4TKNA

Structure of the snx17 ferm domain bound to the second npxf motif of krit1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
256
Chain Sequence
PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
molecule keywords Sorting nexin-17
total genus 77
structure length 256
sequence length 276
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4tknA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tknA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4tknA01
1FGYA 2DFKA 2KTRB 3VFKA 2KNBA 4OVVA 2N7EA 4HAXB 2WX1A 2Q13A 2ZVOA 3NZSA 3DVNU 4M0WB 1NI2A 3U8ZA 1RLFA 1WMHA 2JVCA 1DBHA 3PVUA 3VDZA 3KYDD 1FOEA 4HDQA 2W9NA 3M95A 4KHAA 2RNRB 2FIFA 3L0WB 2KC2A 1V5OA 3O65B 3DCGA 3KW5B 2DYQA 2QKMA 4MK0A 3TO1A 2FUHB 4JLCA 3VUWA 5J3TA 4WQOB 2FNJB 3T9LA 3DXCA 1AWEA 2WYQA 3Q3FA 2KHWB 4K7WA 4W9LA 4WJNA 4IWPA 1PQSA 4MGKE 4B9KA 4HB4B 5HE3A 5EDSA 1P9DU 1C1YB 2EMSA 2R2OA 4G3XB 4WJOA 2ELAA 2J0KA 4KDIC 2COAA 1L7YA 1V6EA 1MIZB 5HKHA 3EECA 5JZEB 1WJNA 4FLHA 2BCJA 4NY0A 4ZRIA 1H10A 1P0RA 2ZPNA 4TUUA 4AJWA 3WAMA 2QKLA 4NJ7A 3ZDMC 1BAKA 1QC6A 2L0FA 2MBBB 1BTNA 1GC7A 4AP4C 1GNUA 3JW0X 4F7UP 4PS3A 2YS5A 1JRUA 2L76A 4A6KA 2IFSA 5HE0A 2DYOA 2KOXA 4GOCA 4I6PA 1V5UA 1B55A 1WX8A 3PHXB 4CHMA 1QZEA 2MP2B 5JP4A 3QWMA 5KCVA 1X1GA 1WH3A 4ICUA 2YS1A 4GDKB 2KLCA 4NNJB 4F7ZA 3N7CA 4IWOA 4I6LB 2REXA 3WA0A 1R4NI 1WGGA 1WZ3A 2DX5B 1KZ7A 2K8CA 3DBLI 3DBRI 3PGEA 1X1MA 3L17A 5CHFA 4GMVA 3LJ3A 4GU2A 4DWFA 2D9XA 1V88A 2YT1A 3AJ4A 3PSEB 5LXHA 2CODA 2V1YA 4L6EA 3V5WA 3AI5A 2VRWB 5D27A 2BKFA 2MX2A 3EC8A 2YRYA 2L05A 2MQJA 4MM3A 4KHOA 2KN5A 3A8QA 3FEHA 2NMBA 4F7GA 4ZRKA 3I3TB 1BWNA 5D94A 2D07B 4PYUA 2Z59B 1WVHA 3JYUA 3JVZX 4TYZA 5D3XA 4FJZA 3UQBA 1IP9A 1MPHA 1Q5WB 3PRMB 2LJ5A 2DHJA 5KQ4A 4GDLA 1CMXB 2LVOA 5CTRC 1U29A 4M8MA 1E8YA 4GSWA 2L2IA 3DBSA 2NPTB 3IFWB 3IHPC 3HHMA 3N32A 2O2VA 1DDVA 2RUKB 4FBJB 2G35A 3ZVRA 5D3VA 1E7VA 4IAPA 4MGZE 2FIDA 1L2NA 1KI1B 2EMTA 3PP2A 1Z2MA 2LZ6A 4K7UA 2HD5B 1AARA 2DTCA 1EGXA 4MEMA 2G4DB 3UINB 4BKTA 3DXEA 2DKPA 2K1FA 4IG7B 4Y94A 4KSLC 4NQKE 5DHAB 3SU8X 4HCPB 1NTVA 1WXVA 2CHWA 2BGFA 4DX90 3GYPA 2L1CA 2MBEA 1W1HA 4M8NA 2KVRA 3PRPB 5L81A 2X18A 3MJWA 3QARA 3RT3B 1M94A 4W9IA 1TJ6A 2LASA 2V4LA 2Y8GA 1RRBA 5DIFB 1P5TA 2IO3B 2GMIC 2JRHA 3DQVA 3NS8A 4B95A 3RYTA 3KRWA 3SV1A 2JXXA 3ULCA 5C5BA 4RMAA 5D7GA 2MLBA 3TBLD 4HAZB 1Q1OA 1I42A 1RAXA 1Q67A 4URKA 2VKIA 4Z2NA 1WYWB 4C0AA 1V5PA 1X11A 2N1VA 3L10B 4W9JA 3D8FA 3DXDA 1NBFC 2N9PC 2LKOA 2I1JA 1WX7A 4WWPA 2OOBB 4A3OA 4G0NB 2MW5A 4D0NB 2BYVE 3MTNB 1WI1A 2VSZA 5J2RA 2KQ7A 5G55A 1LW3A 1P98A 3QJZA 2XQNM 1WGQA 2G4SA 3ZW3A 1SHCA 2M1MA 2LWPA 2Y8FA 5C79A 1K5DB 3RCPA 1V49A 2N23A 2KDEB 2LGXA 2KGXB 3GZNI 1LB1A 1WJ4A 1EO6A 3SNHA 2BYEA 2IBIB 3OANA 3MHSD 3QK0A 3R7RA 2C7NB 2R2QA 2L00B 3UIPB 3PVLA 3ZO5B 1XKEA 2Z0EB 5D6JB 4B6HA 3ULBA 2IY0B 2OQBA 1H4RA 2Z0PA 3FM8C 5EFXA 2CY5A 5DI9B 4GGQA 4HXDA 3W1YA 2LG1A 2EJ8A 2LVQA 3B0AA 3W1SA 1WM2A 2P0DA 4BBKA 1WGDA 3VOQA 2W2XD 1UPRA 1WZ0A 2NZ8B 4WSFA 5JHHA 4DXAB 1OQYA 3B1LX 5GOWB 2BF8B 2KFJA 4W9DA 2YF0A 2LULA 2K2JA 1E7UA 4DHZB 3ODOA 3ENEA 3VIAA 3KYCD 1N3HA 1U5EA 2BKRB 1Z5SB 2KKCA 3TIXA 1ZKHA 3BINA 4HB3B 2KK8A 1C3TA 1ZM0A 3SYXA 2GBKA 3EHVA 3V60A 4BFRA 4IOYX 2NS5A 4F8CB 3NSUA 2DAJA 3O96A 5D3WA 1E90A 2DYBA 2LGYA 1YX6B 3ZTDA 4JQWC 2LOZA 4X57B 3LDZE 5E6PA 4IM0A 3PPAA 3QCAA 2DYNA 3F0WA 4MY6A 1OMWA 1X1FA 4DHZE 2DN6A 4MH0E 1ZC3B 2DA0A 1HE8A 1RFAA 2MFQA 5J3YA 3HM6X 4H8SA 5DPTA 2BPSA 3SDLC 2GBJA 4BKGA 2KD0A 4F1SA 5IA7A 4HATB 2IZVB 2D9YA 3IVFA 4PNKA 1RRPB 3A4RA 1W1GA 1DROA 3RZFA 4DK5A 1GJZA 2M38A 3TMPB 2KFKA 2UZSA 2BYFA 2DYMA 2KMAA 3CMMB 3OJ3A 3RULA 2I1KA 1YIWA 3W1SC 3VTVA 2FCNA 2ROZB 5AZHA 2J0JA 2JPHA 4HAVB 2ZEQA 4W9FA 2O6VA 4HHVA 1UNPA 2NVUI 1LFDA 1TTNA 3H7SA 3H9DA 3NY5A 1MK9B 2N9EB 4KDLB 4WWNA 3NZUA 3PLUA 4RM9A 3HW2B 3QBVB 4MT7A 4WWOA 2JY6A 3HM3A 3PHWB 3QWZB 1WJMA 2ZJDA 1G6JA 3TJPA 1MAIA 2MP2A 2OTXA 1EF5A 2KTRA 3M62B 4GIVA 1OEYA 3DPDA 4HPLB 1E5WA 3ZNID 3VUXA 2MWNB 1E8WA 2RR9A 4I6NB 2D11A 2XK5A 2DX1A 1WE6A 2GOWA 4II3B 1OEYJ 1NU2A 2O6VB 1PMSA 4MGYE 2K25A 1J8CA 2RSGA 4YL8A 5D3YA 5CLLB 4WAAA 2V76A 2K00A 1WGUA 3TW1A 3KY9A 2DZMA 1RJ2A 3ZIMA 2KUPA 3L54A 2KX3A 4MJSA 4OVUA 3TL5A 2J0MA 3T06A 3FSSA 1LXDA 2FCSA 4NAWA 3VXWA 5J18A 5JH5C 4K2OA 4XZ4A 1FHWA 2NBWB 3L16A 4FHKA 3ZDTA 2ZVNA 2ZPYA 3AXCA 3S2AA 1D3ZA 1OTRB 2KJRA 2P0FA 3PZDA 1WF9A 3A1QB 3UZTA 2KTFA 3A9JB 3CXBB 4FA6A 2W2XC 3PVWA 2DAFA 3CIKA 2LUEA 5KHOA 4CYEA 4EJNA 4RM8A 3A8PA 5FR6A 2N0YA 5GMVA 5TR5A 4KAXB 1MKEA 2RVBB 2LRWA 3ZLZA 2WDTB 1WMHB 3VHTC 4HCNB 2UWQA 4DBGA 1WXAA 2DZJA 4PS7A 2ROVA 2CAYA 2AYOB 3ALBA 3KRXA 2KANA 4LDTD 3A9JA 3QQ8B 3WIMA 1XCGA 2H7DA 4HPMB 2CKHB 2DENB 1V5TA 3CSTA 4W9KA 3UF8A 4DHJD 2PE6B 3OLMD 3ZRCA 4DBBA 3JSVB 5FI0A 1X86A 1P3QU 3AU4A 1KZGA 2JWZA 4W9EA 4ZYNA 5BO4B 2W2WA 3KUDB 4HK2A 4TQ1A 4PYZA 5AZGA 4II2B 2DHIA 2LOXA 1ZW7A 2CY4A 3SHQA 1I2HA 2C7HA 1ZC4B 1NTYA 2WWZA 1XT9B 3R3MA 4FN2A 1BTKA 3N30A 5CX3A 4J6IA 2MWSB 2Z0OA 2YS3A 1U27A 2LXCA 3QHTA 2GS0A 1ZGUB 2Y7BA 3A33B 1QQGA 4K81A 3A98B 4A3PA 2A4ZA 3X0WA 1WI0A 1UBQA 2K6QA 2XK5B 4K2PA 3KUCB 3ML8A 4KIKA 2KZRA 1YQBA 2JF5A 4HB0B 1FGZA 4Z2MB 4HAWB 3V6EB 4A5KA 1A5RA 3ML9A 3ML4A 4WJQA 4TKNA 4EEWA 3OJ4B 4AWJA 5DPWA 4K17A 5DH9B 3QX1A 4NQLB 3P7ZA 2FCQA 4PS8A 3H7PA 3VTWA 5FI1A 1XR0B 2P0HA 5IAAC 2ZCCA 1V61A 3PG7A 2K8HA 3RUIB 3HQCA 3N3KB 1P1AA 2IYBA 2PZ1A 2CS4A 1V5MA 1X05A 3P2BA 3KH0A 3QC8B 3V61A 4EUTA 3WAOA 3U7DA 2EC1A 1Y5OA 2MDXA 5LOPB 1KM7A 4ANWA 4ANXA 1OY2A 3V6CB 2I5FA 3APDA 4GB9A 3ZNGC 4NSWA 2D9WA 2L8JA 2PJHA 3VQIA 2WX0A 3K9OB 3GYOA 2KX0A 3UQAA 3CF6E 2LRUA 4TV3A 4N9F4 4GDKA 3ZUNA 2GBRA 5J17A 1V81A 1FHXA 2DHKA 1UD7A 1EUVB 2IYDB 4IC7B 3SUZA 5D2MB 2MBHA 5LONB 3MPXA 3ONSA 3L13A 5E6OA 2C5LC 2IO2B 3ZTCA 1F9JA 1BT0A 1NDDA 4ANUA 5L95C 3DOWA 2YSZA 4IUMB 3R7QA 1K5GB 3R66C 5LLIA 5JHAA 3HIZA 4E3CA 2HTHB 1R4MI 2LGDA 2OJRA 3SD5A 3PEGA 3H1UA 3KSYA 2VRRB 4AUQC 4BOSC 2M17A 4KIKB 2M4NA 1ZSQA 2CHXA 2FAZA 2GCJA 5CHWA 2D9VA 3KVFB 1EAZA 3PV1A 4GDLB 1WIAA 2KO3A 3DVGY 3WAPA 4W9GA 3WANA 2DZKA 2LD9A 4EZJA 1GUAB 4JGHB 2JUOA 3D32A 1J0GA 1P3RA 2M14A 3SO6A 2AL6A 5C6RA 3P6AA 3IG3A 1MK7B 3PTFC 2MRPA 3LJUX 4LJPB 2KLGA 4G50A 3ZNHB 3AU5A 2KDIA 3H6NA 3ZVVA 1ISNA 1KOTA 4MELA 4ASWC 2NCNA 4B6WA 2ZCBA 1OGWA 3QAQA 2GJYA 2JP2A 2KQSA 3M63B 4NPNA 3RD2A 2MCNB 3UGBB 3RCZA 3A9KA 4EKUA 1WG7A 4BOZB 2NPTA 1MG8A 1PFJA 1U5GA 4IW0A 1WM3A 3EFUA 3TCAA 3WALA 4JIOU 5HE1A 2RSUA 3A4SC 4HJKA 4FJYA 3IBEA 4EZLA 1WJUA 1M7EA 3APFA 2Z0DB 3VVWB 5JHBA 4KVGB 2GCLA 5DHFB 3TFMA 1YD8U 5CHVC 4BVUC 2M8SA 2HE7A 3NOBA 4PQ0A 4IM3A 2CHZA 1H8CA 5C5BB 1MIXA 2XBBC 5DPSA 5JHGA 3MDBC 2K39A 4CHKA 3X23A 1WGRA 2KJHB 3VTUA 4BBNF 2P8VA 1E8XA 4W9HA 5DCNA 4TQ0A 2N9XA 2R0DA 2MBOA 4A20A 4G11A 4JL9A 3HK0A 3PSCA 2IY1B 1UEFA 3G9WA 1Y19B 1TXDA 1WFYA 1T0YA 3B08A 4KV2A 4DX8A 3D8DA 5J3QA 2KJ6A 2KWCA 1U5DA 4P7IA 2RGFA 5E6NA 3M3JA 3VH3B 4HLEA 2AEHA 1S1QB 3WYFB 2YVCA 2LXAA 2ZZPB 3DVNV 2B3AA 3PLVA 2K8BA 2BWES 3PS6A 1EF1A 4IFSA 1E8ZA 1TGZB 1UELA 4FULA 2DLWA 5LXIB 1I35A 1M7RA 3PRZA 1AQCA 1I7AA 2ELBA 2BWFA 4FHJA 4KZCA 1S3SG 2G3QB 4NJ6A 2G45B 4LDTB 4EZKA 1WJ6A 2COCA 4HVBA 2NR2A 1FHOA 2L3ZA 1IPGA 2DZIA 3ZRFA 1V80A 4A6FB 4IM2A 1UNRA 5C16A 5C1ZA 2K2UA 2JZZA 3ZNZB 2FCMA 2C9WB 2JZ3B 2IO0B 3KZ1A 3BY4B 1VCBA 4IWQA 2D3GA 4LCDE 1UNQA 1XODA 1WRDB 3DVGX 4MJSB 4W9CA 1TQZA 5AZFA 3T8MA 3VAWA 3KUZA 4WJPA 4XWXA 4DDGD 1SIFA 3ODXA 4HDOA 1WE7A 5KHQA 2COFA 2J59M 1DDMA 2MSED 1LQBA 2RPQA 2XEWA 4BKSA 2D4QA 4BBNC 3U30A 4GMXB 4F7HA 1SE9A 1XD3B 3L08A 3UIOB 4ZRJA 2E2XA 3D8EA 4FJVB 4DHJB 2A5UA 2I5CA 2RD0A 1LM8B 2L7RA 2PE9A 1WXSA 2LI5A 4CHJA 2PEAA 3VH4B 4GZUA 2ASQA 4K7SA 3H7PB 1WY8A 2HJ8A 2O2VB 2EKEC 2O6VD 2V3SA 4MSQB 1KLVA 2KMCA 1YX5B 4HB2B 1V9JA 2HTHA 4ZDVA 1U2BA 2RLOA 1V89A 1WR6E 5JLJB 1XQQA 4HAUB 1TBEA 2KDFB 2KFKB 4CO7A 1XX0A 4A6HA 2J7QB 2K6DB 3ECIA 3M1IB 1P6SA 1PLSA 2JT4B 3A9KB 1GG3A 3NHEB 2QHOA 2NBUA 1UH6A 1TZ1A 2PPHA 1FXTB 1U5FA 4AJYB 4DDID 3F5RA 4E71A 1DDWA 5C23A 3BJIA 1FAOA 3APCA 4MSMB 5CLQB 1UGMA 4HAYB 1XD4A 4K1RB 4FADA 3QA8A 3DDCB 2N1WA 1J19A 3ZKJC 2CU1A 4GN1A 4KHBB 4NAWB 2NBVB 1Y8RC 2M0XA 3AULA 1WR1A 4EMOA 3CSFA 4ICVA 2AWTA 2RGNB 3ODWA 4E74A 4A6FA 2UZRA 5L83A 4YONA 1J0WA 2MBQA 4KZ0A 1WGHA 2ZNVB 3V62A 2D10A 3GOEA 1W1DA 5HE2A 2DHZA 1EVHA 2KWVB 2FJLA 2DKQA 3TVVA 5KQ1A 1WX9A 2N7DA 1YJ1A 2IO1B 2D2QA 1Q0WB 2GBMA 2LYDA 5G2NA 2H7EA 3QIJA 2ZNVC 3RZWC 1SGHA 1WXMA 3A1QA 1UBIA 2AL3A 1DYNA 3PT2B 2R09A 4LJOB 1Z87A 3PREA 2KWUB 2D9ZA 4WJ7A 2YT0A 4WVFB 1IYFA 2N4FA 3OAWA 4HWIB 4AOFA 1IRSA 1WJ1A 4XC2A 2UVMA 4XX5A 3C0RB 1U4AA 1KJTA 2KDBA 2CR5A 4GPTB 1GC6A 4KSKC 3VUYA 1V86A 4GXBA 1ZVRA 1FB8A 1V2YA 1UPQA 5DPRA 5AEKB 2CRFA 2JRIB 1UZXB 2LVPA 1VD2A 2Y5BB 2YLMA 1OQNA 3DBHI 2MKRA 2DX5A 2ADZA 2UYZB 2L0TA 2KC1A 2GBNA 2C7MB 3Q3JA 2KCJA 2Z0QA 4MDKE 4BKSD 4EFOA 1WGYA 3K9PB 2C60A 1K8RB 2KXJA 2MA9B 3JSVA 4MGIE 4ANVA 4EOYA
chains in the Genus database with same CATH superfamily
