1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
b'PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords radixin
molecule tags Cell adhesion
source organism Mus musculus
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
4MDKE 3M63B 2DYMA 4HAWB 3D32A 1UPRA 1NVLA 1WRDB 2HJ8A 2PJHA 3F0WA 3TW1A 3W1YA 3ZVVA 3K9PB 4I6LB 3T9LA 1W1HA 4G3XB 4JLCA 2N1WA 4IUMB 3RYTA 3ZRCA 1AQCA 5HKHA 1Q0WB 5JHAA 2RPQA 2G35A 4KZCA 5AZFA 3Q3JA 5J2RA 1WR6E 2GCLA 1TTNA 4GDLA 1NTVA 4FA6A 1WXSA 2DYOA 5C23A 4YONA 1ZM0A 2DZJA 1A5RA 2LXAA 2ROZB 2MBHA 3CSFA 3IG3A 2K6QA 3ODXA 2D9XA 1WZ3A 5IA7A 4B6HA 1WX8A 2HTHA 2VKIA 1GG3A 1WJNA 2DN6A 1GUAB 2JXXA 4RMAA 2L3ZA 3TVVA 3V60A 3VVWB 4G0NB 4NQKE 2CODA 2FCQA 2GJYA 2IFSA 2JF5A 5EDSA 3MTNB 4DDGD 2MRPA 2YSZA 2ZEQA 3A9JA 1EUVB 1I35A 2PE9A 3PRZA 3WAOA 1GNUA 1E7VA 3ZDMC 3NOBA 4NY0A 3QK0A 4E74A 2J0MA 4F7ZA 1E8ZA 3KW5B 1YIWA 4BBNF 3JSVA 4NQLB 4WJQA 5JHHA 4MELA 2MDXA 5CLQB 3JYUA 2L2IA 1DROA 2M8SA 3V5WA 1KOTA 5L83A 4KIKA 4ICVA 4EZJA 4DBGA 2KC2A 3T8MA 1FOEA 1WGRA 2OJRA 2YF0A 1BT0A 3MDBC 3DBSA 2GBMA 4HHVA 1MK7B 1NI2A 3A98B 3D8EA 4EJNA 2KJHB 3WIMA 4MY6A 2LGXA 3ZW3A 4FADA 3B1LX 1E8WA 1V88A 2J7QB 1EF5A 2IO3B 1V81A 3L10B 4MGKE 1WJMA 3ULCA 4KIKB 3DBRI 4WAAA 5J3QA 2VSZA 3V6CB 2LJ5A 2ZVOA 1WGYA 3L16A 3PEGA 4JQWC 4ANUA 2BKFA 2FDQA 2C7HA 3R7RA 3FP5A 2KFKB 4Z2MB 4K7SA 3KYCD 1UH6A 5D94A 2BGFA 4B95A 2M17A 1WX9A 4J6IA 3PRPB 2N7DA 2MW5A 3EC8A 2JP2A 1TGZB 2LVPA 3P6AA 3X23A 2L0FA 1K5GB 1T0YA 1HBKA 2KLGA 4FHKA 4XZ4A 4HLEA 1WXMA 2KWVB 2KANA 2L76A 4Z2NA 2VRWB 3ECIA 1SIFA 4NNJB 3SHQA 2RSGA 2XEWA 5C1ZA 3KZ1A 5D27A 1XKEA 1WF9A 2D3GA 2Y5BB 2WWZA 2G45B 2BYEA 4HB4B 5IAAC 2MLBA 4IWOA 2KNBA 3DVNV 2FAZA 4GGQA 1E5WA 4HAXB 5DHFB 5GOWB 4GDLB 2JUOA 2DYNA 4BBKA 4BKTA 3SUZA 2P8VA 3AJ4A 3SO6A 1NDDA 4CHMA 3N3KB 4K1RB 2MWSB 5J17A 3KUDB 1K5DB 4KHAA 1ST7A 1U5GA 3HK0A 1WJ4A 3EECA 1OTRB 2OTXA 4HAYB 2EKEC 3DOWA 5C5BA 1UBIA 4HWIB 4JIOU 4KSKC 4TKNA 4IG7B 4KSLC 1KI1B 2DLWA 1KLVA 3QIJA 3QBVB 4YL8A 2CR5A 3L08A 3KH0A 2KGXB 2RGFA 2FJLA 1YX5B 1ZGUB 2CHWA 4EMOA 3VUWA 3ZUNA 3ZRFA 2AWTA 4B9KA 2MWNB 3GYOA 5J3TA 2L0TA 4HXDA 1WFYA 2KMCA 4W9KA 3H1UA 1MK9B 1AARA 2BYVE 1JRUA 3TIXA 2DAFA 4WWNA 5D3WA 4EEWA 2FIFA 1MKEA 4IWPA 4H8SA 2MA9B 3QQ8B 3JSVB 4JL9A 3A8PA 2C7MB 2FNJB 3L0WB 4KDIC 4DK5A 3PG7A 2NZ8B 5DIFB 4HATB 2O6VD 4D0NB 1LW3A 1RJ2A 5CTRC 2C7NB 2G3QB 3U7DA 2WX1A 1XCGA 2NCNA 2EMSA 1WGQA 1V89A 2KX0A 4KV2A 1FAOA 2RR9A 1EVHA 1OMWA 1OEYJ 2LRWA 1NTIA 4K81A 1Z87A 1UPQA 5CLLB 4GSWA 3VDZA 3VTWA 2D9YA 2KDBA 3VH3B 1Y19B 3A9KB 4ANVA 5AZHA 1TBEA 2CY5A 1FHXA 2NBWB 2N4FA 2GBNA 2LVQA 3DXDA 5JZEB 3PGEA 3PVWA 2HRJA 3D8DA 2KTRB 2IYDB 4W9CA 4W9GA 2XBBC 3M95A 2EC1A 5HE3A 3MHSD 3TMPB 4BBNC 1EO6A 1FGZA 4BOSC 1LXDA 4M8MA 1E8XA 1Y8RC 5KHOA 2KJRA 2W2WA 4ZRJA 1ZW7A 4MT7A 2MX2A 1R4NI 1PLSA 4A6KA 2D9WA 3A8QA 1WGGA 3DBHI 5AEKB 5CX3A 1WXAA 4GMVA 5LONB 2KC1A 3TJPA 1IP9A 1NU2A 2DX1A 1IRSA 4FJZA 3VXWA 5LXIB 5CHVC 5D3YA 2COCA 3RULA 1H4RA 2DFKA 2RGNB 1P3QU 2KDFB 1I42A 3UQBA 5CHFA 5L81A 2YT0A 3UZTA 3ONSA 3BJIA 3OLMD 4N9F4 4BKSD 3TO1A 4DHJB 3UQAA 4CYEA 2KZRA 2ELBA 5JHGA 1WM3A 2L8JA 2AL6A 2N0YA 2J59M 2K8CA 2Z0EB 1WJ1A 2IBIB 1E8YA 4IM0A 1YQBA 4F7UP 2R0DA 3DDCB 1WGUA 2I5CA 3OANA 2M1MA 2Z0QA 3AXCA 3HM3A 4IC7B 4WJPA 3R7QA 4EOYA 1WGDA 2LVOA 4NAWA 5JLJB 3ZNGC 3DXEA 2ASQA 5C5BB 3AI5A 4KDLB 4WWPA 3PLVA 4ICUA 5C16A 2JWZA 2LGYA 2MP2A 1V5PA 1V5TA 3SU8X 3ZLZA 2YS3A 2AYOB 4WJNA 4HAZB 2KOXA 2LRUA 2PZ1A 3FM8C 2LASA 3DVNU 4CHKA 3AU5A 2V1YA 1P5TA 5E6PA 1C1YB 2K39A 3V6EB 2COPA 1FHOA 1R4MI 1YJ1A 4KHBB 1SE9A 2MQJA 2CB8A 4XC2A 3RT3B 2DTCA 3B08A 3PPAA 5EFXA 4NJ7A 3RZWC 4URKA 1X86A 1G6JA 2DA0A 3QX1A 3NS8A 2M38A 4DWFA 2W9NA 1WVHA 1MIZB 1P98A 2ZJDA 3CF6E 2RQ1A 1U29A 5DCNA 3SDLC 3UIPB 2CHXA 1Q1OA 1U4AA 5DPSA 4HJKA 4WVFB 3S2AA 1L7YA 1DDVA 4IAPA 5D6JB 4MH0E 3VAWA 2L1CA 3UGBB 2BCJA 4CO7A 5J3YA 1M7RA 3A9KA 3BY4B 4A3OA 3WA0A 1I2HA 3OAWA 4F7GA 4ZYNA 3RUIB 2D9VA 1MG8A 1KM7A 2DENB 1OY2A 4GZUA 1DDMA 2W2XD 2BWES 2JVCA 2LXCA 4A20A 2KTRA 2DKQA 5HE1A 4BOZB 1PMSA 2Z59B 3PP2A 2IY0B 3H7SA 3QJZA 4W9LA 3HQCA 5LXHA 1L2NA 2ZNVB 3SV1A 1OQYA 2NBUA 2LG1A 3G9WA 4W9JA 2XQNM 4G50A 5L95C 3PHWB 5FI0A 1WYWB 2ZZPB 3NZUA 3DBLI 1IYFA 1Y5OA 3O96A 1J19A 2JY6A 3TBLD 3ZO5B 4W9IA 3VQIA 3VUXA 3PZDA 2W2XC 2ZNVC 3ML4A 4GU2A 1BTNA 5IJMA 3BINA 1FHWA 1WZ0A 1WE6A 2DHZA 2BF8B 3IHPC 3ML9A 4ZDVA 2KCJA 2NS5A 4F7HA 2ZCBA 4A5KA 4PS3A 3KUCB 2EMTA 1Z2MA 4P7IA 2A5UA 2N23A 2KFJA 1X1GA 2YS5A 2KJ6A 2MBOA 3OJ3A 5DPWA 2ZPYA 2VRRB 2B3AA 1UZXB 2KK8A 1E7UA 4MSQB 2KDEB 4FN2A 3KY9A 1ACAA 2Y8GA 3TL5A 1V5OA 3A4SC 2KO3A 1FGYA 5C6RA 1TXDA 3VOQA 1WIAA 2C5LC 2G4DB 2MFQA 3I3TB 2AL3A 4EKUA 1GC7A 2O2VB 4NAWB 2FCMA 3A4RA 2NMBA 1MIXA 3WAMA 2A4ZA 2MP2B 2LD9A 2ZPNA 1XR0B 1XD4A 3R3MA 4AJYB 2NVUI 2D2QA 3IVFA 2M0XA 4MK0A 4B6WA 4FJVB 4MSMB 3ZTDA 1TJ6A 2MBQA 2P0DA 4M0WB 3WANA 1GJZA 5HE0A 2D11A 5FI1A 1X1FA 3MPXA 1ZKHA 4IFSA 1UGMA 2MBBB 3GOEA 5GMVA 4E3CA 1UNRA 2ROVA 1UNPA 3M1IB 2Y8FA 3PLUA 4DHJD 4IM2A 1KJTA 1YD8U 2DAJA 1OEYA 2WDTB 3EHVA 4GOCA 4PS8A 4EZKA 2DZIA 3QC8B 4KHOA 3DQVA 2RD0A 4AOFA 4DDID 1C3TA 4LJPB 3ZNZB 2FJ9A 1RRPB 3L13A 2JT4B 4ZRIA 4C0AA 2K1FA 3P7ZA 2RNRB 2BYFA 2LWPA 2PPHA 3QCAA 4LJOB 4KZ0A 3FLVA 4MGZE 2CQUA 2LOZA 4TYZA 1CMXB 3ML8A 2I1JA 3ZNHB 4NSWA 3O65B 2N1VA 4IWQA 3FSSA 1H8CA 3DCGA 5DPRA 3PRMB 1WI1A 1XQQA 2GBKA 2FCSA 2YT1A 3B0AA 4K7UA 1XT9B 2MKRA 3T06A 4HAVB 2FUHB 3D8FA 4ZRKA 2G4SA 2UWQA 3DVGY 4HVBA 1B55A 1V61A 1F9JA 2RVBB 1M94A 2IZVB 2GOWA 3KRXA 2KX3A 4LDTD 5D3VA 2HD5B 1V2YA 3ZTCA 2UVMA 3LDZE 3QWZB 3PVUA 2DZKA 2N7EA 1K8RB 1V49A 1WY8A 2ADZA 4HPLB 2H7DA 3IFWB 1QZEA 1P9DU 2YLMA 2DHIA 4MM3A 2DHKA 3APDA 3VTVA 1OQNA 3Q3FA 2N9EB 3AULA 1EGXA 3LJ3A 4TV3A 3QAQA 3PT2B 1HB8A 3H9DA 4I6NB 1WE7A 1BTKA 2WX0A 3KYDD 4HAUB 4KAXB 2K2JA 3K9OB 4NPNA 3PSCA 2KQSA 1PFJA 2Z0DB 3PHXB 3SYXA 4HDOA 1W1DA 2R2OA 2LKOA 4PYUA 4EZLA 1X05A 1LM8B 4OVUA 4XWXA 4HPMB 2O2VA 1MPHA 3C0RB 1WJUA 2QHOA 2YVCA 2V76A 1LQBA 1NBFC 3H7PB 4MGYE 2ZCCA 1DBHA 4E71A 1RFAA 2KN5A 1LB1A 2CKHB 4IOYX 4F1SA 1J8CA 2RSUA 2DYQA 2E2XA 2M14A 1S1QB 2IO2B 4MJSA 5D7GA 3NSUA 3PREA 3UF8A 2K8BA 3F5RA 2DX5B 3DPDA 2WH5A 2D9ZA 5CHWA 2HE7A 3VTUA 2LUEA 2DHJA 3VIAA 3NY5A 4AUQC 3W1SC 2FCNA 3EFUA 3ODWA 1ZVRA 2JZ3B 2QKMA 3ZIMA 1W1GA 3PVLA 1KZGA 2GBJA 2KD0A 4EUTA 1H10A 1WMHA 2H7EA 5DH9B 2K25A 2IO1B 2O6VB 4A6FB 1WX7A 2KWCA 4LCDE 4BVUC 5HE2A 1PQSA 2N9XA 3AU4A 1P6SA 2CU1A 2CAYA 1BWNA 1UBQA 2NPTA 3KRWA 2C9WB 2EJ8A 1SHCA 4AJWA 2GCJA 4WSFA 3KSYA 3UINB 2D07B 2CY4A 4DX90 4FULA 1TQZA 3MJWA 1V6EA 2D4QA 1RRBA 1UELA 1WR1A 4RM8A 3PV1A 4II2B 3N32A 2IO0B 3DVGX 1UD7A 4JGHB 2IY1B 4DBBA 4F8CB 2KTFA 4EFOA 2FIDA 2P0FA 2K6DB 3APFA 2DYBA 4WJ7A 1V9JA 3QHTA 1WM2A 3A33B 4K7WA 3TFMA 4GMXB 1WXVA 3LJUX 3A1QB 1U2BA 3SD5A 4GDKA 4W9EA 2XK5A 1ZC4B 2GBRA 3KUZA 4GIVA 2ELAA 3JVZX 4CHJA 2V3SA 4DXAB 4PS7A 1U5FA 1J0WA 1WGHA 3IBEA 4W9HA 4XX5A 4PYZA 3WAPA 4K2OA 1EF1A 1XX0A 2K8HA 4AP4C 4BFRA 2PE6B 1Q67A 2REXA 2JZZA 3CXBB 2UYZB 3V62A 1ISNA 2Y7BA 4HB0B 3L17A 5JH5C 4FHJA 3V61A 3WALA 2UZRA 2QKLA 5BO4B 2MBEA 1J0GA 1TZ1A 2LOXA 3PSEB 2KXJA 1EAZA 5G55A 2YS1A 1I7AA 4FLHA 4AWJA 3VUYA 4X57B 5DHAB 4FJYA 4GB9A 2LZ6A 2L05A 2D10A 5DPTA 3HHMA 3R66C 3RCPA 3L54A 5KQ1A 2JPHA 2NBVB 3H7PA 2JRIB 2WYQA 5E6OA 4II3B 5JHBA 1FB8A 4W9DA 3CSTA 4W9FA 2LULA 5LOPB 3HIZA 1V5MA 4WQOB 5E6NA 4IW0A 3GYPA 3APCA 1NTYA 4MEMA 2IYBA 2RUKB 4MJSB 4OVVA 5D2MB 4I6PA 2GMIC 4M8NA 2DX5A 1Z5SB 1GC6A 2N9PC 5KQ4A 1UNQA 3VH4B 4ANXA 4HDQA 3ZKJC 1U5EA 1M7EA 1X11A 3QWMA 1LFDA 1X1MA 4DHZE 2JRHA 2KQ7A 2KLCA 4A6HA 1P1AA 2COFA 1MAIA 1WMHB 2O6VA 2OQBA 4A6FA 4PNKA 2BWFA 4HCNB 3ZNID 4FBJB 1AWEA 2KWUB 3P2BA 4K2PA 5AZGA 2K2UA 4BKGA 1P3RA 4HB2B 1XODA 2X18A 4RM9A 5G2NA 1YX6B 3HW2B 4MGIE 2LBBA 1DYNA 2NPTB 1WG7A 3VHTC 5D3XA 2K00A 1WH3A 4L6EA 2BKRB 4DX8A 1HE8A 4TQ1A 3PS6A 2KDIA 1RAXA 2YRYA 2NR2A 3RZFA 2HTHB 3U8ZA 3PTFC 4IM3A 3CIKA 1XD3B 3DXCA 2AEHA 5FR6A 3VFKA 4HCPB 2L00B 4BKSA 2LI5A 1WJ6A 2Z0PA 3ZDTA 4ASWC 3NZSA 3W1SA 4A3PA 2L7RA 1OGWA 3OJ4B 3A9JB 2UZSA 3A1QA 2C60A 3CMMB 4GDKB 4WWOA 1BAKA 1FXTB 2XK5B 2R09A 4HK2A 4WJOA 5C79A 2Z0OA 2MCNB 4GPTB 3JW0X 4KVGB 4Y94A 2R2QA 3M3JA 1RLFA 1DDWA 1QC6A 3NHEB 3KVFB 3UIOB 2I5FA 2I1KA 1U27A 1V80A 1KZ7A 1VD2A 3ENEA 4NJ6A 1V86A 1IPGA 2V4LA 5TR5A 3N7CA 3EPYA 2J0KA 1ZC3B 1UEFA 1ZSQA 2COAA 4K17A 2KVRA 2OOBB 5KCVA 2DZMA 2LGDA 3GZNI 5J18A 2CS4A 3H6NA 2BPSA 3N30A 3X0WA 2J0JA 4ANWA 3SNHA 3WYFB 4GXBA 2CHZA 2PEAA 1Q5WB 2CRFA 2KKCA 4LDTB 5LLIA 3U30A 5JP4A 3ALBA 3M62B 2MSED 2LYDA 2DKPA 1HB6A 4GN1A 1QQGA 3TCAA 2KMAA 2M4NA 1V5UA 5DI9B 3QA8A 3ODOA 4HB3B 4TQ0A 1N3HA 3RCZA 2ABDA 4PQ0A 2P0HA 1E90A 3ZVRA 1P0RA 1WI0A 3HM6X 2KUPA 4TUUA 4DHZB 3FEHA 2KFKA 1S3SG 2KHWB 1VCBA 3RD2A 5KHQA 1SGHA 2GS0A 2ZVNA 2Q13A 1D3ZA 3ULBA 4G11A 3QARA 1U5DA 2RLOA
chains in the Genus database with same CATH superfamily
