1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Talin
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
1FAOA 4HAVB 4IAPA 4KHBB 4C0AA 5GOWB 3CXBB 4MK0A 2LYDA 4TYZA 1UNPA 1U2BA 3PZDA 5C16A 1ISNA 4HATB 2IFSA 2ABDA 4KAXB 1AWEA 4YL8A 2MFQA 5LOPB 1WG7A 1EVHA 3RCPA 2KGXB 2LKOA 4MT7A 1ST7A 4KHOA 3PG7A 4A5KA 4EMOA 1J0WA 1FOEA 2KCJA 2H7EA 4HAUB 5C5BB 3ODWA 5C6RA 2M38A 4Z2MB 4KVGB 4CYEA 1H10A 1V89A 5EFXA 2NMBA 1X11A 2DTCA 2DN6A 1BWNA 1J19A 1U27A 1BTKA 3DXEA 4WJ7A 4DX90 1QC6A 3M1IB 3V5WA 2VSZA 2YT0A 2OQBA 4K2PA 2M14A 5J3QA 4GPTB 1N3HA 2DHJA 1U5EA 1WJMA 1OY2A 3U8ZA 3F5RA 3OANA 4K2OA 2COAA 2DX1A 2K00A 5D27A 4K81A 2D2QA 1M7RA 2CRFA 4DBBA 2LOXA 1QQGA 2EJ8A 2L2IA 2D4QA 3TVVA 5JHHA 1NI2A 3ZVRA 2J0MA 3PSCA 3ULCA 1DROA 4MY6A 5JP4A 3FP5A 4ZRIA 2P0FA 4F7HA 4PNKA 2D10A 4IOYX 2PZ1A 4HB0B 2N23A 5D3VA 1FHOA 1BAKA 1XKEA 1SHCA 2D9XA 4DXAB 3KRXA 1ACAA 1ZSQA 2BCJA 2D9WA 1MK9B 1NTYA 1XCGA 2DHKA 2LULA 3FEHA 1V61A 3PVWA 4A6FA 2J59M 5JLJB 2NZ8B 1UPRA 3LJUX 2D9YA 2HE7A 2KUPA 3KZ1A 1FHWA 2VRWB 4IFSA 1GC7A 1KZGA 2N0YA 1B55A 2P8VA 2K2JA 1WI1A 4D0NB 2FDQA 2I1KA 3CIKA 1RJ2A 1EGXA 2RVBB 1KI1B 2W2XD 2COFA 1V5UA 2YF0A 3D8EA 1DDWA 3ZDTA 3F0WA 1BTNA 2IYBA 5IJMA 2QKMA 1U5FA 4WVFB 2I5CA 1LB1A 1MKEA 3WA0A 4HAYB 2DKPA 2CQUA 2P0DA 2ADZA 4HAWB 4HAXB 2AL6A 4NY0A 1M7EA 2MWNB 2LBBA 1Z87A 1WVHA 2I5FA 3ML4A 3AU5A 1I7AA 1TQZA 2LOZA 2DLWA 4A6KA 2CODA 1WJ1A 3QIJA 3KY9A 3P7ZA 5C5BA 2XQNM 3UZTA 1WGUA 2FJLA 5CLLB 3QBVB 5FI0A 3KRWA 4HAZB 2LG1A 2DHIA 1KZ7A 2CY5A 1HB8A 3PP2A 2CY4A 5FI1A 3AU4A 5CLQB 3N7CA 2R0DA 4HB4B 4HDOA 4EKUA 1MIZB 5J3TA 2JP2A 2R09A 2J0KA 1FGZA 3DXDA 1WGQA 1V5PA 5JHGA 2E2XA 2UZSA 1V88A 3TCAA 1PMSA 2HTHB 1DBHA 2ELBA 5HE3A 5D3XA 1DDMA 3TFMA 5DIFB 1U29A 4XWXA 2ROZB 1XODA 5DHAB 3PVUA 3KSYA 1EAZA 5LONB 3TO1A 3IVFA 2D11A 2RLOA 4WSFA 1Y5OA 1ZVRA 2Y8FA 3D8FA 1TXDA 1MPHA 2DX5A 2DYNA 1UNQA 3HK0A 4CHJA 1U5DA 1P6SA 3NSUA 1MAIA 2YRYA 3VIAA 5DHFB 4HDQA 3O96A 2MKRA 3ULBA 4GXBA 3AJ4A 4GMXB 1UNRA 1W1DA 4K17A 2J0JA 2RUKB 1OMWA 1EF1A 1Y19B 2YS1A 2I1JA 4GZUA 3SYXA 5D3WA 1W1GA 3G9WA 1IRSA 2W2XC 2WH5A 1SGHA 1FHXA 4F7GA 2QKLA 5HE2A 1H4RA 4Z2NA 2CAYA 1MIXA 2HRJA 2GJYA 1UEFA 2L1CA 3A8PA 4GN1A 1P3RA 3GYOA 2YS5A 4YONA 1Q67A 2Z0PA 2YS3A 1NU2A 2GCLA 5J3YA 4KHAA 3A98B 2Q13A 1ZC4B 1GG3A 3DXCA 3ODXA 1MK7B 5DH9B 3U7DA 1E5WA 1X1FA 2RGNB 1I2HA 1X86A 1X1GA 3BINA 1V5MA 3VOQA 2Y7BA 1NTIA 2COCA 1U5GA 3FSSA 5DI9B 1AQCA 1HB6A 3PEGA 1P5TA 2D9ZA 1K5DB 2DYQA 1PLSA 3EPYA 1HBKA 4NSWA 5KQ1A 2ROVA 2ZPYA 4BBKA 3TW1A 1NTVA 2K2UA 3HW2B 1OQNA 2RSGA 3HQCA 3SUZA 1PFJA 2Z0QA 1UPQA 2MDXA 4ZRKA 3FLVA 2RNRB 4A6HA 3MPXA 2G35A 2RQ1A 1LW3A 4HHVA 1XD4A 2V76A 1K5GB 1RRPB 5C79A 3FM8C 2X18A 3X23A 2GS0A 2UZRA 2CB8A 2EMTA 1FB8A 4DX8A 5D3YA 5HE1A 4B6HA 3WYFB 4HB3B 1NVLA 2FJ9A 1GC6A 1ZM0A 2DFKA 1DYNA 4CHMA 4Y94A 3D8DA 3SV1A 4L6EA 2Y8GA 2YSZA 4H8SA 3A8QA 4TKNA 2COPA 2UVMA 4EJNA 5KQ4A 2OTXA 3ODOA 3SO6A 2YVCA 4ZRJA 1XR0B 2H7DA 4F7UP 2DA0A 4P7IA 1TJ6A 2EC1A 1W1HA 4HB2B 3SNHA 4A6FB 1FGYA 2VKIA 2Z0OA 2AEHA 3MDBC 3T06A 2P0HA 1DDVA 1ZC3B 5KCVA 3QWMA 3BJIA 2YT1A 3P6AA 2DKQA 4GMVA 2GCJA 2W2WA 2D9VA 1XX0A 3GYPA 5HE0A 5L81A 2ELAA 3PVLA 1X05A 4PQ0A 2EMSA
