4TKNA

Structure of the snx17 ferm domain bound to the second npxf motif of krit1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
256
Chain Sequence
PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/signaling protein
molecule keywords Sorting nexin-17
publication title Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 256
sequence length 276
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4tknA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tknA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4tknA01
3ZW3A 1T0YA 3RD2A 3ML9A 2DFKA 2IFSA 2YS5A 4ZRJA 3P7ZA 3B0AA 2KX3A 2KANA 1BTNA 5AZGA 3UZTA 4IWOA 3OANA 5EFXA 2IBIB 4WJOA 3S2AA 3QWZB 2O2VA 4HK2A 2DYQA 2Q13A 1YQBA 3APCA 2Z0OA 3LJ3A 3A98B 2XEWA 2IYBA 3CXBB 2LGDA 3WAPA 3DVNV 2K25A 2KFKA 3DPDA 1EAZA 5CHVC 4KZ0A 1RRPB 3PLVA 2N4FA 3NS8A 1EF5A 1FAOA 2N9XA 3D8DA 4ICVA 3W1YA 1GUAB 2O6VA 2AL3A 2YLMA 2D11A 1PMSA 2DAFA 1WJ4A 2VRRB 3DVGY 4BKSA 2WYQA 4LDTD 1Q5WB 3ODXA 4XX5A 4WWOA 4K7WA 3JW0X 2MX2A 1M94A 3VFKA 1WE6A 2HTHA 3UQBA 3IHPC 2R09A 1XT9B 4TQ0A 1WI1A 2JRIB 2KOXA 4HDQA 1Q1OA 2C9WB 3PVLA 2CS4A 2DHJA 1WRDB 4DHZB 3ODWA 4EZLA 1UPRA 3VUYA 5D94A 1DDVA 4IC7B 1H8CA 1RFAA 4MEMA 2LGXA 3ZVVA 4WJQA 2M14A 4GGQA 5G2NA 3QARA 1V49A 2JXXA 3CF6E 3A8QA 4XWXA 2YRYA 2HJ8A 1KOTA 2LD9A 1KI1B 2PE9A 4BOZB 3JSVB 5CTRC 2D9WA 2FUHB 1SHCA 4F7HA 1V5OA 4FA6A 1CMXB 2BYEA 5KQ4A 3HK0A 2B3AA 4E74A 3UINB 3PRMB 4WJPA 2MBEA 3A9JB 4MJSA 2PE6B 4BKTA 2UZSA 3DVGX 1YJ1A 2AL6A 3A9KB 3PGEA 5GOWB 2ZNVC 1IP9A 4Z2MB 2KDIA 4DX8A 1MPHA 2N7DA 2I1KA 4IM3A 2Z0QA 3ZNZB 2AWTA 1FOEA 3N32A 2ZZPB 2DA0A 3UGBB 2KJ6A 3ULCA 4W9HA 3KRWA 2MWNB 5AZFA 3MDBC 3ALBA 2MQJA 2Z59B 2XK5B 2JRHA 4BOSC 2H7EA 3ZTDA 2RUKB 1PFJA 4M8MA 3AU5A 1DDWA 1ZGUB 2RR9A 2CR5A 5HE3A 3PZDA 1AARA 2FCMA 4LCDE 1U5GA 4NPNA 1LB1A 3RULA 1YIWA 3L54A 3HQCA 2IO3B 1WX9A 2UVMA 2W2XC 4B9KA 4HAUB 1K5DB 4XZ4A 1ZM0A 1TBEA 4GDLB 2X18A 4W9GA 2A5UA 5C5BB 4I6PA 3NSUA 3TBLD 4DWFA 4AOFA 4W9LA 1V5MA 5CX3A 5DHAB 5DCNA 2I5CA 5DH9B 2RD0A 2CHXA 2P8VA 2FJLA 1OEYA 3VAWA 4GXBA 1E8WA 1FHOA 4A6FA 4GOCA 2KNBA 1QC6A 3M63B 2FAZA 2MWSB 3L16A 2COFA 3WIMA 3PVWA 1YD8U 3V60A 1M7RA 4NY0A 2LG1A 2DKQA 3VTUA 4DDGD 3G9WA 2UZRA 2DZKA 4H8SA 2FCNA 3L17A 2IY1B 5D3WA 2CODA 4A20A 5J2RA 2ZCCA 1DROA 1UBIA 1EGXA 1W1DA 4HPMB 2YT0A 1FHXA 1Y5OA 2BWES 3PVUA 1UEFA 4B6HA 3M1IB 1P3QU 3OJ4B 1UZXB 2V76A 3ENEA 4HB0B 1X11A 3OJ3A 2V1YA 5HE0A 4TQ1A 4FN2A 2RVBB 2K6QA 1IRSA 3PSEB 4I6NB 5JLJB 1WJ1A 1LFDA 5LLIA 1V9JA 3DBRI 3A8PA 3P2BA 1WJMA 2PEAA 1J8CA 4MDKE 4MGKE 1JRUA 3T9LA 3PP2A 1OEYJ 4RM9A 2D4QA 2K8HA 2UWQA 4RMAA 2LRUA 4MY6A 2KDEB 2RGFA 4NSWA 1XD4A 2IO1B 2MDXA 4TKNA 3M3JA 1WZ3A 3ONSA 5D7GA 4PYZA 4EFOA 4KHOA 5DPSA 4E3CA 4IUMB 3DXEA 2EJ8A 2YF0A 3VHTC 2LXAA 2LI5A 4C0AA 3H6NA 2BYFA 3WAMA 1WMHA 2DX1A 4EJNA 3GZNI 2OOBB 3NY5A 3QWMA 3H7SA 1SIFA 2KDFB 1L7YA 1P0RA 5KQ1A 4HPLB 2DKPA 3BY4B 2K2JA 4DX90 4F7ZA 4DBGA 1Q0WB 1MK9B 2CHZA 3APFA 5J18A 5HE2A 2LOXA 2G4DB 4HWIB 2XQNM 1GJZA 2LWPA 3VXWA 2NBWB 3R7QA 1WY8A 1SE9A 1P3RA 1WYWB 4KIKA 2P0HA 2IO0B 2O6VB 5DPRA 1WGGA 3JYUA 2EC1A 1NBFC 1V2YA 2K8CA 2VSZA 5E6PA 2N1WA 3TW1A 4ASWC 2L2IA 3HHMA 2Y8FA 2M0XA 5CHFA 2HTHB 3QJZA 3RCZA 5DPWA 1V61A 2DYOA 1J0GA 1ZSQA 1MKEA 4N9F4 1P1AA 4GMVA 4ZYNA 2J0JA 2WWZA 2G35A 2MFQA 4A5KA 1H10A 3QA8A 5D3VA 2BYVE 3VIAA 1WGDA 3VUXA 1K8RB 4JIOU 1KZGA 3D8EA 2KVRA 4WWPA 3U30A 2D2QA 2R0DA 4NJ6A 4P7IA 3SDLC 2Z0DB 2D10A 1TJ6A 2KJHB 5C23A 4PS7A 2N7EA 3ZIMA 3D8FA 1X05A 1UH6A 1WI0A 2KTRA 4ANUA 4A6HA 4NAWA 2ZEQA 2C60A 3VQIA 2JP2A 3BINA 2E2XA 3N7CA 5J3TA 2C5LC 2MW5A 4FULA 4WAAA 3X0WA 2ZVNA 3ML4A 1I35A 4GMXB 1LXDA 2COAA 2BGFA 2MRPA 5LONB 4GU2A 2JF5A 3EC8A 1XCGA 2MP2A 3H7PA 4MGYE 5J17A 1UNRA 4BVUC 5D27A 3V61A 1R4NI 4AJYB 3A1QB 4ZRKA 2CKHB 4OVUA 2DAJA 1LW3A 4IWQA 3NOBA 4MH0E 3SD5A 4LJOB 3TJPA 3QIJA 1DYNA 1LM8B 4FJVB 2CU1A 3DCGA 2LASA 2D9XA 2NMBA 2CHWA 4D0NB 4HJKA 5CLQB 3PT2B 2LVOA 2DYNA 2DZIA 3AULA 3SHQA 3PREA 3WA0A 5IA7A 3O65B 4NJ7A 3RT3B 4ANXA 3QQ8B 3HM6X 3GYPA 5J3QA 1WM2A 5DIFB 1WXAA 2MBQA 2HD5B 4Z2NA 2ZCBA 3VH3B 1WIAA 1R4MI 3APDA 5L95C 2KWCA 3IVFA 5EDSA 1TTNA 1DDMA 4YL8A 4HAVB 4FHJA 4URKA 2JZZA 2J0MA 3DOWA 3WYFB 5D6JB 3UF8A 3VDZA 1WGHA 3PV1A 4HHVA 1M7EA 3CMMB 2CRFA 3SNHA 3U7DA 2PPHA 1GNUA 1Y8RC 4FLHA 3FM8C 3ECIA 5GMVA 1WVHA 2K1FA 2BKFA 1KLVA 3T06A 4K81A 1V89A 5LXHA 4EMOA 1E90A 4KHAA 5C6RA 2DN6A 3IFWB 2GS0A 2EMSA 2JY6A 1TXDA 4EEWA 3UIPB 3DVNU 3PS6A 2ASQA 2NBVB 3NHEB 4KVGB 1WX8A 2MBBB 1E8XA 4MSQB 2M1MA 1FGYA 2WX0A 4IW0A 4MM3A 4J6IA 5JH5C 3DBLI 2M38A 1ZKHA 1NDDA 3NZUA 5J3YA 3F5RA 2LULA 3TMPB 4Y94A 2RSGA 4ZDVA 2RGNB 2OJRA 3LDZE 4IAPA 1U5EA 4FJZA 4AJWA 1U27A 4K2OA 4HCNB 4NNJB 2DENB 3V6CB 4II2B 2P0DA 5C16A 1XODA 1FXTB 4IOYX 2YVCA 5JZEB 3PLUA 1J0WA 3OAWA 4NQKE 2NPTA 1V88A 2NS5A 4K7SA 3PG7A 1E7UA 3PEGA 4BBKA 1OQNA 1WJ6A 2KX0A 2ZJDA 1P98A 2NBUA 1MIXA 2C7HA 1RLFA 2C7MB 2IYDB 2N0YA 3L13A 1D3ZA 3A33B 3QHTA 2REXA 3V6EB 1WE7A 3PTFC 3SU8X 2KQ7A 2I5FA 2BCJA 4BKGA 2YS1A 2W2WA 3A4RA 3RUIB 3ZUNA 4II3B 3V62A 3ZLZA 1A5RA 4ANVA 1LQBA 5LXIB 4KV2A 4MK0A 1W1HA 1PLSA 2LVQA 4IM2A 5JHAA 4IFSA 1F9JA 3SYXA 4LJPB 3RCPA 2QKLA 4HATB 3DQVA 3ZTCA 3N30A 3PPAA 1VCBA 2P0FA 1V86A 4GSWA 4TUUA 1V81A 1NU2A 1B55A 2KD0A 2J7QB 4F1SA 5DPTA 2KCJA 1KJTA 1EVHA 4F8CB 1WJNA 2O6VD 3O96A 5D2MB 1UD7A 1I7AA 2M4NA 4BKSD 2NCNA 3DXCA 3QX1A 1G6JA 4G11A 3KY9A 4GDKA 1X1GA 2GJYA 2NZ8B 2D9VA 2GBRA 1XQQA 3H1UA 2DYMA 4IWPA 4K7UA 4HLEA 4HB4B 1U5FA 4HB2B 3DXDA 4W9EA 1EUVB 2NVUI 1FGZA 5HKHA 3CIKA 2KTRB 2LVPA 3R7RA 1WGRA 2QHOA 4NAWB 3DBHI 4RM8A 1U5DA 5LOPB 4GDLA 2G45B 5FI1A 5C5BA 4GIVA 3VTWA 3F0WA 2M17A 4WJ7A 2Z0EB 4DDID 4BBNF 3MPXA 1RRBA 2O2VB 4K1RB 3N3KB 2GCLA 2L0FA 2ELAA 2MP2B 4TV3A 2R2QA 2D9YA 3H7PB 3Q3FA 3RYTA 4EOYA 2GCJA 3ZDMC 3TFMA 1ZVRA 1UPQA 4XC2A 3QC8B 2KFKB 3L0WB 2L0TA 4A3OA 4KZCA 1V5UA 1Q67A 2KJRA 2GBMA 1PQSA 2FCSA 3BJIA 2ADZA 3ODOA 2KDBA 1Y19B 5C1ZA 1S3SG 2KKCA 2LRWA 2JVCA 2A4ZA 4FJYA 4WQOB 2KC1A 2KWVB 4W9FA 2DZJA 1QQGA 4G50A 3WAOA 3DBSA 1BT0A 2LXCA 4L6EA 3SV1A 1Z5SB 3QCAA 5E6OA 4K2PA 4DBBA 4PS3A 1WH3A 3PHWB 2LGYA 2ROVA 5FR6A 1BTKA 3B1LX 1L2NA 1C3TA 4W9JA 3VOQA 3IG3A 4EZKA 1WJUA 2L7RA 4KSLC 2EMTA 1WGQA 1U4AA 2D9ZA 4E71A 4HAWB 2KFJA 1P6SA 3AI5A 2OTXA 1WG7A 1UNQA 1XR0B 3AJ4A 2HE7A 1N3HA 3DDCB 1OY2A 2GMIC 4GB9A 3TCAA 3ULBA 3WANA 3UQAA 2YT1A 4OVVA 5JHGA 5IAAC 4EUTA 2K6DB 1ZW7A 3OLMD 1FHWA 4MJSB 3KYCD 4JQWC 5DI9B 4CHMA 1UGMA 3KW5B 2EKEC 2C7NB 3TVVA 3KSYA 2KHWB 1EF1A 4KHBB 3CSFA 5CHWA 1E8ZA 3TL5A 3HM3A 3RZWC 5HE1A 2AEHA 3SO6A 1V6EA 2Z0PA 5D3YA 4B95A 2Y8GA 2RPQA 3M95A 2Y7BA 2IZVB 2JPHA 5JHBA 4HXDA 4KSKC 2R2OA 2V3SA 2KUPA 3ZRFA 1H4RA 1QZEA 4W9KA 2KK8A 1ZC3B 2Y5BB 1WR1A 2D3GA 4JLCA 1OGWA 3L10B 3VTVA 4CHKA 1TQZA 4AP4C 2L1CA 4MT7A 1U2BA 1J19A 2K2UA 1TZ1A 3PSCA 5L81A 3ZNID 3KRXA 1WZ0A 2GBJA 4MGZE 2ROZB 1IPGA 2NPTB 3HIZA 3KUCB 2W2XD 2LOZA 2FNJB 3R66C 3WALA 3CSTA 1FB8A 2NR2A 1BWNA 4A6FB 1KZ7A 1I2HA 2CY5A 2DX5A 4NQLB 3GYOA 2L76A 2JWZA 4W9IA 3EHVA 1AQCA 2LKOA 2K00A 1WXMA 5D3XA 3A4SC 4W9CA 3PRPB 2IY0B 5KCVA 1RAXA 4K17A 5G55A 2RNRB 4WJNA 2ZNVB 3VVWB 2KMAA 3K9PB 4ANWA 4HAYB 4WVFB 5JP4A 2MA9B 3ZNHB 4B6WA 2JZ3B 2MSED 4HAZB 2D07B 2RLOA 2KLGA 3GOEA 3W1SC 2LUEA 3A1QA 3PRZA 4IM0A 1K5GB 2N1VA 4LDTB 1P5TA 2KN5A 2M8SA 2ZVOA 1C1YB 3QAQA 4GN1A 4DHJD 1ZC4B 3T8MA 1GG3A 1WGUA 3PHXB 4GDKB 1GC6A 2JT4B 3ZVRA 3ML8A 4AUQC 1YX5B 1E5WA 2MCNB 3B08A 5KHOA 2L3ZA 4M8NA 2MKRA 2FIDA 3K9OB 4FHKA 1NI2A 3MTNB 4DHZE 5C79A 2KMCA 3KUDB 3EECA 4HCPB 3VH4B 3X23A 4HAXB 2ELBA 3TIXA 1E8YA 1X86A 1WXVA 3V5WA 1Z2MA 2LJ5A 4G0NB 2ZPYA 4GZUA 1WMHB 3MJWA 2V4LA 3QBVB 3ZDTA 2KGXB 5L83A 5AZHA 2KXJA 2OQBA 4MGIE 4W9DA 2GBKA 3JSVA 2DHIA 1WFYA 2BWFA 4ICUA 3H9DA 2H7DA 1XD3B 3A9JA 1RJ2A 2KTFA 4F7UP 3A9KA 2YS3A 1IYFA 4JGHB 4KIKB 1XKEA 4DK5A 3IBEA 4DHJB 4HVBA 4KDIC 4CHJA 5DHFB 2KWUB 4HDOA 4I6LB 2BKRB 2KQSA 3ZKJC 3FSSA 3NZSA 3W1SA 2RSUA 3TO1A 4TYZA 1XX0A 1V80A 1WF9A 1NTYA 3KYDD 2COCA 3ZO5B 2BF8B 2XK5A 4G3XB 4PS8A 4ZRIA 3KVFB 5CLLB 2L00B 4DXAB 1WX7A 2XBBC 4FADA 3ZRCA 4BBNC 4EKUA 1MG8A 3P6AA 1TGZB 1MIZB 1WM3A 3MHSD 1X1MA 3L08A 2VRWB 2BPSA 2DTCA 2KO3A 4X57B 3M62B 2VKIA 2L05A 3LJUX 2G4SA 2DLWA 4F7GA 4KDLB 1BAKA 2I1JA 3KH0A 1YX6B 3Q3JA 4FBJB 4A3PA 1WXSA 2JUOA 3AU4A 5BO4B 1OMWA 2YSZA 2WX1A 2CY4A 2FCQA 1SGHA 4PYUA 2PZ1A 5TR5A 2K39A 3RZFA 1HE8A 1AWEA 2PJHA 1U29A 1WR6E 2LYDA 1E7VA 3HW2B 3SUZA 1UNPA 3AXCA 2N23A 3C0RB 1OTRB 4CO7A 1UELA 5JHHA 1V5TA 4MELA 1OQYA 2KC2A 2QKMA 2WDTB 1S1QB 4WWNA 3UIOB 1Z87A 1MK7B 1VD2A 1EO6A 2MBOA 4PQ0A 2DYBA 1P9DU 2DZMA 2J59M 1UBQA 2FIFA 4EZJA 1X1FA 2IO2B 4BFRA 3KZ1A 4JL9A 4A6KA 4KAXB 2GBNA 3U8ZA 2MLBA 4WSFA 1W1GA 1KM7A 4HB3B 4IG7B 1DBHA 2LZ6A 3QK0A 2CAYA 2K8BA 4CYEA 4MSMB 3D32A 4PNKA 3EFUA 3FEHA 3KUZA 2ZPNA 3VUWA 4AWJA 1V5PA 2KZRA 3JVZX 1I42A 2N9PC 4M0WB 2KLCA 2AYOB 4YONA 2J0KA 5KHQA 2GOWA 4GPTB 1ISNA 2G3QB 2UYZB 5AEKB 3ZNGC 1WGYA 2DHKA 2L8JA 2N9EB 2MBHA 3R3MA 2DX5B 5E6NA 1GC7A 5FI0A 3I3TB 2W9NA 2DHZA 1MAIA 1NTVA
chains in the Genus database with same CATH superfamily
