2D2QA

Crystal structure of the dimerized radixin ferm domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Radixin
publication title Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304
pubmed doi rcsb
source organism Mus musculus
total genus 84
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d2qA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d2qA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d2qA01
2MX2A 2G4SA 5D94A 4L6EA 2N7EA 2ZJDA 2LD9A 2C7HA 3PGEA 2M4NA 3PPAA 4HB4B 2PE9A 1QQGA 3CSFA 1UNRA 3DXDA 3Q3JA 1V61A 4IM3A 3A1QB 1LQBA 4A6FB 4DBGA 1HB8A 3KYCD 2DZIA 5GMVA 2RQ1A 2UWQA 1TQZA 4KVGB 1L7YA 3QC8B 4FA6A 4GMXB 1GG3A 5L81A 2DHKA 3OJ4B 2CB8A 5E6OA 2KCJA 2R09A 4DHJB 3B08A 4ZRKA 4KIKA 4FJVB 2IO1B 1U27A 4K1RB 2NS5A 2CU1A 1M7RA 4A6KA 2P0DA 5DH9B 3CIKA 2C7NB 1PFJA 5IAAC 1HBKA 2QHOA 2KHWB 2G45B 4PS7A 2ROZB 2HJ8A 3UIPB 4LJOB 4K17A 4CHKA 2J0KA 2JZZA 2IYBA 4DHJD 5D7GA 2NPTB 5AZFA 3T8MA 1OMWA 2BPSA 3LDZE 2XK5B 4KZ0A 2D9XA 4W9HA 2J7QB 4ZRJA 2D4QA 5D27A 4DXAB 1U2BA 3IVFA 1KZGA 2I5CA 4BKGA 1WGQA 4RM8A 3QWZB 3RCZA 4BOZB 3QWMA 3A9KA 4BVUC 1LB1A 2JRHA 2N1WA 2COFA 1WGDA 2KXJA 5KCVA 1OEYJ 2YS3A 4FN2A 4X57B 2REXA 2NZ8B 4W9GA 3SO6A 4MELA 1EVHA 2FAZA 4XZ4A 3D8EA 2KJHB 2GMIC 2XBBC 5LONB 4KSLC 2LVPA 2LBBA 3ZO5B 2LGXA 5BO4B 2Z0OA 3AU4A 4IG7B 1KJTA 2KZRA 2YLMA 4BBKA 3PVUA 3V5WA 2LKOA 2Y8GA 1PQSA 4M0WB 3WAOA 1GC7A 4WAAA 2RNRB 1L2NA 3AU5A 3U8ZA 3Q3FA 3FM8C 4K7SA 2DYOA 4NJ7A 4W9LA 2CKHB 1WFYA 4P7IA 4ZDVA 1UEFA 1ZC4B 4GZUA 5TR5A 4JGHB 2JUOA 3AULA 4EKUA 4PNKA 2LWPA 2K00A 3NZUA 3WANA 1NTYA 4NJ6A 2KDEB 3PP2A 3SD5A 2K8HA 4ICUA 2KOXA 1UBQA 2CY5A 2N7DA 5CHWA 3VHTC 4EJNA 1B55A 1V9JA 4W9DA 3SU8X 5J17A 3ZTCA 1WJ6A 2LJ5A 4HAZB 2XQNM 3O65B 4TV3A 3K9OB 1YX6B 3PS6A 3EECA 4KHAA 3ZNID 2DHJA 3RD2A 2P8VA 3VFKA 4DWFA 2KWCA 4HJKA 1R4MI 4IUMB 5LLIA 2ZNVC 1WXAA 2RGFA 1NDDA 4GXBA 3UQAA 1U5DA 4PS8A 2FCMA 2BYFA 2UYZB 2LXAA 2IZVB 3M3JA 2R0DA 4IC7B 2KK8A 4CO7A 1ACAA 4KV2A 1UZXB 3ODWA 2KLGA 1Z5SB 4ICVA 4LDTB 4W9FA 4A3OA 3DOWA 1XT9B 5E6NA 4HAYB 4HAVB 3OJ3A 2LG1A 4F7HA 3FLVA 1DROA 3DVNU 3A9JB 2YS1A 4WJOA 5CHVC 1YX5B 3FP5A 3H7PB 1E8XA 4MK0A 4LDTD 1BWNA 1WI0A 4A6FA 4CYEA 4KSKC 4ANWA 1WX7A 2M1MA 2P0FA 1FHOA 3HM6X 2DZMA 3ZRFA 2E2XA 4ANUA 2OQBA 2H7EA 2KDFB 4FHKA 1P5TA 2ZNVB 3ZLZA 2L00B 4HHVA 2C5LC 3TJPA 2PEAA 4BKTA 4WJ7A 3C0RB 3DPDA 1WGGA 2B3AA 3JVZX 1BT0A 1XQQA 1V49A 3CF6E 2PE6B 2J0JA 2C60A 1WX8A 1W1HA 1MAIA 3RZWC 1XCGA 2W2XC 3VQIA 1V5PA 3A4RA 2RVBB 3A98B 5KQ1A 2NPTA 2DYBA 3KSYA 2XK5A 4F7UP 3ODXA 1SGHA 3ULCA 2AL6A 4W9IA 2KX0A 1P6SA 4AOFA 4MH0E 1WJNA 3ZUNA 3FEHA 5L95C 3QX1A 3NSUA 4GDLB 1ZSQA 4MSMB 3PZDA 2RGNB 2GCJA 2EKEC 2JZ3B 3KUZA 4G50A 1NU2A 3M95A 4HAXB 1H8CA 3ZRCA 4B6HA 2IO3B 3EC8A 3ML9A 4RM9A 3A8PA 4DK5A 1U5GA 2EJ8A 3G9WA 2K6DB 2Y8FA 2O6VB 4HAUB 2DAJA 2MWNB 3QHTA 4A6HA 2MW5A 4Z2MB 3ZNHB 4MY6A 4AJWA 3PLVA 1YJ1A 1WR6E 4I6PA 1V5MA 4GDKB 1NI2A 1G6JA 3BY4B 2FIFA 2IO2B 5DPSA 1UNQA 2A5UA 1J19A 2O6VD 3DBHI 1EGXA 1JRUA 4EEWA 3U7DA 5DIFB 4HDOA 5EFXA 3RUIB 2W2XD 3APCA 2KLCA 3W1YA 3AI5A 1V86A 2IY0B 1CMXB 5DCNA 2OOBB 2MKRA 5JZEB 4B95A 1WXSA 4A20A 3DQVA 5C6RA 2KWVB 3IFWB 4JIOU 1X86A 3KYDD 3NOBA 1XX0A 3F0WA 3A8QA 2RSUA 2CAYA 1S1QB 2IBIB 3PG7A 1TTNA 2KC2A 2KMAA 5CLLB 1I35A 1FHWA 3OANA 3ZW3A 1V5UA 2FCNA 2GS0A 1AARA 1WZ0A 4HATB 1ZKHA 2EMSA 5CTRC 4HB2B 4FJZA 2LZ6A 5JP4A 1C1YB 2MP2B 3EHVA 2VKIA 1UELA 2L0FA 1HE8A 4FADA 2D9ZA 2ZZPB 3DXEA 5DHFB 4W9KA 1LFDA 3N32A 5KHQA 2JVCA 4ASWC 2CRFA 1P3RA 4WJNA 1T0YA 1Q1OA 2KQSA 1I7AA 4GSWA 2GJYA 3TMPB 2Y5BB 4EUTA 2KWUB 1P9DU 1WXVA 1FOEA 1E8YA 3H1UA 2N0YA 4NAWB 2HTHB 2RLOA 4JL9A 3PLUA 1ZGUB 4LJPB 2MBHA 3ZIMA 3JSVB 5D3YA 3KW5B 2KTFA 1YQBA 1RLFA 1M94A 4BKSA 2N4FA 1BAKA 5G55A 2L7RA 4KHBB 1RAXA 3APFA 1FHXA 2RD0A 3DXCA 4MJSB 2MRPA 2KKCA 4WWNA 4BOSC 4F8CB 3VH4B 4HLEA 2V3SA 5AZHA 1QC6A 2MDXA 1X1MA 2KO3A 2CODA 1WGHA 1EAZA 1DDMA 3ZTDA 1P1AA 5JHBA 1IP9A 4BBNC 4K7UA 3HK0A 1NVLA 4E74A 3UIOB 1U4AA 3KUCB 1EF1A 3PT2B 3N30A 5FI1A 2Z59B 1WGUA 2N9EB 3BJIA 5DPTA 1DDVA 2DX5B 1EUVB 4MDKE 3VDZA 2O2VB 3RT3B 3KH0A 2ADZA 3QQ8B 3R7RA 4M8NA 4Y94A 3TVVA 5KHOA 4IM2A 3MHSD 2X18A 4GMVA 1SE9A 2VRRB 1XODA 2D07B 2MBQA 2K6QA 2BWFA 5LOPB 4GGQA 1VD2A 3N7CA 2KJRA 2MQJA 2L1CA 2KJ6A 2KC1A 1QZEA 2PPHA 2RPQA 4BBNF 4WQOB 2LXCA 1A5RA 3UF8A 4GIVA 3SDLC 4URKA 4DDID 2DYNA 5D3XA 1WH3A 4TKNA 3NHEB 1WI1A 2Z0QA 3ECIA 2HE7A 2YF0A 5C5BB 3TFMA 2DA0A 2LI5A 2WX1A 2K1FA 3MPXA 4GDLA 3T9LA 1FGYA 2D9WA 2K2UA 2CHWA 3JYUA 2Q13A 4NY0A 1Q5WB 1GC6A 1I42A 3L10B 1XD3B 2GCLA 1OGWA 3ZDTA 2YRYA 3PRZA 2JP2A 4MGIE 4IFSA 2M8SA 2DKQA 2LYDA 3ZVRA 1C3TA 3UQBA 2O6VA 3QA8A 4KIKB 2FCQA 1R4NI 3DBSA 3T06A 3A4SC 4LCDE 1ZC3B 1LW3A 3H7SA 4AWJA 4MM3A 4YONA 3WAPA 1W1GA 4HWIB 2KDIA 1TGZB 4XWXA 2HD5B 4GDKA 3ZKJC 5DPRA 3KRWA 4TQ0A 2ZVNA 4KAXB 3DDCB 4EZLA 1WIAA 2LOZA 3A33B 1E7VA 2ZVOA 1UPQA 4G3XB 3V6CB 4DX8A 2ZEQA 1N3HA 2BYEA 3R3MA 1U29A 2AEHA 2Z0PA 2GBRA 2N9PC 2WH5A 1KZ7A 2MSED 3UZTA 2KVRA 5J3YA 1MKEA 3P6AA 1TZ1A 5HE1A 4K7WA 1WR1A 4HPLB 3L16A 1WM3A 2LOXA 5DPWA 2MCNB 2Y7BA 3A9KB 2NVUI 1UGMA 1XKEA 3A1QA 1WX9A 4N9F4 1AWEA 1Y5OA 4II3B 1E8ZA 4EOYA 3PHXB 2CHZA 3PRMB 1W1DA 4WWOA 2BKRB 1E8WA 5G2NA 2IO0B 2BYVE 5CLQB 2GBKA 2BCJA 2YS5A 4AUQC 2G4DB 1AQCA 3V61A 2IYDB 1KOTA 4MT7A 1EO6A 2QKLA 2LGYA 2MP2A 1P3QU 4KDIC 2PJHA 3WYFB 1K8RB 4MEMA 2KFKB 1RRPB 3ENEA 3CSTA 2N1VA 2K8CA 4B9KA 2Z0DB 4FJYA 4DX90 4MSQB 1P98A 3V6EB 2CY4A 2W2WA 4HPMB 4HVBA 2FUHB 3ML8A 4I6LB 4TQ1A 2K2JA 4CHJA 4CHMA 3GZNI 4NAWA 2HTHA 5HE0A 2DYMA 2CR5A 2V1YA 3NY5A 3JSVA 2KTRB 3X23A 3H9DA 2EMTA 3QCAA 1WGYA 4AJYB 3APDA 3PREA 1FB8A 1OTRB 5HE3A 5FI0A 4MJSA 1WVHA 3P2BA 4GB9A 3RCPA 5C23A 4DBBA 1Z87A 4MGKE 2KN5A 5AEKB 5FR6A 3X0WA 4WJPA 1BTNA 2FJ9A 3M1IB 2IY1B 3VXWA 3W1SC 2KGXB 3LJ3A 2L2IA 3VH3B 1WRDB 3PHWB 3R66C 2BKFA 2MFQA 3SNHA 2KANA 2DHZA 4K2PA 1V81A 2GBJA 1IPGA 3HHMA 4EMOA 3KY9A 2DX5A 5C16A 3AXCA 3K9PB 4PYUA 2JT4B 2O2VA 1WM2A 4E3CA 2YVCA 1TBEA 2K8BA 1WMHB 2DZKA 4F7ZA 1PMSA 3PRPB 4HDQA 1X05A 1VCBA 4F1SA 2NMBA 1V6EA 2ELAA 3QBVB 2MLBA 1WF9A 1WY8A 2DZJA 4XC2A 2JXXA 4KDLB 3JW0X 1GUAB 1DBHA 2WX0A 4BFRA 4F7GA 3NS8A 3PTFC 4FULA 5C1ZA 3M62B 2M38A 1U5EA 2R2QA 3GYPA 4JQWC 2W9NA 2L05A 2BF8B 3TW1A 4C0AA 3P7ZA 2CQUA 3PVWA 5C5BA 1X11A 3SV1A 3HM3A 2NBVB 1E90A 1WJ4A 2D3GA 1K5DB 2C7MB 4IOYX 4D0NB 4G11A 3M63B 4E71A 2ZCBA 4H8SA 1RJ2A 2COAA 4OVVA 2VRWB 4Z2NA 1LXDA 5J3QA 3L17A 1J0WA 3MTNB 2DAFA 3SYXA 3DVNV 3VTWA 3ZNGC 3KVFB 2CS4A 2AWTA 1D3ZA 2AYOB 2NBUA 1MG8A 1EF5A 3ALBA 3AJ4A 5J18A 3IBEA 1WGRA 2DX1A 2LVQA 4NPNA 2MBEA 2ROVA 3HW2B 4XX5A 4HK2A 3TL5A 4ANVA 5LXIB 4MGYE 2J59M 1XR0B 2RUKB 1RFAA 3TCAA 1S3SG 2EC1A 3IHPC 3CMMB 1K5GB 1UBIA 2KFJA 2D10A 3QJZA 4GN1A 3IG3A 1YIWA 1GNUA 5LXHA 4OVUA 1OQYA 4HXDA 2L0TA 1NTVA 4EZJA 4IW0A 1BTKA 2LRUA 3EPYA 1NBFC 2D2QA 3A9JA 1ZM0A 3RULA 3H7PA 3BINA 2ZCCA 1ST7A 3VOQA 2I1KA 2N23A 3L54A 5HKHA 1ZVRA 2QKMA 2DHIA 3D8FA 5D6JB 3ML4A 3RZFA 2MBOA 4PQ0A 1U5FA 3L0WB 2JF5A 2DTCA 2YT0A 3DVGX 4EZKA 3MJWA 3ZNZB 4PS3A 2L8JA 2COPA 1WXMA 5JLJB 3HIZA 1E7UA 2C9WB 2XEWA 5D3VA 1OY2A 2JPHA 3VUYA 4JLCA 2D9VA 3RYTA 1WJUA 1ZW7A 3ODOA 2KFKA 1Z2MA 4G0NB 2DYQA 2DKPA 1WJMA 4A3PA 5CHFA 2MBBB 3QIJA 1TJ6A 3ZVVA 5IA7A 2ELBA 2YSZA 2BGFA 1MIXA 1DYNA 5JHGA 2P0HA 2G3QB 2UVMA 3QARA 2MA9B 2DN6A 1KLVA 2DENB 1LM8B 1DDWA 1KM7A 2ZPNA 3L08A 1HB6A 1M7EA 4HAWB 3DBLI 1V89A 2LASA 3L13A 1I2HA 1UNPA 2KTRA 2M17A 2KUPA 1J8CA 3ONSA 4FBJB 3WA0A 2OTXA 1OEYA 1UH6A 1MK7B 1OQNA 2YT1A 4W9JA 5AZGA 3VTVA 2LGDA 3H6NA 2VSZA 1UD7A 1V5OA 2L76A 2NR2A 1V2YA 3PVLA 2KD0A 1H10A 2JWZA 1Y19B 2J0MA 1X1GA 2L3ZA 2G35A 3N3KB 4EFOA 5KQ4A 3SHQA 5JHHA 4J6IA 2I5FA 2FCSA 2BWES 2K25A 5D2MB 1FXTB 3B1LX 1FAOA 2N9XA 1TXDA 2NBWB 1ISNA 1WMHA 3UINB 2Z0EB 4W9CA 4W9EA 2FDQA 1MPHA 2KDBA 1XD4A 4GPTB 3V60A 2I1JA 4ZYNA 3D32A 3U30A 4IAPA 2LVOA 2WYQA 2GBNA 4WJQA 3SUZA 4ANXA 4WWPA 3F5RA 3D8DA 1KI1B 2WWZA 4II2B 3CXBB 4NSWA 3EFUA 4TYZA 3WALA 2GBMA 2CHXA 4IM0A 3VAWA 5IJMA 4B6WA 2D11A 4DHZB 3VTUA 4PYZA 3MDBC 2RR9A 4A5KA 4HCPB 2M14A 1FGZA 2OJRA 3PV1A 2LUEA 5JHAA 4NNJB 2ABDA 2KX3A 5D3WA 3QK0A 5EDSA 3V62A 4KHOA 4BKSD 1PLSA 1GJZA 1P0RA 4AP4C 2DFKA 3W1SA 2NCNA 3VUWA 5DI9B 3VIAA 3S2AA 2KMCA 4HCNB 1WJ1A 4K2OA 1MK9B 3TO1A 3WIMA 5HE2A 3DVGY 4GU2A 3UGBB 2FJLA 3I3TB 1SIFA 3DCGA 3ZDMC 2A4ZA 3VUXA 5E6PA 2KQ7A 3HQCA 5C79A 1WZ3A 2GOWA 3O96A 3OAWA 2LULA 2HRJA 3PSEB 2M0XA 1YD8U 5J2RA 2RSGA 2FIDA 2AL3A 1IRSA 2JRIB 4TUUA 1SHCA 4IWQA 2JY6A 3OLMD 1V80A 3QAQA 1WG7A 2COCA 1Y8RC 1Q0WB 2D9YA 1MIZB 1V5TA 1V88A 4YL8A 5L83A 5J3TA 2MWSB 3TBLD 3PSCA 4HB3B 4ZRIA 1WYWB 3FSSA 1RRBA 1J0GA 3KZ1A 3LJUX 2DLWA 1Q67A 3NZSA 4IWOA 4HB0B 2K39A 2LRWA 5JH5C 4FLHA 2R2OA 2V4LA 4IWPA 3PEGA 1WE7A 2ASQA 4NQLB 4I6NB 2WDTB 1E5WA 3TIXA 1IYFA 4M8MA 3GOEA 4DDGD 2KNBA 1X1FA 1UPRA 3B0AA 4DHZE 2ZPYA 4FHJA 4WSFA 3KRXA 1H4RA 4K81A 4MGZE 3WAMA 3KUDB 4WVFB 3VVWB 2H7DA 4NQKE 4GOCA 4RMAA 1F9JA 3R7QA 2PZ1A 2UZRA 2V76A 1WE6A 4KZCA 5GOWB 5CX3A 2UZSA 2IFSA 2FNJB 3GYOA 5DHAB 3DBRI 1NTIA 3ULBA
chains in the Genus database with same CATH superfamily