chains in the Genus database with same CATH superfamily
1FAOA 4HAVB 4IAPA 4KHBB 4C0AA 5GOWB 3CXBB 4MK0A 2LYDA 4TYZA 1UNPA 1U2BA 3PZDA 5C16A 1ISNA 4HATB 2IFSA 2ABDA 4KAXB 1AWEA 4YL8A 3OHMB 2YT2A 2MFQA 5LOPB 1WG7A 1EVHA 4QXAB 3RCPA 2KGXB 2LKOA 4MT7A 1ST7A 4KHOA 3PG7A 4A5KA 4EMOA 1J0WA 1FOEA 2KCJA 2Z14A 2H7EA 4HAUB 5C5BB 3ODWA 5C6RA 2M38A 4Z2MB 3FVCA 4HSIA 4KVGB 4CYEA 1H10A 1V89A 5EFXA 2NMBA 1X11A 2DTCA 2DN6A 1BWNA 1J19A 1U27A 1BTKA 3DXEA 4WJ7A 4DX90 1QC6A 3M1IB 3V5WA 2VSZA 2YT0A 2OQBA 3E9OA 4JKAA 2M14A 4K2PA 4GPTB 1N3HA 5J3QA 2DHJA 1U5EA 1WJMA 1OY2A 3U8ZA 3F5RA 3OANA 4K2OA 2COAA 2DX1A 2K00A 3HSAA 5D27A 4K81A 2D2QA 1M7RA 2CRFA 4DBBA 2LOXA 1QQGA 2EJ8A 2L2IA 2D4QA 3TVVA 5JHHA 1NI2A 3ZVRA 2J0MA 3PSCA 3ULCA 1DROA 4MY6A 5JP4A 3FP5A 4ZRIA 2P0FA 4F7HA 4PNKA 2D10A 4IOYX 2PZ1A 3DCXA 2N23A 4HB0B 5D3VA 1FHOA 1BAKA 1XKEA 1SHCA 3U12A 2D9XA 4DXAB 3KRXA 1ACAA 1MI1A 1GGOA 1ZSQA 2BCJA 2D9WA 1MK9B 1NTYA 1XCGA 2DHKA 2LULA 3FEHA 1V61A 4GOUA 2FJUB 3PVWA 4A6FA 2J59M 5JLJB 2Z4DA 5I2SA 2NZ8B 1UPRA 2KUQA 3LJUX 1JDEA 2D9YA 2HE7A 2KUPA 3KZ1A 1FHWA 2VRWB 4IFSA 1GC7A 1KZGA 2N0YA 1B55A 2GUMA 5IRSA 2P8VA 2K2JA 1T77A 1WI1A 4D0NB 2FDQA 2I1KA 3CIKA 1RJ2A 1EGXA 2RVBB 2KIGA 2R2YA 4JKDA 1KI1B 2W2XD 2COFA 1V5UA 2YF0A 3D8EA 1DDWA 4GNKB 3ZDTA 3F0WA 2X0SA 1BTNA 2IYBA 5IJMA 2Z59A 2QKMA 1U5FA 4WVFB 2I5CA 1LB1A 1MKEA 3WA0A 4HAYB 2DKPA 2CQUA 2P0DA 2ADZA 4HAWB 4HAXB 2AL6A 4NY0A 1M7EA 2MWNB 2LBBA 1Z87A 1WVHA 2I5FA 3ML4A 3AU5A 3SBGA 1I7AA 1TQZA 5I2MA 4ILGB 2LOZA 2DLWA 4A6KA 2CODA 1WJ1A 5M4YB 3QIJA 3KY9A 3P7ZA 5C5BA 2XQNM 3UZTA 1WGUA 4CSQA 2FJLA 1KBLA 5CLLB 3QBVB 5FI0A 3KRWA 4HAZB 2LG1A 2DHIA 1KZ7A 2CY5A 1HB8A 3PP2A 2CY4A 5FI1A 3AU4A 1VBGA 3NWAA 5CLQB 3N7CA 2R0DA 4HB4B 4HDOA 4EKUA 1MIZB 5J3TA 2JP2A 2R09A 4QJ3B 2J0KA 1FGZA 2Z13A 3DXDA 1WGQA 1V5PA 2ZKMX 5JHGA 2E2XA 2UZSA 1V88A 3TCAA 1PMSA 2HTHB 1DBHA 2ELBA 5HE3A 5D3XA 2NBVA 1DDMA 3TFMA 5DIFB 4JK8A 1U29A 4JKHA 4XWXA 2ROZB 3E9PA 1XODA 5DHAB 3PVUA 3KSYA 1EAZA 5LONB 3TO1A 3IVFA 2D11A 2RLOA 4WSFA 4ILHA 1Y5OA 3B77A 1ZVRA 2Y8FA 3D8FA 1TXDA 1MPHA 3NW8A 2DX5A 2DYNA 1UNQA 3HK0A 3ENBA 4CHJA 1U5DA 1P6SA 3NSUA 1MAIA 4D6WA 2YRYA 3VIAA 2R82A 5DHFB 4HDQA 3O96A 2MKRA 3ULBA 4JKBA 4GXBA 3AJ4A 4GMXB 1UNRA 1W1DA 1DIKA 4JKCA 4K17A 2J0JA 2RUKB 1OMWA 2K8EA 1EF1A 1Y19B 2YS1A 2I1JA 4GZUA 3SYXA 5D3WA 1W1GA 3G9WA 1IRSA 3NWDA 2W2XC 2WH5A 4L1RA 1SGHA 5JVLA 1FHXA 4F7GA 2QKLA 5HE2A 1H4RA 4Z2NA 2CAYA 1MIXA 2HRJA 2GJYA 1UEFA 2KIEA 2L1CA 4QJ5B 3A8PA 4GN1A 1P3RA 3GYOA 3A58A 1KC7A 2YS5A 4YONA 1Q67A 2Z0PA 4JK9A 2YS3A 1NU2A 2GCLA 5J3YA 4KHAA 3A98B 2Q13A 1ZC4B 1GG3A 3DXCA 3ODXA 4JKGB 1MK7B 5DH9B 3U7DA 1E5WA 1X1FA 2RGNB 1I2HA 4JKFA 3HIEA 4KHBA 1X86A 1X1GA 3BINA 1V5MA 3VOQA 2Y7BA 4OT1A 1NTIA 2COCA 1U5GA 3FSSA 5DI9B 1AQCA 1HB6A 3PEGA 1P5TA 4OSNA 2D9ZA 1K5DB 2DYQA 1PLSA 3EPYA 1HBKA 4NSWA 5KQ1A 4JKGA 2ROVA 2ZPYA 4BBKA 3TW1A 3NWFA 1NTVA 2K2UA 3HW2B 1OQNA 2RSGA 2DIKA 2KR0A 3HQCA 3SUZA 1PFJA 2Z0QA 1UPQA 2MDXA 4ZRKA 3FLVA 2RNRB 4A6HA 3MPXA 2G35A 2RQ1A 1LW3A 4HHVA 1XD4A 2V76A 1K5GB 1RRPB 5C79A 3FM8C 2X18A 3X23A 2GS0A 2UZRA 3E9LA 2CB8A 2EMTA 3E66A 1FB8A 