4JKCA

Open and closed forms of t1800e human prp8 rnase h-like domain with bound mg ion
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTEKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkcA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkcA01
4ILJA 4JKEA 4JKFA 4JKCA 4JKGA 3E66A 4JK7A 3E9PA 3SBGA 4JKAA 4JKGB 4JKBA 3SBTA 4JKHA 4ILGB 3E9OA 3ENBA 4ILHA 3E9LA 4JK9A 4JK8A 4JKDA
chains in the Genus database with same CATH superfamily
1G15A 3C94A 3UIQA 4BR4A 3FZFA 3IKMA 3MDQA 1EF1A 1HYSA 5A2QO 3G4SN 2B5JA 2E2QA 4YOYA 1ATRA 3MX5A 4MQ3A 4MO4A 2F9WA 4QS9A 3K58A 2AEHA 4DTNA 5B8HA 2FBTA 4JNEA 1XMQK 2EMSA 2V7YA 4R5PA 4DLEA 2G8IA 2HOEA 1MK9B 3AA3A 2X74A 3IRXA 1N34K 4KRFA 5IJMA 4C8LA 3TI0A 3AA2A 1YIJN 1LWCA 4JK8A 2KFNA 3LDPA 5AQYA 4IJNA 1VQ7N 4PWDA 1SZ2A 3SQ4A 3AVIA 1NKBA 5FPEA 5FDLA 1VRTA 4NLBA 4BRKA 3TAQA 3AVBA 3AGRA 1S9GA 3T69A 4IZ9A 4XH4A 4RW8A 3CFRA 3LP1A 3MXMA 3GL1A 1OKJA 1OH5A 3NGYA 1OH6A 2ZGZA 5DM6L 4NLCA 3WXJA 3OYKA 4FJKA 3O4WA 3IFRA 3O8MA 2GWJA 3R8EA 1K8AO 1YXQA 2HNYA 2XRIA 1P8ZA 1RT4A 4QS8A 3MEGA 1C1CA 2E1YA 4FWLA 4CZLA 3KD1E 3ZT3A 4BGBA 1YJNN 3CM5A 4DR3K 1IG8A 4KHYA 4B9QA 1U45A 2O8DB 1VQNN 5BN9A 4O8UA 1BI4B 4PA1A 4DTJA 4BRQA 4BRLA 4B9SA 1K6YA 1QSLA 5AQXA 5C2DA 3TAPA 4F9OA 3QINA 3I8DA 1NTIA 3C7NB 4CHPA 4DSJA 4DV5K 3EE8A 5D3GA 2I1KA 1LAVA 3VMFB 4ZHRA 2IAJA 2GEMA 2YV0X 3B6PA 1TUYA 3MWTA 4PQUA 2RHKA 2O4IA 5KRTA 5HRRA 4FWMA 2I1JA 4Z94A 4YOXA 2D1KA 2PYJA 2DFEA 1J5OA 3WT0A 3A8YA 4CFBA 4K42A 3V81A 2OPPA 1IO2A 3VQ8A 3HRGA 4YDUC 1QE1A 4HUFA 4DR6K 3CFPA 1RBTA 2UUBK 5EU7A 3TTCA 4B9LA 1KCFA 4M42A 1T03A 3EKSA 2O8DA 5BR8K 3CCQN 3ZX3A 3OS0A 1BWFO 3K2PA 4AHSA 2G8UA 2UYTA 2RF2A 3AA4A 4DUZK 4NB4A 3DRSA 1HKGA 3C7NA 2W42A 4RW9A 4FK0A 2O8EB 3FE1A 2G8VA 4NCAA 2Z1IA 2DIKA 1JKHA 2I5JA 1VQ4N 2AJQA 4BRPA 4BDYA 3AVHA 5KPRA 3QEWA 1JDEA 4NYFA 3WXKA 3CPWM 1REVA 2CGKA 2OPSA 3SK3A 4ZRIA 4JLHA 2QXFA 1U49A 2YJEA 3UKRA 4M3TA 4JHDA 3T1YK 4FOIA 1ZBHA 1MIXA 1ZBIA 2AL6A 2OA8A 4YY3K 5J2NA 2CH5A 2P9NB 3VEZA 3K5MA 5K14A 1HYVA 1XHXA 1NKCA 4OLAA 3OYGA 1LWEA 4GVMA 4M7XA 3KK3A 1GLFO 2P9PA 1C0FA 2WH5A 5HOOA 1IV0A 2O8EA 4I7FA 3VQPA 2F8SA 3HP9A 5LJVA 4CZJA 4DV3K 1KSPA 4HHTA 3G71N 1NOYA 3DRRA 4DXAB 2VGMA 4GV3A 4CJVA 2ASMA 3U8ZA 4JKGB 1RNHA 4DV2K 1CZAN 3THWB 1HNZK 4FJNA 2QI2A 1RBRA 2IVNA 2P9UB 5KRSA 3MXIA 3O9RA 1U48A 2W40A 1NMNA 4FLYA 4NXMK 1JLBA 4HCBA 4LFAK 3QNOA 5EY4A 5TKWA 1C0MA 4CF0A 4B3TK 1W7AA 4B9TA 1CZ9A 3O4NA 1BGXT 2FC0A 3H46O 1WSIA 2J4RA 1NJWA 2QWOA 3CHWA 2QWPA 3SUOA 4OKKA 1IKVA 3VPZA 4LD0A 4BRCA 1X3MA 2DFFA 1ZXOA 3WA0A 2YNHA 1EQYA 5BPLA 2OTLN 4R79A 4EIAA 3A0IX 3BGRA 4CJ7A 3SUNA 1IBMK 1NK4A 3THWA 3J81O 4FLZA 1RTDA 3DJCA 1S9EA 1KC7A 4CBWA 3N4PA 4Z4FA 2O8CB 2D0CA 3ZEUB 4Y0WA 2ATQA 3CPEA 3CJ9A 3BUZB 3KD5E 4FJLA 4CJ3A 3VA0A 4FW1A 3THYB 2GBZA 4WFAL 1BL3A 3DM2A 2E1ZA 1VSHA 4MLEA 3J8AA 5AQJA 4H0TB 1EP4A 4YOTA 3BY5A 2CB8A 1ILYA 2A40A 4C23A 1QSYA 3QEVA 3HSTB 2VCPA 2FSJA 1RDAA 1X9JA 3AAPA 3OYLA 3SJJA 1S22A 3G10A 2J0JA 1S6PA 5AQVA 3FFIA 4DUYK 3RRHA 2GELA 3CCJN 3RMCA 1LOTB 1XI1A 1C0UA 2CQUA 5C0YA 4Z4EA 5AQHA 3ZCMA 1TAUA 1HQUA 4FPBA 1ASVA 1WSEA 4CFDA 2OZSA 4CGIA 1WBBA 3A5MC 2GUIA 1MU2A 2O8CA 3ZEUA 2D0OA 4F2RA 3FLVA 4O4GA 1BISA 1BO5O 1Q86O 3THYA 3OYEA 4DU4A 3U7DA 4PL8A 3MCAB 5AQSA 4O5FA 2D4WA 1EXQA 2ASPA 3AO4A 2RKIA 1NGFA 3QEPA 1HKCA 3PLAA 4B1ZA 5DK5A 3ZSVA 5JVGL 4Z0UA 3OW2M 3HBTA 4JI1K 3NF6A 4CIFA 3VQDA 2O8BA 4DFPA 3S9HA 2JWLA 4YORA 4DQ8A 4Z4GA 1VQON 4ID1A 3VEVA 2V51B 4IOCL 3GBTA 4CGJA 3S3OA 3NDKA 5AR0A 4IJAA 1A5XA 2BGGA 4FWRA 4B9MA 5LMUK 4Y1CA 1U2VA 5J1EA 3K0SA 3FP5A 3KVGA 1GLEG 3HJFA 2IGIA 2RQ1A 3SAFA 4LF6K 4L3QA 2O8FA 5CE3A 2GV9A 4IG3A 4W5QA 3O3FA 1NKEA 1JJ2M 2Q97A 3K5NA 2FBXA 1F21A 2KZMA 2F96A 2FBYA 2I7PA 5EOYA 3PIOL 3PO4A 4FZYA 3JYTA 4CZGA 2X6NA 3PSIA 3P5JA 4LF7K 2NRRA 1JLCA 3KLIA 3BEXA 4HUGA 2Q3SA 2COPA 2VWKA 2HBKA 3Q7CA 1EETA 3V1OA 4BQLA 1QS4A 1Q9YA 1TYQB 2ZJPL 1OVQA 1ZC6A 3DRPA 2ETJA 5BRHA 4A59A 4JKCA 5C42A 4E7IA 3A5LC 5EX5A 2F7TA 1ST7A 1NGAA 5CYMA 3PX6A 1D5AA 3AO1A 3O1WA 4FWKA 1T3VA 3V6DA 1Q7YO 4YNQA 1SL1A 4CYEA 4DS4A 3O9UA 4CEBA 2HHWA 4H0OA 3HP6A 3AAQA 4JRPA 5M1QA 3O5BA 1KVCA 4W5RA 3OYNA 1FXXA 1C0GA 1VSIA 1Q8IA 4FW2A 1QTMA 4HUEA 4WYBA 3NAEA 3FZLA 4DTMA 4GKKK 1IKXA 1EWRA 4JKBA 3PO5A 1BQNA 1BA1A 2A42A 3SQ1A 4DU3A 3HI0A 1GLLO 1KBLA 4DLGA 4AHTA 4IBNA 2OCEA 3AV9A 1EX4A 4JAXA 3OYFA 3QFUA 1RDCA 3KK2A 3U6FA 4F3TA 1J9AA 4YFUA 4I2QA 3CC7N 3CFOA 1NGCA 3NF8A 4CD3A 4B9VA 5HROA 2WBNA 2P9LB 4ELUA 4DU1A 2UUAK 3AVNA 5FRMA 3BF3A 1VBHA 1XMOK 3TSPA 1DTTA 4TSXA 1O1WA 4CIGA 3TANA 2NRWA 3LDLA 3VENA 2HHSA 1HLUA 3TAMA 4C1NK 4BRNA 3I33A 2YHBA 2PZSA 1WLJA 3DXMB 1ATNA 4IO9L 4CD1A 2NRZA 3HPHA 3CCLN 4KHSA 4WE1A 1WSGA 4DQIA 5F0XA 2QEXN 4CZHA 4IFVA 3ZSWA 2HB5A 2VQFK 4HTLA 4YOWA 1XNQK 2FLOA 4FWNA 1S72N 4RW4A 4CEDA 3TWHA 3J7YP 5CZ2A 2XY6A 4DQPA 1DEJA 1YVNA 4B9NA 3UKUA 4CEEA 4L8RB 5TKYA 1LCUA 1QQMA 3EY1A 2QWRA 2HNZA 2ZPYA 3H1VX 4IKFA 4FWSA 3CMAN 1HNVA 3R3LA 2P1JA 4FWOA 3ZSRA 4KBOA 3OBWA 5C15A 4BG9A 5JLHA 2HMIA 4Z4IA 3C6AA 4CERA 4OLBA 4O8KA 1EWQA 4CJSA 4OPHA 4KTWA 5KGXA 1TV6A 3J7ZO 3FFKB 2HE7A 3NBPA 4ICLA 3EYZA 3OBYA 3V9UA 1NJXA 4BR7A 2LSNA 4K43A 1SKRA 1BUPA 2E2OA 3ID6A 3SCXA 4GW6A 3W3DA 2PY5A 1JLQA 4H8KA 3SNNA 1Q82O 1T6DA 4FJXA 2WC9A 1VAZA 2A1SA 1NJZA 4NO7A 1Z25A 3FZMA 3VQ7A 4I6MB 4EHTA 5AZJA 3P38A 3CERA 1KD1O 1HKBA 1RGIA 3CJCA 2PAVA 3HOTA 4PKGA 4BR2A 5IT9O 3CXCM 3MWPA 1DIKA 4BG8A 1GC6A 5BREA 3NMUA 1YVUA 4K0KK 3D2EA 4YDUA 3CIPA 1ZBLA 4G9ZA 4FJJA 2ZQBA 4DFKA 1TK8A 4OVLA 5GAEP 1JL1A 5GIPA 3NCIA 3ISNC 4DB3A 4BROA 4OPJA 3HPOA 4M7YA 4E7KA 4FZXC 2ZWHA 3F73A 1HUXA 1EKEA 3LPUA 3SQ0A 4CGGA 4KAZA 3QDKA 4OX9K 1YITN 3SUQA 4I6MA 3WQTA 4DTPA 1C0TA 1V4TA 4BRGA 3DYAA 2F8TA 3AVGA 4O0IA 2QWNA 3L8BA 1NJIO 3H6EA 1E5WA 3U3YA 3AO3A 1BU6O 5GIOA 3HT3A 1UOCA 1KTQA 4X66K 3VESA 1GOAA 2XO7A 5LJWA 5AQRA 5HL7L 3RMBA 4MLHA 1ISNA 2DY4A 3K57A 5JVLA 1GLBG 2Q2RA 4CZKA 2LBBA 1GLAG 3M8SA 2HRJA 1JCGA 5HLFA 4H5VA 1K8KB 1S1TA 2QWLA 2V7ZA 3SLCA 4C8NA 2YHAA 3SZ2A 4FK2A 3ULEB 1H4RA 2ITMA 4YOVA 1VQ5N 4ZTFA 3V1RA 1GOBA 4RW6A 3I55N 2VYPA 1ZYQA 1UA1A 1C6VA 1S1WA 2XY5A 2D2QA 5AQNA 3EL2A 3H45C 3VTIA 4H0VB 4V19S 3O08A 2ZJQL 1Z6RA 2HBJA 4CJPA 1QQOA 5EVZA 1YJWN 2Q31A 3V9XA 3ENHA 3DLLL 4LFCK 3AO2A 1KVAA 3NVKA 1TKTA 3MK6A 2QKKA 1KLNA 3M3ZA 1HPZA 1NGGA 3E1YA 3UB5A 3LL3A 3HK2A 3SAGA 1WSJA 4OGEA 4DSKA 1R0AA 3HVRA 1Z05A 3O80A 2NNWA 4CGFA 4AM6A 1NWKA 3O9SA 2D0BA 3K59A 4X64K 4QS7A 3I0RA 3AVLA 5BR9A 5EXWA 4DTRA 5CYQA 3ZX0A 2D0PA 3F5TA 2BTFA 3ZDTA 2W6LA 3L2UA 1BI4A 1BIUA 3L3UA 1W0HA 5SZTA 4Q0BA 3AVMA 4WQ4C 3QNNA 4ISGA 2KW4A 3KK7A 1VSDA 3IS9A 4JI0K 2BE2A 3NVMA 4IG0A 2KLAA 2NLXA 3RMDA 4DV1K 3D2FB 3O6WA 4DSIA 2E6LA 2W6KA 4B1UB 3H08A 3L2WA 1KC8O 4K8ZA 1YUWA 1JXEA 2ZGYA 3T1HK 5AQWA 5AZIB 2VQEK 4CHQA 4WFNL 3PX0A 4JI2K 4WF9L 3DMJA 3JAMO 1LWFA 