4TKNA

Structure of the snx17 ferm domain bound to the second npxf motif of krit1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
256
Chain Sequence
b'PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
total genus 77
structure length 256
sequence length 276
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4tknA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tknA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4tknA01
1Z2MA 1E7UA 2NR2A 3L13A 5LXIB 1NTYA 2MW5A 5D7GA 3ZO5B 4G50A 3RCZA 1DROA 1V81A 1MKEA 3JSVB 3D32A 2Y8GA 1MPHA 3VTWA 2L76A 3R66C 1RJ2A 2LYDA 4GIVA 3VUWA 5C79A 3VIAA 2M14A 3R7QA 5E6OA 4Y94A 1PQSA 5IAAC 4IWOA 2CY4A 5DPSA 1L2NA 4BKSA 2K1FA 2KTFA 4EZKA 2Y7BA 1EAZA 3VUYA 3LDZE 4JL9A 4W9LA 4NAWB 1WI0A 1FB8A 5HE2A 1K5DB 1WE7A 3N32A 3GYOA 1WXMA 4XC2A 2ROVA 2I5CA 1F9JA 3Q3JA 1EGXA 4G11A 3OAWA 4IOYX 3T9LA 3DBRI 1WM3A 2BWFA 5EFXA 2EJ8A 2MBHA 5JHBA 5CHWA 2FCMA 2FNJB 1Q0WB 4FA6A 2C5LC 2GMIC 4GDLA 2PPHA 2UZSA 4BBNC 1UGMA 2Z59B 3B08A 4A5KA 3LJ3A 3U30A 5D3XA 4BKGA 1WGDA 2MBEA 4DDGD 1GC6A 3V6CB 4KHOA 3H9DA 3W1YA 1YX5B 5LOPB 4GMXB 3LJUX 3TL5A 1E8ZA 3HM6X 4NJ7A 2ELBA 2DHZA 2KTRB 2IO1B 2I1KA 1WGGA 2MFQA 2WX0A 2KK8A 2IZVB 2CHWA 3T8MA 4W9FA 4G3XB 3V60A 2M1MA 3L0WB 1I2HA 2P0DA 1XT9B 4MH0E 4DHJB 2ZPYA 4K17A 2LWPA 1FAOA 3A9JB 1ZM0A 1I7AA 2KLGA 4GDKA 2ASQA 4MY6A 4E71A 2N23A 3APDA 2GBKA 3A4SC 2KJRA 2V3SA 4KIKB 2KX0A 5JLJB 2L8JA 4AOFA 1KOTA 3TW1A 4F7ZA 2Y5BB 1ZGUB 5C16A 2DZJA 3AU4A 3PS6A 1X1MA 4MGYE 2FCNA 3DDCB 4PS3A 4NQKE 4KVGB 2EMTA 4A3OA 4GPTB 2C7MB 4JQWC 2BCJA 1P3QU 3ZNID 2XBBC 1TBEA 4I6LB 2LG1A 2GOWA 5J2RA 3HQCA 1NU2A 3TO1A 2XK5A 1X86A 2KKCA 1EO6A 1U5FA 1R4NI 4WJPA 4A3PA 1L7YA 2Y8FA 1WMHA 5JZEB 4XX5A 3JYUA 4MDKE 3M1IB 4WVFB 2AEHA 1I35A 4Z2NA 3OLMD 1BTKA 1WGYA 1WX7A 1C1YB 4HPLB 1UNPA 5JHGA 2KMAA 1H4RA 3ZDMC 1V9JA 3KSYA 2RSUA 1FOEA 4CHMA 2KDEB 4A6HA 5HE1A 3JVZX 3TIXA 3DXDA 2JXXA 1Z5SB 3H7SA 1XCGA 1ZC3B 2KZRA 2L1CA 3EECA 3ZNHB 1UNRA 1QZEA 4KV2A 3PVUA 2V76A 3UQAA 4K2PA 2O6VA 2CS4A 1V6EA 3DXCA 2DYMA 1AQCA 2Z0PA 2JVCA 4DHJD 3QQ8B 2OTXA 4MT7A 4HWIB 2ZEQA 2YSZA 1LM8B 1WM2A 1P0RA 2ZJDA 4KHAA 2L0FA 5DHAB 4IM3A 2KD0A 1B55A 2JZZA 5CHFA 2EKEC 2RNRB 1RFAA 3HM3A 3SYXA 1YX6B 1IYFA 4ANWA 2NCNA 5E6PA 1WR6E 2YS5A 3L54A 4A6FB 3PTFC 2MCNB 2K2JA 5C5BA 2IY0B 2ZCCA 1TZ1A 3RUIB 4W9KA 4ANXA 4HLEA 2JRIB 1WY8A 3M3JA 2N9EB 4EZJA 3PVLA 4GZUA 1H10A 3SV1A 1FHXA 3M95A 2KDBA 2DA0A 4EUTA 2CAYA 1UELA 3TCAA 5DPWA 1V5MA 2KLCA 5DH9B 2BWES 3KH0A 1V5PA 3ECIA 1RRPB 3HIZA 1MG8A 2FJLA 2COFA 2NPTA 5DI9B 1DDVA 1PMSA 2DHKA 3C0RB 1R4MI 2MBQA 4W9EA 2IO0B 1E8WA 4GB9A 3M63B 4HDQA 1QQGA 3QARA 3P7ZA 2NBVB 2D9VA 2D11A 3OJ4B 2L2IA 1ISNA 2DYBA 4JLCA 1P3RA 3KYCD 2G45B 1XODA 5DIFB 1Q1OA 2KJ6A 1WZ0A 3RCPA 3H7PA 4PYUA 3B1LX 2AL6A 2DN6A 2NBUA 2GCLA 2KCJA 3R3MA 2YF0A 4A6KA 4AWJA 4W9CA 4GU2A 5J3YA 2G4SA 2GCJA 2D9YA 1LW3A 3IBEA 1OGWA 1I42A 4PNKA 2YS1A 5KQ4A 4ICVA 5D3VA 2GBMA 1VCBA 1WJ4A 3PLVA 4HB0B 2HJ8A 1C3TA 1OMWA 4NY0A 1U5DA 3H1UA 1WXVA 2N9XA 3A9KA 3UZTA 5BO4B 2D9ZA 3L16A 4HB2B 1BT0A 2I5FA 5FR6A 2WDTB 1MK7B 2FIFA 2JY6A 4MK0A 1P1AA 2N7DA 1E8XA 2HE7A 1N3HA 4DX90 3DBHI 3APCA 5HE0A 2D9XA 2GBRA 2DYOA 2LVOA 5LONB 2Z0EB 4MEMA 1WGRA 3EHVA 4IUMB 2LZ6A 3APFA 2K8CA 3MJWA 1HE8A 2D2QA 3V61A 1BTNA 2DHJA 2D07B 1DBHA 2L7RA 5JP4A 3TJPA 3DPDA 5CLQB 2IY1B 1EVHA 1KJTA 4BOSC 3WANA 1WJUA 4GSWA 2REXA 1U5EA 4K81A 3ULBA 3ZTDA 4E3CA 1WZ3A 3ENEA 1EF1A 1OEYJ 2RR9A 4IG7B 2MLBA 1WJNA 4KDIC 1XX0A 2JF5A 2NMBA 4CYEA 3BINA 1WXAA 2LI5A 2N4FA 2NVUI 4NNJB 2WYQA 4AP4C 4DBBA 4EEWA 2N7EA 4II3B 2ZNVB 2RLOA 2YT1A 4GDKB 1WJMA 1BAKA 2RGNB 3MTNB 4WQOB 3A4RA 1WFYA 2AL3A 4BKSD 3VHTC 3ZRCA 5JHHA 4DDID 3QC8B 3S2AA 4RMAA 1AWEA 2DZIA 1M7RA 1Y5OA 1OEYA 2DX5A 1E90A 2XEWA 2MBBB 2LVQA 3ZKJC 2OQBA 4XZ4A 2J59M 3FSSA 1Y8RC 2OJRA 3KUZA 1GNUA 3A1QA 3AXCA 1V80A 4MGKE 1AARA 3QX1A 3PT2B 2K6QA 1K8RB 2C7HA 1M94A 2L00B 3VXWA 2K00A 4W9IA 3WALA 1WX8A 3VTVA 1LQBA 4WJNA 4IW0A 4BOZB 3RZWC 2KQ7A 2KXJA 2WWZA 1U27A 3KUCB 2UWQA 2XK5B 4M0WB 1FGYA 2L3ZA 2CRFA 1UD7A 2KOXA 3ALBA 1WJ1A 5AEKB 1P5TA 1WMHB 3NY5A 3VDZA 2KJHB 1ZSQA 3QAQA 3FEHA 3Q3FA 4F1SA 3GOEA 1J0GA 2J0KA 1TJ6A 3CF6E 4W9GA 1XKEA 4HK2A 3X0WA 4NPNA 4MJSA 1FGZA 1LXDA 3TFMA 1EUVB 1UPRA 3SDLC 3ZVVA 2ELAA 1UBQA 2PE9A 2LVPA 2P0HA 3PHXB 2KWVB 1J19A 1V5UA 2O6VB 3PSEB 2IYDB 3ZVRA 1M7EA 1IRSA 1TGZB 2MSED 5J3QA 2UZRA 3HW2B 1D3ZA 4J6IA 2ZNVC 1DDWA 2MBOA 2PEAA 4L6EA 1ZVRA 3VTUA 1P98A 2R0DA 1P6SA 2LULA 2HTHA 2E2XA 1KM7A 1WGHA 1ZC4B 4M8MA 5EDSA 3I3TB 4HATB 2DX1A 1KI1B 2M4NA 2DLWA 2O2VA 3WIMA 3O96A 3ZUNA 1GG3A 2D10A 1PFJA 5C5BB 3ZDTA 1V88A 3WAPA 5D27A 4FULA 4LDTB 5DPRA 3QIJA 3GYPA 4HHVA 3CSFA 5D2MB 4FJZA 5TR5A 1OQNA 4I6PA 5KHOA 4PYZA 1MK9B 1XR0B 2MWNB 2BGFA 5AZGA 2KFKA 1UPQA 2BYFA 1XQQA 4DHZB 1RRBA 4H8SA 4W9DA 4BFRA 1W1DA 5HKHA 3DCGA 2M17A 4DK5A 4TV3A 3K9PB 3VH3B 2JZ3B 2DTCA 3CMMB 2BYEA 2NPTB 4AUQC 3KZ1A 2X18A 2JP2A 1NBFC 2K25A 1U2BA 4I6NB 4JGHB 2NZ8B 3VFKA 3A8PA 4JIOU 3DOWA 5G2NA 4GXBA 3DBLI 4KAXB 4PS7A 1J8CA 4KZ0A 1V49A 2MQJA 5G55A 3CSTA 2DYNA 2BKFA 2FUHB 3OJ3A 2J7QB 1OQYA 3K9OB 2C60A 4GGQA 2FCQA 2O6VD 2JWZA 1WE6A 2D3GA 3SD5A 1U4AA 4TYZA 1NTVA 1SE9A 4GMVA 1Q67A 3UGBB 5DPTA 2C9WB 2D4QA 2M0XA 2JUOA 2IYBA 4B95A 3V5WA 4EKUA 3EFUA 3HHMA 2KQSA 3CXBB 3NZSA 2KC2A 2ZVNA 2VRRB 1CMXB 1VD2A 2KUPA 3ZIMA 3D8EA 4CHKA 2LRUA 4HB4B 3A9KB 2CY5A 1E5WA 4LDTD 3IG3A 3N30A 4WWOA 4B6WA 3UQBA 3WAOA 5L81A 3ODXA 2J0MA 2YVCA 4HCNB 2RSGA 1SIFA 3CIKA 1RAXA 3RD2A 2LGYA 4EOYA 1H8CA 4FADA 4ZRJA 5CTRC 2ZPNA 1YD8U 4AJWA 1DDMA 5JHAA 2KWCA 4TUUA 4HAVB 2IBIB 4DHZE 1WVHA 5J18A 3PGEA 4D0NB 1FHOA 3W1SA 5JH5C 3PV1A 3WAMA 3ULCA 2IO2B 2JRHA 2LRWA 1U29A 3HK0A 2YLMA 1J0WA 3T06A 4HAWB 4EFOA 3PRMB 1WF9A 2KANA 3QK0A 2CODA 1WH3A 1YJ1A 4X57B 3A33B 4IFSA 1S1QB 5AZHA 2YS3A 1OTRB 3AJ4A 4ANVA 2QHOA 1W1HA 3DVGX 3L08A 2BF8B 1MIZB 1IP9A 5KCVA 3H6NA 3PRZA 4WJQA 2JPHA 2KNBA 2H7EA 2DAJA 4WWPA 1MAIA 3P2BA 3ODOA 2PJHA 5C6RA 2BPSA 2GBNA 2ROZB 4FLHA 5D3YA 4FJYA 2QKLA 2V4LA 4GOCA 2D9WA 3KRWA 1WXSA 2ZZPB 1K5GB 3DVNV 3B0AA 2KO3A 3D8FA 4GDLB 1YQBA 2DX5B 4MSQB 1Y19B 3AI5A 4K7SA 2B3AA 4HB3B 3L10B 2AYOB 3A1QB 1X11A 1WX9A 3V62A 4RM9A 4KDLB 2EC1A 2KWUB 1XD4A 3MDBC 1UNQA 1WI1A 3ZW3A 5IA7A 2PZ1A 1FHWA 1LB1A 3U7DA 3GZNI 4HPMB 1UZXB 5D6JB 2CR5A 3IHPC 2LD9A 4WSFA 5L83A 2GBJA 2LASA 2MP2A 1UH6A 4GN1A 4ICUA 4F7GA 4YONA 4B6HA 3ZNGC 4CO7A 2JT4B 2RD0A 3TMPB 3EC8A 4K1RB 2KGXB 4NSWA 3SNHA 4ZRIA 1WRDB 3DBSA 1V5TA 1W1GA 3D8DA 1WIAA 4MJSB 3MHSD 2RUKB 1QC6A 1DYNA 3SUZA 3BY4B 2RPQA 3DVGY 1NI2A 2R2QA 2NBWB 1A5RA 4WJ7A 4LJPB 4NJ6A 4E74A 4ZYNA 3UIPB 2DFKA 3IVFA 4ANUA 2CHZA 2OOBB 3M62B 4DWFA 1WGUA 4P7IA 5J3TA 3A98B 3JSVA 4KZCA 2V1YA 2COAA 5D94A 3UF8A 2ZCBA 1RLFA 1YIWA 2HTHB 1WR1A 3F0WA 3VUXA 3ONSA 2O2VB 3IFWB 2LOZA 2N1VA 1E7VA 2KVRA 3WA0A 2LOXA 1ZW7A 4HCPB 4K7WA 5J17A 4NAWA 2Z0QA 3G9WA 3A8QA 4Z2MB 3PPAA 3P6AA 1WGQA 2DYQA 2LKOA 1KZGA 3QWMA 2KFKB 4KSKC 4WWNA 4MGZE 4OVVA 3QBVB 2UVMA 4DBGA 1IPGA 2P8VA 4EJNA 3QJZA 5HE3A 4URKA 3ZLZA 2YT0A 2Z0OA 4ZDVA 3F5RA 2KN5A 2N0YA 4HAYB 2K8HA 4HVBA 3PP2A 2MWSB 3FM8C 4TKNA 4HJKA 3MPXA 2QKMA 3ML8A 4TQ0A 4W9JA 2DKPA 3AULA 3DXEA 1EF5A 2KC1A 1UBIA 3N7CA 2VSZA 2COCA 4LJOB 2G4DB 2W2WA 3NZUA 1WG7A 3VH4B 4BBNF 3QA8A 5LXHA 3QHTA 3PSCA 4LCDE 1BWNA 2Q13A 4FN2A 3RZFA 4M8NA 3N3KB 1WJ6A 2A5UA 3PREA 4IWQA 3VAWA 1SHCA 2KTRA 2FIDA 1V2YA 2MX2A 2G3QB 2MRPA 5C23A 2IFSA 2W2XD 3WYFB 2DAFA 3PHWB 3R7RA 1X05A 3O65B 4MM3A 1X1GA 2W2XC 2XQNM 1LFDA 3VOQA 4FHKA 2DZKA 4ZRKA 3A9JA 4MELA 3NOBA 2VRWB 2BYVE 3VQIA 2I1JA 2WX1A 4KIKA 2EMSA 2UYZB 4DXAB 2H7DA 4A20A 4IWPA 4C0AA 3KW5B 2DZMA 2N1WA 1Q5WB 2KDIA 4IM0A 4BBKA 1TQZA 2PE6B 3RT3B 1JRUA 4IAPA 3JW0X 2RGFA 4F7UP 5CX3A 2FAZA 1FXTB 1TTNA 5D3WA 2CU1A 2DKQA 1OY2A 4HXDA 3UIOB 4IM2A 1S3SG 3L17A 2P0FA 2CHXA 4HAXB 2LJ5A 1MIXA 1SGHA 3U8ZA 4F7HA 1GUAB 4YL8A 4OVUA 4WJOA 3PZDA 4PQ0A 4FHJA 4HAZB 1UEFA 3KY9A 4II2B 4DX8A 3H7PB 3KRXA 3NHEB 3PEGA 4EMOA 4HAUB 3ODWA 1V89A 4G0NB 4FBJB 5L95C 2R09A 5CHVC 1U5GA 3KUDB 4CHJA 5KQ1A 2MDXA 4W9HA 4MGIE 2R2OA 1Z87A 3PLUA 4BVUC 1GJZA 2M8SA 2MA9B 1XD3B 2HD5B 1X1FA 5E6NA 3V6EB 2NS5A 3ZRFA 4AJYB 2KMCA 2LXCA 1V61A 1WYWB 3NS8A 2C7NB 4KSLC 1KZ7A 1NDDA 5LLIA 2L0TA 4ASWC 3DQVA 1V86A 1TXDA 2M38A 3TBLD 2KDFB 4KHBB 1V5OA 5GMVA 3ZNZB 4WAAA 3RULA 5GOWB 2CKHB 4XWXA 1KLVA 2K8BA 2K39A 1ZKHA 2FCSA 4RM8A 1T0YA 4B9KA 5CLLB 2IO3B 4K7UA 4IC7B 5AZFA 1G6JA 3OANA 3X23A 3TVVA 4TQ1A 2ZVOA 3UINB 4A6FA 2LUEA 4PS8A 3PG7A 2GJYA 2LGDA 2KX3A 4EZLA 2K6DB 3DVNU 5FI0A 2AWTA 2A4ZA 2L05A 2GS0A 2MP2B 4NQLB 3KYDD 5DCNA 5C1ZA 2RVBB 2LGXA 2VKIA 2KFJA 2W9NA 4HDOA 3ML9A 4FJVB 3VVWB 3RYTA 2N9PC 1GC7A 3BJIA 2Z0DB 5FI1A 3KVFB 3SO6A 3SU8X 2BKRB 1PLSA 3AU5A 4K2OA 2MKRA 5DHFB 3ML4A 4BKTA 2J0JA 4N9F4 3PVWA 2DHIA 2YRYA 3W1SC 2DENB 3QCAA 2K2UA 3ZTCA 3QWZB 4MSMB 3PRPB 4F8CB 2ADZA 2KHWB 2G35A 1P9DU 2LXAA 3SHQA 5KHQA 3NSUA 1E8YA
chains in the Genus database with same CATH superfamily
