1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords radixin
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
2YS5A 2KDEB 3SV1A 2NVUI 3M3JA 3VH3B 3ZTDA 5KCVA 3DXEA 4LJPB 1MIZB 3N7CA 1XKEA 2COCA 1P3RA 2K39A 2NPTB 1FOEA 2N7DA 2C60A 2DHIA 1NU2A 2J59M 4KHOA 3RULA 4ZDVA 4II2B 2DZJA 1VCBA 5J2RA 1TTNA 3SHQA 1PFJA 2COFA 5KHQA 3SNHA 4GN1A 1QC6A 2CU1A 2KX0A 3NZUA 3ZDMC 3ZVVA 3V61A 4MJSA 2BCJA 3HK0A 3JW0X 5CHVC 4BOZB 2L8JA 2ADZA 4Z2NA 3H9DA 2UZSA 2K25A 3KY9A 2GMIC 3L08A 4B95A 3TCAA 2KUPA 5DI9B 2KTFA 3TMPB 1LW3A 4NAWB 4WVFB 1LB1A 1NBFC 1MKEA 2K6DB 3MPXA 3ODOA 2H7EA 1E8XA 5JLJB 5DH9B 4DX8A 2A4ZA 2CR5A 2ELAA 2ZJDA 1Z87A 3B0AA 3KUZA 1FB8A 2HJ8A 1UNRA 1PLSA 1H10A 4MK0A 3KYDD 4HCPB 4HPLB 4JIOU 3FM8C 1LQBA 2Y5BB 1P5TA 1TGZB 4MDKE 2NBVB 1ZSQA 2WX0A 3A4RA 3PG7A 3PLVA 2N0YA 2KQ7A 1UGMA 3PV1A 2KXJA 2RD0A 2G45B 2KLGA 4AJWA 3F0WA 5HKHA 2JY6A 1WXMA 4NPNA 3WIMA 4TV3A 1WXVA 4PS7A 5EFXA 2V76A 1GJZA 1ZGUB 1FHWA 3MTNB 4MGZE 3U30A 1NVLA 3VHTC 4FBJB 3LDZE 4ANUA 3I3TB 5HE2A 1IYFA 1E5WA 1UH6A 2BF8B 3CF6E 2KVRA 4IWQA 4HCNB 4DK5A 1UELA 5GMVA 2LVQA 4FHKA 4KSKC 2LYDA 3AJ4A 1WJUA 2BYFA 2IY0B 2RPQA 1G6JA 3NS8A 1GC6A 1WGQA 3UIPB 2JP2A 1WX9A 5HE0A 1WI0A 3X23A 4KAXB 3L54A 2YT0A 1QQGA 4E74A 3HHMA 2O2VB 3A98B 4HWIB 1OY2A 5GOWB 4W9IA 5DPWA 1S3SG 3DPDA 1T0YA 2N1WA 4OVUA 2CKHB 2CY5A 2DHJA 3AU5A 3WAPA 3N30A 2W2WA 2LXCA 1KM7A 2D10A 1WJ1A 5L81A 3CSTA 1FXTB 1YX6B 2KTRA 3PHWB 4W9CA 1W1GA 4HLEA 5KQ1A 2MLBA 3Q3JA 2VKIA 1BAKA 4GDLA 1WRDB 1HB6A 3PEGA 2CODA 2J0JA 4K2PA 2KDBA 4HPMB 2V3SA 3D8EA 2Z0QA 2CAYA 2QKLA 3UIOB 2DZMA 4WJQA 1R4MI 2LULA 3HQCA 3CXBB 1WGHA 3A1QA 3QAQA 4FHJA 3ML4A 2IO0B 1C3TA 2JRHA 2KX3A 4GU2A 2NMBA 5C6RA 1OMWA 2FDQA 4K7WA 3M1IB 3NHEB 5CLLB 3TW1A 2YT1A 1GUAB 2ZCCA 4IM2A 2PPHA 3RZFA 1V61A 4A3OA 3PVWA 3ZUNA 3UZTA 1WR6E 2BGFA 1Z5SB 2EMSA 3PSCA 2LVOA 2MP2A 4IM3A 1EGXA 4KDIC 5G2NA 1FAOA 1Y8RC 1B55A 1UD7A 2C7NB 2L76A 1HE8A 2IYDB 2N9EB 1XD3B 1WY8A 4KIKA 4WJPA 2L0TA 1I42A 2MWNB 2YRYA 4A20A 2MSED 3AI5A 1V49A 4HAUB 4K17A 3ZVRA 5D27A 3LJUX 5JP4A 3C0RB 1TZ1A 1UNQA 2AEHA 2CQUA 2NS5A 4C0AA 4LJOB 3SO6A 2UZRA 3PP2A 2L1CA 4HB4B 1X11A 1OQNA 1Q67A 1LXDA 1ZKHA 1U2BA 4F7ZA 2A5UA 4WJ7A 3KRWA 3KSYA 1ZC3B 1EAZA 2LXAA 3WALA 3ZNGC 2NBWB 4EKUA 2ZCBA 3D32A 1HBKA 1U5DA 4GZUA 2RSGA 3QBVB 3R66C 4FJZA 4MJSB 4W9DA 1SHCA 2KTRB 2X18A 3APCA 3DVNV 4D0NB 3A9JB 4RM8A 2HTHB 1WMHB 1OEYJ 4IOYX 4LCDE 1SIFA 1IP9A 2K1FA 3EC8A 3L13A 2IO2B 2V4LA 2CHXA 1ACAA 3PHXB 1WX7A 5JHBA 4TQ1A 1XX0A 5DPRA 2LBBA 3H7PB 1BTNA 4PYUA 4B6HA 2NPTA 2GJYA 4KZ0A 3OJ3A 2CHWA 3MHSD 4HXDA 1WGUA 4HJKA 1V80A 2ZVOA 3JYUA 2PJHA 1N3HA 3H1UA 4WJOA 1I35A 4HAZB 4Y94A 4BOSC 3P6AA 3V5WA 4EOYA 2K2JA 3ZLZA 4P7IA 3K9OB 2K8HA 1R4NI 2VRWB 4DHJD 2ROVA 2YF0A 4JL9A 4NSWA 4W9HA 1WE6A 4HDOA 3CSFA 3H6NA 2D11A 1WJ6A 4MGYE 4F7HA 2MW5A 3CMMB 3RCPA 4BBNF 5JHGA 2XK5B 2Z59B 4K7SA 2R0DA 5D6JB 4NY0A 2D9YA 3FLVA 4PYZA 2N1VA 5AZHA 3RZWC 1GG3A 1X1FA 5CX3A 2MCNB 1P9DU 3VFKA 4DHJB 3K9PB 3L10B 1DROA 1V88A 2COAA 4GB9A 4AP4C 1NTVA 4HATB 3ZKJC 1KI1B 2O6VA 3D8DA 3ENEA 2UVMA 2M4NA 3UF8A 4A6FA 2LD9A 4XC2A 2N9PC 1F9JA 2R2QA 5C79A 3N3KB 1WXSA 1M7EA 1V6EA 2JPHA 2W2XD 3A9KA 2MBHA 4G0NB 3ZNID 1DBHA 4AJYB 4URKA 1H4RA 2NR2A 4GMVA 2IZVB 1U5GA 5DIFB 3QHTA 3QARA 4N9F4 1NTYA 4GGQA 5BO4B 4HB0B 2MBEA 2Z0OA 3R7RA 2BPSA 2LUEA 2ZNVC 2DX5B 2KK8A 3IVFA 3P7ZA 2JZZA 1RJ2A 2KDIA 2HD5B 2Q13A 2KQSA 5CHFA 3A8QA 1P0RA 3NSUA 1WYWB 2KOXA 3M62B 1KLVA 1UPQA 4WWPA 1MAIA 2LKOA 5KHOA 1JRUA 1WGDA 5J3QA 1TBEA 3NY5A 3OLMD 3HM6X 3ZTCA 1FHOA 4MT7A 3ML8A 2OJRA 3N32A 2K8CA 2LGDA 1TQZA 4DBGA 3HW2B 3VDZA 4KHAA 2ZNVB 2L00B 2BYVE 3T9LA 2LJ5A 3V60A 5DHFB 3A8PA 2KFKA 3QK0A 5J17A 4ICVA 5D2MB 2Z0EB 3SU8X 4B6WA 4ANXA 5L83A 1M7RA 3QX1A 1XR0B 4HAWB 3ALBA 3AXCA 4KV2A 3UQAA 4NQKE 4TUUA 2Z0DB 2RSUA 3R3MA 2MBOA 3A33B 3ZDTA 4TQ0A 4ZRKA 4WSFA 3AULA 4CHJA 2M0XA 3PREA 1X1MA 3OJ4B 4IC7B 2HRJA 4DDGD 5EDSA 2O2VA 4HB3B 4K7UA 1D3ZA 1WJ4A 5AZFA 1WF9A 4DDID 1K8RB 2ZEQA 2N9XA 4X57B 2REXA 3ULCA 2GS0A 1V86A 3ZRCA 5D3XA 1AARA 2MFQA 1RLFA 1VD2A 1E90A 2L7RA 1ZM0A 2OQBA 2MKRA 3V6CB 2JUOA 4RMAA 4BFRA 4M0WB 2KJHB 2ELBA 5D3VA 3KUDB 3QJZA 1WH3A 1ST7A 3APFA 3VUXA 4W9JA 4F8CB 1LM8B 1AQCA 1K5DB 3BJIA 3SD5A 2ZVNA 4OVVA 4W9KA 4K2OA 2I1JA 5HE3A 2FNJB 1HB8A 2RGFA 3TO1A 2FCNA 2FUHB 2WWZA 4Z2MB 3VOQA 3IG3A 1E8ZA 4EJNA 2YSZA 4M8MA 3ECIA 2LOZA 1NDDA 2C9WB 2RUKB 3DBHI 4RM9A 3WAMA 4G50A 3PSEB 3H7SA 1WJNA 3DXDA 1WR1A 2G4SA 4J6IA 1TXDA 5TR5A 2GBKA 2D4QA 1WGRA 4MY6A 4DWFA 4IWOA 4G3XB 4GSWA 1BT0A 2DKQA 3KZ1A 1E7VA 2D9ZA 4FLHA 3TL5A 3F5RA 2W2XC 3MDBC 4B9KA 3PPAA 3IFWB 2YS1A 1XT9B 3V6EB 2XK5A 5E6OA 4E3CA 1E8YA 4F7UP 3VAWA 4CO7A 1IRSA 2UWQA 4DHZE 1UBQA 4BVUC 2G35A 2GBRA 1P3QU 1X86A 1V5UA 2YS3A 2DX1A 2ZPYA 2PE9A 3DVGY 4GIVA 4IG7B 3KVFB 4GOCA 3W1YA 2PE6B 5DPSA 3DDCB 2VRRB 5JH5C 2QHOA 4GXBA 2LRWA 1RFAA 1V5MA 1MIXA 2GCJA 2FIDA 3RUIB 2DYBA 3RYTA 3QWZB 2BKRB 2KMCA 4HAXB 4NNJB 5DPTA 4KHBB 2IY1B 3VXWA 1V2YA 2KC1A 3VQIA 1U5EA 1ZW7A 2JF5A 5C5BB 3DVGX 3EPYA 1U29A 2P0HA 2K00A 1X1GA 1NTIA 2XEWA 4FADA 2Y7BA 1UNPA 3PVLA 4GDLB 4II3B 2NZ8B 2L05A 2M14A 4EFOA 4F7GA 1TJ6A 2N23A 3O65B 1Q1OA 1EF5A 3QIJA 4GDKA 2KWVB 4MGKE 5J3YA 4NJ7A 1WXAA 2JT4B 1WE7A 2J0KA 3AU4A 2RGNB 3PVUA 4PNKA 1WFYA 5LONB 2LRUA 3G9WA 1BTKA 1UPRA 2P0DA 3D8FA 2KN5A 2DA0A 2DTCA 2LI5A 3LJ3A 3PRPB 1WI1A 2K6QA 3L17A 3Q3FA 1H8CA 5DHAB 3GYOA 3A4SC 1DDWA 2YLMA 1XQQA 1U27A 2FJ9A 2JWZA 4PQ0A 3V62A 4KIKB 4W9EA 1YX5B 2KO3A 1WJMA 1ZC4B 2RR9A 4YONA 3QA8A 1WGGA 4JLCA 3EHVA 3UGBB 2DLWA 3M95A 3ZIMA 5IA7A 3RD2A 3WAOA 2KLCA 2I1KA 2R09A 2PEAA 3ODXA 4BKGA 1WIAA 2KZRA 2LASA 3DOWA 2M17A 4I6PA 4DHZB 3ULBA 3PZDA 5G55A 4AOFA 3L0WB 2DAJA 4L6EA 2KANA 3A1QB 4IUMB 5D7GA 1GNUA 5JZEB 2FJLA 2AWTA 1YQBA 2V1YA 2DN6A 4TKNA 5CLQB 2G4DB 1YIWA 1WM3A 4K81A 2WYQA 3APDA 4HK2A 1YD8U 2PZ1A 2CHZA 1EVHA 2QKMA 4G11A 4MEMA 2K8BA 2D9VA 1RRPB 2DENB 2LZ6A 5FR6A 4FJYA 2JZ3B 4ZRIA 2C7HA 2KDFB 2JXXA 3NZSA 3TIXA 3T06A 1P1AA 2KHWB 2MBQA 2JRIB 3VTVA 1AWEA 1EF1A 4KVGB 3BY4B 1XCGA 4AWJA 3ONSA 1U5FA 2KD0A 3ZO5B 3PT2B 2MRPA 1J0WA 1ZVRA 3JSVA 3KH0A 3OANA 2D3GA 4JGHB 2ZPNA 1W1HA 1C1YB 3VVWB 2FCQA 3W1SC 1FGZA 3WYFB 4ZRJA 3HIZA 3T8MA 1M94A 4MSMB 2WH5A 3GOEA 4HVBA 5LXIB 3QCAA 1WGYA 4GDKB 2AL3A 4MH0E 2VSZA 1SGHA 4WWOA 2BWFA 2CS4A 1K5GB 3TVVA 1EUVB 2D2QA 1W1DA 3A9KB 2IYBA 3DXCA 3TFMA 4DX90 4W9FA 5LLIA 3W1SA 3KW5B 3TJPA 3HM3A 2P0FA 1QZEA 2L2IA 1E8WA 1SE9A 3VUWA 3PRMB 4YL8A 2FIFA 2JVCA 3RCZA 5L95C 2UYZB 4ASWC 3VUYA 3WA0A 4HAYB 5E6NA 5J3TA 3QC8B 3WANA 5E6PA 1LFDA 2J7QB 2LWPA 4M8NA 2HE7A 3BINA 2LGXA 2KJ6A 2NBUA 3ZW3A 2EMTA 2RVBB 3L16A 5HE1A 3SUZA 1WMHA 2HTHA 5IJMA 2IFSA 2E2XA 1WZ0A 2C5LC 3A9JA 4KDLB 5CHWA 4XZ4A 3R7QA 2DYNA 2IBIB 2WDTB 1OEYA 3DBSA 3JSVB 3KUCB 4WQOB 2FCMA 4A5KA 4ANVA 4H8SA 4EZKA 2L3ZA 3CIKA 1CMXB 1OQYA 2I5FA 2MX2A 2DKPA 3B1LX 3EFUA 5CTRC 4IM0A 5J18A 3DBLI 2XBBC 2LGYA 2O6VB 1I7AA 4PS8A 2GBMA 1IPGA 2KKCA 2NCNA 3DCGA 4EZLA 3GYPA 1ISNA 2KFJA 3RT3B 2DYQA 2KWCA 2I5CA 2KCJA 2ASQA 1FHXA 2G3QB 2IO3B 3IBEA 4BBNC 1MK7B 2H7DA 1Y19B 3FSSA 4GMXB 4KSLC 5JHHA 2YVCA 3TBLD 4EUTA 2D9WA 4NQLB 5C5BA 4ICUA 1V81A 3VTWA 1MPHA 4BBKA 3U8ZA 3P2BA 2M1MA 3B08A 1XD4A 2Z0PA 1UBIA 2MWSB 3OAWA 1J19A 2CY4A 3X0WA 4DXAB 5C16A 1KZGA 2LG1A 1OTRB 2Y8GA 1P98A 4HB2B 2DHZA 4ZYNA 2ABDA 2GBJA 4BKTA 2Y8FA 4FN2A 2K2UA 5D3YA 4E71A 2XQNM 5C1ZA 4HDQA 3KRXA 4GPTB 1PQSA 2P8VA 4F1SA 5D3WA 1S1QB 4FULA 1P6SA 1A5RA 1E7UA 4KZCA 4WAAA 2DX5A 4NAWA 5FI1A 1WM2A 1KOTA 1V89A 2CRFA 3IHPC 3EECA 3H7PA 3QQ8B 4FJVB 2D9XA 5DCNA 4IWPA 2OTXA 3DQVA 2FAZA 2COPA 4CYEA 1KZ7A 2RLOA 1BWNA 1RAXA 2R2OA 1WG7A 2RNRB 1DDMA 2MQJA 3DBRI 3KYCD 4MM3A 4WWNA 4HHVA 1XODA 3ODWA 3ML9A 1UZXB 3PGEA 1MG8A 2DZKA 2ZZPB 3PLUA 4JQWC 2N4FA 4XX5A 5AZGA 3ZRFA 4XWXA 2BYEA 4W9LA 4BKSD 3FP5A 1Q5WB 4PS3A 4ANWA 4W9GA 2MDXA 2DHKA 1L2NA 2KGXB 2M8SA 3JVZX 2D07B 2W9NA 5D94A 2ROZB 4IFSA 5JHAA 1PMSA 2KC2A 4AUQC 1DYNA 3M63B 2GBNA 2FCSA 2DYMA 4I6NB 4K1RB 4A6HA 1Q0WB 2LVPA 4A3PA 3GZNI 2KFKB 1WVHA 1FGYA 2O6VD 1V9JA 1Y5OA 2RQ1A 2J0MA 1V5TA 1YJ1A 2B3AA 4TYZA 2BWES 3MJWA 4LDTD 2KMAA 1WX8A 2IO1B 3S2AA 1U4AA 2KWUB 5FI0A 2DFKA 1OGWA 4CHKA 4EMOA 2EKEC 2AL6A 2DZIA 1NI2A 4A6KA 2MP2B 4MSQB 1J0GA 2EJ8A 2C7MB 4MELA 3PS6A 2KNBA 1X05A 3U7DA 4MGIE 1KJTA 5C23A 2MBBB 2BKFA 1V5PA 5LXHA 4LDTB 3ZNHB 3UQBA 2OOBB 2LOXA 4WJNA 1L7YA 2DYOA 5AEKB 4NJ6A 2GCLA 3VTUA 3O96A 4IAPA 2N7EA 3PTFC 3QWMA 2EC1A 5KQ4A 1Z2MA 4EZJA 4EEWA 3SYXA 2KJRA 3NOBA 4IW0A 4CHMA 3VH4B 1WZ3A 2CB8A 4DBBA 1I2HA 3FEHA 2AYOB 4A6FB 4I6LB 4FA6A 1UEFA 3DVNU 3SDLC 1EO6A 3PRZA 1DDVA 2DAFA 2L0FA 1MK9B 2WX1A 5IAAC 5LOPB 2M38A 3VIAA 3UINB 1RRBA 2GOWA 1V5OA 1GC7A 2MA9B 3ZNZB 4HAVB 4BKSA 1J8CA
chains in the Genus database with same CATH superfamily
