1J19A

Crystal structure of the radxin ferm domain complexed with the icam-2 cytoplasmic peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
316
structure length
316
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDSSGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords radixin
total genus 90
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1j19A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1j19A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j19A01
1E7VA 2LRWA 1AARA 1MK7B 2LI5A 4DDGD 4IG7B 1WJ6A 1GNUA 2MFQA 3NSUA 2LGXA 4EJNA 3HIZA 3KW5B 2NPTA 1EF5A 3NY5A 3D8FA 1ZVRA 4MSMB 1UD7A 4EUTA 5AEKB 1V5PA 2N4FA 4MJSA 1N3HA 4GN1A 2KXJA 2O6VA 2KDEB 3A1QB 2WWZA 4N9F4 1WRDB 1XD3B 3HM3A 2HTHB 2CKHB 3CMMB 1U29A 2BCJA 4NY0A 1WFYA 1GG3A 2MCNB 4NPNA 4LJOB 2RVBB 3HW2B 1XODA 3L0WB 1C3TA 1MIZB 5C6RA 1W1GA 3PVUA 4IC7B 2KHWB 1I42A 1U2BA 1VCBA 1V89A 3QBVB 2BYEA 4TYZA 4YONA 2KX0A 2N9PC 1ZM0A 1KZ7A 2CY4A 2L3ZA 3D8EA 1TGZB 3DVNV 3F5RA 1WVHA 3PS6A 4MJSB 2MSED 1J0GA 1WMHA 3UQBA 1RLFA 2M1MA 4K7WA 1PLSA 2DX5A 2DAJA 2FAZA 1H10A 1FHWA 3AI5A 4TQ0A 3DOWA 2KWCA 1SIFA 2K39A 4A20A 1TJ6A 3DQVA 1NTYA 2UZRA 4E3CA 1DDWA 4BKGA 5JZEB 5JH5C 1U5FA 3VQIA 1JRUA 2L0FA 3L54A 2MDXA 2MA9B 3NOBA 3VH4B 1XD4A 3L13A 1WGUA 2C60A 4HB3B 4WJQA 1MIXA 1WGQA 3PLUA 2RSGA 4ICVA 2ZNVC 2IBIB 3B1LX 2JWZA 3QARA 2FJLA 3BINA 2G4SA 2KJRA 4GIVA 2KGXB 4EKUA 2DZJA 2HTHA 2IO2B 4I6NB 3VHTC 4EFOA 2N9EB 4LDTD 1Z87A 2H7DA 2M4NA 4MEMA 1YD8U 4ANWA 3PEGA 3MHSD 2VKIA 2KDBA 3W1SC 5DPRA 5IJMA 2KC1A 1E8ZA 1NI2A 2Z0DB 1WX7A 2PPHA 4IM3A 3ECIA 3EECA 2K1FA 5D6JB 2KN5A 1OY2A 2LVOA 3DBSA 3ZIMA 2IZVB 4EOYA 4H8SA 5CTRC 3QCAA 2YS5A 1M94A 3WAOA 2J59M 5DI9B 3KH0A 1I2HA 4FULA 4IW0A 4ANUA 2V76A 2LVQA 3SO6A 2CS4A 1FB8A 4KDLB 4RM8A 5L95C 1YIWA 4EEWA 2LGDA 3TBLD 3DXDA 3EPYA 2BPSA 2PZ1A 2K2UA 4EZJA 4IUMB 5D27A 3RYTA 2D10A 1ACAA 1E8YA 3M3JA 5DCNA 2D07B 3PVWA 3X23A 1DDVA 4AOFA 2I1KA 1E90A 4XX5A 3FM8C 5DIFB 5D3WA 3QWZB 4MGYE 2KC2A 2KJ6A 1D3ZA 2KTRB 1G6JA 1K5DB 2COCA 3R66C 2N9XA 4G0NB 1SHCA 1WIAA 4LDTB 4OVUA 3A98B 1MPHA 3PRMB 3WALA 4DK5A 3PG7A 3A4RA 4NJ6A 4B6WA 2NZ8B 2CY5A 2XEWA 3HM6X 1ZKHA 4WWPA 4IFSA 4G11A 5CHVC 5JLJB 2DYQA 1HB8A 2KCJA 2HRJA 2COFA 1KM7A 2YLMA 2OJRA 1WJ1A 1V2YA 2KO3A 2IY1B 1V86A 1M7RA 1PMSA 1NBFC 5LLIA 2EJ8A 2LXAA 3PTFC 5FI0A 1V5OA 2XK5B 1KLVA 2VRWB 2O6VD 2YRYA 3KRWA 2YS1A 5C79A 1WY8A 2L05A 2J0MA 3DVNU 3EHVA 3Q3FA 3DBRI 4FN2A 4GDLB 4DBGA 4AUQC 2FCMA 3ULCA 3S2AA 2GCLA 4MM3A 3KUZA 4DBBA 1FHOA 1BTKA 3VUYA 4DHZB 4A6FA 4HLEA 5LOPB 1OQYA 3OJ3A 3N3KB 2RNRB 2IFSA 1U4AA 2DYMA 4BOSC 4DWFA 2DFKA 1WX9A 5HE1A 3T06A 3TVVA 1WJUA 3Q3JA 2DHZA 3AXCA 2HJ8A 1UEFA 2Q13A 1P98A 2LASA 2WX0A 4GDKB 4GDKA 5E6NA 2LJ5A 2EC1A 1VD2A 1WM2A 1E8WA 2J7QB 4KSKC 4LJPB 1V9JA 2KJHB 4ICUA 2J0KA 3OLMD 3M95A 2M17A 2FIDA 4X57B 2ROVA 2NPTB 4HPMB 4HWIB 4K81A 3H9DA 2FCNA 2ROZB 5DHFB 4DX90 3K9OB 3ZNHB 3HK0A 2KWUB 3L08A 4WQOB 2LD9A 2LXCA 3PP2A 1EVHA 2KLCA 3JSVB 2JRIB 3PHXB 5D7GA 3LJ3A 2FIFA 3SDLC 4M0WB 3V6EB 4W9LA 4HAXB 1XCGA 4HAYB 2Y7BA 2KMAA 2MBHA 2ZNVB 4K2PA 4G50A 4WJNA 2W2XD 3UINB 2D3GA 1BTNA 1E8XA 1WZ0A 2K6QA 2WDTB 1K8RB 4KSLC 4BKTA 2N7DA 3A4SC 2XQNM 4WJ7A 3NS8A 2DYNA 3KY9A 5CLLB 2GCJA 1ZSQA 2C7NB 1ZW7A 5E6PA 2CHWA 1WXVA 3NHEB 3LDZE 2ADZA 1V80A 3NZSA 5DPTA 2DKPA 4KHBB 2GJYA 4AP4C 2KLGA 3R3MA 5AZGA 4GGQA 2COPA 2JUOA 4WJPA 4AJWA 5J2RA 2HE7A 4M8NA 2YS3A 2ZJDA 2O6VB 2N1VA 2KOXA 3AU4A 3A1QA 3A9JA 3ML9A 4MK0A 2N23A 2DHJA 2N7EA 5EFXA 3B08A 4HCNB 3D32A 1I35A 4TKNA 1ZC3B 1P3QU 2K25A 2PE6B 3KYCD 3JYUA 3RT3B 4E71A 1TZ1A 4HDQA 2L76A 3ZRFA 1L2NA 4MELA 1IP9A 4MT7A 4WAAA 2BWFA 4JLCA 1WZ3A 4MY6A 2DKQA 2EMSA 2CHXA 4GZUA 2KNBA 2R2OA 3GOEA 3OJ4B 2GOWA 1OEYJ 4KV2A 3UGBB 1X05A 3H6NA 5C1ZA 1RJ2A 1V88A 4ASWC 2YT0A 2JF5A 2M38A 1GUAB 1S1QB 4JL9A 1E7UA 1EF1A 3ZKJC 5KQ4A 3VTVA 3U30A 2P8VA 2BGFA 2CRFA 3TJPA 3G9WA 3V60A 4HB0B 4KAXB 1WGGA 2CHZA 4KZ0A 5TR5A 3P7ZA 2MRPA 4B6HA 3DVGX 3W1SA 3BY4B 3V62A 3MPXA 1RAXA 2DLWA 4HPLB 2LYDA 3FP5A 2D9YA 2V3SA 1I7AA 4GMVA 4Z2MB 4HAWB 3VH3B 1U5GA 5CHWA 1ZC4B 3RD2A 4FJYA 4HK2A 3RUIB 1WGHA 5KHOA 3RULA 4W9EA 2VSZA 2L0TA 4PS8A 2ZZPB 2CAYA 3RCZA 2KVRA 1V6EA 4W9FA 2D11A 2ZEQA 5D94A 2DENB 4HDOA 5HE0A 2VRRB 4JQWC 1SGHA 1Z5SB 2ZCCA 3NZUA 4Z2NA 2CODA 1WX8A 1R4MI 2B3AA 2C7HA 2PJHA 4RMAA 4B9KA 4CHKA 2RLOA 5EDSA 3QQ8B 1L7YA 2MQJA 4WJOA 2RSUA 4F7ZA 4HAVB 2KFJA 3A8QA 4W9CA 1BT0A 3UZTA 5LONB 1TTNA 5CHFA 5CLQB 2MX2A 1ISNA 1QQGA 2GS0A 4NQLB 5L83A 1UNQA 2V1YA 2KANA 3R7RA 3H1UA 4RM9A 5HE2A 1HB6A 4YL8A 2M0XA 3WAPA 1WJMA 3PHWB 2WYQA 3ZDMC 2A5UA 3ZUNA 1GJZA 3DDCB 2L2IA 2D2QA 4KIKA 4KIKB 3ML8A 1X1MA 3APFA 3DXCA 2NBUA 5AZHA 2GMIC 2OTXA 2Z59B 2OQBA 2K8HA 1RRPB 2EKEC 1TQZA 3PRPB 3QAQA 1NU2A 1V81A 1FGZA 3UIPB 3CIKA 2REXA 3QC8B 4GB9A 1LFDA 4W9JA 5AZFA 1J0WA 1X11A 1TBEA 2ZVNA 4K7SA 2DZIA 4HATB 5HKHA 3ODWA 3RCPA 4DHZE 2NVUI 4IWPA 4NNJB 2UVMA 4L6EA 2MLBA 3B0AA 2LRUA 2YT1A 4F1SA 1WI1A 3CXBB 3AU5A 2G35A 2N0YA 1Q5WB 2BKRB 2DZMA 4ZYNA 1U5EA 1J19A 3IBEA 4WVFB 4KHAA 5D3YA 4XC2A 1KOTA 1V61A 4KVGB 3ZNID 2D9XA 3H7PA 4FJVB 2MP2B 4W9DA 4A3PA 2K2JA 4IOYX 4DDID 2KZRA 4OVVA 1UELA 1UPRA 2GBJA 3A8PA 4HAUB 3A9KB 2Y5BB 3U7DA 2ELBA 5JHHA 2IO3B 3ENEA 2NBVB 1V5UA 2CR5A 4K2OA 2MBBB 2KDFB 1Q67A 1LM8B 2AEHA 3RZFA 2P0HA 4PYZA 3JVZX 3ZTCA 1H4RA 1WG7A 5J3TA 3R7QA 2BYVE 2M8SA 2FCQA 2ZPNA 3QA8A 5JP4A 1NTVA 5D3XA 4F8CB 2RGFA 1XR0B 1H8CA 3N7CA 3V5WA 3ZO5B 4Y94A 3GYOA 5J3YA 1UZXB 4BBNC 5LXIB 2KFKB 2DYOA 4IM0A 4IWQA 1MKEA 4PYUA 1X86A 4BOZB 4E74A 4K17A 4A5KA 3TCAA 2QKLA 4GXBA 3TIXA 3O96A 3TMPB 3VDZA 2KFKA 4ZRJA 4DXAB 2Y8FA 2XBBC 2NBWB 5C5BA 2V4LA 1WF9A 1DBHA 4MGKE 2RR9A 1GC7A 3ZVVA 1F9JA 1XKEA 1MAIA 2BWES 2K6DB 1T0YA 3QIJA 2G3QB 2ASQA 3M62B 1WGDA 1WR1A 4I6LB 1TXDA 4EZLA 4FHKA 1OEYA 4II3B 2JZ3B 4NAWB 3FSSA 4PQ0A 1WE7A 1XT9B 2YF0A 2UWQA 3ALBA 3KYDD 4TQ1A 1YX6B 1FGYA 4BKSD 4GU2A 3DVGY 2KTRA 4LCDE 4HB2B 4B95A 3DPDA 3IHPC 1QZEA 2I1JA 2QKMA 2RUKB 2KX3A 4NJ7A 4ANVA 1WGRA 2NS5A 1U27A 3L17A 2CU1A 3SV1A 1X1GA 2YVCA 2YSZA 2DAFA 2GBKA 3PGEA 2BKFA 2KKCA 3PPAA 4W9KA 4AJYB 5JHBA 3O65B 1Y19B 3WANA 2JT4B 5J18A 3QHTA 2LOXA 4MH0E 2JY6A 5LXHA 4W9HA 2G45B 5BO4B 2LUEA 3QX1A 3FLVA 2LKOA 1FXTB 4A6KA 3ZNZB 3LJUX 2GBRA 4K1RB 5CX3A 2MBEA 4F7GA 1NTIA 1OMWA 5C5BB 4BBKA 2WX1A 4MDKE 3PVLA 3F0WA 3ZDTA 4GPTB 2R0DA 2IO1B 1XX0A 3VXWA 2IYDB 3H7SA 2KTFA 2ELAA 2X18A 1Q1OA 2JRHA 2JPHA 2KQSA 5DHAB 4JIOU 2RD0A 2AL6A 1RRBA 4HCPB 5C16A 2JXXA 2DX1A 2LGYA 2IYBA 4MGIE 5DH9B 1WYWB 1EO6A 4HB4B 1BAKA 1LQBA 4CO7A 4M8MA 5J17A 4HHVA 4TUUA 2EMTA 3IVFA 1IRSA 3ODOA 4EZKA 2P0FA 3A33B 3D8DA 3DCGA 4MGZE 3A9KA 4PS7A 2LZ6A 3QK0A 2HD5B 2D9WA 3VTUA 1YQBA 2AL3A 4AWJA 1V5MA 3VVWB 2G4DB 1BWNA 2C9WB 1KI1B 1P5TA 3TW1A 3KRXA 1IPGA 3T8MA 3SYXA 3H7PB 1SE9A 3KSYA 5JHAA 1EUVB 1GC6A 4I6PA 3IFWB 2D9VA 4KZCA 2FNJB 4C0AA 4WWNA 2DA0A 2MWSB 4NAWA 1C1YB 2UYZB 2MP2A 3T9LA 4GMXB 1Q0WB 2LOZA 1WH3A 1YJ1A 4CHJA 3C0RB 3JW0X 4JGHB 5E6OA 4CYEA 1UPQA 4W9IA 5C23A 3TL5A 1AWEA 2DN6A 3GZNI 3PSCA 3WIMA 2KQ7A 2RQ1A 5KQ1A 4ZRKA 1WI0A 2KDIA 2N1WA 3SNHA 4DHJD 4TV3A 5KHQA 2K00A 3APCA 3ONSA 3DBHI 1LB1A 2MWNB 1FOEA 5L81A 2AWTA 3N32A 2DHIA 2FCSA 4F7HA 1DROA 2L8JA 3L10B 1K5GB 2WH5A 2R09A 2L00B 2MKRA 1FAOA 3W1YA 3VAWA 2KD0A 4DHJB 3X0WA 1A5RA 3CSTA 1Y5OA 4ZDVA 4IAPA 1YX5B 1UNRA 4GSWA 4ANXA 3P6AA 2JVCA 4WWOA 5FI1A 3EFUA 4P7IA 1E5WA 1P6SA 2R2QA 1IYFA 5JHGA 2JZZA 4IWOA 4GDLA 1V5TA 2C7MB 2MW5A 4KDIC 2CQUA 2ZPYA 4HXDA 2DHKA 1PQSA 3EC8A 2J0JA 2LVPA 2W2XC 1WXMA 2PE9A 2Y8GA 4HVBA 2COAA 2L7RA 2BF8B 3KVFB 4J6IA 3PSEB 1M7EA 2M14A 2Z0OA 1AQCA 1B55A 3TO1A 2GBMA 2H7EA 2IO0B 3HQCA 5DPSA 3AJ4A 3MTNB 2LBBA 3I3TB 1DYNA 1OQNA 1UH6A 2BYFA 4FLHA 3KUCB 2NR2A 3P2BA 1WGYA 3TFMA 5J3QA 4PS3A 1EGXA 4URKA 3HHMA 3VUXA 3DXEA 3ZNGC 1PFJA 2MBOA 2KWVB 3PREA 2C5LC 1P1AA 2PEAA 4FA6A 1WXAA 3RZWC 3ULBA 4WSFA 3WA0A 5DPWA 3M1IB 4NSWA 1WR6E 3ZTDA 1CMXB 1HE8A 1RFAA 2AYOB 5D2MB 5FR6A 2IY0B 5HE3A 3SU8X 3PT2B 3A9JB 1W1HA 1QC6A 4HJKA 3FEHA 3GYPA 3WYFB 1WJ4A 2D4QA 2KK8A 2KMCA 1HBKA 2W9NA 1P0RA 5IAAC 4D0NB 4GOCA 2CB8A 5KCVA 3SUZA 2FDQA 2Z0PA 3MDBC 2GBNA 1UGMA 4XZ4A 3UIOB 2O2VA 5G55A 3VUWA 4A6FB 1WM3A 1W1DA 1X1FA 2JP2A 1ZGUB 4DX8A 2I5FA 1U5DA 3QJZA 1R4NI 4K7UA 3V61A 4A3OA 4FADA 2RGNB 2L1CA 3VFKA 4II2B 1FHXA 3U8ZA 2E2XA 3BJIA 2DYBA 4MSQB 1J8CA 1LW3A 2FJ9A 2NMBA 4FBJB 2W2WA 2LG1A 1P9DU 5D3VA 2Z0QA 4A6HA 1WE6A 3QWMA 1ST7A 2FUHB 2Z0EB 4W9GA 1UNPA 2ZCBA 3SD5A 5GOWB 1DDMA 2K8BA 2ABDA 4CHMA 3PRZA 1UBQA 1NVLA 5GMVA 2MBQA 2D9ZA 4XWXA 3WAMA 4HAZB 1KZGA 1NDDA 3VIAA 3PV1A 2UZSA 4G3XB 1KJTA 1OTRB 3AULA 1LXDA 1WXSA 2LULA 2NCNA 2O2VB 4ZRIA 3PLVA 4FJZA 1P3RA 3ZLZA 2A4ZA 3ODXA 3ZRCA 2P0DA 3SHQA 5IA7A 4PNKA 2LWPA 1OGWA 1Z2MA 1MG8A 2DZKA 5G2NA 4BFRA 3K9PB 1EAZA 4FHJA 4F7UP 1XQQA 1V49A 1MK9B 1WJNA 4IM2A 3UQAA 3V6CB 3DBLI 2KUPA 3L16A 4NQKE 4BVUC 3JSVA 2K8CA 3CSFA 3PZDA 3VOQA 3KZ1A 1WMHB 3MJWA 3KUDB 3N30A 1UBIA 3IG3A 2OOBB 2QHOA 3OAWA 3UF8A 3APDA 4KHOA 2RPQA 2DX5B 2XK5A 4BKSA 2I5CA 3M63B 3ML4A 4BBNF 4EMOA 2ZVOA 3OANA 1S3SG 3CF6E 3ZW3A 2DTCA 1Y8RC 3VTWA 3ZVRA
chains in the Genus database with same CATH superfamily
