1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords radixin
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
1EF1A 5LLIA 1FHWA 1FOEA 4F7ZA 3L08A 1UELA 3N32A 1X1MA 1X86A 3SDLC 1LB1A 1WVHA 4IM3A 1Z2MA 4OVUA 3K9PB 2A5UA 1IRSA 4W9KA 4XZ4A 3LDZE 4ZRJA 2L7RA 3QK0A 2KWVB 3H1UA 1E7UA 2D2QA 1Q0WB 2FCNA 4TKNA 1XODA 1U27A 1U4AA 1V5OA 3O65B 2FCSA 3OLMD 3WAMA 3PLUA 3OAWA 4IWPA 3MHSD 4ANWA 2N7DA 2KDBA 2AYOB 2CHZA 4A5KA 4HXDA 4KHAA 4K7UA 2K6DB 3F5RA 2CHXA 1TGZB 3ZRCA 2Z0DB 1NDDA 3CF6E 2DKPA 2OTXA 2N7EA 1K8RB 4KIKB 1XT9B 3PP2A 4E74A 3BINA 2ROVA 2WDTB 2MRPA 4DHZE 5KCVA 5JHHA 2BYEA 2J59M 1L7YA 2YF0A 4IWQA 2RPQA 4FHJA 2CU1A 4GSWA 4EZJA 3U8ZA 1V86A 1WGUA 3RT3B 5C5BA 4WJ7A 3W1YA 3FM8C 3ML8A 1AQCA 3ONSA 3UQBA 3S2AA 5E6OA 2IO1B 2EKEC 3MPXA 1U5DA 1CMXB 2COAA 1WGYA 4F7GA 4MK0A 1WX7A 4K2OA 2MBQA 1V81A 3VUXA 2MBOA 4JLCA 5JHGA 2N9PC 1WX9A 3U30A 2BGFA 1SIFA 4Z2NA 4HPMB 4WJQA 4DDGD 2QKMA 1V5PA 3KH0A 2AL3A 1UGMA 2H7DA 4YONA 1QZEA 2ZNVC 3RCZA 1K5DB 5CTRC 2W9NA 1ISNA 1WJ1A 3DBHI 4LDTD 2IYBA 2LXCA 1WI0A 5HE0A 4AUQC 4MY6A 3TW1A 3TBLD 1U5FA 1MPHA 2K8HA 1XX0A 2RLOA 4DX8A 3WA0A 2DTCA 1RLFA 4NJ7A 2KCJA 4HATB 3RULA 2K39A 3PG7A 4GDLB 2KLGA 1J8CA 2M17A 2NPTA 3A1QB 3ZIMA 1H10A 3ZKJC 2M14A 2DAFA 2KX0A 2DYQA 3TIXA 3U7DA 5KQ4A 1FHOA 2JZ3B 3ZNHB 3PEGA 2V1YA 4MGIE 3CSTA 3ML4A 1S3SG 4FJVB 3WANA 1WGRA 2MBHA 4KVGB 4BKTA 4ZRKA 2GOWA 1OQNA 2UZSA 4EJNA 2Y7BA 1WZ3A 4GU2A 1Q67A 3TCAA 4EOYA 2KMCA 4W9CA 2P0HA 2BF8B 2JF5A 1Q5WB 3PRMB 4G50A 5IJMA 1A5RA 4BFRA 4ANUA 4HDOA 5CLQB 2D9ZA 4LJOB 4HJKA 2O6VB 4GDKA 4GOCA 2LOZA 3N3KB 3VUWA 5D3VA 2ZZPB 3KSYA 1NI2A 4W9GA 1V80A 4CYEA 3OJ4B 1X1GA 4ZRIA 1FHXA 1FXTB 1OQYA 2KANA 1ACAA 4NJ6A 2EC1A 5D3YA 3SNHA 2CRFA 2V76A 4KDIC 4H8SA 2K1FA 2KJHB 3PREA 3TO1A 4HWIB 2L0TA 4FJYA 2DHIA 2JPHA 1D3ZA 1HBKA 3ZRFA 2KKCA 1EUVB 2KK8A 1WXSA 3X0WA 3VQIA 2I5FA 3KVFB 2LGXA 5CHFA 1GC6A 3OANA 1ZM0A 2PE9A 3QCAA 3PRPB 1QQGA 4PS7A 2Z59B 1M7EA 3A4SC 2YS3A 2RQ1A 2AEHA 2DA0A 4GPTB 1UNRA 1GC7A 4IC7B 1NTYA 4MM3A 4GB9A 2PZ1A 2IO0B 1OEYA 3K9OB 4KAXB 4HPLB 2FNJB 2R0DA 1WJUA 2L2IA 2M4NA 3LJ3A 4G11A 3ULCA 2NCNA 3KUCB 1OTRB 3UIPB 3N7CA 3ZDMC 1WXVA 1EF5A 1HE8A 1PFJA 2LVPA 4FA6A 3IBEA 2L76A 1KZ7A 3B1LX 3QAQA 1DDVA 1E8WA 2KD0A 3M3JA 1UNQA 1J0WA 2ADZA 2L3ZA 3TVVA 3C0RB 3VH3B 4TQ0A 1GG3A 2J7QB 1R4NI 3L0WB 3MJWA 2JVCA 5HE1A 2DENB 3PV1A 1C3TA 4KIKA 4RMAA 2KDFB 2IYDB 1WGGA 2C7HA 1J19A 1ZSQA 2AWTA 1WM3A 3P6AA 3P7ZA 4TYZA 2O2VB 2FJLA 2ZCBA 4GN1A 2KJ6A 4GMXB 2K6QA 2KDIA 4URKA 3G9WA 4NAWB 1MG8A 2D10A 3MDBC 2KMAA 3DVNU 1UPQA 2FCMA 4A6HA 4EMOA 1TBEA 5AZFA 2W2XC 3NZUA 3ZLZA 2GBJA 3EPYA 2R2OA 2KWUB 3L17A 4HCNB 2A4ZA 3APCA 5IA7A 3ULBA 3QBVB 2M8SA 1YX5B 2RNRB 3HQCA 5DIFB 5JHBA 4HAYB 5IAAC 1M7RA 4MJSB 1V2YA 1ZC4B 2E2XA 5D94A 4KSLC 4W9JA 1OGWA 1U2BA 1MKEA 1S1QB 2GBNA 3NZSA 5DI9B 1RRBA 2KDEB 1WE7A 2KUPA 2ZPNA 4A6KA 1R4MI 3A9KB 3R66C 4JIOU 4PYZA 3WAOA 3VTVA 4LDTB 1LQBA 4GDLA 3A1QA 4J6IA 3D8EA 3ZW3A 4NNJB 4HAZB 5CHWA 5E6NA 2DX1A 4AOFA 3A33B 2MDXA 2ZEQA 3PTFC 2ABDA 5CX3A 4AJYB 2BYFA 2IZVB 2BKFA 1LXDA 2DYOA 4HVBA 3VXWA 1WZ0A 4HAWB 2IBIB 2KC2A 2MSED 4GGQA 1NBFC 4E71A 2K8CA 4K81A 3B0AA 2D4QA 2DZIA 3A98B 3HW2B 1WFYA 1E8XA 1N3HA 2CQUA 2D3GA 2DYMA 4IM2A 3L16A 4FULA 3PSCA 1DROA 4TUUA 2WX0A 1X11A 2YT0A 4PQ0A 3H7SA 1C1YB 4AP4C 2O6VA 4HHVA 5J17A 1WG7A 2LUEA 3NHEB 3A4RA 3H7PB 4MELA 1ZC3B 1LM8B 2COPA 3M63B 5LOPB 1TZ1A 5GOWB 3DCGA 1B55A 4ANXA 1E8YA 4K1RB 1KM7A 3M62B 1I7AA 3VVWB 1IYFA 5LXIB 4CO7A 3BJIA 4B95A 1ZVRA 4MH0E 2RR9A 2KVRA 1WGHA 3RUIB 1WMHB 3KUZA 3VAWA 2K25A 4G3XB 2DYNA 1WRDB 1IPGA 4WWOA 2MLBA 1TTNA 3R3MA 2UWQA 2NS5A 3A8QA 3GZNI 4W9EA 1XKEA 3VH4B 1V9JA 4WAAA 4OVVA 3FLVA 1OMWA 2I1KA 1UD7A 4FADA 5J3YA 2Z0QA 3OJ3A 3A9JB 2KQSA 2LXAA 4WJPA 5J2RA 2JZZA 1E90A 1Z87A 2DHZA 2RD0A 2YRYA 5L95C 1TXDA 2HD5B 5DPTA 1XD4A 1WM2A 4D0NB 1V88A 2KTRB 5C79A 1XD3B 2D11A 2JUOA 1WJNA 3H6NA 2D9VA 4F8CB 3AULA 1V5UA 4M8NA 1YD8U 3WIMA 2LGYA 1E7VA 2FIDA 2RVBB 1V5TA 4I6PA 1WY8A 5JH5C 4ICVA 2MW5A 4XC2A 3DXCA 3DVGY 3PVUA 2MP2B 2GJYA 1FAOA 2CR5A 3IHPC 1P98A 1KOTA 3Q3JA 2K00A 2GBMA 2LRWA 2KNBA 1E5WA 3PRZA 3APDA 1TQZA 2BWES 1HB8A 4BKSD 1KLVA 4PNKA 3A8PA 3VDZA 3GOEA 2UVMA 3RYTA 4EZKA 2JP2A 4CHMA 2XK5A 3PPAA 2CY4A 5DHAB 5EFXA 2O2VA 2MBEA 1UBQA 3DVNV 2PE6B 1GUAB 2LBBA 2GBKA 3JVZX 5L83A 4AWJA 4L6EA 5FI1A 1NVLA 3QX1A 2LOXA 2LVQA 5C1ZA 4NAWA 4XWXA 2AL6A 2MX2A 2N9EB 3CSFA 4MSQB 1EO6A 3UIOB 2PEAA 2NBWB 1MIXA 4W9LA 1RAXA 1J0GA 5CLLB 5DPSA 2IO2B 3D32A 2L1CA 1W1GA 2DX5B 3BY4B 3JSVB 4MJSA 2KQ7A 4IM0A 5C6RA 3SUZA 2KX3A 2C5LC 4RM8A 1P0RA 1JRUA 3QIJA 1MAIA 4WJOA 3F0WA 3DBRI 2DZJA 2YLMA 3M1IB 1NTIA 3PS6A 4ZDVA 3T9LA 4EUTA 4BKGA 3QA8A 3A9KA 5HKHA 4MEMA 2Z0PA 3VFKA 4FHKA 4B6WA 4FN2A 3DXEA 5BO4B 3SV1A 2G4SA 2REXA 4A3PA 1NTVA 3UGBB 1OY2A 3SYXA 4Y94A 5J3QA 2YS1A 4I6LB 2DZMA 2IFSA 2LYDA 5DPRA 1Y5OA 3DQVA 5KHQA 4HAVB 1V49A 3FP5A 2VRWB 1P3QU 2C60A 1UZXB 1I35A 4KV2A 4K7SA 2ZCCA 2Y5BB 5LONB 2R09A 1BTNA 1I42A 3ZTCA 1YQBA 2J0KA 2HTHB 2B3AA 3PSEB 3EFUA 5J3TA 3KUDB 3PLVA 4BBNC 5L81A 2FAZA 4BOSC 3L10B 3ALBA 1EAZA 2KXJA 3VHTC 1RFAA 4IWOA 4KDLB 3KY9A 4EEWA 5C23A 5DCNA 2XEWA 3TL5A 2JXXA 3DDCB 2M1MA 2DKQA 2L8JA 3H7PA 5J18A 2LG1A 4IOYX 2MCNB 2I1JA 1P3RA 2EMSA 3VTWA 2GBRA 2DLWA 3V60A 4A6FB 3KYDD 2RSUA 4HK2A 1U5GA 3RZFA 1YX6B 3D8FA 2OQBA 3ZNID 2MBBB 4W9HA 4N9F4 2W2WA 2C7MB 1WGDA 2WX1A 2Z0EB 1LW3A 2D9XA 3IVFA 4DBBA 1XCGA 1WE6A 2L00B 3DOWA 4ASWC 4NQKE 1E8ZA 2YSZA 2NMBA 5DHFB 3PZDA 4II2B 2ZPYA 3A9JA 5D6JB 5DPWA 4XX5A 1WYWB 2N23A 2LVOA 3ZO5B 2KWCA 2VKIA 4KHOA 1P9DU 2LRUA 4PS3A 4EZLA 2N0YA 3DVGX 3PT2B 4EKUA 2CHWA 4DHJD 2G45B 1BT0A 1G6JA 2LZ6A 4Z2MB 1WX8A 2MFQA 1H4RA 1U29A 2C9WB 4NPNA 5D3WA 1V89A 3UQAA 1H8CA 2DYBA 2HE7A 2MP2A 2Q13A 5JZEB 3NOBA 3H9DA 4GIVA 3L54A 1I2HA 2DAJA 5AZGA 4F1SA 3ZNZB 2COCA 2M38A 4MSMB 3HIZA 1WIAA 4WJNA 2OJRA 1PMSA 2RSGA 2LD9A 2M0XA 2G3QB 1SHCA 1WJ4A 5KQ1A 1FGZA 5CHVC 4GMVA 3D8DA 4W9FA 2EMTA 4B6HA 2Y8FA 4KHBB 2ROZB 1M94A 1WR6E 1KJTA 1KZGA 4F7UP 5JLJB 3AI5A 3JW0X 4DX90 1ZKHA 2XBBC 4MGZE 4KZCA 3V6CB 2NR2A 1Q1OA 3GYOA 3KRWA 3W1SA 4PS8A 5EDSA 2HRJA 3RCPA 4C0AA 2P0DA 4X57B 2YVCA 2DZKA 1X1FA 3JYUA 3CXBB 2KTFA 2ELAA 1Y19B 1P5TA 2DX5A 4KZ0A 2EJ8A 1AARA 3JSVA 1VD2A 2IY1B 3UINB 2H7EA 2OOBB 3ZVVA 1W1DA 2G35A 2DHJA 2HJ8A 4ICUA 4MGYE 3QQ8B 3Q3FA 3M95A 2ELBA 3W1SC 4IAPA 1V6EA 1SGHA 4NQLB 1XR0B 3CIKA 3NSUA 2JT4B 2CODA 3ECIA 3QC8B 2X18A 5AZHA 1RRPB 3AU4A 2C7NB 3SU8X 2LULA 1F9JA 3KRXA 2PPHA 3CMMB 3LJUX 2JY6A 3VIAA 3EECA 2D07B 3DBSA 3O96A 4FBJB 2CY5A 4P7IA 2XQNM 4BBKA 2LASA 3ZVRA 2FUHB 3VUYA 3HM3A 2P0FA 5FI0A 2K2JA 3TFMA 3IG3A 3V61A 2ZJDA 3FSSA 2NVUI 2K2UA 4A20A 2QHOA 3KYCD 4NSWA 1BWNA 1BAKA 2CS4A 4DHZB 4GZUA 1Y8RC 3ODWA 3SO6A 2DN6A 3UZTA 2HTHA 5DH9B 3ML9A 2BWFA 1UPRA 1GNUA 3HM6X 4MGKE 2N1WA 4WWPA 2FCQA 2GMIC 2FJ9A 1DDWA 1BTKA 2JWZA 2P8VA 4WWNA 4HB4B 2LKOA 3GYPA 2IY0B 3MTNB 4DXAB 1YIWA 3V62A 4A3OA 3V5WA 1WXAA 4FLHA 3I3TB 2DHKA 4A6FA 3UF8A 2UYZB 1MK7B 5C16A 2LI5A 2R2QA 3QWMA 3QJZA 2KFKB 3WYFB 2NBUA 3B08A 3PVWA 1DYNA 3TMPB 4WSFA 2RUKB 5GMVA 3DXDA 2QKLA 3ODXA 5D2MB 1WJ6A 2N9XA 3T06A 4CHJA 1OEYJ 2KN5A 4LCDE 1TJ6A 4BBNF 3VTUA 4RM9A 3IFWB 4M0WB 1WH3A 3PHWB 1QC6A 2RGFA 1EGXA 4JL9A 3WALA 2D9YA 5G55A 3AXCA 3KW5B 4B9KA 4HB3B 5FR6A 2W2XD 3V6EB 2MQJA 1W1HA 1MIZB 3X23A 1WF9A 5TR5A 4HB2B 3RD2A 1SE9A 4G0NB 2JRIB 5D27A 4DHJB 2CAYA 1HB6A 2COFA 4WQOB 4MDKE 1KI1B 3ZNGC 4NY0A 1VCBA 4K2PA 4II3B 3AU5A 5D7GA 3ZUNA 3L13A 1U5EA 3NS8A 4K17A 5C5BB 1T0YA 2BYVE 4LJPB 2KJRA 3DBLI 1IP9A 1V61A 5D3XA 4DK5A 4TV3A 1RJ2A 4AJWA 2ZNVB 4HLEA 4BKSA 4E3CA 4MT7A 3SD5A 3R7RA 3ODOA 3NY5A 4YL8A 2DFKA 1P1AA 2KC1A 3N30A 3QHTA 1WGQA 2LWPA 2JRHA 3T8MA 2FDQA 1WI1A 1GJZA 4JGHB 2KFJA 2GCLA 4BOZB 5HE3A 1P6SA 4TQ1A 1WR1A 3SHQA 2BKRB 2KO3A 2LGDA 2N1VA 3WAPA 5HE2A 1UH6A 4W9IA 2I5CA 4PYUA 3AJ4A 2LJ5A 1AWEA 2G4DB 1YJ1A 4F7HA 2FIFA 2PJHA 2MWNB 2Z0OA 2MA9B 1PQSA 2V3SA 3R7QA 5E6PA 4ZYNA 2RGNB 4HAXB 4W9DA 5KHOA 3DPDA 2KOXA 2Y8GA 3APFA 4IG7B 3EHVA 1MK9B 2J0MA 4HDQA 2NPTB 3PVLA 2NZ8B 4HB0B 1WMHA 4DDID 4IW0A 1UNPA 2MWSB 1FGYA 3KZ1A 2YS5A 2XK5B 2V4LA 1UBIA 3HHMA 1WXMA 2ZVNA 2WH5A 2L05A 2GS0A 4K7WA 1L2NA 3ZTDA 1ST7A 1ZW7A 1XQQA 5G2NA 4DBGA 1ZGUB 2CKHB 2VSZA 2KTRA 2O6VD 2WYQA 3TJPA 4HAUB 3RZWC 1EVHA 3PHXB 4GXBA 2D9WA 4BVUC 3HK0A 4M8MA 2ZVOA 2VRRB 3QARA 1WJMA 1NU2A 4IFSA 2BCJA 2WWZA 2CB8A 4HCPB 1PLSA 2KHWB 4CHKA 4WVFB 4KSKC 4IUMB 4GDKB 3PGEA 4I6NB 3QWZB 3FEHA 4DWFA 4FJZA 2IO3B 2KZRA 5JP4A 1LFDA 1DDMA 1V5MA 3ZDTA 2KLCA 3ENEA 3EC8A 2L0FA 1UEFA 2ASQA 2UZRA 2K8BA 2KGXB 1FB8A 1X05A 2MKRA 1K5GB 2J0JA 3P2BA 2KFKA 2N4FA 2BPSA 2GCJA 4JQWC 4ANVA 1Z5SB 5JHAA 5LXHA 3VOQA 5AEKB 2YT1A 4EFOA 1DBHA 2NBVB
chains in the Genus database with same CATH superfamily
