3X23A

Radixin complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
GSMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MT1-MMP recognition by ERM proteins and its implication in CD44 shedding
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell invasion
molecule keywords Radixin
total genus 88
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3x23A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3x23A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3x23A01
1FHOA 2D9ZA 4WWNA 4FJYA 2M1MA 2B3AA 2H7DA 2EJ8A 2JZ3B 2KC2A 4FN2A 4IWOA 3T9LA 3TBLD 2COAA 4HCNB 1FXTB 3UINB 3IFWB 4G11A 4I6PA 4GN1A 4CO7A 2N4FA 4PS8A 4I6LB 2NZ8B 1JRUA 1ZGUB 1WI1A 2PJHA 2M38A 2YS3A 2XEWA 4CHKA 4K81A 3KRWA 2GBJA 1MAIA 3BJIA 1V86A 1WF9A 1WFYA 2GCLA 2G3QB 5C23A 2L0TA 5BO4B 4KZ0A 5KCVA 2N1VA 2NVUI 4GMVA 4F7UP 3WANA 4IM3A 4CHMA 5E6NA 3V61A 3ODXA 2MQJA 4EZJA 1MG8A 3KRXA 2LKOA 4W9LA 4GSWA 1V5MA 1ZM0A 3VOQA 4M8MA 5DPTA 3U30A 1MIZB 3OLMD 3TFMA 2G4SA 4GDLA 4E71A 2WX1A 2KDBA 4PQ0A 4HAZB 2IYDB 3N32A 3W1SA 1TTNA 3CSTA 3B08A 3PP2A 3D32A 3H1UA 1FHXA 4G50A 1OY2A 1WJMA 3V60A 1W1DA 1EO6A 1L2NA 3SYXA 3EHVA 1DYNA 2PEAA 1D3ZA 1XCGA 2YSZA 3PVUA 1TXDA 2M4NA 3PPAA 4TQ1A 2C7NB 3JW0X 4LDTD 2I1KA 2KQSA 3L54A 2W2XD 3JSVA 2COCA 1E8XA 5D7GA 1X1FA 2L3ZA 2FUHB 1MPHA 2AEHA 4JL9A 2FIFA 3QAQA 2Y8GA 4HAXB 3TW1A 2R2OA 4GDLB 3VUXA 4FULA 1M7RA 2EMTA 1U4AA 4YONA 2O2VA 4WWOA 1WY8A 1WVHA 1WJNA 2L05A 3L10B 3UIOB 3H7SA 2QKMA 2UVMA 3P6AA 2IO2B 3ZKJC 1RJ2A 2IO1B 2CB8A 4I6NB 2ADZA 2D9WA 1YX6B 1NTYA 1WJUA 2L8JA 1KLVA 1WXVA 3CIKA 4PYUA 4BBKA 1Y5OA 1K5GB 1E7VA 1EAZA 2KZRA 5CX3A 4RMAA 2KWUB 1BAKA 4MELA 3OAWA 2KMAA 1OGWA 2XBBC 4ICUA 2LVPA 4YL8A 1V80A 3UIPB 3ZNGC 2REXA 2OTXA 3WALA 1C1YB 5IAAC 2LJ5A 3FEHA 4Z2NA 3Q3JA 2Z0OA 4IOYX 4KZCA 4E74A 3CF6E 2BYEA 1UZXB 2KTRA 3GOEA 1QZEA 1ISNA 3T06A 5JH5C 1WM2A 2KDFB 1WG7A 1UPQA 3ZUNA 1SHCA 2DX5B 1OTRB 3KSYA 1KI1B 4KSLC 4AUQC 5DH9B 4WJ7A 2DZIA 2UZSA 1P9DU 5CHWA 5JHBA 5DIFB 1WX7A 2K8HA 1ZW7A 4MEMA 2KVRA 3L16A 2COFA 3X23A 1BTNA 1OQNA 1OQYA 4A20A 5JZEB 2KJRA 3DBHI 3DQVA 3X0WA 4A6FB 1S3SG 1J8CA 3RYTA 2LI5A 1BTKA 2DHZA 5CHVC 2H7EA 2Y7BA 2KX0A 2M17A 2BGFA 2MSED 2V76A 3A9KB 1B55A 3PLUA 4E3CA 5D3WA 5C1ZA 5LLIA 2RNRB 3G9WA 4WSFA 2ELAA 2IY1B 2RPQA 3VHTC 1DROA 2D11A 1Q1OA 2ZPYA 1MK7B 1XKEA 2Z0QA 4A5KA 2IFSA 2LASA 3PT2B 3SO6A 1Q0WB 2JRIB 2KTFA 3H7PA 4EOYA 1V5TA 2ZCBA 4BVUC 1SE9A 2DYQA 4KDLB 4WJOA 1H4RA 1P98A 4W9JA 4H8SA 2KDIA 3PZDA 1NTIA 1EF5A 1WH3A 2RLOA 3ZDTA 1QC6A 2ZVOA 3SU8X 5IJMA 4KIKB 1J19A 3KYCD 4W9DA 3V5WA 4XC2A 1LQBA 2ROZB 1WI0A 3DBLI 4WWPA 3DOWA 1WMHB 3ZDMC 3EPYA 2CR5A 2V3SA 3A1QA 2RSGA 2FCSA 4BBNC 3PHWB 4WJNA 1GG3A 2LVQA 2MKRA 3ZRCA 4HATB 1RFAA 2COPA 2MLBA 4DWFA 5L83A 1FGZA 2Z59B 1RLFA 2NR2A 3JVZX 1EGXA 4HPMB 2K25A 1GC7A 4K1RB 2V4LA 1XD4A 3PS6A 2LXCA 1J0WA 2K2UA 2P8VA 2RVBB 2LVOA 1KZGA 1N3HA 1WR1A 3ZNZB 2BYFA 4Z2MB 2DAFA 2MP2B 3QBVB 1HE8A 1AWEA 1WRDB 3DBSA 1W1HA 2YS5A 3ODOA 4KAXB 3IVFA 1ZVRA 4HAWB 2KJ6A 1DDWA 2GCJA 1X1MA 2FCQA 1FAOA 2NPTA 3FP5A 2J0JA 1IRSA 3L13A 1FGYA 4EJNA 3B0AA 4GOCA 4ASWC 3V6CB 1BWNA 2K39A 3NZSA 3VH4B 2BKRB 3WA0A 2DX1A 2GS0A 1P3RA 1L7YA 1Y8RC 3ZVRA 1ZKHA 3A4RA 2ZCCA 3DVNU 2V1YA 3ECIA 2RQ1A 3A8QA 2UYZB 3L08A 3S2AA 3UF8A 4DX8A 4B95A 1WE7A 5HE0A 3M95A 2LGXA 3B1LX 5KHOA 4PYZA 4KVGB 1V89A 1UD7A 1YIWA 1H8CA 3MTNB 4IC7B 2DA0A 3AI5A 2EMSA 4HK2A 2NMBA 4KDIC 3W1YA 2K8CA 1YJ1A 4A6HA 2CKHB 3H6NA 3LJ3A 4AOFA 1T0YA 2AWTA 3VVWB 2G4DB 4WVFB 2W2WA 2DKQA 1GNUA 1X1GA 3LJUX 4HDOA 1V5OA 1UEFA 4HB2B 2N9XA 3MHSD 4NPNA 1XD3B 3APCA 2PPHA 3P7ZA 3HW2B 4GIVA 1DDVA 4MT7A 2KTRB 3SHQA 5JHAA 4B9KA 4X57B 1IP9A 1V9JA 1V88A 1ACAA 3GYOA 4F7HA 3QIJA 2KDEB 4NAWA 3UQAA 4KHBB 5D2MB 2MX2A 2KHWB 2NBUA 5DHFB 2KLGA 4NNJB 2BWES 1HB6A 3WAPA 2N7DA 4XX5A 1XQQA 3TIXA 1QQGA 2HTHB 1DDMA 2N7EA 1V5PA 1V6EA 2JVCA 5D94A 2M8SA 3A9JB 4MM3A 2I5FA 1BT0A 1FOEA 2L76A 3VQIA 2FDQA 1PLSA 4K2OA 2MWNB 1WM3A 2D10A 3P2BA 4TUUA 3RD2A 4FBJB 3CXBB 3ZW3A 5EDSA 3ULBA 2KFKA 3DPDA 4MSQB 5DPWA 1YX5B 2O2VB 2ZNVB 2ZNVC 3RUIB 4MGIE 3KVFB 4IM2A 2N9PC 3QJZA 3HM3A 2QKLA 4PNKA 2WYQA 1M94A 2C9WB 5CTRC 2MBOA 2VRRB 5DI9B 2VKIA 3NZUA 1Z87A 5FI1A 2DZJA 2LYDA 2LZ6A 4ZRJA 1KOTA 1UPRA 1P0RA 2FCMA 2XK5A 3K9PB 3NY5A 1WX8A 1AARA 2ZZPB 3DXEA 1XT9B 2Y5BB 5GOWB 5FR6A 3U8ZA 4ANUA 1XR0B 2KOXA 2JF5A 4HPLB 4AWJA 1XODA 2MA9B 4EKUA 4DX90 2CS4A 3QWMA 1OEYJ 1V49A 3JYUA 3UGBB 4BKGA 4ANXA 5D3YA 2CRFA 2BKFA 3KW5B 2DHIA 2GBRA 3PTFC 1V5UA 2N0YA 1KJTA 1TBEA 1H10A 1SGHA 2C7MB 1WZ0A 2AL6A 2J59M 2ROVA 2JUOA 2KKCA 2XK5B 3IG3A 3QARA 4K7WA 1VCBA 4CYEA 4LCDE 1WGGA 4GZUA 5CHFA 4BKTA 1HB8A 1YQBA 3GZNI 4TYZA 1S1QB 1WJ1A 2HD5B 3DXCA 5G2NA 2BYVE 3AXCA 2ABDA 4EEWA 2KUPA 2N9EB 3BY4B 1UGMA 4FA6A 3PG7A 1X86A 4N9F4 3QCAA 3VTVA 2P0HA 2YS1A 4LJPB 1PQSA 2GBNA 1NU2A 3UZTA 4JLCA 4WAAA 3PVWA 5EFXA 2KFKB 5JHGA 4GDKB 2G35A 3A33B 2JPHA 2D9XA 2DYBA 3VH3B 1FHWA 2VSZA 1WMHA 2NCNA 3UQBA 2IZVB 1FB8A 2MBQA 4EZKA 3FSSA 1PMSA 2KN5A 4RM8A 3ZTCA 2RUKB 4L6EA 4MY6A 1E8YA 3AULA 3AU4A 4EFOA 3R7QA 4HCPB 5AZHA 5HKHA 5IA7A 4ZYNA 5C6RA 2NBVB 1W1GA 4WJPA 3ZO5B 1MKEA 2C60A 2L1CA 1PFJA 3I3TB 4MGKE 4HDQA 2D2QA 1GJZA 3A8PA 3O65B 4MGZE 4ANWA 2YRYA 2L2IA 2DHJA 2DYMA 1LXDA 2UWQA 5AEKB 3TL5A 4URKA 3KZ1A 5JHHA 3A9KA 5C79A 3VAWA 1WXMA 2DZMA 1WR6E 4BBNF 1WJ6A 2KWCA 1NVLA 1E8WA 3OANA 1P6SA 3M63B 1GC6A 4F1SA 2JXXA 2A5UA 3HK0A 2W9NA 2JP2A 3HHMA 4PS7A 2LOXA 4GMXB 1V2YA 1RRBA 2FAZA 4W9IA 3ZNID 4BKSA 4HAUB 3GYPA 3AU5A 1E7UA 2JZZA 4HLEA 2MWSB 3KY9A 4MDKE 1U2BA 2OQBA 2LBBA 1MK9B 4Y94A 3KUZA 4DDID 1K5DB 5AZFA 1G6JA 1SIFA 3N7CA 3CMMB 3RT3B 2MRPA 4J6IA 4FJVB 4K7SA 4A3PA 1ZC3B 3WAMA 2HTHA 4W9FA 2J0KA 1RRPB 4BFRA 3PREA 4XZ4A 2K00A 1Z5SB 1OMWA 5J2RA 2KQ7A 3QK0A 1WX9A 1I42A 4NSWA 4IWPA 2HE7A 2MDXA 4W9KA 3ZRFA 4DBGA 4W9CA 3NS8A 1ZC4B 1R4NI 1WGUA 2DENB 4KV2A 5JLJB 1WGDA 3BINA 5J18A 1ZSQA 4TKNA 5J3TA 3KH0A 2A4ZA 2KK8A 1U5GA 3IBEA 2CHXA 1P1AA 1MIXA 2M0XA 2J0MA 3ULCA 1X11A 1V61A 3ODWA 3WYFB 1UELA 4GPTB 3RZWC 3TO1A 2CODA 2MP2A 2QHOA 2YF0A 3DVGX 3MJWA 4MJSA 4W9EA 5E6OA 3EECA 4OVUA 2JY6A 2KCJA 2P0DA 2HJ8A 2P0FA 4CHJA 2OJRA 2BF8B 3Q3FA 4K7UA 2DKPA 2ASQA 4K17A 1YD8U 3HIZA 1DBHA 3PSEB 3VDZA 1EVHA 1K8RB 3K9OB 4DHJB 3PLVA 4B6WA 1A5RA 1IYFA 1U29A 5HE3A 4IM0A 2C5LC 2DN6A 2CAYA 1AQCA 4HB0B 3PEGA 3QC8B 1VD2A 2DZKA 5LXIB 3MDBC 1R4MI 3FLVA 1C3TA 2PE6B 3PSCA 1WIAA 2FCNA 5C16A 2DHKA 3PRPB 4MGYE 3V62A 2D9VA 1WJ4A 5DPSA 5KHQA 1U5FA 2CU1A 3VTWA 4B6HA 3RCZA 1P5TA 2LXAA 2KNBA 4KSKC 4FADA 2GJYA 1TGZB 3HQCA 2NBWB 2IO3B 2RR9A 5L95C 4G0NB 2BPSA 1WXAA 3R7RA 1P3QU 2KMCA 3WIMA 5CLQB 2FIDA 5D3VA 1IPGA 2GBMA 2RSUA 3DBRI 4G3XB 2LWPA 3T8MA 3FM8C 3RCPA 2O6VB 1U5EA 4FHJA 4GU2A 4IUMB 3VFKA 1Q5WB 1TQZA 3KYDD 2WDTB 5TR5A 3R66C 3ML4A 1OEYA 2RD0A 2LULA 2G45B 5J3YA 2DYNA 3EC8A 2K6DB 3A1QB 3M3JA 2I5CA 4F7ZA 4JGHB 3NOBA 2R0DA 2CHZA 5J17A 3AJ4A 2CY5A 1WE6A 2GOWA 4M8NA 5J3QA 2YT0A 1LM8B 5D27A 3A9JA 4AJYB 1UNQA 4P7IA 2FJLA 2J7QB 2JRHA 1CMXB 1KM7A 3A4SC 3ALBA 2L0FA 1E8ZA 3M62B 4FHKA 5C5BB 4ZRKA 2LG1A 3EFUA 4WQOB 3SUZA 4HWIB 5GMVA 1WGYA 5C5BA 1I2HA 1U5DA 5LOPB 3HM6X 4MH0E 3VUWA 5KQ4A 1WGHA 2K1FA 2R09A 3D8DA 3DVNV 3N3KB 2KJHB 3R3MA 4NAWB 1ST7A 1WGRA 4HHVA 2GMIC 3L17A 4RM9A 2MBHA 2CHWA 5KQ1A 2D9YA 2Z0DB 4WJQA 2K6QA 1U27A 5LXHA 2AYOB 2MFQA 3M1IB 2NS5A 2N1WA 2RGFA 3ZTDA 4GDKA 4OVVA 3QHTA 2CY4A 2DLWA 2ELBA 3F5RA 1HBKA 1UBIA 1WXSA 1WZ3A 2E2XA 3RZFA 1UBQA 2O6VA 4BKSD 4ZDVA 4MSMB 3SD5A 1Q67A 4HJKA 2IBIB 4HAYB 3ENEA 3NSUA 3TCAA 3A98B 4EMOA 2LRWA 3PHXB 2Y8FA 2DAJA 3OJ4B 2PZ1A 3V6EB 3VXWA 3WAOA 5JP4A 4IAPA 2KFJA 2XQNM 1Y19B 2WH5A 2UZRA 5D3XA 3KUCB 4HB3B 4MK0A 2L7RA 1LB1A 4LDTB 4LJOB 2LOZA 4NJ6A 3SDLC 5FI0A 4F8CB 3PVLA 3APDA 1EF1A 2FJ9A 1LFDA 1NBFC 4HAVB 3APFA 3OJ3A 5DCNA 3VTUA 3PV1A 3D8FA 2GBKA 3DVGY 3ZVVA 2D3GA 4TV3A 4AJWA 2K2JA 2DFKA 2IYBA 2NPTB 4ZRIA 1UNRA 1V81A 2KO3A 4JQWC 2M14A 2RGNB 4FLHA 3RULA 4TQ0A 4PS3A 3TJPA 2KD0A 4BOSC 2EC1A 4DXAB 2BWFA 2JWZA 4HXDA 4JIOU 4GGQA 4DHZB 4XWXA 2K8BA 2LD9A 1J0GA 4KHOA 2C7HA 3LDZE 2YLMA 4K2PA 3C0RB 4M0WB 4BOZB 4GB9A 2LGYA 3ML8A 2ZPNA 1NI2A 1XX0A 1I35A 3TMPB 3KUDB 4MJSB 4HB4B 2BCJA 2WWZA 3ML9A 3VIAA 2IO0B 2ZVNA 4NQLB 4EZLA 3D8EA 3ZLZA 4NY0A 1LW3A 4ANVA 1M7EA 3O96A 2HRJA 2W2XC 3DXDA 1E90A 2DYOA 2CQUA 2KX3A 1UH6A 1WYWB 2L00B 2MBEA 3CSFA 3N30A 3NHEB 4KIKA 4NJ7A 5E6PA 1WGQA 3ZIMA 5DHAB 3MPXA 4C0AA 1EUVB 2O6VD 3PRMB 4FJZA 1NDDA 2DTCA 2KGXB 5HE1A 3SNHA 2KXJA 2ZEQA 3JSVB 4NQKE 4DHJD 1I7AA 2N23A 2D07B 3H7PB 4DDGD 4D0NB 3IHPC 4DHZE 2EKEC 2ZJDA 2IY0B 3L0WB 1F9JA 1E5WA 2D4QA 4II2B 4GXBA 4IG7B 4ICVA 4HVBA 5DPRA 1KZ7A 2X18A 2JT4B 4IW0A 5AZGA 3ZNHB 4DK5A 2MCNB 2MW5A 2KANA 1RAXA 3H9DA 3W1SC 2I1JA 2Q13A 1GUAB 3F0WA 3QQ8B 4EUTA 4W9HA 4A6FA 4F7GA 5HE2A 2MBBB 2Z0EB 3QWZB 5D6JB 1TZ1A 1UNPA 4IFSA 3QX1A 2FNJB 4AP4C 3U7DA 2LUEA 4IWQA 2VRWB 3QA8A 5G55A 2KWVB 3DDCB 2KLCA 3PRZA 3ONSA 1TJ6A 2YVCA 2LRUA 2AL3A 4A3OA 4W9GA 1X05A 1Z2MA 2KC1A 3DCGA 4II3B 3TVVA 2LGDA 1NTVA 2OOBB 5L81A 2DX5A 2YT1A 2Z0PA 4DBBA 4KHAA 5LONB 3SV1A 2PE9A 2R2QA 4A6KA 3VUYA 5CLLB 2WX0A 3PGEA
chains in the Genus database with same CATH superfamily
