1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords radixin
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
1RAXA 2WX1A 2KANA 3B1LX 2COAA 5JP4A 5KHQA 4GB9A 1MK7B 5J18A 4Z2MB 2YS5A 3ECIA 1WJNA 3VUWA 1F9JA 3H9DA 2COFA 5C1ZA 2NR2A 3QK0A 1J0WA 1WI1A 1UGMA 2YS3A 1C3TA 1KZ7A 3U30A 4DXAB 2BPSA 4K2OA 1VD2A 1WMHA 2L0TA 3SDLC 4W9LA 4ASWC 2LOZA 4NJ7A 1FB8A 4LDTB 3IVFA 3VVWB 4MEMA 1NU2A 2YLMA 3D8FA 1OGWA 4K17A 2MBEA 3M3JA 2N1WA 3AULA 3IBEA 3TL5A 5D3YA 2KXJA 4HCPB 4IG7B 2LD9A 4HB4B 4DHJB 5L95C 2KOXA 2LKOA 4K2PA 1E7UA 4A6FB 1XQQA 4KHAA 1V5MA 4K81A 2ELBA 3EECA 4BBNC 1ST7A 3ML4A 2L00B 4MJSA 3DOWA 1HBKA 4GXBA 2KFKB 4NSWA 2DTCA 3CF6E 4WWOA 2MBHA 2KO3A 5E6PA 2DZKA 1KI1B 2D4QA 2KLCA 3DXDA 4TQ1A 2QKLA 4IFSA 3AJ4A 4WJ7A 2L0FA 4MK0A 5LXHA 3A33B 5C16A 2K25A 2ZZPB 2J0KA 4KDIC 3GYPA 4CHJA 1WX9A 4RM8A 3OANA 1P9DU 3PEGA 3MDBC 1KZGA 3SV1A 3N7CA 2PPHA 1WGGA 2HTHA 4IM0A 1WZ0A 5E6OA 2RLOA 5C6RA 2G4DB 3D32A 2A4ZA 2FJLA 3H7PA 2LVPA 2VKIA 2D07B 5IA7A 4EUTA 1OQYA 2NBUA 2KN5A 1TBEA 4I6NB 4FHKA 1WJUA 4JIOU 1WXSA 3U8ZA 2L1CA 2JRIB 1KOTA 2BKRB 3PP2A 4K1RB 3HM6X 2LRUA 1SHCA 3JVZX 1P5TA 1AARA 3RD2A 1S3SG 1V86A 2DHJA 3TVVA 1EVHA 4W9EA 2RD0A 2LVQA 4W9KA 2LXCA 4EZKA 3ZUNA 3UF8A 3PSEB 2H7DA 1DROA 2YT1A 1BWNA 2MRPA 3VIAA 1E8YA 4W9CA 4KSKC 1UNQA 1WGYA 1W1HA 3PVLA 4K7WA 4JQWC 1MIZB 1X1FA 2KJRA 2CODA 4IC7B 1AWEA 3FEHA 3SUZA 2DHKA 3ZVVA 2ZJDA 4FULA 4WSFA 1E8WA 2NBVB 2HD5B 4A3OA 2OTXA 1UNRA 2GMIC 3WALA 3CXBB 3H6NA 4KDLB 1UBIA 2K2UA 2K8HA 3QIJA 4E74A 2MA9B 2I5CA 2DKQA 4GDKB 2AEHA 5C5BB 2X18A 2J59M 1RRPB 1OEYJ 1I35A 1V5OA 2EJ8A 2UVMA 3NZSA 3D8EA 3VQIA 3L13A 2D9WA 1K5DB 4HJKA 2KDEB 1K8RB 1K5GB 3ODWA 4H8SA 4AOFA 3WIMA 2JUOA 4BBNF 1HE8A 3PGEA 1OY2A 1U5EA 1YX5B 2I1JA 5E6NA 2UYZB 2K8CA 2W9NA 3V6EB 4GOCA 3T9LA 4W9FA 3L08A 3UINB 5JHHA 2FCNA 1HB6A 1X1MA 1P98A 2RUKB 3GYOA 3R7RA 2O2VA 5J3QA 4DHZB 4PS8A 3CSTA 2FJ9A 1ZW7A 4EJNA 1UEFA 5DIFB 2IBIB 2YRYA 1DBHA 3FSSA 3L0WB 1WH3A 5DI9B 2MBQA 3HHMA 2C5LC 1U4AA 3UQAA 2AWTA 1ZC4B 2DX5A 3R7QA 3KY9A 2IO2B 4IAPA 2D11A 1MK9B 1NI2A 1MAIA 4FA6A 4OVUA 4L6EA 2KVRA 2ZPNA 2DYOA 4TUUA 1WZ3A 2KTRB 2UWQA 2DYBA 3HIZA 2Z0PA 3TBLD 2LUEA 4IM2A 1M94A 4AJWA 2XQNM 5J17A 4HAWB 2KD0A 2G45B 3X23A 2MKRA 4HB0B 3V62A 4HXDA 4J6IA 4OVVA 1BAKA 2IYBA 4GIVA 2KQ7A 4IW0A 3KZ1A 1FOEA 3KUZA 4MGZE 4IWPA 5IAAC 3N32A 2KDFB 3RCZA 2LZ6A 3LJUX 4EOYA 3DPDA 1H10A 4HHVA 1WX8A 4MELA 2JP2A 2VRWB 2DZIA 2RQ1A 2JZZA 3M62B 1WYWB 4EFOA 2KKCA 2XEWA 2PZ1A 2IO3B 2KJ6A 3VH4B 4ZRKA 2K6DB 2W2XD 3KYCD 2M14A 1V5PA 4MH0E 2PE6B 2K6QA 2BYVE 5G55A 1Q1OA 1ACAA 2EMTA 2KGXB 3A8QA 4HWIB 3DDCB 3ML9A 4IM3A 4K7SA 3NZUA 2KQSA 4MM3A 2CHXA 2NBWB 5CLLB 2KNBA 2GBRA 2ASQA 2FUHB 2KJHB 1ZKHA 4YONA 1WY8A 4NQLB 3I3TB 3HQCA 1WXMA 3TIXA 3WA0A 3RULA 3ONSA 4P7IA 4FLHA 2NVUI 1IP9A 3VAWA 3ZRCA 1NBFC 1TXDA 4MY6A 3IFWB 2FIDA 2GCJA 4A20A 3TJPA 4A6KA 3QCAA 1BTNA 2MBOA 2M38A 2REXA 3AXCA 3RZFA 2C7HA 2M8SA 3MJWA 1VCBA 2K39A 3P7ZA 4B6HA 4JL9A 1EF1A 4PNKA 4MSQB 2R0DA 3PTFC 1E90A 3PHXB 3PRMB 3PLUA 4GZUA 1Q67A 2DHIA 1XX0A 5G2NA 2KFJA 4GN1A 2JT4B 2V1YA 1Z2MA 3ML8A 2IYDB 3PZDA 1WR6E 2G3QB 2ZNVB 2CY4A 4GDLB 4KVGB 1MIXA 2GOWA 4KIKA 1RJ2A 4I6LB 1E8ZA 4JGHB 3UIPB 4X57B 2FNJB 2ROVA 2ZCCA 1WGDA 3OJ3A 4PQ0A 2OQBA 3BJIA 2P0HA 2D9VA 4BKSA 4G11A 4B9KA 2CS4A 3V60A 2N0YA 4NAWA 1V5TA 2OOBB 4DDGD 3CIKA 4HCNB 3AU5A 3PHWB 2XBBC 2VSZA 2CAYA 1WVHA 4GMVA 2RSUA 2KX3A 5HE3A 3PV1A 1WGRA 3ZW3A 3NY5A 2LG1A 4W9HA 3N30A 4A6HA 3RCPA 1YX6B 3QWMA 1V49A 4YL8A 2JWZA 2KZRA 4GGQA 3PVUA 3VDZA 3D8DA 3KSYA 4BOSC 5KQ1A 5TR5A 4KV2A 2PJHA 2LWPA 3WAMA 3QARA 4N9F4 2BGFA 1L2NA 2D2QA 2Z0QA 1MKEA 4DK5A 2O6VB 4HAVB 2XK5B 1XODA 3PSCA 3UZTA 2N9EB 1WJ1A 5DHAB 3PREA 1R4MI 2ABDA 1WJ6A 1Q5WB 3JYUA 2EC1A 4CYEA 1WX7A 1JRUA 1SE9A 5AZFA 2NMBA 1KM7A 2FAZA 4F8CB 3X0WA 2KHWB 2KDIA 2C9WB 2ELAA 4BKSD 2LXAA 1WFYA 3OAWA 5DPTA 2DENB 4I6PA 2M1MA 2IZVB 3CSFA 4E71A 2N9XA 2NS5A 4IWOA 2P8VA 1OEYA 1J19A 5L83A 3KUDB 2O2VB 1FXTB 2G35A 1TQZA 1XD4A 4KSLC 4G0NB 1D3ZA 3T06A 2B3AA 5JHGA 2YT0A 2M0XA 2GCLA 1ZSQA 3HW2B 2COPA 2KWVB 3NS8A 1EUVB 3QX1A 3AI5A 2ADZA 1YD8U 5J3YA 2FIFA 2DX5B 4DHZE 1PQSA 3RZWC 3ODXA 3TO1A 5C23A 1DDVA 2A5UA 3W1SC 1RLFA 3A9JB 2RVBB 3QHTA 2IY1B 1V6EA 3L17A 3KRWA 2LOXA 4WWPA 1SIFA 4XX5A 3WYFB 4CHMA 1V61A 3Q3FA 1HB8A 4DBBA 1AQCA 2BWFA 3F0WA 5EDSA 2Y8FA 4A6FA 2ZCBA 2Y7BA 1N3HA 3FP5A 4HDOA 1TGZB 5GOWB 3JSVB 5LLIA 3A9KB 4II3B 4HVBA 2BCJA 1LFDA 2HJ8A 3RYTA 3ULCA 4ICVA 4IOYX 5JLJB 1EAZA 3VOQA 1XCGA 4NY0A 1B55A 4EEWA 1E5WA 2UZRA 4IWQA 3QC8B 2KFKA 1IRSA 2DA0A 4WJPA 3SD5A 2ZPYA 3B0AA 2C60A 4PS3A 1DYNA 3APCA 3EFUA 1EF5A 2BF8B 1Q0WB 5DHFB 2CRFA 1P6SA 4RM9A 4HAZB 3EHVA 3A4RA 1Z5SB 2LI5A 4WJQA 4LDTD 4Y94A 3R3MA 3ENEA 3C0RB 4G3XB 5FI0A 4AWJA 4HB2B 4KZCA 2BYFA 5FR6A 2VRRB 1FHWA 2J0MA 4TYZA 2RR9A 3OJ4B 2LULA 4II2B 4XC2A 4ZRIA 2ZVOA 4DHJD 4NPNA 4K7UA 4MSMB 4ANXA 4DWFA 2NPTA 2MWNB 5CHWA 4ZDVA 3B08A 4C0AA 2JF5A 3VUXA 2K1FA 2MDXA 2DZJA 1I2HA 2QKMA 3TCAA 3ZNGC 5C79A 5CX3A 4RMAA 3A98B 5DCNA 4WVFB 2IY0B 3DVNV 1XD3B 2KTFA 3DBSA 2MWSB 3F5RA 2QHOA 5D7GA 2DYNA 2PEAA 2ROZB 1WMHB 1QC6A 4HK2A 4HB3B 1XR0B 3SNHA 1TJ6A 3OLMD 1PMSA 3SO6A 1ISNA 1UZXB 1V81A 2EKEC 4EZLA 2I5FA 1V80A 1WF9A 4LJOB 2E2XA 1FHXA 4B95A 3QQ8B 4W9DA 3V61A 1H8CA 3SU8X 3PG7A 1P0RA 2CU1A 4FADA 2V3SA 2RNRB 2KWCA 3WAOA 3ZDMC 2Z59B 3ZNZB 5D3WA 4BVUC 3QA8A 1X11A 2K8BA 4AP4C 1E8XA 2JXXA 2CY5A 5JH5C 3H1UA 3ZDTA 4XZ4A 4EZJA 1KJTA 2KX0A 3M95A 1CMXB 4DX8A 2LASA 1X86A 4ZYNA 1XKEA 4XWXA 4GDKA 4MJSB 5C5BA 4KZ0A 3APDA 3ZO5B 4FHJA 1J0GA 4BFRA 1M7EA 1QZEA 3PRZA 1YJ1A 3DVGY 3ZTCA 1P3RA 3PLVA 2P0FA 1MPHA 2IO1B 2COCA 5LOPB 1GC7A 1I7AA 1BT0A 4W9JA 1WM2A 2R09A 4W9IA 3QBVB 4GU2A 2C7MB 4DBGA 4F7HA 2MP2A 3TMPB 2LVOA 5DH9B 4FJVB 4WJOA 4GPTB 4PS7A 1XT9B 2HTHB 2DHZA 4FJYA 1RRBA 1UBQA 2OJRA 2DAFA 3DCGA 1M7RA 4B6WA 3H7PB 2L05A 3SYXA 4CO7A 5HE1A 3KRXA 3H7SA 2M4NA 1C1YB 4PYUA 5LONB 2JPHA 1LXDA 2NCNA 5KQ4A 1WXVA 2MBBB 4EMOA 3T8MA 3ZNHB 1WGUA 3LDZE 2MX2A 1Y8RC 3O65B 5JHAA 1WG7A 2Q13A 2J7QB 1E7VA 1R4NI 2KTRA 2AL3A 3QWZB 1W1GA 3QAQA 1EGXA 4FN2A 3N3KB 3R66C 2GBNA 1YIWA 3VXWA 1U2BA 2RGNB 3NHEB 3P2BA 2D10A 2CHZA 1ZGUB 3VH3B 1PLSA 1GNUA 3EPYA 3M63B 4F7GA 2WDTB 3CMMB 3PT2B 2KDBA 1UNPA 3VTVA 4G50A 2JRHA 2HE7A 4MT7A 2LGXA 1G6JA 4KAXB 5JZEB 2YS1A 2UZSA 1EO6A 1GUAB 4DDID 4ZRJA 5DPRA 1DDMA 1WI0A 2CR5A 3RT3B 2DLWA 1WJ4A 3UQBA 1W1DA 1WR1A 1U27A 2WYQA 2YVCA 1V88A 1RFAA 3ODOA 5CLQB 4HAUB 1U5FA 1LM8B 2C7NB 2ZNVC 4E3CA 2L76A 1P1AA 3A1QA 2KMCA 3ALBA 1U29A 4A3PA 2MCNB 1I42A 5CTRC 2RSGA 1NDDA 2AYOB 2DX1A 3PS6A 3SHQA 2YSZA 5D27A 4KHOA 2N23A 2FCMA 1WE7A 3L54A 4AUQC 4TQ0A 2BYEA 1V9JA 2Z0DB 2L2IA 3KH0A 1V2YA 4Z2NA 2N9PC 2N7DA 4A5KA 3BY4B 1ZM0A 2WX0A 2K2JA 2LGYA 2KMAA 2I1KA 4WQOB 2NPTB 4TV3A 3APFA 1UD7A 3HM3A 4LJPB 2LRWA 3DQVA 4HATB 1UPQA 4MGKE 2N1VA 5DPSA 1J8CA 1PFJA 1Y19B 1OTRB 5JHBA 3DBHI 2DN6A 5IJMA 4WJNA 3TFMA 1FGYA 2EMSA 3AU4A 3M1IB 2WH5A 2KLGA 2GBKA 1WJMA 4AJYB 4GDLA 1NTYA 2N7EA 2V76A 1UPRA 3A8PA 3VUYA 1YQBA 4NNJB 2DAJA 1A5RA 1FHOA 2RPQA 3A4SC 4ANUA 2Y8GA 4HAXB 2W2WA 1GC6A 3ZVRA 3HK0A 3UIOB 1WE6A 1IYFA 4F7ZA 1NTIA 2D3GA 3KVFB 3UGBB 2FDQA 3RUIB 1U5DA 2DZMA 3IG3A 4MGIE 4BOZB 2KC1A 2DYMA 3S2AA 2KWUB 2MQJA 4KHBB 3O96A 3Q3JA 3VFKA 1X05A 3U7DA 3PRPB 5DPWA 3L10B 2AL6A 3DVNU 2H7EA 2D9ZA 1GG3A 2W2XC 2BKFA 2LJ5A 3GZNI 2CQUA 3ULBA 1SGHA 1DDWA 3ZRFA 2ZEQA 4URKA 1U5GA 3ZTDA 2O6VA 2PE9A 3ZKJC 1WGHA 1IPGA 2XK5A 3VTUA 5AZGA 2G4SA 4FJZA 4F7UP 1WXAA 2CKHB 2J0JA 2CHWA 4NQKE 4HAYB 4JLCA 2MLBA 5D3XA 3W1SA 4DX90 1LW3A 1NTVA 2DFKA 4ANVA 2NZ8B 2RGFA 4M8MA 5LXIB 2MP2B 2KC2A 3KUCB 5D6JB 3IHPC 3MTNB 2YF0A 4GMXB 5KHOA 2IO0B 3FM8C 3V5WA 5GMVA 3LJ3A 2M17A 2LGDA 3G9WA 1FGZA 2L8JA 3DVGX 1FAOA 2K00A 1S1QB 2MFQA 1WM3A 3MHSD 2GS0A 2WWZA 2IFSA 1WRDB 2R2QA 4LCDE 2LYDA 2Z0OA 3BINA 2Z0EB 4HLEA 1LB1A 3MPXA 4HPMB 4BBKA 1WIAA 3ZNID 2D9YA 3FLVA 2GBJA 1LQBA 4WAAA 5HE0A 3TW1A 3DBRI 3V6CB 1ZC3B 4GSWA 3DXEA 2N4FA 5FI1A 5D3VA 2P0DA 5EFXA 2O6VD 4WWNA 2FCQA 4KIKB 2V4LA 4EKUA 1WGQA 1Z87A 4F1SA 5D2MB 2R2OA 3A9JA 5BO4B 1MG8A 3JW0X 4BKGA 1BTKA 1P3QU 5J3TA 5AZHA 4W9GA 3NSUA 3K9OB 4TKNA 4HPLB 1OMWA 5HKHA 1H4RA 3WANA 4MGYE 1L7YA 2KK8A 1NVLA 3PPAA 4NAWB 3K9PB 4HDQA 1OQNA 3P6AA 2JY6A 4FBJB 3L16A 2LBBA 5AEKB 2GJYA 4BKTA 3PVWA 1T0YA 5HE2A 2CB8A 3QJZA 3JSVA 3A9KA 4NJ6A 4ANWA 1V5UA 2D9XA 2KCJA 2MW5A 4ICUA 1KLVA 2DYQA 5CHFA 3WAPA 3GOEA 2JVCA 3KW5B 1GJZA 4PYZA 3W1YA 1TZ1A 1ZVRA 2FCSA 1QQGA 3VHTC 2MSED 5L81A 4IUMB 3NOBA 5D94A 3A1QB 1Y5OA 3ZIMA 5CHVC 4M0WB 1V89A 2GBMA 1X1GA 2DKPA 4D0NB 4M8NA 3DBLI 1UH6A 3VTWA 1TTNA 3KYDD 3ZLZA 3EC8A 2JZ3B 2HRJA 2ZVNA 4CHKA 5J2RA 2L3ZA 2KUPA 5KCVA 2BWES 1UELA 2L7RA 2Y5BB 4MDKE 3DXCA
chains in the Genus database with same CATH superfamily