4YTPB 2LRWA 1J7AA 4DDGD 2MFQA 2K8EA 3FKYA 5AEKB 2OHFA 3U52E 4MJSA 1KH0A 2G9HD 2KXJA 1BMLC 3A1QB 1TIFA 1E10A 1GG3A 1C3TA 1MIZB 3RNGC 4GLSC 3FILA 2N9PC 3QBVB 1ZM0A 1KZ7A 1FNUA 2EELA 1WVHA 3PS6A 2MSED 2DIKA 1RLFA 2RRFA 4K7WA 2DX5A 1FHWA 1YJIA 5C3JB 2KWCA 3DQVA 2UZRA 4E3CA 3NW8A 4BKGA 2L0FA 3VH4B 1XD4A 1WGUA 3PLUA 4ICVA 2BB5A 2RSGA 4D6WA 4P1BC 2ZNVC 2IBIB 3QARA 2FJLA 1MFWA 2KJRA 4EFOA 2DZJA 3VHTC 1T5XD 1JALA 2N9EB 1Z87A 4MEMA 3PEGA 2WXGA 3W1SC 3H8HA 1KBLA 1T6BX 2KC1A 1E8ZA 3Q8CA 2Z0DB 2NTTA 3IT6B 2KN5A 1OY2A 5CTRC 2J59M 4FULA 2LVQA 5I4DA 3NJTA 3FC4A 4KDLB 2HJ1A 1YIWA 2QC8A 2LGDA 3N20C 5D3WA 4A8XC 3R66C 2YEPB 3A98B 3PRMB 1YN4A 4OZCA 3T3NA 2FUG1 2BS2B 3Q8EA 1QT9A 4NJ6A 1CJEA 1YJJA 1ZKHA 1F52A 5JLJB 2DYQA 2COFA 1V2YA 2IY1B 1V86A 1NBFC 5FI0A 2XK5B 4RFBA 2YS1A 4FN2A 2J0MA 3AE4B 1BTKA 3VUYA 4A6FA 4HLEA 5LOPB 4JWUC 2RNRB 2E6XA 2N7JA 2K0PA 1V8CA 1WJUA 3T06A 3TVVA 3Q3JA 2NBVA 1UEFA 1DOIA 2WX0A 1K50A 4GDKB 2LJ5A 1VD2A 1WM2A 4LJPB 1UNSA 3O13A 4HPPA 4HPMB 4HWIB 2ROZB 5DHFB 5EE0A 3ZNHB 3HK0A 4OT1A 3L08A 2LD9A 1WSPA 3PHXB 5EDSA 4M0WB 4G50A 3AM9A 1ZXIA 2K6QA 2GLSA 1K8RB 3HRDD 4KSLC 1HEZE 2WXOA 4BKTA 1TKEA 2JU6X 2DYNA 1ZW7A 2CHWA 1AN8A 3NHEB 3NZSA 1HZ6A 4REZA 4AP4C 2KLGA 4XWTA 4AJWA 2HE7A 3P4QB 2O6VB 2N1VA 3AMZA 3AU4A 4MK0A 3B08A 4LK0M 4ILGB 1ZC3B 2PE6B 3KYCD 3FVCA 3ZRFA 2BYTA 4HROA 1K52A 4WAAA 3TEZA 2DKQA 1T0RC 2R2OA 3GOEA 1OEYJ 1E7UA 1EF1A 2MJ3A 4NAMA 3ZKJC 1DGJA 4BZAA 3G9WA 1PFDA 2CHZA 1WGGA 4JK9A 3DVGX 4LNOA 3BY4B 3P1MA 3FP5A 1UF0A 4JK7A 4HAWB 1U5GA 2AQ3B 1ZC4B 3RD2A 4C7ZA 1I7HA 1F0ZA 2L0TA 4QAYA 3VR8B 2D11A 5D94A 2LUMA 2VRRB 5EE1A 4YXDB 1SGHA 3GP7A 3NZUA 4Z2NA 1IBXA 2B3AA 1R4MI 2C7HA 2M0AA 3QQ8B 1L7YA 3ABVB 4HAVB 2KFJA 4W9CA 1UUPA 1QQGA 5L83A 2KQ4X 2Y5PA 2M0XA 3WAPA 1I4HA 2WYQA 2A5UA 2L2IA 1GB1A 1X1MA 5AZHA 2GMIC 1C76A 2IGGA 2OQBA 3PRPB 3UIPB 3CIKA 2REXA 3QC8B 4KGTA 1J0WA 3BK1A 1TBEA 2ZVNA 2DZIA 3A58A 4HATB 1B1ZA 2MJEA 2KUQA 4L6EA 2MLBA 1L0YB 3I63C 2J4XA 4F1SA 5C2TB 5H92C 3CXBB 1Q5WB 5JXVA 3AB5A 1J19A 2Y5CA 4XC2A 2H89B 3EFCA 4KVGB 3ZNID 4W9DA 3H7PA 2KZRA 1UELA 1XXGA 3U7DA 2ELBA 1EWYC 1D5ZC 1V5UA 1PYWD 2P0HA 2ONQA 1H4RA 5J3TA 1JDEA 2M8SA 2FCQA 5JP4A 4C00A 3I5JC 4OZBA 1CQVA 5J3YA 1HTOA 1VJKA 4IWQA 4PYUA 4E74A 3IAS1 3TMPB 5AUKA 1DBHA 2RR9A 1GC7A 3ZVVA 4JE3B 2BWES 3GZNB 2R61A 1OEYA 3R2TA 5BYQA 2JZ3B 4NAWB 4PQ0A 1QOGA 3ALBA 3B9JA 1C4PA 4J3OD 4JPSA 4BKSD 2RPVA 3DVGY 4HB2B 2PIAA 4LNIA 2QKMA 4RGMA 1U27A 3PPAA 2YSZA 3AE3B 3WANA 2JT4B 5BO4B 3RPFC 3FLVA 1FXTB 1NTIA 2WX1A 4MDKE 4R3DA 3F0WA 3ZDTA 2IO1B 4OZAA 4YSYB 1XX0A 4C4VB 1N5WA 1D4BA 2ELAA 2X18A 1KOTA 4LLGM 4KHBA 5HFYA 5J17A 1LQBA 4CO7A 4TUUA 2EMTA 1T0QC 1DOYA 4EZKA 2P0FA 2DLBA 4WWMA 3VTUA 2SEBD 4DHZE 2G4DB 2C9WB 3TW1A 1JWAD 4LTUA 1L4ZB 3H7PB 3IFWB 2D9VA 2K49A 1R4NB 2MP2A 4GMXB 1WH3A 2LOZA 1YJ1A 4CHJA 4A3PA 1VBGA 4CYEA 1AWEA 3GZNI 3PSCA 5KHQA 4DHJD 3SNHA 1K53A 4TV3A 2K00A 3APCA 3EA6A 2JYTA 2MWNB 3OHMB 3J9CA 2L00B 4DHJB 3X0WA 1Y5OA 2MJDA 1JWBD 4GSWA 2BTEA 3LXFA 3V05A 5FI1A 3EFUA 4XDCA 4US8A 1IYFA 2W54A 2C7MB 2MW5A 2ZPYA 4HXDA 2Y8GA 2COAA 4USAA 4J6IA 1WRIA 2CJOA 2IO0B 1M7EA 4L1BA 1NYQA 3I3TB 3P2BA 3DWMA 2V3NA 3VR9B 4S0RA 2WS3B 1SF0A 2PEAA 3ULBA 4WSFA 2WU5B 4EE2A 1RFAA 5D2MB 1XLQA 4ZRQA 3FEHA 1WJ4A 3WYFB 2KK8A 1HBKA 5IAAC 1JRPA 5KCVA 4P16A 2GBNA 3ENBA 1UGMA 2O2VA 3E9SA 4A6FB 2DBYA 1X1FA 4DX8A 2I5FA 1R4NI 4K7UA 1D6EC 4FADA 2RGNB 4QJ5B 4II2B 4OSNA 4MSQB 3ETRA 3DBRI 5D3VA 3QWMA 1C78A 4ANVA 1UBQA 5GMVA 2MBQA 4XWXA 2KAJA 3ZXVA 4JWSC 2CU3A 1LXDA 1WXSA 4FJZA 2NCNA 1R4MB 1P3RA 3ZLZA 4UDUC 3SHQA 1OGWA 1MG8A 1JMLA 5G2NA 4BFRA 2JZPA 1XQQA 1V49A 2JSVX 3DBLI 2K8CA 3VOQA 2GUMA 1QOAA 3P4PB 1UBIA 3P4RB 4BBNF 4EMOA 4ZOHC 1S3SG 3ZVRA 3U12A 1E7VA 1AARA 1SJED 4YSXB 4K3BA 1YOVB 4EJNA 1UD7A 2QMTA 3IT4B 5EE3A 1XD3B 3HM3A 3CMMB 1U29A 4NPNA 4IDIA 3AE1B 3PVUA 2KHWB 2INPE 1I42A 1U2BA 2BYEA 2L1AA 3D8EA 1CK1A 3UQBA 2M1MA 1H10A 1XLOA 1SIFA 3RN9C 1TJ6A 3Q8FA 3W5UB 1DDWA 5JH5C 1MIXA 3B1LX 1SE2A 3BVMA 4EKUA 2LMCA 4LDTD 2H7DA 4ANWA 5IN7A 5IJMA 5G5HA 3T3OA 1NI2A 1WX7A 2V3PA 4IM3A 3ECIA 3EECA 2V0GA 3ZIMA 3QCAA 2V76A 2BB6A 2J52A 3DHGC 1FB8A 4RM8A 3TBLD 3EPYA 2RMMA 2WXMA 2OEDA 3RYTA 3C19A 1XCTL 1FXAA 1F2RI 3PVWA 3X23A 4XYCA 2PW9A 4M02A 5DIFB 4MGYE 2KC2A 1G6JA 2KTRB 1K5DB 2N9XA 1SHCA 1WIAA 1KF6B 1SE4A 4ZHOA 1TS2A 3PG7A 1TKYA 3A4RA 2NZ8B 2CY5A 3HM6X 5CHVC 4G11A 1R7SA 1HB8A 4M01A 2HRJA 2H88B 4KX6B 2OJRA 1BXTA 2KO3A 1PMSA 2PVGC 2EJ8A 2B76B 4YWGG 4RGNA 4RF0A 2VRWB 2YRYA 2L05A 3DVNU 3Q3FA 4HKZE 3N9YC 1L0VB 3ULCA 2ZKMX 3N3KB 4BOSC 4DWFA 2DFKA 1D5MC 4ARCA 2HJ8A 2Q13A 4ILJA 1E7PB 1QILA 1E8WA 1NVID 3MC9A 4X57B 2FCNA 3RNFC 3K9OB 4DX90 3HIEA 2LXCA 1EVHA 3JSVB 4BKSA 3LJ3A 3ZJVA 3WCQA 1TJEA 2KMAA 4WJNA 4LNKA 2W2XD 2D3GA 2LEKA 1C9FA 1WZ0A 1M4VA 3KY9A 1ZSQA 1TY0A 2C7NB 5E6PA 4L1RA 2WLBA 2ADZA 2DKPA 4KHBB 2GJYA 3R3MA 5AZGA 4GGQA 2COPA 4DQOC 4WJPA 2VZKB 4M8NA 2ZJDA 4HCNB 4TKNA 4S17A 3AE8B 2L76A 1IP9A 2BWFA 4JLCA 2KNBA 1XCQL 1X05A 3H6NA 2G1EA 1V88A 4ASWC 2KMMA 1S1QB 1GUAB 5BYSA 3VTVA 3RNCC 2CRFA 5BMGA 3P7ZA 4XE0A 2MRPA 2DLWA 2LYDA 4TMAB 3VH3B 4FJYA 5KHOA 3RULA 4PS8A 1V6EA 4W9FA 1XF5L 4JQWC 4QJ3B 2CODA 2PJHA 4RMAA 2MQJA 2PKOA 3A8QA 1BT0A 5LONB 5CHFA 5CLQB 2GS0A 1UNQA 2KANA 4RM9A 2WDQB 4GNKB 3ZDMC 3ZUNA 1GJZA 3APFA 2Z59A 3DXCA 1L6VA 2Z59B 1RRPB 2EKEC 1TQZA 1V81A 1FGZA 4GB9A 2HDEA 4D2KA 1F2RC 5I2MA 1X11A 4K7SA 2HTME 5HKHA 3PO0A 3B0AA 2YT1A 2I2YA 2BKRB 2G35A 1EU3A 1U5EA 3IBEA 3W9CB 3TEXA 2K2JA 4OVVA 1JWSD 2Y5BB 5JHHA 2IO3B 4K2OA 2KDFB 2AEHA 3RZFA 1AYFA 4OHJA 3ZTCA 3TEYA 2BYVE 3QA8A 4YSZB 3ZO5B 3Q3NC 3GYOA 1UZXB 1NEKB 1IBXB 2JQRB 2KFKB 2DYOA 4CSQA 4LNNA 1MKEA 1VZ6A 4A5KA 2QKLA 4GXBA 3VDZA 3KLSX 4ZRJA 4DXAB 2Y8FA 5C5BA 2WXLA 1WF9A 4MGKE 3N1XC 4I6LB 1T0YA 3QIJA 1WR1A 4FHKA 3L4PA 2YF0A 1YX6B 3U2SC 4GU2A 4B95A 2KTRA 3DPDA 3IHPC 2I1JA 2RUKB 1NI3A 2KX3A 1WGRA 3L17A 3PGEA 2YVCA 2INCC 5FKAC 2BVCA 2KT7A 1Y19B 1C79A 4MH0E 3Q2AC 4W9HA 3MP9A 4K1RB 2GBRA 1OMWA 5C5BB 4GPTB 2R0DA 1PGBA 3VXWA 4WIPA 1WYGA 2KTFA 2JPHA 4FXCA 4HCPB 4MGIE 5C16A 2DX1A 1WYWB 1EO6A 1FO4A 1FRDA 2BQQA 1CZPA 4GOUA 3HUIA 2QSDA 3ODOA 3A33B 3D8DA 3DCGA 4MM3B 4PS7A 2X0SA 2LZ6A 3GB1A 2D9WA 4AWJA 5I2SA 1MPEA 3VVWB 1BWNA 1VBHA 1UWXA 1IPGA 1TZOA 1SE9A 3KSYA 5JHAA 1GC6A 5FK9C 2DA0A 2MWSB 1C1YB 2UYZB 4JKGB 4JGHB 4AS1A 1UPQA 2DN6A 1ZPSA 2Z14A 2RQ1A 5KQ1A 4ZRKA 3DHHC 1HTQA 1N63A 2NTSA 1LB1A 2AWTA 2FCSA 1PGAA 2R09A 2I38A 2MKRA 1FAOA 4MACA 2KD0A 1A5RA 3CSTA 4IAPA 1UNRA 3P6AA 4WWOA 4P7IA 3IAM1 4JX1C 2R2QA 4RGTA 2J0JA 2LVPA 2W2XC 1V1PB 1WXMA 2PE9A 4US9A 1ZDVA 3KVFB 4LDTB 3MTNB 2LBBA 2LGSA 5MPOA 2NR2A 1WGYA 5J3QA 2KDMA 3CWIA 3HHMA 3MC8A 4KKJA 3VUXA 3NVYA 3PREA 4JKDA 1P1AA 1QQRA 1WXAA 5DPWA 5FR6A 1T0SC 1EU4A 1STEA 3A9JB 1W1HA 1LGRA 4HJKA 3GYPA 2W9NA 4RGOS 4GOCA 3SUZA 2Z0PA 3MDBC 4XZ4A 3UIOB 4BAXA 5G55A 3C8YA 3V61A 3QJZA 4A3OA 3DWGC 1MJDA 3VFKA 2L1CA 2AQ2B 2JYEA 4FBJB 2W2WA 5AZFA 4W9GA 1ST7A 2ZCBA 1DDMA 2K8BA 5HHDG 3PRZA 3WAMA 1PDXA 3Q6BA 1KZGA 4HSIA 3VIAA 1NDDA 2UZSA 3AULA 2O2VB 2LULA 3ZJUA 1QLBB 1VDVA 2AX5A 2A4ZA 3ZRCA 3NS1A 5IA7A 4PNKA 1ZOYB 3K9PB 1EAZA 4FHJA 3GE8C 1HA5A 3TSSA 1WJNA 2RDHA 3UQAA 3AEBB 2XNAC 4CQNA 2KUPA 3L16A 4NQKE 2BS4B 3JSVA 1L6UA 3KZ1A 4ZHPA 3KUDB 3N30A 2XN9C 2OOBB 2QHOA 3IG3A 3OAWA 3RI7C 1FPYA 3M63B 3ML4A 1T77A 2WU2B 1MK7B 2LI5A 1YN3A 4IG7B 5GXGB 3NSUA 3KW5B 1EF5A 3D8FA 4EUTA 1E6EB 1N3HA 2O6VA 2KDEB 1SSNA 2WXQA 1WRDB 3BWUD 2HTHB 1VR9A 4NY0A 1WFYA 2SAKA 4LJOB 2RVBB 1XODA 2KVZA 3L0WB 5C6RA 1V89A 3B2GA 5JHBA 4TYZA 2CY4A 1TGZB 3F5RA 1J0GA 4MJSB 2K22A 2DAJA 2FAZA 1TKGA 4TQ0A 1I4QA 2K39A 4A20A 4KGSA 3E56A 1U5FA 3SEBA 1JRUA 2Z8LA 2MDXA 4JKEA 3NOBA 2IJ0A 4HB3B 1WGQA 2AQ1B 1L4DB 2UU7A 3BINA 4HRSA 2G4SA 4GIVA 1YN5A 2M4NA 1YD8U 2CJNA 3MHSD 1L5PA 1YMHE 2INDC 2KDBA 5DPRA 1N6ZA 2K1FA 5D6JB 4EOYA 4H8SA 3KWVA 2YS5A 3WAOA 4EZLA 1ZDXA 3KH0A 3SO6A 1TY2A 3HVDA 5L95C 1JCKB 2BPSA 2K2UA 4EZJA 4IUMB 3ZJTA 1ACAA 5M4YB 3AEAB 3RFZB 2KJ6A 3BK2A 2COCA 1FCLA 3WALA 4B6WA 3MHZA 2WP9B 3AE2B 2YLMA 1WJ1A 2MEKA 2LXAA 3P42A 3PTFC 1V5OA 1KLVA 2VZKD 5C79A 4GDLB 4AUQC 2FCMA 3S2AA 2GCLA 3KUZA 4DBBA 1BUIC 1FHOA 4DHZB 1KC7A 3OJ3A 2IFSA 1U4AA 2L52A 1UGJA 1F1HA 2DHZA 1P98A 2LASA 4GDKA 2QDFA 2EC1A 4A90A 2J7QB 4ICUA 2J0KA 3AH7A 3EUB2 3M95A 2FIDA 2ROVA 2NPTB 3AE6B 4K81A 2KWUB 3AV8A 3E9OA 3V6EB 2Y3AA 4HAXB 4HAYB 2MBHA 2Y7BA 2ZNVB 3NVZA 3UINB 1ZE3D 2WDTB 2N7DA 2WDVB 3E9LA 5HG2A 3P4SB 5BMHA 3SBGA 2BW2A 2YS3A 3A1QA 2BBCA 3A9JA 2N23A 3D32A 2K25A 1P3QU 1ACCA 3RT3B 1TZ1A 4HDQA 1L2NA 1IGCA 1RYJA 4MY6A 3OJ4B 4GZUA 3UGBB 5C1ZA 1EWCA 2YT0A 2YEPF 2JF5A 3DCXA 5LNK1 4JL9A 3Q8AA 3PZ7A 3TJPA 3V60A 4HB0B 2LFIA 4KZ0A 2W82A 3BYTB 3RNBC 4B6HA 4DXGA 3V62A 3MPXA 1RAXA 3AN1A 4GMVA 1XO3A 3RUIB 4JK8A 2VSZA 2ZZPB 2KVRA 1AW7A 2WQYB 4M00A 4HDOA 5T8IA 2ZCCA 1QKZA 1ROEA 4B9KA 4CHKA 3UZTA 1L0XB 3H1UA 4PK1A 1SE3A 1HB6A 1WXQA 3PHWB 4KIKB 4KIKA 3ZYYX 4P1CC 3W2DA 2OTXA 2K8HA 2VH2A 2MH7A 1N5XA 1LFDA 4W9JA 4XGAB 2WXJA 2IPKD 1J7CA 2NVUI 2ZW0A 2UVMA 1QOBA 1FNWA 3SFDB 1SJHD 2Q5WD 1WI1A 4ZYNA 3AU5A 2N0YA 2DZMA 1Q10A 5D3YA 3AE7B 2D9XA 2MP2B 4IOYX 4HEA1 1UPRA 4WQMA 4HAUB 3A9KB 2NBVB 2CR5A 4C4VA 1Q67A 3NUHB 2IDYA 1FRRA 3JVZX 2ZPNA 1XR0B 1H8CA 3V5WA 5EE9A 5LXIB 1IUEA 4IM0A 1J7BA 4BOZB 4K17A 3TIXA 3E66A 2KFKA 2XBBC 2NBWB 1UWMA 2V4LA 4YT0B 1SXTA 2QILA 1ZXHA 1F9JA 1XKEA 5LG4B 2ASQA 2ZW1A 4II3B 3FSSA 1WE7A 4TQ1A 4JKFA 1FGYA 1P7FA 2N9KA 4HKQA 2WXFA 4LCDE 3NWDA 3QAQA 1X1GA 2GBKA 3R8BA 1FFUA 2BKFA 4KKIA 3O65B 1I4GA 3QHTA 2LUEA 3QX1A 2LKOA 4A6KA 5CX3A 1N61A 3GE3C 4F7GA 1ET6A 2IYDB 2JRHA 2KQSA 5DHAB 4N6EB 2AL6A 1RRBA 2JXXA 2LGYA 3ZQ4A 2IYBA 5DH9B 3BYYB 2ON8A 1ENFA 4HB4B 1BAKA 2L32A 2GB1A 1VZ8A 4MGZE 3A9KA 5D3DA 2LHEA 1YQBA 2AL3A 2FE8A 1KI1B 2X38A 1OQRA 3KRXA 2Z13A 1GPXA 4KZCA 2WNMA 2FNJB 2WXNA 3C0RB 4W9IA 3TL5A 1HQRD 4JKAA 3SR6A 3WIMA 2KQ7A 1C77A 5BYRA 4HJGE 3BIID 3IXSA 3ONSA 3DBRB 1NENB 1FOEA 5L81A 3FILB 2DHIA 3L10B 4F7HA 1DROA 2WH5A 3W1YA 3VAWA 4JKBA 4ZDVA 4ANXA 1YX5B 2BT6A 1GOZA 2JVCA 1E5WA 2JZZA 4IWOA 1V5TA 2DHKA 2N0SB 4OW0A 3PSEB 2Z0OA 1JROA 3SBTA 1AQCA 1B55A 1JWUD 2H7EA 2D3AA 3BVGA 5DPSA 5TSSA 3AJ4A 1DYNA 1OQNA 2BYFA 2QCZA 4N58A 3KUCB 1B9RA 2BS3B 1EGXA 4URKA 2PVOD 1SB3C 1PFJA 4DIXA 2MBOA 5JVLA 2YT2A 1JW9D 1TT5B 2C5LC 2WXIA 4K3CA 3MFGA 3NZ3A 1HXYD 4NSWA 3EGRA 3DBLB 1CMXB 3SU8X 5HE3A 1SIJA 3PT2B 1QC6A 4WAFA 1P0RA 1YQ4B 2CB8A 4ANUA 2FDQA 3AE9B 3VUWA 2D5GA 1SBBB 1LO5D 2DYBA 1GAQB 1LW3A 2FJ9A 2NMBA 2LG1A 1P9DU 4A6HA 2Z0QA 2Z0EB 4L23A 2ICIA 3NRZA 5GOWB 2ABDA 4CHMA 4HAZB 1A70A 3PV1A 4G3XB 5IRSA 3PLVA 1OTRB 5E6NA 3ZGZA 2GI9A 3ODXA 2P0DA 4LNFA 1FEHA 2LWPA 2QEJC 1Z2MA 2WXPA 3HSAA 4C7YA 4F7UP 1MI1A 1PUTA 4RF1A 2L83A 3V6CB 2KYWA 1MVKA 4BVUC 1WMHB 3V3XA 2JX5A 2RPQA 2I5CA 1QF6A 2ZVOA 3CF6E 3VTWA 4BBNC 1WJ6A 1GNUA 2LGXA 3NY5A 2R2YA 3NVWA 3HIZA 2FBWB 2NPTA 4MSMB 1MHXA 1ZVRA 1V5PA 2N4FA 4GN1A 2WWZA 4N9F4 2CKHB 2BCJA 1FCCC 5E6JA 2MCNB 3HW2B 1W1GA 4IC7B 1VCBA 