4WWNA 3ZYYX 3NVZA 4G11A 1UWXA 4JKAA 4PS8A 1ZGUB 3RNCC 3KRWA 2J42A 4K3CA 3RPFC 2GCLA 2L0TA 5BO4B 4KZ0A 4QJ3B 5KCVA 3Q8FA 4GMVA 3WANA 1GB1A 4IM3A 2JZPA 3ODXA 3VOQA 2WX1A 4HAZB 3W1SA 1VBGA 1N62A 2VZKB 2BBCA 4G50A 1OY2A 3V60A 1W1DA 1DYNA 1XCGA 2HTME 3PVUA 2C7NB 4LDTD 2I1KA 2WXLA 3JSVA 1E8XA 4B0MA 2EKIA 4GDLB 2O2VA 4WWOA 2V4IB 1WY8A 5BYSA 1JWUD 2IO2B 1TY2A 1TKGA 2IO1B 1ZOYB 2N0SB 1T0RC 2CB8A 4I6NB 2ADZA 2L8JA 1NTYA 1WJUA 1KLVA 2WGSA 3ETRA 2V9HA 4BBKA 1F77A 2KZRA 1L6VA 4RH6A 4OSNA 1OGWA 2XBBC 4YL8A 2REXA 2OTXA 2AQ3B 3A58A 3NS1A 3Q3JA 4KZCA 1IBXB 3VR8B 5JH5C 1C4CA 3BK2A 4KSLC 4MT5A 5DH9B 4WJ7A 3MFGA 1P9DU 4MEMA 2KVRA 4KKIA 3Q2AC 2KX0A 2BW2A 2MSED 2V76A 3PLUA 2V3PA 4WSFA 3VHTC 1DROA 3GP7A 1MK7B 2LASA 4L1RA 1MI1A 2KTFA 3H7PA 3ZJTA 1SE9A 1H4RA 4REZA 2MH7A 1NTIA 1TS2A 1QC6A 3KYCD 2WXJA 2QJLA 1FM0D 4WWPA 1WMHB 3EPYA 1YQ4B 4S17A 4WJNA 1GG3A 2LVQA 2MKRA 3LYYA 2W3RA 3TUOA 4DWFA 5L83A 3IXSA 1SJED 2PIAA 1RLFA 1EGXA 4JKDA 2K25A 4K1RB 2V4LA 1F52A 3P4RB 1J0WA 2P8VA 2RVBB 4LNKA 1KZGA 1WR1A 1E7PB 2DAFA 1AN8A 5IO9A 3ODOA 4KGTA 3NVYA 2KJ6A 1X1MA 2V0GA 3L13A 1BXTA 3DBRB 3NZSA 2GS0A 3AE2B 3L08A 2ZCCA 4N59A 2RQ1A 2KMMA 4B95A 4DX8A 5GXGB 4JKEA 5KHOA 4ZRPA 1NENB 1V89A 3AI5A 4KDIC 4JKBA 1QILA 1YJ1A 1T0YA 2K8EA 5G5GA 4WVFB 3IT6B 2Z13A 1V5OA 3MHSD 3B9JA 5JHAA 4RCOA 3TEZA 4LLGM 4B9KA 1V9JA 2KDEB 2M19A 3R2IA 2SEBD 2KHWB 1E9MA 2BB5A 4XWWA 4O1NA 1VR9A 2BWES 1XQQA 3P4SB 2HTHB 1DDMA 2N7EA 2KAJA 3A9JB 1L0VB 1BT0A 2L76A 1V1PB 1PLSA 5BYQA 3ZW3A 1MVKA 4MSQB 5DPWA 1YX5B 2L83A 3RUIB 2GI9A 1KRHA 1NYQA 4M0WA 3P4QB 3LB8C 2WYQA 3AEFB 1M94A 1IUEA 2VKIA 5LG4B 1KOTA 1JDEA 3U52E 2XK5A 1VZ8A 3NY5A 1HQRD 1AARA 2KT7A 5FR6A 2Y5BB 4ANUA 1XR0B 4AWJA 1XODA 2E6XA 2PVOD 4DX90 2CS4A 3QWMA 4BKGA 2R82A 2ICIA 3VR9B 3GB1A 3PTFC 4D6WA 1TBEA 1KJTA 1H10A 1SGHA 4M01A 1WZ0A 2AL6A 3ZNHB 3QARA 1VCBA 1YQBA 3GZNI 1S1QB 3AE8B 3AXCA 4FA6A 1UGMA 1ZPSA 3NZ3A 1H8CA 3RNFC 5EFXA 2KFKB 2JPHA 4YTMB 2VSZA 2AX5A 4KGSA 2IZVB 1FB8A 1KC7A 4TMAB 4OZBA 3FSSA 4RM8A 1N63A 1R4NB 2ON8A 2KDMA 3J9CA 3R7QA 4HCPB 1TZOA 2W54A 5C6RA 2TSSA 4ILHA 1W1GA 4YSXB 2C60A 2L1CA 2FUG1 1PFDA 1UNSA 4MGZE 1D3ZA 2DIKA 5JHHA 1WJ6A 4IOIE 1E8WA 2JXXA 2A5UA 2W9NA 2JP2A 1V2YA 3ZNID 3AU5A 2OQBA 1MK9B 3U7ZA 3BYYB 3N7CA 3W5VB 3RT3B 4FJVB 4ILJA 4K7SA 4BFRA 4XZ4A 2K00A 2PVGC 1I42A 4NSWA 1K51A 4IWPA 2MDXA 3ZRFA 3DWGC 1WGUA 1ZSQA 5J3TA 2LGIA 2A4ZA 2KK8A 2CHXA 2M0XA 1VZ6A 3Q6BA 1DOXA 2CODA 2YF0A 3MJWA 2HJ8A 2P0FA 3NJTA 2BF8B 2DKPA 2ASQA 3K9OB 1A5RA 4C4VA 2DZKA 2PE6B 3PSCA 4JKGA 3PRPB 1ZXHA 5DPSA 3KWVA 1U5FA 3VTWA 2W82A 2D3AA 4KKJA 2KNBA 1TGZB 3T8MA 2RSUA 3W5UB 4HKQA 1U5EA 3HIEA 1TQZA 5TR5A 1HXYD 1SE4A 1SJHD 2WXIA 2LULA 2G45B 3EC8A 2DYNA 3U12A 1ZDXA 2MJ3A 3A1QB 3M3JA 4XDDA 2YT0A 1UNQA 3A4SC 3ALBA 1CMXB 4FHKA 4ZRKA 3EFUA 3HM6X 1I2HA 1V1OA 5KQ4A 2R09A 3DVNV 5C2TB 3R3MA 2RPVA 1WGRA 4HHVA 2GMIC 2CHWA 3AEBB 4USAA 2WHIA 2WNMA 3B2FA 2AYOB 2NS5A 4GDKA 4OVVA 5EE9A 2DLWA 1HBKA 3VRBB 4ZDVA 4MSMB 1Q67A 1JW9D 3EFCA 4HAYB 1DIKA 3A98B 4EMOA 3PHXB 2Y8FA 2KFJA 3KUCB 1C77A 2LOZA 3DCXA 3N1ZC 5FK9C 1EF1A 2FJ9A 3OJ3A 3VTUA 4HAVB 3OWEB 3PV1A 2GBKA 3CWIA 4AJWA 2IYBA 4PS3A 4GOUA 2BWFA 3DWMA 2SAKA 1J0GA 1PUTA 3I9V1 3LDZE 3C0RB 5HFYA 4BOZB 1XX0A 1AYFA 2BCJA 2IO0B 3D8EA 2W2XC 3DXDA 3QJZA 4OT1A 2MBEA 3CSFA 3NHEB 4KIKA 4MM3B 5E6PA 5DHAB 3MPXA 2PLPA 1EUVB 2O6VD 2DTCA 2ZEQA 1SE2A 4NQKE 3H7PB 4DHZE 3IHPC 2IY0B 1E5WA 4HVBA 3TEYA 2X18A 1XLNA 5AZGA 1M4VA 2MCNB 1P7EA 3H9DA 2I1JA 2Q13A 1QLBB 2WXFA 4W9HA 2K49A 1UNPA 2E3TA 4AP4C 1N5WA 3U7DA 4IWQA 2KWVB 3DDCB 1TJ6A 2Z8LA 2LRUA 4JK8A 4W9GA 3TVVA 1YJJA 5L81A 1YN5A 2YT1A 2R2QA 3ZDMC 5D3DA 2WX0A 3TEWA 2PTLA 3N9YC 2M1MA 3T9LA 2EJ8A 4FN2A 4IWOA 3TBLD 3NWFA 4HCNB 2BQQA 4GN1A 5EE3A 1JRUA 1WI1A 2PJHA 4CHKA 4K81A 1AW7A 1MAIA 4HSIA 3BJIA 5C23A 3AMZA 2WXPA 2G1EA 4CHMA 3NW8A 1ROEA 4W9LA 4M8MA 1V5MA 1ZM0A 5DPTA 2G4SA 4PQ0A 1TTNA 3B08A 3PP2A 1C76A 3H1UA 2PEAA 3CIRB 2JWUA 3PPAA 5IKCM 4A90A 5D7GA 1HA5A 2FUHB 1MPHA 2WXRA 1NEKB 1L0XB 3QAQA 2R2OA 4JE3B 1M7RA 1JWAD 3DHIC 1U4AA 4AQ7A 4YONA 1WJNA 1WXQA 2L05A 3P6AA 3ZKJC 1NI3A 4PYUA 4ZYSA 1EAZA 1HZ6A 4JK7A 4MELA 2KMAA 2LVPA 1V80A 3FAHA 1C1YB 5IAAC 4Z2NA 2MJEA 4P1BC 2BYEA 2KTRA 3T06A 2GRIA 3MC0B 2KDFB 1WG7A 1UPQA 3KSYA 1KI1B 2WP9B 4AUQC 5HG2A 4IDIA 5JHBA 5MPOA 1HZ5A 2K8HA 1ZW7A 1LGRA 3X23A 1BTNA 1OQYA 2KJRA 3X0WA 3RYTA 1JCKB 2LI5A 1NVID 3P42A 3A9KB 5LLIA 2IY1B 3G9WA 2D11A 1Q1OA 4JKFA 3SO6A 3GS2A 2RMMA 3DHHC 1I4XA 2MEKA 4W9JA 4H8SA 2QIEB 2X38A 3PZDA 3ABVB 4KIKB 4XC2A 4W9DA 2BS3B 1GPXA 2ROZB 3DBLI 3A1QA 2MLBA 2COPA 1LO5D 2BVCA 3TSSA 3ZGZA 2Z59B 2NR2A 4JK9A 1GC7A 2GB1A 1XD4A 2LXCA 1T6BX 2LVOA 2QDFA 2BYFA 4Z2MB 2MP2B 3IVFA 1DDWA 2GCJA 3Q14C 2J0JA 4LNNA 3B0AA 4ZHPA 3VH4B 1Y56A 2BKRB 1L7YA 1B1ZA 1L0YB 3ZVRA 1F2RI 1Y8RC 3A4RA 5IOIA 3A8QA 2UYZB 1WE7A 5HE0A 3M95A 4IC7B 3H6NA 1SXTA 1VDVA 1SIJA 4QJ5B 5JXVA 2DKQA 2Y5PA 1GNUA 1X1GA 1WSPA 4HDOA 2I2YA 1XD3B 3P7ZA 4GIVA 5H92C 3SHQA 2WDQB 4X57B 5D3IB 2QC8A 1AWDA 1ACAA 4F7HA 3QIJA 4KX6B 4KHBB 5D2MB 4US8A 2NBUA 4NNJB 1HB6A 2OEDA 5D94A 2JX5A 1V5PA 1V6EA 1FRRA 2M8SA 2I5FA 3HUIA 3TEXA 3VQIA 2MWNB 2D10A 5EDSA 4A9AA 1SEBD 2ZNVB 2ZNVC 1YJIA 3HM3A 3BIID 4D2KA 2C9WB 3NZUA 2LYDA 4OVZA 1PGXA 1WX8A 3DXEA 1XT9B 5GOWB 2JF5A 3U2SC 1V49A 2L32A 3JYUA 5D3YA 2LHEA 2CRFA 1ZDVA 2N0YA 2JUOA 2C7MB 2XK5B 2ROVA 3MC9A 4K7WA 4LCDE 4R3DA 2PKOA 4GZUA 1UF0A 4YXDB 5G2NA 1WJ1A 1PGAA 2N9EB 1I4GA 3BY4B 3PG7A 4N9F4 3VTVA 2P0HA 2YS1A 4LJPB 2GBNA 1NU2A 4WAAA 3PVWA 4YSZB 3AV8A 3VH3B 1WMHA 2NCNA 1V1PA 3UQBA 3UI3A 2DWQA 3I63C 2JSVX 2KN5A 5IRSA 3ZJVA 1T3QA 2BTEA 2RUKB 4L6EA 1J7BA 1E8YA 2KWDA 3AU4A 3BVMA 5AZHA 4UDUC 5IA7A 2NBVB 1V97A 2INDC 3ZO5B 3ZJUA 3I3TB 2D2QA 1GJZA 3A8PA 4ANWA 3AN1A 1HTQA 2L2IA 2UWQA 4URKA 3PO0A 3KZ1A 4ARCA 3VAWA 4BBNF 2KN4A 3M63B 1GC6A 3NWDA 2LOXA 4GMXB 2FAZA 2MWSB 3KY9A 2WDRB 4Y94A 1G6JA 3CMMB 4J6IA 2JYEA 4N6EB 3SBTA 3WAMA 2KQ4X 1RRPB 1Z5SB 3QK0A 1ZUD2 1QKZA 1ZC4B 1XLQA 3BZDB 5J18A 3BINA 4TKNA 3IBEA 1U5GA 2J0MA 3ULCA 3RNGC 3ODWA 1UELA 2MP2A 5E6OA 2YT2A 3EECA 4OVUA 2JY6A 2P0DA 1ET6A 4RGNA 4CHJA 2OJRA 3P4PB 4RGTA 1EVHA 4DHJB 3URYA 1U29A 5HE3A 3EGRA 2C5LC 2CAYA 1AQCA 4QJ4B 3PEGA 4P6VF 5JVLA 5LXIB 3SFEB 3BVGA 3RCZA 1P5TA 2LXAA 4KSKC 2K0PA 4C4VB 2NBWB 5L95C 3R7RA 2BS2B 1TT5B 4MACA 2KR0A 5CLQB 4YSYB 3E66A 5D3VA 3DBRI 1QF6A 3FM8C 3RCPA 2O6VB 4GU2A 4FHJA 3VFKA 4IUMB 3KYDD 4HKZE 2BS4B 2W55A 1TKEA 3ML4A 1MHXA 1FO4A 1EM7A 2HDEA 1WRIA 3HSAA 5J17A 3AJ4A 1WE6A 5J3QA 1LM8B 3AE6B 5D27A 4AJYB 4P7IA 2FJLA 1A70A 2JRHA 1KM7A 5BYRA 3SU8X 3E9OA 2LG1A 3SUZA 4P1CC 4EE2A 1IBXA 5C5BA 1QOFA 3KLSX 2K1FA 2ZW1A 3N3KB 1GGOA 1L4ZB 4NAWB 1ST7A 4WJQA 4LK0M 1U27A 5LXHA 3F5RA 1WXSA 1UBIA 4YTPB 1SF0A 1HEZE 1UBQA 2O6VA 4HJKA 3ENEA 3TCAA 2DAJA 3OJ4B 2PZ1A 3VXWA 2XQNM 1Y19B 2WH5A 2LMCA 3SDLC 4HB3B 2L7RA 1LB1A 2NBVA 2RDBC 3PVLA 2QCZA 2INCC 1F2RC 2YEPF 1LFDA 3APDA 5DCNA 1JQ4A 3D8FA 3DVGY 3ZVVA 4TV3A 1DYQA 2K2JA 3SBGA 2DFKA 2IGDA 4ZRIA 4HPPA 4JQWC 3RULA 4TQ0A 4FLHA 2QILA 1I7HA 2KD0A 3TJPA 4BOSC 2EC1A 2JWZA 4DHZB 4JIOU 1FXIA 4KHOA 2C7HA 4GB9A 1PYWD 2ZPNA 2WXNA 3KWLA 3DBHB 1I35A 3VIAA 2ZVNA 4NJ6A 4C80A 2L00B 2DYOA 2KX3A 1UH6A 3IAS1 2G9HD 3ZXRA 4K3BA 2WQYB 4FJZA 4BKSA 1NDDA 3SNHA 1I7AA 2HJ1A 2LUMA 2ZJDA 4II2B 4GXBA 2FJUB 2KIEA 2CJNA 4IW0A 2WXOA 4DK5A 3W1SC 4QAYA 1GUAB 1DOIA 2V3NA 3QQ8B 4A6FA 4F7GA 3QWZB 2Z0EB 1TZ1A 4IFSA 3PRZA 2KLCA 2MJDA 4A3OA 2ONQA 2LGDA 3V05A 2Z0PA 3AM9A 2PE9A 3SV1A 3VUYA 1DOYA 5CLLB 4B6WA 1EWYC 1XLOA 2H7DA 2KC2A 4RF0A 2COAA 1FXTB 3UINB 3IFWB 4I6PA 4CO7A 2N4FA 2M38A 1VRAB 2XNAC 1K52A 2BB6A 2JU6X 2N1VA 3BYTB 2NVUI 4GLSC 2MQJA 4EZJA 1MG8A 2LKOA 1MIZB 1QOAA 4GDLA 4E71A 2KDBA 2JQRB 1WJMA 1EO6A 2LEKA 3SYXA 4XGAB 1OFFA 2YSZA 2M4NA 1T0QC 4TQ1A 3JW0X 3L54A 2W2XD 1C4AA 2L3ZA 3Q3NC 3DBLB 4HAXB 3B2GA 1JALA 3NRZA 2EMTA 1VZ7A 1FD6A 1ZP0B 4Q2JA 3L10B 3UIOB 3H7SA 1TS3A 2UVMA 3OG5A 3P63A 2IGGA 1RJ2A 1F1HA 2NTSA 2D9WA 1WXVA 3CIKA 1TJEA 1K5GB 1TIFA 4LNIA 3FC4A 1R7SA 2LJ5A 3FEHA 5I2MA 3DHGC 1QZEA 1WWTA 1WM2A 4XWTA 1OTRB 1Q10A 2EELA 2W3SA 2UZSA 1OQNA 1ZE3D 3MHZA 1KFYB 3LXFA 3DBHI 3DQVA 2GUMA 4A6FB 2DHZA 5CHVC 2H7EA 4E3CA 2BGFA 2IPKD 1B55A 5D3WA 4ITKA 2RNRB 2YEPB 2ELAA 1P7FA 3PT2B 1KLUD 2JRIB 1V5TA 2ZCBA 3AE7B 1FXAA 1XEEA 1FNWA 3Q8BA 1P98A 2KDIA 1ESFA 1WH3A 1EF5A 3RN9C 1J19A 2R2YA 1SE3A 1LQBA 4YT0B 3B77A 2CR5A 2V3SA 4BBNC 2RSGA 2FCSA 4LNFA 3KQ4A 4ZRQA 1K50A 2J52A 1QT9A 1N3HA 3JSVB 1YN3A 1HE8A 1WRDB 3W9CB 2YS5A 4KAXB 1JWMD 1SBBB 4HAWB 2D5GA 3E9LA 1FAOA 1KF6B 2NPTA 3FP5A 1KLGD 4GOCA 3Q3OC 5HI1A 4L23A 1XF5L 3P1MA 3R2TA 1BWNA 2DX1A 4JKGB 2V1YA 4JKCA 3S2AA 4WIPA 2LGXA 3B1LX 4PYZA 4KVGB 1YIWA 3MTNB 2CKHB 3LJ3A 1JROA 3AEAB 4JX1C 2AWTA 2KVZA 2W2WA 3MP9A 1N6ZA 4HB2B 3APCA 3HW2B 2KTRB 1J7CA 1V88A 3BWUD 3NG0A 5TSSA 2MX2A 2AQ1B 4XDCA 3W2DA 5IP4D 5DHFB 5IN7A 2WDVB 2K22A 1QQGA 1E0ZA 4MM3A 4K2OA 1WM3A 3P2BA 4OZAA 4TUUA 4FBJB 1CK1A 4OHJA 3ULBA 2KFKA 3DPDA 5I2SA 2WU5B 5BMGA 4MGIE 3KVFB 1F0ZA 2N9PC 5CTRC 2VRRB 5DI9B 1Z87A 5FI1A 2LZ6A 1N61A 1UPRA 1GOZA 1P0RA 2FCMA 3K9PB 3EUB2 4ACFA 1RFKA 3U8ZA 2KOXA 2MA9B 4EKUA 3MC8A 3UGBB 1VJKA 2GBRA 1V5UA 1WYGA 2KKCA 2J59M 1TS5A 2R61A 4CYEA 1WGGA 1HB8A 3AH7A 2DLBA 2HD5B 3DXCA 4EEWA 2BYVE 2ABDA 3QCAA 1PQSA 1C79A 4JLCA 3UZTA 4GDKB 2KIGA 1EWCA 2D9XA 2DYBA 2WU2B 1FHWA 3ZXVA 2GLSA 2MBQA 4EZKA 3U4EG 3ZTCA 2LJIA 5LNK1 4MY6A 4L1BA 5HKHA 1YNTE 3N20C 4A8XC 1DGJA 3SR6A 4MGKE 4JWSC 2XN9C 3O65B 2YRYA 2DHJA 1LXDA 1WXMA 1IGCA 1WR6E 3AE1B 4F1SA 3OANA 1P6SA 2FE8A 4PS7A 1RRBA 4W9IA 4HAUB 1E7UA 4MDKE 4DDID 2LBBA 5AZFA 1SIFA 4RNAA 2HTHA 4W9FA 4C00A 1OMWA 4YWGG 1WX9A 2JYTA 2L52A 1FMAD 1XCQL 1N5XA 4W9KA 4W9CA 3NS8A 1R4NI 4KV2A 1WGDA 4HJGE 3KH0A 1P1AA 1MIXA 4XYCA 4WWMA 1X11A 3WYFB 4DXGA 4GPTB 3FVCA 1E6EB 4W9EA 2KCJA 3AE3B 2NTTA 4K7UA 1HTOA 3HIZA 3PSEB 4CSQA 5HHDG 3VDZA 1IYFA 3PLVA 4WURA 4IM0A 3RFZB 4HB0B 2K3UA 3QC8B 3MDBC 3FLVA 3RMKC 1WIAA 5C16A 2D9VA 1WJ4A 1I4QA 3RNBC 5KHQA 2CU1A 3PZ8A 1KH0A 2GJYA 3BVZA 4LTUA 1P3QU 2KMCA 3WIMA 1SB3C 4G3XB 2J4XA 1QOGA 2WDTB 1OEYA 4LNOA 5J3YA 2X8XX 2JXTA 4M00A 2I5CA 4JGHB 2H88B 3NOBA 2R0DA 4M8NA 3A9JA 3M62B 5C5BB 4WQOB 3EA6A 5GMVA 3WCQA 2RRFA 2OJWA 1EU3A 5LOPB 1WGHA 2KJHB 1BUIC 3Q3MC 2MBHA 3GZNB 2Z0DB 2K6QA 2RGFA 3ZTDA 2M0AA 2N1WA 2ELBA 1WZ3A 3T3NA 2E2XA 3RZFA 4BKSD 3NSUA 2LRWA 3V6EB 1TS4A 4QXAB 4FJYA 4OW0A 3C19A 4LDTB 1JRPA 5FI0A 4F8CB 1YOVB 3APFA 1NBFC 2ZW0A 1ZYIA 2D3GA 2NPTB 1V81A 2D3BA 2H89B 3FKYA 4BZAA 2X0SA 1I4HA 4DXAB 4HXDA 4GGQA 4XWXA 2K8BA 2LD9A 1T77A 4M0WB 2YLMA 3E9PA 2FBWB 2BT6A 3OHMB 3TMPB 4HB4B 1VLBA 4EZLA 3ZLZA 1M7EA 3O96A 2HRJA 1E90A 1MHHE 3E56A 2CQUA 1WYWB 2KACA 2Y5CA 1UUPA 1WGQA 3ZIMA 1YMHE 2DNFA 2KXJA 4DHJD 2QSDA 4ZOHC 2N23A 3AE5B 2WXKA 1IGDA 2UU7A 3I57A 4IG7B 2D4QA 4NAMA 1UGJA 1FIQA 5DPRA 2JT4B 1XXGA 2ACZB 4L2YA 3F0WA 5HE2A 2N9KA 2LHDA 5D6JB 1L5PA 2LUEA 3E9SA 3HRDD 4GNKB 1RWSA 2YVCA 1X05A 2OOBB 3NUHB 1NTVA 2K9XA 5LONB 4A6KA 3UF8A 3PGEA 1FHOA 2D9ZA 