2KUQA 2MX2A 2HJ1A 5HI1A 1J7CA 3VR9B 2G4SA 4OZBA 5D94A 4L6EA 3FAHA 4USAA 2N7EA 2CJOA 2ZJDA 5BMGA 2LD9A 2C7HA 3PGEA 2M4NA 2X38A 3PPAA 4HB4B 2PE9A 5H92C 1QQGA 3CSFA 1UNRA 3DXDA 3Q3JA 1V61A 4IM3A 1E0ZA 3A1QB 1LQBA 4A6FB 4DBGA 5D3DA 1WGKA 4DXGA 1HB8A 3NWAA 3KYCD 2DZIA 5GMVA 2RQ1A 2UWQA 1TQZA 4KVGB 1FNUA 1L7YA 3QC8B 4FA6A 4GMXB 2RDHA 1GG3A 5L81A 2DHKA 3OJ4B 2CB8A 5E6OA 1YN4A 2KCJA 2K0PA 2R09A 2XN9C 1ZXHA 4DHJB 3B08A 4ZRKA 4KIKA 4FJVB 2IO1B 2QCZA 2Y5CA 1U27A 2SEBD 4K1RB 1JWBD 2CU1A 2NS5A 4A6QA 1M7RA 5IKCM 4A6KA 2P0DA 5DH9B 4JK8A 3CIKA 2C7NB 1PFJA 5IAAC 1HBKA 3T3OA 2QHOA 3O13A 2KHWB 2QJLA 2G45B 4PS7A 1K53A 4A90A 1HEZE 2ROZB 2HJ8A 3UIPB 4LJOB 4K17A 4YSXB 1HXYD 4CHKA 2J0KA 4M01A 2JZZA 2IYBA 4DHJD 5D7GA 2NPTB 1T5XD 5AZFA 3T8MA 1OMWA 2BPSA 4XE0A 1HA5A 3LDZE 2XK5B 1TS4A 1N63A 4KZ0A 3I57A 2D9XA 4W9HA 3RN9C 5G5HA 2J7QB 2KACA 3OWEB 4ZRJA 4WIPA 2D4QA 5D27A 4DXAB 2BT6A 1U2BA 2ZW0A 3I5JC 2OEDA 2KIGA 2DBYA 3IVFA 1KZGA 2I5CA 4BKGA 1J7BA 1N5WA 1WGQA 4RM8A 3QWZB 3RCZA 1YNTE 1VLBA 1VBHA 3B77A 4BOZB 3QWMA 3A9KA 4BVUC 1LB1A 3MHZA 2JRHA 4US8A 2N1WA 3PO0A 2COFA 1WGDA 2UU7A 2KXJA 5KCVA 4YTPB 1JRPA 1OEYJ 2X0SA 2YS3A 4FN2A 3NVVA 1ET6A 1P7EA 1MI1A 4X57B 2REXA 2NZ8B 4W9GA 1SXTA 1XLPA 1VRAB 1FO4A 4DXFA 3SO6A 1FNWA 4MELA 1KBLA 1EVHA 5JVLA 2FAZA 4XZ4A 2DLBA 3D8EA 5BMHA 4PK1A 2KJHB 3Q3NC 2GMIC 2XBBC 2W55A 1T0QC 5LONB 4KSLC 2R2YA 2LVPA 2QEJC 2LBBA 3ZO5B 2LGXA 4A55A 4ZRQA 5BO4B 2Z0OA 4JKCA 4QJ5B 3AU4A 2X8XX 4IG7B 3P42A 1FPYA 1KJTA 2KZRA 2YLMA 4BBKA 3PVUA 3V5WA 1TKGA 2LKOA 3AEBB 2Y8GA 1PQSA 4M0WB 3WAOA 1GC7A 4ZHPA 1WSPA 4WAAA 1UGJA 2RNRB 1L2NA 1ESFA 3W5VB 3AU5A 3U8ZA 3Q3FA 3V05A 3FM8C 4K7SA 2AQ1B 4K3BA 2DYOA 4NJ7A 4W9LA 2CKHB 1WFYA 3KQ4A 2INNE 4P7IA 4ZDVA 4HSIA 4Q2JA 1UEFA 1ZC4B 4GZUA 5FK9C 5TR5A 4JGHB 2JUOA 5BMIA 3NS1A 1PGBA 3AULA 4WURA 4EKUA 3H8HA 1I4GA 4PNKA 2LWPA 2QC8A 3IT6B 2K00A 3NZUA 3WANA 1JCKB 1NTYA 1JALA 4NJ6A 2KDEB 3AH7A 3PP2A 2QDFA 2BQQA 2ON8A 4YTNB 3FILB 3SD5A 2BS3B 2K8HA 4ICUA 2KOXA 4HKZE 1UBQA 1C9FA 1XLOA 2CY5A 2N7DA 5CHWA 3ZJTA 3VHTC 1HTOA 1VZ7A 4NAMA 4EJNA 1B55A 2FJUB 1V9JA 2DWQA 4W9DA 3SU8X 3HIEA 5J17A 1SIJA 3ZTCA 1FCLA 1WJ6A 2LJ5A 4HAZB 2XQNM 3O65B 4TV3A 3K9OB 1YX6B 2Z8LA 3PS6A 1N5XA 1TY0A 2WQYB 3EECA 2AQ3B 4KHAA 4JPSA 3ZNID 3NW8A 2DHJA 3C8YA 3RD2A 1R4NB 1PDXA 3P63A 2P8VA 3VFKA 4DWFA 2BVCA 2KWCA 4HJKA 1F77A 1R4MI 4IUMB 5LLIA 3AEDB 3Q3MC 2ZNVC 1WXAA 2RGFA 1NDDA 4GXBA 3UQAA 1U5DA 1VZ8A 4PS8A 3N20C 3ETRA 2FCMA 3CWIA 1RWSA 2BYFA 2UYZB 3L4PA 2DIKA 4WAFA 4N6EB 4JKHA 2LXAA 2OJWA 2IZVB 3M3JA 3AEAB 1DGJA 1VDVA 2R0DA 4IC7B 2KK8A 4CO7A 1ACAA 4KV2A 1UZXB 3GB1A 3ODWA 2KLGA 1Z5SB 4ICVA 4LDTB 1V8CA 4W9FA 4RFBA 4A3OA 3DOWA 1XT9B 1NI3A 2PKOA 1J7AA 2INPE 4HROA 5E6NA 4HAYB 1GOZA 4HAVB 3OJ3A 2LG1A 1WXQA 4F7HA 3FLVA 4C80A 1DROA 3DVNU 3U2SC 3A9JB 2BTEA 2YS1A 4WJOA 5CHVC 1YX5B 3FP5A 3H7PB 1E10A 1E8XA 1XLNA 5M4YB 4MK0A 4LDTD 1BWNA 1WI0A 4A6FA 1MJDA 4CYEA 4KSKC 4ANWA 1WX7A 2L83A 4B0EA 2MJ3A 2M1MA 1A70A 2FUG1 2P0FA 1FHOA 1TS2A 3HM6X 2DZMA 2Q5WD 1V1PB 3ZRFA 3KLSX 2E2XA 4ANUA 2OQBA 2H7EA 2KDFB 1KTKA 4FHKA 4P1CC 1P5TA 4TSSA 2ZNVB 3ZLZA 1MPEA 2L00B 4JKGB 4HHVA 2C5LC 3TJPA 1KLGD 2PEAA 4BKTA 3P4QB 1T3QA 4WJ7A 3C0RB 3DPDA 1K51A 2WXFA 4XWWA 1WGGA 2B3AA 3JVZX 5E6JA 3RNAC 1BT0A 1XQQA 1CQVA 1V49A 3CF6E 2PE6B 2J0JA 2C60A 1WX8A 1EU3A 1L4DB 4CQNA 1W1HA 1MAIA 3RZWC 3AECB 1XCGA 2W2XC 3VQIA 1V5PA 3EFCA 3GP7A 1R7SA 3OG5A 3BVGA 2RVBB 3A98B 2K8EA 3A4RA 2EKIA 5KQ1A 2K3UA 2NPTA 2DYBA 3KSYA 5IN7A 2W3RA 2PVOD 3SFEB 2XK5A 5AUKA 4F7UP 3ODXA 1SGHA 3ULCA 2AL6A 4W9IA 1ENFA 2KX0A 2JX5A 4LNNA 4YSYB 1P6SA 4YXDB 4AOFA 4A9AA 4MH0E 1WJNA 3ZUNA 3FEHA 1XCTL 5L95C 3GZNB 3QX1A 3NSUA 2K49A 4GDLB 1QKZA 1PGXA 2NMQA 3MC8A 4LNFA 1ZSQA 1CK1A 4AQ7A 3HVDA 4MSMB 3PZDA 2RGNB 2GCJA 2VZKB 2EKEC 2JZ3B 3KUZA 3ZJVA 4G50A 5FKAC 1NU2A 2GB1A 2WDRB 2BB5A 3M95A 1DIKA 1UWMA 4HAXB 1H8CA 3ZRCA 4B6HA 2IO3B 3NVWA 3EC8A 3ML9A 2ZW1A 3MC0B 4RM9A 3A8PA 1XF5L 4DK5A 5D3IB 1U5GA 2EJ8A 3G9WA 2K6DB 3IT4B 2Y8FA 2XNAC 2O6VB 4K3CA 2VH2A 4HAUB 2DAJA 1FFVA 1RFKA 2Y3AA 4NJCA 2MWNB 2RRFA 3QHTA 4A6HA 2VZKD 2MW5A 4Z2MB 2KWDA 2JU6X 3ZNHB 4MY6A 4MM3B 4OT1A 4AJWA 4BZAA 2V0GA 3PLVA 1YJ1A 1WR6E 3W9CB 4I6PA 1V5MA 4GDKB 1NI2A 1G6JA 3BY4B 2FIFA 2IO2B 1L0YB 2N9KA 3FC4A 5DPSA 2BS2B 3RI7C 1UNQA 2A5UA 1J19A 2K5PA 2E3TA 2O6VD 1NENB 4KX6B 4WQMA 3DBHI 1EGXA 1JRUA 3PZ8A 4EEWA 1GB1A 4JKDA 3U7DA 1N6ZA 4HKQA 5DIFB 2QSDA 4HDOA 4M0WA 5EFXA 1D4BA 3RUIB 2LJIA 4IDIA 4QJ4B 2W2XD 3APCA 2KLCA 3W1YA 3AI5A 1V86A 2IY0B 1CMXB 1QILA 3NWDA 5DCNA 3URYA 4XYCA 2OOBB 2MKRA 5JZEB 4B95A 1JW9D 1DYQA 1WXSA 1L6UA 4A20A 3DQVA 5C6RA 2KWVB 3IFWB 4JIOU 1X86A 3KYDD 3NOBA 1UWXA 1XX0A 3F0WA 3A8QA 2WXPA 3J9CA 1K50A 3N9YC 2RSUA 1FFUA 1TIFA 2CAYA 1S1QB 2IBIB 3PG7A 4JKBA 2J53A 5EE9A 4L1BA 1TTNA 2KC2A 3BVZA 2KMAA 5CLLB 1I35A 5IOIA 1FHWA 3OANA 3ZW3A 3ABVB 2LEKA 3FILA 1V5UA 2FCNA 2GS0A 4LK0M 2N9LA 2KIEA 1AARA 3Q8FA 1WZ0A 1AW7A 4HATB 1TZOA 1ZKHA 2WXNA 2EMSA 2WP9B 5CTRC 3UI3A 1C79A 4HB2B 4FJZA 1IGDA 2LZ6A 1QOGA 5JP4A 1C1YB 3PZ7A 3I63C 2MP2B 3P4SB 3EHVA 2VKIA 1UELA 2L0FA 1HE8A 4FADA 2D9ZA 2ZZPB 3DXEA 5DHFB 2KVZA 3P4PB 4W9KA 3NJTA 1VJKA 1LFDA 3N32A 4S17A 5KHQA 2JVCA 1UNSA 4ASWC 2CRFA 1P3RA 4WJNA 1YJIA 1T0YA 1Q1OA 2Z13A 2KQSA 1ZUD2 4JKFA 1I7AA 4GSWA 2GJYA 3TMPB 2Y5BB 4EUTA 2KWUB 1P9DU 1WXVA 1FOEA 1E8YA 3H1UA 2J42A 3FKYA 2N0YA 4NAWB 2HTHB 2RLOA 4JL9A 2AX5A 3PLUA 1ZGUB 4LJPB 3C19A 2MBHA 3ZIMA 3JSVB 5D3YA 3KW5B 2RDBC 2KTFA 1YN5A 1YQBA 1RLFA 1M94A 4BKSA 2LGSA 5IO9A 3E9PA 1BAKA 1SJHD 2N4FA 5G55A 1MI0A 2L7RA 4KHBB 2D3AA 1TJEA 1RAXA 3APFA 1FHXA 1C77A 2RD0A 3DXCA 4MJSB 2MRPA 2KKCA 2NTSA 1YQ4B 4WWNA 3Q8AA 3TUOA 4OZAA 2GRIA 4BOSC 4C7YA 1GGOA 4F8CB 3VH4B 4HLEA 2V3SA 3IAS1 4M00A 1F2RC 5AZHA 1ZDXA 1QC6A 2MDXA 1FRRA 1X1MA 2KO3A 4L2YA 2CODA 1WGHA 1EAZA 1DDMA 3ZTDA 1P1AA 1RM6C 5JHBA 1IP9A 1YN3A 2V3NA 4BBNC 4K7UA 2JZPA 3HK0A 1NVLA 1BXTA 4E74A 3UIOB 3Q3OC 1U4AA 1YQ3B 2TSSA 3KUCB 1EF1A 3PT2B 1V1PA 5FI1A 3N30A 2YEPF 2Z59B 1WGUA 3RNFC 2N9EB 3BJIA 5DPTA 2RDGA 2Z14A 1KLUD 4OW0A 4JK7A 1E6EB 1DDVA 2DX5B 1EUVB 4MDKE 4P16A 5C2TB 3VDZA 4JKGA 2O2VB 3RT3B 2V4IB 4RGOS 3KH0A 2ADZA 1VR9A 3QQ8B 1T0SC 3R7RA 4M8NA 4Y94A 1FNVA 3TVVA 5HG2A 5KHOA 4OZCA 4IM2A 1OFFA 3MHSD 2X18A 4GMVA 1SE9A 2VRRB 1OQRA 1XODA 2YEPB 2D07B 2MBQA 2K6QA 4UDUC 2BWFA 1D5XC 5LOPB 4GGQA 1I4QA 3NZ3A 3RNCC 1VD2A 3N7CA 2KJRA 2MQJA 1B9RA 2L1CA 2EELA 2KJ6A 3BVMA 2KC1A 2IGGA 1YOVB 4DIXA 2ONQA 1QZEA 4C7ZA 2PPHA 2RPQA 2WDQB 4BBNF 4WQOB 2LXCA 4C4VB 1SE4A 3UF8A 4QJ3B 1A5RA 2FE8A 3N1YC 5G5GA 4GIVA 1JROA 3ZJUA 2RPVA 3SDLC 2LHDA 4URKA 4L23A 1QT9A 4DDID 2DYNA 5D3XA 1WH3A 4TKNA 3Q14C 3NHEB 1WI1A 2Z0QA 4ZHOA 2HE7A 3ECIA 2YF0A 5C5BB 3TFMA 1OQQA 2DA0A 2LI5A 2WX1A 1EM7A 2K1FA 3MPXA 4R3DA 4GDLA 3T9LA 1FGYA 3DBLB 2D9WA 2K2UA 1F2RI 2CHWA 3JYUA 3AE6B 2Q13A 4RF0A 4NY0A 1Q5WB 1ET9A 1JWSD 3HVZA 4L1RA 1GC6A 3SBGA 1I42A 2H89B 3L10B 1XD3B 2GCLA 1OGWA 3ZDTA 1XXGA 2YRYA 1ZPSA 3PRZA 2JP2A 4MGIE 4IFSA 2M8SA 1FRDA 3U52E 2DKQA 2WXJA 2LYDA 3T3NA 3ZVRA 4C00A 1C3TA 2D3BA 2WXOA 3UQBA 2O6VA 3QA8A 4RGNA 2WDVB 4KIKB 2FCQA 5BYQA 1QOAA 3KWVA 1R4NI 3DBSA 3T06A 2NTTA 3A4SC 3R8BA 3P1MA 4LCDE 1ZC3B 1LW3A 3VR8B 3H7SA 4AWJA 4MM3A 1M4VA 4YONA 3WAPA 1W1GA 4HWIB 2KDIA 1TGZB 4XWXA 3AE5B 2HD5B 2KT7A 4GDKA 1SF0A 1SB3C 3ZKJC 2BW2A 3KRWA 5DPRA 4TQ0A 2ZVNA 4KAXB 1ROEA 1I7HA 3DDCB 4EZLA 1WIAA 2LOZA 3A33B 1E7VA 2D5GA 2ZVOA 4O1NA 1UPQA 4LNOA 4G3XB 3W2DA 3V6CB 2IGHA 4DX8A 2ZEQA 1N3HA 2BYEA 4ITKA 4PT5A 3R3MA 2YT2A 1U29A 2AEHA 2Z0PA 4LNIA 2GBRA 2N9PC 2WH5A 1KZ7A 2MSED 2W82A 2KMMA 3UZTA 4A8XC 2H88B 2N7JA 1NYQA 2KVRA 5J3YA 1MKEA 4ZYSA 3P6AA 3KWLA 5HHDG 2RMMA 1TZ1A 5HE1A 1WRIA 4K7WA 1WR1A 4HPLB 3L16A 4TMAB 3I9V1 1WM3A 5EE3A 2LOXA 2MJEA 5DPWA 4S0RA 2MCNB 2Y7BA 3A9KB 5AUIA 2NVUI 1UGMA 4ZRPA 2J4XA 1XKEA 3A1QA 1WX9A 2ACZB 4N9F4 3AE4B 1AWEA 1Y5OA 2KYWA 4II3B 1E8ZA 3SR6A 4EOYA 2WLBA 3PHXB 1I4HA 3BIID 4HJGE 2CHZA 3PRMB 1W1DA 4WWOA 1GAQB 2BKRB 4XDDA 1E8WA 5G2NA 4EE2A 2IO0B 2BYVE 5CLQB 4MH8A 2GBKA 2BCJA 4XDCA 2YS5A 1JDEA 1HZ5A 4AUQC 2G4DB 1AQCA 3V61A 2IYDB 3SFDB 1KOTA 4MT7A 1IUEA 3AEEB 1EO6A 2QKLA 2LGYA 3RNGC 2MP2A 3HUIA 3U12A 1P3QU 4KDIC 3Q2AC 2PJHA 3WYFB 1K8RB 1SJED 1QF6A 4MEMA 3AV8A 2KFKB 1RRPB 3Q69A 1C4AA 3ENEA 2JWUA 4XGAB 1MVKA 3CSTA 2J52A 3LXFA 2N1VA 2K8CA 4B9KA 2Z0DB 4FJYA 4DX90 2HTME 4BAXA 3DWGC 4MSQB 1P98A 1F0ZA 1QOBA 3V6EB 2CY4A 2AQ2B 2W2WA 4HPMB 4HVBA 2FUHB 2PTLA 3ML8A 3BK2A 4YT0B 4I6LB 4TQ1A 2K2JA 4CHJA 4CHMA 3GZNI 4NAWA 2HTHA 5HE0A 2DYMA 3MJ5A 2CR5A 2V1YA 3NY5A 3JSVA 1JQ4A 2KTRB 4QAYA 1PUTA 3X23A 2QILA 2Y5PA 3H9DA 2EMTA 3QCAA 1WGYA 2WXKA 1ZDVA 4AJYB 4KHBA 3APDA 3PREA 2LHEA 1FB8A 1OTRB 5HE3A 3AE2B 1C78A 2G9HD 5FI0A 5I2SA 4FXCA 4MJSA 2L52A 3N1XC 1WVHA 3P2BA 4JWUC 4GB9A 1V1OA 2KQ4X 3RCPA 5C23A 4DBBA 1Z87A 4MGKE 3DHIC 1KF6B 2WXLA 2KN5A 2KN4A 5AEKB 1QQRA 5FR6A 3X0WA 3ZGZA 4WJPA 1T77A 1BTNA 3AE8B 2FJ9A 3M1IB 2IY1B 3VXWA 4ARIA 3W1SC 2KGXB 2GLSA 2L2IA 3B2GA 3LJ3A 3VH3B 1WRDB 3PHWB 3R66C 3ZXVA 2BKFA 3CIRB 3HSAA 2MFQA 3SNHA 1T0RC 2DHZA 2KANA 3RNEC 4K2PA 3NRZA 1V81A 3GS2A 2GBJA 1IPGA 3HHMA 4EMOA 2WXHA 3KY9A 1PYWD 5IP4D 2DX5A 2M19A 5C16A 4KGTA 3AXCA 3K9PB 4PYUA 3IAM1 4KGRA 2JT4B 2O2VA 1E7PB 1WM2A 2LMCA 2WXGA 4GLSC 4E3CA 2WGSA 2YVCA 2CJNA 1TBEA 2K8BA 3EA6A 1WMHB 2DZKA 4GNKB 4C56C 1PMSA 3PRPB 4F7ZA 2ZKMX 4HDQA 1X05A 1VCBA 3AM9A 4F1SA 2NMBA 1V6EA 4IKGA 1TS5A 1N61A 2WXIA 1F52A 4RGMA 2ELAA 3QBVB 1VZ6A 2MLBA 3HRDD 4KKJA 3ENBA 1WF9A 2GUMA 1WY8A 2DZJA 4XC2A 2JXXA 4KDLB 3JW0X 1GUAB 1DBHA 2WX0A 3WCQA 4BFRA 4F7GA 2W54A 3NS8A 3PTFC 4FULA 5C1ZA 3M62B 2M38A 1U5EA 2R2QA 4CSQA 4C4VA 5BYSA 3GYPA 4JQWC 3BYYB 2W9NA 5EE1A 2L05A 2BF8B 3TW1A 4C0AA 3P7ZA 2CQUA 3PVWA 5C5BA 1Y56A 1X11A 3SV1A 3HM3A 1STEA 2NBVB 1E90A 4OVZA 1WJ4A 2D3GA 1K5DB 2C7MB 4IOYX 3E9SA 1UF0A 4D0NB 4G11A 2WXQA 3M63B 1FMAD 4KGSA 4E71A 2ZCBA 4H8SA 4LNKA 5I4DA 1C4PA 1RJ2A 2D3CA 2COAA 1XEEA 4D2KA 1ACCA 4OVVA 2VRWB 4Z2NA 1LXDA 4HEA1 1L4ZB 4ARCA 5J3QA 3L17A 1J0WA 3IXSA 3MTNB 1ZXIA 2DAFA 2KDMA 1PGAA 1L5PA 3SYXA 3DVNV 3VTWA 3ZNGC 3KVFB 2CS4A 2AWTA 4RH6A 2AYOB 1D3ZA 5LNK1 1SE3A 1SBBB 2NBUA 1MG8A 1EF5A 3ALBA 3AJ4A 2MHJA 2JXTA 4RNAA 5J18A 3IBEA 5I2MA 1WGRA 2DX1A 2VH1A 2LVQA 4NPNA 1JWMD 1TKYA 2MBEA 2ROVA 3HW2B 2KR0A 1WWTA 4XX5A 4HK2A 3TL5A 5H8YE 2JYTA 4ANVA 5LXIB 3SBTA 3E9OA 5EE0A 1CJEA 1P7FA 4MGYE 2J59M 1XR0B 2R61A 4P1BC 1KFYB 2SAKA 2QMTA 2RUKB 1XO3A 4JE3B 3AN1A 1HTQA 1NYRA 2PMVA 1RFAA 1FD6A 3TCAA 4RF1A 2LGIA 1B1ZA 1S3SG 3DHGC 2EC1A 3SEBA 3IHPC 2M0AA 3CMMB 1K5GB 3AE7B 1T6BX 1UBIA 1TY2A 2KFJA 4P6VF 3TEWA 1ZYIA 2D10A 3QJZA 1I4RA 3ZQ4A 4GN1A 4N58A 3IG3A 1ZP0B 1N60A 1YIWA 3RNBC 1GNUA 3Q8BA 5LXHA 1OQYA 4OVUA 3U4EG 4HXDA 2L0TA 1XCQL 1WYGA 1NTVA 3NWFA 4EZJA 4IW0A 1BTKA 1F1HA 2LRUA 3EPYA 1NBFC 2D2QA 3A9JA 2K9XA 1DOXA 1ZM0A 3RULA 4B0MA 4MACA 3H7PA 3BINA 2ZCCA 1BUIC 1SSNA 1FM0D 1KRHA 3VOQA 1ST7A 3AE3B 1FIQA 4H2AA 2I1KA 1YMHE 5C3JB 5T8IA 1L0XB 2N23A 3L54A 5HKHA 1IBXB 1SE2A 1ZVRA 2QKMA 2DHIA 3D8FA 5D6JB 3ML4A 1BMLC 