3ZW3A 1T0YA 1N6ZA 3RD2A 1TS3A 2DFKA 3ML9A 2IFSA 1SBBB 3Q6BA 2YS5A 3Q3NC 2CU3A 4ZRJA 3NWFA 3P7ZA 3B0AA 3OG5A 2KX3A 3DBLB 2KANA 2OHFA 1BTNA 5AZGA 3UZTA 1I4GA 1HBKA 4IWOA 2FUG1 1XLNA 3OANA 5EFXA 2INNE 1ZOYB 1TIFA 4D6WA 1VBGA 2IBIB 2GLSA 3A58A 4WJOA 3S2AA 5BYQA 3QWZB 2O2VA 4HK2A 2DYQA 2Q13A 1YQBA 2WXLA 5IKCM 3APCA 2Z0OA 1I7HA 3LJ3A 3A98B 1VDVA 1JWSD 2INPE 4Q2JA 1FIQA 2XEWA 2IYBA 3CXBB 2LGDA 1IGCA 3WAPA 3DVNV 4ZRPA 2LFIA 3GP7A 2K25A 4HROA 2KFKA 3DPDA 1EAZA 5CHVC 4KZ0A 1RRPB 1JWUD 1HB8A 3AN1A 5D3IB 3PLVA 1VR9A 2N4FA 3NS8A 1EF5A 1QKZA 1FAOA 2N9XA 3D8DA 4ICVA 4ZHPA 3W1YA 3NWAA 1GUAB 2O6VA 2AL3A 2YLMA 2D11A 1PMSA 2DAFA 4HKZE 1WJ4A 2N0SB 2VRRB 1VRAB 3DVGY 4BKSA 2WYQA 4LDTD 3UI3A 1Q5WB 1NEKB 3ODXA 4XX5A 3AE8B 4WWOA 4K7WA 3JW0X 2MX2A 1M94A 3T3OA 2BS2B 3VFKA 1WE6A 2HTHA 1E7PB 3UQBA 3IHPC 2R09A 2BW2A 1XT9B 4TQ0A 1WI1A 2JRIB 2WDQB 3VRAB 2KOXA 4HDQA 1Q1OA 4RH6A 2C9WB 2CS4A 3PVLA 2DHJA 3FC4A 1T77A 1PUTA 1WRDB 4DHZB 3ODWA 2KUQA 1WSPA 1UPRA 3VUYA 4EZLA 5D94A 1DDVA 2WXIA 3Q8EA 4IC7B 1H8CA 2B76B 1TKYA 1RFAA 3BVZA 4YXDB 1TS2A 4JPSA 4MEMA 4A9AA 2LGXA 1F1HA 2KIEA 3ZVVA 4WJQA 2M14A 4GGQA 5G2NA 3QARA 1V49A 2JXXA 3CF6E 1YJIA 3A8QA 4L2YA 4XWXA 2YRYA 1QT9A 3NW8A 1TKEA 2DNFA 2HJ8A 1KOTA 2LD9A 1KI1B 2PE9A 4BOZB 3JSVB 5CTRC 2D9WA 2FUHB 1SHCA 4F7HA 1V5OA 3IXSA 4FA6A 3L4PA 1CMXB 2BYEA 3P1MA 1FPYA 5KQ4A 3HK0A 2B3AA 4E74A 1V97A 3UINB 1ZDVA 3DBRB 3PRMB 3U2SC 1HQRD 3P4RB 4WJPA 2MBEA 3A9JB 4MJSA 2PE6B 3N20C 4BKTA 2UZSA 2HTME 3DVGX 1YJ1A 2AL6A 3AE2B 1YNTE 3SEBA 1SF0A 3A9KB 3PGEA 5GOWB 1SXTA 2ZNVC 1IP9A 1AWDA 4Z2MB 2KDIA 1OQQA 4DX8A 1MPHA 2N7DA 2I1KA 4IM3A 4B0MA 1QF6A 2Z0QA 5MPOA 3ZNZB 4KHBA 1E0ZA 2UU7A 3BVMA 1N5WA 2AWTA 1FOEA 3N32A 3RI7C 2ZZPB 3RNFC 2DA0A 3LXFA 3UGBB 2KJ6A 3MJ5A 3ULCA 4W9HA 3KRWA 3ZJTA 2MWNB 5AZFA 2FJUB 3N1YC 3MDBC 3ALBA 3FP5A 2N7JA 2MQJA 2Z59B 2XK5B 2KAJA 2JRHA 5EE0A 1YN5A 1IGDA 4BOSC 3NZ3A 1T6BX 2H7EA 4HRSA 3ZTDA 2RUKB 1PFJA 4M8MA 3AU5A 2EELA 4N59A 1DDWA 1EU3A 1P7FA 1ZGUB 2RR9A 2CR5A 5HE3A 1SIJA 3PZDA 1AARA 2FCMA 4LCDE 1U5GA 1ESFA 4NPNA 1LB1A 3RULA 4GNKB 1KTKA 1YIWA 4TMAB 1RWSA 4ZRQA 1XLOA 2MJEA 3IAS1 3L54A 3HQCA 2IO3B 1WX9A 2UVMA 2IJ0A 2V0GA 2W2XC 1RFKA 3RNEC 4OT1A 4HAUB 4B9KA 4A8XC 1K5DB 3N1ZC 2H88B 4LLGM 4XZ4A 4JKGB 1MHHE 3W9CB 1ZM0A 1TBEA 4CSQA 1K50A 3NVWA 4GDLB 2X18A 4W9GA 2A5UA 2RQ1A 4QJ3B 5C5BB 4FXCA 4I6PA 2K0PA 2QIEB 2SAKA 3NSUA 1LGRA 3TBLD 4DWFA 3TEXA 4AOFA 3KWLA 4W9LA 3SBGA 1V5MA 4ILJA 5CX3A 5DHAB 5DCNA 2I5CA 5DH9B 2RD0A 1F2RC 4RGMA 2IDYA 2CHXA 3HUIA 4OHJA 1JWMD 2WXPA 2P8VA 2FJLA 1OEYA 4P6VF 3VAWA 4WQMA 4GXBA 1E8WA 1FHOA 4A6FA 4GOCA 4WIPA 3C19A 2KNBA 1QC6A 2JWUA 3M63B 2FAZA 2W3SA 2MWSB 2ZW0A 4YSYB 1J7BA 2J53A 3L16A 2COFA 4UDUC 3WIMA 1C4AA 3PVWA 1YD8U 3V60A 1QOFA 2ONQA 2BQQA 1M7RA 4NY0A 2MHJA 2LG1A 2DKQA 1FRRA 3VTUA 4DDGD 1HZ6A 3G9WA 4JKCA 2UZRA 2DZKA 4H8SA 1B9RA 3IT6B 1TY2A 1I4PA 1D4BA 1QOBA 2FCNA 3L17A 3J9CA 3Q14C 2IY1B 5D3WA 2CODA 4A20A 1A70A 2KDMA 5J2RA 2ZCCA 1DROA 1TS4A 1TY0A 1UBIA 4OZCA 1EGXA 2WXHA 1W1DA 2HRJA 4HPMB 1DYQA 2YT0A 1FHXA 1Y5OA 2BWES 3PVUA 1UEFA 4B6HA 3M1IB 1DIKA 4N58A 1P3QU 3OJ4B 1UZXB 2V76A 1BXTA 2COPA 1K51A 2KACA 3ENEA 3ZYYX 2NBVA 4HB0B 4JK7A 1X11A 3OJ3A 2V1YA 3NVVA 2ZKMX 4JWUC 3I57A 5HE0A 4TQ1A 2BB5A 1NVLA 4FN2A 2R61A 3HVDA 1FXIA 2ABDA 2RVBB 5HI1A 4P1BC 4C4VB 2K6QA 1IRSA 3PSEB 5BYRA 4I6NB 5JLJB 1WJ1A 4JK8A 2QCZA 1LFDA 5E6JA 5LLIA 1V9JA 1I4QA 2G1EA 4WWMA 3DBRI 3A8PA 3P2BA 1WJMA 2PEAA 1J8CA 4MDKE 4MGKE 2WXNA 1JRUA 3T9LA 1UF0A 3PP2A 1OEYJ 4RM9A 4C00A 2D4QA 2K8HA 2UWQA 1T0QC 2MJDA 1DOIA 4RMAA 2LRUA 4MY6A 2KDEB 2RGFA 4NSWA 1XD4A 2IO1B 2XNAC 2WGSA 2MDXA 3RNGC 4TKNA 2BBCA 3KWVA 3M3JA 3OHMB 1WZ3A 3ONSA 5D7GA 4PYZA 1ZXHA 4XDDA 4EFOA 3AE9B 4KHOA 3MP9A 3BK1A 5DPSA 4E3CA 4IUMB 3DXEA 2EJ8A 2YF0A 3VHTC 2LXAA 1HXYD 4OVZA 3DCXA 2LI5A 4C0AA 1PGBA 2BYFA 3H6NA 3WAMA 1WMHA 2DX1A 4EJNA 3GZNI 2OOBB 3NY5A 3QWMA 3H7SA 1SIFA 5FR3A 2KDFB 3AV8A 1L7YA 1SE2A 1P0RA 4XDCA 5KQ1A 2R82A 4OZBA 4HPLB 2DKPA 3TEZA 3BY4B 2K2JA 4DX90 2WP9B 3AE1B 1NTIA 1HB6A 1RM6C 3C8YA 4F7ZA 1JDEA 4DBGA 2GRIA 1VZ8A 1QQRA 1Q0WB 1MK9B 2I38A 4RGTA 3FILB 4JK9A 2CHZA 3APFA 5J18A 5HE2A 2WXRA 2LOXA 2G4DB 3W5UB 4HWIB 1STEA 2XQNM 4NAMA 2AX5A 1QOAA 1GJZA 2LWPA 3VXWA 2NBWB 3R7QA 1WY8A 3E9PA 1SE9A 5IN7A 1P3RA 1WYWB 4KIKA 2P0HA 2IO0B 1V8CA 2O6VB 5DPRA 1T5XD 1WGGA 2TSSA 3JYUA 1TZOA 4ZYSA 2BYTA 2EC1A 4ARCA 1NBFC 1V2YA 2K8CA 2VSZA 5E6PA 2YEPB 1C76A 2N1WA 3TW1A 4ASWC 2L2IA 1VZ7A 5FKAC 3HHMA 2Y8FA 2M0XA 3RNAC 5CHFA 3W5VB 2HTHB 3QJZA 3RCZA 5DPWA 1V61A 2DYOA 1J0GA 1ZSQA 1MKEA 2ICIA 4N9F4 1P1AA 1D5MC 1GPXA 4GMVA 4ZYNA 2J0JA 1FEHA 2INCC 2WWZA 2G35A 2MFQA 5IO9A 4A5KA 1H10A 3QA8A 5D3VA 2BYVE 3VIAA 2PLPA 3AE7B 1WGDA 3RNBC 2JQRB 3T3NA 4XE0A 3VUXA 1K8RB 4JIOU 1KZGA 1NI3A 3D8EA 1NYQA 2KVRA 3AEEB 4WWPA 3U30A 2D2QA 1R7SA 1XO3A 2RRFA 2Y5CA 2R0DA 4NJ6A 2Z8LA 1TKGA 4P7IA 2KMMA 3SDLC 2QILA 3N9YC 1VLBA 2Z0DB 2D10A 1TJ6A 2KJHB 3Q8FA 2LEKA 4PS7A 2N7EA 5C23A 4KKJA 4N6EB 3ZIMA 3D8FA 1X05A 1UH6A 4JX1C 1WI0A 2KTRA 4ANUA 4A6HA 4NAWA 2BVCA 2ZEQA 3AE3B 1C78A 4PK1A 2C60A 5JVLA 3VQIA 1ZDXA 3AEGB 2JP2A 3BINA 2E2XA 4JKDA 3N7CA 5J3TA 2GB1A 4XGAB 3MC0B 2C5LC 1PFDA 2MW5A 4FULA 4WAAA 3X0WA 2ZVNA 3ML4A 1I35A 1GB1A 2SEBD 4GMXB 1LXDA 2COAA 2BGFA 1UGJA 2KT7A 2MRPA 5LONB 2NTTA 4GU2A 2JF5A 3EC8A 4RF1A 1XCGA 2MP2A 3H7PA 4MGYE 2K9XA 4MT5A 2IGGA 5J17A 1UNRA 4BVUC 5D27A 3BZDB 3V61A 1R4NI 2X8XX 4AJYB 3A1QB 4ZRKA 2CKHB 4OVUA 2DAJA 1LW3A 3V3XA 4IWQA 3NOBA 2BT6A 3NJTA 4MH0E 3SR6A 4RF0A 3SD5A 2WH5A 4LJOB 3U12A 3TJPA 3QIJA 1DYNA 1LM8B 4FJVB 2KWDA 2CU1A 3DCGA 2V4IB 2LASA 4BZAA 2D9XA 1ZP0B 2DIKA 2NMBA 2CJOA 3KLSX 3NUHB 2CHWA 3ZJVA 4D0NB 3AH7A 4HJKA 5CLQB 3PT2B 5BMHA 4YSXB 2LVOA 2DYNA 2DZIA 3AULA 1QILA 2VH1A 3SHQA 3PREA 5H92C 3B9JA 3WA0A 1WXQA 2JU6X 5IA7A 4ILHA 3O65B 4NJ7A 3RT3B 4ANXA 3QQ8B 3HM6X 3GYPA 3DWGC 5J3QA 1WM2A 5DIFB 1WXAA 3EA6A 2MBQA 2HD5B 4Z2NA 3AEDB 3Q3MC 3TUOA 2ZCBA 1YOVB 2Y3AA 5BMIA 3VH3B 1KBLA 1N61A 2LHDA 2FJ9A 3NRZA 3ZXVA 2NMQA 1WIAA 1R4MI 4ARIA 3NVYA 3APDA 5L95C 2KWCA 3IVFA 5EDSA 1EWYC 3N1XC 1TTNA 1NYRA 4KGTA 2KVZA 1DDMA 4YL8A 1MI1A 4HAVB 4FHJA 4URKA 1GAQB 2JZZA 5IP4D 1NENB 2V3PA 4DXGA 1MJDA 1I4HA 2J0MA 4REZA 3DOWA 5EE1A 3WYFB 3RNCC 4L23A 5D6JB 3UF8A 3VDZA 3FVCA 4YTMB 1WGHA 5AUKA 3PV1A 4HHVA 1JWBD 1M7EA 1NVID 3CMMB 2CRFA 3SNHA 1D5XC 3U7DA 2PPHA 1GNUA 2FE8A 1Y8RC 3RMKC 1DGJA 2WQYB 4FLHA 3FM8C 3ECIA 5GMVA 1WVHA 1FCLA 2K1FA 3NS1A 2BKFA 1XCQL 1KLVA 1FD6A 1EWCA 3T06A 4K81A 5GXGB 1V89A 1ET9A 2EKIA 5LXHA 4EMOA 1E90A 3URYA 4KHAA 5C6RA 2DN6A 3IFWB 1TYGB 3DBHB 3LYYA 2GS0A 2EMSA 3DWMA 3RPFC 2JY6A 1TXDA 4EEWA 3UIPB 3P63A 3KQ4A 2IGDA 3DVNU 3Q3OC 3PS6A 2AQ3B 2ASQA 2NBVB 2PVOD 3NHEB 4KVGB 1WX8A 1N62A 1E8XA 2MBBB 4YT0B 1KRHA 4MSQB 4QJ5B 2M1MA 1MVKA 4XWTA 2VH2A 3R2IA 1FGYA 2WX0A 1JALA 2HJ1A 2WU5B 2RDBC 3ZGZA 4IW0A 4MM3A 4J6IA 5JH5C 3DBLI 2M38A 5LNK1 1ZKHA 1NDDA 2J42A 4JKEA 3NZUA 3O13A 3P42A 5J3YA 2WXMA 3F5RA 2LULA 3TMPB 3GS2A 4OZAA 4Y94A 2RSGA 3AEAB 4HEA1 2PW9A 4ZDVA 1MHXA 2RGNB 2OJRA 3LDZE 4IAPA 4L1BA 2IPKD 2WXJA 4DIXA 1U5EA 4HJGE 4NZLB 4FJZA 4AJWA 1LO5D 1U27A 4K2OA 4HCNB 3SFEB 4NNJB 2DENB 3HRDD 3V6CB 4II2B 2P0DA 2XN9C 5C16A 1XODA 1FXTB 4IOYX 2YVCA 5JZEB 1C4CA 3PLUA 1J0WA 3OAWA 4NQKE 2NPTA 1V88A 3AE5B 3R2TA 2NS5A 4K7SA 3PG7A 1E7UA 3TEWA 3IAM1 3PEGA 4BBKA 4JKBA 1OQNA 1WJ6A 1IBXA 3AECB 2KX0A 1P98A 2ZJDA 1MIXA 2NBUA 2C7HA 2QDFA 1RLFA 1L0VB 1UWMA 2C7MB 2IYDB 2N0YA 1XEEA 3AEBB 3L13A 1D3ZA 3OWEB 3A33B 3QHTA 2REXA 2X38A 3V6EB 3BYTB 1WE7A 3PTFC 3SU8X 2KQ7A 2I5FA 3AE6B 2BCJA 4BKGA 4S0RA 2YS1A 2W2WA 2AQ1B 3A4RA 1KF6B 3RUIB 1FNUA 2J52A 3ZUNA 4II3B 1HZ5A 4O1NA 3V62A 3ZLZA 1A5RA 1EM7A 2L32A 4ANVA 1LQBA 5LXIB 2LGIA 4KV2A 4MK0A 4US9A 1W1HA 1FFUA 4GOUA 1PLSA 2LVQA 4IM2A 5JHAA 4IFSA 1F9JA 3SYXA 3TEYA 4LJPB 3RCPA 3RN9C 2QJLA 2QKLA 2LHEA 4HATB 5BMGA 1WRIA 3AEFB 3DQVA 3ZTCA 3N30A 4KGSA 2RPVA 3PPAA 1VCBA 3E9SA 2P0FA 2JZPA 4JKFA 2CQUA 1V86A 4GSWA 4TUUA 2D3BA 4M01A 1V81A 3I9V1 1J7AA 1RYJA 1NU2A 2ACZB 1B55A 2KD0A 2J7QB 4F1SA 5DPTA 1OFFA 2KCJA 1KJTA 1EVHA 4F8CB 1WJNA 1XLQA 3B77A 2O6VD 2V3NA 3O96A 2Z59A 5D2MB 2D5GA 1UD7A 1I7AA 2M4NA 4BKSD 2NCNA 3FAHA 3DXCA 2WLBA 3QX1A 1G6JA 4G11A 1V1PB 3KY9A 1JWAD 4GDKA 1X1GA 1YQ3B 2GJYA 2NZ8B 1L6UA 2D9VA 2Z4DA 2GBRA 1XQQA 3H1UA 2DYMA 4IWPA 1J7CA 1I4XA 2KR0A 4K7UA 4TSSA 4HLEA 1VJKA 4HB4B 1U5FA 2N9LA 4K3CA 4HB2B 1GOZA 3NG0A 3DXDA 4W9EA 1EUVB 2NVUI 2KIGA 1FGZA 1BUIC 1SJHD 5HKHA 3CIKA 2KTRB 2LVPA 2WS3B 1WGRA 2QHOA 3R7RA 4NAWB 2D3AA 2CJNA 4WAFA 2K49A 3P4QB 3DBHI 4RM8A 1U5DA 1D6EC 5LOPB 4GDLA 1KH0A 2G45B 5FI1A 5C5BA 4GIVA 3VTWA 1JROA 3F0WA 3AB5A 2KQ4X 2M17A 5H8YE 4WJ7A 2Z0EB 4DDID 2L52A 1KC7A 2KN4A 4BBNF 1Q10A 3MPXA 1RRBA 3PZ8A 1SB3C 4LNIA 2O2VB 1JRPA 4K1RB 4RCOA 4PT5A 3N3KB 2GCLA 3LB8C 2L0FA 2ELAA 2MP2B 4ACFA 4TV3A 2R2QA 2D9YA 3H7PB 1YN4A 1ACAA 3Q3FA 3RYTA 4EOYA 1AYFA 2BB6A 2GCJA 3ZDMC 3TFMA 1ZVRA 2DBYA 4KX6B 1VZ6A 1UPQA 1FXAA 4XC2A 3QC8B 4USAA 1C4PA 3DHGC 2KFKB 3L0WB 2L0TA 4A3OA 4RGNA 4KZCA 1V5UA 1Q67A 4KKIA 2KJRA 2GBMA 1PQSA 1ZYIA 2FCSA 3BJIA 2ADZA 3ODOA 2KDBA 3EGRA 1E9MA 5C2TB 1Y19B 5C1ZA 1S3SG 4B0EA 2KKCA 2LRWA 2JVCA 1L5PA 2A4ZA 4OSNA 4DQOC 4FJYA 4WQOB 2KC1A 2KWVB 4W9FA 2DZJA 2YT2A 1YMHE 1WWTA 2H89B 1QQGA 5JXVA 2QC8A 4G50A 3WAOA 2BS3B 3AM9A 3DBSA 2Y5PA 1BT0A 2LXCA 5G5HA 4L6EA 4IDIA 1GGOA 4HKQA 3SV1A 4C7ZA 1Z5SB 3QCAA 5E6OA 2GI9A 4K2PA 4DBBA 4PS3A 4A90A 1WH3A 3ABVB 3PHWB 1ZPSA 2LGYA 2ROVA 5FR6A 1BTKA 3B1LX 4D2KA 1L2NA 1FO4A 1C3TA 4W9JA 3VOQA 2PKOA 3IG3A 4EZKA 1WJUA 2W55A 1C77A 4C4VA 1T0RC 3Q8AA 2L7RA 4JKAA 4KSLC 2EMTA 1WGQA 1U4AA 2D9ZA 1ACCA 2WU2B 4MH8A 4E71A 3VR9B 4HAWB 2KFJA 1P6SA 3AI5A 4LK0M 2L83A 2OTXA 1WG7A 2OJWA 1UNQA 1XR0B 3AJ4A 3B2GA 2HE7A 1N3HA 3DDCB 1OY2A 1CZPA 2GMIC 4GB9A 3TCAA 3EUB2 3ULBA 3WANA 3UQAA 2YT1A 1M4VA 4OVVA 5JHGA 2J4XA 5IAAC 4EUTA 4ILGB 2Z14A 2K6DB 1ZW7A 3OLMD 1FHWA 2Z13A 2QSDA 2YEPF 3W2DA 4MJSB 3KYCD 4JQWC 5DI9B 4CHMA 1UGMA 3KW5B 2LUMA 2DWQA 2EKEC 2C7NB 3TVVA 3KSYA 2KHWB 1YQ4B 1MG4A 1EF1A 1VBHA 2BS4B 4M00A 1C79A 1SE3A 4KHBB 3CSFA 1QLBB 5CHWA 3R8BA 1E8ZA 3HM3A 3TL5A 3RZWC 5HE1A 2WXQA 2AEHA 3SO6A 1V6EA 5EE3A 2Z0PA 3ENBA 5D3YA 4B95A 2Y8GA 4R3DA 2RPQA 5M4YB 1D5ZC 3M95A 3MC9A 2Y7BA 1PGXA 2IZVB 2JPHA 5JHBA 4HXDA 2WXKA 2V9HA 4KSKC 2R2OA 3Q69A 2V3SA 2KUPA 3NWDA 3FILA 1AW7A 3ZRFA 1H4RA 1QZEA 4MM3B 4W9KA 2KK8A 1ZC3B 2Y5BB 1QOGA 1WR1A 1Y56A 2D3GA 4JLCA 1OGWA 3L10B 3VTVA 2PIAA 4AQ7A 2M0AA 4CHKA 1TQZA 4AP4C 2L1CA 2JSVX 4MT7A 2RMMA 4LNNA 1U2BA 1J19A 2K2UA 1BMLC 1TZ1A 3DHIC 3PSCA 5L81A 3ZNID 2K3UA 3KRXA 2M56B 1WZ0A 1E10A 5T8IA 3PO0A 2GBJA 4MGZE 4M0WA 2ROZB 1IPGA 2NPTB 3HIZA 1HEZE 5EE9A 1MPEA 2AQ2B 3KUCB 4XYCA 2W2XD 1T3QA 4LNOA 2LOZA 3U52E 2FNJB 2QEJC 3R66C 4JKHA 1IBXB 1K52A 3WALA 3CSTA 1XCTL 1FB8A 2NR2A 4WURA 1BWNA 4A6FB 3MC8A 1KZ7A 1I2HA 2CY5A 2DX5A 4NQLB 3GYOA 1TJEA 4DXFA 1E6EB 2L76A 2JWZA 4W9IA 2WDVB 1JW9D 1L4DB 4IKGA 3EHVA 1AQCA 2LKOA 2K00A 1WXMA 5D3XA 3A4SC 4W9CA 2W54A 3BYYB 