4JKCA

Open and closed forms of t1800e human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTEKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkcA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkcA01
4JKFA 3E9PA 4JK7A 4ILHA 4JKGA 4JK8A 3SBTA 4ILJA 4JKBA 4JKDA 4ILGB 4JKHA 4JKEA 4JKCA 4JKAA 3SBGA 3ENBA 3E9LA 4JKGB 3E66A 3E9OA 4JK9A
chains in the Genus database with same CATH superfamily
2FBVA 2YHWA 1EX4A 1IO2A 4LC9B 3OBYA 3PV8A 1KRPA 4YFUA 1F21A 2AP1A 2GBZA 4XH4A 4CK1A 4BY9C 1KVBA 3PIPL 4PA1A 1IV0A 1CZAN 2E88A 3EKUA 3THWB 5FLXO 1ESVA 3L4QA 4CJ7A 1K8KB 2O8FA 2W41A 1YJWN 4W5QA 4EZ6A 1NGDA 1JCGA 1T3VA 1KD1O 4X66K 4J2BA 4FK2A 2I5JA 1L3UA 5AFUA 2IOCA 3G4SN 1DIKA 4LF9K 2P9LA 5MLCQ 2FBYA 1C0UA 1D8YA 3RMAA 1MU2A 2CH5A 2F9TA 3MECA 2ASPA 4JLHA 2J0KA 4CHYA 5AQWA 4I6MA 5E26A 1H4RA 3NAEA 3F9MA 3WEEA 1EXQA 4AHVA 5M1NA 2D0OA 1MIXA 4GKJK 3S3OA 3W0LA 1HKGA 3NE6A 3LDOA 2FDQA 2XRIA 3QFUA 1D5AA 1XMOK 2QWLA 4KAZA 4JD2A 4XIUA 2YHAA 3SAFA 4HTLA 2E1YA 1TGOA 1XHXA 1T05A 3LM9A 2HHTA 3LDNA 2P5OA 4PKHA 3J80O 3QLHA 1B9FA 3HM9A 4DTRA 3M8RA 4CHOA 2BE2A 3U3YA 5KPTA 2R7YA 4YOTA 3J8AA 3CIPA 2OPQA 4UQGA 3SZ2A 4JNEA 1KLNA 2F4VK 4F2SA 3KK7A 1T8EA 3SJJA 2JWLA 3CERA 4LH4A 5I9EB 3CQXA 1G99A 4YHHK 4N47A 1ITGA 4M42A 4F9OA 2P9PB 2O8DA 1A5XA 1IKWA 3QESA 1NJYA 4W5NA 2O4IA 1NK0A 5IT9O 4DG1A 1ZYQA 3AVJA 3DXMA 1BA1A 4BR2A 3V4IA 3O6WA 1KTQA 4OJRA 1ASUA 5BRHA 3CJ7A 4W5OA 1VSDA 1YAGA 2ZJQL 2Q1NA 3GBTA 1SGHA 2E1ZA 3K5MA 3UE5A 3DRSA 3SUOA 1QQOA 3CETA 2Z1HA 2W6LA 1P90A 3BP8A 4CYEA 4FM2A 3I55N 1RDBA 1I3AA 1TKTA 1S1WA 4B3OA 3HI0A 1MK9B 2P9NB 4KH4A 2GX9A 3AVNA 3D6RA 1K9MO 2FJ9A 4FJMA 1CLQA 2BTFA 4A62A 2P9SB 3HM8A 3O5BA 5AZJA 4YY3K 4DR5K 4DTPA 2OPSA 4KREA 1Z05A 5AQSA 4IDKA 1ACAA 4M3RA 1IBKK 1KXPA 4LY7A 3GG4A 4DTNA 2HNZA 2NRXA 3E9LA 4PY5A 2KTQA 3M5RA 3VGLA 3L4IA 2JWKA 1NMDA 1RDAA 3CXCM 4E7HA 1HPZA 4MDBA 1XUPO 1U2VA 1KQSM 4BREA 1RTIA 3HXMA 2G8VA 4CCHA 4BDZA 1T03A 2VGNA 1R59O 1HRHA 1WSEA 4CZFA 3CCQN 4CIGA 3VQDA 3HVTA 5AQOA 1FXXA 4IWVA 4FJ9A 5C2FA 1EO1A 4JKGB 1GLCG 3E66A 1GLFO 5BR9A 1NWKA 4R79A 4O0IA 2HNDA 2D0AA 1WSJA 4BVOA 2RHKA 3O9SA 1FJGK 5AQUA 1VQMN 4FZZA 3VA3A 4BG9A 4FJKA 1Q8IA 2OPPA 3UKUB 3AVCA 3DRRA 1QS4A 4CI6A 3C0BA 5AQPA 4Q5VA 3TPQA 1WB9A 3NF9A 4WQ5A 4C8KA 5BN8A 1LV5A 4FWKA 2ZD1A 3DXKB 4M7YA 4M3TA 3AVBA 2FBTA 1NGFA 3TABA 3U6FA 1C6VA 1IKYA 3ID8A 4B1YB 2ZE2A 4ISGA 3VA0A 2Q0UA 2VYPA 5AQHA 4DSFA 3SUNA 4IOAL 3FP5A 2LSNA 2F9WA 3H45C 2HOEA 3A0IX 4MLEA 3QICA 1GOCA 2F7TA 3J81O 3ULEA 4HCCA 2IAJA 4F3OA 4M63C 3UKRA 4K42A 3DI6A 4H5WA 1JLEA 3O3GA 4K0KK 2VG5A 5HBMA 4DQQA 2Z1IA 1XQSC 3BGRA 1NLVA 3ASMA 4OO1J 1HNIA 4FK4A 5AQLA 1HYSA 3K5NA 3CJCA 3FLVA 4E7LA 3MWTA 3SUPA 2HB5A 3ZT4A 3FR0A 3R3LA 4I2QA 1NM1A 2KZZA 3VETA 2EWSA 1GC6A 5AQFA 3NH2A 2GV9A 1L3SA 1LWCA 3S3MA 5BR8K 3HP9A 5KQDA 3L2WA 4HUFA 2CQUA 4MO5A 3D2EB 1W2BM 4DV6K 2O8CB 4LFCK 5BPLA 4DHYA 1S5JA 5KQ8A 3KWGA 4I2PA 4B8CA 3L6QA 1NU0A 2BDPA 4DKWA 1GOBA 3OYAA 5AQQA 3VMFB 3G0ZA 3OYIA 3THYB 2E6MA 4J2EA 3KZBA 1JLCA 4LSNA 3CJ9A 1ZBHA 2OPRA 3BEXA 1SAZA 3FE1A 2B5JA 3AVFA 1I94K 1QZ5A 2YHYA 3DYAA 4CZHA 3M3ZA 1VQ7N 3CI5A 3QFPA 2HHSA 1W9HA 4FWPA 3A5MC 1C1CA 1TK5A 1P8ZA 4LSLA 3D45A 1QSSA 1RBRA 3QEVA 1RBSA 2HHXA 1IG9A 4WQ5C 1KFSA 1S9GA 1KAYA 4CEZA 2V51B 4DS4A 3T1HK 1NGIA 4QS9A 3OYBA 3WXLA 3I33A 2D0CA 3OYKA 3L3UA 4B9UA 4Z4GA 3HJFA 4FJ7A 4CEOA 3NVMA 3SPYA 3E9PA 2QWQA 3AVGA 4O5BA 3K57A 2OTLN 4DQPA 3HO1A 2XHBA 4I7FA 2GUIA 4BR7A 2EMTA 3DLEA 3HPGA 2IGIA 3PO4A 1CXUA 3JSMA 2D1KA 4JKHA 4IZ9A 4FYDA 1S1VA 3VQBA 4E3SA 1YVNA 3CFOA 3RWUA 4E7IA 3VOVA 1ST7A 3NGIA 3CCRN 4CJ3A 2ZWHA 4K25A 1RTJA 5FPMA 3H46O 3QBXA 3DM2A 3O4QA 1MWKA 3OBWA 4FJIA 4FVMA 4CD3A 4LFBK 4C8NA 4XEIA 2EX3A 4ZRIA 2A1SA 4FOIA 4JRQA 4FWQA 2RQ1A 5AQYA 1J53A 5JICA 4DF8A 4QAGA 4IKFA 4FZYA 1QHTA 4AH9A 4FVUA 4CJ4A 3KD1E 2YVCA 3SQ2A 3LZJA 1RTDA 4LF8K 4RW6A 4CJQA 4BR4A 4CGJA 3CG7A 1VQPN 2LBBA 2UUCK 1HKCA 1LCUA 1O13A 1GG3A 4FJ8A 1LWEA 3AA3A 1U04A 4BVPA 4AHSA 1GGOA 3G6EN 4CJRA 1X3MA 1JLQA 1A5WA 4CEQA 1KVAA 4CJKA 4OVLA 3Q7CA 1Y64A 5HP1A 3CHWA 3QNNA 4DWIA 3TAQA 4G1QA 3G71N 3SMSA 3VF6A 4FJGA 5KRSA 4Q0BA 3KLIA 3MXMA 1SL2A 1C1BA 4Z4HA 4GMJB 4CEDA 3DAWA 4BE1A 3TAFA 5AZIB 1LW2A 4FLVA 3NHGA 4ICLA 3U9ZA 4KTQA 3ZSYA 3OVNA 3H1VX 4DR7K 4CBXA 4KB1A 5AQGA 4XH1A 3B6OA 3OYLA 3THXA 1T6DA 5CY4A 3BDPA 3QMLA 4JI6K 1MDUB 1QE1A 5BRFA 2E6LA 4BACA 1V4SA 1VQ9N 3CPWM 4Y1CA 1NK9A 3OTOK 1LAWA 4FW2A 3TTDA 3DXKA 4BQLA 4DR6K 4H8KA 3VEXA 1S1UA 2FXUA 1RBVA 4DV4K 3DLBA 4NB4A 3H3OB 5DMRA 4ID1A 1SKRA 4BGAA 5J2QA 2E2QA 3A5LC 4DTUA 1BHLA 3ZT1A 1DGKN 5ADXH 4KTWA 1NGBA 3OJSA 4KO0A 3J7YP 2YNGA 3T19A 2COPA 5C25A 4LF6K 1NGCA 4DUZK 4KTZA 4A2BA 1C0FA 2P9LB 1FW6A 1NVLA 1WUAA 4F7GA 3MN7A 4QCLA 1JCEA 2O8BB 4KH5A 1ASVA 1QQCA 1S6PA 3HSCA 3KVGA 5CZ2A 3VEWA 4H0PA 3OYDA 1XI1A 1REVA 3H3NO 1EWQA 5LL6Z 1NJXA 1ATNA 4H4OA 3DWLA 3L0QA 1NBWA 3RR8A 1HKBA 1S3XA 1C0GA 4BRNA 1OH5A 1VQ6N 4F4KA 3MK6A 4BRGA 5HOOA 4DTSA 1QZ6A 1YF5L 4CJWA 4YOXA 4TSXA 4LF7K 3EZ5A 4NLCA 3RR7A 4AHRA 3C6TA 3L3VA 3F73A 5GINA 3OS2A 3T7ZA 5JS1A 1HMVA 4OGCA 2EMSA 4C8MA 3T69A 1RT7A 3WNEA 3PX6A 4JI8K 2AA4A 2OYQA 3O1BA 1IKVA 2KLAA 2QWNA 1N5YA 1OVYA 3PX4A 4C23A 4DLEA 5A2QO 4FLTA 3D2EA 3QEXA 3U4LA 3ZETA 4KV8A 1BISA 5EXWA 3W3DA 3ZT3A 3G25A 3I0SA 1BIUA 4NLBA 5IWAK 4E7JA 1Z6RA 4CFDA 3TSUA 4EHUA 3VQAA 1OKJA 4KI6A 3OYGA 2GTDA 3M8QA 5DK5A 4FCYA 2P1JA 2HHVA 4F3TA 3SBGA 3DLRA 1XNQK 3AVMA 3NVKA 4WFBL 4M3UA 4EP4A 1DTQA 4OPKA 2VWJA 3HL8A 4M3WA 1VQLN 2UXCK 5K14A 1EETA 3AO1A 2PBDA 4ZTFA 5AQKA 3P5JA 1XC3A 4CZJA 1MK7B 3E1YA 3IS9A 1ZC6A 2HNYA 4EFHA 2KQ2A 4RW7A 4NXMK 4LH5A 5LY3A 3RMCA 2PAVA 5KTQA 3HOTA 5KGWA 4B08A 1YXQA 2O4GA 4BC5A 5LJWA 4CHZA 1WSFA 2WONA 2RPIA 3EZWA 3QIOA 2QWPA 3CC4N 3U3GA 4B1VA 2FF6A 1XHZA 2PYJA 1C0MA 3H6EA 3TSPA 4CGIA 1X9MA 3P4IA 1B9DA 4BRFA 3NH1A 4BC2A 3QEIA 1KC8O 4GXBA 3KKSA 5F0XA 1BI4B 3RMDA 4PL7A 2P9IB 3O9QA 1OVQA 3O1WA 2HE7A 5JVLA 1YT3A 3DLKA 2P9IA 1Q9YA 2YI1A 2HSTA 3F2KA 4ELVA 2RF2A 1NGAA 3EL2A 4E89A 3HPOA 4YNQA 4ILHA 4DF4A 2PZSA 4CK3A 3BY5A 2NZTA 3SMPA 2B4JA 1RT6A 2YHXA 1RTHA 4GVMA 2FSKA 1JCFA 3I56N 2O8CA 4CEFA 2VG7A 1NK7A 2VQFK 2WFBA 4YDUC 1Q7YO 1YI2N 4J2DA 2HHUA 4CESA 5AZIA 3HPHA 4DR3K 2ABDA 2F8SA 3LDQA 1WAJA 3CPEA 1KAXA 4F8RA 1S1XA 1RT2A 1L3TA 3DMJA 5CHIA 4CJEA 4FLWA 3OY9A 3QDKA 4CJLA 3JYTA 4A5AA 3EE9A 4E1NA 2O8BA 4KHSA 4I9LA 1QVGM 3CC7N 3KD5E 4BDYA 3VERA 1SZ2A 4DUYK 4C8LA 4JI0K 4KHUA 5GADP 3O9TA 1HYZA 5M1OA 1JLGA 4IEEA 1Y97A 2RE2A 3U7DA 4OKJA 2OZMA 1EWRA 2Q0RA 3CQ8A 1EQYA 2FBXA 2HBKA 3MX5A 1DLOA 3QNOA 1UA0A 4IO9L 3CCJN 1OH8A 3ZETB 4DTXA 1NTIA 3O3HA 4GV6A 4MFBA 3N4PA 1YITN 1U48A 1YTUA 3AVIA 3THXB 1BU6O 2IVOA 1TKDA 1RT4A 3VF4A 4JEPA 4IG0A 4CIFA 5C42A 3VEVA 5F1XA 3C95A 2W40A 2UU9K 1VHXA 3SV3A 1XMQK 5FDLA 4CEEA 3MAQA 3LP1A 4B3RK 4DSLA 5BRDA 2YX6A 2HF3A 3M8SA 1NGJA 