1RAXA 2WX1A 2KANA 3B1LX 2COAA 5JP4A 4JKDA 5KHQA 4GB9A 1MK7B 5J18A 2KVZA 1JWBD 5BMIA 4Z2MB 3V05A 2YS5A 1K51A 3ECIA 1WJNA 3VUWA 2INNE 3RI7C 1F9JA 3BYYB 3H9DA 3BYTB 5LNK1 2COFA 5C1ZA 2NR2A 3QK0A 5HHDG 1HQRD 1J0WA 1SBBB 1A70A 1WI1A 1UGMA 2YS3A 1C3TA 1KZ7A 3B9JA 3U30A 2KR0A 4DXAB 2BPSA 3AV8A 2IJ0A 4K2OA 1VD2A 1KLUD 1WMHA 1QILA 2L0TA 3SDLC 4W9LA 2JYTA 2WU5B 4ASWC 1VRAB 5IOIA 2LOZA 3AN1A 3GZNB 2LGSA 4NJ7A 1FB8A 2FE8A 2PTLA 4LDTB 4YTNB 3IVFA 3VVWB 4MEMA 1NU2A 2YLMA 3D8FA 1OGWA 4BZAA 4K17A 2WS3B 2MBEA 3AE1B 1GB1A 1B1ZA 3M3JA 2N1WA 3AULA 3IBEA 4KGRA 3TL5A 5D3YA 2KXJA 4HCPB 3KLSX 1I4XA 2N9LA 4IG7B 3Q3MC 2LD9A 3BWUD 1ZP0B 3ZJTA 3E9SA 2Z59A 4HB4B 1C4CA 4DHJB 1FO4A 5L95C 4RGNA 3U52E 2GUMA 2KOXA 2LKOA 2IGGA 4K2PA 1E7UA 3VR8B 3NRZA 5HFYA 1L6UA 4L1RA 1XLNA 4A6FB 1ZYIA 1XQQA 2G1EA 4KHAA 2V9HA 2BYTA 1V5MA 4K81A 3EGRA 2ELBA 3EECA 3RN9C 4BBNC 1ST7A 3H8HA 1QOAA 1CK1A 4CQNA 3ML4A 2BBCA 3NJTA 3DHHC 4OZCA 3ZQ4A 2L00B 3AEGB 4MJSA 3DOWA 1HBKA 4GXBA 2KFKB 2DLBA 3FC4A 4NSWA 2DTCA 2PLPA 3CF6E 3FILB 4WWOA 2MBHA 4JKGA 2KO3A 5E6PA 3VRBB 2DZKA 1WYGA 4JK8A 1KI1B 2D4QA 2KLCA 3DXDA 4TQ1A 2QKLA 1C79A 2DBYA 4IFSA 3AJ4A 4WJ7A 3NWDA 2L0FA 1V8CA 4MK0A 5LXHA 3A33B 1N6ZA 3AEAB 1SXTA 3DBRB 3PZ7A 3TEWA 5C16A 2K25A 4WURA 2ZZPB 5BYQA 4ILGB 2J0KA 4KDIC 3GYPA 4CHJA 1WX9A 2N0SB 2E6XA 1XF5L 4RM8A 1TIFA 4QXAB 3OANA 1KF6B 5IN7A 1P9DU 2W3SA 3PEGA 2KACA 2XNAC 3MDBC 1UWXA 1KZGA 3SV1A 3N7CA 2PPHA 1WGGA 2HTHA 1L0VB 4IM0A 1WZ0A 3OHMB 5E6OA 3Q2AC 2RLOA 5C6RA 2G4DB 3D32A 4P16A 2A4ZA 2FJLA 3H7PA 2LVPA 5C2TB 2VKIA 1I4RA 2D07B 1JROA 2FUG1 3ZJUA 5IA7A 4EUTA 1OQYA 2NBUA 1RWSA 2KN5A 1TBEA 4I6NB 1AW7A 4FHKA 3LYYA 1WJUA 4JIOU 1WXSA 3DWMA 3U8ZA 2L1CA 2JRIB 1KOTA 2BKRB 3PP2A 4K1RB 3HM6X 1TY0A 3R2TA 2LRUA 2V0GA 1RM6C 3I57A 1SHCA 3JVZX 4NZLB 1P5TA 1AARA 1Q10A 3RD2A 1S3SG 1V86A 3BVZA 2DHJA 3TVVA 2IDYA 1EVHA 4W9EA 2RD0A 3W5UB 1YN5A 2LVQA 4W9KA 1JWSD 2LXCA 4EZKA 3OWEB 3ZUNA 3UF8A 1DOIA 3PSEB 4D6WA 2H7DA 1DROA 2YT1A 1BWNA 1C77A 2HDEA 2MRPA 3VIAA 1BUIC 4EE2A 1TYGB 1E8YA 1VBHA 3HVZA 3N1XC 4W9CA 4BAXA 1QT9A 1I4GA 4KSKC 1UNQA 2WXIA 1WGYA 3RNAC 1W1HA 4JWUC 1MI1A 3PVLA 4K7WA 4B0MA 3ZXVA 1QKZA 4J3OD 4JQWC 1MIZB 1X1FA 1KBLA 1RFKA 1PGBA 5TSSA 1FRRA 1PDXA 2KJRA 3E66A 3DBLB 2CODA 4IC7B 1AWEA 2R82A 3FEHA 5IP4D 3SUZA 2DHKA 3ZVVA 2H89B 2ZJDA 4FULA 4WSFA 1MVKA 4JKAA 4RNAA 1E8WA 2NBVB 2HD5B 1M4VA 2D3AA 4ZOHC 4A3OA 4OZBA 1L0YB 4M00A 2OTXA 4C4VA 1UNRA 3U2SC 2GMIC 3WALA 3CXBB 3H6NA 1L0XB 3P1MA 4KDLB 2WHIA 1UBIA 2K2UA 2K8HA 3QIJA 4E74A 2MA9B 4C56C 2I5CA 2DKQA 5IRSA 3MJ5A 4GDKB 1J7BA 2AEHA 5BYSA 5C5BB 3GS2A 2X18A 2J59M 2BT6A 1RRPB 1OEYJ 1I35A 1V5OA 2MJDA 2EJ8A 2UVMA 3NZSA 3D8EA 3VQIA 4D2KA 4RH6A 3L13A 2D9WA 1GPXA 2W82A 1K5DB 1DOXA 1ROEA 4HJKA 2KDEB 1K8RB 3C19A 3B77A 1K5GB 3ODWA 3DHIC 1T0RC 4H8SA 4AOFA 3IAM1 3WIMA 4CSQA 5I4DA 2JUOA 1IUEA 4BBNF 1HE8A 3PGEA 1JQ4A 1OY2A 1U5EA 1YX5B 1EM7A 3I5JC 4IOIE 4JKFA 4GOUA 2I1JA 2KIEA 5E6NA 1JWMD 2UYZB 2K8CA 2WQYB 2W9NA 3V6EB 4GOCA 3T9LA 4W9FA 1L4DB 3L08A 3UINB 5JHHA 2FCNA 4DXGA 1HB6A 4OSNA 1X1MA 1P98A 2RUKB 3GYOA 3R7RA 2O2VA 3RPFC 5J3QA 2KYWA 4DHZB 4PS8A 3CSTA 4WIPA 2FJ9A 1ZW7A 4EJNA 2Q5WD 1UEFA 5DIFB 2IBIB 4P1BC 2YRYA 1DBHA 3Q8BA 1QOBA 4XWWA 2HTME 2YEPF 3FSSA 3TEXA 2Y3AA 3L0WB 1WH3A 4A6QA 5DI9B 2MBQA 3HHMA 2C5LC 1U4AA 3UQAA 2KIGA 2AWTA 1ZC4B 2DX5A 3R7QA 3KY9A 2IO2B 3C8YA 4IAPA 2D11A 1MK9B 4IDIA 4HJGE 2WDVB 1NI2A 1MAIA 4FA6A 4OVUA 1NYRA 4L6EA 2KVRA 2INCC 2ZPNA 2DYOA 2OEDA 4TUUA 1WZ3A 1K52A 2KTRB 2UWQA 2MHJA 4IKGA 3I63C 1QQRA 2DYBA 3HIZA 3NWAA 4YSXB 2Z0PA 3TBLD 3W9CB 2LUEA 4RF1A 1HZ6A 4IM2A 1M94A 4AJWA 1V1PA 4XWTA 2XQNM 5J17A 4HAWB 2KD0A 1I4PA 2AX5A 2G45B 1FRDA 3X23A 2MKRA 4HB0B 3RNFC 3V62A 4HXDA 4J6IA 4OVVA 1BAKA 2RMMA 1K53A 2MJ3A 2IYBA 4GIVA 1T6BX 2KQ7A 1QLBB 4IW0A 3KZ1A 4KHBA 3BIID 1FOEA 3KUZA 4KKIA 4MGZE 4IWPA 1T0SC 5IAAC 5JXVA 3N32A 2KDFB 2SAKA 3RCZA 2LZ6A 5AUKA 3TSSA 3LJUX 3A58A 4EOYA 3DPDA 1H10A 4USAA 2X38A 4HHVA 3HIEA 1FCCC 2WXMA 1SIJA 1WX8A 4MELA 1F1HA 2DIKA 2JP2A 2VRWB 2N9KA 2DZIA 2RQ1A 3RNBC 2JZZA 3M62B 1WYWB 4EFOA 2KKCA 2XEWA 2PZ1A 4HSIA 2IO3B 2KJ6A 3VH4B 4ZRKA 1YJJA 2K6DB 3J9CA 1ZE3D 2W2XD 3KYCD 3AE4B 1XXGA 1CJEA 1D6EC 2M14A 1GB4A 4MDKE 2M0AA 1V5PA 2WU2B 4MH0E 2PE6B 1GGOA 2QCZA 4JKGB 2K6QA 3MC8A 2BYVE 3GB1A 4YTPB 3URYA 5E6JA 5G55A 1Q1OA 2D3BA 1ACAA 2EMTA 2KGXB 3A8QA 3AE5B 4HWIB 3DDCB 3ML9A 4IM3A 4K7SA 1DGJA 3NZUA 2KQSA 1BXTA 4MM3A 2CHXA 2NBWB 5CLLB 2KNBA 4P6VF 2GBRA 5C3JB 2WXPA 2ASQA 2FUHB 1D5ZC 2KJHB 1ZKHA 3NUHB 4YONA 3DWGC 5EE3A 3NVZA 1WY8A 3N20C 4NQLB 2K0PA 3I3TB 3HQCA 1WXMA 3TIXA 2KWDA 3WA0A 3RULA 3ONSA 1C4PA 3FKYA 2FBWB 2JYEA 4P7IA 4FLHA 2VZKD 2NVUI 2GLSA 4ZHOA 1IP9A 3VAWA 4ZRQA 3ZRCA 1NBFC 1BMLC 1TXDA 4HPPA 1FFVA 1CQVA 4MY6A 3IFWB 2FIDA 1TJEA 2GCJA 4A20A 3TJPA 4A6KA 3AEFB 4K3BA 1TKEA 3QCAA 1E0ZA 1BTNA 2MBOA 2M38A 2REXA 3AXCA 3RZFA 2C7HA 2M8SA 2RDGA 3MJWA 1VCBA 2K39A 3NWFA 3P7ZA 4B6HA 4JL9A 1EF1A 4PNKA 4GLSC 4MSQB 2R0DA 2VH1A 3PTFC 1E90A 3PHXB 3PRMB 3PLUA 4A9AA 4GZUA 1Q67A 2DHIA 1XX0A 2R2YA 5G2NA 2KFJA 4GN1A 2JT4B 2G9HD 2WXQA 2MEKA 2V1YA 1Z2MA 3ML8A 2IYDB 3PZDA 1WR6E 5AUIA 2G3QB 2ZNVB 2CY4A 4JK7A 4GDLB 2TSSA 4KVGB 1MIXA 2GOWA 4KIKA 1RJ2A 4PT5A 4I6LB 1T3QA 4MACA 3KWLA 1E8ZA 4JGHB 1FCLA 3UIPB 1WXQA 4X57B 1LGRA 2FNJB 2ROVA 2ZCCA 2WNMA 4QJ3B 1R7SA 1WGDA 1ZDVA 2BS3B 1TY2A 3OJ3A 1FNUA 4PQ0A 2BW2A 2OQBA 4NAMA 3TUOA 3BJIA 2Z4DA 3FAHA 1QOGA 1KLGD 4ITKA 2P0HA 2D9VA 4BKSA 4G11A 4YXDB 4B9KA 2CS4A 5IO9A 3AMZA 3V60A 2N0YA 4NAWA 4RF0A 1V5TA 2OOBB 4DDGD 3CIKA 4HCNB 3AU5A 4ZRPA 1PGXA 2WDQB 2OHFA 1N60A 3UI3A 3PHWB 2XBBC 1SE3A 2VSZA 1NVID 2CAYA 1C78A 1WVHA 4GMVA 1UUPA 1JDEA 2CJNA 4LNNA 2RSUA 2KX3A 5HE3A 3PV1A 4OW0A 4RGOS 1WGRA 3ZW3A 3NY5A 5FR3A 2LG1A 4W9HA 3N30A 4A6HA 3RCPA 1YX6B 4LNOA 3QWMA 3CIRB 1YOVB 1V49A 4H2AA 4YL8A 4REZA 2JWZA 2KZRA 4GGQA 3PVUA 3VDZA 3D8DA 2L32A 3KSYA 4BOSC 5KQ1A 5TR5A 1TS4A 4KV2A 1VLBA 2PJHA 1CZPA 2LWPA 4L1BA 3WAMA 3QARA 4N9F4 1OFFA 2BGFA 1L2NA 2D2QA 2Z0QA 1MKEA 4DK5A 2O6VB 2QEJC 4A55A 4HAVB 3HRDD 2XK5B 4DXFA 1XODA 3B2FA 5EE1A 4ZHPA 4M0WA 3MFGA 3PSCA 3U12A 2INDC 3Q3NC 4LK0M 3UZTA 2N9EB 1SE4A 1WJ1A 1XO3A 3VRAB 5DHAB 3SBTA 3PREA 1R4MI 2ABDA 1WJ6A 4MH8A 5BMGA 1Q5WB 3JYUA 2EC1A 2WXFA 4CYEA 1PUTA 4XDCA 1I4QA 1TS5A 1WX7A 1P7EA 2LJIA 1JRUA 1SE9A 1E7PB 1L6VA 1MFWA 5AZFA 2NMBA 1KM7A 1EWYC 2FAZA 1AYFA 4F8CB 3X0WA 2KHWB 2KDIA 2C9WB 2ELAA 4BKSD 2LXAA 1WFYA 3OAWA 5DPTA 2DENB 4I6PA 2M1MA 2IZVB 3CSFA 4E71A 2L1AA 3RNGC 2N9XA 2RDHA 2NS5A 4IWOA 2P8VA 1OEYA 1J19A 5L83A 3KUDB 2O2VB 2WXRA 1FXTB 2G35A 1TQZA 1IGCA 1XD4A 4KSLC 4G0NB 2R61A 1D3ZA 4JE3B 4LLGM 1PGAA 3T06A 2B3AA 5JHGA 3AE8B 2YT0A 2M0XA 2GCLA 1ZSQA 3HW2B 4KKJA 2COPA 2KWVB 3NS8A 2IGHA 1EUVB 3QX1A 3U4EG 3AI5A 2ADZA 1NYQA 1YD8U 5J3YA 2FIFA 2DX5B 2KT7A 1VZ8A 3BZDB 3P4PB 4DHZE 1JCKB 1I4HA 1PQSA 1D4BA 4A90A 3RZWC 2ON8A 3ODXA 3TO1A 5C23A 3E9PA 1IBXB 1DDVA 2A5UA 3W1SC 2KMMA 1RLFA 3A9JB 2KDMA 2RVBB 4HROA 4LNFA 3QHTA 1VR9A 1VDVA 2WXJA 2IY1B 2ACZB 1V6EA 4P1CC 3L17A 3KRWA 3CWIA 2BB5A 2LOXA 4HKQA 4WWPA 1SIFA 4XX5A 3WYFB 1XLPA 2B76B 4CHMA 1V61A 1V1PB 3Q3FA 1ZUD2 4C7ZA 2CU3A 3N1ZC 1HB8A 1T5XD 4DBBA 1AQCA 2BWFA 2JX5A 3NVVA 3F0WA 2H88B 1HA5A 5EDSA 3Q69A 3NG0A 4QJ4B 2Y8FA 4A6FA 2M19A 1UNSA 2ZCBA 2Y7BA 2VH2A 1N3HA 3FP5A 5I2SA 4HDOA 1TGZB 1GAQB 5GOWB 3JSVB 4WQMA 5LLIA 3A9KB 3VR9B 4II3B 4HRSA 4HVBA 2BCJA 1LFDA 2HJ8A 3RYTA 3ULCA 4ICVA 2DWQA 3E9LA 4IOYX 5JLJB 1EAZA 4MT5A 3VOQA 1XCGA 4NY0A 2K3UA 1B55A 1TS3A 2QJLA 4EEWA 2NTSA 3NW8A 1E5WA 2UZRA 1FD6A 4IWQA 3QC8B 2KFKA 1HTQA 1IRSA 1WGKA 3ABVB 2DA0A 4WJPA 3SD5A 2ZPYA 2OJWA 3B0AA 2C60A 4PS3A 3FILA 1DYNA 3APCA 3EFUA 4S0RA 1EWCA 5HG2A 1EF5A 2BF8B 1Q0WB 3E9OA 3Q8AA 5DHFB 2KN4A 2CRFA 1P6SA 3Q14C 4RM9A 3IAS1 4HAZB 3U7ZA 3EHVA 5FKAC 3A4RA 5MPOA 1Z5SB 2LI5A 4WJQA 1B9RA 3EA6A 4LDTD 4Y94A 3R3MA 3ENEA 3C0RB 4G3XB 5FI0A 2EELA 4AWJA 3AH7A 4HB2B 4KZCA 4JKCA 2BYFA 2LMCA 4MM3B 3V3XA 1ZOYB 1YMHE 5FR6A 3PZ8A 2VRRB 1FHWA 1NI3A 4DQOC 2J0MA 3MP9A 4TYZA 1PYWD 2RR9A 3OJ4B 2LULA 4II2B 4XC2A 2NMQA 4ZRIA 1F77A 2ZVOA 4NPNA 4DHJD 1AWDA 4K7UA 3AECB 4MSMB 2LUMA 4ANXA 4DWFA 2NPTA 2MWNB 3WCQA 5CHWA 4ZDVA 3BK1A 3B08A 4C0AA 1NENB 2QSDA 2BS4B 2JF5A 3VUXA 2K1FA 2MDXA 1F52A 1MG4A 2RRFA 2CJOA 2DZJA 4N6EB 1I2HA 2QKMA 3TCAA 3T3OA 3ZNGC 4OT1A 5C79A 5CX3A 4RMAA 3A98B 2AQ2B 2KAJA 5DCNA 4WVFB 2IY0B 3DVNV 4HEA1 1YN4A 1XD3B 2KTFA 1LO5D 3DBSA 2MWSB 3F5RA 2PKOA 2QHOA 5D7GA 2DYNA 4QJ5B 2PEAA 1TS2A 1PFDA 1STEA 3KQ4A 1T77A 4US8A 2FJUB 2ROZB 1WMHB 1QC6A 4HK2A 1JRPA 4YSYB 1GOZA 4HB3B 2W54A 2ONQA 1XR0B 1HZ5A 4M01A 1FPYA 3SNHA 1TJ6A 3OLMD 1PMSA 4C00A 3SO6A 1ISNA 1UZXB 3AB5A 3Q8CA 4TMAB 1V81A 2IPKD 5G5HA 1JMLA 2EKEC 4EZLA 2I5FA 1V80A 3N9YC 2L52A 1JW9D 1WF9A 4LJOB 2E2XA 1TT5B 1E6EB 1FHXA 4B95A 3HSAA 3QQ8B 4W9DA 3V61A 3HVDA 1H8CA 2E3TA 1QOFA 3SU8X 3PG7A 1P0RA 2CU1A 4FADA 2V3SA 2RNRB 2KWCA 3WAOA 3ZDMC 1UF0A 2Z59B 1SJED 1R4MB 3ZNZB 5D3WA 4BVUC 2K5PA 3QA8A 5G5GA 2AQ3B 1X11A 2K8BA 4AP4C 1E9MA 1E8XA 2JXXA 2CY5A 5JH5C 2K9XA 3H1UA 2RDBC 3ZDTA 3BVGA 1JWUD 3MHZA 4XZ4A 4EZJA 1MPEA 1KJTA 4N59A 2KX0A 3M95A 1CMXB 4DX8A 2LASA 1X86A 4ZYNA 1XKEA 2Y5CA 4XWXA 1DYQA 4GDKA 4MJSB 5C5BA 4KZ0A 1AN8A 3APDA 3N1YC 4YTMB 1YN3A 4FHJA 3ZO5B 3SEBA 1J0GA 4BFRA 1M7EA 1QZEA 3PRZA 1YJ1A 3AE7B 3DVGY 3ZTCA 1P3RA 5JVLA 3PLVA 2P0FA 4RFBA 1MPHA 2IO1B 2COCA 3ZGZA 5BMHA 1E10A 5LOPB 1GC7A 3EFCA 1N61A 1I7AA 1BT0A 4W9JA 1QF6A 1L5PA 2EKIA 3AE2B 3KWVA 4WH4A 1WM2A 2R09A 3RFZB 2KQ4X 4W9IA 1SB3C 3SBGA 3QBVB 2BS2B 3E56A 1WWTA 2C7MB 4GU2A 3AM9A 4DBGA 4F7HA 3I9V1 2J52A 2MP2A 3TMPB 2LVOA 5DH9B 4FJVB 1JALA 4WJOA 4GPTB 4PS7A 4M02A 1XT9B 2HTHB 4JKEA 1FMAD 2DHZA 4FJYA 2INPE 1RRBA 1UBQA 2OJRA 2DAFA 3DCGA 1M7RA 4B6WA 3H7PB 2L05A 3SYXA 1YQ4B 1XLOA 4CO7A 5HE1A 3KRXA 3H7SA 1ESFA 1N5XA 2M4NA 1C1YB 3Q8EA 4PYUA 5LONB 2PMVA 2JPHA 1LXDA 4UDUC 1F2RI 2NCNA 5KQ4A 1WXVA 2MBBB 4EMOA 3T8MA 3NS1A 2K8EA 3ZNHB 1WGUA 3Q6BA 3LDZE 2ZKMX 3ZYYX 1V1OA 2MX2A 1Y8RC 3O65B 4RGMA 5JHAA 2D3CA 1SSNA 2XN9C 1WG7A 2Q13A 2J7QB 1E7VA 2BVCA 3SFDB 1R4NI 2KTRA 2AL3A 3QWZB 1W1GA 3MC0B 3QAQA 3NZ3A 1SEBD 2Z13A 1EGXA 3P4RB 4FN2A 3N3KB 3MC9A 3R66C 2GBNA 3SFEB 1YIWA 3VXWA 2NTTA 3RMKC 4ILHA 1U2BA 2RGNB 1C76A 3NHEB 3P2BA 2D10A 2CHZA 1ZGUB 2YEPB 3VH3B 1PLSA 1ZXIA 3P4SB 1GNUA 3EPYA 2X8XX 3M63B 3LB8C 4F7GA 2JSVX 2WDTB 3CMMB 1OQRA 3PT2B 2MH7A 2KDBA 1UNPA 3VTVA 1ENFA 3PO0A 4G50A 1C4AA 3AE6B 2JRHA 2HE7A 1N5WA 4MT7A 2LGXA 3ZXRA 2BB6A 1G6JA 4JKHA 2ZW1A 3AEBB 4KAXB 2JWUA 2WXLA 2YS1A 5M4YB 2UZSA 5JZEB 1EO6A 1GUAB 4AQ7A 3P4QB 5D3DA 4B0EA 4JKBA 2K22A 4DDID 4ZRJA 2D5GA 4KGTA 5DPRA 4WAFA 1DDMA 1WI0A 2CR5A 2DLWA 1WJ4A 3LXFA 3RT3B 1W1DA 1WR1A 3UQBA 1U27A 2WYQA 2YVCA 1V88A 1FXAA 1RFAA 4C4VB 3ODOA 2WXNA 5CLQB 4HAUB 1K50A 2QMTA 1U5FA 1LM8B 2C7NB 2J42A 2ZNVC 4A8XC 2JQRB 3W2DA 3R2IA 4E3CA 2L76A 1P1AA 3A1QA 2JXTA 2KMCA 3ENBA 3ZJVA 3ALBA 1RYJA 1U29A 1XEEA 4A3PA 1SJHD 1WRIA 2MCNB 4JK9A 4C80A 1I42A 2ZW0A 5CTRC 2RSGA 2V3NA 5EE0A 1XCQL 2QILA 1NDDA 4K3CA 4XE0A 2BTEA 2AYOB 2DX1A 4KX6B 3PS6A 2LHDA 3SHQA 2N7JA 2YSZA 2DNFA 5D27A 1FXIA 1MHXA 4KHOA 2WXKA 2WXGA 2N23A 1V97A 2FCMA 1SF0A 1WE7A 2WLBA 3L54A 4AUQC 4TQ0A 1J7CA 2BYEA 1HTOA 3GP7A 1V9JA 1ACCA 2L2IA 2Z0DB 4LNKA 3KH0A 1KRHA 1V2YA 4Z2NA 2N9PC 2N7DA 4A5KA 3BY4B 1ZM0A 