E8Z A;  2D9Z A;  3PLU A;  4C0A A;  3PHW B;  2DHI A;  2YF0 A;  2BPS A;  5LXI B;  4EZJ A;  2YT1 A;  3A4R A;  1U27 A;  2XK5 B;  4I6P A;  1H10 A;  1WJ1 A;  2JT4 B;  4A5K A;  5C23 A;  1X1M A;  3PT2 B;  5AZG A;  4W9D A;  3U7D A;  5C6R A;  1X1F A;  4BBK A;  3PPA A;  5CTR C;  3KUZ A;  2M0X A;  3PRP B;  2GJY A;  2KCJ A;  2EKE C;  5FI1 A;  4A20 A;  3PRM B;  3N30 A;  4B6W A;  3GZN I;  3ENE A;  1X1G A;  2IFS A;  1Q0W B;  2CY4 A;  2CHZ A;  2KFJ A;  2D9Y A;  4GMX B;  4PNK A;  2LYD A;  3VUX A;  1P5T A;  4HVB A;  1J8C A;  1U5D A;  4EMO A;  2GBN A;  1V5M A;  1U5E A;  3PSE B;  3A4S C;  4BKG A;  4FA6 A;  4GPT B;  2KDF B;  4GOC A;  2CS4 A;  1FB8 A;  2KWC A;  5CLL B;  2RGF A;  4BKS A;  4E3C A;  2NMB A;  5HE1 A;  2KD0 A;  3B08 A;  4A6F B;  3QWZ B;  2O2V B;  1UPR A;  3N7C A;  2IZV B;  3G9W A;  2B3A A;  1T0Y A;  2AEH A;  2KTF A;  2MP2 A;  3APF A;  3LJU X;  4W9C A;  5LXH A;  3JW0 X;  3DBR I;  4FHK A;  2GMI C;  5J17 A;  4HK2 A;  2LVQ A;  3QA8 A;  3WAL A;  4W9J A;  2M1M A;  1WIA A;  4HPM B;  3R3M A;  1NI2 A;  2I5F A;  4H8S A;  4YL8 A;  3QWM A;  2RGN B;  3NY5 A;  2Z0D B;  3PLV A;  3AJ4 A;  3WIM A;  2LUL A;  2IYB A;  4KIK B;  4DBB A;  3DQV A;  1WY8 A;  2ZVO A;  3LJ3 A;  1L2N A;  2DHJ A;  1JRU A;  1WH3 A;  5IA7 A;  2ELA A;  2JVC A;  3ONS A;  2KLG A;  1LB1 A;  2HTH A;  2J0M A;  2BWF A;  4K17 A;  4MSM B;  5D94 A;  4IWQ A;  2P0H A;  2LRW A;  1G6J A;  4KHB B;  2KDI A;  5DPT A;  1OEY A;  1WXV A;  4RM9 A;  2KJR A;  4AWJ A;  3UGB B;  5DH9 B;  5D2M B;  3O96 A;  2W2X C;  5D3Y A;  4A6H A;  2KC1 A;  1ZC4 B;  2YT0 A;  5D3V A;  2IO3 B;  1TXD A;  1K5D B;  2KOX A;  2CHX A;  2JY6 A;  3VIA A;  2EMT A;  1XCG A;  4ASW C;  1V6E A;  5TR5 A;  4E74 A;  2G4D B;  2J59 M;  3IVF A;  1MG8 A;  3ML8 A;  4KDI C;  4MJS A;  2OQB A;  4DHJ B;  4ANX A;  1J0G A;  4W9K A;  4WSF A;  2COA A;  1KM7 A;  3VTU A;  2XQN M;  1R4N I;  3ZTC A;  4GN1 A;  1WJM A;  1V5O A;  3N32 A;  1WGQ A;  2FJL A;  2OOB B;  4MGK E;  4HWI B;  1WVH A;  2ELB A;  4IC7 B;  2CY5 A;  2COD A;  4A3O A;  4II3 B;  3C0R B;  2NBU A;  1WZ3 A;  3OJ3 A;  4K2O A;  2LGY A;  3ODW A;  4NY0 A;  1WXS A;  3QAQ A;  5E6O A;  1UD7 A;  1EAZ A;  3ZIM A;  1WE7 A;  1KZG A;  1U29 A;  1FAO A;  2LOX A;  4TQ1 A;  3VTW A;  3WAP A;  5FI0 A;  2JRI B;  4RMA A;  4TV3 A;  1UNR A;  2K6D B;  2KFK A;  4KHA A;  3RZW C;  3LDZ E;  1QQG A;  3P2B A;  2MRP A;  1DDW A;  3KH0 A;  1H8C A;  3F5R A;  2JP2 A;  4LJP B;  1GG3 A;  3B0A A;  4IUM B;  4IG7 B;  1DDV A;  5DCN A;  1PLS A;  4GDK A;  2FCS A;  3CIK A;  2KTR B;  1EUV B;  2UZR A;  4P7I A;  2RPQ A;  3MPX A;  3JSV B;  4JQW C;  2WX1 A;  1Y5O A;  2DX5 A;  3SYX A;  2P0D A;  4CO7 A;  4DDI D;  3QBV B;  4ZDV A;  2I1J A;  5CHV C;  2IO1 B;  2KVR A;  1WYW B;  1E7U A;  3QCA A;  3F0W A;  3ZNI D;  3GYP A;  2NZ8 B;  1OTR B;  3VVW B;  3P7Z A;  1WX9 A;  4TKN A;  4DBG A;  3WAM A;  3WYF B;  3A9K A;  2KLC A;  3HW2 B;  1YX5 B;  3IBE A;  3VXW A;  4HDO A;  1ZW7 A;  4YON A;  3A9J A;  1WF9 A;  1V80 A;  1WJU A;  2H7D A;  3PVL A;  2GBK A;  3DPD A;  2K2J A;  2PE6 B;  2Z0Q A;  4FAD A;  3ECI A;  3DBS A;  3JYU A;  4F7U P;  3A1Q B;  3RUI B;  2D11 A;  3ODX A;  3L16 A;  2MBO A;  4AUQ C;  2UYZ B;  4ICV A;  1L7Y A;  1NTV A;  3A8Q A;  2KUP A;  2ZPN A;  2K1F A;  1BT0 A;  2RSU A;  4AOF A;  4LDT D;  4HB3 B;  2GOW A;  2ZVN A;  4MT7 A;  3EFU A;  4W9G A;  2EC1 A;  3DXC A;  2D9W A;  2ZCC A;  4PQ0 A;  3ZRC A;  2ROZ B;  3VDZ A;  3FM8 C;  1WRD B;  2XK5 A;  1V5T A;  2MW5 A;  2GS0 A;  2ADZ A;  5HE0 A;  3ZNG C;  3APC A;  3APD A;  5C5B A;  3D8D A;  2R09 A;  2K8C A;  1KZ7 A;  3R7Q A;  3PG7 A;  1V81 A;  4GGQ A;  1BTK A;  4A3P A;  3PVW A;  4KVG B;  2X18 A;  3MJW A;  5DHF B;  5HE3 A;  4G0N B;  1EGX A;  3M95 A;  2VKI A;  4IAP A;  2E2X A;  3AU5 A;  2Z0O A;  2DYN A;  3VUW A;  1DRO A;  4XWX A;  1ZSQ A;  2D10 A;  2JZZ A;  3TW1 A;  2V76 A;  1Q1O A;  2KK8 A;  5DHA B;  2FIF A;  3VUY A;  1LW3 A;  1OQN A;  3SO6 A;  3ZDM C;  4MSQ B;  1V61 A;  1IRS A;  4GSW A;  3CMM B;  2Y8F A;  3PEG A;  3FEH A;  1E90 A;  2EJ8 A;  3H7S A;  1UPQ A;  2DAJ A;  3CSF A;  4KDL B;  1KOT A;  3KYD D;  3RZF A;  1KJT A;  3VOQ A;  2NCN A;  4F1S A;  3IG3 A;  3L54 A;  5GOW B;  2AL6 A;  4WWN A;  2KX0 A;  4LCD E;  2DN6 A;  2NS5 A;  4KSL C;  4EZK A;  2R0D A;  4HAV B;  4FLH A;  2O6V B;  4GXB A;  5KHO A;  4Z2N A; 
#chains in the Genus database with same CATH topology
