1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
b'PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords radixin
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
3FSSA 3FP5A 1QZEA 4X57B 3TL5A 4NJ6A 2O6VB 4XC2A 3H7PB 5J17A 2DKQA 4HAUB 1WXSA 4W9LA 1XKEA 1P1AA 4I6PA 2HE7A 1DYNA 4W9HA 3AJ4A 3WA0A 3F5RA 2O2VB 3PHXB 3KW5B 2N7EA 1KLVA 3EECA 1WXMA 1Q5WB 2AL3A 3U30A 4HAYB 2C7NB 5HKHA 2ZNVC 4GN1A 2KJRA 2VKIA 2GBKA 4NAWA 1LFDA 4WWOA 4M8NA 3PHWB 4IM3A 3APCA 3ZNGC 1BAKA 1PQSA 3QHTA 3AI5A 2W2WA 3CF6E 1FGZA 5DHAB 1KZ7A 1J0WA 3V60A 1I2HA 3W1SC 4IC7B 4G11A 4LJOB 4BKGA 2DTCA 1UGMA 2GCJA 3APFA 2CRFA 1ST7A 2KFKA 3VUWA 4JLCA 3KRWA 2Z0OA 1NU2A 2MLBA 2V4LA 4MGZE 4DX90 3PRZA 1NVLA 4K7UA 1MIXA 3B08A 2MBHA 4KHAA 3EHVA 3SV1A 4NJ7A 2AEHA 2MW5A 2EKEC 3HK0A 3PS6A 3DBRI 1ZW7A 3V62A 4JIOU 3ML4A 2GCLA 2Y7BA 3G9WA 3QWZB 4K2OA 3LJUX 2YSZA 1XODA 3MTNB 3DBLI 1P3QU 4WAAA 3QQ8B 2OOBB 2WH5A 1EF5A 1OGWA 2DX1A 2BGFA 2DHKA 3PSEB 2DKPA 2ZNVB 3HW2B 2BWFA 3IFWB 4KZ0A 4GSWA 2NPTA 2KZRA 4KV2A 2Z0DB 3WAOA 1AQCA 2RLOA 2LJ5A 3ZRCA 2G35A 3X0WA 3V6CB 3DQVA 4K1RB 4KDLB 3ZO5B 4CYEA 5D27A 3IVFA 3JYUA 4ZRJA 3UQBA 2WDTB 3P7ZA 1W1GA 1K5GB 3RCPA 4GGQA 5JP4A 1YX5B 3FEHA 2M17A 3PVUA 2LOXA 5CX3A 4MGYE 1WGDA 1AWEA 3DVGX 1BTNA 3ZNZB 3M62B 4MJSA 1EF1A 1X05A 4HB4B 4DHZB 2C9WB 1QQGA 2C7MB 4WWPA 5CHFA 2JF5A 2CU1A 4DX8A 4HXDA 5C5BB 4EJNA 3P2BA 2YLMA 4ZRKA 4DK5A 3OAWA 3VXWA 2KFJA 2BCJA 2LGDA 4W9EA 2Y8FA 1ZKHA 2DHZA 2GS0A 3IBEA 3NZUA 3D8EA 4B95A 5LXHA 4J6IA 1AARA 4K17A 3T06A 1A5RA 1NTYA 2LG1A 2D2QA 3D8FA 5GMVA 5DPSA 4MGIE 2R09A 3R3MA 4WJNA 1E5WA 1XCGA 1XD4A 1YD8U 2KQ7A 1MK9B 2ROZB 5DPTA 4IM2A 1YIWA 2KTRB 1WMHA 2PJHA 3L08A 5D3XA 4PYUA 2JVCA 2BKFA 2DN6A 4WVFB 3K9OB 1GNUA 3ZRFA 4ICVA 1MG8A 4NPNA 3ECIA 2ELBA 4MY6A 1Q0WB 3L16A 3U8ZA 3R7RA 2KXJA 4WQOB 4A20A 1GC6A 4AWJA 2LI5A 3KUCB 2FUHB 2FJ9A 5D3WA 4ZRIA 4MH0E 3DXDA 3F0WA 1Z5SB 2VSZA 2DLWA 3VAWA 1K8RB 2DYQA 3S2AA 3A33B 5G55A 4A3OA 2D9YA 4II2B 3MDBC 1WE6A 2LZ6A 2EMSA 4MEMA 1J19A 4WSFA 2JWZA 4FA6A 2FCMA 5J3QA 2YS5A 3IHPC 5D2MB 4FJZA 1KI1B 1DDVA 2CHXA 2NPTB 1WX7A 4RM8A 1YX6B 1V2YA 1C1YB 4HPMB 1TGZB 4B9KA 2DZKA 2KHWB 3KY9A 5CLLB 4CHJA 3RD2A 4PS3A 3RT3B 3D8DA 2GBNA 4HB0B 5LONB 1D3ZA 4A6KA 4BKTA 4HAVB 2V76A 4IWPA 4BVUC 3A9KA 5EFXA 3FM8C 2FJLA 4DWFA 4JL9A 4KSLC 2D11A 3JSVB 5AZGA 2RUKB 3SUZA 2LRWA 5J18A 2UZSA 2ZEQA 2JXXA 3NS8A 3QBVB 1XR0B 1OY2A 1WGHA 2IFSA 3A1QA 1XD3B 3PRMB 2N1VA 3HM3A 1NTIA 4GDLA 2FCNA 2LUEA 3ZVVA 2N7DA 4FULA 4RMAA 4HB3B 2PPHA 2MX2A 3KUZA 2K6QA 1V80A 2CHWA 2ABDA 2LVPA 2NS5A 3UZTA 4LDTD 2UWQA 2ZZPB 5GOWB 1H10A 2K8BA 4GU2A 1OQYA 2KVRA 1WH3A 2KTFA 2JPHA 3DOWA 4GDKB 4WJPA 3SYXA 1H4RA 1E7VA 3KYCD 1V5TA 1PMSA 2GBMA 2YF0A 3DCGA 5KHQA 4EKUA 3A9JA 2D9XA 2N9PC 2FIDA 2LGYA 1KOTA 2NCNA 4ZDVA 2YT1A 1IPGA 3UF8A 1TQZA 4BOZB 5IJMA 2KLGA 4MK0A 5DH9B 1X1GA 1Y19B 3DXEA 2HTHA 4FN2A 2GJYA 2L8JA 2NBWB 3QC8B 4F7ZA 2P0HA 3M63B 2W2XD 2KK8A 3MPXA 3V6EB 3SNHA 1TTNA 1FHOA 4AUQC 2CB8A 3TFMA 3ZTCA 3OJ3A 3BJIA 1V86A 2DHJA 4HVBA 4I6NB 4LCDE 3B0AA 2MBBB 1V5UA 4TQ1A 2KJHB 3GOEA 2LXAA 2KLCA 3ULBA 1LM8B 3QCAA 2K8HA 1TXDA 2COPA 3R66C 3T9LA 2CODA 1WGUA 2R2OA 2G4DB 4WJ7A 1J8CA 4FHKA 2D9WA 3ALBA 2XEWA 5E6NA 4IW0A 1TJ6A 2KD0A 4XZ4A 4A6FA 2PE6B 1ZC4B 1X1MA 1B55A 4XWXA 1YJ1A 2CAYA 5FR6A 4PQ0A 2IO3B 4E74A 2KX0A 2Q13A 4MELA 2RQ1A 2LOZA 4FADA 1HBKA 1IYFA 1HB6A 3GZNI 4TUUA 4CO7A 3P6AA 2A5UA 3N3KB 3WALA 1P5TA 4HDQA 1I42A 2KANA 5BO4B 2I5CA 3C0RB 4Y94A 4IFSA 2DYNA 3VTVA 2M38A 4MSMB 4EZJA 4E3CA 1XX0A 3FLVA 4II3B 2QKMA 2MP2B 4LJPB 2G3QB 3V5WA 3I3TB 5DCNA 3KRXA 3ZW3A 2COFA 2WX0A 2IYDB 3EC8A 1XQQA 4EZLA 2JRHA 4K7WA 2K2JA 3ODXA 4DXAB 4HAXB 2DZJA 3PV1A 1WJMA 3UIOB 2NBVB 1TBEA 5JHAA 2CS4A 3L13A 2L0TA 2MCNB 3TMPB 4G3XB 3HIZA 1FHXA 4RM9A 1T0YA 2ELAA 1UNPA 4KIKB 4TYZA 3L10B 1BWNA 1U5FA 1V81A 2NMBA 2BKRB 2DX5B 2Y5BB 1OQNA 3UIPB 4Z2NA 2KN5A 2RGNB 2D10A 3K9PB 3ODWA 2ASQA 2KMAA 4BBKA 1WGGA 2KCJA 2XQNM 3ZDTA 3L17A 4AP4C 2JZZA 1R4NI 4F7GA 5LLIA 4KHBB 3UINB 2XK5B 2DAFA 1IRSA 5KCVA 3MJWA 3SD5A 4DHZE 1S1QB 2FAZA 3VH4B 2FNJB 4EMOA 2BPSA 2O6VD 5CHVC 2XBBC 3HM6X 4BBNC 2Z0EB 5AZFA 4IM0A 4OVUA 4DBGA 4HJKA 4CHMA 3PRPB 4B6HA 4TKNA 1LB1A 2JT4B 3X23A 3TBLD 1S3SG 3TW1A 1WJNA 1DDMA 4A6FB 2N23A 3VOQA 2RPQA 5JHHA 2L7RA 2M14A 1TZ1A 3NZSA 4HHVA 2JUOA 4NNJB 2KJ6A 4NAWB 2R2QA 1E8XA 2AL6A 3WYFB 5TR5A 3QA8A 4CHKA 2ROVA 4HWIB 1WG7A 3VFKA 3GYPA 4N9F4 1ISNA 2GBJA 1UEFA 3OANA 1XT9B 4LDTB 1OTRB 1U5EA 2CKHB 1UPQA 4IUMB 2NVUI 1WJ1A 2MRPA 2YS1A 2J0MA 2IY0B 3L0WB 1LQBA 4DHJB 3WANA 4KDIC 4YONA 2CR5A 4GOCA 2IO1B 5J3TA 2KFKB 3PREA 1WFYA 3N32A 4FBJB 1SGHA 4A3PA 3ODOA 3ZUNA 4I6LB 3DVNV 4EFOA 4EZKA 1GJZA 3PTFC 1WE7A 3LDZE 5JLJB 3OJ4B 2RGFA 2RNRB 3SO6A 1WM2A 5IA7A 3T8MA 4W9DA 2NBUA 2PE9A 3KH0A 3RZWC 2KGXB 2H7DA 3N30A 2J0KA 2ADZA 2KWCA 3PPAA 4KAXB 3NHEB 3B1LX 2L2IA 2WYQA 1WX9A 2K2UA 3O65B 4JGHB 4ANXA 2O6VA 3PVLA 1FGYA 2BWES 2KC2A 1Y8RC 2JZ3B 1FB8A 4GZUA 4KVGB 3PSCA 4TQ0A 3SHQA 4W9FA 2O2VA 5J3YA 3ZDMC 2H7EA 2K6DB 2MBOA 2DZMA 3AU5A 4AOFA 5C79A 1U27A 5DIFB 1OEYJ 1M94A 2IO2B 1P6SA 3QARA 3WAPA 2E2XA 2N4FA 2K00A 1N3HA 1DBHA 4GIVA 2N9EB 1W1DA 2CY4A 5E6OA 5L83A 2DYOA 3VTUA 2CHZA 3W1YA 3A98B 1Q1OA 2K1FA 4AJWA 3QJZA 4MJSB 3BY4B 2LVOA 4WJQA 5E6PA 3CMMB 2Z59B 5CLQB 3HHMA 2D9VA 1V5PA 1M7EA 2VRRB 2G45B 4M0WB 2V1YA 5KHOA 2MBQA 5AZHA 2P0FA 2GMIC 4MM3A 1V49A 2D07B 2X18A 2M1MA 5LOPB 4IWOA 1WZ0A 3AU4A 2KX3A 3H6NA 4F7UP 1WJUA 5J2RA 2AWTA 2NR2A 2FIFA 2ZPNA 3RCZA 3H7SA 5DHFB 3ZIMA 1RJ2A 2LWPA 2KQSA 2DFKA 2DAJA 2L0FA 1NTVA 4W9CA 2LASA 3WAMA 4URKA 2LGXA 5D3VA 4A5KA 1MPHA 4FLHA 3ZNHB 1QC6A 2L76A 2LKOA 1EGXA 1GUAB 5JH5C 2IZVB 1RFAA 5HE1A 1UNQA 2KDBA 3O96A 3VH3B 1ZVRA 2YVCA 1WMHB 3ZNID 2CY5A 3IG3A 4P7IA 4HAWB 2LXCA 4EOYA 2L3ZA 2HD5B 3VIAA 1LW3A 3W1SA 1V61A 1U5GA 3TVVA 2DYBA 3RULA 2MQJA 3ULCA 1WGQA 2L1CA 1WY8A 2BYVE 1V9JA 1KM7A 1P3RA 3PLVA 3A8PA 2ZVOA 3DPDA 2Y8GA 3UGBB 5KQ4A 4PS8A 1CMXB 1V5OA 5IAAC 4E71A 1YQBA 1G6JA 3CIKA 3SDLC 3DXCA 2K8CA 3CSFA 5C5BA 3Q3JA 3DVNU 1P9DU 3H9DA 4ASWC 4JQWC 2WWZA 2JP2A 2M8SA 3KYDD 1K5DB 1E7UA 4W9IA 2I1JA 1R4MI 1WR1A 2JRIB 3V61A 1X86A 1RLFA 2FCQA 2QKLA 2IYBA 1EAZA 2ZJDA 2ZVNA 4KSKC 1WGRA 1UPRA 3SU8X 4IAPA 3VTWA 1WI1A 1HE8A 2EC1A 3ENEA 2P0DA 4ANVA 1H8CA 1WI0A 1I35A 4YL8A 3A9KB 1F9JA 2MWSB 1ZGUB 2KDEB 2C60A 1V89A 3Q3FA 2NZ8B 1DDWA 1MAIA 1KJTA 4WJOA 2N1WA 2KTRA 1WXAA 2C7HA 3N7CA 3TIXA 5DPWA 1L2NA 2N0YA 4MDKE 2DHIA 3PT2B 1FHWA 2COCA 3M1IB 3A1QB 3WIMA 3ONSA 4M8MA 4HPLB 2R0DA 2GOWA 1UH6A 1MK7B 4NQKE 2RSGA 4F1SA 4GDLB 2KKCA 1ZM0A 1GG3A 2MWNB 3AULA 1SIFA 2COAA 1OMWA 2ZPYA 2HJ8A 3U7DA 1HB8A 1Y5OA 2LD9A 2OJRA 1WYWB 4FHJA 5AEKB 2MDXA 4L6EA 4GMXB 3L54A 1FXTB 3JVZX 1WR6E 5LXIB 3DBHI 4K81A 3PGEA 1PLSA 4OVVA 3APDA 3BINA 5FI0A 1M7RA 4C0AA 5C23A 4PS7A 1PFJA 2YT0A 4GB9A 4IG7B 3A9JB 1E8WA 3KSYA 3PLUA 3VUYA 4NY0A 2ZCCA 2BYEA 2K39A 1RRPB 2KDIA 3LJ3A 2HTHB 2W9NA 2A4ZA 2MSED 3OLMD 2LRUA 3EFUA 1ZSQA 4DBBA 1ZC3B 3RUIB 1P0RA 5HE0A 3HQCA 5C6RA 3D32A 1EUVB 1L7YA 3VHTC 2P8VA 3PVWA 1NDDA 1UZXB 4Z2MB 1U29A 1V6EA 3JSVA 1WIAA 4HLEA 3ZKJC 1C3TA 3KZ1A 4B6WA 3ZLZA 3H1UA 1EO6A 1EVHA 2D9ZA 5DI9B 1UELA 3CSTA 2MBEA 1WM3A 2MKRA 2QHOA 4DDID 2EJ8A 5CHWA 4BBNF 2W2XC 3RZFA 3KVFB 2FCSA 5L95C 4WWNA 4K2PA 1NBFC 4KZCA 1VCBA 4FJVB 2MA9B 2IO0B 1E8ZA 1FAOA 4HCPB 2UYZB 4PYZA 4ICUA 4NQLB 5D7GA 1UNRA 3QX1A 5D3YA 5HE3A 3AXCA 2FDQA 1Z2MA 2V3SA 3UQAA 3ZVRA 2AYOB 4BKSD 1JRUA 4IWQA 1ACAA 1UBQA 5HE2A 4GDKA 4G0NB 2J7QB 3EPYA 1X11A 3PG7A 2WX1A 3ML9A 4NSWA 3NSUA 3RYTA 2DA0A 4F8CB 3QK0A 4KHOA 2LBBA 1MKEA 3A8QA 2G4SA 4AJYB 2DENB 4BFRA 4GPTB 2UZRA 4HATB 1BTKA 5DPRA 2Z0QA 2BYFA 4G50A 2IY1B 2LVQA 4HK2A 2DZIA 1WF9A 2KWVB 3A4SC 4IOYX 3CXBB 5JHGA 1I7AA 2D3GA 3R7QA 4DDGD 1J0GA 3A4RA 2PZ1A 2KNBA 5D6JB 3JW0X 1W1HA 2CQUA 1UD7A 1MIZB 3H7PA 4D0NB 1X1FA 3PEGA 2KOXA 2PEAA 2J0JA 4W9KA 1WJ4A 3ZTDA 1KZGA 5FI1A 2ZCBA 3QIJA 5C16A 4XX5A 4BOSC 2UVMA 4ANUA 2RSUA 1V5MA 1VD2A 2I1KA 5G2NA 2L05A 1U5DA 1WX8A 1Q67A 3GYOA 5D94A 2KWUB 3QWMA 1RRBA 1WJ6A 4W9JA 4W9GA 1LXDA 2REXA 3PP2A 5CTRC 4GXBA 1U2BA 2C5LC 4BKSA 4F7HA 4HAZB 1WGYA 2OQBA 2M4NA 2YS3A 2JY6A 5EDSA 1Z87A 1WRDB 1RAXA 2KUPA 2KMCA 1E8YA 2MP2A 3VVWB 4MSQB 2HRJA 2DYMA 3DBSA 2B3AA 3KUDB 4HCNB 1GC7A 2RVBB 4K7SA 4HDOA 1NI2A 1SHCA 2RD0A 5JHBA 2KC1A 1SE9A 4MGKE 2D4QA 3ML8A 2J59M 3MHSD 4MT7A 4PNKA 3VUXA 5L81A 1WZ3A 2K25A 1OEYA 3TCAA 1WVHA 2Z0PA 2RR9A 4KIKA 2L00B 3VQIA 4FJYA 3VDZA 3DVGY 4A6HA 4TV3A 4HB2B 4EUTA 2YRYA 2M0XA 2DX5A 4DHJD 3QAQA 3TJPA 4H8SA 1UBIA 3NY5A 4EEWA 2IBIB 5JZEB 1FOEA 4ZYNA 2N9XA 2KO3A 2I5FA 2VRWB 1P98A 2LULA 2EMTA 5KQ1A 2BF8B 1WXVA 1V88A 2LYDA 2MFQA 2OTXA 2XK5A 5C1ZA 3M95A 2GBRA 1U4AA 1E90A 3NOBA 1IP9A 4GMVA 1DROA 3PZDA 4ANWA 3DDCB 1BT0A 3TO1A 2KDFB 3M3JA
chains in the Genus database with same CATH superfamily
