4TKNA

Structure of the snx17 ferm domain bound to the second npxf motif of krit1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
256
Chain Sequence
PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLREGSFRVTRMRCWRVTSSVPVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
molecule keywords Sorting nexin-17
total genus 77
structure length 256
sequence length 276
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4tknA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4tknA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4tknA01
1V81A 2K8HA 4GIVA 2O2VA 2K8BA 2K2JA 2KTRB 3EFUA 2KJRA 2N4FA 3IHPC 2DN6A 3QX1A 2RSGA 2RUKB 3PGEA 4MGYE 1GG3A 3AU4A 1WJNA 2JZZA 2EMTA 2LGXA 2N23A 2ZPNA 5KHQA 1W1GA 2PE9A 1K5DB 4TYZA 2KDIA 3NS8A 2B3AA 1WI1A 4A6FA 3V61A 5GMVA 3DXDA 4HAUB 3K9PB 1DDMA 2RD0A 3ZDMC 4A6HA 2BKRB 3DPDA 3QCAA 2VSZA 2IZVB 3KUCB 4GDKA 2IO0B 4NNJB 2MCNB 1FHXA 2R0DA 4W9GA 2RGFA 3B1LX 3HIZA 2Y8GA 1KJTA 3W1SA 1KI1B 2FNJB 4K1RB 3SDLC 2GBJA 5DHFB 2KDEB 2CHWA 4HAZB 2LRUA 1P1AA 3H9DA 4HATB 3ZLZA 3UQBA 4D0NB 1WGYA 2FCSA 2G4SA 1P98A 1P9DU 3PSEB 5DPSA 2C5LC 2DAJA 3C0RB 3RZWC 4EZJA 1YX6B 2KLGA 3D8DA 1WR6E 4WJOA 2WWZA 1PLSA 2MW5A 1EF1A 3OAWA 1WGGA 4II2B 5G55A 4DBGA 2JP2A 3RYTA 1WXAA 1WH3A 1E7VA 1F9JA 2CS4A 5D2MB 1VD2A 1ZSQA 4NY0A 3A4SC 5DPTA 4BKGA 4DHZE 3QC8B 2R09A 3PPAA 3M62B 3ZRFA 3ECIA 1YIWA 5L81A 2IO3B 2MP2B 2MKRA 2DYNA 2M4NA 3JSVA 3RCPA 2KJHB 3BY4B 4FN2A 4IWPA 1LW3A 5G2NA 2MRPA 3ZO5B 1UNQA 1UGMA 4HB2B 3GYPA 3HK0A 2OJRA 3SYXA 3UF8A 4J6IA 4GZUA 2CRFA 1V5OA 4MSQB 5C16A 2YS5A 5CHFA 1RFAA 2MFQA 2L3ZA 2KN5A 2KC1A 1WRDB 3PS6A 5AZGA 4IAPA 2UZSA 2A5UA 2IBIB 2ZPYA 3U30A 3M63B 2FIFA 2ZEQA 4WJNA 2CAYA 2NS5A 1Q0WB 2DKPA 2J59M 4CHJA 1TZ1A 2KD0A 2KJ6A 5D3WA 3R66C 3CIKA 2L05A 4PQ0A 1WMHB 2MX2A 4KIKA 5CLQB 2W2XD 2GBMA 2AL6A 5BO4B 3X0WA 4FJVB 3NSUA 1J0GA 4NJ7A 5CHVC 2OTXA 3U8ZA 4LCDE 3AJ4A 3APDA 3VHTC 1X1GA 1FB8A 2H7DA 2FCNA 2M17A 4E3CA 3WANA 4M0WB 3WAMA 5JHBA 4A5KA 4KHBB 1K5GB 3KY9A 4GPTB 4BFRA 1TQZA 2DYBA 3DVNV 3TO1A 2D9ZA 2J0MA 1XCGA 4K2OA 2RPQA 4GOCA 4AJYB 2DHJA 2E2XA 2IY1B 2LXCA 1EO6A 2O6VB 4GGQA 4W9FA 3VDZA 2UYZB 2DLWA 1RRBA 4GXBA 1U5DA 3QWMA 2N1VA 1DDVA 3PV1A 5JHHA 3QK0A 3ZTCA 4AP4C 4B6WA 3IG3A 4BBNC 2ZVNA 2IO2B 3IFWB 2GCLA 3RULA 1OQYA 3N32A 2UVMA 4W9KA 2KWVB 1MG8A 2DTCA 4ANXA 3IBEA 4JGHB 5HKHA 4N9F4 4WWOA 2KANA 4MSMB 4TUUA 4GMXB 4MH0E 3AU5A 2CR5A 2HTHB 1UZXB 1Z2MA 2V1YA 4LJPB 1G6JA 1U5GA 1KM7A 4TQ1A 4XX5A 3F0WA 1DYNA 2DKQA 1V6EA 2KOXA 4MELA 1SIFA 1RJ2A 2ZZPB 4MJSB 3L54A 3O65B 5LONB 2EMSA 2L0FA 1U4AA 2X18A 3OLMD 3QA8A 3ALBA 3K9OB 3UGBB 5FI0A 4G0NB 3WIMA 4DK5A 4KDLB 1DDWA 3MHSD 3ODWA 3KRXA 5D3VA 2JPHA 1P5TA 2Z0PA 2LI5A 2LVQA 3UIOB 1C3TA 4PS3A 2ZNVC 4KDIC 1UNPA 2PJHA 4NJ6A 4GMVA 3KH0A 4HLEA 2KKCA 4WAAA 1MKEA 4F1SA 4ASWC 2N0YA 3PVUA 3D8EA 3H7PB 5C5BB 1MPHA 1OTRB 2G4DB 2L00B 4A6KA 2BGFA 2Y5BB 2RSUA 4TV3A 5CHWA 5DPWA 1S1QB 3AI5A 5D94A 2M0XA 2OQBA 3MDBC 2C7HA 4TKNA 3V62A 3TVVA 1OQNA 4XZ4A 3V6EB 3UZTA 5JH5C 1LFDA 5JHAA 2MDXA 3VTWA 1SGHA 4K17A 4DX90 2D9VA 4NSWA 5EFXA 1L7YA 1W1HA 1E8WA 1X1MA 3ODOA 2YS1A 2V3SA 1EVHA 3D32A 3A98B 2K39A 1KOTA 4ANWA 4W9HA 3DBLI 2Z59B 3RUIB 3PLVA 1ZM0A 3L0WB 1UEFA 3LDZE 3NZUA 5AZFA 1NTVA 2LRWA 4K7SA 2L1CA 2BYFA 3DQVA 4B9KA 3QAQA 2DHIA 4G50A 4I6NB 4XWXA 2LWPA 3SD5A 4DHZB 2Q13A 2D4QA 3BINA 4NQLB 5IAAC 1FOEA 2DA0A 4K81A 1XKEA 3CMMB 4GDKB 4II3B 4AUQC 2ROZB 1WGRA 2NCNA 1FHOA 4L6EA 2DX1A 3PVWA 1P0RA 1TBEA 3JVZX 3NZSA 4NQKE 2M14A 3T06A 1WIAA 2EC1A 1JRUA 3ZDTA 2W9NA 1WGUA 2FCMA 3CSFA 4HCPB 4FADA 3VH3B 1WM2A 2AL3A 1WJ6A 2O6VD 1BT0A 3L16A 4CO7A 5J3QA 4GDLB 1WXVA 3RCZA 2BYVE 2I1JA 3PP2A 1WY8A 4W9JA 4MJSA 4AJWA 4F7ZA 1I42A 3ZNZB 5AEKB 2I5CA 3ZUNA 2KDBA 4KSLC 4G11A 1IP9A 1S3SG 4ANUA 2R2QA 3QARA 2JY6A 2LJ5A 3DBHI 3GZNI 1U2BA 3ULBA 1NDDA 2WX1A 3JSVB 2MLBA 3PHXB 1WE7A 2LGDA 3PRZA 1J8CA 4P7IA 1GNUA 1BTKA 1PMSA 3DVNU 4HCNB 3WYFB 4IM0A 1MAIA 2ZVOA 5JZEB 2R2OA 4H8SA 2YSZA 4EEWA 3H7PA 4FBJB 2N9PC 2FCQA 1RRPB 4FA6A 4F7GA 2YT1A 1IRSA 1E5WA 3DXEA 4OVVA 3ZW3A 2KXJA 1TXDA 4ZRJA 1U5EA 1BWNA 1P6SA 1X11A 1EUVB 2RGNB 4NAWB 1WGQA 1P3RA 5D3YA 1Q1OA 4TQ0A 3KVFB 1UH6A 2W2WA 3HM6X 3QIJA 3DOWA 3L13A 1OEYA 4A20A 1WMHA 4KIKB 1DROA 2JUOA 2ZCCA 3ONSA 3DBSA 1M7RA 2DYQA 2YRYA 1PQSA 2N7DA 2HJ8A 3EHVA 4A3PA 4IC7B 1ZW7A 4KZCA 4WWNA 4HB0B 3QWZB 2L76A 3SNHA 4WJ7A 3ENEA 2WYQA 1KZGA 3PRMB 2NMBA 1DBHA 2V76A 3JW0X 3M3JA 2YVCA 4I6LB 3UINB 3CXBB 4PS7A 2IFSA 4HVBA 1V86A 2Z0DB 2FIDA 3MTNB 3ML4A 2KDFB 2KGXB 1QQGA 3A1QA 1FGZA 4PS8A 3TMPB 3M95A 4IFSA 2ROVA 1ZGUB 4EZKA 2K1FA 3KYDD 3TBLD 2KNBA 5J18A 1NI2A 4PYUA 3ZNGC 1FGYA 2VKIA 1T0YA 5KCVA 2A4ZA 4KZ0A 1PFJA 2GOWA 4RMAA 3ZVVA 1ZKHA 4AWJA 3L08A 2KC2A 4RM9A 5KHOA 3KUDB 2EJ8A 1HE8A 2LG1A 1QZEA 2QKLA 2O2VB 4HPMB 1EAZA 2MQJA 3QQ8B 4W9CA 5E6PA 3RT3B 3TJPA 1XX0A 2D11A 1YD8U 4KSKC 3WAOA 4EUTA 1GJZA 2L8JA 3GOEA 3FEHA 4HXDA 4JL9A 1H8CA 1SE9A 1AQCA 1K8RB 1OEYJ 1N3HA 4B95A 2PE6B 4AOFA 3PZDA 2NBVB 3DDCB 5J3YA 3KYCD 4K7WA 4W9EA 2C60A 5D7GA 4E71A 3TL5A 1GUAB 1W1DA 1WGDA 3UQAA 3ML9A 1WJ1A 2D9YA 4FULA 4WQOB 4DX8A 5DIFB 3N30A 4ZRIA 3Q3JA 2ZCBA 1I2HA 1FXTB 1WF9A 1C1YB 4KV2A 3I3TB 4MGKE 2M8SA 3TFMA 2KWUB 2Z0EB 3KSYA 3VUXA 1WFYA 2V4LA 2GCJA 2I5FA 3A9JA 4MM3A 1X1FA 5KQ1A 3A33B 3WAPA 3PG7A 2GBKA 3VAWA 1KZ7A 5J17A 4BOZB 3F5RA 3PSCA 2LXAA 3B08A 4IM2A 1GC6A 1XQQA 2LOXA 3ZVRA 1MK9B 5C5BA 2CU1A 2UWQA 3AXCA 4HB3B 3H6NA 5CTRC 2LKOA 1NU2A 3A9KB 3JYUA 1IYFA 1WZ0A 2N9EB 1M94A 5J2RA 4M8MA 3KUZA 2KWCA 2DYOA 2L7RA 2YLMA 4XC2A 3VTUA 1H4RA 1TGZB 5C6RA 2GMIC 4LJOB 4IG7B 4CHMA 3HQCA 1LXDA 3VXWA 4MGZE 3ODXA 1OMWA 3KZ1A 3VIAA 4Z2NA 5KQ4A 1LM8B 3PEGA 2LYDA 2VRWB 1V5MA 3DCGA 1E7UA 1FHWA 1WGHA 2BWES 1ZC3B 4BBNF 2IY0B 2K8CA 2DHKA 1WM3A 2DZMA 5TR5A 3LJUX 1WVHA 2MBBB 3NY5A 1Q67A 2KFKA 3R7QA 4GU2A 3VUYA 4ZYNA 1VCBA 4HPLB 5LLIA 2Y7BA 3SV1A 3P2BA 1BAKA 2Z0QA 5HE2A 3H1UA 4DXAB 3OJ3A 3VVWB 2REXA 2WDTB 2L2IA 4F8CB 2OOBB 2NPTB 3PRPB 3UIPB 1ZVRA 2BYEA 5HE3A 2P0DA 1V2YA 1A5RA 2XEWA 2DX5A 3BJIA 2N9XA 5E6NA 2XQNM 3PHWB 2N1WA 4Z2MB 4Y94A 2NBWB 4HJKA 3PVLA 1NBFC 1WYWB 4M8NA 1L2NA 3RD2A 2KZRA 1MIXA 2KUPA 2XK5A 4WJPA 1M7EA 4IWQA 3V60A 4JQWC 4DDID 3A8QA 3WA0A 1Q5WB 2CODA 1WXMA 2CY5A 1WE6A 4K2PA 2DHZA 2L0TA 4BBKA 2PPHA 3TIXA 4GB9A 3VH4B 2Y8FA 3SU8X 4EFOA 4W9LA 2QHOA 3RZFA 2MWNB 1WG7A 2KTRA 1WJMA 2KMCA 2RR9A 5JP4A 2CY4A 1MK7B 3LJ3A 4DDGD 2VRRB 3SHQA 2MBQA 3QHTA 2ELBA 3ZNID 5EDSA 2O6VA 2KTFA 5LXIB 3HW2B 3B0AA 4URKA 5J3TA 4PNKA 1XD3B 1Y8RC 3KW5B 3EECA 1XODA 1GC7A 3V6CB 4BKSA 2JVCA 4BOSC 1V5TA 5C1ZA 3GYOA 2NBUA 4WVFB 4YL8A 2G45B 2COFA 1YQBA 3APFA 4HWIB 4C0AA 5LOPB 2D3GA 5D6JB 4WSFA 5AZHA 4HK2A 2YS3A 2P8VA 3N7CA 4DHJD 3HM3A 1IPGA 1WR1A 2LUEA 2NR2A 2PZ1A 3DBRI 5CX3A 2M38A 1QC6A 1J0WA 1B55A 2CKHB 4LDTD 1XD4A 2LULA 3T9LA 2P0FA 4ZRKA 2ZJDA 4HAXB 3NHEB 3TCAA 5L83A 1YX5B 2NZ8B 2AWTA 3VQIA 1RAXA 1Z87A 2HE7A 4FJYA 1XR0B 2ADZA 2K2UA 1ISNA 1X86A 3O96A 3X23A 2JWZA 1RLFA 1WXSA 1E90A 5C23A 2KK8A 2LVOA 2WX0A 1E8ZA 2D07B 2KFJA 5DPRA 4ICVA 4BVUC 3Q3FA 2FAZA 2G3QB 4MDKE 2BWFA 2IYBA 2D9XA 3KRWA 4MEMA 2MP2A 4OVUA 4I6PA 3DVGX 2ELAA 4HAVB 2J7QB 2MWSB 2KHWB 4GSWA 4ANVA 3FSSA 4K7UA 1MIZB 4A3OA 2DZJA 1E8YA 2K00A 2BF8B 2DENB 2KQSA 5IA7A 4F7UP 1EF5A 2NPTA 4IM3A 3ZKJC 3ZRCA 2KMAA 2BCJA 5DI9B 4WWPA 1U29A 1LB1A 3IVFA 1J19A 5JHGA 1WJUA 4LDTB 5D3XA 1TJ6A 3A9JB 1I7AA 3G9WA 2DAFA 2KO3A 4E74A 4DHJB 1H10A 2UZRA 5HE0A 1TTNA 2ASQA 2K6DB 1I35A 4IW0A 2YF0A 2MA9B 4GN1A 2KCJA 1UD7A 1Y5OA 2M1MA 2MBOA 2JT4B 2KVRA 3DXCA 2DYMA 3PTFC 4BKSD 3VTVA 1UBIA 2C7MB 2AEHA 3ULCA 4B6HA 4WJQA 4KVGB 2JRHA 2KX3A 2LD9A 2RVBB 2GS0A 3QJZA 2Z0OA 3CF6E 4JLCA 1X05A 4EOYA 4EZLA 2GBRA 5LXHA 2DZIA 4KAXB 1R4NI 5DCNA 5JLJB 4JIOU 4IUMB 4W9IA 3PT2B 2CHXA 2HD5B 1V5PA 2ZNVB 4X57B 4EJNA 3MPXA 4DBBA 3P7ZA 5DHAB 2KLCA 3MJWA 4FHKA 2C9WB 3ZNHB 1Y19B 2BPSA 1SHCA 3TW1A 1R4MI 5DH9B 4HB4B 1XT9B 4HAWB 1AARA 2CHZA 2K25A 2D9WA 1UBQA 2PEAA 2KFKB 3APCA 3L17A 3VOQA 3CSTA 1UELA 4CYEA 2RLOA 3P6AA 2AYOB 4YONA 2J0KA 2LGYA 1V89A 1WX8A 2MBHA 2LVPA 4A6FB 3EC8A 3OJ4B 4G3XB 3PLUA 2BKFA 4PYZA 2H7EA 1WZ3A 3U7DA 3AULA 4HDQA 2RNRB 1U27A 2W2XC 3R3MA 4BKTA 2FUHB 5D27A 2KX0A 4FHJA 1D3ZA 1Z5SB 1KLVA 1V9JA 3W1YA 1UPQA 2N7EA 4NPNA 3N3KB 1UNRA 3W1SC 5GOWB 3A9KA 5HE1A 4MK0A 2YT0A 1AWEA 3PREA 4GDLA 2EKEC 2K6QA 4NAWA 1WI0A 1FAOA 3WALA 4DWFA 2IO1B 3S2AA 2DFKA 4KHAA 4IOYX 4EKUA 5E6OA 1OGWA 5C79A 4MGIE 3DVGY 4HDOA 2MBEA 3NOBA 2KQ7A 3ZTDA 3L10B 3R7RA 3ZIMA 4EMOA 3T8MA 2JZ3B 3VUWA 1UPRA 1BTNA 4F7HA 5CLLB 2LASA 4FJZA 2FJLA 2JRIB 2QKMA 2J0JA 4KHOA 2GBNA 2JF5A 3A8PA 1V5UA 3M1IB 4HAYB 4W9DA 2P0HA 3SUZA 1V49A 4CHKA 3HHMA 1U5FA 2I1KA 3V5WA 2COAA 1V80A 1OY2A 1WX9A 2LOZA 1YJ1A 1P3QU 2C7NB 2DX5B 2COCA 2IYDB 2MSED 4ICUA 2D2QA 1V61A 3OANA 2NVUI 2JXXA 3D8FA 5FI1A 2XBBC 1ZC4B 3A1QB 3A4RA 2D10A 3FM8C 2GJYA 4ZDVA 4FLHA 4IWOA 1WX7A 3ML8A 1V88A 3SO6A 1CMXB 1EGXA 5L95C 2HTHA 2XK5B 1WJ4A 1LQBA 2DZKA 3QBVB 4MT7A 2LZ6A 4RM8A 4MY6A 5FR6A 2G35A 3VFKA 4HHVA 1E8XA 3H7SA 1NTYA
chains in the Genus database with same CATH superfamily