1AN8A 1F52A 4LJPB 3N7CA 2L32A 3RULA 3R8BA 5IN7A 1JDEA 2DZJA 1TTNA 3FILB 3AEAB 5KHQA 3SNHA 2CU1A 2KX0A 3JW0X 3IAS1 2WXQA 2GMIC 2JYEA 3L08A 4P6VF 3TMPB 2DWQA 4WVFB 2K6DB 1RWSA 3ODOA 1E8XA 3RT3B 5JLJB 5DH9B 1SE2A 3KUZA 4RCOA 3SFEB 2HJ8A 1UNRA 1PLSA 3KYDD 4HCPB 4HPLB 4EEWA 2K5PA 3FM8C 2Y5BB 1P5TA 1D5MC 3PLVA 3ETRA 2N0YA 2KQ7A 2RD0A 2Z4DA 1N63A 5HKHA 3WIMA 1GJZA 3VHTC 1NVLA 2KQ4X 1HZ5A 1E5WA 5LG4B 2BF8B 3DHGC 4DK5A 1UELA 5GMVA 2QILA 1WJUA 1G6JA 5AUIA 4OZAA 3A98B 5GOWB 3DPDA 1T0YA 3GS2A 4OVUA 1TS5A 2FE8A 2DHJA 1KLGD 4ZRQA 1FXTB 1YX6B 2KTRA 1W1GA 4HLEA 5KQ1A 1TS3A 1BAKA 1SB3C 1WRDB 2J0JA 2JXTA 2K8EA 2CAYA 5D3DA 4FHJA 4GU2A 5C6RA 2FDQA 1EM7A 2VZKD 4A3OA 1ET9A 4S17A 2BGFA 5D7GA 4IM3A 3PSCA 4BBNC 4NQLB 1UD7A 1V97A 1ACCA 3VTVA 1HE8A 2IYDB 4KIKA 1I42A 2L0TA 1GOZA 3HSAA 2MWNB 3AI5A 1V49A 3AE3B 1TZ1A 2NS5A 3SO6A 4HROA 1OQNA 1U2BA 3U52E 4WJ7A 4JWSC 1EAZA 3ZNGC 3W9CB 1HBKA 4GZUA 2RSGA 3QBVB 3R66C 1EWCA 4LCDE 3L13A 2V4LA 2CHXA 1ACAA 2NPTA 4HJKA 2ZVOA 3JYUA 3MP9A 4QAYA 2KUQA 3V5WA 2AQ3B 1R4NI 4YTNB 4JL9A 4W9HA 1WE6A 1I4RA 3AEFB 2VZKB 4N59A 1ZOYB 1GPXA 5JHGA 1X1FA 1IUEA 2MCNB 1P9DU 4DHJB 3K9PB 2HTME 4AP4C 3D8DA 2UVMA 4A6FA 2R2QA 1NYQA 4C56C 5J2RA 2W2XD 2MBHA 3ZNID 1H4RA 1KC7A 4N9F4 4XYCA 4HB0B 3R7RA 4JKEA 1K52A 2KK8A 2ZNVC 1F1HA 2KQSA 2HD5B 1WYWB 1MAIA 5KHOA 2LUMA 1WGDA 5BMIA 1TBEA 2J42A 3HM6X 3E9SA 2LGDA 1TQZA 3VDZA 2L00B 3T9LA 5HHDG 4HRSA 3QK0A 4B0EA 2Z0EB 3SU8X 1M7RA 3QX1A 3AXCA 3I63C 1MJDA 3A33B 3B9JA 1DGJA 4DDID 2N9XA 1RLFA 1RM6C 5D3VA 3Q8AA 3HVDA 2J52A 3APFA 1LM8B 3SD5A 4L1RA 4W9KA 5JXVA 5HE3A 1HB8A 3TO1A 4Z2MB 1E8ZA 4EJNA 2YSZA 4M8MA 1NDDA 4LLGM 1MHHE 1WR1A 2G4SA 5TR5A 4UDUC 1FNVA 3KZ1A 4B9KA 4FLHA 1PGAA 3MDBC 2WXPA 3IFWB 1XT9B 4JK8A 3P4SB 3A58A 5E6OA 4F7UP 2BW2A 5MPOA 1KBLA 1P3QU 1V5UA 4GIVA 2PE9A 2ZPYA 3W1YA 3KVFB 1I4HA 1V5MA 3RUIB 5C3JB 4NNJB 5DPTA 2IDYA 3VQIA 2JF5A 5C5BB 1VR9A 1AYFA 1X1GA 2E6XA 4FADA 1F2RC 2QDFA 3PVLA 3RI7C 4F7GA 1TJ6A 3O65B 3QIJA 3I9V1 5J3YA 1WXAA 1TS2A 1RYJA 5H8YE 2LRUA 3HUIA 4MDKE 4US9A 3O13A 3G9WA 1BTKA 2KN5A 2DA0A 2K6QA 5FR3A 5DHAB 2RPVA 4RGTA 1R7SA 3A4SC 4ARIA 3Q2AC 3RNEC 1XQQA 1U27A 4PQ0A 3VRBB 4A6QA 2KO3A 2D3CA 4JLCA 3QA8A 5HG2A 2RDHA 2DLWA 3ZIMA 2PEAA 1ZP0B 4DHZB 2QJLA 4N6EB 3ULBA 3PZDA 4L6EA 3A1QB 4WWMA 3Q3MC 2FJLA 2AWTA 1YQBA 4TKNA 2DN6A 2G4DB 3APDA 5E6NA 2CHZA 1TT5B 2IGDA 2QKMA 2IGGA 1RRPB 2J53A 3N1ZC 4ZRIA 2KDFB 2MJ3A 2JXXA 4QXAB 3MC9A 3PT2B 2MRPA 2NTTA 1NENB 1ZVRA 3Q8FA 2WXFA 3T8MA 3GOEA 4NJCA 2HDEA 4OVZA 2VSZA 4IOIE 4WWOA 3TVVA 1EUVB 2D2QA 3A9KB 4DX90 2X8XX 4QJ4B 2LHEA 5BYSA 4HKQA 5EE9A 1XO3A 4ASWC 3VUYA 2DLBA 2OJWA 2Z14A 1ESFA 2NBUA 3ZW3A 2EMTA 1WMHA 2WXJA 3SUZA 3A9JA 5IJMA 2IFSA 3BIID 4KDLB 3FC4A 3E9PA 3DBSA 5EE3A 2MX2A 3EFUA 2DKPA 3Q69A 4EZLA 5E6JA 2GUMA 3ZQ4A 1E9MA 1L4ZB 4ICUA 3VTWA 4BBKA 1P7FA 2Z0PA 4M02A 3X0WA 4DXAB 4ZYNA 2Y8GA 1P98A 1PFDA 4BKTA 2K2UA 5D3YA 3RNAC 2QIEB 1PQSA 4F1SA 2P8VA 3AE1B 3DBRB 3U7ZA 4N58A 2DX5A 1V89A 2CRFA 3EECA 3H7PA 4LTUA 3IAM1 2RLOA 2NBVA 1FPYA 2JQRB 2KAJA 2RNRB 2MQJA 3DBRI 4MM3A 4B95A 2ZZPB 2DNFA 3AH7A 4XWXA 2BYEA 4W9LA 2ZW1A 3FP5A 4PS3A 1L2NA 2DHKA 2IGHA 4KKIA 5D94A 5JHAA 1PMSA 3BVZA 1JWAD 4FXCA 3VR9B 2GBNA 2FCSA 2LVPA 1JRPA 3KW5B 1FGYA 1FRDA 3QARA 2LGIA 1Y5OA 4LDTD 2KMAA 1WX8A 3S2AA 4CHKA 3AN1A 4MSQB 4A6KA 2MP2B 4MELA 3PS6A 1D4BA 2MBBB 2BKFA 3ZNHB 1HQRD 2RMMA 3UQBA 1KF6B 1L7YA 2DYOA 2X38A 2PIAA 3N20C 1JWMD 1ROEA 1QOFA 4IAPA 2N7EA 4MT5A 1Z2MA 1SJHD 3FEHA 1MFWA 1JWUD 1N62A 2AYOB 2D5GA 1UEFA 3DVNU 4I6LB 4YSYB 3L4PA 1XLPA 3EGRA 1DDVA 2DAFA 1SE3A 5IAAC 3UINB 2MA9B 2JWZA 2W54A 2XNAC 3M3JA 5KCVA 1F0ZA 3DXEA 2MJEA 1MIZB 1XKEA 2COCA 2D3BA 2WXLA 1P3RA 2NPTB 3ZXVA 2N7DA 1NU2A 4ZDVA 4XGAB 2XN9C 4YTPB 1PFJA 4GN1A 1QC6A 2BCJA 3HK0A 1ZE3D 3J9CA 5IKCM 4Z2NA 2K25A 2KTFA 1LW3A 2GRIA 1NBFC 3MPXA 2A4ZA 4BZAA 3B0AA 2ZJDA 1Z87A 3KQ4A 4MK0A 4JIOU 1LQBA 3U2SC 1UGMA 2KXJA 2KLGA 2J4XA 2PTLA 2JY6A 1WXMA 4NPNA 1CJEA 4TV3A 2V76A 4FBJB 4LNKA 4JKHA 1IBXB 2DIKA 4ITKA 3IT4B 4IWQA 4P16A 2BYFA 2RPQA 2R61A 3NS8A 1WGQA 2BB6A 1VRAB 2V3NA 3X23A 3L54A 1QLBB 2O2VB 4HWIB 1PDXA 5DPWA 1TY2A 4K3CA 2CY5A 3AU5A 1KM7A 2D10A 1ZYIA 5IO9A 4C4VA 4GDLA 2G1EA 1HB6A 4K2PA 3D8EA 1CK1A 3Q14C 1T0SC 2DZMA 2LULA 1WGHA 2KIEA 2IO0B 2KX3A 2LJIA 3M1IB 3C19A 2WXKA 2WNMA 3RZFA 4L2YA 2FBWB 3UZTA 1WR6E 1Z5SB 2MEKA 1YNTE 3NOBA 1B55A 3ZJUA 2L76A 4WJPA 2N9EB 3IXSA 1WY8A 2INNE 2BS3B 2TSSA 1QOBA 4A20A 2MSED 4K17A 5D27A 1UNQA 2CQUA 3V05A 4C0AA 3SFDB 4ILHA 1UWXA 4F7ZA 1X11A 1LXDA 1ZKHA 4RH6A 2A5UA 3KRWA 1ZC3B 2LXAA 3WALA 2WQYB 4L23A 3D32A 1VBHA 2WU2B 1PYWD 4MJSB 2KTRB 4ZYSA 4D0NB 1FFUA 3A9JB 1WMHB 4RM8A 4IOYX 1IP9A 1FCCC 3UI3A 4TQ1A 1XX0A 3TEZA 2LBBA 2V0GA 2DBYA 4KZ0A 3OJ3A 5AUKA 2PJHA 1N3HA 3H1UA 1L5PA 4Y94A 4ZOHC 2VRWB 3AV8A 2YF0A 4JWUC 3CSFA 3H6NA 2D11A 4F7HA 3CMMB 2IPKD 3H8HA 4PYZA 1TYGB 1GG3A 2GB1A 3MJ5A 1JQ4A 1V88A 2COAA 4GB9A 1BUIC 1WGKA 1TKYA 2V3PA 1I4PA 2M4NA 3Q3OC 4XC2A 3N3KB 4G0NB 1V6EA 4URKA 4AJYB 4GNKB 4S0RA 3BK1A 5DIFB 1OQRA 2JZPA 2LUEA 4A9AA 1PGXA 2Q13A 4QJ3B 4M01A 2EELA 3M62B 1UPQA 1T77A 2N9KA 4WWPA 3TEWA 1YMHE 1JRUA 1YQ3B 3LB8C 1SBBB 3ZTCA 1EU4A 4MT7A 1XF5L 2GLSA 2K8CA 3HW2B 3BWUD 2ZNVB 1J7BA 2KYWA 5DHFB 4TSSA 3GE8C 1TZOA 4ANXA 5L83A 1XR0B 4HAWB 4KV2A 2MBOA 3NVYA 3ZDTA 4TQ0A 4WSFA 4CSQA 2M0XA 4IC7B 4DDGD 1X1MA 5EDSA 2HRJA 2O2VA 1K53A 1YOVB 4RGNA 3N1YC 3ULCA 1V86A 2MFQA 3HRDD 2JUOA 1L0VB 3I5JC 1WH3A 1ST7A 3VUXA 4W9JA 4HKZE 3BJIA 4XE0A 3PZ7A 2WWZA 2FNJB 2FCNA 3DBHI 4RM9A 2ICIA 1WJNA 3DXDA 2Y5PA 1XLOA 2GBKA 1CQVA 1E7VA 1XCQL 1L4DB 3TL5A 2W2XC 1BMLC 1T3QA 4E3CA 2UWQA 1UBQA 1VZ7A 4JKGA 2GBRA 2YS3A 2DX1A 3AECB 2PE6B 5DPSA 3NJTA 4IKGA 2PLPA 4GXBA 2FIDA 2DYBA 3RYTA 3QWZB 2BKRB 1EWYC 2KMCA 1C77A 4KHBB 3DVGX 2JYTA 1T6BX 4WH4A 1NTIA 1UNPA 3AEEB 2NZ8B 2L05A 3CWIA 4II3B 3SR6A 1I4XA 4RFBA 1EF5A 2KWVB 3NVWA 4NJ7A 2J0KA 4PNKA 3D8FA 2P0DA 1B1ZA 2DTCA 4YTMB 3Q3FA 3NW8A 2WS3B 2YLMA 2FJ9A 3V62A 4W9EA 1SIJA 1WJMA 2PVOD 4YONA 1WGGA 2FUG1 1RFKA 2LASA 3RNFC 2M17A 3P42A 2KANA 4IUMB 2FJUB 1GNUA 4BVUC 5CLQB 1WM3A 4K81A 2WYQA 1YD8U 1ZDVA 1EVHA 4MEMA 2DENB 5FR6A 2INCC 3TIXA 3T06A 1P1AA 3R2IA 4KVGB 1XCGA 4AWJA 1U5FA 1XEEA 2D3GA 4JGHB 4MSMB 2WH5A 4A8XC 5H92C 5LNK1 4GDKB 2AL3A 1EU3A 1NVID 1K5GB 1W1DA 2VH1A 3TFMA 5LLIA 1DOXA 1DOIA 1E8WA 3PRMB 4YL8A 5L95C 4A55A 2UYZB 1Q10A 3WA0A 5J3TA 3QC8B 2J7QB 1ZXIA 3BINA 2HTHA 5CHWA 1WRIA 4A5KA 1CMXB 2I5FA 5I2MA 4IM0A 2XBBC 2LGYA 2O6VB 1LGRA 3AE6B 2DYQA 2KCJA 2ASQA 2G3QB 1FO4A 2IO3B 3FSSA 1Y19B 4KSLC 4GMXB 3TBLD 5C5BA 2WXGA 5IRSA 1MPHA 3U8ZA 2M1MA 3OAWA 2MWSB 2CY4A 1MHXA 5C16A 2DHZA 1KTKA 4HB2B 2ABDA 4C4VB 3Q6BA 4E71A 5C1ZA 2PMVA 1S1QB 1E7UA 3IHPC 3QQ8B 2D9XA 2WXRA 1B9RA 1I4QA 2COPA 5CTRC 5HFYA 4WWNA 2WDVB 1DDMA 4HHVA 1XODA 3NG0A 3PGEA 1BXTA 3FILA 2MH7A 1DIKA 4BKSD 4W9GA 1SSNA 2ROZB 1N5XA 3AE2B 3E66A 2DYMA 4A3PA 2IJ0A 3GZNI 2KFKB 2WXMA 1WVHA 2O6VD 5DPRA 2B3AA 4TYZA 1U4AA 1STEA 2DZIA 3KLSX 1NI2A 2C7MB 2KNBA 3GP7A 1KJTA 1V5PA 4LDTB 3AEBB 2PKOA 4NJ6A 3VTUA 3PTFC 3QWMA 2KJRA 4IW0A 1WZ3A 2CB8A 4FA6A 4A6FB 1GB1A 3SDLC 1EO6A 3PRZA 3BK2A 2M38A 1V5OA 1GC7A 3ZNZB 2AQ2B 2YS5A 3SV1A 3ZTDA 4LNIA 2W3RA 4JKAA 2DHIA 2J59M 4KHOA 3NWFA 2COFA 3ZVVA 4MJSA 2INPE 3DWGC 5CHVC 3FVCA 2L8JA 2UZSA 3KY9A 3NZ3A 3TCAA 2KUPA 5DI9B 3EFCA 1L0YB 4NAWB 2BS2B 1SXTA 1LB1A 1MKEA 5D3IB 4ACFA 3VUWA 4DX8A 2ELAA 4MM3B 5JZEB 1KRHA 2NBVB 1ZSQA 2WX0A 4YSXB 3PG7A 5G5HA 3PV1A 1QOAA 2HJ1A 2G45B 1QQRA 1WXVA 5EFXA 1ZGUB 3AE4B 1FHWA 3MTNB 4MGZE 2ON8A 3LDZE 4EE2A 3I3TB 3CF6E 2KVRA 4MACA 2LVQA 4FHKA 4KSKC 1FCLA 2K49A 2LYDA 2IY0B 1GC6A 3E56A 4RNAA 5HE0A 1WI0A 4BAXA 3E9LA 1QQGA 3HHMA 1ZXHA 3ZJTA 2CKHB 1KFYB 4JK9A 3FAHA 2N9LA 3WAPA 1FM0D 2W2WA 4TMAB 1WJ1A 4LNNA 3AE9B 2N7JA 3PHWB 2V3SA 1N60A 3TSSA 4WJQA 1R4MI 2WGSA 3HQCA 4RF0A 1C3TA 3ML4A 2JRHA 3GZNB 4K7WA 5BMGA 3NHEB 5CLLB 3NRZA 1GUAB 4IM2A 1UF0A 2PPHA 1V61A 4DQOC 3ZUNA 2LVOA 4MGKE 4ANUA 5G2NA 3TJPA 1FAOA 4JKCA 2I38A 2KWDA 3LJUX 5JP4A 1KH0A 3C0RB 2SAKA 2L83A 1A70A 2UZRA 3PP2A 3ZYYX 1VBGA 2KR0A 2KDMA 4HB4B 1C4CA 3KSYA 1VZ6A 2NBWB 2ZCBA 1QKZA 1E7PB 1SHCA 3DVNV 3APCA 2BTEA 2HTHB 3EC8A 2IO2B 2BT6A 5GXGB 3NVZA 1BTNA 4B6HA 2GJYA 2CHWA 4HXDA 5G5GA 1V80A 4BOSC 3P6AA 4EOYA 3ZLZA 1WJ6A 1JALA 4MGYE 4PK1A 4BBNF 2Z59B 2XK5B 4K7SA 1TIFA 2R0DA 3U30A 2D9YA 2N1VA 5CX3A 1DROA 1NTVA 3ENEA 2O6VA 3UF8A 2LD9A 5BYQA 2N9PC 1F9JA 4LNFA 5C79A 1HXYD 1DBHA 2IZVB 1NTYA 5FK9C 4M00A 1IGCA 2MBEA 2Z0OA 2BPSA 2DX5B 2JZZA 5CHFA 3A8QA 3NSUA 1NI3A 2LKOA 5J3QA 3NY5A 3ML8A 3N32A 2KVZA 4DBGA 3V60A 2BYVE 4C80A 2LJ5A 2KFKA 5J17A 3U4EG 4ICVA 4B6WA 4JKFA 1OFFA 1J7CA 1V1PA 3UQAA 2AQ1B 2Z0DB 2RSUA 3R3MA 3AULA 4CHJA 1SF0A 3PREA 2LHDA 4HB3B 1WJ4A 5AZFA 1WF9A 1K8RB 4HJGE 4REZA 2ZEQA 2REXA 2GS0A 2RDGA 3RPFC 1AARA 2L7RA 1ZM0A 2OQBA 2MKRA 4RMAA 2ELBA 3P4QB 1AQCA 1K5DB 4K2OA 2I1JA 3IT6B 2PVGC 2FUHB 3VOQA 3WAMA 4AUQC 3ECIA 2LOZA 5IP4D 2RUKB 4OZCA 3V3XA 4MY6A 3ABVB 4DWFA 3VRAB 4G3XB 4GSWA 4AQ7A 2DKQA 1KLVA 2D9ZA 2YS1A 1MI0A 3V6EB 3MFGA 4OHJA 3AB5A 2G35A 3ZJVA 3DVGY 4WQMA 4GOCA 3TUOA 4MH8A 2QHOA 2LRWA 3LXFA 1RFAA 2L52A 2GCJA 3DWMA 3VXWA 2KC1A 1U5EA 1L0XB 1U29A 2K00A 2XEWA 2Q5WD 4EFOA 3MC8A 5I4DA 1Q1OA 2KMMA 4HSIA 5EE1A 4GDKA 2KN4A 1MI1A 2JT4B 3AU4A 2RGNB 3URYA 3DBHB 2LI5A 3GYOA 1YX5B 3W2DA 1ZC4B 1TJEA 2RR9A 3N1XC 3UGBB 3M95A 4XWWA 3RD2A 3WAOA 2KLCA 1D6EC 4BKGA 1WIAA 3RMKC 2DAJA 1PUTA 2W55A 1IGDA 3AEDB 3DBLB 1HA5A 4FJYA 4HK2A 2K8BA 2D9VA 2JZ3B 2OHFA 1UWMA 2MBQA 2JRIB 2BYTA 3BY4B 5FKAC 3ONSA 2KD0A 3ZO5B 4WURA 3JSVA 4ARCA 4Q2JA 1W1HA 1C1YB 3VVWB 4ZRJA 4KKJA 2BQQA 1C79A 2RRFA 2K0PA 2Z13A 5LXIB 1WGYA 2M56B 4RGOS 2M19A 1YQ4B 5TSSA 2IYBA 3AE5B 3MHZA 2QMTA 2L2IA 1SE9A 2R2YA 2JVCA 3RCZA 4HAYB 2LFIA 3WANA 5E6PA 1LFDA 2LWPA 4C00A 1ZDXA 2KJ6A 5HE1A 2C5LC 2E2XA 3R2TA 3R7QA 2DYNA 2WDTB 3JSVB 1OEYA 3KUCB 4WQOB 2FCMA 1UUPA 4EZKA 4H8SA 3WCQA 1OQYA 3BVMA 1MPEA 2WDRB 1XXGA 3DBLI 4PS8A 1I7AA 2GBMA 2KKCA 3GYPA 2D3AA 3Q8BA 2KWCA 4KGSA 1FHXA 1MK7B 2H7DA 1V1OA 1VLBA 1OQQA 3NWAA 1V81A 1YN5A 2WDQB 3B08A 1XD4A 1UBIA 1C78A 1P7EA 3UIPB 1E6EB 2GBJA 4JKDA 2Y8FA 4FN2A 4P1BC 1ENFA 4ZHOA 4USAA 1ZUD2 5D3WA 4C7ZA 4FULA 1P6SA 4KZCA 4WAAA 1WM2A 1YJIA 4FJVB 4KX6B 1T0QC 2OTXA 2FAZA 4EUTA 1BWNA 4O1NA 3ML9A 3QCAA 4JQWC 1UZXB 2CJOA 5AZGA 1N6ZA 5M4YB 4JK7A 3BVGA 3DHHC 3JVZX 2W9NA 1QOGA 1DOYA 1DYNA 4I6NB 1D5XC 3SBGA 1JW9D 4K1RB 1Q0WB 1YJ1A 1ET6A 3DHIC 2J0MA 2BWES 3EA6A 1R4MB 2QCZA 4D2KA 2KWUB 3PO0A 4GOUA 2EJ8A 1X05A 3U7DA 4MGIE 2NTSA 5C23A 1JMLA 4JPSA 2OOBB 4WJNA 5AEKB 3RNBC 1VZ8A 2EC1A 5KQ4A 2WU5B 3SYXA 3NS1A 3VH4B 1QILA 4YXDB 2L0FA 1MG4A 2WX1A 1MK9B 5LOPB 1CZPA 1RRBA 2K9XA 4BKSA 4HAVB 2KDEB 2NVUI 3VH3B 3B2FA 2ZKMX 2W3SA 2K39A 1FOEA 1FIQA 2C60A 4II2B 2JX5A 1VCBA 3I57A 1HTQA 3SHQA 2GI9A 3ZDMC 3NZUA 3V61A 3BYYB 4BOZB 2ADZA 3H9DA 2BS4B 3W5VB 4US8A 3AE8B 2BVCA 4QJ5B 1HZ6A 2H7EA 2V4IB 2CR5A 2X0SA 4P1CC 1FB8A 1GAQB 1C9FA 1H10A 1N61A 1D5ZC 1TGZB 2INDC 3A4RA 1XLQA 3F0WA 2CU3A 1UGJA 4C7YA 3P63A 3PZ8A 1TS4A 4YWGG 5HE2A 1IYFA 1UH6A 4HCNB 3HVZA 4PT5A 3AJ4A 4OSNA 2JP2A 1WX9A 4KAXB 4DIXA 2YT0A 4E74A 1OY2A 3NUHB 1S3SG 1FRRA 2N1WA 1C4AA 1GB4A 3N30A 3T3OA 2LXCA 3Q3NC 2Z59A 5L81A 3CSTA 4ZHPA 4ILJA 4W9CA 1FMAD 3Q3JA 2MLBA 2VKIA 3PEGA 2CODA 2KDBA 4HPMB 2QSDA 