5J2QA 4N47A 4B1XB 4FJ9A 3VQ4A 3RRGA 4AH9A 3ZSOA 4KHPK 2V52B 3J7AP 4B8AB 1JCFA 3JS6A 3P31A 3T3FA 4BRHA 3CCRN 1Y97A 4A5BA 3WXLA 4H4MA 1YHQN 4EZ9A 4O5BA 4CJKA 4P7IA 4AILC 3MXJA 5M1PA 3CC4N 3S3NA 1JLEA 4IO8A 4CJLA 2YX6A 4BRDA 4FJHA 1IBKK 1RFQA 4CHOA 3BZKA 4NYNA 2A5XA 4DV0K 4PY5A 4BRFA 3OA9A 4NXNK 4DQSA 4H5RA 1CXQA 4CGHA 1P90A 3C65A 2OYQA 4FJ8A 3H1QA 3O9QA 2JGUA 4CGDA 4BE0A 2E8AA 5ELZA 1NGJA 4N41A 4LH5A 2P9NA 1KLMA 4AHUA 2G8WA 4HCCA 1RDWX 4GXBA 5AQZA 4H03B 2AP1A 1OH8A 3THVA 1IH7A 1T05A 5KQ8A 4IWVA 1VQPN 3CJ1A 2BH1A 5CY4A 2E88A 3F9KA 3IDHA 1NGEA 4DTUA 4LF5K 4KHWA 1J53A 1CZBA 4AHRA 4HDQA 1MWMA 2EWSA 3DLKA 4WQ5C 3RR7A 4FVUA 3ASMA 1MA9B 2PBDA 4LC9B 3V9ZA 3D7EO 3QEIA 4NCBA 4JYAK 5AQOA 4CCHA 1TK0A 3KZBA 4F8RA 4JKGA 4BR9A 4FLWA 3ZT2A 3RSEB 2P9UA 3VEOA 3BP8A 4WFBL 2Y1JA 2XY8A 4JKHA 4B3SK 4UY8O 4GKJK 4GV6A 2QTDA 3LDOA 3CCSN 1VSJA 3F2KA 3DLBA 1RTIA 3CQYA 4A61A 4DWIA 3SUPA 2FF6A 1XC9A 4KV8A 4DR1K 2YVCA 4KH4A 3OJSA 4B1VA 4H0YB 4CJ5A 3OYBA 1NK5A 1A5WA 3VEWA 4KKOA 5JICA 1B9DA 5FLXO 1U47A 1ATSA 5M1FA 3V4IA 4KFBA 5BRDA 4PKIA 1VRUA 3NFAA 3CM6A 4EZ6A 4ILHA 3ITHA 2KTQA 2ABDA 3FZHA 4DV7K 4HDOA 2QA4N 2Z1JA 5HRSA 3D0PA 1WOQA 1E4FT 4J2BA 3ZSQA 1TL3A 1UAXA 2EMTA 2P51A 4RTFD 4BRMA 3OYCA 3MN9A 4FLTA 4M45A 2GTDA 2IIRA 1X1PA 5MLCQ 4DCHA 5CHIA 4CFCA 4DSLA 5AQPA 2J0KA 3TPQA 2OPQA 3VGMA 3EPYA 3M5RA 5KTQA 1BCOA 3L2QA 2HBLA 5M1OA 3AO5A 1GG3A 3L3VA 2VGNA 5C2FA 2NRHA 4LSLA 5GAGP 4FK4A 5F2RA 2IS3A 4KPYA 2ASOA 2B6AA 3ENOA 1TKDA 1QZ6A 3MCPA 3NF7A 3OHRA 4J8FA 3D6RA 3EZWA 5ADXA 1VQLN 2F9TA 4KO0A 3LANA 4XH5A 3EKUA 5I9EB 4H0PA 3SPZA 3AA5X 2HHTA 1YAGA 3ATUA 3IMXA 3CMEN 5JS2A 2XHBA 5BPMA 3E9LA 1OVYA 3K9KA 4H0XB 1TVRA 3AVJA 2DFHA 3AVKA 4OPKA 4EKUA 2WUSA 1IG9A 2ITGA 4F3OA 1U04A 3WNHA 3THXB 4CJEA 3KLHA 4E1JA 1S1XA 4CEQA 4JI6K 2HF4A 4CIEA 5BRFA 3ZSYA 1X9MA 3VQ9A 4BDZA 1NGDA 1JL2A 1FKOA 3AVFA 3EE9A 4C8MA 1TL1A 1VQKN 1UWBA 3CQ8A 4E7JA 5J2MA 1D8YA 1W9HA 5FROA 3NF9A 4FJMA 3HPGA 4KHQA 1NOZA 2OANA 3KWGA 4HTUA 1M90O 4CFAA 1S1VA 5M1NA 3I56N 2JLEA 3GOIA 5AJ3K 1NGBA 1NLVA 2ZD1A 3ZYYX 4FPAA 4N56A 3K5LA 1IKYA 4JI4K 4E0DA 4M63C 3KTQA 1SGHA 1SAZA 1VSEA 4CJQA 3WQUA 3LDQA 1RBVA 4IFEA 2IC3A 3TTFA 3KLFA 3ZETB 1RDDA 3RMAA 2VWBA 3OYDA 1A5VA 3HM9A 4DV4K 4LY7A 3BINA 1HJOA 1TYQA 3CCVN 4DV6K 2G8FA 4CZIA 3LPTA 4BWMA 4E19A 3KIOA 1GOCA 1NGHA 4KH6A 5GADP 3U3GA 3VF2A 1Q18A 3VQAA 4EAHD 4CHYA 3HL8A 1KRPA 3G9WA 1R59O 4FCYA 4B3MK 4LF4K 2P9SB 3PV8A 1TKXA 4FJIA 4CK1A 4JS5A 5H1SQ 4KI6A 1ASUA 2ZE2A 4PL7A 3TAFA 2WTUA 3SV4A 1NK6A 4JI8K 1ITGA 2P9KB 3C95A 4CEOA 5GINA 1FJGK 3WUHA 2XY7A 3VQBA 2FBVA 2WOMA 3L6QA 4A2AA 4JD2B 3RVCA 3OYMA 1NI2A 3CF5L 1DKGD 4RG8A 2GX9A 4BE1A 1WNSA 2KZZA 1VQMN 3AY9A 1RBUA 3DXKB 2HSTA 1GGOA 1ZBUA 4DR7K 4BREA 2IDOA 5BN8A 1U4BA 2DTUA 1Y64A 3SV3A 4JK7A 2P9SA 3D45A 5JS1A 5IWAK 3VEXA 4O0JA 2P9LA 3P39A 1LW0A 1WB9A 4CZFA 2IOCA 3LP0A 3LP2A 4KREA 3WEEB 5AFUA 1ZBFA 3KJVA 3T7ZA 3ZLJA 5AQTA 4FLUA 2O4GA 4DR5K 2Z1GA 2P9IB 4K8XA 1CXUA 3DXMA 3FR0A 3CD6N 1I3AA 3O3GA 4DTSA 4IOAL 3PY8A 5E41A 4JD2A 4WCEL 4CF8A 2X78A 3TABA 1L5UA 5I42A 3FZKA 1VSMA 4AM7A 4NY0A 3HSCA 3DXKA 1BA0A 1V4SA 3SMPA 2YI1A 3L2VA 2QW9A 4M41A 4CJTA 3VETA 1HPMA 1NM1A 4CK3A 1MIZB 3EO3A 1WN7A 1K9MO 2UXDK 1IJJA 3SJHA 4FJGA 1JLAA 1BOTO 3T19A 4N5SA 1S6QA 4BDPA 5F1XA 3I8BA 4FWQA 2VWJA 1KFDA 4FZZA 1QQNA 3ZX2A 2ZF5O 3WNEA 4M3RA 2P9IA 3QLHA 4JEPA 2ZM6K 2HHHK 1VQ6N 2DPNA 2HHVA 3UE5A 4B1WB 1NNEA 3O1BA 3V9WA 3TTDA 1HRHA 2X0SA 2VG7A 3KLEA 1L3VA 2Y1IA 4E89A 3I0SA 2Q0UA 4JRQA 3P83D 3K9JA 3QERA 3SBGA 1SKSA 2NRVA 1QHTA 4JKAA 1RDBA 3LP3A 4B1YB 4MFBA 3LDSA 5FPNA 1ASWA 3EEQA 1KVBA 1QHAA 4WQ4A 4B3OA 2IVOA 2G8KA 1C1BA 4PHTX 2OZMA 3HXMA 4CE9A 4I9QA 1N5YA 1HMVA 3OYJA 3MEDA 3HO1A 4DF8A 3W0LA 2ZJRL 1DT9A 1VQ8N 3L0QA 3CETA 4DHYA 3MX2A 4JI5K 3QFPA 3WXIA 3DLHA 1C1AA 3VTHA 3WXMB 1Q81O 4H5NA 4QOZB 1T6CA 2UU9K 4Z4CA 3OJUA 4PKHA 3M8RA 3LM9A 4U67L 1YI2N 4FSVA 4ID5A 3OVNA 3ZT4A 3CG7A 3VERA 1TUUA 3QIPA 3OS2A 1WBDA 1XQSC 3H3OB 4EFHA 2KHOA 3LDNA 3DOKA 5T7BA 1XC3A 3QETA 4RW7A 3VF6A 5J2PA 5HP1A 2D11A 2NRXA 3MN6A 2YHXA 4E1NA 4BC4A 1VSLA 1J54A 2YNIA 4CBUA 1BDGA 4DMNA 2QWMA 4CEZA 2X6SA 4FM0A 1SS6A 4BACA 4OKEA 4GV9A 4KH5A 1BCMA 3ULDA 2CGLA 4B3RK 4CEAA 1N32K 1WUAA 3QIJA 3QO9A 2CH6A 4EP5A 1H1VA 5ADXH 4Z4HA 1LW2A 1HNWK 3LAKA 3QESA 5JLFA 1SUQA 2HW3A 1RTHA 1XWLA 3E9OA 1HYZA 4B8CA 3NGZA 4CESA 3CC2N 5CZ1A 4KTZA 1HB6A 4YOUA 4CJFA 4OPAA 4JN4A 4JKDA 3JXUA 4IDHA 3ZT1A 2NUBA 1K8KA 3TAGA 3KLGA 4CI6A 5AQIA 1QZ5A 3ULEA 3TSUA 4OJRA 3LAMA 1N33K 2BANA 2QWQA 4YL8A 3VGKA 3CYMA 4BWJA 4KHUA 1NGIA 4MDBA 4DR4K 4IFYA 1RCHA 4WQ5A 5FRNA 1MWKA 1OH7A 3SAHA 1MK7B 4BC2A 4AQYK 4JI3K 4F7GA 4JK9A 1E4GT 1W97L 4LFBK 3M8QA 1DLOA 2E5LK 4LF9K 3PVLA 3KK1A 2YCHA 2R7YA 5JVHL 1KFSA 4FM2A 4ELVA 1WSHA 3UKRB 4JHDB 2Q0RA 3V9SA 2RN2A 4CECA 3B8AX 1QQCA 4I2PA 2YNGA 2JWKA 3SMSA 4QCLA 1E3MA 3PIPL 4Y1DA 4BE2A 1HBKA 4CF2A 2P9PB 3MAQA 1DTQA 2YHYA 2UXCK 2R82A 2HHXA 1RT2A 5I3UA 3WNGA 3NH0A 1KAXA 3OY9A 5KGWA 3E01A 3AU4A 1JLFA 3MECA 1NG9A 1U6ZA 3AVCA 1X3NA 3MN7A 1T7PA 4BRAA 1B92A 3NE6A 3PSFA 4CZEA 3G6EN 5AQQA 4HWIA 2KFZA 1NK7A 2VG5A 3KHYA 1J6ZA 1TKZA 1LAWA 2FF3B 4H5TA 4EP4A 3DI6A 4K41A 4FLVA 4XIUA 3DAWA 1SL2A 4ISFA 3D2FA 2QXLA 4YHHK 4DF4A 2NZTA 1D9DA 3RWUA 2HF3A 3R6MA 3RTVA 5HBMA 5E26A 4CF9A 3M1FA 1RT3A 2FDQA 2A1RA 3QMLA 4CJWA 5C12A 4FWPA 5AZIA 5DM7L 5LMNK 2QKBA 4DSEA 3AARA 3HM8A 2F4VK 2FSKA 4FM1A 1BIZA 1ACAA 1GLJO 1QVFM 2E4LA 2HVHA 4LH4A 1NMDA 4XEIA 4M3YA 1VBGA 2I7NA 3FLCO 4ISEA 3CJ7A 1NBWA 2J0MA 2YJFA 1HNIA 3BF1A 2BDPA 1SL0A 2IVPA 4UQGA 4C8KA 2P5OA 3U9ZA 1VK0A 3U8XA 3A5NC 2HMPA 3LZIA 5KI6A 2A41A 4I9LA 3A2FA 3O4QA 4CVNE 1WAFA 3C6UA 2CGJA 4KTQA 4GMJB 3S3MA 2PYLA 4F2SA 3R1XA 3TSQA 3CCUN 2UXBK 1JXBA 4FYDA 2D5RA 3LM2A 4NCGA 4E7HA 5AFUH 4BC5A 4ZRKA 3C6TA 1SV5A 1YF5L 3V1QA 3DLRA 3E66A 3KKSA 3LWLA 3O3HA 1LV5A 3B6OA 1YTAA 3EZ5A 3L2RA 3GDQA 1I94K 4GY2B 5AQFA 4HVJA 4IEIA 5AQGA 5FPDA 4FXDA 4E1MA 4JS4A 3TARA 1L3SA 1N6QA 1KQSM 3VGLA 2YKNA 4C1NI 3J80O 4BR5A 4FVMA 4BGAA 3VEYA 4EHUA 1RBSA 3N4QA 1SQKA 4LSNA 1IKWA 3RSEA 3VN5A 4CHNA 3KKRA 4IOXA 1FK9A 3LZJA 2FXUA 4FO0A 1RT5A 2EX3A 2O8BB 4W5OA 4AHCA 3ZSXA 1RTJA 3HZ6A 4TKNA 3L4QA 3C6HA 4BC3A 4J2EA 1XHZA 3ZT0A 4X65K 3QB0A 2PFUA 2W41A 1U2VB 1M1KO 4CJUA 3MMVA 3OYAA 4W5NA 2RE2A 1FKPA 3NHGA 1HQEA 4A62A 2O8FB 4LF8K 4DR2K 5KQDA 1UA0A 3IAYA 5E84A 1WSFA 4DQQA 4A2BA 4GNIA 1XUPO 1T8EA 2QM1A 3VF4A 1TAQA 1YTUA 4KB1A 2FJ9A 1W2BM 3H3NO 3NGIA 4ELTA 3CCMN 4CEFA 1B9FA 2GWKA 5DMRA 3Q7BA 2D0AA 2D10A 1JLGA 3LALA 1NJYA 1RT7A 3M6GA 3TAEA 2GUPA 2UUCK 4ZRJA 1HB8A 5C24A 4X62K 3L4IA 2HBMA 3PUFA 1J19A 4H4OA 1VHXA 1QVGM 4KHNA 1VSFA 2A3ZA 2BUPA 2YNFA 1ESVA 1QSSA 5AQMA 4A57A 3HOSA 4DFJA 3BZCA 1NU0A 3U4LA 2OTJN 4N76A 4KB0A 1J5EK 1YT3A 4M3WA 3DWLA 1O13A 4KI4A 4BRIA 1NK9A 1NK8A 1D4XA 2E2NA 4DS5A 4M3XA 4M3ZA 4FJ7A 3G25A 3HTVA 4IEEA 2FSNA 