2D2QA

Crystal structure of the dimerized radixin ferm domain
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d2qA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d2qA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d2qA01
3QA8A 5LONB 1P1AA 3ZUNA 2EC1A 2KLGA 5C5BA 4HAXB 2CAYA 3R3MA 5D7GA 4HATB 2JPHA 1WYWB 3PEGA 1P9DU 5D3VA 1BT0A 1XQQA 1V6EA 5KHOA 2KMCA 3R7QA 1I7AA 2D9XA 4W9JA 5DPWA 1V81A 3N3KB 2N9PC 3DCGA 4ASWC 4HK2A 2DAFA 1V49A 2MA9B 4FADA 2PJHA 4DX8A 4ICVA 4HVBA 5D27A 3IFWB 3VH3B 3V60A 2HJ8A 3EFUA 5E6NA 3PVWA 3RCPA 3X0WA 3VXWA 1TTNA 4W9GA 4BKSD 4HB0B 1WGYA 2GBMA 2KDBA 4A6HA 5IJMA 2LYDA 1GNUA 2VRRB 3IVFA 5J3YA 2WX0A 3R66C 3TL5A 4K81A 2LRWA 2FNJB 1IPGA 1L7YA 1EF1A 2MBBB 1WXSA 1U2BA 3KY9A 3O65B 2GS0A 3P2BA 4A6FA 2P8VA 3SU8X 4ANWA 4DHJD 3ZDTA 4ANUA 2LGYA 3DVGX 4FJYA 1E5WA 1LQBA 3PZDA 1Q67A 4B6WA 3H7PA 1WF9A 4OVVA 2DAJA 1K5GB 2UZRA 3RD2A 4ANVA 3CSFA 2HRJA 3PHWB 3VHTC 3IBEA 5EFXA 3RT3B 3GOEA 2WX1A 4MJSA 2DX5B 4AWJA 1OQNA 2CHWA 4RM8A 1EAZA 3KUDB 2QKLA 4WJNA 2MDXA 4EMOA 2I1JA 5KHQA 1ZC4B 2CHXA 1YJ1A 2YRYA 4MGIE 1X1FA 5DHAB 1OTRB 4P7IA 5JLJB 3FLVA 1UNRA 2ASQA 2KGXB 4M8NA 5D94A 2D07B 2WH5A 3K9OB 3APCA 2G45B 4IWOA 4WQOB 1UELA 5JHBA 3VFKA 1J0GA 3DVGY 2REXA 3QBVB 2KZRA 1FOEA 2MBOA 3UF8A 3A4RA 1KOTA 1WJ4A 3EPYA 5J18A 3TBLD 3APFA 1WGQA 3SUZA 2KANA 2LD9A 4KSLC 3KZ1A 2CRFA 2IY1B 5AZGA 2CY4A 5C23A 1WZ0A 4Y94A 5CHVC 2W9NA 2BCJA 3ULCA 4A20A 3LJ3A 2EMTA 2VKIA 3ONSA 2JRHA 4MY6A 3CSTA 3A9JA 1UPRA 5DIFB 3QQ8B 2N9XA 3MTNB 2KMAA 3KRXA 5EDSA 5KQ1A 2K1FA 5C16A 4F8CB 2Z0OA 3ZNID 3AJ4A 1ISNA 4WJQA 5LLIA 3QWMA 3ZNGC 3CF6E 2DN6A 1TQZA 3K9PB 3OLMD 1GJZA 4GU2A 3PRMB 3M3JA 2UZSA 1TXDA 1FAOA 3VUWA 4WWPA 3L08A 1GG3A 2MWNB 1RRBA 5FR6A 2LUEA 4PQ0A 2O2VB 2I1KA 2N0YA 1Z87A 1UH6A 3OJ4B 3ZNZB 2JXXA 4MGYE 2N7EA 4HHVA 2LG1A 1WGGA 1WJUA 5DI9B 2Z0QA 1F9JA 3PVLA 1X05A 3QX1A 4WVFB 2DHZA 4NJ6A 2Y5BB 1XODA 4GMXB 1QZEA 3L10B 3L54A 1XD3B 2N7DA 3F0WA 1X86A 2FAZA 3VDZA 3ZRCA 2DFKA 3GZNI 4DBBA 4G11A 4GSWA 1WE7A 1N3HA 2K39A 2QHOA 3FM8C 2L00B 3PRPB 1HBKA 2Z0PA 2COCA 4BKSA 1H8CA 2N9EB 4AUQC 2C60A 1HB8A 2LWPA 2N1WA 4TUUA 4TQ0A 2DZJA 1WR1A 3VIAA 2EJ8A 3QARA 3OAWA 2LOZA 3R7RA 1EVHA 1ZW7A 4IAPA 2M38A 5HE3A 5CHWA 5LOPB 3TFMA 2BGFA 3HK0A 2EMSA 1T0YA 3A98B 2LZ6A 1U27A 1WI1A 3PGEA 1EUVB 3ML8A 2KJRA 1FHOA 2RD0A 1SE9A 3ZTCA 2KWCA 3B1LX 2KO3A 1UNQA 1WXVA 2ZPNA 1CMXB 4DHZE 4BOZB 4MK0A 3ZVRA 5AZHA 2OQBA 4OVUA 3T8MA 2M17A 3L0WB 3WIMA 3D8DA 3FSSA 3QK0A 1WXMA 3ECIA 1UD7A 4W9EA 1X11A 2FCMA 3JSVA 4D0NB 4GPTB 2BYFA 2KVRA 1MIXA 2WYQA 4JLCA 4DDGD 2IYDB 4F7GA 2DYNA 3ODOA 1GUAB 1BTKA 2RR9A 1VCBA 1E90A 1DDVA 2VRWB 2ZEQA 3ULBA 1KZ7A 1G6JA 4KIKB 2W2XD 2QKMA 4JL9A 4XZ4A 4FBJB 4GB9A 2DYBA 1GC6A 4HB4B 3U8ZA 2PE9A 4K7WA 2UVMA 2FIDA 3PG7A 3O96A 4PS7A 4MSQB 3ZLZA 4WAAA 1V5OA 4AP4C 5E6OA 2BKRB 4EZJA 4A6KA 2G4SA 4GDKA 3CMMB 5D3WA 1WGRA 2RSUA 1AQCA 2ABDA 1EF5A 3SV1A 2NBVB 2O6VB 3SD5A 4EZLA 2ZVNA 2V76A 3T06A 4DWFA 5JZEB 5J2RA 2KFJA 1XR0B 2N4FA 3ZW3A 1WJMA 3VH4B 5AZFA 3G9WA 2J0JA 1WG7A 3VVWB 2M4NA 3H7SA 1Q5WB 5C5BB 4A3OA 2D9YA 4KAXB 3KRWA 4EKUA 2DENB 4E74A 4KV2A 1XCGA 4EJNA 1B55A 1WX8A 1QC6A 2K2UA 1SGHA 3PVUA 3A1QA 1ACAA 2RUKB 4W9IA 2CODA 3SDLC 4KHOA 4FJZA 1ZGUB 4IM0A 3L13A 4MH0E 3ENEA 1WM3A 1WJ6A 3BINA 2YS3A 3PSCA 5C6RA 4GN1A 4GZUA 4G3XB 4NJ7A 2M1MA 3PREA 1PQSA 2MBQA 5L81A 4E3CA 1NTVA 4LJPB 4ZDVA 4NAWA 2G4DB 4MEMA 5IA7A 4EFOA 4LDTB 4CO7A 1FGYA 1V5UA 2ROZB 5G2NA 2LOXA 1E7VA 2R09A 1LW3A 3KYDD 3W1SC 3ZVVA 2MKRA 3UIPB 3GYOA 5DPRA 2A5UA 1BAKA 3DXEA 4URKA 1V89A 3N30A 3DXDA 2CKHB 2KX0A 1V5PA 1WGDA 1NBFC 3A33B 1MKEA 1Z2MA 3RCZA 3DQVA 2OTXA 1IP9A 1E8ZA 4F7ZA 2K6DB 3ML9A 4JQWC 1NTYA 4FHJA 4HDQA 4FHKA 1U4AA 3L16A 2L8JA 4A6FB 5CLLB 4NPNA 2J7QB 4II3B 1WMHA 3SNHA 3U7DA 4W9HA 2KC2A 2L0FA 2OOBB 2NPTA 2LXCA 2DZIA 3H7PB 3HM3A 1U5DA 3PV1A 2V3SA 5KQ4A 3M63B 2KFKA 5C1ZA 2COFA 4I6LB 3C0RB 2MW5A 1VD2A 2K8HA 2R2OA 3UQBA 4KDIC 2LJ5A 4RMAA 2N23A 3V6CB 2XBBC 1KI1B 2YLMA 4HWIB 2DA0A 2GMIC 2KQSA 4ZRIA 4IOYX 2DX5A 1M94A 2J0KA 3CIKA 2K2JA 3D8EA 4YONA 4GOCA 4GDLA 3L17A 2AEHA 3RZWC 2ELAA 5BO4B 4Z2NA 4FULA 2Q13A 1ZVRA 2D10A 1NI2A 2RPQA 1WM2A 3T9LA 2K25A 4HB3B 2IY0B 2P0HA 1D3ZA 1M7RA 1LXDA 3ZO5B 3KUCB 2BPSA 2J59M 3ODWA 4G50A 2NR2A 2KUPA 3MJWA 2P0DA 3WA0A 1W1DA 2AL3A 1OY2A 2KQ7A 2ZJDA 2YT1A 2A4ZA 4I6PA 5HKHA 3DBRI 1WI0A 1K5DB 1MIZB 2KTRB 4KVGB 2M8SA 1UPQA 2G3QB 3I3TB 3EHVA 4KSKC 2K00A 1L2NA 2FCQA 4A3PA 1RAXA 3A9JB 1MAIA 2L05A 1ZKHA 2OJRA 1J19A 4NSWA 1FXTB 1MK9B 1TZ1A 2JT4B 3KUZA 2H7DA 2D11A 4PS3A 3ZIMA 1Z5SB 5HE1A 1LM8B 3H6NA 5GOWB 1J0WA 1WFYA 1ZSQA 3HHMA 2L76A 4G0NB 3VUXA 2LULA 2E2XA 3AI5A 3H9DA 5DPSA 4MSMB 4DBGA 1P5TA 4GIVA 1E7UA 5GMVA 2HD5B 2KXJA 1PMSA 3PHXB 2COAA 4CHMA 3FEHA 4IC7B 4M0WB 1ST7A 1WJNA 3WYFB 2K8CA 4K2PA 3SO6A 1JRUA 4MELA 2BYEA 4NY0A 1RFAA 1KJTA 3DBLI 1R4NI 4HB2B 2NZ8B 4I6NB 2IO2B 2L7RA 2AL6A 2M14A 3RULA 3DPDA 1UNPA 1YD8U 2M0XA 1XX0A 4GMVA 2FCSA 2KNBA 1IYFA 2CS4A 3DDCB 4FA6A 4WWOA 1MG8A 2VSZA 2P0FA 2GBKA 1P3QU 3AU5A 5L83A 2MP2B 2XQNM 5LXHA 5CTRC 4HPMB 4BOSC 2KJHB 5JHHA 2HTHA 3TMPB 4JGHB 2JRIB 4WJPA 1I2HA 5JH5C 1WY8A 4HAZB 5FI0A 1HE8A 4DHJB 2JZZA 2XK5B 5DH9B 2GBRA 1NVLA 2RGFA 3QCAA 4DX90 2WDTB 1PFJA 2D3GA 2LVPA 1YIWA 3OJ3A 4AJWA 3KW5B 4BVUC 1P98A 3VTVA 1DBHA 2C7MB 3QHTA 4CHKA 3TVVA 2K6QA 4DHZB 2KLCA 3WANA 2YT0A 1MPHA 3A8QA 2GOWA 3APDA 4CYEA 3HW2B 3JSVB 2ZCBA 2DYMA 1WH3A 1Y19B 1Y5OA 1IRSA 2RVBB 1U29A 4ANXA 4TYZA 1U5GA 1WR6E 1WJ1A 1Q0WB 2LGXA 4AOFA 1RJ2A 1YX6B 2IBIB 5HE2A 2JVCA 4F7UP 4BFRA 1NDDA 2MBEA 3Q3JA 4F1SA 1RLFA 2GBNA 2Y7BA 3D8FA 5E6PA 2L1CA 3VUYA 4IM3A 2Y8GA 3A8PA 5D3YA 4GXBA 2KCJA 3PRZA 2ZPYA 2XEWA 3DOWA 4KHAA 4HJKA 2CB8A 2GCLA 4C0AA 1OMWA 4BKTA 3A9KB 4WWNA 4GDKB 4PYUA 2UWQA 3NZUA 2D4QA 1KZGA 2MSED 1E8YA 2KK8A 1XD4A 1UZXB 2D9WA 2NS5A 1GC7A 1AWEA 4BBKA 3WALA 2D9ZA 1X1MA 2MFQA 3P6AA 2C7NB 3RZFA 3BY4B 4NQLB 4Z2MB 5D6JB 2HE7A 1E8WA 3DVNU 1V5MA 5J3QA 4PS8A 2JY6A 1NU2A 3PLVA 2J0MA 3UGBB 3U30A 4W9KA 2NVUI 3D32A 2LGDA 5CX3A 3TJPA 3A1QB 1UBQA 2KDFB 2RLOA 2I5FA 1E8XA 2K8BA 3JW0X 5HE0A 1EGXA 3V61A 4CHJA 5J3TA 2BKFA 2RGNB 3W1YA 3TCAA 1P0RA 4AJYB 2Z59B 2IO3B 3QWZB 4YL8A 3NOBA 2IO1B 3NSUA 1DDWA 3TIXA 2BWFA 3ZTDA 3M62B 5KCVA 2LBBA 4W9LA 1SHCA 3VAWA 4X57B 3ML4A 2DZKA 4IFSA 4HAUB 3M95A 3ODXA 4NAWB 3RUIB 5FI1A 3H1UA 4N9F4 1ZM0A 2KKCA 5JHGA 2LI5A 2DHJA 2MBHA 2NBWB 3A4SC 5AEKB 1Y8RC 3WAPA 1M7EA 3UQAA 1OGWA 2WWZA 5D3XA 2JZ3B 2R2QA 2FDQA 4IG7B 3KVFB 4L6EA 1V88A 1Q1OA 2MWSB 2ADZA 2D9VA 3MPXA 2AYOB 3KH0A 3SHQA 3DXCA 2DHKA 3HIZA 1OEYA 4HDOA 1WMHB 1OQYA 2KDEB 3LJUX 2JUOA 3VOQA 2ZNVC 2NPTB 4FLHA 4IWPA 1SIFA 4HCPB 3P7ZA 4LCDE 2CHZA 5TR5A 2CY5A 2RSGA 2KFKB 2LASA 2YF0A 2FCNA 1H4RA 2KHWB 4MJSB 2DX1A 4W9FA 3VQIA 3JVZX 2LKOA 2NCNA 3B0AA 4ZYNA 2IYBA 1I42A 4ZRJA 2NMBA 4TQ1A 1WRDB 3N32A 4DK5A 1YQBA 2ZCCA 3HQCA 3QIJA 4GDLB 2CQUA 2GBJA 1RRPB 1FGZA 2DKPA 3M1IB 1WVHA 3AU4A 4FN2A 1FHWA 5G55A 4HPLB 2R0DA 2JWZA 2DHIA 3V5WA 2L0TA 1I35A 2Z0DB 4BKGA 3GYPA 2V4LA 2V1YA 2DYQA 4H8SA 3PP2A 2H7EA 1K8RB 3VTWA 3ZDMC 4K17A 2X18A 2KN5A 3KYCD 2PZ1A 2ELBA 2MQJA 3PTFC 4LJOB 3ZNHB 4IW0A 4K1RB 2FJ9A 2PEAA 2DYOA 4NNJB 1V2YA 1WX9A 4MM3A 2O6VD 4J6IA 3V62A 2BYVE 2FJLA 1WX7A 2KTRA 1MK7B 1TJ6A 2ROVA 5CHFA 1WGUA 1OEYJ 1P6SA 3NZSA 2COPA 5DHFB 3KSYA 3DBSA 4PYZA 4JIOU 4E71A 1FB8A 1V9JA 2PPHA 4FJVB 1WIAA 2Z0EB 2KWUB 3QJZA 2IFSA 4TKNA 2DTCA 4K2OA 4NQKE 1P3RA 1KLVA 3ALBA 1QQGA 3CXBB 5D2MB 3MDBC 1WZ3A 2D2QA 3IG3A 2O2VA 4B6HA 2LRUA 4HAVB 1TBEA 1UGMA 2KWVB 3NY5A 2LVOA 2BWES 3UINB 4WJOA 2CU1A 2PE6B 4WJ7A 2GCJA 2NBUA 3X23A 2MX2A 4LDTD 2LXAA 3F5RA 4HLEA 4RM9A 4KZCA 5DPTA 4DDID 4A5KA 2UYZB 5JP4A 4F7HA 1U5FA 4K7SA 1U5EA 1YX5B 1J8CA 4TV3A 2IZVB 2L3ZA 3NHEB 2L2IA 2GJYA 2EKEC 2KC1A 3JYUA 3PLUA 4II2B 4MGZE 1H10A 1V61A 4B95A 2W2XC 1XKEA 3S2AA 4BBNC 3EC8A 2FUHB 3AXCA 2KOXA 4HCNB 2G35A 3TW1A 2MLBA 1DDMA 3QC8B 3V6EB 1XT9B 4KDLB 4MT7A 3B08A 2ZVOA 2DKQA 1C3TA 3VTUA 1DROA 2MCNB 1S3SG 2LVQA 3DBHI 4DXAB 4MGKE 2HTHB 2MP2A 1KM7A 2BF8B 3IHPC 4W9DA 1LFDA 4HAWB 2DLWA 2YS1A 4ICUA 3WAMA 4IWQA 4XWXA 4KHBB 1NTIA 3PS6A 2KJ6A 2MRPA 4GGQA 1BTNA 5C79A 3HM6X 2XK5A 1WXAA 1LB1A 1FHXA 3RYTA 4EZKA 3SYXA 3UIOB 4PNKA 2KX3A 1A5RA 2W2WA 1BWNA 1C1YB 4IUMB 5IAAC 2YVCA 3WAOA 3UZTA 3QAQA 4K7UA 2IO0B 1PLSA 5DCNA 2KDIA 3BJIA 2C7HA 3EECA 4HXDA 2RNRB 4W9CA 3PT2B 3Q3FA 1AARA 1HB6A 2N1VA 2FIFA 1EO6A 4XX5A 3TO1A 4WSFA 1ZC3B 4EOYA 1UBIA 3OANA 2C5LC 3AULA 5JHAA 4KIKA 3N7CA 2KTFA 4EEWA 3ZRFA 1V80A 2DZMA 3MHSD 4EUTA 3W1SA 3DVNV 2I5CA 2CR5A 1W1HA 4KZ0A 4XC2A 5LXIB 4HAYB 1WE6A 2ZZPB 4IM2A 2YS5A 3LDZE 4MDKE 3PSEB 2YSZA 4M8MA 5CLQB 1V5TA 1X1GA 3NS8A 1S1QB 3A9KA 5J17A 2JP2A 3FP5A 2AWTA 4B9KA 3PPAA 2JF5A 2C9WB 4BBNF 3ZKJC 2RQ1A 1DYNA 1V86A 1WGHA 1TGZB 5L95C 1R4MI 2ZNVB 2Y8FA 1W1GA 2O6VA 4ZRKA 2KD0A 2B3AA 1UEFA
chains in the Genus database with same CATH superfamily
