1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
4CHMA 2H7EA 2OQBA 2YS5A 2UZRA 5IJMA 1NTYA 1UPRA 5JLJB 2QKLA 2RSGA 1P3RA 1Y5OA 2QKMA 3ULBA 3PG7A 2D10A 3KY9A 2DHKA 2D9YA 1BTNA 3ODOA 3TW1A 2K2UA 2M14A 4WVFB 5D3XA 3PVLA 2K2JA 3UZTA 3GYOA 1TJ6A 1V89A 2YSZA 1MIZB 5D3WA 1WGUA 2UZSA 5CLLB 1UEFA 1BWNA 2AEHA 2RLOA 3O96A 3SO6A 2COAA 4MY6A 3N7CA 4KHBB 2CQUA 1WVHA 2VKIA 5EFXA 1I7AA 4XWXA 3P7ZA 1W1HA 3ULCA 5DH9B 3KRXA 2I1JA 3U8ZA 4GMVA 5KCVA 2HE7A 1AWEA 1MPHA 1X86A 3IVFA 1WG7A 1UNRA 3SYXA 1SGHA 2LKOA 3GYPA 3TFMA 4HB0B 1E5WA 5DHFB 1ISNA 1TXDA 2VRWB 3TCAA 1P6SA 2BCJA 2CAYA 2GCLA 4WJ7A 1H10A 2W2WA 1EVHA 3HW2B 5JP4A 1XCGA 5D3VA 2ZPYA 4D0NB 1IRSA 1K5DB 1WGQA 4GPTB 4HAXB 3NSUA 5J3TA 2DA0A 3A8PA 3PEGA 2CRFA 1LB1A 2OTXA 5C5BB 1OMWA 1P5TA 1KZ7A 1XD4A 4Y94A 4DBBA 5J3YA 1W1DA 2COPA 3FP5A 1MK9B 2COFA 2MDXA 3D8EA 5JHGA 2DKPA 3AJ4A 1W1GA 1FAOA 5JHHA 3F5RA 1RRPB 2YS3A 2Z0QA 1J0WA 2RQ1A 2I1KA 2R09A 2D2QA 2KGXB 3KZ1A 4A5KA 2EC1A 4EMOA 1RJ2A 2COCA 5LONB 4IOYX 2EMTA 2M38A 4L6EA 3U7DA 2W2XD 3A98B 2YRYA 4GMXB 2CODA 1EGXA 1U5EA 1WJ1A 1FHOA 2G35A 2Y8FA 1KZGA 1MIXA 1WJMA 1FOEA 4A6FB 4MK0A 3G9WA 1QC6A 4DX8A 4HB2B 4HAUB 1QQGA 3OANA 2Y7BA 2P8VA 4HB4B 5L81A 3ZDTA 5KQ1A 1HB6A 4TYZA 1FHWA 3QWMA 2RVBB 2CY5A 2P0DA 1K5GB 2ELAA 1X1FA 3P6AA 2CY4A 4WSFA 1XR0B 1DROA 2GS0A 4IAPA 5D3YA 1FGYA 4EJNA 1U27A 3PP2A 1GG3A 3KRWA 2N23A 4HAYB 2WH5A 1X1GA 2ELBA 5GOWB 4DXAB 3CXBB 3PSCA 2E2XA 2LG1A 3SV1A 1DBHA 2R0DA 2AL6A 4PNKA 2ROVA 5DIFB 4NSWA 5DHAB 2K00A 5C5BA 5HE1A 4A6HA 3T06A 1UNQA 2RGNB 2I5CA 4Z2NA 5DI9B 1PFJA 2LBBA 3MDBC 2NZ8B 4YL8A 5KQ4A 1N3HA 3HK0A 3MPXA 4HDQA 1UPQA 2DYQA 1ZC3B 5C6RA 1FGZA 1LW3A 2DFKA 3AU5A 2FDQA 2J59M 4BBKA 3DXCA 1XODA 2IYBA 1MAIA 2D11A 3CIKA 1U2BA 3VIAA 2D9XA 3KSYA 4GN1A 4K81A 4NY0A 2XQNM 3FLVA 4CYEA 1UNPA 5D27A 3QIJA 4HATB 4A6KA 4TKNA 2MKRA 4F7HA 1ACAA 1M7RA 2DKQA 2GCJA 1KI1B 5J3QA 1XKEA 1GC7A 1V61A 1NI2A 2P0FA 3ZVRA 1FHXA 4A6FA 2DHJA 1DDVA 1V5PA 4DX90 4HAWB 3ODXA 4PQ0A 3AU4A 1OY2A 2LOZA 3PVUA 1PMSA 1NTVA 1ZSQA 1WI1A 1EAZA 3WA0A 1ZM0A 3BINA 4ZRJA 2L2IA 2UVMA 2YS1A 1V5MA 2YT1A 1J19A 2J0KA 1U5FA 2J0JA 1OQNA 3PVWA 3TO1A 4HDOA 1BTKA 1U5GA 4F7GA 4ZRKA 2LYDA 2DTCA 1DDMA 1DDWA 4P7IA 2Y8GA 2Z0PA 2DHIA 2X18A 4H8SA 5C79A 2YVCA 1Y19B 3D8FA 1DYNA 2YF0A 5FI0A 1SHCA 2LOXA 2YT0A 2DLWA 3SNHA 1I2HA 2VSZA 2J0MA 5HE0A 2DX5A 1GC6A 2KUPA 4K17A 2H7DA 1FB8A 3F0WA 4YONA 1B55A 2N0YA 2D9WA 1TQZA 2DX1A 3EPYA 2EJ8A 4IFSA 1Z87A 4GZUA 1HBKA 2LULA 4Z2MB 4GXBA 2GJYA 3ODWA 3HQCA 2HTHB 3TVVA 3PZDA 1MK7B 4HB3B 1NVLA 2ROZB 1M7EA 2D9VA 2DYNA 3LJUX 1ZC4B 1X11A 5HE2A 1ZVRA 1H4RA 2IFSA 4EKUA 2KCJA 4KVGB 2L1CA 2JP2A 2I5FA 2ADZA 3FEHA 1V88A 3ML4A 3A8QA 2Q13A 5C16A 3QBVB 4K2OA 1U5DA 3X23A 2ABDA 2D4QA 1BAKA 1U29A 1NU2A 3DXDA 2RUKB 3BJIA 3DXEA 2RNRB 3WYFB 4HAVB 5FI1A 1HB8A 4F7UP 2DN6A 1XX0A 4CHJA 1PLSA 5LOPB 1ST7A 2HRJA 4KHAA 2P0HA 5CLQB 5HE3A 1MKEA 2MFQA 2D9ZA 2NMBA 2W2XC 4HAZB 2Z0OA 4MT7A 4KHOA 1V5UA 2FJ9A 1X05A 2EMSA 3FM8C 4K2PA 4HHVA 4ZRIA 3V5WA 1NTIA 1EF1A 1Q67A 2V76A 4KAXB 3D8DA 4B6HA 2MWNB 4C0AA 3VOQA 3RCPA 1AQCA 2FJLA 3SUZA 2PZ1A 3FSSA 3M1IB 2CB8A
chains in the Genus database with same CATH superfamily