4DX8A 5D3YA 5HE1A 4B6HA 3WYFB 4HB3B 1NVLA 2FJ9A 1GC6A 1ZM0A 2RRFA 2DFKA 1DYNA 4CHMA 4Y94A 4JKEA 3D8DA 3SV1A 4L6EA 2Y8GA 2YSZA 2K49A 4H8SA 3A8QA 4TKNA 2COPA 2UVMA 5LG4B 4EJNA 5KQ4A 2OTXA 1ZYIA 3SBTA 3ODOA 1VBHA 3SO6A 2YVCA 4ZRJA 1XR0B 2H7DA 4F7UP 2DA0A 4P7IA 1TJ6A 2EC1A 1W1HA 4HB2B 3SNHA 4A6FB 1FGYA 2VKIA 2Z0OA 2AEHA 3MDBC 3T06A 2P0HA 1DDVA 1ZC3B 4ILJA 4QJ4B 5KCVA 3QWMA 3BJIA 2YT1A 3P6AA 2DKQA 4GMVA 2GCJA 2W2WA 2D9VA 1XX0A 3GYPA 5HE0A 5L81A 4DIXA 2ELAA 4JK7A 3PVLA 1X05A 4PQ0A 2EMSA
chains in the Genus database with same CATH topology
1FAOA 4HAVB 4IAPA 4KHBB 4C0AA 5GOWB 3CXBB 4MK0A 2LYDA 4TYZA 1UNPA 1U2BA 3PZDA 5C16A 1ISNA 4HATB 2IFSA 2ABDA 4KAXB 1AWEA 4YL8A 2MFQA 5LOPB 1WG7A 1EVHA 3RCPA 2KGXB 2LKOA 4MT7A 1ST7A 4KHOA 3PG7A 4A5KA 4EMOA 1J0WA 1FOEA 2KCJA 2H7EA 4HAUB 5C5BB 3ODWA 5C6RA 2M38A 4Z2MB 4KVGB 4CYEA 1H10A 1V89A 5EFXA 2NMBA 1X11A 2DTCA 2DN6A 1BWNA 1J19A 1U27A 1BTKA 3DXEA 4WJ7A 4DX90 1QC6A 3M1IB 3V5WA 2VSZA 2YT0A 2OQBA 3E9OA 4JKAA 2M14A 4K2PA 4GPTB 1N3HA 5J3QA 2DHJA 1U5EA 1WJMA 1OY2A 3U8ZA 3F5RA 3OANA 4K2OA 2COAA 2DX1A 2K00A 5D27A 4K81A 2D2QA 1M7RA 2CRFA 4DBBA 2LOXA 1QQGA 2EJ8A 2L2IA 2D4QA 3TVVA 5JHHA 1NI2A 3ZVRA 2J0MA 3PSCA 3ULCA 1DROA 4MY6A 5JP4A 3FP5A 4ZRIA 2P0FA 4F7HA 4PNKA 2D10A 4IOYX 2PZ1A 4HB0B 2N23A 5D3VA 1FHOA 1BAKA 1XKEA 1SHCA 2D9XA 4DXAB 3KRXA 1ACAA 1ZSQA 1GGOA 2BCJA 2D9WA 1MK9B 1NTYA 1XCGA 2DHKA 2LULA 3FEHA 1V61A 3PVWA 4A6FA 2J59M 5JLJB 2NZ8B 1UPRA 3LJUX 1JDEA 2D9YA 2HE7A 2KUPA 3KZ1A 1FHWA 2VRWB 4IFSA 1GC7A 1KZGA 2N0YA 1B55A 2P8VA 2K2JA 1WI1A 4D0NB 2FDQA 2I1KA 3CIKA 1RJ2A 1EGXA 2RVBB 4JKDA 1KI1B 2W2XD 2COFA 1V5UA 2YF0A 3D8EA 1DDWA 3ZDTA 3F0WA 2X0SA 1BTNA 2IYBA 5IJMA 2QKMA 1U5FA 4WVFB 2I5CA 1LB1A 1MKEA 3WA0A 4HAYB 2DKPA 2CQUA 2P0DA 2ADZA 4HAWB 4HAXB 2AL6A 4NY0A 1M7EA 2MWNB 2LBBA 1Z87A 1WVHA 2I5FA 3ML4A 3AU5A 3SBGA 1I7AA 1TQZA 4ILGB 2LOZA 2DLWA 4A6KA 2CODA 1WJ1A 3QIJA 3KY9A 3P7ZA 5C5BA 2XQNM 3UZTA 1WGUA 2FJLA 1KBLA 5CLLB 3QBVB 5FI0A 3KRWA 4HAZB 2LG1A 2DHIA 1KZ7A 2CY5A 1HB8A 3PP2A 2CY4A 5FI1A 3AU4A 1VBGA 5CLQB 3N7CA 2R0DA 4HB4B 4HDOA 4EKUA 1MIZB 5J3TA 2JP2A 2R09A 2J0KA 1FGZA 3DXDA 1WGQA 1V5PA 5JHGA 2E2XA 2UZSA 1V88A 3TCAA 1PMSA 2HTHB 1DBHA 2ELBA 5HE3A 5D3XA 1DDMA 3TFMA 5DIFB 4JK8A 1U29A 4JKHA 4XWXA 2ROZB 3E9PA 1XODA 5DHAB 3PVUA 3KSYA 1EAZA 5LONB 3TO1A 3IVFA 2D11A 2RLOA 4WSFA 4ILHA 1Y5OA 1ZVRA 2Y8FA 3D8FA 1TXDA 1MPHA 2DX5A 2DYNA 1UNQA 3HK0A 3ENBA 4CHJA 1U5DA 1P6SA 3NSUA 1MAIA 2YRYA 3VIAA 2R82A 5DHFB 4HDQA 3O96A 2MKRA 3ULBA 4JKBA 4GXBA 3AJ4A 4GMXB 1UNRA 1W1DA 1DIKA 4JKCA 4K17A 2J0JA 2RUKB 1OMWA 1EF1A 1Y19B 2YS1A 2I1JA 4GZUA 3SYXA 5D3WA 1W1GA 3G9WA 1IRSA 2W2XC 2WH5A 1SGHA 5JVLA 1FHXA 4F7GA 2QKLA 5HE2A 1H4RA 4Z2NA 2CAYA 1MIXA 2HRJA 2GJYA 1UEFA 2L1CA 3A8PA 4GN1A 1P3RA 3GYOA 1KC7A 2YS5A 4YONA 1Q67A 2Z0PA 4JK9A 2YS3A 1NU2A 2GCLA 5J3YA 4KHAA 3A98B 2Q13A 1ZC4B 1GG3A 3DXCA 3ODXA 4JKGB 1MK7B 5DH9B 3U7DA 1E5WA 1X1FA 2RGNB 1I2HA 4JKFA 1X86A 1X1GA 3BINA 1V5MA 3VOQA 2Y7BA 1NTIA 2COCA 1U5GA 3FSSA 5DI9B 1AQCA 1HB6A 3PEGA 1P5TA 2D9ZA 1K5DB 2DYQA 1PLSA 3EPYA 1HBKA 4NSWA 5KQ1A 4JKGA 2ROVA 2ZPYA 4BBKA 3TW1A 1NTVA 2K2UA 3HW2B 