4JKCA

Open and closed forms of t1800e human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTEKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkcA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkcA01
4JKCA 4JK9A 4JKHA 3E9PA 4ILGB 3E9OA 4ILJA 4ILHA 3ENBA 4JKAA 3E9LA 4JKFA 4JK8A 4JKEA 3E66A 4JKDA 4JKGA 3SBTA 4JKGB 4JK7A 4JKBA 3SBGA
chains in the Genus database with same CATH superfamily
1SZ2A 1NMDA 1I39A 4DQ8A 2J0MA 2D5RA 4FCYA 5MLCQ 3HTVA 5C15A 5HL7L 4UQGA 4CZMA 2KFZA 3VEVA 4XH5A 1JXBA 3VQPA 4BY9C 3G10A 4EHUA 1OVQA 4OPAA 1ST7A 2UXBK 4KTWA 1DKGD 3DOKA 1O13A 1SAZA 4M41A 1QHTA 3MECA 1WBBA 3SV4A 4B3OA 4B9LA 4I2PA 4ZTJA 4OGEA 4DTPA 4C23A 4LSNA 2F8SA 2E2QA 4CGGA 2KZZA 1KTQA 1K8KB 1GOAA 3QO9A 1CZBA 1SGHA 3ASMA 3VPZA 3CCJN 4GKJK 1RTHA 4KB0A 3HL8A 4BRKA 4IOXA 1U49A 2QWNA 5F0XA 1DLOA 2G8WA 2UUAK 3BZCA 4YOXA 1S1WA 1HYVA 4X62K 2EHGA 3FR0A 3ZX0A 3I56N 4KHSA 5AQXA 3QB0A 5IWAK 2QI2A 4O44A 2XRIA 4ZRKA 4LSLA 2B5JA 4BGBA 4DUZK 4JS5A 1QVGM 1XNRK 4JEPA 2YJFA 3MWPA 3BUZB 3CC2N 2D1KA 3J81O 3SMSA 1G99A 4BC3A 4BQZA 5CE3A 2NNWA 1JLCA 4ID1A 4DTMA 1EO1A 3MX5A 1J19A 4CZIA 3BINA 1QQOA 1NGDA 4K42A 5IJMA 3VQ4A 3CIPA 1QZ5A 4WQ5A 5AQFA 5EU7A 3L2QA 4FOEA 1U4BA 2A1SA 3DLBA 1K73O 1BI4A 3HSTB 1VBHA 2ITMA 3WXJA 5GADP 1NNEA 3KVGA 4GKKK 3MN7A 2YNFA 3BP8A 4JI2K 3O3GA 1WSIA 4HTUA 1TUYA 2NRHA 1VSJA 2F9WA 3LDSA 4BDYA 4DFJA 1KAZA 3QIOA 1BQMA 1HKCA 4JKDA 3HPHA 4FJ5A 4LFBK 3SJJA 2QKBA 2B6AA 4W5TA 3D6RA 3AY9A 1T44A 2P9UB 3HRGA 1YI2N 5ADXA 4IZ9A 1ZBSA 1Q8IA 5F1XA 2ZM6K 1NGGA 3OYLA 4KI6A 3WNFA 1V4SA 3OS2A 4CEEA 2O8EA 3HOSA 2Q97A 2ZGYA 4RCHA 2AEHA 3HJFA 4AM6A 4KHUA 1ASVA 4PKIA 4CGDA 3V4IA 2FBTA 3U8ZA 1RDUA 5SZTA 3KZBA 3AO4A 2LBBA 5C24A 1L5UA 2F7TA 3ZLJA 1HX1A 1LWFA 4BG8A 5CYMA 2D0PA 4AHRA 3UIQA 5AQKA 1GLFO 1IKWA 5HRNA 1X3MA 3U3GA 2UU9K 1H1VA 4Y1DA 2RE2A 3DOLA 4DSIA 2G8HA 3CCQN 1NGEA 3VQ9A 2KKZA 3OYEA 4JD2B 1KC7A 3JYTA 1B92A 1NU0A 2A3ZA 3LL3A 4R79A 1TKXA 3IUCA 3V9WA 1VRTA 4HDQA 4B08A 4CVNE 1Y19B 3P38A 3NF8A 3NGZA 4CJFA 3DAWA 3HPOA 1YTAA 2OTJN 2P9PA 4JKCA 1GOBA 4H0XB 3AO1A 5TKYA 3JSMA 3WXMB 4NCAA 3HBTA 2CH6A 3OYGA 3V1QA 4RTFD 4RG8A 3S3MA 2HMPA 1JKHA 1VQ5N 3T1HK 4PA1A 4M63C 4JKGA 2IVOA 4CF0A 4YOVA 3CC7N 3OYHA 3ZYYX 4WCEL 2ZJPL 3ULEB 1XMQK 4M3XA 3VF6A 5KGWA 1E3MA 3MN9A 4CK2A 1BHLA 4Z4IA 4O8KA 4DV6K 2G8UA 3HYFA 1VSDA 5HRPA 3VESA 1E5WA 1HPZA 2VWKA 4IO8A 1BISA 3VENA 3ZT3A 3O4WA 3TSPA 3AU5A 4KO0A 1HMVA 3DRSA 3O3HA 2HNDA 2E4LA 3M3ZA 4LH5A 3VTIA 2G8FA 3H1QA 3QINA 1TAQA 2E5LK 3CC4N 3THXA 2YHWA 1LV5A 2HHWA 3CJ7A 4DHYA 2J4RA 1WSJA 2IOCA 3O9UA 3BZKA 4WE1A 3OS0A 2QWMA 1W0HA 4CEAA 4CF8A 1KSPA 2KQ2A 1MK7B 1RT4A 4CGJA 5AQVA 5E26A 2VG5A 4A57A 3J7ZO 1K8AO 4MDBA 4CESA 3V1RA 1RFQA 1LOTB 4F8RA 1N34K 3HI0A 3ZSYA 2A41A 3VMFB 4EP4A 3OYIA 2AA4A 4JKAA 5SWMA 1HRHA 2Q1NA 2E6MA 4XEIA 4J8FA 1YHQN 4GNIA 3V9UA 3QBXA 1NWKA 3LDPA 4M3UA 2P9KA 3RMAA 4CJ3A 3DWLA 2E6LA 3L6QA 5GAEP 3LZIA 2D0CA 3QEXA 1JCFA 2HOEA 5JLFA 3C94A 4WF9L 1ITGA 3KJVA 4LF8K 4BRNA 3QLHA 3TTCA 3HZ6A 1VQON 3AVKA 4B3TK 2R82A 2P5GA 1D9FA 2PYJA 4HUFA 1GLLO 4BRAA 1GG3A 3LP0A 5LMNK 1N36K 1Z26A 2ABDA 4OKEA 4DV0K 4LF5K 5KRSA 4JYAK 4J2DA 4KAZA 1GC6A 1L3SA 4E0DA 5CZ1A 4FLWA 4H0PA 3N4QA 1BIUA 2B4JA 4JS4A 4EFHA 4W5QA 3C6AA 1N8RO 2O4GA 4J2EA 4Z4FA 2A6AA 1U2VA 4DU4A 3HVTA 4F3OA 1YITN 3H45C 2P9IB 3OTOK 4BRMA 5EXWA 1BA1A 2WOMA 1OH6A 4FLVA 3ZX3A 4BC2A 3F9MA 3FP5A 2E1ZA 1YTUA 1YJWN 4MLHA 4M7YA 4Z4EA 3JAMO 1XHZA 1C0GA 3MN5A 1DTTA 3LDNA 4IFEA 2QWPA 3I55N 4JI1K 2G8VA 4CGHA 1UAXA 1KXPA 3GL1A 5C42A 4FW2A 4C1NK 5JMVA 3CMEN 1TAUA 3GBTA 1TK8A 3AAPA 3DRRA 3CD6N 4F3TA 3H46O 4E3SA 2E88A 1NGBA 4CHNA 2RPIA 5AQIA 3ZETA 1F21A 4NYNA 3B6OA 2BGGA 3M5RA 1QTMA 2NUBA 1RILA 5BN9A 2NLXA 3AV9A 3EYZA 4DTJA 2OPQA 1BDGA 4FWKA 1NGAA 3V9XA 2FBYA 1RT1A 2JWLA 2OPSA 1BU6O 3BY5A 3MEGA 2V52B 3TU5A 2FSJA 4FM2A 5JLHA 2Z1GA 4DSEA 3QETA 4KI4A 1S72N 5FPEA 1EX4A 4DLEA 3KD5E 4IOCL 5F2RA 3D2EA 3AAQA 2YNIA 5CR4A 3BDPA 3AVJA 4KTQA 3R6MA 4Z4GA 4B1ZA 5EOYA 1NJXA 4B3RK 4FLXA 4C8MA 1DTQA 3LP2A 1ZC6A 2JLEA 2DIKA 3ZSXA 2Z1IA 3AVMA 4JD2A 3TARA 4NO7A 4MO5A 4E1NA 4M3TA 3WT0A 1NK6A 1RCHA 3GE1A 3KLGA 3V9ZA 2O8EB 3SAHA 3G25A 4CD1A 4BDPA 4FLTA 5J1EA 3CQ8A 2YHAA 1QSSA 4KB1A 3P1GA 3L2WA 1BO5O 3NVMA 3EZ5A 4H03B 2YCHA 1C1AA 2E2NA 1LW2A 3LP3A 5AQMA 4JHDA 5KPZA 1FJGK 3EE9A 4CIGA 5AQHA 4CJKA 3OYFA 3CXCM 5FPDA 1IKVA 1N33K 1NOYA 4FJNA 1BL3A 3WEEA 1T7PA 3CJ9A 3KLHA 4RW6A 4BR5A 2PBDA 2ATQA 2VCPA 1J6ZA 2RQ1A 3CJBA 3T1AA 2GUPA 1IH7A 5EVZA 5GAHP 2FF6A 3THWB 2VYPA 1TGOA 1WNSA 3MK6A 4FWNA 3A2FA 4G1QA 4QS7A 3OYNA 2P9PB 3O1BA 5FROA 3S3NA 3KLFA 1QQNA 4H5NA 2NRTA 1KLNA 1JLEA 3H1VX 3SI6A 4YL8A 4BWMA 2BTFA 4HCBA 3X23A 3AVGA 4CYEA 2IGIA 4KFBA 1SL1A 4GV6A 4JKGB 3VQ6A 4A61A 4IXCA 4FLUA 3TAQA 4PKHA 1UA0A 3WNHA 3MCPA 4A59A 4FM1A 3MXMA 1BA0A 2UXDK 4BRIA 1ATNA 4BR0A 4BC5A 1JLFA 5CHIA 4KV8A 1DIKA 3I8BA 3MCAB 2ZGZA 5KI6A 4TSXA 3TANA 1IBLK 2O8BA 5AJ3K 2HRJA 4WYBA 3ZT0A 1FW6A 4Z94A 4CIEA 1YIJN 4CZGA 1NGJA 2IVNA 3NAEA 1ZBFA 3P4IA 4HUGA 4FXDA 2YX6A 2QXFA 3RMDA 1DGKN 4YHHK 3VQBA 4C1NI 1YVUA 3THXB 2A42A 1C6VA 2QWOA 4AHTA 3QNNA 1P90A 4NLCA 2O8FA 5AQNA 2V51B 3OW2M 3U6FA 4J2AA 5M1KA 1QHAA 2V7YA 1K9MO 4NYFA 1KLMA 3D0PA 4IWVA 2HBMA 5J2QA 1ILYA 2YVCA 4FWOA 3SUNA 1ZYQA 1XQSC 3OYBA 1JLAA 3M1FA 4RW8A 5TKWA 4I2QA 3FZHA 1JDEA 2F8TA 1MWMA 4CBUA 4K0KK 5AFUH 5EX5A 3M8SA 3PV8A 4TKNA 1IG9A 1I3AA 1QQCA 2W41A 2HHXA 4F4KA 5AQUA 4YDUA 2I7PA 2P9KB 3CPEA 1BGXT 3W0LA 1A5WA 4IG3A 3PX6A 3K59A 3MN6A 2Y1IA 4Z4HA 3ZEUA 4DR3K 3ULDA 2Z1JA 2P9LB 2DTUA 3QMLA 3TI0A 2D0OA 3WA0A 1VAZA 1VHXA 3RSEA 4ZHRA 4JI5K 1EETA 2OA8A 3ZDTA 3QFUA 2KZMA 4HCCA 2PYLA 1T03A 4DQSA 2HF4A 4JV5K 1XC3A 1U04A 2P9IA 4WQ5C 1S1UA 4CE9A 2F4VK 1VRUA 3VQQA 3RRHA 5BPLA 2AL6A 4OLAA 3O08A 2Z1HA 1NKEA 1Z6RA 3NGYA 4MQ3A 3TPQA 2D4WA 3K2PA 3RTVA 1CZ9A 4AHVA 2ZJRL 3ZT2A 5DM7L 2VG7A 3EO3A 4DFPA 3VEXA 3SMPA 4EP5A 4YOWA 5KPRA 5JICA 3T3FA 2E1YA 4FVMA 3EKSA 2EWSA 3BF1A 5GINA 3GDQA 1U2VB 5BRDA 4K41A 3PO5A 1S22A 1MA9B 1KFSA 4LF9K 3U8XA 4BVOA 3ISNC 1VSHA 3WXKA 1S1XA 4FO0A 5LL6Z 1ISNA 4NB4A 4DS5A 4FJXA 3K5MA 2E20A 1D5AA 3S3OA 2PY5A 4BR7A 4CECA 3OYDA 3I8DA 4FJMA 2G8KA 5HRSA 4CI6A 1J5EK 3NF9A 3K57A 1LWEA 4MLEA 4CJVA 3QDKA 4JRQA 3SAGA 2VQFK 1GLEG 1BCMA 1P8ZA 3SUQA 3LDLA 2W40A 3KHYA 3ZSVA 3ZETB 3CCSN 3QIPA 3QFPA 1RDBA 4IFYA 2J0KA 3EN9A 4DFMA 4IDKA 4RWTA 3KWIA 4GVMA 5BR8K 1HJOA 4IFVA 4KREA 4O55A 4AHUA 4E89A 3EKUA 3ID6A 5J2MA 3VOVA 4BRQA 2WONA 3SV3A 1RBSA 2HSTA 4IBNA 1L3UA 3ZT4A 3VN5A 2KTQA 3J7YP 1BG3A 4Z0UA 4H5WA 3CQYA 3T69A 3TAMA 4C8NA 3WNEA 3ATVA 4FWLA 3F9KA 4BC4A 1REVA 3D2EB 5C2FA 3MXIA 3F2KA 4EKUA 1HLUA 4E1MA 1JCEA 4OJRA 5A2QO 3C65A 1S6PA 1UA1A 2XY8A 3SQ0A 1SKWA 1WSGA 4ISFA 1X9WA 4KHPK 4Y1CA 4W5NA 4JI4K 3LZJA 2OYQA 1KQSM 4EZ9A 2FC0A 3FLVA 4DB3A 4CFDA 3ZSQA 5HLFA 4IJAA 4KHQA 3OHRA 4HVJA 1M1KO 5AFUA 3AO5A 