3FSSA 2WGSA 3FP5A 4JKCA 3P63A 1QZEA 4X57B 3TL5A 4NJ6A 2O6VB 4YXDB 4XC2A 3H7PB 5J17A 1UNSA 2DKQA 1JWBD 3NVYA 4HAUB 1WXSA 1YMHE 4W9LA 1XKEA 1P1AA 3R8BA 1M4VA 2KT7A 1KF6B 2CU3A 2BTEA 4I6PA 2HE7A 1DYNA 3HRDD 4W9HA 3AJ4A 3WA0A 4QJ5B 3F5RA 1R4NB 3T3OA 2O2VB 3PHXB 1NYRA 3KW5B 2N7EA 3VRAB 1KLVA 1WYGA 3B9JA 2ONQA 3EECA 1WXMA 2J53A 1Q5WB 3BZDB 3MHZA 3Q8FA 2AL3A 3U30A 4HAYB 2C7NB 5HKHA 2ZNVC 3AM9A 4GN1A 2KJRA 2VKIA 2HTME 4HKZE 1L6UA 1MI1A 2GBKA 1I7HA 4LNFA 4NAWA 1LFDA 3E66A 2Y5PA 4LLGM 2KACA 4WWOA 4M8NA 3PHWB 2R2YA 4IM3A 3APCA 3ZNGC 1BAKA 1PQSA 3QHTA 3AI5A 2W2WA 1C77A 3CF6E 2NTSA 1FGZA 2OEDA 5DHAB 1ZP0B 1KZ7A 2GB1A 1J0WA 3V60A 1I2HA 3W1SC 4C7YA 1FMAD 4IC7B 4G11A 4LJOB 4BKGA 2DTCA 1UGMA 3Q3NC 2GCJA 1DYQA 1EU3A 3APFA 2CRFA 2IGHA 1C78A 1ST7A 2KFKA 1BXTA 2VH1A 3VUWA 4JLCA 1ROEA 4IDIA 3KRWA 2Z0OA 1NU2A 2MLBA 1TIFA 2V4LA 4MGZE 1XF5L 1EU4A 3MC0B 4DX90 3PRZA 1NVLA 4K7UA 4S0RA 1J7CA 1MIXA 1N62A 3B08A 3ABVB 2MBHA 1UF0A 4LNIA 4KHAA 4KGRA 4MM3B 3EHVA 3BYYB 4BZAA 1HQRD 3SV1A 4JPSA 4S17A 2ZW0A 1PDXA 2QJLA 4NJ7A 2AEHA 2MW5A 2EKEC 5D3IB 2GRIA 3HK0A 2RDGA 3PS6A 3DBRI 1ZW7A 3V62A 4JIOU 4K3CA 3ML4A 2GCLA 2Y7BA 3G9WA 3QWZB 4K2OA 3I57A 3LJUX 2WXLA 2YSZA 1XODA 3MTNB 3DBLI 5G5GA 1ZOYB 1P3QU 4WAAA 3QQ8B 1K51A 4L1RA 3IAS1 2OOBB 4XE0A 4JKGA 4IKGA 2WH5A 1EF5A 1JMLA 1OGWA 2DX1A 1FPYA 2BGFA 1I4PA 2DHKA 4JKFA 1KTKA 4CQNA 2WXGA 1DGJA 3PSEB 2DKPA 2PVOD 2ZNVB 3HW2B 2BWFA 3BWUD 1JWAD 3IFWB 4JKHA 4KGSA 4KZ0A 4GSWA 2NPTA 2KZRA 3MC8A 3VR9B 4KV2A 4LK0M 2Z0DB 3OWEB 3FVCA 3WAOA 4RGMA 1N61A 1AQCA 2RLOA 2LJ5A 3ZRCA 2G35A 2JWUA 3X0WA 3V6CB 3DQVA 4K1RB 5HG2A 4KDLB 3ZO5B 4CYEA 3EUB2 5D27A 3IVFA 3JYUA 2RRFA 4ZRJA 3UQBA 2WDTB 2ZKMX 3P7ZA 3RFZB 3R2IA 1K53A 5LNK1 1W1GA 4GLSC 1K5GB 1MG4A 1QKZA 3RCPA 4GGQA 5HI1A 5JP4A 1YX5B 4HRSA 3FEHA 3DCXA 2Z8LA 1I4HA 3PVUA 2M17A 2LOXA 2IPKD 5CX3A 2NMQA 4MGYE 1FIQA 1AWEA 1C4PA 1WGDA 1ZXHA 1UWXA 3DVGX 2OHFA 1MHHE 1BTNA 3ZNZB 2BB5A 5MPOA 3M62B 4MJSA 1EF1A 1X05A 2FJUB 4UDUC 4HB4B 4DHZB 2Z59A 2GUMA 2C9WB 1QQGA 3Q3OC 2C7MB 4WWPA 4RGOS 4M0WA 5CHFA 2JF5A 2BBCA 2CU1A 4DX8A 4HXDA 5C5BB 1QLBB 4EJNA 1C79A 4P6VF 3P2BA 2YLMA 4ZRKA 1WGKA 4DK5A 3OAWA 3PZ7A 3VXWA 2KWDA 2HJ1A 2KFJA 2BCJA 2LGDA 4W9EA 4YTPB 2Y8FA 4ARCA 1ZKHA 2DHZA 2GS0A 1KH0A 5IO9A 1PGAA 1N60A 4A6QA 3IBEA 1T0RC 3NZUA 2KR0A 3D8EA 4B95A 5LXHA 1F1HA 4J6IA 1AARA 2QEJC 4K17A 3T06A 1A5RA 4EE2A 1NTYA 2LG1A 1T6BX 2D2QA 3D8FA 1MHXA 2W55A 5BYSA 5GMVA 1FFVA 5DPSA 4MGIE 1B9RA 2R09A 3R3MA 1YN5A 4WJNA 1XD4A 1E5WA 1XCGA 3CIRB 3DHHC 2BW2A 1YD8U 2KQ7A 1MK9B 3MFGA 4NZLB 2ROZB 3RN9C 1T77A 5DPTA 4IM2A 1YIWA 1YOVB 4J3OD 2KTRB 1WMHA 2Z14A 2PJHA 3L08A 2XNAC 5D3XA 4PYUA 2JVCA 2BKFA 2DN6A 4WVFB 3K9OB 1GNUA 2BYTA 2FBWB 2H89B 3ZRFA 2BQQA 4ICVA 1MG8A 4NPNA 3ECIA 2ELBA 1FEHA 4MY6A 1Q0WB 3L16A 3U8ZA 4ZRQA 2GLSA 3R7RA 4IOIE 2KXJA 1SXTA 4WQOB 4RH6A 1JCKB 1GC6A 4A20A 2WXOA 1AN8A 1ET6A 4AWJA 2LI5A 3KUCB 1P7FA 2WXKA 2BT6A 2R61A 5M4YB 2FUHB 2JSVX 2FJ9A 5D3WA 4ZRIA 4MH0E 1JWSD 3DXDA 3OG5A 3F0WA 3FILB 4XGAB 1Z5SB 5BYRA 1J7AA 4YSYB 2VSZA 2DLWA 3VAWA 2MHJA 4DIXA 1K8RB 4US8A 2DYQA 3S2AA 1OFFA 3A33B 5G55A 2XN9C 3DWGC 4A3OA 2D9YA 4D2KA 4C4VB 4WIPA 4N6EB 2N9KA 4II2B 3MDBC 2INPE 1GPXA 1WE6A 2K3UA 2LZ6A 2EMSA 4MEMA 1J19A 4WSFA 2M19A 2JWZA 2L1AA 3DHGC 4TMAB 2WDVB 4FA6A 2FCMA 1I4GA 5J3QA 4NJCA 2YS5A 2WXRA 3IHPC 5D2MB 4FJZA 1KI1B 1DDVA 4CSQA 2CHXA 2NPTB 1WX7A 4RM8A 1YX6B 1ZPSA 2BVCA 1V2YA 1C1YB 2SEBD 4HPMB 1TGZB 4JKBA 4B9KA 2DZKA 2KHWB 3KY9A 5CLLB 4CHJA 2INNE 3RD2A 1ENFA 4PS3A 3RT3B 3NS1A 3D8DA 2GBNA 4HB0B 5LONB 1D3ZA 4A6KA 2M56B 4BKTA 4HAVB 4ARIA 2V76A 1TYGB 1YQ4B 4IWPA 3RNEC 4BVUC 3A9KA 5EFXA 3FM8C 2FJLA 3N20C 2D3CA 5IN7A 4DWFA 4JL9A 1VZ8A 4KSLC 2D11A 3JSVB 4FXCA 5AZGA 2RUKB 3SUZA 3NWDA 2LRWA 5J18A 2UZSA 2ZEQA 2JXXA 1F0ZA 2G9HD 3NS8A 3Q14C 5JVLA 3QBVB 4N59A 1FO4A 1XR0B 2PTLA 1OY2A 4GOUA 1FNUA 1WGHA 2IFSA 3A1QA 1RWSA 1XD3B 5AUIA 3PRMB 5IKCM 2N1VA 3HM3A 1HZ5A 1C4AA 1NTIA 2BS4B 1R4MB 4XWTA 3RNGC 4GDLA 4JK9A 2FCNA 2LUEA 3Q6BA 3ZVVA 2N7DA 3AB5A 4FULA 5T8IA 4RMAA 4HB3B 2PPHA 2V9HA 5AUKA 2MX2A 3KUZA 2K6QA 1V80A 2CHWA 4YT0B 2ABDA 1LO5D 2LVPA 2DLBA 2NS5A 3DHIC 3UZTA 2N0SB 4LDTD 2WDRB 2UWQA 2MJEA 4KGTA 2K8EA 2ZZPB 3BK2A 1ZXIA 3RMKC 5GOWB 3ZJVA 1H10A 4C00A 2K8BA 2VZKD 4WQMA 2INCC 4GU2A 1OQYA 2KVRA 1WH3A 2KTFA 2JPHA 3ZXRA 3DOWA 3NJTA 4GDKB 4WJPA 3SYXA 3IT4B 3LXFA 1H4RA 1L4DB 4JKAA 1E7VA 1IBXB 4LTUA 1PGXA 3KYCD 1V5TA 3NWAA 1PMSA 2GBMA 2YF0A 3DCGA 3U4EG 5KHQA 3NVVA 4EKUA 3ENBA 3A9JA 2D9XA 2N9PC 2FIDA 2LGYA 2LJIA 3U52E 1KOTA 3OHMB 2NCNA 4ZDVA 2YT1A 4KHBA 1QOBA 3V3XA 1IPGA 3TEZA 3UF8A 2JZPA 4RGTA 1TQZA 4BOZB 5IJMA 4M02A 2KLGA 4MK0A 5DH9B 1X1GA 1Y19B 4OZAA 1XCTL 2WXIA 3DXEA 2HTHA 4FN2A 2GJYA 2L8JA 1ACCA 2NBWB 1UGJA 3QC8B 4F7ZA 2P0HA 3M63B 5BMGA 2W2XD 2KK8A 1WXQA 3MPXA 2IJ0A 3GB1A 3V6EB 3SNHA 1XLQA 4WAFA 1TTNA 1FHOA 4AUQC 2CB8A 4OZBA 2LMCA 3TFMA 1CJEA 1NENB 3ZTCA 3OJ3A 3BJIA 5C2TB 1V86A 2DHJA 4HVBA 3DBHB 4I6NB 1I4QA 4LCDE 3B0AA 3B77A 2MBBB 1V5UA 4TQ1A 2KJHB 3GOEA 2LXAA 2KLCA 4HROA 3ULBA 1LM8B 3QCAA 2K8HA 1KFYB 1TXDA 2COPA 3R66C 3T9LA 2CODA 1WGUA 1TS2A 2R2OA 4QJ3B 2G4DB 4WJ7A 1J8CA 4FHKA 2D9WA 3ALBA 3HUIA 2XEWA 5E6NA 4IW0A 1TJ6A 2KD0A 4XZ4A 3AE3B 4A6FA 2PE6B 1ZC4B 1X1MA 3U12A 4A8XC 1B55A 4XWXA 1YJ1A 3GS2A 5EE0A 2CAYA 5FR6A 4PQ0A 5IOIA 2IO3B 4E74A 3E9LA 3RNFC 2KX0A 3E56A 2Q13A 4MELA 2QILA 4L23A 2RQ1A 1PUTA 2LOZA 4FADA 4H2AA 2KN4A 4A90A 1HBKA 5FKAC 1IYFA 3TEXA 1HB6A 3GZNI 3BYTB 4TUUA 4CO7A 3SBTA 3N9YC 3P6AA 2A5UA 3N3KB 3WALA 4OSNA 1FNWA 1JRPA 1P5TA 4HDQA 2WNMA 1I42A 2PMVA 2KANA 3HVZA 2G1EA 2JQRB 5BO4B 2OJWA 2I5CA 3C0RB 4Y94A 5TSSA 4IFSA 2DYNA 3VTVA 2M38A 4MSMB 4EZJA 1L5PA 4E3CA 1XX0A 1PFDA 3FLVA 4II3B 2QC8A 2QKMA 2MP2B 4LJPB 2G3QB 2B76B 3V5WA 3I3TB 5DCNA 3KRXA 3ZW3A 2COFA 2WX0A 2IYDB 3EC8A 1XQQA 4A55A 1UWMA 2CJOA 3TUOA 4EZLA 4M01A 2H88B 2JRHA 4K7WA 1PYWD 4K3BA 1KBLA 2K2JA 3ODXA 4DXAB 4HAXB 2DZJA 3PV1A 1WJMA 3UIOB 2NBVB 1TBEA 5JHAA 2CS4A 3L13A 2L0TA 2MCNB 3TMPB 4G3XB 1F2RC 3ZYYX 3KLSX 3HIZA 1FHXA 3RNCC 4RM9A 1T0YA 2ELAA 1UNPA 1D5MC 4HSIA 3MC9A 4KIKB 3U2SC 4TYZA 3L10B 3WCQA 4C56C 1BWNA 1U5FA 1V81A 3AV8A 5HFYA 4YTMB 2NMBA 1TJEA 3IT6B 2BKRB 1BUIC 2DX5B 2Y5BB 1OQNA 3UIPB 4ZYSA 4REZA 4Z2NA 2KN5A 2RGNB 2D10A 3K9PB 3ODWA 1FXAA 2ASQA 2KMAA 2IGDA 4A9AA 4BBKA 2WS3B 3AE8B 1WGGA 3AEGB 1HZ6A 2KCJA 2XQNM 3ZDTA 1DOXA 3SFEB 4D6WA 3L17A 4AP4C 1P7EA 1TT5B 2JZZA 4JWUC 1R4NI 2INDC 3W5UB 4F7GA 5LLIA 3Q8BA 4KHBB 1C4CA 3UINB 2XK5B 2DAFA 1JWMD 1JROA 2CJNA 1IRSA 1KLUD 1JWUD 5KCVA 3MJWA 2DBYA 3SD5A 4DHZE 1YN4A 1ESFA 1L4ZB 2EKIA 2NTTA 1S1QB 2FAZA 3VH4B 3N1ZC 2WHIA 2FNJB 4EMOA 2BPSA 1ZE3D 2O6VD 5CHVC 2XBBC 3HM6X 4BBNC 2KYWA 1VJKA 3P42A 3AE5B 4AQ7A 1NEKB 2WXFA 1QOGA 2EELA 5D3DA 2Z0EB 5AZFA 3H8HA 4IM0A 1MJDA 3Q8EA 4OVUA 4DBGA 4HJKA 4CHMA 3PRPB 4B6HA 1WRIA 4P1BC 3FC4A 4TKNA 1CZPA 4JKEA 1LB1A 2JT4B 3X23A 3TBLD 1S3SG 3TW1A 1WJNA 1DDMA 1D5ZC 4A6FB 1TY2A 2N23A 1VRAB 2V0GA 1TKGA 3VOQA 2RPQA 5JHHA 2L7RA 1E6EB 2M14A 1TZ1A 3AEAB 3NZSA 1FNVA 3AN1A 4HHVA 1XEEA 2JUOA 4NNJB 2HDEA 2J4XA 2KJ6A 2L52A 5IP4D 1I4RA 4NAWB 1YJJA 2R2QA 1E8XA 2AL6A 4XYCA 1FD6A 3WYFB 5TR5A 1RFKA 3QA8A 3VR8B 4CHKA 2ROVA 4HWIB 1WG7A 3LYYA 3VFKA 3GYPA 4N9F4 1KLGD 1ISNA 2GBJA 3P4RB 4HEA1 4KX6B 2KAJA 3VRBB 3Q8AA 1UEFA 3OANA 1XT9B 4LDTB 1OTRB 1U5EA 2CKHB 4WURA 1UPQA 4IUMB 2NVUI 1WJ1A 2MRPA 2YS1A 2J0MA 2IY0B 3L0WB 1LQBA 4DHJB 3WANA 3ETRA 4KDIC 1VBHA 4YONA 1N6ZA 2CR5A 4GOCA 2IO1B 1YNTE 2QDFA 3P4PB 5J3TA 2KFKB 3PREA 1WFYA 3N32A 4FBJB 1SGHA 2RPVA 4A3PA 4HJGE 3ODOA 3ZUNA 4I6LB 3DVNV 4EFOA 4EZKA 1GJZA 3PTFC 1WE7A 3LDZE 1V1PA 5JLJB 3OJ4B 3Q8CA 2RGFA 2RNRB 3SO6A 1WM2A 5IA7A 3RPFC 4RGNA 4USAA 3T8MA 4W9DA 2NBUA 2PE9A 3KH0A 3RZWC 2KGXB 2H7DA 3N30A 2J0KA 2ADZA 2KWCA 3PPAA 4ACFA 3AE2B 4KAXB 3NHEB 3B1LX 2L2IA 2WYQA 1WX9A 3P4SB 2K2UA 3O65B 4JGHB 4JKGB 4ANXA 1VBGA 2O6VA 1N5WA 1XO3A 3PVLA 3PO0A 1FGYA 3KWVA 2BWES 2KC2A 1AW7A 1Y8RC 3Q3MC 4OHJA 2JZ3B 1FB8A 2W3SA 1XLNA 1DOYA 2L32A 4GZUA 2R82A 4KVGB 1B1ZA 2RMMA 1DIKA 2WXQA 2JX5A 2WXPA 4L2YA 3PSCA 1N5XA 4TQ0A 2QSDA 3SHQA 4W9FA 3W5VB 2Y5CA 1T0QC 2O2VA 5J3YA 5JXVA 3ZDMC 1GOZA 2I38A 2H7EA 2K6DB 1TS3A 2KUQA 2MBOA 1V1OA 1RM6C 2DZMA 5G5HA 3AU5A 2ZW1A 4QAYA 4JK7A 3A58A 4AOFA 2V4IB 2Z13A 4OT1A 5C79A 1U27A 5DIFB 1OEYJ 1M94A 2LHDA 2WXHA 2IO2B 1E10A 1P6SA 3QARA 3WAPA 2YEPF 2E2XA 2N4FA 2K00A 1N3HA 2BS2B 1DBHA 4GIVA 3NVZA 2N9EB 1W1DA 5I2SA 2CY4A 3ZJTA 5E6OA 5L83A 2DYOA 1NYQA 3VTUA 2CHZA 2AX5A 4DXGA 3W1YA 4PT5A 3A98B 1Y56A 4AS1A 1Q1OA 2K1FA 4AJWA 3QJZA 2PLPA 4MJSB 1MPEA 3BY4B 2LVOA 4WJQA 5E6PA 1FM0D 1HA5A 3CMMB 1ZYIA 2ICIA 2Z59B 5CLQB 2PW9A 3HHMA 2D9VA 1V5PA 2LFIA 1JDEA 3AEBB 1M7EA 2VRRB 3R2TA 1CK1A 2G45B 1V8CA 4M0WB 2V1YA 4KKIA 5KHOA 2MBQA 5AZHA 2FE8A 2P0FA 2GMIC 4MM3A 1V49A 2D07B 2E3TA 2X18A 2M1MA 5LOPB 2FUG1 4IWOA 1WZ0A 3AEDB 3AU4A 2KX3A 5BMHA 3H6NA 1HTOA 4F7UP 1WJUA 5J2RA 2AWTA 2NR2A 3BVZA 4RF1A 2FIFA 2ZPNA 3RCZA 3H7SA 5DHFB 1Q10A 3ZIMA 3TEYA 1RJ2A 1TZOA 2WQYB 2LWPA 2KQSA 2DFKA 2YT2A 1IGDA 2LUMA 4C80A 2DAJA 2L0FA 1NTVA 4W9CA 2LASA 3WAMA 3Q69A 2K9XA 2LGXA 1PGBA 2ON8A 5D3VA 4URKA 4A5KA 1MPHA 4FLHA 3ZNHB 2WP9B 2D3BA 1QC6A 2L76A 2LGSA 1F52A 4OW0A 2LKOA 1EGXA 1GUAB 5JH5C 2IZVB 1RFAA 5HE1A 1UNQA 1CQVA 2MH7A 2DIKA 4L1BA 1XLPA 4ILGB 2MEKA 3J9CA 3U7ZA 2KDBA 3O96A 4WWMA 2KQ4X 3VH3B 1ZVRA 2PIAA 2YVCA 4JK8A 1WMHB 3ZNID 4LNNA 2CY5A 3IG3A 4P7IA 4HAWB 1KRHA 5EE3A 3NRZA 3BK1A 2LXCA 4EOYA 2LHEA 5EE1A 2L3ZA 2HD5B 3VIAA 3DBRB 1LW3A 3W1SA 1V61A 1K52A 4RFBA 1U5GA 3TVVA 2DYBA 5LG4B 4ZRPA 2QCZA 3RULA 2MQJA 4BAXA 3W2DA 3ULCA 1WGQA 3DBLB 1MI0A 2L1CA 1WY8A 2BYVE 1L6VA 1V9JA 1KM7A 1P3RA 3PZ8A 3PLVA 3AE6B 3A8PA 4ITKA 3V05A 2ZVOA 3DPDA 2Y8GA 2UU7A 2VH2A 3UGBB 1XLOA 5KQ4A 3E9SA 2I2YA 4PS8A 1CMXB 1V5OA 5IAAC 1N63A 1EWCA 4QJ4B 4E71A 1YQBA 1G6JA 4JKDA 5I2MA 2DWQA 3CIKA 1K50A 3SDLC 3DXCA 2K8CA 4TSSA 3CSFA 5C5BA 3Q3JA 3DVNU 1LGRA 1P9DU 3H9DA 2WXNA 1C76A 4ASWC 3MP9A 1GAQB 1TS5A 4JQWC 2WWZA 4C7ZA 1ZUD2 2JP2A 1QILA 2M8SA 3KYDD 1K5DB 1E7UA 4W9IA 3P1MA 2I1JA 4R3DA 1R4MI 1WR1A 3ZGZA 2JRIB 3V61A 1X86A 3FAHA 1RLFA 3AEEB 2FCQA 2QKLA 2IYBA 1EAZA 2MJDA 2ZJDA 1TS4A 1VR9A 1IGCA 2ZVNA 4KSKC 1WGRA 1UPRA 3SU8X 4IAPA 3VTWA 1WI1A 2LEKA 1HTQA 1HE8A 2EC1A 3BVMA 3ENEA 1GB4A 3EFCA 4ILHA 2P0DA 4ANVA 1H8CA 1WI0A 1QT9A 4JWSC 1I35A 4YL8A 3A9KB 1F9JA 1L0VB 2MWSB 2RDHA 1ZGUB 2KDEB 2C60A 1V89A 2PVGC 1GB1A 3Q3FA 2NZ8B 4YWGG 1DDWA 1MAIA 1KJTA 4WJOA 4XDCA 2N1WA 2KTRA 1SJHD 1WXAA 2C7HA 3N7CA 3TIXA 5DPWA 1L2NA 4LNOA 2N0YA 2QMTA 3I63C 4MDKE 4Q2JA 2DHIA 1FCCC 3AE1B 3PT2B 1E9MA 2GI9A 1FHWA 2COCA 3M1IB 4N58A 3A1QB 3WIMA 3ONSA 4M8MA 4HPLB 2R0DA 2GOWA 1UH6A 1VDVA 1MK7B 3AECB 4NQKE 2RSGA 4ZHOA 4MH8A 1HXYD 4F1SA 4GDLB 4OZCA 4B0EA 2KKCA 3Q2AC 2X8XX 1KC7A 1ZM0A 2W3RA 1GG3A 2D5GA 2MWNB 3AULA 3FILA 1SIFA 3L4PA 2WXJA 3NG0A 2COAA 1OMWA 2ZPYA 2HJ8A 3U7DA 1HB8A 1Y5OA 2LD9A 2OJRA 1WYWB 4FHJA 5AEKB 3ZQ4A 2MDXA 4L6EA 4GMXB 4C4VA 1F77A 3L54A 1FXTB 1L0XB 1WR6E 3JVZX 5LXIB 3DBHI 1L0YB 4LNKA 3NW8A 2PKOA 4K81A 3RNAC 3AH7A 1OQQA 3PGEA 1PLSA 4OVVA 3APDA 4DQOC 3BINA 5FI0A 1M7RA 4C0AA 5C23A 1UUPA 4PS7A 1PFJA 4P1CC 2YT0A 4GB9A 4IG7B 2K22A 3A9JB 1E8WA 3KSYA 4QXAB 3PLUA 3VUYA 4NY0A 2ZCCA 3IAM1 