1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Talin
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
2KGXB 1ST7A 1OY2A 4HHVA 5CLQB 2DYNA 2QKMA 2L2IA 1NI2A 3ULCA 1X1GA 4GPTB 1NTYA 2WH5A 2IFSA 2P0HA 1W1DA 1H10A 3LJUX 3A98B 3TO1A 2LOZA 4MT7A 3BINA 4EKUA 5CLLB 2DTCA 4ZRKA 5HE2A 1WG7A 2M38A 1UNRA 5J3YA 2Z0PA 2EJ8A 4A6KA 4P7IA 3PVLA 1V61A 2XQNM 1XX0A 1DYNA 2VSZA 2GS0A 3GYOA 3O96A 5DHFB 1WGQA 1U5GA 4K2OA 5C5BA 2W2XD 4A6FB 2LOXA 2CAYA 4KHOA 3HK0A 5HE3A 2LBBA 5HE0A 5FI1A 5DH9B 1DDVA 2ELBA 1UNPA 1TXDA 2DHIA 3FSSA 1HB6A 2DA0A 2MKRA 1GC7A 1WJMA 2Y8FA 2K2UA 3FLVA 3X23A 1BTNA 2GCLA 1FAOA 2L1CA 1H4RA 4PQ0A 4F7HA 2LKOA 3RCPA 1MAIA 1MKEA 2YT0A 2E2XA 4HAYB 1B55A 1FGYA 4B6HA 1U5DA 4YL8A 1MIXA 1EGXA 2D2QA 1ZVRA 3SO6A 3TFMA 1OQNA 1X11A 5JLJB 1ISNA 2CB8A 4PNKA 4HB4B 4L6EA 4Y94A 2KUPA 4GMXB 2COAA 2ROVA 3KRXA 2K2JA 1TJ6A 4HAZB 5HE1A 1U29A 2W2XC 4HB2B 5JHHA 3SYXA 1XR0B 3NSUA 1V5UA 4XWXA 2RQ1A 1V89A 1BTKA 3U8ZA 4GN1A 5D3XA 3VIAA 4YONA 3GYPA 1HB8A 4EJNA 1UEFA 4DBBA 2I1KA 4HAUB 2Z0QA 1MK7B 1ZSQA 3M1IB 3ZDTA 1X05A 3MPXA 5J3QA 3SNHA 1RRPB 2CRFA 1KZ7A 1I2HA 1U27A 2R0DA 4MK0A 2YT1A 3SV1A 4DX8A 1J19A 1X86A 2JP2A 1K5DB 3TVVA 2D9ZA 2J0JA 2OTXA 1XODA 1W1GA 1BWNA 2YSZA 1Q67A 2UZSA 5C5BB 2HE7A 2D9YA 2DKQA 1WJ1A 4IFSA 2YF0A 1Y5OA 2EMSA 3KY9A 1AWEA 2LULA 5DI9B 2ELAA 2BCJA 2P8VA 2D10A 2YS1A 2R09A 5C79A 2FJLA 2J0MA 2Q13A 4TKNA 5KQ1A 2YVCA 2D9WA 2I5FA 3BJIA 4K81A 4IAPA 3D8FA 5C16A 4GZUA 1FHWA 1FOEA 1M7RA 3DXDA 2D9XA 3U7DA 5KCVA 2K00A 2DKPA 1KZGA 2MWNB 3D8DA 2LYDA 2RGNB 3AU5A 2Z0OA 2ABDA 4Z2MB 5EFXA 4HDOA 1NVLA 3QBVB 2COFA 1V5MA 3KSYA 2GCJA 2ROZB 2D11A 1X1FA 1TQZA 4Z2NA 2CY4A 2NMBA 2DFKA 2M14A 5GOWB 3IVFA 1WI1A 2NZ8B 1W1HA 1EF1A 4F7GA 1FHOA 4WVFB 3QIJA 2ZPYA 3PVWA 2FDQA 1V88A 1SGHA 3OANA 4WJ7A 3VOQA 3DXCA 2MDXA 3CIKA 2DX5A 2HTHB 2H7EA 5LONB 1DDMA 1PFJA 3ODWA 5LOPB 2EC1A 1LB1A 4CHJA 1PLSA 1UPRA 3HQCA 4HDQA 4HATB 5D3VA 1XCGA 2AL6A 1HBKA 4IOYX 1DDWA 4HAWB 1NTIA 3ODXA 4K17A 3P7ZA 4CYEA 2I5CA 5JHGA 2QKLA 1U2BA 4ZRIA 2RNRB 1SHCA 3KRWA 2N23A 3MDBC 2D9VA 4HAXB 3A8PA 1K5GB 1RJ2A 5DHAB 5D3YA 1WVHA 2IYBA 2PZ1A 3A8QA 2DX1A 3PSCA 4NSWA 1V5PA 4BBKA 3TW1A 3T06A 4GXBA 1XKEA 3V5WA 2Y7BA 3PEGA 4MY6A 1IRSA 2LG1A 2I1JA 4KVGB 2CQUA 2J0KA 1J0WA 3ML4A 3FM8C 1P6SA 1NTVA 1FGZA 5D3WA 2GJYA 2COPA 4CHMA 2CODA 1ZM0A 3DXEA 4TYZA 3QWMA 1FB8A 3CXBB 3HW2B 3N7CA 4DX90 4ZRJA 2RVBB 2YS5A 3ZVRA 1Z87A 1EAZA 4A5KA 3SUZA 1EVHA 5DIFB 2J59M 1ZC4B 