2HHUA 1G99A 3SQ2A 1S1UA 4K25A 1DGKN 3THXA 2OPRA 5M1KA 4RWTA 3ALYA 3FGUA 4CJ4A 1GLCG 4AF1A 3VQ6A 2NRTA 3SPYA 4DQRA 5FPMA 2Q1NA 3ATVA 1ZBSA 2QK9A 3EN9A 5AQKA 3P1GA 4H5WA 3T1AA 2WFBA 5KPTA 4CBXA 1L3TA 4CJRA 1GC7A 2HVIA 1I39A 3SBTA 3R9PA 3VA3A 5SWMA 2KQ2A 3HYFA 5HRPA 3NH1A 4CHZA 4OGCA 1VQ9N 4G1QA 1N36K 4MO5A 3RR8A 4O55A 1T44A 1FW6A 1Y19B 3G0ZA 2KKZA 3SI6A 1BG3A 2YKMA 3QICA 3PZDA 4C8OA 4BVOA 3F9MA 2E2PA 4MDAA 3WNFA 3GG4A 3S41A 3IG1A 4JKFA 3ZETA 2VG6A 3OTOK 1X9WA 1CLQA 1KXPA 3QIOA 4Q5VA 2AA4A 1GLDG 3M8PA 4ZTJA 3GE1A 4DG1A 4E3SA 1TK5A 4J2AA 3UKUB 4BQZA 3SYZA 1XNRK 3DOLA 3IUCA 5C25A 1Z26A 3O9TA 4J2DA 3TU5A 3OYIA 3JSMA 1N8RO 1JCEA 3CQXA 3AGKA 4FLXA 3K5OA 2P5GA 2Z1HA 3KWIA 3P4IA 4PUOA 3IVFA 4DKWA 1X9SA 3DLEA 1L3UA 5LY3A 3VQEA 1WAJA 4ILGB 3U9DA 2P9KA 4JKEA 2HNDA 1S5JA 3CJAA 3OS1A 3QBXA 3CCEN 3QBWA 1KAYA 4FOEA 3VOVA 3C0BA 3E9PA 3OYHA 5AQUA 4BY9C 1RT1A 3QEXA 2A6AA 2EHGA 1S3XA 1RT6A 3AVAA 1IBLK 5AZJB 2G8HA 1TGOA 4FJ5A 4U7BA 1NK0A 4OKJA 5KPZA 4BR0A 4IXCA 4CF1A 4CZMA 3AU5A 2Q36A 2RPIA 4B08A 2E6MA 1Q9XA 3CJBA 4BVPA 2HHQA 5CR4A 2E20A 4B9UA 3HVTA 4XH1A 1YJ9N 1D9FA 1KAZA 4DSFA 1RILA 1K73O 3D2EB 1VSKA 4JV5K 3MEEA 4IDKA 3WEEA 3A5OC 1HX1A 1RDUA 1EO1A 4DTOA 4CK2A 4O44A 5JMVA 5BPNA 2YHWA 1BHLA 1HJRA 4RCHA 5C10A 4JI7K 1BQMA 4QAGA 4ILJA 3VQQA 4W5TA 4FL9A 4AHVA 3BDPA 3ZSZA 5HRNA 2B4JA 4OO1J 3PX4A 3LWMA 5AQLA 3NH2A 4DFMA 2WONA 3X23A 1MDUB 4DTXA 3CI5A 4A5AA 4GVEA 3DLGA 5GAHP 1NVLA 3VQCA 4M3UA 2H3GX 3ID8A 4CW7B 3VQ5A 4F4KA 1SKWA 1HR0K 3MN5A 3ENBA 1HNXK 3TR8A 5LL6Z 4E7LA
chains in the Genus database with same CATH topology
1WOQA 1HBKA 4JAXA 1E4FT 2P9PB 2YHYA 4BR4A 2EMTA 2R82A 3FZFA 3QFUA 4RTFD 3IKMA 3MDQA 4BRMA 3MN9A 1EF1A 1KAXA 2GTDA 3G4SN 2E2QA 3CC7N 3AU4A 4YOYA 1ATRA 3MX5A 2IIRA 2F9WA 4MO4A 4QS9A 5MLCQ 4DCHA 5CHIA 2AEHA 1U6ZA 1NGCA 1X3NA 3MN7A 4CD3A 5B8HA 4JNEA 2WBNA 4BRAA 2EMSA 5AQPA 2V7YA 2J0KA 3TPQA 3VGMA 2P9LB 3EPYA 2HOEA 1MK9B 3M5RA 5AQQA 4HWIA 2HBLA 4CZEA 5M1OA 5IJMA 3G6EN 1GG3A 3BF3A 1VBHA 3KHYA 2VGNA 5C2FA 1YIJN 2NRHA 4JK8A 3TSPA 5GAGP 1J6ZA 3LDPA 5F2RA 2FF3B 4H5TA 5AQYA 2ASOA 2NRWA 3LDLA 4K41A 4IJNA 3ENOA 1VQ7N 1QZ6A 3VENA 3DAWA 1HLUA 1SZ2A 3MCPA 4ISFA 4C1NK 3D2FA 2QXLA 3I33A 3OHRA 4J8FA 4BRNA 3D6RA 5FPEA 4NLBA 3EZWA 2NZTA 4BRKA 5ADXA 2F9TA 3DXMB 3AGRA 1VQLN 1ATNA 4IO9L 3T69A 4IZ9A 2HF3A 3R6MA 4XH4A 4XH5A 3EKUA 4CD1A 2NRZA 5E26A 5I9EB 3CCLN 3GL1A 3M1FA 2FDQA 4H0PA 3QMLA 1OKJA 5C12A 5F0XA 2QEXN 4FWPA 4CZHA 5AZIA 1YAGA 3ATUA 3IMXA 5DM7L 3CMEN 3AARA 5BPMA 2ZGZA 3E9LA 3HM8A 1OVYA 5DM6L 2FSKA 4NLCA 3K9KA 3WXJA 4HTLA 4YOWA 4H0XB 2FLOA 1ACAA 4FWNA 1S72N 1GLJO 1QVFM 3O4WA 3IFRA 1NMDA 3O8MA 4XEIA 1VBGA 2GWJA 2I7NA 4EKUA 2WUSA 3FLCO 4ISEA 3R8EA 1K8AO 1DEJA 1YVNA 3CJ7A 1YXQA 1NBWA 3UKUA 1P8ZA 2J0MA 2YJFA 3BF1A 4QS8A 4E1JA 5TKYA 1LCUA 2E1YA 2IVPA 4FWLA 4CZLA 1QQMA 4BGBA 2HF4A 1YJNN 3U9ZA 3U8XA 1IG8A 2QWRA 5BRFA 3A5NC 2ZPYA 3H1VX 4B9QA 2HMPA 1NGDA 1VQNN 5BN9A 4FWSA 2A41A 3CMAN 3R3LA 4FWOA 3EE9A 4O8UA 4KBOA 3OBWA 5C15A 4BG9A 5JLHA 2CGJA 4BRQA 3C6AA 4BRLA 1VQKN 4O8KA 5AQXA 5C2DA 4F9OA 1NTIA 3C7NB 4OPHA 3J7ZO 3EE8A 3FFKB 3R1XA 3TSQA 3CCUN 2I1KA 2OANA 2HE7A 3KWGA 3VMFB 1M90O 3OBYA 3MWTA 2GEMA 1TUYA 3LM2A 5M1NA 5AFUH 4BR7A 4BC5A 2RHKA 3I56N 3GOIA 4FWMA 4K43A 4ZRKA 1BUPA 2I1JA 2E2OA 4Z94A 2D1KA 3ID6A 4YOXA 1NGBA 1NLVA 3ZYYX 3W3DA 4FPAA 1YF5L 1Q82O 3WT0A 3A8YA 1T6DA 4K42A 2WC9A 1VAZA 4M63C 4NO7A 3HRGA 4YDUC 1SGHA 1SAZA 3E66A 3FZMA 3WQUA 3LDQA 4I6MB 4IFEA 4EHTA 5AZJA 3P38A 3TTFA 3CERA 3ZETB 3GDQA 4GY2B 5AQFA 3TTCA 4IEIA 5AQGA 2VWBA 1KD1O 1HKBA 3EKSA 5FPDA 3CCQN 1RGIA 3CJCA 3ZX3A 3BINA 1HJOA 2PAVA 1KQSM 3VGLA 4C1NI 1TYQA 3HOTA 4PKGA 4BR2A 1BWFO 4BR5A 4CZIA 3MWPA 3CXCM 3CCVN 1DIKA 4BGAA 4BG8A 1GC6A 2UYTA 3VEYA 4EHUA 5BREA 3N4QA 4NB4A 3NMUA 1HKGA 1SQKA 3D2EA 4YDUA 3CIPA 1NGHA 4KH6A 5GADP 3C7NA 3RSEA 3VF2A 4G9ZA 1Q18A 4IOXA 3FE1A 4EAHD 2FXUA 4FO0A 2DIKA 5GAEP 5GIPA 3HZ6A 3G9WA 4TKNA 3L4QA 1VQ4N 3C6HA 4DB3A 4BROA 1R59O 4BRPA 4BC3A 4M7YA 5KPRA 2ZWHA 2P9SB 1JDEA 3WXKA 3CPWM 1HUXA 3QB0A 2CGKA 2PFUA 2W41A 1U2VB 1M1KO 3SK3A 4ZRIA 3QDKA 3MMVA 5H1SQ 1YITN 2YJEA 3UKRA 4I6MA 4JHDA 2RE2A 3WQTA 4PL7A 4FOIA 1MIXA 4A62A 1V4TA 4BRGA 5KQDA 2AL6A 5E84A 4A2BA 2CH5A 1XUPO 4GNIA 2P9KB 2QWNA 2P9NB 1NJIO 3H6EA 3VEZA 2QM1A 3VF4A 1E5WA 5GINA 1BU6O 3WUHA 5GIOA 4M7XA 3L6QA 4A2AA 4JD2B 3RVCA 1NI2A 3CF5L 2FJ9A 1W2BM 3H3NO 3VESA 1DKGD 1GLFO 2P9PA 1C0FA 3CCMN 2WH5A 5LJWA 5HOOA 5AQRA 5HL7L 4MLHA 2GX9A 1ISNA 2GWKA 1VQMN 5JVLA 3AY9A 1GLBG 3Q7BA 3DXKB 5LJVA 2HSTA 2D10A 1GGOA 4CZJA 4BREA 2Q2RA 4CZKA 5BN8A 2LBBA 1GLAG 2HRJA 1Y64A 3M6GA 2GUPA 4JK7A 4ZRJA 3G71N 1HB8A 1JCGA 2P9SA 4H5VA 1K8KB 2V7ZA 4DXAB 2QWLA 2VGMA 3VEXA 4GV3A 3SLCA 2P9LA 2ASMA 3P39A 3U8ZA 4JKGB 3ULEB 1H4RA 2ITMA 4YOVA 1CZAN 3L4IA 1VQ5N 2QI2A 4CZFA 3WEEB 2HBMA 2IVNA 2P9UB 5AFUA 1J19A 3T7ZA 3O9RA 3I55N 2VYPA 2W40A 5AQTA 1QVGM 2D2QA 2P9IB 5AQNA 3EL2A 3H45C 5EY4A 5TKWA 2A3ZA 2BUPA 3DXMA 3FR0A 4H0VB 3VTIA 3O08A 1ESVA 3CD6N 5AQMA 4A57A 3HOSA 4IOAL 2ZJQL 1Z6RA 2HBJA 4JD2A 1QQOA 5EVZA 4WCEL 1YJWN 3U4LA 2Q31A 3H46O 2OTJN 3ENHA 3DLLL 2J4RA 3DWLA 3NVKA 3FZKA 1O13A 2QWOA 3CHWA 2QWPA 4NY0A 3HSCA 3MK6A 4AM7A 3DXKA 4BRIA 1BA0A 1D4XA 3M3ZA 1V4SA 2E2NA 3SMPA 2YI1A 3VPZA 1NGGA 4BRCA 1X3MA 2QW9A 3G25A 1ZXOA 3HTVA 4IEEA 3E1YA 3WA0A 2FSNA 1EQYA 1G99A 3UB5A 3VETA 5BPLA 2OTLN 1HPMA 1NM1A 3LL3A 1MIZB 3EO3A 4R79A 1K9MO 3SAGA 4K25A 1DGKN 4EIAA 3A0IX 1IJJA 3SJHA 4CJ7A 1Z05A 3O80A 1BOTO 5M1KA 4RWTA 2NNWA 3DJCA 3FGUA 1GLCG 4AF1A 5F1XA 2NRTA 4AM6A 1NWKA 3O9SA 3I8BA 4FWQA 1KC7A 5FPMA 2Q1NA 3ATVA 3N4PA 4QS7A 4CBWA 3ZEUB 1ZBSA 4Y0WA 1QQNA 3ZX2A 3EN9A 2ZF5O 3CPEA 5AQKA 2P9IA 3BUZB 3CJ9A 5EXWA 5BR9A 4JEPA 3ZX0A 4H5WA 2D0PA 2WFBA 5KPTA 3F5TA 4CBXA 1VQ6N 2BTFA 3ZDTA 2DPNA 3UE5A 4B1WB 4WFAL 3O1BA 1GC7A 2E1ZA 3SBTA 4MLEA 3R9PA 3TTDA 4WQ4C 3J8AA 5AQJA 4H0TB 4YOTA 2X0SA 4ISGA 2CB8A 3KK7A 1ILYA 2A40A 1VQ9N 4C23A 2Q0UA 4MO5A 2VCPA 3NVMA 2FSJA 3K9JA 1X9JA 3SBGA 1T44A 3AAPA 2NRVA 1S22A 5AQVA 2J0JA 4JKAA 2KLAA 2NLXA 1Y19B 3D2FB 2KKZA 3O6WA 4B1YB 1BG3A 2GELA 3CCJN 4B1UB 1LOTB 3QICA 3PZDA 5FPNA 4BVOA 2CQUA 3F9MA 5C0YA 1QHAA 2E2PA 4WQ4A 5AQHA 1KC8O 1YUWA 4MDAA 4FPBA 3GG4A 2IVOA 4PHTX 3S41A 2ZGYA 5AQWA 5AZIB 3A5MC 4WFNL 4JKFA 3ZETA 4WF9L 3ZEUA 3W0LA 4B1XB 1DT9A 1KXPA 3L0QA 2ZJRL 2D0OA 1VQ8N 3FLVA 2AA4A 1GLDG 1BO5O 3CETA 3MX2A 2V52B 4DHYA 1Q86O 3GE1A 3U7DA 4PL8A 1JCFA 3MCAB 3QFPA 5AQSA 3JS6A 3P31A 4O5FA 3WXIA 2D4WA 3VTHA 2ASPA 3WXMB 4BRHA 3CCRN 1Q81O 4H5NA 1NGFA 4A5BA 1HKCA 3PLAA 3WXLA 4B1ZA 1T6CA 1YHQN 5JVGL 3UKUB 4BQZA 3OW2M 3HBTA 4PKHA 3IUCA 4P7IA 3LM9A 4U67L 1YI2N 5M1PA 4FSVA 3O9TA 3CC4N 3TU5A 4IO8A 2JWLA 4YORA 2YX6A 3VERA 1TUUA 4BRDA 4DQ8A 1N8RO 1VQON 1XQSC 1JCEA 2V51B 1RFQA 3H3OB 3VEVA 3CQXA 4EFHA 2KHOA 3LDNA 3GBTA 3AGKA 4IOCL 5AR0A 2A5XA 1XC3A 4IJAA 4FWRA 4BRFA 3KWIA 