3X23A

Radixin complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
GSMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title MT1-MMP recognition by ERM proteins and its implication in CD44 shedding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell invasion
total genus 88
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3x23A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3x23A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3x23A01
2PZ1A 2V3SA 4MH0E 1V49A 3AJ4A 1ZW7A 2P0DA 2RLOA 5CTRC 3Q3JA 4GDKB 5DH9B 3V5WA 2KNBA 3QWZB 3JW0X 1NVLA 4BBNF 2YLMA 1WX9A 1E90A 4F8CB 2EKEC 3V61A 1NBFC 5J3QA 4FLHA 2KMAA 3ZVVA 1SIFA 2J59M 2GJYA 4HAVB 2C60A 4GDLB 4WWNA 2HJ8A 3X23A 2IZVB 2KO3A 2RUKB 2KJ6A 3MTNB 5JLJB 2CR5A 4HAWB 2KQSA 1E8YA 3PP2A 4CHKA 4JIOU 3W1YA 2K8CA 3CIKA 4ANXA 2R0DA 3Q3FA 3SO6A 2V76A 5CHVC 2FDQA 2BYFA 4IG7B 1NTVA 4EZLA 4DHJD 2KWVB 5J17A 4GDKA 2KANA 1F9JA 1P3QU 2LYDA 2V4LA 4HLEA 3L0WB 3PPAA 2M8SA 4IOYX 2H7DA 2M1MA 4TQ0A 3ONSA 5LLIA 4IM3A 4FULA 5LONB 3PT2B 4MGZE 1QQGA 2M4NA 2LBBA 4BKGA 1J0GA 3FSSA 3VTVA 4G50A 1P6SA 4GDLA 2KX3A 3RULA 5J3YA 3WYFB 2KTFA 2NS5A 3TBLD 3HW2B 1B55A 1WXVA 5CX3A 5KHQA 2YT0A 3WAOA 2EC1A 1EAZA 2CY5A 4HAUB 2N7EA 1EF1A 3TJPA 1V89A 3PRZA 5TR5A 4IWOA 2G3QB 2OOBB 3QWMA 2M17A 5D27A 2QHOA 3QAQA 3F0WA 2MP2A 4I6LB 5KQ1A 1P0RA 2AYOB 4IW0A 4FBJB 1Y19B 4XC2A 2DAFA 3N7CA 3AI5A 1R4NI 2L8JA 2DHZA 3SNHA 2COFA 5JP4A 4E3CA 4K2OA 4WJPA 4BKSD 2K2JA 1WE7A 1N3HA 3IFWB 3OAWA 1FHXA 3R3MA 4JGHB 3DXDA 3NOBA 3S2AA 2CB8A 2D3GA 4DHZE 3PREA 2YS5A 4MJSB 4H8SA 3DBHI 5AZHA 1V5MA 3F5RA 1KI1B 1XKEA 3BJIA 3ZNID 3WA0A 1MKEA 2MQJA 2KC1A 2O2VB 2I1JA 2KMCA 1YJ1A 2PE6B 3V60A 4EMOA 2DAJA 1UPQA 4Y94A 2DENB 4KDLB 3WALA 2LOZA 2ZNVB 1LFDA 2LI5A 1GJZA 5JHGA 3CF6E 2MDXA 3VXWA 1Z5SB 1RJ2A 1RFAA 5D3YA 4TKNA 3I3TB 1HBKA 4HB0B 2CS4A 1V61A 2MWSB 2JZ3B 3DVGY 2MRPA 2KHWB 5FI0A 4KZCA 4W9IA 2GOWA 4BFRA 2D9ZA 1WZ3A 4DDID 2KLGA 2K6QA 1IYFA 2G4SA 2N9EB 2RPQA 1DYNA 1XODA 2IY0B 5JZEB 5LXHA 1WM2A 4MJSA 3U8ZA 1WZ0A 1I35A 5JHBA 1QC6A 4MGIE 2O2VA 3L10B 3OANA 2RSUA 2ADZA 4YONA 4Z2MB 3LJ3A 3PGEA 3KVFB 1P9DU 4K7WA 2NCNA 4A20A 3P7ZA 3ECIA 1U5EA 2MW5A 1E7UA 2L0FA 3U30A 2CAYA 4IWQA 1ZM0A 2YRYA 3ZIMA 4II3B 5JHHA 3EHVA 1V6EA 2P8VA 1DBHA 5D3XA 1Y5OA 5E6OA 3RT3B 2IO1B 1WGGA 3A98B 1UNRA 2Y8FA 2NBWB 1E8ZA 2DLWA 4MSMB 4FJVB 4CO7A 1XX0A 4FHJA 2MBQA 4G0NB 2A5UA 2EJ8A 3H7PB 3A4RA 2COAA 3VH3B 2MCNB 3EFUA 2KQ7A 2N0YA 2K2UA 4I6NB 3L16A 3EPYA 2IBIB 1CMXB 3CMMB 4IM0A 3TCAA 2ZZPB 3JSVB 1GUAB 2KDEB 4GGQA 1WGHA 2D9YA 2A4ZA 4GPTB 4TYZA 2HTHB 2G45B 1RLFA 3KYCD 4NJ6A 4PYZA 2LULA 1K5GB 1U29A 3IHPC 3HM6X 4EKUA 3DVNV 4GSWA 2CQUA 2FCNA 3UF8A 2FJLA 4ZRIA 2KDBA 2IYDB 2R2QA 2MKRA 2Z0OA 3B0AA 5D2MB 2KDFB 1YX6B 4ANWA 3IG3A 1WI0A 3FP5A 3H7PA 3ML8A 5AEKB 3PV1A 2JRIB 1GG3A 3C0RB 3KY9A 2MFQA 4GMVA 2BWFA 2UZSA 2ABDA 3JSVA 5IAAC 4GXBA 3JYUA 2HTHA 4B95A 2ZCBA 1J8CA 1V81A 2I5FA 2CHXA 1TZ1A 1X1GA 2KTRB 2IYBA 3DQVA 2D10A 2ASQA 4AUQC 3R7RA 2GBMA 2ZPNA 4G11A 2N1VA 1L7YA 4A6HA 4B6WA 4E71A 4LDTD 2YSZA 4A3PA 2K25A 2KOXA 3OJ4B 2MWNB 2RGNB 2P0FA 3TL5A 4IUMB 2DYNA 2KDIA 3VUXA 2JVCA 2WX0A 4WJ7A 5DPWA 1C3TA 3T06A 2LRUA 4WVFB 1FXTB 1D3ZA 4C0AA 2DZJA 2LVPA 4MY6A 5DCNA 4KIKB 3EECA 4XWXA 5HE3A 4AWJA 2VRWB 3GOEA 1OY2A 3FM8C 2KTRA 3D8FA 5C6RA 2LUEA 3SDLC 3QARA 2UVMA 3PLVA 4HPLB 3QJZA 2UWQA 3PSEB 4F7GA 3KRXA 2GCJA 2K39A 4WJNA 2C7HA 3A8QA 2GBKA 2K8HA 4W9CA 4AOFA 1IP9A 4ANVA 2GS0A 1WXMA 3PS6A 2MBHA 2LASA 2BYVE 1IRSA 1XCGA 4AP4C 2RNRB 2VRRB 3H1UA 1WJ4A 3L13A 2NZ8B 1XQQA 4RM8A 5BO4B 1H10A 2AL3A 2GBRA 4KIKA 2IO2B 1BWNA 1EF5A 2QKMA 3PHXB 4F7UP 2ZNVC 4K1RB 3VTWA 2L1CA 1MK9B 1WGQA 4XZ4A 4M8MA 5L83A 4HAYB 4KSLC 2I1KA 2R2OA 5J2RA 2OQBA 2DHKA 4P7IA 2N9PC 3H9DA 3HK0A 1WI1A 4I6PA 3PRMB 5FR6A 3RCZA 2K00A 1W1DA 2CODA 3L54A 3UIPB 2UZRA 4BKSA 4LJPB 2KC2A 5GMVA 2EMSA 4MEMA 1NDDA 1M94A 1GC7A 2AL6A 5KHOA 1XT9B 4JLCA 3RYTA 3PSCA 3QCAA 3CSTA 2KGXB 2JZZA 2ELBA 1GNUA 2B3AA 3TVVA 3D8EA 2MBEA 4Z2NA 4WSFA 2FCSA 2L7RA 1I2HA 2D9VA 1ACAA 1YX5B 1WR1A 2C7NB 5LOPB 2COCA 4X57B 4F7HA 2FIFA 2Q13A 2KJRA 2PE9A 3WAMA 4IAPA 1WG7A 1BTKA 3L17A 3APDA 2DX5B 3R66C 1EVHA 1FGYA 1PFJA 1MG8A 1SE9A 4DX8A 4ZRKA 4BBNC 4EOYA 3ZNGC 3HIZA 1WF9A 2FCQA 1EO6A 3L08A 4B9KA 4HDOA 4E74A 1MPHA 2R09A 2CRFA 3P6AA 1TTNA 2I5CA 2RGFA 2D9XA 1V5OA 1ZC4B 3A33B 4KAXB 1SGHA 1OEYJ 2CU1A 4MDKE 2GMIC 2N4FA 4W9DA 1X05A 4EZKA 4BKTA 1NI2A 4LCDE 3SYXA 3KH0A 4GOCA 4K7UA 1K5DB 5DPSA 3VAWA 4G3XB 3DBRI 2LGYA 2KWUB 1FGZA 3QHTA 2DX5A 5DIFB 4HB2B 3MDBC 1YQBA 2BWES 2IO0B 3VUWA 1E5WA 1S1QB 4MM3A 2M38A 3WANA 1EUVB 1WFYA 5C1ZA 3O65B 1YD8U 1UBIA 4WJOA 4HXDA 2UYZB 1DROA 5CLLB 2MX2A 2PEAA 1KJTA 1A5RA 4HAXB 5G2NA 2M14A 5CHWA 1TQZA 3RZWC 2D11A 3ZRCA 2ELAA 4ZYNA 3JVZX 2H7EA 1M7RA 2LXCA 4NJ7A 5FI1A 4TQ1A 2JPHA 3DVGX 4RM9A 3EC8A 4DHZB 4W9JA 2JRHA 2JF5A 1PQSA 2RR9A 2AWTA 2DYQA 3M62B 3ZNHB 3A9KB 4HB3B 3PVWA 4BOZB 2Z0DB 1XD4A 1IPGA 1J19A 4ICUA 4LDTB 2D2QA 2JP2A 4M0WB 1MIZB 3DCGA 1OMWA 3ZTCA 1Y8RC 1WM3A 1P98A 2J0JA 5L95C 3B1LX 3ZO5B 1UGMA 1RRPB 4F1SA 4K2PA 4KHAA 3UIOB 1RAXA 2DZMA 3N32A 3NHEB 3G9WA 1FOEA 4MK0A 1VCBA 2DKQA 1WJ6A 2N1WA 5KCVA 2GBJA 1DDVA 1YIWA 2KZRA 4DBGA 1HB6A 3IVFA 3A8PA 2PPHA 3DXEA 4CYEA 2KVRA 2KD0A 1S3SG 4NY0A 3ML4A 2DA0A 3UINB 4MELA 2J7QB 3A9KA 3QC8B 1OEYA 2G4DB 4LJOB 4HJKA 3SU8X 2DYOA 1K8RB 4A6FB 2COPA 5DHFB 1U5FA 3PVUA 4PS3A 4NQKE 5LXIB 3H7SA 4NPNA 5L81A 2BKFA 3SUZA 4DBBA 5J18A 3QA8A 4FADA 1AWEA 4FJYA 1X86A 3GYOA 2NPTB 4KZ0A 4BVUC 1P3RA 2X18A 1V9JA 2DN6A 3NY5A 3CSFA 2ZVNA 3APCA 2K8BA 1DDWA 1C1YB 3VHTC 3QK0A 1Q5WB 2NVUI 3KUZA 4PNKA 2LRWA 4HCNB 5HKHA 5E6NA 3TMPB 1WIAA 3CXBB 2J0MA 2N23A 2NBVB 1UEFA 4MSQB 2OTXA 4W9GA 1FB8A 5C5BB 1WXAA 1U4AA 4A6FA 3PLUA 3WIMA 2VKIA 1KLVA 4FJZA 4HATB 4ANUA 3ZKJC 4MGYE 4M8NA 1WYWB 4NQLB 1WJNA 4GU2A 3PHWB 2MSED 4MGKE 2JT4B 3PG7A 2L3ZA 2NMBA 2ZJDA 2IFSA 1LQBA 1V5TA 2NPTA 2ZVOA 4B6HA 5CHFA 2D4QA 2WYQA 2C5LC 1LXDA 3M3JA 1SHCA 4YL8A 2GCLA 2YS1A 3DPDA 3UZTA 3ML9A 2MLBA 2FAZA 3OLMD 2Y5BB 2C7MB 4HHVA 1WJ1A 4K7SA 2LZ6A 3ZDTA 3U7DA 3PVLA 4DDGD 5C5BA 1WVHA 1E8XA 1OQYA 3A9JB 2LVQA 1WJMA 3TW1A 3B08A 3M1IB 3KUCB 1I7AA 4K81A 3ZVRA 2FNJB 2GBNA 1M7EA 4DWFA 4KHOA 3K9PB 2O6VD 2BKRB 3SV1A 2M0XA 4KSKC 5IJMA 4PS8A 2XQNM 1G6JA 2NR2A 4W9EA 3MJWA 4A3OA 3DDCB 1V5PA 2LJ5A 3PRPB 5D3WA 4CHMA 5J3TA 3DVNU 3PEGA 3QX1A 2YF0A 1OQNA 1UNQA 1MK7B 1LM8B 2L2IA 2VSZA 1LW3A 4DK5A 3ALBA 2RSGA 2FJ9A 1WMHB 2ZEQA 3N30A 4HWIB 2C9WB 2HD5B 3MHSD 4PQ0A 2BF8B 4KHBB 3GYPA 2ROVA 2Y7BA 3A9JA 2WX1A 4N9F4 4PS7A 1EGXA 4W9LA 2ROZB 1V80A 1V2YA 2KJHB 2NBUA 1H8CA 2RVBB 3AU4A 1HE8A 1UD7A 3BY4B 2MP2B 1NTIA 4URKA 3RCPA 1MIXA 1AQCA 1KZGA 1V88A 1Q1OA 3A4SC 2XBBC 3M95A 4KDIC 1U5DA 1KZ7A 5GOWB 4XX5A 4BBKA 2L00B 1XD3B 3ODOA 2ZCCA 1WMHA 4L6EA 2IY1B 2XEWA 3KSYA 1FHWA 2FIDA 2BYEA 2KFKB 3ODWA 2DYBA 1UNPA 3W1SC 2BPSA 4IM2A 3VIAA 1WGUA 2KXJA 5IA7A 3KZ1A 3NZSA 2KX0A 4NNJB 3ODXA 5HE2A 2W2XD 3M63B 4GIVA 2KN5A 3LDZE 1W1GA 1X1MA 1U2BA 3ZRFA 4W9FA 2DKPA 2QKLA 3ZTDA 4AJWA 2DZKA 1NU2A 2JXXA 4ASWC 3NS8A 2KKCA 2YS3A 1X1FA 1QZEA 3FLVA 4HVBA 4BOSC 2DTCA 3QQ8B 3P2BA 2Y8GA 1KOTA 5DHAB 4TUUA 5DI9B 1BT0A 3ZLZA 2KFKA 3HQCA 3H6NA 2FUHB 3VUYA 2MA9B 1X11A 3QBVB 5EFXA 2L0TA 3GZNI 2LOXA 3ULCA 1UBQA 2Z59B 2D07B 4EFOA 3VOQA 4FHKA 2XK5B 1V5UA 2Z0PA 3DBLI 4WAAA 2CHWA 2Z0QA 3LJUX 2EMTA 1U27A 3AULA 1V86A 2FCMA 2JUOA 3APFA 3T8MA 3VFKA 4CHJA 4FN2A 3IBEA 1BTNA 1TJ6A 5E6PA 3NSUA 3OJ3A 4IFSA 2WH5A 2AEHA 4EEWA 5DPTA 2CY4A 3WAPA 3BINA 3ZW3A 2HE7A 4F7ZA 2LG1A 1KM7A 3ZDMC 5JHAA 2DHIA 2DZIA 4RMAA 4KV2A 4HDQA 3D8DA 1JRUA 1ISNA 1WR6E 2JY6A 1XR0B 3HM3A 2N7DA 4WQOB 3VVWB 2XK5A 2YVCA 4EZJA 1DDMA 5C79A 3UQAA 2D9WA 3AU5A 4II2B 1Z87A 1WX7A 1OTRB 2JWZA 1L2NA 4MT7A 2KK8A 1H4RA 2BCJA 2LWPA 1UZXB 3NZUA 5G55A 3D32A 1WY8A 3T9LA 4A5KA 3KUDB 1Q67A 4EUTA 2WWZA 3V6EB 2LKOA 2YT1A 2CHZA 3UQBA 4DXAB 2Z0EB 2N9XA 2RQ1A 4HAZB 2E2XA 2HRJA 4HB4B 1WGDA 4IWPA 3ZNZB 2PJHA 1ZC3B 3PZDA 1NTYA 2P0HA 2DX1A 2W2XC 3DOWA 1PLSA 1TGZB 5C16A 3W1SA 5KQ4A 3ENEA 4GMXB 3VH4B 1AARA 3DXCA 3UGBB 4JL9A 1UELA 4ZDVA 2G35A 2V1YA 4HK2A 1GC6A 2O6VB 1T0YA 3VDZA 3ULBA 1WH3A 2LGXA 2WDTB 4GZUA 2W2WA 2K6DB 3VQIA 4NSWA 4HPMB 4JQWC 5C23A 2REXA 4WJQA 3ZUNA 2LXAA 1FAOA 2L76A 3A1QB 1P1AA 5AZFA 3TFMA 3V6CB 4TV3A 3FEHA 1UPRA 2LVOA 5DPRA 3RUIB 1UH6A 2DYMA 2K1FA 2IO3B 4DX90 4WWPA 4AJYB 2MBBB 1LB1A 3V62A 3QIJA 1ZVRA 1BAKA 2LD9A 1MAIA 3TO1A 1J0WA 3PTFC 1WX8A 2OJRA 3MPXA 2RD0A 4OVVA 4A6KA 4GN1A 4NAWB 1TXDA 3RD2A 2J0KA 1E8WA 3AXCA 5D7GA 1WE6A 1U5GA 5AZGA 3X0WA 4K17A 1RRBA 1PMSA 5JH5C 2O6VA 2KUPA 4DHJB 4WWOA 1R4MI 4GB9A 3HHMA 2KFJA 4PYUA 1I42A 1WXSA 2LGDA 1TBEA 5D3VA 3SHQA 3K9OB 2BGFA 1ST7A 2KWCA 4OVUA 3RZFA 3A1QA 3R7QA 4ICVA 1OGWA 2MBOA 1WRDB 4D0NB 2ZPYA 3KRWA 5D94A 4J6IA 1WGRA 3N3KB 3KYDD 1Q0WB 3KW5B 4W9KA 5D6JB 3SD5A 1Z2MA 1ZGUB 2DFKA 4W9HA 1WGYA 1W1HA 2KCJA 3TIXA 4FA6A 1WJUA 1P5TA 4EJNA 1VD2A 1ZKHA 2KLCA 1HB8A 4ZRJA 3DBSA 4HCPB 2L05A 3O96A 4NAWA 1FHOA 1E7VA 5CLQB 5HE1A 2DHJA 2CKHB 4IC7B 5HE0A 3VTUA 1ZSQA 5EDSA 2W9NA 4KVGB
chains in the Genus database with same CATH superfamily
