2D2QA

Crystal structure of the dimerized radixin ferm domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 84
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d2qA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d2qA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d2qA01
4XWXA 2KDEB 2KFKB 2DX5A 4F7HA 1WI1A 3VTWA 3AJ4A 5JP4A 3DPDA 4L6EA 4BBKA 4NJ6A 1XT9B 4NQKE 4WJQA 2DYMA 2GBJA 4TQ1A 3VDZA 4HDOA 2H7EA 3P7ZA 1E8YA 1YX5B 2LXAA 3JVZX 1TTNA 2C5LC 3L0WB 4GGQA 3JSVB 4IW0A 3RZWC 4EZLA 2JVCA 5HKHA 3HM3A 5HE0A 1LB1A 1XX0A 2NPTB 4NY0A 1P9DU 3TO1A 3BY4B 2N9XA 3H7PA 2W2WA 5DHFB 4DX90 2V3SA 3M3JA 3HK0A 3R3MA 3PV1A 1ZW7A 2YSZA 4GZUA 1XQQA 3N7CA 1K8RB 2JRIB 2KD0A 2D9VA 4XZ4A 2PEAA 2GCJA 1U5EA 4WJNA 3D8DA 2K39A 2LBBA 2W2XC 4II2B 1WGYA 5EFXA 4GDLA 4IWQA 1XD3B 3M62B 2OTXA 2C7HA 4DDGD 2BYVE 4FBJB 3U8ZA 4BFRA 1IP9A 1XKEA 2V76A 3AULA 4MSMB 1WGRA 2MBHA 1SE9A 4ICUA 4FHJA 4MGKE 5CLLB 4AWJA 2KCJA 3VIAA 1RRPB 5FI0A 3EFUA 4HAWB 3AI5A 4KHBB 5D3WA 1PMSA 3KH0A 3TBLD 4FADA 1KJTA 2NVUI 4K2PA 2KMCA 2DYQA 4IOYX 1WJ6A 2PPHA 3KYDD 3WYFB 2B3AA 3ZNZB 4YONA 2L7RA 1U5FA 2KX0A 4W9FA 3DBHI 1WJMA 1Z5SB 4KIKB 2Z0QA 2CB8A 2VSZA 3DVNV 2GBKA 1WI0A 5GOWB 2FCMA 4AJYB 2KGXB 2LVPA 3D32A 4E71A 1M7EA 3PT2B 4KV2A 5J3YA 3SV1A 3I3TB 3PPAA 1V86A 4GDKB 3Q3JA 4X57B 3WAMA 5G2NA 2LXCA 2CQUA 1GUAB 1FAOA 1RLFA 2ZJDA 1PFJA 3OJ4B 2G45B 4F1SA 1OQYA 4IM3A 2MLBA 1J8CA 2DZIA 2D3GA 1I2HA 3N30A 2D9WA 2DFKA 5C79A 3VQIA 1FHXA 2LGDA 1UEFA 5D6JB 4D0NB 4NPNA 3NZUA 2XK5A 1WIAA 2IO0B 5J2RA 1E8ZA 3M1IB 2N1VA 4GPTB 2MX2A 4E3CA 1TJ6A 3UINB 2MBBB 2IYDB 2UWQA 3ZNID 1OY2A 2BWES 1IRSA 4DHJB 2FCSA 3GYPA 2ASQA 2KMAA 2MRPA 2R0DA 3A1QB 1MKEA 3RULA 3PLVA 3PZDA 3MHSD 1DDWA 3O96A 1ZC3B 1UPRA 2N23A 2REXA 1AARA 2MSED 5DPRA 1U5DA 3ECIA 2KZRA 4NAWA 1EVHA 1QC6A 3LJUX 4BBNC 2KQ7A 4LCDE 2IBIB 2NR2A 2KWVB 3PP2A 1RRBA 3ML8A 4K2OA 1DROA 1WGGA 3ODWA 5IA7A 3A33B 3VFKA 2EJ8A 3OLMD 4IWOA 2GCLA 2BGFA 2D4QA 1FGZA 2ZPNA 2RPQA 5LLIA 3MJWA 2LOZA 3QC8B 5C5BA 1S1QB 2KJHB 2ZVOA 2ROVA 5KHOA 2KO3A 2DHZA 2KWCA 2G4DB 2FCQA 1WXAA 2D9ZA 3NY5A 1UD7A 4MM3A 2N4FA 1X05A 3G9WA 5LXHA 1GG3A 3V5WA 4BKTA 2KTRA 4Z2NA 3TVVA 2XEWA 3SYXA 4MH0E 4RM8A 2GJYA 3DVGX 4WWOA 4HJKA 4HB2B 4A6FB 1WMHB 1YD8U 3L10B 4LDTB 4EFOA 1PLSA 4K17A 4J6IA 1KZ7A 2CRFA 1FXTB 2JRHA 4BKGA 4N9F4 3A8QA 5IJMA 3VTUA 3U7DA 3K9OB 1N3HA 3H7SA 2R09A 1WE7A 1EF1A 1RJ2A 3TMPB 4K81A 3RT3B 2A5UA 4KDIC 1GJZA 2KVRA 4EUTA 2C7NB 4ZYNA 4GB9A 4NNJB 1E8XA 4IAPA 2I1KA 5FI1A 1WY8A 5GMVA 3AXCA 3ZNHB 5E6PA 3X23A 3IVFA 5DIFB 4MEMA 2RD0A 3W1SC 4A3OA 1YQBA 2RVBB 2PJHA 4F7UP 2KOXA 3SUZA 1FOEA 2YS3A 1UELA 1V5UA 3DBRI 2KHWB 2KWUB 5J18A 4GMVA 1Q5WB 2NMBA 2KKCA 3ZKJC 4HWIB 2EMTA 2LYDA 3SU8X 1ZVRA 5L81A 2MQJA 2FCNA 4OVVA 1MAIA 1U27A 2CODA 3CXBB 3L13A 3R66C 2DTCA 3WAPA 2D9XA 2LASA 4KDLB 3PVLA 2Y8GA 2LD9A 4A3PA 3NSUA 2IO2B 2NBVB 3QX1A 3APDA 1DYNA 5JLJB 2O2VA 3JW0X 4KSLC 3ULBA 4DDID 2LZ6A 3KRWA 2GBRA 1UBQA 4JL9A 1P3QU 4URKA 2NS5A 2XBBC 3DOWA 1Z87A 3ZVRA 2CKHB 1PQSA 3M95A 2Z59B 2MBEA 2D10A 1OEYJ 1Q1OA 2A4ZA 3PHWB 3A9JB 3PLUA 4DX8A 4IG7B 2JWZA 3VHTC 3K9PB 2AYOB 3GOEA 4MGIE 4TQ0A 5DPSA 1KZGA 4I6NB 2M38A 4EKUA 1EO6A 2IY0B 1WGHA 3IBEA 1E5WA 2EC1A 3EHVA 2DAJA 5C16A 2JZ3B 4IM0A 2NBUA 4TV3A 2NBWB 1UBIA 1WXVA 4FJZA 4FULA 4W9KA 4WWPA 3H9DA 3TIXA 3DVNU 2K8CA 4EEWA 4HDQA 1W1HA 1WG7A 2K2UA 3H6NA 3TJPA 2MWSB 1SGHA 1NTVA 2JP2A 2NZ8B 2DYBA 4PS3A 1BTNA 1QZEA 4WAAA 1ZM0A 2DYOA 2QKLA 5BO4B 4CO7A 2ZZPB 2WWZA 2P0HA 4IFSA 2D2QA 4W9GA 2M1MA 2Z0OA 1U5GA 3MTNB 4IC7B 4A20A 2HE7A 1DDMA 3FP5A 3DXEA 3UZTA 1P1AA 4WWNA 4ANUA 4A6HA 4DWFA 4I6LB 4P7IA 2BPSA 2YT0A 3DCGA 1W1GA 1WRDB 3V6EB 4FJYA 4GDLB 1WXMA 4ANVA 1KI1B 4ANWA 2JPHA 2KJ6A 1IYFA 3APFA 5JH5C 2PZ1A 4KHOA 1X11A 5L83A 1V80A 2ZEQA 1H4RA 4M0WB 3EC8A 4JIOU 1V5MA 3AU4A 4HAXB 3KSYA 5JHGA 2PE6B 3FSSA 2K1FA 2NCNA 3KUCB 4HK2A 4IM2A 5DPTA 3W1YA 3HQCA 3EPYA 4HLEA 2UZRA 1VCBA 2LGXA 3PSEB 2DHKA 2ELBA 4A6KA 3TL5A 1I42A 2LVQA 4NJ7A 1P5TA 2AEHA 1H10A 4BOSC 3A9KB 2RSGA 4TKNA 2MWNB 4Y94A 4PS8A 1WM3A 2NPTA 3ML4A 2G35A 3LJ3A 4AOFA 3ZIMA 4BKSD 3N3KB 2AL6A 3NHEB 3VUWA 1WFYA 3WA0A 2R2OA 2N9PC 1R4NI 3DXCA 1MIZB 2ADZA 4MY6A 5AEKB 1X1FA 4HHVA 1GNUA 4F8CB 1MK9B 1AQCA 3PVWA 1WYWB 2L0TA 3QWZB 3ZRFA 3L08A 1TGZB 2RSUA 3SDLC 1LQBA 4K7UA 2RQ1A 2YRYA 2K8HA 3HM6X 3T8MA 1NVLA 1H8CA 5DHAB 5KQ4A 3ENEA 2UYZB 3A9KA 1HE8A 1E90A 4H8SA 4GN1A 1BWNA 1ZC4B 1E8WA 1T0YA 1WE6A 1WZ0A 4CYEA 1Q67A 1MPHA 2KLGA 2ZCCA 5D2MB 4ASWC 5DCNA 2MFQA 4FLHA 2M14A 1V81A 1WX7A 4G0NB 3JYUA 2K00A 1X1MA 2FDQA 4HXDA 4HPMB 1V9JA 1KLVA 2L05A 1W1DA 1D3ZA 2DA0A 2L2IA 2ZNVB 4LDTD 2LWPA 4F7ZA 3ZDTA 1Y19B 3PG7A 4WJ7A 3PEGA 4B6HA 1TQZA 2M4NA 3QA8A 2LOXA 4ZRIA 2WYQA 3ULCA 2DYNA 4DHZB 1VD2A 4K7SA 4KVGB 4HAZB 1V49A 1E7VA 4W9CA 1YJ1A 2FUHB 1V5PA 3UQBA 1WJUA 4W9JA 4WJPA 5AZFA 4FJVB 3PSCA 4BBNF 3ODOA 2GS0A 4HB4B 1LFDA 2JY6A 3C0RB 2M17A 4XX5A 1A5RA 1P3RA 3DBSA 3BINA 3B08A 2P8VA 5JHBA 5CHWA 1M94A 2LULA 4II3B 4RMAA 1EF5A 4WVFB 2KTFA 2KUPA 3R7QA 2QKMA 5CTRC 3PHXB 5FR6A 3PRPB 2Y5BB 2LUEA 5DH9B 2G4SA 2K25A 5CHFA 3ZW3A 2DKQA 5E6OA 2BYFA 2G3QB 3EECA 2VRWB 3D8EA 2C9WB 1TXDA 2KTRB 3H1UA 4EJNA 4ZDVA 2KC2A 2DHJA 2M8SA 2PE9A 1B55A 1J19A 1WM2A 3OJ3A 2L3ZA 2IFSA 3OANA 3TFMA 2WH5A 2BKFA 3ZTCA 3QK0A 3DBLI 3P6AA 4FN2A 2YF0A 4BVUC 4F7GA 1SHCA 1ZGUB 3UGBB 4EOYA 1Y5OA 3IFWB 3KUDB 1NBFC 1J0GA 1V6EA 2COCA 2KQSA 1QQGA 4KIKA 3QIJA 4CHKA 3VAWA 4HCNB 3W1SA 1FHWA 3CIKA 2J7QB 5CLQB 1YX6B 3VUYA 1S3SG 4G3XB 2XQNM 3VTVA 1J0WA 2RR9A 4W9IA 2RGNB 3WANA 3ZUNA 1V89A 1DBHA 3T06A 3KZ1A 3CF6E 4GU2A 3WAOA 1I7AA 1WR1A 1G6JA 2DAFA 4G11A 5AZGA 3DDCB 3DQVA 2MP2B 4KZ0A 4M8MA 5C5BB 2JZZA 1NDDA 4K7WA 2V1YA 3WIMA 2W9NA 3VH4B 4MJSA 5CHVC 1XCGA 1E7UA 3V6CB 1FGYA 2MBQA 3MPXA 2KDIA 3RUIB 2KFKA 3R7RA 4DK5A 3PGEA 2JT4B 2RLOA 1EAZA 3HIZA 3M63B 4A6FA 1WMHA 2JUOA 3F5RA 2DLWA 4DBBA 2K8BA 2KN5A 2RGFA 2L1CA 2BKRB 3PVUA 3A4RA 3VXWA 3A8PA 5LONB 4LJOB 3VVWB 2O6VA 3ZNGC 1WZ3A 4NQLB 4W9EA 1HBKA 4NSWA 4MT7A 1NTIA 1F9JA 1V5OA 4HAVB 1HB6A 2HJ8A 2MCNB 4I6PA 4WSFA 3O65B 2GBMA 3VUXA 4B6WA 4GXBA 3A9JA 2C7MB 2DN6A 3KY9A 4NAWB 3CMMB 2BYEA 3FLVA 3NS8A 4TUUA 3U30A 3QARA 1KM7A 2O6VD 2COFA 2WX1A 2R2QA 2N0YA 3DVGY 4AJWA 2CAYA 2J0MA 1LM8B 5L95C 1UNQA 3NOBA 3N32A 1X1GA 4HB0B 3ALBA 3F0WA 2CHXA 3PRZA 5D3XA 2IO1B 4AUQC 1KOTA 2L76A 2YS5A 3Q3FA 4DHZE 3ZTDA 4PYZA 4EZKA 3B0AA 4HVBA 2J0JA 3KRXA 3KUZA 3TW1A 2CR5A 4PS7A 1ST7A 1WJ4A 3RYTA 3UF8A 5D3VA 1NI2A 3GYOA 3V60A 2VKIA 2ABDA 1WX8A 5JZEB 5HE3A 2I5CA 5IAAC 2ZNVC 4RM9A 2IY1B 2HTHB 3APCA 3PRMB 2D07B 2J0KA 4C0AA 2LRUA 4HAYB 2YLMA 1ZKHA 4MSQB 4IWPA 2OQBA 3D8FA 2IZVB 2N7EA 4BOZB 2Y8FA 2GMIC 1WR6E 3KW5B 2IYBA 2P0FA 1L7YA 3QQ8B 2EKEC 1TBEA 1WF9A 3L54A 3V62A 2MKRA 2HD5B 3KYCD 3PTFC 2DZJA 1CMXB 5C23A 1UNRA 2H7DA 5J3TA 2C60A 2KXJA 1EUVB 3KVFB 3VH3B 2KFJA 1WGUA 1WH3A 3PS6A 2YS1A 3AU5A 1ISNA 2RUKB 1P0RA 2CHZA 5LOPB 2KC1A 4GIVA 4W9LA 4XC2A 2MA9B 2ELAA 2V4LA 1L2NA 2ZPYA 2HTHA 2IO3B 4GSWA 3NZSA 5LXIB 1LW3A 1AWEA 2JXXA 3RD2A 5D3YA 4CHMA 1U29A 1DDVA 2ZCBA 3L16A 5J3QA 4JLCA 5AZHA 2BF8B 2Z0PA 4OVUA 2N1WA 4ANXA 2EMSA 2FJ9A 5HE1A 3HW2B 3MDBC 3QCAA 1Z2MA 4PYUA 3VOQA 5C6RA 3A98B 3V61A 4IUMB 4GMXB 2JF5A 2AL3A 2LI5A 5KCVA 1RFAA 5D27A 3X0WA 2KDBA 2XK5B 4DXAB 2DKPA 1SIFA 1NU2A 1WGQA 2COPA 2LG1A 2DX5B 1K5DB 2FAZA 2L8JA 1P98A 3SNHA 3ONSA 4FHKA 4MELA 4E74A 3B1LX 2UVMA 5HE2A 2K6DB 5KQ1A 3A4SC 3UQAA 4JQWC 1XD4A 3S2AA 2BWFA 4WJOA 4ICVA 2MP2A 5G55A 5CX3A 3UIOB 1GC7A 4KAXB 4HB3B 2L00B 3A1QA 3JSVA 4FA6A 1HB8A 1UPQA 2MBOA 3L17A 4ZRJA 4CHJA 2HRJA 3QAQA 1XODA 3QJZA 3ZVVA 2CY5A 4HATB 1BAKA 2GBNA 2Y7BA 2CU1A 1WVHA 2VRRB 1ACAA 3PREA 4EMOA 1FHOA 2COAA 1NTYA 3RCPA 3ODXA 1V61A 4ZRKA 1XR0B 1U4AA 1WX9A 2FIDA 2LJ5A 2MW5A 3SO6A 2WX0A 4W9HA 2N9EB 2MDXA 3BJIA 2KX3A 3UIPB 2D11A 1YIWA 2O6VB 2I1JA 2DZKA 1WGDA 3IHPC 3ZO5B 1MG8A 2UZSA 2BCJA 2DENB 1RAXA 3T9LA 3TCAA 1WXSA 4KHAA 3ZDMC 2RNRB 5C1ZA 5JHHA 2J59M 2Z0DB 1WJ1A 1BTKA 2GOWA 3CSTA 1Y8RC 1P6SA 2L0FA 3QHTA 4M8NA 2I5FA 2W2XD 2OOBB 1ZSQA 3ML9A 4MGZE 5KHQA 2DHIA 2LVOA 1UGMA 1MK7B 4TYZA 4JGHB 1OQNA 3DXDA 2X18A 1I35A 1UZXB 4AP4C 1GC6A 2KANA 4B95A 4HPLB 3FM8C 3ZRCA 2FNJB 2QHOA 5E6NA 2DX1A 4GOCA 2E2XA 2FIFA 2CHWA 3RZFA 3SHQA 2LKOA 4KZCA 2YVCA 1X86A 1V5TA 2K6QA 4YL8A 1EGXA 5EDSA 4MK0A 2N7DA 4K1RB 1R4MI 4A5KA 2D9YA 2ZVNA 1K5GB 4WQOB 3GZNI 4BKSA 2OJRA 4HAUB 4GDKA 2CS4A 1UH6A 2KK8A 3P2BA 4MGYE 2AWTA 1UNPA 2K2JA 1Q0WB 4LJPB 1WJNA 5D94A 1LXDA 2WDTB 3RCZA 5J17A 5DPWA 2KNBA 1OGWA 3CSFA 2ROZB 3IG3A 1IPGA 3LDZE 2M0XA 3QBVB 5JHAA 3ZLZA 3QWMA 3HHMA 1JRUA 2DZMA 4HCPB 4DHJD 2P0DA 1FB8A 4PNKA 2KDFB 1OMWA 1OEYA 4EZJA 1V88A 2FJLA 2YT1A 4KSKC 5TR5A 4G50A 5DI9B 2O2VB 1M7RA 3FEHA 2LRWA 1C1YB 4DBGA 1C3TA 2LGYA 1BT0A 3WALA 4B9KA 1U2BA 1TZ1A 2KJRA 2CY4A 3OAWA 4MDKE 2Z0EB 2Q13A 1OTRB 1V2YA 2KLCA 4MJSB 3SD5A 4Z2MB 1MIXA 4W9DA 5D7GA 4PQ0A 3H7PB
chains in the Genus database with same CATH superfamily
