3X23A

Radixin complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
b'GSMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title MT1-MMP recognition by ERM proteins and its implication in CD44 shedding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell invasion
total genus 88
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3x23A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3x23A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3x23A01
2GS0A 5E6OA 2N7EA 1UPRA 1P1AA 4G0NB 3ZNHB 2L3ZA 2YLMA 1WGDA 4CHJA 2NS5A 4HK2A 3H7PA 2UYZB 4MGIE 2ABDA 4NPNA 4WJPA 4F7GA 5CHVC 3HW2B 4F8CB 3O65B 2KFKA 3QWMA 1ST7A 1WF9A 4WSFA 2N9EB 1FGYA 3ODOA 2IZVB 1YQBA 4DDID 3IBEA 3JVZX 2H7DA 2A4ZA 3HM6X 1M7EA 3TMPB 1GJZA 1U5FA 3PG7A 3DVGY 4RMAA 4WWOA 4XC2A 3MPXA 4L6EA 1OQNA 5JZEB 3OANA 4P7IA 2KK8A 1N3HA 2MBEA 3VTUA 4WJ7A 4B6HA 3DVNV 1EO6A 3WIMA 4WQOB 2LGDA 1P5TA 3G9WA 2P0DA 2PE9A 3RUIB 1FOEA 4NY0A 2DYNA 1WE7A 2L2IA 2LGXA 2KUPA 4ZYNA 4DHJB 2AL6A 4MELA 1JRUA 2BYFA 2MP2A 3RD2A 2KZRA 3BJIA 1FXTB 1ISNA 2KTRB 4ANXA 2KFJA 4IG7B 4FLHA 5IJMA 3M1IB 1E8XA 2IO2B 5EFXA 3M63B 5TR5A 3A33B 3EPYA 5AEKB 3PRMB 3NY5A 3RCZA 5JHGA 3H7PB 2C7MB 4M8MA 4N9F4 2EMSA 3KY9A 5D27A 2J0KA 1WXAA 2BKRB 2OQBA 4XX5A 2IO1B 4K1RB 3LDZE 2KFKB 3VIAA 2M38A 4LJPB 1TJ6A 1TZ1A 2ZNVC 5HE0A 2KLCA 1BAKA 5CTRC 3JW0X 2DZMA 2LJ5A 4A5KA 1LXDA 4AOFA 2MSED 1I35A 4KAXB 2WX0A 3PT2B 4FBJB 1HB8A 4JIOU 3L13A 3SV1A 1L7YA 2IO0B 4GOCA 2CRFA 2FDQA 1HBKA 4IFSA 3M95A 1K5GB 3KRWA 1UELA 1QQGA 2Y7BA 3VVWB 4ZRJA 1WGQA 2VKIA 1KI1B 3APFA 5D3YA 3QIJA 1Q67A 2WH5A 3VHTC 2AEHA 1KZ7A 1R4NI 4DBGA 3VDZA 2MCNB 2KANA 2I5CA 4MSMB 1X86A 2HTHA 4W9DA 4HJKA 3TW1A 2MP2B 3V6CB 2ROZB 3EHVA 4EOYA 4EZKA 2MX2A 1WH3A 1UBIA 3FP5A 2JP2A 2K6QA 3IG3A 1XX0A 2KC1A 3PSCA 2D2QA 1WJMA 5KHQA 1SE9A 4BVUC 2CHWA 3BINA 1LM8B 4XWXA 4W9JA 5AZFA 2Z0OA 1YX5B 2KMAA 1H4RA 2MW5A 3ML8A 4BBNC 2CODA 2A5UA 3D32A 4NJ6A 5FI0A 2FJ9A 5CHWA 1FGZA 1YIWA 4F7UP 1KOTA 2K6DB 4DDGD 2DHIA 4IUMB 2L0FA 2N4FA 2L0TA 4TQ1A 1X1GA 5LONB 3A1QA 4Z2NA 2IBIB 1E5WA 3OLMD 3HQCA 2CHZA 4IW0A 4HATB 1I42A 4FJVB 3N7CA 3TFMA 1DYNA 5JP4A 2O6VA 3KZ1A 3PREA 1OQYA 3ULBA 2ASQA 2COPA 2C9WB 2LASA 4W9LA 2DHZA 4YL8A 3NS8A 1BT0A 3DQVA 5HKHA 2WX1A 1C3TA 4HB0B 3GOEA 2W2XD 4K7UA 1OTRB 4KIKA 2FCNA 1FHWA 4HPLB 2ZPNA 1MK7B 2JPHA 2DFKA 2M8SA 2MQJA 4IWQA 1X11A 4II2B 2FCMA 2MLBA 3L54A 1I7AA 2DX1A 4NQKE 4IC7B 2LOZA 2GMIC 2V1YA 1MIXA 4HPMB 4DHZE 1GC6A 3ZTDA 2C7NB 1E8ZA 2X18A 2LXCA 1WZ3A 4DX8A 4TYZA 2K1FA 4CYEA 4IM3A 4IWPA 4WAAA 2DYBA 2GBRA 4NAWA 2Y5BB 4MGKE 5L81A 4OVVA 2KQSA 4M8NA 2AYOB 2MWNB 1BTNA 2Z0PA 2RGFA 2WDTB 1WGHA 1AARA 3AJ4A 2NPTA 3UQAA 3QWZB 2ZJDA 4PS3A 1TBEA 4RM8A 1EAZA 1UNPA 4NQLB 2R2QA 1A5RA 4GU2A 5C16A 1ZC3B 4LDTD 2CAYA 4KHBB 3N30A 4W9CA 5D2MB 4JGHB 2JZ3B 2DKQA 2DX5A 2V76A 4WJOA 2OJRA 3QAQA 1MG8A 4HCPB 1WG7A 2GCLA 4IWOA 3APDA 1GUAB 2O6VB 1H10A 2V4LA 4EFOA 3DXDA 2D9WA 1OY2A 3ZRFA 3K9PB 2R09A 1V49A 4IM2A 1NBFC 3LJ3A 2DLWA 4IOYX 3JSVB 2IY0B 2L00B 3AU4A 4KIKB 4G50A 2FJLA 2AWTA 4PS7A 1WE6A 2K8BA 3KUDB 4A20A 4MK0A 4FHKA 5FR6A 1P3RA 1WJ1A 4I6NB 1WMHB 1GC7A 3T9LA 3U8ZA 2ZEQA 3QA8A 4J6IA 4YONA 2KTFA 3EECA 4GPTB 2NBUA 3PRPB 4BKSA 3ZVRA 1Q0WB 2OOBB 4FADA 3IVFA 3ZIMA 2D9XA 4NAWB 2RUKB 2XBBC 2KVRA 1E7UA 2J0MA 2M0XA 3KUZA 2NPTB 2MBBB 2BGFA 2LULA 1DDVA 2ELBA 1M7RA 1WX7A 3Q3JA 3KH0A 4F1SA 3ML9A 3PVUA 2ZVOA 2LGYA 3ENEA 3ONSA 2R2OA 1XD3B 1J8CA 2EJ8A 4DBBA 1YJ1A 5DCNA 4ASWC 3ZNGC 2DX5B 1OMWA 1K5DB 1MIZB 2P0FA 1FAOA 1P3QU 2J0JA 2ROVA 4W9GA 5BO4B 2C5LC 2LD9A 4WWNA 1KZGA 1WY8A 2GBNA 1EVHA 1UD7A 4ICVA 3ZNZB 4EZJA 4B95A 1V88A 5JHHA 3FEHA 2N0YA 3UQBA 3DDCB 5DPWA 3VTWA 3VQIA 1V81A 1J0WA 4CHMA 2CQUA 3A4RA 4KSLC 2EC1A 4DK5A 4WVFB 4HAUB 4MGYE 2NMBA 2RPQA 4PNKA 3ZDMC 2EMTA 2Q13A 1TXDA 5KQ1A 4HDOA 3KYCD 2JWZA 5DPRA 3EC8A 1QC6A 1V61A 4WWPA 4E74A 3VFKA 3MDBC 1WVHA 3PV1A 1P9DU 3EFUA 3D8FA 1NTIA 2KQ7A 2W9NA 1U5GA 2LVOA 5D3XA 2L1CA 5FI1A 4KVGB 2YT0A 2H7EA 3A98B 2YSZA 1YD8U 3OJ3A 2CY4A 2ZPYA 1V5PA 3ZW3A 1EF5A 2D9YA 1KLVA 2KNBA 2YS5A 2HRJA 3V61A 4AJYB 5DH9B 2DA0A 4MH0E 3KVFB 2M14A 3WANA 5IAAC 4BOSC 4NJ7A 4MGZE 2FIDA 4MY6A 1WI0A 1GNUA 5LXIB 5DHFB 4Y94A 2K25A 3UIOB 2RVBB 1L2NA 2DYMA 4EJNA 2D10A 3U7DA 2LYDA 2MFQA 5G2NA 3ML4A 4MJSA 2V3SA 3VUYA 4M0WB 3ZRCA 1WGUA 3PHXB 3TVVA 2G4DB 1RRPB 4HHVA 4K7SA 3AULA 2L76A 2I1KA 2I5FA 4GMVA 1WGYA 5AZHA 4DHJD 2LWPA 2M4NA 2G45B 4AP4C 4K7WA 3DVGX 3RT3B 2KDIA 4EEWA 4ZDVA 3UF8A 4A6FA 3KW5B 4HB4B 3GZNI 1ZM0A 3KUCB 3PRZA 3AXCA 3VTVA 1MPHA 2CU1A 3P2BA 4TV3A 3CF6E 2Y8FA 5HE3A 2IY1B 3H1UA 3A4SC 2J59M 3C0RB 4A6KA 3P6AA 1IYFA 3TBLD 3V5WA 3VOQA 3VAWA 1XD4A 4K17A 3WYFB 1J19A 2DAFA 3W1SA 3UZTA 4K2PA 1DDMA 1D3ZA 1NU2A 2G4SA 2ZZPB 1PFJA 2C7HA 4HAWB 5IA7A 2NBVB 3IFWB 3TJPA 2LG1A 2LRWA 3NSUA 2DYQA 4W9IA 4ANVA 2Z59B 1I2HA 5JHBA 4KZ0A 1BWNA 3HM3A 1Y19B 2DZKA 1HE8A 1G6JA 5KCVA 2PPHA 3RCPA 2BF8B 1XR0B 4GB9A 2CKHB 2MA9B 2FCQA 5D94A 2JRHA 3LJUX 2KGXB 2W2XC 1WM2A 2RLOA 1UBQA 3ECIA 1X05A 2KWUB 2WYQA 3CIKA 2K2JA 3WAPA 4MJSB 2YS3A 4A6HA 3DBSA 2YS1A 1WJ4A 4CO7A 3ZKJC 1RAXA 2BPSA 2RSUA 3TO1A 2PEAA 1MK9B 2RGNB 3NZUA 1WFYA 1P0RA 1LQBA 2VRRB 3DBLI 1ACAA 2YVCA 5C5BA 1YX6B 2ZVNA 2DTCA 1X1FA 3PHWB 1V5OA 2KMCA 5LXHA 1KM7A 1V89A 2D9ZA 2B3AA 4X57B 1H8CA 3L0WB 5AZGA 2G3QB 2DAJA 4MM3A 3CSFA 4ANWA 3H7SA 1EUVB 3ZLZA 2KJ6A 1ZVRA 3BY4B 2HTHB 2QKMA 4II3B 3AU5A 1GG3A 3KSYA 1WRDB 3K9OB 1WR1A 4HB2B 4NNJB 4DXAB 2NCNA 4AWJA 4BOZB 1E8WA 2KO3A 3CXBB 3M62B 4G3XB 1PMSA 1UGMA 1OGWA 4KHOA 3OAWA 1EF1A 4PYZA 1E7VA 1SIFA 1V2YA 3PS6A 4MSQB 3ZVVA 4BKTA 1RJ2A 1UNRA 2CR5A 4JLCA 2KDBA 2N9XA 1P6SA 2GJYA 2K39A 3DBRI 3KYDD 1W1HA 1RRBA 1E8YA 4BBKA 2KDEB 3GYPA 3WA0A 3PLVA 4EUTA 4LJOB 3IHPC 4HVBA 1U27A 3A1QB 2K2UA 5J3YA 1M94A 5C5BB 3SD5A 2DENB 2LBBA 4GMXB 3PP2A 2N9PC 4KHAA 4GGQA 2MWSB 4EKUA 4TQ0A 2LZ6A 2BKFA 2NR2A 3P7ZA 2BYEA 2UZSA 2PJHA 2DZIA 1SGHA 1FHOA 5J3QA 5JH5C 4E3CA 1SHCA 1ZSQA 4HXDA 1C1YB 3VXWA 4A3PA 2KDFB 4OVUA 4W9HA 1DROA 1S3SG 4K2OA 1PLSA 3RZWC 1Z2MA 2COCA 3PSEB 2KKCA 4HAXB 2PZ1A 4Z2MB 3VH3B 5CX3A 2MBHA 5J18A 2O6VD 2Z0EB 1WZ0A 1NTYA 3CSTA 2BCJA 1XQQA 3F5RA 1WJUA 4PYUA 3N32A 3R7RA 2D11A 4IAPA 3FM8C 3FLVA 2PE6B 1AQCA 1WJ6A 2CS4A 2LVQA 5D3VA 2LI5A 3GYOA 4PS8A 1U5EA 4MT7A 4ZRIA 1TTNA 3PLUA 3ZDTA 3V60A 1V9JA 4EMOA 2HE7A 5C23A 3A9JA 2KC2A 4GDKA 2P8VA 1WJNA 3TCAA 1VCBA 3UIPB 2NVUI 2OTXA 2NBWB 3UGBB 2UVMA 4DX90 2GCJA 5JLJB 2D3GA 2RSGA 2HJ8A 1UZXB 2L7RA 2R0DA 4ZRKA 2HD5B 2KWVB 3NZSA 4KDLB 2JT4B 2GBMA 1UH6A 1TGZB 2Z0QA 2D4QA 1S1QB 4RM9A 4B9KA 2FCSA 2KHWB 4FJYA 4BBNF 1B55A 2QHOA 1P98A 4B6WA 2UWQA 4BKGA 1Q5WB 1XT9B 4TUUA 2D07B 2RD0A 3A8PA 5D3WA 2KX0A 1XODA 3L10B 5E6PA 2VSZA 3ULCA 3PVWA 1WGGA 5GMVA 3T06A 5J3TA 4E71A 1QZEA 2REXA 1BTKA 2BWFA 3NHEB 3DXCA 4G11A 1XKEA 5D6JB 3H9DA 1LW3A 5C6RA 2LXAA 4ICUA 1ZW7A 2QKLA 1V80A 4JQWC 5C1ZA 3F0WA 4EZLA 2CHXA 1LB1A 1DDWA 2LOXA 2K00A 3A9JB 4MDKE 4GDKB 4GIVA 2CB8A 3DCGA 1V5MA 2JZZA 3DPDA 4BKSD 3SDLC 4HWIB 2BYVE 1Y8RC 2ZNVB 3WALA 4NSWA 2KLGA 2JUOA 2KN5A 2KOXA 4XZ4A 3H6NA 4CHKA 4AUQC 3PEGA 3MHSD 3W1YA 4KDIC 5CHFA 1WX8A 1IPGA 1WIAA 3R66C 2Y8GA 2N1VA 5E6NA 4BFRA 4K81A 2ZCBA 3SNHA 2MDXA 2KD0A 5J2RA 2I1JA 2CY5A 3ODWA 1CMXB 1NVLA 4I6LB 3ZO5B 2G35A 1V5TA 1ZGUB 3SO6A 1WXVA 2LUEA 5DPSA 1ZKHA 3M3JA 5LOPB 4HAZB 2N23A 1Y5OA 1ZC4B 3VUXA 2RQ1A 3ZNID 4H8SA 2FUHB 3O96A 1T0YA 3A9KA 3T8MA 3U30A 2MBQA 3MJWA 4KV2A 4HB3B 3QCAA 2MKRA 2FNJB 5G55A 1V6EA 1V86A 4URKA 2KX3A 3I3TB 3PVLA 3R3MA 3PTFC 1HB6A 3S2AA 1V5UA 2W2WA 2DKPA 5J17A 3QARA 2XK5A 3SYXA 1Z5SB 1X1MA 3PPAA 3SHQA 1UNQA 1F9JA 1WM3A 3ZTCA 4C0AA 3RZFA 2ADZA 2O2VA 3R7QA 3VH4B 2LKOA 4ANUA 5D7GA 3WAOA 3PGEA 4HDQA 2YRYA 5CLLB 3QX1A 3PZDA 3MTNB 4GSWA 3VUWA 1FHXA 4A6FB 4D0NB 3L17A 5DI9B 4WJNA 1XCGA 5L95C 3V62A 2IFSA 1EGXA 5JHAA 1DBHA 4FJZA 4WJQA 5KQ4A 2KJHB 5LLIA 2JY6A 3X23A 4KZCA 2E2XA 4W9KA 5C79A 3ODXA 2ZCCA 1UEFA 1UPQA 3FSSA 2XQNM 1W1DA 1K8RB 3NOBA 1WYWB 2NZ8B 3DXEA 3SU8X 3X0WA 2D9VA 2YT1A 2ELAA 1Z87A 4LDTB 3DBHI 2LVPA 3ALBA 3OJ4B 2Z0DB 3JSVA 1WR6E 4GXBA 2VRWB 2L8JA 3A9KB 4GDLA 2KCJA 4FHJA 3B1LX 2GBKA 3W1SC 3QK0A 5HE1A 3TIXA 4HCNB 1NI2A 4F7ZA 4PQ0A 4JL9A 4FULA 1WMHA 2FIFA 1U2BA 2JF5A 2KWCA 4DWFA 1U4AA 3QQ8B 1Q1OA 4FN2A 3HIZA 2K8CA 5CLQB 2K8HA 4TKNA 5KHOA 4MEMA 2IYDB 4FA6A 2JRIB 1WGRA 2GBJA 2XK5B 1WXMA 1W1GA 2DHKA 1PQSA 1NDDA 3B08A 3QHTA 5HE2A 1E90A 2EKEC 3RULA 4GZUA 2O2VB 4HLEA 4KSKC 1IP9A 2DN6A 2GOWA 3D8EA 3KRXA 4AJWA 2IYBA 4IM0A 2XEWA 3JYUA 1RLFA 2FAZA 3RYTA 4W9FA 3APCA 2RNRB 2J7QB 2UZRA 3N3KB 1NTVA 1RFAA 5L83A 1U5DA 2KXJA 2N1WA 3B0AA 2N7DA 2RR9A 2COFA 2BWES 3UINB 3DOWA 2LRUA 5DPTA 3A8QA 1AWEA 1MKEA 1WXSA 4A3OA 2JXXA 5DIFB 2COAA 2DYOA 4F7HA 4HAYB 3QBVB 3CMMB 3Q3FA 1J0GA 3L16A 4LCDE 4HAVB 3HK0A 4DHZB 2MBOA 2C60A 2KJRA 2M1MA 4GDLB 1OEYJ 2L05A 3DVNU 1R4MI 5EDSA 3TL5A 4W9EA 3V6EB 2P0HA 5DHAB 3SUZA 3HHMA 3L08A 2IO3B 5GOWB 4GN1A 1OEYA 3AI5A 1IRSA 1KJTA 3QC8B 2JVCA 4I6PA 1LFDA 2DZJA 1FB8A 1WX9A 2AL3A 1WI1A 3QJZA 3ZUNA 3WAMA 1U29A 1TQZA 1VD2A 2DHJA 2MRPA 1MAIA 2YF0A 2KTRA 2WWZA 2M17A 3D8DA
chains in the Genus database with same CATH superfamily
