2FJ9A

High resolution crystal structure of the unliganded human acbp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
86
structure length
86
Chain Sequence
b'SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 34
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2fj9A00
2J0KA 4CYEA 2CB8A 4DXAB 1ACAA 2EMSA 2J0JA 1ST7A 2AL6A 2EMTA 3G9WA 3BINA 2J0MA 2HE7A 4HDQA 4YL8A 3PZDA 3EPYA 1J19A 1MIXA 1H4RA 3X23A 3U8ZA 2LBBA 2D11A 1HBKA 4ZRKA 1Y19B 2ZPYA 4ZRJA 4F7GA 2D2QA 1GC6A 2HRJA 5IJMA 1ISNA 2YVCA 2AEHA 1HB6A 3FP5A 4P7IA 2WH5A 4EKUA 2D10A 3ZDTA 2I1JA 4ZRIA 3IVFA 1GG3A 2ABDA 1MIZB 1NVLA 3PVLA 1SGHA 2FDQA 3QIJA 3U7DA 2I1KA 1E5WA 3AU4A 2COPA 2FJ9A 1MK7B 4NY0A 2RQ1A 1HB8A 4HDOA 3WA0A 1NI2A 3FLVA 1MK9B 3AU5A 1EF1A 1GC7A 1NTIA 2CQUA
chains in the Genus database with same CATH superfamily
4CYEA 1ACAA 2AL6A 3BINA 4YL8A 4JK7A 3SBGA 1MIXA 4ZRKA 1HBKA 2ZPYA 4ZRJA 2D2QA 1JDEA 5IJMA 1HB6A 4JKDA 1NVLA 3QIJA 1GGOA 2I1KA 3AU4A 2FJ9A 4HDOA 3WA0A 1NI2A 3FLVA 4JKGA 4JKAA 1NTIA 3E9LA 4DXAB 2EMSA 1ST7A 3ENBA 3EPYA 1J19A 3X23A 3U8ZA 4F7GA 1GC6A 1ISNA 2WH5A 2D10A 2I1JA 1VBGA 2ABDA 3U7DA 1SGHA 2RQ1A 3E9OA 2DIKA 2CB8A 2J0JA 4JK8A 4HDQA 4JKHA 3PZDA 3E9PA 1H4RA 2LBBA 1Y19B 4JK9A 2HRJA 2X0SA 2YVCA 2AEHA 3FP5A 4JKCA 3ZDTA 5JVLA 4JKEA 1KC7A 1E5WA 1MK7B 1HB8A 4JKGB 1MK9B 3AU5A 4P7IA 2FDQA 1GC7A 2CQUA 2J0KA 2EMTA 3G9WA 2J0MA 2HE7A 3SBTA 2D11A 4GXBA 2R82A 1VBHA 4EKUA 4ILGB 4ZRIA 3IVFA 1GG3A 4JKFA 1MIZB 3PVLA 4ILHA 2COPA 3E66A 4NY0A 4JKBA 4TKNA 1DIKA 4ILJA 1KBLA 1EF1A
chains in the Genus database with same CATH topology
4CYEA 1ACAA 2AL6A 3BINA 4YL8A 4JK7A 3SBGA 1MIXA 4ZRKA 1HBKA 2ZPYA 4ZRJA 2D2QA 1JDEA 5IJMA 1HB6A 4JKDA 1NVLA 3QIJA 1GGOA 2I1KA 3AU4A 2FJ9A 4HDOA 3WA0A 1NI2A 3FLVA 4JKGA 4JKAA 1NTIA 3E9LA 4DXAB 2EMSA 1ST7A 3ENBA 3EPYA 1J19A 3X23A 3U8ZA 4F7GA 1GC6A 1ISNA 2WH5A 2D10A 2I1JA 1VBGA 2ABDA 3U7DA 1SGHA 2RQ1A 3E9OA 2DIKA 2CB8A 2J0JA 4JK8A 4HDQA 4JKHA 3PZDA 3E9PA 1H4RA 2LBBA 1Y19B 4JK9A 2HRJA 2X0SA 2YVCA 2AEHA 3FP5A 4JKCA 3ZDTA 5JVLA 4JKEA 1KC7A 1E5WA 1MK7B 1HB8A 4JKGB 1MK9B 3AU5A 4P7IA 2FDQA 1GC7A 2CQUA 2J0KA 2EMTA 3G9WA 2J0MA 2HE7A 3SBTA 2D11A 4GXBA 2R82A 1VBHA 4EKUA 4ILGB 4ZRIA 3IVFA 1GG3A 4JKFA 1MIZB 3PVLA 4ILHA 2COPA 3E66A 4NY0A 4JKBA 4TKNA 1DIKA 4ILJA 1KBLA 1EF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  4CYE A;  2CB8 A;  4DXA B;  1ACA A;  2EMS A;  2J0J A;  1ST7 A;  2AL6 A;  2EMT A;  3G9W A;  3BIN A;  2J0M A;  2HE7 A;  4HDQ A;  4YL8 A;  3PZD A;  3EPY A;  1J19 A;  1MIX A;  1H4R A;  3X23 A;  3U8Z A;  2LBB A;  2D11 A;  1HBK A;  4ZRK A;  1Y19 B;  2ZPY A;  4ZRJ A;  4F7G A;  2D2Q A;  1GC6 A;  2HRJ A;  5IJM A;  1ISN A;  2YVC A;  2AEH A;  1HB6 A;  3FP5 A;  4P7I A;  2WH5 A;  4EKU A;  2D10 A;  3ZDT A;  2I1J A;  4ZRI A;  3IVF A;  1GG3 A;  2ABD A;  1MIZ B;  1NVL A;  3PVL A;  1SGH A;  2FDQ A;  3QIJ A;  3U7D A;  2I1K A;  1E5W A;  3AU4 A;  2COP A;  2FJ9 A;  1MK7 B;  4NY0 A;  2RQ1 A;  1HB8 A;  4HDO A;  3WA0 A;  1NI2 A;  3FLV A;  1MK9 B;  3AU5 A;  1EF1 A;  1GC7 A;  1NTI A;  2CQU A; 