1OQNA 2RSGA 2DIKA 3HQCA 3SUZA 1PFJA 2Z0QA 1UPQA 2MDXA 4ZRKA 3FLVA 2RNRB 4A6HA 3MPXA 2G35A 2RQ1A 1LW3A 4HHVA 1XD4A 2V76A 1K5GB 1RRPB 5C79A 3FM8C 2X18A 3X23A 2GS0A 2UZRA 3E9LA 2CB8A 2EMTA 3E66A 1FB8A 4DX8A 5D3YA 5HE1A 4B6HA 3WYFB 4HB3B 1NVLA 2FJ9A 1GC6A 1ZM0A 2DFKA 1DYNA 4CHMA 4Y94A 4JKEA 3D8DA 3SV1A 4L6EA 2Y8GA 2YSZA 4H8SA 3A8QA 4TKNA 2COPA 2UVMA 4EJNA 5KQ4A 2OTXA 3SBTA 3ODOA 1VBHA 3SO6A 2YVCA 4ZRJA 1XR0B 2H7DA 4F7UP 2DA0A 4P7IA 1TJ6A 2EC1A 1W1HA 4HB2B 3SNHA 4A6FB 1FGYA 2VKIA 2Z0OA 2AEHA 3MDBC 3T06A 2P0HA 1DDVA 1ZC3B 4ILJA 5KCVA 3QWMA 3BJIA 2YT1A 3P6AA 2DKQA 4GMVA 2GCJA 2W2WA 2D9VA 1XX0A 3GYPA 5HE0A 5L81A 2ELAA 4JK7A 3PVLA 1X05A 4PQ0A 2EMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAO A;  4HAV B;  4IAP A;  4KHB B;  4C0A A;  5GOW B;  3CXB B;  4MK0 A;  2LYD A;  4TYZ A;  1UNP A;  1U2B A;  3PZD A;  5C16 A;  1ISN A;  4HAT B;  2IFS A;  2ABD A;  4KAX B;  1AWE A;  4YL8 A;  2MFQ A;  5LOP B;  1WG7 A;  1EVH A;  3RCP A;  2KGX B;  2LKO A;  4MT7 A;  1ST7 A;  4KHO A;  3PG7 A;  4A5K A;  4EMO A;  1J0W A;  1FOE A;  2KCJ A;  2H7E A;  4HAU B;  5C5B B;  3ODW A;  5C6R A;  2M38 A;  4Z2M B;  4KVG B;  4CYE A;  1H10 A;  1V89 A;  5EFX A;  2NMB A;  1X11 A;  2DTC A;  2DN6 A;  1BWN A;  1J19 A;  1U27 A;  1BTK A;  3DXE A;  4WJ7 A;  4DX9 0;  1QC6 A;  3M1I B;  3V5W A;  2VSZ A;  2YT0 A;  2OQB A;  4K2P A;  2M14 A;  5J3Q A;  4GPT B;  1N3H A;  2DHJ A;  1U5E A;  1WJM A;  1OY2 A;  3U8Z A;  3F5R A;  3OAN A;  4K2O A;  2COA A;  2DX1 A;  2K00 A;  5D27 A;  4K81 A;  2D2Q A;  1M7R A;  2CRF A;  4DBB A;  2LOX A;  1QQG A;  2EJ8 A;  2L2I A;  2D4Q A;  3TVV A;  5JHH A;  1NI2 A;  3ZVR A;  2J0M A;  3PSC A;  3ULC A;  1DRO A;  4MY6 A;  5JP4 A;  3FP5 A;  4ZRI A;  2P0F A;  4F7H A;  4PNK A;  2D10 A;  4IOY X;  2PZ1 A;  4HB0 B;  2N23 A;  5D3V A;  1FHO A;  1BAK A;  1XKE A;  1SHC A;  2D9X A;  4DXA B;  3KRX A;  1ACA A;  1ZSQ A;  2BCJ A;  2D9W A;  1MK9 B;  1NTY A;  1XCG A;  2DHK A;  2LUL A;  3FEH A;  1V61 A;  3PVW A;  4A6F A;  2J59 M;  5JLJ B;  2NZ8 B;  1UPR A;  3LJU X;  2D9Y A;  2HE7 A;  2KUP A;  3KZ1 A;  1FHW A;  2VRW B;  4IFS A;  1GC7 A;  1KZG A;  2N0Y A;  1B55 A;  2P8V A;  2K2J A;  1WI1 A;  4D0N B;  2FDQ A;  2I1K A;  3CIK A;  1RJ2 A;  1EGX A;  2RVB B;  1KI1 B;  2W2X D;  2COF A;  1V5U A;  2YF0 A;  3D8E A;  1DDW A;  3ZDT A;  3F0W A;  1BTN A;  2IYB A;  5IJM A;  2QKM A;  1U5F A;  4WVF B;  2I5C A;  1LB1 A;  1MKE A;  3WA0 A;  4HAY B;  2DKP A;  2CQU A;  2P0D A;  2ADZ A;  4HAW B;  4HAX B;  2AL6 A;  4NY0 A;  1M7E A;  2MWN B;  2LBB A;  1Z87 A;  1WVH A;  2I5F A;  3ML4 A;  3AU5 A;  1I7A A;  1TQZ A;  2LOZ A;  2DLW A;  4A6K A;  2COD A;  1WJ1 A;  3QIJ A;  3KY9 A;  3P7Z A;  5C5B A;  2XQN M;  3UZT A;  1WGU A;  2FJL A;  5CLL B;  3QBV B;  5FI0 A;  3KRW A;  4HAZ B;  2LG1 A;  2DHI A;  1KZ7 A;  2CY5 A;  1HB8 A;  3PP2 A;  2CY4 A;  5FI1 A;  3AU4 A;  5CLQ B;  3N7C A;  2R0D A;  4HB4 B;  4HDO A;  4EKU A;  1MIZ B;  5J3T A;  2JP2 A;  2R09 A;  2J0K A;  1FGZ A;  3DXD A;  1WGQ A;  1V5P A;  5JHG A;  2E2X A;  2UZS A;  1V88 A;  3TCA A;  1PMS A;  2HTH B;  1DBH A;  2ELB A;  5HE3 A;  5D3X A;  1DDM A;  3TFM A;  5DIF