2INDC 3RZFA 1D6EC 2MBOA 1MHXA 4PQ0A 4DQOC 1U5FA 3L0WB 1C76A 2JF5A 2DTCA 2YT0A 3DVGX 4EZKA 3RFZB 3MJWA 3ZNZB 1PFDA 4PS3A 3R2TA 2L8JA 2V9HA 2COPA 1WXMA 5JLJB 3HIZA 1E7UA 2C9WB 2XEWA 5D3VA 1OY2A 3AE1B 2JPHA 3VUYA 4JLCA 4ILJA 2D9VA 2IPKD 3RYTA 1WJUA 1ZW7A 2BYTA 2JSVX 3ODOA 2KFKA 4IOIE 2OHFA 1Z2MA 1L0VB 4G0NB 5TSSA 1UUPA 2DYQA 2DKPA 1WJMA 1EWYC 4A3PA 5CHFA 2INCC 2MBBB 4YWGG 4US9A 4ZOHC 3QIJA 1TJ6A 4ILHA 2MH7A 3ZXRA 3ZVVA 5IA7A 2ELBA 2YSZA 2BGFA 1MIXA 1DYNA 2KAJA 5JHGA 2P0HA 2G3QB 2UVMA 3E56A 3W5UB 2MEKA 3QARA 2MA9B 2DN6A 3MP9A 2E6XA 2WXRA 2L32A 1KLVA 2DENB 5GXGB 3TEXA 4JX1C 1LM8B 1DDWA 1MHHE 1KM7A 2ZPNA 3GE3C 3L08A 1HB6A 5LG4B 3E9LA 1M7EA 4HAWB 1N62A 3DBLI 1V89A 2LASA 1K52A 4REZA 3L13A 1I2HA 1UNPA 2KTRA 2M17A 1JWAD 2KUPA 3AE9B 1J8CA 3ONSA 2FBWB 3B2FA 5HFYA 4FBJB 4GOUA 3WA0A 2OTXA 1OEYA 1UH6A 1MK7B 2R82A 1GPXA 2W3SA 1VBGA 1TT5B 2DNFA 1OQNA 2YT1A 5IRSA 3AMZA 1TYGB 1L6VA 4W9JA 5AZGA 3VTVA 2LGDA 3H6NA 1D5MC 2VSZA 4OSNA 2BB6A 3LYYA 1UD7A 1I4PA 1V5OA 1CZPA 1RYJA 4J3OD 1AN8A 3DCXA 2L76A 3NVYA 1XLQA 2NR2A 1V2YA 3TSSA 3PVLA 2KD0A 1H10A 2JWZA 1Y19B 2J0MA 3Q8CA 3AEFB 1EU4A 3BYTB 4AS1A 2IDYA 4LTUA 3OHMB 1X1GA 2L3ZA 4ILGB 2G35A 3N3KB 2GI9A 4EFOA 3P4RB 5KQ4A 3SHQA 5JHHA 1IGCA 4J6IA 1R4MB 3BK1A 2QIEB 3AEGB 2I5FA 2FCSA 2BWES 2K25A 5D2MB 1FXTB 2PVGC 3B1LX 2BBCA 1FAOA 2N9XA 1TXDA 2NBWB 1ISNA 1WMHA 3UINB 2Z0EB 4W9CA 1LGRA 4W9EA 2FDQA 1JMLA 1MPHA 2KDBA 1XD4A 4GPTB 3V60A 2I1JA 4ZYNA 3D32A 3U30A 1ZE3D 1EWCA 4IAPA 5BYRA 3VRBB 2LVOA 2WYQA 2GBNA 2N0SB 4WJQA 4JK9A 1KH0A 3SUZA 4ANXA 4WWPA 3F5RA 3D8DA 1KI1B 2WWZA 4II2B 3CXBB 4NSWA 3EFUA 4TYZA 2PW9A 3WALA 4HPPA 2GBMA 4KKIA 3Q6BA 1YJJA 2CU3A 1V97A 2CHXA 2WS3B 2PLPA 4IM0A 3VAWA 3RPFC 2Z4DA 5IJMA 4B6WA 2D11A 2WXMA 4DHZB 3VTUA 4PYZA 3MDBC 2RR9A 2NBVA 2M56B 1HZ6A 4A5KA 4HCPB 2LUMA 2M14A 1FGZA 2OJRA 3V3XA 3PV1A 2LUEA 5JHAA 4NNJB 2ABDA 2KX3A 5D3WA 3QK0A 5EDSA 3V62A 4KHOA 4BKSD 1AWDA 1PLSA 1GJZA 1JWUD 1P0RA 2IGDA 2WU5B 2K22A 3BZDB 1FXIA 4AP4C 2DFKA 2NCNA 3VUWA 3W1SA 5DI9B 3LB8C 3VIAA 3AB5A 3S2AA 2I2YA 1C4CA 1E9MA 2KMCA 4HCNB 1WJ1A 4K2OA 3MFGA 1MK9B 2JQRB 4RCOA 3TO1A 2G1EA 2WHIA 4YSZB 2BS4B 3WIMA 5HE2A 3DVGY 1FXAA 4GU2A 3UGBB 3EUB2 2FJLA 3I3TB 5FR3A 1SIFA 4HRSA 3DCGA 3ZDMC 2A4ZA 3VUXA 5E6PA 2KQ7A 3NG0A 4JWSC 3HQCA 5C79A 1WZ3A 2GOWA 3O96A 2I38A 3OAWA 3TEYA 2LULA 2HRJA 3PSEB 2M0XA 2WNMA 2WU2B 1YD8U 5J2RA 1LO5D 2RSGA 2FIDA 4RGTA 2JYEA 2AL3A 1IRSA 2JRIB 4TUUA 1TS3A 3TEZA 1DOYA 1SHCA 1I4XA 4IWQA 2HDEA 2PIAA 2JY6A 4M02A 2LFIA 4OHJA 3OLMD 1V80A 3QAQA 1DOIA 1WG7A 3DHHC 4WWMA 2COCA 2V3PA 1Y8RC 1Q0WB 2D9YA 1MIZB 3FVCA 3NUHB 1AYFA 3DWMA 4LLGM 1MG4A 1V5TA 1V88A 4YL8A 4N59A 5L83A 5J3TA 2MWSB 3Q8EA 1SEBD 3B9JA 3TBLD 4ACFA 3PSCA 4HB3B 3MC9A 3GE8C 4ZRIA 1NEKB 4QXAB 1KC7A 1WYWB 3FSSA 1RRBA 1TKEA 4WH4A 1Q10A 1J0GA 3KZ1A 3LJUX 2DLWA 1Q67A 3NZSA 4IWOA 4HB0B 1ZOYB 3RMKC 2K39A 1IBXA 2LRWA 5JH5C 4FLHA 2R2OA 2Z59A 2V4LA 4IWPA 1FEHA 1FCCC 1QOFA 2IJ0A 3PEGA 2ICIA 1WE7A 2ASQA 4NQLB 4I6NB 3EGRA 2WDTB 1E5WA 3E66A 3TIXA 1IYFA 4M8MA 3GOEA 3A58A 3NVZA 2KNBA 4DDGD 1X1FA 1UPRA 3B0AA 4DHZE 2ZPYA 1MFWA 4FHJA 4WSFA 3KRXA 1H4RA 4MT5A 1HQRD 3R2IA 4K81A 4JKAA 5MPOA 3DBHB 4MGZE 3WAMA 4NZLB 3KUDB 1D5ZC 4WVFB 3U7ZA 2H7DA 3VVWB 4NQKE 4GOCA 4XWTA 4RMAA 1F9JA 3R7QA 4JKEA 2PZ1A 2UZRA 4D6WA 2V76A 1WE6A 4KZCA 5GOWB 1GB4A 2B76B 5CX3A 2UZSA 3VRAB 3ZYYX 2IFSA 2FNJB 3N1ZC 3GYOA 3BWUD 2L1AA 5DHAB 3DBRB 1QLBB 3DBRI 1NTIA 4YTMB 5JXVA 1NVID 2MJDA 3ULBA
chains in the Genus database with same CATH topology
2MX2A 2G4SA 5D94A 4L6EA 2N7EA 2ZJDA 2LD9A 2C7HA 3PGEA 2M4NA 3PPAA 4HB4B 2PE9A 1QQGA 3CSFA 1UNRA 3DXDA 3Q3JA 1V61A 4IM3A 3A1QB 1LQBA 4A6FB 4DBGA 1HB8A 3KYCD 2DZIA 5GMVA 2RQ1A 2UWQA 1TQZA 4KVGB 1L7YA 3QC8B 4FA6A 4GMXB 1GG3A 5L81A 2DHKA 3OJ4B 2CB8A 5E6OA 2KCJA 2R09A 4DHJB 3B08A 4ZRKA 4KIKA 4FJVB 2IO1B 1U27A 4K1RB 2NS5A 2CU1A 1M7RA 4A6KA 2P0DA 5DH9B 4JK8A 3CIKA 2C7NB 1PFJA 5IAAC 1HBKA 2QHOA 2KHWB 2G45B 4PS7A 2ROZB 2HJ8A 3UIPB 4LJOB 4K17A 4CHKA 2J0KA 2JZZA 2IYBA 4DHJD 5D7GA 2NPTB 5AZFA 3T8MA 1OMWA 2BPSA 3LDZE 2XK5B 4KZ0A 2D9XA 4W9HA 2J7QB 4ZRJA 2D4QA 5D27A 4DXAB 1U2BA 3IVFA 1KZGA 2I5CA 4BKGA 1WGQA 4RM8A 3QWZB 3RCZA 1VBHA 4BOZB 3QWMA 3A9KA 4BVUC 1LB1A 2JRHA 2N1WA 2COFA 1WGDA 2KXJA 5KCVA 1OEYJ 2X0SA 2YS3A 4FN2A 4X57B 2REXA 2NZ8B 4W9GA 3SO6A 4MELA 1KBLA 1EVHA 5JVLA 2FAZA 4XZ4A 3D8EA 2KJHB 2GMIC 2XBBC 5LONB 4KSLC 2LVPA 2LBBA 3ZO5B 2LGXA 5BO4B 2Z0OA 4JKCA 3AU4A 4IG7B 1KJTA 2KZRA 2YLMA 4BBKA 3PVUA 3V5WA 2LKOA 2Y8GA 1PQSA 4M0WB 3WAOA 1GC7A 4WAAA 2RNRB 1L2NA 3AU5A 3U8ZA 3Q3FA 3FM8C 4K7SA 2DYOA 4NJ7A 4W9LA 2CKHB 1WFYA 4P7IA 4ZDVA 1UEFA 1ZC4B 4GZUA 5TR5A 4JGHB 2JUOA 3AULA 4EKUA 4PNKA 2LWPA 2K00A 3NZUA 3WANA 1NTYA 4NJ6A 2KDEB 3PP2A 3SD5A 2K8HA 4ICUA 2KOXA 1UBQA 2CY5A 2N7DA 5CHWA 3VHTC 4EJNA 1B55A 1V9JA 4W9DA 3SU8X 5J17A 3ZTCA 1WJ6A 2LJ5A 4HAZB 2XQNM 3O65B 4TV3A 3K9OB 1YX6B 3PS6A 3EECA 4KHAA 3ZNID 2DHJA 3RD2A 2P8VA 3VFKA 4DWFA 2KWCA 4HJKA 1R4MI 4IUMB 5LLIA 2ZNVC 1WXAA 2RGFA 1NDDA 4GXBA 3UQAA 1U5DA 4PS8A 2FCMA 2BYFA 2UYZB 2DIKA 4JKHA 2LXAA 2IZVB 3M3JA 2R0DA 4IC7B 2KK8A 4CO7A 1ACAA 4KV2A 1UZXB 3ODWA 2KLGA 1Z5SB 4ICVA 4LDTB 4W9FA 4A3OA 3DOWA 1XT9B 5E6NA 4HAYB 4HAVB 3OJ3A 2LG1A 4F7HA 3FLVA 1DROA 3DVNU 3A9JB 2YS1A 4WJOA 5CHVC 1YX5B 3FP5A 3H7PB 1E8XA 4MK0A 4LDTD 1BWNA 1WI0A 4A6FA 4CYEA 4KSKC 4ANWA 1WX7A 2M1MA 2P0FA 1FHOA 3HM6X 2DZMA 3ZRFA 2E2XA 4ANUA 2OQBA 2H7EA 2KDFB 4FHKA 1P5TA 2ZNVB 3ZLZA 2L00B 4JKGB 4HHVA 2C5LC 3TJPA 2PEAA 4BKTA 4WJ7A 3C0RB 3DPDA 1WGGA 2B3AA 3JVZX 1BT0A 1XQQA 1V49A 3CF6E 2PE6B 2J0JA 2C60A 1WX8A 1W1HA 1MAIA 3RZWC 1XCGA 2W2XC 3VQIA 1V5PA 2RVBB 3A4RA 3A98B 5KQ1A 2NPTA 2DYBA 3KSYA 2XK5A 4F7UP 3ODXA 1SGHA 3ULCA 2AL6A 4W9IA 2KX0A 1P6SA 4AOFA 4MH0E 1WJNA 3ZUNA 3FEHA 5L95C 3QX1A 3NSUA 4GDLB 1ZSQA 4MSMB 3PZDA 2RGNB 2GCJA 2EKEC 2JZ3B 3KUZA 4G50A 1NU2A 3M95A 1DIKA 4HAXB 1H8CA 3ZRCA 4B6HA 2IO3B 3EC8A 3ML9A 4RM9A 3A8PA 4DK5A 1U5GA 2EJ8A 3G9WA 2K6DB 2Y8FA 2O6VB 4HAUB 2DAJA 2MWNB 3QHTA 4A6HA 2MW5A 4Z2MB 3ZNHB 4MY6A 4AJWA 3PLVA 1YJ1A 1WR6E 4I6PA 1V5MA 4GDKB 1NI2A 1G6JA 3BY4B 2FIFA 2IO2B 5DPSA 1UNQA 2A5UA 1J19A 2O6VD 3DBHI 1EGXA 1JRUA 4EEWA 4JKDA 3U7DA 5DIFB 4HDOA 5EFXA 3RUIB 2W2XD 3APCA 2KLCA 3W1YA 3AI5A 1V86A 2IY0B 1CMXB 5DCNA 2OOBB 2MKRA 5JZEB 4B95A 1WXSA 4A20A 3DQVA 5C6RA 2KWVB 3IFWB 4JIOU 1X86A 3KYDD 3NOBA 1XX0A 3F0WA 3A8QA 2RSUA 2CAYA 1S1QB 2IBIB 3PG7A 4JKBA 1TTNA 2KC2A 2KMAA 5CLLB 1I35A 1FHWA 3OANA 3ZW3A 1V5UA 2FCNA 2GS0A 1AARA 1WZ0A 4HATB 1ZKHA 2EMSA 5CTRC 4HB2B 4FJZA 2LZ6A 5JP4A 1C1YB 2MP2B 3EHVA 2VKIA 1UELA 2L0FA 1HE8A 4FADA 2D9ZA 2ZZPB 3DXEA 5DHFB 4W9KA 1LFDA 3N32A 5KHQA 2JVCA 4ASWC 2CRFA 1P3RA 4WJNA 1T0YA 1Q1OA 2KQSA 4JKFA 1I7AA 4GSWA 2GJYA 3TMPB 2Y5BB 4EUTA 2KWUB 1P9DU 1WXVA 1FOEA 1E8YA 3H1UA 2N0YA 4NAWB 2HTHB 2RLOA 4JL9A 3PLUA 1ZGUB 4LJPB 2MBHA 3ZIMA 3JSVB 5D3YA 3KW5B 2KTFA 1YQBA 1RLFA 1M94A 4BKSA 3E9PA 1BAKA 2N4FA 5G55A 2L7RA 4KHBB 1RAXA 3APFA 1FHXA 2RD0A 3DXCA 4MJSB 2MRPA 2KKCA 4WWNA 4BOSC 1GGOA 4F8CB 3VH4B 4HLEA 2V3SA 5AZHA 1QC6A 2MDXA 1X1MA 2KO3A 2CODA 1WGHA 1EAZA 1DDMA 3ZTDA 1P1AA 5JHBA 1IP9A 4BBNC 4K7UA 3HK0A 1NVLA 4E74A 3UIOB 1U4AA 3KUCB 1EF1A 3PT2B 3N30A 5FI1A 2Z59B 1WGUA 2N9EB 3BJIA 5DPTA 4JK7A 1DDVA 2DX5B 1EUVB 4MDKE 3VDZA 4JKGA 2O2VB 3RT3B 3KH0A 2ADZA 3QQ8B 3R7RA 4M8NA 4Y94A 3TVVA 5KHOA 4IM2A 3MHSD 2X18A 4GMVA 1SE9A 2VRRB 1XODA 2D07B 2MBQA 2K6QA 2BWFA 5LOPB 4GGQA 1VD2A 3N7CA 2KJRA 2MQJA 2L1CA 2KJ6A 2KC1A 1QZEA 2PPHA 2RPQA 4BBNF 4WQOB 2LXCA 1A5RA 3UF8A 4GIVA 3SDLC 4URKA 4DDID 2DYNA 5D3XA 1WH3A 4TKNA 3NHEB 1WI1A 2Z0QA 3ECIA 2HE7A 2YF0A 5C5BB 3TFMA 2DA0A 2LI5A 2WX1A 2K1FA 3MPXA 4GDLA 3T9LA 1FGYA 2D9WA 2K2UA 2CHWA 3JYUA 2Q13A 4NY0A 1Q5WB 1GC6A 3SBGA 1I42A 3L10B 1XD3B 2GCLA 1OGWA 3ZDTA 2YRYA 3PRZA 2JP2A 4MGIE 4IFSA 2M8SA 2DKQA 2LYDA 3ZVRA 1C3TA 3UQBA 2O6VA 3QA8A 4KIKB 2FCQA 1R4NI 3DBSA 3T06A 3A4SC 4LCDE 1ZC3B 1LW3A 3H7SA 4AWJA 4MM3A 4YONA 3WAPA 1W1GA 4HWIB 2KDIA 1TGZB 4XWXA 2HD5B 4GDKA 3ZKJC 5DPRA 3KRWA 4TQ0A 2ZVNA 4KAXB 3DDCB 4EZLA 1WIAA 2LOZA 3A33B 1E7VA 2ZVOA 1UPQA 4G3XB 3V6CB 4DX8A 2ZEQA 1N3HA 2BYEA 3R3MA 1U29A 2AEHA 2Z0PA 2GBRA 2N9PC 2WH5A 1KZ7A 2MSED 3UZTA 2KVRA 5J3YA 1MKEA 3P6AA 1TZ1A 5HE1A 4K7WA 1WR1A 4HPLB 3L16A 1WM3A 2LOXA 5DPWA 2MCNB 2Y7BA 3A9KB 2NVUI 1UGMA 1XKEA 3A1QA 1WX9A 4N9F4 1AWEA 1Y5OA 4II3B 1E8ZA 4EOYA 3PHXB 2CHZA 3PRMB 1W1DA 4WWOA 2BKRB 1E8WA 5G2NA 2IO0B 2BYVE 5CLQB 2GBKA 2BCJA 2YS5A 1JDEA 4AUQC 2G4DB 1AQCA 3V61A 2IYDB 1KOTA 4MT7A 1EO6A 2QKLA 2LGYA 2MP2A 1P3QU 4KDIC 2PJHA 3WYFB 1K8RB 4MEMA 2KFKB 1RRPB 3ENEA 3CSTA 2N1VA 2K8CA 4B9KA 2Z0DB 4FJYA 4DX90 4MSQB 1P98A 3V6EB 2CY4A 2W2WA 4HPMB 4HVBA 2FUHB 3ML8A 4I6LB 4TQ1A 2K2JA 4CHJA 4CHMA 3GZNI 4NAWA 2HTHA 5HE0A 2DYMA 2CR5A 2V1YA 3NY5A 3JSVA 2KTRB 3X23A 3H9DA 2EMTA 3QCAA 1WGYA 4AJYB 3APDA 3PREA 1FB8A 1OTRB 5HE3A 5FI0A 4MJSA 1WVHA 3P2BA 4GB9A 3RCPA 5C23A 4DBBA 1Z87A 4MGKE 2KN5A 5AEKB 5FR6A 3X0WA 4WJPA 1BTNA 2FJ9A 3M1IB 2IY1B 3VXWA 3W1SC 2KGXB 3LJ3A 2L2IA 3VH3B 1WRDB 3PHWB 3R66C 2BKFA 2MFQA 3SNHA 2KANA 2DHZA 4K2PA 1V81A 2GBJA 1IPGA 3HHMA 4EMOA 3KY9A 2DX5A 5C16A 3AXCA 3K9PB 4PYUA 2JT4B 2O2VA 1WM2A 4E3CA 2YVCA 1TBEA 2K8BA 1WMHB 2DZKA 4F7ZA 1PMSA 3PRPB 4HDQA 1X05A 1VCBA 4F1SA 2NMBA 1V6EA 2ELAA 3QBVB 2MLBA 3ENBA 1WF9A 1WY8A 2DZJA 4XC2A 2JXXA 4KDLB 3JW0X 1GUAB 1DBHA 2WX0A 4BFRA 4F7GA 3NS8A 3PTFC 4FULA 5C1ZA 3M62B 2M38A 1U5EA 2R2QA 3GYPA 4JQWC 2W9NA 2L05A 2BF8B 3TW1A 4C0AA 3P7ZA 2CQUA 3PVWA 5C5BA 1X11A 3SV1A 3HM3A 2NBVB 1E90A 1WJ4A 2D3GA 1K5DB 2C7MB 4IOYX 4D0NB 4G11A 3M63B 4E71A 2ZCBA 4H8SA 1RJ2A 2COAA 4OVVA 2VRWB 4Z2NA 1LXDA 5J3QA 3L17A 1J0WA 3MTNB 2DAFA 3SYXA 3DVNV 3VTWA 3ZNGC 3KVFB 2CS4A 2AWTA 1D3ZA 2AYOB 2NBUA 1MG8A 1EF5A 3ALBA 3AJ4A 5J18A 3IBEA 1WGRA 2DX1A 2LVQA 4NPNA 2MBEA 2ROVA 3HW2B 4XX5A 4HK2A 3TL5A 4ANVA 5LXIB 3SBTA 3E9OA 4MGYE 2J59M 1XR0B 2RUKB 1RFAA 3TCAA 1S3SG 2EC1A 3IHPC 3CMMB 1K5GB 1UBIA 2KFJA 2D10A 3QJZA 4GN1A 3IG3A 1YIWA 1GNUA 5LXHA 4OVUA 1OQYA 4HXDA 2L0TA 1NTVA 4EZJA 4IW0A 1BTKA 2LRUA 3EPYA 