1BWFO 4DTOA 4CEOA 1NK9A 1D9DA 2GEMA 3VGMA 5HP1A 3S41A 5KGXA 3THWA 1HR0K 1VSLA 4I9QA 3CPWM 4B3SK 2KFNA 1L3VA 4AF1A 1NJZA 1K6YA 3DRPA 4L8RB 4ILJA 4JNEA 4JHDB 2QKKA 2O4IA 1E4GT 5AQQA 1EWQA 3SPYA 3SNNA 2E2PA 4XH4A 1JLBA 2NRZA 4DR6K 2JWKA 3K5NA 4BRHA 3QEVA 4NLBA 4O4GA 2CH5A 3WEEB 3IFRA 4FJ8A 1VQ8N 4PWDA 3VERA 5AR0A 1HKBA 1Z25A 1W9HA 1EKEA 4F9OA 2QTDA 3ENHA 1T3VA 2R7YA 4DLGA 3NH1A 3RMBA 3A5MC 4MO4A 4LFCK 4BRDA 4I9LA 3CFRA 3FZMA 4AILC 5FDLA 1KBLA 3MDQA 3N4PA 2ZJQL 2AP1A 4DR7K 3L4QA 2IAJA 3F73A 5IT9O 1RBTA 2JGUA 3E01A 1L3TA 3QEIA 3VETA 3ID8A 1IKYA 1RDCA 5KTQA 4JKHA 4DKWA 3ENBA 3AA2A 4IEIA 4EIAA 3IG1A 2UXCK 3CFPA 3K9JA 1OVYA 4A5AA 3QESA 1RTIA 3VTHA 3RWUA 5BN8A 2YV0X 1O1WA 3L3VA 2O8BB 4FZZA 3SQ1A 5HROA 1GLBG 2CGKA 1HNIA 3U9ZA 4YFUA 3VQ5A 3FE1A 3R3LA 1HJRA 2O8CA 1FXXA 2YI1A 1U47A 5AQRA 1ZBIA 4LC9B 4DTXA 1NI2A 1EQYA 1RT5A 3R8EA 3G0ZA 3SZ2A 3DXMB 3IAYA 2DFFA 3VGKA 2O8FB 3EEQA 3HVRA 3VEZA 3SCXA 4CJPA 4M3ZA 4E7HA 3HM9A 3CJAA 4FWMA 4OLBA 3PSIA 1GLJO 3TSQA 4M3WA 4M42A 4CF1A 4CK1A 5C0YA 2P9LA 5HBMA 4L3QA 3IRXA 3C6HA 4CZKA 4DFKA 3SK3A 1Q86O 2HMIA 2VG6A 4YY3K 3L0QA 3NGIA 1OKJA 3C7NA 4CJEA 2Q36A 3VEWA 4BG9A 4FWSA 1N32K 2FBVA 3E66A 3NH2A 4IO9L 4JI3K 4H0YB 3DJCA 3VQCA 2DFEA 3PVLA 4E19A 4DTRA 3P5JA 2HHHK 2UUCK 3D7EO 1B9FA 4LFAK 4BE0A 3AVAA 1LAWA 1EP4A 4PHTX 1NK7A 1NGIA 4LF4K 3THYA 3ZEUB 1NK4A 4GVEA 5J2PA 4M3YA 2P5OA 4Z4CA 4O5FA 3RSEB 3UE5A 1S6QA 3ZCMA 4DWIA 2D2QA 3OYKA 2IDOA 1SKRA 2YJEA 2FJ9A 1HKGA 5I42A 1CLQA 2D0AA 3AVNA 2GV9A 4KRFA 4YOTA 2BH1A 4BREA 3OY9A 3VA0A 3PZDA 4DR5K 4NXMK 4YOYA 4AM7A 2HE7A 4A2BA 4N56A 3HPGA 5KQ8A 3RR8A 4CEQA 4CHOA 3I33A 5BREA 2DFHA 2ZD1A 4N76A 4IG0A 4FOIA 4C8LA 1TV6A 1QE1A 1RDAA 3AA5X 4O5BA 1ZBLA 3VGLA 4FJHA 3A8YA 1WSFA 1KFDA 1KD1O 3MXJA 4JLHA 4G9ZA 5C12A 4DG1A 3WQUA 5FPNA 3TAEA 3UKRA 4C8KA 3KK7A 3SYZA 3FFIA 3DLRA 4H0OA 1SUQA 3RRGA 4DSLA 2V7ZA 1RGIA 3D2FA 4N47A 4CJUA 1J53A 2I1JA 4CEFA 1HUXA 3E9OA 4HTLA 1NOZA 4BR9A 4HHTA 3WXIA 4WQ4C 4X64K 5AQJA 4KH6A 3MEDA 4CJTA 4GV3A 3P31A 2F96A 2GWKA 2FDQA 1J54A 4FJGA 4FJIA 5E41A 1J5OA 3LDQA 1XHXA 3E1YA 4KHNA 1FK9A 3VEYA 1WLJA 4RW4A 3A5LC 2ZWHA 3A0IX 4B9UA 2W6KA 4OGCA 1XC9A 1CXUA 5AQGA 4CZFA 4U67L 4CJSA 4X66K 4A5BA 3QNOA 3F5TA 1J9AA 4QCLA 2VWBA 1Y64A 4NXNK 4OPKA 2FSNA 3P83D 5M1OA 2Q3SA 1CXQA 4WFAL 2J0JA 1NJIO 3MEEA 4E7KA 3AO3A 5FLXO 3ITHA 2CB8A 2OANA 3L2UA 1D8YA 4ICLA 2ZQBA 3A5NC 1IJJA 3O3FA 1EXQA 3HP9A 1NM1A 4CBXA 2CQUA 2HHVA 4E7LA 2E8AA 4I6MA 3CERA 1C0FA 1UOCA 4B9QA 4CJQA 3S9HA 1SQKA 1IBKK 3CCVN 1IBMK 3SBGA 2YHYA 4ZRIA 2ITGA 1TYQB 1VQMN 2VGNA 3TAPA 3R9PA 4IDHA 1KCFA 1KC8O 4FK0A 1Q9YA 4CHYA 4K43A 4O0JA 4H8KA 1VQ9N 5CZ2A 3LAMA 2UUBK 4XH1A 3CCMN 4CW7B 1MU2A 3KLIA 3TABA 3AARA 3SPZA 1YF5L 1RDWX 4BQLA 3CJCA 3UB5A 3V6DA 4FLZA 4CZLA 3THVA 5AQZA 2PFUA 4DSKA 4ID5A 1JJ2M 4B9MA 4DR1K 4DR2K 1QSLA 1UWBA 3CHWA 1WAFA 1GLAG 1ATRA 4NY0A 1NGHA 2BUPA 4BROA 3AO2A 2HBJA 4F2RA 1Q7YO 3LPUA 3LM2A 4LY7A 1XMOK 3QICA 4FK4A 1NGCA 4DQPA 2NRXA 2HNZA 3VQ7A 1RT2A 1TKTA 3NMUA 1A5XA 1ESVA 1NBWA 4X65K 4FVUA 4DTUA 3CF5L 4BR4A 1GLCG 3CCUN 2HBKA 4B8AB 3DXKA 1GOCA 2NRRA 4CHPA 2HBLA 4YDUC 3SLCA 3DXMA 4FJ9A 1TL3A 4KPYA 3VA3A 3NE6A 5AZIA 1S1TA 1MK9B 2WBNA 4FJKA 3U9DA 1RT7A 3KKSA 3EE8A 1YXQA 4ISEA 1RTDA 1QS4A 5AQPA 3QEWA 3U3YA 1IO2A 3RR7A 1ZBHA 3OS1A 4CZEA 3E9LA 2O8CB 1T6DA 2HHQA 1HQUA 4DV4K 4CERA 3JS6A 1QSYA 3ENOA 3TSUA 2WUSA 1WB9A 3PIPL 4QS8A 3CMAN 2HNYA 2O8DB 1C0TA 4CZJA 5BRFA 1KRPA 4FJ7A 2ZF5O 1XUPO 2Q2RA 4PL8A 3J7AP 4DTNA 2A1RA 1OH7A 2Q0UA 2CGJA 4OKKA 3C7NB 2VQEK 1VSEA 4BRCA 3LDOA 3T19A 4A2AA 5M1FA 3NCIA 3BF3A 3T7ZA 1NKBA 2LSNA 3Q7BA 4FZXC 2QWRA 4JK9A 3SUOA 1BOTO 3ATUA 3O8MA 5JVGL 2EMTA 4P7IA 1TKZA 2I5JA 3B8AX 3PIOL 3THYB 5AQWA 4U7BA 1SL0A 1OH5A 4A62A 1ZXOA 3MAQA 3ALYA 3AVBA 3J8AA 2A40A 3HP6A 3VQAA 4CF2A 1BCOA 4CEZA 4O0IA 3FLCO 1VSMA 3CM6A 4FPAA 1SV5A 1NJWA 2F9TA 3OVNA 2FXUA 1NK8A 4DCHA 1QVFM 3RMCA 2E2OA 4CJWA 1LWCA 1HB8A 5I3UA 4Y0WA 3OYJA 4H4MA 2GTDA 3HSCA 1JCGA 5AZJA 1CZAN 2P9NA 2X78A 1GGOA 2YHXA 1HNZK 4RW7A 1U48A 1KVCA 1T8EA 1GLDG 3CJ1A 4H0VB 3SQ2A 2P9SA 4KHWA 5C10A 2OTLN 3WNGA 3VF4A 1YVNA 1WUAA 3FZKA 4B1VA 3CCRN 1Q81O 3G71N 1WSEA 1BUPA 1X3NA 2EX3A 4DU1A 4DXAB 4FJLA 1IKXA 4CEBA 3AVHA 2QW9A 4IEEA 4PQUA 1QZ6A 3OYAA 1TK5A 3UKRB 3AVLA 2UYTA 3VF2A 4J2BA 2IIRA 3D2FB 5DK5A 4KHYA 1B9DA 2WTUA 3LP1A 4FW1A 4CF9A 4JI0K 3M8PA 3O9RA 2XY6A 1V4TA 5CY4A 4KTZA 4F7GA 1D4XA 3EZWA 3TAGA 2YNGA 1EF1A 1N6QA 2RN2A 3CYMA 4B9TA 1HNWK 2A5XA 4YNQA 4E7IA 1KVAA 4AQYK 3SAFA 1HBKA 3EY1A 5DMRA 1ASUA 5K14A 4CD3A 5AQYA 5BRHA 4CFAA 3NH0A 1R59O 4CK3A 4CHQA 1HQEA 2I1KA 4M7XA 4WFBL 3PX4A 4ILHA 3LANA 2HHUA 2IS3A 1MDUB 5AQSA 3IVFA 5JVHL 5AQLA 4FYDA 1TK0A 3PUFA 5D3GA 4OPHA 1YAGA 1VQLN 3IKMA 1VBGA 1TYQA 3C0BA 3WQTA 3KD1E 4LF6K 1SS6A 1C0UA 1HPMA 4FM0A 1RBVA 3W3DA 3DMJA 4GY2B 1M90O 3QIJA 3GG4A 3O9TA 4KH4A 3V1OA 2W42A 4DV7K 2FBXA 3AGRA 4DQIA 4K8XA 3GOIA 1ASWA 2D11A 4MFBA 3OJSA 3VEOA 1S9EA 2HF3A 3DLEA 4OPJA 3OYCA 4CCHA 2QA4N 3HM8A 2PZSA 3TR8A 3LPTA 5LY3A 2XHBA 1IV0A 4I6MB 2KW4A 1JL2A 5I9EB 3FFKB 2GBZA 2OCEA 4CHZA 1VQNN 4B9SA 3EPYA 4DV2K 3O5BA 4N41A 4CJ7A 4YORA 4DSJA 1RBRA 2D10A 3O9QA 4V19S 3CG7A 5T7BA 4CJ4A 3HT3A 5HOOA 4JKFA 2RKIA 4KBOA 4EZ6A 4DV5K 4CGFA 3OBYA 3C95A 3CFOA 1EWRA 2PAVA 4KKOA 4JK7A 4PL7A 4BVPA 4B1YB 5EY4A 3OYMA 2WH5A 3ZSRA 4FJJA 3KLEA 3NF6A 4BWJA 4DTSA 2HHSA 1NG9A 3TAFA 2IC3A 2QK9A 4ELUA 4DUYK 4FLYA 3O4QA 1S5JA 4GV9A 2NRWA 3C6TA 2W6LA 5J2NA 4DSFA 2DY4A 3IDHA 1WOQA 1NLVA 4DS4A 5JS2A 3M8QA 5BPMA 2Y1JA 1RBUA 4FWPA 4HWIA 1JLGA 4H5TA 2VWJA 1Q9XA 3LWLA 3UKUA 3DI6A 2HW3A 1HNVA 2OPPA 1Y97A 2DPNA 1T6CA 4BRFA 1H4RA 3DXKB 1JL1A 3H08A 4B1XB 5GIOA 2COPA 1HYZA 3CCLN 3DLHA 1X9JA 2ASOA 4PY5A 4LF7K 5AZIB 4AH9A 1Q18A 3K5OA 2O8DA 1NMNA 4JKBA 1VQ7N 1LW0A 3JXUA 3I0SA 3P39A 2ZPYA 2WFBA 3NVKA 1U45A 5DM6L 3HO1A 1VQ6N 3O6WA 2X74A 4DF4A 1RNHA 1XI1A 1VSFA 4FSVA 1GC7A 4NCGA 2P1JA 1S3XA 4BRLA 2VGMA 4HUEA 3H3NO 3MWTA 3O4NA 4ELTA 3H6EA 3MX2A 3TWHA 2QXLA 4CJ5A 3RVCA 4OVLA 5LMUK 4JRPA 2KLAA 4E1JA 1SL2A 5H1SQ 3AVFA 3KIOA 4FL9A 3DM2A 1FKOA 1K8KA 4QS9A 4B9VA 4OO1J 4JN4A 3KTQA 3KK1A 4W5OA 2Q0RA 2YHBA 5FRMA 5JVLA 4DV1K 4B1WB 2Q31A 4N5SA 3AVCA 4H5RA 2OZMA 2D0BA 2RHKA 4RW9A 3H3OB 4AHCA 1BQNA 3BEXA 4CZHA 1DEJA 1ACAA 4DF8A 3DLKA 2G8IA 1MWKA 4CIFA 4R5PA 4ZTFA 4PKGA 3ZSZA 4JI6K 1RTJA 3ZT1A 2RF2A 2BDPA 4EHTA 4BE1A 2OPRA 2ASMA 1RT6A 4K8ZA 2YKMA 3G6EN 1IG8A 1T05A 3O80A 3FGUA 4YOUA 4DU3A 1R0AA 3DLLL 2FSKA 4MDAA 2OZSA 2FF3B 3V81A 3G4SN 1MIXA 4B1UB 3M6GA 4FWQA 3L3UA 4O8UA 5KPTA 3KK2A 3HK2A 4GMJB 4H5VA 1BIZA 5GAGP 4NCBA 3CCEN 5B8HA 4HDOA 4CGIA 4ISGA 1YJ9N 2X0SA 3I0RA 4Q5VA 5AZJB 3FZLA 4ELVA 4IKFA 2P9NB 3B6PA 3LM9A 4DQQA 3J80O 1G15A 4B9NA 1WAJA 3A5OC 4GXBA 1I94K 3PY8A 3U4LA 1YUWA 1U6ZA 1TVRA 2P9SB 1RDDA 3K9KA 3L2VA 4H4OA 3R1XA 2P51A 3QEPA 1X9MA 1YT3A 4W5RA 1WBDA 2GELA 4B3MK 3PX0A 