2K8HA 2K9XA 1YJIA 2K8BA 2K2JA 3Q6BA 1ACCA 1AW7A 1DGJA 2KTRB 3EFUA 1SE2A 4N6EB 2DN6A 2COPA 3QX1A 2WXKA 1WJNA 2EMTA 2LGXA 5G5HA 3NUHB 5KHQA 1K5DB 2KDIA 2QIEB 2RD0A 2IZVB 3KUCB 2IO0B 1FHXA 5H92C 3CWIA 1BMLC 2V4IB 2CHWA 1OFFA 4RH6A 3PSEB 1P9DU 2DAJA 1YX6B 2KLGA 1ACAA 2CQUA 2MW5A 3E56A 3FVCA 1WGGA 2JWUA 3OAWA 5G55A 3RYTA 1WXAA 1XEEA 4XDDA 2LEKA 2WH5A 1VD2A 4DHZE 2R09A 3M62B 2MP2B 2MKRA 2DYNA 3JSVA 3WCQA 3P4QB 4HB2B 1MFWA 2G9HD 3HVZA 4GZUA 2CRFA 1V5OA 2YS5A 5E6JA 2N0SB 2KN5A 1ZP0B 2UZSA 2A5UA 5HHDG 2DKPA 4CHJA 2KD0A 2INCC 2L05A 3SBGA 4PQ0A 4WAFA 5BO4B 1J0GA 2W82A 4NJ7A 3AJ4A 3APDA 2FCNA 4M0WB 3WAMA 5JHBA 4KHBB 2MJEA 4LLGM 3FAHA 4ZOHC 4BFRA 2IGGA 2DYBA 3DVNV 1EU3A 1XCGA 2RPQA 5D3DA 3AMZA 1EO6A 1B1ZA 4GGQA 3HVDA 1RRBA 4TMAB 3DBHB 3QWMA 2Z8LA 4BBNC 3IFWB 1FMAD 1OQYA 2HDEA 1MG8A 2FUG1 5IJMA 4ANXA 5HKHA 2KANA 3I63C 4GMXB 1KC7A 1Z2MA 1UZXB 3HRDD 4MELA 3GE3C 1SIFA 2QDFA 1RJ2A 2AQ3B 2EMSA 3VR8B 1F52A 1T0SC 4DK5A 3MHSD 1P5TA 2LVQA 5D3IB 2KUQA 3RMKC 3PVUA 3MP9A 4RCOA 1MPHA 1OTRB 2L00B 2Y5BB 4TV3A 2RSUA 2MEKA 2BS4B 3AI5A 2DIKA 5D94A 2C7HA 4TKNA 1OQNA 3UZTA 5JVLA 1I4XA 4DX90 2RMMA 3TEZA 3D32A 3A98B 1UWMA 2IGDA 1TY0A 3DBLI 1SF0A 1ZUD2 4IKGA 1GGOA 1N63A 4M01A 4OZCA 3PLVA 1ZM0A 3LDZE 3NZUA 3C19A 1NTVA 4JKGA 2BYFA 3QAQA 4G50A 4I6NB 1JWMD 4DHZB 2Q13A 3BINA 2D4QA 1FOEA 3CMMB 4GDKB 3B9JA 2ROZB 2KAJA 2DX1A 3NZSA 1WIAA 1C4PA 4WWMA 5M4YB 2W9NA 3CSFA 4YWGG 1JMLA 2AL3A 1IUEA 1HZ6A 1WXVA 3I57A 2KYWA 4W9JA 4MJSA 4AJWA 4ARCA 4YTNB 3ZNZB 4OVZA 3KWVA 4JX1C 5BMIA 4QXAB 2BYTA 2LJ5A 3GZNI 1MJDA 2J53A 3PHXB 1J8CA 1SIJA 1PMSA 1HEZE 4IM0A 1D6EC 5JZEB 2R2OA 1M4VA 2YSZA 2PVOD 4FBJB 1JQ4A 4F7GA 1AWDA 4ZRJA 1P6SA 1X11A 1EUVB 4NAWB 3P4PB 3KVFB 3QIJA 3DOWA 1OEYA 3R2IA 4L23A 4A20A 2L1AA 1WMHA 4KIKB 1DROA 2ZCCA 2DYQA 2N7DA 2HJ8A 4WWNA 2GLSA 2L76A 1KZGA 3PRMB 3DWMA 3CXBB 3A58A 2FIDA 2KDFB 1QLBB 1D5XC 3NZ3A 1HQRD 2KNBA 4HKQA 1E9MA 2A4ZA 1ST7A 4KZ0A 3DBRB 4AWJA 2LG1A 1JW9D 1K50A 1JALA 5E6PA 3RT3B 3TJPA 1YD8U 1V97A 4JL9A 3O13A 1OEYJ 1RFKA 2NBVB 1FXIA 3DDCB 3KYCD 2C60A 4FULA 1WJ1A 5DCNA 1FXTB 3I3TB 4A55A 1PFDA 5T8IA 2H89B 4MM3A 1X1FA 3A33B 2KQ4X 3PG7A 1K51A 3VAWA 1TS3A 4IM2A 1GC6A 1XQQA 4YXDB 3P63A 5CTRC 3H6NA 4XDCA 4NZLB 3JYUA 1IYFA 1WZ0A 1M94A 3BVZA 2DYOA 3VTUA 3P42A 4LJOB 5C6RA 1KLUD 1PDXA 1LXDA 3VXWA 1I4PA 3ODXA 3VIAA 3PEGA 3DCGA 2BWES 3PZ8A 4J3OD 2L83A 3NY5A 3R7QA 1VCBA 3SV1A 3BK1A 3VVWB 2Z0QA 3OJ3A 2L2IA 4F8CB 2INDC 1TT5B 2P0DA 2EELA 4AS1A 2DX5A 1ZOYB 2N1WA 3EA6A 1NBFC 1WYWB 1AYFA 4DDID 1MIXA 1M7EA 3OWEB 2L0TA 3T3NA 4BBKA 4GB9A 3AE7B 4ITKA 1MK7B 3EUB2 2MBQA 1N61A 2QJLA 4ZYSA 2O6VA 5J3TA 4GOUA 3NVWA 1GB1A 4BKSA 1V5TA 1D5MC 3GYOA 4WVFB 3NVZA 2YS3A 1IPGA 5CX3A 4DIXA 2M38A 4C7ZA 4LDTD 2X8XX 2VZKB 4ZRKA 2ZJDA 3TCAA 4RGNA 3V3XA 1YX5B 1Z87A 4JKAA 4S17A 4USAA 3U7ZA 1A70A 2WX0A 5DPRA 2HJ1A 4ICVA 4OVUA 4MEMA 3RFZB 2J7QB 4A3OA 1E8YA 2K00A 2BF8B 2KQSA 3ZRCA 2NPTA 3ZKJC 1YMHE 1RYJA 2NMQA 3IVFA 1P7EA 5JHGA 1WJUA 4LDTB 5D3XA 1FRDA 2DAFA 2N9KA 1FNVA 1YJJA 4GN1A 1UD7A 2WXFA 3AE2B 2WQYB 3QJZA 2LD9A 1ZYIA 1SE3A 4OHJA 3CF6E 4EOYA 1X05A 4EZLA 2GBRA 2DZIA 5JLJB 4JIOU 3PT2B 2HD5B 2G1EA 3P7ZA 2QMTA 3ZNHB 2C9WB 1MHHE 3TW1A 5DH9B 1XT9B 5FK9C 3NVVA 2OJWA 1KH0A 2OEDA 1UELA 4CYEA 1VDVA 3TEYA 4A6FB 1XCQL 3U7DA 1U27A 2W2XC 4BKTA 1UNRA 3PREA 3W9CB 1FAOA 3U12A 4QJ4B 4IOYX 5E6OA 2BW2A 3ZTDA 1C77A 1LO5D 2OHFA 3NOBA 3ZIMA 4EMOA 2WP9B 4F7HA 1BTNA 4CSQA 3GP7A 2LASA 3IT6B 4KHOA 4QJ3B 2GBNA 2X38A 3M1IB 2P0HA 4CHKA 2AQ1B 2I1KA 1V80A 1YJ1A 2C7NB 4ZRQA 1OY2A 4A8XC 2IYDB 1N5WA 2QSDA 3A1QB 2GJYA 4IWOA 4HSIA 1WX7A 3SO6A 2HTHA 2JWZA 1NTYA 4GNKB 4D6WA 4M0WA 4C4VB 1ESFA 3IHPC 4MH8A 2RUKB 1GG3A 5G5GA 1NTIA 1W1GA 3GZNB 4A6FA 1MPEA 1DYQA 1DDMA 3SEBA 3ZDMC 2K3UA 2BKRB 3QCAA 3Q8FA 2VSZA 3N20C 4KKIA 2KN4A 2R0DA 2RPVA 2ON8A 2Y8GA 2FNJB 1XLPA 2YEPF 3SDLC 2GBJA 2KDEB 4HAZB 3UQBA 3PO0A 5DPSA 2I38A 5BYQA 1FFVA 4EZJA 4WJOA 4C00A 2WWZA 1PLSA 4II2B 1TZOA 4E71A 2GRIA 1WH3A 1E7VA 2CS4A 4BKGA 1FNWA 3QC8B 3PPAA 2M4NA 1GPXA 2HTME 3BY4B 5G2NA 2MRPA 3V05A 1UNQA 1UGMA 5C16A 3PS6A 1ZXHA 1L6VA 2FIFA 2CAYA 2J59M 1TZ1A 2KJ6A 4N59A 3CIKA 3W2DA 1WMHB 4KIKA 2W2XD 5CHVC 2OTXA 1X1GA 1FB8A 1K5GB 2WXIA 1L0YB 4K2OA 2E2XA 2UYZB 2DLWA 1U5DA 3PV1A 4AP4C 1GOZA 2D3AA 3IG3A 2NTTA 2IO2B 3N32A 4JGHB 3ZJUA 4N9F4 3P1MA 2L32A 2CR5A 4O1NA 4RNAA 2W3SA 3Q8EA 4C80A 3L54A 3O65B 3AEGB 2L0FA 1U4AA 1EWYC 3K9OB 4KDLB 2WHIA 3HSAA 5D3VA 2JPHA 2LI5A 3KWLA 4PS3A 2ZNVC 1UNPA 4GMVA 3AE8B 3AH7A 1VR9A 4WAAA 1MKEA 4ASWC 2N0YA 3D8EA 4OSNA 5CHWA 2BGFA 5DPWA 4P16A 2K5PA 4WH4A 3MDBC 3TVVA 5JHAA 3U2SC 4K17A 5EFXA 3Q3MC 1AN8A 1E8WA 2YS1A 1KOTA 1Q10A 4W9HA 3TUOA 4Q2JA 4RF0A 4CQNA 3DHHC 1UEFA 3L0WB 4B9KA 1RWSA 3DQVA 4BAXA 4ZHOA 5BYRA 2GB1A 1L0XB 3FILB 1FHOA 1P0RA 1TBEA 3JVZX 1OQRA 2EC1A 3Q69A 3RNCC 1J7AA 2KR0A 4HCPB 2O6VD 1N60A 3PP2A 3MC0B 4F7ZA 3P4SB 4KSLC 4G11A 4ANUA 3QARA 4TSSA 3DBHI 1U2BA 2MLBA 1WE7A 2N9LA 4P7IA 1GNUA 1BTKA 4HCNB 3DWGC 2M0AA 3E9SA 2INPE 3ZW3A 3SFDB 1TXDA 1U5EA 1WGQA 4TQ0A 1Q1OA 4UDUC 3KLSX 3E9OA 1DOYA 3U52E 1C4CA 1LGRA 3ONSA 4ILHA 1M7RA 4A3PA 2LJIA 1J7CA 3SNHA 4C7YA 3M3JA 2V76A 1MG4A 2NTSA 1V86A 4KGSA 1EU4A 1I7HA 3M95A 4IFSA 1ZGUB 3Q14C 4EZKA 5J18A 1NI2A 3N1YC 4LNNA 1T0YA 1A5RA 1PFJA 1ZKHA 1HE8A 2O2VB 1SE4A 2JSVX 3NS1A 1QOAA 1L5PA 1GJZA 1XX0A 2DBYA 3N1XC 3FEHA 3VRBB 4DXGA 4B95A 2PE6B 4AOFA 4W9EA 4K7WA 5D7GA 1WGDA 2D9YA 1D4BA 4JPSA 4KV2A 4MGKE 4OZAA 1C1YB 3TFMA 3N1ZC 3VUXA 2V4LA 4A90A 3A9JA 5KQ1A 1KZ7A 4BOZB 3F5RA 1F0ZA 2LXAA 3B08A 2LOXA 1MK9B 2CU1A 3AXCA 4HB3B 3NJTA 3OG5A 3A9KB 1FEHA 2N9EB 2FBWB 2W55A 2WXHA 1TGZB 2GMIC 4PK1A 4CHMA 2IGHA 2UU7A 3HQCA 2L52A 5BMGA 1LM8B 1OMWA 5KQ4A 4K3BA 1E7PB 1E7UA 1WGHA 2DHKA 3RN9C 1I4RA 2KFKA 1KF6B 4GU2A 3ZJTA 4HPLB 2Y7BA 2XNAC 1BAKA 3RPFC 3R2TA 4RF1A 2V0GA 1SJED 1ZVRA 2ICIA 3RNGC 1V2YA 5HI1A 2N9XA 2XQNM 3PHWB 1DOXA 4Z2MB 2YEPB 3FLVA 3PVLA 2J42A 4M8NA 2KZRA 4WJPA 2MH7A 1Q5WB 1WXMA 1IGCA 1WE6A 4P1CC 2DHZA 1TKEA 2Y8FA 4W9LA 2QHOA 3C8YA 2KTRA 1DOIA 5JP4A 2VRRB 3QHTA 2ELBA 3ZNID 5EDSA 3B0AA 1ET9A 4URKA 3V6CB 1NVID 1GC7A 2V9HA 3DCXA 4BOSC 3AM9A 2JYTA 4YL8A 3TEWA 3APFA 4C0AA 5LOPB 4LTUA 3N7CA 4REZA 1WR1A 2NR2A 2CKHB 1CZPA 2LULA 3KQ4A 2KT7A 2AWTA 2BVCA 1RAXA 2HE7A 5AEKB 2K22A 1X86A 5C23A 1RLFA 1WXSA 4N58A 2KK8A 2LVOA 2I2YA 1SJHD 3Q3FA 2FAZA 2BWFA 3KRWA 2ELAA 3FSSA 1MIZB 2QC8A 2DENB 5IRSA 2SEBD 4JWUC 1EF5A 2D5GA 5IA7A 2KMAA 3CIRB 3W5VB 5DI9B 1J19A 1ENFA 1TJ6A 2KO3A 2KDMA 2J4XA 1I4QA 4DHJB 1TTNA 1I35A 2PPHA 2KCJA 3DXCA 1UBIA 3ULCA 4B6HA 4WJQA 2GS0A 2Z0OA 1WSPA 4JLCA 5LXHA 2CHXA 1UGJA 5LXIB 3MPXA 3BYTB 2D9WA 2PEAA 3L17A 2RLOA 4YONA 2J0KA 2LGYA 1V89A 2LVPA 4G3XB 4KGTA 2BKFA 1WZ3A 3AE5B 3IAS1 2RNRB 3R3MA 3RI7C 2FUHB 1V9JA 3NRZA 5I4DA 5HE1A 4MK0A 2YT0A 1AWEA 2WGSA 1WI0A 1VLBA 2WDQB 3WALA 5AUIA 2IO1B 1JWBD 3ETRA 2KQ7A 2K0PA 3T8MA 2JZ3B 3VUWA 1C76A 4FJZA 2FJLA 2JRIB 2BTEA 1VJKA 1NI3A 4RGTA 2WXJA 5I2MA 1V49A 3HHMA 1U5FA 3OLMD 2ZKMX 3AEDB 2DX5B 1P3QU 2MSED 2D2QA 1V61A 3OANA 2NVUI 2XBBC 5FI1A 4NJCA 3A4RA 4FLHA 4KGRA 1V1PA 1OQQA 1D5ZC 3ML8A 1V88A 1WJ4A 1LQBA 1J7BA 3RNBC 3QBVB 4RM8A 4R3DA 2MJDA 5FR6A 3VFKA 3BWUD 4HHVA 1WGKA 1VBGA 1V81A 3H7SA 5EE0A 1YQ4B 2O2VA 3NWDA 1TY2A 4YTPB 4JK7A 2N4FA 4D2KA 2RSGA 4MGYE 4C56C 2JZZA 3I9V1 2N23A 4JKGB 2ZPNA 4TYZA 2B3AA 3E9LA 1WI1A 2IPKD 2VH2A 5GMVA 3DXDA 4HAUB 3V61A 3K9PB 1KTKA 1K52A 3DPDA 4GDKA 2RGFA 1KJTA 1KI1B 1ZDVA 1L6UA 5DHFB 1P1AA 4HATB 1WGYA 4HEA1 2G4SA 5IP4D 3AEEB 2KMMA 3RZWC 3D8DA 1EWCA 1FNUA 2JP2A 1F9JA 1XCTL 3HUIA 5D2MB 4JKHA 1ZSQA 4WQMA 5DPTA 3ZRFA 1E10A 3ECIA 1YIWA 5L81A 4FN2A 4E74A 4IWPA 1ROEA 3RCPA 2KJHB 1LW3A 3UF8A 1VRAB 3GYPA 2LBBA 3HK0A 3SYXA 5CHFA 1RFAA 2L3ZA 1WRDB 5AZGA 1HB6A 3U30A 2ZEQA 4WJNA 3E66A 3R66C 5D3WA 1T77A 3X0WA 2AL6A 4WURA 3U8ZA 3VHTC 2H7DA 5AUKA 4A5KA 3GS2A 1TQZA 1MHXA 2J0MA 4ARIA 4GOCA 4AJYB 2DHJA 2LXCA 2IY1B 3VDZA 4W9FA 1F1HA 4GXBA 3QK0A 2RDHA 3DHIC 5EE9A 2WXGA 2GCLA 3RULA 3HIEA 3PZ7A 2KWVB 3MHZA 1ZPSA 3IBEA 1N62A 1K53A 4MSMB 4TUUA 4LJPB 1G6JA 2AQ2B 1U5GA 1KM7A 4TQ1A 4XX5A 4JK9A 1DYNA 2DKQA 1FFUA 3ZQ4A 4B0EA 3TEXA 5FKAC 2ZZPB 3H8HA 4AQ7A 4XE0A 1ZE3D 3GB1A 1L4DB 1VZ8A 3Q8AA 1T0RC 4G0NB 3WIMA 1DDWA 3AEAB 4JWSC 2Z0PA 2PJHA 3KH0A 4HLEA 2KKCA 2JXTA 1FO4A 1JCKB 4A6KA 1JWUD 2Y3AA 1I4GA 2IJ0A 1LFDA 2MDXA 3VTWA 1T3QA 3MJ5A 2D9VA 5FR3A 1L7YA 3ODOA 3GE8C 2BB6A 2PW9A 4P6VF 2LRWA 2DHIA 3T3OA 4XWXA 1CK1A 3SD5A 2K49A 2WXRA 4NQLB 4K81A 3BK2A 4L2YA 1WGRA 4L6EA 1WWTA 3B2FA 1E6EB 2M14A 4DQOC 3T06A 2KWDA 5H8YE 2XN9C 1WRIA 1JRUA 1WGUA 2FCMA 1WM2A 1WJ6A 1BT0A 1B9RA 4MT5A 5J3QA 4GDLB 3RCZA 4IOIE 4B0MA 1I4HA 2I5CA 3ZUNA 1VZ6A 2KIGA 2Z59A 2R2QA 3JSVB 1NDDA 2WX1A 3PRZA 1TS4A 3NW8A 3DVNU 3VR9B 1P7FA 1MAIA 1YN4A 4H8SA 2FCQA 1RRPB 4FA6A 1XO3A 1SB3C 2YT1A 1IRSA 4HRSA 1VBHA 2SAKA 1PGAA 1BWNA 2RGNB 5D3YA 3HM6X 3L13A 2DWQA 4KX6B 1IBXA 2CB8A 3DBSA 3EHVA 1VZ7A 4IC7B 1HTQA 1ZW7A 2YT2A 3E9PA 4HB0B 5IOIA 3ENEA 2WYQA 2NMBA 4I6LB 3JW0X 3UINB 2YVCA 4ACFA 4PS7A 3ML4A 2KGXB 1QQGA 4YSYB 2WXNA 1FGZA 3A1QA 4PS8A 3TMPB 2ROVA 2WLBA 1QOGA 2JZPA 4PYUA 3ZNGC 4EE2A 2VKIA 4A9AA 2BB5A 4ZRPA 3ZVVA 4KKJA 5KHOA 3KUDB 3ENBA 4FADA 3AEBB 1EAZA 4W9CA 1FCLA 2D11A 3WAOA 1QOFA 1XLOA 2RQ1A 2L8JA 1H8CA 1SE9A 1AQCA 1N3HA 3PZDA 4QAYA 5J3YA 1W1DA 1XF5L 2X0SA 3ML9A 1GB4A 4WQOB 4NAMA 1V8CA 4DX8A 5DIFB 3N30A 4ZRIA 3Q3JA 1WF9A 2Z0EB 2I5FA 3ZXVA 3WAPA 1N6ZA 2GBKA 5J17A 3ZVRA 5C5BA 2LKOA 1NU2A 3Q2AC 3IAM1 4US8A 3EFCA 2W54A 5J2RA 4M8MA 2KWCA 1H4RA 4IG7B 4LNKA 1FHWA 2IY0B 1WM3A 2DZMA 5TR5A 1WVHA 2MBBB 3VUYA 1Q67A 2ACZB 5LLIA 3AE9B 1TKYA 4DXAB 2OOBB 2NPTB 1TKGA 5HE3A 2XEWA 3IXSA 1FXAA 4Y94A 1L2NA 3RD2A 2WNMA 2E6XA 3V60A 4JQWC 2CODA 2CY5A 3Q3OC 2Q5WD 3SU8X 3NWFA 2MWNB 1WG7A 1MI1A 1WJMA 2CY4A 3LJ3A 3SHQA 3NVYA 2KTFA 3HW2B 4JE3B 4PNKA 1XD3B 3EECA 1XODA 1DIKA 2LGIA 2QILA 1R7SA 1C79A 1XLNA 4HWIB 4WSFA 4HK2A 2P8VA 4DHJD 3LYYA 2PZ1A 1QC6A 1B55A 1XD4A 3T9LA 2P0FA 2WU5B 1T5XD 2DLBA 3NHEB 4QJ5B 2NZ8B 3VQIA 4FJYA 1XR0B 2K2UA 1XXGA 4K3CA 1YQ3B 2KFJA 3NWAA 2G3QB 4MDKE 3ZXRA 2D9XA 2MP2A 4S0RA 2CJOA 4I6PA 3DVGX 4ZHPA 4GSWA 1NENB 4K7UA 2DZJA 3AE4B 4F7UP 2DNFA 1MVKA 4WWPA 4BZAA 1KFYB 3G9WA 1I7AA 1NVLA 2ABDA 1FCCC 1H10A 2UZRA 5HE0A 1NEKB 1NYRA 2K6DB 4HPPA 2WXOA 4IW0A 3VRAB 2YF0A 2CJNA 4II3B 3PTFC 2M1MA 4BKSD 2KVRA 2C7MB 2FE8A 2AEHA 4KVGB 1KRHA 2JRHA 2KX3A 3AV8A 4W9IA 1V5PA 4EJNA 5DHAB 2KLCA 4FHKA 2BPSA 1SHCA 1R4MI 1CJEA 3AEFB 4HAWB 1AARA 2CHZA 2IDYA 2W3RA 3P6AA 3RNEC 1WX8A 2MBHA 3PLUA 1ZDXA 3AULA 4HDQA 4MACA 1KLVA 5D27A 4FHJA 3P4RB 1UPQA 2N7EA 4XGAB 3N3KB 3W1SC 3BVMA 4NAWA 2EKEC 1QT9A 1T6BX 4DWFA 4KHAA 1OGWA 2PMVA 1C4AA 1QQRA 2MBEA 3L10B 1SXTA 1TYGB 1QOBA 1TS5A 3A8PA 4HAYB 2QCZA 4W9DA 3SUZA 1WX9A 3AE6B 4ICUA 2LOZA 3D8FA 1HZ5A 2BS3B 2WS3B 4LK0M 1EGXA 1QILA 4MT7A 2LZ6A 1JWSD 4MY6A 1E8XA 4GIVA 4YSZB 1F2RI 1NYQA 5C3JB 2KJRA 1YN5A 4IDIA 2PVGC 1ET6A 3PGEA 3AU4A 2VZKD 2PKOA 2R82A 2PE9A 3NS8A 5IO9A 3SFEB 4A6HA 4NNJB 2AX5A 2MCNB 4W9GA 