2DFKA 3NZSA 3H8HA 1RLFA 2JVCA 2KN4A 3PVUA 3M95A 2W9NA 3N1XC 1EU3A 1PGAA 2KC2A 3DCGA 1VJKA 3AEDB 3T9LA 3DXCA 2WYQA 1N61A 1PQSA 3HUIA 1P9DU 1C1YB 1ZDXA 4US8A 4L2YA 4WJOA 2J0KA 4KDIC 1L7YA 4FLHA 4NY0A 4TUUA 4AJWA 2QKLA 1QOFA 3ZDMC 2L0FA 2MBBB 1GC7A 4PS3A 4ILJA 2DYOA 4I6PA 1V5UA 1ZDVA 3PHXB 2WXJA 2GI9A 4ICUA 2FDQA 1AW7A 2K3UA 2WXRA 2Z59A 1FIQA 1LGRA 1R4NI 2DX5B 1WZ3A 3AE5B 2K8CA 3DBLI 4DXGA 3DBRI 3PGEA 2CJNA 2D9XA 1J7BA 4L6EA 5D27A 2L05A 2MQJA 4H2AA 3A8QA 3NUHB 2NMBA 5M4YB 3JYUA 5D3XA 1CQVA 1TZOA 4FJZA 3UQBA 1MPHA 2DHJA 5KQ4A 1U29A 4A9AA 2KAJA 3MHZA 2L2IA 3IFWB 1DDVA 1E7VA 2LZ6A 2KACA 2HD5B 1AARA 2G9HD 3UINB 4KSLC 2KVZA 4HCPB 2W3RA 2WXKA 2LBBA 4DX90 2J53A 3PRPB 2X18A 1M94A 4W9IA 2Y8GA 1RRBA 2JRHA 1T0SC 3DQVA 4B95A 4ZYSA 1MI0A 2X8XX 2K22A 3RYTA 2YEPB 3SV1A 4CQNA 5C5BA 1C4CA 1AWDA 4HAZB 1RAXA 1WYWB 3O13A 2HTME 2LKOA 2I1JA 4G0NB 1P98A 1L6UA 2XQNM 3ZW3A 1NVLA 2M1MA 2LWPA 1K5DB 2WQYB 3RCPA 2LGXA 1R4NB 3DBLB 3GZNI 1YMHE 4JKDA 2IBIB 1FFUA 1MG4A 3BIID 2C7NB 2M0AA 3UIPB 3PVLA 3ZO5B 3SR6A 2Z0EB 2IY0B 4XWTA 2BQQA 4HXDA 2LG1A 3B0AA 4TSSA 4BBKA 3CWIA 2IGHA 4ZHPA 5JHHA 4DXAB 3ZYYX 5FKAC 5GOWB 1AYFA 1OQRA 3BK2A 4JKHA 1I4HA 2K2JA 4DHZB 3I57A 3KYCD 2KKCA 1ZKHA 3SYXA 4F8CB 4XDCA 1E90A 4M02A 4L23A 1R4MB 3P63A 4IM0A 3PPAA 1R7SA 2J52A 1OMWA 1X1FA 3AE7B 1ZC3B 2MFQA 2LHEA 2GBJA 4F1SA 3EGRA 2RMMA 2IZVB 3SBGA 1GJZA 1HB8A 1N5XA 2KFKA 2PVGC 2DYMA 2I1KA 3VTVA 2FCNA 1J7AA 2WH5A 5EDSA 1XCTL 1NTIA 1TTNA 1MK9B 4KDLB 3E9SA 4RM9A 4WWOA 4MT7A 2MJDA 2JY6A 3RNBC 1SJED 2B76B 1BXTA 2OTXA 3Q3OC 4GIVA 3DPDA 2JX5A 1E8WA 2ZW1A 1FD6A 1J8CA 4N59A 2V76A 1SE2A 2ZKMX 2Z14A 1RJ2A 2KX3A 1QLBB 3S2AA 3AXCA 2KJRA 2KTFA 3MP9A 4ITKA 5KHOA 2QEJC 4EJNA 5FR6A 3Q3NC 4KAXB 4PK1A 2WDTB 4PS7A 3AM9A 2AYOB 2K0PA 4HPMB 4D6WA 2KIGA 1P3QU 3AU4A 1KZGA 5BO4B 4RH6A 1XF5L 3EFCA 1ZC4B 1L4DB 1V8CA 2W54A 1BTKA 3N30A 1FEHA 1U27A 4IDIA 1ZGUB 2Y7BA 3LXFA 1QQGA 3A98B 1E6EB 3ZJUA 1UBQA 2K6QA 3KUCB 2WXIA 3ML8A 1YQBA 2JF5A 2WXLA 4Z2MB 4EEWA 5DPWA 4AWJA 4K17A 4PS8A 2VZKD 2RPVA 1XR0B 1MVKA 3PG7A 1V1PA 1JRPA 1QOGA 3QC8B 3V61A 4EUTA 4ANXA 4ANWA 4JKFA 2I5FA 2E3TA 3UQAA 2MJEA 2LRUA 5BMGA 2PKOA 1YJJA 2GBRA 4RF1A 1V81A 5IJMA 2DIKA 4IC7B 2KR0A 2MBHA 2LHDA 3ONSA 3L13A 4NJCA 2WDQB 1BT0A 1NDDA 1C4PA 4ANUA 5LLIA 3R66C 2Z13A 3AN1A 2HTHB 2OJRA 3KSYA 2WXMA 4AUQC 3AB5A 2M17A 3Q14C 1E9MA 5G5HA 1QOBA 1GOZA 3PV1A 1FM0D 1WIAA 2KO3A 3WAPA 3WANA 2LD9A 1NYRA 1GUAB 4JGHB 3D32A 3SO6A 3P6AA 4ZOHC 2MRPA 3LJUX 2KLGA 4G50A 1DIKA 2KDIA 1ISNA 4MELA 2ZCBA 2JP2A 4AQ7A 3A9KA 1RM6C 1SEBD 1U5GA 3CIRB 4IW0A 2L32A 3TCAA 4OW0A 4JIOU 2RSUA 5BYRA 3WALA 4EZLA 1M7EA 1EM7A 4KVGB 5DHFB 3LYYA 2CHZA 5C5BB 1UGJA 2WDVB 2K39A 1T0RC 2ACZB 2K9XA 3VTUA 1TT5B 4TQ0A 4W9HA 5DCNA 2N9XA 2V4IB 2R0DA 2MBOA 4G11A 2IY1B 1TXDA 1T0YA 4KV2A 2W55A 3M3JA 3VH3B 4WIPA 4HLEA 3WYFB 2LXAA 1JWSD 3DVNV 1F52A 2K8BA 4IFSA 2DLWA 1AQCA 1S3SG 2JZPA 1FRRA 4LDTB 2COCA 1FHOA 4JX1C 1ZUD2 2JYTA 2RDBC 3R2TA 2JZZA 4HEA1 5I2SA 3KZ1A 4WWMA 1XODA 3UI3A 1NI3A 1YJIA 2COFA 1DDMA 2RPQA 1LQBA 4BKSA 4BBNC 3U30A 4RNAA 4DHJB 3L08A 2H89B 2A5UA 2RD0A 3EUB2 1WXSA 2LI5A 3ZXRA 5IN7A 1WY8A 2HJ8A 3DHHC 4XGAB 4Q2JA 1C76A 3AEGB 1V9JA 2HTHA 1U2BA 2RLOA 2XN9C 4WURA 1T5XD 1XQQA 1TBEA 3BWUD 1XX0A 2K6DB 2L1AA 1VZ6A 2DBYA 2BB6A 3A9KB 3NHEB 4YTNB 4JWUC 1U5FA 1DDWA 5C23A 4LNOA 5BMIA 3DDCB 4GLSC 1N5WA 3AH7A 1Y8RC 3EA6A 4GOUA 4ICVA 2G1EA 4A6FA 2UZRA 2JU6X 1J0WA 2MBQA 1HTQA 3MFGA 1W1DA 5HE2A 2FJLA 2D2QA 1Q0WB 4RGNA 2LYDA 3QIJA 3RZWC 1UBIA 2AL3A 2R09A 1YN4A 4LJOB 2YT0A 1IYFA 4HWIB 4MACA 1U4AA 2CR5A 3I63C 3AE9B 1B9RA 2LVPA 2CRFA 1UZXB 1L0YB 1VD2A 2Y5BB 2YLMA 3AE2B 2INDC 2WLBA 4MDKE 2KCJA 2Z0QA 3NWAA 1WGYA 2C60A 1K8RB 2KXJA 1YQ4B 3JSVA 1K52A 3K9PB 3KWVA 4ANVA 1WGKA 1KF6B 2KNBA 3IT6B 4HAXB 3VXWA 4M0WB 1NI2A 1KBLA 1FOEA 2PTLA 2FIFA 1V5OA 2MH7A 5GXGB 2DYQA 2QKMA 4O1NA 4DQOC 5J3TA 2FNJB 1YN5A 4K7WA 4B9KA 4IWPA 4MGKE 1HZ6A 4HB4B 4OVZA 2COAA 2LMCA 2BCJA 1P0RA 1FXAA 1QC6A 1BTNA 3FILA 2KOXA 4QJ4B 1B55A 1WX8A 2MP2B 5JP4A 1WH3A 4F7ZA 1PUTA 4I6LB 1KTKA 1KZ7A 1X1MA 3L17A 4GMVA 4DWFA 4GU2A 3PSEB 2YT1A 3AJ4A 4LNNA 4MM3B 2VRWB 3EC8A 3FEHA 1NEKB 4F7GA 1BWNA 4PYUA 2GLSA 1WVHA 5JXVA 2V0GA 2LJ5A 4GDLA 1YNTE 3DWGC 1SBBB 1HQRD 5CTRC 1IGCA 3IHPC 3DBSA 2NPTB 4P1CC 3BZDB 3N32A 2O2VA 4RGTA 2G35A 3ZVRA 5D3VA 4IAPA 4TQ1A 3PP2A 1EGXA 2K1FA 4IG7B 4Y94A 2WDRB 5DHAB 2BBCA 3B2FA 4NQKE 5HFYA 1WXVA 2CHWA 4YWGG 3GYPA 4M8NA 5G5GA 2KVRA 3RT3B 4OSNA 2V4LA 3I9V1 2BT6A 1FPYA 1UUPA 4YTMB 3KRWA 3ULCA 3ZJVA 1K53A 5D7GA 3TBLD 1Q67A 4URKA 2VKIA 1NYQA 4QJ5B 1YN3A 1V5PA 1X11A 2VH1A 4W9JA 3D8FA 1NBFC 2N9PC 1MJDA 4HKQA 5J2RA 1WI1A 5IOIA 2V3PA 4P6VF 1LW3A 4JE3B 5G55A 3QJZA 2G4SA 2L83A 1RWSA 1SHCA 4M01A 1V49A 2KDEB 4LNFA 1EO6A 2BYEA 3MHSD 3OANA 1GAQB 3QK0A 5D3DA 2L00B 2QMTA 1XKEA 4B6HA 2IGDA 2Z0PA 2CY5A 5DI9B 4KX6B 2EJ8A 1AN8A 2P0DA 4US9A 1WGDA 2W2XD 1UPRA 3TEZA 4JPSA 2NZ8B 2WU5B 2BF8B 4W9DA 4OZBA 2YF0A 1WXQA 1E7UA 3ODOA 2BKRB 1Z5SB 3BINA 4HB3B 2GBKA 4BFRA 2BS3B 1C9FA 3NSUA 2DAJA 2LGYA 2CU3A 4JQWC 2LOZA 4JWSC 2K5PA 3J9CA 4DHZE 2DN6A 4MH0E 4ZHOA 1HE8A 3BYYB 5EE9A 1SE4A 5J3YA 5DPTA 4H8SA 2KD0A 4HATB 1KFYB 2VH2A 3R8BA 1DROA 2M38A 3AEBB 3TMPB 2BYFA 3CMMB 1IGDA 3W1SC 1V1PB 4W9FA 2O6VA 4HHVA 3Q8EA 5MPOA 4WWNA 4P1BC 3NY5A 4P16A 2CQUA 3NZUA 4USAA 3HW2B 5HG2A 1G6JA 1L4ZB 2MP2A 3Q3MC 5EE0A 1XLOA 3ZNID 1WE6A 2GOWA 4II3B 2BS2B 4MGYE 2RSGA 2K00A 1MFWA 2DZMA 2M19A 4LLGM 2KUPA 4OVUA 3T06A 1LXDA 2FCSA 4NAWA 5JH5C 1FHWA 2NBWB 3ZDTA 2ZPYA 5IKCM 1D3ZA 3PZDA 2P0FA 3GZNB 1PGBA 1WF9A 1PGXA 4FA6A 2R82A 4LNKA 3GE3C 1L6VA 2QIEB 3A8PA 5GMVA 2N0YA 5I4DA 2HJ1A 3ZLZA 3TEYA 2DZJA 3A9JA 4JK8A 4JK9A 1XCGA 2N7JA 3P4PB 2FJ9A 2CKHB 4HKZE 4W9KA 3KLSX 3JSVB 4W9EA 4ZYNA 3FC4A 2CJOA 3KUDB 2HDEA 4II2B 1I2HA 2C7HA 2JYEA 2WWZA 1XT9B 4FN2A 1WWTA 2Z0OA 1XXGA 2MWSB 1CK1A 2Y5PA 2WXGA 3A33B 2A4ZA 1N63A 2RQ1A 4K2PA 1FGZA 4HAWB 2BVCA 2DLBA 4A5KA 3V6EB 1A5RA 2DNFA 3VR8B 4WJQA 4TKNA 3OJ4B 2MEKA 3H7PA 3VTWA 5FI1A 5IAAC 2ZCCA 1JROA 4HPPA 1DYQA 3SFEB 3HQCA 1SF0A 2IYBA 2PZ1A 2BYTA 1V5MA 1Y5OA 1KM7A 4GB9A 3ZNGC 4NSWA 2D9WA 3K9OB 1T6BX 2KX0A 3CF6E 4TV3A 1RFKA 4OHJA 1FHXA 2DHKA 2IYDB 3SUZA 4R3DA 5D2MB 3NVYA 1F9JA 4QJ3B 5L95C 2YSZA 2LGSA 4IUMB 1K5GB 5JVLA 4K3BA 4E3CA 3SD5A 2NMQA 4KIKB 1ZSQA 2CHXA 2FAZA 5CHWA 3BK1A 2D9VA 1EAZA 3DVGY 1I4PA 2JUOA 5C6RA 2M14A 3IG3A 1MK7B 3ZVVA 2NCNA 2KQSA 3M63B 2MCNB 1FNWA 4EKUA 2V3NA 2NPTA 3EFUA 1TS3A 4FJYA 3AE3B 4LK0M 3NW8A 1ZYIA 2GCLA 3URYA 5DPSA 5JHGA 4CHKA 4JL9A 1UEFA 1WFYA 3Q8AA 3B08A 3D8DA 5J3QA 2KWCA 1U5DA 4L1BA 2AEHA 1S1QB 3PLVA 2BWES 4FULA 4A90A 3PRZA 2ELBA 2BWFA 4KZCA 1ZP0B 2G3QB 1D4BA 1WJ6A 1SE3A 2L3ZA 2Z4DA 2BTEA 2X0SA 2FJUB 3ZRFA 1V80A 4A6FB 4IM2A 5C1ZA 1KRHA 3ZNZB 1B1ZA 2QC8A 2JZ3B 1VCBA 4N58A 2D3GA 1UNQA 3DVGX 4W9CA 1TQZA 3VAWA 3KUZA 4WJPA 4XWXA 5HHDG 1WE7A 2J59M 2MSED 3FVCA 2W3SA 2WXOA 2QCZA 4GMXB 2SAKA 3D8EA 2I5CA 1DOIA 1SB3C 1JWUD 1HB6A 4WH4A 3VH4B 4GZUA 3BVZA 4HROA 4JKGB 1ET6A 2Z8LA 1FFVA 4MSQB 1KLVA 3T3NA 3W5UB 4HAUB 2KFKB 4CO7A 2J7QB 4JKEA 1VDVA 2NBUA 1UH6A 2INPE 4E71A 5I2MA 3VRAB 3BJIA 3APCA 3Q2AC 4HAYB 4FADA 3QA8A 2N1WA 5EE1A 2YEPF 3ZKJC 4GN1A 4KHBB 2NBVB 1WR1A 1ZXHA 2AWTA 2RGNB 1TY2A 4YXDB 4JKCA 5L83A 1JCKB 3DHGC 1WX9A 1L0XB 1YJ1A 3OHMB 2DWQA 5G2NA 1FNVA 2ZNVC 1WXMA 3A1QA 2QJLA 4WVFB 3OAWA 1IRSA 4HSIA 2UVMA 1VZ8A 1L0VB 4PT5A 2OHFA 4GXBA 1FB8A 1V2YA 5AEKB 2JRIB 3ENBA 1JDEA 3HSAA 2QILA 1ACCA 2DX5A 2ADZA 1DGJA 2L0TA 2GBNA 2C7MB 1ACAA 2WU2B 4MGIE 4A6QA 4TMAB 2KTRB 3DVNU 1C4AA 4ARCA 4C4VA 1TY0A 3VRBB 3L0WB 2RNRB 3KW5B 4MK0A 3TO1A 2ON8A 4JLCA 2X38A 4WQOB 1AWEA 1XLNA 3Q3FA 2KHWB 4WJNA 3HRDD 1SSNA 4ZRPA 3ETRA 3NVWA 2PMVA 1V6EA 1MIZB 4BAXA 5JZEB 4L1RA 1H10A 4WQMA 2PW9A 3WAMA 4NJ7A 3B77A 1JALA 4S0RA 4AP4C 1GNUA 3GP7A 4F7UP 1JRUA 2L76A 4A6KA 2XNAC 5HE0A 4GOCA 1DOYA 1OQQA 1QZEA 5KCVA 3QWMA 4MT5A 1X1GA 2YS1A 4GDKB 2KLCA 4M0WA 3N7CA 1SXTA 4IWOA 2JQRB 2REXA 1N62A 5CHFA 1V88A 1QKZA 1C77A 2CODA 1ZXIA 4MM3A 4KHOA 2KN5A 4ZRKA 1FMAD 3I3TB 5D94A 3JVZX 3SBTA 4TYZA 1EWYC 1BMLC 1I4GA 1Q5WB 1K51A 2LVOA 3U2SC 3KQ4A 3HHMA 4YT0B 4JKBA 2RUKB 3BVGA 4RFBA 4MGZE 2FIDA 1KI1B 3FILB 4MEMA 2DTCA 4ILHA 3SU8X 3TEXA 2L1CA 2MBEA 1UF0A 3V05A 1QQRA 4S17A 1TJ6A 2LASA 2IO3B 5DIFB 1P5TA 2JWUA 2JXXA 4RMAA 2MLBA 3AE4B 3RMKC 1I42A 1Q10A 4C0AA 3FP5A 2N1VA 3DXDA 1WX7A 2AQ2B 2MHJA 4D0NB 2BYVE 3MTNB 2VSZA 2KQ7A 3L4PA 2Y8FA 2N23A 4EE2A 3R7RA 3SNHA 4QXAB 4RF0A 2R2QA 5TSSA 2D5GA 1I4XA 1QF6A 1H4RA 3FM8C 4GGQA 1JQ4A 2LVQA 2LJIA 3RNAC 3W1SA 1WM2A 4K3CA 4WSFA 1OQYA 3B1LX 2KFJA 1JW9D 2PIAA 4EZKA 3ENEA 1N3HA 1U5EA 3TIXA 1YOVB 1ZM0A 1N6ZA 3EHVA 3V60A 4IOYX 1WYGA 2DYBA 3O96A 3LDZE 2RDGA 3QCAA 2BS4B 4JKGA 1FCCC 2AQ3B 2KDMA 3HM6X 3SDLC 2BPSA 4BKGA 2ZW0A 1IBXB 3A4RA 2D9YA 4PNKA 1RRPB 4DK5A 2UZSA 4LTUA 3RULA 1ESFA 4C80A 1OFFA 3GE8C 2ROZB 5AZHA 2Q5WD 2ZEQA 2AQ1B 1KLGD 1UNPA 2NVUI 1LFDA 3H7SA 2N9EB 3Q6BA 3HM3A 2L52A 1WJMA 1EF5A 2KTRA 3M62B 1OEYA 1E5WA 3VUXA 2MWNB 2RR9A 2D11A 1OEYJ 2K25A 3NS1A 5CLLB 4WAAA 1WGUA 3P4QB 4MJSA 5J18A 3MC0B 2INCC 4K2OA 3HIEA 4FHKA 1OTRB 3A1QB 3DCXA 3UZTA 3VR9B 2R61A 3CXBB 2W2XC 3PVWA 2DAFA 3CIKA 1HBKA 3U12A 4RM8A 2J42A 1MKEA 1WMHB 4HCNB 4DBGA 2FE8A 2I38A 1WXAA 2KQ4X 2ROVA 2CAYA 3ALBA 3WIMA 2H7DA 2NBVA 1V5TA 4M00A 1GB1A 4DHJD 2WS3B 1TJEA 3ZRCA 5FI0A 1X86A 2JWZA 2KYWA 5LG4B 3RNGC 1MHXA 2IDYA 4B0MA 5HI1A 2DHIA 2LOXA 1QOAA 1T3QA 5CX3A 2LXCA 2YS3A 3BVMA 1FXIA 4K81A 3NVZA 4A3PA 3X0WA 3N20C 1WI0A 1VBGA 4BZAA 5BYQA 2XK5B 2INNE 4KIKA 2KZRA 3MC9A 1PFDA 3ML9A 2FCQA 3NG0A 2P0HA 2K8HA 1V61A 3RUIB 3N3KB 1P1AA 3Q69A 1X05A 3N1ZC 3KH0A 3T3OA 3U7DA 2N0SB 3AEFB 4C7YA 5LNK1 2PVOD 3C19A 1OY2A 3V6CB 3APDA 1N60A 2IPKD 2PJHA 1QT9A 3GYOA 4J3OD 3PZ8A 4NAMA 3V3XA 1ZPSA 5LONB 5E6OA 1PDXA 2C5LC 3ZTCA 3DOWA 1KLUD 3ZGZA 2EKIA 1TYGB 3NJTA 1R4MI 3H1UA 1WRIA 2M4NA 3DBHB 2GCJA 3KVFB 1J7CA 1J0GA 2I2YA 1HEZE 3VDZA 4LJPB 2AL6A 3PTFC 4MSMB 2QSDA 4REZA 3ZNHB 2EELA 5E6JA 1KOTA 4B6WA 1XLPA 3P4RB 4JK7A 3UGBB 3RCZA 1WG7A 1NENB 1PFJA 1F2RI 3AE1B 5HE1A 3IBEA 3APFA 5JHBA 3TFMA 5CHVC 2HRJA 2M8SA 3NOBA 1H8CA 1MIXA 1BUIC 2WGSA 2XBBC 1WGRA 2JSVX 4BBNF 3ZJTA 1E8XA 4QAYA 3AEAB 3E9PA 5C3JB 3G9WA 2NTSA 4NPNA 2COPA 4DX8A 1FCLA 2RGFA 4XE0A 2B3AA 3PS6A 1EF1A 1UELA 1I35A 1M7RA 1HXYD 4FHJA 2FUG1 2WP9B 4B0EA 2G45B 4HVBA 2DZIA 5H92C 5C16A 2K2UA 3GS2A 2WHIA 2FCMA 2C9WB 3PO0A 2IO0B 3BY4B 5C2TB 4IWQA 3W9CB 4LCDE 3T8MA 5AZFA 2QDFA 2AX5A 3RNCC 4DDGD 5KHQA 1E0ZA 1ET9A 2D4QA 1SE9A 3ZTDA 1XD3B 4FJVB 1LM8B 1GB4A 4CHJA 2PEAA 2ASQA 4K7SA 3H7PB 2O6VD 2O2VB 2EKEC 2V3SA 1I4QA 1YX5B 1V89A 1WR6E 2Y3AA 4ILGB 4A6HA 1DOXA 2E6XA 3M1IB 1P6SA 1PLSA 2GB1A 2JT4B 3FAHA 1GG3A 2QHOA 1TZ1A 3PZ7A 2PPHA 1FXTB 4AJYB 4KKJA 4KKIA 1FAOA 4IOIE 1XD4A 4K1RB 3E9OA 1F1HA 2CU1A 2RDHA 2M0XA 1T77A 4EMOA 3CSFA 3ODWA 4E74A 3OG5A 1VLBA 2ICIA 4KZ0A 2ZNVB 3RN9C 3GOEA 2DHZA 3I5JC 2KWVB 2DKQA 3TVVA 3HVZA 5IP4D 5H8YE 2H7EA 1SGHA 4KGRA 3PREA 4WJ7A 2UU7A 2N4FA 4XC2A 1WJ1A 3C0RB 1KJTA 4GPTB 2KIEA 1V86A 1ZVRA 1FO4A 5DPRA 1OQNA 3DBHI 