4ZRPA 1QKZA 2GS0A 5E6OA 2N7EA 1YOVB 3HVDA 1UPRA 1QOAA 1P1AA 2WU2B 4G0NB 3ZNHB 2L3ZA 3UI3A 1WWTA 1V8CA 2K49A 2YLMA 2WXGA 1IBXB 3BYYB 1WGDA 4CHJA 2NS5A 4IOIE 4HK2A 2WGSA 3H7PA 2N9LA 2UYZB 4MGIE 1XF5L 4C7ZA 2ABDA 1GGOA 4NPNA 4WJPA 4F7GA 5CHVC 2GRIA 3HW2B 1QILA 4F8CB 3EFCA 1HTOA 4A90A 3O65B 2KFKA 1FXIA 4QAYA 3DHHC 3QWMA 1ST7A 3SBGA 1WF9A 1FPYA 4WSFA 2N9EB 1FGYA 3ODOA 2IZVB 3IAS1 1YQBA 4LLGM 4DDID 2IJ0A 3IBEA 2WLBA 3JVZX 1P7EA 2H7DA 1P7FA 1R7SA 2A4ZA 3HM6X 4RGOS 1M7EA 3TMPB 2PVGC 1GJZA 1I4HA 3TEYA 1U5FA 2X8XX 3PG7A 3DVGY 4RMAA 4WWOA 4XC2A 3MPXA 1MJDA 4L6EA 1NENB 1OQNA 5JZEB 2RPVA 3OANA 4P7IA 4A8XC 2KK8A 1N3HA 3W9CB 2MBEA 3RNAC 3VTUA 2WXPA 4WJ7A 4B6HA 3DVNV 1EO6A 3WIMA 3Q8EA 4WQOB 2LGDA 1JWSD 1P5TA 3G9WA 2P0DA 2PE9A 3RUIB 1FOEA 3Q2AC 4NY0A 3C19A 4JK9A 2DYNA 3I9V1 3FILB 3SR6A 1WE7A 2L2IA 2LGXA 3DHIC 1KF6B 2KUPA 4ZYNA 4C4VB 2R61A 3VRBB 4DHJB 2AL6A 2IGGA 3MHZA 4MELA 1JRUA 2BYFA 2MP2A 1IGCA 3RD2A 2KZRA 3BJIA 3V05A 1FXTB 1QF6A 3P4PB 1ISNA 2KTRB 4ANXA 2KFJA 4IG7B 3TEZA 4FLHA 3T3OA 5IJMA 3M1IB 1E8XA 3Q8FA 2IO2B 5EFXA 4GNKB 1FNUA 2RRFA 2KWDA 3M63B 2PTLA 5TR5A 3A33B 3EPYA 1ZYIA 4L1RA 5AEKB 3PRMB 3NY5A 3MC9A 3RCZA 5JHGA 4KGTA 1JWMD 3H7PB 2C7MB 4M8MA 4N9F4 2EMSA 3KY9A 5D27A 2J0KA 1EM7A 1WXAA 3ETRA 4N58A 2BKRB 2OQBA 1FFVA 5D3IB 4XX5A 2IO1B 4K1RB 3LDZE 2KFKB 3VIAA 2M38A 1T0RC 4LJPB 1TJ6A 1TZ1A 2ZNVC 5HE0A 2KLCA 1BAKA 2BS3B 3U52E 4LTUA 5H8YE 5CTRC 3JW0X 1NYRA 2DZMA 2LJ5A 4A5KA 4NJCA 4ILHA 1LXDA 4AOFA 2MSED 1I35A 4KAXB 4R3DA 2WX0A 3PT2B 4FBJB 3Q3NC 1HB8A 3OWEB 3L13A 4JIOU 2VZKD 3SV1A 1L7YA 2IO0B 1TT5B 4GOCA 2CRFA 2FDQA 1N5WA 2UU7A 1HBKA 4IFSA 3M95A 1K5GB 4HKQA 3W5VB 3KRWA 3ZJUA 1UELA 1HA5A 1QQGA 1M4VA 3HRDD 2Y7BA 3B2GA 3VVWB 4ZRJA 1WGQA 2VKIA 1KI1B 3APFA 5D3YA 5LG4B 3RNGC 3RNCC 3QIJA 1Q67A 2WH5A 2M19A 3VHTC 2AEHA 1KZ7A 1R4NI 4DBGA 3VDZA 3NVWA 2MCNB 1GAQB 2KANA 2I5CA 4MSMB 1X86A 2HTHA 4W9DA 4HJKA 3TW1A 2J42A 2JYEA 2MP2B 2Y5CA 3V6CB 2ROZB 5BYRA 3EHVA 4EOYA 2WP9B 4EZKA 4YTNB 2KIEA 2MX2A 2LFIA 3V3XA 2KVZA 4JKBA 1GB4A 1WH3A 1UBIA 1KFYB 3FP5A 2JP2A 2K6QA 3IG3A 1XX0A 2KC1A 3PSCA 2I2YA 2D2QA 1WJMA 1WXQA 3HVZA 5KHQA 1NEKB 4RF1A 1SE9A 4JKEA 2CHWA 4BVUC 2MEKA 3BWUD 3BINA 1LM8B 4XWXA 4W9JA 1YN3A 5AZFA 2Z0OA 1YX5B 2LEKA 2KMAA 1H4RA 2MW5A 2KR0A 3ML8A 4BBNC 3Q8BA 4YWGG 2CODA 2A5UA 2ICIA 3D32A 4NJ6A 5FI0A 3DCXA 1QOBA 2FJ9A 5CHWA 1FGZA 1YIWA 4F7UP 1UUPA 1KOTA 2K6DB 2Z8LA 5EE0A 3TUOA 3U2SC 2BTEA 4DDGD 5MPOA 2DHIA 5HFYA 4IUMB 4KHBA 3AV8A 2L0FA 2N4FA 3AMZA 2PLPA 2L0TA 4TQ1A 1XXGA 1X1GA 2HDEA 2W55A 5LONB 3A1QA 4TSSA 3P42A 4Z2NA 2IBIB 3AEGB 2WXJA 5E6JA 1E5WA 2Z4DA 3OLMD 3ZGZA 3HQCA 2CHZA 5I2SA 4IW0A 4HATB 1FRRA 1I42A 4FJVB 4RFBA 3N7CA 3TFMA 4D6WA 1DYNA 5JP4A 2O6VA 2GI9A 3KZ1A 3PREA 1OQYA 3CIRB 3MFGA 3ULBA 2ASQA 4WWMA 1JWBD 2COPA 2C9WB 2LASA 2WXIA 4W9LA 1ZPSA 2DHZA 3EGRA 1I4XA 4YL8A 3NS8A 1KRHA 2WXLA 1BT0A 3DQVA 5HKHA 2WX1A 4OVZA 1C3TA 3NZ3A 4HB0B 3N1XC 3GOEA 2W2XD 4K7UA 1OTRB 1HEZE 2FCNA 2N9KA 4KIKA 1FHWA 4HPLB 2ZPNA 2Y5PA 1MK7B 1JRPA 1ET6A 2JPHA 4UDUC 2DFKA 2M8SA 2MQJA 1QOGA 1T0SC 4IWQA 4C56C 1X11A 4II2B 2FCMA 2MLBA 3L54A 1I7AA 4NAMA 3EUB2 2DX1A 4NQKE 4JK8A 2BBCA 4IC7B 2LOZA 1NVID 2GMIC 2V1YA 1MIXA 3AN1A 4HPMB 2WXFA 4DHZE 3ZJTA 1GC6A 3ZTDA 2C7NB 4WQMA 1MPEA 1E8ZA 2X18A 2LXCA 1WZ3A 2ACZB 3N9YC 1E10A 4DX8A 1XCQL 4TYZA 2K1FA 2WXRA 4CYEA 4IM3A 4N59A 4IWPA 4WAAA 2DYBA 2WQYB 1OFFA 3SBTA 2GBRA 4YSYB 4EE2A 4NAWA 2Y5BB 4MGKE 5L81A 4OVVA 2KQSA 5C2TB 2H89B 4M8NA 3AH7A 2AYOB 3E66A 1BTNA 2MWNB 2Z0PA 2RGFA 2JSVX 2WDTB 1WGHA 1AARA 3AJ4A 2NPTA 3UQAA 3QWZB 2ZJDA 4PS3A 3TSSA 1TBEA 4RM8A 1EAZA 1UNPA 1WRIA 1CJEA 3Q3OC 4NQLB 2CJOA 2R2QA 1A5RA 4GU2A 5C16A 2WXKA 2BYTA 1HXYD 1ZC3B 4LDTD 2KAJA 3I57A 1SXTA 3U12A 2CAYA 3B2FA 4P1CC 4KHBB 1F2RI 3N30A 4JWSC 4W9CA 5D2MB 2MJEA 3PO0A 4JGHB 2JZ3B 5AUKA 2DKQA 2DX5A 2V76A 4WJOA 2DLBA 4XDDA 5GXGB 2OJRA 1XEEA 1JMLA 3QAQA 1MG8A 1D4BA 4HCPB 1WG7A 2GCLA 2JX5A 5BMHA 2BB6A 4IWOA 3APDA 1GUAB 2INDC 3ENBA 2O6VB 1H10A 2V4LA 4EFOA 3DXDA 2D9WA 4MH8A 1SE4A 1OY2A 3ZRFA 4XYCA 3K9PB 2R09A 1V49A 4IM2A 1JW9D 1NBFC 1D5ZC 1FXAA 1RM6C 2WHIA 3W5UB 3LJ3A 2DLWA 2IDYA 4ZHPA 4IOYX 3JSVB 4YXDB 2IY0B 2L00B 3AU4A 4KIKB 4RGNA 4G50A 2FJLA 1YN4A 2AWTA 3VRAB 3VR9B 2PKOA 4PS7A 4LK0M 1WE6A 2K8BA 3KUDB 4A20A 5BMGA 4MK0A 4FHKA 3KWVA 3DWMA 5FR6A 1P3RA 1WJ1A 4I6NB 4ZYSA 4LNKA 1BXTA 4JKAA 1WMHB 1GC7A 2AQ3B 4C80A 3N1YC 3T9LA 3U8ZA 2ZEQA 3QA8A 4J6IA 4YONA 2KTFA 3EECA 4GPTB 2NBUA 2BQQA 2JXTA 2YEPB 4K3BA 4K3CA 3PRPB 4BKSA 1AYFA 1FEHA 3ZVRA 4ZOHC 2SEBD 2QILA 1Q0WB 2OOBB 4FADA 3IVFA 3ZIMA 2D9XA 4NAWB 2RUKB 2L1AA 2XBBC 2KVRA 1E7UA 2J0MA 2M0XA 3KUZA 1L5PA 2NPTB 2MBBB 2BGFA 2LULA 1DDVA 2ELBA 1VJKA 1M7RA 1WX7A 3H8HA 3Q3JA 3KH0A 4F1SA 2JWUA 3ML9A 4NZLB 2E3TA 3PVUA 2ZVOA 1PGXA 2LGYA 3ENEA 3ONSA 1DOYA 2R2OA 1XD3B 1J8CA 2EJ8A 4DBBA 1YJ1A 5DCNA 4ASWC 3MP9A 2DX5B 3ZNGC 1OMWA 3LYYA 3ZQ4A 1UWMA 4GOUA 1K5DB 1MIZB 3P4RB 2P0FA 1FAOA 1P3QU 2J0JA 1TIFA 2ROVA 4W9GA 5BO4B 3FC4A 2C5LC 2OEDA 2LD9A 4WWNA 1KZGA 1WY8A 2GBNA 1SJHD 1YMHE 5FK9C 1EVHA 1UD7A 4ICVA 1IGDA 3ZNZB 2KACA 4B95A 4EZJA 4KGRA 1V88A 5JHHA 4M0WA 3FEHA 2N0YA 3UQBA 3DDCB 5DPWA 1QT9A 3VTWA 3VQIA 1V81A 1J0WA 2B76B 4CHMA 4JKGA 2CQUA 3BIID 3A4RA 3AE3B 4KSLC 2EC1A 4DK5A 2IPKD 4WVFB 4HAUB 4MGYE 2NMBA 2RPQA 1F1HA 2INCC 1N61A 4PNKA 3ZDMC 2EMTA 1TXDA 2Q13A 1PYWD 2AQ2B 5KQ1A 4HDOA 3TEWA 3KYCD 2JWZA 1XLOA 5DPRA 3EC8A 3DBRB 2V3NA 1QC6A 1V61A 1PDXA 4WWPA 4E74A 3VFKA 1YQ4B 2QC8A 3MDBC 1WVHA 3PV1A 1P9DU 3EFUA 3D8FA 2PVOD 1NTIA 2KQ7A 2W9NA 1U5GA 2IGDA 3KWLA 2LVOA 1F2RC 5D3XA 5TSSA 1T77A 3SEBA 2L1CA 1PGAA 3P4QB 3IT4B 5FI1A 4KVGB 2YT0A 2H7EA 3A98B 2YSZA 1YD8U 3OJ3A 2CY4A 2ZPYA 1V5PA 3ZW3A 1EF5A 2D9YA 1KLVA 2KNBA 2YS5A 2HRJA 2W3RA 3V61A 4AJYB 5DH9B 2DA0A 4MH0E 4XWTA 3KVFB 2M14A 2WXMA 1KLUD 3WANA 5IAAC 5BYQA 4BOSC 1J7CA 4NJ7A 4MGZE 2FIDA 3J9CA 4WURA 4MY6A 2NBVA 1WI0A 1GNUA 5LXIB 5DHFB 4Y94A 2K25A 3FKYA 2Z59A 4ILGB 4B0EA 1FNVA 1FFUA 1JWUD 1EU3A 1K51A 2L52A 3UIOB 2MJDA 2YT2A 1I4PA 2RVBB 3DHGC 4C00A 1L2NA 5EE3A 2DYMA 4EJNA 2D10A 3U7DA 1F0ZA 1L0XB 2LYDA 3MC8A 2MFQA 5G2NA 3ML4A 1FD6A 3PZ7A 4MJSA 2V3SA 5JXVA 5G5GA 4YSZB 3FAHA 3VUYA 2LJIA 4M0WB 1WGUA 3ZRCA 3PHXB 3TVVA 2G4DB 1RRPB 4HHVA 4K7SA 1ET9A 3AULA 3R2IA 2L76A 4JKGB 2I1KA 2I5FA 4GMVA 1WGYA 5AZHA 1K53A 1VDVA 4DHJD 2LWPA 4HROA 2M4NA 2XNAC 2G45B 4AP4C 1N6ZA 4K7WA 3W2DA 2JZPA 3NVVA 4HEA1 3DVGX 3SFEB 3RT3B 2KDIA 4EEWA 4ZDVA 3UF8A 4A6FA 4QXAB 1N60A 3KW5B 4HB4B 2DWQA 3GZNI 5C3JB 5IOIA 1SJED 2VH1A 1ZM0A 4A9AA 1VBGA 3KUCB 5FKAC 3PRZA 3AXCA 2J53A 3VTVA 4P1BC 1MPHA 2CU1A 3P2BA 4TV3A 3CF6E 2Y8FA 5HE3A 3Q8AA 2IY1B 3H1UA 1V1OA 3A4SC 2J59M 1NI3A 1ZDXA 3C0RB 4A6KA 3CWIA 1FRDA 1SB3C 1ESFA 3P6AA 1HQRD 2ON8A 1IYFA 3TBLD 3V5WA 3VOQA 3VAWA 1VZ6A 2NMQA 2X0SA 1XD4A 4K17A 4XE0A 3WYFB 1J19A 3AB5A 4HSIA 1JCKB 2DAFA 3W1SA 3UZTA 3AE9B 4K2PA 1DDMA 1D3ZA 4M00A 3FVCA 2JQRB 2QDFA 1RYJA 3ZJVA 1NU2A 3Q3MC 2G4SA 2R82A 2WXOA 2ZZPB 1PFJA 1VBHA 2C7HA 4HAWB 5IA7A 2NBVB 3IFWB 3TJPA 2LG1A 1TKEA 2LRWA 3NSUA 2DYQA 5EE9A 2WXNA 4W9IA 5HI1A 4ANVA 2Z59B 1I2HA 2WS3B 5JHBA 4KZ0A 1L0VB 1BWNA 3HM3A 4KKIA 1TS2A 1Y19B 2DBYA 2DZKA 1HZ6A 1XLNA 1HE8A 1SE2A 1G6JA 5KCVA 2PPHA 3RCPA 2V4IB 2BF8B 4MT5A 1XR0B 4OZAA 4GB9A 2CKHB 3BVGA 2MA9B 2FCQA 3IXSA 5D94A 2JRHA 3LJUX 2KGXB 1JQ4A 2W2XC 1WM2A 2RLOA 3L4PA 1UBQA 2Z13A 3ECIA 1X05A 3E9PA 2KWUB 2WYQA 3CIKA 2K2JA 1SSNA 4MJSB 5IO9A 3WAPA 2YS3A 4A6HA 1CZPA 3DBSA 3OHMB 1KBLA 3NVZA 2YS1A 1WJ4A 4CO7A 3ZKJC 1RAXA 4Q2JA 2BPSA 3A58A 2RSUA 5JVLA 3TO1A 4HKZE 2PEAA 1MK9B 2RGNB 3NZUA 1WFYA 1P0RA 1LQBA 2WDRB 2VRRB 2KDMA 3DBLI 2D3AA 1ACAA 2YVCA 5C5BA 1YX6B 2ZVNA 4BZAA 2DTCA 3BYTB 1X1FA 2YEPF 4TMAB 3PHWB 4XDCA 1V5OA 2KMCA 5LXHA 1KM7A 2M0AA 4S17A 1V89A 2D9ZA 2W3SA 2B3AA 4X57B 3MC0B 1H8CA 3L0WB 5AZGA 2IGHA 2GLSA 3RPFC 2G3QB 2DAJA 4MM3A 3CSFA 3AEDB 4ANWA 1XLQA 3H7SA 1EUVB 4AS1A 3ZLZA 2KJ6A 2OJWA 3P4SB 1YJJA 3GE3C 1ZVRA 3BY4B 2HTHB 2QKMA 1TYGB 4II3B 3AU5A 2I38A 1GG3A 4L1BA 1CK1A 2QCZA 2D3BA 3KSYA 1N63A 1WRDB 2WDVB 3K9OB 1UNSA 1WR1A 4HB2B 2JU6X 4XWWA 4QJ3B 4NNJB 4DXAB 2NCNA 4AWJA 1SBBB 1MG4A 2ZW1A 1AW7A 5D3DA 1PUTA 1TS4A 4BOZB 1E8WA 2KO3A 3CXBB 1C4CA 3M62B 4G3XB 2MH7A 1PMSA 1UGMA 3AE2B 1OGWA 4KHOA 1C4PA 1YN5A 3OAWA 2LUMA 1GB1A 1EF1A 5H92C 2Q5WD 3E9OA 4PYZA 1E7VA 1SIFA 1MVKA 3ZXVA 1V2YA 2BB5A 3PS6A 4MSQB 3ZVVA 4BKTA 1RJ2A 4DQOC 1UNRA 3RNBC 2DIKA 1DOXA 3BVZA 5IKCM 2CR5A 1OQRA 3GZNB 4JLCA 3SFDB 1C9FA 1JWAD 2KDBA 4REZA 2N9XA 1P6SA 2GJYA 2K39A 1ZOYB 3DBRI 3KYDD 1W1HA 1RRBA 1E8YA 4BBKA 2KDEB 1N5XA 3GYPA 3DWGC 5I4DA 3WA0A 4RGTA 3URYA 3PLVA 4EUTA 4LJOB 3IHPC 3T3NA 4HVBA 1U27A 3A1QB 1SIJA 2K2UA 2KUQA 5J3YA 3AECB 4S0RA 1M94A 3AE8B 5C5BB 3SD5A 2DENB 2J4XA 2LBBA 4GMXB 3PP2A 2N9PC 4H2AA 4KHAA 4GGQA 2MWSB 4EKUA 4TQ0A 3B77A 2LZ6A 2BKFA 2NR2A 4MM3B 2TSSA 4HRSA 4JKHA 5EE1A 5IN7A 1C79A 2W82A 4J3OD 3P7ZA 2BYEA 2UZSA 2PJHA 3RFZB 2OHFA 2DZIA 1T3QA 1SGHA 1YJIA 3GS2A 1FHOA 2ZW0A 5J3QA 4KX6B 3BK2A 2KN4A 2WU5B 5JH5C 4E3CA 1V97A 1SHCA 1WSPA 1ZSQA 1K52A 4HXDA 1C1YB 4IKGA 2LGSA 3KQ4A 1PGBA 3VXWA 4A3PA 2KDFB 4OVUA 1L6VA 4W9HA 3NG0A 1DROA 1S3SG 4K2OA 3AEFB 3Q8CA 4ARIA 1PLSA 2NTTA 1WGKA 3RZWC 4B0MA 1C77A 1Z2MA 4BAXA 4L2YA 2COCA 3PSEB 2XN9C 1I4RA 2KKCA 3MJ5A 4HAXB 1YQ3B 2PMVA 5T8IA 2PZ1A 2QMTA 4Z2MB 1VLBA 3DBLB 4O1NA 3VH3B 3HUIA 1E6EB 4LNNA 2N0SB 5CX3A 1IUEA 2AX5A 2MBHA 1YNTE 1TY0A 5J18A 2O6VD 4LNFA 2Z0EB 1WZ0A 1NTYA 3CSTA 3RN9C 2V3PA 2BCJA 1L0YB 1KH0A 1XQQA 3Q6BA 3F5RA 1WJUA 4PYUA 3N32A 3OG5A 3R7RA 2PW9A 2D11A 4IAPA 3FM8C 1Q10A 3FLVA 2PE6B 1AQCA 1WJ6A 2MHJA 1UF0A 1CQVA 2CS4A 2LVQA 5D3VA 2LI5A 4JPSA 3GYOA 4PS8A 1U5EA 1PFDA 4MT7A 1ZXIA 4ZRIA 4RNAA 1TTNA 3PLUA 4AQ7A 3ZDTA 3DBHB 4OZCA 4GLSC 5BYSA 3EA6A 3V60A 1V9JA 2QEJC 1MHHE 2N7JA 4OHJA 4EMOA 2HE7A 2FJUB 5C23A 3A9JA 2KC2A 4GDKA 4ZRQA 2P8VA 3ZXRA 3RNFC 1WJNA 3TCAA 1VCBA 3UIPB 2NVUI 2OTXA 3P63A 2NBWB 4IDIA 3UGBB 2UVMA 4DX90 2GCJA 1D5XC 5JLJB 2D3GA 1STEA 2D5GA 2RSGA 2HJ8A 1UZXB 3NVYA 2L7RA 2LHEA 2R0DA 1TKYA 1FO4A 2K22A 4ZRKA 2HD5B 2KWVB 3NZSA 4KDLB 1ACCA 1ZDVA 1NYQA 2JT4B 4WH4A 2GBMA 1FIQA 3NW8A 1UH6A 1TGZB 3Q69A 2Z0QA 2D4QA 1S1QB 4RM9A 5IRSA 3KLSX 4JKDA 2SAKA 3C8YA 2BW2A 4B9KA 2FCSA 2HJ1A 4PK1A 4CQNA 1FCLA 3HIEA 4D2KA 3NRZA 4DIXA 2PIAA 1GPXA 4M02A 4OW0A 2KHWB 2WNMA 4FJYA 3R2TA 2G1EA 4BBNF 1B55A 1DGJA 2QHOA 1P98A 3AE6B 4B6WA 2UWQA 4BKGA 1Q5WB 1FM0D 1XT9B 4TUUA 2D07B 2RD0A 3A8PA 5D3WA 2KX0A 1ENFA 1XODA 2INNE 1UGJA 3L10B 5E6PA 2VSZA 3ULCA 2BS4B 3PVWA 1WGGA 2VZKB 5GMVA 5FR3A 3T06A 2E6XA 4USAA 2EELA 5J3TA 4E71A 2Z14A 5G5HA 1QZEA 2REXA 1BTKA 2BWFA 1B9RA 5M4YB 4JKCA 3NHEB 3DXCA 4G11A 1XKEA 5D6JB 1XO3A 3NJTA 3H9DA 1KLGD 1LW3A 2BS2B 4RCOA 5C6RA 1I4QA 2LXAA 1AN8A 4ICUA 1ZW7A 2QKLA 1V80A 4JQWC 2FUG1 3F0WA 5C1ZA 4EZLA 1VZ8A 2CHXA 1DIKA 1LB1A 1DDWA 2LOXA 3I63C 2V0GA 2K00A 3A9JB 4MDKE 2WDQB 4GDKB 4GIVA 1L6UA 2CB8A 3DCGA 1V1PA 1V5MA 2JZZA 1R4MB 2CJNA 1N62A 3IAM1 3DPDA 4BKSD 3RMKC 3SDLC 4HWIB 2BYVE 1Y8RC 2KMMA 2ZNVB 3WALA 