2D2QA

Crystal structure of the dimerized radixin ferm domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d2qA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d2qA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d2qA01
2EC1A 2H7DA 4EFOA 3VOQA 3SNHA 4WJPA 3DVGX 2KK8A 4NAWB 1DDWA 1RLFA 2CY4A 4Y94A 1TBEA 2ELBA 4FHKA 3W1SA 3DBLI 2FAZA 1WZ0A 4NY0A 2YS1A 5J2RA 4BBNF 2M17A 5D3WA 3KRXA 1EUVB 2REXA 2MW5A 2LGYA 1U4AA 1E90A 3D8EA 3ZVVA 3ML9A 3DXCA 2KCJA 4JGHB 2KDFB 3V6CB 2CODA 1WGGA 2EKEC 2BYEA 3H7SA 3TFMA 5D3YA 1RRBA 3MPXA 2D2QA 2LXCA 4Z2NA 3CSFA 2M4NA 4IW0A 2DHKA 1ZC3B 1U5EA 1Z2MA 3HQCA 1PQSA 2KLGA 2V76A 3JW0X 4EZJA 2LRWA 1K5GB 2WDTB 2Z0QA 3FLVA 5EFXA 1TGZB 3L0WB 2NS5A 1OMWA 3M3JA 1WX8A 1T0YA 4A6FB 3UZTA 1V88A 1E8YA 2K39A 4GDLB 4JL9A 2RNRB 3IG3A 3AXCA 4XWXA 3EHVA 1MPHA 4H8SA 3LJ3A 4JLCA 1XD3B 2KTRB 2YLMA 3ZDTA 4W9IA 3X23A 2KWVB 2YSZA 4CHJA 1EO6A 3EC8A 2M1MA 1U5DA 3H7PB 2JRIB 1SGHA 2V3SA 3I3TB 2LOZA 1NDDA 2BCJA 3SUZA 2N23A 3QC8B 3T06A 1WMHB 2PE6B 2W9NA 1BT0A 4KIKB 3DBRI 3VAWA 3T8MA 2GS0A 5DIFB 3U7DA 2R0DA 2D11A 2G4DB 5HE2A 4EEWA 2K2JA 5LONB 2MKRA 2NMBA 2DAFA 2RR9A 3PV1A 2UYZB 3VHTC 2A4ZA 1XKEA 1U29A 5CTRC 4B6WA 4RMAA 2KWUB 3G9WA 1NBFC 3VIAA 2YVCA 3PSEB 3A1QA 2V4LA 3RCZA 1SHCA 4HATB 1Z5SB 1OTRB 3ULCA 2KX0A 2KQ7A 4K2PA 1E5WA 2O6VB 5DPWA 2J0KA 4MELA 1V5UA 3O96A 2CHXA 2KDIA 2BYVE 1NTIA 4CHMA 3ZDMC 1WY8A 3H9DA 2C7HA 3A8PA 2KFJA 3IFWB 2ZJDA 3SDLC 4NAWA 4F7HA 1WG7A 2LZ6A 3PLUA 1Z87A 1WIAA 4HAZB 2KXJA 1U5GA 3RZFA 2KZRA 2DFKA 4ANVA 5IAAC 1X05A 4BBKA 2DYBA 3VTWA 1ZC4B 2MRPA 3DXDA 4KSKC 3OJ4B 2MQJA 1I2HA 1V5OA 1AARA 1DBHA 4GZUA 1OY2A 1LXDA 1NVLA 5C5BA 3EFUA 4KVGB 2YF0A 2W2XC 5JHGA 4AOFA 2C7MB 4JQWC 1V6EA 5DPSA 3MJWA 1V2YA 4WWNA 2DYMA 2FIFA 5CLQB 2KKCA 1WXMA 2HE7A 3ZVRA 1GG3A 3QHTA 2DN6A 2I5FA 5TR5A 2LVQA 1IYFA 3AU4A 3EECA 2Z0DB 2O6VD 2RGFA 1Y19B 5LLIA 4HAWB 3PP2A 1N3HA 4KV2A 2LASA 3ENEA 3KVFB 2WX1A 1AWEA 2MX2A 3NHEB 4GDLA 1WH3A 4WWPA 5G55A 2KFKB 1I7AA 4MT7A 4W9EA 3P7ZA 2KTRA 3VUYA 3K9OB 1TQZA 4WAAA 1UZXB 3DBSA 2AEHA 1KM7A 1FAOA 2CRFA 2R2QA 3TMPB 3H7PA 4Z2MB 1WE6A 3QJZA 4ANWA 4TV3A 2GBNA 3IBEA 1FOEA 2K8HA 3M63B 1V61A 3ALBA 2ZPYA 1TJ6A 5C6RA 1J0GA 3TVVA 4JIOU 1Y5OA 5JHHA 3NZSA 4LDTD 4I6PA 3VUWA 3M1IB 2N9EB 2KDBA 1ZVRA 3KSYA 4A20A 1P9DU 2ZNVC 3FSSA 5EDSA 1Y8RC 3JSVB 4MEMA 1BTNA 4HDOA 2KNBA 4IM3A 2K8CA 2CU1A 3WYFB 2L0FA 1WGUA 3FM8C 1BTKA 3QQ8B 1UD7A 2ZCCA 5JZEB 4M8MA 5DCNA 2FUHB 4CO7A 3PHWB 2WWZA 2N9XA 2HTHB 5LXHA 2GOWA 3PHXB 1C1YB 1V80A 3R7QA 5LXIB 3RYTA 1WX7A 3OJ3A 3SV1A 4F1SA 4PNKA 2NR2A 2NBVB 3PRZA 4A3PA 4GDKB 2XK5B 2K00A 1V5PA 1S3SG 1YIWA 4DHZE 2LULA 3OLMD 1J19A 3NZUA 2N9PC 3TIXA 4MM3A 2N1VA 4YL8A 4II2B 4NQKE 1BAKA 4HPMB 2RUKB 5HE0A 3ZIMA 1WGYA 2Z0PA 1FB8A 4HB2B 4HDQA 4BOSC 3WAOA 4YONA 1WI0A 2W2WA 1LB1A 3APCA 4DHZB 4KDIC 4F7GA 3NY5A 1LW3A 1E8XA 2C60A 1UEFA 1X1GA 3VFKA 3D32A 5HE1A 2J0MA 2BWES 2Y8FA 4WJQA 4KHAA 4HK2A 1YQBA 5D7GA 2LKOA 1FHOA 3PGEA 3IHPC 2COFA 5KCVA 3KZ1A 2GBJA 4ZDVA 4L6EA 1GJZA 4TKNA 4ANXA 4EKUA 2DX1A 3KRWA 5C16A 2RVBB 2RLOA 4IAPA 1WXSA 2KFKA 2QKLA 2MLBA 1S1QB 2HJ8A 2KJHB 5D27A 2AWTA 2IY1B 4KAXB 3ZNGC 2BWFA 3PVWA 2L1CA 3DPDA 2KUPA 4A6HA 2A5UA 1QC6A 2K2UA 4CHKA 1D3ZA 4RM8A 2PPHA 3L54A 2IO3B 3AJ4A 3KUZA 4EOYA 2RSGA 2IY0B 2W2XD 3V62A 2B3AA 1W1HA 4GXBA 3JYUA 4MSMB 4MDKE 1YX6B 3H1UA 2M14A 2AYOB 4PYUA 4BFRA 2PJHA 4M0WB 2DHJA 1WR6E 2CKHB 2L0TA 4GGQA 2IBIB 3MHSD 2Z0OA 1UNRA 3ZNID 2MBOA 1WYWB 2IYBA 4ICUA 5D3VA 3KYDD 2KC1A 3JSVA 1A5RA 3LDZE 2DX5B 2IO2B 1F9JA 3KYCD 5C79A 1ST7A 2DENB 5GOWB 3ZKJC 4KHOA 4HXDA 1R4MI 1MAIA 2DZMA 1M7RA 4DBBA 1V9JA 3PEGA 2DYNA 4MGYE 2MP2A 2FCNA 2HTHA 4MSQB 5E6NA 4EJNA 2RSUA 5CHVC 2C7NB 4X57B 2V1YA 1XR0B 2IO0B 3RUIB 2D3GA 2EJ8A 4FN2A 2P0DA 2LGDA 3DVGY 5J17A 1RRPB 1LFDA 2BKRB 3PREA 4GDKA 2XK5A 4HHVA 1ZSQA 1UPQA 2GMIC 5D3XA 5DH9B 4NPNA 3ZTDA 3MDBC 3V60A 4EMOA 2GCJA 2JT4B 4DWFA 1EF5A 1FGZA 3A8QA 2ABDA 1PFJA 5E6OA 4W9FA 2BKFA 3W1SC 5L95C 1MG8A 3IVFA 1HB8A 5J3TA 4K2OA 2GBRA 2P8VA 4URKA 2N7EA 1IPGA 2Y7BA 1UPRA 2M0XA 2KQSA 2D10A 4DHJB 3HM3A 3KUCB 5L81A 1WX9A 4OVUA 5CHFA 3ODXA 3WAPA 3CXBB 3JVZX 5DHAB 3PVLA 2Y5BB 3R66C 4PS3A 4GN1A 3PSCA 4GIVA 2NZ8B 2N0YA 1UNPA 4K81A 1WRDB 1ZKHA 4B9KA 1DDMA 2NVUI 1RFAA 4EZLA 4BKTA 1TXDA 3ZNHB 1UBIA 2R09A 2NCNA 3NOBA 1KZ7A 2VSZA 4K1RB 2KTFA 2MWSB 1UGMA 5FI1A 2L3ZA 1U27A 3SHQA 4A3OA 3AI5A 1NTYA 1GC6A 1WM3A 4AUQC 2LG1A 1NI2A 1I42A 2LI5A 3HM6X 3L10B 3SO6A 2KGXB 2ROZB 2COAA 3GYOA 2COCA 2UZSA 3TO1A 3V6EB 2KHWB 2EMSA 2KC2A 2QHOA 3M62B 2L05A 1I35A 1C3TA 1B55A 2DX5A 4DHJD 4E74A 2YT0A 2DYOA 1J0WA 4LDTB 3ZLZA 4F7ZA 1L7YA 2DYQA 1ZM0A 3OANA 3KH0A 2C5LC 1H10A 3RCPA 1V89A 3RULA 2JZZA 4A6FA 2MCNB 1WZ3A 4ZRKA 1E7UA 4M8NA 4MGIE 3UIOB 2I1KA 3A98B 3UIPB 5AZFA 4A5KA 2CY5A 3BJIA 3QARA 4FJZA 3UQBA 2DA0A 4HAYB 3H6NA 3WANA 2KMAA 4HCPB 1Q0WB 4LJPB 2DTCA 1UH6A 2N1WA 1W1DA 3DBHI 1WMHA 1PMSA 4XZ4A 3VQIA 5DPRA 4DDID 1P3RA 5DPTA 4F8CB 4WJOA 4KIKA 2FDQA 3N30A 3L16A 1BWNA 3N7CA 2ZCBA 4GSWA 2FJ9A 4FA6A 4KHBB 1WGDA 2WYQA 4KSLC 3BY4B 2MBHA 4WJ7A 1V81A 5D94A 2COPA 2YT1A 3GZNI 4HPLB 1UELA 2LJ5A 3ONSA 2PEAA 4HAXB 4WVFB 3ZRFA 2OQBA 3APFA 4XX5A 4IM0A 2O6VA 2ZVOA 1OEYA 3VTUA 1WM2A 2AL6A 2O2VB 2JUOA 4ZYNA 1UBQA 2H7EA 2GBMA 3PTFC 2BGFA 3GOEA 1FXTB 4TQ0A 3T9LA 1QZEA 3HIZA 2MBQA 1K5DB 5D6JB 2KWCA 3FEHA 2LXAA 3UINB 1KLVA 1IP9A 3A4RA 5IJMA 2WH5A 3ML4A 4G0NB 2G45B 3X0WA 4TYZA 1PLSA 4KZ0A 1RJ2A 2Q13A 2NPTB 1EGXA 3PLVA 4KDLB 4F7UP 2GJYA 5KQ4A 3BINA 4IC7B 4K7WA 3DVNV 1IRSA 2KJRA 2YRYA 1YJ1A 2GCLA 3QAQA 2R2OA 1WGHA 1MKEA 1VD2A 4MGZE 3PT2B 3APDA 3O65B 2BPSA 4J6IA 1XCGA 3ODWA 1TZ1A 3QX1A 3B08A 4G50A 3WAMA 4GMXB 1NTVA 4W9HA 1P98A 1KZGA 1V5MA 4XC2A 2FNJB 2P0FA 4II3B 4DDGD 2PZ1A 2JY6A 3M95A 1QQGA 1TTNA 3PRPB 4HWIB 3AULA 2KVRA 5JP4A 3ULBA 4IFSA 1ZW7A 2DLWA 2KX3A 3VVWB 3TBLD 2JP2A 1HB6A 2DKQA 2CHWA 2OTXA 3B1LX 2DHZA 3VUXA 1P5TA 1MIXA 5AEKB 1WVHA 3A1QB 3ZTCA 2LVPA 1ZGUB 3VTVA 2UVMA 2BYFA 2KMCA 3OAWA 4A6KA 1DDVA 2KLCA 2LGXA 3VDZA 1MIZB 5HE3A 2D4QA 4G3XB 1DROA 1AQCA 4OVVA 1MK9B 3QWZB 2LOXA 1OGWA 1LQBA 2K8BA 4HCNB 3CF6E 1V5TA 5G2NA 4W9DA 3TJPA 2JVCA 4RM9A 3F5RA 4MH0E 4NJ6A 3UQAA 2AL3A 3AU5A 3ZRCA 1V49A 3TCAA 2CB8A 5LOPB 2ZNVB 4WSFA 1EAZA 2K25A 1WI1A 4HAVB 3QCAA 4HLEA 3VXWA 1ISNA 1WXAA 5C5BB 1X1FA 2HD5B 1KI1B 2L7RA 3ZUNA 3MTNB 1P1AA 3ZW3A 1SIFA 4NJ7A 3QIJA 4E71A 4I6NB 2O2VA 3PVUA 5FR6A 4KZCA 4MK0A 4LJOB 3HW2B 5AZGA 4PQ0A 1Q67A 1H8CA 4MJSB 4ZRIA 3R3MA 3SYXA 2J7QB 3A9JB 2E2XA 3KUDB 3B0AA 3L08A 2ROVA 2ZVNA 2LRUA 2HRJA 2J59M 5FI0A 1WFYA 3HHMA 3R7RA 2NPTA 2NBWB 3WA0A 1FHXA 2VRRB 2IZVB 4LCDE 1WR1A 2ELAA 5AZHA 3NS8A 3CMMB 1R4NI 4FLHA 3DVNU 2Z59B 1ACAA 2WX0A 1RAXA 2MA9B 2FCSA 2MDXA 3N32A 4D0NB 4E3CA 4BBNC 2FCQA 2JF5A 2DHIA 1E7VA 4AJWA 1OQYA 2J0JA 1GUAB 3PZDA 3ZO5B 5KQ1A 4BKSD 2RGNB 2JZ3B 4FADA 1SE9A 4W9JA 4G11A 5C23A 3UF8A 3VH4B 3Q3FA 2OJRA 1WJ4A 4ICVA 4FBJB 4DBGA 3TW1A 4MY6A 2N4FA 4NQLB 2D9XA 2LYDA 1X1MA 4DK5A 2Z0EB 3SU8X 4N9F4 3DXEA 4PYZA 2MWNB 2ADZA 5C1ZA 4DXAB 2ZZPB 3A33B 3P6AA 4BVUC 1V86A 1HBKA 2DZIA 4PS7A 2ZEQA 4DX8A 4ASWC 4I6LB 2KANA 2OOBB 2VKIA 1XQQA 1XD4A 4HJKA 4AWJA 4CYEA 3S2AA 5DI9B 2XBBC 1U5FA 4IOYX 1WGRA 3CIKA 2DZJA 1OQNA 1WJMA 4P7IA 4WWOA 5DHFB 2NBUA 2D9VA 1M94A 3LJUX 3QK0A 2G3QB 4GB9A 4ANUA 1WJNA 3VH3B 2X18A 3P2BA 2XEWA 4DX90 4K7UA 2JWZA 2MSED 2C9WB 3L17A 1KOTA 3A9KB 3RD2A 2I5CA 3GYPA 2CHZA 3DCGA 1P3QU 4BKSA 2D9WA 3F0WA 2N7DA 5KHQA 4W9KA 3UGBB 2PE9A 1W1GA 1GNUA 5L83A 4MJSA 1XX0A 1E8WA 1WXVA 3A9JA 2D07B 2DZKA 3K9PB 4IWPA 4EZKA 5CX3A 5HKHA 3D8DA 2RPQA 1CMXB 2BF8B 5CLLB 3C0RB 2EMTA 3QWMA 4WQOB 4EUTA 1JRUA 1Q1OA 5J18A 4AJYB 3U30A 2L00B 2M38A 4HB4B 5JHAA 2LUEA 1L2NA 3SD5A 4FHJA 2M8SA 3V5WA 3PS6A 2KN5A 5JLJB 3ODOA 3RT3B 5D2MB 2KO3A 4NSWA 3V61A 2L8JA 5GMVA 2G35A 2K6QA 4B95A 4MGKE 2DKPA 2JXXA 1GC7A 4AP4C 4IM2A 4NNJB 1HE8A 4GOCA 3WIMA 2P0HA 5KHOA 1OEYJ 4ZRJA 2IO1B 1G6JA 2ZPNA 2XQNM 3A4SC 2CS4A 2LVOA 3QA8A 1P0RA 1EF1A 4BKGA 3ZNZB 4TQ1A 5CHWA 1LM8B 1YD8U 3RZWC 4HB0B 1DYNA 2VRWB 2FJLA 3DDCB 1WGQA 3ECIA 3PRMB 2L2IA 4B6HA 5IA7A 3W1YA 1WE7A 3FP5A 2CAYA 3HK0A 2JPHA 2UWQA 2IFSA 5BO4B 1FGYA 4C0AA 1U2BA 2MBEA 4IWOA 4GMVA 3PG7A 3N3KB 4W9CA 1X11A 3EPYA 2MP2B 3U8ZA 3PPAA 2ASQA 2I1JA 2QKMA 4FULA 4IWQA 1WF9A 1WJ1A 3KY9A 2KJ6A 2KD0A 4WJNA 1KJTA 2Y8GA 4IG7B 2KDEB 2YS5A 3DQVA 4W9GA 3L13A 5E6PA 4HVBA 2LBBA 1P6SA 2K1FA 2KOXA 3DOWA 1NU2A 1YX5B 2K6DB 2LD9A 4W9LA 1WJ6A 1VCBA 1FHWA 2UZRA 4K7SA 4FJVB 3WALA 2IYDB 2G4SA 1J8CA 5JHBA 2D9ZA 1X86A 2L76A 3Q3JA 4HB3B 3A9KA 1XT9B 2CQUA 3QBVB 1UNQA 5J3QA 2GBKA 1EVHA 1K8RB 4TUUA 4HAUB 2DAJA 4IUMB 2LWPA 1WJUA 2FIDA 3TL5A 2MBBB 4FJYA 2MFQA 1M7EA 1E8ZA 2D9YA 1Q5WB 4BOZB 3D8FA 4GU2A 5JH5C 4PS8A 1MK7B 1H4RA 2FCMA 4GPTB 4K17A 3CSTA 3KW5B 1XODA 2RD0A 2JRHA 3ML8A 5J3YA 3NSUA 2CR5A 2RQ1A 2YS3A
chains in the Genus database with same CATH superfamily