3QA8A 5LONB 4JKCA 1P1AA 2BS3B 2J52A 2HTME 3ZUNA 1C79A 2EC1A 2EELA 4JX1C 4YSZB 4GOUA 2KLGA 5C5BA 4HAXB 2JQRB 2CAYA 3R3MA 1F2RI 5D7GA 4HATB 2JPHA 1MFWA 2YT2A 1TKGA 1V97A 4RF1A 1WYWB 3PEGA 4RGTA 1D5ZC 2GB1A 2HJ1A 3BZDB 4D2KA 2W3SA 1BUIC 1P9DU 1TIFA 2TSSA 1N62A 4TSSA 2K9XA 2K0PA 5D3VA 1BT0A 1WSPA 1XQQA 3U7ZA 1V6EA 3FKYA 3MC8A 5KHOA 2KMCA 3R7QA 1I7AA 2D9XA 3VR8B 2JX5A 4W9JA 5DPWA 3HVZA 1V81A 3N3KB 5IP4D 2N9PC 3DCGA 4ASWC 4HK2A 1XLQA 3IAM1 1UWXA 4ARCA 1V8CA 2DAFA 1V49A 2MA9B 4FADA 2PJHA 4DX8A 2FBWB 4ICVA 4HVBA 5D27A 4YXDB 3IFWB 3VH3B 3V60A 2HJ8A 3EFUA 5E6NA 3PVWA 3R2TA 4R3DA 1FM0D 3RCPA 1HTQA 3X0WA 3VXWA 4L2YA 1TTNA 4W9GA 2PLPA 4BKSD 4HB0B 3NG0A 3B9JA 1L0XB 1WGYA 3DBHB 3LXFA 2GBMA 2KDBA 4A6HA 4OZBA 3EUB2 5IJMA 2LYDA 1QOGA 1GNUA 2VRRB 4GLSC 3IVFA 5J3YA 3KQ4A 2WX0A 3R66C 3TL5A 5JXVA 1YN4A 3I5JC 2BB6A 4REZA 3SR6A 2KMMA 4K81A 2Z8LA 1PFDA 3VR9B 5HHDG 2LRWA 2FNJB 1IPGA 3Q69A 1JRPA 1L7YA 1KRHA 1EF1A 4US9A 2QIEB 2MBBB 1WXSA 4HROA 1U2BA 3KY9A 3O65B 2GS0A 3P2BA 4A6FA 2IGGA 1HXYD 2P8VA 3BK2A 3SU8X 4ANWA 4DHJD 3ZDTA 4ANUA 1N5XA 1LO5D 2LGYA 3DVGX 2K22A 4JK7A 4FJYA 1E5WA 4RGOS 1LQBA 1SSNA 3PZDA 1Q67A 4B6WA 1FXAA 3H7PA 1WF9A 4XDDA 4OVVA 2DAJA 3RI7C 1K5GB 3RPFC 2UZRA 3RD2A 4ANVA 3CSFA 4KX6B 2HRJA 3PHWB 1GPXA 2CJOA 4ITKA 3VHTC 3W5VB 1AYFA 5T8IA 1ZE3D 1UF0A 3IBEA 5EFXA 3RT3B 3GOEA 2WX1A 1B9RA 1ZYIA 4JKHA 4MJSA 2DX5B 4AWJA 1OQNA 2INDC 2CHWA 4RM8A 1EAZA 3KUDB 2QKLA 3AH7A 4WJNA 2MDXA 4EMOA 2BB5A 2I1JA 5KHQA 3I57A 1ZC4B 3SBGA 4AS1A 2CHXA 1YJ1A 4D6WA 2YRYA 2MHJA 4MGIE 2D3AA 1X1FA 3AV8A 4WWMA 5DHAB 1OTRB 4P7IA 5JLJB 3FLVA 1UNRA 2ASQA 1KTKA 2KGXB 4M8NA 5D94A 2D07B 2PVGC 2WH5A 4C80A 2ACZB 1F52A 1XCQL 3K9OB 3APCA 1KBLA 1JALA 2G45B 5I2MA 2JXTA 4IWOA 4WQOB 1UELA 5JHBA 3VFKA 3I9V1 1J0GA 3DVGY 1QKZA 1UNSA 2REXA 3QBVB 1C78A 2KZRA 2QCZA 1R4MB 1FOEA 2MBOA 3TEZA 3UF8A 3A4RA 1KOTA 1WJ4A 3EPYA 4WH4A 1TS4A 2BW2A 5E6JA 2M0AA 5J18A 3TBLD 3FILA 2YEPF 1N60A 4XE0A 1K51A 2QMTA 3APFA 2AQ3B 1WGQA 3AMZA 3SUZA 2KANA 3TEWA 2LD9A 4KSLC 1AN8A 3SBTA 3KZ1A 2DNFA 2CRFA 2IY1B 2KAJA 4YTNB 5AZGA 2CY4A 2V3NA 5C23A 1RWSA 2D5GA 1WZ0A 4Y94A 5CHVC 4OT1A 2W9NA 3PO0A 2BCJA 4QJ3B 3ULCA 2RMMA 4A20A 4HKQA 3LJ3A 1CZPA 2EMTA 4WURA 2VKIA 2RPVA 1I4QA 3ONSA 2JRHA 4MY6A 3CSTA 3NVYA 1FMAD 3A9JA 3E9LA 5I4DA 1JROA 1UPRA 5DIFB 3FAHA 3QQ8B 3V05A 1VZ7A 2N9XA 3MTNB 5MPOA 2KMAA 3KRXA 5EDSA 1VLBA 5KQ1A 2K1FA 5C16A 4F8CB 2Z0OA 3U4EG 1XCTL 2LMCA 3ZNID 3AJ4A 1QOAA 1ISNA 3Q3OC 4WJQA 5LLIA 2UU7A 3QWMA 2KVZA 3ZNGC 3CF6E 2DN6A 1TQZA 3K9PB 3OLMD 2JSVX 1GJZA 3IXSA 4GU2A 3PRMB 3M3JA 2KIEA 2UZSA 1TXDA 1FAOA 5AUKA 3VUWA 3MC9A 3BK1A 4WWPA 2L52A 3L08A 1PGBA 1GG3A 1TKEA 2BT6A 2MWNB 2WU5B 2V3PA 1RRBA 5FR6A 1D6EC 2LUEA 4PQ0A 2O2VB 4S0RA 2I1KA 2N0YA 1Z87A 1UH6A 3OJ4B 3ZNZB 1SJED 3W9CB 2JXXA 1JW9D 4MGYE 2MH7A 2N7EA 4HHVA 2WS3B 2LG1A 3Q14C 1NYQA 1WGGA 5M4YB 1JMLA 1WJUA 4XDCA 5DI9B 2Z0QA 5IKCM 5EE0A 1F9JA 1XEEA 3PVLA 1X05A 3QX1A 3AE7B 4WVFB 2DHZA 4NJ6A 1OFFA 3HRDD 2Y5BB 1XODA 4GMXB 5EE9A 4LNNA 1JWSD 1QZEA 3L10B 3L54A 2OEDA 1XD3B 2N7DA 3F0WA 1X86A 2FAZA 3B2FA 3VDZA 4K3BA 2RDGA 3ZRCA 1CJEA 2DFKA 3AE5B 3GZNI 4DBBA 1K53A 4G11A 4GSWA 1WE7A 1N3HA 4QXAB 2K39A 2VZKB 2QHOA 3FM8C 2L00B 3PRPB 1HBKA 2Z0PA 1C4AA 3ABVB 2WDRB 2COCA 4BKSA 1H8CA 2N9EB 5IO9A 2C60A 4AUQC 1HB8A 1XF5L 2LWPA 2N1WA 4TUUA 4TQ0A 1QT9A 2DZJA 1WR1A 3VIAA 2EJ8A 5HI1A 3SFDB 3QARA 3OAWA 3MJ5A 4YTMB 2LOZA 3R7RA 3BVZA 1EVHA 1ZW7A 4IAPA 5I2SA 2M38A 5HE3A 5CHWA 1F2RC 1V1PB 5LOPB 1R7SA 2BGFA 3TFMA 3HK0A 2EMSA 1LGRA 5FR3A 2PIAA 1T0YA 1T3QA 3A98B 2KIGA 1TZOA 1I4GA 2LZ6A 1U27A 1N6ZA 2R61A 1WI1A 4L1BA 3ZGZA 3PGEA 1GB4A 4OZCA 1EUVB 3ML8A 1WRIA 2KJRA 2AQ1B 4ZHPA 1FHOA 2RD0A 3RNFC 1TJEA 3NS1A 1SE9A 3U52E 4LK0M 1F0ZA 3KLSX 3ZTCA 2N0SB 3MFGA 4RNAA 2KWCA 3B1LX 2KO3A 1MHHE 3BIID 1BMLC 1UNQA 2KT7A 1WXVA 4LLGM 2ZPNA 1CMXB 4DHZE 4BOZB 4MK0A 3ZVRA 2KR0A 1NYRA 5AZHA 2OQBA 4OVUA 3T8MA 2M17A 3L0WB 3WIMA 1I4PA 3D8DA 3FSSA 3QK0A 2W82A 3E9OA 1SB3C 1WXMA 3ECIA 1UD7A 5EE1A 3DHIC 1X11A 4W9EA 2FCMA 2PTLA 3JSVA 2CJNA 1KH0A 1TS3A 4D0NB 4GPTB 1CQVA 4RH6A 4NAMA 4C00A 2BYFA 1D4BA 2KVRA 1MIXA 2WYQA 1FNUA 4RCOA 3ZJTA 1UGJA 4JLCA 3E9PA 4DDGD 2IYDB 4F7GA 2DYNA 3ODOA 1GUAB 1BTKA 1F77A 2RR9A 1VCBA 1VDVA 1E90A 1DDVA 2K3UA 2VRWB 4USAA 3PZ7A 2ZEQA 3ULBA 2H88B 1KZ7A 1G6JA 4KIKB 2W2XD 2QKMA 4JL9A 3RMKC 1EWYC 2WXKA 3BYTB 4XZ4A 4N58A 4FBJB 3FC4A 4GB9A 2DLBA 2RRFA 2DYBA 1GC6A 4HB4B 3U8ZA 2MJDA 1VR9A 2PE9A 4K7WA 2UVMA 2FIDA 3PG7A 3RNBC 3OWEB 3O96A 4PS7A 4MSQB 3ZLZA 4WAAA 3N9YC 1V5OA 4ZYSA 1V1OA 3ZXRA 4AP4C 4KKJA 5E6OA 2BKRB 4EZJA 1MI1A 4A6KA 2G4SA 4GDKA 3CMMB 5D3WA 1WGRA 2RSUA 2X38A 4ZRQA 4JWSC 2WXMA 1AQCA 2LUMA 1SEBD 1PGAA 3DHHC 3N1ZC 2ABDA 4C7YA 4DXGA 2OHFA 1EF5A 4JK9A 3SV1A 2NBVB 2WXLA 2O6VB 3SD5A 4EZLA 1XO3A 4JPSA 2ZVNA 2V76A 3T06A 3DWGC 2LJIA 4DWFA 5JZEB 1FCLA 5J2RA 2KFJA 1XLOA 1XR0B 5AUIA 2N4FA 4DIXA 3ZW3A 1WJMA 3VH4B 5AZFA 2SAKA 3G9WA 2J0JA 1WG7A 1K50A 3VVWB 2M4NA 3H7SA 3DCXA 1Q5WB 5C5BB 1N63A 4A3OA 2D9YA 4KAXB 4HJGE 3KRWA 4EKUA 2DENB 4E74A 4H2AA 4KV2A 1XCGA 4N59A 4EJNA 1B55A 3IAS1 1WX8A 1QC6A 3BVGA 2K2UA 1SGHA 1BXTA 2ZW0A 3PVUA 4XWTA 3A1QA 5C3JB 1T0SC 1ACAA 2RUKB 4W9IA 3NUHB 3AECB 2G9HD 2CODA 3U12A 3SDLC 4N6EB 4KHOA 4FJZA 1ZGUB 1DOIA 4IM0A 3WCQA 3L13A 4MH0E 1EWCA 4KGTA 3T3OA 2IJ0A 3ENEA 1B1ZA 2Z59A 1WM3A 1WJ6A 3GZNB 3BINA 5BMGA 2YS3A 3PSCA 5C6RA 4GN1A 4GZUA 2L83A 4OSNA 4G3XB 4NJ7A 2M1MA 3PREA 1PQSA 3AE3B 2MBQA 5L81A 4E3CA 1MG4A 1NTVA 4LJPB 4ZDVA 4NAWA 2G4DB 4MEMA 5IA7A 4ZHOA 4EFOA 4LDTB 1F1HA 4CO7A 1FGYA 2GRIA 3AEBB 1V5UA 2ROZB 2FUG1 5G2NA 4A9AA 2LOXA 1E7VA 4L23A 1FD6A 3ZQ4A 2R09A 1TKYA 3AE9B 2SEBD 4ILHA 1LW3A 2VZKD 3KYDD 4IKGA 3W1SC 3ZVVA 2MKRA 1NVID 3UIPB 2GUMA 3GYOA 1C77A 5DPRA 2A5UA 1BAKA 3DXEA 4URKA 2LFIA 1V89A 1JWBD 3N30A 3DXDA 1E10A 2CKHB 2KX0A 1V5PA 4AQ7A 1WGDA 1NBFC 3A33B 1MKEA 1Z2MA 3RCZA 2PVOD 3DQVA 2OTXA 2WXFA 1IP9A 1E8ZA 4F7ZA 4XYCA 4GNKB 2K6DB 3ML9A 4JQWC 1NTYA 4FHJA 4HDQA 3J9CA 4FHKA 1U4AA 1IBXB 3L16A 4YSXB 2L8JA 4A6FB 5CLLB 1FXIA 2X8XX 4C4VB 4NPNA 1VBGA 2J7QB 2Z14A 4II3B 1WMHA 2XNAC 5HFYA 3SNHA 4OW0A 3RN9C 3U7DA 1T5XD 2B76B 4W9HA 1E9MA 2KC2A 2M56B 2L0FA 4LNKA 2OOBB 2NPTA 2LXCA 2WDQB 2DZIA 3H7PB 3HM3A 4XWWA 1U5DA 2WDVB 4LNIA 3PV1A 2V3SA 5KQ4A 2IGHA 2WP9B 3M63B 1FPYA 2KFKA 5C1ZA 3MC0B 2COFA 4I6LB 3C0RB 2MW5A 4KKIA 1VD2A 2K8HA 1L6VA 2R2OA 2BTEA 1SJHD 1XXGA 3UQBA 1Y56A 2LJ5A 4KDIC 1OQRA 4RMAA 3MHZA 2N23A 2WXGA 5IOIA 3V6CB 3P63A 2XBBC 2QC8A 1KI1B 2YLMA 1YN3A 4PT5A 4HWIB 2DA0A 2GMIC 2KQSA 4XGAB 4ZRIA 4IOYX 2DX5A 2INCC 4NJCA 1M94A 2J0KA 4YSYB 3TUOA 3CIKA 5LNK1 2K2JA 3D8EA 1TT5B 4YONA 4GOCA 4GDLA 2DIKA 2PMVA 1ZXHA 2GLSA 3L17A 4A8XC 2AEHA 3RZWC 2ELAA 5BO4B 4YTPB 4Z2NA 4FULA 2Q13A 1ZVRA 1SE3A 2D10A 2WLBA 3A58A 1NI2A 2RPQA 5JVLA 1WM2A 2W54A 3T9LA 2K25A 3W5UB 2PKOA 4HB3B 1WGKA 3C8YA 2IY0B 2P0HA 1VRAB 3NWAA 3AEGB 4K3CA 3EA6A 1D3ZA 1M7RA 1LXDA 3ZO5B 3AB5A 2LGIA 3KUCB 2WXQA 2INPE 2BPSA 2J59M 1T0RC 3ODWA 4G50A 2NR2A 4WIPA 1JQ4A 2KUPA 2N7JA 3MJWA 2P0DA 3WA0A 1W1DA 1EU3A 2AL3A 2DBYA 1OY2A 2KQ7A 2ZJDA 2YT1A 2AX5A 1YQ3B 2A4ZA 4I6PA 4MM3B 4RGNA 5HKHA 3R2IA 3DBRI 1WI0A 1K5DB 1MIZB 2KTRB 4KVGB 2M8SA 1KC7A 2LHEA 1UPQA 2G3QB 3I3TB 3EHVA 2MJEA 4KSKC 2K00A 2JYTA 1KF6B 4HEA1 3NZ3A 1AW7A 1L2NA 2FCQA 4P16A 4A3PA 1RAXA 3A9JB 1NENB 1MAIA 2M19A 2L05A 3I63C 1ZKHA 2OJRA 1J19A 4NSWA 1FXTB 2BVCA 3IT6B 1MK9B 1RYJA 1TZ1A 1ET9A 1FNVA 4A55A 2JT4B 3KUZA 3Q8AA 2H7DA 2D11A 2G1EA 3AEFB 1CK1A 4PS3A 3ZIMA 1Z5SB 5HE1A 2DWQA 1LM8B 3H6NA 5GOWB 1J0WA 1WFYA 4JKDA 3GS2A 1ZSQA 3HHMA 4PK1A 2L76A 2ON8A 4G0NB 4S17A 3VUXA 2BQQA 1L6UA 2LULA 2LHDA 2E2XA 4BZAA 1IGDA 2WU2B 3AI5A 3H9DA 5DPSA 4MSMB 4DBGA 1P5TA 4GIVA 1EU4A 1E7UA 3P4QB 2E6XA 3BYYB 5GMVA 2HD5B 2KXJA 1PMSA 1DYQA 2W3RA 3PHXB 2COAA 4CHMA 4LTUA 3FEHA 4IC7B 4M0WB 1FFUA 4IDIA 1FIQA 1L4DB 2NMQA 1ST7A 2W55A 1WJNA 1N61A 3WYFB 4NZLB 5FK9C 2K8CA 5GXGB 3DWMA 4K2PA 3SO6A 4C7ZA 1JRUA 3E9SA 3NVVA 1L0YB 3GE3C 4MELA 2BYEA 4NY0A 1RFAA 5TSSA 1KJTA 2EKIA 2KWDA 3DBLI 1R4NI 4HB2B 1E7PB 2NZ8B 4I6NB 3URYA 2IO2B 2L7RA 4RF0A 2AL6A 1T77A 2M14A 3RULA 4KGRA 3TEXA 1JWMD 1E0ZA 3DPDA 1UNPA 1YD8U 2M0XA 1XX0A 5D3IB 4GMVA 1Q10A 2FCSA 2KNBA 4LNOA 1IYFA 2LGSA 1HTOA 2CS4A 3DDCB 4FA6A 4WWOA 1MG8A 2WXOA 2VSZA 2QJLA 5LG4B 2P0FA 2GBKA 2L1AA 1FO4A 2BS2B 1P3QU 3AU5A 3ZYYX 5L83A 2MP2B 2XQNM 5LXHA 5CTRC 4HPMB 1YN5A 3OHMB 1YOVB 4BOSC 4FXCA 4CQNA 2PW9A 2KJHB 5JHHA 1YNTE 1J7CA 2HTHA 3AE8B 3TMPB 1WXQA 1V1PA 1ZOYB 4JGHB 1FCCC 2IPKD 2I38A 2JRIB 4WJPA 1I2HA 5JH5C 1RFKA 3P4RB 1WY8A 4HAZB 5FI0A 1HE8A 4DHJB 3EGRA 1DIKA 2JZZA 2XK5B 5DH9B 2GBRA 1NVLA 2RGFA 1TY0A 4KHBA 1C9FA 3QCAA 4DX90 2WDTB 1PFJA 2D3GA 2LVPA 1YIWA 3OJ3A 3EFCA 1I4HA 4AJWA 3KW5B 4JKGB 1P98A 4HKZE 4BVUC 3VTVA 1DBHA 2C7MB 1FEHA 3KWLA 2NTTA 3ETRA 3QHTA 4CHKA 3TVVA 1FFVA 2K6QA 4O1NA 4DHZB 2BYTA 2KLCA 3WANA 2YT0A 4L1RA 2KDMA 2Z4DA 1MPHA 1ZDXA 2FJUB 3A8QA 3BVMA 2GOWA 3APDA 4CYEA 3HW2B 3JSVB 3Q3MC 2ZCBA 2DYMA 1WH3A 1Y19B 1GGOA 1Y5OA 1IRSA 1U29A 2RVBB 2N9KA 4ANXA 4TYZA 1GB1A 1U5GA 1WR6E 1WJ1A 1Q0WB 2LGXA 4AOFA 1L5PA 1RJ2A 1YX6B 2IBIB 5HE2A 2JVCA 4F7UP 4BFRA 4UDUC 2WXJA 1ROEA 3N20C 3Q8CA 4QJ5B 1NDDA 2MBEA 1NI3A 3Q3JA 1I4RA 4F1SA 1RLFA 1GAQB 2GBNA 3KWVA 2BS4B 5G5HA 3BWUD 2Y7BA 2V9HA 3D8FA 1ZPSA 5E6PA 3V3XA 2L1CA 3VUYA 4IM3A 2Y8GA 3A8PA 5D3YA 5BYRA 4GXBA 2KCJA 3PRZA 2ZPYA 1XLNA 1I7HA 2XEWA 3TEYA 2KYWA 3DOWA 4KHAA 4HJKA 2CB8A 2GCLA 4C0AA 3RNGC 1OMWA 4BKTA 3A9KB 4ZRPA 1QQRA 4WWNA 4GDKB 1T6BX 2HDEA 4PYUA 2UWQA 3NZUA 3Q3NC 2K49A 5G5GA 2D4QA 1KZGA 3O13A 2MSED 1E8YA 2KK8A 1XD4A 1YJIA 1UZXB 1ZXIA 3P42A 1DOXA 2D9WA 2NS5A 1GC7A 4YT0B 1J7BA 1AWEA 4BBKA 3WALA 2D9ZA 1X1MA 2MFQA 3P6AA 1DOYA 2C7NB 4US8A 3RZFA 3BY4B 2QDFA 4NQLB 4Z2MB 5D6JB 3HUIA 2WXNA 1GOZA 1QF6A 2HE7A 1E8WA 3DVNU 2KUQA 1V5MA 5J3QA 1P7FA 4PS8A 2JY6A 1NU2A 3PLVA 2J0MA 3N1XC 4CSQA 3UGBB 4JKFA 3U30A 3H8HA 4W9KA 2NVUI 1STEA 3D32A 1RM6C 2LGDA 5CX3A 3TJPA 4BAXA 3A1QB 1UBQA 3NVWA 2KDFB 2X0SA 1K52A 1JCKB 2Y5CA 2RLOA 2I5FA 1E8XA 4OVZA 2K8BA 3JW0X 5HE0A 1EGXA 3V61A 3L4PA 3P1MA 4CHJA 2Z13A 5J3TA 2BKFA 1ZP0B 2RGNB 3TCAA 3W1YA 3B2GA 1P0RA 4TMAB 4AJYB 2Z59B 2IO3B 3DBLB 3QWZB 5HG2A 4YL8A 1R4NB 3NOBA 3HVDA 2IO1B 3NSUA 1DDWA 3TIXA 1J7AA 2BWFA 3ZTDA 3M62B 5KCVA 2LBBA 4W9LA 1SHCA 3VAWA 4X57B 3ML4A 2DZKA 4IFSA 4HAUB 3M95A 3ODXA 1WWTA 4NAWB 3RUIB 5FI1A 3H1UA 1YQ4B 4N9F4 1ZM0A 2V0GA 2KKCA 5JHGA 2LI5A 1L4ZB 2DHJA 2WQYB 1VJKA 1HEZE 1MVKA 2MBHA 2MJ3A 1OQQA 2RDHA 2NBWB 3A4SC 5AEKB 1Y8RC 1E6EB 2MEKA 2FE8A 3WAPA 1M7EA 3UQAA 1OGWA 2WWZA 4P1BC 2J53A 5D3XA 2JZ3B 2R2QA 2FDQA 1ZUD2 4IG7B 1QOBA 3KVFB 4OZAA 4JK8A 4L6EA 2QILA 4MT5A 3RNEC 1V88A 1Q1OA 3R8BA 2MWSB 2ADZA 2D9VA 3MPXA 2AYOB 2V4IB 3KH0A 3SHQA 3DXCA 5BYQA 2DHKA 3HIZA 1OEYA 4HDOA 1WMHB 1DGJA 2WNMA 1MHXA 1OQYA 1SBBB 3C19A 3RNCC 1NEKB 2KDEB 3AE4B 1IBXA 1YJJA 3LJUX 1M4VA 2JUOA 4C4VA 3VOQA 4M00A 3B77A 2ZNVC 3GE8C 2KACA 2INNE 2NPTB 3DHGC 4FLHA 4IWPA 1SIFA 4HCPB 3P7ZA 4LCDE 5EE3A 1JDEA 2CHZA 2N9LA 4ILJA 2LEKA 5TR5A 3NVZA 2CY5A 1UUPA 2RSGA 5BYSA 1EM7A 4B0EA 2KFKB 2LASA 3TSSA 2YF0A 2Q5WD 2FCNA 1H4RA 4OHJA 2KHWB 4MJSB 2DX1A 4W9FA 3VQIA 3JVZX 2LKOA 3MP9A 2NCNA 2WGSA 