2D2QA

Crystal structure of the dimerized radixin ferm domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d2qA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d2qA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d2qA01
3KUZA 2J0MA 2DKPA 1WJMA 2MQJA 2RPQA 1WG7A 2KFKA 3NZUA 4K7WA 1KI1B 2QKMA 4WJPA 5LXIB 3MHSD 3B08A 4CHMA 1KM7A 2LOXA 3APDA 1K8RB 4ZDVA 2FIDA 1DYNA 2V4LA 2FIFA 1GJZA 1IRSA 2D9WA 2KJRA 3M95A 2O2VB 2KTRB 4MDKE 4URKA 2LXAA 2Z0EB 1W1HA 3MDBC 2BKRB 1XD3B 2JUOA 1ZKHA 2M14A 4GOCA 2RGFA 4ICVA 2LASA 4KHAA 4TQ1A 4ANXA 1V5PA 2DHZA 4MGKE 2LRUA 2W2XD 4A20A 2OQBA 2MWSB 4MH0E 2RR9A 2JT4B 4MSQB 1EF1A 2GCJA 1WX9A 4WWNA 3ZDTA 3PG7A 1I35A 2PZ1A 3DVNV 4ZYNA 2N9EB 2KK8A 3DQVA 3DVNU 2PE9A 3P2BA 3G9WA 1UELA 3TJPA 2YS5A 2EC1A 3AXCA 4FLHA 2K00A 1YQBA 4GIVA 3PRZA 2E2XA 2K39A 4K2PA 2M38A 4BKSD 2A4ZA 3QC8B 3UIPB 4RM8A 5GMVA 2CRFA 1DDVA 1FOEA 3APFA 1WGUA 4FBJB 3RZWC 3CF6E 1V5MA 4MM3A 4PNKA 3CMMB 1Y8RC 3NZSA 5CHWA 1UGMA 2K1FA 2ABDA 2NVUI 3QK0A 3MPXA 4K2OA 5E6PA 1GC7A 3PZDA 2CR5A 3HIZA 2IO0B 2RD0A 2KO3A 1BTKA 4NNJB 1WJ4A 4MK0A 1MIZB 1OTRB 1FHOA 3PLUA 1I2HA 4KVGB 4IWPA 2MBHA 2L1CA 5J2RA 3AULA 1U5GA 1QQGA 2FCSA 4WWPA 1S3SG 3PSEB 2ROVA 2XEWA 3A8PA 3ENEA 1WGRA 4IG7B 2I5CA 1TTNA 1WMHB 1OGWA 5IJMA 3ZUNA 5KHOA 4K7UA 4ICUA 4WSFA 5C79A 2XBBC 1S1QB 1IP9A 1TBEA 2Y5BB 2ZEQA 4CHJA 2KANA 3PREA 1HBKA 1E5WA 4HK2A 4HDOA 5AEKB 2MRPA 3N3KB 3X0WA 4HXDA 3ZDMC 3T9LA 2Y7BA 2DZIA 3L54A 2BGFA 2KJHB 2JZZA 2LZ6A 4HVBA 2NR2A 2BPSA 3KRWA 1E8YA 1WMHA 4LJOB 2DFKA 3V61A 2RLOA 2DAJA 3O96A 1UD7A 1UNPA 4ZRKA 3PT2B 3OJ4B 2CQUA 2Q13A 4HJKA 3TFMA 5L81A 1C1YB 4A6KA 3TL5A 1WI0A 3PLVA 3FLVA 1DROA 2MBOA 3LJUX 4L6EA 2KC1A 5CHVC 5C23A 5HE2A 1E90A 2JRIB 4KDLB 2YRYA 3VDZA 3K9PB 1PLSA 4KHOA 3S2AA 1WR6E 4HLEA 2NMBA 2KWCA 3PVLA 1WM2A 2JRHA 3H7SA 3A1QB 1GUAB 4WVFB 1WFYA 3QWMA 3WIMA 2LYDA 3GZNI 2ZPNA 1ZW7A 3VIAA 4NSWA 4I6NB 3PVWA 3WYFB 3NS8A 3SV1A 4MSMB 4HAYB 2L3ZA 2D2QA 2DX1A 4EZLA 2P0FA 3R3MA 1OY2A 4DXAB 3ULCA 4NAWA 3VVWB 3R7QA 5FI1A 1JRUA 3HM3A 2BYFA 3A9KB 1V81A 2M0XA 4FULA 4GPTB 3CSTA 1MK7B 2LXCA 4IOYX 4GZUA 2PJHA 4BKGA 3JSVB 3A1QA 2L2IA 1OEYJ 4TKNA 4MEMA 1UBQA 2QKLA 3DVGX 1RAXA 5JLJB 3DVGY 5J3TA 2L0TA 3F5RA 1WRDB 2WYQA 5DH9B 2BCJA 3D32A 4NJ7A 1Y5OA 4GU2A 2NBVB 4PS8A 3N7CA 5CLLB 3A9KA 4HAXB 3TMPB 1OEYA 1XKEA 3HM6X 1P9DU 1V80A 4KSLC 1XX0A 1A5RA 3ZTCA 5CTRC 1U2BA 2IYDB 5D2MB 3JSVA 5JZEB 2UZRA 3A4RA 2VRRB 4F7UP 4RM9A 1P1AA 2ZCBA 1WGQA 4DHZB 5LOPB 2JWZA 2KVRA 3H7PB 1LXDA 5LXHA 1Z87A 2ZCCA 4RMAA 5JHHA 1HE8A 1MKEA 3C0RB 3ZO5B 2NPTA 5EFXA 1MAIA 3VOQA 3R66C 1U29A 1UNQA 2DLWA 3ZIMA 2WWZA 4J6IA 5D6JB 1Z2MA 5DPTA 3RUIB 2L7RA 3H9DA 3VTUA 3VH4B 3VTWA 4A6FB 3FEHA 2REXA 3MJWA 2UZSA 5LONB 1K5GB 1E7UA 3W1SA 2D9XA 2L00B 2L05A 4CHKA 3H7PA 4G11A 3PVUA 3ECIA 2GBKA 1L2NA 4E74A 5C6RA 3OAWA 1V5UA 2PEAA 3PHWB 3RT3B 2HD5B 3ODWA 2IO2B 2KFKB 4HCNB 2YSZA 3CSFA 2X18A 4NQKE 2N23A 3P6AA 1LQBA 2DYOA 2CU1A 3UGBB 4GGQA 2PPHA 2L76A 4JL9A 3IFWB 4EJNA 5JH5C 5HKHA 1SGHA 1RLFA 3SDLC 4HAZB 4A6FA 1WZ0A 2KFJA 4MT7A 5LLIA 3SU8X 1WJ1A 3CIKA 2Z0PA 3PRMB 2NZ8B 3M63B 3WANA 2DA0A 3K9OB 4BOZB 3ZKJC 1MG8A 2OOBB 1FB8A 4B6HA 3KZ1A 2FCMA 2BYEA 1ZGUB 1P6SA 1YX6B 2CAYA 3UIOB 2UVMA 2KDFB 3VQIA 4K17A 4OVVA 3FP5A 5E6NA 3L17A 5J3YA 1WE7A 2WH5A 4DX90 3ML9A 3NY5A 3VUXA 3RD2A 2DYMA 1W1DA 2D07B 2ASQA 2LUEA 2DHIA 3DDCB 1U4AA 4KIKA 4DBGA 4BKTA 2K2UA 2GBJA 1BAKA 2ADZA 2P8VA 2OTXA 2LI5A 4K7SA 1HB8A 5G55A 3ZW3A 1P3QU 1WY8A 2JVCA 3VTVA 3QX1A 4ANVA 4N9F4 2Z0DB 3ZTDA 1E8XA 3ZNZB 3QWZB 1B55A 2VKIA 2K6QA 5D3VA 3KYCD 5DPWA 4W9CA 2D11A 3EPYA 1P3RA 2D4QA 4FHKA 3F0WA 2MBBB 3T06A 2D9YA 4IWOA 4YONA 4BBKA 5KQ4A 1MPHA 4DBBA 4II2B 3AU4A 2FCNA 3P7ZA 2DYNA 3A9JA 3A98B 2ZNVC 3DXCA 3FM8C 1X05A 3HW2B 1NI2A 1V9JA 2UWQA 5C1ZA 4LDTD 3ZNID 4W9HA 4PQ0A 4ZRIA 2ELAA 2DX5B 4Z2NA 3DPDA 3VUYA 3ODXA 1V61A 3B0AA 3GYPA 3Q3FA 5C5BA 4IM3A 2KJ6A 1RRPB 2M17A 5E6OA 1TGZB 1ZC3B 2J0KA 5HE0A 1SHCA 2IO3B 2AYOB 4CO7A 1ST7A 4AUQC 1OMWA 4TV3A 1V89A 2GMIC 4F7HA 1BTNA 2LVOA 2G4DB 3H6NA 1XQQA 1WH3A 2KDBA 2CKHB 5DCNA 1FHWA 1SIFA 2AL6A 3DXEA 4KSKC 2EKEC 2DX5A 4TQ0A 4TUUA 2RVBB 1XODA 4MGZE 1V88A 5AZGA 3WALA 4WQOB 2W2WA 1UPRA 1X11A 3HQCA 3AU5A 2GBMA 4WAAA 5CHFA 3L13A 4HDQA 2KWUB 1KLVA 4AOFA 3SO6A 2DENB 2Y8GA 2KMCA 1CMXB 2LGDA 2JZ3B 4PYUA 2COAA 2EMTA 5D3YA 3ZNGC 4B95A 1BWNA 1EO6A 4KV2A 4GDLA 3UINB 1YJ1A 3QA8A 3BINA 3QAQA 3V62A 2YS3A 4DK5A 4FADA 4DHZE 1T0YA 3QIJA 4IUMB 1XD4A 1WXVA 3QCAA 5L83A 1WE6A 3QBVB 4W9EA 2KTFA 1Q0WB 1WVHA 2ZZPB 1PMSA 2K8CA 4JIOU 3IVFA 2DTCA 2ELBA 2B3AA 4K81A 1TXDA 3A4SC 2I1KA 4BVUC 4ANWA 3VUWA 1FAOA 2J7QB 4WJNA 1TJ6A 2M4NA 2CHXA 2XK5A 2GCLA 1XCGA 1DDWA 1UH6A 2VSZA 4JQWC 5HE1A 1XT9B 4NAWB 5JP4A 4W9KA 1E7VA 4LCDE 4IAPA 1U27A 1ACAA 3ZVRA 2EJ8A 2BYVE 2KNBA 2CHWA 2MP2A 4DHJD 2J59M 4FJVB 4W9GA 2LG1A 2KWVB 4HAUB 3DBLI 2CY5A 1RFAA 5IAAC 3A8QA 5J18A 5D27A 1ZC4B 4MJSB 3RYTA 5D3XA 1V2YA 1V5TA 3DBRI 2K6DB 1HB6A 4DX8A 5JHGA 4F8CB 1N3HA 2C7MB 2JY6A 4YL8A 1NVLA 3TCAA 4OVUA 1W1GA 1FHXA 5GOWB 1KJTA 3EC8A 1UEFA 2LD9A 4NJ6A 3KSYA 2MBEA 1AQCA 1I42A 2MWNB 2MKRA 4PS3A 1C3TA 1U5EA 4WJQA 1Q1OA 1Z5SB 5DHFB 3KUDB 2K8HA 2NPTB 4GMVA 1H4RA 4MJSA 4HB2B 3SHQA 2ZVNA 4FJZA 2KQ7A 4DDID 4FHJA 2YT0A 2FJ9A 2GJYA 1E8WA 1WZ3A 3OJ3A 4F1SA 3KVFB 4LDTB 4C0AA 2O6VA 1QC6A 3DBSA 1P98A 3RZFA 2BF8B 3V60A 2RSGA 2LGYA 4HB3B 3M62B 2N9XA 2M1MA 2H7EA 1M7RA 3IBEA 1NDDA 3ML8A 2N7EA 1UBIA 4ANUA 2HRJA 4B6WA 2RNRB 2LJ5A 4I6LB 2HE7A 3CXBB 3QHTA 1QZEA 4A6HA 2ZVOA 2J0JA 1M7EA 2FJLA 1ZSQA 1TQZA 3JVZX 1WGGA 2LKOA 3L0WB 2G45B 1RJ2A 2LVQA 1KZ7A 4EEWA 3SUZA 3WAMA 2CB8A 3FSSA 2ZJDA 4B9KA 4GXBA 2W2XC 3RCZA 1TZ1A 1XR0B 1L7YA 3D8DA 3PPAA 2KX3A 3U7DA 3D8EA 3L08A 2MBQA 3KRXA 1GG3A 1YD8U 3AJ4A 2LOZA 1EF5A 1AARA 4K1RB 2XQNM 4W9IA 3KYDD 1WJNA 2LVPA 1WXAA 3KW5B 2N1VA 1WX7A 1F9JA 2MLBA 3PSCA 2C5LC 3IG3A 4FJYA 2HTHB 4HATB 3KY9A 1X1FA 4KIKB 4NY0A 3TBLD 4IC7B 2AL3A 3TVVA 3WAOA 3Q3JA 5AZFA 1FXTB 2Y8FA 4KHBB 1ZVRA 4P7IA 5IA7A 3APCA 2RGNB 2I1JA 4IM0A 2N0YA 2CHZA 3PRPB 3OANA 2QHOA 2N7DA 2DHJA 2BWES 1G6JA 5D7GA 2A5UA 1M94A 2ZNVB 2DYQA 2W9NA 3QQ8B 2HTHA 3IHPC 3V6EB 1DBHA 2AWTA 3PHXB 2M8SA 3U8ZA 3UQBA 4M8MA 2KLGA 4GMXB 2R2QA 1BT0A 4WWOA 3KUCB 4NQLB 2DKQA 1X1GA 2MW5A 3ZLZA 2DZKA 2KLCA 4TYZA 3A9JB 3AI5A 2LGXA 1J0WA 1WXSA 3W1YA 4XX5A 1I7AA 2Z0OA 4MGYE 3I3TB 2PE6B 3WAPA 2O6VD 4E3CA 3LJ3A 2R2OA 4BOSC 1AWEA 3MTNB 4DHJB 4WJOA 1E8ZA 3X23A 4A5KA 2L8JA 2KC2A 1WGHA 2WX0A 2FNJB 3QARA 3PS6A 5C5BB 1H8CA 1LW3A 2LRWA 2KKCA 2H7DA 2DAFA 5DPSA 1IYFA 2HJ8A 2K8BA 1EVHA 2DYBA 1ZM0A 4EZJA 1NTYA 2KTRA 2O2VA 5G2NA 3R7RA 1J8CA 4X57B 3ALBA 4Z2MB 4GDKB 4HAVB 3BY4B 4HCPB 2IO1B 2NBWB 2Z59B 5CX3A 5TR5A 2I5FA 2FDQA 3RCPA 3EECA 2R0DA 4M0WB 1PFJA 3VFKA 3N30A 4G50A 2C7NB 3BJIA 4HWIB 3N32A 4DDGD 5J17A 5JHAA 1KZGA 5HE3A 5DIFB 4AJWA 5BO4B 3UF8A 2GBRA 4MY6A 1Q5WB 3NSUA 1KOTA 2D9VA 5EDSA 2GOWA 4GDLB 4Y94A 4GDKA 5KQ1A 1V86A 4HB0B 2KQSA 2RUKB 2C7HA 3VHTC 3V5WA 2N9PC 4XWXA 2C9WB 1R4MI 2IFSA 2KCJA 3UZTA 2V76A 5CLQB 4II3B 4M8NA 4XC2A 1LFDA 2V1YA 5DHAB 3TO1A 3ODOA 2GBNA 1LM8B 3B1LX 1NU2A 1U5DA 3V6CB 3PP2A 2KOXA 2XK5B 4BBNC 3ZNHB 2G3QB 4W9DA 5C16A 4IM2A 5J3QA 2AEHA 3H1UA 2N1WA 1UZXB 2MA9B 5JHBA 3GYOA 2KDIA 4HPMB 5D3WA 5KCVA 2D3GA 2G4SA 1EGXA 2MSED 2RQ1A 2P0DA 1K5DB 1UPQA 1LB1A 1VCBA 3ONSA 2KGXB 1WF9A 4GB9A 4W9LA 2MP2B 4FA6A 2MX2A 1WJ6A 4CYEA 3SD5A 3PTFC 2IY1B 2Z0QA 2KN5A 1R4NI 4H8SA 1P5TA 3VH3B 5L95C 3VAWA 2UYZB 1D3ZA 4EMOA 4HHVA 2IZVB 1UNRA 2FCQA 3ULBA 3SNHA 3L16A 5FR6A 5D94A 2JXXA 3M1IB 2LWPA 3T8MA 1V5OA 2JP2A 3DXDA 4EKUA 1WR1A 2COPA 2D10A 2IBIB 3DCGA 3NHEB 3DOWA 4IFSA 4F7GA 3ML4A 4KZCA 3JYUA 4PS7A 2G35A 4EOYA 1V49A 2KHWB 3D8FA 1WJUA 3WA0A 2EMSA 2YF0A 3UQAA 2BWFA 5KHQA 3PV1A 1EUVB 1J19A 1GC6A 2WDTB 4ASWC 2YS1A 2KXJA 2NCNA 4G3XB 1NBFC 3M3JA 4A3PA 2VRWB 4DWFA 2IYBA 4G0NB 1DDMA 4BBNF 4EFOA 3EHVA 3KH0A 3ZVVA 3HK0A 2O6VB 4AP4C 4HAWB 2MFQA 1YX5B 1WXMA 2LBBA 2YLMA 2KZRA 1RRBA 1WYWB 1OQYA 1VD2A 1SE9A 2K2JA 4EZKA 4MGIE 2L0FA 3ZRFA 4W9JA 1V6EA 1GNUA 3ZRCA 4MELA 4GSWA 2DZMA 2ROZB 2BKFA 4JLCA 2CODA 1Q67A 2FAZA 4IWQA 1OQNA 3NOBA 2JF5A 4D0NB 2KDEB 2GS0A 1WI1A 2COCA 4E71A 1FGZA 1X86A 2K25A 2N4FA 3JW0X 4KDIC 1WGDA 4AJYB 2COFA 4A3OA 2NS5A 2IY0B 2KX0A 4FN2A 2CS4A 3OLMD 3TIXA 1EAZA 2ZPYA 3LDZE 2P0HA 1J0GA 1WGYA 1X1MA 4IW0A 1H10A 4AWJA 3GOEA 1WM3A 1MIXA 2DN6A 4KAXB 1U5FA 2DHKA 3A33B 5AZHA 4LJPB 2CY4A 2JPHA 3TW1A 2FUHB 4EUTA 4F7ZA 2LULA 4GN1A 3U30A 4HB4B 3SYXA 4I6PA 5FI0A 4BKSA 5DI9B 2MDXA 1P0RA 2KMAA 1MK9B 4WJ7A 2KUPA 2NBUA 1NTIA 4ZRJA 3VXWA 2V3SA 2MCNB 2WX1A 3DBHI 4NPNA 1IPGA 2C60A 4XZ4A 1ISNA 1PQSA 3L10B 1WX8A 1NTVA 3HHMA 2RSUA 4JGHB 2YVCA 2OJRA 3W1SC 1FGYA 3RULA 4PYZA 1YIWA 1Y19B 3PGEA 4KZ0A 2D9ZA 3QJZA 4W9FA 5DPRA 3O65B 2KD0A 4BFRA 2DZJA 2R09A 3PEGA 3EFUA 1WIAA 4HPLB 2YT1A
chains in the Genus database with same CATH superfamily