3B2FA 2KX0A 4YONA 4ILHA 1SEBD 2L3ZA 3DVNV 3RNEC 1FNVA 3GS2A 1WMHA 2K5PA 1PLSA 5HI1A 1YQ3B 4P6VF 3AI5A 3DOWA 2WGSA 2PMVA 1NTYA 2QIEB 5JZEB 3VQIA 3L54A 2MA9B 3L13A 2C60A 4WJQA 4L2YA 2JWZA 2Z4DA 4I6NB 2KGXB 2HTHA 2IO2B 2E3TA 2PTLA 2ACZB 4XWWA 2VKIA 1ET9A 4NZLB 4XDDA 2PPHA 2LVOA 3DBSA 1QOFA 2IZVB 4WURA 1XLPA 1M94A 5DI9B 1I2HA 4N59A 4IW0A 2M19A 2CS4A 3VRBB 4EEWA 3DXDA 3E9PA 2PZ1A 3TUOA 5D27A 2D10A 1E8YA 3M3JA 5DCNA 2D07B 3NVVA 1DDVA 4AOFA 1XEEA 2EKIA 2I1KA 1E90A 4TSSA 1DOXA 1KTKA 4XX5A 3FM8C 3QWZB 1D3ZA 1DYQA 4G0NB 4OVUA 1MPHA 4DK5A 4Q2JA 2XEWA 4WWPA 4IFSA 2D3CA 2KCJA 1AWDA 1KM7A 5LLIA 1M7RA 5BMIA 2O6VD 3KRWA 4H2AA 3EHVA 1WY8A 4DBGA 3NWAA 3Q8BA 2LGIA 3AEGB 5IO9A 4MM3A 4RCOA 3N1YC 1OQYA 1GGOA 2DYMA 3AEFB 1WX9A 4A55A 5HE1A 2V4IB 4IKGA 3AXCA 3TEWA 4MH8A 4KSKC 1V9JA 2KJHB 3OLMD 2GRIA 2M17A 1TYGB 3AEDB 2KWDA 4AQ7A 3H9DA 3I9V1 4WQOB 5H8YE 5D7GA 3PP2A 2KLCA 2JRIB 3SDLC 2FIFA 1ZUD2 1XCGA 1V1OA 4K2PA 2J42A 1BTNA 1E8XA 3A4SC 2XQNM 4WJ7A 3NS8A 5CLLB 2GCJA 3PZ8A 1WXVA 3RNAC 3LDZE 1V80A 5DPTA 3U4EG 2JUOA 5J2RA 2KOXA 2X8XX 3ML9A 2DHJA 2N7EA 5EFXA 1I35A 1FM0D 1FIQA 4B0MA 2WXHA 3JYUA 4E71A 1FFVA 4MELA 2DTCA 4MT7A 1WZ3A 2CHXA 2EMSA 3R2IA 3RCZA 3RMKC 2GOWA 2IGHA 4KV2A 1RJ2A 1NYRA 2M38A 4JKGA 2TSSA 1DIKA 1HZ5A 5KQ4A 2N9LA 2P8VA 2BGFA 3U30A 1Y56A 4KAXB 5TR5A 4YTNB 3W1SA 3OWEB 2D9YA 4C80A 2V3SA 1I7AA 4Z2MB 1JWMD 4HK2A 1WGHA 1MI0A 3DBHB 4W9EA 5IP4D 2CAYA 1KRHA 1OQQA 4A6QA 2ZEQA 2DENB 5HE0A 1YNTE 1K51A 1Z5SB 1WX8A 2RLOA 4WJOA 2RSUA 4F7ZA 3URYA 1TTNA 2MX2A 1ISNA 4NQLB 4ACFA 2RDGA 5D3IB 2V1YA 3R7RA 5HE2A 2R82A 4YL8A 1WJMA 1V1PA 3LYYA 3DDCB 2J53A 2D2QA 3MJ5A 3ML8A 1KLGD 1N60A 2NBUA 1VRAB 4JKHA 4A9AA 2JXTA 2V9HA 1GB4A 1NU2A 1E0ZA 4B0EA 2DNFA 1F77A 4ARIA 3ODWA 2RDBC 3RCPA 3NG0A 4IWPA 4NNJB 3I57A 2W3RA 1ZP0B 2LRUA 4WH4A 2QJLA 3LB8C 4WVFB 4KHAA 1V61A 1E9MA 4DDID 2LJIA 4FJVB 3U7ZA 3CIRB 3AECB 2GBJA 3A8PA 1WWTA 3ENEA 2PLPA 2MBBB 1LM8B 4ITKA 1XLNA 4PYZA 1WG7A 3R7QA 4F8CB 1NTVA 5D3XA 4IOIE 2RGFA 3P63A 3N7CA 4Y94A 1RWSA 1X86A 3TCAA 3O96A 5IKCM 2KR0A 1PGXA 1TS4A 1MAIA 3M62B 2K6DB 2G3QB 1WGDA 1TXDA 3B77A 4NJCA 1IGDA 3W5VB 3KYDD 1XT9B 2UWQA 1FMAD 2MHJA 2IGDA 2KN4A 4NJ7A 1QZEA 2JWUA 2W55A 2NS5A 2CU1A 3SV1A 5CHWA 2DAFA 4AJYB 2KKCA 2K9XA 4W9KA 4RH6A 1FD6A 4KGRA 5J18A 1RFKA 2LOXA 2JY6A 4O1NA 5LXHA 2G45B 4C56C 3ZNZB 3LJUX 2MBEA 4BBKA 2INNE 3PVLA 2M56B 3H7SA 1EM7A 1D5XC 4MT5A 1OFFA 1Q1OA 4JIOU 2RD0A 4M8MA 4HHVA 3HVZA 3Q69A 3IVFA 1IRSA 4OVZA 1WGKA 2HD5B 3AE5B 3QK0A 1V5MA 3UI3A 1P5TA 5AUIA 1C4CA 3VRAB 3T8MA 3SYXA 3Q3MC 1EUVB 2W3SA 4I6PA 4C0AA 4WWNA 4NAWA 1TS3A 3T9LA 3KQ4A 1Q0WB 1JQ4A 5E6OA 1I4PA 3JW0X 3Q14C 5C23A 4M0WA 2LHDA 1KLUD 3Q3OC 4ZYSA 2KDIA 1WI0A 2N1WA 2WHIA 3DBHI 1V97A 2KACA 3KWLA 3N32A 1RM6C 2L8JA 1K5GB 1VZ7A 1P6SA 5JHGA 1P7EA 4GDLA 5FR3A 4KDIC 2CQUA 3EC8A 1PQSA 4HVBA 2L7RA 2BF8B 3BZDB 2GBMA 2M14A 3TO1A 3HQCA 1UH6A 4FLHA 2DWQA 3TFMA 4PS3A 3DXEA 1MHHE 4DXFA 3ZNGC 2KWVB 3ZXRA 5G5GA 4RNAA 4FA6A 3N1ZC 3RZWC 1C4AA 3WA0A 3M1IB 1WR6E 3ZTDA 2AYOB 1ESFA 1I4XA 1HE8A 1T3QA 2IY0B 3DHIC 2KMCA 2D4QA 2NMQA 4D0NB 2K3UA 1WM3A 3BVZA 1W1DA 1ZGUB 2JP2A 3AEEB 1MG4A 1U5DA 2D3BA 1FHXA 1N62A 3OG5A 3U8ZA 2E2XA 2WXKA 3BJIA 1J8CA 3FAHA 1WE6A 2FUHB 1UNPA 3SD5A 5IOIA 1VLBA 1NVLA 2OJWA 2D9ZA 2VH1A 2KIGA 2FJUB 4HPLB 1KJTA 4W9LA 3SFEB 4ZRIA 1ZYIA 4PT5A 2DZKA 3NWFA 4ZRPA 2WXRA 1I4RA 1KFYB 4QJ4B 1FXIA 1MK9B 4IM2A 4YTMB 2KIEA 1TS5A 3CSFA 3PZDA 4JKCA 3UF8A 3MJWA 2WDRB 3APDA 4KHOA 2DX5B 2XK5A 3MC0B 3OANA 3ZW3A 4QXAB 1Y8RC
chains in the Genus database with same CATH topology
2LRWA 4DDGD 2MFQA 5AEKB 4MJSA 2KXJA 3A1QB 1GG3A 1C3TA 1MIZB 2N9PC 3QBVB 1ZM0A 1KZ7A 1WVHA 3PS6A 2MSED 2DIKA 1RLFA 4K7WA 2DX5A 1FHWA 2KWCA 3DQVA 2UZRA 4E3CA 4BKGA 2L0FA 3VH4B 1XD4A 1WGUA 3PLUA 4ICVA 2RSGA 2ZNVC 2IBIB 3QARA 2FJLA 2KJRA 4EFOA 2DZJA 3VHTC 2N9EB 1Z87A 4MEMA 3PEGA 3W1SC 1KBLA 2KC1A 1E8ZA 2Z0DB 2KN5A 1OY2A 5CTRC 2J59M 4FULA 2LVQA 4KDLB 1YIWA 2LGDA 5D3WA 3R66C 3A98B 3PRMB 4NJ6A 1ZKHA 5JLJB 2DYQA 2COFA 1V2YA 2IY1B 1V86A 1NBFC 5FI0A 2XK5B 2YS1A 4FN2A 2J0MA 1BTKA 3VUYA 4A6FA 4HLEA 5LOPB 2RNRB 1WJUA 3T06A 3TVVA 3Q3JA 1UEFA 2WX0A 4GDKB 2LJ5A 1VD2A 1WM2A 4LJPB 4HPMB 4HWIB 2ROZB 5DHFB 3ZNHB 3HK0A 3L08A 2LD9A 5EDSA 3PHXB 4M0WB 4G50A 2K6QA 1K8RB 4KSLC 4BKTA 2DYNA 1ZW7A 2CHWA 3NHEB 3NZSA 4AP4C 2KLGA 4AJWA 2HE7A 2O6VB 2N1VA 3AU4A 4MK0A 3B08A 4ILGB 1ZC3B 2PE6B 3KYCD 3ZRFA 4WAAA 2DKQA 2R2OA 3GOEA 1OEYJ 1E7UA 1EF1A 3ZKJC 3G9WA 2CHZA 1WGGA 4JK9A 3DVGX 3BY4B 3FP5A 4JK7A 4HAWB 1U5GA 3RD2A 1ZC4B 2L0TA 2D11A 5D94A 2VRRB 1SGHA 3NZUA 4Z2NA 2B3AA 1R4MI 2C7HA 3QQ8B 1L7YA 4HAVB 2KFJA 4W9CA 1QQGA 5L83A 2M0XA 3WAPA 2WYQA 2A5UA 2L2IA 1X1MA 5AZHA 2GMIC 2OQBA 3PRPB 3UIPB 3CIKA 2REXA 3QC8B 1J0WA 1TBEA 2ZVNA 2DZIA 4HATB 4L6EA 2MLBA 4F1SA 3CXBB 1Q5WB 1J19A 4XC2A 4KVGB 3ZNID 4W9DA 3H7PA 2KZRA 1UELA 3U7DA 2ELBA 1V5UA 2P0HA 1H4RA 5J3TA 1JDEA 2M8SA 2FCQA 5JP4A 5J3YA 4IWQA 4PYUA 4E74A 3TMPB 1DBHA 2RR9A 1GC7A 3ZVVA 2BWES 1OEYA 2JZ3B 4NAWB 4PQ0A 3ALBA 4BKSD 3DVGY 4HB2B 2QKMA 1U27A 3PPAA 2YSZA 3WANA 2JT4B 5BO4B 3FLVA 1FXTB 1NTIA 2WX1A 4MDKE 3F0WA 3ZDTA 2IO1B 1XX0A 2ELAA 2X18A 1KOTA 5J17A 1LQBA 4CO7A 4TUUA 2EMTA 4EZKA 2P0FA 3VTUA 4DHZE 2G4DB 2C9WB 3TW1A 3H7PB 3IFWB 2D9VA 2MP2A 4GMXB 1WH3A 2LOZA 1YJ1A 4CHJA 4A3PA 1VBGA 4CYEA 1AWEA 3GZNI 3PSCA 5KHQA 4DHJD 3SNHA 4TV3A 2K00A 3APCA 2MWNB 2L00B 4DHJB 3X0WA 1Y5OA 4GSWA 5FI1A 3EFUA 1IYFA 2C7MB 2MW5A 2ZPYA 4HXDA 2Y8GA 2COAA 4J6IA 1M7EA 2IO0B 3I3TB 3P2BA 2PEAA 3ULBA 4WSFA 1RFAA 5D2MB 3FEHA 1WJ4A 3WYFB 2KK8A 1HBKA 5IAAC 5KCVA 2GBNA 3ENBA 1UGMA 2O2VA 4A6FB 1X1FA 4DX8A 2I5FA 1R4NI 4K7UA 4FADA 2RGNB 4II2B 4MSQB 3DBRI 5D3VA 3QWMA 4ANVA 1UBQA 5GMVA 2MBQA 4XWXA 1LXDA 1WXSA 4FJZA 2NCNA 1P3RA 3ZLZA 3SHQA 1OGWA 1MG8A 5G2NA 4BFRA 1XQQA 1V49A 3DBLI 2K8CA 3VOQA 1UBIA 4BBNF 4EMOA 1S3SG 3ZVRA 1E7VA 1AARA 4EJNA 1UD7A 1XD3B 3HM3A 3CMMB 1U29A 4NPNA 3PVUA 2KHWB 1I42A 1U2BA 2BYEA 3D8EA 3UQBA 2M1MA 1H10A 1SIFA 1TJ6A 1DDWA 5JH5C 1MIXA 3B1LX 4EKUA 4LDTD 2H7DA 4ANWA 5IJMA 1NI2A 1WX7A 4IM3A 3ECIA 3EECA 3ZIMA 3QCAA 2V76A 1FB8A 4RM8A 3TBLD 3EPYA 3RYTA 3PVWA 3X23A 5DIFB 4MGYE 2KC2A 1G6JA 2KTRB 1K5DB 2N9XA 1SHCA 1WIAA 3PG7A 3A4RA 2NZ8B 2CY5A 3HM6X 5CHVC 4G11A 1HB8A 2HRJA 2OJRA 2KO3A 1PMSA 2EJ8A 2VRWB 2YRYA 2L05A 3DVNU 3Q3FA 3ULCA 3N3KB 4BOSC 4DWFA 2DFKA 2HJ8A 2Q13A 4ILJA 1E8WA 4X57B 2FCNA 3K9OB 4DX90 2LXCA 1EVHA 3JSVB 4BKSA 3LJ3A 2KMAA 4WJNA 2W2XD 2D3GA 1WZ0A 3KY9A 1ZSQA 2C7NB 5E6PA 2ADZA 2DKPA 4KHBB 2GJYA 3R3MA 5AZGA 4GGQA 2COPA 4WJPA 4M8NA 2ZJDA 4HCNB 4TKNA 2L76A 1IP9A 2BWFA 4JLCA 2KNBA 1X05A 3H6NA 1V88A 4ASWC 1S1QB 1GUAB 3VTVA 2CRFA 3P7ZA 2MRPA 2DLWA 2LYDA 3VH3B 4FJYA 5KHOA 3RULA 4PS8A 1V6EA 4W9FA 4JQWC 2CODA 2PJHA 4RMAA 2MQJA 3A8QA 1BT0A 5LONB 5CHFA 5CLQB 2GS0A 1UNQA 2KANA 4RM9A 3ZDMC 3ZUNA 1GJZA 3APFA 3DXCA 2Z59B 1RRPB 2EKEC 1TQZA 1V81A 1FGZA 4GB9A 1X11A 4K7SA 5HKHA 3B0AA 2YT1A 2BKRB 2G35A 1U5EA 3IBEA 2K2JA 4OVVA 2Y5BB 5JHHA 2IO3B 4K2OA 2KDFB 2AEHA 3RZFA 3ZTCA 2BYVE 3QA8A 3ZO5B 3GYOA 1UZXB 2KFKB 2DYOA 1MKEA 4A5KA 2QKLA 4GXBA 3VDZA 4ZRJA 4DXAB 2Y8FA 5C5BA 1WF9A 4MGKE 4I6LB 1T0YA 3QIJA 1WR1A 4FHKA 2YF0A 1YX6B 4GU2A 4B95A 2KTRA 3DPDA 3IHPC 2I1JA 2RUKB 2KX3A 1WGRA 3L17A 3PGEA 2YVCA 1Y19B 4MH0E 4W9HA 4K1RB 2GBRA 1OMWA 5C5BB 4GPTB 2R0DA 3VXWA 2KTFA 2JPHA 4HCPB 4MGIE 5C16A 2DX1A 1WYWB 1EO6A 3ODOA 3A33B 3D8DA 3DCGA 4PS7A 2X0SA 2LZ6A 4AWJA 2D9WA 3VVWB 1BWNA 1VBHA 1IPGA 1SE9A 3KSYA 5JHAA 1GC6A 2DA0A 2MWSB 1C1YB 2UYZB 4JGHB 4JKGB 1UPQA 2DN6A 2RQ1A 5KQ1A 4ZRKA 1LB1A 2AWTA 2FCSA 2R09A 2MKRA 1FAOA 2KD0A 1A5RA 3CSTA 4IAPA 1UNRA 3P6AA 4WWOA 4P7IA 2R2QA 2J0JA 2LVPA 2W2XC 1WXMA 2PE9A 3KVFB 4LDTB 3MTNB 2LBBA 2NR2A 1WGYA 5J3QA 3HHMA 3VUXA 3PREA 4JKDA 1P1AA 1WXAA 5DPWA 5FR6A 3A9JB 1W1HA 4HJKA 3GYPA 2W9NA 4GOCA 3UIOB 3SUZA 2Z0PA 3MDBC 4XZ4A 5G55A 3V61A 3QJZA 4A3OA 3VFKA 2L1CA 4FBJB 2W2WA 5AZFA 4W9GA 1ST7A 2ZCBA 1DDMA 2K8BA 3PRZA 3WAMA 1KZGA 1NDDA 3VIAA 2UZSA 3AULA 2O2VB 2LULA 2A4ZA 3ZRCA 5IA7A 4PNKA 3K9PB 1EAZA 4FHJA 1WJNA 3UQAA 2KUPA 3L16A 4NQKE 3JSVA 3KZ1A 3KUDB 3N30A 3IG3A 2OOBB 2QHOA 3OAWA 3M63B 3ML4A 1MK7B 2LI5A 4IG7B 3NSUA 3KW5B 1EF5A 3D8FA 4EUTA 1N3HA 2O6VA 2KDEB 1WRDB 2HTHB 4NY0A 1WFYA 4LJOB 2RVBB 1XODA 3L0WB 5C6RA 1V89A 5JHBA 4TYZA 2CY4A 1TGZB 3F5RA 1J0GA 4MJSB 2DAJA 2FAZA 4TQ0A 2K39A 4A20A 1U5FA 1JRUA 2MDXA 4JKEA 3NOBA 4HB3B 1WGQA 3BINA 2G4SA 4GIVA 2M4NA 1YD8U 3MHSD 2KDBA 5DPRA 2K1FA 5D6JB 4EOYA 4H8SA 2YS5A 3WAOA 4EZLA 3KH0A 3SO6A 5L95C 2BPSA 2K2UA 4EZJA 4IUMB 1ACAA 2KJ6A 2COCA 3WALA 4B6WA 2YLMA 1WJ1A 2LXAA 3PTFC 1V5OA 1KLVA 5C79A 4GDLB 4AUQC 2FCMA 3S2AA 2GCLA 3KUZA 4DBBA 1FHOA 4DHZB 1KC7A 3OJ3A 2IFSA 1U4AA 2DHZA 1P98A 2LASA 4GDKA 2EC1A 2J7QB 4ICUA 2J0KA 3M95A 2FIDA 2ROVA 2NPTB 4K81A 2KWUB 3E9OA 3V6EB 4HAXB 4HAYB 2MBHA 2Y7BA 2ZNVB 3UINB 2WDTB 2N7DA 3E9LA 3SBGA 2YS3A 3A1QA 3A9JA 2N23A 3D32A 2K25A 1P3QU 3RT3B 1TZ1A 4HDQA 1L2NA 4MY6A 3OJ4B 4GZUA 3UGBB 5C1ZA 2YT0A 2JF5A 4JL9A 3TJPA 3V60A 4HB0B 4KZ0A 4B6HA 3V62A 3MPXA 1RAXA 4GMVA 3RUIB 4JK8A 2VSZA 2ZZPB 2KVRA 4HDOA 2ZCCA 4B9KA 4CHKA 3UZTA 3H1UA 1HB6A 3PHWB 4KIKB 4KIKA 2OTXA 2K8HA 1LFDA 4W9JA 2NVUI 2UVMA 1WI1A 4ZYNA 3AU5A 2N0YA 2DZMA 5D3YA 2D9XA 2MP2B 4IOYX 1UPRA 4HAUB 3A9KB 2NBVB 2CR5A 1Q67A 3JVZX 2ZPNA 1XR0B 1H8CA 3V5WA 5LXIB 4IM0A 4BOZB 4K17A 3TIXA 3E66A 2KFKA 2XBBC 2NBWB 2V4LA 1F9JA 1XKEA 2ASQA 4II3B 3FSSA 1WE7A 4TQ1A 4JKFA 1FGYA 4LCDE 3QAQA 1X1GA 2GBKA 2BKFA 3O65B 3QHTA 2LUEA 3QX1A 2LKOA 4A6KA 5CX3A 4F7GA 2IYDB 2JRHA 2KQSA 5DHAB 2AL6A 1RRBA 2JXXA 2LGYA 2IYBA 5DH9B 4HB4B 1BAKA 4MGZE 3A9KA 1YQBA 2AL3A 1KI1B 3KRXA 4KZCA 2FNJB 3C0RB 4W9IA 3TL5A 3WIMA 4JKAA 2KQ7A 3ONSA 1FOEA 5L81A 2DHIA 3L10B 4F7HA 1DROA 2WH5A 3W1YA 3VAWA 4JKBA 4ZDVA 4ANXA 1YX5B 2JVCA 1E5WA 2JZZA 4IWOA 1V5TA 2DHKA 3PSEB 2Z0OA 3SBTA 1AQCA 1B55A 2H7EA 5DPSA 3AJ4A 1DYNA 1OQNA 2BYFA 3KUCB 1EGXA 4URKA 1PFJA 2MBOA 5JVLA 2C5LC 4NSWA 1CMXB 3SU8X 5HE3A 3PT2B 1QC6A 1P0RA 2CB8A 4ANUA 2FDQA 3VUWA 2DYBA 1LW3A 2FJ9A 2NMBA 2LG1A 1P9DU 4A6HA 2Z0QA 2Z0EB 5GOWB 2ABDA 