1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
2HRJA 1BTNA 5J3TA 2CAYA 2DN6A 5DIFB 4HDOA 4ZRJA 4YONA 1WI1A 2Z0QA 1J19A 3TW1A 1WGUA 5DHAB 2D11A 2D4QA 3G9WA 4GPTB 1M7RA 2G35A 3ZDTA 3GYPA 1ST7A 4HHVA 3KY9A 3NSUA 3TO1A 1I7AA 3D8DA 3KRWA 1FOEA 1NVLA 3IVFA 2DYNA 2RGNB 2GJYA 2N0YA 2FDQA 2COPA 3TVVA 2MDXA 2COCA 1U29A 1U5EA 3HK0A 1M7EA 2UZRA 3D8FA 1P3RA 2Z0PA 2HE7A 5HE2A 1WJ1A 4HAYB 3ODOA 2DHJA 2AL6A 4Z2NA 4D0NB 1U5GA 3FLVA 2I5CA 3ODXA 5FI0A 3X23A 4WSFA 5D3WA 3QWMA 4HB3B 1P6SA 1EAZA 1WG7A 2COAA 4L6EA 3SYXA 3VOQA 1MIXA 1TJ6A 3ML4A 1DDMA 2YF0A 2Q13A 3OANA 2UVMA 2CRFA 1ACAA 4DX90 4HAZB 1DROA 3QBVB 4TKNA 4DBBA 2DFKA 4EMOA 4ZRIA 1U27A 5DHFB 5JP4A 4PNKA 1MK9B 3T06A 3RCPA 3M1IB 4NY0A 4HATB 2CQUA 3DXCA 1H10A 2KUPA 2I1JA 3FP5A 2ZPYA 4B6HA 3HQCA 3TCAA 2NMBA 4HB2B 1RRPB 5D3VA 2DHKA 2VSZA 3BINA 2DX1A 4HB0B 1SGHA 4KHOA 2DTCA 1HBKA 4K2PA 3A8QA 1V5MA 1MPHA 4NSWA 1LB1A 4WJ7A 1K5DB 4WVFB 4CHMA 4K17A 2J0MA 1AQCA 2K2UA 1FAOA 2IYBA 3N7CA 4EJNA 5KQ4A 2CY4A 1X1FA 5CLQB 2DA0A 2K2JA 3WA0A 3HW2B 3PP2A 5HE1A 3DXDA 2DYQA 2VKIA 5JHHA 1U5DA 5C5BB 2YRYA 3P6AA 1PFJA 3CIKA 2VRWB 1FHWA 2W2WA 1TQZA 2N23A 1GC6A 4A5KA 1DDVA 1X86A 2D9WA 4A6KA 3BJIA 4A6HA 1MAIA 1Q67A 2LG1A 4HAWB 5L81A 2D10A 4F7GA 1V61A 3ULBA 5KCVA 2D2QA 2MKRA 3SNHA 1GC7A 1EF1A 2EJ8A 1EVHA 2I1KA 3KRXA 4CHJA 3LJUX 5HE0A 1KZ7A 1I2HA 1N3HA 2OQBA 2YS5A 1ZSQA 2RNRB 2DHIA 3P7ZA 2DLWA 2GCJA 3MPXA 1EGXA 2ABDA 2J59M 2D9YA 5D3YA 5C16A 2V76A 4A6FA 2UZSA 2BCJA 4YL8A 2QKLA 3FM8C 4KHAA 1B55A 2D9VA 2LBBA 1FHOA 2P0DA 3PG7A 2W2XC 1NU2A 1FHXA 4BBKA 4HAXB 4CYEA 2RVBB 2DKQA 2GCLA 5DI9B 1XKEA 2EC1A 1FB8A 2HTHB 3A98B 2ELAA 1UEFA 4MT7A 1OMWA 5LONB 2J0KA 1QQGA 2RUKB 3ZVRA 1OY2A 2H7EA 2CODA 2Z0OA 2P8VA 1W1GA 5JHGA 1FGZA 1BAKA 1XODA 3KZ1A 4GXBA 2RLOA 5LOPB 1BWNA 2OTXA 3CXBB 4MK0A 5J3YA 1FGYA 3KSYA 1HB6A 2JP2A 2AEHA 4K2OA 3AU4A 2Y7BA 2W2XD 2R0DA 1Y5OA 1V5PA 2CB8A 3FSSA 5IJMA 3GYOA 4GMXB 2ADZA 4GZUA 3SUZA 2NZ8B 3PEGA 1ISNA 2EMTA 2YVCA 3PZDA 2L1CA 1QC6A 2R09A 3ODWA 4KAXB 4IAPA 1U2BA 4H8SA 1V5UA 1WVHA 1NTYA 3AJ4A 5KQ1A 5EFXA 1BTKA 5C5BA 2GS0A 2RQ1A 1Y19B 1X11A 3PVUA 4HB4B 1W1HA 1RJ2A 1XR0B 5FI1A 2M38A 4Z2MB 1AWEA 1K5GB 2FJLA 2KCJA 3MDBC 2YT1A 1H4RA 3TFMA 1ZM0A 2COFA 2X18A 1MK7B 2H7DA 3ULCA 1V88A 3D8EA 1MIZB 2KGXB 2DKPA 5C79A 1UNPA 3F5RA 2YS1A 4F7HA 3VIAA 2ELBA 4HAUB 2K00A 1KZGA 5C6RA 2E2XA 2LKOA 2LOXA 4HDQA 2QKMA 1E5WA 5HE3A 1PMSA 4HAVB 5DH9B 2LYDA 5CLLB 4IOYX 2LOZA 1NTIA 3EPYA 5D27A 3AU5A 4A6FB 1IRSA 2CY5A 2I5FA 3A8PA 1DBHA 2Y8GA 1U5FA 1KI1B 1WGQA 1MKEA 5JLJB 3O96A 2P0FA 1NTVA 2P0HA 2EMSA 1P5TA 2YT0A 1DYNA 4GN1A 2D9ZA 1GG3A 1DDWA 1XX0A 1ZVRA 2DX5A 2IFSA 4KVGB 1W1DA 2MWNB 1LW3A 3DXEA 4IFSA 4TYZA 1OQNA 4ZRKA 3SV1A 1X1GA 1J0WA 4F7UP 3PVLA 1ZC4B 1WJMA 3PVWA 2YS3A 2ROVA 4PQ0A 3SO6A 2L2IA 1XCGA 5D3XA 5GOWB 3U8ZA 2PZ1A 3U7DA 3PSCA 1V89A 2D9XA 1Z87A 3F0WA 1UNRA 4C0AA 2J0JA 2YSZA 3WYFB 1TXDA 1HB8A 4DX8A 1UPQA 2RSGA 1NI2A 2WH5A 4K81A 2ROZB 4DXAB 1X05A 5J3QA 3QIJA 3UZTA 1SHCA 1UNQA 2MFQA 2M14A 4MY6A 2FJ9A 1PLSA 3V5WA 4P7IA 1ZC3B 3FEHA 1XD4A 2LULA 4XWXA 4EKUA 4KHBB 1UPRA 4Y94A 2Y8FA 4GMVA 2XQNM
chains in the Genus database with same CATH superfamily