1AWDA 3B0AA 4ZYNA 2IYBA 1I42A 4ZRJA 4ILGB 5BMHA 2NMBA 1TS2A 4TQ1A 3VRBB 1WRDB 4WQMA 5IRSA 2J4XA 3N32A 1FNWA 4DK5A 1C4PA 1YQBA 2KQ4X 2ZCCA 3AM9A 3HQCA 3AN1A 3QIJA 4GDLB 2CQUA 2GBJA 1RRPB 1FGZA 2DKPA 3M1IB 1WVHA 3AU4A 4MH8A 4FN2A 1FHWA 1D5MC 5G55A 5BMIA 5C2TB 3LYYA 4HPLB 2IDYA 2WXPA 2R0DA 5H8YE 2JWZA 3Q8BA 2DHIA 3V5WA 2ICIA 2L0TA 1I35A 4P6VF 2Z0DB 4BKGA 3GYPA 2V4LA 2V1YA 4DXFA 1HZ6A 3CIRB 4JWUC 2DYQA 2VH2A 4QJ4B 4H8SA 3RFZB 3PP2A 2WXRA 2H7EA 4Q2JA 1K8RB 3HIEA 3VTWA 1XLPA 2JYEA 3ZDMC 4K17A 2X18A 3FILB 2KN5A 3KYCD 2PZ1A 2ELBA 2R2YA 2MQJA 3PTFC 4LJOB 3ZNHB 4IW0A 4K1RB 1JWAD 2FJ9A 2PEAA 2DYOA 4NNJB 1V2YA 1WX9A 4MM3A 2O6VD 4J6IA 3P4PB 1SIJA 3V62A 1PUTA 2ZW1A 4JKAA 4JKBA 3W2DA 2BYVE 3GP7A 2FJLA 4B0MA 1WX7A 2KTRA 1MK7B 4ACFA 5IN7A 1TJ6A 2ROVA 5CHFA 1WGUA 2E3TA 1OEYJ 1P6SA 1FRRA 1HQRD 3NZSA 2COPA 5DHFB 4LNFA 3KSYA 2AQ2B 3DBSA 4PYZA 1TYGB 4JIOU 4M02A 4E71A 1FB8A 3PZ8A 1V9JA 2D3CA 2PPHA 4FJVB 1WIAA 3AE6B 1QOFA 2Z0EB 2KWUB 3QJZA 1ET6A 2IFSA 4TKNA 4KGSA 1KLUD 2DTCA 2BBCA 3AEAB 4M01A 4K2OA 4NQKE 1P3RA 1KLVA 1N5WA 3ALBA 1QQGA 3CXBB 3UI3A 5D2MB 3MDBC 1WZ3A 2D2QA 3IG3A 2O2VA 4B6HA 3E66A 2LRUA 4HAVB 1TBEA 2ZKMX 1UGMA 2KWVB 4A90A 3NY5A 1VZ6A 2LVOA 2BWES 2RDBC 3UINB 4WJOA 1ACCA 2CU1A 2PE6B 3NWDA 4WJ7A 2GCJA 2NBUA 3AEDB 3X23A 2MX2A 4LDTD 2LXAA 3F5RA 2WXIA 4HLEA 4RM9A 4KZCA 5H92C 1WYGA 5DPTA 1D5XC 4DDID 4A5KA 2UYZB 4M0WA 5JP4A 2NTSA 4F7HA 1U5FA 4K7SA 1U5EA 1HZ5A 1YX5B 1J8CA 4TV3A 2IZVB 1FRDA 2L3ZA 2D3BA 3NHEB 2L2IA 2CU3A 2GJYA 3ENBA 2EKEC 2KC1A 3JYUA 3PLUA 3IT4B 1TY2A 2H89B 4II2B 4MGZE 2XN9C 3T3NA 1P7EA 1H10A 1V61A 1C76A 1L0VB 4B95A 4MACA 3NJTA 2W2XC 1XKEA 3S2AA 1SE2A 4BBNC 4IOIE 1KLGD 3AE1B 1T0QC 3EC8A 2FUHB 3AXCA 2KOXA 4HCNB 3ZJVA 2G35A 3TW1A 2OJWA 3HSAA 2MLBA 1DDMA 2J42A 4RGMA 3QC8B 2QSDA 3V6EB 3RNAC 3ZXVA 3LB8C 1XT9B 4KDLB 4MT7A 3B08A 2ZVOA 1I4XA 2DKQA 1C3TA 3VTUA 1DROA 2MCNB 1S3SG 3Q8EA 2LVQA 3AEEB 3DBHI 1VZ8A 1SE4A 4DXAB 3NWFA 4MGKE 2HTHB 2MP2A 2Y3AA 1KM7A 2BF8B 3IHPC 4W9DA 1LFDA 4HAWB 2DLWA 2YS1A 2WXHA 2R82A 1SF0A 3SEBA 4ICUA 3WAMA 4IWQA 4XWXA 4KHBB 1SXTA 1NTIA 3PS6A 2KJ6A 3OG5A 2MRPA 1KFYB 4GGQA 1TS5A 1BTNA 5C79A 3HM6X 2XK5A 3SFEB 1WXAA 5D3DA 4P1CC 4ZOHC 1VBHA 1LB1A 1FHXA 3RYTA 4EZKA 3U2SC 3SYXA 3ZJUA 5FKAC 3UIOB 2K5PA 3AE2B 4PNKA 1PYWD 2KX3A 1A5RA 4QAYA 4JKGA 2W2WA 1BWNA 1C1YB 4IUMB 4C56C 5IAAC 2YVCA 3WAOA 2VH1A 3UZTA 4HRSA 3QAQA 4K7UA 2IO0B 1PLSA 5DCNA 1HA5A 2KDIA 3BJIA 2C7HA 3EECA 4HXDA 2RNRB 2KN4A 4W9CA 2JU6X 3PT2B 4JE3B 3Q3FA 1AARA 2L32A 1HB6A 2N1VA 4JKEA 2GI9A 2Y5PA 4EE2A 2FIFA 1EO6A 1QILA 2IGDA 4XX5A 3TO1A 4YWGG 4WSFA 1ZC3B 3Q8FA 1IGCA 3DBRB 4EOYA 3Q6BA 3VRAB 2ONQA 1MI0A 1PGXA 1UBIA 2YEPB 3OANA 2C5LC 3AULA 3Q2AC 1YMHE 5JHAA 4DQOC 4A6QA 4KIKA 1ENFA 3N7CA 2KTFA 4EEWA 4J3OD 2JZPA 1UWMA 4HPPA 3ZRFA 1V80A 2JWUA 2DZMA 3MHSD 4EUTA 4HSIA 1PDXA 3W1SA 2I2YA 4ARIA 4WAFA 3DVNV 2I5CA 2CR5A 3CWIA 1W1HA 4KZ0A 4XC2A 3NRZA 5LXIB 4HAYB 2K8EA 1WE6A 2ZZPB 4IM2A 2YS5A 3N1YC 3LDZE 1IUEA 1JWUD 4MDKE 2WHIA 1A70A 3PSEB 2YSZA 3FVCA 2QEJC 3GB1A 4M8MA 5CLQB 1ESFA 1V5TA 1X1GA 1ZDVA 3NW8A 3NS8A 4RFBA 1S1QB 3A9KA 1MJDA 5J17A 2JP2A 3FP5A 1C4CA 1MPEA 2AWTA 4B9KA 3PPAA 2JF5A 2C9WB 4BBNF 3ZKJC 2RQ1A 1DYNA 1V86A 1WGHA 1TGZB 1QLBB 1R4MI 2ZNVB 3P4SB 5L95C 2Y8FA 3E56A 1W1GA 2NBVA 2O6VA 4ZRKA 2KD0A 2B3AA 1UEFA
chains in the Genus database with same CATH topology
3QA8A 5LONB 4JKCA 1P1AA 3ZUNA 2EC1A 2KLGA 5C5BA 4HAXB 2CAYA 3R3MA 5D7GA 4HATB 2JPHA 1WYWB 3PEGA 1P9DU 5D3VA 1BT0A 1XQQA 1V6EA 5KHOA 2KMCA 3R7QA 1I7AA 2D9XA 4W9JA 5DPWA 1V81A 3N3KB 2N9PC 3DCGA 4ASWC 4HK2A 2DAFA 1V49A 2MA9B 4FADA 2PJHA 4DX8A 4ICVA 4HVBA 5D27A 3IFWB 3VH3B 3V60A 2HJ8A 3EFUA 5E6NA 3PVWA 3RCPA 3X0WA 3VXWA 1TTNA 4W9GA 4BKSD 4HB0B 1WGYA 2GBMA 2KDBA 4A6HA 5IJMA 2LYDA 1GNUA 2VRRB 3IVFA 5J3YA 2WX0A 3R66C 3TL5A 4K81A 2LRWA 2FNJB 1IPGA 1L7YA 1EF1A 2MBBB 1WXSA 1U2BA 3KY9A 3O65B 2GS0A 3P2BA 4A6FA 2P8VA 3SU8X 4ANWA 4DHJD 3ZDTA 4ANUA 2LGYA 3DVGX 4JK7A 4FJYA 1E5WA 1LQBA 3PZDA 1Q67A 4B6WA 3H7PA 1WF9A 4OVVA 2DAJA 1K5GB 2UZRA 3RD2A 4ANVA 3CSFA 2HRJA 3PHWB 3VHTC 3IBEA 5EFXA 3RT3B 3GOEA 2WX1A 4JKHA 4MJSA 2DX5B 4AWJA 1OQNA 2CHWA 4RM8A 1EAZA 3KUDB 2QKLA 4WJNA 2MDXA 4EMOA 2I1JA 5KHQA 1ZC4B 3SBGA 2CHXA 1YJ1A 2YRYA 4MGIE 1X1FA 5DHAB 1OTRB 4P7IA 5JLJB 3FLVA 1UNRA 2ASQA 2KGXB 4M8NA 5D94A 2D07B 2WH5A 3K9OB 3APCA 1KBLA 2G45B 4IWOA 4WQOB 1UELA 5JHBA 3VFKA 1J0GA 3DVGY 2REXA 3QBVB 2KZRA 1FOEA 2MBOA 3UF8A 3A4RA 1KOTA 1WJ4A 3EPYA 5J18A 3TBLD 3APFA 1WGQA 3SUZA 2KANA 2LD9A 4KSLC 3SBTA 3KZ1A 2CRFA 2IY1B 5AZGA 2CY4A 5C23A 1WZ0A 4Y94A 5CHVC 2W9NA 2BCJA 3ULCA 4A20A 3LJ3A 2EMTA 2VKIA 3ONSA 2JRHA 4MY6A 3CSTA 3A9JA 3E9LA 1UPRA 5DIFB 3QQ8B 2N9XA 3MTNB 2KMAA 3KRXA 5EDSA 5KQ1A 2K1FA 5C16A 4F8CB 2Z0OA 3ZNID 3AJ4A 1ISNA 4WJQA 5LLIA 3QWMA 3ZNGC 3CF6E 2DN6A 1TQZA 3K9PB 3OLMD 1GJZA 4GU2A 3PRMB 3M3JA 2UZSA 1TXDA 1FAOA 3VUWA 4WWPA 3L08A 1GG3A 2MWNB 1RRBA 5FR6A 2LUEA 4PQ0A 2O2VB 2I1KA 2N0YA 1Z87A 1UH6A 3OJ4B 3ZNZB 2JXXA 4MGYE 2N7EA 4HHVA 2LG1A 1WGGA 1WJUA 5DI9B 2Z0QA 1F9JA 3PVLA 1X05A 3QX1A 4WVFB 2DHZA 4NJ6A 2Y5BB 1XODA 4GMXB 1QZEA 3L10B 3L54A 1XD3B 2N7DA 3F0WA 1X86A 2FAZA 3VDZA 3ZRCA 2DFKA 3GZNI 4DBBA 4G11A 4GSWA 1WE7A 1N3HA 2K39A 2QHOA 3FM8C 2L00B 3PRPB 1HBKA 2Z0PA 2COCA 4BKSA 1H8CA 2N9EB 4AUQC 2C60A 1HB8A 2LWPA 2N1WA 4TUUA 4TQ0A 2DZJA 1WR1A 3VIAA 2EJ8A 3QARA 3OAWA 2LOZA 3R7RA 1EVHA 1ZW7A 4IAPA 2M38A 5HE3A 5CHWA 5LOPB 3TFMA 2BGFA 3HK0A 2EMSA 1T0YA 3A98B 2LZ6A 1U27A 1WI1A 3PGEA 1EUVB 3ML8A 2KJRA 1FHOA 2RD0A 1SE9A 3ZTCA 2KWCA 3B1LX 2KO3A 1UNQA 1WXVA 2ZPNA 1CMXB 4DHZE 4BOZB 4MK0A 3ZVRA 5AZHA 2OQBA 4OVUA 3T8MA 2M17A 3L0WB 3WIMA 3D8DA 3FSSA 3QK0A 3E9OA 1WXMA 3ECIA 1UD7A 4W9EA 1X11A 2FCMA 3JSVA 4D0NB 4GPTB 2BYFA 2KVRA 1MIXA 2WYQA 4JLCA 3E9PA 4DDGD 2IYDB 4F7GA 2DYNA 3ODOA 1GUAB 1BTKA 2RR9A 1VCBA 1E90A 1DDVA 2VRWB 2ZEQA 3ULBA 1KZ7A 1G6JA 4KIKB 2W2XD 2QKMA 4JL9A 4XZ4A 4FBJB 4GB9A 2DYBA 1GC6A 4HB4B 3U8ZA 2PE9A 4K7WA 2UVMA 2FIDA 3PG7A 3O96A 4PS7A 4MSQB 3ZLZA 4WAAA 1V5OA 4AP4C 5E6OA 2BKRB 4EZJA 4A6KA 2G4SA 4GDKA 3CMMB 5D3WA 1WGRA 2RSUA 1AQCA 2ABDA 1EF5A 4JK9A 3SV1A 2NBVB 2O6VB 3SD5A 4EZLA 2ZVNA 2V76A 3T06A 4DWFA 5JZEB 5J2RA 2KFJA 1XR0B 2N4FA 3ZW3A 1WJMA 3VH4B 5AZFA 3G9WA 2J0JA 1WG7A 3VVWB 2M4NA 3H7SA 1Q5WB 5C5BB 4A3OA 2D9YA 4KAXB 3KRWA 4EKUA 2DENB 4E74A 4KV2A 1XCGA 4EJNA 1B55A 1WX8A 1QC6A 2K2UA 1SGHA 3PVUA 3A1QA 1ACAA 2RUKB 4W9IA 2CODA 3SDLC 4KHOA 4FJZA 1ZGUB 4IM0A 3L13A 4MH0E 3ENEA 1WM3A 1WJ6A 3BINA 2YS3A 3PSCA 5C6RA 4GN1A 4GZUA 4G3XB 4NJ7A 2M1MA 3PREA 1PQSA 2MBQA 5L81A 4E3CA 1NTVA 4LJPB 4ZDVA 4NAWA 2G4DB 4MEMA 5IA7A 4EFOA 4LDTB 4CO7A 1FGYA 1V5UA 2ROZB 5G2NA 2LOXA 1E7VA 2R09A 4ILHA 1LW3A 3KYDD 3W1SC 3ZVVA 2MKRA 3UIPB 3GYOA 5DPRA 2A5UA 1BAKA 3DXEA 4URKA 1V89A 3N30A 3DXDA 2CKHB 2KX0A 1V5PA 1WGDA 1NBFC 3A33B 1MKEA 1Z2MA 3RCZA 3DQVA 2OTXA 1IP9A 1E8ZA 4F7ZA 2K6DB 3ML9A 4JQWC 1NTYA 4FHJA 4HDQA 4FHKA 1U4AA 3L16A 2L8JA 4A6FB 5CLLB 4NPNA 1VBGA 2J7QB 4II3B 1WMHA 3SNHA 3U7DA 4W9HA 2KC2A 2L0FA 2OOBB 2NPTA 2LXCA 2DZIA 3H7PB 3HM3A 1U5DA 3PV1A 2V3SA 5KQ4A 3M63B 2KFKA 5C1ZA 2COFA 4I6LB 3C0RB 2MW5A 1VD2A 2K8HA 2R2OA 3UQBA 4KDIC 2LJ5A 4RMAA 2N23A 3V6CB 2XBBC 1KI1B 2YLMA 4HWIB 2DA0A 2GMIC 2KQSA 4ZRIA 4IOYX 2DX5A 1M94A 2J0KA 3CIKA 2K2JA 3D8EA 4YONA 4GOCA 4GDLA 2DIKA 3L17A 2AEHA 3RZWC 2ELAA 5BO4B 4Z2NA 4FULA 2Q13A 1ZVRA 2D10A 1NI2A 2RPQA 5JVLA 1WM2A 3T9LA 2K25A 4HB3B 2IY0B 2P0HA 1D3ZA 1M7RA 1LXDA 3ZO5B 3KUCB 2BPSA 2J59M 3ODWA 4G50A 2NR2A 2KUPA 3MJWA 2P0DA 3WA0A 1W1DA 2AL3A 1OY2A 2KQ7A 2ZJDA 2YT1A 2A4ZA 4I6PA 5HKHA 3DBRI 1WI0A 1K5DB 1MIZB 2KTRB 4KVGB 2M8SA 1KC7A 1UPQA 2G3QB 3I3TB 3EHVA 4KSKC 2K00A 1L2NA 2FCQA 4A3PA 1RAXA 3A9JB 1MAIA 2L05A 1ZKHA 2OJRA 1J19A 4NSWA 1FXTB 1MK9B 1TZ1A 2JT4B 3KUZA 2H7DA 2D11A 4PS3A 3ZIMA 1Z5SB 5HE1A 1LM8B 3H6NA 5GOWB 1J0WA 1WFYA 4JKDA 1ZSQA 3HHMA 2L76A 4G0NB 3VUXA 2LULA 2E2XA 3AI5A 3H9DA 5DPSA 4MSMB 4DBGA 1P5TA 4GIVA 1E7UA 5GMVA 2HD5B 2KXJA 1PMSA 3PHXB 2COAA 4CHMA 3FEHA 4IC7B 4M0WB 1ST7A 1WJNA 3WYFB 2K8CA 4K2PA 3SO6A 1JRUA 4MELA 2BYEA 4NY0A 1RFAA 1KJTA 3DBLI 1R4NI 4HB2B 2NZ8B 4I6NB 2IO2B 2L7RA 2AL6A 2M14A 3RULA 3DPDA 1UNPA 1YD8U 2M0XA 1XX0A 4GMVA 2FCSA 2KNBA 1IYFA 2CS4A 3DDCB 4FA6A 4WWOA 1MG8A 2VSZA 2P0FA 2GBKA 1P3QU 3AU5A 5L83A 2MP2B 2XQNM 5LXHA 5CTRC 4HPMB 4BOSC 2KJHB 5JHHA 2HTHA 3TMPB 4JGHB 2JRIB 4WJPA 1I2HA 5JH5C 1WY8A 4HAZB 5FI0A 1HE8A 4DHJB 1DIKA 2JZZA 2XK5B 5DH9B 2GBRA 1NVLA 2RGFA 3QCAA 4DX90 2WDTB 1PFJA 2D3GA 2LVPA 1YIWA 3OJ3A 4AJWA 3KW5B 4JKGB 1P98A 4BVUC 3VTVA 1DBHA 2C7MB 3QHTA 4CHKA 3TVVA 2K6QA 4DHZB 2KLCA 3WANA 2YT0A 1MPHA 3A8QA 2GOWA 3APDA 4CYEA 3HW2B 3JSVB 2ZCBA 2DYMA 1WH3A 1Y19B 1GGOA 1Y5OA 1IRSA 1U29A 2RVBB 4ANXA 4TYZA 1U5GA 1WR6E 1WJ1A 1Q0WB 2LGXA 4AOFA 1RJ2A 1YX6B 2IBIB 5HE2A 2JVCA 4F7UP 4BFRA 1NDDA 2MBEA 3Q3JA 4F1SA 1RLFA 2GBNA 2Y7BA 3D8FA 5E6PA 2L1CA 3VUYA 4IM3A 2Y8GA 3A8PA 5D3YA 4GXBA 2KCJA 3PRZA 2ZPYA 2XEWA 3DOWA 4KHAA 4HJKA 2CB8A 2GCLA 4C0AA 1OMWA 4BKTA 3A9KB 4WWNA 4GDKB 4PYUA 2UWQA 3NZUA 2D4QA 1KZGA 2MSED 1E8YA 2KK8A 1XD4A 1UZXB 2D9WA 2NS5A 1GC7A 1AWEA 4BBKA 3WALA 2D9ZA 1X1MA 2MFQA 3P6AA 2C7NB 3RZFA 3BY4B 4NQLB 4Z2MB 5D6JB 2HE7A 1E8WA 3DVNU 1V5MA 5J3QA 4PS8A 2JY6A 1NU2A 3PLVA 2J0MA 3UGBB 4JKFA 3U30A 4W9KA 2NVUI 3D32A 2LGDA 5CX3A 3TJPA 3A1QB 1UBQA 2KDFB 2X0SA 2RLOA 2I5FA 1E8XA 2K8BA 3JW0X 5HE0A 1EGXA 3V61A 4CHJA 5J3TA 2BKFA 2RGNB 3TCAA 3W1YA 1P0RA 4AJYB 2Z59B 2IO3B 3QWZB 4YL8A 3NOBA 2IO1B 3NSUA 1DDWA 3TIXA 2BWFA 3ZTDA 3M62B 5KCVA 2LBBA 4W9LA 1SHCA 3VAWA 4X57B 3ML4A 2DZKA 4IFSA 4HAUB 3M95A 3ODXA 4NAWB 3RUIB 5FI1A 3H1UA 4N9F4 1ZM0A 2KKCA 5JHGA 2LI5A 2DHJA 2MBHA 2NBWB 3A4SC 5AEKB 1Y8RC 3WAPA 1M7EA 3UQAA 1OGWA 2WWZA 5D3XA 2JZ3B 2R2QA 2FDQA 4IG7B 3KVFB 4JK8A 4L6EA 1V88A 1Q1OA 2MWSB 2ADZA 2D9VA 3MPXA 2AYOB 3KH0A 3SHQA 3DXCA 2DHKA 3HIZA 1OEYA 4HDOA 1WMHB 1OQYA 2KDEB 3LJUX 2JUOA 3VOQA 2ZNVC 2NPTB 4FLHA 4IWPA 1SIFA 4HCPB 3P7ZA 4LCDE 1JDEA 2CHZA 4ILJA 5TR5A 2CY5A 2RSGA 2KFKB 2LASA 2YF0A 2FCNA 1H4RA 2KHWB 4MJSB 