3GE8C 4MDKE 2WXHA 1NVLA 1YJJA 2INPE 3F0WA 4IUMB 4WIPA 3ZRCA 1ACCA 3V05A 1WR6E 2GCLA 4GDLA 2DYOA 2J4XA 3IG3A 4YSZB 2BS2B 2D9XA 1WZ3A 4B6HA 1PDXA 4KKIA 1D6EC 1WJNA 2JZPA 4NQKE 4OW0A 4P1BC 2FCQA 4K3CA 3SBTA 3MTNB 4DDGD 2ZEQA 4YT0B 1E7VA 3B9JA 2K22A 3KW5B 4BBNF 1F2RI 3JSVA 4NQLB 5CLQB 1UNSA 2V0GA 1KOTA 5L83A 2QJLA 2PMVA 4DBGA 2OJRA 3RNEC 3DBSA 2N0SB 3D8EA 1NYRA 4MY6A 3C19A 3ZW3A 1E8WA 2IO3B 1L4ZB 2EKIA 4QXAB 5J3QA 3V6CB 2BKFA 2FDQA 3R7RA 4K7SA 1NI3A 2M17A 1QT9A 2N7DA 2MW5A 1TGZB 2LVPA 4Q2JA 3FAHA 1HBKA 4HLEA 5EE9A 1WXMA 2KWVB 2KANA 3ECIA 4NNJB 5I4DA 3BWUD 2XEWA 4AS1A 2Y5BB 4TMAB 2WWZA 2BYEA 2QDFA 4FXCA 4GGQA 5DHFB 5GOWB 4GDLB 3U12A 2WXLA 4BKTA 3SUZA 2KUQA 1HA5A 2KMMA 5J17A 1ST7A 1WJ4A 4NPNA 5EE1A 1OTRB 2EKEC 3DOWA 1KI1B 2K3UA 3HVDA 2RGFA 1YX5B 1SF0A 3VUWA 4B9KA 2MWNB 3GYOA 2KMCA 1AARA 1JRUA 3AE3B 3Q8FA 4WWNA 4IWPA 2MA9B 3JSVB 2MJDA 3TUOA 4D0NB 1RJ2A 3PTFC 4DWFA 3U7DA 2WX1A 1RM6C 3A58A 1XLPA 2LRWA 1UPQA 3W5UB 3E9LA 1Y19B 2CY5A 1FHXA 2NBWB 3N1XC 5JZEB 3PVWA 3D8DA 2KTRB 4BBNC 3T3OA 3M95A 3MHSD 5IP4D 1LXDA 4M8MA 1OQRA 2BT6A 1Y8RC 3J9CA 3TJPA 5LONB 2DX1A 2KYWA 1GOZA 2GB1A 1H4RA 3UQBA 3NVVA 5CHFA 2WU5B 4BKSD 2W54A 4CYEA 2ELBA 2L8JA 2J59M 2K8CA 1WJ1A 1ZDXA 5IO9A 4F7UP 3DDCB 3OANA 4IC7B 2PVOD 1EWCA 4NAWA 2ASQA 1XLOA 4KDLB 5C16A 2JWZA 3ZLZA 4WJNA 2LRUA 1P5TA 3V6EB 2COPA 1FHOA 1R4MI 1SE9A 4XC2A 3RT3B 3NVZA 1X86A 1G6JA 2DA0A 1K52A 4D6WA 3TEYA 3NVWA 4M00A 4WVFB 3S2AA 3VAWA 1DDVA 5D6JB 4LNFA 1GB1A 4A3OA 3RUIB 3DBHB 4GZUA 4LLGM 2KTRA 2IGDA 1FCCC 4W9LA 1JMLA 1XLNA 1HZ5A 3PHWB 2ZZPB 1IYFA 1Y5OA 3O96A 2W82A 4W9IA 3ML4A 4LNKA 3BINA 1IGDA 1DOXA 2BF8B 4F7HA 3KUCB 2MEKA 3MFGA 5DPWA 1X1GA 2YS5A 2KJ6A 2MBOA 3OJ3A 1UZXB 2RDBC 2Y8GA 3U2SC 4WWMA 1SE4A 4EKUA 4NAWB 2N9KA 2FCMA 5EE3A 2LD9A 2ZPNA 1XD4A 2NVUI 3AH7A 1XCTL 1WWTA 1TJ6A 4HROA 2MBQA 2ON8A 5G5HA 1GJZA 2D11A 2IPKD 2MBBB 1ZKHA 4YTMB 2ROVA 3PLUA 2M0AA 2WDTB 3DQVA 2RD0A 1C3TA 4LJOB 1VJKA 3FLVA 2SAKA 3BYTB 4RGNA 1CMXB 3ML8A 3N1YC 4IWQA 3FSSA 3I9V1 1WI1A 2PKOA 4K7UA 3LXFA 2FUHB 3D8FA 4ZRKA 1FO4A 1B55A 1F9JA 2RVBB 2D5GA 1SE2A 2KX3A 5D3VA 2ZW0A 1V2YA 5M4YB 3PVUA 2N7EA 1P9DU 2NTSA 1L4DB 1KFYB 3APDA 3VTVA 1EGXA 4UDUC 4TV3A 4DQOC 3QAQA 1HB8A 4I6NB 1WE7A 2V3NA 2WX0A 4C4VA 2KQSA 1PFJA 4HDOA 4EZLA 1LM8B 4OVUA 2FE8A 1WJUA 3H7PB 3FVCA 3GS2A 4XYCA 1RFAA 4XGAB 1LB1A 2GRIA 2RSUA 2JXTA 3F5RA 2D9ZA 5CHWA 2HE7A 2LUEA 3PZ8A 3ODWA 1ZVRA 2JZ3B 2N9LA 4KGRA 1H10A 3AV8A 3N1ZC 2N9XA 1C77A 1P6SA 2C9WB 1SJHD 2WS3B 3KSYA 4DX90 4JPSA 1RRBA 1UELA 4USAA 3PV1A 2IO0B 3DVGX 3E9PA 4ITKA 4OSNA 4F8CB 3ZDMC 3QHTA 3A33B 3TFMA 3A1QB 3LJUX 5D3IB 4GDKA 4W9EA 2XK5A 2KN4A 4CHJA 4XX5A 1PFDA 2WXQA 3WAPA 4K2OA 1EF1A 2PE6B 2BS3B 2UZRA 1YNTE 5BO4B 1E0ZA 2ACZB 2YS1A 4FLHA 4X57B 4FJYA 4GB9A 2LZ6A 2D10A 3VR8B 3H7PA 5IRSA 5E6JA 1JWMD 1GAQB 2CJOA 3B2GA 3NG0A 1PYWD 3GYPA 1NTYA 4NAMA 2DWQA 3VH4B 2GMIC 1Z5SB 1GC6A 2R61A 3FILA 1UNQA 4JKGB 3ZKJC 1U5EA 3QWMA 2JRHA 2KQ7A 4A6HA 2COFA 4PNKA 2N7JA 4HCNB 4HB2B 2X18A 5G2NA 4IOIE 1TKYA 2K00A 2BKRB 1F2RC 2AQ1B 1HE8A 4TQ1A 4QJ5B 2KDIA 2YRYA 3I5JC 3U8ZA 1XD3B 3VFKA 4HCPB 5LNK1 3SFEB 2LI5A 4A3PA 1KH0A 2UZSA 3A1QA 1V97A 3CMMB 5HHDG 2XK5B 5BYSA 4WJOA 3JW0X 4Y94A 2R2QA 1WGKA 4JKDA 1V80A 1KZ7A 3IXSA 2V4LA 2WXMA 3SU8X 3EPYA 2J0KA 2KVRA 1UEFA 4K17A 4KIKB 5J18A 2DZMA 3GZNI 1FFVA 2J0JA 4ANWA 3WYFB 1MPEA 2DLBA 2DNFA 1EM7A 2CRFA 1HEZE 1JWUD 3ALBA 1ET6A 3M62B 2MSED 3AEDB 1HB6A 2M4NA 4TQ0A 2MHJA 4HB3B 3NJTA 5C2TB 4PQ0A 2JWUA 3FEHA 2KFKA 1L5PA 1N5WA 2IJ0A 3AE2B 2ZVNA 2Q13A 3ETRA 3Q8AA 1QOAA 3FILB 1FD6A 3M63B 3D32A 4OVZA 2PJHA 1YQ3B 3RNAC 1ESFA 3K9PB 1W1HA 3NRZA 3RYTA 5HKHA 2RPQA 2FJUB 4XDDA 2IGHA 3Q3JA 5J2RA 4YONA 1ZM0A 3HRDD 3U7ZA 5IA7A 4A9AA 2JXXA 2DN6A 1JWBD 4RMAA 2L3ZA 1RYJA 1D5MC 3TVVA 3VVWB 4G0NB 1ZOYB 2JF5A 1UGJA 1I35A 3PRZA 1QKZA 3NOBA 4NY0A 1K51A 3QK0A 2L1AA 1T0RC 3UI3A 4WJQA 3DBLB 4MELA 2MDXA 3OWEB 3W5VB 2M8SA 3V5WA 4ICVA 2KC2A 5BMHA 2YF0A 1BT0A 2GBMA 4HHVA 1NI2A 1TS4A 2KT7A 4DXGA 2AQ2B 3B1LX 2BB6A 1V81A 4OHJA 4RCOA 2G1EA 4HPPA 4N59A 4P1CC 4WAAA 2LJ5A 2ZVOA 3L16A 4JQWC 3GP7A 2KFKB 2IDYA 1YN4A 3PRPB 2BS4B 1B9RA 1YOVB 1K5GB 2KLGA 4FHKA 4HJGE 1VZ8A 3TEWA 4Z2NA 1SIFA 1I4HA 2RSGA 5C1ZA 1L0YB 2D3GA 1WF9A 2KACA 1P7EA 5IAAC 2KNBA 1E5WA 3BVGA 4HAXB 2DYNA 3SO6A 1NDDA 1R4MB 3N3KB 1OQQA 1SE3A 4JWUC 2MWSB 4US8A 1C79A 3BZDB 4JIOU 4P16A 4ZYSA 5C5BA 1P7FA 1UBIA 4R3DA 1QF6A 1KLVA 2DLWA 4ACFA 2W3SA 3QIJA 3QBVB 1SEBD 2CR5A 1L0VB 3BYYB 3L08A 1ZGUB 3ZUNA 3NWDA 4QJ3B 5J3TA 1FRRA 2L0TA 1VRAB 2DAFA 4EEWA 3A8PA 2LHDA 3EFCA 1LW3A 4ARCA 4KV2A 1QOGA 2NCNA 3DBRB 3R8BA 3P42A 1I4XA 5CLLB 1STEA 4GSWA 4WAFA 3VH3B 4ANVA 5AZHA 4AQ7A 2N4FA 2GBNA 2RDGA 3DXDA 2ZW1A 4W9CA 1XF5L 2XBBC 2EC1A 3TMPB 1TY2A 1E8XA 1WXQA 4K7WA 3EUB2 3VDZA 4A6KA 2D9WA 3A8QA 5AEKB 5CX3A 1WXAA 4GMVA 3Q8EA 3GB1A 1NU2A 3VXWA 5LXIB 1I4GA 1E6EB 1I42A 5L81A 2VH2A 3NVYA 4N9F4 2KZRA 4ILHA 1WM3A 3Q14C 2AL6A 2N0YA 4CSQA 2LFIA 1PGBA 1WGUA 3AXCA 3R7QA 3P4RB 2LJIA 4C00A 5JLJB 5C5BB 3AI5A 4JK9A 2MP2A 2X38A 2YS3A 2KOXA 4N58A 2K39A 1YJ1A 3NS1A 2MQJA 3B08A 3RZWC 1L0XB 1R7SA 3NS8A 3W2DA 2M38A 2W9NA 1WVHA 1MIZB 5DCNA 2ZJDA 3SDLC 1L7YA 3TEXA 4MH0E 3UGBB 2BCJA 5MPOA 3A9KA 1FEHA 4F7GA 1MG8A 1KM7A 2LXCA 1DDMA 2JVCA 1CK1A 1JCKB 3PP2A 2V4IB 3BIID 3H7SA 1GPXA 2XQNM 4G50A 3NZUA 4RF1A 1GB4A 2JY6A 3VQIA 2W2XC 2ZNVC 3AE8B 3RZFA 4GU2A 1FHWA 4ZDVA 1WE6A 2NTTA 2KCJA 2ZCBA 4PS3A 2WXIA 4GOUA 2W55A 1IBXB 3KY9A 3A4SC 1FGYA 3VOQA 2JX5A 2O2VB 3R2TA 3A4RA 2J53A 2A4ZA 2EELA 1XXGA 3R3MA 4RGMA 2D2QA 4B6WA 3P4SB 2XN9C 3N9YC 5FI1A 4E3CA 3MPXA 2BW2A 2WXRA 1DIKA 1UNRA 4PK1A 1SIJA 4XDCA 1KJTA 2D3CA 1YN3A 2WXOA 5I2MA 3QC8B 4DDID 4AOFA 4ZHPA 2KDMA 4LJPB 3L13A 1RRPB 4P6VF 2K1FA 4ZRIA 2PPHA 3GE3C 3P7ZA 1JALA 1QILA 4MGZE 1C4CA 4TYZA 4NSWA 5HI1A 2KIGA 4XE0A 2YT1A 3B0AA 1XT9B 4ZHOA 4HSIA 4HAVB 2VZKB 3RFZB 2G4SA 3DVGY 2UWQA 3NWAA 1M94A 4ZRQA 2UVMA 3QWZB 2DZKA 1WY8A 1CQVA 3LB8C 2ADZA 4IKGA 2YLMA 4RNAA 2K0PA 2IGGA 2MJ3A 1BTKA 1BMLC 3K9OB 1FIQA 3PHXB 1TKGA 2RPVA 4PYUA 1X05A 4HPMB 2O2VA 3C0RB 1NBFC 2ZCCA 1DBHA 4E71A 1T0QC 3AE5B 1LGRA 2KN5A 4IOYX 4B0MA 1S1QB 1YN5A 1MG4A 4O1NA 2K8BA 3DPDA 2WH5A 1AWDA 3VTUA 3AEBB 3ZYYX 1NEKB 1W1GA 3PVLA 1KZGA 1JWSD 1WMHA 4D2KA 5DH9B 1B1ZA 1K50A 1WX7A 1L6UA 1T5XD 5HE2A 4JKFA 3AU4A 1BXTA 4HKZE 3KRWA 1XCQL 2GCJA 4RGTA 3UINB 2CY4A 1VZ6A 1WR1A 4II2B 1I4QA 2JU6X 4DBBA 2GUMA 2FIDA 4FADA 1IUEA 2DYBA 3Q69A 5HG2A 1WXVA 2WDQB 2I2YA 4YTNB 1ZC4B 2GBRA 2ELAA 4WH4A 2V3SA 5EDSA 1WGHA 1J0WA 3IBEA 4PYZA 4BFRA 1XX0A 1FPYA 2UYZB 2JZZA 3AE4B 3V62A 1DGJA 3IT4B 5JH5C 1F52A 3PSEB 2LOXA 5G55A 1I7AA 3VUYA 2INDC 3Q8BA 2L05A 3L54A 5E6OA 2BVCA 2JRIB 2WYQA 4II3B 1FB8A 3CSTA 3GZNB 3KWLA 4W9FA 4WQOB 1MI1A 1LO5D 5E6NA 3APCA 3U4EG 4OVVA 5FKAC 4M8NA 2DX5A 2N9PC 1SXTA 1M7EA 1X1MA 3VR9B 3AN1A 3BK2A 1WMHB 1WSPA 4RM9A 4JK8A 1YX6B 3HW2B 2NPTB 3VHTC 1WH3A 1TZOA 2JSVX 1RAXA 2HTHB 5FR6A 2L00B 3ZDTA 2G9HD 3V3XA 3NZSA 1OGWA 3Q2AC 2C60A 4WWOA 1BAKA 2PVGC 2R09A 1DOIA 2MCNB 2I1KA 2J52A 1TIFA 1ZC3B 2OOBB 1V1PA 2BPSA 5IOIA 3VRBB 2V9HA 2CHZA 1VBGA 1Q5WB 2KKCA 5LLIA 1J7BA 3B2FA 2LYDA 4GN1A 1V5UA 2NBVA 1N3HA 2ABDA 2P0HA 4TUUA 4DHZB 2KHWB 3RD2A 3MC9A 4G11A 1U5DA 2RLOA 3RNBC 1JDEA 2DYMA 4HAWB 2RRFA 2HJ8A 5H92C 4US9A 1QOBA 4JLCA 2Y3AA 1AQCA 2XNAC 2D3AA 3B77A 1TTNA 4FA6A 1WXSA 4KGSA 2DZJA 2LXAA 1MFWA 2K6QA 1WX8A 2HTHA 3N20C 4LTUA 1PUTA 4A90A 2GJYA 1A70A 1UUPA 2X0SA 3HUIA 2MRPA 3A9JA 1EUVB 2L32A 2LMCA 2J0MA 3U52E 1E8ZA 1D5XC 4REZA 1HZ6A 2LEKA 3JYUA 4ILGB 1VBHA 1L6VA 1QQRA 4EZJA 3I63C 1V1PB 3PO0A 2KJHB 4EJNA 3L10B 4KX6B 4MGKE 1WJMA 5H8YE 2V3PA 3DBRI 1ET9A 2VSZA 1WGYA 3FP5A 4Z2MB 3KYCD 5D94A 4B95A 2BGFA 1EU3A 1UWMA 4J6IA 1KTKA 2JP2A 1DOYA 3P6AA 1KC7A 2L0FA 2BBCA 2L76A 3BK1A 2K5PA 3AE1B 3KZ1A 1XKEA 2G45B 5I2SA 1MHXA 1EU4A 2FAZA 3ZQ4A 3DCXA 3RNFC 4CHMA 4K1RB 3RPFC 1K5DB 4KHAA 3HK0A 1U5GA 3EECA 4HWIB 4KSKC 4TKNA 4IG7B 2KGXB 2FJLA 1F1HA 1KBLA 3C8YA 1T3QA 1IGCA 1CJEA 1MK9B 3TIXA 1FXAA 1FM0D 5D3WA 3QQ8B 3ZJUA 4DK5A 4KDIC 3PG7A 3AEGB 2NZ8B 2O6VD 4HATB 1FFUA 3P1MA 5CTRC 1XCGA 2YEPB 2EMSA 5AUKA 2D3BA 2KX0A 1OEYJ 2ZKMX 1NTIA 4WURA 3VTWA 3RNGC 3BVZA 1FRDA 1TBEA 1YMHE 2LVQA 2JQRB 4YTPB 2VH1A 2HRJA 4W9GA 1C9FA 2IYDB 5HE3A 1EO6A 1FGZA 2Q5WD 1N60A 5KHOA 2W2WA 4ZRJA 1ZW7A 4MT7A 2MX2A 1R4NI 1PLSA 4OZCA 3KQ4A 2KC1A 4GNKB 1YQ4B 4FJZA 2FUG1 5CHVC 5D3YA 2COCA 1M4VA 2RGNB 4S0RA 2QEJC 4L2YA 3ENBA 3TO1A 4DHJB 5JHGA 2HJ1A 2PTLA 3HVZA 4IM0A 1YQBA 2R0DA 2I5CA 4WJPA 3HM3A 4EOYA 1WGDA 2LVOA 4BAXA 3DXEA 3CWIA 4ICUA 1V5TA 4HAZB 3FM8C 4CHKA 2V1YA 5E6PA 4C7ZA 5BMIA 4ARIA 2CB8A 4URKA 1YJIA 1XO3A 2KR0A 3CF6E 3IT6B 1P98A 3UIPB 2RQ1A 4JE3B 5GXGB 1Q1OA 1MI0A 5DPSA 4RGOS 4MACA 2TSSA 4IAPA 2L1CA 3BY4B 3OAWA 3URYA 2DENB 1OY2A 2BWES 2MH7A 4A20A 2DKQA 4BOZB 1PMSA 2OHFA 2Z59B 2IY0B 1L2NA 2ZNVB 1OQYA 2OJWA 1AYFA 1HTOA 5L95C 5TSSA 3ZJTA 4JKEA 1XLQA 1J19A 1BUIC 3EGRA 3TBLD 3ZO5B 3VUXA 1WZ0A 2DHZA 3ML9A 3BVMA 2NS5A 3DWMA 3R2IA 2EMTA 3E9OA 2A5UA 2N23A 5FK9C 5BMGA 1TYGB 2KFJA 1Y56A 2ZPYA 2VRRB 2B3AA 2KK8A 4HEA1 4MSQB 2KDEB 4FN2A 1UF0A 2KAJA 1V5OA 2PIAA 2KO3A 5C6RA 1FNVA 1TXDA 1WIAA 2C5LC 3I3TB 3KLSX 2MFQA 2AL3A 5BYRA 1XR0B 3TSSA 2K9XA 4N6EB 3IVFA 2M0XA 1AW7A 4MSMB 4M0WB 2P0DA 1VDVA 4KKJA 3WANA 1GGOA 4CQNA 3GOEA 5GMVA 3NW8A 4DHJD 1YD8U 2DAJA 3OG5A 3EHVA 4PS8A 4EZKA 4KHOA 3Q3NC 2FJ9A 4FULA 4C0AA 2LWPA 2BYFA 3QCAA 1N6ZA 3AEAB 4ZRPA 2B76B 3DCGA 3PRMB 2Z59A 2KWDA 3T06A 4HVBA 5JXVA 1E9MA 2JYEA 4LDTD 4NZLB 3ZTCA 3KRXA 2HD5B 3LDZE 3RNCC 1K8RB 1V49A 1I4RA 4HPLB 2H7DA 3L4PA 1QZEA 4MM3A 3EA6A 2DHKA 3LJ3A 2AX5A 3H9DA 4HAUB 3PSCA 3SYXA 2R2OA 2LKOA 1SB3C 2PLPA 4OZAA 2KQ4X 2YVCA 3FC4A 3P4QB 1F77A 2CKHB 1ZPSA 1J8CA 2DYQA 2E2XA 2M14A 4MJSA 2IO2B 5D7GA 3NSUA 3PREA 4M0WA 1SSNA 2E6XA 3DWGC 2DHJA 3VIAA 4AUQC 3W1SC 2FCNA 2QKMA 3ZIMA 2KD0A 2H7EA 2O6VB 2K25A 1ZUD2 1PQSA 3NWFA 2CU1A 3MC0B 1Q10A 2EJ8A 3MJWA 1V6EA 2D4QA 4RM8A 1VR9A 3N32A 2HTME 1UD7A 4JGHB 4DXFA 2IY1B 4L1BA 1QLBB 4JKBA 3APFA 1ZXHA 3SD5A 1V1OA 4GMXB 1FNWA 1U2BA 2ICIA 4GIVA 1VZ7A 4YXDB 3ZNGC 4MM3B 5KHQA 4JKHA 4AP4C 2K8HA 4A6QA 1Q67A 3CXBB 3VRAB 1ISNA 4HB0B 4C4VB 4FHJA 3WALA 2QKLA 1JWAD 1TZ1A 2GLSA 4RF0A 5D3DA 4AWJA 2YT2A 5DPTA 3R66C 5KQ1A 2JPHA 2OEDA 3Q3OC 2LULA 3HIZA 1V5MA 3ZJVA 3Q8CA 4IW0A 4MJSB 1XEEA 5D2MB 2RUKB 5KQ4A 4ANXA 4WQMA 4DHZE 4RH6A 3DHIC 2O6VA 2BWFA 4FBJB 1AWEA 4BKGA 4K2PA 5AZGA 1P3RA 4MGIE 3DHGC 1WG7A 4JWSC 4L6EA 4DX8A 3PS6A 4IM3A 2QIEB 4LNIA 3DXCA 2AEHA 3AEFB 5HFYA 3Q3MC 1E7PB 1ZXIA 4ASWC 3W1SA 2BTEA 5JVLA 4OT1A 2L7RA 3OJ4B 1T0SC 4YSXB 4GDKB 1SJED 1FXTB 2BYTA 5C79A 3M3JA 1RLFA 1QC6A 3UIOB 3NHEB 3MJ5A 3ENEA 1U27A 5TR5A 1VD2A 3H8HA 2CS4A 4J3OD 3X0WA 4JK7A 3SNHA 4GXBA 2PEAA 4LDTB 1A5RA 3U30A 2DKPA 2KMAA 3QA8A 5DI9B 1E90A 1P0RA 1WI0A 3HM6X 3ZVRA 1JQ4A 1S3SG 3ZGZA 1VCBA 2WXNA 2GS0A 3CIRB 3QARA 4JKGA 1UPRA 1WRDB 1R4NB 3TW1A 3W1YA 3ZVVA 4I6LB 3T9LA 4G3XB 2SEBD 2N1WA 1KLGD 1Q0WB 5JHAA 5C3JB 2G35A 4KZCA 5AZFA 1NTVA 5C23A 2ROZB 2MBHA 3CSFA 3O13A 3ODXA 2WU2B 2VKIA 1GG3A 1GUAB 1HTQA 1N5XA 1NVID 3SFDB 3TEZA 3V60A 2CODA 4JKAA 2LUMA 2IFSA 2YSZA 2PE9A 4RFBA 3WAOA 1GNUA 4E74A 2QCZA 4F7ZA 4HKQA 4KGTA 1YIWA 5JHHA 2L2IA 