2PZ1A 2V3SA 1DOYA 4MH0E 1V49A 1EU4A 3AJ4A 1ZW7A 2P0DA 2RLOA 2H89B 5CTRC 3Q3JA 4GDKB 1L5PA 4JPSA 4WURA 5DH9B 4HKZE 3V5WA 2KNBA 1ACCA 3QWZB 3JW0X 1NVLA 4BBNF 2YLMA 3AE9B 1F52A 2WXFA 1WX9A 1E10A 1E90A 4A90A 2K5PA 2WP9B 4F8CB 4BAXA 4R3DA 2EKEC 3V61A 1TYGB 2BB5A 4WIPA 1NBFC 5J3QA 4XYCA 2AQ2B 4FLHA 1XCTL 2KMAA 3GE3C 3ZVVA 1SIFA 2J59M 4P1BC 2GJYA 2WXLA 4HAVB 2C60A 3NWDA 2K8EA 1PGAA 4GDLB 3AMZA 3R2TA 2EELA 4WWNA 2HJ8A 3X23A 2IZVB 1JWBD 2KO3A 2RUKB 2KJ6A 3MTNB 1XO3A 5JLJB 2CR5A 4HAWB 2KQSA 4TSSA 1E8YA 3PP2A 4CHKA 4JIOU 3W1YA 2K8CA 3CIKA 3KLSX 5AUKA 2R0DA 1TKYA 4MH8A 3Q3FA 3SO6A 4ANXA 5BYSA 5H92C 3TEZA 4B0EA 2V76A 1ZXHA 5CHVC 3W9CB 2BVCA 1MVKA 2FDQA 2BYFA 2SEBD 4IG7B 1NTVA 4EZLA 4DHJD 2KWVB 1XXGA 5J17A 4GDKA 2KANA 1F9JA 3DHGC 1P3QU 1SEBD 1GPXA 4CSQA 3SFEB 3AEFB 2LYDA 1QT9A 4QXAB 2V4LA 4HLEA 3L0WB 3PPAA 2M8SA 4IOYX 2H7DA 2M1MA 4TQ0A 3ONSA 3RNBC 5LLIA 4IM3A 3Q2AC 4FULA 5LONB 2RMMA 3BK2A 3E9SA 3E9PA 3PT2B 4MGZE 2ZKMX 1QQGA 2M4NA 2W82A 2LBBA 4BKGA 4KX6B 1J0GA 1WWTA 3FSSA 2MEKA 2QC8A 2RDHA 3VTVA 1UGJA 4G50A 1XCQL 1P6SA 1DOIA 4GDLA 2KX3A 3RULA 5J3YA 3WYFB 1FPYA 2KTFA 3DWMA 1SE2A 4YXDB 2LUMA 5M4YB 2NS5A 1F77A 1ET6A 1NYQA 3TBLD 4C00A 3HW2B 4WAFA 1B55A 1WXVA 5CX3A 5KHQA 2YT0A 3WAOA 2EC1A 3VRBB 1EAZA 2CY5A 4HAUB 2N7EA 1EF1A 3TJPA 1MFWA 3AE7B 1V89A 1CQVA 3PRZA 5TR5A 4IWOA 4C4VB 2G3QB 2OOBB 3URYA 3QWMA 4LNIA 1C9FA 2M17A 5D27A 2QHOA 3QAQA 2KAJA 2WHIA 3F0WA 2MP2A 3P4SB 4M01A 4I6LB 5KQ1A 1E9MA 1JALA 2K3UA 4ILGB 1P0RA 2AYOB 1GB4A 3AE4B 4IW0A 4FBJB 1Y19B 4XC2A 2OEDA 2DAFA 4C7YA 4JE3B 3UI3A 3N7CA 3NG0A 4ACFA 3Q8EA 1AN8A 3AM9A 1RM6C 3OHMB 1N62A 3OG5A 3AECB 4ZOHC 3AE5B 4DXGA 2DLBA 3AI5A 1R4NI 2L8JA 2DHZA 3SNHA 2COFA 5JP4A 3RNEC 4E3CA 4K2OA 4WJPA 2E6XA 4BKSD 1AWDA 2V3PA 2K2JA 1WE7A 1N3HA 3SBGA 3IFWB 3OAWA 4GNKB 1FO4A 3U7ZA 1FHXA 3R3MA 4JGHB 3DXDA 3NOBA 3S2AA 2CB8A 2D3GA 4DHZE 3RFZB 2RPVA 3PREA 1E0ZA 2YS5A 2JYTA 4MJSB 4C7ZA 4H8SA 3DBHI 3EA6A 5AZHA 3ENBA 1V5MA 2KR0A 3F5RA 2KT7A 4C4VA 4HROA 1KI1B 2DBYA 1IGCA 1L6UA 1XKEA 1MI1A 3BJIA 5TSSA 3WA0A 3ZNID 1MKEA 2MQJA 2KC1A 2KMCA 2I1JA 1YJ1A 2O2VB 2PE6B 4EMOA 3V60A 2IGDA 2L1AA 2DAJA 1UPQA 4Y94A 2DENB 4KDLB 3WALA 2Z4DA 2WXQA 3T3NA 2LOZA 1IUEA 2ZNVB 3DBRB 1HTOA 1LFDA 3Q8BA 2LI5A 4ZRQA 1GJZA 5JHGA 1EU3A 3ZJTA 1L4DB 2MDXA 3CF6E 3VXWA 3ABVB 1Z5SB 1RJ2A 3HSAA 1RFAA 5D3YA 1PDXA 4TKNA 2INPE 3I3TB 1HBKA 4HB0B 2CS4A 1V61A 2MWSB 2JZ3B 3DVGY 2MRPA 2Z14A 2KHWB 5FI0A 4KZCA 4ARIA 4W9IA 5D3IB 2GOWA 4BFRA 2D9ZA 1WZ3A 4DDID 2KLGA 2K6QA 1IYFA 2G4SA 2BS2B 2N9EB 2BS3B 1DYNA 1XODA 2IY0B 2RPQA 2WS3B 5JZEB 5LXHA 1WM2A 2KN4A 3ZJUA 4MJSA 2JU6X 4DXFA 4JKDA 3U8ZA 1WZ0A 1PUTA 4LTUA 1I35A 5JHBA 1IGDA 1J7CA 1QC6A 4MGIE 1TS5A 2O2VA 3L10B 1FFUA 4JKAA 3OANA 3SEBA 2RSUA 1CK1A 2ADZA 4YONA 4Z2MB 3LJ3A 3PGEA 3KVFB 1P9DU 4K7WA 2B76B 4OZAA 2NCNA 4A20A 2YEPB 3P7ZA 3ECIA 1U5EA 2J53A 3NW8A 2Q5WD 2MW5A 1E7UA 2L0FA 5IP4D 1TS4A 3U30A 2CAYA 4IWQA 1ZM0A 2YRYA 3ZIMA 4II3B 5JHHA 2WXNA 3EHVA 1V6EA 2P8VA 2WXGA 1C4PA 3GE8C 1DBHA 5AUIA 5D3XA 1Y5OA 5E6OA 2M0AA 2FJUB 2X8XX 3RN9C 3RT3B 1ESFA 2IO1B 1WGGA 3A98B 1UNRA 1M4VA 2Y8FA 1T0RC 1I7HA 3Q3NC 2NBWB 1E8ZA 1QOBA 2DLWA 4MSMB 4OHJA 4FJVB 4CO7A 1XX0A 4FHJA 2MBQA 4G0NB 2A5UA 4NJCA 2EJ8A 3H7PB 2LGIA 3A4RA 2COAA 3VH3B 1EM7A 2MCNB 3EFUA 3SR6A 2KQ7A 1TJEA 1MPEA 2N0YA 4MT5A 2JQRB 5IO9A 2K2UA 4I6NB 3L16A 2D3AA 3EPYA 2IBIB 1CMXB 3CMMB 3AEBB 4IM0A 3TCAA 2ZZPB 1TIFA 2AQ3B 3JSVB 3EUB2 4TMAB 2HTME 1GUAB 2KDEB 4GGQA 2WXIA 4LK0M 1WGHA 2D9YA 2A4ZA 1VZ7A 4GPTB 4TYZA 2HTHB 2G45B 1D4BA 3N1YC 1RLFA 3KYCD 4NJ6A 4K3CA 4PYZA 2LULA 1K5GB 1KH0A 2PKOA 1J7BA 2PVGC 1U29A 2INCC 4XWTA 3IHPC 3HM6X 3RNGC 1VR9A 4EKUA 3DVNV 4GSWA 2CQUA 2FCNA 3UF8A 3NUHB 2FJLA 4ZRIA 2KDBA 2IYDB 2OHFA 4REZA 2R2QA 2MKRA 2N9KA 2WXMA 1KLUD 2Z0OA 3B0AA 4HEA1 5D2MB 4YSXB 2KDFB 3BWUD 4RH6A 1T0SC 1YX6B 2MJ3A 4ANWA 3IG3A 1WI0A 3FP5A 4XWWA 3H7PA 4KGRA 3ML8A 3DHIC 4S0RA 2QJLA 5AEKB 1ZUD2 3PV1A 2JRIB 4HSIA 5BYQA 1GG3A 3C0RB 1E7PB 3KY9A 4US8A 2MFQA 4GMVA 2BT6A 2BWFA 4Q2JA 4HJGE 1WYGA 2UZSA 5IN7A 1V8CA 4JKCA 2ABDA 3JSVA 4UDUC 3Q3MC 5IAAC 2MJDA 4GXBA 3JYUA 2HTHA 3Q8AA 1VZ6A 4B95A 2ZCBA 3P4RB 1J8CA 3B2FA 1V81A 2I5FA 2CHXA 1TZ1A 4QAYA 3N9YC 1X1GA 2KTRB 2IYBA 3DQVA 2D10A 2ASQA 4AUQC 3R7RA 2GBMA 1XLPA 2ZPNA 4G11A 4AQ7A 2D5GA 2N1VA 2WGSA 1F2RC 1BUIC 1L7YA 4A6HA 4QJ5B 4B6WA 4E71A 1FEHA 4LDTD 1T6BX 2YSZA 5HG2A 3BVGA 1R4MB 3IT6B 2G9HD 4A3PA 2K25A 2KOXA 3NRZA 3OJ4B 2MWNB 2RGNB 2P0FA 3TL5A 4IUMB 2DYNA 4GOUA 2KDIA 3VUXA 2WDQB 2JVCA 2WX0A 4ZYSA 4WJ7A 5DPWA 1DIKA 1C3TA 3T06A 1HQRD 2LRUA 4WVFB 4IKGA 1FXTB 5BMIA 3LYYA 1VBGA 1D3ZA 4C0AA 2DZJA 1UWXA 2LVPA 4P16A 4MY6A 5DCNA 3BYYB 4KIKB 3EECA 2QIEB 4XWXA 5HE3A 1F1HA 4AWJA 2VRWB 3GOEA 2KIEA 1OY2A 3FM8C 1I4RA 4MACA 2KTRA 3D8FA 5C6RA 3TEYA 2LUEA 3SDLC 3QARA 3KWLA 3BVMA 1ZDXA 2D3BA 5H8YE 2UVMA 3PLVA 1FIQA 2BB6A 4HPLB 3QJZA 2UWQA 3PSEB 4F7GA 3RI7C 3KRXA 4S17A 2GCJA 2N9LA 2K39A 4WJNA 2C7HA 3A8QA 2GBKA 3I63C 2INNE 3B9JA 5EE1A 2K8HA 3GB1A 4W9CA 4AOFA 1IP9A 4ANVA 1K53A 5FKAC 2GS0A 1WXMA 2W55A 2GLSA 3U4EG 3PS6A 2WXKA 2LGSA 2L32A 2MBHA 2LASA 1JWSD 2BYVE 1IRSA 1XCGA 5GXGB 2BS4B 2LHDA 2Z13A 4AP4C 2HJ1A 1R7SA 3TSSA 1ZE3D 2RNRB 1NI3A 2VRRB 2J42A 3H1UA 1WJ4A 1MHHE 2ONQA 3L13A 2NZ8B 1XQQA 1ZDVA 4RM8A 3P63A 1NENB 5BO4B 1H10A 3TEWA 2AL3A 2Y5CA 1I4QA 2MJEA 2GBRA 4KIKA 4CQNA 2IO2B 1BWNA 1EF5A 2INDC 3P4PB 3AN1A 2JX5A 2QKMA 3I5JC 4IDIA 1KLGD 4F7UP 3PHXB 2ZNVC 4K1RB 3VTWA 2L1CA 3MFGA 3VR8B 5IRSA 1MK9B 1WGQA 4XZ4A 4M8MA 1PFDA 5L83A 4HAYB 4KSLC 1ZYIA 2I1KA 2R2OA 5J2RA 2OQBA 1TT5B 1C77A 2DHKA 4RFBA 1KC7A 4P7IA 1TZOA 2N9PC 3H9DA 3HK0A 1E6EB 1WI1A 4I6PA 5BMHA 1JW9D 1YQ3B 3PRMB 5FR6A 3RCZA 2K00A 1MJDA 3RNAC 1ROEA 1W1DA 2CODA 2K9XA 3L54A 3UIPB 2UZRA 4BKSA 1JQ4A 4LJPB 3SBTA 2KC2A 2K49A 1C78A 5GMVA 1QF6A 2EMSA 4MEMA 1NDDA 1M94A 2R2YA 3E66A 1GC7A 3NS1A 1V97A 2AL6A 2V4IB 2QSDA 5KHOA 1XT9B 4JLCA 3RYTA 3PSCA 2WNMA 1TKGA 3QCAA 1VJKA 3CSTA 2KGXB 2JZZA 2ELBA 3BZDB 1GNUA 2B3AA 3TVVA 2I38A 3D8EA 2JZPA 2MBEA 2V0GA 4Z2NA 4ZHPA 4WSFA 2FCSA 2L7RA 2ICIA 4OW0A 1I2HA 1TY0A 2D9VA 1ACAA 1YX5B 4GLSC 1QQRA 1WR1A 2C7NB 1J7AA 5BMGA 5LOPB 2COCA 4X57B 4F7HA 2FIFA 2Q13A 2W3SA 1KF6B 2KJRA 2PE9A 3RNCC 3WAMA 4IAPA 1WG7A 1BTKA 3L17A 3APDA 3FVCA 2DX5B 4USAA 3R66C 2L52A 1EVHA 1FGYA 1PFJA 1MG8A 3MC0B 2HDEA 1I4XA 1KBLA 2KDMA 4MM3B 1SE9A 4DX8A 4ZRKA 1VBHA 4BBNC 4C56C 4EOYA 3ZNGC 3HIZA 1WF9A 1QKZA 4PT5A 2FCQA 2VH1A 1EO6A 4FXCA 3L08A 4B9KA 1B1ZA 4HDOA 3BK1A 4E74A 1MPHA 2R09A 2CRFA 3P6AA 1TTNA 2I5CA 4XDDA 2RGFA 4ILHA 2D9XA 3B77A 1V5OA 1ZC4B 3A33B 4KAXB 3BYTB 1SGHA 3Q6BA 1OEYJ 4HPPA 2CU1A 2E3TA 2KWDA 1QOFA 2GMIC 4MDKE 4JK9A 2N4FA 4W9DA 1X05A 4EZKA 4BKTA 1NI2A 3NVYA 4LCDE 3SYXA 3ZGZA 3KH0A 4RGOS 4GOCA 1MG4A 3MHZA 4BZAA 4K7UA 4YTMB 2BYTA 1K5DB 4DQOC 5DPSA 3VAWA 4G3XB 3DBRI 2LGYA 2KWUB 4HRSA 1FCLA 1FMAD 1FGZA 3QHTA 2DX5A 5DIFB 3AB5A 4HB2B 3GZNB 3MDBC 1YQBA 1JCKB 3Q69A 2BWES 2IO0B 3VUWA 1E5WA 1S1QB 2IJ0A 4MM3A 4ZRPA 4NZLB 2M38A 3WANA 1EUVB 1WFYA 1SXTA 3HUIA 2LEKA 5C1ZA 3DBHB 4KKIA 3ZYYX 1YN5A 3DBLB 3O65B 1YD8U 1UBIA 3LB8C 1I4HA 4HXDA 4WJOA 1YJIA 2UYZB 1GOZA 1DROA 3C19A 2X0SA 3ZXVA 1WGKA 3ETRA 5CLLB 2MX2A 2PEAA 1K51A 1KJTA 1SB3C 4EE2A 1A5RA 1DGJA 1ZOYB 1RWSA 4HAXB 5G2NA 2M14A 1TS3A 1VZ8A 3H8HA 5IOIA 2PW9A 5C3JB 1PGBA 3VRAB 5CHWA 1TQZA 2QCZA 3RZWC 2D11A 1GB1A 3ZRCA 1OFFA 2ELAA 1JWMD 4ZYNA 3JVZX 2H7EA 1M7RA 2LXCA 1SSNA 4NJ7A 5FI1A 4TQ1A 2JPHA 1L0XB 3DVGX 5HHDG 4RM9A 2CU3A 3EC8A 2WDVB 4DHZB 4W9JA 2WXRA 5I2MA 4OZBA 2JRHA 2JF5A 3I9V1 1FNWA 1C79A 1N63A 1PQSA 2RR9A 1TS2A 1P7FA 1NVID 2AWTA 2PLPA 1LGRA 2DYQA 1D6EC 3O13A 3M62B 3ZNHB 3A9KB 4HB3B 3PVWA 4BOZB 2Z0DB 1XD4A 2D3CA 1IPGA 4WH4A 3VR9B 1J19A 4ICUA 4ZHOA 4L23A 4LDTB 3L4PA 2D2QA 2JP2A 4M0WB 1FXIA 5HFYA 1SE3A 1MIZB 3Q8FA 3DCGA 1OMWA 1GGOA 3ZTCA 1Y8RC 1ZP0B 5E6JA 1WM3A 2J4XA 5JVLA 1P98A 1XLOA 2J0JA 4D6WA 5L95C 3B1LX 3ZO5B 1YN3A 1UGMA 1RRPB 2KUQA 4F1SA 4K2PA 2H88B 4KHAA 3UIOB 1RAXA 2DZMA 3TUOA 3N32A 3NHEB 2JXTA 3G9WA 1K52A 2K22A 3NWAA 1FOEA 4MK0A 1VCBA 2DKQA 1WJ6A 2N1WA 5KCVA 2GBJA 1DDVA 1YIWA 2KZRA 4DBGA 4KGTA 1QILA 1HB6A 3IVFA 4WQMA 3A8PA 2PPHA 4JK8A 1Y56A 3DXEA 4CYEA 4RCOA 4L1RA 2KVRA 2KD0A 3KQ4A 1S3SG 3AEGB 4NY0A 3ML4A 2DA0A 3UINB 4MELA 2J7QB 3A9KA 3QC8B 1ET9A 1OEYA 2G4DB 4LJOB 1N5XA 3GP7A 4HJKA 3SU8X 1ENFA 3C8YA 2DYOA 1K8RB 3W5VB 4A6FB 5FR3A 2COPA 5DHFB 1U5FA 5D3DA 3N1ZC 4M0WA 1QLBB 3PVUA 2BBCA 3P4QB 4PS3A 5EE3A 4NQKE 5LXIB 2LJIA 3H7SA 4NPNA 1CZPA 1I4PA 2KIGA 5L81A 1HZ6A 1VRAB 1ZPSA 2BKFA 4N59A 3SUZA 3E9OA 4DBBA 4LNFA 2RDBC 5J18A 3QA8A 1KFYB 3I57A 1FRDA 4YTPB 4FADA 1AWEA 4FJYA 1X86A 2LFIA 3GYOA 2NPTB 1T0QC 4KZ0A 4BVUC 1P3RA 4DIXA 2X18A 1V9JA 2DN6A 3NY5A 3DCXA 3CSFA 2ZVNA 3APCA 2K8BA 2WU2B 1DDWA 1C1YB 3VHTC 3QK0A 1Q5WB 2NVUI 3KUZA 4PNKA 2LRWA 4HCNB 5HKHA 5E6NA 1N60A 3TMPB 2WU5B 1WIAA 3CXBB 3B2GA 2J0MA 2M56B 2N23A 2NBVB 3NZ3A 4JKBA 2BQQA 1UEFA 4MSQB 1D5ZC 2OTXA 2DIKA 4W9GA 1SJED 1F0ZA 1C4CA 1FB8A 1PYWD 5C5BB 1WXAA 1U4AA 4A8XC 4A6FA 3PLUA 3WIMA 2VKIA 2WLBA 1KLVA 4FJZA 3DHHC 4HATB 1MHXA 3W5UB 4ANUA 2KVZA 3ZKJC 4MGYE 2QILA 4M8NA 1WYWB 4NQLB 3R2IA 1WJNA 2RDGA 4GU2A 3PHWB 2MSED 4MGKE 2JT4B 1KTKA 3PG7A 2L3ZA 1TKEA 2NMBA 1YNTE 2ZJDA 2IFSA 1LQBA 2LHEA 4A6QA 3AE1B 1V5TA 3T3OA 2NPTA 4LLGM 2ZVOA 2J52A 4B6HA 2V3NA 3LXFA 5CHFA 2D4QA 2WYQA 4JKFA 2C5LC 1LXDA 5LG4B 1EWYC 3M3JA 5IKCM 1YQ4B 1SHCA 1AW7A 4YL8A 2GCLA 2YS1A 1DYQA 3DPDA 3UZTA 2RRFA 3ML9A 2MLBA 2FAZA 2KMMA 3PZ8A 1RYJA 2NBVA 3OLMD 2Y5BB 4QJ3B 2NTTA 2C7MB 4HHVA 3ZXRA 1WJ1A 5T8IA 3NWFA 1STEA 4K7SA 2LZ6A 3ZDTA 3U7DA 3PVLA 4DDGD 5C5BA 2PMVA 1WVHA 1E8XA 4QJ4B 1OQYA 3A9JB 2LVQA 1WJMA 3TW1A 3B08A 1MI0A 1NEKB 4L2YA 3M1IB 3KUCB 4OVZA 1I7AA 4K81A 3ZVRA 2FNJB 2W54A 2GBNA 1M7EA 4DWFA 3E9LA 3PO0A 4KHOA 2CJNA 4N6EB 2ZW1A 3K9PB 2KACA 2N7JA 3V05A 2O6VD 2BKRB 3SV1A 3U2SC 4OT1A 1HXYD 2M0XA 4KSKC 5IJMA 4PS8A 4YTNB 2XQNM 1G6JA 2NR2A 2IGHA 4W9EA 3MJWA 3Q8CA 4A3OA 3DDCB 1V5PA 3AEDB 1DOXA 2YT2A 1A70A 1FM0D 2LJ5A 2TSSA 2VH2A 1FNUA 3PRPB 5D3WA 4CHMA 5J3TA 3DVNU 3N1XC 3PEGA 3QX1A 1HTQA 2YF0A 1OQNA 1UNQA 4OZCA 1MK7B 1HEZE 1QOGA 1JRPA 1C76A 1Q10A 1LM8B 2L2IA 2VSZA 1WRIA 1LW3A 2N0SB 4DK5A 3ALBA 2RSGA 2FJ9A 1UNSA 1WMHB 2ZEQA 3AV8A 3N30A 4HWIB 2C9WB 1L6VA 2HD5B 5C2TB 3MHSD 4PQ0A 2BF8B 4KHBB 3GYPA 2ROVA 2Y7BA 3A9JA 2QMTA 2WX1A 3DWGC 4ARCA 4N9F4 4PS7A 2GI9A 1EGXA 2Y3AA 4W9LA 4XGAB 2ROZB 1N5WA 1LO5D 1V80A 1TY2A 1V2YA 2KJHB 2NBUA 1H8CA 4LNNA 1F2RI 2RVBB 3AE6B 3AU4A 2GUMA 1HE8A 3OWEB 1UD7A 3BY4B 2MP2B 1NTIA 4URKA 3RCPA 2MHJA 3RPFC 2DWQA 1MIXA 4B0MA 1AQCA 1KZGA 1V88A 1Q1OA 3A4SC 2XBBC 3M95A 4KDIC 2MH7A 2PVOD 1U5DA 1KZ7A 5GOWB 4US9A 4XX5A 4BBKA 2L00B 2QDFA 1XD3B 1V1OA 2NMQA 2Y5PA 3ODOA 2ZCCA 2SAKA 1T77A 1WMHA 4L6EA 2IY1B 2ZW0A 5G5GA 5FK9C 2XEWA 3KSYA 2JSVX 1FFVA 1FHWA 2FIDA 3P42A 4KHBA 1OQQA 4JWUC 2BYEA 2KFKB 3ODWA 2DYBA 1UNPA 3W1SC 2BPSA 4D2KA 1D5XC 1KRHA 4ITKA 2W3RA 5MPOA 4IM2A 5BYRA 3VIAA 1WGUA 2KXJA 2KYWA 3KZ1A 5IA7A 3NZSA 1FD6A 