4JKCA

Open and closed forms of t1800e human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTEKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkcA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkcA01
4JKBA 4ILJA 4JKGA 3SBTA 4JKHA 4ILGB 3ENBA 4JKCA 3E9OA 3SBGA 4JKEA 3E66A 4JKDA 4ILHA 3E9PA 4JKAA 4JKFA 4JK7A 4JK9A 4JK8A 4JKGB 3E9LA
chains in the Genus database with same CATH superfamily
3H1QA 4FJJA 1TKTA 3I0SA 1UOCA 2VG7A 2V7YA 5IT9O 4IJAA 2KW4A 4BVOA 4CZKA 3OYLA 5I3UA 3EY1A 3VEWA 1VSKA 2KHOA 3WT0A 3NDKA 4KREA 3K57A 4FJ5A 3IDHA 1KAXA 4I6MA 4O4GA 1JLBA 3NAEA 4X62K 4HDQA 3MEDA 2RQ1A 4BRMA 3SJHA 4A57A 4FOIA 3RSEA 1VSHA 4CEFA 2PYLA 4ELTA 3G10A 5ELZA 3CERA 1HKGA 1RBSA 3VQ6A 3VF4A 1RT3A 2EMSA 3A5MC 4KRFA 1YJNN 1NK4A 4Z0UA 4FZYA 4NO7A 3CCVN 3DYAA 4FL9A 5KPZA 4PWDA 5EU7A 4LF6K 2YKNA 4CZJA 3BDPA 4YOTA 3E9LA 3SYZA 4HHTA 1R0AA 2QM1A 2FF6A 3KK7A 4E19A 4CIFA 4AHCA 2F4VK 3CIPA 3OA9A 4K43A 3KLFA 1EXQA 4FJGA 3PIPL 4E7IA 1OH7A 2D0AA 5AR0A 4KFBA 1VQKN 2NRVA 5BRDA 3T1AA 4GV9A 3RR8A 3C65A 2Q3SA 3DWLA 5E41A 5AQHA 4CI6A 2YNHA 4DV6K 2Q31A 1Y97A 4OLBA 4FWRA 3QMLA 2I7NA 1RBVA 3JXUA 3WXMB 2O4GA 4BVPA 3O4QA 1DTTA 4CHYA 2D11A 4AHVA 3QEVA 5C24A 3IKMA 3G25A 4JI7K 3ZLJA 1ZYQA 4DXAB 4ISEA 4AQYK 1WSEA 3THYB 1J6ZA 2DFHA 3WQTA 1J5EK 2IOCA 2E5LK 3WUHA 4KAZA 1GOBA 4M45A 3NMUA 4E7HA 4F4KA 3NGYA 4PKHA 3F5TA 5HLFA 3SQ1A 4XH5A 1XI1A 3OYHA 4BRQA 2CGLA 1J9AA 2G8WA 1I3AA 4H4OA 2F8SA 3AVNA 5AQWA 3OYBA 4JD2A 2ZPYA 4FJKA 3KLEA 5BN8A 4M42A 3I8BA 4GNIA 4JEPA 2PY5A 4OLAA 3SUNA 2VGNA 5BR9A 5EVZA 4ICLA 1DT9A 3TANA 3UIQA 3ZSOA 2YKMA 4AH9A 4JI6K 4KHUA 4HDOA 4BC4A 2KQ2A 5GINA 5HRSA 5C0YA 3RMBA 4RCHA 4BDZA 3DJCA 1U2VA 4M3WA 3DOKA 3ZSXA 3OYJA 4OVLA 4FJLA 1QSLA 4B9NA 1DGKN 4BC5A 1XWLA 2FSNA 4HVJA 4CEDA 3WNFA 2GBZA 4A5BA 1ILYA 2D2QA 3AA4A 2OTLN 1H4RA 4IDHA 3PSIA 4FJIA 4Y1CA 1SV5A 3KLIA 2XRIA 2UUCK 3CJCA 4CVNE 4DR3K 3CCSN 3VPZA 4FJ7A 1LWFA 1C1CA 3A0IX 3H6EA 3ENBA 3VMFB 3HM8A 1RT4A 4I2QA 2IVPA 4DG1A 4BR2A 1NU0A 3MDQA 3B8AX 1P90A 2JWLA 4CIEA 3HXMA 4LH5A 1R59O 1RT2A 5HRRA 1K8KA 4GVMA 3QIJA 3DAWA 3L2UA 2PYJA 3AARA 3NF7A 3O9TA 3W0LA 1NG9A 2F9WA 4DFJA 2FBTA 3THWA 1KVBA 4MO5A 1QHAA 5AQTA 3VN5A 5AZJA 4PQUA 4I9QA 1C0GA 2YV0X 4RG8A 4QOZB 3IVFA 4A5AA 3QLHA 4KO0A 4CHNA 3C6TA 4DV4K 1SL2A 1ZC6A 1HBKA 2GWKA 3LALA 2HBMA 3VQ7A 3VESA 4PL7A 1TL1A 3TSPA 3OJSA 4AM7A 3O1WA 3TTDA 5HRNA 3DOLA 4W5RA 1L3TA 2A5XA 4GW6A 3ULEA 1BCOA 2ZJQL 2YHXA 2QWNA 2ZGZA 3TTFA 3OS2A 3ZSRA 3O9RA 5M1FA 1IKXA 1YVUA 1KFDA 3VEOA 1GC6A 3ZCMA 1Z26A 4J8FA 4K41A 2E1YA 2IC3A 3HVTA 4QS8A 4KH6A 5GAEP 1W7AA 2X0SA 3CCUN 2QKKA 2HVHA 2ZE2A 3K59A 3OW2M 2ZQBA 4BRLA 4ILJA 3CFPA 2HHVA 2AL6A 4DUYK 2V51B 2CGKA 4B9LA 4HCBA 3LDQA 1L3VA 1NJXA 2GUPA 4B3MK 1VQ7N 2HRJA 1NMDA 3N4QA 5C25A 1HYVA 1BL3A 2P9SA 3V9ZA 1VQ8N 3NVKA 4CHPA 4DLGA 4CZMA 2NZTA 4XEIA 4C1NI 3AVHA 3AVJA 2XY7A 1ASUA 3WNGA 2HHWA 5AQYA 4HTLA 1K73O 1CZAN 1C0TA 2D5RA 1YF5L 2JGUA 4H0YB 2Z1IA 3MX2A 4IG3A 4KHQA 4EZ9A 1NGDA 3ZSVA 4LC9B 1SUQA 5F2RA 3C6HA 1N32K 3ZX2A 2YHWA 2HHHK 2PZSA 3EE9A 2OA8A 4BR4A 3CXCM 2Y1JA 4CK2A 1BWFO 1EO1A 2D0BA 4CGJA 2A1RA 1MWKA 2DFFA 1HYSA 4FM1A 2KFZA 4JI8K 1C1BA 5FLXO 3R3LA 2P9IA 5AQKA 4O5FA 2O8FA 5HOOA 2IGIA 2QWQA 4FCYA 1IKYA 4GY2B 2P9PA 4E1MA 4CERA 1VAZA 1WAFA 3ZYYX 5C42A 1NGIA 2WONA 4DR2K 3CJ1A 5SZTA 1XNRK 4IFYA 4YDUC 4CZEA 4FK4A 2Q36A 4BE0A 3AA2A 3RR7A 2ZJRL 3U7DA 5AQZA 2W6LA 1HJOA 3C6UA 4WCEL 1IKWA 2LBBA 4OPAA 3L2VA 4DR4K 2DPNA 2E1ZA 2G8IA 1BOTO 3PUFA 4IO8A 4LSNA 1GOCA 3TSUA 1VQLN 4N56A 3QIPA 2BH1A 2UXCK 3U8XA 1RCHA 4DQQA 3VGLA 2HHTA 3LAMA 3QBWA 1I94K 4AHTA 2HE7A 3HO1A 4IG0A 1I39A 2I1KA 1G99A 1IG8A 1QHTA 1TGOA 3OHRA 3VENA 4DU1A 3AVMA 4G1QA 1U48A 2G8FA 3RTVA 4DV0K 1KAYA 2HBJA 2GELA 5AZIB 4E7KA 1ESVA 2D1KA 5AQPA 3ATUA 5KQDA 5DMRA 4CJ7A 4CESA 3F9KA 5C12A 3EKSA 2E2QA 3HOSA 3AU4A 3QNNA 3TAEA 3Q7CA 1K9MO 4DQ8A 3VTHA 3CCMN 3HJFA 3TSQA 1MU2A 3V81A 2XO7A 2Z1JA 4K42A 1Z25A 5KPTA 3H3OB 3D2EB 2QWLA 3O80A 1BG3A 4FPAA 2O8DB 2RPIA 5LL6Z 4DU3A 3JSMA 1A5VA 4M3RA 1V4TA 4NCAA 1L3UA 3J8AA 1HYZA 2NRTA 4FJ9A 3MN9A 3ZEUB 1Q86O 3MN5A 3L8BA 4Y1DA 3TWHA 4Y0WA 3L4QA 4PHTX 2FDQA 3THXB 2VWKA 4KTQA 4FJ8A 4CZLA 2E6MA 4IEEA 1E3MA 2ETJA 4DV2K 4A59A 3ZETB 1K6YA 4IEIA 3RMCA 3LZIA 1WLJA 1NOZA 4AF1A 4E1NA 5J2QA 1GGOA 1GOAA 2OCEA 1UWBA 3A5NC 3O8MA 2PAVA 4FO0A 3L2QA 5M1NA 3V9XA 5AQQA 4H0XB 1QSSA 2AJQA 3MXIA 3MEEA 1BHLA 2BGGA 1D4XA 2HF4A 3OS0A 1KQSM 4RWTA 2KKZA 1QQNA 4MO4A 3SI6A 4RTFD 1U4BA 4DTMA 3P1GA 3THVA 2A42A 3MCAB 4FK0A 1S1VA 5A2QO 1EX4A 3BY5A 4WFNL 1U47A 4JHDB 3RVCA 4IXCA 4CJEA 4JV5K 4M3ZA 3ZT1A 3VEVA 1MK7B 3AO4A 2HF3A 4YOWA 3VF6A 3UKUB 3B6OA 4V19S 4TKNA 4FVUA 5GADP 1Q8IA 3TAMA 5IWAK 3M6GA 2D0CA 3U3YA 2X78A 1LV5A 3DXMA 1HQEA 4ELVA 1EP4A 1T6DA 2NLXA 4OKJA 3THYA 5HROA 1YAGA 3LP2A 3SNNA 4CGHA 4IKFA 5DM7L 3U8ZA 1X1PA 3SAGA 4QCLA 2IVOA 4DR6K 2OANA 1VQON 2B4JA 2YI1A 3EKUA 1TYQB 1EQYA 3L0QA 4EIAA 4C1NK 4AILC 3FZLA 2G8KA 1RILA 3TAQA 5BPNA 4JK7A 4CFDA 4JKGB 3DLBA 3LP0A 1BI4B 4DTPA 4F3OA 2QXLA 4DQSA 1NK8A 4YFUA 4PA1A 1N8RO 3UB5A 4M7XA 2HHUA 4IOCL 1C1AA 1QVFM 3HL8A 3HI0A 2HB5A 3NGZA 4KTZA 3QDKA 3T7ZA 4BQLA 3WNHA 5LJWA 2RN2A 1KC7A 1OVYA 3T3FA 5AQXA 5CZ1A 4E7JA 5I9EB 2PFUA 3VQ8A 1J54A 4H5VA 2KLAA 4DR7K 3ZDTA 3PV8A 3C0BA 3LWMA 4JS4A 4NYNA 5J2NA 1FW6A 3H45C 2ZGYA 3M8QA 4GMJB 3K5MA 4ILGB 3TABA 1RDAA 2QXFA 2ZF5O 5GAHP 4CJ4A 1HR0K 2YNGA 3O4WA 4H5TA 2HW3A 1ZBSA 2G8VA 4B3RK 1K8AO 3MXMA 1XHZA 2FJ9A 3EZ5A 4N5SA 2HNDA 4JYAK 5AQOA 1XC9A 3K2PA 2FXUA 3FFIA 4FSVA 3SJJA 1HNZK 3AV9A 3PX0A 4DSIA 5D3GA 5JMVA 4DTOA 4DV5K 5AQJA 3GOIA 3K9JA 1SKWA 4DB3A 3O3HA 3AGRA 3KIOA 2KZMA 2ATQA 3V4IA 3AGKA 3D45A 2NRHA 1QQOA 1WSIA 3E66A 3E9PA 3KZBA 4YOUA 1B9FA 1KCFA 3ZSYA 2WUSA 3S9HA 3X23A 5FDLA 4AM6A 1LOTB 3HZ6A 1NJIO 4EP4A 4BWMA 1QZ6A 5E84A 4CJVA 1WSJA 4OX9K 5CHIA 1UA0A 4YY3K 2E2PA 3V9WA 3V1RA 1HNVA 3LWLA 3CQXA 5F0XA 4JI5K 4I7FA 4CF8A 3Q7BA 3SMSA 1EWQA 5I42A 4F8RA 3ATVA 4CJRA 3QNOA 3PO4A 3PO5A 1NTIA 1KAZA 2OYQA 1NMNA 1BA1A 3AVIA 4BQZA 3P39A 5KPRA 1Z6RA 4DQPA 1NVLA 2XHBA 1VQPN 1TV6A 3CC7N 2HVIA 4CFBA 2QW9A 3J7AP 5IJMA 3CCQN 2PBDA 1XUPO 1S6PA 1WAJA 2P9KB 4CJSA 4DF4A 3H46O 3SAFA 1HLUA 1TKZA 2YNIA 2OZMA 2D0PA 4CHOA 1S5JA 1EETA 3BINA 2EWSA 1ATNA 4CJUA 3CCLN 4N47A 3JYTA 1J5OA 3E1YA 3DLHA 1WBBA 2A3ZA 3DRRA 5ADXH 1VBGA 4F2SA 1NJZA 3RRGA 3VOVA 4FK2A 1JL2A 1HRHA 4NY0A 4O44A 4E0DA 4FJNA 1GLCG 1JXEA 2HBKA 1KVCA 3H08A 5AFUH 3C7NA 4BC2A 3E9OA 4P7IA 1B92A 2W41A 2ASMA 3AVAA 3H1VX 2RE2A 1WNSA 4BRPA 2OZSA 1EF1A 2KZZA 4FW2A 2WTUA 2DY4A 5KGXA 2R82A 3ALYA 4GKKK 3QIOA 4H0PA 1ATSA 1QQMA 4NXNK 4WQ5A 4B1VA 3VEYA 4Q0BA 2YX6A 3TAPA 5T7BA 3CCRN 3P4IA 3VQBA 4EAHD 4W5TA 2DIKA 2FLOA 4OKEA 1RGIA 3O9UA 2YHYA 3O4NA 5GIOA 4CF2A 1Y64A 4NYFA 4Z4GA 3HT3A 1VBHA 4JKFA 3MMVA 1Q81O 4MDAA 2O4IA 1S1UA 2IDOA 1BISA 3OYFA 1XQSC 3J81O 2HHXA 4KHWA 4EP5A 