3ATUA 3KTQA 4KPYA 4CFBA 1S22A 3CYMA 1U45A 3MXIA 5HRNA 1Q82O 4AM6A 4BG8A 5E84A 5M1KA 1WBBA 3L2VA 3AY9A 4HDQA 3SK3A 4OPHA 2A41A 4KH6A 3LPUA 1CZBA 3IRXA 3JXUA 4Z4IA 1JXEA 2NLXA 3DLGA 3I8DA 4H4MA 4B1XB 3ATVA 4BRKA 3VQPA 4B9SA 1G15A 2KKZA 2ATQA 3TAPA 1TVRA 4H5NA 4DU1A 4OKKA 4M3ZA 1VQ5N 1B92A 4WYBA 4FPBA 2ITMA 1QHAA 4IFVA 3VQ5A 5JVGL 3MEGA 4CE9A 3R9PA 4B3MK 3LDPA 2R82A 2G8HA 1J19A 2ZQBA 3WXMB 4Z94A 3PSFA 4QS8A 2YCHA 3MN5A 5I3UA 1QVFM 2AJQA 4MO4A 5CYQA 2IS3A 4CFAA 3BF3A 2ZJRL 1RNHA 1JXBA 3AVKA 4H0TB 3CFRA 1VQ4N 1HPMA 1BCOA 4A5BA 1BI4A 4M45A 5J2PA 3UKUA 3HT3A 1NK6A 4CFCA 2P9UB 2QK9A 1VBHA 4EHTA 4I9QA 1KVCA 4O4GA 3CD6N 3EN9A 2IVPA 4W5RA 3A2FA 1KLMA 3FFIA 1JL1A 1HNVA 4NXNK 3KWIA 2G8FA 2AL6A 3V9WA 1N8RO 4CHNA 3HVRA 4WQ4A 3LAKA 2QM1A 3D7EO 2F96A 1S6QA 4JI2K 3L2QA 4MDAA 1X9JA 3I0RA 3NCIA 2HW3A 2YNFA 5AQJA 1XWLA 1GLDG 3OA9A 1VSFA 2FSNA 1ISNA 4JKDA 3O8MA 5DM7L 3LALA 1Z26A 4N56A 3OJUA 4B1WB 2XY6A 1BQMA 1N33K 2A3ZA 2ETJA 3IKMA 2HHHK 2P5GA 3L8BA 3A5NC 4C1NK 1NI2A 4FM0A 1VSIA 3HYFA 2HBJA 1RGIA 4H0VB 1SS6A 2IC3A 4KB0A 3TAGA 2EHGA 5C15A 2E5LK 3DOLA 4A59A 3NGYA 3VQ8A 1XNRK 3OYJA 4JHDA 5J2NA 4BRMA 4CK2A 3ZSZA 1XC9A 1EKEA 3V1QA 5AQMA 4BE2A 4AHUA 3ZX3A 5GIPA 2NRWA 5AQIA 4WCEL 4DFKA 4ISEA 2YNHA 4CZGA 2YHBA 3IDHA 3KJVA 3MMVA 3V81A 1QSLA 2FSJA 2KFNA 2A42A 2W6KA 5E41A 3WNHA 3JS6A 1BL3A 3MEEA 4CJPA 4JS4A 3VTHA 3LDLA 5GAEP 4DSEA 3PUFA 3H1QA 4U7BA 1VQ8N 2HMIA 2YJEA 1RDWX 1JL2A 3CM5A 3HK2A 2HF4A 1HR0K 1NG9A 4JHDB 1QTMA 1FKPA 4H0XB 1D4XA 4FO0A 1RDCA 3V9ZA 3CFPA 4DCHA 4AM7A 2E2NA 1TL3A 1NK5A 3V1OA 2NUBA 4CBWA 2P9KA 1W7AA 4AF1A 3TI0A 3SAHA 4DFPA 2ZPYA 4JKFA 2X78A 4HHTA 3SLCA 3KK1A 4PUOA 3GL1A 4ILJA 4BC3A 4F2RA 4IO8A 5IJMA 4FZXC 3VEYA 1HB6A 2O8DB 4B3SK 1HX1A 4RCHA 4RG8A 2QXFA 3RTVA 3SI6A 3HRGA 4FK0A 2J0MA 1KC7A 1VSLA 3NMUA 1C0TA 2I1JA 1X9SA 1JLAA 2WTUA 2X6NA 1FKOA 4BC4A 1J6ZA 3AVLA 4GVEA 2AEHA 1YVUA 4BE0A 2IIRA 2Q36A 3T1YK 5D3GA 4CZEA 3ITHA 4CJ5A 1T7PA 1DEJA 2VCPA 2X74A 1M1KO 1JLFA 3AA5X 3TAMA 3LP3A 2FC0A 1RCHA 4CZLA 3AA2A 4DV1K 2E4LA 5AQTA 1HB8A 2DPNA 2ZGYA 5HROA 2P51A 3AGRA 4FW1A 4BROA 3WQTA 2GUPA 1VQON 3TTCA 5DM6L 3MCAB 4I6MB 3AGKA 1RT5A 3K5OA 3RRGA 3TU5A 4CGHA 4CF2A 4TKNA 2CGJA 5HRSA 4IXCA 5AQVA 3THYA 4BRLA 4HCBA 4U67L 4DU4A 4JKAA 4OGEA 3DJCA 1HNZK 2F8TA 3HOSA 4YOVA 1E4FT 4FWMA 3CF5L 4DTJA 1GLBG 5FRMA 4JKGA 4XH5A 1KBLA 3SQ4A 1SQKA 3K0SA 4CZIA 4IOXA 1VRUA 4CIEA 3NFAA 2HHWA 2DY4A 3I8BA 4KRFA 3AO4A 3U8XA 3ULDA 5SZTA 3EPYA 1VQKN 3R1XA 3O08A 4GV3A 4H5RA 1LAVA 2QTDA 4ELUA 2YKMA 3V1RA 3U9DA 3K2PA 4Z0UA 1NJIO 1GLEG 3ZT2A 1ZBSA 3VQCA 3TANA 3SJHA 4GW6A 4FLZA 2J0JA 4QS7A 5AFUH 3V9SA 3FFKB 4GNIA 2IDOA 4JKEA 4DQ8A 3VF2A 3CJAA 4C1NI 4JI4K 2I7PA 1SKSA 3QIPA 3C65A 4DR2K 3AAQA 3OYEA 4IJNA 5AZJB 2P9SA 3CCEN 3CCUN 3WUHA 3V6DA 2P9NA 5T7BA 4JYAK 4FXDA 2QI2A 4LD0A 1NKBA 4Y0WA 3VEOA 3H08A 2YNIA 1Z25A 4BRCA 4A2AA 1T44A 3AARA 3MCPA 5CR4A 3VQ9A 1OH6A 3T1AA 1TL1A 4Z4FA 3D0PA 3AVAA 5GAHP 3PX0A 4JRPA 1ATSA 3GOIA 4CGDA 2OANA 5M1FA 5HLFA 3PSIA 1O1WA 1SUQA 5JLHA 5GAGP 4AQYK 4L3QA 4N76A 4P7IA 4JN4A 1BQNA 3IAYA 3ZDTA 1KSPA 2HBLA 4UY8O 3ZYYX 3JAMO 4O8UA 4BRHA 1VRTA 2QEXN 5M1QA 1ZXOA 5CYMA 4FJXA 4JV5K 2PYLA 4GKKK 3PY8A 1GOAA 1RT1A 5M1PA 1K6YA 1SL0A 1TKZA 4KI4A 3HBTA 5EY4A 4EAHD 3ULEB 1YJNN 3F9KA 2G8IA 2BH1A 5C0YA 3SBTA 3OYHA 3S9HA 2V7ZA 3LM2A 1L3VA 3ZSXA 5BREA 1U47A 3AVHA 2D4WA 1WOQA 3O9RA 4V19S 2D0PA 3LP0A 5AQXA 3EY1A 4NY0A 5BPNA 4YOUA 2WBNA 4DQRA 1TKXA 4JAXA 4K43A 3DOKA 2B6AA 5HRRA 4JD2B 3O9UA 3TAEA 1ASWA 3J7ZO 1Q18A 1IKXA 1JDEA 4BR9A 1YIJN 4DU3A 4K8XA 1RILA 4DQIA 4JK8A 1NOYA 3ENHA 3EYZA 3CM6A 4CZKA 3A5OC 1IJJA 5EOYA 3RSEA 2E20A 2E8AA 3RRHA 4FWRA 3ENBA 3TTFA 4CECA 2FLOA 3PO5A 3LZIA 2GELA 3ENOA 4NYNA 1E5WA 1U6ZA 5BPMA 5EVZA 3VQ7A 3V9UA 4FJJA 4GV9A 5J1EA 3C7NA 3LPTA 2UYTA 3CJBA 3HZ6A 1WN7A 3FLCO 1K8KA 2O8FB 4FM1A 4BDPA 1RT3A 3WXIA 1JKHA 4QOZB 4DFJA 2G8UA 3DXMB 2OA8A 1LWFA 4J2AA 1VSJA 2VWKA 1DTTA 4H03B 1VSKA 1U2VB 2KHOA 3SNNA 4MLHA 4CW7B 3OYCA 2P9PA 4PKGA 4BRPA 3S41A 4AHCA 3K59A 4O0JA 3ZSWA 4NO7A 4KHQA 2OCEA 2G8KA 5AJ3K 3P1GA 4OLBA 1ZBUA 5AQZA 5CE3A 4JI3K 1ILYA 4YORA 4CVNE 3P38A 3CCVN 4LFAK 3LANA 3ZX0A 2G8WA 3J7AP 1M90O 2E2PA 4CJSA 3EE8A 1LW0A 3AU4A 4ID5A 2ZF5O 2A6AA 4LF4K 2JGUA 1NMNA 4DR1K 1R0AA 1VSEA 4PQUA 2X6SA 1JJ2M 4FLUA 3OHRA 3O3FA 1MWMA 4JK7A 5ADXA 3L2RA 3KLHA 3AO3A 4L8RB 1RDUA 3B8AX 4DS5A 1X3NA 5GIOA 3R8EA 3DLLL 1BWFO 4IOCL 1HQUA 5TKWA 2WOMA 2CGKA 3D2FB 4DV3K 4KHYA 5H1SQ 3M8PA 1VSHA 3BF1A 4FLYA 4C8OA 3LWLA 4CJUA 1QSYA 4RW9A 1S72N 3O4WA 2E2OA 1HUXA 1NGHA 3TWHA 3C7NB 2YJFA 4Z4CA 3IUCA 4ISFA 5C24A 1NKCA 2KFZA 4DTOA 4NCGA 4NYFA 3MXJA 3PLAA 2BUPA 2UXDK 5FPDA 2OTJN 2HVIA 4CJVA 5HL7L 1E4GT 1KFDA 4HWIA 4X62K 4BRQA 1HBKA 3RSEB 3MN6A 3VEZA 3P39A 2WUSA 2DFFA 4H5VA 4DSIA 3VN5A 4JKBA 1C1AA 4CF1A 1H1VA 5FPNA 1UOCA 4IFEA 5LJVA 3QIJA 4BQZA 1WBDA 4OLAA 1GLAG 2HHQA 4DLGA 3CCSN 3IG1A 1EP4A 2GEMA 2NRHA 1SV5A 3ZX2A 4EP5A 1LOTB 4B1ZA 1S1TA 4K41A 4DB3A 1TUUA 1TAUA 4W5TA 2VWBA 3TR8A 3WEEB 3VPZA 3VENA 4CEBA 4CGGA 1N36K 1ATRA 3WQUA 2D5RA 1BCMA 5AQNA 4ZRKA 1IG8A 3NF6A 4IG3A 3NF8A 4ZTJA 4JI1K 3VQ4A 3SQ0A 5FRNA 3BZCA 3K58A 1BG3A 4B9TA 4K8ZA 4HDOA 2YKNA 2DFHA 2DIKA 2KW4A 1WSGA 4H0YB 3VGMA 4WQ4C 1HNXK 3IVFA 3DLHA 4CF8A 2D11A 4ELTA 1WSIA 4EZ9A 3OYMA 3ID6A 3WXKA 2P9KB 1D9FA 3D2FA 1HJRA 3VGKA 1RBTA 3ZEUB 4B9VA 3BUZB 2A1RA 1WSHA 2RKIA 1TUYA 2OZSA 1BGXT 4FWNA 1QQMA 4RWTA 2NRTA 4YOYA 1Q86O 2HVHA 1W0HA 1TK0A 3BZKA 3UKRB 4WFNL 3SPZA 4CF0A 2Q97A 1BDGA 4B8AB 2XY7A 4DSKA 4OX9K 3EEQA 1KAZA 3T3FA 3WNGA 5BN9A 4E1JA 4H0OA 4HTUA 1IBMK 1Q81O 3ISNC 3OYFA 4FLXA 2D2QA 4AILC 3AU5A 4M41A 4GY2B 3QB0A 4CZMA 4FSVA 1IBLK 4B9NA 3WXJA 1OH7A 3HTVA 3ZLJA 2O8EA 4A57A 1UWBA 2NRVA 4B1UB 3KK3A 4E1MA 3NF7A 3ZEUA 5KPZA 4M3YA 3PVLA 3Q7BA 4JI5K 1HNWK 2VGMA 3KLFA 3P31A 2PFUA 2Z1GA 2DTUA 3CCMN 1VAZA 3SYZA 3R6MA 4E0DA 1MA9B 4YDUA 4FPAA 3KK2A 2DFEA 1NJWA 3TSQA 4FOEA 4YOWA 3F5TA 1HLUA 5HRPA 3G10A 1RFQA 1BA0A 3BINA 1J5EK 3O80A 4CERA 3QO9A 4B3TK 5C10A 5KGXA 1J9AA 3C94A 4WFAL 1X9WA 4MQ3A 4NCAA 3WT0A 4DQSA 1NGGA 1BUPA 1K8AO 1TYQB 3HSTB 3MEDA 4PHTX 3ZT0A 1U49A 2CH6A 3K5LA 1TAQA 5JMVA 4ZRJA 4FL9A 3V9XA 3FZKA 2V52B 4HUGA 3DRPA 3QEWA 4IDHA 3AAPA 3OS0A 2XY5A 3QBWA 4X65K 3KHYA 4H5TA 1NJZA 1YUWA 1Y19B 1CXQA 4HVJA 1RDDA 2Y1JA 2ZGZA 3WNFA 4JI7K 1I39A 4CGFA 5LMNK 5AR0A 2IVNA 3QERA 2I7NA 1N6QA 2QKBA 4RW8A 1RBUA 3HP6A 1MIZB 4ILGB 2WC9A 1VQNN 3ALYA 4CJFA 5LMUK 4R5PA 3C6HA 4DV0K 4FJ5A 1E3MA 2GWKA 1UAXA 3S3NA 4IFYA 2YV0X 3GE1A 4OPAA 3LDSA 2RN2A 3M6GA 4WE1A 3THWA 2NRRA 3O4NA 4O55A 5JS2A 3E01A 4Y1DA 4CD1A 2XY8A 4O8KA 3VTIA 3LP2A 4O5FA 5TKYA 4FJNA 4DV2K 5F2RA 4CEAA 1TK8A 1UA1A 3ZSVA 1ZBLA 3UIQA 3ZSRA 1A5VA 3K9JA 4FWSA 4JS5A 3NH0A 1TV6A 3P83D 3THVA 3L2UA 2BGGA 2O8EB 1KCFA 3NGZA 3LWMA 4DV5K 1D9DA 4FWLA 1K73O 3X23A 3ZCMA 4DR4K 3VQ6A 4FJLA 3NBPA 1NK8A 2A40A 3MDQA 