4F2SA 2XY7A 1QQMA 3K0SA 3SJHA 5LJVA 1C1BA 1BI4B 4DMNA 2EMSA 3KWGA 3K5LA 1VQ4N 2P9UA 2IVPA 4DV3K 2QM1A 3O9SA 4KH5A 4QOZB 4CEDA 4XIUA 2GX9A 3Q7CA 4ZRJA 1NKCA 3ZX2A 1A5VA 3KK3A 4JAXA 3IS9A 5E84A 4M3RA 3AA4A 1XWLA 3L8BA 1VSKA 3EL2A 1ATSA 5KRTA 1HNXK 1W97L 3TTFA 4I7FA 2XY5A 3LAKA 4BRGA 3VQEA 4OKJA 4FWRA 2YNHA 3ZSWA 1WSHA 3SQ4A 2WC9A 2ZE2A 3WUHA 1S9GA 3CM5A 3PO4A 4JI8K 1TL1A 3TTDA 4M45A 3M8RA 1NK5A 2ETJA 3SUPA 2NRVA 3V9SA 2HVIA 4BE2A 2NZTA 4JK8A 1NTIA 4K25A 5GIPA 4EAHD 1VK0A 4PUOA 4BR2A 4CFBA 4WQ4A 5C2DA 4BACA 1C0MA 2I7NA 4OX9K 5FPMA 4IOAL 3MMVA 1NGFA 2QWLA 3LALA 3NHGA 4Q0BA 3AA3A 3E9PA 4WFNL 1VQKN 1VSIA 1OH8A 3L2RA 3QERA 2HB5A 1YJNN 2CGLA 2HVHA 4LH4A 4CFCA 4BGAA 2GWJA 1TUUA 1DT9A 3C6UA 1RT3A 2YKNA 3U7DA 3ULEA 1Q82O 1LAVA 1LCUA 4FZYA 2QEXN 3K58A 1NJYA 2BANA 2HHTA 3PSFA 3VQDA 1HYSA 4B8CA 1E4FT 2GUIA 1JXEA 4IJNA 5FRNA 1MIZB 5BPNA 4LD0A 2X6NA 3QBWA 2ASPA 5C25A 1SKSA 4DQRA 1KVBA 4FK2A 3NFAA 3CI5A 2X6SA 3BGRA 1ZBUA 3O1WA 1TKDA 1JLQA 3NBPA 3DYAA 3G9WA 3KKRA 3AVIA 3IMXA 1KAYA 4CJLA 3D45A 4E7JA 1Z05A 2H3GX 2XO7A 3HOTA 1FKPA 1C1CA 1N5YA 5M1QA 3VQ8A 5CYQA 1NK0A 4UY8O 1XNQK 4JI7K 4FPBA 5KQDA 5M1NA 1NVLA 1KAXA 4DR4K 1HB6A 3HXMA 3FZFA 3PLAA 5ADXH 3OBWA 5BR9A 1S1VA 1X1PA 3DLGA 3CQXA 3T1YK 4C8OA 3NF7A 3LWMA 3OJUA 4ILGB 3UKUB 1W2BM 1X9SA 4CJRA 5JS1A 4BDZA 2BE2A 3NDKA 4CBWA 3OA9A 5AQOA 5LJWA 4JKEA 4AHSA 2QWQA 2KHOA 3L4IA 5ELZA 4GW6A 1W7AA 5HRRA 1WN7A 3AGKA 4QAGA 3SBTA 4H0TB 2AJQA 5AQTA 3WXLA 5M1PA 3AU4A 2FLOA 3ZSOA 3CETA 1VQPN 4BRPA
chains in the Genus database with same CATH topology
4CD3A 1SZ2A 1NMDA 5AQYA 5BRHA 1ZC6A 4DQ8A 2J0MA 1R59O 2DIKA 2P9LA 5C0YA 4JD2A 4L3QA 2I1KA 3HTVA 5C15A 5HL7L 5MLCQ 4NO7A 4M7XA 4MO5A 4WFBL 3C6HA 4CZKA 4ILHA 4CZMA 3SK3A 1Q86O 3VEVA 1MDUB 4XH5A 3WT0A 5AQSA 3IVFA 3L0QA 5JVHL 1OKJA 3C7NA 3GE1A 4BY9C 2Q36A 5AQLA 3VEWA 3G25A 4FWSA 4BG9A 4CD1A 3SAHA 4EHUA 4OPAA 1YAGA 1ST7A 3E66A 4OPHA 4IO9L 1VQLN 3IKMA 3DJCA 1VBGA 4H0YB 1DKGD 1O13A 1TYQA 3PVLA 3C0BA 1BO5O 3WQTA 1SS6A 3NVMA 4H03B 1SAZA 2YCHA 1HPMA 2E2NA 3D7EO 3W3DA 4GY2B 1M90O 3QIJA 3GG4A 3O9TA 4KH4A 3AGRA 5AQMA 4JHDA 5KPZA 4C23A 4PHTX 1NGIA 3EE9A 3ZEUB 2E2QA 5AQHA 1K8KB 3GOIA 3CXCM 5FPDA 2D11A 3VEOA 2HF3A 4GVEA 2QA4N 1SGHA 3HM8A 4O5FA 3RSEB 3UE5A 3WEEA 3VPZA 3CCJN 5LY3A 3CJ9A 2D2QA 1VQPN 4BR5A 4I6MB 4BRKA 2PBDA 2VCPA 1J6ZA 4IOXA 5I9EB 2QWNA 3FFKB 2RQ1A 3CJBA 5F0XA 1VQNN 2GUPA 3EPYA 5EVZA 2YJEA 4YOXA 2FJ9A 1HKGA 2FF6A 5GAHP 2VYPA 3FR0A 3ZX0A 3MK6A 3I56N 4FWNA 4QS7A 3O5BA 4CJ7A 2P9PB 4YORA 5AQXA 4YOTA 3QB0A 3O1BA 2BH1A 2D10A 4BREA 2QI2A 3PZDA 3O9QA 1QQNA 4H5NA 2NRTA 5HOOA 4ZRKA 4JKFA 4BGBA 4YOYA 4KBOA 3H1VX 4AM7A 1QVGM 2HE7A 4YL8A 2BTFA 4JEPA 4A2BA 2YJFA 3X23A 3MWPA 3BUZB 3OBYA 3CC2N 5KQ8A 2D1KA 4CYEA 4GV6A 2PAVA 3SMSA 1G99A 4JKGB 4JK7A 3I33A 5BREA 4BC3A 4PL7A 4A61A 4BQZA 4IXCA 4B1YB 4BVPA 4PKHA 5EY4A 5CE3A 2NNWA 3MCPA 4A59A 2WH5A 1EO1A 3MX5A 4FOIA 1J19A 4CZIA 3BINA 1QQOA 1BA0A 1NGDA 4BRIA 4K42A 1ATNA 4BR0A 4BC5A 5IJMA 5CHIA 3CIPA 1QZ5A 4WQ5A 5AQFA 1DIKA 3I8BA 3VGLA 4GV9A 3MCAB 2ZGZA 3A8YA 4FOEA 2NRWA 1KD1O 2HRJA 1K73O 4G9ZA 4WYBA 3IDHA 5C12A 1VBHA 1WOQA 1NLVA 2ITMA 3WXJA 4Z94A 3WQUA 5GADP 3KVGA 4CZGA 1YIJN 1NGJA 2IVNA 5FPNA 3MN7A 5BPMA 3UKRA 3KK7A 3P4IA 4FWPA 4HWIA 2YX6A 4H0OA 4H5TA 3BP8A 2V7ZA 1RGIA 3D2FA 1DGKN 3UKUA 1TUYA 2I1JA 2NRHA 4C1NI 1HUXA 2A42A 3E9OA 2QWOA 2DPNA 2F9WA 4HTLA 4BR9A 3WXIA 4WQ4C 5AQJA 4KH6A 1T6CA 4BRFA 1H4RA 1P90A 3DXKB 4NLCA 5AQNA 2V51B 1KAZA 3OW2M 5M1KA 4B1XB 4GV3A 3P31A 2GWKA 5GIOA 2FDQA 2COPA 1QHAA 2V7YA 1K9MO 3CCLN 1HKCA 1X9JA 4JKDA 2ASOA 5AZIB 3LDQA 2HBMA 4IWVA 3E1YA 1Q18A 1ILYA 2YVCA 4FWOA 3VEYA 4JKBA 1VQ7N 1XQSC 3D6RA 3JXUA 3A5LC 3AY9A 1T44A 2P9UB 3P39A 3HRGA 2ZPYA 2WFBA 1YI2N 5ADXA 3NVKA 2ZWHA 4IZ9A 1ZBSA 5F1XA 5DM6L 3A0IX 1NGGA 3M1FA 3O6WA 5TKWA 1VQ6N 1V4SA 3FZHA 1JDEA 4FSVA 3HOSA 1GC7A 2Q97A 5AQGA 4CZFA 4U67L 1MWMA 2ZGYA 4RCHA 3F5TA 2AEHA 4A5BA 4CBUA 4AM6A 5AFUH 5EX5A 4PKIA 1S3XA 2VWBA 1Y64A 4TKNA 3U8ZA 1RDUA 3KZBA 2LBBA 2VGMA 4BRLA 2W41A 3H3NO 3MWTA 2F7TA 3H6EA 3MX2A 1HX1A 5AQUA 2FSNA 2QXLA 3RVCA 4BG8A 2D0PA 4YDUA 2I7PA 2KLAA 5AQKA 1GLFO 2P9KB 3CPEA 5M1OA 4E1JA 5H1SQ 3W0LA 1NJIO 1X3MA 2J0JA 4WFAL 4FL9A 3MN6A 1H1VA 2RE2A 3ZEUA 1K8KA 4QS9A 3CCQN 1NGEA 4OO1J 2P9LB 2KKZA 4JN4A 4JD2B 3QMLA 1KC7A 2D0OA 2OANA 2CB8A 3WA0A 1VAZA 2A3ZA 2Q0RA 3RSEA 3A5NC 3LL3A 1IJJA 5JVLA 4R79A 3ZDTA 4B1WB 1NM1A 2Q31A 2CQUA 4CBXA 3IUCA 3QFUA 2E8AA 4HDQA 4I6MA 4H5RA 1Y19B 3CERA 1C0FA 3P38A 4B9QA 2RHKA 1SQKA 3DAWA 3H3OB 2HF4A 3BEXA 4CZHA 1DEJA 1ACAA 3CCVN 1XC3A 2P9IA 4WQ5C 3SBGA 2YHYA 4ZRIA 1VQMN 1TYQB 2VGNA 3R9PA 4IDHA 2OTJN 1MWKA 2P9PA 4JKCA 2AL6A 4PKGA 5BPLA 1KC8O 3O08A 4K43A 4H0XB 1Z6RA 1VQ9N 5TKYA 4EHTA 3WXMB 3HBTA 2CH6A 2ASMA 3TPQA 4RTFD 4XH1A 2D4WA 3CCMN 2HMPA 3AARA 2ZJRL 5DM7L 1YF5L 3G6EN 1VQ5N 3EO3A 1RDWX 1IG8A 4BQLA 3CJCA 3UB5A 4M63C 4JKGA 2IVOA 3O80A 3FGUA 4YOUA 3VEXA 3SMPA 4YOWA 5KPRA 4YOVA 2FSKA 3DLLL 4CZLA 5JICA 3CC7N 4MDAA 2E1YA 2FF3B 3ZYYX 3EKSA 4WCEL 5AQZA 2PFUA 2EWSA 3G4SN 3BF1A 1MIXA 4B1UB 5GINA 3M6GA 2ZJPL 3ULEB 1JJ2M 4FWQA 3GDQA 1U2VB 3VF6A 3MN9A 4O8UA 4O8KA 4K41A 3CHWA 5BRDA 5KPTA 1GLAG 1S22A 4H5VA 1ATRA 4NY0A 1MA9B 1NGHA 3U8XA 2BUPA 4BVOA 4BROA 2HBJA 5GAGP 3VESA 3WXKA 5B8HA 3CCEN 1E5WA 4HDOA 4IO8A 4FO0A 1Q7YO 3VENA 3LM2A 3O4WA 3TSPA 3AU5A 3QICA 1NGCA 1ISNA 4NB4A 4ISGA 2NRXA 1YJ9N 2X0SA 2E20A 3M3ZA 3VTIA 4BR7A 5AZJB 3NMUA 3FZLA 3H1QA 2P9NB 3LM9A 3CC4N 4CI6A 1ESVA 1NBWA 2YHWA 3A5OC 4FVUA 3CJ7A 4GXBA 4DHYA 2J4RA 3CF5L 4BR4A 4MLEA 3QDKA 3U4LA 1YUWA 1U6ZA 3O9UA 3SAGA 1GLCG 3CCUN 2HBKA 2P9SB 3DXKA 3K9KA 1GLEG 2NRRA 3R1XA 1P8ZA 2HBLA 4YDUC 3SLCA 3DXMA 3LDLA 2W40A 2QWMA 3KHYA 3ZETB 2GELA 3CCSN 3QFPA 5AZIA 1MK7B 2J0KA 3EN9A 1MK9B 4RWTA 1QQMA 5AQVA 5E26A 3KWIA 2WBNA 3U9DA 4A57A 3SJHA 5LJVA 3EE8A 2EMSA 1HJOA 1YXQA 3KWGA 4MDBA 3J7ZO 1K8AO 1VQ4N 2P9UA 4ISEA 2IVPA 3EKUA 3ID6A 3VOVA 4BRQA 1RFQA 1LOTB 2QM1A 2HSTA 3O9SA 3HI0A 2A41A 5AQPA 3VMFB 4KH5A 4CZEA 2AA4A 2GX9A 3Q7CA 4JKAA 4ZRJA 1BG3A 3E9LA 3ZX2A 1T6DA 2Q1NA 4H5WA 3CQYA 4JAXA 3T69A 5E84A 4XEIA 3ATVA 4J8FA 1YHQN 4FWLA 4GNIA 3JS6A 3QBXA 1NWKA 3LDPA 4BC4A 3ENOA 3D2EB 3TSUA 5C2FA 2P9KA 2WUSA 3EL2A 1ATSA 3F2KA 4EKUA 1W97L 1HLUA 3TTFA 1JCEA 4QS8A 4BRGA 3PIPL 3CMAN 3DWLA 3C65A 3L6QA 5GAEP 4FWRA 2WC9A 3WUHA 4CZJA 4ISFA 5BRFA 1JCFA 2HOEA 3TTDA 2ZF5O 1KQSM 1XUPO 5JLFA 3FLVA 4WF9L 2Q2RA 4DB3A 2NRVA 4PL8A 4BRNA 2NZTA 4JK8A 1NTIA 4IJAA 4K25A 3TTCA 3HZ6A 2Q0UA 2CGJA 3C7NB 3OHRA 1VQON 5GIPA 4EAHD 1M1KO 2R82A 5AFUA 1BWFO 4BR2A 4WQ4A 4BRCA 3LDOA 5C2DA 2GEMA 3VGMA 4A2AA 5M1FA 3S41A 3BF3A 3T7ZA 2I7NA 5FPMA 4IOAL 1GLLO 3CPWM 3Q7BA 3MMVA 2QWRA 4BRAA 1NGFA 2QWLA 4JK9A 1GG3A 4AF1A 3E9PA 4WFNL 1VQKN 1BOTO 2ABDA 4ILJA 3ATUA 3O8MA 5JVGL 4JNEA 2EMTA 4P7IA 3B8AX 4JHDB 3PIOL 1E4GT 5AQQA 1YJNN 1GC6A 2CGLA 5AQWA 4U7BA 