5EE9A 2KX0A 1YOVB 4NNJB 3ODXA 5EE0A 2R82A 5HE2A 2W2XD 1EWCA 3M63B 2AX5A 4GIVA 4RF1A 2KN5A 3LDZE 1FCCC 1W1GA 1X1MA 1U2BA 1JWAD 3ZRFA 4W9FA 2DKPA 2QKLA 3HRDD 4KGSA 3ZTDA 4AJWA 4LNOA 2DZKA 3EFCA 1NU2A 1PGXA 2JXXA 5I2SA 4ASWC 3RNFC 3NS8A 1XLQA 2KKCA 2YS3A 2VZKB 3EGRA 1X1FA 3HVDA 1QZEA 3FLVA 4JK7A 4HVBA 1T5XD 4BOSC 2DTCA 3NJTA 3QQ8B 2FBWB 3P2BA 2Y8GA 1KOTA 4K3BA 5DHAB 4TUUA 4JKGB 1SJHD 3MC8A 4L1BA 5DI9B 1BT0A 3ZLZA 4M00A 2KFKA 1VDVA 1R4NB 3HQCA 1T3QA 3H6NA 2FUHB 1V1PB 3BIID 3VUYA 2MA9B 1X11A 3QBVB 5EFXA 1FNVA 2L0TA 3GZNI 2IDYA 2LOXA 4N58A 3ULCA 1SE4A 1UBQA 2Z59B 2D07B 4EFOA 2JYEA 1JROA 4KKJA 3VOQA 4FHKA 2XK5B 1V5UA 1XF5L 2Z0PA 3DBLI 4WAAA 2CHWA 3AE8B 2Z0QA 3LJUX 2EMTA 1U27A 3AULA 1V86A 2WDRB 2FCMA 2JUOA 3APFA 3T8MA 3VFKA 3HVZA 4CHJA 3P1MA 4FN2A 1AYFA 3IBEA 4RGMA 4P1CC 1BTNA 1L0VB 1TJ6A 5E6PA 3NSUA 2I2YA 3OJ3A 4IFSA 2WH5A 3IT4B 2AEHA 3ZQ4A 1FRRA 4EEWA 4J3OD 4O1NA 3BVZA 3A58A 5DPTA 2CY4A 3SFDB 1UWMA 3WAPA 3BINA 3IAM1 3NVZA 2UU7A 2HE7A 3ZW3A 3ZJVA 4F7ZA 2LG1A 1JMLA 1KM7A 2BW2A 3J9CA 3ZDMC 4JKGA 5JHAA 5G5HA 2DHIA 2KQ4X 1GAQB 4NAMA 4YSYB 4C80A 2Z8LA 2DZIA 3IAS1 1V1PA 4RMAA 4RNAA 4KV2A 4HDQA 3D8DA 1JRUA 1ISNA 1WR6E 2JY6A 1B9RA 1XR0B 3HM3A 3CIRB 2N7DA 2Z59A 4WQOB 3E56A 2FE8A 3IXSA 2DNFA 3VVWB 1FXAA 2XK5A 2YVCA 4EZJA 1DDMA 5C79A 3UQAA 2D9WA 3AU5A 4II2B 1UF0A 2GRIA 1Z87A 1WX7A 1OTRB 2JWZA 2OJWA 1L2NA 2FUG1 4MT7A 2IGGA 1JWUD 1YJJA 1YN4A 3FILB 2KK8A 1H4RA 2BCJA 2LWPA 4JKHA 1OQRA 1UZXB 3FAHA 3W2DA 3NZUA 5G55A 3D32A 2PTLA 1ZXIA 1WY8A 1P7EA 3T9LA 4A5KA 4A9AA 3AE2B 3KUDB 1Q67A 4EUTA 2WWZA 2VZKD 3V6EB 3Q14C 1K50A 2LKOA 3U12A 3AH7A 1N6ZA 2YT1A 2CHZA 1CJEA 3UQBA 4DXAB 2Z0EB 2N9XA 2K0PA 2RQ1A 4HAZB 2E2XA 3MJ5A 1WSPA 2HRJA 4HB4B 1WGDA 4IWPA 3ZNZB 2PJHA 2NTSA 2QEJC 4LNKA 4OSNA 1ZC3B 3PZDA 3TEXA 3AEEB 1NTYA 2P0HA 1D5MC 2DX1A 2W2XC 3DOWA 1PLSA 2LMCA 4P6VF 4XDCA 1TGZB 4YSZB 5C16A 3W1SA 5KQ4A 3ENEA 4GMXB 3VH4B 1AARA 3DXCA 2L83A 4PK1A 5HI1A 3UGBB 4JL9A 1UELA 1HZ5A 3AEAB 3FILA 4ZDVA 2G35A 2V1YA 4HK2A 1QOAA 1GC6A 3CWIA 2O6VB 1BMLC 1T0YA 4RGTA 2WXPA 1UUPA 3VDZA 3ULBA 1WH3A 2LGXA 2WDTB 3MP9A 4GZUA 2W2WA 2K6DB 3Q3OC 3VQIA 2X38A 4NSWA 4HPMB 1SIJA 1SBBB 2ACZB 2R61A 4JQWC 2JWUA 5C23A 2REXA 4WJQA 3ZUNA 2LXAA 3KWVA 1FAOA 2L76A 3A1QB 3NVVA 1L0YB 1SF0A 1VLBA 1XLNA 1P1AA 1YMHE 5AZFA 3N20C 3TFMA 3V6CB 4IOIE 4TV3A 3FEHA 3FC4A 1UPRA 2LVOA 5DPRA 1WXQA 3RUIB 1UH6A 2DYMA 1IBXB 2K1FA 2IO3B 4DX90 2WQYB 3AE3B 2PIAA 3U52E 4WWPA 4AJYB 2MBBB 1LB1A 3V62A 1I4GA 3QIJA 1ZVRA 1JDEA 3GS2A 3RMKC 1BAKA 2LD9A 4WWMA 1NYRA 4A55A 1MAIA 3TO1A 1J0WA 3PTFC 1WX8A 2OJRA 3MPXA 3PZ7A 2RD0A 4OVVA 4A6KA 3MC9A 4GN1A 2XN9C 1L4ZB 2WXOA 4JX1C 4NAWB 3R8BA 1TXDA 3RD2A 2J0KA 1E8WA 3AXCA 5D7GA 1WE6A 1U5GA 4YT0B 5AZGA 3X0WA 2IPKD 4YWGG 4K17A 1RRBA 1PMSA 5JH5C 1HA5A 2O6VA 4JWSC 2KUPA 4DHJB 4WWOA 1R4MI 4GB9A 3HHMA 2KFJA 4PYUA 1I42A 2M19A 1WXSA 2LGDA 2XNAC 4HKQA 1TBEA 2G1EA 3HIEA 1RFKA 5D3VA 2ON8A 3SHQA 3K9OB 2BGFA 1XEEA 1ST7A 2KWCA 4OVUA 3RZFA 2WXHA 3A1QA 3R7QA 4ICVA 2BTEA 1OGWA 2MBOA 1WRDB 4RGNA 4AS1A 4D0NB 2ZPYA 3KRWA 5D94A 2EKIA 1BXTA 4H2AA 4J6IA 1WGRA 3N3KB 3KYDD 1Q0WB 4RF0A 1IBXA 3KW5B 2CJOA 4W9KA 5D6JB 4ILJA 2V9HA 3SD5A 1Z2MA 1ZGUB 4XE0A 2DFKA 4W9HA 1N61A 1WGYA 1W1HA 2KCJA 3TIXA 3WCQA 4M02A 2AQ1B 4FA6A 1WJUA 1P5TA 2WXJA 4EJNA 1VD2A 1ZKHA 4JKEA 2KLCA 1HB8A 4ZRJA 3DBSA 4HCPB 2L05A 3V3XA 3O96A 4NAWA 1FHOA 3NVWA 1C4AA 1E7VA 5CLQB 5HE1A 2DHJA 2YEPF 2CKHB 4IC7B 5HE0A 5JXVA 5I4DA 3VTUA 1ZSQA 5EDSA 2GB1A 3FKYA 5LNK1 2W9NA 4KVGB
chains in the Genus database with same CATH topology
2PZ1A 2V3SA 4MH0E 1V49A 3AJ4A 1ZW7A 2P0DA 2RLOA 5CTRC 3Q3JA 4GDKB 5DH9B 3V5WA 2KNBA 3QWZB 3JW0X 1NVLA 4BBNF 2YLMA 1WX9A 1E90A 4F8CB 2EKEC 3V61A 1NBFC 5J3QA 4FLHA 2KMAA 3ZVVA 1SIFA 2J59M 2GJYA 4HAVB 2C60A 4GDLB 4WWNA 2HJ8A 3X23A 2IZVB 2KO3A 2RUKB 2KJ6A 3MTNB 5JLJB 2CR5A 4HAWB 2KQSA 1E8YA 3PP2A 4CHKA 4JIOU 3W1YA 2K8CA 3CIKA 4ANXA 2R0DA 3Q3FA 3SO6A 2V76A 5CHVC 2FDQA 2BYFA 4IG7B 1NTVA 4EZLA 4DHJD 2KWVB 5J17A 4GDKA 2KANA 1F9JA 1P3QU 2LYDA 2V4LA 4HLEA 3L0WB 3PPAA 2M8SA 4IOYX 2H7DA 2M1MA 4TQ0A 3ONSA 5LLIA 4IM3A 4FULA 5LONB 3E9PA 3PT2B 4MGZE 1QQGA 2M4NA 2LBBA 4BKGA 1J0GA 3FSSA 3VTVA 4G50A 1P6SA 4GDLA 2KX3A 3RULA 5J3YA 3WYFB 2KTFA 2NS5A 3TBLD 3HW2B 1B55A 1WXVA 5CX3A 5KHQA 2YT0A 3WAOA 2EC1A 1EAZA 2CY5A 4HAUB 2N7EA 1EF1A 3TJPA 1V89A 3PRZA 5TR5A 4IWOA 2G3QB 2OOBB 3QWMA 2M17A 5D27A 2QHOA 3QAQA 3F0WA 2MP2A 4I6LB 5KQ1A 4ILGB 1P0RA 2AYOB 4IW0A 4FBJB 1Y19B 4XC2A 2DAFA 3N7CA 3AI5A 1R4NI 2L8JA 2DHZA 3SNHA 2COFA 5JP4A 4E3CA 4K2OA 4WJPA 4BKSD 2K2JA 1WE7A 1N3HA 3SBGA 3IFWB 3OAWA 1FHXA 3R3MA 4JGHB 3DXDA 3NOBA 3S2AA 2CB8A 2D3GA 4DHZE 3PREA 2YS5A 4MJSB 4H8SA 3DBHI 5AZHA 3ENBA 1V5MA 3F5RA 1KI1B 1XKEA 3BJIA 3ZNID 3WA0A 1MKEA 2MQJA 2KC1A 2O2VB 2I1JA 2KMCA 1YJ1A 2PE6B 4EMOA 3V60A 2DAJA 1UPQA 4Y94A 2DENB 4KDLB 3WALA 2LOZA 2ZNVB 1LFDA 2LI5A 1GJZA 5JHGA 3CF6E 2MDXA 3VXWA 1Z5SB 1RJ2A 1RFAA 5D3YA 4TKNA 3I3TB 1HBKA 4HB0B 2CS4A 1V61A 2MWSB 2JZ3B 3DVGY 2MRPA 2KHWB 5FI0A 4KZCA 4W9IA 2GOWA 4BFRA 2D9ZA 1WZ3A 4DDID 2KLGA 2K6QA 1IYFA 2G4SA 2N9EB 2RPQA 1DYNA 1XODA 2IY0B 5JZEB 5LXHA 1WM2A 4MJSA 4JKDA 3U8ZA 1WZ0A 1I35A 5JHBA 1QC6A 4MGIE 2O2VA 3L10B 4JKAA 3OANA 2RSUA 2ADZA 4YONA 4Z2MB 3LJ3A 3PGEA 3KVFB 1P9DU 4K7WA 2NCNA 4A20A 3P7ZA 3ECIA 1U5EA 2MW5A 1E7UA 2L0FA 3U30A 2CAYA 4IWQA 1ZM0A 2YRYA 3ZIMA 4II3B 5JHHA 3EHVA 1V6EA 2P8VA 1DBHA 5D3XA 1Y5OA 5E6OA 3RT3B 2IO1B 1WGGA 3A98B 1UNRA 2Y8FA 2NBWB 1E8ZA 2DLWA 4MSMB 4FJVB 4CO7A 1XX0A 4FHJA 2MBQA 4G0NB 2A5UA 2EJ8A 3H7PB 3A4RA 2COAA 3VH3B 2MCNB 3EFUA 2KQ7A 2N0YA 2K2UA 4I6NB 3L16A 3EPYA 2IBIB 1CMXB 3CMMB 4IM0A 3TCAA 2ZZPB 3JSVB 1GUAB 2KDEB 4GGQA 1WGHA 2D9YA 2A4ZA 4GPTB 4TYZA 2HTHB 2G45B 1RLFA 3KYCD 4NJ6A 4PYZA 2LULA 1K5GB 1U29A 3IHPC 3HM6X 4EKUA 3DVNV 4GSWA 2CQUA 2FCNA 3UF8A 2FJLA 4ZRIA 2KDBA 2IYDB 2R2QA 2MKRA 2Z0OA 3B0AA 5D2MB 2KDFB 1YX6B 4ANWA 3IG3A 1WI0A 3FP5A 3H7PA 3ML8A 5AEKB 3PV1A 2JRIB 1GG3A 3C0RB 3KY9A 2MFQA 4GMVA 2BWFA 2UZSA 4JKCA 2ABDA 3JSVA 5IAAC 4GXBA 3JYUA 2HTHA 4B95A 2ZCBA 1J8CA 1V81A 2I5FA 2CHXA 1TZ1A 1X1GA 2KTRB 2IYBA 3DQVA 2D10A 2ASQA 4AUQC 3R7RA 2GBMA 2ZPNA 4G11A 2N1VA 1L7YA 4A6HA 4B6WA 4E71A 4LDTD 2YSZA 4A3PA 2K25A 2KOXA 3OJ4B 2MWNB 2RGNB 2P0FA 3TL5A 4IUMB 2DYNA 2KDIA 3VUXA 2JVCA 2WX0A 4WJ7A 5DPWA 1DIKA 1C3TA 3T06A 2LRUA 4WVFB 1FXTB 1VBGA 1D3ZA 4C0AA 2DZJA 2LVPA 4MY6A 5DCNA 4KIKB 3EECA 4XWXA 5HE3A 4AWJA 2VRWB 3GOEA 1OY2A 3FM8C 2KTRA 3D8FA 5C6RA 2LUEA 3SDLC 3QARA 2UVMA 3PLVA 4HPLB 3QJZA 2UWQA 3PSEB 4F7GA 3KRXA 2GCJA 2K39A 4WJNA 2C7HA 3A8QA 2GBKA 2K8HA 4W9CA 4AOFA 1IP9A 4ANVA 2GS0A 1WXMA 3PS6A 2MBHA 2LASA 2BYVE 1IRSA 1XCGA 4AP4C 2RNRB 2VRRB 3H1UA 1WJ4A 3L13A 2NZ8B 1XQQA 4RM8A 5BO4B 1H10A 2AL3A 2GBRA 4KIKA 2IO2B 1BWNA 1EF5A 2QKMA 3PHXB 4F7UP 2ZNVC 4K1RB 3VTWA 2L1CA 1MK9B 1WGQA 4XZ4A 4M8MA 5L83A 4HAYB 4KSLC 2I1KA 2R2OA 5J2RA 2OQBA 2DHKA 1KC7A 4P7IA 2N9PC 3H9DA 3HK0A 1WI1A 4I6PA 3PRMB 5FR6A 3RCZA 2K00A 1W1DA 2CODA 3L54A 3UIPB 2UZRA 4BKSA 4LJPB 3SBTA 2KC2A 5GMVA 2EMSA 4MEMA 1NDDA 1M94A 3E66A 1GC7A 2AL6A 5KHOA 1XT9B 4JLCA 3RYTA 3PSCA 3QCAA 3CSTA 2KGXB 2JZZA 2ELBA 1GNUA 2B3AA 3TVVA 3D8EA 2MBEA 4Z2NA 4WSFA 2FCSA 2L7RA 1I2HA 2D9VA 1ACAA 1YX5B 1WR1A 2C7NB 5LOPB 2COCA 4X57B 4F7HA 2FIFA 2Q13A 2KJRA 2PE9A 3WAMA 4IAPA 1WG7A 1BTKA 3L17A 3APDA 2DX5B 3R66C 1EVHA 1FGYA 1PFJA 1MG8A 1KBLA 1SE9A 4DX8A 4ZRKA 1VBHA 4BBNC 4EOYA 3ZNGC 3HIZA 1WF9A 2FCQA 1EO6A 3L08A 4B9KA 4HDOA 4E74A 1MPHA 2R09A 2CRFA 3P6AA 1TTNA 2I5CA 2RGFA 4ILHA 2D9XA 1V5OA 1ZC4B 3A33B 4KAXB 1SGHA 1OEYJ 2CU1A 4MDKE 2GMIC 4JK9A 2N4FA 4W9DA 1X05A 4EZKA 4BKTA 1NI2A 4LCDE 3SYXA 3KH0A 4GOCA 4K7UA 1K5DB 5DPSA 3VAWA 4G3XB 3DBRI 2LGYA 2KWUB 1FGZA 3QHTA 2DX5A 5DIFB 4HB2B 3MDBC 1YQBA 2BWES 2IO0B 3VUWA 1E5WA 1S1QB 4MM3A 2M38A 3WANA 1EUVB 1WFYA 5C1ZA 3O65B 1YD8U 1UBIA 4WJOA 4HXDA 2UYZB 1DROA 2X0SA 5CLLB 2MX2A 2PEAA 1KJTA 1A5RA 4HAXB 5G2NA 2M14A 5CHWA 1TQZA 3RZWC 2D11A 3ZRCA 2ELAA 4ZYNA 3JVZX 2H7EA 1M7RA 2LXCA 4NJ7A 5FI1A 4TQ1A 2JPHA 3DVGX 4RM9A 3EC8A 4DHZB 4W9JA 2JRHA 2JF5A 1PQSA 2RR9A 2AWTA 2DYQA 3M62B 3ZNHB 3A9KB 4HB3B 3PVWA 4BOZB 2Z0DB 1XD4A 1IPGA 1J19A 4ICUA 4LDTB 2D2QA 2JP2A 4M0WB 1MIZB 3DCGA 1OMWA 1GGOA 3ZTCA 1Y8RC 1WM3A 5JVLA 1P98A 2J0JA 5L95C 3B1LX 3ZO5B 1UGMA 1RRPB 4F1SA 4K2PA 4KHAA 3UIOB 1RAXA 2DZMA 3N32A 3NHEB 3G9WA 1FOEA 4MK0A 1VCBA 2DKQA 1WJ6A 2N1WA 5KCVA 2GBJA 1DDVA 1YIWA 2KZRA 4DBGA 1HB6A 3IVFA 3A8PA 2PPHA 4JK8A 3DXEA 4CYEA 2KVRA 2KD0A 1S3SG 4NY0A 3ML4A 2DA0A 3UINB 4MELA 2J7QB 3A9KA 3QC8B 1OEYA 2G4DB 4LJOB 4HJKA 3SU8X 2DYOA 1K8RB 4A6FB 2COPA 5DHFB 1U5FA 3PVUA 4PS3A 4NQKE 5LXIB 3H7SA 4NPNA 5L81A 2BKFA 3SUZA 3E9OA 4DBBA 5J18A 3QA8A 4FADA 1AWEA 4FJYA 1X86A 3GYOA 2NPTB 4KZ0A 4BVUC 1P3RA 2X18A 1V9JA 2DN6A 3NY5A 3CSFA 2ZVNA 3APCA 2K8BA 1DDWA 1C1YB 3VHTC 3QK0A 1Q5WB 2NVUI 3KUZA 4PNKA 2LRWA 4HCNB 5HKHA 5E6NA 3TMPB 1WIAA 3CXBB 2J0MA 2N23A 2NBVB 4JKBA 1UEFA 4MSQB 2OTXA 2DIKA 4W9GA 1FB8A 5C5BB 1WXAA 1U4AA 4A6FA 3PLUA 3WIMA 2VKIA 1KLVA 4FJZA 4HATB 4ANUA 3ZKJC 4MGYE 4M8NA 1WYWB 4NQLB 1WJNA 4GU2A 3PHWB 2MSED 4MGKE 2JT4B 3PG7A 2L3ZA 2NMBA 2ZJDA 2IFSA 1LQBA 1V5TA 2NPTA 2ZVOA 4B6HA 5CHFA 2D4QA 2WYQA 4JKFA 2C5LC 1LXDA 3M3JA 1SHCA 4YL8A 2GCLA 2YS1A 3DPDA 3UZTA 3ML9A 2MLBA 2FAZA 3OLMD 2Y5BB 2C7MB 4HHVA 1WJ1A 4K7SA 2LZ6A 3ZDTA 3U7DA 3PVLA 4DDGD 5C5BA 1WVHA 1E8XA 1OQYA 3A9JB 2LVQA 1WJMA 3TW1A 3B08A 3M1IB 3KUCB 1I7AA 4K81A 3ZVRA 2FNJB 2GBNA 1M7EA 4DWFA 3E9LA 4KHOA 3K9PB 2O6VD 2BKRB 3SV1A 2M0XA 4KSKC 5IJMA 4PS8A 2XQNM 1G6JA 2NR2A 4W9EA 3MJWA 4A3OA 3DDCB 1V5PA 2LJ5A 3PRPB 5D3WA 4CHMA 5J3TA 3DVNU 3PEGA 3QX1A 2YF0A 1OQNA 1UNQA 1MK7B 1LM8B 2L2IA 2VSZA 1LW3A 4DK5A 3ALBA 2RSGA 2FJ9A 1WMHB 2ZEQA 3N30A 4HWIB 2C9WB 2HD5B 3MHSD 4PQ0A 2BF8B 4KHBB 3GYPA 2ROVA 2Y7BA 3A9JA 2WX1A 4N9F4 4PS7A 1EGXA 4W9LA 2ROZB 1V80A 1V2YA 2KJHB 2NBUA 1H8CA 2RVBB 3AU4A 1HE8A 1UD7A 3BY4B 2MP2B 1NTIA 4URKA 3RCPA 1MIXA 1AQCA 1KZGA 1V88A 1Q1OA 3A4SC 2XBBC 3M95A 4KDIC 1U5DA 1KZ7A 5GOWB 4XX5A 4BBKA 2L00B 1XD3B 3ODOA 2ZCCA 1WMHA 4L6EA 2IY1B 