5B8HA 3SAGA 1DT9A 4FJHA 4EKUA 2JLEA 2QWRA 3CC2N 2ZM6K 3CMEN 1SKWA 1J54A 3IFRA 4X64K 2QWOA 2NRZA 4JKCA 2NNWA 4LF5K 5EX5A 3K9KA 1NOZA 2QW9A 3QINA 4IEIA 4CBUA 3OYNA 1HYVA 4O44A 4JK9A 4BWMA 4BR5A 4EIAA 5FPEA 3SQ1A 2UUBK 1V4TA 4NCBA 2D0BA 1IH7A 3OS1A 2I1KA 5FROA 2UUAK 3AO2A 1T6CA 3UB5A 3LL3A 3RMBA 4FWOA 2W42A 4M3XA 4BR0A 2BANA 3PIOL 1NNEA 4DTMA 2XO7A 1YTAA 1GLJO 2Q31A 5EU7A 3KLEA 1FK9A 3VQEA 4OKEA 4B9MA 4B9QA 4RTFD 1ZBFA 3AA4A 4IBNA 4KKOA 2ZJPL 4BRIA 1S9EA 4AHTA 2HBMA 4DSJA 2KZMA 3GDQA 3FZMA 1NKEA 1X1PA 1CZ9A 1HQEA 5KI6A 1NK4A 4KHWA 1DKGD 3KIOA 5AQRA 3VQQA 2J4RA 4CJTA 4DMNA 3KLGA 3MWPA 3ZSQA 3AO5A 4BWJA 1N32K 4IJAA 3CCLN 4DV7K 2UXBK 2H3GX 4Z4EA 1VBGA 3CJ1A 1JLBA 2HMPA 3KKRA 1NGEA 3MX2A 5KRTA 3IMXA 5I42A 4B9LA 2QKKA 2Q3SA 2A5XA 2D10A 3A8YA 2GWJA 2WH5A 4DFMA 2PY5A 1ZBIA 1TYQA 5J2MA 4PKIA 3FZHA 3E9OA 2VG6A 4KHNA 3G9WA 1WLJA 3C6UA 1WAFA 4BRDA 1YJ9N 4CHPA 2VQEK 1BOTO 1HJOA 3ZSOA 2V7YA 5CZ1A 1J5OA 2Q2RA 3FZFA 1EF1A 1SL1A 3SCXA 3EO3A 4A61A 2QWMA 1BIZA 4KHPK 1VK0A 3NDKA 1WNSA 1GC7A 2Z1JA 3MN9A 4HUEA 4KBOA 3U8ZA 5JLFA 3M1FA 4J8FA 4BRAA 2FF3B 2CB8A 4CF9A 3EKSA 5SWMA 3CMAN 4PL8A 4RW4A 3SUQA 4G9ZA 4CHQA 3LAMA 2ITGA 3PZDA 1W97L 4E19A 3N4QA 3AV9A 2Y1IA 3OW2M 4E7KA 2ASMA 4N5SA 1QQNA 2P9UA 2HRJA 4PWDA 4YL8A 5JVHL 1N34K 3C6AA 1YHQN 1Q9XA 3TARA 1GLLO 3B6PA 3SV4A 1U4BA 1BO5O 2X0SA 3WA0A 4KFBA 4ZHRA 4BGBA 5C2DA 5KPRA 4DXAB 5C12A 3VESA 4M7XA 5ELZA 2QA4N 1VSMA 3FGUA 2QXLA 3FZLA 4N41A 3QETA 3RVCA 4OPJA 4WF9L 3QEPA 2ASOA 2CGLA 3CQYA 1L5UA
chains in the Genus database with same CATH topology
1RGIA 4H0VB 3G71N 3CCSN 1SS6A 2GEMA 2YHWA 3SMSA 2NRHA 3VF6A 4LC9B 3OBYA 3ZX2A 2AP1A 1LOTB 4B1ZA 4K41A 4DB3A 5C15A 4A59A 4XH4A 4BY9C 1TUUA 4JHDA 3PIPL 4BRMA 2VWBA 1CZAN 3WEEB 3DAWA 2E88A 3VPZA 3VENA 5AQMA 3EKUA 5AZIB 1ATRA 3ZX3A 3WQUA 5GIPA 1ESVA 3U9ZA 2NRWA 5AQIA 3L4QA 5AQNA 4CJ7A 4ZRKA 1K8KB 4ISEA 4CZGA 1IG8A 2W41A 3H1VX 3IDHA 3MMVA 1YJWN 2FSJA 4CBXA 2A42A 5AQGA 3JS6A 1NGDA 1JCGA 1T3VA 1KD1O 4XH1A 1T6DA 5AFUA 3VTHA 3LDLA 3QMLA 5GAEP 1MDUB 1BG3A 5BRFA 1DIKA 3G4SN 2P9LA 3H1QA 4HDOA 5MLCQ 4U7BA 1VQ8N 1V4SA 2DIKA 2YJEA 1RDWX 3CPWM 1VQ9N 2F9TA 2CH5A 4H0YB 2ASPA 2HF4A 3TTDA 3DXKA 4BQLA 3VGMA 4WQ4C 2J0KA 3IVFA 4JHDB 2D11A 5AQWA 4I6MA 5E26A 3VEXA 1H4RA 2FXUA 3F9MA 3WEEA 4H0XB 1D4XA 3ID6A 3WXKA 4FO0A 2P9KB 3H3OB 4NB4A 4DCHA 5M1NA 4AM7A 3D2FA 2E2NA 2D0OA 3VGKA 4BGAA 3ZEUB 1MIXA 2E2QA 3A5LC 3W0LA 1HKGA 4CBWA 2P9KA 3LDOA 2FDQA 3BUZB 3QFUA 1DGKN 4AF1A 5ADXH 2QWLA 1TUYA 3SAHA 1NGBA 2ZPYA 4JKFA 4JD2A 3SAFA 2COPA 4FWNA 4HTLA 1QQMA 3SLCA 2NRTA 4RWTA 4YOYA 1Q86O 3GL1A 1NGCA 4ILJA 2E1YA 4BC3A 4IO8A 1C0FA 4A2BA 5IJMA 2P9LB 3VEYA 1NVLA 1WUAA 3LM9A 4F7GA 3MN7A 1HB6A 1JCEA 1HX1A 3LDNA 4RCHA 3UKRB 4KH5A 4PKHA 4WFNL 3HSCA 3KVGA 2Q97A 3HRGA 3VEWA 4H0PA 5KPTA 1BDGA 2J0MA 1KC7A 3J8AA 4YOTA 3CIPA 3NMUA 3H3NO 4JNEA 2I1JA 3KK7A 1KAZA 5BN9A 1ATNA 2JWLA 3DWLA 4E1JA 3CERA 4H0OA 1J6ZA 3L0QA 4BC4A 5I9EB 1Q81O 1NBWA 3CQXA 4GVEA 1G99A 2AEHA 2D2QA 3AU5A 2IIRA 1HKBA 2Q36A 1S3XA 4GY2B 1C0GA 4BRNA 3QB0A 4CZEA 4CZMA 4FSVA 4F9OA 1VQ6N 1DEJA 2VCPA 2P9PB 3MK6A 4BRGA 3WXJA 5HOOA 3HTVA 4A57A 1M1KO 4B1UB 2NRVA 1QZ6A 1YF5L 4YOXA 4CZLA 3ZEUA 4NLCA 5KPZA 3DXMA 5AQTA 3PVLA 1HB8A 1BA1A 2DPNA 2ZGYA 3Q7BA 3AGRA 4BROA 4BR2A 3WQTA 2GUPA 2VGMA 1VQON 3TTCA 3O6WA 3P31A 5GINA 3MCAB 5DM6L 2PFUA 4I6MB 3AGKA 5BRHA 3CCMN 1VAZA 3T7ZA 3R6MA 3CJ7A 1MA9B 1YAGA 2EMSA 3TU5A 2ZJQL 4YDUA 4FPAA 3T69A 2Q1NA 4TKNA 3GBTA 1SGHA 2CGJA 2AA4A 2E1ZA 4IXCA 3UE5A 5AQVA 3O1BA 4FOEA 1QQOA 2KLAA 3TSQA 3F5TA 3CETA 1HLUA 2QWNA 4BRLA 4YOWA 1OVYA 1P90A 3BP8A 4CYEA 4U67L 4C23A 4JKAA 3I55N 1RFQA 1BA0A 3DJCA 3D2EA 3HI0A 1MK9B 3BINA 2P9NB 3O80A 3HOSA 4KH4A 2GX9A 3D6RA 1K9MO 2FJ9A 3U4LA 3ZETA 5C10A 4YOVA 4WFAL 2BTFA 4A62A 1E4FT 4FWMA 3CF5L 2P9SB 5EXWA 3HM8A 3WT0A 3O5BA 1GLBG 5AZJA 3W3DA 1NGGA 3G25A 4JKGA 1BUPA 4NLBA 4XH5A 1K8AO 1KBLA 1TYQB 1Z6RA 4PHTX 1SQKA 1Z05A 3TSUA 4CZIA 2CH6A 4IOXA 5AQSA 4EHUA 1OKJA 1ACAA 3I8BA 1KXPA 2GTDA 5JMVA 4ZRJA 4FL9A 3FZKA 2V52B 3U8XA 1VQKN 3EPYA 3R1XA 3GG4A 3O08A 3AAPA 3SBGA 4IDHA 3NVKA 4WFBL 4H5RA 3QBWA 4GV3A 2NRXA 3E9LA 3KHYA 2QTDA 4H5TA 3M5RA 3VGLA 1VQLN 3L4IA 1YUWA 1Y19B 2PBDA 2JWKA 1NMDA 2ZGZA 3U9DA 3CXCM 5AQKA 1XC3A 4CZJA 4MDBA 1XUPO 1MK7B 3E1YA 4EFHA 1ZC6A 1U2VA 1NJIO 1KQSM 1GLEG 5AR0A 4BREA 1ZBSA 5LY3A 2IVNA 3SJHA 2I7NA 2PAVA 2J0JA 3HOTA 4QS7A 5AFUH 2VGNA 3FFKB 1R59O 1MIZB 4ILGB 4JKEA 1YXQA 2WC9A 4GNIA 4BC5A 4CZFA 4DQ8A 5LJWA 3VF2A 3CJAA 5AQOA 4C1NI 1VQNN 2I7PA 3C6HA 3EZWA 4IWVA 5C2FA 2QWPA 3C65A 3CC4N 1EO1A 3AAQA 4JKGB 1GLCG 4B1VA 4IJNA 3E66A 1GLFO 2GWKA 5BR9A 1NWKA 4R79A 5AZJB 2FF6A 2P9SA 3CCEN 3CCUN 3WUHA 3H6EA 3GE1A 3TSPA 4BVOA 2RHKA 3P4IA 4OPAA 2P9NA 4BRFA 1KC8O 4BC2A 2QI2A 3O9SA 4GXBA 5AQUA 3M6GA 1VQMN 4Y0WA 4BG9A 3VEOA 2NRRA 5F0XA 4BRCA 4PL7A 2P9IB 3O9QA 4A2AA 3O1WA 1T44A 3AARA 3UKUB 2HE7A 3MCPA 5CR4A 4CD1A 4O8KA 5JVLA 3VTIA 4CI6A 2P9IA 3C0BA 2YI1A 2HSTA 4O5FA 5AQPA 3F2KA 5TKYA 3TPQA 5GAHP 1ATSA 3GOIA 2OANA 4WQ5A 1NGAA 5BN8A 3EL2A 5M1FA 4FWKA 5F2RA 5JLHA 3DXKB 4ILHA 5GAGP 4M7YA 4L3QA 1NGFA 4P7IA 4JN4A 2NZTA 3K9JA 4FWSA 3SMPA 4B1YB 3ID8A 3ZDTA 2YHXA 2FSKA 1JCFA 2HBLA 3I56N 4ISGA 4UY8O 3ZYYX 2Q0UA 2VYPA 5AQHA 4IOAL 4O8UA 4BRHA 2QEXN 3FP5A 2WFBA 4FWLA 2F9WA 4YDUC 1K73O 3H45C 5M1QA 2HOEA 3X23A 3A0IX 1YI2N 1Q7YO 1ZXOA 3QICA 4MLEA 5AZIA 2F7TA 3ULEA 2A40A 2ABDA 3LDQA 3MDQA 5B8HA 5M1PA 3SAGA 1DT9A 3CPEA 1KAXA 4M63C 3HBTA 5EY4A 4EAHD 3ULEB 1YJNN 5CHIA 4EKUA 2BH1A 2QWRA 5C0YA 3SBTA 3CC2N 3UKRA 2V7ZA 3QDKA 3CMEN 4K42A 4H5WA 3IFRA 3LM2A 5BREA 2QWOA 4A5AA 2NRZA 3EE9A 2D4WA 1WOQA 3O9RA 2D0PA 5AQXA 4JKCA 4NY0A 1QVGM 3CC7N 2NNWA 5BPNA 3VERA 1XQSC 4YOUA 1SZ2A 3K9KA 4IEIA 1NLVA 2QW9A 2WBNA 5EX5A 5GADP 3O9TA 4JAXA 4K43A 5M1OA 4CBUA 4JD2B 3O9UA 4IEEA 4OO1J 4JK9A 2RE2A 4BR5A 4EIAA 5FPEA 1Q18A 3J7ZO 1V4TA 1JDEA 3U7DA 5AQLA 4BR9A 1YIJN 2I1KA 3CJCA 2Q0RA 3FLVA 1T6CA 3MWTA 1EQYA 3LL3A 3UB5A 4JK8A 2HBKA 3ENHA 3MX5A 4FWOA 4CZKA 3A5OC 4BR0A 3FR0A 3PIOL 3R3LA 1IJJA 4IO9L 1NM1A 5EOYA 3RSEA 3CCJN 3VETA 2EWSA 2E20A 3ZETB 1GC6A 2E8AA 5AQFA 1GLJO 2Q31A 1NTIA 4FWRA 3ENBA 3TTFA 4B9QA 4GV6A 5KQDA 2CQUA 2FLOA 4RTFD 2GELA 4MO5A 3D2EB 3ENOA 3N4PA 1YITN 1W2BM 1E5WA 1U6ZA 5BPMA 5EVZA 5BPLA 4DHYA 2ZJPL 5KQ8A 3KWGA 4GV9A 4BRIA 1BU6O 2IVOA 2HBMA 3C7NA 3L6QA 3VF4A 4DKWA 2UYTA 4JEPA 3CJBA 3HZ6A 3GDQA 3FLCO 1K8KA 3VEVA 5AQQA 3VMFB 5F1XA 3FZMA 3WXIA 2W40A 1DKGD 3KZBA 5AQRA 3DXMB 2J4RA 3CJ9A 4H03B 5BRDA 2YX6A 1U2VB 2KHOA 3BEXA 1SAZA 2HF3A 3MWPA 1NGJA 3FE1A 4MLHA 3ATUA 2P9PA 4PKGA 4BRPA 3S41A 1QZ5A 2YHYA 4IJAA 3CCLN 4CZHA 1S22A 3M3ZA 1VQ7N 2H3GX 4NO7A 3CI5A 1VBGA 3CJ1A 3QFPA 1Q82O 4AM6A 2HMPA 5E84A 4BG8A 5M1KA 1NGEA 4FWPA 3MX2A 3IMXA 3AY9A 4HDQA 3SK3A 4WCEL 3A5MC 5AQZA 4OPHA 1P8ZA 2A5XA 5CE3A 2A41A 2D10A 3A8YA 4KH6A 1ILYA 4YORA 2GWJA 4WQ5C 3P38A 