1I7AA 1DROA 2UZRA 1Y19B 4HAVB 2DHKA 3EPYA 1AQCA 2P0DA 2ADZA 4HB3B 2RSGA 3PZDA 5FI0A 2HRJA 2EMTA 2FJ9A 2DYQA 1GG3A 1LW3A 1PMSA 2DHJA 4WSFA 3P6AA 4A6HA 1E5WA 1XD4A 2UVMA 3AU4A 4A6FA 1BAKA 2DN6A 2AEHA 2Y8GA 1NU2A 3FEHA 2N0YA 5JP4A 2G35A 2MFQA 1OMWA 5L81A 4HB0B 4F7UP 1MK9B 4NY0A 1U5EA 2KCJA 1P5TA 2VKIA 4H8SA 4C0AA 3WA0A 4DXAB 1M7EA 4K2PA 1ZC3B 1MPHA 1UPQA 2VRWB 3AJ4A 3WYFB 1GC6A 3ODOA 5D27A 2YS3A 5C6RA 2RUKB 2X18A 2COCA 2DLWA 1KI1B 2YRYA 4D0NB 2RLOA 5KQ4A 1DBHA 3PG7A 3PP2A 1FHXA 5J3TA 2H7DA 1U5FA 4KHAA 3D8EA 4EMOA 1UNQA 2V76A 4GMVA 2CY5A 2W2WA 4KHBB 3F5RA 3F0WA 3KZ1A 3G9WA 1ACAA 5IJMA 1MIZB 3FP5A 3ULBA 2D4QA 3UZTA 2P0FA 1WGUA 1P3RA 4KAXB 2OQBA 1N3HA 3TCAA 1QC6A 1QQGA 3PVUA
chains in the Genus database with same CATH superfamily
2KGXB 1ST7A 1OY2A 4HHVA 5CLQB 2DYNA 2QKMA 2L2IA 1NI2A 3ULCA 1X1GA 4GPTB 1NTYA 2WH5A 1KBLA 2IFSA 1W1DA 2P0HA 1H10A 3LJUX 3A98B 3TO1A 2LOZA 4MT7A 3BINA 4ILJA 4EKUA 5CLLB 2DTCA 4ZRKA 5HE2A 1WG7A 2M38A 2NBVA 1UNRA 5IRSA 5J3YA 2Z0PA 4HSIA 2EJ8A 4A6KA 4P7IA 3PVLA 1V61A 2XQNM 1GGOA 3HIEA 1XX0A 1DYNA 2VSZA 2GS0A 3GYOA 3O96A 5DHFB 1WGQA 1U5GA 4K2OA 5C5BA 2W2XD 4A6FB 2LOXA 4GOUA 2CAYA 4KHOA 3HK0A 5HE3A 2LBBA 5HE0A 5FI1A 5DH9B 1DDVA 2ELBA 1UNPA 1TXDA 2DHIA 3FSSA 1HB6A 3NWFA 2DA0A 2MKRA 1GC7A 1WJMA 2Y8FA 2K2UA 3FLVA 3X23A 1BTNA 2GCLA 1FAOA 2L1CA 1H4RA 4PQ0A 4F7HA 2LKOA 3RCPA 1MAIA 1MKEA 2YT0A 2E2XA 4HAYB 3E9OA 1B55A 1FGYA 4B6HA 1U5DA 4YL8A 1MIXA 1EGXA 2D2QA 1ZVRA 2Z59A 3SO6A 3TFMA 4JKAA 1OQNA 1X11A 5JLJB 1ISNA 2CB8A 4PNKA 2Z13A 4HB4B 4L6EA 4Y94A 2K49A 2KUPA 4GMXB 4JKFA 2COAA 2ROVA 1MI1A 3KRXA 2K2JA 2ZKMX 1TJ6A 4JKDA 4HAZB 5HE1A 1U29A 2W2XC 4JK8A 4HB2B 5JHHA 4QJ5B 3SYXA 4JK7A 1XR0B 3NSUA 1V5UA 4XWXA 2RQ1A 1V89A 1BTKA 3U8ZA 4GN1A 5D3XA 3VIAA 4CSQA 4YONA 3GYPA 1HB8A 4EJNA 2R2YA 1UEFA 4DBBA 1T77A 2I1KA 2FJUB 4HAUB 2Z0QA 3A58A 3NWAA 1MK7B 2KIGA 1ZSQA 3M1IB 3ZDTA 1X05A 3MPXA 5J3QA 3SNHA 1RRPB 4JKHA 2CRFA 1JDEA 1KZ7A 1I2HA 1U27A 2R0DA 4MK0A 2YT1A 3SV1A 4DX8A 3U12A 1J19A 1X86A 2JP2A 1K5DB 3TVVA 2D9ZA 2J0JA 2OTXA 1XODA 2KR0A 3HSAA 1W1GA 1BWNA 2YSZA 1Q67A 2UZSA 5C5BB 2HE7A 2D9YA 2DKQA 1WJ1A 4IFSA 2YF0A 4L1RA 1Y5OA 2EMSA 3KY9A 1AWEA 2LULA 5DI9B 2ELAA 2BCJA 2P8VA 5I2MA 2D10A 2YS1A 2R09A 1ZYIA 2FJLA 5C79A 2J0MA 2Q13A 4TKNA 5KQ1A 4D6WA 2YVCA 4QJ4B 2D9WA 2I5FA 3B77A 3E9LA 3BJIA 4K81A 4IAPA 3D8FA 5C16A 4GZUA 1FHWA 4ILGB 3NWDA 1FOEA 1M7RA 3DXDA 4JKCA 2D9XA 3U7DA 5KCVA 2K00A 2DKPA 1KZGA 