2R2YA 4NSWA 2QIEB 2KLGA 2JUOA 3AM9A 5IP4D 3O13A 1FNWA 3NWFA 2KN5A 2KOXA 4XZ4A 1KC7A 3H6NA 4CHKA 4AUQC 4JX1C 1RWSA 4LNOA 3PEGA 3MHSD 2KQ4X 3LB8C 4WAFA 3W1YA 4YT0B 4KDIC 5CHFA 1WX8A 1I7HA 1IPGA 2INPE 1QLBB 1WIAA 3PZ8A 3NS1A 1XCTL 2K0PA 4YTPB 2RDGA 3NUHB 3R66C 3NWDA 3ABVB 3VR8B 2Y8GA 2N1VA 5E6NA 2BVCA 5I2MA 4BFRA 4K81A 2ZCBA 2DNFA 3E9SA 4YTMB 2LHDA 3RI7C 3SNHA 1EU4A 2MDXA 2KD0A 4HPPA 2I1JA 5J2RA 1B1ZA 2CY5A 3ODWA 1CMXB 1NVLA 1UWXA 4I6LB 4RGMA 2K5PA 2K9XA 1LGRA 4US9A 2KIGA 3ZO5B 2AQ1B 2FBWB 2G35A 1V5TA 1ZGUB 3GB1A 2CU3A 3SO6A 1WXVA 2LUEA 3P1MA 1C76A 1HTQA 5DPSA 1ZXHA 1ZKHA 4P6VF 3M3JA 5LOPB 4HAZB 2JYTA 2N23A 1Y5OA 1ZC4B 3VUXA 2RQ1A 3ZNID 4H8SA 2FUHB 3O96A 1T0YA 3A9KA 3T8MA 3U30A 2MBQA 3MJWA 4KV2A 1ZE3D 4HB3B 1K50A 3QCAA 1J7AA 2MKRA 2J52A 3BZDB 2K8EA 2FNJB 4FXCA 2G9HD 4ARCA 2H88B 5G55A 1FCCC 1V6EA 1V86A 4URKA 4M01A 2KX3A 3I3TB 4A55A 3PVLA 3R3MA 3PTFC 2MJ3A 1HB6A 4XGAB 3S2AA 1D6EC 1V5UA 3AE7B 2W2WA 2FE8A 2ZKMX 2DKPA 5J17A 2X38A 3QARA 2XK5A 4RF0A 1MFWA 1V1PB 4L23A 3SYXA 4QJ5B 1Z5SB 1X1MA 1TY2A 3PPAA 1Y56A 3SHQA 1UNQA 1F9JA 1WM3A 3ZTCA 4C0AA 3RZFA 2ADZA 2O2VA 3R7QA 3VH4B 2NTSA 2LKOA 1MI0A 1DOIA 4ANUA 5D7GA 3WAOA 3PGEA 3RNEC 1E9MA 1F52A 4HDQA 2YRYA 1JALA 2K3UA 5CLLB 3NWAA 1TJEA 3QX1A 3PZDA 3E9LA 2W54A 2M56B 3MTNB 4GSWA 3VUWA 1FHXA 2QJLA 4A6FB 4D0NB 1RFKA 1MI1A 3WCQA 4ILJA 1HZ5A 2LGIA 3L17A 5DI9B 4WJNA 1XCGA 4P16A 5L95C 3V62A 3B9JA 2IFSA 1EGXA 1F77A 5JHAA 1QOFA 1DBHA 4FJZA 4WJQA 5KQ4A 2KJHB 5LLIA 2JY6A 3X23A 4OZBA 3TEXA 4KZCA 2Y3AA 4PT5A 1TKGA 2E2XA 5C79A 4W9KA 3ODXA 2ZCCA 1UEFA 4LNIA 1UPQA 3FSSA 2XQNM 1W1DA 1K8RB 3NOBA 1WYWB 2NZ8B 3DXEA 3SU8X 4RH6A 2L83A 2VH2A 3X0WA 2D9VA 2YT1A 2ELAA 2HTME 1Z87A 1E0ZA 4LDTB 3DBHI 1MHXA 2LVPA 3ALBA 3OJ4B 1QQRA 2Z0DB 4N6EB 3JSVA 2RDBC 1WR6E 4US8A 4GXBA 2VRWB 4QJ4B 2L8JA 1SE3A 3U7ZA 3A9KB 4GDLA 2D3CA 2KCJA 1VZ7A 4ITKA 1FMAD 4FHJA 3B1LX 2GBKA 3W1SC 5AUIA 4ZHOA 3QK0A 5HE1A 3TIXA 4HCNB 1NI2A 3BK1A 4F7ZA 4PQ0A 2KYWA 4JL9A 4FULA 1WMHA 2FIFA 1U2BA 2JF5A 4JE3B 2KWCA 4DXGA 4DWFA 1U4AA 3QQ8B 1Q1OA 4FN2A 3AE4B 2BT6A 3HIZA 2K8CA 5CLQB 2K8HA 4TKNA 3AEEB 5KHOA 4MACA 4MEMA 2IYDB 4FA6A 2JRIB 1WGRA 4JKFA 1VR9A 2GBJA 2LMCA 2XK5B 1WXMA 1W1GA 2DHKA 1PQSA 4DXFA 1D5MC 1NDDA 3B08A 1JROA 3QHTA 4OT1A 5HE2A 1E90A 1BMLC 2EKEC 1SEBD 3RULA 4GZUA 2O2VB 1AWDA 4HLEA 1ROEA 4KSKC 1IP9A 2DN6A 2L32A 2EKIA 2GOWA 3AE1B 3U4EG 3D8EA 3KRXA 4AJWA 2IYBA 4ACFA 4IM0A 2XEWA 3JYUA 1RLFA 2FAZA 3RYTA 4W9FA 3I5JC 3GP7A 1C78A 1L4ZB 1R4NB 3APCA 2RNRB 2J7QB 2UZRA 3N3KB 3BVMA 5HG2A 1NTVA 1RFAA 5L83A 1U5DA 1I4GA 5HHDG 4KKJA 1XLPA 1IBXA 1T0QC 3N1ZC 2KXJA 2N1WA 3HSAA 3IT6B 1LO5D 3B0AA 2N7DA 2RR9A 2COFA 1VRAB 2BWES 3UINB 1T5XD 4JK7A 4HJGE 1BUIC 3DOWA 2LRUA 2WXQA 5DPTA 2RMMA 1ZUD2 1KTKA 3A8QA 1AWEA 1MKEA 1A70A 1WXSA 3N20C 4A3OA 1E7PB 3AEBB 2JXXA 5DIFB 2COAA 2DYOA 4F7HA 4HAYB 4JWUC 1OQQA 3QBVB 4OSNA 3CMMB 3Q3FA 1J0GA 4WIPA 3L16A 4LCDE 3Q14C 4HAVB 3HK0A 4DHZB 2MBOA 3AE5B 2C60A 1T6BX 3AEAB 1J7BA 1TS3A 2KJRA 2M1MA 4GDLB 3E56A 1OEYJ 1ZP0B 1TZOA 2L05A 3DVNU 1R4MI 4C7YA 5EDSA 1DYQA 3TL5A 2QSDA 4W9EA 3V6EB 2P0HA 5DHAB 3R8BA 5BMIA 3SUZA 3HHMA 2RDHA 3L08A 2IO3B 3LXFA 1TS5A 5GOWB 4GN1A 1OEYA 4YSXB 4CSQA 2GB1A 3FILA 2GUMA 3AI5A 4KGSA 4C4VA 1IRSA 1KJTA 3QC8B 5LNK1 1WYGA 1C4AA 2WXHA 2JVCA 1EWCA 4I6PA 1LFDA 2DZJA 1FB8A 1WX9A 2AL3A 1WI1A 2KT7A 3QJZA 3ZUNA 1EWYC 1JDEA 2ONQA 1SF0A 3WAMA 2V9HA 1U29A 1TQZA 1VD2A 2DHJA 2MRPA 1MAIA 2YF0A 1GOZA 2KTRA 3ZYYX 1L4DB 3GE8C 4A6QA 2WWZA 2M17A 3D8DA
chains in the Genus database with same CATH topology
2GS0A 5E6OA 2N7EA 1UPRA 1P1AA 4G0NB 3ZNHB 2L3ZA 2YLMA 1WGDA 4CHJA 2NS5A 4HK2A 3H7PA 2UYZB 4MGIE 2ABDA 1GGOA 4NPNA 4WJPA 4F7GA 5CHVC 3HW2B 4F8CB 3O65B 2KFKA 3QWMA 1ST7A 3SBGA 1WF9A 4WSFA 2N9EB 1FGYA 3ODOA 2IZVB 1YQBA 4DDID 3IBEA 3JVZX 2H7DA 2A4ZA 3HM6X 1M7EA 3TMPB 1GJZA 1U5FA 3PG7A 3DVGY 4RMAA 4WWOA 4XC2A 3MPXA 4L6EA 1OQNA 5JZEB 3OANA 4P7IA 2KK8A 1N3HA 2MBEA 3VTUA 4WJ7A 4B6HA 3DVNV 1EO6A 3WIMA 4WQOB 2LGDA 1P5TA 3G9WA 2P0DA 2PE9A 3RUIB 1FOEA 4NY0A 4JK9A 2DYNA 1WE7A 2L2IA 2LGXA 2KUPA 4ZYNA 4DHJB 2AL6A 4MELA 1JRUA 2BYFA 2MP2A 3RD2A 2KZRA 3BJIA 1FXTB 1ISNA 2KTRB 4ANXA 2KFJA 4IG7B 4FLHA 5IJMA 3M1IB 1E8XA 2IO2B 5EFXA 3M63B 5TR5A 3A33B 3EPYA 5AEKB 3PRMB 3NY5A 3RCZA 5JHGA 3H7PB 2C7MB 4M8MA 4N9F4 2EMSA 3KY9A 5D27A 2J0KA 1WXAA 2BKRB 2OQBA 4XX5A 2IO1B 4K1RB 3LDZE 2KFKB 3VIAA 2M38A 4LJPB 1TJ6A 1TZ1A 2ZNVC 5HE0A 2KLCA 1BAKA 5CTRC 3JW0X 2DZMA 2LJ5A 4A5KA 4ILHA 1LXDA 4AOFA 2MSED 1I35A 4KAXB 2WX0A 3PT2B 4FBJB 1HB8A 4JIOU 3L13A 3SV1A 1L7YA 2IO0B 4GOCA 2CRFA 2FDQA 1HBKA 4IFSA 3M95A 1K5GB 3KRWA 1UELA 1QQGA 2Y7BA 3VVWB 4ZRJA 1WGQA 2VKIA 1KI1B 3APFA 5D3YA 3QIJA 1Q67A 2WH5A 3VHTC 2AEHA 1KZ7A 1R4NI 4DBGA 3VDZA 2MCNB 2KANA 2I5CA 4MSMB 1X86A 2HTHA 4W9DA 4HJKA 3TW1A 2MP2B 3V6CB 2ROZB 3EHVA 4EOYA 4EZKA 2MX2A 4JKBA 1WH3A 1UBIA 3FP5A 2JP2A 2K6QA 3IG3A 1XX0A 2KC1A 3PSCA 2D2QA 1WJMA 5KHQA 1SE9A 4JKEA 2CHWA 4BVUC 3BINA 1LM8B 4XWXA 4W9JA 5AZFA 2Z0OA 1YX5B 2KMAA 1H4RA 2MW5A 3ML8A 4BBNC 2CODA 2A5UA 3D32A 4NJ6A 5FI0A 2FJ9A 5CHWA 1FGZA 1YIWA 4F7UP 1KOTA 2K6DB 4DDGD 2DHIA 4IUMB 2L0FA 2N4FA 2L0TA 4TQ1A 1X1GA 5LONB 3A1QA 4Z2NA 2IBIB 1E5WA 3OLMD 3HQCA 2CHZA 4IW0A 4HATB 1I42A 4FJVB 3N7CA 3TFMA 1DYNA 5JP4A 2O6VA 3KZ1A 3PREA 1OQYA 3ULBA 2ASQA 2COPA 2C9WB 2LASA 4W9LA 2DHZA 4YL8A 3NS8A 1BT0A 3DQVA 5HKHA 2WX1A 1C3TA 4HB0B 3GOEA 2W2XD 4K7UA 1OTRB 4KIKA 2FCNA 1FHWA 4HPLB 2ZPNA 1MK7B 2JPHA 2DFKA 2M8SA 2MQJA 4IWQA 1X11A 4II2B 2FCMA 2MLBA 3L54A 1I7AA 2DX1A 4NQKE 4JK8A 4IC7B 2LOZA 2GMIC 2V1YA 1MIXA 4HPMB 4DHZE 1GC6A 3ZTDA 2C7NB 1E8ZA 2X18A 2LXCA 1WZ3A 4DX8A 4TYZA 2K1FA 4CYEA 4IM3A 4IWPA 4WAAA 2DYBA 3SBTA 2GBRA 4NAWA 2Y5BB 4MGKE 5L81A 4OVVA 2KQSA 4M8NA 2AYOB 3E66A 1BTNA 2MWNB 2Z0PA 2RGFA 2WDTB 1WGHA 1AARA 3AJ4A 2NPTA 3UQAA 3QWZB 2ZJDA 4PS3A 1TBEA 4RM8A 1EAZA 1UNPA 4NQLB 2R2QA 1A5RA 4GU2A 5C16A 1ZC3B 4LDTD 2CAYA 4KHBB 3N30A 4W9CA 5D2MB 4JGHB 2JZ3B 2DKQA 2DX5A 2V76A 4WJOA 2OJRA 3QAQA 1MG8A 4HCPB 1WG7A 2GCLA 4IWOA 3APDA 1GUAB 3ENBA 2O6VB 1H10A 2V4LA 4EFOA 3DXDA 2D9WA 1OY2A 3ZRFA 3K9PB 2R09A 1V49A 4IM2A 1NBFC 3LJ3A 2DLWA 4IOYX 3JSVB 2IY0B 2L00B 3AU4A 4KIKB 4G50A 2FJLA 2AWTA 4PS7A 1WE6A 2K8BA 3KUDB 4A20A 4MK0A 4FHKA 5FR6A 1P3RA 1WJ1A 4I6NB 4JKAA 1WMHB 1GC7A 3T9LA 3U8ZA 2ZEQA 3QA8A 4J6IA 4YONA 2KTFA 3EECA 4GPTB 2NBUA 3PRPB 4BKSA 3ZVRA 1Q0WB 2OOBB 4FADA 3IVFA 3ZIMA 2D9XA 4NAWB 2RUKB 2XBBC 2KVRA 1E7UA 2J0MA 2M0XA 3KUZA 2NPTB 2MBBB 2BGFA 2LULA 1DDVA 2ELBA 1M7RA 1WX7A 3Q3JA 3KH0A 4F1SA 3ML9A 3PVUA 2ZVOA 2LGYA 3ENEA 3ONSA 2R2OA 1XD3B 1J8CA 2EJ8A 4DBBA 1YJ1A 5DCNA 4ASWC 3ZNGC 2DX5B 1OMWA 1K5DB 1MIZB 2P0FA 1FAOA 1P3QU 2J0JA 2ROVA 4W9GA 5BO4B 2C5LC 2LD9A 4WWNA 1KZGA 1WY8A 2GBNA 1EVHA 1UD7A 4ICVA 3ZNZB 4EZJA 4B95A 1V88A 5JHHA 3FEHA 2N0YA 3UQBA 3DDCB 5DPWA 3VTWA 3VQIA 1V81A 1J0WA 4CHMA 4JKGA 2CQUA 3A4RA 4KSLC 2EC1A 4DK5A 4WVFB 4HAUB 4MGYE 2NMBA 2RPQA 4PNKA 3ZDMC 2EMTA 2Q13A 1TXDA 5KQ1A 4HDOA 3KYCD 2JWZA 5DPRA 3EC8A 1QC6A 1V61A 4WWPA 4E74A 3VFKA 3MDBC 1WVHA 3PV1A 1P9DU 3EFUA 3D8FA 1NTIA 2KQ7A 2W9NA 1U5GA 2LVOA 5D3XA 2L1CA 5FI1A 4KVGB 2YT0A 2H7EA 3A98B 2YSZA 1YD8U 3OJ3A 2CY4A 2ZPYA 1V5PA 3ZW3A 1EF5A 2D9YA 1KLVA 2KNBA 2YS5A 2HRJA 3V61A 4AJYB 5DH9B 2DA0A 4MH0E 3KVFB 2M14A 3WANA 5IAAC 4BOSC 4NJ7A 4MGZE 2FIDA 4MY6A 1WI0A 1GNUA 5LXIB 5DHFB 4Y94A 2K25A 4ILGB 3UIOB 2RVBB 1L2NA 2DYMA 4EJNA 2D10A 3U7DA 2LYDA 2MFQA 5G2NA 3ML4A 4MJSA 2V3SA 3VUYA 4M0WB 3ZRCA 1WGUA 3PHXB 3TVVA 2G4DB 1RRPB 4HHVA 4K7SA 3AULA 2L76A 4JKGB 2I1KA 2I5FA 4GMVA 1WGYA 5AZHA 4DHJD 2LWPA 2M4NA 2G45B 4AP4C 4K7WA 3DVGX 3RT3B 2KDIA 4EEWA 4ZDVA 3UF8A 4A6FA 3KW5B 4HB4B 3GZNI 1ZM0A 1VBGA 3KUCB 3PRZA 3AXCA 3VTVA 1MPHA 2CU1A 3P2BA 4TV3A 3CF6E 2Y8FA 5HE3A 2IY1B 3H1UA 3A4SC 2J59M 3C0RB 4A6KA 3P6AA 1IYFA 3TBLD 3V5WA 3VOQA 3VAWA 2X0SA 1XD4A 4K17A 3WYFB 1J19A 2DAFA 3W1SA 3UZTA 4K2PA 1DDMA 1D3ZA 1NU2A 2G4SA 2R82A 2ZZPB 1PFJA 1VBHA 2C7HA 4HAWB 5IA7A 2NBVB 3IFWB 3TJPA 2LG1A 2LRWA 3NSUA 2DYQA 4W9IA 4ANVA 2Z59B 1I2HA 5JHBA 4KZ0A 1BWNA 3HM3A 1Y19B 2DZKA 1HE8A 1G6JA 5KCVA 2PPHA 3RCPA 2BF8B 1XR0B 4GB9A 2CKHB 2MA9B 2FCQA 5D94A 2JRHA 3LJUX 2KGXB 2W2XC 1WM2A 2RLOA 1UBQA 3ECIA 1X05A 3E9PA 2KWUB 2WYQA 3CIKA 2K2JA 3WAPA 4MJSB 2YS3A 4A6HA 3DBSA 1KBLA 2YS1A 1WJ4A 4CO7A 3ZKJC 1RAXA 2BPSA 2RSUA 5JVLA 3TO1A 2PEAA 1MK9B 2RGNB 3NZUA 1WFYA 1P0RA 1LQBA 2VRRB 3DBLI 1ACAA 2YVCA 5C5BA 1YX6B 2ZVNA 2DTCA 1X1FA 3PHWB 1V5OA 2KMCA 5LXHA 1KM7A 1V89A 2D9ZA 2B3AA 4X57B 1H8CA 3L0WB 5AZGA 2G3QB 2DAJA 4MM3A 3CSFA 4ANWA 3H7SA 1EUVB 3ZLZA 2KJ6A 1ZVRA 3BY4B 2HTHB 2QKMA 4II3B 3AU5A 1GG3A 3KSYA 1WRDB 3K9OB 1WR1A 4HB2B 4NNJB 4DXAB 2NCNA 4AWJA 4BOZB 1E8WA 2KO3A 3CXBB 3M62B 4G3XB 1PMSA 1UGMA 1OGWA 4KHOA 3OAWA 1EF1A 3E9OA 4PYZA 1E7VA 1SIFA 1V2YA 3PS6A 4MSQB 3ZVVA 4BKTA 1RJ2A 1UNRA 2DIKA 2CR5A 4JLCA 2KDBA 2N9XA 1P6SA 2GJYA 2K39A 3DBRI 3KYDD 1W1HA 1RRBA 1E8YA 4BBKA 2KDEB 3GYPA 3WA0A 3PLVA 4EUTA 4LJOB 3IHPC 4HVBA 1U27A 3A1QB 2K2UA 5J3YA 1M94A 5C5BB 3SD5A 2DENB 2LBBA 4GMXB 3PP2A 2N9PC 4KHAA 4GGQA 2MWSB 4EKUA 4TQ0A 2LZ6A 2BKFA 2NR2A 4JKHA 3P7ZA 2BYEA 2UZSA 2PJHA 2DZIA 1SGHA 1FHOA 5J3QA 5JH5C 4E3CA 1SHCA 1ZSQA 4HXDA 1C1YB 3VXWA 4A3PA 2KDFB 4OVUA 4W9HA 1DROA 1S3SG 4K2OA 1PLSA 3RZWC 1Z2MA 2COCA 3PSEB 2KKCA 4HAXB 2PZ1A 4Z2MB 3VH3B 5CX3A 2MBHA 5J18A 2O6VD 2Z0EB 1WZ0A 1NTYA 3CSTA 2BCJA 1XQQA 3F5RA 1WJUA 4PYUA 3N32A 3R7RA 2D11A 4IAPA 3FM8C 3FLVA 2PE6B 1AQCA 1WJ6A 2CS4A 2LVQA 5D3VA 2LI5A 3GYOA 4PS8A 1U5EA 4MT7A 4ZRIA 1TTNA 3PLUA 3ZDTA 3V60A 1V9JA 4EMOA 2HE7A 5C23A 3A9JA 2KC2A 4GDKA 2P8VA 1WJNA 3TCAA 1VCBA 3UIPB 2NVUI 2OTXA 2NBWB 3UGBB 2UVMA 4DX90 2GCJA 5JLJB 2D3GA 2RSGA 2HJ8A 1UZXB 2L7RA 2R0DA 4ZRKA 2HD5B 2KWVB 3NZSA 4KDLB 2JT4B 2GBMA 1UH6A 1TGZB 2Z0QA 2D4QA 1S1QB 4RM9A 4JKDA 4B9KA 2FCSA 2KHWB 4FJYA 4BBNF 1B55A 2QHOA 1P98A 4B6WA 2UWQA 4BKGA 1Q5WB 1XT9B 4TUUA 2D07B 2RD0A 3A8PA 5D3WA 2KX0A 1XODA 3L10B 5E6PA 2VSZA 3ULCA 3PVWA 1WGGA 5GMVA 3T06A 5J3TA 4E71A 1QZEA 2REXA 1BTKA 2BWFA 4JKCA 3NHEB 3DXCA 4G11A 1XKEA 5D6JB 3H9DA 1LW3A 5C6RA 