#chains in the Genus database with same CATH topology
 4CYE A;  1ACA A;  2AL6 A;  3BIN A;  4YL8 A;  4JK7 A;  3SBG A;  1MIX A;  4ZRK A;  1HBK A;  2ZPY A;  4ZRJ A;  2D2Q A;  1JDE A;  5IJM A;  1HB6 A;  4JKD A;  1NVL A;  3QIJ A;  1GGO A;  2I1K A;  3AU4 A;  2FJ9 A;  4HDO A;  3WA0 A;  1NI2 A;  3FLV A;  4JKG A;  4JKA A;  1NTI A;  3E9L A;  4DXA B;  2EMS A;  1ST7 A;  3ENB A;  3EPY A;  1J19 A;  3X23 A;  3U8Z A;  4F7G A;  1GC6 A;  1ISN A;  2WH5 A;  2D10 A;  2I1J A;  1VBG A;  2ABD A;  3U7D A;  1SGH A;  2RQ1 A;  3E9O A;  2DIK A;  2CB8 A;  2J0J A;  4JK8 A;  4HDQ A;  4JKH A;  3PZD A;  3E9P A;  1H4R A;  2LBB A;  1Y19 B;  4JK9 A;  2HRJ A;  2X0S A;  2YVC A;  2AEH A;  3FP5 A;  4JKC A;  3ZDT A;  5JVL A;  4JKE A;  1KC7 A;  1E5W A;  1MK7 B;  1HB8 A;  4JKG B;  1MK9 B;  3AU5 A;  4P7I A;  2FDQ A;  1GC7 A;  2CQU A;  2J0K A;  2EMT A;  3G9W A;  2J0M A;  2HE7 A;  3SBT A;  2D11 A;  4GXB A;  2R82 A;  1VBH A;  4EKU A;  4ILG B;  4ZRI A;  3IVF A;  1GG3 A;  4JKF A;  1MIZ B;  3PVL A;  4ILH A;  2COP A;  3E66 A;  4NY0 A;  4JKB A;  4TKN A;  1DIK A;  4ILJ A;  1KBL A;  1EF1 A; 
#chains in the Genus database with same CATH homology
 4CYE A;  1ACA A;  2AL6 A;  3BIN A;  4YL8 A;  4JK7 A;  3SBG A;  1MIX A;  4ZRK A;  1HBK A;  2ZPY A;  4ZRJ A;  2D2Q A;  1JDE A;  5IJM A;  1HB6 A;  4JKD A;  1NVL A;  3QIJ A;  1GGO A;  2I1K A;  3AU4 A;  2FJ9 A;  4HDO A;  3WA0 A;  1NI2 A;  3FLV A;  4JKG A;  4JKA A;  1NTI A;  3E9L A;  4DXA B;  2EMS A;  1ST7 A;  3ENB A;  3EPY A;  1J19 A;  3X23 A;  3U8Z A;  4F7G A;  1GC6 A;  1ISN A;  2WH5 A;  2D10 A;  2I1J A;  1VBG A;  2ABD A;  3U7D A;  1SGH A;  2RQ1 A;  3E9O A;  2DIK A;  2CB8 A;  2J0J A;  4JK8 A;  4HDQ A;  4JKH A;  3PZD A;  3E9P A;  1H4R A;  2LBB A;  1Y19 B;  4JK9 A;  2HRJ A;  2X0S A;  2YVC A;  2AEH A;  3FP5 A;  4JKC A;  3ZDT A;  5JVL A;  4JKE A;  1KC7 A;  1E5W A;  1MK7 B;  1HB8 A;  4JKG B;  1MK9 B;  3AU5 A;  4P7I A;  2FDQ A;  1GC7 A;  2CQU A;  2J0K A;  2EMT A;  3G9W A;  2J0M A;  2HE7 A;  3SBT A;  2D11 A;  4GXB A;  2R82 A;  1VBH A;  4EKU A;  4ILG B;  4ZRI A;  3IVF A;  1GG3 A;  4JKF A;  1MIZ B;  3PVL A;  4ILH A;  2COP A;  3E66 A;  4NY0 A;  4JKB A;  4TKN A;  1DIK A;  4ILJ A;  1KBL A;  1EF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...