3X23A

Radixin complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
GSMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Radixin
publication title MT1-MMP recognition by ERM proteins and its implication in CD44 shedding
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3x23A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3x23A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3x23A01
3ZRCA 4FLHA 1EGXA 3X23A 1H10A 4HCNB 3VVWB 2QKMA 3A9JA 3V6CB 3H1UA 4EMOA 4KZCA 1WG7A 3FEHA 1TTNA 1P9DU 5HKHA 1E5WA 3VH3B 2JY6A 3WIMA 1P6SA 3U8ZA 3V60A 2M8SA 3M62B 4WJPA 1PLSA 1MAIA 2FUHB 4W9HA 2LG1A 5LLIA 3R3MA 2V4LA 4A6HA 1W1HA 2KFJA 1WMHB 2L1CA 3OLMD 3ZNID 3PP2A 1KJTA 4W9DA 2C5LC 1V81A 4RM9A 4RM8A 4MEMA 1QQGA 4IAPA 2GBKA 1WGDA 2KZRA 2IYDB 4HB2B 3RUIB 2YVCA 4KHAA 4FJVB 2LOZA 3VAWA 4URKA 4LJOB 2W2XD 3L17A 3SHQA 3AU4A 1WZ0A 1ZGUB 1IPGA 3A33B 3T06A 3OAWA 2L2IA 2K2JA 1LB1A 2MX2A 2I1KA 4DHJB 1PMSA 4EEWA 2L00B 1OMWA 2YF0A 3QJZA 1X1GA 3LJUX 5D3WA 1Q1OA 1LXDA 5E6OA 2YT1A 3I3TB 3PHXB 3RZFA 1KLVA 1FOEA 3N30A 2L0FA 2A4ZA 3SUZA 1WGQA 4GMXB 4KDLB 2OTXA 3A9JB 1ISNA 1X1MA 2DTCA 2CS4A 2N7EA 4HK2A 2L8JA 2GBMA 1PQSA 4W9JA 3JSVA 2D2QA 5AZGA 4CYEA 4ANWA 5J17A 2MDXA 5JHBA 2Z0PA 1GC7A 5E6NA 2RNRB 2EJ8A 4HB3B 2ZPYA 3GYPA 2DHIA 2COCA 1KZ7A 4HPMB 2LXAA 1Q67A 1M7RA 1T0YA 2D9YA 2G4SA 1YD8U 2DYQA 5L81A 2KD0A 4HJKA 5JZEB 4NY0A 2K8HA 1KZGA 4GU2A 2RUKB 1RAXA 2UZRA 3PT2B 5IJMA 4IW0A 2KHWB 1Z87A 2DZIA 3PRMB 4A3OA 3EC8A 1H4RA 2L7RA 2DYOA 5KHQA 1W1DA 1UZXB 2YS5A 2ZVOA 3MPXA 3KW5B 4BOSC 2NBVB 2K1FA 1MIZB 5IAAC 3EECA 2V1YA 3C0RB 2O6VA 2D9VA 2ZPNA 2ABDA 3EPYA 4GZUA 2DN6A 2KDBA 5GMVA 1I2HA 1Y19B 3WA0A 4D0NB 2I5FA 3ODOA 4BKSA 3ODXA 1WXVA 1XT9B 3A8PA 3WAOA 1OGWA 1RLFA 3JVZX 2ZCBA 4BBNF 3NS8A 4MGKE 5IA7A 1BTKA 3JSVB 4FJYA 3D8FA 1I7AA 3F0WA 4XX5A 4IM0A 2MA9B 3IHPC 1C3TA 3UZTA 4ANVA 2FCNA 2HE7A 5C23A 2PZ1A 3VXWA 1QC6A 1XKEA 3GZNI 1DDMA 5EFXA 4F1SA 1D3ZA 1MK7B 1E8ZA 2LI5A 5C79A 2WH5A 2C7NB 2NZ8B 4F7ZA 2JP2A 4K1RB 3UF8A 3VQIA 2E2XA 2YS3A 3MDBC 5HE3A 1OTRB 3PPAA 2RGNB 3PSEB 3PG7A 2DYBA 2O6VB 3ZVVA 2JRHA 4MGIE 3RD2A 3A98B 3N32A 2K2UA 1EVHA 3ZTDA 4F7GA 4LJPB 3KY9A 3QAQA 4TV3A 1WJ1A 1E7UA 4HAXB 4BBKA 3O96A 2DZJA 2D9XA 4F7HA 2J59M 3W1SA 4DWFA 4GB9A 3QA8A 3AU5A 5D2MB 1WGYA 1XODA 5J3TA 1P98A 2N7DA 5CHVC 4HATB 2L3ZA 1ZVRA 4BOZB 1WM2A 2ZVNA 4FHJA 2CRFA 4TQ0A 2HTHA 5J3QA 2I1JA 1V5TA 1GJZA 3NZUA 3PLVA 1ZM0A 2M4NA 3KUCB 4HHVA 4IWOA 1ZC4B 4A3PA 2NR2A 3FSSA 4LCDE 1V5UA 2ZNVC 1V5MA 3KRXA 1WH3A 4F8CB 4P7IA 1IRSA 3LJ3A 2A5UA 1TZ1A 1ZKHA 1V89A 2O2VA 3R66C 2KJHB 3BINA 2L76A 2LASA 1DDWA 1OEYA 5L83A 1Y8RC 3VHTC 2RSUA 3U30A 3VH4B 1ZSQA 2HRJA 3N7CA 3H7SA 3UIPB 2AYOB 2KXJA 3PS6A 4WJNA 2MBOA 4K2OA 4J6IA 2YT0A 2M14A 4PS7A 1XQQA 5FI0A 4HPLB 1TBEA 2G35A 2L05A 4KSLC 2K6DB 4GDKA 2CHZA 2M38A 3O65B 1NTVA 3L10B 1XCGA 3L16A 3B08A 3D32A 2VSZA 1XD4A 2Z0EB 2MFQA 2IO1B 1RRBA 2FIDA 2KTFA 5D27A 5FI1A 2HTHB 1E8WA 2KKCA 4TKNA 2LUEA 4IG7B 2M17A 2GBRA 3PVUA 4K17A 2PPHA 1HBKA 2BPSA 2DAFA 2K25A 3AXCA 1WX7A 1FB8A 4PS8A 4GN1A 3WANA 3KVFB 3N3KB 2JZZA 3ZTCA 3SYXA 2LGDA 4HB4B 1WE7A 2KX3A 1SGHA 3DQVA 3V6EB 2Y7BA 2NVUI 2O2VB 2C7MB 2W2WA 3QHTA 4WQOB 4BKTA 2PJHA 5J18A 4GOCA 4CHJA 3P2BA 3PRZA 3ZRFA 3B1LX 4PQ0A 1RJ2A 2ROVA 3ZVRA 2MQJA 1XX0A 1HB8A 2FDQA 4A20A 4BFRA 2DX5A 1LQBA 5DH9B 4NJ6A 1DDVA 2MSED 5CLLB 2RR9A 2AL6A 1UPQA 3JW0X 2LGXA 2Z0QA 3QK0A 3TVVA 1EUVB 3DBLI 3TL5A 4GDKB 3UIOB 2YSZA 4XWXA 4PNKA 2JVCA 2MBHA 1U27A 1Z5SB 1UNQA 1V6EA 3PEGA 2DZKA 3W1YA 2KC2A 3KH0A 4HAYB 2K8CA 4NQLB 3SDLC 5JP4A 2PE6B 4MDKE 4MSQB 2P0FA 1PFJA 1WGGA 3PVWA 3PGEA 2ZCCA 2ZEQA 4DHJD 1WIAA 2HD5B 2EMSA 2AL3A 1UGMA 3DXDA 3DXCA 3TCAA 3A4RA 2IY0B 3APCA 4II2B 2J0KA 4HAZB 1FAOA 4HDOA 4ZRJA 5CX3A 1OY2A 1K5DB 2REXA 2ROZB 2BGFA 3ML8A 3VUXA 1Z2MA 5D94A 3VOQA 3SD5A 3VTVA 2GOWA 2W2XC 4MGYE 4AWJA 3DVNU 4MJSA 1WX8A 4KSKC 4TQ1A 5DHAB 2KFKA 2DX5B 2LZ6A 2Z0OA 2CR5A 3A9KA 3ZNHB 4ICVA 1EF5A 3UGBB 4TUUA 2NBUA 2FJLA 4MK0A 3A8QA 5FR6A 1IP9A 4JL9A 3K9OB 1GUAB 2KVRA 1OEYJ 2DHZA 3R7RA 2D10A 1BWNA 2LRWA 3ML9A 4KIKA 3NHEB 2V76A 3QWZB 4DX8A 5LONB 5CTRC 2D9ZA 4B6WA 1EF1A 3TW1A 2FCSA 1E8YA 5DIFB 1FXTB 4PYZA 1GNUA 2LYDA 1SIFA 5C5BA 4HB0B 4WWPA 5DI9B 3EHVA 5D6JB 2DAJA 2M1MA 3DVNV 1TQZA 1X05A 3WYFB 4IWPA 2DENB 3ZKJC 2IYBA 1WR6E 1UEFA 1AQCA 3B0AA 3F5RA 2XK5A 3GOEA 3PREA 3VFKA 1SE9A 1K8RB 2ELAA 3CSTA 1NU2A 4GIVA 4B9KA 2ADZA 4ICUA 2KDIA 1F9JA 1E8XA 1YJ1A 1FGZA 2ZJDA 1MG8A 4NPNA 2P0DA 2D11A 4E74A 2J0MA 5KQ1A 4X57B 3H6NA 4MJSB 3PLUA 4MH0E 2KFKB 5G2NA 2M0XA 3A9KB 1N3HA 3V61A 4N9F4 2N1WA 1WGUA 3FLVA 4OVUA 2X18A 4NQKE 2MBQA 1EAZA 1V9JA 2N9PC 4HWIB 1UH6A 2KJRA 1YQBA 1NTYA 4KIKB 4Z2NA 2R2OA 4K2PA 3NY5A 4M0WB 3CMMB 1KM7A 5DCNA 3IG3A 5KQ4A 3DBRI 1ST7A 2YLMA 2N0YA 2IZVB 1P5TA 5C5BB 2KK8A 4G50A 4II3B 2IO2B 4EJNA 4G0NB 4H8SA 3LDZE 5CHFA 3ML4A 4MM3A 2KTRA 4XZ4A 5C6RA 4K7WA 2O6VD 3OJ4B 2D3GA 3ODWA 1WFYA 4DDID 3WAPA 2LXCA 2Y5BB 5JH5C 2XK5B 2JXXA 1YIWA 2JRIB 1WZ3A 1WJ4A 3APFA 3A1QA 3QARA 2K6QA 3Q3JA 1ZC3B 5AZFA 3KRWA 1WVHA 2WWZA 2LOXA 2N4FA 4BKSD 1WI1A 3G9WA 4EKUA 2G3QB 4IC7B 2I5CA 1VD2A 1NI2A 2CU1A 2C60A 2KWCA 4EFOA 3RCPA 4HVBA 5CHWA 4RMAA 4KHOA 4NAWA 2LVOA 1U2BA 1U4AA 2V3SA 4KVGB 4KV2A 3QBVB 3RULA 2CY4A 4I6PA 2ASQA 2MKRA 2DX1A 3DBSA 4HDQA 1HB6A 4L6EA 3RCZA 3ONSA 1R4MI 4W9LA 3QC8B 1AARA 2LGYA 2YRYA 1OQNA 1M94A 3VUWA 3DPDA 2WX0A 1L2NA 4IOYX 2YS1A 4A6FA 5BO4B 1A5RA 1Q5WB 4JIOU 4EUTA 2NBWB 5L95C 3QIJA 3CSFA 2GCLA 4FBJB 3X0WA 2PEAA 3KUZA 4M8NA 2ZNVB 2KTRB 1Q0WB 1LFDA 4TYZA 1UBIA 5D7GA 1MKEA 2RQ1A 4IFSA 1UNPA 1EO6A 2CAYA 5GOWB 4W9EA 2BYVE 4FADA 4K7UA 2NMBA 3K9PB 2Z59B 5EDSA 3ENEA 3A1QB 2K39A 3L08A 2KN5A 3QX1A 4WJ7A 3KSYA 2KOXA 1U5DA 1UELA 2BYEA 4GSWA 4K7SA 3EFUA 1WGRA 3L13A 3BY4B 1NBFC 4ASWC 1K5GB 2RD0A 3DXEA 1GC6A 3DDCB 4ZRKA 3S2AA 1GG3A 1J0WA 2QHOA 4NAWB 5D3XA 4IM2A 2JPHA 1E90A 1HE8A 1R4NI 5JLJB 3PZDA 4GXBA 1MIXA 4OVVA 4E3CA 4XC2A 2JZ3B 3IBEA 2QKLA 2IFSA 2DKQA 4W9FA 2D07B 1SHCA 1V49A 1NDDA 4A6FB 4AUQC 3ULBA 1WJMA 4AOFA 2Z0DB 1V2YA 2C7HA 2FCQA 4FA6A 3JYUA 2W9NA 2NCNA 2P0HA 3R7QA 3AULA 2XBBC 2DHJA 2KO3A 3HQCA 1WJ6A 2GMIC 2IO3B 1UPRA 2JF5A 3OANA 2KDFB 5G55A 4ZYNA 3TO1A 4DBGA 2GCJA 2JWZA 3MHSD 1X86A 2J0JA 2MLBA 4WSFA 1TGZB 2LVQA 1C1YB 4I6NB 1WJNA 4FULA 2PE9A 4KDIC 1JRUA 2P8VA 4AJYB 3IFWB 3M3JA 2NS5A 3VTUA 2C9WB 3KYCD 3WALA 3TMPB 5D3VA 1J0GA 3NSUA 4JGHB 1RRPB 3P7ZA 3QCAA 2KQSA 2LKOA 2KGXB 3AI5A 2COPA 3AJ4A 3QQ8B 3DOWA 2AWTA 2MP2A 4IUMB 1J8CA 3DBHI 1W1GA 2BF8B 4NJ7A 5JHHA 2D9WA 1WR1A 2KWVB 2CODA 5DPWA 2ELBA 5AZHA 1RFAA 4HLEA 3KZ1A 2KANA 2MWNB 5DPSA 3KUDB 4GGQA 2BKRB 1P3RA 3QWMA 2K00A 1KOTA 1WXSA 3T8MA 4DBBA 2NPTA 1WM3A 4GDLA 2DA0A 4PS3A 4MELA 1Y5OA 3UQAA 3L54A 2OOBB 3V5WA 5DHFB 4Y94A 4IWQA 2UWQA 1V5PA 4HXDA 4ANUA 3U7DA 1NVLA 2MWSB 2UVMA 4DHZE 4BKGA 3HW2B 4DHZB 5CLQB 4E71A 1TXDA 1IYFA 5KHOA 4M8MA 1J19A 2N9XA 4FHKA 4IM3A 4CHKA 3TFMA 2BCJA 3ZNZB 4BVUC 5TR5A 1LW3A 4HAWB 3D8EA 1ACAA 4YL8A 1U5EA 2MW5A 1FGYA 2LWPA 3SO6A 2N1VA 2RGFA 2VRRB 2BWFA 2BWES 2L0TA 4PYUA 1QZEA 2MP2B 2UYZB 3CIKA 2KLGA 4EOYA 1UD7A 2MCNB 4ZDVA 4EZJA 2KMCA 4DDGD 3SV1A 2LRUA 2LD9A 4HAVB 3PHWB 1FHOA 1H8CA 2XEWA 1WI0A 3WAMA 1DROA 3V62A 3FP5A 2MRPA 2H7EA 5C16A 3DVGX 2VKIA 2RSGA 5LXIB 3TBLD 2NPTB 4GDLB 3ZDTA 3VIAA 2MBBB 3APDA 4WVFB 4DXAB 3ZO5B 4YONA 1MPHA 2Q13A 1WXMA 1S1QB 3PRPB 4DK5A 3DVGY 2KDEB 3CF6E 2BYFA 3SU8X 3HIZA 3PTFC 1XD3B 3VTWA 1UBQA 1BT0A 2DHKA 1BTNA 2DLWA 4NSWA 2FNJB 2KX0A 4G3XB 1V5OA 2KQ7A 3L0WB 3ZDMC 2OJRA 2LBBA 4B95A 2XQNM 2HJ8A 1YX6B 4K81A 5J2RA 1X11A 2LJ5A 2CKHB 1WRDB 2CHXA 5AEKB 3IVFA 4CHMA 4W9KA 3MTNB 2COAA 2JT4B 4AP4C 3FM8C 4W9GA 2CB8A 1NTIA 2DFKA 2GS0A 1G6JA 3VDZA 5LOPB 3PV1A 2EKEC 4MY6A 4Z2MB 3ZW3A 3UINB 2IO0B 2KC1A 4WJOA 1P3QU 4KHBB 4EZLA 3KYDD 3ZUNA 4A6KA 3ZIMA 1BAKA 2JUOA 1V86A 1L7YA 4GPTB 5E6PA 2GJYA 1DYNA 1KI1B 2R2QA 1WE6A 5HE2A 4JQWC 2DKPA 2VRWB 3SNHA 1WJUA 1VCBA 2EMTA 4MGZE 3HM6X 4HCPB 2IY1B 2UZSA 4CO7A 3UQBA 4KAXB 3TJPA 3M1IB 1B55A 4GMVA 3H7PA 3NOBA 4ZRIA 2FJ9A 4G11A 2DZMA 2FCMA 5HE1A 2KWUB 4A5KA 4I6LB 1U29A 3HM3A 2RPQA 2D4QA 2WYQA 2GBNA 3TIXA 2WX1A 2Y8GA 4DX90 3HHMA 1WYWB 1I42A 4C0AA 1S3SG 2KUPA 5KCVA 2ZZPB 4JLCA 4HAUB 1FHXA 5J3YA 2RVBB 5DPRA 4WJQA 1MK9B 2OQBA 1XR0B 2BKFA 1M7EA 2KCJA 1V80A 3ALBA 4FN2A 1ZW7A 1WXAA 2R09A 2IBIB 1OQYA 1CMXB 5DPTA 4WAAA 3PVLA 5JHGA 5HE0A 2KNBA 3H9DA 2N9EB 2AEHA 3M63B 2KLCA 3ECIA 3PSCA 4NNJB 2CQUA 1WF9A 3A4SC 2G45B 5JHAA 2MBEA 2J7QB 2FIFA 2K8BA 2N23A 3BJIA 1WY8A 2Y8FA 2B3AA 4W9IA 3D8DA 4F7UP 4MT7A 1X1FA 1E7VA 2CHWA 3RYTA 3H7PB 3OJ3A 3MJWA 2LULA 3ZNGC 3T9LA 4FJZA 1UNRA 2CY5A 2FAZA 4B6HA 2COFA 2EC1A 5LXHA 1I35A 3DCGA 1U5GA 1V88A 1TJ6A 1WMHA 2DYMA 3CXBB 3P6AA 3W1SC 4W9CA 2DYNA 3GYOA 1WX9A 1P0RA 4BBNC 4MSMB 2KJ6A 3ZLZA 3HK0A 3RZWC 5C1ZA 2R0DA 2GBJA 3RT3B 4WWNA 1LM8B 3ULCA 2WDTB 1U5FA 4AJWA 3Q3FA 2LVPA 3NZSA 2H7DA 3M95A 4LDTD 1WGHA 1P1AA 1YX5B 1DBHA 2G4DB 1V61A 4KZ0A 1FHWA 1AWEA 4ANXA 2RLOA 4LDTB 2KMAA 4WWOA 5D3YA 4EZKA 3VUYA
chains in the Genus database with same CATH superfamily