3OA9A 3P4IA 3VF6A 1U2VA 4H5RA 2D11A 2NRXA 3MN6A 1P90A 3FP5A 2YHXA 3IVFA 4DKWA 3KVGA 1GLEG 4BC4A 3C65A 3H1QA 3O9QA 2RQ1A 3SAFA 2E8AA 4L3QA 1NGJA 5ELZA 4CBUA 1BDGA 5CE3A 5LY3A 2QWMA 1JJ2M 2Q97A 4ILGB 3U9DA 2P9KA 1SS6A 2P9NA 4JKEA 3CJAA 4GV9A 1RDWX 4GXBA 4KH5A 5AQZA 4H03B 3QBXA 2AP1A 2CGLA 2I7PA 1KAYA 3QBWA 4FOEA 5EOYA 3PIOL 3CCEN 4CZGA 3VOVA 3C0BA 3E9PA 1WUAA 3QIJA 5AQUA 4BY9C 2CH6A 2NRRA 5KQ8A 1H1VA 5ADXH 4IWVA 1VQPN 2A6AA 3CJ1A 2BH1A 1S3XA 2E88A 5JLFA 3BEXA 3IDHA 5AZJB 1NGEA 2COPA 4U7BA 3E9OA 4HDQA 1MWMA 2EWSA 4WQ5C 5KPZA 4FVUA 3CC2N 4BR0A 4IXCA 1HB6A 1MA9B 2HBKA 3Q7CA 4JN4A 3AU5A 2PBDA 4OPAA 2Q36A 4YOUA 4CZMA 4JKDA 4BQLA 3JXUA 4IDHA 4LC9B 3CJBA 3D7EO 4BVPA 1K8KA 1TYQB 5CR4A 1ZC6A 2ZJPL 5AQOA 2E20A 5BRHA 4XH1A 4CI6A 1YJ9N 5AQIA 4A59A 1QZ5A 4JKCA 3KZBA 1KAZA 4JKGA 3A5LC 3ULEA 3TSUA 4BR9A 1K73O 5EX5A 3D2EB 2F7TA 1ST7A 1NGAA 2QWQA 4YL8A 3VGKA 3WEEA 3RSEB 2P9UA 3VEOA 3BP8A 4WFBL 3O1WA 4FWKA 3A5OC 1HX1A 1T3VA 1NGIA 4JKHA 4MDBA 1Q7YO 4UY8O 1RDUA 4GV6A 4CYEA 1EO1A 2QTDA 3O9UA 4WQ5A 5JMVA 5BPNA 2YHWA 3LDOA 1MWKA 3CCSN 3F2KA 3SAHA 1MK7B 4H0OA 4BC2A 4RCHA 4F7GA 5C10A 4JK9A 3AAQA 3CQYA 1E4GT 5M1QA 1W97L 4ILJA 4A61A 2FF6A 3O5BA 3PVLA 2YVCA 2YCHA 4KH4A 4B1VA 4H0YB 4FL9A 5JVHL 1C0GA 3UKRB 3VEWA 4JHDB 4OO1J 2Q0RA 5AQLA 5JICA 4WYBA 3X23A 1MDUB 3FZLA 3B8AX 1ATSA 3CI5A 4A5AA 4GVEA 5M1FA 4JKBA 5GAHP 1BA1A 1NVLA 2A42A 2JWKA 2H3GX 3ID8A 3SMSA 5BRDA 4PKIA 3HI0A 1GLLO 3ENBA 4ILHA 1KBLA 3MN5A 3PIPL 2ABDA 3FZHA 4HDOA 2QA4N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILJ A;  4JKE A;  4JKF A;  4JKC A;  4JKG A;  3E66 A;  4JK7 A;  3E9P A;  3SBG A;  4JKA A;  4JKG B;  4JKB A;  3SBT A;  4JKH A;  4ILG B;  3E9O A;  3ENB A;  4ILH A;  3E9L A;  4JK9 A;  4JK8 A;  4JKD A; 
#chains in the Genus database with same CATH topology
 1G15 A;  3C94 A;  3UIQ A;  4BR4 A;  3FZF A;  3IKM A;  3MDQ A;  1EF1 A;  1HYS A;  5A2Q O;  3G4S N;  2B5J A;  2E2Q A;  4YOY A;  1ATR A;  3MX5 A;  4MQ3 A;  4MO4 A;  2F9W A;  4QS9 A;  3K58 A;  2AEH A;  4DTN A;  5B8H A;  2FBT A;  4JNE A;  1XMQ K;  2EMS A;  2V7Y A;  4R5P A;  4DLE A;  2G8I A;  2HOE A;  1MK9 B;  3AA3 A;  2X74 A;  3IRX A;  1N34 K;  4KRF A;  5IJM A;  4C8L A;  3TI0 A;  3AA2 A;  1YIJ N;  1LWC A;  4JK8 A;  2KFN A;  3LDP A;  5AQY A;  4IJN A;  1VQ7 N;  4PWD A;  1SZ2 A;  3SQ4 A;  3AVI A;  1NKB A;  5FPE A;  5FDL A;  1VRT A;  4NLB A;  4BRK A;  3TAQ A;  3AVB A;  3AGR A;  1S9G A;  3T69 A;  4IZ9 A;  4XH4 A;  4RW8 A;  3CFR A;  3LP1 A;  3MXM A;  3GL1 A;  1OKJ A;  1OH5 A;  3NGY A;  1OH6 A;  2ZGZ A;  5DM6 L;  4NLC A;  3WXJ A;  3OYK A;  4FJK A;  3O4W A;  3IFR A;  3O8M A;  2GWJ A;  3R8E A;  1K8A O;  1YXQ A;  2HNY A;  2XRI A;  1P8Z A;  1RT4 A;  4QS8 A;  3MEG A;  1C1C A;  2E1Y A;  4FWL A;  4CZL A;  3KD1 E;  3ZT3 A;  4BGB A;  1YJN N;  3CM5 A;  4DR3 K;  1IG8 A;  4KHY A;  4B9Q A;  1U45 A;  2O8D B;  1VQN N;  5BN9 A;  4O8U A;  1BI4 B;  4PA1 A;  4DTJ A;  4BRQ A;  4BRL A;  4B9S A;  1K6Y A;  1QSL A;  5AQX A;  5C2D A;  3TAP A;  4F9O A;  3QIN A;  3I8D A;  1NTI A;  3C7N B;  4CHP A;  4DSJ A;  4DV5 K;  3EE8 A;  5D3G A;  2I1K A;  1LAV A;  3VMF B;  4ZHR A;  2IAJ A;  2GEM A;  2YV0 X;  3B6P A;  1TUY A;  3MWT A;  4PQU A;  2RHK A;  2O4I A;  5KRT A;  5HRR A;  4FWM A;  2I1J A;  4Z94 A;  4YOX A;  2D1K A;  2PYJ A;  2DFE A;  1J5O A;  3WT0 A;  3A8Y A;  4CFB A;  4K42 A;  3V81 A;  2OPP A;  1IO2 A;  3VQ8 A;  3HRG A;  4YDU C;  1QE1 A;  4HUF A;  4DR6 K;  3CFP A;  1RBT A;  2UUB K;  5EU7 A;  3TTC A;  4B9L A;  1KCF A;  4M42 A;  1T03 A;  3EKS A;  2O8D A;  5BR8 K;  3CCQ N;  3ZX3 A;  3OS0 A;  1BWF O;  3K2P A;  4AHS A;  2G8U A;  2UYT A;  2RF2 A;  3AA4 A;  4DUZ K;  4NB4 A;  3DRS A;  1HKG A;  3C7N A;  2W42 A;  4RW9 A;  4FK0 A;  2O8E B;  3FE1 A;  2G8V A;  4NCA A;  2Z1I A;  2DIK A;  1JKH A;  2I5J A;  1VQ4 N;  2AJQ A;  4BRP A;  4BDY A;  3AVH A;  5KPR A;  3QEW A;  1JDE A;  4NYF A;  3WXK A;  3CPW M;  1REV A;  2CGK A;  2OPS A;  3SK3 A;  4ZRI A;  4JLH A;  2QXF A;  1U49 A;  2YJE A;  3UKR A;  4M3T A;  4JHD A;  3T1Y K;  4FOI A;  1ZBH A;  1MIX A;  1ZBI A;  2AL6 A;  2OA8 A;  4YY3 K;  5J2N A;  2CH5 A;  2P9N B;  3VEZ A;  3K5M A;  5K14 A;  1HYV A;  1XHX A;  1NKC A;  4OLA A;  3OYG A;  1LWE A;  4GVM A;  4M7X A;  3KK3 A;  1GLF O;  2P9P A;  1C0F A;  2WH5 A;  5HOO A;  1IV0 A;  2O8E A;  4I7F A;  3VQP A;  2F8S A;  3HP9 A;  5LJV A;  4CZJ A;  4DV3 K;  1KSP A;  4HHT A;  3G71 N;  1NOY A;  3DRR A;  4DXA B;  2VGM A;  4GV3 A;  4CJV A;  2ASM A;  3U8Z A;  4JKG B;  1RNH A;  4DV2 K;  1CZA N;  3THW B;  1HNZ K;  4FJN A;  2QI2 A;  1RBR A;  2IVN A;  2P9U B;  5KRS A;  3MXI A;  3O9R A;  1U48 A;  2W40 A;  1NMN A;  4FLY A;  4NXM K;  1JLB A;  4HCB A;  4LFA K;  3QNO A;  5EY4 A;  5TKW A;  1C0M A;  4CF0 A;  4B3T K;  1W7A A;  4B9T A;  1CZ9 A;  3O4N A;  1BGX T;  2FC0 A;  3H46 O;  1WSI A;  2J4R A;  1NJW A;  2QWO A;  3CHW A;  2QWP A;  3SUO A;  4OKK A;  1IKV A;  3VPZ A;  4LD0 A;  4BRC A;  1X3M A;  2DFF A;  1ZXO A;  3WA0 A;  2YNH A;  1EQY A;  5BPL A;  2OTL N;  4R79 A;  4EIA A;  3A0I X;  3BGR A;  4CJ7 A;  3SUN A;  1IBM K;  1NK4 A;  3THW A;  3J81 O;  4FLZ A;  1RTD A;  3DJC A;  1S9E A;  1KC7 A;  4CBW A;  3N4P A;  4Z4F A;  2O8C B;  2D0C A;  3ZEU B;  4Y0W A;  2ATQ A;  3CPE A;  3CJ9 A;  3BUZ B;  3KD5 E;  4FJL A;  4CJ3 A;  3VA0 A;  4FW1 A;  3THY B;  2GBZ A;  4WFA L;  1BL3 A;  3DM2 A;  2E1Z A;  1VSH A;  4MLE A;  3J8A A;  5AQJ A;  4H0T B;  1EP4 A;  4YOT A;  3BY5 A;  2CB8 A;  1ILY A;  2A40 A;  4C23 A;  1QSY A;  3QEV A;  3HST B;  2VCP A;  2FSJ A;  1RDA A;  1X9J A;  3AAP A;  3OYL A;  3SJJ A;  1S22 A;  3G10 A;  2J0J A;  1S6P A;  5AQV A;  3FFI A;  4DUY K;  3RRH A;  2GEL A;  3CCJ N;  3RMC A;  1LOT B;  1XI1 A;  1C0U A;  2CQU A;  5C0Y A;  4Z4E A;  5AQH A;  3ZCM A;  1TAU A;  1HQU A;  4FPB A;  1ASV A;  1WSE A;  4CFD A;  2OZS A;  4CGI A;  1WBB A;  3A5M C;  2GUI A;  1MU2 A;  2O8C A;  3ZEU A;  2D0O A;  4F2R A;  3FLV A;  4O4G A;  1BIS A;  1BO5 O;  1Q86 O;  3THY A;  3OYE A;  4DU4 A;  3U7D A;  4PL8 A;  3MCA B;  5AQS A;  4O5F A;  2D4W A;  1EXQ A;  2ASP A;  3AO4 A;  2RKI A;  1NGF A;  3QEP A;  1HKC A;  3PLA A;  4B1Z A;  5DK5 A;  3ZSV A;  5JVG L;  4Z0U A;  3OW2 M;  3HBT A;  4JI1 K;  3NF6 A;  4CIF A;  3VQD A;  2O8B A;  4DFP A;  3S9H A;  2JWL A;  4YOR A;  4DQ8 A;  4Z4G A;  1VQO N;  4ID1 A;  3VEV A;  2V51 B;  4IOC L;  3GBT A;  4CGJ A;  3S3O A;  3NDK A;  5AR0 A;  4IJA A;  1A5X A;  2BGG A;  4FWR A;  4B9M A;  5LMU K;  4Y1C A;  1U2V A;  5J1E A;  3K0S A;  3FP5 A;  3KVG A;  1GLE G;  3HJF A;  2IGI A;  2RQ1 A;  3SAF A;  4LF6 K;  4L3Q A;  2O8F A;  5CE3 A;  2GV9 A;  4IG3 A;  4W5Q A;  3O3F A;  1NKE A;  1JJ2 M;  2Q97 A;  3K5N A;  2FBX A;  1F21 A;  2KZM A;  2F96 A;  2FBY A;  2I7P A;  5EOY A;  3PIO L;  3PO4 A;  4FZY A;  3JYT A;  4CZG A;  2X6N A;  3PSI A;  3P5J