4CHMA 2H7EA 2OQBA 2YS5A 2UZRA 4DIXA 5IJMA 1NTYA 1UPRA 5JLJB 2QKLA 2Z13A 2RSGA 1T77A 1P3RA 1KBLA 1Y5OA 2QKMA 3ULBA 3PG7A 2D10A 2K8EA 3KY9A 2DHKA 1VBHA 2D9YA 1BTNA 3ODOA 3TW1A 2K2UA 2M14A 4JKEA 3FVCA 4JKAA 4WVFB 5D3XA 3PVLA 2K2JA 3UZTA 3GYOA 1TJ6A 1V89A 2YSZA 1MIZB 5D3WA 1WGUA 2ZKMX 2UZSA 3HSAA 5CLLB 1UEFA 1BWNA 2Z14A 2AEHA 2RLOA 2KUQA 3O96A 3SO6A 2COAA 4MY6A 3N7CA 4KHBB 2CQUA 1WVHA 2VKIA 5EFXA 4JK8A 1I7AA 4QJ4B 4QXAB 4XWXA 3P7ZA 1W1HA 3ULCA 5DH9B 3KRXA 2I1JA 3U8ZA 4GMVA 5KCVA 2HE7A 1AWEA 1MPHA 1X86A 3NWFA 3IVFA 1WG7A 1UNRA 3SYXA 1SGHA 2LKOA 3GYPA 3TFMA 4HB0B 1E5WA 5DHFB 1ISNA 3U12A 1TXDA 2VRWB 3TCAA 1P6SA 2BCJA 2CAYA 2GCLA 4WJ7A 1H10A 2W2WA 1EVHA 3HW2B 5JP4A 1XCGA 2NBVA 5D3VA 2ZPYA 4D0NB 1IRSA 1K5DB 1WGQA 4GPTB 4HAXB 3NSUA 2GUMA 5J3TA 2DA0A 2KIGA 3A8PA 3A58A 3NWAA 3PEGA 2CRFA 1LB1A 2OTXA 3B77A 1OMWA 1P5TA 5C5BB 1KZ7A 1XD4A 4Y94A 4DBBA 5J3YA 1MI1A 1W1DA 2COPA 3FP5A 1MK9B 2COFA 2MDXA 3D8EA 5JHGA 2DKPA 3AJ4A 1W1GA 1FAOA 5JHHA 3F5RA 1RRPB 2YS3A 2Z0QA 1J0WA 2RQ1A 2I1KA 2R09A 2D2QA 2KGXB 3KZ1A 4A5KA 2EC1A 4EMOA 1RJ2A 2COCA 5LONB 4CSQA 4IOYX 2EMTA 2M38A 4L6EA 3U7DA 2W2XD 3HIEA 3SBGA 3A98B 2YRYA 4GMXB 2CODA 2R2YA 1EGXA 1U5EA 1WJ1A 1FHOA 2G35A 2Y8FA 1KZGA 1MIXA 1WJMA 1FOEA 4A6FB 4MK0A 3G9WA 4KHBA 1QC6A 4DX8A 4HB2B 4HAUB 1QQGA 3OANA 2Y7BA 2P8VA 1KC7A 4HB4B 5L81A 3ZDTA 3E9LA 1HB6A 5KQ1A 4TYZA 1FHWA 3QWMA 2RVBB 2CY5A 2P0DA 1K5GB 2ELAA 1X1FA 3P6AA 2CY4A 4WSFA 1XR0B 4JKFA 1DROA 2GS0A 4IAPA 5D3YA 1FGYA 4EJNA 1U27A 3PP2A 1GG3A 3KRWA 2K49A 2N23A 4HAYB 2WH5A 1X1GA 2ELBA 5GOWB 4DXAB 3CXBB 3ENBA 3PSCA 2E2XA 2LG1A 3SV1A 1DBHA 2R0DA 2AL6A 4ILHA 4PNKA 2ROVA 5DIFB 4NSWA 5DHAB 2K00A 5C5BA 5HE1A 4A6HA 4GNKB 3T06A 1UNQA 2RGNB 2I5CA 4Z2NA 5DI9B 1PFJA 2LBBA 3MDBC 2NZ8B 4YL8A 5LG4B 3E66A 5KQ4A 1N3HA 3HK0A 3MPXA 4HDQA 1UPQA 2DYQA 1ZC3B 5C6RA 5I2MA 4GOUA 1FGZA 1LW3A 2DFKA 3AU5A 2FDQA 2FJUB 2J59M 3DXCA 4BBKA 1XODA 2IYBA 1MAIA 2D11A 3CIKA 1U2BA 3VIAA 2D9XA 3KSYA 4GN1A 4K81A 4NY0A 4JK7A 2XQNM 3FLVA 4CYEA 2KIEA 1UNPA 5D27A 3QIJA 4HATB 4A6KA 4TKNA 2MKRA 4ILGB 4F7HA 1ACAA 1M7RA 2DKQA 2GCJA 1KI1B 5J3QA 1XKEA 1GC7A 1V61A 1NI2A 2P0FA 3ZVRA 1FHXA 3NWDA 4ILJA 4A6FA 4JKHA 2DHJA 3DCXA 4QJ5B 1DDVA 1V5PA 4HSIA 4DX90 4HAWB 3ODXA 4PQ0A 3AU4A 1OY2A 2LOZA 3PVUA 3E9OA 1PMSA 1NTVA 1ZSQA 4OT1A 1WI1A 1EAZA 3WA0A 2DIKA 1ZM0A 3BINA 4ZRJA 2L2IA 2UVMA 1V5MA 2YS1A 2YT1A 1J19A 5M4YB 2J0KA 1U5FA 2J0JA 1OQNA 3PVWA 3TO1A 4HDOA 2Z4DA 1BTKA 1U5GA 4F7GA 4ZRKA 2LYDA 2DTCA 1DDMA 4JKGA 4P7IA 1DDWA 5JVLA 2Y8GA 2Z0PA 2DHIA 2X18A 4H8SA 5C79A 2YVCA 3NW8A 4JKDA 1Y19B 4D6WA 3D8FA 1DYNA 2YF0A 5FI0A 1SHCA 2LOXA 2YT0A 4OSNA 2DLWA 3SNHA 1I2HA 2VSZA 2J0MA 5HE0A 2DX5A 1GC6A 2KUPA 4K17A 2H7DA 4JKGB 1FB8A 3F0WA 4YONA 1B55A 4JK9A 2N0YA 2D9WA 1TQZA 2DX1A 3EPYA 1VBGA 2EJ8A 2YT2A 4JKBA 4IFSA 1Z87A 4GZUA 5I2SA 1HBKA 2LULA 4Z2MB 4GXBA 2GJYA 3ODWA 3HQCA 2HTHB 3TVVA 3OHMB 3PZDA 1MK7B 4HB3B 1NVLA 2ROZB 2X0SA 4L1RA 1M7EA 2D9VA 2DYNA 3LJUX 1ZC4B 1X11A 5HE2A 1ZVRA 1H4RA 2IFSA 4EKUA 2KCJA 4KVGB 2L1CA 2JP2A 2I5FA 2ADZA 3FEHA 1ZYIA 1V88A 3ML4A 3A8QA 2Q13A 5C16A 3QBVB 2Z59A 4K2OA 1U5DA 3X23A 1DIKA 2ABDA 2D4QA 1BAKA 1U29A 2RRFA 1NU2A 3DXDA 2RUKB 3E9PA 3BJIA 3DXEA 2RNRB 2R82A 3WYFB 4HAVB 5FI1A 1HB8A 4F7UP 1GGOA 2DN6A 1XX0A 4CHJA 1PLSA 5LOPB 1ST7A 5IRSA 3SBTA 2HRJA 4KHAA 2P0HA 5CLQB 5HE3A 1MKEA 2MFQA 2D9ZA 2NMBA 4JKCA 2W2XC 4HAZB 2Z0OA 1JDEA 4MT7A 2KR0A 4KHOA 1V5UA 2FJ9A 1X05A 2EMSA 3FM8C 4K2PA 4HHVA 4ZRIA 3V5WA 1NTIA 1EF1A 1Q67A 2V76A 4QJ3B 4KAXB 3D8DA 4B6HA 2MWNB 4C0AA 3VOQA 3RCPA 1AQCA 2FJLA 3SUZA 2PZ1A 3FSSA 3M1IB 2CB8A