2WXRA 1ZDXA 3KUZA 2J0MA 2DKPA 2SAKA 1JMLA 1WXQA 3NUHB 1WJMA 2MQJA 4USAA 2RPQA 1WG7A 3Q8FA 2KFKA 3NZUA 4K7WA 2MH7A 1KI1B 2QKMA 4WJPA 5LXIB 3AECB 4HEA1 2IGHA 5FKAC 3AM9A 1GGOA 3MHSD 2KWDA 3B08A 1M4VA 1R4MB 3AE5B 4CHMA 1C4AA 1KM7A 2LOXA 1QLBB 3APDA 4LNKA 1ET6A 1K8RB 4ZDVA 4ILGB 2FIDA 3BYYB 3AE3B 1DYNA 2V4LA 2FIFA 4C56C 1FIQA 2WU2B 1GJZA 2PIAA 1IRSA 2D9WA 1FNWA 2KJRA 3M95A 1FCCC 2O2VB 2KTRB 5JVLA 4MDKE 3SFDB 4URKA 2LXAA 3AN1A 1PYWD 2Z0EB 1W1HA 3MDBC 2BKRB 1XD3B 2JUOA 1ZKHA 4JWSC 1FNVA 2M14A 3ZGZA 4GOCA 2RGFA 4ICVA 3EGRA 1N5XA 2CU3A 2LASA 1HZ6A 4KHAA 3ZJVA 4FXCA 4TQ1A 2D3BA 3AEGB 4ANXA 1V5PA 2DHZA 4MGKE 2XN9C 2LRUA 2G1EA 2W2XD 1Q10A 3FVCA 4A20A 2VH2A 2OQBA 2MWSB 4MH0E 2RR9A 2JT4B 4MSQB 1EF1A 2GCJA 1WX9A 4WWNA 4MM3B 3ZDTA 3PG7A 1I35A 2PZ1A 4ACFA 3DVNV 5IRSA 4ZYNA 2N9EB 2KK8A 3DQVA 3DVNU 2PE9A 3P2BA 3VR9B 3G9WA 1KLUD 1UELA 3TJPA 2YS5A 2EC1A 1ENFA 4JK7A 3AXCA 4FLHA 1VZ8A 2K00A 2CJNA 1YQBA 5TSSA 1F1HA 4GIVA 3PRZA 1KFYB 1FO4A 4ZHPA 4JK8A 2E2XA 2K39A 4K2PA 3ZXVA 2M38A 1TY2A 4BKSD 1KLGD 1BUIC 2A4ZA 2WXHA 3QC8B 3UIPB 3U12A 4RM8A 5GMVA 2CRFA 1DDVA 1FOEA 3APFA 1WGUA 2INPE 3Q8CA 4NAMA 3RZWC 4FBJB 3CF6E 1IBXB 1V5MA 4MM3A 2INCC 1JRPA 4PNKA 3CMMB 1Y8RC 3NZSA 1GB4A 5CHWA 3NWFA 1BXTA 3N9YC 4WQMA 1NEKB 1QOFA 1UGMA 2K1FA 2ABDA 2NVUI 3QK0A 1CQVA 3MPXA 4K2OA 3AEEB 5E6JA 1GC7A 5E6PA 3PZDA 2I38A 2BB6A 5MPOA 1SJHD 2CR5A 3HIZA 3MC9A 4XWWA 1PUTA 2IO0B 1MPEA 2RD0A 3HUIA 2QCZA 2KO3A 1BTKA 4NNJB 1WJ4A 4MK0A 3IAS1 1JROA 4N58A 1MIZB 1OTRB 2FJUB 2BW2A 1YQ3B 1FHOA 3PLUA 1I2HA 4KVGB 2Y5CA 4IWPA 1STEA 2IGGA 1C79A 3FC4A 2MBHA 2L1CA 5J2RA 3U4EG 3AULA 1U5GA 1QQGA 2FCSA 3P4QB 2ACZB 2V0GA 4WWPA 1S3SG 3PSEB 2ROVA 2XEWA 3VR8B 1IBXA 3A8PA 4S17A 3ENEA 1WGRA 4IG7B 2I5CA 1TTNA 2WQYB 1WMHB 1OGWA 5IJMA 4L23A 3ZUNA 5KHOA 4K7UA 4ICUA 4WSFA 5C79A 4M02A 1P7FA 2XBBC 1S1QB 1IP9A 1TBEA 5I2MA 2Y5BB 2ZEQA 4CHJA 2KANA 1PGXA 3PREA 1HBKA 1JWSD 1E5WA 3RNEC 4HK2A 4HDOA 5AEKB 2MRPA 1IUEA 3N3KB 3X0WA 4HXDA 3ZDMC 4GNKB 4RGOS 4L1RA 3T9LA 1YN5A 4WIPA 2Y7BA 2DZIA 3L54A 1N62A 2BGFA 2KJHB 2JZZA 2LZ6A 2MJ3A 4HVBA 2BS4B 1GB1A 2NR2A 3SBGA 2BPSA 2KAJA 4A8XC 3KRWA 1E8YA 1WMHA 4LJOB 1QF6A 3P1MA 2DFKA 5HI1A 2RLOA 3V61A 2DAJA 3O96A 1UD7A 1UNPA 4ZRKA 3PT2B 3OJ4B 5JXVA 1EWYC 2CQUA 1TKEA 4O1NA 2Q13A 4HJKA 3TFMA 5L81A 1PDXA 1XXGA 1C1YB 4NZLB 4A6KA 3TL5A 1WI0A 3PLVA 3FLVA 1ZXIA 5I4DA 1DROA 1VBHA 3IT4B 2MBOA 3LJUX 4L6EA 3BYTB 2KC1A 1XLNA 5CHVC 5C23A 4RGTA 2KIEA 1V97A 5HE2A 1E90A 1HTOA 2KN4A 1E7PB 3SEBA 2JRIB 5AUKA 5EE9A 3AEFB 2K0PA 4KDLB 2YRYA 2QEJC 3VDZA 3K9PB 5I2SA 5IP4D 3TSSA 2W54A 1PLSA 4KHOA 2LEKA 3S2AA 1WR6E 4HLEA 2NMBA 2KWCA 3PVLA 1WM2A 2JRHA 2Z14A 3H7SA 3NVWA 3A1QB 1GUAB 1QT9A 4WVFB 1WFYA 3QWMA 4LLGM 4CSQA 1ZYIA 3WIMA 2LYDA 3GZNI 2QIEB 2ZPNA 1ZW7A 2ONQA 3VIAA 4C7YA 4NSWA 2SEBD 4I6NB 4PK1A 3PVWA 1SJED 3WYFB 3NS8A 1K53A 3SV1A 2L52A 4MSMB 2YT2A 4JKGB 4HAYB 2L3ZA 2D2QA 2DX1A 4EZLA 2P0FA 3R3MA 1OY2A 4DXAB 3ULCA 1EWCA 2WP9B 4NAWA 2D5GA 3VVWB 3R7QA 5FI1A 1JRUA 2WU5B 2BYFA 3A9KB 3HM3A 4GLSC 1V81A 2M0XA 4FULA 4GPTB 3I9V1 3CSTA 1MK7B 4K3CA 2LXCA 4IOYX 4GZUA 3OG5A 2LFIA 1UWMA 2PJHA 1E9MA 4BKGA 3JSVB 1SE3A 3A1QA 2L2IA 1OEYJ 4TKNA 4KX6B 4MEMA 2W82A 1UBQA 2QKLA 3DVGX 1RAXA 1YOVB 5JLJB 1L6UA 1WYGA 3DVGY 5J3TA 1JWBD 2L0TA 3F5RA 1WRDB 3ZYYX 2WYQA 4DXGA 4IKGA 2IPKD 4WURA 5DH9B 1OQRA 2PTLA 4JKGA 2BCJA 2KIGA 3D32A 4NJ7A 1Y5OA 4GU2A 2NBVB 1ZOYB 2FE8A 4PS8A 3N7CA 5CLLB 3A9KA 4HAXB 3TMPB 2Z4DA 1OEYA 3NWAA 2X0SA 1XKEA 3RNGC 3HM6X 1P9DU 1V80A 2E3TA 4KSLC 1XX0A 1A5RA 3ZTCA 3B77A 5CTRC 1U2BA 3HVDA 1ROEA 2IYDB 3AE2B 5D2MB 3JSVA 5JZEB 2UZRA 3A4RA 2VRRB 4F7UP 4RM9A 1P1AA 2ZCBA 1WGQA 4DHZB 5LOPB 2JWZA 1TS5A 2KVRA 3H7PB 1LXDA 5LXHA 1Z87A 2ZCCA 4RMAA 5JHHA 1HE8A 3E56A 1MKEA 2NTSA 1SEBD 3C0RB 3WCQA 2PKOA 3E9PA 4D6WA 3ZO5B 2NPTA 5EFXA 1MAIA 3VOQA 2NBVA 1K52A 3R66C 1U29A 1UNQA 2DLWA 3ZIMA 1AYFA 2WWZA 4J6IA 2D3CA 5D6JB 3VRBB 2JZPA 3DHGC 1JW9D 1Z2MA 5DPTA 3Q8EA 2OHFA 3RN9C 3RUIB 2L7RA 4RGMA 2WXFA 3T3OA 3H9DA 3VTUA 3VH4B 3VTWA 4A6FB 3FEHA 2HDEA 2REXA 3MJWA 2UZSA 5LONB 1K5GB 1HEZE 4ZRQA 3URYA 1E7UA 3W1SA 2D9XA 2L00B 2L05A 4CHKA 3H7PA 1ZDVA 1F52A 4G11A 3PVUA 4C80A 3ECIA 2GBKA 1L2NA 4E74A 5C6RA 3OAWA 1V5UA 2PEAA 1VJKA 1XLQA 4GOUA 1OQQA 3PHWB 3RT3B 5C3JB 2J53A 2HD5B 3ODWA 2IO2B 2KFKB 4OHJA 3RNAC 4YWGG 4HCNB 2YSZA 1V1OA 1FRDA 2RPVA 1T0SC 3CSFA 2X18A 4NQKE 3T3NA 2N23A 3P6AA 1LQBA 2DYOA 2CU1A 3UGBB 5IN7A 3Q8BA 4GGQA 2PPHA 2L76A 3CIRB 3HSAA 1KRHA 1J7CA 1YJJA 4JL9A 3IFWB 4EJNA 3MC8A 1L5PA 3ZXRA 5JH5C 5HKHA 1TYGB 1SGHA 3W5VB 1RLFA 3SDLC 3RMKC 4HAZB 3UI3A 4A6FA 1WZ0A 2KFJA 1T5XD 4MT7A 4LNFA 5LLIA 3SU8X 1WJ1A 3CIKA 3W2DA 2Z0PA 1N6ZA 3SBTA 3PRMB 2NZ8B 3M63B 2RDHA 3WANA 1D5MC 2DA0A 3K9OB 4BOZB 3ZKJC 1MG8A 2OOBB 2YEPB 1FB8A 4B6HA 3KZ1A 2FCMA 2BYEA 3KWLA 5D3IB 5H92C 1ZGUB 5G5GA 1P6SA 2JXTA 3AEBB 1YX6B 2CAYA 3UIOB 2UVMA 2KDFB 4A90A 1HA5A 3VQIA 1WWTA 4WWMA 4K17A 3B9JA 3ZQ4A 4OVVA 3FP5A 5E6NA 3L17A 5J3YA 4LK0M 3N1XC 1WE7A 2V4IB 2WH5A 4DX90 3ML9A 3I63C 3NY5A 5HG2A 3Q2AC 4P1BC 3VUXA 3NWDA 2M56B 3EUB2 3RD2A 2DYMA 3TEWA 1W1DA 4N6EB 1WRIA 2D07B 2ASQA 2WXOA 2LUEA 2DHIA 3DDCB 1U4AA 1K51A 4KIKA 5EE3A 4DBGA 4BKTA 2WXJA 2K2UA 2GBJA 3ZJUA 1BAKA 2ADZA 2P8VA 2OTXA 1YJIA 2LI5A 4K7SA 3N1YC 1QQRA 1F2RC 1HB8A 5G55A 3ZW3A 1P3QU 1WY8A 1YMHE 2JVCA 3VTVA 1DYQA 4JKDA 2XNAC 3QX1A 4ANVA 4N9F4 2Z0DB 3ZTDA 1E8XA 3ZNZB 3QWZB 1B55A 2LGSA 2JSVX 2E6XA 2VKIA 2K6QA 3FAHA 5D3VA 3KYCD 5DPWA 4W9CA 2D11A 3EPYA 1P3RA 2D4QA 5GXGB 4FHKA 3F0WA 2MBBB 4C7ZA 3T06A 1K50A 2D9YA 3AE6B 4ILHA 4IWOA 4JKCA 2AX5A 1LO5D 1UUPA 4YONA 4BBKA 5T8IA 5KQ4A 1MPHA 2BQQA 4LNOA 1I4HA 1MI1A 1LGRA 4DBBA 4II2B 3AU4A 2FCNA 3P7ZA 2EKIA 2DYNA 2N9LA 3A9JA 2NTTA 3A98B 2ZNVC 1N5WA 3DXCA 1JWAD 3FM8C 1X05A 3HW2B 1F2RI 1R4NB 1NI2A 2BT6A 1V9JA 2UWQA 2WGSA 3Q14C 3AV8A 5C1ZA 4LDTD 1I4RA 2IDYA 3ZNID 1QOBA 1J7AA 4W9HA 4PQ0A 4ZRIA 4C4VB 2ELAA 4L1BA 2DX5B 1FD6A 4Z2NA 3DPDA 3VUYA 3LYYA 2J52A 3IXSA 3ODXA 3ENBA 1V61A 1TZOA 3B0AA 1SB3C 2PVGC 1B9RA 2X8XX 4HRSA 3GYPA 3ETRA 3V05A 1SXTA 3HVZA 1MG4A 4JE3B 3Q3FA 5C5BA 4IM3A 2JU6X 2KJ6A 1RRPB 2M17A 1FMAD 4LTUA 5BYQA 5E6OA 1TGZB 1ZC3B 1JALA 3AE4B 2J0KA 5HE0A 1AW7A 1SHCA 2IO3B 2AYOB 2V9HA 3NS1A 4IOIE 4CO7A 3E9OA 1ST7A 4AUQC 3BVZA 1OMWA 4TV3A 1V89A 2GMIC 4F7HA 1BTNA 3U7ZA 2LVOA 2G4DB 3H6NA 1BMLC 3GZNB 1XQQA 3O13A 4EE2A 1TJEA 5M4YB 1WH3A 2KDBA 2CKHB 5DCNA 1WGKA 4ZYSA 1FHWA 1SIFA 2HTME 2AL6A 3HRDD 4C4VA 3DXEA 2JYEA 4KSKC 2EKEC 2N9KA 2DX5A 4TQ0A 4TSSA 3OHMB 4TUUA 2RVBB 1XODA 4MGZE 2KT7A 1FFUA 1V88A 5AZGA 3WALA 2WNMA 2IJ0A 4WQOB 2W2WA 3VRAB 5BYRA 1UPRA 1X11A 3HQCA 3AU5A 4HJGE 2WXPA 2GBMA 4WAAA 5CHFA 2V3PA 3L13A 4HDQA 4H2AA 2KWUB 3NVYA 4RF1A 1KLVA 4AOFA 3SO6A 5IO9A 2DENB 2Y8GA 4KGTA 2L1AA 4RGNA 2KMCA 1CMXB 2LGDA 2JZ3B 3DCXA 4PYUA 2COAA 2EMTA 5D3YA 1ZUD2 2YEPF 3ZNGC 4B95A 2RDBC 1V1PA 1BWNA 4A9AA 1EO6A 4KV2A 1E10A 2J42A 2GRIA 4GDLA 1JDEA 3TEXA 1B1ZA 3UINB 1YJ1A 3QA8A 3BINA 3QAQA 3V62A 2YS3A 4DK5A 4FADA 1FPYA 3NG0A 4DHZE 1T0YA 4AS1A 3QIJA 4IUMB 1XD4A 1WXVA 3QCAA 5L83A 1WE6A 2DNFA 4YSXB 3QBVB 4W9EA 1D4BA 2KTFA 1Q0WB 1WVHA 2ZZPB 1PMSA 2K8CA 4JIOU 3IVFA 2DTCA 5BMHA 2ELBA 2B3AA 4K81A 1I4QA 1MHHE 1TXDA 2G9HD 2I1KA 3A4SC 4BVUC 2KACA 3U52E 4ANWA 1SE2A 3AE1B 3VUWA 2MJDA 1FAOA 2J7QB 4WJNA 1TJ6A 3DWGC 2M4NA 2CHXA 3P4RB 2XK5A 2GCLA 1XCGA 2JYTA 1DDWA 1JWUD 3LB8C 1UH6A 2VSZA 2ICIA 2B76B 4JQWC 5HE1A 1XT9B 2HJ1A 4NAWB 5JP4A 4W9KA 2PW9A 3GE8C 2BVCA 3NZ3A 3B2FA 3TEZA 5H8YE 1E7VA 2INDC 1E0ZA 4ZRPA 2WXQA 3L4PA 4ARCA 4WAFA 4LCDE 4IAPA 3SR6A 1U27A 1ACAA 3ZVRA 1A70A 1D6EC 2EJ8A 4OVZA 2FUG1 2BYVE 3GP7A 1L0XB 2KNBA 2CHWA 2MP2A 4DHJD 2J59M 4FJVB 4W9GA 1ZE3D 2QDFA 2LG1A 1N60A 2KWVB 4S0RA 4HAUB 3DBLI 2LGIA 5EE0A 2CY5A 1QOGA 2AQ3B 5IKCM 1RFAA 5IAAC 3A8QA 5J18A 5D27A 1ZC4B 2QSDA 4MJSB 3RYTA 1GPXA 4AQ7A 5D3XA 1V2YA 3DBHB 1V5TA 5HFYA 2K22A 3DBRI 2VZKD 2K6DB 1HB6A 4DX8A 5JHGA 1ACCA 4C00A 4F8CB 1N3HA 2C7MB 2JY6A 4YL8A 1NVLA 3TCAA 4OVUA 1W1GA 1FHXA 4UDUC 1C78A 3KLSX 5GOWB 1KJTA 1DOXA 5D3DA 2KVZA 3EC8A 1UEFA 2LD9A 4NJ6A 3KSYA 1QOAA 2MBEA 3RPFC 4B0EA 1AQCA 1I42A 1C77A 2MWNB 2MKRA 2I2YA 3U2SC 4PS3A 1C3TA 1U5EA 4WJQA 2BB5A 1Q1OA 1Z5SB 3PO0A 3R2TA 5DHFB 1YQ4B 3KUDB 3RNCC 2K8HA 2NPTB 4GMVA 1PGBA 4RCOA 1H4RA 2JWUA 2KYWA 4MJSA 4HB2B 3SHQA 1OFFA 1QILA 4JWUC 3PZ8A 3MC0B 3C19A 2ZVNA 3CWIA 4FJZA 2N7JA 4XWTA 2KQ7A 4DDID 4FHJA 2YT0A 1J7BA 2FJ9A 2GJYA 1E8WA 1PFDA 1WZ3A 3OJ3A 4F1SA 2WDRB 2WS3B 3BK2A 3KVFB 4LDTB 4OZCA 4C0AA 2O6VA 1QC6A 1TIFA 3DBSA 1P98A 3RZFA 3NW8A 2BF8B 3V60A 2M0AA 2RSGA 3RFZB 2LGYA 4HB3B 3M62B 2N9XA 2M1MA 2H7EA 1M7RA 3IBEA 1NDDA 3ML8A 2ON8A 3DHHC 1MFWA 2N7EA 1UBIA 4ANUA 1VZ6A 2HRJA 4B6WA 2RNRB 2V3NA 2LJ5A 1TS2A 4HKZE 4I6LB 2LJIA 4XGAB 2HE7A 3CXBB 3QHTA 4N59A 1QZEA 4A6HA 2ZVOA 4JK9A 1KF6B 2J0JA 4OT1A 4DIXA 1M7EA 2FJLA 1ZSQA 1TQZA 3JVZX 1WGGA 2DWQA 3NJTA 5LNK1 2LKOA 3L0WB 3DWMA 1D5XC 2G45B 2M19A 1RJ2A 2LVQA 2Y3AA 1KZ7A 2LUMA 4EEWA 3SUZA 3WAMA 4OZAA 2CB8A 3LXFA 3FSSA 2ZJDA 4B9KA 4GXBA 2W2XC 3RCZA 1MHXA 1FFVA 1TZ1A 1I4PA 1XR0B 1L7YA 3D8DA 3PPAA 2ZKMX 5FK9C 2KX3A 3U7DA 3D8EA 3L08A 2MBQA 2IGDA 3KRXA 4J3OD 1GG3A 1YD8U 2WDVB 2DLBA 3AJ4A 2LOZA 1EF5A 1AARA 1ET9A 4YTPB 4K1RB 2XQNM 4W9IA 4XDCA 3KYDD 1WJNA 3BVMA 2LVPA 2WXLA 3BK1A 1WXAA 3KW5B 2N1VA 1HQRD 1WX7A 1F9JA 2MLBA 3PSCA 2FBWB 2C5LC 5LG4B 4JKBA 4RF0A 3IG3A 4FJYA 2HTHB 4HATB 4QXAB 2KQ4X 3KY9A 1T0QC 1ZXHA 1X1FA 4KIKB 4NY0A 4QAYA 3TBLD 4IC7B 2AL3A 3TVVA 3E9SA 3WAOA 3Q3JA 5AZFA 3R8BA 1FXTB 3BVGA 2Y8FA 3Q8AA 1CJEA 4KHBB 1ZVRA 2UU7A 4JPSA 4P7IA 5IA7A 3APCA 2RGNB 3GB1A 2I1JA 1VR9A 4IM0A 4NJCA 2N0YA 5BMGA 2DBYA 2CHZA 3AE9B 2KMMA 1NVID 1DOIA 4XDDA 3PRPB 3OANA 2QC8A 2QHOA 1HXYD 2QJLA 2GLSA 2DHJA 2BWES 2N7DA 1G6JA 5D7GA 1DOYA 2A5UA 1M94A 2ZNVB 2NMQA 2MEKA 2DYQA 2W9NA 3QQ8B 2HTHA 3IHPC 3V6EB 2RDGA 1DBHA 2AWTA 3PHXB 2QMTA 4Q2JA 2M8SA 1ZP0B 3U8ZA 1TKGA 3UQBA 3AMZA 1FM0D 4M8MA 2W3SA 2KLGA 4GMXB 2R2QA 1BT0A 4WWOA 3KUCB 2KUQA 3RNFC 4KHBA 1NYRA 2RRFA 4NQLB 2DKQA 2K9XA 1X1GA 3AB5A 2MW5A 3ZLZA 2DZKA 2WXIA 2KLCA 4TYZA 3A9JB 3OWEB 1L4DB 2LHDA 3AI5A 2LGXA 1J0WA 1WXSA 3P42A 2N0SB 3W1YA 1TKYA 2W3RA 4XX5A 3MFGA 1I7AA 2Z0OA 4MGYE 3A58A 4BZAA 2ZW1A 3FKYA 3I3TB 2PE6B 3WAPA 2O6VD 4E3CA 3LJ3A 2R2OA 4BOSC 3AEDB 1AWEA 3MTNB 1RM6C 1I4GA 3BZDB 4L2YA 2WLBA 1D5ZC 4WJOA 4DHJB 1E8ZA 1KBLA 1YN3A 1SF0A 1P7EA 3X23A 4A5KA 4HPPA 2L8JA 2KC2A 4ILJA 2BTEA 1WGHA 2GI9A 1IGDA 2WX0A 4KGSA 2FNJB 3QARA 3PS6A 5C5BB 1V8CA 3Q3MC 1H8CA 1LW3A 2LRWA 2KKCA 2H7DA 4QJ3B 3GE3C 3KWVA 2DAFA 3IT6B 4HROA 3TUOA 5DPSA 1IYFA 3B2GA 2HJ8A 2K8BA 2VZKB 1EVHA 2DYBA 4HSIA 1R7SA 3N1ZC 1N61A 3RI7C 1ZM0A 1UWXA 4EZJA 1NTYA 2KTRA 2O2VA 5G2NA 1VBGA 3R7RA 1J8CA 1XCTL 4X57B 3ALBA 1UF0A 4Z2MB 4GDKB 4HAVB 2INNE 3BY4B 3W5UB 4HCPB 2IO1B 2NBWB 2Z59B 5CX3A 4BAXA 1T0RC 5TR5A 2I5FA 2FDQA 3RCPA 3EECA 2R0DA 4M0WB 1C9FA 1EU3A 4YSYB 1Y56A 4MH8A 3I5JC 1PFJA 3VFKA 3N30A 4G50A 2C7NB 4KKJA 3BJIA 1T3QA 4HWIB 1SSNA 3N32A 2Y5PA 3AE8B 1YN4A 4DDGD 5J17A 1XLPA 4A6QA 5JHAA 4JKAA 3H8HA 2R82A 1T6BX 1KZGA 1UGJA 5HE3A 5DIFB 4AJWA 5BO4B 2OJWA 1V1PB 3UF8A 2GBRA 4MY6A 1Q5WB 3NSUA 1KOTA 3MJ5A 2D9VA 2L83A 5EDSA 2GOWA 4GDLB 4Y94A 1NI3A 1SE4A 