3ZRCA 4P1BC 4FLHA 1EGXA 3X23A 2IDYA 1N62A 1WXQA 1H10A 4HCNB 3VVWB 2QKMA 3A9JA 4KX6B 3V6CB 4US9A 3H1UA 4EMOA 4KZCA 1WG7A 3FEHA 1TTNA 1P9DU 5HKHA 1E5WA 3HIEA 1XCQL 3VH3B 4AS1A 2JY6A 1QOBA 3WIMA 1P6SA 2VZKB 3U8ZA 3V60A 1TT5B 2FE8A 2M8SA 3M62B 1PLSA 3Q2AC 4WJPA 4HPPA 1MAIA 2FUHB 4W9HA 2LG1A 5LLIA 3R3MA 2V4LA 2ZW0A 4A6HA 1W1HA 2KFJA 2Z14A 3P4RB 1WMHB 2L1CA 3OLMD 3ZNID 3AH7A 3PP2A 1KJTA 4W9DA 2SAKA 2C5LC 1V81A 4RM9A 4RM8A 4MEMA 1QQGA 4IAPA 2GBKA 1WGDA 2KZRA 2IYDB 4HB2B 2R61A 2V3PA 3RUIB 2YVCA 2D3CA 1HEZE 4KHAA 4FJVB 2LOZA 1SB3C 3VAWA 2QC8A 1PFDA 4URKA 1WWTA 1D5MC 5LNK1 4KKIA 4LJOB 2W2XD 3L17A 1YQ3B 3SHQA 5HFYA 3AU4A 2CJNA 1DIKA 3BK2A 1KC7A 5EE3A 1WZ0A 1ZGUB 2BBCA 3BZDB 1IPGA 3A33B 3T06A 1GOZA 1T3QA 3OAWA 1F0ZA 4GOUA 2JSVX 2OHFA 3P63A 5E6JA 5I4DA 2L2IA 2KIEA 2K2JA 2NBVA 4HROA 1LB1A 2K3UA 2LHDA 2MX2A 2I1KA 4DHJB 1PMSA 3AN1A 4EEWA 2W54A 2L00B 1OMWA 2YF0A 3QJZA 1X1GA 1RFKA 3LJUX 5D3WA 2FJUB 1Q1OA 3CWIA 1LXDA 5E6OA 2YT1A 3BVGA 3I3TB 1V1OA 5JVLA 3PHXB 3RZFA 1KLVA 1FOEA 3N30A 2L0FA 2A4ZA 3SUZA 1WGQA 3ZQ4A 4GMXB 4KDLB 2OTXA 2PVGC 3A9JB 3OG5A 1ISNA 1X1MA 2DTCA 2M56B 2CS4A 5G5GA 1I4XA 4ARCA 2N7EA 1KH0A 3DBRB 4HK2A 2L8JA 2GBMA 1C79A 1PQSA 2LHEA 4W9JA 5HHDG 3JSVA 4OZAA 2D2QA 2MJEA 5AZGA 3ABVB 4CYEA 4ANWA 2KDMA 5J17A 2MDXA 5JHBA 2Z0PA 1GC7A 5E6NA 2RNRB 2EJ8A 4HB3B 2ZPYA 3GYPA 2DHIA 1PGBA 2COCA 1KZ7A 1L6VA 4HPMB 3RNAC 3PO0A 3N20C 2LXAA 1Q67A 1M7RA 1T0YA 3BWUD 2Z8LA 4WIPA 2D9YA 2G4SA 1YD8U 2DYQA 5L81A 2KD0A 1AW7A 4HJKA 5JZEB 3DWMA 1JALA 5HI1A 3R2IA 4JKBA 4NY0A 2K8HA 1KZGA 4GU2A 2RUKB 2X38A 1RAXA 1HA5A 4IDIA 2UZRA 3PT2B 5IJMA 4JKDA 2KHWB 4IW0A 1Z87A 3PZ8A 4PK1A 4ZRPA 2Q5WD 1YQ4B 2HDEA 2DZIA 3KWVA 3PRMB 4JWUC 2KQ4X 2PVOD 3EC8A 4A3OA 1H4RA 2WNMA 2L7RA 2DYOA 2MJDA 2PLPA 3LXFA 5KHQA 1W1DA 1UZXB 2YS5A 2ZVOA 3MPXA 3KW5B 4BOSC 4C7YA 2NTTA 2NBVB 2K1FA 1BUIC 1XLNA 2HTME 1MIZB 5IAAC 3EECA 2Z13A 2V1YA 2WDVB 3C0RB 2O6VA 2D9VA 2ZPNA 3GE8C 2ABDA 1DOYA 3EPYA 2WXRA 3AEBB 1J7BA 2V3NA 3Q3NC 4LNOA 4GZUA 2DN6A 2KDBA 5GMVA 1I2HA 1E7PB 4M00A 1Y19B 3WA0A 1ESFA 4D0NB 2I5FA 3ODOA 2R82A 2E3TA 4BKSA 3ODXA 1WXVA 1XT9B 5JXVA 3A8PA 2OEDA 3EFCA 3WAOA 1OGWA 1RLFA 1JWAD 2ZCBA 3JVZX 1GPXA 4BBNF 3URYA 3NS8A 4MGKE 5IA7A 1BTKA 5I2MA 4A6QA 1J7CA 3JSVB 4FJYA 4YTPB 3D8FA 1JWMD 2INDC 5EE9A 1EM7A 4HJGE 1I7AA 2BS2B 3F0WA 4XX5A 3MJ5A 1TS2A 4IM0A 2MA9B 3IHPC 1C3TA 3UZTA 4ANVA 3NVVA 3AE5B 1KF6B 2FCNA 4ACFA 2QIEB 1YOVB 4ZYSA 2HE7A 5C23A 5AUKA 1DYQA 2PZ1A 4NAMA 3VXWA 1N60A 1QC6A 1XKEA 3GZNI 4L1BA 1DDMA 5EFXA 4F1SA 1D3ZA 1MK7B 1E8ZA 4DIXA 2LI5A 5C79A 3MC9A 2WH5A 2RDHA 2WXHA 1XF5L 1HTQA 1MPEA 2C7NB 2NZ8B 1JCKB 4F7ZA 4BAXA 2JP2A 2WXFA 4K1RB 2J52A 1C4CA 2Y5PA 4A8XC 3UF8A 4CQNA 3VQIA 2E2XA 2YS3A 1TJEA 1R4NB 3MDBC 5HE3A 1OTRB 3PPAA 2RGNB 3PG7A 3NJTA 2DYBA 3CIRB 1VR9A 3MHZA 3PSEB 2O6VB 1VZ7A 4TMAB 3ZVVA 2K9XA 1ET6A 1PUTA 2JRHA 4MGIE 3RD2A 4ZHOA 3A98B 4MT5A 1KRHA 1KTKA 3GE3C 3N32A 1SF0A 2K2UA 1SE3A 1EVHA 3RPFC 1AYFA 2D5GA 2WXIA 1E9MA 1XO3A 3ZTDA 3ZJVA 4F7GA 4LJPB 3KY9A 3QAQA 1QF6A 1QILA 2KACA 4TV3A 1WJ1A 5LG4B 1E7UA 4HAXB 2KMMA 4OZCA 1FCCC 4BBKA 1LO5D 2WXQA 3O96A 1MI1A 2DZJA 2D9XA 4F7HA 2WQYB 2JX5A 2J59M 2I2YA 3W1SA 4DWFA 4A90A 4GB9A 4N6EB 2TSSA 3QA8A 3AU5A 5D2MB 1WGYA 1XODA 5J3TA 3DHIC 1P98A 2N7DA 5CHVC 4HATB 2L3ZA 3HUIA 1ZVRA 3R2TA 4BOZB 1WM2A 2ZVNA 4QAYA 2BQQA 4FHJA 1YJJA 2JWUA 3DCXA 2CRFA 3B2FA 4TQ0A 2CU3A 4JKFA 4OT1A 2HTHA 1NEKB 4TSSA 5J3QA 2I1JA 1V5TA 5G5HA 1GJZA 3NZUA 3PLVA 2JZPA 1NENB 1ZM0A 2INCC 2M4NA 3KUCB 4HHVA 4IWOA 4KGRA 5AUIA 1ZC4B 1TKEA 2WHIA 4A3PA 2NR2A 4C00A 3SR6A 4US8A 3FSSA 4LCDE 4RGOS 1V5UA 2ZNVC 1V5MA 3KRXA 2E6XA 1WH3A 2INPE 4DQOC 4F8CB 4P7IA 1IRSA 3LJ3A 2A5UA 1TZ1A 1ZKHA 2WP9B 1V89A 1MI0A 2Y3AA 1TKYA 2O2VA 2KJHB 3R66C 3BINA 2L76A 1T6BX 1JRPA 2LASA 1DDWA 1OEYA 1JWSD 2ZW1A 2MH7A 2JQRB 5L83A 1Y8RC 3VHTC 2RSUA 3U30A 3VH4B 1ZSQA 4PT5A 2HRJA 3N7CA 3SEBA 3H7SA 4O1NA 4WAFA 3UIPB 2X0SA 2AYOB 2MHJA 2KXJA 3PS6A 4WJNA 2MBOA 3N1ZC 4K2OA 1C77A 1L4ZB 4J6IA 2YT0A 3MP9A 1ZE3D 3W5UB 2M14A 4PS7A 1XQQA 5FI0A 4HPLB 1TBEA 2G35A 1FO4A 2L05A 2WXKA 4KSLC 2K6DB 2NTSA 4Q2JA 3ZGZA 2YEPF 2Z4DA 4WWMA 4GDKA 2CHZA 2M38A 1YN3A 1SEBD 3O65B 1NTVA 2V4IB 3L10B 4XE0A 1C76A 1XCGA 3L16A 3B08A 1RYJA 5D3DA 3D32A 1YJIA 3RMKC 2ON8A 2VSZA 4ILJA 2W3SA 1XD4A 1QLBB 3BVMA 4JKHA 2Z0EB 2MFQA 2IO1B 1RRBA 4XDDA 3Q8EA 2FIDA 4YSXB 1BMLC 2KTFA 5D27A 5FI1A 2HTHB 4USAA 1E8WA 2KKCA 4ZHPA 4TKNA 2LUEA 4IG7B 2M17A 1FPYA 3J9CA 1FNWA 2GBRA 2IGHA 3PVUA 1P7FA 3AE4B 4K17A 2PPHA 3U52E 1HBKA 1D5ZC 2BPSA 2DAFA 3AE1B 2K25A 3AXCA 1WX7A 1FB8A 3HRDD 4PS8A 4GN1A 3WANA 3KVFB 3I5JC 2JZZA 3N3KB 3ZTCA 3SYXA 2LGDA 4HB4B 3OHMB 1WE7A 2KX3A 1KBLA 2DIKA 1SGHA 3DQVA 3V6EB 3SFEB 3AEGB 2Y7BA 1DOXA 2NVUI 2IJ0A 2O2VB 3BK1A 2C7MB 2W2WA 3QHTA 4WQOB 1XLPA 4BKTA 2PJHA 5J18A 4GOCA 2VZKD 4CHJA 3P2BA 3PRZA 3ZRFA 2J4XA 3B1LX 4PQ0A 3P1MA 4YSYB 1RJ2A 3TUOA 2QDFA 2QSDA 1UWXA 2K0PA 2ROVA 1FCLA 3ZVRA 2MQJA 2FBWB 1XX0A 4KKJA 2QCZA 1HB8A 2MJ3A 2FDQA 4A20A 4BFRA 3E9LA 2DX5A 1LQBA 5DH9B 3V3XA 1NI3A 1SSNA 1JDEA 4NJ6A 1DDVA 1N5XA 2MSED 5CLLB 2EKIA 2RR9A 3NS1A 2AL6A 1UPQA 3JW0X 2LGXA 3P4QB 2Z0QA 3QK0A 3RI7C 3TVVA 1EUVB 3DBLI 1TKGA 4D2KA 3TL5A 1EWYC 4GDKB 3UIOB 1TY2A 2YSZA 4OW0A 4XWXA 4PNKA 2JVCA 4A55A 2MBHA 1U27A 2L1AA 1Z5SB 1UNQA 5FR3A 1V6EA 2W55A 3PEGA 1FNUA 2WGSA 2DZKA 3DHGC 3W1YA 3NWDA 2KC2A 3KH0A 1E6EB 3TEXA 3TEWA 4HAYB 2K8CA 5BYRA 4NQLB 2XNAC 1R7SA 3SDLC 3VRBB 5JP4A 2PE6B 4MDKE 4MSQB 2P0FA 1PFJA 1WGGA 3PVWA 3PGEA 2QJLA 3Q6BA 3Q69A 2ZCCA 3W2DA 2ZEQA 4DHJD 4JK9A 1WIAA 2HD5B 2EMSA 2AL3A 1UGMA 2N9KA 2KIGA 3DXDA 3DXCA 3TCAA 3T3NA 1EU4A 3A4RA 2IY0B 3APCA 4II2B 2J0KA 4HAZB 1FAOA 4HDOA 1FFUA 3AEDB 4OVZA 4ZRJA 4QXAB 1IUEA 5CX3A 1OY2A 1K5DB 3R8BA 2REXA 2ROZB 2BGFA 3ML8A 2INNE 2QEJC 1V1PA 3VUXA 1Z2MA 5D3IB 3VOQA 1YN5A 5D94A 3E9SA 2BB5A 3SD5A 3VTVA 4BZAA 2GOWA 2W2XC 1TS5A 1WGKA 1QOGA 4MGYE 4ILHA 4AWJA 4P16A 3DVNU 4JKGA 4KGTA 4MJSA 1WX8A 4KSKC 4TQ1A 5DHAB 1UF0A 2KFKA 2DX5B 2LZ6A 2Z0OA 3U4EG 2CR5A 1ZPSA 3A9KA 5H92C 3ZNHB 4ICVA 1EF5A 4RGTA 3UGBB 4TUUA 2NBUA 2KYWA 2FJLA 4MK0A 3A8QA 5FR6A 1IP9A 3GB1A 4YWGG 4JL9A 3GZNB 3K9OB 1GUAB 2KVRA 1OEYJ 2DHZA 3R7RA 2D10A 1VZ8A 1BWNA 2LRWA 1Y56A 3ML9A 1P7EA 1KFYB 4KIKA 3NHEB 2V76A 3QWZB 4DX8A 3HVZA 5LONB 5CTRC 2D9ZA 4B6WA 1EF1A 3TW1A 2FCSA 4KGSA 4M0WA 4JKEA 3RNBC 1E8YA 5DIFB 1FXTB 3MFGA 4PYZA 1GNUA 3LB8C 2LYDA 1ACCA 1SIFA 5C5BA 4HB0B 4WWPA 5DI9B 3EHVA 1GB4A 5D6JB 1FIQA 2DAJA 3I9V1 3U7ZA 2M1MA 3DVNV 3W5VB 2DLBA 1TQZA 1X05A 3WYFB 4IWPA 2DENB 1C4AA 2AX5A 3ZKJC 2IYBA 1WSPA 1WR6E 1UEFA 1AQCA 1XLQA 3B0AA 3F5RA 2XK5A 3GOEA 3PREA 2RMMA 4UDUC 3VFKA 1IBXA 1SE9A 1K8RB 2ELAA 3CSTA 1NU2A 1K51A 4GIVA 1T5XD 4RGNA 4B9KA 2ADZA 1SE4A 4ICUA 2KDIA 1F9JA 1QKZA 1E8XA 1V1PB 1YJ1A 2WDQB 1FGZA 2ZJDA 1MG8A 4RF1A 2DBYA 4NPNA 2P0DA 3E9PA 2D11A 4E74A 2WDRB 2J0MA 5KQ1A 1KLGD 3FILA 4WURA 4X57B 3H6NA 4JKGB 1VBGA 1QOAA 4MJSB 2PIAA 3PLUA 2KT7A 4MH0E 2WS3B 1NYRA 2KFKB 3ZJUA 1UGJA 5G2NA 1K52A 2M0XA 3A9KB 2GUMA 1K50A 4YXDB 3AE7B 1N3HA 3V61A 4N9F4 2N1WA 4YSZB 1WGUA 3FLVA 3ENBA 4OVUA 3E66A 3U2SC 2X18A 2K8EA 4NQKE 2MBQA 1EAZA 1V9JA 2WXJA 2N9PC 4HWIB 1L0XB 2LEKA 1UH6A 2KJRA 1YQBA 2W3RA 2PMVA 1NTYA 3DHHC 4KIKB 5IOIA 1CZPA 4Z2NA 2R2OA 4K2PA 3NY5A 2OJWA 4M0WB 3CMMB 1TYGB 1KM7A 5DCNA 3IG3A 5KQ4A 2MEKA 1ST7A 3DBRI 2YLMA 3AM9A 2N0YA 2IZVB 1P5TA 5C5BB 2KK8A 3AE8B 4G50A 1N5WA 4II3B 2IO2B 3FKYA 4EJNA 4G0NB 4H8SA 3AE2B 2WU2B 3LDZE 5CHFA 3ML4A 4MM3A 2KTRA 4XZ4A 3P4SB 5C6RA 4K7WA 5MPOA 2O6VD 3OJ4B 2D3GA 3ODWA 1WFYA 4DDID 3WAPA 2LXCA 2Y5BB 4DXGA 5JH5C 4LNIA 2XK5B 1I4RA 2JXXA 1YIWA 2DNFA 4K3BA 2JRIB 4XGAB 3E56A 2Z59A 1WJ4A 1WZ3A 3APFA 2BYTA 3A1QA 3QARA 2K6QA 1SJED 3Q3JA 1ZC3B 5AZFA 3KRWA 1E0ZA 4YTNB 1WVHA 1RWSA 2WWZA 4EE2A 2LOXA 1F52A 2N4FA 4BKSD 1ZXIA 1VJKA 1WI1A 3G9WA 1EU3A 3RNGC 4EKUA 2G3QB 2DWQA 1F1HA 1UNSA 3BYYB 4IC7B 2I5CA 1VD2A 1NI2A 3FILB 3RNEC 2CU1A 2C60A 2KWCA 4EFOA 3RCPA 4HVBA 1AN8A 5CHWA 1Q10A 4RMAA 4KHOA 4NAWA 2LVOA 2K49A 1U2BA 1U4AA 2V3SA 4KVGB 4KV2A 3QBVB 3RULA 2LUMA 1CK1A 2VH2A 2CY4A 1F2RI 4I6PA 2ASQA 3Q3MC 2MKRA 2DX1A 3DBSA 4HDQA 4HSIA 5H8YE 1HB6A 4L6EA 4YT0B 3RCZA 4JE3B 2GRIA 3ONSA 1R4MI 4W9LA 3QC8B 5BYQA 1AARA 1TS3A 2BS4B 2LGYA 2YRYA 1OQNA 1M94A 4JWSC 3VUWA 3DPDA 1SJHD 1FM0D 1OQRA 3KWLA 2WX0A 4QJ5B 1L2NA 4IOYX 2YS1A 4A6FA 5BO4B 1A5RA 2SEBD 2WXMA 1Q5WB 4JIOU 4EUTA 2NBWB 5L95C 3QIJA 3CSFA 2GCLA 4FBJB 3H8HA 3X0WA 4FXCA 2PEAA 3KUZA 4M8NA 1YN4A 1UUPA 5C2TB 2ZNVB 4MM3B 2KTRB 4P6VF 2V0GA 1Q0WB 1LFDA 4TYZA 1FRRA 2L52A 1UBIA 3BVZA 5D7GA 4L2YA 1T0RC 1MKEA 2RQ1A 4IFSA 1UNPA 1ZOYB 1EO6A 1ROEA 2CAYA 5GOWB 3RNCC 4LNKA 2K22A 4W9EA 2BYVE 4OHJA 3OWEB 4FADA 4K7UA 4L1RA 1V8CA 2G1EA 2NMBA 3K9PB 2Z59B 1I4QA 3ENEA 1XEEA 5EDSA 3A1QB 2K39A 3L08A 2ZKMX 2KN5A 3QX1A 4WJ7A 3KSYA 2KOXA 1U5DA 4XDCA 1UELA 2BYEA 4GSWA 4K7SA 2WU5B 3EFUA 4LK0M 1WGRA 3L13A 4M02A 3BY4B 3SBTA 1NBFC 4ASWC 1K5GB 1C78A 1VLBA 2RD0A 3U12A 3DXEA 1GC6A 2YT2A 3DDCB 1GGOA 4ZRKA 3S2AA 2HJ1A 2VH1A 1GG3A 3FC4A 3AECB 1J0WA 2QHOA 4NAWB 5D3XA 2FUG1 1SXTA 4IM2A 2JPHA 1FNVA 3RNFC 1E90A 1HE8A 3VRAB 1R4NI 2UU7A 5JLJB 2D3AA 3PZDA 4GXBA 1AWDA 1MIXA 4OVVA 4E3CA 3EUB2 2J53A 1BXTA 4XC2A 5BYSA 5EE1A 2JZ3B 1FXIA 3IBEA 4NJCA 4JKAA 5BMHA 2QKLA 2IFSA 2DKQA 4W9FA 1STEA 2D07B 1SHCA 1D5XC 1V49A 1A70A 1NDDA 2ONQA 3NUHB 4A6FB 4AUQC 1YNTE 1XCTL 3ULBA 1HZ6A 1WJMA 3N1YC 4LNFA 4AOFA 3BYTB 2Z0DB 1V2YA 2C7HA 2I38A 2FCQA 4FA6A 2V9HA 3JYUA 2W9NA 5TSSA 4XWTA 1CQVA 2NCNA 2P0HA 3R7QA 3AULA 3AE9B 2XBBC 2DHJA 2KO3A 3HQCA 1ENFA 3W9CB 2ICIA 3GP7A 1WJ6A 2GMIC 2IO3B 1UPRA 3LYYA 3VR8B 2JF5A 3OANA 4QJ3B 3E9OA 2KWDA 1J7AA 2KDFB 1JMLA 3WCQA 5G55A 3NVYA 4AQ7A 4ZYNA 1GB1A 3TO1A 1K53A 4DBGA 2GCJA 2JWZA 4IOIE 2XN9C 3FAHA 3MHSD 1X86A 1FEHA 2J0JA 1RM6C 5BMGA 4DXFA 2MLBA 4WSFA 2BTEA 1TGZB 2LVQA 2H88B 2Y5CA 1L6UA 1TY0A 1C1YB 4I6NB 1WJNA 4FULA 3RN9C 2PE9A 1I4HA 4KDIC 2WXGA 1JRUA 2P8VA 4AJYB 1OQQA 3IFWB 3M3JA 2NS5A 3VTUA 2C9WB 3KYCD 5GXGB 4YTMB 1L5PA 3WALA 2BB6A 2N9LA 3TMPB 5D3VA 2WLBA 3C8YA 1J0GA 2RDGA 3NSUA 4JGHB 1RRPB 3P7ZA 3QCAA 2KQSA 2LKOA 1VZ6A 1WYGA 2KGXB 1I7HA 3AI5A 2NMQA 2COPA 1QT9A 2JU6X 3AE3B 3AJ4A 3GS2A 3QQ8B 3DOWA 2AWTA 2MP2A 4IUMB 1FFVA 1J8CA 3DBHI 1W1GA 1F77A 2BF8B 4NJ7A 4C4VA 5JHHA 2D9WA 1WR1A 2KWVB 2CODA 5DPWA 2ELBA 1VDVA 5AZHA 1RFAA 4HLEA 3EA6A 4HKZE 3MC0B 3KZ1A 1D6EC 4LLGM 2KANA 2MWNB 1FXAA 1ZDVA 2B76B 3T3OA 4LNNA 3KLSX 1CJEA 5DPSA 1NYQA 3KUDB 1NVID 4GGQA 1V97A 2BKRB 1P3RA 3QWMA 1B1ZA 3B9JA 1YMHE 2K00A 1KOTA 2BW2A 1WXSA 5T8IA 2JXTA 3KQ4A 4OZBA 1FMAD 4RH6A 3T8MA 4DBBA 2QILA 2NPTA 4HEA1 4REZA 1WM3A 4GDLA 2DA0A 4PS3A 2N7JA 1Y5OA 3IAS1 4MELA 4JK8A 3HSAA 1N6ZA 4JKCA 3UQAA 3L54A 3I63C 2OOBB 3V5WA 5DHFB 4Y94A 4IWQA 2UWQA 1V5PA 4HXDA 4ANUA 3U7DA 1NVLA 2MWSB 1PGXA 1QOFA 2UVMA 2J42A 3NG0A 4DHZE 1PDXA 4BKGA 2G9HD 3HW2B 4B0EA 1HXYD 3I57A 4DHZB 5CLQB 4E71A 1TXDA 1HZ5A 5HG2A 4RCOA 1IYFA 3MC8A 5KHOA 4M8MA 1J19A 2N9XA 3NVZA 4FHKA 1IGDA 1I4GA 4IM3A 4RF0A 1E10A 4CHKA 3TFMA 2BCJA 4N59A 3ZNZB 4BVUC 5TR5A 3ZYYX 1C9FA 