2Z0QA 2QKLA 3UIOB 2WXHA 3QAQA 3CXBB 1JCKB 3A1QA 3RNCC 4KHBA 2NMBA 1OMWA 1GGOA 4AJWA 3ZGZA 3TW1A 2YT1A 2ZCCA 3PVWA 1NYRA 1I7HA 2EMSA 2MP2A 4KDIC 4DXGA 1EGXA 1Y8RC 2C7NB 2VH2A 1XD3B 1WYGA 2YRYA 4HAUB 3ZVRA 4LJOB 2AEHA 5C2TB 3OWEB 2L1CA 1Q67A 3SEBA 3AE7B 1JROA 4RGMA 4EKUA 4JE3B 1U5DA 2LEKA 5IOIA 1VJKA 4FJZA 4W9DA 2X18A 2WP9B 1OEYJ 1V8CA 1SIFA 2NMQA 2K1FA 3C8YA 1WXQA 3PHXB 1WX7A 5JHBA 2JWUA 3H7PB 4PYUA 3MHSD 1WGUA 2YT2A 4JKBA 4HAZB 3P4RB 2K2JA 4P7IA 3K9OB 2K8HA 4DHJD 2ROVA 4NSWA 4HDOA 5T8IA 2MW5A 3RCPA 3ZXRA 1FNWA 4LK0M 3RZWC 5D6JB 4NY0A 5AZHA 3FLVA 1TKEA 3VFKA 4OW0A 3GE3C 3L10B 4HATB 3ZKJC 2WLBA 1KI1B 1K51A 1WXSA 1M7EA 2JPHA 3A9KA 2I2YA 2NR2A 4GMVA 2RDBC 1U5GA 3QHTA 2KIGA 4GGQA 5BO4B 2E3TA 3IVFA 3P7ZA 1RJ2A 1DYQA 2KDIA 1P0RA 2ZW0A 2KOXA 1WSPA 3MC0B 4J3OD 4RF1A 3B2GA 3OLMD 1C76A 1FHOA 2OJRA 1AWDA 4B0MA 4D6WA 4KHAA 3A8PA 1L6UA 2WHIA 3N9YC 5D2MB 4WAFA 2QEJC 3ALBA 4NQKE 4TUUA 3AM9A 4DXFA 4ZRKA 1C4PA 1F2RI 3OJ4B 2H89B 4KGRA 4K7UA 1T5XD 1D3ZA 1HEZE 4X57B 3ZRCA 5D3XA 3V6CB 1VD2A 1E90A 4BFRA 1UNSA 3EUB2 3DCXA 4JX1C 4M0WB 3B77A 2KJHB 3KUDB 3QJZA 3NVVA 4F8CB 2QC8A 1JWBD 1PGBA 1XLNA 2ZVNA 4OVVA 4HPPA 3KWLA 1V1PB 2RGFA 3IG3A 2C9WB 4G50A 3PSEB 3H7SA 2PW9A 4J6IA 1TXDA 1SJED 2D4QA 1WGRA 4IWOA 2MHJA 1BT0A 3F5RA 3VR8B 1E0ZA 3PPAA 1T0RC 1JWSD 2XK5A 4XDDA 1E8YA 3VAWA 4CO7A 1IRSA 4DHZE 3U12A 1X86A 4IG7B 1E10A 3DDCB 2VRRB 5JH5C 1WWTA 1F77A 1XCTL 4H2AA 1MIXA 1TKGA 4AS1A 4HAXB 1QF6A 2IY1B 1V2YA 2H88B 2WXNA 1ZW7A 3Q8EA 3EPYA 2P0HA 4NAMA 3CIRB 2KT7A 4XDCA 3P4PB 2Y7BA 4LNOA 1I4GA 4GDLB 1NEKB 2M14A 2Y3AA 2N23A 2YEPF 1WE7A 3PVUA 4WJOA 1WFYA 1I35A 5LONB 1UPRA 4A90A 3LJ3A 3PRPB 1WI1A 1H8CA 3L17A 4ILGB 4WIPA 1DDWA 3TEXA 4KIKB 3T3NA 2LMCA 5BMHA 3TEYA 3OG5A 3EHVA 5I2SA 1R4NB 3ENBA 5IA7A 2I1KA 2R09A 2EKIA 3ODXA 1TY0A 2KZRA 1LO5D 3AMZA 3DOWA 4I6PA 4AOFA 5G55A 3L0WB 2V1YA 4PS7A 1YIWA 1MVKA 2PZ1A 4ZRPA 4G11A 2LZ6A 4GLSC 1FXIA 1N5WA 1VDVA 3NZSA 2C7HA 2KHWB 1AWEA 1EF1A 2UU7A 3SBTA 1J0WA 2CJNA 1HTOA 3KH0A 3OANA 1YJJA 2ZPNA 2N0SB 2FCQA 3NWDA 1FGZA 3WYFB 1K50A 3HIZA 3GB1A 1M94A 1FFVA 1SEBD 1FD6A 4HVBA 4MH0E 2M0AA 4CQNA 1SGHA 2BWFA 2CS4A 4W9FA 3DXCA 3W1SA 2BB5A 1KLUD 3HM3A 2P0FA 1QZEA 4L1BA 2G9HD 4HEA1 2FIFA 4OZBA 4M8NA 2HE7A 2LGXA 2RVBB 3L16A 2K3UA 2JSVX 1WZ0A 4XZ4A 2IBIB 4YSZB 4ANVA 2L3ZA 3CIKA 3B1LX 1FXAA 5J18A 2W82A 3HIEA 1IPGA 4KGTA 2B76B 3P1MA 2NCNA 3DCGA 1M4VA 3BYTB 1ISNA 2KFJA 3RN9C 2I5CA 1FNUA 3IBEA 2K22A 2MJDA 2OEDA 1QT9A 3AEGB 3BZDB 5JHHA 2YVCA 2D9WA 1YN3A 2WXOA 3P2BA 2ONQA 1J19A 1KZGA 2LG1A 1OTRB 2Z8LA 4IDIA 2LGSA 1L6VA 3KWVA 5JVLA 2XQNM 2SEBD 4HDQA 3KRXA 4GPTB 2WXIA 1A5RA 3FKYA 1KOTA 4NAWA 5FI1A 5DCNA 2YEPB 4IWPA 3RFZB 3DQVA 3W1SC 2L1AA 4CYEA 1KZ7A 1RAXA 3KYCD 2R2OA 1WG7A 4OT1A 3ODWA 3LYYA 3PLUA 4W9IA 1MG8A 2DZKA 4XX5A 2N4FA 3ZRFA 1Q5WB 4ANWA 2MDXA 2KGXB 2M8SA 2D07B 4R3DA 2JU6X 4IFSA 1IBXA 2KC2A 5BYRA 2KACA 3M63B 4K3BA 1Y56A 4XWTA 4A6HA 1J7AA 1V9JA 1V5TA 2RQ1A 3RNGC 3MJWA 2IO1B 5FI0A 2DFKA 1OGWA 2V9HA 4EMOA 2EKEC 2AL6A 1AW7A 2AX5A 1J0GA 1YN4A 2ACZB 2BBCA 3OHMB 1SE4A 5LXHA 4JKGB 2R82A 3Q8CA 2LOXA 4NZLB 2GCLA 2Y5CA 4M0WA 3O96A 1FEHA 4EZJA 5HI1A 4CHMA 4DBBA 1I2HA 1ZPSA 5EE0A 3VIAA 4YT0B 3W5UB 2GOWA 3E9OA 1J8CA
chains in the Genus database with same CATH topology
4LJPB 3N7CA 3RULA 1JDEA 2DZJA 1TTNA 5KHQA 3SNHA 2CU1A 2KX0A 3JW0X 2GMIC 3L08A 3TMPB 4WVFB 2K6DB 3ODOA 1E8XA 3RT3B 5JLJB 5DH9B 3KUZA 2HJ8A 1UNRA 1PLSA 3KYDD 4HCPB 4HPLB 4EEWA 3FM8C 2Y5BB 1P5TA 3PLVA 2N0YA 2KQ7A 2RD0A 5HKHA 3WIMA 1GJZA 3VHTC 1NVLA 1E5WA 2BF8B 4DK5A 1UELA 5GMVA 1WJUA 1G6JA 3A98B 5GOWB 3DPDA 1T0YA 4OVUA 2DHJA 1FXTB 1YX6B 2KTRA 1W1GA 4HLEA 5KQ1A 1BAKA 1WRDB 2J0JA 2CAYA 4FHJA 4GU2A 5C6RA 2FDQA 4A3OA 2BGFA 5D7GA 4IM3A 3PSCA 4BBNC 3VTVA 1UD7A 4NQLB 1HE8A 2IYDB 4KIKA 1I42A 2L0TA 2MWNB 3AI5A 1V49A 1TZ1A 2NS5A 3SO6A 1OQNA 1U2BA 4WJ7A 1EAZA 3ZNGC 1HBKA 4GZUA 2RSGA 3QBVB 3R66C 4LCDE 3L13A 2V4LA 2CHXA 1ACAA 2NPTA 4HJKA 2ZVOA 3JYUA 3V5WA 1R4NI 4JL9A 4W9HA 1WE6A 5JHGA 1X1FA 2MCNB 1P9DU 4DHJB 3K9PB 4AP4C 3D8DA 2UVMA 4A6FA 2R2QA 5J2RA 2W2XD 2MBHA 3ZNID 1H4RA 1KC7A 4N9F4 4HB0B 3R7RA 4JKEA 2ZNVC 2KK8A 2KQSA 2HD5B 1WYWB 1MAIA 5KHOA 1WGDA 1TBEA 3HM6X 2LGDA 1TQZA 3VDZA 2L00B 3T9LA 3QK0A 2Z0EB 3SU8X 1M7RA 3QX1A 3AXCA 3A33B 4DDID 2N9XA 1RLFA 5D3VA 3APFA 1LM8B 3SD5A 4W9KA 5HE3A 1HB8A 3TO1A 4Z2MB 1E8ZA 4EJNA 2YSZA 4M8MA 1NDDA 1WR1A 2G4SA 5TR5A 3KZ1A 4B9KA 4FLHA 3MDBC 3IFWB 1XT9B 4JK8A 5E6OA 4F7UP 1KBLA 1P3QU 1V5UA 4GIVA 2PE9A 2ZPYA 3W1YA 3KVFB 1V5MA 3RUIB 4NNJB 5DPTA 3VQIA 2JF5A 5C5BB 1X1GA 4FADA 3PVLA 4F7GA 1TJ6A 3O65B 3QIJA 5J3YA 1WXAA 4MDKE 2LRUA 3G9WA 1BTKA 2KN5A 2DA0A 2K6QA 5DHAB 3A4SC 1XQQA 1U27A 4PQ0A 2KO3A 4JLCA 3QA8A 2DLWA 3ZIMA 2PEAA 4DHZB 3ULBA 3PZDA 4L6EA 3A1QB 2FJLA 2AWTA 1YQBA 4TKNA 2DN6A 2G4DB 3APDA 5E6NA 2CHZA 2QKMA 1RRPB 4ZRIA 2KDFB 2JXXA 3PT2B 2MRPA 1ZVRA 3T8MA 3GOEA 2VSZA 4WWOA 3TVVA 1EUVB 2D2QA 3A9KB 4DX90 4ASWC 3VUYA 2NBUA 3ZW3A 2EMTA 1WMHA 3SUZA 3A9JA 5IJMA 2IFSA 4KDLB 3E9PA 3DBSA 2MX2A 3EFUA 2DKPA 4EZLA 4ICUA 3VTWA 4BBKA 2Z0PA 3X0WA 4DXAB 4ZYNA 2Y8GA 1P98A 4BKTA 2K2UA 5D3YA 1PQSA 4F1SA 2P8VA 2DX5A 1V89A 2CRFA 3EECA 3H7PA 2RLOA 2RNRB 2MQJA 3DBRI 4MM3A 4B95A 2ZZPB 4XWXA 2BYEA 4W9LA 3FP5A 4PS3A 1L2NA 2DHKA 5D94A 5JHAA 1PMSA 2GBNA 2FCSA 2LVPA 3QARA 3KW5B 1FGYA 1Y5OA 4LDTD 2KMAA 1WX8A 3S2AA 4CHKA 4MSQB 4A6KA 2MP2B 4MELA 3PS6A 2MBBB 2BKFA 3ZNHB 3UQBA 1L7YA 2DYOA 4IAPA 2N7EA 1Z2MA 3FEHA 2AYOB 4I6LB 1UEFA 3DVNU 1DDVA 2DAFA 5IAAC 3UINB 2MA9B 2JWZA 3M3JA 5KCVA 3DXEA 1MIZB 1XKEA 2COCA 1P3RA 2NPTB 2N7DA 1NU2A 4ZDVA 1PFJA 4GN1A 1QC6A 2BCJA 3HK0A 4Z2NA 2K25A 2KTFA 1LW3A 1NBFC 3MPXA 2A4ZA 3B0AA 2ZJDA 1Z87A 4MK0A 4JIOU 1LQBA 1UGMA 2KXJA 2KLGA 2JY6A 1WXMA 4NPNA 4TV3A 2V76A 4FBJB 4JKHA 2DIKA 4IWQA 2BYFA 2RPQA 3NS8A 1WGQA 3L54A 3X23A 2O2VB 4HWIB 5DPWA 2CY5A 3AU5A 1KM7A 2D10A 4GDLA 1HB6A 4K2PA 3D8EA 2DZMA 2LULA 1WGHA 2IO0B 2KX3A 3M1IB 3RZFA 3UZTA 1WR6E 1Z5SB 3NOBA 1B55A 2L76A 4WJPA 2N9EB 1WY8A 4A20A 2MSED 4K17A 5D27A 1UNQA 2CQUA 4C0AA 4ILHA 4F7ZA 1X11A 1LXDA 1ZKHA 2A5UA 3KRWA 1ZC3B 2LXAA 3WALA 3D32A 1VBHA 4MJSB 2KTRB 4D0NB 3A9JB 4RM8A 1WMHB 4IOYX 1IP9A 4TQ1A 1XX0A 2LBBA 4KZ0A 3OJ3A 2PJHA 1N3HA 3H1UA 4Y94A 2VRWB 2YF0A 3CSFA 3H6NA 2D11A 4F7HA 3CMMB 4PYZA 1GG3A 1V88A 2COAA 4GB9A 2M4NA 4XC2A 3N3KB 4G0NB 1V6EA 4URKA 4AJYB 5DIFB 2LUEA 2Q13A 3M62B 1UPQA 4WWPA 1JRUA 3ZTCA 4MT7A 2K8CA 3HW2B 2ZNVB 5DHFB 4ANXA 5L83A 1XR0B 4HAWB 4KV2A 2MBOA 3ZDTA 4TQ0A 4WSFA 4IC7B 2M0XA 4DDGD 5EDSA 1X1MA 2HRJA 2O2VA 3ULCA 1V86A 2MFQA 2JUOA 1WH3A 1ST7A 3VUXA 4W9JA 3BJIA 2FNJB 2WWZA 2FCNA 3DBHI 4RM9A 1WJNA 3DXDA 2GBKA 1E7VA 3TL5A 2W2XC 4E3CA 2UWQA 1UBQA 4JKGA 2GBRA 2YS3A 2DX1A 2PE6B 5DPSA 4GXBA 2FIDA 2DYBA 3RYTA 3QWZB 2BKRB 2KMCA 4KHBB 3DVGX 1NTIA 1UNPA 4II3B 2NZ8B 2L05A 1EF5A 2KWVB 4NJ7A 2J0KA 4PNKA 3D8FA 2P0DA 2DTCA 3Q3FA 2YLMA 2FJ9A 3V62A 4W9EA 1WJMA 4YONA 1WGGA 2LASA 2M17A 2KANA 4IUMB 1GNUA 4BVUC 5CLQB 1WM3A 4K81A 2WYQA 1YD8U 1EVHA 4MEMA 2DENB 5FR6A 3TIXA 3T06A 1P1AA 4KVGB 1XCGA 4AWJA 1U5FA 2D3GA 4JGHB 4MSMB 2WH5A 4GDKB 2AL3A 1K5GB 1W1DA 5LLIA 3TFMA 1E8WA 3PRMB 4YL8A 5L95C 2UYZB 3WA0A 5J3TA 3QC8B 2J7QB 3BINA 2HTHA 5CHWA 4A5KA 1CMXB 2I5FA 4IM0A 2XBBC 2LGYA 2O6VB 2DYQA 2KCJA 2ASQA 2G3QB 2IO3B 3FSSA 1Y19B 4KSLC 4GMXB 3TBLD 5C5BA 1MPHA 3U8ZA 2M1MA 3OAWA 2MWSB 2CY4A 5C16A 2DHZA 4HB2B 2ABDA 4E71A 5C1ZA 1S1QB 1E7UA 3IHPC 3QQ8B 2D9XA 5CTRC 2COPA 4WWNA 1DDMA 4HHVA 1XODA 3PGEA 1DIKA 4BKSD 4W9GA 2ROZB 3E66A 2DYMA 4A3PA 3GZNI 2KFKB 1WVHA 2O6VD 5DPRA 2B3AA 4TYZA 1U4AA 2DZIA 1NI2A 2C7MB 2KNBA 1KJTA 1V5PA 4LDTB 4NJ6A 3VTUA 3PTFC 3QWMA 2KJRA 4IW0A 1WZ3A 2CB8A 4FA6A 4A6FB 3SDLC 1EO6A 3PRZA 2M38A 1V5OA 1GC7A 3ZNZB 2YS5A 3SV1A 3ZTDA 4JKAA 2DHIA 2J59M 4KHOA 2COFA 3ZVVA 4MJSA 5CHVC 2L8JA 2UZSA 3KY9A 3TCAA 2KUPA 5DI9B 4NAWB 1LB1A 1MKEA 3VUWA 4DX8A 2ELAA 5JZEB 2NBVB 1ZSQA 2WX0A 3PG7A 3PV1A 2G45B 1WXVA 5EFXA 1ZGUB 1FHWA 3MTNB 4MGZE 3LDZE 3I3TB 3CF6E 2KVRA 2LVQA 4FHKA 4KSKC 2LYDA 2IY0B 1GC6A 5HE0A 1WI0A 3E9LA 1QQGA 3HHMA 2CKHB 4JK9A 3WAPA 2W2WA 1WJ1A 3PHWB 2V3SA 4WJQA 1R4MI 3HQCA 1C3TA 3ML4A 2JRHA 4K7WA 3NHEB 5CLLB 1GUAB 4IM2A 2PPHA 1V61A 3ZUNA 2LVOA 4MGKE 4ANUA 5G2NA 3TJPA 1FAOA 4JKCA 3LJUX 5JP4A 3C0RB 2UZRA 3PP2A 1VBGA 4HB4B 3KSYA 2NBWB 2ZCBA 1SHCA 3DVNV 3APCA 2HTHB 3EC8A 2IO2B 1BTNA 4B6HA 2GJYA 2CHWA 4HXDA 1V80A 4BOSC 3P6AA 4EOYA 3ZLZA 1WJ6A 4MGYE 4BBNF 2Z59B 2XK5B 4K7SA 3U30A 2R0DA 2D9YA 2N1VA 5CX3A 1DROA 1NTVA 3ENEA 2O6VA 3UF8A 2LD9A 2N9PC 1F9JA 5C79A 1DBHA 2IZVB 1NTYA 2MBEA 2Z0OA 2BPSA 2DX5B 2JZZA 5CHFA 3A8QA 3NSUA 2LKOA 5J3QA 3NY5A 3ML8A 3N32A 4DBGA 3V60A 2BYVE 2LJ5A 2KFKA 5J17A 4ICVA 4B6WA 4JKFA 3UQAA 2Z0DB 2RSUA 3R3MA 3AULA 4CHJA 3PREA 4HB3B 1WJ4A 5AZFA 1WF9A 1K8RB 2ZEQA 2REXA 2GS0A 1AARA 2L7RA 1ZM0A 2OQBA 2MKRA 4RMAA 2ELBA 1AQCA 1K5DB 4K2OA 2I1JA 2FUHB 3VOQA 3WAMA 4AUQC 3ECIA 2LOZA 2RUKB 4MY6A 4DWFA 4G3XB 4GSWA 1KLVA 2DKQA 2D9ZA 2YS1A 3V6EB 2G35A 3DVGY 4GOCA 2QHOA 2LRWA 1RFAA 2GCJA 3VXWA 2KC1A 1U5EA 1U29A 2K00A 2XEWA 4EFOA 1Q1OA 4GDKA 2JT4B 3AU4A 2RGNB 2LI5A 3GYOA 1YX5B 1ZC4B 2RR9A 3UGBB 3M95A 3RD2A 3WAOA 2KLCA 4BKGA 1WIAA 2DAJA 4FJYA 4HK2A 2K8BA 2D9VA 2JZ3B 2MBQA 2JRIB 3BY4B 3ONSA 2KD0A 3ZO5B 3JSVA 1W1HA 1C1YB 3VVWB 4ZRJA 5LXIB 1WGYA 2IYBA 2L2IA 1SE9A 2JVCA 3RCZA 4HAYB 3WANA 5E6PA 1LFDA 2LWPA 2KJ6A 5HE1A 2C5LC 2E2XA 3R7QA 2DYNA 2WDTB 3JSVB 1OEYA 3KUCB 4WQOB 2FCMA 4EZKA 4H8SA 1OQYA 3DBLI 4PS8A 1I7AA 2GBMA 2KKCA 3GYPA 2KWCA 1FHXA 1MK7B 2H7DA 1V81A 3B08A 1XD4A 1UBIA 3UIPB 2GBJA 4JKDA 2Y8FA 4FN2A 5D3WA 4FULA 1P6SA 4KZCA 4WAAA 1WM2A 4FJVB 2OTXA 2FAZA 4EUTA 1BWNA 3QCAA 3ML9A 4JQWC 1UZXB 5AZGA 4JK7A 3JVZX 2W9NA 1DYNA 4I6NB 4K1RB 3SBGA 1Q0WB 1YJ1A 2J0MA 2BWES 2KWUB 2EJ8A 1X05A 3U7DA 4MGIE 5C23A 2OOBB 4WJNA 5AEKB 2EC1A 5KQ4A 3SYXA 3VH4B 2L0FA 2WX1A 1MK9B 5LOPB 1RRBA 4BKSA 4HAVB 2KDEB 2NVUI 3VH3B 2K39A 1FOEA 2C60A 4II2B 1VCBA 3SHQA 3ZDMC 3NZUA 3V61A 4BOZB 2ADZA 3H9DA 2H7EA 2CR5A 2X0SA 1FB8A 1H10A 1TGZB 3A4RA 3F0WA 