2XEWA 3KSYA 1FHWA 2FIDA 2BYEA 2KFKB 3ODWA 2DYBA 1UNPA 3W1SC 2BPSA 4IM2A 3VIAA 1WGUA 2KXJA 5IA7A 3KZ1A 3NZSA 2KX0A 4NNJB 3ODXA 2R82A 5HE2A 2W2XD 3M63B 4GIVA 2KN5A 3LDZE 1W1GA 1X1MA 1U2BA 3ZRFA 4W9FA 2DKPA 2QKLA 3ZTDA 4AJWA 2DZKA 1NU2A 2JXXA 4ASWC 3NS8A 2KKCA 2YS3A 1X1FA 1QZEA 3FLVA 4JK7A 4HVBA 4BOSC 2DTCA 3QQ8B 3P2BA 2Y8GA 1KOTA 5DHAB 4TUUA 4JKGB 5DI9B 1BT0A 3ZLZA 2KFKA 3HQCA 3H6NA 2FUHB 3VUYA 2MA9B 1X11A 3QBVB 5EFXA 2L0TA 3GZNI 2LOXA 3ULCA 1UBQA 2Z59B 2D07B 4EFOA 3VOQA 4FHKA 2XK5B 1V5UA 2Z0PA 3DBLI 4WAAA 2CHWA 2Z0QA 3LJUX 2EMTA 1U27A 3AULA 1V86A 2FCMA 2JUOA 3APFA 3T8MA 3VFKA 4CHJA 4FN2A 3IBEA 1BTNA 1TJ6A 5E6PA 3NSUA 3OJ3A 4IFSA 2WH5A 2AEHA 4EEWA 5DPTA 2CY4A 3WAPA 3BINA 3ZW3A 2HE7A 4F7ZA 2LG1A 1KM7A 3ZDMC 4JKGA 5JHAA 2DHIA 2DZIA 4RMAA 4KV2A 4HDQA 3D8DA 1JRUA 1ISNA 1WR6E 2JY6A 1XR0B 3HM3A 2N7DA 4WQOB 3VVWB 2XK5A 2YVCA 4EZJA 1DDMA 5C79A 3UQAA 2D9WA 3AU5A 4II2B 1Z87A 1WX7A 1OTRB 2JWZA 1L2NA 4MT7A 2KK8A 1H4RA 2BCJA 2LWPA 4JKHA 1UZXB 3NZUA 5G55A 3D32A 1WY8A 3T9LA 4A5KA 3KUDB 1Q67A 4EUTA 2WWZA 3V6EB 2LKOA 2YT1A 2CHZA 3UQBA 4DXAB 2Z0EB 2N9XA 2RQ1A 4HAZB 2E2XA 2HRJA 4HB4B 1WGDA 4IWPA 3ZNZB 2PJHA 1ZC3B 3PZDA 1NTYA 2P0HA 2DX1A 2W2XC 3DOWA 1PLSA 1TGZB 5C16A 3W1SA 5KQ4A 3ENEA 4GMXB 3VH4B 1AARA 3DXCA 3UGBB 4JL9A 1UELA 4ZDVA 2G35A 2V1YA 4HK2A 1GC6A 2O6VB 1T0YA 3VDZA 3ULBA 1WH3A 2LGXA 2WDTB 4GZUA 2W2WA 2K6DB 3VQIA 4NSWA 4HPMB 4JQWC 5C23A 2REXA 4WJQA 3ZUNA 2LXAA 1FAOA 2L76A 3A1QB 1P1AA 5AZFA 3TFMA 3V6CB 4TV3A 3FEHA 1UPRA 2LVOA 5DPRA 3RUIB 1UH6A 2DYMA 2K1FA 2IO3B 4DX90 4WWPA 4AJYB 2MBBB 1LB1A 3V62A 3QIJA 1ZVRA 1JDEA 1BAKA 2LD9A 1MAIA 3TO1A 1J0WA 3PTFC 1WX8A 2OJRA 3MPXA 2RD0A 4OVVA 4A6KA 4GN1A 4NAWB 1TXDA 3RD2A 2J0KA 1E8WA 3AXCA 5D7GA 1WE6A 1U5GA 5AZGA 3X0WA 4K17A 1RRBA 1PMSA 5JH5C 2O6VA 2KUPA 4DHJB 4WWOA 1R4MI 4GB9A 3HHMA 2KFJA 4PYUA 1I42A 1WXSA 2LGDA 1TBEA 5D3VA 3SHQA 3K9OB 2BGFA 1ST7A 2KWCA 4OVUA 3RZFA 3A1QA 3R7QA 4ICVA 1OGWA 2MBOA 1WRDB 4D0NB 2ZPYA 3KRWA 5D94A 4J6IA 1WGRA 3N3KB 3KYDD 1Q0WB 3KW5B 4W9KA 5D6JB 4ILJA 3SD5A 1Z2MA 1ZGUB 2DFKA 4W9HA 1WGYA 1W1HA 2KCJA 3TIXA 4FA6A 1WJUA 1P5TA 4EJNA 1VD2A 1ZKHA 4JKEA 2KLCA 1HB8A 4ZRJA 3DBSA 4HCPB 2L05A 3O96A 4NAWA 1FHOA 1E7VA 5CLQB 5HE1A 2DHJA 2CKHB 4IC7B 5HE0A 3VTUA 1ZSQA 5EDSA 2W9NA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  2V3S A;  4MH0 E;  1V49 A;  3AJ4 A;  1ZW7 A;  2P0D A;  2RLO A;  5CTR C;  3Q3J A;  4GDK B;  5DH9 B;  3V5W A;  2KNB A;  3QWZ B;  3JW0 X;  1NVL A;  4BBN F;  2YLM A;  1WX9 A;  1E90 A;  4F8C B;  2EKE C;  3V61 A;  1NBF C;  5J3Q A;  4FLH A;  2KMA A;  3ZVV A;  1SIF A;  2J59 M;  2GJY A;  4HAV B;  2C60 A;  4GDL B;  4WWN A;  2HJ8 A;  3X23 A;  2IZV B;  2KO3 A;  2RUK B;  2KJ6 A;  3MTN B;  5JLJ B;  2CR5 A;  4HAW B;  2KQS A;  1E8Y A;  3PP2 A;  4CHK A;  4JIO U;  3W1Y A;  2K8C A;  3CIK A;  4ANX A;  2R0D A;  3Q3F A;  3SO6 A;  2V76 A;  5CHV C;  2FDQ A;  2BYF A;  4IG7 B;  1NTV A;  4EZL A;  4DHJ D;  2KWV B;  5J17 A;  4GDK A;  2KAN A;  1F9J A;  1P3Q U;  2LYD A;  2V4L A;  4HLE A;  3L0W B;  3PPA A;  2M8S A;  4IOY X;  2H7D A;  2M1M A;  4TQ0 A;  3ONS A;  5LLI A;  4IM3 A;  4FUL A;  5LON B;  3PT2 B;  4MGZ E;  1QQG A;  2M4N A;  2LBB A;  4BKG A;  1J0G A;  3FSS A;  3VTV A;  4G50 A;  1P6S A;  4GDL A;  2KX3 A;  3RUL A;  5J3Y A;  3WYF B;  2KTF A;  2NS5 A;  3TBL D;  3HW2 B;  1B55 A;  1WXV A;  5CX3 A;  5KHQ A;  2YT0 A;  3WAO A;  2EC1 A;  1EAZ A;  2CY5 A;  4HAU B;  2N7E A;  1EF1 A;  3TJP A;  1V89 A;  3PRZ A;  5TR5 A;  4IWO A;  2G3Q B;  2OOB B;  3QWM A;  2M17 A;  5D27 A;  2QHO A;  3QAQ A;  3F0W A;  2MP2 A;  4I6L B;  5KQ1 A;  1P0R A;  2AYO B;  4IW0 A;  4FBJ B;  1Y19 B;  4XC2 A;  2DAF A;  3N7C A;  3AI5 A;  1R4N I;  2L8J A;  2DHZ A;  3SNH A;  2COF A;  5JP4 A;  4E3C A;  4K2O A;  4WJP A;  4BKS D;  2K2J A;  1WE7 A;  1N3H A;  3IFW B;  3OAW A;  1FHX A;  3R3M A;  4JGH B;  3DXD A;  3NOB A;  3S2A A;  2CB8 A;  2D3G A;  4DHZ E;  3PRE A;  2YS5 A;  4MJS B;  4H8S A;  3DBH I;  5AZH A;  1V5M A;  3F5R A;  1KI1 B;  1XKE A;  3BJI A;  3ZNI D;  3WA0 A;  1MKE A;  2MQJ A;  2KC1 A;  2O2V B;  2I1J A;  2KMC A;  1YJ1 A;  2PE6 B;  3V60 A;  4EMO A;  2DAJ A;  1UPQ A;  4Y94 A;  2DEN B;  4KDL B;  3WAL A;  2LOZ A;  2ZNV B;  1LFD A;  2LI5 A;  1GJZ A;  5JHG A;  3CF6 E;  2MDX A;  3VXW A;  1Z5S B;  1RJ2 A;  1RFA A;  5D3Y A;  4TKN A;  3I3T B;  1HBK A;  4HB0 B;  2CS4 A;  1V61 A;  2MWS B;  2JZ3 B;  3DVG Y;  2MRP A;  2KHW B;  5FI0 A;  4KZC A;  4W9I A;  2GOW A;  4BFR A;  2D9Z A;  1WZ3 A;  4DDI D;  2KLG A;  2K6Q A;  1IYF A;  2G4S A;  2N9E B;  2RPQ A;  1DYN A;  1XOD A;  2IY0 B;  5JZE B;  5LXH A;  1WM2 A;  4MJS A;  3U8Z A;  1WZ0 A;  1I35 A;  5JHB A;  1QC6 A;  4MGI E;  2O2V A;  3L10 B;  3OAN A;  2RSU A;  2ADZ A;  4YON A;  4Z2M B;  3LJ3 A;  3PGE A;  3KVF B;  1P9D U;  4K7W A;  2NCN A;  4A20 A;  3P7Z A;  3ECI A;  1U5E A;  2MW5 A;  1E7U A;  2L0F A;  3U30 A;  2CAY A;  4IWQ A;  1ZM0 A;  2YRY A;  3ZIM A;  4II3 B;  5JHH A;  3EHV A;  1V6E A;  2P8V A;  1DBH A;  5D3X A;  1Y5O A;  5E6O A;  3RT3 B;  2IO1 B;  1WGG A;  3A98 B;  1UNR A;  2Y8F A;  2NBW B;  1E8Z A;  2DLW A;  4MSM B;  4FJV B;  4CO7 A;  1XX0 A;  4FHJ A;  2MBQ A;  4G0N B;  2A5U A;  2EJ8 A;  3H7P B;  3A4R A;  2COA A;  3VH3 B;  2MCN B;  3EFU A;  2KQ7 A;  2N0Y A;  2K2U A;  4I6N B;  3L16 A;  3EPY A;  2IBI B;  1CMX B;  3CMM B;  4IM0 A;  3TCA A;  2ZZP B;  3JSV B;  1GUA B;  2KDE B;  4GGQ A;  1WGH A;  2D9Y A;  2A4Z A;  4GPT B;  4TYZ A;  2HTH B;  2G45 B;  1RLF A;  3KYC D;  4NJ6 A;  4PYZ A;  2LUL A;  1K5G B;  1U29 A;  3IHP C;  3HM6 X;  4EKU A;  3DVN V;  4GSW A;  2CQU A;  2FCN A;  3UF8 A;  2FJL A;  4ZRI A;  2KDB A;  2IYD B;  2R2Q A;  2MKR A;  2Z0O A;  3B0A A;  5D2M B;  2KDF B;  1YX6 B;  4ANW A;  3IG3 A;  1WI0 A;  3FP5 A;  3H7P A;  3ML8 A;  5AEK B;  3PV1 A;  2JRI B;  1GG3 A;  3C0R B;  3KY9 A;  2MFQ A;  4GMV A;  2BWF A;  2UZS A;  2ABD A;  3JSV A;  5IAA C;  4GXB A;  3JYU A;  2HTH A;  4B95 A;  2ZCB A;  1J8C A;  1V81 A;  2I5F A;  2CHX A;  1TZ1 A;  1X1G A;  2KTR B;  2IYB A;  3DQV A;  2D10 A;  2ASQ A;  4AUQ C;  3R7R A;  2GBM A;  2ZPN A;  4G11 A;  2N1V A;  1L7Y A;  4A6H A;  4B6W A;  4E71 A;  4LDT D;  2YSZ A;  4A3P A;  2K25 A;  2KOX A;  3OJ4 B;  2MWN B;  2RGN B;  2P0F A;  3TL5 A;  4IUM B;  2DYN A;  2KDI A;  3VUX A;  2JVC A;  2WX0 A;  4WJ7 A;  5DPW A;  1C3T A;  3T06 A;  2LRU A;  4WVF B;  1FXT B;  1D3Z A;  4C0A A;  2DZJ A;  2LVP A;  4MY6 A;  5DCN A;  4KIK B;  3EEC A;  4XWX A;  5HE3 A;  4AWJ A;  2VRW B;  3GOE A;  1OY2 A;  3FM8 C;  2KTR A;  3D8F A;  5C6R A;  2LUE A;  3SDL C;  3QAR A;  2UVM A;  3PLV A;  4HPL B;  3QJZ A;  2UWQ A;  3PSE B;  4F7G A;  3KRX A;  2GCJ A;  2K39 A;  4WJN A;  2C7H A;  3A8Q A;  2GBK A;  2K8H A;  4W9C A;  4AOF A;  1IP9 A;  4ANV A;  2GS0 A;  1WXM A;  3PS6 A;  2MBH A;  2LAS A;  2BYV E;  1IRS A;  1XCG A;  4AP4 C;  2RNR B;  2VRR B;  3H1U A;  1WJ4 A;  3L13 A;  2NZ8 B;  1XQQ A;  4RM8 A;  5BO4 B;  1H10 A;  2AL3 A;  2GBR A;  4KIK A;  2IO2 B;  1BWN A;  1EF5 A;  2QKM A;  3PHX B;  4F7U P;  2ZNV C;  4K1R B;  3VTW A;  2L1C A;  1MK9 B;  1WGQ A;  4XZ4 A;  4M8M A;  5L83 A;  4HAY B;  4KSL C;  2I1K A;  2R2O A;  5J2R A;  2OQB A;  2DHK A;  4P7I A;  2N9P C;  3H9D A;  3HK0 A;  1WI1 A;  4I6P A;  3PRM B;  5FR6 A;  3RCZ A;  2K00 A;  1W1D A;  2COD A;  3L54 A;  3UIP B;  2UZR A;  4BKS A;  4LJP B;  2KC2 A;  5GMV A;  2EMS A;  4MEM A;  1NDD A;  1M94 A;  1GC7 A;  2AL6 A;  5KHO A;  1XT9 B;  4JLC A;  3RYT A;  3PSC A;  3QCA A;  3CST A;  2KGX B;  2JZZ A;  2ELB A;  1GNU A;  2B3A A;  3TVV A;  3D8E A;  2MBE A;  4Z2N A;  4WSF A;  2FCS A;  2L7R A;  1I2H A;  2D9V A;  1ACA A;  1YX5 B;  1WR1 A;  2C7N B;  5LOP B;  2COC A;  4X57 B;  4F7H A;  2FIF A;  2Q13 A;  2KJR A;  2PE9 A;  3WAM A;  4IAP A;  1WG7 A;  1BTK A;  3L17 A;  3APD A;  2DX5 B;  3R66 C;  1EVH A;  1FGY A;  1PFJ A;  1MG8 A;  1SE9 A;  4DX8 A;  4ZRK A;  4BBN C;  4EOY A;  3ZNG C;  3HIZ A;  1WF9 A;  2FCQ A;  1EO6 A;  3L08 A;  4B9K A;  4HDO A;  4E74 A;  1MPH A;  2R09 A;  2CRF A;  3P6A A;  1TTN A;  2I5C A;  2RGF A;  2D9X A;  1V5O A;  1ZC4 B;  3A33 B;  4KAX B;  1SGH A;  1OEY J;  2CU1 A;  4MDK E;  2GMI C;  2N4F A;  4W9D A;  1X05 A;  4EZK A;  4BKT A;  1NI2 A;  4LCD E;  3SYX A;  3KH0 A;  4GOC A;  4K7U A;  1K5D B;  5DPS A;  3VAW A;  4G3X B;  3DBR I;  2LGY A;  2KWU B;  1FGZ A;  3QHT A;  2DX5 A;  5DIF B;  4HB2 B;  3MDB C;  1YQB A;  2BWE S;  2IO0 B;  3VUW A;  1E5W A;  1S1Q B;  4MM3 A;  2M38 A;  3WAN A;  1EUV B;  1WFY A;  5C1Z A;  3O65 B;  1YD8 U;  1UBI A;  4WJO A;  4HXD A;  2UYZ B;  1DRO A;  5CLL B;  2MX2 A;  2PEA A;  1KJT A;  1A5R A;  4HAX B;  5G2N A;  2M14 A;  5CHW A;  1TQZ A;  3RZW C;  2D11 A;  3ZRC A;  2ELA A;  4ZYN A;  3JVZ X;  2H7E A;  1M7R A;  2LXC A;  4NJ7 A;  5FI1 A;  4TQ1 A;  2JPH A;  3DVG X;  4RM9 A;  3EC8 A;  4DHZ B;  4W9J A;  2JRH A;  2JF5 A;  1PQS A;  2RR9 A;  2AWT A;  2DYQ A;  3M62 B;  3ZNH B;  3A9K B;  4HB3 B;  3PVW A;  4BOZ B;  2Z0D B;  1XD4 A;  1IPG A;  1J19 A;  4ICU A;  4LDT B;  2D2Q A;  2JP2 A;  4M0W B;  1MIZ B;  3DCG A;  1OMW A;  3ZTC A;  1Y8R C;  1WM3 A;  1P98 A;  2J0J A;  5L95 C;  3B1L X;  3ZO5 B;  1UGM A;  1RRP B;  4F1S A;  4K2P A;  4KHA A;  3UIO B;  1RAX A;  2DZM A;  3N32 A;  3NHE B;  3G9W A;  1FOE A;  4MK0 A;  1VCB A;  2DKQ A;  1WJ6 A;  2N1W A;  5KCV A;  2GBJ A;  1DDV A;  1YIW A;  2KZR A;  4DBG A;  1HB6 A;  3IVF A;  3A8P A;  2PPH A;  3DXE A;  4CYE A;  2KVR A;  2KD0 A;  1S3S G;  4NY0 A;  3ML4 A;  2DA0 A;  3UIN B;  4MEL A;  2J7Q B;  3A9K A;  3QC8 B;  1OEY A;  2G4D B;  4LJO B;  4HJK A;  3SU8 X;  2DYO A;  1K8R B;  4A6F B;  2COP A;  5DHF B;  1U5F A;  3PVU A;  4PS3 A;  4NQK E;  5LXI B;  3H7S A;  4NPN A;  5L81 A;  2BKF A;  3SUZ A;  4DBB A;  5J18 A;  3QA8 A;  4FAD A;  1AWE A;  4FJY A;  1X86 A;  3GYO A;  2NPT B;  4KZ0 A;  4BVU C;  1P3R A;  2X18 A;  1V9J A;  2DN6 A;  3NY5 A;  3CSF A;  2ZVN A;  3APC A;  2K8B A;  1DDW A;  1C1Y B;  3VHT C;  3QK0 A;  1Q5W B;  2NVU I;  3KUZ A;  4PNK A;  2LRW