1NBFC 2D2QA 3A9JA 1ZM0A 3RULA 3H7PA 3BINA 2ZCCA 3VOQA 1ST7A 2I1KA 2N23A 3L54A 5HKHA 1ZVRA 2QKMA 2DHIA 3D8FA 5D6JB 3ML4A 3RZFA 2MBOA 4PQ0A 1U5FA 3L0WB 2JF5A 2DTCA 2YT0A 3DVGX 4EZKA 3MJWA 3ZNZB 4PS3A 2L8JA 2COPA 1WXMA 5JLJB 3HIZA 1E7UA 2C9WB 2XEWA 5D3VA 1OY2A 2JPHA 3VUYA 4JLCA 4ILJA 2D9VA 3RYTA 1WJUA 1ZW7A 3ODOA 2KFKA 1Z2MA 4G0NB 2DYQA 2DKPA 1WJMA 4A3PA 5CHFA 2MBBB 3QIJA 1TJ6A 4ILHA 3ZVVA 5IA7A 2ELBA 2YSZA 2BGFA 1MIXA 1DYNA 5JHGA 2P0HA 2G3QB 2UVMA 3QARA 2MA9B 2DN6A 1KLVA 2DENB 1LM8B 1DDWA 1KM7A 2ZPNA 3L08A 1HB6A 3E9LA 1M7EA 4HAWB 3DBLI 1V89A 2LASA 3L13A 1I2HA 1UNPA 2KTRA 2M17A 2KUPA 1J8CA 3ONSA 4FBJB 3WA0A 2OTXA 1OEYA 1UH6A 1MK7B 2R82A 1VBGA 1OQNA 2YT1A 4W9JA 5AZGA 3VTVA 2LGDA 3H6NA 2VSZA 1UD7A 1V5OA 2L76A 2NR2A 1V2YA 3PVLA 2KD0A 1H10A 2JWZA 1Y19B 2J0MA 1X1GA 2L3ZA 4ILGB 2G35A 3N3KB 4EFOA 5KQ4A 3SHQA 5JHHA 4J6IA 2I5FA 2FCSA 2BWES 2K25A 5D2MB 1FXTB 3B1LX 1FAOA 2N9XA 1TXDA 2NBWB 1ISNA 1WMHA 3UINB 2Z0EB 4W9CA 4W9EA 2FDQA 1MPHA 2KDBA 1XD4A 4GPTB 3V60A 2I1JA 4ZYNA 3D32A 3U30A 4IAPA 2LVOA 2WYQA 2GBNA 4WJQA 4JK9A 3SUZA 4ANXA 4WWPA 3F5RA 3D8DA 1KI1B 2WWZA 4II2B 3CXBB 4NSWA 3EFUA 4TYZA 3WALA 2GBMA 2CHXA 4IM0A 3VAWA 5IJMA 4B6WA 2D11A 4DHZB 3VTUA 4PYZA 3MDBC 2RR9A 4A5KA 4HCPB 2M14A 1FGZA 2OJRA 3PV1A 2LUEA 5JHAA 4NNJB 2ABDA 2KX3A 5D3WA 3QK0A 5EDSA 3V62A 4KHOA 4BKSD 1PLSA 1GJZA 1P0RA 4AP4C 2DFKA 2NCNA 3VUWA 3W1SA 5DI9B 3VIAA 3S2AA 2KMCA 4HCNB 1WJ1A 4K2OA 1MK9B 3TO1A 3WIMA 5HE2A 3DVGY 4GU2A 3UGBB 2FJLA 3I3TB 1SIFA 3DCGA 3ZDMC 2A4ZA 3VUXA 5E6PA 2KQ7A 3HQCA 5C79A 1WZ3A 2GOWA 3O96A 3OAWA 2LULA 2HRJA 3PSEB 2M0XA 1YD8U 5J2RA 2RSGA 2FIDA 2AL3A 1IRSA 2JRIB 4TUUA 1SHCA 4IWQA 2JY6A 3OLMD 1V80A 3QAQA 1WG7A 2COCA 1Y8RC 1Q0WB 2D9YA 1MIZB 1V5TA 1V88A 4YL8A 5L83A 5J3TA 2MWSB 3TBLD 3PSCA 4HB3B 4ZRIA 1KC7A 1WYWB 3FSSA 1RRBA 1J0GA 3KZ1A 3LJUX 2DLWA 1Q67A 3NZSA 4IWOA 4HB0B 2K39A 2LRWA 5JH5C 4FLHA 2R2OA 2V4LA 4IWPA 3PEGA 1WE7A 2ASQA 4NQLB 4I6NB 2WDTB 1E5WA 3E66A 3TIXA 1IYFA 4M8MA 3GOEA 4DDGD 2KNBA 1X1FA 1UPRA 3B0AA 4DHZE 2ZPYA 4FHJA 4WSFA 3KRXA 1H4RA 4K81A 4JKAA 4MGZE 3WAMA 3KUDB 4WVFB 3VVWB 2H7DA 4NQKE 4GOCA 4RMAA 1F9JA 3R7QA 4JKEA 2PZ1A 2UZRA 2V76A 1WE6A 4KZCA 5GOWB 5CX3A 2UZSA 2IFSA 2FNJB 3GYOA 5DHAB 3DBRI 1NTIA 3ULBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX2 A;  2G4S A;  5D94 A;  4L6E A;  2N7E A;  2ZJD A;  2LD9 A;  2C7H A;  3PGE A;  2M4N A;  3PPA A;  4HB4 B;  2PE9 A;  1QQG A;  3CSF A;  1UNR A;  3DXD A;  3Q3J A;  1V61 A;  4IM3 A;  3A1Q B;  1LQB A;  4A6F B;  4DBG A;  1HB8 A;  3KYC D;  2DZI A;  5GMV A;  2RQ1 A;  2UWQ A;  1TQZ A;  4KVG B;  1L7Y A;  3QC8 B;  4FA6 A;  4GMX B;  1GG3 A;  5L81 A;  2DHK A;  3OJ4 B;  2CB8 A;  5E6O A;  2KCJ A;  2R09 A;  4DHJ B;  3B08 A;  4ZRK A;  4KIK A;  4FJV B;  2IO1 B;  1U27 A;  4K1R B;  2NS5 A;  2CU1 A;  1M7R A;  4A6K A;  2P0D A;  5DH9 B;  3CIK A;  2C7N B;  1PFJ A;  5IAA C;  1HBK A;  2QHO A;  2KHW B;  2G45 B;  4PS7 A;  2ROZ B;  2HJ8 A;  3UIP B;  4LJO B;  4K17 A;  4CHK A;  2J0K A;  2JZZ A;  2IYB A;  4DHJ D;  5D7G A;  2NPT B;  5AZF A;  3T8M A;  1OMW A;  2BPS A;  3LDZ E;  2XK5 B;  4KZ0 A;  2D9X A;  4W9H A;  2J7Q B;  4ZRJ A;  2D4Q A;  5D27 A;  4DXA B;  1U2B A;  3IVF A;  1KZG A;  2I5C A;  4BKG A;  1WGQ A;  4RM8 A;  3QWZ B;  3RCZ A;  4BOZ B;  3QWM A;  3A9K A;  4BVU C;  1LB1 A;  2JRH A;  2N1W A;  2COF A;  1WGD A;  2KXJ A;  5KCV A;  1OEY J;  2YS3 A;  4FN2 A;  4X57 B;  2REX A;  2NZ8 B;  4W9G A;  3SO6 A;  4MEL A;  1EVH A;  2FAZ A;  4XZ4 A;  3D8E A;  2KJH B;  2GMI C;  2XBB C;  5LON B;  4KSL C;  2LVP A;  2LBB A;  3ZO5 B;  2LGX A;  5BO4 B;  2Z0O A;  3AU4 A;  4IG7 B;  1KJT A;  2KZR A;  2YLM A;  4BBK A;  3PVU A;  3V5W A;  2LKO A;  2Y8G A;  1PQS A;  4M0W B;  3WAO A;  1GC7 A;  4WAA A;  2RNR B;  1L2N A;  3AU5 A;  3U8Z A;  3Q3F A;  3FM8 C;  4K7S A;  2DYO A;  4NJ7 A;  4W9L A;  2CKH B;  1WFY A;  4P7I A;  4ZDV A;  1UEF A;  1ZC4 B;  4GZU A;  5TR5 A;  4JGH B;  2JUO A;  3AUL A;  4EKU A;  4PNK A;  2LWP A;  2K00 A;  3NZU A;  3WAN A;  1NTY A;  4NJ6 A;  2KDE B;  3PP2 A;  3SD5 A;  2K8H A;  4ICU A;  2KOX A;  1UBQ A;  2CY5 A;  2N7D A;  5CHW A;  3VHT C;  4EJN A;  1B55 A;  1V9J A;  4W9D A;  3SU8 X;  5J17 A;  3ZTC A;  1WJ6 A;  2LJ5 A;  4HAZ B;  2XQN M;  3O65 B;  4TV3 A;  3K9O B;  1YX6 B;  3PS6 A;  3EEC A;  4KHA A;  3ZNI D;  2DHJ A;  3RD2 A;  2P8V A;  3VFK A;  4DWF A;  2KWC A;  4HJK A;  1R4M I;  4IUM B;  5LLI A;  2ZNV C;  1WXA A;  2RGF A;  1NDD A;  4GXB A;  3UQA A;  1U5D A;  4PS8 A;  2FCM A;  2BYF A;  2UYZ B;  2LXA A;  2IZV B;  3M3J A;  2R0D A;  4IC7 B;  2KK8 A;  4CO7 A;  1ACA A;  4KV2 A;  1UZX B;  3ODW A;  2KLG A;  1Z5S B;  4ICV A;  4LDT B;  4W9F A;  4A3O A;  3DOW A;  1XT9 B;  5E6N A;  4HAY B;  4HAV B;  3OJ3 A;  2LG1 A;  4F7H A;  3FLV A;  1DRO A;  3DVN U;  3A9J B;  2YS1 A;  4WJO A;  5CHV C;  1YX5 B;  3FP5 A;  3H7P B;  1E8X A;  4MK0 A;  4LDT D;  1BWN A;  1WI0 A;  4A6F A;  4CYE A;  4KSK C;  4ANW A;  1WX7 A;  2M1M A;  2P0F A;  1FHO A;  3HM6 X;  2DZM A;  3ZRF A;  2E2X A;  4ANU A;  2OQB A;  2H7E A;  2KDF B;  4FHK A;  1P5T A;  2ZNV B;  3ZLZ A;  2L00 B;  4HHV A;  2C5L C;  3TJP A;  2PEA A;  4BKT A;  4WJ7 A;  3C0R B;  3DPD A;  1WGG A;  2B3A A;  3JVZ X;  1BT0 A;  1XQQ A;  1V49 A;  3CF6 E;  2PE6 B;  2J0J A;  2C60 A;  1WX8 A;  1W1H A;  1MAI A;  3RZW C;  1XCG A;  2W2X C;  3VQI A;  1V5P A;  3A4R A;  2RVB B;  3A98 B;  5KQ1 A;  2NPT A;  2DYB A;  3KSY A;  2XK5 A;  4F7U P;  3ODX A;  1SGH A;  3ULC A;  2AL6 A;  4W9I A;  2KX0 A;  1P6S A;  4AOF A;  4MH0 E;  1WJN A;  3ZUN A;  3FEH A;  5L95 C;  3QX1 A;  3NSU A;  4GDL B;  1ZSQ A;  4MSM B;  3PZD A;  2RGN B;  2GCJ A;  2EKE C;  2JZ3 B;  3KUZ A;  4G50 A;  1NU2 A;  3M95 A;  4HAX B;  1H8C A;  3ZRC A;  4B6H A;  2IO3 B;  3EC8 A;  3ML9 A;  4RM9 A;  3A8P A;  4DK5 A;  1U5G A;  2EJ8 A;  3G9W A;  2K6D B;  2Y8F A;  2O6V B;  4HAU B;  2DAJ A;  2MWN B;  3QHT A;  4A6H A;  2MW5 A;  4Z2M B;  3ZNH B;  4MY6 A;  4AJW A;  3PLV A;  1YJ1 A;  1WR6 E;  4I6P A;  1V5M A;  4GDK B;  1NI2 A;  1G6J A;  3BY4 B;  2FIF A;  2IO2 B;  5DPS A;  1UNQ A;  2A5U A;  1J19 A;  2O6V D;  3DBH I;  1EGX A;  1JRU A;  4EEW A;  3U7D A;  5DIF B;  4HDO A;  5EFX A;  3RUI B;  2W2X D;  3APC A;  2KLC A;  3W1Y A;  3AI5 A;  1V86 A;  2IY0 B;  1CMX B;  5DCN A;  2OOB B;  2MKR A;  5JZE B;  4B95 A;  1WXS A;  4A20 A;  3DQV A;  5C6R A;  2KWV B;  3IFW B;  4JIO U;  1X86 A;  3KYD D;  3NOB A;  1XX0 A;  3F0W A;  3A8Q A;  2RSU A;  2CAY A;  1S1Q B;  2IBI B;  3PG7 A;  1TTN A;  2KC2 A;  2KMA A;  5CLL B;  1I35 A;  1FHW A;  3OAN A;  3ZW3 A;  1V5U A;  2FCN A;  2GS0 A;  1AAR A;  1WZ0 A;  4HAT B;  1ZKH A;  2EMS A;  5CTR C;  4HB2 B;  4FJZ A;  2LZ6 A;  5JP4 A;  1C1Y B;  2MP2 B;  3EHV A;  2VKI A;  1UEL A;  2L0F A;  1HE8 A;  4FAD A;  2D9Z A;  2ZZP B;  3DXE A;  5DHF B;  4W9K A;  1LFD A;  3N32 A;  5KHQ A;  2JVC A;  4ASW C;  2CRF A;  1P3R A;  4WJN A;  1T0Y A;  1Q1O A;  2KQS A;  1I7A A;  4GSW A;  2GJY A;  3TMP B;  2Y5B B;  4EUT A;  2KWU B;  1P9D U;  1WXV A;  1FOE A;  1E8Y A;  3H1U A;  2N0Y A;  4NAW B;  2HTH B;  2RLO A;  4JL9 A;  3PLU A;  1ZGU B;  4LJP B;  2MBH A;  3ZIM A;  3JSV B;  5D3Y A;  3KW5 B;  2KTF A;  1YQB A;  1RLF A;  1M94 A;  4BKS A;  2N4F A;  1BAK A;  5G55 A;  2L7R A;  4KHB B;  1RAX A;  3APF A;  1FHX A;  2RD0 A;  3DXC A;  4MJS B;  2MRP A;  2KKC A;  4WWN A;  4BOS C;  4F8C B;  3VH4 B;  4HLE A;  2V3S A;  5AZH A;  1QC6 A;  2MDX A;  1X1M A;  2KO3 A;  2COD A;  1WGH A;  1EAZ A;  1DDM A;  3ZTD A;  1P1A A;  5JHB A;  1IP9 A;  4BBN C;  4K7U A;  3HK0 A;  1NVL A;  4E74 A;  3UIO B;  1U4A A;  3KUC B;  1EF1 A;  3PT2 B;  3N30 A;  5FI1 A;  2Z59 B;  1WGU A;  2N9E B;  3BJI A;  5DPT A;  1DDV A;  2DX5 B;  1EUV B;  4MDK E;  3VDZ A;  2O2V B;  3RT3 B;  3KH0 A;  2ADZ A;  3QQ8 B;  3R7R A;  4M8N A;  4Y94 A;  3TVV A;  5KHO A;  4IM2 A;  3MHS D;  2X18 A;  4GMV A;  1SE9 A;  2VRR B;  1XOD A;  2D07 B;  2MBQ A;  2K6Q A;  2BWF A;  5LOP B;  4GGQ A;  1VD2 A;  3N7C A;  2KJR A;  2MQJ A;  2L1C A;  2KJ6 A;  2KC1 A;  1QZE A;  2PPH A;  2RPQ A;  4BBN F;  4WQO B;  2LXC A;  1A5R A;  3UF8 A;  4GIV A;  3SDL C;  4URK A;  4DDI D;  2DYN A;  5D3X A;  1WH3 A;  4TKN A;  3NHE B;  1WI1 A;  2Z0Q A;  3ECI A;  2HE7 A;  2YF0 A;  5C5B B;  3TFM A;  2DA0 A;  2LI5 A;  2WX1 A;  2K1F A;  3MPX A;  4GDL A;  3T9L A;  1FGY A;  2D9W A;  2K2U A;  2CHW A;  3JYU A;  2Q13 A;  4NY0 A;  1Q5W B;  1GC6 A;  1I42 A;  3L10 B;  1XD3 B;  2GCL A;  1OGW A;  3ZDT A;  2YRY A;  3PRZ A;  2JP2 A;  4MGI E;  4IFS A;  2M8S A;  2DKQ A;  2LYD A;  3ZVR A;  1C3T A;  3UQB A;  2O6V A;  3QA8 A;  4KIK B;  2FCQ A;  1R4N I;  3DBS A;  3T06 A;  3A4S C;  4LCD E;  1ZC3 B;  1LW3 A;  3H7S A;  4AWJ A;  4MM3 A;  4YON A;  3WAP A;  1W1G A;  4HWI B;  2KDI A;  1TGZ B;  4XWX A;  2HD5 B;  4GDK A;  3ZKJ C;  5DPR A;  3KRW A;  4TQ0 A;  2ZVN A;  4KAX B;  3DDC B;  4EZL A;  1WIA A;  2LOZ A;  3A33 B;  1E7V A;  2ZVO A;  1UPQ A;  4G3X B;  3V6C B;  4DX8 A;  2ZEQ A;  1N3H A;  2BYE A;  3R3M A;  1U29 A;  2AEH A;  2Z0P A;  2GBR A;  2N9P C;  2WH5 A;  1KZ7 A;  2MSE D;  3UZT A;  2KVR A;  5J3Y A;  1MKE A;  3P6A A;  1TZ1 A;  5HE1 A;  4K7W A;  1WR1 A;  4HPL B;  3L16 A;  1WM3 A;  2LOX A;  5DPW A;  2MCN B;  2Y7B A;  3A9K B;  2NVU I;  1UGM A;  1XKE A;  3A1Q A;  1WX9 A;  4N9F 4;  1AWE A;  1Y5O A;  4II3 B;  1E8Z A;  4EOY A;  3PHX B;  2CHZ A;  3PRM B;  1W1D A;  4WWO A;  2BKR B;  1E8W A;  5G2N A;  2IO0 B;  2BYV E;  5CLQ B;  2GBK A;  2BCJ A;  2YS5 A;  4AUQ C;  2G4D B;  1AQC A;  3V61 A;  2IYD B;  1KOT A;  4MT7 A;  1EO6 A;  2QKL A;  2LGY A;  2MP2 A;  1P3Q U;  4KDI C;  2PJH A;  3WYF B;  1K8R B;  4MEM A;  2KFK B;  1RRP B;  3ENE A;  3CST A;  2N1V A;  2K8C A;  4B9K A;  2Z0D B;  4FJY A;  4DX9 0;  4MSQ B;  1P98 A;  3V6E B;  2CY4 A;  2W2W A;  4HPM B;  4HVB A;  2FUH B;  3ML8 A;  4I6L B;  4TQ1 A;  2K2J A;  4CHJ A;  4CHM A;  3GZN I;  4NAW A;  2HTH A;  5HE0 A;  2DYM A;  2CR5 A;  2V1Y A;  3NY5 A;  3JSV A;  2KTR B;  3X23 A;  3H9D A;  2EMT A;  3QCA A;  1WGY A;  