2MKRA 2D3CA 2KC1A 4EFOA 3Q3JA 2WXHA 1MHHE 3AMZA 2H88B 4EOYA 1FGYA 3VFKA 2VZKB 4OVVA 2N7EA 2WX1A 2ZVOA 2Q13A 3IAM1 5E6NA 3U8ZA 1ROEA 1WMHA 3SFDB 1DBHA 1CJEA 1D6EC 3KYDD 4HDQA 4KHAA 3O65B 2FUHB 3VUWA 4ZRQA 1D5XC 3LB8C 1CZPA 4W9LA 1I4RA 4KGTA 5HE3A 1PYWD 2IGGA 3TEWA 2EMSA 4GNKB 2R2OA 4G3XB 2ELAA 1JWBD 5HKHA 3EECA 1WJNA 4ZRIA 2ZPNA 3ZXVA 1BAKA 3AEEB 4N6EB 3IT4B 3JW0X 3IXSA 4HRSA 5AUKA 2YS5A 1UWMA 2IFSA 3MC8A 4CHMA 4NNJB 1SIJA 4NZLB 1XCQL 1JWMD 3WA0A 1WGGA 3TSSA 3LJ3A 1HTOA 5LXHA 2V1YA 3V5WA 1P7FA 2WXFA 3AI5A 3Q8FA 2BKFA 2MX2A 5J17A 2YRYA 2D07B 2WNMA 2Z59B 1IP9A 3PRMB 1CMXB 2OJWA 4M8MA 1E8YA 4GSWA 1E10A 4FBJB 2YT2A 1L2NA 4ARIA 3P42A 2EMTA 1Z2MA 2NTTA 4K7UA 2G4DB 3DXEA 2DKPA 4WAFA 4ACFA 4HJGE 4DXFA 1JWAD 1XO3A 2LUMA 1NTVA 2BGFA 1W1HA 2D3AA 3DWMA 5L81A 3MJWA 3QARA 4D2KA 2K49A 3NS8A 2GMIC 4RCOA 4UDUC 2LEKA 1L5PA 3NVVA 1M4VA 1I7HA 1D5ZC 1Q1OA 3E56A 4Z2NA 3L10B 4WWPA 2OOBB 4A3OA 1HZ5A 2MW5A 1WGQA 1LO5D 5C79A 4BKTA 3RFZB 2KGXB 1LB1A 1WJ4A 3MJ5A 4AS1A 2KWDA 4A55A 5D6JB 3ULBA 1NVID 2OQBA 5EFXA 1RYJA 3WCQA 1ST7A 3W1YA 1E7PB 3VOQA 1WZ0A 3U4EG 2LULA 3DHIC 3VIAA 2KK8A 4C4VB 1C3TA 2NS5A 5D3WA 3IAS1 1YX6B 4XWWA 4X57B 1T0QC 5E6PA 3R2IA 2DYNA 3F0WA 4MY6A 2DA0A 1RFAA 2KUQA 5IA7A 3FLVA 3IVFA 3RZFA 1W1GA 1C79A 2KMAA 3OJ3A 1GGOA 3W2DA 1YIWA 2J0JA 2JPHA 4HAVB 3N9YC 3H9DA 3PLUA 1VRAB 3QBVB 1TIFA 3PHWB 3QWZB 2ZJDA 3TJPA 1MAIA 4HPLB 1JMLA 1F2RC 1Y56A 1V97A 4I6NB 2XK5A 2DX1A 1V1OA 1NU2A 2O6VB 1PMSA 4YL8A 5D3YA 3TW1A 3KY9A 3ZIMA 2FBWB 3L54A 3TL5A 2J0MA 3FSSA 3P4SB 4XZ4A 3AE6B 3L16A 1ENFA 2ZVNA 3A9JB 5D3IB 4OZAA 2LUEA 2D3BA 3NWFA 1KC7A 4CYEA 3AV8A 4RGOS 5TR5A 2RVBB 2BB5A 2LRWA 3VHTC 2JXTA 2UWQA 2WXPA 3AECB 4LDTD 3KRXA 2KANA 1TS2A 3QQ8B 4XDDA 1XLQA 2DENB 3W5VB 3CSTA 5BYSA 1TKEA 3UF8A 2PE6B 3OLMD 4DBBA 4IKGA 1WSPA 3P1MA 2W2WA 4YSXB 4HK2A 4C00A 4PYZA 5AZGA 1ZW7A 3KWLA 2CY4A 3SHQA 1NTYA 3R3MA 4J6IA 1VZ7A 3QHTA 2GS0A 4RGMA 3GB1A 3Q8CA 2GUMA 4HB0B 4CSQA 1SJHD 3ML4A 4KGSA 5DH9B 3AE8B 3QX1A 3P7ZA 4NQLB 1D5MC 1FNUA 1UNSA 3EPYA 2CS4A 5EE3A 3P2BA 3WAOA 2EC1A 2MDXA 4KHBA 5LOPB 3B9JA 2N9LA 1MPEA 3B2GA 2Y5CA 2L8JA 3A58A 2WX0A 4LNIA 2PLPA 1K50A 1F0ZA 4YSYB 4OZCA 2KT7A 4GDKA 4N9F4 4XYCA 3ZUNA 3DBRB 2OEDA 3HVDA 1UD7A 1EUVB 3MPXA 1P7EA 2IO2B 1XEEA 3R7QA 2K8EA 5JHAA 2LFIA 3HIZA 2LGDA 3PEGA 2VRRB 4BOSC 4GDLB 4W9GA 2DZKA 4EZJA 3RPFC 2M56B 1P3RA 1ZE3D 3AU5A 3H6NA 1ZOYB 4ASWC 1OGWA 3QAQA 2GJYA 3RD2A 4C7ZA 3FKYA 3RNEC 1FRDA 5IRSA 2J4XA 4BOZB 1MG8A 1EU4A 1WM3A 3A4SC 1TKYA 4HJKA 1WJUA 3NZ3A 2Z0DB 3VVWB 3ABVB 1YD8U 4BVUC 4IM3A 2HE7A 4PQ0A 2ABDA 1HA5A 2WXNA 2ONQA 1TS5A 3MDBC 4YSZB 3X23A 2KJHB 2P8VA 1IBXA 4A20A 3HK0A 3PSCA 2MJ3A 1IUEA 1Y19B 2LGIA 2KJ6A 3VQIA 4P7IA 2V9HA 2ZZPB 2YVCA 4OT1A 1E8ZA 1TGZB 5LXIB 4C56C 1F77A 1I7AA 4NJ6A 1EWCA 2NR2A 1IPGA 5BMHA 3NRZA 1UNRA 2IJ0A 3SEBA 2TSSA 4A8XC 1WRDB 2SEBD 4MJSB 3ZQ4A 2BW2A 1SIFA 4MH8A 3ODXA 4HDOA 3E9LA 2XEWA 3U7ZA 4F7HA 3N1YC 3UIOB 4ZRJA 2E2XA 2L7RA 2PE9A 1QILA 1UWXA 2RRFA 2KMCA 4HB2B 4ZDVA 3RI7C 5JLJB 2KDFB 1C78A 3Q8BA 1YQ3B 3ECIA 2N9KA 3NWDA 2KMMA 3U52E 2CB8A 1STEA 3F5RA 4DDID 4DIXA 5CLQB 1UGMA 2WXQA 5IO9A 1J19A 1A70A 4NAWB 3AULA 3E66A 5FK9C 4YONA 3OWEB 3V62A 1WGHA 2D10A 2GRIA 1EVHA 5KQ1A 3RNFC 2N7DA 1TS4A 2IO1B 3TUOA 2GBMA 3BYTB 2R2YA 3PT2B 1DYNA 1Z87A 2KWUB 2D9ZA 2W82A 1MI1A 4YTPB 4AOFA 4XX5A 5AUIA 2KDBA 1GC6A 4KSKC 1GPXA 3VUYA 1UPQA 4FXCA 1TKGA 4JKAA 1KH0A 2UYZB 5FR3A 4BKSD 5T8IA 1VBHA 1VR9A 3C8YA 2MA9B
chains in the Genus database with same CATH topology
2DFKA 3NZSA 1RLFA 2JVCA 3PVUA 3M95A 2W9NA 2KC2A 3DCGA 3T9LA 3DXCA 2WYQA 1PQSA 1P9DU 1C1YB 4WJOA 2J0KA 4KDIC 1L7YA 4FLHA 4NY0A 4TUUA 4AJWA 2QKLA 3ZDMC 2L0FA 2MBBB 1GC7A 4PS3A 4ILJA 2DYOA 4I6PA 1V5UA 3PHXB 4ICUA 2FDQA 1R4NI 2DX5B 1WZ3A 3DBLI 2K8CA 3DBRI 3PGEA 2D9XA 4L6EA 5D27A 2L05A 2MQJA 3A8QA 2NMBA 3JYUA 5D3XA 4FJZA 3UQBA 1MPHA 2DHJA 5KQ4A 1U29A 2L2IA 3IFWB 1DDVA 1E7VA 2LZ6A 2HD5B 1AARA 3UINB 4KSLC 4HCPB 2LBBA 4DX90 3PRPB 2X18A 1M94A 4W9IA 2Y8GA 1RRBA 2JRHA 3DQVA 4B95A 3RYTA 3SV1A 5C5BA 4HAZB 1RAXA 1WYWB 2LKOA 2I1JA 4G0NB 1P98A 2XQNM 3ZW3A 1NVLA 2M1MA 2LWPA 1K5DB 3RCPA 2LGXA 3GZNI 4JKDA 2IBIB 2C7NB 3UIPB 3PVLA 3ZO5B 2Z0EB 2IY0B 4HXDA 2LG1A 3B0AA 4BBKA 5JHHA 4DXAB 5GOWB 4JKHA 2K2JA 4DHZB 3KYCD 2KKCA 1ZKHA 3SYXA 4F8CB 1E90A 4IM0A 3PPAA 1OMWA 1X1FA 1ZC3B 2MFQA 2GBJA 4F1SA 2IZVB 3SBGA 1GJZA 1HB8A 2KFKA 2DYMA 2I1KA 3VTVA 2FCNA 5EDSA 2WH5A 1NTIA 1TTNA 1MK9B 4KDLB 4RM9A 4WWOA 4MT7A 2JY6A 2OTXA 4GIVA 3DPDA 1E8WA 1J8CA 2V76A 1RJ2A 2KX3A 3S2AA 3AXCA 2KJRA 2KTFA 5KHOA 4EJNA 5FR6A 4KAXB 2WDTB 4PS7A 2AYOB 4HPMB 1P3QU 3AU4A 1KZGA 5BO4B 1ZC4B 1BTKA 3N30A 1U27A 1ZGUB 2Y7BA 1QQGA 3A98B 1UBQA 2K6QA 3KUCB 3ML8A 1YQBA 2JF5A 4Z2MB 4EEWA 5DPWA 4AWJA 4K17A 4PS8A 1XR0B 3PG7A 3QC8B 3V61A 4EUTA 4ANXA 4ANWA 4JKFA 2I5FA 3UQAA 2LRUA 2GBRA 1V81A 5IJMA 2DIKA 4IC7B 2MBHA 3ONSA 3L13A 1BT0A 1NDDA 4ANUA 5LLIA 3R66C 2HTHB 2OJRA 3KSYA 4AUQC 2M17A 3PV1A 1WIAA 2KO3A 3WAPA 3WANA 2LD9A 1GUAB 4JGHB 3D32A 3SO6A 3P6AA 2MRPA 3LJUX 2KLGA 4G50A 1DIKA 2KDIA 1ISNA 4MELA 2ZCBA 2JP2A 3A9KA 1U5GA 4IW0A 3TCAA 3WALA 4JIOU 2RSUA 4EZLA 1M7EA 4KVGB 5DHFB 2CHZA 5C5BB 2K39A 3VTUA 4TQ0A 4W9HA 5DCNA 2N9XA 2R0DA 2MBOA 4G11A 2IY1B 1TXDA 1T0YA 4KV2A 3M3JA 3VH3B 4HLEA 3WYFB 2LXAA 3DVNV 2K8BA 4IFSA 2DLWA 1AQCA 1S3SG 4LDTB 2COCA 1FHOA 2JZZA 3KZ1A 1XODA 2COFA 1DDMA 2RPQA 1LQBA 4BKSA 4BBNC 3U30A 4DHJB 3L08A 2A5UA 2RD0A 1WXSA 2LI5A 1WY8A 2HJ8A 1V9JA 2HTHA 1U2BA 2RLOA 1XQQA 1TBEA 1XX0A 2K6DB 3A9KB 3NHEB 1U5FA 1DDWA 5C23A 3DDCB 1Y8RC 4ICVA 4A6FA 2UZRA 1J0WA 2MBQA 1W1DA 5HE2A 2FJLA 2D2QA 1Q0WB 2LYDA 3QIJA 3RZWC 1UBIA 2AL3A 2R09A 4LJOB 2YT0A 1IYFA 4HWIB 1U4AA 2CR5A 2CRFA 2LVPA 1UZXB 2Y5BB 1VD2A 2YLMA 4MDKE 2KCJA 2Z0QA 1WGYA 3K9PB 2C60A 1K8RB 2KXJA 3JSVA 4ANVA 2KNBA 4HAXB 3VXWA 4M0WB 1NI2A 1KBLA 1FOEA 2FIFA 1V5OA 2DYQA 2QKMA 5J3TA 2FNJB 4K7WA 4B9KA 4IWPA 4MGKE 4HB4B 2COAA 2BCJA 1P0RA 1QC6A 1BTNA 2KOXA 1B55A 1WX8A 2MP2B 5JP4A 1WH3A 4F7ZA 4I6LB 1KZ7A 1X1MA 3L17A 4GMVA 4DWFA 4GU2A 3PSEB 2YT1A 3AJ4A 2VRWB 3EC8A 3FEHA 4F7GA 1BWNA 4PYUA 1WVHA 2LJ5A 4GDLA 5CTRC 3IHPC 3DBSA 2NPTB 3N32A 2O2VA 2G35A 3ZVRA 5D3VA 4IAPA 4TQ1A 3PP2A 1EGXA 2K1FA 4IG7B 4Y94A 4NQKE 5DHAB 1WXVA 2CHWA 3GYPA 4M8NA 2KVRA 3RT3B 2V4LA 3KRWA 3ULCA 5D7GA 3TBLD 1Q67A 4URKA 2VKIA 1V5PA 1X11A 4W9JA 3D8FA 1NBFC 2N9PC 5J2RA 1WI1A 5G55A 1LW3A 3QJZA 2G4SA 1SHCA 1V49A 2KDEB 1EO6A 2BYEA 3MHSD 3OANA 3QK0A 2L00B 1XKEA 4B6HA 2Z0PA 2CY5A 5DI9B 2EJ8A 2P0DA 1WGDA 2W2XD 1UPRA 2NZ8B 2BF8B 4W9DA 2YF0A 1E7UA 3ODOA 2BKRB 1Z5SB 3BINA 4HB3B 2GBKA 4BFRA 3NSUA 2DAJA 2LGYA 4JQWC 2LOZA 4DHZE 2DN6A 4MH0E 1HE8A 5J3YA 5DPTA 4H8SA 2KD0A 4HATB 1DROA 2M38A 3TMPB 2BYFA 3CMMB 3W1SC 4W9FA 2O6VA 4HHVA 4WWNA 3NY5A 2CQUA 3NZUA 3HW2B 1G6JA 2MP2A 3ZNID 1WE6A 2GOWA 4II3B 4MGYE 2RSGA 2K00A 2DZMA 2KUPA 4OVUA 3T06A 1LXDA 2FCSA 4NAWA 5JH5C 1FHWA 2NBWB 3ZDTA 2ZPYA 1D3ZA 3PZDA 2P0FA 1WF9A 4FA6A 2R82A 5GMVA 3A8PA 2N0YA 3ZLZA 2DZJA 3A9JA 4JK8A 4JK9A 1XCGA 2FJ9A 2CKHB 4W9KA 3JSVB 4W9EA 4ZYNA 3KUDB 4II2B 1I2HA 2C7HA 2WWZA 1XT9B 4FN2A 2MWSB 2Z0OA 3A33B 2A4ZA 2RQ1A 4K2PA 1FGZA 4HAWB 3V6EB 4A5KA 1A5RA 4WJQA 4TKNA 3OJ4B 3H7PA 3VTWA 5FI1A 5IAAC 2ZCCA 3HQCA 2IYBA 2PZ1A 1V5MA 1Y5OA 1KM7A 4GB9A 3ZNGC 4NSWA 2D9WA 3K9OB 2KX0A 3CF6E 4TV3A 1FHXA 2DHKA 2IYDB 3SUZA 5D2MB 1F9JA 5L95C 2YSZA 4IUMB 1K5GB 5JVLA 4E3CA 3SD5A 4KIKB 1ZSQA 2CHXA 2FAZA 5CHWA 2D9VA 1EAZA 3DVGY 2JUOA 5C6RA 2M14A 3IG3A 1MK7B 3ZVVA 2NCNA 2KQSA 3M63B 2MCNB 4EKUA 2NPTA 3EFUA 4FJYA 2GCLA 5DPSA 5JHGA 4CHKA 4JL9A 1UEFA 1WFYA 3B08A 3D8DA 5J3QA 2KWCA 1U5DA 2AEHA 1S1QB 3PLVA 2BWES 4FULA 3PRZA 2ELBA 2BWFA 4KZCA 2G3QB 1WJ6A 2L3ZA 2X0SA 3ZRFA 1V80A 4A6FB 4IM2A 5C1ZA 3ZNZB 2JZ3B 1VCBA 2D3GA 1UNQA 3DVGX 4W9CA 1TQZA 3VAWA 3KUZA 4WJPA 4XWXA 1WE7A 2J59M 2MSED 4GMXB 3D8EA 2I5CA 1HB6A 3VH4B 4GZUA 4JKGB 4MSQB 1KLVA 4HAUB 2KFKB 4CO7A 2J7QB 4JKEA 2NBUA 1UH6A 4E71A 3BJIA 3APCA 4HAYB 4FADA 3QA8A 2N1WA 3ZKJC 4GN1A 4KHBB 2NBVB 1WR1A 2AWTA 2RGNB 4JKCA 5L83A 1WX9A 1YJ1A 5G2NA 2ZNVC 1WXMA 3A1QA 4WVFB 3OAWA 1IRSA 2UVMA 4GXBA 1FB8A 1V2YA 5AEKB 3ENBA 2JRIB 1JDEA 2DX5A 2ADZA 2L0TA 2GBNA 2C7MB 1ACAA 4MGIE 2KTRB 3DVNU 3L0WB 2RNRB 3KW5B 4MK0A 3TO1A 4JLCA 4WQOB 1AWEA 3Q3FA 2KHWB 4WJNA 1V6EA 1MIZB 5JZEB 1H10A 3WAMA 4NJ7A 4AP4C 1GNUA 4F7UP 1JRUA 2L76A 4A6KA 5HE0A 4GOCA 1QZEA 5KCVA 3QWMA 1X1GA 2YS1A 4GDKB 2KLCA 3N7CA 4IWOA 2REXA 5CHFA 1V88A 2CODA 4MM3A 4KHOA 2KN5A 4ZRKA 3I3TB 5D94A 3JVZX 3SBTA 4TYZA 1Q5WB 2LVOA 3HHMA 4JKBA 2RUKB 4MGZE 2FIDA 1KI1B 4MEMA 2DTCA 4ILHA 3SU8X 2L1CA 2MBEA 1TJ6A 2LASA 2IO3B 5DIFB 1P5TA 2JXXA 4RMAA 2MLBA 1I42A 4C0AA 3FP5A 2N1VA 3DXDA 1WX7A 4D0NB 2BYVE 3MTNB 2VSZA 2KQ7A 2Y8FA 2N23A 3R7RA 3SNHA 2R2QA 1H4RA 3FM8C 4GGQA 2LVQA 3W1SA 1WM2A 4WSFA 1OQYA 3B1LX 2KFJA 4EZKA 3ENEA 1N3HA 1U5EA 3TIXA 1ZM0A 3EHVA 3V60A 4IOYX 2DYBA 3O96A 3LDZE 3QCAA 4JKGA 3HM6X 3SDLC 2BPSA 4BKGA 3A4RA 2D9YA 4PNKA 1RRPB 4DK5A 2UZSA 3RULA 2ROZB 5AZHA 2ZEQA 1UNPA 2NVUI 1LFDA 3H7SA 2N9EB 3HM3A 1WJMA 1EF5A 2KTRA 3M62B 1OEYA 1E5WA 3VUXA 2MWNB 2RR9A 2D11A 1OEYJ 2K25A 5CLLB 4WAAA 1WGUA 4MJSA 5J18A 4K2OA 4FHKA 1OTRB 3A1QB 3UZTA 3CXBB 2W2XC 3PVWA 2DAFA 3CIKA 1HBKA 4RM8A 1MKEA 1WMHB 4HCNB 4DBGA 1WXAA 2ROVA 2CAYA 3ALBA 3WIMA 2H7DA 1V5TA 4DHJD 3ZRCA 5FI0A 1X86A 2JWZA 2DHIA 2LOXA 5CX3A 2LXCA 2YS3A 4K81A 4A3PA 3X0WA 1WI0A 1VBGA 2XK5B 4KIKA 2KZRA 3ML9A 2FCQA 2P0HA 1V61A 2K8HA 3RUIB 3N3KB 1P1AA 1X05A 3KH0A 3U7DA 1OY2A 3V6CB 3APDA 2PJHA 3GYOA 5LONB 5E6OA 2C5LC 3ZTCA 3DOWA 1R4MI 3H1UA 2M4NA 2GCJA 3KVFB 1J0GA 3VDZA 4LJPB 2AL6A 3PTFC 4MSMB 3ZNHB 1KOTA 4B6WA 3UGBB 4JK7A 3RCZA 1WG7A 1PFJA 5HE1A 3IBEA 3APFA 5JHBA 3TFMA 5CHVC 2HRJA 2M8SA 1H8CA 3NOBA 1MIXA 2XBBC 1WGRA 4BBNF 1E8XA 3E9PA 3G9WA 4NPNA 2COPA 4DX8A 2RGFA 2B3AA 3PS6A 1EF1A 1UELA 1I35A 1M7RA 4FHJA 2G45B 4HVBA 2DZIA 5C16A 2K2UA 2FCMA 2C9WB 2IO0B 3BY4B 4IWQA 4LCDE 3T8MA 5AZFA 4DDGD 5KHQA 2D4QA 3ZTDA 1SE9A 1XD3B 4FJVB 1LM8B 4CHJA 2PEAA 2ASQA 4K7SA 3H7PB 2O6VD 2O2VB 2EKEC 