2RDBC 2BS3B 1QOFA 2IDYA 2KIGA 2BYEA 2K39A 1RRPB 2KDIA 3HSAA 4RNAA 3LJ3A 1T5XD 3N1YC 4RF0A 2HTHB 2W9NA 2L83A 1ZDXA 2Z4DA 2A4ZA 1WSPA 1SE3A 2MSED 1T0SC 3OLMD 2LRUA 3LB8C 4KKJA 3EFUA 1ZSQA 4DBBA 1ZC3B 3RUIB 1SBBB 3FKYA 1P0RA 2E6XA 5HE0A 3HQCA 5C6RA 3D32A 1EUVB 1L7YA 3VHTC 2P8VA 3PVWA 1NDDA 1AWDA 5I4DA 1UZXB 3B2FA 1A70A 1MVKA 3SFDB 4Z2MB 1U29A 1V6EA 3JSVA 1WIAA 2WU5B 4ILJA 4HLEA 3ZKJC 1C3TA 3KZ1A 4B6WA 3CWIA 2AQ2B 3H1UA 3ZLZA 3T3NA 1EO6A 2MJ3A 1EVHA 2D9ZA 2K0PA 5DI9B 1UELA 3CSTA 2MBEA 1WM3A 2MKRA 2QHOA 1ZDVA 4DDID 2EJ8A 5CHWA 4BBNF 2V3PA 2W2XC 1YN3A 3RZFA 1D4BA 3KVFB 2FCSA 5L95C 4WWNA 4K2PA 5C3JB 1NBFC 4KZCA 1EM7A 1QOAA 2Q5WD 4RCOA 1NVID 1VCBA 4FJVB 2MA9B 2IO0B 2WXMA 1VLBA 1FRRA 3AMZA 1E8ZA 1XCQL 1FAOA 1BMLC 1SIJA 2UYZB 4HCPB 4JE3B 4MACA 4ZOHC 4PYZA 1SE4A 4ICUA 4NQLB 5D7GA 1UNRA 5IRSA 4HPPA 3QX1A 5D3YA 5HE3A 3AXCA 2FDQA 2TSSA 1Z2MA 1D5XC 2V3SA 4YSZB 3UQAA 1NI3A 3ZVRA 2AYOB 4BKSD 1JRUA 2JXTA 4IWQA 1OQRA 1ACAA 1UBQA 5HE2A 1ET9A 3I5JC 3TSSA 4GDKA 1IUEA 1SF0A 4G0NB 2J7QB 3EGRA 1FXIA 3EPYA 1X11A 5H8YE 3AE9B 3SR6A 3PG7A 1XXGA 1IBXA 2WX1A 3ML9A 4NSWA 3NSUA 2VZKB 5BYQA 3RYTA 2DA0A 2K5PA 4F8CB 3QK0A 4KHOA 3MJ5A 2IGGA 2N9LA 2Y3AA 2LBBA 1MKEA 3A8QA 4OVZA 2G4SA 4AJYB 2DENB 4BFRA 4GPTB 2J42A 2UZRA 1SE2A 4HATB 1BTKA 1QF6A 5DPRA 1VZ6A 2Z0QA 2BYFA 1I4XA 4G50A 2IY1B 2LVQA 1SSNA 5HHDG 4HK2A 3I9V1 3BVGA 1JALA 2DZIA 1WF9A 1WWTA 2KWVB 3A4SC 4IOYX 3CXBB 5JHGA 1I7AA 2D3GA 5H92C 3R7QA 4DDGD 1J0GA 3A4RA 2PZ1A 3C19A 2KNBA 3NZ3A 1DOIA 5D6JB 3JW0X 1SB3C 1GGOA 2BB6A 1W1HA 1D6EC 1MFWA 2CQUA 1UD7A 1MIZB 3H7PA 4D0NB 3AE4B 1X1FA 3PEGA 2KOXA 2PEAA 3B2GA 2J0JA 3C8YA 4W9KA 3RI7C 1WJ4A 1V97A 2KMMA 3ZTDA 1KZGA 2K49A 4PK1A 1EWYC 3NWFA 5FI1A 3NUHB 4B0MA 2ZCBA 2WDQB 3QIJA 1F2RI 4XWWA 1JW9D 3W9CB 3E9OA 5C16A 4HKQA 4GNKB 2KVZA 4XX5A 4BOSC 2UVMA 4ANUA 2RSUA 3GE3C 1V5MA 1VD2A 2DNFA 3GP7A 2I1KA 1SJED 5G2NA 3P4QB 2L05A 1U5DA 1WX8A 2W54A 5E6JA 1Q67A 3GYOA 5D94A 2KWUB 4DXFA 3QWMA 1RRBA 3SEBA 2J52A 5EE9A 1WJ6A 1AYFA 5FR3A 4W9JA 4W9GA 2N7JA 1SEBD 1LXDA 2REXA 1E7PB 3PP2A 1R7SA 1RYJA 1J7BA 5CTRC 4GXBA 1U2BA 2SAKA 2C5LC 4BKSA 4F7HA 4HAZB 3URYA 4P16A 1WGYA 2V3NA 2OQBA 2M4NA 2YS3A 1C9FA 2JY6A 3AEFB 5EDSA 1Z87A 1WRDB 4NAMA 1RAXA 2KUPA 2KMCA 1E8YA 4XDDA 2MP2A 3VVWB 4MSQB 2HRJA 2DYMA 1TKEA 3DBSA 2B3AA 3KUDB 4HCNB 1GC7A 4YSXB 2RVBB 4K7SA 4JX1C 4HDOA 1NI2A 1SHCA 3DWMA 2RD0A 3ZJUA 5JHBA 2KC1A 1SE9A 4MGKE 2NBVA 1FCLA 2D4QA 2LGIA 3ML8A 2J59M 3MHSD 1HEZE 3GZNB 5BMIA 4MT7A 4PNKA 3N1XC 3VUXA 5L81A 1WZ3A 2K25A 1OEYA 4WH4A 3TCAA 1WVHA 2Z0PA 2RR9A 4KIKA 2L00B 3VQIA 4M00A 2QIEB 4FJYA 3VDZA 3DVGY 2WU2B 4O1NA 1VZ7A 4A6HA 4TV3A 4HB2B 4EUTA 3RNBC 2YRYA 1FRDA 2ACZB 2M0XA 2JYEA 2DX5A 4DHJD 3QAQA 3TJPA 3TEWA 2X0SA 1TY0A 4ZHPA 2YEPB 4H8SA 1UBIA 3NY5A 4EEWA 3HIEA 3AE7B 1QQRA 2IBIB 5JZEB 1FOEA 4ZYNA 2N9XA 1JQ4A 1T3QA 2AQ3B 2KO3A 2I5FA 2VRWB 1P98A 2X38A 4US9A 2LULA 5FK9C 2EMTA 4MT5A 5GXGB 5KQ1A 2BF8B 1WXVA 1STEA 2JYTA 3ZXVA 1V88A 2WLBA 2LYDA 3NVWA 2MFQA 3BIID 1E0ZA 2OTXA 2AQ1B 2XK5A 5C1ZA 2KIEA 3KWLA 3UI3A 3M95A 1YJIA 2GBRA 1U4AA 2KDMA 3GE8C 1E90A 2M0AA 3O13A 1V1PB 3KQ4A 3NOBA 1IP9A 4GMVA 1TKYA 2JU6X 3E9PA 3IXSA 3EA6A 1DROA 1FFUA 1YQ3B 3PZDA 4ANWA 3SBGA 3DDCB 1BT0A 4YTNB 3TO1A 2KDFB 3HVDA 3M3JA 2W82A 2D3AA
chains in the Genus database with same CATH topology
3FSSA 3FP5A 4JKCA 1QZEA 4X57B 3TL5A 4NJ6A 2O6VB 4XC2A 3H7PB 5J17A 2DKQA 4HAUB 1WXSA 4W9LA 1XKEA 1P1AA 4I6PA 2HE7A 1DYNA 4W9HA 3AJ4A 3WA0A 3F5RA 2O2VB 3PHXB 3KW5B 2N7EA 1KLVA 3EECA 1WXMA 1Q5WB 2AL3A 3U30A 4HAYB 2C7NB 5HKHA 2ZNVC 4GN1A 2KJRA 2VKIA 2GBKA 4NAWA 1LFDA 3E66A 4WWOA 4M8NA 3PHWB 4IM3A 3APCA 3ZNGC 1BAKA 1PQSA 3QHTA 3AI5A 2W2WA 3CF6E 1FGZA 5DHAB 1KZ7A 1J0WA 3V60A 1I2HA 3W1SC 4IC7B 4G11A 4LJOB 4BKGA 2DTCA 1UGMA 2GCJA 3APFA 2CRFA 1ST7A 2KFKA 3VUWA 4JLCA 3KRWA 2Z0OA 1NU2A 2MLBA 2V4LA 4MGZE 4DX90 3PRZA 1NVLA 4K7UA 1MIXA 3B08A 2MBHA 4KHAA 3EHVA 3SV1A 4NJ7A 2AEHA 2MW5A 2EKEC 3HK0A 3PS6A 3DBRI 1ZW7A 3V62A 4JIOU 3ML4A 2GCLA 2Y7BA 3G9WA 3QWZB 4K2OA 3LJUX 2YSZA 1XODA 3MTNB 3DBLI 1P3QU 4WAAA 3QQ8B 2OOBB 4JKGA 2WH5A 1EF5A 1OGWA 2DX1A 2BGFA 2DHKA 4JKFA 3PSEB 2DKPA 2ZNVB 3HW2B 2BWFA 3IFWB 4JKHA 4KZ0A 4GSWA 2NPTA 2KZRA 4KV2A 2Z0DB 3WAOA 1AQCA 2RLOA 2LJ5A 3ZRCA 2G35A 3X0WA 3V6CB 3DQVA 4K1RB 4KDLB 3ZO5B 4CYEA 5D27A 3IVFA 3JYUA 4ZRJA 3UQBA 2WDTB 3P7ZA 1W1GA 1K5GB 3RCPA 4GGQA 5JP4A 1YX5B 3FEHA 2M17A 3PVUA 2LOXA 5CX3A 4MGYE 1WGDA 1AWEA 3DVGX 1BTNA 3ZNZB 3M62B 4MJSA 1EF1A 1X05A 4HB4B 4DHZB 2C9WB 1QQGA 2C7MB 4WWPA 5CHFA 2JF5A 2CU1A 4DX8A 4HXDA 5C5BB 4EJNA 3P2BA 2YLMA 4ZRKA 4DK5A 3OAWA 3VXWA 2KFJA 2BCJA 2LGDA 4W9EA 2Y8FA 1ZKHA 2DHZA 2GS0A 3IBEA 3NZUA 3D8EA 4B95A 5LXHA 4J6IA 1AARA 4K17A 3T06A 1A5RA 1NTYA 2LG1A 2D2QA 3D8FA 5GMVA 5DPSA 4MGIE 2R09A 3R3MA 4WJNA 1XD4A 1E5WA 1XCGA 1YD8U 2KQ7A 1MK9B 2ROZB 5DPTA 4IM2A 1YIWA 2KTRB 1WMHA 2PJHA 3L08A 5D3XA 4PYUA 2JVCA 2BKFA 2DN6A 4WVFB 3K9OB 1GNUA 3ZRFA 4ICVA 1MG8A 4NPNA 3ECIA 2ELBA 4MY6A 1Q0WB 3L16A 3U8ZA 3R7RA 2KXJA 4WQOB 4A20A 1GC6A 4AWJA 2LI5A 3KUCB 2FUHB 2FJ9A 5D3WA 4ZRIA 4MH0E 3DXDA 3F0WA 1Z5SB 2VSZA 2DLWA 3VAWA 1K8RB 2DYQA 3S2AA 3A33B 5G55A 4A3OA 2D9YA 4II2B 3MDBC 1WE6A 2LZ6A 2EMSA 4MEMA 1J19A 4WSFA 2JWZA 4FA6A 2FCMA 5J3QA 2YS5A 3IHPC 5D2MB 4FJZA 1KI1B 1DDVA 2CHXA 2NPTB 1WX7A 4RM8A 1YX6B 1V2YA 1C1YB 4HPMB 1TGZB 4JKBA 4B9KA 2DZKA 2KHWB 3KY9A 5CLLB 4CHJA 3RD2A 4PS3A 3RT3B 3D8DA 2GBNA 4HB0B 5LONB 1D3ZA 4A6KA 4BKTA 4HAVB 2V76A 4IWPA 4BVUC 3A9KA 5EFXA 3FM8C 2FJLA 4DWFA 4JL9A 4KSLC 2D11A 3JSVB 5AZGA 2RUKB 3SUZA 2LRWA 5J18A 2UZSA 2ZEQA 2JXXA 3NS8A 5JVLA 3QBVB 1XR0B 1OY2A 1WGHA 2IFSA 3A1QA 1XD3B 3PRMB 2N1VA 3HM3A 1NTIA 4GDLA 4JK9A 2FCNA 2LUEA 3ZVVA 2N7DA 4FULA 4RMAA 4HB3B 2PPHA 2MX2A 3KUZA 2K6QA 1V80A 2CHWA 2ABDA 2LVPA 2NS5A 3UZTA 4LDTD 2UWQA 2ZZPB 5GOWB 1H10A 2K8BA 4GU2A 1OQYA 2KVRA 1WH3A 2KTFA 2JPHA 3DOWA 4GDKB 4WJPA 3SYXA 1H4RA 4JKAA 1E7VA 3KYCD 1V5TA 1PMSA 2GBMA 2YF0A 3DCGA 5KHQA 4EKUA 3ENBA 3A9JA 2D9XA 2N9PC 2FIDA 2LGYA 1KOTA 2NCNA 4ZDVA 2YT1A 1IPGA 3UF8A 1TQZA 4BOZB 5IJMA 2KLGA 4MK0A 5DH9B 1X1GA 1Y19B 3DXEA 2HTHA 4FN2A 2GJYA 2L8JA 2NBWB 3QC8B 4F7ZA 2P0HA 3M63B 2W2XD 2KK8A 3MPXA 3V6EB 3SNHA 1TTNA 1FHOA 4AUQC 2CB8A 3TFMA 3ZTCA 3OJ3A 3BJIA 1V86A 2DHJA 4HVBA 4I6NB 4LCDE 3B0AA 2MBBB 1V5UA 4TQ1A 2KJHB 3GOEA 2LXAA 2KLCA 3ULBA 1LM8B 3QCAA 2K8HA 1TXDA 2COPA 3R66C 3T9LA 2CODA 1WGUA 2R2OA 2G4DB 4WJ7A 1J8CA 4FHKA 2D9WA 3ALBA 2XEWA 5E6NA 4IW0A 1TJ6A 2KD0A 4XZ4A 4A6FA 2PE6B 1ZC4B 1X1MA 1B55A 4XWXA 1YJ1A 2CAYA 5FR6A 4PQ0A 2IO3B 4E74A 3E9LA 2KX0A 2Q13A 4MELA 2RQ1A 2LOZA 4FADA 1HBKA 1IYFA 1HB6A 3GZNI 4TUUA 4CO7A 3SBTA 3P6AA 2A5UA 3N3KB 3WALA 1P5TA 4HDQA 1I42A 2KANA 5BO4B 2I5CA 3C0RB 4Y94A 4IFSA 2DYNA 3VTVA 2M38A 4MSMB 4EZJA 4E3CA 1XX0A 3FLVA 4II3B 2QKMA 2MP2B 4LJPB 2G3QB 3V5WA 3I3TB 5DCNA 3KRXA 3ZW3A 2COFA 2WX0A 2IYDB 3EC8A 1XQQA 4EZLA 2JRHA 4K7WA 1KBLA 2K2JA 3ODXA 4DXAB 4HAXB 2DZJA 3PV1A 1WJMA 3UIOB 2NBVB 1TBEA 5JHAA 2CS4A 3L13A 2L0TA 2MCNB 3TMPB 4G3XB 3HIZA 1FHXA 4RM9A 1T0YA 2ELAA 1UNPA 4KIKB 4TYZA 3L10B 1BWNA 1U5FA 1V81A 2NMBA 2BKRB 2DX5B 2Y5BB 1OQNA 3UIPB 4Z2NA 2KN5A 2RGNB 2D10A 3K9PB 3ODWA 2ASQA 2KMAA 4BBKA 1WGGA 2KCJA 2XQNM 3ZDTA 3L17A 4AP4C 2JZZA 1R4NI 4F7GA 5LLIA 4KHBB 3UINB 2XK5B 2DAFA 1IRSA 5KCVA 3MJWA 3SD5A 4DHZE 1S1QB 2FAZA 3VH4B 2FNJB 4EMOA 2BPSA 2O6VD 5CHVC 2XBBC 3HM6X 4BBNC 2Z0EB 5AZFA 4IM0A 4OVUA 4DBGA 4HJKA 4CHMA 3PRPB 4B6HA 4TKNA 4JKEA 1LB1A 2JT4B 3X23A 3TBLD 1S3SG 3TW1A 1WJNA 1DDMA 4A6FB 2N23A 3VOQA 2RPQA 5JHHA 2L7RA 2M14A 1TZ1A 3NZSA 4HHVA 2JUOA 4NNJB 2KJ6A 4NAWB 2R2QA 1E8XA 2AL6A 3WYFB 5TR5A 3QA8A 4CHKA 2ROVA 4HWIB 1WG7A 3VFKA 3GYPA 4N9F4 1ISNA 2GBJA 1UEFA 3OANA 1XT9B 4LDTB 1OTRB 1U5EA 2CKHB 1UPQA 4IUMB 2NVUI 1WJ1A 2MRPA 2YS1A 2J0MA 2IY0B 3L0WB 1LQBA 4DHJB 3WANA 4KDIC 1VBHA 4YONA 2CR5A 4GOCA 2IO1B 5J3TA 2KFKB 3PREA 1WFYA 3N32A 4FBJB 1SGHA 4A3PA 3ODOA 3ZUNA 4I6LB 3DVNV 4EFOA 4EZKA 1GJZA 3PTFC 1WE7A 3LDZE 5JLJB 3OJ4B 2RGFA 2RNRB 3SO6A 1WM2A 5IA7A 3T8MA 4W9DA 2NBUA 2PE9A 3KH0A 3RZWC 2KGXB 2H7DA 3N30A 2J0KA 2ADZA 2KWCA 3PPAA 4KAXB 3NHEB 3B1LX 2L2IA 2WYQA 1WX9A 2K2UA 3O65B 4JGHB 4JKGB 4ANXA 1VBGA 2O6VA 3PVLA 1FGYA 2BWES 2KC2A 1Y8RC 2JZ3B 1FB8A 4GZUA 2R82A 4KVGB 1DIKA 3PSCA 4TQ0A 3SHQA 4W9FA 2O2VA 5J3YA 3ZDMC 2H7EA 2K6DB 2MBOA 2DZMA 3AU5A 4JK7A 4AOFA 5C79A 1U27A 5DIFB 1OEYJ 1M94A 2IO2B 1P6SA 3QARA 3WAPA 2E2XA 2N4FA 2K00A 1N3HA 1DBHA 4GIVA 2N9EB 1W1DA 2CY4A 5E6OA 5L83A 2DYOA 3VTUA 2CHZA 3W1YA 3A98B 1Q1OA 2K1FA 4AJWA 3QJZA 4MJSB 3BY4B 2LVOA 4WJQA 5E6PA 3CMMB 2Z59B 5CLQB 3HHMA 2D9VA 1V5PA 1JDEA 1M7EA 2VRRB 2G45B 4M0WB 2V1YA 5KHOA 2MBQA 5AZHA 2P0FA 2GMIC 4MM3A 1V49A 2D07B 2X18A 2M1MA 5LOPB 4IWOA 1WZ0A 3AU4A 2KX3A 3H6NA 4F7UP 1WJUA 5J2RA 2AWTA 2NR2A 2FIFA 2ZPNA 3RCZA 3H7SA 5DHFB 3ZIMA 1RJ2A 2LWPA 2KQSA 2DFKA 2DAJA 2L0FA 1NTVA 4W9CA 2LASA 3WAMA 4URKA 2LGXA 5D3VA 4A5KA 1MPHA 4FLHA 3ZNHB 1QC6A 2L76A 2LKOA 1EGXA 1GUAB 5JH5C 2IZVB 1RFAA 5HE1A 1UNQA 2DIKA 4ILGB 2KDBA 3O96A 3VH3B 1ZVRA 2YVCA 4JK8A 1WMHB 3ZNID 2CY5A 3IG3A 4P7IA 4HAWB 2LXCA 4EOYA 2L3ZA 2HD5B 3VIAA 1LW3A 3W1SA 1V61A 1U5GA 3TVVA 2DYBA 3RULA 2MQJA 3ULCA 1WGQA 2L1CA 1WY8A 2BYVE 1V9JA 1KM7A 1P3RA 3PLVA 3A8PA 2ZVOA 3DPDA 2Y8GA 3UGBB 5KQ4A 4PS8A 1CMXB 1V5OA 5IAAC 4E71A 1YQBA 1G6JA 4JKDA 3CIKA 3SDLC 3DXCA 2K8CA 3CSFA 5C5BA 3Q3JA 3DVNU 1P9DU 3H9DA 4ASWC 4JQWC 2WWZA 2JP2A 2M8SA 3KYDD 1K5DB 1E7UA 4W9IA 2I1JA 1R4MI 1WR1A 2JRIB 3V61A 1X86A 1RLFA 2FCQA 2QKLA 2IYBA 1EAZA 2ZJDA 2ZVNA 4KSKC 1WGRA 1UPRA 3SU8X 4IAPA 3VTWA 1WI1A 1HE8A 2EC1A 3ENEA 4ILHA 2P0DA 4ANVA 1H8CA 1WI0A 1I35A 4YL8A 3A9KB 1F9JA 2MWSB 1ZGUB 2KDEB 2C60A 1V89A 3Q3FA 2NZ8B 1DDWA 1MAIA 1KJTA 4WJOA 2N1WA 2KTRA 1WXAA 2C7HA 3N7CA 3TIXA 5DPWA 1L2NA 2N0YA 4MDKE 2DHIA 3PT2B 1FHWA 2COCA 3M1IB 3A1QB 3WIMA 3ONSA 4M8MA 4HPLB 2R0DA 2GOWA 1UH6A 4NQKE 1MK7B 2RSGA 4F1SA 4GDLB 2KKCA 1KC7A 1ZM0A 1GG3A 2MWNB 3AULA 1SIFA 2COAA 1OMWA 2ZPYA 2HJ8A 3U7DA 1HB8A 1Y5OA 2LD9A 2OJRA 1WYWB 4FHJA 5AEKB 2MDXA 4L6EA 4GMXB 3L54A 