1Z2MA 3PO0A 1E7UA 2NR2A 4C7YA 3P4SB 3BYTB 3L13A 5LXIB 1NTYA 2MW5A 5D7GA 2IDYA 1N6ZA 2OJWA 3ZO5B 4G50A 3RCZA 2NBVA 1I7HA 3MC0B 4XDCA 1DROA 1V81A 1MKEA 3JSVB 4P1CC 3D32A 3Q14C 1SE3A 2K3UA 2Y8GA 1MPHA 3VTWA 2RDGA 5C3JB 2L76A 3R66C 1RJ2A 3FILA 3Q6BA 3MP9A 2Y5CA 2LYDA 2W3RA 4GIVA 3VUWA 3DCXA 5C79A 1JCKB 3R8BA 2K8EA 3NWFA 3VIAA 2M14A 3R7QA 4JPSA 5E6OA 4Y94A 4A8XC 1PQSA 5IAAC 4IWOA 2CY4A 1KF6B 4ILHA 3P4RB 5DPSA 1L2NA 2PKOA 4BKSA 2K1FA 2KTFA 4EZKA 2Y7BA 1EAZA 3VUYA 3LDZE 4JL9A 4W9LA 4NAWB 1WI0A 1ZYIA 4USAA 1FB8A 5HE2A 2D3BA 2DBYA 1QKZA 1K5DB 1VLBA 3DBHB 1WE7A 3N32A 3GYOA 1WXMA 4ITKA 4XC2A 2ROVA 2I5CA 1F9JA 3LYYA 3Q3JA 1EGXA 4G11A 1RYJA 3OAWA 4IOYX 3T9LA 3DBRI 3I63C 1WM3A 2BWFA 5EFXA 2EJ8A 2MBHA 5JHBA 5CHWA 2FCMA 4KGTA 4H2AA 2FNJB 1JWMD 1Q0WB 2QMTA 2VZKD 1NENB 4FA6A 5BYQA 3P4PB 2C5LC 2GMIC 4GDLA 1E9MA 2PPHA 3DHGC 3AE3B 2UZSA 4BBNC 1UGMA 2Z59B 3B08A 4A5KA 4A6QA 3LJ3A 1CK1A 3U30A 5D3XA 4BKGA 1EM7A 1WGDA 2MBEA 4DDGD 1XCQL 3AE4B 1GC6A 4RNAA 3AB5A 3GB1A 2V4IB 4QJ5B 3HIEA 1ET9A 3AE2B 3V6CB 4KHOA 3H9DA 3W1YA 1YX5B 5LOPB 2AX5A 4GMXB 3LJUX 3TL5A 1E8ZA 3HM6X 4NJ7A 1XLNA 2ELBA 3O13A 2KR0A 1RFKA 2DHZA 2KTRB 2IO1B 2I1KA 1WGGA 2WXNA 4US8A 4AS1A 3FLVA 2MFQA 2WX0A 2KK8A 5BMIA 2HTME 2G9HD 2IZVB 2CHWA 2DWQA 3T8MA 4W9FA 4G3XB 3V60A 1C9FA 2M1MA 3L0WB 1I2HA 2KQ4X 2P0DA 5EE0A 4MM3B 1WYGA 1XT9B 1PGBA 3J9CA 4MH0E 1YMHE 3P1MA 2ZW0A 3R2TA 4DHJB 2ZPYA 4K17A 2LWPA 1FAOA 2WLBA 3A9JB 1ZM0A 1I7AA 2KLGA 1I4HA 4GDKA 2ASQA 4MY6A 4S0RA 4E71A 5FKAC 4MH8A 4RH6A 2N23A 3APDA 3EPYA 4ACFA 2GBKA 3A4SC 1K51A 2KJRA 2V3SA 3MC8A 4KIKB 2KX0A 1R7SA 5JLJB 2DNFA 1ZE3D 2L8JA 4HSIA 1ZDXA 1EU4A 4AOFA 1KOTA 3TW1A 4F7ZA 1CJEA 3R2IA 2Y5BB 1V1OA 1ZGUB 1PFDA 2MHJA 5C16A 2DZJA 3AEEB 3AU4A 3PS6A 2V3NA 1X1MA 4MGYE 1DIKA 1EU3A 2FCNA 3DDCB 4PS3A 1FXAA 4NQKE 4KVGB 2EMTA 4A3OA 2Q5WD 1C4PA 4GPTB 2C7MB 4JWSC 4JK9A 3AE5B 4JQWC 4AQ7A 2XNAC 2BCJA 1P3QU 3ZNID 2KIEA 2XBBC 1TBEA 2KACA 3ABVB 4I6LB 2LG1A 2GOWA 5J2RA 3HQCA 1NU2A 2BW2A 3TO1A 2XK5A 4M0WA 3IXSA 2QSDA 1X86A 2KKCA 1EO6A 1U5FA 1PGAA 2H89B 2WH5A 1R4NI 4WJPA 4A3PA 1L7YA 2Y8FA 1WMHA 1FM0D 5JZEB 4XX5A 1FNVA 3JYUA 4MDKE 3M1IB 4WVFB 2AEHA 1KFYB 2L83A 1I35A 3NWAA 1FRRA 4Z2NA 3AEFB 3OLMD 1TY2A 1BTKA 4ARCA 1WGYA 2M56B 5M4YB 1WX7A 1C1YB 4DIXA 4HPLB 1UNPA 5JHGA 4L1BA 2KMAA 1H4RA 2KN4A 2R2YA 3ZDMC 3WCQA 1MPEA 1V9JA 1ACAA 3KSYA 2M0AA 2RSUA 4L2YA 1RM6C 2BB6A 1FOEA 4KGRA 4CHMA 2KDEB 4A6HA 5HE1A 3JVZX 4CQNA 3TIXA 3DXDA 2JXXA 1Z5SB 3H7SA 1XCGA 1ZC3B 2KZRA 2NTSA 5MPOA 2L1CA 3EECA 3ZNHB 1LGRA 1HEZE 2V0GA 3Q8FA 1UNRA 1QZEA 4KV2A 3PVUA 5LNK1 2J4XA 1DOYA 2EKIA 2V76A 3UQAA 4K2PA 2O6VA 2CS4A 1V6EA 3DXCA 1N62A 4WIPA 2DYMA 1AQCA 1SBBB 4RGTA 2Z0PA 2JVCA 1IBXA 3E9SA 1JWAD 2TSSA 4JE3B 4DHJD 4QXAB 3QQ8B 2OTXA 2LEKA 1BXTA 4LLGM 4MT7A 3BVGA 4B0MA 4HWIB 2ZEQA 4Q2JA 2YSZA 1LM8B 4D6WA 1WM2A 2IGGA 1P0RA 2ZJDA 4KHAA 2L0FA 5DHAB 4IM3A 1BMLC 2KD0A 1B55A 2JZZA 3I5JC 2GUMA 5CHFA 2EKEC 3P4QB 2RNRB 1RFAA 1C76A 2MH7A 3HM3A 3SYXA 1YX6B 1IYFA 1V1PB 4ANWA 2NCNA 5E6PA 1WR6E 2YS5A 3OWEB 3L54A 2WXHA 1C78A 4A6FB 3ZXRA 3PTFC 4WURA 4ZYSA 1HA5A 2MCNB 2K2JA 5C5BA 2IY0B 3IT6B 2ZCCA 1TZ1A 3RUIB 1FEHA 4W9KA 2NMQA 4ANXA 4HLEA 4P1BC 2R61A 2JRIB 1WY8A 1JWBD 3M3JA 2RQ1A 1SF0A 2N9EB 2KT7A 4EZJA 3PVLA 4GZUA 1H10A 3FKYA 3SV1A 1FHXA 3M95A 2KDBA 2DA0A 4QJ4B 1HTQA 4EUTA 2CAYA 1UELA 3BVMA 3CWIA 3TCAA 5DPWA 1V5MA 2KLCA 2BVCA 4C00A 2EELA 3NRZA 1JDEA 4XGAB 3DBLB 5LG4B 5DH9B 1I4RA 2BWES 3KH0A 1V5PA 1YN3A 3N1ZC 3ECIA 2E3TA 1QLBB 1RRPB 1AYFA 3HIZA 1MG8A 2FJLA 1HQRD 2COFA 4S17A 2FJ9A 1SE2A 2NPTA 2FUG1 3VRBB 3SFEB 5DI9B 2KUQA 1DDVA 1SXTA 2RDHA 1PMSA 3ZYYX 2DHKA 3C0RB 1T0SC 1R4MI 3TEWA 2MBQA 4W9EA 1F52A 2IO0B 1E8WA 4GB9A 4RF0A 4MT5A 2MJDA 2PLPA 3M63B 4HDQA 1QQGA 5AUKA 2KVZA 3QARA 3FAHA 3W9CB 3P7ZA 1UWXA 2RMMA 3SBGA 1JRPA 2NBVB 2D9VA 3AEGB 1NYQA 3RN9C 1TS4A 4KGSA 2D11A 4EE2A 3OJ4B 1TKEA 1WRIA 3NVWA 4P16A 2L2IA 2IGDA 1ISNA 4CSQA 2DYBA 4JLCA 1P3RA 2K5PA 3KYCD 2G45B 1GGOA 1XODA 5DIFB 1Q1OA 2KJ6A 1WZ0A 3RCPA 3H7PA 4MACA 2RRFA 3Q3NC 4PYUA 3B1LX 2AL6A 2DN6A 2WXLA 2NBUA 2GCLA 2KCJA 2E6XA 3R3MA 2YF0A 4A6KA 4AWJA 4W9CA 4GU2A 5J3YA 2PMVA 3AE1B 2G4SA 5I2MA 2GCJA 3T3OA 2D9YA 1LW3A 3IBEA 1OGWA 1I42A 4PNKA 2YS1A 5KQ4A 4DQOC 4ICVA 1TKYA 1DOIA 3Q8AA 4ZHOA 5D3VA 2GBMA 1VCBA 3DHHC 1WJ4A 3PLVA 4HB0B 2RPVA 2K49A 2HJ8A 1Y56A 1C3TA 1OMWA 4N6EB 1PYWD 4NY0A 2CJNA 4B0EA 1U5DA 1YOVB 3H1UA 3MFGA 1WXVA 2N9XA 1TKGA 3A9KA 3UZTA 2L1AA 5BO4B 4C4VA 4LNOA 2D9ZA 3L16A 4HB2B 3RNBC 1BT0A 2I5FA 5FR6A 2WDTB 1MK7B 2FIFA 2JY6A 3N9YC 3U7ZA 4MK0A 1P1AA 2N7DA 1E8XA 3BK2A 3H8HA 2HE7A 4UDUC 3IAS1 1IGCA 1N3HA 4DX90 1I4PA 3DBHI 1JALA 1CZPA 3APCA 1DOXA 5HE0A 4YTNB 2D9XA 2GBRA 3C19A 2DYOA 1QF6A 2LVOA 5LONB 3RNCC 4L1RA 2Z0EB 4MEMA 2X0SA 1WGRA 2WXIA 3EHVA 4IUMB 1XLQA 2LZ6A 3APFA 2K8CA 3MJWA 3RNEC 4OZAA 1HE8A 2JYTA 2D2QA 2FBWB 2GLSA 3V61A 1BTNA 2K9XA 2DHJA 2D07B 2LHEA 2QCZA 1DBHA 2L7RA 5JP4A 3TJPA 3DPDA 2WS3B 5CLQB 2IY1B 1EVHA 1TZOA 1KJTA 4BOSC 3WANA 1WJUA 3TEYA 4GSWA 1FCLA 2REXA 1U5EA 4K81A 3ULBA 2YEPF 3ZTDA 2ABDA 1TS5A 4E3CA 4ARIA 1WZ3A 3ENEA 5G5HA 1QT9A 3AE8B 4NZLB 1OFFA 1EF1A 2DIKA 3ZXVA 1OEYJ 2RR9A 4IG7B 2MLBA 2LJIA 4GOUA 1WJNA 1UNSA 1STEA 4KDIC 1XX0A 2JF5A 3FVCA 3EFCA 2NMBA 4ZHPA 4CYEA 3PZ8A 1P7FA 3EUB2 3HSAA 4YTPB 3BINA 1WXAA 2LI5A 3ZQ4A 2N4FA 2NVUI 1T5XD 5IP4D 4NNJB 1SB3C 2WYQA 4AP4C 3AEAB 2LFIA 5BYSA 4DBBA 2Y5PA 4EEWA 2IJ0A 4K3BA 2N7EA 4HKZE 1FMAD 4II3B 2LUMA 2ZNVB 2Z14A 2RLOA 4US9A 2YT1A 3U4EG 4GDKB 3RMKC 5EE9A 4LTUA 3N1XC 1WJMA 1BAKA 2RGNB 3MTNB 4WQOB 3GP7A 3A4RA 1I4GA 1WFYA 2AL3A 3E9PA 5JVLA 4YT0B 3VHTC 4BKSD 4YWGG 3ZRCA 1P7EA 4JKCA 5JHHA 4DDID 1QOBA 3QC8B 3S2AA 4RMAA 1E6EB 1HXYD 1AWEA 2DZIA 1AW7A 1CQVA 3NJTA 1M7RA 1Y5OA 1OEYA 2DX5A 5BMHA 1E90A 2X38A 2XEWA 2MBBB 3GZNB 2IPKD 2LVQA 4WQMA 1DGJA 3ZKJC 2OQBA 4XZ4A 2J59M 3FSSA 1Y8RC 2OJRA 3BK1A 5FR3A 3KUZA 1GNUA 2V9HA 3A1QA 3AXCA 1V80A 4MGKE 1AARA 3QX1A 1WGKA 2WXJA 3PT2B 2K6QA 1K8RB 2C7HA 1M94A 2L00B 2KYWA 3VXWA 2K00A 4W9IA 1WX8A 3WALA 3VTVA 1NTIA 2KMMA 1LQBA 4WJNA 4IW0A 4BOZB 1XXGA 2G1EA 3RZWC 2KQ7A 1FNUA 2KXJA 2WWZA 1U27A 3KUCB 2UWQA 2XK5B 4M0WB 3E9LA 2HJ1A 1FGYA 2L3ZA 2CRFA 1UD7A 2KOXA 3IAM1 3ALBA 1WJ1A 1TYGB 3RI7C 5AEKB 4PK1A 3FP5A 2LBBA 1P5TA 1WMHB 3NY5A 2K0PA 3DHIC 4K3CA 3VDZA 2KJHB 1ZSQA 3N1YC 4JK7A 2FJUB 3QAQA 3FEHA 3Q2AC 1ZP0B 3Q3FA 4F1SA 2L52A 3GOEA 3LB8C 1J0GA 3ZJVA 2J0KA 1TJ6A 2KAJA 3CF6E 4W9GA 1XKEA 4HK2A 3X0WA 2VH1A 4NPNA 2QDFA 3Q69A 4MJSA 1FGZA 2KIGA 2MJ3A 4JKGA 1VZ7A 4HPPA 5HFYA 2KWDA 4WAFA 4TMAB 1HBKA 1HB6A 5IJMA 1LXDA 4FXCA 3HVDA 2JYEA 3TFMA 1EUVB 1Q10A 1PDXA 1UPRA 1HTOA 3SBTA 3Q8BA 3SDLC 1NVLA 3ZVVA 2ELAA 1UBQA 2PE9A 3SR6A 1VBHA 2LVPA 2P0HA 3PHXB 2KWVB 2PW9A 1J19A 4JKHA 1V5UA 2O6VB 3TSSA 1VZ6A 3PSEB 2IYDB 3ZVRA 1WSPA 1M7EA 1IRSA 1TGZB 2Y3AA 2W82A 1XEEA 1IBXB 2MSED 3NS1A 5J3QA 2UZRA 5H8YE 3HW2B 1D3ZA 4OSNA 3U12A 4J6IA 1GOZA 1E0ZA 2ZNVC 1VDVA 1TY0A 1DDWA 2MBOA 2PEAA 4XWTA 4L6EA 2N9KA 1ZVRA 3VTUA 1SE4A 1P98A 3V3XA 2R0DA 2QEJC 1P6SA 4DXFA 3Q3MC 4N59A 1UF0A 2LULA 4RFBA 2HTHA 1HB8A 2E2XA 4NAMA 1KM7A 1WGHA 1ZC4B 5IRSA 4M8MA 4OZCA 5EDSA 3I3TB 4HATB 2HRJA 2DX1A 1KI1B 2M4NA 2DLWA 2O2VA 3WIMA 3O96A 3ZUNA 1GG3A 4OHJA 3GS2A 2D10A 1PFJA 5C5BB 2CU3A 3ZDTA 1V88A 3WAPA 4JK8A 5D27A 4FULA 4LDTB 5DPRA 3QIJA 2Z4DA 1T0RC 3GYPA 2L32A 4HHVA 3CSFA 3NZ3A 5D2MB 4FJZA 3BIID 5TR5A 1OQNA 4I6PA 5KHOA 4PYZA 1E10A 1MK9B 1XR0B 1L0XB 2MWNB 2BGFA 5AZGA 2KFKA 1UPQA 3KLSX 2BBCA 2BYFA 1XQQA 4DHZB 1RRBA 4H8SA 4W9DA 2MJEA 4BFRA 1W1DA 5HKHA 3DCGA 2M17A 2M19A 1L5PA 4DK5A 4TV3A 2WGSA 2H88B 3K9PB 3AEBB 3VH3B 2JZ3B 4WWMA 2DTCA 3CMMB 2PVGC 2BYEA 2NPTB 4AUQC 2X18A 3KZ1A 2JP2A 4HROA 1NBFC 1JW9D 3HUIA 2K25A 1U2BA 4I6NB 4JGHB 3AEDB 3URYA 2NZ8B 2DLBA 3VFKA 3A8PA 4JIOU 3DOWA 5G2NA 4GXBA 3DBLI 4KAXB 4PS7A 1J8CA 4KZ0A 2GI9A 5C2TB 3MC9A 1V49A 3NVYA 2MQJA 5G55A 3CSTA 2DYNA 1MI0A 2BKFA 2FUHB 3OJ3A 2J7QB 1OQYA 2COPA 3K9OB 1ZXHA 2JZPA 2C60A 4GGQA 2FCQA 4LK0M 2O6VD 1M4VA 2JWZA 1WE6A 1N5WA 2D3GA 2INDC 3NVVA 3SD5A 1U4AA 4TYZA 1NTVA 3B77A 1SE9A 3N20C 4GMVA 1Q67A 3UGBB 5DPTA 2WNMA 2AQ3B 2C9WB 4RGMA 2D4QA 4NJCA 2M0XA 3W5VB 1VBGA 3GE8C 2JUOA 4IOIE 2IYBA 4B95A 3U2SC 3V5WA 4EKUA 3EFUA 3HHMA 2KQSA 3PZ7A 3CXBB 3NZSA 2KC2A 2ZVNA 1N63A 1V8CA 2VRRB 1CMXB 1VD2A 2KUPA 3ZIMA 3D8EA 2AQ1B 2ICIA 4CHKA 2LRUA 2WDQB 4OT1A 4HB4B 3A9KB 3OHMB 2CY5A 3E9OA 4C4VB 1KH0A 1E5WA 4LDTD 1ACCA 3IG3A 3N30A 4WWOA 4B6WA 3UQBA 3WAOA 5L81A 3ZJTA 1UWMA 4A55A 2J0MA 3ODXA 2BYTA 2YVCA 1VJKA 3DWMA 4HCNB 4IKGA 2RSGA 3GE3C 1SIFA 3CIKA 1YJJA 1RAXA 3RD2A 2INPE 2LGYA 1ST7A 4EOYA 1H8CA 3AE9B 3FC4A 1L6UA 4FADA 4ZRJA 2LHDA 5CTRC 1KC7A 3Q8CA 2ZPNA 3L4PA 1YD8U 1DDMA 4AJWA 5JHAA 1FPYA 2KWCA 2VH2A 4TUUA 1L0VB 3RPFC 4HAVB 2IBIB 1FXIA 4DHZE 3FILB 1WVHA 5J18A 3PGEA 4D0NB 1FHOA 1TIFA 3W1SA 5JH5C 3PV1A 1T77A 1J7AA 3ULCA 3WAMA 4OVZA 2IO2B 3B9JA 4WH4A 2JRHA 2LRWA 1U29A 3HK0A 1T0QC 1K53A 2YLMA 1J0WA 3T06A 4HAWB 1YNTE 4EFOA 1FNWA 3PRMB 2ZKMX 1WF9A 2KANA 5TSSA 3QK0A 2CODA 1WH3A 1YJ1A 4X57B 3A33B 5HI1A 4IFSA 1PGXA 2ZW1A 1VRAB 1S1QB 3U52E 5AZHA 2YS3A 1OTRB 4N58A 1ESFA 3AJ4A 2K22A 4ANVA 4LNFA 4ZOHC 2QHOA 2OHFA 1TJEA 1W1HA 2VZKB 3DVGX 3L08A 2BF8B 1MIZB 1IP9A 4XDDA 5KCVA 3H6NA 3PRZA 1A70A 4WJQA 3C8YA 2JPHA 2KNBA 2ON8A 2SAKA 2H7EA 2LGSA 2DAJA 4WWPA 1MAIA 3P2BA 4YXDB 3ODOA 2JX5A 2PJHA 4KHBA 5C6RA 2BPSA 3A58A 1C4CA 2GBNA 2CB8A 5HHDG 2ROZB 4FLHA 5D3YA 4FJYA 1EWCA 1I4QA 2QKLA 4QJ3B 2V4LA 4GOCA 4GNKB 2D9WA 3KRWA 1WXSA 2ZZPB 1K5GB 3DVNV 3B0AA 2KO3A 3LXFA 3D8FA 3BWUD 4GDLB 1YQBA 2DX5B 4MSQB 1Y19B 3AI5A 4BZAA 3T3NA 1I4XA 4K7SA 2B3AA 4HB3B 2OEDA 3AN1A 3L10B 1T6BX 3V05A 2AYOB 3A1QB 1X11A 1WX9A 2WXOA 3V62A 4RM9A 3AMZA 2EC1A 4KDLB 2KWUB 2BS4B 1XD4A 3MDBC 1XLPA 1UNQA 1WI1A 3ZW3A 5IA7A 2PZ1A 1FHWA 1FIQA 1LB1A 4C56C 1NYRA 3U7DA 3GZNI 4HPMB 4JX1C 2AQ2B 1UZXB 1NI3A 4O1NA 1GPXA 5D6JB 2CR5A 3IHPC 2LD9A 4WSFA 5L83A 2GBJA 2LASA 2MP2A 5BYRA 4RCOA 1UH6A 4GN1A 1MVKA 4ICUA 2WDRB 4F7GA 4YONA 4B6HA 3ZNGC 3P42A 4GLSC 4CO7A 2CJOA 2JT4B 2RD0A 3TMPB 2INCC 1D5ZC 3EC8A 1B1ZA 4K1RB 2WXQA 3KWLA 2KGXB 1YJIA 4NSWA 4JKDA 3SNHA 4ZRIA 4KKJA 3RNAC 1K50A 1WRDB 3DBSA 1V5TA 1W1GA 1D4BA 4XYCA 3D8DA 1WIAA 4MJSB 4HKQA 3MHSD 4JKGB 1BUIC 2GRIA 1MFWA 2RUKB 1TS3A 1ENFA 2BB5A 2R82A 2X8XX 2YT2A 1L0YB 2WXFA 1QC6A 1DYNA 2LMCA 3SUZA 4KX6B 3ZJUA 1F0ZA 3BY4B 1B9RA 2RPQA 2BQQA 3DVGY 1VR9A 4A90A 1NI2A 2R2QA 1C4AA 1ZOYB 2NBWB 1IGDA 1F2RI 1A5RA 4WJ7A 4LJPB 4NJ6A 4E74A 4ZYNA 1KBLA 1T3QA 2J52A 1N5XA 3UIPB 2DFKA 1MJDA 3IVFA 4YSYB 4ANUA 2CHZA 2OOBB 3M62B 1SEBD 3HRDD 3NG0A 4DWFA 1WGUA 1WWTA 1FCCC 3DWGC 4P7IA 1N61A 4HJGE 5J3TA 3A98B 3JSVA 4KZCA 4A9AA 2V1YA 2COAA 2WU2B 5D94A 1QOGA 3UF8A 2ZCBA 2BS2B 1JROA 1RLFA 1YIWA 2HTHB 1JWSD 1N60A 1WR1A 1FRDA 3F0WA 3VUXA 3ONSA 2O2VB 3VR8B 3IFWB 2WDVB 5BMGA 2LOZA 2N1VA 2QIEB 4KKIA 4ILGB 3RFZB 1E7VA 1TT5B 2D3AA 2KVRA 3WA0A 2LOXA 3DBRB 1ZW7A 4HCPB 5HG2A 4M01A 5IKCM 4K7WA 5J17A 4NAWA 2Z0QA 3G9WA 3A8QA 4JKEA 2RDBC 4Z2MB 4P6VF 3PPAA 5I4DA 3P6AA 1J7BA 1WGQA 2DYQA 1VZ8A 2I38A 3ZGZA 3P63A 2LKOA 