2LXAA 4ICUA 1ZW7A 2QKLA 1V80A 4JQWC 5C1ZA 3F0WA 4EZLA 2CHXA 1DIKA 1LB1A 1DDWA 2LOXA 2K00A 3A9JB 4MDKE 4GDKB 4GIVA 2CB8A 3DCGA 1V5MA 2JZZA 3DPDA 4BKSD 3SDLC 4HWIB 2BYVE 1Y8RC 2ZNVB 3WALA 4NSWA 2KLGA 2JUOA 2KN5A 2KOXA 4XZ4A 1KC7A 3H6NA 4CHKA 4AUQC 3PEGA 3MHSD 3W1YA 4KDIC 5CHFA 1WX8A 1IPGA 1WIAA 3R66C 2Y8GA 2N1VA 5E6NA 4BFRA 4K81A 2ZCBA 3SNHA 2MDXA 2KD0A 5J2RA 2I1JA 2CY5A 3ODWA 1CMXB 1NVLA 4I6LB 3ZO5B 2G35A 1V5TA 1ZGUB 3SO6A 1WXVA 2LUEA 5DPSA 1ZKHA 3M3JA 5LOPB 4HAZB 2N23A 1Y5OA 1ZC4B 3VUXA 2RQ1A 3ZNID 4H8SA 2FUHB 3O96A 1T0YA 3A9KA 3T8MA 3U30A 2MBQA 3MJWA 4KV2A 4HB3B 3QCAA 2MKRA 2FNJB 5G55A 1V6EA 1V86A 4URKA 2KX3A 3I3TB 3PVLA 3R3MA 3PTFC 1HB6A 3S2AA 1V5UA 2W2WA 2DKPA 5J17A 3QARA 2XK5A 3SYXA 1Z5SB 1X1MA 3PPAA 3SHQA 1UNQA 1F9JA 1WM3A 3ZTCA 4C0AA 3RZFA 2ADZA 2O2VA 3R7QA 3VH4B 2LKOA 4ANUA 5D7GA 3WAOA 3PGEA 4HDQA 2YRYA 5CLLB 3QX1A 3PZDA 3E9LA 3MTNB 4GSWA 3VUWA 1FHXA 4A6FB 4D0NB 4ILJA 3L17A 5DI9B 4WJNA 1XCGA 5L95C 3V62A 2IFSA 1EGXA 5JHAA 1DBHA 4FJZA 4WJQA 5KQ4A 2KJHB 5LLIA 2JY6A 3X23A 4KZCA 2E2XA 4W9KA 5C79A 3ODXA 2ZCCA 1UEFA 1UPQA 3FSSA 2XQNM 1W1DA 1K8RB 3NOBA 1WYWB 2NZ8B 3DXEA 3SU8X 3X0WA 2D9VA 2YT1A 2ELAA 1Z87A 4LDTB 3DBHI 2LVPA 3ALBA 3OJ4B 2Z0DB 3JSVA 1WR6E 4GXBA 2VRWB 2L8JA 3A9KB 4GDLA 2KCJA 4FHJA 3B1LX 2GBKA 3W1SC 3QK0A 5HE1A 3TIXA 4HCNB 1NI2A 4F7ZA 4PQ0A 4JL9A 4FULA 1WMHA 2FIFA 1U2BA 2JF5A 2KWCA 4DWFA 1U4AA 3QQ8B 1Q1OA 4FN2A 3HIZA 2K8CA 5CLQB 2K8HA 4TKNA 5KHOA 4MEMA 2IYDB 4FA6A 2JRIB 1WGRA 4JKFA 2GBJA 2XK5B 1WXMA 1W1GA 2DHKA 1PQSA 1NDDA 3B08A 3QHTA 5HE2A 1E90A 2EKEC 3RULA 4GZUA 2O2VB 4HLEA 4KSKC 1IP9A 2DN6A 2GOWA 3D8EA 3KRXA 4AJWA 2IYBA 4IM0A 2XEWA 3JYUA 1RLFA 2FAZA 3RYTA 4W9FA 3APCA 2RNRB 2J7QB 2UZRA 3N3KB 1NTVA 1RFAA 5L83A 1U5DA 2KXJA 2N1WA 3B0AA 2N7DA 2RR9A 2COFA 2BWES 3UINB 4JK7A 3DOWA 2LRUA 5DPTA 3A8QA 1AWEA 1MKEA 1WXSA 4A3OA 2JXXA 5DIFB 2COAA 2DYOA 4F7HA 4HAYB 3QBVB 3CMMB 3Q3FA 1J0GA 3L16A 4LCDE 4HAVB 3HK0A 4DHZB 2MBOA 2C60A 2KJRA 2M1MA 4GDLB 1OEYJ 2L05A 3DVNU 1R4MI 5EDSA 3TL5A 4W9EA 3V6EB 2P0HA 5DHAB 3SUZA 3HHMA 3L08A 2IO3B 5GOWB 4GN1A 1OEYA 3AI5A 1IRSA 1KJTA 3QC8B 2JVCA 4I6PA 1LFDA 2DZJA 1FB8A 1WX9A 2AL3A 1WI1A 3QJZA 3ZUNA 1JDEA 3WAMA 1U29A 1TQZA 1VD2A 2DHJA 2MRPA 1MAIA 2YF0A 2KTRA 2WWZA 2M17A 3D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GS0 A;  5E6O A;  2N7E A;  1UPR A;  1P1A A;  4G0N B;  3ZNH B;  2L3Z A;  2YLM A;  1WGD A;  4CHJ A;  2NS5 A;  4HK2 A;  3H7P A;  2UYZ B;  4MGI E;  2ABD A;  4NPN A;  4WJP A;  4F7G A;  5CHV C;  3HW2 B;  4F8C B;  3O65 B;  2KFK A;  3QWM A;  1ST7 A;  1WF9 A;  4WSF A;  2N9E B;  1FGY A;  3ODO A;  2IZV B;  1YQB A;  4DDI D;  3IBE A;  3JVZ X;  2H7D A;  2A4Z A;  3HM6 X;  1M7E A;  3TMP B;  1GJZ A;  1U5F A;  3PG7 A;  3DVG Y;  4RMA A;  4WWO A;  4XC2 A;  3MPX A;  4L6E A;  1OQN A;  5JZE B;  3OAN A;  4P7I A;  2KK8 A;  1N3H A;  2MBE A;  3VTU A;  4WJ7 A;  4B6H A;  3DVN V;  1EO6 A;  3WIM A;  4WQO B;  2LGD A;  1P5T A;  3G9W A;  2P0D A;  2PE9 A;  3RUI B;  1FOE A;  4NY0 A;  2DYN A;  1WE7 A;  2L2I A;  2LGX A;  2KUP A;  4ZYN A;  4DHJ B;  2AL6 A;  4MEL A;  1JRU A;  2BYF A;  2MP2 A;  3RD2 A;  2KZR A;  3BJI A;  1FXT B;  1ISN A;  2KTR B;  4ANX A;  2KFJ A;  4IG7 B;  4FLH A;  5IJM A;  3M1I B;  1E8X A;  2IO2 B;  5EFX A;  3M63 B;  5TR5 A;  3A33 B;  3EPY A;  5AEK B;  3PRM B;  3NY5 A;  3RCZ A;  5JHG A;  3H7P B;  2C7M B;  4M8M A;  4N9F 4;  2EMS A;  3KY9 A;  5D27 A;  2J0K A;  1WXA A;  2BKR B;  2OQB A;  4XX5 A;  2IO1 B;  4K1R B;  3LDZ E;  2KFK B;  3VIA A;  2M38 A;  4LJP B;  1TJ6 A;  1TZ1 A;  2ZNV C;  5HE0 A;  2KLC A;  1BAK A;  5CTR C;  3JW0 X;  2DZM A;  2LJ5 A;  4A5K A;  1LXD A;  4AOF A;  2MSE D;  1I35 A;  4KAX B;  2WX0 A;  3PT2 B;  4FBJ B;  1HB8 A;  4JIO U;  3L13 A;  3SV1 A;  1L7Y A;  2IO0 B;  4GOC A;  2CRF A;  2FDQ A;  1HBK A;  4IFS A;  3M95 A;  1K5G B;  3KRW A;  1UEL A;  1QQG A;  2Y7B A;  3VVW B;  4ZRJ A;  1WGQ A;  2VKI A;  1KI1 B;  3APF A;  5D3Y A;  3QIJ A;  1Q67 A;  2WH5 A;  3VHT C;  2AEH A;  1KZ7 A;  1R4N I;  4DBG A;  3VDZ A;  2MCN B;  2KAN A;  2I5C A;  4MSM B;  1X86 A;  2HTH A;  4W9D A;  4HJK A;  3TW1 A;  2MP2 B;  3V6C B;  2ROZ B;  3EHV A;  4EOY A;  4EZK A;  2MX2 A;  1WH3 A;  1UBI A;  3FP5 A;  2JP2 A;  2K6Q A;  3IG3 A;  1XX0 A;  2KC1 A;  3PSC A;  2D2Q A;  1WJM A;  5KHQ A;  1SE9 A;  4BVU C;  2CHW A;  3BIN A;  1LM8 B;  4XWX A;  4W9J A;  5AZF A;  2Z0O A;  1YX5 B;  2KMA A;  1H4R A;  2MW5 A;  3ML8 A;  4BBN C;  2COD A;  2A5U A;  3D32 A;  4NJ6 A;  5FI0 A;  2FJ9 A;  5CHW A;  1FGZ A;  1YIW A;  4F7U P;  1KOT A;  2K6D B;  4DDG D;  2DHI A;  4IUM B;  2L0F A;  2N4F A;  2L0T A;  4TQ1 A;  1X1G A;  5LON B;  3A1Q A;  4Z2N A;  2IBI B;  1E5W A;  3OLM D;  3HQC A;  2CHZ A;  4IW0 A;  4HAT B;  1I42 A;  4FJV B;  3N7C A;  3TFM A;  1DYN A;  5JP4 A;  2O6V A;  3KZ1 A;  3PRE A;  1OQY A;  3ULB A;  2ASQ A;  2COP A;  2C9W B;  2LAS A;  4W9L A;  2DHZ A;  4YL8 A;  3NS8 A;  1BT0 A;  3DQV A;  5HKH A;  2WX1 A;  1C3T A;  4HB0 B;  3GOE A;  2W2X D;  4K7U A;  1OTR B;  4KIK A;  2FCN A;  1FHW A;  4HPL B;  2ZPN A;  1MK7 B;  2JPH A;  2DFK A;  2M8S A;  2MQJ A;  4IWQ A;  1X11 A;  4II2 B;  2FCM A;  2MLB A;  3L54 A;  1I7A A;  2DX1 A;  4NQK E;  4IC7 B;  2LOZ A;  2GMI C;  2V1Y A;  1MIX A;  4HPM B;  4DHZ E;  1GC6 A;  3ZTD A;  2C7N B;  1E8Z A;  2X18 A;  2LXC A;  1WZ3 A;  4DX8 A;  4TYZ A;  2K1F A;  4CYE A;  4IM3 A;  4IWP A;  4WAA A;  2DYB A;  2GBR A;  4NAW A;  2Y5B B;  4MGK E;  5L81 A;  4OVV A;  2KQS A;  4M8N A;  2AYO B;  2MWN B;  1BTN A;  2Z0P A;  2RGF A;  2WDT B;  1WGH A;  1AAR A;  3AJ4 A;  2NPT A;  3UQA A;  3QWZ B;  2ZJD A;  4PS3 A;  1TBE A;  4RM8 A;  1EAZ A;  1UNP A;  4NQL B;  2R2Q A;  1A5R A;  4GU2 A;  5C16 A;  1ZC3 B;  4LDT D;  2CAY A;  4KHB B;  3N30 A;  4W9C A;  5D2M B;  4JGH B;  2JZ3 B;  2DKQ A;  2DX5 A;  2V76 A;  4WJO A;  2OJR A;  3QAQ A;  1MG8 A;  4HCP B;  1WG7 A;  2GCL A;  4IWO A;  3APD A;  1GUA B;  2O6V B;  1H10 A;  2V4L A;  4EFO A;  3DXD A;  2D9W A;  1OY2 A;  3ZRF A;  3K9P B;  2R09 A;  1V49 A;  4IM2 A;  1NBF C;  3LJ3 A;  2DLW A;  4IOY X;  3JSV B;  2IY0 B;  2L00 B;  3AU4 A;  4KIK B;  4G50 A;  2FJL A;  2AWT A;  4PS7 A;  1WE6 A;  2K8B A;  3KUD B;  4A20 A;  4MK0 A;  4FHK A;  5FR6 A;  1P3R A;  1WJ1 A;  4I6N B;  1WMH B;  1GC7 A;  3T9L A;  3U8Z A;  2ZEQ A;  3QA8 A;  4J6I A;  4YON A;  2KTF A;  3EEC A;  4GPT B;  2NBU A;  3PRP B;  4BKS A;  3ZVR A;  1Q0W B;  2OOB B;  4FAD A;  3IVF A;  3ZIM A;  2D9X A;  4NAW B;  2RUK B;  2XBB C;  2KVR A;  1E7U A;  2J0M A;  2M0X A;  3KUZ A;  2NPT B;  2MBB B;  2BGF A;  2LUL A;  1DDV A;  2ELB A;  1M7R A;  1WX7 A;  3Q3J A;  3KH0 A;  4F1S A;  3ML9 A;  3PVU A;  2ZVO A;  2LGY A;  3ENE A;  3ONS A;  2R2O A;  1XD3 B;  1J8C A;  2EJ8 A;  4DBB A;  1YJ1 A;  5DCN A;  4ASW C;  3ZNG C;  2DX5 B;  1OMW A;  1K5D B;  1MIZ B;  2P0F A;  1FAO A;  1P3Q U;  2J0J A;  2ROV A;  4W9G A;  5BO4 B;  2C5L C;  2LD9 A;  4WWN A;  1KZG A;  1WY8 A;  2GBN A;  1EVH A;  1UD7 A;  4ICV A;  3ZNZ B;  4EZJ A;  4B95 A;  1V88 A;  5JHH A;  3FEH A;  2N0Y A;  3UQB A;  3DDC B;  5DPW A;  3VTW A;  3VQI A;  1V81 A;  1J0W A;  4CHM A;  2CQU A;  3A4R A;  4KSL C;  2EC1 A;  4DK5 A;  4WVF B;  4HAU B;  4MGY E;  2NMB A;  2RPQ A;  4PNK A;  3ZDM C;  2EMT A;  2Q13 A;  1TXD A;  5KQ1 A;  4HDO A;  3KYC D;  2JWZ A;  5DPR A;  3EC8 A;  1QC6 A;  1V61 A;  4WWP A;  4E74 A;  3VFK A;  3MDB C;  1WVH A;  3PV1 A;  1P9D U;  3EFU A;  3D8F A;  1NTI A;  2KQ7 A;  2W9N A;  1U5G A;  2LVO A;  5D3X A;  2L1C A;  5FI1 A;  4KVG B;  2YT0 A;  2H7E A;  3A98 B;  2YSZ A;  1YD8 U;  3OJ3 A;  2CY4 A;  2ZPY A;  1V5P A;  3ZW3 A;  1EF5 A;  2D9Y A;  1KLV A;  2KNB A;  2YS5 A;  2HRJ A;  3V61 A;  4AJY B;  5DH9 B;  2DA0 A;  4MH0 E;  3KVF B;  2M14 A;  3WAN A;  5IAA C;  4BOS C;  4NJ7 A;  4MGZ E;  2FID A;  4MY6 A;  1WI0 A;  1GNU A;  5LXI B;  5DHF B;  4Y94 A;  2K25 A;  3UIO B;  2RVB B;  1L2N A;  2DYM A;  4EJN A;  2D10 A;  3U7D A;  2LYD A;  2MFQ A;  5G2N A;  3ML4 A;  4MJS A;  2V3S A;  3VUY A;  4M0W B;  3ZRC A;  1WGU A;  3PHX B;  3TVV A;  2G4D B;  1RRP B;  4HHV A;  4K7S A;  3AUL A;  2L76 A;  2I1K A;  2I5F A;  4GMV A;  1WGY A;  5AZH A;  4DHJ D;  2LWP A;  2M4N A;  2G45 B;  4AP4 C;  4K7W A;  3DVG X;  3RT3 B;  2KDI A;  4EEW A;  4ZDV A;  3UF8 A;  4A6F A;  3KW5 B;  4HB4 B;  3GZN I;  1ZM0 A;  3KUC B;  3PRZ A;  3AXC A;  3VTV A;  1MPH A;  2CU1 A;  3P2B A;  4TV3 A;  3CF6 E;  2Y8F A;  5HE3 A;  2IY1 B;  3H1U A;  3A4S C;  2J59 M;  3C0R B;  4A6K A;  3P6A A;  1IYF A;  3TBL D;  3V5W A;  3VOQ A;  3VAW A;  1XD4 A;  4K17 A;  3WYF B;  1J19 A;  2DAF A;  3W1S A;  3UZT A;  4K2P A;  1DDM A;  1D3Z A;  1NU2 A;  2G4S A;  2ZZP B;  1PFJ A;  2C7H A;  4HAW B;  5IA7 A;  2NBV B;  3IFW B;  3TJP A;  2LG1 A;  2LRW A;  3NSU A;  2DYQ A;  4W9I A;  4ANV A;  2Z59 B;  1I2H A;  5JHB A;  4KZ0 A;  1BWN A;  3HM3 A;  1Y19 B;  2DZK A;  1HE8 A;  1G6J A;  5KCV A;  2PPH A;  3RCP A;  2BF8 B;  1XR0 B;  4GB9 A;  2CKH B;  2MA9 B;  2FCQ A;  5D94 A;  2JRH A;  3LJU X;  2KGX B;  2W2X C;  1WM2 A;  2RLO A;  1UBQ A;  3ECI A;  1X05 A;  2KWU B;  2WYQ A;  3CIK A;  2K2J A;  3WAP A;  4MJS B;  2YS3 A;  4A6H A;  3DBS A;  2YS1 A;  1WJ4 A;  4CO7 A;  3ZKJ C;  1RAX A;  2BPS A;  2RSU A;  3TO1 A;  2PEA A;  1MK9 B;  2RGN B;  3NZU A;  1WFY A;  1P0R A;  1LQB A;  2VRR B;  3DBL I;  1ACA A;  2YVC A;  5C5B A;  1YX6 B;  2ZVN A;  2DTC A;  1X1F A;  3PHW B;  1V5O A;  2KMC A;  5LXH A;  1KM7 A;  1V89 A;  2D9Z A;  2B3A A;  4X57 B;  1H8C A;  3L0W B;  5AZG A;  2G3Q B;  2DAJ A;  4MM3 A;  3CSF A;  4ANW A;  3H7S A;  1EUV B;  3ZLZ A;  2KJ6 A;  1ZVR A;  3BY4 B;  2HTH B;  2QKM A;  4II3 B;  3AU5 A;  1GG3 A;  3KSY A;  1WRD B;  3K9O B;  1WR1 A;  4HB2 B;  4NNJ B;  4DXA B;  2NCN A;  4AWJ A;  4BOZ B;  1E8W A;  2KO3 A;  3CXB B;  3M62 B;  4G3X B;  1PMS A;  1UGM A;  1OGW A;  4KHO A;  3OAW A;  1EF1 A;  4PYZ A;  1E7V A;  1SIF A;  1V2Y A;  3PS6 A;  4MSQ B;  3ZVV A;  4BKT A;  1RJ2 A;  1UNR A;  2CR5 A;  4JLC A;  2KDB A;  2N9X A;  1P6S A;  2GJY A;  