2FJ9A

High resolution crystal structure of the unliganded human acbp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
86
structure length
86
Chain Sequence
SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Acyl-CoA-binding protein
total genus 34
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2fj9A00
3AU5A 3X23A 3PVLA 4EKUA 1HB6A 1MIZB 2COPA 2HRJA 2ZPYA 2I1JA 3U8ZA 4F7GA 1NI2A 1Y19B 2YVCA 3FP5A 1ISNA 1MK7B 4P7IA 1NTIA 4HDOA 4NY0A 4ZRJA 3ZDTA 2D10A 2AL6A 3G9WA 1GC6A 1GC7A 1HBKA 1J19A 1ST7A 4YL8A 4CYEA 2WH5A 1SGHA 1NVLA 3AU4A 1MIXA 4HDQA 1HB8A 3WA0A 1ACAA 1EF1A 4ZRKA 2FDQA 1GG3A 2J0KA 3U7DA 2AEHA 2LBBA 3BINA 1H4RA 1MK9B 2EMSA 2D11A 2EMTA 3FLVA 2I1KA 2ABDA 2CQUA 3QIJA 2FJ9A 1E5WA 2CB8A 4DXAB 2HE7A 2RQ1A 3IVFA 5IJMA 2D2QA 4ZRIA 3PZDA 3EPYA 2J0MA 2J0JA
chains in the Genus database with same CATH superfamily
4ILJA 2HRJA 1MIZB 2COPA 3SBGA 1NI2A 1MK7B 4GXBA 2D10A 2AL6A 4YL8A 4CYEA 1SGHA 4JKFA 4HDQA 1KC7A 1MK9B 2D11A 3FLVA 3E66A 3QIJA 3E9OA 4DXAB 3SBTA 5IJMA 2D2QA 1KBLA 1GGOA 4ZRIA 2J0JA 3AU5A 3X23A 2I1JA 4JKHA 1Y19B 1ISNA 4NY0A 4JKCA 1GC7A 1J19A 1ST7A 2WH5A 1ACAA 3ENBA 4ZRKA 2DIKA 1GG3A 2J0KA 3BINA 1H4RA 1VBGA 2CB8A 2RQ1A 3IVFA 4JKGB 3PZDA 3EPYA 4TKNA 4JK8A 4EKUA 3PVLA 1HB6A 3U8ZA 4F7GA 4JK9A 2ZPYA 4JK7A 3FP5A 4ILGB 3ZDTA 1GC6A 2X0SA 1NVLA 2R82A 4JKBA 1HB8A 1EF1A 3U7DA 2FDQA 2AEHA 2EMSA 4JKEA 2I1KA 2CQUA 4JKGA 2FJ9A 1E5WA 4JKAA 2HE7A 1VBHA 3E9PA 4ILHA 2J0MA 4JKDA 1JDEA 2YVCA 4ZRJA 4P7IA 1NTIA 4HDOA 3G9WA 1HBKA 3AU4A 3E9LA 1MIXA 3WA0A 2LBBA 2EMTA 2ABDA 5JVLA 1DIKA
chains in the Genus database with same CATH topology
4ILJA 2HRJA 1MIZB 2COPA 3SBGA 1NI2A 1MK7B 4GXBA 2D10A 2AL6A 4YL8A 4CYEA 1SGHA 4JKFA 4HDQA 1KC7A 1MK9B 2D11A 3FLVA 3E66A 3QIJA 3E9OA 4DXAB 3SBTA 5IJMA 2D2QA 1KBLA 1GGOA 4ZRIA 2J0JA 3AU5A 3X23A 2I1JA 4JKHA 1Y19B 1ISNA 4NY0A 4JKCA 1GC7A 1J19A 1ST7A 2WH5A 1ACAA 3ENBA 4ZRKA 2DIKA 1GG3A 2J0KA 3BINA 1H4RA 1VBGA 2CB8A 2RQ1A 3IVFA 4JKGB 3PZDA 3EPYA 4TKNA 4JK8A 4EKUA 3PVLA 1HB6A 3U8ZA 4F7GA 4JK9A 2ZPYA 4JK7A 3FP5A 4ILGB 3ZDTA 1GC6A 2X0SA 1NVLA 2R82A 4JKBA 1HB8A 1EF1A 3U7DA 2FDQA 2AEHA 2EMSA 4JKEA 2I1KA 2CQUA 4JKGA 2FJ9A 1E5WA 4JKAA 2HE7A 1VBHA 3E9PA 4ILHA 2J0MA 4JKDA 1JDEA 2YVCA 4ZRJA 4P7IA 1NTIA 4HDOA 3G9WA 1HBKA 3AU4A 3E9LA 1MIXA 3WA0A 2LBBA 2EMTA 2ABDA 5JVLA 1DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  3X23 A;  3PVL A;  4EKU A;  1HB6 A;  1MIZ B;  2COP A;  2HRJ A;  2ZPY A;  2I1J A;  3U8Z A;  4F7G A;  1NI2 A;  1Y19 B;  2YVC A;  3FP5 A;  1ISN A;  1MK7 B;  4P7I A;  1NTI A;  4HDO A;  4NY0 A;  4ZRJ A;  3ZDT A;  2D10 A;  2AL6 A;  3G9W A;  1GC6 A;  1GC7 A;  1HBK A;  1J19 A;  1ST7 A;  4YL8 