2DX1A 4W9FA 3VQIA 3JVZX 2LKOA 2NCNA 3B0AA 4ZYNA 2IYBA 1I42A 4ZRJA 4ILGB 2NMBA 4TQ1A 1WRDB 3N32A 4DK5A 1YQBA 2ZCCA 3HQCA 3QIJA 4GDLB 2CQUA 2GBJA 1RRPB 1FGZA 2DKPA 3M1IB 1WVHA 3AU4A 4FN2A 1FHWA 5G55A 4HPLB 2R0DA 2JWZA 2DHIA 3V5WA 2L0TA 1I35A 2Z0DB 4BKGA 3GYPA 2V4LA 2V1YA 2DYQA 4H8SA 3PP2A 2H7EA 1K8RB 3VTWA 3ZDMC 4K17A 2X18A 2KN5A 3KYCD 2PZ1A 2ELBA 2MQJA 3PTFC 4LJOB 3ZNHB 4IW0A 4K1RB 2FJ9A 2PEAA 2DYOA 4NNJB 1V2YA 1WX9A 4MM3A 2O6VD 4J6IA 3V62A 4JKAA 4JKBA 2BYVE 2FJLA 1WX7A 2KTRA 1MK7B 1TJ6A 2ROVA 5CHFA 1WGUA 1OEYJ 1P6SA 3NZSA 2COPA 5DHFB 3KSYA 3DBSA 4PYZA 4JIOU 4E71A 1FB8A 1V9JA 2PPHA 4FJVB 1WIAA 2Z0EB 2KWUB 3QJZA 2IFSA 4TKNA 2DTCA 4K2OA 4NQKE 1P3RA 1KLVA 3ALBA 1QQGA 3CXBB 5D2MB 3MDBC 1WZ3A 2D2QA 3IG3A 2O2VA 4B6HA 3E66A 2LRUA 4HAVB 1TBEA 1UGMA 2KWVB 3NY5A 2LVOA 2BWES 3UINB 4WJOA 2CU1A 2PE6B 4WJ7A 2GCJA 2NBUA 3X23A 2MX2A 4LDTD 2LXAA 3F5RA 4HLEA 4RM9A 4KZCA 5DPTA 4DDID 4A5KA 2UYZB 5JP4A 4F7HA 1U5FA 4K7SA 1U5EA 1YX5B 1J8CA 4TV3A 2IZVB 2L3ZA 3NHEB 2L2IA 2GJYA 3ENBA 2EKEC 2KC1A 3JYUA 3PLUA 4II2B 4MGZE 1H10A 1V61A 4B95A 2W2XC 1XKEA 3S2AA 4BBNC 3EC8A 2FUHB 3AXCA 2KOXA 4HCNB 2G35A 3TW1A 2MLBA 1DDMA 3QC8B 3V6EB 1XT9B 4KDLB 4MT7A 3B08A 2ZVOA 2DKQA 1C3TA 3VTUA 1DROA 2MCNB 1S3SG 2LVQA 3DBHI 4DXAB 4MGKE 2HTHB 2MP2A 1KM7A 2BF8B 3IHPC 4W9DA 1LFDA 4HAWB 2DLWA 2YS1A 2R82A 4ICUA 3WAMA 4IWQA 4XWXA 4KHBB 1NTIA 3PS6A 2KJ6A 2MRPA 4GGQA 1BTNA 5C79A 3HM6X 2XK5A 1WXAA 1VBHA 1LB1A 1FHXA 3RYTA 4EZKA 3SYXA 3UIOB 4PNKA 2KX3A 1A5RA 4JKGA 2W2WA 1BWNA 1C1YB 4IUMB 5IAAC 2YVCA 3WAOA 3UZTA 3QAQA 4K7UA 2IO0B 1PLSA 5DCNA 2KDIA 3BJIA 2C7HA 3EECA 4HXDA 2RNRB 4W9CA 3PT2B 3Q3FA 1AARA 1HB6A 2N1VA 4JKEA 2FIFA 1EO6A 4XX5A 3TO1A 4WSFA 1ZC3B 4EOYA 1UBIA 3OANA 2C5LC 3AULA 5JHAA 4KIKA 3N7CA 2KTFA 4EEWA 3ZRFA 1V80A 2DZMA 3MHSD 4EUTA 3W1SA 3DVNV 2I5CA 2CR5A 1W1HA 4KZ0A 4XC2A 5LXIB 4HAYB 1WE6A 2ZZPB 4IM2A 2YS5A 3LDZE 4MDKE 3PSEB 2YSZA 4M8MA 5CLQB 1V5TA 1X1GA 3NS8A 1S1QB 3A9KA 5J17A 2JP2A 3FP5A 2AWTA 4B9KA 3PPAA 2JF5A 2C9WB 4BBNF 3ZKJC 2RQ1A 1DYNA 1V86A 1WGHA 1TGZB 5L95C 1R4MI 2ZNVB 2Y8FA 1W1GA 2O6VA 4ZRKA 2KD0A 2B3AA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QA8 A;  5LON B;  1P1A A;  3ZUN A;  2EC1 A;  2KLG A;  5C5B A;  4HAX B;  2CAY A;  3R3M A;  5D7G A;  4HAT B;  2JPH A;  1WYW B;  3PEG A;  1P9D U;  5D3V A;  1BT0 A;  1XQQ A;  1V6E A;  5KHO A;  2KMC A;  3R7Q A;  1I7A A;  2D9X A;  4W9J A;  5DPW A;  1V81 A;  3N3K B;  2N9P C;  3DCG A;  4ASW C;  4HK2 A;  2DAF A;  1V49 A;  2MA9 B;  4FAD A;  2PJH A;  4DX8 A;  4ICV A;  4HVB A;  5D27 A;  3IFW B;  3VH3 B;  3V60 A;  2HJ8 A;  3EFU A;  5E6N A;  3PVW A;  3RCP A;  3X0W A;  3VXW A;  1TTN A;  4W9G A;  4BKS D;  4HB0 B;  1WGY A;  2GBM A;  2KDB A;  4A6H A;  5IJM A;  2LYD A;  1GNU A;  2VRR B;  3IVF A;  5J3Y A;  2WX0 A;  3R66 C;  3TL5 A;  4K81 A;  2LRW A;  2FNJ B;  1IPG A;  1L7Y A;  1EF1 A;  2MBB B;  1WXS A;  1U2B A;  3KY9 A;  3O65 B;  2GS0 A;  3P2B A;  4A6F A;  2P8V A;  3SU8 X;  4ANW A;  4DHJ D;  3ZDT A;  4ANU A;  2LGY A;  3DVG X;  4FJY A;  1E5W A;  1LQB A;  3PZD A;  1Q67 A;  4B6W A;  3H7P A;  1WF9 A;  4OVV A;  2DAJ A;  1K5G B;  2UZR A;  3RD2 A;  4ANV A;  3CSF A;  2HRJ A;  3PHW B;  3VHT C;  3IBE A;  5EFX A;  3RT3 B;  3GOE A;  2WX1 A;  4MJS A;  2DX5 B;  4AWJ A;  1OQN A;  2CHW A;  4RM8 A;  1EAZ A;  3KUD B;  2QKL A;  4WJN A;  2MDX A;  4EMO A;  2I1J A;  5KHQ A;  1ZC4 B;  2CHX A;  1YJ1 A;  2YRY A;  4MGI E;  1X1F A;  5DHA B;  1OTR B;  4P7I A;  5JLJ B;  3FLV A;  1UNR A;  2ASQ A;  2KGX B;  4M8N A;  5D94 A;  2D07 B;  2WH5 A;  3K9O B;  3APC A;  2G45 B;  4IWO A;  4WQO B;  1UEL A;  5JHB A;  3VFK A;  1J0G A;  3DVG Y;  2REX A;  3QBV B;  2KZR A;  1FOE A;  2MBO A;  3UF8 A;  3A4R A;  1KOT A;  1WJ4 A;  3EPY A;  5J18 A;  3TBL D;  3APF A;  1WGQ A;  3SUZ A;  2KAN A;  2LD9 A;  4KSL C;  3KZ1 A;  2CRF A;  2IY1 B;  5AZG A;  2CY4 A;  5C23 A;  1WZ0 A;  4Y94 A;  5CHV C;  2W9N A;  2BCJ A;  3ULC A;  4A20 A;  3LJ3 A;  2EMT A;  2VKI A;  3ONS A;  2JRH A;  4MY6 A;  3CST A;  3A9J A;  1UPR A;  5DIF B;  3QQ8 B;  2N9X A;  3MTN B;  2KMA A;  3KRX A;  5EDS A;  5KQ1 A;  2K1F A;  5C16 A;  4F8C B;  2Z0O A;  3ZNI D;  3AJ4 A;  1ISN A;  4WJQ A;  5LLI A;  3QWM A;  3ZNG C;  3CF6 E;  2DN6 A;  1TQZ A;  3K9P B;  3OLM D;  1GJZ A;  4GU2 A;  3PRM B;  3M3J A;  2UZS A;  1TXD A;  1FAO A;  3VUW A;  4WWP A;  3L08 A;  1GG3 A;  2MWN B;  1RRB A;  5FR6 A;  2LUE A;  4PQ0 A;  2O2V B;  2I1K A;  2N0Y A;  1Z87 A;  1UH6 A;  3OJ4 B;  3ZNZ B;  2JXX A;  4MGY E;  2N7E A;  4HHV A;  2LG1 A;  1WGG A;  1WJU A;  5DI9 B;  2Z0Q A;  1F9J A;  3PVL A;  1X05 A;  3QX1 A;  4WVF B;  2DHZ A;  4NJ6 A;  2Y5B B;  1XOD A;  4GMX B;  1QZE A;  3L10 B;  3L54 A;  1XD3 B;  2N7D A;  3F0W A;  1X86 A;  2FAZ A;  3VDZ A;  3ZRC A;  2DFK A;  3GZN I;  4DBB A;  4G11 A;  4GSW A;  1WE7 A;  1N3H A;  2K39 A;  2QHO A;  3FM8 C;  2L00 B;  3PRP B;  1HBK A;  2Z0P A;  2COC A;  4BKS A;  1H8C A;  2N9E B;  4AUQ C;  2C60 A;  1HB8 A;  2LWP A;  2N1W A;  4TUU A;  4TQ0 A;  2DZJ A;  1WR1 A;  3VIA A;  2EJ8 A;  3QAR A;  3OAW A;  2LOZ A;  3R7R A;  1EVH A;  1ZW7 A;  4IAP A;  2M38 A;  5HE3 A;  5CHW A;  5LOP B;  3TFM A;  2BGF A;  3HK0 A;  2EMS A;  1T0Y A;  3A98 B;  2LZ6 A;  1U27 A;  1WI1 A;  3PGE A;  1EUV B;  3ML8 A;  2KJR A;  1FHO A;  2RD0 A;  1SE9 A;  3ZTC A;  2KWC A;  3B1L X;  2KO3 A;  1UNQ A;  1WXV A;  2ZPN A;  1CMX B;  4DHZ E;  4BOZ B;  4MK0 A;  3ZVR A;  5AZH A;  2OQB A;  4OVU A;  3T8M A;  2M17 A;  3L0W B;  3WIM A;  3D8D A;  3FSS A;  3QK0 A;  1WXM A;  3ECI A;  1UD7 A;  4W9E A;  1X11 A;  2FCM A;  3JSV A;  4D0N B;  4GPT B;  2BYF A;  2KVR A;  1MIX A;  2WYQ A;  4JLC A;  4DDG D;  2IYD B;  4F7G A;  2DYN A;  3ODO A;  1GUA B;  1BTK A;  2RR9 A;  1VCB A;  1E90 A;  1DDV A;  2VRW B;  2ZEQ A;  3ULB A;  1KZ7 A;  1G6J A;  4KIK B;  2W2X D;  2QKM A;  4JL9 A;  4XZ4 A;  4FBJ B;  4GB9 A;  2DYB A;  1GC6 A;  4HB4 B;  3U8Z A;  2PE9 A;  4K7W A;  2UVM A;  2FID A;  3PG7 A;  3O96 A;  4PS7 A;  4MSQ B;  3ZLZ A;  4WAA A;  1V5O A;  4AP4 C;  5E6O A;  2BKR B;  4EZJ A;  4A6K A;  2G4S A;  4GDK A;  3CMM B;  5D3W A;  1WGR A;  2RSU A;  1AQC A;  2ABD A;  1EF5 A;  3SV1 A;  2NBV B;  2O6V B;  3SD5 A;  4EZL A;  2ZVN A;  2V76 A;  3T06 A;  4DWF A;  5JZE B;  5J2R A;  2KFJ A;  1XR0 B;  2N4F A;  3ZW3 A;  1WJM A;  3VH4 B;  5AZF A;  3G9W A;  2J0J A;  1WG7 A;  3VVW B;  2M4N A;  3H7S A;  1Q5W B;  5C5B B;  4A3O A;  2D9Y A;  4KAX B;  3KRW A;  4EKU A;  2DEN B;  4E74 A;  4KV2 A;  1XCG A;  4EJN A;  1B55 A;  1WX8 A;  1QC6 A;  2K2U A;  1SGH A;  3PVU A;  3A1Q A;  1ACA A;  2RUK B;  4W9I A;  2COD A;  3SDL C;  4KHO A;  4FJZ A;  1ZGU B;  4IM0 A;  3L13 A;  4MH0 E;  3ENE A;  1WM3 A;  1WJ6 A;  3BIN A;  2YS3 A;  3PSC A;  5C6R A;  4GN1 A;  4GZU A;  4G3X B;  4NJ7 A;  2M1M A;  3PRE A;  1PQS A;  2MBQ A;  5L81 A;  4E3C A;  1NTV A;  4LJP B;  4ZDV A;  4NAW A;  2G4D B;  4MEM A;  5IA7 A;  4EFO A;  4LDT B;  4CO7 A;  1FGY A;  1V5U A;  2ROZ B;  5G2N A;  2LOX A;  1E7V A;  2R09 A;  1LW3 A;  3KYD D;  3W1S C;  3ZVV A;  2MKR A;  3UIP B;  3GYO A;  5DPR A;  2A5U A;  1BAK A;  3DXE A;  4URK A;  1V89 A;  3N30 A;  3DXD A;  2CKH B;  2KX0 A;  1V5P A;  1WGD A;  1NBF C;  3A33 B;  1MKE A;  1Z2M A;  3RCZ A;  3DQV A;  2OTX A;  1IP9 A;  1E8Z A;  4F7Z A;  2K6D B;  3ML9 A;  4JQW C;  1NTY A;  4FHJ A;  4HDQ A;  4FHK A;  1U4A A;  3L16 A;  2L8J A;  4A6F B;  5CLL B;  4NPN A;  2J7Q B;  4II3 B;  1WMH A;  3SNH A;  3U7D A;  4W9H A;  2KC2 A;  2L0F A;  2OOB B;  2NPT A;  2LXC A;  2DZI A;  3H7P B;  3HM3 A;  1U5D A;  3PV1 A;  2V3S A;  5KQ4 A;  3M63 B;  2KFK A;  5C1Z A;  2COF A;  4I6L B;  3C0R B;  2MW5 A;  1VD2 A;  2K8H A;  2R2O A;  3UQB A;  4KDI C;  2LJ5 A;  4RMA A;  2N23 A;  3V6C B;  2XBB C;  1KI1 B;  2YLM A;  4HWI B;  2DA0 A;  2GMI C;  2KQS A;  4ZRI A;  4IOY X;  2DX5 A;  1M94 A;  2J0K A;  3CIK A;  2K2J A;  3D8E A;  4YON A;  4GOC A;  4GDL A;  3L17 A;  2AEH A;  3RZW C;  2ELA A;  5BO4 B;  4Z2N A;  4FUL A;  2Q13 A;  1ZVR A;  2D10 A;  1NI2 A;  2RPQ A;  1WM2 A;  3T9L A;  2K25 A;  4HB3 B;  2IY0 B;  2P0H A;  1D3Z A;  1M7R A;  1LXD A;  3ZO5 B;  3KUC B;  2BPS A;  2J59 M;  3ODW A;  4G50 A;  2NR2 A;  2KUP A;  3MJW A;  2P0D A;  3WA0 A;  1W1D A;  2AL3 A;  1OY2 A;  2KQ7 A;  2ZJD A;  2YT1 A;  2A4Z A;  4I6P A;  5HKH A;  3DBR I;  1WI0 A;  1K5D B;  1MIZ B;  2KTR B;  4KVG B;  2M8S A;  1UPQ A;  2G3Q B;  3I3T B;  3EHV A;  4KSK C;  2K00 A;  1L2N A;  2FCQ A;  4A3P A;  1RAX A;  3A9J B;  1MAI A;  2L05 A;  1ZKH A;  2OJR A;  1J19 A;  4NSW A;  1FXT B;  1MK9 B;  1TZ1 A;  2JT4 B;  3KUZ A;  2H7D A;  2D11 A;  4PS3 A;  3ZIM A;  1Z5S B;  5HE1 A;  1LM8 B;  3H6N A;  5GOW B;  1J0W A;  1WFY A;  1ZSQ A;  3HHM A;  2L76 A;  4G0N B;  3VUX A;  2LUL A;  2E2X A;  3AI5 A;  3H9D A;  5DPS A;  4MSM B;  4DBG A;  1P5T A;  4GIV A;  1E7U A;  5GMV A;  2HD5 B;  2KXJ A;  1PMS A;  3PHX B;  2COA A;  4CHM A;  3FEH A;  4IC7 B;  4M0W B;  1ST7 A;  1WJN A;  3WYF B;  2K8C A;  4K2P A;  3SO6 A;  1JRU A;  4MEL A;  2BYE A;  4NY0 A;  1RFA A;  1KJT A;  3DBL I;  1R4N I;  4HB2 B;  2NZ8 B;  4I6N B;  2IO2 B;  2L7R A;  2AL6 A;  2M14 A;  3RUL A;  3DPD A;  1UNP A;  1YD8 U;  2M0X A;  1XX0 A;  4GMV A;  2FCS A;  2KNB A;  1IYF A;  2CS4 A;  3DDC B;  4FA6 A;  4WWO A;  1MG8 A;  2VSZ A;  2P0F A;  2GBK A;  1P3Q U;  3AU5 A;  5L83 A;  2MP2 B;  2XQN M;  5LXH A;  5CTR C;  4HPM B;  4BOS C;  2KJH B;  5JHH A;  2HTH A;  3TMP B;  4JGH B;  2JRI B;  4WJP A;  1I2H A;  5JH5 C;  1WY8 A;  4HAZ B;  5FI0 A;  1HE8 A;  4DHJ B;  2JZZ A;  2XK5 B;  5DH9 B;  2GBR A;  1NVL A;  2RGF A;  3QCA A;  4DX9 0;  2WDT B;  1PFJ A;  2D3G A;  2LVP A;  1YIW A;  3OJ3 A;  4AJW A;  3KW5 B;  4BVU C;  1P98 A;  3VTV A;  1DBH A;  2C7M B;  3QHT A;  4CHK A;  3TVV A;  2K6Q A;  4DHZ B;  2KLC A;  3WAN A;  2YT0 A;  1MPH A;  3A8Q A;  2GOW A;  3APD A;  4CYE A;  3HW2 B;  3JSV B;  2ZCB A;  2DYM A;  1WH3 A;  1Y19 B;  1Y5O A;  1IRS A;  2RVB B;  1U29 A;  4ANX A;  4TYZ A;  1U5G A;  1WR6 E;  