1LW3A 4HAWB 4J3OD 5I2SA 3D8EA 3Q8CA 1ACAA 4YL8A 1U5EA 4H2AA 2MW5A 2BVCA 2D3BA 1FGYA 2LWPA 3SO6A 2N1VA 2RGFA 2VRRB 2BWFA 2BWES 2L0TA 4PYUA 1XXGA 4B0MA 1QZEA 2MP2B 2UYZB 3CIKA 2KLGA 1JW9D 4EOYA 4HRSA 2QMTA 3AEAB 1UD7A 3TSSA 4C4VB 2MCNB 4C56C 4JPSA 4ZDVA 4EZJA 2KMCA 2YEPB 4DDGD 3SV1A 2LRUA 1MFWA 4RFBA 2LD9A 4HAVB 4JK7A 1SE2A 3AEEB 3PHWB 1FHOA 1H8CA 2XEWA 2WXPA 1WI0A 2PKOA 3NWFA 3WAMA 1DROA 3V62A 3FP5A 5FK9C 2MRPA 2H7EA 5C16A 3DVGX 3V05A 3L4PA 3AB5A 4ITKA 2VKIA 2RSGA 5LXIB 3ZXVA 3TBLD 2NPTB 4KHBA 2AQ1B 4GDLB 3ZDTA 3VIAA 2MBBB 3APDA 4WVFB 4DXAB 4R3DA 3ZO5B 4YONA 1MPHA 2Q13A 3IT6B 1MHXA 4ZRQA 1WXMA 4JX1C 1S1QB 1PGAA 3IAM1 3PRPB 4IKGA 4DK5A 3DVGY 2KDEB 3CF6E 2BYFA 3Q3OC 4HKQA 5M4YB 2GLSA 3BIID 3SU8X 3NZ3A 3AE6B 3HIZA 3PTFC 1XD3B 3VTWA 1UBQA 1BT0A 2DHKA 4XYCA 3IT4B 1BTNA 2IGDA 2DLWA 1F2RC 1N61A 4NSWA 3FVCA 1R4MB 2FNJB 2KX0A 3N9YC 4G3XB 1V5OA 2KQ7A 3Q8FA 3NRZA 3L0WB 3PZ7A 1L4DB 3ZDMC 2OJRA 2LBBA 4B95A 2XQNM 1L0YB 2HJ8A 3AV8A 1YX6B 4K81A 5J2RA 1X11A 2LJ5A 2CKHB 1WRDB 2KAJA 2CHXA 2LFIA 5AEKB 3ZXRA 3IVFA 4CHMA 4W9KA 3B2GA 3MTNB 2COAA 2JT4B 4AP4C 3FM8C 1EWCA 4W9GA 2CB8A 1KLUD 3SBGA 1ZDXA 1MG4A 1JROA 1NTIA 2DFKA 2GS0A 4NZLB 1G6JA 3VDZA 1MHHE 1WRIA 1SBBB 4A9AA 5LOPB 3PV1A 3IXSA 2EKEC 4MY6A 4Z2MB 3ZW3A 3SFDB 3EGRA 3UINB 2IO0B 2KC1A 1B9RA 4WJOA 1P3QU 3TEZA 3N1XC 4KHBB 4EZLA 3KYDD 3ZUNA 4QJ4B 1MVKA 4A6KA 3ZIMA 2AQ3B 3Q8BA 1BAKA 2JUOA 1V86A 5EE0A 1L7YA 1IBXB 4GPTB 5E6PA 2GJYA 1ZUD2 1DYNA 1KI1B 1T0QC 2R2QA 1WE6A 5HE2A 3Q8AA 4JQWC 2DKPA 2RPVA 2VRWB 3SNHA 1WJUA 3ZJTA 1VCBA 2EMTA 3AMZA 4MGZE 3HM6X 4HCPB 2WXOA 2IY1B 2UZSA 3DWGC 4CO7A 4N58A 3UQBA 4KAXB 3C19A 3M1IB 3TJPA 1B55A 4GMVA 4S17A 4RGMA 1IGCA 4GLSC 2GB1A 1HQRD 3H7PA 3NOBA 4ZRIA 2KUQA 2EELA 1XLOA 2FJ9A 4G11A 2DZMA 2JYTA 1TS4A 2FCMA 5HE1A 2PTLA 2KWUB 4A5KA 4I6LB 1U29A 3O13A 3HM3A 2RPQA 2D4QA 2RDBC 2WYQA 4ZOHC 2GBNA 3P4PB 3TIXA 2WX1A 2IPKD 2Y8GA 4DX90 3NWAA 2PW9A 3HHMA 4WQMA 3A58A 1DOIA 1WYWB 1I42A 2KN4A 4C0AA 1OFFA 1S3SG 1TZOA 4S0RA 2KUPA 5KCVA 2ZZPB 5IN7A 2KR0A 4JLCA 4M01A 1JWBD 4HAUB 1FHXA 5J3YA 3VR9B 2RVBB 2X8XX 4WH4A 4ARIA 5DPRA 4WJQA 1MK9B 2OQBA 1XR0B 2BKFA 1M7EA 2KCJA 1V80A 1ZYIA 3ALBA 4FN2A 1ZW7A 2WXLA 1LGRA 1QQRA 1WXAA 2W82A 2R09A 2IBIB 3TEYA 1OQYA 1CMXB 1MJDA 1FRDA 5DPTA 4WAAA 3PVLA 5JHGA 5HE0A 2KNBA 3H9DA 2N9EB 2AEHA 1DGJA 3M63B 1D4BA 2KLCA 3ECIA 3PSCA 3HVDA 1I4PA 2WXNA 4NNJB 2LGIA 1T77A 2CQUA 1GAQB 4XWWA 3NVWA 1WF9A 3A4SC 3DBLB 2G45B 1ET9A 5JHAA 2MBEA 2J7QB 1ZXHA 2FIFA 5IKCM 2K8BA 2N23A 3BJIA 1WY8A 2Y8FA 2BT6A 2B3AA 4W9IA 1FD6A 3D8DA 4OSNA 4F7UP 4MT7A 1X1FA 1E7VA 3DBHB 2CHWA 3Q14C 4L23A 2LGSA 3NW8A 3RYTA 5IO9A 3H7PB 3OJ3A 2H89B 2M0AA 4C7ZA 1PYWD 3MJWA 2LULA 3ZNGC 3T9LA 4FJZA 5BMIA 1UNRA 2CY5A 1C4PA 2M19A 2FAZA 4B6HA 5C3JB 2COFA 2EC1A 5LXHA 1I35A 2ACZB 4C80A 2L83A 2L32A 1VBHA 3DCGA 1U5GA 1UWMA 1V88A 3P42A 1T0SC 1JWUD 4K3CA 1TJ6A 1WMHA 1JQ4A 2DYMA 3CXBB 3P6AA 2LMCA 2GI9A 3AEFB 3B77A 1HTOA 2RRFA 2KVZA 3W1SC 4W9CA 3RFZB 2JYEA 2DYNA 3GYOA 2LJIA 1ZP0B 1WX9A 1P0RA 4BBNC 4MSMB 2KJ6A 1SIJA 3ZLZA 3HK0A 4D6WA 1L0VB 4CSQA 3RZWC 5FKAC 5C1ZA 2R0DA 2GBJA 3RT3B 4WWNA 1LM8B 2CJOA 3ULCA 2BS3B 2WDTB 4RNAA 1U5FA 4AJWA 1N63A 5IP4D 2R2YA 4GNKB 3Q3FA 4MACA 4P1CC 2LVPA 3NZSA 2H7DA 3UI3A 3M95A 4LDTD 3ETRA 1WGHA 2AQ2B 2K5PA 1TIFA 1M4VA 1P1AA 1YX5B 1DBHA 2G4DB 4LTUA 1V61A 2N0SB 4KZ0A 2IGGA 1FHWA 1AWEA 4ANXA 2RLOA 4ILGB 4LDTB 4MH8A 1VRAB 2KMAA 4WWOA 5D3YA 4EZKA 5IRSA 3VUYA
chains in the Genus database with same CATH topology
3ZRCA 4FLHA 1EGXA 3X23A 1H10A 4HCNB 3VVWB 2QKMA 3A9JA 3V6CB 3H1UA 4EMOA 4KZCA 1WG7A 3FEHA 1TTNA 1P9DU 5HKHA 1E5WA 3VH3B 2JY6A 3WIMA 1P6SA 3U8ZA 3V60A 2M8SA 3M62B 4WJPA 1PLSA 1MAIA 2FUHB 4W9HA 2LG1A 5LLIA 3R3MA 2V4LA 4A6HA 1W1HA 2KFJA 1WMHB 2L1CA 3OLMD 3ZNID 3PP2A 1KJTA 4W9DA 2C5LC 1V81A 4RM9A 4RM8A 4MEMA 1QQGA 4IAPA 2GBKA 1WGDA 2KZRA 2IYDB 4HB2B 3RUIB 2YVCA 4KHAA 4FJVB 2LOZA 3VAWA 4URKA 4LJOB 2W2XD 3L17A 3SHQA 3AU4A 1DIKA 1KC7A 1WZ0A 1ZGUB 1IPGA 3A33B 3T06A 3OAWA 2L2IA 2K2JA 1LB1A 2MX2A 2I1KA 4DHJB 1PMSA 4EEWA 2L00B 1OMWA 2YF0A 3QJZA 1X1GA 3LJUX 5D3WA 1Q1OA 1LXDA 5E6OA 2YT1A 3I3TB 5JVLA 3PHXB 3RZFA 1KLVA 1FOEA 3N30A 2L0FA 2A4ZA 3SUZA 1WGQA 4GMXB 4KDLB 2OTXA 3A9JB 1ISNA 1X1MA 2DTCA 2CS4A 2N7EA 4HK2A 2L8JA 2GBMA 1PQSA 4W9JA 3JSVA 2D2QA 5AZGA 4CYEA 4ANWA 5J17A 2MDXA 5JHBA 2Z0PA 1GC7A 5E6NA 2RNRB 2EJ8A 4HB3B 2ZPYA 3GYPA 2DHIA 2COCA 1KZ7A 4HPMB 2LXAA 1Q67A 1M7RA 1T0YA 2D9YA 2G4SA 1YD8U 2DYQA 5L81A 2KD0A 4HJKA 5JZEB 4JKBA 4NY0A 2K8HA 1KZGA 4GU2A 2RUKB 1RAXA 2UZRA 3PT2B 5IJMA 4JKDA 2KHWB 4IW0A 1Z87A 2DZIA 3PRMB 4A3OA 3EC8A 1H4RA 2L7RA 2DYOA 5KHQA 1W1DA 1UZXB 2YS5A 2ZVOA 3MPXA 3KW5B 4BOSC 2NBVB 2K1FA 1MIZB 5IAAC 3EECA 2V1YA 3C0RB 2O6VA 2D9VA 2ZPNA 2ABDA 3EPYA 4GZUA 2DN6A 2KDBA 5GMVA 1I2HA 1Y19B 3WA0A 4D0NB 2I5FA 3ODOA 2R82A 4BKSA 3ODXA 1WXVA 1XT9B 3A8PA 3WAOA 1OGWA 1RLFA 3JVZX 2ZCBA 4BBNF 3NS8A 4MGKE 5IA7A 1BTKA 3JSVB 4FJYA 3D8FA 1I7AA 3F0WA 4XX5A 4IM0A 2MA9B 3IHPC 1C3TA 3UZTA 4ANVA 2FCNA 2HE7A 5C23A 2PZ1A 3VXWA 1QC6A 1XKEA 3GZNI 1DDMA 5EFXA 4F1SA 1D3ZA 1MK7B 1E8ZA 2LI5A 5C79A 2WH5A 2C7NB 2NZ8B 4F7ZA 2JP2A 4K1RB 3UF8A 3VQIA 2E2XA 2YS3A 3MDBC 5HE3A 1OTRB 3PPAA 2RGNB 3PSEB 3PG7A 2DYBA 2O6VB 3ZVVA 2JRHA 4MGIE 3RD2A 3A98B 3N32A 2K2UA 1EVHA 3ZTDA 4F7GA 4LJPB 3KY9A 3QAQA 4TV3A 1WJ1A 1E7UA 4HAXB 4BBKA 3O96A 2DZJA 2D9XA 4F7HA 2J59M 3W1SA 4DWFA 4GB9A 3QA8A 3AU5A 5D2MB 1WGYA 1XODA 5J3TA 1P98A 2N7DA 5CHVC 4HATB 2L3ZA 1ZVRA 4BOZB 1WM2A 2ZVNA 4FHJA 2CRFA 4TQ0A 4JKFA 2HTHA 5J3QA 2I1JA 1V5TA 1GJZA 3NZUA 3PLVA 1ZM0A 2M4NA 3KUCB 4HHVA 4IWOA 1ZC4B 4A3PA 2NR2A 3FSSA 4LCDE 1V5UA 2ZNVC 1V5MA 3KRXA 1WH3A 4F8CB 4P7IA 1IRSA 3LJ3A 2A5UA 1TZ1A 1ZKHA 1V89A 2O2VA 3R66C 2KJHB 3BINA 2L76A 2LASA 1DDWA 1OEYA 5L83A 1Y8RC 3VHTC 2RSUA 3U30A 3VH4B 1ZSQA 2HRJA 3N7CA 3H7SA 3UIPB 2X0SA 2AYOB 2KXJA 3PS6A 4WJNA 2MBOA 4K2OA 4J6IA 2YT0A 2M14A 4PS7A 1XQQA 5FI0A 4HPLB 1TBEA 2G35A 2L05A 4KSLC 2K6DB 4GDKA 2CHZA 2M38A 3O65B 1NTVA 3L10B 1XCGA 3L16A 3B08A 3D32A 2VSZA 4ILJA 1XD4A 4JKHA 2Z0EB 2MFQA 2IO1B 1RRBA 2FIDA 2KTFA 5D27A 5FI1A 2HTHB 1E8WA 2KKCA 4TKNA 2LUEA 4IG7B 2M17A 2GBRA 3PVUA 4K17A 2PPHA 1HBKA 2BPSA 2DAFA 2K25A 3AXCA 1WX7A 1FB8A 4PS8A 4GN1A 3WANA 3KVFB 3N3KB 2JZZA 3ZTCA 3SYXA 2LGDA 4HB4B 1WE7A 2KX3A 1KBLA 2DIKA 1SGHA 3DQVA 3V6EB 2Y7BA 2NVUI 2O2VB 2C7MB 2W2WA 3QHTA 4WQOB 4BKTA 2PJHA 5J18A 4GOCA 4CHJA 3P2BA 3PRZA 3ZRFA 3B1LX 4PQ0A 1RJ2A 2ROVA 3ZVRA 2MQJA 1XX0A 1HB8A 2FDQA 4A20A 4BFRA 3E9LA 2DX5A 1LQBA 5DH9B 4NJ6A 1JDEA 1DDVA 2MSED 5CLLB 2RR9A 2AL6A 1UPQA 3JW0X 2LGXA 2Z0QA 3QK0A 3TVVA 1EUVB 3DBLI 3TL5A 4GDKB 3UIOB 2YSZA 4XWXA 4PNKA 2JVCA 2MBHA 1U27A 1Z5SB 1UNQA 1V6EA 3PEGA 2DZKA 3W1YA 2KC2A 3KH0A 4HAYB 2K8CA 4NQLB 3SDLC 5JP4A 2PE6B 4MDKE 4MSQB 2P0FA 1PFJA 1WGGA 3PVWA 3PGEA 2ZCCA 2ZEQA 4DHJD 4JK9A 1WIAA 2HD5B 2EMSA 2AL3A 1UGMA 3DXDA 3DXCA 3TCAA 3A4RA 2IY0B 3APCA 4II2B 2J0KA 4HAZB 1FAOA 4HDOA 4ZRJA 5CX3A 1OY2A 1K5DB 2REXA 2ROZB 2BGFA 3ML8A 3VUXA 1Z2MA 5D94A 3VOQA 3SD5A 3VTVA 2GOWA 2W2XC 4MGYE 4ILHA 4AWJA 3DVNU 4JKGA 4MJSA 1WX8A 4KSKC 4TQ1A 5DHAB 2KFKA 2DX5B 2LZ6A 2Z0OA 2CR5A 3A9KA 3ZNHB 4ICVA 1EF5A 3UGBB 4TUUA 2NBUA 2FJLA 4MK0A 3A8QA 5FR6A 1IP9A 4JL9A 3K9OB 1GUAB 2KVRA 1OEYJ 2DHZA 3R7RA 2D10A 1BWNA 2LRWA 3ML9A 4KIKA 3NHEB 2V76A 3QWZB 4DX8A 5LONB 5CTRC 2D9ZA 4B6WA 1EF1A 3TW1A 2FCSA 4JKEA 1E8YA 5DIFB 1FXTB 4PYZA 1GNUA 2LYDA 1SIFA 5C5BA 4HB0B 4WWPA 5DI9B 3EHVA 5D6JB 2DAJA 2M1MA 3DVNV 1TQZA 1X05A 3WYFB 4IWPA 2DENB 3ZKJC 2IYBA 1WR6E 1UEFA 1AQCA 3B0AA 3F5RA 2XK5A 3GOEA 3PREA 3VFKA 1SE9A 1K8RB 2ELAA 3CSTA 1NU2A 4GIVA 4B9KA 2ADZA 4ICUA 2KDIA 1F9JA 1E8XA 1YJ1A 1FGZA 2ZJDA 1MG8A 4NPNA 2P0DA 3E9PA 2D11A 4E74A 2J0MA 5KQ1A 4X57B 3H6NA 4JKGB 1VBGA 4MJSB 3PLUA 4MH0E 2KFKB 5G2NA 2M0XA 3A9KB 1N3HA 3V61A 4N9F4 2N1WA 1WGUA 3FLVA 3ENBA 4OVUA 3E66A 2X18A 4NQKE 2MBQA 1EAZA 1V9JA 2N9PC 4HWIB 1UH6A 2KJRA 1YQBA 1NTYA 4KIKB 4Z2NA 2R2OA 4K2PA 3NY5A 4M0WB 3CMMB 1KM7A 5DCNA 3IG3A 5KQ4A 3DBRI 1ST7A 2YLMA 2N0YA 2IZVB 1P5TA 5C5BB 2KK8A 4G50A 4II3B 2IO2B 4EJNA 4G0NB 4H8SA 3LDZE 5CHFA 3ML4A 4MM3A 2KTRA 4XZ4A 5C6RA 4K7WA 2O6VD 3OJ4B 2D3GA 3ODWA 1WFYA 4DDID 3WAPA 2LXCA 2Y5BB 5JH5C 2XK5B 2JXXA 1YIWA 2JRIB 1WZ3A 1WJ4A 3APFA 3A1QA 3QARA 2K6QA 3Q3JA 1ZC3B 5AZFA 3KRWA 1WVHA 2WWZA 2LOXA 2N4FA 4BKSD 1WI1A 3G9WA 4EKUA 2G3QB 4IC7B 2I5CA 1VD2A 1NI2A 2CU1A 2C60A 2KWCA 4EFOA 3RCPA 4HVBA 5CHWA 4RMAA 4KHOA 4NAWA 2LVOA 1U2BA 1U4AA 2V3SA 4KVGB 4KV2A 3QBVB 3RULA 2CY4A 4I6PA 2ASQA 2MKRA 2DX1A 3DBSA 4HDQA 1HB6A 4L6EA 3RCZA 3ONSA 1R4MI 4W9LA 3QC8B 1AARA 2LGYA 2YRYA 1OQNA 1M94A 3VUWA 3DPDA 2WX0A 1L2NA 4IOYX 2YS1A 4A6FA 5BO4B 1A5RA 1Q5WB 4JIOU 4EUTA 2NBWB 5L95C 3QIJA 3CSFA 2GCLA 4FBJB 3X0WA 2PEAA 3KUZA 4M8NA 2ZNVB 2KTRB 1Q0WB 1LFDA 4TYZA 1UBIA 5D7GA 1MKEA 2RQ1A 4IFSA 1UNPA 1EO6A 2CAYA 5GOWB 4W9EA 2BYVE 4FADA 4K7UA 2NMBA 3K9PB 2Z59B 5EDSA 3ENEA 3A1QB 2K39A 3L08A 2KN5A 3QX1A 4WJ7A 3KSYA 2KOXA 1U5DA 1UELA 2BYEA 4GSWA 4K7SA 3EFUA 1WGRA 3L13A 3BY4B 3SBTA 1NBFC 4ASWC 1K5GB 2RD0A 3DXEA 1GC6A 3DDCB 1GGOA 4ZRKA 3S2AA 1GG3A 1J0WA 2QHOA 4NAWB 5D3XA 4IM2A 2JPHA 1E90A 1HE8A 1R4NI 5JLJB 3PZDA 4GXBA 1MIXA 4OVVA 4E3CA 4XC2A 2JZ3B 3IBEA 4JKAA 2QKLA 2IFSA 2DKQA 4W9FA 2D07B 1SHCA 1V49A 1NDDA 4A6FB 4AUQC 3ULBA 1WJMA 4AOFA 2Z0DB 1V2YA 2C7HA 2FCQA 4FA6A 3JYUA 2W9NA 2NCNA 2P0HA 3R7QA 3AULA 2XBBC 2DHJA 2KO3A 3HQCA 1WJ6A 2GMIC 2IO3B 1UPRA 2JF5A 3OANA 3E9OA 2KDFB 5G55A 4ZYNA 3TO1A 4DBGA 2GCJA 2JWZA 3MHSD 1X86A 2J0JA 2MLBA 4WSFA 1TGZB 2LVQA 1C1YB 4I6NB 1WJNA 4FULA 2PE9A 4KDIC 1JRUA 2P8VA 4AJYB 3IFWB 3M3JA 2NS5A 3VTUA 2C9WB 3KYCD 3WALA 3TMPB 5D3VA 1J0GA 3NSUA 4JGHB 1RRPB 3P7ZA 3QCAA 2KQSA 2LKOA 2KGXB 3AI5A 2COPA 3AJ4A 3QQ8B 3DOWA 2AWTA 2MP2A 4IUMB 1J8CA 3DBHI 1W1GA 2BF8B 4NJ7A 5JHHA 2D9WA 1WR1A 2KWVB 2CODA 5DPWA 2ELBA 5AZHA 1RFAA 4HLEA 3KZ1A 2KANA 2MWNB 5DPSA 3KUDB 4GGQA 2BKRB 1P3RA 3QWMA 2K00A 1KOTA 1WXSA 3T8MA 4DBBA 2NPTA 1WM3A 4GDLA 2DA0A 4PS3A 4MELA 1Y5OA 4JK8A 4JKCA 3UQAA 3L54A 2OOBB 3V5WA 5DHFB 4Y94A 4IWQA 2UWQA 