3CCVN 1KAYA 3JXUA 2WH5A 2V51B 3ZX0A 1NGIA 1M90O 2E2PA 4QS9A 2NLXA 1TYQA 3EE8A 3WXLA 4PKIA 3AU4A 3FZHA 2ZF5O 2A6AA 3I33A 4B1XB 3E9OA 3ATVA 4BRKA 1JJ2M 2KKZA 3OHRA 3G9WA 3NVMA 1MWMA 4H5NA 3E9PA 4JK7A 2QWQA 5ADXA 2OTLN 1VQ5N 4BRDA 1YJ9N 4WYBA 4FPBA 2ITMA 4BR7A 1QHAA 1BOTO 2EMTA 5JVGL 1HJOA 1RDUA 3R9PA 3B8AX 3LDPA 2R82A 1X3NA 5GIOA 1J19A 3R8EA 2D1KA 4JKHA 4IZ9A 2V7YA 3WXMB 4Z94A 3DLLL 1BWFO 4QS8A 4IOCL 5TKWA 1YVNA 2Q2RA 2YCHA 3FZFA 3VOVA 1ST7A 1EF1A 3CCRN 2CGKA 2ZWHA 3MN5A 3D2FB 4K25A 3EO3A 4A61A 2QWMA 5FPMA 5H1SQ 3H46O 1QVFM 3QBXA 3BF1A 4MO4A 1GC7A 3MN9A 3BF3A 4KBOA 2ZJRL 3U8ZA 5JLFA 3M1FA 1MWKA 3OBWA 4J8FA 4BRAA 4H0TB 2FF3B 4CD3A 1VQ4N 2CB8A 1HPMA 3EKSA 4A5BA 4XEIA 4PL8A 3CMAN 3O4WA 1S72N 2E2OA 1HUXA 4G9ZA 1NGHA 4ZRIA 3UKUA 4FOIA 3C7NB 2YJFA 2P9UB 1VBHA 4FWQA 1W97L 3PZDA 4EHTA 2RQ1A 5AQYA 5JICA 3N4QA 3IUCA 3CD6N 3OW2M 4FVUA 2YVCA 3EN9A 2IVPA 4ISFA 2ASMA 3KWIA 1QQNA 2BUPA 3PLAA 2AL6A 2P9UA 2HRJA 5FPDA 1N8RO 4YL8A 4BR4A 5JVHL 1VQPN 2OTJN 2LBBA 4WQ4A 3C6AA 3CCQN 1YHQN 2QM1A 3D7EO 1E4GT 1HKCA 5HL7L 4HWIA 4BRQA 4MDAA 1HBKA 3RSEB 1LCUA 1X9JA 3MN6A 1GLLO 3VEZA 3P39A 1O13A 1GG3A 5AQJA 2WUSA 1GLDG 1BO5O 2X0SA 3OA9A 4H5VA 3WA0A 2FSNA 1ISNA 4JKBA 4JKDA 3O8MA 4BGBA 4BVPA 5DM7L 1H1VA 1GGOA 4B1WB 5FPNA 5C2DA 5KPRA 3G6EN 4DXAB 5C12A 1X3MA 4IFEA 3VESA 4M7XA 5LJVA 5ELZA 2A3ZA 3QIJA 2QA4N 3IKMA 3FGUA 4BQZA 2QXLA 3FZLA 1GLAG 3Q7CA 3A5NC 4C1NK 1NI2A 3RVCA 4WF9L 2ASOA 1Y64A 2CGLA 3CQYA 3CHWA 2HBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  3E9P A;  4JK7 A;  4ILH A;  4JKG A;  4JK8 A;  3SBT A;  4ILJ A;  4JKB A;  4JKD A;  4ILG B;  4JKH A;  4JKE A;  4JKC A;  4JKA A;  3SBG A;  3ENB A;  3E9L A;  4JKG B;  3E66 A;  3E9O A;  4JK9 A; 
#chains in the Genus database with same CATH topology
 2FBV A;  2YHW A;  1EX4 A;  1IO2 A;  4LC9 B;  3OBY A;  3PV8 A;  1KRP A;  4YFU A;  1F21 A;  2AP1 A;  2GBZ A;  4XH4 A;  4CK1 A;  4BY9 C;  1KVB A;  3PIP L;  4PA1 A;  1IV0 A;  1CZA N;  2E88 A;  3EKU A;  3THW B;  5FLX O;  1ESV A;  3L4Q A;  4CJ7 A;  1K8K B;  2O8F A;  2W41 A;  1YJW N;  4W5Q A;  4EZ6 A;  1NGD A;  1JCG A;  1T3V A;  1KD1 O;  4X66 K;  4J2B A;  4FK2 A;  2I5J A;  1L3U A;  5AFU A;  2IOC A;  3G4S N;  1DIK A;  4LF9 K;  2P9L A;  5MLC Q;  2FBY A;  1C0U A;  1D8Y A;  3RMA A;  1MU2 A;  2CH5 A;  2F9T A;  3MEC A;  2ASP A;  4JLH A;  2J0K A;  4CHY A;  5AQW A;  4I6M A;  5E26 A;  1H4R A;  3NAE A;  3F9M A;  3WEE A;  1EXQ A;  4AHV A;  5M1N A;  2D0O A;  1MIX A;  4GKJ K;  3S3O A;  3W0L A;  1HKG A;  3NE6 A;  3LDO A;  2FDQ A;  2XRI A;  3QFU A;  1D5A A;  1XMO K;  2QWL A;  4KAZ A;  4JD2 A;  4XIU A;  2YHA A;  3SAF A;  4HTL A;  2E1Y A;  1TGO A;  1XHX A;  1T05 A;  3LM9 A;  2HHT A;  3LDN A;  2P5O A;  4PKH A;  3J80 O;  3QLH A;  1B9F A;  3HM9 A;  4DTR A;  3M8R A;  4CHO A;  2BE2 A;  3U3Y A;  5KPT A;  2R7Y A;  4YOT A;  3J8A A;  3CIP A;  2OPQ A;  4UQG A;  3SZ2 A;  4JNE A;  1KLN A;  2F4V K;  4F2S A;  3KK7 A;  1T8E A;  3SJJ A;  2JWL A;  3CER A;  4LH4 A;  5I9E B;  3CQX A;  1G99 A;  4YHH K;  4N47 A;  1ITG A;  4M42 A;  4F9O A;  2P9P B;  2O8D A;  1A5X A;  1IKW A;  3QES A;  1NJY A;  4W5N A;  2O4I A;  1NK0 A;  5IT9 O;  4DG1 A;  1ZYQ A;  3AVJ A;  3DXM A;  1BA1 A;  4BR2 A;  3V4I A;  3O6W A;  1KTQ A;  4OJR A;  1ASU A;  5BRH A;  3CJ7 A;  4W5O A;  1VSD A;  1YAG A;  2ZJQ L;  2Q1N A;  3GBT A;  1SGH A;  2E1Z A;  3K5M A;  3UE5 A;  3DRS A;  3SUO A;  1QQO A;  3CET A;  2Z1H A;  2W6L A;  1P90 A;  3BP8 A;  4CYE A;  4FM2 A;  3I55 N;  1RDB A;  1I3A A;  1TKT A;  1S1W A;  4B3O A;  3HI0 A;  1MK9 B;  2P9N B;  4KH4 A;  2GX9 A;  3AVN A;  3D6R A;  1K9M O;  2FJ9 A;  4FJM A;  1CLQ A;  2BTF A;  4A62 A;  2P9S B;  3HM8 A;  3O5B A;  5AZJ A;  4YY3 K;  4DR5 K;  4DTP A;  2OPS A;  4KRE A;  1Z05 A;  5AQS A;  4IDK A;  1ACA A;  4M3R A;  1IBK K;  1KXP A;  4LY7 A;  3GG4 A;  4DTN A;  2HNZ A;  2NRX A;  3E9L A;  4PY5 A;  2KTQ A;  3M5R A;  3VGL A;  3L4I A;  2JWK A;  1NMD A;  1RDA A;  3CXC M;  4E7H A;  1HPZ A;  4MDB A;  1XUP O;  1U2V A;  1KQS M;  4BRE A;  1RTI A;  3HXM A;  2G8V A;  4CCH A;  4BDZ A;  1T03 A;  2VGN A;  1R59 O;  1HRH A;  1WSE A;  4CZF A;  3CCQ N;  4CIG A;  3VQD A;  3HVT A;  5AQO A;  1FXX A;  4IWV A;  4FJ9 A;  5C2F A;  1EO1 A;  4JKG B;  1GLC G;  3E66 A;  1GLF O;  5BR9 A;  1NWK A;  4R79 A;  4O0I A;  2HND A;  2D0A A;  1WSJ A;  4BVO A;  2RHK A;  3O9S A;  1FJG K;  5AQU A;  1VQM N;  4FZZ A;  3VA3 A;  4BG9 A;  4FJK A;  1Q8I A;  2OPP A;  3UKU B;  3AVC A;  3DRR A;  1QS4 A;  4CI6 A;  3C0B A;  5AQP A;  4Q5V A;  3TPQ A;  1WB9 A;  3NF9 A;  4WQ5 A;  4C8K A;  5BN8 A;  1LV5 A;  4FWK A;  2ZD1 A;  3DXK B;  4M7Y A;  4M3T A;  3AVB A;  2FBT A;  1NGF A;  3TAB A;  3U6F A;  1C6V A;  1IKY A;  3ID8 A;  4B1Y B;  2ZE2 A;  4ISG A;  3VA0 A;  2Q0U A;  2VYP A;  5AQH A;  4DSF A;  3SUN A;  4IOA L;  3FP5 A;  2LSN A;  2F9W A;  3H45 C;  2HOE A;  3A0I X;  4MLE A;  3QIC A;  1GOC A;  2F7T A;  3J81 O;  3ULE A;  4HCC A;  2IAJ A;  4F3O A;  4M63 C;  3UKR A;  4K42 A;  3DI6 A;  4H5W A;  1JLE A;  3O3G A;  4K0K K;  2VG5 A;  5HBM A;  4DQQ A;  2Z1I A;  1XQS C;  3BGR A;  1NLV A;  3ASM A;  4OO1 J;  1HNI A;  4FK4 A;  5AQL A;  1HYS A;  3K5N A;  3CJC A;  3FLV A;  4E7L A;  3MWT A;  3SUP A;  2HB5 A;  3ZT4 A;  3FR0 A;  3R3L A;  4I2Q A;  1NM1 A;  2KZZ A;  3VET A;  2EWS A;  1GC6 A;  5AQF A;  3NH2 A;  2GV9 A;  1L3S A;  1LWC A;  3S3M A;  5BR8 K;  3HP9 A;  5KQD A;  3L2W A;  4HUF A;  2CQU A;  4MO5 A;  3D2E B;  1W2B M;  4DV6 K;  2O8C B;  4LFC K;  5BPL A;  4DHY A;  1S5J A;  5KQ8 A;  3KWG A;  4I2P A;  4B8C A;  3L6Q A;  1NU0 A;  2BDP A;  4DKW A;  1GOB A;  3OYA A;  5AQQ A;  3VMF B;  3G0Z A;  3OYI A;  3THY B;  2E6M A;  4J2E A;  3KZB A;  1JLC A;  4LSN A;  3CJ9 A;  1ZBH A;  2OPR A;  3BEX A;  1SAZ A;  3FE1 A;  2B5J A;  3AVF A;  1I94 K;  1QZ5 A;  2YHY A;  3DYA A;  4CZH A;  3M3Z A;  1VQ7 N;  3CI5 A;  3QFP A;  2HHS A;  1W9H A;  4FWP A;  3A5M C;  1C1C A;  1TK5 A;  1P8Z A;  4LSL A;  3D45 A;  1QSS A;  1RBR A;  3QEV A;  1RBS A;  2HHX A;  1IG9 A;  4WQ5 C;  1KFS A;  1S9G A;  1KAY A;  4CEZ A;  2V51 B;  4DS4 A;  3T1H K;  1NGI A;  4QS9 A;  3OYB A;  3WXL A;  3I33 A;  2D0C A;  3OYK A;  3L3U A;  4B9U A;  4Z4G A;  3HJF A;  4FJ7 A;  4CEO A;  3NVM A;  3SPY A;  3E9P A;  2QWQ A;  3AVG A;  4O5B A;  3K57 A;  2OTL N;  4DQP A;  3HO1 A;  2XHB A;  4I7F A;  2GUI A;  4BR7 A;  2EMT A;  3DLE A;  3HPG A;  2IGI A;  3PO4 A;  1CXU A;  3JSM A;  2D1K A;  4JKH A;  4IZ9 A;  4FYD A;  1S1V A;  3VQB A;  4E3S A;  1YVN A;  3CFO A;  3RWU A;  4E7I A;  3VOV A;  1ST7 A;  3NGI A;  3CCR N;  4CJ3 A;  2ZWH A;  4K25 A;  1RTJ A;  5FPM A;  3H46 O;  3QBX A;  3DM2 A;  3O4Q A;  1MWK A;  3OBW A;  4FJI A;  4FVM A;  4CD3 A;  4LFB K;  4C8N A;  4XEI A;  2EX3 A;  4ZRI A;  2A1S A;  4FOI A;  4JRQ A;  4FWQ A;  2RQ1 A;  5AQY A;  1J53 A;  5JIC