2HRJA 1BTNA 5J3TA 2CAYA 1DIKA 2DN6A 5DIFB 4HDOA 4ZRJA 4YONA 1WI1A 2Z0QA 4L1RA 1J19A 3TW1A 1WGUA 5DHAB 2D11A 2D4QA 3G9WA 4GPTB 1M7RA 3E9OA 4JKAA 2G35A 4CSQA 3ZDTA 3GYPA 1ST7A 2NBVA 4HHVA 3KY9A 3NSUA 3TO1A 1I7AA 3D8DA 1MI1A 3KRWA 1FOEA 1NVLA 2KUQA 3IVFA 4QJ4B 4ILJA 2DYNA 2RGNB 2GJYA 2N0YA 2FDQA 2COPA 3TVVA 2MDXA 2COCA 1U29A 1U5EA 3HK0A 1M7EA 2UZRA 3D8FA 1P3RA 2Z0PA 2HE7A 5HE2A 1WJ1A 4HAYB 3ODOA 2DHJA 2AL6A 4Z2NA 2X0SA 4D0NB 1U5GA 1VBHA 3FLVA 2I5CA 3ODXA 5FI0A 3X23A 4WSFA 4JK7A 3QWMA 4HB3B 5D3WA 1P6SA 1EAZA 1WG7A 2COAA 4L6EA 3SYXA 3VOQA 1MIXA 1TJ6A 3ML4A 1DDMA 2K49A 2Q13A 2YF0A 3OANA 3E9LA 2UVMA 2CRFA 1ACAA 4DX90 2Z4DA 4HAZB 4HSIA 2DIKA 1ZYIA 1DROA 4TKNA 3QBVB 4DBBA 2DFKA 4EMOA 4ZRIA 1U27A 5DHFB 5JP4A 4PNKA 1MK9B 3T06A 3RCPA 3M1IB 4NY0A 4HATB 2CQUA 3DXCA 1H10A 2KUPA 2I1JA 3FP5A 2ZPYA 3E9PA 4B6HA 3HQCA 3TCAA 2NMBA 4JKGA 4OT1A 4HB2B 1RRPB 5D3VA 2DHKA 2VSZA 3BINA 2DX1A 4HB0B 1SGHA 4KHOA 2DTCA 1HBKA 4K2PA 3A8QA 1V5MA 1MPHA 4NSWA 1LB1A 4WJ7A 1K5DB 3B77A 5M4YB 4JKFA 4WVFB 4CHMA 4K17A 2J0MA 1AQCA 4JK8A 2K2UA 1FAOA 2IYBA 3N7CA 5I2MA 4EJNA 5KQ4A 2CY4A 4JKBA 1X1FA 5CLQB 2DA0A 2K2JA 4GNKB 3WA0A 3HW2B 4QJ5B 3PP2A 5HE1A 3DXDA 2DYQA 2VKIA 5JHHA 1KC7A 1U5DA 2YRYA 3P6AA 4JK9A 5C5BB 1PFJA 3CIKA 2VRWB 1FHWA 1TQZA 2N23A 2W2WA 1GC6A 4A5KA 1DDVA 1X86A 2D9WA 4A6KA 3BJIA 4A6HA 2Z59A 1MAIA 1Q67A 2LG1A 4HAWB 5L81A 2D10A 4F7GA 1V61A 3ULBA 5LG4B 5KCVA 2D2QA 2MKRA 3SNHA 1EF1A 1GC7A 1GGOA 4JKEA 2EJ8A 1EVHA 2I1KA 3KRXA 4JKDA 4CHJA 3LJUX 5HE0A 1KZ7A 1I2HA 1N3HA 2OQBA 2YS5A 3NW8A 1ZSQA 2RNRB 2DHIA 3P7ZA 2DLWA 2GCJA 3MPXA 1EGXA 2ABDA 2J59M 2D9YA 5D3YA 5C16A 2V76A 4A6FA 2UZSA 2BCJA 4YL8A 2RRFA 1JDEA 2QKLA 3FM8C 4KHAA 1VBGA 1B55A 2D9VA 2LBBA 1FHOA 2P0DA 3PG7A 3DCXA 2W2XC 4QXAB 1NU2A 1FHXA 3FVCA 4BBKA 4HAXB 4CYEA 2RVBB 2GUMA 4ILGB 2DKQA 2GCLA 5DI9B 4ILHA 1XKEA 2EC1A 1FB8A 2HTHB 3A98B 2ELAA 1UEFA 4MT7A 1OMWA 3HIEA 5LONB 2J0KA 1QQGA 2RUKB 3ZVRA 1OY2A 2H7EA 2CODA 2Z0OA 2P8VA 2ZKMX 1W1GA 5JHGA 1FGZA 1BAKA 1XODA 3KZ1A 5JVLA 4GXBA 2RLOA 5LOPB 1BWNA 2OTXA 3CXBB 4MK0A 5J3YA 1FGYA 3KSYA 1HB6A 2JP2A 2AEHA 4K2OA 3AU4A 2Y7BA 2W2XD 2R0DA 1Y5OA 1V5PA 2CB8A 3FSSA 5IJMA 3GYOA 4GMXB 2R2YA 4JKGB 2ADZA 4GZUA 3SUZA 2NZ8B 3PEGA 3U12A 1ISNA 2EMTA 2YVCA 3PZDA 2L1CA 1QC6A 2R09A 3ODWA 4KAXB 4IAPA 1U2BA 4H8SA 1V5UA 1WVHA 1NTYA 3AJ4A 4KHBA 5KQ1A 5EFXA 1BTKA 5C5BA 2GS0A 2RQ1A 1Y19B 4OSNA 2Z14A 1X11A 3PVUA 4HB4B 3NWAA 1W1HA 4JKHA 1RJ2A 1XR0B 5FI1A 2M38A 3ENBA 4Z2MB 2R82A 1K5GB 1AWEA 2FJLA 2KCJA 3MDBC 2FJUB 2YT1A 1H4RA 3TFMA 1ZM0A 2COFA 2X18A 1MK7B 2H7DA 3ULCA 1V88A 3D8EA 1MIZB 2KGXB 2DKPA 5C79A 1UNPA 3F5RA 2YS1A 4F7HA 3VIAA 2K8EA 1KBLA 2ELBA 4DIXA 1T77A 4HAUB 2K00A 1KZGA 5C6RA 2E2XA 2LKOA 2LOXA 4HDQA 2QKMA 1E5WA 5HE3A 1PMSA 4HAVB 5DH9B 2LYDA 5CLLB 3NWFA 4IOYX 2LOZA 2YT2A 1NTIA 3EPYA 5D27A 3AU5A 4A6FB 1IRSA 2CY5A 2I5FA 3A8PA 1DBHA 2Y8GA 1U5FA 1KI1B 2KR0A 4QJ3B 1WGQA 4GOUA 1MKEA 3OHMB 5JLJB 3O96A 2P0FA 1NTVA 2P0HA 2EMSA 1P5TA 2YT0A 1DYNA 4GN1A 2D9ZA 1GG3A 1DDWA 1XX0A 5I2SA 1ZVRA 2DX5A 2IFSA 4KVGB 1W1DA 2MWNB 1LW3A 5IRSA 2Z13A 3DXEA 4IFSA 4TYZA 1OQNA 4ZRKA 3SV1A 1X1GA 1J0WA 4F7UP 3PVLA 1ZC4B 1WJMA 3PVWA 2YS3A 2ROVA 4PQ0A 3SO6A 2L2IA 1XCGA 4D6WA 5D3XA 3SBTA 5GOWB 3U8ZA 2PZ1A 3U7DA 3PSCA 1V89A 2D9XA 1Z87A 3SBGA 3F0WA 1UNRA 4C0AA 2J0JA 2YSZA 3WYFB 3HSAA 1TXDA 1HB8A 4DX8A 1UPQA 2RSGA 1NI2A 2WH5A 2KIGA 4K81A 2ROZB 3A58A 4DXAB 1X05A 5J3QA 3QIJA 3UZTA 1SHCA 3NWDA 4JKCA 1UNQA 2KIEA 2MFQA 2M14A 4MY6A 2FJ9A 1PLSA 3E66A 3V5WA 4P7IA 1ZC3B 3FEHA 1XD4A 2LULA 4XWXA 4EKUA 4KHBB 1UPRA 4Y94A 2Y8FA 4GMVA 2XQNM