1FXTB 3JVZX 1WR6E 5LXIB 3DBHI 4K81A 3PGEA 1PLSA 4OVVA 3APDA 3BINA 5FI0A 1M7RA 4C0AA 5C23A 4PS7A 1PFJA 2YT0A 4GB9A 4IG7B 3A9JB 1E8WA 3KSYA 3PLUA 3VUYA 4NY0A 2ZCCA 2BYEA 2K39A 1RRPB 2KDIA 3LJ3A 2HTHB 2W9NA 2A4ZA 2MSED 3OLMD 2LRUA 3EFUA 1ZSQA 4DBBA 1ZC3B 3RUIB 1P0RA 5HE0A 3HQCA 5C6RA 3D32A 1EUVB 1L7YA 3VHTC 2P8VA 3PVWA 1NDDA 1UZXB 4Z2MB 1U29A 1V6EA 3JSVA 1WIAA 4ILJA 4HLEA 3ZKJC 1C3TA 3KZ1A 4B6WA 3ZLZA 3H1UA 1EO6A 1EVHA 2D9ZA 5DI9B 1UELA 3CSTA 2MBEA 1WM3A 2MKRA 2QHOA 4DDID 2EJ8A 5CHWA 4BBNF 2W2XC 3RZFA 3KVFB 2FCSA 5L95C 4WWNA 4K2PA 1NBFC 4KZCA 1VCBA 4FJVB 2MA9B 2IO0B 1E8ZA 1FAOA 4HCPB 2UYZB 4PYZA 4ICUA 4NQLB 5D7GA 1UNRA 3QX1A 5D3YA 5HE3A 3AXCA 2FDQA 1Z2MA 2V3SA 3UQAA 3ZVRA 2AYOB 4BKSD 1JRUA 4IWQA 1ACAA 1UBQA 5HE2A 4GDKA 4G0NB 2J7QB 3EPYA 1X11A 3PG7A 2WX1A 3ML9A 4NSWA 3NSUA 3RYTA 2DA0A 4F8CB 3QK0A 4KHOA 2LBBA 1MKEA 3A8QA 2G4SA 4AJYB 2DENB 4BFRA 4GPTB 2UZRA 4HATB 1BTKA 5DPRA 2Z0QA 2BYFA 4G50A 2IY1B 2LVQA 4HK2A 2DZIA 1WF9A 2KWVB 3A4SC 4IOYX 3CXBB 5JHGA 1I7AA 2D3GA 3R7QA 4DDGD 1J0GA 3A4RA 2PZ1A 2KNBA 5D6JB 3JW0X 1GGOA 1W1HA 2CQUA 1UD7A 1MIZB 3H7PA 4D0NB 1X1FA 3PEGA 2KOXA 2PEAA 2J0JA 4W9KA 1WJ4A 3ZTDA 1KZGA 5FI1A 2ZCBA 3QIJA 3E9OA 5C16A 4XX5A 4BOSC 2UVMA 4ANUA 2RSUA 1V5MA 1VD2A 2I1KA 5G2NA 2L05A 1U5DA 1WX8A 1Q67A 3GYOA 5D94A 2KWUB 3QWMA 1RRBA 1WJ6A 4W9JA 4W9GA 1LXDA 2REXA 3PP2A 5CTRC 4GXBA 1U2BA 2C5LC 4BKSA 4F7HA 4HAZB 1WGYA 2OQBA 2M4NA 2YS3A 2JY6A 5EDSA 1Z87A 1WRDB 1RAXA 2KUPA 2KMCA 1E8YA 2MP2A 3VVWB 4MSQB 2HRJA 2DYMA 3DBSA 2B3AA 3KUDB 4HCNB 1GC7A 2RVBB 4K7SA 4HDOA 1NI2A 1SHCA 2RD0A 5JHBA 2KC1A 1SE9A 4MGKE 2D4QA 3ML8A 2J59M 3MHSD 4MT7A 4PNKA 3VUXA 5L81A 1WZ3A 2K25A 1OEYA 3TCAA 1WVHA 2Z0PA 2RR9A 4KIKA 2L00B 3VQIA 4FJYA 3VDZA 3DVGY 4A6HA 4TV3A 4HB2B 4EUTA 2YRYA 2M0XA 2DX5A 4DHJD 3QAQA 3TJPA 2X0SA 4H8SA 1UBIA 3NY5A 4EEWA 2IBIB 5JZEB 1FOEA 4ZYNA 2N9XA 2KO3A 2I5FA 2VRWB 1P98A 2LULA 2EMTA 5KQ1A 2BF8B 1WXVA 1V88A 2LYDA 2MFQA 2OTXA 2XK5A 5C1ZA 3M95A 2GBRA 1U4AA 1E90A 3NOBA 1IP9A 4GMVA 3E9PA 1DROA 3PZDA 4ANWA 3SBGA 3DDCB 1BT0A 3TO1A 2KDFB 3M3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSS A;  3FP5 A;  1QZE A;  4X57 B;  3TL5 A;  4NJ6 A;  2O6V B;  4XC2 A;  3H7P B;  5J17 A;  2DKQ A;  4HAU B;  1WXS A;  4W9L A;  1XKE A;  1P1A A;  4I6P A;  2HE7 A;  1DYN A;  4W9H A;  3AJ4 A;  3WA0 A;  3F5R A;  2O2V B;  3PHX B;  3KW5 B;  2N7E A;  1KLV A;  3EEC A;  1WXM A;  1Q5W B;  2AL3 A;  3U30 A;  4HAY B;  2C7N B;  5HKH A;  2ZNV C;  4GN1 A;  2KJR A;  2VKI A;  2GBK A;  4NAW A;  1LFD A;  4WWO A;  4M8N A;  3PHW B;  4IM3 A;  3APC A;  3ZNG C;  1BAK A;  1PQS A;  3QHT A;  3AI5 A;  2W2W A;  3CF6 E;  1FGZ A;  5DHA B;  1KZ7 A;  1J0W A;  3V60 A;  1I2H A;  3W1S C;  4IC7 B;  4G11 A;  4LJO B;  4BKG A;  2DTC A;  1UGM A;  2GCJ A;  3APF A;  2CRF A;  1ST7 A;  2KFK A;  3VUW A;  4JLC A;  3KRW A;  2Z0O A;  1NU2 A;  2MLB A;  2V4L A;  4MGZ E;  4DX9 0;  3PRZ A;  1NVL A;  4K7U A;  1MIX A;  3B08 A;  2MBH A;  4KHA A;  3EHV A;  3SV1 A;  4NJ7 A;  2AEH A;  2MW5 A;  2EKE C;  3HK0 A;  3PS6 A;  3DBR I;  1ZW7 A;  3V62 A;  4JIO U;  3ML4 A;  2GCL A;  2Y7B A;  3G9W A;  3QWZ B;  4K2O A;  3LJU X;  2YSZ A;  1XOD A;  3MTN B;  3DBL I;  1P3Q U;  4WAA A;  3QQ8 B;  2OOB B;  2WH5 A;  1EF5 A;  1OGW A;  2DX1 A;  2BGF A;  2DHK A;  3PSE B;  2DKP A;  2ZNV B;  3HW2 B;  2BWF A;  3IFW B;  4KZ0 A;  4GSW A;  2NPT A;  2KZR A;  4KV2 A;  2Z0D B;  3WAO A;  1AQC A;  2RLO A;  2LJ5 A;  3ZRC A;  2G35 A;  3X0W A;  3V6C B;  3DQV A;  4K1R B;  4KDL B;  3ZO5 B;  4CYE A;  5D27 A;  3IVF A;  3JYU A;  4ZRJ A;  3UQB A;  2WDT B;  3P7Z A;  1W1G A;  1K5G B;  3RCP A;  4GGQ A;  5JP4 A;  1YX5 B;  3FEH A;  2M17 A;  3PVU A;  2LOX A;  5CX3 A;  4MGY E;  1WGD A;  1AWE A;  3DVG X;  1BTN A;  3ZNZ B;  3M62 B;  4MJS A;  1EF1 A;  1X05 A;  4HB4 B;  4DHZ B;  2C9W B;  1QQG A;  2C7M B;  4WWP A;  5CHF A;  2JF5 A;  2CU1 A;  4DX8 A;  4HXD A;  5C5B B;  4EJN A;  3P2B A;  2YLM A;  4ZRK A;  4DK5 A;  3OAW A;  3VXW A;  2KFJ A;  2BCJ A;  2LGD A;  4W9E A;  2Y8F A;  1ZKH A;  2DHZ A;  2GS0 A;  3IBE A;  3NZU A;  3D8E A;  4B95 A;  5LXH A;  4J6I A;  1AAR A;  4K17 A;  3T06 A;  1A5R A;  1NTY A;  2LG1 A;  2D2Q A;  3D8F A;  5GMV A;  5DPS A;  4MGI E;  2R09 A;  3R3M A;  4WJN A;  1E5W A;  1XCG A;  1XD4 A;  1YD8 U;  2KQ7 A;  1MK9 B;  2ROZ B;  5DPT A;  4IM2 A;  1YIW A;  2KTR B;  1WMH A;  2PJH A;  3L08 A;  5D3X A;  4PYU A;  2JVC A;  2BKF A;  2DN6 A;  4WVF B;  3K9O B;  1GNU A;  3ZRF A;  4ICV A;  1MG8 A;  4NPN A;  3ECI A;  2ELB A;  4MY6 A;  1Q0W B;  3L16 A;  3U8Z A;  3R7R A;  2KXJ A;  4WQO B;  4A20 A;  1GC6 A;  4AWJ A;  2LI5 A;  3KUC B;  2FUH B;  2FJ9 A;  5D3W A;  4ZRI A;  4MH0 E;  3DXD A;  3F0W A;  1Z5S B;  2VSZ A;  2DLW A;  3VAW A;  1K8R B;  2DYQ A;  3S2A A;  3A33 B;  5G55 A;  4A3O A;  2D9Y A;  4II2 B;  3MDB C;  1WE6 A;  2LZ6 A;  2EMS A;  4MEM A;  1J19 A;  4WSF A;  2JWZ A;  4FA6 A;  2FCM A;  5J3Q A;  2YS5 A;  3IHP C;  5D2M B;  4FJZ A;  1KI1 B;  1DDV A;  2CHX A;  2NPT B;  1WX7 A;  4RM8 A;  1YX6 B;  1V2Y A;  1C1Y B;  4HPM B;  1TGZ B;  4B9K A;  2DZK A;  2KHW B;  3KY9 A;  5CLL B;  4CHJ A;  3RD2 A;  4PS3 A;  3RT3 B;  3D8D A;  2GBN A;  4HB0 B;  5LON B;  1D3Z A;  4A6K A;  4BKT A;  4HAV B;  2V76 A;  4IWP A;  4BVU C;  3A9K A;  5EFX A;  3FM8 C;  2FJL A;  4DWF A;  4JL9 A;  4KSL C;  2D11 A;  3JSV B;  5AZG A;  2RUK B;  3SUZ A;  2LRW A;  5J18 A;  2UZS A;  2ZEQ A;  2JXX A;  3NS8 A;  3QBV B;  1XR0 B;  1OY2 A;  1WGH A;  2IFS A;  3A1Q A;  1XD3 B;  3PRM B;  2N1V A;  3HM3 A;  1NTI A;  4GDL A;  2FCN A;  2LUE A;  3ZVV A;  2N7D A;  4FUL A;  4RMA A;  4HB3 B;  2PPH A;  2MX2 A;  3KUZ A;  2K6Q A;  1V80 A;  2CHW A;  2ABD A;  2LVP A;  2NS5 A;  3UZT A;  4LDT D;  2UWQ A;  2ZZP B;  5GOW B;  1H10 A;  2K8B A;  4GU2 A;  1OQY A;  2KVR A;  1WH3 A;  2KTF A;  2JPH A;  3DOW A;  4GDK B;  4WJP A;  3SYX A;  1H4R A;  1E7V A;  3KYC D;  1V5T A;  1PMS A;  2GBM A;  2YF0 A;  3DCG A;  5KHQ A;  4EKU A;  3A9J A;  2D9X A;  2N9P C;  2FID A;  2LGY A;  1KOT A;  2NCN A;  4ZDV A;  2YT1 A;  1IPG A;  3UF8 A;  1TQZ A;  4BOZ B;  5IJM A;  2KLG A;  4MK0 A;  5DH9 B;  1X1G A;  1Y19 B;  3DXE A;  2HTH A;  4FN2 A;  2GJY A;  2L8J A;  2NBW B;  3QC8 B;  4F7Z A;  2P0H A;  3M63 B;  2W2X D;  2KK8 A;  3MPX A;  3V6E B;  3SNH A;  1TTN A;  1FHO A;  4AUQ C;  2CB8 A;  3TFM A;  3ZTC A;  3OJ3 A;  3BJI A;  1V86 A;  2DHJ A;  4HVB A;  4I6N B;  4LCD E;  3B0A A;  2MBB B;  1V5U A;  4TQ1 A;  2KJH B;  3GOE A;  2LXA A;  2KLC A;  3ULB A;  1LM8 B;  3QCA A;  2K8H A;  1TXD A;  2COP A;  3R66 C;  3T9L A;  2COD A;  1WGU A;  2R2O A;  2G4D B;  4WJ7 A;  1J8C A;  4FHK A;  2D9W A;  3ALB A;  2XEW A;  5E6N A;  4IW0 A;  1TJ6 A;  2KD0 A;  4XZ4 A;  4A6F A;  2PE6 B;  1ZC4 B;  1X1M A;  1B55 A;  4XWX A;  1YJ1 A;  2CAY A;  5FR6 A;  4PQ0 A;  2IO3 B;  4E74 A;  2KX0 A;  2Q13 A;  4MEL A;  2RQ1 A;  2LOZ A;  4FAD A;  1HBK A;  1IYF A;  1HB6 A;  3GZN I;  4TUU A;  4CO7 A;  3P6A A;  2A5U A;  3N3K B;  3WAL A;  1P5T A;  4HDQ A;  1I42 A;  2KAN A;  5BO4 B;  2I5C A;  3C0R B;  4Y94 A;  4IFS A;  2DYN A;  3VTV A;  2M38 A;  4MSM B;  4EZJ A;  4E3C A;  1XX0 A;  3FLV A;  4II3 B;  2QKM A;  2MP2 B;  4LJP B;  2G3Q B;  3V5W A;  3I3T B;  5DCN A;  3KRX A;  3ZW3 A;  2COF A;  2WX0 A;  2IYD B;  3EC8 A;  1XQQ A;  4EZL A;  2JRH A;  4K7W A;  2K2J A;  3ODX A;  4DXA B;  4HAX B;  2DZJ A;  3PV1 A;  1WJM A;  3UIO B;  2NBV B;  1TBE A;  5JHA A;  2CS4 A;  3L13 A;  2L0T A;  2MCN B;  3TMP B;  4G3X B;  3HIZ A;  1FHX A;  4RM9 A;  1T0Y A;  2ELA A;  1UNP A;  4KIK B;  4TYZ A;  3L10 B;  1BWN A;  1U5F A;  1V81 A;  2NMB A;  2BKR B;  2DX5 B;  2Y5B B;  1OQN A;  3UIP B;  4Z2N A;  2KN5 A;  2RGN B;  2D10 A;  3K9P B;  3ODW A;  2ASQ A;  2KMA A;  4BBK A;  1WGG A;  2KCJ A;  2XQN M;  3ZDT A;  3L17 A;  4AP4 C;  2JZZ A;  1R4N I;  4F7G A;  5LLI A;  4KHB B;  3UIN B;  2XK5 B;  2DAF A;  1IRS A;  5KCV A;  3MJW A;  3SD5 A;  4DHZ E;  1S1Q B;  2FAZ A;  3VH4 B;  2FNJ B;  4EMO A;  2BPS A;  2O6V D;  5CHV C;  2XBB C;  3HM6 X;  4BBN C;  2Z0E B;  5AZF A;  4IM0 A;  4OVU A;  4DBG A;  4HJK A;  4CHM A;  3PRP B;  4B6H A;  4TKN A;  1LB1 A;  2JT4 B;  3X23 A;  3TBL D;  1S3S G;  3TW1 A;  1WJN A;  1DDM A;  4A6F B;  2N23 A;  3VOQ A;  2RPQ A;  5JHH A;  2L7R A;  2M14 A;  1TZ1 A;  3NZS A;  4HHV A;  2JUO A;  4NNJ B;  2KJ6 A;  4NAW B;  2R2Q A;  1E8X A;  2AL6 A;  3WYF B;  5TR5 A;  3QA8 A;  4CHK A;  2ROV A;  4HWI B;  1WG7 A;  3VFK A;  3GYP A;  4N9F 4;  1ISN A;  2GBJ A;  1UEF A;  3OAN A;  1XT9 B;  4LDT B;  1OTR B;  1U5E A;  2CKH B;  1UPQ A;  4IUM B;  2NVU I;  1WJ1 A;  2MRP A;  2YS1 A;  2J0M A;  2IY0 B;  3L0W B;  1LQB A;  4DHJ B;  3WAN A;  4KDI C;  4YON A;  2CR5 A;  4GOC A;  2IO1 B;  5J3T A;  2KFK B;  3PRE A;  1WFY A;  3N32 A;  4FBJ B;  1SGH A;  4A3P A;  3ODO A;  3ZUN A;  4I6L B;  3DVN V;  4EFO A;  4EZK A;  1GJZ A;  3PTF C;  1WE7 A;  3LDZ E;  5JLJ B;  3OJ4 B;  2RGF A;  2RNR B;  3SO6 A;  1WM2 A;  5IA7 A;  3T8M A;  4W9D A;  2NBU A;  2PE9 A;  3KH0 A;  3RZW C;  2KGX B;  2H7D A;  3N30 A;  2J0K A;  2ADZ A;  2KWC A;  3PPA A;  4KAX B;  3NHE B;  3B1L X;  2L2I A;  2WYQ A;  1WX9 A;  2K2U A;  3O65 B;  4JGH B;  4ANX A;  2O6V A;  3PVL A;  1FGY A;  2BWE S;  2KC2 A;  1Y8R C;  2JZ3 B;  1FB8 A;  4GZU A;  4KVG B;  3PSC A;  4TQ0 A;  3SHQ A;  4W9F A;  2O2V A;  5J3Y A;  3ZDM C;  2H7E A;  2K6D B;  2MBO A;  2DZM A;  3AU5 A;  4AOF A;  5C79 A;  1U27 A;  5DIF B;  1OEY J;  1M94 A;  2IO2 B;  1P6S A;  3QAR A;  3WAP A;  2E2X A;  2N4F A;  2K00 A;  1N3H A;  1DBH A;  4GIV A;  2N9E B;  1W1D A;  2CY4 A;  5E6O A;  5L83 A;  2DYO A;  3VTU A;  2CHZ A;  3W1Y A;  3A98 B;  1Q1O A;  2K1F A;  4AJW A;  3QJZ A;  4MJS B;  3BY4 B;  2LVO A;  4WJQ A;  5E6P A;  3CMM B;  2Z59 B;  5CLQ B;  3HHM A;  2D9V A;  1V5P A;  1M7E A;  2VRR B;  2G45 B;  4M0W B;  2V1Y A;  5KHO A;  2MBQ A;  5AZH A;  2P0F A;  2GMI C;  4MM3 A;  1V49 A;  2D07 B;  2X18 A;  2M1M A;  5LOP B;  4IWO A;  1WZ0 A;  3AU4 A;  2KX3 A;  3H6N