1NEKB 2WX0A 2K2JA 4KGSA 5LG4B 2LGYA 1N63A 2KMAA 2I1KA 2GRIA 4WQOB 5I2MA 2JU6X 2NPTB 2LHEA 4US9A 4TV3A 3APFA 1TZOA 3IT4B 1XLQA 1FFUA 2K49A 1UD7A 3HM3A 4LJPB 4QAYA 2LRWA 3B2GA 3DQVA 4HATB 1UPQA 4MGKE 2N1VA 2M56B 5DPSA 2WXOA 1J8CA 1PFJA 1Y19B 1VBGA 1OTRB 5JHBA 5FK9C 3DBHI 2DN6A 5IJMA 4WJNA 4NJCA 3TFMA 4DIXA 1D5XC 1FGYA 2EMSA 3AU4A 3M1IB 2GI9A 2WH5A 2KLGA 2SEBD 2GBKA 1WJMA 4AJYB 3Q3OC 4GDLA 1NTYA 2Z8LA 2N7EA 2V76A 1UPRA 1VZ6A 3O13A 2RPVA 3R8BA 3A8PA 3VUYA 1YQBA 4NNJB 2DAJA 1A5RA 1FHOA 2RPQA 3A4SC 3AEEB 3IXSA 4ANUA 2Y8GA 4HAXB 2PVOD 5H92C 2W2WA 1GC6A 3ZVRA 3HK0A 2WDRB 3P63A 3UIOB 4HKZE 1D5MC 1WE6A 1IYFA 4F7ZA 2J4XA 1NTIA 4ZYSA 2D3GA 3KVFB 3FVCA 1ZDXA 3UGBB 2FDQA 3RUIB 2LGIA 1U5DA 2VZKB 4RGTA 2DZMA 3IG3A 1KFYB 4AS1A 4MGIE 4BOZB 4FXCA 4S17A 1JWAD 2KC1A 2DYMA 3S2AA 2KWUB 4TSSA 2MQJA 4KHBB 3O96A 1T0QC 2KUQA 3Q3JA 2QC8A 3VFKA 1X05A 1TKGA 3U7DA 3PRPB 5DPWA 4YSZB 3L10B 2AL6A 3DVNU 2H7EA 2D9ZA 1GG3A 2W2XC 2BKFA 2LJ5A 3GZNI 4LTUA 1DOYA 4GNKB 3TEYA 2CQUA 3ULBA 1EU3A 5HI1A 1SGHA 2ICIA 1DDWA 5GXGB 5EE9A 3DHGC 3ZRFA 1MJDA 4XDDA 2W55A 2ZEQA 4URKA 1U5GA 3ZTDA 2O6VA 2PE9A 2Z14A 5BYRA 3W5VB 1FM0D 3ZKJC 1DIKA 1WGHA 1IPGA 3ETRA 2XK5A 1J7AA 2BQQA 4O1NA 4OZAA 1ZXHA 3VTUA 5AZGA 2G4SA 3EUB2 4FJZA 4F7UP 4OHJA 1WXAA 2CKHB 4JX1C 2J0JA 2CHWA 4NQKE 4HAYB 4JLCA 2MLBA 5D3XA 3W1SA 4DX90 1LW3A 1NTVA 1FNVA 1R4NB 2DFKA 4ANVA 2NZ8B 2RGFA 4M8MA 4XGAB 2LFIA 5LXIB 2MP2B 1L4ZB 2KC2A 1YJIA 2PVGC 1VZ7A 3KUCB 5D6JB 3IHPC 1UGJA 3MTNB 2YF0A 4GMXB 5KHOA 2IO0B 4L2YA 3FM8C 3V5WA 5GMVA 1FIQA 3HUIA 2HJ1A 3LJ3A 1SE2A 4ARIA 2M17A 2V4IB 3NVYA 2AQ1B 2LGDA 1VJKA 3G9WA 1FGZA 2L8JA 1HXYD 1FAOA 2X0SA 2K00A 2QIEB 3DVGX 1S1QB 1TKYA 2MFQA 1KTKA 1N62A 1WM3A 1KC7A 3MHSD 1ET9A 5H8YE 2GS0A 2WWZA 2IFSA 1WRDB 2R2QA 4LCDE 2LYDA 2Z0OA 1Y56A 3BINA 2YT2A 2Z0EB 2I2YA 4HLEA 1LB1A 3MPXA 4HPMB 2W3RA 4BBKA 1WIAA 3ZNID 2D9YA 1F2RC 2WGSA 3FLVA 2GBJA 1LQBA 2J53A 5HE0A 3TW1A 4WAAA 1F0ZA 3DBRI 3V6CB 4JPSA 3TEZA 1ZC3B 4PK1A 1UWMA 4RCOA 4WWMA 4GSWA 3DXEA 2N4FA 5FI1A 5D3VA 2P0DA 5EFXA 2O6VD 4WWNA 2FCQA 4KIKB 2V4LA 4EKUA 1WGQA 1Z87A 4Q2JA 4F1SA 1IBXA 1MI0A 1MHHE 1FNWA 4OVZA 3NVWA 5D2MB 2R2OA 3A9JA 5D3IB 5BO4B 1MG8A 3JW0X 4ILJA 4BKGA 1BTKA 1P3QU 3BK2A 3P42A 5J3TA 5AZHA 4W9GA 3Q8FA 3NSUA 3K9OB 4TKNA 4HPLB 1OMWA 5HKHA 1H4RA 2UU7A 4JWSC 2WXHA 3WANA 1EU4A 4MGYE 1L7YA 2KK8A 3DCXA 1NVLA 2IGDA 3PPAA 4NAWB 3K9PB 4HDQA 3RNCC 1OQNA 4LNIA 3P6AA 2PW9A 1I7HA 1YQ3B 2JY6A 5IKCM 2NBVA 4FBJB 2JZPA 3AE9B 3L16A 4C7YA 1XCTL 4XYCA 3AEDB 2LBBA 5AEKB 2GJYA 4BKTA 3PVWA 1HEZE 1T0YA 3BVMA 5HE2A 2CB8A 3QJZA 3JSVA 3A9KA 2I38A 4NJ6A 4ANWA 1V5UA 2D9XA 3T3NA 2MJEA 2KCJA 2MW5A 4ICUA 1KLVA 2DYQA 5CHFA 3SR6A 5T8IA 3WAPA 3GOEA 2JVCA 3KW5B 1IGDA 1GJZA 4PYZA 3W1YA 3GE8C 1TZ1A 1ZVRA 2FCSA 2PIAA 1QQGA 1P7FA 1ET6A 1OQQA 3VHTC 2MSED 5L81A 4IUMB 3OG5A 3NOBA 4N58A 5D94A 3A1QB 1C9FA 1Y5OA 3ZIMA 1YNTE 2Y5PA 2L83A 4ACFA 5CHVC 4YT0B 4L23A 3RNEC 4M0WB 3DBHB 1V89A 2GBMA 1X1GA 2DKPA 3IT6B 2V3PA 4D0NB 1WSPA 4M8NA 3DBLI 1FEHA 1UH6A 1ZPSA 3VTWA 4YWGG 3L4PA 4ARCA 1TTNA 3KYDD 3ZLZA 3EC8A 2JZ3B 2HRJA 2ZVNA 4CHKA 2QDFA 5J2RA 3AE3B 2L3ZA 2KUPA 2LEKA 5KCVA 2BWES 3GE3C 4R3DA 1UELA 2WP9B 2L7RA 2Y5BB 2GB1A 1KH0A 3DXCA
chains in the Genus database with same CATH topology
1RAXA 2WX1A 2KANA 3B1LX 2COAA 5JP4A 4JKDA 5KHQA 4GB9A 1MK7B 5J18A 4Z2MB 2YS5A 3ECIA 1WJNA 3VUWA 1F9JA 3H9DA 2COFA 5C1ZA 2NR2A 3QK0A 1J0WA 1WI1A 1UGMA 2YS3A 1C3TA 1KZ7A 3U30A 4DXAB 2BPSA 4K2OA 1VD2A 1WMHA 2L0TA 3SDLC 4W9LA 4ASWC 2LOZA 4NJ7A 1FB8A 4LDTB 3IVFA 3VVWB 4MEMA 1NU2A 2YLMA 3D8FA 1OGWA 4K17A 2MBEA 3M3JA 2N1WA 3AULA 3IBEA 3TL5A 5D3YA 2KXJA 4HCPB 4IG7B 2LD9A 4HB4B 4DHJB 5L95C 2KOXA 2LKOA 4K2PA 1E7UA 4A6FB 1XQQA 4KHAA 1V5MA 4K81A 2ELBA 3EECA 4BBNC 1ST7A 3ML4A 2L00B 4MJSA 3DOWA 1HBKA 4GXBA 2KFKB 4NSWA 2DTCA 3CF6E 4WWOA 2MBHA 4JKGA 2KO3A 5E6PA 2DZKA 4JK8A 1KI1B 2D4QA 2KLCA 3DXDA 4TQ1A 2QKLA 4IFSA 3AJ4A 4WJ7A 2L0FA 4MK0A 5LXHA 3A33B 5C16A 2K25A 2ZZPB 4ILGB 2J0KA 4KDIC 3GYPA 4CHJA 1WX9A 4RM8A 3OANA 1P9DU 3PEGA 3MDBC 1KZGA 3SV1A 3N7CA 2PPHA 1WGGA 2HTHA 4IM0A 1WZ0A 5E6OA 2RLOA 5C6RA 2G4DB 3D32A 2A4ZA 2FJLA 3H7PA 2LVPA 2VKIA 2D07B 5IA7A 4EUTA 1OQYA 2NBUA 2KN5A 1TBEA 4I6NB 4FHKA 1WJUA 4JIOU 1WXSA 3U8ZA 2L1CA 2JRIB 1KOTA 2BKRB 3PP2A 4K1RB 3HM6X 2LRUA 1SHCA 3JVZX 1P5TA 1AARA 3RD2A 1S3SG 1V86A 2DHJA 3TVVA 1EVHA 4W9EA 2RD0A 2LVQA 4W9KA 2LXCA 4EZKA 3ZUNA 3UF8A 3PSEB 2H7DA 1DROA 2YT1A 1BWNA 2MRPA 3VIAA 1E8YA 1VBHA 4W9CA 4KSKC 1UNQA 1WGYA 1W1HA 3PVLA 4K7WA 4JQWC 1MIZB 1X1FA 1KBLA 2KJRA 3E66A 4IC7B 2CODA 1AWEA 2R82A 3FEHA 3SUZA 2DHKA 3ZVVA 2ZJDA 4FULA 4WSFA 4JKAA 1E8WA 2NBVB 2HD5B 4A3OA 2OTXA 1UNRA 2GMIC 3WALA 3CXBB 3H6NA 4KDLB 1UBIA 2K2UA 2K8HA 3QIJA 4E74A 2MA9B 2I5CA 2DKQA 4GDKB 2AEHA 5C5BB 2X18A 2J59M 1RRPB 1OEYJ 1I35A 1V5OA 2EJ8A 2UVMA 3NZSA 3D8EA 3VQIA 3L13A 2D9WA 1K5DB 4HJKA 2KDEB 1K8RB 1K5GB 3ODWA 4H8SA 4AOFA 3WIMA 2JUOA 4BBNF 1HE8A 3PGEA 1OY2A 1U5EA 1YX5B 4JKFA 2I1JA 5E6NA 2UYZB 2K8CA 2W9NA 3V6EB 4GOCA 3T9LA 4W9FA 3L08A 3UINB 5JHHA 2FCNA 1HB6A 1X1MA 1P98A 2RUKB 3GYOA 3R7RA 2O2VA 5J3QA 4DHZB 4PS8A 3CSTA 2FJ9A 1ZW7A 4EJNA 1UEFA 5DIFB 2IBIB 2YRYA 1DBHA 3FSSA 3L0WB 1WH3A 5DI9B 2MBQA 3HHMA 2C5LC 1U4AA 3UQAA 2AWTA 1ZC4B 2DX5A 3R7QA 3KY9A 2IO2B 4IAPA 2D11A 1MK9B 1NI2A 1MAIA 4FA6A 4OVUA 4L6EA 2KVRA 2ZPNA 2DYOA 4TUUA 1WZ3A 2KTRB 2UWQA 2DYBA 3HIZA 2Z0PA 3TBLD 2LUEA 4IM2A 1M94A 4AJWA 2XQNM 5J17A 4HAWB 2KD0A 2G45B 3X23A 2MKRA 4HB0B 3V62A 4HXDA 4J6IA 4OVVA 1BAKA 2IYBA 4GIVA 2KQ7A 4IW0A 3KZ1A 1FOEA 3KUZA 4MGZE 4IWPA 5IAAC 3N32A 2KDFB 3RCZA 2LZ6A 3LJUX 4EOYA 3DPDA 1H10A 4HHVA 1WX8A 4MELA 2DIKA 2JP2A 2VRWB 2DZIA 2RQ1A 2JZZA 3M62B 1WYWB 4EFOA 2KKCA 2XEWA 2PZ1A 2IO3B 2KJ6A 3VH4B 4ZRKA 2K6DB 2W2XD 3KYCD 2M14A 1V5PA 4MH0E 2PE6B 1GGOA 4JKGB 2K6QA 2BYVE 5G55A 1Q1OA 1ACAA 2EMTA 2KGXB 3A8QA 4HWIB 3DDCB 3ML9A 4IM3A 4K7SA 3NZUA 2KQSA 4MM3A 2CHXA 2NBWB 5CLLB 2KNBA 2GBRA 2ASQA 2FUHB 2KJHB 1ZKHA 4YONA 1WY8A 4NQLB 3I3TB 3HQCA 1WXMA 3TIXA 3WA0A 3RULA 3ONSA 4P7IA 4FLHA 2NVUI 1IP9A 3VAWA 3ZRCA 1NBFC 1TXDA 4MY6A 3IFWB 2FIDA 2GCJA 4A20A 3TJPA 4A6KA 3QCAA 1BTNA 2MBOA 2M38A 2REXA 3AXCA 3RZFA 2C7HA 2M8SA 3MJWA 1VCBA 2K39A 3P7ZA 4B6HA 4JL9A 1EF1A 4PNKA 4MSQB 2R0DA 3PTFC 1E90A 3PHXB 3PRMB 3PLUA 4GZUA 1Q67A 2DHIA 1XX0A 5G2NA 2KFJA 4GN1A 2JT4B 2V1YA 1Z2MA 3ML8A 2IYDB 3PZDA 1WR6E 2G3QB 2ZNVB 2CY4A 4JK7A 4GDLB 4KVGB 1MIXA 2GOWA 4KIKA 1RJ2A 4I6LB 1E8ZA 4JGHB 3UIPB 4X57B 2FNJB 2ROVA 2ZCCA 1WGDA 3OJ3A 4PQ0A 2OQBA 3BJIA 2P0HA 2D9VA 4BKSA 4G11A 4B9KA 2CS4A 3V60A 2N0YA 4NAWA 1V5TA 2OOBB 4DDGD 3CIKA 4HCNB 3AU5A 3PHWB 2XBBC 2VSZA 2CAYA 1WVHA 4GMVA 1JDEA 2RSUA 2KX3A 5HE3A 3PV1A 1WGRA 3ZW3A 3NY5A 2LG1A 4W9HA 3N30A 4A6HA 3RCPA 1YX6B 3QWMA 1V49A 4YL8A 2JWZA 2KZRA 4GGQA 3PVUA 3VDZA 3D8DA 3KSYA 4BOSC 5KQ1A 5TR5A 4KV2A 2PJHA 2LWPA 3WAMA 3QARA 4N9F4 2BGFA 1L2NA 2D2QA 2Z0QA 1MKEA 4DK5A 2O6VB 4HAVB 2XK5B 1XODA 3PSCA 3UZTA 2N9EB 1WJ1A 5DHAB 3SBTA 3PREA 1R4MI 2ABDA 1WJ6A 1Q5WB 3JYUA 2EC1A 4CYEA 1WX7A 1JRUA 1SE9A 5AZFA 2NMBA 1KM7A 2FAZA 4F8CB 3X0WA 2KHWB 2KDIA 2C9WB 2ELAA 4BKSD 2LXAA 1WFYA 3OAWA 5DPTA 2DENB 4I6PA 2M1MA 2IZVB 3CSFA 4E71A 2N9XA 2NS5A 4IWOA 2P8VA 1OEYA 1J19A 5L83A 3KUDB 2O2VB 1FXTB 2G35A 1TQZA 1XD4A 4KSLC 4G0NB 1D3ZA 3T06A 2B3AA 5JHGA 2YT0A 2M0XA 2GCLA 1ZSQA 3HW2B 2COPA 2KWVB 3NS8A 1EUVB 3QX1A 3AI5A 2ADZA 1YD8U 5J3YA 2FIFA 2DX5B 4DHZE 1PQSA 3RZWC 3ODXA 3TO1A 5C23A 3E9PA 1DDVA 2A5UA 3W1SC 1RLFA 3A9JB 2RVBB 3QHTA 2IY1B 1V6EA 3L17A 3KRWA 2LOXA 4WWPA 1SIFA 4XX5A 3WYFB 4CHMA 1V61A 3Q3FA 1HB8A 4DBBA 1AQCA 2BWFA 3F0WA 5EDSA 2Y8FA 4A6FA 2ZCBA 2Y7BA 1N3HA 3FP5A 4HDOA 1TGZB 5GOWB 3JSVB 5LLIA 3A9KB 4II3B 4HVBA 2BCJA 1LFDA 2HJ8A 3RYTA 3ULCA 4ICVA 3E9LA 4IOYX 5JLJB 1EAZA 3VOQA 1XCGA 4NY0A 1B55A 4EEWA 1E5WA 2UZRA 4IWQA 3QC8B 2KFKA 1IRSA 2DA0A 4WJPA 3SD5A 2ZPYA 3B0AA 2C60A 4PS3A 1DYNA 3APCA 3EFUA 1EF5A 2BF8B 1Q0WB 3E9OA 5DHFB 2CRFA 1P6SA 4RM9A 4HAZB 3EHVA 3A4RA 1Z5SB 2LI5A 4WJQA 4LDTD 4Y94A 3R3MA 3ENEA 3C0RB 4G3XB 5FI0A 4AWJA 4HB2B 4KZCA 4JKCA 2BYFA 5FR6A 2VRRB 1FHWA 2J0MA 4TYZA 2RR9A 3OJ4B 2LULA 4II2B 4XC2A 4ZRIA 2ZVOA 4DHJD 4NPNA 4K7UA 4MSMB 4ANXA 4DWFA 2NPTA 2MWNB 5CHWA 4ZDVA 3B08A 4C0AA 2JF5A 3VUXA 2K1FA 2MDXA 2DZJA 1I2HA 2QKMA 3TCAA 3ZNGC 5C79A 5CX3A 4RMAA 3A98B 5DCNA 4WVFB 2IY0B 3DVNV 1XD3B 2KTFA 3DBSA 2MWSB 3F5RA 2QHOA 5D7GA 2DYNA 2PEAA 2ROZB 1WMHB 1QC6A 4HK2A 4HB3B 1XR0B 3SNHA 1TJ6A 3OLMD 1PMSA 3SO6A 1ISNA 1UZXB 1V81A 2EKEC 4EZLA 2I5FA 1V80A 1WF9A 4LJOB 2E2XA 1FHXA 4B95A 3QQ8B 4W9DA 3V61A 1H8CA 3SU8X 3PG7A 1P0RA 2CU1A 4FADA 2V3SA 2RNRB 2KWCA 3WAOA 3ZDMC 2Z59B 3ZNZB 5D3WA 4BVUC 3QA8A 1X11A 2K8BA 4AP4C 1E8XA 2JXXA 2CY5A 5JH5C 3H1UA 3ZDTA 4XZ4A 4EZJA 1KJTA 2KX0A 3M95A 1CMXB 4DX8A 2LASA 1X86A 4ZYNA 1XKEA 4XWXA 4GDKA 4MJSB 5C5BA 4KZ0A 3APDA 3ZO5B 4FHJA 1J0GA 4BFRA 1M7EA 1QZEA 3PRZA 1YJ1A 3DVGY 3ZTCA 1P3RA 5JVLA 3PLVA 2P0FA 1MPHA 2IO1B 2COCA 5LOPB 1GC7A 1I7AA 1BT0A 4W9JA 1WM2A 2R09A 4W9IA 3SBGA 3QBVB 4GU2A 2C7MB 4DBGA 4F7HA 2MP2A 3TMPB 2LVOA 5DH9B 4FJVB 4WJOA 4GPTB 4PS7A 1XT9B 2HTHB 4JKEA 2DHZA 4FJYA 1RRBA 1UBQA 2OJRA 2DAFA 3DCGA 1M7RA 4B6WA 3H7PB 2L05A 3SYXA 4CO7A 5HE1A 3KRXA 3H7SA 2M4NA 1C1YB 4PYUA 5LONB 2JPHA 1LXDA 2NCNA 5KQ4A 1WXVA 2MBBB 4EMOA 3T8MA 3ZNHB 1WGUA 3LDZE 2MX2A 1Y8RC 3O65B 5JHAA 1WG7A 2Q13A 2J7QB 1E7VA 1R4NI 2KTRA 2AL3A 3QWZB 1W1GA 3QAQA 1EGXA 4FN2A 3N3KB 3R66C 2GBNA 1YIWA 3VXWA 4ILHA 1U2BA 2RGNB 3NHEB 3P2BA 2D10A 2CHZA 1ZGUB 3VH3B 1PLSA 1GNUA 3EPYA 3M63B 4F7GA 2WDTB 3CMMB 3PT2B 2KDBA 1UNPA 3VTVA 4G50A 2JRHA 2HE7A 4MT7A 2LGXA 1G6JA 4JKHA 4KAXB 5JZEB 2YS1A 2UZSA 1EO6A 1GUAB 4JKBA 4DDID 4ZRJA 5DPRA 1DDMA 1WI0A 2CR5A 3RT3B 2DLWA 1WJ4A 3UQBA 1W1DA 1WR1A 1U27A 2WYQA 2YVCA 1V88A 1RFAA 3ODOA 5CLQB 4HAUB 1U5FA 1LM8B 2C7NB 2ZNVC 4E3CA 2L76A 1P1AA 3A1QA 2KMCA 3ENBA 3ALBA 1U29A 4A3PA 2MCNB 4JK9A 1I42A 5CTRC 2RSGA 1NDDA 2AYOB 2DX1A 3PS6A 3SHQA 2YSZA 5D27A 4KHOA 2N23A 2FCMA 1WE7A 3L54A 4AUQC 4TQ0A 2BYEA 1V9JA 2Z0DB 2L2IA 3KH0A 1V2YA 