2W82A 3PRPB 3TSSA 2IY0B 1SSNA 5KCVA 4HSIA 1RAXA 1N60A 5I2MA 4K17A 5G55A 1PDXA 1YN3A 2RNRB 4WJNA 1IUEA 2ZNVB 3VVWB 3E9OA 2K22A 2KMAA 2CB8A 3K9PB 1PYWD 4ANWA 4HAYB 3Q8BA 1DOXA 4WVFB 4YTNB 1V1OA 3U7ZA 5JP4A 2MA9B 3ZNHB 4CQNA 1TT5B 1F77A 4B6WA 2JZ3B 2MSED 4HAZB 2JX5A 4KGRA 5HHDG 2RDHA 2D07B 3WCQA 2RLOA 2KLGA 3GOEA 3W1SC 2WXOA 3DHHC 2LUEA 3A1QA 4ZOHC 3PRZA 1JMLA 1JQ4A 4IM0A 1UUPA 1K5GB 2N1VA 4LDTB 1P5TA 1ROEA 2KN5A 2M8SA 2ZVOA 3HVZA 1C1YB 3QAQA 1ZUD2 3AMZA 2BTEA 4GN1A 3Q2AC 4DHJD 3MHZA 3P4PB 1ZC4B 3T8MA 1GG3A 3ZXRA 4JE3B 4QAYA 5FK9C 1F52A 3BIID 1WGUA 3PHXB 2PMVA 1T0SC 2OEDA 4GDKB 3GZNB 4A55A 3ETRA 1AN8A 1GC6A 2LBBA 4L1RA 4C80A 2X0SA 2JYEA 2JT4B 1P7EA 3ZVRA 3ML8A 4AUQC 1YX5B 1E5WA 2MCNB 1SJED 3B08A 5KHOA 4A6QA 2L3ZA 4M02A 4M8NA 2MKRA 2FIDA 1ET6A 4IOIE 2Q5WD 3GB1A 2ZW1A 3K9OB 4FHKA 1NI2A 3PZ7A 2WNMA 3MTNB 4DHZE 5C79A 2E6XA 2KMCA 3H8HA 3KUDB 3EECA 4ZHOA 1HA5A 1MFWA 4HCPB 3VH4B 3X23A 4HAXB 2ELBA 1L0XB 3TIXA 1E8YA 1X86A 1WXVA 3V5WA 1Z2MA 2LJ5A 1FCCC 4G0NB 2L1AA 2ZPYA 4J3OD 1XLPA 4GZUA 1WMHB 3ZJUA 3BK2A 3MJWA 1L6VA 2V4LA 3P4SB 3ZDTA 3QBVB 1SE4A 2KGXB 2WXFA 5L83A 5AZHA 1KFYB 2KXJA 2N9KA 4LNFA 1CK1A 2OQBA 2WDRB 4MGIE 5HFYA 4W9DA 2GBKA 2R2YA 3JSVA 2DHIA 4P1CC 1XXGA 1WFYA 2BWFA 3I5JC 1UWXA 2M19A 4ICUA 1DOYA 1KLUD 3GE8C 2H7DA 1XD3B 3H9DA 1GB4A 3ZQ4A 3A9JA 5LG4B 5G5GA 2JYTA 1RJ2A 2KTFA 4F7UP 3A9KA 2YS3A 2WHIA 1IYFA 4JGHB 4KIKB 1XKEA 4DK5A 3IBEA 4DHJB 4HVBA 1YJJA 4KDIC 1HTQA 2PTLA 4CHJA 5DHFB 4XWWA 2KWUB 4HDOA 1FFVA 4I6LB 2BKRB 2KQSA 3ZKJC 3FSSA 3NZSA 3W1SA 3SBTA 1ZE3D 2RSUA 3TO1A 4TYZA 1XX0A 1V80A 1WF9A 1NTYA 3KYDD 2COCA 3ZO5B 2PVGC 2BF8B 2XK5A 3Q8CA 4RFBA 1L4ZB 4G3XB 4PS8A 2K8EA 3MFGA 4ZRIA 4OW0A 3BWUD 3KVFB 5CLLB 2L00B 4DXAB 1WX7A 2XBBC 3EFCA 5D3DA 4FADA 3ZRCA 4BBNC 2QMTA 4EKUA 2FBWB 2INDC 4GLSC 1MG8A 3P6AA 4RGOS 1TGZB 1MIZB 1WYGA 1FRDA 1WM3A 3MHSD 1X1MA 3L08A 3E66A 4RNAA 2VRWB 2BPSA 1ST7A 4BAXA 1CJEA 5I2SA 4H2AA 2KO3A 2DTCA 4X57B 3M62B 3IT4B 5HG2A 1R4NB 2VKIA 2L05A 3HSAA 3LJUX 2G4SA 2DLWA 4F7GA 1XF5L 4KDLB 1BAKA 2VZKD 2NTSA 2I1JA 3KH0A 2FDQA 4JKGA 4JWSC 1YX6B 3Q3JA 4QJ4B 4FBJB 4A3PA 1WXSA 2D3CA 2JUOA 3AU4A 5BO4B 1OMWA 2YSZA 1FNVA 1SEBD 2WX1A 2CY4A 2FCQA 3U4EG 4EE2A 1L0YB 1SGHA 4PYUA 5C3JB 5IOIA 2PZ1A 5TR5A 2MJ3A 2K39A 3RZFA 3VR8B 4QXAB 4YTPB 4P16A 1HE8A 1AWEA 2IGHA 4YWGG 2PJHA 3HIEA 1U29A 1WR6E 2LYDA 1E7VA 3HW2B 3SUZA 1UNPA 3V05A 4AS1A 1PGAA 3AXCA 2N23A 3C0RB 2K5PA 1OTRB 4CO7A 1KLGD 1UELA 5JHHA 1B1ZA 2LJIA 1V5TA 2JXTA 4MELA 1OQYA 2KC2A 1OQRA 3FKYA 3VRBB 2QKMA 2WDTB 1S1QB 4WWNA 3UIOB 1Z87A 1MK7B 2KYWA 1VD2A 1EO6A 2MBOA 5AUIA 4PQ0A 2DYBA 1CQVA 1P9DU 4S17A 3NVZA 2DZMA 2J59M 1UBQA 2FIFA 3E9LA 4US8A 3B2FA 1R4MB 2HDEA 2MEKA 4EZJA 1X1FA 2IO2B 3CIRB 4NJCA 4BFRA 3KZ1A 3FLVA 1F2RI 4JL9A 1C9FA 4A6KA 4KAXB 2GBNA 3U8ZA 2MLBA 4WSFA 3RFZB 1W1GA 1KM7A 2G9HD 4LNKA 1HTOA 4ITKA 4HB3B 1ENFA 5TSSA 4IG7B 1FMAD 1DBHA 2LZ6A 2I2YA 3QK0A 1F0ZA 1FNWA 2CAYA 1MI0A 2W3RA 2K8BA 4CYEA 4MSMB 3D32A 5IJMA 2RDGA 4PNKA 1I4RA 4C7YA 1EU4A 3EFUA 4MACA 3SFDB 2DLBA 1UNSA 3I63C 3FEHA 2MH7A 2ZPNA 3KUZA 4LTUA 3VUWA 4AWJA 1V5PA 2GUMA 2VZKB 1JCKB 2KZRA 3JVZX 4K3BA 1I42A 2N9PC 4M0WB 2KLCA 1TS5A 2AYOB 4YONA 3AE4B 3CWIA 3BVGA 2J0KA 4WH4A 3GE3C 1N5XA 1V1PA 5KHQA 1K53A 2GOWA 2E3TA 4GPTB 1N63A 1ISNA 2G3QB 2WXGA 2UYZB 3E56A 4YSZB 5AEKB 3ZNGC 1WGYA 2DHKA 2L8JA 3EPYA 2ON8A 1WGKA 2N9EB 2MBHA 3R3MA 5I4DA 1FM0D 2DX5B 5BYSA 5E6NA 1GC7A 4C56C 5FI0A 4HPPA 3I3TB 2LMCA 2W9NA 5IRSA 2DHZA 1ZXIA 2LGSA 1MAIA 1NTVA
chains in the Genus database with same CATH topology
3ZW3A 1T0YA 3RD2A 3ML9A 2DFKA 2IFSA 2YS5A 4ZRJA 3P7ZA 3B0AA 2KX3A 2KANA 1BTNA 5AZGA 3UZTA 1HBKA 4IWOA 3OANA 5EFXA 1VBGA 2IBIB 4WJOA 3S2AA 3QWZB 2O2VA 4HK2A 2DYQA 2Q13A 1YQBA 3APCA 2Z0OA 3LJ3A 3A98B 2XEWA 2IYBA 3CXBB 2LGDA 3WAPA 3DVNV 2K25A 2KFKA 3DPDA 1EAZA 5CHVC 4KZ0A 1RRPB 1HB8A 3PLVA 2N4FA 3NS8A 1EF5A 1FAOA 2N9XA 3D8DA 4ICVA 3W1YA 1GUAB 2O6VA 2AL3A 2YLMA 2D11A 1PMSA 2DAFA 1WJ4A 2VRRB 3DVGY 4BKSA 2WYQA 4LDTD 1Q5WB 3ODXA 4XX5A 4WWOA 4K7WA 3JW0X 2MX2A 1M94A 3VFKA 1WE6A 2HTHA 3UQBA 3IHPC 2R09A 1XT9B 4TQ0A 1WI1A 2JRIB 2KOXA 4HDQA 1Q1OA 2C9WB 3PVLA 2CS4A 2DHJA 1WRDB 4DHZB 3ODWA 4EZLA 1UPRA 3VUYA 5D94A 1DDVA 4IC7B 1H8CA 1RFAA 4MEMA 2LGXA 3ZVVA 4WJQA 2M14A 4GGQA 5G2NA 3QARA 1V49A 2JXXA 3CF6E 3A8QA 4XWXA 2YRYA 2HJ8A 1KOTA 2LD9A 1KI1B 2PE9A 4BOZB 3JSVB 5CTRC 2D9WA 2FUHB 1SHCA 4F7HA 1V5OA 4FA6A 1CMXB 2BYEA 5KQ4A 3HK0A 2B3AA 4E74A 3UINB 3PRMB 4WJPA 2MBEA 3A9JB 4MJSA 2PE6B 4BKTA 2UZSA 3DVGX 1YJ1A 2AL6A 3A9KB 3PGEA 5GOWB 2ZNVC 1IP9A 4Z2MB 2KDIA 4DX8A 1MPHA 2N7DA 2I1KA 4IM3A 2Z0QA 3ZNZB 2AWTA 1FOEA 3N32A 2ZZPB 2DA0A 3UGBB 2KJ6A 3ULCA 4W9HA 3KRWA 2MWNB 5AZFA 3MDBC 3ALBA 3FP5A 2MQJA 2Z59B 2XK5B 2JRHA 4BOSC 2H7EA 3ZTDA 2RUKB 1PFJA 4M8MA 3AU5A 1DDWA 1ZGUB 2RR9A 2CR5A 5HE3A 3PZDA 1AARA 2FCMA 4LCDE 1U5GA 4NPNA 1LB1A 3RULA 1YIWA 3L54A 3HQCA 2IO3B 1WX9A 2UVMA 2W2XC 4B9KA 4HAUB 1K5DB 4XZ4A 4JKGB 1ZM0A 1TBEA 4GDLB 2X18A 4W9GA 2A5UA 2RQ1A 5C5BB 4I6PA 3NSUA 3TBLD 4DWFA 4AOFA 4W9LA 3SBGA 1V5MA 4ILJA 5CX3A 5DHAB 5DCNA 2I5CA 5DH9B 2RD0A 2CHXA 2P8VA 2FJLA 1OEYA 3VAWA 4GXBA 1E8WA 1FHOA 4A6FA 4GOCA 2KNBA 1QC6A 3M63B 2FAZA 2MWSB 3L16A 2COFA 3WIMA 3PVWA 1YD8U 3V60A 1M7RA 4NY0A 2LG1A 2DKQA 3VTUA 4DDGD 3G9WA 4JKCA 2UZRA 2DZKA 4H8SA 2FCNA 3L17A 2IY1B 5D3WA 2CODA 4A20A 5J2RA 2ZCCA 1DROA 1UBIA 1EGXA 1W1DA 2HRJA 4HPMB 2YT0A 1FHXA 1Y5OA 2BWES 3PVUA 1UEFA 4B6HA 3M1IB 1DIKA 1P3QU 3OJ4B 1UZXB 2V76A 2COPA 3ENEA 4HB0B 4JK7A 1X11A 3OJ3A 2V1YA 5HE0A 4TQ1A 1NVLA 4FN2A 2ABDA 2RVBB 2K6QA 1IRSA 3PSEB 4I6NB 5JLJB 1WJ1A 4JK8A 1LFDA 5LLIA 1V9JA 3DBRI 3A8PA 3P2BA 1WJMA 2PEAA 1J8CA 4MDKE 4MGKE 1JRUA 3T9LA 3PP2A 1OEYJ 4RM9A 2D4QA 2K8HA 2UWQA 4RMAA 2LRUA 4MY6A 2KDEB 2RGFA 4NSWA 1XD4A 2IO1B 2MDXA 4TKNA 3M3JA 1WZ3A 3ONSA 5D7GA 4PYZA 4EFOA 4KHOA 5DPSA 4E3CA 4IUMB 3DXEA 2EJ8A 2YF0A 3VHTC 2LXAA 2LI5A 4C0AA 3H6NA 2BYFA 3WAMA 1WMHA 2DX1A 4EJNA 3GZNI 2OOBB 3NY5A 3QWMA 3H7SA 1SIFA 2KDFB 1L7YA 1P0RA 5KQ1A 2R82A 4HPLB 2DKPA 3BY4B 2K2JA 4DX90 1NTIA 1HB6A 4F7ZA 1JDEA 4DBGA 1Q0WB 1MK9B 4JK9A 2CHZA 3APFA 5J18A 5HE2A 2LOXA 2G4DB 4HWIB 2XQNM 1GJZA 2LWPA 3VXWA 2NBWB 3R7QA 1WY8A 3E9PA 1SE9A 1P3RA 1WYWB 4KIKA 2P0HA 2IO0B 2O6VB 5DPRA 1WGGA 3JYUA 2EC1A 1NBFC 1V2YA 2K8CA 2VSZA 5E6PA 2N1WA 3TW1A 4ASWC 2L2IA 3HHMA 2Y8FA 2M0XA 5CHFA 2HTHB 3QJZA 3RCZA 5DPWA 1V61A 2DYOA 1J0GA 1ZSQA 1MKEA 4N9F4 1P1AA 4GMVA 4ZYNA 2J0JA 2WWZA 2G35A 2MFQA 4A5KA 1H10A 3QA8A 5D3VA 2BYVE 3VIAA 1WGDA 3VUXA 1K8RB 4JIOU 1KZGA 3D8EA 2KVRA 4WWPA 3U30A 2D2QA 2R0DA 4NJ6A 4P7IA 3SDLC 2Z0DB 2D10A 1TJ6A 2KJHB 5C23A 4PS7A 2N7EA 3ZIMA 3D8FA 1X05A 1UH6A 1WI0A 2KTRA 4ANUA 4A6HA 4NAWA 2ZEQA 2C60A 5JVLA 3VQIA 2JP2A 3BINA 2E2XA 4JKDA 3N7CA 5J3TA 2C5LC 2MW5A 4FULA 4WAAA 3X0WA 2ZVNA 3ML4A 1I35A 4GMXB 1LXDA 2COAA 2BGFA 2MRPA 5LONB 4GU2A 2JF5A 3EC8A 1XCGA 2MP2A 3H7PA 4MGYE 5J17A 1UNRA 4BVUC 5D27A 3V61A 1R4NI 4AJYB 3A1QB 4ZRKA 2CKHB 4OVUA 2DAJA 1LW3A 4IWQA 3NOBA 4MH0E 3SD5A 2WH5A 4LJOB 3TJPA 3QIJA 1DYNA 1LM8B 4FJVB 2CU1A 3DCGA 2LASA 2D9XA 2DIKA 2NMBA 2CHWA 4D0NB 4HJKA 5CLQB 3PT2B 2LVOA 2DYNA 2DZIA 3AULA 3SHQA 3PREA 3WA0A 5IA7A 4ILHA 3O65B 4NJ7A 3RT3B 4ANXA 3QQ8B 3HM6X 3GYPA 5J3QA 1WM2A 5DIFB 1WXAA 2MBQA 2HD5B 4Z2NA 2ZCBA 3VH3B 1KBLA 2FJ9A 1WIAA 1R4MI 3APDA 5L95C 2KWCA 3IVFA 5EDSA 1TTNA 1DDMA 4YL8A 4HAVB 4FHJA 4URKA 2JZZA 2J0MA 3DOWA 3WYFB 5D6JB 3UF8A 3VDZA 1WGHA 3PV1A 4HHVA 1M7EA 3CMMB 2CRFA 3SNHA 3U7DA 2PPHA 1GNUA 1Y8RC 4FLHA 3FM8C 3ECIA 5GMVA 1WVHA 2K1FA 2BKFA 1KLVA 3T06A 4K81A 1V89A 5LXHA 4EMOA 1E90A 4KHAA 5C6RA 2DN6A 3IFWB 2GS0A 2EMSA 2JY6A 1TXDA 4EEWA 3UIPB 3DVNU 3PS6A 2ASQA 2NBVB 3NHEB 4KVGB 1WX8A 2MBBB 1E8XA 4MSQB 2M1MA 1FGYA 2WX0A 4IW0A 4MM3A 4J6IA 5JH5C 3DBLI 2M38A 1ZKHA 1NDDA 4JKEA 3NZUA 5J3YA 3F5RA 2LULA 3TMPB 4Y94A 2RSGA 4ZDVA 2RGNB 2OJRA 3LDZE 4IAPA 1U5EA 4FJZA 4AJWA 1U27A 4K2OA 4HCNB 4NNJB 2DENB 3V6CB 4II2B 2P0DA 5C16A 1XODA 1FXTB 4IOYX 2YVCA 5JZEB 3PLUA 1J0WA 3OAWA 4NQKE 2NPTA 1V88A 2NS5A 4K7SA 3PG7A 1E7UA 3PEGA 4BBKA 4JKBA 1OQNA 1WJ6A 2KX0A 2ZJDA 1P98A 2NBUA 1MIXA 2C7HA 1RLFA 2C7MB 2IYDB 2N0YA 3L13A 1D3ZA 3A33B 3QHTA 2REXA 3V6EB 1WE7A 3PTFC 3SU8X 2KQ7A 2I5FA 2BCJA 4BKGA 2YS1A 2W2WA 3A4RA 3RUIB 3ZUNA 4II3B 3V62A 3ZLZA 1A5RA 4ANVA 1LQBA 5LXIB 4KV2A 4MK0A 1W1HA 1PLSA 2LVQA 4IM2A 5JHAA 4IFSA 1F9JA 3SYXA 4LJPB 3RCPA 2QKLA 4HATB 3DQVA 3ZTCA 3N30A 3PPAA 1VCBA 2P0FA 4JKFA 2CQUA 1V86A 4GSWA 4TUUA 1V81A 1NU2A 1B55A 2KD0A 2J7QB 4F1SA 5DPTA 2KCJA 1KJTA 1EVHA 4F8CB 1WJNA 2O6VD 3O96A 5D2MB 1UD7A 1I7AA 2M4NA 4BKSD 2NCNA 3DXCA 3QX1A 1G6JA 4G11A 3KY9A 4GDKA 1X1GA 2GJYA 2NZ8B 2D9VA 2GBRA 1XQQA 3H1UA 2DYMA 4IWPA 4K7UA 4HLEA 4HB4B 1U5FA 4HB2B 3DXDA 4W9EA 1EUVB 2NVUI 1FGZA 5HKHA 3CIKA 2KTRB 2LVPA 3R7RA 1WGRA 2QHOA 4NAWB 3DBHI 4RM8A 1U5DA 5LOPB 4GDLA 2G45B 5FI1A 5C5BA 4GIVA 3VTWA 3F0WA 2M17A 4WJ7A 2Z0EB 4DDID 1KC7A 4BBNF 3MPXA 1RRBA 2O2VB 4K1RB 3N3KB 2GCLA 2L0FA 2ELAA 2MP2B 4TV3A 2R2QA 2D9YA 3H7PB 3Q3FA 1ACAA 3RYTA 4EOYA 2GCJA 3ZDMC 3TFMA 1ZVRA 1UPQA 4XC2A 3QC8B 2KFKB 3L0WB 2L0TA 4A3OA 4KZCA 1V5UA 1Q67A 2KJRA 2GBMA 1PQSA 2FCSA 3BJIA 2ADZA 3ODOA 2KDBA 1Y19B 5C1ZA 1S3SG 2KKCA 2LRWA 2JVCA 2A4ZA 4FJYA 4WQOB 2KC1A 2KWVB 4W9FA 2DZJA 1QQGA 4G50A 3WAOA 3DBSA 1BT0A 2LXCA 4L6EA 1GGOA 3SV1A 1Z5SB 3QCAA 5E6OA 4K2PA 4DBBA 4PS3A 1WH3A 3PHWB 2LGYA 2ROVA 5FR6A 1BTKA 3B1LX 1L2NA 1C3TA 4W9JA 3VOQA 3IG3A 4EZKA 1WJUA 2L7RA 4JKAA 4KSLC 2EMTA 1WGQA 1U4AA 2D9ZA 4E71A 4HAWB 2KFJA 1P6SA 3AI5A 2OTXA 1WG7A 1UNQA 1XR0B 3AJ4A 2HE7A 1N3HA 3DDCB 1OY2A 2GMIC 4GB9A 3TCAA 3ULBA 3WANA 3UQAA 2YT1A 4OVVA 5JHGA 5IAAC 4EUTA 4ILGB 2K6DB 1ZW7A 3OLMD 1FHWA 4MJSB 3KYCD 4JQWC 5DI9B 4CHMA 1UGMA 3KW5B 2EKEC 2C7NB 3TVVA 3KSYA 2KHWB 1EF1A 1VBHA 4KHBB 3CSFA 5CHWA 1E8ZA 3TL5A 3HM3A 3RZWC 5HE1A 2AEHA 3SO6A 1V6EA 2Z0PA 3ENBA 5D3YA 4B95A 2Y8GA 2RPQA 3M95A 2Y7BA 2IZVB 2JPHA 5JHBA 4HXDA 4KSKC 2R2OA 2V3SA 2KUPA 3ZRFA 1H4RA 1QZEA 4W9KA 2KK8A 1ZC3B 2Y5BB 1WR1A 2D3GA 4JLCA 1OGWA 3L10B 3VTVA 4CHKA 1TQZA 