chains in the Genus database with same CATH topology
4CHMA 2H7EA 2OQBA 2YS5A 2UZRA 5IJMA 1NTYA 1UPRA 5JLJB 2QKLA 2RSGA 1P3RA 1KBLA 1Y5OA 2QKMA 3ULBA 3PG7A 2D10A 3KY9A 2DHKA 1VBHA 2D9YA 1BTNA 3ODOA 3TW1A 2K2UA 2M14A 4JKEA 4JKAA 4WVFB 5D3XA 3PVLA 2K2JA 3UZTA 3GYOA 1TJ6A 1V89A 2YSZA 1MIZB 5D3WA 1WGUA 2UZSA 5CLLB 1UEFA 1BWNA 2AEHA 2RLOA 3O96A 3SO6A 2COAA 4MY6A 3N7CA 4KHBB 2CQUA 1WVHA 2VKIA 5EFXA 4JK8A 1I7AA 4XWXA 3P7ZA 1W1HA 3ULCA 5DH9B 3KRXA 2I1JA 3U8ZA 4GMVA 5KCVA 2HE7A 1AWEA 1MPHA 1X86A 3IVFA 1WG7A 1UNRA 3SYXA 1SGHA 2LKOA 3GYPA 3TFMA 4HB0B 1E5WA 5DHFB 1ISNA 1TXDA 2VRWB 3TCAA 1P6SA 2BCJA 2CAYA 2GCLA 4WJ7A 1H10A 2W2WA 1EVHA 3HW2B 5JP4A 1XCGA 5D3VA 2ZPYA 4D0NB 1IRSA 1K5DB 1WGQA 4GPTB 4HAXB 3NSUA 5J3TA 2DA0A 3A8PA 3PEGA 2CRFA 1LB1A 2OTXA 5C5BB 1OMWA 1P5TA 1KZ7A 1XD4A 4Y94A 4DBBA 5J3YA 1W1DA 2COPA 3FP5A 1MK9B 2COFA 2MDXA 3D8EA 5JHGA 2DKPA 3AJ4A 1W1GA 1FAOA 5JHHA 3F5RA 1RRPB 2YS3A 2Z0QA 1J0WA 2RQ1A 2I1KA 2R09A 2D2QA 2KGXB 3KZ1A 4A5KA 2EC1A 4EMOA 1RJ2A 2COCA 5LONB 4IOYX 2EMTA 2M38A 4L6EA 3U7DA 2W2XD 3SBGA 3A98B 2YRYA 4GMXB 2CODA 1EGXA 1U5EA 1WJ1A 1FHOA 2G35A 2Y8FA 1KZGA 1MIXA 1WJMA 1FOEA 4A6FB 4MK0A 3G9WA 1QC6A 4DX8A 4HB2B 4HAUB 1QQGA 3OANA 2Y7BA 2P8VA 1KC7A 4HB4B 5L81A 3ZDTA 3E9LA 1HB6A 5KQ1A 4TYZA 1FHWA 3QWMA 2RVBB 2CY5A 2P0DA 1K5GB 2ELAA 1X1FA 3P6AA 2CY4A 4WSFA 1XR0B 4JKFA 1DROA 2GS0A 4IAPA 5D3YA 1FGYA 4EJNA 1U27A 3PP2A 1GG3A 3KRWA 2N23A 4HAYB 2WH5A 1X1GA 2ELBA 5GOWB 4DXAB 3CXBB 3ENBA 3PSCA 2E2XA 2LG1A 3SV1A 1DBHA 2R0DA 2AL6A 4ILHA 4PNKA 2ROVA 5DIFB 4NSWA 5DHAB 2K00A 5C5BA 5HE1A 4A6HA 3T06A 1UNQA 2RGNB 2I5CA 4Z2NA 5DI9B 1PFJA 2LBBA 3MDBC 2NZ8B 4YL8A 3E66A 5KQ4A 1N3HA 3HK0A 3MPXA 4HDQA 1UPQA 2DYQA 1ZC3B 5C6RA 1FGZA 1LW3A 2DFKA 3AU5A 2FDQA 2J59M 4BBKA 3DXCA 1XODA 2IYBA 1MAIA 2D11A 3CIKA 1U2BA 3VIAA 2D9XA 3KSYA 4GN1A 4K81A 4NY0A 4JK7A 2XQNM 3FLVA 4CYEA 1UNPA 5D27A 3QIJA 4HATB 4A6KA 4TKNA 2MKRA 4ILGB 4F7HA 1ACAA 1M7RA 2DKQA 2GCJA 1KI1B 5J3QA 1XKEA 1GC7A 1V61A 1NI2A 2P0FA 3ZVRA 1FHXA 4A6FA 4ILJA 4JKHA 2DHJA 1DDVA 1V5PA 4DX90 4HAWB 3ODXA 4PQ0A 3AU4A 1OY2A 2LOZA 3PVUA 3E9OA 1PMSA 1NTVA 1ZSQA 1WI1A 1EAZA 3WA0A 2DIKA 1ZM0A 3BINA 4ZRJA 2L2IA 2UVMA 1V5MA 2YS1A 2YT1A 1J19A 2J0KA 1U5FA 2J0JA 1OQNA 3PVWA 3TO1A 4HDOA 1BTKA 1U5GA 4F7GA 4ZRKA 2LYDA 2DTCA 1DDMA 4JKGA 4P7IA 1DDWA 5JVLA 2Y8GA 2Z0PA 2DHIA 2X18A 4H8SA 5C79A 2YVCA 4JKDA 1Y19B 3D8FA 1DYNA 2YF0A 5FI0A 1SHCA 2LOXA 2YT0A 2DLWA 3SNHA 1I2HA 2VSZA 2J0MA 5HE0A 2DX5A 1GC6A 2KUPA 4K17A 2H7DA 4JKGB 1FB8A 3F0WA 4YONA 1B55A 4JK9A 2N0YA 2D9WA 1TQZA 2DX1A 3EPYA 1VBGA 2EJ8A 4JKBA 4IFSA 1Z87A 4GZUA 1HBKA 2LULA 4Z2MB 4GXBA 2GJYA 3ODWA 3HQCA 2HTHB 3TVVA 