4Z2NA 2N9PC 2N7DA 4A5KA 3BY4B 1ZM0A 2WX0A 2K2JA 2LGYA 2KMAA 2I1KA 4WQOB 2NPTB 4TV3A 3APFA 1UD7A 3HM3A 4LJPB 2LRWA 3DQVA 4HATB 1UPQA 4MGKE 2N1VA 5DPSA 1J8CA 1PFJA 1Y19B 1VBGA 1OTRB 5JHBA 3DBHI 2DN6A 5IJMA 4WJNA 3TFMA 1FGYA 2EMSA 3AU4A 3M1IB 2WH5A 2KLGA 2GBKA 1WJMA 4AJYB 4GDLA 1NTYA 2N7EA 2V76A 1UPRA 3A8PA 3VUYA 1YQBA 4NNJB 2DAJA 1A5RA 1FHOA 2RPQA 3A4SC 4ANUA 2Y8GA 4HAXB 2W2WA 1GC6A 3ZVRA 3HK0A 3UIOB 1WE6A 1IYFA 4F7ZA 1NTIA 2D3GA 3KVFB 3UGBB 2FDQA 3RUIB 1U5DA 2DZMA 3IG3A 4MGIE 4BOZB 2KC1A 2DYMA 3S2AA 2KWUB 2MQJA 4KHBB 3O96A 3Q3JA 3VFKA 1X05A 3U7DA 3PRPB 5DPWA 3L10B 2AL6A 3DVNU 2H7EA 2D9ZA 1GG3A 2W2XC 2BKFA 2LJ5A 3GZNI 2CQUA 3ULBA 1SGHA 1DDWA 3ZRFA 2ZEQA 4URKA 1U5GA 3ZTDA 2O6VA 2PE9A 3ZKJC 1DIKA 1WGHA 1IPGA 2XK5A 3VTUA 5AZGA 2G4SA 4FJZA 4F7UP 1WXAA 2CKHB 2J0JA 2CHWA 4NQKE 4HAYB 4JLCA 2MLBA 5D3XA 3W1SA 4DX90 1LW3A 1NTVA 2DFKA 4ANVA 2NZ8B 2RGFA 4M8MA 5LXIB 2MP2B 2KC2A 3KUCB 5D6JB 3IHPC 3MTNB 2YF0A 4GMXB 5KHOA 2IO0B 3FM8C 3V5WA 5GMVA 3LJ3A 2M17A 2LGDA 3G9WA 1FGZA 2L8JA 3DVGX 1FAOA 2X0SA 2K00A 1S1QB 2MFQA 1WM3A 1KC7A 3MHSD 2GS0A 2WWZA 2IFSA 1WRDB 2R2QA 4LCDE 2LYDA 2Z0OA 3BINA 2Z0EB 4HLEA 1LB1A 3MPXA 4HPMB 4BBKA 1WIAA 3ZNID 2D9YA 3FLVA 2GBJA 1LQBA 4WAAA 5HE0A 3TW1A 3DBRI 3V6CB 1ZC3B 4GSWA 3DXEA 2N4FA 5FI1A 5D3VA 2P0DA 5EFXA 2O6VD 4WWNA 2FCQA 4KIKB 2V4LA 4EKUA 1WGQA 1Z87A 4F1SA 5D2MB 2R2OA 3A9JA 5BO4B 1MG8A 3JW0X 4ILJA 4BKGA 1BTKA 1P3QU 5J3TA 5AZHA 4W9GA 3NSUA 3K9OB 4TKNA 4HPLB 1OMWA 5HKHA 1H4RA 3WANA 4MGYE 1L7YA 2KK8A 1NVLA 3PPAA 4NAWB 3K9PB 4HDQA 1OQNA 3P6AA 2JY6A 4FBJB 3L16A 2LBBA 5AEKB 2GJYA 4BKTA 3PVWA 1T0YA 5HE2A 2CB8A 3QJZA 3JSVA 3A9KA 4NJ6A 4ANWA 1V5UA 2D9XA 2KCJA 2MW5A 4ICUA 1KLVA 2DYQA 5CHFA 3WAPA 3GOEA 2JVCA 3KW5B 1GJZA 4PYZA 3W1YA 1TZ1A 1ZVRA 2FCSA 1QQGA 3VHTC 2MSED 5L81A 4IUMB 3NOBA 5D94A 3A1QB 1Y5OA 3ZIMA 5CHVC 4M0WB 1V89A 2GBMA 1X1GA 2DKPA 4D0NB 4M8NA 3DBLI 1UH6A 3VTWA 1TTNA 3KYDD 3ZLZA 3EC8A 2JZ3B 2HRJA 2ZVNA 4CHKA 5J2RA 2L3ZA 2KUPA 5KCVA 2BWES 1UELA 2L7RA 2Y5BB 4MDKE 3DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAX A;  2WX1 A;  2KAN A;  3B1L X;  2COA A;  5JP4 A;  5KHQ A;  4GB9 A;  1MK7 B;  5J18 A;  4Z2M B;  2YS5 A;  3ECI A;  1WJN A;  3VUW A;  1F9J A;  3H9D A;  2COF A;  5C1Z A;  2NR2 A;  3QK0 A;  1J0W A;  1WI1 A;  1UGM A;  2YS3 A;  1C3T A;  1KZ7 A;  3U30 A;  4DXA B;  2BPS A;  4K2O A;  1VD2 A;  1WMH A;  2L0T A;  3SDL C;  4W9L A;  4ASW C;  2LOZ A;  4NJ7 A;  1FB8 A;  4LDT B;  3IVF A;  3VVW B;  4MEM A;  1NU2 A;  2YLM A;  3D8F A;  1OGW A;  4K17 A;  2MBE A;  3M3J A;  2N1W A;  3AUL A;  3IBE A;  3TL5 A;  5D3Y A;  2KXJ A;  4HCP B;  4IG7 B;  2LD9 A;  4HB4 B;  4DHJ B;  5L95 C;  2KOX A;  2LKO A;  4K2P A;  1E7U A;  4A6F B;  1XQQ A;  4KHA A;  1V5M A;  4K81 A;  2ELB A;  3EEC A;  4BBN C;  1ST7 A;  3ML4 A;  2L00 B;  4MJS A;  3DOW A;  1HBK A;  4GXB A;  2KFK B;  4NSW A;  2DTC A;  3CF6 E;  4WWO A;  2MBH A;  2KO3 A;  5E6P A;  2DZK A;  1KI1 B;  2D4Q A;  2KLC A;  3DXD A;  4TQ1 A;  2QKL A;  4IFS A;  3AJ4 A;  4WJ7 A;  2L0F A;  4MK0 A;  5LXH A;  3A33 B;  5C16 A;  2K25 A;  2ZZP B;  2J0K A;  4KDI C;  3GYP A;  4CHJ A;  1WX9 A;  4RM8 A;  3OAN A;  1P9D U;  3PEG A;  3MDB C;  1KZG A;  3SV1 A;  3N7C A;  2PPH A;  1WGG A;  2HTH A;  4IM0 A;  1WZ0 A;  5E6O A;  2RLO A;  5C6R A;  2G4D B;  3D32 A;  2A4Z A;  2FJL A;  3H7P A;  2LVP A;  2VKI A;  2D07 B;  5IA7 A;  4EUT A;  1OQY A;  2NBU A;  2KN5 A;  1TBE A;  4I6N B;  4FHK A;  1WJU A;  4JIO U;  1WXS A;  3U8Z A;  2L1C A;  2JRI B;  1KOT A;  2BKR B;  3PP2 A;  4K1R B;  3HM6 X;  2LRU A;  1SHC A;  3JVZ X;  1P5T A;  1AAR A;  3RD2 A;  1S3S G;  1V86 A;  2DHJ A;  3TVV A;  1EVH A;  4W9E A;  2RD0 A;  2LVQ A;  4W9K A;  2LXC A;  4EZK A;  3ZUN A;  3UF8 A;  3PSE B;  2H7D A;  1DRO A;  2YT1 A;  1BWN A;  2MRP A;  3VIA A;  1E8Y A;  4W9C A;  4KSK C;  1UNQ A;  1WGY A;  1W1H A;  3PVL A;  4K7W A;  4JQW C;  1MIZ B;  1X1F A;  2KJR A;  2COD A;  4IC7 B;  1AWE A;  3FEH A;  3SUZ A;  2DHK A;  3ZVV A;  2ZJD A;  4FUL A;  4WSF A;  1E8W A;  2NBV B;  2HD5 B;  4A3O A;  2OTX A;  1UNR A;  2GMI C;  3WAL A;  3CXB B;  3H6N A;  4KDL B;  1UBI A;  2K2U A;  2K8H A;  3QIJ A;  4E74 A;  2MA9 B;  2I5C A;  2DKQ A;  4GDK B;  2AEH A;  5C5B B;  2X18 A;  2J59 M;  1RRP B;  1OEY J;  1I35 A;  1V5O A;  2EJ8 A;  2UVM A;  3NZS A;  3D8E A;  3VQI A;  3L13 A;  2D9W A;  1K5D B;  4HJK A;  2KDE B;  1K8R B;  1K5G B;  3ODW A;  4H8S A;  4AOF A;  3WIM A;  2JUO A;  4BBN F;  1HE8 A;  3PGE A;  1OY2 A;  1U5E A;  1YX5 B;  2I1J A;  5E6N A;  2UYZ B;  2K8C A;  2W9N A;  3V6E B;  4GOC A;  3T9L A;  4W9F A;  3L08 A;  3UIN B;  5JHH A;  2FCN A;  1HB6 A;  1X1M A;  1P98 A;  2RUK B;  3GYO A;  3R7R A;  2O2V A;  5J3Q A;  4DHZ B;  4PS8 A;  3CST A;  2FJ9 A;  1ZW7 A;  4EJN A;  1UEF A;  5DIF B;  2IBI B;  2YRY A;  1DBH A;  3FSS A;  3L0W B;  1WH3 A;  5DI9 B;  2MBQ A;  3HHM A;  2C5L C;  1U4A A;  3UQA A;  2AWT A;  1ZC4 B;  2DX5 A;  3R7Q A;  3KY9 A;  2IO2 B;  4IAP A;  2D11 A;  1MK9 B;  1NI2 A;  1MAI A;  4FA6 A;  4OVU A;  4L6E A;  2KVR A;  2ZPN A;  2DYO A;  4TUU A;  1WZ3 A;  2KTR B;  2UWQ A;  2DYB A;  3HIZ A;  2Z0P A;  3TBL D;  2LUE A;  4IM2 A;  1M94 A;  4AJW A;  2XQN M;  5J17 A;  4HAW B;  2KD0 A;  2G45 B;  3X23 A;  2MKR A;  4HB0 B;  3V62 A;  4HXD A;  4J6I A;  4OVV A;  1BAK A;  2IYB A;  4GIV A;  2KQ7 A;  4IW0 A;  3KZ1 A;  1FOE A;  3KUZ A;  4MGZ E;  4IWP A;  5IAA C;  3N32 A;  2KDF B;  3RCZ A;  2LZ6 A;  3LJU X;  4EOY A;  3DPD A;  1H10 A;  4HHV A;  1WX8 A;  4MEL A;  2JP2 A;  2VRW B;  2DZI A;  2RQ1 A;  2JZZ A;  3M62 B;  1WYW B;  4EFO A;  2KKC A;  2XEW A;  2PZ1 A;  2IO3 B;  2KJ6 A;  3VH4 B;  4ZRK A;  2K6D B;  2W2X D;  3KYC D;  2M14 A;  1V5P A;  4MH0 E;  2PE6 B;  2K6Q A;  2BYV E;  5G55 A;  1Q1O A;  1ACA A;  2EMT A;  2KGX B;  3A8Q A;  4HWI B;  3DDC B;  3ML9 A;  4IM3 A;  4K7S A;  3NZU A;  2KQS A;  4MM3 A;  2CHX A;  2NBW B;  5CLL B;  2KNB A;  2GBR A;  2ASQ A;  2FUH B;  2KJH B;  1ZKH A;  4YON A;  1WY8 A;  4NQL B;  3I3T B;  3HQC A;  1WXM A;  3TIX A;  3WA0 A;  3RUL A;  3ONS A;  4P7I A;  4FLH A;  2NVU I;  1IP9 A;  3VAW A;  3ZRC A;  1NBF C;  1TXD A;  4MY6 A;  3IFW B;  2FID A;  2GCJ A;  4A20 A;  3TJP A;  4A6K A;  3QCA A;  1BTN A;  2MBO A;  2M38 A;  2REX A;  3AXC A;  3RZF A;  2C7H A;  2M8S A;  3MJW A;  1VCB A;  2K39 A;  3P7Z A;  4B6H A;  4JL9 A;  1EF1 A;  4PNK A;  4MSQ B;  2R0D A;  3PTF C;  1E90 A;  3PHX B;  3PRM B;  3PLU A;  4GZU A;  1Q67 A;  2DHI A;  1XX0 A;  5G2N A;  2KFJ A;  4GN1 A;  2JT4 B;  2V1Y A;  1Z2M A;  3ML8 A;  2IYD B;  3PZD A;  1WR6 E;  2G3Q B;  2ZNV B;  2CY4 A;  4GDL B;  4KVG B;  1MIX A;  2GOW A;  4KIK A;  1RJ2 A;  4I6L B;  1E8Z A;  4JGH B;  3UIP B;  4X57 B;  2FNJ B;  2ROV A;  2ZCC A;  1WGD A;  3OJ3 A;  4PQ0 A;  2OQB A;  3BJI A;  2P0H A;  2D9V A;  4BKS A;  4G11 A;  4B9K A;  2CS4 A;  3V60 A;  2N0Y A;  4NAW A;  1V5T A;  2OOB B;  4DDG D;  3CIK A;  4HCN B;  3AU5 A;  3PHW B;  2XBB C;  2VSZ A;  2CAY A;  1WVH A;  4GMV A;  2RSU A;  2KX3 A;  5HE3 A;  3PV1 A;  1WGR A;  3ZW3 A;  3NY5 A;  2LG1 A;  4W9H A;  3N30 A;  4A6H A;  3RCP A;  1YX6 B;  3QWM A;  1V49 A;  4YL8 A;  2JWZ A;  2KZR A;  4GGQ A;  3PVU A;  3VDZ A;  3D8D A;  3KSY A;  4BOS C;  5KQ1 A;  5TR5 A;  4KV2 A;  2PJH A;  2LWP A;  3WAM A;  3QAR A;  4N9F 4;  2BGF A;  1L2N A;  2D2Q A;  2Z0Q A;  1MKE A;  4DK5 A;  2O6V B;  4HAV B;  2XK5 B;  1XOD A;  3PSC A;  3UZT A;  2N9E B;  1WJ1 A;  5DHA B;  3PRE A;  1R4M I;  2ABD A;  1WJ6 A;  1Q5W B;  3JYU A;  2EC1 A;  4CYE A;  1WX7 A;  1JRU A;  1SE9 A;  5AZF A;  2NMB A;  1KM7 A;  2FAZ A;  4F8C B;  3X0W A;  2KHW B;  2KDI A;  2C9W B;  2ELA A;  4BKS D;  2LXA A;  1WFY A;  3OAW A;  5DPT A;  2DEN B;  4I6P A;  2M1M A;  2IZV B;  3CSF A;  4E71 A;  2N9X A;  2NS5 A;  4IWO A;  2P8V A;  1OEY A;  1J19 A;  5L83 A;  3KUD B;  2O2V B;  1FXT B;  2G35 A;  1TQZ A;  1XD4 A;  4KSL C;  4G0N B;  1D3Z A;  3T06 A;  2B3A A;  5JHG A;  2YT0 A;  2M0X A;  2GCL A;  1ZSQ A;  3HW2 B;  2COP A;  2KWV B;  3NS8 A;  1EUV B;  3QX1 A;  3AI5 A;  2ADZ A;  1YD8 U;  5J3Y A;  2FIF A;  2DX5 B;  4DHZ E;  1PQS A;  3RZW C;  3ODX A;  3TO1 A;  5C23 A;  1DDV A;  2A5U A;  3W1S C;  1RLF A;  3A9J B;  2RVB B;  3QHT A;  2IY1 B;  1V6E A;  3L17 A;  3KRW A;  2LOX A;  4WWP A;  1SIF A;  4XX5 A;  3WYF B;  4CHM A;  1V61 A;  3Q3F A;  1HB8 A;  4DBB A;  1AQC A;  2BWF A;  3F0W A;  5EDS A;  2Y8F A;  4A6F A;  2ZCB A;  2Y7B A;  1N3H A;  3FP5 A;  4HDO A;  1TGZ B;  5GOW B;  3JSV B;  5LLI A;  3A9K B;  4II3 B;  4HVB A;  2BCJ A;  1LFD A;  2HJ8 A;  3RYT A;  3ULC A;  4ICV A;  4IOY X;  5JLJ B;  1EAZ A;  3VOQ A;  1XCG A;  4NY0 A;  1B55 A;  4EEW A;  1E5W A;  2UZR A;  4IWQ A;  3QC8 B;  2KFK A;  1IRS A;  2DA0 A;  4WJP A;  3SD5 A;  2ZPY A;  3B0A A;  2C60 A;  4PS3 A;  1DYN A;  3APC A;  3EFU A;  1EF5 A;  2BF8 B;  1Q0W B;  5DHF B;  2CRF A;  1P6S A;  4RM9 A;  4HAZ B;  3EHV A;  3A4R A;  1Z5S B;  2LI5 A;  4WJQ A;  4LDT D;  4Y94 A;  3R3M A;  3ENE A;  3C0R B;  4G3X B;  5FI0 A;  4AWJ A;  4HB2 B;  4KZC A;  2BYF A;  5FR6 A;  2VRR B;  1FHW A;  2J0M A;  4TYZ A;  2RR9 A;  3OJ4 B;  2LUL A;  4II2 B;  4XC2 A;  4ZRI A;  2ZVO A;  4DHJ D;  4NPN A;  4K7U A;  4MSM B;  4ANX A;  4DWF A;  2NPT A;  2MWN B;  5CHW A;  4ZDV A;  3B08 A;  4C0A A;  2JF5 A;  3VUX A;  2K1F A;  2MDX A;  2DZJ A;  1I2H A;  2QKM A;  3TCA A;  3ZNG C;  5C79 A;  5CX3 A;  4RMA A;  3A98 B;  5DCN A;  4WVF B;  2IY0 B;  3DVN V;  1XD3 B;  2KTF A;  3DBS A;  2MWS B;  3F5R A;  2QHO A;  5D7G A;  2DYN A;  2PEA A;  2ROZ B;  1WMH B;  1QC6 A;  4HK2 A;  4HB3 B;  1XR0 B;  3SNH A;  1TJ6 A;  3OLM D;  1PMS A;  3SO6 A;  1ISN A;  1UZX B;  1V81 A;  2EKE C;  4EZL A;  2I5F A;  1V80 A;  1WF9 A;  4LJO B;  2E2X A;  1FHX A;  4B95 A;  3QQ8 B;  4W9D A;  3V61 A;  1H8C A;  3SU8 X;  3PG7 A;  1P0R A;  2CU1 A;  4FAD A;  2V3S A;  2RNR B;  2KWC A;  3WAO A;  3ZDM C;  2Z59 B;  3ZNZ B;  5D3W A;  4BVU C;  3QA8 A;  1X11 A;  2K8B A;  4AP4 C;  1E8X A;  2JXX A;  2CY5 A;  5JH5 