4AP4C 2L1CA 4MT7A 1U2BA 1J19A 2K2UA 1TZ1A 3PSCA 5L81A 3ZNID 3KRXA 1WZ0A 2GBJA 4MGZE 2ROZB 1IPGA 2NPTB 3HIZA 3KUCB 2W2XD 2LOZA 2FNJB 3R66C 4JKHA 3WALA 3CSTA 1FB8A 2NR2A 1BWNA 4A6FB 1KZ7A 1I2HA 2CY5A 2DX5A 4NQLB 3GYOA 2L76A 2JWZA 4W9IA 3EHVA 1AQCA 2LKOA 2K00A 1WXMA 5D3XA 3A4SC 4W9CA 3PRPB 2IY0B 5KCVA 1RAXA 4K17A 5G55A 2RNRB 4WJNA 2ZNVB 3VVWB 3E9OA 2KMAA 2CB8A 3K9PB 4ANWA 4HAYB 4WVFB 5JP4A 2MA9B 3ZNHB 4B6WA 2JZ3B 2MSED 4HAZB 2D07B 2RLOA 2KLGA 3GOEA 3W1SC 2LUEA 3A1QA 3PRZA 4IM0A 1K5GB 2N1VA 4LDTB 1P5TA 2KN5A 2M8SA 2ZVOA 1C1YB 3QAQA 4GN1A 4DHJD 1ZC4B 3T8MA 1GG3A 1WGUA 3PHXB 4GDKB 1GC6A 2LBBA 2X0SA 2JT4B 3ZVRA 3ML8A 4AUQC 1YX5B 1E5WA 2MCNB 3B08A 5KHOA 2L3ZA 4M8NA 2MKRA 2FIDA 3K9OB 4FHKA 1NI2A 3MTNB 4DHZE 5C79A 2KMCA 3KUDB 3EECA 4HCPB 3VH4B 3X23A 4HAXB 2ELBA 3TIXA 1E8YA 1X86A 1WXVA 3V5WA 1Z2MA 2LJ5A 4G0NB 2ZPYA 4GZUA 1WMHB 3MJWA 2V4LA 3ZDTA 3QBVB 2KGXB 5L83A 5AZHA 2KXJA 2OQBA 4MGIE 4W9DA 2GBKA 3JSVA 2DHIA 1WFYA 2BWFA 4ICUA 3H9DA 2H7DA 1XD3B 3A9JA 1RJ2A 2KTFA 4F7UP 3A9KA 2YS3A 1IYFA 4JGHB 4KIKB 1XKEA 4DK5A 3IBEA 4DHJB 4HVBA 4KDIC 4CHJA 5DHFB 2KWUB 4HDOA 4I6LB 2BKRB 2KQSA 3ZKJC 3FSSA 3NZSA 3W1SA 3SBTA 2RSUA 3TO1A 4TYZA 1XX0A 1V80A 1WF9A 1NTYA 3KYDD 2COCA 3ZO5B 2BF8B 2XK5A 4G3XB 4PS8A 4ZRIA 3KVFB 5CLLB 2L00B 4DXAB 1WX7A 2XBBC 4FADA 3ZRCA 4BBNC 4EKUA 1MG8A 3P6AA 1TGZB 1MIZB 1WM3A 3MHSD 1X1MA 3L08A 3E66A 2VRWB 2BPSA 1ST7A 2DTCA 2KO3A 4X57B 3M62B 2VKIA 2L05A 3LJUX 2G4SA 2DLWA 4F7GA 4KDLB 1BAKA 2I1JA 3KH0A 2FDQA 4JKGA 1YX6B 3Q3JA 4FBJB 4A3PA 1WXSA 2JUOA 3AU4A 5BO4B 1OMWA 2YSZA 2WX1A 2CY4A 2FCQA 1SGHA 4PYUA 2PZ1A 5TR5A 2K39A 3RZFA 1HE8A 1AWEA 2PJHA 1U29A 1WR6E 2LYDA 1E7VA 3HW2B 3SUZA 1UNPA 3AXCA 2N23A 3C0RB 1OTRB 4CO7A 1UELA 5JHHA 1V5TA 4MELA 1OQYA 2KC2A 2QKMA 2WDTB 1S1QB 4WWNA 3UIOB 1Z87A 1MK7B 1VD2A 1EO6A 2MBOA 4PQ0A 2DYBA 1P9DU 2DZMA 2J59M 1UBQA 2FIFA 3E9LA 4EZJA 1X1FA 2IO2B 4BFRA 3KZ1A 3FLVA 4JL9A 4A6KA 4KAXB 2GBNA 3U8ZA 2MLBA 4WSFA 1W1GA 1KM7A 4HB3B 4IG7B 1DBHA 2LZ6A 3QK0A 2CAYA 2K8BA 4CYEA 4MSMB 3D32A 5IJMA 4PNKA 3EFUA 3FEHA 3KUZA 2ZPNA 3VUWA 4AWJA 1V5PA 2KZRA 3JVZX 1I42A 2N9PC 4M0WB 2KLCA 2AYOB 4YONA 2J0KA 5KHQA 2GOWA 4GPTB 1ISNA 2G3QB 2UYZB 5AEKB 3ZNGC 1WGYA 2DHKA 2L8JA 3EPYA 2N9EB 2MBHA 3R3MA 2DX5B 5E6NA 1GC7A 5FI0A 3I3TB 2W9NA 2DHZA 1MAIA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW3 A;  1T0Y A;  3RD2 A;  3ML9 A;  2DFK A;  2IFS A;  2YS5 A;  4ZRJ A;  3P7Z A;  3B0A A;  2KX3 A;  2KAN A;  1BTN A;  5AZG A;  3UZT A;  4IWO A;  3OAN A;  5EFX A;  2IBI B;  4WJO A;  3S2A A;  3QWZ B;  2O2V A;  4HK2 A;  2DYQ A;  2Q13 A;  1YQB A;  3APC A;  2Z0O A;  3LJ3 A;  3A98 B;  2XEW A;  2IYB A;  3CXB B;  2LGD A;  3WAP A;  3DVN V;  2K25 A;  2KFK A;  3DPD A;  1EAZ A;  5CHV C;  4KZ0 A;  1RRP B;  3PLV A;  2N4F A;  3NS8 A;  1EF5 A;  1FAO A;  2N9X A;  3D8D A;  4ICV A;  3W1Y A;  1GUA B;  2O6V A;  2AL3 A;  2YLM A;  2D11 A;  1PMS A;  2DAF A;  1WJ4 A;  2VRR B;  3DVG Y;  4BKS A;  2WYQ A;  4LDT D;  1Q5W B;  3ODX A;  4XX5 A;  4WWO A;  4K7W A;  3JW0 X;  2MX2 A;  1M94 A;  3VFK A;  1WE6 A;  2HTH A;  3UQB A;  3IHP C;  2R09 A;  1XT9 B;  4TQ0 A;  1WI1 A;  2JRI B;  2KOX A;  4HDQ A;  1Q1O A;  2C9W B;  3PVL A;  2CS4 A;  2DHJ A;  1WRD B;  4DHZ B;  3ODW A;  4EZL A;  1UPR A;  3VUY A;  5D94 A;  1DDV A;  4IC7 B;  1H8C A;  1RFA A;  4MEM A;  2LGX A;  3ZVV A;  4WJQ A;  2M14 A;  4GGQ A;  5G2N A;  3QAR A;  1V49 A;  2JXX A;  3CF6 E;  3A8Q A;  4XWX A;  2YRY A;  2HJ8 A;  1KOT A;  2LD9 A;  1KI1 B;  2PE9 A;  4BOZ B;  3JSV B;  5CTR C;  2D9W A;  2FUH B;  1SHC A;  4F7H A;  1V5O A;  4FA6 A;  1CMX B;  2BYE A;  5KQ4 A;  3HK0 A;  2B3A A;  4E74 A;  3UIN B;  3PRM B;  4WJP A;  2MBE A;  3A9J B;  4MJS A;  2PE6 B;  4BKT A;  2UZS A;  3DVG X;  1YJ1 A;  2AL6 A;  3A9K B;  3PGE A;  5GOW B;  2ZNV C;  1IP9 A;  4Z2M B;  2KDI A;  4DX8 A;  1MPH A;  2N7D A;  2I1K A;  4IM3 A;  2Z0Q A;  3ZNZ B;  2AWT A;  1FOE A;  3N32 A;  2ZZP B;  2DA0 A;  3UGB B;  2KJ6 A;  3ULC A;  4W9H A;  3KRW A;  2MWN B;  5AZF A;  3MDB C;  3ALB A;  2MQJ A;  2Z59 B;  2XK5 B;  2JRH A;  4BOS C;  2H7E A;  3ZTD A;  2RUK B;  1PFJ A;  4M8M A;  3AU5 A;  1DDW A;  1ZGU B;  2RR9 A;  2CR5 A;  5HE3 A;  3PZD A;  1AAR A;  2FCM A;  4LCD E;  1U5G A;  4NPN A;  1LB1 A;  3RUL A;  1YIW A;  3L54 A;  3HQC A;  2IO3 B;  1WX9 A;  2UVM A;  2W2X C;  4B9K A;  4HAU B;  1K5D B;  4XZ4 A;  1ZM0 A;  1TBE A;  4GDL B;  2X18 A;  4W9G A;  2A5U A;  5C5B B;  4I6P A;  3NSU A;  3TBL D;  4DWF A;  4AOF A;  4W9L A;  1V5M A;  5CX3 A;  5DHA B;  5DCN A;  2I5C A;  5DH9 B;  2RD0 A;  2CHX A;  2P8V A;  2FJL A;  1OEY A;  3VAW A;  4GXB A;  1E8W A;  1FHO A;  4A6F A;  4GOC A;  2KNB A;  1QC6 A;  3M63 B;  2FAZ A;  2MWS B;  3L16 A;  2COF A;  3WIM A;  3PVW A;  1YD8 U;  3V60 A;  1M7R A;  4NY0 A;  2LG1 A;  2DKQ A;  3VTU A;  4DDG D;  3G9W A;  2UZR A;  2DZK A;  4H8S A;  2FCN A;  3L17 A;  2IY1 B;  5D3W A;  2COD A;  4A20 A;  5J2R A;  2ZCC A;  1DRO A;  1UBI A;  1EGX A;  1W1D A;  4HPM B;  2YT0 A;  1FHX A;  1Y5O A;  2BWE S;  3PVU A;  1UEF A;  4B6H A;  3M1I B;  1P3Q U;  3OJ4 B;  1UZX B;  2V76 A;  3ENE A;  4HB0 B;  1X11 A;  3OJ3 A;  2V1Y A;  5HE0 A;  4TQ1 A;  4FN2 A;  2RVB B;  2K6Q A;  1IRS A;  3PSE B;  4I6N B;  5JLJ B;  1WJ1 A;  1LFD A;  5LLI A;  1V9J A;  3DBR I;  3A8P A;  3P2B A;  1WJM A;  2PEA A;  1J8C A;  4MDK E;  4MGK E;  1JRU A;  3T9L A;  3PP2 A;  1OEY J;  4RM9 A;  2D4Q A;  2K8H A;  2UWQ A;  4RMA A;  2LRU A;  4MY6 A;  2KDE B;  2RGF A;  4NSW A;  1XD4 A;  2IO1 B;  2MDX A;  4TKN A;  3M3J A;  1WZ3 A;  3ONS A;  5D7G A;  4PYZ A;  4EFO A;  4KHO A;  5DPS A;  4E3C A;  4IUM B;  3DXE A;  2EJ8 A;  2YF0 A;  3VHT C;  2LXA A;  2LI5 A;  4C0A A;  3H6N A;  2BYF A;  3WAM A;  1WMH A;  2DX1 A;  4EJN A;  3GZN I;  2OOB B;  3NY5 A;  3QWM A;  3H7S A;  1SIF A;  2KDF B;  1L7Y A;  1P0R A;  5KQ1 A;  4HPL B;  2DKP A;  3BY4 B;  2K2J A;  4DX9 0;  4F7Z A;  4DBG A;  1Q0W B;  1MK9 B;  2CHZ A;  3APF A;  5J18 A;  5HE2 A;  2LOX A;  2G4D B;  4HWI B;  2XQN M;  1GJZ A;  2LWP A;  3VXW A;  2NBW B;  3R7Q A;  1WY8 A;  1SE9 A;  1P3R A;  1WYW B;  4KIK A;  2P0H A;  2IO0 B;  2O6V B;  5DPR A;  1WGG A;  3JYU A;  2EC1 A;  1NBF C;  1V2Y A;  2K8C A;  2VSZ A;  5E6P A;  2N1W A;  3TW1 A;  4ASW C;  2L2I A;  3HHM A;  2Y8F A;  2M0X A;  5CHF A;  2HTH B;  3QJZ A;  3RCZ A;  5DPW A;  1V61 A;  2DYO A;  1J0G A;  1ZSQ A;  1MKE A;  4N9F 4;  1P1A A;  4GMV A;  4ZYN A;  2J0J A;  2WWZ A;  2G35 A;  2MFQ A;  4A5K A;  1H10 A;  3QA8 A;  5D3V A;  2BYV E;  3VIA A;  1WGD A;  3VUX A;  1K8R B;  4JIO U;  1KZG A;  3D8E A;  2KVR A;  4WWP A;  3U30 A;  2D2Q A;  2R0D A;  4NJ6 A;  4P7I A;  3SDL C;  2Z0D B;  2D10 A;  1TJ6 A;  2KJH B;  5C23 A;  4PS7 A;  2N7E A;  3ZIM A;  3D8F A;  1X05 A;  1UH6 A;  1WI0 A;  2KTR A;  4ANU A;  4A6H A;  4NAW A;  2ZEQ A;  2C60 A;  3VQI A;  2JP2 A;  3BIN A;  2E2X A;  3N7C A;  5J3T A;  2C5L C;  2MW5 A;  4FUL A;  4WAA A;  3X0W A;  2ZVN A;  3ML4 A;  1I35 A;  4GMX B;  1LXD A;  2COA A;  2BGF A;  2MRP A;  5LON B;  4GU2 A;  2JF5 A;  3EC8 A;  1XCG A;  2MP2 A;  3H7P A;  4MGY E;  5J17 A;  1UNR A;  4BVU C;  5D27 A;  3V61 A;  1R4N I;  4AJY B;  3A1Q B;  4ZRK A;  2CKH B;  4OVU A;  2DAJ A;  1LW3 A;  4IWQ A;  3NOB A;  4MH0 E;  3SD5 A;  4LJO B;  3TJP A;  3QIJ A;  1DYN A;  1LM8 B;  4FJV B;  2CU1 A;  3DCG A;  2LAS A;  2D9X A;  2NMB A;  2CHW A;  4D0N B;  4HJK A;  5CLQ B;  3PT2 B;  2LVO A;  2DYN A;  2DZI A;  3AUL A;  3SHQ A;  3PRE A;  3WA0 A;  5IA7 A;  3O65 B;  4NJ7 A;  3RT3 B;  4ANX A;  3QQ8 B;  3HM6 X;  3GYP A;  5J3Q A;  1WM2 A;  5DIF B;  1WXA A;  2MBQ A;  2HD5 B;  4Z2N A;  2ZCB A;  3VH3 B;  1WIA A;  1R4M I;  3APD A;  5L95 C;  2KWC A;  3IVF A;  5EDS A;  1TTN A;  1DDM A;  4YL8 A;  4HAV B;  4FHJ A;  4URK A;  2JZZ A;  2J0M A;  3DOW A;  3WYF B;  5D6J B;  3UF8 A;  3VDZ A;  1WGH A;  3PV1 A;  4HHV A;  1M7E A;  3CMM B;  2CRF A;  3SNH A;  3U7D A;  2PPH A;  1GNU A;  1Y8R C;  4FLH A;  3FM8 C;  3ECI A;  5GMV A;  1WVH A;  2K1F A;  2BKF A;  1KLV A;  3T06 A;  4K81 A;  1V89 A;  5LXH A;  4EMO A;  1E90 A;  4KHA A;  5C6R A;  2DN6 A;  3IFW B;  2GS0 A;  2EMS A;  2JY6 A;  1TXD A;  4EEW A;  3UIP B;  3DVN U;  3PS6 A;  2ASQ A;  2NBV B;  3NHE B;  4KVG B;  1WX8 A;  2MBB B;  1E8X A;  4MSQ B;  2M1M A;  1FGY A;  2WX0 A;  4IW0 A;  4MM3 A;  4J6I A;  5JH5 C;  3DBL I;  2M38 A;  1ZKH A;  1NDD A;  3NZU A;  5J3Y A;  3F5R A;  2LUL A;  3TMP B;  4Y94 A;  2RSG A;  4ZDV A;  2RGN B;  2OJR A;  3LDZ E;  4IAP A;  1U5E A;  4FJZ A;  4AJW A;  1U27 A;  4K2O A;  4HCN B;  4NNJ B;  2DEN B;  3V6C B;  4II2 B;  2P0D A;  5C16 A;  1XOD A;  1FXT B;  4IOY X;  2YVC A;  5JZE B;  3PLU A;  1J0W A;  3OAW A;  4NQK E;  2NPT A;  1V88 A;  2NS5 A;  4K7S A;  3PG7 A;  1E7U A;  3PEG A;  4BBK A;  1OQN A;  1WJ6 A;  2KX0 A;  2ZJD A;  1P98 A;  2NBU A;  1MIX A;  2C7H A;  1RLF A;  2C7M B;  2IYD B;  2N0Y A;  3L13 A;  1D3Z A;  3A33 B;  3QHT A;  2REX A;  3V6E B;  1WE7 A;  3PTF C;  3SU8 X;  2KQ7 A;  2I5F A;  2BCJ A;  4BKG A;  2YS1 A;  2W2W A;  3A4R A;  3RUI B;  3ZUN A;  4II3 B;  3V62 A;  3ZLZ A;  1A5R A;  4ANV A;  1LQB A;  5LXI B;  4KV2 A;  4MK0 A;  1W1H A;  1PLS A;  2LVQ A;  4IM2 A;  5JHA A;  4IFS A;  1F9J A;  3SYX A;  4LJP B;  3RCP A;  2QKL A;  4HAT B;  3DQV A;  3ZTC A;  3N30 A;  3PPA A;  1VCB A;  2P0F A;  1V86 A;  4GSW A;  4TUU A;  1V81 A;  1NU2 A;  1B55 A;  2KD0 A;  2J7Q B;  4F1S A;  5DPT A;  2KCJ A;  1KJT A;  1EVH A;  4F8C B;  1WJN A;  2O6V D;  3O96 A;  5D2M B;  1UD7 A;  1I7A A;  2M4N A;  4BKS D;  2NCN A;  3DXC A;  3QX1 A;  1G6J A;  4G11 A;  3KY9 A;  4GDK A;  1X1G A;  2GJY A;  2NZ8 B;  2D9V A;  2GBR A;  1XQQ A;  3H1U A;  2DYM A;  4IWP A;  4K7U A;  4HLE A;  4HB4 B;  1U5F A;  4HB2 B;  3DXD A;  4W9E A;  1EUV B;  2NVU I;  1FGZ A;  5HKH A;  3CIK A;  2KTR B;  2LVP A;  3R7R A;  1WGR A;  2QHO A;  4NAW B;  3DBH I;  4RM8 A;  1U5D A;  5LOP B;  4GDL A;  2G45 B;  5FI1 A;  5C5B A;  4GIV A;  3VTW A;  3F0W A;  2M17 A;  4WJ7 A;  2Z0E B;  