4E7LA 4DV1K 3FLVA 2HHQA 1GC7A 3SK3A 4L3QA 3R9PA 4DF8A 2I1JA 4LF8K 1Q82O 4BWJA 4B1WB 3VEXA 3ZX3A 4N41A 4I6MB 3CJAA 1X3NA 1MK9B 4CK3A 3TU5A 3FZKA 3CMAN 3PZDA 2UYTA 3I56N 3RSEB 3QFUA 4B1ZA 1M1KO 1KTQA 3KD5E 1HMVA 4ZRIA 4MDBA 4GV3A 4ZRKA 1IBKK 4NLBA 2VWBA 1P8ZA 3U3GA 4YNQA 3E01A 3K5LA 4KB0A 3HPGA 1IG9A 2WFBA 3HTVA 3M8RA 3SQ4A 2ZWHA 2FBYA 1TKXA 5CY4A 3S41A 3C6AA 5AQSA 3KWIA 2Q97A 3FR0A 3SMPA 1KBLA 3DLEA 3S3MA 3BF1A 1JCEA 1YXQA 1QQCA 4DSKA 3PVLA 5LMUK 4IDKA 1KLNA 5AZIA 1NGJA 4H4MA 2P9LB 3FE1A 3EL2A 1TL3A 3DRPA 2WOMA 3M8SA 3I33A 3G4SN 3HVRA 3FP5A 4IOXA 2V52B 2JLEA 3MWTA 3C95A 3O9QA 4B1YB 1RBUA 4WF9L 2ABDA 2J0JA 2O8DA 5J1EA 2W42A 4FXDA 3OY9A 1ZBLA 1NK6A 3ZSZA 1DIKA 2VQEK 4KI6A 2F7TA 3ZEUA 2YHBA 3WXJA 1T44A 3AVFA 4CJQA 4RW8A 3ASMA 2B6AA 1NM1A 1UAXA 1SAZA 2P5OA 3LZJA 2EMTA 4OPJA 4DV3K 4B3OA 3WXKA 4CEQA 1S1WA 4M3YA 5BN9A 3THXA 3I8DA 3BP8A 3N4PA 1NK7A 2VWJA 4G9ZA 1VSIA 3SQ2A 3D6RA 1W0HA 5AQLA 3ID6A 3U4LA 4CYEA 2Y1IA 1VQMN 1JCGA 3SPYA 2F96A 3R6MA 5MLCQ 2X6SA 3MWPA 4FWLA 1TVRA 1VQ9N 4DTRA 1NK9A 3QESA 1HKCA 3RRHA 3P83D 4CJFA 4J2DA 4CGGA 4RW9A 3R1XA 1O1WA 3GDQA 3LDPA 4FWOA 5M1OA 2UUAK 3CCEN 1U2VB 3VQAA 4JNEA 5DM6L 4PUOA 4ID1A 1VHXA 5AJ3K 4DTXA 3EZWA 3AVGA 3DXKB 1MIZB 4HUGA 1M90O 1N33K 4B3TK 3DI6A 1GLAG 3UKUA 1SKRA 4CBWA 3D0PA 1S9GA 4DSEA 1OH5A 2E4LA 1N34K 3HPHA 2G8UA 4C8LA 1ST7A 1KSPA 4KV8A 3DRSA 4CW7B 4JLHA 1LCUA 5JICA 3HOTA 3QEIA 5KRSA 5EOYA 3CETA 5FPDA 2WH5A 3O3FA 2ITGA 4Z4IA 1WSFA 4ZTJA 4DQIA 1TYQA 2YHAA 1HPMA 3IRXA 1NKEA 4H0VB 3KK2A 4ISGA 1Q7YO 1S72N 4WE1A 4K8ZA 4JKGA 2QA4N 3MAQA 1BI4A 4NLCA 1E4GT 3WEEB 4AHSA 5B8HA 3ZT3A 1VQ4N 4M3UA 4DR1K 4GVEA 2YCHA 3O1BA 4CEOA 2NRXA 4JKCA 4W5QA 1QSYA 4Z4HA 3EN9A 2HHSA 1BDGA 4MFBA 4B1XB 4FW1A 1Q18A 1C0MA 4BR9A 4BREA 3M5RA 4EKUA 3BF3A 1EKEA 2W6KA 2GEMA 4FPBA 3AA3A 1X9MA 2ZJPL 4OPHA 4CJKA 3QEWA 4FZZA 4YHHK 1WSGA 4JKHA 3OS1A 1JLQA 1T7PA 1TK5A 4OKKA 1FKPA 3AO3A 4DKWA 2E6LA 2AEHA 1NI2A 1D9DA 4FWKA 4DFKA 2VQFK 1HNWK 3O08A 2HMIA 1VSLA 1ZBHA 1A5XA 2I7PA 1D8YA 4FLTA 2GX9A 5K14A 4BY9C 1MIXA 4LF9K 4MLEA 5BRHA 3OYNA 2DFEA 4JI3K 5AQMA 3VQPA 4JI0K 2RHKA 3ZT2A 3KK3A 1LW2A 4O8KA 2HBLA 3K9KA 1B9DA 2FBVA 3OYKA 3AO5A 1BUPA 1G15A 2QEXN 5AQFA 2E2OA 2HSTA 1S22A 1T8EA 3SV3A 2NNWA 3AO1A 1JLCA 3CC2N 4A2AA 2HNZA 2Q0RA 4AHRA 1DLOA 1GG3A 1ASWA 4CEBA 4BC3A 4IOAL 3HYFA 3MCPA 4I9LA 4CZIA 3PX4A 2XY6A 1RT7A 5DK5A 3L2RA 1HB6A 1HNXK 1MDUB 4MLHA 3PSFA 3AO2A 2HOEA 3VQDA 1VSEA 4KHNA 2XY8A 1NGFA 3EEQA 4FOEA 1TUYA 4F3TA 4FYDA 4CF0A 4BRKA 4B08A 3TPQA 2E20A 1S6QA 2UXDK 4CEEA 1RT1A 3QICA 3P31A 3CF5L 4JI4K 4DU4A 4BRFA 5AQVA 4A62A 2ITMA 4BR5A 1QS4A 3CPEA 4BG8A 5JVGL 1LW0A 3DLKA 4H5WA 3WA0A 4CF9A 2P9KA 1X9WA 4I2PA 1KFSA 1NGCA 1IBMK 3L4IA 4X65K 3O9SA 4DQRA 1U49A 3VQ5A 4KPYA 3NF9A 1IH7A 1KVAA 2CB8A 4YL8A 1U45A 3W3DA 4FLVA 1RBRA 3HM9A 4C8NA 4IO9L 3VETA 2HMPA 3MX5A 4FJXA 2O8CB 3LANA 1YJ9N 1VSDA 3SUPA 1NKCA 4CJLA 5KGWA 3KTQA 4O0IA 3AU5A 1HNIA 1NGGA 3K58A 3OJUA 3H3NO 4GXBA 4KI4A 1CZ9A 1IJJA 4B9SA 4A61A 2OPPA 2YNFA 3LM2A 3G71N 1VQ5N 1BQMA 1FJGK 3K0SA 4CFAA 2P5GA 1OKJA 2AA4A 3S3NA 2I5JA 1ZXOA 4BRDA 3U6FA 5CE3A 4FM0A 3KJVA 5LY3A 2D4WA 2NRZA 3A2FA 4H8KA 4E1JA 4LF4K 3JAMO 4W5OA 1BQNA 5FPMA 4DTNA 2E8AA 4HTUA 1JLFA 4KTWA 4H0OA 4B1UB 1IO2A 4CZHA 5HRPA 3P38A 3T1HK 5HBMA 3TR8A 4DS4A 1DTQA 3CQYA 2D0OA 1BCMA 1D5AA 1VSFA 4L8RB 3CPWM 4XH4A 4R5PA 4KH5A 4N76A 4DSFA 1DKGD 3BGRA 1WBDA 2VG6A 1Z05A 4NXMK 2FSKA 1Q9XA 1REVA 1JXBA 3VQQA 5F1XA 4Z4FA 4B9MA 4Z4CA 5TKWA 3SZ2A 1GLLO 4UY8O 1KD1O 1IKVA 2FBXA 3U9ZA 2ASOA 2E88A 3FLCO 3CJ9A 4DTJA 2CQUA 2P9UB 3HSCA 3O3GA 3NH1A 3M3ZA 3NHGA 1U6ZA 1T6CA 3U9DA 4Z4EA 3FZHA 1YJWN 3NE6A 4B8AB 5HP1A 5KI6A 2O8EB 4ISFA 3CQ8A 3PY8A 1RDDA 4LY7A 5M1PA 1KC8O 4IFEA 5EX5A 4BRGA 1YIJN 1HQUA 3AA5X 3G0ZA 4H03B 1ITGA 2RF2A 3M1FA 4K8XA 4FLYA 4ILHA 2YJEA 1TUUA 2Z1HA 3V9UA 4CJ3A 1NNEA 4FLXA 4ZRJA 1RT5A 4CCHA 4CZGA 3IG1A 3SBTA 3WXIA 2R7YA 2DTUA 1ZBFA 4BRAA 1ATRA 5FROA 4KHSA 2P9LA 4EFHA 2FC0A 3IFRA 3QB0A 1RTJA 4FWNA 4CZFA 4CJWA 3SBGA 1ACAA 1RDWX 3AVCA 4DTUA 2Q1NA 3ZX0A 2OTJN 2VGMA 1S1XA 4F9OA 3PX6A 3NF6A 2CH5A 1CLQA 3ZSWA 4JK8A 2B5JA 1BU6O 4CBXA 2JWKA 4K25A 1VRUA 4BE1A 1JLEA 1RDBA 4FWMA 1XNQK 3R8EA 2YJFA 4C8KA 3OYDA 2QWOA 2FF3B 3KLGA 3CI5A 1JDEA 3D2FB 4BGAA 2O8BB 4IJNA 3UKRB 4DSLA 1TK8A 1JLAA 3CD6N 1TAUA 3DXMB 3KKRA 4WFAL 3J7ZO 3RWUA 4H0TB 4FM2A 4U7BA 5SWMA 1KXPA 4H5RA 5BREA 3V1OA 1YTAA 2CGJA 4C23A 4C8MA 1JLGA 3SUQA 5CYQA 3BUZB 1DEJA 2QWRA 1WB9A 4DWIA 1FXXA 4WQ5C 3F2KA 1YITN 3KWGA 3OYMA 4OGEA 3I55N 3K5NA 1D9FA 1SKSA 2OPRA 3FZMA 4K0KK 1S1TA 3LPUA 1NGAA 2UUBK 2P9NB 1WOQA 3HPOA 5E26A 4W5NA 3O6WA 4E89A 1X9SA 3B6PA 5BR8K 3QFPA 4F2RA 1YVNA 1V4SA 4CE9A 4FWSA 2F8TA 5EXWA 1T03A 4GV6A 1YTUA 5C10A 3DXKA 4BE2A 4FLUA 1CXQA 2OPSA 4JI1K 4BDYA 3GBTA 4EHUA 5FRMA 1EWRA 4CF1A 1RFQA 5EY4A 4BRNA 4XIUA 2A40A 4KHYA 3VF2A 1RTDA 1MWMA 3VQEA 4J2EA 3A5OC 4JKEA 2BTFA 4FWQA 3MN6A 1KLMA 3TARA 4LFAK 3QEXA 3FFKB 3BZKA 1N36K 2A1SA 2HNYA 5JVHL 1W9HA 5JS1A 4YOXA 4DUZK 1SL1A 3LL3A 4YORA 4KBOA 3CCJN 5JS2A 1HX1A 5AQIA 4JRPA 1GLFO 3ULDA 2J0KA 3ENOA 2RKIA 4XH1A 4TSXA 1YI2N 3WEEA 4BR0A 4LF5K 4Q5VA 1N6QA 4OJRA 5KQ8A 3G9WA 1T05A 1FK9A 4CECA 3ID8A 2BDPA 3VTIA 3HP6A 1NJWA 4FZXC 3LP1A 1ISNA 3NH2A 1VSMA 1TKDA 4R79A 1SZ2A 1L5UA 4UQGA 3NBPA 3SV4A 4DFMA 3KKSA 3GG4A 3ZT4A 3NH0A 2A41A 3SQ0A 1ZBUA 3AAQA 3T19A 1H1VA 3OBWA 1NGHA 3DLLL 3FGUA 3O5BA 3VQCA 4CJ5A 1NLVA 3EPYA 1RDCA 1NBWA 2EHGA 4WFBL 1C6VA 4M7YA 3D2EA 3OYGA 3G6EN 4X66K 3SUOA 1RTHA 1J53A 4LD0A 3AVBA 1RNHA 4JKBA 3D7EO 4PKIA 3T1YK 4CFCA 1GLBG 5CZ2A 1L3SA 4KHPK 3CC4N 4B9VA 4M3XA 3L3UA 1NJYA 1NGBA 3QO9A 3IAYA 3NVMA 3OVNA 4M3TA 1A5WA 3IMXA 1XMOK 1NK5A 3AAPA 4JAXA 4OGCA 3ZETA 2IVNA 1NOYA 1MA9B 3NCIA 3LDOA 4B9TA 1BGXT 4JD2B 3NF8A 1U04A 4B8CA 5ADXA 1RTIA 3LP3A 1LWEA 1BIZA 3HK2A 3ITHA 3A5LC 4JRQA 4HUEA 3QBXA 5BRFA 1GLJO 4PKGA 4BACA 4ZTFA 2P1JA 1GLDG 3CFOA 4HUFA 2NRRA 5FPEA 3LAKA 2ZD1A 1JKHA 4M63C 4O5BA 3NGIA 1WSHA 3CJ7A 5AFUA 3C7NB 3KVGA 3CG7A 2QTDA 4YOVA 4JHDA 1BA0A 3LDNA 3VQ9A 1YUWA 1SGHA 4CEAA 1LAVA 4GKJK 1ASVA 3V9SA 1VRTA 4LFCK 4IZ9A 3BEXA 1JL1A 3SCXA 4JS5A 5H1SQ 4FLZA 4B3SK 4FWPA 5J2MA 3MEGA 3MXJA 5C15A 3T69A 2LSNA 4RW6A 2AP1A 1OH8A 1J19A 4B9UA 4BRCA 4KKOA 1XHXA 3TTCA 1XMQK 3VQ4A 3SAHA 2FSJA 1IBLK 4EHTA 4BGBA 1K8KB 1NKBA 2IIRA 3J7YP 2O8CA 3EYZA 5GIPA 1HJRA 3CYMA 5M1QA 1WUAA 4HCCA 4BRIA 3LM9A 2W40A 4LSLA 5FRNA 5AQNA 4WQ4C 3THWB 2G8HA 3F73A 4CHZA 2EX3A 4BR7A 4CJPA 5AZJB 3SPZA 5LMNK 4DSJA 1O13A 2COPA 4JKAA 2P51A 3EE8A 4YDUA 4CGFA 4WYBA 1VQ6N 3MN7A 1RDUA 4WQ4A 1VSJA 4NCBA 4JI2K 4QS7A 1UA1A 5CYMA 5M1KA 3TI0A 1BO5O 4Z94A 1HB8A 4RW4A 3AVLA 2BANA 1S9EA 5C2FA 3HSTB 4FJHA 3GE1A 1QZ5A 3I0RA 2ZM6K 3SLCA 3OYIA 4PL8A 4AHUA 3ULEB 3ZSQA 3CMEN 5HL7L 3QETA 2J4RA 4NCGA 4FVMA 4KH4A 4U67L 1SQKA 2QWPA 3TAFA 1KRPA 1NWKA 4DR5K 1ZBIA 2IAJA 3QEPA 3PLAA 5JLFA 3PIOL 