3NZ3A 1EF1A 5LLIA 1FHWA 1FOEA 4F7ZA 3BWUD 3L08A 1T0RC 1UELA 3N32A 4MM3B 2VH1A 1X1MA 1VR9A 1X86A 2NTSA 4NAMA 3AEBB 2DNFA 3SFEB 3SDLC 1LB1A 1WVHA 3Q3MC 3EUB2 4IM3A 1Z2MA 3AEDB 2HJ1A 3GE8C 4OVUA 3K9PB 2A5UA 5IP4D 3HRDD 1IRSA 3H8HA 4W9KA 4XZ4A 3LDZE 1I7HA 1ZYIA 4ZRJA 2L7RA 3QK0A 2KWVB 3H1UA 1E7UA 4M0WA 3ABVB 2D2QA 1Q0WB 1Q10A 2FCNA 3CWIA 3BK2A 4TKNA 1GPXA 1XODA 3AV8A 3VRAB 5GXGB 1U27A 1T5XD 1U4AA 2B76B 1V5OA 1DOIA 4US8A 3O65B 2FCSA 3OLMD 3WAMA 3PLUA 3OAWA 4IWPA 3MHSD 4ANWA 2N7DA 2KDBA 2AYOB 2CHZA 4A5KA 4HXDA 1SIJA 4KHAA 4K7UA 2K6DB 4DIXA 2PMVA 1TKEA 2BYTA 3F5RA 2CHXA 1TGZB 3ZRCA 4HEA1 2Z0DB 2WXQA 1NDDA 3CF6E 2DKPA 2OTXA 1FIQA 2N7EA 3AECB 4WIPA 1K8RB 3AMZA 4KIKB 4CQNA 1XT9B 3PP2A 4E74A 4M02A 3WCQA 3BINA 3C8YA 2ROVA 2WDTB 2MRPA 3MC8A 4DHZE 5KCVA 4N59A 5JHHA 2BYEA 2J59M 4JKDA 1L7YA 2YF0A 4IWQA 2RPQA 4FHJA 2CU1A 4GSWA 2RRFA 3P4QB 4EZJA 3U8ZA 1V86A 4R3DA 3I57A 1WGUA 1TY0A 3RT3B 5C5BA 4JX1C 2K49A 4XYCA 4WJ7A 1F77A 3W1YA 3FM8C 5IOIA 3ML8A 2KVZA 1AQCA 3ONSA 4N58A 1ZPSA 3UQBA 3S2AA 1KF6B 5E6OA 3DHIC 2IO1B 1ZDVA 4JK8A 2EKEC 3MPXA 2D3AA 1U5DA 3EFCA 2BBCA 1CMXB 4LNKA 3VR9B 2COAA 1WGYA 3HUIA 4F7GA 3ZJVA 4JKGA 4MK0A 3TEZA 1WX7A 1WGKA 4K2OA 2JZPA 2MBQA 3MC0B 3FVCA 1V81A 3VUXA 1ZOYB 2FE8A 1YN5A 2QCZA 2MBOA 4JLCA 5JHGA 2N9PC 1WX9A 3U30A 2BGFA 1SIFA 4Z2NA 4HPMB 4WJQA 4DDGD 2QKMA 1V5PA 1E7PB 4RCOA 3KH0A 2AL3A 1UGMA 2H7DA 1FRDA 4YONA 1QZEA 2ZNVC 3FILA 2PTLA 5H92C 1HEZE 3RCZA 1K5DB 5CTRC 3I5JC 5FKAC 2X0SA 2W9NA 1ISNA 1WJ1A 5C3JB 5MPOA 3DBHI 2N0SB 4LDTD 2IYBA 1HA5A 2LXCA 1JCKB 1GOZA 1WI0A 2NMQA 1QOAA 5HE0A 4AUQC 4MY6A 3TW1A 1OQRA 3TBLD 1U5FA 1N5XA 1MPHA 3L4PA 2JXTA 2K8HA 1XX0A 4EE2A 2RLOA 4DX8A 3WA0A 4RNAA 1R4NB 4RGTA 2DTCA 1RLFA 5AUKA 4NJ7A 1V97A 2KCJA 4HATB 4PT5A 3RULA 1TT5B 1IGCA 2K39A 1XLPA 3PG7A 1RFKA 4GDLB 2KLGA 1J8CA 2M17A 2NPTA 3A1QB 1C79A 2LUMA 3ZIMA 1I4QA 1H10A 3ZKJC 1XCTL 2M14A 2DAFA 1DOYA 1I4GA 2KX0A 2DYQA 3TIXA 3U7DA 5KQ4A 3V05A 1FHOA 2JZ3B 3ZNHB 5HG2A 3PEGA 2V1YA 2LMCA 4MGIE 3CSTA 1D5ZC 3ML4A 1S3SG 4FJVB 1ACCA 1ZDXA 3VRBB 1MPEA 3WANA 1WGRA 2MBHA 2WU2B 4KVGB 4BKTA 2V0GA 4ZRKA 2GOWA 1OQNA 2UZSA 4EJNA 2Y7BA 1WZ3A 3RFZB 4GU2A 2M19A 1Q67A 3TCAA 4EOYA 4USAA 1E6EB 2KMCA 3CIRB 5EE0A 4YSYB 4W9CA 2P0HA 2UU7A 2QIEB 2BF8B 3DWGC 2JF5A 2YEPB 3DHHC 1Q5WB 3PRMB 1UNSA 4L1BA 4G50A 1C78A 5IJMA 4NZLB 3NJTA 1A5RA 2WU5B 4BFRA 2PLPA 4ANUA 2KYWA 4HDOA 5CLQB 2D9ZA 2KUQA 3DWMA 4LJOB 2LGIA 4HJKA 2O6VB 5BMHA 2KT7A 4GDKA 3PZ8A 2LOZA 3N3KB 2MEKA 4GOCA 3VUWA 2BB5A 5D3VA 2RDGA 3P4PB 2ZZPB 3KSYA 1NI2A 2IGDA 4W9GA 1V80A 4CYEA 3OJ4B 3MFGA 3LYYA 1X1GA 4ZRIA 1FHXA 1FXTB 1LO5D 3LXFA 1OQYA 2KANA 1ACAA 4L1RA 2E3TA 4NJ6A 2EC1A 5D3YA 3SNHA 1R4MB 2CRFA 2V76A 4LNNA 3TEWA 4KDIC 3RNFC 4H8SA 2K1FA 2KJHB 3PREA 2WXHA 3N1ZC 3TO1A 1VZ8A 4HWIB 2L0TA 4FJYA 2DHIA 2JPHA 1D3ZA 1HBKA 3ZRFA 2KKCA 1EUVB 2RPVA 2KK8A 1WXSA 3X0WA 3VQIA 2I5FA 3KVFB 3AH7A 2LGXA 1YOVB 5CHFA 1UWXA 1GC6A 3OANA 2LEKA 1ZM0A 2IGGA 2PE9A 3ZYYX 3E9OA 3QCAA 3PRPB 1QQGA 2LHEA 4PS7A 2Z59B 1M7EA 3A4SC 3BZDB 2YS3A 2NBVA 2RQ1A 2BVCA 3Q8CA 2AEHA 2DA0A 4GPTB 2DLBA 1UNRA 1GC7A 4IC7B 3MJ5A 2L32A 1NTYA 1JROA 1PYWD 4MM3A 3DHGC 4GB9A 1C4AA 2PZ1A 2WDRB 2IO0B 4IDIA 1OEYA 2KR0A 3K9OB 4HKQA 4KAXB 3B2FA 4IKGA 4HPLB 3P4SB 2FNJB 1K52A 2R0DA 1FNVA 1WJUA 2L2IA 2M4NA 3LJ3A 4G11A 1XO3A 3RNEC 1FO4A 3ULCA 1VRAB 2BQQA 2NCNA 3KUCB 1OTRB 3UIPB 1FFVA 3N7CA 3ZDMC 3AE8B 1WXVA 1EF5A 1HE8A 1PFJA 2H88B 2LVPA 4FA6A 3IBEA 2L76A 1KZ7A 3B1LX 3QAQA 3A58A 1DDVA 1E8WA 2KD0A 3M3JA 3Q14C 1UNQA 1CZPA 1XLQA 1J0WA 2ADZA 2L3ZA 3TVVA 2GB1A 3C0RB 1EU3A 3VH3B 4TQ0A 1GG3A 2J7QB 2YT2A 1R4NI 3L0WB 2WXRA 3MJWA 2JVCA 5HE1A 2DENB 3PV1A 1C3TA 4KIKA 4JKEA 4QAYA 4RMAA 1VBGA 2KDFB 4ZRQA 3ZGZA 2IYDB 2I38A 1JRPA 1GAQB 2MH7A 3ZXRA 1WGGA 2C7HA 1J19A 1ZSQA 2AWTA 1WM3A 3P6AA 3RNGC 1YN4A 2X8XX 3P7ZA 4TYZA 3BVGA 4P1BC 2W55A 2O2VB 1LGRA 1WYGA 2FJLA 2ZCBA 5HFYA 1RYJA 2ON8A 4GN1A 2KJ6A 4JWUC 2PVOD 4GMXB 2K6QA 2KDIA 4C7YA 1WSPA 3GZNB 4URKA 3G9WA 2DIKA 4NAWB 2KIEA 2NTTA 3B9JA 1MG8A 2D10A 3MDBC 1MFWA 2KMAA 3DVNU 1UPQA 2FCMA 1KBLA 5BYSA 4A6HA 3SFDB 4EMOA 1TBEA 5AZFA 2W2XC 1TS2A 3NZUA 4RGOS 3ZLZA 1QILA 1VZ7A 3EPYA 2GBJA 2R2OA 2KWUB 3L17A 4HCNB 5LNK1 2A4ZA 3APCA 2WLBA 5IA7A 2X38A 3ULBA 3QBVB 1L5PA 1YX5B 2M8SA 2RNRB 4N6EB 3HQCA 2IDYA 5DIFB 3FC4A 4ACFA 5JHBA 4HAYB 2VZKD 5IAAC 3TUOA 3MHZA 1M7RA 1MJDA 1HTOA 2L52A 3RNBC 1EWCA 2KMMA 4MJSB 1V2YA 2N9LA 1ZC4B 2E2XA 5D94A 1SSNA 4KSLC 4W9JA 2K3UA 1OGWA 1U2BA 1FPYA 1F52A 1JMLA 1MKEA 1S1QB 2GBNA 2LHDA 4M00A 3NZSA 5DI9B 1RRBA 2R2YA 1YN3A 3NVWA 1QOBA 2KDEB 1WE7A 2KUPA 2ZPNA 4A6KA 2YEPF 1R4MI 3A9KB 3R66C 1ZXIA 4JIOU 4PYZA 1CQVA 3WAOA 1N60A 3NVYA 3VTVA 4LDTB 1UF0A 2OJWA 1LQBA 4GDLA 3A1QA 4J6IA 3D8EA 3ZW3A 4NNJB 2KACA 3SBTA 2GRIA 4RGMA 4JE3B 4HAZB 5CHWA 5E6NA 2BS4B 3Q2AC 4DXFA 1BXTA 2ICIA 2DX1A 3I63C 4AOFA 3A33B 2MDXA 1FNUA 3T3NA 2ZEQA 2HDEA 3PTFC 2ABDA 4P16A 5CX3A 1TYGB 4AJYB 2BYFA 2IZVB 2BKFA 3T3OA 4JPSA 4OSNA 1LXDA 2KDMA 2DYOA 4HVBA 2H89B 3VXWA 1WZ0A 4HAWB 1C76A 2IBIB 1DIKA 2BT6A 2KC2A 2I2YA 4XGAB 5BYRA 1T0QC 2MSED 4GGQA 1NBFC 2M56B 4E71A 2K8CA 2W82A 4K81A 3B0AA 2D4QA 2DZIA 2FJUB 3EA6A 2AX5A 3A98B 3HW2B 1WFYA 1E8XA 3B77A 1QQRA 1MI0A 2RDHA 1N3HA 3DCXA 2CQUA 1C4PA 2D3GA 1L4ZB 2DYMA 4IM2A 1FXIA 3L16A 5TSSA 4FULA 3PSCA 1DROA 4TUUA 2WX0A 1X11A 2JU6X 1SJHD 2YT0A 4PQ0A 3H7SA 2N7JA 1C1YB 4AP4C 4TMAB 2O6VA 4HHVA 3Q3NC 5J17A 4ZOHC 4HROA 1WG7A 2LUEA 3NHEB 1P7EA 3A4RA 3OWEB 3H7PB 4B0EA 4MELA 4YTMB 1ZC3B 1LM8B 2COPA 3DBRB 1BMLC 3M63B 5LOPB 2V4IB 1TZ1A 1VLBA 5GOWB 3DCGA 1N5WA 1B55A 4ANXA 1E8YA 4K1RB 1KM7A 3M62B 1I7AA 3VVWB 1IYFA 5LXIB 4CO7A 1XF5L 3BJIA 4B95A 1ZVRA 4YXDB 4JK9A 4MH0E 2RR9A 2KVRA 1WGHA 3Q8BA 1WMHB 3RUIB 1IUEA 3KUZA 3VAWA 4A55A 3IT4B 4PK1A 2K25A 3BIID 4G3XB 2DYNA 1M4VA 5JVLA 3NUHB 1WRDB 1IPGA 2QDFA 4WWOA 2MLBA 2Z8LA 1TTNA 3R3MA 3ZXVA 3BVMA 2UWQA 2NS5A 3A8QA 3GZNI 4W9EA 3GE3C 1XKEA 3VH4B 1V9JA 4WAAA 4OVVA 3FLVA 1SJED 1OMWA 2QSDA 2I1KA 1UD7A 1N63A 4FADA 2Z59A 5J3YA 2Z0QA 2QC8A 3OJ3A 3A9JB 2KQSA 2LXAA 2WDQB 4WJPA 5J2RA 2JZZA 1E90A 4OZBA 1Z87A 2DHZA 2RD0A 2YRYA 3AEFB 5L95C 2CJNA 1TXDA 2HD5B 5DPTA 1XD4A 1WM2A 4D0NB 1MHXA 1V88A 3HIEA 4BZAA 2KTRB 4D2KA 5C79A 4XWTA 1XD3B 3E56A 1HXYD 2D11A 3HVDA 2JUOA 1WJNA 3H6NA 2R82A 2D9VA 4F8CB 3N20C 1SXTA 2BB6A 3AULA 1V5UA 4M8NA 1YD8U 3WIMA 3AEEB 2SEBD 2LGYA 1E7VA 2FIDA 2WXIA 3AE2B 2RVBB 2XNAC 1ET6A 1V5TA 2W3SA 4I6PA 1WY8A 5JH5C 4WH4A 1E0ZA 4ICVA 2MW5A 4XC2A 5EE3A 4JKFA 3DXCA 3DVGY 3PVUA 2WHIA 2MP2B 2GJYA 1FAOA 2CR5A 5BYQA 3IHPC 1MI1A 1P98A 1KOTA 2V9HA 5AUIA 3Q3JA 2K00A 3AE7B 2GBMA 2K22A 2LRWA 1F2RI 3PO0A 1N6ZA 3EGRA 1TIFA 2KNBA 1E5WA 3PRZA 1E10A 1STEA 3APDA 1TQZA 4H2AA 2BWES 1KH0A 1HB8A 4BKSD 1KLVA 2K5PA 1FEHA 1N61A 4PNKA 4GNKB 3A8PA 3VDZA 3N9YC 3GOEA 1FCCC 2UVMA 3RYTA 4EZKA 1FMAD 4YSZB 2JP2A 4CHMA 2XK5A 3PPAA 4QJ5B 2CY4A 5DHAB 5EFXA 2O2VA 3NWFA 2MBEA 3BYTB 1UBQA 3DVNV 2PE6B 1JWSD 1GUAB 2LBBA 2GBKA 3JVZX 5L83A 4AWJA 1J7CA 4L6EA 2G1EA 5FI1A 1JW9D 1NVLA 3QX1A 3VR8B 2LOXA 1A70A 1NYRA 2KN4A 2LVQA 5C1ZA 3I9V1 4NAWA 1OQQA 4XWXA 4B0MA 3GP7A 2JX5A 1NVID 2R61A 1I4RA 1NI3A 4LLGM 2AL6A 2MX2A 2N9EB 3CSFA 2INDC 4MSQB 4OT1A 1ZXHA 5FR3A 1EO6A 3IAS1 3UIOB 4YWGG 4A6QA 4K3CA 2PEAA 3Q8FA 2QILA 2IGHA 2NBWB 3Q69A 1MIXA 4W9LA 1RAXA 1J0GA 4P1CC 5CLLB 2IO2B 5DPSA 4FXCA 3D32A 2L1CA 1W1GA 4TSSA 3B2GA 1Y56A 2DX5B 3BY4B 3JSVB 1HTQA 4MJSA 2KQ7A 1QT9A 2WXKA 5C6RA 3BK1A 4IM0A 3SUZA 2KX3A 2C5LC 4RM8A 5H8YE 1P0RA 1JRUA 2G9HD 3QIJA 1MAIA 4OW0A 3ETRA 4WJOA 1P7FA 4ILJA 3F0WA 3U4EG 3DBRI 2DZJA 2VZKB 2YLMA 3M1IB 1NTIA 3PS6A 1RWSA 3W2DA 3AE4B 4ZDVA 2XN9C 3T9LA 4EUTA 4BKGA 3QA8A 5HHDG 2VH2A 2Q5WD 3A9KA 4UDUC 1DYQA 2ZW0A 5HKHA 4MEMA 1QOGA 2Z0PA 3Q6BA 3V3XA 3VFKA 4FHKA 4B6WA 4FN2A 3DXEA 1XLOA 5BO4B 3SV1A 4KKIA 4QJ3B 3SEBA 2G4SA 2REXA 2EKIA 4A3PA 1NTVA 3UGBB 3KQ4A 1OY2A 2RDBC 3SYXA 4Y94A 5J3QA 2YS1A 4I6LB 1GB4A 5D3DA 2DZMA 2IFSA 2LYDA 5DPRA 1Y5OA 2WQYB 3DQVA 4S17A 1F2RC 1PGBA 4HAVB 1V49A 5KHQA 4KGRA 3FP5A 1MVKA 2OHFA 1PGXA 2VRWB 1P3QU 2C60A 1UZXB 3KWLA 4LTUA 1I35A 4KV2A 1NEKB 3Q8AA 4K7SA 2Y5CA 1SEBD 2Y5BB 2ZCCA 5BMIA 5LONB 1CJEA 1V1PB 2R09A 1BTNA 1I42A 3ZTCA 3NWAA 1YQBA 1ZP0B 2J0KA 2HTHB 1T3QA 2B3AA 3PSEB 3EFUA 5J3TA 3KUDB 3PLVA 1NYQA 2LGSA 4BBNC 5L81A 2FAZA 4BOSC 4ZHOA 3L10B 4YSXB 3ALBA 1IGDA 2QJLA 3MC9A 1FM0D 1EAZA 2KXJA 3VHTC 3HSAA 1RFAA 4IWOA 4KDLB 3KY9A 4EEWA 5C23A 5DCNA 1JWAD 1FRRA 1NENB 2XEWA 3TL5A 2JXXA 3DDCB 2M1MA 2DKQA 2L8JA 3H7PA 1YJIA 2LG1A 1E9MA 5J18A 4IOYX 1D6EC 4P6VF 2MCNB 2Y3AA 2I1JA 1P3RA 2EMSA 1SF0A 2WXGA 3VTWA 2GBRA 2DLWA 3RPFC 3V60A 1TJEA 4A6FB 2LJIA 3KYDD 2RSUA 4HK2A 1U5GA 3RZFA 2MHJA 2FUG1 3BYYB 4ZYSA 1CK1A 5BMGA 1YX6B 4C56C 3D8FA 2TSSA 2OQBA 3ZNID 5IO9A 2MBBB 4W9HA 4N9F4 2W2WA 2C7MB 1L0VB 1WGDA 2WX1A 2Z0EB 3ZJTA 1LW3A 2D9XA 3IVFA 4DBBA 1XCGA 2INNE 1WE6A 2L00B 3DOWA 4O1NA 4ASWC 2K8EA 1FFUA 4NQKE 1E8ZA 4ILGB 4HPPA 2YSZA 2NMBA 5DHFB 3PZDA 4II2B 2ZPYA 3A9JA 5D6JB 5DPWA 4MH8A 4XX5A 1WYWB 2N23A 2LVOA 3ZO5B 2KWCA 2VKIA 3BVZA 1PFDA 1L0YB 2J4XA 2GI9A 4KHOA 3AN1A 4ZHPA 1P9DU 2LRUA 1ZE3D 4PS3A 4LNOA 4EZLA 2N0YA 2DBYA 3DVGX 1SB3C 3RI7C 3PT2B 4NJCA 1IBXB 4EKUA 1TS4A 4LK0M 2CHWA 4DHJD 2G45B 1BT0A 1G6JA 4ITKA 2LZ6A 4Z2MB 1WX8A 2MFQA 1H4RA 1U29A 3AE5B 2C9WB 4NPNA 3R2TA 5D3WA 1V89A 4C00A 3UQAA 3TEYA 1H8CA 1JDEA 2DYBA 2WGSA 1ZUD2 5I2MA 2HE7A 1HQRD 2MP2A 2Q13A 3NWDA 2K9XA 5JZEB 4HJGE 2J52A 3NOBA 3H9DA 3P1MA 1B9RA 4GIVA 3L54A 1I2HA 2DAJA 5AZGA 4F1SA 1T77A 3ZNZB 2COCA 2Z14A 2M38A 4MSMB 3HIZA 1WIAA 1VDVA 4WJNA 4RFBA 1L6VA 2OJRA 1PMSA 2RSGA 2LD9A 2M0XA 4WAFA 5JXVA 2G3QB 1SHCA 3U12A 1WJ4A 5KQ1A 1FGZA 3NVZA 5CHVC 4GMVA 3D8DA 4W9FA 1KRHA 2EMTA 5EE9A 4B6HA 2Y8FA 4KHBB 2ROZB 1M94A 1WR6E 1KJTA 2BW2A 1KZGA 4F7UP 5JLJB 2HTME 3AI5A 1J7BA 3JW0X 2MJEA 1VJKA 4DX90 1ZKHA 2XBBC 4KZCA 4MGZE 3P63A 3V6CB 1FCLA 2NR2A 1Q1OA 3GYOA 3KRWA 4C7ZA 3W1SA 2ACZB 4PS8A 5EDSA 2HRJA 3RCPA 4OVZA 3SBGA 4C0AA 2P0DA 4X57B 1EM7A 2YVCA 3NS1A 1TS3A 2DZKA 3E9SA 3U2SC 1X1FA 3JYUA 4US9A 1YQ4B 3CXBB 1KTKA 3RNCC 2KTFA 2ELAA 1Y19B 1P5TA 2DX5A 4KZ0A 2EJ8A 1AARA 4C80A 3JSVA 1VD2A 2IY1B 3UINB 4ARIA 2H7EA 1WXQA 2OOBB 2INCC 3ZVVA 1W1DA 2G35A 3W9CB 2DHJA 2HJ8A 4ICUA 4MGYE 3QQ8B 2D3CA 3M95A 3Q3FA 1KFYB 1D5MC 1UGJA 5LG4B 2WNMA 2ELBA 3R2IA 1QOFA 3KWVA 3W1SC 4IAPA 1V6EA 5D3IB 4QXAB 1SGHA 1L6UA 4ARCA 1C77A 4NQLB 1XR0B 3CIKA 3NSUA 2AQ1B 2JT4B 4A90A 3SR6A 2D5GA 4L2YA 4YT0B 2CODA 3ECIA 3NRZA 3QC8B 2X18A 5AZHA 1RRPB 3AU4A 2C7NB 3SU8X 1K51A 2LULA 1F9JA 5G5HA 1PDXA 1F1HA 3RMKC 1MHHE 3KRXA 3IAM1 2PPHA 3FKYA 3IXSA 3CMMB 5E6JA 3LJUX 2JY6A 3VIAA 3EECA 3N1XC 1DOXA 2D07B 3DBSA 3O96A 1L0XB 3IT6B 4FBJB 2CY5A 4P7IA 2XQNM 4BBKA 2LASA 3ZVRA 2FUHB 3VUYA 3DBLB 1AN8A 1AYFA 2QEJC 3Q3OC 2OEDA 3HM3A 2P0FA 4J3OD 5FI0A 4C4VB 2K2JA 3TFMA 3IG3A 3V61A 2ZJDA 3FSSA 5IKCM 1J7AA 2NVUI 2K2UA 4AQ7A 4A20A 5T8IA 2EELA 2QHOA 3KYCD 4NSWA 1V1PA 1BWNA 1BAKA 2CS4A 4DHZB 4GZUA 1DGJA 1Y8RC 1RM6C 3GS2A 3ODWA 2JQRB 3SO6A 2DN6A 4D6WA 3UZTA 2HTHA 2BS2B 4XDDA 5DH9B 3ML9A 2BWFA 1UPRA 4BAXA 1GNUA 1OFFA 3HM6X 4MACA 4MGKE 2N1WA 1GGOA 4WWPA 2FCQA 2GMIC 1KC7A 2FJ9A 1DDWA 2L1AA 1BTKA 2Y5PA 2JWZA 2CU3A 2P8VA 2BS3B 4RF0A 4WWNA 1ESFA 4HB4B 2J42A 2LKOA 3GYPA 4HRSA 1JQ4A 2IY0B 3MTNB 4WURA 4DXAB 3NG0A 