4DDI D;  4BBN F;  3MPX A;  1RRB A;  2O2V B;  4K1R B;  3N3K B;  2GCL A;  2L0F A;  2ELA A;  2MP2 B;  4TV3 A;  2R2Q A;  2D9Y A;  3H7P B;  3Q3F A;  3RYT A;  4EOY A;  2GCJ A;  3ZDM C;  3TFM A;  1ZVR A;  1UPQ A;  4XC2 A;  3QC8 B;  2KFK B;  3L0W B;  2L0T A;  4A3O A;  4KZC A;  1V5U A;  1Q67 A;  2KJR A;  2GBM A;  1PQS A;  2FCS A;  3BJI A;  2ADZ A;  3ODO A;  2KDB A;  1Y19 B;  5C1Z A;  1S3S G;  2KKC A;  2LRW A;  2JVC A;  2A4Z A;  4FJY A;  4WQO B;  2KC1 A;  2KWV B;  4W9F A;  2DZJ A;  1QQG A;  4G50 A;  3WAO A;  3DBS A;  1BT0 A;  2LXC A;  4L6E A;  3SV1 A;  1Z5S B;  3QCA A;  5E6O A;  4K2P A;  4DBB A;  4PS3 A;  1WH3 A;  3PHW B;  2LGY A;  2ROV A;  5FR6 A;  1BTK A;  3B1L X;  1L2N A;  1C3T A;  4W9J A;  3VOQ A;  3IG3 A;  4EZK A;  1WJU A;  2L7R A;  4KSL C;  2EMT A;  1WGQ A;  1U4A A;  2D9Z A;  4E71 A;  4HAW B;  2KFJ A;  1P6S A;  3AI5 A;  2OTX A;  1WG7 A;  1UNQ A;  1XR0 B;  3AJ4 A;  2HE7 A;  1N3H A;  3DDC B;  1OY2 A;  2GMI C;  4GB9 A;  3TCA A;  3ULB A;  3WAN A;  3UQA A;  2YT1 A;  4OVV A;  5JHG A;  5IAA C;  4EUT A;  2K6D B;  1ZW7 A;  3OLM D;  1FHW A;  4MJS B;  3KYC D;  4JQW C;  5DI9 B;  4CHM A;  1UGM A;  3KW5 B;  2EKE C;  2C7N B;  3TVV A;  3KSY A;  2KHW B;  1EF1 A;  4KHB B;  3CSF A;  5CHW A;  1E8Z A;  3TL5 A;  3HM3 A;  3RZW C;  5HE1 A;  2AEH A;  3SO6 A;  1V6E A;  2Z0P A;  5D3Y A;  4B95 A;  2Y8G A;  2RPQ A;  3M95 A;  2Y7B A;  2IZV B;  2JPH A;  5JHB A;  4HXD A;  4KSK C;  2R2O A;  2V3S A;  2KUP A;  3ZRF A;  1H4R A;  1QZE A;  4W9K A;  2KK8 A;  1ZC3 B;  2Y5B B;  1WR1 A;  2D3G A;  4JLC A;  1OGW A;  3L10 B;  3VTV A;  4CHK A;  1TQZ A;  4AP4 C;  2L1C A;  4MT7 A;  1U2B A;  1J19 A;  2K2U A;  1TZ1 A;  3PSC A;  5L81 A;  3ZNI D;  3KRX A;  1WZ0 A;  2GBJ A;  4MGZ E;  2ROZ B;  1IPG A;  2NPT B;  3HIZ A;  3KUC B;  2W2X D;  2LOZ A;  2FNJ B;  3R66 C;  3WAL A;  3CST A;  1FB8 A;  2NR2 A;  1BWN A;  4A6F B;  1KZ7 A;  1I2H A;  2CY5 A;  2DX5 A;  4NQL B;  3GYO A;  2L76 A;  2JWZ A;  4W9I A;  3EHV A;  1AQC A;  2LKO A;  2K00 A;  1WXM A;  5D3X A;  3A4S C;  4W9C A;  3PRP B;  2IY0 B;  5KCV A;  1RAX A;  4K17 A;  5G55 A;  2RNR B;  4WJN A;  2ZNV B;  3VVW B;  2KMA A;  3K9P B;  4ANW A;  4HAY B;  4WVF B;  5JP4 A;  2MA9 B;  3ZNH B;  4B6W A;  2JZ3 B;  2MSE D;  4HAZ B;  2D07 B;  2RLO A;  2KLG A;  3GOE A;  3W1S C;  2LUE A;  3A1Q A;  3PRZ A;  4IM0 A;  1K5G B;  2N1V A;  4LDT B;  1P5T A;  2KN5 A;  2M8S A;  2ZVO A;  1C1Y B;  3QAQ A;  4GN1 A;  4DHJ D;  1ZC4 B;  3T8M A;  1GG3 A;  1WGU A;  3PHX B;  4GDK B;  1GC6 A;  2JT4 B;  3ZVR A;  3ML8 A;  4AUQ C;  1YX5 B;  1E5W A;  2MCN B;  3B08 A;  5KHO A;  2L3Z A;  4M8N A;  2MKR A;  2FID A;  3K9O B;  4FHK A;  1NI2 A;  3MTN B;  4DHZ E;  5C79 A;  2KMC A;  3KUD B;  3EEC A;  4HCP B;  3VH4 B;  3X23 A;  4HAX B;  2ELB A;  3TIX A;  1E8Y A;  1X86 A;  1WXV A;  3V5W A;  1Z2M A;  2LJ5 A;  4G0N B;  2ZPY A;  4GZU A;  1WMH B;  3MJW A;  2V4L A;  3QBV B;  3ZDT A;  2KGX B;  5L83 A;  5AZH A;  2KXJ A;  2OQB A;  4MGI E;  4W9D A;  2GBK A;  3JSV A;  2DHI A;  1WFY A;  2BWF A;  4ICU A;  3H9D A;  2H7D A;  1XD3 B;  3A9J A;  1RJ2 A;  2KTF A;  4F7U P;  3A9K A;  2YS3 A;  1IYF A;  4JGH B;  4KIK B;  1XKE A;  4DK5 A;  3IBE A;  4DHJ B;  4HVB A;  4KDI C;  4CHJ A;  5DHF B;  2KWU B;  4HDO A;  4I6L B;  2BKR B;  2KQS A;  3ZKJ C;  3FSS A;  3NZS A;  3W1S A;  2RSU A;  3TO1 A;  4TYZ A;  1XX0 A;  1V80 A;  1WF9 A;  1NTY A;  3KYD D;  2COC A;  3ZO5 B;  2BF8 B;  2XK5 A;  4G3X B;  4PS8 A;  4ZRI A;  3KVF B;  5CLL B;  2L00 B;  4DXA B;  1WX7 A;  2XBB C;  4FAD A;  3ZRC A;  4BBN C;  4EKU A;  1MG8 A;  3P6A A;  1TGZ B;  1MIZ B;  1WM3 A;  3MHS D;  1X1M A;  3L08 A;  2VRW B;  2BPS A;  2DTC A;  2KO3 A;  4X57 B;  3M62 B;  2VKI A;  2L05 A;  3LJU X;  2G4S A;  2DLW A;  4F7G A;  4KDL B;  1BAK A;  2I1J A;  3KH0 A;  1YX6 B;  3Q3J A;  4FBJ B;  4A3P A;  1WXS A;  2JUO A;  3AU4 A;  5BO4 B;  1OMW A;  2YSZ A;  2WX1 A;  2CY4 A;  2FCQ A;  1SGH A;  4PYU A;  2PZ1 A;  5TR5 A;  2K39 A;  3RZF A;  1HE8 A;  1AWE A;  2PJH A;  1U29 A;  1WR6 E;  2LYD A;  1E7V A;  3HW2 B;  3SUZ A;  1UNP A;  3AXC A;  2N23 A;  3C0R B;  1OTR B;  4CO7 A;  1UEL A;  5JHH A;  1V5T A;  4MEL A;  1OQY A;  2KC2 A;  2QKM A;  2WDT B;  1S1Q B;  4WWN A;  3UIO B;  1Z87 A;  1MK7 B;  1VD2 A;  1EO6 A;  2MBO A;  4PQ0 A;  2DYB A;  1P9D U;  2DZM A;  2J59 M;  1UBQ A;  2FIF A;  4EZJ A;  1X1F A;  2IO2 B;  4BFR A;  3KZ1 A;  4JL9 A;  4A6K A;  4KAX B;  2GBN A;  3U8Z A;  2MLB A;  4WSF A;  1W1G A;  1KM7 A;  4HB3 B;  4IG7 B;  1DBH A;  2LZ6 A;  3QK0 A;  2CAY A;  2K8B A;  4CYE A;  4MSM B;  3D32 A;  4PNK A;  3EFU A;  3FEH A;  3KUZ A;  2ZPN A;  3VUW A;  4AWJ A;  1V5P A;  2KZR A;  3JVZ X;  1I42 A;  2N9P C;  4M0W B;  2KLC A;  2AYO B;  4YON A;  2J0K A;  5KHQ A;  2GOW A;  4GPT B;  1ISN A;  2G3Q B;  2UYZ B;  5AEK B;  3ZNG C;  1WGY A;  2DHK A;  2L8J A;  2N9E B;  2MBH A;  3R3M A;  2DX5 B;  5E6N A;  1GC7 A;  5FI0 A;  3I3T B;  2W9N A;  2DHZ A;  1MAI A;  1NTV A; 
#chains in the Genus database with same CATH topology
 3ZW3 A;  1T0Y A;  1N6Z A;  3RD2 A;  1TS3 A;  2DFK A;  3ML9 A;  2IFS A;  1SBB B;  3Q6B A;  2YS5 A;  3Q3N C;  2CU3 A;  4ZRJ A;  3NWF A;  3P7Z A;  3B0A A;  3OG5 A;  2KX3 A;  3DBL B;  2KAN A;  2OHF A;  1BTN A;  5AZG A;  3UZT A;  1I4G A;  1HBK A;  4IWO A;  2FUG 1;  1XLN A;  3OAN A;  5EFX A;  2INN E;  1ZOY B;  1TIF A;  4D6W A;  1VBG A;  2IBI B;  2GLS A;  3A58 A;  4WJO A;  3S2A A;  5BYQ A;  3QWZ B;  2O2V A;  4HK2 A;  2DYQ A;  2Q13 A;  1YQB A;  2WXL A;  5IKC M;  3APC A;  2Z0O A;  1I7H A;  3LJ3 A;  3A98 B;  1VDV A;  1JWS D;  2INP E;  4Q2J A;  1FIQ A;  2XEW A;  2IYB A;  3CXB B;  2LGD A;  1IGC A;  3WAP A;  3DVN V;  4ZRP A;  2LFI A;  3GP7 A;  2K25 A;  4HRO A;  2KFK A;  3DPD A;  1EAZ A;  5CHV C;  4KZ0 A;  1RRP B;  1JWU D;  1HB8 A;  3AN1 A;  5D3I B;  3PLV A;  1VR9 A;  2N4F A;  3NS8 A;  1EF5 A;  1QKZ A;  1FAO A;  2N9X A;  3D8D A;  4ICV A;  4ZHP A;  3W1Y A;  3NWA A;  1GUA B;  2O6V A;  2AL3 A;  2YLM A;  2D11 A;  1PMS A;  2DAF A;  4HKZ E;  1WJ4 A;  2N0S B;  2VRR B;  1VRA B;  3DVG Y;  4BKS A;  2WYQ A;  4LDT D;  3UI3 A;  1Q5W B;  1NEK B;  3ODX A;  4XX5 A;  3AE8 B;  4WWO A;  4K7W A;  3JW0 X;  2MX2 A;  1M94 A;  3T3O A;  2BS2 B;  3VFK A;  1WE6 A;  2HTH A;  1E7P B;  3UQB A;  3IHP C;  2R09 A;  2BW2 A;  1XT9 B;  4TQ0 A;  1WI1 A;  2JRI B;  2WDQ B;  3VRA B;  2KOX A;  4HDQ A;  1Q1O A;  4RH6 A;  2C9W B;  2CS4 A;  3PVL A;  2DHJ A;  3FC4 A;  1T77 A;  1PUT A;  1WRD B;  4DHZ B;  3ODW A;  2KUQ A;  1WSP A;  1UPR A;  3VUY A;  4EZL A;  5D94 A;  1DDV A;  2WXI A;  3Q8E A;  4IC7 B;  1H8C A;  2B76 B;  1TKY A;  1RFA A;  3BVZ A;  4YXD B;  1TS2 A;  4JPS A;  4MEM A;  4A9A A;  2LGX A;  1F1H A;  2KIE A;  3ZVV A;  4WJQ A;  2M14 A;  4GGQ A;  5G2N A;  3QAR A;  1V49 A;  2JXX A;  3CF6 E;  1YJI A;  3A8Q A;  4L2Y A;  4XWX A;  2YRY A;  1QT9 A;  3NW8 A;  1TKE A;  2DNF A;  2HJ8 A;  1KOT A;  2LD9 A;  1KI1 B;  2PE9 A;  4BOZ B;  3JSV B;  5CTR C;  2D9W A;  2FUH B;  1SHC A;  4F7H A;  1V5O A;  3IXS A;  4FA6 A;  3L4P A;  1CMX B;  2BYE A;  3P1M A;  1FPY A;  5KQ4 A;  3HK0 A;  2B3A A;  4E74 A;  1V97 A;  3UIN B;  1ZDV A;  3DBR B;  3PRM B;  3U2S C;  1HQR D;  3P4R B;  4WJP A;  2MBE A;  3A9J B;  4MJS A;  2PE6 B;  3N20 C;  4BKT A;  2UZS A;  2HTM E;  3DVG X;  1YJ1 A;  2AL6 A;  3AE2 B;  1YNT E;  3SEB A;  1SF0 A;  3A9K B;  3PGE A;  5GOW B;  1SXT A;  2ZNV C;  1IP9 A;  1AWD A;  4Z2M B;  2KDI A;  1OQQ A;  4DX8 A;  1MPH A;  2N7D A;  2I1K A;  4IM3 A;  4B0M A;  1QF6 A;  2Z0Q A;  5MPO A;  3ZNZ B;  4KHB A;  1E0Z A;  2UU7 A;  3BVM A;  1N5W A;  2AWT A;  1FOE A;  3N32 A;  3RI7 C;  2ZZP B;  3RNF C;  2DA0 A;  3LXF A;  3UGB B;  2KJ6 A;  3MJ5 A;  3ULC A;  4W9H A;  3KRW A;  3ZJT A;  2MWN B;  5AZF A;  2FJU B;  3N1Y C;  3MDB C;  3ALB A;  3FP5 A;  2N7J A;  2MQJ A;  2Z59 B;  2XK5 B;  2KAJ A;  2JRH A;  5EE0 A;  1YN5 A;  1IGD A;  4BOS C;  3NZ3 A;  1T6B X;  2H7E A;  4HRS A;  3ZTD A;  2RUK B;  1PFJ A;  4M8M A;  3AU5 A;  2EEL A;  4N59 A;  1DDW A;  1EU3 A;  1P7F A;  1ZGU B;  2RR9 A;  2CR5 A;  5HE3 A;  1SIJ A;  3PZD A;  1AAR A;  2FCM A;  4LCD E;  1U5G A;  1ESF A;  4NPN A;  1LB1 A;  3RUL A;  4GNK B;  1KTK A;  1YIW A;  4TMA B;  1RWS A;  4ZRQ A;  1XLO A;  2MJE A;  3IAS 1;  3L54 A;  3HQC A;  2IO3 B;  1WX9 A;  2UVM A;  2IJ0 A;  2V0G A;  2W2X C;  1RFK A;  3RNE C;  4OT1 A;  4HAU B;  4B9K A;  4A8X C;  1K5D B;  3N1Z C;  2H88 B;  4LLG M;  4XZ4 A;  4JKG B;  1MHH E;  3W9C B;  1ZM0 A;  1TBE A;  4CSQ A;  1K50 A;  3NVW A;  4GDL B;  2X18 A;  4W9G A;  2A5U A;  2RQ1 A;  4QJ3 B;  5C5B B;  4FXC A;  4I6P A;  2K0P A;  2QIE B;  2SAK A;  3NSU A;  1LGR A;  3TBL D;  4DWF A;  3TEX A;  4AOF A;  3KWL A;  4W9L A;  3SBG A;  1V5M A;  4ILJ A;  5CX3 A;  5DHA B;  5DCN A;  2I5C A;  5DH9 B;  2RD0 A;  1F2R C;  4RGM A;  2IDY A;  2CHX A;  3HUI A;  4OHJ A;  1JWM D;  2WXP A;  2P8V A;  2FJL A;  1OEY A;  4P6V F;  3VAW A;  4WQM A;  4GXB A;  1E8W A;  1FHO A;  4A6F A;  4GOC A;  4WIP A;  3C19 A;  2KNB A;  1QC6 A;  2JWU A;  3M63 B;  2FAZ A;  2W3S A;  2MWS B;  2ZW0 A;  4YSY B;  1J7B A;  2J53 A;  3L16 A;  2COF A;  4UDU C;  3WIM A;  1C4A A;  3PVW A;  1YD8 U;  3V60 A;  1QOF A;  2ONQ A;  2BQQ A;  1M7R A;  4NY0 A;  2MHJ A;  2LG1 A;  2DKQ A;  1FRR A;  3VTU A;  4DDG D;  1HZ6 A;  3G9W A;  4JKC A;  2UZR A;  2DZK A;  4H8S A;  1B9R A;  3IT6 B;  1TY2 A;  1I4P A;  1D4B A;  1QOB A;  2FCN A;  3L17 A;  3J9C A;  3Q14 C;  2IY1 B;  5D3W A;  2COD A;  4A20 A;  1A70 A;  2KDM A;  5J2R A;  2ZCC A;  1DRO A;  1TS4 A;  1TY0 A;  1UBI A;  4OZC A;  1EGX A;  2WXH A;  1W1D A;  2HRJ A;  4HPM B;  1DYQ A;  2YT0 A;  1FHX A;  1Y5O A;  2BWE S;  3PVU A;  1UEF A;  4B6H A;  3M1I B;  1DIK A;  4N58 A;  1P3Q U;  3OJ4 B;  1UZX B;  2V76 A;  1BXT A;  2COP A;  1K51 A;  2KAC A;  3ENE A;  3ZYY X;  2NBV A;  4HB0 B;  4JK7 A;  1X11 A;  3OJ3 A;  2V1Y A;  3NVV A;  2ZKM X;  4JWU C;  3I57 A;  5HE0 A;  4TQ1 A;  2BB5 A;  1NVL A;  4FN2 A;  2R61 A;  3HVD A;  1FXI A;  