2EC1A 4IKGA 3RNGC 3NWAA 1MJDA 2H7DA 1L0XB 4N6EB 4EFOA 3DHHC 3VOQA 5FK9C 2IGGA 3EA6A 3AEDB 2ZW1A 3SNHA 4WJPA 2E3TA 3DVGX 4HJGE 2KK8A 4NAWB 3NVZA 1E10A 1DDWA 1RLFA 2CY4A 1JWUD 3ETRA 4Y94A 1ZXHA 1TBEA 1WYGA 1GB4A 2ELBA 1FM0D 2WU2B 4FHKA 3W1SA 3DBLI 3RNFC 2FAZA 3P4SB 1WZ0A 2R82A 4NY0A 2YS1A 2OJWA 5J2RA 4BBNF 2M17A 1PGBA 4ZHPA 5D3WA 4JK9A 3KRXA 1EUVB 2REXA 2EKIA 2MW5A 4L2YA 1FFUA 2LGYA 1NVID 1U4AA 1E90A 3D8EA 3ZVVA 3ML9A 3DXCA 2KCJA 1L6VA 2KDFB 2Q5WD 4JGHB 3V6CB 2CODA 3SR6A 1WGGA 2EKEC 3NWDA 2BYEA 3H7SA 3TFMA 5D3YA 1RRBA 3GE3C 3MPXA 2RDHA 5JXVA 2D2QA 2LXCA 4Z2NA 3CSFA 4ZOHC 2WDRB 1XLOA 2M4NA 1I4RA 3H8HA 4IW0A 2DHKA 1ZPSA 1VJKA 1ZC3B 3FVCA 1U5EA 4OZCA 1Z2MA 3HQCA 2K49A 2IPKD 4QXAB 1PQSA 2KLGA 2V76A 3NJTA 3JW0X 4EZJA 2LRWA 4XDDA 2B76B 1K5GB 2WDTB 2Z0QA 3FLVA 5EFXA 1TGZB 3L0WB 2NS5A 1V1PA 1OMWA 3M3JA 1WX8A 1T0YA 4A6FB 3UZTA 1V88A 1E8YA 2K39A 4GDLB 4JL9A 2RNRB 3RPFC 3IG3A 1E0ZA 3AXCA 4XWXA 4LK0M 3LXFA 3EHVA 2Y3AA 1MPHA 4H8SA 3LJ3A 4JLCA 1XD3B 4NAMA 2KTRB 2TSSA 2YLMA 3ZDTA 4W9IA 3X23A 4D2KA 2GB1A 2KWVB 1KF6B 2ICIA 3E56A 2YSZA 4CHJA 1EO6A 2I2YA 3EC8A 2M1MA 1U5DA 3OG5A 3H7PB 2JRIB 1MI1A 1D6EC 1SGHA 2V3SA 3I3TB 2LOZA 2I38A 1NDDA 5C3JB 2BCJA 3SUZA 2N23A 4DXFA 3QC8B 3T06A 1WMHB 1MHXA 4YWGG 2G1EA 2K3UA 4RFBA 2PE6B 3FAHA 2W9NA 1BT0A 1RFKA 4KIKB 3DBRI 2MEKA 2K0PA 3VAWA 3T8MA 1I4XA 2GS0A 3HRDD 5DIFB 3U7DA 2R0DA 2D11A 2G4DB 5HE2A 3SFEB 4EEWA 2K2JA 5LONB 3AE2B 4K3CA 2MKRA 2NMBA 1F0ZA 2DAFA 1D5XC 3FKYA 2RR9A 5LNK1 2LFIA 3PV1A 2UYZB 3VHTC 2K8EA 1XKEA 2A4ZA 1U29A 1C78A 5CTRC 3RMKC 2KT7A 4B6WA 1C4PA 4RMAA 2KWUB 1DOXA 2E6XA 4WWMA 3G9WA 1NBFC 1LGRA 3VIAA 2YVCA 3PSEB 1VLBA 4KGTA 4RF1A 5EE3A 3A1QA 2V4LA 3RCZA 1SHCA 4HATB 1DOYA 5FR3A 1Z5SB 1OTRB 3ULCA 2KX0A 2KQ7A 2QIEB 4K2PA 1E5WA 2O6VB 5DPWA 1RYJA 1DIKA 2J0KA 5HFYA 4MELA 1V5UA 3O96A 2CHXA 4LNOA 2KDIA 4C80A 2BYVE 1NTIA 1VDVA 1I4GA 4CHMA 3ZDMC 1WY8A 3H9DA 3ZXVA 2C7HA 3A8PA 2KFJA 3Q2AC 1N63A 3IFWB 1KC7A 2BT6A 2ZJDA 4NAWA 4F7HA 3SDLC 1WWTA 2IDYA 4JKHA 1WG7A 2LZ6A 3PLUA 1Z87A 1WIAA 4HAZB 2KXJA 5H92C 1U5GA 2K22A 4KKJA 3RZFA 2KZRA 2DFKA 4ANVA 1L4DB 5IAAC 1X05A 3RI7C 4BBKA 2DYBA 4LNKA 3VTWA 1ZC4B 2PVOD 2MRPA 2VH1A 3DXDA 4MM3B 1R7SA 2H88B 4KSKC 1UGJA 2PVGC 3OJ4B 4OW0A 1UUPA 2WXHA 2ZW0A 2MQJA 1I2HA 1CK1A 1MFWA 4P1BC 1V5OA 1AARA 1DBHA 4GZUA 1OY2A 1LXDA 1NVLA 5C5BA 3EFUA 4EE2A 1KH0A 4KVGB 2YF0A 3MP9A 2W2XC 5JHGA 1TYGB 4AOFA 2AQ2B 2C7MB 4JQWC 1V6EA 1NENB 5DPSA 3MJWA 1V2YA 4WWNA 2DYMA 1N6ZA 3V3XA 2FIFA 5CLQB 2KKCA 1WXMA 2HE7A 2X38A 3N1ZC 3ZVRA 1GG3A 3QHTA 2DN6A 1QOBA 2I5FA 5TR5A 2LVQA 1VRAB 1IYFA 3AU4A 3EECA 2Z0DB 2O6VD 2RGFA 5G5GA 1Y19B 5LLIA 3TEXA 2BS3B 4HAWB 5JVLA 3PP2A 1N3HA 4KV2A 2LASA 3ENEA 1UNSA 3KVFB 4A90A 2WX1A 2VZKB 1I4HA 3AE7B 1AWEA 1GAQB 3Q6BA 2MX2A 2R61A 5LG4B 3NHEB 4GDLA 1WH3A 1K53A 1UWMA 4WWPA 3W5UB 5G55A 2KFKB 1I7AA 4MT7A 4W9EA 3P7ZA 2WQYB 2J42A 2KTRA 3I5JC 3B2GA 3VUYA 4WQMA 3K9OB 2KACA 1TQZA 2LHEA 4WAAA 1UZXB 4MT5A 3DBSA 2AEHA 3BK1A 1I4PA 1KM7A 3RNCC 2WGSA 2QSDA 1FAOA 2CRFA 1CJEA 2R2QA 2LEKA 3TMPB 3H7PA 4Z2MB 1WE6A 3QJZA 2JYTA 3EUB2 4ANWA 4TV3A 2GBNA 3IBEA 1FOEA 2K8HA 3VRBB 4Q2JA 3M63B 2XN9C 4QJ3B 1V61A 1TKEA 3ALBA 2ZPYA 1TJ6A 5C6RA 1J0GA 3TVVA 4JIOU 1Y5OA 5JHHA 1D4BA 2WXQA 3NZSA 1HZ5A 3B2FA 1PDXA 4LDTD 4I6PA 3VUWA 3M1IB 3ABVB 3Q8EA 1JWSD 2N9EB 2KDBA 4IOIE 1ZVRA 3KSYA 4A20A 4JKEA 1P9DU 3LB8C 2ZNVC 3FSSA 2KDMA 5EDSA 1Y8RC 3JSVB 4NZLB 2IJ0A 4MEMA 1HZ6A 1BTNA 3IAS1 4HDOA 2KNBA 4IM3A 2M19A 2N7JA 2QMTA 2K8CA 2CU1A 3T3NA 2KIGA 3WYFB 2L0FA 1WGUA 3FM8C 1BTKA 3QQ8B 1GOZA 1UD7A 1FO4A 2ZCCA 1E7PB 5JZEB 3HVZA 4M8MA 4XWWA 1L6UA 1FNUA 5DCNA 3P4QB 4XDCA 3RNBC 2FUHB 2DWQA 4CO7A 4HRSA 3TEYA 3PHWB 2WWZA 2KN4A 2N9XA 2WLBA 2HTHB 5LXHA 1NYQA 2GOWA 3PHXB 2D3BA 1C1YB 1V80A 3R7QA 5LXIB 2CJOA 3RYTA 1WX7A 1ET6A 3OJ3A 1P7EA 3BIID 3SV1A 2QILA 4F1SA 4GLSC 4PNKA 2NR2A 1SSNA 2NBVB 1ZYIA 3PRZA 4A3PA 4A6QA 4GOUA 1ROEA 1E9MA 4GDKB 2XK5B 2K00A 1V5PA 1S3SG 3AE5B 1YIWA 4DHZE 1VBGA 2LULA 3OLMD 1J19A 2INCC 3NZUA 2N9PC 2RRFA 3TIXA 2GRIA 4MM3A 2Z8LA 5BMHA 2N1VA 4YL8A 4II2B 4NQKE 1BAKA 3KWVA 4HPMB 2RUKB 5HE0A 3ZIMA 4ILJA 1WGYA 2N9LA 2Z0PA 1FB8A 4HB2B 3NUHB 4US9A 4A55A 4HDQA 4BOSC 3WAOA 3SFDB 1FCLA 4YONA 1WI0A 2W2WA 1KRHA 1LB1A 3APCA 2GI9A 3WCQA 3BVZA 4DHZB 4KDIC 4F7GA 3NY5A 3E9LA 4XWTA 1ZE3D 1NI3A 3NVWA 1LW3A 1E8XA 2C60A 1UEFA 3DHGC 3SEBA 1X1GA 3VFKA 3Q14C 3D32A 5HE1A 5I2MA 2J0MA 2BWES 2Y8FA 4GNKB 4WJQA 4KHAA 4HK2A 1JRPA 1N60A 1YQBA 3NW8A 2J4XA 2BB6A 3SBGA 5D7GA 2LKOA 1FHOA 3PGEA 4MACA 3P4RB 3IHPC 2COFA 5KCVA 3KZ1A 2GUMA 2GBJA 1PGAA 4ZDVA 4L6EA 4OZAA 1GJZA 1GB1A 4TKNA 4ANXA 4EKUA 2DX1A 3KRWA 5C16A 2RVBB 2RLOA 4IAPA 2KFKA 1WXSA 1XO3A 2QKLA 2BBCA 5BYQA 1PFDA 2MLBA 3R2TA 3E9OA 1FCCC 1GGOA 1D5MC 1S1QB 2HJ8A 4YSXB 2KJHB 5D27A 2AWTA 2IY1B 4KAXB 2WXOA 3ZNGC 4DIXA 1Q10A 2BWFA 3PVWA 2L1CA 4JK7A 3DPDA 2KUPA 1XLNA 4A6HA 4MH8A 1B1ZA 2A5UA 1QC6A 2K2UA 4CHKA 1D3ZA 4RM8A 2PPHA 1FFVA 4OT1A 3L54A 1ZP0B 2IO3B 3AJ4A 3KUZA 4YT0B 4EOYA 2RSGA 2IY0B 2W2XD 3V62A 2B3AA 1W1HA 1ESFA 4GXBA 3JYUA 2RPVA 1QF6A 4J3OD 4MSMB 1T6BX 4MDKE 1YX6B 3H1UA 2M14A 2AYOB 4PYUA 4BFRA 2PJHA 4M0WB 2DHJA 1WR6E 2CKHB 2JWUA 2L0TA 2FJUB 3AM9A 4GGQA 1TJEA 2IBIB 4ACFA 2JU6X 2Z0OA 3MHSD 4L1BA 4ZHOA 1UNRA 1FRDA 3ZNID 2MBOA 4WAFA 3AECB 2WS3B 1WYWB 2IYBA 4ICUA 3MFGA 1EU4A 5D3VA 3KYDD 2KC1A 3JSVA 1A5RA 3LDZE 2DX5B 4UDUC 5AUIA 1SB3C 1XLQA 2N0SB 3RFZB 1T3QA 2IO2B 4FXCA 1YNTE 1YJJA 1F9JA 3KYCD 5C79A 2WDQB 1ST7A 2DENB 5GOWB 1VZ7A 3ZKJC 4PK1A 4KHOA 4HXDA 1RM6C 1DYQA 1R4MI 3T3OA 1MAIA 2DZMA 4JE3B 1M7RA 4DBBA 3P42A 1V9JA 3PEGA 2RDBC 2DYNA 4MGYE 2MP2A 1FMAD 2FCNA 2Z13A 2SEBD 2W82A 1K52A 2HTHA 4MSQB 2M56B 5E6NA 4EJNA 2RSUA 4LNNA 5GXGB 2C7NB 5CHVC 4X57B 2V1YA 1XR0B 1F2RC 2IO0B 3I57A 4RH6A 2D3GA 3RUIB 1BXTA 2EJ8A 2RDGA 4KKIA 1MVKA 2D3AA 1DOIA 2LHDA 4FN2A 2P0DA 2LGDA 3DVGY 4YSYB 2WDVB 1BUIC 5J17A 1RRPB 1LFDA 2BKRB 2NBVA 3PREA 1UWXA 1SJED 1XCQL 4GDKA 2XK5A 5EE0A 4HHVA 1ZSQA 1F77A 5EE1A 1FPYA 1UPQA 2QCZA 3EFCA 3GP7A 4DXGA 2GMIC 5D3XA 5DH9B 3OWEB 4NPNA 1SE3A 2WNMA 3ZTDA 3MDBC 3V60A 2W3RA 4EMOA 2GCJA 2JT4B 4DWFA 1EF5A 1FGZA 2FBWB 3A8QA 2ABDA 1PFJA 1ET9A 1AW7A 5E6OA 3B77A 4W9FA 3P4PB 2BKFA 3W1SC 4ZYSA 3IAM1 3AE9B 5L95C 4ITKA 1MG8A 3IVFA 4JWUC 1QT9A 1HB8A 1OQQA 5HI1A 3BWUD 5C2TB 4JWSC 5J3TA 1HTOA 4CSQA 4K2OA 2GBRA 1IBXB 5BYRA 4CQNA 2P8VA 4URKA 2N7EA 1IPGA 2Y7BA 3AE4B 4NJCA 2NTSA 1UPRA 1QOAA 2M0XA 2KQSA 3LYYA 1SE2A 2D10A 1TKGA 3Q8AA 4JKFA 3U4EG 4DHJB 3ZJTA 4RGOS 3ENBA 3HM3A 1XLPA 3KUCB 5L81A 1WX9A 4OVUA 5CHFA 4S17A 3ODXA 3WAPA 3CXBB 3JVZX 4LNIA 5DHAB 1IGCA 4XGAB 3PVLA 2Y5BB 1PGXA 4XYCA 3R66C 4PS3A 5I2SA 4GN1A 3AN1A 3PSCA 4GIVA 4TSSA 5IN7A 3B9JA 2NZ8B 2N0YA 1UNPA 1E6EB 2WP9B 4K81A 3Q8CA 3CIRB 2ACZB 1GPXA 1WRDB 1ZKHA 4B9KA 1DDMA 2NVUI 1K50A 1RFAA 1TY2A 4BKTA 4EZLA 1TXDA 4JX1C 3ZNHB 1UBIA 4AS1A 3AV8A 3DWMA 2R09A 2NCNA 3NOBA 1KZ7A 2VSZA 3GE8C 1XXGA 4K1RB 2KTFA 2MWSB 1AN8A 1UGMA 5FI1A 2L3ZA 1ACCA 1U27A 2VH2A 3SHQA 4A3OA 4AQ7A 1WRIA 2HTME 3AI5A 3NS1A 1NTYA 1GC6A 2L52A 1WM3A 4R3DA 2BYTA 2DLBA 4AUQC 2LG1A 1SF0A 1NI2A 1I42A 2LI5A 2Y5PA 3HM6X 3L10B 2JQRB 3SO6A 2KGXB 2ROZB 1ZUD2 1DGJA 2COAA 3GYOA 4HEA1 2COCA 2UZSA 3A58A 3TO1A 3V6EB 1J7CA 2KHWB 2EMSA 2KC2A 2QC8A 2QHOA 3AB5A 1M4VA 3M62B 2L05A 1I35A 1TT5B 1C3TA 3AE3B 4JKDA 1T0SC 2CU3A 1B55A 2DX5A 4DHJD 4E74A 2YT0A 2DYOA 1FXIA 1J0WA 4USAA 4LDTB 1YQ3B 3ZLZA 1T0QC 1KLUD 3I63C 3KQ4A 4N59A 4WURA 4F7ZA 1L7YA 3U7ZA 2DYQA 3BK2A 4OHJA 1L0VB 1ZM0A 3OANA 3KH0A 4OSNA 2C5LC 1NEKB 4RCOA 1I7HA 1H10A 1VR9A 4A8XC 3RCPA 1V89A 3RULA 2L32A 2JZZA 4L1RA 3W5VB 4A6FA 2MCNB 1WZ3A 2INDC 4ZRKA 1YOVB 1E7UA 4M8NA 2BS2B 4MGIE 3UIOB 2I1KA 4H2AA 3A98B 1C76A 3UIPB 2V0GA 5AZFA 4A5KA 2CY5A 3BJIA 1KBLA 3QARA 3AE1B 4FJZA 3UQBA 1TS5A 3E66A 2DA0A 4XE0A 4HAYB 3H6NA 3WANA 1I4QA 2KMAA 2LJIA 4HCPB 3VRAB 1Q0WB 1JW9D 2ZKMX 1ZDVA 4LJPB 2DTCA 1UH6A 2N1WA 1W1DA 2LGSA 1WMHA 1PMSA 3DBHI 4XZ4A 3VQIA 5DPRA 4DDID 1P3RA 5DPTA 4F8CB 1SXTA 3IT6B 4WJOA 4KIKA 4TMAB 4OVZA 4O1NA 2FDQA 5FKAC 3N30A 2BVCA 3L16A 1KTKA 1BWNA 2K9XA 2LMCA 3N7CA 2ZCBA 5I4DA 4GSWA 2FJ9A 3EGRA 3BYTB 5BYSA 1YN4A 4FA6A 1STEA 4KHBB 1WGDA 2WYQA 3TSSA 4KSLC 3FILB 1HA5A 3BY4B 1OFFA 3TEZA 2QEJC 2MBHA 3E9SA 4WJ7A 1IBXA 1V81A 5D94A 2COPA 3FC4A 2YT1A 1SBBB 4KX6B 3GZNI 1FNVA 1IUEA 4HPLB 1UELA 2LJ5A 3PZ8A 1FXAA 3ONSA 2V3NA 3KLSX 1EWYC 2PEAA 4HAXB 4WVFB 3ZRFA 2FE8A 1PYWD 2OQBA 3APFA 4XX5A 4IM0A 2O6VA 2ZVOA 1OEYA 3VTUA 1WM2A 1IGDA 4BAXA 4HKQA 2AL6A 2O2VB 2JUOA 4HPPA 1FEHA 4ZYNA 2W54A 1UBQA 2H7EA 3AEFB 3AEGB 2GBMA 3PTFC 2BGFA 3RNAC 3GOEA 1FXTB 2PLPA 4TQ0A 4JKGB 3DCXA 2KMMA 5M4YB 3T9LA 1QZEA 2KAJA 1WSPA 3HIZA 2MBQA 1K5DB 5D6JB 2KWCA 3FEHA 2LXAA 1AYFA 1MG4A 4K3BA 3UINB 1KLVA 3NWFA 1IP9A 3L4PA 3A4RA 5IJMA 2WH5A 3ML4A 4G0NB 2G45B 3X0WA 3RNEC 4TYZA 1N62A 1PLSA 4KZ0A 1R4MB 3Q3OC 2IGDA 5AUKA 3HIEA 1RJ2A 2Q13A 2NPTB 2IGHA 3AE8B 1EGXA 1D5ZC 3PLVA 2JX5A 2QJLA 4KDLB 4F7UP 1TIFA 2GJYA 5KQ4A 3PO0A 3BINA 4IC7B 5IKCM 4K7WA 3DVNV 1IRSA 2KJRA 2YRYA 3O13A 1YJ1A 2GCLA 2GLSA 2WHIA 4C7YA 1N61A 3QAQA 2R2OA 4RGMA 1N5XA 2KVZA 1WGHA 4HKZE 1MKEA 1VD2A 4MGZE 3PT2B 3APDA 5D3DA 4US8A 3O65B 2BPSA 2WXJA 4J6IA 1XCGA 3ODWA 1TZ1A 3QX1A 3B08A 3MC8A 4G50A 3WAMA 2KYWA 4GMXB 4HROA 1FD6A 1NTVA 4W9HA 3AE6B 4YSZB 1P98A 1FRRA 3V05A 1KZGA 1V5MA 4XC2A 2FNJB 3BYYB 2P0FA 3BVGA 4II3B 4DDGD 3NRZA 2PZ1A 2JY6A 3M95A 1QQGA 1TTNA 4JKBA 1OQRA 3PRPB 4HWIB 3AULA 2KVRA 5JP4A 3ULBA 4IFSA 1ZW7A 3URYA 4B0MA 2DLWA 3PZ7A 1V8CA 2KX3A 1CQVA 3VVWB 3TBLD 2DBYA 2JP2A 1HB6A 2DKQA 3IT4B 4P1CC 3DWGC 2CHWA 4HSIA 2OTXA 2DIKA 3B1LX 2DHZA 3VUXA 1P5TA 3CWIA 1MIXA 4WIPA 5AEKB 1WVHA 3A1QB 5IO9A 3ZTCA 2WXPA 1XF5L 2LVPA 1ZGUB 3VTVA 2UVMA 1TS3A 2BYFA 2KMCA 3OAWA 4A6KA 1DDVA 2KLCA 1JCKB 3UI3A 2LGXA 3VDZA 1MIZB 1B9RA 5HE3A 3ZQ4A 2D4QA 4G3XB 1DROA 4JPSA 1AQCA 4OVVA 1MK9B 5IOIA 3QWZB 2LOXA 1OGWA 2SAKA 1QOGA 1LQBA 2K8BA 2UU7A 1QOFA 2WXIA 1AWDA 3AH7A 2JYEA 4HCNB 4JKCA 3CF6E 1V5TA 4QAYA 5G2NA 4W9DA 4RGNA 2K5PA 3TJPA 2JVCA 4RM9A 3F5RA 4YXDB 4MH0E 4NJ6A 3UQAA 2AL3A 4YTPB 2N9KA 3AU5A 4KHBA 3ZRCA 1V49A 3TCAA 2CB8A 5LOPB 4QJ5B 2WXRA 3FILA 2ZNVB 4WSFA 1EAZA 2K25A 4JK8A 4ZRQA 1WI1A 4HAVB 2V3PA 1PUTA 3QCAA 4HLEA 4YTNB 2Z4DA 3VXWA 2LUMA 2WXGA 1ISNA 4KGRA 1WXAA 5C5BB 1T5XD 1X1FA 2HD5B 1C9FA 1KI1B 2L7RA 4JKAA 3ZUNA 1UF0A 3MTNB 2ONQA 1RWSA 1FNWA 1P1AA 1HXYD 3ZW3A 1SIFA 1VZ6A 4NJ7A 3AEAB 3QIJA 4E71A 4PT5A 4I6NB 2O2VA 3PVUA 2RMMA 4KZCA 4MK0A 5FR6A 4LJOB 3HW2B 2J52A 3AMZA 5AZGA 4PQ0A 1Q67A 1H8CA 4MJSB 4ZRIA 3R3MA 3SYXA 2FUG1 1Y56A 2J7QB 1F52A 3A9JB 2AX5A 4JKGA 2E2XA 3KUDB 3B0AA 3L08A 3C19A 2ROVA 3ZJUA 2ZVNA 1BMLC 3ZGZA 2LRUA 2D3CA 2Z14A 4RGTA 2HRJA 2J59M 5FI0A 3I9V1 3Q69A 1YJIA 1WFYA 2D5GA 2MJDA 2WXKA 1JQ4A 3U52E 3HHMA 3R7RA 1FIQA 4OZBA 2NPTA 2NBWB 3NVVA 3WA0A 1FHXA 2W3SA 2VRRB 3MC9A 2IZVB 4LCDE 2ON8A 1WR1A 2ELAA 5AZHA 5HHDG 3NS8A 3CMMB 2MJ3A 1R4NI 4FLHA 3DVNU 3J9CA 2Z59B 1F1HA 1ACAA 2WXMA 1C77A 1HQRD 2WX0A 1RAXA 2MA9B 3N1YC 2FCSA 1EU3A 2MDXA 3N32A 4D0NB 2L83A 4ZRPA 4E3CA 3N9YC 4BBNC 2FCQA 1T0RC 2JF5A 2DHIA 1L5PA 1TY0A 1E7VA 4AJWA 1OQYA 2J0JA 1GUAB 3PZDA 3ZO5B 5KQ1A 4BKSD 2RGNB 2JZ3B 1KLGD 2W55A 3DBHB 1J7AA 1SE9A 