1UUPA 2V3NA 3URYA 4IOIE 1YIWA 3V62A 4A3OA 4REZA 3V5WA 2RMMA 4XE0A 1WXAA 3ENBA 1AW7A 1YNTE 4FLHA 3I3TB 1KLGD 3NVVA 4OZAA 2DHKA 1YMHE 2WP9B 4A6FA 2WXFA 3MP9A 5IRSA 4XWWA 3UF8A 2UYZB 3AE1B 1MK7B 4JKBA 5I4DA 3U7ZA 5C16A 4XDCA 2LI5A 2R2QA 2ZW1A 3P42A 3QWMA 1HZ5A 3QJZA 2KFKB 3WYFB 2NBUA 4YTNB 3B08A 2M0AA 3PVWA 1T6BX 1UWMA 1DYNA 4JK7A 3TMPB 4WSFA 3AE6B 2RUKB 5GMVA 4A8XC 2IJ0A 3DXDA 1TKGA 2L83A 2QKLA 3ODXA 3NW8A 5D2MB 3RNAC 1K50A 1WJ6A 2N9XA 3T06A 4CHJA 5FK9C 1OEYJ 3AE9B 1FNWA 2KN5A 4LCDE 1TJ6A 1I4XA 1WWTA 3O13A 4BBNF 3J9CA 4WWMA 3VTUA 4HKZE 3LB8C 4RM9A 4MT5A 3IFWB 2KIGA 2WDVB 4M0WB 4WQMA 1WH3A 3PHWB 2JYEA 2PKOA 1GB1A 1QC6A 2CJOA 2RGFA 1EGXA 4JL9A 2LFIA 3WALA 2D9YA 2ZKMX 5G55A 2N9KA 1VZ6A 3AXCA 3KW5B 1IBXA 4B9KA 5G5GA 4HB3B 1KLUD 1ROEA 5FR6A 2W2XD 3V6EB 2MQJA 2WXOA 1MG4A 2GUMA 1BUIC 1W1HA 5I2SA 1MIZB 3X23A 2PIAA 1T0SC 3OHMB 1WF9A 5IN7A 5TR5A 4HB2B 3RD2A 3E9LA 1SE9A 4YTPB 4G0NB 2JRIB 1JWUD 5D27A 1QLBB 4KGTA 4DHJB 2CAYA 2WXLA 2GLSA 3P4RB 1HB6A 2COFA 4WQOB 4MDKE 1V1OA 1KI1B 2FBWB 3AE3B 4NY0A 3ZNGC 1VCBA 4K2PA 4II3B 3W5UB 1XEEA 3AU5A 5D7GA 1AWDA 1PGAA 3ZUNA 3L13A 1U5EA 3NS8A 4K17A 1XCQL 3W5VB 5C5BB 1T0YA 2BYVE 4LJPB 2KJRA 3DBLI 1IP9A 1V61A 5D3XA 4DK5A 4TV3A 1RJ2A 4KX6B 4AJWA 2J53A 2ZNVB 3Q8EA 4HLEA 4BKSA 4E3CA 4MT7A 1YQ3B 3SD5A 4KHBA 1L4DB 3R7RA 3ZJUA 3ODOA 1C9FA 2AQ3B 3AM9A 2MJ3A 3NY5A 4YL8A 1WRIA 2DFKA 1P1AA 4JKGB 2JWUA 2KC1A 3N30A 2AQ2B 2D3BA 1SBBB 4JKHA 3QHTA 1WGQA 2LWPA 2JRHA 3T8MA 2FDQA 1K53A 3HVZA 1HZ6A 1WI1A 3AEAB 4JGHB 1GJZA 2KFJA 2GCLA 4L23A 4BOZB 1V8CA 3TSSA 1QF6A 5HE3A 1P6SA 4TQ1A 1WR1A 3N1YC 3GB1A 4RF1A 3SHQA 2BKRB 2KO3A 2LGDA 1TY2A 2N1VA 2INPE 3WAPA 5HE2A 4HSIA 1UH6A 4W9IA 2I5CA 4PYUA 3FILB 3AJ4A 1JALA 2LJ5A 1AWEA 2G4DB 1QKZA 1I4PA 1YJ1A 4F7HA 5EE1A 1XXGA 2FIFA 2PJHA 2MWNB 2Z0OA 1XLNA 2MA9B 4OZCA 1PQSA 2V3SA 3R7QA 5E6PA 4M01A 2ONQA 2RGNB 4ILHA 2SAKA 4ZYNA 2E6XA 4HAXB 4W9DA 2PW9A 5KHOA 1FXAA 3DPDA 2KOXA 2Y8GA 3APFA 4IG7B 3EHVA 1MK9B 2J0MA 2QMTA 2PVGC 3AEGB 4AS1A 4KGSA 4HDQA 1FD6A 4JWSC 1ET9A 2WXNA 4JKCA 2NPTB 3PVLA 4JKAA 2NZ8B 4HB0B 1EU4A 1WMHA 4DDID 4IW0A 4OHJA 3FAHA 4GOUA 4LNIA 1UNPA 2MWSB 3OG5A 2Z13A 1FGYA 3KZ1A 2KAJA 2YS5A 2XK5B 2V4LA 4Q2JA 3RN9C 4S0RA 1UBIA 3HHMA 4RGNA 2MJDA 2WS3B 1WXMA 3E9PA 2ZVNA 2WH5A 2L05A 2IPKD 3UI3A 2GS0A 4DQOC 3AB5A 4C4VA 2WXPA 5M4YB 4K7WA 1L2NA 1N62A 3ZTDA 1ST7A 1JWBD 1ZW7A 1XQQA 5G2NA 1ENFA 1I4HA 2K0PA 4DBGA 1F0ZA 1B1ZA 1ZGUB 2CKHB 2VSZA 2KTRA 2O6VD 2WYQA 4A9AA 4QJ4B 3TJPA 2KQ4X 2WXJA 5C2TB 4HAUB 3RZWC 1C4CA 1EVHA 3PHXB 1VBHA 4GXBA 4CSQA 2D9WA 4BVUC 3HK0A 4M8MA 2ZVOA 1SE2A 2VRRB 3QARA 1WJMA 2JSVX 3PZ7A 1NU2A 4IFSA 2BCJA 2WWZA 4GLSC 2CB8A 1TZOA 4HCPB 1PLSA 2KHWB 4CHKA 4WVFB 4KSKC 4IUMB 1R7SA 3R8BA 4GDKB 3PGEA 4I6NB 1D5XC 3QWZB 3FEHA 3DBHB 4DWFA 3KLSX 4LNFA 4FJZA 1JWMD 2IO3B 4DXGA 2KZRA 5JP4A 2W3RA 2W54A 1LFDA 4ZRPA 1DDMA 1V5MA 5HI1A 3ZDTA 1TKYA 2KLCA 2V3PA 2JYTA 3ENEA 3TEXA 2Z4DA 3U52E 1SE3A 3EC8A 2L0FA 1PUTA 3E66A 4KKJA 1UEFA 2ASQA 2UZRA 2K8BA 1YJJA 1EWYC 4RH6A 2KGXB 1FB8A 3C19A 2BTEA 1X05A 2MKRA 1K5GB 2J0JA 1D4BA 3P2BA 2KFKA 2WXMA 2N4FA 2BPSA 2GCJA 4JQWC 4ANVA 1Z5SB 4K3BA 5JHAA 1SE4A 2DWQA 5LXHA 3VOQA 5AEKB 2YT1A 4EFOA 1TS5A 1DBHA 3ZQ4A 2NBVB 2KWDA
chains in the Genus database with same CATH topology
1EF1A 5LLIA 1FHWA 1FOEA 4F7ZA 3L08A 1UELA 3N32A 1X1MA 1X86A 3SDLC 1LB1A 1WVHA 4IM3A 1Z2MA 4OVUA 3K9PB 2A5UA 1IRSA 4W9KA 4XZ4A 3LDZE 4ZRJA 2L7RA 3QK0A 2KWVB 3H1UA 1E7UA 2D2QA 1Q0WB 2FCNA 4TKNA 1XODA 1U27A 1U4AA 1V5OA 3O65B 2FCSA 3OLMD 3WAMA 3PLUA 3OAWA 4IWPA 3MHSD 4ANWA 2N7DA 2KDBA 2AYOB 2CHZA 4A5KA 4HXDA 4KHAA 4K7UA 2K6DB 3F5RA 2CHXA 1TGZB 3ZRCA 2Z0DB 1NDDA 3CF6E 2DKPA 2OTXA 2N7EA 1K8RB 4KIKB 1XT9B 3PP2A 4E74A 3BINA 2ROVA 2WDTB 2MRPA 4DHZE 5KCVA 5JHHA 2BYEA 2J59M 4JKDA 1L7YA 2YF0A 4IWQA 2RPQA 4FHJA 2CU1A 4GSWA 4EZJA 3U8ZA 1V86A 1WGUA 3RT3B 5C5BA 4WJ7A 3W1YA 3FM8C 3ML8A 1AQCA 3ONSA 3UQBA 3S2AA 5E6OA 2IO1B 4JK8A 2EKEC 3MPXA 1U5DA 1CMXB 2COAA 1WGYA 4F7GA 4JKGA 4MK0A 1WX7A 4K2OA 2MBQA 1V81A 3VUXA 2MBOA 4JLCA 5JHGA 2N9PC 1WX9A 3U30A 2BGFA 1SIFA 4Z2NA 4HPMB 4WJQA 4DDGD 2QKMA 1V5PA 3KH0A 2AL3A 1UGMA 2H7DA 4YONA 1QZEA 2ZNVC 3RCZA 1K5DB 5CTRC 2X0SA 2W9NA 1ISNA 1WJ1A 3DBHI 4LDTD 2IYBA 2LXCA 1WI0A 5HE0A 4AUQC 4MY6A 3TW1A 3TBLD 1U5FA 1MPHA 2K8HA 1XX0A 2RLOA 4DX8A 3WA0A 2DTCA 1RLFA 4NJ7A 2KCJA 4HATB 3RULA 2K39A 3PG7A 4GDLB 2KLGA 1J8CA 2M17A 2NPTA 3A1QB 3ZIMA 1H10A 3ZKJC 2M14A 2DAFA 2KX0A 2DYQA 3TIXA 3U7DA 5KQ4A 1FHOA 2JZ3B 3ZNHB 3PEGA 2V1YA 4MGIE 3CSTA 3ML4A 1S3SG 4FJVB 3WANA 1WGRA 2MBHA 4KVGB 4BKTA 4ZRKA 2GOWA 1OQNA 2UZSA 4EJNA 2Y7BA 1WZ3A 4GU2A 1Q67A 3TCAA 4EOYA 2KMCA 4W9CA 2P0HA 2BF8B 2JF5A 1Q5WB 3PRMB 4G50A 5IJMA 1A5RA 4BFRA 4ANUA 4HDOA 5CLQB 2D9ZA 4LJOB 4HJKA 2O6VB 4GDKA 4GOCA 2LOZA 3N3KB 3VUWA 5D3VA 2ZZPB 3KSYA 1NI2A 4W9GA 1V80A 4CYEA 3OJ4B 1X1GA 4ZRIA 1FHXA 1FXTB 1OQYA 2KANA 1ACAA 4NJ6A 2EC1A 5D3YA 3SNHA 2CRFA 2V76A 4KDIC 4H8SA 2K1FA 2KJHB 3PREA 3TO1A 4HWIB 2L0TA 4FJYA 2DHIA 2JPHA 1D3ZA 1HBKA 3ZRFA 2KKCA 1EUVB 2KK8A 1WXSA 3X0WA 3VQIA 2I5FA 3KVFB 2LGXA 5CHFA 1GC6A 3OANA 1ZM0A 2PE9A 3E9OA 3QCAA 3PRPB 1QQGA 4PS7A 2Z59B 1M7EA 3A4SC 2YS3A 2RQ1A 2AEHA 2DA0A 4GPTB 1UNRA 1GC7A 4IC7B 1NTYA 4MM3A 4GB9A 2PZ1A 2IO0B 1OEYA 3K9OB 4KAXB 4HPLB 2FNJB 2R0DA 1WJUA 2L2IA 2M4NA 3LJ3A 4G11A 3ULCA 2NCNA 3KUCB 1OTRB 3UIPB 3N7CA 3ZDMC 1WXVA 1EF5A 1HE8A 1PFJA 2LVPA 4FA6A 3IBEA 2L76A 1KZ7A 3B1LX 3QAQA 1DDVA 1E8WA 2KD0A 3M3JA 1UNQA 1J0WA 2ADZA 2L3ZA 3TVVA 3C0RB 3VH3B 4TQ0A 1GG3A 2J7QB 1R4NI 3L0WB 3MJWA 2JVCA 5HE1A 2DENB 3PV1A 1C3TA 4KIKA 4JKEA 4RMAA 1VBGA 2KDFB 2IYDB 1WGGA 2C7HA 1J19A 1ZSQA 2AWTA 1WM3A 3P6AA 3P7ZA 4TYZA 2O2VB 2FJLA 2ZCBA 4GN1A 2KJ6A 4GMXB 2K6QA 2KDIA 4URKA 3G9WA 2DIKA 4NAWB 1MG8A 2D10A 3MDBC 2KMAA 3DVNU 1UPQA 2FCMA 1KBLA 4A6HA 4EMOA 1TBEA 5AZFA 2W2XC 3NZUA 3ZLZA 2GBJA 3EPYA 2R2OA 2KWUB 3L17A 4HCNB 2A4ZA 3APCA 5IA7A 3ULBA 3QBVB 2M8SA 1YX5B 2RNRB 3HQCA 5DIFB 5JHBA 4HAYB 5IAAC 1M7RA 4MJSB 1V2YA 1ZC4B 2E2XA 5D94A 4KSLC 4W9JA 1OGWA 1U2BA 1MKEA 1S1QB 2GBNA 3NZSA 5DI9B 1RRBA 2KDEB 1WE7A 2KUPA 2ZPNA 4A6KA 1R4MI 3A9KB 3R66C 4JIOU 4PYZA 3WAOA 3VTVA 4LDTB 1LQBA 4GDLA 3A1QA 4J6IA 3D8EA 3ZW3A 4NNJB 3SBTA 4HAZB 5CHWA 5E6NA 2DX1A 4AOFA 3A33B 2MDXA 2ZEQA 3PTFC 2ABDA 5CX3A 4AJYB 2BYFA 2IZVB 2BKFA 1LXDA 2DYOA 4HVBA 3VXWA 1WZ0A 4HAWB 2IBIB 1DIKA 2KC2A 2MSED 4GGQA 1NBFC 4E71A 2K8CA 4K81A 3B0AA 2D4QA 2DZIA 3A98B 3HW2B 1WFYA 1E8XA 1N3HA 2CQUA 2D3GA 2DYMA 4IM2A 3L16A 4FULA 3PSCA 1DROA 4TUUA 2WX0A 1X11A 2YT0A 4PQ0A 3H7SA 1C1YB 4AP4C 2O6VA 4HHVA 5J17A 1WG7A 2LUEA 3NHEB 3A4RA 3H7PB 4MELA 1ZC3B 1LM8B 2COPA 3M63B 5LOPB 1TZ1A 5GOWB 3DCGA 1B55A 4ANXA 1E8YA 4K1RB 1KM7A 3M62B 1I7AA 3VVWB 1IYFA 5LXIB 4CO7A 3BJIA 4B95A 1ZVRA 4JK9A 4MH0E 2RR9A 2KVRA 1WGHA 3RUIB 1WMHB 3KUZA 3VAWA 2K25A 4G3XB 2DYNA 5JVLA 1WRDB 1IPGA 4WWOA 2MLBA 1TTNA 3R3MA 2UWQA 2NS5A 3A8QA 3GZNI 4W9EA 1XKEA 3VH4B 1V9JA 4WAAA 4OVVA 3FLVA 1OMWA 2I1KA 1UD7A 4FADA 5J3YA 2Z0QA 3OJ3A 3A9JB 2KQSA 2LXAA 4WJPA 5J2RA 2JZZA 1E90A 1Z87A 2DHZA 2RD0A 2YRYA 5L95C 1TXDA 2HD5B 5DPTA 1XD4A 1WM2A 4D0NB 1V88A 2KTRB 5C79A 1XD3B 2D11A 2JUOA 1WJNA 3H6NA 2R82A 2D9VA 4F8CB 3AULA 1V5UA 4M8NA 1YD8U 3WIMA 2LGYA 1E7VA 2FIDA 2RVBB 1V5TA 4I6PA 1WY8A 5JH5C 4ICVA 2MW5A 4XC2A 4JKFA 3DXCA 3DVGY 3PVUA 2MP2B 2GJYA 1FAOA 2CR5A 3IHPC 1P98A 1KOTA 3Q3JA 2K00A 2GBMA 2LRWA 2KNBA 1E5WA 3PRZA 3APDA 1TQZA 2BWES 1HB8A 4BKSD 1KLVA 4PNKA 3A8PA 3VDZA 3GOEA 2UVMA 3RYTA 4EZKA 2JP2A 4CHMA 2XK5A 3PPAA 2CY4A 5DHAB 5EFXA 2O2VA 2MBEA 1UBQA 3DVNV 2PE6B 1GUAB 2LBBA 2GBKA 3JVZX 5L83A 4AWJA 4L6EA 5FI1A 1NVLA 3QX1A 2LOXA 2LVQA 5C1ZA 4NAWA 4XWXA 2AL6A 2MX2A 2N9EB 3CSFA 4MSQB 1EO6A 3UIOB 2PEAA 2NBWB 1MIXA 4W9LA 1RAXA 1J0GA 5CLLB 5DPSA 2IO2B 3D32A 2L1CA 1W1GA 2DX5B 3BY4B 3JSVB 4MJSA 2KQ7A 4IM0A 5C6RA 3SUZA 2KX3A 2C5LC 4RM8A 1P0RA 1JRUA 3QIJA 1MAIA 4WJOA 4ILJA 3F0WA 3DBRI 2DZJA 2YLMA 3M1IB 1NTIA 3PS6A 4ZDVA 3T9LA 4EUTA 4BKGA 3QA8A 3A9KA 5HKHA 4MEMA 2Z0PA 3VFKA 4FHKA 4B6WA 4FN2A 3DXEA 5BO4B 3SV1A 2G4SA 2REXA 4A3PA 1NTVA 3UGBB 1OY2A 3SYXA 4Y94A 5J3QA 2YS1A 4I6LB 2DZMA 2IFSA 2LYDA 5DPRA 1Y5OA 3DQVA 5KHQA 4HAVB 1V49A 3FP5A 2VRWB 1P3QU 2C60A 1UZXB 1I35A 4KV2A 4K7SA 2ZCCA 2Y5BB 5LONB 2R09A 1BTNA 1I42A 3ZTCA 1YQBA 2J0KA 2HTHB 2B3AA 3PSEB 3EFUA 5J3TA 3KUDB 3PLVA 4BBNC 5L81A 2FAZA 4BOSC 3L10B 3ALBA 1EAZA 2KXJA 3VHTC 1RFAA 4IWOA 4KDLB 3KY9A 4EEWA 5C23A 5DCNA 2XEWA 3TL5A 2JXXA 3DDCB 2M1MA 2DKQA 2L8JA 3H7PA 5J18A 2LG1A 4IOYX 2MCNB 2I1JA 1P3RA 2EMSA 3VTWA 2GBRA 2DLWA 3V60A 4A6FB 3KYDD 2RSUA 4HK2A 1U5GA 3RZFA 1YX6B 3D8FA 2OQBA 3ZNID 2MBBB 4W9HA 4N9F4 2W2WA 2C7MB 1WGDA 2WX1A 2Z0EB 1LW3A 2D9XA 3IVFA 4DBBA 1XCGA 1WE6A 2L00B 3DOWA 4ASWC 4NQKE 1E8ZA 4ILGB 2YSZA 2NMBA 5DHFB 3PZDA 4II2B 2ZPYA 3A9JA 5D6JB 5DPWA 4XX5A 1WYWB 2N23A 2LVOA 3ZO5B 2KWCA 2VKIA 4KHOA 1P9DU 2LRUA 4PS3A 4EZLA 2N0YA 3DVGX 3PT2B 4EKUA 2CHWA 4DHJD 2G45B 1BT0A 1G6JA 2LZ6A 4Z2MB 1WX8A 2MFQA 1H4RA 1U29A 2C9WB 4NPNA 5D3WA 1V89A 3UQAA 1H8CA 1JDEA 2DYBA 2HE7A 2MP2A 2Q13A 5JZEB 3NOBA 3H9DA 4GIVA 3L54A 1I2HA 2DAJA 5AZGA 4F1SA 3ZNZB 2COCA 2M38A 4MSMB 3HIZA 1WIAA 4WJNA 2OJRA 1PMSA 2RSGA 2LD9A 2M0XA 2G3QB 1SHCA 1WJ4A 5KQ1A 1FGZA 5CHVC 4GMVA 3D8DA 4W9FA 2EMTA 4B6HA 2Y8FA 4KHBB 2ROZB 1M94A 1WR6E 1KJTA 1KZGA 4F7UP 5JLJB 3AI5A 3JW0X 4DX90 1ZKHA 2XBBC 4MGZE 4KZCA 3V6CB 2NR2A 1Q1OA 3GYOA 3KRWA 3W1SA 4PS8A 5EDSA 2HRJA 3RCPA 3SBGA 4C0AA 2P0DA 4X57B 2YVCA 2DZKA 1X1FA 3JYUA 3CXBB 2KTFA 2ELAA 1Y19B 1P5TA 2DX5A 4KZ0A 2EJ8A 1AARA 3JSVA 1VD2A 2IY1B 3UINB 2H7EA 2OOBB 3ZVVA 1W1DA 2G35A 2DHJA 2HJ8A 4ICUA 4MGYE 3QQ8B 3Q3FA 3M95A 2ELBA 3W1SC 4IAPA 1V6EA 1SGHA 4NQLB 1XR0B 3CIKA 3NSUA 2JT4B 2CODA 3ECIA 3QC8B 2X18A 5AZHA 1RRPB 3AU4A 2C7NB 3SU8X 2LULA 1F9JA 3KRXA 2PPHA 3CMMB 3LJUX 2JY6A 3VIAA 3EECA 2D07B 3DBSA 3O96A 4FBJB 2CY5A 4P7IA 2XQNM 4BBKA 2LASA 3ZVRA 2FUHB 3VUYA 3HM3A 2P0FA 5FI0A 2K2JA 3TFMA 3IG3A 3V61A 2ZJDA 3FSSA 2NVUI 2K2UA 4A20A 2QHOA 3KYCD 4NSWA 1BWNA 1BAKA 2CS4A 4DHZB 4GZUA 