2LMCA 3B1LX 3HIZA 3W1SA 4K1RB 2FDQA 3SBTA 2GUMA 3H9DA 3ZLZA 2LRUA 5TSSA 4D0NB 2FCSA 2E3TA 1IGDA 1P98A 3W5UB 2C5LC 3C0RB 1WR6E 2ZW1A 3URYA 5LNK1 1EF1A 4DBGA 1V1OA 3UI3A 4GLSC 3AECB 4NY0A 3A4SC 4EFOA 4YTMB 3Q8CA 2K8EA 2IO3B 1F2RC 3ZO5B 2OJRA 4MSQB 2JQRB 2MFQA 2KC1A 4IAPA 2IBIB 2ZPYA 4ILGB 3M63B 2VH1A 1V1PB 2LHDA 2NS5A 1WXQA 1Q0WB 4OW0A 1RM6C 2MX2A 5CLQB 2GBMA 4FJVB 3NSUA 4LCDE 2M17A 4E3CA 3RNAC 3WANA 2WXPA 1FD6A 3KY9A 4GPTB 3TO1A 2D9ZA 2WDRB 1YN3A 2O6VB 2N1VA 3ZTCA 1DDVA 5JHHA 3EPYA 2Z4DA 4B6WA 2ZVNA 1PGBA 4FXCA 4L1RA 2UVMA 4W9KA 2DTCA 1T0QC 4WWOA 1JROA 1YNTE 4MH0E 3AU5A 2V1YA 2HTHB 3F0WA 1SEBD 2WU2B 1V6EA 2KOXA 1L0VB 4MJSB 5LONB 2X18A 2TSSA 3QA8A 3ALBA 1JDEA 5IKCM 3UGBB 5FI0A 4JK8A 3MC9A 3ODWA 1C78A 3KRXA 1XLQA 1STEA 3UIOB 1UUPA 1C3TA 2CU3A 4KDIC 2RDGA 4NJ6A 1HTOA 3TSSA 1PYWD 4F1SA 1HB8A 1TIFA 3H7PB 5C5BB 2G4DB 2R61A 1S1QB 3B77A 2M0XA 2WDVB 2OQBA 3N9YC 4LNOA 3V62A 4XZ4A 3V6EB 3Q3NC 5JH5C 2KIEA 1SGHA 3DHGC 4NSWA 2JX5A 1W1HA 1X1MA 1MI0A 2V3SA 1EVHA 2K39A 4OT1A 4ANWA 4C4VA 1HXYD 4JKDA 1JRPA 2Z59B 3RUIB 2Y5PA 5AZFA 4K7SA 2L1CA 4DXFA 2RRFA 2LWPA 4LNFA 1CQVA 4P1BC 5IAAC 2DA0A 1XKEA 2RDBC 4AUQC 2NCNA 3AB5A 3PVWA 4NQKE 2V3PA 1UWXA 4RGMA 3ZDTA 5BMHA 1R4NB 3VH3B 3L16A 4HROA 4CO7A 3ZJVA 3ZYYX 2BYVE 2I1JA 1WY8A 3BZDB 1I42A 1KBLA 2KDBA 1IP9A 5HFYA 1S3SG 2Y5CA 2JY6A 2N7JA 3ULBA 3I5JC 2LGDA 3WYFB 2ZVOA 4EEWA 3H7PA 2N9PC 1E5WA 3DXEA 4OVVA 2J52A 2KXJA 4LNIA 2BT6A 3AE3B 1P3RA 1UH6A 2W2WA 3BIID 1HA5A 2EKIA 4KHBA 2JUOA 2YRYA 1PQSA 1QF6A 4KZCA 5EE1A 3QWZB 2KACA 4WJ7A 1R4MB 4ILJA 1DBHA 1UF0A 2IFSA 4HVBA 2Z0DB 2FJUB 3MTNB 4M00A 1BUIC 2K1FA 3KYDD 2H88B 4H2AA 3TBLD 2MHJA 1FGYA 3AE1B 5KCVA 4RMAA 2GOWA 3SR6A 3L08A 2KC2A 4RM9A 5EE3A 2EJ8A 1WYGA 1QZEA 4BVUC 2QKLA 4HPMB 2LHEA 2MQJA 3QQ8B 5LG4B 1KLGD 4KSKC 4EUTA 3GOEA 4HXDA 1FRRA 4US9A 1FIQA 1K8RB 2M19A 2D3CA 5IN7A 3TL5A 1GUAB 3UQAA 2QEJC 3U4EG 2ZCBA 1I2HA 3B2GA 2M8SA 2KWUB 3KSYA 1WFYA 1Y56A 1BXTA 2GCJA 1QKZA 5GXGB 3PSCA 3FILA 2UWQA 4JKFA 2M56B 3R8BA 5JXVA 3KUZA 2L7RA 2PIAA 2YLMA 4XC2A 2PLPA 2Z13A 1SSNA 4MGZE 3KZ1A 4Z2NA 2LYDA 2VRWB 1V5MA 1GAQB 4BBNF 4RFBA 1ZC3B 4XYCA 2K8CA 5I2SA 2R2YA 3LJUX 3ABVB 4ZYNA 3P2BA 1YOVB 1E0ZA 4HKZE 5HE2A 3H1UA 3IT4B 2REXA 2WDTB 3PRPB 3UIPB 3RNFC 2BYEA 1HBKA 2WXMA 3J9CA 3BJIA 5E6NA 3EGRA 5BYSA 4HJKA 2NBWB 2GI9A 4JKBA 2KUPA 2XK5A 4IWQA 3A8QA 3BYYB 3WA0A 3VH4B 3TIXA 4K2PA 1PUTA 3RZFA 2KMCA 2RR9A 4DDGD 1F77A 4HJGE 2Z14A 2HRJA 1PGXA 1Y8RC 3KW5B 1JWAD 2FJ9A 2LGSA 2JVCA 2KVZA 5C1ZA 2V3NA 2NBUA 2G45B 2COFA 1YQBA 2BS2B 5D6JB 2D3GA 5AZHA 3HM3A 3FKYA 2LUEA 3DBRI 2BQQA 1J0WA 2JYEA 2BBCA 4HAXB 5L83A 2ADZA 3O96A 3X23A 1ISNA 1E90A 1E8ZA 2D07B 3AN1A 4JKEA 2IYBA 4HAVB 1EM7A 2MWSB 2KHWB 4ANVA 2LUMA 1UNSA 3MC8A 1FPYA 4IM3A 2BCJA 4L1BA 2B76B 1U29A 1LB1A 1TJEA 3A9JB 2ASQA 1C9FA 4M02A 4YT0B 2MBOA 2MA9B 1Y5OA 2JT4B 2INNE 2DYMA 2ONQA 3L4PA 3VTVA 1L4ZB 2LFIA 2RVBB 2PTLA 3DBLB 4KAXB 1R4NI 2MJ3A 5MPOA 4IUMB 4X57B 2ZNVB 4DBBA 2JU6X 3MJWA 1Y19B 5HG2A 2NBVA 4HB4B 2K25A 4XWTA 3OHMB 4YSXB 1UBQA 2KFKB 3APCA 3VOQA 3CSTA 2AYOB 3NG0A 3FP5A 3EC8A 3OJ4B 4PYZA 2H7EA 3FC4A 4MM3B 3MFGA 1D3ZA 2KX0A 1Z5SB 3W1YA 2WXLA 4NPNA 5GOWB 3A9KA 1N5XA 4PT5A 4WIPA 3BVGA 4GDLA 2K6QA 4JKCA 3LB8C 1FM0D 1SBBB 3S2AA 2DFKA 3LXFA 4EKUA 2ZW0A 5C79A 4MGIE 3DVGY 4HDOA 3R7RA 5C2TB 4XWWA 1UPRA 5CLLB 2D3BA 2QKMA 2J0JA 2JF5A 1ZXIA 1V5UA 3V5WA 2COAA 2COCA 4A6QA 4RGOS 2JXXA 4ZDVA 1ZC4B 2D10A 3FM8C 3ZGZA 1CMXB 4OZBA 5L95C 2WXQA 2XK5B 2DZKA 3Q8BA 1TS2A 1IBXB 2G35A 4J6IA
chains in the Genus database with same CATH topology
2K8HA 2K8BA 2K2JA 2KTRB 3EFUA 2DN6A 2COPA 3QX1A 1WJNA 2EMTA 2LGXA 5KHQA 1K5DB 2KDIA 2RD0A 2IZVB 3KUCB 2IO0B 1FHXA 2CHWA 3PSEB 1P9DU 2DAJA 1YX6B 2KLGA 1ACAA 2CQUA 2MW5A 3OAWA 1WGGA 5G55A 3RYTA 1WXAA 2WH5A 1VD2A 4DHZE 2R09A 3M62B 2MP2B 2MKRA 2DYNA 3JSVA 4HB2B 4GZUA 2CRFA 1V5OA 2YS5A 2KN5A 2UZSA 2A5UA 2DKPA 4CHJA 2KD0A 2L05A 3SBGA 4PQ0A 5BO4B 1J0GA 4NJ7A 3AJ4A 3APDA 2FCNA 4M0WB 3WAMA 5JHBA 4KHBB 4BFRA 2DYBA 3DVNV 1XCGA 2RPQA 1EO6A 4GGQA 1RRBA 3QWMA 4BBNC 3IFWB 1OQYA 1MG8A 5IJMA 4ANXA 5HKHA 2KANA 4GMXB 1KC7A 1Z2MA 1UZXB 4MELA 1SIFA 1RJ2A 2EMSA 4DK5A 3MHSD 1P5TA 2LVQA 3PVUA 1MPHA 1OTRB 2L00B 2Y5BB 4TV3A 2RSUA 3AI5A 2DIKA 5D94A 2C7HA 4TKNA 1OQNA 3UZTA 5JVLA 4DX90 3D32A 3A98B 3DBLI 1GGOA 3PLVA 1ZM0A 3LDZE 3NZUA 1NTVA 4JKGA 2BYFA 3QAQA 4G50A 4I6NB 4DHZB 2Q13A 3BINA 2D4QA 1FOEA 3CMMB 4GDKB 2ROZB 2DX1A 3NZSA 1WIAA 2W9NA 3CSFA 2AL3A 1WXVA 4W9JA 4MJSA 4AJWA 3ZNZB 2LJ5A 3GZNI 3PHXB 1J8CA 1PMSA 4IM0A 5JZEB 2R2OA 2YSZA 4FBJB 4F7GA 4ZRJA 1P6SA 1X11A 1EUVB 4NAWB 3KVFB 3QIJA 3DOWA 1OEYA 4A20A 1WMHA 4KIKB 1DROA 2ZCCA 2DYQA 2N7DA 2HJ8A 4WWNA 2L76A 1KZGA 3PRMB 3CXBB 2FIDA 2KDFB 2KNBA 4KZ0A 2A4ZA 1ST7A 4AWJA 2LG1A 5E6PA 3RT3B 3TJPA 1YD8U 4JL9A 1OEYJ 2NBVB 3DDCB 3KYCD 2C60A 4FULA 1WJ1A 5DCNA 1FXTB 3I3TB 4MM3A 1X1FA 3A33B 3PG7A 3VAWA 4IM2A 1GC6A 1XQQA 5CTRC 3H6NA 3JYUA 1IYFA 1WZ0A 1M94A 2DYOA 3VTUA 4LJOB 5C6RA 1LXDA 3VXWA 3ODXA 3VIAA 3PEGA 3DCGA 2BWES 3NY5A 3R7QA 1VCBA 3SV1A 3VVWB 2Z0QA 3OJ3A 2L2IA 4F8CB 2P0DA 2DX5A 2N1WA 1NBFC 1WYWB 4DDID 1MIXA 1M7EA 2L0TA 4BBKA 4GB9A 1MK7B 2MBQA 2O6VA 5J3TA 4BKSA 1V5TA 3GYOA 4WVFB 2YS3A 1IPGA 5CX3A 2M38A 4LDTD 4ZRKA 2ZJDA 3TCAA 1YX5B 1Z87A 4JKAA 2WX0A 5DPRA 4ICVA 4OVUA 4MEMA 2J7QB 4A3OA 1E8YA 2K00A 2BF8B 2KQSA 3ZRCA 2NPTA 3ZKJC 3IVFA 5JHGA 1WJUA 4LDTB 5D3XA 2DAFA 4GN1A 1UD7A 3QJZA 2LD9A 3CF6E 4EOYA 1X05A 4EZLA 2GBRA 2DZIA 5JLJB 4JIOU 3PT2B 2HD5B 3P7ZA 3ZNHB 2C9WB 3TW1A 5DH9B 1XT9B 1UELA 4CYEA 4A6FB 3U7DA 1U27A 2W2XC 4BKTA 1UNRA 3PREA 1FAOA 4IOYX 5E6OA 3ZTDA 3NOBA 3ZIMA 4EMOA 4F7HA 1BTNA 2LASA 4KHOA 2GBNA 3M1IB 2P0HA 4CHKA 2I1KA 1V80A 1YJ1A 2C7NB 1OY2A 2IYDB 3A1QB 2GJYA 4IWOA 1WX7A 3SO6A 2HTHA 2JWZA 1NTYA 3IHPC 2RUKB 1GG3A 1NTIA 1W1GA 4A6FA 1DDMA 3ZDMC 2BKRB 3QCAA 2VSZA 2R0DA 2Y8GA 2FNJB 3SDLC 2GBJA 2KDEB 4HAZB 3UQBA 5DPSA 4EZJA 4WJOA 2WWZA 1PLSA 4II2B 4E71A 1WH3A 1E7VA 2CS4A 4BKGA 3QC8B 3PPAA 2M4NA 3BY4B 5G2NA 2MRPA 1UNQA 1UGMA 5C16A 3PS6A 2FIFA 2CAYA 2J59M 1TZ1A 2KJ6A 3CIKA 1WMHB 4KIKA 2W2XD 5CHVC 2OTXA 1X1GA 1FB8A 1K5GB 4K2OA 2E2XA 2UYZB 2DLWA 1U5DA 3PV1A 4AP4C 3IG3A 2IO2B 3N32A 4JGHB 4N9F4 2CR5A 3L54A 3O65B 2L0FA 1U4AA 3K9OB 4KDLB 5D3VA 2JPHA 2LI5A 4PS3A 2ZNVC 1UNPA 4GMVA 4WAAA 1MKEA 4ASWC 2N0YA 3D8EA 5CHWA 2BGFA 5DPWA 3MDBC 3TVVA 5JHAA 4K17A 5EFXA 1E8WA 2YS1A 1KOTA 4W9HA 3L0WB 1UEFA 4B9KA 3DQVA 1FHOA 1P0RA 1TBEA 3JVZX 2EC1A 4HCPB 2O6VD 3PP2A 4F7ZA 4KSLC 4G11A 4ANUA 3QARA 3DBHI 1U2BA 2MLBA 1WE7A 4P7IA 1GNUA 1BTKA 4HCNB 3ZW3A 1TXDA 1U5EA 1WGQA 4TQ0A 1Q1OA 3E9OA 3ONSA 4ILHA 1M7RA 4A3PA 3SNHA 3M3JA 2V76A 1V86A 3M95A 4IFSA 1ZGUB 4EZKA 5J18A 1NI2A 1T0YA 1A5RA 1PFJA 1ZKHA 1HE8A 2O2VB 1GJZA 1XX0A 3FEHA 4B95A 2PE6B 4AOFA 4W9EA 4K7WA 5D7GA 1WGDA 2D9YA 4KV2A 4MGKE 1C1YB 3TFMA 3VUXA 2V4LA 3A9JA 5KQ1A 1KZ7A 4BOZB 3F5RA 2LXAA 3B08A 2LOXA 1MK9B 2CU1A 3AXCA 4HB3B 3A9KB 2N9EB 1TGZB 2GMIC 4CHMA 3HQCA 1LM8B 1OMWA 5KQ4A 1E7UA 1WGHA 2DHKA 2KFKA 4GU2A 4HPLB 2Y7BA 1BAKA 1ZVRA 1V2YA 2N9XA 2XQNM 3PHWB 4Z2MB 3FLVA 3PVLA 4M8NA 2KZRA 4WJPA 1Q5WB 1WXMA 1WE6A 2DHZA 2Y8FA 4W9LA 2QHOA 2KTRA 5JP4A 2VRRB 3QHTA 2ELBA 3ZNID 5EDSA 3B0AA 4URKA 3V6CB 1GC7A 4BOSC 4YL8A 3APFA 4C0AA 5LOPB 3N7CA 1WR1A 2NR2A 2CKHB 2LULA 2AWTA 1RAXA 2HE7A 5AEKB 1X86A 5C23A 1RLFA 1WXSA 2KK8A 2LVOA 3Q3FA 2FAZA 2BWFA 3KRWA 2ELAA 3FSSA 1MIZB 2DENB 5IA7A 1EF5A 2KMAA 5DI9B 1J19A 1TJ6A 2KO3A 4DHJB 1TTNA 1I35A 2PPHA 2KCJA 3DXCA 1UBIA 3ULCA 4B6HA 4WJQA 2GS0A 2Z0OA 4JLCA 5LXHA 2CHXA 5LXIB 3MPXA 2D9WA 2PEAA 3L17A 2RLOA 4YONA 2J0KA 2LGYA 1V89A 2LVPA 4G3XB 2BKFA 1WZ3A 2RNRB 3R3MA 2FUHB 1V9JA 5HE1A 4MK0A 2YT0A 1AWEA 1WI0A 3WALA 2IO1B 2KQ7A 3T8MA 2JZ3B 3VUWA 4FJZA 2FJLA 2JRIB 1V49A 3HHMA 3OLMD 1U5FA 2DX5B 1P3QU 2MSED 2D2QA 1V61A 3OANA 2NVUI 2XBBC 5FI1A 3A4RA 4FLHA 3ML8A 1V88A 1WJ4A 1LQBA 3QBVB 4RM8A 3VFKA 5FR6A 4HHVA 3H7SA 1VBGA 1V81A 2O2VA 4JK7A 2N4FA 2RSGA 4MGYE 2JZZA 2N23A 4JKGB 2ZPNA 4TYZA 2B3AA 3E9LA 1WI1A 3V61A 5GMVA 3DXDA 4HAUB 3K9PB 3DPDA 4GDKA 2RGFA 1KJTA 1KI1B 5DHFB 1P1AA 4HATB 1WGYA 2G4SA 3RZWC 3D8DA 2JP2A 1F9JA 5D2MB 4JKHA 1ZSQA 5DPTA 3ZRFA 3ECIA 1YIWA 5L81A 4FN2A 4E74A 4IWPA 3RCPA 2KJHB 1LW3A 3UF8A 3GYPA 2LBBA 3HK0A 3SYXA 5CHFA 1RFAA 2L3ZA 1WRDB 5AZGA 1HB6A 3U30A 2ZEQA 4WJNA 3E66A 3R66C 5D3WA 3X0WA 2AL6A 3U8ZA 3VHTC 2H7DA 4A5KA 1TQZA 2J0MA 4GOCA 4AJYB 2DHJA 2LXCA 2IY1B 3VDZA 4W9FA 4GXBA 3QK0A 2GCLA 3RULA 2KWVB 3IBEA 4MSMB 4TUUA 4LJPB 1G6JA 1U5GA 1KM7A 4TQ1A 4XX5A 4JK9A 1DYNA 2DKQA 2ZZPB 4G0NB 3WIMA 1DDWA 2Z0PA 2PJHA 3KH0A 4HLEA 2KKCA 4A6KA 1LFDA 2MDXA 3VTWA 2D9VA 1L7YA 3ODOA 2LRWA 2DHIA 4XWXA 3SD5A 4NQLB 4K81A 1WGRA 4L6EA 2M14A 3T06A 1JRUA 1WGUA 2FCMA 1WM2A 1WJ6A 1BT0A 5J3QA 4GDLB 3RCZA 2I5CA 3ZUNA 2R2QA 3JSVB 1NDDA 2WX1A 3PRZA 3DVNU 1MAIA 4H8SA 2FCQA 1RRPB 4FA6A 2YT1A 1IRSA 1VBHA 1BWNA 2RGNB 5D3YA 3HM6X 3L13A 2CB8A 3DBSA 3EHVA 4IC7B 1ZW7A 3E9PA 4HB0B 3ENEA 2WYQA 2NMBA 4I6LB 3JW0X 3UINB 2YVCA 4PS7A 3ML4A 2KGXB 1QQGA 3A1QA 1FGZA 4PS8A 3TMPB 2ROVA 4PYUA 3ZNGC 2VKIA 3ZVVA 5KHOA 3KUDB 3ENBA 4FADA 1EAZA 4W9CA 2D11A 3WAOA 2RQ1A 2L8JA 1H8CA 1SE9A 1AQCA 1N3HA 3PZDA 5J3YA 1W1DA 2X0SA 3ML9A 4WQOB 4DX8A 5DIFB 3N30A 4ZRIA 3Q3JA 1WF9A 2Z0EB 2I5FA 3WAPA 2GBKA 5J17A 3ZVRA 5C5BA 2LKOA 1NU2A 5J2RA 4M8MA 2KWCA 1H4RA 4IG7B 1FHWA 2IY0B 1WM3A 2DZMA 5TR5A 1WVHA 2MBBB 3VUYA 1Q67A 5LLIA 4DXAB 2OOBB 2NPTB 5HE3A 2XEWA 4Y94A 1L2NA 3RD2A 3V60A 4JQWC 2CODA 2CY5A 3SU8X 2MWNB 1WG7A 1WJMA 2CY4A 3LJ3A 3SHQA 2KTFA 3HW2B 4PNKA 1XD3B 3EECA 1XODA 1DIKA 4HWIB 4WSFA 4HK2A 2P8VA 4DHJD 2PZ1A 1QC6A 1B55A 1XD4A 3T9LA 2P0FA 3NHEB 3VQIA 2NZ8B 4FJYA 1XR0B 2K2UA 2KFJA 2G3QB 4MDKE 2D9XA 2MP2A 4I6PA 3DVGX 4GSWA 4K7UA 2DZJA 4F7UP 4WWPA 3G9WA 1I7AA 1NVLA 2ABDA 1H10A 2UZRA 5HE0A 2K6DB 4IW0A 2YF0A 4II3B 3PTFC 2M1MA 4BKSD 2KVRA 2C7MB 2AEHA 4KVGB 2JRHA 2KX3A 4W9IA 1V5PA 4EJNA 5DHAB 2KLCA 4FHKA 2BPSA 1SHCA 1R4MI 4HAWB 1AARA 2CHZA 3P6AA 1WX8A 2MBHA 3PLUA 3AULA 4HDQA 1KLVA 5D27A 4FHJA 1UPQA 2N7EA 3N3KB 