1V5PA 4HXDA 4ANUA 3U7DA 1NVLA 2MWSB 2UVMA 4DHZE 4BKGA 3HW2B 4DHZB 5CLQB 4E71A 1TXDA 1IYFA 5KHOA 4M8MA 1J19A 2N9XA 4FHKA 4IM3A 4CHKA 3TFMA 2BCJA 3ZNZB 4BVUC 5TR5A 1LW3A 4HAWB 3D8EA 1ACAA 4YL8A 1U5EA 2MW5A 1FGYA 2LWPA 3SO6A 2N1VA 2RGFA 2VRRB 2BWFA 2BWES 2L0TA 4PYUA 1QZEA 2MP2B 2UYZB 3CIKA 2KLGA 4EOYA 1UD7A 2MCNB 4ZDVA 4EZJA 2KMCA 4DDGD 3SV1A 2LRUA 2LD9A 4HAVB 4JK7A 3PHWB 1FHOA 1H8CA 2XEWA 1WI0A 3WAMA 1DROA 3V62A 3FP5A 2MRPA 2H7EA 5C16A 3DVGX 2VKIA 2RSGA 5LXIB 3TBLD 2NPTB 4GDLB 3ZDTA 3VIAA 2MBBB 3APDA 4WVFB 4DXAB 3ZO5B 4YONA 1MPHA 2Q13A 1WXMA 1S1QB 3PRPB 4DK5A 3DVGY 2KDEB 3CF6E 2BYFA 3SU8X 3HIZA 3PTFC 1XD3B 3VTWA 1UBQA 1BT0A 2DHKA 1BTNA 2DLWA 4NSWA 2FNJB 2KX0A 4G3XB 1V5OA 2KQ7A 3L0WB 3ZDMC 2OJRA 2LBBA 4B95A 2XQNM 2HJ8A 1YX6B 4K81A 5J2RA 1X11A 2LJ5A 2CKHB 1WRDB 2CHXA 5AEKB 3IVFA 4CHMA 4W9KA 3MTNB 2COAA 2JT4B 4AP4C 3FM8C 4W9GA 2CB8A 3SBGA 1NTIA 2DFKA 2GS0A 1G6JA 3VDZA 5LOPB 3PV1A 2EKEC 4MY6A 4Z2MB 3ZW3A 3UINB 2IO0B 2KC1A 4WJOA 1P3QU 4KHBB 4EZLA 3KYDD 3ZUNA 4A6KA 3ZIMA 1BAKA 2JUOA 1V86A 1L7YA 4GPTB 5E6PA 2GJYA 1DYNA 1KI1B 2R2QA 1WE6A 5HE2A 4JQWC 2DKPA 2VRWB 3SNHA 1WJUA 1VCBA 2EMTA 4MGZE 3HM6X 4HCPB 2IY1B 2UZSA 4CO7A 3UQBA 4KAXB 3TJPA 3M1IB 1B55A 4GMVA 3H7PA 3NOBA 4ZRIA 2FJ9A 4G11A 2DZMA 2FCMA 5HE1A 2KWUB 4A5KA 4I6LB 1U29A 3HM3A 2RPQA 2D4QA 2WYQA 2GBNA 3TIXA 2WX1A 2Y8GA 4DX90 3HHMA 1WYWB 1I42A 4C0AA 1S3SG 2KUPA 5KCVA 2ZZPB 4JLCA 4HAUB 1FHXA 5J3YA 2RVBB 5DPRA 4WJQA 1MK9B 2OQBA 1XR0B 2BKFA 1M7EA 2KCJA 1V80A 3ALBA 4FN2A 1ZW7A 1WXAA 2R09A 2IBIB 1OQYA 1CMXB 5DPTA 4WAAA 3PVLA 5JHGA 5HE0A 2KNBA 3H9DA 2N9EB 2AEHA 3M63B 2KLCA 3ECIA 3PSCA 4NNJB 2CQUA 1WF9A 3A4SC 2G45B 5JHAA 2MBEA 2J7QB 2FIFA 2K8BA 2N23A 3BJIA 1WY8A 2Y8FA 2B3AA 4W9IA 3D8DA 4F7UP 4MT7A 1X1FA 1E7VA 2CHWA 3RYTA 3H7PB 3OJ3A 3MJWA 2LULA 3ZNGC 3T9LA 4FJZA 1UNRA 2CY5A 2FAZA 4B6HA 2COFA 2EC1A 5LXHA 1I35A 1VBHA 3DCGA 1U5GA 1V88A 1TJ6A 1WMHA 2DYMA 3CXBB 3P6AA 3W1SC 4W9CA 2DYNA 3GYOA 1WX9A 1P0RA 4BBNC 4MSMB 2KJ6A 3ZLZA 3HK0A 3RZWC 5C1ZA 2R0DA 2GBJA 3RT3B 4WWNA 1LM8B 3ULCA 2WDTB 1U5FA 4AJWA 3Q3FA 2LVPA 3NZSA 2H7DA 3M95A 4LDTD 1WGHA 1P1AA 1YX5B 1DBHA 2G4DB 1V61A 4KZ0A 1FHWA 1AWEA 4ANXA 2RLOA 4ILGB 4LDTB 2KMAA 4WWOA 5D3YA 4EZKA 3VUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRC A;  4FLH A;  1EGX A;  3X23 A;  1H10 A;  4HCN B;  3VVW B;  2QKM A;  3A9J A;  3V6C B;  3H1U A;  4EMO A;  4KZC A;  1WG7 A;  3FEH A;  1TTN A;  1P9D U;  5HKH A;  1E5W A;  3VH3 B;  2JY6 A;  3WIM A;  1P6S A;  3U8Z A;  3V60 A;  2M8S A;  3M62 B;  4WJP A;  1PLS A;  1MAI A;  2FUH B;  4W9H A;  2LG1 A;  5LLI A;  3R3M A;  2V4L A;  4A6H A;  1W1H A;  2KFJ A;  1WMH B;  2L1C A;  3OLM D;  3ZNI D;  3PP2 A;  1KJT A;  4W9D A;  2C5L C;  1V81 A;  4RM9 A;  4RM8 A;  4MEM A;  1QQG A;  4IAP A;  2GBK A;  1WGD A;  2KZR A;  2IYD B;  4HB2 B;  3RUI B;  2YVC A;  4KHA A;  4FJV B;  2LOZ A;  3VAW A;  4URK A;  4LJO B;  2W2X D;  3L17 A;  3SHQ A;  3AU4 A;  1WZ0 A;  1ZGU B;  1IPG A;  3A33 B;  3T06 A;  3OAW A;  2L2I A;  2K2J A;  1LB1 A;  2MX2 A;  2I1K A;  4DHJ B;  1PMS A;  4EEW A;  2L00 B;  1OMW A;  2YF0 A;  3QJZ A;  1X1G A;  3LJU X;  5D3W A;  1Q1O A;  1LXD A;  5E6O A;  2YT1 A;  3I3T B;  3PHX B;  3RZF A;  1KLV A;  1FOE A;  3N30 A;  2L0F A;  2A4Z A;  3SUZ A;  1WGQ A;  4GMX B;  4KDL B;  2OTX A;  3A9J B;  1ISN A;  1X1M A;  2DTC A;  2CS4 A;  2N7E A;  4HK2 A;  2L8J A;  2GBM A;  1PQS A;  4W9J A;  3JSV A;  2D2Q A;  5AZG A;  4CYE A;  4ANW A;  5J17 A;  2MDX A;  5JHB A;  2Z0P A;  1GC7 A;  5E6N A;  2RNR B;  2EJ8 A;  4HB3 B;  2ZPY A;  3GYP A;  2DHI A;  2COC A;  1KZ7 A;  4HPM B;  2LXA A;  1Q67 A;  1M7R A;  1T0Y A;  2D9Y A;  2G4S A;  1YD8 U;  2DYQ A;  5L81 A;  2KD0 A;  4HJK A;  5JZE B;  4NY0 A;  2K8H A;  1KZG A;  4GU2 A;  2RUK B;  1RAX A;  2UZR A;  3PT2 B;  5IJM A;  4IW0 A;  2KHW B;  1Z87 A;  2DZI A;  3PRM B;  4A3O A;  3EC8 A;  1H4R A;  2L7R A;  2DYO A;  5KHQ A;  1W1D A;  1UZX B;  2YS5 A;  2ZVO A;  3MPX A;  3KW5 B;  4BOS C;  2NBV B;  2K1F A;  1MIZ B;  5IAA C;  3EEC A;  2V1Y A;  3C0R B;  2O6V A;  2D9V A;  2ZPN A;  2ABD A;  3EPY A;  4GZU A;  2DN6 A;  2KDB A;  5GMV A;  1I2H A;  1Y19 B;  3WA0 A;  4D0N B;  2I5F A;  3ODO A;  4BKS A;  3ODX A;  1WXV A;  1XT9 B;  3A8P A;  3WAO A;  1OGW A;  1RLF A;  3JVZ X;  2ZCB A;  4BBN F;  3NS8 A;  4MGK E;  5IA7 A;  1BTK A;  3JSV B;  4FJY A;  3D8F A;  1I7A A;  3F0W A;  4XX5 A;  4IM0 A;  2MA9 B;  3IHP C;  1C3T A;  3UZT A;  4ANV A;  2FCN A;  2HE7 A;  5C23 A;  2PZ1 A;  3VXW A;  1QC6 A;  1XKE A;  3GZN I;  1DDM A;  5EFX A;  4F1S A;  1D3Z A;  1MK7 B;  1E8Z A;  2LI5 A;  5C79 A;  2WH5 A;  2C7N B;  2NZ8 B;  4F7Z A;  2JP2 A;  4K1R B;  3UF8 A;  3VQI A;  2E2X A;  2YS3 A;  3MDB C;  5HE3 A;  1OTR B;  3PPA A;  2RGN B;  3PSE B;  3PG7 A;  2DYB A;  2O6V B;  3ZVV A;  2JRH A;  4MGI E;  3RD2 A;  3A98 B;  3N32 A;  2K2U A;  1EVH A;  3ZTD A;  4F7G A;  4LJP B;  3KY9 A;  3QAQ A;  4TV3 A;  1WJ1 A;  1E7U A;  4HAX B;  4BBK A;  3O96 A;  2DZJ A;  2D9X A;  4F7H A;  2J59 M;  3W1S A;  4DWF A;  4GB9 A;  3QA8 A;  3AU5 A;  5D2M B;  1WGY A;  1XOD A;  5J3T A;  1P98 A;  2N7D A;  5CHV C;  4HAT B;  2L3Z A;  1ZVR A;  4BOZ B;  1WM2 A;  2ZVN A;  4FHJ A;  2CRF A;  4TQ0 A;  2HTH A;  5J3Q A;  2I1J A;  1V5T A;  1GJZ A;  3NZU A;  3PLV A;  1ZM0 A;  2M4N A;  3KUC B;  4HHV A;  4IWO A;  1ZC4 B;  4A3P A;  2NR2 A;  3FSS A;  4LCD E;  1V5U A;  2ZNV C;  1V5M A;  3KRX A;  1WH3 A;  4F8C B;  4P7I A;  1IRS A;  3LJ3 A;  2A5U A;  1TZ1 A;  1ZKH A;  1V89 A;  2O2V A;  3R66 C;  2KJH B;  3BIN A;  2L76 A;  2LAS A;  1DDW A;  1OEY A;  5L83 A;  1Y8R C;  3VHT C;  2RSU A;  3U30 A;  3VH4 B;  1ZSQ A;  2HRJ A;  3N7C A;  3H7S A;  3UIP B;  2AYO B;  2KXJ A;  3PS6 A;  4WJN A;  2MBO A;  4K2O A;  4J6I A;  2YT0 A;  2M14 A;  4PS7 A;  1XQQ A;  5FI0 A;  4HPL B;  1TBE A;  2G35 A;  2L05 A;  4KSL C;  2K6D B;  4GDK A;  2CHZ A;  2M38 A;  3O65 B;  1NTV A;  3L10 B;  1XCG A;  3L16 A;  3B08 A;  3D32 A;  2VSZ A;  1XD4 A;  2Z0E B;  2MFQ A;  2IO1 B;  1RRB A;  2FID A;  2KTF A;  5D27 A;  5FI1 A;  2HTH B;  1E8W A;  2KKC A;  4TKN A;  2LUE A;  4IG7 B;  2M17 A;  2GBR A;  3PVU A;  4K17 A;  2PPH A;  1HBK A;  2BPS A;  2DAF A;  2K25 A;  3AXC A;  1WX7 A;  1FB8 A;  4PS8 A;  4GN1 A;  3WAN A;  3KVF B;  3N3K B;  2JZZ A;  3ZTC A;  3SYX A;  2LGD A;  4HB4 B;  1WE7 A;  2KX3 A;  1SGH A;  3DQV A;  3V6E B;  2Y7B A;  2NVU I;  2O2V B;  2C7M B;  2W2W A;  3QHT A;  4WQO B;  4BKT A;  2PJH A;  5J18 A;  4GOC A;  4CHJ A;  3P2B A;  3PRZ A;  3ZRF A;  3B1L X;  4PQ0 A;  1RJ2 A;  2ROV A;  3ZVR A;  2MQJ A;  1XX0 A;  1HB8 A;  2FDQ A;  4A20 A;  4BFR A;  2DX5 A;  1LQB A;  5DH9 B;  4NJ6 A;  1DDV A;  2MSE D;  5CLL B;  2RR9 A;  2AL6 A;  1UPQ A;  3JW0 X;  2LGX A;  2Z0Q A;  3QK0 A;  3TVV A;  1EUV B;  3DBL I;  3TL5 A;  4GDK B;  3UIO B;  2YSZ A;  4XWX A;  4PNK A;  2JVC A;  2MBH A;  1U27 A;  1Z5S B;  1UNQ A;  1V6E A;  3PEG A;  2DZK A;  3W1Y A;  2KC2 A;  3KH0 A;  4HAY B;  2K8C A;  4NQL B;  3SDL C;  5JP4 A;  2PE6 B;  4MDK E;  4MSQ B;  2P0F A;  1PFJ A;  1WGG A;  3PVW A;  3PGE A;  2ZCC A;  2ZEQ A;  4DHJ D;  1WIA A;  2HD5 B;  2EMS A;  2AL3 A;  1UGM A;  3DXD A;  3DXC A;  3TCA A;  3A4R A;  2IY0 B;  3APC A;  4II2 B;  2J0K A;  4HAZ B;  1FAO A;  4HDO A;  4ZRJ A;  5CX3 A;  1OY2 A;  1K5D B;  2REX A;  2ROZ B;  2BGF A;  3ML8 A;  3VUX A;  1Z2M A;  5D94 A;  3VOQ A;  3SD5 A;  3VTV A;  2GOW A;  2W2X C;  4MGY E;  4AWJ A;  3DVN U;  4MJS A;  1WX8 A;  4KSK C;  4TQ1 A;  5DHA B;  2KFK A;  2DX5 B;  2LZ6 A;  2Z0O A;  2CR5 A;  3A9K A;  3ZNH B;  4ICV A;  1EF5 A;  3UGB B;  4TUU A;  2NBU A;  2FJL A;  4MK0 A;  3A8Q A;  5FR6 A;  1IP9 A;  4JL9 A;  3K9O B;  1GUA B;  2KVR A;  1OEY J;  2DHZ A;  3R7R A;  2D10 A;  1BWN A;  2LRW A;  3ML9 A;  4KIK A;  3NHE B;  2V76 A;  3QWZ B;  4DX8 A;  5LON B;  5CTR C;  2D9Z A;  4B6W A;  1EF1 A;  3TW1 A;  2FCS A;  1E8Y A;  5DIF B;  1FXT B;  4PYZ A;  1GNU A;  2LYD A;  1SIF A;  5C5B A;  4HB0 B;  4WWP A;  5DI9 B;  3EHV A;  5D6J B;  2DAJ A;  2M1M A;  3DVN V;  1TQZ A;  1X05 A;  3WYF B;  4IWP A;  2DEN B;  3ZKJ C;  2IYB A;  1WR6 E;  1UEF A;  1AQC A;  3B0A A;  3F5R A;  2XK5 A;  3GOE A;  3PRE A;  3VFK A;  1SE9 A;  1K8R B;  2ELA A;  3CST A;  1NU2 A;  4GIV A;  4B9K A;  2ADZ A;  4ICU A;  2KDI A;  1F9J A;  1E8X A;  1YJ1 A;  1FGZ A;  2ZJD A;  1MG8 A;  4NPN A;  2P0D A;  2D11 A;  4E74 A;  2J0M A;  5KQ1 A;  4X57 B;  3H6N A;  4MJS B;  3PLU A;  4MH0 E;  2KFK B;  5G2N A;  2M0X A;  3A9K B;  1N3H A;  3V61 A;  4N9F 4;  2N1W A;  1WGU A;  3FLV A;  4OVU A;  2X18 A;  4NQK E;  2MBQ A;  1EAZ A;  1V9J A;  2N9P C;  4HWI B;  1UH6 A;  2KJR A;  1YQB A;  1NTY A;  4KIK B;  4Z2N A;  2R2O A;  4K2P A;  3NY5 A;  4M0W B;  3CMM B;  1KM7 A;  5DCN A;  3IG3 A;  5KQ4 A;  3DBR I;  1ST7 A;  2YLM A;  2N0Y A;  2IZV B;  1P5T A;  5C5B B;  2KK8 A;  4G50 A;  4II3 B;  2IO2 B;  4EJN A;  4G0N B;  4H8S A;  3LDZ E;  5CHF A;  3ML4 A;  4MM3 A;  2KTR A;  4XZ4 A;  5C6R A;  4K7W A;  2O6V D;  3OJ4 B;  2D3G A;  3ODW A;  1WFY A;  4DDI D;  3WAP A;  2LXC A;  2Y5B B;  5JH5 C;  2XK5 B;  2JXX A;  1YIW A;  2JRI B;  1WZ3 A;  1WJ4 A;  3APF A;  3A1Q A;  3QAR A;  2K6Q A;  3Q3J A;  1ZC3 B;  5AZF A;  3KRW A;  1WVH A;  2WWZ A;  2LOX A;  2N4F A;  4BKS D;  1WI1 A;  3G9W A;  4EKU A;  2G3Q B;  4IC7 B;  2I5C A;  1VD2 A;  1NI2 A;  2CU1 A;  2C60 A;  2KWC A;  4EFO A;  3RCP A;  4HVB A;  5CHW A;  4RMA A;  4KHO A;  4NAW A;  2LVO A;  1U2B A;  1U4A A;  2V3S A;  4KVG B;  4KV2 A;  3QBV B;  3RUL A;  2CY4 A;  4I6P A;  2ASQ A;  2MKR A;  2DX1 A;  3DBS A;  4HDQ A;  1HB6 A;  4L6E A;  3RCZ A;  3ONS A;  1R4M I;  4W9L A;  3QC8 B;  1AAR A;  2LGY A;  2YRY A;  1OQN A;  1M94 A;  3VUW A;  3DPD A;  2WX0 A;  1L2N A;  4IOY X;  2YS1 A;  4A6F A;  5BO4 B;  1A5R A;  1Q5W B;  4JIO U;  4EUT A;  2NBW B;  5L95 C;  3QIJ A;  3CSF A;  2GCL A;  4FBJ B;  3X0W A;  2PEA A;  3KUZ A;  4M8N A;  2ZNV B;  2KTR B;  1Q0W B;  1LFD A;  4TYZ A;  1UBI A;  5D7G A;  1MKE A;  2RQ1 A;  4IFS A;  1UNP A;  1EO6 A;  2CAY