2ABD A;  2RVB B;  5HI1 A;  4P1B C;  4C4V B;  2K6Q A;  1IRS A;  3PSE B;  5BYR A;  4I6N B;  5JLJ B;  1WJ1 A;  4JK8 A;  2QCZ A;  1LFD A;  5E6J A;  5LLI A;  1V9J A;  1I4Q A;  2G1E A;  4WWM A;  3DBR I;  3A8P A;  3P2B A;  1WJM A;  2PEA A;  1J8C A;  4MDK E;  4MGK E;  2WXN A;  1JRU A;  3T9L A;  1UF0 A;  3PP2 A;  1OEY J;  4RM9 A;  4C00 A;  2D4Q A;  2K8H A;  2UWQ A;  1T0Q C;  2MJD A;  1DOI A;  4RMA A;  2LRU A;  4MY6 A;  2KDE B;  2RGF A;  4NSW A;  1XD4 A;  2IO1 B;  2XNA C;  2WGS A;  2MDX A;  3RNG C;  4TKN A;  2BBC A;  3KWV A;  3M3J A;  3OHM B;  1WZ3 A;  3ONS A;  5D7G A;  4PYZ A;  1ZXH A;  4XDD A;  4EFO A;  3AE9 B;  4KHO A;  3MP9 A;  3BK1 A;  5DPS A;  4E3C A;  4IUM B;  3DXE A;  2EJ8 A;  2YF0 A;  3VHT C;  2LXA A;  1HXY D;  4OVZ A;  3DCX A;  2LI5 A;  4C0A A;  1PGB A;  2BYF A;  3H6N A;  3WAM A;  1WMH A;  2DX1 A;  4EJN A;  3GZN I;  2OOB B;  3NY5 A;  3QWM A;  3H7S A;  1SIF A;  5FR3 A;  2KDF B;  3AV8 A;  1L7Y A;  1SE2 A;  1P0R A;  4XDC A;  5KQ1 A;  2R82 A;  4OZB A;  4HPL B;  2DKP A;  3TEZ A;  3BY4 B;  2K2J A;  4DX9 0;  2WP9 B;  3AE1 B;  1NTI A;  1HB6 A;  1RM6 C;  3C8Y A;  4F7Z A;  1JDE A;  4DBG A;  2GRI A;  1VZ8 A;  1QQR A;  1Q0W B;  1MK9 B;  2I38 A;  4RGT A;  3FIL B;  4JK9 A;  2CHZ A;  3APF A;  5J18 A;  5HE2 A;  2WXR A;  2LOX A;  2G4D B;  3W5U B;  4HWI B;  1STE A;  2XQN M;  4NAM A;  2AX5 A;  1QOA A;  1GJZ A;  2LWP A;  3VXW A;  2NBW B;  3R7Q A;  1WY8 A;  3E9P A;  1SE9 A;  5IN7 A;  1P3R A;  1WYW B;  4KIK A;  2P0H A;  2IO0 B;  1V8C A;  2O6V B;  5DPR A;  1T5X D;  1WGG A;  2TSS A;  3JYU A;  1TZO A;  4ZYS A;  2BYT A;  2EC1 A;  4ARC A;  1NBF C;  1V2Y A;  2K8C A;  2VSZ A;  5E6P A;  2YEP B;  1C76 A;  2N1W A;  3TW1 A;  4ASW C;  2L2I A;  1VZ7 A;  5FKA C;  3HHM A;  2Y8F A;  2M0X A;  3RNA C;  5CHF A;  3W5V B;  2HTH B;  3QJZ A;  3RCZ A;  5DPW A;  1V61 A;  2DYO A;  1J0G A;  1ZSQ A;  1MKE A;  2ICI A;  4N9F 4;  1P1A A;  1D5M C;  1GPX A;  4GMV A;  4ZYN A;  2J0J A;  1FEH A;  2INC C;  2WWZ A;  2G35 A;  2MFQ A;  5IO9 A;  4A5K A;  1H10 A;  3QA8 A;  5D3V A;  2BYV E;  3VIA A;  2PLP A;  3AE7 B;  1WGD A;  3RNB C;  2JQR B;  3T3N A;  4XE0 A;  3VUX A;  1K8R B;  4JIO U;  1KZG A;  1NI3 A;  3D8E A;  1NYQ A;  2KVR A;  3AEE B;  4WWP A;  3U30 A;  2D2Q A;  1R7S A;  1XO3 A;  2RRF A;  2Y5C A;  2R0D A;  4NJ6 A;  2Z8L A;  1TKG A;  4P7I A;  2KMM A;  3SDL C;  2QIL A;  3N9Y C;  1VLB A;  2Z0D B;  2D10 A;  1TJ6 A;  2KJH B;  3Q8F A;  2LEK A;  4PS7 A;  2N7E A;  5C23 A;  4KKJ A;  4N6E B;  3ZIM A;  3D8F A;  1X05 A;  1UH6 A;  4JX1 C;  1WI0 A;  2KTR A;  4ANU A;  4A6H A;  4NAW A;  2BVC A;  2ZEQ A;  3AE3 B;  1C78 A;  4PK1 A;  2C60 A;  5JVL A;  3VQI A;  1ZDX A;  3AEG B;  2JP2 A;  3BIN A;  2E2X A;  4JKD A;  3N7C A;  5J3T A;  2GB1 A;  4XGA B;  3MC0 B;  2C5L C;  1PFD A;  2MW5 A;  4FUL A;  4WAA A;  3X0W A;  2ZVN A;  3ML4 A;  1I35 A;  1GB1 A;  2SEB D;  4GMX B;  1LXD A;  2COA A;  2BGF A;  1UGJ A;  2KT7 A;  2MRP A;  5LON B;  2NTT A;  4GU2 A;  2JF5 A;  3EC8 A;  4RF1 A;  1XCG A;  2MP2 A;  3H7P A;  4MGY E;  2K9X A;  4MT5 A;  2IGG A;  5J17 A;  1UNR A;  4BVU C;  5D27 A;  3BZD B;  3V61 A;  1R4N I;  2X8X X;  4AJY B;  3A1Q B;  4ZRK A;  2CKH B;  4OVU A;  2DAJ A;  1LW3 A;  3V3X A;  4IWQ A;  3NOB A;  2BT6 A;  3NJT A;  4MH0 E;  3SR6 A;  4RF0 A;  3SD5 A;  2WH5 A;  4LJO B;  3U12 A;  3TJP A;  3QIJ A;  1DYN A;  1LM8 B;  4FJV B;  2KWD A;  2CU1 A;  3DCG A;  2V4I B;  2LAS A;  4BZA A;  2D9X A;  1ZP0 B;  2DIK A;  2NMB A;  2CJO A;  3KLS X;  3NUH B;  2CHW A;  3ZJV A;  4D0N B;  3AH7 A;  4HJK A;  5CLQ B;  3PT2 B;  5BMH A;  4YSX B;  2LVO A;  2DYN A;  2DZI A;  3AUL A;  1QIL A;  2VH1 A;  3SHQ A;  3PRE A;  5H92 C;  3B9J A;  3WA0 A;  1WXQ A;  2JU6 X;  5IA7 A;  4ILH A;  3O65 B;  4NJ7 A;  3RT3 B;  4ANX A;  3QQ8 B;  3HM6 X;  3GYP A;  3DWG C;  5J3Q A;  1WM2 A;  5DIF B;  1WXA A;  3EA6 A;  2MBQ A;  2HD5 B;  4Z2N A;  3AED B;  3Q3M C;  3TUO A;  2ZCB A;  1YOV B;  2Y3A A;  5BMI A;  3VH3 B;  1KBL A;  1N61 A;  2LHD A;  2FJ9 A;  3NRZ A;  3ZXV A;  2NMQ A;  1WIA A;  1R4M I;  4ARI A;  3NVY A;  3APD A;  5L95 C;  2KWC A;  3IVF A;  5EDS A;  1EWY C;  3N1X C;  1TTN A;  1NYR A;  4KGT A;  2KVZ A;  1DDM A;  4YL8 A;  1MI1 A;  4HAV B;  4FHJ A;  4URK A;  1GAQ B;  2JZZ A;  5IP4 D;  1NEN B;  2V3P A;  4DXG A;  1MJD A;  1I4H A;  2J0M A;  4REZ A;  3DOW A;  5EE1 A;  3WYF B;  3RNC C;  4L23 A;  5D6J B;  3UF8 A;  3VDZ A;  3FVC A;  4YTM B;  1WGH A;  5AUK A;  3PV1 A;  4HHV A;  1JWB D;  1M7E A;  1NVI D;  3CMM B;  2CRF A;  3SNH A;  1D5X C;  3U7D A;  2PPH A;  1GNU A;  2FE8 A;  1Y8R C;  3RMK C;  1DGJ A;  2WQY B;  4FLH A;  3FM8 C;  3ECI A;  5GMV A;  1WVH A;  1FCL A;  2K1F A;  3NS1 A;  2BKF A;  1XCQ L;  1KLV A;  1FD6 A;  1EWC A;  3T06 A;  4K81 A;  5GXG B;  1V89 A;  1ET9 A;  2EKI A;  5LXH A;  4EMO A;  1E90 A;  3URY A;  4KHA A;  5C6R A;  2DN6 A;  3IFW B;  1TYG B;  3DBH B;  3LYY A;  2GS0 A;  2EMS A;  3DWM A;  3RPF C;  2JY6 A;  1TXD A;  4EEW A;  3UIP B;  3P63 A;  3KQ4 A;  2IGD A;  3DVN U;  3Q3O C;  3PS6 A;  2AQ3 B;  2ASQ A;  2NBV B;  2PVO D;  3NHE B;  4KVG B;  1WX8 A;  1N62 A;  1E8X A;  2MBB B;  4YT0 B;  1KRH A;  4MSQ B;  4QJ5 B;  2M1M A;  1MVK A;  4XWT A;  2VH2 A;  3R2I A;  1FGY A;  2WX0 A;  1JAL A;  2HJ1 A;  2WU5 B;  2RDB C;  3ZGZ A;  4IW0 A;  4MM3 A;  4J6I A;  5JH5 C;  3DBL I;  2M38 A;  5LNK 1;  1ZKH A;  1NDD A;  2J42 A;  4JKE A;  3NZU A;  3O13 A;  3P42 A;  5J3Y A;  2WXM A;  3F5R A;  2LUL A;  3TMP B;  3GS2 A;  4OZA A;  4Y94 A;  2RSG A;  3AEA B;  4HEA 1;  2PW9 A;  4ZDV A;  1MHX A;  2RGN B;  2OJR A;  3LDZ E;  4IAP A;  4L1B A;  2IPK D;  2WXJ A;  4DIX A;  1U5E A;  4HJG E;  4NZL B;  4FJZ A;  4AJW A;  1LO5 D;  1U27 A;  4K2O A;  4HCN B;  3SFE B;  4NNJ B;  2DEN B;  3HRD D;  3V6C B;  4II2 B;  2P0D A;  2XN9 C;  5C16 A;  1XOD A;  1FXT B;  4IOY X;  2YVC A;  5JZE B;  1C4C A;  3PLU A;  1J0W A;  3OAW A;  4NQK E;  2NPT A;  1V88 A;  3AE5 B;  3R2T A;  2NS5 A;  4K7S A;  3PG7 A;  1E7U A;  3TEW A;  3IAM 1;  3PEG A;  4BBK A;  4JKB A;  1OQN A;  1WJ6 A;  1IBX A;  3AEC B;  2KX0 A;  1P98 A;  2ZJD A;  1MIX A;  2NBU A;  2C7H A;  2QDF A;  1RLF A;  1L0V B;  1UWM A;  2C7M B;  2IYD B;  2N0Y A;  1XEE A;  3AEB B;  3L13 A;  1D3Z A;  3OWE B;  3A33 B;  3QHT A;  2REX A;  2X38 A;  3V6E B;  3BYT B;  1WE7 A;  3PTF C;  3SU8 X;  2KQ7 A;  2I5F A;  3AE6 B;  2BCJ A;  4BKG A;  4S0R A;  2YS1 A;  2W2W A;  2AQ1 B;  3A4R A;  1KF6 B;  3RUI B;  1FNU A;  2J52 A;  3ZUN A;  4II3 B;  1HZ5 A;  4O1N A;  3V62 A;  3ZLZ A;  1A5R A;  1EM7 A;  2L32 A;  4ANV A;  1LQB A;  5LXI B;  2LGI A;  4KV2 A;  4MK0 A;  4US9 A;  1W1H A;  1FFU A;  4GOU A;  1PLS A;  2LVQ A;  4IM2 A;  5JHA A;  4IFS A;  1F9J A;  3SYX A;  3TEY A;  4LJP B;  3RCP A;  3RN9 C;  2QJL A;  2QKL A;  2LHE A;  4HAT B;  5BMG A;  1WRI A;  3AEF B;  3DQV A;  3ZTC A;  3N30 A;  4KGS A;  2RPV A;  3PPA A;  1VCB A;  3E9S A;  2P0F A;  2JZP A;  4JKF A;  2CQU A;  1V86 A;  4GSW A;  4TUU A;  2D3B A;  4M01 A;  1V81 A;  3I9V 1;  1J7A A;  1RYJ A;  1NU2 A;  2ACZ B;  1B55 A;  2KD0 A;  2J7Q B;  4F1S A;  5DPT A;  1OFF A;  2KCJ A;  1KJT A;  1EVH A;  4F8C B;  1WJN A;  1XLQ A;  3B77 A;  2O6V D;  2V3N A;  3O96 A;  2Z59 A;  5D2M B;  2D5G A;  1UD7 A;  1I7A A;  2M4N A;  4BKS D;  2NCN A;  3FAH A;  3DXC A;  2WLB A;  3QX1 A;  1G6J A;  4G11 A;  1V1P B;  3KY9 A;  1JWA D;  4GDK A;  1X1G A;  1YQ3 B;  2GJY A;  2NZ8 B;  1L6U A;  2D9V A;  2Z4D A;  2GBR A;  1XQQ A;  3H1U A;  2DYM A;  4IWP A;  1J7C A;  1I4X A;  2KR0 A;  4K7U A;  4TSS A;  4HLE A;  1VJK A;  4HB4 B;  1U5F A;  2N9L A;  4K3C A;  4HB2 B;  1GOZ A;  3NG0 A;  3DXD A;  4W9E A;  1EUV B;  2NVU I;  2KIG A;  1FGZ A;  1BUI C;  1SJH D;  5HKH A;  3CIK A;  2KTR B;  2LVP A;  2WS3 B;  1WGR A;  2QHO A;  3R7R A;  4NAW B;  2D3A A;  2CJN A;  4WAF A;  2K49 A;  3P4Q B;  3DBH I;  4RM8 A;  1U5D A;  1D6E C;  5LOP B;  4GDL A;  1KH0 A;  2G45 B;  5FI1 A;  5C5B A;  4GIV A;  3VTW A;  1JRO A;  3F0W A;  3AB5 A;  2KQ4 X;  2M17 A;  5H8Y E;  4WJ7 A;  2Z0E B;  4DDI D;  2L52 A;  1KC7 A;  2KN4 A;  4BBN F;  1Q10 A;  3MPX A;  1RRB A;  3PZ8 A;  1SB3 C;  4LNI A;  2O2V B;  1JRP A;  4K1R B;  4RCO A;  4PT5 A;  3N3K B;  2GCL A;  3LB8 C;  2L0F A;  2ELA A;  2MP2 B;  4ACF A;  4TV3 A;  2R2Q A;  2D9Y A;  3H7P B;  1YN4 A;  1ACA A;  3Q3F A;  3RYT A;  4EOY A;  1AYF A;  2BB6 A;  2GCJ A;  3ZDM C;  3TFM A;  1ZVR A;  2DBY A;  4KX6 B;  1VZ6 A;  1UPQ A;  1FXA A;  4XC2 A;  3QC8 B;  4USA A;  1C4P A;  3DHG C;  2KFK B;  3L0W B;  2L0T A;  4A3O A;  4RGN A;  4KZC A;  1V5U A;  1Q67 A;  4KKI A;  2KJR A;  2GBM A;  1PQS A;  1ZYI A;  2FCS A;  3BJI A;  2ADZ A;  3ODO A;  2KDB A;  3EGR A;  1E9M A;  5C2T B;  1Y19 B;  5C1Z A;  1S3S G;  4B0E A;  2KKC A;  2LRW A;  2JVC A;  1L5P A;  2A4Z A;  4OSN A;  4DQO C;  4FJY A;  4WQO B;  2KC1 A;  2KWV B;  4W9F A;  2DZJ A;  2YT2 A;  1YMH E;  1WWT A;  2H89 B;  1QQG A;  5JXV A;  2QC8 A;  4G50 A;  3WAO A;  2BS3 B;  3AM9 A;  3DBS A;  2Y5P A;  1BT0 A;  2LXC A;  5G5H A;  4L6E A;  4IDI A;  1GGO A;  4HKQ A;  3SV1 A;  4C7Z A;  1Z5S B;  3QCA A;  5E6O A;  2GI9 A;  4K2P A;  4DBB A;  4PS3 A;  4A90 A;  1WH3 A;  3ABV B;  3PHW B;  1ZPS A;  2LGY A;  2ROV A;  5FR6 A;  1BTK A;  3B1L X;  4D2K A;  1L2N A;  1FO4 A;  1C3T A;  4W9J A;  3VOQ A;  2PKO A;  3IG3 A;  4EZK A;  1WJU A;  2W55 A;  1C77 A;  4C4V A;  1T0R C;  3Q8A A;  2L7R A;  4JKA A;  4KSL C;  2EMT A;  1WGQ A;  1U4A A;  2D9Z A;  1ACC A;  2WU2 B;  4MH8 A;  4E71 A;  3VR9 B;  4HAW B;  2KFJ A;  1P6S A;  3AI5 A;  4LK0 M;  2L83 A;  2OTX A;  1WG7 A;  2OJW A;  1UNQ A;  1XR0 B;  3AJ4 A;  3B2G A;  2HE7 A;  1N3H A;  3DDC B;  1OY2 A;  1CZP A;  2GMI C;  4GB9 A;  3TCA A;  3EUB 2;  3ULB A;  3WAN A;  3UQA A;  2YT1 A;  1M4V A;  4OVV A;  5JHG A;  2J4X A;  5IAA C;  4EUT A;  4ILG B;  2Z14 A;  2K6D B;  1ZW7 A;  3OLM D;  1FHW A;  2Z13 A;  2QSD A;  2YEP F;  3W2D A;  4MJS B;  3KYC D;  4JQW C;  5DI9 B;  4CHM A;  1UGM A;  3KW5 B;  2LUM A;  2DWQ A;  2EKE C;  2C7N