4PK1A 2B3AA 2JZ3B 4US9A 2IJ0A 4I6LB 2NZ8B 3VRAB 2YS3A 2XEWA 2CU3A 2GBJA 1NYRA 1E10A 1V86A 1WF9A 2DBYA 1WFYA 2G3QB 4F7UP 2IGHA 5E6NA 3V61A 3KRXA 4GSWA 3U30A 3OLMD 3TFMA 3GE3C 2M56B 1VBHA 2IYDB 3N32A 4RFBA 3CSTA 3D32A 1FHXA 1FPYA 2NMQA 2D3CA 3EHVA 3N1XC 1XO3A 4ARIA 1TXDA 1KTKA 2KQSA 2COCA 1X1FA 3C8YA 3HVDA 2AEHA 4JL9A 2FIFA 2PW9A 2Y8GA 3TW1A 5AUIA 3VUXA 2MHJA 4FULA 2N9LA 2Q5WD 2KYWA 2Z4DA 1FFUA 1WVHA 5H8YE 2QKMA 3BK1A 3NVWA 1C78A 1L4DB 1YX6B 1UWMA 2RDHA 1Y5OA 2INNE 1E7VA 5CX3A 4RMAA 2KWUB 1BAKA 1RYJA 3OAWA 4ICUA 3UIPB 3ZNGC 3WALA 4ILGB 3AE4B 2Z0OA 4IOYX 4E74A 3CF6E 1UZXB 3GOEA 1ISNA 2N7JA 3AEGB 3ZUNA 2VZKD 1SHCA 2DX5B 1MJDA 3SFDB 1JWBD 4HEA1 2DZIA 5CHWA 5E6JA 5DIFB 1WX7A 4HRSA 3L16A 2COFA 4A20A 5JZEB 3L4PA 1S3SG 1J8CA 2CJOA 1BTKA 2Y7BA 2M17A 5C1ZA 2RPQA 1GB4A 2ZPYA 1XKEA 2Z0QA 4A5KA 2IFSA 3FILA 1Q0WB 4WH4A 1YQ3B 4EOYA 4BVUC 2DYQA 4KDLB 4WJOA 2LGSA 2RLOA 3ZDTA 2ZVOA 5IJMA 2AQ2B 3V5WA 1WI0A 2WXGA 3DOWA 3PHWB 4HROA 3ZRCA 4HATB 1RFAA 3H8HA 4P16A 1FGZA 3JVZX 4HPMB 4S0RA 3PS6A 1FEHA 2K2UA 3ZNZB 1ZXIA 1L2NA 3QBVB 3DBSA 1AWEA 1W1HA 1ZVRA 2FCQA 4KGRA 1FCCC 1IRSA 1B9RA 1FGYA 4EJNA 2ZKMX 4ASWC 3V6CB 2WXHA 2K39A 4WQMA 3WA0A 1P3RA 3DVNU 1ZKHA 2I38A 4BKTA 3ECIA 3AEEB 1MG4A 1UD7A 3AB5A 1QQRA 2DA0A 2EMSA 4HK2A 2NMBA 3W1YA 2K8CA 4A6HA 4AOFA 4C7YA 1OQRA 3VVWB 2G4DB 3IT4B 2N9XA 3LJUX 3GE8C 4NPNA 1UEFA 4B0EA 2PPHA 5I4DA 1DDVA 4MT7A 3IAM1 3NWAA 1IP9A 3GYOA 2Y3AA 4NAWA 3UQAA 4TSSA 1FNUA 3Q8CA 2VH1A 1CQVA 2KLGA 5BMHA 2Z14A 1ACCA 3WAPA 2N7DA 4XX5A 3TIXA 1C9FA 2JVCA 1FOEA 1XLPA 2FDQA 4A6QA 4FXCA 3RD2A 3CXBB 1TYGB 1FRDA 4RGMA 4AS1A 2O2VB 2L1AA 2QEJC 1D5ZC 2J53A 4IM2A 2QKLA 4PNKA 1MFWA 2MBOA 2DZJA 4ZRJA 2WXMA 1FNVA 3N1YC 1ET9A 1D4BA 2ZZPB 2PMVA 2WXQA 4HPLB 2WS3B 1OEYJ 4DQOC 4ANXA 2BKFA 3KW5B 2DHIA 3R8BA 4JPSA 3IG3A 5CHFA 3ZQ4A 1T5XD 4TYZA 5EE1A 2KUPA 5FKAC 1X86A 2Z59A 1MPEA 5JHGA 1STEA 2G35A 3A33B 1PMSA 5BMIA 3AULA 4EFOA 4ZYNA 3AECB 4WJPA 1MKEA 3Q8AA 1PFJA 4HDQA 1EU4A 1ENFA 2DYMA 5AEKB 3TL5A 3A9KA 5C79A 2DZMA 4IKGA 5EE0A 2KWCA 5FR3A 1NVLA 4J3OD 4ANVA 3HK0A 3HHMA 1D5MC 1C4PA 4HLEA 3GYPA 2JZZA 1KBLA 1U2BA 3KUZA 1JMLA 1K5DB 2MRPA 1SSNA 4XE0A 1ZC3B 2J0KA 3PREA 5J2RA 2KQ7A 2VH2A 2KUQA 2HE7A 1QOBA 4DBGA 4M02A 2DENB 5JLJB 4H2AA 1BMLC 4C7ZA 4JKHA 1J7AA 5T8IA 1V61A 3AEDB 3RZWC 3TO1A 2QHOA 4MJSA 3DVGX 1I4PA 2OHFA 4C56C 3Q3FA 4K17A 1GAQB 1YD8U 1DBHA 1D6EC 1K8RB 1FCLA 2DN6A 1VD2A 3AE9B 1R4MI 1C3TA 1PDXA 2FCNA 4RF1A 2DHKA 4MGYE 3V62A 2QMTA 1WGKA 4B6HA 4FADA 4BAXA 2RR9A 1XCTL 3HQCA 2IO3B 4G0NB 2BPSA 1WXAA 2RDGA 5G5HA 1RM6C 1T0SC 2FIDA 2GBMA 1IPGA 2LWPA 1PGBA 4PT5A 1Q5WB 1CJEA 3Q69A 3R66C 3RI7C 2RD0A 4DXFA 4CQNA 2BYTA 3V3XA 2K6DB 1TKYA 4F7ZA 2CHZA 2CY5A 2GOWA 4ZHOA 4N58A 2J7QB 2L0FA 1E8ZA 1L6UA 4HWIB 1WGYA 3VUWA 1U5DA 4MH0E 2WLBA 4KHBA 1OQQA 3D8DA 2IDYA 3FILB 3L17A 4RM9A 3HVZA 5KQ1A 2D9YA 2MFQA 3M1IB 3QHTA 2CY4A 2LFIA 3SD5A 3PZ7A 4WAFA 2IBIB 1I4RA 3WAOA 5JP4A 4IAPA 5D3XA 5M4YB 4NJ7A 2UZRA 4MK0A 4LJOB 3MJ5A 1YN4A 2INPE 1N60A 1UNRA 2KO3A 3RNEC 2M14A 2RGNB 5AUKA 1K53A 4MH8A 4NJCA 4YTNB 2B76B 4K2PA 4OZCA 2LGYA 3ENBA 3ML8A 5C3JB 1NI2A 3NVVA 4NZLB 3KUDB 1CZPA 1D5XC 4MJSB 2WWZA 3ML9A 4NQLB 3O13A 4NY0A 1LW3A 3T3OA 3Q8EA 3N30A 2K5PA 1TY0A 4C0AA 3PRMB 1FFVA 2KGXB 5HE1A 2D07B 4DDGD 4D0NB 4DIXA 2EKEC 3L0WB 4ICVA 1F9JA 4RGOS 1KZ7A 1MI0A 2MW5A 4A55A 3I5JC 2KANA 1RAXA 4EUTA 3SEBA 2MBBB 3RNAC 1JWSD 3QX1A 2FNJB 1V8CA 2VRWB 3QA8A 5G55A 1R4MB 3ONSA 2AL3A 1Z2MA 2KC1A 3DCGA 4II3B 2DX5A 4DBBA 4KHAA 4JWUC 4A3PA
chains in the Genus database with same CATH topology
4WWNA 4G11A 4PS8A 4JKAA 1ZGUB 3KRWA 2GCLA 2L0TA 5BO4B 4KZ0A 5KCVA 4GMVA 3WANA 4IM3A 3ODXA 3VOQA 2WX1A 4HAZB 3W1SA 1VBGA 4G50A 1OY2A 3V60A 1W1DA 1DYNA 1XCGA 3PVUA 2C7NB 4LDTD 2I1KA 3JSVA 1E8XA 4GDLB 2O2VA 4WWOA 1WY8A 2IO2B 2IO1B 2CB8A 4I6NB 2ADZA 2L8JA 1NTYA 1WJUA 1KLVA 4BBKA 2KZRA 1OGWA 2XBBC 4YL8A 2REXA 2OTXA 3Q3JA 4KZCA 5JH5C 4KSLC 5DH9B 4WJ7A 1P9DU 4MEMA 2KVRA 2KX0A 2MSED 2V76A 3PLUA 4WSFA 3VHTC 1DROA 1MK7B 2LASA 2KTFA 3H7PA 1SE9A 1H4RA 1NTIA 1QC6A 3KYCD 4WWPA 1WMHB 3EPYA 4WJNA 1GG3A 2LVQA 2MKRA 4DWFA 5L83A 1RLFA 1EGXA 4JKDA 2K25A 4K1RB 2V4LA 1J0WA 2P8VA 2RVBB 1KZGA 1WR1A 2DAFA 3ODOA 2KJ6A 1X1MA 3L13A 3NZSA 2GS0A 3L08A 2ZCCA 2RQ1A 4B95A 4DX8A 4JKEA 5KHOA 1V89A 3AI5A 4KDIC 4JKBA 1YJ1A 1T0YA 4WVFB 1V5OA 3MHSD 5JHAA 4B9KA 1V9JA 2KDEB 2KHWB 2BWES 1XQQA 2HTHB 1DDMA 2N7EA 3A9JB 1BT0A 2L76A 1PLSA 3ZW3A 4MSQB 5DPWA 1YX5B 3RUIB 2WYQA 1M94A 2VKIA 1KOTA 1JDEA 2XK5A 3NY5A 1AARA 5FR6A 2Y5BB 4ANUA 1XR0B 4AWJA 1XODA 4DX90 2CS4A 3QWMA 4BKGA 2R82A 3PTFC 1TBEA 1KJTA 1H10A 1SGHA 3ZNHB 1WZ0A 2AL6A 3QARA 1VCBA 1YQBA 3GZNI 1S1QB 3AXCA 4FA6A 1UGMA 1H8CA 5EFXA 2KFKB 2JPHA 2VSZA 2IZVB 1FB8A 1KC7A 3FSSA 4RM8A 3R7QA 4HCPB 5C6RA 4ILHA 1W1GA 2C60A 2L1CA 4MGZE 1D3ZA 2DIKA 5JHHA 1WJ6A 1E8WA 2JXXA 2A5UA 2W9NA 2JP2A 1V2YA 3ZNID 3AU5A 2OQBA 1MK9B 3N7CA 3RT3B 4FJVB 4ILJA 4K7SA 4BFRA 4XZ4A 2K00A 1I42A 4NSWA 4IWPA 2MDXA 3ZRFA 1WGUA 1ZSQA 5J3TA 2A4ZA 2KK8A 2CHXA 2M0XA 2CODA 2YF0A 3MJWA 2HJ8A 2P0FA 2BF8B 2DKPA 2ASQA 3K9OB 1A5RA 2DZKA 2PE6B 3PSCA 4JKGA 3PRPB 5DPSA 1U5FA 3VTWA 2KNBA 1TGZB 3T8MA 2RSUA 1U5EA 1TQZA 5TR5A 2LULA 2G45B 3EC8A 2DYNA 3A1QB 3M3JA 2YT0A 1UNQA 3A4SC 3ALBA 1CMXB 4FHKA 4ZRKA 3EFUA 3HM6X 1I2HA 5KQ4A 2R09A 3DVNV 3R3MA 1WGRA 4HHVA 2GMIC 2CHWA 2AYOB 2NS5A 4GDKA 4OVVA 2DLWA 1HBKA 4ZDVA 4MSMB 1Q67A 4HAYB 1DIKA 3A98B 4EMOA 3PHXB 2Y8FA 2KFJA 3KUCB 2LOZA 1EF1A 2FJ9A 3OJ3A 3VTUA 4HAVB 3PV1A 2GBKA 4AJWA 2IYBA 4PS3A 2BWFA 1J0GA 3LDZE 3C0RB 4BOZB 1XX0A 2BCJA 2IO0B 3D8EA 3QJZA 2W2XC 3DXDA 2MBEA 3CSFA 3NHEB 4KIKA 5E6PA 5DHAB 3MPXA 1EUVB 2O6VD 2DTCA 2ZEQA 4NQKE 3H7PB 4DHZE 3IHPC 2IY0B 1E5WA 4HVBA 2X18A 5AZGA 2MCNB 3H9DA 2I1JA 2Q13A 4W9HA 1UNPA 4AP4C 3U7DA 4IWQA 2KWVB 3DDCB 1TJ6A 2LRUA 4JK8A 4W9GA 3TVVA 5L81A 2YT1A 2R2QA 3ZDMC 2WX0A 2M1MA 3T9LA 2EJ8A 4FN2A 4IWOA 3TBLD 4HCNB 4GN1A 1JRUA 1WI1A 2PJHA 4CHKA 4K81A 1MAIA 3BJIA 5C23A 4CHMA 4W9LA 4M8MA 1V5MA 1ZM0A 5DPTA 2G4SA 4PQ0A 1TTNA 3B08A 3PP2A 3H1UA 2PEAA 3PPAA 5D7GA 2FUHB 1MPHA 3QAQA 2R2OA 1M7RA 1U4AA 4YONA 1WJNA 2L05A 3P6AA 3ZKJC 4PYUA 1EAZA 4JK7A 4MELA 2KMAA 2LVPA 1V80A 1C1YB 5IAAC 4Z2NA 2BYEA 2KTRA 3T06A 2KDFB 1WG7A 1UPQA 3KSYA 1KI1B 4AUQC 5JHBA 2K8HA 1ZW7A 3X23A 1BTNA 1OQYA 2KJRA 3X0WA 3RYTA 2LI5A 3A9KB 5LLIA 2IY1B 3G9WA 2D11A 1Q1OA 4JKFA 3SO6A 4W9JA 4H8SA 3PZDA 4KIKB 4XC2A 4W9DA 2ROZB 3DBLI 3A1QA 2MLBA 2COPA 2Z59B 2NR2A 4JK9A 1GC7A 1XD4A 2LXCA 2LVOA 2BYFA 4Z2MB 2MP2B 3IVFA 1DDWA 2GCJA 2J0JA 3B0AA 3VH4B 2BKRB 1L7YA 1Y8RC 3A4RA 3ZVRA 3A8QA 2UYZB 1WE7A 5HE0A 3M95A 4IC7B 3H6NA 2DKQA 1GNUA 1X1GA 4HDOA 1XD3B 3P7ZA 4GIVA 3SHQA 4X57B 1ACAA 4F7HA 3QIJA 4KHBB 5D2MB 2NBUA 4NNJB 1HB6A 5D94A 1V5PA 1V6EA 2M8SA 2I5FA 3VQIA 2MWNB 2D10A 5EDSA 2ZNVB 2ZNVC 3HM3A 2C9WB 3NZUA 2LYDA 1WX8A 3DXEA 1XT9B 5GOWB 2JF5A 1V49A 3JYUA 5D3YA 2CRFA 2N0YA 2JUOA 2C7MB 2XK5B 2ROVA 4K7WA 4LCDE 4GZUA 5G2NA 1WJ1A 2N9EB 3BY4B 3PG7A 4N9F4 3VTVA 2P0HA 2YS1A 4LJPB 2GBNA 1NU2A 4WAAA 3PVWA 3VH3B 1WMHA 2NCNA 3UQBA 2KN5A 2RUKB 4L6EA 1E8YA 3AU4A 5AZHA 5IA7A 2NBVB 3ZO5B 3I3TB 2D2QA 1GJZA 3A8PA 4ANWA 2L2IA 2UWQA 4URKA 3KZ1A 3VAWA 4BBNF 3M63B 1GC6A 2LOXA 4GMXB 2FAZA 2MWSB 3KY9A 4Y94A 1G6JA 3CMMB 4J6IA 3SBTA 3WAMA 1RRPB 1Z5SB 3QK0A 1ZC4B 5J18A 3BINA 4TKNA 3IBEA 1U5GA 2J0MA 3ULCA 3ODWA 1UELA 2MP2A 5E6OA 3EECA 4OVUA 2JY6A 2P0DA 4CHJA 2OJRA 4DHJB 1EVHA 1U29A 5HE3A 2C5LC 2CAYA 1AQCA 3PEGA 5JVLA 5LXIB 3RCZA 1P5TA 2LXAA 4KSKC 2NBWB 5L95C 3R7RA 5CLQB 3E66A 5D3VA 3DBRI 3FM8C 3RCPA 2O6VB 4GU2A 4FHJA 3VFKA 4IUMB 3KYDD 3ML4A 5J17A 3AJ4A 1WE6A 5J3QA 1LM8B 5D27A 4AJYB 3SU8X 4P7IA 2FJLA 2JRHA 1KM7A 3E9OA 2LG1A 3SUZA 5C5BA 2K1FA 3N3KB 1GGOA 4NAWB 1ST7A 4WJQA 1U27A 5LXHA 3F5RA 1WXSA 1UBIA 1UBQA 2O6VA 4HJKA 3ENEA 3TCAA 2DAJA 3OJ4B 2PZ1A 3VXWA 2XQNM 1Y19B 2WH5A 3SDLC 4HB3B 2L7RA 1LB1A 3PVLA 3APDA 1LFDA 5DCNA 3D8FA 3DVGY 3ZVVA 4TV3A 2K2JA 3SBGA 2DFKA 4ZRIA 4JQWC 3RULA 4TQ0A 4FLHA 3TJPA 2KD0A 4BOSC 2EC1A 2JWZA 4DHZB 4JIOU 4KHOA 2C7HA 4GB9A 2ZPNA 1I35A 3VIAA 2ZVNA 4NJ6A 2L00B 2DYOA 2KX3A 1UH6A 4FJZA 4BKSA 1NDDA 3SNHA 1I7AA 2ZJDA 4II2B 4GXBA 4IW0A 4DK5A 3W1SC 1GUAB 3QQ8B 4A6FA 4F7GA 3QWZB 2Z0EB 1TZ1A 4IFSA 3PRZA 2KLCA 4A3OA 2LGDA 2Z0PA 2PE9A 3SV1A 3VUYA 4B6WA 5CLLB 2H7DA 2KC2A 2COAA 1FXTB 3UINB 3IFWB 4I6PA 4CO7A 2N4FA 2M38A 2N1VA 2NVUI 2MQJA 4EZJA 1MG8A 2LKOA 1MIZB 4GDLA 4E71A 2KDBA 1WJMA 1EO6A 3SYXA 2YSZA 2M4NA 4TQ1A 3JW0X 3L54A 2W2XD 2L3ZA 4HAXB 2EMTA 3L10B 3UIOB 3H7SA 2UVMA 1RJ2A 2D9WA 1WXVA 3CIKA 1K5GB 2LJ5A 3FEHA 1QZEA 1WM2A 1OTRB 2UZSA 1OQNA 3DBHI 3DQVA 4A6FB 2DHZA 5CHVC 2H7EA 4E3CA 2BGFA 1B55A 5D3WA 2RNRB 2ELAA 3PT2B 2JRIB 1V5TA 2ZCBA 1P98A 2KDIA 1WH3A 1EF5A 1J19A 1LQBA 2CR5A 2V3SA 4BBNC 2RSGA 2FCSA 1N3HA 3JSVB 1HE8A 1WRDB 2YS5A 4KAXB 4HAWB 3E9LA 1FAOA 2NPTA 3FP5A 4GOCA 1BWNA 2DX1A 4JKGB 2V1YA 4JKCA 3S2AA 2LGXA 3B1LX 4PYZA 4KVGB 1YIWA 3MTNB 2CKHB 3LJ3A 2AWTA 2W2WA 4HB2B 3APCA 3HW2B 2KTRB 1V88A 2MX2A 5DHFB 1QQGA 4MM3A 4K2OA 1WM3A 3P2BA 4TUUA 4FBJB 3ULBA 2KFKA 3DPDA 4MGIE 3KVFB 2N9PC 5CTRC 2VRRB 5DI9B 1Z87A 5FI1A 2LZ6A 1UPRA 1P0RA 2FCMA 3K9PB 3U8ZA 2KOXA 2MA9B 4EKUA 3UGBB 2GBRA 1V5UA 2KKCA 2J59M 4CYEA 1WGGA 1HB8A 2HD5B 3DXCA 4EEWA 2BYVE 2ABDA 3QCAA 1PQSA 4JLCA 3UZTA 4GDKB 2D9XA 2DYBA 1FHWA 2MBQA 4EZKA 3ZTCA 4MY6A 5HKHA 4MGKE 3O65B 2YRYA 2DHJA 1LXDA 1WXMA 1WR6E 4F1SA 3OANA 1P6SA 4PS7A 1RRBA 4W9IA 4HAUB 1E7UA 4MDKE 4DDID 2LBBA 5AZFA 1SIFA 2HTHA 4W9FA 1OMWA 1WX9A 4W9KA 4W9CA 3NS8A 1R4NI 4KV2A 1WGDA 3KH0A 1P1AA 1MIXA 1X11A 3WYFB 4GPTB 4W9EA 2KCJA 4K7UA 3HIZA 3PSEB 3VDZA 1IYFA 3PLVA 4IM0A 4HB0B 3QC8B 3MDBC 3FLVA 1WIAA 5C16A 2D9VA 1WJ4A 5KHQA 2CU1A 2GJYA 1P3QU 2KMCA 3WIMA 4G3XB 2WDTB 1OEYA 5J3YA 2I5CA 4JGHB 3NOBA 2R0DA 4M8NA 3A9JA 3M62B 5C5BB 4WQOB 5GMVA 5LOPB 1WGHA 2KJHB 2MBHA 2Z0DB 2K6QA 2RGFA 3ZTDA 2N1WA 2ELBA 1WZ3A 2E2XA 3RZFA 4BKSD 3NSUA 2LRWA 3V6EB 4FJYA 4LDTB 5FI0A 4F8CB 3APFA 1NBFC 2D3GA 2NPTB 1V81A 2X0SA 4DXAB 4HXDA 4GGQA 4XWXA 2K8BA 2LD9A 4M0WB 2YLMA 3E9PA 3TMPB 4HB4B 4EZLA 3ZLZA 