A;  4LF7 K;  2NRR A;  1JLC A;  3KLI A;  3BEX A;  4HUG A;  2Q3S A;  2COP A;  2VWK A;  2HBK A;  3Q7C A;  1EET A;  3V1O A;  4BQL A;  1QS4 A;  1Q9Y A;  1TYQ B;  2ZJP L;  1OVQ A;  1ZC6 A;  3DRP A;  2ETJ A;  5BRH A;  4A59 A;  4JKC A;  5C42 A;  4E7I A;  3A5L C;  5EX5 A;  2F7T A;  1ST7 A;  1NGA A;  5CYM A;  3PX6 A;  1D5A A;  3AO1 A;  3O1W A;  4FWK A;  1T3V A;  3V6D A;  1Q7Y O;  4YNQ A;  1SL1 A;  4CYE A;  4DS4 A;  3O9U A;  4CEB A;  2HHW A;  4H0O A;  3HP6 A;  3AAQ A;  4JRP A;  5M1Q A;  3O5B A;  1KVC A;  4W5R A;  3OYN A;  1FXX A;  1C0G A;  1VSI A;  1Q8I A;  4FW2 A;  1QTM A;  4HUE A;  4WYB A;  3NAE A;  3FZL A;  4DTM A;  4GKK K;  1IKX A;  1EWR A;  4JKB A;  3PO5 A;  1BQN A;  1BA1 A;  2A42 A;  3SQ1 A;  4DU3 A;  3HI0 A;  1GLL O;  1KBL A;  4DLG A;  4AHT A;  4IBN A;  2OCE A;  3AV9 A;  1EX4 A;  4JAX A;  3OYF A;  3QFU A;  1RDC A;  3KK2 A;  3U6F A;  4F3T A;  1J9A A;  4YFU A;  4I2Q A;  3CC7 N;  3CFO A;  1NGC A;  3NF8 A;  4CD3 A;  4B9V A;  5HRO A;  2WBN A;  2P9L B;  4ELU A;  4DU1 A;  2UUA K;  3AVN A;  5FRM A;  3BF3 A;  1VBH A;  1XMO K;  3TSP A;  1DTT A;  4TSX A;  1O1W A;  4CIG A;  3TAN A;  2NRW A;  3LDL A;  3VEN A;  2HHS A;  1HLU A;  3TAM A;  4C1N K;  4BRN A;  3I33 A;  2YHB A;  2PZS A;  1WLJ A;  3DXM B;  1ATN A;  4IO9 L;  4CD1 A;  2NRZ A;  3HPH A;  3CCL N;  4KHS A;  4WE1 A;  1WSG A;  4DQI A;  5F0X A;  2QEX N;  4CZH A;  4IFV A;  3ZSW A;  2HB5 A;  2VQF K;  4HTL A;  4YOW A;  1XNQ K;  2FLO A;  4FWN A;  1S72 N;  4RW4 A;  4CED A;  3TWH A;  3J7Y P;  5CZ2 A;  2XY6 A;  4DQP A;  1DEJ A;  1YVN A;  4B9N A;  3UKU A;  4CEE A;  4L8R B;  5TKY A;  1LCU A;  1QQM A;  3EY1 A;  2QWR A;  2HNZ A;  2ZPY A;  3H1V X;  4IKF A;  4FWS A;  3CMA N;  1HNV A;  3R3L A;  2P1J A;  4FWO A;  3ZSR A;  4KBO A;  3OBW A;  5C15 A;  4BG9 A;  5JLH A;  2HMI A;  4Z4I A;  3C6A A;  4CER A;  4OLB A;  4O8K A;  1EWQ A;  4CJS A;  4OPH A;  4KTW A;  5KGX A;  1TV6 A;  3J7Z O;  3FFK B;  2HE7 A;  3NBP A;  4ICL A;  3EYZ A;  3OBY A;  3V9U A;  1NJX A;  4BR7 A;  2LSN A;  4K43 A;  1SKR A;  1BUP A;  2E2O A;  3ID6 A;  3SCX A;  4GW6 A;  3W3D A;  2PY5 A;  1JLQ A;  4H8K A;  3SNN A;  1Q82 O;  1T6D A;  4FJX A;  2WC9 A;  1VAZ A;  2A1S A;  1NJZ A;  4NO7 A;  1Z25 A;  3FZM A;  3VQ7 A;  4I6M B;  4EHT A;  5AZJ A;  3P38 A;  3CER A;  1KD1 O;  1HKB A;  1RGI A;  3CJC A;  2PAV A;  3HOT A;  4PKG A;  4BR2 A;  5IT9 O;  3CXC M;  3MWP A;  1DIK A;  4BG8 A;  1GC6 A;  5BRE A;  3NMU A;  1YVU A;  4K0K K;  3D2E A;  4YDU A;  3CIP A;  1ZBL A;  4G9Z A;  4FJJ A;  2ZQB A;  4DFK A;  1TK8 A;  4OVL A;  5GAE P;  1JL1 A;  5GIP A;  3NCI A;  3ISN C;  4DB3 A;  4BRO A;  4OPJ A;  3HPO A;  4M7Y A;  4E7K A;  4FZX C;  2ZWH A;  3F73 A;  1HUX A;  1EKE A;  3LPU A;  3SQ0 A;  4CGG A;  4KAZ A;  3QDK A;  4OX9 K;  1YIT N;  3SUQ A;  4I6M A;  3WQT A;  4DTP A;  1C0T A;  1V4T A;  4BRG A;  3DYA A;  2F8T A;  3AVG A;  4O0I A;  2QWN A;  3L8B A;  1NJI O;  3H6E A;  1E5W A;  3U3Y A;  3AO3 A;  1BU6 O;  5GIO A;  3HT3 A;  1UOC A;  1KTQ A;  4X66 K;  3VES A;  1GOA A;  2XO7 A;  5LJW A;  5AQR A;  5HL7 L;  3RMB A;  4MLH A;  1ISN A;  2DY4 A;  3K57 A;  5JVL A;  1GLB G;  2Q2R A;  4CZK A;  2LBB A;  1GLA G;  3M8S A;  2HRJ A;  1JCG A;  5HLF A;  4H5V A;  1K8K B;  1S1T A;  2QWL A;  2V7Z A;  3SLC A;  4C8N A;  2YHA A;  3SZ2 A;  4FK2 A;  3ULE B;  1H4R A;  2ITM A;  4YOV A;  1VQ5 N;  4ZTF A;  3V1R A;  1GOB A;  4RW6 A;  3I55 N;  2VYP A;  1ZYQ A;  1UA1 A;  1C6V A;  1S1W A;  2XY5 A;  2D2Q A;  5AQN A;  3EL2 A;  3H45 C;  3VTI A;  4H0V B;  4V19 S;  3O08 A;  2ZJQ L;  1Z6R A;  2HBJ A;  4CJP A;  1QQO A;  5EVZ A;  1YJW N;  2Q31 A;  3V9X A;  3ENH A;  3DLL L;  4LFC K;  3AO2 A;  1KVA A;  3NVK A;  1TKT A;  3MK6 A;  2QKK A;  1KLN A;  3M3Z A;  1HPZ A;  1NGG A;  3E1Y A;  3UB5 A;  3LL3 A;  3HK2 A;  3SAG A;  1WSJ A;  4OGE A;  4DSK A;  1R0A A;  3HVR A;  1Z05 A;  3O80 A;  2NNW A;  4CGF A;  4AM6 A;  1NWK A;  3O9S A;  2D0B A;  3K59 A;  4X64 K;  4QS7 A;  3I0R A;  3AVL A;  5BR9 A;  5EXW A;  4DTR A;  5CYQ A;  3ZX0 A;  2D0P A;  3F5T A;  2BTF A;  3ZDT A;  2W6L A;  3L2U A;  1BI4 A;  1BIU A;  3L3U A;  1W0H A;  5SZT A;  4Q0B A;  3AVM A;  4WQ4 C;  3QNN A;  4ISG A;  2KW4 A;  3KK7 A;  1VSD A;  3IS9 A;  4JI0 K;  2BE2 A;  3NVM A;  4IG0 A;  2KLA A;  2NLX A;  3RMD A;  4DV1 K;  3D2F B;  3O6W A;  4DSI A;  2E6L A;  2W6K A;  4B1U B;  3H08 A;  3L2W A;  1KC8 O;  4K8Z A;  1YUW A;  1JXE A;  2ZGY A;  3T1H K;  5AQW A;  5AZI B;  2VQE K;  4CHQ A;  4WFN L;  3PX0 A;  4JI2 K;  4WF9 L;  3DMJ A;  3JAM O;  1LWF A;  5J2Q A;  4N47 A;  4B1X B;  4FJ9 A;  3VQ4 A;  3RRG A;  4AH9 A;  3ZSO A;  4KHP K;  2V52 B;  3J7A P;  4B8A B;  1JCF A;  3JS6 A;  3P31 A;  3T3F A;  4BRH A;  3CCR N;  1Y97 A;  4A5B A;  3WXL A;  4H4M A;  1YHQ N;  4EZ9 A;  4O5B A;  4CJK A;  4P7I A;  4AIL C;  3MXJ A;  5M1P A;  3CC4 N;  3S3N A;  1JLE A;  4IO8 A;  4CJL A;  2YX6 A;  4BRD A;  4FJH A;  1IBK K;  1RFQ A;  4CHO A;  3BZK A;  4NYN A;  2A5X A;  4DV0 K;  4PY5 A;  4BRF A;  3OA9 A;  4NXN K;  4DQS A;  4H5R A;  1CXQ A;  4CGH A;  1P90 A;  3C65 A;  2OYQ A;  4FJ8 A;  3H1Q A;  3O9Q A;  2JGU A;  4CGD A;  4BE0 A;  2E8A A;  5ELZ A;  1NGJ A;  4N41 A;  4LH5 A;  2P9N A;  1KLM A;  4AHU A;  2G8W A;  4HCC A;  1RDW X;  4GXB A;  5AQZ A;  4H03 B;  2AP1 A;  1OH8 A;  3THV A;  1IH7 A;  1T05 A;  5KQ8 A;  4IWV A;  1VQP N;  3CJ1 A;  2BH1 A;  5CY4 A;  2E88 A;  3F9K A;  3IDH A;  1NGE A;  4DTU A;  4LF5 K;  4KHW A;  1J53 A;  1CZB A;  4AHR A;  4HDQ A;  1MWM A;  2EWS A;  3DLK A;  4WQ5 C;  3RR7 A;  4FVU A;  3ASM A;  1MA9 B;  2PBD A;  4LC9 B;  3V9Z A;  3D7E O;  3QEI A;  4NCB A;  4JYA K;  5AQO A;  4CCH A;  1TK0 A;  3KZB A;  4F8R A;  4JKG A;  4BR9 A;  4FLW A;  3ZT2 A;  3RSE B;  2P9U A;  3VEO A;  3BP8 A;  4WFB L;  2Y1J A;  2XY8 A;  4JKH A;  4B3S K;  4UY8 O;  4GKJ K;  4GV6 A;  2QTD A;  3LDO A;  3CCS N;  1VSJ A;  3F2K A;  3DLB A;  1RTI A;  3CQY A;  4A61 A;  4DWI A;  3SUP A;  2FF6 A;  1XC9 A;  4KV8 A;  4DR1 K;  2YVC A;  4KH4 A;  3OJS A;  4B1V A;  4H0Y B;  4CJ5 A;  3OYB A;  1NK5 A;  1A5W A;  3VEW A;  4KKO A;  5JIC A;  1B9D A;  5FLX O;  1U47 A;  1ATS A;  5M1F A;  3V4I A;  4KFB A;  5BRD A;  4PKI A;  1VRU A;  3NFA A;  3CM6 A;  4EZ6 A;  4ILH A;  3ITH A;  2KTQ A;  2ABD A;  3FZH A;  4DV7 K;  4HDO A;  2QA4 N;  2Z1J A;  5HRS A;  3D0P A;  1WOQ A;  1E4F T;  4J2B A;  3ZSQ A;  1TL3 A;  1UAX A;  2EMT A;  2P51 A;  4RTF D;  4BRM A;  3OYC A;  3MN9 A;  4FLT A;  4M45 A;  2GTD A;  2IIR A;  1X1P A;  5MLC Q;  4DCH A;  5CHI A;  4CFC A;  4DSL A;  5AQP A;  2J0K A;  3TPQ A;  2OPQ A;  3VGM A;  3EPY A;  3M5R A;  5KTQ A;  1BCO A;  3L2Q A;  2HBL A;  5M1O A;  3AO5 A;  1GG3 A;  3L3V A;  2VGN A;  5C2F A;  2NRH A;  4LSL A;  5GAG P;  4FK4 A;  5F2R A;  2IS3 A;  4KPY A;  2ASO A;  2B6A A;  3ENO A;  1TKD A;  1QZ6 A;  3MCP A;  3NF7 A;  3OHR A;  4J8F A;  3D6R