1DROA 4KIKA 3T8MA 1FNUA 1FOEA 1WGRA 5AUIA 3MDBC 1MK7B 3A98B 3WIMA 2LGXA 1V88A 2J7QB 1EF5A 1KRHA 3ULCA 1D5ZC 2YEPF 2K49A 4YWGG 3PEGA 3MC8A 4ANUA 2C7HA 1UH6A 4M01A 2QC8A 1WX9A 3EC8A 4QJ4B 3X23A 1T0YA 3FKYA 4XZ4A 1T77A 2VRWB 3SHQA 5D27A 2Z4DA 1ZDVA 3I57A 3PZ7A 4M02A 4HB4B 2MLBA 4IWOA 3DVNV 1NYQA 1RWSA 2JUOA 2R2YA 1TS3A 4BBKA 1WYGA 2P8VA 3AJ4A 1SBBB 3KUDB 2PW9A 2OTXA 4HAYB 2M56B 4KSLC 4K3BA 4YL8A 3KH0A 2H89B 3ZRFA 2CHWA 4EMOA 2AWTA 1N62A 4HXDA 1WFYA 4W9KA 4GLSC 3KWVA 2BYVE 2UU7A 4KHBA 2FIFA 1MKEA 4H8SA 4JL9A 2C7MB 2FNJB 3L0WB 2INNE 5DIFB 1WRIA 2WQYB 2C7NB 2BB5A 2G3QB 1WGQA 1V89A 1FAOA 2RR9A 1EVHA 1OMWA 4QAYA 4LNOA 3RMKC 1D4BA 4K81A 3P63A 1Z87A 2D9YA 2KDBA 5G5GA 2KIEA 3A9KB 2RMMA 3PGEA 2WXJA 4BOSC 1ZE3D 5IN7A 5IKCM 2KJRA 1J7AA 1WGGA 1EWYC 3DBHI 2CJNA 3AE6B 1IP9A 1IRSA 2WXKA 1HQRD 3RULA 1P3QU 2DFKA 2KDFB 2YT0A 3UZTA 3ONSA 3BJIA 3OLMD 3RN9C 3UQAA 3T3NA 2E3TA 2RDHA 2Z0EB 2IBIB 1E8YA 2HDEA 1IBXA 3AM9A 2M1MA 2Z0QA 1ZP0B 4WWPA 3PLVA 2LGYA 1V5PA 1ENFA 2AYOB 1VLBA 4YSYB 2PZ1A 2LASA 3DVNU 3AU5A 2QMTA 3HSAA 1C1YB 1MHHE 4KHBB 5FR3A 2DTCA 3PPAA 4NJ7A 5EFXA 2WDVB 3QX1A 1U29A 2CHXA 1U4AA 2WHIA 4ZOHC 4HJKA 4LNNA 4CO7A 5J3YA 1M7RA 3WA0A 1I2HA 4C7YA 4ZYNA 2D9VA 2W2XD 5HE1A 3MHZA 3WCQA 4C80A 3QJZA 5LXHA 3HQCA 3SV1A 2NBUA 2LG1A 3G9WA 3AECB 4W9JA 3NUHB 5FI0A 1WYWB 1FCLA 4EE2A 3DBLI 5EE0A 3SR6A 1TS2A 2FBWB 3PZDA 1BTNA 5IJMA 3IHPC 3P4PB 4A5KA 1Z2MA 4P7IA 3ZXRA 1E7UA 1ACAA 3TL5A 1TS5A 2G4DB 1RFKA 1C4AA 1GC7A 2MJEA 4A8XC 2NMBA 1MIXA 4ILJA 3WAMA 1JW9D 2MP2B 4AJYB 1F0ZA 4MK0A 4FJVB 4IDIA 3ZTDA 2WXGA 2L83A 5HE0A 1X1FA 4HRSA 4IFSA 1UGMA 3LYYA 3W9CB 1UNPA 3M1IB 2Y8FA 1KF6B 2LGIA 4IM2A 1MJDA 4GOCA 1OEYA 2L52A 1JRPA 2DZIA 2LGSA 3ZNZB 2JT4B 2WXFA 1FMAD 2RNRB 4KZ0A 2CQUA 2LOZA 1I4PA 2I1JA 1J7CA 3ZNHB 3O65B 2N1VA 2Y5CA 3AMZA 4MH8A 1H8CA 5DPRA 1XQQA 2GBKA 2FCSA 2NMQA 4JKCA 2MKRA 1T6BX 2INCC 1AN8A 2X8XX 3DHHC 3IAM1 1V61A 2IZVB 2GOWA 1C78A 2WXPA 1UWXA 2WLBA 3E56A 3IFWB 4S17A 2DHIA 2K8EA 1OQNA 3Q3FA 2N9EB 3AULA 3PT2B 3IAS1 4A55A 4H2AA 1ROEA 3KYDD 4KAXB 2K2JA 1PGXA 2Z14A 2LHEA 2Z0DB 1W1DA 1K53A 4XWXA 2VZKD 1MPHA 2QHOA 2V76A 1LQBA 2Y5PA 4MGYE 4F1SA 2KVZA 2WGSA 4MT5A 3UF8A 4XWTA 2W3RA 3RI7C 2DX5B 4L23A 4NJCA 5LG4B 2R82A 2I38A 3NY5A 1TKEA 3EFUA 2GBJA 5T8IA 2DIKA 4EUTA 3HIEA 2IO1B 4LCDE 4A6FB 4BVUC 2KWCA 3E9SA 2QSDA 1N61A 2CAYA 1BWNA 1UBQA 2J42A 2NPTA 4AJWA 1SHCA 2Z13A 4WSFA 2D07B 1TQZA 2H88B 2WP9B 3AE7B 4BZAA 1E10A 4C56C 2KTFA 4EFOA 2P0FA 2K6DB 4WJ7A 1V9JA 3MP9A 1DYQA 1WM2A 3KUZA 3JVZX 4W9HA 4DXAB 4PS7A 1U5FA 2WNMA 4TSSA 1TY0A 2REXA 2AQ3B 2Y7BA 1MVKA 3AE9B 3L17A 3V61A 1V8CA 2MBEA 1J0GA 2KXJA 1EAZA 2M19A 2DBYA 2JYTA 3ABVB 5DHAB 3HHMA 3RCPA 2NBVB 5JHBA 3OHMB 4W9DA 2WDRB 2BQQA 1QOFA 5LOPB 4JX1C 4MEMA 2IYBA 4PT5A 3Q6BA 4I6PA 4HDQA 1X11A 3NZ3A 3E66A 1FXIA 1LFDA 1ZYIA 2KLCA 4B0EA 1P1AA 1MAIA 1N63A 2OQBA 4A6FA 1KLUD 3ZNID 2KWUB 3P2BA 2K2UA 3AB5A 1XODA 3SBGA 1C76A 2LBBA 1DYNA 1PGAA 5D3XA 1HXYD 2QILA 2NR2A 1TJEA 3CIKA 1NENB 1CZPA 4BKSA 1WJ6A 2Z0PA 4L1RA 1JROA 2Z8LA 3A9JB 2GI9A 4HK2A 2Z0OA 2ONQA 4GPTB 4KVGB 1DDWA 4OZBA 1C4PA 3KVFB 2I5FA 4NJ6A 4XWWA 1V86A 1IPGA 3N7CA 4DIXA 1ZSQA 2COAA 5KCVA 2CU3A 2LGDA 4LK0M 3H6NA 3N30A 3ZXVA 1I7HA 5JP4A 3TCAA 3H1UA 1QQGA 3AEEB 3ODOA 3RCZA 1OFFA 5BYQA 2KUPA 1TT5B 1SGHA 1D3ZA 3ULBA 3SEBA
chains in the Genus database with same CATH topology
4MDKE 1NVLA 3F0WA 4IUMB 3ZRCA 1WR6E 2GCLA 4GDLA 2DYOA 3IG3A 2D9XA 1WZ3A 4B6HA 1WJNA 4NQKE 2FCQA 3SBTA 3MTNB 4DDGD 2ZEQA 1E7VA 3KW5B 4BBNF 3JSVA 4NQLB 5CLQB 1KOTA 5L83A 4DBGA 2OJRA 3DBSA 3D8EA 4MY6A 3ZW3A 1E8WA 2IO3B 5J3QA 3V6CB 2BKFA 2FDQA 3R7RA 4K7SA 2M17A 2N7DA 2MW5A 1TGZB 2LVPA 1HBKA 4HLEA 1WXMA 2KWVB 2KANA 3ECIA 4NNJB 2XEWA 2Y5BB 2WWZA 2BYEA 4GGQA 5DHFB 5GOWB 4GDLB 4BKTA 3SUZA 5J17A 1ST7A 1WJ4A 4NPNA 1OTRB 2EKEC 3DOWA 1KI1B 2RGFA 1YX5B 3VUWA 4B9KA 2MWNB 3GYOA 2KMCA 1AARA 1JRUA 4WWNA 4IWPA 2MA9B 3JSVB 4D0NB 1RJ2A 4DWFA 3PTFC 3U7DA 2WX1A 2LRWA 1UPQA 3E9LA 1Y19B 2CY5A 1FHXA 2NBWB 5JZEB 3PVWA 3D8DA 2KTRB 4BBNC 3M95A 3MHSD 1LXDA 4M8MA 1Y8RC 3TJPA 5LONB 2DX1A 1H4RA 3UQBA 5CHFA 4BKSD 4CYEA 2ELBA 2L8JA 2J59M 2K8CA 1WJ1A 4F7UP 3DDCB 3OANA 4IC7B 4NAWA 2ASQA 4KDLB 5C16A 2JWZA 3ZLZA 4WJNA 2LRUA 1P5TA 3V6EB 2COPA 1FHOA 1R4MI 1SE9A 4XC2A 3RT3B 1X86A 1G6JA 2DA0A 4WVFB 3S2AA 3VAWA 1DDVA 5D6JB 4A3OA 3RUIB 4GZUA 2KTRA 4W9LA 3PHWB 2ZZPB 1IYFA 1Y5OA 3O96A 4W9IA 3ML4A 3BINA 2BF8B 4F7HA 3KUCB 5DPWA 1X1GA 2YS5A 2KJ6A 2MBOA 3OJ3A 1UZXB 2Y8GA 4EKUA 4NAWB 2FCMA 2LD9A 2ZPNA 1XD4A 2NVUI 1TJ6A 2MBQA 1GJZA 2D11A 2MBBB 1ZKHA 2ROVA 3PLUA 2WDTB 3DQVA 2RD0A 1C3TA 4LJOB 3FLVA 1CMXB 3ML8A 4IWQA 3FSSA 1WI1A 4K7UA 2FUHB 3D8FA 4ZRKA 1B55A 1F9JA 2RVBB 2KX3A 5D3VA 1V2YA 3PVUA 2N7EA 1P9DU 3APDA 3VTVA 1EGXA 4TV3A 3QAQA 1HB8A 4I6NB 1WE7A 2WX0A 2KQSA 1PFJA 4HDOA 4EZLA 1LM8B 4OVUA 1WJUA 3H7PB 1RFAA 1LB1A 2RSUA 3F5RA 2D9ZA 5CHWA 2HE7A 2LUEA 3ODWA 1ZVRA 2JZ3B 1H10A 2N9XA 1P6SA 2C9WB 3KSYA 4DX90 1RRBA 1UELA 3PV1A 2IO0B 3DVGX 3E9PA 4F8CB 3ZDMC 3QHTA 3A33B 3TFMA 3A1QB 3LJUX 4GDKA 4W9EA 2XK5A 4CHJA 4XX5A 3WAPA 4K2OA 1EF1A 2PE6B 2UZRA 5BO4B 2YS1A 4FLHA 4X57B 4FJYA 4GB9A 2LZ6A 2D10A 3H7PA 3GYPA 1NTYA 3VH4B 2GMIC 1Z5SB 1GC6A 1UNQA 4JKGB 3ZKJC 1U5EA 3QWMA 2JRHA 2KQ7A 4A6HA 2COFA 4PNKA 4HCNB 4HB2B 2X18A 5G2NA 2K00A 2BKRB 1HE8A 4TQ1A 2KDIA 2YRYA 3U8ZA 1XD3B 3VFKA 4HCPB 2LI5A 4A3PA 2UZSA 3A1QA 3CMMB 2XK5B 4WJOA 3JW0X 4Y94A 2R2QA 4JKDA 1V80A 1KZ7A 2V4LA 3SU8X 3EPYA 2J0KA 2KVRA 4KIKB 1UEFA 4K17A 5J18A 2DZMA 3GZNI 2J0JA 4ANWA 3WYFB 2CRFA 3ALBA 3M62B 2MSED 1HB6A 2M4NA 4TQ0A 4HB3B 4PQ0A 3FEHA 2KFKA 2ZVNA 2Q13A 3M63B 3D32A 2PJHA 3K9PB 1W1HA 3RYTA 5HKHA 2RPQA 5J2RA 3Q3JA 4YONA 1ZM0A 5IA7A 2JXXA 2DN6A 4RMAA 2L3ZA 3TVVA 3VVWB 4G0NB 2JF5A 1I35A 3PRZA 3NOBA 4NY0A 3QK0A 4WJQA 4MELA 2MDXA 2M8SA 3V5WA 4ICVA 2KC2A 2YF0A 1BT0A 2GBMA 4HHVA 1NI2A 3B1LX 1V81A 4WAAA 2LJ5A 2ZVOA 3L16A 4JQWC 2KFKB 3PRPB 1K5GB 2KLGA 4FHKA 4Z2NA 1SIFA 2RSGA 5C1ZA 2D3GA 1WF9A 5IAAC 2KNBA 1E5WA 4HAXB 2DYNA 3SO6A 1NDDA 3N3KB 2MWSB 4JIOU 5C5BA 1UBIA 1KLVA 2DLWA 3QIJA 3QBVB 2CR5A 3L08A 1ZGUB 3ZUNA 5J3TA 2L0TA 2DAFA 4EEWA 3A8PA 1LW3A 4KV2A 2NCNA 5CLLB 4GSWA 3VH3B 4ANVA 5AZHA 2N4FA 2GBNA 3DXDA 4W9CA 2XBBC 2EC1A 3TMPB 1E8XA 4K7WA 3VDZA 4A6KA 2D9WA 3A8QA 5AEKB 5CX3A 1WXAA 4GMVA 1NU2A 3VXWA 5LXIB 1I42A 5L81A 4N9F4 2KZRA 4ILHA 1WM3A 2AL6A 2N0YA 1WGUA 3AXCA 3R7QA 5JLJB 5C5BB 3AI5A 4JK9A 2MP2A 2YS3A 2KOXA 2K39A 1YJ1A 2MQJA 3B08A 3RZWC 3NS8A 2M38A 2W9NA 1WVHA 1MIZB 5DCNA 2ZJDA 3SDLC 1L7YA 4MH0E 3UGBB 2BCJA 3A9KA 4F7GA 1MG8A 1KM7A 2LXCA 1DDMA 2JVCA 3PP2A 3H7SA 2XQNM 4G50A 3NZUA 2JY6A 3VQIA 2W2XC 2ZNVC 3RZFA 4GU2A 1FHWA 4ZDVA 1WE6A 2KCJA 2ZCBA 4PS3A 3KY9A 3A4SC 1FGYA 3VOQA 2O2VB 3A4RA 2A4ZA 3R3MA 2D2QA 4B6WA 5FI1A 4E3CA 3MPXA 1DIKA 1UNRA 1KJTA 3QC8B 4DDID 4AOFA 4LJPB 3L13A 1RRPB 2K1FA 4ZRIA 2PPHA 3P7ZA 4MGZE 4TYZA 4NSWA 2YT1A 3B0AA 1XT9B 4HAVB 2G4SA 3DVGY 2UWQA 1M94A 2UVMA 3QWZB 2DZKA 1WY8A 2ADZA 2YLMA 1BTKA 3K9OB 3PHXB 4PYUA 1X05A 4HPMB 2O2VA 3C0RB 1NBFC 2ZCCA 1DBHA 4E71A 2KN5A 4IOYX 1S1QB 2K8BA 3DPDA 2WH5A 3VTUA 1W1GA 3PVLA 1KZGA 1WMHA 5DH9B 1WX7A 5HE2A 4JKFA 3AU4A 3KRWA 2GCJA 3UINB 2CY4A 1WR1A 4II2B 4DBBA 2FIDA 4FADA 2DYBA 1WXVA 1ZC4B 2GBRA 2ELAA 2V3SA 5EDSA 1WGHA 1J0WA 3IBEA 4PYZA 4BFRA 1XX0A 2UYZB 2JZZA 3V62A 5JH5C 3PSEB 2LOXA 5G55A 1I7AA 3VUYA 2L05A 3L54A 5E6OA 2JRIB 2WYQA 4II3B 1FB8A 3CSTA 4W9FA 4WQOB 5E6NA 3APCA 4OVVA 4M8NA 2DX5A 2N9PC 1M7EA 1X1MA 1WMHB 4RM9A 4JK8A 1YX6B 3HW2B 2NPTB 3VHTC 1WH3A 1RAXA 2HTHB 5FR6A 2L00B 3ZDTA 3NZSA 1OGWA 2C60A 4WWOA 1BAKA 2R09A 2MCNB 2I1KA 1ZC3B 2OOBB 2BPSA 2CHZA 1VBGA 1Q5WB 2KKCA 5LLIA 2LYDA 4GN1A 1V5UA 1N3HA 2ABDA 2P0HA 4TUUA 4DHZB 2KHWB 3RD2A 4G11A 1U5DA 2RLOA 1JDEA 2DYMA 4HAWB 2HJ8A 4JLCA 1AQCA 1TTNA 4FA6A 1WXSA 2DZJA 2LXAA 2K6QA 1WX8A 2HTHA 2GJYA 2X0SA 2MRPA 3A9JA 1EUVB 2J0MA 1E8ZA 3JYUA 4ILGB 1VBHA 4EZJA 2KJHB 4EJNA 3L10B 4MGKE 1WJMA 3DBRI 2VSZA 1WGYA 3FP5A 4Z2MB 3KYCD 5D94A 4B95A 2BGFA 4J6IA 2JP2A 3P6AA 1KC7A 2L0FA 2L76A 3KZ1A 1XKEA 2G45B 2FAZA 4CHMA 4K1RB 1K5DB 4KHAA 3HK0A 1U5GA 3EECA 4HWIB 4KSKC 4TKNA 4IG7B 2KGXB 2FJLA 1KBLA 1MK9B 3TIXA 5D3WA 3QQ8B 4DK5A 4KDIC 3PG7A 2NZ8B 2O6VD 4HATB 5CTRC 1XCGA 2EMSA 2KX0A 1OEYJ 1NTIA 3VTWA 1TBEA 2LVQA 2HRJA 4W9GA 2IYDB 5HE3A 1EO6A 1FGZA 5KHOA 2W2WA 4ZRJA 1ZW7A 4MT7A 2MX2A 1R4NI 1PLSA 2KC1A 4FJZA 5CHVC 5D3YA 2COCA 2RGNB 3ENBA 3TO1A 4DHJB 5JHGA 4IM0A 1YQBA 2R0DA 2I5CA 4WJPA 3HM3A 4EOYA 1WGDA 2LVOA 3DXEA 4ICUA 1V5TA 4HAZB 3FM8C 4CHKA 2V1YA 5E6PA 2CB8A 4URKA 3CF6E 1P98A 3UIPB 2RQ1A 1Q1OA 5DPSA 4IAPA 2L1CA 3BY4B 3OAWA 2DENB 1OY2A 2BWES 4A20A 2DKQA 4BOZB 1PMSA 2Z59B 2IY0B 1L2NA 2ZNVB 1OQYA 5L95C 4JKEA 1J19A 3TBLD 3ZO5B 3VUXA 1WZ0A 2DHZA 3ML9A 2NS5A 2EMTA 3E9OA 2A5UA 2N23A 2KFJA 2ZPYA 2VRRB 2B3AA 2KK8A 4MSQB 2KDEB 4FN2A 1V5OA 2KO3A 5C6RA 2C5LC 1TXDA 1WIAA 3I3TB 2MFQA 2AL3A 1XR0B 3IVFA 2M0XA 4MSMB 4M0WB 2P0DA 3WANA 1GGOA 3GOEA 5GMVA 4DHJD 1YD8U 2DAJA 4PS8A 3EHVA 4EZKA 4KHOA 2FJ9A 4FULA 4C0AA 2LWPA 2BYFA 3QCAA 3DCGA 3PRMB 3T06A 4HVBA 4LDTD 3ZTCA 3KRXA 2HD5B 3LDZE 1K8RB 1V49A 4HPLB 2H7DA 1QZEA 4MM3A 2DHKA 3LJ3A 3H9DA 4HAUB 3PSCA 3SYXA 2R2OA 2LKOA 2YVCA 2CKHB 1J8CA 2DYQA 2E2XA 2M14A 4MJSA 2IO2B 5D7GA 3NSUA 3PREA 2DHJA 3VIAA 4AUQC 3W1SC 2FCNA 2QKMA 3ZIMA 2KD0A 2H7EA 2K25A 2O6VB 1PQSA 2CU1A 2EJ8A 3MJWA 1V6EA 2D4QA 4RM8A 3N32A 1UD7A 4JGHB 2IY1B 4JKBA 3APFA 3SD5A 4GMXB 1U2BA 4GIVA 3ZNGC 5KHQA 4JKHA 4AP4C 2K8HA 1Q67A 3CXBB 1ISNA 4HB0B 4FHJA 3WALA 2QKLA 1TZ1A 4AWJA 5DPTA 3R66C 5KQ1A 2JPHA 2LULA 3HIZA 1V5MA 4IW0A 4MJSB 5D2MB 2RUKB 5KQ4A 4ANXA 4DHZE 2O6VA 2BWFA 4FBJB 1AWEA 4BKGA 4K2PA 5AZGA 1P3RA 4MGIE 1WG7A 4L6EA 4DX8A 3PS6A 4IM3A 3DXCA 2AEHA 4ASWC 3W1SA 5JVLA 2L7RA 3OJ4B 4GDKB 1FXTB 5C79A 3M3JA 1RLFA 1QC6A 3UIOB 3NHEB 3ENEA 5TR5A 1U27A 1VD2A 2CS4A 3X0WA 4JK7A 3SNHA 4GXBA 2PEAA 1A5RA 4LDTB 3U30A 2DKPA 2KMAA 3QA8A 5DI9B 1E90A 1P0RA 1WI0A 3HM6X 3ZVRA 1S3SG 1VCBA 2GS0A 3QARA 4JKGA 1UPRA 1WRDB 3TW1A 3W1YA 3ZVVA 4I6LB 3T9LA 4G3XB 2N1WA 