A;  4DF8 A;  4QAG A;  4IKF A;  4FZY A;  1QHT A;  4AH9 A;  4FVU A;  4CJ4 A;  3KD1 E;  2YVC A;  3SQ2 A;  3LZJ A;  1RTD A;  4LF8 K;  4RW6 A;  4CJQ A;  4BR4 A;  4CGJ A;  3CG7 A;  1VQP N;  2LBB A;  2UUC K;  1HKC A;  1LCU A;  1O13 A;  1GG3 A;  4FJ8 A;  1LWE A;  3AA3 A;  1U04 A;  4BVP A;  4AHS A;  1GGO A;  3G6E N;  4CJR A;  1X3M A;  1JLQ A;  1A5W A;  4CEQ A;  1KVA A;  4CJK A;  4OVL A;  3Q7C A;  1Y64 A;  5HP1 A;  3CHW A;  3QNN A;  4DWI A;  3TAQ A;  4G1Q A;  3G71 N;  3SMS A;  3VF6 A;  4FJG A;  5KRS A;  4Q0B A;  3KLI A;  3MXM A;  1SL2 A;  1C1B A;  4Z4H A;  4GMJ B;  4CED A;  3DAW A;  4BE1 A;  3TAF A;  5AZI B;  1LW2 A;  4FLV A;  3NHG A;  4ICL A;  3U9Z A;  4KTQ A;  3ZSY A;  3OVN A;  3H1V X;  4DR7 K;  4CBX A;  4KB1 A;  5AQG A;  4XH1 A;  3B6O A;  3OYL A;  3THX A;  1T6D A;  5CY4 A;  3BDP A;  3QML A;  4JI6 K;  1MDU B;  1QE1 A;  5BRF A;  2E6L A;  4BAC A;  1V4S A;  1VQ9 N;  3CPW M;  4Y1C A;  1NK9 A;  3OTO K;  1LAW A;  4FW2 A;  3TTD A;  3DXK A;  4BQL A;  4DR6 K;  4H8K A;  3VEX A;  1S1U A;  2FXU A;  1RBV A;  4DV4 K;  3DLB A;  4NB4 A;  3H3O B;  5DMR A;  4ID1 A;  1SKR A;  4BGA A;  5J2Q A;  2E2Q A;  3A5L C;  4DTU A;  1BHL A;  3ZT1 A;  1DGK N;  5ADX H;  4KTW A;  1NGB A;  3OJS A;  4KO0 A;  3J7Y P;  2YNG A;  3T19 A;  2COP A;  5C25 A;  4LF6 K;  1NGC A;  4DUZ K;  4KTZ A;  4A2B A;  1C0F A;  2P9L B;  1FW6 A;  1NVL A;  1WUA A;  4F7G A;  3MN7 A;  4QCL A;  1JCE A;  2O8B B;  4KH5 A;  1ASV A;  1QQC A;  1S6P A;  3HSC A;  3KVG A;  5CZ2 A;  3VEW A;  4H0P A;  3OYD A;  1XI1 A;  1REV A;  3H3N O;  1EWQ A;  5LL6 Z;  1NJX A;  1ATN A;  4H4O A;  3DWL A;  3L0Q A;  1NBW A;  3RR8 A;  1HKB A;  1S3X A;  1C0G A;  4BRN A;  1OH5 A;  1VQ6 N;  4F4K A;  3MK6 A;  4BRG A;  5HOO A;  4DTS A;  1QZ6 A;  1YF5 L;  4CJW A;  4YOX A;  4TSX A;  4LF7 K;  3EZ5 A;  4NLC A;  3RR7 A;  4AHR A;  3C6T A;  3L3V A;  3F73 A;  5GIN A;  3OS2 A;  3T7Z A;  5JS1 A;  1HMV A;  4OGC A;  2EMS A;  4C8M A;  3T69 A;  1RT7 A;  3WNE A;  3PX6 A;  4JI8 K;  2AA4 A;  2OYQ A;  3O1B A;  1IKV A;  2KLA A;  2QWN A;  1N5Y A;  1OVY A;  3PX4 A;  4C23 A;  4DLE A;  5A2Q O;  4FLT A;  3D2E A;  3QEX A;  3U4L A;  3ZET A;  4KV8 A;  1BIS A;  5EXW A;  3W3D A;  3ZT3 A;  3G25 A;  3I0S A;  1BIU A;  4NLB A;  5IWA K;  4E7J A;  1Z6R A;  4CFD A;  3TSU A;  4EHU A;  3VQA A;  1OKJ A;  4KI6 A;  3OYG A;  2GTD A;  3M8Q A;  5DK5 A;  4FCY A;  2P1J A;  2HHV A;  4F3T A;  3SBG A;  3DLR A;  1XNQ K;  3AVM A;  3NVK A;  4WFB L;  4M3U A;  4EP4 A;  1DTQ A;  4OPK A;  2VWJ A;  3HL8 A;  4M3W A;  1VQL N;  2UXC K;  5K14 A;  1EET A;  3AO1 A;  2PBD A;  4ZTF A;  5AQK A;  3P5J A;  1XC3 A;  4CZJ A;  1MK7 B;  3E1Y A;  3IS9 A;  1ZC6 A;  2HNY A;  4EFH A;  2KQ2 A;  4RW7 A;  4NXM K;  4LH5 A;  5LY3 A;  3RMC A;  2PAV A;  5KTQ A;  3HOT A;  5KGW A;  4B08 A;  1YXQ A;  2O4G A;  4BC5 A;  5LJW A;  4CHZ A;  1WSF A;  2WON A;  2RPI A;  3EZW A;  3QIO A;  2QWP A;  3CC4 N;  3U3G A;  4B1V A;  2FF6 A;  1XHZ A;  2PYJ A;  1C0M A;  3H6E A;  3TSP A;  4CGI A;  1X9M A;  3P4I A;  1B9D A;  4BRF A;  3NH1 A;  4BC2 A;  3QEI A;  1KC8 O;  4GXB A;  3KKS A;  5F0X A;  1BI4 B;  3RMD A;  4PL7 A;  2P9I B;  3O9Q A;  1OVQ A;  3O1W A;  2HE7 A;  5JVL A;  1YT3 A;  3DLK A;  2P9I A;  1Q9Y A;  2YI1 A;  2HST A;  3F2K A;  4ELV A;  2RF2 A;  1NGA A;  3EL2 A;  4E89 A;  3HPO A;  4YNQ A;  4ILH A;  4DF4 A;  2PZS A;  4CK3 A;  3BY5 A;  2NZT A;  3SMP A;  2B4J A;  1RT6 A;  2YHX A;  1RTH A;  4GVM A;  2FSK A;  1JCF A;  3I56 N;  2O8C A;  4CEF A;  2VG7 A;  1NK7 A;  2VQF K;  2WFB A;  4YDU C;  1Q7Y O;  1YI2 N;  4J2D A;  2HHU A;  4CES A;  5AZI A;  3HPH A;  4DR3 K;  2ABD A;  2F8S A;  3LDQ A;  1WAJ A;  3CPE A;  1KAX A;  4F8R A;  1S1X A;  1RT2 A;  1L3T A;  3DMJ A;  5CHI A;  4CJE A;  4FLW A;  3OY9 A;  3QDK A;  4CJL A;  3JYT A;  4A5A A;  3EE9 A;  4E1N A;  2O8B A;  4KHS A;  4I9L A;  1QVG M;  3CC7 N;  3KD5 E;  4BDY A;  3VER A;  1SZ2 A;  4DUY K;  4C8L A;  4JI0 K;  4KHU A;  5GAD P;  3O9T A;  1HYZ A;  5M1O A;  1JLG A;  4IEE A;  1Y97 A;  2RE2 A;  3U7D A;  4OKJ A;  2OZM A;  1EWR A;  2Q0R A;  3CQ8 A;  1EQY A;  2FBX A;  2HBK A;  3MX5 A;  1DLO A;  3QNO A;  1UA0 A;  4IO9 L;  3CCJ N;  1OH8 A;  3ZET B;  4DTX A;  1NTI A;  3O3H A;  4GV6 A;  4MFB A;  3N4P A;  1YIT N;  1U48 A;  1YTU A;  3AVI A;  3THX B;  1BU6 O;  2IVO A;  1TKD A;  1RT4 A;  3VF4 A;  4JEP A;  4IG0 A;  4CIF A;  5C42 A;  3VEV A;  5F1X A;  3C95 A;  2W40 A;  2UU9 K;  1VHX A;  3SV3 A;  1XMQ K;  5FDL A;  4CEE A;  3MAQ A;  3LP1 A;  4B3R K;  4DSL A;  5BRD A;  2YX6 A;  2HF3 A;  3M8S A;  1NGJ A;  3ATU A;  3KTQ A;  4KPY A;  4CFB A;  1S22 A;  3CYM A;  1U45 A;  3MXI A;  5HRN A;  1Q82 O;  4AM6 A;  4BG8 A;  5E84 A;  5M1K A;  1WBB A;  3L2V A;  3AY9 A;  4HDQ A;  3SK3 A;  4OPH A;  2A41 A;  4KH6 A;  3LPU A;  1CZB A;  3IRX A;  3JXU A;  4Z4I A;  1JXE A;  2NLX A;  3DLG A;  3I8D A;  4H4M A;  4B1X B;  3ATV A;  4BRK A;  3VQP A;  4B9S A;  1G15 A;  2KKZ A;  2ATQ A;  3TAP A;  1TVR A;  4H5N A;  4DU1 A;  4OKK A;  4M3Z A;  1VQ5 N;  1B92 A;  4WYB A;  4FPB A;  2ITM A;  1QHA A;  4IFV A;  3VQ5 A;  5JVG L;  3MEG A;  4CE9 A;  3R9P A;  4B3M K;  3LDP A;  2R82 A;  2G8H A;  1J19 A;  2ZQB A;  3WXM B;  4Z94 A;  3PSF A;  4QS8 A;  2YCH A;  3MN5 A;  5I3U A;  1QVF M;  2AJQ A;  4MO4 A;  5CYQ A;  2IS3 A;  4CFA A;  3BF3 A;  2ZJR L;  1RNH A;  1JXB A;  3AVK A;  4H0T B;  3CFR A;  1VQ4 N;  1HPM A;  1BCO A;  4A5B A;  1BI4 A;  4M45 A;  5J2P A;  3UKU A;  3HT3 A;  1NK6 A;  4CFC A;  2P9U B;  2QK9 A;  1VBH A;  4EHT A;  4I9Q A;  1KVC A;  4O4G A;  3CD6 N;  3EN9 A;  2IVP A;  4W5R A;  3A2F A;  1KLM A;  3FFI A;  1JL1 A;  1HNV A;  4NXN K;  3KWI A;  2G8F A;  2AL6 A;  3V9W A;  1N8R O;  4CHN A;  3HVR A;  4WQ4 A;  3LAK A;  2QM1 A;  3D7E O;  2F96 A;  1S6Q A;  4JI2 K;  3L2Q A;  4MDA A;  1X9J A;  3I0R A;  3NCI A;  2HW3 A;  2YNF A;  5AQJ A;  1XWL A;  1GLD G;  3OA9 A;  1VSF A;  2FSN A;  1ISN A;  4JKD A;  3O8M A;  5DM7 L;  3LAL A;  1Z26 A;  4N56 A;  3OJU A;  4B1W B;  2XY6 A;  1BQM A;  1N33 K;  2A3Z A;  2ETJ A;  3IKM A;  2HHH K;  2P5G A;  3L8B A;  3A5N C;  4C1N K;  1NI2 A;  4FM0 A;  1VSI A;  3HYF A;  2HBJ A;  1RGI A;  4H0V B;  1SS6 A;  2IC3 A;  4KB0 A;  3TAG A;  2EHG A;  5C15 A;  2E5L K;  3DOL A;  4A59 A;  3NGY A;  3VQ8 A;  1XNR K;  3OYJ A;  4JHD A;  5J2N A;  4BRM A;  4CK2 A;  3ZSZ A;  1XC9 A;  1EKE A;  3V1Q A;  5AQM A;  4BE2 A;  4AHU A;  3ZX3 A;  5GIP A;  2NRW A;  5AQI A;  4WCE L;  4DFK A;  4ISE A;  2YNH A;  4CZG A;  2YHB A;  3IDH A;  3KJV A;  3MMV A;  3V81 A;  1QSL A;  2FSJ A;  2KFN A;  2A42 A;  2W6K A;  5E41 A;  3WNH A;  3JS6 A;  1BL3 A;  3MEE A;  4CJP A;  4JS4 A;  3VTH A;  3LDL A;  5GAE P;  4DSE A;  3PUF A;  3H1Q A;  4U7B A;  1VQ8 N;  2HMI A;  2YJE A;  1RDW X;  1JL2 A;  3CM5 A;  3HK2 A;  2HF4 A;  1HR0 K;  1NG9 A;  4JHD B;  1QTM A;  1FKP A;  4H0X