1M7EA 3O96A 2HRJA 1E90A 2CQUA 1WYWB 1WGQA 3ZIMA 2KXJA 4DHJD 2N23A 4IG7B 2D4QA 5DPRA 2JT4B 3F0WA 5HE2A 5D6JB 2LUEA 2YVCA 1X05A 2OOBB 1NTVA 5LONB 4A6KA 3UF8A 3PGEA 1FHOA 2D9ZA 2B3AA 2JZ3B 4I6LB 2NZ8B 2YS3A 2XEWA 2GBJA 1V86A 1WF9A 2G3QB 1WFYA 4F7UP 5E6NA 3V61A 3KRXA 4GSWA 3U30A 3OLMD 3TFMA 1VBHA 2IYDB 3N32A 3CSTA 3D32A 1FHXA 3EHVA 1TXDA 2KQSA 2COCA 1X1FA 2AEHA 4JL9A 2FIFA 2Y8GA 3TW1A 3VUXA 4FULA 1WVHA 2QKMA 1YX6B 1Y5OA 1E7VA 5CX3A 4RMAA 2KWUB 1BAKA 3OAWA 4ICUA 3UIPB 3ZNGC 3WALA 4ILGB 2Z0OA 4IOYX 4E74A 3CF6E 1UZXB 3GOEA 1ISNA 3ZUNA 1SHCA 2DX5B 2DZIA 5CHWA 5DIFB 1WX7A 3L16A 2COFA 4A20A 5JZEB 1S3SG 1J8CA 1BTKA 2Y7BA 2M17A 5C1ZA 2RPQA 2ZPYA 1XKEA 2Z0QA 4A5KA 2IFSA 1Q0WB 4EOYA 4BVUC 2DYQA 4KDLB 4WJOA 2RLOA 3ZDTA 2ZVOA 5IJMA 3V5WA 1WI0A 3DOWA 3PHWB 3ZRCA 4HATB 1RFAA 1FGZA 3JVZX 4HPMB 3PS6A 2K2UA 3ZNZB 1L2NA 3QBVB 3DBSA 1AWEA 1W1HA 1ZVRA 2FCQA 1IRSA 1FGYA 4EJNA 4ASWC 3V6CB 2K39A 3WA0A 1P3RA 3DVNU 1ZKHA 4BKTA 3ECIA 1UD7A 2DA0A 2EMSA 4HK2A 2NMBA 3W1YA 2K8CA 4A6HA 4AOFA 3VVWB 2G4DB 2N9XA 3LJUX 4NPNA 1UEFA 2PPHA 1DDVA 4MT7A 1IP9A 3GYOA 4NAWA 3UQAA 2KLGA 3WAPA 2N7DA 4XX5A 3TIXA 2JVCA 1FOEA 2FDQA 3RD2A 3CXBB 2O2VB 4IM2A 2QKLA 4PNKA 2MBOA 2DZJA 4ZRJA 2ZZPB 4HPLB 1OEYJ 4ANXA 2BKFA 3KW5B 2DHIA 3IG3A 5CHFA 4TYZA 2KUPA 1X86A 5JHGA 2G35A 3A33B 1PMSA 3AULA 4EFOA 4ZYNA 4WJPA 1MKEA 1PFJA 4HDQA 2DYMA 5AEKB 3TL5A 3A9KA 5C79A 2DZMA 2KWCA 1NVLA 4ANVA 3HK0A 3HHMA 4HLEA 3GYPA 2JZZA 1KBLA 1U2BA 3KUZA 1K5DB 2MRPA 1ZC3B 2J0KA 3PREA 5J2RA 2KQ7A 2HE7A 4DBGA 2DENB 5JLJB 4JKHA 1V61A 3RZWC 3TO1A 2QHOA 4MJSA 3DVGX 3Q3FA 4K17A 1YD8U 1DBHA 1K8RB 2DN6A 1VD2A 1R4MI 1C3TA 2FCNA 2DHKA 4MGYE 3V62A 4B6HA 4FADA 2RR9A 3HQCA 2IO3B 4G0NB 2BPSA 1WXAA 2FIDA 2GBMA 1IPGA 2LWPA 1Q5WB 3R66C 2RD0A 2K6DB 4F7ZA 2CHZA 2CY5A 2GOWA 2J7QB 2L0FA 1E8ZA 4HWIB 1WGYA 3VUWA 1U5DA 4MH0E 3D8DA 3L17A 4RM9A 5KQ1A 2D9YA 2MFQA 3M1IB 3QHTA 2CY4A 3SD5A 2IBIB 3WAOA 5JP4A 4IAPA 5D3XA 4NJ7A 2UZRA 4MK0A 4LJOB 1UNRA 2KO3A 2M14A 2RGNB 4K2PA 2LGYA 3ENBA 3ML8A 1NI2A 3KUDB 4MJSB 2WWZA 3ML9A 4NQLB 4NY0A 1LW3A 3N30A 4C0AA 3PRMB 2KGXB 5HE1A 2D07B 4DDGD 4D0NB 2EKEC 3L0WB 4ICVA 1F9JA 1KZ7A 2MW5A 2KANA 1RAXA 4EUTA 2MBBB 3QX1A 2FNJB 2VRWB 3QA8A 5G55A 3ONSA 2AL3A 1Z2MA 2KC1A 3DCGA 4II3B 2DX5A 4DBBA 4KHAA 4A3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FHO A;  2D9Z A;  4WWN A;  4FJY A;  2M1M A;  2B3A A;  2H7D A;  2EJ8 A;  2JZ3 B;  2KC2 A;  4FN2 A;  4IWO A;  3T9L A;  3TBL D;  2COA A;  4HCN B;  1FXT B;  3UIN B;  3IFW B;  4G11 A;  4I6P A;  4GN1 A;  4CO7 A;  2N4F A;  4PS8 A;  4I6L B;  2NZ8 B;  1JRU A;  1ZGU B;  1WI1 A;  2PJH A;  2M38 A;  2YS3 A;  2XEW A;  4CHK A;  4K81 A;  3KRW A;  2GBJ A;  1MAI A;  3BJI A;  1V86 A;  1WF9 A;  1WFY A;  2GCL A;  2G3Q B;  5C23 A;  2L0T A;  5BO4 B;  4KZ0 A;  5KCV A;  2N1V A;  2NVU I;  4GMV A;  4F7U P;  3WAN A;  4IM3 A;  4CHM A;  5E6N A;  3V61 A;  3ODX A;  2MQJ A;  4EZJ A;  1MG8 A;  3KRX A;  2LKO A;  4W9L A;  4GSW A;  1V5M A;  1ZM0 A;  3VOQ A;  4M8M A;  5DPT A;  3U30 A;  1MIZ B;  3OLM D;  3TFM A;  2G4S A;  4GDL A;  4E71 A;  2WX1 A;  2KDB A;  4PQ0 A;  4HAZ B;  2IYD B;  3N32 A;  3W1S A;  1TTN A;  3CST A;  3B08 A;  3PP2 A;  3D32 A;  3H1U A;  1FHX A;  4G50 A;  1OY2 A;  1WJM A;  3V60 A;  1W1D A;  1EO6 A;  1L2N A;  3SYX A;  3EHV A;  1DYN A;  2PEA A;  1D3Z A;  1XCG A;  2YSZ A;  3PVU A;  1TXD A;  2M4N A;  3PPA A;  4TQ1 A;  2C7N B;  3JW0 X;  4LDT D;  2I1K A;  2KQS A;  3L54 A;  2W2X D;  3JSV A;  2COC A;  1E8X A;  5D7G A;  1X1F A;  2L3Z A;  2FUH B;  1MPH A;  2AEH A;  4JL9 A;  2FIF A;  3QAQ A;  2Y8G A;  4HAX B;  3TW1 A;  2R2O A;  4GDL B;  3VUX A;  4FUL A;  1M7R A;  2EMT A;  1U4A A;  4YON A;  2O2V A;  4WWO A;  1WY8 A;  1WVH A;  1WJN A;  2L05 A;  3L10 B;  3UIO B;  3H7S A;  2QKM A;  2UVM A;  3P6A A;  2IO2 B;  3ZKJ C;  1RJ2 A;  2IO1 B;  2CB8 A;  4I6N B;  2ADZ A;  2D9W A;  1YX6 B;  1NTY A;  1WJU A;  2L8J A;  1KLV A;  1WXV A;  3CIK A;  4PYU A;  4BBK A;  1Y5O A;  1K5G B;  1E7V A;  1EAZ A;  2KZR A;  5CX3 A;  4RMA A;  2KWU B;  1BAK A;  4MEL A;  3OAW A;  2KMA A;  1OGW A;  2XBB C;  4ICU A;  2LVP A;  4YL8 A;  1V80 A;  3UIP B;  3ZNG C;  2REX A;  2OTX A;  3WAL A;  1C1Y B;  5IAA C;  2LJ5 A;  3FEH A;  4Z2N A;  3Q3J A;  2Z0O A;  4IOY X;  4KZC A;  4E74 A;  3CF6 E;  2BYE A;  1UZX B;  2KTR A;  3GOE A;  1QZE A;  1ISN A;  3T06 A;  5JH5 C;  1WM2 A;  2KDF B;  1WG7 A;  1UPQ A;  3ZUN A;  1SHC A;  2DX5 B;  1OTR B;  3KSY A;  1KI1 B;  4KSL C;  4AUQ C;  5DH9 B;  4WJ7 A;  2DZI A;  2UZS A;  1P9D U;  5CHW A;  5JHB A;  5DIF B;  1WX7 A;  2K8H A;  1ZW7 A;  4MEM A;  2KVR A;  3L16 A;  2COF A;  3X23 A;  1BTN A;  1OQN A;  1OQY A;  4A20 A;  5JZE B;  2KJR A;  3DBH I;  3DQV A;  3X0W A;  4A6F B;  1S3S G;  1J8C A;  3RYT A;  2LI5 A;  1BTK A;  2DHZ A;  5CHV C;  2H7E A;  2Y7B A;  2KX0 A;  2M17 A;  2BGF A;  2MSE D;  2V76 A;  3A9K B;  1B55 A;  3PLU A;  4E3C A;  5D3W A;  5C1Z A;  5LLI A;  2RNR B;  3G9W A;  4WSF A;  2ELA A;  2IY1 B;  2RPQ A;  3VHT C;  1DRO A;  2D11 A;  1Q1O A;  2ZPY A;  1MK7 B;  1XKE A;  2Z0Q A;  4A5K A;  2IFS A;  2LAS A;  3PT2 B;  3SO6 A;  1Q0W B;  2JRI B;  2KTF A;  3H7P A;  4EOY A;  1V5T A;  2ZCB A;  4BVU C;  1SE9 A;  2DYQ A;  4KDL B;  4WJO A;  1H4R A;  1P98 A;  4W9J A;  4H8S A;  2KDI A;  3PZD A;  1NTI A;  1EF5 A;  1WH3 A;  2RLO A;  3ZDT A;  1QC6 A;  2ZVO A;  3SU8 X;  5IJM A;  4KIK B;  1J19 A;  3KYC D;  4W9D A;  3V5W A;  4XC2 A;  1LQB A;  2ROZ B;  1WI0 A;  3DBL I;  4WWP A;  3DOW A;  1WMH B;  3ZDM C;  3EPY A;  2CR5 A;  2V3S A;  3A1Q A;  2RSG A;  2FCS A;  4BBN C;  3PHW B;  4WJN A;  1GG3 A;  2LVQ A;  2MKR A;  3ZRC A;  4HAT B;  1RFA A;  2COP A;  2MLB A;  4DWF A;  5L83 A;  1FGZ A;  2Z59 B;  1RLF A;  2NR2 A;  3JVZ X;  1EGX A;  4HPM B;  2K25 A;  1GC7 A;  4K1R B;  2V4L A;  1XD4 A;  3PS6 A;  2LXC A;  1J0W A;  2K2U A;  2P8V A;  2RVB B;  2LVO A;  1KZG A;  1N3H A;  1WR1 A;  3ZNZ B;  2BYF A;  4Z2M B;  2DAF A;  2MP2 B;  3QBV B;  1HE8 A;  1AWE A;  1WRD B;  3DBS A;  1W1H A;  2YS5 A;  3ODO A;  4KAX B;  3IVF A;  1ZVR A;  4HAW B;  2KJ6 A;  1DDW A;  2GCJ A;  1X1M A;  2FCQ A;  1FAO A;  2NPT A;  3FP5 A;  2J0J A;  1IRS A;  3L13 A;  1FGY A;  4EJN A;  3B0A A;  4GOC A;  4ASW C;  3V6C B;  1BWN A;  2K39 A;  3NZS A;  3VH4 B;  2BKR B;  3WA0 A;  2DX1 A;  2GS0 A;  1P3R A;  1L7Y A;  1Y8R C;  3ZVR A;  1ZKH A;  3A4R A;  2ZCC A;  3DVN U;  2V1Y A;  3ECI A;  2RQ1 A;  3A8Q A;  2UYZ B;  3L08 A;  3S2A A;  3UF8 A;  4DX8 A;  4B95 A;  1WE7 A;  5HE0 A;  3M95 A;  2LGX A;  3B1L X;  5KHO A;  4PYZ A;  4KVG B;  1V89 A;  1UD7 A;  1YIW A;  1H8C A;  3MTN B;  4IC7 B;  2DA0 A;  3AI5 A;  2EMS A;  4HK2 A;  2NMB A;  4KDI C;  3W1Y A;  2K8C A;  1YJ1 A;  4A6H A;  2CKH B;  3H6N A;  3LJ3 A;  4AOF A;  1T0Y A;  2AWT A;  3VVW B;  2G4D B;  4WVF B;  2W2W A;  2DKQ A;  1GNU A;  1X1G A;  3LJU X;  4HDO A;  1V5O A;  1UEF A;  4HB2 B;  2N9X A;  3MHS D;  4NPN A;  1XD3 B;  3APC A;  2PPH A;  3P7Z A;  3HW2 B;  4GIV A;  1DDV A;  4MT7 A;  2KTR B;  3SHQ A;  5JHA A;  4B9K A;  4X57 B;  1IP9 A;  1V9J A;  1V88 A;  1ACA A;  3GYO A;  4F7H A;  3QIJ A;  2KDE B;  4NAW A;  3UQA A;  4KHB B;  5D2M B;  2MX2 A;  2KHW B;  2NBU A;  5DHF B;  2KLG A;  4NNJ B;  2BWE S;  1HB6 A;  3WAP A;  2N7D A;  4XX5 A;  1XQQ A;  3TIX A;  1QQG A;  2HTH B;  1DDM A;  2N7E A;  1V5P A;  1V6E A;  2JVC A;  5D94 A;  2M8S A;  3A9J B;  4MM3 A;  2I5F A;  1BT0 A;  1FOE A;  2L76 A;  3VQI A;  2FDQ A;  1PLS A;  4K2O A;  2MWN B;  1WM3 A;  2D10 A;  3P2B A;  4TUU A;  3RD2 A;  4FBJ B;  3CXB B;  3ZW3 A;  5EDS A;  3ULB A;  2KFK A;  3DPD A;  4MSQ B;  5DPW A;  1YX5 B;  2O2V B;  2ZNV B;  2ZNV C;  3RUI B;  4MGI E;  3KVF B;  4IM2 A;  2N9P C;  3QJZ A;  3HM3 A;  2QKL A;  4PNK A;  2WYQ A;  1M94 A;  2C9W B;  5CTR C;  2MBO A;  2VRR B;  5DI9 B;  2VKI A;  3NZU A;  1Z87 A;  5FI1 A;  2DZJ A;  2LYD A;  2LZ6 A;  4ZRJ A;  1KOT A;  1UPR A;  1P0R A;  2FCM A;  2XK5 A;  3K9P B;  3NY5 A;  1WX8 A;  1AAR A;  2ZZP B;  3DXE A;  1XT9 B;  2Y5B B;  5GOW B;  5FR6 A;  3U8Z A;  4ANU A;  1XR0 B;  2KOX A;  2JF5 A;  4HPL B;  4AWJ A;  1XOD A;  2MA9 B;  4EKU A;  4DX9 0;  2CS4 A;  3QWM A;  1OEY J;  1V49 A;  3JYU A;  3UGB B;  4BKG A;  4ANX A;  5D3Y A;  2CRF A;  2BKF A;  3KW5 B;  2DHI A;  2GBR A;  3PTF C;  1V5U A;  2N0Y A;  1KJT A;  1TBE A;  1H10 A;  1SGH A;  2C7M B;  1WZ0 A;  2AL6 A;  2J59 M;  2ROV A;  2JUO A;  2KKC A;  2XK5 B;  3IG3 A;  3QAR A;  4K7W A;  1VCB A;  4CYE A;  4LCD E;  1WGG A;  4GZU A;  5CHF A;  4BKT A;  1HB8 A;  1YQB A;  3GZN I;  4TYZ A;  1S1Q B;  1WJ1 A;  2HD5 B;  3DXC A;  5G2N A;  2BYV E;  3AXC A;  2ABD A;  4EEW A;  2KUP A;  2N9E B;  3BY4 B;  1UGM A;  4FA6 A;  3PG7 A;  1X86 A;  4N9F 4;  3QCA A;  3VTV A;  2P0H A;  2YS1 A;  4LJP B;  1PQS A;  2GBN A;  1NU2 A;  3UZT A;  4JLC A;  4WAA A;  3PVW A;  5EFX A;  2KFK B;  5JHG A;  4GDK B;  2G35 A;  3A33 B;  2JPH A;  2D9X A;  2DYB A;  3VH3 B;  1FHW A;  2VSZ A;  1WMH A;  2NCN A;  3UQB A;  2IZV B;  1FB8 A;  2MBQ A;  4EZK A;  3FSS A;  1PMS A;  2KN5 A;  4RM8 A;  3ZTC A;  2RUK B;  4L6E A;  4MY6 A;  1E8Y A;  3AUL A;  3AU4 A;  4EFO A;  3R7Q A;  4HCP B;  5AZH A;  5HKH A;  5IA7 A;  4ZYN A;  5C6R A;  2NBV B;  1W1G A;  4WJP A;  3ZO5 B;  1MKE A;  2C60 A;  2L1C A;  1PFJ A;  3I3T B;  4MGK E;  4HDQ A;  2D2Q A;  1GJZ A;  3A8P A;  3O65 B;  4MGZ E;  4ANW A;  2YRY A;  2L2I A;  2DHJ A;  2DYM A;  1LXD A;  2UWQ A;  5AEK B;  3TL5 A;  4URK A;  3KZ1 A;  5JHH A;  3A9K A;  5C79 A;  3VAW A;  1WXM A;  2DZM A;  1WR6 E;  4BBN F;  1WJ6 A;  2KWC A;  1NVL A;  1E8W A;  3OAN A;  1P6S A;  3M63 B;  1GC6 A;  4F1S A;  2JXX A;  2A5U A;  3HK0 A;  2W9N A;  2JP2 A;  3HHM A;  4PS7 A;  2LOX A;  4GMX B;  1V2Y A;  1RRB A;  2FAZ A;  4W9I A;  3ZNI D;  4BKS A;  4HAU B;  3GYP A;  3AU5 A;  1E7U A;  2JZZ A;  4HLE A;  2MWS B;  3KY9 A;  4MDK E;  1U2B A;  2OQB A;  2LBB A;  1MK9 B;  4Y94 A;  3KUZ A;  4DDI D;  1K5D B;  5AZF A;  1G6J A;  1SIF A;  3N7C A;  3CMM B;  3RT3 B;  2MRP A;  4J6I A;  4FJV B;  4K7S A;  