 4NAW A;  1SIF A;  2GB1 A;  3FLV A;  3AE1 B;  3BVZ A;  3IFW B;  2I2Y A;  4GNK B;  2DZM A;  1NI3 A;  3N3K B;  3AE5 B;  1DYN A;  3NZ3 A;  2FAZ A;  3DDC B;  3NVV A;  1TQZ A;  2Q5W D;  2X8X X;  3AU4 A;  2ROV A;  3B9J A;  2DYO A;  3RUL A;  2ZW1 A;  2EEL A;  3H7P A;  3K9P B;  4JKA A;  1RFK A;  2E3T A;  1DGJ A;  5LOP B;  4HLE A;  3DBL B;  4C56 C;  2WXK A;  2G45 B;  4NJ7 A;  2QKL A;  1CMX B;  2BYE A;  1SHC A;  2LXA A;  4II2 B;  1WWT A;  4DXF A;  2L7R A;  3NS8 A;  2HRJ A;  5D7G A;  5L81 A;  3N9Y C;  2LUE A;  2K9X A;  5HFY A;  2N9X A;  1K51 A;  3KW5 B;  4K7W A;  2J0K A;  2W2W A;  4L23 A;  1S3S G;  5JLJ B;  3OWE B;  3ODO A;  2WDT B;  3KWV A;  3PVU A;  3P6A A;  2YEP F;  3D8E A;  2CQU A;  3ZXR A;  1MKE A;  3AEG B;  3HIE A;  2OJR A;  2XEW A;  3TL5 A;  4RF0 A;  4KGT A;  4HJK A;  2WXO A;  4GZU A;  1ZOY B;  2L8J A;  4LTU A;  2BYF A;  2C5L C;  3ZQ4 A;  3BYY B;  4XX5 A;  4JK9 A;  5HKH A;  2N4F A;  4WJ7 A;  1WR1 A;  4F7G A;  1I35 A;  4ANU A;  4NJ6 A;  3MJ5 A;  3P4R B;  1X11 A;  3PS6 A;  1MVK A;  1ENF A;  2IGH A;  1A70 A;  2WXQ A;  3O13 A;  4JWS C;  3RCZ A;  2B76 B;  4FN2 A;  1GC7 A;  2PIA A;  3NVY A;  1SE4 A;  3W9C B;  2K8H A;  2R2Q A;  5BMH A;  5HHD G;  2ZNV B;  1BAK A;  2IND C;  4S17 A;  1FPY A;  3L08 A;  2DFK A;  1N60 A;  2W2X D;  3SUZ A;  1D5M C;  4JKC A;  2WYQ A;  3IHP C;  2LGX A;  4PS8 A;  4YWG G;  1C4C A;  1FHO A;  3E56 A;  4HAW B;  1IBX A;  4G3X B;  5IO9 A;  1FCC C;  4JE3 B;  2K39 A;  4DHZ E;  3AMZ A;  2KQS A;  1RFA A;  4MY6 A;  4ITK A;  3Q6B A;  2BGF A;  1E7V A;  4EZL A;  1R4M I;  2IGD A;  1B9R A;  1RLF A;  4NZL B;  1EF5 A;  3AE3 B;  2GBM A;  4US8 A;  1WGH A;  5E6N A;  2LZ6 A;  3L17 A;  4KSK C;  3AXC A;  3KUD B;  4HPP A;  1WXQ A;  1EWC A;  2AQ1 B;  2L2I A;  1XD4 A;  1T3Q A;  3TFM A;  3ZDT A;  3I63 C;  2N7E A;  1NU2 A;  2W55 A;  2YVC A;  2G1E A;  2DEN B;  3URY A;  4TYZ A;  2M0A A;  2DBY A;  4DHZ B;  3DCG A;  3EEC A;  1WM3 A;  2LVO A;  1TS5 A;  3M62 B;  2K25 A;  4ICU A;  2GBJ A;  1YQB A;  4RF1 A;  1SF0 A;  3Q3F A;  1TBE A;  5J3Q A;  5HG2 A;  3EC8 A;  4EFO A;  3NOB A;  2IY1 B;  4YSX B;  2QIL A;  1HTQ A;  3V3X A;  2AWT A;  2DKQ A;  2DZJ A;  3A58 A;  2NPT B;  3FIL B;  1NBF C;  3L13 A;  3DBH B;  4IKG A;  2FJ9 A;  1RRB A;  3OLM D;  5DI9 B;  1M7E A;  3UIP B;  2BF8 B;  4WJN A;  3VAW A;  3ZVV A;  3W1S C;  1XCT L;  4XGA B;  3SFD B;  1WFY A;  2Y7B A;  2JYE A;  1YX6 B;  4OZC A;  1V5U A;  3EFC A;  2L05 A;  1RWS A;  2A5U A;  3HK0 A;  3AE8 B;  4JL9 A;  3TSS A;  1YD8 U;  2KIG A;  2JUO A;  3VFK A;  3BY4 B;  1JWA D;  3UQA A;  5FK9 C;  2PLP A;  5EFX A;  4LJO B;  3DBH I;  3BWU D;  3IAS 1;  5JHA A;  4BVU C;  3AE6 B;  2RLO A;  1VRA B;  1WX7 A;  4TUU A;  3KRW A;  3AEE B;  5IKC M;  3V61 A;  1D5Z C;  3A8P A;  3E9O A;  2BKF A;  2K8E A;  2KIE A;  1ZM0 A;  5BMI A;  2K6Q A;  5BYS A;  1UF0 A;  2XNA C;  2NBV A;  2N23 A;  3X23 A;  1KRH A;  2FCQ A;  4HAZ B;  1SEB D;  1EU4 A;  5BYR A;  4JLC A;  3ENB A;  2A4Z A;  5LG4 B;  4KAX B;  5J3Y A;  1PGA A;  3LYY A;  2ASQ A;  1UWM A;  3Q8C A;  2QJL A;  1F52 A;  2LRU A;  1EWY C;  4AP4 C;  1JWB D;  2MBB B;  2DLW A;  4XZ4 A;  3PZ8 A;  1SE2 A;  3HRD D;  3SHQ A;  1YIW A;  2KTR A;  4W9F A;  4JKG B;  2C9W B;  1CQV A;  1WGD A;  1TS2 A;  2MJE A;  4N58 A;  4MDK E;  4CHK A;  4KV2 A;  4QAY A;  3TIX A;  5CLQ B;  2WXN A;  2OJW A;  1FOE A;  3AEF B;  1M7R A;  1E8W A;  2WXG A;  3RNA C;  1TJ6 A;  5KQ4 A;  3DWM A;  3VR9 B;  4IFS A;  1OQY A;  2L0F A;  3VQI A;  1F0Z A;  5I4D A;  1ROE A;  3O65 B;  2CU1 A;  3ZYY X;  1QF6 A;  1QIL A;  1I4P A;  1YN5 A;  2I5C A;  3VH4 B;  2LGI A;  1NTY A;  2BT6 A;  1TYG B;  1MK7 B;  2JWZ A;  2V1Y A;  4D0N B;  4Y94 A;  4OVV A;  3X0W A;  4GDL B;  2RR9 A;  1BWN A;  1UGM A;  5KCV A;  1AWD A;  1XKE A;  1NTI A;  2M38 A;  5JVL A;  3EUB 2;  3PP2 A;  4PYU A;  2AYO B;  5DPS A;  4ZRP A;  4X57 B;  1FGZ A;  2YS5 A;  4WVF B;  2DA0 A;  2PEA A;  4M02 A;  3L0W B;  3KUC B;  1IGC A;  1TY0 A;  1TTN A;  4RM8 A;  1ZC3 B;  2L3Z A;  2JX5 A;  1QC6 A;  4WQM A;  3D32 A;  2WX0 A;  1EVH A;  5HI1 A;  3NG0 A;  4CHJ A;  3L10 B;  3GP7 A;  1V88 A;  2ZNV C;  3M63 B;  5L95 C;  3ZTD A;  2P0F A;  1UNS A;  3A1Q A;  3KRX A;  4QXA B;  2WXL A;  3IT4 B;  4J3O D;  2RSG A;  2KAN A;  3RYT A;  3KVF B;  2D2Q A;  2YS1 A;  2MJD A;  2V4L A;  2FJU B;  2LI5 A;  1V5P A;  1MHH E;  1IYF A;  4ZHP A;  3ULC A;  3FSS A;  2KJ6 A;  1WMH A;  2N9P C;  3BK1 A;  2W9N A;  2PE9 A;  2HJ8 A;  3ZGZ A;  2LGD A;  4YTP B;  4XE0 A;  4NNJ B;  2NVU I;  1YOV B;  2UU7 A;  1V97 A;  4IWP A;  4M01 A;  2GLS A;  4DHJ D;  1VD2 A;  3PHX B;  2COF A;  4ARI A;  1XR0 B;  2INN E;  1FIQ A;  3W2D A;  2IPK D;  3HVD A;  4YT0 B;  3CXB B;  5JHG A;  1KBL A;  2YLM A;  4G50 A;  3QJZ A;  1J0W A;  2K8B A;  3ZLZ A;  2KFK B;  4C00 A;  2WHI A;  4HDQ A;  3P63 A;  2RQ1 A;  1XX0 A;  3E9L A;  1JWU D;  2IYD B;  1V8C A;  3ULB A;  2CHW A;  4IDI A;  2Z0P A;  5EDS A;  1NYR A;  3ZJU A;  1KLG D;  1B55 A;  1I7A A;  1MHX A;  2BWE S;  3SDL C;  3W1S A;  2LAS A;  1NVI D;  2M8S A;  3NVZ A;  1WGY A;  2KMC A;  2L83 A;  1W1H A;  3Q3N C;  2MSE D;  3E9P A;  2TSS A;  1WXA A;  2RDG A;  4W9I A;  3PZ7 A;  1RJ2 A;  4LNO A;  4GDK B;  2JF5 A;  5E6P A;  5BO4 B;  3MC9 A;  2VSZ A;  1P3R A;  1UEF A;  4DXA B;  4US9 A;  1U5F A;  4P1C C;  5JZE B;  2BKR B;  3CF6 E;  2DX5 B;  3SBG A;  5TSS A;  1S1Q B;  4FBJ B;  1PUT A;  