2FJ9A

High resolution crystal structure of the unliganded human acbp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
86
structure length
86
Chain Sequence
SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Acyl-CoA-binding protein
publication title High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2fj9A00
1E5WA 2COPA 4YL8A 3AU4A 1HBKA 1EF1A 4HDOA 1J19A 1HB6A 1MK9B 1SGHA 1MIXA 2I1KA 1Y19B 2HRJA 2D11A 2I1JA 2ZPYA 3EPYA 3FLVA 3WA0A 3AU5A 4ZRKA 2HE7A 1ACAA 2FDQA 3PZDA 3FP5A 1MK7B 3PVLA 3QIJA 1GC6A 1H4RA 1NVLA 2D2QA 2RQ1A 4NY0A 2LBBA 1HB8A 1NI2A 2J0MA 1GC7A 2FJ9A 4F7GA 2D10A 4ZRJA 3X23A 5IJMA 2AL6A 2J0JA 2YVCA 2EMSA 1ST7A 2CQUA 4DXAB 2CB8A 2ABDA 3G9WA 4P7IA 3U8ZA 1GG3A 1NTIA 3IVFA 2WH5A 1ISNA 4CYEA 3U7DA 4EKUA 2AEHA 3BINA 4ZRIA 3ZDTA 1MIZB 2J0KA 4HDQA 2EMTA
chains in the Genus database with same CATH superfamily
4YL8A 3E9PA 3SBGA 1Y19B 2I1JA 2D11A 3QIJA 2LBBA 4ILHA 2FJ9A 4JKDA 3X23A 1ST7A 2CQUA 2ABDA 3U8ZA 4P7IA 3IVFA 2AEHA 4ZRIA 3ZDTA 4HDQA 2J0MA 2EMTA 1E5WA 3AU4A 1EF1A 4HDOA 4ILJA 1J19A 1SGHA 1DIKA 2HRJA 2R82A 3AU5A 4ZRKA 3E66A 2FDQA 4ILGB 5JVLA 2D2QA 4JK8A 4JKBA 1HB8A 2X0SA 4JKHA 4F7GA 2J0JA 1KC7A 1ISNA 4JK7A 5IJMA 2DIKA 4DXAB 2COPA 1HB6A 1MIXA 3FLVA 3EPYA 3WA0A 2HE7A 1ACAA 1VBGA 3FP5A 1MK7B 1H4RA 1NI2A 4JKGA 1VBHA 1GC7A 2D10A 4ZRJA 2AL6A 2YVCA 2EMSA 1JDEA 2CB8A 1GGOA 1GG3A 2WH5A 3U7DA 4CYEA 4JKCA 3E9LA 1KBLA 4JKAA 1HBKA 1MK9B 2I1KA 2ZPYA 4JKFA 4JKEA 4JK9A 4GXBA 3PZDA 3PVLA 1GC6A 1NVLA 2RQ1A 3ENBA 4NY0A 3SBTA 3E9OA 4JKGB 4TKNA 3G9WA 1NTIA 4EKUA 3BINA 1MIZB 2J0KA
chains in the Genus database with same CATH topology
4YL8A 3E9PA 3SBGA 1Y19B 2I1JA 2D11A 3QIJA 2LBBA 4ILHA 2FJ9A 4JKDA 3X23A 1ST7A 2CQUA 2ABDA 3U8ZA 4P7IA 3IVFA 2AEHA 4ZRIA 3ZDTA 4HDQA 2J0MA 2EMTA 1E5WA 3AU4A 1EF1A 4HDOA 4ILJA 1J19A 1SGHA 1DIKA 2HRJA 2R82A 3AU5A 4ZRKA 3E66A 2FDQA 4ILGB 5JVLA 2D2QA 4JK8A 4JKBA 1HB8A 2X0SA 4JKHA 4F7GA 2J0JA 1KC7A 1ISNA 4JK7A 5IJMA 2DIKA 4DXAB 2COPA 1HB6A 1MIXA 3FLVA 3EPYA 3WA0A 2HE7A 1ACAA 1VBGA 3FP5A 1MK7B 1H4RA 1NI2A 4JKGA 1VBHA 1GC7A 2D10A 4ZRJA 2AL6A 2YVCA 2EMSA 1JDEA 2CB8A 1GGOA 1GG3A 2WH5A 3U7DA 4CYEA 4JKCA 3E9LA 1KBLA 4JKAA 1HBKA 1MK9B 2I1KA 2ZPYA 4JKFA 4JKEA 4JK9A 4GXBA 3PZDA 3PVLA 1GC6A 1NVLA 2RQ1A 3ENBA 4NY0A 3SBTA 3E9OA 4JKGB 4TKNA 3G9WA 1NTIA 4EKUA 3BINA 1MIZB 2J0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5W A;  2COP A;  4YL8 A;  3AU4 A;  1HBK A;  1EF1 A;  4HDO A;  1J19 A;  1HB6 A;  1MK9 B;  1SGH A;  1MIX A;  2I1K A;  1Y19 B;  2HRJ A;  2D11 A;  2I1J A;  2ZPY A;  3EPY A;  3FLV A;  3WA0 A;  3AU5 A;  4ZRK A;  2HE7 A;  1ACA A;  2FDQ A;  3PZD A;  3FP5 A;  1MK7 B;  3PVL A;  3QIJ A;  1GC6 A;  