A;  4F7U P;  1WJU A;  5J2R A;  2AWT A;  2NR2 A;  2FIF A;  2ZPN A;  3RCZ A;  3H7S A;  5DHF B;  3ZIM A;  1RJ2 A;  2LWP A;  2KQS A;  2DFK A;  2DAJ A;  2L0F A;  1NTV A;  4W9C A;  2LAS A;  3WAM A;  4URK A;  2LGX A;  5D3V A;  4A5K A;  1MPH A;  4FLH A;  3ZNH B;  1QC6 A;  2L76 A;  2LKO A;  1EGX A;  1GUA B;  5JH5 C;  2IZV B;  1RFA A;  5HE1 A;  1UNQ A;  2KDB A;  3O96 A;  3VH3 B;  1ZVR A;  2YVC A;  1WMH B;  3ZNI D;  2CY5 A;  3IG3 A;  4P7I A;  4HAW B;  2LXC A;  4EOY A;  2L3Z A;  2HD5 B;  3VIA A;  1LW3 A;  3W1S A;  1V61 A;  1U5G A;  3TVV A;  2DYB A;  3RUL A;  2MQJ A;  3ULC A;  1WGQ A;  2L1C A;  1WY8 A;  2BYV E;  1V9J A;  1KM7 A;  1P3R A;  3PLV A;  3A8P A;  2ZVO A;  3DPD A;  2Y8G A;  3UGB B;  5KQ4 A;  4PS8 A;  1CMX B;  1V5O A;  5IAA C;  4E71 A;  1YQB A;  1G6J A;  3CIK A;  3SDL C;  3DXC A;  2K8C A;  3CSF A;  5C5B A;  3Q3J A;  3DVN U;  1P9D U;  3H9D A;  4ASW C;  4JQW C;  2WWZ A;  2JP2 A;  2M8S A;  3KYD D;  1K5D B;  1E7U A;  4W9I A;  2I1J A;  1R4M I;  1WR1 A;  2JRI B;  3V61 A;  1X86 A;  1RLF A;  2FCQ A;  2QKL A;  2IYB A;  1EAZ A;  2ZJD A;  2ZVN A;  4KSK C;  1WGR A;  1UPR A;  3SU8 X;  4IAP A;  3VTW A;  1WI1 A;  1HE8 A;  2EC1 A;  3ENE A;  2P0D A;  4ANV A;  1H8C A;  1WI0 A;  1I35 A;  4YL8 A;  3A9K B;  1F9J A;  2MWS B;  1ZGU B;  2KDE B;  2C60 A;  1V89 A;  3Q3F A;  2NZ8 B;  1DDW A;  1MAI A;  1KJT A;  4WJO A;  2N1W A;  2KTR A;  1WXA A;  2C7H A;  3N7C A;  3TIX A;  5DPW A;  1L2N A;  2N0Y A;  4MDK E;  2DHI A;  3PT2 B;  1FHW A;  2COC A;  3M1I B;  3A1Q B;  3WIM A;  3ONS A;  4M8M A;  4HPL B;  2R0D A;  2GOW A;  1UH6 A;  1MK7 B;  4NQK E;  2RSG A;  4F1S A;  4GDL B;  2KKC A;  1ZM0 A;  1GG3 A;  2MWN B;  3AUL A;  1SIF A;  2COA A;  1OMW A;  2ZPY A;  2HJ8 A;  3U7D A;  1HB8 A;  1Y5O A;  2LD9 A;  2OJR A;  1WYW B;  4FHJ A;  5AEK B;  2MDX A;  4L6E A;  4GMX B;  3L54 A;  1FXT B;  3JVZ X;  1WR6 E;  5LXI B;  3DBH I;  4K81 A;  3PGE A;  1PLS A;  4OVV A;  3APD A;  3BIN A;  5FI0 A;  1M7R A;  4C0A A;  5C23 A;  4PS7 A;  1PFJ A;  2YT0 A;  4GB9 A;  4IG7 B;  3A9J B;  1E8W A;  3KSY A;  3PLU A;  3VUY A;  4NY0 A;  2ZCC A;  2BYE A;  2K39 A;  1RRP B;  2KDI A;  3LJ3 A;  2HTH B;  2W9N A;  2A4Z A;  2MSE D;  3OLM D;  2LRU A;  3EFU A;  1ZSQ A;  4DBB A;  1ZC3 B;  3RUI B;  1P0R A;  5HE0 A;  3HQC A;  5C6R A;  3D32 A;  1EUV B;  1L7Y A;  3VHT C;  2P8V A;  3PVW A;  1NDD A;  1UZX B;  4Z2M B;  1U29 A;  1V6E A;  3JSV A;  1WIA A;  4HLE A;  3ZKJ C;  1C3T A;  3KZ1 A;  4B6W A;  3ZLZ A;  3H1U A;  1EO6 A;  1EVH A;  2D9Z A;  5DI9 B;  1UEL A;  3CST A;  2MBE A;  1WM3 A;  2MKR A;  2QHO A;  4DDI D;  2EJ8 A;  5CHW A;  4BBN F;  2W2X C;  3RZF A;  3KVF B;  2FCS A;  5L95 C;  4WWN A;  4K2P A;  1NBF C;  4KZC A;  1VCB A;  4FJV B;  2MA9 B;  2IO0 B;  1E8Z A;  1FAO A;  4HCP B;  2UYZ B;  4PYZ A;  4ICU A;  4NQL B;  5D7G A;  1UNR A;  3QX1 A;  5D3Y A;  5HE3 A;  3AXC A;  2FDQ A;  1Z2M A;  2V3S A;  3UQA A;  3ZVR A;  2AYO B;  4BKS D;  1JRU A;  4IWQ A;  1ACA A;  1UBQ A;  5HE2 A;  4GDK A;  4G0N B;  2J7Q B;  3EPY A;  1X11 A;  3PG7 A;  2WX1 A;  3ML9 A;  4NSW A;  3NSU A;  3RYT A;  2DA0 A;  4F8C B;  3QK0 A;  4KHO A;  2LBB A;  1MKE A;  3A8Q A;  2G4S A;  4AJY B;  2DEN B;  4BFR A;  4GPT B;  2UZR A;  4HAT B;  1BTK A;  5DPR A;  2Z0Q A;  2BYF A;  4G50 A;  2IY1 B;  2LVQ A;  4HK2 A;  2DZI A;  1WF9 A;  2KWV B;  3A4S C;  4IOY X;  3CXB B;  5JHG A;  1I7A A;  2D3G A;  3R7Q A;  4DDG D;  1J0G A;  3A4R A;  2PZ1 A;  2KNB A;  5D6J B;  3JW0 X;  1W1H A;  2CQU A;  1UD7 A;  1MIZ B;  3H7P A;  4D0N B;  1X1F A;  3PEG A;  2KOX A;  2PEA A;  2J0J A;  4W9K A;  1WJ4 A;  3ZTD A;  1KZG A;  5FI1 A;  2ZCB A;  3QIJ A;  5C16 A;  4XX5 A;  4BOS C;  2UVM A;  4ANU A;  2RSU A;  1V5M A;  1VD2 A;  2I1K A;  5G2N A;  2L05 A;  1U5D A;  1WX8 A;  1Q67 A;  3GYO A;  5D94 A;  2KWU B;  3QWM A;  1RRB A;  1WJ6 A;  4W9J A;  4W9G A;  1LXD A;  2REX A;  3PP2 A;  5CTR C;  4GXB A;  1U2B A;  2C5L C;  4BKS A;  4F7H A;  4HAZ B;  1WGY A;  2OQB A;  2M4N A;  2YS3 A;  2JY6 A;  5EDS A;  1Z87 A;  1WRD B;  1RAX A;  2KUP A;  2KMC A;  1E8Y A;  2MP2 A;  3VVW B;  4MSQ B;  2HRJ A;  2DYM A;  3DBS A;  2B3A A;  3KUD B;  4HCN B;  1GC7 A;  2RVB B;  4K7S A;  4HDO A;  1NI2 A;  1SHC A;  2RD0 A;  5JHB A;  2KC1 A;  1SE9 A;  4MGK E;  2D4Q A;  3ML8 A;  2J59 M;  3MHS D;  4MT7 A;  4PNK A;  3VUX A;  5L81 A;  1WZ3 A;  2K25 A;  1OEY A;  3TCA A;  1WVH A;  2Z0P A;  2RR9 A;  4KIK A;  2L00 B;  3VQI A;  4FJY A;  3VDZ A;  3DVG Y;  4A6H A;  4TV3 A;  4HB2 B;  4EUT A;  2YRY A;  2M0X A;  2DX5 A;  4DHJ D;  3QAQ A;  3TJP A;  4H8S A;  1UBI A;  3NY5 A;  4EEW A;  2IBI B;  5JZE B;  1FOE A;  4ZYN A;  2N9X A;  2KO3 A;  2I5F A;  2VRW B;  1P98 A;  2LUL A;  2EMT A;  5KQ1 A;  2BF8 B;  1WXV A;  1V88 A;  2LYD A;  2MFQ A;  2OTX A;  2XK5 A;  5C1Z A;  3M95 A;  2GBR A;  1U4A A;  1E90 A;  3NOB A;  1IP9 A;  4GMV A;  1DRO A;  3PZD A;  4ANW A;  3DDC B;  1BT0 A;  3TO1 A;  2KDF B;  3M3J A; 
#chains in the Genus database with same CATH topology
 3FSS A;  2WGS A;  3FP5 A;  4JKC A;  3P63 A;  1QZE A;  4X57 B;  3TL5 A;  4NJ6 A;  2O6V B;  4YXD B;  4XC2 A;  3H7P B;  5J17 A;  1UNS A;  2DKQ A;  1JWB D;  3NVY A;  4HAU B;  1WXS A;  1YMH E;  4W9L A;  1XKE A;  1P1A A;  3R8B A;  1M4V A;  2KT7 A;  1KF6 B;  2CU3 A;  2BTE A;  4I6P A;  2HE7 A;  1DYN A;  3HRD D;  4W9H A;  3AJ4 A;  3WA0 A;  4QJ5 B;  3F5R A;  1R4N B;  3T3O A;  2O2V B;  3PHX B;  1NYR A;  3KW5 B;  2N7E A;  3VRA B;  1KLV A;  1WYG A;  3B9J A;  2ONQ A;  3EEC A;  1WXM A;  2J53 A;  1Q5W B;  3BZD B;  3MHZ A;  3Q8F A;  2AL3 A;  3U30 A;  4HAY B;  2C7N B;  5HKH A;  2ZNV C;  3AM9 A;  4GN1 A;  2KJR A;  2VKI A;  2HTM E;  4HKZ E;  1L6U A;  1MI1 A;  2GBK A;  1I7H A;  4LNF A;  4NAW A;  1LFD A;  3E66 A;  2Y5P A;  4LLG M;  2KAC A;  4WWO A;  4M8N A;  3PHW B;  2R2Y A;  4IM3 A;  3APC A;  3ZNG C;  1BAK A;  1PQS A;  3QHT A;  3AI5 A;  2W2W A;  1C77 A;  3CF6 E;  2NTS A;  1FGZ A;  2OED A;  5DHA B;  1ZP0 B;  1KZ7 A;  2GB1 A;  1J0W A;  3V60 A;  1I2H A;  3W1S C;  4C7Y A;  1FMA D;  4IC7 B;  4G11 A;  4LJO B;  4BKG A;  2DTC A;  1UGM A;  3Q3N C;  2GCJ A;  1DYQ A;  1EU3 A;  3APF A;  2CRF A;  2IGH A;  1C78 A;  1ST7 A;  2KFK A;  1BXT A;  2VH1 A;  3VUW A;  4JLC A;  1ROE A;  4IDI A;  3KRW A;  2Z0O A;  1NU2 A;  2MLB A;  1TIF A;  2V4L A;  4MGZ E;  1XF5 L;  1EU4 A;  3MC0 B;  4DX9 0;  3PRZ A;  1NVL A;  4K7U A;  4S0R A;  1J7C A;  1MIX A;  1N62 A;  3B08 A;  3ABV B;  2MBH A;  1UF0 A;  4LNI A;  4KHA A;  4KGR A;  4MM3 B;  3EHV A;  3BYY B;  4BZA A;  1HQR D;  3SV1 A;  4JPS A;  4S17 A;  2ZW0 A;  1PDX A;  2QJL A;  4NJ7 A;  2AEH A;  2MW5 A;  2EKE C;  5D3I B;  2GRI A;  3HK0 A;  2RDG A;  3PS6 A;  3DBR I;  1ZW7 A;  3V62 A;  4JIO U;  4K3C A;  3ML4 A;  2GCL A;  2Y7B A;  3G9W A;  3QWZ B;  4K2O A;  3I57 A;  3LJU X;  2WXL A;  2YSZ A;  1XOD A;  3MTN B;  3DBL I;  5G5G A;  1ZOY B;  1P3Q U;  4WAA A;  3QQ8 B;  1K51 A;  4L1R A;  3IAS 1;  2OOB B;  4XE0 A;  4JKG A;  4IKG A;  2WH5 A;  1EF5 A;  1JML A;  1OGW A;  2DX1 A;  1FPY A;  2BGF A;  1I4P A;  2DHK A;  4JKF A;  1KTK A;  4CQN A;  2WXG A;  1DGJ A;  3PSE B;  2DKP A;  2PVO D;  2ZNV B;  3HW2 B;  2BWF A;  3BWU D;  1JWA D;  3IFW B;  4JKH A;  4KGS A;  4KZ0 A;  4GSW A;  2NPT A;  2KZR A;  3MC8 A;  3VR9 B;  4KV2 A;  4LK0 M;  2Z0D B;  3OWE B;  3FVC A;  3WAO A;  4RGM A;  1N61 A;  1AQC A;  2RLO A;  2LJ5 A;  3ZRC A;  2G35 A;  2JWU A;  3X0W A;  3V6C B;  3DQV A;  4K1R B;  5HG2 A;  4KDL B;  3ZO5 B;  4CYE A;  3EUB 2;  5D27 A;  3IVF A;  3JYU A;  2RRF A;  4ZRJ A;  3UQB A;  2WDT B;  2ZKM X;  3P7Z A;  3RFZ B;  3R2I A;  1K53 A;  5LNK 1;  1W1G A;  4GLS C;  1K5G B;  1MG4 A;  1QKZ A;  3RCP A;  4GGQ A;  5HI1 A;  5JP4 A;  1YX5 B;  4HRS A;  3FEH A;  3DCX A;  2Z8L A;  1I4H A;  3PVU A;  2M17 A;  2LOX A;  2IPK D;  5CX3 A;  2NMQ A;  4MGY E;  1FIQ A;  1AWE A;  1C4P A;  1WGD A;  1ZXH A;  1UWX A;  3DVG X;  2OHF A;  1MHH E;  1BTN A;  3ZNZ B;  2BB5 A;  5MPO A;  3M62 B;  4MJS A;  1EF1 A;  1X05 A;  2FJU B;  4UDU C;  4HB4 B;  4DHZ B;  2Z59 A;  2GUM A;  2C9W B;  1QQG A;  3Q3O C;  2C7M B;  4WWP A;  4RGO S;  4M0W A;  5CHF A;  2JF5 A;  2BBC A;  2CU1 A;  4DX8 A;  4HXD A;  5C5B B;  1QLB B;  4EJN A;  1C79 A;  4P6V F;  3P2B A;  2YLM A;  4ZRK A;  1WGK A;  4DK5 A;  3OAW A;  3PZ7 A;  3VXW A;  2KWD A;  2HJ1 A;  2KFJ A;  2BCJ A;  2LGD A;  4W9E A;  4YTP B;  2Y8F A;  4ARC A;  1ZKH A;  2DHZ A;  2GS0 A;  1KH0 A;  5IO9 A;  1PGA A;  1N60 A;  4A6Q A;  3IBE A;  1T0R C;  3NZU A;  2KR0 A;  3D8E A;  4B95 A;  5LXH A;  1F1H A;  4J6I A;  1AAR A;  2QEJ C;  4K17 A;  3T06 A;  1A5R A;  4EE2 A;  1NTY A;  2LG1 A;  1T6B X;  2D2Q A;  3D8F A;  1MHX A;  2W55 A;  5BYS A;  5GMV A;  1FFV A;  5DPS A;  4MGI E;  1B9R A;  2R09 A;  3R3M A;  1YN5 A;  4WJN A;  1XD4 A;  1E5W A;  1XCG A;  3CIR B;  3DHH C;  2BW2 A;  1YD8 U;  2KQ7 A;  1MK9 B;  3MFG A;  4NZL B;  2ROZ B;  3RN9 C;  1T77 A;  5DPT A;  4IM2 A;  1YIW A;  1YOV B;  4J3O D;  2KTR B;  1WMH A;  2Z14 A;  2PJH A;  3L08 A;  2XNA C;  5D3X A;  4PYU A;  2JVC A;  2BKF A;  2DN6 A;  4WVF B;  3K9O B;  1GNU A;  2BYT A;  2FBW B;  2H89 B;  3ZRF A;  2BQQ A;  4ICV A;  1MG8 A;  4NPN A;  3ECI A;  2ELB A;  1FEH A;  4MY6 A;  1Q0W B;  3L16 A;  3U8Z A;  4ZRQ A;  2GLS A;  3R7R A;  4IOI E;  2KXJ A;  1SXT A;  4WQO B;  4RH6 A;  1JCK B;  1GC6 A;  4A20 A;  2WXO A;  1AN8 A;  1ET6 A;  4AWJ A;  2LI5 A;  3KUC B;  1P7F A;  2WXK A;  2BT6 A;  2R61 A;  5M4Y B;  2FUH B;  2JSV X;  2FJ9 A;  5D3W A;  4ZRI A;  4MH0 E;  1JWS D;  3DXD A;  3OG5 A;  3F0W A;  3FIL B;  4XGA B;  1Z5S B;  5BYR A;  1J7A A;  4YSY B;  2VSZ A;  2DLW A;  3VAW A;  2MHJ A;  4DIX A;  1K8R B;  4US8 A;  2DYQ A;  3S2A A;  1OFF A;  3A33 B;  5G55 A;  2XN9 C;  3DWG C;  4A3O A;  2D9Y A;  4D2K A;  4C4V B;  4WIP A;  4N6E B;  2N9K A;  4II2 B;  3MDB C;  2INP E;  1GPX A;  1WE6 A;  2K3U A;  2LZ6 A;  2EMS A;  4MEM A;  1J19 A;  4WSF A;  2M19 A;  2JWZ A;  2L1A A;  3DHG C;  4TMA B;  2WDV B;  4FA6 A;  2FCM A;  