A;  5GOW B;  4W9E A;  2BYV E;  4FAD A;  4K7U A;  2NMB A;  3K9P B;  2Z59 B;  5EDS A;  3ENE A;  3A1Q B;  2K39 A;  3L08 A;  2KN5 A;  3QX1 A;  4WJ7 A;  3KSY A;  2KOX A;  1U5D A;  1UEL A;  2BYE A;  4GSW A;  4K7S A;  3EFU A;  1WGR A;  3L13 A;  3BY4 B;  1NBF C;  4ASW C;  1K5G B;  2RD0 A;  3DXE A;  1GC6 A;  3DDC B;  4ZRK A;  3S2A A;  1GG3 A;  1J0W A;  2QHO A;  4NAW B;  5D3X A;  4IM2 A;  2JPH A;  1E90 A;  1HE8 A;  1R4N I;  5JLJ B;  3PZD A;  4GXB A;  1MIX A;  4OVV A;  4E3C A;  4XC2 A;  2JZ3 B;  3IBE A;  2QKL A;  2IFS A;  2DKQ A;  4W9F A;  2D07 B;  1SHC A;  1V49 A;  1NDD A;  4A6F B;  4AUQ C;  3ULB A;  1WJM A;  4AOF A;  2Z0D B;  1V2Y A;  2C7H A;  2FCQ A;  4FA6 A;  3JYU A;  2W9N A;  2NCN A;  2P0H A;  3R7Q A;  3AUL A;  2XBB C;  2DHJ A;  2KO3 A;  3HQC A;  1WJ6 A;  2GMI C;  2IO3 B;  1UPR A;  2JF5 A;  3OAN A;  2KDF B;  5G55 A;  4ZYN A;  3TO1 A;  4DBG A;  2GCJ A;  2JWZ A;  3MHS D;  1X86 A;  2J0J A;  2MLB A;  4WSF A;  1TGZ B;  2LVQ A;  1C1Y B;  4I6N B;  1WJN A;  4FUL A;  2PE9 A;  4KDI C;  1JRU A;  2P8V A;  4AJY B;  3IFW B;  3M3J A;  2NS5 A;  3VTU A;  2C9W B;  3KYC D;  3WAL A;  3TMP B;  5D3V A;  1J0G A;  3NSU A;  4JGH B;  1RRP B;  3P7Z A;  3QCA A;  2KQS A;  2LKO A;  2KGX B;  3AI5 A;  2COP A;  3AJ4 A;  3QQ8 B;  3DOW A;  2AWT A;  2MP2 A;  4IUM B;  1J8C A;  3DBH I;  1W1G A;  2BF8 B;  4NJ7 A;  5JHH A;  2D9W A;  1WR1 A;  2KWV B;  2COD A;  5DPW A;  2ELB A;  5AZH A;  1RFA A;  4HLE A;  3KZ1 A;  2KAN A;  2MWN B;  5DPS A;  3KUD B;  4GGQ A;  2BKR B;  1P3R A;  3QWM A;  2K00 A;  1KOT A;  1WXS A;  3T8M A;  4DBB A;  2NPT A;  1WM3 A;  4GDL A;  2DA0 A;  4PS3 A;  4MEL A;  1Y5O A;  3UQA A;  3L54 A;  2OOB B;  3V5W A;  5DHF B;  4Y94 A;  4IWQ A;  2UWQ A;  1V5P A;  4HXD A;  4ANU A;  3U7D A;  1NVL A;  2MWS B;  2UVM A;  4DHZ E;  4BKG A;  3HW2 B;  4DHZ B;  5CLQ B;  4E71 A;  1TXD A;  1IYF A;  5KHO A;  4M8M A;  1J19 A;  2N9X A;  4FHK A;  4IM3 A;  4CHK A;  3TFM A;  2BCJ A;  3ZNZ B;  4BVU C;  5TR5 A;  1LW3 A;  4HAW B;  3D8E A;  1ACA A;  4YL8 A;  1U5E A;  2MW5 A;  1FGY A;  2LWP A;  3SO6 A;  2N1V A;  2RGF A;  2VRR B;  2BWF A;  2BWE S;  2L0T A;  4PYU A;  1QZE A;  2MP2 B;  2UYZ B;  3CIK A;  2KLG A;  4EOY A;  1UD7 A;  2MCN B;  4ZDV A;  4EZJ A;  2KMC A;  4DDG D;  3SV1 A;  2LRU A;  2LD9 A;  4HAV B;  3PHW B;  1FHO A;  1H8C A;  2XEW A;  1WI0 A;  3WAM A;  1DRO A;  3V62 A;  3FP5 A;  2MRP A;  2H7E A;  5C16 A;  3DVG X;  2VKI A;  2RSG A;  5LXI B;  3TBL D;  2NPT B;  4GDL B;  3ZDT A;  3VIA A;  2MBB B;  3APD A;  4WVF B;  4DXA B;  3ZO5 B;  4YON A;  1MPH A;  2Q13 A;  1WXM A;  1S1Q B;  3PRP B;  4DK5 A;  3DVG Y;  2KDE B;  3CF6 E;  2BYF A;  3SU8 X;  3HIZ A;  3PTF C;  1XD3 B;  3VTW A;  1UBQ A;  1BT0 A;  2DHK A;  1BTN A;  2DLW A;  4NSW A;  2FNJ B;  2KX0 A;  4G3X B;  1V5O A;  2KQ7 A;  3L0W B;  3ZDM C;  2OJR A;  2LBB A;  4B95 A;  2XQN M;  2HJ8 A;  1YX6 B;  4K81 A;  5J2R A;  1X11 A;  2LJ5 A;  2CKH B;  1WRD B;  2CHX A;  5AEK B;  3IVF A;  4CHM A;  4W9K A;  3MTN B;  2COA A;  2JT4 B;  4AP4 C;  3FM8 C;  4W9G A;  2CB8 A;  1NTI A;  2DFK A;  2GS0 A;  1G6J A;  3VDZ A;  5LOP B;  3PV1 A;  2EKE C;  4MY6 A;  4Z2M B;  3ZW3 A;  3UIN B;  2IO0 B;  2KC1 A;  4WJO A;  1P3Q U;  4KHB B;  4EZL A;  3KYD D;  3ZUN A;  4A6K A;  3ZIM A;  1BAK A;  2JUO A;  1V86 A;  1L7Y A;  4GPT B;  5E6P A;  2GJY A;  1DYN A;  1KI1 B;  2R2Q A;  1WE6 A;  5HE2 A;  4JQW C;  2DKP A;  2VRW B;  3SNH A;  1WJU A;  1VCB A;  2EMT A;  4MGZ E;  3HM6 X;  4HCP B;  2IY1 B;  2UZS A;  4CO7 A;  3UQB A;  4KAX B;  3TJP A;  3M1I B;  1B55 A;  4GMV A;  3H7P A;  3NOB A;  4ZRI A;  2FJ9 A;  4G11 A;  2DZM A;  2FCM A;  5HE1 A;  2KWU B;  4A5K A;  4I6L B;  1U29 A;  3HM3 A;  2RPQ A;  2D4Q A;  2WYQ A;  2GBN A;  3TIX A;  2WX1 A;  2Y8G A;  4DX9 0;  3HHM A;  1WYW B;  1I42 A;  4C0A A;  1S3S G;  2KUP A;  5KCV A;  2ZZP B;  4JLC A;  4HAU B;  1FHX A;  5J3Y A;  2RVB B;  5DPR A;  4WJQ A;  1MK9 B;  2OQB A;  1XR0 B;  2BKF A;  1M7E A;  2KCJ A;  1V80 A;  3ALB A;  4FN2 A;  1ZW7 A;  1WXA A;  2R09 A;  2IBI B;  1OQY A;  1CMX B;  5DPT A;  4WAA A;  3PVL A;  5JHG A;  5HE0 A;  2KNB A;  3H9D A;  2N9E B;  2AEH A;  3M63 B;  2KLC A;  3ECI A;  3PSC A;  4NNJ B;  2CQU A;  1WF9 A;  3A4S C;  2G45 B;  5JHA A;  2MBE A;  2J7Q B;  2FIF A;  2K8B A;  2N23 A;  3BJI A;  1WY8 A;  2Y8F A;  2B3A A;  4W9I A;  3D8D A;  4F7U P;  4MT7 A;  1X1F A;  1E7V A;  2CHW A;  3RYT A;  3H7P B;  3OJ3 A;  3MJW A;  2LUL A;  3ZNG C;  3T9L A;  4FJZ A;  1UNR A;  2CY5 A;  2FAZ A;  4B6H A;  2COF A;  2EC1 A;  5LXH A;  1I35 A;  3DCG A;  1U5G A;  1V88 A;  1TJ6 A;  1WMH A;  2DYM A;  3CXB B;  3P6A A;  3W1S C;  4W9C A;  2DYN A;  3GYO A;  1WX9 A;  1P0R A;  4BBN C;  4MSM B;  2KJ6 A;  3ZLZ A;  3HK0 A;  3RZW C;  5C1Z A;  2R0D A;  2GBJ A;  3RT3 B;  4WWN A;  1LM8 B;  3ULC A;  2WDT B;  1U5F A;  4AJW A;  3Q3F A;  2LVP A;  3NZS A;  2H7D A;  3M95 A;  4LDT D;  1WGH A;  1P1A A;  1YX5 B;  1DBH A;  2G4D B;  1V61 A;  4KZ0 A;  1FHW A;  1AWE A;  4ANX A;  2RLO A;  4LDT B;  2KMA A;  4WWO A;  5D3Y A;  4EZK A;  3VUY A; 
#chains in the Genus database with same CATH topology
 3ZRC A;  4P1B C;  4FLH A;  1EGX A;  3X23 A;  2IDY A;  1N62 A;  1WXQ A;  1H10 A;  4HCN B;  3VVW B;  2QKM A;  3A9J A;  4KX6 B;  3V6C B;  4US9 A;  3H1U A;  4EMO A;  4KZC A;  1WG7 A;  3FEH A;  1TTN A;  1P9D U;  5HKH A;  1E5W A;  3HIE A;  1XCQ L;  3VH3 B;  4AS1 A;  2JY6 A;  1QOB A;  3WIM A;  1P6S A;  2VZK B;  3U8Z A;  3V60 A;  1TT5 B;  2FE8 A;  2M8S A;  3M62 B;  1PLS A;  3Q2A C;  4WJP A;  4HPP A;  1MAI A;  2FUH B;  4W9H A;  2LG1 A;  5LLI A;  3R3M A;  2V4L A;  2ZW0 A;  4A6H A;  1W1H A;  2KFJ A;  2Z14 A;  3P4R B;  1WMH B;  2L1C A;  3OLM D;  3ZNI D;  3AH7 A;  3PP2 A;  1KJT A;  4W9D A;  2SAK A;  2C5L C;  1V81 A;  4RM9 A;  4RM8 A;  4MEM A;  1QQG A;  4IAP A;  2GBK A;  1WGD A;  2KZR A;  2IYD B;  4HB2 B;  2R61 A;  2V3P A;  3RUI B;  2YVC A;  2D3C A;  1HEZ E;  4KHA A;  4FJV B;  2LOZ A;  1SB3 C;  3VAW A;  2QC8 A;  1PFD A;  4URK A;  1WWT A;  1D5M C;  5LNK 1;  4KKI A;  4LJO B;  2W2X D;  3L17 A;  1YQ3 B;  3SHQ A;  5HFY A;  3AU4 A;  2CJN A;  1DIK A;  3BK2 A;  1KC7 A;  5EE3 A;  1WZ0 A;  1ZGU B;  2BBC A;  3BZD B;  1IPG A;  3A33 B;  3T06 A;  1GOZ A;  1T3Q A;  3OAW A;  1F0Z A;  4GOU A;  2JSV X;  2OHF A;  3P63 A;  5E6J A;  5I4D A;  2L2I A;  2KIE A;  2K2J A;  2NBV A;  4HRO A;  1LB1 A;  2K3U A;  2LHD A;  2MX2 A;  2I1K A;  4DHJ B;  1PMS A;  3AN1 A;  4EEW A;  2W54 A;  2L00 B;  1OMW A;  2YF0 A;  3QJZ A;  1X1G A;  1RFK A;  3LJU X;  5D3W A;  2FJU B;  1Q1O A;  3CWI A;  1LXD A;  5E6O A;  2YT1 A;  3BVG A;  3I3T B;  1V1O A;  5JVL A;  3PHX B;  3RZF A;  1KLV A;  1FOE A;  3N30 A;  2L0F A;  2A4Z A;  3SUZ A;  1WGQ A;  3ZQ4 A;  4GMX B;  4KDL B;  2OTX A;  2PVG C;  3A9J B;  3OG5 A;  1ISN A;  1X1M A;  2DTC A;  2M56 B;  2CS4 A;  5G5G A;  1I4X A;  4ARC A;  2N7E A;  1KH0 A;  3DBR B;  4HK2 A;  2L8J A;  2GBM A;  1C79 A;  1PQS A;  2LHE A;  4W9J A;  5HHD G;  3JSV A;  4OZA A;  2D2Q A;  2MJE A;  5AZG A;  3ABV B;  4CYE A;  4ANW A;  2KDM A;  5J17 A;  2MDX A;  5JHB A;  2Z0P A;  1GC7 A;  5E6N A;  2RNR B;  2EJ8 A;  4HB3 B;  2ZPY A;  3GYP A;  2DHI A;  1PGB A;  2COC A;  1KZ7 A;  1L6V A;  4HPM B;  3RNA C;  3PO0 A;  3N20 C;  2LXA A;  1Q67 A;  1M7R A;  1T0Y A;  3BWU D;  2Z8L A;  4WIP A;  2D9Y A;  2G4S A;  1YD8 U;  2DYQ A;  5L81 A;  2KD0 A;  1AW7 A;  4HJK A;  5JZE B;  3DWM A;  1JAL A;  5HI1 A;  3R2I A;  4JKB A;  4NY0 A;  2K8H A;  1KZG A;  4GU2 A;  2RUK B;  2X38 A;  1RAX A;  1HA5 A;  4IDI A;  2UZR A;  3PT2 B;  5IJM A;  4JKD A;  2KHW B;  4IW0 A;  1Z87 A;  3PZ8 A;  4PK1 A;  4ZRP A;  2Q5W D;  1YQ4 B;  2HDE A;  2DZI A;  3KWV A;  3PRM B;  4JWU C;  2KQ4 X;  2PVO D;  3EC8 A;  4A3O A;  1H4R A;  2WNM A;  2L7R A;  2DYO A;  2MJD A;  2PLP A;  3LXF A;  5KHQ A;  1W1D A;  1UZX B;  2YS5 A;  2ZVO A;  3MPX A;  3KW5 B;  4BOS C;  4C7Y A;  2NTT A;  2NBV B;  2K1F A;  1BUI C;  1XLN A;  2HTM E;  1MIZ B;  5IAA C;  3EEC A;  2Z13 A;  2V1Y A;  2WDV B;  3C0R B;  2O6V A;  2D9V A;  2ZPN A;  3GE8 C;  2ABD A;  1DOY A;  3EPY A;  2WXR A;  3AEB B;  1J7B A;  2V3N A;  3Q3N C;  4LNO A;  4GZU A;  2DN6 A;  2KDB A;  5GMV A;  1I2H A;  1E7P B;  4M00 A;  1Y19 B;  3WA0 A;  1ESF A;  4D0N B;  2I5F A;  3ODO A;  2R82 A;  2E3T A;  4BKS A;  3ODX A;  1WXV A;  1XT9 B;  5JXV A;  3A8P A;  2OED A;  3EFC A;  3WAO A;  1OGW A;  1RLF A;  1JWA D;  2ZCB A;  3JVZ X;  1GPX A;  4BBN F;  3URY A;  3NS8 A;  4MGK E;  5IA7 A;  1BTK A;  5I2M A;  4A6Q A;  1J7C A;  3JSV B;  4FJY A;  4YTP B;  3D8F A;  1JWM D;  2IND C;  5EE9 A;  1EM7 A;  4HJG E;  1I7A A;  2BS2 B;  3F0W A;  4XX5 A;  3MJ5 A;  1TS2 A;  4IM0 A;  2MA9 B;  3IHP C;  1C3T A;  3UZT A;  4ANV A;  3NVV A;  3AE5 B;  1KF6 B;  2FCN A;  4ACF A;  2QIE B;  1YOV B;  4ZYS A;  2HE7 A;  5C23 A;  5AUK A;  1DYQ A;  2PZ1 A;  4NAM A;  3VXW A;  1N60 A;  1QC6 A;  1XKE A;  3GZN I;  4L1B A;  1DDM A;  5EFX A;  4F1S A;  1D3Z A;  1MK7 B;  1E8Z A;  4DIX A;  2LI5 A;  5C79 A;  3MC9 A;  2WH5 A;  2RDH A;  2WXH A;  1XF5 L;  1HTQ A;  1MPE A;  2C7N B;  2NZ8 B;  1JCK B;  4F7Z A;  4BAX A;  2JP2 A;  2WXF A;  4K1R B;  2J52 A;  1C4C A;  2Y5P A;  4A8X C;  3UF8 A;  4CQN A;  3VQI A;  2E2X A;  2YS3 A;  1TJE A;  1R4N B;  3MDB C;  5HE3 A;  1OTR B;  3PPA A;  2RGN B;  3PG7 A;  3NJT A;  2DYB A;  3CIR B;  1VR9 A;  3MHZ A;  3PSE B;  2O6V B;  1VZ7 A;  4TMA B;  3ZVV A;  2K9X A;  1ET6 A;  1PUT A;  2JRH A;  4MGI E;  3RD2 A;  4ZHO A;  3A98 B;  4MT5 A;  1KRH A;  1KTK A;  3GE3 C;  3N32 A;  1SF0 A;  2K2U A;  1SE3 A;  1EVH A;  3RPF C;  1AYF A;  2D5G A;  2WXI A;  1E9M A;  1XO3 A;  3ZTD A;  3ZJV A;  4F7G A;  4LJP B;  3KY9 A;  3QAQ A;  1QF6 A;  1QIL A;  2KAC A;  4TV3 A;  1WJ1 A;  5LG4 B;  1E7U A;  4HAX B;  2KMM A;  4OZC A;  1FCC C;  4BBK A;  1LO5 D;  2WXQ A;  3O96 A;  1MI1 A;  2DZJ A;  2D9X A;  4F7H A;  2WQY B;  2JX5 A;  2J59 M;  2I2Y A;  3W1S A;  4DWF A;  4A90 A;  4GB9 A;  4N6E B;  2TSS A;  3QA8 A;  3AU5 A;  5D2M B;  1WGY A;  1XOD