2OTX A;  4K1R B;  1MPE A;  4B9K A;  2L0T A;  1V89 A;  2DZK A;  2WXP A;  3SEB A;  4N6E B;  1A5R A;  4WAA A;  3UI3 A;  5C79 A;  1E10 A;  3W1Y A;  1J19 A;  4FJY A;  2K2U A;  3RD2 A;  2FCN A;  4LNN A;  4NPN A;  5J2R A;  2E6X A;  2Q13 A;  1K8R B;  3U8Z A;  1LFD A;  1SBB B;  4XDD A;  2DYM A;  1FEH A;  2JPH A;  1MJD A;  1C3T A;  2D07 B;  1PQS A;  2KDE B;  1T6B X;  2JXT A;  3A9K B;  1ZVR A;  1WGR A;  2IY0 B;  5I2S A;  4LK0 M;  2DWQ A;  2V3S A;  4AJW A;  4NSW A;  2KXJ A;  3C8Y A;  1MIZ B;  2MCN B;  4DQO C;  3HQC A;  2MKR A;  3A9J B;  3QQ8 B;  1FXI A;  1HZ5 A;  4RCO A;  1P7E A;  5CX3 A;  1UNP A;  2BS4 B;  3R7R A;  1N6Z A;  4DK5 A;  3GOE A;  1E9M A;  1NDD A;  3BJI A;  2P8V A;  4NQK E;  5AZH A;  5H8Y E;  2EMS A;  1P0R A;  2ZJD A;  2UZS A;  4WUR A;  1U4A A;  4YXD B;  1I7H A;  3KLS X;  1Q5W B;  1JW9 D;  1TZ1 A;  3QHT A;  4KGR A;  2FDQ A;  1NYQ A;  3HM6 X;  4BBN C;  2KQ4 X;  2AL3 A;  2MWS B;  3TJP A;  4HPL B;  4MEL A;  4L2Y A;  2NR2 A;  1CK1 A;  2Z0E B;  4OVZ A;  2I1K A;  2FID A;  2R82 A;  1YN4 A;  3P4S B;  1OMW A;  4J6I A;  1GC6 A;  3ML4 A;  3R66 C;  3RMK C;  1AAR A;  4M00 A;  1WYG A;  1ZXI A;  3VTV A;  4IM0 A;  4BFR A;  4M8N A;  4URK A;  5LLI A;  4CHM A;  1WXM A;  3FAH A;  1JWM D;  4LNK A;  1FHW A;  2VRW B;  1SGH A;  2HTM E;  3VHT C;  4JWU C;  4NAM A;  4HCP B;  3T8M A;  2BQQ A;  3TCA A;  3DVN U;  3Q8B A;  4A6F A;  2FNJ B;  2O2V A;  2PKO A;  1L4D B;  2KMA A;  1ACC A;  3GZN B;  3IT6 B;  4OVU A;  1QQR A;  3PTF C;  1GGO A;  4NQL B;  2KWD A;  2RNR B;  2GUM A;  3DVG X;  3Q69 A;  2R61 A;  4WQO B;  3ZVR A;  1RRP B;  1V1O A;  4W9H A;  5C5B B;  2ZCB A;  3M3J A;  3DXE A;  2M19 A;  1FHX A;  1GUA B;  2L1C A;  1V49 A;  2LHD A;  1UGJ A;  1YJI A;  3HHM A;  3BZD B;  2LKO A;  2KAC A;  2KNB A;  4C7Y A;  3ZJV A;  2COP A;  4IOY X;  3ZO5 B;  2HD5 B;  4WJO A;  4F7H A;  4KZ0 A;  1CJE A;  3RFZ B;  3SD5 A;  1DBH A;  5CHW A;  4MH0 E;  3TBL D;  1E8Y A;  3U30 A;  1KLV A;  1XOD A;  2XBB C;  3LXF A;  2KKC A;  2WXI A;  3A33 B;  3SFE B;  3KWL A;  4ZRJ A;  2JU6 X;  2YSZ A;  3ZNH B;  3KY9 A;  2J4X A;  4KKJ A;  5IN7 A;  5DPR A;  4A6Q A;  1N3H A;  2DX1 A;  1M94 A;  5D6J B;  4F7Z A;  2Z59 B;  4HCN B;  3ZKJ C;  1XXG A;  3QAR A;  4EJN A;  2PJH A;  4DX9 0;  1ZYI A;  4HAT B;  2X38 A;  1KI1 B;  4CYE A;  4KIK A;  2WXH A;  4WWO A;  1P98 A;  2VRR B;  2OHF A;  4LNF A;  2QSD A;  2YS3 A;  4IW0 A;  3H1U A;  3T3O A;  2RDH A;  1TS3 A;  3DBR B;  4DX8 A;  1FO4 A;  1EU3 A;  3DBL I;  3I5J C;  2K00 A;  4B6H A;  1WM2 A;  2VH1 A;  3OAN A;  1FRD A;  1I42 A;  1PFJ A;  3JVZ X;  1EF1 A;  1UEL A;  4EUT A;  1WR6 E;  2LJ5 A;  3TMP B;  1C77 A;  1U5G A;  4FJV B;  3BK2 A;  2W54 A;  1P6S A;  1QLB B;  1AWE A;  1F77 A;  1TGZ B;  4W9E A;  2KQ7 A;  4MH8 A;  5G55 A;  2JRH A;  1Z87 A;  2FCM A;  3BVG A;  3DHI C;  5J18 A;  3SBT A;  2LEK A;  4NAW B;  3WA0 A;  1YJ1 A;  2COC A;  4KHB A;  3V62 A;  2M17 A;  3AUL A;  3RNB C;  2JZ3 B;  4HXD A;  5MPO A;  1V9J A;  2NPT A;  2LVP A;  1JAL A;  5EE0 A;  4WAF A;  3EHV A;  4G11 A;  3FVC A;  5GXG B;  3RCP A;  2R2Y A;  1MK9 B;  3H7P B;  5AUI A;  2PW9 A;  1K50 A;  5J3T A;  1U2B A;  1C1Y B;  2Y5B B;  4K81 A;  4F8C B;  1XCQ L;  2ZKM X;  3S2A A;  3PSC A;  4HAX B;  3QK0 A;  2PPH A;  1TY2 A;  2MX2 A;  4WWP A;  1ZE3 D;  4JKB A;  2CAY A;  4LNI A;  2FUG 1;  5AZF A;  1TZO A;  2BVC A;  3BII D;  1ISN A;  5DIF B;  1WE6 A;  2LBB A;  3R8B A;  3J9C A;  1Z2M A;  4WJP A;  1W1D A;  1UZX B;  2MA9 B;  2EKI A;  3UF8 A;  4JGH B;  2RRF A;  2IO0 B;  1T0Q C;  1Z5S B;  2IO2 B;  2V4I B;  1AYF A;  5L83 A;  2KJH B;  4ZRI A;  1HTO A;  3TO1 A;  1AN8 A;  1WGG A;  2N7J A;  2J7Q B;  3UQB A;  1T77 A;  1DIK A;  4YSY B;  2O6V D;  3SU8 X;  2MP2 B;  3CWI A;  2L32 A;  3PZD A;  2KT7 A;  3DVN V;  2DKP A;  1V1P B;  3RNC C;  1VCB A;  4K7U A;  3AE2 B;  3ALB A;  5KQ1 A;  2ZW0 A;  3NS1 A;  1QZE A;  2QKM A;  3FKY A;  2KC2 A;  1V2Y A;  5CHF A;  3B2G A;  2BCJ A;  2QHO A;  1WJ6 A;  4DDG D;  3RN9 C;  3V05 A;  1C9F A;  3UIO B;  2UVM A;  2H88 B;  3AE9 B;  2C7M B;  2DHK A;  4JK7 A;  3ZXV A;  2PMV A;  3I57 A;  1SSN A;  4ARC A;  1XT9 B;  4JKG A;  4KHO A;  3N1X C;  1IBX B;  1WRI A;  2DHZ A;  2K5P A;  2BYV E;  4HRO A;  2GCL A;  1FD6 A;  2KO3 A;  1FNU A;  4PS3 A;  1EO6 A;  5IAA C;  4B95 A;  2NTT A;  3GE3 C;  3TVV A;  4HB2 B;  2Y8G A;  1FGY A;  5JHB A;  2C7H A;  3E9S A;  1JDE A;  2KWV B;  2LHE A;  2PZ1 A;  2H89 B;  3Q8A A;  2DNF A;  2MFQ A;  4N9F 4;  2N1W A;  2K22 A;  1XLO A;  3NZU A;  2G9H D;  2WXM A;  2WXJ A;  1B1Z A;  1P1A A;  1CZP A;  5C1Z A;  3IAM 1;  4CQN A;  2KN5 A;  1GAQ B;  2LGS A;  2MBH A;  5H92 C;  4GDL A;  1WI1 A;  3MDB C;  4A55 A;  2LD9 A;  2DTC A;  1ZUD 2;  1MI0 A;  1OGW A;  2MLB A;  1WGU A;  2HTH B;  3QIJ A;  1IPG A;  1SB3 C;  2G3Q B;  3MC0 B;  1FFU A;  1P9D U;  5KHQ A;  2DYB A;  2NBW B;  4HAY B;  1WJN A;  2DAF A;  4PS7 A;  2MWN B;  