A;  3EZW A;  5ADX A;  1VQL N;  2F9T A;  4KO0 A;  3LAN A;  4XH5 A;  3EKU A;  5I9E B;  4H0P A;  3SPZ A;  3AA5 X;  2HHT A;  1YAG A;  3ATU A;  3IMX A;  3CME N;  5JS2 A;  2XHB A;  5BPM A;  3E9L A;  1OVY A;  3K9K A;  4H0X B;  1TVR A;  3AVJ A;  2DFH A;  3AVK A;  4OPK A;  4EKU A;  2WUS A;  1IG9 A;  2ITG A;  4F3O A;  1U04 A;  3WNH A;  3THX B;  4CJE A;  3KLH A;  4E1J A;  1S1X A;  4CEQ A;  4JI6 K;  2HF4 A;  4CIE A;  5BRF A;  3ZSY A;  1X9M A;  3VQ9 A;  4BDZ A;  1NGD A;  1JL2 A;  1FKO A;  3AVF A;  3EE9 A;  4C8M A;  1TL1 A;  1VQK N;  1UWB A;  3CQ8 A;  4E7J A;  5J2M A;  1D8Y A;  1W9H A;  5FRO A;  3NF9 A;  4FJM A;  3HPG A;  4KHQ A;  1NOZ A;  2OAN A;  3KWG A;  4HTU A;  1M90 O;  4CFA A;  1S1V A;  5M1N A;  3I56 N;  2JLE A;  3GOI A;  5AJ3 K;  1NGB A;  1NLV A;  2ZD1 A;  3ZYY X;  4FPA A;  4N56 A;  3K5L A;  1IKY A;  4JI4 K;  4E0D A;  4M63 C;  3KTQ A;  1SGH A;  1SAZ A;  1VSE A;  4CJQ A;  3WQU A;  3LDQ A;  1RBV A;  4IFE A;  2IC3 A;  3TTF A;  3KLF A;  3ZET B;  1RDD A;  3RMA A;  2VWB A;  3OYD A;  1A5V A;  3HM9 A;  4DV4 K;  4LY7 A;  3BIN A;  1HJO A;  1TYQ A;  3CCV N;  4DV6 K;  2G8F A;  4CZI A;  3LPT A;  4BWM A;  4E19 A;  3KIO A;  1GOC A;  1NGH A;  4KH6 A;  5GAD P;  3U3G A;  3VF2 A;  1Q18 A;  3VQA A;  4EAH D;  4CHY A;  3HL8 A;  1KRP A;  3G9W A;  1R59 O;  4FCY A;  4B3M K;  4LF4 K;  2P9S B;  3PV8 A;  1TKX A;  4FJI A;  4CK1 A;  4JS5 A;  5H1S Q;  4KI6 A;  1ASU A;  2ZE2 A;  4PL7 A;  3TAF A;  2WTU A;  3SV4 A;  1NK6 A;  4JI8 K;  1ITG A;  2P9K B;  3C95 A;  4CEO A;  5GIN A;  1FJG K;  3WUH A;  2XY7 A;  3VQB A;  2FBV A;  2WOM A;  3L6Q A;  4A2A A;  4JD2 B;  3RVC A;  3OYM A;  1NI2 A;  3CF5 L;  1DKG D;  4RG8 A;  2GX9 A;  4BE1 A;  1WNS A;  2KZZ A;  1VQM N;  3AY9 A;  1RBU A;  3DXK B;  2HST A;  1GGO A;  1ZBU A;  4DR7 K;  4BRE A;  2IDO A;  5BN8 A;  1U4B A;  2DTU A;  1Y64 A;  3SV3 A;  4JK7 A;  2P9S A;  3D45 A;  5JS1 A;  5IWA K;  3VEX A;  4O0J A;  2P9L A;  3P39 A;  1LW0 A;  1WB9 A;  4CZF A;  2IOC A;  3LP0 A;  3LP2 A;  4KRE A;  3WEE B;  5AFU A;  1ZBF A;  3KJV A;  3T7Z A;  3ZLJ A;  5AQT A;  4FLU A;  2O4G A;  4DR5 K;  2Z1G A;  2P9I B;  4K8X A;  1CXU A;  3DXM A;  3FR0 A;  3CD6 N;  1I3A A;  3O3G A;  4DTS A;  4IOA L;  3PY8 A;  5E41 A;  4JD2 A;  4WCE L;  4CF8 A;  2X78 A;  3TAB A;  1L5U A;  5I42 A;  3FZK A;  1VSM A;  4AM7 A;  4NY0 A;  3HSC A;  3DXK A;  1BA0 A;  1V4S A;  3SMP A;  2YI1 A;  3L2V A;  2QW9 A;  4M41 A;  4CJT A;  3VET A;  1HPM A;  1NM1 A;  4CK3 A;  1MIZ B;  3EO3 A;  1WN7 A;  1K9M O;  2UXD K;  1IJJ A;  3SJH A;  4FJG A;  1JLA A;  1BOT O;  3T19 A;  4N5S A;  1S6Q A;  4BDP A;  5F1X A;  3I8B A;  4FWQ A;  2VWJ A;  1KFD A;  4FZZ A;  1QQN A;  3ZX2 A;  2ZF5 O;  3WNE A;  4M3R A;  2P9I A;  3QLH A;  4JEP A;  2ZM6 K;  2HHH K;  1VQ6 N;  2DPN A;  2HHV A;  3UE5 A;  4B1W B;  1NNE A;  3O1B A;  3V9W A;  3TTD A;  1HRH A;  2X0S A;  2VG7 A;  3KLE A;  1L3V A;  2Y1I A;  4E89 A;  3I0S A;  2Q0U A;  4JRQ A;  3P83 D;  3K9J A;  3QER A;  3SBG A;  1SKS A;  2NRV A;  1QHT A;  4JKA A;  1RDB A;  3LP3 A;  4B1Y B;  4MFB A;  3LDS A;  5FPN A;  1ASW A;  3EEQ A;  1KVB A;  1QHA A;  4WQ4 A;  4B3O A;  2IVO A;  2G8K A;  1C1B A;  4PHT X;  2OZM A;  3HXM A;  4CE9 A;  4I9Q A;  1N5Y A;  1HMV A;  3OYJ A;  3MED A;  3HO1 A;  4DF8 A;  3W0L A;  2ZJR L;  1DT9 A;  1VQ8 N;  3L0Q A;  3CET A;  4DHY A;  3MX2 A;  4JI5 K;  3QFP A;  3WXI A;  3DLH A;  1C1A A;  3VTH A;  3WXM B;  1Q81 O;  4H5N A;  4QOZ B;  1T6C A;  2UU9 K;  4Z4C A;  3OJU A;  4PKH A;  3M8R A;  3LM9 A;  4U67 L;  1YI2 N;  4FSV A;  4ID5 A;  3OVN A;  3ZT4 A;  3CG7 A;  3VER A;  1TUU A;  3QIP A;  3OS2 A;  1WBD A;  1XQS C;  3H3O B;  4EFH A;  2KHO A;  3LDN A;  3DOK A;  5T7B A;  1XC3 A;  3QET A;  4RW7 A;  3VF6 A;  5J2P A;  5HP1 A;  2D11 A;  2NRX A;  3MN6 A;  2YHX A;  4E1N A;  4BC4 A;  1VSL A;  1J54 A;  2YNI A;  4CBU A;  1BDG A;  4DMN A;  2QWM A;  4CEZ A;  2X6S A;  4FM0 A;  1SS6 A;  4BAC A;  4OKE A;  4GV9 A;  4KH5 A;  1BCM A;  3ULD A;  2CGL A;  4B3R K;  4CEA A;  1N32 K;  1WUA A;  3QIJ A;  3QO9 A;  2CH6 A;  4EP5 A;  1H1V A;  5ADX H;  4Z4H A;  1LW2 A;  1HNW K;  3LAK A;  3QES A;  5JLF A;  1SUQ A;  2HW3 A;  1RTH A;  1XWL A;  3E9O A;  1HYZ A;  4B8C A;  3NGZ A;  4CES A;  3CC2 N;  5CZ1 A;  4KTZ A;  1HB6 A;  4YOU A;  4CJF A;  4OPA A;  4JN4 A;  4JKD A;  3JXU A;  4IDH A;  3ZT1 A;  2NUB A;  1K8K A;  3TAG A;  3KLG A;  4CI6 A;  5AQI A;  1QZ5 A;  3ULE A;  3TSU A;  4OJR A;  3LAM A;  1N33 K;  2BAN A;  2QWQ A;  4YL8 A;  3VGK A;  3CYM A;  4BWJ A;  4KHU A;  1NGI A;  4MDB A;  4DR4 K;  4IFY A;  1RCH A;  4WQ5 A;  5FRN A;  1MWK A;  1OH7 A;  3SAH A;  1MK7 B;  4BC2 A;  4AQY K;  4JI3 K;  4F7G A;  4JK9 A;  1E4G T;  1W97 L;  4LFB K;  3M8Q A;  1DLO A;  2E5L K;  4LF9 K;  3PVL A;  3KK1 A;  2YCH A;  2R7Y A;  5JVH L;  1KFS A;  4FM2 A;  4ELV A;  1WSH A;  3UKR B;  4JHD B;  2Q0R A;  3V9S A;  2RN2 A;  4CEC A;  3B8A X;  1QQC A;  4I2P A;  2YNG A;  2JWK A;  3SMS A;  4QCL A;  1E3M A;  3PIP L;  4Y1D A;  4BE2 A;  1HBK A;  4CF2 A;  2P9P B;  3MAQ A;  1DTQ A;  2YHY A;  2UXC K;  2R82 A;  2HHX A;  1RT2 A;  5I3U A;  3WNG A;  3NH0 A;  1KAX A;  3OY9 A;  5KGW A;  3E01 A;  3AU4 A;  1JLF A;  3MEC A;  1NG9 A;  1U6Z A;  3AVC A;  1X3N A;  3MN7 A;  1T7P A;  4BRA A;  1B92 A;  3NE6 A;  3PSF A;  4CZE A;  3G6E N;  5AQQ A;  4HWI A;  2KFZ A;  1NK7 A;  2VG5 A;  3KHY A;  1J6Z A;  1TKZ A;  1LAW A;  2FF3 B;  4H5T A;  4EP4 A;  3DI6 A;  4K41 A;  4FLV A;  4XIU A;  3DAW A;  1SL2 A;  4ISF A;  3D2F A;  2QXL A;  4YHH K;  4DF4 A;  2NZT A;  1D9D A;  3RWU A;  2HF3 A;  3R6M A;  3RTV A;  5HBM A;  5E26 A;  4CF9 A;  3M1F A;  1RT3 A;  2FDQ A;  2A1R A;  3QML A;  4CJW A;  5C12 A;  4FWP A;  5AZI A;  5DM7 L;  5LMN K;  2QKB A;  4DSE A;  3AAR A;  3HM8 A;  2F4V K;  2FSK A;  4FM1 A;  1BIZ A;  1ACA A;  1GLJ O;  1QVF M;  2E4L A;  2HVH A;  4LH4 A;  1NMD A;  4XEI A;  4M3Y A;  1VBG A;  2I7N A;  3FLC O;  4ISE A;  3CJ7 A;  1NBW A;  2J0M A;  2YJF A;  1HNI A;  3BF1 A;  2BDP A;  1SL0 A;  2IVP A;  4UQG A;  4C8K A;  2P5O A;  3U9Z A;  1VK0 A;  3U8X A;  3A5N C;  2HMP A;  3LZI A;  5KI6 A;  2A41 A;  4I9L A;  3A2F A;  3O4Q A;  4CVN E;  1WAF A;  3C6U A;  2CGJ A;  4KTQ A;  4GMJ B;  3S3M A;  2PYL A;  4F2S A;  3R1X A;  3TSQ A;  3CCU N;  2UXB K;  1JXB A;  4FYD A;  2D5R A;  3LM2 A;  4NCG A;  4E7H A;  5AFU H;  4BC5 A;  4ZRK A;  3C6T A;  1SV5 A;  1YF5 L;  3V1Q A;  3DLR A;  3E66 A;  3KKS A;  3LWL A;  3O3H A;  1LV5 A;  3B6O A;  1YTA A;  3EZ5 A;  3L2R A;  3GDQ A;  1I94 K;  4GY2 B;  5AQF A;  4HVJ A;  4IEI A;  5AQG A;  5FPD A;  4FXD A;  4E1M A;  4JS4 A;  3TAR A;  1L3S A;  1N6Q A;  1KQS M;  3VGL A;  2YKN A;  4C1N I;  3J80 O;  4BR5 A;  4FVM A;  4BGA A;  3VEY A;  4EHU A;  1RBS A;  3N4Q A;  1SQK A;  4LSN A;  1IKW A;  3RSE A;  3VN5 A;  4CHN A;  3KKR A;  4IOX A;  1FK9 A;  3LZJ A;  2FXU A;  