5HE2A 1IYFA 1UH6A 4HCNB 3AJ4A 2JP2A 1WX9A 4KAXB 2YT0A 4E74A 1OY2A 1S3SG 2N1WA 3N30A 2LXCA 5L81A 3CSTA 4ILJA 4W9CA 3Q3JA 2MLBA 2VKIA 3PEGA 2CODA 2KDBA 4HPMB 2Z0QA 2QKLA 3UIOB 3QAQA 3CXBB 3A1QA 2NMBA 1OMWA 4AJWA 1GGOA 3TW1A 2YT1A 2ZCCA 3PVWA 4KDIC 2EMSA 2MP2A 1EGXA 1Y8RC 2C7NB 1XD3B 2YRYA 4HAUB 3ZVRA 4LJOB 2AEHA 2L1CA 1Q67A 4EKUA 1U5DA 4FJZA 4W9DA 2X18A 1OEYJ 1SIFA 2K1FA 3PHXB 1WX7A 5JHBA 3H7PB 4PYUA 3MHSD 1WGUA 4JKBA 4HAZB 2K2JA 4P7IA 3K9OB 2K8HA 4DHJD 2ROVA 4NSWA 4HDOA 2MW5A 3RCPA 3RZWC 5D6JB 4NY0A 5AZHA 3FLVA 3VFKA 3L10B 4HATB 3ZKJC 1KI1B 1WXSA 1M7EA 2JPHA 3A9KA 2NR2A 4GMVA 3QHTA 1U5GA 4GGQA 5BO4B 3IVFA 3P7ZA 1RJ2A 2KDIA 1P0RA 2KOXA 3OLMD 1FHOA 2OJRA 4KHAA 3A8PA 5D2MB 3ALBA 4NQKE 4TUUA 4ZRKA 3OJ4B 4K7UA 1D3ZA 4X57B 3ZRCA 5D3XA 3V6CB 1VD2A 1E90A 4BFRA 4M0WB 2KJHB 3KUDB 3QJZA 4F8CB 2ZVNA 4OVVA 2RGFA 3IG3A 2C9WB 4G50A 3PSEB 3H7SA 4J6IA 1TXDA 2D4QA 1WGRA 4IWOA 1BT0A 3F5RA 3PPAA 2XK5A 1E8YA 3VAWA 4CO7A 1IRSA 4DHZE 1X86A 4IG7B 3DDCB 2VRRB 5JH5C 1MIXA 4HAXB 2IY1B 1V2YA 1ZW7A 3EPYA 2P0HA 2Y7BA 4GDLB 2M14A 2N23A 1WE7A 3PVUA 4WJOA 1I35A 1WFYA 5LONB 1UPRA 3LJ3A 3PRPB 1WI1A 1H8CA 3L17A 4ILGB 1DDWA 4KIKB 3EHVA 5IA7A 3ENBA 2I1KA 2R09A 3ODXA 2KZRA 3DOWA 4I6PA 4AOFA 5G55A 3L0WB 2V1YA 4PS7A 1YIWA 2PZ1A 4G11A 2LZ6A 3NZSA 2C7HA 2KHWB 1AWEA 1EF1A 3SBTA 1J0WA 3KH0A 3OANA 2ZPNA 2FCQA 1FGZA 3WYFB 3HIZA 1M94A 4HVBA 4MH0E 1SGHA 2BWFA 2CS4A 4W9FA 3DXCA 3W1SA 3HM3A 2P0FA 1QZEA 2FIFA 4M8NA 2HE7A 2LGXA 2RVBB 3L16A 4XZ4A 1WZ0A 2IBIB 4ANVA 2L3ZA 3CIKA 3B1LX 5J18A 1IPGA 2NCNA 3DCGA 1ISNA 2KFJA 2I5CA 3IBEA 5JHHA 2YVCA 2D9WA 3P2BA 1J19A 1KZGA 2LG1A 1OTRB 5JVLA 2XQNM 4HDQA 3KRXA 4GPTB 1A5RA 1KOTA 4NAWA 5FI1A 5DCNA 4IWPA 3DQVA 3W1SC 4CYEA 1KZ7A 1RAXA 3KYCD 2R2OA 1WG7A 4W9IA 3ODWA 3PLUA 4XX5A 1MG8A 2DZKA 2N4FA 3ZRFA 1Q5WB 4ANWA 2MDXA 2KGXB 2M8SA 2D07B 4IFSA 2KC2A 3M63B 4A6HA 1V9JA 1V5TA 2RQ1A 3MJWA 2IO1B 5FI0A 2DFKA 1OGWA 4EMOA 2EKEC 2AL6A 1J0GA 5LXHA 4JKGB 2R82A 2LOXA 2GCLA 3O96A 4EZJA 4CHMA 4DBBA 1I2HA 3VIAA 2GOWA 3E9OA 1J8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS5 A;  2KDE B;  3SV1 A;  2NVU I;  3M3J A;  3VH3 B;  3ZTD A;  5KCV A;  3DXE A;  4LJP B;  1MIZ B;  3N7C A;  1XKE A;  2COC A;  1P3R A;  2K39 A;  2NPT B;  1FOE A;  2N7D A;  2C60 A;  2DHI A;  1NU2 A;  2J59 M;  4KHO A;  3RUL A;  4ZDV A;  4II2 B;  2DZJ A;  1VCB A;  5J2R A;  1TTN A;  3SHQ A;  1PFJ A;  2COF A;  5KHQ A;  3SNH A;  4GN1 A;  1QC6 A;  2CU1 A;  2KX0 A;  3NZU A;  3ZDM C;  3ZVV A;  3V61 A;  4MJS A;  2BCJ A;  3HK0 A;  3JW0 X;  5CHV C;  4BOZ B;  2L8J A;  2ADZ A;  4Z2N A;  3H9D A;  2UZS A;  2K25 A;  3KY9 A;  2GMI C;  3L08 A;  4B95 A;  3TCA A;  2KUP A;  5DI9 B;  2KTF A;  3TMP B;  1LW3 A;  4NAW B;  4WVF B;  1LB1 A;  1NBF C;  1MKE A;  2K6D B;  3MPX A;  3ODO A;  2H7E A;  1E8X A;  5JLJ B;  5DH9 B;  4DX8 A;  2A4Z A;  2CR5 A;  2ELA A;  2ZJD A;  1Z87 A;  3B0A A;  3KUZ A;  1FB8 A;  2HJ8 A;  1UNR A;  1PLS A;  1H10 A;  4MK0 A;  3KYD D;  4HCP B;  4HPL B;  4JIO U;  3FM8 C;  1LQB A;  2Y5B B;  1P5T A;  1TGZ B;  4MDK E;  2NBV B;  1ZSQ A;  2WX0 A;  3A4R A;  3PG7 A;  3PLV A;  2N0Y A;  2KQ7 A;  1UGM A;  3PV1 A;  2KXJ A;  2RD0 A;  2G45 B;  2KLG A;  4AJW A;  3F0W A;  5HKH A;  2JY6 A;  1WXM A;  4NPN A;  3WIM A;  4TV3 A;  1WXV A;  4PS7 A;  5EFX A;  2V76 A;  1GJZ A;  1ZGU B;  1FHW A;  3MTN B;  4MGZ E;  3U30 A;  1NVL A;  3VHT C;  4FBJ B;  3LDZ E;  4ANU A;  3I3T B;  5HE2 A;  1IYF A;  1E5W A;  1UH6 A;  2BF8 B;  3CF6 E;  2KVR A;  4IWQ A;  4HCN B;  4DK5 A;  1UEL A;  5GMV A;  2LVQ A;  4FHK A;  4KSK C;  2LYD A;  3AJ4 A;  1WJU A;  2BYF A;  2IY0 B;  2RPQ A;  1G6J A;  3NS8 A;  1GC6 A;  1WGQ A;  3UIP B;  2JP2 A;  1WX9 A;  5HE0 A;  1WI0 A;  3X23 A;  4KAX B;  3L54 A;  2YT0 A;  1QQG A;  4E74 A;  3HHM A;  2O2V B;  3A98 B;  4HWI B;  1OY2 A;  5GOW B;  4W9I A;  5DPW A;  1S3S G;  3DPD A;  1T0Y A;  2N1W A;  4OVU A;  2CKH B;  2CY5 A;  2DHJ A;  3AU5 A;  3WAP A;  3N30 A;  2W2W A;  2LXC A;  1KM7 A;  2D10 A;  1WJ1 A;  5L81 A;  3CST A;  1FXT B;  1YX6 B;  2KTR A;  3PHW B;  4W9C A;  1W1G A;  4HLE A;  5KQ1 A;  2MLB A;  3Q3J A;  2VKI A;  1BAK A;  4GDL A;  1WRD B;  1HB6 A;  3PEG A;  2COD A;  2J0J A;  4K2P A;  2KDB A;  4HPM B;  2V3S A;  3D8E A;  2Z0Q A;  2CAY A;  2QKL A;  3UIO B;  2DZM A;  4WJQ A;  1R4M I;  2LUL A;  3HQC A;  3CXB B;  1WGH A;  3A1Q A;  3QAQ A;  4FHJ A;  3ML4 A;  2IO0 B;  1C3T A;  2JRH A;  2KX3 A;  4GU2 A;  2NMB A;  5C6R A;  1OMW A;  2FDQ A;  4K7W A;  3M1I B;  3NHE B;  5CLL B;  3TW1 A;  2YT1 A;  1GUA B;  2ZCC A;  4IM2 A;  2PPH A;  3RZF A;  1V61 A;  4A3O A;  3PVW A;  3ZUN A;  3UZT A;  1WR6 E;  2BGF A;  1Z5S B;  2EMS A;  3PSC A;  2LVO A;  2MP2 A;  4IM3 A;  1EGX A;  4KDI C;  5G2N A;  1FAO A;  1Y8R C;  1B55 A;  1UD7 A;  2C7N B;  2L76 A;  1HE8 A;  2IYD B;  2N9E B;  1XD3 B;  1WY8 A;  4KIK A;  4WJP A;  2L0T A;  1I42 A;  2MWN B;  2YRY A;  4A20 A;  2MSE D;  3AI5 A;  1V49 A;  4HAU B;  4K17 A;  3ZVR A;  5D27 A;  3LJU X;  5JP4 A;  3C0R B;  1TZ1 A;  1UNQ A;  2AEH A;  2CQU A;  2NS5 A;  4C0A A;  4LJO B;  3SO6 A;  2UZR A;  3PP2 A;  2L1C A;  4HB4 B;  1X11 A;  1OQN A;  1Q67 A;  1LXD A;  1ZKH A;  1U2B A;  4F7Z A;  2A5U A;  4WJ7 A;  3KRW A;  3KSY A;  1ZC3 B;  1EAZ A;  2LXA A;  3WAL A;  3ZNG C;  2NBW B;  4EKU A;  2ZCB A;  3D32 A;  1HBK A;  1U5D A;  4GZU A;  2RSG A;  3QBV B;  3R66 C;  4FJZ A;  4MJS B;  4W9D A;  1SHC A;  2KTR B;  2X18 A;  3APC A;  3DVN V;  4D0N B;  3A9J B;  4RM8 A;  2HTH B;  1WMH B;  1OEY J;  4IOY X;  4LCD E;  1SIF A;  1IP9 A;  2K1F A;  3EC8 A;  3L13 A;  2IO2 B;  2V4L A;  2CHX A;  1ACA A;  3PHX B;  1WX7 A;  5JHB A;  4TQ1 A;  1XX0 A;  5DPR A;  2LBB A;  3H7P B;  1BTN A;  4PYU A;  4B6H A;  2NPT A;  2GJY A;  4KZ0 A;  3OJ3 A;  2CHW A;  3MHS D;  4HXD A;  1WGU A;  4HJK A;  1V80 A;  2ZVO A;  3JYU A;  2PJH A;  1N3H A;  3H1U A;  4WJO A;  1I35 A;  4HAZ B;  4Y94 A;  4BOS C;  3P6A A;  3V5W A;  4EOY A;  2K2J A;  3ZLZ A;  4P7I A;  3K9O B;  2K8H A;  1R4N I;  2VRW B;  4DHJ D;  2ROV A;  2YF0 A;  4JL9 A;  4NSW A;  4W9H A;  1WE6 A;  4HDO A;  3CSF A;  3H6N A;  2D11 A;  1WJ6 A;  4MGY E;  4F7H A;  2MW5 A;  3CMM B;  3RCP A;  4BBN F;  5JHG A;  2XK5 B;  2Z59 B;  4K7S A;  2R0D A;  5D6J B;  4NY0 A;  2D9Y A;  3FLV A;  4PYZ A;  2N1V A;  5AZH A;  3RZW C;  1GG3 A;  1X1F A;  5CX3 A;  2MCN B;  1P9D U;  3VFK A;  4DHJ B;  3K9P B;  3L10 B;  1DRO A;  1V88 A;  2COA A;  4GB9 A;  4AP4 C;  1NTV A;  4HAT B;  3ZKJ C;  1KI1 B;  2O6V A;  3D8D A;  3ENE A;  2UVM A;  2M4N A;  3UF8 A;  4A6F A;  2LD9 A;  4XC2 A;  2N9P C;  1F9J A;  2R2Q A;  5C79 A;  3N3K B;  1WXS A;  1M7E A;  1V6E A;  2JPH A;  2W2X D;  3A9K A;  2MBH A;  4G0N B;  3ZNI D;  1DBH A;  4AJY B;  4URK A;  1H4R A;  2NR2 A;  4GMV A;  2IZV B;  1U5G A;  5DIF B;  3QHT A;  3QAR A;  4N9F 4;  1NTY A;  4GGQ A;  5BO4 B;  4HB0 B;  2MBE A;  2Z0O A;  3R7R A;  2BPS A;  2LUE A;  2ZNV C;  2DX5 B;  2KK8 A;  3IVF A;  3P7Z A;  2JZZ A;  1RJ2 A;  2KDI A;  2HD5 B;  2Q13 A;  2KQS A;  5CHF A;  3A8Q A;  1P0R A;  3NSU A;  1WYW B;  2KOX A;  3M62 B;  1KLV A;  1UPQ A;  4WWP A;  1MAI A;  2LKO A;  5KHO A;  1JRU A;  1WGD A;  5J3Q A;  1TBE A;  3NY5 A;  3OLM D;  3HM6 X;  3ZTC A;  1FHO A;  4MT7 A;  3ML8 A;  2OJR A;  3N32 A;  2K8C A;  2LGD A;  1TQZ A;  4DBG A;  3HW2 B;  3VDZ A;  4KHA A;  2ZNV B;  2L00 B;  2BYV E;  3T9L A;  2LJ5 A;  3V60 A;  5DHF B;  3A8P A;  2KFK A;  3QK0 A;  5J17 A;  4ICV A;  5D2M B;  2Z0E B;  3SU8 X;  4B6W A;  4ANX A;  5L83 A;  1M7R A;  3QX1 A;  1XR0 B;  4HAW B;  3ALB A;  3AXC A;  4KV2 A;  3UQA A;  4NQK E;  4TUU A;  2Z0D B;  2RSU A;  3R3M A;  2MBO A;  3A33 B;  3ZDT A;  4TQ0 A;  4ZRK A;  4WSF A;  3AUL A;  4CHJ A;  2M0X A;  3PRE A;  1X1M A;  3OJ4 B;  4IC7 B;  2HRJ A;  4DDG D;  5EDS A;  2O2V A;  4HB3 B;  4K7U A;  1D3Z A;  1WJ4 A;  5AZF A;  1WF9 A;  4DDI D;  1K8R B;  2ZEQ A;  2N9X A;  4X57 B;  2REX A;  3ULC A;  2GS0 A;  1V86 A;  3ZRC A;  5D3X A;  1AAR A;  2MFQ A;  1RLF A;  1VD2 A;  1E90 A;  2L7R A;  1ZM0 A;  2OQB A;  2MKR A;  3V6C B;  2JUO A;  4RMA A;  4BFR A;  4M0W B;  2KJH B;  2ELB A;  5D3V A;  3KUD B;  3QJZ A;  1WH3 A;  1ST7 A;  3APF A;  3VUX A;  4W9J A;  4F8C B;  1LM8 B;  1AQC A;  1K5D B;  3BJI A;  3SD5 A;  2ZVN A;  4OVV A;  4W9K A;  4K2O A;  2I1J A;  5HE3 A;  2FNJ B;  1HB8 A;  2RGF A;  3TO1 A;  2FCN A;  2FUH B;  2WWZ A;  4Z2M B;  3VOQ A;  3IG3 A;  1E8Z A;  4EJN A;  2YSZ A;  4M8M A;  3ECI A;  2LOZ A;  1NDD A;  2C9W B;  2RUK B;  3DBH I;  4RM9 A;  3WAM A;  4G50 A;  3PSE B;  3H7S A;  1WJN A;  3DXD A;  1WR1 A;  2G4S A;  4J6I A;  1TXD A;  5TR5 A;  2GBK A;  2D4Q A;  1WGR A;  4MY6 A;  4DWF A;  4IWO A;  4G3X B;  4GSW A;  1BT0 A;  2DKQ A;  3KZ1 A;  1E7V A;  2D9Z A;  4FLH A;  3TL5 A;  3F5R A;  2W2X C;  3MDB C;  4B9K A;  3PPA A;  3IFW B;  2YS1 A;  1XT9 B;  3V6E B;  2XK5 A;  5E6O A;  4E3C A;  1E8Y A;  4F7U P;  3VAW A;  4CO7 A;  1IRS A;  2UWQ A;  4DHZ E;  1UBQ A;  4BVU C;  2G35 A;  2GBR A;  1P3Q U;  1X86 A;  1V5U A;  2YS3 A;  2DX1 A;  2ZPY A;  2PE9 A;  3DVG Y;  4GIV A;  4IG7 B;  3KVF B;  4GOC A;  3W1Y A;  2PE6 B;  5DPS A;  3DDC B;  2VRR B;  5JH5 C;  2QHO A;  4GXB A;  2LRW A;  1RFA A;  1V5M A;  1MIX A;  2GCJ A;  2FID A;  3RUI B;  2DYB A;  3RYT A;  3QWZ B;  2BKR B;  2KMC A;  4HAX B;  4NNJ B;  5DPT A;  4KHB B;  2IY1 B;  3VXW A;  1V2Y A;  2KC1 A;  3VQI A;  1U5E A;  1ZW7 A;  2JF5 A;  5C5B B;  3DVG X;  3EPY A;  1U29 A;  2P0H A;  2K00 A;  1X1G A;  1NTI A;  2XEW A;  4FAD A;  2Y7B A;  1UNP A;  3PVL A;  4GDL B;  4II3 B;  2NZ8 B;  2L05 A;  2M14 A;  4EFO A;  4F7G A;  1TJ6 A;  2N23 A;  3O65 B;  1Q1O A;  1EF5 A;  3QIJ A;  4GDK A;  2KWV B;  4MGK E;  5J3Y A;  4NJ7 A;  1WXA A;  2JT4 B;  1WE7 A;  2J0K A;  3AU4 A;  2RGN B;  3PVU A;  4PNK A;  1WFY A;  5LON B;  2LRU A;  3G9W A;  1BTK A;  1UPR A;  2P0D A;  3D8F A;  2KN5 A;  2DA0 A;  2DTC A;  2LI5 A;  3LJ3 A;  3PRP B;  1WI1 A;  2K6Q A;  3L17 A;  3Q3F A;  1H8C A;  5DHA B;  3GYO A;  3A4S