1WJ1 A;  1Q0W B;  2LGX A;  4AOF A;  1RJ2 A;  1YX6 B;  2IBI B;  5HE2 A;  2JVC A;  4F7U P;  4BFR A;  1NDD A;  2MBE A;  3Q3J A;  4F1S A;  1RLF A;  2GBN A;  2Y7B A;  3D8F A;  5E6P A;  2L1C A;  3VUY A;  4IM3 A;  2Y8G A;  3A8P A;  5D3Y A;  4GXB A;  2KCJ A;  3PRZ A;  2ZPY A;  2XEW A;  3DOW A;  4KHA A;  4HJK A;  2CB8 A;  2GCL A;  4C0A A;  1OMW A;  4BKT A;  3A9K B;  4WWN A;  4GDK B;  4PYU A;  2UWQ A;  3NZU A;  2D4Q A;  1KZG A;  2MSE D;  1E8Y A;  2KK8 A;  1XD4 A;  1UZX B;  2D9W A;  2NS5 A;  1GC7 A;  1AWE A;  4BBK A;  3WAL A;  2D9Z A;  1X1M A;  2MFQ A;  3P6A A;  2C7N B;  3RZF A;  3BY4 B;  4NQL B;  4Z2M B;  5D6J B;  2HE7 A;  1E8W A;  3DVN U;  1V5M A;  5J3Q A;  4PS8 A;  2JY6 A;  1NU2 A;  3PLV A;  2J0M A;  3UGB B;  3U30 A;  4W9K A;  2NVU I;  3D32 A;  2LGD A;  5CX3 A;  3TJP A;  3A1Q B;  1UBQ A;  2KDF B;  2RLO A;  2I5F A;  1E8X A;  2K8B A;  3JW0 X;  5HE0 A;  1EGX A;  3V61 A;  4CHJ A;  5J3T A;  2BKF A;  2RGN B;  3W1Y A;  3TCA A;  1P0R A;  4AJY B;  2Z59 B;  2IO3 B;  3QWZ B;  4YL8 A;  3NOB A;  2IO1 B;  3NSU A;  1DDW A;  3TIX A;  2BWF A;  3ZTD A;  3M62 B;  5KCV A;  2LBB A;  4W9L A;  1SHC A;  3VAW A;  4X57 B;  3ML4 A;  2DZK A;  4IFS A;  4HAU B;  3M95 A;  3ODX A;  4NAW B;  3RUI B;  5FI1 A;  3H1U A;  4N9F 4;  1ZM0 A;  2KKC A;  5JHG A;  2LI5 A;  2DHJ A;  2MBH A;  2NBW B;  3A4S C;  5AEK B;  1Y8R C;  3WAP A;  1M7E A;  3UQA A;  1OGW A;  2WWZ A;  5D3X A;  2JZ3 B;  2R2Q A;  2FDQ A;  4IG7 B;  3KVF B;  4L6E A;  1V88 A;  1Q1O A;  2MWS B;  2ADZ A;  2D9V A;  3MPX A;  2AYO B;  3KH0 A;  3SHQ A;  3DXC A;  2DHK A;  3HIZ A;  1OEY A;  4HDO A;  1WMH B;  1OQY A;  2KDE B;  3LJU X;  2JUO A;  3VOQ A;  2ZNV C;  2NPT B;  4FLH A;  4IWP A;  1SIF A;  4HCP B;  3P7Z A;  4LCD E;  2CHZ A;  5TR5 A;  2CY5 A;  2RSG A;  2KFK B;  2LAS A;  2YF0 A;  2FCN A;  1H4R A;  2KHW B;  4MJS B;  2DX1 A;  4W9F A;  3VQI A;  3JVZ X;  2LKO A;  2NCN A;  3B0A A;  4ZYN A;  2IYB A;  1I42 A;  4ZRJ A;  2NMB A;  4TQ1 A;  1WRD B;  3N32 A;  4DK5 A;  1YQB A;  2ZCC A;  3HQC A;  3QIJ A;  4GDL B;  2CQU A;  2GBJ A;  1RRP B;  1FGZ A;  2DKP A;  3M1I B;  1WVH A;  3AU4 A;  4FN2 A;  1FHW A;  5G55 A;  4HPL B;  2R0D A;  2JWZ A;  2DHI A;  3V5W A;  2L0T A;  1I35 A;  2Z0D B;  4BKG A;  3GYP A;  2V4L A;  2V1Y A;  2DYQ A;  4H8S A;  3PP2 A;  2H7E A;  1K8R B;  3VTW A;  3ZDM C;  4K17 A;  2X18 A;  2KN5 A;  3KYC D;  2PZ1 A;  2ELB A;  2MQJ A;  3PTF C;  4LJO B;  3ZNH B;  4IW0 A;  4K1R B;  2FJ9 A;  2PEA A;  2DYO A;  4NNJ B;  1V2Y A;  1WX9 A;  4MM3 A;  2O6V D;  4J6I A;  3V62 A;  2BYV E;  2FJL A;  1WX7 A;  2KTR A;  1MK7 B;  1TJ6 A;  2ROV A;  5CHF A;  1WGU A;  1OEY J;  1P6S A;  3NZS A;  2COP A;  5DHF B;  3KSY A;  3DBS A;  4PYZ A;  4JIO U;  4E71 A;  1FB8 A;  1V9J A;  2PPH A;  4FJV B;  1WIA A;  2Z0E B;  2KWU B;  3QJZ A;  2IFS A;  4TKN A;  2DTC A;  4K2O A;  4NQK E;  1P3R A;  1KLV A;  3ALB A;  1QQG A;  3CXB B;  5D2M B;  3MDB C;  1WZ3 A;  2D2Q A;  3IG3 A;  2O2V A;  4B6H A;  2LRU A;  4HAV B;  1TBE A;  1UGM A;  2KWV B;  3NY5 A;  2LVO A;  2BWE S;  3UIN B;  4WJO A;  2CU1 A;  2PE6 B;  4WJ7 A;  2GCJ A;  2NBU A;  3X23 A;  2MX2 A;  4LDT D;  2LXA A;  3F5R A;  4HLE A;  4RM9 A;  4KZC A;  5DPT A;  4DDI D;  4A5K A;  2UYZ B;  5JP4 A;  4F7H A;  1U5F A;  4K7S A;  1U5E A;  1YX5 B;  1J8C A;  4TV3 A;  2IZV B;  2L3Z A;  3NHE B;  2L2I A;  2GJY A;  2EKE C;  2KC1 A;  3JYU A;  3PLU A;  4II2 B;  4MGZ E;  1H10 A;  1V61 A;  4B95 A;  2W2X C;  1XKE A;  3S2A A;  4BBN C;  3EC8 A;  2FUH B;  3AXC A;  2KOX A;  4HCN B;  2G35 A;  3TW1 A;  2MLB A;  1DDM A;  3QC8 B;  3V6E B;  1XT9 B;  4KDL B;  4MT7 A;  3B08 A;  2ZVO A;  2DKQ A;  1C3T A;  3VTU A;  1DRO A;  2MCN B;  1S3S G;  2LVQ A;  3DBH I;  4DXA B;  4MGK E;  2HTH B;  2MP2 A;  1KM7 A;  2BF8 B;  3IHP C;  4W9D A;  1LFD A;  4HAW B;  2DLW A;  2YS1 A;  4ICU A;  3WAM A;  4IWQ A;  4XWX A;  4KHB B;  1NTI A;  3PS6 A;  2KJ6 A;  2MRP A;  4GGQ A;  1BTN A;  5C79 A;  3HM6 X;  2XK5 A;  1WXA A;  1LB1 A;  1FHX A;  3RYT A;  4EZK A;  3SYX A;  3UIO B;  4PNK A;  2KX3 A;  1A5R A;  2W2W A;  1BWN A;  1C1Y B;  4IUM B;  5IAA C;  2YVC A;  3WAO A;  3UZT A;  3QAQ A;  4K7U A;  2IO0 B;  1PLS A;  5DCN A;  2KDI A;  3BJI A;  2C7H A;  3EEC A;  4HXD A;  2RNR B;  4W9C A;  3PT2 B;  3Q3F A;  1AAR A;  1HB6 A;  2N1V A;  2FIF A;  1EO6 A;  4XX5 A;  3TO1 A;  4WSF A;  1ZC3 B;  4EOY A;  1UBI A;  3OAN A;  2C5L C;  3AUL A;  5JHA A;  4KIK A;  3N7C A;  2KTF A;  4EEW A;  3ZRF A;  1V80 A;  2DZM A;  3MHS D;  4EUT A;  3W1S A;  3DVN V;  2I5C A;  2CR5 A;  1W1H A;  4KZ0 A;  4XC2 A;  5LXI B;  4HAY B;  1WE6 A;  2ZZP B;  4IM2 A;  2YS5 A;  3LDZ E;  4MDK E;  3PSE B;  2YSZ A;  4M8M A;  5CLQ B;  1V5T A;  1X1G A;  3NS8 A;  1S1Q B;  3A9K A;  5J17 A;  2JP2 A;  3FP5 A;  2AWT A;  4B9K A;  3PPA A;  2JF5 A;  2C9W B;  4BBN F;  3ZKJ C;  2RQ1 A;  1DYN A;  1V86 A;  1WGH A;  1TGZ B;  5L95 C;  1R4M I;  2ZNV B;  2Y8F A;  1W1G A;  2O6V A;  4ZRK A;  2KD0 A;  2B3A A;  1UEF A; 
#chains in the Genus database with same CATH topology
 3QA8 A;  5LON B;  4JKC A;  1P1A A;  2BS3 B;  2J52 A;  2HTM E;  3ZUN A;  1C79 A;  2EC1 A;  2EEL A;  4JX1 C;  4YSZ B;  4GOU A;  2KLG A;  5C5B A;  4HAX B;  2JQR B;  2CAY A;  3R3M A;  1F2R I;  5D7G A;  4HAT B;  2JPH A;  1MFW A;  2YT2 A;  1TKG A;  1V97 A;  4RF1 A;  1WYW B;  3PEG A;  4RGT A;  1D5Z C;  2GB1 A;  2HJ1 A;  3BZD B;  4D2K A;  2W3S A;  1BUI C;  1P9D U;  1TIF A;  2TSS A;  1N62 A;  4TSS A;  2K9X A;  2K0P A;  5D3V A;  1BT0 A;  1WSP A;  1XQQ A;  3U7Z A;  1V6E A;  3FKY A;  3MC8 A;  5KHO A;  2KMC A;  3R7Q A;  1I7A A;  2D9X A;  3VR8 B;  2JX5 A;  4W9J A;  5DPW A;  3HVZ A;  1V81 A;  3N3K B;  5IP4 D;  2N9P C;  3DCG A;  4ASW C;  4HK2 A;  1XLQ A;  3IAM 1;  1UWX A;  4ARC A;  1V8C A;  2DAF A;  1V49 A;  2MA9 B;  4FAD A;  2PJH A;  4DX8 A;  2FBW B;  4ICV A;  4HVB A;  5D27 A;  4YXD B;  3IFW B;  3VH3 B;  3V60 A;  2HJ8 A;  3EFU A;  5E6N A;  3PVW A;  3R2T A;  4R3D A;  1FM0 D;  3RCP A;  1HTQ A;  3X0W A;  3VXW A;  4L2Y A;  1TTN A;  4W9G A;  2PLP A;  4BKS D;  4HB0 B;  3NG0 A;  3B9J A;  1L0X B;  1WGY A;  3DBH B;  3LXF A;  2GBM A;  2KDB A;  4A6H A;  4OZB A;  3EUB 2;  5IJM A;  2LYD A;  1QOG A;  1GNU A;  2VRR B;  4GLS C;  3IVF A;  5J3Y A;  3KQ4 A;  2WX0 A;  3R66 C;  3TL5 A;  5JXV A;  1YN4 A;  3I5J C;  2BB6 A;  4REZ A;  3SR6 A;  2KMM A;  4K81 A;  2Z8L A;  1PFD A;  3VR9 B;  5HHD G;  2LRW A;  2FNJ B;  1IPG A;  3Q69 A;  1JRP A;  1L7Y A;  1KRH A;  1EF1 A;  4US9 A;  2QIE B;  2MBB B;  1WXS A;  4HRO A;  1U2B A;  3KY9 A;  3O65 B;  2GS0 A;  3P2B A;  4A6F A;  2IGG A;  1HXY D;  2P8V A;  3BK2 A;  3SU8 X;  4ANW A;  4DHJ D;  3ZDT A;  4ANU A;  1N5X A;  1LO5 D;  2LGY A;  3DVG X;  2K22 A;  4JK7 A;  4FJY A;  1E5W A;  4RGO S;  1LQB A;  1SSN A;  3PZD A;  1Q67 A;  4B6W A;  1FXA A;  3H7P A;  1WF9 A;  4XDD A;  4OVV A;  2DAJ A;  3RI7 C;  1K5G B;  3RPF C;  2UZR A;  3RD2 A;  4ANV A;  3CSF A;  4KX6 B;  2HRJ A;  3PHW B;  1GPX A;  2CJO A;  4ITK A;  3VHT C;  3W5V B;  1AYF A;  5T8I A;  1ZE3 D;  1UF0 A;  3IBE A;  5EFX A;  3RT3 B;  3GOE A;  2WX1 A;  1B9R A;  1ZYI A;  4JKH A;  4MJS A;  2DX5 B;  4AWJ A;  1OQN A;  2IND C;  2CHW A;  4RM8 A;  1EAZ A;  3KUD B;  2QKL A;  3AH7 A;  4WJN A;  2MDX A;  4EMO A;  2BB5 A;  2I1J A;  5KHQ A;  3I57 A;  1ZC4 B;  3SBG A;  4AS1 A;  2CHX A;  1YJ1 A;  4D6W A;  2YRY A;  2MHJ A;  4MGI E;  2D3A A;  1X1F A;  3AV8 A;  4WWM A;  5DHA B;  1OTR B;  4P7I A;  5JLJ B;  3FLV A;  1UNR A;  2ASQ A;  1KTK A;  2KGX B;  4M8N A;  5D94 A;  2D07 B;  2PVG C;  2WH5 A;  4C80 A;  2ACZ B;  1F52 A;  1XCQ L;  3K9O B;  3APC A;  1KBL A;  1JAL A;  2G45 B;  5I2M A;  2JXT A;  4IWO A;  4WQO B;  1UEL A;  5JHB A;  3VFK A;  3I9V 1;  1J0G A;  3DVG Y;  1QKZ A;  1UNS A;  2REX A;  3QBV B;  1C78 A;  2KZR A;  2QCZ A;  1R4M B;  1FOE A;  2MBO A;  3TEZ A;  3UF8 A;  3A4R A;  1KOT A;  1WJ4 A;  3EPY A;  4WH4 A;  1TS4 A;  2BW2 A;  5E6J A;  2M0A A;  5J18 A;  3TBL D;  3FIL A;  2YEP F;  1N60 A;  4XE0 A;  1K51 A;  2QMT A;  3APF A;  2AQ3 B;  1WGQ A;  3AMZ A;  3SUZ A;  2KAN A;  3TEW A;  2LD9 A;  4KSL C;  1AN8 A;  3SBT A;  3KZ1 A;  2DNF A;  2CRF A;  2IY1 B;  2KAJ A;  4YTN B;  5AZG A;  2CY4 A;  2V3N A;  5C23 A;  1RWS A;  2D5G A;  1WZ0 A;  4Y94 A;  5CHV C;  4OT1 A;  2W9N A;  3PO0 A;  2BCJ A;  4QJ3 B;  3ULC A;  2RMM A;  4A20 A;  4HKQ A;  3LJ3 A;  1CZP A;  2EMT A;  4WUR A;  2VKI A;  2RPV A;  1I4Q A;  3ONS A;  2JRH A;  4MY6 A;  3CST A;  3NVY A;  1FMA D;  3A9J A;  3E9L A;  5I4D A;  1JRO A;  1UPR A;  5DIF B;  3FAH A;  3QQ8 B;  3V05 A;  1VZ7 A;  2N9X A;  3MTN B;  5MPO A;  2KMA A;  3KRX A;  5EDS A;  1VLB A;  5KQ1 A;  2K1F A;  5C16 A;  4F8C B;  2Z0O A;  3U4E G;  1XCT L;  2LMC A;  3ZNI D;  3AJ4 A;  1QOA A;  1ISN A;  3Q3O C;  4WJQ A;  5LLI A;  2UU7 A;  3QWM A;  2KVZ A;  3ZNG C;  3CF6 E;  2DN6 A;  1TQZ A;  3K9P B;  3OLM D;  2JSV X;  1GJZ A;  3IXS A;  4GU2 A;  3PRM B;  3M3J A;  2KIE A;  2UZS A;  1TXD A;  1FAO A;  5AUK A;  3VUW A;  3MC9 A;  3BK1 A;  4WWP A;  2L52 A;  3L08 A;  1PGB A;  1GG3 A;  1TKE A;  2BT6 A;  2MWN B;  2WU5 B;  2V3P A;  1RRB A;  5FR6 A;  1D6E C;  2LUE A;  4PQ0 A;  2O2V B;  4S0R A;  2I1K A;  2N0Y A;  1Z87 A;  1UH6 A;  3OJ4 B;  3ZNZ B;  1SJE D;  3W9C B;  2JXX A;  1JW9 D;  4MGY E;  2MH7 A;  2N7E A;  4HHV A;  2WS3 B;  2LG1 A;  3Q14 C;  1NYQ A;  1WGG A;  5M4Y B;  1JML A;  1WJU A;  4XDC A;  5DI9 B;  2Z0Q A;  5IKC M;  5EE0 A;  1F9J A;  1XEE A;  3PVL A;  1X05 A;  3QX1 A;  3AE7 B;  4WVF B;  2DHZ A;  4NJ6 A;  1OFF A;  3HRD D;  2Y5B B;  1XOD A;  4GMX B;  5EE9 A;  4LNN A;  1JWS D;  1QZE A;  3L10 B;  3L54 A;  2OED A;  1XD3 B;  2N7D A;  3F0W A;  1X86 A;  2FAZ A;  3B2F A;  3VDZ A;  4K3B A;  2RDG A;  3ZRC A;  1CJE A;  2DFK A;  3AE5 B;  3GZN I;  4DBB A;  1K53 A;  4G11 A;  4GSW A;  1WE7 A;  1N3H A;  4QXA B;  2K39 A;  2VZK B;  2QHO A;  3FM8 C;  2L00 B;  3PRP B;  1HBK A;  2Z0P A;  1C4A A;  3ABV B;  2WDR B;  2COC A;  4BKS A;  1H8C A;  2N9E B;  5IO9 A;  2C60 