1I4G A;  5J3Q A;  4NJC A;  2YS5 A;  2WXR A;  3IHP C;  5D2M B;  4FJZ A;  1KI1 B;  1DDV A;  4CSQ A;  2CHX A;  2NPT B;  1WX7 A;  4RM8 A;  1YX6 B;  1ZPS A;  2BVC A;  1V2Y A;  1C1Y B;  2SEB D;  4HPM B;  1TGZ B;  4JKB A;  4B9K A;  2DZK A;  2KHW B;  3KY9 A;  5CLL B;  4CHJ A;  2INN E;  3RD2 A;  1ENF A;  4PS3 A;  3RT3 B;  3NS1 A;  3D8D A;  2GBN A;  4HB0 B;  5LON B;  1D3Z A;  4A6K A;  2M56 B;  4BKT A;  4HAV B;  4ARI A;  2V76 A;  1TYG B;  1YQ4 B;  4IWP A;  3RNE C;  4BVU C;  3A9K A;  5EFX A;  3FM8 C;  2FJL A;  3N20 C;  2D3C A;  5IN7 A;  4DWF A;  4JL9 A;  1VZ8 A;  4KSL C;  2D11 A;  3JSV B;  4FXC A;  5AZG A;  2RUK B;  3SUZ A;  3NWD A;  2LRW A;  5J18 A;  2UZS A;  2ZEQ A;  2JXX A;  1F0Z A;  2G9H D;  3NS8 A;  3Q14 C;  5JVL A;  3QBV B;  4N59 A;  1FO4 A;  1XR0 B;  2PTL A;  1OY2 A;  4GOU A;  1FNU A;  1WGH A;  2IFS A;  3A1Q A;  1RWS A;  1XD3 B;  5AUI A;  3PRM B;  5IKC M;  2N1V A;  3HM3 A;  1HZ5 A;  1C4A A;  1NTI A;  2BS4 B;  1R4M B;  4XWT A;  3RNG C;  4GDL A;  4JK9 A;  2FCN A;  2LUE A;  3Q6B A;  3ZVV A;  2N7D A;  3AB5 A;  4FUL A;  5T8I A;  4RMA A;  4HB3 B;  2PPH A;  2V9H A;  5AUK A;  2MX2 A;  3KUZ A;  2K6Q A;  1V80 A;  2CHW A;  4YT0 B;  2ABD A;  1LO5 D;  2LVP A;  2DLB A;  2NS5 A;  3DHI C;  3UZT A;  2N0S B;  4LDT D;  2WDR B;  2UWQ A;  2MJE A;  4KGT A;  2K8E A;  2ZZP B;  3BK2 A;  1ZXI A;  3RMK C;  5GOW B;  3ZJV A;  1H10 A;  4C00 A;  2K8B A;  2VZK D;  4WQM A;  2INC C;  4GU2 A;  1OQY A;  2KVR A;  1WH3 A;  2KTF A;  2JPH A;  3ZXR A;  3DOW A;  3NJT A;  4GDK B;  4WJP A;  3SYX A;  3IT4 B;  3LXF A;  1H4R A;  1L4D B;  4JKA A;  1E7V A;  1IBX B;  4LTU A;  1PGX A;  3KYC D;  1V5T A;  3NWA A;  1PMS A;  2GBM A;  2YF0 A;  3DCG A;  3U4E G;  5KHQ A;  3NVV A;  4EKU A;  3ENB A;  3A9J A;  2D9X A;  2N9P C;  2FID A;  2LGY A;  2LJI A;  3U52 E;  1KOT A;  3OHM B;  2NCN A;  4ZDV A;  2YT1 A;  4KHB A;  1QOB A;  3V3X A;  1IPG A;  3TEZ A;  3UF8 A;  2JZP A;  4RGT A;  1TQZ A;  4BOZ B;  5IJM A;  4M02 A;  2KLG A;  4MK0 A;  5DH9 B;  1X1G A;  1Y19 B;  4OZA A;  1XCT L;  2WXI A;  3DXE A;  2HTH A;  4FN2 A;  2GJY A;  2L8J A;  1ACC A;  2NBW B;  1UGJ A;  3QC8 B;  4F7Z A;  2P0H A;  3M63 B;  5BMG A;  2W2X D;  2KK8 A;  1WXQ A;  3MPX A;  2IJ0 A;  3GB1 A;  3V6E B;  3SNH A;  1XLQ A;  4WAF A;  1TTN A;  1FHO A;  4AUQ C;  2CB8 A;  4OZB A;  2LMC A;  3TFM A;  1CJE A;  1NEN B;  3ZTC A;  3OJ3 A;  3BJI A;  5C2T B;  1V86 A;  2DHJ A;  4HVB A;  3DBH B;  4I6N B;  1I4Q A;  4LCD E;  3B0A A;  3B77 A;  2MBB B;  1V5U A;  4TQ1 A;  2KJH B;  3GOE A;  2LXA A;  2KLC A;  4HRO A;  3ULB A;  1LM8 B;  3QCA A;  2K8H A;  1KFY B;  1TXD A;  2COP A;  3R66 C;  3T9L A;  2COD A;  1WGU A;  1TS2 A;  2R2O A;  4QJ3 B;  2G4D B;  4WJ7 A;  1J8C A;  4FHK A;  2D9W A;  3ALB A;  3HUI A;  2XEW A;  5E6N A;  4IW0 A;  1TJ6 A;  2KD0 A;  4XZ4 A;  3AE3 B;  4A6F A;  2PE6 B;  1ZC4 B;  1X1M A;  3U12 A;  4A8X C;  1B55 A;  4XWX A;  1YJ1 A;  3GS2 A;  5EE0 A;  2CAY A;  5FR6 A;  4PQ0 A;  5IOI A;  2IO3 B;  4E74 A;  3E9L A;  3RNF C;  2KX0 A;  3E56 A;  2Q13 A;  4MEL A;  2QIL A;  4L23 A;  2RQ1 A;  1PUT A;  2LOZ A;  4FAD A;  4H2A A;  2KN4 A;  4A90 A;  1HBK A;  5FKA C;  1IYF A;  3TEX A;  1HB6 A;  3GZN I;  3BYT B;  4TUU A;  4CO7 A;  3SBT A;  3N9Y C;  3P6A A;  2A5U A;  3N3K B;  3WAL A;  4OSN A;  1FNW A;  1JRP A;  1P5T A;  4HDQ A;  2WNM A;  1I42 A;  2PMV A;  2KAN A;  3HVZ A;  2G1E A;  2JQR B;  5BO4 B;  2OJW A;  2I5C A;  3C0R B;  4Y94 A;  5TSS A;  4IFS A;  2DYN A;  3VTV A;  2M38 A;  4MSM B;  4EZJ A;  1L5P A;  4E3C A;  1XX0 A;  1PFD A;  3FLV A;  4II3 B;  2QC8 A;  2QKM A;  2MP2 B;  4LJP B;  2G3Q B;  2B76 B;  3V5W A;  3I3T B;  5DCN A;  3KRX A;  3ZW3 A;  2COF A;  2WX0 A;  2IYD B;  3EC8 A;  1XQQ A;  4A55 A;  1UWM A;  2CJO A;  3TUO A;  4EZL A;  4M01 A;  2H88 B;  2JRH A;  4K7W A;  1PYW D;  4K3B A;  1KBL A;  2K2J A;  3ODX A;  4DXA B;  4HAX B;  2DZJ A;  3PV1 A;  1WJM A;  3UIO B;  2NBV B;  1TBE A;  5JHA A;  2CS4 A;  3L13 A;  2L0T A;  2MCN B;  3TMP B;  4G3X B;  1F2R C;  3ZYY X;  3KLS X;  3HIZ A;  1FHX A;  3RNC C;  4RM9 A;  1T0Y A;  2ELA A;  1UNP A;  1D5M C;  4HSI A;  3MC9 A;  4KIK B;  3U2S C;  4TYZ A;  3L10 B;  3WCQ A;  4C56 C;  1BWN A;  1U5F A;  1V81 A;  3AV8 A;  5HFY A;  4YTM B;  2NMB A;  1TJE A;  3IT6 B;  2BKR B;  1BUI C;  2DX5 B;  2Y5B B;  1OQN A;  3UIP B;  4ZYS A;  4REZ A;  4Z2N A;  2KN5 A;  2RGN B;  2D10 A;  3K9P B;  3ODW A;  1FXA A;  2ASQ A;  2KMA A;  2IGD A;  4A9A A;  4BBK A;  2WS3 B;  3AE8 B;  1WGG A;  3AEG B;  1HZ6 A;  2KCJ A;  2XQN M;  3ZDT A;  1DOX A;  3SFE B;  4D6W A;  3L17 A;  4AP4 C;  1P7E A;  1TT5 B;  2JZZ A;  4JWU C;  1R4N I;  2IND C;  3W5U B;  4F7G A;  5LLI A;  3Q8B A;  4KHB B;  1C4C A;  3UIN B;  2XK5 B;  2DAF A;  1JWM D;  1JRO A;  2CJN A;  1IRS A;  1KLU D;  1JWU D;  5KCV A;  3MJW A;  2DBY A;  3SD5 A;  4DHZ E;  1YN4 A;  1ESF A;  1L4Z B;  2EKI A;  2NTT A;  1S1Q B;  2FAZ A;  3VH4 B;  3N1Z C;  2WHI A;  2FNJ B;  4EMO A;  2BPS A;  1ZE3 D;  2O6V D;  5CHV C;  2XBB C;  3HM6 X;  4BBN C;  2KYW A;  1VJK A;  3P42 A;  3AE5 B;  4AQ7 A;  1NEK B;  2WXF A;  1QOG A;  2EEL A;  5D3D A;  2Z0E B;  5AZF A;  3H8H A;  4IM0 A;  1MJD A;  3Q8E A;  4OVU A;  4DBG A;  4HJK A;  4CHM A;  3PRP B;  4B6H A;  1WRI A;  4P1B C;  3FC4 A;  4TKN A;  1CZP A;  4JKE A;  1LB1 A;  2JT4 B;  3X23 A;  3TBL D;  1S3S G;  3TW1 A;  1WJN A;  1DDM A;  1D5Z C;  4A6F B;  1TY2 A;  2N23 A;  1VRA B;  2V0G A;  1TKG A;  3VOQ A;  2RPQ A;  5JHH A;  2L7R A;  1E6E B;  2M14 A;  1TZ1 A;  3AEA B;  3NZS A;  1FNV A;  3AN1 A;  4HHV A;  1XEE A;  2JUO A;  4NNJ B;  2HDE A;  2J4X A;  2KJ6 A;  2L52 A;  5IP4 D;  1I4R A;  4NAW B;  1YJJ A;  2R2Q A;  1E8X A;  2AL6 A;  4XYC A;  1FD6 A;  3WYF B;  5TR5 A;  1RFK A;  3QA8 A;  3VR8 B;  4CHK A;  2ROV A;  4HWI B;  1WG7 A;  3LYY A;  3VFK A;  3GYP A;  4N9F 4;  1KLG D;  1ISN A;  2GBJ A;  3P4R B;  4HEA 1;  4KX6 B;  2KAJ A;  3VRB B;  3Q8A A;  1UEF A;  3OAN A;  1XT9 B;  4LDT B;  1OTR B;  1U5E A;  2CKH B;  4WUR A;  1UPQ A;  4IUM B;  2NVU I;  1WJ1 A;  2MRP A;  2YS1 A;  2J0M A;  2IY0 B;  3L0W B;  1LQB A;  4DHJ B;  3WAN A;  3ETR A;  4KDI C;  1VBH A;  4YON A;  1N6Z A;  2CR5 A;  4GOC A;  2IO1 B;  1YNT E;  2QDF A;  3P4P B;  5J3T A;  2KFK B;  3PRE A;  1WFY A;  3N32 A;  4FBJ B;  1SGH A;  2RPV A;  4A3P A;  4HJG E;  3ODO A;  3ZUN A;  4I6L B;  3DVN V;  4EFO A;  4EZK A;  1GJZ A;  3PTF C;  1WE7 A;  3LDZ E;  1V1P A;  5JLJ B;  3OJ4 B;  3Q8C A;  2RGF A;  2RNR B;  3SO6 A;  1WM2 A;  5IA7 A;  3RPF C;  4RGN A;  4USA A;  3T8M A;  4W9D A;  2NBU A;  2PE9 A;  3KH0 A;  3RZW C;  2KGX B;  2H7D A;  3N30 A;  2J0K A;  2ADZ A;  2KWC A;  3PPA A;  4ACF A;  3AE2 B;  4KAX B;  3NHE B;  3B1L X;  2L2I A;  2WYQ A;  1WX9 A;  3P4S B;  2K2U A;  3O65 B;  4JGH B;  4JKG B;  4ANX A;  1VBG A;  2O6V A;  1N5W A;  1XO3 A;  3PVL A;  3PO0 A;  1FGY A;  3KWV A;  2BWE S;  2KC2 A;  1AW7 A;  1Y8R C;  3Q3M C;  4OHJ A;  2JZ3 B;  1FB8 A;  2W3S A;  1XLN A;  1DOY A;  2L32 A;  4GZU A;  2R82 A;  4KVG B;  1B1Z A;  2RMM A;  1DIK A;  2WXQ A;  2JX5 A;  2WXP A;  4L2Y A;  3PSC A;  1N5X A;  4TQ0 A;  2QSD A;  3SHQ A;  4W9F A;  3W5V B;  2Y5C A;  1T0Q C;  2O2V A;  5J3Y A;  5JXV A;  3ZDM C;  1GOZ A;  2I38 A;  2H7E A;  2K6D B;  1TS3 A;  2KUQ A;  2MBO A;  1V1O A;  1RM6 C;  2DZM A;  5G5H A;  3AU5 A;  2ZW1 A;  4QAY A;  4JK7 A;  3A58 A;  4AOF A;  2V4I B;  2Z13 A;  4OT1 A;  5C79 A;  1U27 A;  5DIF B;  1OEY J;  1M94 A;  2LHD A;  2WXH A;  2IO2 B;  1E10 A;  1P6S A;  3QAR A;  3WAP A;  2YEP F;  2E2X A;  2N4F A;  2K00 A;  1N3H A;  2BS2 B;  1DBH A;  4GIV A;  3NVZ A;  2N9E B;  1W1D A;  5I2S A;  2CY4 A;  3ZJT A;  5E6O A;  5L83 A;  2DYO A;  1NYQ A;  3VTU A;  2CHZ A;  2AX5 A;  4DXG A;  3W1Y A;  4PT5 A;  3A98 B;  1Y56 A;  4AS1 A;  1Q1O A;  2K1F A;  4AJW A;  3QJZ A;  2PLP A;  4MJS B;  1MPE A;  3BY4 B;  2LVO A;  4WJQ A;  5E6P A;  1FM0 D;  1HA5 A;  3CMM B;  1ZYI A;  2ICI A;  2Z59 B;  5CLQ B;  2PW9 A;  3HHM A;  2D9V A;  1V5P A;  2LFI A;  1JDE A;  3AEB B;  1M7E A;  2VRR B;  3R2T A;  1CK1 A;  2G45 B;  1V8C A;  4M0W B;  2V1Y A;  4KKI A;  5KHO A;  2MBQ A;  5AZH A;  2FE8 A;  2P0F A;  2GMI C;  4MM3 A;  1V49 A;  2D07 B;  2E3T A;  2X18 A;  2M1M A;  5LOP B;  2FUG 1;  4IWO A;  1WZ0 A;  3AED B;  3AU4 A;  2KX3 A;  5BMH A;  3H6N A;  1HTO A;  4F7U P;  1WJU A;  5J2R A;  2AWT A;  2NR2 A;  3BVZ A;  4RF1 A;  2FIF A;  2ZPN A;  3RCZ A;  3H7S A;  5DHF B;  1Q10 A;  3ZIM A;  3TEY A;  1RJ2 A;  1TZO A;  2WQY B;  2LWP A;  2KQS A;  2DFK A;  2YT2 A;  1IGD A;  2LUM A;  4C80 A;  2DAJ A;  2L0F A;  1NTV A;  4W9C A;  2LAS A;  3WAM A;  3Q69 A;  2K9X A;  2LGX A;  1PGB A;  2ON8 A;  5D3V A;  4URK A;  4A5K A;  1MPH A;  4FLH A;  3ZNH B;  2WP9 B;  2D3B A;  1QC6 A;  2L76 A;  2LGS A;  1F52 A;  4OW0 A;  2LKO A;  1EGX A;  1GUA B;  5JH5 C;  2IZV B;  1RFA A;  5HE1 A;  1UNQ A;  1CQV A;  2MH7 A;  2DIK A;  4L1B A;  1XLP A;  4ILG B;  2MEK A;  3J9C A;  3U7Z A;  2KDB A;  3O96 A;  4WWM A;  2KQ4 X;  3VH3 B;  1ZVR A;  2PIA A;  2YVC A;  4JK8 A;  1WMH B;  3ZNI D;  4LNN A;  2CY5 A;  3IG3 A;  4P7I A;  4HAW B;  1KRH A;  5EE3 A;  3NRZ A;  3BK1 A;  2LXC A;  4EOY A;  2LHE A;  5EE1 A;  2L3Z A;  2HD5 B;  3VIA A;  3DBR B;  1LW3 A;  3W1S A;  1V61 A;  1K52 A;  4RFB A;  1U5G A;  3TVV A;  2DYB A;  5LG4 B;  4ZRP A;  2QCZ A;  3RUL A;  2MQJ A;  4BAX A;  3W2D A;  3ULC A;  1WGQ A;  3DBL B;  1MI0 A;  2L1C A;  1WY8 A;  2BYV E;  1L6V A;  1V9J A;  1KM7 A;  1P3R A;  3PZ8 A;  3PLV A;  3AE6 B;  3A8P A;  4ITK A;  3V05 A;  2ZVO A;  3DPD A;  2Y8G A;  2UU7 A;  2VH2 A;  3UGB B;  1XLO A;  5KQ4 A;  3E9S A;  2I2Y A;  4PS8 A;  1CMX B;  1V5O A;  5IAA C;  1N63 A;  1EWC A;  4QJ4 B;  4E71 A;  1YQB A;  1G6J A;  4JKD A;  5I2M A;  2DWQ A;  3CIK A;  1K50 A;  3SDL C;  3DXC A;  2K8C A;  4TSS A;  3CSF A;  5C5B A;  3Q3J A;  3DVN U;  1LGR A;  1P9D U;  3H9D A;  2WXN A;  1C76 A;  4ASW C;  3MP9 A;  1GAQ B;  1TS5 A;  4JQW C;  2WWZ A;  4C7Z A;  1ZUD 2;  2JP2 A;  1QIL A;  