4CHMA 4HAZB 3PV1A 5E6NA 4G3XB 3PLVA 1OTRB 3ODXA 2P0DA 2LWPA 1Z2MA 4F7UP 3V6CB 4BVUC 1WMHB 2RPQA 2I5CA 2ZVOA 3CF6E 3VTWA 4BBNC 1WJ6A 1GNUA 2LGXA 3NY5A 3HIZA 2NPTA 4MSMB 1ZVRA 1V5PA 2N4FA 4GN1A 2WWZA 4N9F4 2CKHB 2BCJA 2MCNB 3HW2B 1W1GA 4IC7B 1VCBA 2KX0A 4YONA 4ILHA 3DVNV 2L3ZA 1WMHA 1PLSA 3AI5A 3DOWA 1NTYA 5JZEB 3VQIA 3L54A 2MA9B 3L13A 2C60A 4WJQA 2JWZA 4I6NB 2KGXB 2HTHA 2IO2B 2VKIA 2PPHA 2LVOA 3DBSA 2IZVB 1M94A 5DI9B 1I2HA 4IW0A 2CS4A 4EEWA 3DXDA 3E9PA 2PZ1A 5D27A 2D10A 1E8YA 3M3JA 5DCNA 2D07B 1DDVA 4AOFA 2I1KA 1E90A 4XX5A 3FM8C 3QWZB 1D3ZA 4G0NB 4OVUA 1MPHA 4DK5A 2XEWA 4WWPA 4IFSA 2KCJA 1KM7A 5LLIA 1M7RA 2O6VD 3KRWA 3EHVA 1WY8A 4DBGA 4MM3A 1OQYA 1GGOA 2DYMA 1WX9A 5HE1A 3AXCA 4KSKC 1V9JA 2KJHB 3OLMD 2M17A 3H9DA 4WQOB 5D7GA 3PP2A 2KLCA 2JRIB 3SDLC 2FIFA 1XCGA 4K2PA 1BTNA 1E8XA 3A4SC 2XQNM 4WJ7A 3NS8A 5CLLB 2GCJA 1WXVA 3LDZE 1V80A 5DPTA 2JUOA 5J2RA 2KOXA 3ML9A 2DHJA 2N7EA 5EFXA 1I35A 3JYUA 4E71A 4MELA 4MT7A 1WZ3A 2CHXA 2EMSA 3RCZA 2GOWA 4KV2A 1RJ2A 2M38A 4JKGA 1DIKA 5KQ4A 3U30A 2P8VA 2BGFA 4KAXB 5TR5A 3W1SA 2D9YA 2V3SA 1I7AA 4Z2MB 4HK2A 1WGHA 4W9EA 2CAYA 2ZEQA 2DENB 5HE0A 1Z5SB 1WX8A 2RLOA 4WJOA 2RSUA 4F7ZA 1TTNA 2MX2A 1ISNA 4NQLB 2V1YA 3R7RA 5HE2A 2R82A 4YL8A 1WJMA 3DDCB 2D2QA 3ML8A 2NBUA 4JKHA 1NU2A 3ODWA 3RCPA 4IWPA 4NNJB 2LRUA 4WVFB 4KHAA 1V61A 4DDID 4FJVB 2GBJA 3A8PA 3ENEA 2MBBB 1LM8B 4PYZA 1WG7A 4F8CB 3R7QA 1NTVA 5D3XA 2RGFA 3N7CA 4Y94A 1X86A 3TCAA 3O96A 1MAIA 3M62B 2K6DB 2G3QB 1WGDA 1TXDA 3KYDD 1XT9B 2UWQA 4NJ7A 1QZEA 2NS5A 2CU1A 5CHWA 3SV1A 2DAFA 4AJYB 2KKCA 4W9KA 5J18A 2LOXA 2JY6A 5LXHA 2G45B 3ZNZB 3LJUX 2MBEA 4BBKA 3PVLA 3H7SA 1Q1OA 4JIOU 2RD0A 4M8MA 4HHVA 3IVFA 1IRSA 3QK0A 2HD5B 1V5MA 1P5TA 3T8MA 3SYXA 1EUVB 4I6PA 4C0AA 4WWNA 4NAWA 3T9LA 1Q0WB 5E6OA 3JW0X 5C23A 2KDIA 1WI0A 2N1WA 3DBHI 3N32A 2L8JA 1K5GB 1P6SA 5JHGA 4GDLA 4KDIC 2CQUA 3EC8A 1PQSA 4HVBA 2L7RA 2BF8B 2M14A 2GBMA 3TO1A 3HQCA 1UH6A 4FLHA 3TFMA 4PS3A 3DXEA 3ZNGC 2KWVB 4FA6A 3RZWC 3WA0A 3M1IB 1WR6E 3ZTDA 2AYOB 1HE8A 2IY0B 2KMCA 2D4QA 4D0NB 1WM3A 1W1DA 1ZGUB 2JP2A 1U5DA 1FHXA 3U8ZA 2E2XA 3BJIA 1J8CA 1WE6A 2FUHB 1UNPA 3SD5A 1NVLA 2D9ZA 4HPLB 1KJTA 4W9LA 4ZRIA 2DZKA 1MK9B 4IM2A 3CSFA 3PZDA 4JKCA 3UF8A 3MJWA 3APDA 4KHOA 2DX5B 2XK5A 3OANA 3ZW3A 2DTCA 1Y8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7V A;  2LRW A;  1AAR A;  1MK7 B;  2LI5 A;  4DDG D;  4IG7 B;  1WJ6 A;  1GNU A;  2MFQ A;  3NSU A;  2LGX A;  4EJN A;  3HIZ A;  3KW5 B;  2NPT A;  1EF5 A;  3NY5 A;  3D8F A;  1ZVR A;  4MSM B;  1UD7 A;  4EUT A;  5AEK B;  1V5P A;  2N4F A;  4MJS A;  1N3H A;  4GN1 A;  2KXJ A;  2O6V A;  2KDE B;  3A1Q B;  2WWZ A;  4N9F 4;  1WRD B;  1XD3 B;  3HM3 A;  2HTH B;  2CKH B;  3CMM B;  1U29 A;  2BCJ A;  4NY0 A;  1WFY A;  1GG3 A;  2MCN B;  4NPN A;  4LJO B;  2RVB B;  3HW2 B;  1XOD A;  3L0W B;  1C3T A;  1MIZ B;  5C6R A;  1W1G A;  3PVU A;  4IC7 B;  2KHW B;  1I42 A;  1U2B A;  1VCB A;  1V89 A;  3QBV B;  2BYE A;  4TYZ A;  4YON A;  2KX0 A;  2N9P C;  1ZM0 A;  1KZ7 A;  2CY4 A;  2L3Z A;  3D8E A;  1TGZ B;  3DVN V;  3F5R A;  1WVH A;  3PS6 A;  4MJS B;  2MSE D;  1J0G A;  1WMH A;  3UQB A;  1RLF A;  2M1M A;  4K7W A;  1PLS A;  2DX5 A;  2DAJ A;  2FAZ A;  1H10 A;  1FHW A;  3AI5 A;  4TQ0 A;  3DOW A;  2KWC A;  1SIF A;  2K39 A;  4A20 A;  1TJ6 A;  3DQV A;  1NTY A;  2UZR A;  4E3C A;  1DDW A;  4BKG A;  5JZE B;  5JH5 C;  1U5F A;  3VQI A;  1JRU A;  2L0F A;  3L54 A;  2MDX A;  2MA9 B;  3NOB A;  3VH4 B;  1XD4 A;  3L13 A;  1WGU A;  2C60 A;  4HB3 B;  4WJQ A;  1MIX A;  1WGQ A;  3PLU A;  2RSG A;  4ICV A;  2ZNV C;  2IBI B;  3B1L X;  2JWZ A;  3QAR A;  2FJL A;  3BIN A;  2G4S A;  2KJR A;  4GIV A;  2KGX B;  4EKU A;  2DZJ A;  2HTH A;  2IO2 B;  4I6N B;  3VHT C;  4EFO A;  2N9E B;  4LDT D;  1Z87 A;  2H7D A;  2M4N A;  4MEM A;  1YD8 U;  4ANW A;  3PEG A;  3MHS D;  2VKI A;  2KDB A;  3W1S C;  5DPR A;  5IJM A;  2KC1 A;  1E8Z A;  1NI2 A;  2Z0D B;  1WX7 A;  2PPH A;  4IM3 A;  3ECI A;  3EEC A;  2K1F A;  5D6J B;  2KN5 A;  1OY2 A;  2LVO A;  3DBS A;  3ZIM A;  2IZV B;  4EOY A;  4H8S A;  5CTR C;  3QCA A;  2YS5 A;  1M94 A;  3WAO A;  2J59 M;  5DI9 B;  3KH0 A;  1I2H A;  4FUL A;  4IW0 A;  4ANU A;  2V76 A;  2LVQ A;  3SO6 A;  2CS4 A;  1FB8 A;  4KDL B;  4RM8 A;  5L95 C;  1YIW A;  4EEW A;  2LGD A;  3TBL D;  3DXD A;  3EPY A;  2BPS A;  2PZ1 A;  2K2U A;  4EZJ A;  4IUM B;  5D27 A;  3RYT A;  2D10 A;  1ACA A;  1E8Y A;  3M3J A;  5DCN A;  2D07 B;  3PVW A;  3X23 A;  1DDV A;  4AOF A;  2I1K A;  1E90 A;  4XX5 A;  3FM8 C;  5DIF B;  5D3W A;  3QWZ B;  4MGY E;  2KC2 A;  2KJ6 A;  1D3Z A;  2KTR B;  1G6J A;  1K5D B;  2COC A;  3R66 C;  2N9X A;  4G0N B;  1SHC A;  1WIA A;  4LDT B;  4OVU A;  3A98 B;  1MPH A;  3PRM B;  3WAL A;  4DK5 A;  3PG7 A;  3A4R A;  4NJ6 A;  4B6W A;  2NZ8 B;  2CY5 A;  2XEW A;  3HM6 X;  1ZKH A;  4WWP A;  4IFS A;  4G11 A;  5CHV C;  5JLJ B;  2DYQ A;  1HB8 A;  2KCJ A;  2HRJ A;  2COF A;  1KM7 A;  2YLM A;  2OJR A;  1WJ1 A;  1V2Y A;  2KO3 A;  2IY1 B;  1V86 A;  1M7R A;  1PMS A;  1NBF C;  5LLI A;  2EJ8 A;  2LXA A;  3PTF C;  5FI0 A;  1V5O A;  2XK5 B;  1KLV A;  2VRW B;  2O6V D;  2YRY A;  3KRW A;  2YS1 A;  5C79 A;  1WY8 A;  2L05 A;  2J0M A;  3DVN U;  3EHV A;  3Q3F A;  3DBR I;  4FN2 A;  4GDL B;  4DBG A;  4AUQ C;  2FCM A;  3ULC A;  3S2A A;  2GCL A;  4MM3 A;  3KUZ A;  4DBB A;  1FHO A;  1BTK A;  3VUY A;  4DHZ B;  4A6F A;  4HLE A;  5LOP B;  1OQY A;  3OJ3 A;  3N3K B;  2RNR B;  2IFS A;  1U4A A;  2DYM A;  4BOS C;  4DWF A;  2DFK A;  1WX9 A;  5HE1 A;  3T06 A;  3TVV A;  1WJU A;  3Q3J A;  2DHZ A;  3AXC A;  2HJ8 A;  1UEF A;  2Q13 A;  1P98 A;  2LAS A;  2WX0 A;  4GDK B;  4GDK A;  5E6N A;  2LJ5 A;  2EC1 A;  1VD2 A;  1WM2 A;  1E8W A;  2J7Q B;  4KSK C;  4LJP B;  1V9J A;  2KJH B;  4ICU A;  2J0K A;  3OLM D;  3M95 A;  2M17 A;  2FID A;  4X57 B;  2ROV A;  2NPT B;  4HPM B;  4HWI B;  4K81 A;  3H9D A;  2FCN A;  2ROZ B;  5DHF B;  4DX9 0;  3K9O B;  3ZNH B;  3HK0 A;  2KWU B;  3L08 A;  4WQO B;  2LD9 A;  2LXC A;  3PP2 A;  1EVH A;  2KLC A;  3JSV B;  2JRI B;  3PHX B;  5D7G A;  3LJ3 A;  2FIF A;  3SDL C;  4M0W B;  3V6E B;  4W9L A;  4HAX B;  1XCG A;  4HAY B;  2Y7B A;  2KMA A;  2MBH A;  2ZNV B;  4K2P A;  4G50 A;  4WJN A;  2W2X D;  3UIN B;  2D3G A;  1BTN A;  1E8X A;  1WZ0 A;  2K6Q A;  2WDT B;  1K8R B;  4KSL C;  4BKT A;  2N7D A;  3A4S C;  2XQN M;  4WJ7 A;  3NS8 A;  2DYN A;  3KY9 A;  5CLL B;  2GCJ A;  1ZSQ A;  2C7N B;  1ZW7 A;  5E6P A;  2CHW A;  1WXV A;  3NHE B;  3LDZ E;  2ADZ A;  1V80 A;  3NZS A;  5DPT A;  2DKP A;  4KHB B;  2GJY A;  4AP4 C;  2KLG A;  3R3M A;  5AZG A;  4GGQ A;  2COP A;  2JUO A;  4WJP A;  4AJW A;  5J2R A;  2HE7 A;  4M8N A;  2YS3 A;  2ZJD A;  2O6V B;  2N1V A;  2KOX A;  3AU4 A;  3A1Q A;  3A9J A;  3ML9 A;  4MK0 A;  2N23 A;  2DHJ A;  2N7E A;  5EFX A;  3B08 A;  4HCN B;  3D32 A;  1I35 A;  4TKN A;  1ZC3 B;  1P3Q U;  2K25 A;  2PE6 B;  3KYC D;  3JYU A;  3RT3 B;  4E71 A;  1TZ1 A;  4HDQ A;  2L76 A;  3ZRF A;  1L2N A;  4MEL A;  1IP9 A;  4MT7 A;  4WAA A;  2BWF A;  4JLC A;  1WZ3 A;  4MY6 A;  2DKQ A;  2EMS A;  2CHX A;  4GZU A;  2KNB A;  2R2O A;  3GOE A;  3OJ4 B;  2GOW A;  1OEY J;  4KV2 A;  3UGB B;  1X05 A;  3H6N A;  5C1Z A;  1RJ2 A;  1V88 A;  4ASW C;  2YT0 A;  2JF5 A;  2M38 A;  1GUA B;  1S1Q B;  4JL9 A;  1E7U A;  1EF1 A;  3ZKJ C;  5KQ4 A;  3VTV A;  3U30 A;  2P8V A;  2BGF A;  2CRF A;  3TJP A;  3G9W A;  3V60 A;  4HB0 B;  4KAX B;  1WGG A;  2CHZ A;  4KZ0 A;  5TR5 A;  3P7Z A;  2MRP A;  4B6H A;  3DVG X;  3W1S A;  3BY4 B;  3V62 A;  3MPX A;  1RAX A;  2DLW A;  4HPL B;  2LYD A;  3FP5 A;  2D9Y A;  2V3S A;  1I7A A;  4GMV A;  4Z2M B;  4HAW B;  3VH3 B;  1U5G A;  5CHW A;  1ZC4 B;  3RD2 A;  4FJY A;  4HK2 A;  3RUI B;  1WGH A;  5KHO A;  3RUL A;  4W9E A;  2VSZ A;  2L0T A;  4PS8 A;  2ZZP B;  2CAY A;  3RCZ A;  2KVR A;  1V6E A;  4W9F A;  2D11 A;  2ZEQ A;  5D94 A;  2DEN B;  4HDO A;  5HE0 A;  2VRR B;  4JQW C;  1SGH A;  1Z5S B;  2ZCC A;  3NZU A;  4Z2N A;  2COD A;  1WX8 A;  1R4M I;  2B3A A;  2C7H A;  2PJH A;  4RMA A;  4B9K A;  4CHK A;  2RLO A;  5EDS A;  3QQ8 B;  1L7Y A;  2MQJ A;  4WJO A;  2RSU A;  4F7Z A;  4HAV B;  2KFJ A;  3A8Q A;  4W9C A;  1BT0 A;  3UZT A;  5LON B;  1TTN A;  5CHF A;  5CLQ B;  2MX2 A;  1ISN A;  1QQG A;  2GS0 A;  4NQL B;  5L83 A;  1UNQ A;  2V1Y A;  2KAN A;  3R7R A;  3H1U A;  4RM9 A;  5HE2 A;  1HB6 A;  4YL8 A;  2M0X A;  3WAP A;  1WJM A;  3PHW B;  2WYQ A;  3ZDM C;  2A5U A;  3ZUN A;  1GJZ A;  3DDC B;  2L2I A;  2D2Q A;  4KIK A;  4KIK B;  3ML8 A;  1X1M A;  3APF A;  3DXC A;  2NBU A;  5AZH A;  2GMI C;  2OTX A;  2Z59 B;  2OQB A;  2K8H A;  1RRP B;  2EKE C;  1TQZ A;  3PRP B;  3QAQ A;  1NU2 A;  1V81 A;  1FGZ A;  3UIP B;  3CIK A;  2REX A;  3QC8 B;  4GB9 A;  1LFD A;  4W9J A;  5AZF A;  1J0W A;  1X11 A;  1TBE A;  2ZVN A;  4K7S A;  2DZI A;  4HAT B;  5HKH A;  3ODW A;  3RCP A;  4DHZ E;  2NVU I;  4IWP A;  4NNJ B;  2UVM A;  4L6E A;  2MLB A;  3B0A A;  2LRU A;  2YT1 A;  4F1S A;  1WI1 A;  3CXB B;  3AU5 A;  2G35 A;  2N0Y A;  1Q5W B;  2BKR B;  2DZM A;  4ZYN A;  1U5E A;  1J19 A;  3IBE A;  4WVF B;  4KHA A;  5D3Y A;  4XC2 A;  1KOT A;  1V61 A;  4KVG B;  3ZNI D;  2D9X A;  3H7P A;  4FJV B;  2MP2 B;  4W9D A;  4A3P A;  2K2J A;  4IOY X;  4DDI D;  2KZR A;  4OVV A;  1UEL A;  1UPR A;  2GBJ A;  3A8P A;  4HAU B;  3A9K B;  2Y5B B;  3U7D A;  2ELB A;  5JHH A;  2IO3 B;  3ENE A;  2NBV B;  1V5U A;  2CR5 A;  4K2O A;  2MBB B;  2KDF B;  1Q67 A;  1LM8 B;  2AEH A;  3RZF A;  2P0H A;  4PYZ A;  3JVZ X;  3ZTC A;  1H4R A;  1WG7 A;  5J3T A;  3R7Q A;  2BYV E;  2M8S A;  2FCQ A;  2ZPN A;  3QA8 A;  5JP4 A;  1NTV A;  5D3X A;  4F8C B;  2RGF A;  1XR0 B;  1H8C A;  3N7C A;  3V5W A;  3ZO5 B;  4Y94 A;  3GYO A;  5J3Y A;  1UZX B;  4BBN C;  5LXI B;  2KFK B;  2DYO A;  4IM0 A;  4IWQ A;  1MKE A;  4PYU A;  1X86 A;  4BOZ B;  4E74 A;  4K17 A;  4A5K A;  3TCA A;  2QKL A;  4GXB A;  3TIX A;  3O96 A;  3TMP B;  3VDZ A;  2KFK A;  4ZRJ A;  4DXA B;  2Y8F A;  2XBB C;  2NBW B;  5C5B A;  2V4L A;  1WF9 