C;  3H1U A;  3ZDT A;  4XZ4 A;  4EZJ A;  1KJT A;  2KX0 A;  3M95 A;  1CMX B;  4DX8 A;  2LAS A;  1X86 A;  4ZYN A;  1XKE A;  4XWX A;  4GDK A;  4MJS B;  5C5B A;  4KZ0 A;  3APD A;  3ZO5 B;  4FHJ A;  1J0G A;  4BFR A;  1M7E A;  1QZE A;  3PRZ A;  1YJ1 A;  3DVG Y;  3ZTC A;  1P3R A;  3PLV A;  2P0F A;  1MPH A;  2IO1 B;  2COC A;  5LOP B;  1GC7 A;  1I7A A;  1BT0 A;  4W9J A;  1WM2 A;  2R09 A;  4W9I A;  3QBV B;  4GU2 A;  2C7M B;  4DBG A;  4F7H A;  2MP2 A;  3TMP B;  2LVO A;  5DH9 B;  4FJV B;  4WJO A;  4GPT B;  4PS7 A;  1XT9 B;  2HTH B;  2DHZ A;  4FJY A;  1RRB A;  1UBQ A;  2OJR A;  2DAF A;  3DCG A;  1M7R A;  4B6W A;  3H7P B;  2L05 A;  3SYX A;  4CO7 A;  5HE1 A;  3KRX A;  3H7S A;  2M4N A;  1C1Y B;  4PYU A;  5LON B;  2JPH A;  1LXD A;  2NCN A;  5KQ4 A;  1WXV A;  2MBB B;  4EMO A;  3T8M A;  3ZNH B;  1WGU A;  3LDZ E;  2MX2 A;  1Y8R C;  3O65 B;  5JHA A;  1WG7 A;  2Q13 A;  2J7Q B;  1E7V A;  1R4N I;  2KTR A;  2AL3 A;  3QWZ B;  1W1G A;  3QAQ A;  1EGX A;  4FN2 A;  3N3K B;  3R66 C;  2GBN A;  1YIW A;  3VXW A;  1U2B A;  2RGN B;  3NHE B;  3P2B A;  2D10 A;  2CHZ A;  1ZGU B;  3VH3 B;  1PLS A;  1GNU A;  3EPY A;  3M63 B;  4F7G A;  2WDT B;  3CMM B;  3PT2 B;  2KDB A;  1UNP A;  3VTV A;  4G50 A;  2JRH A;  2HE7 A;  4MT7 A;  2LGX A;  1G6J A;  4KAX B;  5JZE B;  2YS1 A;  2UZS A;  1EO6 A;  1GUA B;  4DDI D;  4ZRJ A;  5DPR A;  1DDM A;  1WI0 A;  2CR5 A;  3RT3 B;  2DLW A;  1WJ4 A;  3UQB A;  1W1D A;  1WR1 A;  1U27 A;  2WYQ A;  2YVC A;  1V88 A;  1RFA A;  3ODO A;  5CLQ B;  4HAU B;  1U5F A;  1LM8 B;  2C7N B;  2ZNV C;  4E3C A;  2L76 A;  1P1A A;  3A1Q A;  2KMC A;  3ALB A;  1U29 A;  4A3P A;  2MCN B;  1I42 A;  5CTR C;  2RSG A;  1NDD A;  2AYO B;  2DX1 A;  3PS6 A;  3SHQ A;  2YSZ A;  5D27 A;  4KHO A;  2N23 A;  2FCM A;  1WE7 A;  3L54 A;  4AUQ C;  4TQ0 A;  2BYE A;  1V9J A;  2Z0D B;  2L2I A;  3KH0 A;  1V2Y A;  4Z2N A;  2N9P C;  2N7D A;  4A5K A;  3BY4 B;  1ZM0 A;  2WX0 A;  2K2J A;  2LGY A;  2KMA A;  2I1K A;  4WQO B;  2NPT B;  4TV3 A;  3APF A;  1UD7 A;  3HM3 A;  4LJP B;  2LRW A;  3DQV A;  4HAT B;  1UPQ A;  4MGK E;  2N1V A;  5DPS A;  1J8C A;  1PFJ A;  1Y19 B;  1OTR B;  5JHB A;  3DBH I;  2DN6 A;  5IJM A;  4WJN A;  3TFM A;  1FGY A;  2EMS A;  3AU4 A;  3M1I B;  2WH5 A;  2KLG A;  2GBK A;  1WJM A;  4AJY B;  4GDL A;  1NTY A;  2N7E A;  2V76 A;  1UPR A;  3A8P A;  3VUY A;  1YQB A;  4NNJ B;  2DAJ A;  1A5R A;  1FHO A;  2RPQ A;  3A4S C;  4ANU A;  2Y8G A;  4HAX B;  2W2W A;  1GC6 A;  3ZVR A;  3HK0 A;  3UIO B;  1WE6 A;  1IYF A;  4F7Z A;  1NTI A;  2D3G A;  3KVF B;  3UGB B;  2FDQ A;  3RUI B;  1U5D A;  2DZM A;  3IG3 A;  4MGI E;  4BOZ B;  2KC1 A;  2DYM A;  3S2A A;  2KWU B;  2MQJ A;  4KHB B;  3O96 A;  3Q3J A;  3VFK A;  1X05 A;  3U7D A;  3PRP B;  5DPW A;  3L10 B;  2AL6 A;  3DVN U;  2H7E A;  2D9Z A;  1GG3 A;  2W2X C;  2BKF A;  2LJ5 A;  3GZN I;  2CQU A;  3ULB A;  1SGH A;  1DDW A;  3ZRF A;  2ZEQ A;  4URK A;  1U5G A;  3ZTD A;  2O6V A;  2PE9 A;  3ZKJ C;  1WGH A;  1IPG A;  2XK5 A;  3VTU A;  5AZG A;  2G4S A;  4FJZ A;  4F7U P;  1WXA A;  2CKH B;  2J0J A;  2CHW A;  4NQK E;  4HAY B;  4JLC A;  2MLB A;  5D3X A;  3W1S A;  4DX9 0;  1LW3 A;  1NTV A;  2DFK A;  4ANV A;  2NZ8 B;  2RGF A;  4M8M A;  5LXI B;  2MP2 B;  2KC2 A;  3KUC B;  5D6J B;  3IHP C;  3MTN B;  2YF0 A;  4GMX B;  5KHO A;  2IO0 B;  3FM8 C;  3V5W A;  5GMV A;  3LJ3 A;  2M17 A;  2LGD A;  3G9W A;  1FGZ A;  2L8J A;  3DVG X;  1FAO A;  2K00 A;  1S1Q B;  2MFQ A;  1WM3 A;  3MHS D;  2GS0 A;  2WWZ A;  2IFS A;  1WRD B;  2R2Q A;  4LCD E;  2LYD A;  2Z0O A;  3BIN A;  2Z0E B;  4HLE A;  1LB1 A;  3MPX A;  4HPM B;  4BBK A;  1WIA A;  3ZNI D;  2D9Y A;  3FLV A;  2GBJ A;  1LQB A;  4WAA A;  5HE0 A;  3TW1 A;  3DBR I;  3V6C B;  1ZC3 B;  4GSW A;  3DXE A;  2N4F A;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  2O6V D;  4WWN A;  2FCQ A;  4KIK B;  2V4L A;  4EKU A;  1WGQ A;  1Z87 A;  4F1S A;  5D2M B;  2R2O A;  3A9J A;  5BO4 B;  1MG8 A;  3JW0 X;  4BKG A;  1BTK A;  1P3Q U;  5J3T A;  5AZH A;  4W9G A;  3NSU A;  3K9O B;  4TKN A;  4HPL B;  1OMW A;  5HKH A;  1H4R A;  3WAN A;  4MGY E;  1L7Y A;  2KK8 A;  1NVL A;  3PPA A;  4NAW B;  3K9P B;  4HDQ A;  1OQN A;  3P6A A;  2JY6 A;  4FBJ B;  3L16 A;  2LBB A;  5AEK B;  2GJY A;  4BKT A;  3PVW A;  1T0Y A;  5HE2 A;  2CB8 A;  3QJZ A;  3JSV A;  3A9K A;  4NJ6 A;  4ANW A;  1V5U A;  2D9X A;  2KCJ A;  2MW5 A;  4ICU A;  1KLV A;  2DYQ A;  5CHF A;  3WAP A;  3GOE A;  2JVC A;  3KW5 B;  1GJZ A;  4PYZ A;  3W1Y A;  1TZ1 A;  1ZVR A;  2FCS A;  1QQG A;  3VHT C;  2MSE D;  5L81 A;  4IUM B;  3NOB A;  5D94 A;  3A1Q B;  1Y5O A;  3ZIM A;  5CHV C;  4M0W B;  1V89 A;  2GBM A;  1X1G A;  2DKP A;  4D0N B;  4M8N A;  3DBL I;  1UH6 A;  3VTW A;  1TTN A;  3KYD D;  3ZLZ A;  3EC8 A;  2JZ3 B;  2HRJ A;  2ZVN A;  4CHK A;  5J2R A;  2L3Z A;  2KUP A;  5KCV A;  2BWE S;  1UEL A;  2L7R A;  2Y5B B;  4MDK E;  3DXC A; 
#chains in the Genus database with same CATH topology
 1RAX A;  2WX1 A;  2KAN A;  3B1L X;  2COA A;  5JP4 A;  4JKD A;  5KHQ A;  4GB9 A;  1MK7 B;  5J18 A;  2KVZ A;  1JWB D;  5BMI A;  4Z2M B;  3V05 A;  2YS5 A;  1K51 A;  3ECI A;  1WJN A;  3VUW A;  2INN E;  3RI7 C;  1F9J A;  3BYY B;  3H9D A;  3BYT B;  5LNK 1;  2COF A;  5C1Z A;  2NR2 A;  3QK0 A;  5HHD G;  1HQR D;  1J0W A;  1SBB B;  1A70 A;  1WI1 A;  1UGM A;  2YS3 A;  1C3T A;  1KZ7 A;  3B9J A;  3U30 A;  2KR0 A;  4DXA B;  2BPS A;  3AV8 A;  2IJ0 A;  4K2O A;  1VD2 A;  1KLU D;  1WMH A;  1QIL A;  2L0T A;  3SDL C;  4W9L A;  2JYT A;  2WU5 B;  4ASW C;  1VRA B;  5IOI A;  2LOZ A;  3AN1 A;  3GZN B;  2LGS A;  4NJ7 A;  1FB8 A;  2FE8 A;  2PTL A;  4LDT B;  4YTN B;  3IVF A;  3VVW B;  4MEM A;  1NU2 A;  2YLM A;  3D8F A;  1OGW A;  4BZA A;  4K17 A;  2WS3 B;  2MBE A;  3AE1 B;  1GB1 A;  1B1Z A;  3M3J A;  2N1W A;  3AUL A;  3IBE A;  4KGR A;  3TL5 A;  5D3Y A;  2KXJ A;  4HCP B;  3KLS X;  1I4X A;  2N9L A;  4IG7 B;  3Q3M C;  2LD9 A;  3BWU D;  1ZP0 B;  3ZJT A;  3E9S A;  2Z59 A;  4HB4 B;  1C4C A;  4DHJ B;  1FO4 A;  5L95 C;  4RGN A;  3U52 E;  2GUM A;  2KOX A;  2LKO A;  2IGG A;  4K2P A;  1E7U A;  3VR8 B;  3NRZ A;  5HFY A;  1L6U A;  4L1R A;  1XLN A;  4A6F B;  1ZYI A;  1XQQ A;  2G1E A;  4KHA A;  2V9H A;  2BYT A;  1V5M A;  4K81 A;  3EGR A;  2ELB A;  3EEC A;  3RN9 C;  4BBN C;  1ST7 A;  3H8H A;  1QOA A;  1CK1 A;  4CQN A;  3ML4 A;  2BBC A;  3NJT A;  3DHH C;  4OZC A;  3ZQ4 A;  2L00 B;  3AEG B;  4MJS A;  3DOW A;  1HBK A;  4GXB A;  2KFK B;  2DLB A;  3FC4 A;  4NSW A;  2DTC A;  2PLP A;  3CF6 E;  3FIL B;  4WWO A;  2MBH A;  4JKG A;  2KO3 A;  5E6P A;  3VRB B;  2DZK A;  1WYG A;  4JK8 A;  1KI1 B;  2D4Q A;  2KLC A;  3DXD A;  4TQ1 A;  2QKL A;  1C79 A;  2DBY A;  4IFS A;  3AJ4 A;  4WJ7 A;  3NWD A;  2L0F A;  1V8C A;  4MK0 A;  5LXH A;  3A33 B;  1N6Z A;  3AEA B;  1SXT A;  3DBR B;  3PZ7 A;  3TEW A;  5C16 A;  2K25 A;  4WUR A;  2ZZP B;  5BYQ A;  4ILG B;  2J0K A;  4KDI C;  3GYP A;  4CHJ A;  1WX9 A;  2N0S B;  2E6X A;  1XF5 L;  4RM8 A;  1TIF A;  4QXA B;  3OAN A;  1KF6 B;  5IN7 A;  1P9D U;  2W3S A;  3PEG A;  2KAC A;  2XNA C;  3MDB C;  1UWX A;  1KZG A;  3SV1 A;  3N7C A;  2PPH A;  1WGG A;  2HTH A;  1L0V B;  4IM0 A;  1WZ0 A;  3OHM B;  5E6O A;  3Q2A C;  2RLO A;  5C6R A;  2G4D B;  3D32 A;  4P16 A;  2A4Z A;  2FJL A;  3H7P A;  2LVP A;  5C2T B;  2VKI A;  1I4R A;  2D07 B;  1JRO A;  2FUG 1;  3ZJU A;  5IA7 A;  4EUT A;  1OQY A;  2NBU A;  1RWS A;  2KN5 A;  1TBE A;  4I6N B;  1AW7 A;  4FHK A;  3LYY A;  1WJU A;  4JIO U;  1WXS A;  3DWM A;  3U8Z A;  2L1C A;  2JRI B;  1KOT A;  2BKR B;  3PP2 A;  4K1R B;  3HM6 X;  1TY0 A;  3R2T A;  2LRU A;  2V0G A;  1RM6 C;  3I57 A;  1SHC A;  3JVZ X;  4NZL B;  1P5T A;  1AAR A;  1Q10 A;  3RD2 A;  1S3S G;  1V86 A;  3BVZ A;  2DHJ A;  3TVV A;  2IDY A;  1EVH A;  4W9E A;  2RD0 A;  3W5U B;  1YN5 A;  2LVQ A;  4W9K A;  1JWS D;  2LXC A;  4EZK A;  3OWE B;  3ZUN A;  3UF8 A;  1DOI A;  3PSE B;  4D6W A;  2H7D A;  1DRO A;  2YT1 A;  1BWN A;  1C77 A;  2HDE A;  2MRP A;  3VIA A;  1BUI C;  4EE2 A;  1TYG B;  1E8Y A;  1VBH A;  3HVZ A;  3N1X C;  4W9C A;  4BAX A;  1QT9 A;  1I4G A;  4KSK C;  1UNQ A;  2WXI A;  1WGY A;  3RNA C;  1W1H A;  4JWU C;  1MI1 A;  3PVL A;  4K7W A;  4B0M A;  3ZXV A;  1QKZ A;  4J3O D;  4JQW C;  1MIZ B;  1X1F A;  1KBL A;  1RFK A;  1PGB A;  5TSS A;  1FRR A;  1PDX A;  2KJR A;  3E66 A;  3DBL B;  2COD A;  4IC7 B;  1AWE A;  2R82 A;  3FEH A;  5IP4 D;  3SUZ A;  2DHK A;  3ZVV A;  2H89 B;  2ZJD A;  4FUL A;  4WSF A;  1MVK A;  4JKA A;  4RNA A;  1E8W A;  2NBV B;  2HD5 B;  1M4V A;  2D3A A;  4ZOH C;  4A3O A;  4OZB A;  1L0Y B;  4M00 A;  2OTX A;  4C4V A;  1UNR A;  3U2S C;  2GMI C;  3WAL A;  3CXB B;  3H6N A;  1L0X B;  3P1M A;  4KDL B;  2WHI A;  1UBI A;  2K2U A;  2K8H A;  3QIJ A;  4E74 A;  2MA9 B;  4C56 C;  2I5C A;  2DKQ A;  5IRS A;  3MJ5 A;  4GDK B;  1J7B A;  2AEH A;  5BYS A;  5C5B B;  3GS2 A;  2X18 A;  2J59 M;  2BT6 A;  1RRP B;  1OEY J;  1I35 A;  1V5O A;  2MJD A;  2EJ8 A;  2UVM A;  3NZS A;  3D8E A;  3VQI A;  4D2K A;  4RH6 A;  3L13 A;  2D9W A;  1GPX A;  2W82 A;  1K5D B;  1DOX A;  1ROE A;  4HJK A;  2KDE B;  1K8R B;  3C19 A;  3B77 A;  1K5G B;  3ODW A;  3DHI C;  1T0R C;  4H8S A;  4AOF A;  3IAM 1;  3WIM A;  4CSQ A;  5I4D A;  2JUO A;  1IUE A;  4BBN F;  1HE8 A;  3PGE A;  1JQ4 A;  1OY2 A;  1U5E A;  1YX5 B;  1EM7 A;  3I5J C;  4IOI E;  4JKF A;  4GOU A;  2I1J A;  2KIE A;  5E6N A;  1JWM D;  2UYZ B;  2K8C A;  2WQY B;  2W9N A;  3V6E B;  4GOC A;  3T9L A;  4W9F A;  1L4D B;  3L08 A;  3UIN B;  5JHH A;  2FCN A;  4DXG A;  1HB6 A;  4OSN A;  1X1M A;  1P98 A;  2RUK B;  3GYO A;  3R7R A;  2O2V A;  3RPF C;  5J3Q A;  2KYW A;  4DHZ B;  4PS8 A;  3CST A;  4WIP A;  2FJ9 A;  1ZW7 A;  4EJN A;  2Q5W D;  1UEF A;  5DIF B;  2IBI B;  4P1B C;  2YRY A;  1DBH A;  3Q8B A;  1QOB A;  4XWW A;  2HTM E;  2YEP F;  3FSS A;  3TEX A;  2Y3A A;  3L0W B;  1WH3 A;  4A6Q A;  5DI9 B;  2MBQ A;  3HHM A;  2C5L C;  1U4A A;  3UQA A;  2KIG A;  