3KQ4A 4GDKA 5C2TB 4KGRA 5KQ1A 1V86A 3I57A 4HB0B 3DBLB 2Z59A 2KQSA 2RUKB 2C7HA 3VHTC 2PVOD 3V5WA 1JQ4A 2N9PC 4M0WA 4XWXA 2C9WB 1R4MI 2IFSA 2KCJA 4ZOHC 3UZTA 2V76A 1YNTE 5CLQB 4II3B 4M8NA 3NVZA 1GOZA 4XC2A 4P6VF 1LFDA 3AE7B 2V1YA 4QJ5B 3DBRB 5DHAB 3TO1A 3ODOA 3ZJTA 2GBNA 1LM8B 3B1LX 3EFCA 1AN8A 1C76A 1UNSA 1FXIA 2BYTA 4LNNA 3J9CA 3E66A 1VRAB 1SBBB 4KKIA 1NU2A 3W9CB 1U5DA 3V6CB 1KC7A 3PP2A 2KOXA 2XK5B 4BBNC 3ZNHB 2G3QB 4W9DA 5C16A 4IM2A 4US8A 5J3QA 1ZPSA 4RNAA 2AEHA 3H1UA 2N1WA 5BYSA 5AUIA 1UZXB 2MA9B 2TSSA 1F77A 5JHBA 3GYOA 2KDIA 4HPMB 5D3WA 5KCVA 1L4ZB 1L0VB 1RFKA 2D3GA 3Q6BA 2G4SA 1EGXA 4CQNA 2MSED 2RQ1A 1EM7A 2P0DA 1K5DB 3V3XA 1UPQA 4M01A 1LB1A 1VCBA 1E6EB 3ONSA 2KGXB 2D3AA 1WF9A 4GB9A 4W9LA 2MP2B 4FA6A 2MX2A 1GAQB 1WJ6A 4CYEA 4YXDB 3SD5A 3PTFC 1TS3A 2IY1B 1NENB 3FILB 2Z0QA 2KN5A 3E9LA 4P1CC 1R4NI 4H8SA 1TS4A 1IGCA 2KDMA 1P5TA 1F0ZA 3VH3B 5L95C 3VAWA 2UYZB 2WXGA 3AH7A 4XE0A 1D3ZA 4EMOA 4HHVA 2IZVB 1DIKA 2WDQB 1UNRA 2VH1A 4OW0A 2FCQA 1FCLA 3ULBA 4OSNA 3SNHA 3L16A 5FR6A 5D94A 2JXXA 1VLBA 4D2KA 3M1IB 2LWPA 3T8MA 1V5OA 4K3BA 3P63A 2JP2A 3DXDA 2AQ1B 4EKUA 3Q3OC 1WR1A 2COPA 1PGAA 2D10A 2IBIB 3DCGA 3NHEB 3DOWA 4IFSA 4F7GA 4ZHOA 2BBCA 3ML4A 4DQOC 1KTKA 4KZCA 3JYUA 5EE1A 4PS7A 3FILA 2G35A 4EOYA 1V49A 2KHWB 3D8FA 1WJUA 1FRRA 3BIID 3WA0A 2EMSA 3Q3NC 3Q69A 1KH0A 2YF0A 3UQAA 3TEYA 2BWFA 3EA6A 1NYQA 3PV1A 5KHQA 1EUVB 1J19A 1XCQL 3P4SB 1L6VA 3MHZA 1GC6A 2WDTB 4ASWC 2YS1A 2K5PA 2PLPA 2KXJA 2NCNA 4G3XB 1NBFC 2QILA 2WHIA 2L32A 3M3JA 4A3PA 2VRWB 4DWFA 2BS3B 4JX1C 1EU4A 5IOIA 2IYBA 4G0NB 1DDMA 3P4PB 4B0MA 4BBNF 4EFOA 1RYJA 3EHVA 3KH0A 1CK1A 3ZVVA 3HK0A 2O6VB 4AP4C 2PMVA 4HAWB 2K8EA 2MFQA 4IDIA 1YX5B 1XEEA 1WXMA 1C4CA 1FEHA 2LBBA 2YLMA 2KZRA 1SIJA 4P16A 1RRBA 1RWSA 2GB1A 1WYWB 1OQYA 4XYCA 1VD2A 2MHJA 1SE9A 5HHDG 2K2JA 1T77A 4EZKA 4MGIE 2L0FA 3ZRFA 1XLOA 1MI0A 2R61A 2Q5WD 1XF5L 4W9JA 1V6EA 4REZA 5G5HA 1GNUA 1DGJA 3ZRCA 4MELA 4GSWA 2DZMA 2ROZB 2BKFA 2W55A 4OZBA 4JLCA 1VDVA 2CODA 1Q67A 2K49A 2FAZA 2K3UA 4IWQA 1OQNA 3NOBA 2JF5A 1I7HA 4US9A 4D0NB 1I4XA 2KDEB 4M00A 2GS0A 1WI1A 2COCA 4QJ4B 2H88B 4E71A 1FGZA 2JQRB 1X86A 3R2IA 4YTNB 2K25A 2N4FA 2WXMA 3JW0X 4JKEA 1HTQA 1C4PA 4KDIC 1WGDA 4AJYB 2COFA 4A3OA 1TY0A 2LHEA 2EELA 2MJEA 2NS5A 2IY0B 2KX0A 4A55A 4FN2A 2CS4A 4JKHA 2ZW0A 1AWDA 3OLMD 3TIXA 3C8YA 1EAZA 2ZPYA 3LDZE 2P0HA 1J0GA 4WH4A 4R3DA 4YTMB 1WGYA 1X1MA 1HZ5A 1MVKA 1N63A 4IW0A 3NRZA 1H10A 4AWJA 3RNBC 3SFEB 2JX5A 4TMAB 1CZPA 4YSZB 3GOEA 1ESFA 1WM3A 1MIXA 4ARIA 2LMCA 2GUMA 2WXKA 2OEDA 2DN6A 4KAXB 3BWUD 4MACA 1U5FA 2DHKA 1JWMD 4LNIA 5BMIA 1TT5B 3A33B 5AZHA 4LJPB 2CY4A 2JPHA 3MP9A 3TW1A 2FUHB 1FXAA 4EUTA 4F7ZA 2LULA 4GN1A 3U30A 4HB4B 3SYXA 4I6PA 5FI0A 4BKSA 5DI9B 2MDXA 1FNUA 1P0RA 2X38A 3NVVA 2KMAA 1XO3A 1MK9B 4RH6A 1JCKB 4WJ7A 2KUPA 2NBUA 2RMMA 4HKQA 1NTIA 4ZRJA 1MJDA 3GS2A 3VXWA 3IAM1 2KR0A 3AEAB 2V3SA 1QKZA 2MCNB 4DXFA 2WX1A 3DBHI 4NPNA 1IPGA 2C60A 1VZ7A 2J4XA 4XZ4A 4PT5A 2H89B 1ISNA 1PQSA 1WSPA 3L10B 1WX8A 1NTVA 3HHMA 2RSUA 4JGHB 2YVCA 2WXNA 4JKFA 2Z13A 2OJRA 3W1SC 1FGYA 4RFBA 3RULA 4PYZA 2CJOA 3DHIC 1YIWA 2BS2B 1Y19B 3PGEA 5FR3A 4KZ0A 2D9ZA 3QJZA 4W9FA 5DPRA 2AQ2B 3O65B 4YT0B 4ITKA 2KD0A 4BFRA 2DIKA 1L0YB 2DZJA 2R09A 3PEGA 3N20C 3EFUA 1WIAA 4HPLB 3HIEA 2R2YA 3ABVB 2Z8LA 4MT5A 2YT1A 3PZ7A
chains in the Genus database with same CATH topology
3KUZA 2J0MA 2DKPA 1WJMA 2MQJA 2RPQA 1WG7A 2KFKA 3NZUA 4K7WA 1KI1B 2QKMA 4WJPA 5LXIB 1GGOA 3MHSD 3B08A 4CHMA 1KM7A 2LOXA 3APDA 1K8RB 4ZDVA 4ILGB 2FIDA 1DYNA 2V4LA 2FIFA 1GJZA 1IRSA 2D9WA 2KJRA 3M95A 2O2VB 2KTRB 5JVLA 4MDKE 4URKA 2LXAA 2Z0EB 1W1HA 3MDBC 2BKRB 1XD3B 2JUOA 1ZKHA 2M14A 4GOCA 2RGFA 4ICVA 2LASA 4KHAA 4TQ1A 4ANXA 1V5PA 2DHZA 4MGKE 2LRUA 2W2XD 4A20A 2OQBA 2MWSB 4MH0E 2RR9A 2JT4B 4MSQB 1EF1A 2GCJA 1WX9A 4WWNA 3ZDTA 3PG7A 1I35A 2PZ1A 3DVNV 4ZYNA 2N9EB 2KK8A 3DQVA 3DVNU 2PE9A 3P2BA 3G9WA 1UELA 3TJPA 2YS5A 2EC1A 4JK7A 3AXCA 4FLHA 2K00A 1YQBA 4GIVA 3PRZA 4JK8A 2E2XA 2K39A 4K2PA 2M38A 4BKSD 2A4ZA 3QC8B 3UIPB 4RM8A 5GMVA 2CRFA 1DDVA 1FOEA 3APFA 1WGUA 4FBJB 3RZWC 3CF6E 1V5MA 4MM3A 4PNKA 3CMMB 1Y8RC 3NZSA 5CHWA 1UGMA 2K1FA 2ABDA 2NVUI 3QK0A 3MPXA 4K2OA 5E6PA 1GC7A 3PZDA 2CR5A 3HIZA 2IO0B 2RD0A 2KO3A 1BTKA 4NNJB 1WJ4A 4MK0A 1MIZB 1OTRB 1FHOA 3PLUA 1I2HA 4KVGB 4IWPA 2MBHA 2L1CA 5J2RA 3AULA 1U5GA 1QQGA 2FCSA 4WWPA 1S3SG 3PSEB 2ROVA 2XEWA 3A8PA 3ENEA 1WGRA 4IG7B 2I5CA 1TTNA 1WMHB 1OGWA 5IJMA 3ZUNA 5KHOA 4K7UA 4ICUA 4WSFA 5C79A 2XBBC 1S1QB 1IP9A 1TBEA 2Y5BB 2ZEQA 4CHJA 2KANA 3PREA 1HBKA 1E5WA 4HK2A 4HDOA 5AEKB 2MRPA 3N3KB 3X0WA 4HXDA 3ZDMC 3T9LA 2Y7BA 2DZIA 3L54A 2BGFA 2KJHB 2JZZA 2LZ6A 4HVBA 2NR2A 3SBGA 2BPSA 3KRWA 1E8YA 1WMHA 4LJOB 2DFKA 3V61A 2RLOA 2DAJA 3O96A 1UD7A 1UNPA 4ZRKA 3PT2B 3OJ4B 2CQUA 2Q13A 4HJKA 3TFMA 5L81A 1C1YB 4A6KA 3TL5A 1WI0A 3PLVA 3FLVA 1DROA 1VBHA 2MBOA 3LJUX 4L6EA 2KC1A 5CHVC 5C23A 5HE2A 1E90A 2JRIB 4KDLB 2YRYA 3VDZA 3K9PB 1PLSA 4KHOA 3S2AA 1WR6E 4HLEA 2NMBA 2KWCA 3PVLA 1WM2A 2JRHA 3H7SA 3A1QB 1GUAB 4WVFB 1WFYA 3QWMA 3WIMA 2LYDA 3GZNI 2ZPNA 1ZW7A 3VIAA 4NSWA 4I6NB 3PVWA 3WYFB 3NS8A 3SV1A 4MSMB 4JKGB 4HAYB 2L3ZA 2D2QA 2DX1A 4EZLA 2P0FA 3R3MA 1OY2A 4DXAB 3ULCA 4NAWA 3VVWB 3R7QA 5FI1A 1JRUA 3HM3A 3A9KB 2BYFA 1V81A 2M0XA 4FULA 4GPTB 3CSTA 1MK7B 2LXCA 4IOYX 4GZUA 2PJHA 4BKGA 3JSVB 3A1QA 2L2IA 1OEYJ 4TKNA 4MEMA 1UBQA 2QKLA 3DVGX 1RAXA 5JLJB 3DVGY 5J3TA 2L0TA 3F5RA 1WRDB 2WYQA 5DH9B 4JKGA 2BCJA 3D32A 4NJ7A 1Y5OA 4GU2A 2NBVB 4PS8A 3N7CA 5CLLB 3A9KA 4HAXB 3TMPB 1OEYA 2X0SA 1XKEA 3HM6X 1P9DU 1V80A 4KSLC 1XX0A 1A5RA 3ZTCA 5CTRC 1U2BA 2IYDB 5D2MB 3JSVA 5JZEB 2UZRA 3A4RA 2VRRB 4F7UP 4RM9A 1P1AA 2ZCBA 1WGQA 4DHZB 5LOPB 2JWZA 2KVRA 3H7PB 1LXDA 5LXHA 1Z87A 2ZCCA 4RMAA 5JHHA 1HE8A 1MKEA 3C0RB 3E9PA 3ZO5B 2NPTA 5EFXA 1MAIA 3VOQA 3R66C 1U29A 1UNQA 2DLWA 3ZIMA 2WWZA 4J6IA 5D6JB 1Z2MA 5DPTA 3RUIB 2L7RA 3H9DA 3VTUA 3VH4B 3VTWA 4A6FB 3FEHA 2REXA 3MJWA 2UZSA 5LONB 1K5GB 1E7UA 3W1SA 2D9XA 2L00B 2L05A 4CHKA 3H7PA 4G11A 3PVUA 3ECIA 2GBKA 1L2NA 4E74A 5C6RA 3OAWA 1V5UA 2PEAA 3PHWB 3RT3B 2HD5B 3ODWA 2IO2B 2KFKB 4HCNB 2YSZA 3CSFA 2X18A 4NQKE 2N23A 3P6AA 1LQBA 2DYOA 2CU1A 3UGBB 4GGQA 2PPHA 2L76A 4JL9A 3IFWB 4EJNA 5JH5C 5HKHA 1SGHA 1RLFA 3SDLC 4HAZB 4A6FA 1WZ0A 2KFJA 4MT7A 5LLIA 3SU8X 1WJ1A 3CIKA 2Z0PA 3SBTA 3PRMB 2NZ8B 3M63B 3WANA 2DA0A 3K9OB 4BOZB 3ZKJC 1MG8A 2OOBB 1FB8A 4B6HA 3KZ1A 2FCMA 2BYEA 1ZGUB 1P6SA 1YX6B 2CAYA 3UIOB 2UVMA 2KDFB 3VQIA 4K17A 4OVVA 3FP5A 5E6NA 3L17A 5J3YA 1WE7A 2WH5A 4DX90 3ML9A 3NY5A 3VUXA 3RD2A 2DYMA 1W1DA 2D07B 2ASQA 2LUEA 2DHIA 3DDCB 1U4AA 4KIKA 4DBGA 4BKTA 2K2UA 2GBJA 1BAKA 2ADZA 2P8VA 2OTXA 2LI5A 4K7SA 1HB8A 5G55A 3ZW3A 1P3QU 1WY8A 2JVCA 3VTVA 4JKDA 3QX1A 4ANVA 4N9F4 2Z0DB 3ZTDA 1E8XA 3ZNZB 3QWZB 1B55A 2VKIA 2K6QA 5D3VA 3KYCD 5DPWA 4W9CA 2D11A 3EPYA 1P3RA 2D4QA 4FHKA 3F0WA 2MBBB 3T06A 2D9YA 4ILHA 4IWOA 4JKCA 4YONA 4BBKA 5KQ4A 1MPHA 4DBBA 4II2B 3AU4A 2FCNA 3P7ZA 2DYNA 3A9JA 3A98B 2ZNVC 3DXCA 3FM8C 1X05A 3HW2B 1NI2A 1V9JA 2UWQA 5C1ZA 4LDTD 3ZNID 4W9HA 4PQ0A 4ZRIA 2ELAA 2DX5B 4Z2NA 3DPDA 3VUYA 3ODXA 3ENBA 1V61A 3B0AA 3GYPA 3Q3FA 5C5BA 4IM3A 2KJ6A 1RRPB 2M17A 5E6OA 1TGZB 1ZC3B 2J0KA 5HE0A 1SHCA 2IO3B 2AYOB 4CO7A 3E9OA 1ST7A 4AUQC 1OMWA 4TV3A 1V89A 2GMIC 4F7HA 1BTNA 2LVOA 2G4DB 3H6NA 1XQQA 1WH3A 2KDBA 2CKHB 5DCNA 1FHWA 1SIFA 2AL6A 3DXEA 4KSKC 2EKEC 2DX5A 4TQ0A 4TUUA 2RVBB 1XODA 4MGZE 1V88A 5AZGA 3WALA 4WQOB 2W2WA 1UPRA 1X11A 3HQCA 3AU5A 2GBMA 4WAAA 5CHFA 3L13A 4HDQA 2KWUB 1KLVA 4AOFA 3SO6A 2DENB 2Y8GA 2KMCA 1CMXB 2LGDA 2JZ3B 4PYUA 2COAA 2EMTA 5D3YA 3ZNGC 4B95A 1BWNA 1EO6A 4KV2A 4GDLA 1JDEA 3UINB 1YJ1A 3QA8A 3BINA 3QAQA 3V62A 2YS3A 4DK5A 4FADA 4DHZE 1T0YA 3QIJA 4IUMB 1XD4A 1WXVA 3QCAA 5L83A 1WE6A 3QBVB 4W9EA 2KTFA 1Q0WB 1WVHA 2ZZPB 1PMSA 2K8CA 4JIOU 3IVFA 2DTCA 2ELBA 2B3AA 4K81A 1TXDA 3A4SC 2I1KA 4BVUC 4ANWA 3VUWA 1FAOA 2J7QB 4WJNA 1TJ6A 2M4NA 2CHXA 2XK5A 2GCLA 1XCGA 1DDWA 1UH6A 2VSZA 4JQWC 5HE1A 1XT9B 4NAWB 5JP4A 4W9KA 1E7VA 4LCDE 4IAPA 1U27A 1ACAA 3ZVRA 2EJ8A 2BYVE 2KNBA 2CHWA 2MP2A 4DHJD 2J59M 4FJVB 4W9GA 2LG1A 2KWVB 4HAUB 3DBLI 2CY5A 1RFAA 5IAAC 3A8QA 5J18A 5D27A 1ZC4B 4MJSB 3RYTA 5D3XA 1V2YA 1V5TA 3DBRI 2K6DB 1HB6A 4DX8A 5JHGA 4F8CB 1N3HA 2C7MB 2JY6A 4YL8A 1NVLA 3TCAA 4OVUA 1W1GA 1FHXA 5GOWB 1KJTA 3EC8A 1UEFA 2LD9A 4NJ6A 3KSYA 2MBEA 1AQCA 1I42A 2MWNB 2MKRA 4PS3A 1C3TA 1U5EA 4WJQA 1Q1OA 1Z5SB 5DHFB 3KUDB 2K8HA 2NPTB 4GMVA 1H4RA 4MJSA 4HB2B 3SHQA 2ZVNA 4FJZA 2KQ7A 4DDID 4FHJA 2YT0A 2FJ9A 2GJYA 1E8WA 1WZ3A 3OJ3A 4F1SA 3KVFB 4LDTB 4C0AA 2O6VA 1QC6A 3DBSA 1P98A 3RZFA 2BF8B 3V60A 2RSGA 2LGYA 4HB3B 3M62B 2N9XA 2M1MA 2H7EA 1M7RA 3IBEA 1NDDA 3ML8A 2N7EA 1UBIA 4ANUA 2HRJA 4B6WA 2RNRB 2LJ5A 4I6LB 2HE7A 3CXBB 3QHTA 1QZEA 4A6HA 2ZVOA 4JK9A 2J0JA 1M7EA 2FJLA 1ZSQA 1TQZA 3JVZX 1WGGA 2LKOA 3L0WB 2G45B 1RJ2A 2LVQA 1KZ7A 4EEWA 3SUZA 3WAMA 2CB8A 3FSSA 2ZJDA 4B9KA 4GXBA 2W2XC 3RCZA 1TZ1A 1XR0B 1L7YA 3D8DA 3PPAA 2KX3A 3U7DA 3D8EA 3L08A 2MBQA 3KRXA 1GG3A 1YD8U 3AJ4A 2LOZA 1EF5A 1AARA 4K1RB 2XQNM 4W9IA 3KYDD 1WJNA 2LVPA 1WXAA 3KW5B 2N1VA 1WX7A 1F9JA 2MLBA 3PSCA 2C5LC 4JKBA 3IG3A 4FJYA 2HTHB 4HATB 3KY9A 1X1FA 4KIKB 4NY0A 3TBLD 4IC7B 2AL3A 3TVVA 3WAOA 3Q3JA 5AZFA 1FXTB 2Y8FA 4KHBB 1ZVRA 4P7IA 5IA7A 3APCA 2RGNB 2I1JA 4IM0A 2N0YA 2CHZA 3PRPB 3OANA 2QHOA 2N7DA 2DHJA 2BWES 1G6JA 5D7GA 2A5UA 1M94A 2ZNVB 2DYQA 2W9NA 3QQ8B 2HTHA 3IHPC 3V6EB 1DBHA 2AWTA 3PHXB 2M8SA 3U8ZA 3UQBA 4M8MA 2KLGA 4GMXB 2R2QA 1BT0A 4WWOA 3KUCB 4NQLB 2DKQA 1X1GA 2MW5A 3ZLZA 2DZKA 2KLCA 4TYZA 3A9JB 3AI5A 2LGXA 1J0WA 1WXSA 3W1YA 4XX5A 1I7AA 2Z0OA 4MGYE 3I3TB 2PE6B 3WAPA 2O6VD 4E3CA 3LJ3A 2R2OA 4BOSC 1AWEA 3MTNB 4DHJB 4WJOA 1E8ZA 1KBLA 3X23A 4A5KA 2L8JA 2KC2A 4ILJA 1WGHA 2WX0A 2FNJB 3QARA 3PS6A 5C5BB 1H8CA 1LW3A 2LRWA 2KKCA 2H7DA 2DAFA 5DPSA 1IYFA 2HJ8A 2K8BA 1EVHA 2DYBA 1ZM0A 4EZJA 1NTYA 2KTRA 2O2VA 5G2NA 1VBGA 3R7RA 1J8CA 4X57B 3ALBA 4Z2MB 4GDKB 4HAVB 3BY4B 4HCPB 2IO1B 2NBWB 2Z59B 5CX3A 5TR5A 2I5FA 2FDQA 3RCPA 3EECA 2R0DA 4M0WB 