2V3SA 1YX5B 1V89A 1WR6E 4ILGB 4A6HA 3M1IB 1P6SA 1PLSA 2JT4B 1GG3A 2QHOA 1TZ1A 2PPHA 1FXTB 4AJYB 1FAOA 1XD4A 4K1RB 3E9OA 2CU1A 2M0XA 4EMOA 3CSFA 3ODWA 4E74A 4KZ0A 2ZNVB 3GOEA 2DHZA 2KWVB 2DKQA 3TVVA 2H7EA 1SGHA 3PREA 4WJ7A 2N4FA 4XC2A 1WJ1A 3C0RB 1KJTA 4GPTB 1V86A 1ZVRA 5DPRA 1OQNA 3DBHI 2MKRA 2KC1A 4EFOA 3Q3JA 4EOYA 1FGYA 3VFKA 4OVVA 2N7EA 2WX1A 2ZVOA 2Q13A 5E6NA 3U8ZA 1WMHA 1DBHA 3KYDD 4HDQA 4KHAA 3O65B 2FUHB 3VUWA 4W9LA 5HE3A 2EMSA 2R2OA 4G3XB 2ELAA 5HKHA 3EECA 1WJNA 4ZRIA 2ZPNA 1BAKA 3JW0X 2YS5A 2IFSA 4CHMA 4NNJB 3WA0A 1WGGA 3LJ3A 5LXHA 2V1YA 3V5WA 3AI5A 2BKFA 2MX2A 5J17A 2YRYA 2D07B 2Z59B 1IP9A 3PRMB 1CMXB 4M8MA 1E8YA 4GSWA 4FBJB 1L2NA 2EMTA 1Z2MA 4K7UA 2G4DB 3DXEA 2DKPA 1NTVA 2BGFA 1W1HA 5L81A 3MJWA 3QARA 3NS8A 2GMIC 1Q1OA 4Z2NA 3L10B 4WWPA 2OOBB 4A3OA 2MW5A 1WGQA 5C79A 4BKTA 2KGXB 1LB1A 1WJ4A 5D6JB 3ULBA 2OQBA 5EFXA 1ST7A 3W1YA 3VOQA 1WZ0A 2LULA 3VIAA 2KK8A 1C3TA 2NS5A 5D3WA 1YX6B 4X57B 5E6PA 2DYNA 3F0WA 4MY6A 2DA0A 1RFAA 5IA7A 3FLVA 3IVFA 3RZFA 1W1GA 2KMAA 3OJ3A 1GGOA 1YIWA 2J0JA 2JPHA 4HAVB 3H9DA 3PLUA 3QBVB 3PHWB 3QWZB 2ZJDA 3TJPA 1MAIA 4HPLB 4I6NB 2XK5A 2DX1A 1NU2A 2O6VB 1PMSA 4YL8A 5D3YA 3TW1A 3KY9A 3ZIMA 3L54A 3TL5A 2J0MA 3FSSA 4XZ4A 3L16A 2ZVNA 3A9JB 2LUEA 1KC7A 4CYEA 5TR5A 2RVBB 2LRWA 3VHTC 2UWQA 4LDTD 3KRXA 2KANA 3QQ8B 2DENB 3CSTA 3UF8A 2PE6B 3OLMD 4DBBA 2W2WA 4HK2A 4PYZA 5AZGA 1ZW7A 2CY4A 3SHQA 1NTYA 3R3MA 4J6IA 3QHTA 2GS0A 4HB0B 3ML4A 5DH9B 3QX1A 4NQLB 3P7ZA 2CS4A 3EPYA 3P2BA 3WAOA 2EC1A 2MDXA 5LOPB 2L8JA 2WX0A 4N9F4 4GDKA 3ZUNA 1UD7A 1EUVB 3MPXA 2IO2B 3R7QA 5JHAA 3HIZA 2LGDA 3PEGA 2VRRB 4BOSC 4GDLB 4W9GA 2DZKA 4EZJA 1P3RA 3AU5A 3H6NA 4ASWC 1OGWA 3QAQA 2GJYA 3RD2A 4BOZB 1MG8A 1WM3A 3A4SC 4HJKA 1WJUA 2Z0DB 3VVWB 1YD8U 4BVUC 4IM3A 2HE7A 4PQ0A 2ABDA 3MDBC 3X23A 2KJHB 2P8VA 4A20A 3HK0A 3PSCA 1Y19B 3VQIA 2KJ6A 4P7IA 2ZZPB 2YVCA 1E8ZA 1TGZB 5LXIB 1I7AA 4NJ6A 2NR2A 1IPGA 1UNRA 1WRDB 4MJSB 1SIFA 3ODXA 4HDOA 3E9LA 2XEWA 4F7HA 3UIOB 4ZRJA 2E2XA 2L7RA 2PE9A 2KMCA 4HB2B 4ZDVA 5JLJB 2KDFB 3ECIA 2CB8A 4DDID 3F5RA 5CLQB 1UGMA 1J19A 4NAWB 3AULA 3E66A 4YONA 3V62A 1WGHA 2D10A 1EVHA 5KQ1A 2N7DA 2IO1B 2GBMA 3PT2B 1DYNA 1Z87A 2KWUB 2D9ZA 4AOFA 4XX5A 2KDBA 1GC6A 4KSKC 3VUYA 1UPQA 4JKAA 2UYZB 4BKSD 1VBHA 2MA9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGY A;  2DFK A;  2KTR B;  3VFK A;  2KNB A;  4OVV A;  2N7E A;  4HAX B;  2WX1 A;  2Q13 A;  2ZVO A;  3NZS A;  3DVN U;  4M0W B;  1NI2 A;  3U8Z A;  1RLF A;  1WMH A;  2JVC A;  1DBH A;  3PVU A;  3VDZ A;  3KYD D;  1FOE A;  4HDQ A;  2W9N A;  3M95 A;  4KHA A;  2RNR B;  2FIF A;  3L0W B;  2KC2 A;  1V5O A;  3O65 B;  3DCG A;  3KW5 B;  2DYQ A;  2QKM A;  4MK0 A;  3TO1 A;  2FUH B;  4JLC A;  3VUW A;  5J3T A;  4WQO B;  2FNJ B;  3T9L A;  3DXC A;  1AWE A;  2WYQ A;  3Q3F A;  2KHW B;  4K7W A;  4W9L A;  4WJN A;  4IWP A;  1PQS A;  4MGK E;  4B9K A;  4HB4 B;  5HE3 A;  5EDS A;  1P9D U;  1C1Y B;  2EMS A;  2R2O A;  4G3X B;  4WJO A;  2ELA A;  2J0K A;  4KDI C;  2COA A;  1L7Y A;  1V6E A;  1MIZ B;  5HKH A;  3EEC A;  5JZE B;  1WJN A;  4FLH A;  2BCJ A;  4NY0 A;  4ZRI A;  1H10 A;  1P0R A;  2ZPN A;  4TUU A;  4AJW A;  3WAM A;  2QKL A;  4NJ7 A;  3ZDM C;  1BAK A;  1QC6 A;  2L0F A;  2MBB B;  1BTN A;  1GC7 A;  4AP4 C;  1GNU A;  3JW0 X;  4F7U P;  4PS3 A;  2YS5 A;  1JRU A;  2L76 A;  4A6K A;  2IFS A;  5HE0 A;  2DYO A;  2KOX A;  4GOC A;  4I6P A;  1V5U A;  1B55 A;  1WX8 A;  3PHX B;  4CHM A;  1QZE A;  2MP2 B;  5JP4 A;  3QWM A;  5KCV A;  1X1G A;  1WH3 A;  4ICU A;  2YS1 A;  4GDK B;  2KLC A;  4NNJ B;  4F7Z A;  3N7C A;  4IWO A;  4I6L B;  2REX A;  3WA0 A;  1R4N I;  1WGG A;  1WZ3 A;  2DX5 B;  1KZ7 A;  2K8C A;  3DBL I;  3DBR I;  3PGE A;  1X1M A;  3L17 A;  5CHF A;  4GMV A;  3LJ3 A;  4GU2 A;  4DWF A;  2D9X A;  1V88 A;  2YT1 A;  3AJ4 A;  3PSE B;  5LXH A;  2COD A;  2V1Y A;  4L6E A;  3V5W A;  3AI5 A;  2VRW B;  5D27 A;  2BKF A;  2MX2 A;  3EC8 A;  2YRY A;  2L05 A;  2MQJ A;  4MM3 A;  4KHO A;  2KN5 A;  3A8Q A;  3FEH A;  2NMB A;  4F7G A;  4ZRK A;  3I3T B;  1BWN A;  5D94 A;  2D07 B;  4PYU A;  2Z59 B;  1WVH A;  3JYU A;  3JVZ X;  4TYZ A;  5D3X A;  4FJZ A;  3UQB A;  1IP9 A;  1MPH A;  1Q5W B;  3PRM B;  2LJ5 A;  2DHJ A;  5KQ4 A;  4GDL A;  1CMX B;  2LVO A;  5CTR C;  1U29 A;  4M8M A;  1E8Y A;  4GSW A;  2L2I A;  3DBS A;  2NPT B;  3IFW B;  3IHP C;  3HHM A;  3N32 A;  2O2V A;  1DDV A;  2RUK B;  4FBJ B;  2G35 A;  3ZVR A;  5D3V A;  1E7V A;  4IAP A;  4MGZ E;  2FID A;  1L2N A;  1KI1 B;  2EMT A;  3PP2 A;  1Z2M A;  2LZ6 A;  4K7U A;  2HD5 B;  1AAR A;  2DTC A;  1EGX A;  4MEM A;  2G4D B;  3UIN B;  4BKT A;  3DXE A;  2DKP A;  2K1F A;  4IG7 B;  4Y94 A;  4KSL C;  4NQK E;  5DHA B;  3SU8 X;  4HCP B;  1NTV A;  1WXV A;  2CHW A;  2BGF A;  4DX9 0;  3GYP A;  2L1C A;  2MBE A;  1W1H A;  4M8N A;  2KVR A;  3PRP B;  5L81 A;  2X18 A;  3MJW A;  3QAR A;  3RT3 B;  1M94 A;  4W9I A;  1TJ6 A;  2LAS A;  2V4L A;  2Y8G A;  1RRB A;  5DIF B;  1P5T A;  2IO3 B;  2GMI C;  2JRH A;  3DQV A;  3NS8 A;  4B95 A;  3RYT A;  3KRW A;  3SV1 A;  2JXX A;  3ULC A;  5C5B A;  4RMA A;  5D7G A;  2MLB A;  3TBL D;  4HAZ B;  1Q1O A;  1I42 A;  1RAX A;  1Q67 A;  4URK A;  2VKI A;  4Z2N A;  1WYW B;  4C0A A;  1V5P A;  1X11 A;  2N1V A;  3L10 B;  4W9J A;  3D8F A;  3DXD A;  1NBF C;  2N9P C;  2LKO A;  2I1J A;  1WX7 A;  4WWP A;  2OOB B;  4A3O A;  4G0N B;  2MW5 A;  4D0N B;  2BYV E;  3MTN B;  1WI1 A;  2VSZ A;  5J2R A;  2KQ7 A;  5G55 A;  1LW3 A;  1P98 A;  3QJZ A;  2XQN M;  1WGQ A;  2G4S A;  3ZW3 A;  1SHC A;  2M1M A;  2LWP A;  2Y8F A;  5C79 A;  1K5D B;  3RCP A;  1V49 A;  2N23 A;  2KDE B;  2LGX A;  2KGX B;  3GZN I;  1LB1 A;  1WJ4 A;  1EO6 A;  3SNH A;  2BYE A;  2IBI B;  3OAN A;  3MHS D;  3QK0 A;  3R7R A;  2C7N B;  2R2Q A;  2L00 B;  3UIP B;  3PVL A;  3ZO5 B;  1XKE A;  2Z0E B;  5D6J B;  4B6H A;  3ULB A;  2IY0 B;  2OQB A;  1H4R A;  2Z0P A;  3FM8 C;  5EFX A;  2CY5 A;  5DI9 B;  4GGQ A;  4HXD A;  3W1Y A;  2LG1 A;  2EJ8 A;  2LVQ A;  3B0A A;  3W1S A;  1WM2 A;  2P0D A;  4BBK A;  1WGD A;  3VOQ A;  2W2X D;  1UPR A;  1WZ0 A;  2NZ8 B;  4WSF A;  5JHH A;  4DXA B;  1OQY A;  3B1L X;  5GOW B;  2BF8 B;  2KFJ A;  4W9D A;  2YF0 A;  2LUL A;  2K2J A;  1E7U A;  4DHZ B;  3ODO A;  3ENE A;  3VIA A;  3KYC D;  1N3H A;  1U5E A;  2BKR B;  1Z5S B;  2KKC A;  3TIX A;  1ZKH A;  3BIN A;  4HB3 B;  2KK8 A;  1C3T A;  1ZM0 A;  3SYX A;  2GBK A;  3EHV A;  3V60 A;  4BFR A;  4IOY X;  2NS5 A;  4F8C B;  3NSU A;  2DAJ A;  3O96 A;  5D3W A;  1E90 A;  2DYB A;  2LGY A;  1YX6 B;  3ZTD A;  4JQW C;  2LOZ A;  4X57 B;  3LDZ E;  5E6P A;  4IM0 A;  3PPA A;  3QCA A;  2DYN A;  3F0W A;  4MY6 A;  1OMW A;  1X1F A;  4DHZ E;  2DN6 A;  4MH0 E;  1ZC3 B;  2DA0 A;  1HE8 A;  1RFA A;  2MFQ A;  5J3Y A;  3HM6 X;  4H8S A;  5DPT A;  2BPS A;  3SDL C;  2GBJ A;  4BKG A;  2KD0 A;  4F1S A;  5IA7 A;  4HAT B;  2IZV B;  2D9Y A;  3IVF A;  4PNK A;  1RRP B;  3A4R A;  1W1G A;  1DRO A;  3RZF A;  4DK5 A;  1GJZ A;  2M38 A;  3TMP B;  2KFK A;  2UZS A;  2BYF A;  2DYM A;  2KMA A;  3CMM B;  3OJ3 A;  3RUL A;  2I1K A;  1YIW A;  3W1S C;  3VTV A;  2FCN A;  2ROZ B;  5AZH A;  2J0J A;  2JPH A;  4HAV B;  2ZEQ A;  4W9F A;  2O6V A;  4HHV A;  1UNP A;  2NVU I;  1LFD A;  1TTN A;  3H7S A;  3H9D A;  3NY5 A;  1MK9 B;  2N9E B;  4KDL B;  4WWN A;  3NZU A;  3PLU A;  4RM9 A;  3HW2 B;  3QBV B;  4MT7 A;  4WWO A;  2JY6 A;  3HM3 A;  3PHW B;  3QWZ B;  1WJM A;  2ZJD A;  1G6J A;  3TJP A;  1MAI A;  2MP2 A;  2OTX A;  1EF5 A;  2KTR A;  3M62 B;  4GIV A;  1OEY A;  3DPD A;  4HPL B;  1E5W A;  3ZNI D;  3VUX A;  2MWN B;  1E8W A;  2RR9 A;  4I6N B;  2D11 A;  2XK5 A;  2DX1 A;  1WE6 A;  2GOW A;  4II3 B;  1OEY J;  1NU2 A;  2O6V B;  1PMS A;  4MGY E;  2K25 A;  1J8C A;  2RSG A;  4YL8 A;  5D3Y A;  5CLL B;  4WAA A;  2V76 A;  2K00 A;  1WGU A;  3TW1 A;  3KY9 A;  2DZM A;  1RJ2 A;  3ZIM A;  2KUP A;  3L54 A;  2KX3 A;  4MJS A;  4OVU A;  3TL5 A;  2J0M A;  3T06 A;  3FSS A;  1LXD A;  2FCS A;  4NAW A;  3VXW A;  5J18 A;  5JH5 C;  4K2O A;  4XZ4 A;  1FHW A;  2NBW B;  3L16 A;  4FHK A;  3ZDT A;  2ZVN A;  2ZPY A;  3AXC A;  3S2A A;  1D3Z A;  1OTR B;  2KJR A;  2P0F A;  3PZD A;  1WF9 A;  3A1Q B;  3UZT A;  2KTF A;  3A9J B;  3CXB B;  4FA6 A;  2W2X C;  3PVW A;  2DAF A;  3CIK A;  2LUE A;  5KHO A;  4CYE A;  4EJN A;  4RM8 A;  3A8P A;  5FR6 A;  2N0Y A;  5GMV A;  5TR5 A;  4KAX B;  1MKE A;  2RVB B;  2LRW A;  3ZLZ A;  2WDT B;  1WMH B;  3VHT C;  4HCN B;  2UWQ A;  4DBG A;  1WXA A;  2DZJ A;  4PS7 A;  2ROV A;  2CAY A;  2AYO B;  3ALB A;  3KRX A;  2KAN A;  4LDT D;  3A9J A;  3QQ8 B;  3WIM A;  1XCG A;  2H7D A;  4HPM B;  2CKH B;  2DEN B;  1V5T A;  3CST A;  4W9K A;  3UF8 A;  4DHJ D;  2PE6 B;  3OLM D;  3ZRC A;  4DBB A;  3JSV B;  5FI0 A;  1X86 A;  1P3Q U;  3AU4 A;  1KZG A;  2JWZ A;  4W9E A;  4ZYN A;  5BO4 B;  2W2W A;  3KUD B;  4HK2 A;  4TQ1 A;  4PYZ A;  5AZG A;  4II2 B;  2DHI A;  2LOX A;  1ZW7 A;  2CY4 A;  3SHQ A;  1I2H A;  2C7H A;  1ZC4 B;  1NTY A;  2WWZ A;  1XT9 B;  3R3M A;  4FN2 A;  1BTK A;  3N30 A;  5CX3 A;  4J6I A;  2MWS B;  2Z0O A;  2YS3 A;  1U27 A;  2LXC A;  3QHT A;  2GS0 A;  1ZGU B;  2Y7B A;  3A33 B;  1QQG A;  4K81 A;  3A98 B;  4A3P A;  2A4Z A;  3X0W A;  1WI0 A;  1UBQ A;  2K6Q A;  2XK5 B;  4K2P A;  3KUC B;  3ML8 A;  4KIK A;  2KZR A;  1YQB A;  2JF5 A;  4HB0 B;  1FGZ A;  4Z2M B;  4HAW B;  3V6E B;  4A5K A;  1A5R A;  3ML9 A;  3ML4 A;  4WJQ A;  4TKN A;  4EEW A;  3OJ4 B;  4AWJ A;  5DPW A;  4K17 A;  5DH9 B;  3QX1 A;  4NQL B;  3P7Z A;  2FCQ A;  4PS8 A;  3H7P A;  3VTW A;  5FI1 A;  1XR0 B;  2P0H A;  5IAA C;  2ZCC A;  1V61 A;  3PG7 A;  2K8H A;  3RUI B;  3HQC A;  3N3K B;  1P1A A;  2IYB A;  2PZ1 A;  2CS4 A;  1V5M A;  1X05 A;  3P2B A;  3KH0 A;  3QC8 B;  3V61 A;  4EUT A;  3WAO A;  3U7D A;  2EC1 A;  1Y5O A;  2MDX A;  5LOP B;  1KM7 A;  4ANW A;  4ANX A;  1OY2 A;  3V6C B;  2I5F A;  3APD A;  4GB9 A;  3ZNG C;  4NSW A;  2D9W A;  2L8J A;  2PJH A;  3VQI A;  2WX0 A;  3K9O B;  3GYO A;  2KX0 