4A3P A;  1ZC3 B;  3WAM A;  2HTH A;  4W9F A;  2J0K A;  1RRP B;  4BFR A;  3PRE A;  4XZ4 A;  2K00 A;  1Z5S B;  1OMW A;  5J2R A;  2KQ7 A;  3QK0 A;  1WX9 A;  1I42 A;  4NSW A;  4IWP A;  2HE7 A;  2MDX A;  4W9K A;  3ZRF A;  4DBG A;  4W9C A;  3NS8 A;  1ZC4 B;  1R4N I;  1WGU A;  2DEN B;  4KV2 A;  5JLJ B;  1WGD A;  3BIN A;  5J18 A;  1ZSQ A;  4TKN A;  5J3T A;  3KH0 A;  2A4Z A;  2KK8 A;  1U5G A;  3IBE A;  2CHX A;  1P1A A;  1MIX A;  2M0X A;  2J0M A;  3ULC A;  1X11 A;  1V61 A;  3ODW A;  3WYF B;  1UEL A;  4GPT B;  3RZW C;  3TO1 A;  2COD A;  2MP2 A;  2QHO A;  2YF0 A;  3DVG X;  3MJW A;  4MJS A;  4W9E A;  5E6O A;  3EEC A;  4OVU A;  2JY6 A;  2KCJ A;  2P0D A;  2HJ8 A;  2P0F A;  4CHJ A;  2OJR A;  2BF8 B;  3Q3F A;  4K7U A;  2DKP A;  2ASQ A;  4K17 A;  1YD8 U;  3HIZ A;  1DBH A;  3PSE B;  3VDZ A;  1EVH A;  1K8R B;  3K9O B;  4DHJ B;  3PLV A;  4B6W A;  1A5R A;  1IYF A;  1U29 A;  5HE3 A;  4IM0 A;  2C5L C;  2DN6 A;  2CAY A;  1AQC A;  4HB0 B;  3PEG A;  3QC8 B;  1VD2 A;  2DZK A;  5LXI B;  3MDB C;  1R4M I;  3FLV A;  1C3T A;  2PE6 B;  3PSC A;  1WIA A;  2FCN A;  5C16 A;  2DHK A;  3PRP B;  4MGY E;  3V62 A;  2D9V A;  1WJ4 A;  5DPS A;  5KHQ A;  1U5F A;  2CU1 A;  3VTW A;  4B6H A;  3RCZ A;  1P5T A;  2LXA A;  2KNB A;  4KSK C;  4FAD A;  2GJY A;  1TGZ B;  3HQC A;  2NBW B;  2IO3 B;  2RR9 A;  5L95 C;  4G0N B;  2BPS A;  1WXA A;  3R7R A;  1P3Q U;  2KMC A;  3WIM A;  5CLQ B;  2FID A;  5D3V A;  1IPG A;  2GBM A;  2RSU A;  3DBR I;  4G3X B;  2LWP A;  3T8M A;  3FM8 C;  3RCP A;  2O6V B;  1U5E A;  4FHJ A;  4GU2 A;  4IUM B;  3VFK A;  1Q5W B;  1TQZ A;  3KYD D;  2WDT B;  5TR5 A;  3R66 C;  3ML4 A;  1OEY A;  2RD0 A;  2LUL A;  2G45 B;  5J3Y A;  2DYN A;  3EC8 A;  2K6D B;  3A1Q B;  3M3J A;  2I5C A;  4F7Z A;  4JGH B;  3NOB A;  2R0D A;  2CHZ A;  5J17 A;  3AJ4 A;  2CY5 A;  1WE6 A;  2GOW A;  4M8N A;  5J3Q A;  2YT0 A;  1LM8 B;  5D27 A;  3A9J A;  4AJY B;  1UNQ A;  4P7I A;  2FJL A;  2J7Q B;  2JRH A;  1CMX B;  1KM7 A;  3A4S C;  3ALB A;  2L0F A;  1E8Z A;  3M62 B;  4FHK A;  5C5B B;  4ZRK A;  2LG1 A;  3EFU A;  4WQO B;  3SUZ A;  4HWI B;  5GMV A;  1WGY A;  5C5B A;  1I2H A;  1U5D A;  5LOP B;  3HM6 X;  4MH0 E;  3VUW A;  5KQ4 A;  1WGH A;  2K1F A;  2R09 A;  3D8D A;  3DVN V;  3N3K B;  2KJH B;  3R3M A;  4NAW B;  1ST7 A;  1WGR A;  4HHV A;  2GMI C;  3L17 A;  4RM9 A;  2MBH A;  2CHW A;  5KQ1 A;  2D9Y A;  2Z0D B;  4WJQ A;  2K6Q A;  1U27 A;  5LXH A;  2AYO B;  2MFQ A;  3M1I B;  2NS5 A;  2N1W A;  2RGF A;  3ZTD A;  4GDK A;  4OVV A;  3QHT A;  2CY4 A;  2DLW A;  2ELB A;  3F5R A;  1HBK A;  1UBI A;  1WXS A;  1WZ3 A;  2E2X A;  3RZF A;  1UBQ A;  2O6V A;  4BKS D;  4ZDV A;  4MSM B;  3SD5 A;  1Q67 A;  4HJK A;  2IBI B;  4HAY B;  3ENE A;  3NSU A;  3TCA A;  3A98 B;  4EMO A;  2LRW A;  3PHX B;  2Y8F A;  2DAJ A;  3OJ4 B;  2PZ1 A;  3V6E B;  3VXW A;  3WAO A;  5JP4 A;  4IAP A;  2KFJ A;  2XQN M;  1Y19 B;  2WH5 A;  2UZR A;  5D3X A;  3KUC B;  4HB3 B;  4MK0 A;  2L7R A;  1LB1 A;  4LDT B;  4LJO B;  2LOZ A;  4NJ6 A;  3SDL C;  5FI0 A;  4F8C B;  3PVL A;  3APD A;  1EF1 A;  2FJ9 A;  1LFD A;  1NBF C;  4HAV B;  3APF A;  3OJ3 A;  5DCN A;  3VTU A;  3PV1 A;  3D8F A;  2GBK A;  3DVG Y;  3ZVV A;  2D3G A;  4TV3 A;  4AJW A;  2K2J A;  2DFK A;  2IYB A;  2NPT B;  4ZRI A;  1UNR A;  1V81 A;  2KO3 A;  4JQW C;  2M14 A;  2RGN B;  4FLH A;  3RUL A;  4TQ0 A;  4PS3 A;  3TJP A;  2KD0 A;  4BOS C;  2EC1 A;  4DXA B;  2BWF A;  2JWZ A;  4HXD A;  4JIO U;  4GGQ A;  4DHZ B;  4XWX A;  2K8B A;  2LD9 A;  1J0G A;  4KHO A;  2C7H A;  3LDZ E;  2YLM A;  4K2P A;  3C0R B;  4M0W B;  4BOZ B;  4GB9 A;  2LGY A;  3ML8 A;  2ZPN A;  1NI2 A;  1XX0 A;  1I35 A;  3TMP B;  3KUD B;  4MJS B;  4HB4 B;  2BCJ A;  2WWZ A;  3ML9 A;  3VIA A;  2IO0 B;  2ZVN A;  4NQL B;  4EZL A;  3D8E A;  3ZLZ A;  4NY0 A;  1LW3 A;  4ANV A;  1M7E A;  3O96 A;  2HRJ A;  2W2X C;  3DXD A;  1E90 A;  2DYO A;  2CQU A;  2KX3 A;  1UH6 A;  1WYW B;  2L00 B;  2MBE A;  3CSF A;  3N30 A;  3NHE B;  4KIK A;  4NJ7 A;  5E6P A;  1WGQ A;  3ZIM A;  5DHA B;  3MPX A;  4C0A A;  1EUV B;  2O6V D;  3PRM B;  4FJZ A;  1NDD A;  2DTC A;  2KGX B;  5HE1 A;  3SNH A;  2KXJ A;  2ZEQ A;  3JSV B;  4NQK E;  4DHJ D;  1I7A A;  2N23 A;  2D07 B;  3H7P B;  4DDG D;  4D0N B;  3IHP C;  4DHZ E;  2EKE C;  2ZJD A;  2IY0 B;  3L0W B;  1F9J A;  1E5W A;  2D4Q A;  4II2 B;  4GXB A;  4IG7 B;  4ICV A;  4HVB A;  5DPR A;  1KZ7 A;  2X18 A;  2JT4 B;  4IW0 A;  5AZG A;  3ZNH B;  4DK5 A;  2MCN B;  2MW5 A;  2KAN A;  1RAX A;  3H9D A;  3W1S C;  2I1J A;  2Q13 A;  1GUA B;  3F0W A;  3QQ8 B;  4EUT A;  4W9H A;  4A6F A;  4F7G A;  5HE2 A;  2MBB B;  2Z0E B;  3QWZ B;  5D6J B;  1TZ1 A;  1UNP A;  4IFS A;  3QX1 A;  2FNJ B;  4AP4 C;  3U7D A;  2LUE A;  4IWQ A;  2VRW B;  3QA8 A;  5G55 A;  2KWV B;  3DDC B;  2KLC A;  3PRZ A;  3ONS A;  1TJ6 A;  2YVC A;  2LRU A;  2AL3 A;  4A3O A;  4W9G A;  1X05 A;  1Z2M A;  2KC1 A;  3DCG A;  4II3 B;  3TVV A;  2LGD A;  1NTV A;  2OOB B;  5L81 A;  2DX5 A;  2YT1 A;  2Z0P A;  4DBB A;  4KHA A;  5LON B;  3SV1 A;  2PE9 A;  2R2Q A;  4A6K A;  3VUY A;  5CLL B;  2WX0 A;  3PGE A; 
#chains in the Genus database with same CATH topology
 4WWN A;  3ZYY X;  3NVZ A;  4G11 A;  1UWX A;  4JKA A;  4PS8 A;  1ZGU B;  3RNC C;  3KRW A;  2J42 A;  4K3C A;  3RPF C;  2GCL A;  2L0T A;  5BO4 B;  4KZ0 A;  4QJ3 B;  5KCV A;  3Q8F A;  4GMV A;  3WAN A;  1GB1 A;  4IM3 A;  2JZP A;  3ODX A;  3VOQ A;  2WX1 A;  4HAZ B;  3W1S A;  1VBG A;  1N62 A;  2VZK B;  2BBC A;  4G50 A;  1OY2 A;  3V60 A;  1W1D A;  1DYN A;  1XCG A;  2HTM E;  3PVU A;  2C7N B;  4LDT D;  2I1K A;  2WXL A;  3JSV A;  1E8X A;  4B0M A;  2EKI A;  4GDL B;  2O2V A;  4WWO A;  2V4I B;  1WY8 A;  5BYS A;  1JWU D;  2IO2 B;  1TY2 A;  1TKG A;  2IO1 B;  1ZOY B;  2N0S B;  1T0R C;  2CB8 A;  4I6N B;  2ADZ A;  2L8J A;  1NTY A;  1WJU A;  1KLV A;  2WGS A;  3ETR A;  2V9H A;  4BBK A;  1F77 A;  2KZR A;  1L6V A;  4RH6 A;  4OSN A;  1OGW A;  2XBB C;  4YL8 A;  2REX A;  2OTX A;  2AQ3 B;  3A58 A;  3NS1 A;  3Q3J A;  4KZC A;  1IBX B;  3VR8 B;  5JH5 C;  1C4C A;  3BK2 A;  4KSL C;  4MT5 A;  5DH9 B;  4WJ7 A;  3MFG A;  1P9D U;  4MEM A;  2KVR A;  4KKI A;  3Q2A C;  2KX0 A;  2BW2 A;  2MSE D;  2V76 A;  3PLU A;  2V3P A;  4WSF A;  3VHT C;  1DRO A;  3GP7 A;  1MK7 B;  2LAS A;  4L1R A;  1MI1 A;  2KTF A;  3H7P A;  3ZJT A;  1SE9 A;  1H4R A;  4REZ A;  2MH7 A;  1NTI A;  1TS2 A;  1QC6 A;  3KYC D;  2WXJ A;  2QJL A;  1FM0 D;  4WWP A;  1WMH B;  3EPY A;  1YQ4 B;  4S17 A;  4WJN A;  1GG3 A;  2LVQ A;  2MKR A;  3LYY A;  2W3R A;  3TUO A;  4DWF A;  5L83 A;  3IXS A;  1SJE D;  2PIA A;  1RLF A;  1EGX A;  4JKD A;  2K25 A;  4K1R B;  2V4L A;  1F52 A;  3P4R B;  1J0W A;  2P8V A;  2RVB B;  4LNK A;  1KZG A;  1WR1 A;  1E7P B;  2DAF A;  1AN8 A;  5IO9 A;  3ODO A;  4KGT A;  3NVY A;  2KJ6 A;  1X1M A;  2V0G A;  3L13 A;  1BXT A;  3DBR B;  3NZS A;  2GS0 A;  3AE2 B;  3L08 A;  2ZCC A;  4N59 A;  2RQ1 A;  2KMM A;  4B95 A;  4DX8 A;  5GXG B;  4JKE A;  5KHO A;  4ZRP A;  1NEN B;  1V89 A;  3AI5 A;  4KDI C;  4JKB A;  1QIL A;  1YJ1 A;  1T0Y A;  2K8E A;  5G5G A;  4WVF B;  3IT6 B;  2Z13 A;  1V5O A;  3MHS D;  3B9J A;  5JHA A;  4RCO A;  3TEZ A;  4LLG M;  4B9K A;  1V9J A;  2KDE B;  2M19 A;  3R2I A;  2SEB D;  2KHW B;  1E9M A;  2BB5 A;  4XWW A;  4O1N A;  1VR9 A;  2BWE S;  1XQQ A;  3P4S B;  2HTH B;  1DDM A;  2N7E A;  2KAJ A;  3A9J B;  1L0V B;  1BT0 A;  2L76 A;  1V1P B;  1PLS A;  5BYQ A;  3ZW3 A;  1MVK A;  4MSQ B;  5DPW A;  1YX5 B;  2L83 A;  3RUI B;  2GI9 A;  1KRH A;  1NYQ A;  4M0W A;  3P4Q B;  3LB8 C;  2WYQ A;  3AEF B;  1M94 A;  1IUE A;  2VKI A;  5LG4 B;  1KOT A;  1JDE A;  3U52 E;  2XK5 A;  1VZ8 A;  3NY5 A;  1HQR D;  1AAR A;  2KT7 A;  5FR6 A;  2Y5B B;  4ANU A;  1XR0 B;  4AWJ A;  1XOD A;  2E6X A;  2PVO D;  4DX9 0;  2CS4 A;  3QWM A;  4BKG A;  2R82 A;  2ICI A;  3VR9 B;  3GB1 A;  3PTF C;  4D6W A;  1TBE A;  1KJT A;  1H10 A;  1SGH A;  4M01 A;  1WZ0 A;  2AL6 A;  3ZNH B;  3QAR A;  1VCB A;  1YQB A;  3GZN I;  1S1Q B;  3AE8 B;  3AXC A;  4FA6 A;  1UGM A;  1ZPS A;  3NZ3 A;  1H8C A;  3RNF C;  5EFX A;  2KFK B;  2JPH A;  4YTM B;  2VSZ A;  2AX5 A;  4KGS A;  2IZV B;  1FB8 A;  1KC7 A;  4TMA B;  4OZB A;  3FSS A;  4RM8 A;  1N63 A;  1R4N B;  2ON8 A;  2KDM A;  3J9C A;  3R7Q A;  4HCP B;  1TZO A;  2W54 A;  5C6R A;  2TSS A;  4ILH A;  1W1G A;  4YSX B;  2C60 A;  2L1C A;  2FUG 1;  1PFD A;  1UNS A;  4MGZ E;  1D3Z A;  2DIK A;  5JHH A;  1WJ6 A;  4IOI E;  1E8W A;  2JXX A;  2A5U A;  2W9N A;  2JP2 A;  1V2Y A;  3ZNI D;  3AU5 A;  2OQB A;  1MK9 B;  3U7Z A;  3BYY B;  3N7C A;  3W5V B;  3RT3 B;  4FJV B;  4ILJ A;  4K7S A;  4BFR A;  4XZ4 A;  2K00 A;  2PVG C;  1I42 A;  4NSW A;  1K51 A;  4IWP A;  2MDX A;  3ZRF A;  3DWG C;  1WGU A;  1ZSQ A;  5J3T A;  2LGI A;  2A4Z A;  2KK8 A;  2CHX A;  2M0X A;  1VZ6 A;  3Q6B A;  1DOX A;  2COD A;  2YF0 A;  3MJW A;  2HJ8 A;  2P0F A;  3NJT A;  2BF8 B;  2DKP A;  2ASQ A;  3K9O B;  1A5R A;  4C4V A;  2DZK A;  2PE6 B;  3PSC A;  4JKG A;  3PRP B;  1ZXH A;  5DPS A;  3KWV A;  1U5F A;  3VTW A;  2W82 A;  2D3A A;  4KKJ A;  2KNB A;  1TGZ B;  3T8M A;  2RSU A;  3W5U B;  4HKQ A;  1U5E A;  3HIE A;  1TQZ A;  5TR5 A;  1HXY D;  1SE4 A;  1SJH D;  2WXI A;  2LUL A;  2G45 B;  3EC8 A;  2DYN A;  3U12 A;  1ZDX A;  2MJ3 A;  3A1Q B;  3M3J A;  4XDD A;  2YT0 A;  1UNQ A;  3A4S C;  3ALB A;  1CMX B;  4FHK A;  4ZRK A;  3EFU A;  3HM6 X;  1I2H A;  1V1O A;  5KQ4 A;  2R09 A;  3DVN V;  5C2T B;  3R3M A;  2RPV A;  1WGR A;  4HHV A;  2GMI C;  2CHW A;  3AEB B;  4USA A;  2WHI A;  2WNM A;  3B2F A;  2AYO B;  2NS5 A;  4GDK A;  4OVV A;  5EE9 A;  2DLW A;  1HBK A;  3VRB B;  4ZDV A;  4MSM B;  1Q67 A;  1JW9 D;  3EFC A;  4HAY B;  1DIK A;  3A98 B;  4EMO A;  3PHX B;  2Y8F A;  2KFJ A;  3KUC B;  1C77 A;  2LOZ A;  3DCX A;  3N1Z C;  5FK9 C;  1EF1 A;  2FJ9 A;  3OJ3 A;  3VTU A;  4HAV B;  3OWE B;  3PV1 A;  2GBK A;  3CWI A;  4AJW A;  2IYB A;  4PS3 A;  4GOU A;  2BWF A;  3DWM A;  2SAK A;  1J0G A;  1PUT A;  3I9V 1;  3LDZ E;  3C0R B;  