4W9JA 4G11A 4FADA 2CJNA 5C23A 3UF8A 3VH4B 1V1OA 3Q3FA 2OJRA 1MPEA 3R2IA 1WJ4A 4ICVA 4FBJB 4DBGA 3TW1A 4MY6A 2N4FA 4NQLB 2D9XA 3ZJVA 2LYDA 1X1MA 4C4VB 4DK5A 2Z0EB 3SU8X 3Q3MC 4N9F4 3DXEA 4PYZA 3P1MA 2OEDA 1SEBD 4KGSA 2MWNB 4B0EA 2PW9A 2ADZA 5C1ZA 2YEPB 4DXAB 3N20C 5BMGA 2ZZPB 3A33B 2G9HD 3P6AA 4BVUC 1SJHD 1V86A 3BVMA 1HBKA 2YT2A 2DZIA 3GZNB 1EM7A 4PS7A 2ZEQA 4DX8A 2INPE 4ASWC 1JMLA 4I6LB 2KANA 1N5WA 1KFYB 2OOBB 4WH4A 2VKIA 1ZXIA 1XQQA 1LO5D 1XD4A 4HJKA 4AWJA 4CYEA 3TUOA 3S2AA 1C4CA 1XEEA 5DI9B 3ZYYX 3SBTA 1QLBB 2XBBC 2WXNA 3AEBB 4M0WA 1U5FA 2HJ1A 1JALA 4IOYX 2NTTA 2H89B 1WGRA 3CIKA 2DZJA 1OQNA 1WJMA 4P7IA 1TZOA 4WWOA 4DQOC 5DHFB 2NBUA 2D9VA 1M94A 3LJUX 3QK0A 1MI0A 2G3QB 2MHJA 4GB9A 4ANUA 1WJNA 3VH3B 2X18A 1TKYA 3BZDB 2BTEA 3P2BA 2XEWA 4DX90 4K7UA 2JWZA 2MSED 2J53A 1JWBD 2C9WB 4C00A 3L17A 1KOTA 3A9KB 3DHIC 2WU5B 3RD2A 2I5CA 3ZXRA 1ZDXA 3GYPA 2CHZA 3DCGA 1P3QU 2KQ4X 2PKOA 4BKSA 2D9WA 1CZPA 3F0WA 2KUQA 2N7DA 5KHQA 4W9KA 3IXSA 1L4ZB 4C56C 3UGBB 4RNAA 5MPOA 1P7FA 2PE9A 3GB1A 1JWAD 1W1GA 1QKZA 1GNUA 3NZ3A 5L83A 4MJSA 1XX0A 5TSSA 3Q8FA 4M00A 1ENFA 1E8WA 2X0SA 1WXVA 3A9JA 2D07B 2DZKA 3K9PB 4IWPA 5HG2A 4EZKA 5CX3A 5HKHA 3D8DA 5D3IB 4LTUA 3HSAA 2RPQA 1CMXB 2BF8B 2BQQA 4BZAA 1YN5A 5CLLB 3C0RB 4LLGM 2EMTA 3QWMA 1K51A 5IP4D 4WQOB 4EUTA 1JRUA 1Q1OA 3GS2A 2KWDA 4N58A 4AJYB 5J18A 3U30A 2L00B 2M38A 4HB4B 5JHAA 2LUEA 1L2NA 4D6WA 2OHFA 3SD5A 5G5HA 4FHJA 1C4AA 4ARCA 2M8SA 3W2DA 3V5WA 3PS6A 2KN5A 5JLJB 3ODOA 4ILHA 2JSVX 3RT3B 5D2MB 2KO3A 4NSWA 3V61A 3NG0A 3HUIA 2KR0A 2L8JA 5GMVA 2G35A 3W9CB 2Z59A 2WXLA 1J7BA 1TS2A 2K6QA 4B95A 4MGKE 2DKPA 2JXXA 1GC7A 4QJ4B 4AP4C 4IM2A 4NNJB 4M01A 1HE8A 4GOCA 3WIMA 2P0HA 2XNAC 5KHOA 1OEYJ 4ZRJA 2IO1B 1XCTL 1G6JA 3KWLA 2ZPNA 2XQNM 3A4SC 1VBHA 4A9AA 4P16A 2CS4A 3MJ5A 2LVOA 3QA8A 1P0RA 3U2SC 1EF1A 4BKGA 3ZNZB 4TQ1A 5CHWA 1LM8B 1YD8U 3RZWC 4HB0B 1DYNA 4REZA 2VRWB 2HDEA 2FJLA 3DDCB 1WGQA 3ECIA 3PRMB 2L2IA 1QQRA 2M0AA 4B6HA 3DBLB 2X8XX 5IA7A 2PIAA 4C4VA 2AQ3B 3W1YA 2MJEA 4P6VF 1WE7A 2VZKD 3FP5A 2CAYA 3HK0A 2JPHA 2UWQA 2V4IB 2IFSA 1VZ8A 1SE4A 1HTQA 5BO4B 1FGYA 1QILA 2YEPF 4C0AA 3VR9B 4C7ZA 1U2BA 2MBEA 4IWOA 2AQ1B 4GMVA 3PG7A 3N3KB 1TS4A 4W9CA 1X11A 4YTMB 3EPYA 2QDFA 2MP2B 3NVYA 1V1PB 3U8ZA 2R2YA 3PPAA 5H8YE 1WGKA 1HEZE 2ASQA 2I1JA 2QKMA 4FULA 5EE9A 2MH7A 4IWQA 3R8BA 5IRSA 1WF9A 1WJ1A 3KY9A 2KJ6A 2KD0A 1JWMD 3TEWA 4LNFA 4WJNA 1KJTA 5BMIA 2Y8GA 4IG7B 1A70A 2Y5CA 2KDEB 2WXFA 2YS5A 3DQVA 4W9GA 3AEEB 1V97A 3L13A 2V9HA 4S0RA 5E6PA 4HVBA 4ARIA 1WXQA 2LBBA 1P6SA 2K1FA 3MC0B 1EWCA 2KOXA 3DOWA 1NU2A 1YX5B 2K6DB 1SIJA 2LD9A 1F2RI 4W9LA 4IDIA 1WJ6A 1YMHE 1VCBA 2DNFA 1FHWA 3P63A 2UZRA 2PMVA 4K7SA 4FJVB 3WALA 2IYDB 3U12A 2G4SA 1C79A 1JROA 1NYRA 1J8CA 1JDEA 5T8IA 4L23A 5JHBA 2D9ZA 1X86A 2L76A 3Q3JA 4HB3B 3A9KA 1XT9B 3VR8B 2CQUA 2BB5A 3RN9C 3C8YA 3QBVB 1L0YB 1UNQA 5J3QA 2GBKA 1EVHA 1K8RB 2INNE 2KIEA 4TUUA 2JXTA 4HAUB 2DAJA 1MHHE 4ILGB 4IUMB 2LWPA 3OHMB 1WJUA 2FIDA 1T77A 3Q8BA 4M02A 3TL5A 2MBBB 1R4NB 2BW2A 4FJYA 2MFQA 2EELA 1M7EA 2NMQA 1E8ZA 2D9YA 3N1XC 2L1AA 1Q5WB 2BS4B 4BOZB 3D8FA 3Q3NC 2PTLA 4GU2A 5JH5C 1ZOYB 4PS8A 1MK7B 1H4RA 3HVDA 3MHZA 2FCMA 4GPTB 1YN3A 4K17A 4RF0A 3CSTA 3KW5B 3E9PA 1XODA 5E6JA 2RD0A 2JRHA 3ML8A 5J3YA 3NSUA 2CR5A 2LGIA 2JZPA 3DBRB 1YQ4B 2RQ1A 2YS3A
chains in the Genus database with same CATH topology
2EC1A 2H7DA 4EFOA 3VOQA 3SNHA 4WJPA 3DVGX 2KK8A 4NAWB 1DDWA 1RLFA 2CY4A 4Y94A 1TBEA 2ELBA 4FHKA 3W1SA 3DBLI 2FAZA 1WZ0A 2R82A 4NY0A 2YS1A 5J2RA 4BBNF 2M17A 5D3WA 4JK9A 3KRXA 1EUVB 2REXA 2MW5A 2LGYA 1U4AA 1E90A 3D8EA 3ZVVA 3ML9A 3DXCA 2KCJA 4JGHB 2KDFB 3V6CB 2CODA 1WGGA 2EKEC 2BYEA 3H7SA 3TFMA 5D3YA 1RRBA 3MPXA 2D2QA 2LXCA 4Z2NA 3CSFA 2M4NA 4IW0A 2DHKA 1ZC3B 1U5EA 1Z2MA 3HQCA 1PQSA 2KLGA 2V76A 3JW0X 4EZJA 2LRWA 1K5GB 2WDTB 2Z0QA 3FLVA 5EFXA 1TGZB 3L0WB 2NS5A 1OMWA 3M3JA 1WX8A 1T0YA 4A6FB 3UZTA 1V88A 1E8YA 2K39A 4GDLB 4JL9A 2RNRB 3IG3A 3AXCA 4XWXA 3EHVA 1MPHA 4H8SA 3LJ3A 4JLCA 1XD3B 2KTRB 2YLMA 3ZDTA 4W9IA 3X23A 2KWVB 2YSZA 4CHJA 1EO6A 3EC8A 2M1MA 1U5DA 3H7PB 2JRIB 1SGHA 2V3SA 3I3TB 2LOZA 1NDDA 2BCJA 3SUZA 2N23A 3QC8B 3T06A 1WMHB 2PE6B 2W9NA 1BT0A 4KIKB 3DBRI 3VAWA 3T8MA 2GS0A 5DIFB 3U7DA 2R0DA 2D11A 2G4DB 5HE2A 4EEWA 2K2JA 5LONB 2MKRA 2NMBA 2DAFA 2RR9A 3PV1A 2UYZB 3VHTC 2A4ZA 1XKEA 1U29A 5CTRC 4B6WA 4RMAA 2KWUB 3G9WA 1NBFC 3VIAA 2YVCA 3PSEB 3A1QA 2V4LA 3RCZA 1SHCA 4HATB 1Z5SB 1OTRB 3ULCA 2KX0A 2KQ7A 4K2PA 1E5WA 2O6VB 5DPWA 1DIKA 2J0KA 4MELA 1V5UA 3O96A 2CHXA 2KDIA 2BYVE 1NTIA 4CHMA 3ZDMC 1WY8A 3H9DA 2C7HA 3A8PA 2KFJA 3IFWB 1KC7A 2ZJDA 3SDLC 4NAWA 4F7HA 4JKHA 1WG7A 2LZ6A 3PLUA 1Z87A 1WIAA 4HAZB 2KXJA 1U5GA 3RZFA 2KZRA 2DFKA 4ANVA 5IAAC 1X05A 4BBKA 2DYBA 3VTWA 1ZC4B 2MRPA 3DXDA 4KSKC 3OJ4B 2MQJA 1I2HA 1V5OA 1AARA 1DBHA 4GZUA 1OY2A 1LXDA 1NVLA 5C5BA 3EFUA 4KVGB 2YF0A 2W2XC 5JHGA 4AOFA 2C7MB 4JQWC 1V6EA 5DPSA 3MJWA 1V2YA 4WWNA 2DYMA 2FIFA 5CLQB 2KKCA 1WXMA 2HE7A 3ZVRA 1GG3A 3QHTA 2DN6A 2I5FA 5TR5A 2LVQA 1IYFA 3AU4A 3EECA 2Z0DB 2O6VD 2RGFA 1Y19B 5LLIA 4HAWB 5JVLA 3PP2A 1N3HA 4KV2A 2LASA 3ENEA 3KVFB 2WX1A 1AWEA 2MX2A 4GDLA 3NHEB 1WH3A 4WWPA 5G55A 2KFKB 1I7AA 4MT7A 4W9EA 3P7ZA 2KTRA 3VUYA 3K9OB 1TQZA 4WAAA 1UZXB 3DBSA 2AEHA 1KM7A 1FAOA 2CRFA 2R2QA 3TMPB 3H7PA 4Z2MB 1WE6A 3QJZA 4ANWA 4TV3A 2GBNA 3IBEA 1FOEA 2K8HA 3M63B 1V61A 3ALBA 2ZPYA 1TJ6A 5C6RA 1J0GA 3TVVA 4JIOU 1Y5OA 5JHHA 3NZSA 4LDTD 4I6PA 3VUWA 3M1IB 2N9EB 2KDBA 1ZVRA 3KSYA 4A20A 4JKEA 1P9DU 2ZNVC 3FSSA 5EDSA 1Y8RC 3JSVB 4MEMA 1BTNA 4HDOA 2KNBA 4IM3A 2K8CA 2CU1A 3WYFB 2L0FA 1WGUA 3FM8C 1BTKA 3QQ8B 1UD7A 2ZCCA 5JZEB 4M8MA 5DCNA 2FUHB 4CO7A 3PHWB 2WWZA 2N9XA 2HTHB 5LXHA 2GOWA 3PHXB 1C1YB 1V80A 3R7QA 5LXIB 3RYTA 1WX7A 3OJ3A 3SV1A 4F1SA 4PNKA 2NR2A 2NBVB 3PRZA 4A3PA 4GDKB 2XK5B 2K00A 1V5PA 1S3SG 1YIWA 4DHZE 1VBGA 2LULA 3OLMD 1J19A 3NZUA 2N9PC 3TIXA 4MM3A 2N1VA 4YL8A 4II2B 4NQKE 1BAKA 4HPMB 2RUKB 5HE0A 3ZIMA 4ILJA 1WGYA 2Z0PA 1FB8A 4HB2B 4HDQA 4BOSC 3WAOA 4YONA 1WI0A 2W2WA 1LB1A 3APCA 4DHZB 4KDIC 4F7GA 3NY5A 3E9LA 1LW3A 1E8XA 2C60A 1UEFA 1X1GA 3VFKA 3D32A 5HE1A 2J0MA 2BWES 2Y8FA 4WJQA 4KHAA 4HK2A 1YQBA 5D7GA 3SBGA 2LKOA 1FHOA 3PGEA 3IHPC 2COFA 5KCVA 3KZ1A 2GBJA 4ZDVA 4L6EA 1GJZA 4TKNA 4ANXA 4EKUA 2DX1A 3KRWA 5C16A 2RVBB 2RLOA 4IAPA 1WXSA 2KFKA 2QKLA 2MLBA 3E9OA 1GGOA 1S1QB 2HJ8A 2KJHB 5D27A 2AWTA 2IY1B 4KAXB 3ZNGC 2BWFA 3PVWA 2L1CA 4JK7A 3DPDA 2KUPA 4A6HA 2A5UA 1QC6A 2K2UA 4CHKA 1D3ZA 4RM8A 2PPHA 3L54A 2IO3B 3AJ4A 3KUZA 4EOYA 2RSGA 2IY0B 2W2XD 3V62A 2B3AA 1W1HA 4GXBA 3JYUA 4MSMB 4MDKE 1YX6B 3H1UA 2M14A 2AYOB 4PYUA 4BFRA 2PJHA 4M0WB 2DHJA 1WR6E 2CKHB 2L0TA 4GGQA 2IBIB 3MHSD 2Z0OA 1UNRA 3ZNID 2MBOA 1WYWB 2IYBA 4ICUA 5D3VA 3KYDD 2KC1A 3JSVA 1A5RA 3LDZE 2DX5B 2IO2B 1F9JA 3KYCD 5C79A 1ST7A 2DENB 5GOWB 3ZKJC 4KHOA 4HXDA 1R4MI 1MAIA 2DZMA 1M7RA 4DBBA 1V9JA 3PEGA 2DYNA 4MGYE 2MP2A 2FCNA 2HTHA 4MSQB 5E6NA 4EJNA 2RSUA 5CHVC 2C7NB 4X57B 2V1YA 1XR0B 2IO0B 3RUIB 2D3GA 2EJ8A 4FN2A 2P0DA 2LGDA 3DVGY 5J17A 1RRPB 1LFDA 2BKRB 3PREA 4GDKA 2XK5A 4HHVA 1ZSQA 1UPQA 2GMIC 5D3XA 5DH9B 4NPNA 3ZTDA 3MDBC 3V60A 4EMOA 2GCJA 2JT4B 4DWFA 1EF5A 1FGZA 3A8QA 2ABDA 1PFJA 5E6OA 4W9FA 2BKFA 3W1SC 5L95C 1MG8A 3IVFA 1HB8A 5J3TA 4K2OA 2GBRA 2P8VA 4URKA 2N7EA 1IPGA 2Y7BA 1UPRA 2M0XA 2KQSA 2D10A 4JKFA 4DHJB 3ENBA 3HM3A 3KUCB 5L81A 1WX9A 4OVUA 5CHFA 3ODXA 3WAPA 3CXBB 3JVZX 5DHAB 3PVLA 2Y5BB 3R66C 4PS3A 4GN1A 3PSCA 4GIVA 2NZ8B 2N0YA 1UNPA 4K81A 1WRDB 1ZKHA 4B9KA 1DDMA 2NVUI 1RFAA 4EZLA 4BKTA 1TXDA 3ZNHB 1UBIA 2R09A 2NCNA 3NOBA 1KZ7A 2VSZA 4K1RB 2KTFA 2MWSB 1UGMA 5FI1A 2L3ZA 1U27A 3SHQA 4A3OA 3AI5A 1NTYA 1GC6A 1WM3A 4AUQC 2LG1A 1NI2A 1I42A 2LI5A 3HM6X 3L10B 3SO6A 2KGXB 2ROZB 2COAA 3GYOA 2COCA 2UZSA 3TO1A 3V6EB 2KHWB 2EMSA 2KC2A 2QHOA 3M62B 2L05A 1I35A 1C3TA 4JKDA 1B55A 2DX5A 4DHJD 4E74A 2YT0A 2DYOA 1J0WA 4LDTB 3ZLZA 4F7ZA 1L7YA 2DYQA 1ZM0A 3OANA 3KH0A 2C5LC 1H10A 3RCPA 1V89A 3RULA 2JZZA 4A6FA 2MCNB 1WZ3A 4ZRKA 1E7UA 4M8NA 4MGIE 3UIOB 2I1KA 3A98B 3UIPB 5AZFA 4A5KA 2CY5A 3BJIA 1KBLA 3QARA 4FJZA 3UQBA 3E66A 2DA0A 4HAYB 3H6NA 3WANA 2KMAA 4HCPB 1Q0WB 4LJPB 2DTCA 1UH6A 2N1WA 1W1DA 3DBHI 1WMHA 1PMSA 4XZ4A 3VQIA 5DPRA 4DDID 1P3RA 5DPTA 4F8CB 4WJOA 4KIKA 2FDQA 3N30A 3L16A 1BWNA 3N7CA 2ZCBA 4GSWA 2FJ9A 4FA6A 4KHBB 1WGDA 2WYQA 4KSLC 3BY4B 2MBHA 4WJ7A 1V81A 5D94A 2COPA 2YT1A 3GZNI 4HPLB 1UELA 2LJ5A 3ONSA 2PEAA 4HAXB 4WVFB 3ZRFA 2OQBA 3APFA 4XX5A 4IM0A 2O6VA 2ZVOA 1OEYA 3VTUA 1WM2A 2AL6A 2O2VB 2JUOA 4ZYNA 1UBQA 2H7EA 2GBMA 3PTFC 2BGFA 3GOEA 1FXTB 4TQ0A 4JKGB 3T9LA 1QZEA 3HIZA 2MBQA 1K5DB 5D6JB 2KWCA 3FEHA 2LXAA 3UINB 1KLVA 1IP9A 3A4RA 5IJMA 2WH5A 3ML4A 4G0NB 2G45B 3X0WA 4TYZA 1PLSA 4KZ0A 1RJ2A 2Q13A 2NPTB 1EGXA 3PLVA 4KDLB 4F7UP 2GJYA 5KQ4A 3BINA 4IC7B 4K7WA 3DVNV 1IRSA 2KJRA 2YRYA 1YJ1A 2GCLA 3QAQA 2R2OA 1WGHA 1MKEA 1VD2A 4MGZE 3PT2B 3APDA 3O65B 2BPSA 4J6IA 1XCGA 3ODWA 1TZ1A 3QX1A 3B08A 4G50A 3WAMA 4GMXB 1NTVA 4W9HA 1P98A 1KZGA 1V5MA 4XC2A 2FNJB 2P0FA 4II3B 4DDGD 2PZ1A 2JY6A 3M95A 1QQGA 1TTNA 4JKBA 3PRPB 4HWIB 3AULA 2KVRA 5JP4A 3ULBA 4IFSA 1ZW7A 2DLWA 2KX3A 3VVWB 3TBLD 2JP2A 1HB6A 2DKQA 2CHWA 2OTXA 2DIKA 3B1LX 2DHZA 3VUXA 1P5TA 1MIXA 5AEKB 1WVHA 3A1QB 3ZTCA 2LVPA 1ZGUB 3VTVA 2UVMA 2BYFA 2KMCA 3OAWA 4A6KA 1DDVA 2KLCA 2LGXA 3VDZA 1MIZB 5HE3A 2D4QA 4G3XB 1DROA 1AQCA 4OVVA 1MK9B 3QWZB 2LOXA 1OGWA 1LQBA 2K8BA 4HCNB 4JKCA 3CF6E 1V5TA 5G2NA 4W9DA 3TJPA 2JVCA 4RM9A 3F5RA 4MH0E 4NJ6A 3UQAA 2AL3A 3AU5A 3ZRCA 1V49A 3TCAA 2CB8A 5LOPB 2ZNVB 4WSFA 1EAZA 2K25A 4JK8A 1WI1A 4HAVB 3QCAA 4HLEA 3VXWA 1ISNA 1WXAA 5C5BB 1X1FA 2HD5B 1KI1B 2L7RA 4JKAA 3ZUNA 3MTNB 1P1AA 3ZW3A 1SIFA 4NJ7A 3QIJA 4E71A 4I6NB 2O2VA 3PVUA 5FR6A 4KZCA 4MK0A 4LJOB 3HW2B 5AZGA 4PQ0A 1Q67A 1H8CA 4MJSB 3R3MA 4ZRIA 3SYXA 2J7QB 3A9JB 4JKGA 2E2XA 3KUDB 3B0AA 3L08A 2ROVA 2ZVNA 2LRUA 2HRJA 2J59M 5FI0A 1WFYA 3HHMA 3R7RA 2NPTA 2NBWB 3WA0A 1FHXA 2VRRB 2IZVB 4LCDE 1WR1A 2ELAA 5AZHA 3NS8A 3CMMB 1R4NI 4FLHA 3DVNU 2Z59B 1ACAA 2WX0A 1RAXA 2MA9B 2FCSA 2MDXA 3N32A 