A;  1DBH A;  4MGK E;  2RR9 A;  1GC7 A;  3ZVV A;  1F9J A;  1XKE A;  1MAI A;  2BWE S;  2K6D B;  1T0Y A;  3QIJ A;  2G3Q B;  2ASQ A;  3M62 B;  1WGD A;  1WR1 A;  4I6L B;  1TXD A;  4EZL A;  4FHK A;  1OEY A;  4II3 B;  2JZ3 B;  4NAW B;  3FSS A;  4PQ0 A;  1WE7 A;  1XT9 B;  2YF0 A;  2UWQ A;  3ALB A;  3KYD D;  4TQ1 A;  1YX6 B;  1FGY A;  4BKS D;  4GU2 A;  3DVG Y;  2KTR A;  4LCD E;  4HB2 B;  4B95 A;  3DPD A;  3IHP C;  1QZE A;  2I1J A;  2QKM A;  2RUK B;  2KX3 A;  4NJ7 A;  4ANV A;  1WGR A;  2NS5 A;  1U27 A;  3L17 A;  2CU1 A;  3SV1 A;  1X1G A;  2YVC A;  2YSZ A;  2DAF A;  2GBK A;  3PGE A;  2BKF A;  2KKC A;  3PPA A;  4W9K A;  4AJY B;  5JHB A;  3O65 B;  1Y19 B;  3WAN A;  2JT4 B;  5J18 A;  3QHT A;  2LOX A;  4MH0 E;  2JY6 A;  5LXH A;  4W9H A;  2G45 B;  5BO4 B;  2LUE A;  3QX1 A;  3FLV A;  2LKO A;  1FXT B;  4A6K A;  3ZNZ B;  3LJU X;  2GBR A;  4K1R B;  5CX3 A;  2MBE A;  4F7G A;  1NTI A;  1OMW A;  5C5B B;  4BBK A;  2WX1 A;  4MDK E;  3PVL A;  3F0W A;  3ZDT A;  4GPT B;  2R0D A;  2IO1 B;  1XX0 A;  3VXW A;  2IYD B;  3H7S A;  2KTF A;  2ELA A;  2X18 A;  1Q1O A;  2JRH A;  2JPH A;  2KQS A;  5DHA B;  4JIO U;  2RD0 A;  2AL6 A;  1RRB A;  4HCP B;  5C16 A;  2JXX A;  2DX1 A;  2LGY A;  2IYB A;  4MGI E;  5DH9 B;  1WYW B;  1EO6 A;  4HB4 B;  1BAK A;  1LQB A;  4CO7 A;  4M8M A;  5J17 A;  4HHV A;  4TUU A;  2EMT A;  3IVF A;  1IRS A;  3ODO A;  4EZK A;  2P0F A;  3A33 B;  3D8D A;  3DCG A;  4MGZ E;  3A9K A;  4PS7 A;  2LZ6 A;  3QK0 A;  2HD5 B;  2D9W A;  3VTU A;  1YQB A;  2AL3 A;  4AWJ A;  1V5M A;  3VVW B;  2G4D B;  1BWN A;  2C9W B;  1KI1 B;  1P5T A;  3TW1 A;  3KRX A;  1IPG A;  3T8M A;  3SYX A;  3H7P B;  1SE9 A;  3KSY A;  5JHA A;  1EUV B;  1GC6 A;  4I6P A;  3IFW B;  2D9V A;  4KZC A;  2FNJ B;  4C0A A;  4WWN A;  2DA0 A;  2MWS B;  4NAW A;  1C1Y B;  2UYZ B;  2MP2 A;  3T9L A;  4GMX B;  1Q0W B;  2LOZ A;  1WH3 A;  1YJ1 A;  4CHJ A;  3C0R B;  3JW0 X;  4JGH B;  5E6O A;  4CYE A;  1UPQ A;  4W9I A;  5C23 A;  3TL5 A;  1AWE A;  2DN6 A;  3GZN I;  3PSC A;  3WIM A;  2KQ7 A;  2RQ1 A;  5KQ1 A;  4ZRK A;  1WI0 A;  2KDI A;  2N1W A;  3SNH A;  4DHJ D;  4TV3 A;  5KHQ A;  2K00 A;  3APC A;  3ONS A;  3DBH I;  1LB1 A;  2MWN B;  1FOE A;  5L81 A;  2AWT A;  3N32 A;  2DHI A;  2FCS A;  4F7H A;  1DRO A;  2L8J A;  3L10 B;  1K5G B;  2WH5 A;  2R09 A;  2L00 B;  2MKR A;  1FAO A;  3W1Y A;  3VAW A;  2KD0 A;  4DHJ B;  3X0W A;  1A5R A;  3CST A;  1Y5O A;  4ZDV A;  4IAP A;  1YX5 B;  1UNR A;  4GSW A;  4ANX A;  3P6A A;  2JVC A;  4WWO A;  5FI1 A;  3EFU A;  4P7I A;  1E5W A;  1P6S A;  2R2Q A;  1IYF A;  5JHG A;  2JZZ A;  4IWO A;  4GDL A;  1V5T A;  2C7M B;  2MW5 A;  4KDI C;  2CQU A;  2ZPY A;  4HXD A;  2DHK A;  1PQS A;  3EC8 A;  2J0J A;  2LVP A;  2W2X C;  1WXM A;  2PE9 A;  2Y8G A;  4HVB A;  2COA A;  2L7R A;  2BF8 B;  3KVF B;  4J6I A;  3PSE B;  1M7E A;  2M14 A;  2Z0O A;  1AQC A;  1B55 A;  3TO1 A;  2GBM A;  2H7E A;  2IO0 B;  3HQC A;  5DPS A;  3AJ4 A;  3MTN B;  2LBB A;  3I3T B;  1DYN A;  1OQN A;  1UH6 A;  2BYF A;  4FLH A;  3KUC B;  2NR2 A;  3P2B A;  1WGY A;  3TFM A;  5J3Q A;  4PS3 A;  1EGX A;  4URK A;  3HHM A;  3VUX A;  3DXE A;  3ZNG C;  1PFJ A;  2MBO A;  2KWV B;  3PRE A;  2C5L C;  1P1A A;  2PEA A;  4FA6 A;  1WXA A;  3RZW C;  3ULB A;  4WSF A;  3WA0 A;  5DPW A;  3M1I B;  4NSW A;  1WR6 E;  3ZTD A;  1CMX B;  1HE8 A;  1RFA A;  2AYO B;  5D2M B;  5FR6 A;  2IY0 B;  5HE3 A;  3SU8 X;  3PT2 B;  3A9J B;  1W1H A;  1QC6 A;  4HJK A;  3FEH A;  3GYP A;  3WYF B;  1WJ4 A;  2D4Q A;  2KK8 A;  2KMC A;  1HBK A;  2W9N A;  1P0R A;  5IAA C;  4D0N B;  4GOC A;  2CB8 A;  5KCV A;  3SUZ A;  2FDQ A;  2Z0P A;  3MDB C;  2GBN A;  1UGM A;  4XZ4 A;  3UIO B;  2O2V A;  5G55 A;  3VUW A;  4A6F B;  1WM3 A;  1W1D A;  1X1F A;  2JP2 A;  1ZGU B;  4DX8 A;  2I5F A;  1U5D A;  3QJZ A;  1R4N I;  4K7U A;  3V61 A;  4A3O A;  4FAD A;  2RGN B;  2L1C A;  3VFK A;  4II2 B;  1FHX A;  3U8Z A;  2E2X A;  3BJI A;  2DYB A;  4MSQ B;  1J8C A;  1LW3 A;  2FJ9 A;  2NMB A;  4FBJ B;  2W2W A;  2LG1 A;  1P9D U;  5D3V A;  2Z0Q A;  4A6H A;  1WE6 A;  3QWM A;  1ST7 A;  2FUH B;  2Z0E B;  4W9G A;  1UNP A;  2ZCB A;  3SD5 A;  5GOW B;  1DDM A;  2K8B A;  2ABD A;  4CHM A;  3PRZ A;  1UBQ A;  1NVL A;  5GMV A;  2MBQ A;  2D9Z A;  4XWX A;  3WAM A;  4HAZ B;  1KZG A;  1NDD A;  3VIA A;  3PV1 A;  2UZS A;  4G3X B;  1KJT A;  1OTR B;  3AUL A;  1LXD A;  1WXS A;  2LUL A;  2NCN A;  2O2V B;  4ZRI A;  3PLV A;  4FJZ A;  1P3R A;  3ZLZ A;  2A4Z A;  3ODX A;  3ZRC A;  2P0D A;  3SHQ A;  5IA7 A;  4PNK A;  2LWP A;  1OGW A;  1Z2M A;  1MG8 A;  2DZK A;  5G2N A;  4BFR A;  3K9P B;  1EAZ A;  4FHJ A;  4F7U P;  1XQQ A;  1V49 A;  1MK9 B;  1WJN A;  4IM2 A;  3UQA A;  3V6C B;  3DBL I;  2KUP A;  3L16 A;  4NQK E;  4BVU C;  3JSV A;  2K8C A;  3CSF A;  3PZD A;  3VOQ A;  3KZ1 A;  1WMH B;  3MJW A;  3KUD B;  3N30 A;  1UBI A;  3IG3 A;  2OOB B;  2QHO A;  3OAW A;  3UF8 A;  3APD A;  4KHO A;  2RPQ A;  2DX5 B;  2XK5 A;  4BKS A;  2I5C A;  3M63 B;  3ML4 A;  4BBN F;  4EMO A;  2ZVO A;  3OAN A;  1S3S G;  3CF6 E;  3ZW3 A;  2DTC A;  1Y8R C;  3VTW A;  3ZVR A; 
#chains in the Genus database with same CATH topology
 4YTP B;  2LRW A;  1J7A A;  4DDG D;  2MFQ A;  2K8E A;  3FKY A;  5AEK B;  2OHF A;  3U52 E;  4MJS A;  1KH0 A;  2G9H D;  2KXJ A;  1BML C;  3A1Q B;  1TIF A;  1E10 A;  1GG3 A;  1C3T A;  1MIZ B;  3RNG C;  4GLS C;  3FIL A;  2N9P C;  3QBV B;  1ZM0 A;  1KZ7 A;  1FNU A;  2EEL A;  1WVH A;  3PS6 A;  2MSE D;  2DIK A;  1RLF A;  2RRF A;  4K7W A;  2DX5 A;  1FHW A;  1YJI A;  5C3J B;  2KWC A;  3DQV A;  2UZR A;  4E3C A;  3NW8 A;  4BKG A;  2L0F A;  3VH4 B;  1XD4 A;  1WGU A;  3PLU A;  4ICV A;  2BB5 A;  2RSG A;  4D6W A;  4P1B C;  2ZNV C;  2IBI B;  3QAR A;  2FJL A;  1MFW A;  2KJR A;  4EFO A;  2DZJ A;  3VHT C;  1T5X D;  1JAL A;  2N9E B;  1Z87 A;  4MEM A;  3PEG A;  2WXG A;  3W1S C;  3H8H A;  1KBL A;  1T6B X;  2KC1 A;  1E8Z A;  3Q8C A;  2Z0D B;  2NTT A;  3IT6 B;  2KN5 A;  1OY2 A;  5CTR C;  2J59 M;  4FUL A;  2LVQ A;  5I4D A;  3NJT A;  3FC4 A;  4KDL B;  2HJ1 A;  1YIW A;  2QC8 A;  2LGD A;  3N20 C;  5D3W A;  4A8X C;  3R66 C;  2YEP B;  3A98 B;  3PRM B;  1YN4 A;  4OZC A;  3T3N A;  2FUG 1;  2BS2 B;  3Q8E A;  1QT9 A;  4NJ6 A;  1CJE A;  1YJJ A;  1ZKH A;  1F52 A;  5JLJ B;  2DYQ A;  2COF A;  1V2Y A;  2IY1 B;  1V86 A;  1NBF C;  5FI0 A;  2XK5 B;  4RFB A;  2YS1 A;  4FN2 A;  2J0M A;  3AE4 B;  1BTK A;  3VUY A;  4A6F A;  4HLE A;  5LOP B;  4JWU C;  2RNR B;  2E6X A;  2N7J A;  2K0P A;  1V8C A;  1WJU A;  3T06 A;  3TVV A;  3Q3J A;  2NBV A;  1UEF A;  1DOI A;  2WX0 A;  1K50 A;  4GDK B;  2LJ5 A;  1VD2 A;  1WM2 A;  4LJP B;  1UNS A;  3O13 A;  4HPP A;  4HPM B;  4HWI B;  2ROZ B;  5DHF B;  5EE0 A;  3ZNH B;  3HK0 A;  4OT1 A;  3L08 A;  2LD9 A;  1WSP A;  3PHX B;  5EDS A;  4M0W B;  4G50 A;  3AM9 A;  1ZXI A;  2K6Q A;  2GLS A;  1K8R B;  3HRD D;  4KSL C;  1HEZ E;  2WXO A;  4BKT A;  1TKE A;  2JU6 X;  2DYN A;  1ZW7 A;  2CHW A;  1AN8 A;  3NHE B;  3NZS A;  1HZ6 A;  4REZ A;  4AP4 C;  2KLG A;  4XWT A;  4AJW A;  2HE7 A;  3P4Q B;  2O6V B;  2N1V A;  3AMZ A;  3AU4 A;  4MK0 A;  3B08 A;  4LK0 M;  4ILG B;  1ZC3 B;  2PE6 B;  3KYC D;  3FVC A;  3ZRF A;  2BYT A;  4HRO A;  1K52 A;  4WAA A;  3TEZ A;  2DKQ A;  1T0R C;  2R2O A;  3GOE A;  1OEY J;  1E7U A;  1EF1 A;  2MJ3 A;  4NAM A;  3ZKJ C;  1DGJ A;  4BZA A;  3G9W A;  1PFD A;  2CHZ A;  1WGG A;  4JK9 A;  3DVG X;  4LNO A;  3BY4 B;  3P1M A;  3FP5 A;  1UF0 A;  4JK7 A;  4HAW B;  1U5G A;  2AQ3 B;  1ZC4 B;  3RD2 A;  4C7Z A;  1I7H A;  1F0Z A;  2L0T A;  4QAY A;  3VR8 B;  2D11 A;  5D94 A;  2LUM A;  2VRR B;  5EE1 A;  4YXD B;  1SGH A;  3GP7 A;  3NZU A;  4Z2N A;  1IBX A;  2B3A A;  1R4M I;  2C7H A;  2M0A A;  3QQ8 B;  1L7Y A;  3ABV B;  4HAV B;  2KFJ A;  4W9C A;  1UUP A;  1QQG A;  5L83 A;  2KQ4 X;  2Y5P A;  2M0X A;  3WAP A;  1I4H A;  2WYQ A;  2A5U A;  2L2I A;  1GB1 A;  1X1M A;  5AZH A;  2GMI C;  1C76 A;  2IGG A;  2OQB A;  3PRP B;  3UIP B;  3CIK A;  2REX A;  3QC8 B;  4KGT A;  1J0W A;  3BK1 A;  1TBE A;  2ZVN A;  2DZI A;  3A58 A;  4HAT B;  1B1Z A;  2MJE A;  2KUQ A;  4L6E A;  2MLB A;  1L0Y B;  3I63 C;  2J4X A;  4F1S A;  5C2T B;  5H92 C;  3CXB B;  1Q5W B;  5JXV A;  3AB5 A;  1J19 A;  2Y5C A;  4XC2 A;  2H89 B;  3EFC A;  4KVG B;  3ZNI D;  4W9D A;  3H7P A;  2KZR A;  1UEL A;  1XXG A;  3U7D A;  2ELB A;  1EWY C;  1D5Z C;  1V5U A;  1PYW D;  2P0H A;  2ONQ A;  1H4R A;  5J3T A;  1JDE A;  2M8S A;  2FCQ A;  5JP4 A;  4C00 A;  3I5J C;  4OZB A;  1CQV A;  5J3Y A;  1HTO A;  1VJK A;  4IWQ A;  4PYU A;  4E74 A;  3IAS 1;  3TMP B;  5AUK A;  1DBH A;  2RR9 A;  1GC7 A;  3ZVV A;  4JE3 B;  2BWE S;  3GZN B;  2R61 A;  1OEY A;  3R2T A;  5BYQ A;  2JZ3 B;  4NAW B;  4PQ0 A;  1QOG A;  3ALB A;  3B9J A;  1C4P A;  4J3O D;  4JPS A;  4BKS D;  2RPV A;  3DVG Y;  4HB2 B;  2PIA A;  4LNI A;  2QKM A;  4RGM A;  1U27 A;  3PPA A;  2YSZ A;  3AE3 B;  3WAN A;  2JT4 B;  5BO4 B;  3RPF C;  3FLV A;  1FXT B;  1NTI A;  2WX1 A;  4MDK E;  4R3D A;  3F0W A;  3ZDT A;  2IO1 B;  4OZA A;  4YSY B;  1XX0 A;  4C4V B;  1N5W A;  1D4B A;  2ELA A;  2X18 A;  1KOT A;  4LLG M;  4KHB A;  5HFY A;  5J17 A;  1LQB A;  4CO7 A;  4TUU A;  2EMT A;  1T0Q C;  1DOY A;  4EZK A;  2P0F A;  2DLB A;  4WWM A;  3VTU A;  2SEB D;  4DHZ E;  2G4D B;  2C9W B;  3TW1 A;  1JWA D;  4LTU A;  1L4Z B;  3H7P B;  3IFW B;  2D9V A;  2K49 A;  1R4N B;  2MP2 A;  4GMX B;  1WH3 A;  2LOZ A;  1YJ1 A;  4CHJ A;  4A3P A;  1VBG A;  4CYE A;  1AWE A;  3GZN I;  3PSC A;  5KHQ A;  4DHJ D;  3SNH A;  1K53 A;  4TV3 A;  2K00 A;  3APC A;  3EA6 A;  2JYT A;  2MWN B;  3OHM B;  3J9C A;  2L00 B;  4DHJ B;  3X0W A;  1Y5O A;  2MJD A;  1JWB D;  4GSW A;  2BTE A;  3LXF A;  3V05 A;  5FI1 A;  3EFU A;  4XDC A;  4US8 A;  1IYF A;  2W54 A;  2C7M B;  2MW5 A;  2ZPY A;  4HXD A;  2Y8G A;  2COA A;  4USA A;  4J6I A;  1WRI A;  2CJO A;  2IO0 B;  1M7E A;  4L1B A;  1NYQ A;  3I3T B;  3P2B A;  3DWM A;  2V3N A;  3VR9 B;  4S0R A;  2WS3 B;  1SF0 A;  2PEA A;  3ULB A;  4WSF A;  2WU5 