B;  1D4X A;  4FO0 A;  1RDC A;  3V9Z A;  3CFP A;  4DCH A;  4AM7 A;  2E2N A;  1TL3 A;  1NK5 A;  3V1O A;  2NUB A;  4CBW A;  2P9K A;  1W7A A;  4AF1 A;  3TI0 A;  3SAH A;  4DFP A;  2ZPY A;  4JKF A;  2X78 A;  4HHT A;  3SLC A;  3KK1 A;  4PUO A;  3GL1 A;  4ILJ A;  4BC3 A;  4F2R A;  4IO8 A;  5IJM A;  4FZX C;  3VEY A;  1HB6 A;  2O8D B;  4B3S K;  1HX1 A;  4RCH A;  4RG8 A;  2QXF A;  3RTV A;  3SI6 A;  3HRG A;  4FK0 A;  2J0M A;  1KC7 A;  1VSL A;  3NMU A;  1C0T A;  2I1J A;  1X9S A;  1JLA A;  2WTU A;  2X6N A;  1FKO A;  4BC4 A;  1J6Z A;  3AVL A;  4GVE A;  2AEH A;  1YVU A;  4BE0 A;  2IIR A;  2Q36 A;  3T1Y K;  5D3G A;  4CZE A;  3ITH A;  4CJ5 A;  1T7P A;  1DEJ A;  2VCP A;  2X74 A;  1M1K O;  1JLF A;  3AA5 X;  3TAM A;  3LP3 A;  2FC0 A;  1RCH A;  4CZL A;  3AA2 A;  4DV1 K;  2E4L A;  5AQT A;  1HB8 A;  2DPN A;  2ZGY A;  5HRO A;  2P51 A;  3AGR A;  4FW1 A;  4BRO A;  3WQT A;  2GUP A;  1VQO N;  3TTC A;  5DM6 L;  3MCA B;  4I6M B;  3AGK A;  1RT5 A;  3K5O A;  3RRG A;  3TU5 A;  4CGH A;  4CF2 A;  4TKN A;  2CGJ A;  5HRS A;  4IXC A;  5AQV A;  3THY A;  4BRL A;  4HCB A;  4U67 L;  4DU4 A;  4JKA A;  4OGE A;  3DJC A;  1HNZ K;  2F8T A;  3HOS A;  4YOV A;  1E4F T;  4FWM A;  3CF5 L;  4DTJ A;  1GLB G;  5FRM A;  4JKG A;  4XH5 A;  1KBL A;  3SQ4 A;  1SQK A;  3K0S A;  4CZI A;  4IOX A;  1VRU A;  4CIE A;  3NFA A;  2HHW A;  2DY4 A;  3I8B A;  4KRF A;  3AO4 A;  3U8X A;  3ULD A;  5SZT A;  3EPY A;  1VQK N;  3R1X A;  3O08 A;  4GV3 A;  4H5R A;  1LAV A;  2QTD A;  4ELU A;  2YKM A;  3V1R A;  3U9D A;  3K2P A;  4Z0U A;  1NJI O;  1GLE G;  3ZT2 A;  1ZBS A;  3VQC A;  3TAN A;  3SJH A;  4GW6 A;  4FLZ A;  2J0J A;  4QS7 A;  5AFU H;  3V9S A;  3FFK B;  4GNI A;  2IDO A;  4JKE A;  4DQ8 A;  3VF2 A;  3CJA A;  4C1N I;  4JI4 K;  2I7P A;  1SKS A;  3QIP A;  3C65 A;  4DR2 K;  3AAQ A;  3OYE A;  4IJN A;  5AZJ B;  2P9S A;  3CCE N;  3CCU N;  3WUH A;  3V6D A;  2P9N A;  5T7B A;  4JYA K;  4FXD A;  2QI2 A;  4LD0 A;  1NKB A;  4Y0W A;  3VEO A;  3H08 A;  2YNI A;  1Z25 A;  4BRC A;  4A2A A;  1T44 A;  3AAR A;  3MCP A;  5CR4 A;  3VQ9 A;  1OH6 A;  3T1A A;  1TL1 A;  4Z4F A;  3D0P A;  3AVA A;  5GAH P;  3PX0 A;  4JRP A;  1ATS A;  3GOI A;  4CGD A;  2OAN A;  5M1F A;  5HLF A;  3PSI A;  1O1W A;  1SUQ A;  5JLH A;  5GAG P;  4AQY K;  4L3Q A;  4N76 A;  4P7I A;  4JN4 A;  1BQN A;  3IAY A;  3ZDT A;  1KSP A;  2HBL A;  4UY8 O;  3ZYY X;  3JAM O;  4O8U A;  4BRH A;  1VRT A;  2QEX N;  5M1Q A;  1ZXO A;  5CYM A;  4FJX A;  4JV5 K;  2PYL A;  4GKK K;  3PY8 A;  1GOA A;  1RT1 A;  5M1P A;  1K6Y A;  1SL0 A;  1TKZ A;  4KI4 A;  3HBT A;  5EY4 A;  4EAH D;  3ULE B;  1YJN N;  3F9K A;  2G8I A;  2BH1 A;  5C0Y A;  3SBT A;  3OYH A;  3S9H A;  2V7Z A;  3LM2 A;  1L3V A;  3ZSX A;  5BRE A;  1U47 A;  3AVH A;  2D4W A;  1WOQ A;  3O9R A;  4V19 S;  2D0P A;  3LP0 A;  5AQX A;  3EY1 A;  4NY0 A;  5BPN A;  4YOU A;  2WBN A;  4DQR A;  1TKX A;  4JAX A;  4K43 A;  3DOK A;  2B6A A;  5HRR A;  4JD2 B;  3O9U A;  3TAE A;  1ASW A;  3J7Z O;  1Q18 A;  1IKX A;  1JDE A;  4BR9 A;  1YIJ N;  4DU3 A;  4K8X A;  1RIL A;  4DQI A;  4JK8 A;  1NOY A;  3ENH A;  3EYZ A;  3CM6 A;  4CZK A;  3A5O C;  1IJJ A;  5EOY A;  3RSE A;  2E20 A;  2E8A A;  3RRH A;  4FWR A;  3ENB A;  3TTF A;  4CEC A;  2FLO A;  3PO5 A;  3LZI A;  2GEL A;  3ENO A;  4NYN A;  1E5W A;  1U6Z A;  5BPM A;  5EVZ A;  3VQ7 A;  3V9U A;  4FJJ A;  4GV9 A;  5J1E A;  3C7N A;  3LPT A;  2UYT A;  3CJB A;  3HZ6 A;  1WN7 A;  3FLC O;  1K8K A;  2O8F B;  4FM1 A;  4BDP A;  1RT3 A;  3WXI A;  1JKH A;  4QOZ B;  4DFJ A;  2G8U A;  3DXM B;  2OA8 A;  1LWF A;  4J2A A;  1VSJ A;  2VWK A;  1DTT A;  4H03 B;  1VSK A;  1U2V B;  2KHO A;  3SNN A;  4MLH A;  4CW7 B;  3OYC A;  2P9P A;  4PKG A;  4BRP A;  3S41 A;  4AHC A;  3K59 A;  4O0J A;  3ZSW A;  4NO7 A;  4KHQ A;  2OCE A;  2G8K A;  5AJ3 K;  3P1G A;  4OLB A;  1ZBU A;  5AQZ A;  5CE3 A;  4JI3 K;  1ILY A;  4YOR A;  4CVN E;  3P38 A;  3CCV N;  4LFA K;  3LAN A;  3ZX0 A;  2G8W A;  3J7A P;  1M90 O;  2E2P A;  4CJS A;  3EE8 A;  1LW0 A;  3AU4 A;  4ID5 A;  2ZF5 O;  2A6A A;  4LF4 K;  2JGU A;  1NMN A;  4DR1 K;  1R0A A;  1VSE A;  4PQU A;  2X6S A;  1JJ2 M;  4FLU A;  3OHR A;  3O3F A;  1MWM A;  4JK7 A;  5ADX A;  3L2R A;  3KLH A;  3AO3 A;  4L8R B;  1RDU A;  3B8A X;  4DS5 A;  1X3N A;  5GIO A;  3R8E A;  3DLL L;  1BWF O;  4IOC L;  1HQU A;  5TKW A;  2WOM A;  2CGK A;  3D2F B;  4DV3 K;  4KHY A;  5H1S Q;  3M8P A;  1VSH A;  3BF1 A;  4FLY A;  4C8O A;  3LWL A;  4CJU A;  1QSY A;  4RW9 A;  1S72 N;  3O4W A;  2E2O A;  1HUX A;  1NGH A;  3TWH A;  3C7N B;  2YJF A;  4Z4C A;  3IUC A;  4ISF A;  5C24 A;  1NKC A;  2KFZ A;  4DTO A;  4NCG A;  4NYF A;  3MXJ A;  3PLA A;  2BUP A;  2UXD K;  5FPD A;  2OTJ N;  2HVI A;  4CJV A;  5HL7 L;  1E4G T;  1KFD A;  4HWI A;  4X62 K;  4BRQ A;  1HBK A;  3RSE B;  3MN6 A;  3VEZ A;  3P39 A;  2WUS A;  2DFF A;  4H5V A;  4DSI A;  3VN5 A;  4JKB A;  1C1A A;  4CF1 A;  1H1V A;  5FPN A;  1UOC A;  4IFE A;  5LJV A;  3QIJ A;  4BQZ A;  1WBD A;  4OLA A;  1GLA G;  2HHQ A;  4DLG A;  3CCS N;  3IG1 A;  1EP4 A;  2GEM A;  2NRH A;  1SV5 A;  3ZX2 A;  4EP5 A;  1LOT B;  4B1Z A;  1S1T A;  4K41 A;  4DB3 A;  1TUU A;  1TAU A;  4W5T A;  2VWB A;  3TR8 A;  3WEE B;  3VPZ A;  3VEN A;  4CEB A;  4CGG A;  1N36 K;  1ATR A;  3WQU A;  2D5R A;  1BCM A;  5AQN A;  4ZRK A;  1IG8 A;  3NF6 A;  4IG3 A;  3NF8 A;  4ZTJ A;  4JI1 K;  3VQ4 A;  3SQ0 A;  5FRN A;  3BZC A;  3K58 A;  1BG3 A;  4B9T A;  4K8Z A;  4HDO A;  2YKN A;  2DFH A;  2DIK A;  2KW4 A;  1WSG A;  4H0Y B;  3VGM A;  4WQ4 C;  1HNX K;  3IVF A;  3DLH A;  4CF8 A;  2D11 A;  4ELT A;  1WSI A;  4EZ9 A;  3OYM A;  3ID6 A;  3WXK A;  2P9K B;  1D9F A;  3D2F A;  1HJR A;  3VGK A;  1RBT A;  3ZEU B;  4B9V A;  3BUZ B;  2A1R A;  1WSH A;  2RKI A;  1TUY A;  2OZS A;  1BGX T;  4FWN A;  1QQM A;  4RWT A;  2NRT A;  4YOY A;  1Q86 O;  2HVH A;  1W0H A;  1TK0 A;  3BZK A;  3UKR B;  4WFN L;  3SPZ A;  4CF0 A;  2Q97 A;  1BDG A;  4B8A B;  2XY7 A;  4DSK A;  4OX9 K;  3EEQ A;  1KAZ A;  3T3F A;  3WNG A;  5BN9 A;  4E1J A;  4H0O A;  4HTU A;  1IBM K;  1Q81 O;  3ISN C;  3OYF A;  4FLX A;  2D2Q A;  4AIL C;  3AU5 A;  4M41 A;  4GY2 B;  3QB0 A;  4CZM A;  4FSV A;  1IBL K;  4B9N A;  3WXJ A;  1OH7 A;  3HTV A;  3ZLJ A;  2O8E A;  4A57 A;  1UWB A;  2NRV A;  4B1U B;  3KK3 A;  4E1M A;  3NF7 A;  3ZEU A;  5KPZ A;  4M3Y A;  3PVL A;  3Q7B A;  4JI5 K;  1HNW K;  2VGM A;  3KLF A;  3P31 A;  2PFU A;  2Z1G A;  2DTU A;  3CCM N;  1VAZ A;  3SYZ A;  3R6M A;  4E0D A;  1MA9 B;  4YDU A;  4FPA A;  3KK2 A;  2DFE A;  1NJW A;  3TSQ A;  4FOE A;  4YOW A;  3F5T A;  1HLU A;  5HRP A;  3G10 A;  1RFQ A;  1BA0 A;  3BIN A;  1J5E K;  3O80 A;  4CER A;  3QO9 A;  4B3T K;  5C10 A;  5KGX A;  1J9A A;  3C94 A;  4WFA L;  1X9W A;  4MQ3 A;  4NCA A;  3WT0 A;  4DQS A;  1NGG A;  1BUP A;  1K8A O;  1TYQ B;  