4AJY B;  3APD A;  3PRE A;  1FB8 A;  1OTR B;  5HE3 A;  5FI0 A;  4MJS A;  1WVH A;  3P2B A;  4GB9 A;  3RCP A;  5C23 A;  4DBB A;  1Z87 A;  4MGK E;  2KN5 A;  5AEK B;  5FR6 A;  3X0W A;  4WJP A;  1BTN A;  2FJ9 A;  3M1I B;  2IY1 B;  3VXW A;  3W1S C;  2KGX B;  3LJ3 A;  2L2I A;  3VH3 B;  1WRD B;  3PHW B;  3R66 C;  2BKF A;  2MFQ A;  3SNH A;  2KAN A;  2DHZ A;  4K2P A;  1V81 A;  2GBJ A;  1IPG A;  3HHM A;  4EMO A;  3KY9 A;  2DX5 A;  5C16 A;  3AXC A;  3K9P B;  4PYU A;  2JT4 B;  2O2V A;  1WM2 A;  4E3C A;  2YVC A;  1TBE A;  2K8B A;  1WMH B;  2DZK A;  4F7Z A;  1PMS A;  3PRP B;  4HDQ A;  1X05 A;  1VCB A;  4F1S A;  2NMB A;  1V6E A;  2ELA A;  3QBV B;  2MLB A;  1WF9 A;  1WY8 A;  2DZJ A;  4XC2 A;  2JXX A;  4KDL B;  3JW0 X;  1GUA B;  1DBH A;  2WX0 A;  4BFR A;  4F7G A;  3NS8 A;  3PTF C;  4FUL A;  5C1Z A;  3M62 B;  2M38 A;  1U5E A;  2R2Q A;  3GYP A;  4JQW C;  2W9N A;  2L05 A;  2BF8 B;  3TW1 A;  4C0A A;  3P7Z A;  2CQU A;  3PVW A;  5C5B A;  1X11 A;  3SV1 A;  3HM3 A;  2NBV B;  1E90 A;  1WJ4 A;  2D3G A;  1K5D B;  2C7M B;  4IOY X;  4D0N B;  4G11 A;  3M63 B;  4E71 A;  2ZCB A;  4H8S A;  1RJ2 A;  2COA A;  4OVV A;  2VRW B;  4Z2N A;  1LXD A;  5J3Q A;  3L17 A;  1J0W A;  3MTN B;  2DAF A;  3SYX A;  3DVN V;  3VTW A;  3ZNG C;  3KVF B;  2CS4 A;  2AWT A;  1D3Z A;  2AYO B;  2NBU A;  1MG8 A;  1EF5 A;  3ALB A;  3AJ4 A;  5J18 A;  3IBE A;  1WGR A;  2DX1 A;  2LVQ A;  4NPN A;  2MBE A;  2ROV A;  3HW2 B;  4XX5 A;  4HK2 A;  3TL5 A;  4ANV A;  5LXI B;  4MGY E;  2J59 M;  1XR0 B;  2RUK B;  1RFA A;  3TCA A;  1S3S G;  2EC1 A;  3IHP C;  3CMM B;  1K5G B;  1UBI A;  2KFJ A;  2D10 A;  3QJZ A;  4GN1 A;  3IG3 A;  1YIW A;  1GNU A;  5LXH A;  4OVU A;  1OQY A;  4HXD A;  2L0T A;  1NTV A;  4EZJ A;  4IW0 A;  1BTK A;  2LRU A;  3EPY A;  1NBF C;  2D2Q A;  3A9J A;  1ZM0 A;  3RUL A;  3H7P A;  3BIN A;  2ZCC A;  1ST7 A;  3VOQ A;  2I1K A;  2N23 A;  3L54 A;  5HKH A;  1ZVR A;  2QKM A;  2DHI A;  3D8F A;  5D6J B;  3ML4 A;  3RZF A;  2MBO A;  4PQ0 A;  1U5F A;  3L0W B;  2JF5 A;  2DTC A;  2YT0 A;  3DVG X;  4EZK A;  3MJW A;  3ZNZ B;  4PS3 A;  2L8J A;  2COP A;  1WXM A;  5JLJ B;  3HIZ A;  1E7U A;  2C9W B;  2XEW A;  5D3V A;  1OY2 A;  2JPH A;  3VUY A;  4JLC A;  2D9V A;  3RYT A;  1WJU A;  1ZW7 A;  3ODO A;  2KFK A;  1Z2M A;  4G0N B;  2DYQ A;  2DKP A;  1WJM A;  4A3P A;  5CHF A;  2MBB B;  3QIJ A;  1TJ6 A;  3ZVV A;  5IA7 A;  2ELB A;  2YSZ A;  2BGF A;  1MIX A;  1DYN A;  5JHG A;  2P0H A;  2G3Q B;  2UVM A;  3QAR A;  2MA9 B;  2DN6 A;  1KLV A;  2DEN B;  1LM8 B;  1DDW A;  1KM7 A;  2ZPN A;  3L08 A;  1HB6 A;  1M7E A;  4HAW B;  3DBL I;  1V89 A;  2LAS A;  3L13 A;  1I2H A;  1UNP A;  2KTR A;  2M17 A;  2KUP A;  1J8C A;  3ONS A;  4FBJ B;  3WA0 A;  2OTX A;  1OEY A;  1UH6 A;  1MK7 B;  1OQN A;  2YT1 A;  4W9J A;  5AZG A;  3VTV A;  2LGD A;  3H6N A;  2VSZ A;  1UD7 A;  1V5O A;  2L76 A;  2NR2 A;  1V2Y A;  3PVL A;  2KD0 A;  1H10 A;  2JWZ A;  1Y19 B;  2J0M A;  1X1G A;  2L3Z A;  2G35 A;  3N3K B;  4EFO A;  5KQ4 A;  3SHQ A;  5JHH A;  4J6I A;  2I5F A;  2FCS A;  2BWE S;  2K25 A;  5D2M B;  1FXT B;  3B1L X;  1FAO A;  2N9X A;  1TXD A;  2NBW B;  1ISN A;  1WMH A;  3UIN B;  2Z0E B;  4W9C A;  4W9E A;  2FDQ A;  1MPH A;  2KDB A;  1XD4 A;  4GPT B;  3V60 A;  2I1J A;  4ZYN A;  3D32 A;  3U30 A;  4IAP A;  2LVO A;  2WYQ A;  2GBN A;  4WJQ A;  3SUZ A;  4ANX A;  4WWP A;  3F5R A;  3D8D A;  1KI1 B;  2WWZ A;  4II2 B;  3CXB B;  4NSW A;  3EFU A;  4TYZ A;  3WAL A;  2GBM A;  2CHX A;  4IM0 A;  3VAW A;  5IJM A;  4B6W A;  2D11 A;  4DHZ B;  3VTU A;  4PYZ A;  3MDB C;  2RR9 A;  4A5K A;  4HCP B;  2M14 A;  1FGZ A;  2OJR A;  3PV1 A;  2LUE A;  5JHA A;  4NNJ B;  2ABD A;  2KX3 A;  5D3W A;  3QK0 A;  5EDS A;  3V62 A;  4KHO A;  4BKS D;  1PLS A;  1GJZ A;  1P0R A;  4AP4 C;  2DFK A;  3W1S A;  2NCN A;  3VUW A;  5DI9 B;  3VIA A;  3S2A A;  2KMC A;  4HCN B;  1WJ1 A;  4K2O A;  1MK9 B;  3TO1 A;  3WIM A;  5HE2 A;  3DVG Y;  4GU2 A;  3UGB B;  2FJL A;  3I3T B;  1SIF A;  3DCG A;  3ZDM C;  2A4Z A;  3VUX A;  5E6P A;  2KQ7 A;  3HQC A;  5C79 A;  1WZ3 A;  2GOW A;  3O96 A;  3OAW A;  2LUL A;  2HRJ A;  3PSE B;  2M0X A;  1YD8 U;  5J2R A;  2RSG A;  2FID A;  2AL3 A;  1IRS A;  2JRI B;  4TUU A;  1SHC A;  4IWQ A;  2JY6 A;  3OLM D;  1V80 A;  3QAQ A;  1WG7 A;  2COC A;  1Y8R C;  1Q0W B;  2D9Y A;  1MIZ B;  1V5T A;  1V88 A;  4YL8 A;  5L83 A;  5J3T A;  2MWS B;  3TBL D;  3PSC A;  4HB3 B;  4ZRI A;  1WYW B;  3FSS A;  1RRB A;  1J0G A;  3KZ1 A;  3LJU X;  2DLW A;  1Q67 A;  3NZS A;  4IWO A;  4HB0 B;  2K39 A;  2LRW A;  5JH5 C;  4FLH A;  2R2O A;  2V4L A;  4IWP A;  3PEG A;  1WE7 A;  2ASQ A;  4NQL B;  4I6N B;  2WDT B;  1E5W A;  3TIX A;  1IYF A;  4M8M A;  3GOE A;  4DDG D;  2KNB A;  1X1F A;  1UPR A;  3B0A A;  4DHZ E;  2ZPY A;  4FHJ A;  4WSF A;  3KRX A;  1H4R A;  4K81 A;  4MGZ E;  3WAM A;  3KUD B;  4WVF B;  3VVW B;  2H7D A;  4NQK E;  4GOC A;  4RMA A;  1F9J A;  3R7Q A;  2PZ1 A;  2UZR A;  2V76 A;  1WE6 A;  4KZC A;  5GOW B;  5CX3 A;  2UZS A;  2IFS A;  2FNJ B;  3GYO A;  5DHA B;  3DBR I;  1NTI A;  3ULB A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  2MX2 A;  2HJ1 A;  5HI1 A;  1J7C A;  3VR9 B;  2G4S A;  4OZB A;  5D94 A;  4L6E A;  3FAH A;  4USA A;  2N7E A;  2CJO A;  2ZJD A;  5BMG A;  2LD9 A;  2C7H A;  3PGE A;  2M4N A;  2X38 A;  3PPA A;  4HB4 B;  2PE9 A;  5H92 C;  1QQG A;  3CSF A;  1UNR A;  3DXD A;  3Q3J A;  1V61 A;  4IM3 A;  1E0Z A;  3A1Q B;  1LQB A;  4A6F B;  4DBG A;  5D3D A;  1WGK A;  4DXG A;  1HB8 A;  3NWA A;  3KYC D;  2DZI A;  5GMV A;  2RQ1 A;  2UWQ A;  1TQZ A;  4KVG B;  1FNU A;  1L7Y A;  3QC8 B;  4FA6 A;  4GMX B;  2RDH A;  1GG3 A;  5L81 A;  2DHK A;  3OJ4 B;  2CB8 A;  5E6O A;  1YN4 A;  2KCJ A;  2K0P A;  2R09 A;  2XN9 C;  1ZXH A;  4DHJ B;  3B08 A;  4ZRK A;  4KIK A;  4FJV B;  2IO1 B;  2QCZ A;  2Y5C A;  1U27 A;  2SEB D;  4K1R B;  1JWB D;  2CU1 A;  2NS5 A;  4A6Q A;  1M7R A;  5IKC M;  4A6K A;  2P0D A;  5DH9 B;  4JK8 A;  3CIK A;  2C7N B;  1PFJ A;  5IAA C;  1HBK A;  3T3O A;  2QHO A;  3O13 A;  2KHW B;  2QJL A;  2G45 B;  4PS7 A;  1K53 A;  4A90 A;  1HEZ E;  2ROZ B;  2HJ8 A;  3UIP B;  4LJO B;  4K17 A;  4YSX B;  1HXY D;  4CHK A;  2J0K A;  4M01 A;  2JZZ A;  2IYB A;  4DHJ D;  5D7G A;  2NPT B;  1T5X D;  5AZF A;  3T8M A;  1OMW A;  2BPS A;  4XE0 A;  1HA5 A;  3LDZ E;  2XK5 B;  1TS4 A;  1N63 A;  4KZ0 A;  3I57 A;  2D9X A;  4W9H A;  3RN9 C;  5G5H A;  2J7Q B;  2KAC A;  3OWE B;  4ZRJ A;  4WIP A;  2D4Q A;  5D27 A;  4DXA B;  2BT6 A;  1U2B A;  2ZW0 A;  3I5J C;  2OED A;  2KIG A;  2DBY A;  3IVF A;  1KZG A;  2I5C A;  4BKG A;  1J7B A;  1N5W A;  1WGQ A;  4RM8 A;  3QWZ B;  3RCZ A;  1YNT E;  1VLB A;  1VBH A;  3B77 A;  4BOZ B;  3QWM A;  3A9K A;  4BVU C;  1LB1 A;  3MHZ A;  2JRH A;  4US8 A;  2N1W A;  3PO0 A;  2COF A;  1WGD A;  2UU7 A;  2KXJ A;  5KCV A;  4YTP B;  1JRP A;  1OEY J;  2X0S A;  2YS3 A;  4FN2 A;  3NVV A;  1ET6 A;  1P7E A;  1MI1 A;  4X57 B;  2REX A;  2NZ8 B;  4W9G A;  1SXT A;  1XLP A;  1VRA B;  1FO4 A;  4DXF A;  3SO6 A;  1FNW A;  4MEL A;  1KBL A;  1EVH A;  5JVL A;  2FAZ A;  4XZ4 A;  2DLB A;  3D8E A;  5BMH A;  4PK1 A;  2KJH B;  3Q3N C;  2GMI C;  2XBB C;  2W55 A;  1T0Q C;  5LON B;  4KSL C;  2R2Y A;  2LVP A;  2QEJ C;  2LBB A;  3ZO5 B;  2LGX A;  4A55 A;  4ZRQ A;  5BO4 B;  2Z0O A;  4JKC A;  4QJ5 B;  3AU4 A;  2X8X X;  4IG7 B;  3P42 A;  1FPY A;  1KJT A;  2KZR A;  2YLM A;  4BBK A;  3PVU A;  3V5W A;  1TKG A;  2LKO A;  3AEB B;  2Y8G A;  1PQS A;  4M0W B;  3WAO A;  1GC7 A;  4ZHP A;  1WSP A;  4WAA A;  1UGJ A;  2RNR B;  1L2N A;  1ESF A;  3W5V B;  3AU5 A;  3U8Z A;  3Q3F A;  3V05 A;  3FM8 C;  4K7S A;  2AQ1 B;  4K3B A;  2DYO A;  4NJ7 A;  4W9L A;  2CKH B;  1WFY A;  3KQ4 A;  2INN E;  4P7I A;  4ZDV A;  4HSI A;  4Q2J A;  1UEF A;  1ZC4 B;  4GZU A;  5FK9 C;  5TR5 A;  4JGH B;  2JUO A;  5BMI A;  3NS1 A;  1PGB A;  3AUL A;  4WUR A;  4EKU A;  3H8H A;  1I4G A;  4PNK A;  2LWP A;  2QC8 A;  3IT6 B;  2K00 A;  3NZU A;  3WAN A;  1JCK B;  1NTY A;  1JAL A;  4NJ6 A;  2KDE B;  3AH7 A;  3PP2 A;  2QDF A;  2BQQ A;  2ON8 A;  4YTN B;  3FIL B;  3SD5 A;  2BS3 B;  2K8H A;  4ICU A;  2KOX A;  4HKZ E;  1UBQ A;  1C9F A;  1XLO A;  2CY5 A;  2N7D A;  5CHW A;  3ZJT A;  3VHT C;  1HTO A;  1VZ7 A;  4NAM A;  4EJN A;  1B55 A;  2FJU B;  1V9J A;  2DWQ A;  4W9D A;  3SU8 X;  3HIE A;  5J17 A;  1SIJ A;  3ZTC A;  1FCL A;  1WJ6 A;  2LJ5 A;  4HAZ B;  2XQN M;  3O65 B;  4TV3 A;  3K9O B;  1YX6 B;  2Z8L A;  3PS6 A;  1N5X A;  1TY0 A;  2WQY B;  3EEC A;  2AQ3 B;  4KHA A;  4JPS A;  3ZNI D;  3NW8 A;  2DHJ A;  3C8Y A;  3RD2 A;  1R4N B;  1PDX A;  3P63 A;  2P8V A;  3VFK A;  4DWF A;  2BVC A;  2KWC A;  4HJK A;  1F77 A;  1R4M I;  4IUM B;  5LLI A;  3AED B;  3Q3M C;  2ZNV C;  1WXA A;  2RGF A;  1NDD A;  4GXB A;  3UQA A;  1U5D A;  1VZ8 A;  4PS8 A;  3N20 C;  3ETR A;  2FCM A;  3CWI A;  1RWS A;  2BYF A;  2UYZ B;  3L4P A;  2DIK A;  4WAF A;  4N6E B;  4JKH A;  2LXA A;  2OJW A;  2IZV B;  3M3J A;  3AEA B;  1DGJ A;  1VDV A;  2R0D A;  4IC7 B;  2KK8 A;  4CO7 A;  1ACA A;  4KV2 A;  1UZX B;  3GB1 A;  3ODW A;  2KLG A;  1Z5S B;  4ICV A;  4LDT B;  1V8C A;  4W9F A;  4RFB A;  4A3O A;  3DOW A;  1XT9 B;  1NI3 A;  2PKO A;  1J7A A;  2INP E;  4HRO A;  5E6N A;  4HAY B;  1GOZ A;  4HAV B;  3OJ3 A;  2LG1 A;  1WXQ A;  4F7H A;  3FLV A;  4C80 A;  1DRO A;  3DVN U;  3U2S C;  3A9J B;  2BTE A;  2YS1 A;  4WJO A;  5CHV C;  1YX5 B;  3FP5 A;  3H7P B;  1E10 A;  1E8X A;  1XLN A;  5M4Y B;  4MK0 A;  4LDT D;  1BWN A;  1WI0 A;  4A6F A;  1MJD A;  4CYE A;  4KSK C;  4ANW A;  1WX7 A;  2L83 A;  4B0E A;  2MJ3 A;  2M1M A;  1A70 A;  2FUG 1;  2P0F A;  1FHO A;  1TS2 A;  3HM6 X;  2DZM A;  2Q5W D;  1V1P B;  3ZRF A;  3KLS X;  2E2X A;  4ANU A;  2OQB A;  2H7E A;  2KDF B;  1KTK A;  4FHK A;  4P1C C;  1P5T A;  4TSS A;  2ZNV B;  3ZLZ A;  1MPE A;  2L00 B;  4JKG B;  4HHV A;  2C5L C;  3TJP A;  1KLG D;  2PEA A;  4BKT A;  3P4Q B;  1T3Q A;  4WJ7 A;  3C0R B;  3DPD A;  1K51 A;  2WXF A;  4XWW A;  1WGG A;  2B3A