2MWNB 4JKGA 3D8DA 2LYDA 2RGNB 3AU5A 2Z0OA 2ABDA 4Z2MB 5EFXA 4HDOA 3E9PA 1NVLA 3QBVB 2COFA 1V5MA 3KSYA 2GCJA 4JKEA 2ROZB 2YT2A 2D11A 1X1FA 1TQZA 4Z2NA 2CY4A 2NMBA 2DFKA 2M14A 5GOWB 3IVFA 1WI1A 2NZ8B 1W1HA 1EF1A 4F7GA 1FHOA 4WVFB 3QIJA 2ZPYA 3PVWA 2FDQA 2KIEA 3DCXA 1V88A 1SGHA 3OANA 4WJ7A 3VOQA 3DXCA 2MDXA 3CIKA 4QJ3B 2DX5A 2HTHB 2H7EA 5LONB 1DDMA 1PFJA 3ODWA 5LOPB 2EC1A 1LB1A 4CHJA 1PLSA 1UPRA 3HQCA 4JKBA 4HDQA 4HATB 5D3VA 1XCGA 2Z4DA 2KUQA 2AL6A 1HBKA 4IOYX 1DDWA 4HAWB 1NTIA 3ODXA 4K17A 3P7ZA 4CYEA 2I5CA 5JHGA 2QKLA 1U2BA 4ZRIA 2RNRB 1SHCA 3KRWA 2N23A 3MDBC 2D9VA 3FVCA 4HAXB 3A8PA 4OT1A 1K5GB 1RJ2A 5DHAB 5D3YA 3OHMB 1WVHA 2IYBA 2PZ1A 3A8QA 2DX1A 3PSCA 4NSWA 1V5PA 4BBKA 2GUMA 3TW1A 3T06A 4KHBA 4GXBA 1XKEA 3V5WA 2Y7BA 3PEGA 4MY6A 3SBTA 2R82A 1IRSA 2LG1A 2I1JA 4KVGB 1VBGA 2CQUA 2J0KA 1J0WA 3ML4A 3SBGA 3FM8C 1P6SA 1NTVA 1FGZA 5D3WA 2GJYA 2COPA 4CHMA 4JKGB 2CODA 1ZM0A 3DXEA 4TYZA 3QWMA 1FB8A 3CXBB 3HW2B 3N7CA 4DX90 4ZRJA 2RVBB 2YS5A 3ZVRA 1Z87A 1EAZA 5M4YB 3ENBA 4A5KA 3SUZA 1EVHA 5DIFB 3NW8A 2J59M 5I2SA 1ZC4B 1I7AA 2K8EA 1DROA 2Z14A 2UZRA 1Y19B 4HAVB 2DHKA 3EPYA 1AQCA 2P0DA 2ADZA 4HB3B 2RSGA 3PZDA 5FI0A 2HRJA 2EMTA 2FJ9A 2DYQA 1GG3A 1LW3A 1PMSA 2DHJA 2RRFA 4WSFA 3P6AA 4OSNA 4QXAB 4ILHA 4A6HA 1E5WA 1XD4A 2UVMA 3AU4A 3E66A 4A6FA 1BAKA 2DN6A 2DIKA 2AEHA 2Y8GA 1NU2A 5LG4B 3FEHA 2N0YA 5JP4A 2G35A 2MFQA 1OMWA 5L81A 4HB0B 4F7UP 1MK9B 4NY0A 1U5EA 2KCJA 1KC7A 1P5TA 4GNKB 2VKIA 4H8SA 4C0AA 3WA0A 4DXAB 1M7EA 4K2PA 1ZC3B 1MPHA 4JK9A 1UPQA 2VRWB 3AJ4A 3WYFB 1GC6A 3ODOA 5D27A 2YS3A 5C6RA 2RUKB 1DIKA 2X18A 2COCA 2DLWA 1KI1B 2YRYA 4D0NB 2RLOA 5KQ4A 1DBHA 3PG7A 3PP2A 1FHXA 5J3TA 2H7DA 1U5FA 4KHAA 3D8EA 4EMOA 1UNQA 2V76A 4GMVA 2CY5A 2W2WA 4KHBB 3F5RA 3F0WA 3KZ1A 3G9WA 1ACAA 5IJMA 1MIZB 2X0SA 3FP5A 3ULBA 2D4QA 3UZTA 2P0FA 1WGUA 1VBHA 1P3RA 5JVLA 4KAXB 2OQBA 1N3HA 3TCAA 1QC6A 4DIXA 1QQGA 3PVUA
chains in the Genus database with same CATH topology
2KGXB 1ST7A 1OY2A 4HHVA 5CLQB 2DYNA 2QKMA 2L2IA 1NI2A 3ULCA 1X1GA 4GPTB 1NTYA 2WH5A 1KBLA 2IFSA 1W1DA 2P0HA 1H10A 3LJUX 3A98B 3TO1A 2LOZA 4MT7A 3BINA 4ILJA 4EKUA 5CLLB 2DTCA 4ZRKA 5HE2A 1WG7A 2M38A 1UNRA 5J3YA 2Z0PA 2EJ8A 4A6KA 4P7IA 3PVLA 1V61A 2XQNM 1GGOA 1XX0A 1DYNA 2VSZA 2GS0A 3GYOA 3O96A 5DHFB 1WGQA 1U5GA 4K2OA 5C5BA 2W2XD 4A6FB 2LOXA 2CAYA 4KHOA 3HK0A 5HE3A 2LBBA 5HE0A 5FI1A 5DH9B 1DDVA 2ELBA 1UNPA 1TXDA 2DHIA 3FSSA 1HB6A 2DA0A 2MKRA 1GC7A 1WJMA 2Y8FA 