1Q0WB 5JHAA 2G35A 4KZCA 5AZFA 1NTVA 5C23A 2ROZB 2MBHA 3CSFA 3ODXA 2VKIA 1GG3A 1GUAB 3V60A 2CODA 4JKAA 2IFSA 2YSZA 2PE9A 3WAOA 1GNUA 4E74A 4F7ZA 1YIWA 5JHHA 2L2IA 1DROA 4KIKA 3T8MA 1FOEA 1WGRA 3MDBC 1MK7B 3A98B 3WIMA 2LGXA 1V88A 2J7QB 1EF5A 3ULCA 3PEGA 4ANUA 2C7HA 1UH6A 1WX9A 3EC8A 3X23A 1T0YA 4XZ4A 2VRWB 3SHQA 5D27A 4HB4B 2MLBA 4IWOA 3DVNV 2JUOA 4BBKA 3AJ4A 2P8VA 3KUDB 2OTXA 4HAYB 4KSLC 4YL8A 3KH0A 3ZRFA 2CHWA 4EMOA 2AWTA 4HXDA 1WFYA 4W9KA 2BYVE 2FIFA 1MKEA 4H8SA 4JL9A 2C7MB 2FNJB 3L0WB 5DIFB 2C7NB 2G3QB 1WGQA 1V89A 1FAOA 2RR9A 1EVHA 1OMWA 4K81A 1Z87A 2D9YA 2KDBA 3A9KB 3PGEA 4BOSC 2KJRA 1WGGA 3DBHI 1IP9A 1IRSA 3RULA 1P3QU 2DFKA 2KDFB 2YT0A 3UZTA 3ONSA 3BJIA 3OLMD 3UQAA 2Z0EB 2IBIB 1E8YA 2M1MA 2Z0QA 4WWPA 3PLVA 2LGYA 1V5PA 2AYOB 2PZ1A 2LASA 3DVNU 3AU5A 1C1YB 4KHBB 2DTCA 3PPAA 4NJ7A 5EFXA 3QX1A 1U29A 2CHXA 1U4AA 4HJKA 4CO7A 5J3YA 1M7RA 3WA0A 1I2HA 4ZYNA 2D9VA 2W2XD 5HE1A 3QJZA 5LXHA 3HQCA 3SV1A 2NBUA 2LG1A 3G9WA 4W9JA 5FI0A 1WYWB 3DBLI 3PZDA 1BTNA 5IJMA 3IHPC 4A5KA 1Z2MA 4P7IA 1E7UA 1ACAA 3TL5A 2G4DB 1GC7A 2NMBA 1MIXA 4ILJA 3WAMA 2MP2B 4AJYB 4MK0A 4FJVB 3ZTDA 5HE0A 1X1FA 4IFSA 1UGMA 1UNPA 3M1IB 2Y8FA 4IM2A 4GOCA 1OEYA 2DZIA 3ZNZB 2JT4B 2RNRB 4KZ0A 2CQUA 2LOZA 2I1JA 3ZNHB 3O65B 2N1VA 1H8CA 5DPRA 1XQQA 2GBKA 2FCSA 4JKCA 2MKRA 1V61A 2IZVB 2GOWA 3IFWB 2DHIA 1OQNA 3Q3FA 2N9EB 3AULA 3PT2B 3KYDD 4KAXB 2K2JA 2Z0DB 1W1DA 4XWXA 1MPHA 2QHOA 2V76A 1LQBA 4MGYE 4F1SA 3UF8A 2DX5B 2R82A 3NY5A 3EFUA 2GBJA 2DIKA 4EUTA 2IO1B 4LCDE 4A6FB 4BVUC 2KWCA 2CAYA 1BWNA 1UBQA 2NPTA 4AJWA 1SHCA 4WSFA 2D07B 1TQZA 2KTFA 4EFOA 2P0FA 2K6DB 4WJ7A 1V9JA 1WM2A 3KUZA 3JVZX 4W9HA 4DXAB 4PS7A 1U5FA 2REXA 2Y7BA 3L17A 3V61A 2MBEA 1J0GA 2KXJA 1EAZA 5DHAB 3HHMA 3RCPA 2NBVB 5JHBA 4W9DA 5LOPB 4MEMA 2IYBA 4I6PA 4HDQA 1X11A 3E66A 1LFDA 2KLCA 1P1AA 1MAIA 2OQBA 4A6FA 3ZNID 2KWUB 3P2BA 2K2UA 1XODA 3SBGA 2LBBA 1DYNA 5D3XA 2NR2A 3CIKA 4BKSA 1WJ6A 2Z0PA 3A9JB 4HK2A 2Z0OA 4GPTB 4KVGB 1DDWA 3KVFB 2I5FA 4NJ6A 1V86A 1IPGA 3N7CA 1ZSQA 2COAA 5KCVA 2LGDA 3H6NA 3N30A 5JP4A 3H1UA 3TCAA 1QQGA 3ODOA 3RCZA 2KUPA 1SGHA 1D3ZA 3ULBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDK E;  3M63 B;  2DYM A;  4HAW B;  3D32 A;  1UPR A;  1NVL A;  1WRD B;  2HJ8 A;  2PJH A;  3F0W A;  3TW1 A;  3W1Y A;  3ZVV A;  3K9P B;  4I6L B;  3T9L A;  1W1H A;  4G3X B;  4JLC A;  2N1W A;  4IUM B;  3RYT A;  3ZRC A;  1AQC A;  5HKH A;  1Q0W B;  5JHA A;  2RPQ A;  2G35 A;  4KZC A;  5AZF A;  3Q3J A;  5J2R A;  1WR6 E;  2GCL A;  1TTN A;  4GDL A;  1NTV A;  4FA6 A;  1WXS A;  2DYO A;  5C23 A;  4YON A;  1ZM0 A;  2DZJ A;  1A5R A;  2LXA A;  2ROZ B;  2MBH A;  3CSF A;  3IG3 A;  2K6Q A;  3ODX A;  2D9X A;  1WZ3 A;  5IA7 A;  4B6H A;  1WX8 A;  2HTH A;  2VKI A;  1GG3 A;  1WJN A;  2DN6 A;  1GUA B;  2JXX A;  4RMA A;  2L3Z A;  3TVV A;  3V60 A;  3VVW B;  4G0N B;  4NQK E;  2COD A;  2FCQ A;  2GJY A;  2IFS A;  2JF5 A;  5EDS A;  3MTN B;  4DDG D;  2MRP A;  2YSZ A;  2ZEQ A;  3A9J A;  1EUV B;  1I35 A;  2PE9 A;  3PRZ A;  3WAO A;  1GNU A;  1E7V A;  3ZDM C;  3NOB A;  4NY0 A;  3QK0 A;  4E74 A;  2J0M A;  4F7Z A;  1E8Z A;  3KW5 B;  1YIW A;  4BBN F;  3JSV A;  4NQL B;  4WJQ A;  5JHH A;  4MEL A;  2MDX A;  5CLQ B;  3JYU A;  2L2I A;  1DRO A;  2M8S A;  3V5W A;  1KOT A;  5L83 A;  4KIK A;  4ICV A;  4EZJ A;  4DBG A;  2KC2 A;  3T8M A;  1FOE A;  1WGR A;  2OJR A;  2YF0 A;  1BT0 A;  3MDB C;  3DBS A;  2GBM A;  4HHV A;  1MK7 B;  1NI2 A;  3A98 B;  3D8E A;  4EJN A;  2KJH B;  3WIM A;  4MY6 A;  2LGX A;  3ZW3 A;  4FAD A;  3B1L X;  1E8W A;  1V88 A;  2J7Q B;  1EF5 A;  2IO3 B;  1V81 A;  3L10 B;  4MGK E;  1WJM A;  3ULC A;  4KIK B;  3DBR I;  4WAA A;  5J3Q A;  2VSZ A;  3V6C B;  2LJ5 A;  2ZVO A;  1WGY A;  3L16 A;  3PEG A;  4JQW C;  4ANU A;  2BKF A;  2FDQ A;  2C7H A;  3R7R A;  3FP5 A;  2KFK B;  4Z2M B;  4K7S A;  3KYC D;  1UH6 A;  5D94 A;  2BGF A;  4B95 A;  2M17 A;  1WX9 A;  4J6I A;  3PRP B;  2N7D A;  2MW5 A;  3EC8 A;  2JP2 A;  1TGZ B;  2LVP A;  3P6A A;  3X23 A;  2L0F A;  1K5G B;  1T0Y A;  1HBK A;  2KLG A;  4FHK A;  4XZ4 A;  4HLE A;  1WXM A;  2KWV B;  2KAN A;  2L76 A;  4Z2N A;  2VRW B;  3ECI A;  1SIF A;  4NNJ B;  3SHQ A;  2RSG A;  2XEW A;  5C1Z A;  3KZ1 A;  5D27 A;  1XKE A;  1WF9 A;  2D3G A;  2Y5B B;  2WWZ A;  2G45 B;  2BYE A;  4HB4 B;  5IAA C;  2MLB A;  4IWO A;  2KNB A;  3DVN V;  2FAZ A;  4GGQ A;  1E5W A;  4HAX B;  5DHF B;  5GOW B;  4GDL B;  2JUO A;  2DYN A;  4BBK A;  4BKT A;  3SUZ A;  2P8V A;  3AJ4 A;  3SO6 A;  1NDD A;  4CHM A;  3N3K B;  4K1R B;  2MWS B;  5J17 A;  3KUD B;  1K5D B;  4KHA A;  1ST7 A;  1U5G A;  3HK0 A;  1WJ4 A;  3EEC A;  1OTR B;  2OTX A;  4HAY B;  2EKE C;  3DOW A;  5C5B A;  1UBI A;  4HWI B;  4JIO U;  4KSK C;  4TKN A;  4IG7 B;  4KSL C;  1KI1 B;  2DLW A;  1KLV A;  3QIJ A;  3QBV B;  4YL8 A;  2CR5 A;  3L08 A;  3KH0 A;  2KGX B;  2RGF A;  2FJL A;  1YX5 B;  1ZGU B;  2CHW A;  4EMO A;  3VUW A;  3ZUN A;  3ZRF A;  2AWT A;  4B9K A;  2MWN B;  3GYO A;  5J3T A;  2L0T A;  4HXD A;  1WFY A;  2KMC A;  4W9K A;  3H1U A;  1MK9 B;  1AAR A;  2BYV E;  1JRU A;  3TIX A;  2DAF A;  4WWN A;  5D3W A;  4EEW A;  2FIF A;  1MKE A;  4IWP A;  4H8S A;  2MA9 B;  3QQ8 B;  3JSV B;  4JL9 A;  3A8P A;  2C7M B;  2FNJ B;  3L0W B;  4KDI C;  4DK5 A;  3PG7 A;  2NZ8 B;  5DIF B;  4HAT B;  2O6V D;  4D0N B;  1LW3 A;  1RJ2 A;  5CTR C;  2C7N B;  2G3Q B;  3U7D A;  2WX1 A;  1XCG A;  2NCN A;  2EMS A;  1WGQ A;  1V89 A;  2KX0 A;  4KV2 A;  1FAO A;  2RR9 A;  1EVH A;  1OMW A;  1OEY J;  2LRW A;  1NTI A;  4K81 A;  1Z87 A;  1UPQ A;  5CLL B;  4GSW A;  3VDZ A;  3VTW A;  2D9Y A;  2KDB A;  3VH3 B;  1Y19 B;  3A9K B;  4ANV A;  5AZH A;  1TBE A;  2CY5 A;  1FHX A;  2NBW B;  2N4F A;  2GBN A;  2LVQ A;  3DXD A;  5JZE B;  3PGE A;  3PVW A;  2HRJ A;  3D8D A;  2KTR B;  2IYD B;  4W9C A;  4W9G A;  2XBB C;  3M95 A;  2EC1 A;  5HE3 A;  3MHS D;  3TMP B;  4BBN C;  1EO6 A;  1FGZ A;  4BOS C;  1LXD A;  4M8M A;  1E8X A;  1Y8R C;  5KHO A;  2KJR A;  2W2W A;  4ZRJ A;  1ZW7 A;  4MT7 A;  2MX2 A;  1R4N I;  1PLS A;  4A6K A;  2D9W A;  3A8Q A;  1WGG A;  3DBH I;  5AEK B;  5CX3 A;  1WXA A;  4GMV A;  5LON B;  2KC1 A;  3TJP A;  1IP9 A;  1NU2 A;  2DX1 A;  1IRS A;  4FJZ A;  3VXW A;  5LXI B;  5CHV C;  5D3Y A;  2COC A;  3RUL A;  1H4R A;  2DFK A;  2RGN B;  1P3Q U;  2KDF B;  1I42 A;  3UQB A;  5CHF A;  5L81 A;  2YT0 A;  3UZT A;  3ONS A;  3BJI A;  3OLM D;  4N9F 4;  4BKS D;  3TO1 A;  4DHJ B;  3UQA A;  4CYE A;  2KZR A;  2ELB A;  5JHG A;  1WM3 A;  2L8J A;  2AL6 A;  2N0Y A;  2J59 M;  2K8C A;  2Z0E B;  1WJ1 A;  2IBI B;  1E8Y A;  4IM0 A;  1YQB A;  4F7U P;  2R0D A;  3DDC B;  1WGU A;  2I5C A;  3OAN A;  2M1M A;  2Z0Q A;  3AXC A;  3HM3 A;  4IC7 B;  4WJP A;  3R7Q A;  4EOY A;  1WGD A;  2LVO A;  4NAW A;  5JLJ B;  3ZNG C;  3DXE A;  2ASQ A;  5C5B B;  3AI5 A;  4KDL B;  4WWP A;  3PLV A;  4ICU A;  5C16 A;  2JWZ A;  2LGY A;  2MP2 A;  1V5P A;  1V5T A;  3SU8 X;  3ZLZ A;  2YS3 A;  2AYO B;  4WJN A;  4HAZ B;  2KOX A;  2LRU A;  2PZ1 A;  3FM8 C;  2LAS A;  3DVN U;  4CHK A;  3AU5 A;  2V1Y A;  1P5T A;  5E6P A;  1C1Y B;  2K39 A;  3V6E B;  2COP A;  1FHO A;  1R4M I;  1YJ1 A;  4KHB B;  1SE9 A;  2MQJ A;  2CB8 A;  4XC2 A;  3RT3 B;  2DTC A;  3B08 A;  3PPA A;  5EFX A;  4NJ7 A;  3RZW C;  4URK A;  1X86 A;  1G6J A;  2DA0 A;  3QX1 A;  3NS8 A;  2M38 A;  4DWF A;  2W9N A;  1WVH A;  1MIZ B;  1P98 A;  2ZJD A;  3CF6 E;  2RQ1 A;  1U29 A;  5DCN A;  3SDL C;  3UIP B;  2CHX A;  1Q1O A;  1U4A A;  5DPS A;  4HJK A;  4WVF B;  3S2A A;  1L7Y A;  1DDV A;  4IAP A;  5D6J B;  4MH0 E;  3VAW A;  2L1C A;  3UGB B;  2BCJ A;  4CO7 A;  5J3Y A;  1M7R A;  3A9K A;  3BY4 B;  4A3O A;  3WA0 A;  1I2H A;  3OAW A;  4F7G A;  4ZYN A;  3RUI B;  2D9V A;  1MG8 A;  1KM7 A;  2DEN B;  1OY2 A;  4GZU A;  1DDM A;  2W2X D;  2BWE S;  2JVC A;  2LXC A;  4A20 A;  2KTR A;  2DKQ A;  5HE1 A;  4BOZ B;  1PMS A;  2Z59 B;  3PP2 A;  2IY0 B;  3H7S A;  3QJZ A;  4W9L A;  3HQC A;  5LXH A;  1L2N A;  2ZNV B;  3SV1 A;  1OQY A;  2NBU A;  2LG1 A;  3G9W A;  4W9J A;  2XQN M;  4G50 A;  5L95 C;  3PHW B;  5FI0 A;  1WYW B;  2ZZP B;  3NZU A;  3DBL I;  1IYF A;  1Y5O A;  3O96 A;  1J19 A;  2JY6 A;  3TBL D;  3ZO5 B;  4W9I A;  3VQI A;  3VUX A;  3PZD A;  2W2X C;  2ZNV C;  3ML4 A;  4GU2 A;  1BTN A;  5IJM A;  3BIN A;  1FHW A;  1WZ0 A;  1WE6 A;  2DHZ A;  2BF8 B;  3IHP C;  3ML9 A;  4ZDV A;  2KCJ A;  2NS5 A;  4F7H A;  2ZCB A;  4A5K A;  4PS3 A;  3KUC B;  2EMT A;  1Z2M A;  4P7I A;  2A5U A;  2N23 A;  2KFJ A;  1X1G A;  2YS5 A;  2KJ6 A;  2MBO A;  3OJ3 A;  5DPW A;  2ZPY A;  2VRR B;  2B3A A;  1UZX B;  2KK8 A;  1E7U A;  4MSQ B;  2KDE B;  4FN2 A;  3KY9 A;  1ACA A;  2Y8G A;  3TL5 A;  1V5O A;  3A4S C;  2KO3 A;  1FGY A;  5C6R A;  1TXD A;  3VOQ A;  1WIA A;  2C5L C;  2G4D B;  2MFQ A;  3I3T B;  2AL3 A;  4EKU A;  1GC7 A;  2O2V B;  4NAW B;  2FCM A;  3A4R A;  2NMB A;  1MIX A;  3WAM A;  2A4Z A;  2MP2 B;  2LD9 A;  2ZPN A;  1XR0 B;  1XD4 A;  3R3M A;  4AJY B;  2NVU I;  2D2Q A;  3IVF A;  2M0X A;  4MK0 A;  4B6W A;  4FJV B;  4MSM B;  3ZTD A;  1TJ6 A;  2MBQ A;  2P0D A;  4M0W B;  3WAN A;  1GJZ A;  5HE0 A;  2D11 A;  5FI1 A;  1X1F A;  3MPX A;  1ZKH A;  4IFS A;  1UGM A;  2MBB B;  3GOE A;  5GMV A;  4E3C A;  1UNR A;  2ROV A;  1UNP A;  3M1I B;  2Y8F A;  3PLU A;  4DHJ D;  4IM2 A;  1KJT A;  1YD8 U;  2DAJ A;  1OEY A;  2WDT B;  3EHV A;  4GOC A;  4PS8 A;  4EZK A;  2DZI A;  3QC8 B;  4KHO A;  3DQV A;  2RD0 A;  4AOF A;  4DDI D;  1C3T A;  4LJP B;  3ZNZ B;  2FJ9 A;  1RRP B;  3L13 A;  2JT4 B;  4ZRI A;  4C0A A;  2K1F A;  3P7Z A;  2RNR B;  2BYF A;  2LWP A;  2PPH A;  3QCA A;  4LJO B;  4KZ0 A;  3FLV A;  4MGZ E;  2CQU A;  2LOZ A;  4TYZ A;  1CMX B;  3ML8 A;  2I1J A;  3ZNH B;  4NSW A;  3O65 B;  2N1V A;  4IWQ A;  3FSS A;  1H8C A;  3DCG A;  5DPR A;  3PRM B;  1WI1 A;  1XQQ A;  2GBK A;  2FCS A;  2YT1 A;  3B0A A;  4K7U A;  1XT9 B;  2MKR A;  3T06 A;  4HAV B;  2FUH B;  3D8F A;  4ZRK A;  2G4S A;  2UWQ A;  3DVG Y;  4HVB A;  1B55 A;  