chains in the Genus database with same CATH topology
2HRJA 1BTNA 5J3TA 2CAYA 1DIKA 2DN6A 5DIFB 4HDOA 4ZRJA 4YONA 1WI1A 2Z0QA 1J19A 3TW1A 1WGUA 5DHAB 2D11A 2D4QA 3G9WA 4GPTB 1M7RA 3E9OA 4JKAA 2G35A 3ZDTA 3GYPA 1ST7A 4HHVA 3KY9A 3NSUA 3TO1A 1I7AA 3D8DA 3KRWA 1FOEA 1NVLA 3IVFA 4ILJA 2DYNA 2RGNB 2GJYA 2N0YA 2FDQA 2COPA 3TVVA 2MDXA 2COCA 1U29A 1U5EA 3HK0A 1M7EA 2UZRA 3D8FA 1P3RA 2Z0PA 2HE7A 5HE2A 1WJ1A 4HAYB 3ODOA 2DHJA 2AL6A 4Z2NA 2X0SA 4D0NB 1U5GA 1VBHA 3FLVA 2I5CA 3ODXA 5FI0A 3X23A 4WSFA 4JK7A 3QWMA 4HB3B 5D3WA 1P6SA 1EAZA 1WG7A 2COAA 4L6EA 3SYXA 3VOQA 1MIXA 1TJ6A 3ML4A 1DDMA 2YF0A 2Q13A 3OANA 3E9LA 2UVMA 2CRFA 1ACAA 4DX90 4HAZB 2DIKA 1DROA 4TKNA 3QBVB 4DBBA 2DFKA 4EMOA 4ZRIA 1U27A 5DHFB 5JP4A 4PNKA 1MK9B 3T06A 3RCPA 3M1IB 4NY0A 4HATB 2CQUA 3DXCA 1H10A 2KUPA 2I1JA 3FP5A 2ZPYA 3E9PA 4B6HA 3HQCA 3TCAA 2NMBA 4JKGA 4HB2B 1RRPB 5D3VA 2DHKA 2VSZA 3BINA 2DX1A 4HB0B 1SGHA 4KHOA 2DTCA 1HBKA 4K2PA 3A8QA 1V5MA 1MPHA 4NSWA 1LB1A 4WJ7A 1K5DB 4JKFA 4WVFB 4CHMA 4K17A 2J0MA 1AQCA 4JK8A 2K2UA 1FAOA 2IYBA 3N7CA 4EJNA 5KQ4A 2CY4A 4JKBA 1X1FA 5CLQB 2DA0A 2K2JA 3WA0A 3HW2B 3PP2A 5HE1A 3DXDA 2DYQA 2VKIA 5JHHA 1KC7A 1U5DA 2YRYA 3P6AA 4JK9A 5C5BB 1PFJA 3CIKA 2VRWB 1FHWA 1TQZA 2N23A 2W2WA 1GC6A 4A5KA 1DDVA 1X86A 2D9WA 4A6KA 3BJIA 4A6HA 1MAIA 1Q67A 2LG1A 4HAWB 5L81A 2D10A 4F7GA 1V61A 3ULBA 5KCVA 2D2QA 2MKRA 3SNHA 1EF1A 1GC7A 1GGOA 4JKEA 2EJ8A 1EVHA 2I1KA 3KRXA 4JKDA 4CHJA 3LJUX 5HE0A 1KZ7A 1I2HA 1N3HA 2OQBA 2YS5A 1ZSQA 2RNRB 2DHIA 3P7ZA 2DLWA 2GCJA 3MPXA 1EGXA 2ABDA 2J59M 2D9YA 5D3YA 5C16A 2V76A 4A6FA 2UZSA 2BCJA 4YL8A 1JDEA 2QKLA 3FM8C 4KHAA 1VBGA 1B55A 2D9VA 2LBBA 1FHOA 2P0DA 3PG7A 2W2XC 1NU2A 1FHXA 4BBKA 4HAXB 4CYEA 2RVBB 4ILGB 2DKQA 2GCLA 5DI9B 4ILHA 1XKEA 2EC1A 1FB8A 2HTHB 3A98B 2ELAA 1UEFA 4MT7A 1OMWA 5LONB 2J0KA 1QQGA 2RUKB 3ZVRA 1OY2A 2H7EA 2CODA 2Z0OA 2P8VA 1W1GA 5JHGA 1FGZA 1BAKA 1XODA 3KZ1A 5JVLA 4GXBA 2RLOA 5LOPB 1BWNA 2OTXA 3CXBB 4MK0A 5J3YA 1FGYA 3KSYA 1HB6A 2JP2A 2AEHA 4K2OA 3AU4A 2Y7BA 2W2XD 2R0DA 1Y5OA 1V5PA 2CB8A 3FSSA 5IJMA 3GYOA 4GMXB 4JKGB 2ADZA 4GZUA 3SUZA 2NZ8B 3PEGA 1ISNA 2EMTA 2YVCA 3PZDA 2L1CA 1QC6A 2R09A 3ODWA 4KAXB 4IAPA 1U2BA 4H8SA 1V5UA 1WVHA 1NTYA 3AJ4A 5KQ1A 5EFXA 1BTKA 5C5BA 2GS0A 2RQ1A 1Y19B 1X11A 3PVUA 4HB4B 1W1HA 4JKHA 1RJ2A 1XR0B 5FI1A 2M38A 3ENBA 4Z2MB 2R82A 1K5GB 1AWEA 2FJLA 2KCJA 3MDBC 2YT1A 1H4RA 3TFMA 1ZM0A 2COFA 2X18A 1MK7B 2H7DA 3ULCA 1V88A 3D8EA 1MIZB 2KGXB 2DKPA 5C79A 1UNPA 3F5RA 2YS1A 4F7HA 3VIAA 1KBLA 2ELBA 4HAUB 2K00A 1KZGA 5C6RA 2E2XA 2LKOA 2LOXA 4HDQA 2QKMA 1E5WA 5HE3A 1PMSA 4HAVB 5DH9B 2LYDA 5CLLB 4IOYX 2LOZA 1NTIA 3EPYA 5D27A 3AU5A 4A6FB 1IRSA 2CY5A 2I5FA 