C;  1DDW A;  2YLM A;  1XQQ A;  1U27 A;  2FJ9 A;  2JWZ A;  4PQ0 A;  3V62 A;  4KIK B;  4W9E A;  1YX5 B;  2KO3 A;  1WJM A;  1ZC4 B;  2RR9 A;  4YON A;  3QA8 A;  1WGG A;  4JLC A;  3EHV A;  3UGB B;  2DLW A;  3M95 A;  3ZIM A;  5IA7 A;  3RD2 A;  3WAO A;  2KLC A;  2I1K A;  2R09 A;  2PEA A;  3ODX A;  4BKG A;  1WIA A;  2KZR A;  2LAS A;  3DOW A;  2M17 A;  4I6P A;  4DHZ B;  3ULB A;  3PZD A;  5G55 A;  4AOF A;  3L0W B;  2DAJ A;  4L6E A;  2KAN A;  3A1Q B;  4IUM B;  5D7G A;  1GNU A;  5JZE B;  2FJL A;  2AWT A;  1YQB A;  2V1Y A;  2DN6 A;  4TKN A;  5CLQ B;  2G4D B;  1YIW A;  1WM3 A;  4K81 A;  2WYQ A;  3APD A;  4HK2 A;  1YD8 U;  2PZ1 A;  2CHZ A;  1EVH A;  2QKM A;  4G11 A;  4MEM A;  2K8B A;  2D9V A;  1RRP B;  2DEN B;  2LZ6 A;  5FR6 A;  4FJY A;  2JZ3 B;  4ZRI A;  2C7H A;  2KDF B;  2JXX A;  3NZS A;  3TIX A;  3T06 A;  1P1A A;  2KHW B;  2MBQ A;  2JRI B;  3VTV A;  1AWE A;  1EF1 A;  4KVG B;  3BY4 B;  1XCG A;  4AWJ A;  3ONS A;  1U5F A;  2KD0 A;  3ZO5 B;  3PT2 B;  2MRP A;  1J0W A;  1ZVR A;  3JSV A;  3KH0 A;  3OAN A;  2D3G A;  4JGH B;  2ZPN A;  1W1H A;  1C1Y B;  3VVW B;  2FCQ A;  3W1S C;  1FGZ A;  3WYF B;  4ZRJ A;  3HIZ A;  3T8M A;  1M94 A;  4MSM B;  2WH5 A;  3GOE A;  4HVB A;  5LXI B;  3QCA A;  1WGY A;  4GDK B;  2AL3 A;  4MH0 E;  2VSZ A;  1SGH A;  4WWO A;  2BWF A;  2CS4 A;  1K5G B;  3TVV A;  1EUV B;  2D2Q A;  1W1D A;  3A9K B;  2IYB A;  3DXC A;  3TFM A;  4DX9 0;  4W9F A;  5LLI A;  3W1S A;  3KW5 B;  3TJP A;  3HM3 A;  2P0F A;  1QZE A;  2L2I A;  1E8W A;  1SE9 A;  3VUW A;  3PRM B;  4YL8 A;  2FIF A;  2JVC A;  3RCZ A;  5L95 C;  2UYZ B;  4ASW C;  3VUY A;  3WA0 A;  4HAY B;  5E6N A;  5J3T A;  3QC8 B;  3WAN A;  5E6P A;  1LFD A;  2J7Q B;  2LWP A;  4M8N A;  2HE7 A;  3BIN A;  2LGX A;  2KJ6 A;  2NBU A;  3ZW3 A;  2EMT A;  2RVB B;  3L16 A;  5HE1 A;  3SUZ A;  1WMH A;  2HTH A;  5IJM A;  2IFS A;  2E2X A;  1WZ0 A;  2C5L C;  3A9J A;  4KDL B;  5CHW A;  4XZ4 A;  3R7Q A;  2DYN A;  2IBI B;  2WDT B;  1OEY A;  3DBS A;  3JSV B;  3KUC B;  4WQO B;  2FCM A;  4A5K A;  4ANV A;  4H8S A;  4EZK A;  2L3Z A;  3CIK A;  1CMX B;  1OQY A;  2I5F A;  2MX2 A;  2DKP A;  3B1L X;  3EFU A;  5CTR C;  4IM0 A;  5J18 A;  3DBL I;  2XBB C;  2LGY A;  2O6V B;  1I7A A;  4PS8 A;  2GBM A;  1IPG A;  2KKC A;  2NCN A;  3DCG A;  4EZL A;  3GYP A;  1ISN A;  2KFJ A;  3RT3 B;  2DYQ A;  2KWC A;  2I5C A;  2KCJ A;  2ASQ A;  1FHX A;  2G3Q B;  2IO3 B;  3IBE A;  4BBN C;  1MK7 B;  2H7D A;  1Y19 B;  3FSS A;  4GMX B;  4KSL C;  5JHH A;  2YVC A;  3TBL D;  4EUT A;  2D9W A;  4NQL B;  5C5B A;  4ICU A;  1V81 A;  3VTW A;  1MPH A;  4BBK A;  3U8Z A;  3P2B A;  2M1M A;  3B08 A;  1XD4 A;  2Z0P A;  1UBI A;  2MWS B;  3OAW A;  1J19 A;  2CY4 A;  3X0W A;  4DXA B;  5C16 A;  1KZG A;  2LG1 A;  1OTR B;  2Y8G A;  1P98 A;  4HB2 B;  2DHZ A;  4ZYN A;  2ABD A;  2GBJ A;  4BKT A;  2Y8F A;  4FN2 A;  2K2U A;  5D3Y A;  4E71 A;  2XQN M;  5C1Z A;  4HDQ A;  3KRX A;  4GPT B;  1PQS A;  2P8V A;  4F1S A;  5D3W A;  1S1Q B;  4FUL A;  1P6S A;  1A5R A;  1E7U A;  4KZC A;  4WAA A;  2DX5 A;  4NAW A;  5FI1 A;  1WM2 A;  1KOT A;  1V89 A;  2CRF A;  3IHP C;  3EEC A;  3H7P A;  3QQ8 B;  4FJV B;  2D9X A;  5DCN A;  4IWP A;  2OTX A;  3DQV A;  2FAZ A;  2COP A;  4CYE A;  1KZ7 A;  2RLO A;  1BWN A;  1RAX A;  2R2O A;  1WG7 A;  2RNR B;  1DDM A;  2MQJ A;  3DBR I;  3KYC D;  4MM3 A;  4WWN A;  4HHV A;  1XOD A;  3ODW A;  3ML9 A;  1UZX B;  3PGE A;  1MG8 A;  2DZK A;  2ZZP B;  3PLU A;  4JQW C;  2N4F A;  4XX5 A;  5AZG A;  3ZRF A;  4XWX A;  2BYE A;  4W9L A;  4BKS D;  3FP5 A;  1Q5W B;  4PS3 A;  4ANW A;  4W9G A;  2MDX A;  2DHK A;  1L2N A;  2KGX B;  2M8S A;  3JVZ X;  2D07 B;  2W9N A;  5D94 A;  2ROZ B;  4IFS A;  5JHA A;  1PMS A;  2KC2 A;  4AUQ C;  1DYN A;  3M63 B;  2GBN A;  2FCS A;  2DYM A;  4I6N B;  4K1R B;  4A6H A;  1Q0W B;  2LVP A;  4A3P A;  3GZN I;  2KFK B;  1WVH A;  1FGY A;  2O6V D;  1V9J A;  1Y5O A;  2RQ1 A;  2J0M A;  1V5T A;  1YJ1 A;  2B3A A;  4TYZ A;  2BWE S;  3MJW A;  4LDT D;  2KMA A;  1WX8 A;  2IO1 B;  3S2A A;  1U4A A;  2KWU B;  5FI0 A;  2DFK A;  1OGW A;  4CHK A;  4EMO A;  2EKE C;  2AL6 A;  2DZI A;  1NI2 A;  4A6K A;  2MP2 B;  4MSQ B;  1J0G A;  2EJ8 A;  2C7M B;  4MEL A;  3PS6 A;  2KNB A;  1X05 A;  3U7D A;  4MGI E;  1KJT A;  5C23 A;  2MBB B;  2BKF A;  1V5P A;  5LXH A;  4LDT B;  3ZNH B;  3UQB A;  2OOB B;  2LOX A;  4WJN A;  1L7Y A;  2DYO A;  5AEK B;  4NJ6 A;  2GCL A;  3VTU A;  3O96 A;  4IAP A;  2N7E A;  3PTF C;  3QWM A;  2EC1 A;  5KQ4 A;  1Z2M A;  4EZJ A;  4EEW A;  3SYX A;  2KJR A;  3NOB A;  4IW0 A;  4CHM A;  3VH4 B;  1WZ3 A;  2CB8 A;  4DBB A;  1I2H A;  3FEH A;  2AYO B;  4A6F B;  4I6L B;  4FA6 A;  1UEF A;  3DVN U;  3SDL C;  1EO6 A;  3PRZ A;  1DDV A;  2DAF A;  2L0F A;  1MK9 B;  2WX1 A;  5IAA C;  5LOP B;  2M38 A;  3VIA A;  3UIN B;  1RRB A;  2GOW A;  1V5O A;  1GC7 A;  2MA9 B;  3ZNZ B;  4HAV B;  4BKS A;  1J8C A; 
#chains in the Genus database with same CATH topology
 1AN8 A;  1F52 A;  4LJP B;  3N7C A;  2L32 A;  3RUL A;  3R8B A;  5IN7 A;  1JDE A;  2DZJ A;  1TTN A;  3FIL B;  3AEA B;  5KHQ A;  3SNH A;  2CU1 A;  2KX0 A;  3JW0 X;  3IAS 1;  2WXQ A;  2GMI C;  2JYE A;  3L08 A;  4P6V F;  3TMP B;  2DWQ A;  4WVF B;  2K6D B;  1RWS A;  3ODO A;  1E8X A;  3RT3 B;  5JLJ B;  5DH9 B;  1SE2 A;  3KUZ A;  4RCO A;  3SFE B;  2HJ8 A;  1UNR A;  1PLS A;  3KYD D;  4HCP B;  4HPL B;  4EEW A;  2K5P A;  3FM8 C;  2Y5B B;  1P5T A;  1D5M C;  3PLV A;  3ETR A;  2N0Y A;  2KQ7 A;  2RD0 A;  2Z4D A;  1N63 A;  5HKH A;  3WIM A;  1GJZ A;  3VHT C;  1NVL A;  2KQ4 X;  1HZ5 A;  1E5W A;  5LG4 B;  2BF8 B;  3DHG C;  4DK5 A;  1UEL A;  5GMV A;  2QIL A;  1WJU A;  1G6J A;  5AUI A;  4OZA A;  3A98 B;  5GOW B;  3DPD A;  1T0Y A;  3GS2 A;  4OVU A;  1TS5 A;  2FE8 A;  2DHJ A;  1KLG D;  4ZRQ A;  1FXT B;  1YX6 B;  2KTR A;  1W1G A;  4HLE A;  5KQ1 A;  1TS3 A;  1BAK A;  1SB3 C;  1WRD B;  2J0J A;  2JXT A;  2K8E A;  2CAY A;  5D3D A;  4FHJ A;  4GU2 A;  5C6R A;  2FDQ A;  1EM7 A;  2VZK D;  4A3O A;  1ET9 A;  4S17 A;  2BGF A;  5D7G A;  4IM3 A;  3PSC A;  4BBN C;  4NQL B;  1UD7 A;  1V97 A;  1ACC A;  3VTV A;  1HE8 A;  2IYD B;  4KIK A;  1I42 A;  2L0T A;  1GOZ A;  3HSA A;  2MWN B;  3AI5 A;  1V49 A;  3AE3 B;  1TZ1 A;  2NS5 A;  3SO6 A;  4HRO A;  1OQN A;  1U2B A;  3U52 E;  4WJ7 A;  4JWS C;  1EAZ A;  3ZNG C;  3W9C B;  1HBK A;  4GZU A;  2RSG A;  3QBV B;  3R66 C;  1EWC A;  4LCD E;  3L13 A;  2V4L A;  2CHX A;  1ACA A;  2NPT A;  4HJK A;  2ZVO A;  3JYU A;  3MP9 A;  4QAY A;  2KUQ A;  3V5W A;  2AQ3 B;  1R4N I;  4YTN B;  4JL9 A;  4W9H A;  1WE6 A;  1I4R A;  3AEF B;  2VZK B;  4N59 A;  1ZOY B;  1GPX A;  5JHG A;  1X1F A;  1IUE A;  2MCN B;  1P9D U;  4DHJ B;  3K9P B;  2HTM E;  4AP4 C;  3D8D A;  2UVM A;  4A6F A;  2R2Q A;  1NYQ A;  4C56 C;  5J2R A;  2W2X D;  2MBH A;  3ZNI D;  1H4R A;  1KC7 A;  4N9F 4;  4XYC A;  4HB0 B;  3R7R A;  4JKE A;  1K52 A;  2KK8 A;  2ZNV C;  1F1H A;  2KQS A;  2HD5 B;  1WYW B;  1MAI A;  5KHO A;  2LUM A;  1WGD A;  5BMI A;  1TBE A;  2J42 A;  3HM6 X;  3E9S A;  2LGD A;  1TQZ A;  3VDZ A;  2L00 B;  3T9L A;  5HHD G;  4HRS A;  3QK0 A;  4B0E A;  2Z0E B;  3SU8 X;  1M7R A;  3QX1 A;  3AXC A;  3I63 C;  1MJD A;  3A33 B;  3B9J A;  1DGJ A;  4DDI D;  2N9X A;  1RLF A;  1RM6 C;  5D3V A;  3Q8A A;  3HVD A;  2J52 A;  3APF A;  1LM8 B;  3SD5 A;  4L1R A;  4W9K A;  5JXV A;  5HE3 A;  1HB8 A;  3TO1 A;  4Z2M B;  1E8Z A;  4EJN A;  2YSZ A;  4M8M A;  1NDD A;  4LLG M;  1MHH E;  1WR1 A;  2G4S A;  5TR5 A;  4UDU C;  1FNV A;  3KZ1 A;  4B9K A;  4FLH A;  1PGA A;  3MDB C;  2WXP A;  3IFW B;  1XT9 B;  4JK8 A;  3P4S B;  3A58 A;  5E6O A;  4F7U P;  2BW2 A;  5MPO A;  1KBL A;  1P3Q U;  1V5U A;  4GIV A;  2PE9 A;  2ZPY A;  3W1Y A;  3KVF B;  1I4H A;  1V5M A;  3RUI B;  5C3J B;  4NNJ B;  5DPT A;  2IDY A;  3VQI A;  2JF5 A;  5C5B B;  1VR9 A;  1AYF A;  1X1G A;  2E6X A;  4FAD A;  1F2R C;  2QDF A;  3PVL A;  3RI7 C;  4F7G A;  1TJ6 A;  3O65 B;  3QIJ A;  3I9V 1;  5J3Y A;  1WXA A;  1TS2 A;  1RYJ A;  5H8Y E;  2LRU A;  3HUI A;  4MDK E;  4US9 A;  3O13 A;  3G9W A;  1BTK A;  2KN5 A;  2DA0 A;  2K6Q A;  5FR3 A;  5DHA B;  2RPV A;  4RGT A;  1R7S A;  3A4S C;  4ARI A;  3Q2A C;  3RNE C;  1XQQ A;  1U27 A;  4PQ0 A;  3VRB B;  4A6Q A;  2KO3 A;  2D3C A;  4JLC A;  3QA8 A;  5HG2 A;  2RDH A;  2DLW A;  3ZIM A;  2PEA A;  1ZP0 B;  4DHZ B;  2QJL A;  4N6E B;  3ULB A;  3PZD A;  4L6E A;  3A1Q B;  4WWM A;  3Q3M C;  2FJL A;  2AWT A;  1YQB A;  4TKN A;  2DN6 A;  2G4D B;  3APD A;  5E6N A;  2CHZ A;  1TT5 B;  2IGD A;  2QKM A;  2IGG A;  1RRP B;  2J53 A;  3N1Z C;  4ZRI A;  2KDF B;  2MJ3 A;  2JXX A;  4QXA B;  3MC9 A;  3PT2 B;  2MRP A;  2NTT A;  1NEN B;  1ZVR A;  3Q8F A;  2WXF A;  3T8M A;  3GOE A;  4NJC A;  2HDE A;  4OVZ A;  2VSZ A;  4IOI E;  4WWO A;  3TVV A;  1EUV B;  2D2Q A;  3A9K B;  4DX9 0;  2X8X X;  4QJ4 B;  2LHE A;  5BYS A;  4HKQ A;  5EE9 A;  1XO3 A;  4ASW C;  3VUY A;  2DLB A;  2OJW A;  2Z14 A;  1ESF A;  2NBU A;  3ZW3 A;  2EMT A;  1WMH A;  2WXJ A;  3SUZ A;  3A9J A;  5IJM A;  2IFS A;  3BII D;  4KDL B;  3FC4 A;  3E9P A;  3DBS A;  5EE3 A;  2MX2 A;  3EFU A;  2DKP A;  3Q69 A;  4EZL A;  5E6J A;  2GUM A;  3ZQ4 A;  1E9M A;  1L4Z B;  4ICU A;  3VTW A;  4BBK A;  1P7F A;  2Z0P A;  4M02 A;  3X0W A;  4DXA B;  4ZYN A;  2Y8G A;  1P98 A;  1PFD A;  4BKT A;  2K2U A;  5D3Y A;  3RNA C;  2QIE B;  1PQS A;  4F1S A;  2P8V A;  3AE1 B;  3DBR B;  3U7Z A;  4N58 A;  2DX5 A;  1V89 A;  2CRF A;  3EEC A;  3H7P A;  4LTU A;  3IAM 1;  2RLO A;  2NBV A;  1FPY A;  2JQR B;  2KAJ A;  2RNR B;  2MQJ A;  3DBR I;  4MM3 A;  4B95 A;  2ZZP B;  2DNF A;  3AH7 A;  4XWX A;  2BYE A;  4W9L A;  2ZW1 A;  3FP5 A;  4PS3 A;  1L2N A;  2DHK A;  2IGH A;  4KKI A;  5D94 A;  5JHA A;  1PMS A;  3BVZ A;  1JWA D;  4FXC A;  3VR9 B;  2GBN A;  2FCS A;  2LVP A;  1JRP A;  3KW5 B;  1FGY A;  1FRD A;  3QAR A;  2LGI A;  1Y5O A;  4LDT D;  2KMA A;  1WX8 A;  3S2A A;  4CHK A;  3AN1 A;  4MSQ B;  4A6K A;  2MP2 