2AWT A;  1ZC4 B;  2DX5 A;  3R7Q A;  3KY9 A;  2IO2 B;  3C8Y A;  4IAP A;  2D11 A;  1MK9 B;  4IDI A;  4HJG E;  2WDV B;  1NI2 A;  1MAI A;  4FA6 A;  4OVU A;  1NYR A;  4L6E A;  2KVR A;  2INC C;  2ZPN A;  2DYO A;  2OED A;  4TUU A;  1WZ3 A;  1K52 A;  2KTR B;  2UWQ A;  2MHJ A;  4IKG A;  3I63 C;  1QQR A;  2DYB A;  3HIZ A;  3NWA A;  4YSX B;  2Z0P A;  3TBL D;  3W9C B;  2LUE A;  4RF1 A;  1HZ6 A;  4IM2 A;  1M94 A;  4AJW A;  1V1P A;  4XWT A;  2XQN M;  5J17 A;  4HAW B;  2KD0 A;  1I4P A;  2AX5 A;  2G45 B;  1FRD A;  3X23 A;  2MKR A;  4HB0 B;  3RNF C;  3V62 A;  4HXD A;  4J6I A;  4OVV A;  1BAK A;  2RMM A;  1K53 A;  2MJ3 A;  2IYB A;  4GIV A;  1T6B X;  2KQ7 A;  1QLB B;  4IW0 A;  3KZ1 A;  4KHB A;  3BII D;  1FOE A;  3KUZ A;  4KKI A;  4MGZ E;  4IWP A;  1T0S C;  5IAA C;  5JXV A;  3N32 A;  2KDF B;  2SAK A;  3RCZ A;  2LZ6 A;  5AUK A;  3TSS A;  3LJU X;  3A58 A;  4EOY A;  3DPD A;  1H10 A;  4USA A;  2X38 A;  4HHV A;  3HIE A;  1FCC C;  2WXM A;  1SIJ A;  1WX8 A;  4MEL A;  1F1H A;  2DIK A;  2JP2 A;  2VRW B;  2N9K A;  2DZI A;  2RQ1 A;  3RNB C;  2JZZ A;  3M62 B;  1WYW B;  4EFO A;  2KKC A;  2XEW A;  2PZ1 A;  4HSI A;  2IO3 B;  2KJ6 A;  3VH4 B;  4ZRK A;  1YJJ A;  2K6D B;  3J9C A;  1ZE3 D;  2W2X D;  3KYC D;  3AE4 B;  1XXG A;  1CJE A;  1D6E C;  2M14 A;  1GB4 A;  4MDK E;  2M0A A;  1V5P A;  2WU2 B;  4MH0 E;  2PE6 B;  1GGO A;  2QCZ A;  4JKG B;  2K6Q A;  3MC8 A;  2BYV E;  3GB1 A;  4YTP B;  3URY A;  5E6J A;  5G55 A;  1Q1O A;  2D3B A;  1ACA A;  2EMT A;  2KGX B;  3A8Q A;  3AE5 B;  4HWI B;  3DDC B;  3ML9 A;  4IM3 A;  4K7S A;  1DGJ A;  3NZU A;  2KQS A;  1BXT A;  4MM3 A;  2CHX A;  2NBW B;  5CLL B;  2KNB A;  4P6V F;  2GBR A;  5C3J B;  2WXP A;  2ASQ A;  2FUH B;  1D5Z C;  2KJH B;  1ZKH A;  3NUH B;  4YON A;  3DWG C;  5EE3 A;  3NVZ A;  1WY8 A;  3N20 C;  4NQL B;  2K0P A;  3I3T B;  3HQC A;  1WXM A;  3TIX A;  2KWD A;  3WA0 A;  3RUL A;  3ONS A;  1C4P A;  3FKY A;  2FBW B;  2JYE A;  4P7I A;  4FLH A;  2VZK D;  2NVU I;  2GLS A;  4ZHO A;  1IP9 A;  3VAW A;  4ZRQ A;  3ZRC A;  1NBF C;  1BML C;  1TXD A;  4HPP A;  1FFV A;  1CQV A;  4MY6 A;  3IFW B;  2FID A;  1TJE A;  2GCJ A;  4A20 A;  3TJP A;  4A6K A;  3AEF B;  4K3B A;  1TKE A;  3QCA A;  1E0Z A;  1BTN A;  2MBO A;  2M38 A;  2REX A;  3AXC A;  3RZF A;  2C7H A;  2M8S A;  2RDG A;  3MJW A;  1VCB A;  2K39 A;  3NWF A;  3P7Z A;  4B6H A;  4JL9 A;  1EF1 A;  4PNK A;  4GLS C;  4MSQ B;  2R0D A;  2VH1 A;  3PTF C;  1E90 A;  3PHX B;  3PRM B;  3PLU A;  4A9A A;  4GZU A;  1Q67 A;  2DHI A;  1XX0 A;  2R2Y A;  5G2N A;  2KFJ A;  4GN1 A;  2JT4 B;  2G9H D;  2WXQ A;  2MEK A;  2V1Y A;  1Z2M A;  3ML8 A;  2IYD B;  3PZD A;  1WR6 E;  5AUI A;  2G3Q B;  2ZNV B;  2CY4 A;  4JK7 A;  4GDL B;  2TSS A;  4KVG B;  1MIX A;  2GOW A;  4KIK A;  1RJ2 A;  4PT5 A;  4I6L B;  1T3Q A;  4MAC A;  3KWL A;  1E8Z A;  4JGH B;  1FCL A;  3UIP B;  1WXQ A;  4X57 B;  1LGR A;  2FNJ B;  2ROV A;  2ZCC A;  2WNM A;  4QJ3 B;  1R7S A;  1WGD A;  1ZDV A;  2BS3 B;  1TY2 A;  3OJ3 A;  1FNU A;  4PQ0 A;  2BW2 A;  2OQB A;  4NAM A;  3TUO A;  3BJI A;  2Z4D A;  3FAH A;  1QOG A;  1KLG D;  4ITK A;  2P0H A;  2D9V A;  4BKS A;  4G11 A;  4YXD B;  4B9K A;  2CS4 A;  5IO9 A;  3AMZ A;  3V60 A;  2N0Y A;  4NAW A;  4RF0 A;  1V5T A;  2OOB B;  4DDG D;  3CIK A;  4HCN B;  3AU5 A;  4ZRP A;  1PGX A;  2WDQ B;  2OHF A;  1N60 A;  3UI3 A;  3PHW B;  2XBB C;  1SE3 A;  2VSZ A;  1NVI D;  2CAY A;  1C78 A;  1WVH A;  4GMV A;  1UUP A;  1JDE A;  2CJN A;  4LNN A;  2RSU A;  2KX3 A;  5HE3 A;  3PV1 A;  4OW0 A;  4RGO S;  1WGR A;  3ZW3 A;  3NY5 A;  5FR3 A;  2LG1 A;  4W9H A;  3N30 A;  4A6H A;  3RCP A;  1YX6 B;  4LNO A;  3QWM A;  3CIR B;  1YOV B;  1V49 A;  4H2A A;  4YL8 A;  4REZ A;  2JWZ A;  2KZR A;  4GGQ A;  3PVU A;  3VDZ A;  3D8D A;  2L32 A;  3KSY A;  4BOS C;  5KQ1 A;  5TR5 A;  1TS4 A;  4KV2 A;  1VLB A;  2PJH A;  1CZP A;  2LWP A;  4L1B A;  3WAM A;  3QAR A;  4N9F 4;  1OFF A;  2BGF A;  1L2N A;  2D2Q A;  2Z0Q A;  1MKE A;  4DK5 A;  2O6V B;  2QEJ C;  4A55 A;  4HAV B;  3HRD D;  2XK5 B;  4DXF A;  1XOD A;  3B2F A;  5EE1 A;  4ZHP A;  4M0W A;  3MFG A;  3PSC A;  3U12 A;  2IND C;  3Q3N C;  4LK0 M;  3UZT A;  2N9E B;  1SE4 A;  1WJ1 A;  1XO3 A;  3VRA B;  5DHA B;  3SBT A;  3PRE A;  1R4M I;  2ABD A;  1WJ6 A;  4MH8 A;  5BMG A;  1Q5W B;  3JYU A;  2EC1 A;  2WXF A;  4CYE A;  1PUT A;  4XDC A;  1I4Q A;  1TS5 A;  1WX7 A;  1P7E A;  2LJI A;  1JRU A;  1SE9 A;  1E7P B;  1L6V A;  1MFW A;  5AZF A;  2NMB A;  1KM7 A;  1EWY C;  2FAZ A;  1AYF A;  4F8C B;  3X0W A;  2KHW B;  2KDI A;  2C9W B;  2ELA A;  4BKS D;  2LXA A;  1WFY A;  3OAW A;  5DPT A;  2DEN B;  4I6P A;  2M1M A;  2IZV B;  3CSF A;  4E71 A;  2L1A A;  3RNG C;  2N9X A;  2RDH A;  2NS5 A;  4IWO A;  2P8V A;  1OEY A;  1J19 A;  5L83 A;  3KUD B;  2O2V B;  2WXR A;  1FXT B;  2G35 A;  1TQZ A;  1IGC A;  1XD4 A;  4KSL C;  4G0N B;  2R61 A;  1D3Z A;  4JE3 B;  4LLG M;  1PGA A;  3T06 A;  2B3A A;  5JHG A;  3AE8 B;  2YT0 A;  2M0X A;  2GCL A;  1ZSQ A;  3HW2 B;  4KKJ A;  2COP A;  2KWV B;  3NS8 A;  2IGH A;  1EUV B;  3QX1 A;  3U4E G;  3AI5 A;  2ADZ A;  1NYQ A;  1YD8 U;  5J3Y A;  2FIF A;  2DX5 B;  2KT7 A;  1VZ8 A;  3BZD B;  3P4P B;  4DHZ E;  1JCK B;  1I4H A;  1PQS A;  1D4B A;  4A90 A;  3RZW C;  2ON8 A;  3ODX A;  3TO1 A;  5C23 A;  3E9P A;  1IBX B;  1DDV A;  2A5U A;  3W1S C;  2KMM A;  1RLF A;  3A9J B;  2KDM A;  2RVB B;  4HRO A;  4LNF A;  3QHT A;  1VR9 A;  1VDV A;  2WXJ A;  2IY1 B;  2ACZ B;  1V6E A;  4P1C C;  3L17 A;  3KRW A;  3CWI A;  2BB5 A;  2LOX A;  4HKQ A;  4WWP A;  1SIF A;  4XX5 A;  3WYF B;  1XLP A;  2B76 B;  4CHM A;  1V61 A;  1V1P B;  3Q3F A;  1ZUD 2;  4C7Z A;  2CU3 A;  3N1Z C;  1HB8 A;  1T5X D;  4DBB A;  1AQC A;  2BWF A;  2JX5 A;  3NVV A;  3F0W A;  2H88 B;  1HA5 A;  5EDS A;  3Q69 A;  3NG0 A;  4QJ4 B;  2Y8F A;  4A6F A;  2M19 A;  1UNS A;  2ZCB A;  2Y7B A;  2VH2 A;  1N3H A;  3FP5 A;  5I2S A;  4HDO A;  1TGZ B;  1GAQ B;  5GOW B;  3JSV B;  4WQM A;  5LLI A;  3A9K B;  3VR9 B;  4II3 B;  4HRS A;  4HVB A;  2BCJ A;  1LFD A;  2HJ8 A;  3RYT A;  3ULC A;  4ICV A;  2DWQ A;  3E9L A;  4IOY X;  5JLJ B;  1EAZ A;  4MT5 A;  3VOQ A;  1XCG A;  4NY0 A;  2K3U A;  1B55 A;  1TS3 A;  2QJL A;  4EEW A;  2NTS A;  3NW8 A;  1E5W A;  2UZR A;  1FD6 A;  4IWQ A;  3QC8 B;  2KFK A;  1HTQ A;  1IRS A;  1WGK A;  3ABV B;  2DA0 A;  4WJP A;  3SD5 A;  2ZPY A;  2OJW A;  3B0A A;  2C60 A;  4PS3 A;  3FIL A;  1DYN A;  3APC A;  3EFU A;  4S0R A;  1EWC A;  5HG2 A;  1EF5 A;  2BF8 B;  1Q0W B;  3E9O A;  3Q8A A;  5DHF B;  2KN4 A;  2CRF A;  1P6S A;  3Q14 C;  4RM9 A;  3IAS 1;  4HAZ B;  3U7Z A;  3EHV A;  5FKA C;  3A4R A;  5MPO A;  1Z5S B;  2LI5 A;  4WJQ A;  1B9R A;  3EA6 A;  4LDT D;  4Y94 A;  3R3M A;  3ENE A;  3C0R B;  4G3X B;  5FI0 A;  2EEL A;  4AWJ A;  3AH7 A;  4HB2 B;  4KZC A;  4JKC A;  2BYF A;  2LMC A;  4MM3 B;  3V3X A;  1ZOY B;  1YMH E;  5FR6 A;  3PZ8 A;  2VRR B;  1FHW A;  1NI3 A;  4DQO C;  2J0M A;  3MP9 A;  4TYZ A;  1PYW D;  2RR9 A;  3OJ4 B;  2LUL A;  4II2 B;  4XC2 A;  2NMQ A;  4ZRI A;  1F77 A;  2ZVO A;  4NPN A;  4DHJ D;  1AWD A;  4K7U A;  3AEC B;  4MSM B;  2LUM A;  4ANX A;  4DWF A;  2NPT A;  2MWN B;  3WCQ A;  5CHW A;  4ZDV A;  3BK1 A;  3B08 A;  4C0A A;  1NEN B;  2QSD A;  2BS4 B;  2JF5 A;  3VUX A;  2K1F A;  2MDX A;  1F52 A;  1MG4 A;  2RRF A;  2CJO A;  2DZJ A;  4N6E B;  1I2H A;  2QKM A;  3TCA A;  3T3O A;  3ZNG C;  4OT1 A;  5C79 A;  5CX3 A;  4RMA A;  3A98 B;  2AQ2 B;  2KAJ A;  5DCN A;  4WVF B;  2IY0 B;  3DVN V;  4HEA 1;  1YN4 A;  1XD3 B;  2KTF A;  1LO5 D;  3DBS A;  2MWS B;  3F5R A;  2PKO A;  2QHO A;  5D7G A;  2DYN A;  4QJ5 B;  2PEA A;  1TS2 A;  1PFD A;  1STE A;  3KQ4 A;  1T77 A;  4US8 A;  2FJU B;  2ROZ B;  1WMH B;  1QC6 A;  4HK2 A;  1JRP A;  4YSY B;  1GOZ A;  4HB3 B;  2W54 A;  2ONQ A;  1XR0 B;  1HZ5 A;  4M01 A;  1FPY A;  3SNH A;  1TJ6 A;  3OLM D;  1PMS A;  4C00 A;  3SO6 A;  1ISN A;  1UZX B;  3AB5 A;  3Q8C A;  4TMA B;  1V81 A;  2IPK D;  5G5H A;  1JML A;  2EKE C;  4EZL A;  2I5F A;  1V80 A;  3N9Y C;  2L52 A;  1JW9 D;  1WF9 A;  4LJO B;  2E2X A;  1TT5 B;  1E6E B;  1FHX A;  4B95 A;  3HSA A;  3QQ8 B;  4W9D A;  3V61 A;  3HVD A;  1H8C A;  2E3T A;  1QOF A;  3SU8 X;  3PG7 A;  1P0R A;  2CU1 A;  4FAD A;  2V3S A;  2RNR B;  2KWC A;  3WAO A;  3ZDM C;  1UF0 A;  2Z59 B;  1SJE D;  1R4M B;  3ZNZ B;  5D3W A;  4BVU C;  2K5P A;  3QA8 A;  5G5G A;  2AQ3 B;  1X11 A;  2K8B A;  4AP4 C;  1E9M A;  1E8X A;  2JXX A;  2CY5 A;  5JH5 C;  2K9X A;  3H1U A;  2RDB C;  3ZDT A;  3BVG A;  1JWU D;  3MHZ A;  4XZ4 A;  4EZJ A;  1MPE A;  1KJT A;  4N59 A;  2KX0 A;  3M95 A;  1CMX B;  4DX8 A;  2LAS A;  1X86 A;  4ZYN A;  1XKE A;  2Y5C A;  4XWX A;  1DYQ A;  4GDK A;  4MJS B;  5C5B A;  4KZ0 A;  1AN8 A;  3APD A;  3N1Y C;  4YTM B;  1YN3 A;  4FHJ A;  3ZO5 B;  3SEB A;  1J0G A;  4BFR A;  1M7E A;  1QZE A;  3PRZ A;  1YJ1 A;  3AE7 B;  3DVG Y;  3ZTC A;  1P3R A;  5JVL A;  3PLV A;  2P0F A;  4RFB A;  1MPH A;  2IO1 B;  2COC A;  3ZGZ A;  5BMH A;  1E10 A;  5LOP B;  1GC7 A;  3EFC A;  1N61 A;  1I7A A;  1BT0 A;  4W9J A;  1QF6 A;  1L5P A;  2EKI A;  3AE2 B;  3KWV A;  4WH4 A;  1WM2 A;  2R09 A;  3RFZ B;  2KQ4 X;  4W9I A;  1SB3 C;  3SBG A;  3QBV B;  2BS2 B;  3E56 A;  1WWT A;  2C7M B;  4GU2 A;  3AM9 A;  4DBG A;  4F7H A;  3I9V 1;  2J52 A;  2MP2 A;  3TMP B;  2LVO A;  5DH9 B;  4FJV B;  1JAL A;  4WJO A;  4GPT B;  4PS7 A;  4M02 A;  1XT9 B;  2HTH B;  4JKE A;  1FMA D;  2DHZ A;  4FJY A;  2INP E;  1RRB A;  1UBQ A;  2OJR A;  2DAF A;  3DCG A;  1M7R A;  4B6W A;  3H7P B;  2L05 A;  3SYX A;  1YQ4 B;  1XLO A;  4CO7 A;  5HE1 A;  3KRX A;  3H7S A;  1ESF A;  1N5X A;  2M4N A;  1C1Y B;  3Q8E A;  4PYU A;  5LON B;  2PMV A;  2JPH A;  1LXD A;  4UDU C;  1F2R I;  2NCN A;  5KQ4 A;  1WXV A;  2MBB B;  4EMO A;  3T8M A;  3NS1 A;  2K8E A;  3ZNH B;  1WGU A;  3Q6B A;  3LDZ E;  2ZKM X;  3ZYY X;  1V1O A;  2MX2 A;  1Y8R C;  3O65 B;  4RGM A;  5JHA A;  2D3C A;  1SSN A;  2XN9 C;  1WG7 A;  2Q13 