4BGAA 2GWJA 2E2PA 4A62A 4H0PA 4XH4A 1ZXOA 3N4QA 1TUUA 1DT9A 2NRZA 2JWKA 4BRHA 4EFHA 4NLBA 3J8AA 2A40A 2CH5A 3C6AA 3U7DA 3IFRA 3WEEB 1N8RO 2A6AA 3ULEA 1Q82O 1VQ8N 1U2VA 3VERA 1LCUA 5AR0A 2QEXN 1HKBA 3FLCO 4FPAA 1YITN 3H45C 2P9IB 4F9OA 2F9TA 2QTDA 4BRMA 3ENHA 1T3VA 2FXUA 5EXWA 1BA1A 4DCHA 3A5MC 4MO4A 1E4FT 4IJNA 4BRDA 1QVFM 2E2OA 1MIZB 3ZX3A 5BPNA 4BC2A 3FZMA 3F9MA 3FP5A 1HB8A 2E1ZA 1KBLA 3QBWA 3MDQA 2ASPA 4Y0WA 1YJWN 3N4PA 2GTDA 3HSCA 1JCGA 4M7YA 1CZAN 4MLHA 5AZJA 2ZJQL 1C0GA 2AP1A 3LDNA 2P9NA 3MN5A 2QWPA 4IFEA 1GGOA 2YHXA 3L4QA 3I55N 1KXPA 3CI5A 3GL1A 4C1NK 5JMVA 3CMEN 3GBTA 3O1WA 1GLDG 3AAPA 3CJ1A 3CD6N 4H0VB 2P9SA 3ID8A 3VETA 4IOCL 3G9WA 5C10A 2OTLN 4JKHA 1KAYA 3H46O 2E88A 3IMXA 1NGBA 3VF4A 1YVNA 5AQIA 4DKWA 1Z05A 3ENBA 3ZETA 4IEIA 4EIAA 1WUAA 3FZKA 2H3GX 4B1VA 3CCRN 1Q81O 3HOTA 3G71N 3K9JA 3M5RA 1OVYA 1BUPA 1X3NA 5M1QA 5BN9A 4A5AA 2NLXA 3VTHA 4UY8O 4DXAB 5BN8A 4FPBA 2QW9A 5KQDA 5M1NA 1NVLA 1KAXA 4IEEA 1BDGA 4FWKA 1HB6A 1GLBG 3FZFA 1NGAA 1QZ6A 5ADXH 3PLAA 2CGKA 3OBWA 5BR9A 3U9ZA 3CQXA 2JWLA 3UKRB 1BU6O 3FE1A 2UYTA 2V52B 3R3LA 3TU5A 3VF2A 2FSJA 2IIRA 4ILGB 3D2FB 3UKUB 2YI1A 5JLHA 1W2BM 5AQRA 3O9RA 4LC9B 1NI2A 1V4TA 4F7GA 3EZWA 1D4XA 1EQYA 5FPEA 1S72N 4CBWA 3OA9A 5F2RA 3D2EA 3AAQA 1EF1A 3DXMB 5AQOA 3R8EA 5LJWA 4JKEA 3VGKA 2QWQA 2KHOA 3L4IA 5ELZA 3VEZA 2A5XA 5CR4A 3R6MA 3AGKA 3CJAA 3SBTA 4FWMA 4H0TB 5EOYA 4B1ZA 5AQTA 3WXLA 5M1PA 1GLJO 3AU4A 2FLOA 3TSQA 3CETA 3SAFA 1HBKA 4BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKC A;  4JK9 A;  4JKH A;  3E9P A;  4ILG B;  3E9O A;  4ILJ A;  4ILH A;  3ENB A;  4JKA A;  3E9L A;  4JKF A;  4JK8 A;  4JKE A;  3E66 A;  4JKD A;  4JKG A;  3SBT A;  4JKG B;  4JK7 A;  4JKB A;  3SBG A; 
#chains in the Genus database with same CATH topology
 1SZ2 A;  1NMD A;  1I39 A;  4DQ8 A;  2J0M A;  2D5R A;  4FCY A;  5MLC Q;  3HTV A;  5C15 A;  5HL7 L;  4UQG A;  4CZM A;  2KFZ A;  3VEV A;  4XH5 A;  1JXB A;  3VQP A;  4BY9 C;  3G10 A;  4EHU A;  1OVQ A;  4OPA A;  1ST7 A;  2UXB K;  4KTW A;  1DKG D;  3DOK A;  1O13 A;  1SAZ A;  4M41 A;  1QHT A;  3MEC A;  1WBB A;  3SV4 A;  4B3O A;  4B9L A;  4I2P A;  4ZTJ A;  4OGE A;  4DTP A;  4C23 A;  4LSN A;  2F8S A;  2E2Q A;  4CGG A;  2KZZ A;  1KTQ A;  1K8K B;  1GOA A;  3QO9 A;  1CZB A;  1SGH A;  3ASM A;  3VPZ A;  3CCJ N;  4GKJ K;  1RTH A;  4KB0 A;  3HL8 A;  4BRK A;  4IOX A;  1U49 A;  2QWN A;  5F0X A;  1DLO A;  2G8W A;  2UUA K;  3BZC A;  4YOX A;  1S1W A;  1HYV A;  4X62 K;  2EHG A;  3FR0 A;  3ZX0 A;  3I56 N;  4KHS A;  5AQX A;  3QB0 A;  5IWA K;  2QI2 A;  4O44 A;  2XRI A;  4ZRK A;  4LSL A;  2B5J A;  4BGB A;  4DUZ K;  4JS5 A;  1QVG M;  1XNR K;  4JEP A;  2YJF A;  3MWP A;  3BUZ B;  3CC2 N;  2D1K A;  3J81 O;  3SMS A;  1G99 A;  4BC3 A;  4BQZ A;  5CE3 A;  2NNW A;  1JLC A;  4ID1 A;  4DTM A;  1EO1 A;  3MX5 A;  1J19 A;  4CZI A;  3BIN A;  1QQO A;  1NGD A;  4K42 A;  5IJM A;  3VQ4 A;  3CIP A;  1QZ5 A;  4WQ5 A;  5AQF A;  5EU7 A;  3L2Q A;  4FOE A;  1U4B A;  2A1S A;  3DLB A;  1K73 O;  1BI4 A;  3HST B;  1VBH A;  2ITM A;  3WXJ A;  5GAD P;  1NNE A;  3KVG A;  4GKK K;  3MN7 A;  2YNF A;  3BP8 A;  4JI2 K;  3O3G A;  1WSI A;  4HTU A;  1TUY A;  2NRH A;  1VSJ A;  2F9W A;  3LDS A;  4BDY A;  4DFJ A;  1KAZ A;  3QIO A;  1BQM A;  1HKC A;  4JKD A;  3HPH A;  4FJ5 A;  4LFB K;  3SJJ A;  2QKB A;  2B6A A;  4W5T A;  3D6R A;  3AY9 A;  1T44 A;  2P9U B;  3HRG A;  1YI2 N;  5ADX A;  4IZ9 A;  1ZBS A;  1Q8I A;  5F1X A;  2ZM6 K;  1NGG A;  3OYL A;  4KI6 A;  3WNF A;  1V4S A;  3OS2 A;  4CEE A;  2O8E A;  3HOS A;  2Q97 A;  2ZGY A;  4RCH A;  2AEH A;  3HJF A;  4AM6 A;  4KHU A;  1ASV A;  4PKI A;  4CGD A;  3V4I A;  2FBT A;  3U8Z A;  1RDU A;  5SZT A;  3KZB A;  3AO4 A;  2LBB A;  5C24 A;  1L5U A;  2F7T A;  3ZLJ A;  1HX1 A;  1LWF A;  4BG8 A;  5CYM A;  2D0P A;  4AHR A;  3UIQ A;  5AQK A;  1GLF O;  1IKW A;  5HRN A;  1X3M A;  3U3G A;  2UU9 K;  1H1V A;  4Y1D A;  2RE2 A;  3DOL A;  4DSI A;  2G8H A;  3CCQ N;  1NGE A;  3VQ9 A;  2KKZ A;  3OYE A;  4JD2 B;  1KC7 A;  3JYT A;  1B92 A;  1NU0 A;  2A3Z A;  3LL3 A;  4R79 A;  1TKX A;  3IUC A;  3V9W A;  1VRT A;  4HDQ A;  4B08 A;  4CVN E;  1Y19 B;  3P38 A;  3NF8 A;  3NGZ A;  4CJF A;  3DAW A;  3HPO A;  1YTA A;  2OTJ N;  2P9P A;  4JKC A;  1GOB A;  4H0X B;  3AO1 A;  5TKY A;  3JSM A;  3WXM B;  4NCA A;  3HBT A;  2CH6 A;  3OYG A;  3V1Q A;  4RTF D;  4RG8 A;  3S3M A;  2HMP A;  1JKH A;  1VQ5 N;  3T1H K;  4PA1 A;  4M63 C;  4JKG A;  2IVO A;  4CF0 A;  4YOV A;  3CC7 N;  3OYH A;  3ZYY X;  4WCE L;  2ZJP L;  3ULE B;  1XMQ K;  4M3X A;  3VF6 A;  5KGW A;  1E3M A;  3MN9 A;  4CK2 A;  1BHL A;  4Z4I A;  4O8K A;  4DV6 K;  2G8U A;  3HYF A;  1VSD A;  5HRP A;  3VES A;  1E5W A;  1HPZ A;  2VWK A;  4IO8 A;  1BIS A;  3VEN A;  3ZT3 A;  3O4W A;  3TSP A;  3AU5 A;  4KO0 A;  1HMV A;  3DRS A;  3O3H A;  2HND A;  2E4L A;  3M3Z A;  4LH5 A;  3VTI A;  2G8F A;  3H1Q A;  3QIN A;  1TAQ A;  2E5L K;  3CC4 N;  3THX A;  2YHW A;  1LV5 A;  2HHW A;  3CJ7 A;  4DHY A;  2J4R A;  1WSJ A;  2IOC A;  3O9U A;  3BZK A;  4WE1 A;  3OS0 A;  2QWM A;  1W0H A;  4CEA A;  4CF8 A;  1KSP A;  2KQ2 A;  1MK7 B;  1RT4 A;  4CGJ A;  5AQV A;  5E26 A;  2VG5 A;  4A57 A;  3J7Z O;  1K8A O;  4MDB A;  4CES A;  3V1R A;  1RFQ A;  1LOT B;  4F8R A;  1N34 K;  3HI0 A;  3ZSY A;  2A41 A;  3VMF B;  4EP4 A;  3OYI A;  2AA4 A;  4JKA A;  5SWM A;  1HRH A;  2Q1N A;  2E6M A;  4XEI A;  4J8F A;  1YHQ N;  4GNI A;  3V9U A;  3QBX A;  1NWK A;  3LDP A;  4M3U A;  2P9K A;  3RMA A;  4CJ3 A;  3DWL A;  2E6L A;  3L6Q A;  5GAE P;  3LZI A;  2D0C A;  3QEX A;  1JCF A;  2HOE A;  5JLF A;  3C94 A;  4WF9 L;  1ITG A;  3KJV A;  4LF8 K;  4BRN A;  3QLH A;  3TTC A;  3HZ6 A;  1VQO N;  3AVK A;  4B3T K;  2R82 A;  2P5G A;  1D9F A;  2PYJ A;  4HUF A;  1GLL O;  4BRA A;  1GG3 A;  3LP0 A;  5LMN K;  1N36 K;  1Z26 A;  2ABD A;  4OKE A;  4DV0 K;  4LF5 K;  5KRS A;  4JYA K;  4J2D A;  4KAZ A;  1GC6 A;  1L3S A;  4E0D A;  5CZ1 A;  4FLW A;  4H0P A;  3N4Q A;  1BIU A;  2B4J A;  4JS4 A;  4EFH A;  4W5Q A;  3C6A A;  1N8R O;  2O4G A;  4J2E A;  4Z4F A;  2A6A A;  1U2V A;  4DU4 A;  3HVT A;  4F3O A;  1YIT N;  3H45 C;  2P9I B;  3OTO K;  4BRM A;  5EXW A;  1BA1 A;  2WOM A;  1OH6 A;  4FLV A;  3ZX3 A;  4BC2 A;  3F9M A;  3FP5 A;  2E1Z A;  1YTU A;  1YJW N;  4MLH A;  4M7Y A;  4Z4E A;  3JAM O;  1XHZ A;  1C0G A;  3MN5 A;  1DTT A;  3LDN A;  4IFE A;  2QWP A;  3I55 N;  4JI1 K;  2G8V A;  4CGH A;  1UAX A;  1KXP A;  3GL1 A;  5C42 A;  4FW2 A;  4C1N K;  5JMV A;  3CME N;  1TAU A;  3GBT A;  1TK8 A;  3AAP A;  3DRR A;  3CD6 N;  4F3T A;  3H46 O;  4E3S A;  2E88 A;  1NGB A;  4CHN A;  2RPI A;  5AQI A;  3ZET A;  1F21 A;  4NYN A;  3B6O A;  2BGG A;  3M5R A;  1QTM A;  2NUB A;  1RIL A;  5BN9 A;  2NLX A;  3AV9 A;  3EYZ A;  4DTJ A;  2OPQ A;  1BDG A;  4FWK A;  1NGA A;  3V9X A;  