4D0NB 4E3CA 4BBNC 2FCQA 2JF5A 2DHIA 1E7VA 4AJWA 1OQYA 2J0JA 1GUAB 3PZDA 3ZO5B 5KQ1A 4BKSD 2RGNB 2JZ3B 4FADA 1SE9A 4W9JA 4G11A 5C23A 3UF8A 3VH4B 3Q3FA 2OJRA 1WJ4A 4ICVA 4FBJB 4DBGA 3TW1A 4MY6A 2N4FA 4NQLB 2D9XA 2LYDA 1X1MA 4DK5A 2Z0EB 3SU8X 4N9F4 3DXEA 4PYZA 2MWNB 2ADZA 5C1ZA 4DXAB 2ZZPB 3A33B 3P6AA 4BVUC 1V86A 1HBKA 2DZIA 4PS7A 2ZEQA 4DX8A 4ASWC 4I6LB 2KANA 2OOBB 2VKIA 1XQQA 1XD4A 4HJKA 4AWJA 4CYEA 3S2AA 5DI9B 3SBTA 2XBBC 1U5FA 4IOYX 1WGRA 3CIKA 2DZJA 1OQNA 1WJMA 4P7IA 4WWOA 5DHFB 2NBUA 2D9VA 1M94A 3LJUX 3QK0A 2G3QB 4GB9A 4ANUA 1WJNA 3VH3B 2X18A 3P2BA 2XEWA 4DX90 4K7UA 2JWZA 2MSED 2C9WB 3L17A 1KOTA 3A9KB 3RD2A 2I5CA 3GYPA 2CHZA 3DCGA 1P3QU 4BKSA 2D9WA 3F0WA 2N7DA 5KHQA 4W9KA 3UGBB 2PE9A 1W1GA 1GNUA 5L83A 4MJSA 1XX0A 1E8WA 2X0SA 1WXVA 3A9JA 2D07B 2DZKA 3K9PB 4IWPA 4EZKA 5CX3A 5HKHA 3D8DA 2RPQA 1CMXB 2BF8B 5CLLB 3C0RB 2EMTA 3QWMA 4WQOB 4EUTA 1JRUA 1Q1OA 5J18A 4AJYB 3U30A 2L00B 2M38A 4HB4B 5JHAA 2LUEA 1L2NA 3SD5A 4FHJA 2M8SA 3V5WA 3PS6A 2KN5A 5JLJB 3ODOA 4ILHA 3RT3B 5D2MB 2KO3A 4NSWA 3V61A 2L8JA 5GMVA 2G35A 2K6QA 4B95A 4MGKE 2DKPA 2JXXA 1GC7A 4AP4C 4IM2A 4NNJB 1HE8A 4GOCA 3WIMA 2P0HA 5KHOA 1OEYJ 4ZRJA 2IO1B 1G6JA 2ZPNA 2XQNM 3A4SC 1VBHA 2CS4A 2LVOA 3QA8A 1P0RA 1EF1A 4BKGA 3ZNZB 4TQ1A 5CHWA 1LM8B 1YD8U 3RZWC 4HB0B 1DYNA 2VRWB 2FJLA 3DDCB 1WGQA 3ECIA 3PRMB 2L2IA 4B6HA 5IA7A 3W1YA 1WE7A 3FP5A 2CAYA 3HK0A 2JPHA 2UWQA 2IFSA 5BO4B 1FGYA 4C0AA 1U2BA 2MBEA 4IWOA 4GMVA 3PG7A 3N3KB 4W9CA 1X11A 3EPYA 2MP2B 3U8ZA 3PPAA 2ASQA 2I1JA 2QKMA 4FULA 4IWQA 1WF9A 1WJ1A 3KY9A 2KJ6A 2KD0A 4WJNA 1KJTA 2Y8GA 4IG7B 2KDEB 2YS5A 3DQVA 4W9GA 3L13A 5E6PA 4HVBA 2LBBA 1P6SA 2K1FA 2KOXA 3DOWA 1NU2A 1YX5B 2K6DB 2LD9A 4W9LA 1WJ6A 1VCBA 1FHWA 2UZRA 4K7SA 4FJVB 3WALA 2IYDB 2G4SA 1J8CA 1JDEA 5JHBA 2D9ZA 1X86A 2L76A 3Q3JA 4HB3B 3A9KA 1XT9B 2CQUA 3QBVB 1UNQA 5J3QA 2GBKA 1EVHA 1K8RB 4TUUA 4HAUB 2DAJA 4ILGB 4IUMB 2LWPA 1WJUA 2FIDA 3TL5A 2MBBB 4FJYA 2MFQA 1M7EA 1E8ZA 2D9YA 1Q5WB 4BOZB 3D8FA 4GU2A 5JH5C 4PS8A 1MK7B 1H4RA 2FCMA 4GPTB 4K17A 3CSTA 3KW5B 3E9PA 1XODA 2RD0A 2JRHA 3ML8A 5J3YA 3NSUA 2CR5A 2RQ1A 2YS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC1 A;  2H7D A;  4EFO A;  3VOQ A;  3SNH A;  4WJP A;  3DVG X;  2KK8 A;  4NAW B;  1DDW A;  1RLF A;  2CY4 A;  4Y94 A;  1TBE A;  2ELB A;  4FHK A;  3W1S A;  3DBL I;  2FAZ A;  1WZ0 A;  4NY0 A;  2YS1 A;  5J2R A;  4BBN F;  2M17 A;  5D3W A;  3KRX A;  1EUV B;  2REX A;  2MW5 A;  2LGY A;  1U4A A;  1E90 A;  3D8E A;  3ZVV A;  3ML9 A;  3DXC A;  2KCJ A;  4JGH B;  2KDF B;  3V6C B;  2COD A;  1WGG A;  2EKE C;  2BYE A;  3H7S A;  3TFM A;  5D3Y A;  1RRB A;  3MPX A;  2D2Q A;  2LXC A;  4Z2N A;  3CSF A;  2M4N A;  4IW0 A;  2DHK A;  1ZC3 B;  1U5E A;  1Z2M A;  3HQC A;  1PQS A;  2KLG A;  2V76 A;  3JW0 X;  4EZJ A;  2LRW A;  1K5G B;  2WDT B;  2Z0Q A;  3FLV A;  5EFX A;  1TGZ B;  3L0W B;  2NS5 A;  1OMW A;  3M3J A;  1WX8 A;  1T0Y A;  4A6F B;  3UZT A;  1V88 A;  1E8Y A;  2K39 A;  4GDL B;  4JL9 A;  2RNR B;  3IG3 A;  3AXC A;  4XWX A;  3EHV A;  1MPH A;  4H8S A;  3LJ3 A;  4JLC A;  1XD3 B;  2KTR B;  2YLM A;  3ZDT A;  4W9I A;  3X23 A;  2KWV B;  2YSZ A;  4CHJ A;  1EO6 A;  3EC8 A;  2M1M A;  1U5D A;  3H7P B;  2JRI B;  1SGH A;  2V3S A;  3I3T B;  2LOZ A;  1NDD A;  2BCJ A;  3SUZ A;  2N23 A;  3QC8 B;  3T06 A;  1WMH B;  2PE6 B;  2W9N A;  1BT0 A;  4KIK B;  3DBR I;  3VAW A;  3T8M A;  2GS0 A;  5DIF B;  3U7D A;  2R0D A;  2D11 A;  2G4D B;  5HE2 A;  4EEW A;  2K2J A;  5LON B;  2MKR A;  2NMB A;  2DAF A;  2RR9 A;  3PV1 A;  2UYZ B;  3VHT C;  2A4Z A;  1XKE A;  1U29 A;  5CTR C;  4B6W A;  4RMA A;  2KWU B;  3G9W A;  1NBF C;  3VIA A;  2YVC A;  3PSE B;  3A1Q A;  2V4L A;  3RCZ A;  1SHC A;  4HAT B;  1Z5S B;  1OTR B;  3ULC A;  2KX0 A;  2KQ7 A;  4K2P A;  1E5W A;  2O6V B;  5DPW A;  2J0K A;  4MEL A;  1V5U A;  3O96 A;  2CHX A;  2KDI A;  2BYV E;  1NTI A;  4CHM A;  3ZDM C;  1WY8 A;  3H9D A;  2C7H A;  3A8P A;  2KFJ A;  3IFW B;  2ZJD A;  3SDL C;  4NAW A;  4F7H A;  1WG7 A;  2LZ6 A;  3PLU A;  1Z87 A;  1WIA A;  4HAZ B;  2KXJ A;  1U5G A;  3RZF A;  2KZR A;  2DFK A;  4ANV A;  5IAA C;  1X05 A;  4BBK A;  2DYB A;  3VTW A;  1ZC4 B;  2MRP A;  3DXD A;  4KSK C;  3OJ4 B;  2MQJ A;  1I2H A;  1V5O A;  1AAR A;  1DBH A;  4GZU A;  1OY2 A;  1LXD A;  1NVL A;  5C5B A;  3EFU A;  4KVG B;  2YF0 A;  2W2X C;  5JHG A;  4AOF A;  2C7M B;  4JQW C;  1V6E A;  5DPS A;  3MJW A;  1V2Y A;  4WWN A;  2DYM A;  2FIF A;  5CLQ B;  2KKC A;  1WXM A;  2HE7 A;  3ZVR A;  1GG3 A;  3QHT A;  2DN6 A;  2I5F A;  5TR5 A;  2LVQ A;  1IYF A;  3AU4 A;  3EEC A;  2Z0D B;  2O6V D;  2RGF A;  1Y19 B;  5LLI A;  4HAW B;  3PP2 A;  1N3H A;  4KV2 A;  2LAS A;  3ENE A;  3KVF B;  2WX1 A;  1AWE A;  2MX2 A;  3NHE B;  4GDL A;  1WH3 A;  4WWP A;  5G55 A;  2KFK B;  1I7A A;  4MT7 A;  4W9E A;  3P7Z A;  2KTR A;  3VUY A;  3K9O B;  1TQZ A;  4WAA A;  1UZX B;  3DBS A;  2AEH A;  1KM7 A;  1FAO A;  2CRF A;  2R2Q A;  3TMP B;  3H7P A;  4Z2M B;  1WE6 A;  3QJZ A;  4ANW A;  4TV3 A;  2GBN A;  3IBE A;  1FOE A;  2K8H A;  3M63 B;  1V61 A;  3ALB A;  2ZPY A;  1TJ6 A;  5C6R A;  1J0G A;  3TVV A;  4JIO U;  1Y5O A;  5JHH A;  3NZS A;  4LDT D;  4I6P A;  3VUW A;  3M1I B;  2N9E B;  2KDB A;  1ZVR A;  3KSY A;  4A20 A;  1P9D U;  2ZNV C;  3FSS A;  5EDS A;  1Y8R C;  3JSV B;  4MEM A;  1BTN A;  4HDO A;  2KNB A;  4IM3 A;  2K8C A;  2CU1 A;  3WYF B;  2L0F A;  1WGU A;  3FM8 C;  1BTK A;  3QQ8 B;  1UD7 A;  2ZCC A;  5JZE B;  4M8M A;  5DCN A;  2FUH B;  4CO7 A;  3PHW B;  2WWZ A;  2N9X A;  2HTH B;  5LXH A;  2GOW A;  3PHX B;  1C1Y B;  1V80 A;  3R7Q A;  5LXI B;  3RYT A;  1WX7 A;  3OJ3 A;  3SV1 A;  4F1S A;  4PNK A;  2NR2 A;  2NBV B;  3PRZ A;  4A3P A;  4GDK B;  2XK5 B;  2K00 A;  1V5P A;  1S3S G;  1YIW A;  4DHZ E;  2LUL A;  3OLM D;  1J19 A;  3NZU A;  2N9P C;  3TIX A;  4MM3 A;  2N1V A;  4YL8 A;  4II2 B;  4NQK E;  1BAK A;  4HPM B;  2RUK B;  5HE0 A;  3ZIM A;  1WGY A;  2Z0P A;  1FB8 A;  4HB2 B;  4HDQ A;  4BOS C;  3WAO A;  4YON A;  1WI0 A;  2W2W A;  1LB1 A;  3APC A;  4DHZ B;  4KDI C;  4F7G A;  3NY5 A;  1LW3 A;  1E8X A;  2C60 A;  1UEF A;  1X1G A;  3VFK A;  3D32 A;  5HE1 A;  2J0M A;  2BWE S;  2Y8F A;  4WJQ A;  4KHA A;  4HK2 A;  1YQB A;  5D7G A;  2LKO A;  1FHO A;  3PGE A;  3IHP C;  2COF A;  5KCV A;  3KZ1 A;  2GBJ A;  4ZDV A;  4L6E A;  1GJZ A;  4TKN A;  4ANX A;  4EKU A;  2DX1 A;  3KRW A;  5C16 A;  2RVB B;  2RLO A;  4IAP A;  1WXS A;  2KFK A;  2QKL A;  2MLB A;  1S1Q B;  2HJ8 A;  2KJH B;  5D27 A;  2AWT A;  2IY1 B;  4KAX B;  3ZNG C;  2BWF A;  3PVW A;  2L1C A;  3DPD A;  2KUP A;  4A6H A;  2A5U A;  1QC6 A;  2K2U A;  4CHK A;  1D3Z A;  4RM8 A;  2PPH A;  3L54 A;  2IO3 B;  3AJ4 A;  3KUZ A;  4EOY A;  2RSG A;  2IY0 B;  2W2X D;  3V62 A;  2B3A A;  1W1H A;  4GXB A;  3JYU A;  4MSM B;  4MDK E;  1YX6 B;  3H1U A;  2M14 A;  2AYO B;  4PYU A;  4BFR A;  2PJH A;  4M0W B;  2DHJ A;  1WR6 E;  2CKH B;  2L0T A;  4GGQ A;  2IBI B;  3MHS D;  2Z0O A;  1UNR A;  3ZNI D;  2MBO A;  1WYW B;  2IYB A;  4ICU A;  5D3V A;  3KYD D;  2KC1 A;  3JSV A;  1A5R A;  3LDZ E;  2DX5 B;  2IO2 B;  1F9J A;  3KYC D;  5C79 A;  1ST7 A;  2DEN B;  5GOW B;  3ZKJ C;  4KHO A;  4HXD A;  1R4M I;  1MAI A;  2DZM A;  1M7R A;  4DBB A;  1V9J A;  3PEG A;  2DYN A;  4MGY E;  2MP2 A;  2FCN A;  2HTH A;  4MSQ B;  5E6N A;  4EJN A;  2RSU A;  5CHV C;  2C7N B;  4X57 B;  2V1Y A;  1XR0 B;  2IO0 B;  3RUI B;  2D3G A;  2EJ8 A;  4FN2 A;  2P0D A;  2LGD A;  3DVG Y;  5J17 A;  1RRP B;  1LFD A;  2BKR B;  3PRE A;  4GDK A;  2XK5 A;  4HHV A;  1ZSQ A;  1UPQ A;  2GMI C;  5D3X A;  5DH9 B;  4NPN A;  3ZTD A;  3MDB C;  3V60 A;  4EMO A;  2GCJ A;  2JT4 B;  4DWF A;  1EF5 A;  1FGZ A;  3A8Q A;  2ABD A;  1PFJ A;  5E6O A;  4W9F A;  2BKF A;  3W1S C;  5L95 C;  1MG8 A;  3IVF A;  1HB8 A;  5J3T A;  4K2O A;  2GBR A;  2P8V A;  4URK A;  2N7E A;  1IPG A;  2Y7B A;  1UPR A;  2M0X A;  2KQS A;  2D10 A;  4DHJ B;  3HM3 A;  3KUC B;  5L81 A;  1WX9 A;  4OVU A;  5CHF A;  3ODX A;  3WAP A;  3CXB B;  3JVZ X;  5DHA B;  3PVL A;  2Y5B B;  3R66 C;  4PS3 A;  4GN1 A;  3PSC A;  4GIV A;  2NZ8 B;  2N0Y A;  1UNP A;  4K81 A;  1WRD B;  1ZKH A;  4B9K A;  1DDM A;  2NVU I;  1RFA A;  4EZL A;  4BKT A;  1TXD A;  3ZNH B;  1UBI A;  2R09 A;  2NCN A;  3NOB A;  1KZ7 A;  2VSZ A;  4K1R B;  2KTF A;  2MWS B;  1UGM A;  5FI1 A;  2L3Z A;  1U27 A;  3SHQ A;  4A3O A;  3AI5 A;  1NTY A;  1GC6 A;  1WM3 A;  4AUQ C;  2LG1 A;  1NI2 A;  1I42 A;  2LI5 A;  3HM6 X;  3L10 B;  3SO6 A;  2KGX B;  2ROZ B;  2COA A;  3GYO A;  2COC A;  2UZS A;  3TO1 A;  3V6E B;  2KHW B;  2EMS A;  2KC2 A;  2QHO A;  3M62 B;  2L05 A;  1I35 A;  1C3T A;  1B55 A;  2DX5 A;  4DHJ D;  4E74 A;  2YT0 A;  2DYO A;  1J0W A;  4LDT B;  3ZLZ A;  4F7Z A;  1L7Y A;  2DYQ A;  1ZM0 A;  3OAN A;  3KH0 A;  2C5L C;  1H10 A;  3RCP A;  1V89 A;  3RUL A;  2JZZ A;  4A6F A;  2MCN B;  1WZ3 A;  4ZRK A;  1E7U A;  4M8N A;  4MGI E;  3UIO B;  2I1K A;  3A98 B;  3UIP B;  5AZF A;  4A5K A;  2CY5 A;  3BJI A;  3QAR A;  4FJZ A;  3UQB A;  2DA0 A;  4HAY B;  3H6N A;  3WAN A;  2KMA A;  4HCP B;  1Q0W B;  4LJP B;  2DTC A;  1UH6 A;  2N1W A;  1W1D A;  3DBH I;  1WMH A;  1PMS A;  4XZ4 A;  3VQI A;  5DPR A;  4DDI D;  1P3R A;  5DPT A;  4F8C B;  4WJO A;  4KIK A;  2FDQ A;  3N30 A;  3L16 A;  1BWN A;  3N7C A;  2ZCB A;  4GSW A;  2FJ9 A;  4FA6 A;  4KHB B;  1WGD A;  2WYQ A;  4KSL C;  3BY4 B;  2MBH A;  4WJ7 A;  1V81 A;  5D94 A;  2COP A;  2YT1 A;  3GZN I;  4HPL B;  1UEL A;  2LJ5 A;  3ONS A;  2PEA A;  4HAX B;  4WVF B;  3ZRF A;  2OQB A;  3APF A;  4XX5 A;  4IM0 A;  2O6V A;  2ZVO A;  1OEY A;  3VTU A;  1WM2 A;  2AL6 A;  2O2V B;  2JUO A;  4ZYN A;  1UBQ A;  2H7E A;  2GBM A;  3PTF C;  2BGF A;  3GOE A;  1FXT B;  4TQ0 A;  3T9L A;  1QZE A;  3HIZ A;  2MBQ A;  1K5D B;  5D6J B;  2KWC A;  3FEH A;  2LXA A;  3UIN B;  1KLV A;  1IP9 A;  3A4R A;  5IJM A;  2WH5 A;  3ML4 A;  4G0N B;  2G45 B;  3X0W A;  4TYZ A;  1PLS A;  4KZ0 A;  1RJ2 A;  2Q13 A;  2NPT B;  1EGX A;  3PLV A;  4KDL B;  4F7U