A;  2J7Q B;  1E7V A;  2BVC A;  3SFD B;  1R4N I;  2KTR A;  2AL3 A;  3QWZ B;  1W1G A;  3MC0 B;  3QAQ A;  3NZ3 A;  1SEB D;  2Z13 A;  1EGX A;  3P4R B;  4FN2 A;  3N3K B;  3MC9 A;  3R66 C;  2GBN A;  3SFE B;  1YIW A;  3VXW A;  2NTT A;  3RMK C;  4ILH A;  1U2B A;  2RGN B;  1C76 A;  3NHE B;  3P2B A;  2D10 A;  2CHZ A;  1ZGU B;  2YEP B;  3VH3 B;  1PLS A;  1ZXI A;  3P4S B;  1GNU A;  3EPY A;  2X8X X;  3M63 B;  3LB8 C;  4F7G A;  2JSV X;  2WDT B;  3CMM B;  1OQR A;  3PT2 B;  2MH7 A;  2KDB A;  1UNP A;  3VTV A;  1ENF A;  3PO0 A;  4G50 A;  1C4A A;  3AE6 B;  2JRH A;  2HE7 A;  1N5W A;  4MT7 A;  2LGX A;  3ZXR A;  2BB6 A;  1G6J A;  4JKH A;  2ZW1 A;  3AEB B;  4KAX B;  2JWU A;  2WXL A;  2YS1 A;  5M4Y B;  2UZS A;  5JZE B;  1EO6 A;  1GUA B;  4AQ7 A;  3P4Q B;  5D3D A;  4B0E A;  4JKB A;  2K22 A;  4DDI D;  4ZRJ A;  2D5G A;  4KGT A;  5DPR A;  4WAF A;  1DDM A;  1WI0 A;  2CR5 A;  2DLW A;  1WJ4 A;  3LXF A;  3RT3 B;  1W1D A;  1WR1 A;  3UQB A;  1U27 A;  2WYQ A;  2YVC A;  1V88 A;  1FXA A;  1RFA A;  4C4V B;  3ODO A;  2WXN A;  5CLQ B;  4HAU B;  1K50 A;  2QMT A;  1U5F A;  1LM8 B;  2C7N B;  2J42 A;  2ZNV C;  4A8X C;  2JQR B;  3W2D A;  3R2I A;  4E3C A;  2L76 A;  1P1A A;  3A1Q A;  2JXT A;  2KMC A;  3ENB A;  3ZJV A;  3ALB A;  1RYJ A;  1U29 A;  1XEE A;  4A3P A;  1SJH D;  1WRI A;  2MCN B;  4JK9 A;  4C80 A;  1I42 A;  2ZW0 A;  5CTR C;  2RSG A;  2V3N A;  5EE0 A;  1XCQ L;  2QIL A;  1NDD A;  4K3C A;  4XE0 A;  2BTE A;  2AYO B;  2DX1 A;  4KX6 B;  3PS6 A;  2LHD A;  3SHQ A;  2N7J A;  2YSZ A;  2DNF A;  5D27 A;  1FXI A;  1MHX A;  4KHO A;  2WXK A;  2WXG A;  2N23 A;  1V97 A;  2FCM A;  1SF0 A;  1WE7 A;  2WLB A;  3L54 A;  4AUQ C;  4TQ0 A;  1J7C A;  2BYE A;  1HTO A;  3GP7 A;  1V9J A;  1ACC A;  2L2I A;  2Z0D B;  4LNK A;  3KH0 A;  1KRH A;  1V2Y A;  4Z2N A;  2N9P C;  2N7D A;  4A5K A;  3BY4 B;  1ZM0 A;  1NEK B;  2WX0 A;  2K2J A;  4KGS A;  5LG4 B;  2LGY A;  1N63 A;  2KMA A;  2I1K A;  2GRI A;  4WQO B;  5I2M A;  2JU6 X;  2NPT B;  2LHE A;  4US9 A;  4TV3 A;  3APF A;  1TZO A;  3IT4 B;  1XLQ A;  1FFU A;  2K49 A;  1UD7 A;  3HM3 A;  4LJP B;  4QAY A;  2LRW A;  3B2G A;  3DQV A;  4HAT B;  1UPQ A;  4MGK E;  2N1V A;  2M56 B;  5DPS A;  2WXO A;  1J8C A;  1PFJ A;  1Y19 B;  1VBG A;  1OTR B;  5JHB A;  5FK9 C;  3DBH I;  2DN6 A;  5IJM A;  4WJN A;  4NJC A;  3TFM A;  4DIX A;  1D5X C;  1FGY A;  2EMS A;  3AU4 A;  3M1I B;  2GI9 A;  2WH5 A;  2KLG A;  2SEB D;  2GBK A;  1WJM A;  4AJY B;  3Q3O C;  4GDL A;  1NTY A;  2Z8L A;  2N7E A;  2V76 A;  1UPR A;  1VZ6 A;  3O13 A;  2RPV A;  3R8B A;  3A8P A;  3VUY A;  1YQB A;  4NNJ B;  2DAJ A;  1A5R A;  1FHO A;  2RPQ A;  3A4S C;  3AEE B;  3IXS A;  4ANU A;  2Y8G A;  4HAX B;  2PVO D;  5H92 C;  2W2W A;  1GC6 A;  3ZVR A;  3HK0 A;  2WDR B;  3P63 A;  3UIO B;  4HKZ E;  1D5M C;  1WE6 A;  1IYF A;  4F7Z A;  2J4X A;  1NTI A;  4ZYS A;  2D3G A;  3KVF B;  3FVC A;  1ZDX A;  3UGB B;  2FDQ A;  3RUI B;  2LGI A;  1U5D A;  2VZK B;  4RGT A;  2DZM A;  3IG3 A;  1KFY B;  4AS1 A;  4MGI E;  4BOZ B;  4FXC A;  4S17 A;  1JWA D;  2KC1 A;  2DYM A;  3S2A A;  2KWU B;  4TSS A;  2MQJ A;  4KHB B;  3O96 A;  1T0Q C;  2KUQ A;  3Q3J A;  2QC8 A;  3VFK A;  1X05 A;  1TKG A;  3U7D A;  3PRP B;  5DPW A;  4YSZ B;  3L10 B;  2AL6 A;  3DVN U;  2H7E A;  2D9Z A;  1GG3 A;  2W2X C;  2BKF A;  2LJ5 A;  3GZN I;  4LTU A;  1DOY A;  4GNK B;  3TEY A;  2CQU A;  3ULB A;  1EU3 A;  5HI1 A;  1SGH A;  2ICI A;  1DDW A;  5GXG B;  5EE9 A;  3DHG C;  3ZRF A;  1MJD A;  4XDD A;  2W55 A;  2ZEQ A;  4URK A;  1U5G A;  3ZTD A;  2O6V A;  2PE9 A;  2Z14 A;  5BYR A;  3W5V B;  1FM0 D;  3ZKJ C;  1DIK A;  1WGH A;  1IPG A;  3ETR A;  2XK5 A;  1J7A A;  2BQQ A;  4O1N A;  4OZA A;  1ZXH A;  3VTU A;  5AZG A;  2G4S A;  3EUB 2;  4FJZ A;  4F7U P;  4OHJ A;  1WXA A;  2CKH B;  4JX1 C;  2J0J A;  2CHW A;  4NQK E;  4HAY B;  4JLC A;  2MLB A;  5D3X A;  3W1S A;  4DX9 0;  1LW3 A;  1NTV A;  1FNV A;  1R4N B;  2DFK A;  4ANV A;  2NZ8 B;  2RGF A;  4M8M A;  4XGA B;  2LFI A;  5LXI B;  2MP2 B;  1L4Z B;  2KC2 A;  1YJI A;  2PVG C;  1VZ7 A;  3KUC B;  5D6J B;  3IHP C;  1UGJ A;  3MTN B;  2YF0 A;  4GMX B;  5KHO A;  2IO0 B;  4L2Y A;  3FM8 C;  3V5W A;  5GMV A;  1FIQ A;  3HUI A;  2HJ1 A;  3LJ3 A;  1SE2 A;  4ARI A;  2M17 A;  2V4I B;  3NVY A;  2AQ1 B;  2LGD A;  1VJK A;  3G9W A;  1FGZ A;  2L8J A;  1HXY D;  1FAO A;  2X0S A;  2K00 A;  2QIE B;  3DVG X;  1S1Q B;  1TKY A;  2MFQ A;  1KTK A;  1N62 A;  1WM3 A;  1KC7 A;  3MHS D;  1ET9 A;  5H8Y E;  2GS0 A;  2WWZ A;  2IFS A;  1WRD B;  2R2Q A;  4LCD E;  2LYD A;  2Z0O A;  1Y56 A;  3BIN A;  2YT2 A;  2Z0E B;  2I2Y A;  4HLE A;  1LB1 A;  3MPX A;  4HPM B;  2W3R A;  4BBK A;  1WIA A;  3ZNI D;  2D9Y A;  1F2R C;  2WGS A;  3FLV A;  2GBJ A;  1LQB A;  2J53 A;  5HE0 A;  3TW1 A;  4WAA A;  1F0Z A;  3DBR I;  3V6C B;  4JPS A;  3TEZ A;  1ZC3 B;  4PK1 A;  1UWM A;  4RCO A;  4WWM A;  4GSW A;  3DXE A;  2N4F A;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  2O6V D;  4WWN A;  2FCQ A;  4KIK B;  2V4L A;  4EKU A;  1WGQ A;  1Z87 A;  4Q2J A;  4F1S A;  1IBX A;  1MI0 A;  1MHH E;  1FNW A;  4OVZ A;  3NVW A;  5D2M B;  2R2O A;  3A9J A;  5D3I B;  5BO4 B;  1MG8 A;  3JW0 X;  4ILJ A;  4BKG A;  1BTK A;  1P3Q U;  3BK2 A;  3P42 A;  5J3T A;  5AZH A;  4W9G A;  3Q8F A;  3NSU A;  3K9O B;  4TKN A;  4HPL B;  1OMW A;  5HKH A;  1H4R A;  2UU7 A;  4JWS C;  2WXH A;  3WAN A;  1EU4 A;  4MGY E;  1L7Y A;  2KK8 A;  3DCX A;  1NVL A;  2IGD A;  3PPA A;  4NAW B;  3K9P B;  4HDQ A;  3RNC C;  1OQN A;  4LNI A;  3P6A A;  2PW9 A;  1I7H A;  1YQ3 B;  2JY6 A;  5IKC M;  2NBV A;  4FBJ B;  2JZP A;  3AE9 B;  3L16 A;  4C7Y A;  1XCT L;  4XYC A;  3AED B;  2LBB A;  5AEK B;  2GJY A;  4BKT A;  3PVW A;  1HEZ E;  1T0Y A;  3BVM A;  5HE2 A;  2CB8 A;  3QJZ A;  3JSV A;  3A9K A;  2I38 A;  4NJ6 A;  4ANW A;  1V5U A;  2D9X A;  3T3N A;  2MJE A;  2KCJ A;  2MW5 A;  4ICU A;  1KLV A;  2DYQ A;  5CHF A;  3SR6 A;  5T8I A;  3WAP A;  3GOE A;  2JVC A;  3KW5 B;  1IGD A;  1GJZ A;  4PYZ A;  3W1Y A;  3GE8 C;  1TZ1 A;  1ZVR A;  2FCS A;  2PIA A;  1QQG A;  1P7F A;  1ET6 A;  1OQQ A;  3VHT C;  2MSE D;  5L81 A;  4IUM B;  3OG5 A;  3NOB A;  4N58 A;  5D94 A;  3A1Q B;  1C9F A;  1Y5O A;  3ZIM A;  1YNT E;  2Y5P A;  2L83 A;  4ACF A;  5CHV C;  4YT0 B;  4L23 A;  3RNE C;  4M0W B;  3DBH B;  1V89 A;  2GBM A;  1X1G A;  2DKP A;  3IT6 B;  2V3P A;  4D0N B;  1WSP A;  4M8N A;  3DBL I;  1FEH A;  1UH6 A;  1ZPS A;  3VTW A;  4YWG G;  3L4P A;  4ARC A;  1TTN A;  3KYD D;  3ZLZ A;  3EC8 A;  2JZ3 B;  2HRJ A;  2ZVN A;  4CHK A;  2QDF A;  5J2R A;  3AE3 B;  2L3Z A;  2KUP A;  2LEK A;  5KCV A;  2BWE S;  3GE3 C;  4R3D A;  1UEL A;  2WP9 B;  2L7R A;  2Y5B B;  2GB1 A;  1KH0 A;  3DXC A; 
#chains in the Genus database with same CATH homology
 1RAX A;  2WX1 A;  2KAN A;  3B1L X;  2COA A;  5JP4 A;  4JKD A;  5KHQ A;  4GB9 A;  1MK7 B;  5J18 A;  4Z2M B;  2YS5 A;  3ECI A;  1WJN A;  3VUW A;  1F9J A;  3H9D A;  2COF A;  5C1Z A;  2NR2 A;  3QK0 A;  1J0W A;  1WI1 A;  1UGM A;  2YS3 A;  1C3T A;  1KZ7 A;  3U30 A;  4DXA B;  2BPS A;  4K2O A;  1VD2 A;  1WMH A;  2L0T A;  3SDL C;  4W9L A;  4ASW C;  2LOZ A;  4NJ7 A;  1FB8 A;  4LDT B;  3IVF A;  3VVW B;  4MEM A;  1NU2 A;  2YLM A;  3D8F A;  1OGW A;  4K17 A;  2MBE A;  3M3J A;  2N1W A;  3AUL A;  3IBE A;  3TL5 A;  5D3Y A;  2KXJ A;  4HCP B;  4IG7 B;  2LD9 A;  4HB4 B;  4DHJ B;  5L95 C;  2KOX A;  2LKO A;  4K2P A;  1E7U A;  4A6F B;  1XQQ A;  4KHA A;  1V5M A;  4K81 A;  2ELB A;  3EEC A;  4BBN C;  1ST7 A;  3ML4 A;  2L00 B;  4MJS A;  3DOW A;  1HBK A;  4GXB A;  2KFK B;  4NSW A;  2DTC A;  3CF6 E;  4WWO A;  2MBH A;  4JKG A;  2KO3 A;  5E6P A;  2DZK A;  4JK8 A;  1KI1 B;  2D4Q A;  2KLC A;  3DXD A;  4TQ1 A;  2QKL A;  4IFS A;  3AJ4 A;  4WJ7 A;  2L0F A;  4MK0 A;  5LXH A;  3A33 B;  5C16 A;  2K25 A;  2ZZP B;  4ILG B;  2J0K A;  4KDI C;  3GYP A;  4CHJ A;  1WX9 A;  4RM8 A;  3OAN A;  1P9D U;  3PEG A;  3MDB C;  1KZG A;  3SV1 A;  3N7C A;  2PPH A;  1WGG A;  2HTH A;  4IM0 A;  1WZ0 A;  5E6O A;  2RLO A;  5C6R A;  2G4D B;  3D32 A;  2A4Z A;  2FJL A;  3H7P A;  2LVP A;  2VKI A;  2D07 B;  5IA7 A;  4EUT A;  1OQY A;  2NBU A;  2KN5 A;  1TBE A;  4I6N B;  4FHK A;  1WJU A;  4JIO U;  1WXS A;  3U8Z A;  2L1C A;  2JRI B;  1KOT A;  2BKR B;  3PP2 A;  4K1R B;  3HM6 X;  2LRU A;  1SHC A;  3JVZ X;  1P5T A;  1AAR A;  3RD2 A;  1S3S G;  1V86 A;  2DHJ A;  3TVV A;  1EVH A;  4W9E A;  2RD0 A;  2LVQ A;  4W9K A;  2LXC A;  4EZK A;  3ZUN A;  3UF8 A;  3PSE B;  2H7D A;  1DRO A;  2YT1 A;  1BWN A;  2MRP A;  3VIA A;  1E8Y A;  1VBH A;  4W9C A;  4KSK C;  1UNQ A;  1WGY A;  1W1H A;  3PVL A;  4K7W A;  4JQW C;  1MIZ B;  1X1F A;  1KBL A;  2KJR A;  3E66 A;  4IC7 B;  2COD A;  1AWE A;  2R82 A;  3FEH A;  3SUZ A;  2DHK A;  3ZVV A;  2ZJD A;  4FUL A;  4WSF A;  4JKA A;  1E8W A;  2NBV B;  2HD5 B;  4A3O A;  2OTX A;  1UNR A;  2GMI C;  3WAL A;  3CXB B;  3H6N A;  4KDL B;  1UBI A;  2K2U A;  2K8H A;  3QIJ A;  4E74 A;  2MA9 B;  2I5C A;  2DKQ A;  4GDK B;  2AEH A;  5C5B B;  2X18 A;  2J59 M;  1RRP B;  1OEY J;  1I35 A;  1V5O A;  2EJ8 A;  2UVM A;  3NZS A;  3D8E A;  3VQI A;  3L13 A;  2D9W A;  1K5D B;  4HJK A;  2KDE B;  1K8R B;  1K5G B;  3ODW A;  4H8S A;  4AOF A;  3WIM A;  2JUO A;  4BBN F;  1HE8 A;  3PGE A;  1OY2 A;  1U5E A;  1YX5 B;  4JKF A;  2I1J A;  5E6N A;  2UYZ B;  2K8C A;  2W9N A;  3V6E B;  4GOC A;  3T9L A;  4W9F A;  3L08 A;  3UIN B;  5JHH A;  2FCN A;  1HB6 A;  1X1M A;  1P98 A;  2RUK B;  3GYO A;  3R7R A;  2O2V A;  5J3Q A;  4DHZ B;  4PS8 A;  3CST A;  2FJ9 A;  1ZW7 A;  4EJN A;  1UEF A;  5DIF B;  2IBI B;  2YRY A;  1DBH A;  3FSS A;  3L0W B;  1WH3 A;  5DI9 B;  2MBQ A;  3HHM A;  2C5L C;  1U4A A;  3UQA A;  2AWT A;  1ZC4 B;  2DX5 A;  3R7Q A;  3KY9 A;  2IO2 B;  4IAP A;  2D11 A;  1MK9 B;  1NI2 A;  1MAI A;  4FA6 A;  4OVU A;  4L6E A;  2KVR A;  2ZPN A;  2DYO A;  4TUU A;  1WZ3 A;  2KTR B;  2UWQ A;  2DYB A;  3HIZ A;  2Z0P A;  3TBL D;  2LUE A;  4IM2 A;  