1Y8RC 3ODWA 3SO6A 2DN6A 3UZTA 2HTHA 5DH9B 3ML9A 2BWFA 1UPRA 1GNUA 3HM6X 4MGKE 2N1WA 1GGOA 4WWPA 2FCQA 2GMIC 1KC7A 2FJ9A 1DDWA 1BTKA 2JWZA 2P8VA 4WWNA 4HB4B 2LKOA 3GYPA 2IY0B 3MTNB 4DXAB 1YIWA 3V62A 4A3OA 3V5WA 1WXAA 3ENBA 4FLHA 3I3TB 2DHKA 4A6FA 3UF8A 2UYZB 1MK7B 4JKBA 5C16A 2LI5A 2R2QA 3QWMA 3QJZA 2KFKB 3WYFB 2NBUA 3B08A 3PVWA 1DYNA 4JK7A 3TMPB 4WSFA 2RUKB 5GMVA 3DXDA 2QKLA 3ODXA 5D2MB 1WJ6A 2N9XA 3T06A 4CHJA 1OEYJ 2KN5A 4LCDE 1TJ6A 4BBNF 3VTUA 4RM9A 3IFWB 4M0WB 1WH3A 3PHWB 1QC6A 2RGFA 1EGXA 4JL9A 3WALA 2D9YA 5G55A 3AXCA 3KW5B 4B9KA 4HB3B 5FR6A 2W2XD 3V6EB 2MQJA 1W1HA 1MIZB 3X23A 1WF9A 5TR5A 4HB2B 3RD2A 3E9LA 1SE9A 4G0NB 2JRIB 5D27A 4DHJB 2CAYA 1HB6A 2COFA 4WQOB 4MDKE 1KI1B 3ZNGC 4NY0A 1VCBA 4K2PA 4II3B 3AU5A 5D7GA 3ZUNA 3L13A 1U5EA 3NS8A 4K17A 5C5BB 1T0YA 2BYVE 4LJPB 2KJRA 3DBLI 1IP9A 1V61A 5D3XA 4DK5A 4TV3A 1RJ2A 4AJWA 2ZNVB 4HLEA 4BKSA 4E3CA 4MT7A 3SD5A 3R7RA 3ODOA 3NY5A 4YL8A 2DFKA 1P1AA 4JKGB 2KC1A 3N30A 4JKHA 3QHTA 1WGQA 2LWPA 2JRHA 3T8MA 2FDQA 1WI1A 1GJZA 4JGHB 2KFJA 2GCLA 4BOZB 5HE3A 1P6SA 4TQ1A 1WR1A 3SHQA 2BKRB 2KO3A 2LGDA 2N1VA 3WAPA 5HE2A 1UH6A 4W9IA 2I5CA 4PYUA 3AJ4A 2LJ5A 1AWEA 2G4DB 1YJ1A 4F7HA 2FIFA 2PJHA 2MWNB 2Z0OA 2MA9B 1PQSA 2V3SA 3R7QA 5E6PA 4ZYNA 2RGNB 4ILHA 4HAXB 4W9DA 5KHOA 3DPDA 2KOXA 2Y8GA 3APFA 4IG7B 3EHVA 1MK9B 2J0MA 4HDQA 4JKCA 2NPTB 3PVLA 4JKAA 2NZ8B 4HB0B 1WMHA 4DDID 4IW0A 1UNPA 2MWSB 1FGYA 3KZ1A 2YS5A 2XK5B 2V4LA 1UBIA 3HHMA 1WXMA 3E9PA 2ZVNA 2WH5A 2L05A 2GS0A 4K7WA 1L2NA 3ZTDA 1ST7A 1ZW7A 1XQQA 5G2NA 4DBGA 1ZGUB 2CKHB 2VSZA 2KTRA 2O6VD 2WYQA 3TJPA 4HAUB 3RZWC 3PHXB 1EVHA 1VBHA 4GXBA 2D9WA 4BVUC 3HK0A 4M8MA 2ZVOA 2VRRB 3QARA 1WJMA 1NU2A 4IFSA 2BCJA 2WWZA 2CB8A 4HCPB 1PLSA 2KHWB 4CHKA 4WVFB 4KSKC 4IUMB 4GDKB 3PGEA 4I6NB 3QWZB 3FEHA 4DWFA 4FJZA 2IO3B 2KZRA 5JP4A 1LFDA 1DDMA 1V5MA 3ZDTA 2KLCA 3ENEA 3EC8A 2L0FA 3E66A 1UEFA 2ASQA 2UZRA 2K8BA 2KGXB 1FB8A 1X05A 2MKRA 1K5GB 2J0JA 3P2BA 2KFKA 2N4FA 2BPSA 2GCJA 4JQWC 4ANVA 1Z5SB 5JHAA 5LXHA 3VOQA 5AEKB 2YT1A 4EFOA 1DBHA 2NBVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 A;  5LLI A;  1FHW A;  1FOE A;  4F7Z A;  3L08 A;  1UEL A;  3N32 A;  1X1M A;  1X86 A;  3SDL C;  1LB1 A;  1WVH A;  4IM3 A;  1Z2M A;  4OVU A;  3K9P B;  2A5U A;  1IRS A;  4W9K A;  4XZ4 A;  3LDZ E;  4ZRJ A;  2L7R A;  3QK0 A;  2KWV B;  3H1U A;  1E7U A;  2D2Q A;  1Q0W B;  2FCN A;  4TKN A;  1XOD A;  1U27 A;  1U4A A;  1V5O A;  3O65 B;  2FCS A;  3OLM D;  3WAM A;  3PLU A;  3OAW A;  4IWP A;  3MHS D;  4ANW A;  2N7D A;  2KDB A;  2AYO B;  2CHZ A;  4A5K A;  4HXD A;  4KHA A;  4K7U A;  2K6D B;  3F5R A;  2CHX A;  1TGZ B;  3ZRC A;  2Z0D B;  1NDD A;  3CF6 E;  2DKP A;  2OTX A;  2N7E A;  1K8R B;  4KIK B;  1XT9 B;  3PP2 A;  4E74 A;  3BIN A;  2ROV A;  2WDT B;  2MRP A;  4DHZ E;  5KCV A;  5JHH A;  2BYE A;  2J59 M;  1L7Y A;  2YF0 A;  4IWQ A;  2RPQ A;  4FHJ A;  2CU1 A;  4GSW A;  4EZJ A;  3U8Z A;  1V86 A;  1WGU A;  3RT3 B;  5C5B A;  4WJ7 A;  3W1Y A;  3FM8 C;  3ML8 A;  1AQC A;  3ONS A;  3UQB A;  3S2A A;  5E6O A;  2IO1 B;  2EKE C;  3MPX A;  1U5D A;  1CMX B;  2COA A;  1WGY A;  4F7G A;  4MK0 A;  1WX7 A;  4K2O A;  2MBQ A;  1V81 A;  3VUX A;  2MBO A;  4JLC A;  5JHG A;  2N9P C;  1WX9 A;  3U30 A;  2BGF A;  1SIF A;  4Z2N A;  4HPM B;  4WJQ A;  4DDG D;  2QKM A;  1V5P A;  3KH0 A;  2AL3 A;  1UGM A;  2H7D A;  4YON A;  1QZE A;  2ZNV C;  3RCZ A;  1K5D B;  5CTR C;  2W9N A;  1ISN A;  1WJ1 A;  3DBH I;  4LDT D;  2IYB A;  2LXC A;  1WI0 A;  5HE0 A;  4AUQ C;  4MY6 A;  3TW1 A;  3TBL D;  1U5F A;  1MPH A;  2K8H A;  1XX0 A;  2RLO A;  4DX8 A;  3WA0 A;  2DTC A;  1RLF A;  4NJ7 A;  2KCJ A;  4HAT B;  3RUL A;  2K39 A;  3PG7 A;  4GDL B;  2KLG A;  1J8C A;  2M17 A;  2NPT A;  3A1Q B;  3ZIM A;  1H10 A;  3ZKJ C;  2M14 A;  2DAF A;  2KX0 A;  2DYQ A;  3TIX A;  3U7D A;  5KQ4 A;  1FHO A;  2JZ3 B;  3ZNH B;  3PEG A;  2V1Y A;  4MGI E;  3CST A;  3ML4 A;  1S3S G;  4FJV B;  3WAN A;  1WGR A;  2MBH A;  4KVG B;  4BKT A;  4ZRK A;  2GOW A;  1OQN A;  2UZS A;  4EJN A;  2Y7B A;  1WZ3 A;  4GU2 A;  1Q67 A;  3TCA A;  4EOY A;  2KMC A;  4W9C A;  2P0H A;  2BF8 B;  2JF5 A;  1Q5W B;  3PRM B;  4G50 A;  5IJM A;  1A5R A;  4BFR A;  4ANU A;  4HDO A;  5CLQ B;  2D9Z A;  4LJO B;  4HJK A;  2O6V B;  4GDK A;  4GOC A;  2LOZ A;  3N3K B;  3VUW A;  5D3V A;  2ZZP B;  3KSY A;  1NI2 A;  4W9G A;  1V80 A;  4CYE A;  3OJ4 B;  1X1G A;  4ZRI A;  1FHX A;  1FXT B;  1OQY A;  2KAN A;  1ACA A;  4NJ6 A;  2EC1 A;  5D3Y A;  3SNH A;  2CRF A;  2V76 A;  4KDI C;  4H8S A;  2K1F A;  2KJH B;  3PRE A;  3TO1 A;  4HWI B;  2L0T A;  4FJY A;  2DHI A;  2JPH A;  1D3Z A;  1HBK A;  3ZRF A;  2KKC A;  1EUV B;  2KK8 A;  1WXS A;  3X0W A;  3VQI A;  2I5F A;  3KVF B;  2LGX A;  5CHF A;  1GC6 A;  3OAN A;  1ZM0 A;  2PE9 A;  3QCA A;  3PRP B;  1QQG A;  4PS7 A;  2Z59 B;  1M7E A;  3A4S C;  2YS3 A;  2RQ1 A;  2AEH A;  2DA0 A;  4GPT B;  1UNR A;  1GC7 A;  4IC7 B;  1NTY A;  4MM3 A;  4GB9 A;  2PZ1 A;  2IO0 B;  1OEY A;  3K9O B;  4KAX B;  4HPL B;  2FNJ B;  2R0D A;  1WJU A;  2L2I A;  2M4N A;  3LJ3 A;  4G11 A;  3ULC A;  2NCN A;  3KUC B;  1OTR B;  3UIP B;  3N7C A;  3ZDM C;  1WXV A;  1EF5 A;  1HE8 A;  1PFJ A;  2LVP A;  4FA6 A;  3IBE A;  2L76 A;  1KZ7 A;  3B1L X;  3QAQ A;  1DDV A;  1E8W A;  2KD0 A;  3M3J A;  1UNQ A;  1J0W A;  2ADZ A;  2L3Z A;  3TVV A;  3C0R B;  3VH3 B;  4TQ0 A;  1GG3 A;  2J7Q B;  1R4N I;  3L0W B;  3MJW A;  2JVC A;  5HE1 A;  2DEN B;  3PV1 A;  1C3T A;  4KIK A;  4RMA A;  2KDF B;  2IYD B;  1WGG A;  2C7H A;  1J19 A;  1ZSQ A;  2AWT A;  1WM3 A;  3P6A A;  3P7Z A;  4TYZ A;  2O2V B;  2FJL A;  2ZCB A;  4GN1 A;  2KJ6 A;  4GMX B;  2K6Q A;  2KDI A;  4URK A;  3G9W A;  4NAW B;  1MG8 A;  2D10 A;  3MDB C;  2KMA A;  3DVN U;  1UPQ A;  2FCM A;  4A6H A;  4EMO A;  1TBE A;  5AZF A;  2W2X C;  3NZU A;  3ZLZ A;  2GBJ A;  3EPY A;  2R2O A;  2KWU B;  3L17 A;  4HCN B;  2A4Z A;  3APC A;  5IA7 A;  3ULB A;  3QBV B;  2M8S A;  1YX5 B;  2RNR B;  3HQC A;  5DIF B;  5JHB A;  4HAY B;  5IAA C;  1M7R A;  4MJS B;  1V2Y A;  1ZC4 B;  2E2X A;  5D94 A;  4KSL C;  4W9J A;  1OGW A;  1U2B A;  1MKE A;  1S1Q B;  2GBN A;  3NZS A;  5DI9 B;  1RRB A;  2KDE B;  1WE7 A;  2KUP A;  2ZPN A;  4A6K A;  1R4M I;  3A9K B;  3R66 C;  4JIO U;  4PYZ A;  3WAO A;  3VTV A;  4LDT B;  1LQB A;  4GDL A;  3A1Q A;  4J6I A;  3D8E A;  3ZW3 A;  4NNJ B;  4HAZ B;  5CHW A;  5E6N A;  2DX1 A;  4AOF A;  3A33 B;  2MDX A;  2ZEQ A;  3PTF C;  2ABD A;  5CX3 A;  4AJY B;  2BYF A;  2IZV B;  2BKF A;  1LXD A;  2DYO A;  4HVB A;  3VXW A;  1WZ0 A;  4HAW B;  2IBI B;  2KC2 A;  2MSE D;  4GGQ A;  1NBF C;  4E71 A;  2K8C A;  4K81 A;  3B0A A;  2D4Q A;  2DZI A;  3A98 B;  3HW2 B;  1WFY A;  1E8X A;  1N3H A;  2CQU A;  2D3G A;  2DYM A;  4IM2 A;  3L16 A;  4FUL A;  3PSC A;  1DRO A;  4TUU A;  2WX0 A;  1X11 A;  2YT0 A;  4PQ0 A;  3H7S A;  1C1Y B;  4AP4 C;  2O6V A;  4HHV A;  5J17 A;  1WG7 A;  2LUE A;  3NHE B;  3A4R A;  3H7P B;  4MEL A;  1ZC3 B;  1LM8 B;  2COP A;  3M63 B;  5LOP B;  1TZ1 A;  5GOW B;  3DCG A;  1B55 A;  4ANX A;  1E8Y A;  4K1R B;  1KM7 A;  3M62 B;  1I7A A;  3VVW B;  1IYF A;  5LXI B;  4CO7 A;  3BJI A;  4B95 A;  1ZVR A;  4MH0 E;  2RR9 A;  2KVR A;  1WGH A;  3RUI B;  1WMH B;  3KUZ A;  3VAW A;  2K25 A;  4G3X B;  2DYN A;  1WRD B;  1IPG A;  4WWO A;  2MLB A;  1TTN A;  3R3M A;  2UWQ A;  2NS5 A;  3A8Q A;  3GZN I;  4W9E A;  1XKE A;  3VH4 B;  1V9J A;  4WAA A;  4OVV A;  3FLV A;  1OMW A;  2I1K A;  1UD7 A;  4FAD A;  5J3Y A;  2Z0Q A;  3OJ3 A;  3A9J B;  2KQS A;  2LXA A;  4WJP A;  5J2R A;  2JZZ A;  1E90 A;  1Z87 A;  2DHZ A;  2RD0 A;  2YRY A;  5L95 C;  1TXD A;  2HD5 B;  5DPT A;  1XD4 A;  1WM2 A;  4D0N B;  1V88 A;  2KTR B;  5C79 A;  1XD3 B;  2D11 A;  2JUO A;  1WJN A;  3H6N A;  2D9V A;  4F8C B;  3AUL A;  1V5U A;  4M8N A;  1YD8 U;  3WIM A;  2LGY A;  1E7V A;  2FID A;  2RVB B;  1V5T A;  4I6P A;  1WY8 A;  5JH5 C;  4ICV A;  2MW5 A;  4XC2 A;  3DXC A;  3DVG Y;  3PVU A;  2MP2 B;  2GJY A;  1FAO A;  2CR5 A;  3IHP C;  1P98 A;  1KOT A;  3Q3J A;  2K00 A;  2GBM A;  2LRW A;  2KNB A;  1E5W A;  3PRZ A;  3APD A;  1TQZ A;  2BWE S;  1HB8 A;  4BKS D;  1KLV A;  4PNK A;  3A8P A;  3VDZ A;  3GOE A;  2UVM A;  3RYT A;  4EZK A;  2JP2 A;  4CHM A;  2XK5 A;  3PPA A;  2CY4 A;  5DHA B;  5EFX A;  2O2V A;  2MBE A;  1UBQ A;  3DVN V;  2PE6 B;  1GUA B;  2LBB A;  2GBK A;  3JVZ X;  5L83 A;  4AWJ A;  4L6E A;  5FI1 A;  1NVL A;  3QX1 A;  2LOX A;  2LVQ A;  5C1Z A;  4NAW A;  4XWX A;  2AL6 A;  2MX2 A;  2N9E B;  3CSF A;  4MSQ B;  1EO6 A;  3UIO B;  2PEA A;  2NBW B;  1MIX A;  4W9L A;  1RAX A;  1J0G A;  5CLL B;  5DPS A;  2IO2 B;  3D32 A;  2L1C A;  1W1G A;  2DX5 B;  3BY4 B;  3JSV B;  4MJS A;  2KQ7 A;  4IM0 A;  5C6R A;  3SUZ A;  2KX3 A;  2C5L C;  4RM8 A;  1P0R A;  1JRU A;  3QIJ A;  1MAI A;  4WJO A;  3F0W A;  3DBR I;  2DZJ A;  2YLM A;  3M1I B;  1NTI A;  3PS6 A;  4ZDV A;  3T9L A;  4EUT A;  4BKG A;  3QA8 A;  3A9K A;  5HKH A;  4MEM A;  2Z0P A;  3VFK A;  4FHK A;  4B6W A;  4FN2 A;  3DXE A;  5BO4 B;  3SV1 A;  2G4S A;  2REX A;  4A3P A;  1NTV A;  3UGB B;  1OY2 A;  3SYX A;  4Y94 A;  5J3Q A;  2YS1 A;  4I6L B;  2DZM A;  2IFS A;  2LYD A;  5DPR A;  1Y5O A;  3DQV A;  5KHQ A;  4HAV B;  1V49 A;  3FP5 A;  2VRW B;  1P3Q U;  2C60 A;  1UZX B;  1I35 A;  4KV2 A;  4K7S A;  2ZCC A;  2Y5B B;  5LON B;  2R09 A;  1BTN A;  1I42 A;  3ZTC A;  1YQB A;  2J0K A;  2HTH B;  2B3A A;  3PSE B;  3EFU A;  5J3T A;  3KUD B;  3PLV A;  4BBN C;  5L81 A;  2FAZ A;  4BOS C;  3L10 B;  3ALB A;  1EAZ A;  2KXJ A;  3VHT C;  1RFA A;  4IWO A;  4KDL B;  3KY9 A;  4EEW A;  5C23 A;  5DCN A;  2XEW A;  3TL5 A;  2JXX A;  3DDC B;  2M1M A;  2DKQ A;  2L8J A;  3H7P A;  5J18 A;  2LG1 A;  4IOY X;  2MCN B;  2I1J A;  1P3R A;  2EMS A;  3VTW A;  2GBR A;  2DLW A;  3V60 A;  4A6F B;  3KYD D;  2RSU A;  4HK2 A;  1U5G A;  3RZF A;  1YX6 B;  3D8F A;  2OQB A;  3ZNI D;  2MBB B;  4W9H A;  4N9F 4;  2W2W A;  2C7M B;  1WGD A;  2WX1 A;  2Z0E B;  1LW3 A;  