1PFJA 3VFKA 3N30A 4G50A 2C7NB 3BJIA 4HWIB 3N32A 4DDGD 5J17A 5JHAA 4JKAA 2R82A 1KZGA 5HE3A 5DIFB 4AJWA 5BO4B 3UF8A 2GBRA 4MY6A 1Q5WB 3NSUA 1KOTA 2D9VA 5EDSA 2GOWA 4GDLB 4Y94A 4GDKA 5KQ1A 1V86A 4HB0B 2KQSA 2RUKB 2C7HA 3VHTC 3V5WA 2N9PC 4XWXA 2C9WB 1R4MI 2IFSA 2KCJA 3UZTA 2V76A 5CLQB 4II3B 4M8NA 4XC2A 1LFDA 2V1YA 5DHAB 3TO1A 3ODOA 2GBNA 1LM8B 3B1LX 3E66A 1NU2A 1U5DA 3V6CB 1KC7A 3PP2A 2KOXA 2XK5B 4BBNC 3ZNHB 2G3QB 4W9DA 5C16A 4IM2A 5J3QA 2AEHA 3H1UA 2N1WA 1UZXB 2MA9B 5JHBA 3GYOA 2KDIA 4HPMB 5D3WA 5KCVA 2D3GA 2G4SA 1EGXA 2MSED 2RQ1A 2P0DA 1K5DB 1UPQA 1LB1A 1VCBA 3ONSA 2KGXB 1WF9A 4GB9A 4W9LA 2MP2B 4FA6A 2MX2A 1WJ6A 4CYEA 3SD5A 3PTFC 2IY1B 2Z0QA 2KN5A 3E9LA 1R4NI 4H8SA 1P5TA 3VH3B 5L95C 3VAWA 2UYZB 1D3ZA 4EMOA 4HHVA 2IZVB 1DIKA 1UNRA 2FCQA 3ULBA 3SNHA 3L16A 5FR6A 5D94A 2JXXA 3M1IB 2LWPA 3T8MA 1V5OA 2JP2A 3DXDA 4EKUA 1WR1A 2COPA 2D10A 2IBIB 3DCGA 3NHEB 3DOWA 4IFSA 4F7GA 3ML4A 4KZCA 3JYUA 4PS7A 2G35A 4EOYA 1V49A 2KHWB 3D8FA 1WJUA 3WA0A 2EMSA 2YF0A 3UQAA 2BWFA 5KHQA 3PV1A 1EUVB 1J19A 1GC6A 2WDTB 4ASWC 2YS1A 2KXJA 2NCNA 4G3XB 1NBFC 3M3JA 4A3PA 2VRWB 4DWFA 2IYBA 4G0NB 1DDMA 4BBNF 4EFOA 3EHVA 3KH0A 3ZVVA 3HK0A 2O6VB 4AP4C 4HAWB 2MFQA 1YX5B 1WXMA 2LBBA 2YLMA 2KZRA 1RRBA 1WYWB 1OQYA 1VD2A 1SE9A 2K2JA 4EZKA 4MGIE 2L0FA 3ZRFA 4W9JA 1V6EA 1GNUA 3ZRCA 4MELA 4GSWA 2DZMA 2ROZB 2BKFA 4JLCA 2CODA 1Q67A 2FAZA 4IWQA 1OQNA 3NOBA 2JF5A 4D0NB 2KDEB 2GS0A 1WI1A 2COCA 4E71A 1FGZA 1X86A 2K25A 2N4FA 3JW0X 4JKEA 4KDIC 1WGDA 4AJYB 2COFA 4A3OA 2NS5A 2IY0B 2KX0A 4FN2A 2CS4A 4JKHA 3OLMD 3TIXA 1EAZA 2ZPYA 3LDZE 2P0HA 1J0GA 1WGYA 1X1MA 4IW0A 1H10A 4AWJA 3GOEA 1WM3A 1MIXA 2DN6A 4KAXB 1U5FA 2DHKA 3A33B 5AZHA 4LJPB 2CY4A 2JPHA 3TW1A 2FUHB 4EUTA 4F7ZA 2LULA 4GN1A 3U30A 4HB4B 3SYXA 4I6PA 5FI0A 4BKSA 5DI9B 2MDXA 1P0RA 2KMAA 1MK9B 4WJ7A 2KUPA 2NBUA 1NTIA 4ZRJA 3VXWA 2V3SA 2MCNB 2WX1A 3DBHI 4NPNA 1IPGA 2C60A 4XZ4A 1ISNA 1PQSA 3L10B 1WX8A 1NTVA 3HHMA 2RSUA 4JGHB 2YVCA 4JKFA 2OJRA 3W1SC 1FGYA 3RULA 4PYZA 1YIWA 1Y19B 3PGEA 4KZ0A 2D9ZA 3QJZA 4W9FA 5DPRA 3O65B 2KD0A 4BFRA 2DIKA 2DZJA 2R09A 3PEGA 3EFUA 1WIAA 4HPLB 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUZ A;  2J0M A;  2DKP A;  1WJM A;  2MQJ A;  2RPQ A;  1WG7 A;  2KFK A;  3NZU A;  4K7W A;  1KI1 B;  2QKM A;  4WJP A;  5LXI B;  3MHS D;  3B08 A;  4CHM A;  1KM7 A;  2LOX A;  3APD A;  1K8R B;  4ZDV A;  2FID A;  1DYN A;  2V4L A;  2FIF A;  1GJZ A;  1IRS A;  2D9W A;  2KJR A;  3M95 A;  2O2V B;  2KTR B;  4MDK E;  4URK A;  2LXA A;  2Z0E B;  1W1H A;  3MDB C;  2BKR B;  1XD3 B;  2JUO A;  1ZKH A;  2M14 A;  4GOC A;  2RGF A;  4ICV A;  2LAS A;  4KHA A;  4TQ1 A;  4ANX A;  1V5P A;  2DHZ A;  4MGK E;  2LRU A;  2W2X D;  4A20 A;  2OQB A;  2MWS B;  4MH0 E;  2RR9 A;  2JT4 B;  4MSQ B;  1EF1 A;  2GCJ A;  1WX9 A;  4WWN A;  3ZDT A;  3PG7 A;  1I35 A;  2PZ1 A;  3DVN V;  4ZYN A;  2N9E B;  2KK8 A;  3DQV A;  3DVN U;  2PE9 A;  3P2B A;  3G9W A;  1UEL A;  3TJP A;  2YS5 A;  2EC1 A;  3AXC A;  4FLH A;  2K00 A;  1YQB A;  4GIV A;  3PRZ A;  2E2X A;  2K39 A;  4K2P A;  2M38 A;  4BKS D;  2A4Z A;  3QC8 B;  3UIP B;  4RM8 A;  5GMV A;  2CRF A;  1DDV A;  1FOE A;  3APF A;  1WGU A;  4FBJ B;  3RZW C;  3CF6 E;  1V5M A;  4MM3 A;  4PNK A;  3CMM B;  1Y8R C;  3NZS A;  5CHW A;  1UGM A;  2K1F A;  2ABD A;  2NVU I;  3QK0 A;  3MPX A;  4K2O A;  5E6P A;  1GC7 A;  3PZD A;  2CR5 A;  3HIZ A;  2IO0 B;  2RD0 A;  2KO3 A;  1BTK A;  4NNJ B;  1WJ4 A;  4MK0 A;  1MIZ B;  1OTR B;  1FHO A;  3PLU A;  1I2H A;  4KVG B;  4IWP A;  2MBH A;  2L1C A;  5J2R A;  3AUL A;  1U5G A;  1QQG A;  2FCS A;  4WWP A;  1S3S G;  3PSE B;  2ROV A;  2XEW A;  3A8P A;  3ENE A;  1WGR A;  4IG7 B;  2I5C A;  1TTN A;  1WMH B;  1OGW A;  5IJM A;  3ZUN A;  5KHO A;  4K7U A;  4ICU A;  4WSF A;  5C79 A;  2XBB C;  1S1Q B;  1IP9 A;  1TBE A;  2Y5B B;  2ZEQ A;  4CHJ A;  2KAN A;  3PRE A;  1HBK A;  1E5W A;  4HK2 A;  4HDO A;  5AEK B;  2MRP A;  3N3K B;  3X0W A;  4HXD A;  3ZDM C;  3T9L A;  2Y7B A;  2DZI A;  3L54 A;  2BGF A;  2KJH B;  2JZZ A;  2LZ6 A;  4HVB A;  2NR2 A;  2BPS A;  3KRW A;  1E8Y A;  1WMH A;  4LJO B;  2DFK A;  3V61 A;  2RLO A;  2DAJ A;  3O96 A;  1UD7 A;  1UNP A;  4ZRK A;  3PT2 B;  3OJ4 B;  2CQU A;  2Q13 A;  4HJK A;  3TFM A;  5L81 A;  1C1Y B;  4A6K A;  3TL5 A;  1WI0 A;  3PLV A;  3FLV A;  1DRO A;  2MBO A;  3LJU X;  4L6E A;  2KC1 A;  5CHV C;  5C23 A;  5HE2 A;  1E90 A;  2JRI B;  4KDL B;  2YRY A;  3VDZ A;  3K9P B;  1PLS A;  4KHO A;  3S2A A;  1WR6 E;  4HLE A;  2NMB A;  2KWC A;  3PVL A;  1WM2 A;  2JRH A;  3H7S A;  3A1Q B;  1GUA B;  4WVF B;  1WFY A;  3QWM A;  3WIM A;  2LYD A;  3GZN I;  2ZPN A;  1ZW7 A;  3VIA A;  4NSW A;  4I6N B;  3PVW A;  3WYF B;  3NS8 A;  3SV1 A;  4MSM B;  4HAY B;  2L3Z A;  2D2Q A;  2DX1 A;  4EZL A;  2P0F A;  3R3M A;  1OY2 A;  4DXA B;  3ULC A;  4NAW A;  3VVW B;  3R7Q A;  5FI1 A;  1JRU A;  3HM3 A;  2BYF A;  3A9K B;  1V81 A;  2M0X A;  4FUL A;  4GPT B;  3CST A;  1MK7 B;  2LXC A;  4IOY X;  4GZU A;  2PJH A;  4BKG A;  3JSV B;  3A1Q A;  2L2I A;  1OEY J;  4TKN A;  4MEM A;  1UBQ A;  2QKL A;  3DVG X;  1RAX A;  5JLJ B;  3DVG Y;  5J3T A;  2L0T A;  3F5R A;  1WRD B;  2WYQ A;  5DH9 B;  2BCJ A;  3D32 A;  4NJ7 A;  1Y5O A;  4GU2 A;  2NBV B;  4PS8 A;  3N7C A;  5CLL B;  3A9K A;  4HAX B;  3TMP B;  1OEY A;  1XKE A;  3HM6 X;  1P9D U;  1V80 A;  4KSL C;  1XX0 A;  1A5R A;  3ZTC A;  5CTR C;  1U2B A;  2IYD B;  5D2M B;  3JSV A;  5JZE B;  2UZR A;  3A4R A;  2VRR B;  4F7U P;  4RM9 A;  1P1A A;  2ZCB A;  1WGQ A;  4DHZ B;  5LOP B;  2JWZ A;  2KVR A;  3H7P B;  1LXD A;  5LXH A;  1Z87 A;  2ZCC A;  4RMA A;  5JHH A;  1HE8 A;  1MKE A;  3C0R B;  3ZO5 B;  2NPT A;  5EFX A;  1MAI A;  3VOQ A;  3R66 C;  1U29 A;  1UNQ A;  2DLW A;  3ZIM A;  2WWZ A;  4J6I A;  5D6J B;  1Z2M A;  5DPT A;  3RUI B;  2L7R A;  3H9D A;  3VTU A;  3VH4 B;  3VTW A;  4A6F B;  3FEH A;  2REX A;  3MJW A;  2UZS A;  5LON B;  1K5G B;  1E7U A;  3W1S A;  2D9X A;  2L00 B;  2L05 A;  4CHK A;  3H7P A;  4G11 A;  3PVU A;  3ECI A;  2GBK A;  1L2N A;  4E74 A;  5C6R A;  3OAW A;  1V5U A;  2PEA A;  3PHW B;  3RT3 B;  2HD5 B;  3ODW A;  2IO2 B;  2KFK B;  4HCN B;  2YSZ A;  3CSF A;  2X18 A;  4NQK E;  2N23 A;  3P6A A;  1LQB A;  2DYO A;  2CU1 A;  3UGB B;  4GGQ A;  2PPH A;  2L76 A;  4JL9 A;  3IFW B;  4EJN A;  5JH5 C;  5HKH A;  1SGH A;  1RLF A;  3SDL C;  4HAZ B;  4A6F A;  1WZ0 A;  2KFJ A;  4MT7 A;  5LLI A;  3SU8 X;  1WJ1 A;  3CIK A;  2Z0P A;  3PRM B;  2NZ8 B;  3M63 B;  3WAN A;  2DA0 A;  3K9O B;  4BOZ B;  3ZKJ C;  1MG8 A;  2OOB B;  1FB8 A;  4B6H A;  3KZ1 A;  2FCM A;  2BYE A;  1ZGU B;  1P6S A;  1YX6 B;  2CAY A;  3UIO B;  2UVM A;  2KDF B;  3VQI A;  4K17 A;  4OVV A;  3FP5 A;  5E6N A;  3L17 A;  5J3Y A;  1WE7 A;  2WH5 A;  4DX9 0;  3ML9 A;  3NY5 A;  3VUX A;  3RD2 A;  2DYM A;  1W1D A;  2D07 B;  2ASQ A;  2LUE A;  2DHI A;  3DDC B;  1U4A A;  4KIK A;  4DBG A;  4BKT A;  2K2U A;  2GBJ A;  1BAK A;  2ADZ A;  2P8V A;  2OTX A;  2LI5 A;  4K7S A;  1HB8 A;  5G55 A;  3ZW3 A;  1P3Q U;  1WY8 A;  2JVC A;  3VTV A;  3QX1 A;  4ANV A;  4N9F 4;  2Z0D B;  3ZTD A;  1E8X A;  3ZNZ B;  3QWZ B;  1B55 A;  2VKI A;  2K6Q A;  5D3V A;  3KYC D;  5DPW A;  4W9C A;  2D11 A;  3EPY A;  1P3R A;  2D4Q A;  4FHK A;  3F0W A;  2MBB B;  3T06 A;  2D9Y A;  4IWO A;  4YON A;  4BBK A;  5KQ4 A;  1MPH A;  4DBB A;  4II2 B;  3AU4 A;  2FCN A;  3P7Z A;  2DYN A;  3A9J A;  3A98 B;  2ZNV C;  3DXC A;  3FM8 C;  1X05 A;  3HW2 B;  1NI2 A;  1V9J A;  2UWQ A;  5C1Z A;  4LDT D;  3ZNI D;  4W9H A;  4PQ0 A;  4ZRI A;  2ELA A;  2DX5 B;  4Z2N A;  3DPD A;  3VUY A;  3ODX A;  1V61 A;  3B0A A;  3GYP A;  3Q3F A;  5C5B A;  4IM3 A;  2KJ6 A;  1RRP B;  2M17 A;  5E6O A;  1TGZ B;  1ZC3 B;  2J0K A;  5HE0 A;  1SHC A;  2IO3 B;  2AYO B;  4CO7 A;  1ST7 A;  4AUQ C;  1OMW A;  4TV3 A;  1V89 A;  2GMI C;  4F7H A;  1BTN A;  2LVO A;  2G4D B;  3H6N A;  1XQQ A;  1WH3 A;  2KDB A;  2CKH B;  5DCN A;  1FHW A;  1SIF A;  2AL6 A;  3DXE A;  4KSK C;  2EKE C;  2DX5 A;  4TQ0 A;  4TUU A;  2RVB B;  1XOD A;  4MGZ E;  1V88 A;  5AZG A;  3WAL A;  4WQO B;  2W2W A;  1UPR A;  1X11 A;  3HQC A;  3AU5 A;  2GBM A;  4WAA A;  5CHF A;  3L13 A;  4HDQ A;  2KWU B;  1KLV A;  4AOF A;  3SO6 A;  2DEN B;  2Y8G A;  2KMC A;  1CMX B;  2LGD A;  2JZ3 B;  4PYU A;  2COA A;  2EMT A;  5D3Y A;  3ZNG C;  4B95 A;  1BWN A;  1EO6 A;  4KV2 A;  4GDL A;  3UIN B;  1YJ1 A;  3QA8 A;  3BIN A;  3QAQ A;  3V62 A;  2YS3 A;  4DK5 A;  4FAD A;  4DHZ E;  1T0Y A;  3QIJ A;  4IUM B;  1XD4 A;  1WXV A;  3QCA A;  5L83 A;  1WE6 A;  3QBV B;  4W9E A;  2KTF A;  1Q0W B;  1WVH A;  2ZZP B;  1PMS A;  2K8C A;  4JIO U;  3IVF A;  2DTC A;  2ELB A;  2B3A A;  4K81 A;  1TXD A;  3A4S C;  2I1K A;  4BVU C;  4ANW A;  3VUW A;  1FAO A;  2J7Q B;  4WJN A;  1TJ6 A;  2M4N A;  2CHX A;  2XK5 A;  2GCL A;  1XCG A;  1DDW A;  1UH6 A;  2VSZ A;  4JQW C;  5HE1 A;  1XT9 B;  4NAW B;  5JP4 A;  4W9K A;  1E7V A;  4LCD E;  4IAP A;  1U27 A;  1ACA A;  3ZVR A;  2EJ8 A;  2BYV E;  2KNB A;  2CHW A;  2MP2 A;  4DHJ D;  2J59 M;  4FJV B;  4W9G A;  2LG1 A;  2KWV B;  4HAU B;  3DBL I;  2CY5 A;  1RFA A;  5IAA C;  3A8Q A;  5J18 A;  5D27 A;  1ZC4 B;  4MJS B;  3RYT A;  5D3X A;  1V2Y A;  1V5T A;  3DBR I;  2K6D B;  1HB6 A;  4DX8 A;  5JHG A;  4F8C B;  1N3H A;  2C7M B;  2JY6 A;  4YL8 A;  1NVL A;  3TCA A;  4OVU A;  1W1G A;  1FHX A;  5GOW B;  1KJT A;  3EC8 A;  1UEF A;  2LD9 A;  4NJ6 A;  3KSY A;  2MBE A;  1AQC A;  1I42 A;  2MWN B;  2MKR A;  4PS3 A;  1C3T A;  1U5E A;  4WJQ A;  1Q1O A;  1Z5S B;  5DHF B;  3KUD B;  2K8H A;  2NPT B;  4GMV A;  1H4R A;  4MJS A;  4HB2 B;  3SHQ A;  2ZVN A;  4FJZ A;  2KQ7 A;  4DDI D;  4FHJ A;  2YT0 A;  2FJ9 A;  2GJY A;  1E8W A;  1WZ3 A;  3OJ3 A;  4F1S A;  3KVF B;  4LDT B;  4C0A A;  2O6V A;  1QC6 A;  3DBS A;  1P98 A;  3RZF A;  2BF8 B;  3V60 A;  2RSG A;  2LGY A;  4HB3 B;  3M62 B;  2N9X A;  2M1M A;  2H7E A;  1M7R A;  3IBE A;  1NDD A;  3ML8 A;  2N7E A;  1UBI A;  4ANU A;  2HRJ A;  4B6W A;  2RNR B;  2LJ5 A;  4I6L