A;  5J3T A;  3DHI C;  1P98 A;  2N7D A;  5CHV C;  4HAT B;  2L3Z A;  3HUI A;  1ZVR A;  3R2T A;  4BOZ B;  1WM2 A;  2ZVN A;  4QAY A;  2BQQ A;  4FHJ A;  1YJJ A;  2JWU A;  3DCX A;  2CRF A;  3B2F A;  4TQ0 A;  2CU3 A;  4JKF A;  4OT1 A;  2HTH A;  1NEK B;  4TSS A;  5J3Q A;  2I1J A;  1V5T A;  5G5H A;  1GJZ A;  3NZU A;  3PLV A;  2JZP A;  1NEN B;  1ZM0 A;  2INC C;  2M4N A;  3KUC B;  4HHV A;  4IWO A;  4KGR A;  5AUI A;  1ZC4 B;  1TKE A;  2WHI A;  4A3P A;  2NR2 A;  4C00 A;  3SR6 A;  4US8 A;  3FSS A;  4LCD E;  4RGO S;  1V5U A;  2ZNV C;  1V5M A;  3KRX A;  2E6X A;  1WH3 A;  2INP E;  4DQO C;  4F8C B;  4P7I A;  1IRS A;  3LJ3 A;  2A5U A;  1TZ1 A;  1ZKH A;  2WP9 B;  1V89 A;  1MI0 A;  2Y3A A;  1TKY A;  2O2V A;  2KJH B;  3R66 C;  3BIN A;  2L76 A;  1T6B X;  1JRP A;  2LAS A;  1DDW A;  1OEY A;  1JWS D;  2ZW1 A;  2MH7 A;  2JQR B;  5L83 A;  1Y8R C;  3VHT C;  2RSU A;  3U30 A;  3VH4 B;  1ZSQ A;  4PT5 A;  2HRJ A;  3N7C A;  3SEB A;  3H7S A;  4O1N A;  4WAF A;  3UIP B;  2X0S A;  2AYO B;  2MHJ A;  2KXJ A;  3PS6 A;  4WJN A;  2MBO A;  3N1Z C;  4K2O A;  1C77 A;  1L4Z B;  4J6I A;  2YT0 A;  3MP9 A;  1ZE3 D;  3W5U B;  2M14 A;  4PS7 A;  1XQQ A;  5FI0 A;  4HPL B;  1TBE A;  2G35 A;  1FO4 A;  2L05 A;  2WXK A;  4KSL C;  2K6D B;  2NTS A;  4Q2J A;  3ZGZ A;  2YEP F;  2Z4D A;  4WWM A;  4GDK A;  2CHZ A;  2M38 A;  1YN3 A;  1SEB D;  3O65 B;  1NTV A;  2V4I B;  3L10 B;  4XE0 A;  1C76 A;  1XCG A;  3L16 A;  3B08 A;  1RYJ A;  5D3D A;  3D32 A;  1YJI A;  3RMK C;  2ON8 A;  2VSZ A;  4ILJ A;  2W3S A;  1XD4 A;  1QLB B;  3BVM A;  4JKH A;  2Z0E B;  2MFQ A;  2IO1 B;  1RRB A;  4XDD A;  3Q8E A;  2FID A;  4YSX B;  1BML C;  2KTF A;  5D27 A;  5FI1 A;  2HTH B;  4USA A;  1E8W A;  2KKC A;  4ZHP A;  4TKN A;  2LUE A;  4IG7 B;  2M17 A;  1FPY A;  3J9C A;  1FNW A;  2GBR A;  2IGH A;  3PVU A;  1P7F A;  3AE4 B;  4K17 A;  2PPH A;  3U52 E;  1HBK A;  1D5Z C;  2BPS A;  2DAF A;  3AE1 B;  2K25 A;  3AXC A;  1WX7 A;  1FB8 A;  3HRD D;  4PS8 A;  4GN1 A;  3WAN A;  3KVF B;  3I5J C;  2JZZ A;  3N3K B;  3ZTC A;  3SYX A;  2LGD A;  4HB4 B;  3OHM B;  1WE7 A;  2KX3 A;  1KBL A;  2DIK A;  1SGH A;  3DQV A;  3V6E B;  3SFE B;  3AEG B;  2Y7B A;  1DOX A;  2NVU I;  2IJ0 A;  2O2V B;  3BK1 A;  2C7M B;  2W2W A;  3QHT A;  4WQO B;  1XLP A;  4BKT A;  2PJH A;  5J18 A;  4GOC A;  2VZK D;  4CHJ A;  3P2B A;  3PRZ A;  3ZRF A;  2J4X A;  3B1L X;  4PQ0 A;  3P1M A;  4YSY B;  1RJ2 A;  3TUO A;  2QDF A;  2QSD A;  1UWX A;  2K0P A;  2ROV A;  1FCL A;  3ZVR A;  2MQJ A;  2FBW B;  1XX0 A;  4KKJ A;  2QCZ A;  1HB8 A;  2MJ3 A;  2FDQ A;  4A20 A;  4BFR A;  3E9L A;  2DX5 A;  1LQB A;  5DH9 B;  3V3X A;  1NI3 A;  1SSN A;  1JDE A;  4NJ6 A;  1DDV A;  1N5X A;  2MSE D;  5CLL B;  2EKI A;  2RR9 A;  3NS1 A;  2AL6 A;  1UPQ A;  3JW0 X;  2LGX A;  3P4Q B;  2Z0Q A;  3QK0 A;  3RI7 C;  3TVV A;  1EUV B;  3DBL I;  1TKG A;  4D2K A;  3TL5 A;  1EWY C;  4GDK B;  3UIO B;  1TY2 A;  2YSZ A;  4OW0 A;  4XWX A;  4PNK A;  2JVC A;  4A55 A;  2MBH A;  1U27 A;  2L1A A;  1Z5S B;  1UNQ A;  5FR3 A;  1V6E A;  2W55 A;  3PEG A;  1FNU A;  2WGS A;  2DZK A;  3DHG C;  3W1Y A;  3NWD A;  2KC2 A;  3KH0 A;  1E6E B;  3TEX A;  3TEW A;  4HAY B;  2K8C A;  5BYR A;  4NQL B;  2XNA C;  1R7S A;  3SDL C;  3VRB B;  5JP4 A;  2PE6 B;  4MDK E;  4MSQ B;  2P0F A;  1PFJ A;  1WGG A;  3PVW A;  3PGE A;  2QJL A;  3Q6B A;  3Q69 A;  2ZCC A;  3W2D A;  2ZEQ A;  4DHJ D;  4JK9 A;  1WIA A;  2HD5 B;  2EMS A;  2AL3 A;  1UGM A;  2N9K A;  2KIG A;  3DXD A;  3DXC A;  3TCA A;  3T3N A;  1EU4 A;  3A4R A;  2IY0 B;  3APC A;  4II2 B;  2J0K A;  4HAZ B;  1FAO A;  4HDO A;  1FFU A;  3AED B;  4OVZ A;  4ZRJ A;  4QXA B;  1IUE A;  5CX3 A;  1OY2 A;  1K5D B;  3R8B A;  2REX A;  2ROZ B;  2BGF A;  3ML8 A;  2INN E;  2QEJ C;  1V1P A;  3VUX A;  1Z2M A;  5D3I B;  3VOQ A;  1YN5 A;  5D94 A;  3E9S A;  2BB5 A;  3SD5 A;  3VTV A;  4BZA A;  2GOW A;  2W2X C;  1TS5 A;  1WGK A;  1QOG A;  4MGY E;  4ILH A;  4AWJ A;  4P16 A;  3DVN U;  4JKG A;  4KGT A;  4MJS A;  1WX8 A;  4KSK C;  4TQ1 A;  5DHA B;  1UF0 A;  2KFK A;  2DX5 B;  2LZ6 A;  2Z0O A;  3U4E G;  2CR5 A;  1ZPS A;  3A9K A;  5H92 C;  3ZNH B;  4ICV A;  1EF5 A;  4RGT A;  3UGB B;  4TUU A;  2NBU A;  2KYW A;  2FJL A;  4MK0 A;  3A8Q A;  5FR6 A;  1IP9 A;  3GB1 A;  4YWG G;  4JL9 A;  3GZN B;  3K9O B;  1GUA B;  2KVR A;  1OEY J;  2DHZ A;  3R7R A;  2D10 A;  1VZ8 A;  1BWN A;  2LRW A;  1Y56 A;  3ML9 A;  1P7E A;  1KFY B;  4KIK A;  3NHE B;  2V76 A;  3QWZ B;  4DX8 A;  3HVZ A;  5LON B;  5CTR C;  2D9Z A;  4B6W A;  1EF1 A;  3TW1 A;  2FCS A;  4KGS A;  4M0W A;  4JKE A;  3RNB C;  1E8Y A;  5DIF B;  1FXT B;  3MFG A;  4PYZ A;  1GNU A;  3LB8 C;  2LYD A;  1ACC A;  1SIF A;  5C5B A;  4HB0 B;  4WWP A;  5DI9 B;  3EHV A;  1GB4 A;  5D6J B;  1FIQ A;  2DAJ A;  3I9V 1;  3U7Z A;  2M1M A;  3DVN V;  3W5V B;  2DLB A;  1TQZ A;  1X05 A;  3WYF B;  4IWP A;  2DEN B;  1C4A A;  2AX5 A;  3ZKJ C;  2IYB A;  1WSP A;  1WR6 E;  1UEF A;  1AQC A;  1XLQ A;  3B0A A;  3F5R A;  2XK5 A;  3GOE A;  3PRE A;  2RMM A;  4UDU C;  3VFK A;  1IBX A;  1SE9 A;  1K8R B;  2ELA A;  3CST A;  1NU2 A;  1K51 A;  4GIV A;  1T5X D;  4RGN A;  4B9K A;  2ADZ A;  1SE4 A;  4ICU A;  2KDI A;  1F9J A;  1QKZ A;  1E8X A;  1V1P B;  1YJ1 A;  2WDQ B;  1FGZ A;  2ZJD A;  1MG8 A;  4RF1 A;  2DBY A;  4NPN A;  2P0D A;  3E9P A;  2D11 A;  4E74 A;  2WDR B;  2J0M A;  5KQ1 A;  1KLG D;  3FIL A;  4WUR A;  4X57 B;  3H6N A;  4JKG B;  1VBG A;  1QOA A;  4MJS B;  2PIA A;  3PLU A;  2KT7 A;  4MH0 E;  2WS3 B;  1NYR A;  2KFK B;  3ZJU A;  1UGJ A;  5G2N A;  1K52 A;  2M0X A;  3A9K B;  2GUM A;  1K50 A;  4YXD B;  3AE7 B;  1N3H A;  3V61 A;  4N9F 4;  2N1W A;  4YSZ B;  1WGU A;  3FLV A;  3ENB A;  4OVU A;  3E66 A;  3U2S C;  2X18 A;  2K8E A;  4NQK E;  2MBQ A;  1EAZ A;  1V9J A;  2WXJ A;  2N9P C;  4HWI B;  1L0X B;  2LEK A;  1UH6 A;  2KJR A;  1YQB A;  2W3R A;  2PMV A;  1NTY A;  3DHH C;  4KIK B;  5IOI A;  1CZP A;  4Z2N A;  2R2O A;  4K2P A;  3NY5 A;  2OJW A;  4M0W B;  3CMM B;  1TYG B;  1KM7 A;  5DCN A;  3IG3 A;  5KQ4 A;  2MEK A;  1ST7 A;  3DBR I;  2YLM A;  3AM9 A;  2N0Y A;  2IZV B;  1P5T A;  5C5B B;  2KK8 A;  3AE8 B;  4G50 A;  1N5W A;  4II3 B;  2IO2 B;  3FKY A;  4EJN A;  4G0N B;  4H8S A;  3AE2 B;  2WU2 B;  3LDZ E;  5CHF A;  3ML4 A;  4MM3 A;  2KTR A;  4XZ4 A;  3P4S B;  5C6R A;  4K7W A;  5MPO A;  2O6V D;  3OJ4 B;  2D3G A;  3ODW A;  1WFY A;  4DDI D;  3WAP A;  2LXC A;  2Y5B B;  4DXG A;  5JH5 C;  4LNI A;  2XK5 B;  1I4R A;  2JXX A;  1YIW A;  2DNF A;  4K3B A;  2JRI B;  4XGA B;  3E56 A;  2Z59 A;  1WJ4 A;  1WZ3 A;  3APF A;  2BYT A;  3A1Q A;  3QAR A;  2K6Q A;  1SJE D;  3Q3J A;  1ZC3 B;  5AZF A;  3KRW A;  1E0Z A;  4YTN B;  1WVH A;  1RWS A;  2WWZ A;  4EE2 A;  2LOX A;  1F52 A;  2N4F A;  4BKS D;  1ZXI A;  1VJK A;  1WI1 A;  3G9W A;  1EU3 A;  3RNG C;  4EKU A;  2G3Q B;  2DWQ A;  1F1H A;  1UNS A;  3BYY B;  4IC7 B;  2I5C A;  1VD2 A;  1NI2 A;  3FIL B;  3RNE C;  2CU1 A;  2C60 A;  2KWC A;  4EFO A;  3RCP A;  4HVB A;  1AN8 A;  5CHW A;  1Q10 A;  4RMA A;  4KHO A;  4NAW A;  2LVO A;  2K49 A;  1U2B A;  1U4A A;  2V3S A;  4KVG B;  4KV2 A;  3QBV B;  3RUL A;  2LUM A;  1CK1 A;  2VH2 A;  2CY4 A;  1F2R I;  4I6P A;  2ASQ A;  3Q3M C;  2MKR A;  2DX1 A;  3DBS A;  4HDQ A;  4HSI A;  5H8Y E;  1HB6 A;  4L6E A;  4YT0 B;  3RCZ A;  4JE3 B;  2GRI A;  3ONS A;  1R4M I;  4W9L A;  3QC8 B;  5BYQ A;  1AAR A;  1TS3 A;  2BS4 B;  2LGY A;  2YRY A;  1OQN A;  1M94 A;  4JWS C;  3VUW A;  3DPD A;  1SJH D;  1FM0 D;  1OQR A;  3KWL A;  2WX0 A;  4QJ5 B;  1L2N A;  4IOY X;  2YS1 A;  4A6F A;  5BO4 B;  1A5R A;  2SEB D;  2WXM A;  1Q5W B;  4JIO U;  4EUT A;  2NBW B;  5L95 C;  3QIJ A;  3CSF A;  2GCL A;  4FBJ B;  3H8H A;  3X0W A;  4FXC A;  2PEA A;  3KUZ A;  4M8N A;  1YN4 A;  1UUP A;  5C2T B;  2ZNV B;  4MM3 B;  2KTR B;  4P6V F;  2V0G A;  1Q0W B;  1LFD A;  4TYZ A;  1FRR A;  2L52 A;  1UBI A;  3BVZ A;  5D7G A;  4L2Y A;  1T0R C;  1MKE A;  2RQ1 A;  4IFS A;  1UNP A;  1ZOY B;  1EO6 A;  1ROE A;  2CAY A;  5GOW B;  3RNC C;  4LNK A;  2K22 A;  4W9E A;  2BYV E;  4OHJ A;  3OWE B;  4FAD A;  4K7U A;  4L1R A;  1V8C A;  2G1E A;  2NMB A;  3K9P B;  2Z59 B;  1I4Q A;  3ENE A;  1XEE A;  5EDS A;  3A1Q B;  2K39 A;  3L08 A;  2ZKM X;  2KN5 A;  3QX1 A;  4WJ7 A;  3KSY A;  2KOX A;  1U5D A;  4XDC A;  1UEL A;  2BYE A;  4GSW A;  4K7S A;  2WU5 B;  3EFU A;  4LK0 M;  1WGR A;  3L13 A;  4M02 A;  3BY4 B;  3SBT A;  1NBF C;  4ASW C;  1K5G B;  1C78 A;  1VLB A;  2RD0 A;  3U12 A;  3DXE A;  1GC6 A;  2YT2 A;  3DDC B;  1GGO A;  4ZRK A;  3S2A A;  2HJ1 A;  2VH1 A;  1GG3 A;  3FC4 A;  3AEC B;  1J0W A;  2QHO A;  4NAW B;  5D3X A;  2FUG 1;  1SXT A;  4IM2 A;  2JPH A;  1FNV A;  3RNF C;  1E90 A;  1HE8 A;  3VRA B;  1R4N I;  2UU7 A;  5JLJ B;  2D3A A;  3PZD A;  4GXB A;  1AWD A;  1MIX A;  4OVV A;  4E3C A;  3EUB 2;  2J53 A;  1BXT A;  4XC2 A;  5BYS A;  5EE1 A;  2JZ3 B;  1FXI A;  3IBE A;  4NJC A;  4JKA A;  5BMH A;  2QKL A;  2IFS A;  2DKQ A;  4W9F A;  1STE A;  2D07 B;  1SHC A;  1D5X C;  1V49 A;  1A70 A;  1NDD A;  2ONQ A;  3NUH B;  4A6F B;  4AUQ C;  1YNT E;  1XCT L;  3ULB A;  1HZ6 A;  1WJM A;  3N1Y C;  4LNF A;  4AOF A;  3BYT B;  2Z0D B;  1V2Y A;  2C7H A;  2I38 A;  2FCQ A;  4FA6 A;  2V9H A;  3JYU A;  2W9N A;  5TSS A;  4XWT A;  1CQV A;  2NCN A;  2P0H A;  3R7Q A;  3AUL A;  3AE9 B;  2XBB C;  2DHJ A;  2KO3 A;  3HQC A;  1ENF A;  3W9C B;  2ICI A;  3GP7 A;  1WJ6 A;  2GMI C;  2IO3 B;  1UPR A;  3LYY A;  3VR8 B;  2JF5 A;  3OAN A;  4QJ3 B;  3E9O A;  2KWD A;  1J7A A;  2KDF B;  1JML A;  3WCQ A;  5G55 A;  3NVY A;  4AQ7 A;  4ZYN A;  1GB1 A;  3TO1 A;  1K53 A;  4DBG A;  2GCJ A;  2JWZ A;  4IOI E;  2XN9 C;  3FAH A;  3MHS D;  1X86 A;  1FEH A;  2J0J A;  1RM6 C;  5BMG A;  4DXF A;  2MLB A;  4WSF A;  2BTE A;  1TGZ B;  2LVQ A;  2H88 B;  2Y5C A;  1L6U A;  1TY0 A;  1C1Y B;  4I6N B;  1WJN A;  4FUL A;  3RN9 C;  2PE9 A;  1I4H A;  4KDI C;  2WXG A;  1JRU A;  2P8V A;  4AJY B;  1OQQ A;  3IFW B;  3M3J A;  2NS5 A;  3VTU A;  2C9W