1M94 A;  4AJW A;  2XQN M;  5J17 A;  4HAW B;  2KD0 A;  2G45 B;  3X23 A;  2MKR A;  4HB0 B;  3V62 A;  4HXD A;  4J6I A;  4OVV A;  1BAK A;  2IYB A;  4GIV A;  2KQ7 A;  4IW0 A;  3KZ1 A;  1FOE A;  3KUZ A;  4MGZ E;  4IWP A;  5IAA C;  3N32 A;  2KDF B;  3RCZ A;  2LZ6 A;  3LJU X;  4EOY A;  3DPD A;  1H10 A;  4HHV A;  1WX8 A;  4MEL A;  2DIK A;  2JP2 A;  2VRW B;  2DZI A;  2RQ1 A;  2JZZ A;  3M62 B;  1WYW B;  4EFO A;  2KKC A;  2XEW A;  2PZ1 A;  2IO3 B;  2KJ6 A;  3VH4 B;  4ZRK A;  2K6D B;  2W2X D;  3KYC D;  2M14 A;  1V5P A;  4MH0 E;  2PE6 B;  1GGO A;  4JKG B;  2K6Q A;  2BYV E;  5G55 A;  1Q1O A;  1ACA A;  2EMT A;  2KGX B;  3A8Q A;  4HWI B;  3DDC B;  3ML9 A;  4IM3 A;  4K7S A;  3NZU A;  2KQS A;  4MM3 A;  2CHX A;  2NBW B;  5CLL B;  2KNB A;  2GBR A;  2ASQ A;  2FUH B;  2KJH B;  1ZKH A;  4YON A;  1WY8 A;  4NQL B;  3I3T B;  3HQC A;  1WXM A;  3TIX A;  3WA0 A;  3RUL A;  3ONS A;  4P7I A;  4FLH A;  2NVU I;  1IP9 A;  3VAW A;  3ZRC A;  1NBF C;  1TXD A;  4MY6 A;  3IFW B;  2FID A;  2GCJ A;  4A20 A;  3TJP A;  4A6K A;  3QCA A;  1BTN A;  2MBO A;  2M38 A;  2REX A;  3AXC A;  3RZF A;  2C7H A;  2M8S A;  3MJW A;  1VCB A;  2K39 A;  3P7Z A;  4B6H A;  4JL9 A;  1EF1 A;  4PNK A;  4MSQ B;  2R0D A;  3PTF C;  1E90 A;  3PHX B;  3PRM B;  3PLU A;  4GZU A;  1Q67 A;  2DHI A;  1XX0 A;  5G2N A;  2KFJ A;  4GN1 A;  2JT4 B;  2V1Y A;  1Z2M A;  3ML8 A;  2IYD B;  3PZD A;  1WR6 E;  2G3Q B;  2ZNV B;  2CY4 A;  4JK7 A;  4GDL B;  4KVG B;  1MIX A;  2GOW A;  4KIK A;  1RJ2 A;  4I6L B;  1E8Z A;  4JGH B;  3UIP B;  4X57 B;  2FNJ B;  2ROV A;  2ZCC A;  1WGD A;  3OJ3 A;  4PQ0 A;  2OQB A;  3BJI A;  2P0H A;  2D9V A;  4BKS A;  4G11 A;  4B9K A;  2CS4 A;  3V60 A;  2N0Y A;  4NAW A;  1V5T A;  2OOB B;  4DDG D;  3CIK A;  4HCN B;  3AU5 A;  3PHW B;  2XBB C;  2VSZ A;  2CAY A;  1WVH A;  4GMV A;  1JDE A;  2RSU A;  2KX3 A;  5HE3 A;  3PV1 A;  1WGR A;  3ZW3 A;  3NY5 A;  2LG1 A;  4W9H A;  3N30 A;  4A6H A;  3RCP A;  1YX6 B;  3QWM A;  1V49 A;  4YL8 A;  2JWZ A;  2KZR A;  4GGQ A;  3PVU A;  3VDZ A;  3D8D A;  3KSY A;  4BOS C;  5KQ1 A;  5TR5 A;  4KV2 A;  2PJH A;  2LWP A;  3WAM A;  3QAR A;  4N9F 4;  2BGF A;  1L2N A;  2D2Q A;  2Z0Q A;  1MKE A;  4DK5 A;  2O6V B;  4HAV B;  2XK5 B;  1XOD A;  3PSC A;  3UZT A;  2N9E B;  1WJ1 A;  5DHA B;  3SBT A;  3PRE A;  1R4M I;  2ABD A;  1WJ6 A;  1Q5W B;  3JYU A;  2EC1 A;  4CYE A;  1WX7 A;  1JRU A;  1SE9 A;  5AZF A;  2NMB A;  1KM7 A;  2FAZ A;  4F8C B;  3X0W A;  2KHW B;  2KDI A;  2C9W B;  2ELA A;  4BKS D;  2LXA A;  1WFY A;  3OAW A;  5DPT A;  2DEN B;  4I6P A;  2M1M A;  2IZV B;  3CSF A;  4E71 A;  2N9X A;  2NS5 A;  4IWO A;  2P8V A;  1OEY A;  1J19 A;  5L83 A;  3KUD B;  2O2V B;  1FXT B;  2G35 A;  1TQZ A;  1XD4 A;  4KSL C;  4G0N B;  1D3Z A;  3T06 A;  2B3A A;  5JHG A;  2YT0 A;  2M0X A;  2GCL A;  1ZSQ A;  3HW2 B;  2COP A;  2KWV B;  3NS8 A;  1EUV B;  3QX1 A;  3AI5 A;  2ADZ A;  1YD8 U;  5J3Y A;  2FIF A;  2DX5 B;  4DHZ E;  1PQS A;  3RZW C;  3ODX A;  3TO1 A;  5C23 A;  3E9P A;  1DDV A;  2A5U A;  3W1S C;  1RLF A;  3A9J B;  2RVB B;  3QHT A;  2IY1 B;  1V6E A;  3L17 A;  3KRW A;  2LOX A;  4WWP A;  1SIF A;  4XX5 A;  3WYF B;  4CHM A;  1V61 A;  3Q3F A;  1HB8 A;  4DBB A;  1AQC A;  2BWF A;  3F0W A;  5EDS A;  2Y8F A;  4A6F A;  2ZCB A;  2Y7B A;  1N3H A;  3FP5 A;  4HDO A;  1TGZ B;  5GOW B;  3JSV B;  5LLI A;  3A9K B;  4II3 B;  4HVB A;  2BCJ A;  1LFD A;  2HJ8 A;  3RYT A;  3ULC A;  4ICV A;  3E9L A;  4IOY X;  5JLJ B;  1EAZ A;  3VOQ A;  1XCG A;  4NY0 A;  1B55 A;  4EEW A;  1E5W A;  2UZR A;  4IWQ A;  3QC8 B;  2KFK A;  1IRS A;  2DA0 A;  4WJP A;  3SD5 A;  2ZPY A;  3B0A A;  2C60 A;  4PS3 A;  1DYN A;  3APC A;  3EFU A;  1EF5 A;  2BF8 B;  1Q0W B;  3E9O A;  5DHF B;  2CRF A;  1P6S A;  4RM9 A;  4HAZ B;  3EHV A;  3A4R A;  1Z5S B;  2LI5 A;  4WJQ A;  4LDT D;  4Y94 A;  3R3M A;  3ENE A;  3C0R B;  4G3X B;  5FI0 A;  4AWJ A;  4HB2 B;  4KZC A;  4JKC A;  2BYF A;  5FR6 A;  2VRR B;  1FHW A;  2J0M A;  4TYZ A;  2RR9 A;  3OJ4 B;  2LUL A;  4II2 B;  4XC2 A;  4ZRI A;  2ZVO A;  4DHJ D;  4NPN A;  4K7U A;  4MSM B;  4ANX A;  4DWF A;  2NPT A;  2MWN B;  5CHW A;  4ZDV A;  3B08 A;  4C0A A;  2JF5 A;  3VUX A;  2K1F A;  2MDX A;  2DZJ A;  1I2H A;  2QKM A;  3TCA A;  3ZNG C;  5C79 A;  5CX3 A;  4RMA A;  3A98 B;  5DCN A;  4WVF B;  2IY0 B;  3DVN V;  1XD3 B;  2KTF A;  3DBS A;  2MWS B;  3F5R A;  2QHO A;  5D7G A;  2DYN A;  2PEA A;  2ROZ B;  1WMH B;  1QC6 A;  4HK2 A;  4HB3 B;  1XR0 B;  3SNH A;  1TJ6 A;  3OLM D;  1PMS A;  3SO6 A;  1ISN A;  1UZX B;  1V81 A;  2EKE C;  4EZL A;  2I5F A;  1V80 A;  1WF9 A;  4LJO B;  2E2X A;  1FHX A;  4B95 A;  3QQ8 B;  4W9D A;  3V61 A;  1H8C A;  3SU8 X;  3PG7 A;  1P0R A;  2CU1 A;  4FAD A;  2V3S A;  2RNR B;  2KWC A;  3WAO A;  3ZDM C;  2Z59 B;  3ZNZ B;  5D3W A;  4BVU C;  3QA8 A;  1X11 A;  2K8B A;  4AP4 C;  1E8X A;  2JXX A;  2CY5 A;  5JH5 C;  3H1U A;  3ZDT A;  4XZ4 A;  4EZJ A;  1KJT A;  2KX0 A;  3M95 A;  1CMX B;  4DX8 A;  2LAS A;  1X86 A;  4ZYN A;  1XKE A;  4XWX A;  4GDK A;  4MJS B;  5C5B A;  4KZ0 A;  3APD A;  3ZO5 B;  4FHJ A;  1J0G A;  4BFR A;  1M7E A;  1QZE A;  3PRZ A;  1YJ1 A;  3DVG Y;  3ZTC A;  1P3R A;  5JVL A;  3PLV A;  2P0F A;  1MPH A;  2IO1 B;  2COC A;  5LOP B;  1GC7 A;  1I7A A;  1BT0 A;  4W9J A;  1WM2 A;  2R09 A;  4W9I A;  3SBG A;  3QBV B;  4GU2 A;  2C7M B;  4DBG A;  4F7H A;  2MP2 A;  3TMP B;  2LVO A;  5DH9 B;  4FJV B;  4WJO A;  4GPT B;  4PS7 A;  1XT9 B;  2HTH B;  4JKE A;  2DHZ A;  4FJY A;  1RRB A;  1UBQ A;  2OJR A;  2DAF A;  3DCG A;  1M7R A;  4B6W A;  3H7P B;  2L05 A;  3SYX A;  4CO7 A;  5HE1 A;  3KRX A;  3H7S A;  2M4N A;  1C1Y B;  4PYU A;  5LON B;  2JPH A;  1LXD A;  2NCN A;  5KQ4 A;  1WXV A;  2MBB B;  4EMO A;  3T8M A;  3ZNH B;  1WGU A;  3LDZ E;  2MX2 A;  1Y8R C;  3O65 B;  5JHA A;  1WG7 A;  2Q13 A;  2J7Q B;  1E7V A;  1R4N I;  2KTR A;  2AL3 A;  3QWZ B;  1W1G A;  3QAQ A;  1EGX A;  4FN2 A;  3N3K B;  3R66 C;  2GBN A;  1YIW A;  3VXW A;  4ILH A;  1U2B A;  2RGN B;  3NHE B;  3P2B A;  2D10 A;  2CHZ A;  1ZGU B;  3VH3 B;  1PLS A;  1GNU A;  3EPY A;  3M63 B;  4F7G A;  2WDT B;  3CMM B;  3PT2 B;  2KDB A;  1UNP A;  3VTV A;  4G50 A;  2JRH A;  2HE7 A;  4MT7 A;  2LGX A;  1G6J A;  4JKH A;  4KAX B;  5JZE B;  2YS1 A;  2UZS A;  1EO6 A;  1GUA B;  4JKB A;  4DDI D;  4ZRJ A;  5DPR A;  1DDM A;  1WI0 A;  2CR5 A;  3RT3 B;  2DLW A;  1WJ4 A;  3UQB A;  1W1D A;  1WR1 A;  1U27 A;  2WYQ A;  2YVC A;  1V88 A;  1RFA A;  3ODO A;  5CLQ B;  4HAU B;  1U5F A;  1LM8 B;  2C7N B;  2ZNV C;  4E3C A;  2L76 A;  1P1A A;  3A1Q A;  2KMC A;  3ENB A;  3ALB A;  1U29 A;  4A3P A;  2MCN B;  4JK9 A;  1I42 A;  5CTR C;  2RSG A;  1NDD A;  2AYO B;  2DX1 A;  3PS6 A;  3SHQ A;  2YSZ A;  5D27 A;  4KHO A;  2N23 A;  2FCM A;  1WE7 A;  3L54 A;  4AUQ C;  4TQ0 A;  2BYE A;  1V9J A;  2Z0D B;  2L2I A;  3KH0 A;  1V2Y A;  4Z2N A;  2N9P C;  2N7D A;  4A5K A;  3BY4 B;  1ZM0 A;  2WX0 A;  2K2J A;  2LGY A;  2KMA A;  2I1K A;  4WQO B;  2NPT B;  4TV3 A;  3APF A;  1UD7 A;  3HM3 A;  4LJP B;  2LRW A;  3DQV A;  4HAT B;  1UPQ A;  4MGK E;  2N1V A;  5DPS A;  1J8C A;  1PFJ A;  1Y19 B;  1VBG A;  1OTR B;  5JHB A;  3DBH I;  2DN6 A;  5IJM A;  4WJN A;  3TFM A;  1FGY A;  2EMS A;  3AU4 A;  3M1I B;  2WH5 A;  2KLG A;  2GBK A;  1WJM A;  4AJY B;  4GDL A;  1NTY A;  2N7E A;  2V76 A;  1UPR A;  3A8P A;  3VUY A;  1YQB A;  4NNJ B;  2DAJ A;  1A5R A;  1FHO A;  2RPQ A;  3A4S C;  4ANU A;  2Y8G A;  4HAX B;  2W2W A;  1GC6 A;  3ZVR A;  3HK0 A;  3UIO B;  1WE6 A;  1IYF A;  4F7Z A;  1NTI A;  2D3G A;  3KVF B;  3UGB B;  2FDQ A;  3RUI B;  1U5D A;  2DZM A;  3IG3 A;  4MGI E;  4BOZ B;  2KC1 A;  2DYM A;  3S2A A;  2KWU B;  2MQJ A;  4KHB B;  3O96 A;  3Q3J A;  3VFK A;  1X05 A;  3U7D A;  3PRP B;  5DPW A;  3L10 B;  2AL6 A;  3DVN U;  2H7E A;  2D9Z A;  1GG3 A;  2W2X C;  2BKF A;  2LJ5 A;  3GZN I;  2CQU A;  3ULB A;  1SGH A;  1DDW A;  3ZRF A;  2ZEQ A;  4URK A;  1U5G A;  3ZTD A;  2O6V A;  2PE9 A;  3ZKJ C;  1DIK A;  1WGH A;  1IPG A;  2XK5 A;  3VTU A;  5AZG A;  2G4S A;  4FJZ A;  4F7U P;  1WXA A;  2CKH B;  2J0J A;  2CHW A;  4NQK E;  4HAY B;  4JLC A;  2MLB A;  5D3X A;  3W1S A;  4DX9 0;  1LW3 A;  1NTV A;  2DFK A;  4ANV A;  2NZ8 B;  2RGF A;  4M8M A;  5LXI B;  2MP2 B;  2KC2 A;  3KUC B;  5D6J B;  3IHP C;  3MTN B;  2YF0 A;  4GMX B;  5KHO A;  2IO0 B;  3FM8 C;  3V5W A;  5GMV A;  3LJ3 A;  2M17 A;  2LGD A;  3G9W A;  1FGZ A;  2L8J A;  3DVG X;  1FAO A;  2X0S A;  2K00 A;  1S1Q B;  2MFQ A;  1WM3 A;  1KC7 A;  3MHS D;  2GS0 A;  2WWZ A;  2IFS A;  1WRD B;  2R2Q A;  4LCD E;  2LYD A;  2Z0O A;  3BIN A;  2Z0E B;  4HLE A;  1LB1 A;  3MPX A;  4HPM B;  4BBK A;  1WIA A;  3ZNI D;  2D9Y A;  3FLV A;  2GBJ A;  1LQB A;  4WAA A;  5HE0 A;  3TW1 A;  3DBR I;  3V6C B;  1ZC3 B;  4GSW A;  3DXE A;  2N4F A;  5FI1 A;  5D3V A;  2P0D A;  5EFX A;  2O6V D;  4WWN A;  2FCQ A;  4KIK B;  2V4L A;  4EKU A;  1WGQ A;  1Z87 A;  4F1S A;  5D2M B;  2R2O A;  3A9J A;  5BO4 B;  1MG8 A;  3JW0 X;  4ILJ A;  4BKG A;  1BTK A;  1P3Q U;  5J3T A;  5AZH A;  4W9G A;  3NSU A;  3K9O B;  4TKN A;  4HPL B;  1OMW A;  5HKH A;  1H4R A;  3WAN A;  4MGY E;  1L7Y A;  2KK8 A;  1NVL A;  3PPA A;  4NAW B;  3K9P B;  4HDQ A;  1OQN A;  3P6A A;  2JY6 A;  4FBJ B;  3L16 A;  2LBB A;  5AEK B;  2GJY A;  4BKT A;  3PVW A;  1T0Y A;  5HE2 A;  2CB8 A;  3QJZ A;  3JSV A;  3A9K A;  4NJ6 A;  4ANW A;  1V5U A;  2D9X A;  2KCJ A;  2MW5 A;  4ICU A;  1KLV A;  2DYQ A;  5CHF A;  3WAP A;  3GOE A;  2JVC A;  3KW5 B;  1GJZ A;  4PYZ A;  3W1Y A;  1TZ1 A;  1ZVR A;  2FCS A;  1QQG A;  3VHT C;  2MSE D;  5L81 A;  4IUM B;  3NOB A;  5D94 A;  3A1Q B;  1Y5O A;  3ZIM A;  5CHV C;  4M0W B;  1V89 A;  2GBM A;  1X1G A;  2DKP A;  4D0N B;  4M8N A;  3DBL I;  1UH6 A;  3VTW A;  1TTN A;  3KYD D;  3ZLZ A;  3EC8 A;  2JZ3 B;  2HRJ A;  2ZVN A;  4CHK A;  5J2R A;  2L3Z A;  2KUP A;  5KCV A;  2BWE S;  1UEL A;  2L7R A;  2Y5B B;  4MDK E;  3DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...