B;  2HE7 A;  3CXB B;  3QHT A;  1QZE A;  4A6H A;  2ZVO A;  2J0J A;  1M7E A;  2FJL A;  1ZSQ A;  1TQZ A;  3JVZ X;  1WGG A;  2LKO A;  3L0W B;  2G45 B;  1RJ2 A;  2LVQ A;  1KZ7 A;  4EEW A;  3SUZ A;  3WAM A;  2CB8 A;  3FSS A;  2ZJD A;  4B9K A;  4GXB A;  2W2X C;  3RCZ A;  1TZ1 A;  1XR0 B;  1L7Y A;  3D8D A;  3PPA A;  2KX3 A;  3U7D A;  3D8E A;  3L08 A;  2MBQ A;  3KRX A;  1GG3 A;  1YD8 U;  3AJ4 A;  2LOZ A;  1EF5 A;  1AAR A;  4K1R B;  2XQN M;  4W9I A;  3KYD D;  1WJN A;  2LVP A;  1WXA A;  3KW5 B;  2N1V A;  1WX7 A;  1F9J A;  2MLB A;  3PSC A;  2C5L C;  3IG3 A;  4FJY A;  2HTH B;  4HAT B;  3KY9 A;  1X1F A;  4KIK B;  4NY0 A;  3TBL D;  4IC7 B;  2AL3 A;  3TVV A;  3WAO A;  3Q3J A;  5AZF A;  1FXT B;  2Y8F A;  4KHB B;  1ZVR A;  4P7I A;  5IA7 A;  3APC A;  2RGN B;  2I1J A;  4IM0 A;  2N0Y A;  2CHZ A;  3PRP B;  3OAN A;  2QHO A;  2N7D A;  2DHJ A;  2BWE S;  1G6J A;  5D7G A;  2A5U A;  1M94 A;  2ZNV B;  2DYQ A;  2W9N A;  3QQ8 B;  2HTH A;  3IHP C;  3V6E B;  1DBH A;  2AWT A;  3PHX B;  2M8S A;  3U8Z A;  3UQB A;  4M8M A;  2KLG A;  4GMX B;  2R2Q A;  1BT0 A;  4WWO A;  3KUC B;  4NQL B;  2DKQ A;  1X1G A;  2MW5 A;  3ZLZ A;  2DZK A;  2KLC A;  4TYZ A;  3A9J B;  3AI5 A;  2LGX A;  1J0W A;  1WXS A;  3W1Y A;  4XX5 A;  1I7A A;  2Z0O A;  4MGY E;  3I3T B;  2PE6 B;  3WAP A;  2O6V D;  4E3C A;  3LJ3 A;  2R2O A;  4BOS C;  1AWE A;  3MTN B;  4DHJ B;  4WJO A;  1E8Z A;  3X23 A;  4A5K A;  2L8J A;  2KC2 A;  1WGH A;  2WX0 A;  2FNJ B;  3QAR A;  3PS6 A;  5C5B B;  1H8C A;  1LW3 A;  2LRW A;  2KKC A;  2H7D A;  2DAF A;  5DPS A;  1IYF A;  2HJ8 A;  2K8B A;  1EVH A;  2DYB A;  1ZM0 A;  4EZJ A;  1NTY A;  2KTR A;  2O2V A;  5G2N A;  3R7R A;  1J8C A;  4X57 B;  3ALB A;  4Z2M B;  4GDK B;  4HAV B;  3BY4 B;  4HCP B;  2IO1 B;  2NBW B;  2Z59 B;  5CX3 A;  5TR5 A;  2I5F A;  2FDQ A;  3RCP A;  3EEC A;  2R0D A;  4M0W B;  1PFJ A;  3VFK A;  3N30 A;  4G50 A;  2C7N B;  3BJI A;  4HWI B;  3N32 A;  4DDG D;  5J17 A;  5JHA A;  1KZG A;  5HE3 A;  5DIF B;  4AJW A;  5BO4 B;  3UF8 A;  2GBR A;  4MY6 A;  1Q5W B;  3NSU A;  1KOT A;  2D9V A;  5EDS A;  2GOW A;  4GDL B;  4Y94 A;  4GDK A;  5KQ1 A;  1V86 A;  4HB0 B;  2KQS A;  2RUK B;  2C7H A;  3VHT C;  3V5W A;  2N9P C;  4XWX A;  2C9W B;  1R4M I;  2IFS A;  2KCJ A;  3UZT A;  2V76 A;  5CLQ B;  4II3 B;  4M8N A;  4XC2 A;  1LFD A;  2V1Y A;  5DHA B;  3TO1 A;  3ODO A;  2GBN A;  1LM8 B;  3B1L X;  1NU2 A;  1U5D A;  3V6C B;  3PP2 A;  2KOX A;  2XK5 B;  4BBN C;  3ZNH B;  2G3Q B;  4W9D A;  5C16 A;  4IM2 A;  5J3Q A;  2AEH A;  3H1U A;  2N1W A;  1UZX B;  2MA9 B;  5JHB A;  3GYO A;  2KDI A;  4HPM B;  5D3W A;  5KCV A;  2D3G A;  2G4S A;  1EGX A;  2MSE D;  2RQ1 A;  2P0D A;  1K5D B;  1UPQ A;  1LB1 A;  1VCB A;  3ONS A;  2KGX B;  1WF9 A;  4GB9 A;  4W9L A;  2MP2 B;  4FA6 A;  2MX2 A;  1WJ6 A;  4CYE A;  3SD5 A;  3PTF C;  2IY1 B;  2Z0Q A;  2KN5 A;  1R4N I;  4H8S A;  1P5T A;  3VH3 B;  5L95 C;  3VAW A;  2UYZ B;  1D3Z A;  4EMO A;  4HHV A;  2IZV B;  1UNR A;  2FCQ A;  3ULB A;  3SNH A;  3L16 A;  5FR6 A;  5D94 A;  2JXX A;  3M1I B;  2LWP A;  3T8M A;  1V5O A;  2JP2 A;  3DXD A;  4EKU A;  1WR1 A;  2COP A;  2D10 A;  2IBI B;  3DCG A;  3NHE B;  3DOW A;  4IFS A;  4F7G A;  3ML4 A;  4KZC A;  3JYU A;  4PS7 A;  2G35 A;  4EOY A;  1V49 A;  2KHW B;  3D8F A;  1WJU A;  3WA0 A;  2EMS A;  2YF0 A;  3UQA A;  2BWF A;  5KHQ A;  3PV1 A;  1EUV B;  1J19 A;  1GC6 A;  2WDT B;  4ASW C;  2YS1 A;  2KXJ A;  2NCN A;  4G3X B;  1NBF C;  3M3J A;  4A3P A;  2VRW B;  4DWF A;  2IYB A;  4G0N B;  1DDM A;  4BBN F;  4EFO A;  3EHV A;  3KH0 A;  3ZVV A;  3HK0 A;  2O6V B;  4AP4 C;  4HAW B;  2MFQ A;  1YX5 B;  1WXM A;  2LBB A;  2YLM A;  2KZR A;  1RRB A;  1WYW B;  1OQY A;  1VD2 A;  1SE9 A;  2K2J A;  4EZK A;  4MGI E;  2L0F A;  3ZRF A;  4W9J A;  1V6E A;  1GNU A;  3ZRC A;  4MEL A;  4GSW A;  2DZM A;  2ROZ B;  2BKF A;  4JLC A;  2COD A;  1Q67 A;  2FAZ A;  4IWQ A;  1OQN A;  3NOB A;  2JF5 A;  4D0N B;  2KDE B;  2GS0 A;  1WI1 A;  2COC A;  4E71 A;  1FGZ A;  1X86 A;  2K25 A;  2N4F A;  3JW0 X;  4KDI C;  1WGD A;  4AJY B;  2COF A;  4A3O A;  2NS5 A;  2IY0 B;  2KX0 A;  4FN2 A;  2CS4 A;  3OLM D;  3TIX A;  1EAZ A;  2ZPY A;  3LDZ E;  2P0H A;  1J0G A;  1WGY A;  1X1M A;  4IW0 A;  1H10 A;  4AWJ A;  3GOE A;  1WM3 A;  1MIX A;  2DN6 A;  4KAX B;  1U5F A;  2DHK A;  3A33 B;  5AZH A;  4LJP B;  2CY4 A;  2JPH A;  3TW1 A;  2FUH B;  4EUT A;  4F7Z A;  2LUL A;  4GN1 A;  3U30 A;  4HB4 B;  3SYX A;  4I6P A;  5FI0 A;  4BKS A;  5DI9 B;  2MDX A;  1P0R A;  2KMA A;  1MK9 B;  4WJ7 A;  2KUP A;  2NBU A;  1NTI A;  4ZRJ A;  3VXW A;  2V3S A;  2MCN B;  2WX1 A;  3DBH I;  4NPN A;  1IPG A;  2C60 A;  4XZ4 A;  1ISN A;  1PQS A;  3L10 B;  1WX8 A;  1NTV A;  3HHM A;  2RSU A;  4JGH B;  2YVC A;  2OJR A;  3W1S C;  1FGY A;  3RUL A;  4PYZ A;  1YIW A;  1Y19 B;  3PGE A;  4KZ0 A;  2D9Z A;  3QJZ A;  4W9F A;  5DPR A;  3O65 B;  2KD0 A;  4BFR A;  2DZJ A;  2R09 A;  3PEG A;  3EFU A;  1WIA A;  4HPL B;  2YT1 A; 
#chains in the Genus database with same CATH topology
 2WXR A;  1ZDX A;  3KUZ A;  2J0M A;  2DKP A;  2SAK A;  1JML A;  1WXQ A;  3NUH B;  1WJM A;  2MQJ A;  4USA A;  2RPQ A;  1WG7 A;  3Q8F A;  2KFK A;  3NZU A;  4K7W A;  2MH7 A;  1KI1 B;  2QKM A;  4WJP A;  5LXI B;  3AEC B;  4HEA 1;  2IGH A;  5FKA C;  3AM9 A;  1GGO A;  3MHS D;  2KWD A;  3B08 A;  1M4V A;  1R4M B;  3AE5 B;  4CHM A;  1C4A A;  1KM7 A;  2LOX A;  1QLB B;  3APD A;  4LNK A;  1ET6 A;  1K8R B;  4ZDV A;  4ILG B;  2FID A;  3BYY B;  3AE3 B;  1DYN A;  2V4L A;  2FIF A;  4C56 C;  1FIQ A;  2WU2 B;  1GJZ A;  2PIA A;  1IRS A;  2D9W A;  1FNW A;  2KJR A;  3M95 A;  1FCC C;  2O2V B;  2KTR B;  5JVL A;  4MDK E;  3SFD B;  4URK A;  2LXA A;  3AN1 A;  1PYW D;  2Z0E B;  1W1H A;  3MDB C;  2BKR B;  1XD3 B;  2JUO A;  1ZKH A;  4JWS C;  1FNV A;  2M14 A;  3ZGZ A;  4GOC A;  2RGF A;  4ICV A;  3EGR A;  1N5X A;  2CU3 A;  2LAS A;  1HZ6 A;  4KHA A;  3ZJV A;  4FXC A;  4TQ1 A;  2D3B A;  3AEG B;  4ANX A;  1V5P A;  2DHZ A;  4MGK E;  2XN9 C;  2LRU A;  2G1E A;  2W2X D;  1Q10 A;  3FVC A;  4A20 A;  2VH2 A;  2OQB A;  2MWS B;  4MH0 E;  2RR9 A;  2JT4 B;  4MSQ B;  1EF1 A;  2GCJ A;  1WX9 A;  4WWN A;  4MM3 B;  3ZDT A;  3PG7 A;  1I35 A;  2PZ1 A;  4ACF A;  3DVN V;  5IRS A;  4ZYN A;  2N9E B;  2KK8 A;  3DQV A;  3DVN U;  2PE9 A;  3P2B A;  3VR9 B;  3G9W A;  1KLU D;  1UEL A;  3TJP A;  2YS5 A;  2EC1 A;  1ENF A;  4JK7 A;  3AXC A;  4FLH A;  1VZ8 A;  2K00 A;  2CJN A;  1YQB A;  5TSS A;  1F1H A;  4GIV A;  3PRZ A;  1KFY B;  1FO4 A;  4ZHP A;  4JK8 A;  2E2X A;  2K39 A;  4K2P A;  3ZXV A;  2M38 A;  1TY2 A;  4BKS D;  1KLG D;  1BUI C;  2A4Z A;  2WXH A;  3QC8 B;  3UIP B;  3U12 A;  4RM8 A;  5GMV A;  2CRF A;  1DDV A;  1FOE A;  3APF A;  1WGU A;  2INP E;  3Q8C A;  4NAM A;  3RZW C;  4FBJ B;  3CF6 E;  1IBX B;  1V5M A;  4MM3 A;  2INC C;  1JRP A;  4PNK A;  3CMM B;  1Y8R C;  3NZS A;  1GB4 A;  5CHW A;  3NWF A;  1BXT A;  3N9Y C;  4WQM A;  1NEK B;  1QOF A;  1UGM A;  2K1F A;  2ABD A;  2NVU I;  3QK0 A;  1CQV A;  3MPX A;  4K2O A;  3AEE B;  5E6J A;  1GC7 A;  5E6P A;  3PZD A;  2I38 A;  2BB6 A;  5MPO A;  1SJH D;  2CR5 A;  3HIZ A;  3MC9 A;  4XWW A;  1PUT A;  2IO0 B;  1MPE A;  2RD0 A;  3HUI A;  2QCZ A;  2KO3 A;  1BTK A;  4NNJ B;  1WJ4 A;  4MK0 A;  3IAS 1;  1JRO A;  4N58 A;  1MIZ B;  1OTR B;  2FJU B;  2BW2 A;  1YQ3 B;  1FHO A;  3PLU A;  1I2H A;  4KVG B;  2Y5C A;  4IWP A;  1STE A;  2IGG A;  1C79 A;  3FC4 A;  2MBH A;  2L1C A;  5J2R A;  3U4E G;  3AUL A;  1U5G A;  1QQG A;  2FCS A;  3P4Q B;  2ACZ B;  2V0G A;  4WWP A;  1S3S G;  3PSE B;  2ROV A;  2XEW A;  3VR8 B;  1IBX A;  3A8P A;  4S17 A;  3ENE A;  1WGR A;  4IG7 B;  2I5C A;  1TTN A;  2WQY B;  1WMH B;  1OGW A;  5IJM A;  4L23 A;  3ZUN A;  5KHO A;  4K7U A;  4ICU A;  4WSF A;  5C79 A;  4M02 A;  1P7F A;  2XBB C;  1S1Q B;  1IP9 A;  1TBE A;  5I2M A;  2Y5B B;  2ZEQ A;  4CHJ A;  2KAN A;  1PGX A;  3PRE A;  1HBK A;  1JWS D;  1E5W A;  3RNE C;  4HK2 A;  4HDO A;  5AEK B;  2MRP A;  1IUE A;  3N3K B;  3X0W A;  4HXD A;  3ZDM C;  4GNK B;  4RGO S;  4L1R A;  3T9L A;  1YN5 A;  4WIP A;  2Y7B A;  2DZI A;  3L54 A;  1N62 A;  2BGF A;  2KJH B;  2JZZ A;  2LZ6 A;  2MJ3 A;  4HVB A;  2BS4 B;  1GB1 A;  2NR2 A;  3SBG A;  2BPS A;  2KAJ A;  4A8X C;  3KRW A;  1E8Y A;  1WMH A;  4LJO B;  1QF6 A;  3P1M A;  2DFK A;  5HI1 A;  2RLO A;  3V61 A;  2DAJ A;  3O96 A;  1UD7 A;  1UNP A;  4ZRK A;  3PT2 B;  3OJ4 B;  5JXV A;  1EWY C;  2CQU A;  1TKE A;  4O1N A;  2Q13 A;  4HJK A;  3TFM A;  5L81 A;  1PDX A;  1XXG A;  1C1Y B;  4NZL B;  4A6K A;  3TL5 A;  1WI0 A;  3PLV A;  3FLV A;  1ZXI A;  5I4D A;  1DRO A;  1VBH A;  3IT4 B;  2MBO A;  3LJU X;  4L6E A;  3BYT B;  2KC1 A;  1XLN A;  5CHV C;  5C23 A;  4RGT A;  2KIE A;  1V97 A;  5HE2 A;  1E90 A;  1HTO A;  2KN4 A;  1E7P B;  3SEB A;  2JRI B;  5AUK A;  5EE9 A;  3AEF B;  2K0P A;  4KDL B;  2YRY A;  2QEJ C;  3VDZ A;  3K9P B;  5I2S A;  5IP4 D;  3TSS A;  2W54 A;  1PLS A;  4KHO A;  2LEK A;  3S2A A;  1WR6 E;  4HLE A;  2NMB A;  2KWC A;  3PVL A;  1WM2 A;  2JRH A;  2Z14 A;  3H7S A;  3NVW A;  3A1Q B;  1GUA B;  1QT9 A;  4WVF B;  1WFY A;  3QWM A;  4LLG M;  4CSQ A;  1ZYI A;  3WIM A;  2LYD A;  3GZN I;  2QIE B;  2ZPN A;  1ZW7 A;  2ONQ A;  3VIA A;  4C7Y A;  4NSW A;  2SEB D;  4I6N B;  4PK1 A;  3PVW A;  1SJE D;  3WYF B;  3NS8 A;  1K53 A;  3SV1 A;  2L52 A;  4MSM B;  2YT2 A;  4JKG B;  4HAY B;  2L3Z A;  2D2Q A;  2DX1 A;  4EZL A;  2P0F A;  3R3M A;  1OY2 A;  4DXA B;  3ULC A;  1EWC A;  2WP9 B;  4NAW A;  2D5G A;  3VVW B;  3R7Q A;  5FI1 A;  1JRU A;  2WU5 B;  2BYF A;  3A9K B;  3HM3 A;  4GLS C;  1V81 A;  2M0X A;  4FUL A;  4GPT B;  3I9V 1;  3CST A;  1MK7 B;  4K3C A;  2LXC A;  4IOY X;  4GZU A;  3OG5 A;  2LFI A;  1UWM A;  2PJH A;  1E9M A;  4BKG A;  3JSV B;  1SE3 A;  3A1Q A;  2L2I A;  1OEY J;  4TKN A;  4KX6 B;  4MEM A;  2W82 A;  1UBQ A;  2QKL A;  3DVG X;  1RAX A;  1YOV B;  5JLJ B;  1L6U A;  1WYG A;  3DVG Y;  5J3T A;  1JWB D;  2L0T A;  3F5R A;  