B;  1U29 A;  4XWX A;  2ROZ B;  1XOD A;  5DHA B;  3PVU A;  3KSY A;  1EAZ A;  5LON B;  3TO1 A;  3IVF A;  2D11 A;  2RLO A;  4WSF A;  1Y5O A;  1ZVR A;  2Y8F A;  3D8F A;  1TXD A;  1MPH A;  2DX5 A;  2DYN A;  1UNQ A;  3HK0 A;  4CHJ A;  1U5D A;  1P6S A;  3NSU A;  1MAI A;  2YRY A;  3VIA A;  5DHF B;  4HDQ A;  3O96 A;  2MKR A;  3ULB A;  4GXB A;  3AJ4 A;  4GMX B;  1UNR A;  1W1D A;  4K17 A;  2J0J A;  2RUK B;  1OMW A;  1EF1 A;  1Y19 B;  2YS1 A;  2I1J A;  4GZU A;  3SYX A;  5D3W A;  1W1G A;  3G9W A;  1IRS A;  2W2X C;  2WH5 A;  1SGH A;  1FHX A;  4F7G A;  2QKL A;  5HE2 A;  1H4R A;  4Z2N A;  2CAY A;  1MIX A;  2HRJ A;  2GJY A;  1UEF A;  2L1C A;  3A8P A;  4GN1 A;  1P3R A;  3GYO A;  2YS5 A;  4YON A;  1Q67 A;  2Z0P A;  2YS3 A;  1NU2 A;  2GCL A;  5J3Y A;  4KHA A;  3A98 B;  2Q13 A;  1ZC4 B;  1GG3 A;  3DXC A;  3ODX A;  1MK7 B;  5DH9 B;  3U7D A;  1E5W A;  1X1F A;  2RGN B;  1I2H A;  1X86 A;  1X1G A;  3BIN A;  1V5M A;  3VOQ A;  2Y7B A;  1NTI A;  2COC A;  1U5G A;  3FSS A;  5DI9 B;  1AQC A;  1HB6 A;  3PEG A;  1P5T A;  2D9Z A;  1K5D B;  2DYQ A;  1PLS A;  3EPY A;  1HBK A;  4NSW A;  5KQ1 A;  2ROV A;  2ZPY A;  4BBK A;  3TW1 A;  1NTV A;  2K2U A;  3HW2 B;  1OQN A;  2RSG A;  3HQC A;  3SUZ A;  1PFJ A;  2Z0Q A;  1UPQ A;  2MDX A;  4ZRK A;  3FLV A;  2RNR B;  4A6H A;  3MPX A;  2G35 A;  2RQ1 A;  1LW3 A;  4HHV A;  1XD4 A;  2V76 A;  1K5G B;  1RRP B;  5C79 A;  3FM8 C;  2X18 A;  3X23 A;  2GS0 A;  2UZR A;  2CB8 A;  2EMT A;  1FB8 A;  4DX8 A;  5D3Y A;  5HE1 A;  4B6H A;  3WYF B;  4HB3 B;  1NVL A;  2FJ9 A;  1GC6 A;  1ZM0 A;  2DFK A;  1DYN A;  4CHM A;  4Y94 A;  3D8D A;  3SV1 A;  4L6E A;  2Y8G A;  2YSZ A;  4H8S A;  3A8Q A;  4TKN A;  2COP A;  2UVM A;  4EJN A;  5KQ4 A;  2OTX A;  3ODO A;  3SO6 A;  2YVC A;  4ZRJ A;  1XR0 B;  2H7D A;  4F7U P;  2DA0 A;  4P7I A;  1TJ6 A;  2EC1 A;  1W1H A;  4HB2 B;  3SNH A;  4A6F B;  1FGY A;  2VKI A;  2Z0O A;  2AEH A;  3MDB C;  3T06 A;  2P0H A;  1DDV A;  1ZC3 B;  5KCV A;  3QWM A;  3BJI A;  2YT1 A;  3P6A A;  2DKQ A;  4GMV A;  2GCJ A;  2W2W A;  2D9V A;  1XX0 A;  3GYP A;  5HE0 A;  5L81 A;  2ELA A;  3PVL A;  1X05 A;  4PQ0 A;  2EMS A; 
#chains in the Genus database with same CATH topology
 1FAO A;  4HAV B;  4IAP A;  4KHB B;  4C0A A;  5GOW B;  3CXB B;  4MK0 A;  2LYD A;  4TYZ A;  1UNP A;  1U2B A;  3PZD A;  5C16 A;  1ISN A;  4HAT B;  2IFS A;  2ABD A;  4KAX B;  1AWE A;  4YL8 A;  3OHM B;  2YT2 A;  2MFQ A;  5LOP B;  1WG7 A;  1EVH A;  4QXA B;  3RCP A;  2KGX B;  2LKO A;  4MT7 A;  1ST7 A;  4KHO A;  3PG7 A;  4A5K A;  4EMO A;  1J0W A;  1FOE A;  2KCJ A;  2Z14 A;  2H7E A;  4HAU B;  5C5B B;  3ODW A;  5C6R A;  2M38 A;  4Z2M B;  3FVC A;  4HSI A;  4KVG B;  4CYE A;  1H10 A;  1V89 A;  5EFX A;  2NMB A;  1X11 A;  2DTC A;  2DN6 A;  1BWN A;  1J19 A;  1U27 A;  1BTK A;  3DXE A;  4WJ7 A;  4DX9 0;  1QC6 A;  3M1I B;  3V5W A;  2VSZ A;  2YT0 A;  2OQB A;  3E9O A;  4JKA A;  2M14 A;  4K2P A;  4GPT B;  1N3H A;  5J3Q A;  2DHJ A;  1U5E A;  1WJM A;  1OY2 A;  3U8Z A;  3F5R A;  3OAN A;  4K2O A;  2COA A;  2DX1 A;  2K00 A;  3HSA A;  5D27 A;  4K81 A;  2D2Q A;  1M7R A;  2CRF A;  4DBB A;  2LOX