3PZDA 1MK7B 4HB3B 1NVLA 2ROZB 2X0SA 1M7EA 2D9VA 2DYNA 3LJUX 1ZC4B 1X11A 5HE2A 1ZVRA 1H4RA 2IFSA 4EKUA 2KCJA 4KVGB 2L1CA 2JP2A 2I5FA 2ADZA 3FEHA 1V88A 3ML4A 3A8QA 2Q13A 5C16A 3QBVB 4K2OA 1U5DA 3X23A 1DIKA 2ABDA 2D4QA 1BAKA 1U29A 1NU2A 3DXDA 2RUKB 3E9PA 3BJIA 3DXEA 2RNRB 2R82A 3WYFB 4HAVB 5FI1A 1HB8A 4F7UP 1GGOA 2DN6A 1XX0A 4CHJA 1PLSA 5LOPB 1ST7A 3SBTA 2HRJA 4KHAA 2P0HA 5CLQB 5HE3A 1MKEA 2MFQA 2D9ZA 2NMBA 4JKCA 2W2XC 4HAZB 2Z0OA 1JDEA 4MT7A 4KHOA 1V5UA 2FJ9A 1X05A 2EMSA 3FM8C 4K2PA 4HHVA 4ZRIA 3V5WA 1NTIA 1EF1A 1Q67A 2V76A 4KAXB 3D8DA 4B6HA 2MWNB 4C0AA 3VOQA 3RCPA 1AQCA 2FJLA 3SUZA 2PZ1A 3FSSA 3M1IB 2CB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  2H7E A;  2OQB A;  2YS5 A;  2UZR A;  5IJM A;  1NTY A;  1UPR A;  5JLJ B;  2QKL A;  2RSG A;  1P3R A;  1Y5O A;  2QKM A;  3ULB A;  3PG7 A;  2D10 A;  3KY9 A;  2DHK A;  2D9Y A;  1BTN A;  3ODO A;  3TW1 A;  2K2U A;  2M14 A;  4WVF B;  5D3X A;  3PVL A;  2K2J A;  3UZT A;  3GYO A;  1TJ6 A;  1V89 A;  2YSZ A;  1MIZ B;  5D3W A;  1WGU A;  2UZS A;  5CLL B;  1UEF A;  1BWN A;  2AEH A;  2RLO A;  3O96 A;  3SO6 A;  2COA A;  4MY6 A;  3N7C A;  4KHB B;  2CQU A;  1WVH A;  2VKI A;  5EFX A;  1I7A A;  4XWX A;  3P7Z A;  1W1H A;  3ULC A;  5DH9 B;  3KRX A;  2I1J A;  3U8Z A;  4GMV A;  5KCV A;  2HE7 A;  1AWE A;  1MPH A;  1X86 A;  3IVF A;  1WG7 A;  1UNR A;  3SYX A;  1SGH A;  2LKO A;  3GYP A;  3TFM A;  4HB0 B;  1E5W A;  5DHF B;  1ISN A;  1TXD A;  2VRW B;  3TCA A;  1P6S A;  2BCJ A;  2CAY A;  2GCL A;  4WJ7 A;  1H10 A;  2W2W A;  1EVH A;  3HW2 B;  5JP4 A;  1XCG A;  5D3V A;  2ZPY A;  4D0N B;  1IRS A;  1K5D B;  1WGQ A;  4GPT B;  4HAX B;  3NSU A;  5J3T A;  2DA0 A;  3A8P A;  3PEG A;  2CRF A;  1LB1 A;  2OTX A;  5C5B B;  1OMW A;  1P5T A;  1KZ7 A;  1XD4 A;  4Y94 A;  4DBB A;  5J3Y A;  1W1D A;  2COP A;  3FP5 A;  1MK9 B;  2COF A;  2MDX A;  3D8E A;  5JHG A;  2DKP A;  3AJ4 A;  1W1G A;  1FAO A;  5JHH A;  3F5R A;  1RRP B;  2YS3 A;  2Z0Q A;  1J0W A;  2RQ1 A;  2I1K A;  2R09 A;  2D2Q A;  2KGX B;  3KZ1 A;  4A5K A;  2EC1 A;  4EMO A;  1RJ2 A;  2COC A;  5LON B;  4IOY X;  2EMT A;  2M38 A;  4L6E A;  3U7D A;  2W2X D;  3A98 B;  2YRY A;  4GMX B;  2COD A;  1EGX A;  1U5E A;  1WJ1 A;  1FHO A;  2G35 A;  2Y8F A;  1KZG A;  1MIX A;  1WJM A;  1FOE A;  4A6F B;  4MK0 A;  3G9W A;  1QC6 A;  4DX8 A;  4HB2 B;  4HAU B;  1QQG A;  3OAN A;  2Y7B A;  2P8V A;  4HB4 B;  5L81 A;  3ZDT A;  5KQ1 A;  1HB6 A;  4TYZ A;  1FHW A;  3QWM A;  2RVB B;  2CY5 A;  2P0D A;  1K5G B;  2ELA A;  1X1F A;  3P6A A;  2CY4 A;  4WSF A;  1XR0 B;  1DRO A;  2GS0 A;  4IAP A;  5D3Y A;  1FGY A;  4EJN A;  1U27 A;  3PP2 A;  1GG3 A;  3KRW A;  2N23 A;  4HAY B;  2WH5 A;  1X1G A;  2ELB A;  5GOW B;  4DXA B;  3CXB B;  3PSC A;  2E2X A;  2LG1 A;  3SV1 A;  1DBH A;  2R0D A;  2AL6 A;  4PNK A;  2ROV A;  5DIF B;  4NSW A;  5DHA B;  2K00 A;  5C5B A;  5HE1 A;  4A6H A;  3T06 A;  1UNQ A;  2RGN B;  2I5C A;  4Z2N A;  5DI9 B;  1PFJ A;  2LBB A;  3MDB C;  2NZ8 B;  4YL8 A;  5KQ4 A;  1N3H A;  3HK0 A;  3MPX A;  4HDQ A;  1UPQ A;  2DYQ A;  1ZC3 B;  5C6R A;  1FGZ A;  1LW3 A;  2DFK A;  3AU5 A;  2FDQ A;  2J59 M;  