2FBY A;  1RT1 A;  2JWL A;  2OPS A;  1BU6 O;  3BY5 A;  3MEG A;  2V52 B;  3TU5 A;  2FSJ A;  4FM2 A;  5JLH A;  2Z1G A;  4DSE A;  3QET A;  4KI4 A;  1S72 N;  5FPE A;  1EX4 A;  4DLE A;  3KD5 E;  4IOC L;  5F2R A;  3D2E A;  3AAQ A;  2YNI A;  5CR4 A;  3BDP A;  3AVJ A;  4KTQ A;  3R6M A;  4Z4G A;  4B1Z A;  5EOY A;  1NJX A;  4B3R K;  4FLX A;  4C8M A;  1DTQ A;  3LP2 A;  1ZC6 A;  2JLE A;  2DIK A;  3ZSX A;  2Z1I A;  3AVM A;  4JD2 A;  3TAR A;  4NO7 A;  4MO5 A;  4E1N A;  4M3T A;  3WT0 A;  1NK6 A;  1RCH A;  3GE1 A;  3KLG A;  3V9Z A;  2O8E B;  3SAH A;  3G25 A;  4CD1 A;  4BDP A;  4FLT A;  5J1E A;  3CQ8 A;  2YHA A;  1QSS A;  4KB1 A;  3P1G A;  3L2W A;  1BO5 O;  3NVM A;  3EZ5 A;  4H03 B;  2YCH A;  1C1A A;  2E2N A;  1LW2 A;  3LP3 A;  5AQM A;  4JHD A;  5KPZ A;  1FJG K;  3EE9 A;  4CIG A;  5AQH A;  4CJK A;  3OYF A;  3CXC M;  5FPD A;  1IKV A;  1N33 K;  1NOY A;  4FJN A;  1BL3 A;  3WEE A;  1T7P A;  3CJ9 A;  3KLH A;  4RW6 A;  4BR5 A;  2PBD A;  2ATQ A;  2VCP A;  1J6Z A;  2RQ1 A;  3CJB A;  3T1A A;  2GUP A;  1IH7 A;  5EVZ A;  5GAH P;  2FF6 A;  3THW B;  2VYP A;  1TGO A;  1WNS A;  3MK6 A;  4FWN A;  3A2F A;  4G1Q A;  4QS7 A;  3OYN A;  2P9P B;  3O1B A;  5FRO A;  3S3N A;  3KLF A;  1QQN A;  4H5N A;  2NRT A;  1KLN A;  1JLE A;  3H1V X;  3SI6 A;  4YL8 A;  4BWM A;  2BTF A;  4HCB A;  3X23 A;  3AVG A;  4CYE A;  2IGI A;  4KFB A;  1SL1 A;  4GV6 A;  4JKG B;  3VQ6 A;  4A61 A;  4IXC A;  4FLU A;  3TAQ A;  4PKH A;  1UA0 A;  3WNH A;  3MCP A;  4A59 A;  4FM1 A;  3MXM A;  1BA0 A;  2UXD K;  4BRI A;  1ATN A;  4BR0 A;  4BC5 A;  1JLF A;  5CHI A;  4KV8 A;  1DIK A;  3I8B A;  3MCA B;  2ZGZ A;  5KI6 A;  4TSX A;  3TAN A;  1IBL K;  2O8B A;  5AJ3 K;  2HRJ A;  4WYB A;  3ZT0 A;  1FW6 A;  4Z94 A;  4CIE A;  1YIJ N;  4CZG A;  1NGJ A;  2IVN A;  3NAE A;  1ZBF A;  3P4I A;  4HUG A;  4FXD A;  2YX6 A;  2QXF A;  3RMD A;  1DGK N;  4YHH K;  3VQB A;  4C1N I;  1YVU A;  3THX B;  2A42 A;  1C6V A;  2QWO A;  4AHT A;  3QNN A;  1P90 A;  4NLC A;  2O8F A;  5AQN A;  2V51 B;  3OW2 M;  3U6F A;  4J2A A;  5M1K A;  1QHA A;  2V7Y A;  1K9M O;  4NYF A;  1KLM A;  3D0P A;  4IWV A;  2HBM A;  5J2Q A;  1ILY A;  2YVC A;  4FWO A;  3SUN A;  1ZYQ A;  1XQS C;  3OYB A;  1JLA A;  3M1F A;  4RW8 A;  5TKW A;  4I2Q A;  3FZH A;  1JDE A;  2F8T A;  1MWM A;  4CBU A;  4K0K K;  5AFU H;  5EX5 A;  3M8S A;  3PV8 A;  4TKN A;  1IG9 A;  1I3A A;  1QQC A;  2W41 A;  2HHX A;  4F4K A;  5AQU A;  4YDU A;  2I7P A;  2P9K B;  3CPE A;  1BGX T;  3W0L A;  1A5W A;  4IG3 A;  3PX6 A;  3K59 A;  3MN6 A;  2Y1I A;  4Z4H A;  3ZEU A;  4DR3 K;  3ULD A;  2Z1J A;  2P9L B;  2DTU A;  3QML A;  3TI0 A;  2D0O A;  3WA0 A;  1VAZ A;  1VHX A;  3RSE A;  4ZHR A;  4JI5 K;  1EET A;  2OA8 A;  3ZDT A;  3QFU A;  2KZM A;  4HCC A;  2PYL A;  1T03 A;  4DQS A;  2HF4 A;  4JV5 K;  1XC3 A;  1U04 A;  2P9I A;  4WQ5 C;  1S1U A;  4CE9 A;  2F4V K;  1VRU A;  3VQQ A;  3RRH A;  5BPL A;  2AL6 A;  4OLA A;  3O08 A;  2Z1H A;  1NKE A;  1Z6R A;  3NGY A;  4MQ3 A;  3TPQ A;  2D4W A;  3K2P A;  3RTV A;  1CZ9 A;  4AHV A;  2ZJR L;  3ZT2 A;  5DM7 L;  2VG7 A;  3EO3 A;  4DFP A;  3VEX A;  3SMP A;  4EP5 A;  4YOW A;  5KPR A;  5JIC A;  3T3F A;  2E1Y A;  4FVM A;  3EKS A;  2EWS A;  3BF1 A;  5GIN A;  3GDQ A;  1U2V B;  5BRD A;  4K41 A;  3PO5 A;  1S22 A;  1MA9 B;  1KFS A;  4LF9 K;  3U8X A;  4BVO A;  3ISN C;  1VSH A;  3WXK A;  1S1X A;  4FO0 A;  5LL6 Z;  1ISN A;  4NB4 A;  4DS5 A;  4FJX A;  3K5M A;  2E20 A;  1D5A A;  3S3O A;  2PY5 A;  4BR7 A;  4CEC A;  3OYD A;  3I8D A;  4FJM A;  2G8K A;  5HRS A;  4CI6 A;  1J5E K;  3NF9 A;  3K57 A;  1LWE A;  4MLE A;  4CJV A;  3QDK A;  4JRQ A;  3SAG A;  2VQF K;  1GLE G;  1BCM A;  1P8Z A;  3SUQ A;  3LDL A;  2W40 A;  3KHY A;  3ZSV A;  3ZET B;  3CCS N;  3QIP A;  3QFP A;  1RDB A;  4IFY A;  2J0K A;  3EN9 A;  4DFM A;  4IDK A;  4RWT A;  3KWI A;  4GVM A;  5BR8 K;  1HJO A;  4IFV A;  4KRE A;  4O55 A;  4AHU A;  4E89 A;  3EKU A;  3ID6 A;  5J2M A;  3VOV A;  4BRQ A;  2WON A;  3SV3 A;  1RBS A;  2HST A;  4IBN A;  1L3U A;  3ZT4 A;  3VN5 A;  2KTQ A;  3J7Y P;  1BG3 A;  4Z0U A;  4H5W A;  3CQY A;  3T69 A;  3TAM A;  4C8N A;  3WNE A;  3ATV A;  4FWL A;  3F9K A;  4BC4 A;  1REV A;  3D2E B;  5C2F A;  3MXI A;  3F2K A;  4EKU A;  1HLU A;  4E1M A;  1JCE A;  4OJR A;  5A2Q O;  3C65 A;  1S6P A;  1UA1 A;  2XY8 A;  3SQ0 A;  1SKW A;  1WSG A;  4ISF A;  1X9W A;  4KHP K;  4Y1C A;  4W5N A;  4JI4 K;  3LZJ A;  2OYQ A;  1KQS M;  4EZ9 A;  2FC0 A;  3FLV A;  4DB3 A;  4CFD A;  3ZSQ A;  5HLF A;  4IJA A;  4KHQ A;  3OHR A;  4HVJ A;  1M1K O;  5AFU A;  3AO5 A;  1BWF O;  4DTO A;  4CEO A;  1NK9 A;  1D9D A;  2GEM A;  3VGM A;  5HP1 A;  3S41 A;  5KGX A;  3THW A;  1HR0 K;  1VSL A;  4I9Q A;  3CPW M;  4B3S K;  2KFN A;  1L3V A;  4AF1 A;  1NJZ A;  1K6Y A;  3DRP A;  4L8R B;  4ILJ A;  4JNE A;  4JHD B;  2QKK A;  2O4I A;  1E4G T;  5AQQ A;  1EWQ A;  3SPY A;  3SNN A;  2E2P A;  4XH4 A;  1JLB A;  2NRZ A;  4DR6 K;  2JWK A;  3K5N A;  4BRH A;  3QEV A;  4NLB A;  4O4G A;  2CH5 A;  3WEE B;  3IFR A;  4FJ8 A;  1VQ8 N;  4PWD A;  3VER A;  5AR0 A;  1HKB A;  1Z25 A;  1W9H A;  1EKE A;  4F9O A;  2QTD A;  3ENH A;  1T3V A;  2R7Y A;  4DLG A;  3NH1 A;  3RMB A;  3A5M C;  4MO4 A;  4LFC K;  4BRD A;  4I9L A;  3CFR A;  3FZM A;  4AIL C;  5FDL A;  1KBL A;  3MDQ A;  3N4P A;  2ZJQ L;  2AP1 A;  4DR7 K;  3L4Q A;  2IAJ A;  3F73 A;  5IT9 O;  1RBT A;  2JGU A;  3E01 A;  1L3T A;  3QEI A;  3VET A;  3ID8 A;  1IKY A;  1RDC A;  5KTQ A;  4JKH A;  4DKW A;  3ENB A;  3AA2 A;  4IEI A;  4EIA A;  3IG1 A;  2UXC K;  3CFP A;  3K9J A;  1OVY A;  4A5A A;  3QES A;  1RTI A;  3VTH A;  3RWU A;  5BN8 A;  2YV0 X;  1O1W A;  3L3V A;  2O8B B;  4FZZ A;  3SQ1 A;  5HRO A;  1GLB G;  2CGK A;  1HNI A;  3U9Z A;  4YFU A;  3VQ5 A;  3FE1 A;  3R3L A;  1HJR A;  2O8C A;  1FXX A;  2YI1 A;  1U47 A;  5AQR A;  1ZBI A;  4LC9 B;  4DTX A;  1NI2 A;  1EQY A;  1RT5 A;  3R8E A;  3G0Z A;  3SZ2 A;  3DXM B;  3IAY A;  2DFF A;  3VGK A;  2O8F B;  3EEQ A;  3HVR A;  3VEZ A;  3SCX A;  4CJP A;  4M3Z A;  4E7H A;  3HM9 A;  3CJA A;  4FWM A;  4OLB A;  3PSI A;  1GLJ O;  3TSQ A;  4M3W A;  4M42 A;  4CF1 A;  4CK1 A;  5C0Y A;  2P9L A;  5HBM A;  4L3Q A;  3IRX A;  3C6H A;  4CZK A;  4DFK A;  3SK3 A;  1Q86 O;  2HMI A;  2VG6 A;  4YY3 K;  3L0Q A;  3NGI A;  1OKJ A;  3C7N A;  4CJE A;  2Q36 A;  3VEW A;  4BG9 A;  4FWS A;  1N32 K;  2FBV A;  3E66 A;  3NH2 A;  4IO9 L;  4JI3 K;  4H0Y B;  3DJC A;  3VQC A;  2DFE A;  3PVL A;  4E19 A;  4DTR A;  3P5J A;  2HHH K;  2UUC K;  3D7E O;  1B9F A;  4LFA K;  4BE0 A;  3AVA A;  1LAW A;  1EP4 A;  4PHT X;  1NK7 A;  1NGI A;  4LF4 K;  3THY A;  3ZEU B;  1NK4 A;  4GVE A;  5J2P A;  4M3Y A;  2P5O A;  4Z4C A;  4O5F A;  3RSE B;  3UE5 A;  1S6Q A;  3ZCM A;  4DWI A;  2D2Q A;  3OYK A;  2IDO A;  1SKR A;  2YJE A;  2FJ9 A;  1HKG A;  5I42 A;  1CLQ A;  