4MM3 A;  1PYW D;  4IWO A;  1GNU A;  4GU2 A;  1RM6 C;  3PV1 A;  4ZRK A;  4FJZ A;  1K52 A;  4GIV A;  1F9J A;  2L76 A;  3JSV A;  1DDM A;  3MHS D;  4PT5 A;  2J53 A;  2D5G A;  1K53 A;  3NSU A;  4TQ0 A;  5JH5 C;  1Y8R C;  4WJQ A;  1MIX A;  3RT3 B;  5EE1 A;  1WX8 A;  1KFY B;  3NWD A;  1WZ0 A;  4HEA 1;  3KYC D;  3V60 A;  4LDT B;  5IJM A;  2KWU B;  3Q8F A;  2N7D A;  5G5H A;  2BBC A;  3H6N A;  2GCJ A;  4MGY E;  2KZR A;  5D3I B;  1E5W A;  4GMV A;  5T8I A;  4HKQ A;  5IOI A;  1X05 A;  2JXX A;  4MJS B;  1HE8 A;  3PRZ A;  3K9O B;  1OY2 A;  4FUL A;  1ESF A;  5JXV A;  2CR5 A;  4BOZ B;  1IP9 A;  1TJE A;  4BKS D;  2KHW B;  1L5P A;  5LON B;  1E8X A;  1SJH D;  1UBI A;  1UNQ A;  1ZDV A;  5JHH A;  4HKZ E;  3V5W A;  1VZ8 A;  3TEW A;  4HB4 B;  1XLQ A;  4IM2 A;  4QJ5 B;  4RFB A;  2DZI A;  2NBV B;  3UIN B;  1HA5 A;  3B1L X;  2M14 A;  1E6E B;  2QMT A;  3GB1 A;  4M0W B;  1X86 A;  2L00 B;  1UUP A;  2RUK B;  1SJE D;  3AI5 A;  5G2N A;  2HJ1 A;  1RAX A;  1FXT B;  4ANV A;  2NTS A;  3VH3 B;  4XYC A;  4AS1 A;  3AE4 B;  4LLG M;  1MPH A;  2LJI A;  2AQ2 B;  3OAW A;  4DWF A;  5GMV A;  3RI7 C;  3NHE B;  4B0M A;  2D9X A;  5FR3 A;  4KZC A;  1MI1 A;  1QKZ A;  1N62 A;  2ABD A;  4JKE A;  2MQJ A;  1I4Q A;  4MGI E;  2V3P A;  3OJ4 B;  2ICI A;  1MAI A;  4PYZ A;  3CST A;  3ZRF A;  1SE9 A;  2RVB B;  2G35 A;  4FHJ A;  2IJ0 A;  3H8H A;  2VZK D;  1GJZ A;  3HIZ A;  3T9L A;  1KLU D;  2CRF A;  2JQR B;  2GBR A;  5FKA C;  3TEY A;  1N61 A;  3BIN A;  3A98 B;  3C19 A;  4XC2 A;  1PGX A;  3KSY A;  4IM3 A;  1UBQ A;  2C60 A;  1T0R C;  1WJ4 A;  3I3T B;  4EE2 A;  3QC8 B;  2BYT A;  2AX5 A;  1JRP A;  2C7N B;  4JK8 A;  1QT9 A;  2ZPY A;  2MBE A;  3Q14 C;  4JX1 C;  1XD3 B;  3KZ1 A;  1NEN B;  1BTN A;  2KGX B;  2UWQ A;  4HAU B;  1OEY J;  2BTE A;  3DVG Y;  1WG7 A;  3TUO A;  4RGT A;  1D3Z A;  4BKT A;  2D3G A;  3SNH A;  4K3B A;  1PMS A;  3ZW3 A;  1W1G A;  4BBN F;  2W3S A;  1AQC A;  1HXY D;  2D4Q A;  4KX6 B;  4YSZ B;  3MP9 A;  4KKI A;  4AJY B;  4A6K A;  2W82 A;  2ZZP B;  1I2H A;  3V6E B;  1WGK A;  4L6E A;  3NJT A;  1V86 A;  1ZXH A;  5DPW A;  2ZEQ A;  1P7F A;  4I6N B;  2LOZ A;  3WAO A;  1P3Q U;  1ZKH A;  4C4V B;  4L1R A;  1PDX A;  4W9L A;  3Q3J A;  4EEW A;  3MTN B;  1OQQ A;  3ZNZ B;  1L6V A;  1OFF A;  1XQQ A;  3M1I B;  3LB8 C;  4BOS C;  3D8F A;  3UZT A;  2R2O A;  3PRE A;  2DYQ A;  2N0S B;  1Q67 A;  5HE2 A;  3ML9 A;  1WMH B;  4M8M A;  4Z2M B;  5D3W A;  2YEP B;  3PGE A;  4ZHO A;  2M4N A;  2CKH B;  4HHV A;  2MBQ A;  3HM3 A;  3GYO A;  4ZYN A;  2KAJ A;  1KH0 A;  2FUH B;  1K5G B;  4K2P A;  1J7C A;  4HB0 B;  2O6V A;  1LM8 B;  1DOX A;  3VRB B;  4MEM A;  5D3X A;  4RGM A;  1ZGU B;  2G4S A;  4TMA B;  3AEB B;  2RMM A;  1BXT A;  2KDB A;  2LXC A;  4EKU A;  2X0S A;  5AEK B;  4MK0 A;  3NZS A;  3GE8 C;  4K7S A;  2M56 B;  4WH4 A;  2HE7 A;  2W3R A;  4I6L B;  2SEB D;  2D9V A;  4JIO U;  2WS3 B;  4MGZ E;  2JZP A;  3QX1 A;  4DXG A;  2J0J A;  2WLB A;  2RD0 A;  2N0Y A;  2LWP A;  4GB9 A;  4DIX A;  4RGN A;  1UH6 A;  2CJN A;  1XF5 L;  1Y19 B;  3AEC B;  3H9D A;  3B2F A;  5C16 A;  3NVW A;  3OHM B;  4ANW A;  3DWG C;  3SV1 A;  1PGB A;  2KX3 A;  1VLB A;  5FR6 A;  1D6E C;  1FNV A;  3RPF C;  4E71 A;  3WAN A;  2IBI B;  3DXD A;  3T06 A;  3DOW A;  2MDX A;  2H7E A;  1QOG A;  2YRY A;  1WI0 A;  2N1V A;  1ET6 A;  2WWZ A;  1LXD A;  1KTK A;  2LG1 A;  5D27 A;  2REX A;  1GB4 A;  5JP4 A;  1LQB A;  4S0R A;  4EOY A;  1HBK A;  3ZUN A;  4P1B C;  3ETR A;  4TSS A;  2Z59 A;  3NW8 A;  2N9E B;  1H4R A;  3V6C B;  1E8Z A;  1QOF A;  2D9Z A;  2L52 A;  3PLU A;  4C0A A;  3PHW B;  2DHI A;  1JCK B;  1XO3 A;  3W5U B;  2YF0 A;  4R3D A;  2LFI A;  2BPS A;  5LXI B;  4EZJ A;  2YT1 A;  3A4R A;  3AV8 A;  1U27 A;  2XK5 B;  3SR6 A;  3HUI A;  4I6P A;  2AQ3 B;  1H10 A;  1WJ1 A;  1EM7 A;  2JT4 B;  4A5K A;  5C23 A;  2D3A A;  1X1M A;  3W5V B;  2JSV X;  2WU5 B;  2KR0 A;  3PT2 B;  5AZG A;  4W9D A;  3U7D A;  2V9H A;  5C6R A;  1X1F A;  2V3N A;  3MC8 A;  5C2T B;  4BBK A;  3PPA A;  5CTR C;  3KUZ A;  3IXS A;  2M0X A;  4HSI A;  3PRP B;  2GJY A;  2KCJ A;  2EKE C;  5FI1 A;  4A20 A;  3PRM B;  3N30 A;  4B6W A;  3GZN I;  3ENE A;  3P1M A;  1X1G A;  3I9V 1;  2IFS A;  1J7B A;  1Q0W B;  3U7Z A;  2Z4D A;  2CY4 A;  2CHZ A;  1J7A A;  2KFJ A;  2D9Y A;  1ST7 A;  4GMX B;  4PNK A;  2LYD A;  3VUX A;  1P5T A;  4HVB A;  3CIR B;  1J8C A;  1U5D A;  4EMO A;  2GBN A;  1V5M A;  4JKH A;  1U5E A;  3PSE B;  3A4S C;  1T5X D;  4BKG A;  1HZ6 A;  4FA6 A;  4GPT B;  1LGR A;  2KDF B;  5EE9 A;  1VBH A;  4GOC A;  2CS4 A;  4XWW A;  1FB8 A;  2KWC A;  1TKG A;  5CLL B;  3AN1 A;  2RGF A;  3VRA B;  4BKS A;  4E3C A;  2NMB A;  5HE1 A;  2KD0 A;  3B08 A;  1VZ7 A;  4A6F B;  3QWZ B;  2O2V B;  1UPR A;  2K3U A;  1SE3 A;  4AQ7 A;  1ET9 A;  3N7C A;  2ACZ B;  3U12 A;  2IZV B;  3G9W A;  1I4X A;  2B3A A;  1T0Y A;  2MEK A;  1XLP A;  2AEH A;  1R4M