4BBK A;  3DXC A;  1XOD A;  2IYB A;  1MAI A;  2D11 A;  3CIK A;  1U2B A;  3VIA A;  2D9X A;  3KSY A;  4GN1 A;  4K81 A;  4NY0 A;  2XQN M;  3FLV A;  4CYE A;  1UNP A;  5D27 A;  3QIJ A;  4HAT B;  4A6K A;  4TKN A;  2MKR A;  4F7H A;  1ACA A;  1M7R A;  2DKQ A;  2GCJ A;  1KI1 B;  5J3Q A;  1XKE A;  1GC7 A;  1V61 A;  1NI2 A;  2P0F A;  3ZVR A;  1FHX A;  4A6F A;  2DHJ A;  1DDV A;  1V5P A;  4DX9 0;  4HAW B;  3ODX A;  4PQ0 A;  3AU4 A;  1OY2 A;  2LOZ A;  3PVU A;  1PMS A;  1NTV A;  1ZSQ A;  1WI1 A;  1EAZ A;  3WA0 A;  1ZM0 A;  3BIN A;  4ZRJ A;  2L2I A;  2UVM A;  2YS1 A;  1V5M A;  2YT1 A;  1J19 A;  2J0K A;  1U5F A;  2J0J A;  1OQN A;  3PVW A;  3TO1 A;  4HDO A;  1BTK A;  1U5G A;  4F7G A;  4ZRK A;  2LYD A;  2DTC A;  1DDM A;  1DDW A;  4P7I A;  2Y8G A;  2Z0P A;  2DHI A;  2X18 A;  4H8S A;  5C79 A;  2YVC A;  1Y19 B;  3D8F A;  1DYN A;  2YF0 A;  5FI0 A;  1SHC A;  2LOX A;  2YT0 A;  2DLW A;  3SNH A;  1I2H A;  2VSZ A;  2J0M A;  5HE0 A;  2DX5 A;  1GC6 A;  2KUP A;  4K17 A;  2H7D A;  1FB8 A;  3F0W A;  4YON A;  1B55 A;  2N0Y A;  2D9W A;  1TQZ A;  2DX1 A;  3EPY A;  2EJ8 A;  4IFS A;  1Z87 A;  4GZU A;  1HBK A;  2LUL A;  4Z2M B;  4GXB A;  2GJY A;  3ODW A;  3HQC A;  2HTH B;  3TVV A;  3PZD A;  1MK7 B;  4HB3 B;  1NVL A;  2ROZ B;  1M7E A;  2D9V A;  2DYN A;  3LJU X;  1ZC4 B;  1X11 A;  5HE2 A;  1ZVR A;  1H4R A;  2IFS A;  4EKU A;  2KCJ A;  4KVG B;  2L1C A;  2JP2 A;  2I5F A;  2ADZ A;  3FEH A;  1V88 A;  3ML4 A;  3A8Q A;  2Q13 A;  5C16 A;  3QBV B;  4K2O A;  1U5D A;  3X23 A;  2ABD A;  2D4Q A;  1BAK A;  1U29 A;  1NU2 A;  3DXD A;  2RUK B;  3BJI A;  3DXE A;  2RNR B;  3WYF B;  4HAV B;  5FI1 A;  1HB8 A;  4F7U P;  2DN6 A;  1XX0 A;  4CHJ A;  1PLS A;  5LOP B;  1ST7 A;  2HRJ A;  4KHA A;  2P0H A;  5CLQ B;  5HE3 A;  1MKE A;  2MFQ A;  2D9Z A;  2NMB A;  2W2X C;  4HAZ B;  2Z0O A;  4MT7 A;  4KHO A;  1V5U A;  2FJ9 A;  1X05 A;  2EMS A;  3FM8 C;  4K2P A;  4HHV A;  4ZRI A;  3V5W A;  1NTI A;  1EF1 A;  1Q67 A;  2V76 A;  4KAX B;  3D8D A;  4B6H A;  2MWN B;  4C0A A;  3VOQ A;  3RCP A;  1AQC A;  2FJL A;  3SUZ A;  2PZ1 A;  3FSS A;  3M1I B;  2CB8 A; 
#chains in the Genus database with same CATH topology
 4CHM A;  2H7E A;  2OQB A;  2YS5 A;  2UZR A;  4DIX A;  5IJM A;  1NTY A;  1UPR A;  5JLJ B;  2QKL A;  2Z13 A;  2RSG A;  1T77 A;  1P3R A;  1KBL A;  1Y5O A;  2QKM A;  3ULB A;  3PG7 A;  2D10 A;  2K8E A;  3KY9 A;  2DHK A;  1VBH A;  2D9Y A;  1BTN A;  3ODO A;  3TW1 A;  2K2U A;  2M14 A;  4JKE A;  3FVC A;  4JKA A;  4WVF B;  5D3X A;  3PVL A;  2K2J A;  3UZT A;  3GYO A;  1TJ6 A;  1V89 A;  2YSZ A;  1MIZ B;  5D3W A;  1WGU A;  2ZKM X;  2UZS A;  3HSA A;  5CLL B;  1UEF A;  1BWN A;  2Z14 A;  2AEH A;  2RLO A;  2KUQ A;  3O96 A;  3SO6 A;  2COA A;  4MY6 A;  3N7C A;  4KHB B;  2CQU A;  1WVH A;  2VKI A;  5EFX A;  4JK8 A;  1I7A A;  4QJ4 B;  4QXA B;  4XWX A;  3P7Z A;  1W1H A;  3ULC A;  5DH9 B;  3KRX A;  2I1J A;  3U8Z A;  4GMV A;  5KCV A;  2HE7 A;  1AWE A;  1MPH A;  1X86 A;  3NWF A;  3IVF A;  1WG7 A;  1UNR A;  3SYX A;  1SGH A;  2LKO A;  3GYP A;  3TFM A;  4HB0 B;  1E5W A;  5DHF B;  1ISN A;  3U12 A;  1TXD A;  2VRW B;  