A;  4HCN B;  5HKH A;  5E6N A;  3TMP B;  1WIA A;  3CXB B;  2J0M A;  2N23 A;  2NBV B;  1UEF A;  4MSQ B;  2OTX A;  4W9G A;  1FB8 A;  5C5B B;  1WXA A;  1U4A A;  4A6F A;  3PLU A;  3WIM A;  2VKI A;  1KLV A;  4FJZ A;  4HAT B;  4ANU A;  3ZKJ C;  4MGY E;  4M8N A;  1WYW B;  4NQL B;  1WJN A;  4GU2 A;  3PHW B;  2MSE D;  4MGK E;  2JT4 B;  3PG7 A;  2L3Z A;  2NMB A;  2ZJD A;  2IFS A;  1LQB A;  1V5T A;  2NPT A;  2ZVO A;  4B6H A;  5CHF A;  2D4Q A;  2WYQ A;  2C5L C;  1LXD A;  3M3J A;  1SHC A;  4YL8 A;  2GCL A;  2YS1 A;  3DPD A;  3UZT A;  3ML9 A;  2MLB A;  2FAZ A;  3OLM D;  2Y5B B;  2C7M B;  4HHV A;  1WJ1 A;  4K7S A;  2LZ6 A;  3ZDT A;  3U7D A;  3PVL A;  4DDG D;  5C5B A;  1WVH A;  1E8X A;  1OQY A;  3A9J B;  2LVQ A;  1WJM A;  3TW1 A;  3B08 A;  3M1I B;  3KUC B;  1I7A A;  4K81 A;  3ZVR A;  2FNJ B;  2GBN A;  1M7E A;  4DWF A;  4KHO A;  3K9P B;  2O6V D;  2BKR B;  3SV1 A;  2M0X A;  4KSK C;  5IJM A;  4PS8 A;  2XQN M;  1G6J A;  2NR2 A;  4W9E A;  3MJW A;  4A3O A;  3DDC B;  1V5P A;  2LJ5 A;  3PRP B;  5D3W A;  4CHM A;  5J3T A;  3DVN U;  3PEG A;  3QX1 A;  2YF0 A;  1OQN A;  1UNQ A;  1MK7 B;  1LM8 B;  2L2I A;  2VSZ A;  1LW3 A;  4DK5 A;  3ALB A;  2RSG A;  2FJ9 A;  1WMH B;  2ZEQ A;  3N30 A;  4HWI B;  2C9W B;  2HD5 B;  3MHS D;  4PQ0 A;  2BF8 B;  4KHB B;  3GYP A;  2ROV A;  2Y7B A;  3A9J A;  2WX1 A;  4N9F 4;  4PS7 A;  1EGX A;  4W9L A;  2ROZ B;  1V80 A;  1V2Y A;  2KJH B;  2NBU A;  1H8C A;  2RVB B;  3AU4 A;  1HE8 A;  1UD7 A;  3BY4 B;  2MP2 B;  1NTI A;  4URK A;  3RCP A;  1MIX A;  1AQC A;  1KZG A;  1V88 A;  1Q1O A;  3A4S C;  2XBB C;  3M95 A;  4KDI C;  1U5D A;  1KZ7 A;  5GOW B;  4XX5 A;  4BBK A;  2L00 B;  1XD3 B;  3ODO A;  2ZCC A;  1WMH A;  4L6E A;  2IY1 B;  2XEW A;  3KSY A;  1FHW A;  2FID A;  2BYE A;  2KFK B;  3ODW A;  2DYB A;  1UNP A;  3W1S C;  2BPS A;  4IM2 A;  3VIA A;  1WGU A;  2KXJ A;  5IA7 A;  3KZ1 A;  3NZS A;  2KX0 A;  4NNJ B;  3ODX A;  5HE2 A;  2W2X D;  3M63 B;  4GIV A;  2KN5 A;  3LDZ E;  1W1G A;  1X1M A;  1U2B A;  3ZRF A;  4W9F A;  2DKP A;  2QKL A;  3ZTD A;  4AJW A;  2DZK A;  1NU2 A;  2JXX A;  4ASW C;  3NS8 A;  2KKC A;  2YS3 A;  1X1F A;  1QZE A;  3FLV A;  4HVB A;  4BOS C;  2DTC A;  3QQ8 B;  3P2B A;  2Y8G A;  1KOT A;  5DHA B;  4TUU A;  5DI9 B;  1BT0 A;  3ZLZ A;  2KFK A;  3HQC A;  3H6N A;  2FUH B;  3VUY A;  2MA9 B;  1X11 A;  3QBV B;  5EFX A;  2L0T A;  3GZN I;  2LOX A;  3ULC A;  1UBQ A;  2Z59 B;  2D07 B;  4EFO A;  3VOQ A;  4FHK A;  2XK5 B;  1V5U A;  2Z0P A;  3DBL I;  4WAA A;  2CHW A;  2Z0Q A;  3LJU X;  2EMT A;  1U27 A;  3AUL A;  1V86 A;  2FCM A;  2JUO A;  3APF A;  3T8M A;  3VFK A;  4CHJ A;  4FN2 A;  3IBE A;  1BTN A;  1TJ6 A;  5E6P A;  3NSU A;  3OJ3 A;  4IFS A;  2WH5 A;  2AEH A;  4EEW A;  5DPT A;  2CY4 A;  3WAP A;  3BIN A;  3ZW3 A;  2HE7 A;  4F7Z A;  2LG1 A;  1KM7 A;  3ZDM C;  5JHA A;  2DHI A;  2DZI A;  4RMA A;  4KV2 A;  4HDQ A;  3D8D A;  1JRU A;  1ISN A;  1WR6 E;  2JY6 A;  1XR0 B;  3HM3 A;  2N7D A;  4WQO B;  3VVW B;  2XK5 A;  2YVC A;  4EZJ A;  1DDM A;  5C79 A;  3UQA A;  2D9W A;  3AU5 A;  4II2 B;  1Z87 A;  1WX7 A;  1OTR B;  2JWZ A;  1L2N A;  4MT7 A;  2KK8 A;  1H4R A;  2BCJ A;  2LWP A;  1UZX B;  3NZU A;  5G55 A;  3D32 A;  1WY8 A;  3T9L A;  4A5K A;  3KUD B;  1Q67 A;  4EUT A;  2WWZ A;  3V6E B;  2LKO A;  2YT1 A;  2CHZ A;  3UQB A;  4DXA B;  2Z0E B;  2N9X A;  2RQ1 A;  4HAZ B;  2E2X A;  2HRJ A;  4HB4 B;  1WGD A;  4IWP A;  3ZNZ B;  2PJH A;  1ZC3 B;  3PZD A;  1NTY A;  2P0H A;  2DX1 A;  2W2X C;  3DOW A;  1PLS A;  1TGZ B;  5C16 A;  3W1S A;  5KQ4 A;  3ENE A;  4GMX B;  3VH4 B;  1AAR A;  3DXC A;  3UGB B;  4JL9 A;  1UEL A;  4ZDV A;  2G35 A;  2V1Y A;  4HK2 A;  1GC6 A;  2O6V B;  1T0Y A;  3VDZ A;  3ULB A;  1WH3 A;  2LGX A;  2WDT B;  4GZU A;  2W2W A;  2K6D B;  3VQI A;  4NSW A;  4HPM B;  4JQW C;  5C23 A;  2REX A;  4WJQ A;  3ZUN A;  2LXA A;  1FAO A;  2L76 A;  3A1Q B;  1P1A A;  5AZF A;  3TFM A;  3V6C B;  4TV3 A;  3FEH A;  1UPR A;  2LVO A;  5DPR A;  3RUI B;  1UH6 A;  2DYM A;  2K1F A;  2IO3 B;  4DX9 0;  4WWP A;  4AJY B;  2MBB B;  1LB1 A;  3V62 A;  3QIJ A;  1ZVR A;  1BAK A;  2LD9 A;  1MAI A;  3TO1 A;  1J0W A;  3PTF C;  1WX8 A;  2OJR A;  3MPX A;  2RD0 A;  4OVV A;  4A6K A;  4GN1 A;  4NAW B;  1TXD A;  3RD2 A;  2J0K A;  1E8W A;  3AXC A;  5D7G A;  1WE6 A;  1U5G A;  5AZG A;  3X0W A;  4K17 A;  1RRB A;  1PMS A;  5JH5 C;  2O6V A;  2KUP A;  4DHJ B;  4WWO A;  1R4M I;  4GB9 A;  3HHM A;  2KFJ A;  4PYU A;  1I42 A;  1WXS A;  2LGD A;  1TBE A;  5D3V A;  3SHQ A;  3K9O B;  2BGF A;  1ST7 A;  2KWC A;  4OVU A;  3RZF A;  3A1Q A;  3R7Q A;  4ICV A;  1OGW A;  2MBO A;  1WRD B;  4D0N B;  2ZPY A;  3KRW A;  5D94 A;  4J6I A;  1WGR A;  3N3K B;  3KYD D;  1Q0W B;  3KW5 B;  4W9K A;  5D6J B;  3SD5 A;  1Z2M A;  1ZGU B;  2DFK A;  4W9H A;  1WGY A;  1W1H A;  2KCJ A;  3TIX A;  4FA6 A;  1WJU A;  1P5T A;  4EJN A;  1VD2 A;  1ZKH A;  2KLC A;  1HB8 A;  4ZRJ A;  3DBS A;  4HCP B;  2L05 A;  3O96 A;  4NAW A;  1FHO A;  1E7V A;  5CLQ B;  5HE1 A;  2DHJ A;  2CKH B;  4IC7 B;  5HE0 A;  3VTU A;  1ZSQ A;  5EDS A;  2W9N A;  4KVG B; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  2V3S A;  1DOY A;  4MH0 E;  1V49 A;  1EU4 A;  3AJ4 A;  1ZW7 A;  2P0D A;  2RLO A;  2H89 B;  5CTR C;  3Q3J A;  4GDK B;  1L5P A;  4JPS A;  4WUR A;  5DH9 B;  4HKZ E;  3V5W A;  2KNB A;  1ACC A;  3QWZ B;  3JW0 X;  1NVL A;  4BBN F;  2YLM A;  3AE9 B;  1F52 A;  2WXF A;  1WX9 A;  1E10 A;  1E90 A;  4A90 A;  2K5P A;  2WP9 B;  4F8C B;  4BAX A;  4R3D A;  2EKE C;  3V61 A;  1TYG B;  2BB5 A;  4WIP A;  1NBF C;  5J3Q A;  4XYC A;  2AQ2 B;  4FLH A;  1XCT L;  2KMA A;  3GE3 C;  3ZVV A;  1SIF A;  2J59 M;  4P1B C;  2GJY A;  2WXL A;  4HAV B;  2C60 A;  3NWD A;  2K8E A;  1PGA A;  4GDL B;  3AMZ A;  3R2T A;  2EEL A;  4WWN A;  2HJ8 A;  3X23 A;  2IZV B;  1JWB D;  2KO3 A;  2RUK B;  2KJ6 A;  3MTN B;  1XO3 A;  5JLJ B;  2CR5 A;  4HAW B;  2KQS A;  4TSS A;  1E8Y A;  3PP2 A;  4CHK A;  4JIO U;  3W1Y A;  2K8C A;  3CIK A;  3KLS X;  5AUK A;  2R0D A;  1TKY A;  4MH8 A;  3Q3F A;  3SO6 A;  4ANX A;  5BYS A;  5H92 C;  3TEZ A;  4B0E A;  2V76 A;  1ZXH A;  5CHV C;  3W9C B;  2BVC A;  1MVK A;  2FDQ A;  2BYF A;  2SEB D;  4IG7 B;  1NTV A;  4EZL A;  4DHJ D;  2KWV B;  1XXG A;  5J17 A;  4GDK A;  2KAN A;  1F9J A;  3DHG C;  1P3Q U;  1SEB D;  1GPX A;  4CSQ A;  3SFE B;  3AEF B;  2LYD A;  1QT9 A;  4QXA B;  2V4L A;  4HLE A;  3L0W B;  3PPA A;  2M8S A;  4IOY X;  2H7D A;  2M1M A;  4TQ0 A;  3ONS A;  3RNB C;  5LLI A;  4IM3 A;  3Q2A C;  4FUL A;  5LON B;  2RMM A;  3BK2 A;  3E9S A;  3E9P A;  3PT2 B;  4MGZ E;  2ZKM X;  1QQG A;  2M4N A;  2W82 A;  2LBB A;  4BKG A;  4KX6 B;  1J0G A;  1WWT A;  3FSS A;  2MEK A;  2QC8 A;  2RDH A;  3VTV A;  1UGJ A;  4G50 A;  1XCQ L;  1P6S A;  1DOI A;  4GDL A;  2KX3 A;  3RUL A;  5J3Y A;  3WYF B;  1FPY A;  2KTF A;  3DWM A;  1SE2 A;  4YXD B;  2LUM A;  5M4Y B;  2NS5 A;  1F77 A;  1ET6 A;  1NYQ A;  3TBL D;  4C00 A;  3HW2 B;  4WAF A;  1B55 A;  1WXV A;  5CX3 A;  5KHQ A;  2YT0 A;  3WAO A;  2EC1 A;  3VRB B;  1EAZ A;  2CY5 A;  4HAU B;  2N7E A;  1EF1 A;  3TJP A;  1MFW A;  3AE7 B;  1V89 A;  1CQV A;  3PRZ A;  5TR5 A;  4IWO A;  4C4V B;  2G3Q B;  2OOB B;  3URY A;  3QWM A;  4LNI A;  1C9F A;  2M17 A;  5D27 A;  2QHO A;  3QAQ A;  2KAJ A;  2WHI A;  3F0W A;  2MP2 A;  3P4S B;  4M01 A;  4I6L B;  5KQ1 A;  1E9M A;  1JAL A;  2K3U A;  4ILG B;  1P0R A;  2AYO B;  1GB4 A;  3AE4 B;  4IW0 A;  4FBJ B;  1Y19 B;  4XC2 A;  2OED A;  2DAF A;  4C7Y A;  4JE3 B;  3UI3 A;  3N7C A;  3NG0 A;  4ACF A;  3Q8E A;  1AN8 A;  3AM9 A;  1RM6 C;  3OHM B;  1N62 A;  3OG5 A;  3AEC B;  4ZOH C;  3AE5 B;  4DXG A;  2DLB A;  3AI5 A;  1R4N I;  2L8J A;  2DHZ A;  3SNH A;  2COF A;  5JP4 A;  3RNE C;  4E3C A;  4K2O A;  4WJP A;  2E6X A;  4BKS D;  1AWD A;  2V3P A;  2K2J A;  1WE7 A;  1N3H A;  3SBG A;  3IFW B;  3OAW A;  4GNK B;  1FO4 A;  3U7Z A;  1FHX A;  3R3M A;  4JGH B;  3DXD A;  3NOB A;  3S2A A;  2CB8 A;  2D3G A;  4DHZ E;  3RFZ B;  2RPV A;  3PRE A;  1E0Z A;  2YS5 A;  2JYT A;  4MJS B;  4C7Z A;  4H8S A;  3DBH I;  3EA6 A;  5AZH A;  3ENB A;  1V5M A;  2KR0 A;  3F5R A;  2KT7 A;  4C4V A;  4HRO A;  1KI1 B;  2DBY A;  1IGC A;  1L6U A;  1XKE A;  1MI1 A;  3BJI A;  5TSS A;  3WA0 A;  3ZNI D;  1MKE A;  2MQJ A;  2KC1 A;  2KMC A;  2I1J A;  1YJ1 A;  2O2V B;  2PE6 B;  4EMO A;  3V60 A;  2IGD A;  2L1A A;  2DAJ A;  1UPQ A;  4Y94 A;  2DEN B;  4KDL B;  3WAL A;  2Z4D A;  2WXQ A;  3T3N A;  2LOZ A;  1IUE A;  2ZNV B;  3DBR B;  1HTO A;  1LFD A;  3Q8B A;  2LI5 A;  4ZRQ A;  1GJZ A;  5JHG A;  1EU3 A;  3ZJT A;  1L4D B;  2MDX A;  3CF6 E;  3VXW A;  3ABV B;  1Z5S B;  1RJ2 A;  3HSA A;  1RFA A;  5D3Y A;  1PDX A;  4TKN A;  2INP E;  3I3T B;  1HBK A;  4HB0 B;  2CS4 A;  1V61 A;  2MWS B;  2JZ3 B;  3DVG Y;  2MRP A;  2Z14 A;  2KHW B;  5FI0 A;  4KZC A;  4ARI A;  4W9I A;  5D3I B;  2GOW A;  4BFR A;  2D9Z A;  1WZ3 A;  4DDI D;  2KLG A;  2K6Q A;  1IYF A;  2G4S A;  2BS2 B;  2N9E B;  2BS3 B;  1DYN A;  1XOD A;  2IY0 B;  2RPQ A;  2WS3 B;  5JZE B;  5LXH A;  1WM2 A;  2KN4 A;  3ZJU A;  4MJS A;  2JU6 X;  4DXF A;  4JKD A;  3U8Z A;  1WZ0 A;  1PUT A;  4LTU A;  1I35 A;  5JHB A;  1IGD A;  1J7C A;  1QC6 A;  4MGI E;  1TS5 A;  2O2V A;  3L10 B;  1FFU A;  4JKA A;  3OAN A;  3SEB A;  2RSU A;  1CK1 A;  2ADZ A;  4YON A;  4Z2M B;  3LJ3 A;  3PGE A;  3KVF B;  1P9D U;  4K7W A;  2B76 B;  4OZA A;  2NCN A;  4A20 A;  2YEP B;  3P7Z A;  3ECI A;  1U5E A;  2J53 A;  3NW8 A;  2Q5W D;  2MW5 A;  1E7U A;  2L0F A;  5IP4 D;  1TS4 A;  3U30 A;  2CAY A;  4IWQ A;  1ZM0 A;  2YRY A;  3ZIM A;  4II3 B;  5JHH A;  2WXN A;  3EHV A;  1V6E A;  2P8V A;  2WXG A;  1C4P A;  3GE8 C;  1DBH A;  5AUI A;  5D3X A;  1Y5O A;  5E6O A;  2M0A A;  2FJU B;  2X8X X;  3RN9 C;  3RT3 B;  1ESF A;  2IO1 B;  1WGG A;  3A98 B;  1UNR A;  1M4V A;  2Y8F A;  1T0R C;  1I7H A;  3Q3N C;  2NBW B;  1E8Z A;  1QOB A;  2DLW A;  4MSM B;  4OHJ A;  4FJV B;  4CO7 A;  1XX0 A;  4FHJ A;  2MBQ A;  4G0N B;  2A5U A;  4NJC A;  