1WRD B;  3ZYY X;  2WYQ A;  4DXG A;  4IKG A;  2IPK D;  4WUR A;  5DH9 B;  1OQR A;  2PTL A;  4JKG A;  2BCJ A;  2KIG A;  3D32 A;  4NJ7 A;  1Y5O A;  4GU2 A;  2NBV B;  1ZOY B;  2FE8 A;  4PS8 A;  3N7C A;  5CLL B;  3A9K A;  4HAX B;  3TMP B;  2Z4D A;  1OEY A;  3NWA A;  2X0S A;  1XKE A;  3RNG C;  3HM6 X;  1P9D U;  1V80 A;  2E3T A;  4KSL C;  1XX0 A;  1A5R A;  3ZTC A;  3B77 A;  5CTR C;  1U2B A;  3HVD A;  1ROE A;  2IYD B;  3AE2 B;  5D2M B;  3JSV A;  5JZE B;  2UZR A;  3A4R A;  2VRR B;  4F7U P;  4RM9 A;  1P1A A;  2ZCB A;  1WGQ A;  4DHZ B;  5LOP B;  2JWZ A;  1TS5 A;  2KVR A;  3H7P B;  1LXD A;  5LXH A;  1Z87 A;  2ZCC A;  4RMA A;  5JHH A;  1HE8 A;  3E56 A;  1MKE A;  2NTS A;  1SEB D;  3C0R B;  3WCQ A;  2PKO A;  3E9P A;  4D6W A;  3ZO5 B;  2NPT A;  5EFX A;  1MAI A;  3VOQ A;  2NBV A;  1K52 A;  3R66 C;  1U29 A;  1UNQ A;  2DLW A;  3ZIM A;  1AYF A;  2WWZ A;  4J6I A;  2D3C A;  5D6J B;  3VRB B;  2JZP A;  3DHG C;  1JW9 D;  1Z2M A;  5DPT A;  3Q8E A;  2OHF A;  3RN9 C;  3RUI B;  2L7R A;  4RGM A;  2WXF A;  3T3O A;  3H9D A;  3VTU A;  3VH4 B;  3VTW A;  4A6F B;  3FEH A;  2HDE A;  2REX A;  3MJW A;  2UZS A;  5LON B;  1K5G B;  1HEZ E;  4ZRQ A;  3URY A;  1E7U A;  3W1S A;  2D9X A;  2L00 B;  2L05 A;  4CHK A;  3H7P A;  1ZDV A;  1F52 A;  4G11 A;  3PVU A;  4C80 A;  3ECI A;  2GBK A;  1L2N A;  4E74 A;  5C6R A;  3OAW A;  1V5U A;  2PEA A;  1VJK A;  1XLQ A;  4GOU A;  1OQQ A;  3PHW B;  3RT3 B;  5C3J B;  2J53 A;  2HD5 B;  3ODW A;  2IO2 B;  2KFK B;  4OHJ A;  3RNA C;  4YWG G;  4HCN B;  2YSZ A;  1V1O A;  1FRD A;  2RPV A;  1T0S C;  3CSF A;  2X18 A;  4NQK E;  3T3N A;  2N23 A;  3P6A A;  1LQB A;  2DYO A;  2CU1 A;  3UGB B;  5IN7 A;  3Q8B A;  4GGQ A;  2PPH A;  2L76 A;  3CIR B;  3HSA A;  1KRH A;  1J7C A;  1YJJ A;  4JL9 A;  3IFW B;  4EJN A;  3MC8 A;  1L5P A;  3ZXR A;  5JH5 C;  5HKH A;  1TYG B;  1SGH A;  3W5V B;  1RLF A;  3SDL C;  3RMK C;  4HAZ B;  3UI3 A;  4A6F A;  1WZ0 A;  2KFJ A;  1T5X D;  4MT7 A;  4LNF A;  5LLI A;  3SU8 X;  1WJ1 A;  3CIK A;  3W2D A;  2Z0P A;  1N6Z A;  3SBT A;  3PRM B;  2NZ8 B;  3M63 B;  2RDH A;  3WAN A;  1D5M C;  2DA0 A;  3K9O B;  4BOZ B;  3ZKJ C;  1MG8 A;  2OOB B;  2YEP B;  1FB8 A;  4B6H A;  3KZ1 A;  2FCM A;  2BYE A;  3KWL A;  5D3I B;  5H92 C;  1ZGU B;  5G5G A;  1P6S A;  2JXT A;  3AEB B;  1YX6 B;  2CAY A;  3UIO B;  2UVM A;  2KDF B;  4A90 A;  1HA5 A;  3VQI A;  1WWT A;  4WWM A;  4K17 A;  3B9J A;  3ZQ4 A;  4OVV A;  3FP5 A;  5E6N A;  3L17 A;  5J3Y A;  4LK0 M;  3N1X C;  1WE7 A;  2V4I B;  2WH5 A;  4DX9 0;  3ML9 A;  3I63 C;  3NY5 A;  5HG2 A;  3Q2A C;  4P1B C;  3VUX A;  3NWD A;  2M56 B;  3EUB 2;  3RD2 A;  2DYM A;  3TEW A;  1W1D A;  4N6E B;  1WRI A;  2D07 B;  2ASQ A;  2WXO A;  2LUE A;  2DHI A;  3DDC B;  1U4A A;  1K51 A;  4KIK A;  5EE3 A;  4DBG A;  4BKT A;  2WXJ A;  2K2U A;  2GBJ A;  3ZJU A;  1BAK A;  2ADZ A;  2P8V A;  2OTX A;  1YJI A;  2LI5 A;  4K7S A;  3N1Y C;  1QQR A;  1F2R C;  1HB8 A;  5G55 A;  3ZW3 A;  1P3Q U;  1WY8 A;  1YMH E;  2JVC A;  3VTV A;  1DYQ A;  4JKD A;  2XNA C;  3QX1 A;  4ANV A;  4N9F 4;  2Z0D B;  3ZTD A;  1E8X A;  3ZNZ B;  3QWZ B;  1B55 A;  2LGS A;  2JSV X;  2E6X A;  2VKI A;  2K6Q A;  3FAH A;  5D3V A;  3KYC D;  5DPW A;  4W9C A;  2D11 A;  3EPY A;  1P3R A;  2D4Q A;  5GXG B;  4FHK A;  3F0W A;  2MBB B;  4C7Z A;  3T06 A;  1K50 A;  2D9Y A;  3AE6 B;  4ILH A;  4IWO A;  4JKC A;  2AX5 A;  1LO5 D;  1UUP A;  4YON A;  4BBK A;  5T8I A;  5KQ4 A;  1MPH A;  2BQQ A;  4LNO A;  1I4H A;  1MI1 A;  1LGR A;  4DBB A;  4II2 B;  3AU4 A;  2FCN A;  3P7Z A;  2EKI A;  2DYN A;  2N9L A;  3A9J A;  2NTT A;  3A98 B;  2ZNV C;  1N5W A;  3DXC A;  1JWA D;  3FM8 C;  1X05 A;  3HW2 B;  1F2R I;  1R4N B;  1NI2 A;  2BT6 A;  1V9J A;  2UWQ A;  2WGS A;  3Q14 C;  3AV8 A;  5C1Z A;  4LDT D;  1I4R A;  2IDY A;  3ZNI D;  1QOB A;  1J7A A;  4W9H A;  4PQ0 A;  4ZRI A;  4C4V B;  2ELA A;  4L1B A;  2DX5 B;  1FD6 A;  4Z2N A;  3DPD A;  3VUY A;  3LYY A;  2J52 A;  3IXS A;  3ODX A;  3ENB A;  1V61 A;  1TZO A;  3B0A A;  1SB3 C;  2PVG C;  1B9R A;  2X8X X;  4HRS A;  3GYP A;  3ETR A;  3V05 A;  1SXT A;  3HVZ A;  1MG4 A;  4JE3 B;  3Q3F A;  5C5B A;  4IM3 A;  2JU6 X;  2KJ6 A;  1RRP B;  2M17 A;  1FMA D;  4LTU A;  5BYQ A;  5E6O A;  1TGZ B;  1ZC3 B;  1JAL A;  3AE4 B;  2J0K A;  5HE0 A;  1AW7 A;  1SHC A;  2IO3 B;  2AYO B;  2V9H A;  3NS1 A;  4IOI E;  4CO7 A;  3E9O A;  1ST7 A;  4AUQ C;  3BVZ A;  1OMW A;  4TV3 A;  1V89 A;  2GMI C;  4F7H A;  1BTN A;  3U7Z A;  2LVO A;  2G4D B;  3H6N A;  1BML C;  3GZN B;  1XQQ A;  3O13 A;  4EE2 A;  1TJE A;  5M4Y B;  1WH3 A;  2KDB A;  2CKH B;  5DCN A;  1WGK A;  4ZYS A;  1FHW A;  1SIF A;  2HTM E;  2AL6 A;  3HRD D;  4C4V A;  3DXE A;  2JYE A;  4KSK C;  2EKE C;  2N9K A;  2DX5 A;  4TQ0 A;  4TSS A;  3OHM B;  4TUU A;  2RVB B;  1XOD A;  4MGZ E;  2KT7 A;  1FFU A;  1V88 A;  5AZG A;  3WAL A;  2WNM A;  2IJ0 A;  4WQO B;  2W2W A;  3VRA B;  5BYR A;  1UPR A;  1X11 A;  3HQC A;  3AU5 A;  4HJG E;  2WXP A;  2GBM A;  4WAA A;  5CHF A;  2V3P A;  3L13 A;  4HDQ A;  4H2A A;  2KWU B;  3NVY A;  4RF1 A;  1KLV A;  4AOF A;  3SO6 A;  5IO9 A;  2DEN B;  2Y8G A;  4KGT A;  2L1A A;  4RGN A;  2KMC A;  1CMX B;  2LGD A;  2JZ3 B;  3DCX A;  4PYU A;  2COA A;  2EMT A;  5D3Y A;  1ZUD 2;  2YEP F;  3ZNG C;  4B95 A;  2RDB C;  1V1P A;  1BWN A;  4A9A A;  1EO6 A;  4KV2 A;  1E10 A;  2J42 A;  2GRI A;  4GDL A;  1JDE A;  3TEX A;  1B1Z A;  3UIN B;  1YJ1 A;  3QA8 A;  3BIN A;  3QAQ A;  3V62 A;  2YS3 A;  4DK5 A;  4FAD A;  1FPY A;  3NG0 A;  4DHZ E;  1T0Y A;  4AS1 A;  3QIJ A;  4IUM B;  1XD4 A;  1WXV A;  3QCA A;  5L83 A;  1WE6 A;  2DNF A;  4YSX B;  3QBV B;  4W9E A;  1D4B A;  2KTF A;  1Q0W B;  1WVH A;  2ZZP B;  1PMS A;  2K8C A;  4JIO U;  3IVF A;  2DTC A;  5BMH A;  2ELB A;  2B3A A;  4K81 A;  1I4Q A;  1MHH E;  1TXD A;  2G9H D;  2I1K A;  3A4S C;  4BVU C;  2KAC A;  3U52 E;  4ANW A;  1SE2 A;  3AE1 B;  3VUW A;  2MJD A;  1FAO A;  2J7Q B;  4WJN A;  1TJ6 A;  3DWG C;  2M4N A;  2CHX A;  3P4R B;  2XK5 A;  2GCL A;  1XCG A;  2JYT A;  1DDW A;  1JWU D;  3LB8 C;  1UH6 A;  2VSZ A;  2ICI A;  2B76 B;  4JQW C;  5HE1 A;  1XT9 B;  2HJ1 A;  4NAW B;  5JP4 A;  4W9K A;  2PW9 A;  3GE8 C;  2BVC A;  3NZ3 A;  3B2F A;  3TEZ A;  5H8Y E;  1E7V A;  2IND C;  1E0Z A;  4ZRP A;  2WXQ A;  3L4P A;  4ARC A;  4WAF A;  4LCD E;  4IAP A;  3SR6 A;  1U27 A;  1ACA A;  3ZVR A;  1A70 A;  1D6E C;  2EJ8 A;  4OVZ A;  2FUG 1;  2BYV E;  3GP7 A;  1L0X B;  2KNB A;  2CHW A;  2MP2 A;  4DHJ D;  2J59 M;  4FJV B;  4W9G A;  1ZE3 D;  2QDF A;  2LG1 A;  1N60 A;  2KWV B;  4S0R A;  4HAU B;  3DBL I;  2LGI A;  5EE0 A;  2CY5 A;  1QOG A;  2AQ3 B;  5IKC M;  1RFA A;  5IAA C;  3A8Q A;  5J18 A;  5D27 A;  1ZC4 B;  2QSD A;  4MJS B;  3RYT A;  1GPX A;  4AQ7 A;  5D3X A;  1V2Y A;  3DBH B;  1V5T A;  5HFY A;  2K22 A;  3DBR I;  2VZK D;  2K6D B;  1HB6 A;  4DX8 A;  5JHG A;  1ACC A;  4C00 A;  4F8C B;  1N3H A;  2C7M B;  2JY6 A;  4YL8 A;  1NVL A;  3TCA A;  4OVU A;  1W1G A;  1FHX A;  4UDU C;  1C78 A;  3KLS X;  5GOW B;  1KJT A;  1DOX A;  5D3D A;  2KVZ A;  3EC8 A;  1UEF A;  2LD9 A;  4NJ6 A;  3KSY A;  1QOA A;  2MBE A;  3RPF C;  4B0E A;  1AQC A;  1I42 A;  1C77 A;  2MWN B;  2MKR A;  2I2Y A;  3U2S C;  4PS3 A;  1C3T A;  1U5E A;  4WJQ A;  2BB5 A;  1Q1O A;  1Z5S B;  3PO0 A;  3R2T A;  5DHF B;  1YQ4 B;  3KUD B;  3RNC C;  2K8H A;  2NPT B;  4GMV A;  1PGB A;  4RCO A;  1H4R A;  2JWU A;  2KYW A;  4MJS A;  4HB2 B;  3SHQ A;  1OFF A;  1QIL A;  4JWU C;  3PZ8 A;  3MC0 B;  3C19 A;  2ZVN A;  3CWI A;  4FJZ A;  2N7J A;  4XWT A;  2KQ7 A;  4DDI D;  4FHJ A;  2YT0 A;  1J7B A;  2FJ9 A;  2GJY A;  1E8W A;  1PFD A;  1WZ3 A;  3OJ3 A;  4F1S A;  2WDR B;  2WS3 B;  3BK2 A;  3KVF B;  4LDT B;  4OZC A;  4C0A A;  2O6V A;  1QC6 A;  1TIF A;  3DBS A;  1P98 A;  3RZF A;  3NW8 A;  2BF8 B;  3V60 A;  2M0A A;  2RSG A;  3RFZ B;  2LGY A;  4HB3 B;  3M62 B;  2N9X A;  2M1M A;  2H7E A;  1M7R A;  3IBE A;  1NDD A;  3ML8 A;  2ON8 A;  3DHH C;  1MFW A;  2N7E A;  1UBI A;  4ANU A;  1VZ6 A;  2HRJ A;  4B6W A;  2RNR B;  2V3N A;  2LJ5 A;  1TS2 A;  4HKZ E;  4I6L B;  2LJI A;  4XGA B;  2HE7 A;  3CXB B;  3QHT A;  4N59 A;  1QZE A;  4A6H A;  2ZVO A;  4JK9 A;  1KF6 B;  2J0J A;  4OT1 A;  4DIX A;  1M7E A;  2FJL A;  1ZSQ A;  1TQZ A;  3JVZ X;  1WGG A;  2DWQ A;  3NJT A;  5LNK 1;  2LKO A;  3L0W B;  3DWM A;  1D5X C;  2G45 B;  2M19 A;  1RJ2 A;  2LVQ A;  2Y3A A;  1KZ7 A;  2LUM A;  4EEW A;  3SUZ A;  3WAM A;  4OZA A;  2CB8 A;  3LXF A;  3FSS A;  2ZJD A;  4B9K A;  4GXB A;  2W2X C;  3RCZ A;  1MHX A;  1FFV A;  1TZ1 A;  1I4P A;  1XR0 B;  1L7Y A;  3D8D A;  3PPA A;  2ZKM X;  5FK9 C;  2KX3 A;  3U7D A;  3D8E A;  3L08 A;  2MBQ A;  2IGD A;  3KRX A;  4J3O D;  1GG3 A;  1YD8 U;  2WDV B;  2DLB A;  3AJ4 A;  2LOZ A;  1EF5 A;  1AAR A;  1ET9 A;  4YTP B;  4K1R B;  2XQN M;  4W9I A;  4XDC A;  3KYD D;  1WJN A;  3BVM A;  2LVP A;  2WXL A;  3BK1 A;  1WXA A;  3KW5 B;  2N1V A;  1HQR D;  1WX7 A;  1F9J A;  2MLB A;  3PSC A;  2FBW B;  2C5L C;  5LG4 B;  4JKB A;  4RF0 A;  3IG3 A;  4FJY A;  2HTH B;  4HAT B;  4QXA B;  2KQ4 X;  3KY9 A;  1T0Q C;  1ZXH A;  1X1F A;  4KIK B;  4NY0 A;  4QAY A;  3TBL D;  4IC7 B;  2AL3 A;  3TVV A;  3E9S A;  3WAO A;  3Q3J A;  5AZF A;  3R8B A;  1FXT B;  3BVG A;  2Y8F A;  3Q8A A;  1CJE A;  4KHB B;  1ZVR A;  2UU7 A;  4JPS A;  4P7I A;  5IA7 A;  3APC A;  2RGN B;  3GB1 A;  2I1J A;  1VR9 A;  4IM0 A;  4NJC A;  2N0Y A;  5BMG A;  2DBY A;  2CHZ A;  3AE9 B;  2KMM A;  1NVI D;  1DOI A;  4XDD A;  3PRP B;  3OAN A;  2QC8 A;  2QHO A;  1HXY D;  2QJL A;  2GLS A;  2DHJ A;  2BWE S;  2N7D A;  1G6J A;  5D7G A;  1DOY A;  2A5U A;  1M94 A;  2ZNV B;  2NMQ A;  2MEK A;  2DYQ A;  2W9N A;  3QQ8 B;  2HTH A;  3IHP C;  3V6E B;  2RDG A;  1DBH A;  2AWT A;  3PHX B;  2QMT A;  4Q2J A;  2M8S A;  1ZP0 B;  3U8Z A;  1TKG A;  3UQB A;  3AMZ A;  1FM0 D;  4M8M A;  2W3S A;  2KLG A;  4GMX B;  2R2Q A;  1BT0 A;  4WWO A;  3KUC B;  2KUQ A;  3RNF C;  4KHB A;  1NYR A;  2RRF A;  