3TCA A;  1P6S A;  2BCJ A;  2CAY A;  2GCL A;  4WJ7 A;  1H10 A;  2W2W A;  1EVH A;  3HW2 B;  5JP4 A;  1XCG A;  2NBV A;  5D3V A;  2ZPY A;  4D0N B;  1IRS A;  1K5D B;  1WGQ A;  4GPT B;  4HAX B;  3NSU A;  2GUM A;  5J3T A;  2DA0 A;  2KIG A;  3A8P A;  3A58 A;  3NWA A;  3PEG A;  2CRF A;  1LB1 A;  2OTX A;  3B77 A;  1OMW A;  1P5T A;  5C5B B;  1KZ7 A;  1XD4 A;  4Y94 A;  4DBB A;  5J3Y A;  1MI1 A;  1W1D A;  2COP A;  3FP5 A;  1MK9 B;  2COF A;  2MDX A;  3D8E A;  5JHG A;  2DKP A;  3AJ4 A;  1W1G A;  1FAO A;  5JHH A;  3F5R A;  1RRP B;  2YS3 A;  2Z0Q A;  1J0W A;  2RQ1 A;  2I1K A;  2R09 A;  2D2Q A;  2KGX B;  3KZ1 A;  4A5K A;  2EC1 A;  4EMO A;  1RJ2 A;  2COC A;  5LON B;  4CSQ A;  4IOY X;  2EMT A;  2M38 A;  4L6E A;  3U7D A;  2W2X D;  3HIE A;  3SBG A;  3A98 B;  2YRY A;  4GMX B;  2COD A;  2R2Y A;  1EGX A;  1U5E A;  1WJ1 A;  1FHO A;  2G35 A;  2Y8F A;  1KZG A;  1MIX A;  1WJM A;  1FOE A;  4A6F B;  4MK0 A;  3G9W A;  4KHB A;  1QC6 A;  4DX8 A;  4HB2 B;  4HAU B;  1QQG A;  3OAN A;  2Y7B A;  2P8V A;  1KC7 A;  4HB4 B;  5L81 A;  3ZDT A;  3E9L A;  1HB6 A;  5KQ1 A;  4TYZ A;  1FHW A;  3QWM A;  2RVB B;  2CY5 A;  2P0D A;  1K5G B;  2ELA A;  1X1F A;  3P6A A;  2CY4 A;  4WSF A;  1XR0 B;  4JKF A;  1DRO A;  2GS0 A;  4IAP A;  5D3Y A;  1FGY A;  4EJN A;  1U27 A;  3PP2 A;  1GG3 A;  3KRW A;  2K49 A;  2N23 A;  4HAY B;  2WH5 A;  1X1G A;  2ELB A;  5GOW B;  4DXA B;  3CXB B;  3ENB A;  3PSC A;  2E2X A;  2LG1 A;  3SV1 A;  1DBH A;  2R0D A;  2AL6 A;  4ILH A;  4PNK A;  2ROV A;  5DIF B;  4NSW A;  5DHA B;  2K00 A;  5C5B A;  5HE1 A;  4A6H A;  4GNK B;  3T06 A;  1UNQ A;  2RGN B;  2I5C A;  4Z2N A;  5DI9 B;  1PFJ A;  2LBB A;  3MDB C;  2NZ8 B;  4YL8 A;  5LG4 B;  3E66 A;  5KQ4 A;  1N3H A;  3HK0 A;  3MPX A;  4HDQ A;  1UPQ A;  2DYQ A;  1ZC3 B;  5C6R A;  5I2M A;  4GOU A;  1FGZ A;  1LW3 A;  2DFK A;  3AU5 A;  2FDQ A;  2FJU B;  2J59 M;  3DXC A;  4BBK A;  1XOD A;  2IYB A;  1MAI A;  2D11 A;  3CIK A;  1U2B A;  3VIA A;  2D9X A;  3KSY A;  4GN1 A;  4K81 A;  4NY0 A;  4JK7 A;  2XQN M;  3FLV A;  4CYE A;  2KIE A;  1UNP A;  5D27 A;  3QIJ A;  4HAT B;  4A6K A;  4TKN A;  2MKR A;  4ILG B;  4F7H A;  1ACA A;  1M7R A;  2DKQ A;  2GCJ A;  1KI1 B;  5J3Q A;  1XKE A;  1GC7 A;  1V61 A;  1NI2 A;  2P0F A;  3ZVR A;  1FHX A;  3NWD A;  4ILJ A;  4A6F A;  4JKH A;  2DHJ A;  3DCX A;  4QJ5 B;  1DDV A;  1V5P A;  4HSI A;  4DX9 0;  4HAW B;  3ODX A;  4PQ0 A;  3AU4 A;  1OY2 A;  2LOZ A;  3PVU A;  3E9O A;  1PMS A;  1NTV A;  1ZSQ A;  4OT1 A;  1WI1 A;  1EAZ A;  3WA0 A;  2DIK A;  1ZM0 A;  3BIN A;  4ZRJ A;  2L2I A;  2UVM A;  1V5M A;  2YS1 A;  2YT1 A;  1J19 A;  5M4Y B;  2J0K A;  1U5F A;  2J0J A;  1OQN A;  3PVW A;  3TO1 A;  4HDO A;  2Z4D A;  1BTK A;  1U5G A;  4F7G A;  4ZRK A;  2LYD A;  2DTC A;  1DDM A;  4JKG A;  4P7I A;  1DDW A;  5JVL A;  2Y8G A;  2Z0P A;  2DHI A;  2X18 A;  4H8S A;  5C79 A;  2YVC A;  3NW8 A;  4JKD A;  1Y19 B;  4D6W A;  3D8F A;  1DYN A;  2YF0 A;  5FI0 A;  1SHC A;  2LOX A;  2YT0 A;  4OSN A;  2DLW A;  3SNH A;  1I2H A;  2VSZ A;  2J0M A;  5HE0 A;  2DX5 A;  1GC6 A;  2KUP A;  4K17 A;  2H7D A;  4JKG B;  1FB8 A;  3F0W A;  4YON