A;  1QQG A;  2EJ8 A;  2L2I A;  2D4Q A;  3TVV A;  5JHH A;  1NI2 A;  3ZVR A;  2J0M A;  3PSC A;  3ULC A;  1DRO A;  4MY6 A;  5JP4 A;  3FP5 A;  4ZRI A;  2P0F A;  4F7H A;  4PNK A;  2D10 A;  4IOY X;  2PZ1 A;  3DCX A;  2N23 A;  4HB0 B;  5D3V A;  1FHO A;  1BAK A;  1XKE A;  1SHC A;  3U12 A;  2D9X A;  4DXA B;  3KRX A;  1ACA A;  1MI1 A;  1GGO A;  1ZSQ A;  2BCJ A;  2D9W A;  1MK9 B;  1NTY A;  1XCG A;  2DHK A;  2LUL A;  3FEH A;  1V61 A;  4GOU A;  2FJU B;  3PVW A;  4A6F A;  2J59 M;  5JLJ B;  2Z4D A;  5I2S A;  2NZ8 B;  1UPR A;  2KUQ A;  3LJU X;  1JDE A;  2D9Y A;  2HE7 A;  2KUP A;  3KZ1 A;  1FHW A;  2VRW B;  4IFS A;  1GC7 A;  1KZG A;  2N0Y A;  1B55 A;  2GUM A;  5IRS A;  2P8V A;  2K2J A;  1T77 A;  1WI1 A;  4D0N B;  2FDQ A;  2I1K A;  3CIK A;  1RJ2 A;  1EGX A;  2RVB B;  2KIG A;  2R2Y A;  4JKD A;  1KI1 B;  2W2X D;  2COF A;  1V5U A;  2YF0 A;  3D8E A;  1DDW A;  4GNK B;  3ZDT A;  3F0W A;  2X0S A;  1BTN A;  2IYB A;  5IJM A;  2Z59 A;  2QKM A;  1U5F A;  4WVF B;  2I5C A;  1LB1 A;  1MKE A;  3WA0 A;  4HAY B;  2DKP A;  2CQU A;  2P0D A;  2ADZ A;  4HAW B;  4HAX B;  2AL6 A;  4NY0 A;  1M7E A;  2MWN B;  2LBB A;  1Z87 A;  1WVH A;  2I5F A;  3ML4 A;  3AU5 A;  3SBG A;  1I7A A;  1TQZ A;  5I2M A;  4ILG B;  2LOZ A;  2DLW A;  4A6K A;  2COD A;  1WJ1 A;  5M4Y B;  3QIJ A;  3KY9 A;  3P7Z A;  5C5B A;  2XQN M;  3UZT A;  1WGU A;  4CSQ A;  2FJL A;  1KBL A;  5CLL B;  3QBV B;  5FI0 A;  3KRW A;  4HAZ B;  2LG1 A;  2DHI A;  1KZ7 A;  2CY5 A;  1HB8 A;  3PP2 A;  2CY4 A;  5FI1 A;  3AU4 A;  1VBG A;  3NWA A;  5CLQ B;  3N7C A;  2R0D A;  4HB4 B;  4HDO A;  4EKU A;  1MIZ B;  5J3T A;  2JP2 A;  2R09 A;  4QJ3 B;  2J0K A;  1FGZ A;  2Z13 A;  3DXD A;  1WGQ A;  1V5P A;  2ZKM X;  5JHG A;  2E2X A;  2UZS A;  1V88 A;  3TCA A;  1PMS A;  2HTH B;  1DBH A;  2ELB A;  5HE3 A;  5D3X A;  2NBV A;  1DDM A;  3TFM A;  5DIF B;  4JK8 A;  1U29 A;  4JKH A;  4XWX A;  2ROZ B;  3E9P A;  1XOD A;  5DHA B;  3PVU A;  3KSY A;  1EAZ A;  5LON B;  3TO1 A;  3IVF A;  2D11 A;  2RLO A;  4WSF A;  4ILH A;  1Y5O A;  3B77 A;  1ZVR A;  2Y8F A;  3D8F A;  1TXD A;  1MPH A;  3NW8 A;  2DX5 A;  2DYN A;  1UNQ A;  3HK0 A;  3ENB A;  4CHJ A;  1U5D A;  1P6S A;  3NSU A;  1MAI A;  4D6W A;  2YRY A;  3VIA A;  2R82 A;  5DHF B;  4HDQ A;  3O96 A;  2MKR A;  3ULB A;  4JKB A;  4GXB A;  3AJ4 A;  4GMX B;  1UNR A;  1W1D A;  1DIK A;  4JKC A;  4K17 A;  2J0J A;  2RUK B;  1OMW A;  2K8E A;  1EF1 A;  1Y19 B;  2YS1 A;  2I1J A;  4GZU A;  3SYX A;  5D3W A;  1W1G A;  3G9W A;  1IRS A;  3NWD A;  2W2X C;  2WH5 A;  4L1R A;  1SGH A;  5JVL A;  1FHX A;  4F7G A;  2QKL A;  5HE2 A;  1H4R A;  4Z2N A;  2CAY A;  1MIX A;  2HRJ A;  2GJY A;  1UEF A;  2KIE A;  2L1C A;  4QJ5 B;  3A8P A;  4GN1 A;  1P3R A;  3GYO A;  3A58 A;  1KC7 A;  2YS5 A;  4YON A;  1Q67 A;  2Z0P A;  4JK9 A;  2YS3 A;  1NU2 A;  2GCL A;  5J3Y A;  4KHA A;  3A98 B;  2Q13 A;  1ZC4 B;  1GG3 A;  3DXC A;  3ODX A;  4JKG B;  1MK7 B;  5DH9 B;  3U7D A;  1E5W A;  1X1F A;  2RGN B;  1I2H A;  4JKF A;  3HIE A;  4KHB A;  1X86 A;  1X1G A;  3BIN A;  1V5M A;  3VOQ A;  2Y7B A;  4OT1 A;  1NTI A;  2COC A;  1U5G A;  3FSS A;  5DI9 B;  1AQC A;  