1V61 A;  1F9J A;  2RVB B;  1M94 A;  2IZV B;  2GOW A;  3KRX A;  2KX3 A;  4LDT D;  5D3V A;  2HD5 B;  1V2Y A;  3ZTC A;  2UVM A;  3LDZ E;  3QWZ B;  3PVU A;  2DZK A;  2N7E A;  1K8R B;  1V49 A;  1WY8 A;  2ADZ A;  4HPL B;  2H7D A;  3IFW B;  1QZE A;  1P9D U;  2YLM A;  2DHI A;  4MM3 A;  2DHK A;  3APD A;  3VTV A;  1OQN A;  3Q3F A;  2N9E B;  3AUL A;  1EGX A;  3LJ3 A;  4TV3 A;  3QAQ A;  3PT2 B;  1HB8 A;  3H9D A;  4I6N B;  1WE7 A;  1BTK A;  2WX0 A;  3KYD D;  4HAU B;  4KAX B;  2K2J A;  3K9O B;  4NPN A;  3PSC A;  2KQS A;  1PFJ A;  2Z0D B;  3PHX B;  3SYX A;  4HDO A;  1W1D A;  2R2O A;  2LKO A;  4PYU A;  4EZL A;  1X05 A;  1LM8 B;  4OVU A;  4XWX A;  4HPM B;  2O2V A;  1MPH A;  3C0R B;  1WJU A;  2QHO A;  2YVC A;  2V76 A;  1LQB A;  1NBF C;  3H7P B;  4MGY E;  2ZCC A;  1DBH A;  4E71 A;  1RFA A;  2KN5 A;  1LB1 A;  2CKH B;  4IOY X;  4F1S A;  1J8C A;  2RSU A;  2DYQ A;  2E2X A;  2M14 A;  1S1Q B;  2IO2 B;  4MJS A;  5D7G A;  3NSU A;  3PRE A;  3UF8 A;  2K8B A;  3F5R A;  2DX5 B;  3DPD A;  2WH5 A;  2D9Z A;  5CHW A;  2HE7 A;  3VTU A;  2LUE A;  2DHJ A;  3VIA A;  3NY5 A;  4AUQ C;  3W1S C;  2FCN A;  3EFU A;  3ODW A;  1ZVR A;  2JZ3 B;  2QKM A;  3ZIM A;  1W1G A;  3PVL A;  1KZG A;  2GBJ A;  2KD0 A;  4EUT A;  1H10 A;  1WMH A;  2H7E A;  5DH9 B;  2K25 A;  2IO1 B;  2O6V B;  4A6F B;  1WX7 A;  2KWC A;  4LCD E;  4BVU C;  5HE2 A;  1PQS A;  2N9X A;  3AU4 A;  1P6S A;  2CU1 A;  2CAY A;  1BWN A;  1UBQ A;  2NPT A;  3KRW A;  2C9W B;  2EJ8 A;  1SHC A;  4AJW A;  2GCJ A;  4WSF A;  3KSY A;  3UIN B;  2D07 B;  2CY4 A;  4DX9 0;  4FUL A;  1TQZ A;  3MJW A;  1V6E A;  2D4Q A;  1RRB A;  1UEL A;  1WR1 A;  4RM8 A;  3PV1 A;  4II2 B;  3N32 A;  2IO0 B;  3DVG X;  1UD7 A;  4JGH B;  2IY1 B;  4DBB A;  4F8C B;  2KTF A;  4EFO A;  2FID A;  2P0F A;  2K6D B;  3APF A;  2DYB A;  4WJ7 A;  1V9J A;  3QHT A;  1WM2 A;  3A33 B;  4K7W A;  3TFM A;  4GMX B;  1WXV A;  3LJU X;  3A1Q B;  1U2B A;  3SD5 A;  4GDK A;  4W9E A;  2XK5 A;  1ZC4 B;  2GBR A;  3KUZ A;  4GIV A;  2ELA A;  3JVZ X;  4CHJ A;  2V3S A;  4DXA B;  4PS7 A;  1U5F A;  1J0W A;  1WGH A;  3IBE A;  4W9H A;  4XX5 A;  4PYZ A;  3WAP A;  4K2O A;  1EF1 A;  1XX0 A;  2K8H A;  4AP4 C;  4BFR A;  2PE6 B;  1Q67 A;  2REX A;  2JZZ A;  3CXB B;  2UYZ B;  3V62 A;  1ISN A;  2Y7B A;  4HB0 B;  3L17 A;  5JH5 C;  4FHJ A;  3V61 A;  3WAL A;  2UZR A;  2QKL A;  5BO4 B;  2MBE A;  1J0G A;  1TZ1 A;  2LOX A;  3PSE B;  2KXJ A;  1EAZ A;  5G55 A;  2YS1 A;  1I7A A;  4FLH A;  4AWJ A;  3VUY A;  4X57 B;  5DHA B;  4FJY A;  4GB9 A;  2LZ6 A;  2L05 A;  2D10 A;  5DPT A;  3HHM A;  3R66 C;  3RCP A;  3L54 A;  5KQ1 A;  2JPH A;  2NBV B;  3H7P A;  2JRI B;  2WYQ A;  5E6O A;  4II3 B;  5JHB A;  1FB8 A;  4W9D A;  3CST A;  4W9F A;  2LUL A;  5LOP B;  3HIZ A;  1V5M A;  4WQO B;  5E6N A;  4IW0 A;  3GYP A;  3APC A;  1NTY A;  4MEM A;  2IYB A;  2RUK B;  4MJS B;  4OVV A;  5D2M B;  4I6P A;  2GMI C;  4M8N A;  2DX5 A;  1Z5S B;  1GC6 A;  2N9P C;  5KQ4 A;  1UNQ A;  3VH4 B;  4ANX A;  4HDQ A;  3ZKJ C;  1U5E A;  1M7E A;  1X11 A;  3QWM A;  1LFD A;  1X1M A;  4DHZ E;  2JRH A;  2KQ7 A;  2KLC A;  4A6H A;  1P1A A;  2COF A;  1MAI A;  1WMH B;  2O6V A;  2OQB A;  4A6F A;  4PNK A;  2BWF A;  4HCN B;  3ZNI D;  4FBJ B;  1AWE A;  2KWU B;  3P2B A;  4K2P A;  5AZG A;  2K2U A;  4BKG A;  1P3R A;  4HB2 B;  1XOD A;  2X18 A;  4RM9 A;  5G2N A;  1YX6 B;  3HW2 B;  4MGI E;  2LBB A;  1DYN A;  2NPT B;  1WG7 A;  3VHT C;  5D3X A;  2K00 A;  1WH3 A;  4L6E A;  2BKR B;  4DX8 A;  1HE8 A;  4TQ1 A;  3PS6 A;  2KDI A;  1RAX A;  2YRY A;  2NR2 A;  3RZF A;  2HTH B;  3U8Z A;  3PTF C;  4IM3 A;  3CIK A;  1XD3 B;  3DXC A;  2AEH A;  5FR6 A;  3VFK A;  4HCP B;  2L00 B;  4BKS A;  2LI5 A;  1WJ6 A;  2Z0P A;  3ZDT A;  4ASW C;  3NZS A;  3W1S A;  4A3P A;  2L7R A;  1OGW A;  3OJ4 B;  3A9J B;  2UZS A;  3A1Q A;  2C60 A;  3CMM B;  4GDK B;  4WWO A;  1BAK A;  1FXT B;  2XK5 B;  2R09 A;  4HK2 A;  4WJO A;  5C79 A;  2Z0O A;  2MCN B;  4GPT B;  3JW0 X;  4KVG B;  4Y94 A;  2R2Q A;  3M3J A;  1RLF A;  1DDW A;  1QC6 A;  3NHE B;  3KVF B;  3UIO B;  2I5F A;  2I1K A;  1U27 A;  1V80 A;  1KZ7 A;  1VD2 A;  3ENE A;  4NJ6 A;  1V86 A;  1IPG A;  2V4L A;  5TR5 A;  3N7C A;  3EPY A;  2J0K A;  1ZC3 B;  1UEF A;  1ZSQ A;  2COA A;  4K17 A;  2KVR A;  2OOB B;  5KCV A;  2DZM A;  2LGD A;  3GZN I;  5J18 A;  2CS4 A;  3H6N A;  2BPS A;  3N30 A;  3X0W A;  2J0J A;  4ANW A;  3SNH A;  3WYF B;  4GXB A;  2CHZ A;  2PEA A;  1Q5W B;  2CRF A;  2KKC A;  4LDT B;  5LLI A;  3U30 A;  5JP4 A;  3ALB A;  3M62 B;  2MSE D;  2LYD A;  2DKP A;  1HB6 A;  4GN1 A;  1QQG A;  3TCA A;  2KMA A;  2M4N A;  1V5U A;  5DI9 B;  3QA8 A;  3ODO A;  4HB3 B;  4TQ0 A;  1N3H A;  3RCZ A;  2ABD A;  4PQ0 A;  2P0H A;  1E90 A;  3ZVR A;  1P0R A;  1WI0 A;  3HM6 X;  2KUP A;  4TUU A;  4DHZ B;  3FEH A;  2KFK A;  1S3S G;  2KHW B;  1VCB A;  3RD2 A;  5KHQ A;  1SGH A;  2GS0 A;  2ZVN A;  2Q13 A;  1D3Z A;  3ULB A;  4G11 A;  3QAR A;  1U5D A;  2RLO A; 
#chains in the Genus database with same CATH topology
 3GE8 C;  4MDK E;  2WXH A;  1NVL A;  1YJJ A;  2INP E;  3F0W A;  4IUM B;  4WIP A;  3ZRC A;  1ACC A;  3V05 A;  1WR6 E;  2GCL A;  4GDL A;  2DYO A;  2J4X A;  3IG3 A;  4YSZ B;  2BS2 B;  2D9X A;  1WZ3 A;  4B6H A;  1PDX A;  4KKI A;  1D6E C;  1WJN A;  2JZP A;  4NQK E;  4OW0 A;  4P1B C;  2FCQ A;  4K3C A;  3SBT A;  3MTN B;  4DDG D;  2ZEQ A;  4YT0 B;  1E7V A;  3B9J A;  2K22 A;  3KW5 B;  4BBN F;  1F2R I;  3JSV A;  4NQL B;  5CLQ B;  1UNS A;  2V0G A;  1KOT A;  5L83 A;  2QJL A;  2PMV A;  4DBG A;  2OJR A;  3RNE C;  3DBS A;  2N0S B;  3D8E A;  1NYR A;  4MY6 A;  3C19 A;  3ZW3 A;  1E8W A;  2IO3 B;  1L4Z B;  2EKI A;  4QXA B;  5J3Q A;  3V6C B;  2BKF A;  2FDQ A;  3R7R A;  4K7S A;  1NI3 A;  2M17 A;  1QT9 A;  2N7D A;  2MW5 A;  1TGZ B;  2LVP A;  4Q2J A;  3FAH A;  1HBK A;  4HLE A;  5EE9 A;  1WXM A;  2KWV B;  2KAN A;  3ECI A;  4NNJ B;  5I4D A;  3BWU D;  2XEW A;  4AS1 A;  2Y5B B;  4TMA B;  2WWZ A;  2BYE A;  2QDF A;  4FXC A;  4GGQ A;  5DHF B;  5GOW B;  4GDL B;  3U12 A;  2WXL A;  4BKT A;  3SUZ A;  2KUQ A;  1HA5 A;  2KMM A;  5J17 A;  1ST7 A;  1WJ4 A;  4NPN A;  5EE1 A;  1OTR B;  2EKE C;  3DOW A;  1KI1 B;  2K3U A;  3HVD A;  2RGF A;  1YX5 B;  1SF0 A;  3VUW A;  4B9K A;  2MWN B;  3GYO A;  2KMC A;  1AAR A;  1JRU A;  3AE3 B;  3Q8F A;  4WWN A;  4IWP A;  2MA9 B;  3JSV B;  2MJD A;  3TUO A;  4D0N B;  1RJ2 A;  3PTF C;  4DWF A;  3U7D A;  2WX1 A;  1RM6 C;  3A58 A;  1XLP A;  2LRW A;  1UPQ A;  3W5U B;  3E9L A;  1Y19 B;  2CY5 A;  1FHX A;  2NBW B;  3N1X C;  5JZE B;  3PVW A;  3D8D A;  2KTR B;  4BBN C;  3T3O A;  3M95 A;  3MHS D;  5IP4 D;  1LXD A;  4M8M A;  1OQR A;  2BT6 A;  1Y8R C;  3J9C A;  3TJP A;  5LON B;  2DX1 A;  2KYW A;  1GOZ A;  2GB1 A;  1H4R A;  3UQB A;  3NVV A;  5CHF A;  2WU5 B;  4BKS D;  2W54 A;  4CYE A;  2ELB A;  2L8J A;  2J59 M;  2K8C A;  1WJ1 A;  1ZDX A;  5IO9 A;  4F7U P;  3DDC B;  3OAN A;  4IC7 B;  2PVO D;  1EWC A;  4NAW A;  2ASQ A;  1XLO A;  4KDL B;  5C16 A;  2JWZ A;  3ZLZ A;  4WJN A;  2LRU A;  1P5T A;  3V6E B;  2COP A;  1FHO A;  1R4M I;  1SE9 A;  4XC2 A;  3RT3 B;  3NVZ A;  1X86 A;  1G6J A;  2DA0 A;  1K52 A;  4D6W A;  3TEY A;  3NVW A;  4M00 A;  4WVF B;  3S2A A;  3VAW A;  1DDV A;  5D6J B;  4LNF A;  1GB1 A;  4A3O A;  3RUI B;  3DBH B;  4GZU A;  4LLG M;  2KTR A;  2IGD A;  1FCC C;  4W9L A;  1JML A;  1XLN A;  1HZ5 A;  3PHW B;  2ZZP B;  1IYF A;  1Y5O A;  3O96 A;  2W82 A;  4W9I A;  3ML4 A;  4LNK A;  3BIN A;  1IGD A;  1DOX A;  2BF8 B;  4F7H A;  3KUC B;  2MEK A;  3MFG A;  5DPW A;  1X1G A;  2YS5 A;  2KJ6 A;  2MBO A;  3OJ3 A;  1UZX B;  2RDB C;  2Y8G A;  3U2S C;  4WWM A;  1SE4 A;  4EKU A;  4NAW B;  2N9K A;  2FCM A;  5EE3 A;  2LD9 A;  2ZPN A;  1XD4 A;  2NVU I;  3AH7 A;  1XCT L;  1WWT A;  1TJ6 A;  4HRO A;  2MBQ A;  2ON8 A;  5G5H A;  1GJZ A;  2D11 A;  2IPK D;  2MBB B;  1ZKH A;  4YTM B;  2ROV A;  3PLU A;  2M0A A;  2WDT B;  3DQV A;  2RD0 A;  1C3T A;  4LJO B;  1VJK A;  3FLV A;  2SAK A;  3BYT B;  4RGN A;  1CMX B;  3ML8 A;  3N1Y C;  4IWQ A;  3FSS A;  3I9V 1;  1WI1 A;  2PKO A;  4K7U A;  3LXF A;  2FUH B;  3D8F A;  4ZRK A;  1FO4 A;  1B55 A;  1F9J A;  2RVB B;  2D5G A;  1SE2 A;  2KX3 A;  5D3V A;  2ZW0 A;  1V2Y A;  5M4Y B;  3PVU A;  2N7E A;  1P9D U;  2NTS A;  1L4D B;  1KFY B;  3APD A;  3VTV A;  1EGX A;  4UDU C;  4TV3 A;  4DQO C;  3QAQ A;  1HB8 A;  4I6N B;  1WE7 A;  2V3N A;  2WX0 A;  4C4V A;  2KQS A;  1PFJ A;  4HDO A;  4EZL A;  1LM8 B;  4OVU A;  2FE8 A;  1WJU A;  3H7P B;  3FVC A;  3GS2 A;  4XYC A;  1RFA A;  4XGA B;  1LB1 A;  2GRI A;  2RSU A;  2JXT A;  3F5R A;  2D9Z A;  5CHW A;  2HE7 A;  2LUE A;  3PZ8 A;  3ODW A;  1ZVR A;  2JZ3 B;  2N9L A;  4KGR A;  1H10 A;  3AV8 A;  3N1Z C;  2N9X A;  1C77 A;  1P6S A;  2C9W B;  1SJH D;  2WS3 B;  3KSY A;  4DX9 0;  4JPS A;  1RRB A;  1UEL A;  4USA A;  3PV1 A;  2IO0 B;  3DVG X;  3E9P A;  4ITK A;  4OSN A;  4F8C B;  3ZDM C;  3QHT A;  3A33 B;  3TFM A;  3A1Q B;  3LJU X;  5D3I B;  4GDK A;  4W9E A;  2XK5 A;  2KN4 A;  4CHJ A;  4XX5 A;  1PFD A;  2WXQ A;  3WAP A;  4K2O A;  1EF1 A;  2PE6 B;  2BS3 B;  2UZR A;  1YNT E;  5BO4 B;  1E0Z A;  2ACZ B;  2YS1 A;  4FLH A;  4X57 B;  4FJY A;  4GB9 A;  2LZ6 A;  2D10 A;  3VR8 B;  3H7P A;  5IRS A;  5E6J A;  1JWM D;  1GAQ B;  2CJO A;  3B2G A;  3NG0 A;  1PYW D;  3GYP A;  1NTY A;  4NAM A;  2DWQ A;  3VH4 B;  2GMI C;  1Z5S B;  1GC6 A;  2R61 A;  3FIL A;  1UNQ A;  4JKG B;  3ZKJ C;  1U5E A;  3QWM A;  2JRH A;  2KQ7 A;  4A6H A;  2COF A;  4PNK A;  2N7J A;  4HCN B;  4HB2 B;  2X18 A;  5G2N A;  4IOI E;  1TKY A;  2K00 A;  2BKR B;  1F2R C;  2AQ1 B;  1HE8 A;  4TQ1 A;  4QJ5 B;  2KDI A;  2YRY A;  3I5J C;  3U8Z A;  1XD3 B;  3VFK A;  4HCP B;  5LNK 1;  3SFE B;  2LI5 A;  4A3P A;  1KH0 A;  2UZS A;  3A1Q A;  1V97 A;  3CMM B;  5HHD G;  2XK5 B;  5BYS A;  4WJO A;  3JW0 X;  4Y94 A;  2R2Q A;  1WGK A;  4JKD A;  1V80 A;  1KZ7 A;  3IXS A;  2V4L A;  2WXM A;  3SU8 X;  3EPY A;  2J0K A;  2KVR A;  1UEF A;  