4NQL B;  2DKQ A;  2K9X A;  1X1G A;  3AB5 A;  2MW5 A;  3ZLZ A;  2DZK A;  2WXI A;  2KLC A;  4TYZ A;  3A9J B;  3OWE B;  1L4D B;  2LHD A;  3AI5 A;  2LGX A;  1J0W A;  1WXS A;  3P42 A;  2N0S B;  3W1Y A;  1TKY A;  2W3R A;  4XX5 A;  3MFG A;  1I7A A;  2Z0O A;  4MGY E;  3A58 A;  4BZA A;  2ZW1 A;  3FKY A;  3I3T B;  2PE6 B;  3WAP A;  2O6V D;  4E3C A;  3LJ3 A;  2R2O A;  4BOS C;  3AED B;  1AWE A;  3MTN B;  1RM6 C;  1I4G A;  3BZD B;  4L2Y A;  2WLB A;  1D5Z C;  4WJO A;  4DHJ B;  1E8Z A;  1KBL A;  1YN3 A;  1SF0 A;  1P7E A;  3X23 A;  4A5K A;  4HPP A;  2L8J A;  2KC2 A;  4ILJ A;  2BTE A;  1WGH A;  2GI9 A;  1IGD A;  2WX0 A;  4KGS A;  2FNJ B;  3QAR A;  3PS6 A;  5C5B B;  1V8C A;  3Q3M C;  1H8C A;  1LW3 A;  2LRW A;  2KKC A;  2H7D A;  4QJ3 B;  3GE3 C;  3KWV A;  2DAF A;  3IT6 B;  4HRO A;  3TUO A;  5DPS A;  1IYF A;  3B2G A;  2HJ8 A;  2K8B A;  2VZK B;  1EVH A;  2DYB A;  4HSI A;  1R7S A;  3N1Z C;  1N61 A;  3RI7 C;  1ZM0 A;  1UWX A;  4EZJ A;  1NTY A;  2KTR A;  2O2V A;  5G2N A;  1VBG A;  3R7R A;  1J8C A;  1XCT L;  4X57 B;  3ALB A;  1UF0 A;  4Z2M B;  4GDK B;  4HAV B;  2INN E;  3BY4 B;  3W5U B;  4HCP B;  2IO1 B;  2NBW B;  2Z59 B;  5CX3 A;  4BAX A;  1T0R C;  5TR5 A;  2I5F A;  2FDQ A;  3RCP A;  3EEC A;  2R0D A;  4M0W B;  1C9F A;  1EU3 A;  4YSY B;  1Y56 A;  4MH8 A;  3I5J C;  1PFJ A;  3VFK A;  3N30 A;  4G50 A;  2C7N B;  4KKJ A;  3BJI A;  1T3Q A;  4HWI B;  1SSN A;  3N32 A;  2Y5P A;  3AE8 B;  1YN4 A;  4DDG D;  5J17 A;  1XLP A;  4A6Q A;  5JHA A;  4JKA A;  3H8H A;  2R82 A;  1T6B X;  1KZG A;  1UGJ A;  5HE3 A;  5DIF B;  4AJW A;  5BO4 B;  2OJW A;  1V1P B;  3UF8 A;  2GBR A;  4MY6 A;  1Q5W B;  3NSU A;  1KOT A;  3MJ5 A;  2D9V A;  2L83 A;  5EDS A;  2GOW A;  4GDL B;  4Y94 A;  1NI3 A;  1SE4 A;  3KQ4 A;  4GDK A;  5C2T B;  4KGR A;  5KQ1 A;  1V86 A;  3I57 A;  4HB0 B;  3DBL B;  2Z59 A;  2KQS A;  2RUK B;  2C7H A;  3VHT C;  2PVO D;  3V5W A;  1JQ4 A;  2N9P C;  4M0W A;  4XWX A;  2C9W B;  1R4M I;  2IFS A;  2KCJ A;  4ZOH C;  3UZT A;  2V76 A;  1YNT E;  5CLQ B;  4II3 B;  4M8N A;  3NVZ A;  1GOZ A;  4XC2 A;  4P6V F;  1LFD A;  3AE7 B;  2V1Y A;  4QJ5 B;  3DBR B;  5DHA B;  3TO1 A;  3ODO A;  3ZJT A;  2GBN A;  1LM8 B;  3B1L X;  3EFC A;  1AN8 A;  1C76 A;  1UNS A;  1FXI A;  2BYT A;  4LNN A;  3J9C A;  3E66 A;  1VRA B;  1SBB B;  4KKI A;  1NU2 A;  3W9C B;  1U5D A;  3V6C B;  1KC7 A;  3PP2 A;  2KOX A;  2XK5 B;  4BBN C;  3ZNH B;  2G3Q B;  4W9D A;  5C16 A;  4IM2 A;  4US8 A;  5J3Q A;  1ZPS A;  4RNA A;  2AEH A;  3H1U A;  2N1W A;  5BYS A;  5AUI A;  1UZX B;  2MA9 B;  2TSS A;  1F77 A;  5JHB A;  3GYO A;  2KDI A;  4HPM B;  5D3W A;  5KCV A;  1L4Z B;  1L0V B;  1RFK A;  2D3G A;  3Q6B A;  2G4S A;  1EGX A;  4CQN A;  2MSE D;  2RQ1 A;  1EM7 A;  2P0D A;  1K5D B;  3V3X A;  1UPQ A;  4M01 A;  1LB1 A;  1VCB A;  1E6E B;  3ONS A;  2KGX B;  2D3A A;  1WF9 A;  4GB9 A;  4W9L A;  2MP2 B;  4FA6 A;  2MX2 A;  1GAQ B;  1WJ6 A;  4CYE A;  4YXD B;  3SD5 A;  3PTF C;  1TS3 A;  2IY1 B;  1NEN B;  3FIL B;  2Z0Q A;  2KN5 A;  3E9L A;  4P1C C;  1R4N I;  4H8S A;  1TS4 A;  1IGC A;  2KDM A;  1P5T A;  1F0Z A;  3VH3 B;  5L95 C;  3VAW A;  2UYZ B;  2WXG A;  3AH7 A;  4XE0 A;  1D3Z A;  4EMO A;  4HHV A;  2IZV B;  1DIK A;  2WDQ B;  1UNR A;  2VH1 A;  4OW0 A;  2FCQ A;  1FCL A;  3ULB A;  4OSN A;  3SNH A;  3L16 A;  5FR6 A;  5D94 A;  2JXX A;  1VLB A;  4D2K A;  3M1I B;  2LWP A;  3T8M A;  1V5O A;  4K3B A;  3P63 A;  2JP2 A;  3DXD A;  2AQ1 B;  4EKU A;  3Q3O C;  1WR1 A;  2COP A;  1PGA A;  2D10 A;  2IBI B;  3DCG A;  3NHE B;  3DOW A;  4IFS A;  4F7G A;  4ZHO A;  2BBC A;  3ML4 A;  4DQO C;  1KTK A;  4KZC A;  3JYU A;  5EE1 A;  4PS7 A;  3FIL A;  2G35 A;  4EOY A;  1V49 A;  2KHW B;  3D8F A;  1WJU A;  1FRR A;  3BII D;  3WA0 A;  2EMS A;  3Q3N C;  3Q69 A;  1KH0 A;  2YF0 A;  3UQA A;  3TEY A;  2BWF A;  3EA6 A;  1NYQ A;  3PV1 A;  5KHQ A;  1EUV B;  1J19 A;  1XCQ L;  3P4S B;  1L6V A;  3MHZ A;  1GC6 A;  2WDT B;  4ASW C;  2YS1 A;  2K5P A;  2PLP A;  2KXJ A;  2NCN A;  4G3X B;  1NBF C;  2QIL A;  2WHI A;  2L32 A;  3M3J A;  4A3P A;  2VRW B;  4DWF A;  2BS3 B;  4JX1 C;  1EU4 A;  5IOI A;  2IYB A;  4G0N B;  1DDM A;  3P4P B;  4B0M A;  4BBN F;  4EFO A;  1RYJ A;  3EHV A;  3KH0 A;  1CK1 A;  3ZVV A;  3HK0 A;  2O6V B;  4AP4 C;  2PMV A;  4HAW B;  2K8E A;  2MFQ A;  4IDI A;  1YX5 B;  1XEE A;  1WXM A;  1C4C A;  1FEH A;  2LBB A;  2YLM A;  2KZR A;  1SIJ A;  4P16 A;  1RRB A;  1RWS A;  2GB1 A;  1WYW B;  1OQY A;  4XYC A;  1VD2 A;  2MHJ A;  1SE9 A;  5HHD G;  2K2J A;  1T77 A;  4EZK A;  4MGI E;  2L0F A;  3ZRF A;  1XLO A;  1MI0 A;  2R61 A;  2Q5W D;  1XF5 L;  4W9J A;  1V6E A;  4REZ A;  5G5H A;  1GNU A;  1DGJ A;  3ZRC A;  4MEL A;  4GSW A;  2DZM A;  2ROZ B;  2BKF A;  2W55 A;  4OZB A;  4JLC A;  1VDV A;  2COD A;  1Q67 A;  2K49 A;  2FAZ A;  2K3U A;  4IWQ A;  1OQN A;  3NOB A;  2JF5 A;  1I7H A;  4US9 A;  4D0N B;  1I4X A;  2KDE B;  4M00 A;  2GS0 A;  1WI1 A;  2COC A;  4QJ4 B;  2H88 B;  4E71 A;  1FGZ A;  2JQR B;  1X86 A;  3R2I A;  4YTN B;  2K25 A;  2N4F A;  2WXM A;  3JW0 X;  4JKE A;  1HTQ A;  1C4P A;  4KDI C;  1WGD A;  4AJY B;  2COF A;  4A3O A;  1TY0 A;  2LHE A;  2EEL A;  2MJE A;  2NS5 A;  2IY0 B;  2KX0 A;  4A55 A;  4FN2 A;  2CS4 A;  4JKH A;  2ZW0 A;  1AWD A;  3OLM D;  3TIX A;  3C8Y A;  1EAZ A;  2ZPY A;  3LDZ E;  2P0H A;  1J0G A;  4WH4 A;  4R3D A;  4YTM B;  1WGY A;  1X1M A;  1HZ5 A;  1MVK A;  1N63 A;  4IW0 A;  3NRZ A;  1H10 A;  4AWJ A;  3RNB C;  3SFE B;  2JX5 A;  4TMA B;  1CZP A;  4YSZ B;  3GOE A;  1ESF A;  1WM3 A;  1MIX A;  4ARI A;  2LMC A;  2GUM A;  2WXK A;  2OED A;  2DN6 A;  4KAX B;  3BWU D;  4MAC A;  1U5F A;  2DHK A;  1JWM D;  4LNI A;  5BMI A;  1TT5 B;  3A33 B;  5AZH A;  4LJP B;  2CY4 A;  2JPH A;  3MP9 A;  3TW1 A;  2FUH B;  1FXA A;  4EUT A;  4F7Z A;  2LUL A;  4GN1 A;  3U30 A;  4HB4 B;  3SYX A;  4I6P A;  5FI0 A;  4BKS A;  5DI9 B;  2MDX A;  1FNU A;  1P0R A;  2X38 A;  3NVV A;  2KMA A;  1XO3 A;  1MK9 B;  4RH6 A;  1JCK B;  4WJ7 A;  2KUP A;  2NBU A;  2RMM A;  4HKQ A;  1NTI A;  4ZRJ A;  1MJD A;  3GS2 A;  3VXW A;  3IAM 1;  2KR0 A;  3AEA B;  2V3S A;  1QKZ A;  2MCN B;  4DXF A;  2WX1 A;  3DBH I;  4NPN A;  1IPG A;  2C60 A;  1VZ7 A;  2J4X A;  4XZ4 A;  4PT5 A;  2H89 B;  1ISN A;  1PQS A;  1WSP A;  3L10 B;  1WX8 A;  1NTV A;  3HHM A;  2RSU A;  4JGH B;  2YVC A;  2WXN A;  4JKF A;  2Z13 A;  2OJR A;  3W1S C;  1FGY A;  4RFB A;  3RUL A;  4PYZ A;  2CJO A;  3DHI C;  1YIW A;  2BS2 B;  1Y19 B;  3PGE A;  5FR3 A;  4KZ0 A;  2D9Z A;  3QJZ A;  4W9F A;  5DPR A;  2AQ2 B;  3O65 B;  4YT0 B;  4ITK A;  2KD0 A;  4BFR A;  2DIK A;  1L0Y B;  2DZJ A;  2R09 A;  3PEG A;  3N20 C;  3EFU A;  1WIA A;  4HPL B;  3HIE A;  2R2Y A;  3ABV B;  2Z8L A;  4MT5 A;  2YT1 A;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 3KUZ A;  2J0M A;  2DKP A;  1WJM A;  2MQJ A;  2RPQ A;  1WG7 A;  2KFK A;  3NZU A;  4K7W A;  1KI1 B;  2QKM A;  4WJP A;  5LXI B;  1GGO A;  3MHS D;  3B08 A;  4CHM A;  1KM7 A;  2LOX A;  3APD A;  1K8R B;  4ZDV A;  4ILG B;  2FID A;  1DYN A;  2V4L A;  2FIF A;  1GJZ A;  1IRS A;  2D9W A;  2KJR A;  3M95 A;  2O2V B;  2KTR B;  5JVL A;  4MDK E;  4URK A;  2LXA A;  2Z0E B;  1W1H A;  3MDB C;  2BKR B;  1XD3 B;  2JUO A;  1ZKH A;  2M14 A;  4GOC A;  2RGF A;  4ICV A;  2LAS A;  4KHA A;  4TQ1 A;  4ANX A;  1V5P A;  2DHZ A;  4MGK E;  2LRU A;  2W2X D;  4A20 A;  2OQB A;  2MWS B;  4MH0 E;  2RR9 A;  2JT4 B;  4MSQ B;  1EF1 A;  2GCJ A;  1WX9 A;  4WWN A;  3ZDT A;  3PG7 A;  1I35 A;  2PZ1 A;  3DVN V;  4ZYN A;  2N9E B;  2KK8 A;  3DQV A;  3DVN U;  2PE9 A;  3P2B A;  3G9W A;  1UEL A;  3TJP A;  2YS5 A;  2EC1 A;  4JK7 A;  3AXC A;  4FLH A;  2K00 A;  1YQB A;  4GIV A;  3PRZ A;  4JK8 A;  2E2X A;  2K39 A;  4K2P A;  2M38 A;  4BKS D;  2A4Z A;  3QC8 B;  3UIP B;  4RM8 A;  5GMV A;  2CRF A;  1DDV A;  1FOE A;  3APF A;  1WGU A;  4FBJ B;  3RZW C;  3CF6 E;  1V5M A;  4MM3 A;  4PNK A;  3CMM B;  1Y8R C;  3NZS A;  5CHW A;  1UGM A;  2K1F A;  2ABD A;  2NVU I;  3QK0 A;  3MPX A;  4K2O A;  5E6P A;  1GC7 A;  3PZD A;  2CR5 A;  3HIZ A;  2IO0 B;  2RD0 A;  2KO3 A;  1BTK A;  4NNJ B;  1WJ4 A;  4MK0 A;  1MIZ B;  1OTR B;  1FHO A;  3PLU A;  1I2H A;  4KVG B;  4IWP A;  2MBH A;  2L1C A;  5J2R A;  3AUL A;  1U5G A;  1QQG A;  2FCS A;  4WWP A;  1S3S G;  3PSE B;  2ROV A;  2XEW A;  3A8P A;  3ENE A;  1WGR A;  4IG7 B;  2I5C A;  1TTN A;  1WMH B;  1OGW A;  5IJM A;  3ZUN A;  5KHO A;  4K7U A;  4ICU A;  4WSF A;  5C79 A;  2XBB C;  1S1Q B;  1IP9 A;  1TBE A;  2Y5B B;  2ZEQ A;  4CHJ A;  2KAN A;  3PRE A;  1HBK A;  1E5W A;  4HK2 A;  4HDO A;  5AEK B;  2MRP A;  3N3K B;  3X0W A;  4HXD A;  3ZDM C;  3T9L A;  2Y7B A;  2DZI A;  3L54 A;  2BGF A;  2KJH B;  2JZZ A;  2LZ6 A;  4HVB A;  2NR2 A;  3SBG A;  2BPS A;  3KRW A;  1E8Y A;  1WMH A;  4LJO B;  2DFK A;  3V61 A;  2RLO A;  2DAJ A;  3O96 A;  1UD7 A;  1UNP A;  4ZRK A;  3PT2 B;  3OJ4 B;  2CQU A;  2Q13 A;  4HJK A;  3TFM A;  5L81 A;  1C1Y B;  4A6K A;  3TL5 A;  1WI0 A;  3PLV A;  3FLV A;  1DRO A;  1VBH A;  2MBO A;  3LJU X;  4L6E A;  2KC1 A;  5CHV C;  5C23 A;  5HE2 A;  1E90 A;  2JRI B;  4KDL B;  2YRY A;  3VDZ A;  3K9P B;  1PLS A;  4KHO A;  3S2A A;  1WR6 E;  4HLE A;  2NMB A;  2KWC A;  3PVL A;  1WM2 A;  2JRH A;  3H7S A;  3A1Q B;  1GUA B;  4WVF B;  1WFY A;  3QWM A;  3WIM A;  2LYD A;  3GZN I;  2ZPN A;  1ZW7 A;  3VIA A;  4NSW A;  4I6N B;  3PVW A;  3WYF B;  3NS8 A;  3SV1 A;  4MSM B;  4JKG B;  4HAY B;  2L3Z A;  2D2Q A;  2DX1 A;  4EZL A;  2P0F A;  3R3M A;  1OY2 A;  4DXA B;  3ULC A;  4NAW A;  3VVW B;  3R7Q A;  5FI1 A;  1JRU A;  3HM3 A;  3A9K B;  2BYF A;  1V81 A;  2M0X A;  4FUL A;  4GPT B;  3CST A;  1MK7 B;  2LXC A;  4IOY X;  4GZU A;  2PJH A;  4BKG A;  3JSV B;  3A1Q A;  2L2I A;  1OEY J;  4TKN A;  4MEM A;  1UBQ A;  2QKL A;  3DVG X;  1RAX A;  5JLJ B;  3DVG Y;  5J3T A;  2L0T A;  3F5R A;  1WRD B;  2WYQ A;  5DH9 B;  4JKG A;  2BCJ A;  3D32 A;  4NJ7 A;  1Y5O A;  4GU2 A;  2NBV B;  4PS8 A;  3N7C A;  5CLL