A;  3UQA A;  3CF6 E;  2LRU A;  4TV3 A;  4N9F 4;  4GDK A;  3ZUN A;  2GBR A;  5J17 A;  1V81 A;  1FHX A;  2DHK A;  1UD7 A;  1EUV B;  2IYD B;  4IC7 B;  3SUZ A;  5D2M B;  2MBH A;  5LON B;  3MPX A;  3ONS A;  3L13 A;  5E6O A;  2C5L C;  2IO2 B;  3ZTC A;  1F9J A;  1BT0 A;  1NDD A;  4ANU A;  5L95 C;  3DOW A;  2YSZ A;  4IUM B;  3R7Q A;  1K5G B;  3R66 C;  5LLI A;  5JHA A;  3HIZ A;  4E3C A;  2HTH B;  1R4M I;  2LGD A;  2OJR A;  3SD5 A;  3PEG A;  3H1U A;  3KSY A;  2VRR B;  4AUQ C;  4BOS C;  2M17 A;  4KIK B;  2M4N A;  1ZSQ A;  2CHX A;  2FAZ A;  2GCJ A;  5CHW A;  2D9V A;  3KVF B;  1EAZ A;  3PV1 A;  4GDL B;  1WIA A;  2KO3 A;  3DVG Y;  3WAP A;  4W9G A;  3WAN A;  2DZK A;  2LD9 A;  4EZJ A;  1GUA B;  4JGH B;  2JUO A;  3D32 A;  1J0G A;  1P3R A;  2M14 A;  3SO6 A;  2AL6 A;  5C6R A;  3P6A A;  3IG3 A;  1MK7 B;  3PTF C;  2MRP A;  3LJU X;  4LJP B;  2KLG A;  4G50 A;  3ZNH B;  3AU5 A;  2KDI A;  3H6N A;  3ZVV A;  1ISN A;  1KOT A;  4MEL A;  4ASW C;  2NCN A;  4B6W A;  2ZCB A;  1OGW A;  3QAQ A;  2GJY A;  2JP2 A;  2KQS A;  3M63 B;  4NPN A;  3RD2 A;  2MCN B;  3UGB B;  3RCZ A;  3A9K A;  4EKU A;  1WG7 A;  4BOZ B;  2NPT A;  1MG8 A;  1PFJ A;  1U5G A;  4IW0 A;  1WM3 A;  3EFU A;  3TCA A;  3WAL A;  4JIO U;  5HE1 A;  2RSU A;  3A4S C;  4HJK A;  4FJY A;  3IBE A;  4EZL A;  1WJU A;  1M7E A;  3APF A;  2Z0D B;  3VVW B;  5JHB A;  4KVG B;  2GCL A;  5DHF B;  3TFM A;  1YD8 U;  5CHV C;  4BVU C;  2M8S A;  2HE7 A;  3NOB A;  4PQ0 A;  4IM3 A;  2CHZ A;  1H8C A;  5C5B B;  1MIX A;  2XBB C;  5DPS A;  5JHG A;  3MDB C;  2K39 A;  4CHK A;  3X23 A;  1WGR A;  2KJH B;  3VTU A;  4BBN F;  2P8V A;  1E8X A;  4W9H A;  5DCN A;  4TQ0 A;  2N9X A;  2R0D A;  2MBO A;  4A20 A;  4G11 A;  4JL9 A;  3HK0 A;  3PSC A;  2IY1 B;  1UEF A;  3G9W A;  1Y19 B;  1TXD A;  1WFY A;  1T0Y A;  3B08 A;  4KV2 A;  4DX8 A;  3D8D A;  5J3Q A;  2KJ6 A;  2KWC A;  1U5D A;  4P7I A;  2RGF A;  5E6N A;  3M3J A;  3VH3 B;  4HLE A;  2AEH A;  1S1Q B;  3WYF B;  2YVC A;  2LXA A;  2ZZP B;  3DVN V;  2B3A A;  3PLV A;  2K8B A;  2BWE S;  3PS6 A;  1EF1 A;  4IFS A;  1E8Z A;  1TGZ B;  1UEL A;  4FUL A;  2DLW A;  5LXI B;  1I35 A;  1M7R A;  3PRZ A;  1AQC A;  1I7A A;  2ELB A;  2BWF A;  4FHJ A;  4KZC A;  1S3S G;  2G3Q B;  4NJ6 A;  2G45 B;  4LDT B;  4EZK A;  1WJ6 A;  2COC A;  4HVB A;  2NR2 A;  1FHO A;  2L3Z A;  1IPG A;  2DZI A;  3ZRF A;  1V80 A;  4A6F B;  4IM2 A;  1UNR A;  5C16 A;  5C1Z A;  2K2U A;  2JZZ A;  3ZNZ B;  2FCM A;  2C9W B;  2JZ3 B;  2IO0 B;  3KZ1 A;  3BY4 B;  1VCB A;  4IWQ A;  2D3G A;  4LCD E;  1UNQ A;  1XOD A;  1WRD B;  3DVG X;  4MJS B;  4W9C A;  1TQZ A;  5AZF A;  3T8M A;  3VAW A;  3KUZ A;  4WJP A;  4XWX A;  4DDG D;  1SIF A;  3ODX A;  4HDO A;  1WE7 A;  5KHQ A;  2COF A;  2J59 M;  1DDM A;  2MSE D;  1LQB A;  2RPQ A;  2XEW A;  4BKS A;  2D4Q A;  4BBN C;  3U30 A;  4GMX B;  4F7H A;  1SE9 A;  1XD3 B;  3L08 A;  3UIO B;  4ZRJ A;  2E2X A;  3D8E A;  4FJV B;  4DHJ B;  2A5U A;  2I5C A;  2RD0 A;  1LM8 B;  2L7R A;  2PE9 A;  1WXS A;  2LI5 A;  4CHJ A;  2PEA A;  3VH4 B;  4GZU A;  2ASQ A;  4K7S A;  3H7P B;  1WY8 A;  2HJ8 A;  2O2V B;  2EKE C;  2O6V D;  2V3S A;  4MSQ B;  1KLV A;  2KMC A;  1YX5 B;  4HB2 B;  1V9J A;  2HTH A;  4ZDV A;  1U2B A;  2RLO A;  1V89 A;  1WR6 E;  5JLJ B;  1XQQ A;  4HAU B;  1TBE A;  2KDF B;  2KFK B;  4CO7 A;  1XX0 A;  4A6H A;  2J7Q B;  2K6D B;  3ECI A;  3M1I B;  1P6S A;  1PLS A;  2JT4 B;  3A9K B;  1GG3 A;  3NHE B;  2QHO A;  2NBU A;  1UH6 A;  1TZ1 A;  2PPH A;  1FXT B;  1U5F A;  4AJY B;  4DDI D;  3F5R A;  4E71 A;  1DDW A;  5C23 A;  3BJI A;  1FAO A;  3APC A;  4MSM B;  5CLQ B;  1UGM A;  4HAY B;  1XD4 A;  4K1R B;  4FAD A;  3QA8 A;  3DDC B;  2N1W A;  1J19 A;  3ZKJ C;  2CU1 A;  4GN1 A;  4KHB B;  4NAW B;  2NBV B;  1Y8R C;  2M0X A;  3AUL A;  1WR1 A;  4EMO A;  3CSF A;  4ICV A;  2AWT A;  2RGN B;  3ODW A;  4E74 A;  4A6F A;  2UZR A;  5L83 A;  4YON A;  1J0W A;  2MBQ A;  4KZ0 A;  1WGH A;  2ZNV B;  3V62 A;  2D10 A;  3GOE A;  1W1D A;  5HE2 A;  2DHZ A;  1EVH A;  2KWV B;  2FJL A;  2DKQ A;  3TVV A;  5KQ1 A;  1WX9 A;  2N7D A;  1YJ1 A;  2IO1 B;  2D2Q A;  1Q0W B;  2GBM A;  2LYD A;  5G2N A;  2H7E A;  3QIJ A;  2ZNV C;  3RZW C;  1SGH A;  1WXM A;  3A1Q A;  1UBI A;  2AL3 A;  1DYN A;  3PT2 B;  2R09 A;  4LJO B;  1Z87 A;  3PRE A;  2KWU B;  2D9Z A;  4WJ7 A;  2YT0 A;  4WVF B;  1IYF A;  2N4F A;  3OAW A;  4HWI B;  4AOF A;  1IRS A;  1WJ1 A;  4XC2 A;  2UVM A;  4XX5 A;  3C0R B;  1U4A A;  1KJT A;  2KDB A;  2CR5 A;  4GPT B;  1GC6 A;  4KSK C;  3VUY A;  1V86 A;  4GXB A;  1ZVR A;  1FB8 A;  1V2Y A;  1UPQ A;  5DPR A;  5AEK B;  2CRF A;  2JRI B;  1UZX B;  2LVP A;  1VD2 A;  2Y5B B;  2YLM A;  1OQN A;  3DBH I;  2MKR A;  2DX5 A;  2ADZ A;  2UYZ B;  2L0T A;  2KC1 A;  2GBN A;  2C7M B;  3Q3J A;  2KCJ A;  2Z0Q A;  4MDK E;  4BKS D;  4EFO A;  1WGY A;  3K9P B;  2C60 A;  1K8R B;  2KXJ A;  2MA9 B;  3JSV A;  4MGI E;  4ANV A;  4EOY A; 
#chains in the Genus database with same CATH topology
 2DFK A;  3NZS A;  3H8H A;  1RLF A;  2JVC A;  2KN4 A;  3PVU A;  3M95 A;  2W9N A;  3N1X C;  1EU3 A;  1PGA A;  2KC2 A;  3DCG A;  1VJK A;  3AED B;  3T9L A;  3DXC A;  2WYQ A;  1N61 A;  1PQS A;  3HUI A;  1P9D U;  1C1Y B;  1ZDX A;  4US8 A;  4L2Y A;  4WJO A;  2J0K A;  4KDI C;  1L7Y A;  4FLH A;  4NY0 A;  4TUU A;  4AJW A;  2QKL A;  1QOF A;  3ZDM C;  2L0F A;  2MBB B;  1GC7 A;  4PS3 A;  4ILJ A;  2DYO A;  4I6P A;  1V5U A;  1ZDV A;  3PHX B;  2WXJ A;  2GI9 A;  4ICU A;  2FDQ A;  1AW7 A;  2K3U A;  2WXR A;  2Z59 A;  1FIQ A;  1LGR A;  1R4N I;  2DX5 B;  1WZ3 A;  3AE5 B;  2K8C A;  3DBL I;  4DXG A;  3DBR I;  3PGE A;  2CJN A;  2D9X A;  1J7B A;  4L6E A;  5D27 A;  2L05 A;  2MQJ A;  4H2A A;  3A8Q A;  3NUH B;  2NMB A;  5M4Y B;  3JYU A;  5D3X A;  1CQV A;  1TZO A;  4FJZ A;  3UQB A;  1MPH A;  2DHJ A;  5KQ4 A;  1U29 A;  4A9A A;  2KAJ A;  3MHZ A;  2L2I A;  3IFW B;  1DDV A;  1E7V A;  2LZ6 A;  2KAC A;  2HD5 B;  1AAR A;  2G9H D;  3UIN B;  4KSL C;  2KVZ A;  4HCP B;  2W3R A;  2WXK A;  2LBB A;  4DX9 0;  2J53 A;  3PRP B;  2X18 A;  1M94 A;  4W9I A;  2Y8G A;  1RRB A;  2JRH A;  1T0S C;  3DQV A;  4B95 A;  4ZYS A;  1MI0 A;  2X8X X;  2K22 A;  3RYT A;  2YEP B;  3SV1 A;  4CQN A;  5C5B A;  1C4C A;  1AWD A;  4HAZ B;  1RAX A;  1WYW B;  3O13 A;  2HTM E;  2LKO A;  2I1J A;  4G0N B;  1P98 A;  1L6U A;  2XQN M;  3ZW3 A;  1NVL A;  2M1M A;  2LWP A;  1K5D B;  2WQY B;  3RCP A;  2LGX A;  1R4N B;  3DBL B;  3GZN I;  1YMH E;  4JKD A;  2IBI B;  1FFU A;  1MG4 A;  3BII D;  2C7N B;  2M0A A;  3UIP B;  3PVL A;  3ZO5 B;  3SR6 A;  2Z0E B;  2IY0 B;  4XWT A;  2BQQ A;  4HXD A;  2LG1 A;  3B0A A;  4TSS A;  4BBK A;  3CWI A;  2IGH A;  4ZHP A;  5JHH A;  4DXA B;  3ZYY X;  5FKA C;  5GOW B;  1AYF A;  1OQR A;  3BK2 A;  4JKH A;  1I4H A;  2K2J A;  4DHZ B;  3I57 A;  3KYC D;  2KKC A;  1ZKH A;  3SYX A;  4F8C B;  4XDC A;  1E90 A;  4M02 A;  4L23 A;  1R4M B;  3P63 A;  4IM0 A;  3PPA A;  1R7S A;  2J52 A;  1OMW A;  1X1F A;  3AE7 B;  1ZC3 B;  2MFQ A;  2LHE A;  2GBJ A;  4F1S A;  3EGR A;  2RMM A;  2IZV B;  3SBG A;  1GJZ A;  1HB8 A;  1N5X A;  2KFK A;  2PVG C;  2DYM A;  2I1K A;  3VTV A;  2FCN A;  1J7A A;  2WH5 A;  5EDS A;  1XCT L;  1NTI A;  1TTN A;  1MK9 B;  4KDL B;  3E9S A;  4RM9 A;  4WWO A;  4MT7 A;  2MJD A;  2JY6 A;  3RNB C;  1SJE D;  2B76 B;  1BXT A;  2OTX A;  3Q3O C;  4GIV A;  3DPD A;  2JX5 A;  1E8W A;  2ZW1 A;  1FD6 A;  1J8C A;  4N59 A;  2V76 A;  1SE2 A;  2ZKM X;  2Z14 A;  1RJ2 A;  2KX3 A;  1QLB B;  3S2A A;  3AXC A;  2KJR A;  2KTF A;  3MP9 A;  4ITK A;  5KHO A;  2QEJ C;  4EJN A;  5FR6 A;  3Q3N C;  4KAX B;  4PK1 A;  2WDT B;  4PS7 A;  3AM9 A;  2AYO B;  2K0P A;  4HPM B;  4D6W A;  2KIG A;  1P3Q U;  3AU4 A;  1KZG A;  5BO4 B;  4RH6 A;  1XF5 L;  3EFC A;  1ZC4 B;  1L4D B;  1V8C A;  2W54 A;  1BTK A;  3N30 A;  1FEH A;  1U27 A;  4IDI A;  1ZGU B;  2Y7B A;  3LXF A;  1QQG A;  3A98 B;  1E6E B;  3ZJU A;  1UBQ A;  2K6Q A;  3KUC B;  2WXI A;  3ML8 A;  1YQB A;  2JF5 A;  2WXL A;  4Z2M B;  4EEW A;  5DPW A;  4AWJ A;  4K17 A;  4PS8 A;  2VZK D;  2RPV A;  1XR0 B;  1MVK A;  3PG7 A;  1V1P A;  1JRP A;  1QOG A;  3QC8 B;  3V61 A;  4EUT A;  4ANX A;  4ANW A;  4JKF A;  2I5F A;  2E3T A;  3UQA A;  2MJE A;  2LRU A;  5BMG A;  2PKO A;  1YJJ A;  2GBR A;  4RF1 A;  1V81 A;  5IJM A;  2DIK A;  4IC7 B;  2KR0 A;  2MBH A;  2LHD A;  3ONS A;  3L13 A;  4NJC A;  2WDQ B;  1BT0 A;  1NDD A;  1C4P A;  4ANU A;  5LLI A;  3R66 C;  2Z13 A;  3AN1 A;  2HTH B;  2OJR A;  3KSY A;  2WXM A;  4AUQ C;  3AB5 A;  2M17 A;  3Q14 C;  1E9M A;  5G5H A;  1QOB A;  1GOZ A;  3PV1 A;  1FM0 D;  1WIA A;  2KO3 A;  3WAP A;  3WAN A;  2LD9 A;  1NYR A;  1GUA B;  4JGH B;  3D32 A;  3SO6 A;  3P6A A;  4ZOH C;  2MRP A;  3LJU X;  2KLG A;  4G50 A;  1DIK A;  2KDI A;  1ISN A;  4MEL A;  2ZCB A;  2JP2 A;  4AQ7 A;  3A9K A;  1RM6 C;  1SEB D;  1U5G A;  3CIR B;  4IW0 A;  2L32 A;  3TCA A;  4OW0 A;  4JIO U;  2RSU A;  5BYR A;  3WAL A;  4EZL A;  1M7E A;  1EM7 A;  4KVG B;  5DHF B;  3LYY A;  2CHZ A;  5C5B B;  1UGJ A;  2WDV B;  2K39 A;  1T0R C;  2ACZ B;  2K9X A;  3VTU A;  1TT5 B;  4TQ0 A;  4W9H A;  5DCN A;  2N9X A;  2V4I B;  2R0D A;  2MBO A;  4G11 A;  2IY1 B;  1TXD A;  1T0Y A;  4KV2 A;  2W55 A;  3M3J A;  3VH3 B;  4WIP A;  4HLE A;  3WYF B;  2LXA A;  1JWS D;  3DVN V;  1F52 A;  2K8B A;  4IFS A;  2DLW A;  1AQC A;  1S3S G;  2JZP A;  1FRR A;  4LDT B;  2COC A;  1FHO A;  4JX1 C;  1ZUD 2;  2JYT A;  2RDB C;  3R2T A;  2JZZ A;  4HEA 1;  5I2S A;  3KZ1 A;  4WWM A;  1XOD A;  3UI3 A;  1NI3 A;  1YJI A;  2COF A;  1DDM A;  2RPQ A;  1LQB A;  4BKS A;  4BBN C;  3U30 A;  4RNA A;  4DHJ B;  3L08 A;  2H89 B;  2A5U A;  2RD0 A;  3EUB 2;  1WXS A;  2LI5 A;  3ZXR A;  5IN7 A;  1WY8 A;  2HJ8 A;  3DHH C;  4XGA B;  4Q2J A;  1C76 A;  3AEG B;  1V9J A;  2HTH A;  1U2B A;  2RLO A;  2XN9 C;  4WUR A;  1T5X D;  1XQQ A;  1TBE A;  3BWU D;  1XX0 A;  2K6D B;  2L1A A;  1VZ6 A;  2DBY A;  2BB6 A;  3A9K B;  3NHE B;  4YTN B;  4JWU C;  