2VG5A 1YHQN 4ZHRA 4OPKA 1RT6A 4CD3A 4QAGA 1XC3A 3OYAA 1NK0A 3AVKA 3OTOK 5CR4A 5JVLA 2GWJA 3JS6A 1HKBA 5BPMA 4CJTA 1QVGM 2IS3A 3HBTA 2NUBA 2BE2A 5AQRA 2D10A 3KD1E 3VERA 1QTMA 1LWCA 4CGIA 4RW7A 1X3MA 4LH4A 4DS5A 5C2DA 3AY9A 3GL1A 1NGEA 3LDLA 4F7GA 3CHWA 2P9UA 4DHYA 3KK1A 4CEZA 1W97L 1QE1A 2GV9A 3VEZA 3ENHA 3OBYA 3A8YA 2X6NA 1T3VA 1GLEG 2O8EA 1JJ2M 2P9SB 5J2PA 2Q2RA 3WNEA 4JKDA 1TK0A 4QS9A 4H5NA 3WXLA 4JK9A 3V1QA 4CHQA 3K5OA 4MQ3A 4BROA 2UXBK 1X9JA 3LDSA 4A2BA 4EZ6A 2WC9A 3HRGA 3TAGA 4LF7K 3MECA 1FKOA 1CXUA 3S3OA 2KTQA 1C0UA 2NRWA 3BZCA 4CGDA 2ASPA 1BIUA 2GUIA 4CBUA 3VA0A 4O8UA 4BG9A 3RMDA 2XY5A 2QWMA 2H3GX 4J2AA 1VQNN 4DLEA 2QI2A 3OYEA 3RMAA 1SL0A 1WN7A 1TAQA 3C94A 4IWVA 1HPZA 3UE5A 1S3XA 2J0MA 1C0FA 3DM2A 1YT3A 4DFPA 4DV7K 4O0JA 2P9IB 3OYCA 5KRTA 1E4FT 2BUPA 3QERA 2O8FB 3VGMA 4LFBK 4CIGA 2X74A 1LAWA 5KTQA 1RBTA 4OO1J 2P9PB 2Q0UA 3D2FA 4FJMA 2O8BA 3UKRA 2F9TA 2KFNA 4JN4A 3FZFA 1CZBA 1JCFA 3V6DA 4BDPA 5TKYA 3L6QA 4ID5A 4CK1A 3LPTA 5AQUA 4IFVA 3ISNC 2VCPA 3VA3A 4HWIA 1IV0A 3DMJA 4E3SA 1W2BM 1N5YA 3M8PA 2QKBA 4YOYA 3KHYA 1E5WA 4DTSA 4C8OA 3QINA 2WBNA 3NFAA 2E2NA 4M41A 3CM6A 3L2WA 2GTDA 4X64K 3EO3A 4IBNA 3VGKA 2Z1GA 3MK6A 4NB4A 3CM5A 1OVQA 2A6AA 3IUCA 1OH6A 3L3VA 2OPQA 4DCHA 2V7ZA 1Y19B 2VYPA 1SS6A 2UU9K 4PY5A 3HP9A 5AQGA 5JLHA 2P9NA 4KB1A 4J2BA 3KLHA 5GAGP 4ELUA 5FPNA 4O55A 4BRHA 5BPLA 2YVCA 1Q9YA 2QK9A 3WQUA 5LJVA 3IS9A 4B9QA 3J80O 3ZT0A 1HUXA 2CH6A 3CJBA 3DLGA 3CFRA 4FLWA 1F21A 3DLRA 1VK0A 4DMNA 3F9MA 4CD1A 3P5JA
chains in the Genus database with same CATH topology
2P9NB 3H1QA 3MN9A 3ZEUB 1WOQA 1Q86O 5AQLA 3ID6A 5E26A 3MN5A 2V7YA 3O6WA 4IJAA 3U4LA 4CYEA 4CZKA 4BVOA 4Y0WA 1VQMN 1JCGA 3L4QA 3QFPA 3VEWA 4PHTX 2FDQA 2KHOA 1YVNA 1V4SA 3WT0A 4FWSA 5EXWA 4CZLA 3R6MA 4IEEA 5MLCQ 4GV6A 3MWPA 5C10A 3DXKA 4FWLA 1VQ9N 3IDHA 1KAXA 4I6MA 4A59A 3ZETB 1HKCA 4IEIA 4HDQA 4AF1A 2RQ1A 1GGOA 4BRMA 3R1XA 3SJHA 4A57A 3GBTA 4FOIA 3GDQA 3LDPA 3A5NC 4EHUA 3RSEA 3O8MA 1RFQA 2PAVA 4FO0A 5EY4A 4BRNA 5M1NA 4FWOA 5ELZA 3CERA 1HKGA 5M1OA 1U2VB 5AQQA 3CCEN 4JNEA 4H0XB 2A40A 5DM6L 3VF4A 3A5MC 2EMSA 3EZWA 1YJNN 1D4XA 3VF2A 2HF4A 1MWMA 3DXKB 1MIZB 1KQSM 4RWTA 2KKZA 1QQNA 4MO4A 4NO7A 3A5OC 4JKEA 2BTFA 4FL9A 3MN6A 4FWQA 4RTFD 3CCVN 5KPZA 1GLAG 3FFKB 3UKUA 4CBWA 2A42A 3MCAB 4CZJA 5JVHL 4YOTA 3E9LA 4YOXA 4WFNL 3LL3A 4YORA 4KBOA 4JHDB 2QM1A 2FF6A 3KK7A 3CCJN 1HX1A 3RVCA 4IXCA 1ST7A 5AQIA 1GLFO 5JICA 2J0KA 1LCUA 3CIPA 3HOTA 3ENOA 3OA9A 4XH1A 1YI2N 3WEEA 4BR0A 5EOYA 4K43A 3CETA 5FPDA 2WH5A 3VEVA 1MK7B 4YOWA 2HF3A 3VF6A 3UKUB 3PIPL 5AR0A 5KQ8A 4TKNA 1VQKN 1TYQA 3G9WA 4FVUA 5GADP 2NRVA 1HPMA 5BRDA 3ID8A 3M6GA 3VTIA 4GV9A 3C65A 3DWLA 3DXMA 5AQHA 4CI6A 4H0VB 4ISGA 2Q31A 1Q7YO 1ISNA 1T6DA 2NLXA 3QMLA 4FWRA 5AQSA 1YAGA 1S72N 4R79A 1SZ2A 2I7NA 4JKGA 2QA4N 4NLCA 5B8HA 1E4GT 3WEEB 5DM7L 3U8ZA 3GG4A 3JXUA 3SAGA 2IVOA 3WXMB 1VQ4N 2A41A 2OANA 3AAQA 1VQON 4BVPA 1H1VA 3OBWA 2YI1A 2YCHA 1NGHA 3EKUA 1TYQB 3FGUA 4GVEA 3O1BA 3O5BA 3DLLL 2D11A 4JKCA 1EQYA 1NLVA 2NRXA 3EPYA 3L0QA 4EIAA 3EN9A 1NBWA 3IKMA 1BDGA 4C1NK 4WFBL 3G25A 3FZLA 3D2EA 4M7YA 4B1XB 4DXAB 1Q18A 4ISEA 4BR9A 3M5RA 4BREA 4EKUA 3BF3A 5BPNA 1J6ZA 3G6EN 2GEMA 4JK7A 3WQTA 4JKGB 4FPBA 2QXLA 3WUHA 4JKBA 3D7EO 3NMUA 2ZJPL 4OPHA 4OO1J 4PKHA 4PKIA 3F5TA 4XH5A 1GLBG 1N8RO 3UB5A 4M7XA 4BRQA 2CGLA 4JKHA 4IOCL 1QVFM 3CC4N 3HI0A 5AQWA 1NGBA 4DKWA 4JD2A 3QDKA 2AEHA 2ZPYA 3T7ZA 1NI2A 4BQLA 3NVMA 4FWKA 5LJWA 1KC7A 1OVYA 5BN8A 5AQXA 3I8BA 3IMXA 4GNIA 5I9EB 4JEPA 2PFUA 4H5VA 2VGNA 3O08A 3AAPA 2KLAA 5EVZA 4JAXA 1DT9A 5BR9A 3ZDTA 3C0BA 3ZETA 2I7PA 2IVNA 2GX9A 1MA9B 3H45C 3LDOA 4BY9C 1MIXA 4MLEA 5BRHA 4HDOA 2ZGYA 4BC4A 5GINA 4JD2B 4ILGB 5C0YA 5AQMA 2ZF5O 4RCHA 5GAHP 3O4WA 5ADXA 3DJCA 2RHKA 4H5TA 1U2VA 4O8KA 1ZBSA 2HBLA 3K9KA 3A5LC 1DGKN 4BC5A 3QBXA 5BRFA 1GLJO 1K8AO 2FSNA 2FJ9A 1BUPA 4PKGA 1GLDG 4A5BA 1ILYA 2D2QA 2OTLN 2QEXN 1H4RA 4IDHA 2NRRA 5AQOA 5AQFA 5FPEA 2E2OA 2HSTA 1S22A 2FXUA 1K73O 4FSVA 4M63C 2NNWA 3CJCA 3CJ7A 3CCSN 3VPZA 5AFUA 3C7NB 3KVGA 5JMVA 5AQJA 3GOIA 3K9JA 2QTDA 4DB3A 4YOVA 4A2AA 3CC2N 4JHDA 1BA0A 3LDNA 3AGRA 2Q0RA 3A0IX 3H6EA 3ENBA 1YUWA 3HM8A 1SGHA 3VMFB 2IVPA 4BR2A 3MDQA 1GG3A 4IOAL 3AGKA 3B8AX 4BC3A 3MCPA 4CZIA 1P90A 2NRHA 4IZ9A 2JWLA 1QQOA 3E66A 3E9PA 1HB6A 3KZBA 4YOUA 1R59O 1MDUB 3BEXA 4MLHA 2WUSA 1K8KA 3X23A 2HOEA 5H1SQ 4FWPA 4AM6A 3QIJA 1LOTB 3DAWA 3HZ6A 1NJIO 1NGFA 3AARA 1QZ6A 4FOEA 5E84A 1TUYA 3O9TA 5C15A 3T69A 2AP1A 3W0LA 1J19A 4BRCA 2F9WA 4BRKA 3TTCA 3TPQA 2E20A 5CHIA 4MO5A 2FSJA 3SAHA 1QHAA 2E2PA 3QICA 4EHTA 3P31A 5AQTA 4BGBA 3CF5L 5AZJA 1K8KB 2IIRA 3CQXA 4BRFA 5AQVA 4A62A 5F0XA 2ITMA 1C0GA 4BR5A 3CPEA 4BG8A 3Q7BA 5JVGL 3SMSA 5GIPA 3IVFA 3ATVA 4H5WA 3WA0A 5M1QA 4A5AA 2P9KA 1WUAA 1NGCA 4BRIA 3LM9A 2W40A 1ZC6A 1NTIA 1HBKA 1KAZA 2GWKA 3L4IA 3O9SA 1BA1A 2HBMA 4WQ4C 5AQNA 3VESA 4PL7A 4BQZA 2CB8A 3P39A 5KPRA 1Z6RA 4YL8A 3TSPA 1NVLA 3W3DA 1VQPN 4BR7A 5AZJB 3CC7N 4IO9L 3VETA 2QW9A 4AM7A 3O1WA 5IJMA 2HMPA 3MX5A 1O13A 3CCQN 2PBDA 3TTDA 1XUPO 1YJ9N 2COPA 4JKAA 3EE8A 4YDUA 4WYBA 2A5XA 2P9KB 1VQ6N 3H46O 3MN7A 1RDUA 3ULEA 4WQ4A 3SAFA 1HLUA 2ZJQL 2YHXA 3KWIA 2QWNA 2ZGZA 3TTFA 3AU5A 3O9RA 5M1FA 4QS7A 2D0PA 5M1KA 3VEOA 1BO5O 4Z94A 1GC6A 1HB8A 1NGGA 3BINA 2EWSA 3H3NO 4J8FA 4GXBA 5C2FA 1ATNA 4K41A 1IJJA 2E1YA 3GE1A 3CCLN 1QZ5A 3E1YA 4A61A 3LM2A 3SLCA 3G71N 1VQ5N 2A3ZA 4PL8A 4QS8A 4KH6A 5GAEP 3ULEB 1VBGA 2X0SA 5ADXH 3CMEN 3CCUN 1OKJA 2AA4A 5HL7L 1ZXOA 3VOVA 4BRDA 4CD1A 5CE3A 4NY0A 2J4RA 3OW2M 4BRLA 4ILJA 5LY3A 2D4WA 2NRZA 4E1JA 4U67L 4KH4A 1GLCG 2AL6A 1SQKA 2QWPA 5FPMA 2E8AA 2V51B 1NWKA 2CGKA 4H0OA 3LDQA 4B1UB 3PLAA 2HBKA 5JLFA 3PIOL 2GUPA 1YHQN 4CZHA 3P38A 4CD3A 5AFUH 1VQ7N 1XC3A 2HRJA 3C7NA 1NMDA 4BC2A 5CR4A 5JVLA 2GWJA 3JS6A 1HKBA 3E9OA 4P7IA 2W41A 3CQYA 2ASMA 3H1VX 3N4QA 2D0OA 5BPMA 2RE2A 1QVGM 3HBTA 4BRPA 1EF1A 2P9SA 5AQRA 1VQ8N 3NVKA 2D10A 3CPWM 3VERA 4CZMA 4XH4A 2R82A 2NZTA 4KH5A 4XEIA 4C1NI 1X3MA 1DKGD 4H0PA 1ATSA 3AY9A 5C2DA 1QQMA 3GL1A 4WQ5A 1NGEA 3LDLA 5AQYA 4F7GA 4HTLA 1CZAN 3CHWA 1Z05A 3VEYA 4B1VA 2P9UA 2FSKA 2YX6A 1YF5L 4DHYA 3CCRN 4H0YB 3P4IA 1W97L 3MX2A 4EAHD 5F1XA 3VEZA 3ENHA 2DIKA 2FLOA 3OBYA 3A8YA 1T3VA 1GLEG 1RGIA 5TKWA 1GLLO 1NGDA 4UY8O 1JJ2M 2P9SB 3O9UA 2YHYA 5GIOA 4LC9B 1Y64A 3C6HA 5F2RA 2Q2RA 1KD1O 3U9ZA 4JKDA 2ASOA 3ZX2A 2YHWA 4QS9A 2E88A 1VBHA 4JKFA 3MMVA 4H5NA 1Q81O 3FLCO 3EE9A 4JK9A 3CJ9A 4MDAA 2CQUA 3WXLA 1XQSC 4BROA 2P9UB 4BR4A 3HSCA 3CXCM 1BWFO 1X9JA 3M3ZA 3FLVA 1EO1A 1U6ZA 1T6CA 1GC7A 2WC9A 3HRGA 3SK3A 4L3QA 3FZHA 3U9DA 4A2BA 1MWKA 1YJWN 3R9PA 2I1JA 1Q82O 4B1WB 4ISFA 3VEXA 3ZX3A 2NRWA 5M1PA 1KC8O 4I6MB 3CJAA 1X3NA 3R3LA 1MK9B 2P9IA 4IFEA 4O5FA 5AQKA 5EX5A 3TU5A 4BRGA 4H03B 2ASPA 3FZKA 3CMAN 1YIJN 3M1FA 3PZDA 5HOOA 4CBUA 2UYTA 4ILHA 4O8UA 4BG9A 2QWQA 1TUUA 2YJEA 3I56N 2QWMA 4GY2B 2H3GX 