2EJ8 A;  3H7P B;  2LGI A;  3A4R A;  2COA A;  3VH3 B;  1EM7 A;  2MCN B;  3EFU A;  3SR6 A;  2KQ7 A;  1TJE A;  1MPE A;  2N0Y A;  4MT5 A;  2JQR B;  5IO9 A;  2K2U A;  4I6N B;  3L16 A;  2D3A A;  3EPY A;  2IBI B;  1CMX B;  3CMM B;  3AEB B;  4IM0 A;  3TCA A;  2ZZP B;  1TIF A;  2AQ3 B;  3JSV B;  3EUB 2;  4TMA B;  2HTM E;  1GUA B;  2KDE B;  4GGQ A;  2WXI A;  4LK0 M;  1WGH A;  2D9Y A;  2A4Z A;  1VZ7 A;  4GPT B;  4TYZ A;  2HTH B;  2G45 B;  1D4B A;  3N1Y C;  1RLF A;  3KYC D;  4NJ6 A;  4K3C A;  4PYZ A;  2LUL A;  1K5G B;  1KH0 A;  2PKO A;  1J7B A;  2PVG C;  1U29 A;  2INC C;  4XWT A;  3IHP C;  3HM6 X;  3RNG C;  1VR9 A;  4EKU A;  3DVN V;  4GSW A;  2CQU A;  2FCN A;  3UF8 A;  3NUH B;  2FJL A;  4ZRI A;  2KDB A;  2IYD B;  2OHF A;  4REZ A;  2R2Q A;  2MKR A;  2N9K A;  2WXM A;  1KLU D;  2Z0O A;  3B0A A;  4HEA 1;  5D2M B;  4YSX B;  2KDF B;  3BWU D;  4RH6 A;  1T0S C;  1YX6 B;  2MJ3 A;  4ANW A;  3IG3 A;  1WI0 A;  3FP5 A;  4XWW A;  3H7P A;  4KGR A;  3ML8 A;  3DHI C;  4S0R A;  2QJL A;  5AEK B;  1ZUD 2;  3PV1 A;  2JRI B;  4HSI A;  5BYQ A;  1GG3 A;  3C0R B;  1E7P B;  3KY9 A;  4US8 A;  2MFQ A;  4GMV A;  2BT6 A;  2BWF A;  4Q2J A;  4HJG E;  1WYG A;  2UZS A;  5IN7 A;  1V8C A;  4JKC A;  2ABD A;  3JSV A;  4UDU C;  3Q3M C;  5IAA C;  2MJD A;  4GXB A;  3JYU A;  2HTH A;  3Q8A A;  1VZ6 A;  4B95 A;  2ZCB A;  3P4R B;  1J8C A;  3B2F A;  1V81 A;  2I5F A;  2CHX A;  1TZ1 A;  4QAY A;  3N9Y C;  1X1G A;  2KTR B;  2IYB A;  3DQV A;  2D10 A;  2ASQ A;  4AUQ C;  3R7R A;  2GBM A;  1XLP A;  2ZPN A;  4G11 A;  4AQ7 A;  2D5G A;  2N1V A;  2WGS A;  1F2R C;  1BUI C;  1L7Y A;  4A6H A;  4QJ5 B;  4B6W A;  4E71 A;  1FEH A;  4LDT D;  1T6B X;  2YSZ A;  5HG2 A;  3BVG A;  1R4M B;  3IT6 B;  2G9H D;  4A3P A;  2K25 A;  2KOX A;  3NRZ A;  3OJ4 B;  2MWN B;  2RGN B;  2P0F A;  3TL5 A;  4IUM B;  2DYN A;  4GOU A;  2KDI A;  3VUX A;  2WDQ B;  2JVC A;  2WX0 A;  4ZYS A;  4WJ7 A;  5DPW A;  1DIK A;  1C3T A;  3T06 A;  1HQR D;  2LRU A;  4WVF B;  4IKG A;  1FXT B;  5BMI A;  3LYY A;  1VBG A;  1D3Z A;  4C0A A;  2DZJ A;  1UWX A;  2LVP A;  4P16 A;  4MY6 A;  5DCN A;  3BYY B;  4KIK B;  3EEC A;  2QIE B;  4XWX A;  5HE3 A;  1F1H A;  4AWJ A;  2VRW B;  3GOE A;  2KIE A;  1OY2 A;  3FM8 C;  1I4R A;  4MAC A;  2KTR A;  3D8F A;  5C6R A;  3TEY A;  2LUE A;  3SDL C;  3QAR A;  3KWL A;  3BVM A;  1ZDX A;  2D3B A;  5H8Y E;  2UVM A;  3PLV A;  1FIQ A;  2BB6 A;  4HPL B;  3QJZ A;  2UWQ A;  3PSE B;  4F7G A;  3RI7 C;  3KRX A;  4S17 A;  2GCJ A;  2N9L A;  2K39 A;  4WJN A;  2C7H A;  3A8Q A;  2GBK A;  3I63 C;  2INN E;  3B9J A;  5EE1 A;  2K8H A;  3GB1 A;  4W9C A;  4AOF A;  1IP9 A;  4ANV A;  1K53 A;  5FKA C;  2GS0 A;  1WXM A;  2W55 A;  2GLS A;  3U4E G;  3PS6 A;  2WXK A;  2LGS A;  2L32 A;  2MBH A;  2LAS A;  1JWS D;  2BYV E;  1IRS A;  1XCG A;  5GXG B;  2BS4 B;  2LHD A;  2Z13 A;  4AP4 C;  2HJ1 A;  1R7S A;  3TSS A;  1ZE3 D;  2RNR B;  1NI3 A;  2VRR B;  2J42 A;  3H1U A;  1WJ4 A;  1MHH E;  2ONQ A;  3L13 A;  2NZ8 B;  1XQQ A;  1ZDV A;  4RM8 A;  3P63 A;  1NEN B;  5BO4 B;  1H10 A;  3TEW A;  2AL3 A;  2Y5C A;  1I4Q A;  2MJE A;  2GBR A;  4KIK A;  4CQN A;  2IO2 B;  1BWN A;  1EF5 A;  2IND C;  3P4P B;  3AN1 A;  2JX5 A;  2QKM A;  3I5J C;  4IDI A;  1KLG D;  4F7U P;  3PHX B;  2ZNV C;  4K1R B;  3VTW A;  2L1C A;  3MFG A;  3VR8 B;  5IRS A;  1MK9 B;  1WGQ A;  4XZ4 A;  4M8M A;  1PFD A;  5L83 A;  4HAY B;  4KSL C;  1ZYI A;  2I1K A;  2R2O A;  5J2R A;  2OQB A;  1TT5 B;  1C77 A;  2DHK A;  4RFB A;  1KC7 A;  4P7I A;  1TZO A;  2N9P C;  3H9D A;  3HK0 A;  1E6E B;  1WI1 A;  4I6P A;  5BMH A;  1JW9 D;  1YQ3 B;  3PRM B;  5FR6 A;  3RCZ A;  2K00 A;  1MJD A;  3RNA C;  1ROE A;  1W1D A;  2COD A;  2K9X A;  3L54 A;  3UIP B;  2UZR A;  4BKS A;  1JQ4 A;  4LJP B;  3SBT A;  2KC2 A;  2K49 A;  1C78 A;  5GMV A;  1QF6 A;  2EMS A;  4MEM A;  1NDD A;  1M94 A;  2R2Y A;  3E66 A;  1GC7 A;  3NS1 A;  1V97 A;  2AL6 A;  2V4I B;  2QSD A;  5KHO A;  1XT9 B;  4JLC A;  3RYT A;  3PSC A;  2WNM A;  1TKG A;  3QCA A;  1VJK A;  3CST A;  2KGX B;  2JZZ A;  2ELB A;  3BZD B;  1GNU A;  2B3A A;  3TVV A;  2I38 A;  3D8E A;  2JZP A;  2MBE A;  2V0G A;  4Z2N A;  4ZHP A;  4WSF A;  2FCS A;  2L7R A;  2ICI A;  4OW0 A;  1I2H A;  1TY0 A;  2D9V A;  1ACA A;  1YX5 B;  4GLS C;  1QQR A;  1WR1 A;  2C7N B;  1J7A A;  5BMG A;  5LOP B;  2COC A;  4X57 B;  4F7H A;  2FIF A;  2Q13 A;  2W3S A;  1KF6 B;  2KJR A;  2PE9 A;  3RNC C;  3WAM A;  4IAP A;  1WG7 A;  1BTK A;  3L17 A;  3APD A;  3FVC A;  2DX5 B;  4USA A;  3R66 C;  2L52 A;  1EVH A;  1FGY A;  1PFJ A;  1MG8 A;  3MC0 B;  2HDE A;  1I4X A;  1KBL A;  2KDM A;  4MM3 B;  1SE9 A;  4DX8 A;  4ZRK A;  1VBH A;  4BBN C;  4C56 C;  4EOY A;  3ZNG C;  3HIZ A;  1WF9 A;  1QKZ A;  4PT5 A;  2FCQ A;  2VH1 A;  1EO6 A;  4FXC A;  3L08 A;  4B9K A;  1B1Z A;  4HDO A;  3BK1 A;  4E74 A;  1MPH A;  2R09 A;  2CRF A;  3P6A A;  1TTN A;  2I5C A;  4XDD A;  2RGF A;  4ILH A;  2D9X A;  3B77 A;  1V5O A;  1ZC4 B;  3A33 B;  4KAX B;  3BYT B;  1SGH A;  3Q6B A;  1OEY J;  4HPP A;  2CU1 A;  2E3T A;  2KWD A;  1QOF A;  2GMI C;  4MDK E;  4JK9 A;  2N4F A;  4W9D A;  1X05 A;  4EZK A;  4BKT A;  1NI2 A;  3NVY A;  4LCD E;  3SYX A;  3ZGZ A;  3KH0 A;  4RGO S;  4GOC A;  1MG4 A;  3MHZ A;  4BZA A;  4K7U A;  4YTM B;  2BYT A;  1K5D B;  4DQO C;  5DPS A;  3VAW A;  4G3X B;  3DBR I;  2LGY A;  2KWU B;  4HRS A;  1FCL A;  1FMA D;  1FGZ A;  3QHT A;  2DX5 A;  5DIF B;  3AB5 A;  4HB2 B;  3GZN B;  3MDB C;  1YQB A;  1JCK B;  3Q69 A;  2BWE S;  2IO0 B;  3VUW A;  1E5W A;  1S1Q B;  2IJ0 A;  4MM3 A;  4ZRP A;  4NZL B;  2M38 A;  3WAN A;  1EUV B;  1WFY A;  1SXT A;  3HUI A;  2LEK A;  5C1Z A;  3DBH B;  4KKI A;  3ZYY X;  1YN5 A;  3DBL B;  3O65 B;  1YD8 U;  1UBI A;  3LB8 C;  1I4H A;  4HXD A;  4WJO A;  1YJI A;  2UYZ B;  1GOZ A;  1DRO A;  3C19 A;  2X0S A;  3ZXV A;  1WGK A;  3ETR A;  5CLL B;  2MX2 A;  2PEA A;  1K51 A;  1KJT A;  1SB3 C;  4EE2 A;  1A5R A;  1DGJ A;  1ZOY B;  1RWS A;  4HAX B;  5G2N A;  2M14 A;  1TS3 A;  1VZ8 A;  3H8H A;  5IOI A;  2PW9 A;  5C3J B;  1PGB A;  3VRA B;  5CHW A;  1TQZ A;  2QCZ A;  3RZW C;  2D11 A;  1GB1 A;  3ZRC A;  1OFF A;  2ELA A;  1JWM D;  4ZYN A;  3JVZ X;  2H7E A;  1M7R A;  2LXC A;  1SSN A;  4NJ7 A;  5FI1 A;  4TQ1 A;  2JPH A;  1L0X B;  3DVG X;  5HHD G;  4RM9 A;  2CU3 A;  3EC8 A;  2WDV B;  4DHZ B;  4W9J A;  2WXR A;  5I2M A;  4OZB A;  2JRH A;  2JF5 A;  3I9V 1;  1FNW A;  1C79 A;  1N63 A;  1PQS A;  2RR9 A;  1TS2 A;  1P7F A;  1NVI D;  2AWT A;  2PLP A;  1LGR A;  2DYQ A;  1D6E C;  3O13 A;  3M62 B;  3ZNH B;  3A9K B;  4HB3 B;  3PVW A;  4BOZ B;  2Z0D B;  1XD4 A;  2D3C A;  1IPG A;  4WH4 A;  3VR9 B;  1J19 A;  4ICU A;  4ZHO A;  4L23 A;  4LDT B;  3L4P A;  2D2Q A;  2JP2 A;  4M0W B;  1FXI A;  5HFY A;  1SE3 A;  1MIZ B;  3Q8F A;  3DCG A;  1OMW A;  1GGO A;  3ZTC A;  1Y8R C;  1ZP0 B;  5E6J A;  1WM3 A;  2J4X A;  5JVL A;  1P98 A;  1XLO A;  2J0J A;  4D6W A;  5L95 C;  3B1L X;  3ZO5 B;  1YN3 A;  1UGM A;  1RRP B;  2KUQ A;  4F1S A;  4K2P A;  2H88 B;  4KHA A;  3UIO B;  1RAX A;  2DZM A;  3TUO A;  3N32 A;  3NHE B;  2JXT A;  3G9W A;  1K52 A;  2K22 A;  3NWA A;  1FOE A;  4MK0 A;  1VCB A;  2DKQ A;  1WJ6 A;  2N1W A;  5KCV A;  2GBJ A;  1DDV A;  1YIW A;  2KZR A;  4DBG A;  4KGT A;  1QIL A;  1HB6 A;  3IVF A;  4WQM A;  3A8P A;  2PPH A;  4JK8 A;  1Y56 A;  3DXE A;  4CYE A;  4RCO A;  4L1R A;  2KVR A;  2KD0 A;  3KQ4 A;  1S3S G;  3AEG B;  4NY0 A;  3ML4 A;  2DA0 A;  3UIN B;  4MEL A;  2J7Q B;  3A9K A;  3QC8 B;  1ET9 A;  1OEY A;  2G4D B;  4LJO B;  1N5X A;  3GP7 A;  4HJK A;  3SU8 X;  1ENF A;  3C8Y A;  2DYO A;  1K8R B;  3W5V B;  4A6F B;  5FR3 A;  2COP A;  5DHF B;  1U5F A;  5D3D A;  3N1Z C;  4M0W A;  1QLB B;  3PVU A;  2BBC A;  3P4Q B;  4PS3 A;  5EE3 A;  4NQK E;  5LXI B;  2LJI A;  3H7S A;  4NPN A;  1CZP A;  1I4P A;  2KIG A;  5L81 A;  1HZ6 A;  1VRA B;  1ZPS A;  2BKF A;  4N59 A;  3SUZ A;  3E9O A;  4DBB A;  4LNF A;  2RDB C;  5J18 A;  3QA8 A;  1KFY B;  3I57 A;  1FRD A;  4YTP B;  4FAD A;  1AWE A;  4FJY A;  1X86 A;  2LFI A;  3GYO A;  2NPT B;  1T0Q C;  4KZ0 A;  4BVU C;  1P3R A;  4DIX A;  2X18 A;  1V9J A;  2DN6 A;  3NY5 A;  3DCX A;  3CSF A;  2ZVN A;  3APC A;  2K8B A;  2WU2 B;  1DDW A;  1C1Y B;  3VHT C;  3QK0 A;  1Q5W B;  2NVU I;  3KUZ A;  4PNK A;  2LRW A;  4HCN B;  5HKH A;  5E6N A;  1N60 A;  3TMP B;  2WU5 B;  1WIA A;  3CXB B;  3B2G A;  2J0M A;  2M56 B;  2N23 A;  2NBV B;  3NZ3 A;  4JKB A;  2BQQ A;  1UEF A;  4MSQ B;  1D5Z C;  2OTX A;  2DIK A;  4W9G A;  1SJE D;  1F0Z A;  1C4C A;  1FB8 A;  1PYW D;  5C5B B;  1WXA A;  1U4A A;  4A8X C;  4A6F A;  3PLU A;  3WIM A;  2VKI A;  2WLB A;  1KLV A;  4FJZ A;  3DHH C;  4HAT B;  1MHX A;  3W5U B;  4ANU A;  2KVZ A;  3ZKJ C;  4MGY E;  2QIL A;  4M8N A;  1WYW B;  4NQL B;  3R2I A;  1WJN A;  2RDG A;  4GU2 A;  3PHW B;  2MSE D;  4MGK E;  2JT4 B;  1KTK A;  3PG7 A;  2L3Z A;  1TKE A;  2NMB A;  1YNT E;  2ZJD A;  2IFS A;  1LQB A;  2LHE A;  4A6Q A;  3AE1 B;  1V5T A;  3T3O A;  2NPT A;  4LLG M;  2ZVO A;  2J52 A;  4B6H A;  2V3N A;  3LXF A;  5CHF A;  2D4Q A;  2WYQ A;  4JKF A;  2C5L C;  1LXD A;  5LG4 B;  1EWY C;  3M3J A;  5IKC M;  1YQ4 B;  1SHC A;  1AW7 A;  4YL8 A;  2GCL A;  2YS1 A;  1DYQ A;  3DPD A;  3UZT A;  2RRF A;  3ML9 A;  2MLB A;  2FAZ A;  2KMM A;  3PZ8 A;  1RYJ A;  2NBV A;  3OLM D;  2Y5B B;  4QJ3 B;  2NTT A;  2C7M B;  4HHV A;  3ZXR A;  1WJ1 A;  5T8I A;  3NWF A;  1STE A;  4K7S A;  2LZ6 A;  3ZDT A;  3U7D A;  3PVL A;  4DDG D;  5C5B A;  2PMV A;  1WVH A;  1E8X A;  4QJ4 B;  1OQY A;  3A9J B;  2LVQ A;  1WJM A;  3TW1 A;  3B08 A;  1MI0 A;  1NEK B;  4L2Y A;  3M1I B;  3KUC B;  4OVZ A;  1I7A A;  4K81 A;  3ZVR A;  2FNJ B;  2W54 A;  2GBN A;  1M7E A;  4DWF A;  3E9L A;  3PO0 A;  4KHO A;  2CJN A;  4N6E B;  2ZW1 A;  3K9P B;  2KAC A;  2N7J A;  3V05 A;  2O6V D;  2BKR B;  3SV1 A;  3U2S C;  4OT1 A;  1HXY D;  2M0X A;  4KSK C;  5IJM A;  4PS8 A;  4YTN B;  2XQN M;  1G6J A;  2NR2 A;  2IGH A;  4W9E A;  3MJW A;  3Q8C A;  4A3O A;  