4FO0 A;  1RT5 A;  2EX3 A;  2O8B B;  4W5O A;  4AHC A;  3ZSX A;  1RTJ A;  3HZ6 A;  4TKN A;  3L4Q A;  3C6H A;  4BC3 A;  4J2E A;  1XHZ A;  3ZT0 A;  4X65 K;  3QB0 A;  2PFU A;  2W41 A;  1U2V B;  1M1K O;  4CJU A;  3MMV A;  3OYA A;  4W5N A;  2RE2 A;  1FKP A;  3NHG A;  1HQE A;  4A62 A;  2O8F B;  4LF8 K;  4DR2 K;  5KQD A;  1UA0 A;  3IAY A;  5E84 A;  1WSF A;  4DQQ A;  4A2B A;  4GNI A;  1XUP O;  1T8E A;  2QM1 A;  3VF4 A;  1TAQ A;  1YTU A;  4KB1 A;  2FJ9 A;  1W2B M;  3H3N O;  3NGI A;  4ELT A;  3CCM N;  4CEF A;  1B9F A;  2GWK A;  5DMR A;  3Q7B A;  2D0A A;  2D10 A;  1JLG A;  3LAL A;  1NJY A;  1RT7 A;  3M6G A;  3TAE A;  2GUP A;  2UUC K;  4ZRJ A;  1HB8 A;  5C24 A;  4X62 K;  3L4I A;  2HBM A;  3PUF A;  1J19 A;  4H4O A;  1VHX A;  1QVG M;  4KHN A;  1VSF A;  2A3Z A;  2BUP A;  2YNF A;  1ESV A;  1QSS A;  5AQM A;  4A57 A;  3HOS A;  4DFJ A;  3BZC A;  1NU0 A;  3U4L A;  2OTJ N;  4N76 A;  4KB0 A;  1J5E K;  1YT3 A;  4M3W A;  3DWL A;  1O13 A;  4KI4 A;  4BRI A;  1NK9 A;  1NK8 A;  1D4X A;  2E2N A;  4DS5 A;  4M3X A;  4M3Z A;  4FJ7 A;  3G25 A;  3HTV A;  4IEE A;  2FSN A;  2HHU A;  1G99 A;  3SQ2 A;  1S1U A;  4K25 A;  1DGK N;  3THX A;  2OPR A;  5M1K A;  4RWT A;  3ALY A;  3FGU A;  4CJ4 A;  1GLC G;  4AF1 A;  3VQ6 A;  2NRT A;  3SPY A;  4DQR A;  5FPM A;  2Q1N A;  3ATV A;  1ZBS A;  2QK9 A;  3EN9 A;  5AQK A;  3P1G A;  4H5W A;  3T1A A;  2WFB A;  5KPT A;  4CBX A;  1L3T A;  4CJR A;  1GC7 A;  2HVI A;  1I39 A;  3SBT A;  3R9P A;  3VA3 A;  5SWM A;  2KQ2 A;  3HYF A;  5HRP A;  3NH1 A;  4CHZ A;  4OGC A;  1VQ9 N;  4G1Q A;  1N36 K;  4MO5 A;  3RR8 A;  4O55 A;  1T44 A;  1FW6 A;  1Y19 B;  3G0Z A;  2KKZ A;  3SI6 A;  1BG3 A;  2YKM A;  3QIC A;  3PZD A;  4C8O A;  4BVO A;  3F9M A;  2E2P A;  4MDA A;  3WNF A;  3GG4 A;  3S41 A;  3IG1 A;  4JKF A;  3ZET A;  2VG6 A;  3OTO K;  1X9W A;  1CLQ A;  1KXP A;  3QIO A;  4Q5V A;  2AA4 A;  1GLD G;  3M8P A;  4ZTJ A;  3GE1 A;  4DG1 A;  4E3S A;  1TK5 A;  4J2A A;  3UKU B;  4BQZ A;  3SYZ A;  1XNR K;  3DOL A;  3IUC A;  5C25 A;  1Z26 A;  3O9T A;  4J2D A;  3TU5 A;  3OYI A;  3JSM A;  1N8R O;  1JCE A;  3CQX A;  3AGK A;  4FLX A;  3K5O A;  2P5G A;  2Z1H A;  3KWI A;  3P4I A;  4PUO A;  3IVF A;  4DKW A;  1X9S A;  3DLE A;  1L3U A;  5LY3 A;  3VQE A;  1WAJ A;  4ILG B;  3U9D A;  2P9K A;  4JKE A;  2HND A;  1S5J A;  3CJA A;  3OS1 A;  3QBX A;  3CCE N;  3QBW A;  1KAY A;  4FOE A;  3VOV A;  3C0B A;  3E9P A;  3OYH A;  5AQU A;  4BY9 C;  1RT1 A;  3QEX A;  2A6A A;  2EHG A;  1S3X A;  1RT6 A;  3AVA A;  1IBL K;  5AZJ B;  2G8H A;  1TGO A;  4FJ5 A;  4U7B A;  1NK0 A;  4OKJ A;  5KPZ A;  4BR0 A;  4IXC A;  4CF1 A;  4CZM A;  3AU5 A;  2Q36 A;  2RPI A;  4B08 A;  2E6M A;  1Q9X A;  3CJB A;  4BVP A;  2HHQ A;  5CR4 A;  2E20 A;  4B9U A;  3HVT A;  4XH1 A;  1YJ9 N;  1D9F A;  1KAZ A;  4DSF A;  1RIL A;  1K73 O;  3D2E B;  1VSK A;  4JV5 K;  3MEE A;  4IDK A;  3WEE A;  3A5O C;  1HX1 A;  1RDU A;  1EO1 A;  4DTO A;  4CK2 A;  4O44 A;  5JMV A;  5BPN A;  2YHW A;  1BHL A;  1HJR A;  4RCH A;  5C10 A;  4JI7 K;  1BQM A;  4QAG A;  4ILJ A;  3VQQ A;  4W5T A;  4FL9 A;  4AHV A;  3BDP A;  3ZSZ A;  5HRN A;  2B4J A;  4OO1 J;  3PX4 A;  3LWM A;  5AQL A;  3NH2 A;  4DFM A;  2WON A;  3X23 A;  1MDU B;  4DTX A;  3CI5 A;  4A5A A;  4GVE A;  3DLG A;  5GAH P;  1NVL A;  3VQC A;  4M3U A;  2H3G X;  3ID8 A;  4CW7 B;  3VQ5 A;  4F4K A;  1SKW A;  1HR0 K;  3MN5 A;  3ENB A;  1HNX K;  3TR8 A;  5LL6 Z;  4E7L A; 
#chains in the Genus database with same CATH homology
 1WOQ A;  1HBK A;  4JAX A;  1E4F T;  2P9P B;  2YHY A;  4BR4 A;  2EMT A;  2R82 A;  3FZF A;  3QFU A;  4RTF D;  3IKM A;  3MDQ A;  4BRM A;  3MN9 A;  1EF1 A;  1KAX A;  2GTD A;  3G4S N;  2E2Q A;  3CC7 N;  3AU4 A;  4YOY A;  1ATR A;  3MX5 A;  2IIR A;  2F9W A;  4MO4 A;  4QS9 A;  5MLC Q;  4DCH A;  5CHI A;  2AEH A;  1U6Z A;  1NGC A;  1X3N A;  3MN7 A;  4CD3 A;  5B8H A;  4JNE A;  2WBN A;  4BRA A;  2EMS A;  5AQP A;  2V7Y A;  2J0K A;  3TPQ A;  3VGM A;  2P9L B;  3EPY A;  2HOE A;  1MK9 B;  3M5R A;  5AQQ A;  4HWI A;  2HBL A;  4CZE A;  5M1O A;  5IJM A;  3G6E N;  1GG3 A;  3BF3 A;  1VBH A;  3KHY A;  2VGN A;  5C2F A;  1YIJ N;  2NRH A;  4JK8 A;  3TSP A;  5GAG P;  1J6Z A;  3LDP A;  5F2R A;  2FF3 B;  4H5T A;  5AQY A;  2ASO A;  2NRW A;  3LDL A;  4K41 A;  4IJN A;  3ENO A;  1VQ7 N;  1QZ6 A;  3VEN A;  3DAW A;  1HLU A;  1SZ2 A;  3MCP A;  4ISF A;  4C1N K;  3D2F A;  2QXL A;  3I33 A;  3OHR A;  4J8F A;  4BRN A;  3D6R A;  5FPE A;  4NLB A;  3EZW A;  2NZT A;  4BRK A;  5ADX A;  2F9T A;  3DXM B;  3AGR A;  1VQL N;  1ATN A;  4IO9 L;  3T69 A;  4IZ9 A;  2HF3 A;  3R6M A;  4XH4 A;  4XH5 A;  3EKU A;  4CD1 A;  2NRZ A;  5E26 A;  5I9E B;  3CCL N;  3GL1 A;  3M1F A;  2FDQ A;  4H0P A;  3QML A;  1OKJ A;  5C12 A;  5F0X A;  2QEX N;  4FWP A;  4CZH A;  5AZI A;  1YAG A;  3ATU A;  3IMX A;  5DM7 L;  3CME N;  3AAR A;  5BPM A;  2ZGZ A;  3E9L A;  3HM8 A;  1OVY A;  5DM6 L;  2FSK A;  4NLC A;  3K9K A;  3WXJ A;  4HTL A;  4YOW A;  4H0X B;  2FLO A;  1ACA A;  4FWN A;  1S72 N;  1GLJ O;  1QVF M;  3O4W A;  3IFR A;  1NMD A;  3O8M A;  4XEI A;  1VBG A;  2GWJ A;  2I7N A;  4EKU A;  2WUS A;  3FLC O;  4ISE A;  3R8E A;  1K8A O;  1DEJ A;  1YVN A;  3CJ7 A;  1YXQ A;  1NBW A;  3UKU A;  1P8Z A;  2J0M A;  2YJF A;  3BF1 A;  4QS8 A;  4E1J A;  5TKY A;  1LCU A;  2E1Y A;  2IVP A;  4FWL A;  4CZL A;  1QQM A;  4BGB A;  2HF4 A;  1YJN N;  3U9Z A;  3U8X A;  1IG8 A;  2QWR A;  5BRF A;  3A5N C;  2ZPY A;  3H1V X;  4B9Q A;  2HMP A;  1NGD A;  1VQN N;  5BN9 A;  4FWS A;  2A41 A;  3CMA N;  3R3L A;  4FWO A;  3EE9 A;  4O8U A;  4KBO A;  3OBW A;  5C15 A;  4BG9 A;  5JLH A;  2CGJ A;  4BRQ A;  3C6A A;  4BRL A;  1VQK N;  4O8K A;  5AQX A;  5C2D A;  4F9O A;  1NTI A;  3C7N B;  4OPH A;  3J7Z O;  3EE8 A;  3FFK B;  3R1X A;  3TSQ A;  3CCU N;  2I1K A;  2OAN A;  2HE7 A;  3KWG A;  3VMF B;  1M90 O;  3OBY A;  3MWT A;  2GEM A;  1TUY A;  3LM2 A;  5M1N A;  5AFU H;  4BR7 A;  4BC5 A;  2RHK A;  3I56 N;  3GOI A;  4FWM A;  4K43 A;  4ZRK A;  1BUP A;  2I1J A;  2E2O A;  4Z94 A;  2D1K A;  3ID6 A;  4YOX A;  1NGB A;  1NLV A;  3ZYY X;  3W3D A;  4FPA A;  1YF5 L;  1Q82 O;  3WT0 A;  3A8Y A;  1T6D A;  4K42 A;  2WC9 A;  1VAZ A;  4M63 C;  4NO7 A;  3HRG A;  4YDU C;  1SGH A;  1SAZ A;  3E66 A;  3FZM A;  3WQU A;  3LDQ A;  4I6M B;  4IFE A;  4EHT A;  5AZJ A;  3P38 A;  3TTF A;  3CER A;  3ZET B;  3GDQ A;  4GY2 B;  5AQF A;  3TTC A;  4IEI A;  5AQG A;  2VWB A;  1KD1 O;  1HKB A;  3EKS A;  5FPD A;  3CCQ N;  1RGI A;  3CJC A;  3ZX3 A;  3BIN A;  1HJO A;  2PAV A;  1KQS M;  3VGL A;  4C1N I;  1TYQ A;  3HOT A;  4PKG A;  4BR2 A;  1BWF O;  4BR5 A;  4CZI A;  3MWP A;  3CXC M;  3CCV N;  1DIK A;  4BGA A;  4BG8 A;  1GC6 A;  2UYT A;  3VEY A;  4EHU A;  5BRE A;  3N4Q A;  4NB4 A;  3NMU A;  1HKG A;  1SQK A;  3D2E A;  4YDU A;  3CIP A;  1NGH A;  