B;  3TVV A;  3KSY A;  2KHW B;  1YQ4 B;  1MG4 A;  1EF1 A;  1VBH A;  2BS4 B;  4M00 A;  1C79 A;  1SE3 A;  4KHB B;  3CSF A;  1QLB B;  5CHW A;  3R8B A;  1E8Z A;  3HM3 A;  3TL5 A;  3RZW C;  5HE1 A;  2WXQ A;  2AEH A;  3SO6 A;  1V6E A;  5EE3 A;  2Z0P A;  3ENB A;  5D3Y A;  4B95 A;  2Y8G A;  4R3D A;  2RPQ A;  5M4Y B;  1D5Z C;  3M95 A;  3MC9 A;  2Y7B A;  1PGX A;  2IZV B;  2JPH A;  5JHB A;  4HXD A;  2WXK A;  2V9H A;  4KSK C;  2R2O A;  3Q69 A;  2V3S A;  2KUP A;  3NWD A;  3FIL A;  1AW7 A;  3ZRF A;  1H4R A;  1QZE A;  4MM3 B;  4W9K A;  2KK8 A;  1ZC3 B;  2Y5B B;  1QOG A;  1WR1 A;  1Y56 A;  2D3G A;  4JLC A;  1OGW A;  3L10 B;  3VTV A;  2PIA A;  4AQ7 A;  2M0A A;  4CHK A;  1TQZ A;  4AP4 C;  2L1C A;  2JSV X;  4MT7 A;  2RMM A;  4LNN A;  1U2B A;  1J19 A;  2K2U A;  1BML C;  1TZ1 A;  3DHI C;  3PSC A;  5L81 A;  3ZNI D;  2K3U A;  3KRX A;  2M56 B;  1WZ0 A;  1E10 A;  5T8I A;  3PO0 A;  2GBJ A;  4MGZ E;  4M0W A;  2ROZ B;  1IPG A;  2NPT B;  3HIZ A;  1HEZ E;  5EE9 A;  1MPE A;  2AQ2 B;  3KUC B;  4XYC A;  2W2X D;  1T3Q A;  4LNO A;  2LOZ A;  3U52 E;  2FNJ B;  2QEJ C;  3R66 C;  4JKH A;  1IBX B;  1K52 A;  3WAL A;  3CST A;  1XCT L;  1FB8 A;  2NR2 A;  4WUR A;  1BWN A;  4A6F B;  3MC8 A;  1KZ7 A;  1I2H A;  2CY5 A;  2DX5 A;  4NQL B;  3GYO A;  1TJE A;  4DXF A;  1E6E B;  2L76 A;  2JWZ A;  4W9I A;  2WDV B;  1JW9 D;  1L4D B;  4IKG A;  3EHV A;  1AQC A;  2LKO A;  2K00 A;  1WXM A;  5D3X A;  3A4S C;  4W9C A;  2W54 A;  3BYY B;  2W82 A;  3PRP B;  3TSS A;  2IY0 B;  1SSN A;  5KCV A;  4HSI A;  1RAX A;  1N60 A;  5I2M A;  4K17 A;  5G55 A;  1PDX A;  1YN3 A;  2RNR B;  4WJN A;  1IUE A;  2ZNV B;  3VVW B;  3E9O A;  2K22 A;  2KMA A;  2CB8 A;  3K9P B;  1PYW D;  4ANW A;  4HAY B;  3Q8B A;  1DOX A;  4WVF B;  4YTN B;  1V1O A;  3U7Z A;  5JP4 A;  2MA9 B;  3ZNH B;  4CQN A;  1TT5 B;  1F77 A;  4B6W A;  2JZ3 B;  2MSE D;  4HAZ B;  2JX5 A;  4KGR A;  5HHD G;  2RDH A;  2D07 B;  3WCQ A;  2RLO A;  2KLG A;  3GOE A;  3W1S C;  2WXO A;  3DHH C;  2LUE A;  3A1Q A;  4ZOH C;  3PRZ A;  1JML A;  1JQ4 A;  4IM0 A;  1UUP A;  1K5G B;  2N1V A;  4LDT B;  1P5T A;  1ROE A;  2KN5 A;  2M8S A;  2ZVO A;  3HVZ A;  1C1Y B;  3QAQ A;  1ZUD 2;  3AMZ A;  2BTE A;  4GN1 A;  3Q2A C;  4DHJ D;  3MHZ A;  3P4P B;  1ZC4 B;  3T8M A;  1GG3 A;  3ZXR A;  4JE3 B;  4QAY A;  5FK9 C;  1F52 A;  3BII D;  1WGU A;  3PHX B;  2PMV A;  1T0S C;  2OED A;  4GDK B;  3GZN B;  4A55 A;  3ETR A;  1AN8 A;  1GC6 A;  2LBB A;  4L1R A;  4C80 A;  2X0S A;  2JYE A;  2JT4 B;  1P7E A;  3ZVR A;  3ML8 A;  4AUQ C;  1YX5 B;  1E5W A;  2MCN B;  1SJE D;  3B08 A;  5KHO A;  4A6Q A;  2L3Z A;  4M02 A;  4M8N A;  2MKR A;  2FID A;  1ET6 A;  4IOI E;  2Q5W D;  3GB1 A;  2ZW1 A;  3K9O B;  4FHK A;  1NI2 A;  3PZ7 A;  2WNM A;  3MTN B;  4DHZ E;  5C79 A;  2E6X A;  2KMC A;  3H8H A;  3KUD B;  3EEC A;  4ZHO A;  1HA5 A;  1MFW A;  4HCP B;  3VH4 B;  3X23 A;  4HAX B;  2ELB A;  1L0X B;  3TIX A;  1E8Y A;  1X86 A;  1WXV A;  3V5W A;  1Z2M A;  2LJ5 A;  1FCC C;  4G0N B;  2L1A A;  2ZPY A;  4J3O D;  1XLP A;  4GZU A;  1WMH B;  3ZJU A;  3BK2 A;  3MJW A;  1L6V A;  2V4L A;  3P4S B;  3ZDT A;  3QBV B;  1SE4 A;  2KGX B;  2WXF A;  5L83 A;  5AZH A;  1KFY B;  2KXJ A;  2N9K A;  4LNF A;  1CK1 A;  2OQB A;  2WDR B;  4MGI E;  5HFY A;  4W9D A;  2GBK A;  2R2Y A;  3JSV A;  2DHI A;  4P1C C;  1XXG A;  1WFY A;  2BWF A;  3I5J C;  1UWX A;  2M19 A;  4ICU A;  1DOY A;  1KLU D;  3GE8 C;  2H7D A;  1XD3 B;  3H9D A;  1GB4 A;  3ZQ4 A;  3A9J A;  5LG4 B;  5G5G A;  2JYT A;  1RJ2 A;  2KTF A;  4F7U P;  3A9K A;  2YS3 A;  2WHI A;  1IYF A;  4JGH B;  4KIK B;  1XKE A;  4DK5 A;  3IBE A;  4DHJ B;  4HVB A;  1YJJ A;  4KDI C;  1HTQ A;  2PTL A;  4CHJ A;  5DHF B;  4XWW A;  2KWU B;  4HDO A;  1FFV A;  4I6L B;  2BKR B;  2KQS A;  3ZKJ C;  3FSS A;  3NZS A;  3W1S A;  3SBT A;  1ZE3 D;  2RSU A;  3TO1 A;  4TYZ A;  1XX0 A;  1V80 A;  1WF9 A;  1NTY A;  3KYD D;  2COC A;  3ZO5 B;  2PVG C;  2BF8 B;  2XK5 A;  3Q8C A;  4RFB A;  1L4Z B;  4G3X B;  4PS8 A;  2K8E A;  3MFG A;  4ZRI A;  4OW0 A;  3BWU D;  3KVF B;  5CLL B;  2L00 B;  4DXA B;  1WX7 A;  2XBB C;  3EFC A;  5D3D A;  4FAD A;  3ZRC A;  4BBN C;  2QMT A;  4EKU A;  2FBW B;  2IND C;  4GLS C;  1MG8 A;  3P6A A;  4RGO S;  1TGZ B;  1MIZ B;  1WYG A;  1FRD A;  1WM3 A;  3MHS D;  1X1M A;  3L08 A;  3E66 A;  4RNA A;  2VRW B;  2BPS A;  1ST7 A;  4BAX A;  1CJE A;  5I2S A;  4H2A A;  2KO3 A;  2DTC A;  4X57 B;  3M62 B;  3IT4 B;  5HG2 A;  1R4N B;  2VKI A;  2L05 A;  3HSA A;  3LJU X;  2G4S A;  2DLW A;  4F7G A;  1XF5 L;  4KDL B;  1BAK A;  2VZK D;  2NTS A;  2I1J A;  3KH0 A;  2FDQ A;  4JKG A;  4JWS C;  1YX6 B;  3Q3J A;  4QJ4 B;  4FBJ B;  4A3P A;  1WXS A;  2D3C A;  2JUO A;  3AU4 A;  5BO4 B;  1OMW A;  2YSZ A;  1FNV A;  1SEB D;  2WX1 A;  2CY4 A;  2FCQ A;  3U4E G;  4EE2 A;  1L0Y B;  1SGH A;  4PYU A;  5C3J B;  5IOI A;  2PZ1 A;  5TR5 A;  2MJ3 A;  2K39 A;  3RZF A;  3VR8 B;  4QXA B;  4YTP B;  4P16 A;  1HE8 A;  1AWE A;  2IGH A;  4YWG G;  2PJH A;  3HIE A;  1U29 A;  1WR6 E;  2LYD A;  1E7V A;  3HW2 B;  3SUZ A;  1UNP A;  3V05 A;  4AS1 A;  1PGA A;  3AXC A;  2N23 A;  3C0R B;  2K5P A;  1OTR B;  4CO7 A;  1KLG D;  1UEL A;  5JHH A;  1B1Z A;  2LJI A;  1V5T A;  2JXT A;  4MEL A;  1OQY A;  2KC2 A;  1OQR A;  3FKY A;  3VRB B;  2QKM A;  2WDT B;  1S1Q B;  4WWN A;  3UIO B;  1Z87 A;  1MK7 B;  2KYW A;  1VD2 A;  1EO6 A;  2MBO A;  5AUI A;  4PQ0 A;  2DYB A;  1CQV A;  1P9D U;  4S17 A;  3NVZ A;  2DZM A;  2J59 M;  1UBQ A;  2FIF A;  3E9L A;  4US8 A;  3B2F A;  1R4M B;  2HDE A;  2MEK A;  4EZJ A;  1X1F A;  2IO2 B;  3CIR B;  4NJC A;  4BFR A;  3KZ1 A;  3FLV A;  1F2R I;  4JL9 A;  1C9F A;  4A6K A;  4KAX B;  2GBN A;  3U8Z A;  2MLB A;  4WSF A;  3RFZ B;  1W1G A;  1KM7 A;  2G9H D;  4LNK A;  1HTO A;  4ITK A;  4HB3 B;  1ENF A;  5TSS A;  4IG7 B;  1FMA D;  1DBH A;  2LZ6 A;  2I2Y A;  3QK0 A;  1F0Z A;  1FNW A;  2CAY A;  1MI0 A;  2W3R A;  2K8B A;  4CYE A;  4MSM B;  3D32 A;  5IJM A;  2RDG A;  4PNK A;  1I4R A;  4C7Y A;  1EU4 A;  3EFU A;  4MAC A;  3SFD B;  2DLB A;  1UNS A;  3I63 C;  3FEH A;  2MH7 A;  2ZPN A;  3KUZ A;  4LTU A;  3VUW A;  4AWJ A;  1V5P A;  2GUM A;  2VZK B;  1JCK B;  2KZR A;  3JVZ X;  4K3B A;  1I42 A;  2N9P C;  4M0W B;  2KLC A;  1TS5 A;  2AYO B;  4YON A;  3AE4 B;  3CWI A;  3BVG A;  2J0K A;  4WH4 A;  3GE3 C;  1N5X A;  1V1P A;  5KHQ A;  1K53 A;  2GOW A;  2E3T A;  4GPT B;  1N63 A;  1ISN A;  2G3Q B;  2WXG A;  2UYZ B;  3E56 A;  4YSZ B;  5AEK B;  3ZNG C;  1WGY A;  2DHK A;  2L8J A;  3EPY A;  2ON8 A;  1WGK A;  2N9E B;  2MBH A;  3R3M A;  5I4D A;  1FM0 D;  2DX5 B;  5BYS A;  5E6N A;  1GC7 A;  4C56 C;  5FI0 A;  4HPP A;  3I3T B;  2LMC A;  2W9N A;  5IRS A;  2DHZ A;  1ZXI A;  2LGS A;  1MAI A;  1NTV A; 
#chains in the Genus database with same CATH homology
 3ZW3 A;  1T0Y A;  3RD2 A;  3ML9 A;  2DFK A;  2IFS A;  2YS5 A;  4ZRJ A;  3P7Z A;  3B0A A;  2KX3 A;  2KAN A;  1BTN A;  5AZG A;  3UZT A;  1HBK A;  4IWO A;  3OAN A;  5EFX A;  1VBG A;  2IBI B;  4WJO A;  3S2A A;  3QWZ B;  2O2V A;  4HK2 A;  2DYQ A;  2Q13 A;  1YQB A;  3APC A;  2Z0O A;  3LJ3 A;  3A98 B;  2XEW A;  2IYB A;  3CXB B;  2LGD A;  3WAP A;  3DVN V;  2K25 A;  2KFK A;  3DPD A;  1EAZ A;  5CHV C;  4KZ0 A;  1RRP B;  1HB8 A;  3PLV A;  2N4F A;  3NS8 A;  1EF5 A;  1FAO A;  2N9X A;  3D8D A;  4ICV A;  3W1Y A;  1GUA B;  2O6V A;  2AL3 A;  2YLM A;  2D11 A;  1PMS A;  2DAF A;  1WJ4 A;  2VRR B;  3DVG Y;  4BKS A;  2WYQ A;  4LDT D;  1Q5W B;  3ODX A;  4XX5 A;  4WWO A;  4K7W A;  3JW0 X;  2MX2 A;  1M94 A;  3VFK A;  1WE6 A;  2HTH A;  3UQB A;  3IHP C;  2R09 A;  1XT9 B;  4TQ0 A;  1WI1 A;  2JRI B;  2KOX A;  4HDQ A;  1Q1O A;  2C9W B;  3PVL A;  2CS4 A;  2DHJ A;  1WRD B;  4DHZ B;  3ODW A;  4EZL A;  1UPR A;  3VUY A;  5D94 A;  1DDV A;  4IC7 B;  1H8C A;  1RFA A;  4MEM A;  2LGX A;  3ZVV A;  4WJQ A;  2M14 A;  4GGQ A;  5G2N A;  3QAR A;  1V49 A;  2JXX A;  3CF6 E;  3A8Q A;  4XWX A;  2YRY A;  2HJ8 A;  1KOT A;  2LD9 A;  1KI1 B;  2PE9 A;  4BOZ B;  3JSV B;  5CTR C;  2D9W A;  2FUH B;  1SHC A;  4F7H A;  1V5O A;  4FA6 A;  1CMX B;  2BYE A;  5KQ4 A;  3HK0 A;  2B3A A;  4E74 A;  3UIN B;  3PRM B;  4WJP A;  2MBE A;  3A9J B;  4MJS A;  2PE6 B;  4BKT A;  2UZS A;  3DVG X;  1YJ1 A;  2AL6 A;  3A9K B;  3PGE A;  5GOW B;  2ZNV C;  1IP9 A;  4Z2M B;  2KDI A;  4DX8 A;  1MPH A;  2N7D A;  2I1K A;  4IM3 A;  2Z0Q A;  3ZNZ B;  2AWT A;  1FOE A;  3N32 A;  2ZZP B;  2DA0 A;  3UGB B;  2KJ6 A;  3ULC A;  4W9H A;  3KRW A;  2MWN B;  5AZF A;  3MDB C;  3ALB A;  3FP5 A;  2MQJ A;  2Z59 B;  2XK5 B;  2JRH A;  4BOS C;  2H7E A;  3ZTD A;  2RUK B;  1PFJ A;  4M8M A;  3AU5 A;  1DDW A;  1ZGU B;  2RR9 A;  2CR5 A;  5HE3 A;  3PZD A;  1AAR A;  2FCM A;  4LCD E;  1U5G A;  4NPN A;  1LB1 A;  3RUL A;  1YIW A;  3L54 A;  3HQC A;  2IO3 B;  1WX9 A;  2UVM A;  2W2X C;  4B9K A;  4HAU B;  1K5D B;  4XZ4 A;  4JKG B;  1ZM0 A;  1TBE A;  4GDL B;  2X18 A;  4W9G A;  2A5U A;  2RQ1 A;  5C5B B;  4I6P A;  3NSU A;  3TBL D;  4DWF A;  4AOF A;  4W9L A;  3SBG A;  1V5M A;  4ILJ A;  5CX3 A;  5DHA B;  5DCN A;  2I5C A;  5DH9 B;  2RD0 A;  2CHX A;  2P8V A;  2FJL A;  1OEY A;  3VAW A;  4GXB A;  1E8W A;  1FHO A;  4A6F A;  4GOC A;  2KNB A;  1QC6 A;  3M63 B;  2FAZ A;  2MWS B;  3L16 A;  2COF A;  3WIM A;  3PVW A;  1YD8 U;  3V60 A;  1M7R A;  4NY0 A;  2LG1 A;  2DKQ A;  3VTU A;  4DDG D;  3G9W A;  4JKC A;  2UZR A;  2DZK A;  4H8S A;  2FCN A;  3L17 A;  2IY1 B;  5D3W A;  2COD A;  4A20 A;  5J2R A;  2ZCC A;  1DRO A;  1UBI A;  1EGX A;  1W1D A;  2HRJ A;  4HPM B;  2YT0 A;  1FHX A;  1Y5O A;  2BWE S;  3PVU A;  1UEF A;  4B6H A;  3M1I B;  1DIK A;  1P3Q U;  3OJ4 B;  1UZX B;  2V76 A;  2COP A;  3ENE A;  4HB0 B;  4JK7 A;  1X11 A;  3OJ3 A;  2V1Y A;  5HE0 A;  4TQ1 A;  1NVL A;  4FN2 A;  2ABD A;  2RVB B;  2K6Q A;  1IRS A;  3PSE B;  4I6N B;  5JLJ B;  1WJ1 A;  4JK8 A;  1LFD A;  5LLI A;  1V9J A;  3DBR I;  3A8P A;  3P2B A;  1WJM A;  2PEA A;  1J8C A;  4MDK E;  4MGK E;  1JRU A;  3T9L