B;  4MEL A;  3PS6 A;  1D4B A;  2MBB B;  2BKF A;  3ZNH B;  1HQR D;  2RMM A;  3UQB A;  1KF6 B;  1L7Y A;  2DYO A;  2X38 A;  2PIA A;  3N20 C;  1JWM D;  1ROE A;  1QOF A;  4IAP A;  2N7E A;  4MT5 A;  1Z2M A;  1SJH D;  3FEH A;  1MFW A;  1JWU D;  1N62 A;  2AYO B;  2D5G A;  1UEF A;  3DVN U;  4I6L B;  4YSY B;  3L4P A;  1XLP A;  3EGR A;  1DDV A;  2DAF A;  1SE3 A;  5IAA C;  3UIN B;  2MA9 B;  2JWZ A;  2W54 A;  2XNA C;  3M3J A;  5KCV A;  1F0Z A;  3DXE A;  2MJE A;  1MIZ B;  1XKE A;  2COC A;  2D3B A;  2WXL A;  1P3R A;  2NPT B;  3ZXV A;  2N7D A;  1NU2 A;  4ZDV A;  4XGA B;  2XN9 C;  4YTP B;  1PFJ A;  4GN1 A;  1QC6 A;  2BCJ A;  3HK0 A;  1ZE3 D;  3J9C A;  5IKC M;  4Z2N A;  2K25 A;  2KTF A;  1LW3 A;  2GRI A;  1NBF C;  3MPX A;  2A4Z A;  4BZA A;  3B0A A;  2ZJD A;  1Z87 A;  3KQ4 A;  4MK0 A;  4JIO U;  1LQB A;  3U2S C;  1UGM A;  2KXJ A;  2KLG A;  2J4X A;  2PTL A;  2JY6 A;  1WXM A;  4NPN A;  1CJE A;  4TV3 A;  2V76 A;  4FBJ B;  4LNK A;  4JKH A;  1IBX B;  2DIK A;  4ITK A;  3IT4 B;  4IWQ A;  4P16 A;  2BYF A;  2RPQ A;  2R61 A;  3NS8 A;  1WGQ A;  2BB6 A;  1VRA B;  2V3N A;  3X23 A;  3L54 A;  1QLB B;  2O2V B;  4HWI B;  1PDX A;  5DPW A;  1TY2 A;  4K3C A;  2CY5 A;  3AU5 A;  1KM7 A;  2D10 A;  1ZYI A;  5IO9 A;  4C4V A;  4GDL A;  2G1E A;  1HB6 A;  4K2P A;  3D8E A;  1CK1 A;  3Q14 C;  1T0S C;  2DZM A;  2LUL A;  1WGH A;  2KIE A;  2IO0 B;  2KX3 A;  2LJI A;  3M1I B;  3C19 A;  2WXK A;  2WNM A;  3RZF A;  4L2Y A;  2FBW B;  3UZT A;  1WR6 E;  1Z5S B;  2MEK A;  1YNT E;  3NOB A;  1B55 A;  3ZJU A;  2L76 A;  4WJP A;  2N9E B;  3IXS A;  1WY8 A;  2INN E;  2BS3 B;  2TSS A;  1QOB A;  4A20 A;  2MSE D;  4K17 A;  5D27 A;  1UNQ A;  2CQU A;  3V05 A;  4C0A A;  3SFD B;  4ILH A;  1UWX A;  4F7Z A;  1X11 A;  1LXD A;  1ZKH A;  4RH6 A;  2A5U A;  3KRW A;  1ZC3 B;  2LXA A;  3WAL A;  2WQY B;  4L23 A;  3D32 A;  1VBH A;  2WU2 B;  1PYW D;  4MJS B;  2KTR B;  4ZYS A;  4D0N B;  1FFU A;  3A9J B;  1WMH B;  4RM8 A;  4IOY X;  1IP9 A;  1FCC C;  3UI3 A;  4TQ1 A;  1XX0 A;  3TEZ A;  2LBB A;  2V0G A;  2DBY A;  4KZ0 A;  3OJ3 A;  5AUK A;  2PJH A;  1N3H A;  3H1U A;  1L5P A;  4Y94 A;  4ZOH C;  2VRW B;  3AV8 A;  2YF0 A;  4JWU C;  3CSF A;  3H6N A;  2D11 A;  4F7H A;  3CMM B;  2IPK D;  3H8H A;  4PYZ A;  1TYG B;  1GG3 A;  2GB1 A;  3MJ5 A;  1JQ4 A;  1V88 A;  2COA A;  4GB9 A;  1BUI C;  1WGK A;  1TKY A;  2V3P A;  1I4P A;  2M4N A;  3Q3O C;  4XC2 A;  3N3K B;  4G0N B;  1V6E A;  4URK A;  4AJY B;  4GNK B;  4S0R A;  3BK1 A;  5DIF B;  1OQR A;  2JZP A;  2LUE A;  4A9A A;  1PGX A;  2Q13 A;  4QJ3 B;  4M01 A;  2EEL A;  3M62 B;  1UPQ A;  1T77 A;  2N9K A;  4WWP A;  3TEW A;  1YMH E;  1JRU A;  1YQ3 B;  3LB8 C;  1SBB B;  3ZTC A;  1EU4 A;  4MT7 A;  1XF5 L;  2GLS A;  2K8C A;  3HW2 B;  3BWU D;  2ZNV B;  1J7B A;  2KYW A;  5DHF B;  4TSS A;  3GE8 C;  1TZO A;  4ANX A;  5L83 A;  1XR0 B;  4HAW B;  4KV2 A;  2MBO A;  3NVY A;  3ZDT A;  4TQ0 A;  4WSF A;  4CSQ A;  2M0X A;  4IC7 B;  4DDG D;  1X1M A;  5EDS A;  2HRJ A;  2O2V A;  1K53 A;  1YOV B;  4RGN A;  3N1Y C;  3ULC A;  1V86 A;  2MFQ A;  3HRD D;  2JUO A;  1L0V B;  3I5J C;  1WH3 A;  1ST7 A;  3VUX A;  4W9J A;  4HKZ E;  3BJI A;  4XE0 A;  3PZ7 A;  2WWZ A;  2FNJ B;  2FCN A;  3DBH I;  4RM9 A;  2ICI A;  1WJN A;  3DXD A;  2Y5P A;  1XLO A;  2GBK A;  1CQV A;  1E7V A;  1XCQ L;  1L4D B;  3TL5 A;  2W2X C;  1BML C;  1T3Q A;  4E3C A;  2UWQ A;  1UBQ A;  1VZ7 A;  4JKG A;  2GBR A;  2YS3 A;  2DX1 A;  3AEC B;  2PE6 B;  5DPS A;  3NJT A;  4IKG A;  2PLP A;  4GXB A;  2FID A;  2DYB A;  3RYT A;  3QWZ B;  2BKR B;  1EWY C;  2KMC A;  1C77 A;  4KHB B;  3DVG X;  2JYT A;  1T6B X;  4WH4 A;  1NTI A;  1UNP A;  3AEE B;  2NZ8 B;  2L05 A;  3CWI A;  4II3 B;  3SR6 A;  1I4X A;  4RFB A;  1EF5 A;  2KWV B;  3NVW A;  4NJ7 A;  2J0K A;  4PNK A;  3D8F A;  2P0D A;  1B1Z A;  2DTC A;  4YTM B;  3Q3F A;  3NW8 A;  2WS3 B;  2YLM A;  2FJ9 A;  3V62 A;  4W9E A;  1SIJ A;  1WJM A;  2PVO D;  4YON A;  1WGG A;  2FUG 1;  1RFK A;  2LAS A;  3RNF C;  2M17 A;  3P42 A;  2KAN A;  4IUM B;  2FJU B;  1GNU A;  4BVU C;  5CLQ B;  1WM3 A;  4K81 A;  2WYQ A;  1YD8 U;  1ZDV A;  1EVH A;  4MEM A;  2DEN B;  5FR6 A;  2INC C;  3TIX A;  3T06 A;  1P1A A;  3R2I A;  4KVG B;  1XCG A;  4AWJ A;  1U5F A;  1XEE A;  2D3G A;  4JGH B;  4MSM B;  2WH5 A;  4A8X C;  5H92 C;  5LNK 1;  4GDK B;  2AL3 A;  1EU3 A;  1NVI D;  1K5G B;  1W1D A;  2VH1 A;  3TFM A;  5LLI A;  1DOX A;  1DOI A;  1E8W A;  3PRM B;  4YL8 A;  5L95 C;  4A55 A;  2UYZ B;  1Q10 A;  3WA0 A;  5J3T A;  3QC8 B;  2J7Q B;  1ZXI A;  3BIN A;  2HTH A;  5CHW A;  1WRI A;  4A5K A;  1CMX B;  2I5F A;  5I2M A;  4IM0 A;  2XBB C;  2LGY A;  2O6V B;  1LGR A;  3AE6 B;  2DYQ A;  2KCJ A;  2ASQ A;  2G3Q B;  1FO4 A;  2IO3 B;  3FSS A;  1Y19 B;  4KSL C;  4GMX B;  3TBL D;  5C5B A;  2WXG A;  5IRS A;  1MPH A;  3U8Z A;  2M1M A;  3OAW A;  2MWS B;  2CY4 A;  1MHX A;  5C16 A;  2DHZ A;  1KTK A;  4HB2 B;  2ABD A;  4C4V B;  3Q6B A;  4E71 A;  5C1Z A;  2PMV A;  1S1Q B;  1E7U A;  3IHP C;  3QQ8 B;  2D9X A;  2WXR A;  1B9R A;  1I4Q A;  2COP A;  5CTR C;  5HFY A;  4WWN A;  2WDV B;  1DDM A;  4HHV A;  1XOD A;  3NG0 A;  3PGE A;  1BXT A;  3FIL A;  2MH7 A;  1DIK A;  4BKS D;  4W9G A;  1SSN A;  2ROZ B;  1N5X A;  3AE2 B;  3E66 A;  2DYM A;  4A3P A;  2IJ0 A;  3GZN I;  2KFK B;  2WXM A;  1WVH A;  2O6V D;  5DPR A;  2B3A A;  4TYZ A;  1U4A A;  1STE A;  2DZI A;  3KLS X;  1NI2 A;  2C7M B;  2KNB A;  3GP7 A;  1KJT A;  1V5P A;  4LDT B;  3AEB B;  2PKO A;  4NJ6 A;  3VTU A;  3PTF C;  3QWM A;  2KJR A;  4IW0 A;  1WZ3 A;  2CB8 A;  4FA6 A;  4A6F B;  1GB1 A;  3SDL C;  1EO6 A;  3PRZ A;  3BK2 A;  2M38 A;  1V5O A;  1GC7 A;  3ZNZ B;  2AQ2 B;  2YS5 A;  3SV1 A;  3ZTD A;  4LNI A;  2W3R A;  4JKA A;  2DHI A;  2J59 M;  4KHO A;  3NWF A;  2COF A;  3ZVV A;  4MJS A;  2INP E;  3DWG C;  5CHV C;  3FVC A;  2L8J A;  2UZS A;  3KY9 A;  3NZ3 A;  3TCA A;  2KUP A;  5DI9 B;  3EFC A;  1L0Y B;  4NAW B;  2BS2 B;  1SXT A;  1LB1 A;  1MKE A;  5D3I B;  4ACF A;  3VUW A;  4DX8 A;  2ELA A;  4MM3 B;  5JZE B;  1KRH A;  2NBV B;  1ZSQ A;  2WX0 A;  4YSX B;  3PG7 A;  5G5H A;  3PV1 A;  1QOA A;  2HJ1 A;  2G45 B;  1QQR A;  1WXV A;  5EFX A;  1ZGU B;  3AE4 B;  1FHW A;  3MTN B;  4MGZ E;  2ON8 A;  3LDZ E;  4EE2 A;  3I3T B;  3CF6 E;  2KVR A;  4MAC A;  2LVQ A;  4FHK A;  4KSK C;  1FCL A;  2K49 A;  2LYD A;  2IY0 B;  1GC6 A;  3E56 A;  4RNA A;  5HE0 A;  1WI0 A;  4BAX A;  3E9L A;  1QQG A;  3HHM A;  1ZXH A;  3ZJT A;  2CKH B;  1KFY B;  4JK9 A;  3FAH A;  2N9L A;  3WAP A;  1FM0 D;  2W2W A;  4TMA B;  1WJ1 A;  4LNN A;  3AE9 B;  2N7J A;  3PHW B;  2V3S A;  1N60 A;  3TSS A;  4WJQ A;  1R4M I;  2WGS A;  3HQC A;  4RF0 A;  1C3T A;  3ML4 A;  2JRH A;  3GZN B;  4K7W A;  5BMG A;  3NHE B;  5CLL B;  3NRZ A;  1GUA B;  4IM2 A;  1UF0 A;  2PPH A;  1V61 A;  4DQO C;  3ZUN A;  2LVO A;  4MGK E;  4ANU A;  5G2N A;  3TJP A;  1FAO A;  4JKC A;  2I38 A;  2KWD A;  3LJU X;  5JP4 A;  1KH0 A;  3C0R B;  2SAK A;  2L83 A;  1A70 A;  2UZR A;  3PP2 A;  3ZYY X;  1VBG A;  2KR0 A;  2KDM A;  4HB4 B;  1C4C A;  3KSY A;  1VZ6 A;  2NBW B;  2ZCB A;  1QKZ A;  1E7P B;  1SHC A;  3DVN V;  3APC A;  2BTE A;  2HTH B;  3EC8 A;  2IO2 B;  2BT6 A;  5GXG B;  3NVZ A;  1BTN A;  4B6H A;  2GJY A;  2CHW A;  4HXD A;  5G5G A;  1V80 A;  4BOS C;  3P6A A;  4EOY A;  3ZLZ A;  1WJ6 A;  1JAL A;  4MGY E;  4PK1 A;  4BBN F;  2Z59 B;  2XK5 B;  4K7S A;  1TIF A;  2R0D A;  3U30 A;  2D9Y A;  2N1V A;  5CX3 A;  1DRO A;  1NTV A;  3ENE A;  2O6V A;  3UF8 A;  2LD9 A;  5BYQ A;  2N9P C;  1F9J A;  4LNF A;  5C79 A;  1HXY D;  1DBH A;  2IZV B;  1NTY A;  5FK9 C;  4M00 A;  1IGC A;  2MBE A;  2Z0O A;  2BPS A;  2DX5 B;  2JZZ A;  5CHF A;  3A8Q A;  3NSU A;  1NI3 A;  2LKO A;  5J3Q A;  3NY5 A;  3ML8 A;  3N32 A;  2KVZ A;  4DBG A;  3V60 A;  2BYV E;  4C80 A;  2LJ5 A;  2KFK A;  5J17 A;  3U4E G;  4ICV A;  4B6W A;  4JKF A;  1OFF A;  1J7C A;  1V1P A;  3UQA A;  2AQ1 B;  2Z0D B;  2RSU A;  3R3M A;  3AUL A;  4CHJ A;  1SF0 A;  3PRE A;  2LHD A;  4HB3 B;  1WJ4 A;  5AZF A;  1WF9 A;  1K8R B;  4HJG E;  4REZ A;  2ZEQ A;  2REX A;  2GS0 A;  2RDG A;  3RPF C;  1AAR A;  2L7R A;  1ZM0 A;  2OQB A;  2MKR A;  4RMA A;  2ELB A;  3P4Q B;  1AQC A;  1K5D B;  4K2O A;  2I1J A;  3IT6 B;  2PVG C;  2FUH B;  3VOQ A;  3WAM A;  4AUQ C;  3ECI A;  2LOZ A;  5IP4 D;  2RUK B;  4OZC A;  3V3X A;  4MY6 A;  3ABV B;  4DWF A;  3VRA B;  4G3X B;  4GSW A;  4AQ7 A;  2DKQ A;  1KLV A;  2D9Z A;  2YS1 A;  1MI0 A;  3V6E B;  3MFG A;  4OHJ A;  3AB5 A;  2G35 A;  3ZJV A;  3DVG Y;  4WQM A;  4GOC A;  3TUO A;  4MH8 A;  2QHO A;  2LRW A;  3LXF A;  1RFA A;  2L52 A;  2GCJ A;  3DWM A;  3VXW A;  2KC1 A;  1U5E A;  1L0X B;  1U29 A;  2K00 A;  2XEW A;  2Q5W D;  4EFO A;  3MC8 A;  5I4D A;  1Q1O A;  2KMM A;  4HSI A;  5EE1 A;  4GDK A;  2KN4 A;  1MI1 A;  2JT4 B;  3AU4 A;  2RGN B;  3URY A;  3DBH B;  2LI5 A;  3GYO A;  1YX5 B;  3W2D A;  1ZC4 B;  1TJE A;  2RR9 A;  3N1X C;  3UGB B;  3M95 A;  4XWW A;  3RD2 A;  3WAO A;  2KLC A;  1D6E C;  4BKG A;  1WIA A;  3RMK C;  2DAJ A;  1PUT A;  2W55 A;  1IGD A;  3AED B;  3DBL B;  1HA5 A;  4FJY A;  4HK2 A;  2K8B A;  2D9V A;  2JZ3 B;  2OHF A;  1UWM A;  2MBQ A;  2JRI B;  2BYT A;  3BY4 B;  5FKA C;  3ONS A;  2KD0 A;  3ZO5 B;  4WUR A;  3JSV A;  4ARC A;  4Q2J A;  1W1H A;  1C1Y B;  3VVW B;  4ZRJ A;  4KKJ A;  2BQQ A;  1C79 A;  2RRF A;  2K0P A;  2Z13 A;  5LXI B;  1WGY A;  2M56 B;  4RGO S;  2M19 A;  1YQ4 B;  5TSS A;  2IYB A;  3AE5 B;  3MHZ A;  2QMT A;  2L2I A;  1SE9 A;  2R2Y A;  2JVC A;  3RCZ A;  4HAY B;  2LFI A;  3WAN A;  5E6P A;  1LFD A;  2LWP A;  4C00 A;  1ZDX A;  2KJ6 A;  5HE1 A;  2C5L C;  2E2X A;  3R2T A;  3R7Q A;  2DYN A;  2WDT B;  3JSV B;  1OEY A;  3KUC B;  4WQO B;  2FCM A;  1UUP A;  4EZK A;  4H8S A;  3WCQ A;  1OQY A;  3BVM A;  1MPE A;  2WDR B;  1XXG A;  3DBL I;  4PS8 A;  1I7A A;  2GBM A;  2KKC A;  3GYP A;  2D3A A;  3Q8B A;  2KWC A;  4KGS A;  1FHX A;  1MK7 B;  2H7D A;  1V1O A;  1VLB