5HFY A;  4BOZ B;  1XX0 A;  1AYF A;  2BCJ A;  2IO0 B;  3D8E A;  2W2X C;  3DXD A;  3QJZ A;  4OT1 A;  2MBE A;  3CSF A;  3NHE B;  4KIK A;  4MM3 B;  5E6P A;  5DHA B;  3MPX A;  2PLP A;  1EUV B;  2O6V D;  2DTC A;  2ZEQ A;  1SE2 A;  4NQK E;  3H7P B;  4DHZ E;  3IHP C;  2IY0 B;  1E5W A;  4HVB A;  3TEY A;  2X18 A;  1XLN A;  5AZG A;  1M4V A;  2MCN B;  1P7E A;  3H9D A;  2I1J A;  2Q13 A;  1QLB B;  2WXF A;  4W9H A;  2K49 A;  1UNP A;  2E3T A;  4AP4 C;  1N5W A;  3U7D A;  4IWQ A;  2KWV B;  3DDC B;  1TJ6 A;  2Z8L A;  2LRU A;  4JK8 A;  4W9G A;  3TVV A;  1YJJ A;  5L81 A;  1YN5 A;  2YT1 A;  2R2Q A;  3ZDM C;  5D3D A;  2WX0 A;  3TEW A;  2PTL A;  3N9Y C;  2M1M A;  3T9L A;  2EJ8 A;  4FN2 A;  4IWO A;  3TBL D;  3NWF A;  4HCN B;  2BQQ A;  4GN1 A;  5EE3 A;  1JRU A;  1WI1 A;  2PJH A;  4CHK A;  4K81 A;  1AW7 A;  1MAI A;  4HSI A;  3BJI A;  5C23 A;  3AMZ A;  2WXP A;  2G1E A;  4CHM A;  3NW8 A;  1ROE A;  4W9L A;  4M8M A;  1V5M A;  1ZM0 A;  5DPT A;  2G4S A;  4PQ0 A;  1TTN A;  3B08 A;  3PP2 A;  1C76 A;  3H1U A;  2PEA A;  3CIR B;  2JWU A;  3PPA A;  5IKC M;  4A90 A;  5D7G A;  1HA5 A;  2FUH B;  1MPH A;  2WXR A;  1NEK B;  1L0X B;  3QAQ A;  2R2O A;  4JE3 B;  1M7R A;  1JWA D;  3DHI C;  1U4A A;  4AQ7 A;  4YON A;  1WJN A;  1WXQ A;  2L05 A;  3P6A A;  3ZKJ C;  1NI3 A;  4PYU A;  4ZYS A;  1EAZ A;  1HZ6 A;  4JK7 A;  4MEL A;  2KMA A;  2LVP A;  1V80 A;  3FAH A;  1C1Y B;  5IAA C;  4Z2N A;  2MJE A;  4P1B C;  2BYE A;  2KTR A;  3T06 A;  2GRI A;  3MC0 B;  2KDF B;  1WG7 A;  1UPQ A;  3KSY A;  1KI1 B;  2WP9 B;  4AUQ C;  5HG2 A;  4IDI A;  5JHB A;  5MPO A;  1HZ5 A;  2K8H A;  1ZW7 A;  1LGR A;  3X23 A;  1BTN A;  1OQY A;  2KJR A;  3X0W A;  3RYT A;  1JCK B;  2LI5 A;  1NVI D;  3P42 A;  3A9K B;  5LLI A;  2IY1 B;  3G9W A;  2D11 A;  1Q1O A;  4JKF A;  3SO6 A;  3GS2 A;  2RMM A;  3DHH C;  1I4X A;  2MEK A;  4W9J A;  4H8S A;  2QIE B;  2X38 A;  3PZD A;  3ABV B;  4KIK B;  4XC2 A;  4W9D A;  2BS3 B;  1GPX A;  2ROZ B;  3DBL I;  3A1Q A;  2MLB A;  2COP A;  1LO5 D;  2BVC A;  3TSS A;  3ZGZ A;  2Z59 B;  2NR2 A;  4JK9 A;  1GC7 A;  2GB1 A;  1XD4 A;  2LXC A;  1T6B X;  2LVO A;  2QDF A;  2BYF A;  4Z2M B;  2MP2 B;  3IVF A;  1DDW A;  2GCJ A;  3Q14 C;  2J0J A;  4LNN A;  3B0A A;  4ZHP A;  3VH4 B;  1Y56 A;  2BKR B;  1L7Y A;  1B1Z A;  1L0Y B;  3ZVR A;  1F2R I;  1Y8R C;  3A4R A;  5IOI A;  3A8Q A;  2UYZ B;  1WE7 A;  5HE0 A;  3M95 A;  4IC7 B;  3H6N A;  1SXT A;  1VDV A;  1SIJ A;  4QJ5 B;  5JXV A;  2DKQ A;  2Y5P A;  1GNU A;  1X1G A;  1WSP A;  4HDO A;  2I2Y A;  1XD3 B;  3P7Z A;  4GIV A;  5H92 C;  3SHQ A;  2WDQ B;  4X57 B;  5D3I B;  2QC8 A;  1AWD A;  1ACA A;  4F7H A;  3QIJ A;  4KX6 B;  4KHB B;  5D2M B;  4US8 A;  2NBU A;  4NNJ B;  1HB6 A;  2OED A;  5D94 A;  2JX5 A;  1V5P A;  1V6E A;  1FRR A;  2M8S A;  2I5F A;  3HUI A;  3TEX A;  3VQI A;  2MWN B;  2D10 A;  5EDS A;  4A9A A;  1SEB D;  2ZNV B;  2ZNV C;  1YJI A;  3HM3 A;  3BII D;  4D2K A;  2C9W B;  3NZU A;  2LYD A;  4OVZ A;  1PGX A;  1WX8 A;  3DXE A;  1XT9 B;  5GOW B;  2JF5 A;  3U2S C;  1V49 A;  2L32 A;  3JYU A;  5D3Y A;  2LHE A;  2CRF A;  1ZDV A;  2N0Y A;  2JUO A;  2C7M B;  2XK5 B;  2ROV A;  3MC9 A;  4K7W A;  4LCD E;  4R3D A;  2PKO A;  4GZU A;  1UF0 A;  4YXD B;  5G2N A;  1WJ1 A;  1PGA A;  2N9E B;  1I4G A;  3BY4 B;  3PG7 A;  4N9F 4;  3VTV A;  2P0H A;  2YS1 A;  4LJP B;  2GBN A;  1NU2 A;  4WAA A;  3PVW A;  4YSZ B;  3AV8 A;  3VH3 B;  1WMH A;  2NCN A;  1V1P A;  3UQB A;  3UI3 A;  2DWQ A;  3I63 C;  2JSV X;  2KN5 A;  5IRS A;  3ZJV A;  1T3Q A;  2BTE A;  2RUK B;  4L6E A;  1J7B A;  1E8Y A;  2KWD A;  3AU4 A;  3BVM A;  5AZH A;  4UDU C;  5IA7 A;  2NBV B;  1V97 A;  2IND C;  3ZO5 B;  3ZJU A;  3I3T B;  2D2Q A;  1GJZ A;  3A8P A;  4ANW A;  3AN1 A;  1HTQ A;  2L2I A;  2UWQ A;  4URK A;  3PO0 A;  3KZ1 A;  4ARC A;  3VAW A;  4BBN F;  2KN4 A;  3M63 B;  1GC6 A;  3NWD A;  2LOX A;  4GMX B;  2FAZ A;  2MWS B;  3KY9 A;  2WDR B;  4Y94 A;  1G6J A;  3CMM B;  4J6I A;  2JYE A;  4N6E B;  3SBT A;  3WAM A;  2KQ4 X;  1RRP B;  1Z5S B;  3QK0 A;  1ZUD 2;  1QKZ A;  1ZC4 B;  1XLQ A;  3BZD B;  5J18 A;  3BIN A;  4TKN A;  3IBE A;  1U5G A;  2J0M A;  3ULC A;  3RNG C;  3ODW A;  1UEL A;  2MP2 A;  5E6O A;  2YT2 A;  3EEC A;  4OVU A;  2JY6 A;  2P0D A;  1ET6 A;  4RGN A;  4CHJ A;  2OJR A;  3P4P B;  4RGT A;  1EVH A;  4DHJ B;  3URY A;  1U29 A;  5HE3 A;  3EGR A;  2C5L C;  2CAY A;  1AQC A;  4QJ4 B;  3PEG A;  4P6V F;  5JVL A;  5LXI B;  3SFE B;  3BVG A;  3RCZ A;  1P5T A;  2LXA A;  4KSK C;  2K0P A;  4C4V B;  2NBW B;  5L95 C;  3R7R A;  2BS2 B;  1TT5 B;  4MAC A;  2KR0 A;  5CLQ B;  4YSY B;  3E66 A;  5D3V A;  3DBR I;  1QF6 A;  3FM8 C;  3RCP A;  2O6V B;  4GU2 A;  4FHJ A;  3VFK A;  4IUM B;  3KYD D;  4HKZ E;  2BS4 B;  2W55 A;  1TKE A;  3ML4 A;  1MHX A;  1FO4 A;  1EM7 A;  2HDE A;  1WRI A;  3HSA A;  5J17 A;  3AJ4 A;  1WE6 A;  5J3Q A;  1LM8 B;  3AE6 B;  5D27 A;  4AJY B;  4P7I A;  2FJL A;  1A70 A;  2JRH A;  1KM7 A;  5BYR A;  3SU8 X;  3E9O A;  2LG1 A;  3SUZ A;  4P1C C;  4EE2 A;  1IBX A;  5C5B A;  1QOF A;  3KLS X;  2K1F A;  2ZW1 A;  3N3K B;  1GGO A;  1L4Z B;  4NAW B;  1ST7 A;  4WJQ A;  4LK0 M;  1U27 A;  5LXH A;  3F5R A;  1WXS A;  1UBI A;  4YTP B;  1SF0 A;  1HEZ E;  1UBQ A;  2O6V A;  4HJK A;  3ENE A;  3TCA A;  2DAJ A;  3OJ4 B;  2PZ1 A;  3VXW A;  2XQN M;  1Y19 B;  2WH5 A;  2LMC A;  3SDL C;  4HB3 B;  2L7R A;  1LB1 A;  2NBV A;  2RDB C;  3PVL A;  2QCZ A;  2INC C;  1F2R C;  2YEP F;  1LFD A;  3APD A;  5DCN A;  1JQ4 A;  3D8F A;  3DVG Y;  3ZVV A;  4TV3 A;  1DYQ A;  2K2J A;  3SBG A;  2DFK A;  2IGD A;  4ZRI A;  4HPP A;  4JQW C;  3RUL A;  4TQ0 A;  4FLH A;  2QIL A;  1I7H A;  2KD0 A;  3TJP A;  4BOS C;  2EC1 A;  2JWZ A;  4DHZ B;  4JIO U;  1FXI A;  4KHO A;  2C7H A;  4GB9 A;  1PYW D;  2ZPN A;  2WXN A;  3KWL A;  3DBH B;  1I35 A;  3VIA A;  2ZVN A;  4NJ6 A;  4C80 A;  2L00 B;  2DYO A;  2KX3 A;  1UH6 A;  3IAS 1;  2G9H D;  3ZXR A;  4K3B A;  2WQY B;  4FJZ A;  4BKS A;  1NDD A;  3SNH A;  1I7A A;  2HJ1 A;  2LUM A;  2ZJD A;  4II2 B;  4GXB A;  2FJU B;  2KIE A;  2CJN A;  4IW0 A;  2WXO A;  4DK5 A;  3W1S C;  4QAY A;  1GUA B;  1DOI A;  2V3N A;  3QQ8 B;  4A6F A;  4F7G A;  3QWZ B;  2Z0E B;  1TZ1 A;  4IFS A;  3PRZ A;  2KLC A;  2MJD A;  4A3O A;  2ONQ A;  2LGD A;  3V05 A;  2Z0P A;  3AM9 A;  2PE9 A;  3SV1 A;  3VUY A;  1DOY A;  5CLL B;  4B6W A;  1EWY C;  1XLO A;  2H7D A;  2KC2 A;  4RF0 A;  2COA A;  1FXT B;  3UIN B;  3IFW B;  4I6P A;  4CO7 A;  2N4F A;  2M38 A;  1VRA B;  2XNA C;  1K52 A;  2BB6 A;  2JU6 X;  2N1V A;  3BYT B;  2NVU I;  4GLS C;  2MQJ A;  4EZJ A;  1MG8 A;  2LKO A;  1MIZ B;  1QOA A;  4GDL A;  4E71 A;  2KDB A;  2JQR B;  1WJM A;  1EO6 A;  2LEK A;  3SYX A;  4XGA B;  1OFF A;  2YSZ A;  2M4N A;  1T0Q C;  4TQ1 A;  3JW0 X;  3L54 A;  2W2X D;  1C4A A;  2L3Z A;  3Q3N C;  3DBL B;  4HAX B;  3B2G A;  1JAL A;  3NRZ A;  2EMT A;  1VZ7 A;  1FD6 A;  1ZP0 B;  4Q2J A;  3L10 B;  3UIO B;  3H7S A;  1TS3 A;  2UVM A;  3OG5 A;  3P63 A;  2IGG A;  1RJ2 A;  1F1H A;  2NTS A;  2D9W A;  1WXV A;  3CIK A;  1TJE A;  1K5G B;  1TIF A;  4LNI A;  3FC4 A;  1R7S A;  2LJ5 A;  3FEH A;  5I2M A;  3DHG C;  1QZE A;  1WWT A;  1WM2 A;  4XWT A;  1OTR B;  1Q10 A;  2EEL A;  2W3S A;  2UZS A;  1OQN A;  1ZE3 D;  3MHZ A;  1KFY B;  3LXF A;  3DBH I;  3DQV A;  2GUM A;  4A6F B;  2DHZ A;  5CHV C;  2H7E A;  4E3C A;  2BGF A;  2IPK D;  1B55 A;  5D3W A;  4ITK A;  2RNR B;  2YEP B;  2ELA A;  1P7F A;  3PT2 B;  1KLU D;  2JRI B;  1V5T A;  2ZCB A;  3AE7 B;  1FXA A;  1XEE A;  1FNW A;  3Q8B A;  1P98 A;  2KDI A;  1ESF A;  1WH3 A;  1EF5 A;  3RN9 C;  1J19 A;  2R2Y A;  1SE3 A;  1LQB A;  4YT0 B;  3B77 A;  2CR5 A;  2V3S A;  4BBN C;  2RSG A;  2FCS A;  4LNF A;  3KQ4 A;  4ZRQ A;  1K50 A;  2J52 A;  1QT9 A;  1N3H A;  3JSV B;  1YN3 A;  1HE8 A;  1WRD B;  3W9C B;  2YS5 A;  4KAX B;  1JWM D;  1SBB B;  4HAW B;  2D5G A;  3E9L A;  1FAO A;  1KF6 B;  2NPT A;  3FP5 A;  1KLG D;  4GOC A;  3Q3O C;  5HI1 A;  4L23 A;  1XF5 L;  3P1M A;  3R2T A;  1BWN A;  2DX1 A;  4JKG B;  2V1Y A;  4JKC A;  3S2A A;  4WIP A;  2LGX A;  3B1L X;  4PYZ A;  4KVG B;  1YIW A;  3MTN B;  2CKH B;  3LJ3 A;  1JRO A;  3AEA B;  4JX1 C;  2AWT A;  2KVZ A;  2W2W A;  3MP9 A;  1N6Z A;  4HB2 B;  3APC A;  3HW2 B;  2KTR B;  1J7C A;  1V88 A;  3BWU D;  3NG0 A;  5TSS A;  2MX2 A;  2AQ1 B;  4XDC A;  3W2D A;  5IP4 D;  5DHF B;  5IN7 A;  2WDV B;  2K22 A;  1QQG A;  1E0Z A;  4MM3 A;  4K2O A;  1WM3 A;  3P2B A;  4OZA A;  4TUU A;  4FBJ B;  1CK1 A;  4OHJ A;  3ULB A;  2KFK A;  3DPD A;  5I2S A;  2WU5 B;  5BMG A;  4MGI E;  3KVF B;  1F0Z A;  2N9P C;  5CTR C;  2VRR B;  5DI9 B;  1Z87 A;  5FI1 A;  2LZ6 A;  1N61 A;  1UPR A;  1GOZ A;  1P0R A;  2FCM A;  3K9P B;  3EUB 2;  4ACF A;  1RFK A;  3U8Z A;  2KOX A;  2MA9 B;  4EKU A;  3MC8 A;  3UGB B;  1VJK A;  2GBR A;  1V5U A;  1WYG A;  2KKC A;  2J59 M;  1TS5 A;  2R61 A;  4CYE A;  1WGG A;  1HB8 A;  3AH7 A;  2DLB A;  2HD5 B;  3DXC A;  4EEW A;  2BYV E;  2ABD A;  3QCA A;  1PQS A;  1C79 A;  4JLC A;  3UZT A;  4GDK B;  2KIG A;  1EWC A;  2D9X A;  2DYB A;  2WU2 B;  1FHW A;  3ZXV A;  2GLS A;  2MBQ A;  4EZK A;  3U4E G;  3ZTC A;  2LJI A;  5LNK 1;  4MY6 A;  4L1B A;  5HKH A;  1YNT E;  3N20 C;  4A8X C;  1DGJ A;  3SR6 A;  4MGK E;  4JWS C;  2XN9 C;  3O65 B;  2YRY A;  2DHJ A;  1LXD A;  1WXM A;  1IGC A;  1WR6 E;  3AE1 B;  4F1S A;  3OAN A;  1P6S A;  2FE8 A;  4PS7 A;  1RRB A;  4W9I A;  4HAU B;  1E7U A;  4MDK E;  4DDI D;  2LBB A;  5AZF A;  1SIF A;  4RNA A;  2HTH A;  4W9F A;  4C00 A;  1OMW A;  4YWG G;  1WX9 A;  2JYT A;  2L52 A;  1FMA D;  1XCQ L;  1N5X A;  4W9K A;  4W9C A;  3NS8 A;  1R4N I;  4KV2 A;  1WGD A;  4HJG E;  3KH0 A;  1P1A A;  1MIX A;  4XYC A;  4WWM A;  1X11 A;  3WYF B;  4DXG A;  4GPT B;  3FVC A;  1E6E B;  4W9E A;  2KCJ A;  3AE3 B;  2NTT A;  4K7U A;  1HTO A;  3HIZ A;  3PSE B;  4CSQ A;  5HHD G;  3VDZ A;  1IYF A;  3PLV A;  4WUR A;  4IM0 A;  3RFZ B;  4HB0 B;  2K3U A;  3QC8 B;  3MDB C;  3FLV A;  3RMK C;  1WIA A;  5C16 A;  2D9V A;  1WJ4 