B;  1TIF A;  2INC C;  2MP2 A;  2KTF A;  1TT5 B;  1YMH E;  3APF A;  5IP4 D;  1V1P A;  4WWM A;  3LJU X;  1L4Z B;  3AE7 B;  1JRO A;  4W9C A;  3FP5 A;  5LXH A;  3FIL A;  3JW0 X;  1GB1 A;  1I4H A;  3DBR I;  4FHK A;  3MFG A;  2GRI A;  2GMI C;  3B77 A;  5M4Y B;  5J17 A;  4HK2 A;  2LVQ A;  3QA8 A;  3WAL A;  4W9J A;  2M1M A;  2QC8 A;  1WIA A;  4HPM B;  3R3M A;  1NI2 A;  2I5F A;  2KN4 A;  2Z14 A;  4YL8 A;  4H8S A;  1KF6 B;  3QWM A;  2MHJ A;  5C3J B;  3N1Z C;  3TEZ A;  2MJ3 A;  3ZJT A;  2KUQ A;  2PVO D;  2KMM A;  2RGN B;  3NY5 A;  1FFV A;  2Z0D B;  2WNM A;  1MFW A;  1FM0 D;  3PLV A;  3AJ4 A;  4N59 A;  3WIM A;  2LUL A;  2IYB A;  4KIK B;  1L6U A;  4MAC A;  4DBB A;  2HDE A;  1ZP0 B;  2PTL A;  3DQV A;  2WXF A;  1WY8 A;  2ZVO A;  3LJ3 A;  1JQ4 A;  1L2N A;  3DHH C;  4P16 A;  2DHJ A;  1JRU A;  2I38 A;  1WH3 A;  1LO5 D;  4OT1 A;  5IA7 A;  3EA6 A;  1NVL A;  2ELA A;  5D3D A;  1VR9 A;  4YTM B;  2JVC A;  3ONS A;  4BZA A;  2KLG A;  2BB6 A;  1KC7 A;  1LB1 A;  2QCZ A;  2HTH A;  2J0M A;  4ILH A;  2BWF A;  3PO0 A;  4K17 A;  2FBW B;  3FC4 A;  2V0G A;  2CJO A;  3GS2 A;  1DOI A;  1JWS D;  4MSM B;  5D94 A;  2WDQ B;  4IWQ A;  1F2R I;  4MT5 A;  2P0H A;  2LRW A;  1G6J A;  4KHB B;  2KDI A;  5DPT A;  1OEY A;  1WXV A;  4RM9 A;  1QOB A;  2KJR A;  4AWJ A;  3UGB B;  4H2A A;  5DH9 B;  3E66 A;  1TS4 A;  5D2M B;  3O96 A;  1FXA A;  2W2X C;  3RNF C;  1TKE A;  5D3Y A;  1F1H A;  1R4N B;  4A6H A;  4JKD A;  4ZOH C;  2KC1 A;  3R2T A;  1ZC4 B;  2WQY B;  2YT0 A;  5D3V A;  2IO3 B;  1YN3 A;  2SAK A;  1TXD A;  1K5D B;  2KOX A;  2CHX A;  1E0Z A;  2JY6 A;  3MHZ A;  3VIA A;  2EMT A;  4GOU A;  1XCG A;  4ASW C;  1V6E A;  5TR5 A;  4Q2J A;  4E74 A;  4ZRQ A;  2G4D B;  4ILJ A;  2J59 M;  3IVF A;  2VZK B;  1MG8 A;  1HEZ E;  1N5W A;  2KYW A;  4GLS C;  4JPS A;  3ML8 A;  1FNW A;  3RNG C;  4KDI C;  3NUH B;  4MJS A;  2OQB A;  4XDC A;  4DHJ B;  4OHJ A;  4ANX A;  1XEE A;  1J0G A;  4QJ4 B;  3BVM A;  4W9K A;  4WSF A;  2COA A;  1KM7 A;  3AEA B;  2WH5 A;  2VH2 A;  3VTU A;  3AB5 A;  2XQN M;  2CU3 A;  5IRS A;  1R4N I;  3ZTC A;  4GN1 A;  1WJM A;  1V5O A;  2BW2 A;  3N32 A;  1WGQ A;  2FJL A;  1HB8 A;  2OOB B;  4MGK E;  4HWI B;  4QJ3 B;  2Z13 A;  1WVH A;  2ELB A;  4IC7 B;  4L1B A;  2CY5 A;  1VDV A;  2COD A;  4A3O A;  4M0W A;  5LNK 1;  4II3 B;  4FXC A;  3C0R B;  2NBU A;  1NEK B;  3U2S C;  3VR8 B;  1WZ3 A;  1DYQ A;  2ONQ A;  5G5G A;  1GOZ A;  1UWX A;  3T3N A;  3OJ3 A;  4K2O A;  1QOA A;  3AED B;  2RDB C;  2WDR B;  2LGY A;  2FE8 A;  3ODW A;  1MG4 A;  3Q3O C;  4NY0 A;  1WXS A;  4RNA A;  1GPX A;  2WXR A;  3QAQ A;  1FCL A;  5E6O A;  2N9L A;  4B0E A;  3L4P A;  1UD7 A;  1EAZ A;  3ZIM A;  3AH7 A;  1WE7 A;  1KZG A;  1U29 A;  1FAO A;  3Q2A C;  1E7P B;  2JWU A;  3TEX A;  2LOX A;  4TQ1 A;  2INP E;  3VTW A;  2LUM A;  3WAP A;  5FI0 A;  1M4V A;  5I2M A;  1FMA D;  2JRI B;  4RMA A;  4TV3 A;  1HQR D;  1UNR A;  2KVZ A;  1YQ3 B;  1AW7 A;  1VBG A;  2K6D B;  1XLN A;  2KFK A;  3EGR A;  4KHA A;  1YQ4 B;  3RZW C;  3LDZ E;  2Y5C A;  1QQG A;  2NMQ A;  3P2B A;  1L0V B;  2MRP A;  3Q8E A;  1DDW A;  3KH0 A;  1C4A A;  1H8C A;  3NWF A;  3BYT B;  3F5R A;  2JP2 A;  4LJP B;  1GG3 A;  3B0A A;  1D5X C;  1SXT A;  4IUM B;  1OQR A;  4IG7 B;  1I4G A;  3KQ4 A;  1DDV A;  2PVG C;  5DCN A;  1PLS A;  4GDK A;  2FCS A;  3CIK A;  2KTR B;  1EUV B;  2UZR A;  1C78 A;  4MM3 B;  4P7I A;  2RPQ A;  3MPX A;  1L0Y B;  3JSV B;  4JQW C;  1N5X A;  1IUE A;  2WX1 A;  1Y5O A;  2DX5 A;  2K49 A;  2P0D A;  3SYX A;  4C4V A;  4CO7 A;  4DDI D;  3QBV B;  1HB6 A;  1PFD A;  3U4E G;  4ZDV A;  2I1J A;  5E6J A;  3EPY A;  1BUI C;  5EE3 A;  4A8X C;  1VZ6 A;  4ILG B;  2IDY A;  5CHV C;  2IO1 B;  1C79 A;  2KVR A;  1L0X B;  2RPV A;  2D3C A;  1WYW B;  1E7U A;  3QCA A;  3F0W A;  3ZNI D;  3GYP A;  1DOY A;  2NZ8 B;  1OTR B;  3VVW B;  3P7Z A;  1IGD A;  1I4R A;  2Z8L A;  1WX9 A;  3HVZ A;  3P4P B;  4TKN A;  4RGO S;  4DBG A;  3WAM A;  3WYF B;  3A9K A;  2KLC A;  3HW2 B;  4D2K A;  1F2R C;  2BS3 B;  1YX5 B;  3IBE A;  1Q10 A;  2N9K A;  3VXW A;  3RNE C;  4HDO A;  1ZW7 A;  4YON A;  2YT2 A;  1ZPS A;  3A9J A;  2LMC A;  2J52 A;  4O1N A;  1WF9 A;  1V80 A;  1WJU A;  2H7D A;  4YTN B;  4D6W A;  3PVL A;  2DIK A;  2GBK A;  3DPD A;  2K2J A;  2PE6 B;  2Z0Q A;  4FAD A;  2K0P A;  3ECI A;  2QDF A;  1T0S C;  3DBS A;  3JYU A;  4KGS A;  4ZYS A;  4F7U P;  3A1Q B;  4XWT A;  3RUI B;  1SIJ A;  2D11 A;  3ODX A;  1JML A;  3L16 A;  2MBO A;  4BAX A;  4AUQ C;  2UYZ B;  4ICV A;  2L1A A;  3DCX A;  1L7Y A;  5BYQ A;  1NTV A;  3A8Q A;  2KUP A;  2ZPN A;  1YNT E;  2K1F A;  1BT0 A;  2QIE B;  2RSU A;  4AOF A;  4LDT D;  5AUK A;  4HB3 B;  4C7Z A;  2GOW A;  4USA A;  2IGG A;  2ZVN A;  3ABV B;  4OSN A;  4PK1 A;  4MT7 A;  3EFU A;  4HRS A;  4W9G A;  4C80 A;  2EC1 A;  5BMG A;  3P42 A;  3DXC A;  1C4P A;  2J42 A;  4OW0 A;  2D9W A;  2ZCC A;  4PQ0 A;  