P;  2GJY A;  5KQ4 A;  3BIN A;  4IC7 B;  4K7W A;  3DVN V;  1IRS A;  2KJR A;  2YRY A;  1YJ1 A;  2GCL A;  3QAQ A;  2R2O A;  1WGH A;  1MKE A;  1VD2 A;  4MGZ E;  3PT2 B;  3APD A;  3O65 B;  2BPS A;  4J6I A;  1XCG A;  3ODW A;  1TZ1 A;  3QX1 A;  3B08 A;  4G50 A;  3WAM A;  4GMX B;  1NTV A;  4W9H A;  1P98 A;  1KZG A;  1V5M A;  4XC2 A;  2FNJ B;  2P0F A;  4II3 B;  4DDG D;  2PZ1 A;  2JY6 A;  3M95 A;  1QQG A;  1TTN A;  3PRP B;  4HWI B;  3AUL A;  2KVR A;  5JP4 A;  3ULB A;  4IFS A;  1ZW7 A;  2DLW A;  2KX3 A;  3VVW B;  3TBL D;  2JP2 A;  1HB6 A;  2DKQ A;  2CHW A;  2OTX A;  3B1L X;  2DHZ A;  3VUX A;  1P5T A;  1MIX A;  5AEK B;  1WVH A;  3A1Q B;  3ZTC A;  2LVP A;  1ZGU B;  3VTV A;  2UVM A;  2BYF A;  2KMC A;  3OAW A;  4A6K A;  1DDV A;  2KLC A;  2LGX A;  3VDZ A;  1MIZ B;  5HE3 A;  2D4Q A;  4G3X B;  1DRO A;  1AQC A;  4OVV A;  1MK9 B;  3QWZ B;  2LOX A;  1OGW A;  1LQB A;  2K8B A;  4HCN B;  3CF6 E;  1V5T A;  5G2N A;  4W9D A;  3TJP A;  2JVC A;  4RM9 A;  3F5R A;  4MH0 E;  4NJ6 A;  3UQA A;  2AL3 A;  3AU5 A;  3ZRC A;  1V49 A;  3TCA A;  2CB8 A;  5LOP B;  2ZNV B;  4WSF A;  1EAZ A;  2K25 A;  1WI1 A;  4HAV B;  3QCA A;  4HLE A;  3VXW A;  1ISN A;  1WXA A;  5C5B B;  1X1F A;  2HD5 B;  1KI1 B;  2L7R A;  3ZUN A;  3MTN B;  1P1A A;  3ZW3 A;  1SIF A;  4NJ7 A;  3QIJ A;  4E71 A;  4I6N B;  2O2V A;  3PVU A;  5FR6 A;  4KZC A;  4MK0 A;  4LJO B;  3HW2 B;  5AZG A;  4PQ0 A;  1Q67 A;  1H8C A;  4MJS B;  4ZRI A;  3R3M A;  3SYX A;  2J7Q B;  3A9J B;  2E2X A;  3KUD B;  3B0A A;  3L08 A;  2ROV A;  2ZVN A;  2LRU A;  2HRJ A;  2J59 M;  5FI0 A;  1WFY A;  3HHM A;  3R7R A;  2NPT A;  2NBW B;  3WA0 A;  1FHX A;  2VRR B;  2IZV B;  4LCD E;  1WR1 A;  2ELA A;  5AZH A;  3NS8 A;  3CMM B;  1R4N I;  4FLH A;  3DVN U;  2Z59 B;  1ACA A;  2WX0 A;  1RAX A;  2MA9 B;  2FCS A;  2MDX A;  3N32 A;  4D0N B;  4E3C A;  4BBN C;  2FCQ A;  2JF5 A;  2DHI A;  1E7V A;  4AJW A;  1OQY A;  2J0J A;  1GUA B;  3PZD A;  3ZO5 B;  5KQ1 A;  4BKS D;  2RGN B;  2JZ3 B;  4FAD A;  1SE9 A;  4W9J A;  4G11 A;  5C23 A;  3UF8 A;  3VH4 B;  3Q3F A;  2OJR A;  1WJ4 A;  4ICV A;  4FBJ B;  4DBG A;  3TW1 A;  4MY6 A;  2N4F A;  4NQL B;  2D9X A;  2LYD A;  1X1M A;  4DK5 A;  2Z0E B;  3SU8 X;  4N9F 4;  3DXE A;  4PYZ A;  2MWN B;  2ADZ A;  5C1Z A;  4DXA B;  2ZZP B;  3A33 B;  3P6A A;  4BVU C;  1V86 A;  1HBK A;  2DZI A;  4PS7 A;  2ZEQ A;  4DX8 A;  4ASW C;  4I6L B;  2KAN A;  2OOB B;  2VKI A;  1XQQ A;  1XD4 A;  4HJK A;  4AWJ A;  4CYE A;  3S2A A;  5DI9 B;  2XBB C;  1U5F A;  4IOY X;  1WGR A;  3CIK A;  2DZJ A;  1OQN A;  1WJM A;  4P7I A;  4WWO A;  5DHF B;  2NBU A;  2D9V A;  1M94 A;  3LJU X;  3QK0 A;  2G3Q B;  4GB9 A;  4ANU A;  1WJN A;  3VH3 B;  2X18 A;  3P2B A;  2XEW A;  4DX9 0;  4K7U A;  2JWZ A;  2MSE D;  2C9W B;  3L17 A;  1KOT A;  3A9K B;  3RD2 A;  2I5C A;  3GYP A;  2CHZ A;  3DCG A;  1P3Q U;  4BKS A;  2D9W A;  3F0W A;  2N7D A;  5KHQ A;  4W9K A;  3UGB B;  2PE9 A;  1W1G A;  1GNU A;  5L83 A;  4MJS A;  1XX0 A;  1E8W A;  1WXV A;  3A9J A;  2D07 B;  2DZK A;  3K9P B;  4IWP A;  4EZK A;  5CX3 A;  5HKH A;  3D8D A;  2RPQ A;  1CMX B;  2BF8 B;  5CLL B;  3C0R B;  2EMT A;  3QWM A;  4WQO B;  4EUT A;  1JRU A;  1Q1O A;  5J18 A;  4AJY B;  3U30 A;  2L00 B;  2M38 A;  4HB4 B;  5JHA A;  2LUE A;  1L2N A;  3SD5 A;  4FHJ A;  2M8S A;  3V5W A;  3PS6 A;  2KN5 A;  5JLJ B;  3ODO A;  3RT3 B;  5D2M B;  2KO3 A;  4NSW A;  3V61 A;  2L8J A;  5GMV A;  2G35 A;  2K6Q A;  4B95 A;  4MGK E;  2DKP A;  2JXX A;  1GC7 A;  4AP4 C;  4IM2 A;  4NNJ B;  1HE8 A;  4GOC A;  3WIM A;  2P0H A;  5KHO A;  1OEY J;  4ZRJ A;  2IO1 B;  1G6J A;  2ZPN A;  2XQN M;  3A4S C;  2CS4 A;  2LVO A;  3QA8 A;  1P0R A;  1EF1 A;  4BKG A;  3ZNZ B;  4TQ1 A;  5CHW A;  1LM8 B;  1YD8 U;  3RZW C;  4HB0 B;  1DYN A;  2VRW B;  2FJL A;  3DDC B;  1WGQ A;  3ECI A;  3PRM B;  2L2I A;  4B6H A;  5IA7 A;  3W1Y A;  1WE7 A;  3FP5 A;  2CAY A;  3HK0 A;  2JPH A;  2UWQ A;  2IFS A;  5BO4 B;  1FGY A;  4C0A A;  1U2B A;  2MBE A;  4IWO A;  4GMV A;  3PG7 A;  3N3K B;  4W9C A;  1X11 A;  3EPY A;  2MP2 B;  3U8Z A;  3PPA A;  2ASQ A;  2I1J A;  2QKM A;  4FUL A;  4IWQ A;  1WF9 A;  1WJ1 A;  3KY9 A;  2KJ6 A;  2KD0 A;  4WJN A;  1KJT A;  2Y8G A;  4IG7 B;  2KDE B;  2YS5 A;  3DQV A;  4W9G A;  3L13 A;  5E6P A;  4HVB A;  2LBB A;  1P6S A;  2K1F A;  2KOX A;  3DOW A;  1NU2 A;  1YX5 B;  2K6D B;  2LD9 A;  4W9L A;  1WJ6 A;  1VCB A;  1FHW A;  2UZR A;  4K7S A;  4FJV B;  3WAL A;  2IYD B;  2G4S A;  1J8C A;  5JHB A;  2D9Z A;  1X86 A;  2L76 A;  3Q3J A;  4HB3 B;  3A9K A;  1XT9 B;  2CQU A;  3QBV B;  1UNQ A;  5J3Q A;  2GBK A;  1EVH A;  1K8R B;  4TUU A;  4HAU B;  2DAJ A;  4IUM B;  2LWP A;  1WJU A;  2FID A;  3TL5 A;  2MBB B;  4FJY A;  2MFQ A;  1M7E A;  1E8Z A;  2D9Y A;  1Q5W B;  4BOZ B;  3D8F A;  4GU2 A;  5JH5 C;  4PS8 A;  1MK7 B;  1H4R A;  2FCM A;  4GPT B;  4K17 A;  3CST A;  3KW5 B;  1XOD A;  2RD0 A;  2JRH A;  3ML8 A;  5J3Y A;  3NSU A;  2CR5 A;  2RQ1 A;  2YS3 A; 
#chains in the Genus database with same CATH topology
 2EC1 A;  4IKG A;  3RNG C;  3NWA A;  1MJD A;  2H7D A;  1L0X B;  4N6E B;  4EFO A;  3DHH C;  3VOQ A;  5FK9 C;  2IGG A;  3EA6 A;  3AED B;  2ZW1 A;  3SNH A;  4WJP A;  2E3T A;  3DVG X;  4HJG E;  2KK8 A;  4NAW B;  3NVZ A;  1E10 A;  1DDW A;  1RLF A;  2CY4 A;  1JWU D;  3ETR A;  4Y94 A;  1ZXH A;  1TBE A;  1WYG A;  1GB4 A;  2ELB A;  1FM0 D;  2WU2 B;  4FHK A;  3W1S A;  3DBL I;  3RNF C;  2FAZ A;  3P4S B;  1WZ0 A;  2R82 A;  4NY0 A;  2YS1 A;  2OJW A;  5J2R A;  4BBN F;  2M17 A;  1PGB A;  4ZHP A;  5D3W A;  4JK9 A;  3KRX A;  1EUV B;  2REX A;  2EKI A;  2MW5 A;  4L2Y A;  1FFU A;  2LGY A;  1NVI D;  1U4A A;  1E90 A;  3D8E A;  3ZVV A;  3ML9 A;  3DXC A;  2KCJ A;  1L6V A;  2KDF B;  2Q5W D;  4JGH B;  3V6C B;  2COD A;  3SR6 A;  1WGG A;  2EKE C;  3NWD A;  2BYE A;  3H7S A;  3TFM A;  5D3Y A;  1RRB A;  3GE3 C;  3MPX A;  2RDH A;  5JXV A;  2D2Q A;  2LXC A;  4Z2N A;  3CSF A;  4ZOH C;  2WDR B;  1XLO A;  2M4N A;  1I4R A;  3H8H A;  4IW0 A;  2DHK A;  1ZPS A;  1VJK A;  1ZC3 B;  3FVC A;  1U5E A;  4OZC A;  1Z2M A;  3HQC A;  2K49 A;  2IPK D;  4QXA B;  1PQS A;  2KLG A;  2V76 A;  3NJT A;  3JW0 X;  4EZJ A;  2LRW A;  4XDD A;  2B76 B;  1K5G B;  2WDT B;  2Z0Q A;  3FLV A;  5EFX A;  1TGZ B;  3L0W B;  2NS5 A;  1V1P A;  1OMW A;  3M3J A;  1WX8 A;  1T0Y A;  4A6F B;  3UZT A;  1V88 A;  1E8Y A;  2K39 A;  4GDL B;  4JL9 A;  2RNR B;  3RPF C;  3IG3 A;  1E0Z A;  3AXC A;  4XWX A;  4LK0 M;  3LXF A;  3EHV A;  2Y3A A;  1MPH A;  4H8S A;  3LJ3 A;  4JLC A;  1XD3 B;  4NAM A;  2KTR B;  2TSS A;  2YLM A;  3ZDT A;  4W9I A;  3X23 A;  4D2K A;  2GB1 A;  2KWV B;  1KF6 B;  2ICI A;  3E56 A;  2YSZ A;  4CHJ A;  1EO6 A;  2I2Y A;  3EC8 A;  2M1M A;  1U5D A;  3OG5 A;  3H7P B;  2JRI B;  1MI1 A;  1D6E C;  1SGH A;  2V3S A;  3I3T B;  2LOZ A;  2I38 A;  1NDD A;  5C3J B;  2BCJ A;  3SUZ A;  2N23 A;  4DXF A;  3QC8 B;  3T06 A;  1WMH B;  1MHX A;  4YWG G;  2G1E A;  2K3U A;  4RFB A;  2PE6 B;  3FAH A;  2W9N A;  1BT0 A;  1RFK A;  4KIK B;  3DBR I;  2MEK A;  2K0P A;  3VAW A;  3T8M A;  1I4X A;  2GS0 A;  3HRD D;  5DIF B;  3U7D A;  2R0D A;  2D11 A;  2G4D B;  5HE2 A;  3SFE B;  4EEW A;  2K2J A;  5LON B;  3AE2 B;  4K3C A;  2MKR A;  2NMB A;  1F0Z A;  2DAF A;  1D5X C;  3FKY A;  2RR9 A;  5LNK 1;  2LFI A;  3PV1 A;  2UYZ B;  3VHT C;  2K8E A;  1XKE A;  2A4Z A;  1U29 A;  1C78 A;  5CTR C;  3RMK C;  2KT7 A;  4B6W A;  1C4P A;  4RMA A;  2KWU B;  1DOX A;  2E6X A;  4WWM A;  3G9W A;  1NBF C;  1LGR A;  3VIA A;  2YVC A;  3PSE B;  1VLB A;  4KGT A;  4RF1 A;  5EE3 A;  3A1Q A;  2V4L A;  3RCZ A;  1SHC A;  4HAT B;  1DOY A;  5FR3 A;  1Z5S B;  1OTR B;  3ULC A;  2KX0 A;  2KQ7 A;  2QIE B;  4K2P A;  1E5W A;  2O6V B;  5DPW A;  1RYJ A;  1DIK A;  2J0K A;  5HFY A;  4MEL A;  1V5U A;  3O96 A;  2CHX A;  4LNO A;  2KDI A;  4C80 A;  2BYV E;  1NTI A;  1VDV A;  1I4G A;  4CHM A;  3ZDM C;  1WY8 A;  3H9D A;  3ZXV A;  2C7H A;  3A8P A;  2KFJ A;  3Q2A C;  1N63 A;  3IFW B;  1KC7 A;  2BT6 A;  2ZJD A;  4NAW A;  4F7H A;  3SDL C;  1WWT A;  2IDY A;  4JKH A;  1WG7 A;  2LZ6 A;  3PLU A;  1Z87 A;  1WIA A;  4HAZ B;  2KXJ A;  5H92 C;  1U5G A;  2K22 A;  4KKJ A;  3RZF A;  2KZR A;  2DFK A;  4ANV A;  1L4D B;  5IAA C;  1X05 A;  3RI7 C;  4BBK A;  2DYB A;  4LNK A;  3VTW A;  1ZC4 B;  2PVO D;  2MRP A;  2VH1 A;  3DXD A;  4MM3 B;  1R7S A;  2H88 B;  4KSK C;  1UGJ A;  2PVG C;  3OJ4 B;  4OW0 A;  1UUP A;  2WXH A;  2ZW0 A;  2MQJ A;  1I2H A;  1CK1 A;  1MFW A;  4P1B C;  1V5O A;  1AAR A;  1DBH A;  4GZU A;  1OY2 A;  1LXD A;  1NVL A;  5C5B A;  3EFU A;  4EE2 A;  1KH0 A;  4KVG B;  2YF0 A;  3MP9 A;  2W2X C;  5JHG A;  1TYG B;  4AOF A;  2AQ2 B;  2C7M B;  4JQW C;  1V6E A;  1NEN B;  5DPS A;  3MJW A;  1V2Y A;  4WWN A;  2DYM A;  1N6Z A;  3V3X A;  2FIF A;  5CLQ B;  2KKC A;  1WXM A;  2HE7 A;  2X38 A;  3N1Z C;  3ZVR A;  1GG3 A;  3QHT A;  2DN6 A;  1QOB A;  2I5F A;  5TR5 A;  2LVQ A;  1VRA B;  1IYF A;  3AU4 A;  3EEC A;  2Z0D B;  2O6V D;  2RGF A;  5G5G A;  1Y19 B;  5LLI A;  3TEX A;  2BS3 B;  4HAW B;  5JVL A;  3PP2 A;  1N3H A;  4KV2 A;  2LAS A;  3ENE A;  1UNS A;  3KVF B;  4A90 A;  2WX1 A;  2VZK B;  1I4H A;  3AE7 B;  1AWE A;  1GAQ B;  3Q6B A;  2MX2 A;  2R61 A;  5LG4 B;  3NHE B;  4GDL A;  1WH3 A;  1K53 A;  1UWM A;  4WWP A;  3W5U B;  5G55 A;  2KFK B;  1I7A A;  4MT7 A;  4W9E A;  3P7Z A;  2WQY B;  2J42 A;  2KTR A;  3I5J C;  3B2G A;  3VUY A;  4WQM A;  3K9O B;  2KAC A;  1TQZ A;  2LHE A;  4WAA A;  1UZX B;  4MT5 A;  3DBS A;  2AEH A;  3BK1 A;  1I4P A;  1KM7 A;  3RNC C;  2WGS A;  2QSD A;  1FAO A;  2CRF A;  1CJE A;  2R2Q A;  2LEK A;  3TMP B;  3H7P A;  4Z2M B;  1WE6 A;  3QJZ A;  2JYT A;  3EUB 2;  4ANW A;  4TV3 A;  2GBN A;  3IBE A;  1FOE A;  2K8H A;  3VRB B;  4Q2J A;  3M63 B;  2XN9 C;  4QJ3 B;  1V61 A;  1TKE A;  3ALB A;  2ZPY A;  1TJ6 A;  5C6R A;  1J0G A;  3TVV A;  4JIO U;  1Y5O A;  5JHH A;  1D4B A;  2WXQ A;  3NZS A;  1HZ5 A;  3B2F A;  1PDX A;  4LDT D;  4I6P A;  3VUW A;  