2K39 A;  3DBR I;  3KYD D;  1W1H A;  1RRB A;  1E8Y A;  4BBK A;  2KDE B;  3GYP A;  3WA0 A;  3PLV A;  4EUT A;  4LJO B;  3IHP C;  4HVB A;  1U27 A;  3A1Q B;  2K2U A;  5J3Y A;  1M94 A;  5C5B B;  3SD5 A;  2DEN B;  2LBB A;  4GMX B;  3PP2 A;  2N9P C;  4KHA A;  4GGQ A;  2MWS B;  4EKU A;  4TQ0 A;  2LZ6 A;  2BKF A;  2NR2 A;  3P7Z A;  2BYE A;  2UZS A;  2PJH A;  2DZI A;  1SGH A;  1FHO A;  5J3Q A;  5JH5 C;  4E3C A;  1SHC A;  1ZSQ A;  4HXD A;  1C1Y B;  3VXW A;  4A3P A;  2KDF B;  4OVU A;  4W9H A;  1DRO A;  1S3S G;  4K2O A;  1PLS A;  3RZW C;  1Z2M A;  2COC A;  3PSE B;  2KKC A;  4HAX B;  2PZ1 A;  4Z2M B;  3VH3 B;  5CX3 A;  2MBH A;  5J18 A;  2O6V D;  2Z0E B;  1WZ0 A;  1NTY A;  3CST A;  2BCJ A;  1XQQ A;  3F5R A;  1WJU A;  4PYU A;  3N32 A;  3R7R A;  2D11 A;  4IAP A;  3FM8 C;  3FLV A;  2PE6 B;  1AQC A;  1WJ6 A;  2CS4 A;  2LVQ A;  5D3V A;  2LI5 A;  3GYO A;  4PS8 A;  1U5E A;  4MT7 A;  4ZRI A;  1TTN A;  3PLU A;  3ZDT A;  3V60 A;  1V9J A;  4EMO A;  2HE7 A;  5C23 A;  3A9J A;  2KC2 A;  4GDK A;  2P8V A;  1WJN A;  3TCA A;  1VCB A;  3UIP B;  2NVU I;  2OTX A;  2NBW B;  3UGB B;  2UVM A;  4DX9 0;  2GCJ A;  5JLJ B;  2D3G A;  2RSG A;  2HJ8 A;  1UZX B;  2L7R A;  2R0D A;  4ZRK A;  2HD5 B;  2KWV B;  3NZS A;  4KDL B;  2JT4 B;  2GBM A;  1UH6 A;  1TGZ B;  2Z0Q A;  2D4Q A;  1S1Q B;  4RM9 A;  4B9K A;  2FCS A;  2KHW B;  4FJY A;  4BBN F;  1B55 A;  2QHO A;  1P98 A;  4B6W A;  2UWQ A;  4BKG A;  1Q5W B;  1XT9 B;  4TUU A;  2D07 B;  2RD0 A;  3A8P A;  5D3W A;  2KX0 A;  1XOD A;  3L10 B;  5E6P A;  2VSZ A;  3ULC A;  3PVW A;  1WGG A;  5GMV A;  3T06 A;  5J3T A;  4E71 A;  1QZE A;  2REX A;  1BTK A;  2BWF A;  3NHE B;  3DXC A;  4G11 A;  1XKE A;  5D6J B;  3H9D A;  1LW3 A;  5C6R A;  2LXA A;  4ICU A;  1ZW7 A;  2QKL A;  1V80 A;  4JQW C;  5C1Z A;  3F0W A;  4EZL A;  2CHX A;  1LB1 A;  1DDW A;  2LOX A;  2K00 A;  3A9J B;  4MDK E;  4GDK B;  4GIV A;  2CB8 A;  3DCG A;  1V5M A;  2JZZ A;  3DPD A;  4BKS D;  3SDL C;  4HWI B;  2BYV E;  1Y8R C;  2ZNV B;  3WAL A;  4NSW A;  2KLG A;  2JUO A;  2KN5 A;  2KOX A;  4XZ4 A;  3H6N A;  4CHK A;  4AUQ C;  3PEG A;  3MHS D;  3W1Y A;  4KDI C;  5CHF A;  1WX8 A;  1IPG A;  1WIA A;  3R66 C;  2Y8G A;  2N1V A;  5E6N A;  4BFR A;  4K81 A;  2ZCB A;  3SNH A;  2MDX A;  2KD0 A;  5J2R A;  2I1J A;  2CY5 A;  3ODW A;  1CMX B;  1NVL A;  4I6L B;  3ZO5 B;  2G35 A;  1V5T A;  1ZGU B;  3SO6 A;  1WXV A;  2LUE A;  5DPS A;  1ZKH A;  3M3J A;  5LOP B;  4HAZ B;  2N23 A;  1Y5O A;  1ZC4 B;  3VUX A;  2RQ1 A;  3ZNI D;  4H8S A;  2FUH B;  3O96 A;  1T0Y A;  3A9K A;  3T8M A;  3U30 A;  2MBQ A;  3MJW A;  4KV2 A;  4HB3 B;  3QCA A;  2MKR A;  2FNJ B;  5G55 A;  1V6E A;  1V86 A;  4URK A;  2KX3 A;  3I3T B;  3PVL A;  3R3M A;  3PTF C;  1HB6 A;  3S2A A;  1V5U A;  2W2W A;  2DKP A;  5J17 A;  3QAR A;  2XK5 A;  3SYX A;  1Z5S B;  1X1M A;  3PPA A;  3SHQ A;  1UNQ A;  1F9J A;  1WM3 A;  3ZTC A;  4C0A A;  3RZF A;  2ADZ A;  2O2V A;  3R7Q A;  3VH4 B;  2LKO A;  4ANU A;  5D7G A;  3WAO A;  3PGE A;  4HDQ A;  2YRY A;  5CLL B;  3QX1 A;  3PZD A;  3MTN B;  4GSW A;  3VUW A;  1FHX A;  4A6F B;  4D0N B;  3L17 A;  5DI9 B;  4WJN A;  1XCG A;  5L95 C;  3V62 A;  2IFS A;  1EGX A;  5JHA A;  1DBH A;  4FJZ A;  4WJQ A;  5KQ4 A;  2KJH B;  5LLI A;  2JY6 A;  3X23 A;  4KZC A;  2E2X A;  4W9K A;  5C79 A;  3ODX A;  2ZCC A;  1UEF A;  1UPQ A;  3FSS A;  2XQN M;  1W1D A;  1K8R B;  3NOB A;  1WYW B;  2NZ8 B;  3DXE A;  3SU8 X;  3X0W A;  2D9V A;  2YT1 A;  2ELA A;  1Z87 A;  4LDT B;  3DBH I;  2LVP A;  3ALB A;  3OJ4 B;  2Z0D B;  3JSV A;  1WR6 E;  4GXB A;  2VRW B;  2L8J A;  3A9K B;  4GDL A;  2KCJ A;  4FHJ A;  3B1L X;  2GBK A;  3W1S C;  3QK0 A;  5HE1 A;  3TIX A;  4HCN B;  1NI2 A;  4F7Z A;  4PQ0 A;  4JL9 A;  4FUL A;  1WMH A;  2FIF A;  1U2B A;  2JF5 A;  2KWC A;  4DWF A;  1U4A A;  3QQ8 B;  1Q1O A;  4FN2 A;  3HIZ A;  2K8C A;  5CLQ B;  2K8H A;  4TKN A;  5KHO A;  4MEM A;  2IYD B;  4FA6 A;  2JRI B;  1WGR A;  2GBJ A;  2XK5 B;  1WXM A;  1W1G A;  2DHK A;  1PQS A;  1NDD A;  3B08 A;  3QHT A;  5HE2 A;  1E90 A;  2EKE C;  3RUL A;  4GZU A;  2O2V B;  4HLE A;  4KSK C;  1IP9 A;  2DN6 A;  2GOW A;  3D8E A;  3KRX A;  4AJW A;  2IYB A;  4IM0 A;  2XEW A;  3JYU A;  1RLF A;  2FAZ A;  3RYT A;  4W9F A;  3APC A;  2RNR B;  2J7Q B;  2UZR A;  3N3K B;  1NTV A;  1RFA A;  5L83 A;  1U5D A;  2KXJ A;  2N1W A;  3B0A A;  2N7D A;  2RR9 A;  2COF A;  2BWE S;  3UIN B;  3DOW A;  2LRU A;  5DPT A;  3A8Q A;  1AWE A;  1MKE A;  1WXS A;  4A3O A;  2JXX A;  5DIF B;  2COA A;  2DYO A;  4F7H A;  4HAY B;  3QBV B;  3CMM B;  3Q3F A;  1J0G A;  3L16 A;  4LCD E;  4HAV B;  3HK0 A;  4DHZ B;  2MBO A;  2C60 A;  2KJR A;  2M1M A;  4GDL B;  1OEY J;  2L05 A;  3DVN U;  1R4M I;  5EDS A;  3TL5 A;  4W9E A;  3V6E B;  2P0H A;  5DHA B;  3SUZ A;  3HHM A;  3L08 A;  2IO3 B;  5GOW B;  4GN1 A;  1OEY A;  3AI5 A;  1IRS A;  1KJT A;  3QC8 B;  2JVC A;  4I6P A;  1LFD A;  2DZJ A;  1FB8 A;  1WX9 A;  2AL3 A;  1WI1 A;  3QJZ A;  3ZUN A;  3WAM A;  1U29 A;  1TQZ A;  1VD2 A;  2DHJ A;  2MRP A;  1MAI A;  2YF0 A;  2KTR A;  2WWZ A;  2M17 A;  3D8D A; 
#chains in the Genus database with same CATH topology
 4ZRP A;  1QKZ A;  2GS0 A;  5E6O A;  2N7E A;  1YOV B;  3HVD A;  1UPR A;  1QOA A;  1P1A A;  2WU2 B;  4G0N B;  3ZNH B;  2L3Z A;  3UI3 A;  1WWT A;  1V8C A;  2K49 A;  2YLM A;  2WXG A;  1IBX B;  3BYY B;  1WGD A;  4CHJ A;  2NS5 A;  4IOI E;  4HK2 A;  2WGS A;  3H7P A;  2N9L A;  2UYZ B;  4MGI E;  1XF5 L;  4C7Z A;  2ABD A;  1GGO A;  4NPN A;  4WJP A;  4F7G A;  5CHV C;  2GRI A;  3HW2 B;  1QIL A;  4F8C B;  3EFC A;  1HTO A;  4A90 A;  3O65 B;  2KFK A;  1FXI A;  4QAY A;  3DHH C;  3QWM A;  1ST7 A;  3SBG A;  1WF9 A;  1FPY A;  4WSF A;  2N9E B;  1FGY A;  3ODO A;  2IZV B;  3IAS 1;  1YQB A;  4LLG M;  4DDI D;  2IJ0 A;  3IBE A;  2WLB A;  3JVZ X;  1P7E A;  2H7D A;  1P7F A;  1R7S A;  2A4Z A;  3HM6 X;  4RGO S;  1M7E A;  3TMP B;  2PVG C;  1GJZ A;  1I4H A;  3TEY A;  1U5F A;  2X8X X;  3PG7 A;  3DVG Y;  4RMA A;  4WWO A;  4XC2 A;  3MPX A;  1MJD A;  4L6E A;  1NEN B;  1OQN A;  5JZE B;  2RPV A;  3OAN A;  4P7I A;  4A8X C;  2KK8 A;  1N3H A;  3W9C B;  2MBE A;  3RNA C;  3VTU A;  2WXP A;  4WJ7 A;  4B6H A;  3DVN V;  1EO6 A;  3WIM A;  3Q8E A;  4WQO B;  2LGD A;  1JWS D;  1P5T A;  3G9W A;  2P0D A;  2PE9 A;  3RUI B;  1FOE A;  3Q2A C;  4NY0 A;  3C19 A;  4JK9 A;  2DYN A;  3I9V 1;  3FIL B;  3SR6 A;  1WE7 A;  2L2I A;  2LGX A;  3DHI C;  1KF6 B;  2KUP A;  4ZYN A;  4C4V B;  2R61 A;  3VRB B;  4DHJ B;  2AL6 A;  2IGG A;  3MHZ A;  4MEL A;  1JRU A;  2BYF A;  2MP2 A;  1IGC A;  3RD2 A;  2KZR A;  3BJI A;  3V05 A;  1FXT B;  1QF6 A;  3P4P B;  1ISN A;  2KTR B;  4ANX A;  2KFJ A;  4IG7 B;  3TEZ A;  4FLH A;  3T3O A;  5IJM A;  3M1I B;  1E8X A;  3Q8F A;  2IO2 B;  5EFX A;  4GNK B;  1FNU A;  2RRF A;  2KWD A;  3M63 B;  2PTL A;  5TR5 A;  3A33 B;  3EPY A;  1ZYI A;  4L1R A;  5AEK B;  3PRM B;  3NY5 A;  3MC9 A;  3RCZ A;  5JHG A;  4KGT A;  1JWM D;  3H7P B;  2C7M B;  4M8M A;  4N9F 4;  2EMS A;  3KY9 A;  5D27 A;  2J0K A;  1EM7 A;  1WXA A;  3ETR A;  4N58 A;  2BKR B;  2OQB A;  1FFV A;  5D3I B;  4XX5 A;  2IO1 B;  4K1R B;  3LDZ E;  2KFK B;  3VIA A;  2M38 A;  1T0R C;  4LJP B;  1TJ6 A;  1TZ1 A;  2ZNV C;  5HE0 A;  2KLC A;  1BAK A;  2BS3 B;  3U52 E;  4LTU A;  5H8Y E;  5CTR C;  3JW0 X;  1NYR A;  2DZM A;  2LJ5 A;  4A5K A;  4NJC A;  4ILH A;  1LXD A;  4AOF A;  2MSE D;  1I35 A;  4KAX B;  4R3D A;  2WX0 A;  3PT2 B;  4FBJ B;  3Q3N C;  1HB8 A;  3OWE B;  3L13 A;  4JIO U;  2VZK D;  3SV1 A;  1L7Y A;  2IO0 B;  1TT5 B;  4GOC A;  2CRF A;  2FDQ A;  1N5W A;  2UU7 A;  1HBK A;  4IFS A;  3M95 A;  1K5G B;  4HKQ A;  3W5V B;  3KRW A;  3ZJU A;  1UEL A;  1HA5 A;  1QQG A;  1M4V A;  3HRD D;  2Y7B A;  3B2G A;  3VVW B;  4ZRJ A;  1WGQ A;  2VKI A;  1KI1 B;  3APF A;  5D3Y A;  5LG4 B;  3RNG C;  3RNC C;  3QIJ A;  1Q67 A;  2WH5 A;  2M19 A;  3VHT C;  2AEH A;  1KZ7 A;  1R4N I;  4DBG A;  3VDZ A;  3NVW A;  2MCN B;  1GAQ B;  2KAN A;  2I5C A;  4MSM B;  1X86 A;  2HTH A;  4W9D A;  4HJK A;  3TW1 A;  2J42 A;  2JYE A;  2MP2 B;  2Y5C A;  3V6C B;  2ROZ B;  5BYR A;  3EHV A;  4EOY A;  2WP9 B;  4EZK A;  4YTN B;  2KIE A;  2MX2 A;  2LFI A;  3V3X A;  2KVZ A;  4JKB A;  1GB4 A;  1WH3 A;  1UBI A;  1KFY B;  3FP5 A;  2JP2 A;  2K6Q A;  3IG3 A;  1XX0 A;  2KC1 A;  3PSC A;  2I2Y A;  2D2Q A;  1WJM A;  1WXQ A;  3HVZ A;  5KHQ A;  1NEK B;  4RF1 A;  1SE9 A;  4JKE A;  2CHW A;  4BVU C;  2MEK A;  3BWU D;  3BIN A;  1LM8 B;  4XWX A;  4W9J A;  1YN3 A;  5AZF A;  2Z0O A;  1YX5 B;  2LEK A;  2KMA A;  1H4R A;  2MW5 A;  2KR0 A;  3ML8 A;  4BBN C;  3Q8B A;  4YWG G;  2COD A;  2A5U A;  2ICI A;  3D32 A;  4NJ6 A;  5FI0 A;  3DCX A;  1QOB A;  2FJ9 A;  5CHW A;  1FGZ A;  1YIW A;  4F7U P;  1UUP A;  1KOT A;  2K6D B;  2Z8L A;  5EE0 A;  3TUO A;  3U2S C;  2BTE A;  4DDG D;  5MPO A;  2DHI A;  5HFY A;  4IUM B;  4KHB A;  3AV8 A;  2L0F A;  2N4F A;  3AMZ A;  2PLP A;  2L0T A;  4TQ1 A;  1XXG A;  1X1G A;  2HDE A;  2W55 A;  5LON B;  3A1Q A;  4TSS A;  3P42 A;  4Z2N A;  2IBI B;  3AEG B;  2WXJ A;  5E6J A;  1E5W A;  2Z4D A;  3OLM D;  3ZGZ A;  3HQC A;  2CHZ A;  5I2S A;  4IW0 A;  4HAT B;  1FRR A;  1I42 A;  4FJV B;  4RFB A;  3N7C A;  3TFM A;  4D6W A;  1DYN A;  5JP4 A;  2O6V A;  2GI9 A;  3KZ1 A;  3PRE A;  1OQY A;  3CIR B;  3MFG A;  3ULB A;  2ASQ A;  4WWM A;  1JWB D;  2COP A;  2C9W B;  2LAS A;  2WXI A;  4W9L A;  1ZPS A;  2DHZ A;  3EGR A;  1I4X A;  4YL8 A;  3NS8 A;  1KRH A;  2WXL A;  1BT0 A;  3DQV A;  5HKH A;  2WX1 A;  4OVZ A;  1C3T A;  3NZ3 A;  4HB0 B;  3N1X C;  3GOE A;  2W2X D;  4K7U A;  1OTR B;  1HEZ E;  2FCN A;  2N9K A;  4KIK A;  1FHW A;  4HPL B;  2ZPN A;  2Y5P A;  1MK7 B;  1JRP A;  1ET6 A;  2JPH A;  4UDU C;  2DFK A;  2M8S A;  2MQJ A;  1QOG A;  1T0S C;  4IWQ A;  4C56 C;  1X11 A;  4II2 B;  2FCM A;  2MLB A;  3L54 A;  1I7A A;  4NAM A;  3EUB 2;  2DX1 A;  4NQK E;  4JK8 A;  2BBC A;  4IC7 B;  2LOZ A;  1NVI D;  2GMI C;  2V1Y A;  1MIX A;  3AN1 A;  4HPM B;  2WXF A;  4DHZ E;  