2KFKB 1SEBD 1IUEA 1EWYC 3VDZA 4C4VA 5JXVA 1E8YA 2LXAA 3JVZX 4EZLA 3B2GA 3BY4B 1C4PA 2FBWB 3CIRB 4HPPA 3MC8A 3HK0A 3R3MA 3AE8B 3PV1A 1ZW7A 2YSZA 1ENFA 2RPVA 3RFZB 3N7CA 3RPFC 3KWVA 4UDUC 3DHIC 3E9LA 5M4YB 3M62B 2OTXA 3AULA 1WGRA 1SE9A 4JKCA 5CLLB 1C77A 3AV8A 5FI0A 3EFUA 4KHBB 4FADA 4ILGB 2KMCA 2L7RA 1U5FA 1C76A 4LTUA 3DBHI 1WJMA 2Z0QA 2VSZA 2Y3AA 2FCMA 1SE3A 4AJYB 2QILA 3SV1A 1XXGA 3I3TB 3PPAA 3W9CB 2K22A 1HXYD 3Q3JA 2KVZA 2LXCA 2M0AA 4WWMA 2DZIA 2D3GA 1I2HA 2Z59A 1T3QA 1GPXA 1D5XC 1E8ZA 4E3CA 2MX2A 1OY2A 4DHJB 2FCSA 3GYPA 2KMAA 1QT9A 3V05A 3A1QB 3PZDA 2WDQB 3MFGA 2REXA 3WCQA 2MSED 2QSDA 3A58A 4LCDE 4K2OA 3VFKA 1MVKA 1M4VA 3OLMD 4IWOA 1GB4A 1ZXIA 3MJWA 2KJHB 2ZVOA 1KH0A 3AB5A 2D9ZA 1WSPA 2NTTA 1JWAD 3G9WA 4BKTA 1FXIA 3SYXA 1OQQA 1KF6B 3DVGX 4HJKA 2L83A 3L10B 1PLSA 2L1AA 1XLOA 1N6ZA 2CRFA 3NW8A 1FXTB 2JRHA 1R4MB 3VTUA 3K9OB 1RJ2A 3TMPB 1ET9A 4KDIC 4ZYNA 1E8XA 4RFBA 4KKIA 1C4AA 2PJHA 4F7UP 2KOXA 1FOEA 2YS3A 1V5UA 1V97A 2RMMA 1OFFA 2KHWB 2KWUB 1FRDA 2K9XA 4JK8A 2KKCA 1ZVRA 5L81A 4OVVA 3FAHA 3R66C 2DTCA 1DIKA 3APDA 2O2VA 4KSLC 4DDID 2LMCA 1TS2A 2NS5A 3DOWA 3ZVRA 3M95A 3PHWB 2D10A 2A4ZA 5BMHA 4DX8A 2JWZA 2AYOB 5DPSA 1KZGA 2BB5A 5C3JB 1E5WA 4IM0A 3U4EG 2NBWB 1WXVA 4W9KA 1WYGA 1GOZA 3TIXA 1WG7A 1TJEA 1DGJA 3TJPA 2MWSB 2JP2A 1BTNA 1TZOA 5BO4B 1DYQA 1L5PA 2P0HA 4IFSA 2ZZPB 2M1MA 3FP5A 1P1AA 3BYYB 4WWNA 2CJOA 4DWFA 4P7IA 2W82A 1W1GA 3DCGA 4FJYA 4YT0B 1WXMA 4ANVA 1KI1B 4JE3B 4ANWA 4L1BA 5JH5C 4KHOA 5L83A 3T3NA 2OEDA 4YXDB 3AU4A 4HAXB 3KSYA 5JHGA 4HK2A 1STEA 1V1PA 2X8XX 2AEHA 3A9KB 2RSGA 4TKNA 4Y94A 3LJ3A 3BVGA 3ZIMA 3NHEB 2OJWA 3NJTA 3FC4A 4XYCA 4MY6A 5AEKB 4HHVA 1ZYIA 1MK9B 2L0TA 2INPE 3L08A 5EE3A 3SDLC 1LQBA 1DOXA 3HM6X 3FILA 5DHAB 1HE8A 1WE6A 4GN1A 1BWNA 1WZ0A 2D5GA 4G50A 1MPHA 1L0VB 5DCNA 4G0NB 2K00A 3AEDB 5H92C 1Q10A 2L2IA 4F7ZA 4B6HA 2M4NA 3PG7A 4ZRIA 2B76B 3I63C 1JCKB 4KVGB 2LJIA 3UQBA 1FO4A 4W9JA 5AZFA 4ZDVA 3PSCA 4P16A 4BBNF 1LFDA 2JY6A 2WHIA 1UUPA 2DWQA 4XX5A 5H8YE 3VR8B 2BW2A 2WNMA 1HEZE 3U2SC 3I9V1 2KUPA 3P4QB 5CTRC 2GRIA 2Y5BB 2G4SA 2K25A 3ZW3A 5E6OA 2K0PA 1TKEA 2Y5CA 3H1UA 4ZRQA 3PZ7A 2V0GA 1B55A 2D3CA 2W55A 3DBHB 2YF0A 2VH2A 3IFWB 3FVCA 1E7PB 2COCA 1L4ZB 4XDCA 4KIKA 3CIKA 5CLQB 3RNBC 1J0WA 2RR9A 2RGNB 1I7AA 4OVZA 4G11A 2MP2B 5C5BB 3VRAB 1J7CA 1I4GA 5GXGB 3LYYA 1FGYA 3MPXA 2KDIA 3GS2A 2JT4B 4A6FA 1EWCA 2RDHA 2DLWA 3VVWB 5D3IB 2HJ8A 4HAVB 1HB6A 4I6PA 4B6WA 2WXHA 2LEKA 3U30A 4TUUA 3QARA 1NI3A 3Q14C 2J0MA 4HB0B 3F0WA 2CHXA 3PRZA 5D3XA 3AEBB 2PLPA 3ZTDA 4PS7A 3RYTA 2VKIA 5IAAC 2WQYB 2IY1B 1JROA 3PRMB 2YLMA 2J0KA 2OQBA 2GMIC 1L7YA 2EKEC 3L54A 2HD5B 3AE5B 3KYCD 5C23A 1EUVB 4A8XC 1IBXA 2KFJA 3AE7B 1P7FA 1KBLA 4W9LA 3AU5A 2KC1A 2ELAA 4GSWA 1LW3A 2ZCBA 4JLCA 5AZHA 1QKZA 5IRSA 3BYTB 3AN1A 5HE1A 1B1ZA 1RM6C 2LI5A 1RFAA 3X0WA 2K3UA 2KDBA 3U52E 4DXAB 3AM9A 4ITKA 4E74A 4MELA 2WXRA 3B1LX 2K6DB 4KGTA 4JQWC 4C4VB 5G55A 1MG4A 2N0SB 2BTEA 2L32A 1GC7A 1HB8A 1UPQA 2OHFA 1P7EA 4HJGE 1L6UA 4HROA 1WRIA 1BAKA 2Y7BA 1WVHA 3HIEA 3PREA 2WX1A 2FIDA 2BB6A 3SO6A 3UIPB 4RGNA 2D11A 2DLBA 1ZPSA 3O13A 3T9LA 3ZDMC 1WXSA 4KHAA 3BVZA 2ZW1A 1WJ1A 1Y8RC 3RNFC 1F2RI 3TEZA 4TSSA 2QC8A 3ML9A 3NWDA 2VH1A 2DHIA 4TYZA 1UZXB 4JKEA 1DOYA 1GC6A 4JKGA 4QAYA 3FM8C 5E6NA 3AEEB 1FCCC 2CHWA 1FMAD 2YVCA 4WH4A 4A5KA 2D9YA 1ZOYB 5BMIA 2D3AA 4A55A 4P6VF 3NVYA 4MGYE 3TEYA 2K2JA 3RCZA 2N9KA 1OGWA 2BBCA 3CSFA 2UU7A 4HSIA 3QWMA 1JRUA 2DZMA 4DHJD 4ARIA 1YN4A 2KDFB 4EZJA 2N7JA 5DI9B 1M7RA 2LRWA 3WALA 2W54A 1QLBB 1DOIA 1OTRB 5IKCM 1AW7A 1MIXA 1AWDA 4PQ0A 2X0SA 3H7PB 1JQ4A 2KDEB 1WI1A 3DPDA 4BBKA 4NJ6A 1XT9B 2DYMA 1RWSA 4HDOA 2H7EA 4GGQA 3L0WB 3JSVB 3HM3A 5HE0A 1LB1A 2NPTB 2V3SA 2WXPA 5FK9C 2KDMA 1QILA 5FKAC 4GZUA 1XQQA 2J52A 2KD0A 2PEAA 3D8DA 1L4DB 2LFIA 3AE6B 3NS1A 2W2XC 4II2B 4IWQA 4K3BA 4GDLA 3U8ZA 2PMVA 2V76A 1VJKA 4MSMB 2KCJA 3VIAA 1RRPB 3SEBA 1L6VA 4YTPB 4W9GA 3KYDD 4IOYX 4XE0A 2J42A 3WYFB 2XNAC 1QQRA 1Z5SB 2SEBD 2GBKA 3I57A 2FJUB 2IGHA 3PT2B 4KV2A 2HJ1A 3P1MA 1YQ3B 4GDKB 2H88B 5G2NA 4S0RA 1GUAB 1RLFA 3PO0A 3OJ4B 4F1SA 1VRAB 1OQYA 5C79A 2KT7A 3Q3NC 1N63A 4RNAA 1UEFA 2N9LA 4RCOA 5D6JB 1VBGA 2EKIA 2Z13A 1XLQA 3M1IB 5I2SA 2Z4DA 2MBBB 2UWQA 2BWES 1IRSA 2MRPA 1MKEA 3RULA 1DDWA 3O96A 2R2YA 2L52A 3ECIA 4EUTA 2IGDA 1RRBA 1F1HA 3ODWA 5IA7A 3N20C 1AYFA 2EJ8A 1ROEA 5LLIA 2BGFA 2ZPNA 1S1QB 2ROVA 2FCQA 2INNE 3NY5A 2N4FA 1MFWA 3V5WA 2XEWA 3N9YC 2GI9A 4RGMA 1MI0A 4WWOA 1I7HA 1PGBA 1FFVA 1TY2A 1ZP0B 3U7DA 4US9A 2WLBA 3GZNB 3H7SA 2KVRA 4GB9A 4NNJB 5HG2A 4IAPA 5FI1A 5E6PA 2G1EA 1XO3A 5DIFB 4MEMA 3RI7C 3SUZA 1RFKA 1Q5WB 4HWIB 1U27A 2CODA 3CXBB 3WAPA 2LASA 1E10A 3NSUA 4ZRPA 1DYNA 1SJED 3P4SB 2RDGA 3KRWA 2GBRA 4JL9A 2XBBC 4W9FA 1SE2A 1Q1OA 2JX5A 3E56A 3VHTC 3K9PB 3GOEA 4MGIE 4TQ0A 4M00A 2M38A 4EKUA 1WGHA 2BS2B 3AE3B 4FULA 3W2DA 1N5XA 4WWPA 4EEWA 1LGRA 3H6NA 1SGHA 2DYOA 2WWZA 2D2QA 1U5GA 1JWMD 2HE7A 1IGDA 3UZTA 1C4CA 3C8YA 4JPSA 2QJLA 3CWIA 3V6EB 4GDLB 1WWTA 1CQVA 1J7BA 4KGSA 1IYFA 3TSSA 2PZ1A 5IP4D 5HHDG 4M0WB 1H4RA 3W5UB 1V5MA 2PE6B 3FSSA 3KUCB 2JXTA 4HLEA 1VCBA 1P5TA 2KACA 4ZYSA 1VZ8A 2MWNB 1WM3A 3ML4A 4QJ4B 3VUWA 3E9SA 1WFYA 3WA0A 2RDBC 2N9PC 1R4NI 3DXCA 2H89B 2ADZA 3QWZB 3ZRFA 4RF0A 1TGZB 4OW0A 2K49A 3EA6A 2K8HA 1H8CA 1E90A 4J6IA 4CSQA 1ZC4B 1T0RC 2MFQA 3N1ZC 3JYUA 1CJEA 4HPMB 3GE8C 1CK1A 4B0MA 3OWEB 2ZNVB 2WXOA 3ZDTA 1Y56A 3QA8A 2LOXA 2WYQA 2FE8A 3MC9A 3ULCA 2DYNA 5IO9A 1E7VA 4JKFA 1YJ1A 2FUHB 2VZKD 4W9CA 4YWGG 1WJUA 5LXHA 4FJVB 3ODOA 2GS0A 4HB4B 2BQQA 3B08A 3FKYA 2I38A 4P1CC 1M94A 4II3B 1EF5A 4YTMB 3R7QA 3PHXB 5FR6A 3PRPB 2R82A 1V8CA 2LUEA 2BYFA 3EECA 2VRWB 3D8EA 4EJNA 2PE9A 1KTKA 4JKDA 3OJ3A 2IFSA 3OANA 3DBLI 4K3CA 3TEXA 4EOYA 3UGBB 1NBFC 3TEWA 2IDYA 1QQGA 4CHKA 1E0ZA 3VAWA 1YX6B 3VUYA 1S3SG 4W9IA 4HKQA 1V89A 1DBHA 3T06A 3KZ1A 3CF6E 1N62A 2DAFA 4M8MA 4WIPA 1IBXB 2V1YA 4MJSA 5CHVC 3R7RA 3B77A 1K53A 3F5RA 1QF6A 4DBBA 2V3PA 4YSYB 3A8PA 5LONB 4LJOB 4ARCA 4W9EA 1TKGA 1HZ5A 1XCQL 4GXBA 3E66A 3SR6A 3KY9A 4NAWB 1L0XB 2R2QA 2N0YA 3DVGY 4AJWA 2CAYA 1LM8B 3RMKC 2BS3B 2YEPF 1XLNA 3ENBA 1KOTA 1I4PA 3B0AA 3KRXA 1VLBA 5EE1A 4C56C 3UF8A 1ST7A 1WJ4A 3V60A 1NI2A 1WX8A 5HE3A 2ZNVC 3APCA 3RT3B 2D07B 4C0AA 2LRUA 4HAYB 1GB1A 1N61A 2PVGC 2IZVB 2N7EA 3KW5B 2AX5A 2IYBA 2GLSA 5BMGA 4YSZB 3RNAC 1HZ6A 2KXJA 1WGUA 2YS1A 1P0RA 1ISNA 5G5HA 5LOPB 2MA9B 2HTHA 1NEKB 2IO3B 3RD2A 5EE0A 5D3YA 3L16A 2BF8B 4OVUA 2FUG1 2FJ9A 3MDBC 3QCAA 1Z2MA 4PYUA 3V61A 4GMXB 2JF5A 5KCVA 3R2IA 2XK5B 1WGQA 2LG1A 3SNHA 1YN3A 2UVMA 5HE2A 1UNSA 2BWFA 3Q8CA 3JSVA 2XN9C 2IGGA 4FA6A 3L17A 4CHJA 3ZVVA 1XODA 2CU1A 1ACAA 1F77A 1FHOA 4DQOC 3RCPA 3ODXA 4ZRKA 1XR0B 3BIID 2WX0A 3BJIA 2KX3A 1YIWA 2BCJA 5C1ZA 5JHHA 2J59M 2QIEB 2PKOA 2L0FA 3QHTA 4M8NA 2AQ3B 4MGZE 3RN9C 1UGMA 1MK7B 4JGHB 2NBVA 1OQNA 2ONQA 1SSNA 1V1OA 2PW9A 3HUIA 2ZKMX 2PTLA 2LKOA 4YL8A 1EGXA 4K1RB 1K5GB 4BKSA 3GZNI 2WDVB 1V1PB 4GDKA 3P2BA 2AWTA 3HVZA 1UNPA 1K51A 5DPWA 2MHJA 2KNBA 5HI1A 2ROZB 3LDZE 3QBVB 3ZLZA 3EGRA 4HCPB 1FB8A 4L1RA 2TSSA 4D2KA 1OMWA 1OEYA 1V88A 2FJLA 2YT1A 4KSKC 4DBGA 1C3TA 3ETRA 2KJRA 2CY4A 4MDKE 2KIEA 1TT5B 4MJSB 2AQ2B 4MACA 4XWXA 2DX5A 4F7HA 3AJ4A 3N1XC 4NQKE 2IPKD 4TQ1A 1YX5B 3EFCA 4IW0A 1XX0A 4NY0A 1P9DU 2N9XA 3M3JA 1F0ZA 1JWSD 4PK1A 4C7YA 1PDXA 4XZ4A 2D9VA 2GCJA 1U5EA 1KRHA 2LBBA 1WGYA 4FBJB 2C7HA 2BYVE 2KQ4X 4BFRA 1XKEA 1KFYB 2MBHA 4ICUA 4FHJA 4MGKE 4AWJA 3AI5A 3RNGC 1PMSA 1YOVB 3KH0A 1UWMA 4K2PA 3AEFB 2DYQA 2PPHA 1ZXHA 3ZNZB 2KX0A 1JWUD 4KIKB 1K50A 5GOWB 1WI0A 3D32A 1M7EA 5J3YA 2WXKA 1FNUA 2KAJA 1V86A 4X57B 1NYQA 3WAMA 1TKYA 1FAOA 1PFDA 3UI3A 2D9WA 2DFKA 3VQIA 3E9PA 2LGDA 1YJIA 4JKAA 4D0NB 1SE4A 2PIAA 1WIAA 2N1VA 4GPTB 2ICIA 3Q3OC 2WP9B 1HTOA 3ZNID 2ASQA 1VZ7A 2R0DA 3BK1A 1ZC3B 1T0QC 1UPRA 1AARA 1T5XD 4RF1A 2KZRA 1VDVA 3Q2AC 1QC6A 2KN4A 4BBNC 2KQ7A 2KWVB 1JALA 1WGGA 5HFYA 3A33B 2GCLA 1TY0A 2D4QA 2RPQA 2BYTA 1GAQB 2KO3A 2KWCA 2G4DB 2ACZB 1WXAA 1I4QA 1UD7A 4O1NA 1OQRA 1GG3A 3TVVA 4MH0E 4RM8A 1WMHB 1YD8U 4LDTB 1KZ7A 1T77A 4JKGB 4BKGA 1JW9D 2GUMA 2BT6A 2W3RA 5IJMA 1N3HA 3MJ5A 2R09A 4OSNA 5I4DA 1EF1A 1GJZA 2C7NB 1UF0A 1WY8A 4JWSC 3AXCA 3ZNHB 3X23A 3IVFA 2GB1A 2RD0A 2RVBB 2MJEA 3KWLA 1UELA 4Q2JA 2NMBA 2LYDA 3J9CA 2D9XA 4KDLB 2Y8GA 3E9OA 3AMZA 3QX1A 1R4NB 2M19A 3JW0X 4A6QA 4OHJA 3ULBA 2I2YA 2LZ6A 1P3QU 4URKA 3AE4B 1Z87A 2CKHB 1PQSA 2MBEA 3A9JB 2NMQA 2MEKA 1VZ6A 3OHMB 4I6NB 2IY0B 1YN5A 2JWUA 2EC1A 2JZ3B 4TV3A 1UBIA 2KIGA 5C2TB 1BUIC 2K8CA 3IAM1 2K2UA 2JSVX 4JX1C 2DIKA 3NVWA 4CO7A 1QZEA 2WXMA 1ZM0A 3MTNB 2Z0OA 4IC7B 4A20A 1JMLA 3DXEA 2M56B 4LLGM 4ANUA 4A6HA 2V3NA 4I6LB 2BPSA 4ZHOA 2YT0A 1WRDB 3AE2B 3HSAA 2KJ6A 1X11A 4S17A 1V80A 1FRRA 4OZCA 4JIOU 3V62A 3EPYA 2UZRA 2LGXA 2W3SA 1J7AA 2DHKA 3PSEB 4A90A 4HRSA 4XWTA 2LUMA 4BOSC 2NPTA 2G35A 2AL6A 2BS4B 3U12A 1X1FA 2K5PA 1WYWB 3AE9B 2HDEA 4K7UA 2RQ1A 1NVLA 2INDC 3DHHC 2UYZB 3A9KA 1E8WA 3Q8FA 4AS1A 1T0YA 2MJ3A 4CYEA 2PVOD 2ZCCA 4ASWC 4FLHA 1JDEA 2M14A 3IXSA 1X1MA 2FDQA 4HXDA 1KLVA 3AEGB 1W1DA 1D3ZA 4IOIE 3IT6B 1FNVA 2LWPA 4LDTD 4WJ7A 3FILB 3NZ3A 1JWBD 1ZDVA 2YT2A 4DHZB 4K7SA 1V49A 5LNK1 1V5PA 5BYSA 4ACFA 4WJPA 1EM7A 5IOIA 1I4XA 3C0RB 1A5RA 1P3RA 4AQ7A 5CHWA 1RYJA 5CHFA 3MP9A 2DKQA 2MH7A 2G3QB 1C9FA 2Z8LA 2C9WB 2KC2A 2DHJA 2M8SA 5LG4B 1WM2A 2L3ZA 2WH5A 3ZTCA 4TMAB 4BVUC 4F7GA 2HTME 1N60A 1V6EA 2KQSA 3W1SA 1FHWA 2J7QB 1N5WA 4G3XB 3VTVA 3WANA 3WAOA 1JRPA 1HQRD 2JZPA 1ZDXA 4H2AA 3DDCB 3DQVA 4K7WA 4QXAB 3VH4B 1XCGA 1E7UA 3Q69A 2RLOA 3M63B 2DNFA 2KN5A 2BKRB 3A4RA 1I4HA 3ZNGC 4NQLB 1MHHE 1HBKA 4MT7A 1NTIA 1V5OA 2D3BA 2MCNB 4QJ3B 3O65B 2GBMA 3DCXA 2C7MB 3FLVA 2COFA 2WXFA 5L95C 3ZJTA 1IGCA 3ALBA 2LHDA 2WXLA 2IO1B 4M01A 4AUQC 4EZKA 4PYZA 4N6EB 4HVBA 5AUKA 2J0JA 3KUZA 2CR5A 3GYOA 4IKGA 5JZEB 2ABDA 4JKHA 4KHBA 3NRZA 5EDSA 1MPEA 3IT4B 4REZA 4YSXB 4BOZB 3D8FA 2Y8FA 4IG7B 1WR6E 3P4PB 1ZUD2 3V3XA 3VTWA 2WU2B 1UNRA 2H7DA 3VH3B 1WH3A 4GIVA 4XC2A 2CHZA 3Q3MC 2ZPYA 5I2MA 4RGTA 1DDVA 1XCTL 4ANXA 2KUQA 3HW2B 3VOQA 4BAXA 3A98B 5D27A 3B2FA 4HKZE 3AEAB 4LNFA 2DKPA 1SIFA 2DX5B 1NU2A 4C80A 2COPA 3ONSA 3W1SC 1K5DB 2FAZA 4FHKA 1P98A 4D6WA 3UQAA 3A4SC 4NAMA 1XD4A 1XF5L 3UIOB 4ICVA 2LGIA 2E3TA 3DHGC 4KAXB 2L00B 3RNCC 1L0YB 5EE9A 2HRJA 3QJZA 3ZYYX 2CY5A 2GBNA 4EMOA 1NTYA 1WX9A 1V61A 2LJ5A 2MW5A 3VXWA 4N59A 2MDXA 2EELA 3N1YC 2O6VB 2I1JA 2DZKA 1MG8A 2QMTA 2DENB 1RAXA 3TCAA 2RNRB 2Z0DB 1B9RA 4YTNB 2OOBB 1ZSQA 5KHQA 4L2YA 1I35A 2V9HA 2X18A 1K52A 4AP4C 2KANA 3ZRCA 2QHOA 1YJJA 4GOCA 1CZPA 2FIFA 4NJCA 4JK9A 4JK7A 4KZCA 5MPOA 1X86A 4MK0A 1D5ZC 1R4MI 4HEA1 2ZVNA 4WQOB 4HAUB 4OT1A 2CS4A 1UH6A 1BMLC 1WJNA 1LXDA 2WDTB 4XWWA 1IPGA 3HHMA 4MM3B 4PNKA 2O2VB 3FEHA 3Q8AA 1F52A 1TZ1A 1FFUA 1V2YA 3SD5A 4Z2MB 3GP7A 4W9DA 5D7GA 3NWFA 2R2OA 1FM0D 3NUHB 5JP4A 4L6EA 3HRDD 4WJQA 5T8IA 1NENB 2GBJA 1I4RA 3P7ZA 3AE1B 1TTNA 2C5LC 3RZWC 5HKHA 4ZHPA 2Y5PA 2JVCA 1UGJA 4QJ5B 3BVMA 4LNOA 3TO1A 3H7PA 2W2WA 5DHFB 4DX90 1EU3A 4CQNA 2J4XA 3RNEC 1K8RB 2JRIB 4WJNA 2K39A 1GGOA 1MJDA 3H8HA 5EFXA 2YEPB 3I5JC 1XD3B 4DDGD 1IP9A 2Z14A 3AECB 4HAWB 3TUOA 5D3WA 3TBLD 1KJTA 2NVUI 4GOUA 1WJ6A 2B3AA 4YONA 3P42A 5D3DA 