3W1SC 4NAWA 2EKEC 4DWFA 4KHAA 1OGWA 2MBEA 3L10B 3A8PA 4HAYB 4W9DA 3SUZA 1WX9A 4ICUA 2LOZA 3D8FA 1EGXA 4MT7A 2LZ6A 4MY6A 1E8XA 4GIVA 2KJRA 3PGEA 3AU4A 2R82A 2PE9A 3NS8A 4A6HA 4NNJB 2MCNB 4W9GA 3B1LX 3HIZA 3W1SA 4K1RB 2FDQA 3SBTA 3H9DA 3ZLZA 2LRUA 4D0NB 2FCSA 1P98A 2C5LC 3C0RB 1WR6E 1EF1A 4DBGA 4NY0A 3A4SC 4EFOA 2IO3B 3ZO5B 2OJRA 4MSQB 2MFQA 2KC1A 4IAPA 2IBIB 2ZPYA 4ILGB 3M63B 2NS5A 1Q0WB 2MX2A 5CLQB 2GBMA 4FJVB 3NSUA 4LCDE 2M17A 4E3CA 3WANA 3KY9A 4GPTB 3TO1A 2D9ZA 2O6VB 2N1VA 3ZTCA 1DDVA 5JHHA 3EPYA 4B6WA 2ZVNA 2UVMA 4W9KA 2DTCA 4WWOA 4MH0E 3AU5A 2V1YA 2HTHB 3F0WA 1V6EA 2KOXA 4MJSB 5LONB 2X18A 3QA8A 3ALBA 1JDEA 3UGBB 5FI0A 4JK8A 3ODWA 3KRXA 3UIOB 1C3TA 4KDIC 4NJ6A 4F1SA 1HB8A 3H7PB 5C5BB 2G4DB 1S1QB 2M0XA 2OQBA 3V62A 4XZ4A 3V6EB 5JH5C 1SGHA 4NSWA 1W1HA 1X1MA 2V3SA 1EVHA 2K39A 4ANWA 4JKDA 2Z59B 3RUIB 5AZFA 4K7SA 2L1CA 2LWPA 5IAAC 2DA0A 1XKEA 4AUQC 2NCNA 3PVWA 4NQKE 3ZDTA 3VH3B 3L16A 4CO7A 2BYVE 2I1JA 1WY8A 1I42A 1KBLA 2KDBA 1IP9A 1S3SG 2JY6A 3ULBA 2LGDA 3WYFB 2ZVOA 4EEWA 3H7PA 2N9PC 1E5WA 3DXEA 4OVVA 2KXJA 1P3RA 1UH6A 2W2WA 2JUOA 2YRYA 1PQSA 4KZCA 3QWZB 4WJ7A 4ILJA 1DBHA 2IFSA 4HVBA 2Z0DB 3MTNB 2K1FA 3KYDD 3TBLD 1FGYA 5KCVA 4RMAA 2GOWA 3L08A 2KC2A 4RM9A 2EJ8A 1QZEA 4BVUC 2QKLA 4HPMB 2MQJA 3QQ8B 4KSKC 4EUTA 3GOEA 4HXDA 1K8RB 3TL5A 1GUAB 3UQAA 2ZCBA 1I2HA 2M8SA 2KWUB 3KSYA 1WFYA 2GCJA 3PSCA 2UWQA 4JKFA 3KUZA 2L7RA 2YLMA 4XC2A 4MGZE 3KZ1A 4Z2NA 2LYDA 2VRWB 1V5MA 4BBNF 1ZC3B 2K8CA 3LJUX 4ZYNA 3P2BA 5HE2A 3H1UA 2REXA 2WDTB 3PRPB 3UIPB 2BYEA 1HBKA 3BJIA 5E6NA 4HJKA 2NBWB 4JKBA 2KUPA 2XK5A 4IWQA 3A8QA 3WA0A 3VH4B 3TIXA 4K2PA 3RZFA 2KMCA 2RR9A 4DDGD 2HRJA 1Y8RC 3KW5B 2FJ9A 2JVCA 5C1ZA 2NBUA 2G45B 2COFA 1YQBA 5D6JB 2D3GA 5AZHA 3HM3A 2LUEA 3DBRI 1J0WA 4HAXB 5L83A 2ADZA 3O96A 3X23A 1ISNA 1E90A 1E8ZA 2D07B 4JKEA 2IYBA 4HAVB 2MWSB 2KHWB 4ANVA 4IM3A 2BCJA 1U29A 1LB1A 3A9JB 2ASQA 2MA9B 2MBOA 1Y5OA 2JT4B 2DYMA 3VTVA 2RVBB 4KAXB 1R4NI 4IUMB 4X57B 2ZNVB 4DBBA 3MJWA 1Y19B 4HB4B 2K25A 1UBQA 2KFKB 3APCA 3VOQA 3CSTA 2AYOB 3FP5A 3EC8A 3OJ4B 4PYZA 2H7EA 1D3ZA 2KX0A 1Z5SB 3W1YA 4NPNA 5GOWB 3A9KA 4GDLA 2K6QA 4JKCA 3S2AA 2DFKA 4EKUA 5C79A 4MGIE 3DVGY 4HDOA 3R7RA 1UPRA 5CLLB 2QKMA 2J0JA 2JF5A 1V5UA 3V5WA 2COAA 2COCA 2JXXA 4ZDVA 1ZC4B 2D10A 3FM8C 1CMXB 5L95C 2XK5B 2DZKA 2G35A 4J6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V81 A;  2K8H A;  4GIV A;  2O2V A;  2K8B A;  2K2J A;  2KTR B;  3EFU A;  2KJR A;  2N4F A;  3IHP C;  2DN6 A;  3QX1 A;  2RSG A;  2RUK B;  3PGE A;  4MGY E;  1GG3 A;  3AU4 A;  1WJN A;  2JZZ A;  2EMT A;  2LGX A;  2N23 A;  2ZPN A;  5KHQ A;  1W1G A;  2PE9 A;  1K5D B;  4TYZ A;  2KDI A;  3NS8 A;  2B3A A;  1WI1 A;  4A6F A;  3V61 A;  5GMV A;  3DXD A;  4HAU B;  3K9P B;  1DDM A;  2RD0 A;  3ZDM C;  4A6H A;  2BKR B;  3DPD A;  3QCA A;  2VSZ A;  2IZV B;  3KUC B;  4GDK A;  2IO0 B;  4NNJ B;  2MCN B;  1FHX A;  2R0D A;  4W9G A;  2RGF A;  3B1L X;  3HIZ A;  2Y8G A;  1KJT A;  3W1S A;  1KI1 B;  2FNJ B;  4K1R B;  3SDL C;  2GBJ A;  5DHF B;  2KDE B;  2CHW A;  4HAZ B;  2LRU A;  1P1A A;  3H9D A;  4HAT B;  3ZLZ A;  3UQB A;  4D0N B;  1WGY A;  2FCS A;  2G4S A;  1P98 A;  1P9D U;  3PSE B;  5DPS A;  2C5L C;  2DAJ A;  3C0R B;  3RZW C;  4EZJ A;  1YX6 B;  2KLG A;  3D8D A;  1WR6 E;  4WJO A;  2WWZ A;  1PLS A;  2MW5 A;  1EF1 A;  3OAW A;  1WGG A;  4II2 B;  5G55 A;  4DBG A;  2JP2 A;  3RYT A;  1WXA A;  1WH3 A;  1E7V A;  1F9J A;  2CS4 A;  5D2M B;  1VD2 A;  1ZSQ A;  4NY0 A;  3A4S C;  5DPT A;  4BKG A;  4DHZ E;  3QC8 B;  2R09 A;  3PPA A;  3M62 B;  3ZRF A;  3ECI A;  1YIW A;  5L81 A;  2IO3 B;  2MP2 B;  2MKR A;  2DYN A;  2M4N A;  3JSV A;  3RCP A;  2KJH B;  3BY4 B;  4FN2 A;  4IWP A;  1LW3 A;  5G2N A;  2MRP A;  3ZO5 B;  1UNQ A;  1UGM A;  4HB2 B;  3GYP A;  3HK0 A;  2OJR A;  3SYX A;  3UF8 A;  4J6I A;  4GZU A;  2CRF A;  1V5O A;  4MSQ B;  5C16 A;  2YS5 A;  5CHF A;  1RFA A;  2MFQ A;  2L3Z A;  2KN5 A;  2KC1 A;  1WRD B;  3PS6 A;  5AZG A;  4IAP A;  2UZS A;  2A5U A;  2IBI B;  2ZPY A;  3U30 A;  3M63 B;  2FIF A;  2ZEQ A;  4WJN A;  2CAY A;  2NS5 A;  1Q0W B;  2DKP A;  2J59 M;  4CHJ A;  1TZ1 A;  2KD0 A;  2KJ6 A;  5D3W A;  3R66 C;  3CIK A;  2L05 A;  4PQ0 A;  1WMH B;  2MX2 A;  4KIK A;  5CLQ B;  2W2X D;  2GBM A;  2AL6 A;  5BO4 B;  3X0W A;  4FJV B;  3NSU A;  1J0G A;  4NJ7 A;  5CHV C;  2OTX A;  3U8Z A;  4LCD E;  3AJ4 A;  3APD A;  3VHT C;  1X1G A;  1FB8 A;  2H7D A;  2FCN A;  2M17 A;  4E3C A;  3WAN A;  4M0W B;  3WAM A;  5JHB A;  4A5K A;  4KHB B;  1K5G B;  3KY9 A;  4GPT B;  4BFR A;  1TQZ A;  2DYB A;  3DVN V;  3TO1 A;  2D9Z A;  2J0M A;  1XCG A;  4K2O A;  2RPQ A;  4GOC A;  4AJY B;  2DHJ A;  2E2X A;  2IY1 B;  2LXC A;  1EO6 A;  2O6V B;  4GGQ A;  4W9F A;  3VDZ A;  2UYZ B;  2DLW A;  1RRB A;  4GXB A;  1U5D A;  3QWM A;  2N1V A;  1DDV A;  3PV1 A;  5JHH A;  3QK0 A;  3ZTC A;  4AP4 C;  4B6W A;  3IG3 A;  4BBN C;  2ZVN A;  2IO2 B;  3IFW B;  2GCL A;  3RUL A;  1OQY A;  3N32 A;  2UVM A;  4W9K A;  2KWV B;  1MG8 A;  2DTC A;  4ANX A;  3IBE A;  4JGH B;  5HKH A;  4N9F 4;  4WWO A;  2KAN A;  4MSM B;  4TUU A;  4GMX B;  4MH0 E;  3AU5 A;  2CR5 A;  2HTH B;  1UZX B;  1Z2M A;  2V1Y A;  4LJP B;  1G6J A;  1U5G A;  1KM7 A;  4TQ1 A;  4XX5 A;  3F0W A;  1DYN A;  2DKQ A;  1V6E A;  2KOX A;  4MEL A;  1SIF A;  1RJ2 A;  2ZZP B;  4MJS B;  3L54 A;  3O65 B;  5LON B;  2EMS A;  2L0F A;  1U4A A;  2X18 A;  3OLM D;  3QA8 A;  3ALB A;  3K9O B;  3UGB B;  5FI0 A;  4G0N B;  3WIM A;  4DK5 A;  4KDL B;  1DDW A;  3MHS D;  3ODW A;  3KRX A;  5D3V A;  2JPH A;  1P5T A;  2Z0P A;  2LI5 A;  2LVQ A;  3UIO B;  1C3T A;  4PS3 A;  2ZNV C;  4KDI C;  1UNP A;  2PJH A;  4NJ6 A;  4GMV A;  3KH0 A;  4HLE A;  2KKC A;  4WAA A;  1MKE A;  4F1S A;  4ASW C;  2N0Y A;  3PVU A;  3D8E A;  3H7P B;  5C5B B;  1MPH A;  1OTR B;  2G4D B;  2L00 B;  4A6K A;  2BGF A;  2Y5B B;  2RSU A;  4TV3 A;  5CHW A;  5DPW A;  1S1Q B;  3AI5 A;  5D94 A;  2M0X A;  2OQB A;  3MDB C;  2C7H A;  4TKN A;  3V62 A;  3TVV A;  1OQN A;  4XZ4 A;  3V6E B;  3UZT A;  5JH5 C;  1LFD A;  5JHA A;  2MDX A;  3VTW A;  1SGH A;  4K17 A;  4DX9 0;  2D9V A;  4NSW A;  5EFX A;  1L7Y A;  1W1H A;  1E8W A;  1X1M A;  3ODO A;  2YS1 A;  2V3S A;  1EVH A;  3D32 A;  3A98 B;  2K39 A;  1KOT A;  4ANW A;  4W9H A;  3DBL I;  2Z59 B;  3RUI B;  3PLV A;  1ZM0 A;  3L0W B;  1UEF A;  3LDZ E;  3NZU A;  5AZF A;  1NTV A;  2LRW A;  4K7S A;  2L1C A;  2BYF A;  3DQV A;  4B9K A;  3QAQ A;  2DHI A;  4G50 A;  4I6N B;  4XWX A;  2LWP A;  3SD5 A;  4DHZ B;  2Q13 A;  2D4Q A;  3BIN A;  4NQL B;  5IAA C;  1FOE A;  2DA0 A;  4K81 A;  1XKE A;  3CMM B;  4GDK B;  4II3 B;  4AUQ C;  2ROZ B;  1WGR A;  2NCN A;  1FHO A;  4L6E A;  2DX1 A;  3PVW A;  1P0R A;  1TBE A;  3JVZ X;  3NZS A;  4NQK E;  2M14 A;  3T06 A;  1WIA A;  2EC1 A;  1JRU A;  3ZDT A;  2W9N A;  1WGU A;  2FCM A;  3CSF A;  4HCP B;  4FAD A;  3VH3 B;  1WM2 A;  2AL3 A;  1WJ6 A;  2O6V D;  1BT0 A;  3L16 A;  4CO7 A;  5J3Q A;  4GDL B;  1WXV A;  3RCZ A;  2BYV E;  2I1J A;  3PP2 A;  1WY8 A;  4W9J A;  4MJS A;  4AJW A;  4F7Z A;  1I42 A;  3ZNZ B;  5AEK B;  2I5C A;  3ZUN A;  2KDB A;  4KSL C;  4G11 A;  1IP9 A;  1S3S G;  4ANU A;  2R2Q A;  3QAR A;  2JY6 A;  2LJ5 A;  3DBH I;  3GZN I;  1U2B A;  3ULB A;  1NDD A;  2WX1 A;  3JSV B;  2MLB A;  3PHX B;  1WE7 A;  2LGD A;  3PRZ A;  1J8C A;  4P7I A;  1GNU A;  1BTK A;  1PMS A;  3DVN U;  4HCN B;  3WYF B;  4IM0 A;  1MAI A;  2ZVO A;  5JZE B;  2R2O A;  4H8S A;  2YSZ A;  4EEW A;  3H7P A;  4FBJ B;  2N9P C;  2FCQ A;  1RRP B;  4FA6 A;  4F7G A;  2YT1 A;  1IRS A;  1E5W A;  3DXE A;  4OVV A;  3ZW3 A;  2KXJ A;  1TXD A;  4ZRJ A;  1U5E A;  1BWN A;  1P6S A;  1X11 A;  1EUV B;  2RGN B;  4NAW B;  1WGQ A;  1P3R A;  5D3Y A;  1Q1O A;  4TQ0 A;  3KVF B;  1UH6 A;  2W2W A;  3HM6 X;  3QIJ A;  3DOW A;  3L13 A;  1OEY A;  4A20 A;  1WMH A;  4KIK B;  1DRO A;  2JUO A;  2ZCC A;  3ONS A;  3DBS A;  1M7R A;  2DYQ A;  2YRY A;  1PQS A;  2N7D A;  2HJ8 A;  3EHV A;  4A3P A;  4IC7 B;  1ZW7 A;  4KZC A;  4WWN A;  4HB0 B;  3QWZ B;  2L76 A;  3SNH A;  4WJ7 A;  3ENE A;  2WYQ A;  1KZG A;  3PRM B;  2NMB A;  1DBH A;  2V76 A;  3JW0 X;  3M3J A;  2YVC A;  4I6L B;  3UIN B;  3CXB B;  4PS7 A;  2IFS A;  4HVB A;  1V86 A;  2Z0D B;  2FID A;  3MTN B;  3ML4 A;  2KDF B;  2KGX B;  1QQG A;  3A1Q A;  1FGZ A;  4PS8 A;  3TMP B;  3M95 A;  4IFS A;  2ROV A;  1ZGU B;  4EZK A;  2K1F A;  3KYD D;  3TBL D;  2KNB A;  5J18 A;  1NI2 A;  4PYU A;  3ZNG C;  1FGY A;  2VKI A;  1T0Y A;  5KCV A;  2A4Z A;  4KZ0 A;  1PFJ A;  2GOW A;  4RMA A;  3ZVV A;  1ZKH A;  4AWJ A;  3L08 A;  2KC2 A;  4RM9 A;  5KHO A;  3KUD B;  2EJ8 A;  1HE8 A;  2LG1 A;  1QZE A;  2QKL A;  2O2V B;  4HPM B;  1EAZ A;  2MQJ A;  3QQ8 B;  4W9C A;  5E6P A;  3RT3 B;  3TJP A;  1XX0 A;  2D11 A;  1YD8 U;  4KSK C;  3WAO A;  4EUT A;  1GJZ A;  2L8J A;  3GOE A;  3FEH A;  4HXD A;  4JL9 A;  1H8C A;  1SE9 A;  1AQC A;  1K8R B;  1OEY J;  1N3H A;  4B95 A;  2PE6 B;  4AOF A;  3PZD A;  2NBV B;  3DDC B;  5J3Y A;  3KYC D;  4K7W A;  4W9E A;  2C60 A;  5D7G A;  4E71 A;  3TL5 A;  1GUA B;  1W1D A;  1WGD A;  3UQA A;  3ML9 A;  1WJ1 A;  2D9Y A;  4FUL A;  4WQO B;  4DX8 A;  5DIF B;  3N30 A;  4ZRI A;  3Q3J A;  2ZCB A;  1I2H A;  1FXT B;  1WF9 A;  1C1Y B;  4KV2 A;  3I3T B;  4MGK E;  2M8S A;  3TFM A;  2KWU B;  2Z0E B;  3KSY A;  3VUX A;  1WFY A;  2V4L A;  2GCJ A;  2I5F A;  3A9J A;  4MM3 A;  1X1F A;  5KQ1 A;  3A33 B;  3WAP A;  3PG7 A;  2GBK A;  3VAW A;  1KZ7 A;  5J17 A;  4BOZ B;  3F5R A;  3PSC A;  2LXA A;  3B08 A;  4IM2 A;  1GC6 A;  1XQQ A;  2LOX A;  3ZVR A;  1MK9 B;  5C5B A;  2CU1 A;  2UWQ A;  3AXC A;  4HB3 B;  3H6N A;  5CTR C;  2LKO A;  1NU2 A;  3A9K B;  3JYU A;  1IYF A;  1WZ0 A;  2N9E B;  1M94 A;  5J2R A;  4M8M A;  3KUZ A;  2KWC A;  2DYO A;  2L7R A;  2YLM A;  4XC2 A;  3VTU A;  1H4R A;  1TGZ B;  5C6R A;  2GMI C;  4LJO B;  4IG7 B;  4CHM A;  3HQC A;  1LXD A;  3VXW A;  4MGZ E;  3ODX A;  1OMW A;  3KZ1 A;  3VIA A;  4Z2N A;  5KQ4 A;  1LM8 B;  3PEG A;  