3ZJT A;  1GC6 A;  3ZTD A;  2C7N B;  4WQM A;  1MPE A;  1E8Z A;  2X18 A;  2LXC A;  1WZ3 A;  2ACZ B;  3N9Y C;  1E10 A;  4DX8 A;  1XCQ L;  4TYZ A;  2K1F A;  2WXR A;  4CYE A;  4IM3 A;  4N59 A;  4IWP A;  4WAA A;  2DYB A;  2WQY B;  1OFF A;  3SBT A;  2GBR A;  4YSY B;  4EE2 A;  4NAW A;  2Y5B B;  4MGK E;  5L81 A;  4OVV A;  2KQS A;  5C2T B;  2H89 B;  4M8N A;  3AH7 A;  2AYO B;  3E66 A;  1BTN A;  2MWN B;  2Z0P A;  2RGF A;  2JSV X;  2WDT B;  1WGH A;  1AAR A;  3AJ4 A;  2NPT A;  3UQA A;  3QWZ B;  2ZJD A;  4PS3 A;  3TSS A;  1TBE A;  4RM8 A;  1EAZ A;  1UNP A;  1WRI A;  1CJE A;  3Q3O C;  4NQL B;  2CJO A;  2R2Q A;  1A5R A;  4GU2 A;  5C16 A;  2WXK A;  2BYT A;  1HXY D;  1ZC3 B;  4LDT D;  2KAJ A;  3I57 A;  1SXT A;  3U12 A;  2CAY A;  3B2F A;  4P1C C;  4KHB B;  1F2R I;  3N30 A;  4JWS C;  4W9C A;  5D2M B;  2MJE A;  3PO0 A;  4JGH B;  2JZ3 B;  5AUK A;  2DKQ A;  2DX5 A;  2V76 A;  4WJO A;  2DLB A;  4XDD A;  5GXG B;  2OJR A;  1XEE A;  1JML A;  3QAQ A;  1MG8 A;  1D4B A;  4HCP B;  1WG7 A;  2GCL A;  2JX5 A;  5BMH A;  2BB6 A;  4IWO A;  3APD A;  1GUA B;  2IND C;  3ENB A;  2O6V B;  1H10 A;  2V4L A;  4EFO A;  3DXD A;  2D9W A;  4MH8 A;  1SE4 A;  1OY2 A;  3ZRF A;  4XYC A;  3K9P B;  2R09 A;  1V49 A;  4IM2 A;  1JW9 D;  1NBF C;  1D5Z C;  1FXA A;  1RM6 C;  2WHI A;  3W5U B;  3LJ3 A;  2DLW A;  2IDY A;  4ZHP A;  4IOY X;  3JSV B;  4YXD B;  2IY0 B;  2L00 B;  3AU4 A;  4KIK B;  4RGN A;  4G50 A;  2FJL A;  1YN4 A;  2AWT A;  3VRA B;  3VR9 B;  2PKO A;  4PS7 A;  4LK0 M;  1WE6 A;  2K8B A;  3KUD B;  4A20 A;  5BMG A;  4MK0 A;  4FHK A;  3KWV A;  3DWM A;  5FR6 A;  1P3R A;  1WJ1 A;  4I6N B;  4ZYS A;  4LNK A;  1BXT A;  4JKA A;  1WMH B;  1GC7 A;  2AQ3 B;  4C80 A;  3N1Y C;  3T9L A;  3U8Z A;  2ZEQ A;  3QA8 A;  4J6I A;  4YON A;  2KTF A;  3EEC A;  4GPT B;  2NBU A;  2BQQ A;  2JXT A;  2YEP B;  4K3B A;  4K3C A;  3PRP B;  4BKS A;  1AYF A;  1FEH A;  3ZVR A;  4ZOH C;  2SEB D;  2QIL A;  1Q0W B;  2OOB B;  4FAD A;  3IVF A;  3ZIM A;  2D9X A;  4NAW B;  2RUK B;  2L1A A;  2XBB C;  2KVR A;  1E7U A;  2J0M A;  2M0X A;  3KUZ A;  1L5P A;  2NPT B;  2MBB B;  2BGF A;  2LUL A;  1DDV A;  2ELB A;  1VJK A;  1M7R A;  1WX7 A;  3H8H A;  3Q3J A;  3KH0 A;  4F1S A;  2JWU A;  3ML9 A;  4NZL B;  2E3T A;  3PVU A;  2ZVO A;  1PGX A;  2LGY A;  3ENE A;  3ONS A;  1DOY A;  2R2O A;  1XD3 B;  1J8C A;  2EJ8 A;  4DBB A;  1YJ1 A;  5DCN A;  4ASW C;  3MP9 A;  2DX5 B;  3ZNG C;  1OMW A;  3LYY A;  3ZQ4 A;  1UWM A;  4GOU A;  1K5D B;  1MIZ B;  3P4R B;  2P0F A;  1FAO A;  1P3Q U;  2J0J A;  1TIF A;  2ROV A;  4W9G A;  5BO4 B;  3FC4 A;  2C5L C;  2OED A;  2LD9 A;  4WWN A;  1KZG A;  1WY8 A;  2GBN A;  1SJH D;  1YMH E;  5FK9 C;  1EVH A;  1UD7 A;  4ICV A;  1IGD A;  3ZNZ B;  2KAC A;  4B95 A;  4EZJ A;  4KGR A;  1V88 A;  5JHH A;  4M0W A;  3FEH A;  2N0Y A;  3UQB A;  3DDC B;  5DPW A;  1QT9 A;  3VTW A;  3VQI A;  1V81 A;  1J0W A;  2B76 B;  4CHM A;  4JKG A;  2CQU A;  3BII D;  3A4R A;  3AE3 B;  4KSL C;  2EC1 A;  4DK5 A;  2IPK D;  4WVF B;  4HAU B;  4MGY E;  2NMB A;  2RPQ A;  1F1H A;  2INC C;  1N61 A;  4PNK A;  3ZDM C;  2EMT A;  1TXD A;  2Q13 A;  1PYW D;  2AQ2 B;  5KQ1 A;  4HDO A;  3TEW A;  3KYC D;  2JWZ A;  1XLO A;  5DPR A;  3EC8 A;  3DBR B;  2V3N A;  1QC6 A;  1V61 A;  1PDX A;  4WWP A;  4E74 A;  3VFK A;  1YQ4 B;  2QC8 A;  3MDB C;  1WVH A;  3PV1 A;  1P9D U;  3EFU A;  3D8F A;  2PVO D;  1NTI A;  2KQ7 A;  2W9N A;  1U5G A;  2IGD A;  3KWL A;  2LVO A;  1F2R C;  5D3X A;  5TSS A;  1T77 A;  3SEB A;  2L1C A;  1PGA A;  3P4Q B;  3IT4 B;  5FI1 A;  4KVG B;  2YT0 A;  2H7E A;  3A98 B;  2YSZ A;  1YD8 U;  3OJ3 A;  2CY4 A;  2ZPY A;  1V5P A;  3ZW3 A;  1EF5 A;  2D9Y A;  1KLV A;  2KNB A;  2YS5 A;  2HRJ A;  2W3R A;  3V61 A;  4AJY B;  5DH9 B;  2DA0 A;  4MH0 E;  4XWT A;  3KVF B;  2M14 A;  2WXM A;  1KLU D;  3WAN A;  5IAA C;  5BYQ A;  4BOS C;  1J7C A;  4NJ7 A;  4MGZ E;  2FID A;  3J9C A;  4WUR A;  4MY6 A;  2NBV A;  1WI0 A;  1GNU A;  5LXI B;  5DHF B;  4Y94 A;  2K25 A;  3FKY A;  2Z59 A;  4ILG B;  4B0E A;  1FNV A;  1FFU A;  1JWU D;  1EU3 A;  1K51 A;  2L52 A;  3UIO B;  2MJD A;  2YT2 A;  1I4P A;  2RVB B;  3DHG C;  4C00 A;  1L2N A;  5EE3 A;  2DYM A;  4EJN A;  2D10 A;  3U7D A;  1F0Z A;  1L0X B;  2LYD A;  3MC8 A;  2MFQ A;  5G2N A;  3ML4 A;  1FD6 A;  3PZ7 A;  4MJS A;  2V3S A;  5JXV A;  5G5G A;  4YSZ B;  3FAH A;  3VUY A;  2LJI A;  4M0W B;  1WGU A;  3ZRC A;  3PHX B;  3TVV A;  2G4D B;  1RRP B;  4HHV A;  4K7S A;  1ET9 A;  3AUL A;  3R2I A;  2L76 A;  4JKG B;  2I1K A;  2I5F A;  4GMV A;  1WGY A;  5AZH A;  1K53 A;  1VDV A;  4DHJ D;  2LWP A;  4HRO A;  2M4N A;  2XNA C;  2G45 B;  4AP4 C;  1N6Z A;  4K7W A;  3W2D A;  2JZP A;  3NVV A;  4HEA 1;  3DVG X;  3SFE B;  3RT3 B;  2KDI A;  4EEW A;  4ZDV A;  3UF8 A;  4A6F A;  4QXA B;  1N60 A;  3KW5 B;  4HB4 B;  2DWQ A;  3GZN I;  5C3J B;  5IOI A;  1SJE D;  2VH1 A;  1ZM0 A;  4A9A A;  1VBG A;  3KUC B;  5FKA C;  3PRZ A;  3AXC A;  2J53 A;  3VTV A;  4P1B C;  1MPH A;  2CU1 A;  3P2B A;  4TV3 A;  3CF6 E;  2Y8F A;  5HE3 A;  3Q8A A;  2IY1 B;  3H1U A;  1V1O A;  3A4S C;  2J59 M;  1NI3 A;  1ZDX A;  3C0R B;  4A6K A;  3CWI A;  1FRD A;  1SB3 C;  1ESF A;  3P6A A;  1HQR D;  2ON8 A;  1IYF A;  3TBL D;  3V5W A;  3VOQ A;  3VAW A;  1VZ6 A;  2NMQ A;  2X0S A;  1XD4 A;  4K17 A;  4XE0 A;  3WYF B;  1J19 A;  3AB5 A;  4HSI A;  1JCK B;  2DAF A;  3W1S A;  3UZT A;  3AE9 B;  4K2P A;  1DDM A;  1D3Z A;  4M00 A;  3FVC A;  2JQR B;  2QDF A;  1RYJ A;  3ZJV A;  1NU2 A;  3Q3M C;  2G4S A;  2R82 A;  2WXO A;  2ZZP B;  1PFJ A;  1VBH A;  2C7H A;  4HAW B;  5IA7 A;  2NBV B;  3IFW B;  3TJP A;  2LG1 A;  1TKE A;  2LRW A;  3NSU A;  2DYQ A;  5EE9 A;  2WXN A;  4W9I A;  5HI1 A;  4ANV A;  2Z59 B;  1I2H A;  2WS3 B;  5JHB A;  4KZ0 A;  1L0V B;  1BWN A;  3HM3 A;  4KKI A;  1TS2 A;  1Y19 B;  2DBY A;  2DZK A;  1HZ6 A;  1XLN A;  1HE8 A;  1SE2 A;  1G6J A;  5KCV A;  2PPH A;  3RCP A;  2V4I B;  2BF8 B;  4MT5 A;  1XR0 B;  4OZA A;  4GB9 A;  2CKH B;  3BVG A;  2MA9 B;  2FCQ A;  3IXS A;  5D94 A;  2JRH A;  3LJU X;  2KGX B;  1JQ4 A;  2W2X C;  1WM2 A;  2RLO A;  3L4P A;  1UBQ A;  2Z13 A;  3ECI A;  1X05 A;  3E9P A;  2KWU B;  2WYQ A;  3CIK A;  2K2J A;  1SSN A;  4MJS B;  5IO9 A;  3WAP A;  2YS3 A;  4A6H A;  1CZP A;  3DBS A;  3OHM B;  1KBL A;  3NVZ A;  2YS1 A;  1WJ4 A;  4CO7 A;  3ZKJ C;  1RAX A;  4Q2J A;  2BPS A;  3A58 A;  2RSU A;  5JVL A;  3TO1 A;  4HKZ E;  2PEA A;  1MK9 B;  2RGN B;  3NZU A;  1WFY A;  1P0R A;  1LQB A;  2WDR B;  2VRR B;  2KDM A;  3DBL I;  2D3A A;  1ACA A;  2YVC A;  5C5B A;  1YX6 B;  2ZVN A;  4BZA A;  2DTC A;  3BYT B;  1X1F A;  2YEP F;  4TMA B;  3PHW B;  4XDC A;  1V5O A;  2KMC A;  5LXH A;  1KM7 A;  2M0A A;  4S17 A;  1V89 A;  2D9Z A;  2W3S A;  2B3A A;  4X57 B;  3MC0 B;  1H8C A;  3L0W B;  5AZG A;  2IGH A;  2GLS A;  3RPF C;  2G3Q B;  2DAJ A;  4MM3 A;  3CSF A;  3AED B;  4ANW A;  1XLQ A;  3H7S A;  1EUV B;  4AS1 A;  3ZLZ A;  2KJ6 A;  2OJW A;  3P4S B;  1YJJ A;  3GE3 C;  1ZVR A;  3BY4 B;  2HTH B;  2QKM A;  1TYG B;  4II3 B;  3AU5 A;  2I38 A;  1GG3 A;  4L1B A;  1CK1 A;  2QCZ A;  2D3B A;  3KSY A;  1N63 A;  1WRD B;  2WDV B;  3K9O B;  1UNS A;  1WR1 A;  4HB2 B;  2JU6 X;  4XWW A;  4QJ3 B;  4NNJ B;  4DXA B;  2NCN A;  4AWJ A;  1SBB B;  1MG4 A;  2ZW1 A;  1AW7 A;  5D3D A;  1PUT A;  1TS4 A;  4BOZ B;  1E8W A;  2KO3 A;  3CXB B;  1C4C A;  3M62 B;  4G3X B;  2MH7 A;  1PMS A;  1UGM A;  3AE2 B;  1OGW A;  4KHO A;  1C4P A;  1YN5 A;  3OAW A;  2LUM A;  1GB1 A;  1EF1 A;  5H92 C;  2Q5W D;  3E9O A;  4PYZ A;  1E7V A;  1SIF A;  1MVK A;  3ZXV A;  1V2Y A;  2BB5 A;  3PS6 A;  4MSQ B;  3ZVV A;  4BKT A;  1RJ2 A;  4DQO C;  1UNR A;  3RNB C;  2DIK A;  1DOX A;  3BVZ A;  5IKC M;  2CR5 A;  1OQR A;  3GZN B;  4JLC A;  3SFD B;  1C9F A;  1JWA D;  2KDB A;  4REZ A;  2N9X A;  1P6S A;  2GJY A;  2K39 A;  1ZOY B;  3DBR I;  3KYD D;  1W1H A;  1RRB A;  1E8Y A;  4BBK A;  2KDE B;  1N5X A;  3GYP A;  3DWG C;  5I4D A;  3WA0 A;  4RGT A;  3URY A;  3PLV A;  4EUT A;  4LJO B;  3IHP C;  3T3N A;  4HVB A;  1U27 A;  3A1Q B;  1SIJ A;  2K2U A;  2KUQ A;  5J3Y A;  3AEC B;  4S0R A;  1M94 A;  3AE8 B;  5C5B B;  3SD5 A;  2DEN B;  2J4X A;  2LBB A;  4GMX B;  3PP2 A;  2N9P C;  4H2A A;  4KHA A;  4GGQ A;  2MWS B;  4EKU A;  4TQ0 A;  3B77 A;  2LZ6 A;  2BKF A;  2NR2 A;  4MM3 B;  2TSS A;  4HRS A;  4JKH A;  5EE1 A;  5IN7 A;  1C79 A;  2W82 A;  4J3O D;  3P7Z A;  2BYE A;  2UZS A;  2PJH A;  3RFZ B;  2OHF A;  2DZI A;  1T3Q A;  1SGH A;  1YJI A;  3GS2 A;  1FHO A;  2ZW0 A;  5J3Q A;  4KX6 B;  3BK2 A;  2KN4 A;  2WU5 B;  5JH5 C;  4E3C A;  1V97 A;  1SHC A;  1WSP A;  1ZSQ A;  1K52 A;  4HXD A;  1C1Y B;  4IKG A;  2LGS A;  3KQ4 A;  1PGB A;  3VXW A;  4A3P A;  2KDF B;  4OVU A;  1L6V A;  4W9H A;  3NG0 A;  1DRO A;  1S3S G;  4K2O A;  3AEF B;  3Q8C A;  4ARI A;  1PLS A;  2NTT A;  1WGK A;  3RZW C;  4B0M A;  1C77 A;  1Z2M A;  4BAX A;  4L2Y A;  2COC A;  3PSE B;  2XN9 C;  1I4R A;  2KKC A;  3MJ5 A;  4HAX B;  1YQ3 B;  2PMV A;  5T8I A;  2PZ1 A;  2QMT A;  4Z2M B;  1VLB A;  3DBL B;  4O1N A;  3VH3 B;  3HUI A;  1E6E B;  4LNN A;  2N0S B;  5CX3 A;  1IUE A;  2AX5 A;  2MBH A;  1YNT E;  1TY0 A;  5J18 A;  2O6V D;  4LNF A;  2Z0E B;  1WZ0 A;  1NTY A;  3CST A;  3RN9 C;  2V3P A;  2BCJ A;  1L0Y B;  1KH0 A;  1XQQ A;  3Q6B A;  3F5R A;  1WJU A;  4PYU A;  3N32 A;  3OG5 A;  3R7R A;  2PW9 A;  2D11 A;  4IAP A;  3FM8 C;  1Q10 A;  3FLV A;  2PE6 B;  1AQC A;  1WJ6 A;  2MHJ A;  1UF0 A;  1CQV A;  2CS4 A;  2LVQ A;  5D3V A;  2LI5 A;  4JPS A;  3GYO A;  4PS8 A;  1U5E A;  1PFD A;  4MT7 A;  1ZXI A;  4ZRI A;  4RNA A;  1TTN A;  3PLU A;  4AQ7 A;  3ZDT A;  3DBH B;  4OZC A;  4GLS C;  5BYS A;  3EA6 A;  3V60 A;  1V9J A;  2QEJ C;  1MHH E;  2N7J A;  4OHJ A;  4EMO A;  2HE7 A;  2FJU B;  5C23 A;  3A9J A;  2KC2 A;  4GDK A;  4ZRQ A;  2P8V A;  3ZXR A;  3RNF C;  1WJN A;  3TCA A;  1VCB A;  3UIP B;  2NVU I;  2OTX A;  3P63 A;  2NBW B;  4IDI A;  3UGB B;  2UVM A;  4DX9 0;  2GCJ A;  1D5X C;  5JLJ B;  2D3G A;  1STE A;  