2ON8 A;  2DLB A;  4JKF A;  3ZRC A;  2ROZ B;  1VJK A;  1ZDX A;  3VDZ A;  4OZB A;  3FM8 C;  4REZ A;  1C76 A;  1WSP A;  1WRD B;  2XK5 A;  1V5T A;  2MW5 A;  3U52 E;  4NJC A;  2GS0 A;  2ADZ A;  2CB8 A;  5HE0 A;  3ZNG C;  3APC A;  1R7S A;  3APD A;  5C5B A;  4A90 A;  3DHG C;  4HJG E;  4WIP A;  2BB5 A;  2D3B A;  3D8D A;  2R09 A;  2K8C A;  1KZ7 A;  3R7Q A;  3PG7 A;  1V81 A;  4GGQ A;  2MH7 A;  1YJJ A;  1BTK A;  3AM9 A;  4A3P A;  3PVW A;  4ACF A;  3NRZ A;  4KVG B;  2X18 A;  3MJW A;  5DHF B;  1FRR A;  2BS2 B;  5HE3 A;  4G0N B;  2WDV B;  1EGX A;  3M95 A;  2VKI A;  4IAP A;  2OED A;  3R2I A;  2E2X A;  2WU2 B;  3NWA A;  2KDM A;  3AU5 A;  2JYT A;  2Z0O A;  2DYN A;  3VUW A;  1DRO A;  2QEJ C;  4XWX A;  2D10 A;  1ZSQ A;  2JZZ A;  3TW1 A;  2V76 A;  1Q1O A;  2GI9 A;  2KK8 A;  3P4Q B;  5DHA B;  4P6V F;  2FIF A;  4CSQ A;  3VUY A;  1LW3 A;  1OQN A;  3SO6 A;  3ZDM C;  4MSQ B;  2Y3A A;  1V61 A;  1D4B A;  1IRS A;  2XN9 C;  4GSW A;  3CMM B;  2Y8F A;  3PEG A;  3FEH A;  3OG5 A;  1E90 A;  1BML C;  2EJ8 A;  1N63 A;  3H7S A;  1RYJ A;  1UPQ A;  2DAJ A;  2WP9 B;  3CSF A;  4KDL B;  1KOT A;  3KYD D;  3RZF A;  4OZA A;  1KJT A;  3VOQ A;  2NCN A;  4A9A A;  4F1S A;  3IG3 A;  3L54 A;  5GOW B;  4UDU C;  2AL6 A;  1ACA A;  1STE A;  3N20 C;  4WWN A;  2KX0 A;  4LCD E;  2DN6 A;  2NS5 A;  4KSL C;  2WGS A;  4IOI E;  1TKY A;  1Y56 A;  4K3C A;  4EZK A;  3HSA A;  2R0D A;  4HAV B;  4RH6 A;  3Q3M C;  4FLH A;  2O6V B;  4GXB A;  2Y5P A;  5KHO A;  3N1Y C;  4Z2N A;  3WCQ A; 
#chains in the Genus database with same CATH homology
 4NAW A;  1SIF A;  3FLV A;  3IFW B;  2DZM A;  3N3K B;  1DYN A;  2FAZ A;  3DDC B;  1TQZ A;  3AU4 A;  2ROV A;  2DYO A;  3RUL A;  3K9P B;  3H7P A;  4JKA A;  5LOP B;  4HLE A;  2G45 B;  4NJ7 A;  2QKL A;  1CMX B;  2BYE A;  1SHC A;  2LXA A;  4II2 B;  2L7R A;  3NS8 A;  2HRJ A;  5D7G A;  5L81 A;  2LUE A;  2N9X A;  3KW5 B;  4K7W A;  2J0K A;  2W2W A;  1S3S G;  5JLJ B;  3ODO A;  2WDT B;  3PVU A;  3P6A A;  3D8E A;  2CQU A;  1MKE A;  2OJR A;  2XEW A;  3TL5 A;  4HJK A;  4GZU A;  2L8J A;  2BYF A;  2C5L C;  4XX5 A;  4JK9 A;  5HKH A;  2N4F A;  4WJ7 A;  1WR1 A;  4F7G A;  1I35 A;  4ANU A;  4NJ6 A;  1X11 A;  3PS6 A;  3RCZ A;  4FN2 A;  1GC7 A;  2K8H A;  2R2Q A;  2ZNV B;  1BAK A;  3L08 A;  2DFK A;  2W2X D;  3SUZ A;  2WYQ A;  4JKC A;  3IHP C;  4PS8 A;  2LGX A;  1FHO A;  4HAW B;  4G3X B;  2K39 A;  4DHZ E;  2KQS A;  1RFA A;  4MY6 A;  2BGF A;  1E7V A;  4EZL A;  1R4M I;  1RLF A;  1EF5 A;  2GBM A;  1WGH A;  5E6N A;  2LZ6 A;  3L17 A;  4KSK C;  3AXC A;  3KUD B;  2L2I A;  1XD4 A;  3TFM A;  3ZDT A;  2N7E A;  1NU2 A;  2YVC A;  2DEN B;  4TYZ A;  4DHZ B;  3DCG A;  3EEC A;  1WM3 A;  2LVO A;  3M62 B;  2K25 A;  4ICU A;  2GBJ A;  1YQB A;  3Q3F A;  1TBE A;  5J3Q A;  3EC8 A;  4EFO A;  3NOB A;  2IY1 B;  2AWT A;  2DKQ A;  2DZJ A;  2NPT B;  1NBF C;  3L13 A;  2FJ9 A;  1RRB A;  3OLM D;  5DI9 B;  1M7E A;  3UIP B;  2BF8 B;  4WJN A;  3VAW A;  3ZVV A;  3W1S C;  1WFY A;  2Y7B A;  1YX6 B;  1V5U A;  2L05 A;  2A5U A;  3HK0 A;  4JL9 A;  1YD8 U;  2JUO A;  3VFK A;  3BY4 B;  3UQA A;  5EFX A;  4LJO B;  3DBH I;  5JHA A;  4BVU C;  2RLO A;  1WX7 A;  4TUU A;  3KRW A;  3V61 A;  3A8P A;  3E9O A;  2BKF A;  1ZM0 A;  2K6Q A;  2N23 A;  3X23 A;  2FCQ A;  4HAZ B;  4JLC A;  3ENB A;  2A4Z A;  4KAX B;  5J3Y A;  2ASQ A;  2LRU A;  4AP4 C;  2MBB B;  2DLW A;  4XZ4 A;  3SHQ A;  1YIW A;  2KTR A;  4W9F A;  4JKG B;  2C9W B;  1WGD A;  4MDK E;  4CHK A;  4KV2 A;  3TIX A;  5CLQ B;  1FOE A;  1M7R A;  1E8W A;  1TJ6 A;  5KQ4 A;  4IFS A;  1OQY A;  2L0F A;  3VQI A;  3O65 B;  2CU1 A;  2I5C A;  3VH4 B;  1NTY A;  1MK7 B;  2JWZ A;  2V1Y A;  4D0N B;  4Y94 A;  4OVV A;  3X0W A;  4GDL B;  2RR9 A;  1BWN A;  1UGM A;  5KCV A;  1XKE A;  1NTI A;  2M38 A;  5JVL A;  3PP2 A;  4PYU A;  2AYO B;  5DPS A;  4X57 B;  1FGZ A;  2YS5 A;  4WVF B;  2DA0 A;  2PEA A;  3L0W B;  3KUC B;  1TTN A;  4RM8 A;  1ZC3 B;  2L3Z A;  1QC6 A;  3D32 A;  2WX0 A;  1EVH A;  4CHJ A;  3L10 B;  1V88 A;  2ZNV C;  3M63 B;  5L95 C;  3ZTD A;  2P0F A;  3A1Q A;  3KRX A;  2RSG A;  2KAN A;  3RYT A;  3KVF B;  2D2Q A;  2YS1 A;  2V4L A;  2LI5 A;  1V5P A;  1IYF A;  3ULC A;  3FSS A;  2KJ6 A;  1WMH A;  2N9P C;  2W9N A;  2PE9 A;  2HJ8 A;  2LGD A;  4NNJ B;  2NVU I;  4IWP A;  4DHJ D;  1VD2 A;  3PHX B;  2COF A;  1XR0 B;  3CXB B;  5JHG A;  1KBL A;  2YLM A;  4G50 A;  3QJZ A;  1J0W A;  2K8B A;  3ZLZ A;  2KFK B;  4HDQ A;  2RQ1 A;  1XX0 A;  3E9L A;  2IYD B;  3ULB A;  2CHW A;  5EDS A;  2Z0P A;  1B55 A;  1I7A A;  2BWE S;  3SDL C;  3W1S A;  2LAS A;  2M8S A;  1WGY A;  2KMC A;  1W1H A;  2MSE D;  3E9P A;  1WXA A;  4W9I A;  1RJ2 A;  4GDK B;  2JF5 A;  5E6P A;  5BO4 B;  2VSZ A;  1P3R A;  1UEF A;  4DXA B;  1U5F A;  5JZE B;  2BKR B;  3CF6 E;  2DX5 B;  3SBG A;  1S1Q B;  4FBJ B;  2OTX A;  4K1R B;  4B9K A;  2L0T A;  1V89 A;  2DZK A;  1A5R