1HB6 A;  3PEG A;  1P5T A;  4OSN A;  2D9Z A;  1K5D B;  2DYQ A;  1PLS A;  3EPY A;  1HBK A;  4NSW A;  5KQ1 A;  4JKG A;  2ROV A;  2ZPY A;  4BBK A;  3TW1 A;  3NWF A;  1NTV A;  2K2U A;  3HW2 B;  1OQN A;  2RSG A;  2DIK A;  2KR0 A;  3HQC A;  3SUZ A;  1PFJ A;  2Z0Q A;  1UPQ A;  2MDX A;  4ZRK A;  3FLV A;  2RNR B;  4A6H A;  3MPX A;  2G35 A;  2RQ1 A;  1LW3 A;  4HHV A;  1XD4 A;  2V76 A;  1K5G B;  1RRP B;  5C79 A;  3FM8 C;  2X18 A;  3X23 A;  2GS0 A;  2UZR A;  3E9L A;  2CB8 A;  2EMT A;  3E66 A;  1FB8 A;  4DX8 A;  5D3Y A;  5HE1 A;  4B6H A;  3WYF B;  4HB3 B;  1NVL A;  2FJ9 A;  1GC6 A;  1ZM0 A;  2RRF A;  2DFK A;  1DYN A;  4CHM A;  4Y94 A;  4JKE A;  3D8D A;  3SV1 A;  4L6E A;  2Y8G A;  2YSZ A;  2K49 A;  4H8S A;  3A8Q A;  4TKN A;  2COP A;  2UVM A;  5LG4 B;  4EJN A;  5KQ4 A;  2OTX A;  1ZYI A;  3SBT A;  3ODO A;  1VBH A;  3SO6 A;  2YVC A;  4ZRJ A;  1XR0 B;  2H7D A;  4F7U P;  2DA0 A;  4P7I A;  1TJ6 A;  2EC1 A;  1W1H A;  4HB2 B;  3SNH A;  4A6F B;  1FGY A;  2VKI A;  2Z0O A;  2AEH A;  3MDB C;  3T06 A;  2P0H A;  1DDV A;  1ZC3 B;  4ILJ A;  4QJ4 B;  5KCV A;  3QWM A;  3BJI A;  2YT1 A;  3P6A A;  2DKQ A;  4GMV A;  2GCJ A;  2W2W A;  2D9V A;  1XX0 A;  3GYP A;  5HE0 A;  5L81 A;  4DIX A;  2ELA A;  4JK7 A;  3PVL A;  1X05 A;  4PQ0 A;  2EMS A; 
#chains in the Genus database with same CATH homology
 1FAO A;  4HAV B;  4IAP A;  4KHB B;  4C0A A;  5GOW B;  3CXB B;  4MK0 A;  2LYD A;  4TYZ A;  1UNP A;  1U2B A;  3PZD A;  5C16 A;  1ISN A;  4HAT B;  2IFS A;  2ABD A;  4KAX B;  1AWE A;  4YL8 A;  2MFQ A;  5LOP B;  1WG7 A;  1EVH A;  3RCP A;  2KGX B;  2LKO A;  4MT7 A;  1ST7 A;  4KHO A;  3PG7 A;  4A5K A;  4EMO A;  1J0W A;  1FOE A;  2KCJ A;  2H7E A;  4HAU B;  5C5B B;  3ODW A;  5C6R A;  2M38 A;  4Z2M B;  4KVG B;  4CYE A;  1H10 A;  1V89 A;  5EFX A;  2NMB A;  1X11 A;  2DTC A;  2DN6 A;  1BWN A;  1J19 A;  1U27 A;  1BTK A;  3DXE A;  4WJ7 A;  4DX9 0;  1QC6 A;  3M1I B;  3V5W A;  2VSZ A;  2YT0 A;  2OQB A;  3E9O A;  4JKA A;  2M14 A;  4K2P A;  4GPT B;  1N3H A;  5J3Q A;  2DHJ A;  1U5E A;  1WJM A;  1OY2 A;  3U8Z A;  3F5R A;  3OAN A;  4K2O A;  2COA A;  2DX1 A;  2K00 A;  5D27 A;  4K81 A;  2D2Q A;  1M7R A;  2CRF A;  4DBB A;  2LOX A;  1QQG A;  2EJ8 A;  2L2I A;  2D4Q A;  3TVV A;  5JHH A;  1NI2 A;  3ZVR A;  2J0M A;  3PSC A;  3ULC A;  1DRO A;  4MY6 A;  5JP4 A;  3FP5 A;  4ZRI A;  2P0F A;  4F7H A;  4PNK A;  2D10 A;  4IOY X;  2PZ1 A;  4HB0 B;  2N23 A;  5D3V A;  1FHO A;  1BAK A;  1XKE A;  1SHC A;  2D9X A;  4DXA B;  3KRX A;  1ACA A;  1ZSQ A;  1GGO A;  2BCJ A;  2D9W A;  1MK9 B;  1NTY A;  1XCG A;  2DHK A;  2LUL A;  3FEH A;  1V61 A;  3PVW A;  4A6F A;  2J59 M;  5JLJ B;  2NZ8 B;  1UPR A;  3LJU X;  1JDE A;  2D9Y A;  2HE7 A;  2KUP A;  3KZ1 A;  1FHW A;  2VRW B;  4IFS A;  1GC7 A;  1KZG A;  2N0Y A;  1B55 A;  2P8V A;  2K2J A;  1WI1 A;  4D0N B;  2FDQ A;  2I1K A;  3CIK A;  1RJ2 A;  1EGX A;  2RVB B;  4JKD A;  1KI1 B;  2W2X D;  2COF A;  1V5U A;  2YF0 A;  3D8E A;  1DDW A;  3ZDT A;  3F0W A;  2X0S A;  1BTN A;  2IYB A;  5IJM A;  2QKM A;  1U5F A;  4WVF B;  2I5C A;  1LB1 A;  1MKE A;  3WA0 A;  4HAY B;  2DKP A;  2CQU A;  