2D5G A;  2RSG A;  2HJ8 A;  1UZX B;  3NVY A;  2L7R A;  2LHE A;  2R0D A;  1TKY A;  1FO4 A;  2K22 A;  4ZRK A;  2HD5 B;  2KWV B;  3NZS A;  4KDL B;  1ACC A;  1ZDV A;  1NYQ A;  2JT4 B;  4WH4 A;  2GBM A;  1FIQ A;  3NW8 A;  1UH6 A;  1TGZ B;  3Q69 A;  2Z0Q A;  2D4Q A;  1S1Q B;  4RM9 A;  5IRS A;  3KLS X;  4JKD A;  2SAK A;  3C8Y A;  2BW2 A;  4B9K A;  2FCS A;  2HJ1 A;  4PK1 A;  4CQN A;  1FCL A;  3HIE A;  4D2K A;  3NRZ A;  4DIX A;  2PIA A;  1GPX A;  4M02 A;  4OW0 A;  2KHW B;  2WNM A;  4FJY A;  3R2T A;  2G1E A;  4BBN F;  1B55 A;  1DGJ A;  2QHO A;  1P98 A;  3AE6 B;  4B6W A;  2UWQ A;  4BKG A;  1Q5W B;  1FM0 D;  1XT9 B;  4TUU A;  2D07 B;  2RD0 A;  3A8P A;  5D3W A;  2KX0 A;  1ENF A;  1XOD A;  2INN E;  1UGJ A;  3L10 B;  5E6P A;  2VSZ A;  3ULC A;  2BS4 B;  3PVW A;  1WGG A;  2VZK B;  5GMV A;  5FR3 A;  3T06 A;  2E6X A;  4USA A;  2EEL A;  5J3T A;  4E71 A;  2Z14 A;  5G5H A;  1QZE A;  2REX A;  1BTK A;  2BWF A;  1B9R A;  5M4Y B;  4JKC A;  3NHE B;  3DXC A;  4G11 A;  1XKE A;  5D6J B;  1XO3 A;  3NJT A;  3H9D A;  1KLG D;  1LW3 A;  2BS2 B;  4RCO A;  5C6R A;  1I4Q A;  2LXA A;  1AN8 A;  4ICU A;  1ZW7 A;  2QKL A;  1V80 A;  4JQW C;  2FUG 1;  3F0W A;  5C1Z A;  4EZL A;  1VZ8 A;  2CHX A;  1DIK A;  1LB1 A;  1DDW A;  2LOX A;  3I63 C;  2V0G A;  2K00 A;  3A9J B;  4MDK E;  2WDQ B;  4GDK B;  4GIV A;  1L6U A;  2CB8 A;  3DCG A;  1V1P A;  1V5M A;  2JZZ A;  1R4M B;  2CJN A;  1N62 A;  3IAM 1;  3DPD A;  4BKS D;  3RMK C;  3SDL C;  4HWI B;  2BYV E;  1Y8R C;  2KMM A;  2ZNV B;  3WAL A;  2R2Y A;  4NSW A;  2QIE B;  2KLG A;  2JUO A;  3AM9 A;  5IP4 D;  3O13 A;  1FNW A;  3NWF A;  2KN5 A;  2KOX A;  4XZ4 A;  1KC7 A;  3H6N A;  4CHK A;  4AUQ C;  4JX1 C;  1RWS A;  4LNO A;  3PEG A;  3MHS D;  2KQ4 X;  3LB8 C;  4WAF A;  3W1Y A;  4YT0 B;  4KDI C;  5CHF A;  1WX8 A;  1I7H A;  1IPG A;  2INP E;  1QLB B;  1WIA A;  3PZ8 A;  3NS1 A;  1XCT L;  2K0P A;  4YTP B;  2RDG A;  3NUH B;  3R66 C;  3NWD A;  3ABV B;  3VR8 B;  2Y8G A;  2N1V A;  5E6N A;  2BVC A;  5I2M A;  4BFR A;  4K81 A;  2ZCB A;  2DNF A;  3E9S A;  4YTM B;  2LHD A;  3RI7 C;  3SNH A;  1EU4 A;  2MDX A;  2KD0 A;  4HPP A;  2I1J A;  5J2R A;  1B1Z A;  2CY5 A;  3ODW A;  1CMX B;  1NVL A;  1UWX A;  4I6L B;  4RGM A;  2K5P A;  2K9X A;  1LGR A;  4US9 A;  2KIG A;  3ZO5 B;  2AQ1 B;  2FBW B;  2G35 A;  1V5T A;  1ZGU B;  3GB1 A;  2CU3 A;  3SO6 A;  1WXV A;  2LUE A;  3P1M A;  1C76 A;  1HTQ A;  5DPS A;  1ZXH A;  1ZKH A;  4P6V F;  3M3J A;  5LOP B;  4HAZ B;  2JYT A;  2N23 A;  1Y5O A;  1ZC4 B;  3VUX A;  2RQ1 A;  3ZNI D;  4H8S A;  2FUH B;  3O96 A;  1T0Y A;  3A9K A;  3T8M A;  3U30 A;  2MBQ A;  3MJW A;  4KV2 A;  1ZE3 D;  4HB3 B;  1K50 A;  3QCA A;  1J7A A;  2MKR A;  2J52 A;  3BZD B;  2K8E A;  2FNJ B;  4FXC A;  2G9H D;  4ARC A;  2H88 B;  5G55 A;  1FCC C;  1V6E A;  1V86 A;  4URK A;  4M01 A;  2KX3 A;  3I3T B;  4A55 A;  3PVL A;  3R3M A;  3PTF C;  2MJ3 A;  1HB6 A;  4XGA B;  3S2A A;  1D6E C;  1V5U A;  3AE7 B;  2W2W A;  2FE8 A;  2ZKM X;  2DKP A;  5J17 A;  2X38 A;  3QAR A;  2XK5 A;  4RF0 A;  1MFW A;  1V1P B;  4L23 A;  3SYX A;  4QJ5 B;  1Z5S B;  1X1M A;  1TY2 A;  3PPA A;  1Y56 A;  3SHQ A;  1UNQ A;  1F9J A;  1WM3 A;  3ZTC A;  4C0A A;  3RZF A;  2ADZ A;  2O2V A;  3R7Q A;  3VH4 B;  2NTS A;  2LKO A;  1MI0 A;  1DOI A;  4ANU A;  5D7G A;  3WAO A;  3PGE A;  3RNE C;  1E9M A;  1F52 A;  4HDQ A;  2YRY A;  1JAL A;  2K3U A;  5CLL B;  3NWA A;  1TJE A;  3QX1 A;  3PZD A;  3E9L A;  2W54 A;  2M56 B;  3MTN B;  4GSW A;  3VUW A;  1FHX A;  2QJL A;  4A6F B;  4D0N B;  1RFK A;  1MI1 A;  3WCQ A;  4ILJ A;  1HZ5 A;  2LGI A;  3L17 A;  5DI9 B;  4WJN A;  1XCG A;  4P16 A;  5L95 C;  3V62 A;  3B9J A;  2IFS A;  1EGX A;  1F77 A;  5JHA A;  1QOF A;  1DBH A;  4FJZ A;  4WJQ A;  5KQ4 A;  2KJH B;  5LLI A;  2JY6 A;  3X23 A;  4OZB A;  3TEX A;  4KZC A;  2Y3A A;  4PT5 A;  1TKG A;  2E2X A;  5C79 A;  4W9K A;  3ODX A;  2ZCC A;  1UEF A;  4LNI A;  1UPQ A;  3FSS A;  2XQN M;  1W1D A;  1K8R B;  3NOB A;  1WYW B;  2NZ8 B;  3DXE A;  3SU8 X;  4RH6 A;  2L83 A;  2VH2 A;  3X0W A;  2D9V A;  2YT1 A;  2ELA A;  2HTM E;  1Z87 A;  1E0Z A;  4LDT B;  3DBH I;  1MHX A;  2LVP A;  3ALB A;  3OJ4 B;  1QQR A;  2Z0D B;  4N6E B;  3JSV A;  2RDB C;  1WR6 E;  4US8 A;  4GXB A;  2VRW B;  4QJ4 B;  2L8J A;  1SE3 A;  3U7Z A;  3A9K B;  4GDL A;  2D3C A;  2KCJ A;  1VZ7 A;  4ITK A;  1FMA D;  4FHJ A;  3B1L X;  2GBK A;  3W1S C;  5AUI A;  4ZHO A;  3QK0 A;  5HE1 A;  3TIX A;  4HCN B;  1NI2 A;  3BK1 A;  4F7Z A;  4PQ0 A;  2KYW A;  4JL9 A;  4FUL A;  1WMH A;  2FIF A;  1U2B A;  2JF5 A;  4JE3 B;  2KWC A;  4DXG A;  4DWF A;  1U4A A;  3QQ8 B;  1Q1O A;  4FN2 A;  3AE4 B;  2BT6 A;  3HIZ A;  2K8C A;  5CLQ B;  2K8H A;  4TKN A;  3AEE B;  5KHO A;  4MAC A;  4MEM A;  2IYD B;  4FA6 A;  2JRI B;  1WGR A;  4JKF A;  1VR9 A;  2GBJ A;  2LMC A;  2XK5 B;  1WXM A;  1W1G A;  2DHK A;  1PQS A;  4DXF A;  1D5M C;  1NDD A;  3B08 A;  1JRO A;  3QHT A;  4OT1 A;  5HE2 A;  1E90 A;  1BML C;  2EKE C;  1SEB D;  3RUL A;  4GZU A;  2O2V B;  1AWD A;  4HLE A;  1ROE A;  4KSK C;  1IP9 A;  2DN6 A;  2L32 A;  2EKI A;  2GOW A;  3AE1 B;  3U4E G;  3D8E A;  3KRX A;  4AJW A;  2IYB A;  4ACF A;  4IM0 A;  2XEW A;  3JYU A;  1RLF A;  2FAZ A;  3RYT A;  4W9F A;  3I5J C;  3GP7 A;  1C78 A;  1L4Z B;  1R4N B;  3APC A;  2RNR B;  2J7Q B;  2UZR A;  3N3K B;  3BVM A;  5HG2 A;  1NTV A;  1RFA A;  5L83 A;  1U5D A;  1I4G A;  5HHD G;  4KKJ A;  1XLP A;  1IBX A;  1T0Q C;  3N1Z C;  2KXJ A;  2N1W A;  3HSA A;  3IT6 B;  1LO5 D;  3B0A A;  2N7D A;  2RR9 A;  2COF A;  1VRA B;  2BWE S;  3UIN B;  1T5X D;  4JK7 A;  4HJG E;  1BUI C;  3DOW A;  2LRU A;  2WXQ A;  5DPT A;  2RMM A;  1ZUD 2;  1KTK A;  3A8Q A;  1AWE A;  1MKE A;  1A70 A;  1WXS A;  3N20 C;  4A3O A;  1E7P B;  3AEB B;  2JXX A;  5DIF B;  2COA A;  2DYO A;  4F7H A;  4HAY B;  4JWU C;  1OQQ A;  3QBV B;  4OSN A;  3CMM B;  3Q3F A;  1J0G A;  4WIP A;  3L16 A;  4LCD E;  3Q14 C;  4HAV B;  3HK0 A;  4DHZ B;  2MBO A;  3AE5 B;  2C60 A;  1T6B X;  3AEA B;  1J7B A;  1TS3 A;  2KJR A;  2M1M A;  4GDL B;  3E56 A;  1OEY J;  1ZP0 B;  1TZO A;  2L05 A;  3DVN U;  1R4M I;  4C7Y A;  5EDS A;  1DYQ A;  3TL5 A;  2QSD A;  4W9E A;  3V6E B;  2P0H A;  5DHA B;  3R8B A;  5BMI A;  3SUZ A;  3HHM A;  2RDH A;  3L08 A;  2IO3 B;  3LXF A;  1TS5 A;  5GOW B;  4GN1 A;  1OEY A;  4YSX B;  4CSQ A;  2GB1 A;  3FIL A;  2GUM A;  3AI5 A;  4KGS A;  4C4V A;  1IRS A;  1KJT A;  3QC8 B;  5LNK 1;  1WYG A;  1C4A A;  2WXH A;  2JVC A;  1EWC A;  4I6P A;  1LFD A;  2DZJ A;  1FB8 A;  1WX9 A;  2AL3 A;  1WI1 A;  2KT7 A;  3QJZ A;  3ZUN A;  1EWY C;  1JDE A;  2ONQ A;  1SF0 A;  3WAM A;  2V9H A;  1U29 A;  1TQZ A;  1VD2 A;  2DHJ A;  2MRP A;  1MAI A;  2YF0 A;  1GOZ A;  2KTR A;  3ZYY X;  1L4D B;  3GE8 C;  4A6Q A;  2WWZ A;  2M17 A;  3D8D A; 
#chains in the Genus database with same CATH homology
 2GS0 A;  5E6O A;  2N7E A;  1UPR A;  1P1A A;  4G0N B;  3ZNH B;  2L3Z A;  2YLM A;  1WGD A;  4CHJ A;  2NS5 A;  4HK2 A;  3H7P A;  2UYZ B;  4MGI E;  2ABD A;  1GGO A;  4NPN A;  4WJP A;  4F7G A;  5CHV C;  3HW2 B;  4F8C B;  3O65 B;  2KFK A;  3QWM A;  1ST7 A;  3SBG A;  1WF9 A;  4WSF A;  2N9E B;  1FGY A;  3ODO A;  2IZV B;  1YQB A;  4DDI D;  3IBE A;  3JVZ X;  2H7D A;  2A4Z A;  3HM6 X;  1M7E A;  3TMP B;  1GJZ A;  1U5F A;  3PG7 A;  3DVG Y;  4RMA A;  4WWO A;  4XC2 A;  3MPX A;  4L6E A;  1OQN A;  5JZE B;  3OAN A;  4P7I A;  2KK8 A;  1N3H A;  2MBE A;  3VTU A;  4WJ7 A;  4B6H A;  3DVN V;  1EO6 A;  3WIM A;  4WQO B;  2LGD A;  1P5T A;  3G9W A;  2P0D A;  2PE9 A;  3RUI B;  1FOE A;  4NY0 A;  4JK9 A;  2DYN A;  1WE7 A;  2L2I A;  2LGX A;  2KUP A;  4ZYN A;  4DHJ B;  2AL6 A;  4MEL A;  1JRU A;  2BYF A;  2MP2 A;  3RD2 A;  2KZR A;  3BJI A;  1FXT B;  1ISN A;  2KTR B;  4ANX A;  2KFJ A;  4IG7 B;  4FLH A;  5IJM A;  3M1I B;  1E8X A;  2IO2 B;  5EFX A;  3M63 B;  5TR5 A;  3A33 B;  3EPY A;  5AEK B;  3PRM B;  3NY5 A;  3RCZ A;  5JHG A;  3H7P B;  2C7M B;  4M8M A;  4N9F 4;  2EMS A;  3KY9 A;  5D27 A;  2J0K A;  1WXA A;  2BKR B;  2OQB A;  4XX5 A;  2IO1 B;  4K1R B;  3LDZ E;  2KFK B;  3VIA A;  2M38 A;  4LJP B;  1TJ6 A;  1TZ1 A;  2ZNV C;  5HE0 A;  2KLC A;  1BAK A;  5CTR C;  3JW0 X;  2DZM A;  2LJ5 A;  4A5K A;  4ILH A;  1LXD A;  4AOF A;  2MSE D;  1I35 A;  4KAX B;  2WX0 A;  3PT2 B;  4FBJ B;  1HB8 A;  4JIO U;  3L13 A;  3SV1 A;  1L7Y A;  2IO0 B;  4GOC A;  2CRF A;  2FDQ A;  1HBK A;  4IFS A;  3M95 A;  1K5G B;  3KRW A;  1UEL A;  1QQG A;  2Y7B A;  3VVW B;  4ZRJ A;  1WGQ A;  2VKI A;  1KI1 B;  3APF A;  5D3Y A;  3QIJ A;  1Q67 A;  2WH5 A;  3VHT C;  2AEH A;  1KZ7 A;  1R4N I;  4DBG A;  3VDZ A;  2MCN B;  2KAN A;  2I5C A;  4MSM B;  1X86 A;  2HTH A;  4W9D A;  4HJK A;  3TW1 A;  2MP2 B;  3V6C B;  2ROZ B;  3EHV A;  4EOY A;  4EZK A;  2MX2 A;  4JKB A;  1WH3 A;  1UBI A;  3FP5 A;  2JP2 A;  2K6Q A;  3IG3 A;  1XX0 A;  2KC1 A;  3PSC A;  2D2Q A;  1WJM A;  5KHQ A;  1SE9 A;  4JKE A;  2CHW A;  4BVU C;  3BIN A;  1LM8 B;  4XWX A;  4W9J A;  5AZF A;  2Z0O A;  1YX5 B;  2KMA A;  1H4R A;  2MW5 A;  3ML8 A;  4BBN C;  2COD A;  2A5U A;  3D32 A;  4NJ6 A;  5FI0 A;  2FJ9 A;  5CHW A;  1FGZ A;  1YIW A;  4F7U P;  1KOT A;  2K6D B;  4DDG D;  2DHI A;  4IUM B;  2L0F A;  2N4F A;  2L0T A;  4TQ1 A;  1X1G A;  5LON B;  3A1Q A;  4Z2N A;  2IBI B;  1E5W A;  3OLM D;  3HQC A;  2CHZ A;  4IW0 A;  4HAT B;  1I42 A;  4FJV B;  3N7C A;  3TFM A;  1DYN A;  5JP4 A;  2O6V A;  3KZ1 A;  3PRE A;  1OQY A;  3ULB A;  2ASQ A;  2COP A;  2C9W B;  2LAS A;  4W9L A;  2DHZ A;  4YL8 A;  3NS8 A;  1BT0 A;  3DQV A;  5HKH A;  2WX1 A;  1C3T A;  4HB0 B;  3GOE A;  2W2X D;  4K7U A;  1OTR B;  4KIK A;  2FCN A;  1FHW A;  4HPL B;  2ZPN A;  1MK7 B;  2JPH A;  2DFK A;  2M8S A;  2MQJ A;  4IWQ A;  1X11 A;  4II2 B;  2FCM A;  2MLB A;  3L54 A;  1I7A A;  2DX1 A;  4NQK E;  4JK8 A;  4IC7 B;  2LOZ A;  2GMI C;  2V1Y A;  1MIX A;  4HPM B;  4DHZ E;  1GC6 A;  3ZTD A;  2C7N B;  1E8Z A;  2X18 A;  2LXC A;  1WZ3 A;  4DX8 A;  4TYZ A;  2K1F A;  4CYE A;  4IM3 A;  4IWP