3M1I B;  3ABV B;  3Q8E A;  1JWS D;  2N9E B;  2KDB A;  4IOI E;  1ZVR A;  3KSY A;  4A20 A;  4JKE A;  1P9D U;  3LB8 C;  2ZNV C;  3FSS A;  2KDM A;  5EDS A;  1Y8R C;  3JSV B;  4NZL B;  2IJ0 A;  4MEM A;  1HZ6 A;  1BTN A;  3IAS 1;  4HDO A;  2KNB A;  4IM3 A;  2M19 A;  2N7J A;  2QMT A;  2K8C A;  2CU1 A;  3T3N A;  2KIG A;  3WYF B;  2L0F A;  1WGU A;  3FM8 C;  1BTK A;  3QQ8 B;  1GOZ A;  1UD7 A;  1FO4 A;  2ZCC A;  1E7P B;  5JZE B;  3HVZ A;  4M8M A;  4XWW A;  1L6U A;  1FNU A;  5DCN A;  3P4Q B;  4XDC A;  3RNB C;  2FUH B;  2DWQ A;  4CO7 A;  4HRS A;  3TEY A;  3PHW B;  2WWZ A;  2KN4 A;  2N9X A;  2WLB A;  2HTH B;  5LXH A;  1NYQ A;  2GOW A;  3PHX B;  2D3B A;  1C1Y B;  1V80 A;  3R7Q A;  5LXI B;  2CJO A;  3RYT A;  1WX7 A;  1ET6 A;  3OJ3 A;  1P7E A;  3BII D;  3SV1 A;  2QIL A;  4F1S A;  4GLS C;  4PNK A;  2NR2 A;  1SSN A;  2NBV B;  1ZYI A;  3PRZ A;  4A3P A;  4A6Q A;  4GOU A;  1ROE A;  1E9M A;  4GDK B;  2XK5 B;  2K00 A;  1V5P A;  1S3S G;  3AE5 B;  1YIW A;  4DHZ E;  1VBG A;  2LUL A;  3OLM D;  1J19 A;  2INC C;  3NZU A;  2N9P C;  2RRF A;  3TIX A;  2GRI A;  4MM3 A;  2Z8L A;  5BMH A;  2N1V A;  4YL8 A;  4II2 B;  4NQK E;  1BAK A;  3KWV A;  4HPM B;  2RUK B;  5HE0 A;  3ZIM A;  4ILJ A;  1WGY A;  2N9L A;  2Z0P A;  1FB8 A;  4HB2 B;  3NUH B;  4US9 A;  4A55 A;  4HDQ A;  4BOS C;  3WAO A;  3SFD B;  1FCL A;  4YON A;  1WI0 A;  2W2W A;  1KRH A;  1LB1 A;  3APC A;  2GI9 A;  3WCQ A;  3BVZ A;  4DHZ B;  4KDI C;  4F7G A;  3NY5 A;  3E9L A;  4XWT A;  1ZE3 D;  1NI3 A;  3NVW A;  1LW3 A;  1E8X A;  2C60 A;  1UEF A;  3DHG C;  3SEB A;  1X1G A;  3VFK A;  3Q14 C;  3D32 A;  5HE1 A;  5I2M A;  2J0M A;  2BWE S;  2Y8F A;  4GNK B;  4WJQ A;  4KHA A;  4HK2 A;  1JRP A;  1N60 A;  1YQB A;  3NW8 A;  2J4X A;  2BB6 A;  3SBG A;  5D7G A;  2LKO A;  1FHO A;  3PGE A;  4MAC A;  3P4R B;  3IHP C;  2COF A;  5KCV A;  3KZ1 A;  2GUM A;  2GBJ A;  1PGA A;  4ZDV A;  4L6E A;  4OZA A;  1GJZ A;  1GB1 A;  4TKN A;  4ANX A;  4EKU A;  2DX1 A;  3KRW A;  5C16 A;  2RVB B;  2RLO A;  4IAP A;  2KFK A;  1WXS A;  1XO3 A;  2QKL A;  2BBC A;  5BYQ A;  1PFD A;  2MLB A;  3R2T A;  3E9O A;  1FCC C;  1GGO A;  1D5M C;  1S1Q B;  2HJ8 A;  4YSX B;  2KJH B;  5D27 A;  2AWT A;  2IY1 B;  4KAX B;  2WXO A;  3ZNG C;  4DIX A;  1Q10 A;  2BWF A;  3PVW A;  2L1C A;  4JK7 A;  3DPD A;  2KUP A;  1XLN A;  4A6H A;  4MH8 A;  1B1Z A;  2A5U A;  1QC6 A;  2K2U A;  4CHK A;  1D3Z A;  4RM8 A;  2PPH A;  1FFV A;  4OT1 A;  3L54 A;  1ZP0 B;  2IO3 B;  3AJ4 A;  3KUZ A;  4YT0 B;  4EOY A;  2RSG A;  2IY0 B;  2W2X D;  3V62 A;  2B3A A;  1W1H A;  1ESF A;  4GXB A;  3JYU A;  2RPV A;  1QF6 A;  4J3O D;  4MSM B;  1T6B X;  4MDK E;  1YX6 B;  3H1U A;  2M14 A;  2AYO B;  4PYU A;  4BFR A;  2PJH A;  4M0W B;  2DHJ A;  1WR6 E;  2CKH B;  2JWU A;  2L0T A;  2FJU B;  3AM9 A;  4GGQ A;  1TJE A;  2IBI B;  4ACF A;  2JU6 X;  2Z0O A;  3MHS D;  4L1B A;  4ZHO A;  1UNR A;  1FRD A;  3ZNI D;  2MBO A;  4WAF A;  3AEC B;  2WS3 B;  1WYW B;  2IYB A;  4ICU A;  3MFG A;  1EU4 A;  5D3V A;  3KYD D;  2KC1 A;  3JSV A;  1A5R A;  3LDZ E;  2DX5 B;  4UDU C;  5AUI A;  1SB3 C;  1XLQ A;  2N0S B;  3RFZ B;  1T3Q A;  2IO2 B;  4FXC A;  1YNT E;  1YJJ A;  1F9J A;  3KYC D;  5C79 A;  2WDQ B;  1ST7 A;  2DEN B;  5GOW B;  1VZ7 A;  3ZKJ C;  4PK1 A;  4KHO A;  4HXD A;  1RM6 C;  1DYQ A;  1R4M I;  3T3O A;  1MAI A;  2DZM A;  4JE3 B;  1M7R A;  4DBB A;  3P42 A;  1V9J A;  3PEG A;  2RDB C;  2DYN A;  4MGY E;  2MP2 A;  1FMA D;  2FCN A;  2Z13 A;  2SEB D;  2W82 A;  1K52 A;  2HTH A;  4MSQ B;  2M56 B;  5E6N A;  4EJN A;  2RSU A;  4LNN A;  5GXG B;  2C7N B;  5CHV C;  4X57 B;  2V1Y A;  1XR0 B;  1F2R C;  2IO0 B;  3I57 A;  4RH6 A;  2D3G A;  3RUI B;  1BXT A;  2EJ8 A;  2RDG A;  4KKI A;  1MVK A;  2D3A A;  1DOI A;  2LHD A;  4FN2 A;  2P0D A;  2LGD A;  3DVG Y;  4YSY B;  2WDV B;  1BUI C;  5J17 A;  1RRP B;  1LFD A;  2BKR B;  2NBV A;  3PRE A;  1UWX A;  1SJE D;  1XCQ L;  4GDK A;  2XK5 A;  5EE0 A;  4HHV A;  1ZSQ A;  1F77 A;  5EE1 A;  1FPY A;  1UPQ A;  2QCZ A;  3EFC A;  3GP7 A;  4DXG A;  2GMI C;  5D3X A;  5DH9 B;  3OWE B;  4NPN A;  1SE3 A;  2WNM A;  3ZTD A;  3MDB C;  3V60 A;  2W3R A;  4EMO A;  2GCJ A;  2JT4 B;  4DWF A;  1EF5 A;  1FGZ A;  2FBW B;  3A8Q A;  2ABD A;  1PFJ A;  1ET9 A;  1AW7 A;  5E6O A;  3B77 A;  4W9F A;  3P4P B;  2BKF A;  3W1S C;  4ZYS A;  3IAM 1;  3AE9 B;  5L95 C;  4ITK A;  1MG8 A;  3IVF A;  4JWU C;  1QT9 A;  1HB8 A;  1OQQ A;  5HI1 A;  3BWU D;  5C2T B;  4JWS C;  5J3T A;  1HTO A;  4CSQ A;  4K2O A;  2GBR A;  1IBX B;  5BYR A;  4CQN A;  2P8V A;  4URK A;  2N7E A;  1IPG A;  2Y7B A;  3AE4 B;  4NJC A;  2NTS A;  1UPR A;  1QOA A;  2M0X A;  2KQS A;  3LYY A;  1SE2 A;  2D10 A;  1TKG A;  3Q8A A;  4JKF A;  3U4E G;  4DHJ B;  3ZJT A;  4RGO S;  3ENB A;  3HM3 A;  1XLP A;  3KUC B;  5L81 A;  1WX9 A;  4OVU A;  5CHF A;  4S17 A;  3ODX A;  3WAP A;  3CXB B;  3JVZ X;  4LNI A;  5DHA B;  1IGC A;  4XGA B;  3PVL A;  2Y5B B;  1PGX A;  4XYC A;  3R66 C;  4PS3 A;  5I2S A;  4GN1 A;  3AN1 A;  3PSC A;  4GIV A;  4TSS A;  5IN7 A;  3B9J A;  2NZ8 B;  2N0Y A;  1UNP A;  1E6E B;  2WP9 B;  4K81 A;  3Q8C A;  3CIR B;  2ACZ B;  1GPX A;  1WRD B;  1ZKH A;  4B9K A;  1DDM A;  2NVU I;  1K50 A;  1RFA A;  1TY2 A;  4BKT A;  4EZL A;  1TXD A;  4JX1 C;  3ZNH B;  1UBI A;  4AS1 A;  3AV8 A;  3DWM A;  2R09 A;  2NCN A;  3NOB A;  1KZ7 A;  2VSZ A;  3GE8 C;  1XXG A;  4K1R B;  2KTF A;  2MWS B;  1AN8 A;  1UGM A;  5FI1 A;  2L3Z A;  1ACC A;  1U27 A;  2VH2 A;  3SHQ A;  4A3O A;  4AQ7 A;  1WRI A;  2HTM E;  3AI5 A;  3NS1 A;  1NTY A;  1GC6 A;  2L52 A;  1WM3 A;  4R3D A;  2BYT A;  2DLB A;  4AUQ C;  2LG1 A;  1SF0 A;  1NI2 A;  1I42 A;  2LI5 A;  2Y5P A;  3HM6 X;  3L10 B;  2JQR B;  3SO6 A;  2KGX B;  2ROZ B;  1ZUD 2;  1DGJ A;  2COA A;  3GYO A;  4HEA 1;  2COC A;  2UZS A;  3A58 A;  3TO1 A;  3V6E B;  1J7C A;  2KHW B;  2EMS A;  2KC2 A;  2QC8 A;  2QHO A;  3AB5 A;  1M4V A;  3M62 B;  2L05 A;  1I35 A;  1TT5 B;  1C3T A;  3AE3 B;  4JKD A;  1T0S C;  2CU3 A;  1B55 A;  2DX5 A;  4DHJ D;  4E74 A;  2YT0 A;  2DYO A;  1FXI A;  1J0W A;  4USA A;  4LDT B;  1YQ3 B;  3ZLZ A;  1T0Q C;  1KLU D;  3I63 C;  3KQ4 A;  4N59 A;  4WUR A;  4F7Z A;  1L7Y A;  3U7Z A;  2DYQ A;  3BK2 A;  4OHJ A;  1L0V B;  1ZM0 A;  3OAN A;  3KH0 A;  4OSN A;  2C5L C;  1NEK B;  4RCO A;  1I7H A;  1H10 A;  1VR9 A;  4A8X C;  3RCP A;  1V89 A;  3RUL A;  2L32 A;  2JZZ A;  4L1R A;  3W5V B;  4A6F A;  2MCN B;  1WZ3 A;  2IND C;  4ZRK A;  1YOV B;  1E7U A;  4M8N A;  2BS2 B;  4MGI E;  3UIO B;  2I1K A;  4H2A A;  3A98 B;  1C76 A;  3UIP B;  2V0G A;  5AZF A;  4A5K A;  2CY5 A;  3BJI A;  1KBL A;  3QAR A;  3AE1 B;  4FJZ A;  3UQB A;  1TS5 A;  3E66 A;  2DA0 A;  4XE0 A;  4HAY B;  3H6N A;  3WAN A;  1I4Q A;  2KMA A;  2LJI A;  4HCP B;  3VRA B;  1Q0W B;  1JW9 D;  2ZKM X;  1ZDV A;  4LJP B;  2DTC A;  1UH6 A;  2N1W A;  1W1D A;  2LGS A;  1WMH A;  1PMS A;  3DBH I;  4XZ4 A;  3VQI A;  5DPR A;  4DDI D;  1P3R A;  5DPT A;  4F8C B;  1SXT A;  3IT6 B;  4WJO A;  4KIK A;  4TMA B;  4OVZ A;  4O1N A;  2FDQ A;  5FKA C;  3N30 A;  2BVC A;  3L16 A;  1KTK A;  1BWN A;  2K9X A;  2LMC A;  3N7C A;  2ZCB A;  5I4D A;  4GSW A;  2FJ9 A;  3EGR A;  3BYT B;  5BYS A;  1YN4 A;  4FA6 A;  1STE A;  4KHB B;  1WGD A;  2WYQ A;  3TSS A;  4KSL C;  3FIL B;  1HA5 A;  3BY4 B;  1OFF A;  3TEZ A;  2QEJ C;  2MBH A;  3E9S A;  4WJ7 A;  1IBX A;  1V81 A;  5D94 A;  2COP A;  3FC4 A;  2YT1 A;  1SBB B;  4KX6 B;  3GZN I;  1FNV A;  1IUE A;  4HPL B;  1UEL A;  2LJ5 A;  3PZ8 A;  1FXA A;  3ONS A;  2V3N A;  3KLS X;  1EWY C;  2PEA A;  4HAX B;  4WVF B;  3ZRF A;  2FE8 A;  1PYW D;  2OQB A;  3APF A;  4XX5 A;  4IM0 A;  2O6V A;  2ZVO A;  1OEY A;  3VTU A;  1WM2 A;  1IGD A;  4BAX A;  4HKQ A;  2AL6 A;  2O2V B;  2JUO A;  4HPP A;  1FEH A;  4ZYN A;  2W54 A;  1UBQ A;  2H7E A;  3AEF B;  3AEG B;  2GBM A;  3PTF C;  2BGF A;  3RNA C;  3GOE A;  1FXT B;  2PLP A;  4TQ0 A;  4JKG B;  3DCX A;  2KMM A;  5M4Y B;  3T9L A;  1QZE A;  2KAJ A;  1WSP A;  3HIZ A;  2MBQ A;  1K5D B;  5D6J B;  2KWC A;  3FEH A;  2LXA A;  1AYF A;  1MG4 A;  4K3B A;  3UIN B;  1KLV A;  3NWF A;  1IP9 A;  3L4P A;  3A4R A;  5IJM A;  2WH5 A;  3ML4 A;  4G0N B;  2G45 B;  3X0W A;  3RNE C;  4TYZ A;  1N62 A;  1PLS A;  4KZ0 A;  1R4M B;  3Q3O C;  2IGD A;  5AUK A;  3HIE A;  1RJ2 A;  2Q13 A;  2NPT B;  2IGH A;  3AE8 B;  1EGX A;  1D5Z C;  3PLV A;  2JX5 A;  2QJL A;  4KDL B;  4F7U P;  1TIF A;  2GJY A;  5KQ4 A;  3PO0 A;  3BIN A;  4IC7 B;  5IKC M;  4K7W A;  3DVN V;  1IRS A;  2KJR A;  2YRY A;  3O13 A;  1YJ1 A;  2GCL A;  2GLS A;  2WHI A;  4C7Y A;  1N61 A;  3QAQ A;  2R2O A;  4RGM A;  1N5X A;  2KVZ A;  1WGH A;  4HKZ E;  1MKE A;  1VD2 A;  4MGZ E;  3PT2 B;  3APD A;  5D3D A;  4US8 A;  3O65 B;  2BPS A;  2WXJ A;  4J6I A;  1XCG A;  3ODW A;  1TZ1 A;  3QX1 A;  3B08 A;  3MC8 A;  4G50 A;  3WAM A;  2KYW A;  4GMX B;  4HRO A;  1FD6 A;  1NTV A;  4W9H A;  3AE6 B;  4YSZ B;  1P98 A;  1FRR A;  3V05 A;  1KZG A;  1V5M A;  4XC2 A;  2FNJ B;  3BYY B;  2P0F A;  3BVG A;  4II3 B;  4DDG D;  3NRZ A;  2PZ1 A;  2JY6 A;  3M95 A;  1QQG A;  1TTN A;  4JKB A;  1OQR A;  3PRP B;  4HWI B;  3AUL A;  2KVR A;  5JP4 A;  3ULB A;  4IFS A;  1ZW7 A;  3URY A;  4B0M A;  2DLW A;  3PZ7 A;  1V8C A;  2KX3 A;  1CQV A;  3VVW B;  3TBL D;  2DBY A;  2JP2 A;  1HB6 A;  2DKQ A;  3IT4 B;  4P1C C;  3DWG C;  2CHW A;  4HSI A;  2OTX A;  2DIK A;  3B1L X;  2DHZ A;  3VUX A;  1P5T A;  3CWI A;  1MIX A;  4WIP A;  5AEK B;  1WVH A;  3A1Q B;  5IO9 A;  3ZTC A;  2WXP A;  1XF5 L;  2LVP A;  1ZGU B;  3VTV A;  2UVM A;  1TS3 A;  2BYF A;  2KMC A;  3OAW A;  4A6K A;  1DDV A;  2KLC A;  1JCK B;  3UI3 A;  2LGX A;  3VDZ A;  1MIZ B;  1B9R A;  5HE3 A;  3ZQ4 A;  2D4Q A;  4G3X B;  1DRO A;  4JPS A;  1AQC A;  4OVV A;  1MK9 B;  5IOI A;  3QWZ B;  2LOX A;  1OGW A;  2SAK A;  1QOG A;  1LQB A;  2K8B A;  2UU7 A;  1QOF A;  2WXI A;  1AWD A;  3AH7 A;  2JYE A;  4HCN B;  4JKC A;  3CF6 E;  1V5T A;  4QAY A;  5G2N A;  4W9D A;  4RGN A;  2K5P