4LNKA 2MJDA 2CB8A 3DBLB 3DVNV 3R2TA 2JYTA 2KGXB 2LVPA 4E71A 1YMHE 2Q5WD 1D5MC 2CQUA 3LXFA 2ZJDA 1PFJA 4B0EA 2G45B 4IM3A 1T6BX 1NYRA 2MLBA 3GB1A 1J8CA 1EU4A 3MC0B 3N30A 1FHXA 4NPNA 3NZUA 2XK5A 2IO0B 1PYWD 1XLPA 3R8BA 1TJ6A 3ABVB 3EUB2 3UINB 2KYWA 2CJNA 2IYDB 3PLVA 3MHSD 2N23A 3DBRB 5DPRA 1U5DA 1FEHA 2INCC 4NAWA 1EVHA 3LJUX 3VRBB 2IBIB 2NR2A 3PP2A 3ML8A 1DROA 3GE3C 1FGZA 1TYGB 2LOZA 3QC8B 5C5BA 2V4IB 5KHOA 2DHZA 1FPYA 1SJHD 4MM3A 1TS3A 1X05A 2KTRA 4Z2NA 1A70A 2GJYA 4IDIA 4KKJA 3P63A 4HB2B 4A6FB 4EFOA 4K17A 4JWUC 2RRFA 4P1BC 4N9F4 4C00A 3A8QA 2WXIA 1WE7A 1C79A 4K81A 2A5UA 4LK0M 5GMVA 2I1KA 1LO5D 1SXTA 2KWDA 3AH7A 4A3OA 1YQBA 4NZLB 5J18A 4GMVA 3ZKJC 3NVZA 2EMTA 3SU8X 2MQJA 1HTQA 2FCNA 1MAIA 3L13A 1AN8A 4KGRA 3PVLA 2LD9A 4A3PA 2IO2B 2NBVB 5JLJB 3HVDA 1UBQA 3ZGZA 2Z59B 1OEYJ 3PLUA 1T0SC 1EO6A 3IBEA 3EHVA 4EE2A 2DAJA 5C16A 2NBUA 4FJZA 1HA5A 3H9DA 3DVNU 4HDQA 1W1HA 5G5GA 1NTVA 1E9MA 2DYBA 2NZ8B 4PS3A 4WAAA 2QKLA 5IN7A 1DDMA 4US8A 3T3OA 3IAS1 4L23A 3ZQ4A 2WXJA 2DBYA 2JPHA 5JVLA 1MHXA 1E6EB 3APFA 1NVID 3EC8A 2K1FA 3W1YA 2NCNA 4IM2A 5DPTA 3HQCA 1I42A 4A6KA 2ELBA 1VBHA 4XGAB 3TL5A 2LVQA 4NJ7A 1H10A 4PS8A 4AOFA 4BKSD 1ET6A 3U7ZA 3N3KB 1QOBA 1MIZB 4M02A 4LNIA 2WXNA 1GNUA 4F8CB 1AQCA 3PVWA 2BVCA 2RSUA 2YRYA 3T8MA 1VR9A 4XDDA 5KQ4A 3ENEA 3ZJUA 4ZOHC 1TIFA 4H8SA 2KK8A 5D2MB 2KLGA 2ON8A 1Q67A 3W5VB 1V81A 1WX7A 2WXGA 1V9JA 2L05A 2DA0A 1FXAA 5J2RA 1Y19B 1R7SA 3PEGA 1QOFA 1TQZA 4ILJA 3NWAA 4C7ZA 1VD2A 4HAZB 2LGSA 2JU6X 2LHEA 5BYRA 2M17A 2WS3B 3DBSA 4DXGA 3BINA 2P8VA 4USAA 5JHBA 2LULA 4OZBA 4RMAA 4WVFB 2E6XA 2KTFA 2QKMA 4WQMA 5DH9B 1TS5A 1D4BA 1KC7A 1TXDA 1UWXA 2KTRB 5TSSA 3NVVA 1KLUD 3ZXVA 1QOAA 4LNNA 1J19A 1FD6A 5E6JA 3TFMA 2BKFA 3QK0A 1SBBB 3P6AA 4FN2A 2KR0A 4GLSC 1SHCA 1ZGUB 2VZKB 1Y5OA 3KUDB 4FXCA 1SB3C 1J0GA 3Q8BA 3PZ8A 1ZE3D 3SFEB 3QIJA 4GNKB 1QOGA 4HCNB 2K8EA 4DIXA 2XQNM 1YQ4B 3ZUNA 4ILHA 4GU2A 1WR1A 4J3OD 1G6JA 5AZGA 4KZ0A 2JZZA 4BZAA 5AUIA 1NDDA 3WIMA 2W9NA 4WURA 3V6CB 2MBQA 4DK5A 3RUIB 2KFKA 1ESFA 3PGEA 3HIZA 1EAZA 1WMHA 2JUOA 2K8BA 2RGFA 2L1CA 3PVUA 2O6VA 2QEJC 1WZ3A 4MT5A 4NSWA 1F9JA 2JQRB 4WSFA 1PGXA 1WGKA 3A9JA 2ZW0A 2DN6A 3CMMB 2BYEA 2WDRB 3NS8A 1KM7A 2O6VD 1FIQA 2WGSA 1UNQA 3NOBA 3N32A 1X1GA 2L76A 2YS5A 3Q3FA 4DHZE 3BZDB 3BK2A 4OZAA 3TW1A 4DXFA 5D3VA 1KLGD 2I5CA 1FCLA 4RM9A 2HTHB 4MSQB 4WJOA 4RH6A 1BXTA 1YNTE 1ZKHA 4IWPA 3DWMA 3QQ8B 2P0FA 1TBEA 1WF9A 3ZJVA 2MKRA 3PTFC 2DZJA 1CMXB 5J3TA 2C60A 3KVFB 1WXQA 3PS6A 2RUKB 1L2NA 4RGOS 2V4LA 2R61A 3NZSA 5LXIB 1AWEA 2JXXA 1SIJA 4CHMA 3DWGC 1U29A 2X38A 5J3QA 3P4RB 2Z0PA 1C78A 2N1WA 2EMSA 3VR9B 5C6RA 4IUMB 2AL3A 3KLSX 2WXQA 3NG0A 4KX6B 2L8JA 5D94A 2CU3A 5KQ1A 4MH8A 3S2AA 2MP2A 5BYQA 5CX3A 3URYA 3SBTA 4HB3B 3A1QA 3BWUD 2MBOA 4ZRJA 3QAQA 4WAFA 3LB8C 4HATB 2VRRB 3SBGA 1U4AA 3DBRI 2COAA 2ZEQA 3VUXA 4W9HA 2N9EB 4N58A 1MI1A 3IHPC 1WGDA 1XEEA 3ZO5B 2UZSA 3SFDB 2SAKA 2GOWA 1BTKA 2WU5B 3CSTA 1P6SA 3ZXRA 2I5FA 2W2XD 3KQ4A 3B9JA 2LVOA 3DXDA 4B95A 4HPLB 5FR3A 2FNJB 2QCZA 2DX1A 4A9AA 2E2XA 1TS4A 3RZFA 3SHQA 1V5TA 2K6QA 2N7DA 1PGAA 2IJ0A 4M0WA 2OJRA 2NTSA 4JKBA 1SF0A 4LJPB 1Q0WB 4PT5A 3OG5A 5J17A 2JYEA 2KMMA 1F2RC 3IG3A 3C19A 3MHZA 2M0XA 5JHAA 2P0DA 3Q6BA 3L4PA 2QDFA 2AQ1B 5TR5A 1FNWA 3Q8EA 4R3DA 1C1YB 2G9HD 2LGYA 1BT0A 4B9KA 1ACCA 1U2BA 3OAWA 2Z0EB 1D6EC 2Q13A 2KLCA 2J53A 1PUTA
chains in the Genus database with same CATH topology
2KFKB 3VDZA 1E8YA 2LXAA 3JVZX 4EZLA 3BY4B 3HK0A 3R3MA 3PV1A 1ZW7A 2YSZA 3N7CA 3E9LA 3M62B 2OTXA 3AULA 1WGRA 1SE9A 4JKCA 5CLLB 5FI0A 3EFUA 4KHBB 4FADA 4ILGB 2KMCA 2L7RA 1U5FA 3DBHI 1WJMA 2Z0QA 2VSZA 2FCMA 4AJYB 3SV1A 3I3TB 3PPAA 3Q3JA 2LXCA 2DZIA 2D3GA 1I2HA 1E8ZA 4E3CA 2MX2A 1OY2A 4DHJB 2FCSA 3GYPA 2KMAA 3A1QB 3PZDA 2REXA 2MSED 4LCDE 4K2OA 3VFKA 3OLMD 4IWOA 3MJWA 2KJHB 2ZVOA 2D9ZA 3G9WA 4BKTA 3SYXA 3DVGX 4HJKA 3L10B 1PLSA 2CRFA 1FXTB 2JRHA 3VTUA 3K9OB 1RJ2A 3TMPB 4KDIC 4ZYNA 1E8XA 2PJHA 4F7UP 2KOXA 1FOEA 2YS3A 1V5UA 2KHWB 2KWUB 2KKCA 4JK8A 1ZVRA 5L81A 4OVVA 3R66C 2DTCA 1DIKA 3APDA 2O2VA 4KSLC 4DDID 2NS5A 3DOWA 3ZVRA 3M95A 3PHWB 2D10A 2A4ZA 4DX8A 2JWZA 2AYOB 5DPSA 1KZGA 1E5WA 4IM0A 2NBWB 1WXVA 4W9KA 3TIXA 1WG7A 3TJPA 2MWSB 2JP2A 1BTNA 5BO4B 2ZZPB 2P0HA 4IFSA 2M1MA 3FP5A 1P1AA 4WWNA 4DWFA 4P7IA 3DCGA 1W1GA 4FJYA 1WXMA 4ANVA 1KI1B 4ANWA 5JH5C 4KHOA 5L83A 3AU4A 4HAXB 3KSYA 5JHGA 4HK2A 2AEHA 3A9KB 2RSGA 4TKNA 4Y94A 3LJ3A 3ZIMA 3NHEB 4MY6A 5AEKB 4HHVA 1MK9B 2L0TA 3L08A 3SDLC 1LQBA 3HM6X 5DHAB 1HE8A 1WE6A 4GN1A 1BWNA 1WZ0A 4G50A 1MPHA 5DCNA 4G0NB 2K00A 2L2IA 4F7ZA 4B6HA 2M4NA 3PG7A 4ZRIA 4KVGB 3UQBA 4W9JA 5AZFA 4ZDVA 3PSCA 4BBNF 1LFDA 2JY6A 4XX5A 2KUPA 5CTRC 2Y5BB 2G4SA 2K25A 3ZW3A 5E6OA 3H1UA 1B55A 2YF0A 3IFWB 2COCA 4KIKA 3CIKA 5CLQB 1J0WA 2RR9A 2RGNB 1I7AA 4G11A 2MP2B 5C5BB 1FGYA 3MPXA 2KDIA 2JT4B 4A6FA 2DLWA 3VVWB 2HJ8A 4HAVB 1HB6A 4I6PA 4B6WA 3U30A 4TUUA 3QARA 2J0MA 4HB0B 3F0WA 2CHXA 3PRZA 5D3XA 3ZTDA 4PS7A 3RYTA 2VKIA 5IAAC 2IY1B 3PRMB 2YLMA 2J0KA 2OQBA 2GMIC 1L7YA 2EKEC 3L54A 2HD5B 3KYCD 5C23A 1EUVB 2KFJA 1KBLA 4W9LA 3AU5A 2KC1A 2ELAA 4GSWA 1LW3A 2ZCBA 4JLCA 5AZHA 5HE1A 2LI5A 1RFAA 3X0WA 2KDBA 4DXAB 4E74A 4MELA 3B1LX 2K6DB 4JQWC 5G55A 1GC7A 1HB8A 1UPQA 1BAKA 2Y7BA 1WVHA 3PREA 2WX1A 2FIDA 3SO6A 3UIPB 2D11A 3ZDMC 3T9LA 1WXSA 4KHAA 1WJ1A 1Y8RC 3ML9A 2DHIA 4TYZA 1UZXB 4JKEA 1GC6A 4JKGA 3FM8C 5E6NA 2CHWA 2YVCA 4A5KA 2D9YA 4MGYE 2K2JA 3RCZA 1OGWA 3CSFA 3QWMA 1JRUA 2DZMA 4DHJD 2KDFB 4EZJA 5DI9B 1M7RA 2LRWA 3WALA 1OTRB 1MIXA 4PQ0A 3H7PB 2X0SA 2KDEB 1WI1A 3DPDA 4BBKA 4NJ6A 1XT9B 2DYMA 4HDOA 2H7EA 4GGQA 3L0WB 3JSVB 3HM3A 5HE0A 1LB1A 2NPTB 2V3SA 4GZUA 1XQQA 2KD0A 2PEAA 3D8DA 2W2XC 4II2B 4IWQA 4GDLA 3U8ZA 2V76A 4MSMB 2KCJA 3VIAA 1RRPB 4W9GA 3KYDD 4IOYX 3WYFB 1Z5SB 2GBKA 3PT2B 4KV2A 4GDKB 5G2NA 1GUAB 1RLFA 3OJ4B 4F1SA 1OQYA 5C79A 1UEFA 5D6JB 1VBGA 3M1IB 2MBBB 2UWQA 2BWES 1IRSA 2MRPA 1MKEA 3RULA 1DDWA 3O96A 3ECIA 4EUTA 1RRBA 5IA7A 3ODWA 2EJ8A 5LLIA 2BGFA 2ZPNA 1S1QB 2ROVA 2FCQA 3NY5A 2N4FA 3V5WA 2XEWA 4WWOA 3U7DA 3H7SA 2KVRA 4GB9A 4NNJB 4IAPA 5FI1A 5E6PA 5DIFB 4MEMA 3SUZA 1Q5WB 4HWIB 1U27A 2CODA 3CXBB 3WAPA 2LASA 3NSUA 1DYNA 3KRWA 2GBRA 4JL9A 2XBBC 4W9FA 1Q1OA 3VHTC 3K9PB 3GOEA 4MGIE 4TQ0A 2M38A 4EKUA 1WGHA 4FULA 4WWPA 4EEWA 3H6NA 1SGHA 2DYOA 2WWZA 2D2QA 1U5GA 2HE7A 3UZTA 3V6EB 4GDLB 1IYFA 2PZ1A 4M0WB 1H4RA 1V5MA 2PE6B 3FSSA 3KUCB 4HLEA 1VCBA 1P5TA 2MWNB 1WM3A 3ML4A 3VUWA 1WFYA 3WA0A 2N9PC 1R4NI 3DXCA 2ADZA 3QWZB 3ZRFA 1TGZB 2K8HA 1H8CA 1E90A 4J6IA 1ZC4B 2MFQA 3JYUA 4HPMB 2ZNVB 3ZDTA 3QA8A 2LOXA 2WYQA 3ULCA 2DYNA 1E7VA 4JKFA 1YJ1A 2FUHB 4W9CA 5LXHA 1WJUA 4FJVB 3ODOA 2GS0A 4HB4B 3B08A 1M94A 4II3B 1EF5A 3R7QA 3PHXB 5FR6A 3PRPB 2R82A 2LUEA 2BYFA 3EECA 2VRWB 3D8EA 4EJNA 2PE9A 4JKDA 3OJ3A 2IFSA 3OANA 3DBLI 4EOYA 3UGBB 1NBFC 1QQGA 4CHKA 3VAWA 1YX6B 3VUYA 1S3SG 4W9IA 1V89A 1DBHA 3T06A 3KZ1A 3CF6E 2DAFA 4M8MA 2V1YA 4MJSA 5CHVC 3R7RA 3F5RA 4DBBA 3A8PA 5LONB 4LJOB 4W9EA 4GXBA 3E66A 3KY9A 4NAWB 2R2QA 2N0YA 3DVGY 4AJWA 2CAYA 1LM8B 3ENBA 1KOTA 3B0AA 3KRXA 3UF8A 1ST7A 1WJ4A 3V60A 1NI2A 1WX8A 5HE3A 2ZNVC 3APCA 3RT3B 2D07B 4C0AA 2LRUA 4HAYB 2IZVB 2N7EA 3KW5B 2IYBA 2KXJA 1WGUA 2YS1A 1P0RA 1ISNA 5LOPB 2MA9B 2HTHA 2IO3B 3RD2A 5D3YA 3L16A 2BF8B 4OVUA 2FJ9A 3MDBC 3QCAA 1Z2MA 4PYUA 3V61A 4GMXB 2JF5A 5KCVA 2XK5B 1WGQA 2LG1A 3SNHA 2UVMA 5HE2A 2BWFA 3JSVA 4FA6A 3L17A 4CHJA 3ZVVA 1XODA 2CU1A 1ACAA 1FHOA 3RCPA 3ODXA 4ZRKA 1XR0B 2WX0A 3BJIA 2KX3A 1YIWA 2BCJA 5C1ZA 5JHHA 2J59M 2L0FA 3QHTA 4M8NA 4MGZE 1UGMA 1MK7B 4JGHB 1OQNA 2LKOA 4YL8A 1EGXA 4K1RB 1K5GB 4BKSA 3GZNI 4GDKA 3P2BA 2AWTA 1UNPA 5DPWA 2KNBA 2ROZB 3LDZE 3QBVB 3ZLZA 4HCPB 1FB8A 1OMWA 1OEYA 1V88A 2FJLA 2YT1A 4KSKC 4DBGA 1C3TA 2KJRA 2CY4A 4MDKE 4MJSB 4XWXA 2DX5A 4F7HA 3AJ4A 4NQKE 4TQ1A 1YX5B 4IW0A 1XX0A 4NY0A 1P9DU 2N9XA 3M3JA 4XZ4A 2D9VA 2GCJA 1U5EA 2LBBA 1WGYA 4FBJB 2C7HA 2BYVE 4BFRA 1XKEA 2MBHA 4ICUA 4FHJA 4MGKE 4AWJA 3AI5A 1PMSA 3KH0A 4K2PA 2DYQA 2PPHA 3ZNZB 2KX0A 4KIKB 1WI0A 5GOWB 3D32A 1M7EA 5J3YA 1V86A 4X57B 3WAMA 1FAOA 2D9WA 2DFKA 3VQIA 3E9PA 2LGDA 4JKAA 4D0NB 1WIAA 2N1VA 4GPTB 3ZNID 2ASQA 2R0DA 1ZC3B 1UPRA 1AARA 2KZRA 4BBNC 1QC6A 2KQ7A 2KWVB 1WGGA 3A33B 2GCLA 2D4QA 2RPQA 2KO3A 2KWCA 2G4DB 1WXAA 1UD7A 1GG3A 3TVVA 4MH0E 4RM8A 1WMHB 1YD8U 4LDTB 1KZ7A 4JKGB 4BKGA 5IJMA 1N3HA 2R09A 1EF1A 1GJZA 2C7NB 1WY8A 3AXCA 3ZNHB 3X23A 3IVFA 2RD0A 2RVBB 1UELA 2NMBA 2LYDA 2D9XA 4KDLB 2Y8GA 3E9OA 3QX1A 3JW0X 3ULBA 2LZ6A 1P3QU 4URKA 1Z87A 2CKHB 1PQSA 2MBEA 3A9JB 4I6NB 2IY0B 2EC1A 2JZ3B 4TV3A 1UBIA 2K8CA 2K2UA 2DIKA 4CO7A 1QZEA 1ZM0A 3MTNB 2Z0OA 4IC7B 4A20A 3DXEA 4ANUA 4A6HA 4I6LB 2BPSA 2YT0A 1WRDB 2KJ6A 1X11A 1V80A 4JIOU 3V62A 3EPYA 2UZRA 2LGXA 3PSEB 2DHKA 4BOSC 2NPTA 2G35A 2AL6A 1X1FA 1WYWB 4K7UA 2RQ1A 1NVLA 2UYZB 3A9KA 1E8WA 1T0YA 4CYEA 2ZCCA 4ASWC 4FLHA 1JDEA 2M14A 1X1MA 2FDQA 4HXDA 1KLVA 1D3ZA 1W1DA 4LDTD 2LWPA 4WJ7A 4DHZB 4K7SA 1V49A 1V5PA 4WJPA 3C0RB 1A5RA 1P3RA 5CHWA 5CHFA 2DKQA 2G3QB 2C9WB 2KC2A 2DHJA 2M8SA 1WM2A 2L3ZA 2WH5A 3ZTCA 4BVUC 4F7GA 1V6EA 2KQSA 3W1SA 1FHWA 2J7QB 4G3XB 3VTVA 3WANA 3WAOA 3DDCB 3DQVA 4K7WA 3VH4B 1XCGA 1E7UA 2RLOA 3M63B 2KN5A 2BKRB 3A4RA 3ZNGC 4NQLB 1HBKA 4MT7A 1NTIA 1V5OA 2MCNB 3O65B 2GBMA 2C7MB 3FLVA 2COFA 5L95C 3ALBA 2IO1B 4AUQC 4EZKA 4PYZA 4HVBA 2J0JA 3KUZA 2CR5A 3GYOA 5JZEB 2ABDA 4JKHA 5EDSA 4BOZB 3D8FA 4IG7B 2Y8FA 1WR6E 3VTWA 1UNRA 2H7DA 3VH3B 1WH3A 4GIVA 4XC2A 2CHZA 2ZPYA 1DDVA 4ANXA 3HW2B 3VOQA 3A98B 5D27A 2DKPA 1SIFA 2DX5B 1NU2A 2COPA 3W1SC 3ONSA 1K5DB 2FAZA 4FHKA 1P98A 3UQAA 3A4SC 1XD4A 3UIOB 4ICVA 4KAXB 2L00B 2HRJA 3QJZA 2CY5A 2GBNA 4EMOA 1NTYA 1WX9A 1V61A 2LJ5A 2MW5A 3VXWA 2MDXA 2O6VB 2I1JA 2DZKA 1MG8A 2DENB 1RAXA 3TCAA 2RNRB 2Z0DB 2OOBB 1ZSQA 5KHQA 1I35A 2X18A 4AP4C 2KANA 3ZRCA 2QHOA 4GOCA 2FIFA 4JK9A 4JK7A 4KZCA 1X86A 4MK0A 1R4MI 2ZVNA 4WQOB 4HAUB 2CS4A 1UH6A 1WJNA 1LXDA 2WDTB 1IPGA 3HHMA 4PNKA 2O2VB 3FEHA 1TZ1A 1V2YA 3SD5A 4Z2MB 4W9DA 5D7GA 2R2OA 5JP4A 4L6EA 4WJQA 2GBJA 3P7ZA 1TTNA 2C5LC 3RZWC 5HKHA 2JVCA 