5E6JA 1KZGA 3BZDB 3QWMA 2KFKB 4HRSA 4KSKC 5H92C 1QILA 3AE7B 4WWNA 4MGZE 3CIRB 4OVVA 3QBVB 2UVMA 4DBGA 1XO3A 2BS3B 4QAYA 1IPGA 2P8VA 3NVZA 4EJNA 3QJZA 5HE3A 2MEKA 4URKA 2N0SB 4JKAA 4YSZB 1OQRA 3ZLZA 2YT0A 2Z0OA 4ZDVA 3F5RA 5GXGB 4HEA1 1JMLA 2KN5A 2N0YA 4HAYB 3RNFC 1AN8A 4JKFA 2K8HA 4HVBA 1HZ5A 2PVOD 3PP2A 1XCTL 2MWSB 3E56A 3FM8C 4TKNA 1C79A 3MPXA 4HJKA 2QKMA 3ML8A 1DYQA 1ZUD2 1OQQA 4TQ0A 2Z59A 4W9JA 1ROEA 2DKPA 3AULA 1QOFA 3DXEA 1L4DB 1EF5A 1QOAA 2WQYB 5D3DA 2KC1A 4OW0A 1UBIA 3N7CA 2WP9B 2VSZA 3MHZA 2COCA 1MG4A 2Z13A 4LJOB 2G4DB 2W2WA 3NZUA 2QJLA 1WG7A 3VH4B 4BBNF 3QA8A 5LXHA 3QHTA 3W2DA 3PSCA 4LCDE 2HDEA 1BWNA 2Q13A 4FN2A 3RZFA 4M8NA 2IGHA 2QC8A 3N3KB 1FFUA 1SJED 1WJ6A 1GB1A 2A5UA 3PREA 4IWQA 3VAWA 1SHCA 3HVZA 2KTRA 2FIDA 5IN7A 1V2YA 2D3CA 2MX2A 2G3QB 2J42A 2MRPA 1SJHD 4D2KA 1EWYC 1QQRA 5C23A 2WXPA 2IFSA 2W2XD 3WYFB 2DAFA 2JXTA 3PHWB 4LNIA 3R7RA 1X05A 3O65B 4MM3A 1X1GA 2W2XC 2XQNM 5EE3A 5I2SA 2WXGA 4R3DA 2W54A 4ZRQA 1LFDA 3KQ4A 3B2FA 3VOQA 4FHKA 4LNNA 2DZKA 4ZRKA 3A9JA 1F77A 4MELA 1J7CA 3NOBA 2VRWB 4PT5A 2YEPB 2BYVE 3VQIA 2I1JA 2WX1A 4KIKA 2EMSA 1GAQB 1KRHA 2UYZB 4DXAB 2JQRB 3Q8EA 1RWSA 2H7DA 4A20A 4IWPA 4C0AA 5JXVA 3KW5B 4REZA 4LNKA 4XWWA 5D3IB 4J3OD 2Z8LA 1FD6A 2DZMA 1NEKB 2N1WA 2I2YA 4YTMB 3RNGC 1Q5WB 2KDIA 3I9V1 4IM0A 4BBKA 1TQZA 2PE6B 3RT3B 5EE1A 4L23A 1F2RC 1JRUA 4IAPA 1UGJA 3JW0X 2RGFA 4F7UP 5CX3A 3ENBA 2FAZA 1FXTB 1R4NB 2WXKA 1TTNA 1AWDA 1SIJA 5D3WA 2CU1A 2DKQA 1OY2A 4HXDA 3UIOB 4YSXB 3VR9B 2JU6X 4IM2A 1L6VA 1S3SG 3L17A 2P0FA 2CHXA 4HAXB 1F1HA 2LJ5A 1MIXA 1SGHA 3U8ZA 4F7HA 1GUAB 3Q3OC 3ETRA 4YL8A 4OVUA 4WJOA 3PZDA 1TS2A 1ZXIA 2WHIA 4PQ0A 4FHJA 4HAZB 4BAXA 1UEFA 3KY9A 4II2B 4DX8A 3H7PB 3KRXA 3AM9A 3NHEB 1FO4A 3E66A 3PEGA 4EMOA 3TEZA 4HAUB 1KTKA 2PIAA 1E7PB 3ODWA 4RGOS 1V89A 4G0NB 4FBJB 5L95C 3NUHB 2R09A 2JSVX 5CHVC 1U5GA 3KUDB 1D5MC 1PUTA 4CHJA 1LO5D 3IT4B 5KQ1A 2MDXA 4W9HA 4MGIE 2R2OA 1XF5L 1Z87A 2JWUA 3PLUA 3W5UB 4BVUC 1GJZA 2M8SA 1C77A 1ZPSA 2ONQA 4IDIA 2MA9B 3EGRA 1XD3B 5IO9A 5T8IA 2HD5B 1X1FA 5E6NA 3V6EB 2NS5A 1YN5A 1V97A 3ZRFA 4AJYB 2KMCA 2LXCA 1V61A 1WYWB 3NS8A 2C7NB 1NVID 3TUOA 4KSLC 4M02A 1KZ7A 3TEXA 1NDDA 2INNE 2B76B 2L0TA 2UU7A 5LLIA 4ASWC 3DQVA 1V86A 4JKBA 3NW8A 1YN4A 1TXDA 1GB4A 2M38A 3BVZA 3TBLD 1YQ4B 2KDFB 2QILA 4KHBB 4ZRPA 1V5OA 1KLUD 5GMVA 3ZNZB 4WAAA 1SSNA 3RULA 2SEBD 4RF1A 5GOWB 3BYYB 4M00A 2CKHB 3EA6A 4XWXA 4C80A 2K8BA 1KLVA 2WU5B 2K39A 1ZKHA 2PTLA 3AH7A 2W55A 1MHXA 2FCSA 4RM8A 1KLGD 1T0YA 4B9KA 2ACZB 5CLLB 2IO3B 2J53A 4K7UA 2WXRA 1YQ3B 2LGIA 4IC7B 1MHHE 5AZFA 1V1PA 3AECB 1G6JA 3X23A 3OANA 3TVVA 4TQ1A 3KWVA 1IUEA 2ZVOA 3AE6B 3UINB 4A6FA 2LUEA 4PS8A 3PG7A 3SEBA 2GJYA 2LGDA 2KX3A 4EZLA 2K6DB 3DVNU 5FI0A 1MI1A 2AWTA 3VRAB 4ILJA 2A4ZA 2L05A 2NTTA 2CQUA 2GS0A 2MP2B 4NQLB 3KYDD 5DCNA 5C1ZA 2RVBB 2LGXA 2VKIA 2KFJA 2W9NA 4HDOA 4C7ZA 1FFVA 5FK9C 3ML9A 4FJVB 3VVWB 3RYTA 2N9PC 1GC7A 2W3SA 2N7JA 2BTEA 2XN9C 5IOIA 3BJIA 5G5GA 2Z0DB 5FI1A 3KVFB 1R4MB 3SO6A 3SU8X 2BKRB 1PLSA 1D6EC 3AU5A 4JWUC 4K2OA 2MKRA 4DXGA 2FE8A 5DHFB 1XLOA 3ML4A 3NWDA 4BKTA 3MJ5A 1ZDVA 2WXMA 2D5GA 2J0JA 4N9F4 3PVWA 2FDQA 2DHIA 2YRYA 2KDMA 4XE0A 3W1SC 2DENB 4RGNA 3QCAA 2K2UA 2BT6A 3ZTCA 1JWUD 3B2GA 1WXQA 3QWZB 3SFDB 4MSMB 5AUIA 1D5XC 3I57A 3PRPB 1ET6A 4F8CB 2ADZA 2KHWB 2GB1A 2N9LA 2V3PA 2G35A 4OZBA 1UUPA 3OG5A 1HZ6A 1P9DU 2LXAA 3SHQA 1JQ4A 5KHQA 1L4ZB 4TSSA 1K52A 3AV8A 3NSUA 3UI3A 1E8YA
chains in the Genus database with same CATH topology
1Z2MA 1E7UA 2NR2A 3L13A 5LXIB 1NTYA 2MW5A 5D7GA 3ZO5B 4G50A 3RCZA 1DROA 1V81A 1MKEA 3JSVB 3D32A 2Y8GA 1MPHA 3VTWA 2L76A 3R66C 1RJ2A 2LYDA 4GIVA 3VUWA 5C79A 3VIAA 2M14A 3R7QA 5E6OA 4Y94A 1PQSA 5IAAC 4IWOA 2CY4A 4ILHA 5DPSA 1L2NA 4BKSA 2K1FA 2KTFA 4EZKA 2Y7BA 1EAZA 3VUYA 3LDZE 4JL9A 4W9LA 4NAWB 1WI0A 1FB8A 5HE2A 1K5DB 1WE7A 3N32A 3GYOA 1WXMA 4XC2A 2ROVA 2I5CA 1F9JA 3Q3JA 1EGXA 4G11A 3OAWA 4IOYX 3T9LA 3DBRI 1WM3A 2BWFA 5EFXA 2EJ8A 2MBHA 5JHBA 5CHWA 2FCMA 2FNJB 1Q0WB 4FA6A 2C5LC 2GMIC 4GDLA 2PPHA 2UZSA 4BBNC 1UGMA 2Z59B 3B08A 4A5KA 3LJ3A 3U30A 5D3XA 4BKGA 1WGDA 2MBEA 4DDGD 1GC6A 3V6CB 4KHOA 3H9DA 3W1YA 1YX5B 5LOPB 4GMXB 3LJUX 3TL5A 1E8ZA 3HM6X 4NJ7A 2ELBA 2DHZA 2KTRB 2IO1B 2I1KA 1WGGA 3FLVA 2MFQA 2WX0A 2KK8A 2IZVB 2CHWA 3T8MA 4W9FA 4G3XB 3V60A 2M1MA 3L0WB 1I2HA 2P0DA 1XT9B 4MH0E 4DHJB 2ZPYA 4K17A 2LWPA 1FAOA 3A9JB 1ZM0A 1I7AA 2KLGA 4GDKA 2ASQA 4MY6A 4E71A 2N23A 3APDA 3EPYA 2GBKA 3A4SC 2KJRA 2V3SA 4KIKB 2KX0A 5JLJB 2L8JA 4AOFA 1KOTA 3TW1A 4F7ZA 2Y5BB 1ZGUB 5C16A 2DZJA 3AU4A 3PS6A 1X1MA 4MGYE 1DIKA 2FCNA 3DDCB 4PS3A 4NQKE 4KVGB 2EMTA 4A3OA 4GPTB 2C7MB 4JK9A 4JQWC 2BCJA 1P3QU 3ZNID 2XBBC 1TBEA 4I6LB 2LG1A 2GOWA 5J2RA 3HQCA 1NU2A 3TO1A 2XK5A 1X86A 2KKCA 1EO6A 1U5FA 2WH5A 1R4NI 4WJPA 4A3PA 1L7YA 2Y8FA 1WMHA 5JZEB 4XX5A 3JYUA 4MDKE 3M1IB 4WVFB 2AEHA 1I35A 3OLMD 4Z2NA 1BTKA 1WGYA 1WX7A 1C1YB 4HPLB 1UNPA 5JHGA 2KMAA 1H4RA 3ZDMC 1V9JA 1ACAA 3KSYA 2RSUA 1FOEA 4CHMA 2KDEB 4A6HA 5HE1A 3JVZX 3TIXA 3DXDA 2JXXA 1Z5SB 3H7SA 1XCGA 1ZC3B 2KZRA 2L1CA 3EECA 3ZNHB 1UNRA 1QZEA 4KV2A 3PVUA 2V76A 3UQAA 4K2PA 2O6VA 2CS4A 1V6EA 3DXCA 2DYMA 1AQCA 2Z0PA 2JVCA 4DHJD 3QQ8B 2OTXA 4MT7A 4HWIB 2ZEQA 2YSZA 1LM8B 1WM2A 1P0RA 2ZJDA 4KHAA 2L0FA 5DHAB 4IM3A 2KD0A 1B55A 2JZZA 5CHFA 2EKEC 2RNRB 1RFAA 3HM3A 3SYXA 1YX6B 1IYFA 4ANWA 2NCNA 5E6PA 1WR6E 2YS5A 3L54A 4A6FB 3PTFC 2MCNB 2K2JA 5C5BA 2IY0B 2ZCCA 1TZ1A 3RUIB 4W9KA 4ANXA 4HLEA 2JRIB 1WY8A 3M3JA 2RQ1A 2N9EB 4EZJA 3PVLA 4GZUA 1H10A 3SV1A 1FHXA 3M95A 2KDBA 2DA0A 4EUTA 2CAYA 1UELA 3TCAA 5DPWA 1V5MA 2KLCA 1JDEA 5DH9B 2BWES 3KH0A 1V5PA 3ECIA 1RRPB 3HIZA 1MG8A 2FJLA 2COFA 2FJ9A 2NPTA 5DI9B 1DDVA 1PMSA 2DHKA 3C0RB 1R4MI 2MBQA 4W9EA 2IO0B 1E8WA 4GB9A 3M63B 4HDQA 1QQGA 3QARA 3P7ZA 3SBGA 2NBVB 2D9VA 2D11A 3OJ4B 2L2IA 1ISNA 2DYBA 4JLCA 1P3RA 3KYCD 2G45B 1GGOA 1XODA 5DIFB 1Q1OA 2KJ6A 1WZ0A 3RCPA 3H7PA 4PYUA 3B1LX 2AL6A 2DN6A 2NBUA 2GCLA 2KCJA 3R3MA 2YF0A 4A6KA 4AWJA 4W9CA 4GU2A 5J3YA 2G4SA 2GCJA 2D9YA 1LW3A 3IBEA 1OGWA 1I42A 4PNKA 2YS1A 5KQ4A 4ICVA 5D3VA 2GBMA 1VCBA 1WJ4A 3PLVA 4HB0B 2HJ8A 1C3TA 1OMWA 4NY0A 1U5DA 3H1UA 1WXVA 2N9XA 3A9KA 3UZTA 5BO4B 2D9ZA 3L16A 4HB2B 1BT0A 2I5FA 5FR6A 2WDTB 1MK7B 2FIFA 2JY6A 4MK0A 1P1AA 2N7DA 1E8XA 2HE7A 1N3HA 4DX90 3DBHI 3APCA 5HE0A 2D9XA 2GBRA 2DYOA 2LVOA 5LONB 2Z0EB 4MEMA 2X0SA 1WGRA 3EHVA 4IUMB 2LZ6A 3APFA 2K8CA 3MJWA 1HE8A 2D2QA 3V61A 1BTNA 2DHJA 2D07B 1DBHA 2L7RA 5JP4A 3TJPA 3DPDA 5CLQB 2IY1B 1EVHA 1KJTA 4BOSC 3WANA 1WJUA 4GSWA 2REXA 1U5EA 4K81A 3ULBA 3ZTDA 2ABDA 4E3CA 1WZ3A 3ENEA 1EF1A 2DIKA 1OEYJ 2RR9A 4IG7B 2MLBA 1WJNA 4KDIC 1XX0A 2JF5A 2NMBA 4CYEA 3BINA 1WXAA 2LI5A 2N4FA 2NVUI 4NNJB 2WYQA 4AP4C 4DBBA 4EEWA 2N7EA 4II3B 2ZNVB 2RLOA 2YT1A 4GDKB 1WJMA 1BAKA 2RGNB 3MTNB 4WQOB 3A4RA 1WFYA 2AL3A 3E9PA 5JVLA 3VHTC 4BKSD 3ZRCA 4JKCA 5JHHA 4DDID 3QC8B 3S2AA 4RMAA 1AWEA 2DZIA 1M7RA 1Y5OA 1OEYA 2DX5A 1E90A 2XEWA 2MBBB 2LVQA 3ZKJC 2OQBA 4XZ4A 2J59M 3FSSA 1Y8RC 2OJRA 3KUZA 1GNUA 3A1QA 3AXCA 1V80A 4MGKE 1AARA 3QX1A 3PT2B 2K6QA 1K8RB 2C7HA 1M94A 2L00B 3VXWA 2K00A 4W9IA 1WX8A 3WALA 3VTVA 1NTIA 1LQBA 4WJNA 4IW0A 4BOZB 3RZWC 2KQ7A 2KXJA 2WWZA 1U27A 3KUCB 2UWQA 2XK5B 4M0WB 3E9LA 1FGYA 2L3ZA 2CRFA 1UD7A 2KOXA 3ALBA 1WJ1A 5AEKB 3FP5A 2LBBA 1P5TA 1WMHB 3NY5A 3VDZA 2KJHB 1ZSQA 4JK7A 3QAQA 3FEHA 3Q3FA 4F1SA 3GOEA 1J0GA 2J0KA 1TJ6A 3CF6E 4W9GA 1XKEA 4HK2A 3X0WA 4NPNA 4MJSA 1FGZA 4JKGA 1HBKA 1HB6A 5IJMA 1LXDA 3TFMA 1EUVB 1UPRA 3SBTA 3SDLC 1NVLA 3ZVVA 2ELAA 1UBQA 2PE9A 1VBHA 2LVPA 2P0HA 3PHXB 2KWVB 1J19A 4JKHA 1V5UA 2O6VB 3PSEB 2IYDB 3ZVRA 1M7EA 1IRSA 1TGZB 2MSED 5J3QA 2UZRA 3HW2B 1D3ZA 4J6IA 2ZNVC 1DDWA 2MBOA 2PEAA 4L6EA 1ZVRA 3VTUA 1P98A 2R0DA 1P6SA 2LULA 2HTHA 1HB8A 2E2XA 1KM7A 1WGHA 1ZC4B 4M8MA 5EDSA 3I3TB 4HATB 2HRJA 2DX1A 1KI1B 2M4NA 2DLWA 2O2VA 3WIMA 3O96A 3ZUNA 1GG3A 2D10A 1PFJA 5C5BB 3ZDTA 1V88A 3WAPA 4JK8A 5D27A 4FULA 4LDTB 5DPRA 3QIJA 3GYPA 4HHVA 3CSFA 5D2MB 4FJZA 5TR5A 1OQNA 4I6PA 5KHOA 4PYZA 1MK9B 1XR0B 2MWNB 2BGFA 5AZGA 2KFKA 1UPQA 2BYFA 1XQQA 4DHZB 1RRBA 4H8SA 4W9DA 4BFRA 1W1DA 5HKHA 3DCGA 2M17A 4DK5A 4TV3A 3K9PB 3VH3B 2JZ3B 2DTCA 3CMMB 2BYEA 2NPTB 4AUQC 2X18A 3KZ1A 2JP2A 1NBFC 2K25A 1U2BA 4I6NB 4JGHB 2NZ8B 3VFKA 3A8PA 4JIOU 3DOWA 5G2NA 4GXBA 3DBLI 4KAXB 4PS7A 1J8CA 4KZ0A 1V49A 2MQJA 5G55A 3CSTA 2DYNA 2BKFA 2FUHB 3OJ3A 2J7QB 1OQYA 2COPA 3K9OB 2C60A 4GGQA 2FCQA 2O6VD 2JWZA 1WE6A 2D3GA 3SD5A 1U4AA 4TYZA 1NTVA 1SE9A 4GMVA 1Q67A 3UGBB 5DPTA 2C9WB 2D4QA 2M0XA 1VBGA 2JUOA 2IYBA 4B95A 3V5WA 4EKUA 3EFUA 3HHMA 2KQSA 3CXBB 3NZSA 2KC2A 2ZVNA 2VRRB 1CMXB 1VD2A 2KUPA 3ZIMA 3D8EA 4CHKA 2LRUA 4HB4B 3A9KB 2CY5A 3E9OA 1E5WA 4LDTD 3IG3A 3N30A 4WWOA 4B6WA 3UQBA 3WAOA 5L81A 2J0MA 3ODXA 2YVCA 4HCNB 2RSGA 1SIFA 3CIKA 1RAXA 3RD2A 2LGYA 1ST7A 4EOYA 1H8CA 4FADA 4ZRJA 5CTRC 1KC7A 2ZPNA 1YD8U 1DDMA 4AJWA 5JHAA 2KWCA 4TUUA 4HAVB 2IBIB 4DHZE 1WVHA 5J18A 3PGEA 4D0NB 1FHOA 3W1SA 5JH5C 3PV1A 3WAMA 3ULCA 2IO2B 2JRHA 2LRWA 1U29A 3HK0A 2YLMA 1J0WA 3T06A 4HAWB 4EFOA 3PRMB 1WF9A 2KANA 3QK0A 2CODA 1WH3A 1YJ1A 4X57B 3A33B 4IFSA 1S1QB 5AZHA 2YS3A 1OTRB 3AJ4A 4ANVA 2QHOA 1W1HA 3DVGX 3L08A 2BF8B 1MIZB 1IP9A 5KCVA 3H6NA 3PRZA 4WJQA 2JPHA 2KNBA 2H7EA 2DAJA 4WWPA 1MAIA 3P2BA 3ODOA 2PJHA 5C6RA 2BPSA 2GBNA 2CB8A 2ROZB 4FLHA 5D3YA 4FJYA 2QKLA 2V4LA 4GOCA 2D9WA 3KRWA 1WXSA 2ZZPB 1K5GB 3DVNV 3B0AA 2KO3A 3D8FA 4GDLB 1YQBA 2DX5B 4MSQB 1Y19B 3AI5A 4K7SA 2B3AA 4HB3B 3L10B 2AYOB 3A1QB 1X11A 1WX9A 3V62A 4RM9A 4KDLB 2EC1A 2KWUB 1XD4A 3MDBC 1UNQA 1WI1A 3ZW3A 5IA7A 2PZ1A 1FHWA 1LB1A 3U7DA 3GZNI 4HPMB 1UZXB 5D6JB 2CR5A 3IHPC 2LD9A 4WSFA 5L83A 2GBJA 2LASA 2MP2A 1UH6A 4GN1A 4ICUA 4F7GA 4YONA 4B6HA 3ZNGC 4CO7A 2JT4B 2RD0A 3TMPB 3EC8A 4K1RB 2KGXB 4NSWA 4JKDA 3SNHA 4ZRIA 1WRDB 3DBSA 1V5TA 1W1GA 3D8DA 1WIAA 4MJSB 3MHSD 4JKGB 2RUKB 2R82A 1QC6A 1DYNA 3SUZA 3BY4B 2RPQA 3DVGY 1NI2A 2R2QA 2NBWB 1A5RA 4WJ7A 4LJPB 4NJ6A 4E74A 4ZYNA 1KBLA 3UIPB 2DFKA 3IVFA 4ANUA 2CHZA 2OOBB 3M62B 4DWFA 1WGUA 4P7IA 5J3TA 3A98B 