2P0D A;  2ADZ A;  4HAW B;  4HAX B;  2AL6 A;  4NY0 A;  1M7E A;  2MWN B;  2LBB A;  1Z87 A;  1WVH A;  2I5F A;  3ML4 A;  3AU5 A;  3SBG A;  1I7A A;  1TQZ A;  4ILG B;  2LOZ A;  2DLW A;  4A6K A;  2COD A;  1WJ1 A;  3QIJ A;  3KY9 A;  3P7Z A;  5C5B A;  2XQN M;  3UZT A;  1WGU A;  2FJL A;  1KBL A;  5CLL B;  3QBV B;  5FI0 A;  3KRW A;  4HAZ B;  2LG1 A;  2DHI A;  1KZ7 A;  2CY5 A;  1HB8 A;  3PP2 A;  2CY4 A;  5FI1 A;  3AU4 A;  1VBG A;  5CLQ B;  3N7C A;  2R0D A;  4HB4 B;  4HDO A;  4EKU A;  1MIZ B;  5J3T A;  2JP2 A;  2R09 A;  2J0K A;  1FGZ A;  3DXD A;  1WGQ A;  1V5P A;  5JHG A;  2E2X A;  2UZS A;  1V88 A;  3TCA A;  1PMS A;  2HTH B;  1DBH A;  2ELB A;  5HE3 A;  5D3X A;  1DDM A;  3TFM A;  5DIF B;  4JK8 A;  1U29 A;  4JKH A;  4XWX A;  2ROZ B;  3E9P A;  1XOD A;  5DHA B;  3PVU A;  3KSY A;  1EAZ A;  5LON B;  3TO1 A;  3IVF A;  2D11 A;  2RLO A;  4WSF A;  4ILH A;  1Y5O A;  1ZVR A;  2Y8F A;  3D8F A;  1TXD A;  1MPH A;  2DX5 A;  2DYN A;  1UNQ A;  3HK0 A;  3ENB A;  4CHJ A;  1U5D A;  1P6S A;  3NSU A;  1MAI A;  2YRY A;  3VIA A;  2R82 A;  5DHF B;  4HDQ A;  3O96 A;  2MKR A;  3ULB A;  4JKB A;  4GXB A;  3AJ4 A;  4GMX B;  1UNR A;  1W1D A;  1DIK A;  4JKC A;  4K17 A;  2J0J A;  2RUK B;  1OMW A;  1EF1 A;  1Y19 B;  2YS1 A;  2I1J A;  4GZU A;  3SYX A;  5D3W A;  1W1G A;  3G9W A;  1IRS A;  2W2X C;  2WH5 A;  1SGH A;  5JVL A;  1FHX A;  4F7G A;  2QKL A;  5HE2 A;  1H4R A;  4Z2N A;  2CAY A;  1MIX A;  2HRJ A;  2GJY A;  1UEF A;  2L1C A;  3A8P A;  4GN1 A;  1P3R A;  3GYO A;  1KC7 A;  2YS5 A;  4YON A;  1Q67 A;  2Z0P A;  4JK9 A;  2YS3 A;  1NU2 A;  2GCL A;  5J3Y A;  4KHA A;  3A98 B;  2Q13 A;  1ZC4 B;  1GG3 A;  3DXC A;  3ODX A;  4JKG B;  1MK7 B;  5DH9 B;  3U7D A;  1E5W A;  1X1F A;  2RGN B;  1I2H A;  4JKF A;  1X86 A;  1X1G A;  3BIN A;  1V5M A;  3VOQ A;  2Y7B A;  1NTI A;  2COC A;  1U5G A;  3FSS A;  5DI9 B;  1AQC A;  1HB6 A;  3PEG A;  1P5T A;  2D9Z A;  1K5D B;  2DYQ A;  1PLS A;  3EPY A;  1HBK A;  4NSW A;  5KQ1 A;  4JKG A;  2ROV A;  2ZPY A;  4BBK A;  3TW1 A;  1NTV A;  2K2U A;  3HW2 B;  1OQN A;  2RSG A;  2DIK A;  3HQC A;  3SUZ A;  1PFJ A;  2Z0Q A;  1UPQ A;  2MDX A;  4ZRK A;  3FLV A;  2RNR B;  4A6H A;  3MPX A;  2G35 A;  2RQ1 A;  1LW3 A;  4HHV A;  1XD4 A;  2V76 A;  1K5G B;  1RRP B;  5C79 A;  3FM8 C;  2X18 A;  3X23 A;  2GS0 A;  2UZR A;  3E9L A;  2CB8 A;  2EMT A;  3E66 A;  1FB8 A;  4DX8 A;  5D3Y A;  5HE1 A;  4B6H A;  3WYF B;  4HB3 B;  1NVL A;  2FJ9 A;  1GC6 A;  1ZM0 A;  2DFK A;  1DYN A;  4CHM A;  4Y94 A;  4JKE A;  3D8D A;  3SV1 A;  4L6E A;  2Y8G A;  2YSZ A;  4H8S A;  3A8Q A;  4TKN A;  2COP A;  2UVM A;  4EJN A;  5KQ4 A;  2OTX A;  3SBT A;  3ODO A;  1VBH A;  3SO6 A;  2YVC A;  4ZRJ A;  1XR0 B;  2H7D A;  4F7U P;  2DA0 A;  4P7I A;  1TJ6 A;  2EC1 A;  1W1H A;  4HB2 B;  3SNH A;  4A6F B;  1FGY A;  2VKI A;  2Z0O A;  2AEH A;  3MDB C;  3T06 A;  2P0H A;  1DDV A;  1ZC3 B;  4ILJ A;  5KCV A;  3QWM A;  3BJI A;  2YT1 A;  3P6A A;  2DKQ A;  4GMV A;  2GCJ A;  2W2W A;  2D9V A;  1XX0 A;  3GYP A;  5HE0 A;  5L81 A;  2ELA A;  4JK7 A;  3PVL A;  1X05 A;  4PQ0 A;  2EMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...