3TO1A 3H7PA 2W2WA 5DHFB 4DX90 1K8RB 2JRIB 4WJNA 2K39A 1GGOA 5EFXA 1XD3B 4DDGD 1IP9A 4HAWB 5D3WA 3TBLD 1KJTA 2NVUI 1WJ6A 2B3AA 4YONA 2CB8A 3DVNV 2KGXB 2LVPA 4E71A 2CQUA 2ZJDA 1PFJA 2G45B 4IM3A 2MLBA 1J8CA 3N30A 1FHXA 4NPNA 3NZUA 2XK5A 2IO0B 1TJ6A 3UINB 2IYDB 3PLVA 3MHSD 2N23A 5DPRA 1U5DA 4NAWA 1EVHA 3LJUX 2IBIB 2NR2A 3PP2A 3ML8A 1DROA 1FGZA 2LOZA 3QC8B 5C5BA 5KHOA 2DHZA 4MM3A 1X05A 2KTRA 4Z2NA 2GJYA 4HB2B 4A6FB 4EFOA 4K17A 4N9F4 3A8QA 1WE7A 4K81A 2A5UA 5GMVA 2I1KA 4A3OA 1YQBA 5J18A 4GMVA 3ZKJC 2EMTA 3SU8X 2MQJA 2FCNA 1MAIA 3L13A 3PVLA 2LD9A 4A3PA 2IO2B 2NBVB 5JLJB 1UBQA 2Z59B 1OEYJ 3PLUA 1EO6A 3IBEA 3EHVA 2DAJA 5C16A 2NBUA 4FJZA 3H9DA 3DVNU 4HDQA 1W1HA 1NTVA 2DYBA 2NZ8B 4PS3A 4WAAA 2QKLA 1DDMA 2JPHA 5JVLA 3APFA 3EC8A 2K1FA 3W1YA 2NCNA 4IM2A 5DPTA 3HQCA 1I42A 4A6KA 2ELBA 1VBHA 3TL5A 2LVQA 4NJ7A 1H10A 4PS8A 4AOFA 4BKSD 3N3KB 1MIZB 1GNUA 4F8CB 1AQCA 3PVWA 2RSUA 2YRYA 3T8MA 5KQ4A 3ENEA 4H8SA 2KK8A 5D2MB 2KLGA 1Q67A 1V81A 1WX7A 1V9JA 2L05A 2DA0A 5J2RA 1Y19B 3PEGA 1TQZA 4ILJA 1VD2A 4HAZB 2M17A 3DBSA 3BINA 2P8VA 5JHBA 2LULA 4RMAA 4WVFB 2KTFA 2QKMA 5DH9B 1KC7A 1TXDA 2KTRB 1J19A 3TFMA 2BKFA 3QK0A 3P6AA 4FN2A 1SHCA 1ZGUB 1Y5OA 3KUDB 1J0GA 3QIJA 4HCNB 2XQNM 3ZUNA 4ILHA 4GU2A 1WR1A 1G6JA 5AZGA 4KZ0A 2JZZA 1NDDA 3WIMA 2W9NA 3V6CB 2MBQA 4DK5A 3RUIB 2KFKA 3PGEA 3HIZA 1EAZA 1WMHA 2JUOA 2K8BA 2RGFA 2L1CA 3PVUA 2O6VA 1WZ3A 4NSWA 1F9JA 4WSFA 3A9JA 2DN6A 3CMMB 2BYEA 3NS8A 1KM7A 2O6VD 1UNQA 3NOBA 3N32A 1X1GA 2L76A 2YS5A 3Q3FA 4DHZE 3TW1A 5D3VA 2I5CA 4RM9A 2HTHB 4MSQB 4WJOA 1ZKHA 4IWPA 3QQ8B 2P0FA 1TBEA 1WF9A 2MKRA 3PTFC 2DZJA 1CMXB 5J3TA 2C60A 3KVFB 3PS6A 2RUKB 1L2NA 2V4LA 3NZSA 5LXIB 1AWEA 2JXXA 4CHMA 1U29A 5J3QA 2Z0PA 2N1WA 2EMSA 5C6RA 4IUMB 2AL3A 2L8JA 5D94A 5KQ1A 3S2AA 2MP2A 5CX3A 3SBTA 4HB3B 3A1QA 2MBOA 4ZRJA 3QAQA 4HATB 2VRRB 3SBGA 1U4AA 3DBRI 2COAA 2ZEQA 3VUXA 4W9HA 2N9EB 3IHPC 1WGDA 3ZO5B 2UZSA 2GOWA 1BTKA 3CSTA 1P6SA 2I5FA 2W2XD 2LVOA 3DXDA 4B95A 4HPLB 2FNJB 2DX1A 2E2XA 3RZFA 3SHQA 1V5TA 2K6QA 2N7DA 2OJRA 4JKBA 4LJPB 1Q0WB 5J17A 3IG3A 2M0XA 5JHAA 2P0DA 5TR5A 1C1YB 2LGYA 1BT0A 4B9KA 1U2BA 3OAWA 2Z0EB 2Q13A 2KLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWX A;  2KDE B;  2KFK B;  2DX5 A;  4F7H A;  1WI1 A;  3VTW A;  3AJ4 A;  5JP4 A;  3DPD A;  4L6E A;  4BBK A;  4NJ6 A;  1XT9 B;  4NQK E;  4WJQ A;  2DYM A;  2GBJ A;  4TQ1 A;  3VDZ A;  4HDO A;  2H7E A;  3P7Z A;  1E8Y A;  1YX5 B;  2LXA A;  3JVZ X;  1TTN A;  2C5L C;  3L0W B;  4GGQ A;  3JSV B;  4IW0 A;  3RZW C;  4EZL A;  2JVC A;  5HKH A;  3HM3 A;  5HE0 A;  1LB1 A;  1XX0 A;  2NPT B;  4NY0 A;  1P9D U;  3TO1 A;  3BY4 B;  2N9X A;  3H7P A;  2W2W A;  5DHF B;  4DX9 0;  2V3S A;  3M3J A;  3HK0 A;  3R3M A;  3PV1 A;  1ZW7 A;  2YSZ A;  4GZU A;  1XQQ A;  3N7C A;  1K8R B;  2JRI B;  2KD0 A;  2D9V A;  4XZ4 A;  2PEA A;  2GCJ A;  1U5E A;  4WJN A;  3D8D A;  2K39 A;  2LBB A;  2W2X C;  4II2 B;  1WGY A;  5EFX A;  4GDL A;  4IWQ A;  1XD3 B;  3M62 B;  2OTX A;  2C7H A;  4DDG D;  2BYV E;  4FBJ B;  3U8Z A;  4BFR A;  1IP9 A;  1XKE A;  2V76 A;  3AUL A;  4MSM B;  1WGR A;  2MBH A;  1SE9 A;  4ICU A;  4FHJ A;  4MGK E;  5CLL B;  4AWJ A;  2KCJ A;  3VIA A;  1RRP B;  5FI0 A;  3EFU A;  4HAW B;  3AI5 A;  4KHB B;  5D3W A;  1PMS A;  3KH0 A;  3TBL D;  4FAD A;  1KJT A;  2NVU I;  4K2P A;  2KMC A;  2DYQ A;  4IOY X;  1WJ6 A;  2PPH A;  3KYD D;  3WYF B;  2B3A A;  3ZNZ B;  4YON A;  2L7R A;  1U5F A;  2KX0 A;  4W9F A;  3DBH I;  1WJM A;  1Z5S B;  4KIK B;  2Z0Q A;  2CB8 A;  2VSZ A;  3DVN V;  2GBK A;  1WI0 A;  5GOW B;  2FCM A;  4AJY B;  2KGX B;  2LVP A;  3D32 A;  4E71 A;  1M7E A;  3PT2 B;  4KV2 A;  5J3Y A;  3SV1 A;  3I3T B;  3PPA A;  1V86 A;  4GDK B;  3Q3J A;  4X57 B;  3WAM A;  5G2N A;  2LXC A;  2CQU A;  1GUA B;  1FAO A;  1RLF A;  2ZJD A;  1PFJ A;  3OJ4 B;  2G45 B;  4F1S A;  1OQY A;  4IM3 A;  2MLB A;  1J8C A;  2DZI A;  2D3G A;  1I2H A;  3N30 A;  2D9W A;  2DFK A;  5C79 A;  3VQI A;  1FHX A;  2LGD A;  1UEF A;  5D6J B;  4D0N B;  4NPN A;  3NZU A;  2XK5 A;  1WIA A;  2IO0 B;  5J2R A;  1E8Z A;  3M1I B;  2N1V A;  4GPT B;  2MX2 A;  4E3C A;  1TJ6 A;  3UIN B;  2MBB B;  2IYD B;  2UWQ A;  3ZNI D;  1OY2 A;  2BWE S;  1IRS A;  4DHJ B;  2FCS A;  3GYP A;  2ASQ A;  2KMA A;  2MRP A;  2R0D A;  3A1Q B;  1MKE A;  3RUL A;  3PLV A;  3PZD A;  3MHS D;  1DDW A;  3O96 A;  1ZC3 B;  1UPR A;  2N23 A;  2REX A;  1AAR A;  2MSE D;  5DPR A;  1U5D A;  3ECI A;  2KZR A;  4NAW A;  1EVH A;  1QC6 A;  3LJU X;  4BBN C;  2KQ7 A;  4LCD E;  2IBI B;  2NR2 A;  2KWV B;  3PP2 A;  1RRB A;  3ML8 A;  4K2O A;  1DRO A;  1WGG A;  3ODW A;  5IA7 A;  3A33 B;  3VFK A;  2EJ8 A;  3OLM D;  4IWO A;  2GCL A;  2BGF A;  2D4Q A;  1FGZ A;  2ZPN A;  2RPQ A;  5LLI A;  3MJW A;  2LOZ A;  3QC8 B;  5C5B A;  1S1Q B;  2KJH B;  2ZVO A;  2ROV A;  5KHO A;  2KO3 A;  2DHZ A;  2KWC A;  2G4D B;  2FCQ A;  1WXA A;  2D9Z A;  3NY5 A;  1UD7 A;  4MM3 A;  2N4F A;  1X05 A;  3G9W A;  5LXH A;  1GG3 A;  3V5W A;  4BKT A;  2KTR A;  4Z2N A;  3TVV A;  2XEW A;  3SYX A;  4MH0 E;  4RM8 A;  2GJY A;  3DVG X;  4WWO A;  4HJK A;  4HB2 B;  4A6F B;  1WMH B;  1YD8 U;  3L10 B;  4LDT B;  4EFO A;  1PLS A;  4K17 A;  4J6I A;  1KZ7 A;  2CRF A;  1FXT B;  2JRH A;  4BKG A;  4N9F 4;  3A8Q A;  5IJM A;  3VTU A;  3U7D A;  3K9O B;  1N3H A;  3H7S A;  2R09 A;  1WE7 A;  1EF1 A;  1RJ2 A;  3TMP B;  4K81 A;  3RT3 B;  2A5U A;  4KDI C;  1GJZ A;  2KVR A;  4EUT A;  2C7N B;  4ZYN A;  4GB9 A;  4NNJ B;  1E8X A;  4IAP A;  2I1K A;  5FI1 A;  1WY8 A;  5GMV A;  3AXC A;  3ZNH B;  5E6P A;  3X23 A;  3IVF A;  5DIF B;  4MEM A;  2RD0 A;  3W1S C;  4A3O A;  1YQB A;  2RVB B;  2PJH A;  4F7U P;  2KOX A;  3SUZ A;  1FOE A;  2YS3 A;  1UEL A;  1V5U A;  3DBR I;  2KHW B;  2KWU B;  5J18 A;  4GMV A;  1Q5W B;  2NMB A;  2KKC A;  3ZKJ C;  4HWI B;  2EMT A;  2LYD A;  3SU8 X;  1ZVR A;  5L81 A;  2MQJ A;  2FCN A;  4OVV A;  1MAI A;  1U27 A;  2COD A;  3CXB B;  3L13 A;  3R66 C;  2DTC A;  3WAP A;  2D9X A;  2LAS A;  4KDL B;  3PVL A;  2Y8G A;  2LD9 A;  4A3P A;  3NSU A;  2IO2 B;  2NBV B;  3QX1 A;  3APD A;  1DYN A;  5JLJ B;  2O2V A;  3JW0 X;  4KSL C;  3ULB A;  4DDI D;  2LZ6 A;  3KRW A;  2GBR A;  1UBQ A;  4JL9 A;  1P3Q U;  4URK A;  2NS5 A;  2XBB C;  3DOW A;  1Z87 A;  3ZVR A;  2CKH B;  1PQS A;  3M95 A;  2Z59 B;  2MBE A;  2D10 A;  1OEY J;  1Q1O A;  2A4Z A;  3PHW B;  3A9J B;  3PLU A;  4DX8 A;  4IG7 B;  2JWZ A;  3VHT C;  3K9P B;  2AYO B;  3GOE A;  4MGI E;  4TQ0 A;  5DPS A;  1KZG A;  4I6N B;  2M38 A;  4EKU A;  1EO6 A;  2IY0 B;  1WGH A;  3IBE A;  1E5W A;  2EC1 A;  3EHV A;  2DAJ A;  5C16 A;  2JZ3 B;  4IM0 A;  2NBU A;  4TV3 A;  2NBW B;  1UBI A;  1WXV A;  4FJZ A;  4FUL A;  4W9K A;  4WWP A;  3H9D A;  3TIX A;  3DVN U;  2K8C A;  4EEW A;  4HDQ A;  1W1H A;  1WG7 A;  2K2U A;  3H6N A;  3TJP A;  2MWS B;  1SGH A;  1NTV A;  2JP2 A;  2NZ8 B;  2DYB A;  4PS3 A;  1BTN A;  1QZE A;  4WAA A;  1ZM0 A;  2DYO A;  2QKL A;  5BO4 B;  4CO7 A;  2ZZP B;  2WWZ A;  2P0H A;  4IFS A;  2D2Q A;  4W9G A;  2M1M A;  2Z0O A;  1U5G A;  3MTN B;  4IC7 B;  4A20 A;  2HE7 A;  1DDM A;  3FP5 A;  3DXE A;  3UZT A;  1P1A A;  4WWN A;  4ANU A;  4A6H A;  4DWF A;  4I6L B;  4P7I A;  2BPS A;  2YT0 A;  3DCG A;  1W1G A;  1WRD B;  3V6E B;  4FJY A;  4GDL B;  1WXM A;  4ANV A;  1KI1 B;  4ANW A;  2JPH A;  2KJ6 A;  1IYF A;  3APF A;  5JH5 C;  2PZ1 A;  4KHO A;  1X11 A;  5L83 A;  1V80 A;  2ZEQ A;  1H4R A;  4M0W B;  3EC8 A;  4JIO U;  1V5M A;  3AU4 A;  4HAX B;  3KSY A;  5JHG A;  2PE6 B;  3FSS A;  2K1F A;  2NCN A;  3KUC B;  4HK2 A;  4IM2 A;  5DPT A;  3W1Y A;  3HQC A;  3EPY A;  4HLE A;  2UZR A;  1VCB A;  2LGX A;  3PSE B;  2DHK A;  2ELB A;  4A6K A;  3TL5 A;  1I42 A;  2LVQ A;  4NJ7 A;  1P5T A;  2AEH A;  1H10 A;  4BOS C;  3A9K B;  2RSG A;  4TKN A;  2MWN B;  4Y94 A;  4PS8 A;  1WM3 A;  2NPT A;  3ML4 A;  2G35 A;  3LJ3 A;  4AOF A;  3ZIM A;  4BKS D;  3N3K B;  2AL6 A;  3NHE B;  3VUW A;  1WFY A;  3WA0 A;  2R2O A;  2N9P C;  1R4N I;  3DXC A;  1MIZ B;  2ADZ A;  4MY6 A;  5AEK B;  1X1F A;  4HHV A;  1GNU A;  4F8C B;  1MK9 B;  1AQC A;  3PVW A;  1WYW B;  2L0T A;  3QWZ B;  3ZRF A;  3L08 A;  1TGZ B;  2RSU A;  3SDL C;  1LQB A;  4K7U A;  2RQ1 A;  2YRY A;  2K8H A;  3HM6 X;  3T8M A;  1NVL A;  1H8C A;  5DHA B;  5KQ4 A;  3ENE A;  2UYZ B;  3A9K A;  1HE8 A;  1E90 A;  4H8S A;  4GN1 A;  1BWN A;  1ZC4 B;  1E8W A;  1T0Y A;  1WE6 A;  1WZ0 A;  4CYE A;  1Q67 A;  1MPH A;  2KLG A;  2ZCC A;  5D2M B;  4ASW C;  5DCN A;  2MFQ A;  4FLH A;  2M14 A;  1V81 A;  1WX7 A;  4G0N B;  3JYU A;  2K00 A;  1X1M A;  2FDQ A;  4HXD A;  4HPM B;  1V9J A;  1KLV A;  2L05 A;  1W1D A;  1D3Z A;  2DA0 A;  2L2I A;  2ZNV B;  4LDT D;  2LWP A;  4F7Z A;  3ZDT A;  1Y19 B;  3PG7 A;  4WJ7 A;  3PEG A;  4B6H A;  1TQZ A;  2M4N A;  3QA8 A;  2LOX A;  4ZRI A;  2WYQ A;  3ULC A;  2DYN A;  4DHZ B;  1VD2 A;  4K7S A;  4KVG B;  4HAZ B;  1V49 A;  1E7V A;  4W9C A;  1YJ1 A;  2FUH B;  1V5P A;  3UQB A;  1WJU A;  4W9J A;  4WJP A;  5AZF A;  4FJV B;  3PSC A;  4BBN F;  3ODO A;  2GS0 A;  4HB4 B;  1LFD A;  2JY6 A;  3C0R B;  2M17 A;  4XX5 A;  1A5R A;  1P3R A;  3DBS A;  3BIN A;  3B08 A;  2P8V A;  5JHB A;  5CHW A;  1M94 A;  2LUL A;  4II3 B;  4RMA A;  1EF5 A;  4WVF B;  2KTF A;  2KUP A;  3R7Q A;  2QKM A;  5CTR C;  3PHX B;  5FR6 A;  3PRP B;  2Y5B B;  2LUE A;  5DH9 B;  2G4S A;  2K25 A;  5CHF A;  3ZW3 A;  2DKQ A;  5E6O A;  2BYF A;  2G3Q B;  3EEC A;  2VRW B;  3D8E A;  2C9W B;  1TXD A;  2KTR B;  3H1U A;  4EJN A;  4ZDV A;  2KC2 A;  2DHJ A;  2M8S A;  2PE9 A;  1B55 A;  1J19 A;  1WM2 A;  3OJ3 A;  2L3Z A;  2IFS A;  3OAN A;  3TFM A;  2WH5 A;  2BKF A;  3ZTC A;  3QK0 A;  3DBL I;  3P6A A;  4FN2 A;  2YF0 A;  4BVU C;  4F7G A;  1SHC A;  1ZGU B;  3UGB B;  4EOY A;  1Y5O A;  3IFW B;  3KUD B;  1NBF C;  1J0G A;  1V6E A;  2COC A;  2KQS A;  1QQG A;  4KIK A;  3QIJ A;  4CHK A;  3VAW A;  4HCN B;  3W1S A;  1FHW A;  3CIK A;  2J7Q B;  5CLQ B;  1YX6 B;  3VUY A;  1S3S G;  4G3X B;  2XQN M;  3VTV A;  1J0W A;  