2D0A A;  3AVN A;  2GV9 A;  4KRF A;  4YOT A;  2BH1 A;  4BRE A;  3OY9 A;  3VA0 A;  3PZD A;  4DR5 K;  4NXM K;  4YOY A;  4AM7 A;  2HE7 A;  4A2B A;  4N56 A;  3HPG A;  5KQ8 A;  3RR8 A;  4CEQ A;  4CHO A;  3I33 A;  5BRE A;  2DFH A;  2ZD1 A;  4N76 A;  4IG0 A;  4FOI A;  4C8L A;  1TV6 A;  1QE1 A;  1RDA A;  3AA5 X;  4O5B A;  1ZBL A;  3VGL A;  4FJH A;  3A8Y A;  1WSF A;  1KFD A;  1KD1 O;  3MXJ A;  4JLH A;  4G9Z A;  5C12 A;  4DG1 A;  3WQU A;  5FPN A;  3TAE A;  3UKR A;  4C8K A;  3KK7 A;  3SYZ A;  3FFI A;  3DLR A;  4H0O A;  1SUQ A;  3RRG A;  4DSL A;  2V7Z A;  1RGI A;  3D2F A;  4N47 A;  4CJU A;  1J53 A;  2I1J A;  4CEF A;  1HUX A;  3E9O A;  4HTL A;  1NOZ A;  4BR9 A;  4HHT A;  3WXI A;  4WQ4 C;  4X64 K;  5AQJ A;  4KH6 A;  3MED A;  4CJT A;  4GV3 A;  3P31 A;  2F96 A;  2GWK A;  2FDQ A;  1J54 A;  4FJG A;  4FJI A;  5E41 A;  1J5O A;  3LDQ A;  1XHX A;  3E1Y A;  4KHN A;  1FK9 A;  3VEY A;  1WLJ A;  4RW4 A;  3A5L C;  2ZWH A;  3A0I X;  4B9U A;  2W6K A;  4OGC A;  1XC9 A;  1CXU A;  5AQG A;  4CZF A;  4U67 L;  4CJS A;  4X66 K;  4A5B A;  3QNO A;  3F5T A;  1J9A A;  4QCL A;  2VWB A;  1Y64 A;  4NXN K;  4OPK A;  2FSN A;  3P83 D;  5M1O A;  2Q3S A;  1CXQ A;  4WFA L;  2J0J A;  1NJI O;  3MEE A;  4E7K A;  3AO3 A;  5FLX O;  3ITH A;  2CB8 A;  2OAN A;  3L2U A;  1D8Y A;  4ICL A;  2ZQB A;  3A5N C;  1IJJ A;  3O3F A;  1EXQ A;  3HP9 A;  1NM1 A;  4CBX A;  2CQU A;  2HHV A;  4E7L A;  2E8A A;  4I6M A;  3CER A;  1C0F A;  1UOC A;  4B9Q A;  4CJQ A;  3S9H A;  1SQK A;  1IBK K;  3CCV N;  1IBM K;  3SBG A;  2YHY A;  4ZRI A;  2ITG A;  1TYQ B;  1VQM N;  2VGN A;  3TAP A;  3R9P A;  4IDH A;  1KCF A;  1KC8 O;  4FK0 A;  1Q9Y A;  4CHY A;  4K43 A;  4O0J A;  4H8K A;  1VQ9 N;  5CZ2 A;  3LAM A;  2UUB K;  4XH1 A;  3CCM N;  4CW7 B;  1MU2 A;  3KLI A;  3TAB A;  3AAR A;  3SPZ A;  1YF5 L;  1RDW X;  4BQL A;  3CJC A;  3UB5 A;  3V6D A;  4FLZ A;  4CZL A;  3THV A;  5AQZ A;  2PFU A;  4DSK A;  4ID5 A;  1JJ2 M;  4B9M A;  4DR1 K;  4DR2 K;  1QSL A;  1UWB A;  3CHW A;  1WAF A;  1GLA G;  1ATR A;  4NY0 A;  1NGH A;  2BUP A;  4BRO A;  3AO2 A;  2HBJ A;  4F2R A;  1Q7Y O;  3LPU A;  3LM2 A;  4LY7 A;  1XMO K;  3QIC A;  4FK4 A;  1NGC A;  4DQP A;  2NRX A;  2HNZ A;  3VQ7 A;  1RT2 A;  1TKT A;  3NMU A;  1A5X A;  1ESV A;  1NBW A;  4X65 K;  4FVU A;  4DTU A;  3CF5 L;  4BR4 A;  1GLC G;  3CCU N;  2HBK A;  4B8A B;  3DXK A;  1GOC A;  2NRR A;  4CHP A;  2HBL A;  4YDU C;  3SLC A;  3DXM A;  4FJ9 A;  1TL3 A;  4KPY A;  3VA3 A;  3NE6 A;  5AZI A;  1S1T A;  1MK9 B;  2WBN A;  4FJK A;  3U9D A;  1RT7 A;  3KKS A;  3EE8 A;  1YXQ A;  4ISE A;  1RTD A;  1QS4 A;  5AQP A;  3QEW A;  3U3Y A;  1IO2 A;  3RR7 A;  1ZBH A;  3OS1 A;  4CZE A;  3E9L A;  2O8C B;  1T6D A;  2HHQ A;  1HQU A;  4DV4 K;  4CER A;  3JS6 A;  1QSY A;  3ENO A;  3TSU A;  2WUS A;  1WB9 A;  3PIP L;  4QS8 A;  3CMA N;  2HNY A;  2O8D B;  1C0T A;  4CZJ A;  5BRF A;  1KRP A;  4FJ7 A;  2ZF5 O;  1XUP O;  2Q2R A;  4PL8 A;  3J7A P;  4DTN A;  2A1R A;  1OH7 A;  2Q0U A;  2CGJ A;  4OKK A;  3C7N B;  2VQE K;  1VSE A;  4BRC A;  3LDO A;  3T19 A;  4A2A A;  5M1F A;  3NCI A;  3BF3 A;  3T7Z A;  1NKB A;  2LSN A;  3Q7B A;  4FZX C;  2QWR A;  4JK9 A;  3SUO A;  1BOT O;  3ATU A;  3O8M A;  5JVG L;  2EMT A;  4P7I A;  1TKZ A;  2I5J A;  3B8A X;  3PIO L;  3THY B;  5AQW A;  4U7B A;  1SL0 A;  1OH5 A;  4A62 A;  1ZXO A;  3MAQ A;  3ALY A;  3AVB A;  3J8A A;  2A40 A;  3HP6 A;  3VQA A;  4CF2 A;  1BCO A;  4CEZ A;  4O0I A;  3FLC O;  1VSM A;  3CM6 A;  4FPA A;  1SV5 A;  1NJW A;  2F9T A;  3OVN A;  2FXU A;  1NK8 A;  4DCH A;  1QVF M;  3RMC A;  2E2O A;  4CJW A;  1LWC A;  1HB8 A;  5I3U A;  4Y0W A;  3OYJ A;  4H4M A;  2GTD A;  3HSC A;  1JCG A;  5AZJ A;  1CZA N;  2P9N A;  2X78 A;  1GGO A;  2YHX A;  1HNZ K;  4RW7 A;  1U48 A;  1KVC A;  1T8E A;  1GLD G;  3CJ1 A;  4H0V B;  3SQ2 A;  2P9S A;  4KHW A;  5C10 A;  2OTL N;  3WNG A;  3VF4 A;  1YVN A;  1WUA A;  3FZK A;  4B1V A;  3CCR N;  1Q81 O;  3G71 N;  1WSE A;  1BUP A;  1X3N A;  2EX3 A;  4DU1 A;  4DXA B;  4FJL A;  1IKX A;  4CEB A;  3AVH A;  2QW9 A;  4IEE A;  4PQU A;  1QZ6 A;  3OYA A;  1TK5 A;  3UKR B;  3AVL A;  2UYT A;  3VF2 A;  4J2B A;  2IIR A;  3D2F B;  5DK5 A;  4KHY A;  1B9D A;  2WTU A;  3LP1 A;  4FW1 A;  4CF9 A;  4JI0 K;  3M8P A;  3O9R A;  2XY6 A;  1V4T A;  5CY4 A;  4KTZ A;  4F7G A;  1D4X A;  3EZW A;  3TAG A;  2YNG A;  1EF1 A;  1N6Q A;  2RN2 A;  3CYM A;  4B9T A;  1HNW K;  2A5X A;  4YNQ A;  4E7I A;  1KVA A;  4AQY K;  3SAF A;  1HBK A;  3EY1 A;  5DMR A;  1ASU A;  5K14 A;  4CD3 A;  5AQY A;  5BRH A;  4CFA A;  3NH0 A;  1R59 O;  4CK3 A;  4CHQ A;  1HQE A;  2I1K A;  4M7X A;  4WFB L;  3PX4 A;  4ILH A;  3LAN A;  2HHU A;  2IS3 A;  1MDU B;  5AQS A;  3IVF A;  5JVH L;  5AQL A;  4FYD A;  1TK0 A;  3PUF A;  5D3G A;  4OPH A;  1YAG A;  1VQL N;  3IKM A;  1VBG A;  1TYQ A;  3C0B A;  3WQT A;  3KD1 E;  4LF6 K;  1SS6 A;  1C0U A;  1HPM A;  4FM0 A;  1RBV A;  3W3D A;  3DMJ A;  4GY2 B;  1M90 O;  3QIJ A;  3GG4 A;  3O9T A;  4KH4 A;  3V1O A;  2W42 A;  4DV7 K;  2FBX A;  3AGR A;  4DQI A;  4K8X A;  3GOI A;  1ASW A;  2D11 A;  4MFB A;  3OJS A;  3VEO A;  1S9E A;  2HF3 A;  3DLE A;  4OPJ A;  3OYC A;  4CCH A;  2QA4 N;  3HM8 A;  2PZS A;  3TR8 A;  3LPT A;  5LY3 A;  2XHB A;  1IV0 A;  4I6M B;  2KW4 A;  1JL2 A;  5I9E B;  3FFK B;  2GBZ A;  2OCE A;  4CHZ A;  1VQN N;  4B9S A;  3EPY A;  4DV2 K;  3O5B A;  4N41 A;  4CJ7 A;  4YOR A;  4DSJ A;  1RBR A;  2D10 A;  3O9Q A;  4V19 S;  3CG7 A;  5T7B A;  4CJ4 A;  3HT3 A;  5HOO A;  4JKF A;  2RKI A;  4KBO A;  4EZ6 A;  4DV5 K;  4CGF A;  3OBY A;  3C95 A;  3CFO A;  1EWR A;  2PAV A;  4KKO A;  4JK7 A;  4PL7 A;  4BVP A;  4B1Y B;  5EY4 A;  3OYM A;  2WH5 A;  3ZSR A;  4FJJ A;  3KLE A;  3NF6 A;  4BWJ A;  4DTS A;  2HHS A;  1NG9 A;  3TAF A;  2IC3 A;  2QK9 A;  4ELU A;  4DUY K;  4FLY A;  3O4Q A;  1S5J A;  4GV9 A;  2NRW A;  3C6T A;  2W6L A;  5J2N A;  4DSF A;  2DY4 A;  3IDH A;  1WOQ A;  1NLV A;  4DS4 A;  5JS2 A;  3M8Q A;  5BPM A;  2Y1J A;  1RBU A;  4FWP A;  4HWI A;  1JLG A;  4H5T A;  2VWJ A;  1Q9X A;  3LWL A;  3UKU A;  3DI6 A;  2HW3 A;  1HNV A;  2OPP A;  1Y97 A;  2DPN A;  1T6C A;  4BRF A;  1H4R A;  3DXK B;  1JL1 A;  3H08 A;  4B1X B;  5GIO A;  2COP A;  1HYZ A;  3CCL N;  3DLH A;  1X9J A;  2ASO A;  4PY5 A;  4LF7 K;  5AZI B;  4AH9 A;  1Q18 A;  3K5O A;  2O8D A;  1NMN A;  4JKB A;  1VQ7 N;  1LW0 A;  3JXU A;  3I0S A;  3P39 A;  2ZPY A;  2WFB A;  3NVK A;  1U45 A;  5DM6 L;  3HO1 A;  1VQ6 N;  3O6W A;  2X74 A;  4DF4 A;  1RNH A;  1XI1 A;  1VSF A;  4FSV A;  1GC7 A;  4NCG A;  2P1J A;  1S3X A;  4BRL A;  2VGM A;  4HUE A;  3H3N O;  3MWT A;  3O4N A;  4ELT A;  3H6E A;  3MX2 A;  3TWH A;  2QXL A;  4CJ5 A;  3RVC A;  4OVL A;  5LMU K;  4JRP A;  2KLA A;  4E1J A;  1SL2 A;  5H1S Q;  3AVF A;  3KIO A;  4FL9 A;  3DM2 A;  1FKO A;  1K8K A;  4QS9 A;  