4KH6 A;  5GAD P;  3C7N A;  3RSE A;  3VF2 A;  4G9Z A;  1Q18 A;  4IOX A;  3FE1 A;  4EAH D;  2FXU A;  4FO0 A;  2DIK A;  5GAE P;  5GIP A;  3HZ6 A;  3G9W A;  4TKN A;  3L4Q A;  1VQ4 N;  3C6H A;  4DB3 A;  4BRO A;  1R59 O;  4BRP A;  4BC3 A;  4M7Y A;  5KPR A;  2ZWH A;  2P9S B;  1JDE A;  3WXK A;  3CPW M;  1HUX A;  3QB0 A;  2CGK A;  2PFU A;  2W41 A;  1U2V B;  1M1K O;  3SK3 A;  4ZRI A;  3QDK A;  3MMV A;  5H1S Q;  1YIT N;  2YJE A;  3UKR A;  4I6M A;  4JHD A;  2RE2 A;  3WQT A;  4PL7 A;  4FOI A;  1MIX A;  4A62 A;  1V4T A;  4BRG A;  5KQD A;  2AL6 A;  5E84 A;  4A2B A;  2CH5 A;  1XUP O;  4GNI A;  2P9K B;  2QWN A;  2P9N B;  1NJI O;  3H6E A;  3VEZ A;  2QM1 A;  3VF4 A;  1E5W A;  5GIN A;  1BU6 O;  3WUH A;  5GIO A;  4M7X A;  3L6Q A;  4A2A A;  4JD2 B;  3RVC A;  1NI2 A;  3CF5 L;  2FJ9 A;  1W2B M;  3H3N O;  3VES A;  1DKG D;  1GLF O;  2P9P A;  1C0F A;  3CCM N;  2WH5 A;  5LJW A;  5HOO A;  5AQR A;  5HL7 L;  4MLH A;  2GX9 A;  1ISN A;  2GWK A;  1VQM N;  5JVL A;  3AY9 A;  1GLB G;  3Q7B A;  3DXK B;  5LJV A;  2HST A;  2D10 A;  1GGO A;  4CZJ A;  4BRE A;  2Q2R A;  4CZK A;  5BN8 A;  2LBB A;  1GLA G;  2HRJ A;  1Y64 A;  3M6G A;  2GUP A;  4JK7 A;  4ZRJ A;  3G71 N;  1HB8 A;  1JCG A;  2P9S A;  4H5V A;  1K8K B;  2V7Z A;  4DXA B;  2QWL A;  2VGM A;  3VEX A;  4GV3 A;  3SLC A;  2P9L A;  2ASM A;  3P39 A;  3U8Z A;  4JKG B;  3ULE B;  1H4R A;  2ITM A;  4YOV A;  1CZA N;  3L4I A;  1VQ5 N;  2QI2 A;  4CZF A;  3WEE B;  2HBM A;  2IVN A;  2P9U B;  5AFU A;  1J19 A;  3T7Z A;  3O9R A;  3I55 N;  2VYP A;  2W40 A;  5AQT A;  1QVG M;  2D2Q A;  2P9I B;  5AQN A;  3EL2 A;  3H45 C;  5EY4 A;  5TKW A;  2A3Z A;  2BUP A;  3DXM A;  3FR0 A;  4H0V B;  3VTI A;  3O08 A;  1ESV A;  3CD6 N;  5AQM A;  4A57 A;  3HOS A;  4IOA L;  2ZJQ L;  1Z6R A;  2HBJ A;  4JD2 A;  1QQO A;  5EVZ A;  4WCE L;  1YJW N;  3U4L A;  2Q31 A;  3H46 O;  2OTJ N;  3ENH A;  3DLL L;  2J4R A;  3DWL A;  3NVK A;  3FZK A;  1O13 A;  2QWO A;  3CHW A;  2QWP A;  4NY0 A;  3HSC A;  3MK6 A;  4AM7 A;  3DXK A;  4BRI A;  1BA0 A;  1D4X A;  3M3Z A;  1V4S A;  2E2N A;  3SMP A;  2YI1 A;  3VPZ A;  1NGG A;  4BRC A;  1X3M A;  2QW9 A;  3G25 A;  1ZXO A;  3HTV A;  4IEE A;  3E1Y A;  3WA0 A;  2FSN A;  1EQY A;  1G99 A;  3UB5 A;  3VET A;  5BPL A;  2OTL N;  1HPM A;  1NM1 A;  3LL3 A;  1MIZ B;  3EO3 A;  4R79 A;  1K9M O;  3SAG A;  4K25 A;  1DGK N;  4EIA A;  3A0I X;  1IJJ A;  3SJH A;  4CJ7 A;  1Z05 A;  3O80 A;  1BOT O;  5M1K A;  4RWT A;  2NNW A;  3DJC A;  3FGU A;  1GLC G;  4AF1 A;  5F1X A;  2NRT A;  4AM6 A;  1NWK A;  3O9S A;  3I8B A;  4FWQ A;  1KC7 A;  5FPM A;  2Q1N A;  3ATV A;  3N4P A;  4QS7 A;  4CBW A;  3ZEU B;  1ZBS A;  4Y0W A;  1QQN A;  3ZX2 A;  3EN9 A;  2ZF5 O;  3CPE A;  5AQK A;  2P9I A;  3BUZ B;  3CJ9 A;  5EXW A;  5BR9 A;  4JEP A;  3ZX0 A;  4H5W A;  2D0P A;  2WFB A;  5KPT A;  3F5T A;  4CBX A;  1VQ6 N;  2BTF A;  3ZDT A;  2DPN A;  3UE5 A;  4B1W B;  4WFA L;  3O1B A;  1GC7 A;  2E1Z A;  3SBT A;  4MLE A;  3R9P A;  3TTD A;  4WQ4 C;  3J8A A;  5AQJ A;  4H0T B;  4YOT A;  2X0S A;  4ISG A;  2CB8 A;  3KK7 A;  1ILY A;  2A40 A;  1VQ9 N;  4C23 A;  2Q0U A;  4MO5 A;  2VCP A;  3NVM A;  2FSJ A;  3K9J A;  1X9J A;  3SBG A;  1T44 A;  3AAP A;  2NRV A;  1S22 A;  5AQV A;  2J0J A;  4JKA A;  2KLA A;  2NLX A;  1Y19 B;  3D2F B;  2KKZ A;  3O6W A;  4B1Y B;  1BG3 A;  2GEL A;  3CCJ N;  4B1U B;  1LOT B;  3QIC A;  3PZD A;  5FPN A;  4BVO A;  2CQU A;  3F9M A;  5C0Y A;  1QHA A;  2E2P A;  4WQ4 A;  5AQH A;  1KC8 O;  1YUW A;  4MDA A;  4FPB A;  3GG4 A;  2IVO A;  4PHT X;  3S41 A;  2ZGY A;  5AQW A;  5AZI B;  3A5M C;  4WFN L;  4JKF A;  3ZET A;  4WF9 L;  3ZEU A;  3W0L A;  4B1X B;  1DT9 A;  1KXP A;  3L0Q A;  2ZJR L;  2D0O A;  1VQ8 N;  3FLV A;  2AA4 A;  1GLD G;  1BO5 O;  3CET A;  3MX2 A;  2V52 B;  4DHY A;  1Q86 O;  3GE1 A;  3U7D A;  4PL8 A;  1JCF A;  3MCA B;  3QFP A;  5AQS A;  3JS6 A;  3P31 A;  4O5F A;  3WXI A;  2D4W A;  3VTH A;  2ASP A;  3WXM B;  4BRH A;  3CCR N;  1Q81 O;  4H5N A;  1NGF A;  4A5B A;  1HKC A;  3PLA A;  3WXL A;  4B1Z A;  1T6C A;  1YHQ N;  5JVG L;  3UKU B;  4BQZ A;  3OW2 M;  3HBT A;  4PKH A;  3IUC A;  4P7I A;  3LM9 A;  4U67 L;  1YI2 N;  5M1P A;  4FSV A;  3O9T A;  3CC4 N;  3TU5 A;  4IO8 A;  2JWL A;  4YOR A;  2YX6 A;  3VER A;  1TUU A;  4BRD A;  4DQ8 A;  1N8R O;  1VQO N;  1XQS C;  1JCE A;  2V51 B;  1RFQ A;  3H3O B;  3VEV A;  3CQX A;  4EFH A;  2KHO A;  3LDN A;  3GBT A;  3AGK A;  4IOC L;  5AR0 A;  2A5X A;  1XC3 A;  4IJA A;  4FWR A;  4BRF A;  3KWI A;  3OA9 A;  3P4I A;  3VF6 A;  1U2V A;  4H5R A;  2D11 A;  2NRX A;  3MN6 A;  1P90 A;  3FP5 A;  2YHX A;  3IVF A;  4DKW A;  3KVG A;  1GLE G;  4BC4 A;  3C65 A;  3H1Q A;  3O9Q A;  2RQ1 A;  3SAF A;  2E8A A;  4L3Q A;  1NGJ A;  5ELZ A;  4CBU A;  1BDG A;  5CE3 A;  5LY3 A;  2QWM A;  1JJ2 M;  2Q97 A;  4ILG B;  3U9D A;  2P9K A;  1SS6 A;  2P9N A;  4JKE A;  3CJA A;  4GV9 A;  1RDW X;  4GXB A;  4KH5 A;  5AQZ A;  4H03 B;  3QBX A;  2AP1 A;  2CGL A;  2I7P A;  1KAY A;  3QBW A;  4FOE A;  5EOY A;  3PIO L;  3CCE N;  4CZG A;  3VOV A;  3C0B A;  3E9P A;  1WUA A;  3QIJ A;  5AQU A;  4BY9 C;  2CH6 A;  2NRR A;  5KQ8 A;  1H1V A;  5ADX H;  4IWV A;  1VQP N;  2A6A A;  3CJ1 A;  2BH1 A;  1S3X A;  2E88 A;  5JLF A;  3BEX A;  3IDH A;  5AZJ B;  1NGE A;  2COP A;  4U7B A;  3E9O A;  4HDQ A;  1MWM A;  2EWS A;  4WQ5 C;  5KPZ A;  4FVU A;  3CC2 N;  4BR0 A;  4IXC A;  1HB6 A;  1MA9 B;  2HBK A;  3Q7C A;  4JN4 A;  3AU5 A;  2PBD A;  4OPA A;  2Q36 A;  4YOU A;  4CZM A;  4JKD A;  4BQL A;  3JXU A;  4IDH A;  4LC9 B;  3CJB A;  3D7E O;  4BVP A;  1K8K A;  1TYQ B;  5CR4 A;  1ZC6 A;  2ZJP L;  5AQO A;  2E20 A;  5BRH A;  4XH1 A;  4CI6 A;  1YJ9 N;  5AQI A;  4A59 A;  1QZ5 A;  4JKC A;  3KZB A;  1KAZ A;  4JKG A;  3A5L C;  3ULE A;  3TSU A;  4BR9 A;  1K73 O;  5EX5 A;  3D2E B;  2F7T A;  1ST7 A;  1NGA A;  2QWQ A;  4YL8 A;  3VGK A;  3WEE A;  3RSE B;  2P9U A;  3VEO A;  3BP8 A;  4WFB L;  3O1W A;  4FWK A;  3A5O C;  1HX1 A;  1T3V A;  1NGI A;  4JKH A;  4MDB A;  1Q7Y O;  4UY8 O;  1RDU A;  4GV6 A;  4CYE A;  1EO1 A;  2QTD A;  3O9U A;  4WQ5 A;  5JMV A;  5BPN A;  2YHW A;  3LDO A;  1MWK A;  3CCS N;  3F2K A;  3SAH A;  1MK7 B;  4H0O A;  4BC2 A;  4RCH A;  4F7G A;  5C10 A;  4JK9 A;  3AAQ A;  3CQY A;  1E4G T;  5M1Q A;  1W97 L;  4ILJ A;  4A61 A;  2FF6 A;  3O5B A;  3PVL A;  2YVC A;  2YCH A;  4KH4 A;  4B1V A;  4H0Y B;  4FL9 A;  5JVH L;  1C0G A;  3UKR B;  3VEW A;  4JHD B;  4OO1 J;  2Q0R A;  5AQL A;  5JIC A;  4WYB A;  3X23 A;  1MDU B;  3FZL A;  3B8A X;  1ATS A;  3CI5 A;  4A5A A;  4GVE A;  5M1F A;  4JKB A;  5GAH P;  1BA1 A;  1NVL A;  2A42 A;  2JWK A;  2H3G X;  3ID8 A;  3SMS A;  5BRD A;  4PKI A;  3HI0 A;  1GLL O;  3ENB A;  4ILH A;  1KBL A;  3MN5 A;  3PIP L;  2ABD A;  3FZH A;  4HDO A;  2QA4 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...