2P9PA 3RSEB 1VQNN 3QFUA 4B1ZA 4ZRJA 1VAZA 1M1KO 2QI2A 3ZYYX 4ZRIA 4IWVA 4MDBA 3UE5A 1S3XA 1NGIA 4CZGA 4GV3A 4ZRKA 2J0MA 1C0FA 1M90O 3SBTA 3CJ1A 3WXIA 4NLBA 2VWBA 1P8ZA 4YDUC 4CZEA 4BRAA 1ATRA 2P9LA 2Q36A 4EFHA 2P9IB 2WFBA 3IFRA 2ZJRL 3U7DA 3HTVA 3QB0A 5AQZA 2ZWHA 1E4FT 2BUPA 1HJOA 3VGMA 4CZFA 4FWNA 4WCEL 3S41A 3SBGA 2Q97A 1ACAA 3C6AA 2LBBA 1RDWX 3FR0A 1KBLA 2P9PB 2Q0UA 4OPAA 2Q1NA 3D2FA 3SMPA 3ZX0A 2DPNA 2E1ZA 2VGMA 1BOTO 3BF1A 3UKRA 4F9OA 2F9TA 1JCEA 2CH5A 3FZFA 4JN4A 1YXQA 1JCFA 5TKYA 3L6QA 4JK8A 3PVLA 4IO8A 2OTJN 1BU6O 4CBXA 2JWKA 3TSUA 4K25A 1VQLN 5AQUA 5AZIA 1NGJA 2BH1A 3U8XA 2VCPA 4HWIA 2P9LB 3FE1A 1W2BM 3EL2A 3VGLA 4FWMA 3R8EA 2YJFA 2QWOA 4YOYA 3QBWA 3I33A 3G4SN 3KHYA 2FF3B 1E5WA 3FP5A 2HE7A 3CI5A 1JDEA 2WBNA 4IOXA 2E2NA 2V52B 3D2FB 4BGAA 4IJNA 3MWTA 3UKRB 3O9QA 2I1KA 1G99A 1IG8A 3CD6N 3OHRA 3VENA 4B1YB 3DXMB 2GTDA 4WF9L 2ABDA 3EO3A 3VGKA 2J0JA 4WFAL 1KAYA 2HBJA 2GELA 3MK6A 4NB4A 3J7ZO 2A6AA 3IUCA 5AZIB 1ESVA 4DCHA 2V7ZA 1Y19B 2D1KA 2VYPA 4H0TB 5AQPA 3ATUA 5KQDA 1SS6A 4CJ7A 5AQGA 3HOSA 1DIKA 5C12A 3EKSA 2E2QA 4U7BA 3AU4A 1KXPA 4H5RA 5JLHA 5BREA 2F7TA 3Q7CA 1K9MO 2P9NA 4DQ8A 3VTHA 3ZEUA 4C23A 2CGJA 5GAGP 3CCMN 3TSQA 3BUZB 1DEJA 2QWRA 3WXJA 5FPNA 1T44A 4K42A 5KPTA 3H3OB 1NM1A 3D2EB 2QWLA 3O80A 4WQ5C 4BRHA 1SAZA 5BPLA 3F2KA 2YVCA 1BG3A 2EMTA 4FPAA 3WQUA 1YITN 3KWGA 3WXKA 5LJVA 4B9QA 5BN9A 1HUXA 2CH6A 3CJBA 3BP8A 3N4PA 3I55N 1V4TA 3J8AA 3FZMA 2NRTA 4G9ZA 3F9MA 1NGAA 3D6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  4ILJ A;  4JKG A;  3SBT A;  4JKH A;  4ILG B;  3ENB A;  4JKC A;  3E9O A;  3SBG A;  4JKE A;  3E66 A;  4JKD A;  4ILH A;  3E9P A;  4JKA A;  4JKF A;  4JK7 A;  4JK9 A;  4JK8 A;  4JKG B;  3E9L A; 
#chains in the Genus database with same CATH topology
 3H1Q A;  4FJJ A;  1TKT A;  3I0S A;  1UOC A;  2VG7 A;  2V7Y A;  5IT9 O;  4IJA A;  2KW4 A;  4BVO A;  4CZK A;  3OYL A;  5I3U A;  3EY1 A;  3VEW A;  1VSK A;  2KHO A;  3WT0 A;  3NDK A;  4KRE A;  3K57 A;  4FJ5 A;  3IDH A;  1KAX A;  4I6M A;  4O4G A;  1JLB A;  3NAE A;  4X62 K;  4HDQ A;  3MED A;  2RQ1 A;  4BRM A;  3SJH A;  4A57 A;  4FOI A;  3RSE A;  1VSH A;  4CEF A;  2PYL A;  4ELT A;  3G10 A;  5ELZ A;  3CER A;  1HKG A;  1RBS A;  3VQ6 A;  3VF4 A;  1RT3 A;  2EMS A;  3A5M C;  4KRF A;  1YJN N;  1NK4 A;  4Z0U A;  4FZY A;  4NO7 A;  3CCV N;  3DYA A;  4FL9 A;  5KPZ A;  4PWD A;  5EU7 A;  4LF6 K;  2YKN A;  4CZJ A;  3BDP A;  4YOT A;  3E9L A;  3SYZ A;  4HHT A;  1R0A A;  2QM1 A;  2FF6 A;  3KK7 A;  4E19 A;  4CIF A;  4AHC A;  2F4V K;  3CIP A;  3OA9 A;  4K43 A;  3KLF A;  1EXQ A;  4FJG A;  3PIP L;  4E7I A;  1OH7 A;  2D0A A;  5AR0 A;  4KFB A;  1VQK N;  2NRV A;  5BRD A;  3T1A A;  4GV9 A;  3RR8 A;  3C65 A;  2Q3S A;  3DWL A;  5E41 A;  5AQH A;  4CI6 A;  2YNH A;  4DV6 K;  2Q31 A;  1Y97 A;  4OLB A;  4FWR A;  3QML A;  2I7N A;  1RBV A;  3JXU A;  3WXM B;  2O4G A;  4BVP A;  3O4Q A;  1DTT A;  4CHY A;  2D11 A;  4AHV A;  3QEV A;  5C24 A;  3IKM A;  3G25 A;  4JI7 K;  3ZLJ A;  1ZYQ A;  4DXA B;  4ISE A;  4AQY K;  1WSE A;  3THY B;  1J6Z A;  2DFH A;  3WQT A;  1J5E K;  2IOC A;  2E5L K;  3WUH A;  4KAZ A;  1GOB A;  4M45 A;  3NMU A;  4E7H A;  4F4K A;  3NGY A;  4PKH A;  3F5T A;  5HLF A;  3SQ1 A;  4XH5 A;  1XI1 A;  3OYH A;  4BRQ A;  2CGL A;  1J9A A;  2G8W A;  1I3A A;  4H4O A;  2F8S A;  3AVN A;  5AQW A;  3OYB A;  4JD2 A;  2ZPY A;  4FJK A;  3KLE A;  5BN8 A;  4M42 A;  3I8B A;  4GNI A;  4JEP A;  2PY5 A;  4OLA A;  3SUN A;  2VGN A;  5BR9 A;  5EVZ A;  4ICL A;  1DT9 A;  3TAN A;  3UIQ A;  3ZSO A;  2YKM A;  4AH9 A;  4JI6 K;  4KHU A;  4HDO A;  4BC4 A;  2KQ2 A;  5GIN A;  5HRS A;  5C0Y A;  3RMB A;  4RCH A;  4BDZ A;  3DJC A;  1U2V A;  4M3W A;  3DOK A;  3ZSX A;  3OYJ A;  4OVL A;  4FJL A;  1QSL A;  4B9N A;  1DGK N;  4BC5 A;  1XWL A;  2FSN A;  4HVJ A;  4CED A;  3WNF A;  2GBZ A;  4A5B A;  1ILY A;  2D2Q A;  3AA4 A;  2OTL N;  1H4R A;  4IDH A;  3PSI A;  4FJI A;  4Y1C A;  1SV5 A;  3KLI A;  2XRI A;  2UUC K;  3CJC A;  4CVN E;  4DR3 K;  3CCS N;  3VPZ A;  4FJ7 A;  1LWF A;  1C1C A;  3A0I X;  3H6E A;  3ENB A;  3VMF B;  3HM8 A;  1RT4 A;  4I2Q A;  2IVP A;  4DG1 A;  4BR2 A;  1NU0 A;  3MDQ A;  3B8A X;  1P90 A;  2JWL A;  4CIE A;  3HXM A;  4LH5 A;  1R59 O;  1RT2 A;  5HRR A;  1K8K A;  4GVM A;  3QIJ A;  3DAW A;  3L2U A;  2PYJ A;  3AAR A;  3NF7 A;  3O9T A;  3W0L A;  1NG9 A;  2F9W A;  4DFJ A;  2FBT A;  3THW A;  1KVB A;  4MO5 A;  1QHA A;  5AQT A;  3VN5 A;  5AZJ A;  4PQU A;  4I9Q A;  1C0G A;  2YV0 X;  4RG8 A;  4QOZ B;  3IVF A;  4A5A A;  3QLH A;  4KO0 A;  4CHN A;  3C6T A;  4DV4 K;  1SL2 A;  1ZC6 A;  1HBK A;  2GWK A;  3LAL A;  2HBM A;  3VQ7 A;  3VES A;  4PL7 A;  1TL1 A;  3TSP A;  3OJS A;  4AM7 A;  3O1W A;  3TTD A;  5HRN A;  3DOL A;  4W5R A;  1L3T A;  2A5X A;  4GW6 A;  3ULE A;  1BCO A;  2ZJQ L;  2YHX A;  2QWN A;  2ZGZ A;  3TTF A;  3OS2 A;  3ZSR A;  3O9R A;  5M1F A;  1IKX A;  1YVU A;  1KFD A;  3VEO A;  1GC6 A;  3ZCM A;  1Z26 A;  4J8F A;  4K41 A;  2E1Y A;  2IC3 A;  3HVT A;  4QS8 A;  4KH6 A;  5GAE P;  1W7A A;  2X0S A;  3CCU N;  2QKK A;  2HVH A;  2ZE2 A;  3K59 A;  3OW2 M;  2ZQB A;  4BRL A;  4ILJ A;  3CFP A;  2HHV A;  2AL6 A;  4DUY K;  2V51 B;  2CGK A;  4B9L A;  4HCB A;  3LDQ A;  1L3V A;  1NJX A;  2GUP A;  4B3M K;  1VQ7 N;  2HRJ A;  1NMD A;  3N4Q A;  5C25 A;  1HYV A;  1BL3 A;  2P9S A;  3V9Z A;  1VQ8 N;  3NVK A;  4CHP A;  4DLG A;  4CZM A;  2NZT A;  4XEI A;  4C1N I;  3AVH A;  3AVJ A;  2XY7 A;  1ASU A;  3WNG A;  2HHW A;  5AQY A;  4HTL A;  1K73 O;  1CZA N;  1C0T A;  2D5R A;  1YF5 L;  2JGU A;  4H0Y B;  2Z1I A;  3MX2 A;  4IG3 A;  4KHQ A;  4EZ9 A;  1NGD A;  3ZSV A;  4LC9 B;  1SUQ A;  5F2R A;  3C6H A;  1N32 K;  3ZX2 A;  2YHW A;  2HHH K;  2PZS A;  3EE9 A;  2OA8 A;  4BR4 A;  3CXC M;  2Y1J A;  4CK2 A;  1BWF O;  1EO1 A;  2D0B A;  4CGJ A;  2A1R A;  1MWK A;  2DFF A;  1HYS A;  4FM1 A;  2KFZ A;  4JI8 K;  1C1B A;  5FLX O;  3R3L A;  2P9I A;  5AQK A;  4O5F A;  2O8F A;  5HOO A;  2IGI A;  2QWQ A;  4FCY A;  1IKY A;  4GY2 B;  2P9P A;  4E1M A;  4CER A;  1VAZ A;  1WAF A;  3ZYY X;  5C42 A;  1NGI A;  2WON A;  4DR2 K;  3CJ1 A;  5SZT A;  1XNR K;  4IFY A;  4YDU C;  4CZE A;  4FK4 A;  2Q36 A;  4BE0 A;  3AA2 A;  3RR7 A;  2ZJR L;  3U7D A;  5AQZ A;  2W6L A;  1HJO A;  3C6U A;  4WCE L;  1IKW A;  2LBB A;  4OPA A;  3L2V A;  4DR4 K;  2DPN A;  2E1Z A;  2G8I A;  1BOT O;  3PUF A;  4IO8 A;  4LSN A;  1GOC A;  3TSU A;  1VQL N;  4N56 A;  3QIP A;  2BH1 A;  2UXC K;  3U8X A;  1RCH A;  4DQQ A;  3VGL A;  2HHT A;  3LAM A;  3QBW A;  1I94 K;  4AHT A;  2HE7 A;  3HO1 A;  4IG0 A;  1I39 A;  2I1K A;  1G99 A;  1IG8 A;  1QHT A;  1TGO A;  3OHR A;  3VEN A;  4DU1 A;  3AVM A;  4G1Q A;  1U48 A;  2G8F A;  3RTV A;  4DV0 K;  1KAY A;  2HBJ A;  2GEL A;  5AZI B;  4E7K A;  1ESV A;  2D1K A;  5AQP A;  3ATU A;  5KQD