A;  4AUQ C;  1HB8 A;  1XF5 L;  2LWP A;  2N1W A;  4TUU A;  4TQ0 A;  1QT9 A;  2DZJ A;  1WR1 A;  3VIA A;  2EJ8 A;  5HI1 A;  3SFD B;  3QAR A;  3OAW A;  3MJ5 A;  4YTM B;  2LOZ A;  3R7R A;  3BVZ A;  1EVH A;  1ZW7 A;  4IAP A;  5I2S A;  2M38 A;  5HE3 A;  5CHW A;  1F2R C;  1V1P B;  5LOP B;  1R7S A;  2BGF A;  3TFM A;  3HK0 A;  2EMS A;  1LGR A;  5FR3 A;  2PIA A;  1T0Y A;  1T3Q A;  3A98 B;  2KIG A;  1TZO A;  1I4G A;  2LZ6 A;  1U27 A;  1N6Z A;  2R61 A;  1WI1 A;  4L1B A;  3ZGZ A;  3PGE A;  1GB4 A;  4OZC A;  1EUV B;  3ML8 A;  1WRI A;  2KJR A;  2AQ1 B;  4ZHP A;  1FHO A;  2RD0 A;  3RNF C;  1TJE A;  3NS1 A;  1SE9 A;  3U52 E;  4LK0 M;  1F0Z A;  3KLS X;  3ZTC A;  2N0S B;  3MFG A;  4RNA A;  2KWC A;  3B1L X;  2KO3 A;  1MHH E;  3BII D;  1BML C;  1UNQ A;  2KT7 A;  1WXV A;  4LLG M;  2ZPN A;  1CMX B;  4DHZ E;  4BOZ B;  4MK0 A;  3ZVR A;  2KR0 A;  1NYR A;  5AZH A;  2OQB A;  4OVU A;  3T8M A;  2M17 A;  3L0W B;  3WIM A;  1I4P A;  3D8D A;  3FSS A;  3QK0 A;  2W82 A;  3E9O A;  1SB3 C;  1WXM A;  3ECI A;  1UD7 A;  5EE1 A;  3DHI C;  1X11 A;  4W9E A;  2FCM A;  2PTL A;  3JSV A;  2CJN A;  1KH0 A;  1TS3 A;  4D0N B;  4GPT B;  1CQV A;  4RH6 A;  4NAM A;  4C00 A;  2BYF A;  1D4B A;  2KVR A;  1MIX A;  2WYQ A;  1FNU A;  4RCO A;  3ZJT A;  1UGJ A;  4JLC A;  3E9P A;  4DDG D;  2IYD B;  4F7G A;  2DYN A;  3ODO A;  1GUA B;  1BTK A;  1F77 A;  2RR9 A;  1VCB A;  1VDV A;  1E90 A;  1DDV A;  2K3U A;  2VRW B;  4USA A;  3PZ7 A;  2ZEQ A;  3ULB A;  2H88 B;  1KZ7 A;  1G6J A;  4KIK B;  2W2X D;  2QKM A;  4JL9 A;  3RMK C;  1EWY C;  2WXK A;  3BYT B;  4XZ4 A;  4N58 A;  4FBJ B;  3FC4 A;  4GB9 A;  2DLB A;  2RRF A;  2DYB A;  1GC6 A;  4HB4 B;  3U8Z A;  2MJD A;  1VR9 A;  2PE9 A;  4K7W A;  2UVM A;  2FID A;  3PG7 A;  3RNB C;  3OWE B;  3O96 A;  4PS7 A;  4MSQ B;  3ZLZ A;  4WAA A;  3N9Y C;  1V5O A;  4ZYS A;  1V1O A;  3ZXR A;  4AP4 C;  4KKJ A;  5E6O A;  2BKR B;  4EZJ A;  1MI1 A;  4A6K A;  2G4S A;  4GDK A;  3CMM B;  5D3W A;  1WGR A;  2RSU A;  2X38 A;  4ZRQ A;  4JWS C;  2WXM A;  1AQC A;  2LUM A;  1SEB D;  1PGA A;  3DHH C;  3N1Z C;  2ABD A;  4C7Y A;  4DXG A;  2OHF A;  1EF5 A;  4JK9 A;  3SV1 A;  2NBV B;  2WXL A;  2O6V B;  3SD5 A;  4EZL A;  1XO3 A;  4JPS A;  2ZVN A;  2V76 A;  3T06 A;  3DWG C;  2LJI A;  4DWF A;  5JZE B;  1FCL A;  5J2R A;  2KFJ A;  1XLO A;  1XR0 B;  5AUI A;  2N4F A;  4DIX A;  3ZW3 A;  1WJM A;  3VH4 B;  5AZF A;  2SAK A;  3G9W A;  2J0J A;  1WG7 A;  1K50 A;  3VVW B;  2M4N A;  3H7S A;  3DCX A;  1Q5W B;  5C5B B;  1N63 A;  4A3O A;  2D9Y A;  4KAX B;  4HJG E;  3KRW A;  4EKU A;  2DEN B;  4E74 A;  4H2A A;  4KV2 A;  1XCG A;  4N59 A;  4EJN A;  1B55 A;  3IAS 1;  1WX8 A;  1QC6 A;  3BVG A;  2K2U A;  1SGH A;  1BXT A;  2ZW0 A;  3PVU A;  4XWT A;  3A1Q A;  5C3J B;  1T0S C;  1ACA A;  2RUK B;  4W9I A;  3NUH B;  3AEC B;  2G9H D;  2COD A;  3U12 A;  3SDL C;  4N6E B;  4KHO A;  4FJZ A;  1ZGU B;  1DOI A;  4IM0 A;  3WCQ A;  3L13 A;  4MH0 E;  1EWC A;  4KGT A;  3T3O A;  2IJ0 A;  3ENE A;  1B1Z A;  2Z59 A;  1WM3 A;  1WJ6 A;  3GZN B;  3BIN A;  5BMG A;  2YS3 A;  3PSC A;  5C6R A;  4GN1 A;  4GZU A;  2L83 A;  4OSN A;  4G3X B;  4NJ7 A;  2M1M A;  3PRE A;  1PQS A;  3AE3 B;  2MBQ A;  5L81 A;  4E3C A;  1MG4 A;  1NTV A;  4LJP B;  4ZDV A;  4NAW A;  2G4D B;  4MEM A;  5IA7 A;  4ZHO A;  4EFO A;  4LDT B;  1F1H A;  4CO7 A;  1FGY A;  2GRI A;  3AEB B;  1V5U A;  2ROZ B;  2FUG 1;  5G2N A;  4A9A A;  2LOX A;  1E7V A;  4L23 A;  1FD6 A;  3ZQ4 A;  2R09 A;  1TKY A;  3AE9 B;  2SEB D;  4ILH A;  1LW3 A;  2VZK D;  3KYD D;  4IKG A;  3W1S C;  3ZVV A;  2MKR A;  1NVI D;  3UIP B;  2GUM A;  3GYO A;  1C77 A;  5DPR A;  2A5U A;  1BAK A;  3DXE A;  4URK A;  2LFI A;  1V89 A;  1JWB D;  3N30 A;  3DXD A;  1E10 A;  2CKH B;  2KX0 A;  1V5P A;  4AQ7 A;  1WGD A;  1NBF C;  3A33 B;  1MKE A;  1Z2M A;  3RCZ A;  2PVO D;  3DQV A;  2OTX A;  2WXF A;  1IP9 A;  1E8Z A;  4F7Z A;  4XYC A;  4GNK B;  2K6D B;  3ML9 A;  4JQW C;  1NTY A;  4FHJ A;  4HDQ A;  3J9C A;  4FHK A;  1U4A A;  1IBX B;  3L16 A;  4YSX B;  2L8J A;  4A6F B;  5CLL B;  1FXI A;  2X8X X;  4C4V B;  4NPN A;  1VBG A;  2J7Q B;  2Z14 A;  4II3 B;  1WMH A;  2XNA C;  5HFY A;  3SNH A;  4OW0 A;  3RN9 C;  3U7D A;  1T5X D;  2B76 B;  4W9H A;  1E9M A;  2KC2 A;  2M56 B;  2L0F A;  4LNK A;  2OOB B;  2NPT A;  2LXC A;  2WDQ B;  2DZI A;  3H7P B;  3HM3 A;  4XWW A;  1U5D A;  2WDV B;  4LNI A;  3PV1 A;  2V3S A;  5KQ4 A;  2IGH A;  2WP9 B;  3M63 B;  1FPY A;  2KFK A;  5C1Z A;  3MC0 B;  2COF A;  4I6L B;  3C0R B;  2MW5 A;  4KKI A;  1VD2 A;  2K8H A;  1L6V A;  2R2O A;  2BTE A;  1SJH D;  1XXG A;  3UQB A;  1Y56 A;  2LJ5 A;  4KDI C;  1OQR A;  4RMA A;  3MHZ A;  2N23 A;  2WXG A;  5IOI A;  3V6C B;  3P63 A;  2XBB C;  2QC8 A;  1KI1 B;  2YLM A;  1YN3 A;  4PT5 A;  4HWI B;  2DA0 A;  2GMI C;  2KQS A;  4XGA B;  4ZRI A;  4IOY X;  2DX5 A;  2INC C;  4NJC A;  1M94 A;  2J0K A;  4YSY B;  3TUO A;  3CIK A;  5LNK 1;  2K2J A;  3D8E A;  1TT5 B;  4YON A;  4GOC A;  4GDL A;  2DIK A;  2PMV A;  1ZXH A;  2GLS A;  3L17 A;  4A8X C;  2AEH A;  3RZW C;  2ELA A;  5BO4 B;  4YTP B;  4Z2N A;  4FUL A;  2Q13 A;  1ZVR A;  1SE3 A;  2D10 A;  2WLB A;  3A58 A;  1NI2 A;  2RPQ A;  5JVL A;  1WM2 A;  2W54 A;  3T9L A;  2K25 A;  3W5U B;  2PKO A;  4HB3 B;  1WGK A;  3C8Y A;  2IY0 B;  2P0H A;  1VRA B;  3NWA A;  3AEG B;  4K3C A;  3EA6 A;  1D3Z A;  1M7R A;  1LXD A;  3ZO5 B;  3AB5 A;  2LGI A;  3KUC B;  2WXQ A;  2INP E;  2BPS A;  2J59 M;  1T0R C;  3ODW A;  4G50 A;  2NR2 A;  4WIP A;  1JQ4 A;  2KUP A;  2N7J A;  3MJW A;  2P0D A;  3WA0 A;  1W1D A;  1EU3 A;  2AL3 A;  2DBY A;  1OY2 A;  2KQ7 A;  2ZJD A;  2YT1 A;  2AX5 A;  1YQ3 B;  2A4Z A;  4I6P A;  4MM3 B;  4RGN A;  5HKH A;  3R2I A;  3DBR I;  1WI0 A;  1K5D B;  1MIZ B;  2KTR B;  4KVG B;  2M8S A;  1KC7 A;  2LHE A;  1UPQ A;  2G3Q B;  3I3T B;  3EHV A;  2MJE A;  4KSK C;  2K00 A;  2JYT A;  1KF6 B;  4HEA 1;  3NZ3 A;  1AW7 A;  1L2N A;  2FCQ A;  4P16 A;  4A3P A;  1RAX A;  3A9J B;  1NEN B;  1MAI A;  2M19 A;  2L05 A;  3I63 C;  1ZKH A;  2OJR A;  1J19 A;  4NSW A;  1FXT B;  2BVC A;  3IT6 B;  1MK9 B;  1RYJ A;  1TZ1 A;  1ET9 A;  1FNV A;  4A55 A;  2JT4 B;  3KUZ A;  3Q8A A;  2H7D A;  2D11 A;  2G1E A;  3AEF B;  1CK1 A;  4PS3 A;  3ZIM A;  1Z5S B;  5HE1 A;  2DWQ A;  1LM8 B;  3H6N A;  5GOW B;  1J0W A;  1WFY A;  4JKD A;  3GS2 A;  1ZSQ A;  3HHM A;  4PK1 A;  2L76 A;  2ON8 A;  4G0N B;  4S17 A;  3VUX A;  2BQQ A;  1L6U A;  2LUL A;  2LHD A;  2E2X A;  4BZA A;  1IGD A;  2WU2 B;  3AI5 A;  3H9D A;  5DPS A;  4MSM B;  4DBG A;  1P5T A;  4GIV A;  1EU4 A;  1E7U A;  3P4Q B;  2E6X A;  3BYY B;  5GMV A;  2HD5 B;  2KXJ A;  1PMS A;  1DYQ A;  2W3R A;  3PHX B;  2COA A;  4CHM A;  4LTU A;  3FEH A;  4IC7 B;  4M0W B;  1FFU A;  4IDI A;  1FIQ A;  1L4D B;  2NMQ A;  1ST7 A;  2W55 A;  1WJN A;  1N61 A;  3WYF B;  4NZL B;  5FK9 C;  2K8C A;  5GXG B;  3DWM A;  4K2P A;  3SO6 A;  4C7Z A;  1JRU A;  3E9S A;  3NVV A;  1L0Y B;  3GE3 C;  4MEL A;  2BYE A;  4NY0 A;  1RFA A;  5TSS A;  1KJT A;  2EKI A;  2KWD A;  3DBL I;  1R4N I;  4HB2 B;  1E7P B;  2NZ8 B;  4I6N B;  3URY A;  2IO2 B;  2L7R A;  4RF0 A;  2AL6 A;  1T77 A;  2M14 A;  3RUL A;  4KGR A;  3TEX A;  1JWM D;  1E0Z A;  3DPD A;  1UNP A;  1YD8 U;  2M0X A;  1XX0 A;  5D3I B;  4GMV A;  1Q10 A;  2FCS A;  2KNB A;  4LNO A;  1IYF A;  2LGS A;  1HTO A;  2CS4 A;  3DDC B;  4FA6 A;  4WWO A;  1MG8 A;  2WXO A;  2VSZ A;  2QJL A;  5LG4 B;  2P0F A;  2GBK A;  2L1A A;  1FO4 A;  2BS2 B;  1P3Q U;  3AU5 A;  3ZYY X;  5L83 A;  2MP2 B;  2XQN M;  5LXH A;  5CTR C;  4HPM B;  1YN5 A;  3OHM B;  1YOV B;  4BOS C;  4FXC A;  4CQN A;  2PW9 A;  2KJH B;  5JHH A;  1YNT E;  1J7C A;  2HTH A;  3AE8 B;  3TMP B;  1WXQ A;  1V1P A;  1ZOY B;  4JGH B;  1FCC C;  2IPK D;  2I38 A;  2JRI B;  4WJP A;  1I2H A;  5JH5 C;  1RFK A;  3P4R B;  1WY8 A;  4HAZ B;  5FI0 A;  1HE8 A;  4DHJ B;  3EGR A;  1DIK A;  2JZZ A;  2XK5 B;  5DH9 B;  2GBR A;  1NVL A;  2RGF A;  1TY0 A;  4KHB A;  1C9F A;  3QCA A;  4DX9 0;  2WDT B;  1PFJ A;  2D3G A;  2LVP A;  1YIW A;  3OJ3 A;  3EFC A;  1I4H A;  4AJW A;  3KW5 B;  4JKG B;  1P98 A;  4HKZ E;  4BVU C;  3VTV A;  1DBH A;  2C7M B;  1FEH A;  3KWL A;  2NTT A;  3ETR A;  3QHT A;  4CHK A;  3TVV A;  1FFV A;  2K6Q A;  4O1N A;  4DHZ B;  2BYT A;  2KLC A;  3WAN A;  2YT0 A;  4L1R A;  2KDM A;  2Z4D A;  1MPH A;  1ZDX A;  2FJU B;  3A8Q A;  3BVM A;  2GOW A;  3APD A;  4CYE A;  3HW2 B;  3JSV B;  3Q3M C;  2ZCB A;  2DYM A;  1WH3 A;  1Y19 B;  1GGO A;  1Y5O A;  1IRS A;  1U29 A;  2RVB B;  2N9K A;  4ANX A;  4TYZ A;  1GB1 A;  1U5G A;  1WR6 E;  1WJ1 A;  1Q0W B;  2LGX A;  4AOF A;  1L5P A;  1RJ2 A;  1YX6 B;  2IBI B;  5HE2 A;  2JVC A;  4F7U P;  4BFR A;  4UDU C;  2WXJ A;  1ROE A;  3N20 C;  3Q8C A;  4QJ5 B;  1NDD A;  2MBE A;  1NI3 A;  3Q3J A;  1I4R A;  4F1S A;  1RLF A;  1GAQ B;  2GBN A;  3KWV A;  2BS4 B;  5G5H A;  3BWU D;  2Y7B A;  2V9H A;  3D8F A;  1ZPS A;  5E6P A;  3V3X A;  2L1C A;  3VUY A;  4IM3 A;  2Y8G A;  3A8P A;  5D3Y A;  5BYR A;  4GXB A;  2KCJ A;  3PRZ A;  2ZPY A;  1XLN A;  1I7H A;  2XEW A;  3TEY A;  2KYW A;  3DOW A;  4KHA A;  4HJK A;  2CB8 A;  2GCL A;  4C0A A;  3RNG C;  1OMW A;  4BKT A;  3A9K B;  4ZRP A;  1QQR A;  4WWN A;  4GDK B;  1T6B X;  2HDE A;  4PYU A;  2UWQ A;  3NZU A;  3Q3N C;  2K49 A;  5G5G A;  2D4Q A;  1KZG A;  3O13 A;  2MSE D;  1E8Y A;  2KK8 A;  1XD4 A;  1YJI A;  1UZX B;  1ZXI A;  3P42 A;  1DOX A;  2D9W A;  2NS5 A;  1GC7 A;  4YT0 B;  1J7B A;  1AWE A;  4BBK A;  3WAL A;  2D9Z A;  1X1M A;  2MFQ A;  3P6A A;  1DOY A;  2C7N B;  4US8 A;  3RZF A;  3BY4 B;  2QDF A;  4NQL B;  4Z2M B;  5D6J B;  3HUI A;  2WXN A;  1GOZ A;  1QF6 A;  2HE7 A;  1E8W A;  3DVN U;  2KUQ A;  1V5M A;  5J3Q A;  1P7F A;  4PS8 A;  2JY6 A;  1NU2 A;  3PLV A;  2J0M A;  3N1X C;  4CSQ A;  3UGB B;  4JKF A;  3U30 A;  3H8H A;  4W9K A;  2NVU I;  1STE A;  3D32 A;  1RM6 C;  2LGD A;  5CX3 A;  3TJP A;  4BAX A;  3A1Q B;  1UBQ A;  3NVW A;  2KDF B;  2X0S A;  1K52 A;  