A;  4WAA A;  5C79 A;  3W1Y A;  1J19 A;  4FJY A;  2K2U A;  3RD2 A;  2FCN A;  4NPN A;  5J2R A;  2Q13 A;  1K8R B;  3U8Z A;  1LFD A;  2DYM A;  2JPH A;  1C3T A;  2D07 B;  1PQS A;  2KDE B;  3A9K B;  1ZVR A;  1WGR A;  2IY0 B;  2V3S A;  4AJW A;  4NSW A;  2KXJ A;  1MIZ B;  2MCN B;  3HQC A;  2MKR A;  3A9J B;  3QQ8 B;  5CX3 A;  1UNP A;  3R7R A;  4DK5 A;  3GOE A;  1NDD A;  3BJI A;  2P8V A;  4NQK E;  5AZH A;  2EMS A;  1P0R A;  2ZJD A;  2UZS A;  1U4A A;  1Q5W B;  1TZ1 A;  3QHT A;  2FDQ A;  3HM6 X;  4BBN C;  2AL3 A;  2MWS B;  3TJP A;  4HPL B;  4MEL A;  2NR2 A;  2Z0E B;  2I1K A;  2FID A;  2R82 A;  1OMW A;  4J6I A;  1GC6 A;  3ML4 A;  3R66 C;  1AAR A;  3VTV A;  4IM0 A;  4BFR A;  4M8N A;  4URK A;  5LLI A;  4CHM A;  1WXM A;  1FHW A;  2VRW B;  1SGH A;  3VHT C;  4HCP B;  3T8M A;  3TCA A;  3DVN U;  4A6F A;  2FNJ B;  2O2V A;  2KMA A;  4OVU A;  3PTF C;  1GGO A;  4NQL B;  2RNR B;  3DVG X;  4WQO B;  3ZVR A;  1RRP B;  4W9H A;  5C5B B;  2ZCB A;  3M3J A;  3DXE A;  1FHX A;  1GUA B;  2L1C A;  1V49 A;  3HHM A;  2LKO A;  2KNB A;  2COP A;  4IOY X;  3ZO5 B;  2HD5 B;  4WJO A;  4F7H A;  4KZ0 A;  3SD5 A;  1DBH A;  5CHW A;  4MH0 E;  3TBL D;  1E8Y A;  3U30 A;  1KLV A;  1XOD A;  2XBB C;  2KKC A;  3A33 B;  4ZRJ A;  2YSZ A;  3ZNH B;  3KY9 A;  5DPR A;  1N3H A;  2DX1 A;  1M94 A;  5D6J B;  4F7Z A;  2Z59 B;  4HCN B;  3ZKJ C;  3QAR A;  4EJN A;  2PJH A;  4DX9 0;  4HAT B;  1KI1 B;  4CYE A;  4KIK A;  4WWO A;  1P98 A;  2VRR B;  2YS3 A;  4IW0 A;  3H1U A;  4DX8 A;  3DBL I;  2K00 A;  4B6H A;  1WM2 A;  3OAN A;  1I42 A;  1PFJ A;  3JVZ X;  1EF1 A;  1UEL A;  4EUT A;  1WR6 E;  2LJ5 A;  3TMP B;  1U5G A;  4FJV B;  1P6S A;  1AWE A;  1TGZ B;  4W9E A;  2KQ7 A;  5G55 A;  2JRH A;  1Z87 A;  2FCM A;  5J18 A;  3SBT A;  4NAW B;  3WA0 A;  1YJ1 A;  2COC A;  3V62 A;  2M17 A;  3AUL A;  2JZ3 B;  4HXD A;  1V9J A;  2NPT A;  2LVP A;  3EHV A;  4G11 A;  3RCP A;  1MK9 B;  3H7P B;  5J3T A;  1U2B A;  1C1Y B;  2Y5B B;  4K81 A;  4F8C B;  3S2A A;  3PSC A;  4HAX B;  3QK0 A;  2PPH A;  2MX2 A;  4WWP A;  4JKB A;  2CAY A;  5AZF A;  1ISN A;  5DIF B;  1WE6 A;  2LBB A;  1Z2M A;  4WJP A;  1W1D A;  1UZX B;  2MA9 B;  3UF8 A;  4JGH B;  2IO0 B;  1Z5S B;  2IO2 B;  5L83 A;  2KJH B;  4ZRI A;  3TO1 A;  1WGG A;  2J7Q B;  3UQB A;  1DIK A;  2O6V D;  3SU8 X;  2MP2 B;  3PZD A;  3DVN V;  2DKP A;  1VCB A;  4K7U A;  3ALB A;  5KQ1 A;  1QZE A;  2QKM A;  2KC2 A;  1V2Y A;  5CHF A;  2BCJ A;  2QHO A;  1WJ6 A;  4DDG D;  3UIO B;  2UVM A;  2C7M B;  2DHK A;  4JK7 A;  1XT9 B;  4JKG A;  4KHO A;  2DHZ A;  2BYV E;  2GCL A;  2KO3 A;  4PS3 A;  1EO6 A;  5IAA C;  4B95 A;  3TVV A;  4HB2 B;  2Y8G A;  1FGY A;  5JHB A;  2C7H A;  1JDE A;  2KWV B;  2PZ1 A;  2MFQ A;  4N9F 4;  2N1W A;  3NZU A;  1P1A A;  5C1Z A;  2KN5 A;  2MBH A;  4GDL A;  1WI1 A;  3MDB C;  2LD9 A;  2DTC A;  1OGW A;  2MLB A;  1WGU A;  2HTH B;  3QIJ A;  1IPG A;  2G3Q B;  1P9D U;  5KHQ A;  2DYB A;  2NBW B;  4HAY B;  1WJN A;  2DAF A;  4PS7 A;  2MWN B;  4MM3 A;  4IWO A;  1GNU A;  4GU2 A;  3PV1 A;  4ZRK A;  4FJZ A;  4GIV A;  1F9J A;  2L76 A;  3JSV A;  1DDM A;  3MHS D;  3NSU A;  4TQ0 A;  5JH5 C;  1Y8R C;  4WJQ A;  1MIX A;  3RT3 B;  1WX8 A;  1WZ0 A;  3KYC D;  3V60 A;  4LDT B;  5IJM A;  2KWU B;  2N7D A;  3H6N A;  2GCJ A;  4MGY E;  2KZR A;  1E5W A;  4GMV A;  1X05 A;  2JXX A;  4MJS B;  1HE8 A;  3PRZ A;  3K9O B;  1OY2 A;  4FUL A;  2CR5 A;  4BOZ B;  1IP9 A;  4BKS D;  2KHW B;  5LON B;  1E8X A;  1UBI A;  1UNQ A;  5JHH A;  3V5W A;  4HB4 B;  4IM2 A;  2DZI A;  2NBV B;  3UIN B;  3B1L X;  2M14 A;  4M0W B;  1X86 A;  2L00 B;  2RUK B;  3AI5 A;  5G2N A;  1RAX A;  1FXT B;  4ANV A;  3VH3 B;  1MPH A;  3OAW A;  4DWF A;  5GMV A;  3NHE B;  2D9X A;  4KZC A;  2ABD A;  4JKE A;  2MQJ A;  4MGI E;  3OJ4 B;  1MAI A;  4PYZ A;  3CST A;  3ZRF A;  1SE9 A;  2RVB B;  2G35 A;  4FHJ A;  1GJZ A;  3HIZ A;  3T9L A;  2CRF A;  2GBR A;  3BIN A;  3A98 B;  4XC2 A;  3KSY A;  4IM3 A;  1UBQ A;  2C60 A;  1WJ4 A;  3I3T B;  3QC8 B;  2C7N B;  4JK8 A;  2ZPY A;  2MBE A;  1XD3 B;  3KZ1 A;  1BTN A;  2KGX B;  2UWQ A;  4HAU B;  1OEY J;  3DVG Y;  1WG7 A;  1D3Z A;  4BKT A;  2D3G A;  3SNH A;  1PMS A;  3ZW3 A;  1W1G A;  4BBN F;  1AQC A;  2D4Q A;  4AJY B;  4A6K A;  2ZZP B;  1I2H A;  3V6E B;  4L6E A;  1V86 A;  5DPW A;  2ZEQ A;  4I6N B;  2LOZ A;  3WAO A;  1P3Q U;  1ZKH A;  4W9L A;  3Q3J A;  4EEW A;  3MTN B;  3ZNZ B;  1XQQ A;  3M1I B;  4BOS C;  3D8F A;  3UZT A;  2R2O A;  3PRE A;  2DYQ A;  1Q67 A;  5HE2 A;  3ML9 A;  1WMH B;  4M8M A;  4Z2M B;  5D3W A;  3PGE A;  2M4N A;  2CKH B;  4HHV A;  2MBQ A;  3HM3 A;  3GYO A;  4ZYN A;  2FUH B;  1K5G B;  4K2P A;  4HB0 B;  2O6V A;  1LM8 B;  4MEM A;  5D3X A;  1ZGU B;  2G4S A;  2KDB A;  2LXC A;  4EKU A;  2X0S A;  5AEK B;  4MK0 A;  3NZS A;  4K7S A;  2HE7 A;  4I6L B;  2D9V A;  4JIO U;  4MGZ E;  3QX1 A;  2J0J A;  2RD0 A;  2N0Y A;  2LWP A;  4GB9 