A;  1I4Q A;  3RNB C;  5KHQ A;  2CU1 A;  3PZ8 A;  1KH0 A;  2GJY A;  3BVZ A;  4LTU A;  1P3Q U;  2KMC A;  3WIM A;  1SB3 C;  4G3X B;  2J4X A;  1QOG A;  2WDT B;  1OEY A;  4LNO A;  5J3Y A;  2X8X X;  2JXT A;  4M00 A;  2I5C A;  4JGH B;  2H88 B;  3NOB A;  2R0D A;  4M8N A;  3A9J A;  3M62 B;  5C5B B;  4WQO B;  3EA6 A;  5GMV A;  3WCQ A;  2RRF A;  2OJW A;  1EU3 A;  5LOP B;  1WGH A;  2KJH B;  1BUI C;  3Q3M C;  2MBH A;  3GZN B;  2Z0D B;  2K6Q A;  2RGF A;  3ZTD A;  2M0A A;  2N1W A;  2ELB A;  1WZ3 A;  3T3N A;  2E2X A;  3RZF A;  4BKS D;  3NSU A;  2LRW A;  3V6E B;  1TS4 A;  4QXA B;  4FJY A;  4OW0 A;  3C19 A;  4LDT B;  1JRP A;  5FI0 A;  4F8C B;  1YOV B;  3APF A;  1NBF C;  2ZW0 A;  1ZYI A;  2D3G A;  2NPT B;  1V81 A;  2D3B A;  2H89 B;  3FKY A;  4BZA A;  2X0S A;  1I4H A;  4DXA B;  4HXD A;  4GGQ A;  4XWX A;  2K8B A;  2LD9 A;  1T77 A;  4M0W B;  2YLM A;  3E9P A;  2FBW B;  2BT6 A;  3OHM B;  3TMP B;  4HB4 B;  1VLB A;  4EZL A;  3ZLZ A;  1M7E A;  3O96 A;  2HRJ A;  1E90 A;  1MHH E;  3E56 A;  2CQU A;  1WYW B;  2KAC A;  2Y5C A;  1UUP A;  1WGQ A;  3ZIM A;  1YMH E;  2DNF A;  2KXJ A;  4DHJ D;  2QSD A;  4ZOH C;  2N23 A;  3AE5 B;  2WXK A;  1IGD A;  2UU7 A;  3I57 A;  4IG7 B;  2D4Q A;  4NAM A;  1UGJ A;  1FIQ A;  5DPR A;  2JT4 B;  1XXG A;  2ACZ B;  4L2Y A;  3F0W A;  5HE2 A;  2N9K A;  2LHD A;  5D6J B;  1L5P A;  2LUE A;  3E9S A;  3HRD D;  4GNK B;  1RWS A;  2YVC A;  1X05 A;  2OOB B;  3NUH B;  1NTV A;  2K9X A;  5LON B;  4A6K A;  3UF8 A;  3PGE A;  1FHO A;  2D9Z A;  4PK1 A;  2B3A A;  2JZ3 B;  4US9 A;  2IJ0 A;  4I6L B;  2NZ8 B;  3VRA B;  2YS3 A;  2XEW A;  2CU3 A;  2GBJ A;  1NYR A;  1E10 A;  1V86 A;  1WF9 A;  2DBY A;  1WFY A;  2G3Q B;  4F7U P;  2IGH A;  5E6N A;  3V61 A;  3KRX A;  4GSW A;  3U30 A;  3OLM D;  3TFM A;  3GE3 C;  2M56 B;  1VBH A;  2IYD B;  3N32 A;  4RFB A;  3CST A;  3D32 A;  1FHX A;  1FPY A;  2NMQ A;  2D3C A;  3EHV A;  3N1X C;  1XO3 A;  4ARI A;  1TXD A;  1KTK A;  2KQS A;  2COC A;  1X1F A;  3C8Y A;  3HVD A;  2AEH A;  4JL9 A;  2FIF A;  2PW9 A;  2Y8G A;  3TW1 A;  5AUI A;  3VUX A;  2MHJ A;  4FUL A;  2N9L A;  2Q5W D;  2KYW A;  2Z4D A;  1FFU A;  1WVH A;  5H8Y E;  2QKM A;  3BK1 A;  3NVW A;  1C78 A;  1L4D B;  1YX6 B;  1UWM A;  2RDH A;  1Y5O A;  2INN E;  1E7V A;  5CX3 A;  4RMA A;  2KWU B;  1BAK A;  1RYJ A;  3OAW A;  4ICU A;  3UIP B;  3ZNG C;  3WAL A;  4ILG B;  3AE4 B;  2Z0O A;  4IOY X;  4E74 A;  3CF6 E;  1UZX B;  3GOE A;  1ISN A;  2N7J A;  3AEG B;  3ZUN A;  2VZK D;  1SHC A;  2DX5 B;  1MJD A;  3SFD B;  1JWB D;  4HEA 1;  2DZI A;  5CHW A;  5E6J A;  5DIF B;  1WX7 A;  4HRS A;  3L16 A;  2COF A;  4A20 A;  5JZE B;  3L4P A;  1S3S G;  1J8C A;  2CJO A;  1BTK A;  2Y7B A;  2M17 A;  5C1Z A;  2RPQ A;  1GB4 A;  2ZPY A;  1XKE A;  2Z0Q A;  4A5K A;  2IFS A;  3FIL A;  1Q0W B;  4WH4 A;  1YQ3 B;  4EOY A;  4BVU C;  2DYQ A;  4KDL B;  4WJO A;  2LGS A;  2RLO A;  3ZDT A;  2ZVO A;  5IJM A;  2AQ2 B;  3V5W A;  1WI0 A;  2WXG A;  3DOW A;  3PHW B;  4HRO A;  3ZRC A;  4HAT B;  1RFA A;  3H8H A;  4P16 A;  1FGZ A;  3JVZ X;  4HPM B;  4S0R A;  3PS6 A;  1FEH A;  2K2U A;  3ZNZ B;  1ZXI A;  1L2N A;  3QBV B;  3DBS A;  1AWE A;  1W1H A;  1ZVR A;  2FCQ A;  4KGR A;  1FCC C;  1IRS A;  1B9R A;  1FGY A;  4EJN A;  2ZKM X;  4ASW C;  3V6C B;  2WXH A;  2K39 A;  4WQM A;  3WA0 A;  1P3R A;  3DVN U;  1ZKH A;  2I38 A;  4BKT A;  3ECI A;  3AEE B;  1MG4 A;  1UD7 A;  3AB5 A;  1QQR A;  2DA0 A;  2EMS A;  4HK2 A;  2NMB A;  3W1Y A;  2K8C A;  4A6H A;  4AOF A;  4C7Y A;  1OQR A;  3VVW B;  2G4D B;  3IT4 B;  2N9X A;  3LJU X;  3GE8 C;  4NPN A;  1UEF A;  4B0E A;  2PPH A;  5I4D A;  1DDV A;  4MT7 A;  3IAM 1;  3NWA A;  1IP9 A;  3GYO A;  2Y3A A;  4NAW A;  3UQA A;  4TSS A;  1FNU A;  3Q8C A;  2VH1 A;  1CQV A;  2KLG A;  5BMH A;  2Z14 A;  1ACC A;  3WAP A;  2N7D A;  4XX5 A;  3TIX A;  1C9F A;  2JVC A;  1FOE A;  1XLP A;  2FDQ A;  4A6Q A;  4FXC A;  3RD2 A;  3CXB B;  1TYG B;  1FRD A;  4RGM A;  4AS1 A;  2O2V B;  2L1A A;  2QEJ C;  1D5Z C;  2J53 A;  4IM2 A;  2QKL A;  4PNK A;  1MFW A;  2MBO A;  2DZJ A;  4ZRJ A;  2WXM A;  1FNV A;  3N1Y C;  1ET9 A;  1D4B A;  2ZZP B;  2PMV A;  2WXQ A;  4HPL B;  2WS3 B;  1OEY J;  4DQO C;  4ANX A;  2BKF A;  3KW5 B;  2DHI A;  3R8B A;  4JPS A;  3IG3 A;  5CHF A;  3ZQ4 A;  1T5X D;  4TYZ A;  5EE1 A;  2KUP A;  5FKA C;  1X86 A;  2Z59 A;  1MPE A;  5JHG A;  1STE A;  2G35 A;  3A33 B;  1PMS A;  5BMI A;  3AUL A;  4EFO A;  4ZYN A;  3AEC B;  4WJP A;  1MKE A;  3Q8A A;  1PFJ A;  4HDQ A;  1EU4 A;  1ENF A;  2DYM A;  5AEK B;  3TL5 A;  3A9K A;  5C79 A;  2DZM A;  4IKG A;  5EE0 A;  2KWC A;  5FR3 A;  1NVL A;  4J3O D;  4ANV A;  3HK0 A;  3HHM A;  1D5M C;  1C4P A;  4HLE A;  3GYP A;  2JZZ A;  1KBL A;  1U2B A;  3KUZ A;  1JML A;  1K5D B;  2MRP A;  1SSN A;  4XE0 A;  1ZC3 B;  2J0K A;  3PRE A;  5J2R A;  2KQ7 A;  2VH2 A;  2KUQ A;  2HE7 A;  1QOB A;  4DBG A;  4M02 A;  2DEN B;  5JLJ B;  4H2A A;  1BML C;  4C7Z A;  4JKH A;  1J7A A;  5T8I A;  1V61 A;  3AED B;  3RZW C;  3TO1 A;  2QHO A;  4MJS A;  3DVG X;  1I4P A;  2OHF A;  4C56 C;  3Q3F A;  4K17 A;  1GAQ B;  1YD8 U;  1DBH A;  1D6E C;  1K8R B;  1FCL A;  2DN6 A;  1VD2 A;  3AE9 B;  1R4M I;  1C3T A;  1PDX A;  2FCN A;  4RF1 A;  2DHK A;  4MGY E;  3V62 A;  2QMT A;  1WGK A;  4B6H A;  4FAD A;  4BAX A;  2RR9 A;  1XCT L;  3HQC A;  2IO3 B;  4G0N B;  2BPS A;  1WXA A;  2RDG A;  5G5H A;  1RM6 C;  1T0S C;  2FID A;  2GBM A;  1IPG A;  2LWP A;  1PGB A;  4PT5 A;  1Q5W B;  1CJE A;  3Q69 A;  3R66 C;  3RI7 C;  2RD0 A;  4DXF A;  4CQN A;  2BYT A;  3V3X A;  2K6D B;  1TKY A;  4F7Z A;  2CHZ A;  2CY5 A;  2GOW A;  4ZHO A;  4N58 A;  2J7Q B;  2L0F A;  1E8Z A;  1L6U A;  4HWI B;  1WGY A;  3VUW A;  1U5D A;  4MH0 E;  2WLB A;  4KHB A;  1OQQ A;  3D8D A;  2IDY A;  3FIL B;  3L17 A;  4RM9 A;  3HVZ A;  5KQ1 A;  2D9Y A;  2MFQ A;  3M1I B;  3QHT A;  2CY4 A;  2LFI A;  3SD5 A;  3PZ7 A;  4WAF A;  2IBI B;  1I4R A;  3WAO A;  5JP4 A;  4IAP A;  5D3X A;  5M4Y B;  4NJ7 A;  2UZR A;  4MK0 A;  4LJO B;  3MJ5 A;  1YN4 A;  2INP E;  1N60 A;  1UNR A;  2KO3 A;  3RNE C;  2M14 A;  2RGN B;  5AUK A;  1K53 A;  4MH8 A;  4NJC A;  4YTN B;  2B76 B;  4K2P A;  4OZC A;  2LGY A;  3ENB A;  3ML8 A;  5C3J B;  1NI2 A;  3NVV A;  4NZL B;  3KUD B;  1CZP A;  1D5X C;  4MJS B;  2WWZ A;  3ML9 A;  4NQL B;  3O13 A;  4NY0 A;  1LW3 A;  3T3O A;  3Q8E A;  3N30 A;  2K5P A;  1TY0 A;  4C0A A;  3PRM B;  1FFV A;  2KGX B;  5HE1 A;  2D07 B;  4DDG D;  4D0N B;  4DIX A;  2EKE C;  3L0W B;  4ICV A;  1F9J A;  4RGO S;  1KZ7 A;  1MI0 A;  2MW5 A;  4A55 A;  3I5J C;  2KAN A;  1RAX A;  4EUT A;  3SEB A;  2MBB B;  3RNA C;  1JWS D;  3QX1 A;  2FNJ B;  1V8C A;  2VRW B;  3QA8 A;  5G55 A;  1R4M B;  3ONS A;  2AL3 A;  1Z2M A;  2KC1 A;  3DCG A;  4II3 B;  2DX5 A;  4DBB A;  4KHA A;  4JWU C;  4A3P A; 
#chains in the Genus database with same CATH homology
 4WWN A;  4G11 A;  4PS8 A;  4JKA A;  1ZGU B;  3KRW A;  2GCL A;  2L0T A;  5BO4 B;  4KZ0 A;  5KCV A;  4GMV A;  3WAN A;  4IM3 A;  3ODX A;  3VOQ A;  2WX1 A;  4HAZ B;  3W1S A;  1VBG A;  4G50 A;  1OY2 A;  3V60 A;  1W1D A;  1DYN A;  1XCG A;  3PVU A;  2C7N B;  4LDT D;  2I1K A;  3JSV A;  1E8X A;  4GDL B;  2O2V A;  4WWO A;  1WY8 A;  2IO2 B;  2IO1 B;  2CB8 A;  4I6N B;  2ADZ A;  2L8J A;  1NTY A;  1WJU A;  1KLV A;  4BBK A;  2KZR A;  1OGW A;  2XBB C;  4YL8 A;  2REX A;  2OTX A;  3Q3J A;  4KZC A;  5JH5 C;  4KSL C;  5DH9 B;  4WJ7 A;  1P9D U;  4MEM A;  2KVR A;  2KX0 A;  2MSE D;  2V76 A;  3PLU A;  4WSF A;  3VHT C;  1DRO A;  1MK7 B;  2LAS A;  2KTF A;  3H7P A;  1SE9 A;  1H4R A;  1NTI A;  1QC6 A;  3KYC D;  4WWP A;  1WMH B;  3EPY A;  4WJN A;  1GG3 A;  2LVQ A;  2MKR A;  4DWF A;  5L83 A;  1RLF A;  1EGX A;  4JKD A;  2K25 A;  4K1R B;  2V4L A;  1J0W A;  2P8V A;  2RVB B;  1KZG A;  1WR1 A;  2DAF A;  3ODO A;  2KJ6 A;  1X1M A;  3L13 A;  3NZS A;  2GS0 A;  3L08 A;  2ZCC A;  2RQ1 A;  4B95 A;  4DX8 A;  4JKE A;  5KHO A;  1V89 A;  3AI5 A;  4KDI C;  4JKB A;  1YJ1 A;  1T0Y A;  4WVF B;  1V5O A;  3MHS D;  5JHA A;  4B9K A;  1V9J A;  2KDE B;  2KHW B;  2BWE S;  1XQQ A;  2HTH B;  1DDM A;  2N7E A;  3A9J B;  1BT0 A;  2L76 A;  1PLS A;  3ZW3 A;  4MSQ B;  5DPW A;  1YX5 B;  3RUI B;  2WYQ A;  1M94 A;  2VKI A;  1KOT A;  1JDE A;  2XK5 A;  3NY5 A;  1AAR A;  5FR6 A;  2Y5B B;  4ANU A;  1XR0 B;  4AWJ A;  1XOD A;  4DX9 0;  2CS4 A;  3QWM A;  4BKG A;  2R82 A;  3PTF C;  1TBE A;  1KJT A;  1H10 A;  1SGH A;  3ZNH B;  1WZ0 A;  2AL6 A;  3QAR A;  1VCB A;  1YQB A;  3GZN I;  1S1Q B;  3AXC A;  4FA6 A;  1UGM A;  1H8C A;  5EFX A;  2KFK B;  2JPH A;  2VSZ A;  2IZV B;  1FB8 A;  1KC7 A;  3FSS A;  4RM8 A;  3R7Q A;  4HCP B;  5C6R A;  4ILH A;  1W1G A;  2C60 A;  2L1C A;  4MGZ E;  1D3Z A;  2DIK A;  5JHH A;  1WJ6 A;  1E8W A;  2JXX A;  2A5U A;  2W9N A;  2JP2 A;  1V2Y A;  3ZNI D;  3AU5 A;  2OQB A;  1MK9 B;  3N7C A;  3RT3 B;  4FJV B;  4ILJ A;  4K7S A;  4BFR A;  4XZ4 A;  2K00 A;  1I42 A;  4NSW A;  4IWP A;  2MDX A;  3ZRF A;  1WGU A;  1ZSQ A;  5J3T A;  2A4Z A;  2KK8 A;  2CHX A;  2M0X A;  2COD A;  2YF0 A;  3MJW A;  2HJ8 A;  2P0F A;  2BF8 B;  2DKP A;  2ASQ A;  3K9O B;  1A5R A;  2DZK A;  2PE6 B;  3PSC A;  4JKG A;  3PRP B;  5DPS A;  1U5F A;  3VTW A;  2KNB A;  1TGZ B;  3T8M A;  2RSU A;  1U5E A;  1TQZ A;  5TR5 A;  2LUL A;  2G45 B;  3EC8 A;  2DYN A;  3A1Q B;  3M3J A;  2YT0 A;  1UNQ A;  3A4S C;  3ALB A;  1CMX B;  4FHK A;  4ZRK A;  3EFU A;  3HM6 X;  1I2H A;  5KQ4 A;  2R09 A;  3DVN V;  3R3M A;  1WGR A;  4HHV A;  2GMI C;  2CHW A;  2AYO B;  2NS5 A;  4GDK A;  4OVV A;  2DLW A;  1HBK A;  4ZDV A;  4MSM B;  1Q67 A;  4HAY B;  1DIK A;  3A98 B;  4EMO A;  3PHX B;  2Y8F A;  2KFJ A;  3KUC B;  2LOZ A;  1EF1 A;  2FJ9 A;  3OJ3 A;  3VTU A;  4HAV B;  3PV1 A;  2GBK A;  4AJW A;  2IYB A;  4PS3 A;  2BWF A;  1J0G A;  3LDZ E;  3C0R B;  4BOZ B;  1XX0 A;  2BCJ A;  2IO0 B;  3D8E A;  3QJZ A;  2W2X C;  3DXD A;  2MBE A;  3CSF A;  3NHE B;  4KIK A;  5E6P A;  5DHA B;  3MPX A;  1EUV B;  2O6V D;  2DTC A;  2ZEQ A;  4NQK E;  3H7P