A;  5DMR A;  4CJ7 A;  4CES A;  3F9K A;  5C12 A;  3EKS A;  2E2Q A;  3HOS A;  3AU4 A;  3QNN A;  3TAE A;  3Q7C A;  1K9M O;  4DQ8 A;  3VTH A;  3CCM N;  3HJF A;  3TSQ A;  1MU2 A;  3V81 A;  2XO7 A;  2Z1J A;  4K42 A;  1Z25 A;  5KPT A;  3H3O B;  3D2E B;  2QWL A;  3O80 A;  1BG3 A;  4FPA A;  2O8D B;  2RPI A;  5LL6 Z;  4DU3 A;  3JSM A;  1A5V A;  4M3R A;  1V4T A;  4NCA A;  1L3U A;  3J8A A;  1HYZ A;  2NRT A;  4FJ9 A;  3MN9 A;  3ZEU B;  1Q86 O;  3MN5 A;  3L8B A;  4Y1D A;  3TWH A;  4Y0W A;  3L4Q A;  4PHT X;  2FDQ A;  3THX B;  2VWK A;  4KTQ A;  4FJ8 A;  4CZL A;  2E6M A;  4IEE A;  1E3M A;  2ETJ A;  4DV2 K;  4A59 A;  3ZET B;  1K6Y A;  4IEI A;  3RMC A;  3LZI A;  1WLJ A;  1NOZ A;  4AF1 A;  4E1N A;  5J2Q A;  1GGO A;  1GOA A;  2OCE A;  1UWB A;  3A5N C;  3O8M A;  2PAV A;  4FO0 A;  3L2Q A;  5M1N A;  3V9X A;  5AQQ A;  4H0X B;  1QSS A;  2AJQ A;  3MXI A;  3MEE A;  1BHL A;  2BGG A;  1D4X A;  2HF4 A;  3OS0 A;  1KQS M;  4RWT A;  2KKZ A;  1QQN A;  4MO4 A;  3SI6 A;  4RTF D;  1U4B A;  4DTM A;  3P1G A;  3THV A;  2A42 A;  3MCA B;  4FK0 A;  1S1V A;  5A2Q O;  1EX4 A;  3BY5 A;  4WFN L;  1U47 A;  4JHD B;  3RVC A;  4IXC A;  4CJE A;  4JV5 K;  4M3Z A;  3ZT1 A;  3VEV A;  1MK7 B;  3AO4 A;  2HF3 A;  4YOW A;  3VF6 A;  3UKU B;  3B6O A;  4V19 S;  4TKN A;  4FVU A;  5GAD P;  1Q8I A;  3TAM A;  5IWA K;  3M6G A;  2D0C A;  3U3Y A;  2X78 A;  1LV5 A;  3DXM A;  1HQE A;  4ELV A;  1EP4 A;  1T6D A;  2NLX A;  4OKJ A;  3THY A;  5HRO A;  1YAG A;  3LP2 A;  3SNN A;  4CGH A;  4IKF A;  5DM7 L;  3U8Z A;  1X1P A;  3SAG A;  4QCL A;  2IVO A;  4DR6 K;  2OAN A;  1VQO N;  2B4J A;  2YI1 A;  3EKU A;  1TYQ B;  1EQY A;  3L0Q A;  4EIA A;  4C1N K;  4AIL C;  3FZL A;  2G8K A;  1RIL A;  3TAQ A;  5BPN A;  4JK7 A;  4CFD A;  4JKG B;  3DLB A;  3LP0 A;  1BI4 B;  4DTP A;  4F3O A;  2QXL A;  4DQS A;  1NK8 A;  4YFU A;  4PA1 A;  1N8R O;  3UB5 A;  4M7X A;  2HHU A;  4IOC L;  1C1A A;  1QVF M;  3HL8 A;  3HI0 A;  2HB5 A;  3NGZ A;  4KTZ A;  3QDK A;  3T7Z A;  4BQL A;  3WNH A;  5LJW A;  2RN2 A;  1KC7 A;  1OVY A;  3T3F A;  5AQX A;  5CZ1 A;  4E7J A;  5I9E B;  2PFU A;  3VQ8 A;  1J54 A;  4H5V A;  2KLA A;  4DR7 K;  3ZDT A;  3PV8 A;  3C0B A;  3LWM A;  4JS4 A;  4NYN A;  5J2N A;  1FW6 A;  3H45 C;  2ZGY A;  3M8Q A;  4GMJ B;  3K5M A;  4ILG B;  3TAB A;  1RDA A;  2QXF A;  2ZF5 O;  5GAH P;  4CJ4 A;  1HR0 K;  2YNG A;  3O4W A;  4H5T A;  2HW3 A;  1ZBS A;  2G8V A;  4B3R K;  1K8A O;  3MXM A;  1XHZ A;  2FJ9 A;  3EZ5 A;  4N5S A;  2HND A;  4JYA K;  5AQO A;  1XC9 A;  3K2P A;  2FXU A;  3FFI A;  4FSV A;  3SJJ A;  1HNZ K;  3AV9 A;  3PX0 A;  4DSI A;  5D3G A;  5JMV A;  4DTO A;  4DV5 K;  5AQJ A;  3GOI A;  3K9J A;  1SKW A;  4DB3 A;  3O3H A;  3AGR A;  3KIO A;  2KZM A;  2ATQ A;  3V4I A;  3AGK A;  3D45 A;  2NRH A;  1QQO A;  1WSI A;  3E66 A;  3E9P A;  3KZB A;  4YOU A;  1B9F A;  1KCF A;  3ZSY A;  2WUS A;  3S9H A;  3X23 A;  5FDL A;  4AM6 A;  1LOT B;  3HZ6 A;  1NJI O;  4EP4 A;  4BWM A;  1QZ6 A;  5E84 A;  4CJV A;  1WSJ A;  4OX9 K;  5CHI A;  1UA0 A;  4YY3 K;  2E2P A;  3V9W A;  3V1R A;  1HNV A;  3LWL A;  3CQX A;  5F0X A;  4JI5 K;  4I7F A;  4CF8 A;  3Q7B A;  3SMS A;  1EWQ A;  5I42 A;  4F8R A;  3ATV A;  4CJR A;  3QNO A;  3PO4 A;  3PO5 A;  1NTI A;  1KAZ A;  2OYQ A;  1NMN A;  1BA1 A;  3AVI A;  4BQZ A;  3P39 A;  5KPR A;  1Z6R A;  4DQP A;  1NVL A;  2XHB A;  1VQP N;  1TV6 A;  3CC7 N;  2HVI A;  4CFB A;  2QW9 A;  3J7A P;  5IJM A;  3CCQ N;  2PBD A;  1XUP O;  1S6P A;  1WAJ A;  2P9K B;  4CJS A;  4DF4 A;  3H46 O;  3SAF A;  1HLU A;  1TKZ A;  2YNI A;  2OZM A;  2D0P A;  4CHO A;  1S5J A;  1EET A;  3BIN A;  2EWS A;  1ATN A;  4CJU A;  3CCL N;  4N47 A;  3JYT A;  1J5O A;  3E1Y A;  3DLH A;  1WBB A;  2A3Z A;  3DRR A;  5ADX H;  1VBG A;  4F2S A;  1NJZ A;  3RRG A;  3VOV A;  4FK2 A;  1JL2 A;  1HRH A;  4NY0 A;  4O44 A;  4E0D A;  4FJN A;  1GLC G;  1JXE A;  2HBK A;  1KVC A;  3H08 A;  5AFU H;  3C7N A;  4BC2 A;  3E9O A;  4P7I A;  1B92 A;  2W41 A;  2ASM A;  3AVA A;  3H1V X;  2RE2 A;  1WNS A;  4BRP A;  2OZS A;  1EF1 A;  2KZZ A;  4FW2 A;  2WTU A;  2DY4 A;  5KGX A;  2R82 A;  3ALY A;  4GKK K;  3QIO A;  4H0P A;  1ATS A;  1QQM A;  4NXN K;  4WQ5 A;  4B1V A;  3VEY A;  4Q0B A;  2YX6 A;  3TAP A;  5T7B A;  3CCR N;  3P4I A;  3VQB A;  4EAH D;  4W5T A;  2DIK A;  2FLO A;  4OKE A;  1RGI A;  3O9U A;  2YHY A;  3O4N A;  5GIO A;  4CF2 A;  1Y64 A;  4NYF A;  4Z4G A;  3HT3 A;  1VBH A;  4JKF A;  3MMV A;  1Q81 O;  4MDA A;  2O4I A;  1S1U A;  2IDO A;  1BIS A;  3OYF A;  1XQS C;  3J81 O;  2HHX A;  4KHW A;  4EP5 A;  4E7L A;  4DV1 K;  3FLV A;  2HHQ A;  1GC7 A;  3SK3 A;  4L3Q A;  3R9P A;  4DF8 A;  2I1J A;  4LF8 K;  1Q82 O;  4BWJ A;  4B1W B;  3VEX A;  3ZX3 A;  4N41 A;  4I6M B;  3CJA A;  1X3N A;  1MK9 B;  4CK3 A;  3TU5 A;  3FZK A;  3CMA N;  3PZD A;  2UYT A;  3I56 N;  3RSE B;  3QFU A;  4B1Z A;  1M1K O;  1KTQ A;  3KD5 E;  1HMV A;  4ZRI A;  4MDB A;  4GV3 A;  4ZRK A;  1IBK K;  4NLB A;  2VWB A;  1P8Z A;  3U3G A;  4YNQ A;  3E01 A;  3K5L A;  4KB0 A;  3HPG A;  1IG9 A;  2WFB A;  3HTV A;  3M8R A;  3SQ4 A;  2ZWH A;  2FBY A;  1TKX A;  5CY4 A;  3S41 A;  3C6A A;  5AQS A;  3KWI A;  2Q97 A;  3FR0 A;  3SMP A;  1KBL A;  3DLE A;  3S3M A;  3BF1 A;  1JCE A;  1YXQ A;  1QQC A;  4DSK A;  3PVL A;  5LMU K;  4IDK A;  1KLN A;  5AZI A;  1NGJ A;  4H4M A;  2P9L B;  3FE1 A;  3EL2 A;  1TL3 A;  3DRP A;  2WOM A;  3M8S A;  3I33 A;  3G4S N;  3HVR A;  3FP5 A;  4IOX A;  2V52 B;  2JLE A;  3MWT A;  3C95 A;  3O9Q A;  4B1Y B;  1RBU A;  4WF9 L;  2ABD A;  2J0J A;  2O8D A;  5J1E A;  2W42 A;  4FXD A;  3OY9 A;  1ZBL A;  1NK6 A;  3ZSZ A;  1DIK A;  2VQE K;  4KI6 A;  2F7T A;  3ZEU A;  2YHB A;  3WXJ A;  1T44 A;  3AVF A;  4CJQ A;  4RW8 A;  3ASM A;  2B6A A;  1NM1 A;  1UAX A;  1SAZ A;  2P5O A;  3LZJ A;  2EMT A;  4OPJ A;  4DV3 K;  4B3O A;  3WXK A;  4CEQ A;  1S1W A;  4M3Y A;  5BN9 A;  3THX A;  3I8D A;  3BP8 A;  3N4P A;  1NK7 A;  2VWJ A;  4G9Z A;  1VSI A;  3SQ2 A;  3D6R A;  1W0H A;  5AQL A;  3ID6 A;  3U4L A;  4CYE A;  2Y1I A;  1VQM N;  1JCG A;  3SPY A;  2F96 A;  3R6M A;  5MLC Q;  2X6S A;  3MWP A;  4FWL A;  1TVR A;  1VQ9 N;  4DTR A;  1NK9 A;  3QES A;  1HKC A;  3RRH A;  3P83 D;  4CJF A;  4J2D A;  4CGG A;  4RW9 A;  3R1X A;  1O1W A;  3GDQ A;  3LDP A;  4FWO A;  5M1O A;  2UUA K;  3CCE N;  1U2V B;  3VQA A;  4JNE A;  5DM6 L;  4PUO A;  4ID1 A;  1VHX A;  5AJ3 K;  4DTX A;  3EZW A;  3AVG A;  3DXK B;  1MIZ B;  4HUG A;  1M90 O;  1N33 K;  4B3T K;  3DI6 A;  1GLA G;  3UKU A;  1SKR A;  4CBW A;  3D0P A;  1S9G A;  4DSE A;  1OH5 A;  2E4L A;  1N34 K;  3HPH A;  2G8U A;  4C8L A;  1ST7 A;  1KSP A;  4KV8 A;  3DRS A;  4CW7 B;  4JLH A;  1LCU A;  5JIC A;  3HOT A;  3QEI A;  5KRS A;  5EOY A;  3CET A;  5FPD A;  2WH5 A;  3O3F A;  2ITG A;  4Z4I A;  1WSF A;  4ZTJ A;  4DQI A;  1TYQ A;  2YHA A;  1HPM