2K2UA 3FLVA 3X23A 1BTNA 2GCLA 1FAOA 2L1CA 1H4RA 4PQ0A 4F7HA 2LKOA 3RCPA 1MAIA 1MKEA 2YT0A 2E2XA 4HAYB 3E9OA 1B55A 1FGYA 4B6HA 1U5DA 4YL8A 1MIXA 1EGXA 2D2QA 1ZVRA 3SO6A 3TFMA 4JKAA 1OQNA 1X11A 5JLJB 1ISNA 2CB8A 4PNKA 4HB4B 4L6EA 4Y94A 2KUPA 4GMXB 4JKFA 2COAA 2ROVA 3KRXA 2K2JA 1TJ6A 4JKDA 4HAZB 5HE1A 1U29A 2W2XC 4JK8A 4HB2B 5JHHA 3SYXA 4JK7A 1XR0B 3NSUA 1V5UA 4XWXA 2RQ1A 1V89A 1BTKA 3U8ZA 4GN1A 5D3XA 3VIAA 4YONA 3GYPA 1HB8A 4EJNA 1UEFA 4DBBA 2I1KA 4HAUB 2Z0QA 1MK7B 1ZSQA 3M1IB 3ZDTA 1X05A 3MPXA 5J3QA 3SNHA 1RRPB 4JKHA 2CRFA 1JDEA 1KZ7A 1I2HA 1U27A 2R0DA 4MK0A 2YT1A 3SV1A 4DX8A 1J19A 1X86A 2JP2A 1K5DB 3TVVA 2D9ZA 2J0JA 2OTXA 1XODA 1W1GA 1BWNA 2YSZA 1Q67A 2UZSA 5C5BB 2HE7A 2D9YA 2DKQA 1WJ1A 4IFSA 2YF0A 1Y5OA 2EMSA 3KY9A 1AWEA 2LULA 5DI9B 2ELAA 2BCJA 2P8VA 2D10A 2YS1A 2R09A 5C79A 2FJLA 2J0MA 2Q13A 4TKNA 5KQ1A 2YVCA 2D9WA 2I5FA 3E9LA 3BJIA 4K81A 4IAPA 3D8FA 5C16A 4GZUA 1FHWA 4ILGB 1FOEA 1M7RA 3DXDA 4JKCA 2D9XA 3U7DA 5KCVA 2K00A 2DKPA 1KZGA 2MWNB 4JKGA 3D8DA 2LYDA 2RGNB 3AU5A 2Z0OA 2ABDA 4Z2MB 5EFXA 4HDOA 3E9PA 1NVLA 3QBVB 2COFA 1V5MA 3KSYA 2GCJA 4JKEA 2ROZB 2D11A 1X1FA 1TQZA 4Z2NA 2CY4A 2NMBA 2DFKA 2M14A 5GOWB 3IVFA 1WI1A 2NZ8B 1W1HA 1EF1A 4F7GA 1FHOA 4WVFB 3QIJA 2ZPYA 3PVWA 2FDQA 1V88A 1SGHA 3OANA 4WJ7A 3VOQA 3DXCA 2MDXA 3CIKA 2DX5A 2HTHB 2H7EA 5LONB 1DDMA 1PFJA 3ODWA 5LOPB 2EC1A 1LB1A 4CHJA 1PLSA 1UPRA 3HQCA 4JKBA 4HDQA 4HATB 5D3VA 1XCGA 2AL6A 1HBKA 4IOYX 1DDWA 4HAWB 1NTIA 3ODXA 4K17A 3P7ZA 4CYEA 2I5CA 5JHGA 2QKLA 1U2BA 4ZRIA 2RNRB 1SHCA 3KRWA 2N23A 3MDBC 2D9VA 4HAXB 3A8PA 1K5GB 1RJ2A 5DHAB 5D3YA 1WVHA 2IYBA 2PZ1A 3A8QA 2DX1A 3PSCA 4NSWA 1V5PA 4BBKA 3TW1A 3T06A 4GXBA 1XKEA 3V5WA 2Y7BA 3PEGA 4MY6A 3SBTA 2R82A 1IRSA 2LG1A 2I1JA 4KVGB 1VBGA 2CQUA 2J0KA 1J0WA 3ML4A 3SBGA 3FM8C 1P6SA 1NTVA 1FGZA 5D3WA 2GJYA 2COPA 4CHMA 4JKGB 2CODA 1ZM0A 3DXEA 4TYZA 3QWMA 1FB8A 3CXBB 3HW2B 3N7CA 4DX90 4ZRJA 2RVBB 2YS5A 3ZVRA 1Z87A 1EAZA 3ENBA 4A5KA 3SUZA 1EVHA 5DIFB 2J59M 1ZC4B 1I7AA 1DROA 2UZRA 1Y19B 4HAVB 2DHKA 3EPYA 1AQCA 2P0DA 2ADZA 4HB3B 2RSGA 3PZDA 5FI0A 2HRJA 2EMTA 2FJ9A 2DYQA 1GG3A 1LW3A 1PMSA 2DHJA 4WSFA 3P6AA 4ILHA 4A6HA 1E5WA 1XD4A 2UVMA 3AU4A 3E66A 4A6FA 1BAKA 2DN6A 2DIKA 2AEHA 2Y8GA 1NU2A 3FEHA 2N0YA 5JP4A 2G35A 2MFQA 1OMWA 5L81A 4HB0B 4F7UP 1MK9B 4NY0A 1U5EA 2KCJA 1KC7A 1P5TA 2VKIA 4H8SA 4C0AA 3WA0A 4DXAB 1M7EA 4K2PA 1ZC3B 1MPHA 4JK9A 1UPQA 2VRWB 3AJ4A 3WYFB 1GC6A 3ODOA 5D27A 2YS3A 5C6RA 2RUKB 