B;  3A9K A;  4HAX B;  3TMP B;  1OEY A;  2X0S A;  1XKE A;  3HM6 X;  1P9D U;  1V80 A;  4KSL C;  1XX0 A;  1A5R A;  3ZTC A;  5CTR C;  1U2B A;  2IYD B;  5D2M B;  3JSV A;  5JZE B;  2UZR A;  3A4R A;  2VRR B;  4F7U P;  4RM9 A;  1P1A A;  2ZCB A;  1WGQ A;  4DHZ B;  5LOP B;  2JWZ A;  2KVR A;  3H7P B;  1LXD A;  5LXH A;  1Z87 A;  2ZCC A;  4RMA A;  5JHH A;  1HE8 A;  1MKE A;  3C0R B;  3E9P A;  3ZO5 B;  2NPT A;  5EFX A;  1MAI A;  3VOQ A;  3R66 C;  1U29 A;  1UNQ A;  2DLW A;  3ZIM A;  2WWZ A;  4J6I A;  5D6J B;  1Z2M A;  5DPT A;  3RUI B;  2L7R A;  3H9D A;  3VTU A;  3VH4 B;  3VTW A;  4A6F B;  3FEH A;  2REX A;  3MJW A;  2UZS A;  5LON B;  1K5G B;  1E7U A;  3W1S A;  2D9X A;  2L00 B;  2L05 A;  4CHK A;  3H7P A;  4G11 A;  3PVU A;  3ECI A;  2GBK A;  1L2N A;  4E74 A;  5C6R A;  3OAW A;  1V5U A;  2PEA A;  3PHW B;  3RT3 B;  2HD5 B;  3ODW A;  2IO2 B;  2KFK B;  4HCN B;  2YSZ A;  3CSF A;  2X18 A;  4NQK E;  2N23 A;  3P6A A;  1LQB A;  2DYO A;  2CU1 A;  3UGB B;  4GGQ A;  2PPH A;  2L76 A;  4JL9 A;  3IFW B;  4EJN A;  5JH5 C;  5HKH A;  1SGH A;  1RLF A;  3SDL C;  4HAZ B;  4A6F A;  1WZ0 A;  2KFJ A;  4MT7 A;  5LLI A;  3SU8 X;  1WJ1 A;  3CIK A;  2Z0P A;  3SBT A;  3PRM B;  2NZ8 B;  3M63 B;  3WAN A;  2DA0 A;  3K9O B;  4BOZ B;  3ZKJ C;  1MG8 A;  2OOB B;  1FB8 A;  4B6H A;  3KZ1 A;  2FCM A;  2BYE A;  1ZGU B;  1P6S A;  1YX6 B;  2CAY A;  3UIO B;  2UVM A;  2KDF B;  3VQI A;  4K17 A;  4OVV A;  3FP5 A;  5E6N A;  3L17 A;  5J3Y A;  1WE7 A;  2WH5 A;  4DX9 0;  3ML9 A;  3NY5 A;  3VUX A;  3RD2 A;  2DYM A;  1W1D A;  2D07 B;  2ASQ A;  2LUE A;  2DHI A;  3DDC B;  1U4A A;  4KIK A;  4DBG A;  4BKT A;  2K2U A;  2GBJ A;  1BAK A;  2ADZ A;  2P8V A;  2OTX A;  2LI5 A;  4K7S A;  1HB8 A;  5G55 A;  3ZW3 A;  1P3Q U;  1WY8 A;  2JVC A;  3VTV A;  4JKD A;  3QX1 A;  4ANV A;  4N9F 4;  2Z0D B;  3ZTD A;  1E8X A;  3ZNZ B;  3QWZ B;  1B55 A;  2VKI A;  2K6Q A;  5D3V A;  3KYC D;  5DPW A;  4W9C A;  2D11 A;  3EPY A;  1P3R A;  2D4Q A;  4FHK A;  3F0W A;  2MBB B;  3T06 A;  2D9Y A;  4ILH A;  4IWO A;  4JKC A;  4YON A;  4BBK A;  5KQ4 A;  1MPH A;  4DBB A;  4II2 B;  3AU4 A;  2FCN A;  3P7Z A;  2DYN A;  3A9J A;  3A98 B;  2ZNV C;  3DXC A;  3FM8 C;  1X05 A;  3HW2 B;  1NI2 A;  1V9J A;  2UWQ A;  5C1Z A;  4LDT D;  3ZNI D;  4W9H A;  4PQ0 A;  4ZRI A;  2ELA A;  2DX5 B;  4Z2N A;  3DPD A;  3VUY A;  3ODX A;  3ENB A;  1V61 A;  3B0A A;  3GYP A;  3Q3F A;  5C5B A;  4IM3 A;  2KJ6 A;  1RRP B;  2M17 A;  5E6O A;  1TGZ B;  1ZC3 B;  2J0K A;  5HE0 A;  1SHC A;  2IO3 B;  2AYO B;  4CO7 A;  3E9O A;  1ST7 A;  4AUQ C;  1OMW A;  4TV3 A;  1V89 A;  2GMI C;  4F7H A;  1BTN A;  2LVO A;  2G4D B;  3H6N A;  1XQQ A;  1WH3 A;  2KDB A;  2CKH B;  5DCN A;  1FHW A;  1SIF A;  2AL6 A;  3DXE A;  4KSK C;  2EKE C;  2DX5 A;  4TQ0 A;  4TUU A;  2RVB B;  1XOD A;  4MGZ E;  1V88 A;  5AZG A;  3WAL A;  4WQO B;  2W2W A;  1UPR A;  1X11 A;  3HQC A;  3AU5 A;  2GBM A;  4WAA A;  5CHF A;  3L13 A;  4HDQ A;  2KWU B;  1KLV A;  4AOF A;  3SO6 A;  2DEN B;  2Y8G A;  2KMC A;  1CMX B;  2LGD A;  2JZ3 B;  4PYU A;  2COA A;  2EMT A;  5D3Y A;  3ZNG C;  4B95 A;  1BWN A;  1EO6 A;  4KV2 A;  4GDL A;  1JDE A;  3UIN B;  1YJ1 A;  3QA8 A;  3BIN A;  3QAQ A;  3V62 A;  2YS3 A;  4DK5 A;  4FAD A;  4DHZ E;  1T0Y A;  3QIJ A;  4IUM B;  1XD4 A;  1WXV A;  3QCA A;  5L83 A;  1WE6 A;  3QBV B;  4W9E A;  2KTF A;  1Q0W B;  1WVH A;  2ZZP B;  1PMS A;  2K8C A;  4JIO U;  3IVF A;  2DTC A;  2ELB A;  2B3A A;  4K81 A;  1TXD A;  3A4S C;  2I1K A;  4BVU C;  4ANW A;  3VUW A;  1FAO A;  2J7Q B;  4WJN A;  1TJ6 A;  2M4N A;  2CHX A;  2XK5 A;  2GCL A;  1XCG A;  1DDW A;  1UH6 A;  2VSZ A;  4JQW C;  5HE1 A;  1XT9 B;  4NAW B;  5JP4 A;  4W9K A;  1E7V A;  4LCD E;  4IAP A;  1U27 A;  1ACA A;  3ZVR A;  2EJ8 A;  2BYV E;  2KNB A;  2CHW A;  2MP2 A;  4DHJ D;  2J59 M;  4FJV B;  4W9G A;  2LG1 A;  2KWV B;  4HAU B;  3DBL I;  2CY5 A;  1RFA A;  5IAA C;  3A8Q A;  5J18 A;  5D27 A;  1ZC4 B;  4MJS B;  3RYT A;  5D3X A;  1V2Y A;  1V5T A;  3DBR I;  2K6D B;  1HB6 A;  4DX8 A;  5JHG A;  4F8C B;  1N3H A;  2C7M B;  2JY6 A;  4YL8 A;  1NVL A;  3TCA A;  4OVU A;  1W1G A;  1FHX A;  5GOW B;  1KJT A;  3EC8 A;  1UEF A;  2LD9 A;  4NJ6 A;  3KSY A;  2MBE A;  1AQC A;  1I42 A;  2MWN B;  2MKR A;  4PS3 A;  1C3T A;  1U5E A;  4WJQ A;  1Q1O A;  1Z5S B;  5DHF B;  3KUD B;  2K8H A;  2NPT B;  4GMV A;  1H4R A;  4MJS A;  4HB2 B;  3SHQ A;  2ZVN A;  4FJZ A;  2KQ7 A;  4DDI D;  4FHJ A;  2YT0 A;  2FJ9 A;  2GJY A;  1E8W A;  1WZ3 A;  3OJ3 A;  4F1S A;  3KVF B;  4LDT B;  4C0A A;  2O6V A;  1QC6 A;  3DBS A;  1P98 A;  3RZF A;  2BF8 B;  3V60 A;  2RSG A;  2LGY A;  4HB3 B;  3M62 B;  2N9X A;  2M1M A;  2H7E A;  1M7R A;  3IBE A;  1NDD A;  3ML8 A;  2N7E A;  1UBI A;  4ANU A;  2HRJ A;  4B6W A;  2RNR B;  2LJ5 A;  4I6L B;  2HE7 A;  3CXB B;  3QHT A;  1QZE A;  4A6H A;  2ZVO A;  4JK9 A;  2J0J A;  1M7E A;  2FJL A;  1ZSQ A;  1TQZ A;  3JVZ X;  1WGG A;  2LKO A;  3L0W B;  2G45 B;  1RJ2 A;  2LVQ A;  1KZ7 A;  4EEW A;  3SUZ A;  3WAM A;  2CB8 A;  3FSS A;  2ZJD A;  4B9K A;  4GXB A;  2W2X C;  3RCZ A;  1TZ1 A;  1XR0 B;  1L7Y A;  3D8D A;  3PPA A;  2KX3 A;  3U7D A;  3D8E A;  3L08 A;  2MBQ A;  3KRX A;  1GG3 A;  1YD8 U;  3AJ4 A;  2LOZ A;  1EF5 A;  1AAR A;  4K1R B;  2XQN M;  4W9I A;  3KYD D;  1WJN A;  2LVP A;  1WXA A;  3KW5 B;  2N1V A;  1WX7 A;  1F9J A;  2MLB A;  3PSC A;  2C5L C;  4JKB A;  3IG3 A;  4FJY A;  2HTH B;  4HAT B;  3KY9 A;  1X1F A;  4KIK B;  4NY0 A;  3TBL D;  4IC7 B;  2AL3 A;  3TVV A;  3WAO A;  3Q3J A;  5AZF A;  1FXT B;  2Y8F A;  4KHB B;  1ZVR A;  4P7I A;  5IA7 A;  3APC A;  2RGN B;  2I1J A;  4IM0 A;  2N0Y A;  2CHZ A;  3PRP B;  3OAN A;  2QHO A;  2N7D A;  2DHJ A;  2BWE S;  1G6J A;  5D7G A;  2A5U A;  1M94 A;  2ZNV B;  2DYQ A;  2W9N A;  3QQ8 B;  2HTH A;  3IHP C;  3V6E B;  1DBH A;  2AWT A;  3PHX B;  2M8S A;  3U8Z A;  3UQB A;  4M8M A;  2KLG A;  4GMX B;  2R2Q A;  1BT0 A;  4WWO A;  3KUC B;  4NQL B;  2DKQ A;  1X1G A;  2MW5 A;  3ZLZ A;  2DZK A;  2KLC A;  4TYZ A;  3A9J B;  3AI5 A;  2LGX A;  1J0W A;  1WXS A;  3W1Y A;  4XX5 A;  1I7A A;  2Z0O A;  4MGY E;  3I3T B;  2PE6 B;  3WAP A;  2O6V D;  4E3C A;  3LJ3 A;  2R2O A;  4BOS C;  1AWE A;  3MTN B;  4DHJ B;  4WJO A;  1E8Z A;  1KBL A;  3X23 A;  4A5K A;  2L8J A;  2KC2 A;  4ILJ A;  1WGH A;  2WX0 A;  2FNJ B;  3QAR A;  3PS6 A;  5C5B B;  1H8C A;  1LW3 A;  2LRW A;  2KKC A;  2H7D A;  2DAF A;  5DPS A;  1IYF A;  2HJ8 A;  2K8B A;  1EVH A;  2DYB A;  1ZM0 A;  4EZJ A;  1NTY A;  2KTR A;  2O2V A;  5G2N A;  1VBG A;  3R7R A;  1J8C A;  4X57 B;  3ALB A;  4Z2M B;  4GDK B;  4HAV B;  3BY4 B;  4HCP B;  2IO1 B;  2NBW B;  2Z59 B;  5CX3 A;  5TR5 A;  2I5F A;  2FDQ A;  3RCP A;  3EEC A;  2R0D A;  4M0W B;  1PFJ A;  3VFK A;  3N30 A;  4G50 A;  2C7N B;  3BJI A;  4HWI B;  3N32 A;  4DDG D;  5J17 A;  5JHA A;  4JKA A;  2R82 A;  1KZG A;  5HE3 A;  5DIF B;  4AJW A;  5BO4 B;  3UF8 A;  2GBR A;  4MY6 A;  1Q5W B;  3NSU A;  1KOT A;  2D9V A;  5EDS A;  2GOW A;  4GDL B;  4Y94 A;  4GDK A;  5KQ1 A;  1V86 A;  4HB0 B;  2KQS A;  2RUK B;  2C7H A;  3VHT C;  3V5W A;  2N9P C;  4XWX A;  2C9W B;  1R4M I;  2IFS A;  2KCJ A;  3UZT A;  2V76 A;  5CLQ B;  4II3 B;  4M8N A;  4XC2 A;  1LFD A;  2V1Y A;  5DHA B;  3TO1 A;  3ODO A;  2GBN A;  1LM8 B;  3B1L X;  3E66 A;  1NU2 A;  1U5D A;  3V6C B;  1KC7 A;  3PP2 A;  2KOX A;  2XK5 B;  4BBN C;  3ZNH B;  2G3Q B;  4W9D A;  5C16 A;  4IM2 A;  5J3Q A;  2AEH A;  3H1U A;  2N1W A;  1UZX B;  2MA9 B;  5JHB A;  3GYO A;  2KDI A;  4HPM B;  5D3W A;  5KCV A;  2D3G A;  2G4S A;  1EGX A;  2MSE D;  2RQ1 A;  2P0D A;  1K5D B;  1UPQ A;  1LB1 A;  1VCB A;  3ONS A;  2KGX B;  1WF9 A;  4GB9 A;  4W9L A;  2MP2 B;  4FA6 A;  2MX2 A;  1WJ6 A;  4CYE A;  3SD5 A;  3PTF C;  2IY1 B;  2Z0Q A;  2KN5 A;  3E9L A;  1R4N I;  4H8S A;  1P5T A;  3VH3 B;  5L95 C;  3VAW A;  2UYZ B;  1D3Z A;  4EMO A;  4HHV A;  2IZV B;  1DIK A;  1UNR A;  2FCQ A;  3ULB A;  3SNH A;  3L16 A;  5FR6 A;  5D94 A;  2JXX A;  3M1I B;  2LWP A;  3T8M A;  1V5O A;  2JP2 A;  3DXD A;  4EKU A;  1WR1 A;  2COP A;  2D10 A;  2IBI B;  3DCG A;  3NHE B;  3DOW A;  4IFS A;  4F7G A;  3ML4 A;  4KZC A;  3JYU A;  4PS7 A;  2G35 A;  4EOY A;  1V49 A;  2KHW B;  3D8F A;  1WJU A;  3WA0 A;  2EMS A;  2YF0 A;  3UQA A;  2BWF A;  5KHQ A;  3PV1 A;  1EUV B;  1J19 A;  1GC6 A;  2WDT B;  4ASW C;  2YS1 A;  2KXJ A;  2NCN A;  4G3X B;  1NBF C;  3M3J A;  4A3P A;  2VRW B;  4DWF A;  2IYB A;  4G0N B;  1DDM A;  4BBN F;  4EFO A;  3EHV A;  3KH0 A;  3ZVV A;  3HK0 A;  2O6V B;  4AP4 C;  4HAW B;  2MFQ A;  1YX5 B;  1WXM A;  2LBB A;  2YLM A;  2KZR A;  1RRB A;  1WYW B;  1OQY A;  1VD2 A;  1SE9 A;  2K2J A;  4EZK A;  4MGI E;  2L0F A;  3ZRF A;  4W9J A;  1V6E A;  1GNU A;  3ZRC A;  4MEL A;  4GSW A;  2DZM A;  2ROZ B;  2BKF A;  4JLC A;  2COD A;  1Q67 A;  2FAZ A;  4IWQ A;  1OQN A;  3NOB A;  2JF5 A;  4D0N B;  2KDE B;  2GS0 A;  1WI1 A;  2COC A;  4E71 A;  1FGZ A;  1X86 A;  2K25 A;  2N4F A;  3JW0 X;  4JKE A;  4KDI C;  1WGD A;  4AJY B;  2COF A;  4A3O A;  2NS5 A;  2IY0 B;  2KX0 A;  4FN2 A;  2CS4 A;  4JKH A;  3OLM D;  3TIX A;  1EAZ A;  2ZPY A;  3LDZ E;  2P0H A;  1J0G A;  1WGY A;  1X1M A;  4IW0 A;  1H10 A;  4AWJ A;  3GOE A;  1WM3 A;  1MIX A;  2DN6 A;  4KAX B;  1U5F A;  2DHK A;  3A33 B;  5AZH A;  4LJP B;  2CY4 A;  2JPH A;  3TW1 A;  2FUH B;  4EUT A;  4F7Z A;  2LUL A;  4GN1 A;  3U30 A;  4HB4 B;  3SYX A;  4I6P A;  5FI0 A;  4BKS A;  5DI9 B;  2MDX A;  1P0R A;  2KMA A;  1MK9 B;  4WJ7 A;  2KUP A;  2NBU A;  1NTI A;  4ZRJ A;  3VXW A;  2V3S A;  2MCN B;  2WX1 A;  3DBH I;  4NPN A;  1IPG A;  2C60 A;  4XZ4 A;  1ISN A;  1PQS A;  3L10 B;  1WX8 A;  1NTV A;  3HHM A;  2RSU A;  4JGH B;  2YVC A;  4JKF A;  2OJR A;  3W1S C;  1FGY A;  3RUL A;  4PYZ A;  1YIW A;  1Y19 B;  3PGE A;  4KZ0 A;  2D9Z A;  3QJZ A;  4W9F A;  5DPR A;  3O65 B;  2KD0 A;  4BFR A;  2DIK A;  2DZJ A;  2R09 A;  3PEG A;  3EFU A;  1WIA A;  4HPL B;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...