B;  3KYC D;  5GXG B;  4YTM B;  1L5P A;  3WAL A;  2BB6 A;  2N9L A;  3TMP B;  5D3V A;  2WLB A;  3C8Y A;  1J0G A;  2RDG A;  3NSU A;  4JGH B;  1RRP B;  3P7Z A;  3QCA A;  2KQS A;  2LKO A;  1VZ6 A;  1WYG A;  2KGX B;  1I7H A;  3AI5 A;  2NMQ A;  2COP A;  1QT9 A;  2JU6 X;  3AE3 B;  3AJ4 A;  3GS2 A;  3QQ8 B;  3DOW A;  2AWT A;  2MP2 A;  4IUM B;  1FFV A;  1J8C A;  3DBH I;  1W1G A;  1F77 A;  2BF8 B;  4NJ7 A;  4C4V A;  5JHH A;  2D9W A;  1WR1 A;  2KWV B;  2COD A;  5DPW A;  2ELB A;  1VDV A;  5AZH A;  1RFA A;  4HLE A;  3EA6 A;  4HKZ E;  3MC0 B;  3KZ1 A;  1D6E C;  4LLG M;  2KAN A;  2MWN B;  1FXA A;  1ZDV A;  2B76 B;  3T3O A;  4LNN A;  3KLS X;  1CJE A;  5DPS A;  1NYQ A;  3KUD B;  1NVI D;  4GGQ A;  1V97 A;  2BKR B;  1P3R A;  3QWM A;  1B1Z A;  3B9J A;  1YMH E;  2K00 A;  1KOT A;  2BW2 A;  1WXS A;  5T8I A;  2JXT A;  3KQ4 A;  4OZB A;  1FMA D;  4RH6 A;  3T8M A;  4DBB A;  2QIL A;  2NPT A;  4HEA 1;  4REZ A;  1WM3 A;  4GDL A;  2DA0 A;  4PS3 A;  2N7J A;  1Y5O A;  3IAS 1;  4MEL A;  4JK8 A;  3HSA A;  1N6Z A;  4JKC A;  3UQA A;  3L54 A;  3I63 C;  2OOB B;  3V5W A;  5DHF B;  4Y94 A;  4IWQ A;  2UWQ A;  1V5P A;  4HXD A;  4ANU A;  3U7D A;  1NVL A;  2MWS B;  1PGX A;  1QOF A;  2UVM A;  2J42 A;  3NG0 A;  4DHZ E;  1PDX A;  4BKG A;  2G9H D;  3HW2 B;  4B0E A;  1HXY D;  3I57 A;  4DHZ B;  5CLQ B;  4E71 A;  1TXD A;  1HZ5 A;  5HG2 A;  4RCO A;  1IYF A;  3MC8 A;  5KHO A;  4M8M A;  1J19 A;  2N9X A;  3NVZ A;  4FHK A;  1IGD A;  1I4G A;  4IM3 A;  4RF0 A;  1E10 A;  4CHK A;  3TFM A;  2BCJ A;  4N59 A;  3ZNZ B;  4BVU C;  5TR5 A;  3ZYY X;  1C9F A;  1LW3 A;  4HAW B;  4J3O D;  5I2S A;  3D8E A;  3Q8C A;  1ACA A;  4YL8 A;  1U5E A;  4H2A A;  2MW5 A;  2BVC A;  2D3B A;  1FGY A;  2LWP A;  3SO6 A;  2N1V A;  2RGF A;  2VRR B;  2BWF A;  2BWE S;  2L0T A;  4PYU A;  1XXG A;  4B0M A;  1QZE A;  2MP2 B;  2UYZ B;  3CIK A;  2KLG A;  1JW9 D;  4EOY A;  4HRS A;  2QMT A;  3AEA B;  1UD7 A;  3TSS A;  4C4V B;  2MCN B;  4C56 C;  4JPS A;  4ZDV A;  4EZJ A;  2KMC A;  2YEP B;  4DDG D;  3SV1 A;  2LRU A;  1MFW A;  4RFB A;  2LD9 A;  4HAV B;  4JK7 A;  1SE2 A;  3AEE B;  3PHW B;  1FHO A;  1H8C A;  2XEW A;  2WXP A;  1WI0 A;  2PKO A;  3NWF A;  3WAM A;  1DRO A;  3V62 A;  3FP5 A;  5FK9 C;  2MRP A;  2H7E A;  5C16 A;  3DVG X;  3V05 A;  3L4P A;  3AB5 A;  4ITK A;  2VKI A;  2RSG A;  5LXI B;  3ZXV A;  3TBL D;  2NPT B;  4KHB A;  2AQ1 B;  4GDL B;  3ZDT A;  3VIA A;  2MBB B;  3APD A;  4WVF B;  4DXA B;  4R3D A;  3ZO5 B;  4YON A;  1MPH A;  2Q13 A;  3IT6 B;  1MHX A;  4ZRQ A;  1WXM A;  4JX1 C;  1S1Q B;  1PGA A;  3IAM 1;  3PRP B;  4IKG A;  4DK5 A;  3DVG Y;  2KDE B;  3CF6 E;  2BYF A;  3Q3O C;  4HKQ A;  5M4Y B;  2GLS A;  3BII D;  3SU8 X;  3NZ3 A;  3AE6 B;  3HIZ A;  3PTF C;  1XD3 B;  3VTW A;  1UBQ A;  1BT0 A;  2DHK A;  4XYC A;  3IT4 B;  1BTN A;  2IGD A;  2DLW A;  1F2R C;  1N61 A;  4NSW A;  3FVC A;  1R4M B;  2FNJ B;  2KX0 A;  3N9Y C;  4G3X B;  1V5O A;  2KQ7 A;  3Q8F A;  3NRZ A;  3L0W B;  3PZ7 A;  1L4D B;  3ZDM C;  2OJR A;  2LBB A;  4B95 A;  2XQN M;  1L0Y B;  2HJ8 A;  3AV8 A;  1YX6 B;  4K81 A;  5J2R A;  1X11 A;  2LJ5 A;  2CKH B;  1WRD B;  2KAJ A;  2CHX A;  2LFI A;  5AEK B;  3ZXR A;  3IVF A;  4CHM A;  4W9K A;  3B2G A;  3MTN B;  2COA A;  2JT4 B;  4AP4 C;  3FM8 C;  1EWC A;  4W9G A;  2CB8 A;  1KLU D;  3SBG A;  1ZDX A;  1MG4 A;  1JRO A;  1NTI A;  2DFK A;  2GS0 A;  4NZL B;  1G6J A;  3VDZ A;  1MHH E;  1WRI A;  1SBB B;  4A9A A;  5LOP B;  3PV1 A;  3IXS A;  2EKE C;  4MY6 A;  4Z2M B;  3ZW3 A;  3SFD B;  3EGR A;  3UIN B;  2IO0 B;  2KC1 A;  1B9R A;  4WJO A;  1P3Q U;  3TEZ A;  3N1X C;  4KHB B;  4EZL A;  3KYD D;  3ZUN A;  4QJ4 B;  1MVK A;  4A6K A;  3ZIM A;  2AQ3 B;  3Q8B A;  1BAK A;  2JUO A;  1V86 A;  5EE0 A;  1L7Y A;  1IBX B;  4GPT B;  5E6P A;  2GJY A;  1ZUD 2;  1DYN A;  1KI1 B;  1T0Q C;  2R2Q A;  1WE6 A;  5HE2 A;  3Q8A A;  4JQW C;  2DKP A;  2RPV A;  2VRW B;  3SNH A;  1WJU A;  3ZJT A;  1VCB A;  2EMT A;  3AMZ A;  4MGZ E;  3HM6 X;  4HCP B;  2WXO A;  2IY1 B;  2UZS A;  3DWG C;  4CO7 A;  4N58 A;  3UQB A;  4KAX B;  3C19 A;  3M1I B;  3TJP A;  1B55 A;  4GMV A;  4S17 A;  4RGM A;  1IGC A;  4GLS C;  2GB1 A;  1HQR D;  3H7P A;  3NOB A;  4ZRI A;  2KUQ A;  2EEL A;  1XLO A;  2FJ9 A;  4G11 A;  2DZM A;  2JYT A;  1TS4 A;  2FCM A;  5HE1 A;  2PTL A;  2KWU B;  4A5K A;  4I6L B;  1U29 A;  3O13 A;  3HM3 A;  2RPQ A;  2D4Q A;  2RDB C;  2WYQ A;  4ZOH C;  2GBN A;  3P4P B;  3TIX A;  2WX1 A;  2IPK D;  2Y8G A;  4DX9 0;  3NWA A;  2PW9 A;  3HHM A;  4WQM A;  3A58 A;  1DOI A;  1WYW B;  1I42 A;  2KN4 A;  4C0A A;  1OFF A;  1S3S G;  1TZO A;  4S0R A;  2KUP A;  5KCV A;  2ZZP B;  5IN7 A;  2KR0 A;  4JLC A;  4M01 A;  1JWB D;  4HAU B;  1FHX A;  5J3Y A;  3VR9 B;  2RVB B;  2X8X X;  4WH4 A;  4ARI A;  5DPR A;  4WJQ A;  1MK9 B;  2OQB A;  1XR0 B;  2BKF A;  1M7E A;  2KCJ A;  1V80 A;  1ZYI A;  3ALB A;  4FN2 A;  1ZW7 A;  2WXL A;  1LGR A;  1QQR A;  1WXA A;  2W82 A;  2R09 A;  2IBI B;  3TEY A;  1OQY A;  1CMX B;  1MJD A;  1FRD A;  5DPT A;  4WAA A;  3PVL A;  5JHG A;  5HE0 A;  2KNB A;  3H9D A;  2N9E B;  2AEH A;  1DGJ A;  3M63 B;  1D4B A;  2KLC A;  3ECI A;  3PSC A;  3HVD A;  1I4P A;  2WXN A;  4NNJ B;  2LGI A;  1T77 A;  2CQU A;  1GAQ B;  4XWW A;  3NVW A;  1WF9 A;  3A4S C;  3DBL B;  2G45 B;  1ET9 A;  5JHA A;  2MBE A;  2J7Q B;  1ZXH A;  2FIF A;  5IKC M;  2K8B A;  2N23 A;  3BJI A;  1WY8 A;  2Y8F A;  2BT6 A;  2B3A A;  4W9I A;  1FD6 A;  3D8D A;  4OSN A;  4F7U P;  4MT7 A;  1X1F A;  1E7V A;  3DBH B;  2CHW A;  3Q14 C;  4L23 A;  2LGS A;  3NW8 A;  3RYT A;  5IO9 A;  3H7P B;  3OJ3 A;  2H89 B;  2M0A A;  4C7Z A;  1PYW D;  3MJW A;  2LUL A;  3ZNG C;  3T9L A;  4FJZ A;  5BMI A;  1UNR A;  2CY5 A;  1C4P A;  2M19 A;  2FAZ A;  4B6H A;  5C3J B;  2COF A;  2EC1 A;  5LXH A;  1I35 A;  2ACZ B;  4C80 A;  2L83 A;  2L32 A;  1VBH A;  3DCG A;  1U5G A;  1UWM A;  1V88 A;  3P42 A;  1T0S C;  1JWU D;  4K3C A;  1TJ6 A;  1WMH A;  1JQ4 A;  2DYM A;  3CXB B;  3P6A A;  2LMC A;  2GI9 A;  3AEF B;  3B77 A;  1HTO A;  2RRF A;  2KVZ A;  3W1S C;  4W9C A;  3RFZ B;  2JYE A;  2DYN A;  3GYO A;  2LJI A;  1ZP0 B;  1WX9 A;  1P0R A;  4BBN C;  4MSM B;  2KJ6 A;  1SIJ A;  3ZLZ A;  3HK0 A;  4D6W A;  1L0V B;  4CSQ A;  3RZW C;  5FKA C;  5C1Z A;  2R0D A;  2GBJ A;  3RT3 B;  4WWN A;  1LM8 B;  2CJO A;  3ULC A;  2BS3 B;  2WDT B;  4RNA A;  1U5F A;  4AJW A;  1N63 A;  5IP4 D;  2R2Y A;  4GNK B;  3Q3F A;  4MAC A;  4P1C C;  2LVP A;  3NZS A;  2H7D A;  3UI3 A;  3M95 A;  4LDT D;  3ETR A;  1WGH A;  2AQ2 B;  2K5P A;  1TIF A;  1M4V A;  1P1A A;  1YX5 B;  1DBH A;  2G4D B;  4LTU A;  1V61 A;  2N0S B;  4KZ0 A;  2IGG A;  1FHW A;  1AWE A;  4ANX A;  2RLO A;  4ILG B;  4LDT B;  4MH8 A;  1VRA B;  2KMA A;  4WWO A;  5D3Y A;  4EZK A;  5IRS A;  3VUY A; 
#chains in the Genus database with same CATH homology
 3ZRC A;  4FLH A;  1EGX A;  3X23 A;  1H10 A;  4HCN B;  3VVW B;  2QKM A;  3A9J A;  3V6C B;  3H1U A;  4EMO A;  4KZC A;  1WG7 A;  3FEH A;  1TTN A;  1P9D U;  5HKH A;  1E5W A;  3VH3 B;  2JY6 A;  3WIM A;  1P6S A;  3U8Z A;  3V60 A;  2M8S A;  3M62 B;  4WJP A;  1PLS A;  1MAI A;  2FUH B;  4W9H A;  2LG1 A;  5LLI A;  3R3M A;  2V4L A;  4A6H A;  1W1H A;  2KFJ A;  1WMH B;  2L1C A;  3OLM D;  3ZNI D;  3PP2 A;  1KJT A;  4W9D A;  2C5L C;  1V81 A;  4RM9 A;  4RM8 A;  4MEM A;  1QQG A;  4IAP A;  2GBK A;  1WGD A;  2KZR A;  2IYD B;  4HB2 B;  3RUI B;  2YVC A;  4KHA A;  4FJV B;  2LOZ A;  3VAW A;  4URK A;  4LJO B;  2W2X D;  3L17 A;  3SHQ A;  3AU4 A;  1DIK A;  1KC7 A;  1WZ0 A;  1ZGU B;  1IPG A;  3A33 B;  3T06 A;  3OAW A;  2L2I A;  2K2J A;  1LB1 A;  2MX2 A;  2I1K A;  4DHJ B;  1PMS A;  4EEW A;  2L00 B;  1OMW A;  2YF0 A;  3QJZ A;  1X1G A;  3LJU X;  5D3W A;  1Q1O A;  1LXD A;  5E6O A;  2YT1 A;  3I3T B;  5JVL A;  3PHX B;  3RZF A;  1KLV A;  1FOE A;  3N30 A;  2L0F A;  2A4Z A;  3SUZ A;  1WGQ A;  4GMX B;  4KDL B;  2OTX A;  3A9J B;  1ISN A;  1X1M A;  2DTC A;  2CS4 A;  2N7E A;  4HK2 A;  2L8J A;  2GBM A;  1PQS A;  4W9J A;  3JSV A;  2D2Q A;  5AZG A;  4CYE A;  4ANW A;  5J17 A;  2MDX A;  5JHB A;  2Z0P A;  1GC7 A;  5E6N A;  2RNR B;  2EJ8 A;  4HB3 B;  2ZPY A;  3GYP A;  2DHI A;  2COC A;  1KZ7 A;  4HPM B;  2LXA A;  1Q67 A;  1M7R A;  1T0Y A;  2D9Y A;  2G4S A;  1YD8 U;  2DYQ A;  5L81 A;  2KD0 A;  4HJK A;  5JZE B;  4JKB A;  4NY0 A;  2K8H A;  1KZG A;  4GU2 A;  2RUK B;  1RAX A;  2UZR A;  3PT2 B;  5IJM A;  4JKD A;  2KHW B;  4IW0 A;  1Z87 A;  2DZI A;  3PRM B;  4A3O A;  3EC8 A;  1H4R A;  2L7R A;  2DYO A;  5KHQ A;  1W1D A;  1UZX B;  2YS5 A;  2ZVO A;  3MPX A;  3KW5 B;  4BOS C;  2NBV B;  2K1F A;  1MIZ B;  5IAA C;  3EEC A;  2V1Y A;  3C0R B;  2O6V A;  2D9V A;  2ZPN A;  2ABD A;  3EPY A;  4GZU A;  2DN6 A;  2KDB A;  5GMV A;  1I2H A;  1Y19 B;  3WA0 A;  4D0N B;  2I5F A;  3ODO A;  2R82 A;  4BKS A;  3ODX A;  1WXV A;  1XT9 B;  3A8P A;  3WAO A;  1OGW A;  1RLF A;  3JVZ X;  2ZCB A;  4BBN F;  3NS8 A;  4MGK E;  5IA7 A;  1BTK A;  3JSV B;  4FJY A;  3D8F A;  1I7A A;  3F0W A;  4XX5 A;  4IM0 A;  2MA9 B;  3IHP C;  1C3T A;  3UZT A;  4ANV A;  2FCN A;  2HE7 A;  5C23 A;  2PZ1 A;  3VXW A;  1QC6 A;  1XKE A;  3GZN I;  1DDM A;  5EFX A;  4F1S A;  1D3Z A;  1MK7 B;  1E8Z A;  2LI5 A;  5C79 A;  2WH5 A;  2C7N B;  2NZ8 B;  4F7Z A;  2JP2 A;  4K1R B;  3UF8 A;  3VQI A;  2E2X A;  2YS3 A;  3MDB C;  5HE3 A;  1OTR B;  3PPA A;  2RGN B;  3PSE B;  3PG7 A;  2DYB A;  2O6V B;  3ZVV A;  2JRH A;  4MGI E;  3RD2 A;  3A98 B;  3N32 A;  2K2U A;  1EVH A;  3ZTD A;  4F7G A;  4LJP B;  3KY9 A;  3QAQ A;  4TV3 A;  1WJ1 A;  1E7U A;  4HAX B;  4BBK A;  3O96 A;  2DZJ A;  2D9X A;  4F7H A;  2J59 M;  3W1S A;  4DWF A;  4GB9 A;  3QA8 A;  3AU5 A;  5D2M B;  1WGY A;  1XOD A;  5J3T A;  1P98 A;  2N7D A;  5CHV C;  4HAT B;  2L3Z A;  1ZVR A;  4BOZ B;  1WM2 A;  2ZVN A;  4FHJ A;  2CRF A;  4TQ0 A;  4JKF A;  2HTH A;  5J3Q A;  2I1J A;  1V5T A;  1GJZ A;  3NZU A;  3PLV A;  1ZM0 A;  2M4N A;  3KUC B;  4HHV A;  4IWO A;  1ZC4 B;  4A3P A;  2NR2 A;  3FSS