1DIKA 2X18A 2COCA 2DLWA 1KI1B 2YRYA 4D0NB 2RLOA 5KQ4A 1DBHA 3PG7A 3PP2A 1FHXA 5J3TA 2H7DA 1U5FA 4KHAA 3D8EA 4EMOA 1UNQA 2V76A 4GMVA 2CY5A 2W2WA 4KHBB 3F5RA 3F0WA 3KZ1A 3G9WA 1ACAA 5IJMA 1MIZB 2X0SA 3FP5A 3ULBA 2D4QA 3UZTA 2P0FA 1WGUA 1VBHA 1P3RA 5JVLA 4KAXB 2OQBA 1N3HA 3TCAA 1QC6A 1QQGA 3PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGX B;  1ST7 A;  1OY2 A;  4HHV A;  5CLQ B;  2DYN A;  2QKM A;  2L2I A;  1NI2 A;  3ULC A;  1X1G A;  4GPT B;  1NTY A;  2WH5 A;  2IFS A;  2P0H A;  1W1D A;  1H10 A;  3LJU X;  3A98 B;  3TO1 A;  2LOZ A;  4MT7 A;  3BIN A;  4EKU A;  5CLL B;  2DTC A;  4ZRK A;  5HE2 A;  1WG7 A;  2M38 A;  1UNR A;  5J3Y A;  2Z0P A;  2EJ8 A;  4A6K A;  4P7I A;  3PVL A;  1V61 A;  2XQN M;  1XX0 A;  1DYN A;  2VSZ A;  2GS0 A;  3GYO A;  3O96 A;  5DHF B;  1WGQ A;  1U5G A;  4K2O A;  5C5B A;  2W2X D;  4A6F B;  2LOX A;  2CAY A;  4KHO A;  3HK0 A;  5HE3 A;  2LBB A;  5HE0 A;  5FI1 A;  5DH9 B;  1DDV A;  2ELB A;  1UNP A;  1TXD A;  2DHI A;  3FSS A;  1HB6 A;  2DA0 A;  2MKR A;  1GC7 A;  1WJM A;  2Y8F A;  2K2U A;  3FLV A;  3X23 A;  1BTN A;  2GCL A;  1FAO A;  2L1C A;  1H4R A;  4PQ0 A;  4F7H A;  2LKO A;  3RCP A;  1MAI A;  1MKE A;  2YT0 A;  2E2X A;  4HAY B;  1B55 A;  1FGY A;  4B6H A;  1U5D A;  4YL8 A;  1MIX A;  1EGX A;  2D2Q A;  1ZVR A;  3SO6 A;  3TFM A;  1OQN A;  1X11 A;  5JLJ B;  1ISN A;  2CB8 A;  4PNK A;  4HB4 B;  4L6E A;  4Y94 A;  2KUP A;  4GMX B;  2COA A;  2ROV A;  3KRX A;  2K2J A;  1TJ6 A;  4HAZ B;  5HE1 A;  1U29 A;  2W2X C;  4HB2 B;  5JHH A;  3SYX A;  1XR0 B;  3NSU A;  1V5U A;  4XWX A;  2RQ1 A;  1V89 A;  1BTK A;  3U8Z A;  4GN1 A;  5D3X A;  3VIA A;  4YON A;  3GYP A;  1HB8 A;  4EJN A;  1UEF A;  4DBB A;  2I1K A;  4HAU B;  2Z0Q A;  1MK7 B;  1ZSQ A;  3M1I B;  3ZDT A;  1X05 A;  3MPX A;  5J3Q A;  3SNH A;  1RRP B;  2CRF A;  1KZ7 A;  1I2H A;  1U27 A;  2R0D A;  4MK0 A;  2YT1 A;  3SV1 A;  4DX8 A;  1J19 A;  1X86 A;  2JP2 A;  1K5D B;  3TVV A;  2D9Z A;  2J0J A;  2OTX A;  1XOD A;  1W1G A;  1BWN A;  2YSZ A;  1Q67 A;  2UZS A;  5C5B B;  2HE7 A;  2D9Y A;  2DKQ A;  1WJ1 A;  4IFS A;  2YF0 A;  1Y5O A;  2EMS A;  3KY9 A;  1AWE A;  2LUL A;  5DI9 B;  2ELA A;  2BCJ A;  2P8V A;  2D10 A;  2YS1 A;  2R09 A;  5C79 A;  2FJL A;  2J0M A;  2Q13 A;  4TKN A;  5KQ1 A;  2YVC A;  2D9W A;  2I5F A;  3BJI A;  4K81 A;  4IAP A;  3D8F A;  5C16 A;  4GZU A;  1FHW A;  1FOE A;  1M7R A;  3DXD A;  2D9X A;  3U7D A;  5KCV A;  2K00 A;  2DKP