A;  3TJP A;  2JVC A;  4RM9 A;  3F5R A;  4YXD B;  4MH0 E;  4NJ6 A;  3UQA A;  2AL3 A;  4YTP B;  2N9K A;  3AU5 A;  4KHB A;  3ZRC A;  1V49 A;  3TCA A;  2CB8 A;  5LOP B;  4QJ5 B;  2WXR A;  3FIL A;  2ZNV B;  4WSF A;  1EAZ A;  2K25 A;  4JK8 A;  4ZRQ A;  1WI1 A;  4HAV B;  2V3P A;  1PUT A;  3QCA A;  4HLE A;  4YTN B;  2Z4D A;  3VXW A;  2LUM A;  2WXG A;  1ISN A;  4KGR A;  1WXA A;  5C5B B;  1T5X D;  1X1F A;  2HD5 B;  1C9F A;  1KI1 B;  2L7R A;  4JKA A;  3ZUN A;  1UF0 A;  3MTN B;  2ONQ A;  1RWS A;  1FNW A;  1P1A A;  1HXY D;  3ZW3 A;  1SIF A;  1VZ6 A;  4NJ7 A;  3AEA B;  3QIJ A;  4E71 A;  4PT5 A;  4I6N B;  2O2V A;  3PVU A;  2RMM A;  4KZC A;  4MK0 A;  5FR6 A;  4LJO B;  3HW2 B;  2J52 A;  3AMZ A;  5AZG A;  4PQ0 A;  1Q67 A;  1H8C A;  4MJS B;  4ZRI A;  3R3M A;  3SYX A;  2FUG 1;  1Y56 A;  2J7Q B;  1F52 A;  3A9J B;  2AX5 A;  4JKG A;  2E2X A;  3KUD B;  3B0A A;  3L08 A;  3C19 A;  2ROV A;  3ZJU A;  2ZVN A;  1BML C;  3ZGZ A;  2LRU A;  2D3C A;  2Z14 A;  4RGT A;  2HRJ A;  2J59 M;  5FI0 A;  3I9V 1;  3Q69 A;  1YJI A;  1WFY A;  2D5G A;  2MJD A;  2WXK A;  1JQ4 A;  3U52 E;  3HHM A;  3R7R A;  1FIQ A;  4OZB A;  2NPT A;  2NBW B;  3NVV A;  3WA0 A;  1FHX A;  2W3S A;  2VRR B;  3MC9 A;  2IZV B;  4LCD E;  2ON8 A;  1WR1 A;  2ELA A;  5AZH A;  5HHD G;  3NS8 A;  3CMM B;  2MJ3 A;  1R4N I;  4FLH A;  3DVN U;  3J9C A;  2Z59 B;  1F1H A;  1ACA A;  2WXM A;  1C77 A;  1HQR D;  2WX0 A;  1RAX A;  2MA9 B;  3N1Y C;  2FCS A;  1EU3 A;  2MDX A;  3N32 A;  4D0N B;  2L83 A;  4ZRP A;  4E3C A;  3N9Y C;  4BBN C;  2FCQ A;  1T0R C;  2JF5 A;  2DHI A;  1L5P A;  1TY0 A;  1E7V A;  4AJW A;  1OQY A;  2J0J A;  1GUA B;  3PZD A;  3ZO5 B;  5KQ1 A;  4BKS D;  2RGN B;  2JZ3 B;  1KLG D;  2W55 A;  3DBH B;  1J7A A;  1SE9 A;  4W9J A;  4G11 A;  4FAD A;  2CJN A;  5C23 A;  3UF8 A;  3VH4 B;  1V1O A;  3Q3F A;  2OJR A;  1MPE A;  3R2I A;  1WJ4 A;  4ICV A;  4FBJ B;  4DBG A;  3TW1 A;  4MY6 A;  2N4F A;  4NQL B;  2D9X A;  3ZJV A;  2LYD A;  1X1M A;  4C4V B;  4DK5 A;  2Z0E B;  3SU8 X;  3Q3M C;  4N9F 4;  3DXE A;  4PYZ A;  3P1M A;  2OED A;  1SEB D;  4KGS A;  2MWN B;  4B0E A;  2PW9 A;  2ADZ A;  5C1Z A;  2YEP B;  4DXA B;  3N20 C;  5BMG A;  2ZZP B;  3A33 B;  2G9H D;  3P6A A;  4BVU C;  1SJH D;  1V86 A;  3BVM A;  1HBK A;  2YT2 A;  2DZI A;  3GZN B;  1EM7 A;  4PS7 A;  2ZEQ A;  4DX8 A;  2INP E;  4ASW C;  1JML A;  4I6L B;  2KAN A;  1N5W A;  1KFY B;  2OOB B;  4WH4 A;  2VKI A;  1ZXI A;  1XQQ A;  1LO5 D;  1XD4 A;  4HJK A;  4AWJ A;  4CYE A;  3TUO A;  3S2A A;  1C4C A;  1XEE A;  5DI9 B;  3ZYY X;  3SBT A;  1QLB B;  2XBB C;  2WXN A;  3AEB B;  4M0W A;  1U5F A;  2HJ1 A;  1JAL A;  4IOY X;  2NTT A;  2H89 B;  1WGR A;  3CIK A;  2DZJ A;  1OQN A;  1WJM A;  4P7I A;  1TZO A;  4WWO A;  4DQO C;  5DHF B;  2NBU A;  2D9V A;  1M94 A;  3LJU X;  3QK0 A;  1MI0 A;  2G3Q B;  2MHJ A;  4GB9 A;  4ANU A;  1WJN A;  3VH3 B;  2X18 A;  1TKY A;  3BZD B;  2BTE A;  3P2B A;  2XEW A;  4DX9 0;  4K7U A;  2JWZ A;  2MSE D;  2J53 A;  1JWB D;  2C9W B;  4C00 A;  3L17 A;  1KOT A;  3A9K B;  3DHI C;  2WU5 B;  3RD2 A;  2I5C A;  3ZXR A;  1ZDX A;  3GYP A;  2CHZ A;  3DCG A;  1P3Q U;  2KQ4 X;  2PKO A;  4BKS A;  2D9W A;  1CZP A;  3F0W A;  2KUQ A;  2N7D A;  5KHQ A;  4W9K A;  3IXS A;  1L4Z B;  4C56 C;  3UGB B;  4RNA A;  5MPO A;  1P7F A;  2PE9 A;  3GB1 A;  1JWA D;  1W1G A;  1QKZ A;  1GNU A;  3NZ3 A;  5L83 A;  4MJS A;  1XX0 A;  5TSS A;  3Q8F A;  4M00 A;  1ENF A;  1E8W A;  2X0S A;  1WXV A;  3A9J A;  2D07 B;  2DZK A;  3K9P B;  4IWP A;  5HG2 A;  4EZK A;  5CX3 A;  5HKH A;  3D8D A;  5D3I B;  4LTU A;  3HSA A;  2RPQ A;  1CMX B;  2BF8 B;  2BQQ A;  4BZA A;  1YN5 A;  5CLL B;  3C0R B;  4LLG M;  2EMT A;  3QWM A;  1K51 A;  5IP4 D;  4WQO B;  4EUT A;  1JRU A;  1Q1O A;  3GS2 A;  2KWD A;  4N58 A;  4AJY B;  5J18 A;  3U30 A;  2L00 B;  2M38 A;  4HB4 B;  5JHA A;  2LUE A;  1L2N A;  4D6W A;  2OHF A;  3SD5 A;  5G5H A;  4FHJ A;  1C4A A;  4ARC A;  2M8S A;  3W2D A;  3V5W A;  3PS6 A;  2KN5 A;  5JLJ B;  3ODO A;  4ILH A;  2JSV X;  3RT3 B;  5D2M B;  2KO3 A;  4NSW A;  3V61 A;  3NG0 A;  3HUI A;  2KR0 A;  2L8J A;  5GMV A;  2G35 A;  3W9C B;  2Z59 A;  2WXL A;  1J7B A;  1TS2 A;  2K6Q A;  4B95 A;  4MGK E;  2DKP A;  2JXX A;  1GC7 A;  4QJ4 B;  4AP4 C;  4IM2 A;  4NNJ B;  4M01 A;  1HE8 A;  4GOC A;  3WIM A;  2P0H A;  2XNA C;  5KHO A;  1OEY J;  4ZRJ A;  2IO1 B;  1XCT L;  1G6J A;  3KWL A;  2ZPN A;  2XQN M;  3A4S C;  1VBH A;  4A9A A;  4P16 A;  2CS4 A;  3MJ5 A;  2LVO A;  3QA8 A;  1P0R A;  3U2S C;  1EF1 A;  4BKG A;  3ZNZ B;  4TQ1 A;  5CHW A;  1LM8 B;  1YD8 U;  3RZW C;  4HB0 B;  1DYN A;  4REZ A;  2VRW B;  2HDE A;  2FJL A;  3DDC B;  1WGQ A;  3ECI A;  3PRM B;  2L2I A;  1QQR A;  2M0A A;  4B6H A;  3DBL B;  2X8X X;  5IA7 A;  2PIA A;  4C4V A;  2AQ3 B;  3W1Y A;  2MJE A;  4P6V F;  1WE7 A;  2VZK D;  3FP5 A;  2CAY A;  3HK0 A;  2JPH A;  2UWQ A;  2V4I B;  2IFS A;  1VZ8 A;  1SE4 A;  1HTQ A;  5BO4 B;  1FGY A;  1QIL A;  2YEP F;  4C0A A;  3VR9 B;  4C7Z A;  1U2B A;  2MBE A;  4IWO A;  2AQ1 B;  4GMV A;  3PG7 A;  3N3K B;  1TS4 A;  4W9C A;  1X11 A;  4YTM B;  3EPY A;  2QDF A;  2MP2 B;  3NVY A;  1V1P B;  3U8Z A;  2R2Y A;  3PPA A;  5H8Y E;  1WGK A;  1HEZ E;  2ASQ A;  2I1J A;  2QKM A;  4FUL A;  5EE9 A;  2MH7 A;  4IWQ A;  3R8B A;  5IRS A;  1WF9 A;  1WJ1 A;  3KY9 A;  2KJ6 A;  2KD0 A;  1JWM D;  3TEW A;  4LNF A;  4WJN A;  1KJT A;  5BMI A;  2Y8G A;  4IG7 B;  1A70 A;  2Y5C A;  2KDE B;  2WXF A;  2YS5 A;  3DQV A;  4W9G A;  3AEE B;  1V97 A;  3L13 A;  2V9H A;  4S0R A;  5E6P A;  4HVB A;  4ARI A;  1WXQ A;  2LBB A;  1P6S A;  2K1F A;  3MC0 B;  1EWC A;  2KOX A;  3DOW A;  1NU2 A;  1YX5 B;  2K6D B;  1SIJ A;  2LD9 A;  1F2R I;  4W9L A;  4IDI A;  1WJ6 A;  1YMH E;  1VCB A;  2DNF A;  1FHW A;  3P63 A;  2UZR A;  2PMV A;  4K7S A;  4FJV B;  3WAL A;  2IYD B;  3U12 A;  2G4S A;  1C79 A;  1JRO A;  1NYR A;  1J8C A;  1JDE A;  5T8I A;  4L23 A;  5JHB A;  2D9Z A;  1X86 A;  2L76 A;  3Q3J A;  4HB3 B;  3A9K A;  1XT9 B;  3VR8 B;  2CQU A;  2BB5 A;  3RN9 C;  3C8Y A;  3QBV B;  1L0Y B;  1UNQ A;  5J3Q A;  2GBK A;  1EVH A;  1K8R B;  2INN E;  2KIE A;  4TUU A;  2JXT A;  4HAU B;  2DAJ A;  1MHH E;  4ILG B;  4IUM B;  2LWP A;  3OHM B;  1WJU A;  2FID A;  1T77 A;  3Q8B A;  4M02 A;  3TL5 A;  2MBB B;  1R4N B;  2BW2 A;  4FJY A;  2MFQ A;  2EEL A;  1M7E A;  2NMQ A;  1E8Z A;  2D9Y A;  3N1X C;  2L1A A;  1Q5W B;  2BS4 B;  4BOZ B;  3D8F A;  3Q3N C;  2PTL A;  4GU2 A;  5JH5 C;  1ZOY B;  4PS8 A;  1MK7 B;  1H4R A;  3HVD A;  3MHZ A;  2FCM A;  4GPT B;  1YN3 A;  4K17 A;  4RF0 A;  3CST A;  3KW5 B;  3E9P A;  1XOD A;  5E6J A;  2RD0 A;  2JRH A;  3ML8 A;  5J3Y A;  3NSU A;  2CR5 A;  2LGI A;  2JZP A;  3DBR B;  1YQ4 B;  2RQ1 A;  2YS3 A; 
#chains in the Genus database with same CATH homology
 2EC1 A;  2H7D A;  4EFO A;  3VOQ A;  3SNH A;  4WJP A;  3DVG X;  2KK8 A;  4NAW B;  1DDW A;  1RLF A;  2CY4 A;  4Y94 A;  1TBE A;  2ELB A;  4FHK A;  3W1S A;  3DBL I;  2FAZ A;  1WZ0 A;  2R82 A;  4NY0 A;  2YS1 A;  5J2R A;  4BBN F;  2M17 A;  5D3W A;  4JK9 A;  3KRX A;  1EUV B;  2REX A;  2MW5 A;  2LGY A;  1U4A A;  1E90 A;  3D8E A;  3ZVV A;  3ML9 A;  3DXC A;  2KCJ A;  4JGH B;  2KDF B;  3V6C B;  2COD A;  1WGG A;  2EKE C;  2BYE A;  3H7S A;  3TFM A;  5D3Y A;  1RRB A;  3MPX A;  2D2Q A;  2LXC A;  4Z2N A;  3CSF A;  2M4N A;  4IW0 A;  2DHK A;  1ZC3 B;  1U5E A;  1Z2M A;  3HQC A;  1PQS A;  2KLG A;  2V76 A;  3JW0 X;  4EZJ A;  2LRW A;  1K5G B;  2WDT B;  2Z0Q A;  3FLV A;  5EFX A;  1TGZ B;  3L0W B;  2NS5 A;  1OMW A;  3M3J A;  1WX8 A;  1T0Y A;  4A6F B;  3UZT A;  1V88 A;  1E8Y A;  2K39 A;  4GDL B;  4JL9 A;  2RNR B;  3IG3 A;  3AXC A;  4XWX A;  3EHV A;  1MPH A;  4H8S A;  3LJ3 A;  4JLC A;  1XD3 B;  2KTR B;  2YLM A;  3ZDT A;  4W9I A;  3X23 A;  2KWV B;  2YSZ A;  4CHJ A;  1EO6 A;  3EC8 A;  2M1M A;  1U5D A;  3H7P B;  2JRI B;  1SGH A;  2V3S A;  3I3T B;  2LOZ A;  1NDD A;  2BCJ A;  3SUZ A;  2N23 A;  3QC8 B;  3T06 A;  1WMH B;  2PE6 B;  2W9N A;  1BT0 A;  4KIK B;  3DBR I;  3VAW A;  3T8M A;  2GS0 A;  5DIF B;  3U7D A;  2R0D A;  2D11 A;  2G4D B;  5HE2 A;  4EEW A;  2K2J A;  5LON B;  2MKR A;  2NMB A;  2DAF A;  2RR9 A;  3PV1 A;  2UYZ B;  3VHT C;  2A4Z A;  1XKE A;  1U29 A;  5CTR C;  4B6W A;  4RMA A;  2KWU B;  3G9W A;  1NBF C;  3VIA A;  2YVC A;  3PSE B;  3A1Q A;  2V4L A;  3RCZ A;  1SHC A;  4HAT B;  1Z5S B;  1OTR B;  3ULC A;  2KX0 A;  2KQ7 A;  4K2P A;  1E5W A;  2O6V B;  5DPW A;  1DIK A;  2J0K A;  4MEL A;  1V5U A;  3O96 A;  2CHX A;  2KDI A;  2BYV E;  1NTI A;  4CHM A;  3ZDM C;  1WY8 A;  3H9D A;  2C7H A;  3A8P A;  2KFJ A;  3IFW B;  1KC7 A;  2ZJD A;  3SDL C;  4NAW A;  4F7H A;  4JKH A;  1WG7 A;  2LZ6 A;  3PLU A;  1Z87 A;  1WIA A;  4HAZ B;  2KXJ A;  1U5G A;  3RZF A;  2KZR A;  2DFK A;  4ANV A;  5IAA C;  1X05 A;  4BBK A;  2DYB A;  3VTW A;  1ZC4 B;  2MRP A;  3DXD A;  4KSK C;  3OJ4 B;  2MQJ A;  1I2H A;  1V5O A;  1AAR A;  1DBH A;  4GZU A;  1OY2 A;  1LXD A;  1NVL A;  5C5B A;  3EFU A;  4KVG B;  2YF0 A;  2W2X C;  5JHG A;  4AOF A;  2C7M B;  4JQW C;  1V6E A;  5DPS A;  3MJW A;  1V2Y A;  4WWN A;  2DYM A;  2FIF A;  5CLQ B;  2KKC A;  1WXM A;  2HE7 A;  3ZVR A;  1GG3 A;  3QHT A;  2DN6 A;  2I5F A;  5TR5 A;  2LVQ A;  1IYF A;  3AU4 A;  3EEC A;  2Z0D B;  2O6V D;  2RGF A;  1Y19 B;  5LLI A;  4HAW B;  5JVL A;  3PP2 A;  1N3H A;  4KV2 A;  2LAS A;  3ENE A;  3KVF B;  2WX1 A;  1AWE A;  2MX2 A;  4GDL A;  3NHE B;  1WH3 A;  4WWP A;  5G55 A;  2KFK B;  1I7A A;  4MT7 A;  4W9E A;  3P7Z A;  2KTR A;  3VUY A;  3K9O B;  1TQZ A;  4WAA A;  1UZX B;  3DBS A;  2AEH A;  1KM7 A;  1FAO A;  2CRF A;  2R2Q A;  3TMP B;  3H7P A;  4Z2M B;  1WE6 A;  3QJZ A;  4ANW A;  4TV3 A;  2GBN A;  3IBE A;  1FOE A;  2K8H A;  3M63 B;  1V61 A;  3ALB A;  2ZPY A;  1TJ6 A;  5C6R A;  1J0G A;  3TVV A;  4JIO U;  1Y5O A;  5JHH A;  3NZS A;  4LDT D;  4I6P A;  3VUW A;  3M1I B;  2N9E B;  2KDB A;  1ZVR A;  3KSY A;  4A20 A;  4JKE A;  1P9D U;  2ZNV C;  3FSS A;  