2D9X A;  3IVF A;  4DBB A;  1XCG A;  1WE6 A;  2L00 B;  3DOW A;  4ASW C;  4NQK E;  1E8Z A;  2YSZ A;  2NMB A;  5DHF B;  3PZD A;  4II2 B;  2ZPY A;  3A9J A;  5D6J B;  5DPW A;  4XX5 A;  1WYW B;  2N23 A;  2LVO A;  3ZO5 B;  2KWC A;  2VKI A;  4KHO A;  1P9D U;  2LRU A;  4PS3 A;  4EZL A;  2N0Y A;  3DVG X;  3PT2 B;  4EKU A;  2CHW A;  4DHJ D;  2G45 B;  1BT0 A;  1G6J A;  2LZ6 A;  4Z2M B;  1WX8 A;  2MFQ A;  1H4R A;  1U29 A;  2C9W B;  4NPN A;  5D3W A;  1V89 A;  3UQA A;  1H8C A;  2DYB A;  2HE7 A;  2MP2 A;  2Q13 A;  5JZE B;  3NOB A;  3H9D A;  4GIV A;  3L54 A;  1I2H A;  2DAJ A;  5AZG A;  4F1S A;  3ZNZ B;  2COC A;  2M38 A;  4MSM B;  3HIZ A;  1WIA A;  4WJN A;  2OJR A;  1PMS A;  2RSG A;  2LD9 A;  2M0X A;  2G3Q B;  1SHC A;  1WJ4 A;  5KQ1 A;  1FGZ A;  5CHV C;  4GMV A;  3D8D A;  4W9F A;  2EMT A;  4B6H A;  2Y8F A;  4KHB B;  2ROZ B;  1M94 A;  1WR6 E;  1KJT A;  1KZG A;  4F7U P;  5JLJ B;  3AI5 A;  3JW0 X;  4DX9 0;  1ZKH A;  2XBB C;  4MGZ E;  4KZC A;  3V6C B;  2NR2 A;  1Q1O A;  3GYO A;  3KRW A;  3W1S A;  4PS8 A;  5EDS A;  2HRJ A;  3RCP A;  4C0A A;  2P0D A;  4X57 B;  2YVC A;  2DZK A;  1X1F A;  3JYU A;  3CXB B;  2KTF A;  2ELA A;  1Y19 B;  1P5T A;  2DX5 A;  4KZ0 A;  2EJ8 A;  1AAR A;  3JSV A;  1VD2 A;  2IY1 B;  3UIN B;  2H7E A;  2OOB B;  3ZVV A;  1W1D A;  2G35 A;  2DHJ A;  2HJ8 A;  4ICU A;  4MGY E;  3QQ8 B;  3Q3F A;  3M95 A;  2ELB A;  3W1S C;  4IAP A;  1V6E A;  1SGH A;  4NQL B;  1XR0 B;  3CIK A;  3NSU A;  2JT4 B;  2COD A;  3ECI A;  3QC8 B;  2X18 A;  5AZH A;  1RRP B;  3AU4 A;  2C7N B;  3SU8 X;  2LUL A;  1F9J A;  3KRX A;  2PPH A;  3CMM B;  3LJU X;  2JY6 A;  3VIA A;  3EEC A;  2D07 B;  3DBS A;  3O96 A;  4FBJ B;  2CY5 A;  4P7I A;  2XQN M;  4BBK A;  2LAS A;  3ZVR A;  2FUH B;  3VUY A;  3HM3 A;  2P0F A;  5FI0 A;  2K2J A;  3TFM A;  3IG3 A;  3V61 A;  2ZJD A;  3FSS A;  2NVU I;  2K2U A;  4A20 A;  2QHO A;  3KYC D;  4NSW A;  1BWN A;  1BAK A;  2CS4 A;  4DHZ B;  4GZU A;  1Y8R C;  3ODW A;  3SO6 A;  2DN6 A;  3UZT A;  2HTH A;  5DH9 B;  3ML9 A;  2BWF A;  1UPR A;  1GNU A;  3HM6 X;  4MGK E;  2N1W A;  4WWP A;  2FCQ A;  2GMI C;  2FJ9 A;  1DDW A;  1BTK A;  2JWZ A;  2P8V A;  4WWN A;  4HB4 B;  2LKO A;  3GYP A;  2IY0 B;  3MTN B;  4DXA B;  1YIW A;  3V62 A;  4A3O A;  3V5W A;  1WXA A;  4FLH A;  3I3T B;  2DHK A;  4A6F A;  3UF8 A;  2UYZ B;  1MK7 B;  5C16 A;  2LI5 A;  2R2Q A;  3QWM A;  3QJZ A;  2KFK B;  3WYF B;  2NBU A;  3B08 A;  3PVW A;  1DYN A;  3TMP B;  4WSF A;  2RUK B;  5GMV A;  3DXD A;  2QKL A;  3ODX A;  5D2M B;  1WJ6 A;  2N9X A;  3T06 A;  4CHJ A;  1OEY J;  2KN5 A;  4LCD E;  1TJ6 A;  4BBN F;  3VTU A;  4RM9 A;  3IFW B;  4M0W B;  1WH3 A;  3PHW B;  1QC6 A;  2RGF A;  1EGX A;  4JL9 A;  3WAL A;  2D9Y A;  5G55 A;  3AXC A;  3KW5 B;  4B9K A;  4HB3 B;  5FR6 A;  2W2X D;  3V6E B;  2MQJ A;  1W1H A;  1MIZ B;  3X23 A;  1WF9 A;  5TR5 A;  4HB2 B;  3RD2 A;  1SE9 A;  4G0N B;  2JRI B;  5D27 A;  4DHJ B;  2CAY A;  1HB6 A;  2COF A;  4WQO B;  4MDK E;  1KI1 B;  3ZNG C;  4NY0 A;  1VCB A;  4K2P A;  4II3 B;  3AU5 A;  5D7G A;  3ZUN A;  3L13 A;  1U5E A;  3NS8 A;  4K17 A;  5C5B B;  1T0Y A;  2BYV E;  4LJP B;  2KJR A;  3DBL I;  1IP9 A;  1V61 A;  5D3X A;  4DK5 A;  4TV3 A;  1RJ2 A;  4AJW A;  2ZNV B;  4HLE A;  4BKS A;  4E3C A;  4MT7 A;  3SD5 A;  3R7R A;  3ODO A;  3NY5 A;  4YL8 A;  2DFK A;  1P1A A;  2KC1 A;  3N30 A;  3QHT A;  1WGQ A;  2LWP A;  2JRH A;  3T8M A;  2FDQ A;  1WI1 A;  1GJZ A;  4JGH B;  2KFJ A;  2GCL A;  4BOZ B;  5HE3 A;  1P6S A;  4TQ1 A;  1WR1 A;  3SHQ A;  2BKR B;  2KO3 A;  2LGD A;  2N1V A;  3WAP A;  5HE2 A;  1UH6 A;  4W9I A;  2I5C A;  4PYU A;  3AJ4 A;  2LJ5 A;  1AWE A;  2G4D B;  1YJ1 A;  4F7H A;  2FIF A;  2PJH A;  2MWN B;  2Z0O A;  2MA9 B;  1PQS A;  2V3S A;  3R7Q A;  5E6P A;  4ZYN A;  2RGN B;  4HAX B;  4W9D A;  5KHO A;  3DPD A;  2KOX A;  2Y8G A;  3APF A;  4IG7 B;  3EHV A;  1MK9 B;  2J0M A;  4HDQ A;  2NPT B;  3PVL A;  2NZ8 B;  4HB0 B;  1WMH A;  4DDI D;  4IW0 A;  1UNP A;  2MWS B;  1FGY A;  3KZ1 A;  2YS5 A;  2XK5 B;  2V4L A;  1UBI A;  3HHM A;  1WXM A;  2ZVN A;  2WH5 A;  2L05 A;  2GS0 A;  4K7W A;  1L2N A;  3ZTD A;  1ST7 A;  1ZW7 A;  1XQQ A;  5G2N A;  4DBG A;  1ZGU B;  2CKH B;  2VSZ A;  2KTR A;  2O6V D;  2WYQ A;  3TJP A;  4HAU B;  3RZW C;  1EVH A;  3PHX B;  4GXB A;  2D9W A;  4BVU C;  3HK0 A;  4M8M A;  2ZVO A;  2VRR B;  3QAR A;  1WJM A;  1NU2 A;  4IFS A;  2BCJ A;  2WWZ A;  2CB8 A;  4HCP B;  1PLS A;  2KHW B;  4CHK A;  4WVF B;  4KSK C;  4IUM B;  4GDK B;  3PGE A;  4I6N B;  3QWZ B;  3FEH A;  4DWF A;  4FJZ A;  2IO3 B;  2KZR A;  5JP4 A;  1LFD A;  1DDM A;  1V5M A;  3ZDT A;  2KLC A;  3ENE A;  3EC8 A;  2L0F A;  1UEF A;  2ASQ A;  2UZR A;  2K8B A;  2KGX B;  1FB8 A;  1X05 A;  2MKR A;  1K5G B;  2J0J A;  3P2B A;  2KFK A;  2N4F A;  2BPS A;  2GCJ A;  4JQW C;  4ANV A;  1Z5S B;  5JHA A;  5LXH A;  3VOQ A;  5AEK B;  2YT1 A;  4EFO A;  1DBH A;  2NBV B; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  1EF1 A;  5LLI A;  1FHW A;  1FOE A;  4F7Z A;  3BWU D;  3L08 A;  1T0R C;  1UEL A;  3N32 A;  4MM3 B;  2VH1 A;  1X1M A;  1VR9 A;  1X86 A;  2NTS A;  4NAM A;  3AEB B;  2DNF A;  3SFE B;  3SDL C;  1LB1 A;  1WVH A;  3Q3M C;  3EUB 2;  4IM3 A;  1Z2M A;  3AED B;  2HJ1 A;  3GE8 C;  4OVU A;  3K9P B;  2A5U A;  5IP4 D;  3HRD D;  1IRS A;  3H8H A;  4W9K A;  4XZ4 A;  3LDZ E;  1I7H A;  1ZYI A;  4ZRJ A;  2L7R A;  3QK0 A;  2KWV B;  3H1U A;  1E7U A;  4M0W A;  3ABV B;  2D2Q A;  1Q0W B;  1Q10 A;  2FCN A;  3CWI A;  3BK2 A;  4TKN A;  1GPX A;  1XOD A;  3AV8 A;  3VRA B;  5GXG B;  1U27 A;  1T5X D;  1U4A A;  2B76 B;  1V5O A;  1DOI A;  4US8 A;  3O65 B;  2FCS A;  3OLM D;  3WAM A;  3PLU A;  3OAW A;  4IWP A;  3MHS D;  4ANW A;  2N7D A;  2KDB A;  2AYO B;  2CHZ A;  4A5K A;  4HXD A;  1SIJ A;  4KHA A;  4K7U A;  2K6D B;  4DIX A;  2PMV A;  1TKE A;  2BYT A;  3F5R A;  2CHX A;  1TGZ B;  3ZRC A;  4HEA 1;  2Z0D B;  2WXQ A;  1NDD A;  3CF6 E;  2DKP A;  2OTX A;  1FIQ A;  2N7E A;  3AEC B;  4WIP A;  1K8R B;  3AMZ A;  4KIK B;  4CQN A;  1XT9 B;  3PP2 A;  4E74 A;  4M02 A;  3WCQ A;  3BIN A;  3C8Y A;  2ROV A;  2WDT B;  2MRP A;  3MC8 A;  4DHZ E;  5KCV A;  4N59 A;  5JHH A;  2BYE A;  2J59 M;  4JKD A;  1L7Y A;  2YF0 A;  4IWQ A;  2RPQ A;  4FHJ A;  2CU1 A;  4GSW A;  2RRF A;  3P4Q B;  4EZJ A;  3U8Z A;  1V86 A;  4R3D A;  3I57 A;  1WGU A;  1TY0 A;  3RT3 B;  5C5B A;  4JX1 C;  2K49 A;  4XYC A;  4WJ7 A;  1F77 A;  3W1Y A;  3FM8 C;  5IOI A;  3ML8 A;  2KVZ A;  1AQC A;  3ONS A;  4N58 A;  1ZPS A;  3UQB A;  3S2A A;  1KF6 B;  5E6O A;  3DHI C;  2IO1 B;  1ZDV A;  4JK8 A;  2EKE C;  3MPX A;  2D3A A;  1U5D A;  3EFC A;  2BBC A;  1CMX B;  4LNK A;  3VR9 B;  2COA A;  1WGY A;  3HUI A;  4F7G A;  3ZJV A;  4JKG A;  4MK0 A;  3TEZ A;  1WX7 A;  1WGK A;  4K2O A;  2JZP A;  2MBQ A;  3MC0 B;  3FVC A;  1V81 A;  3VUX A;  1ZOY B;  2FE8 A;  1YN5 A;  2QCZ A;  2MBO A;  4JLC A;  5JHG A;  2N9P C;  1WX9 A;  3U30 A;  2BGF A;  1SIF A;  4Z2N A;  4HPM B;  4WJQ A;  4DDG D;  2QKM A;  1V5P A;  1E7P B;  4RCO A;  3KH0 A;  2AL3 A;  1UGM A;  2H7D A;  1FRD A;  4YON A;  1QZE A;  2ZNV C;  3FIL A;  2PTL A;  5H92 C;  1HEZ E;  3RCZ A;  1K5D B;  5CTR C;  3I5J C;  5FKA C;  2X0S A;  2W9N A;  1ISN A;  1WJ1 A;  5C3J B;  5MPO A;  3DBH I;  2N0S B;  4LDT D;  2IYB A;  1HA5 A;  2LXC A;  1JCK B;  1GOZ A;  1WI0 A;  2NMQ A;  1QOA A;  5HE0 A;  4AUQ C;  4MY6 A;  3TW1 A;  1OQR A;  3TBL D;  1U5F A;  1N5X A;  1MPH A;  3L4P A;  2JXT A;  2K8H A;  1XX0 A;  4EE2 A;  2RLO A;  4DX8 A;  3WA0 A;  4RNA A;  1R4N B;  4RGT A;  2DTC A;  1RLF A;  5AUK A;  4NJ7 A;  1V97 A;  2KCJ A;  4HAT B;  4PT5 A;  3RUL A;  1TT5 B;  1IGC A;  2K39 A;  1XLP A;  3PG7 A;  1RFK A;  4GDL B;  2KLG A;  1J8C A;  2M17 A;  2NPT A;  3A1Q B;  1C79 A;  2LUM A;  3ZIM A;  1I4Q A;  1H10 A;  3ZKJ C;  1XCT L;  2M14 A;  2DAF A;  1DOY A;  1I4G A;  2KX0 A;  2DYQ A;  3TIX A;  3U7D A;  5KQ4 A;  3V05 A;  1FHO A;  2JZ3 B;  3ZNH B;  5HG2 A;  3PEG A;  2V1Y A;  2LMC A;  4MGI E;  3CST A;  1D5Z C;  3ML4 A;  1S3S G;  4FJV B;  1ACC A;  1ZDX A;  3VRB B;  1MPE A;  3WAN A;  1WGR A;  2MBH A;  2WU2 B;  4KVG B;  4BKT A;  2V0G A;  4ZRK A;  2GOW A;  1OQN A;  2UZS A;  4EJN A;  2Y7B A;  1WZ3 A;  3RFZ B;  4GU2 A;  2M19 A;  1Q67 A;  3TCA A;  4EOY A;  4USA A;  1E6E B;  2KMC A;  3CIR B;  5EE0 A;  4YSY B;  4W9C A;  2P0H A;  2UU7 A;  2QIE B;  2BF8 B;  3DWG C;  2JF5 A;  2YEP B;  3DHH C;  1Q5W B;  3PRM B;  1UNS A;  4L1B A;  4G50 A;  1C78 A;  5IJM A;  4NZL B;  3NJT A;  1A5R A;  2WU5 B;  4BFR A;  2PLP A;  4ANU A;  2KYW A;  4HDO A;  5CLQ B;  2D9Z A;  2KUQ A;  3DWM A;  4LJO B;  2LGI A;  4HJK A;  2O6V B;  5BMH A;  2KT7 A;  4GDK A;  3PZ8 A;  2LOZ A;  3N3K B;  2MEK A;  4GOC A;  3VUW A;  2BB5 A;  5D3V A;  2RDG A;  3P4P B;  2ZZP B;  3KSY A;  1NI2 A;  2IGD A;  4W9G A;  1V80 A;  4CYE A;  3OJ4 B;  3MFG A;  3LYY A;  1X1G A;  4ZRI A;  1FHX A;  1FXT B;  1LO5 D;  3LXF A;  1OQY A;  2KAN A;  1ACA A;  4L1R A;  2E3T A;  4NJ6 A;  2EC1 A;  5D3Y A;  3SNH A;  1R4M B;  2CRF A;  2V76 A;  4LNN A;  3TEW A;  4KDI C;  3RNF C;  4H8S A;  2K1F A;  2KJH B;  3PRE A;  2WXH A;  3N1Z C;  3TO1 A;  1VZ8 A;  4HWI B;  2L0T A;  4FJY A;  2DHI A;  2JPH A;  1D3Z A;  1HBK A;  3ZRF A;  2KKC A;  1EUV B;  2RPV A;  2KK8 A;  1WXS A;  3X0W A;  3VQI A;  2I5F A;  3KVF B;  3AH7 A;  2LGX A;  1YOV B;  5CHF A;  1UWX A;  1GC6 A;  3OAN A;  2LEK A;  1ZM0 A;  2IGG A;  2PE9 A;  3ZYY X;  3E9O A;  3QCA A;  3PRP B;  1QQG A;  2LHE A;  4PS7 A;  2Z59 B;  1M7E A;  3A4S C;  3BZD B;  2YS3 A;  2NBV A;  2RQ1 A;  2BVC A;  3Q8C A;  2AEH A;  2DA0 A;  4GPT B;  2DLB A;  1UNR A;  1GC7 A;  4IC7 B;  3MJ5 A;  2L32 A;  1NTY A;  1JRO A;  1PYW D;  4MM3 A;  3DHG C;  4GB9 A;  1C4A A;  2PZ1 A;  2WDR B;  2IO0 B;  4IDI A;  1OEY A;  2KR0 A;  3K9O B;  4HKQ A;  4KAX B;  3B2F A;  4IKG A;  4HPL B;  3P4S B;  2FNJ B;  1K52 A;  2R0D A;  1FNV A;  1WJU A;  2L2I A;  2M4N A;  3LJ3 A;  4G11 A;  1XO3 A;  3RNE C;  