3JSVA 4KZCA 2V1YA 2COAA 5D94A 3UF8A 2ZCBA 1RLFA 1YIWA 2HTHB 1WR1A 3F0WA 3VUXA 3ONSA 2O2VB 3IFWB 2LOZA 2N1VA 4ILGB 1E7VA 2KVRA 3WA0A 2LOXA 1ZW7A 4HCPB 4K7WA 5J17A 4NAWA 2Z0QA 3G9WA 3A8QA 4JKEA 4Z2MB 3PPAA 3P6AA 1WGQA 2DYQA 2LKOA 1KZGA 3QWMA 2KFKB 4KSKC 4WWNA 4MGZE 4OVVA 3QBVB 2UVMA 4DBGA 1IPGA 2P8VA 4EJNA 3QJZA 5HE3A 4URKA 4JKAA 3ZLZA 2YT0A 2Z0OA 4ZDVA 3F5RA 2KN5A 2N0YA 4HAYB 4JKFA 2K8HA 4HVBA 3PP2A 2MWSB 3FM8C 4TKNA 4HJKA 3MPXA 2QKMA 3ML8A 4TQ0A 4W9JA 2DKPA 3AULA 3DXEA 1EF5A 2KC1A 1UBIA 3N7CA 2VSZA 2COCA 4LJOB 2G4DB 2W2WA 3NZUA 1WG7A 3VH4B 4BBNF 3QA8A 5LXHA 3QHTA 3PSCA 4LCDE 1BWNA 2Q13A 4FN2A 3RZFA 4M8NA 3N3KB 1WJ6A 2A5UA 3PREA 4IWQA 3VAWA 1SHCA 2KTRA 2FIDA 1V2YA 2MX2A 2G3QB 2MRPA 5C23A 2IFSA 2W2XD 3WYFB 2DAFA 3PHWB 3R7RA 1X05A 3O65B 4MM3A 1X1GA 2W2XC 2XQNM 1LFDA 3VOQA 4FHKA 2DZKA 4ZRKA 3A9JA 4MELA 3NOBA 2VRWB 2BYVE 3VQIA 2I1JA 2WX1A 4KIKA 2EMSA 2UYZB 4DXAB 2H7DA 4A20A 4IWPA 4C0AA 3KW5B 2DZMA 2N1WA 1Q5WB 2KDIA 4IM0A 4BBKA 1TQZA 2PE6B 3RT3B 1JRUA 4IAPA 3JW0X 2RGFA 4F7UP 5CX3A 3ENBA 2FAZA 1FXTB 1TTNA 5D3WA 2CU1A 2DKQA 1OY2A 4HXDA 3UIOB 4IM2A 1S3SG 3L17A 2P0FA 2CHXA 4HAXB 2LJ5A 1MIXA 1SGHA 3U8ZA 4F7HA 1GUAB 4YL8A 4OVUA 4WJOA 3PZDA 4PQ0A 4FHJA 4HAZB 1UEFA 3KY9A 4II2B 4DX8A 3H7PB 3KRXA 3NHEB 3E66A 3PEGA 4EMOA 4HAUB 3ODWA 1V89A 4G0NB 4FBJB 5L95C 2R09A 5CHVC 1U5GA 3KUDB 4CHJA 5KQ1A 2MDXA 4W9HA 4MGIE 2R2OA 1Z87A 3PLUA 4BVUC 1GJZA 2M8SA 2MA9B 1XD3B 2HD5B 1X1FA 5E6NA 3V6EB 2NS5A 3ZRFA 4AJYB 2KMCA 2LXCA 1V61A 1WYWB 3NS8A 2C7NB 4KSLC 1KZ7A 1NDDA 5LLIA 2L0TA 4ASWC 3DQVA 1V86A 4JKBA 1TXDA 2M38A 3TBLD 2KDFB 4KHBB 1V5OA 5GMVA 3ZNZB 4WAAA 3RULA 5GOWB 2CKHB 4XWXA 1KLVA 2K8BA 2K39A 1ZKHA 2FCSA 4RM8A 1T0YA 4B9KA 5CLLB 2IO3B 4K7UA 4IC7B 5AZFA 1G6JA 3X23A 3OANA 3TVVA 4TQ1A 2ZVOA 3UINB 4A6FA 2LUEA 4PS8A 3PG7A 2GJYA 2LGDA 2KX3A 4EZLA 2K6DB 3DVNU 5FI0A 2AWTA 4ILJA 2A4ZA 2L05A 2CQUA 2GS0A 2MP2B 4NQLB 3KYDD 5DCNA 5C1ZA 2RVBB 2LGXA 2VKIA 2KFJA 2W9NA 4HDOA 3ML9A 4FJVB 3VVWB 3RYTA 2N9PC 1GC7A 3BJIA 2Z0DB 5FI1A 3KVFB 3SO6A 3SU8X 2BKRB 1PLSA 3AU5A 4K2OA 2MKRA 5DHFB 3ML4A 4BKTA 2J0JA 4N9F4 3PVWA 2FDQA 2DHIA 2YRYA 3W1SC 2DENB 3QCAA 2K2UA 3ZTCA 3QWZB 4MSMB 3PRPB 4F8CB 2ADZA 2KHWB 2G35A 1P9DU 2LXAA 3SHQA 5KHQA 3NSUA 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2M A;  1E7U A;  2NR2 A;  3L13 A;  5LXI B;  1NTY A;  2MW5 A;  5D7G A;  3ZO5 B;  4G50 A;  3RCZ A;  1DRO A;  1V81 A;  1MKE A;  3JSV B;  3D32 A;  2Y8G A;  1MPH A;  3VTW A;  2L76 A;  3R66 C;  1RJ2 A;  2LYD A;  4GIV A;  3VUW A;  5C79 A;  3VIA A;  2M14 A;  3R7Q A;  5E6O A;  4Y94 A;  1PQS A;  5IAA C;  4IWO A;  2CY4 A;  5DPS A;  1L2N A;  4BKS A;  2K1F A;  2KTF A;  4EZK A;  2Y7B A;  1EAZ A;  3VUY A;  3LDZ E;  4JL9 A;  4W9L A;  4NAW B;  1WI0 A;  1FB8 A;  5HE2 A;  1K5D B;  1WE7 A;  3N32 A;  3GYO A;  1WXM A;  4XC2 A;  2ROV A;  2I5C A;  1F9J A;  3Q3J A;  1EGX A;  4G11 A;  3OAW A;  4IOY X;  3T9L A;  3DBR I;  1WM3 A;  2BWF A;  5EFX A;  2EJ8 A;  2MBH A;  5JHB A;  5CHW A;  2FCM A;  2FNJ B;  1Q0W B;  4FA6 A;  2C5L C;  2GMI C;  4GDL A;  2PPH A;  2UZS A;  4BBN C;  1UGM A;  2Z59 B;  3B08 A;  4A5K A;  3LJ3 A;  3U30 A;  5D3X A;  4BKG A;  1WGD A;  2MBE A;  4DDG D;  1GC6 A;  3V6C B;  4KHO A;  3H9D A;  3W1Y A;  1YX5 B;  5LOP B;  4GMX B;  3LJU X;  3TL5 A;  1E8Z A;  3HM6 X;  4NJ7 A;  2ELB A;  2DHZ A;  2KTR B;  2IO1 B;  2I1K A;  1WGG A;  2MFQ A;  2WX0 A;  2KK8 A;  2IZV B;  2CHW A;  3T8M A;  4W9F A;  4G3X B;  3V60 A;  2M1M A;  3L0W B;  1I2H A;  2P0D A;  1XT9 B;  4MH0 E;  4DHJ B;  2ZPY A;  4K17 A;  2LWP A;  1FAO A;  3A9J B;  1ZM0 A;  1I7A A;  2KLG A;  4GDK A;  2ASQ A;  4MY6 A;  4E71 A;  2N23 A;  3APD A;  2GBK A;  3A4S C;  2KJR A;  2V3S A;  4KIK B;  2KX0 A;  5JLJ B;  2L8J A;  4AOF A;  1KOT A;  3TW1 A;  4F7Z A;  2Y5B B;  1ZGU B;  5C16 A;  2DZJ A;  3AU4 A;  3PS6 A;  1X1M A;  4MGY E;  2FCN A;  3DDC B;  4PS3 A;  4NQK E;  4KVG B;  2EMT A;  4A3O A;  4GPT B;  2C7M B;  4JQW C;  2BCJ A;  1P3Q U;  3ZNI D;  2XBB C;  1TBE A;  4I6L B;  2LG1 A;  2GOW A;  5J2R A;  3HQC A;  1NU2 A;  3TO1 A;  2XK5 A;  1X86 A;  2KKC A;  1EO6 A;  1U5F A;  1R4N I;  4WJP A;  4A3P A;  1L7Y A;  2Y8F A;  1WMH A;  5JZE B;  4XX5 A;  3JYU A;  4MDK E;  3M1I B;  4WVF B;  2AEH A;  1I35 A;  4Z2N A;  3OLM D;  1BTK A;  1WGY A;  1WX7 A;  1C1Y B;  4HPL B;  1UNP A;  5JHG A;  2KMA A;  1H4R A;  3ZDM C;  1V9J A;  3KSY A;  2RSU A;  1FOE A;  4CHM A;  2KDE B;  4A6H A;  5HE1 A;  3JVZ X;  3TIX A;  3DXD A;  2JXX A;  1Z5S B;  3H7S A;  1XCG A;  1ZC3 B;  2KZR A;  2L1C A;  3EEC A;  3ZNH B;  1UNR A;  1QZE A;  4KV2 A;  3PVU A;  2V76 A;  3UQA A;  4K2P A;  2O6V A;  2CS4 A;  1V6E A;  3DXC A;  2DYM A;  1AQC A;  2Z0P A;  2JVC A;  4DHJ D;  3QQ8 B;  2OTX A;  4MT7 A;  4HWI B;  2ZEQ A;  2YSZ A;  1LM8 B;  1WM2 A;  1P0R A;  2ZJD A;  4KHA A;  2L0F A;  5DHA B;  4IM3 A;  2KD0 A;  1B55 A;  2JZZ A;  5CHF A;  2EKE C;  2RNR B;  1RFA A;  3HM3 A;  3SYX A;  1YX6 B;  1IYF A;  4ANW A;  2NCN A;  5E6P A;  1WR6 E;  2YS5 A;  3L54 A;  4A6F B;  3PTF C;  2MCN B;  2K2J A;  5C5B A;  2IY0 B;  2ZCC A;  1TZ1 A;  3RUI B;  4W9K A;  4ANX A;  4HLE A;  2JRI B;  1WY8 A;  3M3J A;  2N9E B;  4EZJ A;  3PVL A;  4GZU A;  1H10 A;  3SV1 A;  1FHX A;  3M95 A;  2KDB A;  2DA0 A;  4EUT A;  2CAY A;  1UEL A;  3TCA A;  5DPW A;  1V5M A;  2KLC A;  5DH9 B;  2BWE S;  3KH0 A;  1V5P A;  3ECI A;  1RRP B;  3HIZ A;  1MG8 A;  2FJL A;  2COF A;  2NPT A;  5DI9 B;  1DDV A;  1PMS A;  2DHK A;  3C0R B;  1R4M I;  2MBQ A;  4W9E A;  2IO0 B;  1E8W A;  4GB9 A;  3M63 B;  4HDQ A;  1QQG A;  3QAR A;  3P7Z A;  2NBV B;  2D9V A;  2D11 A;  3OJ4 B;  2L2I A;  1ISN A;  2DYB A;  4JLC A;  1P3R A;  3KYC D;  2G45 B;  1XOD A;  5DIF B;  1Q1O A;  2KJ6 A;  1WZ0 A;  3RCP A;  3H7P A;  4PYU A;  3B1L X;  2AL6 A;  2DN6 A;  2NBU A;  2GCL A;  2KCJ A;  3R3M A;  2YF0 A;  4A6K A;  4AWJ A;  4W9C A;  4GU2 A;  5J3Y A;  2G4S A;  2GCJ A;  2D9Y A;  1LW3 A;  3IBE A;  1OGW A;  1I42 A;  4PNK A;  2YS1 A;  5KQ4 A;  4ICV A;  5D3V A;  2GBM A;  1VCB A;  1WJ4 A;  3PLV A;  4HB0 B;  2HJ8 A;  1C3T A;  1OMW A;  4NY0 A;  1U5D A;  3H1U A;  1WXV A;  2N9X A;  3A9K A;  3UZT A;  5BO4 B;  2D9Z A;  3L16 A;  4HB2 B;  1BT0 A;  2I5F A;  5FR6 A;  2WDT B;  1MK7 B;  2FIF A;  2JY6 A;  4MK0 A;  1P1A A;  2N7D A;  1E8X A;  2HE7 A;  1N3H A;  4DX9 0;  3DBH I;  3APC A;  5HE0 A;  2D9X A;  2GBR A;  2DYO A;  2LVO A;  5LON B;  2Z0E B;  4MEM A;  1WGR A;  3EHV A;  4IUM B;  2LZ6 A;  3APF A;  2K8C A;  3MJW A;  1HE8 A;  2D2Q A;  3V61 A;  1BTN A;  2DHJ A;  2D07 B;  1DBH A;  2L7R A;  5JP4 A;  3TJP A;  3DPD A;  5CLQ B;  2IY1 B;  1EVH A;  1KJT A;  4BOS C;  3WAN A;  1WJU A;  4GSW A;  2REX A;  1U5E A;  4K81 A;  3ULB A;  3ZTD A;  4E3C A;  1WZ3 A;  3ENE A;  1EF1 A;  1OEY J;  2RR9 A;  4IG7 B;  2MLB A;  1WJN A;  4KDI C;  1XX0 A;  2JF5 A;  2NMB A;  4CYE A;  3BIN A;  1WXA A;  2LI5 A;  2N4F A;  2NVU I;  4NNJ B;  2WYQ A;  4AP4 C;  4DBB A;  4EEW A;  2N7E A;  4II3 B;  2ZNV B;  2RLO A;  2YT1 A;  4GDK B;  1WJM A;  1BAK A;  2RGN B;  3MTN B;  4WQO B;  3A4R A;  1WFY A;  2AL3 A;  4BKS D;  3VHT C;  3ZRC A;  5JHH A;  4DDI D;  3QC8 B;  3S2A A;  4RMA A;  1AWE A;  2DZI A;  1M7R A;  1Y5O A;  1OEY A;  2DX5 A;  1E90 A;  2XEW A;  2MBB B;  2LVQ A;  3ZKJ C;  2OQB A;  4XZ4 A;  2J59 M;  3FSS A;  1Y8R C;  2OJR A;  3KUZ A;  1GNU A;  3A1Q A;  3AXC A;  1V80 A;  4MGK E;  1AAR A;  3QX1 A;  3PT2 B;  2K6Q A;  1K8R B;  2C7H A;  1M94 A;  2L00 B;  3VXW A;  2K00 A;  4W9I A;  3WAL A;  1WX8 A;  3VTV A;  1LQB A;  4WJN A;  4IW0 A;  4BOZ B;  3RZW C;  2KQ7 A;  2KXJ A;  2WWZ A;  1U27 A;  3KUC B;  2UWQ A;  2XK5 B;  4M0W B;  1FGY A;  2L3Z A;  2CRF A;  1UD7 A;  2KOX A;  3ALB A;  1WJ1 A;  5AEK B;  1P5T A;  1WMH B;  3NY5 A;  3VDZ A;  2KJH B;  1ZSQ A;  3QAQ A;  3FEH A;  3Q3F A;  4F1S A;  3GOE A;  1J0G A;  2J0K A;  1TJ6 A;  3CF6 E;  4W9G A;  1XKE A;  4HK2 A;  3X0W A;  4NPN A;  4MJS A;  1FGZ A;  1LXD A;  3TFM A;  1EUV B;  1UPR A;  3SDL C;  3ZVV A;  2ELA A;  1UBQ A;  2PE9 A;  2LVP A;  2P0H A;  3PHX B;  2KWV B;  1J19 A;  1V5U A;  2O6V B;  3PSE B;  2IYD B;  3ZVR A;  1M7E A;  1IRS A;  1TGZ B;  2MSE D;  5J3Q A;  2UZR A;  3HW2 B;  1D3Z A;  4J6I A;  2ZNV C;  1DDW A;  2MBO A;  2PEA A;  4L6E A;  1ZVR A;  3VTU A;  1P98 A;  2R0D A;  1P6S A;  2LUL A;  2HTH A;  2E2X A;  1KM7 A;  1WGH A;  1ZC4 B;  4M8M A;  5EDS A;  3I3T B;  4HAT B;  2DX1 A;  1KI1 B;  2M4N A;  2DLW A;  2O2V A;  3WIM A;  3O96 A;  3ZUN A;  1GG3 A;  2D10 A;  1PFJ A;  5C5B B;  3ZDT A;  1V88 A;  3WAP A;  5D27 A;  4FUL A;  4LDT B;  5DPR A;  3QIJ A;  3GYP A;  4HHV A;  3CSF A;  5D2M B;  4FJZ A;  5TR5 A;  1OQN A;  4I6P A;  5KHO A;  4PYZ A;  1MK9 B;  1XR0 B;  2MWN B;  2BGF A;  5AZG A;  2KFK A;  1UPQ A;  2BYF A;  1XQQ A;  4DHZ B;  1RRB A;  4H8S A;  4W9D A;  4BFR A;  1W1D A;  5HKH A;  3DCG A;  2M17 A;  4DK5 A;  4TV3 A;  3K9P B;  3VH3 B;  2JZ3 B;  2DTC A;  3CMM B;  2BYE A;  2NPT B;  4AUQ C;  3KZ1 A;  2X18 A;  2JP2 A;  1NBF C;  2K25 A;  1U2B A;  4I6N B;  4JGH B;  2NZ8 B;  3VFK A;  3A8P A;  4JIO U;  3DOW A;  5G2N A;  4GXB A;  3DBL I;  4KAX B;  4PS7 A;  1J8C A;  4KZ0 A;  1V49 A;  2MQJ A;  5G55 A;  3CST A;  2DYN A;  2BKF A;  2FUH B;  3OJ3 A;  2J7Q B;  1OQY A;  3K9O B;  2C60 A;  4GGQ A;  2FCQ A;  2O6V D;  2JWZ A;  1WE6 A;  2D3G A;  3SD5 A;  1U4A A;  4TYZ A;  1NTV A;  1SE9 A;  4GMV A;  1Q67 A;  3UGB B;  5DPT A;  2C9W B;  2D4Q A;  2M0X A;  2JUO A;  2IYB A;  4B95 A;  3V5W A;  4EKU A;  3EFU A;  3HHM A;  2KQS A;  3CXB B;  3NZS A;  2KC2 A;  2ZVN A;  2VRR B;  1CMX B;  1VD2 A;  2KUP A;  3ZIM A;  3D8E A;  4CHK A;  2LRU A;  4HB4 B;  3A9K B;  2CY5 A;  1E5W A;  4LDT D;  3IG3 A;  3N30 A;  4WWO A;  4B6W A;  3UQB A;  3WAO A;  5L81 A;  3ODX A;  2J0M A;  2YVC A;  4HCN B;  2RSG A;  1SIF A;  3CIK A;  1RAX A;  3RD2 A;  2LGY A;  4EOY A;  1H8C A;  4FAD A;  4ZRJ A;  5CTR C;  2ZPN A;  1YD8 U;  4AJW A;  1DDM A;  5JHA A;  2KWC A;  4TUU A;  4HAV B;  2IBI B;  