2LYD A;  2VRW B;  1V5M A;  3DCG A;  1E7U A;  1FHW A;  1WGH A;  2BWE S;  1ZC3 B;  4BBN F;  2IY0 B;  2K8C A;  2DHK A;  1WM3 A;  2DZM A;  5TR5 A;  3LJU X;  1WVH A;  2MBB B;  3NY5 A;  1Q67 A;  2KFK A;  3R7Q A;  4GU2 A;  3VUY A;  4ZYN A;  1VCB A;  4HPL B;  5LLI A;  2Y7B A;  3SV1 A;  3P2B A;  1BAK A;  2Z0Q A;  5HE2 A;  3H1U A;  4DXA B;  3OJ3 A;  3VVW B;  2REX A;  2WDT B;  2L2I A;  4F8C B;  2OOB B;  2NPT B;  3PRP B;  3UIP B;  1ZVR A;  2BYE A;  5HE3 A;  2P0D A;  1V2Y A;  1A5R A;  2XEW A;  2DX5 A;  3BJI A;  2N9X A;  5E6N A;  2XQN M;  3PHW B;  2N1W A;  4Z2M B;  4Y94 A;  2NBW B;  4HJK A;  3PVL A;  1NBF C;  1WYW B;  4M8N A;  1L2N A;  3RD2 A;  2KZR A;  1MIX A;  2KUP A;  2XK5 A;  4WJP A;  1M7E A;  4IWQ A;  3V60 A;  4JQW C;  4DDI D;  3A8Q A;  3WA0 A;  1Q5W B;  2COD A;  1WXM A;  2CY5 A;  1WE6 A;  4K2P A;  2DHZ A;  2L0T A;  4BBK A;  2PPH A;  3TIX A;  4GB9 A;  3VH4 B;  2Y8F A;  3SU8 X;  4EFO A;  4W9L A;  2QHO A;  3RZF A;  2MWN B;  1WG7 A;  2KTR A;  1WJM A;  2KMC A;  2RR9 A;  5JP4 A;  2CY4 A;  1MK7 B;  3LJ3 A;  4DDG D;  2VRR B;  3SHQ A;  2MBQ A;  3QHT A;  2ELB A;  3ZNI D;  5EDS A;  2O6V A;  2KTF A;  5LXI B;  3HW2 B;  3B0A A;  4URK A;  5J3T A;  4PNK A;  1XD3 B;  1Y8R C;  3KW5 B;  3EEC A;  1XOD A;  1GC7 A;  3V6C B;  4BKS A;  2JVC A;  4BOS C;  1V5T A;  5C1Z A;  3GYO A;  2NBU A;  4WVF B;  4YL8 A;  2G45 B;  2COF A;  1YQB A;  3APF A;  4HWI B;  4C0A A;  5LOP B;  2D3G A;  5D6J B;  4WSF A;  5AZH A;  4HK2 A;  2YS3 A;  2P8V A;  3N7C A;  4DHJ D;  3HM3 A;  1IPG A;  1WR1 A;  2LUE A;  2NR2 A;  2PZ1 A;  3DBR I;  5CX3 A;  2M38 A;  1QC6 A;  1J0W A;  1B55 A;  2CKH B;  4LDT D;  1XD4 A;  2LUL A;  3T9L A;  2P0F A;  4ZRK A;  2ZJD A;  4HAX B;  3NHE B;  3TCA A;  5L83 A;  1YX5 B;  2NZ8 B;  2AWT A;  3VQI A;  1RAX A;  1Z87 A;  2HE7 A;  4FJY A;  1XR0 B;  2ADZ A;  2K2U A;  1ISN A;  1X86 A;  3O96 A;  3X23 A;  2JWZ A;  1RLF A;  1WXS A;  1E90 A;  5C23 A;  2KK8 A;  2LVO A;  2WX0 A;  1E8Z A;  2D07 B;  2KFJ A;  5DPR A;  4ICV A;  4BVU C;  3Q3F A;  2FAZ A;  2G3Q B;  4MDK E;  2BWF A;  2IYB A;  2D9X A;  3KRW A;  4MEM A;  2MP2 A;  4OVU A;  4I6P A;  3DVG X;  2ELA A;  4HAV B;  2J7Q B;  2MWS B;  2KHW B;  4GSW A;  4ANV A;  3FSS A;  4K7U A;  1MIZ B;  4A3O A;  2DZJ A;  1E8Y A;  2K00 A;  2BF8 B;  2DEN B;  2KQS A;  5IA7 A;  4F7U P;  1EF5 A;  2NPT A;  4IM3 A;  3ZKJ C;  3ZRC A;  2KMA A;  2BCJ A;  5DI9 B;  4WWP A;  1U29 A;  1LB1 A;  3IVF A;  1J19 A;  5JHG A;  1WJU A;  4LDT B;  5D3X A;  1TJ6 A;  3A9J B;  1I7A A;  3G9W A;  2DAF A;  2KO3 A;  4E74 A;  4DHJ B;  1H10 A;  2UZR A;  5HE0 A;  1TTN A;  2ASQ A;  2K6D B;  1I35 A;  4IW0 A;  2YF0 A;  2MA9 B;  4GN1 A;  2KCJ A;  1UD7 A;  1Y5O A;  2M1M A;  2MBO A;  2JT4 B;  2KVR A;  3DXC A;  2DYM A;  3PTF C;  4BKS D;  3VTV A;  1UBI A;  2C7M B;  2AEH A;  3ULC A;  4B6H A;  4WJQ A;  4KVG B;  2JRH A;  2KX3 A;  2LD9 A;  2RVB B;  2GS0 A;  3QJZ A;  2Z0O A;  3CF6 E;  4JLC A;  1X05 A;  4EOY A;  4EZL A;  2GBR A;  5LXH A;  2DZI A;  4KAX B;  1R4N I;  5DCN A;  5JLJ B;  4JIO U;  4IUM B;  4W9I A;  3PT2 B;  2CHX A;  2HD5 B;  1V5P A;  2ZNV B;  4X57 B;  4EJN A;  3MPX A;  4DBB A;  3P7Z A;  5DHA B;  2KLC A;  3MJW A;  4FHK A;  2C9W B;  3ZNH B;  1Y19 B;  2BPS A;  1SHC A;  3TW1 A;  1R4M I;  5DH9 B;  4HB4 B;  1XT9 B;  4HAW B;  1AAR A;  2CHZ A;  2K25 A;  2D9W A;  1UBQ A;  2PEA A;  2KFK B;  3APC A;  3L17 A;  3VOQ A;  3CST A;  1UEL A;  4CYE A;  2RLO A;  3P6A A;  2AYO B;  4YON A;  2J0K A;  2LGY A;  1V89 A;  1WX8 A;  2MBH A;  2LVP A;  4A6F B;  3EC8 A;  3OJ4 B;  4G3X B;  3PLU A;  2BKF A;  4PYZ A;  2H7E A;  1WZ3 A;  3U7D A;  3AUL A;  4HDQ A;  2RNR B;  1U27 A;  2W2X C;  3R3M A;  4BKT A;  2FUH B;  5D27 A;  2KX0 A;  4FHJ A;  1D3Z A;  1Z5S B;  1KLV A;  1V9J A;  3W1Y A;  1UPQ A;  2N7E A;  4NPN A;  3N3K B;  1UNR A;  3W1S C;  5GOW B;  3A9K A;  5HE1 A;  4MK0 A;  2YT0 A;  1AWE A;  3PRE A;  4GDL A;  2EKE C;  2K6Q A;  4NAW A;  1WI0 A;  1FAO A;  3WAL A;  4DWF A;  2IO1 B;  3S2A A;  2DFK A;  4KHA A;  4IOY X;  4EKU A;  5E6O A;  1OGW A;  5C79 A;  4MGI E;  3DVG Y;  4HDO A;  2MBE A;  3NOB A;  2KQ7 A;  3ZTD A;  3L10 B;  3R7R A;  3ZIM A;  4EMO A;  3T8M A;  2JZ3 B;  3VUW A;  1UPR A;  1BTN A;  4F7H A;  5CLL B;  2LAS A;  4FJZ A;  2FJL A;  2JRI B;  2QKM A;  2J0J A;  4KHO A;  2GBN A;  2JF5 A;  3A8P A;  1V5U A;  3M1I B;  4HAY B;  4W9D A;  2P0H A;  3SUZ A;  1V49 A;  4CHK A;  3HHM A;  1U5F A;  2I1K A;  3V5W A;  2COA A;  1V80 A;  1OY2 A;  1WX9 A;  2LOZ A;  1YJ1 A;  1P3Q U;  2C7N B;  2DX5 B;  2COC A;  2IYD B;  2MSE D;  4ICU A;  2D2Q A;  1V61 A;  3OAN A;  2NVU I;  2JXX A;  3D8F A;  5FI1 A;  2XBB C;  1ZC4 B;  3A1Q B;  3A4R A;  2D10 A;  3FM8 C;  2GJY A;  4ZDV A;  4FLH A;  4IWO A;  1WX7 A;  3ML8 A;  1V88 A;  3SO6 A;  1CMX B;  1EGX A;  5L95 C;  2HTH A;  2XK5 B;  1WJ4 A;  1LQB A;  2DZK A;  3QBV B;  4MT7 A;  2LZ6 A;  4RM8 A;  4MY6 A;  5FR6 A;  2G35 A;  3VFK A;  4HHV A;  1E8X A;  3H7S A;  1NTY A; 
#chains in the Genus database with same CATH topology
 2K8H A;  2K9X A;  1YJI A;  2K8B A;  2K2J A;  3Q6B A;  1ACC A;  1AW7 A;  1DGJ A;  2KTR B;  3EFU A;  1SE2 A;  4N6E B;  2DN6 A;  2COP A;  3QX1 A;  2WXK A;  1WJN A;  2EMT A;  2LGX A;  5G5H A;  3NUH B;  5KHQ A;  1K5D B;  2KDI A;  2QIE B;  2RD0 A;  2IZV B;  3KUC B;  2IO0 B;  1FHX A;  5H92 C;  3CWI A;  1BML C;  2V4I B;  2CHW A;  1OFF A;  4RH6 A;  3PSE B;  1P9D U;  2DAJ A;  1YX6 B;  2KLG A;  1ACA A;  2CQU A;  2MW5 A;  3E56 A;  3FVC A;  1WGG A;  2JWU A;  3OAW A;  5G55 A;  3RYT A;  1WXA A;  1XEE A;  4XDD A;  2LEK A;  2WH5 A;  1VD2 A;  4DHZ E;  2R09 A;  3M62 B;  2MP2 B;  2MKR A;  2DYN A;  3JSV A;  3WCQ A;  3P4Q B;  4HB2 B;  1MFW A;  2G9H D;  3HVZ A;  4GZU A;  2CRF A;  1V5O A;  2YS5 A;  5E6J A;  2N0S B;  2KN5 A;  1ZP0 B;  2UZS A;  2A5U A;  5HHD G;  2DKP A;  4CHJ A;  2KD0 A;  2INC C;  2L05 A;  3SBG A;  4PQ0 A;  4WAF A;  5BO4 B;  1J0G A;  2W82 A;  4NJ7 A;  3AJ4 A;  3APD A;  2FCN A;  4M0W B;  3WAM A;  5JHB A;  4KHB B;  2MJE A;  4LLG M;  3FAH A;  4ZOH C;  4BFR A;  2IGG A;  2DYB A;  3DVN V;  1EU3 A;  1XCG A;  2RPQ A;  5D3D A;  3AMZ A;  1EO6 A;  1B1Z A;  4GGQ A;  3HVD A;  1RRB A;  4TMA B;  3DBH B;  3QWM A;  2Z8L A;  4BBN C;  3IFW B;  1FMA D;  1OQY A;  2HDE A;  1MG8 A;  2FUG 1;  5IJM A;  4ANX A;  5HKH A;  2KAN A;  3I63 C;  4GMX B;  1KC7 A;  1Z2M A;  1UZX B;  3HRD D;  4MEL A;  3GE3 C;  1SIF A;  2QDF A;  1RJ2 A;  2AQ3 B;  2EMS A;  3VR8 B;  1F52 A;  1T0S C;  4DK5 A;  3MHS D;  1P5T A;  2LVQ A;  5D3I B;  2KUQ A;  3RMK C;  3PVU A;  3MP9 A;  4RCO A;  1MPH A;  1OTR B;  2L00 B;  2Y5B B;  4TV3 A;  2RSU A;  2MEK A;  2BS4 B;  3AI5 A;  2DIK A;  5D94 A;  2C7H A;  4TKN A;  1OQN A;  3UZT A;  5JVL A;  1I4X A;  4DX9 0;  2RMM A;  3TEZ A;  3D32 A;  3A98 B;  1UWM A;  2IGD A;  1TY0 A;  3DBL I;  1SF0 A;  1ZUD 2;  4IKG A;  1GGO A;  1N63 A;  4M01 A;  4OZC A;  3PLV A;  1ZM0 A;  3LDZ E;  3NZU A;  3C19 A;  1NTV A;  4JKG A;  2BYF A;  3QAQ A;  4G50 A;  4I6N B;  1JWM D;  4DHZ B;  2Q13 A;  3BIN A;  2D4Q A;  1FOE A;  3CMM B;  4GDK B;  3B9J A;  2ROZ B;  2KAJ A;  2DX1 A;  3NZS A;  1WIA A;  1C4P A;  4WWM A;  5M4Y B;  2W9N A;  3CSF A;  4YWG G;  1JML A;  2AL3 A;  1IUE A;  1HZ6 A;  1WXV A;  3I57 A;  2KYW A;  4W9J A;  4MJS A;  4AJW A;  4ARC A;  4YTN B;  3ZNZ B;  4OVZ A;  3KWV A;  4JX1 C;  5BMI A;  4QXA B;  2BYT A;  2LJ5 A;  3GZN I;  1MJD A;  2J53 A;  3PHX B;  1J8C A;  1SIJ A;  1PMS A;  1HEZ E;  4IM0 A;  1D6E C;  5JZE B;  2R2O A;  1M4V A;  2YSZ A;  2PVO D;  4FBJ B;  1JQ4 A;  4F7G A;  1AWD A;  4ZRJ A;  1P6S A;  1X11 A;  1EUV B;  4NAW B;  3P4P B;  3KVF B;  3QIJ A;  3DOW A;  1OEY A;  3R2I A;  4L23 A;  4A20 A;  2L1A A;  1WMH A;  4KIK B;  1DRO A;  2ZCC A;  2DYQ A;  2N7D A;  2HJ8 A;  4WWN A;  2GLS A;  2L76 A;  1KZG A;  3PRM B;  3DWM A;  3CXB B;  3A58 A;  2FID A;  2KDF B;  1QLB B;  1D5X C;  3NZ3 A;  1HQR D;  2KNB A;  4HKQ A;  1E9M A;  2A4Z A;  1ST7 A;  4KZ0 A;  3DBR B;  4AWJ A;  2LG1 A;  1JW9 D;  1K50 A;  1JAL A;  5E6P A;  3RT3 B;  3TJP A;  1YD8 U;  1V97 A;  4JL9 A;  3O13 A;  1OEY J;  1RFK A;  2NBV B;  1FXI A;  3DDC B;  3KYC D;  2C60 A;  4FUL A;  1WJ1 A;  5DCN A;  1FXT B;  3I3T B;  4A55 A;  1PFD A;  5T8I A;  2H89 B;  4MM3 A;  1X1F A;  3A33 B;  2KQ4 X;  3PG7 A;  1K51 A;  3VAW A;  1TS3 A;  4IM2 A;  1GC6 A;  1XQQ A;  4YXD B;  3P63 A;  5CTR C;  3H6N A;  4XDC A;  4NZL B;  3JYU A;  1IYF A;  1WZ0 A;  1M94 A;  3BVZ A;  2DYO A;  3VTU A;  3P42 A;  4LJO B;  5C6R A;  1KLU D;  1PDX A;  1LXD A;  3VXW A;  1I4P A;  3ODX A;  3VIA A;  3PEG A;  3DCG A;  2BWE S;  3PZ8 A;  4J3O D;  2L83 A;  3NY5 A;  3R7Q A;  1VCB A;  3SV1 A;  3BK1 A;  3VVW B;  2Z0Q A;  3OJ3 A;  2L2I A;  4F8C B;  2IND C;  1TT5 B;  2P0D A;  2EEL A;  4AS1 A;  2DX5 A;  1ZOY B;  2N1W A;  3EA6 A;  1NBF C;  1WYW B;  1AYF A;  4DDI D;  1MIX A;  1M7E A;  3OWE B;  2L0T A;  3T3N A;  4BBK A;  4GB9 A;  3AE7 B;  4ITK A;  1MK7 B;  3EUB 2;  2MBQ A;  1N61 A;  2QJL A;  4ZYS A;  2O6V A;  5J3T A;  4GOU A;  3NVW A;  1GB1 A;  4BKS A;  1V5T A;  1D5M C;  3GYO A;  4WVF B;  3NVZ A;  2YS3 A;  1IPG A;  5CX3 A;  4DIX A;  2M38 A;  4C7Z A;  4LDT D;  2X8X X;  2VZK B;  4ZRK A;  2ZJD A;  3TCA A;  4RGN A;  3V3X A;  1YX5 B;  1Z87 A;  4JKA A;  4S17 A;  4USA A;  3U7Z A;  1A70 A;  2WX0 A;  5DPR A;  2HJ1 A;  4ICV A;  4OVU A;  4MEM A;  3RFZ B;  2J7Q B;  4A3O A;  1E8Y A;  2K00 A;  2BF8 B;  2KQS A;  3ZRC A;  2NPT A;  3ZKJ C;  1YMH E;  1RYJ A;  2NMQ A;  3IVF A;  1P7E A;  5JHG A;  1WJU A;  4LDT B;  5D3X A;  1FRD A;  2DAF A;  2N9K A;  1FNV A;  1YJJ A;  4GN1 A;  1UD7 A;  2WXF A;  3AE2 B;  2WQY B;  3QJZ A;  2LD9 A;  1ZYI A;  1SE3 A;  4OHJ A;  3CF6 E;  4EOY A;  1X05 A;  4EZL A;  2GBR A;  2DZI A;  5JLJ B;  4JIO U;  3PT2 B;  2HD5 B;  2G1E A;  3P7Z A;  2QMT A;  3ZNH B;  2C9W B;  1MHH E;  3TW1 A;  5DH9 B;  1XT9 B;  5FK9 C;  3NVV A;  2OJW A;  1KH0 A;  2OED A;  1UEL A;  4CYE A;  1VDV A;  3TEY A;  4A6F B;  1XCQ L;  3U7D A;  1U27 