2RR9 A;  4W9I A;  2RGN B;  3WAN A;  3ZUN A;  1V89 A;  1DBH A;  3T06 A;  3KZ1 A;  3CF6 E;  4GU2 A;  3WAO A;  1I7A A;  1WR1 A;  1G6J A;  2DAF A;  4G11 A;  5AZG A;  3DDC B;  3DQV A;  2MP2 B;  4KZ0 A;  4M8M A;  5C5B B;  2JZZ A;  1NDD A;  4K7W A;  2V1Y A;  3WIM A;  2W9N A;  3VH4 B;  4MJS A;  5CHV C;  1XCG A;  1E7U A;  3V6C B;  1FGY A;  2MBQ A;  3MPX A;  2KDI A;  3RUI B;  2KFK A;  3R7R A;  4DK5 A;  3PGE A;  2JT4 B;  2RLO A;  1EAZ A;  3HIZ A;  3M63 B;  4A6F A;  1WMH A;  2JUO A;  3F5R A;  2DLW A;  4DBB A;  2K8B A;  2KN5 A;  2RGF A;  2L1C A;  2BKR B;  3PVU A;  3A4R A;  3VXW A;  3A8P A;  5LON B;  4LJO B;  3VVW B;  2O6V A;  3ZNG C;  1WZ3 A;  4NQL B;  4W9E A;  1HBK A;  4NSW A;  4MT7 A;  1NTI A;  1F9J A;  1V5O A;  4HAV B;  1HB6 A;  2HJ8 A;  2MCN B;  4I6P A;  4WSF A;  3O65 B;  2GBM A;  3VUX A;  4B6W A;  4GXB A;  3A9J A;  2C7M B;  2DN6 A;  3KY9 A;  4NAW B;  3CMM B;  2BYE A;  3FLV A;  3NS8 A;  4TUU A;  3U30 A;  3QAR A;  1KM7 A;  2O6V D;  2COF A;  2WX1 A;  2R2Q A;  2N0Y A;  3DVG Y;  4AJW A;  2CAY A;  2J0M A;  1LM8 B;  5L95 C;  1UNQ A;  3NOB A;  3N32 A;  1X1G A;  4HB0 B;  3ALB A;  3F0W A;  2CHX A;  3PRZ A;  5D3X A;  2IO1 B;  4AUQ C;  1KOT A;  2L76 A;  2YS5 A;  3Q3F A;  4DHZ E;  3ZTD A;  4PYZ A;  4EZK A;  3B0A A;  4HVB A;  2J0J A;  3KRX A;  3KUZ A;  3TW1 A;  2CR5 A;  4PS7 A;  1ST7 A;  1WJ4 A;  3RYT A;  3UF8 A;  5D3V A;  1NI2 A;  3GYO A;  3V60 A;  2VKI A;  2ABD A;  1WX8 A;  5JZE B;  5HE3 A;  2I5C A;  5IAA C;  2ZNV C;  4RM9 A;  2IY1 B;  2HTH B;  3APC A;  3PRM B;  2D07 B;  2J0K A;  4C0A A;  2LRU A;  4HAY B;  2YLM A;  1ZKH A;  4MSQ B;  4IWP A;  2OQB A;  3D8F A;  2IZV B;  2N7E A;  4BOZ B;  2Y8F A;  2GMI C;  1WR6 E;  3KW5 B;  2IYB A;  2P0F A;  1L7Y A;  3QQ8 B;  2EKE C;  1TBE A;  1WF9 A;  3L54 A;  3V62 A;  2MKR A;  2HD5 B;  3KYC D;  3PTF C;  2DZJ A;  1CMX B;  5C23 A;  1UNR A;  2H7D A;  5J3T A;  2C60 A;  2KXJ A;  1EUV B;  3KVF B;  3VH3 B;  2KFJ A;  1WGU A;  1WH3 A;  3PS6 A;  2YS1 A;  3AU5 A;  1ISN A;  2RUK B;  1P0R A;  2CHZ A;  5LOP B;  2KC1 A;  4GIV A;  4W9L A;  4XC2 A;  2MA9 B;  2ELA A;  2V4L A;  1L2N A;  2ZPY A;  2HTH A;  2IO3 B;  4GSW A;  3NZS A;  5LXI B;  1LW3 A;  1AWE A;  2JXX A;  3RD2 A;  5D3Y A;  4CHM A;  1U29 A;  1DDV A;  2ZCB A;  3L16 A;  5J3Q A;  4JLC A;  5AZH A;  2BF8 B;  2Z0P A;  4OVU A;  2N1W A;  4ANX A;  2EMS A;  2FJ9 A;  5HE1 A;  3HW2 B;  3MDB C;  3QCA A;  1Z2M A;  4PYU A;  3VOQ A;  5C6R A;  3A98 B;  3V61 A;  4IUM B;  4GMX B;  2JF5 A;  2AL3 A;  2LI5 A;  5KCV A;  1RFA A;  5D27 A;  3X0W A;  2KDB A;  2XK5 B;  4DXA B;  2DKP A;  1SIF A;  1NU2 A;  1WGQ A;  2COP A;  2LG1 A;  2DX5 B;  1K5D B;  2FAZ A;  2L8J A;  1P98 A;  3SNH A;  3ONS A;  4FHK A;  4MEL A;  4E74 A;  3B1L X;  2UVM A;  5HE2 A;  2K6D B;  5KQ1 A;  3A4S C;  3UQA A;  4JQW C;  1XD4 A;  3S2A A;  2BWF A;  4WJO A;  4ICV A;  2MP2 A;  5G55 A;  5CX3 A;  3UIO B;  1GC7 A;  4KAX B;  4HB3 B;  2L00 B;  3A1Q A;  3JSV A;  4FA6 A;  1HB8 A;  1UPQ A;  2MBO A;  3L17 A;  4ZRJ A;  4CHJ A;  2HRJ A;  3QAQ A;  1XOD A;  3QJZ A;  3ZVV A;  2CY5 A;  4HAT B;  1BAK A;  2GBN A;  2Y7B A;  2CU1 A;  1WVH A;  2VRR B;  1ACA A;  3PRE A;  4EMO A;  1FHO A;  2COA A;  1NTY A;  3RCP A;  3ODX A;  1V61 A;  4ZRK A;  1XR0 B;  1U4A A;  1WX9 A;  2FID A;  2LJ5 A;  2MW5 A;  3SO6 A;  2WX0 A;  4W9H A;  2N9E B;  2MDX A;  3BJI A;  2KX3 A;  3UIP B;  2D11 A;  1YIW A;  2O6V B;  2I1J A;  2DZK A;  1WGD A;  3IHP C;  3ZO5 B;  1MG8 A;  2UZS A;  2BCJ A;  2DEN B;  1RAX A;  3T9L A;  3TCA A;  1WXS A;  4KHA A;  3ZDM C;  2RNR B;  5C1Z A;  5JHH A;  2J59 M;  2Z0D B;  1WJ1 A;  1BTK A;  2GOW A;  3CST A;  1Y8R C;  1P6S A;  2L0F A;  3QHT A;  4M8N A;  2I5F A;  2W2X D;  2OOB B;  1ZSQ A;  3ML9 A;  4MGZ E;  5KHQ A;  2DHI A;  2LVO A;  1UGM A;  1MK7 B;  4TYZ A;  4JGH B;  1OQN A;  3DXD A;  2X18 A;  1I35 A;  1UZX B;  4AP4 C;  1GC6 A;  2KAN A;  4B95 A;  4HPL B;  3FM8 C;  3ZRC A;  2FNJ B;  2QHO A;  5E6N A;  2DX1 A;  4GOC A;  2E2X A;  2FIF A;  2CHW A;  3RZF A;  3SHQ A;  2LKO A;  4KZC A;  2YVC A;  1X86 A;  1V5T A;  2K6Q A;  4YL8 A;  1EGX A;  5EDS A;  4MK0 A;  2N7D A;  4K1R B;  1R4M I;  4A5K A;  2D9Y A;  2ZVN A;  1K5G B;  4WQO B;  3GZN I;  4BKS A;  2OJR A;  4HAU B;  4GDK A;  2CS4 A;  1UH6 A;  2KK8 A;  3P2B A;  4MGY E;  2AWT A;  1UNP A;  2K2J A;  1Q0W B;  4LJP B;  1WJN A;  5D94 A;  1LXD A;  2WDT B;  3RCZ A;  5J17 A;  5DPW A;  2KNB A;  1OGW A;  3CSF A;  2ROZ B;  3IG3 A;  1IPG A;  3LDZ E;  2M0X A;  3QBV B;  5JHA A;  3ZLZ A;  3QWM A;  3HHM A;  1JRU A;  2DZM A;  4HCP B;  4DHJ D;  2P0D A;  1FB8 A;  4PNK A;  2KDF B;  1OMW A;  1OEY A;  4EZJ A;  1V88 A;  2FJL A;  2YT1 A;  4KSK C;  5TR5 A;  4G50 A;  5DI9 B;  2O2V B;  1M7R A;  3FEH A;  2LRW A;  1C1Y B;  4DBG A;  1C3T A;  2LGY A;  1BT0 A;  3WAL A;  4B9K A;  1U2B A;  1TZ1 A;  2KJR A;  2CY4 A;  3OAW A;  4MDK E;  2Z0E B;  2Q13 A;  1OTR B;  1V2Y A;  2KLC A;  4MJS B;  3SD5 A;  4Z2M B;  1MIX A;  4W9D A;  5D7G A;  4PQ0 A;  3H7P B; 
#chains in the Genus database with same CATH topology
 2KFK B;  1SEB D;  1IUE A;  1EWY C;  3VDZ A;  4C4V A;  5JXV A;  1E8Y A;  2LXA A;  3JVZ X;  4EZL A;  3B2G A;  3BY4 B;  1C4P A;  2FBW B;  3CIR B;  4HPP A;  3MC8 A;  3HK0 A;  3R3M A;  3AE8 B;  3PV1 A;  1ZW7 A;  2YSZ A;  1ENF A;  2RPV A;  3RFZ B;  3N7C A;  3RPF C;  3KWV A;  4UDU C;  3DHI C;  3E9L A;  5M4Y B;  3M62 B;  2OTX A;  3AUL A;  1WGR A;  1SE9 A;  4JKC A;  5CLL B;  1C77 A;  3AV8 A;  5FI0 A;  3EFU A;  4KHB B;  4FAD A;  4ILG B;  2KMC A;  2L7R A;  1U5F A;  1C76 A;  4LTU A;  3DBH I;  1WJM A;  2Z0Q A;  2VSZ A;  2Y3A A;  2FCM A;  1SE3 A;  4AJY B;  2QIL A;  3SV1 A;  1XXG A;  3I3T B;  3PPA A;  3W9C B;  2K22 A;  1HXY D;  3Q3J A;  2KVZ A;  2LXC A;  2M0A A;  4WWM A;  2DZI A;  2D3G A;  1I2H A;  2Z59 A;  1T3Q A;  1GPX A;  1D5X C;  1E8Z A;  4E3C A;  2MX2 A;  1OY2 A;  4DHJ B;  2FCS A;  3GYP A;  2KMA A;  1QT9 A;  3V05 A;  3A1Q B;  3PZD A;  2WDQ B;  3MFG A;  2REX A;  3WCQ A;  2MSE D;  2QSD A;  3A58 A;  4LCD E;  4K2O A;  3VFK A;  1MVK A;  1M4V A;  3OLM D;  4IWO A;  1GB4 A;  1ZXI A;  3MJW A;  2KJH B;  2ZVO A;  1KH0 A;  3AB5 A;  2D9Z A;  1WSP A;  2NTT A;  1JWA D;  3G9W A;  4BKT A;  1FXI A;  3SYX A;  1OQQ A;  1KF6 B;  3DVG X;  4HJK A;  2L83 A;  3L10 B;  1PLS A;  2L1A A;  1XLO A;  1N6Z A;  2CRF A;  3NW8 A;  1FXT B;  2JRH A;  1R4M B;  3VTU A;  3K9O B;  1RJ2 A;  3TMP B;  1ET9 A;  4KDI C;  4ZYN A;  1E8X A;  4RFB A;  4KKI A;  1C4A A;  2PJH A;  4F7U P;  2KOX A;  1FOE A;  2YS3 A;  1V5U A;  1V97 A;  2RMM A;  1OFF A;  2KHW B;  2KWU B;  1FRD A;  2K9X A;  4JK8 A;  2KKC A;  1ZVR A;  5L81 A;  4OVV A;  3FAH A;  3R66 C;  2DTC A;  1DIK A;  3APD A;  2O2V A;  4KSL C;  4DDI D;  2LMC A;  1TS2 A;  2NS5 A;  3DOW A;  3ZVR A;  3M95 A;  3PHW B;  2D10 A;  2A4Z A;  5BMH A;  4DX8 A;  2JWZ A;  2AYO B;  5DPS A;  1KZG A;  2BB5 A;  5C3J B;  1E5W A;  4IM0 A;  3U4E G;  2NBW B;  1WXV A;  4W9K A;  1WYG A;  1GOZ A;  3TIX A;  1WG7 A;  1TJE A;  1DGJ A;  3TJP A;  2MWS B;  2JP2 A;  1BTN A;  1TZO A;  5BO4 B;  1DYQ A;  1L5P A;  2P0H A;  4IFS A;  2ZZP B;  2M1M A;  3FP5 A;  1P1A A;  3BYY B;  4WWN A;  2CJO A;  4DWF A;  4P7I A;  2W82 A;  1W1G A;  3DCG A;  4FJY A;  4YT0 B;  1WXM A;  4ANV A;  1KI1 B;  4JE3 B;  4ANW A;  4L1B A;  5JH5 C;  4KHO A;  5L83 A;  3T3N A;  2OED A;  4YXD B;  3AU4 A;  4HAX B;  3KSY A;  5JHG A;  4HK2 A;  1STE A;  1V1P A;  2X8X X;  2AEH A;  3A9K B;  2RSG A;  4TKN A;  4Y94 A;  3LJ3 A;  3BVG A;  3ZIM A;  3NHE B;  2OJW A;  3NJT A;  3FC4 A;  4XYC A;  4MY6 A;  5AEK B;  4HHV A;  1ZYI A;  1MK9 B;  2L0T A;  2INP E;  3L08 A;  5EE3 A;  3SDL C;  1LQB A;  1DOX A;  3HM6 X;  3FIL A;  5DHA B;  1HE8 A;  1WE6 A;  4GN1 A;  1BWN A;  1WZ0 A;  2D5G A;  4G50 A;  1MPH A;  1L0V B;  5DCN A;  4G0N B;  2K00 A;  3AED B;  5H92 C;  1Q10 A;  2L2I A;  4F7Z A;  4B6H A;  2M4N A;  3PG7 A;  4ZRI A;  2B76 B;  3I63 C;  1JCK B;  4KVG B;  2LJI A;  3UQB A;  1FO4 A;  4W9J A;  5AZF A;  4ZDV A;  3PSC A;  4P16 A;  4BBN F;  1LFD A;  2JY6 A;  2WHI A;  1UUP A;  2DWQ A;  4XX5 A;  5H8Y E;  3VR8 B;  2BW2 A;  2WNM A;  1HEZ E;  3U2S C;  3I9V 1;  2KUP A;  3P4Q B;  5CTR C;  2GRI A;  2Y5B B;  2G4S A;  2K25 A;  3ZW3 A;  5E6O A;  2K0P A;  1TKE A;  2Y5C A;  3H1U A;  4ZRQ A;  3PZ7 A;  2V0G A;  1B55 A;  2D3C A;  2W55 A;  3DBH B;  2YF0 A;  2VH2 A;  3IFW B;  3FVC A;  1E7P B;  2COC A;  1L4Z B;  4XDC A;  4KIK A;  3CIK A;  5CLQ B;  3RNB C;  1J0W A;  2RR9 A;  2RGN B;  1I7A A;  4OVZ A;  4G11 A;  2MP2 B;  5C5B B;  3VRA B;  1J7C A;  1I4G A;  5GXG B;  3LYY A;  1FGY A;  3MPX A;  2KDI A;  3GS2 A;  2JT4 B;  4A6F A;  1EWC A;  2RDH A;  2DLW A;  3VVW B;  5D3I B;  2HJ8 A;  4HAV B;  1HB6 A;  4I6P A;  4B6W A;  2WXH A;  2LEK A;  3U30 A;  4TUU A;  3QAR A;  1NI3 A;  3Q14 C;  2J0M A;  4HB0 B;  3F0W A;  2CHX A;  3PRZ A;  5D3X A;  3AEB B;  2PLP A;  3ZTD A;  4PS7 A;  3RYT A;  2VKI A;  5IAA C;  2WQY B;  2IY1 B;  1JRO A;  3PRM B;  2YLM A;  2J0K A;  2OQB A;  2GMI C;  1L7Y A;  2EKE C;  3L54 A;  2HD5 B;  3AE5 B;  3KYC D;  5C23 A;  1EUV B;  4A8X C;  1IBX A;  2KFJ A;  3AE7 B;  1P7F A;  1KBL A;  4W9L A;  3AU5 A;  2KC1 A;  2ELA A;  4GSW A;  1LW3 A;  2ZCB A;  4JLC A;  5AZH A;  1QKZ A;  5IRS A;  3BYT B;  3AN1 A;  5HE1 A;  1B1Z A;  1RM6 C;  2LI5 A;  1RFA A;  3X0W A;  2K3U A;  2KDB A;  3U52 E;  4DXA B;  3AM9 A;  4ITK A;  4E74 A;  4MEL A;  2WXR A;  3B1L X;  2K6D B;  4KGT A;  4JQW C;  4C4V B;  5G55 A;  1MG4 A;  2N0S B;  2BTE A;  2L32 A;  1GC7 A;  1HB8 A;  1UPQ A;  2OHF A;  1P7E A;  4HJG E;  1L6U A;  4HRO A;  1WRI A;  1BAK A;  2Y7B A;  1WVH A;  3HIE A;  3PRE A;  2WX1 A;  2FID A;  2BB6 A;  3SO6 A;  3UIP B;  4RGN A;  2D11 A;  2DLB A;  1ZPS A;  3O13 A;  3T9L A;  3ZDM C;  1WXS A;  4KHA A;  3BVZ A;  2ZW1 A;  1WJ1 A;  1Y8R C;  3RNF C;  1F2R I;  3TEZ A;  4TSS A;  2QC8 A;  3ML9 A;  3NWD A;  2VH1 A;  2DHI A;  4TYZ A;  1UZX B;  4JKE A;  1DOY A;  1GC6 A;  4JKG A;  4QAY A;  3FM8 C;  5E6N A;  3AEE