B;  4EE2 A;  1RFA A;  5D2M B;  1XLQ A;  4ZRQ A;  3FEH A;  1WJ4 A;  3WYF B;  2KK8 A;  1HBK A;  5IAA C;  1JRP A;  5KCV A;  4P16 A;  2GBN A;  3ENB A;  1UGM A;  2O2V A;  3E9S A;  4A6F B;  2DBY A;  1X1F A;  4DX8 A;  2I5F A;  1R4N I;  4K7U A;  1D6E C;  4FAD A;  2RGN B;  4QJ5 B;  4II2 B;  4OSN A;  4MSQ B;  3ETR A;  3DBR I;  5D3V A;  3QWM A;  1C78 A;  4ANV A;  1UBQ A;  5GMV A;  2MBQ A;  4XWX A;  2KAJ A;  3ZXV A;  4JWS C;  2CU3 A;  1LXD A;  1WXS A;  4FJZ A;  2NCN A;  1R4M B;  1P3R A;  3ZLZ A;  4UDU C;  3SHQ A;  1OGW A;  1MG8 A;  1JML A;  5G2N A;  4BFR A;  2JZP A;  1XQQ A;  1V49 A;  2JSV X;  3DBL I;  2K8C A;  3VOQ A;  2GUM A;  1QOA A;  3P4P B;  1UBI A;  3P4R B;  4BBN F;  4EMO A;  4ZOH C;  1S3S G;  3ZVR A;  3U12 A;  1E7V A;  1AAR A;  1SJE D;  4YSX B;  4K3B A;  1YOV B;  4EJN A;  1UD7 A;  2QMT A;  3IT4 B;  5EE3 A;  1XD3 B;  3HM3 A;  3CMM B;  1U29 A;  4NPN A;  4IDI A;  3AE1 B;  3PVU A;  2KHW B;  2INP E;  1I42 A;  1U2B A;  2BYE A;  2L1A A;  3D8E A;  1CK1 A;  3UQB A;  2M1M A;  1H10 A;  1XLO A;  1SIF A;  3RN9 C;  1TJ6 A;  3Q8F A;  3W5U B;  1DDW A;  5JH5 C;  1MIX A;  3B1L X;  1SE2 A;  3BVM A;  4EKU A;  2LMC A;  4LDT D;  2H7D A;  4ANW A;  5IN7 A;  5IJM A;  5G5H A;  3T3O A;  1NI2 A;  1WX7 A;  2V3P A;  4IM3 A;  3ECI A;  3EEC A;  2V0G A;  3ZIM A;  3QCA A;  2V76 A;  2BB6 A;  2J52 A;  3DHG C;  1FB8 A;  4RM8 A;  3TBL D;  3EPY A;  2RMM A;  2WXM A;  2OED A;  3RYT A;  3C19 A;  1XCT L;  1FXA A;  1F2R I;  3PVW A;  3X23 A;  4XYC A;  2PW9 A;  4M02 A;  5DIF B;  4MGY E;  2KC2 A;  1G6J A;  2KTR B;  1K5D B;  2N9X A;  1SHC A;  1WIA A;  1KF6 B;  1SE4 A;  4ZHO A;  1TS2 A;  3PG7 A;  1TKY A;  3A4R A;  2NZ8 B;  2CY5 A;  3HM6 X;  5CHV C;  4G11 A;  1R7S A;  1HB8 A;  4M01 A;  2HRJ A;  2H88 B;  4KX6 B;  2OJR A;  1BXT A;  2KO3 A;  1PMS A;  2PVG C;  2EJ8 A;  2B76 B;  4YWG G;  4RGN A;  4RF0 A;  2VRW B;  2YRY A;  2L05 A;  3DVN U;  3Q3F A;  4HKZ E;  3N9Y C;  1L0V B;  3ULC A;  2ZKM X;  3N3K B;  4BOS C;  4DWF A;  2DFK A;  1D5M C;  4ARC A;  2HJ8 A;  2Q13 A;  4ILJ A;  1E7P B;  1QIL A;  1E8W A;  1NVI D;  3MC9 A;  4X57 B;  2FCN A;  3RNF C;  3K9O B;  4DX9 0;  3HIE A;  2LXC A;  1EVH A;  3JSV B;  4BKS A;  3LJ3 A;  3ZJV A;  3WCQ A;  1TJE A;  2KMA A;  4WJN A;  4LNK A;  2W2X D;  2D3G A;  2LEK A;  1C9F A;  1WZ0 A;  1M4V A;  3KY9 A;  1ZSQ A;  1TY0 A;  2C7N B;  5E6P A;  4L1R A;  2WLB A;  2ADZ A;  2DKP A;  4KHB B;  2GJY A;  3R3M A;  5AZG A;  4GGQ A;  2COP A;  4DQO C;  4WJP A;  2VZK B;  4M8N A;  2ZJD A;  4HCN B;  4TKN A;  4S17 A;  3AE8 B;  2L76 A;  1IP9 A;  2BWF A;  4JLC A;  2KNB A;  1XCQ L;  1X05 A;  3H6N A;  2G1E A;  1V88 A;  4ASW C;  2KMM A;  1S1Q B;  1GUA B;  5BYS A;  3VTV A;  3RNC C;  2CRF A;  5BMG A;  3P7Z A;  4XE0 A;  2MRP A;  2DLW A;  2LYD A;  4TMA B;  3VH3 B;  4FJY A;  5KHO A;  3RUL A;  4PS8 A;  1V6E A;  4W9F A;  1XF5 L;  4JQW C;  4QJ3 B;  2COD A;  2PJH A;  4RMA A;  2MQJ A;  2PKO A;  3A8Q A;  1BT0 A;  5LON B;  5CHF A;  5CLQ B;  2GS0 A;  1UNQ A;  2KAN A;  4RM9 A;  2WDQ B;  4GNK B;  3ZDM C;  3ZUN A;  1GJZ A;  3APF A;  2Z59 A;  3DXC A;  1L6V A;  2Z59 B;  1RRP B;  2EKE C;  1TQZ A;  1V81 A;  1FGZ A;  4GB9 A;  2HDE A;  4D2K A;  1F2R C;  5I2M A;  1X11 A;  4K7S A;  2HTM E;  5HKH A;  3PO0 A;  3B0A A;  2YT1 A;  2I2Y A;  2BKR B;  2G35 A;  1EU3 A;  1U5E A;  3IBE A;  3W9C B;  3TEX A;  2K2J A;  4OVV A;  1JWS D;  2Y5B B;  5JHH A;  2IO3 B;  4K2O A;  2KDF B;  2AEH A;  3RZF A;  1AYF A;  4OHJ A;  3ZTC A;  3TEY A;  2BYV E;  3QA8 A;  4YSZ B;  3ZO5 B;  3Q3N C;  3GYO A;  1UZX B;  1NEK B;  1IBX B;  2JQR B;  2KFK B;  2DYO A;  4CSQ A;  4LNN A;  1MKE A;  1VZ6 A;  4A5K A;  2QKL A;  4GXB A;  3VDZ A;  3KLS X;  4ZRJ A;  4DXA B;  2Y8F A;  5C5B A;  2WXL A;  1WF9 A;  4MGK E;  3N1X C;  4I6L B;  1T0Y A;  3QIJ A;  1WR1 A;  4FHK A;  3L4P A;  2YF0 A;  1YX6 B;  3U2S C;  4GU2 A;  4B95 A;  2KTR A;  3DPD A;  3IHP C;  2I1J A;  2RUK B;  1NI3 A;  2KX3 A;  1WGR A;  3L17 A;  3PGE A;  2YVC A;  2INC C;  5FKA C;  2BVC A;  2KT7 A;  1Y19 B;  1C79 A;  4MH0 E;  3Q2A C;  4W9H A;  3MP9 A;  4K1R B;  2GBR A;  1OMW A;  5C5B B;  4GPT B;  2R0D A;  1PGB A;  3VXW A;  4WIP A;  1WYG A;  2KTF A;  2JPH A;  4FXC A;  4HCP B;  4MGI E;  5C16 A;  2DX1 A;  1WYW B;  1EO6 A;  1FO4 A;  1FRD A;  2BQQ A;  1CZP A;  4GOU A;  3HUI A;  2QSD A;  3ODO A;  3A33 B;  3D8D A;  3DCG A;  4MM3 B;  4PS7 A;  2X0S A;  2LZ6 A;  3GB1 A;  2D9W A;  4AWJ A;  5I2S A;  1MPE A;  3VVW B;  1BWN A;  1VBH A;  1UWX A;  1IPG A;  1TZO A;  1SE9 A;  3KSY A;  5JHA A;  1GC6 A;  5FK9 C;  2DA0 A;  2MWS B;  1C1Y B;  2UYZ B;  4JKG B;  4JGH B;  4AS1 A;  1UPQ A;  2DN6 A;  1ZPS A;  2Z14 A;  2RQ1 A;  5KQ1 A;  4ZRK A;  3DHH C;  1HTQ A;  1N63 A;  2NTS A;  1LB1 A;  2AWT A;  2FCS A;  1PGA A;  2R09 A;  2I38 A;  2MKR A;  1FAO A;  4MAC A;  2KD0 A;  1A5R A;  3CST A;  4IAP A;  1UNR A;  3P6A A;  4WWO A;  4P7I A;  3IAM 1;  4JX1 C;  2R2Q A;  4RGT A;  2J0J A;  2LVP A;  2W2X C;  1V1P B;  1WXM A;  2PE9 A;  4US9 A;  1ZDV A;  3KVF B;  4LDT B;  3MTN B;  2LBB A;  2LGS A;  5MPO A;  2NR2 A;  1WGY A;  5J3Q A;  2KDM A;  3CWI A;  3HHM A;  3MC8 A;  4KKJ A;  3VUX A;  3NVY A;  3PRE A;  4JKD A;  1P1A A;  1QQR A;  1WXA A;  5DPW A;  5FR6 A;  1T0S C;  1EU4 A;  1STE A;  3A9J B;  1W1H A;  1LGR A;  4HJK A;  3GYP A;  2W9N A;  4RGO S;  4GOC A;  3SUZ A;  2Z0P A;  3MDB C;  4XZ4 A;  3UIO B;  4BAX A;  5G55 A;  3C8Y A;  3V61 A;  3QJZ A;  4A3O A;  3DWG C;  1MJD A;  3VFK A;  2L1C A;  2AQ2 B;  2JYE A;  4FBJ B;  2W2W A;  5AZF A;  4W9G A;  1ST7 A;  2ZCB A;  1DDM A;  2K8B A;  5HHD G;  3PRZ A;  3WAM A;  1PDX A;  3Q6B A;  1KZG A;  4HSI A;  3VIA A;  1NDD A;  2UZS A;  3AUL A;  2O2V B;  2LUL A;  3ZJU A;  1QLB B;  1VDV A;  2AX5 A;  2A4Z A;  3ZRC A;  3NS1 A;  5IA7 A;  4PNK A;  1ZOY B;  3K9P B;  1EAZ A;  4FHJ A;  3GE8 C;  1HA5 A;  3TSS A;  1WJN A;  2RDH A;  3UQA A;  3AEB B;  2XNA C;  4CQN A;  2KUP A;  3L16 A;  4NQK E;  2BS4 B;  3JSV A;  1L6U A;  3KZ1 A;  4ZHP A;  3KUD B;  3N30 A;  2XN9 C;  2OOB B;  2QHO A;  3IG3 A;  3OAW A;  3RI7 C;  1FPY A;  3M63 B;  3ML4 A;  1T77 A;  2WU2 B;  1MK7 B;  2LI5 A;  1YN3 A;  4IG7 B;  5GXG B;  3NSU A;  3KW5 B;  1EF5 A;  3D8F A;  4EUT A;  1E6E B;  1N3H A;  2O6V A;  2KDE B;  1SSN A;  2WXQ A;  1WRD B;  3BWU D;  2HTH B;  1VR9 A;  4NY0 A;  1WFY A;  2SAK A;  4LJO B;  2RVB B;  1XOD A;  2KVZ A;  3L0W B;  5C6R A;  1V89 A;  3B2G A;  5JHB A;  4TYZ A;  2CY4 A;  1TGZ B;  3F5R A;  1J0G A;  4MJS B;  2K22 A;  2DAJ A;  2FAZ A;  1TKG A;  4TQ0 A;  1I4Q A;  2K39 A;  4A20 A;  4KGS A;  3E56 A;  1U5F A;  3SEB A;  1JRU A;  2Z8L A;  2MDX A;  4JKE A;  3NOB A;  2IJ0 A;  4HB3 B;  1WGQ A;  2AQ1 B;  1L4D B;  2UU7 A;  3BIN A;  4HRS A;  2G4S A;  4GIV A;  1YN5 A;  2M4N A;  1YD8 U;  2CJN A;  3MHS D;  1L5P A;  1YMH E;  2IND C;  2KDB A;  5DPR A;  1N6Z A;  2K1F A;  5D6J B;  4EOY A;  4H8S A;  3KWV A;  2YS5 A;  3WAO A;  4EZL A;  1ZDX A;  3KH0 A;  3SO6 A;  1TY2 A;  3HVD A;  5L95 C;  1JCK B;  2BPS A;  2K2U A;  4EZJ A;  4IUM B;  3ZJT A;  1ACA A;  5M4Y B;  3AEA B;  3RFZ B;  2KJ6 A;  3BK2 A;  2COC A;  1FCL A;  3WAL A;  4B6W A;  3MHZ A;  2WP9 B;  3AE2 B;  2YLM A;  1WJ1 A;  2MEK A;  2LXA A;  3P42 A;  3PTF C;  1V5O A;  1KLV A;  2VZK D;  5C79 A;  4GDL B;  4AUQ C;  2FCM A;  3S2A A;  2GCL A;  3KUZ A;  4DBB A;  1BUI C;  1FHO A;  4DHZ B;  1KC7 A;  3OJ3 A;  2IFS A;  1U4A A;  2L52 A;  1UGJ A;  1F1H A;  2DHZ A;  1P98 A;  2LAS A;  4GDK A;  2QDF A;  2EC1 A;  4A90 A;  2J7Q B;  4ICU A;  2J0K A;  3AH7 A;  3EUB 2;  3M95 A;  2FID A;  2ROV A;  2NPT B;  3AE6 B;  4K81 A;  2KWU B;  3AV8 A;  3E9O A;  3V6E B;  2Y3A A;  4HAX B;  4HAY B;  2MBH A;  2Y7B A;  2ZNV B;  3NVZ A;  3UIN B;  1ZE3 D;  2WDT B;  2N7D A;  2WDV B;  3E9L A;  5HG2 A;  3P4S B;  5BMH A;  3SBG A;  2BW2 A;  2YS3 A;  3A1Q A;  2BBC A;  3A9J A;  2N23 A;  3D32 A;  2K25 A;  1P3Q U;  1ACC A;  3RT3 B;  1TZ1 A;  4HDQ A;  1L2N A;  1IGC A;  1RYJ A;  4MY6 A;  3OJ4 B;  4GZU A;  3UGB B;  5C1Z A;  1EWC A;  2YT0 A;  2YEP F;  2JF5 A;  3DCX A;  5LNK 1;  4JL9 A;  3Q8A A;  3PZ7 A;  3TJP A;  3V60 A;  4HB0 B;  2LFI A;  4KZ0 A;  2W82 A;  3BYT B;  3RNB C;  4B6H A;  4DXG A;  3V62 A;  3MPX A;  1RAX A;  3AN1 A;  4GMV A;  1XO3 A;  3RUI B;  4JK8 A;  2VSZ A;  2ZZP B;  2KVR A;  1AW7 A;  2WQY B;  4M00 A;  4HDO A;  5T8I A;  2ZCC A;  1QKZ A;  1ROE A;  4B9K A;  4CHK A;  3UZT A;  1L0X B;  3H1U A;  4PK1 A;  1SE3 A;  1HB6 A;  1WXQ A;  3PHW B;  4KIK B;  4KIK A;  3ZYY X;  4P1C C;  3W2D A;  2OTX A;  2K8H A;  2VH2 A;  2MH7 A;  1N5X A;  1LFD A;  4W9J A;  4XGA B;  2WXJ A;  2IPK D;  1J7C A;  2NVU I;  2ZW0 A;  2UVM A;  1QOB A;  1FNW A;  3SFD B;  1SJH D;  2Q5W D;  1WI1 A;  4ZYN A;  3AU5 A;  2N0Y A;  2DZM A;  1Q10 A;  5D3Y A;  3AE7 B;  2D9X A;  2MP2 B;  4IOY X;  4HEA 1;  1UPR A;  4WQM A;  4HAU B;  3A9K B;  2NBV B;  2CR5 A;  4C4V A;  1Q67 A;  3NUH B;  2IDY A;  1FRR A;  3JVZ X;  2ZPN A;  1XR0 B;  1H8C A;  3V5W A;  5EE9 A;  5LXI B;  1IUE A;  4IM0 A;  1J7B A;  4BOZ B;  4K17 A;  3TIX A;  3E66 A;  2KFK A;  2XBB C;  2NBW B;  1UWM A;  2V4L A;  4YT0 B;  1SXT A;  2QIL A;  1ZXH A;  1F9J A;  1XKE A;  5LG4 B;  2ASQ A;  2ZW1 A;  4II3 B;  3FSS A;  1WE7 A;  4TQ1 A;  4JKF A;  1FGY A;  1P7F A;  2N9K A;  4HKQ A;  2WXF A;  4LCD E;  3NWD A;  3QAQ A;  1X1G A;  2GBK A;  3R8B A;  1FFU A;  2BKF A;  4KKI A;  3O65 B;  1I4G A;  3QHT A;  2LUE A;  3QX1 A;  2LKO A;  4A6K A;  5CX3 A;  1N61 A;  3GE3 C;  4F7G A;  1ET6 A;  2IYD B;  2JRH A;  2KQS A;  5DHA B;  4N6E B;  2AL6 A;  1RRB A;  2JXX A;  2LGY A;  3ZQ4 A;  2IYB A;  5DH9 B;  3BYY B;  2ON8 A;  1ENF A;  4HB4 B;  1BAK A;  2L32 A;  2GB1 A;  1VZ8 A;  4MGZ E;  3A9K A;  5D3D A;  2LHE A;  1YQB A;  2AL3 A;  2FE8 A;  1KI1 B;  2X38 A;  1OQR A;  3KRX A;  2Z13 A;  1GPX A;  4KZC A;  2WNM A;  2FNJ B;  2WXN A;  3C0R B;  4W9I A;  3TL5 A;  1HQR D;  4JKA A;  3SR6 A;  3WIM A;  2KQ7 A;  1C77 A;  5BYR A;  4HJG E;  3BII D;  3IXS A;  3ONS A;  3DBR B;  1NEN B;  1FOE A;  5L81 A;  3FIL