3HST B;  3MED A;  4PHT X;  3ZT0 A;  1U49 A;  2CH6 A;  3K5L A;  1TAQ A;  5JMV A;  4ZRJ A;  4FL9 A;  3V9X A;  3FZK A;  2V52 B;  4HUG A;  3DRP A;  3QEW A;  4IDH A;  3AAP A;  3OS0 A;  2XY5 A;  3QBW A;  4X65 K;  3KHY A;  4H5T A;  1NJZ A;  1YUW A;  1Y19 B;  1CXQ A;  4HVJ A;  1RDD A;  2Y1J A;  2ZGZ A;  3WNF A;  4JI7 K;  1I39 A;  4CGF A;  5LMN K;  5AR0 A;  2IVN A;  3QER A;  2I7N A;  1N6Q A;  2QKB A;  4RW8 A;  1RBU A;  3HP6 A;  1MIZ B;  4ILG B;  2WC9 A;  1VQN N;  3ALY A;  4CJF A;  5LMU K;  4R5P A;  3C6H A;  4DV0 K;  4FJ5 A;  1E3M A;  2GWK A;  1UAX A;  3S3N A;  4IFY A;  2YV0 X;  3GE1 A;  4OPA A;  3LDS A;  2RN2 A;  3M6G A;  4WE1 A;  3THW A;  2NRR A;  3O4N A;  4O55 A;  5JS2 A;  3E01 A;  4Y1D A;  4CD1 A;  2XY8 A;  4O8K A;  3VTI A;  3LP2 A;  4O5F A;  5TKY A;  4FJN A;  4DV2 K;  5F2R A;  4CEA A;  1TK8 A;  1UA1 A;  3ZSV A;  1ZBL A;  3UIQ A;  3ZSR A;  1A5V A;  3K9J A;  4FWS A;  4JS5 A;  3NH0 A;  1TV6 A;  3P83 D;  3THV A;  3L2U A;  2BGG A;  2O8E B;  1KCF A;  3NGZ A;  3LWM A;  4DV5 K;  1D9D A;  4FWL A;  1K73 O;  3X23 A;  3ZCM A;  4DR4 K;  3VQ6 A;  4FJL A;  3NBP A;  1NK8 A;  2A40 A;  3MDQ A;  5B8H A;  3SAG A;  1DT9 A;  4FJH A;  4EKU A;  2JLE A;  2QWR A;  3CC2 N;  2ZM6 K;  3CME N;  1SKW A;  1J54 A;  3IFR A;  4X64 K;  2QWO A;  2NRZ A;  4JKC A;  2NNW A;  4LF5 K;  5EX5 A;  3K9K A;  1NOZ A;  2QW9 A;  3QIN A;  4IEI A;  4CBU A;  3OYN A;  1HYV A;  4O44 A;  4JK9 A;  4BWM A;  4BR5 A;  4EIA A;  5FPE A;  3SQ1 A;  2UUB K;  1V4T A;  4NCB A;  2D0B A;  1IH7 A;  3OS1 A;  2I1K A;  5FRO A;  2UUA K;  3AO2 A;  1T6C A;  3UB5 A;  3LL3 A;  3RMB A;  4FWO A;  2W42 A;  4M3X A;  4BR0 A;  2BAN A;  3PIO L;  1NNE A;  4DTM A;  2XO7 A;  1YTA A;  1GLJ O;  2Q31 A;  5EU7 A;  3KLE A;  1FK9 A;  3VQE A;  4OKE A;  4B9M A;  4B9Q A;  4RTF D;  1ZBF A;  3AA4 A;  4IBN A;  4KKO A;  2ZJP L;  4BRI A;  1S9E A;  4AHT A;  2HBM A;  4DSJ A;  2KZM A;  3GDQ A;  3FZM A;  1NKE A;  1X1P A;  1CZ9 A;  1HQE A;  5KI6 A;  1NK4 A;  4KHW A;  1DKG D;  3KIO A;  5AQR A;  3VQQ A;  2J4R A;  4CJT A;  4DMN A;  3KLG A;  3MWP A;  3ZSQ A;  3AO5 A;  4BWJ A;  1N32 K;  4IJA A;  3CCL N;  4DV7 K;  2UXB K;  2H3G X;  4Z4E A;  1VBG A;  3CJ1 A;  1JLB A;  2HMP A;  3KKR A;  1NGE A;  3MX2 A;  5KRT A;  3IMX A;  5I42 A;  4B9L A;  2QKK A;  2Q3S A;  2A5X A;  2D10 A;  3A8Y A;  2GWJ A;  2WH5 A;  4DFM A;  2PY5 A;  1ZBI A;  1TYQ A;  5J2M A;  4PKI A;  3FZH A;  3E9O A;  2VG6 A;  4KHN A;  3G9W A;  1WLJ A;  3C6U A;  1WAF A;  4BRD A;  1YJ9 N;  4CHP A;  2VQE K;  1BOT O;  1HJO A;  3ZSO A;  2V7Y A;  5CZ1 A;  1J5O A;  2Q2R A;  3FZF A;  1EF1 A;  1SL1 A;  3SCX A;  3EO3 A;  4A61 A;  2QWM A;  1BIZ A;  4KHP K;  1VK0 A;  3NDK A;  1WNS A;  1GC7 A;  2Z1J A;  3MN9 A;  4HUE A;  4KBO A;  3U8Z A;  5JLF A;  3M1F A;  4J8F A;  4BRA A;  2FF3 B;  2CB8 A;  4CF9 A;  3EKS A;  5SWM A;  3CMA N;  4PL8 A;  4RW4 A;  3SUQ A;  4G9Z A;  4CHQ A;  3LAM A;  2ITG A;  3PZD A;  1W97 L;  4E19 A;  3N4Q A;  3AV9 A;  2Y1I A;  3OW2 M;  4E7K A;  2ASM A;  4N5S A;  1QQN A;  2P9U A;  2HRJ A;  4PWD A;  4YL8 A;  5JVH L;  1N34 K;  3C6A A;  1YHQ N;  1Q9X A;  3TAR A;  1GLL O;  3B6P A;  3SV4 A;  1U4B A;  1BO5 O;  2X0S A;  3WA0 A;  4KFB A;  4ZHR A;  4BGB A;  5C2D A;  5KPR A;  4DXA B;  5C12 A;  3VES A;  4M7X A;  5ELZ A;  2QA4 N;  1VSM A;  3FGU A;  2QXL A;  3FZL A;  4N41 A;  3QET A;  3RVC A;  4OPJ A;  4WF9 L;  3QEP A;  2ASO A;  2CGL A;  3CQY A;  1L5U A; 
#chains in the Genus database with same CATH homology
 1RGI A;  4H0V B;  3G71 N;  3CCS N;  1SS6 A;  2GEM A;  2YHW A;  3SMS A;  2NRH A;  3VF6 A;  4LC9 B;  3OBY A;  3ZX2 A;  2AP1 A;  1LOT B;  4B1Z A;  4K41 A;  4DB3 A;  5C15 A;  4A59 A;  4XH4 A;  4BY9 C;  1TUU A;  4JHD A;  3PIP L;  4BRM A;  2VWB A;  1CZA N;  3WEE B;  3DAW A;  2E88 A;  3VPZ A;  3VEN A;  5AQM A;  3EKU A;  5AZI B;  1ATR A;  3ZX3 A;  3WQU A;  5GIP A;  1ESV A;  3U9Z A;  2NRW A;  5AQI A;  3L4Q A;  5AQN A;  4CJ7 A;  4ZRK A;  1K8K B;  4ISE A;  4CZG A;  1IG8 A;  2W41 A;  3H1V X;  3IDH A;  3MMV A;  1YJW N;  2FSJ A;  4CBX A;  2A42 A;  5AQG A;  3JS6 A;  1NGD A;  1JCG A;  1T3V A;  1KD1 O;  4XH1 A;  1T6D A;  5AFU A;  3VTH A;  3LDL A;  3QML A;  5GAE P;  1MDU B;  1BG3 A;  5BRF A;  1DIK A;  3G4S N;  2P9L A;  3H1Q A;  4HDO A;  5MLC Q;  4U7B A;  1VQ8 N;  1V4S A;  2DIK A;  2YJE A;  1RDW X;  3CPW M;  1VQ9 N;  2F9T A;  2CH5 A;  4H0Y B;  2ASP A;  2HF4 A;  3TTD A;  3DXK A;  4BQL A;  3VGM A;  4WQ4 C;  2J0K A;  3IVF A;  4JHD B;  2D11 A;  5AQW A;  4I6M A;  5E26 A;  3VEX A;  1H4R A;  2FXU A;  3F9M A;  3WEE A;  4H0X B;  1D4X A;  3ID6 A;  3WXK A;  4FO0 A;  2P9K B;  3H3O B;  4NB4 A;  4DCH A;  5M1N A;  4AM7 A;  3D2F A;  2E2N A;  2D0O A;  3VGK A;  4BGA A;  3ZEU B;  1MIX A;  2E2Q A;  3A5L C;  3W0L A;  1HKG A;  4CBW A;  2P9K A;  3LDO A;  2FDQ A;  3BUZ B;  3QFU A;  1DGK N;  4AF1 A;  5ADX H;  2QWL A;  1TUY A;  3SAH A;  1NGB A;  2ZPY A;  4JKF A;  4JD2 A;  3SAF A;  2COP A;  4FWN A;  4HTL A;  1QQM A;  3SLC A;  2NRT A;  4RWT A;  4YOY A;  1Q86 O;  3GL1 A;  1NGC A;  4ILJ A;  2E1Y A;  4BC3 A;  4IO8 A;  1C0F A;  4A2B A;  5IJM A;  2P9L B;  3VEY A;  1NVL A;  1WUA A;  3LM9 A;  4F7G A;  3MN7 A;  1HB6 A;  1JCE A;  1HX1 A;  3LDN A;  4RCH A;  3UKR B;  4KH5 A;  4PKH A;  4WFN L;  3HSC A;  3KVG A;  2Q97 A;  3HRG A;  3VEW A;  4H0P A;  5KPT A;  1BDG A;  2J0M A;  1KC7 A;  3J8A A;  4YOT A;  3CIP A;  3NMU A;  3H3N O;  4JNE A;  2I1J A;  3KK7 A;  1KAZ A;  5BN9 A;  1ATN A;  2JWL A;  3DWL A;  4E1J A;  3CER A;  4H0O A;  1J6Z A;  3L0Q A;  4BC4 A;  5I9E B;  1Q81 O;  1NBW A;  3CQX A;  4GVE A;  1G99 A;  2AEH A;  2D2Q A;  3AU5 A;  2IIR A;  1HKB A;  2Q36 A;  1S3X A;  4GY2 B;  1C0G A;  4BRN A;  3QB0 A;  4CZE A;  4CZM A;  4FSV A;  4F9O A;  1VQ6 N;  1DEJ A;  2VCP A;  2P9P B;  3MK6 A;  4BRG A;  3WXJ A;  5HOO A;  3HTV A;  4A57 A;  1M1K O;  4B1U B;  2NRV A;  1QZ6 A;  1YF5 L;  4YOX A;  4CZL A;  3ZEU A;  4NLC A;  5KPZ A;  3DXM A;  5AQT A;  3PVL A;  1HB8 A;  1BA1 A;  2DPN A;  2ZGY A;  3Q7B A;  3AGR A;  4BRO A;  4BR2 A;  3WQT A;  2GUP A;  2VGM A;  1VQO N;  3TTC A;  3O6W A;  3P31 A;  5GIN A;  3MCA B;  5DM6 L;  2PFU A;  4I6M B;  3AGK A;  5BRH A;  3CCM N;  1VAZ A;  3T7Z A;  3R6M A;  3CJ7 A;  1MA9 B;  1YAG A;  2EMS A;  3TU5 A;  2ZJQ L;  4YDU A;  4FPA A;  3T69 A;  2Q1N A;  4TKN A;  3GBT A;  1SGH A;  2CGJ A;  2AA4 A;  2E1Z A;  4IXC A;  3UE5 A;  5AQV A;  3O1B A;  4FOE A;  1QQO A;  2KLA A;  3TSQ A;  3F5T A;  3CET A;  1HLU A;  2QWN A;  4BRL A;  4YOW A;  1OVY A;  1P90 A;  3BP8 A;  4CYE A;  4U67 L;  4C23 A;  4JKA A;  3I55 N;  1RFQ A;  1BA0 A;  3DJC A;  3D2E A;  3HI0 A;  1MK9 B;  3BIN A;  2P9N B;  3O80 A;  3HOS A;  4KH4 A;  2GX9 A;  3D6R A;  1K9M O;  2FJ9 A;  3U4L A;  3ZET A;  5C10 A;  4YOV A;  4WFA L;  2BTF A;  4A62 A;  1E4F T;  4FWM A;  3CF5 L;  2P9S