3A8PA 1DBHA 2Y8GA 1U5FA 1KI1B 1WGQA 1MKEA 5JLJB 3O96A 2P0FA 1NTVA 2P0HA 2EMSA 1P5TA 2YT0A 1DYNA 4GN1A 2D9ZA 1GG3A 1DDWA 1XX0A 1ZVRA 2DX5A 2IFSA 4KVGB 1W1DA 2MWNB 1LW3A 3DXEA 4IFSA 4TYZA 1OQNA 4ZRKA 3SV1A 1X1GA 1J0WA 4F7UP 3PVLA 1ZC4B 1WJMA 3PVWA 2YS3A 2ROVA 4PQ0A 3SO6A 2L2IA 1XCGA 5D3XA 3SBTA 5GOWB 3U8ZA 2PZ1A 3U7DA 3PSCA 1V89A 2D9XA 1Z87A 3SBGA 3F0WA 1UNRA 4C0AA 2J0JA 2YSZA 3WYFB 1TXDA 1HB8A 4DX8A 1UPQA 2RSGA 1NI2A 2WH5A 4K81A 2ROZB 4DXAB 1X05A 5J3QA 3QIJA 3UZTA 1SHCA 4JKCA 1UNQA 2MFQA 2M14A 4MY6A 2FJ9A 1PLSA 3E66A 3V5WA 4P7IA 1ZC3B 3FEHA 1XD4A 2LULA 4XWXA 4EKUA 4KHBB 1UPRA 4Y94A 2Y8FA 4GMVA 2XQNM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRJ A;  1BTN A;  5J3T A;  2CAY A;  2DN6 A;  5DIF B;  4HDO A;  4ZRJ A;  4YON A;  1WI1 A;  2Z0Q A;  1J19 A;  3TW1 A;  1WGU A;  5DHA B;  2D11 A;  2D4Q A;  3G9W A;  4GPT B;  1M7R A;  2G35 A;  3ZDT A;  3GYP A;  1ST7 A;  4HHV A;  3KY9 A;  3NSU A;  3TO1 A;  1I7A A;  3D8D A;  3KRW A;  1FOE A;  1NVL A;  3IVF A;  2DYN A;  2RGN B;  2GJY A;  2N0Y A;  2FDQ A;  2COP A;  3TVV A;  2MDX A;  2COC A;  1U29 A;  1U5E A;  3HK0 A;  1M7E A;  2UZR A;  3D8F A;  1P3R A;  2Z0P A;  2HE7 A;  5HE2 A;  1WJ1 A;  4HAY B;  3ODO A;  2DHJ A;  2AL6 A;  4Z2N A;  4D0N B;  1U5G A;  3FLV A;  2I5C A;  3ODX A;  5FI0 A;  3X23 A;  4WSF A;  5D3W A;  3QWM A;  4HB3 B;  1P6S A;  1EAZ A;  1WG7 A;  2COA A;  4L6E A;  3SYX A;  3VOQ A;  1MIX A;  1TJ6 A;  3ML4 A;  1DDM A;  2YF0 A;  2Q13 A;  3OAN A;  2UVM A;  2CRF A;  1ACA A;  4DX9 0;  4HAZ B;  1DRO A;  3QBV B;  4TKN A;  4DBB A;  2DFK A;  4EMO A;  4ZRI A;  1U27 A;  5DHF B;  5JP4 A;  4PNK A;  1MK9 B;  3T06 A;  3RCP A;  3M1I B;  4NY0 A;  4HAT B;  2CQU A;  3DXC A;  1H10 A;  2KUP A;  2I1J A;  3FP5 A;  2ZPY A;  4B6H A;  3HQC A;  3TCA A;  2NMB A;  4HB2 B;  1RRP B;  5D3V A;  2DHK A;  2VSZ A;  3BIN A;  2DX1 A;  4HB0 B;  1SGH A;  4KHO A;  2DTC A;  1HBK A;  4K2P A;  3A8Q A;  1V5M A;  1MPH A;  4NSW A;  1LB1 A;  4WJ7 A;  1K5D B;  4WVF B;  4CHM A;  4K17 A;  2J0M A;  1AQC A;  2K2U A;  1FAO A;  2IYB A;  3N7C A;  4EJN A;  5KQ4 A;  2CY4 A;  1X1F A;  5CLQ B;  2DA0 A;  2K2J A;  3WA0 A;  3HW2 B;  3PP2 A;  5HE1 A;  3DXD A;  2DYQ A;  2VKI A;  5JHH A;  1U5D A;  5C5B B;  2YRY A;  3P6A A;  1PFJ A;  3CIK A;  2VRW B;  1FHW A;  2W2W A;  1TQZ A;  2N23 A;  1GC6 A;  4A5K A;  1DDV A;  1X86 A;  2D9W A;  4A6K A;  3BJI A;  4A6H A;  1MAI A;  1Q67 A;  2LG1 A;  4HAW B;  5L81 A;  2D10 A;  4F7G A;  1V61 A;  3ULB A;  5KCV A;  2D2Q A;  2MKR A;  3SNH A;  1GC7 A;  1EF1 A;  2EJ8 A;  1EVH A;  2I1K A;  3KRX A;  4CHJ A;  3LJU X;  5HE0 A;  1KZ7 A;  1I2H A;  1N3H A;  2OQB A;  2YS5 A;  1ZSQ A;  2RNR B;  2DHI A;  3P7Z A;  2DLW A;  2GCJ A;  3MPX A;  1EGX A;  2ABD A;  2J59 M;  2D9Y A;  5D3Y A;  5C16 A;  2V76 A;  4A6F A;  2UZS A;  2BCJ A;  4YL8 A;  2QKL A;  3FM8 C;  4KHA A;  1B55 A;  2D9V A;  2LBB A;  1FHO A;  2P0D A;  3PG7 A;  2W2X C;  1NU2 A;  1FHX A;  4BBK A;  4HAX B;  4CYE A;  2RVB B;  2DKQ A;  2GCL A;  5DI9 B;  1XKE A;  2EC1 A;  1FB8 A;  2HTH B;  3A98 B;  2ELA A;  1UEF A;  4MT7 A;  1OMW A;  5LON B;  2J0K A;  1QQG A;  2RUK