A;  4LCD E;  1V5U A;  2ZNV C;  1V5M A;  3KRX A;  1WH3 A;  4F8C B;  4P7I A;  1IRS A;  3LJ3 A;  2A5U A;  1TZ1 A;  1ZKH A;  1V89 A;  2O2V A;  3R66 C;  2KJH B;  3BIN A;  2L76 A;  2LAS A;  1DDW A;  1OEY A;  5L83 A;  1Y8R C;  3VHT C;  2RSU A;  3U30 A;  3VH4 B;  1ZSQ A;  2HRJ A;  3N7C A;  3H7S A;  3UIP B;  2X0S A;  2AYO B;  2KXJ A;  3PS6 A;  4WJN A;  2MBO A;  4K2O A;  4J6I A;  2YT0 A;  2M14 A;  4PS7 A;  1XQQ A;  5FI0 A;  4HPL B;  1TBE A;  2G35 A;  2L05 A;  4KSL C;  2K6D B;  4GDK A;  2CHZ A;  2M38 A;  3O65 B;  1NTV A;  3L10 B;  1XCG A;  3L16 A;  3B08 A;  3D32 A;  2VSZ A;  4ILJ A;  1XD4 A;  4JKH A;  2Z0E B;  2MFQ A;  2IO1 B;  1RRB A;  2FID A;  2KTF A;  5D27 A;  5FI1 A;  2HTH B;  1E8W A;  2KKC A;  4TKN A;  2LUE A;  4IG7 B;  2M17 A;  2GBR A;  3PVU A;  4K17 A;  2PPH A;  1HBK A;  2BPS A;  2DAF A;  2K25 A;  3AXC A;  1WX7 A;  1FB8 A;  4PS8 A;  4GN1 A;  3WAN A;  3KVF B;  3N3K B;  2JZZ A;  3ZTC A;  3SYX A;  2LGD A;  4HB4 B;  1WE7 A;  2KX3 A;  1KBL A;  2DIK A;  1SGH A;  3DQV A;  3V6E B;  2Y7B A;  2NVU I;  2O2V B;  2C7M B;  2W2W A;  3QHT A;  4WQO B;  4BKT A;  2PJH A;  5J18 A;  4GOC A;  4CHJ A;  3P2B A;  3PRZ A;  3ZRF A;  3B1L X;  4PQ0 A;  1RJ2 A;  2ROV A;  3ZVR A;  2MQJ A;  1XX0 A;  1HB8 A;  2FDQ A;  4A20 A;  4BFR A;  3E9L A;  2DX5 A;  1LQB A;  5DH9 B;  4NJ6 A;  1JDE A;  1DDV A;  2MSE D;  5CLL B;  2RR9 A;  2AL6 A;  1UPQ A;  3JW0 X;  2LGX A;  2Z0Q A;  3QK0 A;  3TVV A;  1EUV B;  3DBL I;  3TL5 A;  4GDK B;  3UIO B;  2YSZ A;  4XWX A;  4PNK A;  2JVC A;  2MBH A;  1U27 A;  1Z5S B;  1UNQ A;  1V6E A;  3PEG A;  2DZK A;  3W1Y A;  2KC2 A;  3KH0 A;  4HAY B;  2K8C A;  4NQL B;  3SDL C;  5JP4 A;  2PE6 B;  4MDK E;  4MSQ B;  2P0F A;  1PFJ A;  1WGG A;  3PVW A;  3PGE A;  2ZCC A;  2ZEQ A;  4DHJ D;  4JK9 A;  1WIA A;  2HD5 B;  2EMS A;  2AL3 A;  1UGM A;  3DXD A;  3DXC A;  3TCA A;  3A4R A;  2IY0 B;  3APC A;  4II2 B;  2J0K A;  4HAZ B;  1FAO A;  4HDO A;  4ZRJ A;  5CX3 A;  1OY2 A;  1K5D B;  2REX A;  2ROZ B;  2BGF A;  3ML8 A;  3VUX A;  1Z2M A;  5D94 A;  3VOQ A;  3SD5 A;  3VTV A;  2GOW A;  2W2X C;  4MGY E;  4ILH A;  4AWJ A;  3DVN U;  4JKG A;  4MJS A;  1WX8 A;  4KSK C;  4TQ1 A;  5DHA B;  2KFK A;  2DX5 B;  2LZ6 A;  2Z0O A;  2CR5 A;  3A9K A;  3ZNH B;  4ICV A;  1EF5 A;  3UGB B;  4TUU A;  2NBU A;  2FJL A;  4MK0 A;  3A8Q A;  5FR6 A;  1IP9 A;  4JL9 A;  3K9O B;  1GUA B;  2KVR A;  1OEY J;  2DHZ A;  3R7R A;  2D10 A;  1BWN A;  2LRW A;  3ML9 A;  4KIK A;  3NHE B;  2V76 A;  3QWZ B;  4DX8 A;  5LON B;  5CTR C;  2D9Z A;  4B6W A;  1EF1 A;  3TW1 A;  2FCS A;  4JKE A;  1E8Y A;  5DIF B;  1FXT B;  4PYZ A;  1GNU A;  2LYD A;  1SIF A;  5C5B A;  4HB0 B;  4WWP A;  5DI9 B;  3EHV A;  5D6J B;  2DAJ A;  2M1M A;  3DVN V;  1TQZ A;  1X05 A;  3WYF B;  4IWP A;  2DEN B;  3ZKJ C;  2IYB A;  1WR6 E;  1UEF A;  1AQC A;  3B0A A;  3F5R A;  2XK5 A;  3GOE A;  3PRE A;  3VFK A;  1SE9 A;  1K8R B;  2ELA A;  3CST A;  1NU2 A;  4GIV A;  4B9K A;  2ADZ A;  4ICU A;  2KDI A;  1F9J A;  1E8X A;  1YJ1 A;  1FGZ A;  2ZJD A;  1MG8 A;  4NPN A;  2P0D A;  3E9P A;  2D11 A;  4E74 A;  2J0M A;  5KQ1 A;  4X57 B;  3H6N A;  4JKG B;  1VBG A;  4MJS B;  3PLU A;  4MH0 E;  2KFK B;  5G2N A;  2M0X A;  3A9K B;  1N3H A;  3V61 A;  4N9F 4;  2N1W A;  1WGU A;  3FLV A;  3ENB A;  4OVU A;  3E66 A;  2X18 A;  4NQK E;  2MBQ A;  1EAZ A;  1V9J A;  2N9P C;  4HWI B;  1UH6 A;  2KJR A;  1YQB A;  1NTY A;  4KIK B;  4Z2N A;  2R2O A;  4K2P A;  3NY5 A;  4M0W B;  3CMM B;  1KM7 A;  5DCN A;  3IG3 A;  5KQ4 A;  3DBR I;  1ST7 A;  2YLM A;  2N0Y A;  2IZV B;  1P5T A;  5C5B B;  2KK8 A;  4G50 A;  4II3 B;  2IO2 B;  4EJN A;  4G0N B;  4H8S A;  3LDZ E;  5CHF A;  3ML4 A;  4MM3 A;  2KTR A;  4XZ4 A;  5C6R A;  4K7W A;  2O6V D;  3OJ4 B;  2D3G A;  3ODW A;  1WFY A;  4DDI D;  3WAP A;  2LXC A;  2Y5B B;  5JH5 C;  2XK5 B;  2JXX A;  1YIW A;  2JRI B;  1WZ3 A;  1WJ4 A;  3APF A;  3A1Q A;  3QAR A;  2K6Q A;  3Q3J A;  1ZC3 B;  5AZF A;  3KRW A;  1WVH A;  2WWZ A;  2LOX A;  2N4F A;  4BKS D;  1WI1 A;  3G9W A;  4EKU A;  2G3Q B;  4IC7 B;  2I5C A;  1VD2 A;  1NI2 A;  2CU1 A;  2C60 A;  2KWC A;  4EFO A;  3RCP A;  4HVB A;  5CHW A;  4RMA A;  4KHO A;  4NAW A;  2LVO A;  1U2B A;  1U4A A;  2V3S A;  4KVG B;  4KV2 A;  3QBV B;  3RUL A;  2CY4 A;  4I6P A;  2ASQ A;  2MKR A;  2DX1 A;  3DBS A;  4HDQ A;  1HB6 A;  4L6E A;  3RCZ A;  3ONS A;  1R4M I;  4W9L A;  3QC8 B;  1AAR A;  2LGY A;  2YRY A;  1OQN A;  1M94 A;  3VUW A;  3DPD A;  2WX0 A;  1L2N A;  4IOY X;  2YS1 A;  4A6F A;  5BO4 B;  1A5R A;  1Q5W B;  4JIO U;  4EUT A;  2NBW B;  5L95 C;  3QIJ A;  3CSF A;  2GCL A;  4FBJ B;  3X0W A;  2PEA A;  3KUZ A;  4M8N A;  2ZNV B;  2KTR B;  1Q0W B;  1LFD A;  4TYZ A;  1UBI A;  5D7G A;  1MKE A;  2RQ1 A;  4IFS A;  1UNP A;  1EO6 A;  2CAY A;  5GOW B;  4W9E A;  2BYV E;  4FAD A;  4K7U A;  2NMB A;  3K9P B;  2Z59 B;  5EDS A;  3ENE A;  3A1Q B;  2K39 A;  3L08 A;  2KN5 A;  3QX1 A;  4WJ7 A;  3KSY A;  2KOX A;  1U5D A;  1UEL A;  2BYE A;  4GSW A;  4K7S A;  3EFU A;  1WGR A;  3L13 A;  3BY4 B;  3SBT A;  1NBF C;  4ASW C;  1K5G B;  2RD0 A;  3DXE A;  1GC6 A;  3DDC B;  1GGO A;  4ZRK A;  3S2A A;  1GG3 A;  1J0W A;  2QHO A;  4NAW B;  5D3X A;  4IM2 A;  2JPH A;  1E90 A;  1HE8 A;  1R4N I;  5JLJ B;  3PZD A;  4GXB A;  1MIX A;  4OVV A;  4E3C A;  4XC2 A;  2JZ3 B;  3IBE A;  4JKA A;  2QKL A;  2IFS A;  2DKQ A;  4W9F A;  2D07 B;  1SHC A;  1V49 A;  1NDD A;  4A6F B;  4AUQ C;  3ULB A;  1WJM A;  4AOF A;  2Z0D B;  1V2Y A;  2C7H A;  2FCQ A;  4FA6 A;  3JYU A;  2W9N A;  2NCN A;  2P0H A;  3R7Q A;  3AUL A;  2XBB C;  2DHJ A;  2KO3 A;  3HQC A;  1WJ6 A;  2GMI C;  2IO3 B;  1UPR A;  2JF5 A;  3OAN A;  3E9O A;  2KDF B;  5G55 A;  4ZYN A;  3TO1 A;  4DBG A;  2GCJ A;  2JWZ A;  3MHS D;  1X86 A;  2J0J A;  2MLB A;  4WSF A;  1TGZ B;  2LVQ A;  1C1Y B;  4I6N B;  1WJN A;  4FUL A;  2PE9 A;  4KDI C;  1JRU A;  2P8V A;  4AJY B;  3IFW B;  3M3J A;  2NS5 A;  3VTU A;  2C9W B;  3KYC D;  3WAL A;  3TMP B;  5D3V A;  1J0G A;  3NSU A;  4JGH B;  1RRP B;  3P7Z A;  3QCA A;  2KQS A;  2LKO A;  2KGX B;  3AI5 A;  2COP A;  3AJ4 A;  3QQ8 B;  3DOW A;  2AWT A;  2MP2 A;  4IUM B;  1J8C A;  3DBH I;  1W1G A;  2BF8 B;  4NJ7 A;  5JHH A;  2D9W A;  1WR1 A;  2KWV B;  2COD A;  5DPW A;  2ELB A;  5AZH A;  1RFA A;  4HLE A;  3KZ1 A;  2KAN A;  2MWN B;  5DPS A;  3KUD B;  4GGQ A;  2BKR B;  1P3R A;  3QWM A;  2K00 A;  1KOT A;  1WXS A;  3T8M A;  4DBB A;  2NPT A;  1WM3 A;  4GDL A;  2DA0 A;  4PS3 A;  4MEL A;  1Y5O A;  4JK8 A;  4JKC A;  3UQA A;  3L54 A;  2OOB B;  3V5W A;  5DHF B;  4Y94 A;  4IWQ A;  2UWQ A;  1V5P A;  4HXD A;  4ANU A;  3U7D A;  1NVL A;  2MWS B;  2UVM A;  4DHZ E;  4BKG A;  3HW2 B;  4DHZ B;  5CLQ B;  4E71 A;  1TXD A;  1IYF A;  5KHO A;  4M8M A;  1J19 A;  2N9X A;  4FHK A;  4IM3 A;  4CHK A;  3TFM A;  2BCJ A;  3ZNZ B;  4BVU C;  5TR5 A;  1LW3 A;  4HAW B;  3D8E A;  1ACA A;  4YL8 A;  1U5E A;  2MW5 A;  1FGY A;  2LWP A;  3SO6 A;  2N1V A;  2RGF A;  2VRR B;  2BWF A;  2BWE S;  2L0T A;  4PYU A;  1QZE A;  2MP2 B;  2UYZ B;  3CIK A;  2KLG A;  4EOY A;  1UD7 A;  2MCN B;  4ZDV A;  4EZJ A;  2KMC A;  4DDG D;  3SV1 A;  2LRU A;  2LD9 A;  4HAV B;  4JK7 A;  3PHW B;  1FHO A;  1H8C A;  2XEW A;  1WI0 A;  3WAM A;  1DRO A;  3V62 A;  3FP5 A;  2MRP A;  2H7E A;  5C16 A;  3DVG X;  2VKI A;  2RSG A;  5LXI B;  3TBL D;  2NPT B;  4GDL B;  3ZDT A;  3VIA A;  2MBB B;  3APD A;  4WVF B;  4DXA B;  3ZO5 B;  4YON A;  1MPH A;  2Q13 A;  1WXM A;  1S1Q B;  3PRP B;  4DK5 A;  3DVG Y;  2KDE B;  3CF6 E;  2BYF A;  3SU8 X;  3HIZ A;  3PTF C;  1XD3 B;  3VTW A;  1UBQ A;  1BT0 A;  2DHK A;  1BTN A;  2DLW A;  4NSW A;  2FNJ B;  2KX0 A;  4G3X B;  1V5O A;  2KQ7 A;  3L0W B;  3ZDM C;  2OJR A;  2LBB A;  4B95 A;  2XQN M;  2HJ8 A;  1YX6 B;  4K81 A;  5J2R A;  1X11 A;  2LJ5 A;  2CKH B;  1WRD B;  2CHX A;  5AEK B;  3IVF A;  4CHM A;  4W9K A;  3MTN B;  2COA A;  2JT4 B;  4AP4 C;  3FM8 C;  4W9G A;  2CB8 A;  3SBG A;  1NTI A;  2DFK A;  2GS0 A;  1G6J A;  3VDZ A;  5LOP B;  3PV1 A;  2EKE C;  4MY6 A;  4Z2M B;  3ZW3 A;  3UIN B;  2IO0 B;  2KC1 A;  4WJO A;  1P3Q U;  4KHB B;  4EZL A;  3KYD D;  3ZUN A;  4A6K A;  3ZIM A;  1BAK A;  2JUO A;  1V86 A;  1L7Y A;  4GPT B;  5E6P A;  2GJY A;  1DYN A;  1KI1 B;  2R2Q A;  1WE6 A;  5HE2 A;  4JQW C;  2DKP A;  2VRW B;  3SNH A;  1WJU A;  1VCB A;  2EMT A;  4MGZ E;  3HM6 X;  4HCP B;  2IY1 B;  2UZS A;  4CO7 A;  3UQB A;  4KAX B;  3TJP A;  3M1I B;  1B55 A;  4GMV A;  3H7P A;  3NOB A;  4ZRI A;  2FJ9 A;  4G11 A;  2DZM A;  2FCM A;  5HE1 A;  2KWU B;  4A5K A;  4I6L B;  1U29 A;  3HM3 A;  2RPQ A;  2D4Q A;  2WYQ A;  2GBN A;  3TIX A;  2WX1 A;  2Y8G A;  4DX9 0;  3HHM A;  1WYW B;  1I42 A;  4C0A A;  1S3S G;  2KUP A;  5KCV A;  2ZZP B;  4JLC A;  4HAU B;  1FHX A;  5J3Y A;  2RVB B;  5DPR A;  4WJQ A;  1MK9 B;  2OQB A;  1XR0 B;  2BKF A;  1M7E A;  2KCJ A;  1V80 A;  3ALB A;  4FN2 A;  1ZW7 A;  1WXA A;  2R09 A;  2IBI B;  1OQY A;  1CMX B;  5DPT A;  4WAA A;  3PVL A;  5JHG A;  5HE0 A;  2KNB A;  3H9D A;  2N9E B;  2AEH A;  3M63 B;  2KLC A;  3ECI A;  3PSC A;  4NNJ B;  2CQU A;  1WF9 A;  3A4S C;  2G45 B;  5JHA A;  2MBE A;  2J7Q B;  2FIF A;  2K8B A;  2N23 A;  3BJI A;  1WY8 A;  2Y8F A;  2B3A A;  4W9I A;  3D8D A;  4F7U P;  4MT7 A;  1X1F A;  1E7V A;  2CHW A;  3RYT A;  3H7P B;  3OJ3 A;  3MJW A;  2LUL A;  3ZNG C;  3T9L A;  4FJZ A;  1UNR A;  2CY5 A;  2FAZ A;  4B6H A;  2COF A;  2EC1 A;  5LXH A;  1I35 A;  1VBH A;  3DCG A;  1U5G A;  1V88 A;  1TJ6 A;  1WMH A;  2DYM A;  3CXB B;  3P6A A;  3W1S C;  4W9C A;  2DYN A;  3GYO A;  1WX9 A;  1P0R A;  4BBN C;  4MSM B;  2KJ6 A;  3ZLZ A;  3HK0 A;  3RZW C;  5C1Z A;  2R0D A;  2GBJ A;  3RT3 B;  4WWN A;  1LM8 B;  3ULC A;  2WDT B;  1U5F A;  4AJW A;  3Q3F A;  2LVP A;  3NZS A;  2H7D A;  3M95 A;  4LDT D;  1WGH A;  1P1A A;  1YX5 B;  1DBH A;  2G4D B;  1V61 A;  4KZ0 A;  1FHW A;  1AWE A;  4ANX A;  2RLO A;  4ILG B;  4LDT B;  2KMA A;  4WWO A;  5D3Y A;  4EZK A;  3VUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...