B;  4DHZ E;  3IHP C;  2IY0 B;  1E5W A;  4HVB A;  2X18 A;  5AZG A;  2MCN B;  3H9D A;  2I1J A;  2Q13 A;  4W9H A;  1UNP A;  4AP4 C;  3U7D A;  4IWQ A;  2KWV B;  3DDC B;  1TJ6 A;  2LRU A;  4JK8 A;  4W9G A;  3TVV A;  5L81 A;  2YT1 A;  2R2Q A;  3ZDM C;  2WX0 A;  2M1M A;  3T9L A;  2EJ8 A;  4FN2 A;  4IWO A;  3TBL D;  4HCN B;  4GN1 A;  1JRU A;  1WI1 A;  2PJH A;  4CHK A;  4K81 A;  1MAI A;  3BJI A;  5C23 A;  4CHM A;  4W9L A;  4M8M A;  1V5M A;  1ZM0 A;  5DPT A;  2G4S A;  4PQ0 A;  1TTN A;  3B08 A;  3PP2 A;  3H1U A;  2PEA A;  3PPA A;  5D7G A;  2FUH B;  1MPH A;  3QAQ A;  2R2O A;  1M7R A;  1U4A A;  4YON A;  1WJN A;  2L05 A;  3P6A A;  3ZKJ C;  4PYU A;  1EAZ A;  4JK7 A;  4MEL A;  2KMA A;  2LVP A;  1V80 A;  1C1Y B;  5IAA C;  4Z2N A;  2BYE A;  2KTR A;  3T06 A;  2KDF B;  1WG7 A;  1UPQ A;  3KSY A;  1KI1 B;  4AUQ C;  5JHB A;  2K8H A;  1ZW7 A;  3X23 A;  1BTN A;  1OQY A;  2KJR A;  3X0W A;  3RYT A;  2LI5 A;  3A9K B;  5LLI A;  2IY1 B;  3G9W A;  2D11 A;  1Q1O A;  4JKF A;  3SO6 A;  4W9J A;  4H8S A;  3PZD A;  4KIK B;  4XC2 A;  4W9D A;  2ROZ B;  3DBL I;  3A1Q A;  2MLB A;  2COP A;  2Z59 B;  2NR2 A;  4JK9 A;  1GC7 A;  1XD4 A;  2LXC A;  2LVO A;  2BYF A;  4Z2M B;  2MP2 B;  3IVF A;  1DDW A;  2GCJ A;  2J0J A;  3B0A A;  3VH4 B;  2BKR B;  1L7Y A;  1Y8R C;  3A4R A;  3ZVR A;  3A8Q A;  2UYZ B;  1WE7 A;  5HE0 A;  3M95 A;  4IC7 B;  3H6N A;  2DKQ A;  1GNU A;  1X1G A;  4HDO A;  1XD3 B;  3P7Z A;  4GIV A;  3SHQ A;  4X57 B;  1ACA A;  4F7H A;  3QIJ A;  4KHB B;  5D2M B;  2NBU A;  4NNJ B;  1HB6 A;  5D94 A;  1V5P A;  1V6E A;  2M8S A;  2I5F A;  3VQI A;  2MWN B;  2D10 A;  5EDS A;  2ZNV B;  2ZNV C;  3HM3 A;  2C9W B;  3NZU A;  2LYD A;  1WX8 A;  3DXE A;  1XT9 B;  5GOW B;  2JF5 A;  1V49 A;  3JYU A;  5D3Y A;  2CRF A;  2N0Y A;  2JUO A;  2C7M B;  2XK5 B;  2ROV A;  4K7W A;  4LCD E;  4GZU A;  5G2N A;  1WJ1 A;  2N9E B;  3BY4 B;  3PG7 A;  4N9F 4;  3VTV A;  2P0H A;  2YS1 A;  4LJP B;  2GBN A;  1NU2 A;  4WAA A;  3PVW A;  3VH3 B;  1WMH A;  2NCN A;  3UQB A;  2KN5 A;  2RUK B;  4L6E A;  1E8Y A;  3AU4 A;  5AZH A;  5IA7 A;  2NBV B;  3ZO5 B;  3I3T B;  2D2Q A;  1GJZ A;  3A8P A;  4ANW A;  2L2I A;  2UWQ A;  4URK A;  3KZ1 A;  3VAW A;  4BBN F;  3M63 B;  1GC6 A;  2LOX A;  4GMX B;  2FAZ A;  2MWS B;  3KY9 A;  4Y94 A;  1G6J A;  3CMM B;  4J6I A;  3SBT A;  3WAM A;  1RRP B;  1Z5S B;  3QK0 A;  1ZC4 B;  5J18 A;  3BIN A;  4TKN A;  3IBE A;  1U5G A;  2J0M A;  3ULC A;  3ODW A;  1UEL A;  2MP2 A;  5E6O A;  3EEC A;  4OVU A;  2JY6 A;  2P0D A;  4CHJ A;  2OJR A;  4DHJ B;  1EVH A;  1U29 A;  5HE3 A;  2C5L C;  2CAY A;  1AQC A;  3PEG A;  5JVL A;  5LXI B;  3RCZ A;  1P5T A;  2LXA A;  4KSK C;  2NBW B;  5L95 C;  3R7R A;  5CLQ B;  3E66 A;  5D3V A;  3DBR I;  3FM8 C;  3RCP A;  2O6V B;  4GU2 A;  4FHJ A;  3VFK A;  4IUM B;  3KYD D;  3ML4 A;  5J17 A;  3AJ4 A;  1WE6 A;  5J3Q A;  1LM8 B;  5D27 A;  4AJY B;  3SU8 X;  4P7I A;  2FJL A;  2JRH A;  1KM7 A;  3E9O A;  2LG1 A;  3SUZ A;  5C5B A;  2K1F A;  3N3K B;  1GGO A;  4NAW B;  1ST7 A;  4WJQ A;  1U27 A;  5LXH A;  3F5R A;  1WXS A;  1UBI A;  1UBQ A;  2O6V A;  4HJK A;  3ENE A;  3TCA A;  2DAJ A;  3OJ4 B;  2PZ1 A;  3VXW A;  2XQN M;  1Y19 B;  2WH5 A;  3SDL C;  4HB3 B;  2L7R A;  1LB1 A;  3PVL A;  3APD A;  1LFD A;  5DCN A;  3D8F A;  3DVG Y;  3ZVV A;  4TV3 A;  2K2J A;  3SBG A;  2DFK A;  4ZRI A;  4JQW C;  3RUL A;  4TQ0 A;  4FLH A;  3TJP A;  2KD0 A;  4BOS C;  2EC1 A;  2JWZ A;  4DHZ B;  4JIO U;  4KHO A;  2C7H A;  4GB9 A;  2ZPN A;  1I35 A;  3VIA A;  2ZVN A;  4NJ6 A;  2L00 B;  2DYO A;  2KX3 A;  1UH6 A;  4FJZ A;  4BKS A;  1NDD A;  3SNH A;  1I7A A;  2ZJD A;  4II2 B;  4GXB A;  4IW0 A;  4DK5 A;  3W1S C;  1GUA B;  3QQ8 B;  4A6F A;  4F7G A;  3QWZ B;  2Z0E B;  1TZ1 A;  4IFS A;  3PRZ A;  2KLC A;  4A3O A;  2LGD A;  2Z0P A;  2PE9 A;  3SV1 A;  3VUY A;  4B6W A;  5CLL B;  2H7D A;  2KC2 A;  2COA A;  1FXT B;  3UIN B;  3IFW B;  4I6P A;  4CO7 A;  2N4F A;  2M38 A;  2N1V A;  2NVU I;  2MQJ A;  4EZJ A;  1MG8 A;  2LKO A;  1MIZ B;  4GDL A;  4E71 A;  2KDB A;  1WJM A;  1EO6 A;  3SYX A;  2YSZ A;  2M4N A;  4TQ1 A;  3JW0 X;  3L54 A;  2W2X D;  2L3Z A;  4HAX B;  2EMT A;  3L10 B;  3UIO B;  3H7S A;  2UVM A;  1RJ2 A;  2D9W A;  1WXV A;  3CIK A;  1K5G B;  2LJ5 A;  3FEH A;  1QZE A;  1WM2 A;  1OTR B;  2UZS A;  1OQN A;  3DBH I;  3DQV A;  4A6F B;  2DHZ A;  5CHV C;  2H7E A;  4E3C A;  2BGF A;  1B55 A;  5D3W A;  2RNR B;  2ELA A;  3PT2 B;  2JRI B;  1V5T A;  2ZCB A;  1P98 A;  2KDI A;  1WH3 A;  1EF5 A;  1J19 A;  1LQB A;  2CR5 A;  2V3S A;  4BBN C;  2RSG A;  2FCS A;  1N3H A;  3JSV B;  1HE8 A;  1WRD B;  2YS5 A;  4KAX B;  4HAW B;  3E9L A;  1FAO A;  2NPT A;  3FP5 A;  4GOC A;  1BWN A;  2DX1 A;  4JKG B;  2V1Y A;  4JKC A;  3S2A A;  2LGX A;  3B1L X;  4PYZ A;  4KVG B;  1YIW A;  3MTN B;  2CKH B;  3LJ3 A;  2AWT A;  2W2W A;  4HB2 B;  3APC A;  3HW2 B;  2KTR B;  1V88 A;  2MX2 A;  5DHF B;  1QQG A;  4MM3 A;  4K2O A;  1WM3 A;  3P2B A;  4TUU A;  4FBJ B;  3ULB A;  2KFK A;  3DPD A;  4MGI E;  3KVF B;  2N9P C;  5CTR C;  2VRR B;  5DI9 B;  1Z87 A;  5FI1 A;  2LZ6 A;  1UPR A;  1P0R A;  2FCM A;  3K9P B;  3U8Z A;  2KOX A;  2MA9 B;  4EKU A;  3UGB B;  2GBR A;  1V5U A;  2KKC A;  2J59 M;  4CYE A;  1WGG A;  1HB8 A;  2HD5 B;  3DXC A;  4EEW A;  2BYV E;  2ABD A;  3QCA A;  1PQS A;  4JLC A;  3UZT A;  4GDK B;  2D9X A;  2DYB A;  1FHW A;  2MBQ A;  4EZK A;  3ZTC A;  4MY6 A;  5HKH A;  4MGK E;  3O65 B;  2YRY A;  2DHJ A;  1LXD A;  1WXM A;  1WR6 E;  4F1S A;  3OAN A;  1P6S A;  4PS7 A;  1RRB A;  4W9I A;  4HAU B;  1E7U A;  4MDK E;  4DDI D;  2LBB A;  5AZF A;  1SIF A;  2HTH A;  4W9F A;  1OMW A;  1WX9 A;  4W9K A;  4W9C A;  3NS8 A;  1R4N I;  4KV2 A;  1WGD A;  3KH0 A;  1P1A A;  1MIX A;  1X11 A;  3WYF B;  4GPT B;  4W9E A;  2KCJ A;  4K7U A;  3HIZ A;  3PSE B;  3VDZ A;  1IYF A;  3PLV A;  4IM0 A;  4HB0 B;  3QC8 B;  3MDB C;  3FLV A;  1WIA A;  5C16 A;  2D9V A;  1WJ4 A;  5KHQ A;  2CU1 A;  2GJY A;  1P3Q U;  2KMC A;  3WIM A;  4G3X B;  2WDT B;  1OEY A;  5J3Y A;  2I5C A;  4JGH B;  3NOB A;  2R0D A;  4M8N A;  3A9J A;  3M62 B;  5C5B B;  4WQO B;  5GMV A;  5LOP B;  1WGH A;  2KJH B;  2MBH A;  2Z0D B;  2K6Q A;  2RGF A;  3ZTD A;  2N1W A;  2ELB A;  1WZ3 A;  2E2X A;  3RZF A;  4BKS D;  3NSU A;  2LRW A;  3V6E B;  4FJY A;  4LDT B;  5FI0 A;  4F8C B;  3APF A;  1NBF C;  2D3G A;  2NPT B;  1V81 A;  2X0S A;  4DXA B;  4HXD A;  4GGQ A;  4XWX A;  2K8B A;  2LD9 A;  4M0W B;  2YLM A;  3E9P A;  3TMP B;  4HB4 B;  4EZL A;  3ZLZ A;  1M7E A;  3O96 A;  2HRJ A;  1E90 A;  2CQU A;  1WYW B;  1WGQ A;  3ZIM A;  2KXJ A;  4DHJ D;  2N23 A;  4IG7 B;  2D4Q A;  5DPR A;  2JT4 B;  3F0W A;  5HE2 A;  5D6J B;  2LUE A;  2YVC A;  1X05 A;  2OOB B;  1NTV A;  5LON B;  4A6K A;  3UF8 A;  3PGE A;  1FHO A;  2D9Z A;  2B3A A;  2JZ3 B;  4I6L B;  2NZ8 B;  2YS3 A;  2XEW A;  2GBJ A;  1V86 A;  1WF9 A;  2G3Q B;  1WFY A;  4F7U P;  5E6N A;  3V61 A;  3KRX A;  4GSW A;  3U30 A;  3OLM D;  3TFM A;  1VBH A;  2IYD B;  3N32 A;  3CST A;  3D32 A;  1FHX A;  3EHV A;  1TXD A;  2KQS A;  2COC A;  1X1F A;  2AEH A;  4JL9 A;  2FIF A;  2Y8G A;  3TW1 A;  3VUX A;  4FUL A;  1WVH A;  2QKM A;  1YX6 B;  1Y5O A;  1E7V A;  5CX3 A;  4RMA A;  2KWU B;  1BAK A;  3OAW A;  4ICU A;  3UIP B;  3ZNG C;  3WAL A;  4ILG B;  2Z0O A;  4IOY X;  4E74 A;  3CF6 E;  1UZX B;  3GOE A;  1ISN A;  3ZUN A;  1SHC A;  2DX5 B;  2DZI A;  5CHW A;  5DIF B;  1WX7 A;  3L16 A;  2COF A;  4A20 A;  5JZE B;  1S3S G;  1J8C A;  1BTK A;  2Y7B A;  2M17 A;  5C1Z A;  2RPQ A;  2ZPY A;  1XKE A;  2Z0Q A;  4A5K A;  2IFS A;  1Q0W B;  4EOY A;  4BVU C;  2DYQ A;  4KDL B;  4WJO A;  2RLO A;  3ZDT A;  2ZVO A;  5IJM A;  3V5W A;  1WI0 A;  3DOW A;  3PHW B;  3ZRC A;  4HAT B;  1RFA A;  1FGZ A;  3JVZ X;  4HPM B;  3PS6 A;  2K2U A;  3ZNZ B;  1L2N A;  3QBV B;  3DBS A;  1AWE A;  1W1H A;  1ZVR A;  2FCQ A;  1IRS A;  1FGY A;  4EJN A;  4ASW C;  3V6C B;  2K39 A;  3WA0 A;  1P3R A;  3DVN U;  1ZKH A;  4BKT A;  3ECI A;  1UD7 A;  2DA0 A;  2EMS A;  4HK2 A;  2NMB A;  3W1Y A;  2K8C A;  4A6H A;  4AOF A;  3VVW B;  2G4D B;  2N9X A;  3LJU X;  4NPN A;  1UEF A;  2PPH A;  1DDV A;  4MT7 A;  1IP9 A;  3GYO A;  4NAW A;  3UQA A;  2KLG A;  3WAP A;  2N7D A;  4XX5 A;  3TIX A;  2JVC A;  1FOE A;  2FDQ A;  3RD2 A;  3CXB B;  2O2V B;  4IM2 A;  2QKL A;  4PNK A;  2MBO A;  2DZJ A;  4ZRJ A;  2ZZP B;  4HPL B;  1OEY J;  4ANX A;  2BKF A;  3KW5 B;  2DHI A;  3IG3 A;  5CHF A;  4TYZ A;  2KUP A;  1X86 A;  5JHG A;  2G35 A;  3A33 B;  1PMS A;  3AUL A;  4EFO A;  4ZYN A;  4WJP A;  1MKE A;  1PFJ A;  4HDQ A;  2DYM A;  5AEK B;  3TL5 A;  3A9K A;  5C79 A;  2DZM A;  2KWC A;  1NVL A;  4ANV A;  3HK0 A;  3HHM A;  4HLE A;  3GYP A;  2JZZ A;  1KBL A;  1U2B A;  3KUZ A;  1K5D B;  2MRP A;  1ZC3 B;  2J0K A;  3PRE A;  5J2R A;  2KQ7 A;  2HE7 A;  4DBG A;  2DEN B;  5JLJ B;  4JKH A;  1V61 A;  3RZW C;  3TO1 A;  2QHO A;  4MJS A;  3DVG X;  3Q3F A;  4K17 A;  1YD8 U;  1DBH A;  1K8R B;  2DN6 A;  1VD2 A;  1R4M I;  1C3T A;  2FCN A;  2DHK A;  4MGY E;  3V62 A;  4B6H A;  4FAD A;  2RR9 A;  3HQC A;  2IO3 B;  4G0N B;  2BPS A;  1WXA A;  2FID A;  2GBM A;  1IPG A;  2LWP A;  1Q5W B;  3R66 C;  2RD0 A;  2K6D B;  4F7Z A;  2CHZ A;  2CY5 A;  2GOW A;  2J7Q B;  2L0F A;  1E8Z A;  4HWI B;  1WGY A;  3VUW A;  1U5D A;  4MH0 E;  3D8D A;  3L17 A;  4RM9 A;  5KQ1 A;  2D9Y A;  2MFQ A;  3M1I B;  3QHT A;  2CY4 A;  3SD5 A;  2IBI B;  3WAO A;  5JP4 A;  4IAP A;  5D3X A;  4NJ7 A;  2UZR A;  4MK0 A;  4LJO B;  1UNR A;  2KO3 A;  2M14 A;  2RGN B;  4K2P A;  2LGY A;  3ENB A;  3ML8 A;  1NI2 A;  3KUD B;  4MJS B;  2WWZ A;  3ML9 A;  4NQL B;  4NY0 A;  1LW3 A;  3N30 A;  4C0A A;  3PRM B;  2KGX B;  5HE1 A;  2D07 B;  4DDG D;  4D0N B;  2EKE C;  3L0W B;  4ICV A;  1F9J A;  1KZ7 A;  2MW5 A;  2KAN A;  1RAX A;  4EUT A;  2MBB B;  3QX1 A;  2FNJ B;  2VRW B;  3QA8 A;  5G55 A;  3ONS A;  2AL3 A;  1Z2M A;  2KC1 A;  3DCG A;  4II3 B;  2DX5 A;  4DBB A;  4KHA A;  4A3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...