4K17 A;  4KIK B;  5J18 A;  2DZM A;  3GZN I;  1FFV A;  2J0J A;  4ANW A;  3WYF B;  1MPE A;  2DLB A;  2DNF A;  1EM7 A;  2CRF A;  1HEZ E;  1JWU D;  3ALB A;  1ET6 A;  3M62 B;  2MSE D;  3AED B;  1HB6 A;  2M4N A;  4TQ0 A;  2MHJ A;  4HB3 B;  3NJT A;  5C2T B;  4PQ0 A;  2JWU A;  3FEH A;  2KFK A;  1L5P A;  1N5W A;  2IJ0 A;  3AE2 B;  2ZVN A;  2Q13 A;  3ETR A;  3Q8A A;  1QOA A;  3FIL B;  1FD6 A;  3M63 B;  3D32 A;  4OVZ A;  2PJH A;  1YQ3 B;  3RNA C;  1ESF A;  3K9P B;  1W1H A;  3NRZ A;  3RYT A;  5HKH A;  2RPQ A;  2FJU B;  4XDD A;  2IGH A;  3Q3J A;  5J2R A;  4YON A;  1ZM0 A;  3HRD D;  3U7Z A;  5IA7 A;  4A9A A;  2JXX A;  2DN6 A;  1JWB D;  4RMA A;  2L3Z A;  1RYJ A;  1D5M C;  3TVV A;  3VVW B;  4G0N B;  1ZOY B;  2JF5 A;  1UGJ A;  1I35 A;  3PRZ A;  1QKZ A;  3NOB A;  4NY0 A;  1K51 A;  3QK0 A;  2L1A A;  1T0R C;  3UI3 A;  4WJQ A;  3DBL B;  4MEL A;  2MDX A;  3OWE B;  3W5V B;  2M8S A;  3V5W A;  4ICV A;  2KC2 A;  5BMH A;  2YF0 A;  1BT0 A;  2GBM A;  4HHV A;  1NI2 A;  1TS4 A;  2KT7 A;  4DXG A;  2AQ2 B;  3B1L X;  2BB6 A;  1V81 A;  4OHJ A;  4RCO A;  2G1E A;  4HPP A;  4N59 A;  4P1C C;  4WAA A;  2LJ5 A;  2ZVO A;  3L16 A;  4JQW C;  3GP7 A;  2KFK B;  2IDY A;  1YN4 A;  3PRP B;  2BS4 B;  1B9R A;  1YOV B;  1K5G B;  2KLG A;  4FHK A;  4HJG E;  1VZ8 A;  3TEW A;  4Z2N A;  1SIF A;  1I4H A;  2RSG A;  5C1Z A;  1L0Y B;  2D3G A;  1WF9 A;  2KAC A;  1P7E A;  5IAA C;  2KNB A;  1E5W A;  3BVG A;  4HAX B;  2DYN A;  3SO6 A;  1NDD A;  1R4M B;  3N3K B;  1OQQ A;  1SE3 A;  4JWU C;  2MWS B;  4US8 A;  1C79 A;  3BZD B;  4JIO U;  4P16 A;  4ZYS A;  5C5B A;  1P7F A;  1UBI A;  4R3D A;  1QF6 A;  1KLV A;  2DLW A;  4ACF A;  2W3S A;  3QIJ A;  3QBV B;  1SEB D;  2CR5 A;  1L0V B;  3BYY B;  3L08 A;  1ZGU B;  3ZUN A;  3NWD A;  4QJ3 B;  5J3T A;  1FRR A;  2L0T A;  1VRA B;  2DAF A;  4EEW A;  3A8P A;  2LHD A;  3EFC A;  1LW3 A;  4ARC A;  4KV2 A;  1QOG A;  2NCN A;  3DBR B;  3R8B A;  3P42 A;  1I4X A;  5CLL B;  1STE A;  4GSW A;  4WAF A;  3VH3 B;  4ANV A;  5AZH A;  4AQ7 A;  2N4F A;  2GBN A;  2RDG A;  3DXD A;  2ZW1 A;  4W9C A;  1XF5 L;  2XBB C;  2EC1 A;  3TMP B;  1TY2 A;  1E8X A;  1WXQ A;  4K7W A;  3EUB 2;  3VDZ A;  4A6K A;  2D9W A;  3A8Q A;  5AEK B;  5CX3 A;  1WXA A;  4GMV A;  3Q8E A;  3GB1 A;  1NU2 A;  3VXW A;  5LXI B;  1I4G A;  1E6E B;  1I42 A;  5L81 A;  2VH2 A;  3NVY A;  4N9F 4;  2KZR A;  4ILH A;  1WM3 A;  3Q14 C;  2AL6 A;  2N0Y A;  4CSQ A;  2LFI A;  1PGB A;  1WGU A;  3AXC A;  3R7Q A;  3P4R B;  2LJI A;  4C00 A;  5JLJ B;  5C5B B;  3AI5 A;  4JK9 A;  2MP2 A;  2X38 A;  2YS3 A;  2KOX A;  4N58 A;  2K39 A;  1YJ1 A;  3NS1 A;  2MQJ A;  3B08 A;  3RZW C;  1L0X B;  1R7S A;  3NS8 A;  3W2D A;  2M38 A;  2W9N A;  1WVH A;  1MIZ B;  5DCN A;  2ZJD A;  3SDL C;  1L7Y A;  3TEX A;  4MH0 E;  3UGB B;  2BCJ A;  5MPO A;  3A9K A;  1FEH A;  4F7G A;  1MG8 A;  1KM7 A;  2LXC A;  1DDM A;  2JVC A;  1CK1 A;  1JCK B;  3PP2 A;  2V4I B;  3BII D;  3H7S A;  1GPX A;  2XQN M;  4G50 A;  3NZU A;  4RF1 A;  1GB4 A;  2JY6 A;  3VQI A;  2W2X C;  2ZNV C;  3AE8 B;  3RZF A;  4GU2 A;  1FHW A;  4ZDV A;  1WE6 A;  2NTT A;  2KCJ A;  2ZCB A;  4PS3 A;  2WXI A;  4GOU A;  2W55 A;  1IBX B;  3KY9 A;  3A4S C;  1FGY A;  3VOQ A;  2JX5 A;  2O2V B;  3R2T A;  3A4R A;  2J53 A;  2A4Z A;  2EEL A;  1XXG A;  3R3M A;  4RGM A;  2D2Q A;  4B6W A;  3P4S B;  2XN9 C;  3N9Y C;  5FI1 A;  4E3C A;  3MPX A;  2BW2 A;  2WXR A;  1DIK A;  1UNR A;  4PK1 A;  1SIJ A;  4XDC A;  1KJT A;  2D3C A;  1YN3 A;  2WXO A;  5I2M A;  3QC8 B;  4DDI D;  4AOF A;  4ZHP A;  2KDM A;  4LJP B;  3L13 A;  1RRP B;  4P6V F;  2K1F A;  4ZRI A;  2PPH A;  3GE3 C;  3P7Z A;  1JAL A;  1QIL A;  4MGZ E;  1C4C A;  4TYZ A;  4NSW A;  5HI1 A;  2KIG A;  4XE0 A;  2YT1 A;  3B0A A;  1XT9 B;  4ZHO A;  4HSI A;  4HAV B;  2VZK B;  3RFZ B;  2G4S A;  3DVG Y;  2UWQ A;  3NWA A;  1M94 A;  4ZRQ A;  2UVM A;  3QWZ B;  2DZK A;  1WY8 A;  1CQV A;  3LB8 C;  2ADZ A;  4IKG A;  2YLM A;  4RNA A;  2K0P A;  2IGG A;  2MJ3 A;  1BTK A;  1BML C;  3K9O B;  1FIQ A;  3PHX B;  1TKG A;  2RPV A;  4PYU A;  1X05 A;  4HPM B;  2O2V A;  3C0R B;  1NBF C;  2ZCC A;  1DBH A;  4E71 A;  1T0Q C;  3AE5 B;  1LGR A;  2KN5 A;  4IOY X;  4B0M A;  1S1Q B;  1YN5 A;  1MG4 A;  4O1N A;  2K8B A;  3DPD A;  2WH5 A;  1AWD A;  3VTU A;  3AEB B;  3ZYY X;  1NEK B;  1W1G A;  3PVL A;  1KZG A;  1JWS D;  1WMH A;  4D2K A;  5DH9 B;  1B1Z A;  1K50 A;  1WX7 A;  1L6U A;  1T5X D;  5HE2 A;  4JKF A;  3AU4 A;  1BXT A;  4HKZ E;  3KRW A;  1XCQ L;  2GCJ A;  4RGT A;  3UIN B;  2CY4 A;  1VZ6 A;  1WR1 A;  4II2 B;  1I4Q A;  2JU6 X;  4DBB A;  2GUM A;  2FID A;  4FAD A;  1IUE A;  2DYB A;  3Q69 A;  5HG2 A;  1WXV A;  2WDQ B;  2I2Y A;  4YTN B;  1ZC4 B;  2GBR A;  2ELA A;  4WH4 A;  2V3S A;  5EDS A;  1WGH A;  1J0W A;  3IBE A;  4PYZ A;  4BFR A;  1XX0 A;  1FPY A;  2UYZ B;  2JZZ A;  3AE4 B;  3V62 A;  1DGJ A;  3IT4 B;  5JH5 C;  1F52 A;  3PSE B;  2LOX A;  5G55 A;  1I7A A;  3VUY A;  2IND C;  3Q8B A;  2L05 A;  3L54 A;  5E6O A;  2BVC A;  2JRI B;  2WYQ A;  4II3 B;  1FB8 A;  3CST A;  3GZN B;  3KWL A;  4W9F A;  4WQO B;  1MI1 A;  1LO5 D;  5E6N A;  3APC A;  3U4E G;  4OVV A;  5FKA C;  4M8N A;  2DX5 A;  2N9P C;  1SXT A;  1M7E A;  1X1M A;  3VR9 B;  3AN1 A;  3BK2 A;  1WMH B;  1WSP A;  4RM9 A;  4JK8 A;  1YX6 B;  3HW2 B;  2NPT B;  3VHT C;  1WH3 A;  1TZO A;  2JSV X;  1RAX A;  2HTH B;  5FR6 A;  2L00 B;  3ZDT A;  2G9H D;  3V3X A;  3NZS A;  1OGW A;  3Q2A C;  2C60 A;  4WWO A;  1BAK A;  2PVG C;  2R09 A;  1DOI A;  2MCN B;  2I1K A;  2J52 A;  1TIF A;  1ZC3 B;  2OOB B;  1V1P A;  2BPS A;  5IOI A;  3VRB B;  2V9H A;  2CHZ A;  1VBG A;  1Q5W B;  2KKC A;  5LLI A;  1J7B A;  3B2F A;  2LYD A;  4GN1 A;  1V5U A;  2NBV A;  1N3H A;  2ABD A;  2P0H A;  4TUU A;  4DHZ B;  2KHW B;  3RD2 A;  3MC9 A;  4G11 A;  1U5D A;  2RLO A;  3RNB C;  1JDE A;  2DYM A;  4HAW B;  2RRF A;  2HJ8 A;  5H92 C;  4US9 A;  1QOB A;  4JLC A;  2Y3A A;  1AQC A;  2XNA C;  2D3A A;  3B77 A;  1TTN A;  4FA6 A;  1WXS A;  4KGS A;  2DZJ A;  2LXA A;  1MFW A;  2K6Q A;  1WX8 A;  2HTH A;  3N20 C;  4LTU A;  1PUT A;  4A90 A;  2GJY A;  1A70 A;  1UUP A;  2X0S A;  3HUI A;  2MRP A;  3A9J A;  1EUV B;  2L32 A;  2LMC A;  2J0M A;  3U52 E;  1E8Z A;  1D5X C;  4REZ A;  1HZ6 A;  2LEK A;  3JYU A;  4ILG B;  1VBH A;  1L6V A;  1QQR A;  4EZJ A;  3I63 C;  1V1P B;  3PO0 A;  2KJH B;  4EJN A;  3L10 B;  4KX6 B;  4MGK E;  1WJM A;  5H8Y E;  2V3P A;  3DBR I;  1ET9 A;  2VSZ A;  1WGY A;  3FP5 A;  4Z2M B;  3KYC D;  5D94 A;  4B95 A;  2BGF A;  1EU3 A;  1UWM A;  4J6I A;  1KTK A;  2JP2 A;  1DOY A;  3P6A A;  1KC7 A;  2L0F A;  2BBC A;  2L76 A;  3BK1 A;  2K5P A;  3AE1 B;  3KZ1 A;  1XKE A;  2G45 B;  5I2S A;  1MHX A;  1EU4 A;  2FAZ A;  3ZQ4 A;  3DCX A;  3RNF C;  4CHM A;  4K1R B;  3RPF C;  1K5D B;  4KHA A;  3HK0 A;  1U5G A;  3EEC A;  4HWI B;  4KSK C;  4TKN A;  4IG7 B;  2KGX B;  2FJL A;  1F1H A;  1KBL A;  3C8Y A;  1T3Q A;  1IGC A;  1CJE A;  1MK9 B;  3TIX A;  1FXA A;  1FM0 D;  5D3W A;  3QQ8 B;  3ZJU A;  4DK5 A;  4KDI C;  3PG7 A;  3AEG B;  2NZ8 B;  2O6V D;  4HAT B;  1FFU A;  3P1M A;  5CTR C;  1XCG A;  2YEP B;  2EMS A;  5AUK A;  2D3B A;  2KX0 A;  1OEY J;  2ZKM X;  1NTI A;  4WUR A;  3VTW A;  3RNG C;  3BVZ A;  1FRD A;  1TBE A;  1YMH E;  2LVQ A;  2JQR B;  4YTP B;  2VH1 A;  2HRJ A;  4W9G A;  1C9F A;  2IYD B;  5HE3 A;  1EO6 A;  1FGZ A;  2Q5W D;  1N60 A;  5KHO A;  2W2W A;  4ZRJ A;  1ZW7 A;  4MT7 A;  2MX2 A;  1R4N I;  1PLS A;  4OZC A;  3KQ4 A;  2KC1 A;  4GNK B;  1YQ4 B;  4FJZ A;  2FUG 1;  5CHV C;  5D3Y A;  2COC A;  1M4V A;  2RGN B;  4S0R A;  2QEJ C;  4L2Y A;  3ENB A;  3TO1 A;  4DHJ B;  5JHG A;  2HJ1 A;  2PTL A;  3HVZ A;  4IM0 A;  1YQB A;  2R0D A;  2I5C A;  4WJP A;  3HM3 A;  4EOY A;  1WGD A;  2LVO A;  4BAX A;  3DXE A;  3CWI A;  4ICU A;  1V5T A;  4HAZ B;  3FM8 C;  4CHK A;  2V1Y A;  5E6P A;  4C7Z A;  5BMI A;  4ARI A;  2CB8 A;  4URK A;  1YJI A;  1XO3 A;  2KR0 A;  3CF6 E;  3IT6 B;  1P98 A;  3UIP B;  2RQ1 A;  4JE3 B;  5GXG B;  1Q1O A;  1MI0 A;  5DPS A;  4RGO S;  4MAC A;  2TSS A;  4IAP A;  2L1C A;  3BY4 B;  3OAW A;  3URY A;  2DEN B;  1OY2 A;  2BWE S;  2MH7 A;  4A20 A;  2DKQ A;  4BOZ B;  1PMS A;  2OHF A;  2Z59 B;  2IY0 B;  1L2N A;  2ZNV B;  1OQY A;  2OJW A;  1AYF A;  1HTO A;  5L95 C;  5TSS A;  3ZJT A;  4JKE A;  1XLQ A;  1J19 A;  1BUI C;  3EGR A;  3TBL D;  3ZO5 B;  3VUX A;  1WZ0 A;  2DHZ A;  3ML9 A;  3BVM A;  2NS5 A;  3DWM A;  3R2I A;  2EMT A;  3E9O A;  2A5U A;  2N23 A;  5FK9 C;  5BMG A;  1TYG B;  2KFJ A;  1Y56 A;  2ZPY A;  2VRR B;  2B3A A;  2KK8 A;  4HEA 1;  4MSQ B;  2KDE B;  4FN2 A;  1UF0 A;  2KAJ A;  1V5O A;  2PIA A;  2KO3 A;  5C6R A;  1FNV A;  1TXD A;  1WIA A;  2C5L C;  3I3T B;  3KLS X;  2MFQ A;  2AL3 A;  5BYR A;  1XR0 B;  3TSS A;  2K9X A;  4N6E B;  3IVF A;  2M0X A;  1AW7 A;  4MSM B;  4M0W B;  2P0D A;  1VDV A;  4KKJ A;  3WAN A;  1GGO A;  4CQN A;  3GOE A;  5GMV A;  3NW8 A;  4DHJ D;  1YD8 U;  2DAJ A;  3OG5 A;  3EHV A;  4PS8 A;  4EZK A;  4KHO A;  3Q3N C;  2FJ9 A;  4FUL A;  4C0A A;  2LWP A;  2BYF A;  3QCA A;  1N6Z A;  3AEA B;  4ZRP A;  2B76 B;  3DCG A;  3PRM B;  2Z59 A;  2KWD A;  3T06 A;  4HVB A;  5JXV A;  1E9M A;  2JYE A;  4LDT D;  4NZL B;  3ZTC A;  3KRX A;  2HD5 B;  3LDZ E;  3RNC C;  1K8R B;  1V49 A;  1I4R A;  4HPL B;  2H7D A;  3L4P A;  1QZE A;  4MM3 A;  3EA6 A;  2DHK A;  3LJ3 A;  2AX5 A;  3H9D A;  4HAU B;  3PSC A;  3SYX A;  2R2O A;  2LKO A;  1SB3 C;  2PLP A;  4OZA A;  2KQ4 X;  2YVC A;  3FC4 A;  3P4Q B;  1F77 A;  2CKH B;  1ZPS A;  1J8C A;  2DYQ A;  2E2X A;  2M14 A;  4MJS A;  2IO2 B;  5D7G A;  3NSU A;  3PRE A;  4M0W A;  1SSN A;  2E6X A;  3DWG C;  2DHJ A;  3VIA A;  4AUQ C;  3W1S C;  2FCN A;  2QKM A;  3ZIM A;  2KD0 A;  2H7E A;  2O6V B;  2K25 A;  1ZUD 2;  1PQS A;  3NWF A;  2CU1 A;  3MC0 B;  1Q10 A;  2EJ8 A;  3MJW A;  1V6E A;  2D4Q A;  4RM8 A;  1VR9 A;  3N32 A;  2HTM E;  1UD7 A;  4JGH B;  4DXF A;  2IY1 B;  4L1B A;  1QLB B;  4JKB A;  3APF A;  1ZXH