2M8S A;  3KYD D;  1K5D B;  1E7U A;  4W9I A;  3P1M A;  2I1J A;  4R3D A;  1R4M I;  1WR1 A;  3ZGZ A;  2JRI B;  3V61 A;  1X86 A;  3FAH A;  1RLF A;  3AEE B;  2FCQ A;  2QKL A;  2IYB A;  1EAZ A;  2MJD A;  2ZJD A;  1TS4 A;  1VR9 A;  1IGC A;  2ZVN A;  4KSK C;  1WGR A;  1UPR A;  3SU8 X;  4IAP A;  3VTW A;  1WI1 A;  2LEK A;  1HTQ A;  1HE8 A;  2EC1 A;  3BVM A;  3ENE A;  1GB4 A;  3EFC A;  4ILH A;  2P0D A;  4ANV A;  1H8C A;  1WI0 A;  1QT9 A;  4JWS C;  1I35 A;  4YL8 A;  3A9K B;  1F9J A;  1L0V B;  2MWS B;  2RDH A;  1ZGU B;  2KDE B;  2C60 A;  1V89 A;  2PVG C;  1GB1 A;  3Q3F A;  2NZ8 B;  4YWG G;  1DDW A;  1MAI A;  1KJT A;  4WJO A;  4XDC A;  2N1W A;  2KTR A;  1SJH D;  1WXA A;  2C7H A;  3N7C A;  3TIX A;  5DPW A;  1L2N A;  4LNO A;  2N0Y A;  2QMT A;  3I63 C;  4MDK E;  4Q2J A;  2DHI A;  1FCC C;  3AE1 B;  3PT2 B;  1E9M A;  2GI9 A;  1FHW A;  2COC A;  3M1I B;  4N58 A;  3A1Q B;  3WIM A;  3ONS A;  4M8M A;  4HPL B;  2R0D A;  2GOW A;  1UH6 A;  1VDV A;  1MK7 B;  3AEC B;  4NQK E;  2RSG A;  4ZHO A;  4MH8 A;  1HXY D;  4F1S A;  4GDL B;  4OZC A;  4B0E A;  2KKC A;  3Q2A C;  2X8X X;  1KC7 A;  1ZM0 A;  2W3R A;  1GG3 A;  2D5G A;  2MWN B;  3AUL A;  3FIL A;  1SIF A;  3L4P A;  2WXJ A;  3NG0 A;  2COA A;  1OMW A;  2ZPY A;  2HJ8 A;  3U7D A;  1HB8 A;  1Y5O A;  2LD9 A;  2OJR A;  1WYW B;  4FHJ A;  5AEK B;  3ZQ4 A;  2MDX A;  4L6E A;  4GMX B;  4C4V A;  1F77 A;  3L54 A;  1FXT B;  1L0X B;  1WR6 E;  3JVZ X;  5LXI B;  3DBH I;  1L0Y B;  4LNK A;  3NW8 A;  2PKO A;  4K81 A;  3RNA C;  3AH7 A;  1OQQ A;  3PGE A;  1PLS A;  4OVV A;  3APD A;  4DQO C;  3BIN A;  5FI0 A;  1M7R A;  4C0A A;  5C23 A;  1UUP A;  4PS7 A;  1PFJ A;  4P1C C;  2YT0 A;  4GB9 A;  4IG7 B;  2K22 A;  3A9J B;  1E8W A;  3KSY A;  4QXA B;  3PLU A;  3VUY A;  4NY0 A;  2ZCC A;  3IAM 1;  2RDB C;  2BS3 B;  1QOF A;  2IDY A;  2KIG A;  2BYE A;  2K39 A;  1RRP B;  2KDI A;  3HSA A;  4RNA A;  3LJ3 A;  1T5X D;  3N1Y C;  4RF0 A;  2HTH B;  2W9N A;  2L83 A;  1ZDX A;  2Z4D A;  2A4Z A;  1WSP A;  1SE3 A;  2MSE D;  1T0S C;  3OLM D;  2LRU A;  3LB8 C;  4KKJ A;  3EFU A;  1ZSQ A;  4DBB A;  1ZC3 B;  3RUI B;  1SBB B;  3FKY A;  1P0R A;  2E6X A;  5HE0 A;  3HQC A;  5C6R A;  3D32 A;  1EUV B;  1L7Y A;  3VHT C;  2P8V A;  3PVW A;  1NDD A;  1AWD A;  5I4D A;  1UZX B;  3B2F A;  1A70 A;  1MVK A;  3SFD B;  4Z2M B;  1U29 A;  1V6E A;  3JSV A;  1WIA A;  2WU5 B;  4ILJ A;  4HLE A;  3ZKJ C;  1C3T A;  3KZ1 A;  4B6W A;  3CWI A;  2AQ2 B;  3H1U A;  3ZLZ A;  3T3N A;  1EO6 A;  2MJ3 A;  1EVH A;  2D9Z A;  2K0P A;  5DI9 B;  1UEL A;  3CST A;  2MBE A;  1WM3 A;  2MKR A;  2QHO A;  1ZDV A;  4DDI D;  2EJ8 A;  5CHW A;  4BBN F;  2V3P A;  2W2X C;  1YN3 A;  3RZF A;  1D4B A;  3KVF B;  2FCS A;  5L95 C;  4WWN A;  4K2P A;  5C3J B;  1NBF C;  4KZC A;  1EM7 A;  1QOA A;  2Q5W D;  4RCO A;  1NVI D;  1VCB A;  4FJV B;  2MA9 B;  2IO0 B;  2WXM A;  1VLB A;  1FRR A;  3AMZ A;  1E8Z A;  1XCQ L;  1FAO A;  1BML C;  1SIJ A;  2UYZ B;  4HCP B;  4JE3 B;  4MAC A;  4ZOH C;  4PYZ A;  1SE4 A;  4ICU A;  4NQL B;  5D7G A;  1UNR A;  5IRS A;  4HPP A;  3QX1 A;  5D3Y A;  5HE3 A;  3AXC A;  2FDQ A;  2TSS A;  1Z2M A;  1D5X C;  2V3S A;  4YSZ B;  3UQA A;  1NI3 A;  3ZVR A;  2AYO B;  4BKS D;  1JRU A;  2JXT A;  4IWQ A;  1OQR A;  1ACA A;  1UBQ A;  5HE2 A;  1ET9 A;  3I5J C;  3TSS A;  4GDK A;  1IUE A;  1SF0 A;  4G0N B;  2J7Q B;  3EGR A;  1FXI A;  3EPY A;  1X11 A;  5H8Y E;  3AE9 B;  3SR6 A;  3PG7 A;  1XXG A;  1IBX A;  2WX1 A;  3ML9 A;  4NSW A;  3NSU A;  2VZK B;  5BYQ A;  3RYT A;  2DA0 A;  2K5P A;  4F8C B;  3QK0 A;  4KHO A;  3MJ5 A;  2IGG A;  2N9L A;  2Y3A A;  2LBB A;  1MKE A;  3A8Q A;  4OVZ A;  2G4S A;  4AJY B;  2DEN B;  4BFR A;  4GPT B;  2J42 A;  2UZR A;  1SE2 A;  4HAT B;  1BTK A;  1QF6 A;  5DPR A;  1VZ6 A;  2Z0Q A;  2BYF A;  1I4X A;  4G50 A;  2IY1 B;  2LVQ A;  1SSN A;  5HHD G;  4HK2 A;  3I9V 1;  3BVG A;  1JAL A;  2DZI A;  1WF9 A;  1WWT A;  2KWV B;  3A4S C;  4IOY X;  3CXB B;  5JHG A;  1I7A A;  2D3G A;  5H92 C;  3R7Q A;  4DDG D;  1J0G A;  3A4R A;  2PZ1 A;  3C19 A;  2KNB A;  3NZ3 A;  1DOI A;  5D6J B;  3JW0 X;  1SB3 C;  1GGO A;  2BB6 A;  1W1H A;  1D6E C;  1MFW A;  2CQU A;  1UD7 A;  1MIZ B;  3H7P A;  4D0N B;  3AE4 B;  1X1F A;  3PEG A;  2KOX A;  2PEA A;  3B2G A;  2J0J A;  3C8Y A;  4W9K A;  3RI7 C;  1WJ4 A;  1V97 A;  2KMM A;  3ZTD A;  1KZG A;  2K49 A;  4PK1 A;  1EWY C;  3NWF A;  5FI1 A;  3NUH B;  4B0M A;  2ZCB A;  2WDQ B;  3QIJ A;  1F2R I;  4XWW A;  1JW9 D;  3W9C B;  3E9O A;  5C16 A;  4HKQ A;  4GNK B;  2KVZ A;  4XX5 A;  4BOS C;  2UVM A;  4ANU A;  2RSU A;  3GE3 C;  1V5M A;  1VD2 A;  2DNF A;  3GP7 A;  2I1K A;  1SJE D;  5G2N A;  3P4Q B;  2L05 A;  1U5D A;  1WX8 A;  2W54 A;  5E6J A;  1Q67 A;  3GYO A;  5D94 A;  2KWU B;  4DXF A;  3QWM A;  1RRB A;  3SEB A;  2J52 A;  5EE9 A;  1WJ6 A;  1AYF A;  5FR3 A;  4W9J A;  4W9G A;  2N7J A;  1SEB D;  1LXD A;  2REX A;  1E7P B;  3PP2 A;  1R7S A;  1RYJ A;  1J7B A;  5CTR C;  4GXB A;  1U2B A;  2SAK A;  2C5L C;  4BKS A;  4F7H A;  4HAZ B;  3URY A;  4P16 A;  1WGY A;  2V3N A;  2OQB A;  2M4N A;  2YS3 A;  1C9F A;  2JY6 A;  3AEF B;  5EDS A;  1Z87 A;  1WRD B;  4NAM A;  1RAX A;  2KUP A;  2KMC A;  1E8Y A;  4XDD A;  2MP2 A;  3VVW B;  4MSQ B;  2HRJ A;  2DYM A;  1TKE A;  3DBS A;  2B3A A;  3KUD B;  4HCN B;  1GC7 A;  4YSX B;  2RVB B;  4K7S A;  4JX1 C;  4HDO A;  1NI2 A;  1SHC A;  3DWM A;  2RD0 A;  3ZJU A;  5JHB A;  2KC1 A;  1SE9 A;  4MGK E;  2NBV A;  1FCL A;  2D4Q A;  2LGI A;  3ML8 A;  2J59 M;  3MHS D;  1HEZ E;  3GZN B;  5BMI A;  4MT7 A;  4PNK A;  3N1X C;  3VUX A;  5L81 A;  1WZ3 A;  2K25 A;  1OEY A;  4WH4 A;  3TCA A;  1WVH A;  2Z0P A;  2RR9 A;  4KIK A;  2L00 B;  3VQI A;  4M00 A;  2QIE B;  4FJY A;  3VDZ A;  3DVG Y;  2WU2 B;  4O1N A;  1VZ7 A;  4A6H A;  4TV3 A;  4HB2 B;  4EUT A;  3RNB C;  2YRY A;  1FRD A;  2ACZ B;  2M0X A;  2JYE A;  2DX5 A;  4DHJ D;  3QAQ A;  3TJP A;  3TEW A;  2X0S A;  1TY0 A;  4ZHP A;  2YEP B;  4H8S A;  1UBI A;  3NY5 A;  4EEW A;  3HIE A;  3AE7 B;  1QQR A;  2IBI B;  5JZE B;  1FOE A;  4ZYN A;  2N9X A;  1JQ4 A;  1T3Q A;  2AQ3 B;  2KO3 A;  2I5F A;  2VRW B;  1P98 A;  2X38 A;  4US9 A;  2LUL A;  5FK9 C;  2EMT A;  4MT5 A;  5GXG B;  5KQ1 A;  2BF8 B;  1WXV A;  1STE A;  2JYT A;  3ZXV A;  1V88 A;  2WLB A;  2LYD A;  3NVW A;  2MFQ A;  3BII D;  1E0Z A;  2OTX A;  2AQ1 B;  2XK5 A;  5C1Z A;  2KIE A;  3KWL A;  3UI3 A;  3M95 A;  1YJI A;  2GBR A;  1U4A A;  2KDM A;  3GE8 C;  1E90 A;  2M0A A;  3O13 A;  1V1P B;  3KQ4 A;  3NOB A;  1IP9 A;  4GMV A;  1TKY A;  2JU6 X;  3E9P A;  3IXS A;  3EA6 A;  1DRO A;  1FFU A;  1YQ3 B;  3PZD A;  4ANW A;  3SBG A;  3DDC B;  1BT0 A;  4YTN B;  3TO1 A;  2KDF B;  3HVD A;  3M3J A;  2W82 A;  2D3A A; 
#chains in the Genus database with same CATH homology
 3FSS A;  3FP5 A;  4JKC A;  1QZE A;  4X57 B;  3TL5 A;  4NJ6 A;  2O6V B;  4XC2 A;  3H7P B;  5J17 A;  2DKQ A;  4HAU B;  1WXS A;  4W9L A;  1XKE A;  1P1A A;  4I6P A;  2HE7 A;  1DYN A;  4W9H A;  3AJ4 A;  3WA0 A;  3F5R A;  2O2V B;  3PHX B;  3KW5 B;  2N7E A;  1KLV A;  3EEC A;  1WXM A;  1Q5W B;  2AL3 A;  3U30 A;  4HAY B;  2C7N B;  5HKH A;  2ZNV C;  4GN1 A;  2KJR A;  2VKI A;  2GBK A;  4NAW A;  1LFD A;  3E66 A;  4WWO A;  4M8N A;  3PHW B;  4IM3 A;  3APC A;  3ZNG C;  1BAK A;  1PQS A;  3QHT A;  3AI5 A;  2W2W A;  3CF6 E;  1FGZ A;  5DHA B;  1KZ7 A;  1J0W A;  3V60 A;  1I2H A;  3W1S C;  4IC7 B;  4G11 A;  4LJO B;  4BKG A;  2DTC A;  1UGM A;  2GCJ A;  3APF A;  2CRF A;  1ST7 A;  2KFK A;  3VUW A;  4JLC A;  3KRW A;  2Z0O A;  1NU2 A;  2MLB A;  2V4L A;  4MGZ E;  4DX9 0;  3PRZ A;  1NVL A;  4K7U A;  1MIX A;  3B08 A;  2MBH A;  4KHA A;  3EHV A;  3SV1 A;  4NJ7 A;  2AEH A;  2MW5 A;  2EKE C;  3HK0 A;  3PS6 A;  3DBR I;  1ZW7 A;  3V62 A;  4JIO U;  3ML4 A;  2GCL A;  2Y7B A;  3G9W A;  3QWZ B;  4K2O A;  3LJU X;  2YSZ A;  1XOD A;  3MTN B;  3DBL I;  1P3Q U;  4WAA A;  3QQ8 B;  2OOB B;  4JKG A;  2WH5 A;  1EF5 A;  1OGW A;  2DX1 A;  2BGF A;  2DHK A;  4JKF A;  3PSE B;  2DKP A;  2ZNV B;  3HW2 B;  2BWF A;  3IFW B;  4JKH A;  4KZ0 A;  4GSW A;  2NPT A;  2KZR A;  4KV2 A;  2Z0D B;  3WAO A;  1AQC A;  2RLO A;  2LJ5 A;  3ZRC A;  2G35 A;  3X0W A;  3V6C B;  3DQV A;  4K1R B;  4KDL B;  3ZO5 B;  4CYE A;  5D27 A;  3IVF A;  3JYU A;  4ZRJ A;  3UQB A;  2WDT B;  3P7Z A;  1W1G A;  1K5G B;  3RCP A;  4GGQ A;  5JP4 A;  1YX5 B;  3FEH A;  2M17 A;  3PVU A;  2LOX A;  5CX3 A;  4MGY E;  1WGD A;  1AWE A;  3DVG X;  1BTN A;  3ZNZ B;  3M62 B;  4MJS A;  1EF1 A;  1X05 A;  4HB4 B;  4DHZ B;  2C9W B;  1QQG A;  2C7M B;  4WWP A;  5CHF A;  2JF5 A;  2CU1 A;  4DX8 A;  4HXD A;  5C5B B;  4EJN A;  3P2B A;  2YLM A;  4ZRK A;  4DK5 A;  3OAW A;  3VXW A;  2KFJ A;  2BCJ A;  2LGD A;  4W9E A;  2Y8F A;  1ZKH A;  2DHZ A;  2GS0 A;  3IBE A;  3NZU A;  3D8E A;  4B95 A;  5LXH A;  4J6I A;  1AAR A;  4K17 A;  3T06 A;  1A5R A;  1NTY A;  2LG1 A;  2D2Q A;  3D8F A;  5GMV A;  5DPS A;  4MGI E;  2R09 A;  3R3M A;  4WJN A;  1XD4 A;  1E5W A;  1XCG A;  1YD8 U;  2KQ7 A;  1MK9 B;  2ROZ B;  5DPT A;  4IM2 A;  1YIW A;  2KTR B;  1WMH A;  2PJH A;  3L08 A;  5D3X A;  4PYU A;  2JVC A;  2BKF A;  2DN6 A;  4WVF B;  3K9O B;  1GNU A;  3ZRF A;  4ICV A;  1MG8 A;  4NPN A;  3ECI A;  2ELB A;  4MY6 A;  1Q0W B;  3L16 A;  3U8Z A;  3R7R A;  2KXJ A;  4WQO B;  4A20 A;  1GC6 A;  4AWJ A;  2LI5 A;  3KUC B;  2FUH B;  2FJ9 A;  5D3W A;  4ZRI A;  4MH0 E;  3DXD A;  3F0W A;  1Z5S B;  2VSZ A;  2DLW A;  3VAW A;  1K8R B;  2DYQ A;  3S2A A;  3A33 B;  5G55 A;  4A3O A;  2D9Y A;  4II2 B;  3MDB C;  1WE6 A;  2LZ6 A;  2EMS A;  4MEM A;  1J19 A;  4WSF A;  2JWZ A;  4FA6 A;  2FCM A;  5J3Q A;  2YS5 A;  3IHP C;  5D2M B;  4FJZ A;  1KI1 B;  1DDV A;  2CHX A;  2NPT B;  1WX7 A;  4RM8 A;  1YX6 B;  1V2Y A;  1C1Y B;  4HPM B;  1TGZ B;  4JKB A;  4B9K A;  2DZK A;  2KHW B;  3KY9 A;  5CLL B;  4CHJ A;  3RD2 A;  4PS3 A;  3RT3 B;  3D8D A;  2GBN A;  4HB0 B;  5LON B;  1D3Z A;  4A6K A;  4BKT A;  4HAV B;  2V76 A;  4IWP