A;  1KZG A;  2MWN B;  3D8D A;  2LYD A;  2RGN B;  3AU5 A;  2Z0O A;  2ABD A;  4Z2M B;  5EFX A;  4HDO A;  1NVL A;  3QBV B;  2COF A;  1V5M A;  3KSY A;  2GCJ A;  2ROZ B;  2D11 A;  1X1F A;  1TQZ A;  4Z2N A;  2CY4 A;  2NMB A;  2DFK A;  2M14 A;  5GOW B;  3IVF A;  1WI1 A;  2NZ8 B;  1W1H A;  1EF1 A;  4F7G A;  1FHO A;  4WVF B;  3QIJ A;  2ZPY A;  3PVW A;  2FDQ A;  1V88 A;  1SGH A;  3OAN A;  4WJ7 A;  3VOQ A;  3DXC A;  2MDX A;  3CIK A;  2DX5 A;  2HTH B;  2H7E A;  5LON B;  1DDM A;  1PFJ A;  3ODW A;  5LOP B;  2EC1 A;  1LB1 A;  4CHJ A;  1PLS A;  1UPR A;  3HQC A;  4HDQ A;  4HAT B;  5D3V A;  1XCG A;  2AL6 A;  1HBK A;  4IOY X;  1DDW A;  4HAW B;  1NTI A;  3ODX A;  4K17 A;  3P7Z A;  4CYE A;  2I5C A;  5JHG A;  2QKL A;  1U2B A;  4ZRI A;  2RNR B;  1SHC A;  3KRW A;  2N23 A;  3MDB C;  2D9V A;  4HAX B;  3A8P A;  1K5G B;  1RJ2 A;  5DHA B;  5D3Y A;  1WVH A;  2IYB A;  2PZ1 A;  3A8Q A;  2DX1 A;  3PSC A;  4NSW A;  1V5P A;  4BBK A;  3TW1 A;  3T06 A;  4GXB A;  1XKE A;  3V5W A;  2Y7B A;  3PEG A;  4MY6 A;  1IRS A;  2LG1 A;  2I1J A;  4KVG B;  2CQU A;  2J0K A;  1J0W A;  3ML4 A;  3FM8 C;  1P6S A;  1NTV A;  1FGZ A;  5D3W A;  2GJY A;  2COP A;  4CHM A;  2COD A;  1ZM0 A;  3DXE A;  4TYZ A;  3QWM A;  1FB8 A;  3CXB B;  3HW2 B;  3N7C A;  4DX9 0;  4ZRJ A;  2RVB B;  2YS5 A;  3ZVR A;  1Z87 A;  1EAZ A;  4A5K A;  3SUZ A;  1EVH A;  5DIF B;  2J59 M;  1ZC4 B;  1I7A A;  1DRO A;  2UZR A;  1Y19 B;  4HAV B;  2DHK A;  3EPY A;  1AQC A;  2P0D A;  2ADZ A;  4HB3 B;  2RSG A;  3PZD A;  5FI0 A;  2HRJ A;  2EMT A;  2FJ9 A;  2DYQ A;  1GG3 A;  1LW3 A;  1PMS A;  2DHJ A;  4WSF A;  3P6A A;  4A6H A;  1E5W A;  1XD4 A;  2UVM A;  3AU4 A;  4A6F A;  1BAK A;  2DN6 A;  2AEH A;  2Y8G A;  1NU2 A;  3FEH A;  2N0Y A;  5JP4 A;  2G35 A;  2MFQ A;  1OMW A;  5L81 A;  4HB0 B;  4F7U P;  1MK9 B;  4NY0 A;  1U5E A;  2KCJ A;  1P5T A;  2VKI A;  4H8S A;  4C0A A;  3WA0 A;  4DXA B;  1M7E A;  4K2P A;  1ZC3 B;  1MPH A;  1UPQ A;  2VRW B;  3AJ4 A;  3WYF B;  1GC6 A;  3ODO A;  5D27 A;  2YS3 A;  5C6R A;  2RUK B;  2X18 A;  2COC A;  2DLW A;  1KI1 B;  2YRY A;  4D0N B;  2RLO A;  5KQ4 A;  1DBH A;  3PG7 A;  3PP2 A;  1FHX A;  5J3T A;  2H7D A;  1U5F A;  4KHA A;  3D8E A;  4EMO A;  1UNQ A;  2V76 A;  4GMV A;  2CY5 A;  2W2W A;  4KHB B;  3F5R A;  3F0W A;  3KZ1 A;  3G9W A;  1ACA A;  5IJM A;  1MIZ B;  3FP5 A;  3ULB A;  2D4Q A;  3UZT A;  2P0F A;  1WGU A;  1P3R A;  4KAX B;  2OQB A;  1N3H A;  3TCA A;  1QC6 A;  1QQG A;  3PVU A; 