B;  2DHI A;  3L10 B;  4F7H A;  1DRO A;  2WH5 A;  3W1Y A;  3VAW A;  4JKB A;  4ZDV A;  4ANX A;  1YX5 B;  2BT6 A;  1GOZ A;  2JVC A;  1E5W A;  2JZZ A;  4IWO A;  1V5T A;  2DHK A;  2N0S B;  4OW0 A;  3PSE B;  2Z0O A;  1JRO A;  3SBT A;  1AQC A;  1B55 A;  1JWU D;  2H7E A;  2D3A A;  3BVG A;  5DPS A;  5TSS A;  3AJ4 A;  1DYN A;  1OQN A;  2BYF A;  2QCZ A;  4N58 A;  3KUC B;  1B9R A;  2BS3 B;  1EGX A;  4URK A;  2PVO D;  1SB3 C;  1PFJ A;  4DIX A;  2MBO A;  5JVL A;  2YT2 A;  1JW9 D;  1TT5 B;  2C5L C;  2WXI A;  4K3C A;  3MFG A;  3NZ3 A;  1HXY D;  4NSW A;  3EGR A;  3DBL B;  1CMX B;  3SU8 X;  5HE3 A;  1SIJ A;  3PT2 B;  1QC6 A;  4WAF A;  1P0R A;  1YQ4 B;  2CB8 A;  4ANU A;  2FDQ A;  3AE9 B;  3VUW A;  2D5G A;  1SBB B;  1LO5 D;  2DYB A;  1GAQ B;  1LW3 A;  2FJ9 A;  2NMB A;  2LG1 A;  1P9D U;  4A6H A;  2Z0Q A;  2Z0E B;  4L23 A;  2ICI A;  3NRZ A;  5GOW B;  2ABD A;  4CHM A;  4HAZ B;  1A70 A;  3PV1 A;  4G3X B;  5IRS A;  3PLV A;  1OTR B;  5E6N A;  3ZGZ A;  2GI9 A;  3ODX A;  2P0D A;  4LNF A;  1FEH A;  2LWP A;  2QEJ C;  1Z2M A;  2WXP A;  3HSA A;  4C7Y A;  4F7U P;  1MI1 A;  1PUT A;  4RF1 A;  2L83 A;  3V6C B;  2KYW A;  1MVK A;  4BVU C;  1WMH B;  3V3X A;  2JX5 A;  2RPQ A;  2I5C A;  1QF6 A;  2ZVO A;  3CF6 E;  3VTW A;  4BBN C;  1WJ6 A;  1GNU A;  2LGX A;  3NY5 A;  2R2Y A;  3NVW A;  3HIZ A;  2FBW B;  2NPT A;  4MSM B;  1MHX A;  1ZVR A;  1V5P A;  2N4F A;  4GN1 A;  2WWZ A;  4N9F 4;  2CKH B;  2BCJ A;  1FCC C;  5E6J A;  2MCN B;  3HW2 B;  1W1G A;  4IC7 B;  1VCB A;  3B2F A;  2KX0 A;  4YON A;  4ILH A;  1SEB D;  2L3Z A;  3DVN V;  3RNE C;  1FNV A;  3GS2 A;  1WMH A;  2K5P A;  1PLS A;  5HI1 A;  1YQ3 B;  4P6V F;  3AI5 A;  3DOW A;  2WGS A;  2PMV A;  1NTY A;  2QIE B;  5JZE B;  3VQI A;  3L54 A;  2MA9 B;  3L13 A;  2C60 A;  4WJQ A;  4L2Y A;  2JWZ A;  2Z4D A;  4I6N B;  2KGX B;  2HTH A;  2IO2 B;  2E3T A;  2PTL A;  2ACZ B;  4XWW A;  2VKI A;  1ET9 A;  4NZL B;  4XDD A;  2PPH A;  2LVO A;  3DBS A;  1QOF A;  2IZV B;  4WUR A;  1XLP A;  1M94 A;  5DI9 B;  1I2H A;  4N59 A;  4IW0 A;  2M19 A;  2CS4 A;  3VRB B;  4EEW A;  3DXD A;  3E9P A;  2PZ1 A;  3TUO A;  5D27 A;  2D10 A;  1E8Y A;  3M3J A;  5DCN A;  2D07 B;  3NVV A;  1DDV A;  4AOF A;  1XEE A;  2EKI A;  2I1K A;  1E90 A;  4TSS A;  1DOX A;  1KTK A;  4XX5 A;  3FM8 C;  3QWZ B;  1D3Z A;  1DYQ A;  4G0N B;  4OVU A;  1MPH A;  4DK5 A;  4Q2J A;  2XEW A;  4WWP A;  4IFS A;  2D3C A;  2KCJ A;  1AWD A;  1KM7 A;  5LLI A;  1M7R A;  5BMI A;  2O6V D;  3KRW A;  4H2A A;  3EHV A;  1WY8 A;  4DBG A;  3NWA A;  3Q8B A;  2LGI A;  3AEG B;  5IO9 A;  4MM3 A;  4RCO A;  3N1Y C;  1OQY A;  1GGO A;  2DYM A;  3AEF B;  1WX9 A;  4A55 A;  5HE1 A;  2V4I B;  4IKG A;  3AXC A;  3TEW A;  4MH8 A;  4KSK C;  1V9J A;  2KJH B;  3OLM D;  2GRI A;  2M17 A;  1TYG B;  3AED B;  2KWD A;  4AQ7 A;  3H9D A;  3I9V 1;  4WQO B;  5H8Y E;  5D7G A;  3PP2 A;  2KLC A;  2JRI B;  3SDL C;  2FIF A;  1ZUD 2;  1XCG A;  1V1O A;  4K2P A;  2J42 A;  1BTN A;  1E8X A;  3A4S C;  2XQN M;  4WJ7 A;  3NS8 A;  5CLL B;  2GCJ A;  3PZ8 A;  1WXV A;  3RNA C;  3LDZ E;  1V80 A;  5DPT A;  3U4E G;  2JUO A;  5J2R A;  2KOX A;  2X8X X;  3ML9 A;  2DHJ A;  2N7E A;  5EFX A;  1I35 A;  1FM0 D;  1FIQ A;  4B0M A;  2WXH A;  3JYU A;  4E71 A;  1FFV A;  4MEL A;  2DTC A;  4MT7 A;  1WZ3 A;  2CHX A;  2EMS A;  3R2I A;  3RCZ A;  3RMK C;  2GOW A;  2IGH A;  4KV2 A;  1RJ2 A;  1NYR A;  2M38 A;  4JKG A;  2TSS A;  1DIK A;  1HZ5 A;  5KQ4 A;  2N9L A;  2P8V A;  2BGF A;  3U30 A;  1Y56 A;  4KAX B;  5TR5 A;  4YTN B;  3W1S A;  3OWE B;  2D9Y A;  4C80 A;  2V3S A;  1I7A A;  4Z2M B;  1JWM D;  4HK2 A;  1WGH A;  1MI0 A;  3DBH B;  4W9E A;  5IP4 D;  2CAY A;  1KRH A;  1OQQ A;  4A6Q A;  2ZEQ A;  2DEN B;  5HE0 A;  1YNT E;  1K51 A;  1Z5S B;  1WX8 A;  2RLO A;  4WJO A;  2RSU A;  4F7Z A;  3URY A;  1TTN A;  2MX2 A;  1ISN A;  4NQL B;  4ACF A;  2RDG A;  5D3I B;  2V1Y A;  3R7R A;  5HE2 A;  2R82 A;  4YL8 A;  1WJM A;  1V1P A;  3LYY A;  3DDC B;  2J53 A;  2D2Q A;  3MJ5 A;  3ML8 A;  1KLG D;  1N60 A;  2NBU A;  1VRA B;  4JKH A;  4A9A A;  2JXT A;  2V9H A;  1GB4 A;  1NU2 A;  1E0Z A;  4B0E A;  2DNF A;  1F77 A;  4ARI A;  3ODW A;  2RDB C;  3RCP A;  3NG0 A;  4IWP A;  4NNJ B;  3I57 A;  2W3R A;  1ZP0 B;  2LRU A;  4WH4 A;  2QJL A;  3LB8 C;  4WVF B;  4KHA A;  1V61 A;  1E9M A;  4DDI D;  2LJI A;  4FJV B;  3U7Z A;  3CIR B;  3AEC B;  2GBJ A;  3A8P A;  1WWT A;  3ENE A;  2PLP A;  2MBB B;  1LM8 B;  4ITK A;  1XLN A;  4PYZ A;  1WG7 A;  3R7Q A;  4F8C B;  1NTV A;  5D3X A;  4IOI E;  2RGF A;  3P63 A;  3N7C A;  4Y94 A;  1RWS A;  1X86 A;  3TCA A;  3O96 A;  5IKC M;  2KR0 A;  1PGX A;  1TS4 A;  1MAI A;  3M62 B;  2K6D B;  2G3Q B;  1WGD A;  1TXD A;  3B77 A;  4NJC A;  1IGD A;  3W5V B;  3KYD D;  1XT9 B;  2UWQ A;  1FMA D;  2MHJ A;  2IGD A;  2KN4 A;  4NJ7 A;  1QZE A;  2JWU A;  2W55 A;  2NS5 A;  2CU1 A;  3SV1 A;  5CHW A;  2DAF A;  4AJY B;  2KKC A;  2K9X A;  4W9K A;  4RH6 A;  1FD6 A;  4KGR A;  5J18 A;  1RFK A;  2LOX A;  2JY6 A;  4O1N A;  5LXH A;  2G45 B;  4C56 C;  3ZNZ B;  3LJU X;  2MBE A;  4BBK A;  2INN E;  3PVL A;  2M56 B;  3H7S A;  1EM7 A;  1D5X C;  4MT5 A;  1OFF A;  1Q1O A;  4JIO U;  2RD0 A;  4M8M A;  4HHV A;  3HVZ A;  3Q69 A;  3IVF A;  1IRS A;  4OVZ A;  1WGK A;  2HD5 B;  3AE5 B;  3QK0 A;  1V5M A;  3UI3 A;  1P5T A;  5AUI A;  1C4C A;  3VRA B;  3T8M A;  3SYX A;  3Q3M C;  1EUV B;  2W3S A;  4I6P A;  4C0A A;  4WWN A;  4NAW A;  1TS3 A;  3T9L A;  3KQ4 A;  1Q0W B;  1JQ4 A;  5E6O A;  1I4P A;  3JW0 X;  3Q14 C;  5C23 A;  4M0W A;  2LHD A;  1KLU D;  3Q3O C;  4ZYS A;  2KDI A;  1WI0 A;  2N1W A;  2WHI A;  3DBH I;  1V97 A;  2KAC A;  3KWL A;  3N32 A;  1RM6 C;  2L8J A;  1K5G B;  1VZ7 A;  1P6S A;  5JHG A;  1P7E A;  4GDL A;  5FR3 A;  4KDI C;  2CQU A;  3EC8 A;  1PQS A;  4HVB A;  2L7R A;  2BF8 B;  3BZD B;  2GBM A;  2M14 A;  3TO1 A;  3HQC A;  1UH6 A;  4FLH A;  2DWQ A;  3TFM A;  4PS3 A;  3DXE A;  1MHH E;  4DXF A;  3ZNG C;  2KWV B;  3ZXR A;  5G5G A;  4RNA A;  4FA6 A;  3N1Z C;  3RZW C;  1C4A A;  3WA0 A;  3M1I B;  1WR6 E;  3ZTD A;  2AYO B;  1ESF A;  1I4X A;  1HE8 A;  1T3Q A;  2IY0 B;  3DHI C;  2KMC A;  2D4Q A;  2NMQ A;  4D0N B;  2K3U A;  1WM3 A;  3BVZ A;  1W1D A;  1ZGU B;  2JP2 A;  3AEE B;  1MG4 A;  1U5D A;  2D3B A;  1FHX A;  1N62 A;  3OG5 A;  3U8Z A;  2E2X A;  2WXK A;  3BJI A;  1J8C A;  3FAH A;  1WE6 A;  2FUH B;  1UNP A;  3SD5 A;  5IOI A;  1VLB A;  1NVL A;  2OJW A;  2D9Z A;  2VH1 A;  2KIG A;  2FJU B;  4HPL B;  1KJT A;  4W9L A;  3SFE B;  4ZRI A;  1ZYI A;  4PT5 A;  2DZK A;  3NWF A;  4ZRP A;  2WXR A;  1I4R A;  1KFY B;  4QJ4 B;  1FXI A;  1MK9 B;  4IM2 A;  4YTM B;  2KIE A;  1TS5 A;  3CSF A;  3PZD A;  4JKC A;  3UF8 A;  3MJW A;  2WDR B;  3APD A;  4KHO A;  2DX5 B;  2XK5 A;  3MC0 B;  3OAN A;  3ZW3 A;  4QXA B;  1Y8R C; 
#chains in the Genus database with same CATH homology
 2LRW A;  4DDG D;  2MFQ A;  5AEK B;  4MJS A;  2KXJ A;  3A1Q B;  1GG3 A;  1C3T A;  1MIZ B;  2N9P C;  3QBV B;  1ZM0 A;  1KZ7 A;  1WVH A;  3PS6 A;  2MSE D;  2DIK A;  1RLF A;  4K7W A;  2DX5 A;  1FHW A;  2KWC A;  3DQV A;  2UZR A;  4E3C A;  4BKG A;  2L0F A;  3VH4 B;  1XD4 A;  1WGU A;  3PLU A;  4ICV A;  2RSG A;  2ZNV C;  2IBI B;  3QAR A;  2FJL A;  2KJR A;  4EFO A;  2DZJ A;  3VHT C;  2N9E B;  1Z87 A;  4MEM A;  3PEG A;  3W1S C;  1KBL A;  2KC1 A;  1E8Z A;  2Z0D B;  2KN5 A;  1OY2 A;  5CTR C;  2J59 M;  4FUL A;  2LVQ A;  4KDL B;  1YIW A;  2LGD A;  5D3W A;  3R66 C;  3A98 B;  3PRM B;  4NJ6 A;  1ZKH A;  5JLJ B;  2DYQ A;  2COF A;  1V2Y A;  2IY1 B;  1V86 A;  1NBF C;  5FI0 A;  2XK5 B;  2YS1 A;  4FN2 A;  2J0M A;  1BTK A;  3VUY A;  4A6F A;  4HLE A;  5LOP B;  2RNR B;  1WJU A;  3T06 A;  3TVV A;  3Q3J A;  1UEF A;  2WX0 A;  4GDK B;  2LJ5 A;  1VD2 A;  1WM2 A;  4LJP B;  4HPM B;  4HWI B;  2ROZ B;  5DHF B;  3ZNH B;  3HK0 A;  3L08 A;  2LD9 A;  5EDS A;  3PHX B;  4M0W B;  4G50 A;  2K6Q A;  1K8R B;  4KSL C;  4BKT A;  2DYN A;  1ZW7 A;  2CHW A;  3NHE B;  3NZS A;  4AP4 C;  2KLG A;  4AJW A;  2HE7 A;  2O6V B;  2N1V A;  3AU4 A;  4MK0 A;  3B08 A;  4ILG B;  1ZC3 B;  2PE6 B;  3KYC D;  3ZRF A;  4WAA A;  2DKQ A;  2R2O A;  3GOE A;  1OEY J;  1E7U A;  1EF1 A;  3ZKJ C;  3G9W A;  2CHZ A;  1WGG A;  4JK9 A;  3DVG X;  3BY4 B;  3FP5 A;  4JK7 A;  4HAW B;  1U5G A;  3RD2 A;  1ZC4 B;  2L0T A;  2D11 A;  5D94 A;  2VRR B;  1SGH A;  3NZU A;  4Z2N A;  2B3A A;  1R4M I;  2C7H A;  3QQ8 B;  1L7Y A;  4HAV B;  2KFJ A;  4W9C A;  1QQG A;  5L83 A;  2M0X A;  3WAP A;  2WYQ A;  2A5U A;  2L2I A;  1X1M A;  5AZH A;  2GMI C;  2OQB A;  3PRP B;  3UIP B;  3CIK A;  2REX A;  3QC8 B;  1J0W A;  1TBE A;  2ZVN A;  2DZI A;  4HAT B;  4L6E A;  2MLB A;  4F1S A;  3CXB B;  1Q5W B;  1J19 A;  4XC2 A;  4KVG B;  3ZNI D;  4W9D A;  3H7P A;  2KZR A;  1UEL A;  3U7D A;  2ELB A;  1V5U A;  2P0H A;  1H4R A;  5J3T A;  1JDE A;  2M8S A;  2FCQ A;  5JP4 A;  5J3Y A;  4IWQ A;  4PYU A;  4E74 A;  3TMP B;  1DBH A;  2RR9 A;  1GC7 A;  3ZVV A;  2BWE S;  1OEY A;  2JZ3 B;  4NAW B;  4PQ0 A;  3ALB A;  4BKS D;  3DVG Y;  4HB2 B;  2QKM A;  1U27 A;  3PPA A;  2YSZ A;  3WAN A;  2JT4 B;  5BO4 B;  3FLV A;  1FXT B;  1NTI A;  2WX1 A;  4MDK E;  3F0W A;  3ZDT A;  2IO1 B;  1XX0 A;  2ELA A;  2X18 A;  1KOT A;  5J17 A;  1LQB A;  4CO7 A;  4TUU A;  2EMT A;  4EZK A;  2P0F A;  3VTU A;  4DHZ E;  2G4D B;  2C9W B;  3TW1 A;  3H7P B;  3IFW B;  2D9V A;  2MP2 A;  4GMX B;  1WH3 A;  2LOZ A;  1YJ1 A;  4CHJ A;  4A3P A;  1VBG A;  4CYE A;  1AWE A;  3GZN I;  3PSC A;  5KHQ A;  4DHJ D;  3SNH A;  4TV3 A;  2K00 A;  3APC A;  2MWN B;  2L00 B;  4DHJ B;  3X0W A;  1Y5O A;  4GSW A;  5FI1 A;  3EFU A;  1IYF A;  2C7M B;  2MW5 A;  2ZPY A;  4HXD A;  2Y8G A;  2COA A;  4J6I A;  1M7E A;  2IO0 B;  3I3T B;  3P2B A;  2PEA A;  3ULB A;  4WSF A;  1RFA A;  5D2M B;  3FEH A;  1WJ4 A;  3WYF B;  2KK8 A;  1HBK A;  5IAA C;  5KCV A;  2GBN A;  3ENB A;  1UGM A;  2O2V A;  4A6F B;  1X1F A;  4DX8 A;  2I5F A;  1R4N I;  4K7U A;  4FAD A;  2RGN B;  4II2 B;  4MSQ B;  3DBR I;  5D3V A;  3QWM