B;  1FCC C;  2CHW A;  1FMA D;  2YVC A;  4WH4 A;  4A5K A;  2D9Y A;  1ZOY B;  5BMI A;  2D3A A;  4A55 A;  4P6V F;  3NVY A;  4MGY E;  3TEY A;  2K2J A;  3RCZ A;  2N9K A;  1OGW A;  2BBC A;  3CSF A;  2UU7 A;  4HSI A;  3QWM A;  1JRU A;  2DZM A;  4DHJ D;  4ARI A;  1YN4 A;  2KDF B;  4EZJ A;  2N7J A;  5DI9 B;  1M7R A;  2LRW A;  3WAL A;  2W54 A;  1QLB B;  1DOI A;  1OTR B;  5IKC M;  1AW7 A;  1MIX A;  1AWD A;  4PQ0 A;  2X0S A;  3H7P B;  1JQ4 A;  2KDE B;  1WI1 A;  3DPD A;  4BBK A;  4NJ6 A;  1XT9 B;  2DYM A;  1RWS A;  4HDO A;  2H7E A;  4GGQ A;  3L0W B;  3JSV B;  3HM3 A;  5HE0 A;  1LB1 A;  2NPT B;  2V3S A;  2WXP A;  5FK9 C;  2KDM A;  1QIL A;  5FKA C;  4GZU A;  1XQQ A;  2J52 A;  2KD0 A;  2PEA A;  3D8D A;  1L4D B;  2LFI A;  3AE6 B;  3NS1 A;  2W2X C;  4II2 B;  4IWQ A;  4K3B A;  4GDL A;  3U8Z A;  2PMV A;  2V76 A;  1VJK A;  4MSM B;  2KCJ A;  3VIA A;  1RRP B;  3SEB A;  1L6V A;  4YTP B;  4W9G A;  3KYD D;  4IOY X;  4XE0 A;  2J42 A;  3WYF B;  2XNA C;  1QQR A;  1Z5S B;  2SEB D;  2GBK A;  3I57 A;  2FJU B;  2IGH A;  3PT2 B;  4KV2 A;  2HJ1 A;  3P1M A;  1YQ3 B;  4GDK B;  2H88 B;  5G2N A;  4S0R A;  1GUA B;  1RLF A;  3PO0 A;  3OJ4 B;  4F1S A;  1VRA B;  1OQY A;  5C79 A;  2KT7 A;  3Q3N C;  1N63 A;  4RNA A;  1UEF A;  2N9L A;  4RCO A;  5D6J B;  1VBG A;  2EKI A;  2Z13 A;  1XLQ A;  3M1I B;  5I2S A;  2Z4D A;  2MBB B;  2UWQ A;  2BWE S;  1IRS A;  2MRP A;  1MKE A;  3RUL A;  1DDW A;  3O96 A;  2R2Y A;  2L52 A;  3ECI A;  4EUT A;  2IGD A;  1RRB A;  1F1H A;  3ODW A;  5IA7 A;  3N20 C;  1AYF A;  2EJ8 A;  1ROE A;  5LLI A;  2BGF A;  2ZPN A;  1S1Q B;  2ROV A;  2FCQ A;  2INN E;  3NY5 A;  2N4F A;  1MFW A;  3V5W A;  2XEW A;  3N9Y C;  2GI9 A;  4RGM A;  1MI0 A;  4WWO A;  1I7H A;  1PGB A;  1FFV A;  1TY2 A;  1ZP0 B;  3U7D A;  4US9 A;  2WLB A;  3GZN B;  3H7S A;  2KVR A;  4GB9 A;  4NNJ B;  5HG2 A;  4IAP A;  5FI1 A;  5E6P A;  2G1E A;  1XO3 A;  5DIF B;  4MEM A;  3RI7 C;  3SUZ A;  1RFK A;  1Q5W B;  4HWI B;  1U27 A;  2COD A;  3CXB B;  3WAP A;  2LAS A;  1E10 A;  3NSU A;  4ZRP A;  1DYN A;  1SJE D;  3P4S B;  2RDG A;  3KRW A;  2GBR A;  4JL9 A;  2XBB C;  4W9F A;  1SE2 A;  1Q1O A;  2JX5 A;  3E56 A;  3VHT C;  3K9P B;  3GOE A;  4MGI E;  4TQ0 A;  4M00 A;  2M38 A;  4EKU A;  1WGH A;  2BS2 B;  3AE3 B;  4FUL A;  3W2D A;  1N5X A;  4WWP A;  4EEW A;  1LGR A;  3H6N A;  1SGH A;  2DYO A;  2WWZ A;  2D2Q A;  1U5G A;  1JWM D;  2HE7 A;  1IGD A;  3UZT A;  1C4C A;  3C8Y A;  4JPS A;  2QJL A;  3CWI A;  3V6E B;  4GDL B;  1WWT A;  1CQV A;  1J7B A;  4KGS A;  1IYF A;  3TSS A;  2PZ1 A;  5IP4 D;  5HHD G;  4M0W B;  1H4R A;  3W5U B;  1V5M A;  2PE6 B;  3FSS A;  3KUC B;  2JXT A;  4HLE A;  1VCB A;  1P5T A;  2KAC A;  4ZYS A;  1VZ8 A;  2MWN B;  1WM3 A;  3ML4 A;  4QJ4 B;  3VUW A;  3E9S A;  1WFY A;  3WA0 A;  2RDB C;  2N9P C;  1R4N I;  3DXC A;  2H89 B;  2ADZ A;  3QWZ B;  3ZRF A;  4RF0 A;  1TGZ B;  4OW0 A;  2K49 A;  3EA6 A;  2K8H A;  1H8C A;  1E90 A;  4J6I A;  4CSQ A;  1ZC4 B;  1T0R C;  2MFQ A;  3N1Z C;  3JYU A;  1CJE A;  4HPM B;  3GE8 C;  1CK1 A;  4B0M A;  3OWE B;  2ZNV B;  2WXO A;  3ZDT A;  1Y56 A;  3QA8 A;  2LOX A;  2WYQ A;  2FE8 A;  3MC9 A;  3ULC A;  2DYN A;  5IO9 A;  1E7V A;  4JKF A;  1YJ1 A;  2FUH B;  2VZK D;  4W9C A;  4YWG G;  1WJU A;  5LXH A;  4FJV B;  3ODO A;  2GS0 A;  4HB4 B;  2BQQ A;  3B08 A;  3FKY A;  2I38 A;  4P1C C;  1M94 A;  4II3 B;  1EF5 A;  4YTM B;  3R7Q A;  3PHX B;  5FR6 A;  3PRP B;  2R82 A;  1V8C A;  2LUE A;  2BYF A;  3EEC A;  2VRW B;  3D8E A;  4EJN A;  2PE9 A;  1KTK A;  4JKD A;  3OJ3 A;  2IFS A;  3OAN A;  3DBL I;  4K3C A;  3TEX A;  4EOY A;  3UGB B;  1NBF C;  3TEW A;  2IDY A;  1QQG A;  4CHK A;  1E0Z A;  3VAW A;  1YX6 B;  3VUY A;  1S3S G;  4W9I A;  4HKQ A;  1V89 A;  1DBH A;  3T06 A;  3KZ1 A;  3CF6 E;  1N62 A;  2DAF A;  4M8M A;  4WIP A;  1IBX B;  2V1Y A;  4MJS A;  5CHV C;  3R7R A;  3B77 A;  1K53 A;  3F5R A;  1QF6 A;  4DBB A;  2V3P A;  4YSY B;  3A8P A;  5LON B;  4LJO B;  4ARC A;  4W9E A;  1TKG A;  1HZ5 A;  1XCQ L;  4GXB A;  3E66 A;  3SR6 A;  3KY9 A;  4NAW B;  1L0X B;  2R2Q A;  2N0Y A;  3DVG Y;  4AJW A;  2CAY A;  1LM8 B;  3RMK C;  2BS3 B;  2YEP F;  1XLN A;  3ENB A;  1KOT A;  1I4P A;  3B0A A;  3KRX A;  1VLB A;  5EE1 A;  4C56 C;  3UF8 A;  1ST7 A;  1WJ4 A;  3V60 A;  1NI2 A;  1WX8 A;  5HE3 A;  2ZNV C;  3APC A;  3RT3 B;  2D07 B;  4C0A A;  2LRU A;  4HAY B;  1GB1 A;  1N61 A;  2PVG C;  2IZV B;  2N7E A;  3KW5 B;  2AX5 A;  2IYB A;  2GLS A;  5BMG A;  4YSZ B;  3RNA C;  1HZ6 A;  2KXJ A;  1WGU A;  2YS1 A;  1P0R A;  1ISN A;  5G5H A;  5LOP B;  2MA9 B;  2HTH A;  1NEK B;  2IO3 B;  3RD2 A;  5EE0 A;  5D3Y A;  3L16 A;  2BF8 B;  4OVU A;  2FUG 1;  2FJ9 A;  3MDB C;  3QCA A;  1Z2M A;  4PYU A;  3V61 A;  4GMX B;  2JF5 A;  5KCV A;  3R2I A;  2XK5 B;  1WGQ A;  2LG1 A;  3SNH A;  1YN3 A;  2UVM A;  5HE2 A;  1UNS A;  2BWF A;  3Q8C A;  3JSV A;  2XN9 C;  2IGG A;  4FA6 A;  3L17 A;  4CHJ A;  3ZVV A;  1XOD A;  2CU1 A;  1ACA A;  1F77 A;  1FHO A;  4DQO C;  3RCP A;  3ODX A;  4ZRK A;  1XR0 B;  3BII D;  2WX0 A;  3BJI A;  2KX3 A;  1YIW A;  2BCJ A;  5C1Z A;  5JHH A;  2J59 M;  2QIE B;  2PKO A;  2L0F A;  3QHT A;  4M8N A;  2AQ3 B;  4MGZ E;  3RN9 C;  1UGM A;  1MK7 B;  4JGH B;  2NBV A;  1OQN A;  2ONQ A;  1SSN A;  1V1O A;  2PW9 A;  3HUI A;  2ZKM X;  2PTL A;  2LKO A;  4YL8 A;  1EGX A;  4K1R B;  1K5G B;  4BKS A;  3GZN I;  2WDV B;  1V1P B;  4GDK A;  3P2B A;  2AWT A;  3HVZ A;  1UNP A;  1K51 A;  5DPW A;  2MHJ A;  2KNB A;  5HI1 A;  2ROZ B;  3LDZ E;  3QBV B;  3ZLZ A;  3EGR A;  4HCP B;  1FB8 A;  4L1R A;  2TSS A;  4D2K A;  1OMW A;  1OEY A;  1V88 A;  2FJL A;  2YT1 A;  4KSK C;  4DBG A;  1C3T A;  3ETR A;  2KJR A;  2CY4 A;  4MDK E;  2KIE A;  1TT5 B;  4MJS B;  2AQ2 B;  4MAC A;  4XWX A;  2DX5 A;  4F7H A;  3AJ4 A;  3N1X C;  4NQK E;  2IPK D;  4TQ1 A;  1YX5 B;  3EFC A;  4IW0 A;  1XX0 A;  4NY0 A;  1P9D U;  2N9X A;  3M3J A;  1F0Z A;  1JWS D;  4PK1 A;  4C7Y A;  1PDX A;  4XZ4 A;  2D9V A;  2GCJ A;  1U5E A;  1KRH A;  2LBB A;  1WGY A;  4FBJ B;  2C7H A;  2BYV E;  2KQ4 X;  4BFR A;  1XKE A;  1KFY B;  2MBH A;  4ICU A;  4FHJ A;  4MGK E;  4AWJ A;  3AI5 A;  3RNG C;  1PMS A;  1YOV B;  3KH0 A;  1UWM A;  4K2P A;  3AEF B;  2DYQ A;  2PPH A;  1ZXH A;  3ZNZ B;  2KX0 A;  1JWU D;  4KIK B;  1K50 A;  5GOW B;  1WI0 A;  3D32 A;  1M7E A;  5J3Y A;  2WXK A;  1FNU A;  2KAJ A;  1V86 A;  4X57 B;  1NYQ A;  3WAM A;  1TKY A;  1FAO A;  1PFD A;  3UI3 A;  2D9W A;  2DFK A;  3VQI A;  3E9P A;  2LGD A;  1YJI A;  4JKA A;  4D0N B;  1SE4 A;  2PIA A;  1WIA A;  2N1V A;  4GPT B;  2ICI A;  3Q3O C;  2WP9 B;  1HTO A;  3ZNI D;  2ASQ A;  1VZ7 A;  2R0D A;  3BK1 A;  1ZC3 B;  1T0Q C;  1UPR A;  1AAR A;  1T5X D;  4RF1 A;  2KZR A;  1VDV A;  3Q2A C;  1QC6 A;  2KN4 A;  4BBN C;  2KQ7 A;  2KWV B;  1JAL A;  1WGG A;  5HFY A;  3A33 B;  2GCL A;  1TY0 A;  2D4Q A;  2RPQ A;  2BYT A;  1GAQ B;  2KO3 A;  2KWC A;  2G4D B;  2ACZ B;  1WXA A;  1I4Q A;  1UD7 A;  4O1N A;  1OQR A;  1GG3 A;  3TVV A;  4MH0 E;  4RM8 A;  1WMH B;  1YD8 U;  4LDT B;  1KZ7 A;  1T77 A;  4JKG B;  4BKG A;  1JW9 D;  2GUM A;  2BT6 A;  2W3R A;  5IJM A;  1N3H A;  3MJ5 A;  2R09 A;  4OSN A;  5I4D A;  1EF1 A;  1GJZ A;  2C7N B;  1UF0 A;  1WY8 A;  4JWS C;  3AXC A;  3ZNH B;  3X23 A;  3IVF A;  2GB1 A;  2RD0 A;  2RVB B;  2MJE A;  3KWL A;  1UEL A;  4Q2J A;  2NMB A;  2LYD A;  3J9C A;  2D9X A;  4KDL B;  2Y8G A;  3E9O A;  3AMZ A;  3QX1 A;  1R4N B;  2M19 A;  3JW0 X;  4A6Q A;  4OHJ A;  3ULB A;  2I2Y A;  2LZ6 A;  1P3Q U;  4URK A;  3AE4 B;  1Z87 A;  2CKH B;  1PQS A;  2MBE A;  3A9J B;  2NMQ A;  2MEK A;  1VZ6 A;  3OHM B;  4I6N B;  2IY0 B;  1YN5 A;  2JWU A;  2EC1 A;  2JZ3 B;  4TV3 A;  1UBI A;  2KIG A;  5C2T B;  1BUI C;  2K8C A;  3IAM 1;  2K2U A;  2JSV X;  4JX1 C;  2DIK A;  3NVW A;  4CO7 A;  1QZE A;  2WXM A;  1ZM0 A;  3MTN B;  2Z0O A;  4IC7 B;  4A20 A;  1JML A;  3DXE A;  2M56 B;  4LLG M;  4ANU A;  4A6H A;  2V3N A;  4I6L B;  2BPS A;  4ZHO A;  2YT0 A;  1WRD B;  3AE2 B;  3HSA A;  2KJ6 A;  1X11 A;  4S17 A;  1V80 A;  1FRR A;  4OZC A;  4JIO U;  3V62 A;  3EPY A;  2UZR A;  2LGX A;  2W3S A;  1J7A A;  2DHK A;  3PSE B;  4A90 A;  4HRS A;  4XWT A;  2LUM A;  4BOS C;  2NPT A;  2G35 A;  2AL6 A;  2BS4 B;  3U12 A;  1X1F A;  2K5P A;  1WYW B;  3AE9 B;  2HDE A;  4K7U A;  2RQ1 A;  1NVL A;  2IND C;  3DHH C;  2UYZ B;  3A9K A;  1E8W A;  3Q8F A;  4AS1 A;  1T0Y A;  2MJ3 A;  4CYE A;  2PVO D;  2ZCC A;  4ASW C;  4FLH A;  1JDE A;  2M14 A;  3IXS A;  1X1M A;  2FDQ A;  4HXD A;  1KLV A;  3AEG B;  1W1D A;  1D3Z A;  4IOI E;  3IT6 B;  1FNV A;  2LWP A;  4LDT D;  4WJ7 A;  3FIL B;  3NZ3 A;  1JWB D;  1ZDV A;  2YT2 A;  4DHZ B;  4K7S A;  1V49 A;  5LNK 1;  1V5P A;  5BYS A;  4ACF A;  4WJP A;  1EM7 A;  5IOI A;  1I4X A;  3C0R B;  1A5R A;  1P3R A;  4AQ7 A;  5CHW A;  1RYJ A;  5CHF A;  3MP9 A;  2DKQ A;  2MH7 A;  2G3Q B;  1C9F A;  2Z8L A;  2C9W B;  2KC2 A;  2DHJ A;  2M8S A;  5LG4 B;  1WM2 A;  2L3Z A;  2WH5 A;  3ZTC A;  4TMA B;  4BVU C;  4F7G A;  2HTM E;  1N60 A;  1V6E A;  2KQS A;  3W1S A;  1FHW A;  2J7Q B;  1N5W A;  4G3X B;  3VTV A;  3WAN A;  3WAO A;  1JRP A;  1HQR D;  2JZP A;  1ZDX A;  4H2A A;  3DDC B;  3DQV A;  4K7W A;  4QXA B;  3VH4 B;  1XCG A;  1E7U A;  3Q69 A;  2RLO A;  3M63 B;  2DNF A;  2KN5 A;  2BKR B;  3A4R A;  1I4H A;  3ZNG C;  4NQL B;  1MHH E;  1HBK A;  4MT7 A;  1NTI A;  1V5O A;  2D3B A;  2MCN B;  4QJ3 B;  3O65 B;  2GBM A;  3DCX A;  2C7M B;  3FLV A;  2COF A;  2WXF A;  5L95 C;  3ZJT A;  1IGC A;  3ALB A;  2LHD A;  2WXL A;  2IO1 B;  4M01 A;  4AUQ C;  4EZK A;  4PYZ A;  4N6E B;  4HVB A;  5AUK A;  2J0J A;  3KUZ A;  2CR5 A;  3GYO A;  4IKG A;  5JZE B;  2ABD A;  4JKH A;  4KHB A;  3NRZ A;  5EDS A;  1MPE A;  3IT4 B;  4REZ A;  4YSX B;  4BOZ B;  3D8F A;  2Y8F A;  4IG7 B;  1WR6 E;  3P4P B;  1ZUD 2;  3V3X A;  3VTW A;  2WU2 B;  1UNR A;  2H7D A;  3VH3 B;  1WH3 A;  4GIV A;  4XC2 A;  2CHZ A;  3Q3M C;  2ZPY A;  5I2M A;  4RGT A;  1DDV A;  1XCT L;  4ANX A;  