A;  1B55 A;  4JK9 A;  2N0Y A;  2D9W A;  1TQZ A;  2DX1 A;  3EPY A;  1VBG A;  2EJ8 A;  2YT2 A;  4JKB A;  4IFS A;  1Z87 A;  4GZU A;  5I2S A;  1HBK A;  2LUL A;  4Z2M B;  4GXB A;  2GJY A;  3ODW A;  3HQC A;  2HTH B;  3TVV A;  3OHM B;  3PZD A;  1MK7 B;  4HB3 B;  1NVL A;  2ROZ B;  2X0S A;  4L1R A;  1M7E A;  2D9V A;  2DYN A;  3LJU X;  1ZC4 B;  1X11 A;  5HE2 A;  1ZVR A;  1H4R A;  2IFS A;  4EKU A;  2KCJ A;  4KVG B;  2L1C A;  2JP2 A;  2I5F A;  2ADZ A;  3FEH A;  1ZYI A;  1V88 A;  3ML4 A;  3A8Q A;  2Q13 A;  5C16 A;  3QBV B;  2Z59 A;  4K2O A;  1U5D A;  3X23 A;  1DIK A;  2ABD A;  2D4Q A;  1BAK A;  1U29 A;  2RRF A;  1NU2 A;  3DXD A;  2RUK B;  3E9P A;  3BJI A;  3DXE A;  2RNR B;  2R82 A;  3WYF B;  4HAV B;  5FI1 A;  1HB8 A;  4F7U P;  1GGO A;  2DN6 A;  1XX0 A;  4CHJ A;  1PLS A;  5LOP B;  1ST7 A;  5IRS A;  3SBT A;  2HRJ A;  4KHA A;  2P0H A;  5CLQ B;  5HE3 A;  1MKE A;  2MFQ A;  2D9Z A;  2NMB A;  4JKC A;  2W2X C;  4HAZ B;  2Z0O A;  1JDE A;  4MT7 A;  2KR0 A;  4KHO A;  1V5U A;  2FJ9 A;  1X05 A;  2EMS A;  3FM8 C;  4K2P A;  4HHV A;  4ZRI A;  3V5W A;  1NTI A;  1EF1 A;  1Q67 A;  2V76 A;  4QJ3 B;  4KAX B;  3D8D A;  4B6H A;  2MWN B;  4C0A A;  3VOQ A;  3RCP A;  1AQC A;  2FJL A;  3SUZ A;  2PZ1 A;  3FSS A;  3M1I B;  2CB8 A; 
#chains in the Genus database with same CATH homology
 4CHM A;  2H7E A;  2OQB A;  2YS5 A;  2UZR A;  5IJM A;  1NTY A;  1UPR A;  5JLJ B;  2QKL A;  2RSG A;  1P3R A;  1KBL A;  1Y5O A;  2QKM A;  3ULB A;  3PG7 A;  2D10 A;  3KY9 A;  2DHK A;  1VBH A;  2D9Y A;  1BTN A;  3ODO A;  3TW1 A;  2K2U A;  2M14 A;  4JKE A;  4JKA A;  4WVF B;  5D3X A;  3PVL A;  2K2J A;  3UZT A;  3GYO A;  1TJ6 A;  1V89 A;  2YSZ A;  1MIZ B;  5D3W A;  1WGU A;  2UZS A;  5CLL B;  1UEF A;  1BWN A;  2AEH A;  2RLO A;  3O96 A;  3SO6 A;  2COA A;  4MY6 A;  3N7C A;  4KHB B;  2CQU A;  1WVH A;  2VKI A;  5EFX A;  4JK8 A;  1I7A A;  4XWX A;  3P7Z A;  1W1H A;  3ULC A;  5DH9 B;  3KRX A;  2I1J A;  3U8Z A;  4GMV A;  5KCV A;  2HE7 A;  1AWE A;  1MPH A;  1X86 A;  3IVF A;  1WG7 A;  1UNR A;  3SYX A;  1SGH A;  2LKO A;  3GYP A;  3TFM A;  4HB0 B;  1E5W A;  5DHF B;  1ISN A;  1TXD A;  2VRW B;  3TCA A;  1P6S A;  2BCJ A;  2CAY A;  2GCL A;  4WJ7 A;  1H10 A;  2W2W A;  1EVH A;  3HW2 B;  5JP4 A;  1XCG A;  5D3V A;  2ZPY A;  4D0N B;  1IRS A;  1K5D B;  1WGQ A;  4GPT B;  4HAX B;  3NSU A;  5J3T A;  2DA0 A;  3A8P A;  3PEG A;  2CRF A;  1LB1 A;  2OTX A;  5C5B B;  1OMW A;  1P5T A;  1KZ7 A;  1XD4 A;  4Y94 A;  4DBB A;  5J3Y A;  1W1D A;  2COP A;  3FP5 A;  1MK9 B;  2COF A;  2MDX A;  3D8E A;  5JHG A;  2DKP A;  3AJ4 A;  1W1G A;  1FAO A;  5JHH A;  3F5R A;  1RRP B;  2YS3 A;  2Z0Q A;  1J0W A;  2RQ1 A;  2I1K A;  2R09 A;  2D2Q A;  2KGX B;  3KZ1 A;  4A5K A;  2EC1 A;  4EMO A;  1RJ2 A;  2COC A;  5LON B;  4IOY X;  2EMT A;  2M38 A;  4L6E A;  3U7D A;  2W2X D;  3SBG A;  3A98 B;  2YRY A;  4GMX B;  2COD A;  1EGX A;  1U5E A;  1WJ1 A;  1FHO A;  2G35 A;  2Y8F A;  1KZG A;  1MIX A;  1WJM A;  1FOE A;  4A6F B;  4MK0 A;  3G9W A;  1QC6 A;  4DX8 A;  4HB2 B;  4HAU B;  1QQG A;  3OAN A;  2Y7B A;  2P8V A;  1KC7 A;  4HB4 B;  5L81 A;  3ZDT A;  