1FO4 A;  3ULC A;  1VRA B;  2BQQ A;  2NCN A;  3KUC B;  1OTR B;  3UIP B;  1FFV A;  3N7C A;  3ZDM C;  3AE8 B;  1WXV A;  1EF5 A;  1HE8 A;  1PFJ A;  2H88 B;  2LVP A;  4FA6 A;  3IBE A;  2L76 A;  1KZ7 A;  3B1L X;  3QAQ A;  3A58 A;  1DDV A;  1E8W A;  2KD0 A;  3M3J A;  3Q14 C;  1UNQ A;  1CZP A;  1XLQ A;  1J0W A;  2ADZ A;  2L3Z A;  3TVV A;  2GB1 A;  3C0R B;  1EU3 A;  3VH3 B;  4TQ0 A;  1GG3 A;  2J7Q B;  2YT2 A;  1R4N I;  3L0W B;  2WXR A;  3MJW A;  2JVC A;  5HE1 A;  2DEN B;  3PV1 A;  1C3T A;  4KIK A;  4JKE A;  4QAY A;  4RMA A;  1VBG A;  2KDF B;  4ZRQ A;  3ZGZ A;  2IYD B;  2I38 A;  1JRP A;  1GAQ B;  2MH7 A;  3ZXR A;  1WGG A;  2C7H A;  1J19 A;  1ZSQ A;  2AWT A;  1WM3 A;  3P6A A;  3RNG C;  1YN4 A;  2X8X X;  3P7Z A;  4TYZ A;  3BVG A;  4P1B C;  2W55 A;  2O2V B;  1LGR A;  1WYG A;  2FJL A;  2ZCB A;  5HFY A;  1RYJ A;  2ON8 A;  4GN1 A;  2KJ6 A;  4JWU C;  2PVO D;  4GMX B;  2K6Q A;  2KDI A;  4C7Y A;  1WSP A;  3GZN B;  4URK A;  3G9W A;  2DIK A;  4NAW B;  2KIE A;  2NTT A;  3B9J A;  1MG8 A;  2D10 A;  3MDB C;  1MFW A;  2KMA A;  3DVN U;  1UPQ A;  2FCM A;  1KBL A;  5BYS A;  4A6H A;  3SFD B;  4EMO A;  1TBE A;  5AZF A;  2W2X C;  1TS2 A;  3NZU A;  4RGO S;  3ZLZ A;  1QIL A;  1VZ7 A;  3EPY A;  2GBJ A;  2R2O A;  2KWU B;  3L17 A;  4HCN B;  5LNK 1;  2A4Z A;  3APC A;  2WLB A;  5IA7 A;  2X38 A;  3ULB A;  3QBV B;  1L5P A;  1YX5 B;  2M8S A;  2RNR B;  4N6E B;  3HQC A;  2IDY A;  5DIF B;  3FC4 A;  4ACF A;  5JHB A;  4HAY B;  2VZK D;  5IAA C;  3TUO A;  3MHZ A;  1M7R A;  1MJD A;  1HTO A;  2L52 A;  3RNB C;  1EWC A;  2KMM A;  4MJS B;  1V2Y A;  2N9L A;  1ZC4 B;  2E2X A;  5D94 A;  1SSN A;  4KSL C;  4W9J A;  2K3U A;  1OGW A;  1U2B A;  1FPY A;  1F52 A;  1JML A;  1MKE A;  1S1Q B;  2GBN A;  2LHD A;  4M00 A;  3NZS A;  5DI9 B;  1RRB A;  2R2Y A;  1YN3 A;  3NVW A;  1QOB A;  2KDE B;  1WE7 A;  2KUP A;  2ZPN A;  4A6K A;  2YEP F;  1R4M I;  3A9K B;  3R66 C;  1ZXI A;  4JIO U;  4PYZ A;  1CQV A;  3WAO A;  1N60 A;  3NVY A;  3VTV A;  4LDT B;  1UF0 A;  2OJW A;  1LQB A;  4GDL A;  3A1Q A;  4J6I A;  3D8E A;  3ZW3 A;  4NNJ B;  2KAC A;  3SBT A;  2GRI A;  4RGM A;  4JE3 B;  4HAZ B;  5CHW A;  5E6N A;  2BS4 B;  3Q2A C;  4DXF A;  1BXT A;  2ICI A;  2DX1 A;  3I63 C;  4AOF A;  3A33 B;  2MDX A;  1FNU A;  3T3N A;  2ZEQ A;  2HDE A;  3PTF C;  2ABD A;  4P16 A;  5CX3 A;  1TYG B;  4AJY B;  2BYF A;  2IZV B;  2BKF A;  3T3O A;  4JPS A;  4OSN A;  1LXD A;  2KDM A;  2DYO A;  4HVB A;  2H89 B;  3VXW A;  1WZ0 A;  4HAW B;  1C76 A;  2IBI B;  1DIK A;  2BT6 A;  2KC2 A;  2I2Y A;  4XGA B;  5BYR A;  1T0Q C;  2MSE D;  4GGQ A;  1NBF C;  2M56 B;  4E71 A;  2K8C A;  2W82 A;  4K81 A;  3B0A A;  2D4Q A;  2DZI A;  2FJU B;  3EA6 A;  2AX5 A;  3A98 B;  3HW2 B;  1WFY A;  1E8X A;  3B77 A;  1QQR A;  1MI0 A;  2RDH A;  1N3H A;  3DCX A;  2CQU A;  1C4P A;  2D3G A;  1L4Z B;  2DYM A;  4IM2 A;  1FXI A;  3L16 A;  5TSS A;  4FUL A;  3PSC A;  1DRO A;  4TUU A;  2WX0 A;  1X11 A;  2JU6 X;  1SJH D;  2YT0 A;  4PQ0 A;  3H7S A;  2N7J A;  1C1Y B;  4AP4 C;  4TMA B;  2O6V A;  4HHV A;  3Q3N C;  5J17 A;  4ZOH C;  4HRO A;  1WG7 A;  2LUE A;  3NHE B;  1P7E A;  3A4R A;  3OWE B;  3H7P B;  4B0E A;  4MEL A;  4YTM B;  1ZC3 B;  1LM8 B;  2COP A;  3DBR B;  1BML C;  3M63 B;  5LOP B;  2V4I B;  1TZ1 A;  1VLB A;  5GOW B;  3DCG A;  1N5W A;  1B55 A;  4ANX A;  1E8Y A;  4K1R B;  1KM7 A;  3M62 B;  1I7A A;  3VVW B;  1IYF A;  5LXI B;  4CO7 A;  1XF5 L;  3BJI A;  4B95 A;  1ZVR A;  4YXD B;  4JK9 A;  4MH0 E;  2RR9 A;  2KVR A;  1WGH A;  3Q8B A;  1WMH B;  3RUI B;  1IUE A;  3KUZ A;  3VAW A;  4A55 A;  3IT4 B;  4PK1 A;  2K25 A;  3BII D;  4G3X B;  2DYN A;  1M4V A;  5JVL A;  3NUH B;  1WRD B;  1IPG A;  2QDF A;  4WWO A;  2MLB A;  2Z8L A;  1TTN A;  3R3M A;  3ZXV A;  3BVM A;  2UWQ A;  2NS5 A;  3A8Q A;  3GZN I;  4W9E A;  3GE3 C;  1XKE A;  3VH4 B;  1V9J A;  4WAA A;  4OVV A;  3FLV A;  1SJE D;  1OMW A;  2QSD A;  2I1K A;  1UD7 A;  1N63 A;  4FAD A;  2Z59 A;  5J3Y A;  2Z0Q A;  2QC8 A;  3OJ3 A;  3A9J B;  2KQS A;  2LXA A;  2WDQ B;  4WJP A;  5J2R A;  2JZZ A;  1E90 A;  4OZB A;  1Z87 A;  2DHZ A;  2RD0 A;  2YRY A;  3AEF B;  5L95 C;  2CJN A;  1TXD A;  2HD5 B;  5DPT A;  1XD4 A;  1WM2 A;  4D0N B;  1MHX A;  1V88 A;  3HIE A;  4BZA A;  2KTR B;  4D2K A;  5C79 A;  4XWT A;  1XD3 B;  3E56 A;  1HXY D;  2D11 A;  3HVD A;  2JUO A;  1WJN A;  3H6N A;  2R82 A;  2D9V A;  4F8C B;  3N20 C;  1SXT A;  2BB6 A;  3AUL A;  1V5U A;  4M8N A;  1YD8 U;  3WIM A;  3AEE B;  2SEB D;  2LGY A;  1E7V A;  2FID A;  2WXI A;  3AE2 B;  2RVB B;  2XNA C;  1ET6 A;  1V5T A;  2W3S A;  4I6P A;  1WY8 A;  5JH5 C;  4WH4 A;  1E0Z A;  4ICV A;  2MW5 A;  4XC2 A;  5EE3 A;  4JKF A;  3DXC A;  3DVG Y;  3PVU A;  2WHI A;  2MP2 B;  2GJY A;  1FAO A;  2CR5 A;  5BYQ A;  3IHP C;  1MI1 A;  1P98 A;  1KOT A;  2V9H A;  5AUI A;  3Q3J A;  2K00 A;  3AE7 B;  2GBM A;  2K22 A;  2LRW A;  1F2R I;  3PO0 A;  1N6Z A;  3EGR A;  1TIF A;  2KNB A;  1E5W A;  3PRZ A;  1E10 A;  1STE A;  3APD A;  1TQZ A;  4H2A A;  2BWE S;  1KH0 A;  1HB8 A;  4BKS D;  1KLV A;  2K5P A;  1FEH A;  1N61 A;  4PNK A;  4GNK B;  3A8P A;  3VDZ A;  3N9Y C;  3GOE A;  1FCC C;  2UVM A;  3RYT A;  4EZK A;  1FMA D;  4YSZ B;  2JP2 A;  4CHM A;  2XK5 A;  3PPA A;  4QJ5 B;  2CY4 A;  5DHA B;  5EFX A;  2O2V A;  3NWF A;  2MBE A;  3BYT B;  1UBQ A;  3DVN V;  2PE6 B;  1JWS D;  1GUA B;  2LBB A;  2GBK A;  3JVZ X;  5L83 A;  4AWJ A;  1J7C A;  4L6E A;  2G1E A;  5FI1 A;  1JW9 D;  1NVL A;  3QX1 A;  3VR8 B;  2LOX A;  1A70 A;  1NYR A;  2KN4 A;  2LVQ A;  5C1Z A;  3I9V 1;  4NAW A;  1OQQ A;  4XWX A;  4B0M A;  3GP7 A;  2JX5 A;  1NVI D;  2R61 A;  1I4R A;  1NI3 A;  4LLG M;  2AL6 A;  2MX2 A;  2N9E B;  3CSF A;  2IND C;  4MSQ B;  4OT1 A;  1ZXH A;  5FR3 A;  1EO6 A;  3IAS 1;  3UIO B;  4YWG G;  4A6Q A;  4K3C A;  2PEA A;  3Q8F A;  2QIL A;  2IGH A;  2NBW B;  3Q69 A;  1MIX A;  4W9L A;  1RAX A;  1J0G A;  4P1C C;  5CLL B;  2IO2 B;  5DPS A;  4FXC A;  3D32 A;  2L1C A;  1W1G A;  4TSS A;  3B2G A;  1Y56 A;  2DX5 B;  3BY4 B;  3JSV B;  1HTQ A;  4MJS A;  2KQ7 A;  1QT9 A;  2WXK A;  5C6R A;  3BK1 A;  4IM0 A;  3SUZ A;  2KX3 A;  2C5L C;  4RM8 A;  5H8Y E;  1P0R A;  1JRU A;  2G9H D;  3QIJ A;  1MAI A;  4OW0 A;  3ETR A;  4WJO A;  1P7F A;  4ILJ A;  3F0W A;  3U4E G;  3DBR I;  2DZJ A;  2VZK B;  2YLM A;  3M1I B;  1NTI A;  3PS6 A;  1RWS A;  3W2D A;  3AE4 B;  4ZDV A;  2XN9 C;  3T9L A;  4EUT A;  4BKG A;  3QA8 A;  5HHD G;  2VH2 A;  2Q5W D;  3A9K A;  4UDU C;  1DYQ A;  2ZW0 A;  5HKH A;  4MEM A;  1QOG A;  2Z0P A;  3Q6B A;  3V3X A;  3VFK A;  4FHK A;  4B6W A;  4FN2 A;  3DXE A;  1XLO A;  5BO4 B;  3SV1 A;  4KKI A;  4QJ3 B;  3SEB A;  2G4S A;  2REX A;  2EKI A;  4A3P A;  1NTV A;  3UGB B;  3KQ4 A;  1OY2 A;  2RDB C;  3SYX A;  4Y94 A;  5J3Q A;  2YS1 A;  4I6L B;  1GB4 A;  5D3D A;  2DZM A;  2IFS A;  2LYD A;  5DPR A;  1Y5O A;  2WQY B;  3DQV A;  4S17 A;  1F2R C;  1PGB A;  4HAV B;  1V49 A;  5KHQ A;  4KGR A;  3FP5 A;  1MVK A;  2OHF A;  1PGX A;  2VRW B;  1P3Q U;  2C60 A;  1UZX B;  3KWL A;  4LTU A;  1I35 A;  4KV2 A;  1NEK B;  3Q8A A;  4K7S A;  2Y5C A;  1SEB D;  2Y5B B;  2ZCC A;  5BMI A;  5LON B;  1CJE A;  1V1P B;  2R09 A;  1BTN A;  1I42 A;  3ZTC A;  3NWA A;  1YQB A;  1ZP0 B;  2J0K A;  2HTH B;  1T3Q A;  2B3A A;  3PSE B;  3EFU A;  5J3T A;  3KUD B;  3PLV A;  1NYQ A;  2LGS A;  4BBN C;  5L81 A;  2FAZ A;  4BOS C;  4ZHO A;  3L10 B;  4YSX B;  3ALB A;  1IGD A;  2QJL A;  3MC9 A;  1FM0 D;  1EAZ A;  2KXJ A;  3VHT C;  3HSA A;  1RFA A;  4IWO A;  4KDL B;  3KY9 A;  4EEW A;  5C23 A;  5DCN A;  1JWA D;  1FRR A;  1NEN B;  2XEW A;  3TL5 A;  2JXX A;  3DDC B;  2M1M A;  2DKQ A;  2L8J A;  3H7P A;  1YJI A;  2LG1 A;  1E9M A;  5J18 A;  4IOY X;  1D6E C;  4P6V F;  2MCN B;  2Y3A A;  2I1J A;  1P3R A;  2EMS A;  1SF0 A;  2WXG A;  3VTW A;  2GBR A;  2DLW A;  3RPF C;  3V60 A;  1TJE A;  4A6F B;  2LJI A;  3KYD D;  2RSU A;  4HK2 A;  1U5G A;  3RZF A;  2MHJ A;  2FUG 1;  3BYY B;  4ZYS A;  1CK1 A;  5BMG A;  1YX6 B;  4C56 C;  3D8F A;  2TSS A;  2OQB A;  3ZNI D;  5IO9 A;  2MBB B;  4W9H A;  4N9F 4;  2W2W A;  2C7M B;  1L0V B;  1WGD A;  2WX1 A;  2Z0E B;  3ZJT A;  1LW3 A;  2D9X A;  3IVF A;  4DBB A;  1XCG A;  2INN E;  1WE6 A;  2L00 B;  3DOW A;  4O1N A;  4ASW C;  2K8E A;  1FFU A;  4NQK E;  1E8Z A;  4ILG B;  4HPP A;  2YSZ A;  2NMB A;  5DHF B;  3PZD A;  4II2 B;  2ZPY A;  3A9J A;  5D6J B;  5DPW A;  4MH8 A;  4XX5 A;  1WYW B;  2N23 A;  2LVO A;  3ZO5 B;  2KWC A;  2VKI A;  3BVZ A;  1PFD A;  1L0Y B;  2J4X A;  2GI9 A;  4KHO A;  3AN1 A;  4ZHP A;  1P9D U;  2LRU A;  1ZE3 D;  4PS3 A;  4LNO A;  4EZL A;  2N0Y A;  2DBY A;  3DVG X;  1SB3 C;  3RI7 C;  3PT2 B;  4NJC A;  1IBX B;  4EKU A;  1TS4 A;  4LK0 M;  2CHW A;  4DHJ D;  2G45 B;  1BT0 A;  1G6J A;  4ITK A;  2LZ6 A;  4Z2M B;  1WX8 A;  2MFQ A;  1H4R A;  1U29 A;  3AE5 B;  2C9W B;  4NPN A;  3R2T A;  5D3W A;  1V89 A;  4C00 A;  3UQA A;  3TEY A;  1H8C A;  1JDE A;  2DYB A;  2WGS A;  1ZUD 2;  5I2M A;  2HE7 A;  1HQR D;  2MP2 A;  2Q13 A;  3NWD A;  2K9X A;  5JZE B;  4HJG E;  2J52 A;  3NOB A;  3H9D A;  3P1M A;  1B9R A;  4GIV A;  3L54 A;  1I2H A;  2DAJ A;  5AZG A;  4F1S A;  1T77 A;  3ZNZ B;  2COC A;  2Z14 A;  2M38 A;  4MSM B;  3HIZ A;  1WIA A;  1VDV A;  4WJN A;  4RFB A;  1L6V A;  2OJR A;  1PMS A;  2RSG A;  2LD9 A;  2M0X A;  4WAF A;  5JXV A;  2G3Q B;  1SHC A;  3U12 A;  1WJ4 A;  5KQ1 A;  1FGZ A;  3NVZ A;  5CHV C;  4GMV A;  3D8D A;  4W9F A;  1KRH A;  2EMT A;  5EE9 A;  4B6H A;  2Y8F A;  4KHB B;  2ROZ B;  1M94 A;  1WR6 E;  1KJT A;  2BW2 A;  1KZG A;  4F7U P;  5JLJ B;  2HTM E;  3AI5 A;  1J7B A;  3JW0 X;  2MJE A;  1VJK A;  4DX9 0;  1ZKH A;  2XBB C;  4KZC A;  4MGZ E;  3P63 A;  3V6C B;  1FCL A;  2NR2 A;  1Q1O A;  3GYO A;  3KRW A;  4C7Z A;  3W1S A;  2ACZ B;  4PS8 A;  5EDS A;  2HRJ A;  3RCP A;  4OVZ A;  3SBG A;  4C0A A;  2P0D A;  4X57 B;  1EM7 A;  2YVC A;  3NS1 A;  1TS3 A;  2DZK A;  3E9S A;  3U2S C;  1X1F A;  3JYU A;  