B;  3ZVR A;  1OY2 A;  2H7E A;  2COD A;  2Z0O A;  2P8V A;  1W1G A;  5JHG A;  1FGZ A;  1BAK A;  1XOD A;  3KZ1 A;  4GXB A;  2RLO A;  5LOP B;  1BWN A;  2OTX A;  3CXB B;  4MK0 A;  5J3Y A;  1FGY A;  3KSY A;  1HB6 A;  2JP2 A;  2AEH A;  4K2O A;  3AU4 A;  2Y7B A;  2W2X D;  2R0D A;  1Y5O A;  1V5P A;  2CB8 A;  3FSS A;  5IJM A;  3GYO A;  4GMX B;  2ADZ A;  4GZU A;  3SUZ A;  2NZ8 B;  3PEG A;  1ISN A;  2EMT A;  2YVC A;  3PZD A;  2L1C A;  1QC6 A;  2R09 A;  3ODW A;  4KAX B;  4IAP A;  1U2B A;  4H8S A;  1V5U A;  1WVH A;  1NTY A;  3AJ4 A;  5KQ1 A;  5EFX A;  1BTK A;  5C5B A;  2GS0 A;  2RQ1 A;  1Y19 B;  1X11 A;  3PVU A;  4HB4 B;  1W1H A;  1RJ2 A;  1XR0 B;  5FI1 A;  2M38 A;  4Z2M B;  1AWE A;  1K5G B;  2FJL A;  2KCJ A;  3MDB C;  2YT1 A;  1H4R A;  3TFM A;  1ZM0 A;  2COF A;  2X18 A;  1MK7 B;  2H7D A;  3ULC A;  1V88 A;  3D8E A;  1MIZ B;  2KGX B;  2DKP A;  5C79 A;  1UNP A;  3F5R A;  2YS1 A;  4F7H A;  3VIA A;  2ELB A;  4HAU B;  2K00 A;  1KZG A;  5C6R A;  2E2X A;  2LKO A;  2LOX A;  4HDQ A;  2QKM A;  1E5W A;  5HE3 A;  1PMS A;  4HAV B;  5DH9 B;  2LYD A;  5CLL B;  4IOY X;  2LOZ A;  1NTI A;  3EPY A;  5D27 A;  3AU5 A;  4A6F B;  1IRS A;  2CY5 A;  2I5F A;  3A8P A;  1DBH A;  2Y8G A;  1U5F A;  1KI1 B;  1WGQ A;  1MKE A;  5JLJ B;  3O96 A;  2P0F A;  1NTV A;  2P0H A;  2EMS A;  1P5T A;  2YT0 A;  1DYN A;  4GN1 A;  2D9Z A;  1GG3 A;  1DDW A;  1XX0 A;  1ZVR A;  2DX5 A;  2IFS A;  4KVG B;  1W1D A;  2MWN B;  1LW3 A;  3DXE A;  4IFS A;  4TYZ A;  1OQN A;  4ZRK A;  3SV1 A;  1X1G A;  1J0W A;  4F7U P;  3PVL A;  1ZC4 B;  1WJM A;  3PVW A;  2YS3 A;  2ROV A;  4PQ0 A;  3SO6 A;  2L2I A;  1XCG A;  5D3X A;  5GOW B;  3U8Z A;  2PZ1 A;  3U7D A;  3PSC A;  1V89 A;  2D9X A;  1Z87 A;  3F0W A;  1UNR A;  4C0A A;  2J0J A;  2YSZ A;  3WYF B;  1TXD A;  1HB8 A;  4DX8 A;  1UPQ A;  2RSG A;  1NI2 A;  2WH5 A;  4K81 A;  2ROZ B;  4DXA B;  1X05 A;  5J3Q A;  3QIJ A;  3UZT A;  1SHC A;  1UNQ A;  2MFQ A;  2M14 A;  4MY6 A;  2FJ9 A;  1PLS A;  3V5W A;  4P7I A;  1ZC3 B;  3FEH A;  1XD4 A;  2LUL A;  4XWX A;  4EKU A;  4KHB B;  1UPR A;  4Y94 A;  2Y8F A;  4GMV A;  2XQN M; 
#chains in the Genus database with same CATH topology
 2HRJ A;  1BTN A;  5J3T A;  2CAY A;  1DIK A;  2DN6 A;  5DIF B;  4HDO A;  4ZRJ A;  4YON A;  1WI1 A;  2Z0Q A;  4L1R A;  1J19 A;  3TW1 A;  1WGU A;  5DHA B;  2D11 A;  2D4Q A;  3G9W A;  4GPT B;  1M7R A;  3E9O A;  4JKA A;  2G35 A;  4CSQ A;  3ZDT A;  3GYP A;  1ST7 A;  2NBV A;  4HHV A;  3KY9 A;  3NSU A;  3TO1 A;  1I7A A;  3D8D A;  1MI1 A;  3KRW A;  1FOE A;  1NVL A;  2KUQ A;  3IVF A;  4QJ4 B;  4ILJ A;  2DYN A;  2RGN B;  2GJY A;  2N0Y A;  2FDQ A;  2COP A;  3TVV A;  2MDX A;  2COC A;  1U29 A;  1U5E A;  3HK0 A;  1M7E A;  2UZR A;  3D8F A;  1P3R A;  2Z0P A;  2HE7 A;  5HE2 A;  1WJ1 A;  4HAY B;  3ODO A;  2DHJ A;  2AL6 A;  4Z2N A;  2X0S A;  4D0N B;  1U5G A;  1VBH A;  3FLV A;  2I5C A;  3ODX A;  5FI0 A;  3X23 A;  4WSF A;  4JK7 A;  3QWM A;  4HB3 B;  5D3W A;  1P6S A;  1EAZ A;  1WG7 A;  2COA A;  4L6E A;  3SYX A;  3VOQ A;  1MIX A;  1TJ6 A;  3ML4 A;  1DDM A;  2K49 A;  2Q13 A;  2YF0 A;  3OAN A;  3E9L A;  2UVM A;  