4DHZ E;  1WVH A;  5J18 A;  3PGE A;  4D0N B;  1FHO A;  3W1S A;  5JH5 C;  3PV1 A;  3WAM A;  3ULC A;  2IO2 B;  2JRH A;  2LRW A;  1U29 A;  3HK0 A;  2YLM A;  1J0W A;  3T06 A;  4HAW B;  4EFO A;  3PRM B;  1WF9 A;  2KAN A;  3QK0 A;  2COD A;  1WH3 A;  1YJ1 A;  4X57 B;  3A33 B;  4IFS A;  1S1Q B;  5AZH A;  2YS3 A;  1OTR B;  3AJ4 A;  4ANV A;  2QHO A;  1W1H A;  3DVG X;  3L08 A;  2BF8 B;  1MIZ B;  1IP9 A;  5KCV A;  3H6N A;  3PRZ A;  4WJQ A;  2JPH A;  2KNB A;  2H7E A;  2DAJ A;  4WWP A;  1MAI A;  3P2B A;  3ODO A;  2PJH A;  5C6R A;  2BPS A;  2GBN A;  2ROZ B;  4FLH A;  5D3Y A;  4FJY A;  2QKL A;  2V4L A;  4GOC A;  2D9W A;  3KRW A;  1WXS A;  2ZZP B;  1K5G B;  3DVN V;  3B0A A;  2KO3 A;  3D8F A;  4GDL B;  1YQB A;  2DX5 B;  4MSQ B;  1Y19 B;  3AI5 A;  4K7S A;  2B3A A;  4HB3 B;  3L10 B;  2AYO B;  3A1Q B;  1X11 A;  1WX9 A;  3V62 A;  4RM9 A;  4KDL B;  2EC1 A;  2KWU B;  1XD4 A;  3MDB C;  1UNQ A;  1WI1 A;  3ZW3 A;  5IA7 A;  2PZ1 A;  1FHW A;  1LB1 A;  3U7D A;  3GZN I;  4HPM B;  1UZX B;  5D6J B;  2CR5 A;  3IHP C;  2LD9 A;  4WSF A;  5L83 A;  2GBJ A;  2LAS A;  2MP2 A;  1UH6 A;  4GN1 A;  4ICU A;  4F7G A;  4YON A;  4B6H A;  3ZNG C;  4CO7 A;  2JT4 B;  2RD0 A;  3TMP B;  3EC8 A;  4K1R B;  2KGX B;  4NSW A;  3SNH A;  4ZRI A;  1WRD B;  3DBS A;  1V5T A;  1W1G A;  3D8D A;  1WIA A;  4MJS B;  3MHS D;  2RUK B;  1QC6 A;  1DYN A;  3SUZ A;  3BY4 B;  2RPQ A;  3DVG Y;  1NI2 A;  2R2Q A;  2NBW B;  1A5R A;  4WJ7 A;  4LJP B;  4NJ6 A;  4E74 A;  4ZYN A;  3UIP B;  2DFK A;  3IVF A;  4ANU A;  2CHZ A;  2OOB B;  3M62 B;  4DWF A;  1WGU A;  4P7I A;  5J3T A;  3A98 B;  3JSV A;  4KZC A;  2V1Y A;  2COA A;  5D94 A;  3UF8 A;  2ZCB A;  1RLF A;  1YIW A;  2HTH B;  1WR1 A;  3F0W A;  3VUX A;  3ONS A;  2O2V B;  3IFW B;  2LOZ A;  2N1V A;  1E7V A;  2KVR A;  3WA0 A;  2LOX A;  1ZW7 A;  4HCP B;  4K7W A;  5J17 A;  4NAW A;  2Z0Q A;  3G9W A;  3A8Q A;  4Z2M B;  3PPA A;  3P6A A;  1WGQ A;  2DYQ A;  2LKO A;  1KZG A;  3QWM A;  2KFK B;  4KSK C;  4WWN A;  4MGZ E;  4OVV A;  3QBV B;  2UVM A;  4DBG A;  1IPG A;  2P8V A;  4EJN A;  3QJZ A;  5HE3 A;  4URK A;  3ZLZ A;  2YT0 A;  2Z0O A;  4ZDV A;  3F5R A;  2KN5 A;  2N0Y A;  4HAY B;  2K8H A;  4HVB A;  3PP2 A;  2MWS B;  3FM8 C;  4TKN A;  4HJK A;  3MPX A;  2QKM A;  3ML8 A;  4TQ0 A;  4W9J A;  2DKP A;  3AUL A;  3DXE A;  1EF5 A;  2KC1 A;  1UBI A;  3N7C A;  2VSZ A;  2COC A;  4LJO B;  2G4D B;  2W2W A;  3NZU A;  1WG7 A;  3VH4 B;  4BBN F;  3QA8 A;  5LXH A;  3QHT A;  3PSC A;  4LCD E;  1BWN A;  2Q13 A;  4FN2 A;  3RZF A;  4M8N A;  3N3K B;  1WJ6 A;  2A5U A;  3PRE A;  4IWQ A;  3VAW A;  1SHC A;  2KTR A;  2FID A;  1V2Y A;  2MX2 A;  2G3Q B;  2MRP A;  5C23 A;  2IFS A;  2W2X D;  3WYF B;  2DAF A;  3PHW B;  3R7R A;  1X05 A;  3O65 B;  4MM3 A;  1X1G A;  2W2X C;  2XQN M;  1LFD A;  3VOQ A;  4FHK A;  2DZK A;  4ZRK A;  3A9J A;  4MEL A;  3NOB A;  2VRW B;  2BYV E;  3VQI A;  2I1J A;  2WX1 A;  4KIK A;  2EMS A;  2UYZ B;  4DXA B;  2H7D A;  4A20 A;  4IWP A;  4C0A A;  3KW5 B;  2DZM A;  2N1W A;  1Q5W B;  2KDI A;  4IM0 A;  4BBK A;  1TQZ A;  2PE6 B;  3RT3 B;  1JRU A;  4IAP A;  3JW0 X;  2RGF A;  4F7U P;  5CX3 A;  2FAZ A;  1FXT B;  1TTN A;  5D3W A;  2CU1 A;  2DKQ A;  1OY2 A;  4HXD A;  3UIO B;  4IM2 A;  1S3S G;  3L17 A;  2P0F A;  2CHX A;  4HAX B;  2LJ5 A;  1MIX A;  1SGH A;  3U8Z A;  4F7H A;  1GUA B;  4YL8 A;  4OVU A;  4WJO A;  3PZD A;  4PQ0 A;  4FHJ A;  4HAZ B;  1UEF A;  3KY9 A;  4II2 B;  4DX8 A;  3H7P B;  3KRX A;  3NHE B;  3PEG A;  4EMO A;  4HAU B;  3ODW A;  1V89 A;  4G0N B;  4FBJ B;  5L95 C;  2R09 A;  5CHV C;  1U5G A;  3KUD B;  4CHJ A;  5KQ1 A;  2MDX A;  4W9H A;  4MGI E;  2R2O A;  1Z87 A;  3PLU A;  4BVU C;  1GJZ A;  2M8S A;  2MA9 B;  1XD3 B;  2HD5 B;  1X1F A;  5E6N A;  3V6E B;  2NS5 A;  3ZRF A;  4AJY B;  2KMC A;  2LXC A;  1V61 A;  1WYW B;  3NS8 A;  2C7N B;  4KSL C;  1KZ7 A;  1NDD A;  5LLI A;  2L0T A;  4ASW C;  3DQV A;  1V86 A;  1TXD A;  2M38 A;  3TBL D;  2KDF B;  4KHB B;  1V5O A;  5GMV A;  3ZNZ B;  4WAA A;  3RUL A;  5GOW B;  2CKH B;  4XWX A;  1KLV A;  2K8B A;  2K39 A;  1ZKH A;  2FCS A;  4RM8 A;  1T0Y A;  4B9K A;  5CLL B;  2IO3 B;  4K7U A;  4IC7 B;  5AZF A;  1G6J A;  3OAN A;  3X23 A;  3TVV A;  4TQ1 A;  2ZVO A;  3UIN B;  4A6F A;  2LUE A;  4PS8 A;  3PG7 A;  2GJY A;  2LGD A;  2KX3 A;  4EZL A;  2K6D B;  3DVN U;  5FI0 A;  2AWT A;  2A4Z A;  2L05 A;  2GS0 A;  2MP2 B;  4NQL B;  3KYD D;  5DCN A;  5C1Z A;  2RVB B;  2LGX A;  2VKI A;  2KFJ A;  2W9N A;  4HDO A;  3ML9 A;  4FJV B;  3VVW B;  3RYT A;  2N9P C;  1GC7 A;  3BJI A;  2Z0D B;  5FI1 A;  3KVF B;  3SO6 A;  3SU8 X;  2BKR B;  1PLS A;  3AU5 A;  4K2O A;  2MKR A;  5DHF B;  3ML4 A;  4BKT A;  2J0J A;  4N9F 4;  3PVW A;  2DHI A;  2YRY A;  3W1S C;  2DEN B;  3QCA A;  2K2U A;  3ZTC A;  3QWZ B;  4MSM B;  3PRP B;  4F8C B;  2ADZ A;  2KHW B;  2G35 A;  1P9D U;  2LXA A;  3SHQ A;  5KHQ A;  3NSU A;  1E8Y A; 
#chains in the Genus database with same CATH topology
 1Z2M A;  3PO0 A;  1E7U A;  2NR2 A;  4C7Y A;  3P4S B;  3BYT B;  3L13 A;  5LXI B;  1NTY A;  2MW5 A;  5D7G A;  2IDY A;  1N6Z A;  2OJW A;  3ZO5 B;  4G50 A;  3RCZ A;  2NBV A;  1I7H A;  3MC0 B;  4XDC A;  1DRO A;  1V81 A;  1MKE A;  3JSV B;  4P1C C;  3D32 A;  3Q14 C;  1SE3 A;  2K3U A;  2Y8G A;  1MPH A;  3VTW A;  2RDG A;  5C3J B;  2L76 A;  3R66 C;  1RJ2 A;  3FIL A;  3Q6B A;  3MP9 A;  2Y5C A;  2LYD A;  2W3R A;  4GIV A;  3VUW A;  3DCX A;  5C79 A;  1JCK B;  3R8B A;  2K8E A;  3NWF A;  3VIA A;  2M14 A;  3R7Q A;  4JPS A;  5E6O A;  4Y94 A;  4A8X C;  1PQS A;  5IAA C;  4IWO A;  2CY4 A;  1KF6 B;  4ILH A;  3P4R B;  5DPS A;  1L2N A;  2PKO A;  4BKS A;  2K1F A;  2KTF A;  4EZK A;  2Y7B A;  1EAZ A;  3VUY A;  3LDZ E;  4JL9 A;  4W9L A;  4NAW B;  1WI0 A;  1ZYI A;  4USA A;  1FB8 A;  5HE2 A;  2D3B A;  2DBY A;  1QKZ A;  1K5D B;  1VLB A;  3DBH B;  1WE7 A;  3N32 A;  3GYO A;  1WXM A;  4ITK A;  4XC2 A;  2ROV A;  2I5C A;  1F9J A;  3LYY A;  3Q3J A;  1EGX A;  4G11 A;  1RYJ A;  3OAW A;  4IOY X;  3T9L A;  3DBR I;  3I63 C;  1WM3 A;  2BWF A;  5EFX A;  2EJ8 A;  2MBH A;  5JHB A;  5CHW A;  2FCM A;  4KGT A;  4H2A A;  2FNJ B;  1JWM D;  1Q0W B;  2QMT A;  2VZK D;  1NEN B;  4FA6 A;  5BYQ A;  3P4P B;  2C5L C;  2GMI C;  4GDL A;  1E9M A;  2PPH A;  3DHG C;  3AE3 B;  2UZS A;  4BBN C;  1UGM A;  2Z59 B;  3B08 A;  4A5K A;  4A6Q A;  3LJ3 A;  1CK1 A;  3U30 A;  5D3X A;  4BKG A;  1EM7 A;  1WGD A;  2MBE A;  4DDG D;  1XCQ L;  3AE4 B;  1GC6 A;  4RNA A;  3AB5 A;  3GB1 A;  2V4I B;  4QJ5 B;  3HIE A;  1ET9 A;  3AE2 B;  3V6C B;  4KHO A;  3H9D A;  3W1Y A;  1YX5 B;  5LOP B;  2AX5 A;  4GMX B;  3LJU X;  3TL5 A;  1E8Z A;  3HM6 X;  4NJ7 A;  1XLN A;  2ELB A;  3O13 A;  2KR0 A;  1RFK A;  2DHZ A;  2KTR B;  2IO1 B;  2I1K A;  1WGG A;  2WXN A;  4US8 A;  4AS1 A;  3FLV A;  2MFQ A;  2WX0 A;  2KK8 A;  5BMI A;  2HTM E;  2G9H D;  2IZV B;  2CHW A;  2DWQ A;  3T8M A;  4W9F A;  4G3X B;  3V60 A;  1C9F A;  2M1M A;  3L0W B;  1I2H A;  2KQ4 X;  2P0D A;  5EE0 A;  4MM3 B;  1WYG A;  1XT9 B;  1PGB A;  3J9C A;  4MH0 E;  1YMH E;  3P1M A;  2ZW0 A;  3R2T A;  4DHJ B;  2ZPY A;  4K17 A;  2LWP A;  1FAO A;  2WLB A;  3A9J B;  1ZM0 A;  1I7A A;  2KLG A;  1I4H A;  4GDK A;  2ASQ A;  4MY6 A;  4S0R A;  4E71 A;  5FKA C;  4MH8 A;  4RH6 A;  2N23 A;  3APD A;  3EPY A;  4ACF A;  2GBK A;  3A4S C;  1K51 A;  2KJR A;  2V3S A;  3MC8 A;  4KIK B;  2KX0 A;  1R7S A;  5JLJ B;  2DNF A;  1ZE3 D;  2L8J A;  4HSI A;  1ZDX A;  1EU4 A;  4AOF A;  1KOT A;  3TW1 A;  4F7Z A;  1CJE A;  3R2I A;  2Y5B B;  1V1O A;  1ZGU B;  1PFD A;  2MHJ A;  5C16 A;  2DZJ A;  3AEE B;  3AU4 A;  3PS6 A;  2V3N A;  1X1M A;  4MGY E;  1DIK A;  1EU3 A;  2FCN A;  3DDC B;  4PS3 A;  1FXA A;  4NQK E;  4KVG B;  2EMT A;  4A3O A;  2Q5W D;  1C4P A;  4GPT B;  2C7M B;  4JWS C;  4JK9 A;  3AE5 B;  4JQW C;  4AQ7 A;  2XNA C;  2BCJ A;  1P3Q U;  3ZNI D;  2KIE A;  2XBB C;  1TBE A;  2KAC A;  3ABV B;  4I6L B;  2LG1 A;  2GOW A;  5J2R A;  3HQC A;  1NU2 A;  2BW2 A;  3TO1 A;  2XK5 A;  4M0W A;  3IXS A;  2QSD A;  1X86 A;  2KKC A;  1EO6 A;  1U5F A;  1PGA A;  2H89 B;  2WH5 A;  1R4N I;  4WJP A;  4A3P A;  1L7Y A;  2Y8F A;  1WMH A;  1FM0 D;  5JZE B;  4XX5 A;  1FNV A;  3JYU A;  4MDK E;  3M1I B;  4WVF B;  2AEH A;  1KFY B;  2L83 A;  1I35 A;  3NWA A;  1FRR A;  4Z2N A;  3AEF B;  3OLM D;  1TY2 A;  1BTK A;  4ARC A;  1WGY A;  2M56 B;  5M4Y B;  1WX7 A;  1C1Y B;  4DIX A;  4HPL B;  1UNP A;  5JHG A;  4L1B A;  2KMA A;  1H4R A;  2KN4 A;  2R2Y A;  3ZDM C;  3WCQ A;  1MPE A;  1V9J A;  1ACA A;  3KSY A;  2M0A A;  2RSU A;  4L2Y A;  1RM6 C;  2BB6 A;  1FOE A;  4KGR A;  4CHM A;  2KDE B;  4A6H A;  5HE1 A;  3JVZ X;  4CQN A;  3TIX A;  3DXD A;  2JXX A;  1Z5S B;  3H7S A;  1XCG A;  1ZC3 B;  2KZR A;  2NTS A;  5MPO A;  2L1C A;  3EEC A;  3ZNH B;  1LGR A;  1HEZ E;  2V0G A;  3Q8F A;  1UNR A;  1QZE A;  4KV2 A;  3PVU A;  5LNK 1;  2J4X A;  1DOY A;  2EKI A;  2V76 A;  3UQA A;  4K2P A;  2O6V A;  2CS4 A;  1V6E A;  3DXC A;  1N62 A;  4WIP A;  2DYM A;  1AQC A;  1SBB B;  4RGT A;  2Z0P A;  2JVC A;  1IBX A;  3E9S A;  1JWA D;  2TSS A;  4JE3 B;  4DHJ D;  4QXA B;  3QQ8 B;  2OTX A;  2LEK A;  1BXT A;  4LLG M;  4MT7 A;  3BVG A;  4B0M A;  4HWI B;  2ZEQ A;  4Q2J A;  2YSZ A;  1LM8 B;  4D6W A;  1WM2 A;  2IGG A;  1P0R A;  2ZJD A;  4KHA A;  2L0F A;  5DHA B;  4IM3 A;  1BML C;  2KD0 A;  1B55 A;  2JZZ A;  3I5J C;  2GUM A;  5CHF A;  2EKE C;  3P4Q B;  2RNR B;  1RFA A;  1C76 A;  2MH7 A;  3HM3 A;  3SYX A;  1YX6 B;  1IYF A;  1V1P B;  4ANW A;  2NCN A;  5E6P A;  1WR6 E;  2YS5 A;  3OWE B;  3L54 A;  2WXH A;  1C78 A;  4A6F B;  3ZXR A;  3PTF C;  4WUR A;  4ZYS A;  1HA5 A;  2MCN B;  2K2J A;  5C5B A;  2IY0 B;  3IT6 B;  2ZCC A;  1TZ1 A;  3RUI B;  1FEH A;  4W9K A;  2NMQ A;  4ANX A;  4HLE A;  4P1B C;  2R61 A;  2JRI B;  1WY8 A;  1JWB D;  3M3J A;  2RQ1 A;  1SF0 A;  2N9E B;  2KT7 A;  4EZJ A;  3PVL A;  4GZU A;  1H10 A;  3FKY A;  3SV1 A;  1FHX A;  3M95 A;  2KDB A;  2DA0 A;  