4US9 A;  1YQ4 B;  3CXB B;  1KTK A;  3RNC C;  2KTF A;  2ELA A;  1Y19 B;  1P5T A;  2DX5 A;  4KZ0 A;  2EJ8 A;  1AAR A;  4C80 A;  3JSV A;  1VD2 A;  2IY1 B;  3UIN B;  4ARI A;  2H7E A;  1WXQ A;  2OOB B;  2INC C;  3ZVV A;  1W1D A;  2G35 A;  3W9C B;  2DHJ A;  2HJ8 A;  4ICU A;  4MGY E;  3QQ8 B;  2D3C A;  3M95 A;  3Q3F A;  1KFY B;  1D5M C;  1UGJ A;  5LG4 B;  2WNM A;  2ELB A;  3R2I A;  1QOF A;  3KWV A;  3W1S C;  4IAP A;  1V6E A;  5D3I B;  4QXA B;  1SGH A;  1L6U A;  4ARC A;  1C77 A;  4NQL B;  1XR0 B;  3CIK A;  3NSU A;  2AQ1 B;  2JT4 B;  4A90 A;  3SR6 A;  2D5G A;  4L2Y A;  4YT0 B;  2COD A;  3ECI A;  3NRZ A;  3QC8 B;  2X18 A;  5AZH A;  1RRP B;  3AU4 A;  2C7N B;  3SU8 X;  1K51 A;  2LUL A;  1F9J A;  5G5H A;  1PDX A;  1F1H A;  3RMK C;  1MHH E;  3KRX A;  3IAM 1;  2PPH A;  3FKY A;  3IXS A;  3CMM B;  5E6J A;  3LJU X;  2JY6 A;  3VIA A;  3EEC A;  3N1X C;  1DOX A;  2D07 B;  3DBS A;  3O96 A;  1L0X B;  3IT6 B;  4FBJ B;  2CY5 A;  4P7I A;  2XQN M;  4BBK A;  2LAS A;  3ZVR A;  2FUH B;  3VUY A;  3DBL B;  1AN8 A;  1AYF A;  2QEJ C;  3Q3O C;  2OED A;  3HM3 A;  2P0F A;  4J3O D;  5FI0 A;  4C4V B;  2K2J A;  3TFM A;  3IG3 A;  3V61 A;  2ZJD A;  3FSS A;  5IKC M;  1J7A A;  2NVU I;  2K2U A;  4AQ7 A;  4A20 A;  5T8I A;  2EEL A;  2QHO A;  3KYC D;  4NSW A;  1V1P A;  1BWN A;  1BAK A;  2CS4 A;  4DHZ B;  4GZU A;  1DGJ A;  1Y8R C;  1RM6 C;  3GS2 A;  3ODW A;  2JQR B;  3SO6 A;  2DN6 A;  4D6W A;  3UZT A;  2HTH A;  2BS2 B;  4XDD A;  5DH9 B;  3ML9 A;  2BWF A;  1UPR A;  4BAX A;  1GNU A;  1OFF A;  3HM6 X;  4MAC A;  4MGK E;  2N1W A;  1GGO A;  4WWP A;  2FCQ A;  2GMI C;  1KC7 A;  2FJ9 A;  1DDW A;  2L1A A;  1BTK A;  2Y5P A;  2JWZ A;  2CU3 A;  2P8V A;  2BS3 B;  4RF0 A;  4WWN A;  1ESF A;  4HB4 B;  2J42 A;  2LKO A;  3GYP A;  4HRS A;  1JQ4 A;  2IY0 B;  3MTN B;  4WUR A;  4DXA B;  3NG0 A;  1UUP A;  2V3N A;  3URY A;  4IOI E;  1YIW A;  3V62 A;  4A3O A;  4REZ A;  3V5W A;  2RMM A;  4XE0 A;  1WXA A;  3ENB A;  1AW7 A;  1YNT E;  4FLH A;  3I3T B;  1KLG D;  3NVV A;  4OZA A;  2DHK A;  1YMH E;  2WP9 B;  4A6F A;  2WXF A;  3MP9 A;  5IRS A;  4XWW A;  3UF8 A;  2UYZ B;  3AE1 B;  1MK7 B;  4JKB A;  5I4D A;  3U7Z A;  5C16 A;  4XDC A;  2LI5 A;  2R2Q A;  2ZW1 A;  3P42 A;  3QWM A;  1HZ5 A;  3QJZ A;  2KFK B;  3WYF B;  2NBU A;  4YTN B;  3B08 A;  2M0A A;  3PVW A;  1T6B X;  1UWM A;  1DYN A;  4JK7 A;  3TMP B;  4WSF A;  3AE6 B;  2RUK B;  5GMV A;  4A8X C;  2IJ0 A;  3DXD A;  1TKG A;  2L83 A;  2QKL A;  3ODX A;  3NW8 A;  5D2M B;  3RNA C;  1K50 A;  1WJ6 A;  2N9X A;  3T06 A;  4CHJ A;  5FK9 C;  1OEY J;  3AE9 B;  1FNW A;  2KN5 A;  4LCD E;  1TJ6 A;  1I4X A;  1WWT A;  3O13 A;  4BBN F;  3J9C A;  4WWM A;  3VTU A;  4HKZ E;  3LB8 C;  4RM9 A;  4MT5 A;  3IFW B;  2KIG A;  2WDV B;  4M0W B;  4WQM A;  1WH3 A;  3PHW B;  2JYE A;  2PKO A;  1GB1 A;  1QC6 A;  2CJO A;  2RGF A;  1EGX A;  4JL9 A;  2LFI A;  3WAL A;  2D9Y A;  2ZKM X;  5G55 A;  2N9K A;  1VZ6 A;  3AXC A;  3KW5 B;  1IBX A;  4B9K A;  5G5G A;  4HB3 B;  1KLU D;  1ROE A;  5FR6 A;  2W2X D;  3V6E B;  2MQJ A;  2WXO A;  1MG4 A;  2GUM A;  1BUI C;  1W1H A;  5I2S A;  1MIZ B;  3X23 A;  2PIA A;  1T0S C;  3OHM B;  1WF9 A;  5IN7 A;  5TR5 A;  4HB2 B;  3RD2 A;  3E9L A;  1SE9 A;  4YTP B;  4G0N B;  2JRI B;  1JWU D;  5D27 A;  1QLB B;  4KGT A;  4DHJ B;  2CAY A;  2WXL A;  2GLS A;  3P4R B;  1HB6 A;  2COF A;  4WQO B;  4MDK E;  1V1O A;  1KI1 B;  2FBW B;  3AE3 B;  4NY0 A;  3ZNG C;  1VCB A;  4K2P A;  4II3 B;  3W5U B;  1XEE A;  3AU5 A;  5D7G A;  1AWD A;  1PGA A;  3ZUN A;  3L13 A;  1U5E A;  3NS8 A;  4K17 A;  1XCQ L;  3W5V B;  5C5B B;  1T0Y A;  2BYV E;  4LJP B;  2KJR A;  3DBL I;  1IP9 A;  1V61 A;  5D3X A;  4DK5 A;  4TV3 A;  1RJ2 A;  4KX6 B;  4AJW A;  2J53 A;  2ZNV B;  3Q8E A;  4HLE A;  4BKS A;  4E3C A;  4MT7 A;  1YQ3 B;  3SD5 A;  4KHB A;  1L4D B;  3R7R A;  3ZJU A;  3ODO A;  1C9F A;  2AQ3 B;  3AM9 A;  2MJ3 A;  3NY5 A;  4YL8 A;  1WRI A;  2DFK A;  1P1A A;  4JKG B;  2JWU A;  2KC1 A;  3N30 A;  2AQ2 B;  2D3B A;  1SBB B;  4JKH A;  3QHT A;  1WGQ A;  2LWP A;  2JRH A;  3T8M A;  2FDQ A;  1K53 A;  3HVZ A;  1HZ6 A;  1WI1 A;  3AEA B;  4JGH B;  1GJZ A;  2KFJ A;  2GCL A;  4L23 A;  4BOZ B;  1V8C A;  3TSS A;  1QF6 A;  5HE3 A;  1P6S A;  4TQ1 A;  1WR1 A;  3N1Y C;  3GB1 A;  4RF1 A;  3SHQ A;  2BKR B;  2KO3 A;  2LGD A;  1TY2 A;  2N1V A;  2INP E;  3WAP A;  5HE2 A;  4HSI A;  1UH6 A;  4W9I A;  2I5C A;  4PYU A;  3FIL B;  3AJ4 A;  1JAL A;  2LJ5 A;  1AWE A;  2G4D B;  1QKZ A;  1I4P A;  1YJ1 A;  4F7H A;  5EE1 A;  1XXG A;  2FIF A;  2PJH A;  2MWN B;  2Z0O A;  1XLN A;  2MA9 B;  4OZC A;  1PQS A;  2V3S A;  3R7Q A;  5E6P A;  4M01 A;  2ONQ A;  2RGN B;  4ILH A;  2SAK A;  4ZYN A;  2E6X A;  4HAX B;  4W9D A;  2PW9 A;  5KHO A;  1FXA A;  3DPD A;  2KOX A;  2Y8G A;  3APF A;  4IG7 B;  3EHV A;  1MK9 B;  2J0M A;  2QMT A;  2PVG C;  3AEG B;  4AS1 A;  4KGS A;  4HDQ A;  1FD6 A;  4JWS C;  1ET9 A;  2WXN A;  4JKC A;  2NPT B;  3PVL A;  4JKA A;  2NZ8 B;  4HB0 B;  1EU4 A;  1WMH A;  4DDI D;  4IW0 A;  4OHJ A;  3FAH A;  4GOU A;  4LNI A;  1UNP A;  2MWS B;  3OG5 A;  2Z13 A;  1FGY A;  3KZ1 A;  2KAJ A;  2YS5 A;  2XK5 B;  2V4L A;  4Q2J A;  3RN9 C;  4S0R A;  1UBI A;  3HHM A;  4RGN A;  2MJD A;  2WS3 B;  1WXM A;  3E9P A;  2ZVN A;  2WH5 A;  2L05 A;  2IPK D;  3UI3 A;  2GS0 A;  4DQO C;  3AB5 A;  4C4V A;  2WXP A;  5M4Y B;  4K7W A;  1L2N A;  1N62 A;  3ZTD A;  1ST7 A;  1JWB D;  1ZW7 A;  1XQQ A;  5G2N A;  1ENF A;  1I4H A;  2K0P A;  4DBG A;  1F0Z A;  1B1Z A;  1ZGU B;  2CKH B;  2VSZ A;  2KTR A;  2O6V D;  2WYQ A;  4A9A A;  4QJ4 B;  3TJP A;  2KQ4 X;  2WXJ A;  5C2T B;  4HAU B;  3RZW C;  1C4C A;  1EVH A;  3PHX B;  1VBH A;  4GXB A;  4CSQ A;  2D9W A;  4BVU C;  3HK0 A;  4M8M A;  2ZVO A;  1SE2 A;  2VRR B;  3QAR A;  1WJM A;  2JSV X;  3PZ7 A;  1NU2 A;  4IFS A;  2BCJ A;  2WWZ A;  4GLS C;  2CB8 A;  1TZO A;  4HCP B;  1PLS A;  2KHW B;  4CHK A;  4WVF B;  4KSK C;  4IUM B;  1R7S A;  3R8B A;  4GDK B;  3PGE A;  4I6N B;  1D5X C;  3QWZ B;  3FEH A;  3DBH B;  4DWF A;  3KLS X;  4LNF A;  4FJZ A;  1JWM D;  2IO3 B;  4DXG A;  2KZR A;  5JP4 A;  2W3R A;  2W54 A;  1LFD A;  4ZRP A;  1DDM A;  1V5M A;  5HI1 A;  3ZDT A;  1TKY A;  2KLC A;  2V3P A;  2JYT A;  3ENE A;  3TEX A;  2Z4D A;  3U52 E;  1SE3 A;  3EC8 A;  2L0F A;  1PUT A;  3E66 A;  4KKJ A;  1UEF A;  2ASQ A;  2UZR A;  2K8B A;  1YJJ A;  1EWY C;  4RH6 A;  2KGX B;  1FB8 A;  3C19 A;  2BTE A;  1X05 A;  2MKR A;  1K5G B;  2J0J A;  1D4B A;  3P2B A;  2KFK A;  2WXM A;  2N4F A;  2BPS A;  2GCJ A;  4JQW C;  4ANV A;  1Z5S B;  4K3B A;  5JHA A;  1SE4 A;  2DWQ A;  5LXH A;  3VOQ A;  5AEK B;  2YT1 A;  4EFO A;  1TS5 A;  1DBH A;  3ZQ4 A;  2NBV B;  2KWD A; 
#chains in the Genus database with same CATH homology
 1EF1 A;  5LLI A;  1FHW A;  1FOE A;  4F7Z A;  3L08 A;  1UEL A;  3N32 A;  1X1M A;  1X86 A;  3SDL C;  1LB1 A;  1WVH A;  4IM3 A;  1Z2M A;  4OVU A;  3K9P B;  2A5U A;  1IRS A;  4W9K A;  4XZ4 A;  3LDZ E;  4ZRJ A;  2L7R A;  3QK0 A;  2KWV B;  3H1U A;  1E7U A;  2D2Q A;  1Q0W B;  2FCN A;  4TKN A;  1XOD A;  1U27 A;  1U4A A;  1V5O A;  3O65 B;  2FCS A;  3OLM D;  3WAM A;  3PLU A;  3OAW A;  4IWP A;  3MHS D;  4ANW A;  2N7D A;  2KDB A;  2AYO B;  2CHZ A;  4A5K A;  4HXD A;  4KHA A;  4K7U A;  2K6D B;  3F5R A;  2CHX A;  1TGZ B;  3ZRC A;  2Z0D B;  1NDD A;  3CF6 E;  2DKP A;  2OTX A;  2N7E A;  1K8R B;  4KIK B;  1XT9 B;  3PP2 A;  4E74 A;  3BIN A;  2ROV A;  2WDT B;  2MRP A;  4DHZ E;  5KCV A;  5JHH A;  2BYE A;  2J59 M;  4JKD A;  1L7Y A;  2YF0 A;  4IWQ A;  2RPQ A;  4FHJ A;  2CU1 A;  4GSW A;  4EZJ A;  3U8Z A;  1V86 A;  1WGU A;  3RT3 B;  5C5B A;  4WJ7 A;  3W1Y A;  3FM8 C;  3ML8 A;  1AQC A;  3ONS A;  3UQB A;  3S2A A;  5E6O A;  2IO1 B;  4JK8 A;  2EKE C;  3MPX A;  1U5D A;  1CMX B;  2COA A;  1WGY A;  4F7G A;  4JKG A;  4MK0 A;  1WX7 A;  4K2O A;  2MBQ A;  1V81 A;  3VUX A;  2MBO A;  4JLC A;  5JHG A;  2N9P C;  1WX9 A;  3U30 A;  2BGF A;  1SIF A;  4Z2N A;  4HPM B;  4WJQ A;  4DDG D;  2QKM A;  1V5P A;  3KH0 A;  2AL3 A;  1UGM A;  2H7D A;  4YON A;  1QZE A;  2ZNV C;  3RCZ A;  1K5D B;  5CTR C;  2X0S A;  2W9N A;  1ISN A;  1WJ1 A;  3DBH I;  4LDT D;  2IYB A;  2LXC A;  1WI0 A;  5HE0 A;  4AUQ C;  4MY6 A;  3TW1 A;  3TBL D;  1U5F A;  1MPH A;  2K8H A;  1XX0 A;  2RLO A;  4DX8 A;  3WA0 A;  2DTC A;  1RLF A;  4NJ7 A;  2KCJ A;  4HAT B;  3RUL A;  2K39 A;  3PG7 A;  4GDL B;  2KLG A;  1J8C A;  2M17 A;  2NPT A;  3A1Q B;  3ZIM A;  1H10 A;  3ZKJ C;  2M14 A;  2DAF A;  2KX0 A;  2DYQ A;  3TIX A;  3U7D A;  5KQ4 A;  1FHO A;  2JZ3 B;  3ZNH B;  3PEG A;  2V1Y A;  4MGI E;  3CST A;  3ML4 A;  1S3S G;  4FJV B;  3WAN A;  1WGR A;  2MBH A;  4KVG B;  4BKT A;  4ZRK A;  2GOW A;  1OQN A;  2UZS A;  4EJN A;  2Y7B A;  1WZ3 A;  4GU2 A;  1Q67 A;  3TCA A;  4EOY A;  2KMC A;  4W9C A;  2P0H A;  2BF8 B;  2JF5 A;  1Q5W B;  3PRM B;  4G50 A;  5IJM A;  1A5R A;  4BFR A;  4ANU A;  4HDO A;  5CLQ B;  2D9Z A;  4LJO B;  4HJK A;  2O6V B;  4GDK A;  4GOC A;  2LOZ A;  3N3K B;  3VUW A;  5D3V A;  2ZZP B;  3KSY A;  1NI2 A;  4W9G A;  1V80 A;  4CYE A;  3OJ4 B;  1X1G A;  4ZRI A;  1FHX A;  1FXT B;  1OQY A;  2KAN A;  1ACA A;  4NJ6 A;  2EC1 A;  5D3Y A;  3SNH A;  2CRF A;  2V76 A;  4KDI C;  4H8S A;  2K1F A;  2KJH B;  3PRE A;  3TO1 A;  4HWI B;  2L0T A;  4FJY A;  2DHI A;  2JPH A;  1D3Z A;  1HBK A;  3ZRF A;  2KKC A;  1EUV B;  2KK8 A;  1WXS A;  3X0W A;  3VQI A;  2I5F A;  3KVF B;  2LGX A;  5CHF A;  1GC6 A;  3OAN A;  1ZM0 A;  2PE9 A;  3E9O A;  3QCA A;  3PRP B;  1QQG A;  4PS7 A;  2Z59 B;  1M7E A;  3A4S C;  2YS3 A;  2RQ1 A;  2AEH A;  2DA0 A;  4GPT B;  1UNR A;  1GC7 A;  4IC7 B;  1NTY A;  4MM3 A;  4GB9 A;  2PZ1 A;  2IO0 B;  1OEY A;  3K9O B;  4KAX B;  4HPL B;  2FNJ B;  2R0D A;  1WJU A;  2L2I A;  2M4N A;  3LJ3 A;  4G11 A;  3ULC A;  2NCN A;  3KUC B;  1OTR B;  3UIP B;  3N7C A;  3ZDM C;  1WXV A;  1EF5 A;  1HE8 A;  1PFJ A;  2LVP A;  4FA6 A;  3IBE A;  2L76 A;  1KZ7 A;  3B1L