2KUQ A;  3HW2 B;  3VOQ A;  4BAX A;  3A98 B;  5D27 A;  3B2F A;  4HKZ E;  3AEA B;  4LNF A;  2DKP A;  1SIF A;  2DX5 B;  1NU2 A;  4C80 A;  2COP A;  3ONS A;  3W1S C;  1K5D B;  2FAZ A;  4FHK A;  1P98 A;  4D6W A;  3UQA A;  3A4S C;  4NAM A;  1XD4 A;  1XF5 L;  3UIO B;  4ICV A;  2LGI A;  2E3T A;  3DHG C;  4KAX B;  2L00 B;  3RNC C;  1L0Y B;  5EE9 A;  2HRJ A;  3QJZ A;  3ZYY X;  2CY5 A;  2GBN A;  4EMO A;  1NTY A;  1WX9 A;  1V61 A;  2LJ5 A;  2MW5 A;  3VXW A;  4N59 A;  2MDX A;  2EEL A;  3N1Y C;  2O6V B;  2I1J A;  2DZK A;  1MG8 A;  2QMT A;  2DEN B;  1RAX A;  3TCA A;  2RNR B;  2Z0D B;  1B9R A;  4YTN B;  2OOB B;  1ZSQ A;  5KHQ A;  4L2Y A;  1I35 A;  2V9H A;  2X18 A;  1K52 A;  4AP4 C;  2KAN A;  3ZRC A;  2QHO A;  1YJJ A;  4GOC A;  1CZP A;  2FIF A;  4NJC A;  4JK9 A;  4JK7 A;  4KZC A;  5MPO A;  1X86 A;  4MK0 A;  1D5Z C;  1R4M I;  4HEA 1;  2ZVN A;  4WQO B;  4HAU B;  4OT1 A;  2CS4 A;  1UH6 A;  1BML C;  1WJN A;  1LXD A;  2WDT B;  4XWW A;  1IPG A;  3HHM A;  4MM3 B;  4PNK A;  2O2V B;  3FEH A;  3Q8A A;  1F52 A;  1TZ1 A;  1FFU A;  1V2Y A;  3SD5 A;  4Z2M B;  3GP7 A;  4W9D A;  5D7G A;  3NWF A;  2R2O A;  1FM0 D;  3NUH B;  5JP4 A;  4L6E A;  3HRD D;  4WJQ A;  5T8I A;  1NEN B;  2GBJ A;  1I4R A;  3P7Z A;  3AE1 B;  1TTN A;  2C5L C;  3RZW C;  5HKH A;  4ZHP A;  2Y5P A;  2JVC A;  1UGJ A;  4QJ5 B;  3BVM A;  4LNO A;  3TO1 A;  3H7P A;  2W2W A;  5DHF B;  4DX9 0;  1EU3 A;  4CQN A;  2J4X A;  3RNE C;  1K8R B;  2JRI B;  4WJN A;  2K39 A;  1GGO A;  1MJD A;  3H8H A;  5EFX A;  2YEP B;  3I5J C;  1XD3 B;  4DDG D;  1IP9 A;  2Z14 A;  3AEC B;  4HAW B;  3TUO A;  5D3W A;  3TBL D;  1KJT A;  2NVU I;  4GOU A;  1WJ6 A;  2B3A A;  4YON A;  3P42 A;  5D3D A;  4LNK A;  2MJD A;  2CB8 A;  3DBL B;  3DVN V;  3R2T A;  2JYT A;  2KGX B;  2LVP A;  4E71 A;  1YMH E;  2Q5W D;  1D5M C;  2CQU A;  3LXF A;  2ZJD A;  1PFJ A;  4B0E A;  2G45 B;  4IM3 A;  1T6B X;  1NYR A;  2MLB A;  3GB1 A;  1J8C A;  1EU4 A;  3MC0 B;  3N30 A;  1FHX A;  4NPN A;  3NZU A;  2XK5 A;  2IO0 B;  1PYW D;  1XLP A;  3R8B A;  1TJ6 A;  3ABV B;  3EUB 2;  3UIN B;  2KYW A;  2CJN A;  2IYD B;  3PLV A;  3MHS D;  2N23 A;  3DBR B;  5DPR A;  1U5D A;  1FEH A;  2INC C;  4NAW A;  1EVH A;  3LJU X;  3VRB B;  2IBI B;  2NR2 A;  3PP2 A;  3ML8 A;  1DRO A;  3GE3 C;  1FGZ A;  1TYG B;  2LOZ A;  3QC8 B;  5C5B A;  2V4I B;  5KHO A;  2DHZ A;  1FPY A;  1SJH D;  4MM3 A;  1TS3 A;  1X05 A;  2KTR A;  4Z2N A;  1A70 A;  2GJY A;  4IDI A;  4KKJ A;  3P63 A;  4HB2 B;  4A6F B;  4EFO A;  4K17 A;  4JWU C;  2RRF A;  4P1B C;  4N9F 4;  4C00 A;  3A8Q A;  2WXI A;  1WE7 A;  1C79 A;  4K81 A;  2A5U A;  4LK0 M;  5GMV A;  2I1K A;  1LO5 D;  1SXT A;  2KWD A;  3AH7 A;  4A3O A;  1YQB A;  4NZL B;  5J18 A;  4GMV A;  3ZKJ C;  3NVZ A;  2EMT A;  3SU8 X;  2MQJ A;  1HTQ A;  2FCN A;  1MAI A;  3L13 A;  1AN8 A;  4KGR A;  3PVL A;  2LD9 A;  4A3P A;  2IO2 B;  2NBV B;  5JLJ B;  3HVD A;  1UBQ A;  3ZGZ A;  2Z59 B;  1OEY J;  3PLU A;  1T0S C;  1EO6 A;  3IBE A;  3EHV A;  4EE2 A;  2DAJ A;  5C16 A;  2NBU A;  4FJZ A;  1HA5 A;  3H9D A;  3DVN U;  4HDQ A;  1W1H A;  5G5G A;  1NTV A;  1E9M A;  2DYB A;  2NZ8 B;  4PS3 A;  4WAA A;  2QKL A;  5IN7 A;  1DDM A;  4US8 A;  3T3O A;  3IAS 1;  4L23 A;  3ZQ4 A;  2WXJ A;  2DBY A;  2JPH A;  5JVL A;  1MHX A;  1E6E B;  3APF A;  1NVI D;  3EC8 A;  2K1F A;  3W1Y A;  2NCN A;  4IM2 A;  5DPT A;  3HQC A;  1I42 A;  4A6K A;  2ELB A;  1VBH A;  4XGA B;  3TL5 A;  2LVQ A;  4NJ7 A;  1H10 A;  4PS8 A;  4AOF A;  4BKS D;  1ET6 A;  3U7Z A;  3N3K B;  1QOB A;  1MIZ B;  4M02 A;  4LNI A;  2WXN A;  1GNU A;  4F8C B;  1AQC A;  3PVW A;  2BVC A;  2RSU A;  2YRY A;  3T8M A;  1VR9 A;  4XDD A;  5KQ4 A;  3ENE A;  3ZJU A;  4ZOH C;  1TIF A;  4H8S A;  2KK8 A;  5D2M B;  2KLG A;  2ON8 A;  1Q67 A;  3W5V B;  1V81 A;  1WX7 A;  2WXG A;  1V9J A;  2L05 A;  2DA0 A;  1FXA A;  5J2R A;  1Y19 B;  1R7S A;  3PEG A;  1QOF A;  1TQZ A;  4ILJ A;  3NWA A;  4C7Z A;  1VD2 A;  4HAZ B;  2LGS A;  2JU6 X;  2LHE A;  5BYR A;  2M17 A;  2WS3 B;  3DBS A;  4DXG A;  3BIN A;  2P8V A;  4USA A;  5JHB A;  2LUL A;  4OZB A;  4RMA A;  4WVF B;  2E6X A;  2KTF A;  2QKM A;  4WQM A;  5DH9 B;  1TS5 A;  1D4B A;  1KC7 A;  1TXD A;  1UWX A;  2KTR B;  5TSS A;  3NVV A;  1KLU D;  3ZXV A;  1QOA A;  4LNN A;  1J19 A;  1FD6 A;  5E6J A;  3TFM A;  2BKF A;  3QK0 A;  1SBB B;  3P6A A;  4FN2 A;  2KR0 A;  4GLS C;  1SHC A;  1ZGU B;  2VZK B;  1Y5O A;  3KUD B;  4FXC A;  1SB3 C;  1J0G A;  3Q8B A;  3PZ8 A;  1ZE3 D;  3SFE B;  3QIJ A;  4GNK B;  1QOG A;  4HCN B;  2K8E A;  4DIX A;  2XQN M;  1YQ4 B;  3ZUN A;  4ILH A;  4GU2 A;  1WR1 A;  4J3O D;  1G6J A;  5AZG A;  4KZ0 A;  2JZZ A;  4BZA A;  5AUI A;  1NDD A;  3WIM A;  2W9N A;  4WUR A;  3V6C B;  2MBQ A;  4DK5 A;  3RUI B;  2KFK A;  1ESF A;  3PGE A;  3HIZ A;  1EAZ A;  1WMH A;  2JUO A;  2K8B A;  2RGF A;  2L1C A;  3PVU A;  2O6V A;  2QEJ C;  1WZ3 A;  4MT5 A;  4NSW A;  1F9J A;  2JQR B;  4WSF A;  1PGX A;  1WGK A;  3A9J A;  2ZW0 A;  2DN6 A;  3CMM B;  2BYE A;  2WDR B;  3NS8 A;  1KM7 A;  2O6V D;  1FIQ A;  2WGS A;  1UNQ A;  3NOB A;  3N32 A;  1X1G A;  2L76 A;  2YS5 A;  3Q3F A;  4DHZ E;  3BZD B;  3BK2 A;  4OZA A;  3TW1 A;  4DXF A;  5D3V A;  1KLG D;  2I5C A;  1FCL A;  4RM9 A;  2HTH B;  4MSQ B;  4WJO A;  4RH6 A;  1BXT A;  1YNT E;  1ZKH A;  4IWP A;  3DWM A;  3QQ8 B;  2P0F A;  1TBE A;  1WF9 A;  3ZJV A;  2MKR A;  3PTF C;  2DZJ A;  1CMX B;  5J3T A;  2C60 A;  3KVF B;  1WXQ A;  3PS6 A;  2RUK B;  1L2N A;  4RGO S;  2V4L A;  2R61 A;  3NZS A;  5LXI B;  1AWE A;  2JXX A;  1SIJ A;  4CHM A;  3DWG C;  1U29 A;  2X38 A;  5J3Q A;  3P4R B;  2Z0P A;  1C78 A;  2N1W A;  2EMS A;  3VR9 B;  5C6R A;  4IUM B;  2AL3 A;  3KLS X;  2WXQ A;  3NG0 A;  4KX6 B;  2L8J A;  5D94 A;  2CU3 A;  5KQ1 A;  4MH8 A;  3S2A A;  2MP2 A;  5BYQ A;  5CX3 A;  3URY A;  3SBT A;  4HB3 B;  3A1Q A;  3BWU D;  2MBO A;  4ZRJ A;  3QAQ A;  4WAF A;  3LB8 C;  4HAT B;  2VRR B;  3SBG A;  1U4A A;  3DBR I;  2COA A;  2ZEQ A;  3VUX A;  4W9H A;  2N9E B;  4N58 A;  1MI1 A;  3IHP C;  1WGD A;  1XEE A;  3ZO5 B;  2UZS A;  3SFD B;  2SAK A;  2GOW A;  1BTK A;  2WU5 B;  3CST A;  1P6S A;  3ZXR A;  2I5F A;  2W2X D;  3KQ4 A;  3B9J A;  2LVO A;  3DXD A;  4B95 A;  4HPL B;  5FR3 A;  2FNJ B;  2QCZ A;  2DX1 A;  4A9A A;  2E2X A;  1TS4 A;  3RZF A;  3SHQ A;  1V5T A;  2K6Q A;  2N7D A;  1PGA A;  2IJ0 A;  4M0W A;  2OJR A;  2NTS A;  4JKB A;  1SF0 A;  4LJP B;  1Q0W B;  4PT5 A;  3OG5 A;  5J17 A;  2JYE A;  2KMM A;  1F2R C;  3IG3 A;  3C19 A;  3MHZ A;  2M0X A;  5JHA A;  2P0D A;  3Q6B A;  3L4P A;  2QDF A;  2AQ1 B;  5TR5 A;  1FNW A;  3Q8E A;  4R3D A;  1C1Y B;  2G9H D;  2LGY A;  1BT0 A;  4B9K A;  1ACC A;  1U2B A;  3OAW A;  2Z0E B;  1D6E C;  2Q13 A;  2KLC A;  2J53 A;  1PUT A; 
#chains in the Genus database with same CATH homology
 2KFK B;  3VDZ A;  1E8Y A;  2LXA A;  3JVZ X;  4EZL A;  3BY4 B;  3HK0 A;  3R3M A;  3PV1 A;  1ZW7 A;  2YSZ A;  3N7C A;  3E9L A;  3M62 B;  2OTX A;  3AUL A;  1WGR A;  1SE9 A;  4JKC A;  5CLL B;  5FI0 A;  3EFU A;  4KHB B;  4FAD A;  4ILG B;  2KMC A;  2L7R A;  1U5F A;  3DBH I;  1WJM A;  2Z0Q A;  2VSZ A;  2FCM A;  4AJY B;  3SV1 A;  3I3T B;  3PPA A;  3Q3J A;  2LXC A;  2DZI A;  2D3G A;  1I2H A;  1E8Z A;  4E3C A;  2MX2 A;  1OY2 A;  4DHJ B;  2FCS A;  3GYP A;  2KMA A;  3A1Q B;  3PZD A;  2REX A;  2MSE D;  4LCD E;  4K2O A;  3VFK A;  3OLM D;  4IWO A;  3MJW A;  2KJH B;  2ZVO A;  2D9Z A;  3G9W A;  4BKT A;  3SYX A;  3DVG X;  4HJK A;  3L10 B;  1PLS A;  2CRF A;  1FXT B;  2JRH A;  3VTU A;  3K9O B;  1RJ2 A;  3TMP B;  4KDI C;  4ZYN A;  1E8X A;  2PJH A;  4F7U P;  2KOX A;  1FOE A;  2YS3 A;  1V5U A;  2KHW B;  2KWU B;  2KKC A;  4JK8 A;  1ZVR A;  5L81 A;  4OVV A;  3R66 C;  2DTC A;  1DIK A;  3APD A;  2O2V A;  4KSL C;  4DDI D;  2NS5 A;  3DOW A;  3ZVR A;  3M95 A;  3PHW B;  2D10 A;  2A4Z A;  4DX8 A;  2JWZ A;  2AYO B;  5DPS A;  1KZG A;  1E5W A;  4IM0 A;  2NBW B;  1WXV A;  4W9K A;  3TIX A;  1WG7 A;  3TJP A;  2MWS B;  2JP2 A;  1BTN A;  5BO4 B;  2ZZP B;  2P0H A;  4IFS A;  2M1M A;  3FP5 A;  1P1A A;  4WWN A;  4DWF A;  4P7I A;  3DCG A;  1W1G A;  4FJY A;  1WXM A;  4ANV A;  1KI1 B;  4ANW A;  5JH5 C;  4KHO A;  5L83 A;  3AU4 A;  4HAX B;  3KSY A;  5JHG A;  4HK2 A;  2AEH A;  3A9K B;  2RSG A;  4TKN A;  4Y94 A;  3LJ3 A;  3ZIM A;  3NHE B;  4MY6 A;  5AEK B;  4HHV A;  1MK9 B;  2L0T A;  3L08 A;  3SDL C;  1LQB A;  3HM6 X;  5DHA B;  1HE8 A;  1WE6 A;  4GN1 A;  1BWN A;  1WZ0 A;  4G50 A;  1MPH A;  5DCN A;  4G0N B;  2K00 A;  2L2I A;  4F7Z A;  4B6H A;  2M4N A;  3PG7 A;  4ZRI A;  4KVG B;  3UQB A;  4W9J A;  5AZF A;  4ZDV A;  3PSC A;  4BBN F;  1LFD A;  2JY6 A;  4XX5 A;  2KUP A;  5CTR C;  2Y5B B;  2G4S A;  2K25 A;  3ZW3 A;  5E6O A;  3H1U A;  1B55 A;  2YF0 A;  3IFW B;  2COC A;  4KIK A;  3CIK A;  5CLQ B;  1J0W A;  2RR9 A;  2RGN B;  1I7A A;  4G11 A;  2MP2 B;  5C5B B;  1FGY A;  3MPX A;  2KDI A;  2JT4 B;  4A6F A;  2DLW A;  3VVW B;  2HJ8 A;  4HAV B;  1HB6 A;  4I6P A;  4B6W A;  3U30 A;  4TUU A;  3QAR A;  2J0M A;  4HB0 B;  3F0W A;  2CHX A;  3PRZ A;  5D3X A;  3ZTD A;  4PS7 A;  3RYT A;  2VKI A;  5IAA C;  2IY1 B;  3PRM B;  2YLM A;  2J0K A;  2OQB A;  2GMI C;  1L7Y A;  2EKE C;  3L54 A;  2HD5 B;  3KYC D;  5C23 A;  1EUV B;  2KFJ A;  1KBL A;  4W9L A;  3AU5 A;  2KC1 A;  2ELA A;  4GSW A;  1LW3 A;  2ZCB A;  4JLC A;  5AZH A;  5HE1 A;  2LI5 A;  1RFA A;  3X0W A;  2KDB A;  4DXA B;  4E74 A;  4MEL A;  3B1L X;  2K6D B;  4JQW C;  5G55 A;  1GC7 A;  1HB8 A;  1UPQ A;  1BAK A;  2Y7B A;  1WVH A;  3PRE A;  2WX1 A;  2FID A;  3SO6 A;  3UIP B;  2D11 A;  3ZDM C;  3T9L A;  1WXS A;  4KHA A;  1WJ1 A;  1Y8R C;  3ML9 A;  2DHI A;  4TYZ A;  1UZX B;  4JKE A;  1GC6 A;  4JKG A;  3FM8 C;  5E6N A;  2CHW A;  2YVC A;  4A5K A;  2D9Y A;  4MGY E;  2K2J A;  3RCZ A;  1OGW A;  3CSF A;  3QWM A;  1JRU A;  2DZM A;  4DHJ D;  2KDF B;  4EZJ A;  5DI9 B;  1M7R A;  2LRW A;  3WAL A;  1OTR B;  1MIX A;  4PQ0 A;  3H7P B;  2X0S A;  2KDE B;  1WI1 A;  