A;  3JVZ X;  5E6J A;  3RNA C;  1BT0 A;  1XQQ A;  1CQV A;  1V49 A;  3CF6 E;  2PE6 B;  2J0J A;  2C60 A;  1WX8 A;  1EU3 A;  1L4D B;  4CQN A;  1W1H A;  1MAI A;  3RZW C;  3AEC B;  1XCG A;  2W2X C;  3VQI A;  1V5P A;  3EFC A;  3GP7 A;  1R7S A;  3OG5 A;  3BVG A;  2RVB B;  3A98 B;  2K8E A;  3A4R A;  2EKI A;  5KQ1 A;  2K3U A;  2NPT A;  2DYB A;  3KSY A;  5IN7 A;  2W3R A;  2PVO D;  3SFE B;  2XK5 A;  5AUK A;  4F7U P;  3ODX A;  1SGH A;  3ULC A;  2AL6 A;  4W9I A;  1ENF A;  2KX0 A;  2JX5 A;  4LNN A;  4YSY B;  1P6S A;  4YXD B;  4AOF A;  4A9A A;  4MH0 E;  1WJN A;  3ZUN A;  3FEH A;  1XCT L;  5L95 C;  3GZN B;  3QX1 A;  3NSU A;  2K49 A;  4GDL B;  1QKZ A;  1PGX A;  2NMQ A;  3MC8 A;  4LNF A;  1ZSQ A;  1CK1 A;  4AQ7 A;  3HVD A;  4MSM B;  3PZD A;  2RGN B;  2GCJ A;  2VZK B;  2EKE C;  2JZ3 B;  3KUZ A;  3ZJV A;  4G50 A;  5FKA C;  1NU2 A;  2GB1 A;  2WDR B;  2BB5 A;  3M95 A;  1DIK A;  1UWM A;  4HAX B;  1H8C A;  3ZRC A;  4B6H A;  2IO3 B;  3NVW A;  3EC8 A;  3ML9 A;  2ZW1 A;  3MC0 B;  4RM9 A;  3A8P A;  1XF5 L;  4DK5 A;  5D3I B;  1U5G A;  2EJ8 A;  3G9W A;  2K6D B;  3IT4 B;  2Y8F A;  2XNA C;  2O6V B;  4K3C A;  2VH2 A;  4HAU B;  2DAJ A;  1FFV A;  1RFK A;  2Y3A A;  4NJC A;  2MWN B;  2RRF A;  3QHT A;  4A6H A;  2VZK D;  2MW5 A;  4Z2M B;  2KWD A;  2JU6 X;  3ZNH B;  4MY6 A;  4MM3 B;  4OT1 A;  4AJW A;  4BZA A;  2V0G A;  3PLV A;  1YJ1 A;  1WR6 E;  3W9C B;  4I6P A;  1V5M A;  4GDK B;  1NI2 A;  1G6J A;  3BY4 B;  2FIF A;  2IO2 B;  1L0Y B;  2N9K A;  3FC4 A;  5DPS A;  2BS2 B;  3RI7 C;  1UNQ A;  2A5U A;  1J19 A;  2K5P A;  2E3T A;  2O6V D;  1NEN B;  4KX6 B;  4WQM A;  3DBH I;  1EGX A;  1JRU A;  3PZ8 A;  4EEW A;  1GB1 A;  4JKD A;  3U7D A;  1N6Z A;  4HKQ A;  5DIF B;  2QSD A;  4HDO A;  4M0W A;  5EFX A;  1D4B A;  3RUI B;  2LJI A;  4IDI A;  4QJ4 B;  2W2X D;  3APC A;  2KLC A;  3W1Y A;  3AI5 A;  1V86 A;  2IY0 B;  1CMX B;  1QIL A;  3NWD A;  5DCN A;  3URY A;  4XYC A;  2OOB B;  2MKR A;  5JZE B;  4B95 A;  1JW9 D;  1DYQ A;  1WXS A;  1L6U A;  4A20 A;  3DQV A;  5C6R A;  2KWV B;  3IFW B;  4JIO U;  1X86 A;  3KYD D;  3NOB A;  1UWX A;  1XX0 A;  3F0W A;  3A8Q A;  2WXP A;  3J9C A;  1K50 A;  3N9Y C;  2RSU A;  1FFU A;  1TIF A;  2CAY A;  1S1Q B;  2IBI B;  3PG7 A;  4JKB A;  2J53 A;  5EE9 A;  4L1B A;  1TTN A;  2KC2 A;  3BVZ A;  2KMA A;  5CLL B;  1I35 A;  5IOI A;  1FHW A;  3OAN A;  3ZW3 A;  3ABV B;  2LEK A;  3FIL A;  1V5U A;  2FCN A;  2GS0 A;  4LK0 M;  2N9L A;  2KIE A;  1AAR A;  3Q8F A;  1WZ0 A;  1AW7 A;  4HAT B;  1TZO A;  1ZKH A;  2WXN A;  2EMS A;  2WP9 B;  5CTR C;  3UI3 A;  1C79 A;  4HB2 B;  4FJZ A;  1IGD A;  2LZ6 A;  1QOG A;  5JP4 A;  1C1Y B;  3PZ7 A;  3I63 C;  2MP2 B;  3P4S B;  3EHV A;  2VKI A;  1UEL A;  2L0F A;  1HE8 A;  4FAD A;  2D9Z A;  2ZZP B;  3DXE A;  5DHF B;  2KVZ A;  3P4P B;  4W9K A;  3NJT A;  1VJK A;  1LFD A;  3N32 A;  4S17 A;  5KHQ A;  2JVC A;  1UNS A;  4ASW C;  2CRF A;  1P3R A;  4WJN A;  1YJI A;  1T0Y A;  1Q1O A;  2Z13 A;  2KQS A;  1ZUD 2;  4JKF A;  1I7A A;  4GSW A;  2GJY A;  3TMP B;  2Y5B B;  4EUT A;  2KWU B;  1P9D U;  1WXV A;  1FOE A;  1E8Y A;  3H1U A;  2J42 A;  3FKY A;  2N0Y A;  4NAW B;  2HTH B;  2RLO A;  4JL9 A;  2AX5 A;  3PLU A;  1ZGU B;  4LJP B;  3C19 A;  2MBH A;  3ZIM A;  3JSV B;  5D3Y A;  3KW5 B;  2RDB C;  2KTF A;  1YN5 A;  1YQB A;  1RLF A;  1M94 A;  4BKS A;  2LGS A;  5IO9 A;  3E9P A;  1BAK A;  1SJH D;  2N4F A;  5G55 A;  1MI0 A;  2L7R A;  4KHB B;  2D3A A;  1TJE A;  1RAX A;  3APF A;  1FHX A;  1C77 A;  2RD0 A;  3DXC A;  4MJS B;  2MRP A;  2KKC A;  2NTS A;  1YQ4 B;  4WWN A;  3Q8A A;  3TUO A;  4OZA A;  2GRI A;  4BOS C;  4C7Y A;  1GGO A;  4F8C B;  3VH4 B;  4HLE A;  2V3S A;  3IAS 1;  4M00 A;  1F2R C;  5AZH A;  1ZDX A;  1QC6 A;  2MDX A;  1FRR A;  1X1M A;  2KO3 A;  4L2Y A;  2COD A;  1WGH A;  1EAZ A;  1DDM A;  3ZTD A;  1P1A A;  1RM6 C;  5JHB A;  1IP9 A;  1YN3 A;  2V3N A;  4BBN C;  4K7U A;  2JZP A;  3HK0 A;  1NVL A;  1BXT A;  4E74 A;  3UIO B;  3Q3O C;  1U4A A;  1YQ3 B;  2TSS A;  3KUC B;  1EF1 A;  3PT2 B;  1V1P A;  5FI1 A;  3N30 A;  2YEP F;  2Z59 B;  1WGU A;  3RNF C;  2N9E B;  3BJI A;  5DPT A;  2RDG A;  2Z14 A;  1KLU D;  4OW0 A;  4JK7 A;  1E6E B;  1DDV A;  2DX5 B;  1EUV B;  4MDK E;  4P16 A;  5C2T B;  3VDZ A;  4JKG A;  2O2V B;  3RT3 B;  2V4I B;  4RGO S;  3KH0 A;  2ADZ A;  1VR9 A;  3QQ8 B;  1T0S C;  3R7R A;  4M8N A;  4Y94 A;  1FNV A;  3TVV A;  5HG2 A;  5KHO A;  4OZC A;  4IM2 A;  1OFF A;  3MHS D;  2X18 A;  4GMV A;  1SE9 A;  2VRR B;  1OQR A;  1XOD A;  2YEP B;  2D07 B;  2MBQ A;  2K6Q A;  4UDU C;  2BWF A;  1D5X C;  5LOP B;  4GGQ A;  1I4Q A;  3NZ3 A;  3RNC C;  1VD2 A;  3N7C A;  2KJR A;  2MQJ A;  1B9R A;  2L1C A;  2EEL A;  2KJ6 A;  3BVM A;  2KC1 A;  2IGG A;  1YOV B;  4DIX A;  2ONQ A;  1QZE A;  4C7Z A;  2PPH A;  2RPQ A;  2WDQ B;  4BBN F;  4WQO B;  2LXC A;  4C4V B;  1SE4 A;  3UF8 A;  4QJ3 B;  1A5R A;  2FE8 A;  3N1Y C;  5G5G A;  4GIV A;  1JRO A;  3ZJU A;  2RPV A;  3SDL C;  2LHD A;  4URK A;  4L23 A;  1QT9 A;  4DDI D;  2DYN A;  5D3X A;  1WH3 A;  4TKN A;  3Q14 C;  3NHE B;  1WI1 A;  2Z0Q A;  4ZHO A;  2HE7 A;  3ECI A;  2YF0 A;  5C5B B;  3TFM A;  1OQQ A;  2DA0 A;  2LI5 A;  2WX1 A;  1EM7 A;  2K1F A;  3MPX A;  4R3D A;  4GDL A;  3T9L A;  1FGY A;  3DBL B;  2D9W A;  2K2U A;  1F2R I;  2CHW A;  3JYU A;  3AE6 B;  2Q13 A;  4RF0 A;  4NY0 A;  1Q5W B;  1ET9 A;  1JWS D;  3HVZ A;  4L1R A;  1GC6 A;  3SBG A;  1I42 A;  2H89 B;  3L10 B;  1XD3 B;  2GCL A;  1OGW A;  3ZDT A;  1XXG A;  2YRY A;  1ZPS A;  3PRZ A;  2JP2 A;  4MGI E;  4IFS A;  2M8S A;  1FRD A;  3U52 E;  2DKQ A;  2WXJ A;  2LYD A;  3T3N A;  3ZVR A;  4C00 A;  1C3T A;  2D3B A;  2WXO A;  3UQB A;  2O6V A;  3QA8 A;  4RGN A;  2WDV B;  4KIK B;  2FCQ A;  5BYQ A;  1QOA A;  3KWV A;  1R4N I;  3DBS A;  3T06 A;  2NTT A;  3A4S C;  3R8B A;  3P1M A;  4LCD E;  1ZC3 B;  1LW3 A;  3VR8 B;  3H7S A;  4AWJ A;  4MM3 A;  1M4V A;  4YON A;  3WAP A;  1W1G A;  4HWI B;  2KDI A;  1TGZ B;  4XWX A;  3AE5 B;  2HD5 B;  2KT7 A;  4GDK A;  1SF0 A;  1SB3 C;  3ZKJ C;  2BW2 A;  3KRW A;  5DPR A;  4TQ0 A;  2ZVN A;  4KAX B;  1ROE A;  1I7H A;  3DDC B;  4EZL A;  1WIA A;  2LOZ A;  3A33 B;  1E7V A;  2D5G A;  2ZVO A;  4O1N A;  1UPQ A;  4LNO A;  4G3X B;  3W2D A;  3V6C B;  2IGH A;  4DX8 A;  2ZEQ A;  1N3H A;  2BYE A;  4ITK A;  4PT5 A;  3R3M A;  2YT2 A;  1U29 A;  2AEH A;  2Z0P A;  4LNI A;  2GBR A;  2N9P C;  2WH5 A;  1KZ7 A;  2MSE D;  2W82 A;  2KMM A;  3UZT A;  4A8X C;  2H88 B;  2N7J A;  1NYQ A;  2KVR A;  5J3Y A;  1MKE A;  4ZYS A;  3P6A A;  3KWL A;  5HHD G;  2RMM A;  1TZ1 A;  5HE1 A;  1WRI A;  4K7W A;  1WR1 A;  4HPL B;  3L16 A;  4TMA B;  3I9V 1;  1WM3 A;  5EE3 A;  2LOX A;  2MJE A;  5DPW A;  4S0R A;  2MCN B;  2Y7B A;  3A9K B;  5AUI A;  2NVU I;  1UGM A;  4ZRP A;  2J4X A;  1XKE A;  3A1Q A;  1WX9 A;  2ACZ B;  4N9F 4;  3AE4 B;  1AWE A;  1Y5O A;  2KYW A;  4II3 B;  1E8Z A;  3SR6 A;  4EOY A;  2WLB A;  3PHX B;  1I4H A;  3BII D;  4HJG E;  2CHZ A;  3PRM B;  1W1D A;  4WWO A;  1GAQ B;  2BKR B;  4XDD A;  1E8W A;  5G2N A;  4EE2 A;  2IO0 B;  2BYV E;  5CLQ B;  4MH8 A;  2GBK A;  2BCJ A;  4XDC A;  2YS5 A;  1JDE A;  1HZ5 A;  4AUQ C;  2G4D B;  1AQC A;  3V61 A;  2IYD B;  3SFD B;  1KOT A;  4MT7 A;  1IUE A;  3AEE B;  1EO6 A;  2QKL A;  2LGY A;  3RNG C;  2MP2 A;  3HUI A;  3U12 A;  1P3Q U;  4KDI C;  3Q2A C;  2PJH A;  3WYF B;  1K8R B;  1SJE D;  1QF6 A;  4MEM A;  3AV8 A;  2KFK B;  1RRP B;  3Q69 A;  1C4A A;  3ENE A;  2JWU A;  4XGA B;  1MVK A;  3CST A;  2J52 A;  3LXF A;  2N1V A;  2K8C A;  4B9K A;  2Z0D B;  4FJY A;  4DX9 0;  2HTM E;  4BAX A;  3DWG C;  4MSQ B;  1P98 A;  1F0Z A;  1QOB A;  3V6E B;  2CY4 A;  2AQ2 B;  2W2W A;  4HPM B;  4HVB A;  2FUH B;  2PTL A;  3ML8 A;  3BK2 A;  4YT0 B;  4I6L B;  4TQ1 A;  2K2J A;  4CHJ A;  4CHM A;  3GZN I;  4NAW A;  2HTH A;  5HE0 A;  2DYM A;  3MJ5 A;  2CR5 A;  2V1Y A;  3NY5 A;  3JSV A;  1JQ4 A;  2KTR B;  4QAY A;  1PUT A;  3X23 A;  2QIL A;  2Y5P A;  3H9D A;  2EMT A;  3QCA A;  1WGY A;  2WXK A;  1ZDV A;  4AJY B;  4KHB A;  3APD A;  3PRE A;  2LHE A;  1FB8 A;  1OTR B;  5HE3 A;  3AE2 B;  1C78 A;  2G9H D;  5FI0 A;  5I2S A;  4FXC A;  4MJS A;  2L52 A;  3N1X C;  1WVH A;  3P2B A;  4JWU C;  4GB9 A;  1V1O A;  2KQ4 X;  3RCP A;  5C23 A;  4DBB A;  1Z87 A;  4MGK E;  3DHI C;  1KF6 B;  2WXL A;  2KN5 A;  2KN4 A;  5AEK B;  1QQR A;  5FR6 A;  3X0W A;  3ZGZ A;  4WJP A;  1T77 A;  1BTN A;  3AE8 B;  2FJ9 A;  3M1I B;  2IY1 B;  3VXW A;  4ARI A;  3W1S C;  2KGX B;  2GLS A;  2L2I A;  3B2G A;  3LJ3 A;  3VH3 B;  1WRD B;  3PHW B;  3R66 C;  3ZXV A;  2BKF A;  3CIR B;  3HSA A;  2MFQ A;  3SNH A;  1T0R C;  2DHZ A;  2KAN A;  3RNE C;  4K2P A;  3NRZ A;  1V81 A;  3GS2 A;  2GBJ A;  1IPG A;  3HHM A;  4EMO A;  2WXH A;  3KY9 A;  1PYW D;  5IP4 D;  2DX5 A;  2M19 A;  5C16 A;  4KGT A;  3AXC A;  3K9P B;  4PYU A;  3IAM 1;  4KGR A;  2JT4 B;  2O2V A;  1E7P B;  1WM2 A;  2LMC A;  2WXG A;  4GLS C;  4E3C A;  2WGS A;  2YVC A;  2CJN A;  1TBE A;  2K8B A;  3EA6 A;  1WMH B;  2DZK A;  4GNK B;  4C56 C;  1PMS A;  3PRP B;  4F7Z A;  2ZKM X;  4HDQ A;  1X05 A;  1VCB A;  3AM9 A;  4F1S A;  2NMB A;  1V6E A;  4IKG A;  1TS5 A;  1N61 A;  2WXI A;  1F52 A;  4RGM A;  2ELA A;  3QBV B;  1VZ6 A;  2MLB A;  3HRD D;  4KKJ A;  3ENB A;  1WF9 A;  2GUM A;  1WY8 A;  2DZJ A;  4XC2 A;  2JXX A;  4KDL B;  3JW0 X;  1GUA B;  1DBH A;  2WX0 A;  3WCQ A;  4BFR A;  4F7G A;  2W54 A;  3NS8 A;  3PTF C;  4FUL A;  5C1Z A;  3M62 B;  2M38 A;  1U5E A;  2R2Q A;  4CSQ A;  4C4V A;  5BYS A;  3GYP A;  4JQW C;  3BYY B;  2W9N A;  5EE1 A;  2L05 A;  2BF8 B;  3TW1 A;  4C0A A;  3P7Z A;  2CQU A;  3PVW A;  5C5B A;  1Y56 A;  1X11 A;  3SV1 A;  3HM3 A;  1STE A;  2NBV B;  1E90 A;  4OVZ A;  1WJ4 A;  2D3G A;  1K5D B;  2C7M B;  4IOY X;  3E9S A;  1UF0 A;  4D0N B;  4G11 A;  2WXQ A;  3M63 B;  1FMA D;  4KGS A;  4E71 A;  2ZCB A;  4H8S A;  4LNK A;  5I4D A;  1C4P A;  1RJ2 A;  2D3C A;  2COA A;  1XEE A;  4D2K A;  1ACC A;  4OVV A;  2VRW B;  4Z2N A;  1LXD