A;  3SD5 A;  1V1O A;  4GMX B;  1FNW A;  1U2B A;  2ICI A;  4GIV A;  1VZ7 A;  4YXD B;  3ZNG C;  4MM3 B;  5KHQ A;  4JKH A;  4AP4 C;  2K8H A;  4A6Q A;  1Q67 A;  3CXB B;  3VRA B;  1ISN A;  4HB0 B;  4C4V B;  4FHJ A;  3WAL A;  2QKL A;  1JWA D;  1TZ1 A;  2GLS A;  4RF0 A;  5D3D A;  4AWJ A;  2YT2 A;  5DPT A;  3R66 C;  5KQ1 A;  2JPH A;  2OED A;  3Q3O C;  2LUL A;  3HIZ A;  1V5M A;  3ZJV A;  3Q8C A;  4IW0 A;  4MJS B;  1XEE A;  5D2M B;  2RUK B;  5KQ4 A;  4ANX A;  4WQM A;  4DHZ E;  4RH6 A;  3DHI C;  2O6V A;  2BWF A;  4FBJ B;  1AWE A;  4BKG A;  4K2P A;  5AZG A;  1P3R A;  4MGI E;  3DHG C;  1WG7 A;  4JWS C;  4L6E A;  4DX8 A;  3PS6 A;  4IM3 A;  2QIE B;  4LNI A;  3DXC A;  2AEH A;  3AEF B;  5HFY A;  3Q3M C;  1E7P B;  1ZXI A;  4ASW C;  3W1S A;  2BTE A;  5JVL A;  4OT1 A;  2L7R A;  3OJ4 B;  1T0S C;  4YSX B;  4GDK B;  1SJE D;  1FXT B;  2BYT A;  5C79 A;  3M3J A;  1RLF A;  1QC6 A;  3UIO B;  3NHE B;  3MJ5 A;  3ENE A;  1U27 A;  5TR5 A;  1VD2 A;  3H8H A;  2CS4 A;  4J3O D;  3X0W A;  4JK7 A;  3SNH A;  4GXB A;  2PEA A;  4LDT B;  1A5R A;  3U30 A;  2DKP A;  2KMA A;  3QA8 A;  5DI9 B;  1E90 A;  1P0R A;  1WI0 A;  3HM6 X;  3ZVR A;  1JQ4 A;  1S3S G;  3ZGZ A;  1VCB A;  2WXN A;  2GS0 A;  3CIR B;  3QAR A;  4JKG A;  1UPR A;  1WRD B;  1R4N B;  3TW1 A;  3W1Y A;  3ZVV A;  4I6L B;  3T9L A;  4G3X B;  2SEB D;  2N1W A;  1KLG D;  1Q0W B;  5JHA A;  5C3J B;  2G35 A;  4KZC A;  5AZF A;  1NTV A;  5C23 A;  2ROZ B;  2MBH A;  3CSF A;  3O13 A;  3ODX A;  2WU2 B;  2VKI A;  1GG3 A;  1GUA B;  1HTQ A;  1N5X A;  1NVI D;  3SFD B;  3TEZ A;  3V60 A;  2COD A;  4JKA A;  2LUM A;  2IFS A;  2YSZ A;  2PE9 A;  4RFB A;  3WAO A;  1GNU A;  4E74 A;  2QCZ A;  4F7Z A;  4HKQ A;  4KGT A;  1YIW A;  5JHH A;  2L2I A;  1DRO A;  4KIK A;  3T8M A;  1FNU A;  1FOE A;  1WGR A;  5AUI A;  3MDB C;  1MK7 B;  3A98 B;  3WIM A;  2LGX A;  1V88 A;  2J7Q B;  1EF5 A;  1KRH A;  3ULC A;  1D5Z C;  2YEP F;  2K49 A;  4YWG G;  3PEG A;  3MC8 A;  4ANU A;  2C7H A;  1UH6 A;  4M01 A;  2QC8 A;  1WX9 A;  3EC8 A;  4QJ4 B;  3X23 A;  1T0Y A;  3FKY A;  4XZ4 A;  1T77 A;  2VRW B;  3SHQ A;  5D27 A;  2Z4D A;  1ZDV A;  3I57 A;  3PZ7 A;  4M02 A;  4HB4 B;  2MLB A;  4IWO A;  3DVN V;  1NYQ A;  1RWS A;  2JUO A;  2R2Y A;  1TS3 A;  4BBK A;  1WYG A;  2P8V A;  3AJ4 A;  1SBB B;  3KUD B;  2PW9 A;  2OTX A;  4HAY B;  2M56 B;  4KSL C;  4K3B A;  4YL8 A;  3KH0 A;  2H89 B;  3ZRF A;  2CHW A;  4EMO A;  2AWT A;  1N62 A;  4HXD A;  1WFY A;  4W9K A;  4GLS C;  3KWV A;  2BYV E;  2UU7 A;  4KHB A;  2FIF A;  1MKE A;  4H8S A;  4JL9 A;  2C7M B;  2FNJ B;  3L0W B;  2INN E;  5DIF B;  1WRI A;  2WQY B;  2C7N B;  2BB5 A;  2G3Q B;  1WGQ A;  1V89 A;  1FAO A;  2RR9 A;  1EVH A;  1OMW A;  4QAY A;  4LNO A;  3RMK C;  1D4B A;  4K81 A;  3P63 A;  1Z87 A;  2D9Y A;  2KDB A;  5G5G A;  2KIE A;  3A9K B;  2RMM A;  3PGE A;  2WXJ A;  4BOS C;  1ZE3 D;  5IN7 A;  5IKC M;  2KJR A;  1J7A A;  1WGG A;  1EWY C;  3DBH I;  2CJN A;  3AE6 B;  1IP9 A;  1IRS A;  2WXK A;  1HQR D;  3RUL A;  1P3Q U;  2DFK A;  2KDF B;  2YT0 A;  3UZT A;  3ONS A;  3BJI A;  3OLM D;  3RN9 C;  3UQA A;  3T3N A;  2E3T A;  2RDH A;  2Z0E B;  2IBI B;  1E8Y A;  2HDE A;  1IBX A;  3AM9 A;  2M1M A;  2Z0Q A;  1ZP0 B;  4WWP A;  3PLV A;  2LGY A;  1V5P A;  1ENF A;  2AYO B;  1VLB A;  4YSY B;  2PZ1 A;  2LAS A;  3DVN U;  3AU5 A;  2QMT A;  3HSA A;  1C1Y B;  1MHH E;  4KHB B;  5FR3 A;  2DTC A;  3PPA A;  4NJ7 A;  5EFX A;  2WDV B;  3QX1 A;  1U29 A;  2CHX A;  1U4A A;  2WHI A;  4ZOH C;  4HJK A;  4LNN A;  4CO7 A;  5J3Y A;  1M7R A;  3WA0 A;  1I2H A;  4C7Y A;  4ZYN A;  2D9V A;  2W2X D;  5HE1 A;  3MHZ A;  3WCQ A;  4C80 A;  3QJZ A;  5LXH A;  3HQC A;  3SV1 A;  2NBU A;  2LG1 A;  3G9W A;  3AEC B;  4W9J A;  3NUH B;  5FI0 A;  1WYW B;  1FCL A;  4EE2 A;  3DBL I;  5EE0 A;  3SR6 A;  1TS2 A;  2FBW B;  3PZD A;  1BTN A;  5IJM A;  3IHP C;  3P4P B;  4A5K A;  1Z2M A;  4P7I A;  3ZXR A;  1E7U A;  1ACA A;  3TL5 A;  1TS5 A;  2G4D B;  1RFK A;  1C4A A;  1GC7 A;  2MJE A;  4A8X C;  2NMB A;  1MIX A;  4ILJ A;  3WAM A;  1JW9 D;  2MP2 B;  4AJY B;  1F0Z A;  4MK0 A;  4FJV B;  4IDI A;  3ZTD A;  2WXG A;  2L83 A;  5HE0 A;  1X1F A;  4HRS A;  4IFS A;  1UGM A;  3LYY A;  3W9C B;  1UNP A;  3M1I B;  2Y8F A;  1KF6 B;  2LGI A;  4IM2 A;  1MJD A;  4GOC A;  1OEY A;  2L52 A;  1JRP A;  2DZI A;  2LGS A;  3ZNZ B;  2JT4 B;  2WXF A;  1FMA D;  2RNR B;  4KZ0 A;  2CQU A;  2LOZ A;  1I4P A;  2I1J A;  1J7C A;  3ZNH B;  3O65 B;  2N1V A;  2Y5C A;  3AMZ A;  4MH8 A;  1H8C A;  5DPR A;  1XQQ A;  2GBK A;  2FCS A;  2NMQ A;  4JKC A;  2MKR A;  1T6B X;  2INC C;  1AN8 A;  2X8X X;  3DHH C;  3IAM 1;  1V61 A;  2IZV B;  2GOW A;  1C78 A;  2WXP A;  1UWX A;  2WLB A;  3E56 A;  3IFW B;  4S17 A;  2DHI A;  2K8E A;  1OQN A;  3Q3F A;  2N9E B;  3AUL A;  3PT2 B;  3IAS 1;  4A55 A;  4H2A A;  1ROE A;  3KYD D;  4KAX B;  2K2J A;  1PGX A;  2Z14 A;  2LHE A;  2Z0D B;  1W1D A;  1K53 A;  4XWX A;  2VZK D;  1MPH A;  2QHO A;  2V76 A;  1LQB A;  2Y5P A;  4MGY E;  4F1S A;  2KVZ A;  2WGS A;  4MT5 A;  3UF8 A;  4XWT A;  2W3R A;  3RI7 C;  2DX5 B;  4L23 A;  4NJC A;  5LG4 B;  2R82 A;  2I38 A;  3NY5 A;  1TKE A;  3EFU A;  2GBJ A;  5T8I A;  2DIK A;  4EUT A;  3HIE A;  2IO1 B;  4LCD E;  4A6F B;  4BVU C;  2KWC A;  3E9S A;  2QSD A;  1N61 A;  2CAY A;  1BWN A;  1UBQ A;  2J42 A;  2NPT A;  4AJW A;  1SHC A;  2Z13 A;  4WSF A;  2D07 B;  1TQZ A;  2H88 B;  2WP9 B;  3AE7 B;  4BZA A;  1E10 A;  4C56 C;  2KTF A;  4EFO A;  2P0F A;  2K6D B;  4WJ7 A;  1V9J A;  3MP9 A;  1DYQ A;  1WM2 A;  3KUZ A;  3JVZ X;  4W9H A;  4DXA B;  4PS7 A;  1U5F A;  2WNM A;  4TSS A;  1TY0 A;  2REX A;  2AQ3 B;  2Y7B A;  1MVK A;  3AE9 B;  3L17 A;  3V61 A;  1V8C A;  2MBE A;  1J0G A;  2KXJ A;  1EAZ A;  2M19 A;  2DBY A;  2JYT A;  3ABV B;  5DHA B;  3HHM A;  3RCP A;  2NBV B;  5JHB A;  3OHM B;  4W9D A;  2WDR B;  2BQQ A;  1QOF A;  5LOP B;  4JX1 C;  4MEM A;  2IYB A;  4PT5 A;  3Q6B A;  4I6P A;  4HDQ A;  1X11 A;  3NZ3 A;  3E66 A;  1FXI A;  1LFD A;  1ZYI A;  2KLC A;  4B0E A;  1P1A A;  1MAI A;  1N63 A;  2OQB A;  4A6F A;  1KLU D;  3ZNI D;  2KWU B;  3P2B A;  2K2U A;  3AB5 A;  1XOD A;  3SBG A;  1C76 A;  2LBB A;  1DYN A;  1PGA A;  5D3X A;  1HXY D;  2QIL A;  2NR2 A;  1TJE A;  3CIK A;  1NEN B;  1CZP A;  4BKS A;  1WJ6 A;  2Z0P A;  4L1R A;  1JRO A;  2Z8L A;  3A9J B;  2GI9 A;  4HK2 A;  2Z0O A;  2ONQ A;  4GPT B;  4KVG B;  1DDW A;  4OZB A;  1C4P A;  3KVF B;  2I5F A;  4NJ6 A;  4XWW A;  1V86 A;  1IPG A;  3N7C A;  4DIX A;  1ZSQ A;  2COA A;  5KCV A;  2CU3 A;  2LGD A;  4LK0 M;  3H6N A;  3N30 A;  3ZXV A;  1I7H A;  5JP4 A;  3TCA A;  3H1U A;  1QQG A;  3AEE B;  3ODO A;  3RCZ A;  1OFF A;  5BYQ A;  2KUP A;  1TT5 B;  1SGH A;  1D3Z A;  3ULB A;  3SEB A; 
#chains in the Genus database with same CATH homology
 4MDK E;  1NVL A;  3F0W A;  4IUM B;  3ZRC A;  1WR6 E;  2GCL A;  4GDL A;  2DYO A;  3IG3 A;  2D9X A;  1WZ3 A;  4B6H A;  1WJN A;  4NQK E;  2FCQ A;  3SBT A;  3MTN B;  4DDG D;  2ZEQ A;  1E7V A;  3KW5 B;  4BBN F;  3JSV A;  4NQL B;  5CLQ B;  1KOT A;  5L83 A;  4DBG A;  2OJR A;  3DBS A;  3D8E A;  4MY6 A;  3ZW3 A;  1E8W A;  2IO3 B;  5J3Q A;  3V6C B;  2BKF A;  2FDQ A;  3R7R A;  4K7S A;  2M17 A;  2N7D A;  2MW5 A;  1TGZ B;  2LVP A;  1HBK A;  4HLE A;  1WXM A;  2KWV B;  2KAN A;  3ECI A;  4NNJ B;  2XEW A;  2Y5B B;  2WWZ A;  2BYE A;  4GGQ A;  5DHF B;  5GOW B;  4GDL B;  4BKT A;  3SUZ A;  5J17 A;  1ST7 A;  1WJ4 A;  4NPN A;  1OTR B;  2EKE C;  3DOW A;  1KI1 B;  2RGF A;  1YX5 B;  3VUW A;  4B9K A;  2MWN B;  3GYO A;  2KMC A;  1AAR A;  1JRU A;  4WWN A;  4IWP A;  2MA9 B;  3JSV B;  4D0N B;  1RJ2 A;  4DWF A;  3PTF C;  3U7D A;  2WX1 A;  2LRW A;  1UPQ A;  3E9L A;  1Y19 B;  2CY5 A;  1FHX A;  2NBW B;  5JZE B;  3PVW A;  3D8D A;  2KTR B;  4BBN C;  3M95 A;  3MHS D;  1LXD A;  4M8M A;  1Y8R C;  3TJP A;  5LON B;  2DX1 A;  1H4R A;  3UQB A;  5CHF A;  4BKS D;  4CYE A;  2ELB A;  2L8J A;  2J59 M;  2K8C A;  1WJ1 A;  4F7U P;  3DDC B;  3OAN A;  4IC7 B;  4NAW A;  2ASQ A;  4KDL B;  5C16 A;  2JWZ A;  3ZLZ A;  4WJN A;  2LRU A;  1P5T A;  3V6E B;  2COP A;  1FHO A;  1R4M I;  1SE9 A;  4XC2 A;  3RT3 B;  1X86 A;  1G6J A;  2DA0 A;  4WVF B;  3S2A A;  3VAW A;  1DDV A;  5D6J B;  4A3O A;  3RUI B;  4GZU A;  2KTR A;  4W9L A;  3PHW B;  2ZZP B;  1IYF A;  1Y5O A;  3O96 A;  4W9I A;  3ML4 A;  3BIN A;  2BF8 B;  4F7H A;  3KUC B;  5DPW A;  1X1G A;  2YS5 A;  2KJ6 A;  2MBO A;  3OJ3 A;  1UZX B;  2Y8G A;  4EKU A;  4NAW B;  2FCM A;  2LD9 A;  2ZPN A;  1XD4 A;  2NVU I;  1TJ6 A;  2MBQ A;  1GJZ A;  2D11 A;  2MBB B;  1ZKH A;  2ROV A;  3PLU A;  2WDT B;  3DQV A;  2RD0 A;  1C3T A;  4LJO B;  3FLV A;  1CMX B;  3ML8 A;  4IWQ A;  3FSS A;  1WI1 A;  4K7U A;  2FUH B;  3D8F A;  4ZRK A;  1B55 A;  1F9J A;  2RVB B;  2KX3 A;  5D3V A;  1V2Y A;  3PVU A;  2N7E A;  1P9D U;  3APD A;  3VTV A;  1EGX A;  4TV3 A;  3QAQ A;  1HB8 A;  4I6N B;  1WE7 A;  2WX0 A;  2KQS A;  1PFJ A;  4HDO A;  4EZL A;  1LM8 B;  4OVU A;  1WJU A;  3H7P B;  1RFA A;  1LB1 A;  2RSU A;  3F5R A;  2D9Z A;  5CHW A;  2HE7 A;  2LUE A;  3ODW A;  1ZVR A;  2JZ3 B;  1H10 A;  2N9X A;  1P6S A;  2C9W B;  3KSY A;  4DX9 0;  1RRB A;  1UEL A;  3PV1 A;  2IO0 B;  3DVG X;  3E9P A;  4F8C B;  3ZDM C;  3QHT A;  3A33 B;  3TFM A;  3A1Q B;  3LJU X;  4GDK A;  4W9E A;  2XK5 A;  4CHJ A;  4XX5 A;  3WAP A;  4K2O A;  1EF1 A;  2PE6 B;  2UZR A;  5BO4 B;  2YS1 A;  4FLH A;  4X57 B;  4FJY A;  4GB9 A;  2LZ6 A;  2D10 A;  3H7P A;  3GYP A;  1NTY A;  3VH4 B;  2GMI C;  1Z5S B;  1GC6 A;  1UNQ A;  4JKG B;  3ZKJ C;  1U5E A;  3QWM A;  2JRH A;  2KQ7 A;  4A6H A;  2COF A;  4PNK A;  4HCN B;  4HB2 B;  2X18 A;  5G2N A;  2K00 A;  2BKR B;  1HE8 A;  4TQ1 A;  2KDI A;  2YRY A;  3U8Z A;  1XD3 B;  3VFK A;  4HCP B;  2LI5 A;  4A3P A;  2UZS A;  3A1Q A;  3CMM B;  2XK5 B;  4WJO A;  3JW0 X;  4Y94 A;  2R2Q A;  4JKD A;  1V80 A;  1KZ7 A;  2V4L A;  3SU8 X;  3EPY A;  2J0K A;  2KVR A;  4KIK B;  1UEF A;  4K17 A;  5J18 A;  2DZM A;  