2CRF A;  1ACA A;  4DX9 0;  2Z4D A;  4HAZ B;  4HSI A;  2DIK A;  1ZYI A;  1DRO A;  4TKN A;  3QBV B;  4DBB A;  2DFK A;  4EMO A;  4ZRI A;  1U27 A;  5DHF B;  5JP4 A;  4PNK A;  1MK9 B;  3T06 A;  3RCP A;  3M1I B;  4NY0 A;  4HAT B;  2CQU A;  3DXC A;  1H10 A;  2KUP A;  2I1J A;  3FP5 A;  2ZPY A;  3E9P A;  4B6H A;  3HQC A;  3TCA A;  2NMB A;  4JKG A;  4OT1 A;  4HB2 B;  1RRP B;  5D3V A;  2DHK A;  2VSZ A;  3BIN A;  2DX1 A;  4HB0 B;  1SGH A;  4KHO A;  2DTC A;  1HBK A;  4K2P A;  3A8Q A;  1V5M A;  1MPH A;  4NSW A;  1LB1 A;  4WJ7 A;  1K5D B;  3B77 A;  5M4Y B;  4JKF A;  4WVF B;  4CHM A;  4K17 A;  2J0M A;  1AQC A;  4JK8 A;  2K2U A;  1FAO A;  2IYB A;  3N7C A;  5I2M A;  4EJN A;  5KQ4 A;  2CY4 A;  4JKB A;  1X1F A;  5CLQ B;  2DA0 A;  2K2J A;  4GNK B;  3WA0 A;  3HW2 B;  4QJ5 B;  3PP2 A;  5HE1 A;  3DXD A;  2DYQ A;  2VKI A;  5JHH A;  1KC7 A;  1U5D A;  2YRY A;  3P6A A;  4JK9 A;  5C5B B;  1PFJ A;  3CIK A;  2VRW B;  1FHW A;  1TQZ A;  2N23 A;  2W2W A;  1GC6 A;  4A5K A;  1DDV A;  1X86 A;  2D9W A;  4A6K A;  3BJI A;  4A6H A;  2Z59 A;  1MAI A;  1Q67 A;  2LG1 A;  4HAW B;  5L81 A;  2D10 A;  4F7G A;  1V61 A;  3ULB A;  5LG4 B;  5KCV A;  2D2Q A;  2MKR A;  3SNH A;  1EF1 A;  1GC7 A;  1GGO A;  4JKE A;  2EJ8 A;  1EVH A;  2I1K A;  3KRX A;  4JKD A;  4CHJ A;  3LJU X;  5HE0 A;  1KZ7 A;  1I2H A;  1N3H A;  2OQB A;  2YS5 A;  3NW8 A;  1ZSQ A;  2RNR B;  2DHI A;  3P7Z A;  2DLW A;  2GCJ A;  3MPX A;  1EGX A;  2ABD A;  2J59 M;  2D9Y A;  5D3Y A;  5C16 A;  2V76 A;  4A6F A;  2UZS A;  2BCJ A;  4YL8 A;  2RRF A;  1JDE A;  2QKL A;  3FM8 C;  4KHA A;  1VBG A;  1B55 A;  2D9V A;  2LBB A;  1FHO A;  2P0D A;  3PG7 A;  3DCX A;  2W2X C;  4QXA B;  1NU2 A;  1FHX A;  3FVC A;  4BBK A;  4HAX B;  4CYE A;  2RVB B;  2GUM A;  4ILG B;  2DKQ A;  2GCL A;  5DI9 B;  4ILH A;  1XKE A;  2EC1 A;  1FB8 A;  2HTH B;  3A98 B;  2ELA A;  1UEF A;  4MT7 A;  1OMW A;  3HIE A;  5LON B;  2J0K A;  1QQG A;  2RUK B;  3ZVR A;  1OY2 A;  2H7E A;  2COD A;  2Z0O A;  2P8V A;  2ZKM X;  1W1G A;  5JHG A;  1FGZ A;  1BAK A;  1XOD A;  3KZ1 A;  5JVL A;  4GXB A;  2RLO A;  5LOP B;  1BWN A;  2OTX A;  3CXB B;  4MK0 A;  5J3Y A;  1FGY A;  3KSY A;  1HB6 A;  2JP2 A;  2AEH A;  4K2O A;  3AU4 A;  2Y7B A;  2W2X D;  2R0D A;  1Y5O A;  1V5P A;  2CB8 A;  3FSS A;  5IJM A;  3GYO A;  4GMX B;  2R2Y A;  4JKG B;  2ADZ A;  4GZU A;  3SUZ A;  2NZ8 B;  3PEG A;  3U12 A;  1ISN A;  2EMT A;  2YVC A;  3PZD A;  2L1C A;  1QC6 A;  2R09 A;  3ODW A;  4KAX B;  4IAP A;  1U2B A;  4H8S A;  1V5U A;  1WVH A;  1NTY A;  3AJ4 A;  4KHB A;  5KQ1 A;  5EFX A;  1BTK A;  5C5B A;  2GS0 A;  2RQ1 A;  1Y19 B;  4OSN A;  2Z14 A;  1X11 A;  3PVU A;  4HB4 B;  3NWA A;  1W1H A;  4JKH A;  1RJ2 A;  1XR0 B;  5FI1 A;  2M38 A;  3ENB A;  4Z2M B;  2R82 A;  1K5G B;  1AWE A;  2FJL A;  2KCJ A;  3MDB C;  2FJU B;  2YT1 A;  1H4R A;  3TFM A;  1ZM0 A;  2COF A;  2X18 A;  1MK7 B;  2H7D A;  3ULC A;  1V88 A;  3D8E A;  1MIZ B;  2KGX B;  2DKP A;  5C79 A;  1UNP A;  3F5R A;  2YS1 A;  4F7H A;  3VIA A;  2K8E A;  1KBL A;  2ELB A;  4DIX A;  1T77 A;  4HAU B;  2K00 A;  1KZG A;  5C6R A;  2E2X A;  2LKO A;  2LOX A;  4HDQ A;  2QKM A;  1E5W A;  5HE3 A;  1PMS A;  4HAV B;  5DH9 B;  2LYD A;  5CLL B;  3NWF A;  4IOY X;  2LOZ A;  2YT2 A;  1NTI A;  3EPY A;  5D27 A;  3AU5 A;  4A6F B;  1IRS A;  2CY5 A;  2I5F A;  3A8P A;  1DBH A;  2Y8G A;  1U5F A;  1KI1 B;  2KR0 A;  4QJ3 B;  1WGQ A;  4GOU A;  1MKE A;  3OHM B;  5JLJ B;  3O96 A;  2P0F A;  1NTV A;  2P0H A;  2EMS A;  1P5T A;  2YT0 A;  1DYN A;  4GN1 A;  2D9Z A;  1GG3 A;  1DDW A;  1XX0 A;  5I2S A;  1ZVR A;  2DX5 A;  2IFS A;  4KVG B;  1W1D A;  2MWN B;  1LW3 A;  5IRS A;  2Z13 A;  3DXE A;  4IFS A;  4TYZ A;  1OQN A;  4ZRK A;  3SV1 A;  1X1G A;  1J0W A;  4F7U P;  3PVL A;  1ZC4 B;  1WJM A;  3PVW A;  2YS3 A;  2ROV A;  4PQ0 A;  3SO6 A;  2L2I A;  1XCG A;  4D6W A;  5D3X A;  3SBT A;  5GOW B;  3U8Z A;  2PZ1 A;  3U7D A;  3PSC A;  1V89 A;  2D9X A;  1Z87 A;  3SBG A;  3F0W A;  1UNR A;  4C0A A;  2J0J A;  2YSZ A;  3WYF B;  3HSA A;  1TXD A;  1HB8 A;  4DX8 A;  1UPQ A;  2RSG A;  1NI2 A;  2WH5 A;  2KIG A;  4K81 A;  2ROZ B;  3A58 A;  4DXA B;  1X05 A;  5J3Q A;  3QIJ A;  3UZT A;  1SHC A;  3NWD A;  4JKC A;  1UNQ A;  2KIE A;  2MFQ A;  2M14 A;  4MY6 A;  2FJ9 A;  1PLS A;  3E66 A;  3V5W A;  4P7I A;  1ZC3 B;  3FEH A;  1XD4 A;  2LUL A;  4XWX A;  4EKU A;  4KHB B;  1UPR A;  4Y94 A;  2Y8F A;  4GMV A;  2XQN M; 
#chains in the Genus database with same CATH homology
 2HRJ A;  1BTN A;  5J3T A;  2CAY A;  1DIK A;  2DN6 A;  5DIF B;  4HDO A;  4ZRJ A;  4YON A;  1WI1 A;  2Z0Q A;  1J19 A;  3TW1 A;  1WGU A;  5DHA B;  2D11 A;  2D4Q A;  3G9W A;  4GPT B;  1M7R A;  3E9O A;  4JKA A;  2G35 A;  3ZDT A;  3GYP A;  1ST7 A;  4HHV A;  3KY9 A;  3NSU A;  3TO1 A;  1I7A A;  3D8D A;  3KRW A;  1FOE A;  1NVL A;  3IVF A;  4ILJ A;  2DYN A;  2RGN B;  2GJY A;  2N0Y A;  2FDQ A;  2COP A;  3TVV A;  2MDX A;  2COC A;  1U29 A;  1U5E A;  3HK0 A;  1M7E A;  2UZR A;  3D8F A;  1P3R A;  2Z0P A;  2HE7 A;  5HE2 A;  1WJ1 A;  4HAY B;  3ODO A;  2DHJ A;  2AL6 A;  4Z2N A;  2X0S A;  4D0N B;  1U5G A;  1VBH A;  3FLV A;  2I5C A;  3ODX A;  5FI0 A;  3X23 A;  4WSF A;  4JK7 A;  3QWM A;  4HB3 B;  5D3W A;  1P6S A;  1EAZ A;  1WG7 A;  2COA A;  4L6E A;  3SYX A;  3VOQ A;  1MIX A;  1TJ6 A;  3ML4 A;  1DDM A;  2YF0 A;  2Q13 A;  3OAN A;  3E9L A;  2UVM A;  2CRF A;  1ACA A;  4DX9 0;  4HAZ B;  2DIK A;  1DRO A;  4TKN A;  3QBV B;  4DBB A;  2DFK A;  4EMO A;  4ZRI A;  1U27 A;  5DHF B;  5JP4 A;  4PNK A;  1MK9 B;  3T06 A;  3RCP A;  3M1I B;  4NY0 A;  4HAT B;  2CQU A;  3DXC A;  1H10 A;  2KUP A;  2I1J A;  3FP5 A;  2ZPY A;  3E9P A;  4B6H A;  3HQC A;  3TCA A;  2NMB A;  4JKG A;  4HB2 B;  1RRP B;  5D3V A;  2DHK A;  2VSZ A;  3BIN A;  2DX1 A;  4HB0 B;  1SGH A;  4KHO A;  2DTC A;  1HBK A;  4K2P A;  3A8Q A;  1V5M A;  1MPH A;  4NSW A;  1LB1 A;  4WJ7 A;  1K5D B;  4JKF A;  4WVF B;  4CHM A;  4K17 A;  2J0M A;  1AQC A;  4JK8 A;  2K2U A;  1FAO A;  2IYB A;  3N7C A;  4EJN A;  5KQ4 A;  2CY4 A;  4JKB A;  1X1F A;  5CLQ B;  2DA0 A;  2K2J A;  3WA0 A;  3HW2 B;  3PP2 A;  5HE1 A;  3DXD A;  2DYQ A;  2VKI A;  5JHH A;  1KC7 A;  1U5D A;  2YRY A;  3P6A A;  4JK9 A;  5C5B B;  1PFJ A;  3CIK A;  2VRW B;  1FHW A;  1TQZ A;  2N23 A;  2W2W A;  1GC6 A;  