A;  4HEA 1;  1L4Z B;  4ARC A;  5J3Q A;  3L17 A;  1J0W A;  3IXS A;  3MTN B;  1ZXI A;  2DAF A;  2KDM A;  1PGA A;  1L5P A;  3SYX A;  3DVN V;  3VTW A;  3ZNG C;  3KVF B;  2CS4 A;  2AWT A;  4RH6 A;  2AYO B;  1D3Z A;  5LNK 1;  1SE3 A;  1SBB B;  2NBU A;  1MG8 A;  1EF5 A;  3ALB A;  3AJ4 A;  2MHJ A;  2JXT A;  4RNA A;  5J18 A;  3IBE A;  5I2M A;  1WGR A;  2DX1 A;  2VH1 A;  2LVQ A;  4NPN A;  1JWM D;  1TKY A;  2MBE A;  2ROV A;  3HW2 B;  2KR0 A;  1WWT A;  4XX5 A;  4HK2 A;  3TL5 A;  5H8Y E;  2JYT A;  4ANV A;  5LXI B;  3SBT A;  3E9O A;  5EE0 A;  1CJE A;  1P7F A;  4MGY E;  2J59 M;  1XR0 B;  2R61 A;  4P1B C;  1KFY B;  2SAK A;  2QMT A;  2RUK B;  1XO3 A;  4JE3 B;  3AN1 A;  1HTQ A;  1NYR A;  2PMV A;  1RFA A;  1FD6 A;  3TCA A;  4RF1 A;  2LGI A;  1B1Z A;  1S3S G;  3DHG C;  2EC1 A;  3SEB A;  3IHP C;  2M0A A;  3CMM B;  1K5G B;  3AE7 B;  1T6B X;  1UBI A;  1TY2 A;  2KFJ A;  4P6V F;  3TEW A;  1ZYI A;  2D10 A;  3QJZ A;  1I4R A;  3ZQ4 A;  4GN1 A;  4N58 A;  3IG3 A;  1ZP0 B;  1N60 A;  1YIW A;  3RNB C;  1GNU A;  3Q8B A;  5LXH A;  1OQY A;  4OVU A;  3U4E G;  4HXD A;  2L0T A;  1XCQ L;  1WYG A;  1NTV A;  3NWF A;  4EZJ A;  4IW0 A;  1BTK A;  1F1H A;  2LRU A;  3EPY A;  1NBF C;  2D2Q A;  3A9J A;  2K9X A;  1DOX A;  1ZM0 A;  3RUL A;  4B0M A;  4MAC A;  3H7P A;  3BIN A;  2ZCC A;  1BUI C;  1SSN A;  1FM0 D;  1KRH A;  3VOQ A;  1ST7 A;  3AE3 B;  1FIQ A;  4H2A A;  2I1K A;  1YMH E;  5C3J B;  5T8I A;  1L0X B;  2N23 A;  3L54 A;  5HKH A;  1IBX B;  1SE2 A;  1ZVR A;  2QKM A;  2DHI A;  3D8F A;  5D6J B;  3ML4 A;  1BML C;  2IND C;  3RZF A;  1D6E C;  2MBO A;  1MHX A;  4PQ0 A;  4DQO C;  1U5F A;  3L0W B;  1C76 A;  2JF5 A;  2DTC A;  2YT0 A;  3DVG X;  4EZK A;  3RFZ B;  3MJW A;  3ZNZ B;  1PFD A;  4PS3 A;  3R2T A;  2L8J A;  2V9H A;  2COP A;  1WXM A;  5JLJ B;  3HIZ A;  1E7U A;  2C9W B;  2XEW A;  5D3V A;  1OY2 A;  3AE1 B;  2JPH A;  3VUY A;  4JLC A;  4ILJ A;  2D9V A;  2IPK D;  3RYT A;  1WJU A;  1ZW7 A;  2BYT A;  2JSV X;  3ODO A;  2KFK A;  4IOI E;  2OHF A;  1Z2M A;  1L0V B;  4G0N B;  5TSS A;  1UUP A;  2DYQ A;  2DKP A;  1WJM A;  1EWY C;  4A3P A;  5CHF A;  2INC C;  2MBB B;  4YWG G;  4US9 A;  4ZOH C;  3QIJ A;  1TJ6 A;  4ILH A;  2MH7 A;  3ZXR A;  3ZVV A;  5IA7 A;  2ELB A;  2YSZ A;  2BGF A;  1MIX A;  1DYN A;  2KAJ A;  5JHG A;  2P0H A;  2G3Q B;  2UVM A;  3E56 A;  3W5U B;  2MEK A;  3QAR A;  2MA9 B;  2DN6 A;  3MP9 A;  2E6X A;  2WXR A;  2L32 A;  1KLV A;  2DEN B;  5GXG B;  3TEX A;  4JX1 C;  1LM8 B;  1DDW A;  1MHH E;  1KM7 A;  2ZPN A;  3GE3 C;  3L08 A;  1HB6 A;  5LG4 B;  3E9L A;  1M7E A;  4HAW B;  1N62 A;  3DBL I;  1V89 A;  2LAS A;  1K52 A;  4REZ A;  3L13 A;  1I2H A;  1UNP A;  2KTR A;  2M17 A;  1JWA D;  2KUP A;  3AE9 B;  1J8C A;  3ONS A;  2FBW B;  3B2F A;  5HFY A;  4FBJ B;  4GOU A;  3WA0 A;  2OTX A;  1OEY A;  1UH6 A;  1MK7 B;  2R82 A;  1GPX A;  2W3S A;  1VBG A;  1TT5 B;  2DNF A;  1OQN A;  2YT1 A;  5IRS A;  3AMZ A;  1TYG B;  1L6V A;  4W9J A;  5AZG A;  3VTV A;  2LGD A;  3H6N A;  1D5M C;  2VSZ A;  4OSN A;  2BB6 A;  3LYY A;  1UD7 A;  1I4P A;  1V5O A;  1CZP A;  1RYJ A;  4J3O D;  1AN8 A;  3DCX A;  2L76 A;  3NVY A;  1XLQ A;  2NR2 A;  1V2Y A;  3TSS A;  3PVL A;  2KD0 A;  1H10 A;  2JWZ A;  1Y19 B;  2J0M A;  3Q8C A;  3AEF B;  1EU4 A;  3BYT B;  4AS1 A;  2IDY A;  4LTU A;  3OHM B;  1X1G A;  2L3Z A;  4ILG B;  2G35 A;  3N3K B;  2GI9 A;  4EFO A;  3P4R B;  5KQ4 A;  3SHQ A;  5JHH A;  1IGC A;  4J6I A;  1R4M B;  3BK1 A;  2QIE B;  3AEG B;  2I5F A;  2FCS A;  2BWE S;  2K25 A;  5D2M B;  1FXT B;  2PVG C;  3B1L X;  2BBC A;  1FAO A;  2N9X A;  1TXD A;  2NBW B;  1ISN A;  1WMH A;  3UIN B;  2Z0E B;  4W9C A;  1LGR A;  4W9E A;  2FDQ A;  1JML A;  1MPH A;  2KDB A;  1XD4 A;  4GPT B;  3V60 A;  2I1J A;  4ZYN A;  3D32 A;  3U30 A;  1ZE3 D;  1EWC A;  4IAP A;  5BYR A;  3VRB B;  2LVO A;  2WYQ A;  2GBN A;  2N0S B;  4WJQ A;  4JK9 A;  1KH0 A;  3SUZ A;  4ANX A;  4WWP A;  3F5R A;  3D8D A;  1KI1 B;  2WWZ A;  4II2 B;  3CXB B;  4NSW A;  3EFU A;  4TYZ A;  2PW9 A;  3WAL A;  4HPP A;  2GBM A;  4KKI A;  3Q6B A;  1YJJ A;  2CU3 A;  1V97 A;  2CHX A;  2WS3 B;  2PLP A;  4IM0 A;  3VAW A;  3RPF C;  2Z4D A;  5IJM A;  4B6W A;  2D11 A;  2WXM A;  4DHZ B;  3VTU A;  4PYZ A;  3MDB C;  2RR9 A;  2NBV A;  2M56 B;  1HZ6 A;  4A5K A;  4HCP B;  2LUM A;  2M14 A;  1FGZ A;  2OJR A;  3V3X A;  3PV1 A;  2LUE A;  5JHA A;  4NNJ B;  2ABD A;  2KX3 A;  5D3W A;  3QK0 A;  5EDS A;  3V62 A;  4KHO A;  4BKS D;  1AWD A;  1PLS A;  1GJZ A;  1JWU D;  1P0R A;  2IGD A;  2WU5 B;  2K22 A;  3BZD B;  1FXI A;  4AP4 C;  2DFK A;  2NCN A;  3VUW A;  3W1S A;  5DI9 B;  3LB8 C;  3VIA A;  3AB5 A;  3S2A A;  2I2Y A;  1C4C A;  1E9M A;  2KMC A;  4HCN B;  1WJ1 A;  4K2O A;  3MFG A;  1MK9 B;  2JQR B;  4RCO A;  3TO1 A;  2G1E A;  2WHI A;  4YSZ B;  2BS4 B;  3WIM A;  5HE2 A;  3DVG Y;  1FXA A;  4GU2 A;  3UGB B;  3EUB 2;  2FJL A;  3I3T B;  5FR3 A;  1SIF A;  4HRS A;  3DCG A;  3ZDM C;  2A4Z A;  3VUX A;  5E6P A;  2KQ7 A;  3NG0 A;  4JWS C;  3HQC A;  5C79 A;  1WZ3 A;  2GOW A;  3O96 A;  2I38 A;  3OAW A;  3TEY A;  2LUL A;  2HRJ A;  3PSE B;  2M0X A;  2WNM A;  2WU2 B;  1YD8 U;  5J2R A;  1LO5 D;  2RSG A;  2FID A;  4RGT A;  2JYE A;  2AL3 A;  1IRS A;  2JRI B;  4TUU A;  1TS3 A;  3TEZ A;  1DOY A;  1SHC A;  1I4X A;  4IWQ A;  2HDE A;  2PIA A;  2JY6 A;  4M02 A;  2LFI A;  4OHJ A;  3OLM D;  1V80 A;  3QAQ A;  1DOI A;  1WG7 A;  3DHH C;  4WWM A;  2COC A;  2V3P A;  1Y8R C;  1Q0W B;  2D9Y A;  1MIZ B;  3FVC A;  3NUH B;  1AYF A;  3DWM A;  4LLG M;  1MG4 A;  1V5T A;  1V88 A;  4YL8 A;  4N59 A;  5L83 A;  5J3T A;  2MWS B;  3Q8E A;  1SEB D;  3B9J A;  3TBL D;  4ACF A;  3PSC A;  4HB3 B;  3MC9 A;  3GE8 C;  4ZRI A;  1NEK B;  4QXA B;  1KC7 A;  1WYW B;  3FSS A;  1RRB A;  1TKE A;  4WH4 A;  1Q10 A;  1J0G A;  3KZ1 A;  3LJU X;  2DLW A;  1Q67 A;  3NZS A;  4IWO A;  4HB0 B;  1ZOY B;  3RMK C;  2K39 A;  1IBX A;  2LRW A;  5JH5 C;  4FLH A;  2R2O A;  2Z59 A;  2V4L A;  4IWP A;  1FEH A;  1FCC C;  1QOF A;  2IJ0 A;  3PEG A;  2ICI A;  1WE7 A;  2ASQ A;  4NQL B;  4I6N B;  3EGR A;  2WDT B;  1E5W A;  3E66 A;  3TIX A;  1IYF A;  4M8M A;  3GOE A;  3A58 A;  3NVZ A;  2KNB A;  4DDG D;  1X1F A;  1UPR A;  3B0A A;  4DHZ E;  2ZPY A;  1MFW A;  4FHJ A;  4WSF A;  3KRX A;  1H4R A;  4MT5 A;  1HQR D;  3R2I A;  4K81 A;  4JKA A;  5MPO A;  3DBH B;  4MGZ E;  3WAM A;  4NZL B;  3KUD B;  1D5Z C;  4WVF B;  3U7Z A;  2H7D A;  3VVW B;  4NQK E;  4GOC A;  4XWT A;  4RMA A;  1F9J A;  3R7Q A;  4JKE A;  2PZ1 A;  2UZR A;  4D6W A;  2V76 A;  1WE6 A;  4KZC A;  5GOW B;  1GB4 A;  2B76 B;  5CX3 A;  2UZS A;  3VRA B;  3ZYY X;  2IFS A;  2FNJ B;  3N1Z C;  3GYO A;  3BWU D;  2L1A A;  5DHA B;  3DBR B;  1QLB B;  3DBR I;  1NTI A;  4YTM B;  5JXV A;  1NVI D;  2MJD A;  3ULB A; 
#chains in the Genus database with same CATH homology
 2MX2 A;  2G4S A;  5D94 A;  4L6E A;  2N7E A;  2ZJD A;  2LD9 A;  2C7H A;  3PGE A;  2M4N A;  3PPA A;  4HB4 B;  2PE9 A;  1QQG A;  3CSF A;  1UNR A;  3DXD A;  3Q3J A;  1V61 A;  4IM3 A;  3A1Q B;  1LQB A;  4A6F B;  4DBG A;  1HB8 A;  3KYC D;  2DZI A;  5GMV A;  2RQ1 A;  2UWQ A;  1TQZ A;  4KVG B;  1L7Y A;  3QC8 B;  4FA6 A;  4GMX B;  1GG3 A;  5L81 A;  2DHK A;  3OJ4 B;  2CB8 A;  5E6O A;  2KCJ A;  2R09 A;  4DHJ B;  3B08 A;  4ZRK A;  4KIK A;  4FJV B;  2IO1 B;  1U27 A;  4K1R B;  2NS5 A;  2CU1 A;  1M7R A;  4A6K A;  2P0D A;  5DH9 B;  4JK8 A;  3CIK A;  2C7N B;  1PFJ A;  5IAA C;  1HBK A;  2QHO A;  2KHW B;  2G45 B;  4PS7 A;  2ROZ B;  2HJ8 A;  3UIP B;  4LJO B;  4K17 A;  4CHK A;  2J0K A;  2JZZ A;  2IYB A;  4DHJ D;  5D7G A;  2NPT B;  5AZF A;  3T8M A;  1OMW A;  2BPS A;  3LDZ E;  2XK5 B;  4KZ0 A;  2D9X A;  4W9H A;  2J7Q B;  4ZRJ A;  2D4Q A;  5D27 A;  4DXA B;  1U2B A;  3IVF A;  1KZG A;  2I5C A;  4BKG A;  1WGQ A;  4RM8 A;  3QWZ B;  3RCZ A;  1VBH A;  4BOZ B;  3QWM A;  3A9K A;  4BVU C;  1LB1 A;  2JRH A;  2N1W A;  2COF A;  1WGD A;  2KXJ A;  5KCV A;  1OEY J;  2X0S A;  2YS3 A;  4FN2 A;  4X57 B;  2REX A;  2NZ8 B;  4W9G A;  3SO6 A;  4MEL A;  1KBL A;  1EVH A;  5JVL A;  2FAZ A;  4XZ4 A;  3D8E A;  2KJH B;  2GMI C;  2XBB C;  5LON B;  4KSL C;  2LVP A;  2LBB A;  3ZO5 B;  2LGX A;  5BO4 B;  2Z0O A;  4JKC A;  3AU4 A;  4IG7 B;  1KJT A;  2KZR A;  2YLM A;  4BBK A;  3PVU A;  3V5W A;  2LKO A;  2Y8G A;  1PQS A;  4M0W B;  3WAO A;  1GC7 A;  4WAA A;  2RNR B;  1L2N A;  3AU5 A;  3U8Z A;  3Q3F A;  3FM8 C;  4K7S A;  2DYO A;  4NJ7 A;  4W9L A;  2CKH B;  1WFY A;  4P7I A;  4ZDV A;  1UEF A;  1ZC4 B;  4GZU A;  5TR5 A;  4JGH B;  2JUO A;  3AUL A;  4EKU A;  4PNK A;  2LWP A;  2K00 A;  3NZU A;  3WAN A;  1NTY A;  4NJ6 A;  2KDE B;  3PP2 A;  3SD5 A;  2K8H A;  4ICU A;  2KOX A;  1UBQ A;  2CY5 A;  2N7D A;  5CHW A;  3VHT C;  4EJN A;  1B55 A;  1V9J A;  4W9D A;  3SU8 X;  5J17 A;  3ZTC A;  1WJ6 A;  2LJ5 A;  4HAZ B;  2XQN M;  3O65 B;  4TV3 A;  3K9O B;  1YX6 B;  3PS6 A;  3EEC A;  4KHA A;  3ZNI D;  2DHJ A;  3RD2 A;  2P8V A;  3VFK A;  4DWF A;  2KWC A;  4HJK A;  1R4M I;  4IUM B;  5LLI A;  2ZNV C;  1WXA A;  2RGF A;  1NDD A;  4GXB A;  3UQA A;  1U5D A;  4PS8 A;  2FCM A;  2BYF A;  2UYZ B;  2DIK A;  4JKH A;  2LXA A;  2IZV B;  3M3J A;  2R0D A;  4IC7 B;  2KK8 A;  4CO7 A;  1ACA A;  4KV2 A;  1UZX B;  3ODW A;  2KLG A;  1Z5S B;  4ICV A;  4LDT B;  4W9F A;  4A3O A;  3DOW A;  1XT9 B;  5E6N A;  4HAY B;  4HAV B;  3OJ3 A;  2LG1 A;  4F7H A;  3FLV A;  1DRO A;  3DVN U;  3A9J B;  2YS1 A;  4WJO A;  5CHV C;  1YX5 B;  3FP5 A;  3H7P B;  1E8X A;  4MK0 A;  4LDT D;  1BWN A;  1WI0 A;  4A6F A;  4CYE A;  4KSK C;  4ANW A;  1WX7 A;  2M1M A;  2P0F A;  1FHO A;  3HM6 X;  2DZM A;  3ZRF A;  2E2X A;  4ANU A;  2OQB A;  2H7E A;  2KDF B;  4FHK A;  1P5T A;  2ZNV B;  3ZLZ A;  2L00 B;  4JKG B;  4HHV A;  2C5L C;  3TJP A;  2PEA A;  4BKT A;  4WJ7 A;  3C0R B;  3DPD A;  1WGG A;  2B3A A;  3JVZ X;  1BT0 A;  1XQQ A;  1V49 A;  3CF6 E;  2PE6 B;  2J0J A;  2C60 A;  1WX8 A;  1W1H A;  1MAI A;  3RZW C;  1XCG A;  2W2X C;  3VQI A;  1V5P A;  2RVB B;  3A4R A;  3A98 B;  5KQ1 A;  2NPT A;  2DYB A;  3KSY A;  2XK5 A;  4F7U P;  3ODX A;  1SGH A;  3ULC A;  2AL6 A;  4W9I A;  2KX0 A;  1P6S A;  4AOF A;  4MH0 E;  1WJN A;  3ZUN A;  3FEH A;  5L95 C;  3QX1 A;  3NSU A;  4GDL B;  1ZSQ A;  4MSM B;  3PZD A;  2RGN B;  2GCJ A;  2EKE C;  2JZ3 B;  3KUZ A;  4G50 A;  1NU2 A;  3M95 A;  1DIK A;  4HAX B;  1H8C A;  3ZRC A;  4B6H A;  2IO3 B;  3EC8 A;  3ML9 A;  4RM9 A;  3A8P A;  4DK5 A;  1U5G A;  2EJ8 A;  3G9W A;  2K6D B;  2Y8F A;  2O6V B;  4HAU B;  2DAJ A;  2MWN B;  3QHT A;  4A6H A;  2MW5 A;  4Z2M B;  3ZNH B;  4MY6 A;  4AJW A;  3PLV A;  1YJ1 A;  1WR6 E;  4I6P A;  1V5M A;  4GDK B;  1NI2 A;  1G6J A;  3BY4 B;  2FIF A;  2IO2 B;  5DPS A;  1UNQ A;  2A5U A;  1J19 A;  2O6V D;  3DBH I;  1EGX A;  1JRU A;  4EEW A;  4JKD A;  3U7D A;  5DIF B;  4HDO A;  5EFX A;  3RUI B;  2W2X D;  3APC A;  2KLC A;  3W1Y A;  3AI5 A;  1V86 A;  2IY0 B;  1CMX B;  5DCN A;  2OOB B;  2MKR A;  5JZE B;  4B95 A;  1WXS A;  4A20 A;  3DQV A;  5C6R A;  2KWV B;  3IFW B;  4JIO U;  1X86 A;  3KYD D;  3NOB A;  1XX0 A;  3F0W A;  3A8Q A;  2RSU A;  2CAY A;  1S1Q B;  2IBI B;  3PG7 A;  4JKB A;  1TTN A;  2KC2 A;  2KMA A;  5CLL B;  1I35 A;  1FHW A;  3OAN A;  3ZW3 A;  1V5U A;  2FCN A;  2GS0 A;  1AAR A;  1WZ0 A;  4HAT B;  1ZKH A;  2EMS A;  5CTR C;  4HB2 B;  4FJZ A;  2LZ6 A;  5JP4 A;  1C1Y B;  2MP2 B;  3EHV A;  2VKI A;  1UEL A;  2L0F A;  1HE8 A;  4FAD A;  2D9Z A;  2ZZP B;  3DXE A;  5DHF B;  4W9K A;  1LFD A;  3N32 A;  5KHQ A;  2JVC A;  4ASW C;  2CRF A;  1P3R A;  4WJN A;  1T0Y A;  1Q1O A;  2KQS A;  4JKF A;  1I7A A;  4GSW A;  2GJY A;  3TMP B;  2Y5B B;  4EUT A;  2KWU B;  1P9D U;  1WXV A;  1FOE A;  1E8Y A;  3H1U A;  2N0Y A;  4NAW B;  2HTH B;  2RLO A;  4JL9 A;  3PLU A;  1ZGU B;  4LJP B;  2MBH A;  3ZIM A;  3JSV B;  5D3Y A;  3KW5 B;  2KTF A;  1YQB A;  1RLF A;  1M94 A;  4BKS A;  3E9P A;  1BAK A;  2N4F A;  5G55 A;  2L7R A;  4KHB B;  1RAX A;  3APF A;  1FHX A;  2RD0 A;  3DXC A;  4MJS B;  2MRP A;  2KKC A;  4WWN A;  4BOS C;  1GGO A;  4F8C B;  3VH4 B;  4HLE A;  2V3S A;  5AZH A;  1QC6 A;  2MDX A;  1X1M A;  2KO3 A;  2COD A;  1WGH A;  1EAZ A;  1DDM A;  3ZTD A;  1P1A A;  5JHB A;  1IP9 A;  4BBN C;  4K7U A;  3HK0 A;  1NVL A;  4E74 A;  3UIO B;  1U4A A;  3KUC B;  1EF1 A;  3PT2 B;  3N30 A;  5FI1 A;  2Z59 B;  1WGU A;  2N9E B;  3BJI A;  5DPT A;  4JK7 A;  1DDV A;  2DX5 B;  1EUV B;  4MDK E;  3VDZ A;  4JKG A;  2O2V B;  3RT3 B;  3KH0 A;  2ADZ A;  3QQ8 B;  3R7R A;  4M8N A;  4Y94 A;  3TVV A;  5KHO A;  4IM2 A;  3MHS D;  2X18 A;  4GMV A;  1SE9 A;  2VRR B;  1XOD A;  2D07 B;  2MBQ A;  2K6Q A;  2BWF A;  5LOP B;  4GGQ A;  1VD2 A;  3N7C A;  2KJR A;  2MQJ A;  2L1C A;  2KJ6 A;  2KC1 A;  1QZE A;  2PPH A;  2RPQ A;  4BBN F;  4WQO B;  2LXC A;  1A5R A;  3UF8 A;  4GIV A;  3SDL C;  4URK A;  4DDI D;  2DYN A;  5D3X A;  1WH3 A;  4TKN A;  3NHE B;  1WI1 A;  2Z0Q A;  3ECI A;  2HE7 A;  2YF0 A;  5C5B B;  3TFM A;  2DA0 A;  2LI5 A;  2WX1 A;  2K1F A;  3MPX A;  4GDL A;  3T9L A;  1FGY A;  2D9W A;  2K2U A;  2CHW A;  3JYU A;  2Q13 A;  4NY0 A;  1Q5W B;  1GC6 A;  3SBG A;  1I42 A;  3L10 B;  1XD3 B;  2GCL A;  1OGW A;  3ZDT A;  2YRY A;  3PRZ A;  2JP2 A;  4MGI E;  4IFS A;  2M8S A;  2DKQ A;  2LYD A;  3ZVR A;  1C3T A;  3UQB A;  2O6V A;  3QA8 A;  4KIK B;  2FCQ A;  1R4N I;  3DBS A;  3T06 A;  3A4S C;  4LCD E;  1ZC3 B;  1LW3 A;  3H7S A;  4AWJ A;  4MM3 A;  4YON A;  3WAP A;  1W1G A;  4HWI B;  2KDI A;  1TGZ B;  4XWX A;  2HD5 B;  4GDK A;  3ZKJ C;  5DPR A;  3KRW A;  4TQ0 A;  2ZVN A;  4KAX B;  3DDC B;  4EZL A;  1WIA A;  2LOZ A;  3A33 B;  1E7V A;  2ZVO A;  1UPQ A;  4G3X B;  3V6C B;  4DX8 A;  2ZEQ A;  1N3H A;  2BYE A;  3R3M A;  1U29 A;  2AEH A;  2Z0P A;  2GBR A;  2N9P C;  2WH5 A;  1KZ7 A;  2MSE D;  3UZT A;  2KVR A;  5J3Y A;  1MKE A;  3P6A A;  1TZ1 A;  5HE1 A;  4K7W A;  1WR1 A;  4HPL B;  3L16 A;  1WM3 A;  2LOX A;  5DPW A;  2MCN B;  2Y7B A;  3A9K B;  2NVU I;  1UGM A;  1XKE A;  3A1Q A;  1WX9 A;  4N9F 4;  1AWE A;  1Y5O A;  4II3 B;  1E8Z A;  4EOY A;  3PHX B;  2CHZ A;  3PRM B;  1W1D A;  4WWO A;  2BKR B;  1E8W A;  5G2N A;  2IO0 B;  2BYV E;  5CLQ B;  2GBK A;  2BCJ A;  2YS5 A;  1JDE A;  4AUQ C;  2G4D B;  1AQC A;  3V61 A;  2IYD B;  1KOT A;  4MT7 A;  1EO6 A;  2QKL A;  2LGY A;  2MP2 A;  1P3Q U;  4KDI C;  2PJH A;  3WYF B;  1K8R B;  4MEM A;  2KFK B;  1RRP B;  3ENE A;  3CST A;  2N1V A;  2K8C A;  4B9K A;  2Z0D B;  4FJY A;  4DX9 0;  4MSQ B;  1P98 A;  3V6E B;  2CY4 A;  2W2W A;  4HPM B;  4HVB A;  2FUH B;  3ML8 A;  4I6L B;  4TQ1 A;  2K2J A;  4CHJ A;  4CHM A;  3GZN I;  4NAW A;  2HTH A;  5HE0 A;  2DYM A;  2CR5 A;  2V1Y A;  3NY5 A;  3JSV A;  2KTR B;  3X23 A;  3H9D A;  2EMT A;  3QCA A;  1WGY A;  4AJY B;  3APD A;  3PRE A;  1FB8 A;  1OTR B;  5HE3 A;  5FI0 A;  4MJS A;  1WVH A;  3P2B A;  4GB9 A;  3RCP A;  5C23 A;  4DBB A;  1Z87 A;  4MGK E;  2KN5 A;  5AEK B;  5FR6 A;  3X0W A;  4WJP A;  1BTN A;  2FJ9 A;  3M1I B;  2IY1 B;  3VXW A;  3W1S C;  2KGX B;  3LJ3 A;  2L2I A;  3VH3 B;  1WRD B;  3PHW B;  3R66 C;  2BKF A;  2MFQ A;  3SNH A;  2KAN A;  2DHZ A;  4K2P A;  1V81 A;  2GBJ A;  1IPG A;  3HHM A;  4EMO A;  3KY9 A;  2DX5 A;  5C16 A;  3AXC A;  3K9P B;  4PYU A;  2JT4 B;  2O2V A;  1WM2 A;  4E3C A;  2YVC A;  1TBE A;  2K8B A;  1WMH B;  2DZK A;  4F7Z A;  1PMS A;  3PRP B;  4HDQ A;  1X05 A;  1VCB A;  4F1S A;  2NMB A;  1V6E A;  2ELA A;  3QBV B;  2MLB A;  3ENB A;  1WF9 A;  1WY8 A;  2DZJ A;  4XC2 A;  2JXX A;  4KDL B;  3JW0 X;  1GUA B;  1DBH A;  2WX0 A;  4BFR A;  4F7G A;  3NS8 A;  3PTF C;  4FUL A;  5C1Z A;  3M62 B;  2M38 A;  1U5E A;  2R2Q A;  3GYP A;  4JQW C;  2W9N A;  2L05 A;  2BF8 B;  3TW1 A;  4C0A A;  3P7Z A;  2CQU A;  3PVW A;  5C5B A;  1X11 A;  3SV1 A;  3HM3 A;  2NBV B;  1E90 A;  1WJ4 A;  2D3G A;  1K5D B;  2C7M B;  4IOY X;  4D0N B;  4G11 A;  3M63 B;  4E71 A;  2ZCB A;  4H8S A;  1RJ2 A;  2COA A;  4OVV A;  2VRW B;  4Z2N A;  1LXD A;  5J3Q A;  3L17 A;  1J0W A;  3MTN B;  2DAF A;  3SYX A;  3DVN V;  3VTW A;  3ZNG C;  3KVF B;  2CS4 A;  2AWT A;  1D3Z A;  2AYO B;  2NBU A;  1MG8 A;  1EF5 A;  3ALB A;  3AJ4 A;  5J18 A;  3IBE A;  1WGR A;  2DX1 A;  2LVQ A;  4NPN A;  2MBE A;  2ROV A;  3HW2 B;  4XX5 A;  4HK2 A;  3TL5 A;  4ANV A;  5LXI B;  3SBT A;  3E9O A;  4MGY E;  2J59 M;  1XR0 B;  2RUK B;  1RFA A;  3TCA A;  1S3S G;  2EC1 A;  3IHP C;  3CMM B;  1K5G B;  1UBI A;  2KFJ A;  2D10 A;  3QJZ A;  4GN1 A;  3IG3 A;  1YIW A;  1GNU A;  5LXH A;  4OVU A;  1OQY A;  4HXD A;  2L0T A;  1NTV A;  4EZJ A;  4IW0 A;  1BTK A;  2LRU A;  3EPY A;  1NBF C;  2D2Q A;  3A9J A;  1ZM0 A;  3RUL A;  3H7P A;  3BIN A;  2ZCC A;  3VOQ A;  1ST7 A;  2I1K A;  2N23 A;  3L54 A;  5HKH A;  1ZVR A;  2QKM A;  2DHI A;  3D8F A;  5D6J B;  3ML4 A;  3RZF A;  2MBO A;  4PQ0 A;  1U5F A;  3L0W B;  2JF5 A;  2DTC A;  2YT0 A;  3DVG X;  4EZK A;  3MJW A;  3ZNZ B;  4PS3 A;  2L8J A;  2COP A;  1WXM A;  5JLJ B;  3HIZ A;  1E7U A;  2C9W B;  2XEW A;  5D3V A;  1OY2 A;  2JPH A;  3VUY A;  4JLC A;  4ILJ A;  2D9V A;  3RYT A;  1WJU A;  1ZW7 A;  3ODO A;  2KFK A;  1Z2M A;  4G0N B;  2DYQ A;  2DKP A;  1WJM A;  4A3P A;  5CHF A;  2MBB B;  3QIJ A;  1TJ6 A;  4ILH A;  3ZVV A;  5IA7 A;  2ELB A;  2YSZ A;  2BGF A;  1MIX A;  1DYN A;  5JHG A;  2P0H A;  2G3Q B;  2UVM A;  3QAR A;  2MA9 B;  2DN6 A;  1KLV A;  2DEN B;  1LM8 B;  1DDW A;  1KM7 A;  2ZPN A;  3L08 A;  1HB6 A;  3E9L A;  1M7E A;  4HAW B;  3DBL I;  1V89 A;  2LAS A;  3L13 A;  1I2H A;  1UNP A;  2KTR A;  2M17 A;  2KUP A;  1J8C A;  3ONS A;  4FBJ B;  3WA0 A;  2OTX A;  1OEY A;  1UH6 A;  1MK7 B;  2R82 A;  1VBG A;  1OQN A;  2YT1 A;  4W9J A;  5AZG A;  3VTV A;  2LGD A;  3H6N A;  2VSZ A;  1UD7 A;  1V5O A;  2L76 A;  2NR2 A;  1V2Y A;  3PVL A;  2KD0 A;  1H10 A;  2JWZ A;  1Y19 B;  2J0M A;  1X1G A;  2L3Z A;  4ILG B;  2G35 A;  3N3K B;  4EFO A;  5KQ4 A;  3SHQ A;  5JHH A;  4J6I A;  2I5F A;  2FCS A;  2BWE S;  2K25 A;  5D2M B;  1FXT B;  3B1L X;  1FAO A;  2N9X A;  1TXD A;  2NBW B;  1ISN A;  1WMH A;  3UIN B;  2Z0E B;  4W9C A;  4W9E A;  2FDQ A;  1MPH A;  2KDB A;  1XD4 A;  4GPT B;  3V60 A;  2I1J A;  4ZYN A;  3D32 A;  3U30 A;  4IAP A;  2LVO A;  2WYQ A;  2GBN A;  4WJQ A;  4JK9 A;  3SUZ A;  4ANX A;  4WWP A;  3F5R A;  3D8D A;  1KI1 B;  2WWZ A;  4II2 B;  3CXB B;  4NSW A;  3EFU A;  4TYZ A;  3WAL A;  2GBM A;  2CHX A;  4IM0 A;  3VAW A;  5IJM A;  4B6W A;  2D11 A;  4DHZ B;  3VTU A;  4PYZ A;  3MDB C;  2RR9 A;  4A5K A;  4HCP B;  2M14 A;  1FGZ A;  2OJR A;  3PV1 A;  2LUE A;  5JHA A;  4NNJ B;  2ABD A;  2KX3 A;  5D3W A;  3QK0 A;  5EDS A;  3V62 A;  4KHO A;  4BKS D;  1PLS A;  1GJZ A;  1P0R A;  4AP4 C;  2DFK A;  2NCN A;  3VUW A;  3W1S A;  5DI9 B;  3VIA A;  3S2A A;  2KMC A;  4HCN B;  1WJ1 A;  4K2O A;  1MK9 B;  3TO1 A;  3WIM A;  5HE2 A;  3DVG Y;  4GU2 A;  3UGB B;  2FJL A;  3I3T B;  1SIF A;  3DCG A;  3ZDM C;  2A4Z A;  3VUX A;  5E6P A;  2KQ7 A;  3HQC A;  5C79 A;  1WZ3 A;  2GOW A;  3O96 A;  3OAW A;  2LUL A;  2HRJ A;  3PSE B;  2M0X A;  1YD8 U;  5J2R A;  2RSG A;  2FID A;  2AL3 A;  1IRS A;  2JRI B;  4TUU A;  1SHC A;  4IWQ A;  2JY6 A;  3OLM D;  1V80 A;  3QAQ A;  1WG7 A;  2COC A;  1Y8R C;  1Q0W B;  2D9Y A;  1MIZ B;  1V5T A;  1V88 A;  4YL8 A;  5L83 A;  5J3T A;  2MWS B;  3TBL D;  3PSC A;  4HB3 B;  4ZRI A;  1KC7 A;  1WYW B;  3FSS A;  1RRB A;  1J0G A;  3KZ1 A;  3LJU X;  2DLW A;  1Q67 A;  3NZS A;  4IWO A;  4HB0 B;  2K39 A;  2LRW A;  5JH5 C;  4FLH A;  2R2O A;  2V4L A;  4IWP A;  3PEG A;  1WE7 A;  2ASQ A;  4NQL B;  4I6N B;  2WDT B;  1E5W A;  3E66 A;  3TIX A;  1IYF A;  4M8M A;  3GOE A;  4DDG D;  2KNB A;  1X1F A;  1UPR A;  3B0A A;  4DHZ E;  2ZPY A;  4FHJ A;  4WSF A;  3KRX A;  1H4R A;  4K81 A;  4JKA A;  4MGZ E;  3WAM A;  3KUD B;  4WVF B;  3VVW B;  2H7D A;  4NQK E;  4GOC A;  4RMA A;  1F9J A;  3R7Q A;  4JKE A;  2PZ1 A;  2UZR A;  2V76 A;  1WE6 A;  4KZC A;  5GOW B;  5CX3 A;  2UZS A;  2IFS A;  2FNJ B;  3GYO A;  5DHA B;  3DBR I;  1NTI A;  3ULB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...