4QJ4 B;  1HTQ A;  4EUT A;  2CAY A;  1UEL A;  3BVM A;  3CWI A;  3TCA A;  5DPW A;  1V5M A;  2KLC A;  2BVC A;  4C00 A;  2EEL A;  3NRZ A;  1JDE A;  4XGA B;  3DBL B;  5LG4 B;  5DH9 B;  1I4R A;  2BWE S;  3KH0 A;  1V5P A;  1YN3 A;  3N1Z C;  3ECI A;  2E3T A;  1QLB B;  1RRP B;  1AYF A;  3HIZ A;  1MG8 A;  2FJL A;  1HQR D;  2COF A;  4S17 A;  2FJ9 A;  1SE2 A;  2NPT A;  2FUG 1;  3VRB B;  3SFE B;  5DI9 B;  2KUQ A;  1DDV A;  1SXT A;  2RDH A;  1PMS A;  3ZYY X;  2DHK A;  3C0R B;  1T0S C;  1R4M I;  3TEW A;  2MBQ A;  4W9E A;  1F52 A;  2IO0 B;  1E8W A;  4GB9 A;  4RF0 A;  4MT5 A;  2MJD A;  2PLP A;  3M63 B;  4HDQ A;  1QQG A;  5AUK A;  2KVZ A;  3QAR A;  3FAH A;  3W9C B;  3P7Z A;  1UWX A;  2RMM A;  3SBG A;  1JRP A;  2NBV B;  2D9V A;  3AEG B;  1NYQ A;  3RN9 C;  1TS4 A;  4KGS A;  2D11 A;  4EE2 A;  3OJ4 B;  1TKE A;  1WRI A;  3NVW A;  4P16 A;  2L2I A;  2IGD A;  1ISN A;  4CSQ A;  2DYB A;  4JLC A;  1P3R A;  2K5P A;  3KYC D;  2G45 B;  1GGO A;  1XOD A;  5DIF B;  1Q1O A;  2KJ6 A;  1WZ0 A;  3RCP A;  3H7P A;  4MAC A;  2RRF A;  3Q3N C;  4PYU A;  3B1L X;  2AL6 A;  2DN6 A;  2WXL A;  2NBU A;  2GCL A;  2KCJ A;  2E6X A;  3R3M A;  2YF0 A;  4A6K A;  4AWJ A;  4W9C A;  4GU2 A;  5J3Y A;  2PMV A;  3AE1 B;  2G4S A;  5I2M A;  2GCJ A;  3T3O A;  2D9Y A;  1LW3 A;  3IBE A;  1OGW A;  1I42 A;  4PNK A;  2YS1 A;  5KQ4 A;  4DQO C;  4ICV A;  1TKY A;  1DOI A;  3Q8A A;  4ZHO A;  5D3V A;  2GBM A;  1VCB A;  3DHH C;  1WJ4 A;  3PLV A;  4HB0 B;  2RPV A;  2K49 A;  2HJ8 A;  1Y56 A;  1C3T A;  1OMW A;  4N6E B;  1PYW D;  4NY0 A;  2CJN A;  4B0E A;  1U5D A;  1YOV B;  3H1U A;  3MFG A;  1WXV A;  2N9X A;  1TKG A;  3A9K A;  3UZT A;  2L1A A;  5BO4 B;  4C4V A;  4LNO A;  2D9Z A;  3L16 A;  4HB2 B;  3RNB C;  1BT0 A;  2I5F A;  5FR6 A;  2WDT B;  1MK7 B;  2FIF A;  2JY6 A;  3N9Y C;  3U7Z A;  4MK0 A;  1P1A A;  2N7D A;  1E8X A;  3BK2 A;  3H8H A;  2HE7 A;  4UDU C;  3IAS 1;  1IGC A;  1N3H A;  4DX9 0;  1I4P A;  3DBH I;  1JAL A;  1CZP A;  3APC A;  1DOX A;  5HE0 A;  4YTN B;  2D9X A;  2GBR A;  3C19 A;  2DYO A;  1QF6 A;  2LVO A;  5LON B;  3RNC C;  4L1R A;  2Z0E B;  4MEM A;  2X0S A;  1WGR A;  2WXI A;  3EHV A;  4IUM B;  1XLQ A;  2LZ6 A;  3APF A;  2K8C A;  3MJW A;  3RNE C;  4OZA A;  1HE8 A;  2JYT A;  2D2Q A;  2FBW B;  2GLS A;  3V61 A;  1BTN A;  2K9X A;  2DHJ A;  2D07 B;  2LHE A;  2QCZ A;  1DBH A;  2L7R A;  5JP4 A;  3TJP A;  3DPD A;  2WS3 B;  5CLQ B;  2IY1 B;  1EVH A;  1TZO A;  1KJT A;  4BOS C;  3WAN A;  1WJU A;  3TEY A;  4GSW A;  1FCL A;  2REX A;  1U5E A;  4K81 A;  3ULB A;  2YEP F;  3ZTD A;  2ABD A;  1TS5 A;  4E3C A;  4ARI A;  1WZ3 A;  3ENE A;  5G5H A;  1QT9 A;  3AE8 B;  4NZL B;  1OFF A;  1EF1 A;  2DIK A;  3ZXV A;  1OEY J;  2RR9 A;  4IG7 B;  2MLB A;  2LJI A;  4GOU A;  1WJN A;  1UNS A;  1STE A;  4KDI C;  1XX0 A;  2JF5 A;  3FVC A;  3EFC A;  2NMB A;  4ZHP A;  4CYE A;  3PZ8 A;  1P7F A;  3EUB 2;  3HSA A;  4YTP B;  3BIN A;  1WXA A;  2LI5 A;  3ZQ4 A;  2N4F A;  2NVU I;  1T5X D;  5IP4 D;  4NNJ B;  1SB3 C;  2WYQ A;  4AP4 C;  3AEA B;  2LFI A;  5BYS A;  4DBB A;  2Y5P A;  4EEW A;  2IJ0 A;  4K3B A;  2N7E A;  4HKZ E;  1FMA D;  4II3 B;  2LUM A;  2ZNV B;  2Z14 A;  2RLO A;  4US9 A;  2YT1 A;  3U4E G;  4GDK B;  3RMK C;  5EE9 A;  4LTU A;  3N1X C;  1WJM A;  1BAK A;  2RGN B;  3MTN B;  4WQO B;  3GP7 A;  3A4R A;  1I4G A;  1WFY A;  2AL3 A;  3E9P A;  5JVL A;  4YT0 B;  3VHT C;  4BKS D;  4YWG G;  3ZRC A;  1P7E A;  4JKC A;  5JHH A;  4DDI D;  1QOB A;  3QC8 B;  3S2A A;  4RMA A;  1E6E B;  1HXY D;  1AWE A;  2DZI A;  1AW7 A;  1CQV A;  3NJT A;  1M7R A;  1Y5O A;  1OEY A;  2DX5 A;  5BMH A;  1E90 A;  2X38 A;  2XEW A;  2MBB B;  3GZN B;  2IPK D;  2LVQ A;  4WQM A;  1DGJ A;  3ZKJ C;  2OQB A;  4XZ4 A;  2J59 M;  3FSS A;  1Y8R C;  2OJR A;  3BK1 A;  5FR3 A;  3KUZ A;  1GNU A;  2V9H A;  3A1Q A;  3AXC A;  1V80 A;  4MGK E;  1AAR A;  3QX1 A;  1WGK A;  2WXJ A;  3PT2 B;  2K6Q A;  1K8R B;  2C7H A;  1M94 A;  2L00 B;  2KYW A;  3VXW A;  2K00 A;  4W9I A;  1WX8 A;  3WAL A;  3VTV A;  1NTI A;  2KMM A;  1LQB A;  4WJN A;  4IW0 A;  4BOZ B;  1XXG A;  2G1E A;  3RZW C;  2KQ7 A;  1FNU A;  2KXJ A;  2WWZ A;  1U27 A;  3KUC B;  2UWQ A;  2XK5 B;  4M0W B;  3E9L A;  2HJ1 A;  1FGY A;  2L3Z A;  2CRF A;  1UD7 A;  2KOX A;  3IAM 1;  3ALB A;  1WJ1 A;  1TYG B;  3RI7 C;  5AEK B;  4PK1 A;  3FP5 A;  2LBB A;  1P5T A;  1WMH B;  3NY5 A;  2K0P A;  3DHI C;  4K3C A;  3VDZ A;  2KJH B;  1ZSQ A;  3N1Y C;  4JK7 A;  2FJU B;  3QAQ A;  3FEH A;  3Q2A C;  1ZP0 B;  3Q3F A;  4F1S A;  2L52 A;  3GOE A;  3LB8 C;  1J0G A;  3ZJV A;  2J0K A;  1TJ6 A;  2KAJ A;  3CF6 E;  4W9G A;  1XKE A;  4HK2 A;  3X0W A;  2VH1 A;  4NPN A;  2QDF A;  3Q69 A;  4MJS A;  1FGZ A;  2KIG A;  2MJ3 A;  4JKG A;  1VZ7 A;  4HPP A;  5HFY A;  2KWD A;  4WAF A;  4TMA B;  1HBK A;  1HB6 A;  5IJM A;  1LXD A;  4FXC A;  3HVD A;  2JYE A;  3TFM A;  1EUV B;  1Q10 A;  1PDX A;  1UPR A;  1HTO A;  3SBT A;  3Q8B A;  3SDL C;  1NVL A;  3ZVV A;  2ELA A;  1UBQ A;  2PE9 A;  3SR6 A;  1VBH A;  2LVP A;  2P0H A;  3PHX B;  2KWV B;  2PW9 A;  1J19 A;  4JKH A;  1V5U A;  2O6V B;  3TSS A;  1VZ6 A;  3PSE B;  2IYD B;  3ZVR A;  1WSP A;  1M7E A;  1IRS A;  1TGZ B;  2Y3A A;  2W82 A;  1XEE A;  1IBX B;  2MSE D;  3NS1 A;  5J3Q A;  2UZR A;  5H8Y E;  3HW2 B;  1D3Z A;  4OSN A;  3U12 A;  4J6I A;  1GOZ A;  1E0Z A;  2ZNV C;  1VDV A;  1TY0 A;  1DDW A;  2MBO A;  2PEA A;  4XWT A;  4L6E A;  2N9K A;  1ZVR A;  3VTU A;  1SE4 A;  1P98 A;  3V3X A;  2R0D A;  2QEJ C;  1P6S A;  4DXF A;  3Q3M C;  4N59 A;  1UF0 A;  2LUL A;  4RFB A;  2HTH A;  1HB8 A;  2E2X A;  4NAM A;  1KM7 A;  1WGH A;  1ZC4 B;  5IRS A;  4M8M A;  4OZC A;  5EDS A;  3I3T B;  4HAT B;  2HRJ A;  2DX1 A;  1KI1 B;  2M4N A;  2DLW A;  2O2V A;  3WIM A;  3O96 A;  3ZUN A;  1GG3 A;  4OHJ A;  3GS2 A;  2D10 A;  1PFJ A;  5C5B B;  2CU3 A;  3ZDT A;  1V88 A;  3WAP A;  4JK8 A;  5D27 A;  4FUL A;  4LDT B;  5DPR A;  3QIJ A;  2Z4D A;  1T0R C;  3GYP A;  2L32 A;  4HHV A;  3CSF A;  3NZ3 A;  5D2M B;  4FJZ A;  3BII D;  5TR5 A;  1OQN A;  4I6P A;  5KHO A;  4PYZ A;  1E10 A;  1MK9 B;  1XR0 B;  1L0X B;  2MWN B;  2BGF A;  5AZG A;  2KFK A;  1UPQ A;  3KLS X;  2BBC A;  2BYF A;  1XQQ A;  4DHZ B;  1RRB A;  4H8S A;  4W9D A;  2MJE A;  4BFR A;  1W1D A;  5HKH A;  3DCG A;  2M17 A;  2M19 A;  1L5P A;  4DK5 A;  4TV3 A;  2WGS A;  2H88 B;  3K9P B;  3AEB B;  3VH3 B;  2JZ3 B;  4WWM A;  2DTC A;  3CMM B;  2PVG C;  2BYE A;  2NPT B;  4AUQ C;  2X18 A;  3KZ1 A;  2JP2 A;  4HRO A;  1NBF C;  1JW9 D;  3HUI A;  2K25 A;  1U2B A;  4I6N B;  4JGH B;  3AED B;  3URY A;  2NZ8 B;  2DLB A;  3VFK A;  3A8P A;  4JIO U;  3DOW A;  5G2N A;  4GXB A;  3DBL I;  4KAX B;  4PS7 A;  1J8C A;  4KZ0 A;  2GI9 A;  5C2T B;  3MC9 A;  1V49 A;  3NVY A;  2MQJ A;  5G55 A;  3CST A;  2DYN A;  1MI0 A;  2BKF A;  2FUH B;  3OJ3 A;  2J7Q B;  1OQY A;  2COP A;  3K9O B;  1ZXH A;  2JZP A;  2C60 A;  4GGQ A;  2FCQ A;  4LK0 M;  2O6V D;  1M4V A;  2JWZ A;  1WE6 A;  1N5W A;  2D3G A;  2IND C;  3NVV A;  3SD5 A;  1U4A A;  4TYZ A;  1NTV A;  3B77 A;  1SE9 A;  3N20 C;  4GMV A;  1Q67 A;  3UGB B;  5DPT A;  2WNM A;  2AQ3 B;  2C9W B;  4RGM A;  2D4Q A;  4NJC A;  2M0X A;  3W5V B;  1VBG A;  3GE8 C;  2JUO A;  4IOI E;  2IYB A;  4B95 A;  3U2S C;  3V5W A;  4EKU A;  3EFU A;  3HHM A;  2KQS A;  3PZ7 A;  3CXB B;  3NZS A;  2KC2 A;  2ZVN A;  1N63 A;  1V8C A;  2VRR B;  1CMX B;  1VD2 A;  2KUP A;  3ZIM A;  3D8E A;  2AQ1 B;  2ICI A;  4CHK A;  2LRU A;  2WDQ B;  4OT1 A;  4HB4 B;  3A9K B;  3OHM B;  2CY5 A;  3E9O A;  4C4V B;  1KH0 A;  1E5W A;  4LDT D;  1ACC A;  3IG3 A;  3N30 A;  4WWO A;  4B6W A;  3UQB A;  3WAO A;  5L81 A;  3ZJT A;  1UWM A;  4A55 A;  2J0M A;  3ODX A;  2BYT A;  2YVC A;  1VJK A;  3DWM A;  4HCN B;  4IKG A;  2RSG A;  3GE3 C;  1SIF A;  3CIK A;  1YJJ A;  1RAX A;  3RD2 A;  2INP E;  2LGY A;  1ST7 A;  4EOY A;  1H8C A;  3AE9 B;  3FC4 A;  1L6U A;  4FAD A;  4ZRJ A;  2LHD A;  5CTR C;  1KC7 A;  3Q8C A;  2ZPN A;  3L4P A;  1YD8 U;  1DDM A;  4AJW A;  5JHA A;  1FPY A;  2KWC A;  2VH2 A;  4TUU A;  1L0V B;  3RPF C;  4HAV B;  2IBI B;  1FXI A;  4DHZ E;  3FIL B;  1WVH A;  5J18 A;  3PGE A;  4D0N B;  1FHO A;  1TIF A;  3W1S A;  5JH5 C;  3PV1 A;  1T77 A;  1J7A A;  3ULC A;  3WAM A;  4OVZ A;  2IO2 B;  3B9J A;  4WH4 A;  2JRH A;  2LRW A;  1U29 A;  3HK0 A;  1T0Q C;  1K53 A;  2YLM A;  1J0W A;  3T06 A;  4HAW B;  1YNT E;  4EFO A;  1FNW A;  3PRM B;  2ZKM X;  1WF9 A;  2KAN A;  5TSS A;  3QK0 A;  2COD A;  1WH3 A;  1YJ1 A;  4X57 B;  3A33 B;  5HI1 A;  4IFS A;  1PGX A;  2ZW1 A;  1VRA B;  1S1Q B;  3U52 E;  5AZH A;  2YS3 A;  1OTR B;  4N58 A;  1ESF A;  3AJ4 A;  2K22 A;  4ANV A;  4LNF A;  4ZOH C;  2QHO A;  2OHF A;  1TJE A;  1W1H A;  2VZK B;  3DVG X;  3L08 A;  2BF8 B;  1MIZ B;  1IP9 A;  4XDD A;  5KCV A;  3H6N A;  3PRZ A;  1A70 A;  4WJQ A;  3C8Y A;  2JPH A;  2KNB A;  2ON8 A;  2SAK A;  2H7E A;  2LGS A;  2DAJ A;  4WWP A;  1MAI A;  3P2B A;  4YXD B;  3ODO A;  2JX5 A;  2PJH A;  4KHB A;  5C6R A;  2BPS A;  3A58 A;  1C4C A;  2GBN A;  2CB8 A;  5HHD G;  2ROZ B;  4FLH A;  5D3Y A;  4FJY A;  1EWC A;  1I4Q A;  2QKL A;  4QJ3 B;  2V4L A;  4GOC A;  4GNK B;  2D9W A;  3KRW A;  1WXS A;  2ZZP B;  1K5G B;  3DVN V;  3B0A A;  2KO3 A;  3LXF A;  3D8F A;  3BWU D;  4GDL B;  1YQB A;  2DX5 B;  4MSQ B;  1Y19 B;  3AI5 A;  4BZA A;  3T3N A;  1I4X A;  4K7S A;  2B3A A;  4HB3 B;  2OED A;  3AN1 A;  3L10 B;  1T6B X;  3V05 A;  2AYO B;  3A1Q B;  1X11 A;  1WX9 A;  2WXO A;  3V62 A;  4RM9 A;  3AMZ A;  2EC1 A;  4KDL B;  2KWU B;  2BS4 B;  1XD4 A;  3MDB C;  1XLP A;  1UNQ A;  1WI1 A;  3ZW3 A;  5IA7 A;  2PZ1 A;  1FHW A;  1FIQ A;  1LB1 A;  4C56 C;  1NYR A;  3U7D A;  3GZN I;  4HPM B;  4JX1 C;  2AQ2 B;  1UZX B;  1NI3 A;  4O1N A;  1GPX A;  5D6J B;  2CR5 A;  3IHP C;  2LD9 A;  4WSF A;  5L83 A;  2GBJ A;  2LAS A;  2MP2 A;  5BYR A;  4RCO A;  1UH6 A;  4GN1 A;  1MVK A;  4ICU A;  2WDR B;  4F7G A;  4YON A;  4B6H A;  3ZNG C;  3P42 A;  4GLS C;  