3DDC B;  1V5P A;  3AED B;  1DOX A;  2YT2 A;  1A70 A;  1FM0 D;  2LJ5 A;  2TSS A;  2VH2 A;  1FNU A;  3PRP B;  5D3W A;  4CHM A;  5J3T A;  3DVN U;  3N1X C;  3PEG A;  3QX1 A;  1HTQ A;  2YF0 A;  1OQN A;  1UNQ A;  4OZC A;  1MK7 B;  1HEZ E;  1QOG A;  1JRP A;  1C76 A;  1Q10 A;  1LM8 B;  2L2I A;  2VSZ A;  1WRI A;  1LW3 A;  2N0S B;  4DK5 A;  3ALB A;  2RSG A;  2FJ9 A;  1UNS A;  1WMH B;  2ZEQ A;  3AV8 A;  3N30 A;  4HWI B;  2C9W B;  1L6V A;  2HD5 B;  5C2T B;  3MHS D;  4PQ0 A;  2BF8 B;  4KHB B;  3GYP A;  2ROV A;  2Y7B A;  3A9J A;  2QMT A;  2WX1 A;  3DWG C;  4ARC A;  4N9F 4;  4PS7 A;  2GI9 A;  1EGX A;  2Y3A A;  4W9L A;  4XGA B;  2ROZ B;  1N5W A;  1LO5 D;  1V80 A;  1TY2 A;  1V2Y A;  2KJH B;  2NBU A;  1H8C A;  4LNN A;  1F2R I;  2RVB B;  3AE6 B;  3AU4 A;  2GUM A;  1HE8 A;  3OWE B;  1UD7 A;  3BY4 B;  2MP2 B;  1NTI A;  4URK A;  3RCP A;  2MHJ A;  3RPF C;  2DWQ A;  1MIX A;  4B0M A;  1AQC A;  1KZG A;  1V88 A;  1Q1O A;  3A4S C;  2XBB C;  3M95 A;  4KDI C;  2MH7 A;  2PVO D;  1U5D A;  1KZ7 A;  5GOW B;  4US9 A;  4XX5 A;  4BBK A;  2L00 B;  2QDF A;  1XD3 B;  1V1O A;  2NMQ A;  2Y5P A;  3ODO A;  2ZCC A;  2SAK A;  1T77 A;  1WMH A;  4L6E A;  2IY1 B;  2ZW0 A;  5G5G A;  5FK9 C;  2XEW A;  3KSY A;  2JSV X;  1FFV A;  1FHW A;  2FID A;  3P42 A;  4KHB A;  1OQQ A;  4JWU C;  2BYE A;  2KFK B;  3ODW A;  2DYB A;  1UNP A;  3W1S C;  2BPS A;  4D2K A;  1D5X C;  1KRH A;  4ITK A;  2W3R A;  5MPO A;  4IM2 A;  5BYR A;  3VIA A;  1WGU A;  2KXJ A;  2KYW A;  3KZ1 A;  5IA7 A;  3NZS A;  1FD6 A;  5EE9 A;  2KX0 A;  1YOV B;  4NNJ B;  3ODX A;  5EE0 A;  2R82 A;  5HE2 A;  2W2X D;  1EWC A;  3M63 B;  2AX5 A;  4GIV A;  4RF1 A;  2KN5 A;  3LDZ E;  1FCC C;  1W1G A;  1X1M A;  1U2B A;  1JWA D;  3ZRF A;  4W9F A;  2DKP A;  2QKL A;  3HRD D;  4KGS A;  3ZTD A;  4AJW A;  4LNO A;  2DZK A;  3EFC A;  1NU2 A;  1PGX A;  2JXX A;  5I2S A;  4ASW C;  3RNF C;  3NS8 A;  1XLQ A;  2KKC A;  2YS3 A;  2VZK B;  3EGR A;  1X1F A;  3HVD A;  1QZE A;  3FLV A;  4JK7 A;  4HVB A;  1T5X D;  4BOS C;  2DTC A;  3NJT A;  3QQ8 B;  2FBW B;  3P2B A;  2Y8G A;  1KOT A;  4K3B A;  5DHA B;  4TUU A;  4JKG B;  1SJH D;  3MC8 A;  4L1B A;  5DI9 B;  1BT0 A;  3ZLZ A;  4M00 A;  2KFK A;  1VDV A;  1R4N B;  3HQC A;  1T3Q A;  3H6N A;  2FUH B;  1V1P B;  3BII D;  3VUY A;  2MA9 B;  1X11 A;  3QBV B;  5EFX A;  1FNV A;  2L0T A;  3GZN I;  2IDY A;  2LOX A;  4N58 A;  3ULC A;  1SE4 A;  1UBQ A;  2Z59 B;  2D07 B;  4EFO A;  2JYE A;  1JRO A;  4KKJ A;  3VOQ A;  4FHK A;  2XK5 B;  1V5U A;  1XF5 L;  2Z0P A;  3DBL I;  4WAA A;  2CHW A;  3AE8 B;  2Z0Q A;  3LJU X;  2EMT A;  1U27 A;  3AUL A;  1V86 A;  2WDR B;  2FCM A;  2JUO A;  3APF A;  3T8M A;  3VFK A;  3HVZ A;  4CHJ A;  3P1M A;  4FN2 A;  1AYF A;  3IBE A;  4RGM A;  4P1C C;  1BTN A;  1L0V B;  1TJ6 A;  5E6P A;  3NSU A;  2I2Y A;  3OJ3 A;  4IFS A;  2WH5 A;  3IT4 B;  2AEH A;  3ZQ4 A;  1FRR A;  4EEW A;  4J3O D;  4O1N A;  3BVZ A;  3A58 A;  5DPT A;  2CY4 A;  3SFD B;  1UWM A;  3WAP A;  3BIN A;  3IAM 1;  3NVZ A;  2UU7 A;  2HE7 A;  3ZW3 A;  3ZJV A;  4F7Z A;  2LG1 A;  1JML A;  1KM7 A;  2BW2 A;  3J9C A;  3ZDM C;  4JKG A;  5JHA A;  5G5H A;  2DHI A;  2KQ4 X;  1GAQ B;  4NAM A;  4YSY B;  4C80 A;  2Z8L A;  2DZI A;  3IAS 1;  1V1P A;  4RMA A;  4RNA A;  4KV2 A;  4HDQ A;  3D8D A;  1JRU A;  1ISN A;  1WR6 E;  2JY6 A;  1B9R A;  1XR0 B;  3HM3 A;  3CIR B;  2N7D A;  2Z59 A;  4WQO B;  3E56 A;  2FE8 A;  3IXS A;  2DNF A;  3VVW B;  1FXA A;  2XK5 A;  2YVC A;  4EZJ A;  1DDM A;  5C79 A;  3UQA A;  2D9W A;  3AU5 A;  4II2 B;  1UF0 A;  2GRI A;  1Z87 A;  1WX7 A;  1OTR B;  2JWZ A;  2OJW A;  1L2N A;  2FUG 1;  4MT7 A;  2IGG A;  1JWU D;  1YJJ A;  1YN4 A;  3FIL B;  2KK8 A;  1H4R A;  2BCJ A;  2LWP A;  4JKH A;  1OQR A;  1UZX B;  3FAH A;  3W2D A;  3NZU A;  5G55 A;  3D32 A;  2PTL A;  1ZXI A;  1WY8 A;  1P7E A;  3T9L A;  4A5K A;  4A9A A;  3AE2 B;  3KUD B;  1Q67 A;  4EUT A;  2WWZ A;  2VZK D;  3V6E B;  3Q14 C;  1K50 A;  2LKO A;  3U12 A;  3AH7 A;  1N6Z A;  2YT1 A;  2CHZ A;  1CJE A;  3UQB A;  4DXA B;  2Z0E B;  2N9X A;  2K0P A;  2RQ1 A;  4HAZ B;  2E2X A;  3MJ5 A;  1WSP A;  2HRJ A;  4HB4 B;  1WGD A;  4IWP A;  3ZNZ B;  2PJH A;  2NTS A;  2QEJ C;  4LNK A;  4OSN A;  1ZC3 B;  3PZD A;  3TEX A;  3AEE B;  1NTY A;  2P0H A;  1D5M C;  2DX1 A;  2W2X C;  3DOW A;  1PLS A;  2LMC A;  4P6V F;  4XDC A;  1TGZ B;  4YSZ B;  5C16 A;  3W1S A;  5KQ4 A;  3ENE A;  4GMX B;  3VH4 B;  1AAR A;  3DXC A;  2L83 A;  4PK1 A;  5HI1 A;  3UGB B;  4JL9 A;  1UEL A;  1HZ5 A;  3AEA B;  3FIL A;  4ZDV A;  2G35 A;  2V1Y A;  4HK2 A;  1QOA A;  1GC6 A;  3CWI A;  2O6V B;  1BML C;  1T0Y A;  4RGT A;  2WXP A;  1UUP A;  3VDZ A;  3ULB A;  1WH3 A;  2LGX A;  2WDT B;  3MP9 A;  4GZU A;  2W2W A;  2K6D B;  3Q3O C;  3VQI A;  2X38 A;  4NSW A;  4HPM B;  1SIJ A;  1SBB B;  2ACZ B;  2R61 A;  4JQW C;  2JWU A;  5C23 A;  2REX A;  4WJQ A;  3ZUN A;  2LXA A;  3KWV A;  1FAO A;  2L76 A;  3A1Q B;  3NVV A;  1L0Y B;  1SF0 A;  1VLB A;  1XLN A;  1P1A A;  1YMH E;  5AZF A;  3N20 C;  3TFM A;  3V6C B;  4IOI E;  4TV3 A;  3FEH A;  3FC4 A;  1UPR A;  2LVO A;  5DPR A;  1WXQ A;  3RUI B;  1UH6 A;  2DYM A;  1IBX B;  2K1F A;  2IO3 B;  4DX9 0;  2WQY B;  3AE3 B;  2PIA A;  3U52 E;  4WWP A;  4AJY B;  2MBB B;  1LB1 A;  3V62 A;  1I4G A;  3QIJ A;  1ZVR A;  1JDE A;  3GS2 A;  3RMK C;  1BAK A;  2LD9 A;  4WWM A;  1NYR A;  4A55 A;  1MAI A;  3TO1 A;  1J0W A;  3PTF C;  1WX8 A;  2OJR A;  3MPX A;  3PZ7 A;  2RD0 A;  4OVV A;  4A6K A;  3MC9 A;  4GN1 A;  2XN9 C;  1L4Z B;  2WXO A;  4JX1 C;  4NAW B;  3R8B A;  1TXD A;  3RD2 A;  2J0K A;  1E8W A;  3AXC A;  5D7G A;  1WE6 A;  1U5G A;  4YT0 B;  5AZG A;  3X0W A;  2IPK D;  4YWG G;  4K17 A;  1RRB A;  1PMS A;  5JH5 C;  1HA5 A;  2O6V A;  4JWS C;  2KUP A;  4DHJ B;  4WWO A;  1R4M I;  4GB9 A;  3HHM A;  2KFJ A;  4PYU A;  1I42 A;  2M19 A;  1WXS A;  2LGD A;  2XNA C;  4HKQ A;  1TBE A;  2G1E A;  3HIE A;  1RFK A;  5D3V A;  2ON8 A;  3SHQ A;  3K9O B;  2BGF A;  1XEE A;  1ST7 A;  2KWC A;  4OVU A;  3RZF A;  2WXH A;  3A1Q A;  3R7Q A;  4ICV A;  2BTE A;  1OGW A;  2MBO A;  1WRD B;  4RGN A;  4AS1 A;  4D0N B;  2ZPY A;  3KRW A;  5D94 A;  2EKI A;  1BXT A;  4H2A A;  4J6I A;  1WGR A;  3N3K B;  3KYD D;  1Q0W B;  4RF0 A;  1IBX A;  3KW5 B;  2CJO A;  4W9K A;  5D6J B;  4ILJ A;  2V9H A;  3SD5 A;  1Z2M A;  1ZGU B;  4XE0 A;  2DFK A;  4W9H A;  1N61 A;  1WGY A;  1W1H A;  2KCJ A;  3TIX A;  3WCQ A;  4M02 A;  2AQ1 B;  4FA6 A;  1WJU A;  1P5T A;  2WXJ A;  4EJN A;  1VD2 A;  1ZKH A;  4JKE A;  2KLC A;  1HB8 A;  4ZRJ A;  3DBS A;  4HCP B;  2L05 A;  3V3X A;  3O96 A;  4NAW A;  1FHO A;  3NVW A;  1C4A A;  1E7V A;  5CLQ B;  5HE1 A;  2DHJ A;  2YEP F;  2CKH B;  4IC7 B;  5HE0 A;  5JXV A;  5I4D A;  3VTU A;  1ZSQ A;  5EDS A;  2GB1 A;  3FKY A;  5LNK 1;  2W9N A;  4KVG B; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  2V3S A;  4MH0 E;  1V49 A;  3AJ4 A;  1ZW7 A;  2P0D A;  2RLO A;  5CTR C;  3Q3J A;  4GDK B;  5DH9 B;  3V5W A;  2KNB A;  3QWZ B;  3JW0 X;  1NVL A;  4BBN F;  2YLM A;  1WX9 A;  1E90 A;  4F8C B;  2EKE C;  3V61 A;  1NBF C;  5J3Q A;  4FLH A;  2KMA A;  3ZVV A;  1SIF A;  2J59 M;  2GJY A;  4HAV B;  2C60 A;  4GDL B;  4WWN A;  2HJ8 A;  3X23 A;  2IZV B;  2KO3 A;  2RUK B;  2KJ6 A;  3MTN B;  5JLJ B;  2CR5 A;  4HAW B;  2KQS A;  1E8Y A;  3PP2 A;  4CHK A;  4JIO U;  3W1Y A;  2K8C A;  3CIK A;  4ANX A;  2R0D A;  3Q3F A;  3SO6 A;  2V76 A;  5CHV C;  2FDQ A;  2BYF A;  4IG7 B;  1NTV A;  4EZL A;  4DHJ D;  2KWV B;  5J17 A;  4GDK A;  2KAN A;  1F9J A;  1P3Q U;  2LYD A;  2V4L A;  4HLE A;  3L0W B;  3PPA A;  2M8S A;  4IOY X;  2H7D A;  2M1M A;  4TQ0 A;  3ONS A;  5LLI A;  4IM3 A;  4FUL A;  5LON B;  3E9P A;  3PT2 B;  4MGZ E;  1QQG A;  2M4N A;  2LBB A;  4BKG A;  1J0G A;  3FSS A;  3VTV A;  4G50 A;  1P6S A;  4GDL A;  2KX3 A;  3RUL A;  5J3Y A;  3WYF B;  2KTF A;  2NS5 A;  3TBL D;  3HW2 B;  1B55 A;  1WXV A;  5CX3 A;  5KHQ A;  2YT0 A;  3WAO A;  2EC1 A;  1EAZ A;  2CY5 A;  4HAU B;  2N7E A;  1EF1 A;  3TJP A;  1V89 A;  3PRZ A;  5TR5 A;  4IWO A;  2G3Q B;  2OOB B;  3QWM A;  2M17 A;  5D27 A;  2QHO A;  3QAQ A;  3F0W A;  2MP2 A;  4I6L B;  5KQ1 A;  4ILG B;  1P0R A;  2AYO B;  4IW0 A;  4FBJ B;  1Y19 B;  4XC2 A;  2DAF A;  3N7C A;  3AI5 A;  1R4N I;  2L8J A;  2DHZ A;  3SNH A;  2COF A;  5JP4 A;  4E3C A;  4K2O A;  4WJP A;  4BKS D;  2K2J A;  1WE7 A;  1N3H A;  3SBG A;  3IFW B;  3OAW A;  1FHX A;  3R3M A;  4JGH B;  3DXD A;  3NOB A;  3S2A A;  2CB8 A;  2D3G A;  4DHZ E;  3PRE A;  2YS5 A;  4MJS B;  4H8S A;  3DBH I;  5AZH A;  3ENB A;  1V5M A;  3F5R A;  1KI1 B;  1XKE A;  3BJI A;  3ZNI D;  3WA0 A;  1MKE A;  2MQJ A;  2KC1 A;  2O2V B;  2I1J A;  2KMC A;  1YJ1 A;  2PE6 B;  4EMO A;  3V60 A;  2DAJ A;  1UPQ A;  4Y94 A;  2DEN B;  4KDL B;  3WAL A;  2LOZ A;  2ZNV B;  1LFD A;  2LI5 A;  1GJZ A;  5JHG A;  3CF6 E;  2MDX A;  3VXW A;  1Z5S B;  1RJ2 A;  1RFA A;  5D3Y A;  4TKN A;  3I3T B;  1HBK A;  4HB0 B;  2CS4 A;  1V61 A;  2MWS B;  2JZ3 B;  3DVG Y;  2MRP A;  2KHW B;  5FI0 A;  4KZC A;  4W9I A;  2GOW A;  4BFR A;  2D9Z A;  1WZ3 A;  4DDI D;  2KLG A;  2K6Q A;  1IYF A;  2G4S A;  2N9E B;  2RPQ A;  1DYN A;  1XOD A;  2IY0 B;  5JZE B;  5LXH A;  1WM2 A;  4MJS A;  4JKD A;  3U8Z A;  1WZ0 A;  1I35 A;  5JHB A;  1QC6 A;  4MGI E;  2O2V A;  3L10 B;  4JKA A;  3OAN A;  2RSU A;  2ADZ A;  4YON A;  4Z2M B;  3LJ3 A;  3PGE A;  3KVF B;  1P9D U;  4K7W A;  2NCN A;  4A20 A;  3P7Z A;  3ECI A;  1U5E A;  2MW5 A;  1E7U A;  2L0F A;  3U30 A;  2CAY A;  4IWQ A;  1ZM0 A;  2YRY A;  3ZIM A;  4II3 B;  5JHH A;  3EHV A;  1V6E A;  2P8V A;  1DBH A;  5D3X A;  1Y5O A;  5E6O A;  3RT3 B;  2IO1 B;  1WGG A;  3A98 B;  1UNR A;  2Y8F A;  2NBW B;  1E8Z A;  2DLW A;  4MSM B;  4FJV B;  4CO7 A;  1XX0 A;  4FHJ A;  2MBQ A;  4G0N B;  2A5U A;  2EJ8 A;  3H7P B;  3A4R A;  2COA A;  3VH3 B;  2MCN B;  3EFU A;  2KQ7 A;  2N0Y A;  2K2U A;  4I6N B;  3L16 A;  3EPY A;  2IBI B;  1CMX B;  3CMM B;  4IM0 A;  3TCA A;  2ZZP B;  3JSV B;  1GUA B;  2KDE