A;  3PP2 A;  1OEY J;  4RM9 A;  2D4Q A;  2K8H A;  2UWQ A;  4RMA A;  2LRU A;  4MY6 A;  2KDE B;  2RGF A;  4NSW A;  1XD4 A;  2IO1 B;  2MDX A;  4TKN A;  3M3J A;  1WZ3 A;  3ONS A;  5D7G A;  4PYZ A;  4EFO A;  4KHO A;  5DPS A;  4E3C A;  4IUM B;  3DXE A;  2EJ8 A;  2YF0 A;  3VHT C;  2LXA A;  2LI5 A;  4C0A A;  3H6N A;  2BYF A;  3WAM A;  1WMH A;  2DX1 A;  4EJN A;  3GZN I;  2OOB B;  3NY5 A;  3QWM A;  3H7S A;  1SIF A;  2KDF B;  1L7Y A;  1P0R A;  5KQ1 A;  2R82 A;  4HPL B;  2DKP A;  3BY4 B;  2K2J A;  4DX9 0;  1NTI A;  1HB6 A;  4F7Z A;  1JDE A;  4DBG A;  1Q0W B;  1MK9 B;  4JK9 A;  2CHZ A;  3APF A;  5J18 A;  5HE2 A;  2LOX A;  2G4D B;  4HWI B;  2XQN M;  1GJZ A;  2LWP A;  3VXW A;  2NBW B;  3R7Q A;  1WY8 A;  3E9P A;  1SE9 A;  1P3R A;  1WYW B;  4KIK A;  2P0H A;  2IO0 B;  2O6V B;  5DPR A;  1WGG A;  3JYU A;  2EC1 A;  1NBF C;  1V2Y A;  2K8C A;  2VSZ A;  5E6P A;  2N1W A;  3TW1 A;  4ASW C;  2L2I A;  3HHM A;  2Y8F A;  2M0X A;  5CHF A;  2HTH B;  3QJZ A;  3RCZ A;  5DPW A;  1V61 A;  2DYO A;  1J0G A;  1ZSQ A;  1MKE A;  4N9F 4;  1P1A A;  4GMV A;  4ZYN A;  2J0J A;  2WWZ A;  2G35 A;  2MFQ A;  4A5K A;  1H10 A;  3QA8 A;  5D3V A;  2BYV E;  3VIA A;  1WGD A;  3VUX A;  1K8R B;  4JIO U;  1KZG A;  3D8E A;  2KVR A;  4WWP A;  3U30 A;  2D2Q A;  2R0D A;  4NJ6 A;  4P7I A;  3SDL C;  2Z0D B;  2D10 A;  1TJ6 A;  2KJH B;  5C23 A;  4PS7 A;  2N7E A;  3ZIM A;  3D8F A;  1X05 A;  1UH6 A;  1WI0 A;  2KTR A;  4ANU A;  4A6H A;  4NAW A;  2ZEQ A;  2C60 A;  5JVL A;  3VQI A;  2JP2 A;  3BIN A;  2E2X A;  4JKD A;  3N7C A;  5J3T A;  2C5L C;  2MW5 A;  4FUL A;  4WAA A;  3X0W A;  2ZVN A;  3ML4 A;  1I35 A;  4GMX B;  1LXD A;  2COA A;  2BGF A;  2MRP A;  5LON B;  4GU2 A;  2JF5 A;  3EC8 A;  1XCG A;  2MP2 A;  3H7P A;  4MGY E;  5J17 A;  1UNR A;  4BVU C;  5D27 A;  3V61 A;  1R4N I;  4AJY B;  3A1Q B;  4ZRK A;  2CKH B;  4OVU A;  2DAJ A;  1LW3 A;  4IWQ A;  3NOB A;  4MH0 E;  3SD5 A;  2WH5 A;  4LJO B;  3TJP A;  3QIJ A;  1DYN A;  1LM8 B;  4FJV B;  2CU1 A;  3DCG A;  2LAS A;  2D9X A;  2DIK A;  2NMB A;  2CHW A;  4D0N B;  4HJK A;  5CLQ B;  3PT2 B;  2LVO A;  2DYN A;  2DZI A;  3AUL A;  3SHQ A;  3PRE A;  3WA0 A;  5IA7 A;  4ILH A;  3O65 B;  4NJ7 A;  3RT3 B;  4ANX A;  3QQ8 B;  3HM6 X;  3GYP A;  5J3Q A;  1WM2 A;  5DIF B;  1WXA A;  2MBQ A;  2HD5 B;  4Z2N A;  2ZCB A;  3VH3 B;  1KBL A;  2FJ9 A;  1WIA A;  1R4M I;  3APD A;  5L95 C;  2KWC A;  3IVF A;  5EDS A;  1TTN A;  1DDM A;  4YL8 A;  4HAV B;  4FHJ A;  4URK A;  2JZZ A;  2J0M A;  3DOW A;  3WYF B;  5D6J B;  3UF8 A;  3VDZ A;  1WGH A;  3PV1 A;  4HHV A;  1M7E A;  3CMM B;  2CRF A;  3SNH A;  3U7D A;  2PPH A;  1GNU A;  1Y8R C;  4FLH A;  3FM8 C;  3ECI A;  5GMV A;  1WVH A;  2K1F A;  2BKF A;  1KLV A;  3T06 A;  4K81 A;  1V89 A;  5LXH A;  4EMO A;  1E90 A;  4KHA A;  5C6R A;  2DN6 A;  3IFW B;  2GS0 A;  2EMS A;  2JY6 A;  1TXD A;  4EEW A;  3UIP B;  3DVN U;  3PS6 A;  2ASQ A;  2NBV B;  3NHE B;  4KVG B;  1WX8 A;  2MBB B;  1E8X A;  4MSQ B;  2M1M A;  1FGY A;  2WX0 A;  4IW0 A;  4MM3 A;  4J6I A;  5JH5 C;  3DBL I;  2M38 A;  1ZKH A;  1NDD A;  4JKE A;  3NZU A;  5J3Y A;  3F5R A;  2LUL A;  3TMP B;  4Y94 A;  2RSG A;  4ZDV A;  2RGN B;  2OJR A;  3LDZ E;  4IAP A;  1U5E A;  4FJZ A;  4AJW A;  1U27 A;  4K2O A;  4HCN B;  4NNJ B;  2DEN B;  3V6C B;  4II2 B;  2P0D A;  5C16 A;  1XOD A;  1FXT B;  4IOY X;  2YVC A;  5JZE B;  3PLU A;  1J0W A;  3OAW A;  4NQK E;  2NPT A;  1V88 A;  2NS5 A;  4K7S A;  3PG7 A;  1E7U A;  3PEG A;  4BBK A;  4JKB A;  1OQN A;  1WJ6 A;  2KX0 A;  2ZJD A;  1P98 A;  2NBU A;  1MIX A;  2C7H A;  1RLF A;  2C7M B;  2IYD B;  2N0Y A;  3L13 A;  1D3Z A;  3A33 B;  3QHT A;  2REX A;  3V6E B;  1WE7 A;  3PTF C;  3SU8 X;  2KQ7 A;  2I5F A;  2BCJ A;  4BKG A;  2YS1 A;  2W2W A;  3A4R A;  3RUI B;  3ZUN A;  4II3 B;  3V62 A;  3ZLZ A;  1A5R A;  4ANV A;  1LQB A;  5LXI B;  4KV2 A;  4MK0 A;  1W1H A;  1PLS A;  2LVQ A;  4IM2 A;  5JHA A;  4IFS A;  1F9J A;  3SYX A;  4LJP B;  3RCP A;  2QKL A;  4HAT B;  3DQV A;  3ZTC A;  3N30 A;  3PPA A;  1VCB A;  2P0F A;  4JKF A;  2CQU A;  1V86 A;  4GSW A;  4TUU A;  1V81 A;  1NU2 A;  1B55 A;  2KD0 A;  2J7Q B;  4F1S A;  5DPT A;  2KCJ A;  1KJT A;  1EVH A;  4F8C B;  1WJN A;  2O6V D;  3O96 A;  5D2M B;  1UD7 A;  1I7A A;  2M4N A;  4BKS D;  2NCN A;  3DXC A;  3QX1 A;  1G6J A;  4G11 A;  3KY9 A;  4GDK A;  1X1G A;  2GJY A;  2NZ8 B;  2D9V A;  2GBR A;  1XQQ A;  3H1U A;  2DYM A;  4IWP A;  4K7U A;  4HLE A;  4HB4 B;  1U5F A;  4HB2 B;  3DXD A;  4W9E A;  1EUV B;  2NVU I;  1FGZ A;  5HKH A;  3CIK A;  2KTR B;  2LVP A;  3R7R A;  1WGR A;  2QHO A;  4NAW B;  3DBH I;  4RM8 A;  1U5D A;  5LOP B;  4GDL A;  2G45 B;  5FI1 A;  5C5B A;  4GIV A;  3VTW A;  3F0W A;  2M17 A;  4WJ7 A;  2Z0E B;  4DDI D;  1KC7 A;  4BBN F;  3MPX A;  1RRB A;  2O2V B;  4K1R B;  3N3K B;  2GCL A;  2L0F A;  2ELA A;  2MP2 B;  4TV3 A;  2R2Q A;  2D9Y A;  3H7P B;  3Q3F A;  1ACA A;  3RYT A;  4EOY A;  2GCJ A;  3ZDM C;  3TFM A;  1ZVR A;  1UPQ A;  4XC2 A;  3QC8 B;  2KFK B;  3L0W B;  2L0T A;  4A3O A;  4KZC A;  1V5U A;  1Q67 A;  2KJR A;  2GBM A;  1PQS A;  2FCS A;  3BJI A;  2ADZ A;  3ODO A;  2KDB A;  1Y19 B;  5C1Z A;  1S3S G;  2KKC A;  2LRW A;  2JVC A;  2A4Z A;  4FJY A;  4WQO B;  2KC1 A;  2KWV B;  4W9F A;  2DZJ A;  1QQG A;  4G50 A;  3WAO A;  3DBS A;  1BT0 A;  2LXC A;  4L6E A;  1GGO A;  3SV1 A;  1Z5S B;  3QCA A;  5E6O A;  4K2P A;  4DBB A;  4PS3 A;  1WH3 A;  3PHW B;  2LGY A;  2ROV A;  5FR6 A;  1BTK A;  3B1L X;  1L2N A;  1C3T A;  4W9J A;  3VOQ A;  3IG3 A;  4EZK A;  1WJU A;  2L7R A;  4JKA A;  4KSL C;  2EMT A;  1WGQ A;  1U4A A;  2D9Z A;  4E71 A;  4HAW B;  2KFJ A;  1P6S A;  3AI5 A;  2OTX A;  1WG7 A;  1UNQ A;  1XR0 B;  3AJ4 A;  2HE7 A;  1N3H A;  3DDC B;  1OY2 A;  2GMI C;  4GB9 A;  3TCA A;  3ULB A;  3WAN A;  3UQA A;  2YT1 A;  4OVV A;  5JHG A;  5IAA C;  4EUT A;  4ILG B;  2K6D B;  1ZW7 A;  3OLM D;  1FHW A;  4MJS B;  3KYC D;  4JQW C;  5DI9 B;  4CHM A;  1UGM A;  3KW5 B;  2EKE C;  2C7N B;  3TVV A;  3KSY A;  2KHW B;  1EF1 A;  1VBH A;  4KHB B;  3CSF A;  5CHW A;  1E8Z A;  3TL5 A;  3HM3 A;  3RZW C;  5HE1 A;  2AEH A;  3SO6 A;  1V6E A;  2Z0P A;  3ENB A;  5D3Y A;  4B95 A;  2Y8G A;  2RPQ A;  3M95 A;  2Y7B A;  2IZV B;  2JPH A;  5JHB A;  4HXD A;  4KSK C;  2R2O A;  2V3S A;  2KUP A;  3ZRF A;  1H4R A;  1QZE A;  4W9K A;  2KK8 A;  1ZC3 B;  2Y5B B;  1WR1 A;  2D3G A;  4JLC A;  1OGW A;  3L10 B;  3VTV A;  4CHK A;  1TQZ A;  4AP4 C;  2L1C A;  4MT7 A;  1U2B A;  1J19 A;  2K2U A;  1TZ1 A;  3PSC A;  5L81 A;  3ZNI D;  3KRX A;  1WZ0 A;  2GBJ A;  4MGZ E;  2ROZ B;  1IPG A;  2NPT B;  3HIZ A;  3KUC B;  2W2X D;  2LOZ A;  2FNJ B;  3R66 C;  4JKH A;  3WAL A;  3CST A;  1FB8 A;  2NR2 A;  1BWN A;  4A6F B;  1KZ7 A;  1I2H A;  2CY5 A;  2DX5 A;  4NQL B;  3GYO A;  2L76 A;  2JWZ A;  4W9I A;  3EHV A;  1AQC A;  2LKO A;  2K00 A;  1WXM A;  5D3X A;  3A4S C;  4W9C A;  3PRP B;  2IY0 B;  5KCV A;  1RAX A;  4K17 A;  5G55 A;  2RNR B;  4WJN A;  2ZNV B;  3VVW B;  3E9O A;  2KMA A;  2CB8 A;  3K9P B;  4ANW A;  4HAY B;  4WVF B;  5JP4 A;  2MA9 B;  3ZNH B;  4B6W A;  2JZ3 B;  2MSE D;  4HAZ B;  2D07 B;  2RLO A;  2KLG A;  3GOE A;  3W1S C;  2LUE A;  3A1Q A;  3PRZ A;  4IM0 A;  1K5G B;  2N1V A;  4LDT B;  1P5T A;  2KN5 A;  2M8S A;  2ZVO A;  1C1Y B;  3QAQ A;  4GN1 A;  4DHJ D;  1ZC4 B;  3T8M A;  1GG3 A;  1WGU A;  3PHX B;  4GDK B;  1GC6 A;  2LBB A;  2X0S A;  2JT4 B;  3ZVR A;  3ML8 A;  4AUQ C;  1YX5 B;  1E5W A;  2MCN B;  3B08 A;  5KHO A;  2L3Z A;  4M8N A;  2MKR A;  2FID A;  3K9O B;  4FHK A;  1NI2 A;  3MTN B;  4DHZ E;  5C79 A;  2KMC A;  3KUD B;  3EEC A;  4HCP B;  3VH4 B;  3X23 A;  4HAX B;  2ELB A;  3TIX A;  1E8Y A;  1X86 A;  1WXV A;  3V5W A;  1Z2M A;  2LJ5 A;  4G0N B;  2ZPY A;  4GZU A;  1WMH B;  3MJW A;  2V4L A;  3ZDT A;  3QBV B;  2KGX B;  5L83 A;  5AZH A;  2KXJ A;  2OQB A;  4MGI E;  4W9D A;  2GBK A;  3JSV A;  2DHI A;  1WFY A;  2BWF A;  4ICU A;  3H9D A;  2H7D A;  1XD3 B;  3A9J A;  1RJ2 A;  2KTF A;  4F7U P;  3A9K A;  2YS3 A;  1IYF A;  4JGH B;  4KIK B;  1XKE A;  4DK5 A;  3IBE A;  4DHJ B;  4HVB A;  4KDI C;  4CHJ A;  5DHF B;  2KWU B;  4HDO A;  4I6L B;  2BKR B;  2KQS A;  3ZKJ C;  3FSS A;  3NZS A;  3W1S A;  3SBT A;  2RSU A;  3TO1 A;  4TYZ A;  1XX0 A;  1V80 A;  1WF9 A;  1NTY A;  3KYD D;  2COC A;  3ZO5 B;  2BF8 B;  2XK5 A;  4G3X B;  4PS8 A;  4ZRI A;  3KVF B;  5CLL B;  2L00 B;  4DXA B;  1WX7 A;  2XBB C;  4FAD A;  3ZRC A;  4BBN C;  4EKU A;  1MG8 A;  3P6A A;  1TGZ B;  1MIZ B;  1WM3 A;  3MHS D;  1X1M A;  3L08 A;  3E66 A;  2VRW B;  2BPS A;  1ST7 A;  2DTC A;  2KO3 A;  4X57 B;  3M62 B;  2VKI A;  2L05 A;  3LJU X;  2G4S A;  2DLW A;  4F7G A;  4KDL B;  1BAK A;  2I1J A;  3KH0 A;  2FDQ A;  4JKG A;  1YX6 B;  3Q3J A;  4FBJ B;  4A3P A;  1WXS A;  2JUO A;  3AU4 A;  5BO4 B;  1OMW A;  2YSZ A;  2WX1 A;  2CY4 A;  2FCQ A;  1SGH A;  4PYU A;  2PZ1 A;  5TR5 A;  2K39 A;  3RZF A;  1HE8 A;  1AWE A;  2PJH A;  1U29 A;  1WR6 E;  2LYD A;  1E7V A;  3HW2 B;  3SUZ A;  1UNP A;  3AXC A;  2N23 A;  3C0R B;  1OTR B;  4CO7 A;  1UEL A;  5JHH A;  1V5T A;  4MEL A;  1OQY A;  2KC2 A;  2QKM A;  2WDT B;  1S1Q B;  4WWN A;  3UIO B;  1Z87 A;  1MK7 B;  1VD2 A;  1EO6 A;  2MBO A;  4PQ0 A;  2DYB A;  1P9D U;  2DZM A;  2J59 M;  1UBQ A;  2FIF A;  3E9L A;  4EZJ A;  1X1F A;  2IO2 B;  4BFR A;  3KZ1 A;  3FLV A;  4JL9 A;  4A6K A;  4KAX B;  2GBN A;  3U8Z A;  2MLB A;  4WSF A;  1W1G A;  1KM7 A;  4HB3 B;  4IG7 B;  1DBH A;  2LZ6 A;  3QK0 A;  2CAY A;  2K8B A;  4CYE A;  4MSM B;  3D32 A;  5IJM A;  4PNK A;  3EFU A;  3FEH A;  3KUZ A;  2ZPN A;  3VUW A;  4AWJ A;  1V5P A;  2KZR A;  3JVZ X;  1I42 A;  2N9P C;  4M0W B;  2KLC A;  2AYO B;  4YON A;  2J0K A;  5KHQ A;  2GOW A;  4GPT B;  1ISN A;  2G3Q B;  2UYZ B;  5AEK B;  3ZNG C;  1WGY A;  2DHK A;  2L8J A;  3EPY A;  2N9E B;  2MBH A;  3R3M A;  2DX5 B;  5E6N A;  1GC7 A;  5FI0 A;  3I3T B;  2W9N A;  2DHZ A;  1MAI A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...