A;  4WAA A;  2DYB A;  3SBT A;  2GBR A;  4NAW A;  2Y5B B;  4MGK E;  5L81 A;  4OVV A;  2KQS A;  4M8N A;  2AYO B;  3E66 A;  1BTN A;  2MWN B;  2Z0P A;  2RGF A;  2WDT B;  1WGH A;  1AAR A;  3AJ4 A;  2NPT A;  3UQA A;  3QWZ B;  2ZJD A;  4PS3 A;  1TBE A;  4RM8 A;  1EAZ A;  1UNP A;  4NQL B;  2R2Q A;  1A5R A;  4GU2 A;  5C16 A;  1ZC3 B;  4LDT D;  2CAY A;  4KHB B;  3N30 A;  4W9C A;  5D2M B;  4JGH B;  2JZ3 B;  2DKQ A;  2DX5 A;  2V76 A;  4WJO A;  2OJR A;  3QAQ A;  1MG8 A;  4HCP B;  1WG7 A;  2GCL A;  4IWO A;  3APD A;  1GUA B;  3ENB A;  2O6V B;  1H10 A;  2V4L A;  4EFO A;  3DXD A;  2D9W A;  1OY2 A;  3ZRF A;  3K9P B;  2R09 A;  1V49 A;  4IM2 A;  1NBF C;  3LJ3 A;  2DLW A;  4IOY X;  3JSV B;  2IY0 B;  2L00 B;  3AU4 A;  4KIK B;  4G50 A;  2FJL A;  2AWT A;  4PS7 A;  1WE6 A;  2K8B A;  3KUD B;  4A20 A;  4MK0 A;  4FHK A;  5FR6 A;  1P3R A;  1WJ1 A;  4I6N B;  4JKA A;  1WMH B;  1GC7 A;  3T9L A;  3U8Z A;  2ZEQ A;  3QA8 A;  4J6I A;  4YON A;  2KTF A;  3EEC A;  4GPT B;  2NBU A;  3PRP B;  4BKS A;  3ZVR A;  1Q0W B;  2OOB B;  4FAD A;  3IVF A;  3ZIM A;  2D9X A;  4NAW B;  2RUK B;  2XBB C;  2KVR A;  1E7U A;  2J0M A;  2M0X A;  3KUZ A;  2NPT B;  2MBB B;  2BGF A;  2LUL A;  1DDV A;  2ELB A;  1M7R A;  1WX7 A;  3Q3J A;  3KH0 A;  4F1S A;  3ML9 A;  3PVU A;  2ZVO A;  2LGY A;  3ENE A;  3ONS A;  2R2O A;  1XD3 B;  1J8C A;  2EJ8 A;  4DBB A;  1YJ1 A;  5DCN A;  4ASW C;  3ZNG C;  2DX5 B;  1OMW A;  1K5D B;  1MIZ B;  2P0F A;  1FAO A;  1P3Q U;  2J0J A;  2ROV A;  4W9G A;  5BO4 B;  2C5L C;  2LD9 A;  4WWN A;  1KZG A;  1WY8 A;  2GBN A;  1EVH A;  1UD7 A;  4ICV A;  3ZNZ B;  4EZJ A;  4B95 A;  1V88 A;  5JHH A;  3FEH A;  2N0Y A;  3UQB A;  3DDC B;  5DPW A;  3VTW A;  3VQI A;  1V81 A;  1J0W A;  4CHM A;  4JKG A;  2CQU A;  3A4R A;  4KSL C;  2EC1 A;  4DK5 A;  4WVF B;  4HAU B;  4MGY E;  2NMB A;  2RPQ A;  4PNK A;  3ZDM C;  2EMT A;  2Q13 A;  1TXD A;  5KQ1 A;  4HDO A;  3KYC D;  2JWZ A;  5DPR A;  3EC8 A;  1QC6 A;  1V61 A;  4WWP A;  4E74 A;  3VFK A;  3MDB C;  1WVH A;  3PV1 A;  1P9D U;  3EFU A;  3D8F A;  1NTI A;  2KQ7 A;  2W9N A;  1U5G A;  2LVO A;  5D3X A;  2L1C A;  5FI1 A;  4KVG B;  2YT0 A;  2H7E A;  3A98 B;  2YSZ A;  1YD8 U;  3OJ3 A;  2CY4 A;  2ZPY A;  1V5P A;  3ZW3 A;  1EF5 A;  2D9Y A;  1KLV A;  2KNB A;  2YS5 A;  2HRJ A;  3V61 A;  4AJY B;  5DH9 B;  2DA0 A;  4MH0 E;  3KVF B;  2M14 A;  3WAN A;  5IAA C;  4BOS C;  4NJ7 A;  4MGZ E;  2FID A;  4MY6 A;  1WI0 A;  1GNU A;  5LXI B;  5DHF B;  4Y94 A;  2K25 A;  4ILG B;  3UIO B;  2RVB B;  1L2N A;  2DYM A;  4EJN A;  2D10 A;  3U7D A;  2LYD A;  2MFQ A;  5G2N A;  3ML4 A;  4MJS A;  2V3S A;  3VUY A;  4M0W B;  3ZRC A;  1WGU A;  3PHX B;  3TVV A;  2G4D B;  1RRP B;  4HHV A;  4K7S A;  3AUL A;  2L76 A;  4JKG B;  2I1K A;  2I5F A;  4GMV A;  1WGY A;  5AZH A;  4DHJ D;  2LWP A;  2M4N A;  2G45 B;  4AP4 C;  4K7W A;  3DVG X;  3RT3 B;  2KDI A;  4EEW A;  4ZDV A;  3UF8 A;  4A6F A;  3KW5 B;  4HB4 B;  3GZN I;  1ZM0 A;  1VBG A;  3KUC B;  3PRZ A;  3AXC A;  3VTV A;  1MPH A;  2CU1 A;  3P2B A;  4TV3 A;  3CF6 E;  2Y8F A;  5HE3 A;  2IY1 B;  3H1U A;  3A4S C;  2J59 M;  3C0R B;  4A6K A;  3P6A A;  1IYF A;  3TBL D;  3V5W A;  3VOQ A;  3VAW A;  2X0S A;  1XD4 A;  4K17 A;  3WYF B;  1J19 A;  2DAF A;  3W1S A;  3UZT A;  4K2P A;  1DDM A;  1D3Z A;  1NU2 A;  2G4S A;  2R82 A;  2ZZP B;  1PFJ A;  1VBH A;  2C7H A;  4HAW B;  5IA7 A;  2NBV B;  3IFW B;  3TJP A;  2LG1 A;  2LRW A;  3NSU A;  2DYQ A;  4W9I A;  4ANV A;  2Z59 B;  1I2H A;  5JHB A;  4KZ0 A;  1BWN A;  3HM3 A;  1Y19 B;  2DZK A;  1HE8 A;  1G6J A;  5KCV A;  2PPH A;  3RCP A;  2BF8 B;  1XR0 B;  4GB9 A;  2CKH B;  2MA9 B;  2FCQ A;  5D94 A;  2JRH A;  3LJU X;  2KGX B;  2W2X C;  1WM2 A;  2RLO A;  1UBQ A;  3ECI A;  1X05 A;  3E9P A;  2KWU B;  2WYQ A;  3CIK A;  2K2J A;  3WAP A;  4MJS B;  2YS3 A;  4A6H A;  3DBS A;  1KBL A;  2YS1 A;  1WJ4 A;  4CO7 A;  3ZKJ C;  1RAX A;  2BPS A;  2RSU A;  5JVL A;  3TO1 A;  2PEA A;  1MK9 B;  2RGN B;  3NZU A;  1WFY A;  1P0R A;  1LQB A;  2VRR B;  3DBL I;  1ACA A;  2YVC A;  5C5B A;  1YX6 B;  2ZVN A;  2DTC A;  1X1F A;  3PHW B;  1V5O A;  2KMC A;  5LXH A;  1KM7 A;  1V89 A;  2D9Z A;  2B3A A;  4X57 B;  1H8C A;  3L0W B;  5AZG A;  2G3Q B;  2DAJ A;  4MM3 A;  3CSF A;  4ANW A;  3H7S A;  1EUV B;  3ZLZ A;  2KJ6 A;  1ZVR A;  3BY4 B;  2HTH B;  2QKM A;  4II3 B;  3AU5 A;  1GG3 A;  3KSY A;  1WRD B;  3K9O B;  1WR1 A;  4HB2 B;  4NNJ B;  4DXA B;  2NCN A;  4AWJ A;  4BOZ B;  1E8W A;  2KO3 A;  3CXB B;  3M62 B;  4G3X B;  1PMS A;  1UGM A;  1OGW A;  4KHO A;  3OAW A;  1EF1 A;  3E9O A;  4PYZ A;  1E7V A;  1SIF A;  1V2Y A;  3PS6 A;  4MSQ B;  3ZVV A;  4BKT A;  1RJ2 A;  1UNR A;  2DIK A;  2CR5 A;  4JLC A;  2KDB A;  2N9X A;  1P6S A;  2GJY A;  2K39 A;  3DBR I;  3KYD D;  1W1H A;  1RRB A;  1E8Y A;  4BBK A;  2KDE B;  3GYP A;  3WA0 A;  3PLV A;  4EUT A;  4LJO B;  3IHP C;  4HVB A;  1U27 A;  3A1Q B;  2K2U A;  5J3Y A;  1M94 A;  5C5B B;  3SD5 A;  2DEN B;  2LBB A;  4GMX B;  3PP2 A;  2N9P C;  4KHA A;  4GGQ A;  2MWS B;  4EKU A;  4TQ0 A;  2LZ6 A;  2BKF A;  2NR2 A;  4JKH A;  3P7Z A;  2BYE A;  2UZS A;  2PJH A;  2DZI A;  1SGH A;  1FHO A;  5J3Q A;  5JH5 C;  4E3C A;  1SHC A;  1ZSQ A;  4HXD A;  1C1Y B;  3VXW A;  4A3P A;  2KDF B;  4OVU A;  4W9H A;  1DRO A;  1S3S G;  4K2O A;  1PLS A;  3RZW C;  1Z2M A;  2COC A;  3PSE B;  2KKC A;  4HAX B;  2PZ1 A;  4Z2M B;  3VH3 B;  5CX3 A;  2MBH A;  5J18 A;  2O6V D;  2Z0E B;  1WZ0 A;  1NTY A;  3CST A;  2BCJ A;  1XQQ A;  3F5R A;  1WJU A;  4PYU A;  3N32 A;  3R7R A;  2D11 A;  4IAP A;  3FM8 C;  3FLV A;  2PE6 B;  1AQC A;  1WJ6 A;  2CS4 A;  2LVQ A;  5D3V A;  2LI5 A;  3GYO A;  4PS8 A;  1U5E A;  4MT7 A;  4ZRI A;  1TTN A;  3PLU A;  3ZDT A;  3V60 A;  1V9J A;  4EMO A;  2HE7 A;  5C23 A;  3A9J A;  2KC2 A;  4GDK A;  2P8V A;  1WJN A;  3TCA A;  1VCB A;  3UIP B;  2NVU I;  2OTX A;  2NBW B;  3UGB B;  2UVM A;  4DX9 0;  2GCJ A;  5JLJ B;  2D3G A;  2RSG A;  2HJ8 A;  1UZX B;  2L7R A;  2R0D A;  4ZRK A;  2HD5 B;  2KWV B;  3NZS A;  4KDL B;  2JT4 B;  2GBM A;  1UH6 A;  1TGZ B;  2Z0Q A;  2D4Q A;  1S1Q B;  4RM9 A;  4JKD A;  4B9K A;  2FCS A;  2KHW B;  4FJY A;  4BBN F;  1B55 A;  2QHO A;  1P98 A;  4B6W A;  2UWQ A;  4BKG A;  1Q5W B;  1XT9 B;  4TUU A;  2D07 B;  2RD0 A;  3A8P A;  5D3W A;  2KX0 A;  1XOD A;  3L10 B;  5E6P A;  2VSZ A;  3ULC A;  3PVW A;  1WGG A;  5GMV A;  3T06 A;  5J3T A;  4E71 A;  1QZE A;  2REX A;  1BTK A;  2BWF A;  4JKC A;  3NHE B;  3DXC A;  4G11 A;  1XKE A;  5D6J B;  3H9D A;  1LW3 A;  5C6R A;  2LXA A;  4ICU A;  1ZW7 A;  2QKL A;  1V80 A;  4JQW C;  5C1Z A;  3F0W A;  4EZL A;  2CHX A;  1DIK A;  1LB1 A;  1DDW A;  2LOX A;  2K00 A;  3A9J B;  4MDK E;  4GDK B;  4GIV A;  2CB8 A;  3DCG A;  1V5M A;  2JZZ A;  3DPD A;  4BKS D;  3SDL C;  4HWI B;  2BYV E;  1Y8R C;  2ZNV B;  3WAL A;  4NSW A;  2KLG A;  2JUO A;  2KN5 A;  2KOX A;  4XZ4 A;  1KC7 A;  3H6N A;  4CHK A;  4AUQ C;  3PEG A;  3MHS D;  3W1Y A;  4KDI C;  5CHF A;  1WX8 A;  1IPG A;  1WIA A;  3R66 C;  2Y8G A;  2N1V A;  5E6N A;  4BFR A;  4K81 A;  2ZCB A;  3SNH A;  2MDX A;  2KD0 A;  5J2R A;  2I1J A;  2CY5 A;  3ODW A;  1CMX B;  1NVL A;  4I6L B;  3ZO5 B;  2G35 A;  1V5T A;  1ZGU B;  3SO6 A;  1WXV A;  2LUE A;  5DPS A;  1ZKH A;  3M3J A;  5LOP B;  4HAZ B;  2N23 A;  1Y5O A;  1ZC4 B;  3VUX A;  2RQ1 A;  3ZNI D;  4H8S A;  2FUH B;  3O96 A;  1T0Y A;  3A9K A;  3T8M A;  3U30 A;  2MBQ A;  3MJW A;  4KV2 A;  4HB3 B;  3QCA A;  2MKR A;  2FNJ B;  5G55 A;  1V6E A;  1V86 A;  4URK A;  2KX3 A;  3I3T B;  3PVL A;  3R3M A;  3PTF C;  1HB6 A;  3S2A A;  1V5U A;  2W2W A;  2DKP A;  5J17 A;  3QAR A;  2XK5 A;  3SYX A;  1Z5S B;  1X1M A;  3PPA A;  3SHQ A;  1UNQ A;  1F9J A;  1WM3 A;  3ZTC A;  4C0A A;  3RZF A;  2ADZ A;  2O2V A;  3R7Q A;  3VH4 B;  2LKO A;  4ANU A;  5D7G A;  3WAO A;  3PGE A;  4HDQ A;  2YRY A;  5CLL B;  3QX1 A;  3PZD A;  3E9L A;  3MTN B;  4GSW A;  3VUW A;  1FHX A;  4A6F B;  4D0N B;  4ILJ A;  3L17 A;  5DI9 B;  4WJN A;  1XCG A;  5L95 C;  3V62 A;  2IFS A;  1EGX A;  5JHA A;  1DBH A;  4FJZ A;  4WJQ A;  5KQ4 A;  2KJH B;  5LLI A;  2JY6 A;  3X23 A;  4KZC A;  2E2X A;  4W9K A;  5C79 A;  3ODX A;  2ZCC A;  1UEF A;  1UPQ A;  3FSS A;  2XQN M;  1W1D A;  1K8R B;  3NOB A;  1WYW B;  2NZ8 B;  3DXE A;  3SU8 X;  3X0W A;  2D9V A;  2YT1 A;  2ELA A;  1Z87 A;  4LDT B;  3DBH I;  2LVP A;  3ALB A;  3OJ4 B;  2Z0D B;  3JSV A;  1WR6 E;  4GXB A;  2VRW B;  2L8J A;  3A9K B;  4GDL A;  2KCJ A;  4FHJ A;  3B1L X;  2GBK A;  3W1S C;  3QK0 A;  5HE1 A;  3TIX A;  4HCN B;  1NI2 A;  4F7Z A;  4PQ0 A;  4JL9 A;  4FUL A;  1WMH A;  2FIF A;  1U2B A;  2JF5 A;  2KWC A;  4DWF A;  1U4A A;  3QQ8 B;  1Q1O A;  4FN2 A;  3HIZ A;  2K8C A;  5CLQ B;  2K8H A;  4TKN A;  5KHO A;  4MEM A;  2IYD B;  4FA6 A;  2JRI B;  1WGR A;  4JKF A;  2GBJ A;  2XK5 B;  1WXM A;  1W1G A;  2DHK A;  1PQS A;  1NDD A;  3B08 A;  3QHT A;  5HE2 A;  1E90 A;  2EKE C;  3RUL A;  4GZU A;  2O2V B;  4HLE A;  4KSK C;  1IP9 A;  2DN6 A;  2GOW A;  3D8E A;  3KRX A;  4AJW A;  2IYB A;  4IM0 A;  2XEW A;  3JYU A;  1RLF A;  2FAZ A;  3RYT A;  4W9F A;  3APC A;  2RNR B;  2J7Q B;  2UZR A;  3N3K B;  1NTV A;  1RFA A;  5L83 A;  1U5D A;  2KXJ A;  2N1W A;  3B0A A;  2N7D A;  2RR9 A;  2COF A;  2BWE S;  3UIN B;  4JK7 A;  3DOW A;  2LRU A;  5DPT A;  3A8Q A;  1AWE A;  1MKE A;  1WXS A;  4A3O A;  2JXX A;  5DIF B;  2COA A;  2DYO A;  4F7H A;  4HAY B;  3QBV B;  3CMM B;  3Q3F A;  1J0G A;  3L16 A;  4LCD E;  4HAV B;  3HK0 A;  4DHZ B;  2MBO A;  2C60 A;  2KJR A;  2M1M A;  4GDL B;  1OEY J;  2L05 A;  3DVN U;  1R4M I;  5EDS A;  3TL5 A;  4W9E A;  3V6E B;  2P0H A;  5DHA B;  3SUZ A;  3HHM A;  3L08 A;  2IO3 B;  5GOW B;  4GN1 A;  1OEY A;  3AI5 A;  1IRS A;  1KJT A;  3QC8 B;  2JVC A;  4I6P A;  1LFD A;  2DZJ A;  1FB8 A;  1WX9 A;  2AL3 A;  1WI1 A;  3QJZ A;  3ZUN A;  1JDE A;  3WAM A;  1U29 A;  1TQZ A;  1VD2 A;  2DHJ A;  2MRP A;  1MAI A;  2YF0 A;  2KTR A;  2WWZ A;  2M17 A;  3D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...