4B9V A;  4OO1 J;  4JN4 A;  3KTQ A;  3KK1 A;  4W5O A;  2Q0R A;  2YHB A;  5FRM A;  5JVL A;  4DV1 K;  4B1W B;  2Q31 A;  4N5S A;  3AVC A;  4H5R A;  2OZM A;  2D0B A;  2RHK A;  4RW9 A;  3H3O B;  4AHC A;  1BQN A;  3BEX A;  4CZH A;  1DEJ A;  1ACA A;  4DF8 A;  3DLK A;  2G8I A;  1MWK A;  4CIF A;  4R5P A;  4ZTF A;  4PKG A;  3ZSZ A;  4JI6 K;  1RTJ A;  3ZT1 A;  2RF2 A;  2BDP A;  4EHT A;  4BE1 A;  2OPR A;  2ASM A;  1RT6 A;  4K8Z A;  2YKM A;  3G6E N;  1IG8 A;  1T05 A;  3O80 A;  3FGU A;  4YOU A;  4DU3 A;  1R0A A;  3DLL L;  2FSK A;  4MDA A;  2OZS A;  2FF3 B;  3V81 A;  3G4S N;  1MIX A;  4B1U B;  3M6G A;  4FWQ A;  3L3U A;  4O8U A;  5KPT A;  3KK2 A;  3HK2 A;  4GMJ B;  4H5V A;  1BIZ A;  5GAG P;  4NCB A;  3CCE N;  5B8H A;  4HDO A;  4CGI A;  4ISG A;  1YJ9 N;  2X0S A;  3I0R A;  4Q5V A;  5AZJ B;  3FZL A;  4ELV A;  4IKF A;  2P9N B;  3B6P A;  3LM9 A;  4DQQ A;  3J80 O;  1G15 A;  4B9N A;  1WAJ A;  3A5O C;  4GXB A;  1I94 K;  3PY8 A;  3U4L A;  1YUW A;  1U6Z A;  1TVR A;  2P9S B;  1RDD A;  3K9K A;  3L2V A;  4H4O A;  3R1X A;  2P51 A;  3QEP A;  1X9M A;  1YT3 A;  4W5R A;  1WBD A;  2GEL A;  4B3M K;  3PX0 A;  4F2S A;  2XY7 A;  1QQM A;  3K0S A;  3SJH A;  5LJV A;  1C1B A;  1BI4 B;  4DMN A;  2EMS A;  3KWG A;  3K5L A;  1VQ4 N;  2P9U A;  2IVP A;  4DV3 K;  2QM1 A;  3O9S A;  4KH5 A;  4QOZ B;  4CED A;  4XIU A;  2GX9 A;  3Q7C A;  4ZRJ A;  1NKC A;  3ZX2 A;  1A5V A;  3KK3 A;  4JAX A;  3IS9 A;  5E84 A;  4M3R A;  3AA4 A;  1XWL A;  3L8B A;  1VSK A;  3EL2 A;  1ATS A;  5KRT A;  1HNX K;  1W97 L;  3TTF A;  4I7F A;  2XY5 A;  3LAK A;  4BRG A;  3VQE A;  4OKJ A;  4FWR A;  2YNH A;  3ZSW A;  1WSH A;  3SQ4 A;  2WC9 A;  2ZE2 A;  3WUH A;  1S9G A;  3CM5 A;  3PO4 A;  4JI8 K;  1TL1 A;  3TTD A;  4M45 A;  3M8R A;  1NK5 A;  2ETJ A;  3SUP A;  2NRV A;  3V9S A;  2HVI A;  4BE2 A;  2NZT A;  4JK8 A;  1NTI A;  4K25 A;  5GIP A;  4EAH D;  1VK0 A;  4PUO A;  4BR2 A;  4CFB A;  4WQ4 A;  5C2D A;  4BAC A;  1C0M A;  2I7N A;  4OX9 K;  5FPM A;  4IOA L;  3MMV A;  1NGF A;  2QWL A;  3LAL A;  3NHG A;  4Q0B A;  3AA3 A;  3E9P A;  4WFN L;  1VQK N;  1VSI A;  1OH8 A;  3L2R A;  3QER A;  2HB5 A;  1YJN N;  2CGL A;  2HVH A;  4LH4 A;  4CFC A;  4BGA A;  2GWJ A;  1TUU A;  1DT9 A;  3C6U A;  1RT3 A;  2YKN A;  3U7D A;  3ULE A;  1Q82 O;  1LAV A;  1LCU A;  4FZY A;  2QEX N;  3K58 A;  1NJY A;  2BAN A;  2HHT A;  3PSF A;  3VQD A;  1HYS A;  4B8C A;  1E4F T;  2GUI A;  1JXE A;  4IJN A;  5FRN A;  1MIZ B;  5BPN A;  4LD0 A;  2X6N A;  3QBW A;  2ASP A;  5C25 A;  1SKS A;  4DQR A;  1KVB A;  4FK2 A;  3NFA A;  3CI5 A;  2X6S A;  3BGR A;  1ZBU A;  3O1W A;  1TKD A;  1JLQ A;  3NBP A;  3DYA A;  3G9W A;  3KKR A;  3AVI A;  3IMX A;  1KAY A;  4CJL A;  3D45 A;  4E7J A;  1Z05 A;  2H3G X;  2XO7 A;  3HOT A;  1FKP A;  1C1C A;  1N5Y A;  5M1Q A;  3VQ8 A;  5CYQ A;  1NK0 A;  4UY8 O;  1XNQ K;  4JI7 K;  4FPB A;  5KQD A;  5M1N A;  1NVL A;  1KAX A;  4DR4 K;  1HB6 A;  3HXM A;  3FZF A;  3PLA A;  5ADX H;  3OBW A;  5BR9 A;  1S1V A;  1X1P A;  3DLG A;  3CQX A;  3T1Y K;  4C8O A;  3NF7 A;  3LWM A;  3OJU A;  4ILG B;  3UKU B;  1W2B M;  1X9S A;  4CJR A;  5JS1 A;  4BDZ A;  2BE2 A;  3NDK A;  4CBW A;  3OA9 A;  5AQO A;  5LJW A;  4JKE A;  4AHS A;  2QWQ A;  2KHO A;  3L4I A;  5ELZ A;  4GW6 A;  1W7A A;  5HRR A;  1WN7 A;  3AGK A;  4QAG A;  3SBT A;  4H0T B;  2AJQ A;  5AQT A;  3WXL A;  5M1P A;  3AU4 A;  2FLO A;  3ZSO A;  3CET A;  1VQP N;  4BRP A; 
#chains in the Genus database with same CATH homology
 4CD3 A;  1SZ2 A;  1NMD A;  5AQY A;  5BRH A;  1ZC6 A;  4DQ8 A;  2J0M A;  1R59 O;  2DIK A;  2P9L A;  5C0Y A;  4JD2 A;  4L3Q A;  2I1K A;  3HTV A;  5C15 A;  5HL7 L;  5MLC Q;  4NO7 A;  4M7X A;  4MO5 A;  4WFB L;  3C6H A;  4CZK A;  4ILH A;  4CZM A;  3SK3 A;  1Q86 O;  3VEV A;  1MDU B;  4XH5 A;  3WT0 A;  5AQS A;  3IVF A;  3L0Q A;  5JVH L;  1OKJ A;  3C7N A;  3GE1 A;  4BY9 C;  2Q36 A;  5AQL A;  3VEW A;  3G25 A;  4FWS A;  4BG9 A;  4CD1 A;  3SAH A;  4EHU A;  4OPA A;  1YAG A;  1ST7 A;  3E66 A;  4OPH A;  4IO9 L;  1VQL N;  3IKM A;  3DJC A;  1VBG A;  4H0Y B;  1DKG D;  1O13 A;  1TYQ A;  3PVL A;  3C0B A;  1BO5 O;  3WQT A;  1SS6 A;  3NVM A;  4H03 B;  1SAZ A;  2YCH A;  1HPM A;  2E2N A;  3D7E O;  3W3D A;  4GY2 B;  1M90 O;  3QIJ A;  3GG4 A;  3O9T A;  4KH4 A;  3AGR A;  5AQM A;  4JHD A;  5KPZ A;  4C23 A;  4PHT X;  1NGI A;  3EE9 A;  3ZEU B;  2E2Q A;  5AQH A;  1K8K B;  3GOI A;  3CXC M;  5FPD A;  2D11 A;  3VEO A;  2HF3 A;  4GVE A;  2QA4 N;  1SGH A;  3HM8 A;  4O5F A;  3RSE B;  3UE5 A;  3WEE A;  3VPZ A;  3CCJ N;  5LY3 A;  3CJ9 A;  2D2Q A;  1VQP N;  4BR5 A;  4I6M B;  4BRK A;  2PBD A;  2VCP A;  1J6Z A;  4IOX A;  5I9E B;  2QWN A;  3FFK B;  2RQ1 A;  3CJB A;  5F0X A;  1VQN N;  2GUP A;  3EPY A;  5EVZ A;  2YJE A;  4YOX A;  2FJ9 A;  1HKG A;  2FF6 A;  5GAH P;  2VYP A;  3FR0 A;  3ZX0 A;  3MK6 A;  3I56 N;  4FWN A;  4QS7 A;  3O5B A;  4CJ7 A;  2P9P B;  4YOR A;  5AQX A;  4YOT A;  3QB0 A;  3O1B A;  2BH1 A;  2D10 A;  4BRE A;  2QI2 A;  3PZD A;  3O9Q A;  1QQN A;  4H5N A;  2NRT A;  5HOO A;  4ZRK A;  4JKF A;  4BGB A;  4YOY A;  4KBO A;  3H1V X;  4AM7 A;  1QVG M;  2HE7 A;  4YL8 A;  2BTF A;  4JEP A;  4A2B A;  2YJF A;  3X23 A;  3MWP A;  3BUZ B;  3OBY A;  3CC2 N;  5KQ8 A;  2D1K A;  4CYE A;  4GV6 A;  2PAV A;  3SMS A;  1G99 A;  4JKG B;  4JK7 A;  3I33 A;  5BRE A;  4BC3 A;  4PL7 A;  4A61 A;  4BQZ A;  4IXC A;  4B1Y B;  4BVP A;  4PKH A;  5EY4 A;  5CE3 A;  2NNW A;  3MCP A;  4A59 A;  2WH5 A;  1EO1 A;  3MX5 A;  4FOI A;  1J19 A;  4CZI A;  3BIN A;  1QQO A;  1BA0 A;  1NGD A;  4BRI A;  4K42 A;  1ATN A;  4BR0 A;  4BC5 A;  5IJM A;  5CHI A;  3CIP A;  1QZ5 A;  4WQ5 A;  5AQF A;  1DIK A;  3I8B A;  3VGL A;  4GV9 A;  3MCA B;  2ZGZ A;  3A8Y A;  4FOE A;  2NRW A;  1KD1 O;  2HRJ A;  1K73 O;  4G9Z A;  4WYB A;  3IDH A;  5C12 A;  1VBH A;  1WOQ A;  1NLV A;  2ITM A;  3WXJ A;  4Z94 A;  3WQU A;  5GAD P;  3KVG A;  4CZG A;  1YIJ N;  1NGJ A;  2IVN A;  5FPN A;  3MN7 A;  5BPM A;  3UKR A;  3KK7 A;  3P4I A;  4FWP A;  4HWI A;  2YX6 A;  4H0O A;  4H5T A;  3BP8 A;  2V7Z A;  1RGI A;  3D2F A;  1DGK N;  3UKU A;  1TUY A;  2I1J A;  2NRH A;  4C1N I;  1HUX A;  2A42 A;  3E9O A;  2QWO A;  2DPN A;  2F9W A;  4HTL A;  4BR9 A;  3WXI A;  4WQ4 C;  5AQJ A;  4KH6 A;  1T6C A;  4BRF A;  1H4R A;  1P90 A;  3DXK B;  4NLC A;  5AQN A;  2V51 B;  1KAZ A;  3OW2 M;  5M1K A;  4B1X B;  4GV3 A;  3P31 A;  2GWK A;  5GIO A;  2FDQ A;  2COP A;  1QHA A;  2V7Y A;  1K9M O;  3CCL N;  1HKC A;  1X9J A;  4JKD A;  2ASO A;  5AZI B;  3LDQ A;  2HBM A;  4IWV A;  3E1Y A;  1Q18 A;  1ILY A;  2YVC A;  4FWO A;  3VEY A;  4JKB A;  1VQ7 N;  1XQS C;  3D6R A;  3JXU A;  3A5L C;  3AY9 A;  1T44 A;  2P9U B;  3P39 A;  3HRG A;  2ZPY A;  2WFB A;  1YI2 N;  5ADX A;  3NVK A;  2ZWH A;  4IZ9 A;  1ZBS A;  5F1X A;  5DM6 L;  3A0I X;  1NGG