4CO7 A;  2CJO A;  2JT4 B;  2RD0 A;  3TMP B;  2INC C;  1D5Z C;  3EC8 A;  1B1Z A;  4K1R B;  2WXQ A;  3KWL A;  2KGX B;  1YJI A;  4NSW A;  4JKD A;  3SNH A;  4ZRI A;  4KKJ A;  3RNA C;  1K50 A;  1WRD B;  3DBS A;  1V5T A;  1W1G A;  1D4B A;  4XYC A;  3D8D A;  1WIA A;  4MJS B;  4HKQ A;  3MHS D;  4JKG B;  1BUI C;  2GRI A;  1MFW A;  2RUK B;  1TS3 A;  1ENF A;  2BB5 A;  2R82 A;  2X8X X;  2YT2 A;  1L0Y B;  2WXF A;  1QC6 A;  1DYN A;  2LMC A;  3SUZ A;  4KX6 B;  3ZJU A;  1F0Z A;  3BY4 B;  1B9R A;  2RPQ A;  2BQQ A;  3DVG Y;  1VR9 A;  4A90 A;  1NI2 A;  2R2Q A;  1C4A A;  1ZOY B;  2NBW B;  1IGD A;  1F2R I;  1A5R A;  4WJ7 A;  4LJP B;  4NJ6 A;  4E74 A;  4ZYN A;  1KBL A;  1T3Q A;  2J52 A;  1N5X A;  3UIP B;  2DFK A;  1MJD A;  3IVF A;  4YSY B;  4ANU A;  2CHZ A;  2OOB B;  3M62 B;  1SEB D;  3HRD D;  3NG0 A;  4DWF A;  1WGU A;  1WWT A;  1FCC C;  3DWG C;  4P7I A;  1N61 A;  4HJG E;  5J3T A;  3A98 B;  3JSV A;  4KZC A;  4A9A A;  2V1Y A;  2COA A;  2WU2 B;  5D94 A;  1QOG A;  3UF8 A;  2ZCB A;  2BS2 B;  1JRO A;  1RLF A;  1YIW A;  2HTH B;  1JWS D;  1N60 A;  1WR1 A;  1FRD A;  3F0W A;  3VUX A;  3ONS A;  2O2V B;  3VR8 B;  3IFW B;  2WDV B;  5BMG A;  2LOZ A;  2N1V A;  2QIE B;  4KKI A;  4ILG B;  3RFZ B;  1E7V A;  1TT5 B;  2D3A A;  2KVR A;  3WA0 A;  2LOX A;  3DBR B;  1ZW7 A;  4HCP B;  5HG2 A;  4M01 A;  5IKC M;  4K7W A;  5J17 A;  4NAW A;  2Z0Q A;  3G9W A;  3A8Q A;  4JKE A;  2RDB C;  4Z2M B;  4P6V F;  3PPA A;  5I4D A;  3P6A A;  1J7B A;  1WGQ A;  2DYQ A;  1VZ8 A;  2I38 A;  3ZGZ A;  3P63 A;  2LKO A;  5E6J A;  1KZG A;  3BZD B;  3QWM A;  2KFK B;  4HRS A;  4KSK C;  5H92 C;  1QIL A;  3AE7 B;  4WWN A;  4MGZ E;  3CIR B;  4OVV A;  3QBV B;  2UVM A;  4DBG A;  1XO3 A;  2BS3 B;  4QAY A;  1IPG A;  2P8V A;  3NVZ A;  4EJN A;  3QJZ A;  5HE3 A;  2MEK A;  4URK A;  2N0S B;  4JKA A;  4YSZ B;  1OQR A;  3ZLZ A;  2YT0 A;  2Z0O A;  4ZDV A;  3F5R A;  5GXG B;  4HEA 1;  1JML A;  2KN5 A;  2N0Y A;  4HAY B;  3RNF C;  1AN8 A;  4JKF A;  2K8H A;  4HVB A;  1HZ5 A;  2PVO D;  3PP2 A;  1XCT L;  2MWS B;  3E56 A;  3FM8 C;  4TKN A;  1C79 A;  3MPX A;  4HJK A;  2QKM A;  3ML8 A;  1DYQ A;  1ZUD 2;  1OQQ A;  4TQ0 A;  2Z59 A;  4W9J A;  1ROE A;  2DKP A;  3AUL A;  1QOF A;  3DXE A;  1L4D B;  1EF5 A;  1QOA A;  2WQY B;  5D3D A;  2KC1 A;  4OW0 A;  1UBI A;  3N7C A;  2WP9 B;  2VSZ A;  3MHZ A;  2COC A;  1MG4 A;  2Z13 A;  4LJO B;  2G4D B;  2W2W A;  3NZU A;  2QJL A;  1WG7 A;  3VH4 B;  4BBN F;  3QA8 A;  5LXH A;  3QHT A;  3W2D A;  3PSC A;  4LCD E;  2HDE A;  1BWN A;  2Q13 A;  4FN2 A;  3RZF A;  4M8N A;  2IGH A;  2QC8 A;  3N3K B;  1FFU A;  1SJE D;  1WJ6 A;  1GB1 A;  2A5U A;  3PRE A;  4IWQ A;  3VAW A;  1SHC A;  3HVZ A;  2KTR A;  2FID A;  5IN7 A;  1V2Y A;  2D3C A;  2MX2 A;  2G3Q B;  2J42 A;  2MRP A;  1SJH D;  4D2K A;  1EWY C;  1QQR A;  5C23 A;  2WXP A;  2IFS A;  2W2X D;  3WYF B;  2DAF A;  2JXT A;  3PHW B;  4LNI A;  3R7R A;  1X05 A;  3O65 B;  4MM3 A;  1X1G A;  2W2X C;  2XQN M;  5EE3 A;  5I2S A;  2WXG A;  4R3D A;  2W54 A;  4ZRQ A;  1LFD A;  3KQ4 A;  3B2F A;  3VOQ A;  4FHK A;  4LNN A;  2DZK A;  4ZRK A;  3A9J A;  1F77 A;  4MEL A;  1J7C A;  3NOB A;  2VRW B;  4PT5 A;  2YEP B;  2BYV E;  3VQI A;  2I1J A;  2WX1 A;  4KIK A;  2EMS A;  1GAQ B;  1KRH A;  2UYZ B;  4DXA B;  2JQR B;  3Q8E A;  1RWS A;  2H7D A;  4A20 A;  4IWP A;  4C0A A;  5JXV A;  3KW5 B;  4REZ A;  4LNK A;  4XWW A;  5D3I B;  4J3O D;  2Z8L A;  1FD6 A;  2DZM A;  1NEK B;  2N1W A;  2I2Y A;  4YTM B;  3RNG C;  1Q5W B;  2KDI A;  3I9V 1;  4IM0 A;  4BBK A;  1TQZ A;  2PE6 B;  3RT3 B;  5EE1 A;  4L23 A;  1F2R C;  1JRU A;  4IAP A;  1UGJ A;  3JW0 X;  2RGF A;  4F7U P;  5CX3 A;  3ENB A;  2FAZ A;  1FXT B;  1R4N B;  2WXK A;  1TTN A;  1AWD A;  1SIJ A;  5D3W A;  2CU1 A;  2DKQ A;  1OY2 A;  4HXD A;  3UIO B;  4YSX B;  3VR9 B;  2JU6 X;  4IM2 A;  1L6V A;  1S3S G;  3L17 A;  2P0F A;  2CHX A;  4HAX B;  1F1H A;  2LJ5 A;  1MIX A;  1SGH A;  3U8Z A;  4F7H A;  1GUA B;  3Q3O C;  3ETR A;  4YL8 A;  4OVU A;  4WJO A;  3PZD A;  1TS2 A;  1ZXI A;  2WHI A;  4PQ0 A;  4FHJ A;  4HAZ B;  4BAX A;  1UEF A;  3KY9 A;  4II2 B;  4DX8 A;  3H7P B;  3KRX A;  3AM9 A;  3NHE B;  1FO4 A;  3E66 A;  3PEG A;  4EMO A;  3TEZ A;  4HAU B;  1KTK A;  2PIA A;  1E7P B;  3ODW A;  4RGO S;  1V89 A;  4G0N B;  4FBJ B;  5L95 C;  3NUH B;  2R09 A;  2JSV X;  5CHV C;  1U5G A;  3KUD B;  1D5M C;  1PUT A;  4CHJ A;  1LO5 D;  3IT4 B;  5KQ1 A;  2MDX A;  4W9H A;  4MGI E;  2R2O A;  1XF5 L;  1Z87 A;  2JWU A;  3PLU A;  3W5U B;  4BVU C;  1GJZ A;  2M8S A;  1C77 A;  1ZPS A;  2ONQ A;  4IDI A;  2MA9 B;  3EGR A;  1XD3 B;  5IO9 A;  5T8I A;  2HD5 B;  1X1F A;  5E6N A;  3V6E B;  2NS5 A;  1YN5 A;  1V97 A;  3ZRF A;  4AJY B;  2KMC A;  2LXC A;  1V61 A;  1WYW B;  3NS8 A;  2C7N B;  1NVI D;  3TUO A;  4KSL C;  4M02 A;  1KZ7 A;  3TEX A;  1NDD A;  2INN E;  2B76 B;  2L0T A;  2UU7 A;  5LLI A;  4ASW C;  3DQV A;  1V86 A;  4JKB A;  3NW8 A;  1YN4 A;  1TXD A;  1GB4 A;  2M38 A;  3BVZ A;  3TBL D;  1YQ4 B;  2KDF B;  2QIL A;  4KHB B;  4ZRP A;  1V5O A;  1KLU D;  5GMV A;  3ZNZ B;  4WAA A;  1SSN A;  3RUL A;  2SEB D;  4RF1 A;  5GOW B;  3BYY B;  4M00 A;  2CKH B;  3EA6 A;  4XWX A;  4C80 A;  2K8B A;  1KLV A;  2WU5 B;  2K39 A;  1ZKH A;  2PTL A;  3AH7 A;  2W55 A;  1MHX A;  2FCS A;  4RM8 A;  1KLG D;  1T0Y A;  4B9K A;  2ACZ B;  5CLL B;  2IO3 B;  2J53 A;  4K7U A;  2WXR A;  1YQ3 B;  2LGI A;  4IC7 B;  1MHH E;  5AZF A;  1V1P A;  3AEC B;  1G6J A;  3X23 A;  3OAN A;  3TVV A;  4TQ1 A;  3KWV A;  1IUE A;  2ZVO A;  3AE6 B;  3UIN B;  4A6F A;  2LUE A;  4PS8 A;  3PG7 A;  3SEB A;  2GJY A;  2LGD A;  2KX3 A;  4EZL A;  2K6D B;  3DVN U;  5FI0 A;  1MI1 A;  2AWT A;  3VRA B;  4ILJ A;  2A4Z A;  2L05 A;  2NTT A;  2CQU A;  2GS0 A;  2MP2 B;  4NQL B;  3KYD D;  5DCN A;  5C1Z A;  2RVB B;  2LGX A;  2VKI A;  2KFJ A;  2W9N A;  4HDO A;  4C7Z A;  1FFV A;  5FK9 C;  3ML9 A;  4FJV B;  3VVW B;  3RYT A;  2N9P C;  1GC7 A;  2W3S A;  2N7J A;  2BTE A;  2XN9 C;  5IOI A;  3BJI A;  5G5G A;  2Z0D B;  5FI1 A;  3KVF B;  1R4M B;  3SO6 A;  3SU8 X;  2BKR B;  1PLS A;  1D6E C;  3AU5 A;  4JWU C;  4K2O A;  2MKR A;  4DXG A;  2FE8 A;  5DHF B;  1XLO A;  3ML4 A;  3NWD A;  4BKT A;  3MJ5 A;  1ZDV A;  2WXM A;  2D5G A;  2J0J A;  4N9F 4;  3PVW A;  2FDQ A;  2DHI A;  2YRY A;  2KDM A;  4XE0 A;  3W1S C;  2DEN B;  4RGN A;  3QCA A;  2K2U A;  2BT6 A;  3ZTC A;  1JWU D;  3B2G A;  1WXQ A;  3QWZ B;  3SFD B;  4MSM B;  5AUI A;  1D5X C;  3I57 A;  3PRP B;  1ET6 A;  4F8C B;  2ADZ A;  2KHW B;  2GB1 A;  2N9L A;  2V3P A;  2G35 A;  4OZB A;  1UUP A;  3OG5 A;  1HZ6 A;  1P9D U;  2LXA A;  3SHQ A;  1JQ4 A;  5KHQ A;  1L4Z B;  4TSS A;  1K52 A;  3AV8 A;  3NSU A;  3UI3 A;  1E8Y A; 
#chains in the Genus database with same CATH homology
 1Z2M A;  1E7U A;  2NR2 A;  3L13 A;  5LXI B;  1NTY A;  2MW5 A;  5D7G A;  3ZO5 B;  4G50 A;  3RCZ A;  1DRO A;  1V81 A;  1MKE A;  3JSV B;  3D32 A;  2Y8G A;  1MPH A;  3VTW A;  2L76 A;  3R66 C;  1RJ2 A;  2LYD A;  4GIV A;  3VUW A;  5C79 A;  3VIA A;  2M14 A;  3R7Q A;  5E6O A;  4Y94 A;  1PQS A;  5IAA C;  4IWO A;  2CY4 A;  4ILH A;  5DPS A;  1L2N A;  4BKS A;  2K1F A;  2KTF A;  4EZK A;  2Y7B A;  1EAZ A;  3VUY A;  3LDZ E;  4JL9 A;  4W9L A;  4NAW B;  1WI0 A;  1FB8 A;  5HE2 A;  1K5D B;  1WE7 A;  3N32 A;  3GYO A;  1WXM A;  4XC2 A;  2ROV A;  2I5C A;  1F9J A;  3Q3J A;  1EGX A;  4G11 A;  3OAW A;  4IOY X;  3T9L A;  3DBR I;  1WM3 A;  2BWF A;  5EFX A;  2EJ8 A;  2MBH A;  5JHB A;  5CHW A;  2FCM A;  2FNJ B;  1Q0W B;  4FA6 A;  2C5L C;  2GMI C;  4GDL A;  2PPH A;  2UZS A;  4BBN C;  1UGM A;  2Z59 B;  3B08 A;  4A5K A;  3LJ3 A;  3U30 A;  5D3X A;  4BKG A;  1WGD A;  2MBE A;  4DDG D;  1GC6 A;  3V6C B;  4KHO A;  3H9D A;  3W1Y A;  1YX5 B;  5LOP B;  4GMX B;  3LJU X;  3TL5 A;  1E8Z A;  3HM6 X;  4NJ7 A;  2ELB A;  2DHZ A;  2KTR B;  2IO1 B;  2I1K A;  1WGG A;  3FLV A;  2MFQ A;  2WX0 A;  2KK8 A;  2IZV B;  2CHW A;  3T8M A;  4W9F A;  4G3X B;  3V60 A;  2M1M A;  3L0W B;  1I2H A;  2P0D A;  1XT9 B;  4MH0 E;  4DHJ B;  2ZPY A;  4K17 A;  2LWP A;  1FAO A;  3A9J B;  1ZM0 A;  1I7A A;  2KLG A;  4GDK A;  2ASQ A;  4MY6 A;  4E71 A;  2N23 A;  3APD A;  3EPY A;  2GBK A;  3A4S C;  2KJR A;  2V3S A;  4KIK B;  2KX0 A;  5JLJ B;  2L8J A;  4AOF A;  1KOT A;  3TW1 A;  4F7Z A;  2Y5B B;  1ZGU B;  5C16 A;  2DZJ A;  3AU4 A;  3PS6 A;  1X1M A;  4MGY E;  1DIK A;  2FCN A;  3DDC B;  4PS3 A;  4NQK E;  4KVG B;  2EMT A;  4A3O A;  4GPT B;  2C7M B;  4JK9 A;  4JQW C;  2BCJ A;  1P3Q U;  3ZNI D;  2XBB C;  1TBE A;  4I6L B;  2LG1 A;  2GOW A;  5J2R A;  3HQC A;  1NU2 A;  3TO1 A;  2XK5 A;  1X86 A;  2KKC A;  1EO6 A;  1U5F A;  2WH5 A;  1R4N I;  4WJP A;  4A3P A;  1L7Y A;  2Y8F A;  1WMH A;  5JZE B;  4XX5 A;  3JYU A;  4MDK E;  3M1I B;  4WVF B;  2AEH A;  1I35 A;  3OLM D;  4Z2N A;  1BTK A;  1WGY A;  1WX7 A;  1C1Y B;  4HPL B;  1UNP A;  5JHG A;  2KMA A;  1H4R A;  3ZDM C;  1V9J A;  1ACA A;  3KSY A;  2RSU A;  1FOE A;  4CHM A;  2KDE B;  4A6H A;  5HE1 A;  3JVZ X;  3TIX A;  3DXD A;  2JXX A;  1Z5S B;  3H7S A;  1XCG A;  1ZC3 B;  2KZR A;  2L1C A;  3EEC A;  3ZNH B;  1UNR A;  1QZE A;  4KV2 A;  3PVU A;  2V76 A;  3UQA A;  4K2P A;  2O6V A;  2CS4 A;  1V6E A;  3DXC A;  2DYM A;  1AQC A;  2Z0P A;  2JVC A;  4DHJ D;  3QQ8 B;  2OTX A;  4MT7 A;  4HWI B;  2ZEQ A;  2YSZ A;  1LM8 B;  1WM2 A;  1P0R A;  2ZJD A;  4KHA A;  2L0F A;  5DHA B;  4IM3 A;  2KD0 A;  1B55 A;  2JZZ A;  5CHF A;  2EKE C;  2RNR B;  1RFA A;  3HM3 A;  3SYX A;  1YX6 B;  1IYF A;  4ANW A;  2NCN A;  5E6P A;  1WR6 E;  2YS5 A;  3L54 A;  4A6F B;  3PTF C;  2MCN B;  2K2J A;  5C5B A;  2IY0 B;  2ZCC A;  1TZ1 A;  3RUI B;  4W9K A;  4ANX A;  4HLE A;  2JRI B;  1WY8 A;  3M3J A;  2RQ1 A;  2N9E B;  4EZJ A;  3PVL A;  4GZU A;  1H10 A;  3SV1 A;  1FHX A;  3M95 A;  2KDB A;  2DA0 A;  4EUT A;  2CAY A;  1UEL A;  3TCA A;  5DPW A;  1V5M A;  2KLC A;  1JDE A;  5DH9 B;  2BWE S;  3KH0 A;  1V5P A;  3ECI A;  1RRP B;  3HIZ A;  