1JCK B;  2Y5C A;  2RLO A;  2I5F A;  1E8X A;  4OVZ A;  2K8B A;  3JW0 X;  5HE0 A;  1EGX A;  3V61 A;  3L4P A;  3P1M A;  4CHJ A;  2Z13 A;  5J3T A;  2BKF A;  1ZP0 B;  2RGN B;  3TCA A;  3W1Y A;  3B2G A;  1P0R A;  4TMA B;  4AJY B;  2Z59 B;  2IO3 B;  3DBL B;  3QWZ B;  5HG2 A;  4YL8 A;  1R4N B;  3NOB A;  3HVD A;  2IO1 B;  3NSU A;  1DDW A;  3TIX A;  1J7A A;  2BWF A;  3ZTD A;  3M62 B;  5KCV A;  2LBB A;  4W9L A;  1SHC A;  3VAW A;  4X57 B;  3ML4 A;  2DZK A;  4IFS A;  4HAU B;  3M95 A;  3ODX A;  1WWT A;  4NAW B;  3RUI B;  5FI1 A;  3H1U A;  1YQ4 B;  4N9F 4;  1ZM0 A;  2V0G A;  2KKC A;  5JHG A;  2LI5 A;  1L4Z B;  2DHJ A;  2WQY B;  1VJK A;  1HEZ E;  1MVK A;  2MBH A;  2MJ3 A;  1OQQ A;  2RDH A;  2NBW B;  3A4S C;  5AEK B;  1Y8R C;  1E6E B;  2MEK A;  2FE8 A;  3WAP A;  1M7E A;  3UQA A;  1OGW A;  2WWZ A;  4P1B C;  2J53 A;  5D3X A;  2JZ3 B;  2R2Q A;  2FDQ A;  1ZUD 2;  4IG7 B;  1QOB A;  3KVF B;  4OZA A;  4JK8 A;  4L6E A;  2QIL A;  4MT5 A;  3RNE C;  1V88 A;  1Q1O A;  3R8B A;  2MWS B;  2ADZ A;  2D9V A;  3MPX A;  2AYO B;  2V4I B;  3KH0 A;  3SHQ A;  3DXC A;  5BYQ A;  2DHK A;  3HIZ A;  1OEY A;  4HDO A;  1WMH B;  1DGJ A;  2WNM A;  1MHX A;  1OQY A;  1SBB B;  3C19 A;  3RNC C;  1NEK B;  2KDE B;  3AE4 B;  1IBX A;  1YJJ A;  3LJU X;  1M4V A;  2JUO A;  4C4V A;  3VOQ A;  4M00 A;  3B77 A;  2ZNV C;  3GE8 C;  2KAC A;  2INN E;  2NPT B;  3DHG C;  4FLH A;  4IWP A;  1SIF A;  4HCP B;  3P7Z A;  4LCD E;  5EE3 A;  1JDE A;  2CHZ A;  2N9L A;  4ILJ A;  2LEK A;  5TR5 A;  3NVZ A;  2CY5 A;  1UUP A;  2RSG A;  5BYS A;  1EM7 A;  4B0E A;  2KFK B;  2LAS A;  3TSS A;  2YF0 A;  2Q5W D;  2FCN A;  1H4R A;  4OHJ A;  2KHW B;  4MJS B;  2DX1 A;  4W9F A;  3VQI A;  3JVZ X;  2LKO A;  3MP9 A;  2NCN A;  2WGS A;  1AWD A;  3B0A A;  4ZYN A;  2IYB A;  1I42 A;  4ZRJ A;  4ILG B;  5BMH A;  2NMB A;  1TS2 A;  4TQ1 A;  3VRB B;  1WRD B;  4WQM A;  5IRS A;  2J4X A;  3N32 A;  1FNW A;  4DK5 A;  1C4P A;  1YQB A;  2KQ4 X;  2ZCC A;  3AM9 A;  3HQC A;  3AN1 A;  3QIJ A;  4GDL B;  2CQU A;  2GBJ A;  1RRP B;  1FGZ A;  2DKP A;  3M1I B;  1WVH A;  3AU4 A;  4MH8 A;  4FN2 A;  1FHW A;  1D5M C;  5G55 A;  5BMI A;  5C2T B;  3LYY A;  4HPL B;  2IDY A;  2WXP A;  2R0D A;  5H8Y E;  2JWZ A;  3Q8B A;  2DHI A;  3V5W A;  2ICI A;  2L0T A;  1I35 A;  4P6V F;  2Z0D B;  4BKG A;  3GYP A;  2V4L A;  2V1Y A;  4DXF A;  1HZ6 A;  3CIR B;  4JWU C;  2DYQ A;  2VH2 A;  4QJ4 B;  4H8S A;  3RFZ B;  3PP2 A;  2WXR A;  2H7E A;  4Q2J A;  1K8R B;  3HIE A;  3VTW A;  1XLP A;  2JYE A;  3ZDM C;  4K17 A;  2X18 A;  3FIL B;  2KN5 A;  3KYC D;  2PZ1 A;  2ELB A;  2R2Y A;  2MQJ A;  3PTF C;  4LJO B;  3ZNH B;  4IW0 A;  4K1R B;  1JWA D;  2FJ9 A;  2PEA A;  2DYO A;  4NNJ B;  1V2Y A;  1WX9 A;  4MM3 A;  2O6V D;  4J6I A;  3P4P B;  1SIJ A;  3V62 A;  1PUT A;  2ZW1 A;  4JKA A;  4JKB A;  3W2D A;  2BYV E;  3GP7 A;  2FJL A;  4B0M A;  1WX7 A;  2KTR A;  1MK7 B;  4ACF A;  5IN7 A;  1TJ6 A;  2ROV A;  5CHF A;  1WGU A;  2E3T A;  1OEY J;  1P6S A;  1FRR A;  1HQR D;  3NZS A;  2COP A;  5DHF B;  4LNF A;  3KSY A;  2AQ2 B;  3DBS A;  4PYZ A;  1TYG B;  4JIO U;  4M02 A;  4E71 A;  1FB8 A;  3PZ8 A;  1V9J A;  2D3C A;  2PPH A;  4FJV B;  1WIA A;  3AE6 B;  1QOF A;  2Z0E B;  2KWU B;  3QJZ A;  1ET6 A;  2IFS A;  4TKN A;  4KGS A;  1KLU D;  2DTC A;  2BBC A;  3AEA B;  4M01 A;  4K2O A;  4NQK E;  1P3R A;  1KLV A;  1N5W A;  3ALB A;  1QQG A;  3CXB B;  3UI3 A;  5D2M B;  3MDB C;  1WZ3 A;  2D2Q A;  3IG3 A;  2O2V A;  4B6H A;  3E66 A;  2LRU A;  4HAV B;  1TBE A;  2ZKM X;  1UGM A;  2KWV B;  4A90 A;  3NY5 A;  1VZ6 A;  2LVO A;  2BWE S;  2RDB C;  3UIN B;  4WJO A;  1ACC A;  2CU1 A;  2PE6 B;  3NWD A;  4WJ7 A;  2GCJ A;  2NBU A;  3AED B;  3X23 A;  2MX2 A;  4LDT D;  2LXA A;  3F5R A;  2WXI A;  4HLE A;  4RM9 A;  4KZC A;  5H92 C;  1WYG A;  5DPT A;  1D5X C;  4DDI D;  4A5K A;  2UYZ B;  4M0W A;  5JP4 A;  2NTS A;  4F7H A;  1U5F A;  4K7S A;  1U5E A;  1HZ5 A;  1YX5 B;  1J8C A;  4TV3 A;  2IZV B;  1FRD A;  2L3Z A;  2D3B A;  3NHE B;  2L2I A;  2CU3 A;  2GJY A;  3ENB A;  2EKE C;  2KC1 A;  3JYU A;  3PLU A;  3IT4 B;  1TY2 A;  2H89 B;  4II2 B;  4MGZ E;  2XN9 C;  3T3N A;  1P7E A;  1H10 A;  1V61 A;  1C76 A;  1L0V B;  4B95 A;  4MAC A;  3NJT A;  2W2X C;  1XKE A;  3S2A A;  1SE2 A;  4BBN C;  4IOI E;  1KLG D;  3AE1 B;  1T0Q C;  3EC8 A;  2FUH B;  3AXC A;  2KOX A;  4HCN B;  3ZJV A;  2G35 A;  3TW1 A;  2OJW A;  3HSA A;  2MLB A;  1DDM A;  2J42 A;  4RGM A;  3QC8 B;  2QSD A;  3V6E B;  3RNA C;  3ZXV A;  3LB8 C;  1XT9 B;  4KDL B;  4MT7 A;  3B08 A;  2ZVO A;  1I4X A;  2DKQ A;  1C3T A;  3VTU A;  1DRO A;  2MCN B;  1S3S G;  3Q8E A;  2LVQ A;  3AEE B;  3DBH I;  1VZ8 A;  1SE4 A;  4DXA B;  3NWF A;  4MGK E;  2HTH B;  2MP2 A;  2Y3A A;  1KM7 A;  2BF8 B;  3IHP C;  4W9D A;  1LFD A;  4HAW B;  2DLW A;  2YS1 A;  2WXH A;  2R82 A;  1SF0 A;  3SEB A;  4ICU A;  3WAM A;  4IWQ A;  4XWX A;  4KHB B;  1SXT A;  1NTI A;  3PS6 A;  2KJ6 A;  3OG5 A;  2MRP A;  1KFY B;  4GGQ A;  1TS5 A;  1BTN A;  5C79 A;  3HM6 X;  2XK5 A;  3SFE B;  1WXA A;  5D3D A;  4P1C C;  4ZOH C;  1VBH A;  1LB1 A;  1FHX A;  3RYT A;  4EZK A;  3U2S C;  3SYX A;  3ZJU A;  5FKA C;  3UIO B;  2K5P A;  3AE2 B;  4PNK A;  1PYW D;  2KX3 A;  1A5R A;  4QAY A;  4JKG A;  2W2W A;  1BWN A;  1C1Y B;  4IUM B;  4C56 C;  5IAA C;  2YVC A;  3WAO A;  2VH1 A;  3UZT A;  4HRS A;  3QAQ A;  4K7U A;  2IO0 B;  1PLS A;  5DCN A;  1HA5 A;  2KDI A;  3BJI A;  2C7H A;  3EEC A;  4HXD A;  2RNR B;  2KN4 A;  4W9C A;  2JU6 X;  3PT2 B;  4JE3 B;  3Q3F A;  1AAR A;  2L32 A;  1HB6 A;  2N1V A;  4JKE A;  2GI9 A;  2Y5P A;  4EE2 A;  2FIF A;  1EO6 A;  1QIL A;  2IGD A;  4XX5 A;  3TO1 A;  4YWG G;  4WSF A;  1ZC3 B;  3Q8F A;  1IGC A;  3DBR B;  4EOY A;  3Q6B A;  3VRA B;  2ONQ A;  1MI0 A;  1PGX A;  1UBI A;  2YEP B;  3OAN A;  2C5L C;  3AUL A;  3Q2A C;  1YMH E;  5JHA A;  4DQO C;  4A6Q A;  4KIK A;  1ENF A;  3N7C A;  2KTF A;  4EEW A;  4J3O D;  2JZP A;  1UWM A;  4HPP A;  3ZRF A;  1V80 A;  2JWU A;  2DZM A;  3MHS D;  4EUT A;  4HSI A;  1PDX A;  3W1S A;  2I2Y A;  4ARI A;  4WAF A;  3DVN V;  2I5C A;  2CR5 A;  3CWI A;  1W1H A;  4KZ0 A;  4XC2 A;  3NRZ A;  5LXI B;  4HAY B;  2K8E A;  1WE6 A;  2ZZP B;  4IM2 A;  2YS5 A;  3N1Y C;  3LDZ E;  1IUE A;  1JWU D;  4MDK E;  2WHI A;  1A70 A;  3PSE B;  2YSZ A;  3FVC A;  2QEJ C;  3GB1 A;  4M8M A;  5CLQ B;  1ESF A;  1V5T A;  1X1G A;  1ZDV A;  3NW8 A;  3NS8 A;  4RFB A;  1S1Q B;  3A9K A;  1MJD A;  5J17 A;  2JP2 A;  3FP5 A;  1C4C A;  1MPE A;  2AWT A;  4B9K A;  3PPA A;  2JF5 A;  2C9W B;  4BBN F;  3ZKJ C;  2RQ1 A;  1DYN A;  1V86 A;  1WGH A;  1TGZ B;  1QLB B;  1R4M I;  2ZNV B;  3P4S B;  5L95 C;  2Y8F A;  3E56 A;  1W1G A;  2NBV A;  2O6V A;  4ZRK A;  2KD0 A;  2B3A A;  1UEF A; 
#chains in the Genus database with same CATH homology
 3QA8 A;  5LON B;  4JKC A;  1P1A A;  3ZUN A;  2EC1 A;  2KLG A;  5C5B A;  4HAX B;  2CAY A;  3R3M A;  5D7G A;  4HAT B;  2JPH A;  1WYW B;  3PEG A;  1P9D U;  5D3V A;  1BT0 A;  1XQQ A;  1V6E A;  5KHO A;  2KMC A;  3R7Q A;  1I7A A;  2D9X A;  4W9J A;  5DPW A;  1V81 A;  3N3K B;  2N9P C;  3DCG A;  4ASW C;  4HK2 A;  2DAF A;  1V49 A;  2MA9 B;  4FAD A;  2PJH A;  4DX8 A;  4ICV A;  4HVB A;  5D27 A;  3IFW B;  3VH3 B;  3V60 A;  2HJ8 A;  3EFU A;  5E6N A;  3PVW A;  3RCP A;  3X0W A;  3VXW A;  1TTN A;  4W9G A;  4BKS D;  4HB0 B;  1WGY A;  2GBM A;  2KDB A;  4A6H A;  5IJM A;  2LYD A;  1GNU A;  2VRR B;  3IVF A;  5J3Y A;  2WX0 A;  3R66 C;  3TL5 A;  4K81 A;  2LRW A;  2FNJ B;  1IPG A;  1L7Y A;  1EF1 A;  2MBB B;  1WXS A;  1U2B A;  3KY9 A;  3O65 B;  2GS0 A;  3P2B A;  4A6F A;  2P8V A;  3SU8 X;  4ANW A;  4DHJ D;  3ZDT A;  4ANU A;  2LGY A;  3DVG X;  4JK7 A;  4FJY A;  1E5W A;  1LQB A;  3PZD A;  1Q67 A;  4B6W A;  3H7P A;  1WF9 A;  4OVV A;  2DAJ A;  1K5G B;  2UZR A;  3RD2 A;  4ANV A;  3CSF A;  2HRJ A;  3PHW B;  3VHT C;  3IBE A;  5EFX A;  3RT3 B;  3GOE A;  2WX1 A;  4JKH A;  4MJS A;  2DX5 B;  4AWJ A;  1OQN A;  2CHW A;  4RM8 A;  1EAZ A;  3KUD B;  2QKL A;  4WJN A;  2MDX A;  4EMO A;  2I1J A;  5KHQ A;  1ZC4 B;  3SBG A;  2CHX A;  1YJ1 A;  2YRY A;  4MGI E;  1X1F A;  5DHA B;  1OTR B;  4P7I A;  5JLJ B;  3FLV A;  1UNR A;  2ASQ A;  2KGX B;  4M8N A;  5D94 A;  2D07 B;  2WH5 A;  3K9O B;  3APC A;  1KBL A;  2G45 B;  4IWO A;  4WQO B;  1UEL A;  5JHB A;  3VFK A;  1J0G A;  3DVG Y;  2REX A;  3QBV B;  2KZR A;  1FOE A;  2MBO A;  3UF8 A;  3A4R A;  1KOT A;  1WJ4 A;  3EPY A;  5J18 A;  3TBL D;  3APF A;  1WGQ A;  3SUZ A;  2KAN A;  2LD9 A;  4KSL C;  3SBT A;  3KZ1 A;  2CRF A;  2IY1 B;  5AZG A;  2CY4 A;  5C23 A;  1WZ0 A;  4Y94 A;  5CHV C;  2W9N A;  2BCJ A;  3ULC A;  4A20 A;  3LJ3 A;  2EMT A;  2VKI A;  3ONS A;  2JRH A;  4MY6 A;  3CST A;  3A9J A;  3E9L A;  1UPR A;  5DIF B;  3QQ8 B;  2N9X A;  3MTN B;  2KMA A;  3KRX A;  5EDS A;  5KQ1 A;  2K1F A;  5C16 A;  4F8C B;  2Z0O A;  3ZNI D;  3AJ4 A;  1ISN A;  4WJQ A;  5LLI A;  3QWM A;  3ZNG C;  3CF6 E;  2DN6 A;  1TQZ A;  3K9P B;  3OLM D;  1GJZ A;  4GU2 A;  3PRM B;  3M3J A;  2UZS A;  1TXD A;  1FAO A;  3VUW A;  4WWP A;  3L08 A;  1GG3 A;  2MWN B;  1RRB A;  5FR6 A;  2LUE A;  4PQ0 A;  2O2V B;  2I1K A;  2N0Y A;  1Z87 A;  1UH6 A;  3OJ4 B;  3ZNZ B;  2JXX A;  4MGY E;  2N7E A;  4HHV A;  2LG1 A;  1WGG A;  1WJU A;  5DI9 B;  2Z0Q A;  1F9J A;  3PVL A;  1X05 A;  3QX1 A;  4WVF B;  2DHZ A;  4NJ6 A;  2Y5B B;  1XOD A;  4GMX B;  1QZE A;  3L10 B;  3L54 A;  1XD3 B;  2N7D A;  3F0W A;  1X86 A;  2FAZ A;  3VDZ A;  3ZRC A;  2DFK A;  3GZN I;  4DBB A;  4G11 A;  4GSW A;  1WE7 A;  1N3H A;  2K39 A;  2QHO A;  3FM8 C;  2L00 B;  3PRP B;  1HBK A;  2Z0P A;  2COC A;  4BKS A;  1H8C A;  2N9E B;  4AUQ C;  2C60 A;  1HB8 A;  2LWP A;  2N1W A;  4TUU A;  4TQ0 A;  2DZJ A;  1WR1 A;  3VIA A;  2EJ8 A;  3QAR A;  3OAW A;  2LOZ A;  3R7R A;  1EVH A;  1ZW7 A;  4IAP A;  2M38 A;  5HE3 A;  5CHW A;  5LOP B;  3TFM A;  2BGF A;  3HK0 A;  2EMS A;  1T0Y A;  3A98 B;  2LZ6 A;  1U27 A;  1WI1 A;  3PGE A;  1EUV B;  3ML8 