3GZN I;  2J0J A;  4ANW A;  3WYF B;  2CRF A;  3ALB A;  3M62 B;  2MSE D;  1HB6 A;  2M4N A;  4TQ0 A;  4HB3 B;  4PQ0 A;  3FEH A;  2KFK A;  2ZVN A;  2Q13 A;  3M63 B;  3D32 A;  2PJH A;  3K9P B;  1W1H A;  3RYT A;  5HKH A;  2RPQ A;  5J2R A;  3Q3J A;  4YON A;  1ZM0 A;  5IA7 A;  2JXX A;  2DN6 A;  4RMA A;  2L3Z A;  3TVV A;  3VVW B;  4G0N B;  2JF5 A;  1I35 A;  3PRZ A;  3NOB A;  4NY0 A;  3QK0 A;  4WJQ A;  4MEL A;  2MDX A;  2M8S A;  3V5W A;  4ICV A;  2KC2 A;  2YF0 A;  1BT0 A;  2GBM A;  4HHV A;  1NI2 A;  3B1L X;  1V81 A;  4WAA A;  2LJ5 A;  2ZVO A;  3L16 A;  4JQW C;  2KFK B;  3PRP B;  1K5G B;  2KLG A;  4FHK A;  4Z2N A;  1SIF A;  2RSG A;  5C1Z A;  2D3G A;  1WF9 A;  5IAA C;  2KNB A;  1E5W A;  4HAX B;  2DYN A;  3SO6 A;  1NDD A;  3N3K B;  2MWS B;  4JIO U;  5C5B A;  1UBI A;  1KLV A;  2DLW A;  3QIJ A;  3QBV B;  2CR5 A;  3L08 A;  1ZGU B;  3ZUN A;  5J3T A;  2L0T A;  2DAF A;  4EEW A;  3A8P A;  1LW3 A;  4KV2 A;  2NCN A;  5CLL B;  4GSW A;  3VH3 B;  4ANV A;  5AZH A;  2N4F A;  2GBN A;  3DXD A;  4W9C A;  2XBB C;  2EC1 A;  3TMP B;  1E8X A;  4K7W A;  3VDZ A;  4A6K A;  2D9W A;  3A8Q A;  5AEK B;  5CX3 A;  1WXA A;  4GMV A;  1NU2 A;  3VXW A;  5LXI B;  1I42 A;  5L81 A;  4N9F 4;  2KZR A;  4ILH A;  1WM3 A;  2AL6 A;  2N0Y A;  1WGU A;  3AXC A;  3R7Q A;  5JLJ B;  5C5B B;  3AI5 A;  4JK9 A;  2MP2 A;  2YS3 A;  2KOX A;  2K39 A;  1YJ1 A;  2MQJ A;  3B08 A;  3RZW C;  3NS8 A;  2M38 A;  2W9N A;  1WVH A;  1MIZ B;  5DCN A;  2ZJD A;  3SDL C;  1L7Y A;  4MH0 E;  3UGB B;  2BCJ A;  3A9K A;  4F7G A;  1MG8 A;  1KM7 A;  2LXC A;  1DDM A;  2JVC A;  3PP2 A;  3H7S A;  2XQN M;  4G50 A;  3NZU A;  2JY6 A;  3VQI A;  2W2X C;  2ZNV C;  3RZF A;  4GU2 A;  1FHW A;  4ZDV A;  1WE6 A;  2KCJ A;  2ZCB A;  4PS3 A;  3KY9 A;  3A4S C;  1FGY A;  3VOQ A;  2O2V B;  3A4R A;  2A4Z A;  3R3M A;  2D2Q A;  4B6W A;  5FI1 A;  4E3C A;  3MPX A;  1DIK A;  1UNR A;  1KJT A;  3QC8 B;  4DDI D;  4AOF A;  4LJP B;  3L13 A;  1RRP B;  2K1F A;  4ZRI A;  2PPH A;  3P7Z A;  4MGZ E;  4TYZ A;  4NSW A;  2YT1 A;  3B0A A;  1XT9 B;  4HAV B;  2G4S A;  3DVG Y;  2UWQ A;  1M94 A;  2UVM A;  3QWZ B;  2DZK A;  1WY8 A;  2ADZ A;  2YLM A;  1BTK A;  3K9O B;  3PHX B;  4PYU A;  1X05 A;  4HPM B;  2O2V A;  3C0R B;  1NBF C;  2ZCC A;  1DBH A;  4E71 A;  2KN5 A;  4IOY X;  1S1Q B;  2K8B A;  3DPD A;  2WH5 A;  3VTU A;  1W1G A;  3PVL A;  1KZG A;  1WMH A;  5DH9 B;  1WX7 A;  5HE2 A;  4JKF A;  3AU4 A;  3KRW A;  2GCJ A;  3UIN B;  2CY4 A;  1WR1 A;  4II2 B;  4DBB A;  2FID A;  4FAD A;  2DYB A;  1WXV A;  1ZC4 B;  2GBR A;  2ELA A;  2V3S A;  5EDS A;  1WGH A;  1J0W A;  3IBE A;  4PYZ A;  4BFR A;  1XX0 A;  2UYZ B;  2JZZ A;  3V62 A;  5JH5 C;  3PSE B;  2LOX A;  5G55 A;  1I7A A;  3VUY A;  2L05 A;  3L54 A;  5E6O A;  2JRI B;  2WYQ A;  4II3 B;  1FB8 A;  3CST A;  4W9F A;  4WQO B;  5E6N A;  3APC A;  4OVV A;  4M8N A;  2DX5 A;  2N9P C;  1M7E A;  1X1M A;  1WMH B;  4RM9 A;  4JK8 A;  1YX6 B;  3HW2 B;  2NPT B;  3VHT C;  1WH3 A;  1RAX A;  2HTH B;  5FR6 A;  2L00 B;  3ZDT A;  3NZS A;  1OGW A;  2C60 A;  4WWO A;  1BAK A;  2R09 A;  2MCN B;  2I1K A;  1ZC3 B;  2OOB B;  2BPS A;  2CHZ A;  1VBG A;  1Q5W B;  2KKC A;  5LLI A;  2LYD A;  4GN1 A;  1V5U A;  1N3H A;  2ABD A;  2P0H A;  4TUU A;  4DHZ B;  2KHW B;  3RD2 A;  4G11 A;  1U5D A;  2RLO A;  1JDE A;  2DYM A;  4HAW B;  2HJ8 A;  4JLC A;  1AQC A;  1TTN A;  4FA6 A;  1WXS A;  2DZJ A;  2LXA A;  2K6Q A;  1WX8 A;  2HTH A;  2GJY A;  2X0S A;  2MRP A;  3A9J A;  1EUV B;  2J0M A;  1E8Z A;  3JYU A;  4ILG B;  1VBH A;  4EZJ A;  2KJH B;  4EJN A;  3L10 B;  4MGK E;  1WJM A;  3DBR I;  2VSZ A;  1WGY A;  3FP5 A;  4Z2M B;  3KYC D;  5D94 A;  4B95 A;  2BGF A;  4J6I A;  2JP2 A;  3P6A A;  1KC7 A;  2L0F A;  2L76 A;  3KZ1 A;  1XKE A;  2G45 B;  2FAZ A;  4CHM A;  4K1R B;  1K5D B;  4KHA A;  3HK0 A;  1U5G A;  3EEC A;  4HWI B;  4KSK C;  4TKN A;  4IG7 B;  2KGX B;  2FJL A;  1KBL A;  1MK9 B;  3TIX A;  5D3W A;  3QQ8 B;  4DK5 A;  4KDI C;  3PG7 A;  2NZ8 B;  2O6V D;  4HAT B;  5CTR C;  1XCG A;  2EMS A;  2KX0 A;  1OEY J;  1NTI A;  3VTW A;  1TBE A;  2LVQ A;  2HRJ A;  4W9G A;  2IYD B;  5HE3 A;  1EO6 A;  1FGZ A;  5KHO A;  2W2W A;  4ZRJ A;  1ZW7 A;  4MT7 A;  2MX2 A;  1R4N I;  1PLS A;  2KC1 A;  4FJZ A;  5CHV C;  5D3Y A;  2COC A;  2RGN B;  3ENB A;  3TO1 A;  4DHJ B;  5JHG A;  4IM0 A;  1YQB A;  2R0D A;  2I5C A;  4WJP A;  3HM3 A;  4EOY A;  1WGD A;  2LVO A;  3DXE A;  4ICU A;  1V5T A;  4HAZ B;  3FM8 C;  4CHK A;  2V1Y A;  5E6P A;  2CB8 A;  4URK A;  3CF6 E;  1P98 A;  3UIP B;  2RQ1 A;  1Q1O A;  5DPS A;  4IAP A;  2L1C A;  3BY4 B;  3OAW A;  2DEN B;  1OY2 A;  2BWE S;  4A20 A;  2DKQ A;  4BOZ B;  1PMS A;  2Z59 B;  2IY0 B;  1L2N A;  2ZNV B;  1OQY A;  5L95 C;  4JKE A;  1J19 A;  3TBL D;  3ZO5 B;  3VUX A;  1WZ0 A;  2DHZ A;  3ML9 A;  2NS5 A;  2EMT A;  3E9O A;  2A5U A;  2N23 A;  2KFJ A;  2ZPY A;  2VRR B;  2B3A A;  2KK8 A;  4MSQ B;  2KDE B;  4FN2 A;  1V5O A;  2KO3 A;  5C6R A;  2C5L C;  1TXD A;  1WIA A;  3I3T B;  2MFQ A;  2AL3 A;  1XR0 B;  3IVF A;  2M0X A;  4MSM B;  4M0W B;  2P0D A;  3WAN A;  1GGO A;  3GOE A;  5GMV A;  4DHJ D;  1YD8 U;  2DAJ A;  4PS8 A;  3EHV A;  4EZK A;  4KHO A;  2FJ9 A;  4FUL A;  4C0A A;  2LWP A;  2BYF A;  3QCA A;  3DCG A;  3PRM B;  3T06 A;  4HVB A;  4LDT D;  3ZTC A;  3KRX A;  2HD5 B;  3LDZ E;  1K8R B;  1V49 A;  4HPL B;  2H7D A;  1QZE A;  4MM3 A;  2DHK A;  3LJ3 A;  3H9D A;  4HAU B;  3PSC A;  3SYX A;  2R2O A;  2LKO A;  2YVC A;  2CKH B;  1J8C A;  2DYQ A;  2E2X A;  2M14 A;  4MJS A;  2IO2 B;  5D7G A;  3NSU A;  3PRE A;  2DHJ A;  3VIA A;  4AUQ C;  3W1S C;  2FCN A;  2QKM A;  3ZIM A;  2KD0 A;  2H7E A;  2K25 A;  2O6V B;  1PQS A;  2CU1 A;  2EJ8 A;  3MJW A;  1V6E A;  2D4Q A;  4RM8 A;  3N32 A;  1UD7 A;  4JGH B;  2IY1 B;  4JKB A;  3APF A;  3SD5 A;  4GMX B;  1U2B A;  4GIV A;  3ZNG C;  5KHQ A;  4JKH A;  4AP4 C;  2K8H A;  1Q67 A;  3CXB B;  1ISN A;  4HB0 B;  4FHJ A;  3WAL A;  2QKL A;  1TZ1 A;  4AWJ A;  5DPT A;  3R66 C;  5KQ1 A;  2JPH A;  2LUL A;  3HIZ A;  1V5M A;  4IW0 A;  4MJS B;  5D2M B;  2RUK B;  5KQ4 A;  4ANX A;  4DHZ E;  2O6V A;  2BWF A;  4FBJ B;  1AWE A;  4BKG A;  4K2P A;  5AZG A;  1P3R A;  4MGI E;  1WG7 A;  4L6E A;  4DX8 A;  3PS6 A;  4IM3 A;  3DXC A;  2AEH A;  4ASW C;  3W1S A;  5JVL A;  2L7R A;  3OJ4 B;  4GDK B;  1FXT B;  5C79 A;  3M3J A;  1RLF A;  1QC6 A;  3UIO B;  3NHE B;  3ENE A;  5TR5 A;  1U27 A;  1VD2 A;  2CS4 A;  3X0W A;  4JK7 A;  3SNH A;  4GXB A;  2PEA A;  1A5R A;  4LDT B;  3U30 A;  2DKP A;  2KMA A;  3QA8 A;  5DI9 B;  1E90 A;  1P0R A;  1WI0 A;  3HM6 X;  3ZVR A;  1S3S G;  1VCB A;  2GS0 A;  3QAR A;  4JKG A;  1UPR A;  1WRD B;  3TW1 A;  3W1Y A;  3ZVV A;  4I6L B;  3T9L A;  4G3X B;  2N1W A;  1Q0W B;  5JHA A;  2G35 A;  4KZC A;  5AZF A;  1NTV A;  5C23 A;  2ROZ B;  2MBH A;  3CSF A;  3ODX A;  2VKI A;  1GG3 A;  1GUA B;  3V60 A;  2COD A;  4JKA A;  2IFS A;  2YSZ A;  2PE9 A;  3WAO A;  1GNU A;  4E74 A;  4F7Z A;  1YIW A;  5JHH A;  2L2I A;  1DRO A;  4KIK A;  3T8M A;  1FOE A;  1WGR A;  3MDB C;  1MK7 B;  3A98 B;  3WIM A;  2LGX A;  1V88 A;  2J7Q B;  1EF5 A;  3ULC A;  3PEG A;  4ANU A;  2C7H A;  1UH6 A;  1WX9 A;  3EC8 A;  3X23 A;  1T0Y A;  4XZ4 A;  2VRW B;  3SHQ A;  5D27 A;  4HB4 B;  2MLB A;  4IWO A;  3DVN V;  2JUO A;  4BBK A;  3AJ4 A;  2P8V A;  3KUD B;  2OTX A;  4HAY B;  4KSL C;  4YL8 A;  3KH0 A;  3ZRF A;  2CHW A;  4EMO A;  2AWT A;  4HXD A;  1WFY A;  4W9K A;  2BYV E;  2FIF A;  1MKE A;  4H8S A;  4JL9 A;  2C7M B;  2FNJ B;  3L0W B;  5DIF B;  2C7N B;  2G3Q B;  1WGQ A;  1V89 A;  1FAO A;  2RR9 A;  1EVH A;  1OMW A;  4K81 A;  1Z87 A;  2D9Y A;  2KDB A;  3A9K B;  3PGE A;  4BOS C;  2KJR A;  1WGG A;  3DBH I;  1IP9 A;  1IRS A;  3RUL A;  1P3Q U;  2DFK A;  2KDF B;  2YT0 A;  3UZT A;  3ONS A;  3BJI A;  3OLM D;  3UQA A;  2Z0E B;  2IBI B;  1E8Y A;  2M1M A;  2Z0Q A;  4WWP A;  3PLV A;  2LGY A;  1V5P A;  2AYO B;  2PZ1 A;  2LAS A;  3DVN U;  3AU5 A;  1C1Y B;  4KHB B;  2DTC A;  3PPA A;  4NJ7 A;  5EFX A;  3QX1 A;  1U29 A;  2CHX A;  1U4A A;  4HJK A;  4CO7 A;  5J3Y A;  1M7R A;  3WA0 A;  1I2H A;  4ZYN A;  2D9V A;  2W2X D;  5HE1 A;  3QJZ A;  5LXH A;  3HQC A;  3SV1 A;  2NBU A;  2LG1 A;  3G9W A;  4W9J A;  5FI0 A;  1WYW B;  3DBL I;  3PZD A;  1BTN A;  5IJM A;  3IHP C;  4A5K A;  1Z2M A;  4P7I A;  1E7U A;  1ACA A;  3TL5 A;  2G4D B;  1GC7 A;  2NMB A;  1MIX A;  4ILJ A;  3WAM A;  2MP2 B;  4AJY B;  4MK0 A;  4FJV B;  3ZTD A;  5HE0 A;  1X1F A;  4IFS A;  1UGM A;  1UNP A;  3M1I B;  2Y8F A;  4IM2 A;  4GOC A;  1OEY A;  2DZI A;  3ZNZ B;  2JT4 B;  2RNR B;  4KZ0 A;  2CQU A;  2LOZ A;  2I1J A;  3ZNH B;  3O65 B;  2N1V A;  1H8C A;  5DPR A;  1XQQ A;  2GBK A;  2FCS A;  4JKC A;  2MKR A;  1V61 A;  2IZV B;  2GOW A;  3IFW B;  2DHI A;  1OQN A;  3Q3F A;  2N9E B;  3AUL A;  3PT2 B;  3KYD D;  4KAX B;  2K2J A;  2Z0D B;  1W1D A;  4XWX A;  1MPH A;  2QHO A;  2V76 A;  1LQB A;  4MGY E;  4F1S A;  3UF8 A;  2DX5 B;  2R82 A;  3NY5 A;  3EFU A;  2GBJ A;  2DIK A;  4EUT A;  2IO1 B;  4LCD E;  4A6F B;  4BVU C;  2KWC A;  2CAY A;  1BWN A;  1UBQ A;  2NPT A;  4AJW A;  1SHC A;  4WSF A;  2D07 B;  1TQZ A;  2KTF A;  4EFO A;  2P0F A;  2K6D B;  4WJ7 A;  1V9J A;  1WM2 A;  3KUZ A;  3JVZ X;  4W9H A;  4DXA B;  4PS7 A;  1U5F A;  2REX A;  2Y7B A;  3L17 A;  3V61 A;  2MBE A;  1J0G A;  2KXJ A;  1EAZ A;  5DHA B;  3HHM A;  3RCP A;  2NBV B;  5JHB A;  4W9D A;  5LOP B;  4MEM A;  2IYB A;  4I6P A;  4HDQ A;  1X11 A;  3E66 A;  1LFD A;  2KLC A;  1P1A A;  1MAI A;  2OQB A;  4A6F A;  3ZNI D;  2KWU B;  3P2B A;  2K2U A;  1XOD A;  3SBG A;  2LBB A;  1DYN A;  5D3X A;  2NR2 A;  3CIK A;  4BKS A;  1WJ6 A;  2Z0P A;  3A9J B;  4HK2 A;  2Z0O A;  4GPT B;  4KVG B;  1DDW A;  3KVF B;  2I5F A;  4NJ6 A;  1V86 A;  1IPG A;  3N7C A;  1ZSQ A;  2COA A;  5KCV A;  2LGD A;  3H6N A;  3N30 A;  5JP4 A;  3H1U A;  3TCA A;  1QQG A;  3ODO A;  3RCZ A;  2KUP A;  1SGH A;  1D3Z A;  3ULB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...