1U5F A;  1DDW A;  5C23 A;  4LNO A;  5BMI A;  3DDC B;  4GLS C;  1N5W A;  3AH7 A;  1Y8R C;  3EA6 A;  4GOU A;  4ICV A;  2G1E A;  4A6F A;  2UZR A;  2JU6 X;  1J0W A;  2MBQ A;  1HTQ A;  3MFG A;  1W1D A;  5HE2 A;  2FJL A;  2D2Q A;  1Q0W B;  4RGN A;  2LYD A;  3QIJ A;  3RZW C;  1UBI A;  2AL3 A;  2R09 A;  1YN4 A;  4LJO B;  2YT0 A;  1IYF A;  4HWI B;  4MAC A;  1U4A A;  2CR5 A;  3I63 C;  3AE9 B;  1B9R A;  2LVP A;  2CRF A;  1UZX B;  1L0Y B;  1VD2 A;  2Y5B B;  2YLM A;  3AE2 B;  2IND C;  2WLB A;  4MDK E;  2KCJ A;  2Z0Q A;  3NWA A;  1WGY A;  2C60 A;  1K8R B;  2KXJ A;  1YQ4 B;  3JSV A;  1K52 A;  3K9P B;  3KWV A;  4ANV A;  1WGK A;  1KF6 B;  2KNB A;  3IT6 B;  4HAX B;  3VXW A;  4M0W B;  1NI2 A;  1KBL A;  1FOE A;  2PTL A;  2FIF A;  1V5O A;  2MH7 A;  5GXG B;  2DYQ A;  2QKM A;  4O1N A;  4DQO C;  5J3T A;  2FNJ B;  1YN5 A;  4K7W A;  4B9K A;  4IWP A;  4MGK E;  1HZ6 A;  4HB4 B;  4OVZ A;  2COA A;  2LMC A;  2BCJ A;  1P0R A;  1FXA A;  1QC6 A;  1BTN A;  3FIL A;  2KOX A;  4QJ4 B;  1B55 A;  1WX8 A;  2MP2 B;  5JP4 A;  1WH3 A;  4F7Z A;  1PUT A;  4I6L B;  1KTK A;  1KZ7 A;  1X1M A;  3L17 A;  4GMV A;  4DWF A;  4GU2 A;  3PSE B;  2YT1 A;  3AJ4 A;  4LNN A;  4MM3 B;  2VRW B;  3EC8 A;  3FEH A;  1NEK B;  4F7G A;  1BWN A;  4PYU A;  2GLS A;  1WVH A;  5JXV A;  2V0G A;  2LJ5 A;  4GDL A;  1YNT E;  3DWG C;  1SBB B;  1HQR D;  5CTR C;  1IGC A;  3IHP C;  3DBS A;  2NPT B;  4P1C C;  3BZD B;  3N32 A;  2O2V A;  4RGT A;  2G35 A;  3ZVR A;  5D3V A;  4IAP A;  4TQ1 A;  3PP2 A;  1EGX A;  2K1F A;  4IG7 B;  4Y94 A;  2WDR B;  5DHA B;  2BBC A;  3B2F A;  4NQK E;  5HFY A;  1WXV A;  2CHW A;  4YWG G;  3GYP A;  4M8N A;  5G5G A;  2KVR A;  3RT3 B;  4OSN A;  2V4L A;  3I9V 1;  2BT6 A;  1FPY A;  1UUP A;  4YTM B;  3KRW A;  3ULC A;  3ZJV A;  1K53 A;  5D7G A;  3TBL D;  1Q67 A;  4URK A;  2VKI A;  1NYQ A;  4QJ5 B;  1YN3 A;  1V5P A;  1X11 A;  2VH1 A;  4W9J A;  3D8F A;  1NBF C;  2N9P C;  1MJD A;  4HKQ A;  5J2R A;  1WI1 A;  5IOI A;  2V3P A;  4P6V F;  1LW3 A;  4JE3 B;  5G55 A;  3QJZ A;  2G4S A;  2L83 A;  1RWS A;  1SHC A;  4M01 A;  1V49 A;  2KDE B;  4LNF A;  1EO6 A;  2BYE A;  3MHS D;  3OAN A;  1GAQ B;  3QK0 A;  5D3D A;  2L00 B;  2QMT A;  1XKE A;  4B6H A;  2IGD A;  2Z0P A;  2CY5 A;  5DI9 B;  4KX6 B;  2EJ8 A;  1AN8 A;  2P0D A;  4US9 A;  1WGD A;  2W2X D;  1UPR A;  3TEZ A;  4JPS A;  2NZ8 B;  2WU5 B;  2BF8 B;  4W9D A;  4OZB A;  2YF0 A;  1WXQ A;  1E7U A;  3ODO A;  2BKR B;  1Z5S B;  3BIN A;  4HB3 B;  2GBK A;  4BFR A;  2BS3 B;  1C9F A;  3NSU A;  2DAJ A;  2LGY A;  2CU3 A;  4JQW C;  2LOZ A;  4JWS C;  2K5P A;  3J9C A;  4DHZ E;  2DN6 A;  4MH0 E;  4ZHO A;  1HE8 A;  3BYY B;  5EE9 A;  1SE4 A;  5J3Y A;  5DPT A;  4H8S A;  2KD0 A;  4HAT B;  1KFY B;  2VH2 A;  3R8B A;  1DRO A;  2M38 A;  3AEB B;  3TMP B;  2BYF A;  3CMM B;  1IGD A;  3W1S C;  1V1P B;  4W9F A;  2O6V A;  4HHV A;  3Q8E A;  5MPO A;  4WWN A;  4P1B C;  3NY5 A;  4P16 A;  2CQU A;  3NZU A;  4USA A;  3HW2 B;  5HG2 A;  1G6J A;  1L4Z B;  2MP2 A;  3Q3M C;  5EE0 A;  1XLO A;  3ZNI D;  1WE6 A;  2GOW A;  4II3 B;  2BS2 B;  4MGY E;  2RSG A;  2K00 A;  1MFW A;  2DZM A;  2M19 A;  4LLG M;  2KUP A;  4OVU A;  3T06 A;  1LXD A;  2FCS A;  4NAW A;  5JH5 C;  1FHW A;  2NBW B;  3ZDT A;  2ZPY A;  5IKC M;  1D3Z A;  3PZD A;  2P0F A;  3GZN B;  1PGB A;  1WF9 A;  1PGX A;  4FA6 A;  2R82 A;  4LNK A;  3GE3 C;  1L6V A;  2QIE B;  3A8P A;  5GMV A;  2N0Y A;  5I4D A;  2HJ1 A;  3ZLZ A;  3TEY A;  2DZJ A;  3A9J A;  4JK8 A;  4JK9 A;  1XCG A;  2N7J A;  3P4P B;  2FJ9 A;  2CKH B;  4HKZ E;  4W9K A;  3KLS X;  3JSV B;  4W9E A;  4ZYN A;  3FC4 A;  2CJO A;  3KUD B;  2HDE A;  4II2 B;  1I2H A;  2C7H A;  2JYE A;  2WWZ A;  1XT9 B;  4FN2 A;  1WWT A;  2Z0O A;  1XXG A;  2MWS B;  1CK1 A;  2Y5P A;  2WXG A;  3A33 B;  2A4Z A;  1N63 A;  2RQ1 A;  4K2P A;  1FGZ A;  4HAW B;  2BVC A;  2DLB A;  4A5K A;  3V6E B;  1A5R A;  2DNF A;  3VR8 B;  4WJQ A;  4TKN A;  3OJ4 B;  2MEK A;  3H7P A;  3VTW A;  5FI1 A;  5IAA C;  2ZCC A;  1JRO A;  4HPP A;  1DYQ A;  3SFE B;  3HQC A;  1SF0 A;  2IYB A;  2PZ1 A;  2BYT A;  1V5M A;  1Y5O A;  1KM7 A;  4GB9 A;  3ZNG C;  4NSW A;  2D9W A;  3K9O B;  1T6B X;  2KX0 A;  3CF6 E;  4TV3 A;  1RFK A;  4OHJ A;  1FHX A;  2DHK A;  2IYD B;  3SUZ A;  4R3D A;  5D2M B;  3NVY A;  1F9J A;  4QJ3 B;  5L95 C;  2YSZ A;  2LGS A;  4IUM B;  1K5G B;  5JVL A;  4K3B A;  4E3C A;  3SD5 A;  2NMQ A;  4KIK B;  1ZSQ A;  2CHX A;  2FAZ A;  5CHW A;  3BK1 A;  2D9V A;  1EAZ A;  3DVG Y;  1I4P A;  2JUO A;  5C6R A;  2M14 A;  3IG3 A;  1MK7 B;  3ZVV A;  2NCN A;  2KQS A;  3M63 B;  2MCN B;  1FNW A;  4EKU A;  2V3N A;  2NPT A;  3EFU A;  1TS3 A;  4FJY A;  3AE3 B;  4LK0 M;  3NW8 A;  1ZYI A;  2GCL A;  3URY A;  5DPS A;  5JHG A;  4CHK A;  4JL9 A;  1UEF A;  1WFY A;  3Q8A A;  3B08 A;  3D8D A;  5J3Q A;  2KWC A;  1U5D A;  4L1B A;  2AEH A;  1S1Q B;  3PLV A;  2BWE S;  4FUL A;  4A90 A;  3PRZ A;  2ELB A;  2BWF A;  4KZC A;  1ZP0 B;  2G3Q B;  1D4B A;  1WJ6 A;  1SE3 A;  2L3Z A;  2Z4D A;  2BTE A;  2X0S A;  2FJU B;  3ZRF A;  1V80 A;  4A6F B;  4IM2 A;  5C1Z A;  1KRH A;  3ZNZ B;  1B1Z A;  2QC8 A;  2JZ3 B;  1VCB A;  4N58 A;  2D3G A;  1UNQ A;  3DVG X;  4W9C A;  1TQZ A;  3VAW A;  3KUZ A;  4WJP A;  4XWX A;  5HHD G;  1WE7 A;  2J59 M;  2MSE D;  3FVC A;  2W3S A;  2WXO A;  2QCZ A;  4GMX B;  2SAK A;  3D8E A;  2I5C A;  1DOI A;  1SB3 C;  1JWU D;  1HB6 A;  4WH4 A;  3VH4 B;  4GZU A;  3BVZ A;  4HRO A;  4JKG B;  1ET6 A;  2Z8L A;  1FFV A;  4MSQ B;  1KLV A;  3T3N A;  3W5U B;  4HAU B;  2KFK B;  4CO7 A;  2J7Q B;  4JKE A;  1VDV A;  2NBU A;  1UH6 A;  2INP E;  4E71 A;  5I2M A;  3VRA B;  3BJI A;  3APC A;  3Q2A C;  4HAY B;  4FAD A;  3QA8 A;  2N1W A;  5EE1 A;  2YEP F;  3ZKJ C;  4GN1 A;  4KHB B;  2NBV B;  1WR1 A;  1ZXH A;  2AWT A;  2RGN B;  1TY2 A;  4YXD B;  4JKC A;  5L83 A;  1JCK B;  3DHG C;  1WX9 A;  1L0X B;  1YJ1 A;  3OHM B;  2DWQ A;  5G2N A;  1FNV A;  2ZNV C;  1WXM A;  3A1Q A;  2QJL A;  4WVF B;  3OAW A;  1IRS A;  4HSI A;  2UVM A;  1VZ8 A;  1L0V B;  4PT5 A;  2OHF A;  4GXB A;  1FB8 A;  1V2Y A;  5AEK B;  2JRI B;  3ENB A;  1JDE A;  3HSA A;  2QIL A;  1ACC A;  2DX5 A;  2ADZ A;  1DGJ A;  2L0T A;  2GBN A;  2C7M B;  1ACA A;  2WU2 B;  4MGI E;  4A6Q A;  4TMA B;  2KTR B;  3DVN U;  1C4A A;  4ARC A;  4C4V A;  1TY0 A;  3VRB B;  3L0W B;  2RNR B;  3KW5 B;  4MK0 A;  3TO1 A;  2ON8 A;  4JLC A;  2X38 A;  4WQO B;  1AWE A;  1XLN A;  3Q3F A;  2KHW B;  4WJN A;  3HRD D;  1SSN A;  4ZRP A;  3ETR A;  3NVW A;  2PMV A;  1V6E A;  1MIZ B;  4BAX A;  5JZE B;  4L1R A;  1H10 A;  4WQM A;  2PW9 A;  3WAM A;  4NJ7 A;  3B77 A;  1JAL A;  4S0R A;  4AP4 C;  1GNU A;  3GP7 A;  4F7U P;  1JRU A;  2L76 A;  4A6K A;  2XNA C;  5HE0 A;  4GOC A;  1DOY A;  1OQQ A;  1QZE A;  5KCV A;  3QWM A;  4MT5 A;  1X1G A;  2YS1 A;  4GDK B;  2KLC A;  4M0W A;  3N7C A;  1SXT A;  4IWO A;  2JQR B;  2REX A;  1N62 A;  5CHF A;  1V88 A;  1QKZ A;  1C77 A;  2COD A;  1ZXI A;  4MM3 A;  4KHO A;  2KN5 A;  4ZRK A;  1FMA D;  3I3T B;  5D94 A;  3JVZ X;  3SBT A;  4TYZ A;  1EWY C;  1BML C;  1I4G A;  1Q5W B;  1K51 A;  2LVO A;  3U2S C;  3KQ4 A;  3HHM A;  4YT0 B;  4JKB A;  2RUK B;  3BVG A;  4RFB A;  4MGZ E;  2FID A;  1KI1 B;  3FIL B;  4MEM A;  2DTC A;  4ILH A;  3SU8 X;  3TEX A;  2L1C A;  2MBE A;  1UF0 A;  3V05 A;  1QQR A;  4S17 A;  1TJ6 A;  2LAS A;  2IO3 B;  5DIF B;  1P5T A;  2JWU A;  2JXX A;  4RMA A;  2MLB A;  3AE4 B;  3RMK C;  1I42 A;  1Q10 A;  4C0A A;  3FP5 A;  2N1V A;  3DXD A;  1WX7 A;  2AQ2 B;  2MHJ A;  4D0N B;  2BYV E;  3MTN B;  2VSZ A;  2KQ7 A;  3L4P A;  2Y8F A;  2N23 A;  4EE2 A;  3R7R A;  3SNH A;  4QXA B;  4RF0 A;  2R2Q A;  5TSS A;  2D5G A;  1I4X A;  1QF6 A;  1H4R A;  3FM8 C;  4GGQ A;  1JQ4 A;  2LVQ A;  2LJI A;  3RNA C;  3W1S A;  1WM2 A;  4K3C A;  4WSF A;  1OQY A;  3B1L X;  2KFJ A;  1JW9 D;  2PIA A;  4EZK A;  3ENE A;  1N3H A;  1U5E A;  3TIX A;  1YOV B;  1ZM0 A;  1N6Z A;  3EHV A;  3V60 A;  4IOY X;  1WYG A;  2DYB A;  3O96 A;  3LDZ E;  2RDG A;  3QCA A;  2BS4 B;  4JKG A;  1FCC C;  2AQ3 B;  2KDM A;  3HM6 X;  3SDL C;  2BPS A;  4BKG A;  2ZW0 A;  1IBX B;  3A4R A;  2D9Y A;  4PNK A;  1RRP B;  4DK5 A;  2UZS A;  4LTU A;  3RUL A;  1ESF A;  4C80 A;  1OFF A;  3GE8 C;  2ROZ B;  5AZH A;  2Q5W D;  2ZEQ A;  2AQ1 B;  1KLG D;  1UNP A;  2NVU I;  1LFD A;  3H7S A;  2N9E B;  3Q6B A;  3HM3 A;  2L52 A;  1WJM A;  1EF5 A;  2KTR A;  3M62 B;  1OEY A;  1E5W A;  3VUX A;  2MWN B;  2RR9 A;  2D11 A;  1OEY J;  2K25 A;  3NS1 A;  5CLL B;  4WAA A;  1WGU A;  3P4Q B;  4MJS A;  5J18 A;  3MC0 B;  2INC C;  4K2O A;  3HIE A;  4FHK A;  1OTR B;  3A1Q B;  3DCX A;  3UZT A;  3VR9 B;  2R61 A;  3CXB B;  2W2X C;  3PVW A;  2DAF A;  3CIK A;  1HBK A;  3U12 A;  4RM8 A;  2J42 A;  1MKE A;  1WMH B;  4HCN B;  4DBG A;  2FE8 A;  2I38 A;  1WXA A;  2KQ4 X;  2ROV A;  2CAY A;  3ALB A;  3WIM A;  2H7D A;  2NBV A;  1V5T A;  4M00 A;  1GB1 A;  4DHJ D;  2WS3 B;  1TJE A;  3ZRC A;  5FI0 A;  1X86 A;  2JWZ A;  2KYW A;  5LG4 B;  3RNG C;  1MHX A;  2IDY A;  4B0M A;  5HI1 A;  2DHI A;  2LOX A;  1QOA A;  1T3Q A;  5CX3 A;  2LXC A;  2YS3 A;  3BVM A;  1FXI A;  4K81 A;  3NVZ A;  4A3P A;  3X0W A;  3N20 C;  1WI0 A;  1VBG A;  4BZA A;  5BYQ A;  2XK5 B;  2INN E;  4KIK A;  2KZR A;  3MC9 A;  1PFD A;  3ML9 A;  2FCQ A;  3NG0 A;  2P0H A;  2K8H A;  1V61 A;  3RUI B;  3N3K B;  1P1A A;  3Q69 A;  1X05 A;  3N1Z C;  3KH0 A;  3T3O A;  3U7D A;  2N0S B;  3AEF B;  4C7Y A;  5LNK 1;  2PVO D;  3C19 A;  1OY2 A;  3V6C B;  3APD A;  1N60 A;  2IPK D;  2PJH A;  1QT9 A;  3GYO A;  4J3O D;  3PZ8 A;  4NAM A;  3V3X A;  1ZPS A;  5LON B;  5E6O A;  1PDX A;  2C5L C;  3ZTC A;  3DOW A;  1KLU D;  3ZGZ A;  2EKI A;  1TYG B;  3NJT A;  1R4M I;  3H1U A;  1WRI A;  2M4N A;  3DBH B;  2GCJ A;  3KVF B;  1J7C A;  1J0G A;  2I2Y A;  1HEZ E;  3VDZ A;  4LJP B;  2AL6 A;  3PTF C;  4MSM B;  2QSD A;  4REZ A;  3ZNH B;  2EEL A;  5E6J A;  1KOT A;  4B6W A;  1XLP A;  3P4R B;  4JK7 A;  3UGB B;  3RCZ A;  1WG7 