5EDS A;  1Y8R C;  3JSV B;  4MEM A;  1BTN A;  4HDO A;  2KNB A;  4IM3 A;  2K8C A;  2CU1 A;  3WYF B;  2L0F A;  1WGU A;  3FM8 C;  1BTK A;  3QQ8 B;  1UD7 A;  2ZCC A;  5JZE B;  4M8M A;  5DCN A;  2FUH B;  4CO7 A;  3PHW B;  2WWZ A;  2N9X A;  2HTH B;  5LXH A;  2GOW A;  3PHX B;  1C1Y B;  1V80 A;  3R7Q A;  5LXI B;  3RYT A;  1WX7 A;  3OJ3 A;  3SV1 A;  4F1S A;  4PNK A;  2NR2 A;  2NBV B;  3PRZ A;  4A3P A;  4GDK B;  2XK5 B;  2K00 A;  1V5P A;  1S3S G;  1YIW A;  4DHZ E;  1VBG A;  2LUL A;  3OLM D;  1J19 A;  3NZU A;  2N9P C;  3TIX A;  4MM3 A;  2N1V A;  4YL8 A;  4II2 B;  4NQK E;  1BAK A;  4HPM B;  2RUK B;  5HE0 A;  3ZIM A;  4ILJ A;  1WGY A;  2Z0P A;  1FB8 A;  4HB2 B;  4HDQ A;  4BOS C;  3WAO A;  4YON A;  1WI0 A;  2W2W A;  1LB1 A;  3APC A;  4DHZ B;  4KDI C;  4F7G A;  3NY5 A;  3E9L A;  1LW3 A;  1E8X A;  2C60 A;  1UEF A;  1X1G A;  3VFK A;  3D32 A;  5HE1 A;  2J0M A;  2BWE S;  2Y8F A;  4WJQ A;  4KHA A;  4HK2 A;  1YQB A;  5D7G A;  3SBG A;  2LKO A;  1FHO A;  3PGE A;  3IHP C;  2COF A;  5KCV A;  3KZ1 A;  2GBJ A;  4ZDV A;  4L6E A;  1GJZ A;  4TKN A;  4ANX A;  4EKU A;  2DX1 A;  3KRW A;  5C16 A;  2RVB B;  2RLO A;  4IAP A;  1WXS A;  2KFK A;  2QKL A;  2MLB A;  3E9O A;  1GGO A;  1S1Q B;  2HJ8 A;  2KJH B;  5D27 A;  2AWT A;  2IY1 B;  4KAX B;  3ZNG C;  2BWF A;  3PVW A;  2L1C A;  4JK7 A;  3DPD A;  2KUP A;  4A6H A;  2A5U A;  1QC6 A;  2K2U A;  4CHK A;  1D3Z A;  4RM8 A;  2PPH A;  3L54 A;  2IO3 B;  3AJ4 A;  3KUZ A;  4EOY A;  2RSG A;  2IY0 B;  2W2X D;  3V62 A;  2B3A A;  1W1H A;  4GXB A;  3JYU A;  4MSM B;  4MDK E;  1YX6 B;  3H1U A;  2M14 A;  2AYO B;  4PYU A;  4BFR A;  2PJH A;  4M0W B;  2DHJ A;  1WR6 E;  2CKH B;  2L0T A;  4GGQ A;  2IBI B;  3MHS D;  2Z0O A;  1UNR A;  3ZNI D;  2MBO A;  1WYW B;  2IYB A;  4ICU A;  5D3V A;  3KYD D;  2KC1 A;  3JSV A;  1A5R A;  3LDZ E;  2DX5 B;  2IO2 B;  1F9J A;  3KYC D;  5C79 A;  1ST7 A;  2DEN B;  5GOW B;  3ZKJ C;  4KHO A;  4HXD A;  1R4M I;  1MAI A;  2DZM A;  1M7R A;  4DBB A;  1V9J A;  3PEG A;  2DYN A;  4MGY E;  2MP2 A;  2FCN A;  2HTH A;  4MSQ B;  5E6N A;  4EJN A;  2RSU A;  5CHV C;  2C7N B;  4X57 B;  2V1Y A;  1XR0 B;  2IO0 B;  3RUI B;  2D3G A;  2EJ8 A;  4FN2 A;  2P0D A;  2LGD A;  3DVG Y;  5J17 A;  1RRP B;  1LFD A;  2BKR B;  3PRE A;  4GDK A;  2XK5 A;  4HHV A;  1ZSQ A;  1UPQ A;  2GMI C;  5D3X A;  5DH9 B;  4NPN A;  3ZTD A;  3MDB C;  3V60 A;  4EMO A;  2GCJ A;  2JT4 B;  4DWF A;  1EF5 A;  1FGZ A;  3A8Q A;  2ABD A;  1PFJ A;  5E6O A;  4W9F A;  2BKF A;  3W1S C;  5L95 C;  1MG8 A;  3IVF A;  1HB8 A;  5J3T A;  4K2O A;  2GBR A;  2P8V A;  4URK A;  2N7E A;  1IPG A;  2Y7B A;  1UPR A;  2M0X A;  2KQS A;  2D10 A;  4JKF A;  4DHJ B;  3ENB A;  3HM3 A;  3KUC B;  5L81 A;  1WX9 A;  4OVU A;  5CHF A;  3ODX A;  3WAP A;  3CXB B;  3JVZ X;  5DHA B;  3PVL A;  2Y5B B;  3R66 C;  4PS3 A;  4GN1 A;  3PSC A;  4GIV A;  2NZ8 B;  2N0Y A;  1UNP A;  4K81 A;  1WRD B;  1ZKH A;  4B9K A;  1DDM A;  2NVU I;  1RFA A;  4EZL A;  4BKT A;  1TXD A;  3ZNH B;  1UBI A;  2R09 A;  2NCN A;  3NOB A;  1KZ7 A;  2VSZ A;  4K1R B;  2KTF A;  2MWS B;  1UGM A;  5FI1 A;  2L3Z A;  1U27 A;  3SHQ A;  4A3O A;  3AI5 A;  1NTY A;  1GC6 A;  1WM3 A;  4AUQ C;  2LG1 A;  1NI2 A;  1I42 A;  2LI5 A;  3HM6 X;  3L10 B;  3SO6 A;  2KGX B;  2ROZ B;  2COA A;  3GYO A;  2COC A;  2UZS A;  3TO1 A;  3V6E B;  2KHW B;  2EMS A;  2KC2 A;  2QHO A;  3M62 B;  2L05 A;  1I35 A;  1C3T A;  4JKD A;  1B55 A;  2DX5 A;  4DHJ D;  4E74 A;  2YT0 A;  2DYO A;  1J0W A;  4LDT B;  3ZLZ A;  4F7Z A;  1L7Y A;  2DYQ A;  1ZM0 A;  3OAN A;  3KH0 A;  2C5L C;  1H10 A;  3RCP A;  1V89 A;  3RUL A;  2JZZ A;  4A6F A;  2MCN B;  1WZ3 A;  4ZRK A;  1E7U A;  4M8N A;  4MGI E;  3UIO B;  2I1K A;  3A98 B;  3UIP B;  5AZF A;  4A5K A;  2CY5 A;  3BJI A;  1KBL A;  3QAR A;  4FJZ A;  3UQB A;  3E66 A;  2DA0 A;  4HAY B;  3H6N A;  3WAN A;  2KMA A;  4HCP B;  1Q0W B;  4LJP B;  2DTC A;  1UH6 A;  2N1W A;  1W1D A;  3DBH I;  1WMH A;  1PMS A;  4XZ4 A;  3VQI A;  5DPR A;  4DDI D;  1P3R A;  5DPT A;  4F8C B;  4WJO A;  4KIK A;  2FDQ A;  3N30 A;  3L16 A;  1BWN A;  3N7C A;  2ZCB A;  4GSW A;  2FJ9 A;  4FA6 A;  4KHB B;  1WGD A;  2WYQ A;  4KSL C;  3BY4 B;  2MBH A;  4WJ7 A;  1V81 A;  5D94 A;  2COP A;  2YT1 A;  3GZN I;  4HPL B;  1UEL A;  2LJ5 A;  3ONS A;  2PEA A;  4HAX B;  4WVF B;  3ZRF A;  2OQB A;  3APF A;  4XX5 A;  4IM0 A;  2O6V A;  2ZVO A;  1OEY A;  3VTU A;  1WM2 A;  2AL6 A;  2O2V B;  2JUO A;  4ZYN A;  1UBQ A;  2H7E A;  2GBM A;  3PTF C;  2BGF A;  3GOE A;  1FXT B;  4TQ0 A;  4JKG B;  3T9L A;  1QZE A;  3HIZ A;  2MBQ A;  1K5D B;  5D6J B;  2KWC A;  3FEH A;  2LXA A;  3UIN B;  1KLV A;  1IP9 A;  3A4R A;  5IJM A;  2WH5 A;  3ML4 A;  4G0N B;  2G45 B;  3X0W A;  4TYZ A;  1PLS A;  4KZ0 A;  1RJ2 A;  2Q13 A;  2NPT B;  1EGX A;  3PLV A;  4KDL B;  4F7U P;  2GJY A;  5KQ4 A;  3BIN A;  4IC7 B;  4K7W A;  3DVN V;  1IRS A;  2KJR A;  2YRY A;  1YJ1 A;  2GCL A;  3QAQ A;  2R2O A;  1WGH A;  1MKE A;  1VD2 A;  4MGZ E;  3PT2 B;  3APD A;  3O65 B;  2BPS A;  4J6I A;  1XCG A;  3ODW A;  1TZ1 A;  3QX1 A;  3B08 A;  4G50 A;  3WAM A;  4GMX B;  1NTV A;  4W9H A;  1P98 A;  1KZG A;  1V5M A;  4XC2 A;  2FNJ B;  2P0F A;  4II3 B;  4DDG D;  2PZ1 A;  2JY6 A;  3M95 A;  1QQG A;  1TTN A;  4JKB A;  3PRP B;  4HWI B;  3AUL A;  2KVR A;  5JP4 A;  3ULB A;  4IFS A;  1ZW7 A;  2DLW A;  2KX3 A;  3VVW B;  3TBL D;  2JP2 A;  1HB6 A;  2DKQ A;  2CHW A;  2OTX A;  2DIK A;  3B1L X;  2DHZ A;  3VUX A;  1P5T A;  1MIX A;  5AEK B;  1WVH A;  3A1Q B;  3ZTC A;  2LVP A;  1ZGU B;  3VTV A;  2UVM A;  2BYF A;  2KMC A;  3OAW A;  4A6K A;  1DDV A;  2KLC A;  2LGX A;  3VDZ A;  1MIZ B;  5HE3 A;  2D4Q A;  4G3X B;  1DRO A;  1AQC A;  4OVV A;  1MK9 B;  3QWZ B;  2LOX A;  1OGW A;  1LQB A;  2K8B A;  4HCN B;  4JKC A;  3CF6 E;  1V5T A;  5G2N A;  4W9D A;  3TJP A;  2JVC A;  4RM9 A;  3F5R A;  4MH0 E;  4NJ6 A;  3UQA A;  2AL3 A;  3AU5 A;  3ZRC A;  1V49 A;  3TCA A;  2CB8 A;  5LOP B;  2ZNV B;  4WSF A;  1EAZ A;  2K25 A;  4JK8 A;  1WI1 A;  4HAV B;  3QCA A;  4HLE A;  3VXW A;  1ISN A;  1WXA A;  5C5B B;  1X1F A;  2HD5 B;  1KI1 B;  2L7R A;  4JKA A;  3ZUN A;  3MTN B;  1P1A A;  3ZW3 A;  1SIF A;  4NJ7 A;  3QIJ A;  4E71 A;  4I6N B;  2O2V A;  3PVU A;  5FR6 A;  4KZC A;  4MK0 A;  4LJO B;  3HW2 B;  5AZG A;  4PQ0 A;  1Q67 A;  1H8C A;  4MJS B;  3R3M A;  4ZRI A;  3SYX A;  2J7Q B;  3A9J B;  4JKG A;  2E2X A;  3KUD B;  3B0A A;  3L08 A;  2ROV A;  2ZVN A;  2LRU A;  2HRJ A;  2J59 M;  5FI0 A;  1WFY A;  3HHM A;  3R7R A;  2NPT A;  2NBW B;  3WA0 A;  1FHX A;  2VRR B;  2IZV B;  4LCD E;  1WR1 A;  2ELA A;  5AZH A;  3NS8 A;  3CMM B;  1R4N I;  4FLH A;  3DVN U;  2Z59 B;  1ACA A;  2WX0 A;  1RAX A;  2MA9 B;  2FCS A;  2MDX A;  3N32 A;  4D0N B;  4E3C A;  4BBN C;  2FCQ A;  2JF5 A;  2DHI A;  1E7V A;  4AJW A;  1OQY A;  2J0J A;  1GUA B;  3PZD A;  3ZO5 B;  5KQ1 A;  4BKS D;  2RGN B;  2JZ3 B;  4FAD A;  1SE9 A;  4W9J A;  4G11 A;  5C23 A;  3UF8 A;  3VH4 B;  3Q3F A;  2OJR A;  1WJ4 A;  4ICV A;  4FBJ B;  4DBG A;  3TW1 A;  4MY6 A;  2N4F A;  4NQL B;  2D9X A;  2LYD A;  1X1M A;  4DK5 A;  2Z0E B;  3SU8 X;  4N9F 4;  3DXE A;  4PYZ A;  2MWN B;  2ADZ A;  5C1Z A;  4DXA B;  2ZZP B;  3A33 B;  3P6A A;  4BVU C;  1V86 A;  1HBK A;  2DZI A;  4PS7 A;  2ZEQ A;  4DX8 A;  4ASW C;  4I6L B;  2KAN A;  2OOB B;  2VKI A;  1XQQ A;  1XD4 A;  4HJK A;  4AWJ A;  4CYE A;  3S2A A;  5DI9 B;  3SBT A;  2XBB C;  1U5F A;  4IOY X;  1WGR A;  3CIK A;  2DZJ A;  1OQN A;  1WJM A;  4P7I A;  4WWO A;  5DHF B;  2NBU A;  2D9V A;  1M94 A;  3LJU X;  3QK0 A;  2G3Q B;  4GB9 A;  4ANU A;  1WJN A;  3VH3 B;  2X18 A;  3P2B A;  2XEW A;  4DX9 0;  4K7U A;  2JWZ A;  2MSE D;  2C9W B;  3L17 A;  1KOT A;  3A9K B;  3RD2 A;  2I5C A;  3GYP A;  2CHZ A;  3DCG A;  1P3Q U;  4BKS A;  2D9W A;  3F0W A;  2N7D A;  5KHQ A;  4W9K A;  3UGB B;  2PE9 A;  1W1G A;  1GNU A;  5L83 A;  4MJS A;  1XX0 A;  1E8W A;  2X0S A;  1WXV A;  3A9J A;  2D07 B;  2DZK A;  3K9P B;  4IWP A;  4EZK A;  5CX3 A;  5HKH A;  3D8D A;  2RPQ A;  1CMX B;  2BF8 B;  5CLL B;  3C0R B;  2EMT A;  3QWM A;  4WQO B;  4EUT A;  1JRU A;  1Q1O A;  5J18 A;  4AJY B;  3U30 A;  2L00 B;  2M38 A;  4HB4 B;  5JHA A;  2LUE A;  1L2N A;  3SD5 A;  4FHJ A;  2M8S A;  3V5W A;  3PS6 A;  2KN5 A;  5JLJ B;  3ODO A;  4ILH A;  3RT3 B;  5D2M B;  2KO3 A;  4NSW A;  3V61 A;  2L8J A;  5GMV A;  2G35 A;  2K6Q A;  4B95 A;  4MGK E;  2DKP A;  2JXX A;  1GC7 A;  4AP4 C;  4IM2 A;  4NNJ B;  1HE8 A;  4GOC A;  3WIM A;  2P0H A;  5KHO A;  1OEY J;  4ZRJ A;  2IO1 B;  1G6J A;  2ZPN A;  2XQN M;  3A4S C;  1VBH A;  2CS4 A;  2LVO A;  3QA8 A;  1P0R A;  1EF1 A;  4BKG A;  3ZNZ B;  4TQ1 A;  5CHW A;  1LM8 B;  1YD8 U;  3RZW C;  4HB0 B;  1DYN A;  2VRW B;  2FJL A;  3DDC B;  1WGQ A;  3ECI A;  3PRM B;  2L2I A;  4B6H A;  5IA7 A;  3W1Y A;  1WE7 A;  3FP5 A;  2CAY A;  3HK0 A;  2JPH A;  2UWQ A;  2IFS A;  5BO4 B;  1FGY A;  4C0A A;  1U2B A;  2MBE A;  4IWO A;  4GMV A;  3PG7 A;  3N3K B;  4W9C A;  1X11 A;  3EPY A;  2MP2 B;  3U8Z A;  3PPA A;  2ASQ A;  2I1J A;  2QKM A;  4FUL A;  4IWQ A;  1WF9 A;  1WJ1 A;  3KY9 A;  2KJ6 A;  2KD0 A;  4WJN A;  1KJT A;  2Y8G A;  4IG7 B;  2KDE B;  2YS5 A;  3DQV A;  4W9G A;  3L13 A;  5E6P A;  4HVB A;  2LBB A;  1P6S A;  2K1F A;  2KOX A;  3DOW A;  1NU2 A;  1YX5 B;  2K6D B;  2LD9 A;  4W9L A;  1WJ6 A;  1VCB A;  1FHW A;  2UZR A;  4K7S A;  4FJV B;  3WAL A;  2IYD B;  2G4S A;  1J8C A;  1JDE A;  5JHB A;  2D9Z A;  1X86 A;  2L76 A;  3Q3J A;  4HB3 B;  3A9K A;  1XT9 B;  2CQU A;  3QBV B;  1UNQ A;  5J3Q A;  2GBK A;  1EVH A;  1K8R B;  4TUU A;  4HAU B;  2DAJ A;  4ILG B;  4IUM B;  2LWP A;  1WJU A;  2FID A;  3TL5 A;  2MBB B;  4FJY A;  2MFQ A;  1M7E A;  1E8Z A;  2D9Y A;  1Q5W B;  4BOZ B;  3D8F A;  4GU2 A;  5JH5 C;  4PS8 A;  1MK7 B;  1H4R A;  2FCM A;  4GPT B;  4K17 A;  3CST A;  3KW5 B;  3E9P A;  1XOD A;  2RD0 A;  2JRH A;  3ML8 A;  5J3Y A;  3NSU A;  2CR5 A;  2RQ1 A;  2YS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...