A;  3IRX A;  1NKE A;  4H0V B;  3KK2 A;  4ISG A;  1Q7Y O;  1S72 N;  4WE1 A;  4K8Z A;  4JKG A;  2QA4 N;  3MAQ A;  1BI4 A;  4NLC A;  1E4G T;  3WEE B;  4AHS A;  5B8H A;  3ZT3 A;  1VQ4 N;  4M3U A;  4DR1 K;  4GVE A;  2YCH A;  3O1B A;  4CEO A;  2NRX A;  4JKC A;  4W5Q A;  1QSY A;  4Z4H A;  3EN9 A;  2HHS A;  1BDG A;  4MFB A;  4B1X B;  4FW1 A;  1Q18 A;  1C0M A;  4BR9 A;  4BRE A;  3M5R A;  4EKU A;  3BF3 A;  1EKE A;  2W6K A;  2GEM A;  4FPB A;  3AA3 A;  1X9M A;  2ZJP L;  4OPH A;  4CJK A;  3QEW A;  4FZZ A;  4YHH K;  1WSG A;  4JKH A;  3OS1 A;  1JLQ A;  1T7P A;  1TK5 A;  4OKK A;  1FKP A;  3AO3 A;  4DKW A;  2E6L A;  2AEH A;  1NI2 A;  1D9D A;  4FWK A;  4DFK A;  2VQF K;  1HNW K;  3O08 A;  2HMI A;  1VSL A;  1ZBH A;  1A5X A;  2I7P A;  1D8Y A;  4FLT A;  2GX9 A;  5K14 A;  4BY9 C;  1MIX A;  4LF9 K;  4MLE A;  5BRH A;  3OYN A;  2DFE A;  4JI3 K;  5AQM A;  3VQP A;  4JI0 K;  2RHK A;  3ZT2 A;  3KK3 A;  1LW2 A;  4O8K A;  2HBL A;  3K9K A;  1B9D A;  2FBV A;  3OYK A;  3AO5 A;  1BUP A;  1G15 A;  2QEX N;  5AQF A;  2E2O A;  2HST A;  1S22 A;  1T8E A;  3SV3 A;  2NNW A;  3AO1 A;  1JLC A;  3CC2 N;  4A2A A;  2HNZ A;  2Q0R A;  4AHR A;  1DLO A;  1GG3 A;  1ASW A;  4CEB A;  4BC3 A;  4IOA L;  3HYF A;  3MCP A;  4I9L A;  4CZI A;  3PX4 A;  2XY6 A;  1RT7 A;  5DK5 A;  3L2R A;  1HB6 A;  1HNX K;  1MDU B;  4MLH A;  3PSF A;  3AO2 A;  2HOE A;  3VQD A;  1VSE A;  4KHN A;  2XY8 A;  1NGF A;  3EEQ A;  4FOE A;  1TUY A;  4F3T A;  4FYD A;  4CF0 A;  4BRK A;  4B08 A;  3TPQ A;  2E20 A;  1S6Q A;  2UXD K;  4CEE A;  1RT1 A;  3QIC A;  3P31 A;  3CF5 L;  4JI4 K;  4DU4 A;  4BRF A;  5AQV A;  4A62 A;  2ITM A;  4BR5 A;  1QS4 A;  3CPE A;  4BG8 A;  5JVG L;  1LW0 A;  3DLK A;  4H5W A;  3WA0 A;  4CF9 A;  2P9K A;  1X9W A;  4I2P A;  1KFS A;  1NGC A;  1IBM K;  3L4I A;  4X65 K;  3O9S A;  4DQR A;  1U49 A;  3VQ5 A;  4KPY A;  3NF9 A;  1IH7 A;  1KVA A;  2CB8 A;  4YL8 A;  1U45 A;  3W3D A;  4FLV A;  1RBR A;  3HM9 A;  4C8N A;  4IO9 L;  3VET A;  2HMP A;  3MX5 A;  4FJX A;  2O8C B;  3LAN A;  1YJ9 N;  1VSD A;  3SUP A;  1NKC A;  4CJL A;  5KGW A;  3KTQ A;  4O0I A;  3AU5 A;  1HNI A;  1NGG A;  3K58 A;  3OJU A;  3H3N O;  4GXB A;  4KI4 A;  1CZ9 A;  1IJJ A;  4B9S A;  4A61 A;  2OPP A;  2YNF A;  3LM2 A;  3G71 N;  1VQ5 N;  1BQM A;  1FJG K;  3K0S A;  4CFA A;  2P5G A;  1OKJ A;  2AA4 A;  3S3N A;  2I5J A;  1ZXO A;  4BRD A;  3U6F A;  5CE3 A;  4FM0 A;  3KJV A;  5LY3 A;  2D4W A;  2NRZ A;  3A2F A;  4H8K A;  4E1J A;  4LF4 K;  3JAM O;  4W5O A;  1BQN A;  5FPM A;  4DTN A;  2E8A A;  4HTU A;  1JLF A;  4KTW A;  4H0O A;  4B1U B;  1IO2 A;  4CZH A;  5HRP A;  3P38 A;  3T1H K;  5HBM A;  3TR8 A;  4DS4 A;  1DTQ A;  3CQY A;  2D0O A;  1BCM A;  1D5A A;  1VSF A;  4L8R B;  3CPW M;  4XH4 A;  4R5P A;  4KH5 A;  4N76 A;  4DSF A;  1DKG D;  3BGR A;  1WBD A;  2VG6 A;  1Z05 A;  4NXM K;  2FSK A;  1Q9X A;  1REV A;  1JXB A;  3VQQ A;  5F1X A;  4Z4F A;  4B9M A;  4Z4C A;  5TKW A;  3SZ2 A;  1GLL O;  4UY8 O;  1KD1 O;  1IKV A;  2FBX A;  3U9Z A;  2ASO A;  2E88 A;  3FLC O;  3CJ9 A;  4DTJ A;  2CQU A;  2P9U B;  3HSC A;  3O3G A;  3NH1 A;  3M3Z A;  3NHG A;  1U6Z A;  1T6C A;  3U9D A;  4Z4E A;  3FZH A;  1YJW N;  3NE6 A;  4B8A B;  5HP1 A;  5KI6 A;  2O8E B;  4ISF A;  3CQ8 A;  3PY8 A;  1RDD A;  4LY7 A;  5M1P A;  1KC8 O;  4IFE A;  5EX5 A;  4BRG A;  1YIJ N;  1HQU A;  3AA5 X;  3G0Z A;  4H03 B;  1ITG A;  2RF2 A;  3M1F A;  4K8X A;  4FLY A;  4ILH A;  2YJE A;  1TUU A;  2Z1H A;  3V9U A;  4CJ3 A;  1NNE A;  4FLX A;  4ZRJ A;  1RT5 A;  4CCH A;  4CZG A;  3IG1 A;  3SBT A;  3WXI A;  2R7Y A;  2DTU A;  1ZBF A;  4BRA A;  1ATR A;  5FRO A;  4KHS A;  2P9L A;  4EFH A;  2FC0 A;  3IFR A;  3QB0 A;  1RTJ A;  4FWN A;  4CZF A;  4CJW A;  3SBG A;  1ACA A;  1RDW X;  3AVC A;  4DTU A;  2Q1N A;  3ZX0 A;  2OTJ N;  2VGM A;  1S1X A;  4F9O A;  3PX6 A;  3NF6 A;  2CH5 A;  1CLQ A;  3ZSW A;  4JK8 A;  2B5J A;  1BU6 O;  4CBX A;  2JWK A;  4K25 A;  1VRU A;  4BE1 A;  1JLE A;  1RDB A;  4FWM A;  1XNQ K;  3R8E A;  2YJF A;  4C8K A;  3OYD A;  2QWO A;  2FF3 B;  3KLG A;  3CI5 A;  1JDE A;  3D2F B;  4BGA A;  2O8B B;  4IJN A;  3UKR B;  4DSL A;  1TK8 A;  1JLA A;  3CD6 N;  1TAU A;  3DXM B;  3KKR A;  4WFA L;  3J7Z O;  3RWU A;  4H0T B;  4FM2 A;  4U7B A;  5SWM A;  1KXP A;  4H5R A;  5BRE A;  3V1O A;  1YTA A;  2CGJ A;  4C23 A;  4C8M A;  1JLG A;  3SUQ A;  5CYQ A;  3BUZ B;  1DEJ A;  2QWR A;  1WB9 A;  4DWI A;  1FXX A;  4WQ5 C;  3F2K A;  1YIT N;  3KWG A;  3OYM A;  4OGE A;  3I55 N;  3K5N A;  1D9F A;  1SKS A;  2OPR A;  3FZM A;  4K0K K;  1S1T A;  3LPU A;  1NGA A;  2UUB K;  2P9N B;  1WOQ A;  3HPO A;  5E26 A;  4W5N A;  3O6W A;  4E89 A;  1X9S A;  3B6P A;  5BR8 K;  3QFP A;  4F2R A;  1YVN A;  1V4S A;  4CE9 A;  4FWS A;  2F8T A;  5EXW A;  1T03 A;  4GV6 A;  1YTU A;  5C10 A;  3DXK A;  4BE2 A;  4FLU A;  1CXQ A;  2OPS A;  4JI1 K;  4BDY A;  3GBT A;  4EHU A;  5FRM A;  1EWR A;  4CF1 A;  1RFQ A;  5EY4 A;  4BRN A;  4XIU A;  2A40 A;  4KHY A;  3VF2 A;  1RTD A;  1MWM A;  3VQE A;  4J2E A;  3A5O C;  4JKE A;  2BTF A;  4FWQ A;  3MN6 A;  1KLM A;  3TAR A;  4LFA K;  3QEX A;  3FFK B;  3BZK A;  1N36 K;  2A1S A;  2HNY A;  5JVH L;  1W9H A;  5JS1 A;  4YOX A;  4DUZ K;  1SL1 A;  3LL3 A;  4YOR A;  4KBO A;  3CCJ N;  5JS2 A;  1HX1 A;  5AQI A;  4JRP A;  1GLF O;  3ULD A;  2J0K A;  3ENO A;  2RKI A;  4XH1 A;  4TSX A;  1YI2 N;  3WEE A;  4BR0 A;  4LF5 K;  4Q5V A;  1N6Q A;  4OJR A;  5KQ8 A;  3G9W A;  1T05 A;  1FK9 A;  4CEC A;  3ID8 A;  2BDP A;  3VTI A;  3HP6 A;  1NJW A;  4FZX C;  3LP1 A;  1ISN A;  3NH2 A;  1VSM A;  1TKD A;  4R79 A;  1SZ2 A;  1L5U A;  4UQG A;  3NBP A;  3SV4 A;  4DFM A;  3KKS A;  3GG4 A;  3ZT4 A;  3NH0 A;  2A41 A;  3SQ0 A;  1ZBU A;  3AAQ A;  3T19 A;  1H1V A;  3OBW A;  1NGH A;  3DLL L;  3FGU A;  3O5B A;  3VQC A;  4CJ5 A;  1NLV A;  3EPY A;  1RDC A;  1NBW A;  2EHG A;  4WFB L;  1C6V A;  4M7Y A;  3D2E A;  3OYG A;  3G6E N;  4X66 K;  3SUO A;  1RTH A;  1J53 A;  4LD0 A;  3AVB A;  1RNH A;  4JKB A;  3D7E O;  4PKI A;  3T1Y K;  4CFC A;  1GLB G;  5CZ2 A;  1L3S A;  4KHP K;  3CC4 N;  4B9V A;  4M3X A;  3L3U A;  1NJY A;  1NGB A;  3QO9 A;  3IAY A;  3NVM A;  3OVN A;  4M3T A;  1A5W A;  3IMX A;  1XMO K;  1NK5 A;  3AAP A;  4JAX A;  4OGC A;  3ZET A;  2IVN A;  1NOY A;  1MA9 B;  3NCI A;  3LDO A;  4B9T A;  1BGX T;  4JD2 B;  3NF8 A;  1U04 A;  4B8C A;  5ADX A;  1RTI A;  3LP3 A;  1LWE A;  1BIZ A;  3HK2 A;  3ITH A;  3A5L C;  4JRQ A;  4HUE A;  3QBX A;  5BRF A;  1GLJ O;  4PKG A;  4BAC A;  4ZTF A;  2P1J A;  1GLD G;  3CFO A;  4HUF A;  2NRR A;  5FPE A;  3LAK A;  2ZD1 A;  1JKH A;  4M63 C;  4O5B A;  3NGI A;  1WSH A;  3CJ7 A;  5AFU A;  3C7N B;  3KVG A;  3CG7 A;  2QTD A;  4YOV A;  4JHD A;  1BA0 A;  3LDN A;  3VQ9 A;  1YUW A;  1SGH A;  4CEA A;  1LAV A;  4GKJ K;  1ASV A;  3V9S A;  1VRT A;  4LFC K;  