3DPD A;  4BBK A;  4NJ6 A;  1XT9 B;  2DYM A;  4HDO A;  2H7E A;  4GGQ A;  3L0W B;  3JSV B;  3HM3 A;  5HE0 A;  1LB1 A;  2NPT B;  2V3S A;  4GZU A;  1XQQ A;  2KD0 A;  2PEA A;  3D8D A;  2W2X C;  4II2 B;  4IWQ A;  4GDL A;  3U8Z A;  2V76 A;  4MSM B;  2KCJ A;  3VIA A;  1RRP B;  4W9G A;  3KYD D;  4IOY X;  3WYF B;  1Z5S B;  2GBK A;  3PT2 B;  4KV2 A;  4GDK B;  5G2N A;  1GUA B;  1RLF A;  3OJ4 B;  4F1S A;  1OQY A;  5C79 A;  1UEF A;  5D6J B;  1VBG A;  3M1I B;  2MBB B;  2UWQ A;  2BWE S;  1IRS A;  2MRP A;  1MKE A;  3RUL A;  1DDW A;  3O96 A;  3ECI A;  4EUT A;  1RRB A;  5IA7 A;  3ODW A;  2EJ8 A;  5LLI A;  2BGF A;  2ZPN A;  1S1Q B;  2ROV A;  2FCQ A;  3NY5 A;  2N4F A;  3V5W A;  2XEW A;  4WWO A;  3U7D A;  3H7S A;  2KVR A;  4GB9 A;  4NNJ B;  4IAP A;  5FI1 A;  5E6P A;  5DIF B;  4MEM A;  3SUZ A;  1Q5W B;  4HWI B;  1U27 A;  2COD A;  3CXB B;  3WAP A;  2LAS A;  3NSU A;  1DYN A;  3KRW A;  2GBR A;  4JL9 A;  2XBB C;  4W9F A;  1Q1O A;  3VHT C;  3K9P B;  3GOE A;  4MGI E;  4TQ0 A;  2M38 A;  4EKU A;  1WGH A;  4FUL A;  4WWP A;  4EEW A;  3H6N A;  1SGH A;  2DYO A;  2WWZ A;  2D2Q A;  1U5G A;  2HE7 A;  3UZT A;  3V6E B;  4GDL B;  1IYF A;  2PZ1 A;  4M0W B;  1H4R A;  1V5M A;  2PE6 B;  3FSS A;  3KUC B;  4HLE A;  1VCB A;  1P5T A;  2MWN B;  1WM3 A;  3ML4 A;  3VUW A;  1WFY A;  3WA0 A;  2N9P C;  1R4N I;  3DXC A;  2ADZ A;  3QWZ B;  3ZRF A;  1TGZ B;  2K8H A;  1H8C A;  1E90 A;  4J6I A;  1ZC4 B;  2MFQ A;  3JYU A;  4HPM B;  2ZNV B;  3ZDT A;  3QA8 A;  2LOX A;  2WYQ A;  3ULC A;  2DYN A;  1E7V A;  4JKF A;  1YJ1 A;  2FUH B;  4W9C A;  5LXH A;  1WJU A;  4FJV B;  3ODO A;  2GS0 A;  4HB4 B;  3B08 A;  1M94 A;  4II3 B;  1EF5 A;  3R7Q A;  3PHX B;  5FR6 A;  3PRP B;  2R82 A;  2LUE A;  2BYF A;  3EEC A;  2VRW B;  3D8E A;  4EJN A;  2PE9 A;  4JKD A;  3OJ3 A;  2IFS A;  3OAN A;  3DBL I;  4EOY A;  3UGB B;  1NBF C;  1QQG A;  4CHK A;  3VAW A;  1YX6 B;  3VUY A;  1S3S G;  4W9I A;  1V89 A;  1DBH A;  3T06 A;  3KZ1 A;  3CF6 E;  2DAF A;  4M8M A;  2V1Y A;  4MJS A;  5CHV C;  3R7R A;  3F5R A;  4DBB A;  3A8P A;  5LON B;  4LJO B;  4W9E A;  4GXB A;  3E66 A;  3KY9 A;  4NAW B;  2R2Q A;  2N0Y A;  3DVG Y;  4AJW A;  2CAY A;  1LM8 B;  3ENB A;  1KOT A;  3B0A A;  3KRX A;  3UF8 A;  1ST7 A;  1WJ4 A;  3V60 A;  1NI2 A;  1WX8 A;  5HE3 A;  2ZNV C;  3APC A;  3RT3 B;  2D07 B;  4C0A A;  2LRU A;  4HAY B;  2IZV B;  2N7E A;  3KW5 B;  2IYB A;  2KXJ A;  1WGU A;  2YS1 A;  1P0R A;  1ISN A;  5LOP B;  2MA9 B;  2HTH A;  2IO3 B;  3RD2 A;  5D3Y A;  3L16 A;  2BF8 B;  4OVU A;  2FJ9 A;  3MDB C;  3QCA A;  1Z2M A;  4PYU A;  3V61 A;  4GMX B;  2JF5 A;  5KCV A;  2XK5 B;  1WGQ A;  2LG1 A;  3SNH A;  2UVM A;  5HE2 A;  2BWF A;  3JSV A;  4FA6 A;  3L17 A;  4CHJ A;  3ZVV A;  1XOD A;  2CU1 A;  1ACA A;  1FHO A;  3RCP A;  3ODX A;  4ZRK A;  1XR0 B;  2WX0 A;  3BJI A;  2KX3 A;  1YIW A;  2BCJ A;  5C1Z A;  5JHH A;  2J59 M;  2L0F A;  3QHT A;  4M8N A;  4MGZ E;  1UGM A;  1MK7 B;  4JGH B;  1OQN A;  2LKO A;  4YL8 A;  1EGX A;  4K1R B;  1K5G B;  4BKS A;  3GZN I;  4GDK A;  3P2B A;  2AWT A;  1UNP A;  5DPW A;  2KNB A;  2ROZ B;  3LDZ E;  3QBV B;  3ZLZ A;  4HCP B;  1FB8 A;  1OMW A;  1OEY A;  1V88 A;  2FJL A;  2YT1 A;  4KSK C;  4DBG A;  1C3T A;  2KJR A;  2CY4 A;  4MDK E;  4MJS B;  4XWX A;  2DX5 A;  4F7H A;  3AJ4 A;  4NQK E;  4TQ1 A;  1YX5 B;  4IW0 A;  1XX0 A;  4NY0 A;  1P9D U;  2N9X A;  3M3J A;  4XZ4 A;  2D9V A;  2GCJ A;  1U5E A;  2LBB A;  1WGY A;  4FBJ B;  2C7H A;  2BYV E;  4BFR A;  1XKE A;  2MBH A;  4ICU A;  4FHJ A;  4MGK E;  4AWJ A;  3AI5 A;  1PMS A;  3KH0 A;  4K2P A;  2DYQ A;  2PPH A;  3ZNZ B;  2KX0 A;  4KIK B;  1WI0 A;  5GOW B;  3D32 A;  1M7E A;  5J3Y A;  1V86 A;  4X57 B;  3WAM A;  1FAO A;  2D9W A;  2DFK A;  3VQI A;  3E9P A;  2LGD A;  4JKA A;  4D0N B;  1WIA A;  2N1V A;  4GPT B;  3ZNI D;  2ASQ A;  2R0D A;  1ZC3 B;  1UPR A;  1AAR A;  2KZR A;  4BBN C;  1QC6 A;  2KQ7 A;  2KWV B;  1WGG A;  3A33 B;  2GCL A;  2D4Q A;  2RPQ A;  2KO3 A;  2KWC A;  2G4D B;  1WXA A;  1UD7 A;  1GG3 A;  3TVV A;  4MH0 E;  4RM8 A;  1WMH B;  1YD8 U;  4LDT B;  1KZ7 A;  4JKG B;  4BKG A;  5IJM A;  1N3H A;  2R09 A;  1EF1 A;  1GJZ A;  2C7N B;  1WY8 A;  3AXC A;  3ZNH B;  3X23 A;  3IVF A;  2RD0 A;  2RVB B;  1UEL A;  2NMB A;  2LYD A;  2D9X A;  4KDL B;  2Y8G A;  3E9O A;  3QX1 A;  3JW0 X;  3ULB A;  2LZ6 A;  1P3Q U;  4URK A;  1Z87 A;  2CKH B;  1PQS A;  2MBE A;  3A9J B;  4I6N B;  2IY0 B;  2EC1 A;  2JZ3 B;  4TV3 A;  1UBI A;  2K8C A;  2K2U A;  2DIK A;  4CO7 A;  1QZE A;  1ZM0 A;  3MTN B;  2Z0O A;  4IC7 B;  4A20 A;  3DXE A;  4ANU A;  4A6H A;  4I6L B;  2BPS A;  2YT0 A;  1WRD B;  2KJ6 A;  1X11 A;  1V80 A;  4JIO U;  3V62 A;  3EPY A;  2UZR A;  2LGX A;  3PSE B;  2DHK A;  4BOS C;  2NPT A;  2G35 A;  2AL6 A;  1X1F A;  1WYW B;  4K7U A;  2RQ1 A;  1NVL A;  2UYZ B;  3A9K A;  1E8W A;  1T0Y A;  4CYE A;  2ZCC A;  4ASW C;  4FLH A;  1JDE A;  2M14 A;  1X1M A;  2FDQ A;  4HXD A;  1KLV A;  1D3Z A;  1W1D A;  4LDT D;  2LWP A;  4WJ7 A;  4DHZ B;  4K7S A;  1V49 A;  1V5P A;  4WJP A;  3C0R B;  1A5R A;  1P3R A;  5CHW A;  5CHF A;  2DKQ A;  2G3Q B;  2C9W B;  2KC2 A;  2DHJ A;  2M8S A;  1WM2 A;  2L3Z A;  2WH5 A;  3ZTC A;  4BVU C;  4F7G A;  1V6E A;  2KQS A;  3W1S A;  1FHW A;  2J7Q B;  4G3X B;  3VTV A;  3WAN A;  3WAO A;  3DDC B;  3DQV A;  4K7W A;  3VH4 B;  1XCG A;  1E7U A;  2RLO A;  3M63 B;  2KN5 A;  2BKR B;  3A4R A;  3ZNG C;  4NQL B;  1HBK A;  4MT7 A;  1NTI A;  1V5O A;  2MCN B;  3O65 B;  2GBM A;  2C7M B;  3FLV A;  2COF A;  5L95 C;  3ALB A;  2IO1 B;  4AUQ C;  4EZK A;  4PYZ A;  4HVB A;  2J0J A;  3KUZ A;  2CR5 A;  3GYO A;  5JZE B;  2ABD A;  4JKH A;  5EDS A;  4BOZ B;  3D8F A;  4IG7 B;  2Y8F A;  1WR6 E;  3VTW A;  1UNR A;  2H7D A;  3VH3 B;  1WH3 A;  4GIV A;  4XC2 A;  2CHZ A;  2ZPY A;  1DDV A;  4ANX A;  3HW2 B;  3VOQ A;  3A98 B;  5D27 A;  2DKP A;  1SIF A;  2DX5 B;  1NU2 A;  2COP A;  3W1S C;  3ONS A;  1K5D B;  2FAZ A;  4FHK A;  1P98 A;  3UQA A;  3A4S C;  1XD4 A;  3UIO B;  4ICV A;  4KAX B;  2L00 B;  2HRJ A;  3QJZ A;  2CY5 A;  2GBN A;  4EMO A;  1NTY A;  1WX9 A;  1V61 A;  2LJ5 A;  2MW5 A;  3VXW A;  2MDX A;  2O6V B;  2I1J A;  2DZK A;  1MG8 A;  2DEN B;  1RAX A;  3TCA A;  2RNR B;  2Z0D B;  2OOB B;  1ZSQ A;  5KHQ A;  1I35 A;  2X18 A;  4AP4 C;  2KAN A;  3ZRC A;  2QHO A;  4GOC A;  2FIF A;  4JK9 A;  4JK7 A;  4KZC A;  1X86 A;  4MK0 A;  1R4M I;  2ZVN A;  4WQO B;  4HAU B;  2CS4 A;  1UH6 A;  1WJN A;  1LXD A;  2WDT B;  1IPG A;  3HHM A;  4PNK A;  2O2V B;  3FEH A;  1TZ1 A;  1V2Y A;  3SD5 A;  4Z2M B;  4W9D A;  5D7G A;  2R2O A;  5JP4 A;  4L6E A;  4WJQ A;  2GBJ A;  3P7Z A;  1TTN A;  2C5L C;  3RZW C;  5HKH A;  2JVC A;  3TO1 A;  3H7P A;  2W2W A;  5DHF B;  4DX9 0;  1K8R B;  2JRI B;  4WJN A;  2K39 A;  1GGO A;  5EFX A;  1XD3 B;  4DDG D;  1IP9 A;  4HAW B;  5D3W A;  3TBL D;  1KJT A;  2NVU I;  1WJ6 A;  2B3A A;  4YON A;  2CB8 A;  3DVN V;  2KGX B;  2LVP A;  4E71 A;  2CQU A;  2ZJD A;  1PFJ A;  2G45 B;  4IM3 A;  2MLB A;  1J8C A;  3N30 A;  1FHX A;  4NPN A;  3NZU A;  2XK5 A;  2IO0 B;  1TJ6 A;  3UIN B;  2IYD B;  3PLV A;  3MHS D;  2N23 A;  5DPR A;  1U5D A;  4NAW A;  1EVH A;  3LJU X;  2IBI B;  2NR2 A;  3PP2 A;  3ML8 A;  1DRO A;  1FGZ A;  2LOZ A;  3QC8 B;  5C5B A;  5KHO A;  2DHZ A;  4MM3 A;  1X05 A;  2KTR A;  4Z2N A;  2GJY A;  4HB2 B;  4A6F B;  4EFO A;  4K17 A;  4N9F 4;  3A8Q A;  1WE7 A;  4K81 A;  2A5U A;  5GMV A;  2I1K A;  4A3O A;  1YQB A;  5J18 A;  4GMV A;  3ZKJ C;  2EMT A;  3SU8 X;  2MQJ A;  2FCN A;  1MAI A;  3L13 A;  3PVL A;  2LD9 A;  4A3P A;  2IO2 B;  2NBV B;  5JLJ B;  1UBQ A;  2Z59 B;  1OEY J;  3PLU A;  1EO6 A;  3IBE A;  3EHV A;  2DAJ A;  5C16 A;  2NBU A;  4FJZ A;  3H9D A;  3DVN U;  4HDQ A;  1W1H A;  1NTV A;  2DYB A;  2NZ8 B;  4PS3 A;  4WAA A;  2QKL A;  1DDM A;  2JPH A;  5JVL A;  3APF A;  3EC8 A;  2K1F A;  3W1Y A;  2NCN A;  4IM2 A;  5DPT A;  3HQC A;  1I42 A;  4A6K A;  2ELB A;  1VBH A;  3TL5 A;  2LVQ A;  4NJ7 A;  1H10 A;  4PS8 A;  4AOF A;  4BKS D;  3N3K B;  1MIZ B;  1GNU A;  4F8C B;  1AQC A;  3PVW A;  2RSU A;  2YRY A;  3T8M A;  5KQ4 A;  3ENE A;  4H8S A;  2KK8 A;  5D2M B;  2KLG A;  1Q67 A;  1V81 A;  1WX7 A;  1V9J A;  2L05 A;  2DA0 A;  5J2R A;  1Y19 B;  3PEG A;  1TQZ A;  4ILJ A;  1VD2 A;  4HAZ B;  2M17 A;  3DBS A;  3BIN A;  2P8V A;  5JHB A;  2LUL A;  4RMA A;  4WVF B;  2KTF A;  2QKM A;  5DH9 B;  1KC7 A;  1TXD A;  2KTR B;  1J19 A;  3TFM A;  2BKF A;  3QK0 A;  3P6A A;  4FN2 A;  1SHC A;  1ZGU B;  1Y5O A;  3KUD B;  1J0G A;  3QIJ A;  4HCN B;  2XQN M;  3ZUN A;  4ILH A;  4GU2 A;  1WR1 A;  1G6J A;  5AZG A;  4KZ0 A;  2JZZ A;  1NDD A;  3WIM A;  2W9N A;  3V6C B;  2MBQ A;  4DK5 A;  3RUI B;  2KFK A;  3PGE A;  3HIZ A;  1EAZ A;  1WMH A;  2JUO A;  2K8B A;  2RGF A;  2L1C A;  3PVU A;  2O6V A;  1WZ3 A;  4NSW A;  1F9J A;  4WSF A;  3A9J A;  2DN6 A;  3CMM B;  2BYE A;  3NS8 A;  1KM7 A;  2O6V D;  1UNQ A;  3NOB A;  3N32 A;  1X1G A;  2L76 A;  2YS5 A;  3Q3F A;  4DHZ E;  3TW1 A;  5D3V A;  2I5C A;  4RM9 A;  2HTH B;  4MSQ B;  4WJO A;  1ZKH A;  4IWP A;  3QQ8 B;  2P0F A;  1TBE A;  1WF9 A;  2MKR A;  3PTF C;  2DZJ A;  1CMX B;  5J3T A;  2C60 A;  3KVF B;  3PS6 A;  2RUK B;  1L2N A;  2V4L A;  3NZS A;  5LXI B;  1AWE A;  2JXX A;  4CHM A;  1U29 A;  5J3Q A;  2Z0P A;  2N1W A;  2EMS A;  5C6R A;  4IUM B;  2AL3 A;  2L8J A;  5D94 A;  5KQ1 A;  3S2A A;  2MP2 A;  5CX3 A;  3SBT A;  4HB3 B;  3A1Q A;  2MBO A;  4ZRJ A;  3QAQ A;  4HAT B;  2VRR B;  3SBG A;  1U4A A;  3DBR I;  2COA A;  2ZEQ A;  3VUX A;  4W9H A;  2N9E B;  3IHP C;  1WGD A;  3ZO5 B;  2UZS A;  2GOW A;  1BTK A;  3CST A;  1P6S A;  2I5F A;  2W2X D;  2LVO A;  3DXD A;  4B95 A;  4HPL B;  2FNJ B;  2DX1 A;  2E2X A;  3RZF A;  3SHQ A;  1V5T A;  2K6Q A;  2N7D A;  2OJR A;  4JKB A;  4LJP B;  1Q0W B;  5J17 A;  3IG3 A;  2M0X A;  5JHA A;  2P0D A;  5TR5 A;  1C1Y B;  2LGY A;  1BT0 A;  4B9K A;  1U2B A;  3OAW A;  2Z0E B;  2Q13 A;  2KLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...