#chains in the Genus database with same CATH topology
 2KGX B;  1ST7 A;  1OY2 A;  4HHV A;  5CLQ B;  2DYN A;  2QKM A;  2L2I A;  1NI2 A;  3ULC A;  1X1G A;  4GPT B;  1NTY A;  2WH5 A;  1KBL A;  2IFS A;  1W1D A;  2P0H A;  1H10 A;  3LJU X;  3A98 B;  3TO1 A;  2LOZ A;  4MT7 A;  3BIN A;  4ILJ A;  4EKU A;  5CLL B;  2DTC A;  4ZRK A;  5HE2 A;  1WG7 A;  2M38 A;  2NBV A;  1UNR A;  5IRS A;  5J3Y A;  2Z0P A;  4HSI A;  2EJ8 A;  4A6K A;  4P7I A;  3PVL A;  1V61 A;  2XQN M;  1GGO A;  3HIE A;  1XX0 A;  1DYN A;  2VSZ A;  2GS0 A;  3GYO A;  3O96 A;  5DHF B;  1WGQ A;  1U5G A;  4K2O A;  5C5B A;  2W2X D;  4A6F B;  2LOX A;  4GOU A;  2CAY A;  4KHO A;  3HK0 A;  5HE3 A;  2LBB A;  5HE0 A;  5FI1 A;  5DH9 B;  1DDV A;  2ELB A;  1UNP A;  1TXD A;  2DHI A;  3FSS A;  1HB6 A;  3NWF A;  2DA0 A;  2MKR A;  1GC7 A;  1WJM A;  2Y8F A;  2K2U A;  3FLV A;  3X23 A;  1BTN A;  2GCL A;  1FAO A;  2L1C A;  1H4R A;  4PQ0 A;  4F7H A;  2LKO A;  3RCP A;  1MAI A;  1MKE A;  2YT0 A;  2E2X A;  4HAY B;  3E9O A;  1B55 A;  1FGY A;  4B6H A;  1U5D A;  4YL8 A;  1MIX A;  1EGX A;  2D2Q A;  1ZVR A;  2Z59 A;  3SO6 A;  3TFM A;  4JKA A;  1OQN A;  1X11 A;  5JLJ B;  1ISN A;  2CB8 A;  4PNK A;  2Z13 A;  4HB4 B;  4L6E A;  4Y94 A;  2K49 A;  2KUP A;  4GMX B;  4JKF A;  2COA A;  2ROV A;  1MI1 A;  3KRX A;  2K2J A;  2ZKM X;  1TJ6 A;  4JKD A;  4HAZ B;  5HE1 A;  1U29 A;  2W2X C;  4JK8 A;  4HB2 B;  5JHH A;  4QJ5 B;  3SYX A;  4JK7 A;  1XR0 B;  3NSU A;  1V5U A;  4XWX A;  2RQ1 A;  1V89 A;  1BTK A;  3U8Z A;  4GN1 A;  5D3X A;  3VIA A;  4CSQ A;  4YON A;  3GYP A;  1HB8 A;  4EJN A;  2R2Y A;  1UEF A;  4DBB A;  1T77 A;  2I1K A;  2FJU B;  4HAU B;  2Z0Q A;  3A58 A;  3NWA A;  1MK7 B;  2KIG A;  1ZSQ A;  3M1I B;  3ZDT A;  1X05 A;  3MPX A;  5J3Q A;  3SNH A;  1RRP B;  4JKH A;  2CRF A;  1JDE A;  1KZ7 A;  1I2H A;  1U27 A;  2R0D A;  4MK0 A;  2YT1 A;  3SV1 A;  4DX8 A;  3U12 A;  1J19 A;  1X86 A;  2JP2 A;  1K5D B;  3TVV A;  2D9Z A;  2J0J A;  2OTX A;  1XOD A;  2KR0 A;  3HSA A;  1W1G A;  1BWN A;  2YSZ A;  1Q67 A;  2UZS A;  5C5B B;  2HE7 A;  2D9Y A;  2DKQ A;  1WJ1 A;  4IFS A;  2YF0 A;  4L1R A;  1Y5O A;  2EMS A;  3KY9 A;  1AWE A;  2LUL A;  5DI9 B;  2ELA A;  2BCJ A;  2P8V A;  5I2M A;  2D10 A;  2YS1 A;  2R09 A;  1ZYI A;  2FJL A;  5C79 A;  2J0M A;  2Q13 A;  4TKN A;  5KQ1 A;  4D6W A;  2YVC A;  4QJ4 B;  2D9W A;  2I5F A;  3B77 A;  3E9L A;  3BJI A;  4K81 A;  4IAP A;  