A;  3M1F A;  3O6W A;  5TKW A;  1VQ6 N;  1V4S A;  3FZH A;  1JDE A;  4FSV A;  3HOS A;  1GC7 A;  2Q97 A;  5AQG A;  4CZF A;  4U67 L;  1MWM A;  2ZGY A;  4RCH A;  3F5T A;  2AEH A;  4A5B A;  4CBU A;  4AM6 A;  5AFU H;  5EX5 A;  4PKI A;  1S3X A;  2VWB A;  1Y64 A;  4TKN A;  3U8Z A;  1RDU A;  3KZB A;  2LBB A;  2VGM A;  4BRL A;  2W41 A;  3H3N O;  3MWT A;  2F7T A;  3H6E A;  3MX2 A;  1HX1 A;  5AQU A;  2FSN A;  2QXL A;  3RVC A;  4BG8 A;  2D0P A;  4YDU A;  2I7P A;  2KLA A;  5AQK A;  1GLF O;  2P9K B;  3CPE A;  5M1O A;  4E1J A;  5H1S Q;  3W0L A;  1NJI O;  1X3M A;  2J0J A;  4WFA L;  4FL9 A;  3MN6 A;  1H1V A;  2RE2 A;  3ZEU A;  1K8K A;  4QS9 A;  3CCQ N;  1NGE A;  4OO1 J;  2P9L B;  2KKZ A;  4JN4 A;  4JD2 B;  3QML A;  1KC7 A;  2D0O A;  2OAN A;  2CB8 A;  3WA0 A;  1VAZ A;  2A3Z A;  2Q0R A;  3RSE A;  3A5N C;  3LL3 A;  1IJJ A;  5JVL A;  4R79 A;  3ZDT A;  4B1W B;  1NM1 A;  2Q31 A;  2CQU A;  4CBX A;  3IUC A;  3QFU A;  2E8A A;  4HDQ A;  4I6M A;  4H5R A;  1Y19 B;  3CER A;  1C0F A;  3P38 A;  4B9Q A;  2RHK A;  1SQK A;  3DAW A;  3H3O B;  2HF4 A;  3BEX A;  4CZH A;  1DEJ A;  1ACA A;  3CCV N;  1XC3 A;  2P9I A;  4WQ5 C;  3SBG A;  2YHY A;  4ZRI A;  1VQM N;  1TYQ B;  2VGN A;  3R9P A;  4IDH A;  2OTJ N;  1MWK A;  2P9P A;  4JKC A;  2AL6 A;  4PKG A;  5BPL A;  1KC8 O;  3O08 A;  4K43 A;  4H0X B;  1Z6R A;  1VQ9 N;  5TKY A;  4EHT A;  3WXM B;  3HBT A;  2CH6 A;  2ASM A;  3TPQ A;  4RTF D;  4XH1 A;  2D4W A;  3CCM N;  2HMP A;  3AAR A;  2ZJR L;  5DM7 L;  1YF5 L;  3G6E N;  1VQ5 N;  3EO3 A;  1RDW X;  1IG8 A;  4BQL A;  3CJC A;  3UB5 A;  4M63 C;  4JKG A;  2IVO A;  3O80 A;  3FGU A;  4YOU A;  3VEX A;  3SMP A;  4YOW A;  5KPR A;  4YOV A;  2FSK A;  3DLL L;  4CZL A;  5JIC A;  3CC7 N;  4MDA A;  2E1Y A;  2FF3 B;  3ZYY X;  3EKS A;  4WCE L;  5AQZ A;  2PFU A;  2EWS A;  3G4S N;  3BF1 A;  1MIX A;  4B1U B;  5GIN A;  3M6G A;  2ZJP L;  3ULE B;  1JJ2 M;  4FWQ A;  3GDQ A;  1U2V B;  3VF6 A;  3MN9 A;  4O8U A;  4O8K A;  4K41 A;  3CHW A;  5BRD A;  5KPT A;  1GLA G;  1S22 A;  4H5V A;  1ATR A;  4NY0 A;  1MA9 B;  1NGH A;  3U8X A;  2BUP A;  4BVO A;  4BRO A;  2HBJ A;  5GAG P;  3VES A;  3WXK A;  5B8H A;  3CCE N;  1E5W A;  4HDO A;  4IO8 A;  4FO0 A;  1Q7Y O;  3VEN A;  3LM2 A;  3O4W A;  3TSP A;  3AU5 A;  3QIC A;  1NGC A;  1ISN A;  4NB4 A;  4ISG A;  2NRX A;  1YJ9 N;  2X0S A;  2E20 A;  3M3Z A;  3VTI A;  4BR7 A;  5AZJ B;  3NMU A;  3FZL A;  3H1Q A;  2P9N B;  3LM9 A;  3CC4 N;  4CI6 A;  1ESV A;  1NBW A;  2YHW A;  3A5O C;  4FVU A;  3CJ7 A;  4GXB A;  4DHY A;  2J4R A;  3CF5 L;  4BR4 A;  4MLE A;  3QDK A;  3U4L A;  1YUW A;  1U6Z A;  3O9U A;  3SAG A;  1GLC G;  3CCU N;  2HBK A;  2P9S B;  3DXK A;  3K9K A;  1GLE G;  2NRR A;  3R1X A;  1P8Z A;  2HBL A;  4YDU C;  3SLC A;  3DXM A;  3LDL A;  2W40 A;  2QWM A;  3KHY A;  3ZET B;  2GEL A;  3CCS N;  3QFP A;  5AZI A;  1MK7 B;  2J0K A;  3EN9 A;  1MK9 B;  4RWT A;  1QQM A;  5AQV A;  5E26 A;  3KWI A;  2WBN A;  3U9D A;  4A57 A;  3SJH A;  5LJV A;  3EE8 A;  2EMS A;  1HJO A;  1YXQ A;  3KWG A;  4MDB A;  3J7Z O;  1K8A O;  1VQ4 N;  2P9U A;  4ISE A;  2IVP A;  3EKU A;  3ID6 A;  3VOV A;  4BRQ A;  1RFQ A;  1LOT B;  2QM1 A;  2HST A;  3O9S A;  3HI0 A;  2A41 A;  5AQP A;  3VMF B;  4KH5 A;  4CZE A;  2AA4 A;  2GX9 A;  3Q7C A;  4JKA A;  4ZRJ A;  1BG3 A;  3E9L A;  3ZX2 A;  1T6D A;  2Q1N A;  4H5W A;  3CQY A;  4JAX A;  3T69 A;  5E84 A;  4XEI A;  3ATV A;  4J8F A;  1YHQ N;  4FWL A;  4GNI A;  3JS6 A;  3QBX A;  1NWK A;  3LDP A;  4BC4 A;  3ENO A;  3D2E B;  3TSU A;  5C2F A;  2P9K A;  2WUS A;  3EL2 A;  1ATS A;  3F2K A;  4EKU A;  1W97 L;  1HLU A;  3TTF A;  1JCE A;  4QS8 A;  4BRG A;  3PIP L;  3CMA N;  3DWL A;  3C65 A;  3L6Q A;  5GAE P;  4FWR A;  2WC9 A;  3WUH A;  4CZJ A;  4ISF A;  5BRF A;  1JCF A;  2HOE A;  3TTD A;  2ZF5 O;  1KQS M;  1XUP O;  5JLF A;  3FLV A;  4WF9 L;  2Q2R A;  4DB3 A;  2NRV A;  4PL8 A;  4BRN A;  2NZT A;  4JK8 A;  1NTI A;  4IJA A;  4K25 A;  3TTC A;  3HZ6 A;  2Q0U A;  2CGJ A;  3C7N B;  3OHR A;  1VQO N;  5GIP A;  4EAH D;  1M1K O;  2R82 A;  5AFU A;  1BWF O;  4BR2 A;  4WQ4 A;  4BRC A;  3LDO A;  5C2D A;  2GEM A;  3VGM A;  4A2A A;  5M1F A;  3S41 A;  3BF3 A;  3T7Z A;  2I7N A;  5FPM A;  4IOA L;  1GLL O;  3CPW M;  3Q7B A;  3MMV A;  2QWR A;  4BRA A;  1NGF A;  2QWL A;  4JK9 A;  1GG3 A;  4AF1 A;  3E9P A;  4WFN L;  1VQK N;  1BOT O;  2ABD A;  4ILJ A;  3ATU A;  3O8M A;  5JVG L;  4JNE A;  2EMT A;  4P7I A;  3B8A X;  4JHD B;  3PIO L;  1E4G T;  5AQQ A;  1YJN N;  1GC6 A;  2CGL A;  5AQW A;  4U7B A;  4BGA A;  2GWJ A;  2E2P A;  4A62 A;  4H0P A;  4XH4 A;  1ZXO A;  3N4Q A;  1TUU A;  1DT9 A;  2NRZ A;  2JWK A;  4BRH A;  4EFH A;  4NLB A;  3J8A A;  2A40 A;  2CH5 A;  3C6A A;  3U7D A;  3IFR A;  3WEE B;  1N8R O;  2A6A A;  3ULE A;  1Q82 O;  1VQ8 N;  1U2V A;  3VER A;  1LCU A;  5AR0 A;  2QEX N;  1HKB A;  3FLC O;  4FPA A;  1YIT N;  3H45 C;  2P9I B;  4F9O A;  2F9T A;  2QTD A;  4BRM A;  3ENH A;  1T3V A;  2FXU A;  5EXW A;  1BA1 A;  4DCH A;  3A5M C;  4MO4 A;  1E4F T;  4IJN A;  4BRD A;  1QVF M;  2E2O A;  1MIZ B;  3ZX3 A;  5BPN A;  4BC2 A;  3FZM A;  3F9M A;  3FP5 A;  1HB8 A;  2E1Z A;  1KBL A;  3QBW A;  3MDQ A;  2ASP A;  4Y0W A;  1YJW N;  3N4P A;  2GTD A;  3HSC A;  1JCG A;  4M7Y A;  1CZA N;  4MLH A;  5AZJ A;  2ZJQ L;  1C0G A;  2AP1 A;  3LDN A;  2P9N A;  3MN5 A;  2QWP A;  4IFE A;  1GGO A;  2YHX A;  3L4Q A;  3I55 N;  1KXP A;  3CI5 A;  3GL1 A;  4C1N K;  5JMV A;  3CME N;  3GBT A;  3O1W A;  1GLD G;  3AAP A;  3CJ1 A;  3CD6 N;  4H0V B;  2P9S A;  3ID8 A;  3VET A;  4IOC L;  3G9W A;  5C10 A;  2OTL N;  4JKH A;  1KAY A;  3H46 O;  2E88 A;  3IMX A;  1NGB A;  3VF4 A;  1YVN A;  5AQI A;  4DKW A;  1Z05 A;  3ENB A;  3ZET A;  4IEI A;  4EIA A;  1WUA A;  3FZK A;  2H3G X;  4B1V A;  3CCR N;  1Q81 O;  3HOT A;  3G71 N;  3K9J A;  3M5R A;  1OVY A;  1BUP A;  1X3N A;  5M1Q A;  5BN9 A;  4A5A A;  2NLX A;  3VTH A;  4UY8 O;  4DXA B;  5BN8 A;  4FPB A;  2QW9 A;  5KQD A;  5M1N A;  1NVL A;  1KAX A;  4IEE A;  1BDG A;  4FWK A;  1HB6 A;  1GLB G;  3FZF A;  1NGA A;  1QZ6 A;  5ADX H;  3PLA A;  2CGK A;  3OBW A;  5BR9 A;  3U9Z A;  3CQX A;  2JWL A;  3UKR B;  1BU6 O;  3FE1 A;  2UYT A;  2V52 B;  3R3L A;  3TU5 A;  3VF2 A;  2FSJ A;  2IIR A;  4ILG B;  3D2F B;  3UKU B;  2YI1 A;  5JLH A;  1W2B M;  5AQR A;  3O9R A;  4LC9 B;  1NI2 A;  1V4T A;  4F7G A;  3EZW A;  1D4X A;  1EQY A;  5FPE A;  1S72 N;  4CBW A;  3OA9 A;  5F2R A;  3D2E A;  3AAQ A;  1EF1 A;  3DXM B;  5AQO A;  3R8E A;  5LJW A;  4JKE A;  3VGK A;  2QWQ A;  2KHO A;  3L4I A;  5ELZ A;  3VEZ A;  2A5X A;  5CR4 A;  3R6M A;  3AGK A;  3CJA A;  3SBT A;  4FWM A;  4H0T B;  5EOY A;  4B1Z A;  5AQT A;  3WXL A;  5M1P A;  1GLJ O;  3AU4 A;  2FLO A;  3TSQ A;  3CET A;  3SAF A;  1HBK A;  4BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...