B;  5EXW A;  3HM8 A;  3WT0 A;  3O5B A;  1GLB G;  5AZJ A;  3W3D A;  1NGG A;  3G25 A;  4JKG A;  1BUP A;  4NLB A;  4XH5 A;  1K8A O;  1KBL A;  1TYQ B;  1Z6R A;  4PHT X;  1SQK A;  1Z05 A;  3TSU A;  4CZI A;  2CH6 A;  4IOX A;  5AQS A;  4EHU A;  1OKJ A;  1ACA A;  3I8B A;  1KXP A;  2GTD A;  5JMV A;  4ZRJ A;  4FL9 A;  3FZK A;  2V52 B;  3U8X A;  1VQK N;  3EPY A;  3R1X A;  3GG4 A;  3O08 A;  3AAP A;  3SBG A;  4IDH A;  3NVK A;  4WFB L;  4H5R A;  3QBW A;  4GV3 A;  2NRX A;  3E9L A;  3KHY A;  2QTD A;  4H5T A;  3M5R A;  3VGL A;  1VQL N;  3L4I A;  1YUW A;  1Y19 B;  2PBD A;  2JWK A;  1NMD A;  2ZGZ A;  3U9D A;  3CXC M;  5AQK A;  1XC3 A;  4CZJ A;  4MDB A;  1XUP O;  1MK7 B;  3E1Y A;  4EFH A;  1ZC6 A;  1U2V A;  1NJI O;  1KQS M;  1GLE G;  5AR0 A;  4BRE A;  1ZBS A;  5LY3 A;  2IVN A;  3SJH A;  2I7N A;  2PAV A;  2J0J A;  3HOT A;  4QS7 A;  5AFU H;  2VGN A;  3FFK B;  1R59 O;  1MIZ B;  4ILG B;  4JKE A;  1YXQ A;  2WC9 A;  4GNI A;  4BC5 A;  4CZF A;  4DQ8 A;  5LJW A;  3VF2 A;  3CJA A;  5AQO A;  4C1N I;  1VQN N;  2I7P A;  3C6H A;  3EZW A;  4IWV A;  5C2F A;  2QWP A;  3C65 A;  3CC4 N;  1EO1 A;  3AAQ A;  4JKG B;  1GLC G;  4B1V A;  4IJN A;  3E66 A;  1GLF O;  2GWK A;  5BR9 A;  1NWK A;  4R79 A;  5AZJ B;  2FF6 A;  2P9S A;  3CCE N;  3CCU N;  3WUH A;  3H6E A;  3GE1 A;  3TSP A;  4BVO A;  2RHK A;  3P4I A;  4OPA A;  2P9N A;  4BRF A;  1KC8 O;  4BC2 A;  2QI2 A;  3O9S A;  4GXB A;  5AQU A;  3M6G A;  1VQM N;  4Y0W A;  4BG9 A;  3VEO A;  2NRR A;  5F0X A;  4BRC A;  4PL7 A;  2P9I B;  3O9Q A;  4A2A A;  3O1W A;  1T44 A;  3AAR A;  3UKU B;  2HE7 A;  3MCP A;  5CR4 A;  4CD1 A;  4O8K A;  5JVL A;  3VTI A;  4CI6 A;  2P9I A;  3C0B A;  2YI1 A;  2HST A;  4O5F A;  5AQP A;  3F2K A;  5TKY A;  3TPQ A;  5GAH P;  1ATS A;  3GOI A;  2OAN A;  4WQ5 A;  1NGA A;  5BN8 A;  3EL2 A;  5M1F A;  4FWK A;  5F2R A;  5JLH A;  3DXK B;  4ILH A;  5GAG P;  4M7Y A;  4L3Q A;  1NGF A;  4P7I A;  4JN4 A;  2NZT A;  3K9J A;  4FWS A;  3SMP A;  4B1Y B;  3ID8 A;  3ZDT A;  2YHX A;  2FSK A;  1JCF A;  2HBL A;  3I56 N;  4ISG A;  4UY8 O;  3ZYY X;  2Q0U A;  2VYP A;  5AQH A;  4IOA L;  4O8U A;  4BRH A;  2QEX N;  3FP5 A;  2WFB A;  4FWL A;  2F9W A;  4YDU C;  1K73 O;  3H45 C;  5M1Q A;  2HOE A;  3X23 A;  3A0I X;  1YI2 N;  1Q7Y O;  1ZXO A;  3QIC A;  4MLE A;  5AZI A;  2F7T A;  3ULE A;  2A40 A;  2ABD A;  3LDQ A;  3MDQ A;  5B8H A;  5M1P A;  3SAG A;  1DT9 A;  3CPE A;  1KAX A;  4M63 C;  3HBT A;  5EY4 A;  4EAH D;  3ULE B;  1YJN N;  5CHI A;  4EKU A;  2BH1 A;  2QWR A;  5C0Y A;  3SBT A;  3CC2 N;  3UKR A;  2V7Z A;  3QDK A;  3CME N;  4K42 A;  4H5W A;  3IFR A;  3LM2 A;  5BRE A;  2QWO A;  4A5A A;  2NRZ A;  3EE9 A;  2D4W A;  1WOQ A;  3O9R A;  2D0P A;  5AQX A;  4JKC A;  4NY0 A;  1QVG M;  3CC7 N;  2NNW A;  5BPN A;  3VER A;  1XQS C;  4YOU A;  1SZ2 A;  3K9K A;  4IEI A;  1NLV A;  2QW9 A;  2WBN A;  5EX5 A;  5GAD P;  3O9T A;  4JAX A;  4K43 A;  5M1O A;  4CBU A;  4JD2 B;  3O9U A;  4IEE A;  4OO1 J;  4JK9 A;  2RE2 A;  4BR5 A;  4EIA A;  5FPE A;  1Q18 A;  3J7Z O;  1V4T A;  1JDE A;  3U7D A;  5AQL A;  4BR9 A;  1YIJ N;  2I1K A;  3CJC A;  2Q0R A;  3FLV A;  1T6C A;  3MWT A;  1EQY A;  3LL3 A;  3UB5 A;  4JK8 A;  2HBK A;  3ENH A;  3MX5 A;  4FWO A;  4CZK A;  3A5O C;  4BR0 A;  3FR0 A;  3PIO L;  3R3L A;  1IJJ A;  4IO9 L;  1NM1 A;  5EOY A;  3RSE A;  3CCJ N;  3VET A;  2EWS A;  2E20 A;  3ZET B;  1GC6 A;  2E8A A;  5AQF A;  1GLJ O;  2Q31 A;  1NTI A;  4FWR A;  3ENB A;  3TTF A;  4B9Q A;  4GV6 A;  5KQD A;  2CQU A;  2FLO A;  4RTF D;  2GEL A;  4MO5 A;  3D2E B;  3ENO A;  3N4P A;  1YIT N;  1W2B M;  1E5W A;  1U6Z A;  5BPM A;  5EVZ A;  5BPL A;  4DHY A;  2ZJP L;  5KQ8 A;  3KWG A;  4GV9 A;  4BRI A;  1BU6 O;  2IVO A;  2HBM A;  3C7N A;  3L6Q A;  3VF4 A;  4DKW A;  2UYT A;  4JEP A;  3CJB A;  3HZ6 A;  3GDQ A;  3FLC O;  1K8K A;  3VEV A;  5AQQ A;  3VMF B;  5F1X A;  3FZM A;  3WXI A;  2W40 A;  1DKG D;  3KZB A;  5AQR A;  3DXM B;  2J4R A;  3CJ9 A;  4H03 B;  5BRD A;  2YX6 A;  1U2V B;  2KHO A;  3BEX A;  1SAZ A;  2HF3 A;  3MWP A;  1NGJ A;  3FE1 A;  4MLH A;  3ATU A;  2P9P A;  4PKG A;  4BRP A;  3S41 A;  1QZ5 A;  2YHY A;  4IJA A;  3CCL N;  4CZH A;  1S22 A;  3M3Z A;  1VQ7 N;  2H3G X;  4NO7 A;  3CI5 A;  1VBG A;  3CJ1 A;  3QFP A;  1Q82 O;  4AM6 A;  2HMP A;  5E84 A;  4BG8 A;  5M1K A;  1NGE A;  4FWP A;  3MX2 A;  3IMX A;  3AY9 A;  4HDQ A;  3SK3 A;  4WCE L;  3A5M C;  5AQZ A;  4OPH A;  1P8Z A;  2A5X A;  5CE3 A;  2A41 A;  2D10 A;  3A8Y A;  4KH6 A;  1ILY A;  4YOR A;  2GWJ A;  4WQ5 C;  3P38 A;  3CCV N;  1KAY A;  3JXU A;  2WH5 A;  2V51 B;  3ZX0 A;  1NGI A;  1M90 O;  2E2P A;  4QS9 A;  2NLX A;  1TYQ A;  3EE8 A;  3WXL A;  4PKI A;  3AU4 A;  3FZH A;  2ZF5 O;  2A6A A;  3I33 A;  4B1X B;  3E9O A;  3ATV A;  4BRK A;  1JJ2 M;  2KKZ A;  3OHR A;  3G9W A;  3NVM A;  1MWM A;  4H5N A;  3E9P A;  4JK7 A;  2QWQ A;  5ADX A;  2OTL N;  1VQ5 N;  4BRD A;  1YJ9 N;  4WYB A;  4FPB A;  2ITM A;  4BR7 A;  1QHA A;  1BOT O;  2EMT A;  5JVG L;  1HJO A;  1RDU A;  3R9P A;  3B8A X;  3LDP A;  2R82 A;  1X3N A;  5GIO A;  1J19 A;  3R8E A;  2D1K A;  4JKH A;  4IZ9 A;  2V7Y A;  3WXM B;  4Z94 A;  3DLL L;  1BWF O;  4QS8 A;  4IOC L;  5TKW A;  1YVN A;  2Q2R A;  2YCH A;  3FZF A;  3VOV A;  1ST7 A;  1EF1 A;  3CCR N;  2CGK A;  2ZWH A;  3MN5 A;  3D2F B;  4K25 A;  3EO3 A;  4A61 A;  2QWM A;  5FPM A;  5H1S Q;  3H46 O;  1QVF M;  3QBX A;  3BF1 A;  4MO4 A;  1GC7 A;  3MN9 A;  3BF3 A;  4KBO A;  2ZJR L;  3U8Z A;  5JLF A;  3M1F A;  1MWK A;  3OBW A;  4J8F A;  4BRA A;  4H0T B;  2FF3 B;  4CD3 A;  1VQ4 N;  2CB8 A;  1HPM A;  3EKS A;  4A5B A;  4XEI A;  4PL8 A;  3CMA N;  3O4W A;  1S72 N;  2E2O A;  1HUX A;  4G9Z A;  1NGH A;  4ZRI A;  3UKU A;  4FOI A;  3C7N B;  2YJF A;  2P9U B;  1VBH A;  4FWQ A;  1W97 L;  3PZD A;  4EHT A;  2RQ1 A;  5AQY A;  5JIC A;  3N4Q A;  3IUC A;  3CD6 N;  3OW2 M;  4FVU A;  2YVC A;  3EN9 A;  2IVP A;  4ISF A;  2ASM A;  3KWI A;  1QQN A;  2BUP A;  3PLA A;  2AL6 A;  2P9U A;  2HRJ A;  5FPD A;  1N8R O;  4YL8 A;  4BR4 A;  5JVH L;  1VQP N;  2OTJ N;  2LBB A;  4WQ4 A;  3C6A A;  3CCQ N;  1YHQ N;  2QM1 A;  3D7E O;  1E4G T;  1HKC A;  5HL7 L;  4HWI A;  4BRQ A;  4MDA A;  1HBK A;  3RSE B;  1LCU A;  1X9J A;  3MN6 A;  1GLL O;  3VEZ A;  3P39 A;  1O13 A;  1GG3 A;  5AQJ A;  2WUS A;  1GLD G;  1BO5 O;  2X0S A;  3OA9 A;  4H5V A;  3WA0 A;  2FSN A;  1ISN A;  4JKB A;  4JKD A;  3O8M A;  4BGB A;  4BVP A;  5DM7 L;  1H1V A;  1GGO A;  4B1W B;  5FPN A;  5C2D A;  5KPR A;  3G6E N;  4DXA B;  5C12 A;  1X3M A;  4IFE A;  3VES A;  4M7X A;  5LJV A;  5ELZ A;  2A3Z A;  3QIJ A;  2QA4 N;  3IKM A;  3FGU A;  4BQZ A;  2QXL A;  3FZL A;  1GLA G;  3Q7C A;  3A5N C;  4C1N K;  1NI2 A;  3RVC A;  4WF9 L;  2ASO A;  1Y64 A;  2CGL A;  3CQY A;  3CHW A;  2HBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...