A;  1NEN B;  1PFJ A;  1F2R I;  3AE1 B;  5HE1 A;  3IBE A;  3APF A;  5JHB A;  3TFM A;  5CHV C;  2HRJ A;  2M8S A;  3NOB A;  1H8C A;  1MIX A;  1BUI C;  2WGS A;  2XBB C;  1WGR A;  2JSV X;  4BBN F;  3ZJT A;  1E8X A;  4QAY A;  3AEA B;  3E9P A;  5C3J B;  3G9W A;  2NTS A;  4NPN A;  2COP A;  4DX8 A;  1FCL A;  2RGF A;  4XE0 A;  2B3A A;  3PS6 A;  1EF1 A;  1UEL A;  1I35 A;  1M7R A;  1HXY D;  4FHJ A;  2FUG 1;  2WP9 B;  4B0E A;  2G45 B;  4HVB A;  2DZI A;  5H92 C;  5C16 A;  2K2U A;  3GS2 A;  2WHI A;  2FCM A;  2C9W B;  3PO0 A;  2IO0 B;  3BY4 B;  5C2T B;  4IWQ A;  3W9C B;  4LCD E;  3T8M A;  5AZF A;  2QDF A;  2AX5 A;  3RNC C;  4DDG D;  5KHQ A;  1E0Z A;  1ET9 A;  2D4Q A;  1SE9 A;  3ZTD A;  1XD3 B;  4FJV B;  1LM8 B;  1GB4 A;  4CHJ A;  2PEA A;  2ASQ A;  4K7S A;  3H7P B;  2O6V D;  2O2V B;  2EKE C;  2V3S A;  1I4Q A;  1YX5 B;  1V89 A;  1WR6 E;  2Y3A A;  4ILG B;  4A6H A;  1DOX A;  2E6X A;  3M1I B;  1P6S A;  1PLS A;  2GB1 A;  2JT4 B;  3FAH A;  1GG3 A;  2QHO A;  1TZ1 A;  3PZ7 A;  2PPH A;  1FXT B;  4AJY B;  4KKJ A;  4KKI A;  1FAO A;  4IOI E;  1XD4 A;  4K1R B;  3E9O A;  1F1H A;  2CU1 A;  2RDH A;  2M0X A;  1T77 A;  4EMO A;  3CSF A;  3ODW A;  4E74 A;  3OG5 A;  1VLB A;  2ICI A;  4KZ0 A;  2ZNV B;  3RN9 C;  3GOE A;  2DHZ A;  3I5J C;  2KWV B;  2DKQ A;  3TVV A;  3HVZ A;  5IP4 D;  5H8Y E;  2H7E A;  1SGH A;  4KGR A;  3PRE A;  4WJ7 A;  2UU7 A;  2N4F A;  4XC2 A;  1WJ1 A;  3C0R B;  1KJT A;  4GPT B;  2KIE A;  1V86 A;  1ZVR A;  1FO4 A;  5DPR A;  1OQN A;  3DBH I;  2MKR A;  2D3C A;  2KC1 A;  4EFO A;  3Q3J A;  2WXH A;  1MHH E;  3AMZ A;  2H88 B;  4EOY A;  1FGY A;  3VFK A;  2VZK B;  4OVV A;  2N7E A;  2WX1 A;  2ZVO A;  2Q13 A;  3IAM 1;  5E6N A;  3U8Z A;  1ROE A;  1WMH A;  3SFD B;  1DBH A;  1CJE A;  1D6E C;  3KYD D;  4HDQ A;  4KHA A;  3O65 B;  2FUH B;  3VUW A;  4ZRQ A;  1D5X C;  3LB8 C;  1CZP A;  4W9L A;  1I4R A;  4KGT A;  5HE3 A;  1PYW D;  2IGG A;  3TEW A;  2EMS A;  4GNK B;  2R2O A;  4G3X B;  2ELA A;  1JWB D;  5HKH A;  3EEC A;  1WJN A;  4ZRI A;  2ZPN A;  3ZXV A;  1BAK A;  3AEE B;  4N6E B;  3IT4 B;  3JW0 X;  3IXS A;  4HRS A;  5AUK A;  2YS5 A;  1UWM A;  2IFS A;  3MC8 A;  4CHM A;  4NNJ B;  1SIJ A;  4NZL B;  1XCQ L;  1JWM D;  3WA0 A;  1WGG A;  3TSS A;  3LJ3 A;  1HTO A;  5LXH A;  2V1Y A;  3V5W A;  1P7F A;  2WXF A;  3AI5 A;  3Q8F A;  2BKF A;  2MX2 A;  5J17 A;  2YRY A;  2D07 B;  2WNM A;  2Z59 B;  1IP9 A;  3PRM B;  1CMX B;  2OJW A;  4M8M A;  1E8Y A;  4GSW A;  1E10 A;  4FBJ B;  2YT2 A;  1L2N A;  4ARI A;  3P42 A;  2EMT A;  1Z2M A;  2NTT A;  4K7U A;  2G4D B;  3DXE A;  2DKP A;  4WAF A;  4ACF A;  4HJG E;  4DXF A;  1JWA D;  1XO3 A;  2LUM A;  1NTV A;  2BGF A;  1W1H A;  2D3A A;  3DWM A;  5L81 A;  3MJW A;  3QAR A;  4D2K A;  2K49 A;  3NS8 A;  2GMI C;  4RCO A;  4UDU C;  2LEK A;  1L5P A;  3NVV A;  1M4V A;  1I7H A;  1D5Z C;  1Q1O A;  3E56 A;  4Z2N A;  3L10 B;  4WWP A;  2OOB B;  4A3O A;  1HZ5 A;  2MW5 A;  1WGQ A;  1LO5 D;  5C79 A;  4BKT A;  3RFZ B;  2KGX B;  1LB1 A;  1WJ4 A;  3MJ5 A;  4AS1 A;  2KWD A;  4A55 A;  5D6J B;  3ULB A;  1NVI D;  2OQB A;  5EFX A;  1RYJ A;  3WCQ A;  1ST7 A;  3W1Y A;  1E7P B;  3VOQ A;  1WZ0 A;  3U4E G;  2LUL A;  3DHI C;  3VIA A;  2KK8 A;  4C4V B;  1C3T A;  2NS5 A;  5D3W A;  3IAS 1;  1YX6 B;  4XWW A;  4X57 B;  1T0Q C;  5E6P A;  3R2I A;  2DYN A;  3F0W A;  4MY6 A;  2DA0 A;  1RFA A;  2KUQ A;  5IA7 A;  3FLV A;  3IVF A;  3RZF A;  1W1G A;  1C79 A;  2KMA A;  3OJ3 A;  1GGO A;  3W2D A;  1YIW A;  2J0J A;  2JPH A;  4HAV B;  3N9Y C;  3H9D A;  3PLU A;  1VRA B;  3QBV B;  1TIF A;  3PHW B;  3QWZ B;  2ZJD A;  3TJP A;  1MAI A;  4HPL B;  1JML A;  1F2R C;  1Y56 A;  1V97 A;  4I6N B;  2XK5 A;  2DX1 A;  1V1O A;  1NU2 A;  2O6V B;  1PMS A;  4YL8 A;  5D3Y A;  3TW1 A;  3KY9 A;  3ZIM A;  2FBW B;  3L54 A;  3TL5 A;  2J0M A;  3FSS A;  3P4S B;  4XZ4 A;  3AE6 B;  3L16 A;  1ENF A;  2ZVN A;  3A9J B;  5D3I B;  4OZA A;  2LUE A;  2D3B A;  3NWF A;  1KC7 A;  4CYE A;  3AV8 A;  4RGO S;  5TR5 A;  2RVB B;  2BB5 A;  2LRW A;  3VHT C;  2JXT A;  2UWQ A;  2WXP A;  3AEC B;  4LDT D;  3KRX A;  2KAN A;  1TS2 A;  3QQ8 B;  4XDD A;  1XLQ A;  2DEN B;  3W5V B;  3CST A;  5BYS A;  1TKE A;  3UF8 A;  2PE6 B;  3OLM D;  4DBB A;  4IKG A;  1WSP A;  3P1M A;  2W2W A;  4YSX B;  4HK2 A;  4C00 A;  4PYZ A;  5AZG A;  1ZW7 A;  3KWL A;  2CY4 A;  3SHQ A;  1NTY A;  3R3M A;  4J6I A;  1VZ7 A;  3QHT A;  2GS0 A;  4RGM A;  3GB1 A;  3Q8C A;  2GUM A;  4HB0 B;  4CSQ A;  1SJH D;  3ML4 A;  4KGS A;  5DH9 B;  3AE8 B;  3QX1 A;  3P7Z A;  4NQL B;  1D5M C;  1FNU A;  1UNS A;  3EPY A;  2CS4 A;  5EE3 A;  3P2B A;  3WAO A;  2EC1 A;  2MDX A;  4KHB A;  5LOP B;  3B9J A;  2N9L A;  1MPE A;  3B2G A;  2Y5C A;  2L8J A;  3A58 A;  2WX0 A;  4LNI A;  2PLP A;  1K50 A;  1F0Z A;  4YSY B;  4OZC A;  2KT7 A;  4GDK A;  4N9F 4;  4XYC A;  3ZUN A;  3DBR B;  2OED A;  3HVD A;  1UD7 A;  1EUV B;  3MPX A;  1P7E A;  2IO2 B;  1XEE A;  3R7Q A;  2K8E A;  5JHA A;  2LFI A;  3HIZ A;  2LGD A;  3PEG A;  2VRR B;  4BOS C;  4GDL B;  4W9G A;  2DZK A;  4EZJ A;  3RPF C;  2M56 B;  1P3R A;  1ZE3 D;  3AU5 A;  3H6N A;  1ZOY B;  4ASW C;  1OGW A;  3QAQ A;  2GJY A;  3RD2 A;  4C7Z A;  3FKY A;  3RNE C;  1FRD A;  5IRS A;  2J4X A;  4BOZ B;  1MG8 A;  1EU4 A;  1WM3 A;  3A4S C;  1TKY A;  4HJK A;  1WJU A;  3NZ3 A;  2Z0D B;  3VVW B;  3ABV B;  1YD8 U;  4BVU C;  4IM3 A;  2HE7 A;  4PQ0 A;  2ABD A;  1HA5 A;  2WXN A;  2ONQ A;  1TS5 A;  3MDB C;  4YSZ B;  3X23 A;  2KJH B;  2P8V A;  1IBX A;  4A20 A;  3HK0 A;  3PSC A;  2MJ3 A;  1IUE A;  1Y19 B;  2LGI A;  2KJ6 A;  3VQI A;  4P7I A;  2V9H A;  2ZZP B;  2YVC A;  4OT1 A;  1E8Z A;  1TGZ B;  5LXI B;  4C56 C;  1F77 A;  1I7A A;  4NJ6 A;  1EWC A;  2NR2 A;  1IPG A;  5BMH A;  3NRZ A;  1UNR A;  2IJ0 A;  3SEB A;  2TSS A;  4A8X C;  1WRD B;  2SEB D;  4MJS B;  3ZQ4 A;  2BW2 A;  1SIF A;  4MH8 A;  3ODX A;  4HDO A;  3E9L A;  2XEW A;  3U7Z A;  4F7H A;  3N1Y C;  3UIO B;  4ZRJ A;  2E2X A;  2L7R A;  2PE9 A;  1QIL A;  1UWX A;  2RRF A;  2KMC A;  4HB2 B;  4ZDV A;  3RI7 C;  5JLJ B;  2KDF B;  1C78 A;  3Q8B A;  1YQ3 B;  3ECI A;  2N9K A;  3NWD A;  2KMM A;  3U52 E;  2CB8 A;  1STE A;  3F5R A;  4DDI D;  4DIX A;  5CLQ B;  1UGM A;  2WXQ A;  5IO9 A;  1J19 A;  1A70 A;  4NAW B;  3AUL A;  3E66 A;  5FK9 C;  4YON A;  3OWE B;  3V62 A;  1WGH A;  2D10 A;  2GRI A;  1EVH A;  5KQ1 A;  3RNF C;  2N7D A;  1TS4 A;  2IO1 B;  3TUO A;  2GBM A;  3BYT B;  2R2Y A;  3PT2 B;  1DYN A;  1Z87 A;  2KWU B;  2D9Z A;  2W82 A;  1MI1 A;  4YTP B;  4AOF A;  4XX5 A;  5AUI A;  2KDB A;  1GC6 A;  4KSK C;  1GPX A;  3VUY A;  1UPQ A;  4FXC A;  1TKG A;  4JKA A;  1KH0 A;  2UYZ B;  5FR3 A;  4BKS D;  5T8I A;  1VBH A;  1VR9 A;  3C8Y A;  2MA9 B; 
#chains in the Genus database with same CATH homology
 2DFK A;  3NZS A;  1RLF A;  2JVC A;  3PVU A;  3M95 A;  2W9N A;  2KC2 A;  3DCG A;  3T9L A;  3DXC A;  2WYQ A;  1PQS A;  1P9D U;  1C1Y B;  4WJO A;  2J0K A;  4KDI C;  1L7Y A;  4FLH A;  4NY0 A;  4TUU A;  4AJW A;  2QKL A;  3ZDM C;  2L0F A;  2MBB B;  1GC7 A;  4PS3 A;  4ILJ A;  2DYO A;  4I6P A;  1V5U A;  3PHX B;  4ICU A;  2FDQ A;  1R4N I;  2DX5 B;  1WZ3 A;  3DBL I;  2K8C A;  3DBR I;  3PGE A;  2D9X A;  4L6E A;  5D27 A;  2L05 A;  2MQJ A;  3A8Q A;  2NMB A;  3JYU A;  5D3X A;  4FJZ A;  3UQB A;  1MPH A;  2DHJ A;  5KQ4 A;  1U29 A;  2L2I A;  3IFW B;  1DDV A;  1E7V A;  2LZ6 A;  2HD5 B;  1AAR A;  3UIN B;  4KSL C;  4HCP B;  2LBB A;  4DX9 0;  3PRP B;  2X18 A;  1M94 A;  4W9I A;  2Y8G A;  1RRB A;  2JRH A;  3DQV A;  4B95 A;  3RYT A;  3SV1 A;  5C5B A;  4HAZ B;  1RAX A;  1WYW B;  2LKO A;  2I1J A;  4G0N B;  1P98 A;  2XQN M;  3ZW3 A;  1NVL A;  2M1M A;  2LWP A;  1K5D B;  3RCP A;  2LGX A;  3GZN I;  4JKD A;  2IBI B;  2C7N B;  3UIP B;  3PVL A;  3ZO5 B;  2Z0E B;  2IY0 B;  4HXD A;  2LG1 A;  3B0A A;  4BBK A;  5JHH A;  4DXA B;  5GOW B;  4JKH A;  2K2J A;  4DHZ B;  3KYC D;  2KKC A;  1ZKH A;  3SYX A;  4F8C B;  1E90 A;  4IM0 A;  3PPA A;  1OMW A;  1X1F A;  1ZC3 B;  2MFQ A;  2GBJ A;  4F1S A;  2IZV B;  3SBG A;  1GJZ A;  1HB8 A;  2KFK A;  2DYM A;  2I1K A;  3VTV A;  2FCN A;  5EDS A;  2WH5 A;  1NTI A;  1TTN A;  1MK9 B;  4KDL B;  4RM9 A;  4WWO A;  4MT7 A;  2JY6 A;  2OTX A;  4GIV A;  3DPD A;  1E8W A;  1J8C A;  2V76 A;  1RJ2 A;  2KX3 A;  3S2A A;  3AXC A;  2KJR A;  2KTF A;  5KHO A;  4EJN A;  5FR6 A;  4KAX B;  2WDT B;  4PS7 A;  2AYO B;  4HPM B;  1P3Q U;  3AU4 A;  1KZG A;  5BO4 B;  1ZC4 B;  1BTK A;  3N30 A;  1U27 A;  1ZGU B;  2Y7B A;  1QQG A;  3A98 B;  1UBQ A;  2K6Q A;  3KUC B;  3ML8 A;  1YQB A;  2JF5 A;  4Z2M B;  4EEW A;  5DPW A;  4AWJ A;  4K17 A;  4PS8 A;  1XR0 B;  3PG7 A;  3QC8 B;  3V61 A;  4EUT A;  4ANX A;  4ANW A;  4JKF A;  2I5F A;  3UQA A;  2LRU A;  2GBR A;  1V81 A;  5IJM A;  2DIK A;  4IC7 B;  2MBH A;  3ONS A;  3L13 A;  1BT0 A;  1NDD A;  4ANU A;  5LLI A;  3R66 C;  2HTH B;  2OJR A;  3KSY A;  4AUQ C;  2M17 A;  3PV1 A;  1WIA A;  2KO3 A;  3WAP A;  3WAN A;  2LD9 A;  1GUA B;  4JGH B;  3D32 A;  3SO6 A;  3P6A A;  2MRP A;  3LJU X;  2KLG A;  4G50 A;  1DIK A;  2KDI A;  1ISN A;  4MEL A;  2ZCB A;  2JP2 A;  3A9K A;  1U5G A;  4IW0 A;  3TCA A;  3WAL A;  4JIO U;  2RSU A;  4EZL A;  1M7E A;  4KVG B;  5DHF B;  2CHZ A;  5C5B B;  2K39 A;  3VTU A;  4TQ0 A;  4W9H A;  5DCN A;  2N9X A;  2R0D A;  2MBO A;  4G11 A;  2IY1 B;  1TXD A;  1T0Y A;  4KV2 A;  3M3J A;  3VH3 B;  4HLE A;  3WYF B;  2LXA A;  3DVN V;  2K8B A;  4IFS A;  2DLW A;  1AQC A;  1S3S G;  4LDT B;  2COC A;  1FHO A;  2JZZ A;  3KZ1 A;  1XOD A;  2COF A;  1DDM A;  2RPQ A;  1LQB A;  4BKS A;  4BBN C;  3U30 A;  4DHJ B;  3L08 A;  2A5U A;  2RD0 A;  1WXS A;  2LI5 A;  1WY8 A;  2HJ8 A;  1V9J A;  2HTH A;  1U2B A;  2RLO A;  1XQQ A;  1TBE A;  1XX0 A;  2K6D B;  3A9K B;  3NHE B;  1U5F A;  1DDW A;  5C23 A;  3DDC B;  1Y8R C;  4ICV A;  4A6F A;  2UZR A;  1J0W A;  2MBQ A;  1W1D A;  5HE2 A;  2FJL A;  2D2Q A;  1Q0W B;  2LYD A;  3QIJ A;  3RZW C;  1UBI A;  2AL3 A;  2R09 A;  