A;  4CYE A;  2WH5 A;  1SGH A;  1NVL A;  3AU4 A;  1MIX A;  4HDQ A;  1HB8 A;  3WA0 A;  1ACA A;  1EF1 A;  4ZRK A;  2FDQ A;  1GG3 A;  2J0K A;  3U7D A;  2AEH A;  2LBB A;  3BIN A;  1H4R A;  1MK9 B;  2EMS A;  2D11 A;  2EMT A;  3FLV A;  2I1K A;  2ABD A;  2CQU A;  3QIJ A;  2FJ9 A;  1E5W A;  2CB8 A;  4DXA B;  2HE7 A;  2RQ1 A;  3IVF A;  5IJM A;  2D2Q A;  4ZRI A;  3PZD A;  3EPY A;  2J0M A;  2J0J A; 
#chains in the Genus database with same CATH topology
 4ILJ A;  2HRJ A;  1MIZ B;  2COP A;  3SBG A;  1NI2 A;  1MK7 B;  4GXB A;  2D10 A;  2AL6 A;  4YL8 A;  4CYE A;  1SGH A;  4JKF A;  4HDQ A;  1KC7 A;  1MK9 B;  2D11 A;  3FLV A;  3E66 A;  3QIJ A;  3E9O A;  4DXA B;  3SBT A;  5IJM A;  2D2Q A;  1KBL A;  1GGO A;  4ZRI A;  2J0J A;  3AU5 A;  3X23 A;  2I1J A;  4JKH A;  1Y19 B;  1ISN A;  4NY0 A;  4JKC A;  1GC7 A;  1J19 A;  1ST7 A;  2WH5 A;  1ACA A;  3ENB A;  4ZRK A;  2DIK A;  1GG3 A;  2J0K A;  3BIN A;  1H4R A;  1VBG A;  2CB8 A;  2RQ1 A;  3IVF A;  4JKG B;  3PZD A;  3EPY A;  4TKN A;  4JK8 A;  4EKU A;  3PVL A;  1HB6 A;  3U8Z A;  4F7G A;  4JK9 A;  2ZPY A;  4JK7 A;  3FP5 A;  4ILG B;  3ZDT A;  1GC6 A;  2X0S A;  1NVL A;  2R82 A;  4JKB A;  1HB8 A;  1EF1 A;  3U7D A;  2FDQ A;  2AEH A;  2EMS A;  4JKE A;  2I1K A;  2CQU A;  4JKG A;  2FJ9 A;  1E5W A;  4JKA A;  2HE7 A;  1VBH A;  3E9P A;  4ILH A;  2J0M A;  4JKD A;  1JDE A;  2YVC A;  4ZRJ A;  4P7I A;  1NTI A;  4HDO A;  3G9W A;  1HBK A;  3AU4 A;  3E9L A;  1MIX A;  3WA0 A;  2LBB A;  2EMT A;  2ABD A;  5JVL A;  1DIK A; 
#chains in the Genus database with same CATH homology
 4ILJ A;  2HRJ A;  1MIZ B;  2COP A;  3SBG A;  1NI2 A;  1MK7 B;  4GXB A;  2D10 A;  2AL6 A;  4YL8 A;  4CYE A;  1SGH A;  4JKF A;  4HDQ A;  1KC7 A;  1MK9 B;  2D11 A;  3FLV A;  3E66 A;  3QIJ A;  3E9O A;  4DXA B;  3SBT A;  5IJM A;  2D2Q A;  1KBL A;  1GGO A;  4ZRI A;  2J0J A;  3AU5 A;  3X23 A;  2I1J A;  4JKH A;  1Y19 B;  1ISN A;  4NY0 A;  4JKC A;  1GC7 A;  1J19 A;  1ST7 A;  2WH5 A;  1ACA A;  3ENB A;  4ZRK A;  2DIK A;  1GG3 A;  2J0K A;  3BIN A;  1H4R A;  1VBG A;  2CB8 A;  2RQ1 A;  3IVF A;  4JKG B;  3PZD A;  3EPY A;  4TKN A;  4JK8 A;  4EKU A;  3PVL A;  1HB6 A;  3U8Z A;  4F7G A;  4JK9 A;  2ZPY A;  4JK7 A;  3FP5 A;  4ILG B;  3ZDT A;  1GC6 A;  2X0S A;  1NVL A;  2R82 A;  4JKB A;  1HB8 A;  1EF1 A;  3U7D A;  2FDQ A;  2AEH A;  2EMS A;  4JKE A;  2I1K A;  2CQU A;  4JKG A;  2FJ9 A;  1E5W A;  4JKA A;  2HE7 A;  1VBH A;  3E9P A;  4ILH A;  2J0M A;  4JKD A;  1JDE A;  2YVC A;  4ZRJ A;  4P7I A;  1NTI A;  4HDO A;  3G9W A;  1HBK A;  3AU4 A;  3E9L A;  1MIX A;  3WA0 A;  2LBB A;  2EMT A;  2ABD A;  5JVL A;  1DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...