A;  2KJR A;  1FHO A;  2RD0 A;  1SE9 A;  3ZTC A;  2KWC A;  3B1L X;  2KO3 A;  1UNQ A;  1WXV A;  2ZPN A;  1CMX B;  4DHZ E;  4BOZ B;  4MK0 A;  3ZVR A;  5AZH A;  2OQB A;  4OVU A;  3T8M A;  2M17 A;  3L0W B;  3WIM A;  3D8D A;  3FSS A;  3QK0 A;  3E9O A;  1WXM A;  3ECI A;  1UD7 A;  4W9E A;  1X11 A;  2FCM A;  3JSV A;  4D0N B;  4GPT B;  2BYF A;  2KVR A;  1MIX A;  2WYQ A;  4JLC A;  3E9P A;  4DDG D;  2IYD B;  4F7G A;  2DYN A;  3ODO A;  1GUA B;  1BTK A;  2RR9 A;  1VCB A;  1E90 A;  1DDV A;  2VRW B;  2ZEQ A;  3ULB A;  1KZ7 A;  1G6J A;  4KIK B;  2W2X D;  2QKM A;  4JL9 A;  4XZ4 A;  4FBJ B;  4GB9 A;  2DYB A;  1GC6 A;  4HB4 B;  3U8Z A;  2PE9 A;  4K7W A;  2UVM A;  2FID A;  3PG7 A;  3O96 A;  4PS7 A;  4MSQ B;  3ZLZ A;  4WAA A;  1V5O A;  4AP4 C;  5E6O A;  2BKR B;  4EZJ A;  4A6K A;  2G4S A;  4GDK A;  3CMM B;  5D3W A;  1WGR A;  2RSU A;  1AQC A;  2ABD A;  1EF5 A;  4JK9 A;  3SV1 A;  2NBV B;  2O6V B;  3SD5 A;  4EZL A;  2ZVN A;  2V76 A;  3T06 A;  4DWF A;  5JZE B;  5J2R A;  2KFJ A;  1XR0 B;  2N4F A;  3ZW3 A;  1WJM A;  3VH4 B;  5AZF A;  3G9W A;  2J0J A;  1WG7 A;  3VVW B;  2M4N A;  3H7S A;  1Q5W B;  5C5B B;  4A3O A;  2D9Y A;  4KAX B;  3KRW A;  4EKU A;  2DEN B;  4E74 A;  4KV2 A;  1XCG A;  4EJN A;  1B55 A;  1WX8 A;  1QC6 A;  2K2U A;  1SGH A;  3PVU A;  3A1Q A;  1ACA A;  2RUK B;  4W9I A;  2COD A;  3SDL C;  4KHO A;  4FJZ A;  1ZGU B;  4IM0 A;  3L13 A;  4MH0 E;  3ENE A;  1WM3 A;  1WJ6 A;  3BIN A;  2YS3 A;  3PSC A;  5C6R A;  4GN1 A;  4GZU A;  4G3X B;  4NJ7 A;  2M1M A;  3PRE A;  1PQS A;  2MBQ A;  5L81 A;  4E3C A;  1NTV A;  4LJP B;  4ZDV A;  4NAW A;  2G4D B;  4MEM A;  5IA7 A;  4EFO A;  4LDT B;  4CO7 A;  1FGY A;  1V5U A;  2ROZ B;  5G2N A;  2LOX A;  1E7V A;  2R09 A;  4ILH A;  1LW3 A;  3KYD D;  3W1S C;  3ZVV A;  2MKR A;  3UIP B;  3GYO A;  5DPR A;  2A5U A;  1BAK A;  3DXE A;  4URK A;  1V89 A;  3N30 A;  3DXD A;  2CKH B;  2KX0 A;  1V5P A;  1WGD A;  1NBF C;  3A33 B;  1MKE A;  1Z2M A;  3RCZ A;  3DQV A;  2OTX A;  1IP9 A;  1E8Z A;  4F7Z A;  2K6D B;  3ML9 A;  4JQW C;  1NTY A;  4FHJ A;  4HDQ A;  4FHK A;  1U4A A;  3L16 A;  2L8J A;  4A6F B;  5CLL B;  4NPN A;  1VBG A;  2J7Q B;  4II3 B;  1WMH A;  3SNH A;  3U7D A;  4W9H A;  2KC2 A;  2L0F A;  2OOB B;  2NPT A;  2LXC A;  2DZI A;  3H7P B;  3HM3 A;  1U5D A;  3PV1 A;  2V3S A;  5KQ4 A;  3M63 B;  2KFK A;  5C1Z A;  2COF A;  4I6L B;  3C0R B;  2MW5 A;  1VD2 A;  2K8H A;  2R2O A;  3UQB A;  4KDI C;  2LJ5 A;  4RMA A;  2N23 A;  3V6C B;  2XBB C;  1KI1 B;  2YLM A;  4HWI B;  2DA0 A;  2GMI C;  2KQS A;  4ZRI A;  4IOY X;  2DX5 A;  1M94 A;  2J0K A;  3CIK A;  2K2J A;  3D8E A;  4YON A;  4GOC A;  4GDL A;  2DIK A;  3L17 A;  2AEH A;  3RZW C;  2ELA A;  5BO4 B;  4Z2N A;  4FUL A;  2Q13 A;  1ZVR A;  2D10 A;  1NI2 A;  2RPQ A;  5JVL A;  1WM2 A;  3T9L A;  2K25 A;  4HB3 B;  2IY0 B;  2P0H A;  1D3Z A;  1M7R A;  1LXD A;  3ZO5 B;  3KUC B;  2BPS A;  2J59 M;  3ODW A;  4G50 A;  2NR2 A;  2KUP A;  3MJW A;  2P0D A;  3WA0 A;  1W1D A;  2AL3 A;  1OY2 A;  2KQ7 A;  2ZJD A;  2YT1 A;  2A4Z A;  4I6P A;  5HKH A;  3DBR I;  1WI0 A;  1K5D B;  1MIZ B;  2KTR B;  4KVG B;  2M8S A;  1KC7 A;  1UPQ A;  2G3Q B;  3I3T B;  3EHV A;  4KSK C;  2K00 A;  1L2N A;  2FCQ A;  4A3P A;  1RAX A;  3A9J B;  1MAI A;  2L05 A;  1ZKH A;  2OJR A;  1J19 A;  4NSW A;  1FXT B;  1MK9 B;  1TZ1 A;  2JT4 B;  3KUZ A;  2H7D A;  2D11 A;  4PS3 A;  3ZIM A;  1Z5S B;  5HE1 A;  1LM8 B;  3H6N A;  5GOW B;  1J0W A;  1WFY A;  4JKD A;  1ZSQ A;  3HHM A;  2L76 A;  4G0N B;  3VUX A;  2LUL A;  2E2X A;  3AI5 A;  3H9D A;  5DPS A;  4MSM B;  4DBG A;  1P5T A;  4GIV A;  1E7U A;  5GMV A;  2HD5 B;  2KXJ A;  1PMS A;  3PHX B;  2COA A;  4CHM A;  3FEH A;  4IC7 B;  4M0W B;  1ST7 A;  1WJN A;  3WYF B;  2K8C A;  4K2P A;  3SO6 A;  1JRU A;  4MEL A;  2BYE A;  4NY0 A;  1RFA A;  1KJT A;  3DBL I;  1R4N I;  4HB2 B;  2NZ8 B;  4I6N B;  2IO2 B;  2L7R A;  2AL6 A;  2M14 A;  3RUL A;  3DPD A;  1UNP A;  1YD8 U;  2M0X A;  1XX0 A;  4GMV A;  2FCS A;  2KNB A;  1IYF A;  2CS4 A;  3DDC B;  4FA6 A;  4WWO A;  1MG8 A;  2VSZ A;  2P0F A;  2GBK A;  1P3Q U;  3AU5 A;  5L83 A;  2MP2 B;  2XQN M;  5LXH A;  5CTR C;  4HPM B;  4BOS C;  2KJH B;  5JHH A;  2HTH A;  3TMP B;  4JGH B;  2JRI B;  4WJP A;  1I2H A;  5JH5 C;  1WY8 A;  4HAZ B;  5FI0 A;  1HE8 A;  4DHJ B;  1DIK A;  2JZZ A;  2XK5 B;  5DH9 B;  2GBR A;  1NVL A;  2RGF A;  3QCA A;  4DX9 0;  2WDT B;  1PFJ A;  2D3G A;  2LVP A;  1YIW A;  3OJ3 A;  4AJW A;  3KW5 B;  4JKG B;  1P98 A;  4BVU C;  3VTV A;  1DBH A;  2C7M B;  3QHT A;  4CHK A;  3TVV A;  2K6Q A;  4DHZ B;  2KLC A;  3WAN A;  2YT0 A;  1MPH A;  3A8Q A;  2GOW A;  3APD A;  4CYE A;  3HW2 B;  3JSV B;  2ZCB A;  2DYM A;  1WH3 A;  1Y19 B;  1GGO A;  1Y5O A;  1IRS A;  1U29 A;  2RVB B;  4ANX A;  4TYZ A;  1U5G A;  1WR6 E;  1WJ1 A;  1Q0W B;  2LGX A;  4AOF A;  1RJ2 A;  1YX6 B;  2IBI B;  5HE2 A;  2JVC A;  4F7U P;  4BFR A;  1NDD A;  2MBE A;  3Q3J A;  4F1S A;  1RLF A;  2GBN A;  2Y7B A;  3D8F A;  5E6P A;  2L1C A;  3VUY A;  4IM3 A;  2Y8G A;  3A8P A;  5D3Y A;  4GXB A;  2KCJ A;  3PRZ A;  2ZPY A;  2XEW A;  3DOW A;  4KHA A;  4HJK A;  2CB8 A;  2GCL A;  4C0A A;  1OMW A;  4BKT A;  3A9K B;  4WWN A;  4GDK B;  4PYU A;  2UWQ A;  3NZU A;  2D4Q A;  1KZG A;  2MSE D;  1E8Y A;  2KK8 A;  1XD4 A;  1UZX B;  2D9W A;  2NS5 A;  1GC7 A;  1AWE A;  4BBK A;  3WAL A;  2D9Z A;  1X1M A;  2MFQ A;  3P6A A;  2C7N B;  3RZF A;  3BY4 B;  4NQL B;  4Z2M B;  5D6J B;  2HE7 A;  1E8W A;  3DVN U;  1V5M A;  5J3Q A;  4PS8 A;  2JY6 A;  1NU2 A;  3PLV A;  2J0M A;  3UGB B;  4JKF A;  3U30 A;  4W9K A;  2NVU I;  3D32 A;  2LGD A;  5CX3 A;  3TJP A;  3A1Q B;  1UBQ A;  2KDF B;  2X0S A;  2RLO A;  2I5F A;  1E8X A;  2K8B A;  3JW0 X;  5HE0 A;  1EGX A;  3V61 A;  4CHJ A;  5J3T A;  2BKF A;  2RGN B;  3TCA A;  3W1Y A;  1P0R A;  4AJY B;  2Z59 B;  2IO3 B;  3QWZ B;  4YL8 A;  3NOB A;  2IO1 B;  3NSU A;  1DDW A;  3TIX A;  2BWF A;  3ZTD A;  3M62 B;  5KCV A;  2LBB A;  4W9L A;  1SHC A;  3VAW A;  4X57 B;  3ML4 A;  2DZK A;  4IFS A;  4HAU B;  3M95 A;  3ODX A;  4NAW B;  3RUI B;  5FI1 A;  3H1U A;  4N9F 4;  1ZM0 A;  2KKC A;  5JHG A;  2LI5 A;  2DHJ A;  2MBH A;  2NBW B;  3A4S C;  5AEK B;  1Y8R C;  3WAP A;  1M7E A;  3UQA A;  1OGW A;  2WWZ A;  5D3X A;  2JZ3 B;  2R2Q A;  2FDQ A;  4IG7 B;  3KVF B;  4JK8 A;  4L6E A;  1V88 A;  1Q1O A;  2MWS B;  2ADZ A;  2D9V A;  3MPX A;  2AYO B;  3KH0 A;  3SHQ A;  3DXC A;  2DHK A;  3HIZ A;  1OEY A;  4HDO A;  1WMH B;  1OQY A;  2KDE B;  3LJU X;  2JUO A;  3VOQ A;  2ZNV C;  2NPT B;  4FLH A;  4IWP A;  1SIF A;  4HCP B;  3P7Z A;  4LCD E;  1JDE A;  2CHZ A;  4ILJ A;  5TR5 A;  2CY5 A;  2RSG A;  2KFK B;  2LAS A;  2YF0 A;  2FCN A;  1H4R A;  2KHW B;  4MJS B;  2DX1 A;  4W9F A;  3VQI A;  3JVZ X;  2LKO A;  2NCN A;  3B0A A;  4ZYN A;  2IYB A;  1I42 A;  4ZRJ A;  4ILG B;  2NMB A;  4TQ1 A;  1WRD B;  3N32 A;  4DK5 A;  1YQB A;  2ZCC A;  3HQC A;  3QIJ A;  4GDL B;  2CQU A;  2GBJ A;  1RRP B;  1FGZ A;  2DKP A;  3M1I B;  1WVH A;  3AU4 A;  4FN2 A;  1FHW A;  5G55 A;  4HPL B;  2R0D A;  2JWZ A;  2DHI A;  3V5W A;  2L0T A;  1I35 A;  2Z0D B;  4BKG A;  3GYP A;  2V4L A;  2V1Y A;  2DYQ A;  4H8S A;  3PP2 A;  2H7E A;  1K8R B;  3VTW A;  3ZDM C;  4K17 A;  2X18 A;  2KN5 A;  3KYC D;  2PZ1 A;  2ELB A;  2MQJ A;  3PTF C;  4LJO B;  3ZNH B;  4IW0 A;  4K1R B;  2FJ9 A;  2PEA A;  2DYO A;  4NNJ B;  1V2Y A;  1WX9 A;  4MM3 A;  2O6V D;  4J6I A;  3V62 A;  4JKA A;  4JKB A;  2BYV E;  2FJL A;  1WX7 A;  2KTR A;  1MK7 B;  1TJ6 A;  2ROV A;  5CHF A;  1WGU A;  1OEY J;  1P6S A;  3NZS A;  2COP A;  5DHF B;  3KSY A;  3DBS A;  4PYZ A;  4JIO U;  4E71 A;  1FB8 A;  1V9J A;  2PPH A;  4FJV B;  1WIA A;  2Z0E B;  2KWU B;  3QJZ A;  2IFS A;  4TKN A;  2DTC A;  4K2O A;  4NQK E;  1P3R A;  1KLV A;  3ALB A;  1QQG A;  3CXB B;  5D2M B;  3MDB C;  1WZ3 A;  2D2Q A;  3IG3 A;  2O2V A;  4B6H A;  3E66 A;  2LRU A;  4HAV B;  1TBE A;  1UGM A;  2KWV B;  3NY5 A;  2LVO A;  2BWE S;  3UIN B;  4WJO A;  2CU1 A;  2PE6 B;  4WJ7 A;  2GCJ A;  2NBU A;  3X23 A;  2MX2 A;  4LDT D;  2LXA A;  3F5R A;  4HLE A;  4RM9 A;  4KZC A;  5DPT A;  4DDI D;  4A5K A;  2UYZ B;  5JP4 A;  4F7H A;  1U5F A;  4K7S A;  1U5E A;  1YX5 B;  1J8C A;  4TV3 A;  2IZV B;  2L3Z A;  3NHE B;  2L2I A;  2GJY A;  3ENB A;  2EKE C;  2KC1 A;  3JYU A;  3PLU A;  4II2 B;  4MGZ E;  1H10 A;  1V61 A;  4B95 A;  2W2X C;  1XKE A;  3S2A A;  4BBN C;  3EC8 A;  2FUH B;  3AXC A;  2KOX A;  4HCN B;  2G35 A;  3TW1 A;  2MLB A;  1DDM A;  3QC8 B;  3V6E B;  1XT9 B;  4KDL B;  4MT7 A;  3B08 A;  2ZVO A;  2DKQ A;  1C3T A;  3VTU A;  1DRO A;  2MCN B;  1S3S G;  2LVQ A;  3DBH I;  4DXA B;  4MGK E;  2HTH B;  2MP2 A;  1KM7 A;  2BF8 B;  3IHP C;  4W9D A;  1LFD A;  4HAW B;  2DLW A;  2YS1 A;  2R82 A;  4ICU A;  3WAM A;  4IWQ A;  4XWX A;  4KHB B;  1NTI A;  3PS6 A;  2KJ6 A;  2MRP A;  4GGQ A;  1BTN A;  5C79 A;  3HM6 X;  2XK5 A;  1WXA A;  1VBH A;  1LB1 A;  1FHX A;  3RYT A;  4EZK A;  3SYX A;  3UIO B;  4PNK A;  2KX3 A;  1A5R A;  4JKG A;  2W2W A;  1BWN A;  1C1Y B;  4IUM B;  5IAA C;  2YVC A;  3WAO A;  3UZT A;  3QAQ A;  4K7U A;  2IO0 B;  1PLS A;  5DCN A;  2KDI A;  3BJI A;  2C7H A;  3EEC A;  4HXD A;  2RNR B;  4W9C A;  3PT2 B;  3Q3F A;  1AAR A;  1HB6 A;  2N1V A;  4JKE A;  2FIF A;  1EO6 A;  4XX5 A;  3TO1 A;  4WSF A;  1ZC3 B;  4EOY A;  1UBI A;  3OAN A;  2C5L C;  3AUL A;  5JHA A;  4KIK A;  3N7C A;  2KTF A;  4EEW A;  3ZRF A;  1V80 A;  2DZM A;  3MHS D;  4EUT A;  3W1S A;  3DVN V;  2I5C A;  2CR5 A;  1W1H A;  4KZ0 A;  4XC2 A;  5LXI B;  4HAY B;  1WE6 A;  2ZZP B;  4IM2 A;  2YS5 A;  3LDZ E;  4MDK E;  3PSE B;  2YSZ A;  4M8M A;  5CLQ B;  1V5T A;  1X1G A;  3NS8 A;  1S1Q B;  3A9K A;  5J17 A;  2JP2 A;  3FP5 A;  2AWT A;  4B9K A;  3PPA A;  2JF5 A;  2C9W B;  4BBN F;  3ZKJ C;  2RQ1 A;  1DYN A;  1V86 A;  1WGH A;  1TGZ B;  5L95 C;  1R4M I;  2ZNV B;  2Y8F A;  1W1G A;  2O6V A;  4ZRK A;  2KD0 A;  2B3A A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...