X;  3QAQ A;  1DDV A;  1E8W A;  2KD0 A;  3M3J A;  1UNQ A;  1J0W A;  2ADZ A;  2L3Z A;  3TVV A;  3C0R B;  3VH3 B;  4TQ0 A;  1GG3 A;  2J7Q B;  1R4N I;  3L0W B;  3MJW A;  2JVC A;  5HE1 A;  2DEN B;  3PV1 A;  1C3T A;  4KIK A;  4JKE A;  4RMA A;  1VBG A;  2KDF B;  2IYD B;  1WGG A;  2C7H A;  1J19 A;  1ZSQ A;  2AWT A;  1WM3 A;  3P6A A;  3P7Z A;  4TYZ A;  2O2V B;  2FJL A;  2ZCB A;  4GN1 A;  2KJ6 A;  4GMX B;  2K6Q A;  2KDI A;  4URK A;  3G9W A;  2DIK A;  4NAW B;  1MG8 A;  2D10 A;  3MDB C;  2KMA A;  3DVN U;  1UPQ A;  2FCM A;  1KBL A;  4A6H A;  4EMO A;  1TBE A;  5AZF A;  2W2X C;  3NZU A;  3ZLZ A;  2GBJ A;  3EPY A;  2R2O A;  2KWU B;  3L17 A;  4HCN B;  2A4Z A;  3APC A;  5IA7 A;  3ULB A;  3QBV B;  2M8S A;  1YX5 B;  2RNR B;  3HQC A;  5DIF B;  5JHB A;  4HAY B;  5IAA C;  1M7R A;  4MJS B;  1V2Y A;  1ZC4 B;  2E2X A;  5D94 A;  4KSL C;  4W9J A;  1OGW A;  1U2B A;  1MKE A;  1S1Q B;  2GBN A;  3NZS A;  5DI9 B;  1RRB A;  2KDE B;  1WE7 A;  2KUP A;  2ZPN A;  4A6K A;  1R4M I;  3A9K B;  3R66 C;  4JIO U;  4PYZ A;  3WAO A;  3VTV A;  4LDT B;  1LQB A;  4GDL A;  3A1Q A;  4J6I A;  3D8E A;  3ZW3 A;  4NNJ B;  3SBT A;  4HAZ B;  5CHW A;  5E6N A;  2DX1 A;  4AOF A;  3A33 B;  2MDX A;  2ZEQ A;  3PTF C;  2ABD A;  5CX3 A;  4AJY B;  2BYF A;  2IZV B;  2BKF A;  1LXD A;  2DYO A;  4HVB A;  3VXW A;  1WZ0 A;  4HAW B;  2IBI B;  1DIK A;  2KC2 A;  2MSE D;  4GGQ A;  1NBF C;  4E71 A;  2K8C A;  4K81 A;  3B0A A;  2D4Q A;  2DZI A;  3A98 B;  3HW2 B;  1WFY A;  1E8X A;  1N3H A;  2CQU A;  2D3G A;  2DYM A;  4IM2 A;  3L16 A;  4FUL A;  3PSC A;  1DRO A;  4TUU A;  2WX0 A;  1X11 A;  2YT0 A;  4PQ0 A;  3H7S A;  1C1Y B;  4AP4 C;  2O6V A;  4HHV A;  5J17 A;  1WG7 A;  2LUE A;  3NHE B;  3A4R A;  3H7P B;  4MEL A;  1ZC3 B;  1LM8 B;  2COP A;  3M63 B;  5LOP B;  1TZ1 A;  5GOW B;  3DCG A;  1B55 A;  4ANX A;  1E8Y A;  4K1R B;  1KM7 A;  3M62 B;  1I7A A;  3VVW B;  1IYF A;  5LXI B;  4CO7 A;  3BJI A;  4B95 A;  1ZVR A;  4JK9 A;  4MH0 E;  2RR9 A;  2KVR A;  1WGH A;  3RUI B;  1WMH B;  3KUZ A;  3VAW A;  2K25 A;  4G3X B;  2DYN A;  5JVL A;  1WRD B;  1IPG A;  4WWO A;  2MLB A;  1TTN A;  3R3M A;  2UWQ A;  2NS5 A;  3A8Q A;  3GZN I;  4W9E A;  1XKE A;  3VH4 B;  1V9J A;  4WAA A;  4OVV A;  3FLV A;  1OMW A;  2I1K A;  1UD7 A;  4FAD A;  5J3Y A;  2Z0Q A;  3OJ3 A;  3A9J B;  2KQS A;  2LXA A;  4WJP A;  5J2R A;  2JZZ A;  1E90 A;  1Z87 A;  2DHZ A;  2RD0 A;  2YRY A;  5L95 C;  1TXD A;  2HD5 B;  5DPT A;  1XD4 A;  1WM2 A;  4D0N B;  1V88 A;  2KTR B;  5C79 A;  1XD3 B;  2D11 A;  2JUO A;  1WJN A;  3H6N A;  2R82 A;  2D9V A;  4F8C B;  3AUL A;  1V5U A;  4M8N A;  1YD8 U;  3WIM A;  2LGY A;  1E7V A;  2FID A;  2RVB B;  1V5T A;  4I6P A;  1WY8 A;  5JH5 C;  4ICV A;  2MW5 A;  4XC2 A;  4JKF A;  3DXC A;  3DVG Y;  3PVU A;  2MP2 B;  2GJY A;  1FAO A;  2CR5 A;  3IHP C;  1P98 A;  1KOT A;  3Q3J A;  2K00 A;  2GBM A;  2LRW A;  2KNB A;  1E5W A;  3PRZ A;  3APD A;  1TQZ A;  2BWE S;  1HB8 A;  4BKS D;  1KLV A;  4PNK A;  3A8P A;  3VDZ A;  3GOE A;  2UVM A;  3RYT A;  4EZK A;  2JP2 A;  4CHM A;  2XK5 A;  3PPA A;  2CY4 A;  5DHA B;  5EFX A;  2O2V A;  2MBE A;  1UBQ A;  3DVN V;  2PE6 B;  1GUA B;  2LBB A;  2GBK A;  3JVZ X;  5L83 A;  4AWJ A;  4L6E A;  5FI1 A;  1NVL A;  3QX1 A;  2LOX A;  2LVQ A;  5C1Z A;  4NAW A;  4XWX A;  2AL6 A;  2MX2 A;  2N9E B;  3CSF A;  4MSQ B;  1EO6 A;  3UIO B;  2PEA A;  2NBW B;  1MIX A;  4W9L A;  1RAX A;  1J0G A;  5CLL B;  5DPS A;  2IO2 B;  3D32 A;  2L1C A;  1W1G A;  2DX5 B;  3BY4 B;  3JSV B;  4MJS A;  2KQ7 A;  4IM0 A;  5C6R A;  3SUZ A;  2KX3 A;  2C5L C;  4RM8 A;  1P0R A;  1JRU A;  3QIJ A;  1MAI A;  4WJO A;  4ILJ A;  3F0W A;  3DBR I;  2DZJ A;  2YLM A;  3M1I B;  1NTI A;  3PS6 A;  4ZDV A;  3T9L A;  4EUT A;  4BKG A;  3QA8 A;  3A9K A;  5HKH A;  4MEM A;  2Z0P A;  3VFK A;  4FHK A;  4B6W A;  4FN2 A;  3DXE A;  5BO4 B;  3SV1 A;  2G4S A;  2REX A;  4A3P A;  1NTV A;  3UGB B;  1OY2 A;  3SYX A;  4Y94 A;  5J3Q A;  2YS1 A;  4I6L B;  2DZM A;  2IFS A;  2LYD A;  5DPR A;  1Y5O A;  3DQV A;  5KHQ A;  4HAV B;  1V49 A;  3FP5 A;  2VRW B;  1P3Q U;  2C60 A;  1UZX B;  1I35 A;  4KV2 A;  4K7S A;  2ZCC A;  2Y5B B;  5LON B;  2R09 A;  1BTN A;  1I42 A;  3ZTC A;  1YQB A;  2J0K A;  2HTH B;  2B3A A;  3PSE B;  3EFU A;  5J3T A;  3KUD B;  3PLV A;  4BBN C;  5L81 A;  2FAZ A;  4BOS C;  3L10 B;  3ALB A;  1EAZ A;  2KXJ A;  3VHT C;  1RFA A;  4IWO A;  4KDL B;  3KY9 A;  4EEW A;  5C23 A;  5DCN A;  2XEW A;  3TL5 A;  2JXX A;  3DDC B;  2M1M A;  2DKQ A;  2L8J A;  3H7P A;  5J18 A;  2LG1 A;  4IOY X;  2MCN B;  2I1J A;  1P3R A;  2EMS A;  3VTW A;  2GBR A;  2DLW A;  3V60 A;  4A6F B;  3KYD D;  2RSU A;  4HK2 A;  1U5G A;  3RZF A;  1YX6 B;  3D8F A;  2OQB A;  3ZNI D;  2MBB B;  4W9H A;  4N9F 4;  2W2W A;  2C7M B;  1WGD A;  2WX1 A;  2Z0E B;  1LW3 A;  2D9X A;  3IVF A;  4DBB A;  1XCG A;  1WE6 A;  2L00 B;  3DOW A;  4ASW C;  4NQK E;  1E8Z A;  4ILG B;  2YSZ A;  2NMB A;  5DHF B;  3PZD A;  4II2 B;  2ZPY A;  3A9J A;  5D6J B;  5DPW A;  4XX5 A;  1WYW B;  2N23 A;  2LVO A;  3ZO5 B;  2KWC A;  2VKI A;  4KHO A;  1P9D U;  2LRU A;  4PS3 A;  4EZL A;  2N0Y A;  3DVG X;  3PT2 B;  4EKU A;  2CHW A;  4DHJ D;  2G45 B;  1BT0 A;  1G6J A;  2LZ6 A;  4Z2M B;  1WX8 A;  2MFQ A;  1H4R A;  1U29 A;  2C9W B;  4NPN A;  5D3W A;  1V89 A;  3UQA A;  1H8C A;  1JDE A;  2DYB A;  2HE7 A;  2MP2 A;  2Q13 A;  5JZE B;  3NOB A;  3H9D A;  4GIV A;  3L54 A;  1I2H A;  2DAJ A;  5AZG A;  4F1S A;  3ZNZ B;  2COC A;  2M38 A;  4MSM B;  3HIZ A;  1WIA A;  4WJN A;  2OJR A;  1PMS A;  2RSG A;  2LD9 A;  2M0X A;  2G3Q B;  1SHC A;  1WJ4 A;  5KQ1 A;  1FGZ A;  5CHV C;  4GMV A;  3D8D A;  4W9F A;  2EMT A;  4B6H A;  2Y8F A;  4KHB B;  2ROZ B;  1M94 A;  1WR6 E;  1KJT A;  1KZG A;  4F7U P;  5JLJ B;  3AI5 A;  3JW0 X;  4DX9 0;  1ZKH A;  2XBB C;  4MGZ E;  4KZC A;  3V6C B;  2NR2 A;  1Q1O A;  3GYO A;  3KRW A;  3W1S A;  4PS8 A;  5EDS A;  2HRJ A;  3RCP A;  3SBG A;  4C0A A;  2P0D A;  4X57 B;  2YVC A;  2DZK A;  1X1F A;  3JYU A;  3CXB B;  2KTF A;  2ELA A;  1Y19 B;  1P5T A;  2DX5 A;  4KZ0 A;  2EJ8 A;  1AAR A;  3JSV A;  1VD2 A;  2IY1 B;  3UIN B;  2H7E A;  2OOB B;  3ZVV A;  1W1D A;  2G35 A;  2DHJ A;  2HJ8 A;  4ICU A;  4MGY E;  3QQ8 B;  3Q3F A;  3M95 A;  2ELB A;  3W1S C;  4IAP A;  1V6E A;  1SGH A;  4NQL B;  1XR0 B;  3CIK A;  3NSU A;  2JT4 B;  2COD A;  3ECI A;  3QC8 B;  2X18 A;  5AZH A;  1RRP B;  3AU4 A;  2C7N B;  3SU8 X;  2LUL A;  1F9J A;  3KRX A;  2PPH A;  3CMM B;  3LJU X;  2JY6 A;  3VIA A;  3EEC A;  2D07 B;  3DBS A;  3O96 A;  4FBJ B;  2CY5 A;  4P7I A;  2XQN M;  4BBK A;  2LAS A;  3ZVR A;  2FUH B;  3VUY A;  3HM3 A;  2P0F A;  5FI0 A;  2K2J A;  3TFM A;  3IG3 A;  3V61 A;  2ZJD A;  3FSS A;  2NVU I;  2K2U A;  4A20 A;  2QHO A;  3KYC D;  4NSW A;  1BWN A;  1BAK A;  2CS4 A;  4DHZ B;  4GZU A;  1Y8R C;  3ODW A;  3SO6 A;  2DN6 A;  3UZT A;  2HTH A;  5DH9 B;  3ML9 A;  2BWF A;  1UPR A;  1GNU A;  3HM6 X;  4MGK E;  2N1W A;  1GGO A;  4WWP A;  2FCQ A;  2GMI C;  1KC7 A;  2FJ9 A;  1DDW A;  1BTK A;  2JWZ A;  2P8V A;  4WWN A;  4HB4 B;  2LKO A;  3GYP A;  2IY0 B;  3MTN B;  4DXA B;  1YIW A;  3V62 A;  4A3O A;  3V5W A;  1WXA A;  3ENB A;  4FLH A;  3I3T B;  2DHK A;  4A6F A;  3UF8 A;  2UYZ B;  1MK7 B;  4JKB A;  5C16 A;  2LI5 A;  2R2Q A;  3QWM A;  3QJZ A;  2KFK B;  3WYF B;  2NBU A;  3B08 A;  3PVW A;  1DYN A;  4JK7 A;  3TMP B;  4WSF A;  2RUK B;  5GMV A;  3DXD A;  2QKL A;  3ODX A;  5D2M B;  1WJ6 A;  2N9X A;  3T06 A;  4CHJ A;  1OEY J;  2KN5 A;  4LCD E;  1TJ6 A;  4BBN F;  3VTU A;  4RM9 A;  3IFW B;  4M0W B;  1WH3 A;  3PHW B;  1QC6 A;  2RGF A;  1EGX A;  4JL9 A;  3WAL A;  2D9Y A;  5G55 A;  3AXC A;  3KW5 B;  4B9K A;  4HB3 B;  5FR6 A;  2W2X D;  3V6E B;  2MQJ A;  1W1H A;  1MIZ B;  3X23 A;  1WF9 A;  5TR5 A;  4HB2 B;  3RD2 A;  3E9L A;  1SE9 A;  4G0N B;  2JRI B;  5D27 A;  4DHJ B;  2CAY A;  1HB6 A;  2COF A;  4WQO B;  4MDK E;  1KI1 B;  3ZNG C;  4NY0 A;  1VCB A;  4K2P A;  4II3 B;  3AU5 A;  5D7G A;  3ZUN A;  3L13 A;  1U5E A;  3NS8 A;  4K17 A;  5C5B B;  1T0Y A;  2BYV E;  4LJP B;  2KJR A;  3DBL I;  1IP9 A;  1V61 A;  5D3X A;  4DK5 A;  4TV3 A;  1RJ2 A;  4AJW A;  2ZNV B;  4HLE A;  4BKS A;  4E3C A;  4MT7 A;  3SD5 A;  3R7R A;  3ODO A;  3NY5 A;  4YL8 A;  2DFK A;  1P1A A;  4JKG B;  2KC1 A;  3N30 A;  4JKH A;  3QHT A;  1WGQ A;  2LWP A;  2JRH A;  3T8M A;  2FDQ A;  1WI1 A;  1GJZ A;  4JGH B;  2KFJ A;  2GCL A;  4BOZ B;  5HE3 A;  1P6S A;  4TQ1 A;  1WR1 A;  3SHQ A;  2BKR B;  2KO3 A;  2LGD A;  2N1V A;  3WAP A;  5HE2 A;  1UH6 A;  4W9I A;  2I5C A;  4PYU A;  3AJ4 A;  2LJ5 A;  1AWE A;  2G4D B;  1YJ1 A;  4F7H A;  2FIF A;  2PJH A;  2MWN B;  2Z0O A;  2MA9 B;  1PQS A;  2V3S A;  3R7Q A;  5E6P A;  4ZYN A;  2RGN B;  4ILH A;  4HAX B;  4W9D A;  5KHO A;  3DPD A;  2KOX A;  2Y8G A;  3APF A;  4IG7 B;  3EHV A;  1MK9 B;  2J0M A;  4HDQ A;  4JKC A;  2NPT B;  3PVL A;  4JKA A;  2NZ8 B;  4HB0 B;  1WMH A;  4DDI D;  4IW0 A;  1UNP A;  2MWS B;  1FGY A;  3KZ1 A;  2YS5 A;  2XK5 B;  2V4L A;  1UBI A;  3HHM A;  1WXM A;  3E9P A;  2ZVN A;  2WH5 A;  2L05 A;  2GS0 A;  4K7W A;  1L2N A;  3ZTD A;  1ST7 A;  1ZW7 A;  1XQQ A;  5G2N A;  4DBG A;  1ZGU B;  2CKH B;  2VSZ A;  2KTR A;  2O6V D;  2WYQ A;  3TJP A;  4HAU B;  3RZW C;  3PHX B;  1EVH A;  1VBH A;  4GXB A;  2D9W A;  4BVU C;  3HK0 A;  4M8M A;  2ZVO A;  2VRR B;  3QAR A;  1WJM A;  1NU2 A;  4IFS A;  2BCJ A;  2WWZ A;  2CB8 A;  4HCP B;  1PLS A;  2KHW B;  4CHK A;  4WVF B;  4KSK C;  4IUM B;  4GDK B;  3PGE A;  4I6N B;  3QWZ B;  3FEH A;  4DWF A;  4FJZ A;  2IO3 B;  2KZR A;  5JP4 A;  1LFD A;  1DDM A;  1V5M A;  3ZDT A;  2KLC A;  3ENE A;  3EC8 A;  2L0F A;  3E66 A;  1UEF A;  2ASQ A;  2UZR A;  2K8B A;  2KGX B;  1FB8 A;  1X05 A;  2MKR A;  1K5G B;  2J0J A;  3P2B A;  2KFK A;  2N4F A;  2BPS A;  2GCJ A;  4JQW C;  4ANV A;  1Z5S B;  5JHA A;  5LXH A;  3VOQ A;  5AEK B;  2YT1 A;  4EFO A;  1DBH A;  2NBV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...