A;  4ANV A;  1UBQ A;  5GMV A;  2MBQ A;  4XWX A;  1LXD A;  1WXS A;  4FJZ A;  2NCN A;  1P3R A;  3ZLZ A;  3SHQ A;  1OGW A;  1MG8 A;  5G2N A;  4BFR A;  1XQQ A;  1V49 A;  3DBL I;  2K8C A;  3VOQ A;  1UBI A;  4BBN F;  4EMO A;  1S3S G;  3ZVR A;  1E7V A;  1AAR A;  4EJN A;  1UD7 A;  1XD3 B;  3HM3 A;  3CMM B;  1U29 A;  4NPN A;  3PVU A;  2KHW B;  1I42 A;  1U2B A;  2BYE A;  3D8E A;  3UQB A;  2M1M A;  1H10 A;  1SIF A;  1TJ6 A;  1DDW A;  5JH5 C;  1MIX A;  3B1L X;  4EKU A;  4LDT D;  2H7D A;  4ANW A;  5IJM A;  1NI2 A;  1WX7 A;  4IM3 A;  3ECI A;  3EEC A;  3ZIM A;  3QCA A;  2V76 A;  1FB8 A;  4RM8 A;  3TBL D;  3EPY A;  3RYT A;  3PVW A;  3X23 A;  5DIF B;  4MGY E;  2KC2 A;  1G6J A;  2KTR B;  1K5D B;  2N9X A;  1SHC A;  1WIA A;  3PG7 A;  3A4R A;  2NZ8 B;  2CY5 A;  3HM6 X;  5CHV C;  4G11 A;  1HB8 A;  2HRJ A;  2OJR A;  2KO3 A;  1PMS A;  2EJ8 A;  2VRW B;  2YRY A;  2L05 A;  3DVN U;  3Q3F A;  3ULC A;  3N3K B;  4BOS C;  4DWF A;  2DFK A;  2HJ8 A;  2Q13 A;  4ILJ A;  1E8W A;  4X57 B;  2FCN A;  3K9O B;  4DX9 0;  2LXC A;  1EVH A;  3JSV B;  4BKS A;  3LJ3 A;  2KMA A;  4WJN A;  2W2X D;  2D3G A;  1WZ0 A;  3KY9 A;  1ZSQ A;  2C7N B;  5E6P A;  2ADZ A;  2DKP A;  4KHB B;  2GJY A;  3R3M A;  5AZG A;  4GGQ A;  2COP A;  4WJP A;  4M8N A;  2ZJD A;  4HCN B;  4TKN A;  2L76 A;  1IP9 A;  2BWF A;  4JLC A;  2KNB A;  1X05 A;  3H6N A;  1V88 A;  4ASW C;  1S1Q B;  1GUA B;  3VTV A;  2CRF A;  3P7Z A;  2MRP A;  2DLW A;  2LYD A;  3VH3 B;  4FJY A;  5KHO A;  3RUL A;  4PS8 A;  1V6E A;  4W9F A;  4JQW C;  2COD A;  2PJH A;  4RMA A;  2MQJ A;  3A8Q A;  1BT0 A;  5LON B;  5CHF A;  5CLQ B;  2GS0 A;  1UNQ A;  2KAN A;  4RM9 A;  3ZDM C;  3ZUN A;  1GJZ A;  3APF A;  3DXC A;  2Z59 B;  1RRP B;  2EKE C;  1TQZ A;  1V81 A;  1FGZ A;  4GB9 A;  1X11 A;  4K7S A;  5HKH A;  3B0A A;  2YT1 A;  2BKR B;  2G35 A;  1U5E A;  3IBE A;  2K2J A;  4OVV A;  2Y5B B;  5JHH A;  2IO3 B;  4K2O A;  2KDF B;  2AEH A;  3RZF A;  3ZTC A;  2BYV E;  3QA8 A;  3ZO5 B;  3GYO A;  1UZX B;  2KFK B;  2DYO A;  1MKE A;  4A5K A;  2QKL A;  4GXB A;  3VDZ A;  4ZRJ A;  4DXA B;  2Y8F A;  5C5B A;  1WF9 A;  4MGK E;  4I6L B;  1T0Y A;  3QIJ A;  1WR1 A;  4FHK A;  2YF0 A;  1YX6 B;  4GU2 A;  4B95 A;  2KTR A;  3DPD A;  3IHP C;  2I1J A;  2RUK B;  2KX3 A;  1WGR A;  3L17 A;  3PGE A;  2YVC A;  1Y19 B;  4MH0 E;  4W9H A;  4K1R B;  2GBR A;  1OMW A;  5C5B B;  4GPT B;  2R0D A;  3VXW A;  2KTF A;  2JPH A;  4HCP B;  4MGI E;  5C16 A;  2DX1 A;  1WYW B;  1EO6 A;  3ODO A;  3A33 B;  3D8D A;  3DCG A;  4PS7 A;  2X0S A;  2LZ6 A;  4AWJ A;  2D9W A;  3VVW B;  1BWN A;  1VBH A;  1IPG A;  1SE9 A;  3KSY A;  5JHA A;  1GC6 A;  2DA0 A;  2MWS B;  1C1Y B;  2UYZ B;  4JGH B;  4JKG B;  1UPQ A;  2DN6 A;  2RQ1 A;  5KQ1 A;  4ZRK A;  1LB1 A;  2AWT A;  2FCS A;  2R09 A;  2MKR A;  1FAO A;  2KD0 A;  1A5R A;  3CST A;  4IAP A;  1UNR A;  3P6A A;  4WWO A;  4P7I A;  2R2Q A;  2J0J A;  2LVP A;  2W2X C;  1WXM A;  2PE9 A;  3KVF B;  4LDT B;  3MTN B;  2LBB A;  2NR2 A;  1WGY A;  5J3Q A;  3HHM A;  3VUX A;  3PRE A;  4JKD A;  1P1A A;  1WXA A;  5DPW A;  5FR6 A;  3A9J B;  1W1H A;  4HJK A;  3GYP A;  2W9N A;  4GOC A;  3UIO B;  3SUZ A;  2Z0P A;  3MDB C;  4XZ4 A;  5G55 A;  3V61 A;  3QJZ A;  4A3O A;  3VFK A;  2L1C A;  4FBJ B;  2W2W A;  5AZF A;  4W9G A;  1ST7 A;  2ZCB A;  1DDM A;  2K8B A;  3PRZ A;  3WAM A;  1KZG A;  1NDD A;  3VIA A;  2UZS A;  3AUL A;  2O2V B;  2LUL A;  2A4Z A;  3ZRC A;  5IA7 A;  4PNK A;  3K9P B;  1EAZ A;  4FHJ A;  1WJN A;  3UQA A;  2KUP A;  3L16 A;  4NQK E;  3JSV A;  3KZ1 A;  3KUD B;  3N30 A;  3IG3 A;  2OOB B;  2QHO A;  3OAW A;  3M63 B;  3ML4 A;  1MK7 B;  2LI5 A;  4IG7 B;  3NSU A;  3KW5 B;  1EF5 A;  3D8F A;  4EUT A;  1N3H A;  2O6V A;  2KDE B;  1WRD B;  2HTH B;  4NY0 A;  1WFY A;  4LJO B;  2RVB B;  1XOD A;  3L0W B;  5C6R A;  1V89 A;  5JHB A;  4TYZ A;  2CY4 A;  1TGZ B;  3F5R A;  1J0G A;  4MJS B;  2DAJ A;  2FAZ A;  4TQ0 A;  2K39 A;  4A20 A;  1U5F A;  1JRU A;  2MDX A;  4JKE A;  3NOB A;  4HB3 B;  1WGQ A;  3BIN A;  2G4S A;  4GIV A;  2M4N A;  1YD8 U;  3MHS D;  2KDB A;  5DPR A;  2K1F A;  5D6J B;  4EOY A;  4H8S A;  2YS5 A;  3WAO A;  4EZL A;  3KH0 A;  3SO6 A;  5L95 C;  2BPS A;  2K2U A;  4EZJ A;  4IUM B;  1ACA A;  2KJ6 A;  2COC A;  3WAL A;  4B6W A;  2YLM A;  1WJ1 A;  2LXA A;  3PTF C;  1V5O A;  1KLV A;  5C79 A;  4GDL B;  4AUQ C;  2FCM A;  3S2A A;  2GCL A;  3KUZ A;  4DBB A;  1FHO A;  4DHZ B;  1KC7 A;  3OJ3 A;  2IFS A;  1U4A A;  2DHZ A;  1P98 A;  2LAS A;  4GDK A;  2EC1 A;  2J7Q B;  4ICU A;  2J0K A;  3M95 A;  2FID A;  2ROV A;  2NPT B;  4K81 A;  2KWU B;  3E9O A;  3V6E B;  4HAX B;  4HAY B;  2MBH A;  2Y7B A;  2ZNV B;  3UIN B;  2WDT B;  2N7D A;  3E9L A;  3SBG A;  2YS3 A;  3A1Q A;  3A9J A;  2N23 A;  3D32 A;  2K25 A;  1P3Q U;  3RT3 B;  1TZ1 A;  4HDQ A;  1L2N A;  4MY6 A;  3OJ4 B;  4GZU A;  3UGB B;  5C1Z A;  2YT0 A;  2JF5 A;  4JL9 A;  3TJP A;  3V60 A;  4HB0 B;  4KZ0 A;  4B6H A;  3V62 A;  3MPX A;  1RAX A;  4GMV A;  3RUI B;  4JK8 A;  2VSZ A;  2ZZP B;  2KVR A;  4HDO A;  2ZCC A;  4B9K A;  4CHK A;  3UZT A;  3H1U A;  1HB6 A;  3PHW B;  4KIK B;  4KIK A;  2OTX A;  2K8H A;  1LFD A;  4W9J A;  2NVU I;  2UVM A;  1WI1 A;  4ZYN A;  3AU5 A;  2N0Y A;  2DZM A;  5D3Y A;  2D9X A;  2MP2 B;  4IOY X;  1UPR A;  4HAU B;  3A9K B;  2NBV B;  2CR5 A;  1Q67 A;  3JVZ X;  2ZPN A;  1XR0 B;  1H8C A;  3V5W A;  5LXI B;  4IM0 A;  4BOZ B;  4K17 A;  3TIX A;  3E66 A;  2KFK A;  2XBB C;  2NBW B;  2V4L A;  1F9J A;  1XKE A;  2ASQ A;  4II3 B;  3FSS A;  1WE7 A;  4TQ1 A;  4JKF A;  1FGY A;  4LCD E;  3QAQ A;  1X1G A;  2GBK A;  2BKF A;  3O65 B;  3QHT A;  2LUE A;  3QX1 A;  2LKO A;  4A6K A;  5CX3 A;  4F7G A;  2IYD B;  2JRH A;  2KQS A;  5DHA B;  2AL6 A;  1RRB A;  2JXX A;  2LGY A;  2IYB A;  5DH9 B;  4HB4 B;  1BAK A;  4MGZ E;  3A9K A;  1YQB A;  2AL3 A;  1KI1 B;  3KRX A;  4KZC A;  2FNJ B;  3C0R B;  4W9I A;  3TL5 A;  3WIM A;  4JKA A;  2KQ7 A;  3ONS A;  1FOE A;  5L81 A;  2DHI A;  3L10 B;  4F7H A;  1DRO A;  2WH5 A;  3W1Y A;  3VAW A;  4JKB A;  4ZDV A;  4ANX A;  1YX5 B;  2JVC A;  1E5W A;  2JZZ A;  4IWO A;  1V5T A;  2DHK A;  3PSE B;  2Z0O A;  3SBT A;  1AQC A;  1B55 A;  2H7E A;  5DPS A;  3AJ4 A;  1DYN A;  1OQN A;  2BYF A;  3KUC B;  1EGX A;  4URK A;  1PFJ A;  2MBO A;  5JVL A;  2C5L C;  4NSW A;  1CMX B;  3SU8 X;  5HE3 A;  3PT2 B;  1QC6 A;  1P0R A;  2CB8 A;  4ANU A;  2FDQ A;  3VUW A;  2DYB A;  1LW3 A;  2FJ9 A;  2NMB A;  2LG1 A;  1P9D U;  4A6H A;  2Z0Q A;  2Z0E B;  5GOW B;  2ABD A;  4CHM A;  4HAZ B;  3PV1 A;  5E6N A;  4G3X B;  3PLV A;  1OTR B;  3ODX A;  2P0D A;  2LWP A;  1Z2M A;  4F7U P;  3V6C B;  4BVU C;  1WMH B;  2RPQ A;  2I5C A;  2ZVO A;  3CF6 E;  3VTW A;  4BBN C;  1WJ6 A;  1GNU A;  2LGX A;  3NY5 A;  3HIZ A;  2NPT A;  4MSM B;  1ZVR A;  1V5P A;  2N4F A;  4GN1 A;  2WWZ A;  4N9F 4;  2CKH B;  2BCJ A;  2MCN B;  3HW2 B;  1W1G A;  4IC7 B;  1VCB A;  2KX0 A;  4YON A;  4ILH A;  3DVN V;  2L3Z A;  1WMH A;  1PLS A;  3AI5 A;  3DOW A;  1NTY A;  5JZE B;  3VQI A;  3L54 A;  2MA9 B;  3L13 A;  2C60 A;  4WJQ A;  2JWZ A;  4I6N B;  2KGX B;  2HTH A;  2IO2 B;  2VKI A;  2PPH A;  2LVO A;  3DBS A;  2IZV B;  1M94 A;  5DI9 B;  1I2H A;  4IW0 A;  2CS4 A;  4EEW A;  3DXD A;  3E9P A;  2PZ1 A;  5D27 A;  2D10 A;  1E8Y A;  3M3J A;  5DCN A;  2D07 B;  1DDV A;  4AOF A;  2I1K A;  1E90 A;  4XX5 A;  3FM8 C;  3QWZ B;  1D3Z A;  4G0N B;  4OVU A;  1MPH A;  4DK5 A;  2XEW A;  4WWP A;  4IFS A;  2KCJ A;  1KM7 A;  5LLI A;  1M7R A;  2O6V D;  3KRW A;  3EHV A;  1WY8 A;  4DBG A;  4MM3 A;  1OQY A;  1GGO A;  2DYM A;  1WX9 A;  5HE1 A;  3AXC A;  4KSK C;  1V9J A;  2KJH B;  3OLM D;  2M17 A;  3H9D A;  4WQO B;  5D7G A;  3PP2 A;  2KLC A;  2JRI B;  3SDL C;  2FIF A;  1XCG A;  4K2P A;  1BTN A;  1E8X A;  3A4S C;  2XQN M;  4WJ7 A;  3NS8 A;  5CLL B;  2GCJ A;  1WXV A;  3LDZ E;  1V80 A;  5DPT A;  2JUO A;  5J2R A;  2KOX A;  3ML9 A;  2DHJ A;  2N7E A;  5EFX A;  1I35 A;  3JYU A;  4E71 A;  4MEL A;  4MT7 A;  1WZ3 A;  2CHX A;  2EMS A;  3RCZ A;  2GOW A;  4KV2 A;  1RJ2 A;  2M38 A;  4JKG A;  1DIK A;  5KQ4 A;  3U30 A;  2P8V A;  2BGF A;  4KAX B;  5TR5 A;  3W1S A;  2D9Y A;  2V3S A;  1I7A A;  4Z2M B;  4HK2 A;  1WGH A;  4W9E A;  2CAY A;  2ZEQ A;  2DEN B;  5HE0 A;  1Z5S B;  1WX8 A;  2RLO A;  4WJO A;  2RSU A;  4F7Z A;  1TTN A;  2MX2 A;  1ISN A;  4NQL B;  2V1Y A;  3R7R A;  5HE2 A;  2R82 A;  4YL8 A;  1WJM A;  3DDC B;  2D2Q A;  3ML8 A;  2NBU A;  4JKH A;  1NU2 A;  3ODW A;  3RCP A;  4IWP A;  4NNJ B;  2LRU A;  4WVF B;  4KHA A;  1V61 A;  4DDI D;  4FJV B;  2GBJ A;  3A8P A;  3ENE A;  2MBB B;  1LM8 B;  4PYZ A;  1WG7 A;  4F8C B;  3R7Q A;  1NTV A;  5D3X A;  2RGF A;  3N7C A;  4Y94 A;  1X86 A;  3TCA A;  3O96 A;  1MAI A;  3M62 B;  2K6D B;  2G3Q B;  1WGD A;  1TXD A;  3KYD D;  1XT9 B;  2UWQ A;  4NJ7 A;  1QZE A;  2NS5 A;  2CU1 A;  5CHW A;  3SV1 A;  2DAF A;  4AJY B;  2KKC A;  4W9K A;  5J18 A;  2LOX A;  2JY6 A;  5LXH A;  2G45 B;  3ZNZ B;  3LJU X;  2MBE A;  4BBK A;  3PVL A;  3H7S A;  1Q1O A;  4JIO U;  2RD0 A;  4M8M A;  4HHV A;  3IVF A;  1IRS A;  3QK0 A;  2HD5 B;  1V5M A;  1P5T A;  3T8M A;  3SYX A;  1EUV B;  4I6P A;  4C0A A;  4WWN A;  4NAW A;  3T9L A;  1Q0W B;  5E6O A;  3JW0 X;  5C23 A;  2KDI A;  1WI0 A;  2N1W A;  3DBH I;  3N32 A;  2L8J A;  1K5G B;  1P6S A;  5JHG A;  4GDL A;  4KDI C;  2CQU A;  3EC8 A;  1PQS A;  4HVB A;  2L7R A;  2BF8 B;  2M14 A;  2GBM A;  3TO1 A;  3HQC A;  1UH6 A;  4FLH A;  3TFM A;  4PS3 A;  3DXE A;  3ZNG C;  2KWV B;  4FA6 A;  3RZW C;  3WA0 A;  3M1I B;  1WR6 E;  3ZTD A;  2AYO B;  1HE8 A;  2IY0 B;  2KMC A;  2D4Q A;  4D0N B;  1WM3 A;  1W1D A;  1ZGU B;  2JP2 A;  1U5D A;  1FHX A;  3U8Z A;  2E2X A;  3BJI A;  1J8C A;  1WE6 A;  2FUH B;  1UNP A;  3SD5 A;  1NVL A;  2D9Z A;  4HPL B;  1KJT A;  4W9L A;  4ZRI A;  2DZK A;  1MK9 B;  4IM2 A;  3CSF A;  3PZD A;  4JKC A;  3UF8 A;  3MJW A;  3APD A;  4KHO A;  2DX5 B;  2XK5 A;  3OAN A;  3ZW3 A;  2DTC A;  1Y8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...