A;  2W2X C;  4BKT A;  1UNR A;  3PRE A;  3W9C B;  1FAO A;  3U12 A;  4QJ4 B;  4IOY X;  5E6O A;  2BW2 A;  3ZTD A;  1C77 A;  1LO5 D;  2OHF A;  3NOB A;  3ZIM A;  4EMO A;  2WP9 B;  4F7H A;  1BTN A;  4CSQ A;  3GP7 A;  2LAS A;  3IT6 B;  4KHO A;  4QJ3 B;  2GBN A;  2X38 A;  3M1I B;  2P0H A;  4CHK A;  2AQ1 B;  2I1K A;  1V80 A;  1YJ1 A;  2C7N B;  4ZRQ A;  1OY2 A;  4A8X C;  2IYD B;  1N5W A;  2QSD A;  3A1Q B;  2GJY A;  4IWO A;  4HSI A;  1WX7 A;  3SO6 A;  2HTH A;  2JWZ A;  1NTY A;  4GNK B;  4D6W A;  4M0W A;  4C4V B;  1ESF A;  3IHP C;  4MH8 A;  2RUK B;  1GG3 A;  5G5G A;  1NTI A;  1W1G A;  3GZN B;  4A6F A;  1MPE A;  1DYQ A;  1DDM A;  3SEB A;  3ZDM C;  2K3U A;  2BKR B;  3QCA A;  3Q8F A;  2VSZ A;  3N20 C;  4KKI A;  2KN4 A;  2R0D A;  2RPV A;  2ON8 A;  2Y8G A;  2FNJ B;  1XLP A;  2YEP F;  3SDL C;  2GBJ A;  2KDE B;  4HAZ B;  3UQB A;  3PO0 A;  5DPS A;  2I38 A;  5BYQ A;  1FFV A;  4EZJ A;  4WJO A;  4C00 A;  2WWZ A;  1PLS A;  4II2 B;  1TZO A;  4E71 A;  2GRI A;  1WH3 A;  1E7V A;  2CS4 A;  4BKG A;  1FNW A;  3QC8 B;  3PPA A;  2M4N A;  1GPX A;  2HTM E;  3BY4 B;  5G2N A;  2MRP A;  3V05 A;  1UNQ A;  1UGM A;  5C16 A;  3PS6 A;  1ZXH A;  1L6V A;  2FIF A;  2CAY A;  2J59 M;  1TZ1 A;  2KJ6 A;  4N59 A;  3CIK A;  3W2D A;  1WMH B;  4KIK A;  2W2X D;  5CHV C;  2OTX A;  1X1G A;  1FB8 A;  1K5G B;  2WXI A;  1L0Y B;  4K2O A;  2E2X A;  2UYZ B;  2DLW A;  1U5D A;  3PV1 A;  4AP4 C;  1GOZ A;  2D3A A;  3IG3 A;  2NTT A;  2IO2 B;  3N32 A;  4JGH B;  3ZJU A;  4N9F 4;  3P1M A;  2L32 A;  2CR5 A;  4O1N A;  4RNA A;  2W3S A;  3Q8E A;  4C80 A;  3L54 A;  3O65 B;  3AEG B;  2L0F A;  1U4A A;  1EWY C;  3K9O B;  4KDL B;  2WHI A;  3HSA A;  5D3V A;  2JPH A;  2LI5 A;  3KWL A;  4PS3 A;  2ZNV C;  1UNP A;  4GMV A;  3AE8 B;  3AH7 A;  1VR9 A;  4WAA A;  1MKE A;  4ASW C;  2N0Y A;  3D8E A;  4OSN A;  5CHW A;  2BGF A;  5DPW A;  4P16 A;  2K5P A;  4WH4 A;  3MDB C;  3TVV A;  5JHA A;  3U2S C;  4K17 A;  5EFX A;  3Q3M C;  1AN8 A;  1E8W A;  2YS1 A;  1KOT A;  1Q10 A;  4W9H A;  3TUO A;  4Q2J A;  4RF0 A;  4CQN A;  3DHH C;  1UEF A;  3L0W B;  4B9K A;  1RWS A;  3DQV A;  4BAX A;  4ZHO A;  5BYR A;  2GB1 A;  1L0X B;  3FIL B;  1FHO A;  1P0R A;  1TBE A;  3JVZ X;  1OQR A;  2EC1 A;  3Q69 A;  3RNC C;  1J7A A;  2KR0 A;  4HCP B;  2O6V D;  1N60 A;  3PP2 A;  3MC0 B;  4F7Z A;  3P4S B;  4KSL C;  4G11 A;  4ANU A;  3QAR A;  4TSS A;  3DBH I;  1U2B A;  2MLB A;  1WE7 A;  2N9L A;  4P7I A;  1GNU A;  1BTK A;  4HCN B;  3DWG C;  2M0A A;  3E9S A;  2INP E;  3ZW3 A;  3SFD B;  1TXD A;  1U5E A;  1WGQ A;  4TQ0 A;  1Q1O A;  4UDU C;  3KLS X;  3E9O A;  1DOY A;  3U52 E;  1C4C A;  1LGR A;  3ONS A;  4ILH A;  1M7R A;  4A3P A;  2LJI A;  1J7C A;  3SNH A;  4C7Y A;  3M3J A;  2V76 A;  1MG4 A;  2NTS A;  1V86 A;  4KGS A;  1EU4 A;  1I7H A;  3M95 A;  4IFS A;  1ZGU B;  3Q14 C;  4EZK A;  5J18 A;  1NI2 A;  3N1Y C;  4LNN A;  1T0Y A;  1A5R A;  1PFJ A;  1ZKH A;  1HE8 A;  2O2V B;  1SE4 A;  2JSV X;  3NS1 A;  1QOA A;  1L5P A;  1GJZ A;  1XX0 A;  2DBY A;  3N1X C;  3FEH A;  3VRB B;  4DXG A;  4B95 A;  2PE6 B;  4AOF A;  4W9E A;  4K7W A;  5D7G A;  1WGD A;  2D9Y A;  1D4B A;  4JPS A;  4KV2 A;  4MGK E;  4OZA A;  1C1Y B;  3TFM A;  3N1Z C;  3VUX A;  2V4L A;  4A90 A;  3A9J A;  5KQ1 A;  1KZ7 A;  4BOZ B;  3F5R A;  1F0Z A;  2LXA A;  3B08 A;  2LOX A;  1MK9 B;  2CU1 A;  3AXC A;  4HB3 B;  3NJT A;  3OG5 A;  3A9K B;  1FEH A;  2N9E B;  2FBW B;  2W55 A;  2WXH A;  1TGZ B;  2GMI C;  4PK1 A;  4CHM A;  2IGH A;  2UU7 A;  3HQC A;  2L52 A;  5BMG A;  1LM8 B;  1OMW A;  5KQ4 A;  4K3B A;  1E7P B;  1E7U A;  1WGH A;  2DHK A;  3RN9 C;  1I4R A;  2KFK A;  1KF6 B;  4GU2 A;  3ZJT A;  4HPL B;  2Y7B A;  2XNA C;  1BAK A;  3RPF C;  3R2T A;  4RF1 A;  2V0G A;  1SJE D;  1ZVR A;  2ICI A;  3RNG C;  1V2Y A;  5HI1 A;  2N9X A;  2XQN M;  3PHW B;  1DOX A;  4Z2M B;  2YEP B;  3FLV A;  3PVL A;  2J42 A;  4M8N A;  2KZR A;  4WJP A;  2MH7 A;  1Q5W B;  1WXM A;  1IGC A;  1WE6 A;  4P1C C;  2DHZ A;  1TKE A;  2Y8F A;  4W9L A;  2QHO A;  3C8Y A;  2KTR A;  1DOI A;  5JP4 A;  2VRR B;  3QHT A;  2ELB A;  3ZNI D;  5EDS A;  3B0A A;  1ET9 A;  4URK A;  3V6C B;  1NVI D;  1GC7 A;  2V9H A;  3DCX A;  4BOS C;  3AM9 A;  2JYT A;  4YL8 A;  3TEW A;  3APF A;  4C0A A;  5LOP B;  4LTU A;  3N7C A;  4REZ A;  1WR1 A;  2NR2 A;  2CKH B;  1CZP A;  2LUL A;  3KQ4 A;  2KT7 A;  2AWT A;  2BVC A;  1RAX A;  2HE7 A;  5AEK B;  2K22 A;  1X86 A;  5C23 A;  1RLF A;  1WXS A;  4N58 A;  2KK8 A;  2LVO A;  2I2Y A;  1SJH D;  3Q3F A;  2FAZ A;  2BWF A;  3KRW A;  2ELA A;  3FSS A;  1MIZ B;  2QC8 A;  2DEN B;  5IRS A;  2SEB D;  4JWU C;  1EF5 A;  2D5G A;  5IA7 A;  2KMA A;  3CIR B;  3W5V B;  5DI9 B;  1J19 A;  1ENF A;  1TJ6 A;  2KO3 A;  2KDM A;  2J4X A;  1I4Q A;  4DHJ B;  1TTN A;  1I35 A;  2PPH A;  2KCJ A;  3DXC A;  1UBI A;  3ULC A;  4B6H A;  4WJQ A;  2GS0 A;  2Z0O A;  1WSP A;  4JLC A;  5LXH A;  2CHX A;  1UGJ A;  5LXI B;  3MPX A;  3BYT B;  2D9W A;  2PEA A;  3L17 A;  2RLO A;  4YON A;  2J0K A;  2LGY A;  1V89 A;  2LVP A;  4G3X B;  4KGT A;  2BKF A;  1WZ3 A;  3AE5 B;  3IAS 1;  2RNR B;  3R3M A;  3RI7 C;  2FUH B;  1V9J A;  3NRZ A;  5I4D A;  5HE1 A;  4MK0 A;  2YT0 A;  1AWE A;  2WGS A;  1WI0 A;  1VLB A;  2WDQ B;  3WAL A;  5AUI A;  2IO1 B;  1JWB D;  3ETR A;  2KQ7 A;  2K0P A;  3T8M A;  2JZ3 B;  3VUW A;  1C76 A;  4FJZ A;  2FJL A;  2JRI B;  2BTE A;  1VJK A;  1NI3 A;  4RGT A;  2WXJ A;  5I2M A;  1V49 A;  3HHM A;  1U5F A;  3OLM D;  2ZKM X;  3AED B;  2DX5 B;  1P3Q U;  2MSE D;  2D2Q A;  1V61 A;  3OAN A;  2NVU I;  2XBB C;  5FI1 A;  4NJC A;  3A4R A;  4FLH A;  4KGR A;  1V1P A;  1OQQ A;  1D5Z C;  3ML8 A;  1V88 A;  1WJ4 A;  1LQB A;  1J7B A;  3RNB C;  3QBV B;  4RM8 A;  4R3D A;  2MJD A;  5FR6 A;  3VFK A;  3BWU D;  4HHV A;  1WGK A;  1VBG A;  1V81 A;  3H7S A;  5EE0 A;  1YQ4 B;  2O2V A;  3NWD A;  1TY2 A;  4YTP B;  4JK7 A;  2N4F A;  4D2K A;  2RSG A;  4MGY E;  4C56 C;  2JZZ A;  3I9V 1;  2N23 A;  4JKG B;  2ZPN A;  4TYZ A;  2B3A A;  3E9L A;  1WI1 A;  2IPK D;  2VH2 A;  5GMV A;  3DXD A;  4HAU B;  3V61 A;  3K9P B;  1KTK A;  1K52 A;  3DPD A;  4GDK A;  2RGF A;  1KJT A;  1KI1 B;  1ZDV A;  1L6U A;  5DHF B;  1P1A A;  4HAT B;  1WGY A;  4HEA 1;  2G4S A;  5IP4 D;  3AEE B;  2KMM A;  3RZW C;  3D8D A;  1EWC A;  1FNU A;  2JP2 A;  1F9J A;  1XCT L;  3HUI A;  5D2M B;  4JKH A;  1ZSQ A;  4WQM A;  5DPT A;  3ZRF A;  1E10 A;  3ECI A;  1YIW A;  5L81 A;  4FN2 A;  4E74 A;  4IWP A;  1ROE A;  3RCP A;  2KJH B;  1LW3 A;  3UF8 A;  1VRA B;  3GYP A;  2LBB A;  3HK0 A;  3SYX A;  5CHF A;  1RFA A;  2L3Z A;  1WRD B;  5AZG A;  1HB6 A;  3U30 A;  2ZEQ A;  4WJN A;  3E66 A;  3R66 C;  5D3W A;  1T77 A;  3X0W A;  2AL6 A;  4WUR A;  3U8Z A;  3VHT C;  2H7D A;  5AUK A;  4A5K A;  3GS2 A;  1TQZ A;  1MHX A;  2J0M A;  4ARI A;  4GOC A;  4AJY B;  2DHJ A;  2LXC A;  2IY1 B;  3VDZ A;  4W9F A;  1F1H A;  4GXB A;  3QK0 A;  2RDH A;  3DHI C;  5EE9 A;  2WXG A;  2GCL A;  3RUL A;  3HIE A;  3PZ7 A;  2KWV B;  3MHZ A;  1ZPS A;  3IBE A;  1N62 A;  1K53 A;  4MSM B;  4TUU A;  4LJP B;  1G6J A;  2AQ2 B;  1U5G A;  1KM7 A;  4TQ1 A;  4XX5 A;  4JK9 A;  1DYN A;  2DKQ A;  1FFU A;  3ZQ4 A;  4B0E A;  3TEX A;  5FKA C;  2ZZP B;  3H8H A;  4AQ7 A;  4XE0 A;  1ZE3 D;  3GB1 A;  1L4D B;  1VZ8 A;  3Q8A A;  1T0R C;  4G0N B;  3WIM A;  1DDW A;  3AEA B;  4JWS C;  2Z0P A;  2PJH A;  3KH0 A;  4HLE A;  2KKC A;  2JXT A;  1FO4 A;  1JCK B;  4A6K A;  1JWU D;  2Y3A A;  1I4G A;  2IJ0 A;  1LFD A;  2MDX A;  3VTW A;  1T3Q A;  3MJ5 A;  2D9V A;  5FR3 A;  1L7Y A;  3ODO A;  3GE8 C;  2BB6 A;  2PW9 A;  4P6V F;  2LRW A;  2DHI A;  3T3O A;  4XWX A;  1CK1 A;  3SD5 A;  2K49 A;  2WXR A;  4NQL B;  4K81 A;  3BK2 A;  4L2Y A;  1WGR A;  4L6E A;  1WWT A;  3B2F A;  1E6E B;  2M14 A;  4DQO C;  3T06 A;  2KWD A;  5H8Y E;  2XN9 C;  1WRI A;  1JRU A;  1WGU A;  2FCM A;  1WM2 A;  1WJ6 A;  1BT0 A;  1B9R A;  4MT5 A;  5J3Q A;  4GDL B;  3RCZ A;  4IOI E;  4B0M A;  1I4H A;  2I5C A;  3ZUN A;  1VZ6 A;  2KIG A;  2Z59 A;  2R2Q A;  3JSV B;  1NDD A;  2WX1 A;  3PRZ A;  1TS4 A;  3NW8 A;  3DVN U;  3VR9 B;  1P7F A;  1MAI A;  1YN4 A;  4H8S A;  2FCQ A;  1RRP B;  4FA6 A;  1XO3 A;  1SB3 C;  2YT1 A;  1IRS A;  4HRS A;  1VBH A;  2SAK A;  1PGA A;  1BWN A;  2RGN B;  5D3Y A;  3HM6 X;  3L13 A;  2DWQ A;  4KX6 B;  1IBX A;  2CB8 A;  3DBS A;  3EHV A;  1VZ7 A;  4IC7 B;  1HTQ A;  1ZW7 A;  2YT2 A;  3E9P A;  4HB0 B;  5IOI A;  3ENE A;  2WYQ A;  2NMB A;  4I6L B;  3JW0 X;  3UIN B;  2YVC A;  4ACF A;  4PS7 A;  3ML4 A;  2KGX B;  1QQG A;  4YSY B;  2WXN A;  1FGZ A;  3A1Q A;  4PS8 A;  3TMP B;  2ROV A;  2WLB A;  1QOG A;  2JZP A;  4PYU A;  3ZNG C;  4EE2 A;  2VKI A;  4A9A A;  2BB5 A;  4ZRP A;  3ZVV A;  4KKJ A;  5KHO A;  3KUD B;  3ENB A;  4FAD A;  3AEB B;  1EAZ A;  4W9C A;  1FCL A;  2D11 A;  3WAO A;  1QOF A;  1XLO A;  2RQ1 A;  2L8J A;  1H8C A;  1SE9 A;  1AQC A;  1N3H A;  3PZD A;  4QAY A;  5J3Y A;  1W1D A;  1XF5 L;  2X0S A;  3ML9 A;  1GB4 A;  4WQO B;  4NAM A;  1V8C A;  4DX8 A;  5DIF B;  3N30 A;  4ZRI A;  3Q3J A;  1WF9 A;  2Z0E B;  2I5F A;  3ZXV A;  3WAP A;  1N6Z A;  2GBK A;  5J17 A;  3ZVR A;  5C5B A;  2LKO A;  1NU2 A;  3Q2A C;  3IAM 1;  4US8 A;  3EFC A;  2W54 A;  5J2R A;  4M8M A;  2KWC A;  1H4R A;  4IG7 B;  4LNK A;  1FHW A;  2IY0 B;  1WM3 A;  2DZM A;  5TR5 A;  1WVH A;  2MBB B;  3VUY A;  1Q67 A;  2ACZ B;  5LLI A;  3AE9 B;  1TKY A;  4DXA B;  2OOB B;  2NPT B;  1TKG A;  5HE3 A;  2XEW A;  3IXS A;  1FXA A;  4Y94 A;  1L2N A;  3RD2 A;  2WNM A;  2E6X A;  3V60 A;  4JQW C;  2COD A;  2CY5 A;  3Q3O C;  2Q5W D;  3SU8 X;  3NWF A;  2MWN B;  1WG7 A;  1MI1 A;  1WJM A;  2CY4 A;  3LJ3 A;  3SHQ A;  3NVY A;  2KTF A;  3HW2 B;  4JE3 B;  4PNK A;  1XD3 B;  3EEC A;  1XOD A;  1DIK A;  2LGI A;  2QIL A;  1R7S A;  1C79 A;  1XLN A;  4HWI B;  4WSF A;  4HK2 A;  2P8V A;  4DHJ D;  3LYY A;  2PZ1 A;  1QC6 A;  1B55 A;  1XD4 A;  3T9L A;  2P0F A;  2WU5 B;  1T5X D;  2DLB A;  3NHE B;  4QJ5 B;  2NZ8 B;  3VQI A;  4FJY A;  1XR0 