B;  4GGQ A;  1WGH A;  2D9Y A;  2A4Z A;  4GPT B;  4TYZ A;  2HTH B;  2G45 B;  1RLF A;  3KYC D;  4NJ6 A;  4PYZ A;  2LUL A;  1K5G B;  1U29 A;  3IHP C;  3HM6 X;  4EKU A;  3DVN V;  4GSW A;  2CQU A;  2FCN A;  3UF8 A;  2FJL A;  4ZRI A;  2KDB A;  2IYD B;  2R2Q A;  2MKR A;  2Z0O A;  3B0A A;  5D2M B;  2KDF B;  1YX6 B;  4ANW A;  3IG3 A;  1WI0 A;  3FP5 A;  3H7P A;  3ML8 A;  5AEK B;  3PV1 A;  2JRI B;  1GG3 A;  3C0R B;  3KY9 A;  2MFQ A;  4GMV A;  2BWF A;  2UZS A;  4JKC A;  2ABD A;  3JSV A;  5IAA C;  4GXB A;  3JYU A;  2HTH A;  4B95 A;  2ZCB A;  1J8C A;  1V81 A;  2I5F A;  2CHX A;  1TZ1 A;  1X1G A;  2KTR B;  2IYB A;  3DQV A;  2D10 A;  2ASQ A;  4AUQ C;  3R7R A;  2GBM A;  2ZPN A;  4G11 A;  2N1V A;  1L7Y A;  4A6H A;  4B6W A;  4E71 A;  4LDT D;  2YSZ A;  4A3P A;  2K25 A;  2KOX A;  3OJ4 B;  2MWN B;  2RGN B;  2P0F A;  3TL5 A;  4IUM B;  2DYN A;  2KDI A;  3VUX A;  2JVC A;  2WX0 A;  4WJ7 A;  5DPW A;  1DIK A;  1C3T A;  3T06 A;  2LRU A;  4WVF B;  1FXT B;  1VBG A;  1D3Z A;  4C0A A;  2DZJ A;  2LVP A;  4MY6 A;  5DCN A;  4KIK B;  3EEC A;  4XWX A;  5HE3 A;  4AWJ A;  2VRW B;  3GOE A;  1OY2 A;  3FM8 C;  2KTR A;  3D8F A;  5C6R A;  2LUE A;  3SDL C;  3QAR A;  2UVM A;  3PLV A;  4HPL B;  3QJZ A;  2UWQ A;  3PSE B;  4F7G A;  3KRX A;  2GCJ A;  2K39 A;  4WJN A;  2C7H A;  3A8Q A;  2GBK A;  2K8H A;  4W9C A;  4AOF A;  1IP9 A;  4ANV A;  2GS0 A;  1WXM A;  3PS6 A;  2MBH A;  2LAS A;  2BYV E;  1IRS A;  1XCG A;  4AP4 C;  2RNR B;  2VRR B;  3H1U A;  1WJ4 A;  3L13 A;  2NZ8 B;  1XQQ A;  4RM8 A;  5BO4 B;  1H10 A;  2AL3 A;  2GBR A;  4KIK A;  2IO2 B;  1BWN A;  1EF5 A;  2QKM A;  3PHX B;  4F7U P;  2ZNV C;  4K1R B;  3VTW A;  2L1C A;  1MK9 B;  1WGQ A;  4XZ4 A;  4M8M A;  5L83 A;  4HAY B;  4KSL C;  2I1K A;  2R2O A;  5J2R A;  2OQB A;  2DHK A;  1KC7 A;  4P7I A;  2N9P C;  3H9D A;  3HK0 A;  1WI1 A;  4I6P A;  3PRM B;  5FR6 A;  3RCZ A;  2K00 A;  1W1D A;  2COD A;  3L54 A;  3UIP B;  2UZR A;  4BKS A;  4LJP B;  3SBT A;  2KC2 A;  5GMV A;  2EMS A;  4MEM A;  1NDD A;  1M94 A;  3E66 A;  1GC7 A;  2AL6 A;  5KHO A;  1XT9 B;  4JLC A;  3RYT A;  3PSC A;  3QCA A;  3CST A;  2KGX B;  2JZZ A;  2ELB A;  1GNU A;  2B3A A;  3TVV A;  3D8E A;  2MBE A;  4Z2N A;  4WSF A;  2FCS A;  2L7R A;  1I2H A;  2D9V A;  1ACA A;  1YX5 B;  1WR1 A;  2C7N B;  5LOP B;  2COC A;  4X57 B;  4F7H A;  2FIF A;  2Q13 A;  2KJR A;  2PE9 A;  3WAM A;  4IAP A;  1WG7 A;  1BTK A;  3L17 A;  3APD A;  2DX5 B;  3R66 C;  1EVH A;  1FGY A;  1PFJ A;  1MG8 A;  1KBL A;  1SE9 A;  4DX8 A;  4ZRK A;  1VBH A;  4BBN C;  4EOY A;  3ZNG C;  3HIZ A;  1WF9 A;  2FCQ A;  1EO6 A;  3L08 A;  4B9K A;  4HDO A;  4E74 A;  1MPH A;  2R09 A;  2CRF A;  3P6A A;  1TTN A;  2I5C A;  2RGF A;  4ILH A;  2D9X A;  1V5O A;  1ZC4 B;  3A33 B;  4KAX B;  1SGH A;  1OEY J;  2CU1 A;  4MDK E;  2GMI C;  4JK9 A;  2N4F A;  4W9D A;  1X05 A;  4EZK A;  4BKT A;  1NI2 A;  4LCD E;  3SYX A;  3KH0 A;  4GOC A;  4K7U A;  1K5D B;  5DPS A;  3VAW A;  4G3X B;  3DBR I;  2LGY A;  2KWU B;  1FGZ A;  3QHT A;  2DX5 A;  5DIF B;  4HB2 B;  3MDB C;  1YQB A;  2BWE S;  2IO0 B;  3VUW A;  1E5W A;  1S1Q B;  4MM3 A;  2M38 A;  3WAN A;  1EUV B;  1WFY A;  5C1Z A;  3O65 B;  1YD8 U;  1UBI A;  4WJO A;  4HXD A;  2UYZ B;  1DRO A;  2X0S A;  5CLL B;  2MX2 A;  2PEA A;  1KJT A;  1A5R A;  4HAX B;  5G2N A;  2M14 A;  5CHW A;  1TQZ A;  3RZW C;  2D11 A;  3ZRC A;  2ELA A;  4ZYN A;  3JVZ X;  2H7E A;  1M7R A;  2LXC A;  4NJ7 A;  5FI1 A;  4TQ1 A;  2JPH A;  3DVG X;  4RM9 A;  3EC8 A;  4DHZ B;  4W9J A;  2JRH A;  2JF5 A;  1PQS A;  2RR9 A;  2AWT A;  2DYQ A;  3M62 B;  3ZNH B;  3A9K B;  4HB3 B;  3PVW A;  4BOZ B;  2Z0D B;  1XD4 A;  1IPG A;  1J19 A;  4ICU A;  4LDT B;  2D2Q A;  2JP2 A;  4M0W B;  1MIZ B;  3DCG A;  1OMW A;  1GGO A;  3ZTC A;  1Y8R C;  1WM3 A;  5JVL A;  1P98 A;  2J0J A;  5L95 C;  3B1L X;  3ZO5 B;  1UGM A;  1RRP B;  4F1S A;  4K2P A;  4KHA A;  3UIO B;  1RAX A;  2DZM A;  3N32 A;  3NHE B;  3G9W A;  1FOE A;  4MK0 A;  1VCB A;  2DKQ A;  1WJ6 A;  2N1W A;  5KCV A;  2GBJ A;  1DDV A;  1YIW A;  2KZR A;  4DBG A;  1HB6 A;  3IVF A;  3A8P A;  2PPH A;  4JK8 A;  3DXE A;  4CYE A;  2KVR A;  2KD0 A;  1S3S G;  4NY0 A;  3ML4 A;  2DA0 A;  3UIN B;  4MEL A;  2J7Q B;  3A9K A;  3QC8 B;  1OEY A;  2G4D B;  4LJO B;  4HJK A;  3SU8 X;  2DYO A;  1K8R B;  4A6F B;  2COP A;  5DHF B;  1U5F A;  3PVU A;  4PS3 A;  4NQK E;  5LXI B;  3H7S A;  4NPN A;  5L81 A;  2BKF A;  3SUZ A;  3E9O A;  4DBB A;  5J18 A;  3QA8 A;  4FAD A;  1AWE A;  4FJY A;  1X86 A;  3GYO A;  2NPT B;  4KZ0 A;  4BVU C;  1P3R A;  2X18 A;  1V9J A;  2DN6 A;  3NY5 A;  3CSF A;  2ZVN A;  3APC A;  2K8B A;  1DDW A;  1C1Y B;  3VHT C;  3QK0 A;  1Q5W B;  2NVU I;  3KUZ A;  4PNK A;  2LRW A;  4HCN B;  5HKH A;  5E6N A;  3TMP B;  1WIA A;  3CXB B;  2J0M A;  2N23 A;  2NBV B;  4JKB A;  1UEF A;  4MSQ B;  2OTX A;  2DIK A;  4W9G A;  1FB8 A;  5C5B B;  1WXA A;  1U4A A;  4A6F A;  3PLU A;  3WIM A;  2VKI A;  1KLV A;  4FJZ A;  4HAT B;  4ANU A;  3ZKJ C;  4MGY E;  4M8N A;  1WYW B;  4NQL B;  1WJN A;  4GU2 A;  3PHW B;  2MSE D;  4MGK E;  2JT4 B;  3PG7 A;  2L3Z A;  2NMB A;  2ZJD A;  2IFS A;  1LQB A;  1V5T A;  2NPT A;  2ZVO A;  4B6H A;  5CHF A;  2D4Q A;  2WYQ A;  4JKF A;  2C5L C;  1LXD A;  3M3J A;  1SHC A;  4YL8 A;  2GCL A;  2YS1 A;  3DPD A;  3UZT A;  3ML9 A;  2MLB A;  2FAZ A;  3OLM D;  2Y5B B;  2C7M B;  4HHV A;  1WJ1 A;  4K7S A;  2LZ6 A;  3ZDT A;  3U7D A;  3PVL A;  4DDG D;  5C5B A;  1WVH A;  1E8X A;  1OQY A;  3A9J B;  2LVQ A;  1WJM A;  3TW1 A;  3B08 A;  3M1I B;  3KUC B;  1I7A A;  4K81 A;  3ZVR A;  2FNJ B;  2GBN A;  1M7E A;  4DWF A;  3E9L A;  4KHO A;  3K9P B;  2O6V D;  2BKR B;  3SV1 A;  2M0X A;  4KSK C;  5IJM A;  4PS8 A;  2XQN M;  1G6J A;  2NR2 A;  4W9E A;  3MJW A;  4A3O A;  3DDC B;  1V5P A;  2LJ5 A;  3PRP B;  5D3W A;  4CHM A;  5J3T A;  3DVN U;  3PEG A;  3QX1 A;  2YF0 A;  1OQN A;  1UNQ A;  1MK7 B;  1LM8 B;  2L2I A;  2VSZ A;  1LW3 A;  4DK5 A;  3ALB A;  2RSG A;  2FJ9 A;  1WMH B;  2ZEQ A;  3N30 A;  4HWI B;  2C9W B;  2HD5 B;  3MHS D;  4PQ0 A;  2BF8 B;  4KHB B;  3GYP A;  2ROV A;  2Y7B A;  3A9J A;  2WX1 A;  4N9F 4;  4PS7 A;  1EGX A;  4W9L A;  2ROZ B;  1V80 A;  1V2Y A;  2KJH B;  2NBU A;  1H8C A;  2RVB B;  3AU4 A;  1HE8 A;  1UD7 A;  3BY4 B;  2MP2 B;  1NTI A;  4URK A;  3RCP A;  1MIX A;  1AQC A;  1KZG A;  1V88 A;  1Q1O A;  3A4S C;  2XBB C;  3M95 A;  4KDI C;  1U5D A;  1KZ7 A;  5GOW B;  4XX5 A;  4BBK A;  2L00 B;  1XD3 B;  3ODO A;  2ZCC A;  1WMH A;  4L6E A;  2IY1 B;  2XEW A;  3KSY A;  1FHW A;  2FID A;  2BYE A;  2KFK B;  3ODW A;  2DYB A;  1UNP A;  3W1S C;  2BPS A;  4IM2 A;  3VIA A;  1WGU A;  2KXJ A;  5IA7 A;  3KZ1 A;  3NZS A;  2KX0 A;  4NNJ B;  3ODX A;  2R82 A;  5HE2 A;  2W2X D;  3M63 B;  4GIV A;  2KN5 A;  3LDZ E;  1W1G A;  1X1M A;  1U2B A;  3ZRF A;  4W9F A;  2DKP A;  2QKL A;  3ZTD A;  4AJW A;  2DZK A;  1NU2 A;  2JXX A;  4ASW C;  3NS8 A;  2KKC A;  2YS3 A;  1X1F A;  1QZE A;  3FLV A;  4JK7 A;  4HVB A;  4BOS C;  2DTC A;  3QQ8 B;  3P2B A;  2Y8G A;  1KOT A;  5DHA B;  4TUU A;  4JKG B;  5DI9 B;  1BT0 A;  3ZLZ A;  2KFK A;  3HQC A;  3H6N A;  2FUH B;  3VUY A;  2MA9 B;  1X11 A;  3QBV B;  5EFX A;  2L0T A;  3GZN I;  2LOX A;  3ULC A;  1UBQ A;  2Z59 B;  2D07 B;  4EFO A;  3VOQ A;  4FHK A;  2XK5 B;  1V5U A;  2Z0P A;  3DBL I;  4WAA A;  2CHW A;  2Z0Q A;  3LJU X;  2EMT A;  1U27 A;  3AUL A;  1V86 A;  2FCM A;  2JUO A;  3APF A;  3T8M A;  3VFK A;  4CHJ A;  4FN2 A;  3IBE A;  1BTN A;  1TJ6 A;  5E6P A;  3NSU A;  3OJ3 A;  4IFS A;  2WH5 A;  2AEH A;  4EEW A;  5DPT A;  2CY4 A;  3WAP A;  3BIN A;  3ZW3 A;  2HE7 A;  4F7Z A;  2LG1 A;  1KM7 A;  3ZDM C;  4JKG A;  5JHA A;  2DHI A;  2DZI A;  4RMA A;  4KV2 A;  4HDQ A;  3D8D A;  1JRU A;  1ISN A;  1WR6 E;  2JY6 A;  1XR0 B;  3HM3 A;  2N7D A;  4WQO B;  3VVW B;  2XK5 A;  2YVC A;  4EZJ A;  1DDM A;  5C79 A;  3UQA A;  2D9W A;  3AU5 A;  4II2 B;  1Z87 A;  1WX7 A;  1OTR B;  2JWZ A;  1L2N A;  4MT7 A;  2KK8 A;  1H4R A;  2BCJ A;  2LWP A;  4JKH A;  1UZX B;  3NZU A;  5G55 A;  3D32 A;  1WY8 A;  3T9L A;  4A5K A;  3KUD B;  1Q67 A;  4EUT A;  2WWZ A;  3V6E B;  2LKO A;  2YT1 A;  2CHZ A;  3UQB A;  4DXA B;  2Z0E B;  2N9X A;  2RQ1 A;  4HAZ B;  2E2X A;  2HRJ A;  4HB4 B;  1WGD A;  4IWP A;  3ZNZ B;  2PJH A;  1ZC3 B;  3PZD A;  1NTY A;  2P0H A;  2DX1 A;  2W2X C;  3DOW A;  1PLS A;  1TGZ B;  5C16 A;  3W1S A;  5KQ4 A;  3ENE A;  4GMX B;  3VH4 B;  1AAR A;  3DXC A;  3UGB B;  4JL9 A;  1UEL A;  4ZDV A;  2G35 A;  2V1Y A;  4HK2 A;  1GC6 A;  2O6V B;  1T0Y A;  3VDZ A;  3ULB A;  1WH3 A;  2LGX A;  2WDT B;  4GZU A;  2W2W A;  2K6D B;  3VQI A;  4NSW A;  4HPM B;  4JQW C;  5C23 A;  2REX A;  4WJQ A;  3ZUN A;  2LXA A;  1FAO A;  2L76 A;  3A1Q B;  1P1A A;  5AZF A;  3TFM A;  3V6C B;  4TV3 A;  3FEH A;  1UPR A;  2LVO A;  5DPR A;  3RUI B;  1UH6 A;  2DYM A;  2K1F A;  2IO3 B;  4DX9 0;  4WWP A;  4AJY B;  2MBB B;  1LB1 A;  3V62 A;  3QIJ A;  1ZVR A;  1JDE A;  1BAK A;  2LD9 A;  1MAI A;  3TO1 A;  1J0W A;  3PTF C;  1WX8 A;  2OJR A;  3MPX A;  2RD0 A;  4OVV A;  4A6K A;  4GN1 A;  4NAW B;  1TXD A;  3RD2 A;  2J0K A;  1E8W A;  3AXC A;  5D7G A;  1WE6 A;  1U5G A;  5AZG A;  3X0W A;  4K17 A;  1RRB A;  1PMS A;  5JH5 C;  2O6V A;  2KUP A;  4DHJ B;  4WWO A;  1R4M I;  4GB9 A;  3HHM A;  2KFJ A;  4PYU A;  1I42 A;  1WXS A;  2LGD A;  1TBE A;  5D3V A;  3SHQ A;  3K9O B;  2BGF A;  1ST7 A;  2KWC A;  4OVU A;  3RZF A;  3A1Q A;  3R7Q A;  4ICV A;  1OGW A;  2MBO A;  1WRD B;  4D0N B;  2ZPY A;  3KRW A;  5D94 A;  4J6I A;  1WGR A;  3N3K B;  3KYD D;  1Q0W B;  3KW5 B;  4W9K A;  5D6J B;  4ILJ A;  3SD5 A;  1Z2M A;  1ZGU B;  2DFK A;  4W9H A;  1WGY A;  1W1H A;  2KCJ A;  3TIX A;  4FA6 A;  1WJU A;  1P5T A;  4EJN A;  1VD2 A;  1ZKH A;  4JKE A;  2KLC A;  1HB8 A;  4ZRJ A;  3DBS A;  4HCP B;  2L05 A;  3O96 A;  4NAW A;  1FHO A;  1E7V A;  5CLQ B;  5HE1 A;  2DHJ A;  2CKH B;  4IC7 B;  5HE0 A;  3VTU A;  1ZSQ A;  5EDS A;  2W9N A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...