A;  1OQQ A;  3NWA A;  1V81 A;  1YN5 A;  2WDQ B;  3B08 A;  1XD4 A;  1UBI A;  1C78 A;  1P7E A;  3UIP B;  1E6E B;  2GBJ A;  4JKD A;  2Y8F A;  4FN2 A;  4P1B C;  1ENF A;  4ZHO A;  4USA A;  1ZUD 2;  5D3W A;  4C7Z A;  4FUL A;  1P6S A;  4KZC A;  4WAA A;  1WM2 A;  1YJI A;  4FJV B;  4KX6 B;  1T0Q C;  2OTX A;  2FAZ A;  4EUT A;  1BWN A;  4O1N A;  3ML9 A;  3QCA A;  4JQW C;  1UZX B;  2CJO A;  5AZG A;  1N6Z A;  5M4Y B;  4JK7 A;  3BVG A;  3DHH C;  3JVZ X;  2W9N A;  1QOG A;  1DOY A;  1DYN A;  4I6N B;  1D5X C;  3SBG A;  1JW9 D;  4K1R B;  1Q0W B;  1YJ1 A;  1ET6 A;  3DHI C;  2J0M A;  2BWE S;  3EA6 A;  1R4M B;  2QCZ A;  4D2K A;  2KWU B;  3PO0 A;  4GOU A;  2EJ8 A;  1X05 A;  3U7D A;  4MGI E;  2NTS A;  5C23 A;  1JML A;  4JPS A;  2OOB B;  4WJN A;  5AEK B;  3RNB C;  1VZ8 A;  2EC1 A;  5KQ4 A;  2WU5 B;  3SYX A;  3NS1 A;  3VH4 B;  1QIL A;  4YXD B;  2L0F A;  1MG4 A;  2WX1 A;  1MK9 B;  5LOP B;  1CZP A;  1RRB A;  2K9X A;  4BKS A;  4HAV B;  2KDE B;  2NVU I;  3VH3 B;  3B2F A;  2ZKM X;  2W3S A;  2K39 A;  1FOE A;  1FIQ A;  2C60 A;  4II2 B;  2JX5 A;  1VCB A;  3I57 A;  1HTQ A;  3SHQ A;  2GI9 A;  3ZDM C;  3NZU A;  3V61 A;  3BYY B;  4BOZ B;  2ADZ A;  3H9D A;  2BS4 B;  3W5V B;  4US8 A;  3AE8 B;  2BVC A;  4QJ5 B;  1HZ6 A;  2H7E A;  2V4I B;  2CR5 A;  2X0S A;  4P1C C;  1FB8 A;  1GAQ B;  1C9F A;  1H10 A;  1N61 A;  1D5Z C;  1TGZ B;  2IND C;  3A4R A;  1XLQ A;  3F0W A;  2CU3 A;  1UGJ A;  4C7Y A;  3P63 A;  3PZ8 A;  1TS4 A;  4YWG G;  5HE2 A;  1IYF A;  1UH6 A;  4HCN B;  3HVZ A;  4PT5 A;  3AJ4 A;  4OSN A;  2JP2 A;  1WX9 A;  4KAX B;  4DIX A;  2YT0 A;  4E74 A;  1OY2 A;  3NUH B;  1S3S G;  1FRR A;  2N1W A;  1C4A A;  1GB4 A;  3N30 A;  3T3O A;  2LXC A;  3Q3N C;  2Z59 A;  5L81 A;  3CST A;  4ZHP A;  4ILJ A;  4W9C A;  1FMA D;  3Q3J A;  2MLB A;  2VKI A;  3PEG A;  2COD A;  2KDB A;  4HPM B;  2QSD A;  2Z0Q A;  2QKL A;  3UIO B;  2WXH A;  3QAQ A;  3CXB B;  1JCK B;  3A1Q A;  3RNC C;  4KHB A;  2NMB A;  1OMW A;  1GGO A;  4AJW A;  3ZGZ A;  3TW1 A;  2YT1 A;  2ZCC A;  3PVW A;  1NYR A;  1I7H A;  2EMS A;  2MP2 A;  4KDI C;  4DXG A;  1EGX A;  1Y8R C;  2C7N B;  2VH2 A;  1XD3 B;  1WYG A;  2YRY A;  4HAU B;  3ZVR A;  4LJO B;  2AEH A;  5C2T B;  3OWE B;  2L1C A;  1Q67 A;  3SEB A;  3AE7 B;  1JRO A;  4RGM A;  4EKU A;  4JE3 B;  1U5D A;  2LEK A;  5IOI A;  1VJK A;  4FJZ A;  4W9D A;  2X18 A;  2WP9 B;  1OEY J;  1V8C A;  1SIF A;  2NMQ A;  2K1F A;  3C8Y A;  1WXQ A;  3PHX B;  1WX7 A;  5JHB A;  2JWU A;  3H7P B;  4PYU A;  3MHS D;  1WGU A;  2YT2 A;  4JKB A;  4HAZ B;  3P4R B;  2K2J A;  4P7I A;  3K9O B;  2K8H A;  4DHJ D;  2ROV A;  4NSW A;  4HDO A;  5T8I A;  2MW5 A;  3RCP A;  3ZXR A;  1FNW A;  4LK0 M;  3RZW C;  5D6J B;  4NY0 A;  5AZH A;  3FLV A;  1TKE A;  3VFK A;  4OW0 A;  3GE3 C;  3L10 B;  4HAT B;  3ZKJ C;  2WLB A;  1KI1 B;  1K51 A;  1WXS A;  1M7E A;  2JPH A;  3A9K A;  2I2Y A;  2NR2 A;  4GMV A;  2RDB C;  1U5G A;  3QHT A;  2KIG A;  4GGQ A;  5BO4 B;  2E3T A;  3IVF A;  3P7Z A;  1RJ2 A;  1DYQ A;  2KDI A;  1P0R A;  2ZW0 A;  2KOX A;  1WSP A;  3MC0 B;  4J3O D;  4RF1 A;  3B2G A;  3OLM D;  1C76 A;  1FHO A;  2OJR A;  1AWD A;  4B0M A;  4D6W A;  4KHA A;  3A8P A;  1L6U A;  2WHI A;  3N9Y C;  5D2M B;  4WAF A;  2QEJ C;  3ALB A;  4NQK E;  4TUU A;  3AM9 A;  4DXF A;  4ZRK A;  1C4P A;  1F2R I;  3OJ4 B;  2H89 B;  4KGR A;  4K7U A;  1T5X D;  1D3Z A;  1HEZ E;  4X57 B;  3ZRC A;  5D3X A;  3V6C B;  1VD2 A;  1E90 A;  4BFR A;  1UNS A;  3EUB 2;  3DCX A;  4JX1 C;  4M0W B;  3B77 A;  2KJH B;  3KUD B;  3QJZ A;  3NVV A;  4F8C B;  2QC8 A;  1JWB D;  1PGB A;  1XLN A;  2ZVN A;  4OVV A;  4HPP A;  3KWL A;  1V1P B;  2RGF A;  3IG3 A;  2C9W B;  4G50 A;  3PSE B;  3H7S A;  2PW9 A;  4J6I A;  1TXD A;  1SJE D;  2D4Q A;  1WGR A;  4IWO A;  2MHJ A;  1BT0 A;  3F5R A;  3VR8 B;  1E0Z A;  3PPA A;  1T0R C;  1JWS D;  2XK5 A;  4XDD A;  1E8Y A;  3VAW A;  4CO7 A;  1IRS A;  4DHZ E;  3U12 A;  1X86 A;  4IG7 B;  1E10 A;  3DDC B;  2VRR B;  5JH5 C;  1WWT A;  1F77 A;  1XCT L;  4H2A A;  1MIX A;  1TKG A;  4AS1 A;  4HAX B;  1QF6 A;  2IY1 B;  1V2Y A;  2H88 B;  2WXN A;  1ZW7 A;  3Q8E A;  3EPY A;  2P0H A;  4NAM A;  3CIR B;  2KT7 A;  4XDC A;  3P4P B;  2Y7B A;  4LNO A;  1I4G A;  4GDL B;  1NEK B;  2M14 A;  2Y3A A;  2N23 A;  2YEP F;  1WE7 A;  3PVU A;  4WJO A;  1WFY A;  1I35 A;  5LON B;  1UPR A;  4A90 A;  3LJ3 A;  3PRP B;  1WI1 A;  1H8C A;  3L17 A;  4ILG B;  4WIP A;  1DDW A;  3TEX A;  4KIK B;  3T3N A;  2LMC A;  5BMH A;  3TEY A;  3OG5 A;  3EHV A;  5I2S A;  1R4N B;  3ENB A;  5IA7 A;  2I1K A;  2R09 A;  2EKI A;  3ODX A;  1TY0 A;  2KZR A;  1LO5 D;  3AMZ A;  3DOW A;  4I6P A;  4AOF A;  5G55 A;  3L0W B;  2V1Y A;  4PS7 A;  1YIW A;  1MVK A;  2PZ1 A;  4ZRP A;  4G11 A;  2LZ6 A;  4GLS C;  1FXI A;  1N5W A;  1VDV A;  3NZS A;  2C7H A;  2KHW B;  1AWE A;  1EF1 A;  2UU7 A;  3SBT A;  1J0W A;  2CJN A;  1HTO A;  3KH0 A;  3OAN A;  1YJJ A;  2ZPN A;  2N0S B;  2FCQ A;  3NWD A;  1FGZ A;  3WYF B;  1K50 A;  3HIZ A;  3GB1 A;  1M94 A;  1FFV A;  1SEB D;  1FD6 A;  4HVB A;  4MH0 E;  2M0A A;  4CQN A;  1SGH A;  2BWF A;  2CS4 A;  4W9F A;  3DXC A;  3W1S A;  2BB5 A;  1KLU D;  3HM3 A;  2P0F A;  1QZE A;  4L1B A;  2G9H D;  4HEA 1;  2FIF A;  4OZB A;  4M8N A;  2HE7 A;  2LGX A;  2RVB B;  3L16 A;  2K3U A;  2JSV X;  1WZ0 A;  4XZ4 A;  2IBI B;  4YSZ B;  4ANV A;  2L3Z A;  3CIK A;  3B1L X;  1FXA A;  5J18 A;  2W82 A;  3HIE A;  1IPG A;  4KGT A;  2B76 B;  3P1M A;  2NCN A;  3DCG A;  1M4V A;  3BYT B;  1ISN A;  2KFJ A;  3RN9 C;  2I5C A;  1FNU A;  3IBE A;  2K22 A;  2MJD A;  2OED A;  1QT9 A;  3AEG B;  3BZD B;  5JHH A;  2YVC A;  2D9W A;  1YN3 A;  2WXO A;  3P2B A;  2ONQ A;  1J19 A;  1KZG A;  2LG1 A;  1OTR B;  2Z8L A;  4IDI A;  2LGS A;  1L6V A;  3KWV A;  5JVL A;  2XQN M;  2SEB D;  4HDQ A;  3KRX A;  4GPT B;  2WXI A;  1A5R A;  3FKY A;  1KOT A;  4NAW A;  5FI1 A;  5DCN A;  2YEP B;  4IWP A;  3RFZ B;  3DQV A;  3W1S C;  2L1A A;  4CYE A;  1KZ7 A;  1RAX A;  3KYC D;  2R2O A;  1WG7 A;  4OT1 A;  3ODW A;  3LYY A;  3PLU A;  4W9I A;  1MG8 A;  2DZK A;  4XX5 A;  2N4F A;  3ZRF A;  1Q5W B;  4ANW A;  2MDX A;  2KGX B;  2M8S A;  2D07 B;  4R3D A;  2JU6 X;  4IFS A;  1IBX A;  2KC2 A;  5BYR A;  2KAC A;  3M63 B;  4K3B A;  1Y56 A;  4XWT A;  4A6H A;  1J7A A;  1V9J A;  1V5T A;  2RQ1 A;  3RNG C;  3MJW A;  2IO1 B;  5FI0 A;  2DFK A;  1OGW A;  2V9H A;  4EMO A;  2EKE C;  2AL6 A;  1AW7 A;  2AX5 A;  1J0G A;  1YN4 A;  2ACZ B;  2BBC A;  3OHM B;  1SE4 A;  5LXH A;  4JKG B;  2R82 A;  3Q8C A;  2LOX A;  4NZL B;  2GCL A;  2Y5C A;  4M0W A;  3O96 A;  1FEH A;  4EZJ A;  5HI1 A;  4CHM A;  4DBB A;  1I2H A;  1ZPS A;  5EE0 A;  3VIA A;  4YT0 B;  3W5U B;  2GOW A;  3E9O A;  1J8C A; 
#chains in the Genus database with same CATH homology
 4LJP B;  3N7C A;  3RUL A;  1JDE A;  2DZJ A;  1TTN A;  5KHQ A;  3SNH A;  2CU1 A;  2KX0 A;  3JW0 X;  2GMI C;  3L08 A;  3TMP B;  4WVF B;  2K6D B;  3ODO A;  1E8X A;  3RT3 B;  5JLJ B;  5DH9 B;  3KUZ A;  2HJ8 A;  1UNR A;  1PLS A;  3KYD D;  4HCP B;  4HPL B;  4EEW A;  3FM8 C;  2Y5B B;  1P5T A;  3PLV A;  2N0Y A;  2KQ7 A;  2RD0 A;  5HKH A;  3WIM A;  1GJZ A;  3VHT C;  1NVL A;  1E5W A;  2BF8 B;  4DK5 A;  1UEL A;  5GMV A;  1WJU A;  1G6J A;  3A98 B;  5GOW B;  3DPD A;  1T0Y A;  4OVU A;  2DHJ A;  1FXT B;  1YX6 B;  2KTR A;  1W1G A;  4HLE A;  5KQ1 A;  1BAK A;  1WRD B;  2J0J A;  2CAY A;  4FHJ A;  4GU2 A;  5C6R A;  2FDQ A;  4A3O A;  2BGF A;  5D7G A;  4IM3 A;  3PSC A;  4BBN C;  3VTV A;  1UD7 A;  4NQL B;  1HE8 A;  2IYD B;  4KIK A;  1I42 A;  2L0T A;  2MWN B;  3AI5 A;  1V49 A;  1TZ1 A;  2NS5 A;  3SO6 A;  1OQN A;  1U2B A;  4WJ7 A;  1EAZ A;  3ZNG C;  1HBK A;  4GZU A;  2RSG A;  3QBV B;  3R66 C;  4LCD E;  3L13 A;  2V4L A;  2CHX A;  1ACA A;  2NPT A;  4HJK A;  2ZVO A;  3JYU A;  3V5W A;  1R4N I;  4JL9 A;  4W9H A;  1WE6 A;  5JHG A;  1X1F A;  2MCN B;  1P9D U;  4DHJ B;  3K9P B;  4AP4 C;  3D8D A;  2UVM A;  4A6F A;  2R2Q A;  5J2R A;  2W2X D;  2MBH A;  3ZNI D;  1H4R A;  1KC7 A;  4N9F 4;  4HB0 B;  3R7R A;  4JKE A;  2ZNV C;  2KK8 A;  2KQS A;  2HD5 B;  1WYW B;  1MAI A;  5KHO A;  1WGD A;  1TBE A;  3HM6 X;  2LGD A;  1TQZ A;  3VDZ A;  2L00 B;  3T9L A;  3QK0 A;  2Z0E B;  3SU8 X;  1M7R A;  3QX1 A;  3AXC A;  3A33 B;  4DDI D;  2N9X A;  1RLF A;  5D3V A;  3APF A;  1LM8 B;  3SD5 A;  4W9K A;  5HE3 A;  1HB8 A;  3TO1 A;  4Z2M B;  1E8Z A;  4EJN A;  2YSZ A;  4M8M A;  1NDD A;  1WR1 A;  2G4S A;  5TR5 A;  3KZ1 A;  4B9K A;  4FLH A;  3MDB C;  3IFW B;  1XT9 B;  4JK8 A;  5E6O A;  4F7U P;  1KBL A;  1P3Q U;  1V5U A;  4GIV A;  2PE9 A;  2ZPY A;  3W1Y A;  3KVF B;  1V5M A;  3RUI B;  4NNJ B;  5DPT A;  3VQI A;  2JF5 A;  5C5B B;  1X1G A;  4FAD A;  3PVL A;  4F7G A;  1TJ6 A;  3O65 B;  3QIJ A;  5J3Y A;  1WXA A;  4MDK E;  2LRU A;  3G9W A;  1BTK A;  2KN5 A;  2DA0 A;  2K6Q A;  5DHA B;  3A4S C;  1XQQ A;  1U27 A;  4PQ0 A;  2KO3 A;  4JLC A;  3QA8 A;  2DLW A;  3ZIM A;  2PEA A;  4DHZ B;  3ULB A;  3PZD A;  4L6E A;  3A1Q B;  2FJL A;  2AWT A;  1YQB A;  4TKN A;  2DN6 A;  2G4D B;  3APD A;  5E6N A;  2CHZ A;  2QKM A;  1RRP B;  4ZRI A;  2KDF B;  2JXX A;  3PT2 B;  2MRP A;  1ZVR A;  3T8M A;  3GOE A;  2VSZ A;  4WWO A;  3TVV A;  1EUV B;  2D2Q A;  3A9K B;  4DX9 0;  4ASW C;  3VUY A;  2NBU A;  3ZW3 A;  2EMT A;  1WMH A;  3SUZ A;  3A9J A;  5IJM A;  2IFS A;  4KDL B;  3E9P A;  3DBS A;  2MX2 A;  3EFU A;  2DKP A;  4EZL A;  4ICU A;  3VTW A;  4BBK A;  2Z0P A;  3X0W A;  4DXA B;  4ZYN A;  2Y8G A;  1P98 A;  4BKT A;  2K2U A;  5D3Y A;  1PQS A;  4F1S A;  2P8V A;  2DX5 A;  1V89 A;  2CRF A;  3EEC A;  3H7P A;  2RLO A;  2RNR B;  2MQJ A;  3DBR I;  4MM3 A;  4B95 A;  2ZZP B;  4XWX A;  2BYE A;  4W9L A;  3FP5 A;  4PS3 A;  1L2N A;  2DHK A;  5D94 A;  5JHA A;  1PMS A;  2GBN A;  2FCS A;  2LVP A;  3QAR A;  3KW5 B;  1FGY A;  1Y5O A;  4LDT D;  2KMA A;  1WX8 A;  3S2A A;  4CHK A;  4MSQ B;  4A6K A;  2MP2 B;  4MEL A;  3PS6 A;  2MBB B;  2BKF A;  3ZNH B;  3UQB A;  1L7Y