1H4R A;  1NVL A;  2D2Q A;  2RQ1 A;  4NY0 A;  2LBB A;  1HB8 A;  1NI2 A;  2J0M A;  1GC7 A;  2FJ9 A;  4F7G A;  2D10 A;  4ZRJ A;  3X23 A;  5IJM A;  2AL6 A;  2J0J A;  2YVC A;  2EMS A;  1ST7 A;  2CQU A;  4DXA B;  2CB8 A;  2ABD A;  3G9W A;  4P7I A;  3U8Z A;  1GG3 A;  1NTI A;  3IVF A;  2WH5 A;  1ISN A;  4CYE A;  3U7D A;  4EKU A;  2AEH A;  3BIN A;  4ZRI A;  3ZDT A;  1MIZ B;  2J0K A;  4HDQ A;  2EMT A; 
#chains in the Genus database with same CATH topology
 4YL8 A;  3E9P A;  3SBG A;  1Y19 B;  2I1J A;  2D11 A;  3QIJ A;  2LBB A;  4ILH A;  2FJ9 A;  4JKD A;  3X23 A;  1ST7 A;  2CQU A;  2ABD A;  3U8Z A;  4P7I A;  3IVF A;  2AEH A;  4ZRI A;  3ZDT A;  4HDQ A;  2J0M A;  2EMT A;  1E5W A;  3AU4 A;  1EF1 A;  4HDO A;  4ILJ A;  1J19 A;  1SGH A;  1DIK A;  2HRJ A;  2R82 A;  3AU5 A;  4ZRK A;  3E66 A;  2FDQ A;  4ILG B;  5JVL A;  2D2Q A;  4JK8 A;  4JKB A;  1HB8 A;  2X0S A;  4JKH A;  4F7G A;  2J0J A;  1KC7 A;  1ISN A;  4JK7 A;  5IJM A;  2DIK A;  4DXA B;  2COP A;  1HB6 A;  1MIX A;  3FLV A;  3EPY A;  3WA0 A;  2HE7 A;  1ACA A;  1VBG A;  3FP5 A;  1MK7 B;  1H4R A;  1NI2 A;  4JKG A;  1VBH A;  1GC7 A;  2D10 A;  4ZRJ A;  2AL6 A;  2YVC A;  2EMS A;  1JDE A;  2CB8 A;  1GGO A;  1GG3 A;  2WH5 A;  3U7D A;  4CYE A;  4JKC A;  3E9L A;  1KBL A;  4JKA A;  1HBK A;  1MK9 B;  2I1K A;  2ZPY A;  4JKF A;  4JKE A;  4JK9 A;  4GXB A;  3PZD A;  3PVL A;  1GC6 A;  1NVL A;  2RQ1 A;  3ENB A;  4NY0 A;  3SBT A;  3E9O A;  4JKG B;  4TKN A;  3G9W A;  1NTI A;  4EKU A;  3BIN A;  1MIZ B;  2J0K A; 
#chains in the Genus database with same CATH homology
 4YL8 A;  3E9P A;  3SBG A;  1Y19 B;  2I1J A;  2D11 A;  3QIJ A;  2LBB A;  4ILH A;  2FJ9 A;  4JKD A;  3X23 A;  1ST7 A;  2CQU A;  2ABD A;  3U8Z A;  4P7I A;  3IVF A;  2AEH A;  4ZRI A;  3ZDT A;  4HDQ A;  2J0M A;  2EMT A;  1E5W A;  3AU4 A;  1EF1 A;  4HDO A;  4ILJ A;  1J19 A;  1SGH A;  1DIK A;  2HRJ A;  2R82 A;  3AU5 A;  4ZRK A;  3E66 A;  2FDQ A;  4ILG B;  5JVL A;  2D2Q A;  4JK8 A;  4JKB A;  1HB8 A;  2X0S A;  4JKH A;  4F7G A;  2J0J A;  1KC7 A;  1ISN A;  4JK7 A;  5IJM A;  2DIK A;  4DXA B;  2COP A;  1HB6 A;  1MIX A;  3FLV A;  3EPY A;  3WA0 A;  2HE7 A;  1ACA A;  1VBG A;  3FP5 A;  1MK7 B;  1H4R A;  1NI2 A;  4JKG A;  1VBH A;  1GC7 A;  2D10 A;  4ZRJ A;  2AL6 A;  2YVC A;  2EMS A;  1JDE A;  2CB8 A;  1GGO A;  1GG3 A;  2WH5 A;  3U7D A;  4CYE A;  4JKC A;  3E9L A;  1KBL A;  4JKA A;  1HBK A;  1MK9 B;  2I1K A;  2ZPY A;  4JKF A;  4JKE A;  4JK9 A;  4GXB A;  3PZD A;  3PVL A;  1GC6 A;  1NVL A;  2RQ1 A;  3ENB A;  4NY0 A;  3SBT A;  3E9O A;  4JKG B;  4TKN A;  3G9W A;  1NTI A;  4EKU A;  3BIN A;  1MIZ B;  2J0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...