4IZ9 A;  3BEX A;  1JL1 A;  3SCX A;  4JS5 A;  5H1S Q;  4FLZ A;  4B3S K;  4FWP A;  5J2M A;  3MEG A;  3MXJ A;  5C15 A;  3T69 A;  2LSN A;  4RW6 A;  2AP1 A;  1OH8 A;  1J19 A;  4B9U A;  4BRC A;  4KKO A;  1XHX A;  3TTC A;  1XMQ K;  3VQ4 A;  3SAH A;  2FSJ A;  1IBL K;  4EHT A;  4BGB A;  1K8K B;  1NKB A;  2IIR A;  3J7Y P;  2O8C A;  3EYZ A;  5GIP A;  1HJR A;  3CYM A;  5M1Q A;  1WUA A;  4HCC A;  4BRI A;  3LM9 A;  2W40 A;  4LSL A;  5FRN A;  5AQN A;  4WQ4 C;  3THW B;  2G8H A;  3F73 A;  4CHZ A;  2EX3 A;  4BR7 A;  4CJP A;  5AZJ B;  3SPZ A;  5LMN K;  4DSJ A;  1O13 A;  2COP A;  4JKA A;  2P51 A;  3EE8 A;  4YDU A;  4CGF A;  4WYB A;  1VQ6 N;  3MN7 A;  1RDU A;  4WQ4 A;  1VSJ A;  4NCB A;  4JI2 K;  4QS7 A;  1UA1 A;  5CYM A;  5M1K A;  3TI0 A;  1BO5 O;  4Z94 A;  1HB8 A;  4RW4 A;  3AVL A;  2BAN A;  1S9E A;  5C2F A;  3HST B;  4FJH A;  3GE1 A;  1QZ5 A;  3I0R A;  2ZM6 K;  3SLC A;  3OYI A;  4PL8 A;  4AHU A;  3ULE B;  3ZSQ A;  3CME N;  5HL7 L;  3QET A;  2J4R A;  4NCG A;  4FVM A;  4KH4 A;  4U67 L;  1SQK A;  2QWP A;  3TAF A;  1KRP A;  1NWK A;  4DR5 K;  1ZBI A;  2IAJ A;  3QEP A;  3PLA A;  5JLF A;  3PIO L;  2VG5 A;  1YHQ N;  4ZHR A;  4OPK A;  1RT6 A;  4CD3 A;  4QAG A;  1XC3 A;  3OYA A;  1NK0 A;  3AVK A;  3OTO K;  5CR4 A;  5JVL A;  2GWJ A;  3JS6 A;  1HKB A;  5BPM A;  4CJT A;  1QVG M;  2IS3 A;  3HBT A;  2NUB A;  2BE2 A;  5AQR A;  2D10 A;  3KD1 E;  3VER A;  1QTM A;  1LWC A;  4CGI A;  4RW7 A;  1X3M A;  4LH4 A;  4DS5 A;  5C2D A;  3AY9 A;  3GL1 A;  1NGE A;  3LDL A;  4F7G A;  3CHW A;  2P9U A;  4DHY A;  3KK1 A;  4CEZ A;  1W97 L;  1QE1 A;  2GV9 A;  3VEZ A;  3ENH A;  3OBY A;  3A8Y A;  2X6N A;  1T3V A;  1GLE G;  2O8E A;  1JJ2 M;  2P9S B;  5J2P A;  2Q2R A;  3WNE A;  4JKD A;  1TK0 A;  4QS9 A;  4H5N A;  3WXL A;  4JK9 A;  3V1Q A;  4CHQ A;  3K5O A;  4MQ3 A;  4BRO A;  2UXB K;  1X9J A;  3LDS A;  4A2B A;  4EZ6 A;  2WC9 A;  3HRG A;  3TAG A;  4LF7 K;  3MEC A;  1FKO A;  1CXU A;  3S3O A;  2KTQ A;  1C0U A;  2NRW A;  3BZC A;  4CGD A;  2ASP A;  1BIU A;  2GUI A;  4CBU A;  3VA0 A;  4O8U A;  4BG9 A;  3RMD A;  2XY5 A;  2QWM A;  2H3G X;  4J2A A;  1VQN N;  4DLE A;  2QI2 A;  3OYE A;  3RMA A;  1SL0 A;  1WN7 A;  1TAQ A;  3C94 A;  4IWV A;  1HPZ A;  3UE5 A;  1S3X A;  2J0M A;  1C0F A;  3DM2 A;  1YT3 A;  4DFP A;  4DV7 K;  4O0J A;  2P9I B;  3OYC A;  5KRT A;  1E4F T;  2BUP A;  3QER A;  2O8F B;  3VGM A;  4LFB K;  4CIG A;  2X74 A;  1LAW A;  5KTQ A;  1RBT A;  4OO1 J;  2P9P B;  2Q0U A;  3D2F A;  4FJM A;  2O8B A;  3UKR A;  2F9T A;  2KFN A;  4JN4 A;  3FZF A;  1CZB A;  1JCF A;  3V6D A;  4BDP A;  5TKY A;  3L6Q A;  4ID5 A;  4CK1 A;  3LPT A;  5AQU A;  4IFV A;  3ISN C;  2VCP A;  3VA3 A;  4HWI A;  1IV0 A;  3DMJ A;  4E3S A;  1W2B M;  1N5Y A;  3M8P A;  2QKB A;  4YOY A;  3KHY A;  1E5W A;  4DTS A;  4C8O A;  3QIN A;  2WBN A;  3NFA A;  2E2N A;  4M41 A;  3CM6 A;  3L2W A;  2GTD A;  4X64 K;  3EO3 A;  4IBN A;  3VGK A;  2Z1G A;  3MK6 A;  4NB4 A;  3CM5 A;  1OVQ A;  2A6A A;  3IUC A;  1OH6 A;  3L3V A;  2OPQ A;  4DCH A;  2V7Z A;  1Y19 B;  2VYP A;  1SS6 A;  2UU9 K;  4PY5 A;  3HP9 A;  5AQG A;  5JLH A;  2P9N A;  4KB1 A;  4J2B A;  3KLH A;  5GAG P;  4ELU A;  5FPN A;  4O55 A;  4BRH A;  5BPL A;  2YVC A;  1Q9Y A;  2QK9 A;  3WQU A;  5LJV A;  3IS9 A;  4B9Q A;  3J80 O;  3ZT0 A;  1HUX A;  2CH6 A;  3CJB A;  3DLG A;  3CFR A;  4FLW A;  1F21 A;  3DLR A;  1VK0 A;  4DMN A;  3F9M A;  4CD1 A;  3P5J A; 
#chains in the Genus database with same CATH homology
 2P9N B;  3H1Q A;  3MN9 A;  3ZEU B;  1WOQ A;  1Q86 O;  5AQL A;  3ID6 A;  5E26 A;  3MN5 A;  2V7Y A;  3O6W A;  4IJA A;  3U4L A;  4CYE A;  4CZK A;  4BVO A;  4Y0W A;  1VQM N;  1JCG A;  3L4Q A;  3QFP A;  3VEW A;  4PHT X;  2FDQ A;  2KHO A;  1YVN A;  1V4S A;  3WT0 A;  4FWS A;  5EXW A;  4CZL A;  3R6M A;  4IEE A;  5MLC Q;  4GV6 A;  3MWP A;  5C10 A;  3DXK A;  4FWL A;  1VQ9 N;  3IDH A;  1KAX A;  4I6M A;  4A59 A;  3ZET B;  1HKC A;  4IEI A;  4HDQ A;  4AF1 A;  2RQ1 A;  1GGO A;  4BRM A;  3R1X A;  3SJH A;  4A57 A;  3GBT A;  4FOI A;  3GDQ A;  3LDP A;  3A5N C;  4EHU A;  3RSE A;  3O8M A;  1RFQ A;  2PAV A;  4FO0 A;  5EY4 A;  4BRN A;  5M1N A;  4FWO A;  5ELZ A;  3CER A;  1HKG A;  5M1O A;  1U2V B;  5AQQ A;  3CCE N;  4JNE A;  4H0X B;  2A40 A;  5DM6 L;  3VF4 A;  3A5M C;  2EMS A;  3EZW A;  1YJN N;  1D4X A;  3VF2 A;  2HF4 A;  1MWM A;  3DXK B;  1MIZ B;  1KQS M;  4RWT A;  2KKZ A;  1QQN A;  4MO4 A;  4NO7 A;  3A5O C;  4JKE A;  2BTF A;  4FL9 A;  3MN6 A;  4FWQ A;  4RTF D;  3CCV N;  5KPZ A;  1GLA G;  3FFK B;  3UKU A;  4CBW A;  2A42 A;  3MCA B;  4CZJ A;  5JVH L;  4YOT A;  3E9L A;  4YOX A;  4WFN L;  3LL3 A;  4YOR A;  4KBO A;  4JHD B;  2QM1 A;  2FF6 A;  3KK7 A;  3CCJ N;  1HX1 A;  3RVC A;  4IXC A;  1ST7 A;  5AQI A;  1GLF O;  5JIC A;  2J0K A;  1LCU A;  3CIP A;  3HOT A;  3ENO A;  3OA9 A;  4XH1 A;  1YI2 N;  3WEE A;  4BR0 A;  5EOY A;  4K43 A;  3CET A;  5FPD A;  2WH5 A;  3VEV A;  1MK7 B;  4YOW A;  2HF3 A;  3VF6 A;  3UKU B;  3PIP L;  5AR0 A;  5KQ8 A;  4TKN A;  1VQK N;  1TYQ A;  3G9W A;  4FVU A;  5GAD P;  2NRV A;  1HPM A;  5BRD A;  3ID8 A;  3M6G A;  3VTI A;  4GV9 A;  3C65 A;  3DWL A;  3DXM A;  5AQH A;  4CI6 A;  4H0V B;  4ISG A;  2Q31 A;  1Q7Y O;  1ISN A;  1T6D A;  2NLX A;  3QML A;  4FWR A;  5AQS A;  1YAG A;  1S72 N;  4R79 A;  1SZ2 A;  2I7N A;  4JKG A;  2QA4 N;  4NLC A;  5B8H A;  1E4G T;  3WEE B;  5DM7 L;  3U8Z A;  3GG4 A;  3JXU A;  3SAG A;  2IVO A;  3WXM B;  1VQ4 N;  2A41 A;  2OAN A;  3AAQ A;  1VQO N;  4BVP A;  1H1V A;  3OBW A;  2YI1 A;  2YCH A;  1NGH A;  3EKU A;  1TYQ B;  3FGU A;  4GVE A;  3O1B A;  3O5B A;  3DLL L;  2D11 A;  4JKC A;  1EQY A;  1NLV A;  2NRX A;  3EPY A;  3L0Q A;  4EIA A;  3EN9 A;  1NBW A;  3IKM A;  1BDG A;  4C1N K;  4WFB L;  3G25 A;  3FZL A;  3D2E A;  4M7Y A;  4B1X B;  4DXA B;  1Q18 A;  4ISE A;  4BR9 A;  3M5R A;  4BRE A;  4EKU A;  3BF3 A;  5BPN A;  1J6Z A;  3G6E N;  2GEM A;  4JK7 A;  3WQT A;  4JKG B;  4FPB A;  2QXL A;  3WUH A;  4JKB A;  3D7E O;  3NMU A;  2ZJP L;  4OPH A;  4OO1 J;  4PKH A;  4PKI A;  3F5T A;  4XH5 A;  1GLB G;  1N8R O;  3UB5 A;  4M7X A;  4BRQ A;  2CGL A;  4JKH A;  4IOC L;  1QVF M;  3CC4 N;  3HI0 A;  5AQW A;  1NGB A;  4DKW A;  4JD2 A;  3QDK A;  2AEH A;  2ZPY A;  3T7Z A;  1NI2 A;  4BQL A;  3NVM A;  4FWK A;  5LJW A;  1KC7 A;  1OVY A;  5BN8 A;  5AQX A;  3I8B A;  3IMX A;  4GNI A;  5I9E B;  4JEP A;  2PFU A;  4H5V A;  2VGN A;  3O08 A;  3AAP A;  2KLA A;  5EVZ A;  4JAX A;  1DT9 A;  5BR9 A;  3ZDT A;  3C0B A;  3ZET A;  2I7P A;  2IVN A;  2GX9 A;  1MA9 B;  3H45 C;  3LDO A;  4BY9 C;  1MIX A;  4MLE A;  5BRH A;  4HDO A;  2ZGY A;  4BC4 A;  5GIN A;  4JD2 B;  4ILG B;  5C0Y A;  5AQM A;  2ZF5 O;  4RCH A;  5GAH P;  3O4W A;  5ADX A;  3DJC A;  2RHK A;  4H5T A;  1U2V A;  4O8K A;  1ZBS A;  2HBL A;  3K9K A;  3A5L