4LJO B;  2YT0 A;  1IYF A;  4HWI B;  1U4A A;  2CR5 A;  2CRF A;  2LVP A;  1UZX B;  2Y5B B;  1VD2 A;  2YLM A;  4MDK E;  2KCJ A;  2Z0Q A;  1WGY A;  3K9P B;  2C60 A;  1K8R B;  2KXJ A;  3JSV A;  4ANV A;  2KNB A;  4HAX B;  3VXW A;  4M0W B;  1NI2 A;  1KBL A;  1FOE A;  2FIF A;  1V5O A;  2DYQ A;  2QKM A;  5J3T A;  2FNJ B;  4K7W A;  4B9K A;  4IWP A;  4MGK E;  4HB4 B;  2COA A;  2BCJ A;  1P0R A;  1QC6 A;  1BTN A;  2KOX A;  1B55 A;  1WX8 A;  2MP2 B;  5JP4 A;  1WH3 A;  4F7Z A;  4I6L B;  1KZ7 A;  1X1M A;  3L17 A;  4GMV A;  4DWF A;  4GU2 A;  3PSE B;  2YT1 A;  3AJ4 A;  2VRW B;  3EC8 A;  3FEH A;  4F7G A;  1BWN A;  4PYU A;  1WVH A;  2LJ5 A;  4GDL A;  5CTR C;  3IHP C;  3DBS A;  2NPT B;  3N32 A;  2O2V A;  2G35 A;  3ZVR A;  5D3V A;  4IAP A;  4TQ1 A;  3PP2 A;  1EGX A;  2K1F A;  4IG7 B;  4Y94 A;  4NQK E;  5DHA B;  1WXV A;  2CHW A;  3GYP A;  4M8N A;  2KVR A;  3RT3 B;  2V4L A;  3KRW A;  3ULC A;  5D7G A;  3TBL D;  1Q67 A;  4URK A;  2VKI A;  1V5P A;  1X11 A;  4W9J A;  3D8F A;  1NBF C;  2N9P C;  5J2R A;  1WI1 A;  5G55 A;  1LW3 A;  3QJZ A;  2G4S A;  1SHC A;  1V49 A;  2KDE B;  1EO6 A;  2BYE A;  3MHS D;  3OAN A;  3QK0 A;  2L00 B;  1XKE A;  4B6H A;  2Z0P A;  2CY5 A;  5DI9 B;  2EJ8 A;  2P0D A;  1WGD A;  2W2X D;  1UPR A;  2NZ8 B;  2BF8 B;  4W9D A;  2YF0 A;  1E7U A;  3ODO A;  2BKR B;  1Z5S B;  3BIN A;  4HB3 B;  2GBK A;  4BFR A;  3NSU A;  2DAJ A;  2LGY A;  4JQW C;  2LOZ A;  4DHZ E;  2DN6 A;  4MH0 E;  1HE8 A;  5J3Y A;  5DPT A;  4H8S A;  2KD0 A;  4HAT B;  1DRO A;  2M38 A;  3TMP B;  2BYF A;  3CMM B;  3W1S C;  4W9F A;  2O6V A;  4HHV A;  4WWN A;  3NY5 A;  2CQU A;  3NZU A;  3HW2 B;  1G6J A;  2MP2 A;  3ZNI D;  1WE6 A;  2GOW A;  4II3 B;  4MGY E;  2RSG A;  2K00 A;  2DZM A;  2KUP A;  4OVU A;  3T06 A;  1LXD A;  2FCS A;  4NAW A;  5JH5 C;  1FHW A;  2NBW B;  3ZDT A;  2ZPY A;  1D3Z A;  3PZD A;  2P0F A;  1WF9 A;  4FA6 A;  2R82 A;  5GMV A;  3A8P A;  2N0Y A;  3ZLZ A;  2DZJ A;  3A9J A;  4JK8 A;  4JK9 A;  1XCG A;  2FJ9 A;  2CKH B;  4W9K A;  3JSV B;  4W9E A;  4ZYN A;  3KUD B;  4II2 B;  1I2H A;  2C7H A;  2WWZ A;  1XT9 B;  4FN2 A;  2MWS B;  2Z0O A;  3A33 B;  2A4Z A;  2RQ1 A;  4K2P A;  1FGZ A;  4HAW B;  3V6E B;  4A5K A;  1A5R A;  4WJQ A;  4TKN A;  3OJ4 B;  3H7P A;  3VTW A;  5FI1 A;  5IAA C;  2ZCC A;  3HQC A;  2IYB A;  2PZ1 A;  1V5M A;  1Y5O A;  1KM7 A;  4GB9 A;  3ZNG C;  4NSW A;  2D9W A;  3K9O B;  2KX0 A;  3CF6 E;  4TV3 A;  1FHX A;  2DHK A;  2IYD B;  3SUZ A;  5D2M B;  1F9J A;  5L95 C;  2YSZ A;  4IUM B;  1K5G B;  5JVL A;  4E3C A;  3SD5 A;  4KIK B;  1ZSQ A;  2CHX A;  2FAZ A;  5CHW A;  2D9V A;  1EAZ A;  3DVG Y;  2JUO A;  5C6R A;  2M14 A;  3IG3 A;  1MK7 B;  3ZVV A;  2NCN A;  2KQS A;  3M63 B;  2MCN B;  4EKU A;  2NPT A;  3EFU A;  4FJY A;  2GCL A;  5DPS A;  5JHG A;  4CHK A;  4JL9 A;  1UEF A;  1WFY A;  3B08 A;  3D8D A;  5J3Q A;  2KWC A;  1U5D A;  2AEH A;  1S1Q B;  3PLV A;  2BWE S;  4FUL A;  3PRZ A;  2ELB A;  2BWF A;  4KZC A;  2G3Q B;  1WJ6 A;  2L3Z A;  2X0S A;  3ZRF A;  1V80 A;  4A6F B;  4IM2 A;  5C1Z A;  3ZNZ B;  2JZ3 B;  1VCB A;  2D3G A;  1UNQ A;  3DVG X;  4W9C A;  1TQZ A;  3VAW A;  3KUZ A;  4WJP A;  4XWX A;  1WE7 A;  2J59 M;  2MSE D;  4GMX B;  3D8E A;  2I5C A;  1HB6 A;  3VH4 B;  4GZU A;  4JKG B;  4MSQ B;  1KLV A;  4HAU B;  2KFK B;  4CO7 A;  2J7Q B;  4JKE A;  2NBU A;  1UH6 A;  4E71 A;  3BJI A;  3APC A;  4HAY B;  4FAD A;  3QA8 A;  2N1W A;  3ZKJ C;  4GN1 A;  4KHB B;  2NBV B;  1WR1 A;  2AWT A;  2RGN B;  4JKC A;  5L83 A;  1WX9 A;  1YJ1 A;  5G2N A;  2ZNV C;  1WXM A;  3A1Q A;  4WVF B;  3OAW A;  1IRS A;  2UVM A;  4GXB A;  1FB8 A;  1V2Y A;  5AEK B;  3ENB A;  2JRI B;  1JDE A;  2DX5 A;  2ADZ A;  2L0T A;  2GBN A;  2C7M B;  1ACA A;  4MGI E;  2KTR B;  3DVN U;  3L0W B;  2RNR B;  3KW5 B;  4MK0 A;  3TO1 A;  4JLC A;  4WQO B;  1AWE A;  3Q3F A;  2KHW B;  4WJN A;  1V6E A;  1MIZ B;  5JZE B;  1H10 A;  3WAM A;  4NJ7 A;  4AP4 C;  1GNU A;  4F7U P;  1JRU A;  2L76 A;  4A6K A;  5HE0 A;  4GOC A;  1QZE A;  5KCV A;  3QWM A;  1X1G A;  2YS1 A;  4GDK B;  2KLC A;  3N7C A;  4IWO A;  2REX A;  5CHF A;  1V88 A;  2COD A;  4MM3 A;  4KHO A;  2KN5 A;  4ZRK A;  3I3T B;  5D94 A;  3JVZ X;  3SBT A;  4TYZ A;  1Q5W B;  2LVO A;  3HHM A;  4JKB A;  2RUK B;  4MGZ E;  2FID A;  1KI1 B;  4MEM A;  2DTC A;  4ILH A;  3SU8 X;  2L1C A;  2MBE A;  1TJ6 A;  2LAS A;  2IO3 B;  5DIF B;  1P5T A;  2JXX A;  4RMA A;  2MLB A;  1I42 A;  4C0A A;  3FP5 A;  2N1V A;  3DXD A;  1WX7 A;  4D0N B;  2BYV E;  3MTN B;  2VSZ A;  2KQ7 A;  2Y8F A;  2N23 A;  3R7R A;  3SNH A;  2R2Q A;  1H4R A;  3FM8 C;  4GGQ A;  2LVQ A;  3W1S A;  1WM2 A;  4WSF A;  1OQY A;  3B1L X;  2KFJ A;  4EZK A;  3ENE A;  1N3H A;  1U5E A;  3TIX A;  1ZM0 A;  3EHV A;  3V60 A;  4IOY X;  2DYB A;  3O96 A;  3LDZ E;  3QCA A;  4JKG A;  3HM6 X;  3SDL C;  2BPS A;  4BKG A;  3A4R A;  2D9Y A;  4PNK A;  1RRP B;  4DK5 A;  2UZS A;  3RUL A;  2ROZ B;  5AZH A;  2ZEQ A;  1UNP A;  2NVU I;  1LFD A;  3H7S A;  2N9E B;  3HM3 A;  1WJM A;  1EF5 A;  2KTR A;  3M62 B;  1OEY A;  1E5W A;  3VUX A;  2MWN B;  2RR9 A;  2D11 A;  1OEY J;  2K25 A;  5CLL B;  4WAA A;  1WGU A;  4MJS A;  5J18 A;  4K2O A;  4FHK A;  1OTR B;  3A1Q B;  3UZT A;  3CXB B;  2W2X C;  3PVW A;  2DAF A;  3CIK A;  1HBK A;  4RM8 A;  1MKE A;  1WMH B;  4HCN B;  4DBG A;  1WXA A;  2ROV A;  2CAY A;  3ALB A;  3WIM A;  2H7D A;  1V5T A;  4DHJ D;  3ZRC A;  5FI0 A;  1X86 A;  2JWZ A;  2DHI A;  2LOX A;  5CX3 A;  2LXC A;  2YS3 A;  4K81 A;  4A3P A;  3X0W A;  1WI0 A;  1VBG A;  2XK5 B;  4KIK A;  2KZR A;  3ML9 A;  2FCQ A;  2P0H A;  1V61 A;  2K8H A;  3RUI B;  3N3K B;  1P1A A;  1X05 A;  3KH0 A;  3U7D A;  1OY2 A;  3V6C B;  3APD A;  2PJH A;  3GYO A;  5LON B;  5E6O A;  2C5L C;  3ZTC A;  3DOW A;  1R4M I;  3H1U A;  2M4N A;  2GCJ A;  3KVF B;  1J0G A;  3VDZ A;  4LJP B;  2AL6 A;  3PTF C;  4MSM B;  3ZNH B;  1KOT A;  4B6W A;  3UGB B;  4JK7 A;  3RCZ A;  1WG7 A;  1PFJ A;  5HE1 A;  3IBE A;  3APF A;  5JHB A;  3TFM A;  5CHV C;  2HRJ A;  2M8S A;  1H8C A;  3NOB A;  1MIX A;  2XBB C;  1WGR A;  4BBN F;  1E8X A;  3E9P A;  3G9W A;  4NPN A;  2COP A;  4DX8 A;  2RGF A;  2B3A A;  3PS6 A;  1EF1 A;  1UEL A;  1I35 A;  1M7R A;  4FHJ A;  2G45 B;  4HVB A;  2DZI A;  5C16 A;  2K2U A;  2FCM A;  2C9W B;  2IO0 B;  3BY4 B;  4IWQ A;  4LCD E;  3T8M A;  5AZF A;  4DDG D;  5KHQ A;  2D4Q A;  3ZTD A;  1SE9 A;  1XD3 B;  4FJV B;  1LM8 B;  4CHJ A;  2PEA A;  2ASQ A;  4K7S A;  3H7P B;  2O6V D;  2O2V B;  2EKE C;  2V3S A;  1YX5 B;  1V89 A;  1WR6 E;  4ILG B;  4A6H A;  3M1I B;  1P6S A;  1PLS A;  2JT4 B;  1GG3 A;  2QHO A;  1TZ1 A;  2PPH A;  1FXT B;  4AJY B;  1FAO A;  1XD4 A;  4K1R B;  3E9O A;  2CU1 A;  2M0X A;  4EMO A;  3CSF A;  3ODW A;  4E74 A;  4KZ0 A;  2ZNV B;  3GOE A;  2DHZ A;  2KWV B;  2DKQ A;  3TVV A;  2H7E A;  1SGH A;  3PRE A;  4WJ7 A;  2N4F A;  4XC2 A;  1WJ1 A;  3C0R B;  1KJT A;  4GPT B;  1V86 A;  1ZVR A;  5DPR A;  1OQN A;  3DBH I;  2MKR A;  2KC1 A;  4EFO A;  3Q3J A;  4EOY A;  1FGY A;  3VFK A;  4OVV A;  2N7E A;  2WX1 A;  2ZVO A;  2Q13 A;  5E6N A;  3U8Z A;  1WMH A;  1DBH A;  3KYD D;  4HDQ A;  4KHA A;  3O65 B;  2FUH B;  3VUW A;  4W9L A;  5HE3 A;  2EMS A;  2R2O A;  4G3X B;  2ELA A;  5HKH A;  3EEC A;  1WJN A;  4ZRI A;  2ZPN A;  1BAK A;  3JW0 X;  2YS5 A;  2IFS A;  4CHM A;  4NNJ B;  3WA0 A;  1WGG A;  3LJ3 A;  5LXH A;  2V1Y A;  3V5W A;  3AI5 A;  2BKF A;  2MX2 A;  5J17 A;  2YRY A;  2D07 B;  2Z59 B;  1IP9 A;  3PRM B;  1CMX B;  4M8M A;  1E8Y A;  4GSW A;  4FBJ B;  1L2N A;  2EMT A;  1Z2M A;  4K7U A;  2G4D B;  3DXE A;  2DKP A;  1NTV A;  2BGF A;  1W1H A;  5L81 A;  3MJW A;  3QAR A;  3NS8 A;  2GMI C;  1Q1O A;  4Z2N A;  3L10 B;  4WWP A;  2OOB B;  4A3O A;  2MW5 A;  1WGQ A;  5C79 A;  4BKT A;  2KGX B;  1LB1 A;  1WJ4 A;  5D6J B;  3ULB A;  2OQB A;  5EFX A;  1ST7 A;  3W1Y A;  3VOQ A;  1WZ0 A;  2LUL A;  3VIA A;  2KK8 A;  1C3T A;  2NS5 A;  5D3W A;  1YX6 B;  4X57 B;  5E6P A;  2DYN A;  3F0W A;  4MY6 A;  2DA0 A;  1RFA A;  5IA7 A;  3FLV A;  3IVF A;  3RZF A;  1W1G A;  2KMA A;  3OJ3 A;  1GGO A;  1YIW A;  2J0J A;  2JPH A;  4HAV B;  3H9D A;  3PLU A;  3QBV B;  3PHW B;  3QWZ B;  2ZJD A;  3TJP A;  1MAI A;  4HPL B;  4I6N B;  2XK5 A;  2DX1 A;  1NU2 A;  2O6V B;  1PMS A;  4YL8 A;  5D3Y A;  3TW1 A;  3KY9 A;  3ZIM A;  3L54 A;  3TL5 A;  2J0M A;  3FSS A;  4XZ4 A;  3L16 A;  2ZVN A;  3A9J B;  2LUE A;  1KC7 A;  4CYE A;  5TR5 A;  2RVB B;  2LRW A;  3VHT C;  2UWQ A;  4LDT D;  3KRX A;  2KAN A;  3QQ8 B;  2DEN B;  3CST A;  3UF8 A;  2PE6 B;  3OLM D;  4DBB A;  2W2W A;  4HK2 A;  4PYZ A;  5AZG A;  1ZW7 A;  2CY4 A;  3SHQ A;  1NTY A;  3R3M A;  4J6I A;  3QHT A;  2GS0 A;  4HB0 B;  3ML4 A;  5DH9 B;  3QX1 A;  4NQL B;  3P7Z A;  2CS4 A;  3EPY A;  3P2B A;  3WAO A;  2EC1 A;  2MDX A;  5LOP B;  2L8J A;  2WX0 A;  4N9F 4;  4GDK A;  3ZUN A;  1UD7 A;  1EUV B;  3MPX A;  2IO2 B;  3R7Q A;  5JHA A;  3HIZ A;  2LGD A;  3PEG A;  2VRR B;  4BOS C;  4GDL B;  4W9G A;  2DZK A;  4EZJ A;  1P3R A;  3AU5 A;  3H6N A;  4ASW C;  1OGW A;  3QAQ A;  2GJY A;  3RD2 A;  4BOZ B;  1MG8 A;  1WM3 A;  3A4S C;  4HJK A;  1WJU A;  2Z0D B;  3VVW B;  1YD8 U;  4BVU C;  4IM3 A;  2HE7 A;  4PQ0 A;  2ABD A;  3MDB C;  3X23 A;  2KJH B;  2P8V A;  4A20 A;  3HK0 A;  3PSC A;  1Y19 B;  3VQI A;  2KJ6 A;  4P7I A;  2ZZP B;  2YVC A;  1E8Z A;  1TGZ B;  5LXI B;  1I7A A;  4NJ6 A;  2NR2 A;  1IPG A;  1UNR A;  1WRD B;  4MJS B;  1SIF A;  3ODX A;  4HDO A;  3E9L A;  2XEW A;  4F7H A;  3UIO B;  4ZRJ A;  2E2X A;  2L7R A;  2PE9 A;  2KMC A;  4HB2 B;  4ZDV A;  5JLJ B;  2KDF B;  3ECI A;  2CB8 A;  4DDI D;  3F5R A;  5CLQ B;  1UGM A;  1J19 A;  4NAW B;  3AUL A;  3E66 A;  4YON A;  3V62 A;  1WGH A;  2D10 A;  1EVH A;  5KQ1 A;  2N7D A;  2IO1 B;  2GBM A;  3PT2 B;  1DYN A;  1Z87 A;  2KWU B;  2D9Z A;  4AOF A;  4XX5 A;  2KDB A;  1GC6 A;  4KSK C;  3VUY A;  1UPQ A;  4JKA A;  2UYZ B;  4BKS D;  1VBH A;  2MA9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...