4A5K A;  1DDV A;  1X86 A;  2D9W A;  4A6K A;  3BJI A;  4A6H A;  1MAI A;  1Q67 A;  2LG1 A;  4HAW B;  5L81 A;  2D10 A;  4F7G A;  1V61 A;  3ULB A;  5KCV A;  2D2Q A;  2MKR A;  3SNH A;  1EF1 A;  1GC7 A;  1GGO A;  4JKE A;  2EJ8 A;  1EVH A;  2I1K A;  3KRX A;  4JKD A;  4CHJ A;  3LJU X;  5HE0 A;  1KZ7 A;  1I2H A;  1N3H A;  2OQB A;  2YS5 A;  1ZSQ A;  2RNR B;  2DHI A;  3P7Z A;  2DLW A;  2GCJ A;  3MPX A;  1EGX A;  2ABD A;  2J59 M;  2D9Y A;  5D3Y A;  5C16 A;  2V76 A;  4A6F A;  2UZS A;  2BCJ A;  4YL8 A;  1JDE A;  2QKL A;  3FM8 C;  4KHA A;  1VBG A;  1B55 A;  2D9V A;  2LBB A;  1FHO A;  2P0D A;  3PG7 A;  2W2X C;  1NU2 A;  1FHX A;  4BBK A;  4HAX B;  4CYE A;  2RVB B;  4ILG B;  2DKQ A;  2GCL A;  5DI9 B;  4ILH A;  1XKE A;  2EC1 A;  1FB8 A;  2HTH B;  3A98 B;  2ELA A;  1UEF A;  4MT7 A;  1OMW A;  5LON B;  2J0K A;  1QQG A;  2RUK B;  3ZVR A;  1OY2 A;  2H7E A;  2COD A;  2Z0O A;  2P8V A;  1W1G A;  5JHG A;  1FGZ A;  1BAK A;  1XOD A;  3KZ1 A;  5JVL A;  4GXB A;  2RLO A;  5LOP B;  1BWN A;  2OTX A;  3CXB B;  4MK0 A;  5J3Y A;  1FGY A;  3KSY A;  1HB6 A;  2JP2 A;  2AEH A;  4K2O A;  3AU4 A;  2Y7B A;  2W2X D;  2R0D A;  1Y5O A;  1V5P A;  2CB8 A;  3FSS A;  5IJM A;  3GYO A;  4GMX B;  4JKG B;  2ADZ A;  4GZU A;  3SUZ A;  2NZ8 B;  3PEG A;  1ISN A;  2EMT A;  2YVC A;  3PZD A;  2L1C A;  1QC6 A;  2R09 A;  3ODW A;  4KAX B;  4IAP A;  1U2B A;  4H8S A;  1V5U A;  1WVH A;  1NTY A;  3AJ4 A;  5KQ1 A;  5EFX A;  1BTK A;  5C5B A;  2GS0 A;  2RQ1 A;  1Y19 B;  1X11 A;  3PVU A;  4HB4 B;  1W1H A;  4JKH A;  1RJ2 A;  1XR0 B;  5FI1 A;  2M38 A;  3ENB A;  4Z2M B;  2R82 A;  1K5G B;  1AWE A;  2FJL A;  2KCJ A;  3MDB C;  2YT1 A;  1H4R A;  3TFM A;  1ZM0 A;  2COF A;  2X18 A;  1MK7 B;  2H7D A;  3ULC A;  1V88 A;  3D8E A;  1MIZ B;  2KGX B;  2DKP A;  5C79 A;  1UNP A;  3F5R A;  2YS1 A;  4F7H A;  3VIA A;  1KBL A;  2ELB A;  4HAU B;  2K00 A;  1KZG A;  5C6R A;  2E2X A;  2LKO A;  2LOX A;  4HDQ A;  2QKM A;  1E5W A;  5HE3 A;  1PMS A;  4HAV B;  5DH9 B;  2LYD A;  5CLL B;  4IOY X;  2LOZ A;  1NTI A;  3EPY A;  5D27 A;  3AU5 A;  4A6F B;  1IRS A;  2CY5 A;  2I5F A;  3A8P A;  1DBH A;  2Y8G A;  1U5F A;  1KI1 B;  1WGQ A;  1MKE A;  5JLJ B;  3O96 A;  2P0F A;  1NTV A;  2P0H A;  2EMS A;  1P5T A;  2YT0 A;  1DYN A;  4GN1 A;  2D9Z A;  1GG3 A;  1DDW A;  1XX0 A;  1ZVR A;  2DX5 A;  2IFS A;  4KVG B;  1W1D A;  2MWN B;  1LW3 A;  3DXE A;  4IFS A;  4TYZ A;  1OQN A;  4ZRK A;  3SV1 A;  1X1G A;  1J0W A;  4F7U P;  3PVL A;  1ZC4 B;  1WJM A;  3PVW A;  2YS3 A;  2ROV A;  4PQ0 A;  3SO6 A;  2L2I A;  1XCG A;  5D3X A;  3SBT A;  5GOW B;  3U8Z A;  2PZ1 A;  3U7D A;  3PSC A;  1V89 A;  2D9X A;  1Z87 A;  3SBG A;  3F0W A;  1UNR A;  4C0A A;  2J0J A;  2YSZ A;  3WYF B;  1TXD A;  1HB8 A;  4DX8 A;  1UPQ A;  2RSG A;  1NI2 A;  2WH5 A;  4K81 A;  2ROZ B;  4DXA B;  1X05 A;  5J3Q A;  3QIJ A;  3UZT A;  1SHC A;  4JKC A;  1UNQ A;  2MFQ A;  2M14 A;  4MY6 A;  2FJ9 A;  1PLS A;  3E66 A;  3V5W A;  4P7I A;  1ZC3 B;  3FEH A;  1XD4 A;  2LUL A;  4XWX A;  4EKU A;  4KHB B;  1UPR A;  4Y94 A;  2Y8F A;  4GMV A;  2XQN M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...