C;  1DGK N;  4BC5 A;  3QBX A;  5BRF A;  1GLJ O;  1K8A O;  2FSN A;  2FJ9 A;  1BUP A;  4PKG A;  1GLD G;  4A5B A;  1ILY A;  2D2Q A;  2OTL N;  2QEX N;  1H4R A;  4IDH A;  2NRR A;  5AQO A;  5AQF A;  5FPE A;  2E2O A;  2HST A;  1S22 A;  2FXU A;  1K73 O;  4FSV A;  4M63 C;  2NNW A;  3CJC A;  3CJ7 A;  3CCS N;  3VPZ A;  5AFU A;  3C7N B;  3KVG A;  5JMV A;  5AQJ A;  3GOI A;  3K9J A;  2QTD A;  4DB3 A;  4YOV A;  4A2A A;  3CC2 N;  4JHD A;  1BA0 A;  3LDN A;  3AGR A;  2Q0R A;  3A0I X;  3H6E A;  3ENB A;  1YUW A;  3HM8 A;  1SGH A;  3VMF B;  2IVP A;  4BR2 A;  3MDQ A;  1GG3 A;  4IOA L;  3AGK A;  3B8A X;  4BC3 A;  3MCP A;  4CZI A;  1P90 A;  2NRH A;  4IZ9 A;  2JWL A;  1QQO A;  3E66 A;  3E9P A;  1HB6 A;  3KZB A;  4YOU A;  1R59 O;  1MDU B;  3BEX A;  4MLH A;  2WUS A;  1K8K A;  3X23 A;  2HOE A;  5H1S Q;  4FWP A;  4AM6 A;  3QIJ A;  1LOT B;  3DAW A;  3HZ6 A;  1NJI O;  1NGF A;  3AAR A;  1QZ6 A;  4FOE A;  5E84 A;  1TUY A;  3O9T A;  5C15 A;  3T69 A;  2AP1 A;  3W0L A;  1J19 A;  4BRC A;  2F9W A;  4BRK A;  3TTC A;  3TPQ A;  2E20 A;  5CHI A;  4MO5 A;  2FSJ A;  3SAH A;  1QHA A;  2E2P A;  3QIC A;  4EHT A;  3P31 A;  5AQT A;  4BGB A;  3CF5 L;  5AZJ A;  1K8K B;  2IIR A;  3CQX A;  4BRF A;  5AQV A;  4A62 A;  5F0X A;  2ITM A;  1C0G A;  4BR5 A;  3CPE A;  4BG8 A;  3Q7B A;  5JVG L;  3SMS A;  5GIP A;  3IVF A;  3ATV A;  4H5W A;  3WA0 A;  5M1Q A;  4A5A A;  2P9K A;  1WUA A;  1NGC A;  4BRI A;  3LM9 A;  2W40 A;  1ZC6 A;  1NTI A;  1HBK A;  1KAZ A;  2GWK A;  3L4I A;  3O9S A;  1BA1 A;  2HBM A;  4WQ4 C;  5AQN A;  3VES A;  4PL7 A;  4BQZ A;  2CB8 A;  3P39 A;  5KPR A;  1Z6R A;  4YL8 A;  3TSP A;  1NVL A;  3W3D A;  1VQP N;  4BR7 A;  5AZJ B;  3CC7 N;  4IO9 L;  3VET A;  2QW9 A;  4AM7 A;  3O1W A;  5IJM A;  2HMP A;  3MX5 A;  1O13 A;  3CCQ N;  2PBD A;  3TTD A;  1XUP O;  1YJ9 N;  2COP A;  4JKA A;  3EE8 A;  4YDU A;  4WYB A;  2A5X A;  2P9K B;  1VQ6 N;  3H46 O;  3MN7 A;  1RDU A;  3ULE A;  4WQ4 A;  3SAF A;  1HLU A;  2ZJQ L;  2YHX A;  3KWI A;  2QWN A;  2ZGZ A;  3TTF A;  3AU5 A;  3O9R A;  5M1F A;  4QS7 A;  2D0P A;  5M1K A;  3VEO A;  1BO5 O;  4Z94 A;  1GC6 A;  1HB8 A;  1NGG A;  3BIN A;  2EWS A;  3H3N O;  4J8F A;  4GXB A;  5C2F A;  1ATN A;  4K41 A;  1IJJ A;  2E1Y A;  3GE1 A;  3CCL N;  1QZ5 A;  3E1Y A;  4A61 A;  3LM2 A;  3SLC A;  3G71 N;  1VQ5 N;  2A3Z A;  4PL8 A;  4QS8 A;  4KH6 A;  5GAE P;  3ULE B;  1VBG A;  2X0S A;  5ADX H;  3CME N;  3CCU N;  1OKJ A;  2AA4 A;  5HL7 L;  1ZXO A;  3VOV A;  4BRD A;  4CD1 A;  5CE3 A;  4NY0 A;  2J4R A;  3OW2 M;  4BRL A;  4ILJ A;  5LY3 A;  2D4W A;  2NRZ A;  4E1J A;  4U67 L;  4KH4 A;  1GLC G;  2AL6 A;  1SQK A;  2QWP A;  5FPM A;  2E8A A;  2V51 B;  1NWK A;  2CGK A;  4H0O A;  3LDQ A;  4B1U B;  3PLA A;  2HBK A;  5JLF A;  3PIO L;  2GUP A;  1YHQ N;  4CZH A;  3P38 A;  4CD3 A;  5AFU H;  1VQ7 N;  1XC3 A;  2HRJ A;  3C7N A;  1NMD A;  4BC2 A;  5CR4 A;  5JVL A;  2GWJ A;  3JS6 A;  1HKB A;  3E9O A;  4P7I A;  2W41 A;  3CQY A;  2ASM A;  3H1V X;  3N4Q A;  2D0O A;  5BPM A;  2RE2 A;  1QVG M;  3HBT A;  4BRP A;  1EF1 A;  2P9S A;  5AQR A;  1VQ8 N;  3NVK A;  2D10 A;  3CPW M;  3VER A;  4CZM A;  4XH4 A;  2R82 A;  2NZT A;  4KH5 A;  4XEI A;  4C1N I;  1X3M A;  1DKG D;  4H0P A;  1ATS A;  3AY9 A;  5C2D A;  1QQM A;  3GL1 A;  4WQ5 A;  1NGE A;  3LDL A;  5AQY A;  4F7G A;  4HTL A;  1CZA N;  3CHW A;  1Z05 A;  3VEY A;  4B1V A;  2P9U A;  2FSK A;  2YX6 A;  1YF5 L;  4DHY A;  3CCR N;  4H0Y B;  3P4I A;  1W97 L;  3MX2 A;  4EAH D;  5F1X A;  3VEZ A;  3ENH A;  2DIK A;  2FLO A;  3OBY A;  3A8Y A;  1T3V A;  1GLE G;  1RGI A;  5TKW A;  1GLL O;  1NGD A;  4UY8 O;  1JJ2 M;  2P9S B;  3O9U A;  2YHY A;  5GIO A;  4LC9 B;  1Y64 A;  3C6H A;  5F2R A;  2Q2R A;  1KD1 O;  3U9Z A;  4JKD A;  2ASO A;  3ZX2 A;  2YHW A;  4QS9 A;  2E88 A;  1VBH A;  4JKF A;  3MMV A;  4H5N A;  1Q81 O;  3FLC O;  3EE9 A;  4JK9 A;  3CJ9 A;  4MDA A;  2CQU A;  3WXL A;  1XQS C;  4BRO A;  2P9U B;  4BR4 A;  3HSC A;  3CXC M;  1BWF O;  1X9J A;  3M3Z A;  3FLV A;  1EO1 A;  1U6Z A;  1T6C A;  1GC7 A;  2WC9 A;  3HRG A;  3SK3 A;  4L3Q A;  3FZH A;  3U9D A;  4A2B A;  1MWK A;  1YJW N;  3R9P A;  2I1J A;  1Q82 O;  4B1W B;  4ISF A;  3VEX A;  3ZX3 A;  2NRW A;  5M1P A;  1KC8 O;  4I6M B;  3CJA A;  1X3N A;  3R3L A;  1MK9 B;  2P9I A;  4IFE A;  4O5F A;  5AQK A;  5EX5 A;  3TU5 A;  4BRG A;  4H03 B;  2ASP A;  3FZK A;  3CMA N;  1YIJ N;  3M1F A;  3PZD A;  5HOO A;  4CBU A;  2UYT A;  4ILH A;  4O8U A;  4BG9 A;  2QWQ A;  1TUU A;  2YJE A;  3I56 N;  2QWM A;  4GY2 B;  2H3G X;  2P9P A;  3RSE B;  1VQN N;  3QFU A;  4B1Z A;  4ZRJ A;  1VAZ A;  1M1K O;  2QI2 A;  3ZYY X;  4ZRI A;  4IWV A;  4MDB A;  3UE5 A;  1S3X A;  1NGI A;  4CZG A;  4GV3 A;  4ZRK A;  2J0M A;  1C0F A;  1M90 O;  3SBT A;  3CJ1 A;  3WXI A;  4NLB A;  2VWB A;  1P8Z A;  4YDU C;  4CZE A;  4BRA A;  1ATR A;  2P9L A;  2Q36 A;  4EFH A;  2P9I B;  2WFB A;  3IFR A;  2ZJR L;  3U7D A;  3HTV A;  3QB0 A;  5AQZ A;  2ZWH A;  1E4F T;  2BUP A;  1HJO A;  3VGM A;  4CZF A;  4FWN A;  4WCE L;  3S41 A;  3SBG A;  2Q97 A;  1ACA A;  3C6A A;  2LBB A;  1RDW X;  3FR0 A;  1KBL A;  2P9P B;  2Q0U A;  4OPA A;  2Q1N A;  3D2F A;  3SMP A;  3ZX0 A;  2DPN A;  2E1Z A;  2VGM A;  1BOT O;  3BF1 A;  3UKR A;  4F9O A;  2F9T A;  1JCE A;  2CH5 A;  3FZF A;  4JN4 A;  1YXQ A;  1JCF A;  5TKY A;  3L6Q A;  4JK8 A;  3PVL A;  4IO8 A;  2OTJ N;  1BU6 O;  4CBX A;  2JWK A;  3TSU A;  4K25 A;  1VQL N;  5AQU A;  5AZI A;  1NGJ A;  2BH1 A;  3U8X A;  2VCP A;  4HWI A;  2P9L B;  3FE1 A;  1W2B M;  3EL2 A;  3VGL A;  4FWM A;  3R8E A;  2YJF A;  2QWO A;  4YOY A;  3QBW A;  3I33 A;  3G4S N;  3KHY A;  2FF3 B;  1E5W A;  3FP5 A;  2HE7 A;  3CI5 A;  1JDE A;  2WBN A;  4IOX A;  2E2N A;  2V52 B;  3D2F B;  4BGA A;  4IJN A;  3MWT A;  3UKR B;  3O9Q A;  2I1K A;  1G99 A;  1IG8 A;  3CD6 N;  3OHR A;  3VEN A;  4B1Y B;  3DXM B;  2GTD A;  4WF9 L;  2ABD A;  3EO3 A;  3VGK A;  2J0J A;  4WFA L;  1KAY A;  2HBJ A;  2GEL A;  3MK6 A;  4NB4 A;  3J7Z O;  2A6A A;  3IUC A;  5AZI B;  1ESV A;  4DCH A;  2V7Z A;  1Y19 B;  2D1K A;  2VYP A;  4H0T B;  5AQP A;  3ATU A;  5KQD A;  1SS6 A;  4CJ7 A;  5AQG A;  3HOS A;  1DIK A;  5C12 A;  3EKS A;  2E2Q A;  4U7B A;  3AU4 A;  1KXP A;  4H5R A;  5JLH A;  5BRE A;  2F7T A;  3Q7C A;  1K9M O;  2P9N A;  4DQ8 A;  3VTH A;  3ZEU A;  4C23 A;  2CGJ A;  5GAG P;  3CCM N;  3TSQ A;  3BUZ B;  1DEJ A;  2QWR A;  3WXJ A;  5FPN A;  1T44 A;  4K42 A;  5KPT A;  3H3O B;  1NM1 A;  3D2E B;  2QWL A;  3O80 A;  4WQ5 C;  4BRH A;  1SAZ A;  5BPL A;  3F2K A;  2YVC A;  1BG3 A;  2EMT A;  4FPA A;  3WQU A;  1YIT N;  3KWG A;  3WXK A;  5LJV A;  4B9Q A;  5BN9 A;  1HUX A;  2CH6 A;  3CJB A;  3BP8 A;  3N4P A;  3I55 N;  1V4T A;  3J8A A;  3FZM A;  2NRT A;  4G9Z A;  3F9M A;  1NGA A;  3D6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...