A;  4BVU C;  3A9K A;  5EFX A;  3FM8 C;  2FJL A;  4DWF A;  4JL9 A;  4KSL C;  2D11 A;  3JSV B;  5AZG A;  2RUK B;  3SUZ A;  2LRW A;  5J18 A;  2UZS A;  2ZEQ A;  2JXX A;  3NS8 A;  5JVL A;  3QBV B;  1XR0 B;  1OY2 A;  1WGH A;  2IFS A;  3A1Q A;  1XD3 B;  3PRM B;  2N1V A;  3HM3 A;  1NTI A;  4GDL A;  4JK9 A;  2FCN A;  2LUE A;  3ZVV A;  2N7D A;  4FUL A;  4RMA A;  4HB3 B;  2PPH A;  2MX2 A;  3KUZ A;  2K6Q A;  1V80 A;  2CHW A;  2ABD A;  2LVP A;  2NS5 A;  3UZT A;  4LDT D;  2UWQ A;  2ZZP B;  5GOW B;  1H10 A;  2K8B A;  4GU2 A;  1OQY A;  2KVR A;  1WH3 A;  2KTF A;  2JPH A;  3DOW A;  4GDK B;  4WJP A;  3SYX A;  1H4R A;  4JKA A;  1E7V A;  3KYC D;  1V5T A;  1PMS A;  2GBM A;  2YF0 A;  3DCG A;  5KHQ A;  4EKU A;  3ENB A;  3A9J A;  2D9X A;  2N9P C;  2FID A;  2LGY A;  1KOT A;  2NCN A;  4ZDV A;  2YT1 A;  1IPG A;  3UF8 A;  1TQZ A;  4BOZ B;  5IJM A;  2KLG A;  4MK0 A;  5DH9 B;  1X1G A;  1Y19 B;  3DXE A;  2HTH A;  4FN2 A;  2GJY A;  2L8J A;  2NBW B;  3QC8 B;  4F7Z A;  2P0H A;  3M63 B;  2W2X D;  2KK8 A;  3MPX A;  3V6E B;  3SNH A;  1TTN A;  1FHO A;  4AUQ C;  2CB8 A;  3TFM A;  3ZTC A;  3OJ3 A;  3BJI A;  1V86 A;  2DHJ A;  4HVB A;  4I6N B;  4LCD E;  3B0A A;  2MBB B;  1V5U A;  4TQ1 A;  2KJH B;  3GOE A;  2LXA A;  2KLC A;  3ULB A;  1LM8 B;  3QCA A;  2K8H A;  1TXD A;  2COP A;  3R66 C;  3T9L A;  2COD A;  1WGU A;  2R2O A;  2G4D B;  4WJ7 A;  1J8C A;  4FHK A;  2D9W A;  3ALB A;  2XEW A;  5E6N A;  4IW0 A;  1TJ6 A;  2KD0 A;  4XZ4 A;  4A6F A;  2PE6 B;  1ZC4 B;  1X1M A;  1B55 A;  4XWX A;  1YJ1 A;  2CAY A;  5FR6 A;  4PQ0 A;  2IO3 B;  4E74 A;  3E9L A;  2KX0 A;  2Q13 A;  4MEL A;  2RQ1 A;  2LOZ A;  4FAD A;  1HBK A;  1IYF A;  1HB6 A;  3GZN I;  4TUU A;  4CO7 A;  3SBT A;  3P6A A;  2A5U A;  3N3K B;  3WAL A;  1P5T A;  4HDQ A;  1I42 A;  2KAN A;  5BO4 B;  2I5C A;  3C0R B;  4Y94 A;  4IFS A;  2DYN A;  3VTV A;  2M38 A;  4MSM B;  4EZJ A;  4E3C A;  1XX0 A;  3FLV A;  4II3 B;  2QKM A;  2MP2 B;  4LJP B;  2G3Q B;  3V5W A;  3I3T B;  5DCN A;  3KRX A;  3ZW3 A;  2COF A;  2WX0 A;  2IYD B;  3EC8 A;  1XQQ A;  4EZL A;  2JRH A;  4K7W A;  1KBL A;  2K2J A;  3ODX A;  4DXA B;  4HAX B;  2DZJ A;  3PV1 A;  1WJM A;  3UIO B;  2NBV B;  1TBE A;  5JHA A;  2CS4 A;  3L13 A;  2L0T A;  2MCN B;  3TMP B;  4G3X B;  3HIZ A;  1FHX A;  4RM9 A;  1T0Y A;  2ELA A;  1UNP A;  4KIK B;  4TYZ A;  3L10 B;  1BWN A;  1U5F A;  1V81 A;  2NMB A;  2BKR B;  2DX5 B;  2Y5B B;  1OQN A;  3UIP B;  4Z2N A;  2KN5 A;  2RGN B;  2D10 A;  3K9P B;  3ODW A;  2ASQ A;  2KMA A;  4BBK A;  1WGG A;  2KCJ A;  2XQN M;  3ZDT A;  3L17 A;  4AP4 C;  2JZZ A;  1R4N I;  4F7G A;  5LLI A;  4KHB B;  3UIN B;  2XK5 B;  2DAF A;  1IRS A;  5KCV A;  3MJW A;  3SD5 A;  4DHZ E;  1S1Q B;  2FAZ A;  3VH4 B;  2FNJ B;  4EMO A;  2BPS A;  2O6V D;  5CHV C;  2XBB C;  3HM6 X;  4BBN C;  2Z0E B;  5AZF A;  4IM0 A;  4OVU A;  4DBG A;  4HJK A;  4CHM A;  3PRP B;  4B6H A;  4TKN A;  4JKE A;  1LB1 A;  2JT4 B;  3X23 A;  3TBL D;  1S3S G;  3TW1 A;  1WJN A;  1DDM A;  4A6F B;  2N23 A;  3VOQ A;  2RPQ A;  5JHH A;  2L7R A;  2M14 A;  1TZ1 A;  3NZS A;  4HHV A;  2JUO A;  4NNJ B;  2KJ6 A;  4NAW B;  2R2Q A;  1E8X A;  2AL6 A;  3WYF B;  5TR5 A;  3QA8 A;  4CHK A;  2ROV A;  4HWI B;  1WG7 A;  3VFK A;  3GYP A;  4N9F 4;  1ISN A;  2GBJ A;  1UEF A;  3OAN A;  1XT9 B;  4LDT B;  1OTR B;  1U5E A;  2CKH B;  1UPQ A;  4IUM B;  2NVU I;  1WJ1 A;  2MRP A;  2YS1 A;  2J0M A;  2IY0 B;  3L0W B;  1LQB A;  4DHJ B;  3WAN A;  4KDI C;  1VBH A;  4YON A;  2CR5 A;  4GOC A;  2IO1 B;  5J3T A;  2KFK B;  3PRE A;  1WFY A;  3N32 A;  4FBJ B;  1SGH A;  4A3P A;  3ODO A;  3ZUN A;  4I6L B;  3DVN V;  4EFO A;  4EZK A;  1GJZ A;  3PTF C;  1WE7 A;  3LDZ E;  5JLJ B;  3OJ4 B;  2RGF A;  2RNR B;  3SO6 A;  1WM2 A;  5IA7 A;  3T8M A;  4W9D A;  2NBU A;  2PE9 A;  3KH0 A;  3RZW C;  2KGX B;  2H7D A;  3N30 A;  2J0K A;  2ADZ A;  2KWC A;  3PPA A;  4KAX B;  3NHE B;  3B1L X;  2L2I A;  2WYQ A;  1WX9 A;  2K2U A;  3O65 B;  4JGH B;  4JKG B;  4ANX A;  1VBG A;  2O6V A;  3PVL A;  1FGY A;  2BWE S;  2KC2 A;  1Y8R C;  2JZ3 B;  1FB8 A;  4GZU A;  2R82 A;  4KVG B;  1DIK A;  3PSC A;  4TQ0 A;  3SHQ A;  4W9F A;  2O2V A;  5J3Y A;  3ZDM C;  2H7E A;  2K6D B;  2MBO A;  2DZM A;  3AU5 A;  4JK7 A;  4AOF A;  5C79 A;  1U27 A;  5DIF B;  1OEY J;  1M94 A;  2IO2 B;  1P6S A;  3QAR A;  3WAP A;  2E2X A;  2N4F A;  2K00 A;  1N3H A;  1DBH A;  4GIV A;  2N9E B;  1W1D A;  2CY4 A;  5E6O A;  5L83 A;  2DYO A;  3VTU A;  2CHZ A;  3W1Y A;  3A98 B;  1Q1O A;  2K1F A;  4AJW A;  3QJZ A;  4MJS B;  3BY4 B;  2LVO A;  4WJQ A;  5E6P A;  3CMM B;  2Z59 B;  5CLQ B;  3HHM A;  2D9V A;  1V5P A;  1JDE A;  1M7E A;  2VRR B;  2G45 B;  4M0W B;  2V1Y A;  5KHO A;  2MBQ A;  5AZH A;  2P0F A;  2GMI C;  4MM3 A;  1V49 A;  2D07 B;  2X18 A;  2M1M A;  5LOP B;  4IWO A;  1WZ0 A;  3AU4 A;  2KX3 A;  3H6N A;  4F7U P;  1WJU A;  5J2R A;  2AWT A;  2NR2 A;  2FIF A;  2ZPN A;  3RCZ A;  3H7S A;  5DHF B;  3ZIM A;  1RJ2 A;  2LWP A;  2KQS A;  2DFK A;  2DAJ A;  2L0F A;  1NTV A;  4W9C A;  2LAS A;  3WAM A;  4URK A;  2LGX A;  5D3V A;  4A5K A;  1MPH A;  4FLH A;  3ZNH B;  1QC6 A;  2L76 A;  2LKO A;  1EGX A;  1GUA B;  5JH5 C;  2IZV B;  1RFA A;  5HE1 A;  1UNQ A;  2DIK A;  4ILG B;  2KDB A;  3O96 A;  3VH3 B;  1ZVR A;  2YVC A;  4JK8 A;  1WMH B;  3ZNI D;  2CY5 A;  3IG3 A;  4P7I A;  4HAW B;  2LXC A;  4EOY A;  2L3Z A;  2HD5 B;  3VIA A;  1LW3 A;  3W1S A;  1V61 A;  1U5G A;  3TVV A;  2DYB A;  3RUL A;  2MQJ A;  3ULC A;  1WGQ A;  2L1C A;  1WY8 A;  2BYV E;  1V9J A;  1KM7 A;  1P3R A;  3PLV A;  3A8P A;  2ZVO A;  3DPD A;  2Y8G A;  3UGB B;  5KQ4 A;  4PS8 A;  1CMX B;  1V5O A;  5IAA C;  4E71 A;  1YQB A;  1G6J A;  4JKD A;  3CIK A;  3SDL C;  3DXC A;  2K8C A;  3CSF A;  5C5B A;  3Q3J A;  3DVN U;  1P9D U;  3H9D A;  4ASW C;  4JQW C;  2WWZ A;  2JP2 A;  2M8S A;  3KYD D;  1K5D B;  1E7U A;  4W9I A;  2I1J A;  1R4M I;  1WR1 A;  2JRI B;  3V61 A;  1X86 A;  1RLF A;  2FCQ A;  2QKL A;  2IYB A;  1EAZ A;  2ZJD A;  2ZVN A;  4KSK C;  1WGR A;  1UPR A;  3SU8 X;  4IAP A;  3VTW A;  1WI1 A;  1HE8 A;  2EC1 A;  3ENE A;  4ILH A;  2P0D A;  4ANV A;  1H8C A;  1WI0 A;  1I35 A;  4YL8 A;  3A9K B;  1F9J A;  2MWS B;  1ZGU B;  2KDE B;  2C60 A;  1V89 A;  3Q3F A;  2NZ8 B;  1DDW A;  1MAI A;  1KJT A;  4WJO A;  2N1W A;  2KTR A;  1WXA A;  2C7H A;  3N7C A;  3TIX A;  5DPW A;  1L2N A;  2N0Y A;  4MDK E;  2DHI A;  3PT2 B;  1FHW A;  2COC A;  3M1I B;  3A1Q B;  3WIM A;  3ONS A;  4M8M A;  4HPL B;  2R0D A;  2GOW A;  1UH6 A;  4NQK E;  1MK7 B;  2RSG A;  4F1S A;  4GDL B;  2KKC A;  1KC7 A;  1ZM0 A;  1GG3 A;  2MWN B;  3AUL A;  1SIF A;  2COA A;  1OMW A;  2ZPY A;  2HJ8 A;  3U7D A;  1HB8 A;  1Y5O A;  2LD9 A;  2OJR A;  1WYW B;  4FHJ A;  5AEK B;  2MDX A;  4L6E A;  4GMX B;  3L54 A;  1FXT B;  3JVZ X;  1WR6 E;  5LXI B;  3DBH I;  4K81 A;  3PGE A;  1PLS A;  4OVV A;  3APD A;  3BIN A;  5FI0 A;  1M7R A;  4C0A A;  5C23 A;  4PS7 A;  1PFJ A;  2YT0 A;  4GB9 A;  4IG7 B;  3A9J B;  1E8W A;  3KSY A;  3PLU A;  3VUY A;  4NY0 A;  2ZCC A;  2BYE A;  2K39 A;  1RRP B;  2KDI A;  3LJ3 A;  2HTH B;  2W9N A;  2A4Z A;  2MSE D;  3OLM D;  2LRU A;  3EFU A;  1ZSQ A;  4DBB A;  1ZC3 B;  3RUI B;  1P0R A;  5HE0 A;  3HQC A;  5C6R A;  3D32 A;  1EUV B;  1L7Y A;  3VHT C;  2P8V A;  3PVW A;  1NDD A;  1UZX B;  4Z2M B;  1U29 A;  1V6E A;  3JSV A;  1WIA A;  4ILJ A;  4HLE A;  3ZKJ C;  1C3T A;  3KZ1 A;  4B6W A;  3ZLZ A;  3H1U A;  1EO6 A;  1EVH A;  2D9Z A;  5DI9 B;  1UEL A;  3CST A;  2MBE A;  1WM3 A;  2MKR A;  2QHO A;  4DDI D;  2EJ8 A;  5CHW A;  4BBN F;  2W2X C;  3RZF A;  3KVF B;  2FCS A;  5L95 C;  4WWN A;  4K2P A;  1NBF C;  4KZC A;  1VCB A;  4FJV B;  2MA9 B;  2IO0 B;  1E8Z A;  1FAO A;  4HCP B;  2UYZ B;  4PYZ A;  4ICU A;  4NQL B;  5D7G A;  1UNR A;  3QX1 A;  5D3Y A;  5HE3 A;  3AXC A;  2FDQ A;  1Z2M A;  2V3S A;  3UQA A;  3ZVR A;  2AYO B;  4BKS D;  1JRU A;  4IWQ A;  1ACA A;  1UBQ A;  5HE2 A;  4GDK A;  4G0N B;  2J7Q B;  3EPY A;  1X11 A;  3PG7 A;  2WX1 A;  3ML9 A;  4NSW A;  3NSU A;  3RYT A;  2DA0 A;  4F8C B;  3QK0 A;  4KHO A;  2LBB A;  1MKE A;  3A8Q A;  2G4S A;  4AJY B;  2DEN B;  4BFR A;  4GPT B;  2UZR A;  4HAT B;  1BTK A;  5DPR A;  2Z0Q A;  2BYF A;  4G50 A;  2IY1 B;  2LVQ A;  4HK2 A;  2DZI A;  1WF9 A;  2KWV B;  3A4S C;  4IOY X;  3CXB B;  5JHG A;  1I7A A;  2D3G A;  3R7Q A;  4DDG D;  1J0G A;  3A4R A;  2PZ1 A;  2KNB A;  5D6J B;  3JW0 X;  1GGO A;  1W1H A;  2CQU A;  1UD7 A;  1MIZ B;  3H7P A;  4D0N B;  1X1F A;  3PEG A;  2KOX A;  2PEA A;  2J0J A;  4W9K A;  1WJ4 A;  3ZTD A;  1KZG A;  5FI1 A;  2ZCB A;  3QIJ A;  3E9O A;  5C16 A;  4XX5 A;  4BOS C;  2UVM A;  4ANU A;  2RSU A;  1V5M A;  1VD2 A;  2I1K A;  5G2N A;  2L05 A;  1U5D A;  1WX8 A;  1Q67 A;  3GYO A;  5D94 A;  2KWU B;  3QWM A;  1RRB A;  1WJ6 A;  4W9J A;  4W9G A;  1LXD A;  2REX A;  3PP2 A;  5CTR C;  4GXB A;  1U2B A;  2C5L C;  4BKS A;  4F7H A;  4HAZ B;  1WGY A;  2OQB A;  2M4N A;  2YS3 A;  2JY6 A;  5EDS A;  1Z87 A;  1WRD B;  1RAX A;  2KUP A;  2KMC A;  1E8Y A;  2MP2 A;  3VVW B;  4MSQ B;  2HRJ A;  2DYM A;  3DBS A;  2B3A A;  3KUD B;  4HCN B;  1GC7 A;  2RVB B;  4K7S A;  4HDO A;  1NI2 A;  1SHC A;  2RD0 A;  5JHB A;  2KC1 A;  1SE9 A;  4MGK E;  2D4Q A;  3ML8 A;  2J59 M;  3MHS D;  4MT7 A;  4PNK A;  3VUX A;  5L81 A;  1WZ3 A;  2K25 A;  1OEY A;  3TCA A;  1WVH A;  2Z0P A;  2RR9 A;  4KIK A;  2L00 B;  3VQI A;  4FJY A;  3VDZ A;  3DVG Y;  4A6H A;  4TV3 A;  4HB2 B;  4EUT A;  2YRY A;  2M0X A;  2DX5 A;  4DHJ D;  3QAQ A;  3TJP A;  2X0S A;  4H8S A;  1UBI A;  3NY5 A;  4EEW A;  2IBI B;  5JZE B;  1FOE A;  4ZYN A;  2N9X A;  2KO3 A;  2I5F A;  2VRW B;  1P98 A;  2LUL A;  2EMT A;  5KQ1 A;  2BF8 B;  1WXV A;  1V88 A;  2LYD A;  2MFQ A;  2OTX A;  2XK5 A;  5C1Z A;  3M95 A;  2GBR A;  1U4A A;  1E90 A;  3NOB A;  1IP9 A;  4GMV A;  3E9P A;  1DRO A;  3PZD A;  4ANW A;  3SBG A;  3DDC B;  1BT0 A;  3TO1 A;  2KDF B;  3M3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...