A;  1UH6 A;  1Y19 B;  3H9D A;  4ANW A;  5C16 A;  3SV1 A;  2KX3 A;  5FR6 A;  4E71 A;  3WAN A;  2IBI B;  3DXD A;  3T06 A;  3DOW A;  2MDX A;  2H7E A;  2YRY A;  1WI0 A;  2N1V A;  2WWZ A;  1LXD A;  2LG1 A;  5D27 A;  2REX A;  5JP4 A;  1LQB A;  4EOY A;  1HBK A;  3ZUN A;  2N9E B;  1H4R A;  3V6C B;  1E8Z A;  2D9Z A;  3PLU A;  4C0A A;  3PHW B;  2DHI A;  2YF0 A;  2BPS A;  5LXI B;  4EZJ A;  2YT1 A;  3A4R A;  1U27 A;  2XK5 B;  4I6P A;  1H10 A;  1WJ1 A;  2JT4 B;  4A5K A;  5C23 A;  1X1M A;  3PT2 B;  5AZG A;  4W9D A;  3U7D A;  5C6R A;  1X1F A;  4BBK A;  3PPA A;  5CTR C;  3KUZ A;  2M0X A;  3PRP B;  2GJY A;  2KCJ A;  2EKE C;  5FI1 A;  4A20 A;  3PRM B;  3N30 A;  4B6W A;  3GZN I;  3ENE A;  1X1G A;  2IFS A;  1Q0W B;  2CY4 A;  2CHZ A;  2KFJ A;  2D9Y A;  1ST7 A;  4GMX B;  4PNK A;  2LYD A;  3VUX A;  1P5T A;  4HVB A;  1J8C A;  1U5D A;  4EMO A;  2GBN A;  1V5M A;  4JKH A;  1U5E A;  3PSE B;  3A4S C;  4BKG A;  4FA6 A;  4GPT B;  2KDF B;  1VBH A;  4GOC A;  2CS4 A;  1FB8 A;  2KWC A;  5CLL B;  2RGF A;  4BKS A;  4E3C A;  2NMB A;  5HE1 A;  2KD0 A;  3B08 A;  4A6F B;  3QWZ B;  2O2V B;  1UPR A;  3N7C A;  2IZV B;  3G9W A;  2B3A A;  1T0Y A;  2AEH A;  2KTF A;  2MP2 A;  3APF A;  3LJU X;  4W9C A;  3FP5 A;  5LXH A;  3JW0 X;  3DBR I;  4FHK A;  2GMI C;  5J17 A;  4HK2 A;  2LVQ A;  3QA8 A;  3WAL A;  4W9J A;  2M1M A;  1WIA A;  4HPM B;  3R3M A;  1NI2 A;  2I5F A;  4YL8 A;  4H8S A;  3QWM A;  2RGN B;  3NY5 A;  2Z0D B;  3PLV A;  3AJ4 A;  3WIM A;  2LUL A;  2IYB A;  4KIK B;  4DBB A;  3DQV A;  1WY8 A;  2ZVO A;  3LJ3 A;  1L2N A;  2DHJ A;  1JRU A;  1WH3 A;  5IA7 A;  1NVL A;  2ELA A;  2JVC A;  3ONS A;  2KLG A;  1KC7 A;  1LB1 A;  2HTH A;  2J0M A;  4ILH A;  2BWF A;  4K17 A;  4MSM B;  5D94 A;  4IWQ A;  2P0H A;  2LRW A;  1G6J A;  4KHB B;  2KDI A;  5DPT A;  1OEY A;  1WXV A;  4RM9 A;  2KJR A;  4AWJ A;  3UGB B;  5DH9 B;  3E66 A;  5D2M B;  3O96 A;  2W2X C;  5D3Y A;  4A6H A;  4JKD A;  2KC1 A;  1ZC4 B;  2YT0 A;  5D3V A;  2IO3 B;  1TXD A;  1K5D B;  2KOX A;  2CHX A;  2JY6 A;  3VIA A;  2EMT A;  1XCG A;  4ASW C;  1V6E A;  5TR5 A;  4E74 A;  2G4D B;  4ILJ A;  2J59 M;  3IVF A;  1MG8 A;  3ML8 A;  4KDI C;  4MJS A;  2OQB A;  4DHJ B;  4ANX A;  1J0G A;  4W9K A;  4WSF A;  2COA A;  1KM7 A;  2WH5 A;  3VTU A;  2XQN M;  1R4N I;  3ZTC A;  4GN1 A;  1WJM A;  1V5O A;  3N32 A;  1WGQ A;  2FJL A;  1HB8 A;  2OOB B;  4MGK E;  4HWI B;  1WVH A;  2ELB A;  4IC7 B;  2CY5 A;  2COD A;  4A3O A;  4II3 B;  3C0R B;  2NBU A;  1WZ3 A;  3OJ3 A;  4K2O A;  2LGY A;  3ODW A;  4NY0 A;  1WXS A;  3QAQ A;  5E6O A;  1UD7 A;  1EAZ A;  3ZIM A;  1WE7 A;  1KZG A;  1U29 A;  1FAO A;  2LOX A;  4TQ1 A;  3VTW A;  3WAP A;  5FI0 A;  2JRI B;  4RMA A;  4TV3 A;  1UNR A;  1VBG A;  2K6D B;  2KFK A;  4KHA A;  3RZW C;  3LDZ E;  1QQG A;  3P2B A;  2MRP A;  1DDW A;  3KH0 A;  1H8C A;  3F5R A;  2JP2 A;  4LJP B;  1GG3 A;  3B0A A;  4IUM B;  4IG7 B;  1DDV A;  5DCN A;  1PLS A;  4GDK A;  2FCS A;  3CIK A;  2KTR B;  1EUV B;  2UZR A;  4P7I A;  2RPQ A;  3MPX A;  3JSV B;  4JQW C;  2WX1 A;  1Y5O A;  2DX5 A;  3SYX A;  2P0D A;  4CO7 A;  4DDI D;  3QBV B;  1HB6 A;  4ZDV A;  2I1J A;  3EPY A;  4ILG B;  5CHV C;  2IO1 B;  2KVR A;  1WYW B;  1E7U A;  3QCA A;  3F0W A;  3ZNI D;  3GYP A;  2NZ8 B;  1OTR B;  3VVW B;  3P7Z A;  1WX9 A;  4TKN A;  4DBG A;  3WAM A;  3WYF B;  3A9K A;  2KLC A;  3HW2 B;  1YX5 B;  3IBE A;  3VXW A;  4HDO A;  1ZW7 A;  4YON A;  3A9J A;  1WF9 A;  1V80 A;  1WJU A;  2H7D A;  3PVL A;  2DIK A;  2GBK A;  3DPD A;  2K2J A;  2PE6 B;  2Z0Q A;  4FAD A;  3ECI A;  3DBS A;  3JYU A;  4F7U P;  3A1Q B;  3RUI B;  2D11 A;  3ODX A;  3L16 A;  2MBO A;  4AUQ C;  2UYZ B;  4ICV A;  1L7Y A;  1NTV A;  3A8Q A;  2KUP A;  2ZPN A;  2K1F A;  1BT0 A;  2RSU A;  4AOF A;  4LDT D;  4HB3 B;  2GOW A;  2ZVN A;  4MT7 A;  3EFU A;  4W9G A;  2EC1 A;  3DXC A;  2D9W A;  2ZCC A;  4PQ0 A;  4JKF A;  3ZRC A;  2ROZ B;  3VDZ A;  3FM8 C;  1WRD B;  2XK5 A;  1V5T A;  2MW5 A;  2GS0 A;  2ADZ A;  2CB8 A;  5HE0 A;  3ZNG C;  3APC A;  3APD A;  5C5B A;  3D8D A;  2R09 A;  2K8C A;  1KZ7 A;  3R7Q A;  3PG7 A;  1V81 A;  4GGQ A;  1BTK A;  4A3P A;  3PVW A;  4KVG B;  2X18 A;  3MJW A;  5DHF B;  5HE3 A;  4G0N B;  1EGX A;  3M95 A;  2VKI A;  4IAP A;  2E2X A;  3AU5 A;  2Z0O A;  2DYN A;  3VUW A;  1DRO A;  4XWX A;  2D10 A;  1ZSQ A;  2JZZ A;  3TW1 A;  2V76 A;  1Q1O A;  2KK8 A;  5DHA B;  2FIF A;  3VUY A;  1LW3 A;  1OQN A;  3SO6 A;  3ZDM C;  4MSQ B;  1V61 A;  1IRS A;  4GSW A;  3CMM B;  2Y8F A;  3PEG A;  3FEH A;  1E90 A;  2EJ8 A;  3H7S A;  1UPQ A;  2DAJ A;  3CSF A;  4KDL B;  1KOT A;  3KYD D;  3RZF A;  1KJT A;  3VOQ A;  2NCN A;  4F1S A;  3IG3 A;  3L54 A;  5GOW B;  2AL6 A;  1ACA A;  4WWN A;  2KX0 A;  4LCD E;  2DN6 A;  2NS5 A;  4KSL C;  4EZK A;  2R0D A;  4HAV B;  4FLH A;  2O6V B;  4GXB A;  5KHO A;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...