A;  2DYO A;  4IAP A;  2N7E A;  1Z2M A;  3FEH A;  2AYO B;  4I6L B;  1UEF A;  3DVN U;  1DDV A;  2DAF A;  5IAA C;  3UIN B;  2MA9 B;  2JWZ A;  3M3J A;  5KCV A;  3DXE A;  1MIZ B;  1XKE A;  2COC A;  1P3R A;  2NPT B;  2N7D A;  1NU2 A;  4ZDV A;  1PFJ A;  4GN1 A;  1QC6 A;  2BCJ A;  3HK0 A;  4Z2N A;  2K25 A;  2KTF A;  1LW3 A;  1NBF C;  3MPX A;  2A4Z A;  3B0A A;  2ZJD A;  1Z87 A;  4MK0 A;  4JIO U;  1LQB A;  1UGM A;  2KXJ A;  2KLG A;  2JY6 A;  1WXM A;  4NPN A;  4TV3 A;  2V76 A;  4FBJ B;  4JKH A;  2DIK A;  4IWQ A;  2BYF A;  2RPQ A;  3NS8 A;  1WGQ A;  3L54 A;  3X23 A;  2O2V B;  4HWI B;  5DPW A;  2CY5 A;  3AU5 A;  1KM7 A;  2D10 A;  4GDL A;  1HB6 A;  4K2P A;  3D8E A;  2DZM A;  2LUL A;  1WGH A;  2IO0 B;  2KX3 A;  3M1I B;  3RZF A;  3UZT A;  1WR6 E;  1Z5S B;  3NOB A;  1B55 A;  2L76 A;  4WJP A;  2N9E B;  1WY8 A;  4A20 A;  2MSE D;  4K17 A;  5D27 A;  1UNQ A;  2CQU A;  4C0A A;  4ILH A;  4F7Z A;  1X11 A;  1LXD A;  1ZKH A;  2A5U A;  3KRW A;  1ZC3 B;  2LXA A;  3WAL A;  3D32 A;  1VBH A;  4MJS B;  2KTR B;  4D0N B;  3A9J B;  4RM8 A;  1WMH B;  4IOY X;  1IP9 A;  4TQ1 A;  1XX0 A;  2LBB A;  4KZ0 A;  3OJ3 A;  2PJH A;  1N3H A;  3H1U A;  4Y94 A;  2VRW B;  2YF0 A;  3CSF A;  3H6N A;  2D11 A;  4F7H A;  3CMM B;  4PYZ A;  1GG3 A;  1V88 A;  2COA A;  4GB9 A;  2M4N A;  4XC2 A;  3N3K B;  4G0N B;  1V6E A;  4URK A;  4AJY B;  5DIF B;  2LUE A;  2Q13 A;  3M62 B;  1UPQ A;  4WWP A;  1JRU A;  3ZTC A;  4MT7 A;  2K8C A;  3HW2 B;  2ZNV B;  5DHF B;  4ANX A;  5L83 A;  1XR0 B;  4HAW B;  4KV2 A;  2MBO A;  3ZDT A;  4TQ0 A;  4WSF A;  4IC7 B;  2M0X A;  4DDG D;  5EDS A;  1X1M A;  2HRJ A;  2O2V A;  3ULC A;  1V86 A;  2MFQ A;  2JUO A;  1WH3 A;  1ST7 A;  3VUX A;  4W9J A;  3BJI A;  2FNJ B;  2WWZ A;  2FCN A;  3DBH I;  4RM9 A;  1WJN A;  3DXD A;  2GBK A;  1E7V A;  3TL5 A;  2W2X C;  4E3C A;  2UWQ A;  1UBQ A;  4JKG A;  2GBR A;  2YS3 A;  2DX1 A;  2PE6 B;  5DPS A;  4GXB A;  2FID A;  2DYB A;  3RYT A;  3QWZ B;  2BKR B;  2KMC A;  4KHB B;  3DVG X;  1NTI A;  1UNP A;  4II3 B;  2NZ8 B;  2L05 A;  1EF5 A;  2KWV B;  4NJ7 A;  2J0K A;  4PNK A;  3D8F A;  2P0D A;  2DTC A;  3Q3F A;  2YLM A;  2FJ9 A;  3V62 A;  4W9E A;  1WJM A;  4YON A;  1WGG A;  2LAS A;  2M17 A;  2KAN A;  4IUM B;  1GNU A;  4BVU C;  5CLQ B;  1WM3 A;  4K81 A;  2WYQ A;  1YD8 U;  1EVH A;  4MEM A;  2DEN B;  5FR6 A;  3TIX A;  3T06 A;  1P1A A;  4KVG B;  1XCG A;  4AWJ A;  1U5F A;  2D3G A;  4JGH B;  4MSM B;  2WH5 A;  4GDK B;  2AL3 A;  1K5G B;  1W1D A;  5LLI A;  3TFM A;  1E8W A;  3PRM B;  4YL8 A;  5L95 C;  2UYZ B;  3WA0 A;  5J3T A;  3QC8 B;  2J7Q B;  3BIN A;  2HTH A;  5CHW A;  4A5K A;  1CMX B;  2I5F A;  4IM0 A;  2XBB C;  2LGY A;  2O6V B;  2DYQ A;  2KCJ A;  2ASQ A;  2G3Q B;  2IO3 B;  3FSS A;  1Y19 B;  4KSL C;  4GMX B;  3TBL D;  5C5B A;  1MPH A;  3U8Z A;  2M1M A;  3OAW A;  2MWS B;  2CY4 A;  5C16 A;  2DHZ A;  4HB2 B;  2ABD A;  4E71 A;  5C1Z A;  1S1Q B;  1E7U A;  3IHP C;  3QQ8 B;  2D9X A;  5CTR C;  2COP A;  4WWN A;  1DDM A;  4HHV A;  1XOD A;  3PGE A;  1DIK A;  4BKS D;  4W9G A;  2ROZ B;  3E66 A;  2DYM A;  4A3P A;  3GZN I;  2KFK B;  1WVH A;  2O6V D;  5DPR A;  2B3A A;  4TYZ A;  1U4A A;  2DZI A;  1NI2 A;  2C7M B;  2KNB A;  1KJT A;  1V5P A;  4LDT B;  4NJ6 A;  3VTU A;  3PTF C;  3QWM A;  2KJR A;  4IW0 A;  1WZ3 A;  2CB8 A;  4FA6 A;  4A6F B;  3SDL C;  1EO6 A;  3PRZ A;  2M38 A;  1V5O A;  1GC7 A;  3ZNZ B;  2YS5 A;  3SV1 A;  3ZTD A;  4JKA A;  2DHI A;  2J59 M;  4KHO A;  2COF A;  3ZVV A;  4MJS A;  5CHV C;  2L8J A;  2UZS A;  3KY9 A;  3TCA A;  2KUP A;  5DI9 B;  4NAW B;  1LB1 A;  1MKE A;  3VUW A;  4DX8 A;  2ELA A;  5JZE B;  2NBV B;  1ZSQ A;  2WX0 A;  3PG7 A;  3PV1 A;  2G45 B;  1WXV A;  5EFX A;  1ZGU B;  1FHW A;  3MTN B;  4MGZ E;  3LDZ E;  3I3T B;  3CF6 E;  2KVR A;  2LVQ A;  4FHK A;  4KSK C;  2LYD A;  2IY0 B;  1GC6 A;  5HE0 A;  1WI0 A;  3E9L A;  1QQG A;  3HHM A;  2CKH B;  4JK9 A;  3WAP A;  2W2W A;  1WJ1 A;  3PHW B;  2V3S A;  4WJQ A;  1R4M I;  3HQC A;  1C3T A;  3ML4 A;  2JRH A;  4K7W A;  3NHE B;  5CLL B;  1GUA B;  4IM2 A;  2PPH A;  1V61 A;  3ZUN A;  2LVO A;  4MGK E;  4ANU A;  5G2N A;  3TJP A;  1FAO A;  4JKC A;  3LJU X;  5JP4 A;  3C0R B;  2UZR A;  3PP2 A;  1VBG A;  4HB4 B;  3KSY A;  2NBW B;  2ZCB A;  1SHC A;  3DVN V;  3APC A;  2HTH B;  3EC8 A;  2IO2 B;  1BTN A;  4B6H A;  2GJY A;  2CHW A;  4HXD A;  1V80 A;  4BOS C;  3P6A A;  4EOY A;  3ZLZ A;  1WJ6 A;  4MGY E;  4BBN F;  2Z59 B;  2XK5 B;  4K7S A;  3U30 A;  2R0D A;  2D9Y A;  2N1V A;  5CX3 A;  1DRO A;  1NTV A;  3ENE A;  2O6V A;  3UF8 A;  2LD9 A;  2N9P C;  1F9J A;  5C79 A;  1DBH A;  2IZV B;  1NTY A;  2MBE A;  2Z0O A;  2BPS A;  2DX5 B;  2JZZ A;  5CHF A;  3A8Q A;  3NSU A;  2LKO A;  5J3Q A;  3NY5 A;  3ML8 A;  3N32 A;  4DBG A;  3V60 A;  2BYV E;  2LJ5 A;  2KFK A;  5J17 A;  4ICV A;  4B6W A;  4JKF A;  3UQA A;  2Z0D B;  2RSU A;  3R3M A;  3AUL A;  4CHJ A;  3PRE A;  4HB3 B;  1WJ4 A;  5AZF A;  1WF9 A;  1K8R B;  2ZEQ A;  2REX A;  2GS0 A;  1AAR A;  2L7R A;  1ZM0 A;  2OQB A;  2MKR A;  4RMA A;  2ELB A;  1AQC A;  1K5D B;  4K2O A;  2I1J A;  2FUH B;  3VOQ A;  3WAM A;  4AUQ C;  3ECI A;  2LOZ A;  2RUK B;  4MY6 A;  4DWF A;  4G3X B;  4GSW A;  1KLV A;  2DKQ A;  2D9Z A;  2YS1 A;  3V6E B;  2G35 A;  3DVG Y;  4GOC A;  2QHO A;  2LRW A;  1RFA A;  2GCJ A;  3VXW A;  2KC1 A;  1U5E A;  1U29 A;  2K00 A;  2XEW A;  4EFO A;  1Q1O A;  4GDK A;  2JT4 B;  3AU4 A;  2RGN B;  2LI5 A;  3GYO A;  1YX5 B;  1ZC4 B;  2RR9 A;  3UGB B;  3M95 A;  3RD2 A;  3WAO A;  2KLC A;  4BKG A;  1WIA A;  2DAJ A;  4FJY A;  4HK2 A;  2K8B A;  2D9V A;  2JZ3 B;  2MBQ A;  2JRI B;  3BY4 B;  3ONS A;  2KD0 A;  3ZO5 B;  3JSV A;  1W1H A;  1C1Y B;  3VVW B;  4ZRJ A;  5LXI B;  1WGY A;  2IYB A;  2L2I A;  1SE9 A;  2JVC A;  3RCZ A;  4HAY B;  3WAN A;  5E6P A;  1LFD A;  2LWP A;  2KJ6 A;  5HE1 A;  2C5L C;  2E2X A;  3R7Q A;  2DYN A;  2WDT B;  3JSV B;  1OEY A;  3KUC B;  4WQO B;  2FCM A;  4EZK A;  4H8S A;  1OQY A;  3DBL I;  4PS8 A;  1I7A A;  2GBM A;  2KKC A;  3GYP A;  2KWC A;  1FHX A;  1MK7 B;  2H7D A;  1V81 A;  3B08 A;  1XD4 A;  1UBI A;  3UIP B;  2GBJ A;  4JKD A;  2Y8F A;  4FN2 A;  5D3W A;  4FUL A;  1P6S A;  4KZC A;  4WAA A;  1WM2 A;  4FJV B;  2OTX A;  2FAZ A;  4EUT A;  1BWN A;  3QCA A;  3ML9 A;  4JQW C;  1UZX B;  5AZG A;  4JK7 A;  3JVZ X;  2W9N A;  1DYN A;  4I6N B;  4K1R B;  3SBG A;  1Q0W B;  1YJ1 A;  2J0M A;  2BWE S;  2KWU B;  2EJ8 A;  1X05 A;  3U7D A;  4MGI E;  5C23 A;  2OOB B;  4WJN A;  5AEK B;  2EC1 A;  5KQ4 A;  3SYX A;  3VH4 B;  2L0F A;  2WX1 A;  1MK9 B;  5LOP B;  1RRB A;  4BKS A;  4HAV B;  2KDE B;  2NVU I;  3VH3 B;  2K39 A;  1FOE A;  2C60 A;  4II2 B;  1VCB A;  3SHQ A;  3ZDM C;  3NZU A;  3V61 A;  4BOZ B;  2ADZ A;  3H9D A;  2H7E A;  2CR5 A;  2X0S A;  1FB8 A;  1H10 A;  1TGZ B;  3A4R A;  3F0W A;  5HE2 A;  1IYF A;  1UH6 A;  4HCN B;  3AJ4 A;  2JP2 A;  1WX9 A;  4KAX B;  2YT0 A;  4E74 A;  1OY2 A;  1S3S G;  2N1W A;  3N30 A;  2LXC A;  5L81 A;  3CST A;  4ILJ A;  4W9C A;  3Q3J A;  2MLB A;  2VKI A;  3PEG A;  2COD A;  2KDB A;  4HPM B;  2Z0Q A;  2QKL A;  3UIO B;  3QAQ A;  3CXB B;  3A1Q A;  2NMB A;  1OMW A;  4AJW A;  1GGO A;  3TW1 A;  2YT1 A;  2ZCC A;  3PVW A;  4KDI C;  2EMS A;  2MP2 A;  1EGX A;  1Y8R C;  2C7N B;  1XD3 B;  2YRY A;  4HAU B;  3ZVR A;  4LJO B;  2AEH A;  2L1C A;  1Q67 A;  4EKU A;  1U5D A;  4FJZ A;  4W9D A;  2X18 A;  1OEY J;  1SIF A;  2K1F A;  3PHX B;  1WX7 A;  5JHB A;  3H7P B;  4PYU A;  3MHS D;  1WGU A;  4JKB A;  4HAZ B;  2K2J A;  4P7I A;  3K9O B;  2K8H A;  4DHJ D;  2ROV A;  4NSW A;  4HDO A;  2MW5 A;  3RCP A;  3RZW C;  5D6J B;  4NY0 A;  5AZH A;  3FLV A;  3VFK A;  3L10 B;  4HAT B;  3ZKJ C;  1KI1 B;  1WXS A;  1M7E A;  2JPH A;  3A9K A;  2NR2 A;  4GMV A;  3QHT A;  1U5G A;  4GGQ A;  5BO4 B;  3IVF A;  3P7Z A;  1RJ2 A;  2KDI A;  1P0R A;  2KOX A;  3OLM D;  1FHO A;  2OJR A;  4KHA A;  3A8P A;  5D2M B;  3ALB A;  4NQK E;  4TUU A;  4ZRK A;  3OJ4 B;  4K7U A;  1D3Z A;  4X57 B;  3ZRC A;  5D3X A;  3V6C B;  1VD2 A;  1E90 A;  4BFR A;  4M0W B;  2KJH B;  3KUD B;  3QJZ A;  4F8C B;  2ZVN A;  4OVV A;  2RGF A;  3IG3 A;  2C9W B;  4G50 A;  3PSE B;  3H7S A;  4J6I A;  1TXD A;  2D4Q A;  1WGR A;  4IWO A;  1BT0 A;  3F5R A;  3PPA A;  2XK5 A;  1E8Y A;  3VAW A;  4CO7 A;  1IRS A;  4DHZ E;  1X86 A;  4IG7 B;  3DDC B;  2VRR B;  5JH5 C;  1MIX A;  4HAX B;  2IY1 B;  1V2Y A;  1ZW7 A;  3EPY A;  2P0H A;  2Y7B A;  4GDL B;  2M14 A;  2N23 A;  1WE7 A;  3PVU A;  4WJO A;  1I35 A;  1WFY A;  5LON B;  1UPR A;  3LJ3 A;  3PRP B;  1WI1 A;  1H8C A;  3L17 A;  4ILG B;  1DDW A;  4KIK B;  3EHV A;  5IA7 A;  3ENB A;  2I1K A;  2R09 A;  3ODX A;  2KZR A;  3DOW A;  4I6P A;  4AOF A;  5G55 A;  3L0W B;  2V1Y A;  4PS7 A;  1YIW A;  2PZ1 A;  4G11 A;  2LZ6 A;  3NZS A;  2C7H A;  2KHW B;  1AWE A;  1EF1 A;  3SBT A;  1J0W A;  3KH0 A;  3OAN A;  2ZPN A;  2FCQ A;  1FGZ A;  3WYF B;  3HIZ A;  1M94 A;  4HVB A;  4MH0 E;  1SGH A;  2BWF A;  2CS4 A;  4W9F A;  3DXC A;  3W1S A;  3HM3 A;  2P0F A;  1QZE A;  2FIF A;  4M8N A;  2HE7 A;  2LGX A;  2RVB B;  3L16 A;  4XZ4 A;  1WZ0 A;  2IBI B;  4ANV A;  2L3Z A;  3CIK A;  3B1L X;  5J18 A;  1IPG A;  2NCN A;  3DCG A;  1ISN A;  2KFJ A;  2I5C A;  3IBE A;  5JHH A;  2YVC A;  2D9W A;  3P2B A;  1J19 A;  1KZG A;  2LG1 A;  1OTR B;  5JVL A;  2XQN M;  4HDQ A;  3KRX A;  4GPT B;  1A5R A;  1KOT A;  4NAW A;  5FI1 A;  5DCN A;  4IWP A;  3DQV A;  3W1S C;  4CYE A;  1KZ7 A;  1RAX A;  3KYC D;  2R2O A;  1WG7 A;  4W9I A;  3ODW A;  3PLU A;  4XX5 A;  1MG8 A;  2DZK A;  2N4F A;  3ZRF A;  1Q5W B;  4ANW A;  2MDX A;  2KGX B;  2M8S A;  2D07 B;  4IFS A;  2KC2 A;  3M63 B;  4A6H A;  1V9J A;  1V5T A;  2RQ1 A;  3MJW A;  2IO1 B;  5FI0 A;  2DFK A;  1OGW A;  4EMO A;  2EKE C;  2AL6 A;  1J0G A;  5LXH A;  4JKG B;  2R82 A;  2LOX A;  2GCL A;  3O96 A;  4EZJ A;  4CHM A;  4DBB A;  1I2H A;  3VIA A;  2GOW A;  3E9O A;  1J8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...