B;  2K2U A;  1XXG A;  4K3C A;  1YQ3 B;  2KFJ A;  3NWA A;  2G3Q B;  4MDK E;  3ZXR A;  2D9X A;  2MP2 A;  4S0R A;  2CJO A;  4I6P A;  3DVG X;  4ZHP A;  4GSW A;  1NEN B;  4K7U A;  2DZJ A;  3AE4 B;  4F7U P;  2DNF A;  1MVK A;  4WWP A;  4BZA A;  1KFY B;  3G9W A;  1I7A A;  1NVL A;  2ABD A;  1FCC C;  1H10 A;  2UZR A;  5HE0 A;  1NEK B;  1NYR A;  2K6D B;  4HPP A;  2WXO A;  4IW0 A;  3VRA B;  2YF0 A;  2CJN A;  4II3 B;  3PTF C;  2M1M A;  4BKS D;  2KVR A;  2C7M B;  2FE8 A;  2AEH A;  4KVG B;  1KRH A;  2JRH A;  2KX3 A;  3AV8 A;  4W9I A;  1V5P A;  4EJN A;  5DHA B;  2KLC A;  4FHK A;  2BPS A;  1SHC A;  1R4M I;  1CJE A;  3AEF B;  4HAW B;  1AAR A;  2CHZ A;  2IDY A;  2W3R A;  3P6A A;  3RNE C;  1WX8 A;  2MBH A;  3PLU A;  1ZDX A;  3AUL A;  4HDQ A;  4MAC A;  1KLV A;  5D27 A;  4FHJ A;  3P4R B;  1UPQ A;  2N7E A;  4XGA B;  3N3K B;  3W1S C;  3BVM A;  4NAW A;  2EKE C;  1QT9 A;  1T6B X;  4DWF A;  4KHA A;  1OGW A;  2PMV A;  1C4A A;  1QQR A;  2MBE A;  3L10 B;  1SXT A;  1TYG B;  1QOB A;  1TS5 A;  3A8P A;  4HAY B;  2QCZ A;  4W9D A;  3SUZ A;  1WX9 A;  3AE6 B;  4ICU A;  2LOZ A;  3D8F A;  1HZ5 A;  2BS3 B;  2WS3 B;  4LK0 M;  1EGX A;  1QIL A;  4MT7 A;  2LZ6 A;  1JWS D;  4MY6 A;  1E8X A;  4GIV A;  4YSZ B;  1F2R I;  1NYQ A;  5C3J B;  2KJR A;  1YN5 A;  4IDI A;  2PVG C;  1ET6 A;  3PGE A;  3AU4 A;  2VZK D;  2PKO A;  2R82 A;  2PE9 A;  3NS8 A;  5IO9 A;  3SFE B;  4A6H A;  4NNJ B;  2AX5 A;  2MCN B;  4W9G A;  2LMC A;  3B1L X;  3HIZ A;  3W1S A;  4K1R B;  2FDQ A;  3SBT A;  2GUM A;  3H9D A;  3ZLZ A;  2LRU A;  5TSS A;  4D0N B;  2FCS A;  2E3T A;  1IGD A;  1P98 A;  3W5U B;  2C5L C;  3C0R B;  1WR6 E;  2ZW1 A;  3URY A;  5LNK 1;  1EF1 A;  4DBG A;  1V1O A;  3UI3 A;  4GLS C;  3AEC B;  4NY0 A;  3A4S C;  4EFO A;  4YTM B;  3Q8C A;  2K8E A;  2IO3 B;  1F2R C;  3ZO5 B;  2OJR A;  4MSQ B;  2JQR B;  2MFQ A;  2KC1 A;  4IAP A;  2IBI B;  2ZPY A;  4ILG B;  3M63 B;  2VH1 A;  1V1P B;  2LHD A;  2NS5 A;  1WXQ A;  1Q0W B;  4OW0 A;  1RM6 C;  2MX2 A;  5CLQ B;  2GBM A;  4FJV B;  3NSU A;  4LCD E;  2M17 A;  4E3C A;  3RNA C;  3WAN A;  2WXP A;  1FD6 A;  3KY9 A;  4GPT B;  3TO1 A;  2D9Z A;  2WDR B;  1YN3 A;  2O6V B;  2N1V A;  3ZTC A;  1DDV A;  5JHH A;  3EPY A;  2Z4D A;  4B6W A;  2ZVN A;  1PGB A;  4FXC A;  4L1R A;  2UVM A;  4W9K A;  2DTC A;  1T0Q C;  4WWO A;  1JRO A;  1YNT E;  4MH0 E;  3AU5 A;  2V1Y A;  2HTH B;  3F0W A;  1SEB D;  2WU2 B;  1V6E A;  2KOX A;  1L0V B;  4MJS B;  5LON B;  2X18 A;  2TSS A;  3QA8 A;  3ALB A;  1JDE A;  5IKC M;  3UGB B;  5FI0 A;  4JK8 A;  3MC9 A;  3ODW A;  1C78 A;  3KRX A;  1XLQ A;  1STE A;  3UIO B;  1UUP A;  1C3T A;  2CU3 A;  4KDI C;  2RDG A;  4NJ6 A;  1HTO A;  3TSS A;  1PYW D;  4F1S A;  1HB8 A;  1TIF A;  3H7P B;  5C5B B;  2G4D B;  2R61 A;  1S1Q B;  3B77 A;  2M0X A;  2WDV B;  2OQB A;  3N9Y C;  4LNO A;  3V62 A;  4XZ4 A;  3V6E B;  3Q3N C;  5JH5 C;  2KIE A;  1SGH A;  3DHG C;  4NSW A;  2JX5 A;  1W1H A;  1X1M A;  1MI0 A;  2V3S A;  1EVH A;  2K39 A;  4OT1 A;  4ANW A;  4C4V A;  1HXY D;  4JKD A;  1JRP A;  2Z59 B;  3RUI B;  2Y5P A;  5AZF A;  4K7S A;  2L1C A;  4DXF A;  2RRF A;  2LWP A;  4LNF A;  1CQV A;  4P1B C;  5IAA C;  2DA0 A;  1XKE A;  2RDB C;  4AUQ C;  2NCN A;  3AB5 A;  3PVW A;  4NQK E;  2V3P A;  1UWX A;  4RGM A;  3ZDT A;  5BMH A;  1R4N B;  3VH3 B;  3L16 A;  4HRO A;  4CO7 A;  3ZJV A;  3ZYY X;  2BYV E;  2I1J A;  1WY8 A;  3BZD B;  1I42 A;  1KBL A;  2KDB A;  1IP9 A;  5HFY A;  1S3S G;  2Y5C A;  2JY6 A;  2N7J A;  3ULB A;  3I5J C;  2LGD A;  3WYF B;  2ZVO A;  4EEW A;  3H7P A;  2N9P C;  1E5W A;  3DXE A;  4OVV A;  2J52 A;  2KXJ A;  4LNI A;  2BT6 A;  3AE3 B;  1P3R A;  1UH6 A;  2W2W A;  3BII D;  1HA5 A;  2EKI A;  4KHB A;  2JUO A;  2YRY A;  1PQS A;  1QF6 A;  4KZC A;  5EE1 A;  3QWZ B;  2KAC A;  4WJ7 A;  1R4M B;  4ILJ A;  1DBH A;  1UF0 A;  2IFS A;  4HVB A;  2Z0D B;  2FJU B;  3MTN B;  4M00 A;  1BUI C;  2K1F A;  3KYD D;  2H88 B;  4H2A A;  3TBL D;  2MHJ A;  1FGY A;  3AE1 B;  5KCV A;  4RMA A;  2GOW A;  3SR6 A;  3L08 A;  2KC2 A;  4RM9 A;  5EE3 A;  2EJ8 A;  1WYG A;  1QZE A;  4BVU C;  2QKL A;  4HPM B;  2LHE A;  2MQJ A;  3QQ8 B;  5LG4 B;  1KLG D;  4KSK C;  4EUT A;  3GOE A;  4HXD A;  1FRR A;  4US9 A;  1FIQ A;  1K8R B;  2M19 A;  2D3C A;  5IN7 A;  3TL5 A;  1GUA B;  3UQA A;  2QEJ C;  3U4E G;  2ZCB A;  1I2H A;  3B2G A;  2M8S A;  2KWU B;  3KSY A;  1WFY A;  1Y56 A;  1BXT A;  2GCJ A;  1QKZ A;  5GXG B;  3PSC A;  3FIL A;  2UWQ A;  4JKF A;  2M56 B;  3R8B A;  5JXV A;  3KUZ A;  2L7R A;  2PIA A;  2YLM A;  4XC2 A;  2PLP A;  2Z13 A;  1SSN A;  4MGZ E;  3KZ1 A;  4Z2N A;  2LYD A;  2VRW B;  1V5M A;  1GAQ B;  4BBN F;  4RFB A;  1ZC3 B;  4XYC A;  2K8C A;  5I2S A;  2R2Y A;  3LJU X;  3ABV B;  4ZYN A;  3P2B A;  1YOV B;  1E0Z A;  4HKZ E;  5HE2 A;  3H1U A;  3IT4 B;  2REX A;  2WDT B;  3PRP B;  3UIP B;  3RNF C;  2BYE A;  1HBK A;  2WXM A;  3J9C A;  3BJI A;  5E6N A;  3EGR A;  5BYS A;  4HJK A;  2NBW B;  2GI9 A;  4JKB A;  2KUP A;  2XK5 A;  4IWQ A;  3A8Q A;  3BYY B;  3WA0 A;  3VH4 B;  3TIX A;  4K2P A;  1PUT A;  3RZF A;  2KMC A;  2RR9 A;  4DDG D;  1F77 A;  4HJG E;  2Z14 A;  2HRJ A;  1PGX A;  1Y8R C;  3KW5 B;  1JWA D;  2FJ9 A;  2LGS A;  2JVC A;  2KVZ A;  5C1Z A;  2V3N A;  2NBU A;  2G45 B;  2COF A;  1YQB A;  2BS2 B;  5D6J B;  2D3G A;  5AZH A;  3HM3 A;  3FKY A;  2LUE A;  3DBR I;  2BQQ A;  1J0W A;  2JYE A;  2BBC A;  4HAX B;  5L83 A;  2ADZ A;  3O96 A;  3X23 A;  1ISN A;  1E90 A;  1E8Z A;  2D07 B;  3AN1 A;  4JKE A;  2IYB A;  4HAV B;  1EM7 A;  2MWS B;  2KHW B;  4ANV A;  2LUM A;  1UNS A;  3MC8 A;  1FPY A;  4IM3 A;  2BCJ A;  4L1B A;  2B76 B;  1U29 A;  1LB1 A;  1TJE A;  3A9J B;  2ASQ A;  1C9F A;  4M02 A;  4YT0 B;  2MBO A;  2MA9 B;  1Y5O A;  2JT4 B;  2INN E;  2DYM A;  2ONQ A;  3L4P A;  3VTV A;  1L4Z B;  2LFI A;  2RVB B;  2PTL A;  3DBL B;  4KAX B;  1R4N I;  2MJ3 A;  5MPO A;  4IUM B;  4X57 B;  2ZNV B;  4DBB A;  2JU6 X;  3MJW A;  1Y19 B;  5HG2 A;  2NBV A;  4HB4 B;  2K25 A;  4XWT A;  3OHM B;  4YSX B;  1UBQ A;  2KFK B;  3APC A;  3VOQ A;  3CST A;  2AYO B;  3NG0 A;  3FP5 A;  3EC8 A;  3OJ4 B;  4PYZ A;  2H7E A;  3FC4 A;  4MM3 B;  3MFG A;  1D3Z A;  2KX0 A;  1Z5S B;  3W1Y A;  2WXL A;  4NPN A;  5GOW B;  3A9K A;  1N5X A;  4PT5 A;  4WIP A;  3BVG A;  4GDL A;  2K6Q A;  4JKC A;  3LB8 C;  1FM0 D;  1SBB B;  3S2A A;  2DFK A;  3LXF A;  4EKU A;  2ZW0 A;  5C79 A;  4MGI E;  3DVG Y;  4HDO A;  3R7R A;  5C2T B;  4XWW A;  1UPR A;  5CLL B;  2D3B A;  2QKM A;  2J0J A;  2JF5 A;  1ZXI A;  1V5U A;  3V5W A;  2COA A;  2COC A;  4A6Q A;  4RGO S;  2JXX A;  4ZDV A;  1ZC4 B;  2D10 A;  3FM8 C;  3ZGZ A;  1CMX B;  4OZB A;  5L95 C;  2WXQ A;  2XK5 B;  2DZK A;  3Q8B A;  1TS2 A;  1IBX B;  2G35 A;  4J6I A; 
#chains in the Genus database with same CATH homology
 2K8H A;  2K8B A;  2K2J A;  2KTR B;  3EFU A;  2DN6 A;  2COP A;  3QX1 A;  1WJN A;  2EMT A;  2LGX A;  5KHQ A;  1K5D B;  2KDI A;  2RD0 A;  2IZV B;  3KUC B;  2IO0 B;  1FHX A;  2CHW A;  3PSE B;  1P9D U;  2DAJ A;  1YX6 B;  2KLG A;  1ACA A;  2CQU A;  2MW5 A;  3OAW A;  1WGG A;  5G55 A;  3RYT A;  1WXA A;  2WH5 A;  1VD2 A;  4DHZ E;  2R09 A;  3M62 B;  2MP2 B;  2MKR A;  2DYN A;  3JSV A;  4HB2 B;  4GZU A;  2CRF A;  1V5O A;  2YS5 A;  2KN5 A;  2UZS A;  2A5U A;  2DKP A;  4CHJ A;  2KD0 A;  2L05 A;  3SBG A;  4PQ0 A;  5BO4 B;  1J0G A;  4NJ7 A;  3AJ4 A;  3APD A;  2FCN A;  4M0W B;  3WAM A;  5JHB A;  4KHB B;  4BFR A;  2DYB A;  3DVN V;  1XCG A;  2RPQ A;  1EO6 A;  4GGQ A;  1RRB A;  3QWM A;  4BBN C;  3IFW B;  1OQY A;  1MG8 A;  5IJM A;  4ANX A;  5HKH A;  2KAN A;  4GMX B;  1KC7 A;  1Z2M A;  1UZX B;  4MEL A;  1SIF A;  1RJ2 A;  2EMS A;  4DK5 A;  3MHS D;  1P5T A;  2LVQ A;  3PVU A;  1MPH A;  1OTR B;  2L00 B;  2Y5B B;  4TV3 A;  2RSU A;  3AI5 A;  2DIK A;  5D94 A;  2C7H A;  4TKN A;  1OQN A;  3UZT A;  5JVL A;  4DX9 0;  3D32 A;  3A98 B;  3DBL I;  1GGO A;  3PLV A;  1ZM0 A;  3LDZ E;  3NZU A;  1NTV A;  4JKG A;  2BYF A;  3QAQ A;  4G50 A;  4I6N B;  4DHZ B;  2Q13 A;  3BIN A;  2D4Q A;  1FOE A;  3CMM B;  4GDK B;  2ROZ B;  2DX1 A;  3NZS A;  1WIA A;  2W9N A;  3CSF A;  2AL3 A;  1WXV A;  4W9J A;  4MJS A;  4AJW A;  3ZNZ B;  2LJ5 A;  3GZN I;  3PHX B;  1J8C A;  1PMS A;  4IM0 A;  5JZE B;  2R2O A;  2YSZ A;  4FBJ B;  4F7G A;  4ZRJ A;  1P6S A;  1X11 A;  1EUV B;  4NAW B;  3KVF B;  3QIJ A;  3DOW A;  1OEY A;  4A20 A;  1WMH A;  4KIK B;  1DRO A;  2ZCC A;  2DYQ A;  2N7D A;  2HJ8 A;  4WWN A;  2L76 A;  1KZG A;  3PRM B;  3CXB B;  2FID A;  2KDF B;  2KNB A;  4KZ0 A;  2A4Z A;  1ST7 A;  4AWJ A;  2LG1 A;  5E6P A;  3RT3 B;  3TJP A;  1YD8 U;  4JL9 A;  1OEY J;  2NBV B;  3DDC B;  3KYC D;  2C60 A;  4FUL A;  1WJ1 A;  5DCN A;  1FXT B;  3I3T B;  4MM3 A;  1X1F A;  3A33 B;  3PG7 A;  3VAW A;  4IM2 A;  1GC6 A;  1XQQ A;  5CTR C;  3H6N A;  3JYU A;  1IYF A;  1WZ0 A;  1M94 A;  2DYO A;  3VTU A;  4LJO B;  5C6R A;  1LXD A;  3VXW A;  3ODX A;  3VIA A;  3PEG A;  3DCG A;  2BWE S;  3NY5 A;  3R7Q A;  1VCB A;  3SV1 A;  3VVW B;  2Z0Q A;  3OJ3 A;  2L2I A;  4F8C B;  2P0D A;  2DX5 A;  2N1W A;  1NBF C;  1WYW B;  4DDI D;  1MIX A;  1M7E A;  2L0T A;  4BBK A;  4GB9 A;  1MK7 B;  2MBQ A;  2O6V A;  5J3T A;  4BKS A;  1V5T A;  3GYO A;  4WVF B;  2YS3 A;  1IPG A;  5CX3 A;  2M38 A;  4LDT D;  4ZRK A;  2ZJD A;  3TCA A;  1YX5 B;  1Z87 A;  4JKA A;  2WX0 A;  5DPR A;  4ICV A;  4OVU A;  4MEM A;  2J7Q B;  4A3O A;  1E8Y A;  2K00 A;  2BF8 B;  2KQS A;  3ZRC A;  2NPT A;  3ZKJ C;  3IVF A;  5JHG A;  1WJU A;  4LDT B;  5D3X A;  2DAF A;  4GN1 A;  1UD7 A;  3QJZ A;  2LD9 A;  3CF6 E;  4EOY A;  1X05 A;  4EZL A;  2GBR A;  2DZI A;  5JLJ B;  4JIO U;  3PT2 B;  2HD5 B;  3P7Z A;  3ZNH B;  2C9W B;  3TW1 A;  5DH9 B;  1XT9 B;  1UEL A;  4CYE A;  4A6F B;  3U7D A;  1U27 A;  2W2X C;  4BKT A;  1UNR A;  3PRE A;  1FAO A;  4IOY X;  5E6O A;  3ZTD A;  3NOB A;  3ZIM A;  4EMO A;  4F7H A;  1BTN A;  2LAS A;  4KHO A;  2GBN A;  3M1I B;  2P0H A;  4CHK A;  2I1K A;  1V80 A;  1YJ1 A;  