3E9L A;  1HB6 A;  5KQ1 A;  4TYZ A;  1FHW A;  3QWM A;  2RVB B;  2CY5 A;  2P0D A;  1K5G B;  2ELA A;  1X1F A;  3P6A A;  2CY4 A;  4WSF A;  1XR0 B;  4JKF A;  1DRO A;  2GS0 A;  4IAP A;  5D3Y A;  1FGY A;  4EJN A;  1U27 A;  3PP2 A;  1GG3 A;  3KRW A;  2N23 A;  4HAY B;  2WH5 A;  1X1G A;  2ELB A;  5GOW B;  4DXA B;  3CXB B;  3ENB A;  3PSC A;  2E2X A;  2LG1 A;  3SV1 A;  1DBH A;  2R0D A;  2AL6 A;  4ILH A;  4PNK A;  2ROV A;  5DIF B;  4NSW A;  5DHA B;  2K00 A;  5C5B A;  5HE1 A;  4A6H A;  3T06 A;  1UNQ A;  2RGN B;  2I5C A;  4Z2N A;  5DI9 B;  1PFJ A;  2LBB A;  3MDB C;  2NZ8 B;  4YL8 A;  3E66 A;  5KQ4 A;  1N3H A;  3HK0 A;  3MPX A;  4HDQ A;  1UPQ A;  2DYQ A;  1ZC3 B;  5C6R A;  1FGZ A;  1LW3 A;  2DFK A;  3AU5 A;  2FDQ A;  2J59 M;  4BBK A;  3DXC A;  1XOD A;  2IYB A;  1MAI A;  2D11 A;  3CIK A;  1U2B A;  3VIA A;  2D9X A;  3KSY A;  4GN1 A;  4K81 A;  4NY0 A;  4JK7 A;  2XQN M;  3FLV A;  4CYE A;  1UNP A;  5D27 A;  3QIJ A;  4HAT B;  4A6K A;  4TKN A;  2MKR A;  4ILG B;  4F7H A;  1ACA A;  1M7R A;  2DKQ A;  2GCJ A;  1KI1 B;  5J3Q A;  1XKE A;  1GC7 A;  1V61 A;  1NI2 A;  2P0F A;  3ZVR A;  1FHX A;  4A6F A;  4ILJ A;  4JKH A;  2DHJ A;  1DDV A;  1V5P A;  4DX9 0;  4HAW B;  3ODX A;  4PQ0 A;  3AU4 A;  1OY2 A;  2LOZ A;  3PVU A;  3E9O A;  1PMS A;  1NTV A;  1ZSQ A;  1WI1 A;  1EAZ A;  3WA0 A;  2DIK A;  1ZM0 A;  3BIN A;  4ZRJ A;  2L2I A;  2UVM A;  1V5M A;  2YS1 A;  2YT1 A;  1J19 A;  2J0K A;  1U5F A;  2J0J A;  1OQN A;  3PVW A;  3TO1 A;  4HDO A;  1BTK A;  1U5G A;  4F7G A;  4ZRK A;  2LYD A;  2DTC A;  1DDM A;  4JKG A;  4P7I A;  1DDW A;  5JVL A;  2Y8G A;  2Z0P A;  2DHI A;  2X18 A;  4H8S A;  5C79 A;  2YVC A;  4JKD A;  1Y19 B;  3D8F A;  1DYN A;  2YF0 A;  5FI0 A;  1SHC A;  2LOX A;  2YT0 A;  2DLW A;  3SNH A;  1I2H A;  2VSZ A;  2J0M A;  5HE0 A;  2DX5 A;  1GC6 A;  2KUP A;  4K17 A;  2H7D A;  4JKG B;  1FB8 A;  3F0W A;  4YON A;  1B55 A;  4JK9 A;  2N0Y A;  2D9W A;  1TQZ A;  2DX1 A;  3EPY A;  1VBG A;  2EJ8 A;  4JKB A;  4IFS A;  1Z87 A;  4GZU A;  1HBK A;  2LUL A;  4Z2M B;  4GXB A;  2GJY A;  3ODW A;  3HQC A;  2HTH B;  3TVV A;  3PZD A;  1MK7 B;  4HB3 B;  1NVL A;  2ROZ B;  2X0S A;  1M7E A;  2D9V A;  2DYN A;  3LJU X;  1ZC4 B;  1X11 A;  5HE2 A;  1ZVR A;  1H4R A;  2IFS A;  4EKU A;  2KCJ A;  4KVG B;  2L1C A;  2JP2 A;  2I5F A;  2ADZ A;  3FEH A;  1V88 A;  3ML4 A;  3A8Q A;  2Q13 A;  5C16 A;  3QBV B;  4K2O A;  1U5D A;  3X23 A;  1DIK A;  2ABD A;  2D4Q A;  1BAK A;  1U29 A;  1NU2 A;  3DXD A;  2RUK B;  3E9P A;  3BJI A;  3DXE A;  2RNR B;  2R82 A;  3WYF B;  4HAV B;  5FI1 A;  1HB8 A;  4F7U P;  1GGO A;  2DN6 A;  1XX0 A;  4CHJ A;  1PLS A;  5LOP B;  1ST7 A;  3SBT A;  2HRJ A;  4KHA A;  2P0H A;  5CLQ B;  5HE3 A;  1MKE A;  2MFQ A;  2D9Z A;  2NMB A;  4JKC A;  2W2X C;  4HAZ B;  2Z0O A;  1JDE A;  4MT7 A;  4KHO A;  1V5U A;  2FJ9 A;  1X05 A;  2EMS A;  3FM8 C;  4K2P A;  4HHV A;  4ZRI A;  3V5W A;  1NTI A;  1EF1 A;  1Q67 A;  2V76 A;  4KAX B;  3D8D A;  4B6H A;  2MWN B;  4C0A A;  3VOQ A;  3RCP A;  1AQC A;  2FJL A;  3SUZ A;  2PZ1 A;  3FSS A;  3M1I B;  2CB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...