1MG8 A;  2FJL A;  2COF A;  2FJ9 A;  2NPT A;  5DI9 B;  1DDV A;  1PMS A;  2DHK A;  3C0R B;  1R4M I;  2MBQ A;  4W9E A;  2IO0 B;  1E8W A;  4GB9 A;  3M63 B;  4HDQ A;  1QQG A;  3QAR A;  3P7Z A;  3SBG A;  2NBV B;  2D9V A;  2D11 A;  3OJ4 B;  2L2I A;  1ISN A;  2DYB A;  4JLC A;  1P3R A;  3KYC D;  2G45 B;  1GGO A;  1XOD A;  5DIF B;  1Q1O A;  2KJ6 A;  1WZ0 A;  3RCP A;  3H7P A;  4PYU A;  3B1L X;  2AL6 A;  2DN6 A;  2NBU A;  2GCL A;  2KCJ A;  3R3M A;  2YF0 A;  4A6K A;  4AWJ A;  4W9C A;  4GU2 A;  5J3Y A;  2G4S A;  2GCJ A;  2D9Y A;  1LW3 A;  3IBE A;  1OGW A;  1I42 A;  4PNK A;  2YS1 A;  5KQ4 A;  4ICV A;  5D3V A;  2GBM A;  1VCB A;  1WJ4 A;  3PLV A;  4HB0 B;  2HJ8 A;  1C3T A;  1OMW A;  4NY0 A;  1U5D A;  3H1U A;  1WXV A;  2N9X A;  3A9K A;  3UZT A;  5BO4 B;  2D9Z A;  3L16 A;  4HB2 B;  1BT0 A;  2I5F A;  5FR6 A;  2WDT B;  1MK7 B;  2FIF A;  2JY6 A;  4MK0 A;  1P1A A;  2N7D A;  1E8X A;  2HE7 A;  1N3H A;  4DX9 0;  3DBH I;  3APC A;  5HE0 A;  2D9X A;  2GBR A;  2DYO A;  2LVO A;  5LON B;  2Z0E B;  4MEM A;  2X0S A;  1WGR A;  3EHV A;  4IUM B;  2LZ6 A;  3APF A;  2K8C A;  3MJW A;  1HE8 A;  2D2Q A;  3V61 A;  1BTN A;  2DHJ A;  2D07 B;  1DBH A;  2L7R A;  5JP4 A;  3TJP A;  3DPD A;  5CLQ B;  2IY1 B;  1EVH A;  1KJT A;  4BOS C;  3WAN A;  1WJU A;  4GSW A;  2REX A;  1U5E A;  4K81 A;  3ULB A;  3ZTD A;  2ABD A;  4E3C A;  1WZ3 A;  3ENE A;  1EF1 A;  2DIK A;  1OEY J;  2RR9 A;  4IG7 B;  2MLB A;  1WJN A;  4KDI C;  1XX0 A;  2JF5 A;  2NMB A;  4CYE A;  3BIN A;  1WXA A;  2LI5 A;  2N4F A;  2NVU I;  4NNJ B;  2WYQ A;  4AP4 C;  4DBB A;  4EEW A;  2N7E A;  4II3 B;  2ZNV B;  2RLO A;  2YT1 A;  4GDK B;  1WJM A;  1BAK A;  2RGN B;  3MTN B;  4WQO B;  3A4R A;  1WFY A;  2AL3 A;  3E9P A;  5JVL A;  3VHT C;  4BKS D;  3ZRC A;  4JKC A;  5JHH A;  4DDI D;  3QC8 B;  3S2A A;  4RMA A;  1AWE A;  2DZI A;  1M7R A;  1Y5O A;  1OEY A;  2DX5 A;  1E90 A;  2XEW A;  2MBB B;  2LVQ A;  3ZKJ C;  2OQB A;  4XZ4 A;  2J59 M;  3FSS A;  1Y8R C;  2OJR A;  3KUZ A;  1GNU A;  3A1Q A;  3AXC A;  1V80 A;  4MGK E;  1AAR A;  3QX1 A;  3PT2 B;  2K6Q A;  1K8R B;  2C7H A;  1M94 A;  2L00 B;  3VXW A;  2K00 A;  4W9I A;  1WX8 A;  3WAL A;  3VTV A;  1NTI A;  1LQB A;  4WJN A;  4IW0 A;  4BOZ B;  3RZW C;  2KQ7 A;  2KXJ A;  2WWZ A;  1U27 A;  3KUC B;  2UWQ A;  2XK5 B;  4M0W B;  3E9L A;  1FGY A;  2L3Z A;  2CRF A;  1UD7 A;  2KOX A;  3ALB A;  1WJ1 A;  5AEK B;  3FP5 A;  2LBB A;  1P5T A;  1WMH B;  3NY5 A;  3VDZ A;  2KJH B;  1ZSQ A;  4JK7 A;  3QAQ A;  3FEH A;  3Q3F A;  4F1S A;  3GOE A;  1J0G A;  2J0K A;  1TJ6 A;  3CF6 E;  4W9G A;  1XKE A;  4HK2 A;  3X0W A;  4NPN A;  4MJS A;  1FGZ A;  4JKG A;  1HBK A;  1HB6 A;  5IJM A;  1LXD A;  3TFM A;  1EUV B;  1UPR A;  3SBT A;  3SDL C;  1NVL A;  3ZVV A;  2ELA A;  1UBQ A;  2PE9 A;  1VBH A;  2LVP A;  2P0H A;  3PHX B;  2KWV B;  1J19 A;  4JKH A;  1V5U A;  2O6V B;  3PSE B;  2IYD B;  3ZVR A;  1M7E A;  1IRS A;  1TGZ B;  2MSE D;  5J3Q A;  2UZR A;  3HW2 B;  1D3Z A;  4J6I A;  2ZNV C;  1DDW A;  2MBO A;  2PEA A;  4L6E A;  1ZVR A;  3VTU A;  1P98 A;  2R0D A;  1P6S A;  2LUL A;  2HTH A;  1HB8 A;  2E2X A;  1KM7 A;  1WGH A;  1ZC4 B;  4M8M A;  5EDS A;  3I3T B;  4HAT B;  2HRJ A;  2DX1 A;  1KI1 B;  2M4N A;  2DLW A;  2O2V A;  3WIM A;  3O96 A;  3ZUN A;  1GG3 A;  2D10 A;  1PFJ A;  5C5B B;  3ZDT A;  1V88 A;  3WAP A;  4JK8 A;  5D27 A;  4FUL A;  4LDT B;  5DPR A;  3QIJ A;  3GYP A;  4HHV A;  3CSF A;  5D2M B;  4FJZ A;  5TR5 A;  1OQN A;  4I6P A;  5KHO A;  4PYZ A;  1MK9 B;  1XR0 B;  2MWN B;  2BGF A;  5AZG A;  2KFK A;  1UPQ A;  2BYF A;  1XQQ A;  4DHZ B;  1RRB A;  4H8S A;  4W9D A;  4BFR A;  1W1D A;  5HKH A;  3DCG A;  2M17 A;  4DK5 A;  4TV3 A;  3K9P B;  3VH3 B;  2JZ3 B;  2DTC A;  3CMM B;  2BYE A;  2NPT B;  4AUQ C;  2X18 A;  3KZ1 A;  2JP2 A;  1NBF C;  2K25 A;  1U2B A;  4I6N B;  4JGH B;  2NZ8 B;  3VFK A;  3A8P A;  4JIO U;  3DOW A;  5G2N A;  4GXB A;  3DBL I;  4KAX B;  4PS7 A;  1J8C A;  4KZ0 A;  1V49 A;  2MQJ A;  5G55 A;  3CST A;  2DYN A;  2BKF A;  2FUH B;  3OJ3 A;  2J7Q B;  1OQY A;  2COP A;  3K9O B;  2C60 A;  4GGQ A;  2FCQ A;  2O6V D;  2JWZ A;  1WE6 A;  2D3G A;  3SD5 A;  1U4A A;  4TYZ A;  1NTV A;  1SE9 A;  4GMV A;  1Q67 A;  3UGB B;  5DPT A;  2C9W B;  2D4Q A;  2M0X A;  1VBG A;  2JUO A;  2IYB A;  4B95 A;  3V5W A;  4EKU A;  3EFU A;  3HHM A;  2KQS A;  3CXB B;  3NZS A;  2KC2 A;  2ZVN A;  2VRR B;  1CMX B;  1VD2 A;  2KUP A;  3ZIM A;  3D8E A;  4CHK A;  2LRU A;  4HB4 B;  3A9K B;  2CY5 A;  3E9O A;  1E5W A;  4LDT D;  3IG3 A;  3N30 A;  4WWO A;  4B6W A;  3UQB A;  3WAO A;  5L81 A;  2J0M A;  3ODX A;  2YVC A;  4HCN B;  2RSG A;  1SIF A;  3CIK A;  1RAX A;  3RD2 A;  2LGY A;  1ST7 A;  4EOY A;  1H8C A;  4FAD A;  4ZRJ A;  5CTR C;  1KC7 A;  2ZPN A;  1YD8 U;  1DDM A;  4AJW A;  5JHA A;  2KWC A;  4TUU A;  4HAV B;  2IBI B;  4DHZ E;  1WVH A;  5J18 A;  3PGE A;  4D0N B;  1FHO A;  3W1S A;  5JH5 C;  3PV1 A;  3WAM A;  3ULC A;  2IO2 B;  2JRH A;  2LRW A;  1U29 A;  3HK0 A;  2YLM A;  1J0W A;  3T06 A;  4HAW B;  4EFO A;  3PRM B;  1WF9 A;  2KAN A;  3QK0 A;  2COD A;  1WH3 A;  1YJ1 A;  4X57 B;  3A33 B;  4IFS A;  1S1Q B;  5AZH A;  2YS3 A;  1OTR B;  3AJ4 A;  4ANV A;  2QHO A;  1W1H A;  3DVG X;  3L08 A;  2BF8 B;  1MIZ B;  1IP9 A;  5KCV A;  3H6N A;  3PRZ A;  4WJQ A;  2JPH A;  2KNB A;  2H7E A;  2DAJ A;  4WWP A;  1MAI A;  3P2B A;  3ODO A;  2PJH A;  5C6R A;  2BPS A;  2GBN A;  2CB8 A;  2ROZ B;  4FLH A;  5D3Y A;  4FJY A;  2QKL A;  2V4L A;  4GOC A;  2D9W A;  3KRW A;  1WXS A;  2ZZP B;  1K5G B;  3DVN V;  3B0A A;  2KO3 A;  3D8F A;  4GDL B;  1YQB A;  2DX5 B;  4MSQ B;  1Y19 B;  3AI5 A;  4K7S A;  2B3A A;  4HB3 B;  3L10 B;  2AYO B;  3A1Q B;  1X11 A;  1WX9 A;  3V62 A;  4RM9 A;  4KDL B;  2EC1 A;  2KWU B;  1XD4 A;  3MDB C;  1UNQ A;  1WI1 A;  3ZW3 A;  5IA7 A;  2PZ1 A;  1FHW A;  1LB1 A;  3U7D A;  3GZN I;  4HPM B;  1UZX B;  5D6J B;  2CR5 A;  3IHP C;  2LD9 A;  4WSF A;  5L83 A;  2GBJ A;  2LAS A;  2MP2 A;  1UH6 A;  4GN1 A;  4ICU A;  4F7G A;  4YON A;  4B6H A;  3ZNG C;  4CO7 A;  2JT4 B;  2RD0 A;  3TMP B;  3EC8 A;  4K1R B;  2KGX B;  4NSW A;  4JKD A;  3SNH A;  4ZRI A;  1WRD B;  3DBS A;  1V5T A;  1W1G A;  3D8D A;  1WIA A;  4MJS B;  3MHS D;  4JKG B;  2RUK B;  2R82 A;  1QC6 A;  1DYN A;  3SUZ A;  3BY4 B;  2RPQ A;  3DVG Y;  1NI2 A;  2R2Q A;  2NBW B;  1A5R A;  4WJ7 A;  4LJP B;  4NJ6 A;  4E74 A;  4ZYN A;  1KBL A;  3UIP B;  2DFK A;  3IVF A;  4ANU A;  2CHZ A;  2OOB B;  3M62 B;  4DWF A;  1WGU A;  4P7I A;  5J3T A;  3A98 B;  3JSV A;  4KZC A;  2V1Y A;  2COA A;  5D94 A;  3UF8 A;  2ZCB A;  1RLF A;  1YIW A;  2HTH B;  1WR1 A;  3F0W A;  3VUX A;  3ONS A;  2O2V B;  3IFW B;  2LOZ A;  2N1V A;  4ILG B;  1E7V A;  2KVR A;  3WA0 A;  2LOX A;  1ZW7 A;  4HCP B;  4K7W A;  5J17 A;  4NAW A;  2Z0Q A;  3G9W A;  3A8Q A;  4JKE A;  4Z2M B;  3PPA A;  3P6A A;  1WGQ A;  2DYQ A;  2LKO A;  1KZG A;  3QWM A;  2KFK B;  4KSK C;  4WWN A;  4MGZ E;  4OVV A;  3QBV B;  2UVM A;  4DBG A;  1IPG A;  2P8V A;  4EJN A;  3QJZ A;  5HE3 A;  4URK A;  4JKA A;  3ZLZ A;  2YT0 A;  2Z0O A;  4ZDV A;  3F5R A;  2KN5 A;  2N0Y A;  4HAY B;  4JKF A;  2K8H A;  4HVB A;  3PP2 A;  2MWS B;  3FM8 C;  4TKN A;  4HJK A;  3MPX A;  2QKM A;  3ML8 A;  4TQ0 A;  4W9J A;  2DKP A;  3AUL A;  3DXE A;  1EF5 A;  2KC1 A;  1UBI A;  3N7C A;  2VSZ A;  2COC A;  4LJO B;  2G4D B;  2W2W A;  3NZU A;  1WG7 A;  3VH4 B;  4BBN F;  3QA8 A;  5LXH A;  3QHT A;  3PSC A;  4LCD E;  1BWN A;  2Q13 A;  4FN2 A;  3RZF A;  4M8N A;  3N3K B;  1WJ6 A;  2A5U A;  3PRE A;  4IWQ A;  3VAW A;  1SHC A;  2KTR A;  2FID A;  1V2Y A;  2MX2 A;  2G3Q B;  2MRP A;  5C23 A;  2IFS A;  2W2X D;  3WYF B;  2DAF A;  3PHW B;  3R7R A;  1X05 A;  3O65 B;  4MM3 A;  1X1G A;  2W2X C;  2XQN M;  1LFD A;  3VOQ A;  4FHK A;  2DZK A;  4ZRK A;  3A9J A;  4MEL A;  3NOB A;  2VRW B;  2BYV E;  3VQI A;  2I1J A;  2WX1 A;  4KIK A;  2EMS A;  2UYZ B;  4DXA B;  2H7D A;  4A20 A;  4IWP A;  4C0A A;  3KW5 B;  2DZM A;  2N1W A;  1Q5W B;  2KDI A;  4IM0 A;  4BBK A;  1TQZ A;  2PE6 B;  3RT3 B;  1JRU A;  4IAP A;  3JW0 X;  2RGF A;  4F7U P;  5CX3 A;  3ENB A;  2FAZ A;  1FXT B;  1TTN A;  5D3W A;  2CU1 A;  2DKQ A;  1OY2 A;  4HXD A;  3UIO B;  4IM2 A;  1S3S G;  3L17 A;  2P0F A;  2CHX A;  4HAX B;  2LJ5 A;  1MIX A;  1SGH A;  3U8Z A;  4F7H A;  1GUA B;  4YL8 A;  4OVU A;  4WJO A;  3PZD A;  4PQ0 A;  4FHJ A;  4HAZ B;  1UEF A;  3KY9 A;  4II2 B;  4DX8 A;  3H7P B;  3KRX A;  3NHE B;  3E66 A;  3PEG A;  4EMO A;  4HAU B;  3ODW A;  1V89 A;  4G0N B;  4FBJ B;  5L95 C;  2R09 A;  5CHV C;  1U5G A;  3KUD B;  4CHJ A;  5KQ1 A;  2MDX A;  4W9H A;  4MGI E;  2R2O A;  1Z87 A;  3PLU A;  4BVU C;  1GJZ A;  2M8S A;  2MA9 B;  1XD3 B;  2HD5 B;  1X1F A;  5E6N A;  3V6E B;  2NS5 A;  3ZRF A;  4AJY B;  2KMC A;  2LXC A;  1V61 A;  1WYW B;  3NS8 A;  2C7N B;  4KSL C;  1KZ7 A;  1NDD A;  5LLI A;  2L0T A;  4ASW C;  3DQV A;  1V86 A;  4JKB A;  1TXD A;  2M38 A;  3TBL D;  2KDF B;  4KHB B;  1V5O A;  5GMV A;  3ZNZ B;  4WAA A;  3RUL A;  5GOW B;  2CKH B;  4XWX A;  1KLV A;  2K8B A;  2K39 A;  1ZKH A;  2FCS A;  4RM8 A;  1T0Y A;  4B9K A;  5CLL B;  2IO3 B;  4K7U A;  4IC7 B;  5AZF A;  1G6J A;  3X23 A;  3OAN A;  3TVV A;  4TQ1 A;  2ZVO A;  3UIN B;  4A6F A;  2LUE A;  4PS8 A;  3PG7 A;  2GJY A;  2LGD A;  2KX3 A;  4EZL A;  2K6D B;  3DVN U;  5FI0 A;  2AWT A;  4ILJ A;  2A4Z A;  2L05 A;  2CQU A;  2GS0 A;  2MP2 B;  4NQL B;  3KYD D;  5DCN A;  5C1Z A;  2RVB B;  2LGX A;  2VKI A;  2KFJ A;  2W9N A;  4HDO A;  3ML9 A;  4FJV B;  3VVW B;  3RYT A;  2N9P C;  1GC7 A;  3BJI A;  2Z0D B;  5FI1 A;  3KVF B;  3SO6 A;  3SU8 X;  2BKR B;  1PLS A;  3AU5 A;  4K2O A;  2MKR A;  5DHF B;  3ML4 A;  4BKT A;  2J0J A;  4N9F 4;  3PVW A;  2FDQ A;  2DHI A;  2YRY A;  3W1S C;  2DEN B;  3QCA A;  2K2U A;  3ZTC A;  3QWZ B;  4MSM B;  3PRP B;  4F8C B;  2ADZ A;  2KHW B;  2G35 A;  1P9D U;  2LXA A;  3SHQ A;  5KHQ A;  3NSU A;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...