2C7N B;  1OY2 A;  2IYD B;  3A1Q B;  2GJY A;  4IWO A;  1WX7 A;  3SO6 A;  2HTH A;  2JWZ A;  1NTY A;  3IHP C;  2RUK B;  1GG3 A;  1NTI A;  1W1G A;  4A6F A;  1DDM A;  3ZDM C;  2BKR B;  3QCA A;  2VSZ A;  2R0D A;  2Y8G A;  2FNJ B;  3SDL C;  2GBJ A;  2KDE B;  4HAZ B;  3UQB A;  5DPS A;  4EZJ A;  4WJO A;  2WWZ A;  1PLS A;  4II2 B;  4E71 A;  1WH3 A;  1E7V A;  2CS4 A;  4BKG A;  3QC8 B;  3PPA A;  2M4N A;  3BY4 B;  5G2N A;  2MRP A;  1UNQ A;  1UGM A;  5C16 A;  3PS6 A;  2FIF A;  2CAY A;  2J59 M;  1TZ1 A;  2KJ6 A;  3CIK A;  1WMH B;  4KIK A;  2W2X D;  5CHV C;  2OTX A;  1X1G A;  1FB8 A;  1K5G B;  4K2O A;  2E2X A;  2UYZ B;  2DLW A;  1U5D A;  3PV1 A;  4AP4 C;  3IG3 A;  2IO2 B;  3N32 A;  4JGH B;  4N9F 4;  2CR5 A;  3L54 A;  3O65 B;  2L0F A;  1U4A A;  3K9O B;  4KDL B;  5D3V A;  2JPH A;  2LI5 A;  4PS3 A;  2ZNV C;  1UNP A;  4GMV A;  4WAA A;  1MKE A;  4ASW C;  2N0Y A;  3D8E A;  5CHW A;  2BGF A;  5DPW A;  3MDB C;  3TVV A;  5JHA A;  4K17 A;  5EFX A;  1E8W A;  2YS1 A;  1KOT A;  4W9H A;  3L0W B;  1UEF A;  4B9K A;  3DQV A;  1FHO A;  1P0R A;  1TBE A;  3JVZ X;  2EC1 A;  4HCP B;  2O6V D;  3PP2 A;  4F7Z A;  4KSL C;  4G11 A;  4ANU A;  3QAR A;  3DBH I;  1U2B A;  2MLB A;  1WE7 A;  4P7I A;  1GNU A;  1BTK A;  4HCN B;  3ZW3 A;  1TXD A;  1U5E A;  1WGQ A;  4TQ0 A;  1Q1O A;  3E9O A;  3ONS A;  4ILH A;  1M7R A;  4A3P A;  3SNH A;  3M3J A;  2V76 A;  1V86 A;  3M95 A;  4IFS A;  1ZGU B;  4EZK A;  5J18 A;  1NI2 A;  1T0Y A;  1A5R A;  1PFJ A;  1ZKH A;  1HE8 A;  2O2V B;  1GJZ A;  1XX0 A;  3FEH A;  4B95 A;  2PE6 B;  4AOF A;  4W9E A;  4K7W A;  5D7G A;  1WGD A;  2D9Y A;  4KV2 A;  4MGK E;  1C1Y B;  3TFM A;  3VUX A;  2V4L A;  3A9J A;  5KQ1 A;  1KZ7 A;  4BOZ B;  3F5R A;  2LXA A;  3B08 A;  2LOX A;  1MK9 B;  2CU1 A;  3AXC A;  4HB3 B;  3A9K B;  2N9E B;  1TGZ B;  2GMI C;  4CHM A;  3HQC A;  1LM8 B;  1OMW A;  5KQ4 A;  1E7U A;  1WGH A;  2DHK A;  2KFK A;  4GU2 A;  4HPL B;  2Y7B A;  1BAK A;  1ZVR A;  1V2Y A;  2N9X A;  2XQN M;  3PHW B;  4Z2M B;  3FLV A;  3PVL A;  4M8N A;  2KZR A;  4WJP A;  1Q5W B;  1WXM A;  1WE6 A;  2DHZ A;  2Y8F A;  4W9L A;  2QHO A;  2KTR A;  5JP4 A;  2VRR B;  3QHT A;  2ELB A;  3ZNI D;  5EDS A;  3B0A A;  4URK A;  3V6C B;  1GC7 A;  4BOS C;  4YL8 A;  3APF A;  4C0A A;  5LOP B;  3N7C A;  1WR1 A;  2NR2 A;  2CKH B;  2LUL A;  2AWT A;  1RAX A;  2HE7 A;  5AEK B;  1X86 A;  5C23 A;  1RLF A;  1WXS A;  2KK8 A;  2LVO A;  3Q3F A;  2FAZ A;  2BWF A;  3KRW A;  2ELA A;  3FSS A;  1MIZ B;  2DEN B;  5IA7 A;  1EF5 A;  2KMA A;  5DI9 B;  1J19 A;  1TJ6 A;  2KO3 A;  4DHJ B;  1TTN A;  1I35 A;  2PPH A;  2KCJ A;  3DXC A;  1UBI A;  3ULC A;  4B6H A;  4WJQ A;  2GS0 A;  2Z0O A;  4JLC A;  5LXH A;  2CHX A;  5LXI B;  3MPX A;  2D9W A;  2PEA A;  3L17 A;  2RLO A;  4YON A;  2J0K A;  2LGY A;  1V89 A;  2LVP A;  4G3X B;  2BKF A;  1WZ3 A;  2RNR B;  3R3M A;  2FUH B;  1V9J A;  5HE1 A;  4MK0 A;  2YT0 A;  1AWE A;  1WI0 A;  3WAL A;  2IO1 B;  2KQ7 A;  3T8M A;  2JZ3 B;  3VUW A;  4FJZ A;  2FJL A;  2JRI B;  1V49 A;  3HHM A;  3OLM D;  1U5F A;  2DX5 B;  1P3Q U;  2MSE D;  2D2Q A;  1V61 A;  3OAN A;  2NVU I;  2XBB C;  5FI1 A;  3A4R A;  4FLH A;  3ML8 A;  1V88 A;  1WJ4 A;  1LQB A;  3QBV B;  4RM8 A;  3VFK A;  5FR6 A;  4HHV A;  3H7S A;  1VBG A;  1V81 A;  2O2V A;  4JK7 A;  2N4F A;  2RSG A;  4MGY E;  2JZZ A;  2N23 A;  4JKG B;  2ZPN A;  4TYZ A;  2B3A A;  3E9L A;  1WI1 A;  3V61 A;  5GMV A;  3DXD A;  4HAU B;  3K9P B;  3DPD A;  4GDK A;  2RGF A;  1KJT A;  1KI1 B;  5DHF B;  1P1A A;  4HAT B;  1WGY A;  2G4S A;  3RZW C;  3D8D A;  2JP2 A;  1F9J A;  5D2M B;  4JKH A;  1ZSQ A;  5DPT A;  3ZRF A;  3ECI A;  1YIW A;  5L81 A;  4FN2 A;  4E74 A;  4IWP A;  3RCP A;  2KJH B;  1LW3 A;  3UF8 A;  3GYP A;  2LBB A;  3HK0 A;  3SYX A;  5CHF A;  1RFA A;  2L3Z A;  1WRD B;  5AZG A;  1HB6 A;  3U30 A;  2ZEQ A;  4WJN A;  3E66 A;  3R66 C;  5D3W A;  3X0W A;  2AL6 A;  3U8Z A;  3VHT C;  2H7D A;  4A5K A;  1TQZ A;  2J0M A;  4GOC A;  4AJY B;  2DHJ A;  2LXC A;  2IY1 B;  3VDZ A;  4W9F A;  4GXB A;  3QK0 A;  2GCL A;  3RUL A;  2KWV B;  3IBE A;  4MSM B;  4TUU A;  4LJP B;  1G6J A;  1U5G A;  1KM7 A;  4TQ1 A;  4XX5 A;  4JK9 A;  1DYN A;  2DKQ A;  2ZZP B;  4G0N B;  3WIM A;  1DDW A;  2Z0P A;  2PJH A;  3KH0 A;  4HLE A;  2KKC A;  4A6K A;  1LFD A;  2MDX A;  3VTW A;  2D9V A;  1L7Y A;  3ODO A;  2LRW A;  2DHI A;  4XWX A;  3SD5 A;  4NQL B;  4K81 A;  1WGR A;  4L6E A;  2M14 A;  3T06 A;  1JRU A;  1WGU A;  2FCM A;  1WM2 A;  1WJ6 A;  1BT0 A;  5J3Q A;  4GDL B;  3RCZ A;  2I5C A;  3ZUN A;  2R2Q A;  3JSV B;  1NDD A;  2WX1 A;  3PRZ A;  3DVN U;  1MAI A;  4H8S A;  2FCQ A;  1RRP B;  4FA6 A;  2YT1 A;  1IRS A;  1VBH A;  1BWN A;  2RGN B;  5D3Y A;  3HM6 X;  3L13 A;  2CB8 A;  3DBS A;  3EHV A;  4IC7 B;  1ZW7 A;  3E9P A;  4HB0 B;  3ENE A;  2WYQ A;  2NMB A;  4I6L B;  3JW0 X;  3UIN B;  2YVC A;  4PS7 A;  3ML4 A;  2KGX B;  1QQG A;  3A1Q A;  1FGZ A;  4PS8 A;  3TMP B;  2ROV A;  4PYU A;  3ZNG C;  2VKI A;  3ZVV A;  5KHO A;  3KUD B;  3ENB A;  4FAD A;  1EAZ A;  4W9C A;  2D11 A;  3WAO A;  2RQ1 A;  2L8J A;  1H8C A;  1SE9 A;  1AQC A;  1N3H A;  3PZD A;  5J3Y A;  1W1D A;  2X0S A;  3ML9 A;  4WQO B;  4DX8 A;  5DIF B;  3N30 A;  4ZRI A;  3Q3J A;  1WF9 A;  2Z0E B;  2I5F A;  3WAP A;  2GBK A;  5J17 A;  3ZVR A;  5C5B A;  2LKO A;  1NU2 A;  5J2R A;  4M8M A;  2KWC A;  1H4R A;  4IG7 B;  1FHW A;  2IY0 B;  1WM3 A;  2DZM A;  5TR5 A;  1WVH A;  2MBB B;  3VUY A;  1Q67 A;  5LLI A;  4DXA B;  2OOB B;  2NPT B;  5HE3 A;  2XEW A;  4Y94 A;  1L2N A;  3RD2 A;  3V60 A;  4JQW C;  2COD A;  2CY5 A;  3SU8 X;  2MWN B;  1WG7 A;  1WJM A;  2CY4 A;  3LJ3 A;  3SHQ A;  2KTF A;  3HW2 B;  4PNK A;  1XD3 B;  3EEC A;  1XOD A;  1DIK A;  4HWI B;  4WSF A;  4HK2 A;  2P8V A;  4DHJ D;  2PZ1 A;  1QC6 A;  1B55 A;  1XD4 A;  3T9L A;  2P0F A;  3NHE B;  3VQI A;  2NZ8 B;  4FJY A;  1XR0 B;  2K2U A;  2KFJ A;  2G3Q B;  4MDK E;  2D9X A;  2MP2 A;  4I6P A;  3DVG X;  4GSW A;  4K7U A;  2DZJ A;  4F7U P;  4WWP A;  3G9W A;  1I7A A;  1NVL A;  2ABD A;  1H10 A;  2UZR A;  5HE0 A;  2K6D B;  4IW0 A;  2YF0 A;  4II3 B;  3PTF C;  2M1M A;  4BKS D;  2KVR A;  2C7M B;  2AEH A;  4KVG B;  2JRH A;  2KX3 A;  4W9I A;  1V5P A;  4EJN A;  5DHA B;  2KLC A;  4FHK A;  2BPS A;  1SHC A;  1R4M I;  4HAW B;  1AAR A;  2CHZ A;  3P6A A;  1WX8 A;  2MBH A;  3PLU A;  3AUL A;  4HDQ A;  1KLV A;  5D27 A;  4FHJ A;  1UPQ A;  2N7E A;  3N3K B;  3W1S C;  4NAW A;  2EKE C;  4DWF A;  4KHA A;  1OGW A;  2MBE A;  3L10 B;  3A8P A;  4HAY B;  4W9D A;  3SUZ A;  1WX9 A;  4ICU A;  2LOZ A;  3D8F A;  1EGX A;  4MT7 A;  2LZ6 A;  4MY6 A;  1E8X A;  4GIV A;  2KJR A;  3PGE A;  3AU4 A;  2R82 A;  2PE9 A;  3NS8 A;  4A6H A;  4NNJ B;  2MCN B;  4W9G A;  3B1L X;  3HIZ A;  3W1S A;  4K1R B;  2FDQ A;  3SBT A;  3H9D A;  3ZLZ A;  2LRU A;  4D0N B;  2FCS A;  1P98 A;  2C5L C;  3C0R B;  1WR6 E;  1EF1 A;  4DBG A;  4NY0 A;  3A4S C;  4EFO A;  2IO3 B;  3ZO5 B;  2OJR A;  4MSQ B;  2MFQ A;  2KC1 A;  4IAP A;  2IBI B;  2ZPY A;  4ILG B;  3M63 B;  2NS5 A;  1Q0W B;  2MX2 A;  5CLQ B;  2GBM A;  4FJV B;  3NSU A;  4LCD E;  2M17 A;  4E3C A;  3WAN A;  3KY9 A;  4GPT B;  3TO1 A;  2D9Z A;  2O6V B;  2N1V A;  3ZTC A;  1DDV A;  5JHH A;  3EPY A;  4B6W A;  2ZVN A;  2UVM A;  4W9K A;  2DTC A;  4WWO A;  4MH0 E;  3AU5 A;  2V1Y A;  2HTH B;  3F0W A;  1V6E A;  2KOX A;  4MJS B;  5LON B;  2X18 A;  3QA8 A;  3ALB A;  1JDE A;  3UGB B;  5FI0 A;  4JK8 A;  3ODW A;  3KRX A;  3UIO B;  1C3T A;  4KDI C;  4NJ6 A;  4F1S A;  1HB8 A;  3H7P B;  5C5B B;  2G4D B;  1S1Q B;  2M0X A;  2OQB A;  3V62 A;  4XZ4 A;  3V6E B;  5JH5 C;  1SGH A;  4NSW A;  1W1H A;  1X1M A;  2V3S A;  1EVH A;  2K39 A;  4ANW A;  4JKD A;  2Z59 B;  3RUI B;  5AZF A;  4K7S A;  2L1C A;  2LWP A;  5IAA C;  2DA0 A;  1XKE A;  4AUQ C;  2NCN A;  3PVW A;  4NQK E;  3ZDT A;  3VH3 B;  3L16 A;  4CO7 A;  2BYV E;  2I1J A;  1WY8 A;  1I42 A;  1KBL A;  2KDB A;  1IP9 A;  1S3S G;  2JY6 A;  3ULB A;  2LGD A;  3WYF B;  2ZVO A;  4EEW A;  3H7P A;  2N9P C;  1E5W A;  3DXE A;  4OVV A;  2KXJ A;  1P3R A;  1UH6 A;  2W2W A;  2JUO A;  2YRY A;  1PQS A;  4KZC A;  3QWZ B;  4WJ7 A;  4ILJ A;  1DBH A;  2IFS A;  4HVB A;  2Z0D B;  3MTN B;  2K1F A;  3KYD D;  3TBL D;  1FGY A;  5KCV A;  4RMA A;  2GOW A;  3L08 A;  2KC2 A;  4RM9 A;  2EJ8 A;  1QZE A;  4BVU C;  2QKL A;  4HPM B;  2MQJ A;  3QQ8 B;  4KSK C;  4EUT A;  3GOE A;  4HXD A;  1K8R B;  3TL5 A;  1GUA B;  3UQA A;  2ZCB A;  1I2H A;  2M8S A;  2KWU B;  3KSY A;  1WFY A;  2GCJ A;  3PSC A;  2UWQ A;  4JKF A;  3KUZ A;  2L7R A;  2YLM A;  4XC2 A;  4MGZ E;  3KZ1 A;  4Z2N A;  2LYD A;  2VRW B;  1V5M A;  4BBN F;  1ZC3 B;  2K8C A;  3LJU X;  4ZYN A;  3P2B A;  5HE2 A;  3H1U A;  2REX A;  2WDT B;  3PRP B;  3UIP B;  2BYE A;  1HBK A;  3BJI A;  5E6N A;  4HJK A;  2NBW B;  4JKB A;  2KUP A;  2XK5 A;  4IWQ A;  3A8Q A;  3WA0 A;  3VH4 B;  3TIX A;  4K2P A;  3RZF A;  2KMC A;  2RR9 A;  4DDG D;  2HRJ A;  1Y8R C;  3KW5 B;  2FJ9 A;  2JVC A;  5C1Z A;  2NBU A;  2G45 B;  2COF A;  1YQB A;  5D6J B;  2D3G A;  5AZH A;  3HM3 A;  2LUE A;  3DBR I;  1J0W A;  4HAX B;  5L83 A;  2ADZ A;  3O96 A;  3X23 A;  1ISN A;  1E90 A;  1E8Z A;  2D07 B;  4JKE A;  2IYB A;  4HAV B;  2MWS B;  2KHW B;  4ANV A;  4IM3 A;  2BCJ A;  1U29 A;  1LB1 A;  3A9J B;  2ASQ A;  2MA9 B;  2MBO A;  1Y5O A;  2JT4 B;  2DYM A;  3VTV A;  2RVB B;  4KAX B;  1R4N I;  4IUM B;  4X57 B;  2ZNV B;  4DBB A;  3MJW A;  1Y19 B;  4HB4 B;  2K25 A;  1UBQ A;  2KFK B;  3APC A;  3VOQ A;  3CST A;  2AYO B;  3FP5 A;  3EC8 A;  3OJ4 B;  4PYZ A;  2H7E A;  1D3Z A;  2KX0 A;  1Z5S B;  3W1Y A;  4NPN A;  5GOW B;  3A9K A;  4GDL A;  2K6Q A;  4JKC A;  3S2A A;  2DFK A;  4EKU A;  5C79 A;  4MGI E;  3DVG Y;  4HDO A;  3R7R A;  1UPR A;  5CLL B;  2QKM A;  2J0J A;  2JF5 A;  1V5U A;  3V5W A;  2COA A;  2COC A;  2JXX A;  4ZDV A;  1ZC4 B;  2D10 A;  3FM8 C;  1CMX B;  5L95 C;  2XK5 B;  2DZK A;  2G35 A;  4J6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...