3D8F A;  5C16 A;  4GZU A;  1FHW A;  4ILG B;  3NWD A;  1FOE A;  1M7R A;  3DXD A;  4JKC A;  2D9X A;  3U7D A;  5KCV A;  2K00 A;  2DKP A;  1KZG A;  2MWN B;  4JKG A;  3D8D A;  2LYD A;  2RGN B;  3AU5 A;  2Z0O A;  2ABD A;  4Z2M B;  5EFX A;  4HDO A;  3E9P A;  1NVL A;  3QBV B;  2COF A;  1V5M A;  3KSY A;  2GCJ A;  4JKE A;  2ROZ B;  2YT2 A;  2D11 A;  1X1F A;  1TQZ A;  4Z2N A;  2CY4 A;  2NMB A;  2DFK A;  2M14 A;  5GOW B;  3IVF A;  1WI1 A;  2NZ8 B;  1W1H A;  1EF1 A;  4F7G A;  1FHO A;  4WVF B;  3QIJ A;  2ZPY A;  3PVW A;  2FDQ A;  2KIE A;  3DCX A;  1V88 A;  1SGH A;  3OAN A;  4WJ7 A;  3VOQ A;  3DXC A;  2MDX A;  3CIK A;  4QJ3 B;  2DX5 A;  2HTH B;  2H7E A;  5LON B;  1DDM A;  1PFJ A;  3ODW A;  5LOP B;  2EC1 A;  1LB1 A;  4CHJ A;  1PLS A;  1UPR A;  3HQC A;  4JKB A;  4HDQ A;  4HAT B;  5D3V A;  1XCG A;  2Z4D A;  2KUQ A;  2AL6 A;  1HBK A;  4IOY X;  1DDW A;  4HAW B;  1NTI A;  3ODX A;  4K17 A;  3P7Z A;  4CYE A;  2I5C A;  5JHG A;  2QKL A;  1U2B A;  4ZRI A;  2RNR B;  1SHC A;  3KRW A;  2N23 A;  3MDB C;  2D9V A;  3FVC A;  4HAX B;  3A8P A;  4OT1 A;  1K5G B;  1RJ2 A;  5DHA B;  5D3Y A;  3OHM B;  1WVH A;  2IYB A;  2PZ1 A;  3A8Q A;  2DX1 A;  3PSC A;  4NSW A;  1V5P A;  4BBK A;  2GUM A;  3TW1 A;  3T06 A;  4KHB A;  4GXB A;  1XKE A;  3V5W A;  2Y7B A;  3PEG A;  4MY6 A;  3SBT A;  2R82 A;  1IRS A;  2LG1 A;  2I1J A;  4KVG B;  1VBG A;  2CQU A;  2J0K A;  1J0W A;  3ML4 A;  3SBG A;  3FM8 C;  1P6S A;  1NTV A;  1FGZ A;  5D3W A;  2GJY A;  2COP A;  4CHM A;  4JKG B;  2COD A;  1ZM0 A;  3DXE A;  4TYZ A;  3QWM A;  1FB8 A;  3CXB B;  3HW2 B;  3N7C A;  4DX9 0;  4ZRJ A;  2RVB B;  2YS5 A;  3ZVR A;  1Z87 A;  1EAZ A;  5M4Y B;  3ENB A;  4A5K A;  3SUZ A;  1EVH A;  5DIF B;  3NW8 A;  2J59 M;  5I2S A;  1ZC4 B;  1I7A A;  2K8E A;  1DRO A;  2Z14 A;  2UZR A;  1Y19 B;  4HAV B;  2DHK A;  3EPY A;  1AQC A;  2P0D A;  2ADZ A;  4HB3 B;  2RSG A;  3PZD A;  5FI0 A;  2HRJ A;  2EMT A;  2FJ9 A;  2DYQ A;  1GG3 A;  1LW3 A;  1PMS A;  2DHJ A;  2RRF A;  4WSF A;  3P6A A;  4OSN A;  4QXA B;  4ILH A;  4A6H A;  1E5W A;  1XD4 A;  2UVM A;  3AU4 A;  3E66 A;  4A6F A;  1BAK A;  2DN6 A;  2DIK A;  2AEH A;  2Y8G A;  1NU2 A;  5LG4 B;  3FEH A;  2N0Y A;  5JP4 A;  2G35 A;  2MFQ A;  1OMW A;  5L81 A;  4HB0 B;  4F7U P;  1MK9 B;  4NY0 A;  1U5E A;  2KCJ A;  1KC7 A;  1P5T A;  4GNK B;  2VKI A;  4H8S A;  4C0A A;  3WA0 A;  4DXA B;  1M7E A;  4K2P A;  1ZC3 B;  1MPH A;  4JK9 A;  1UPQ A;  2VRW B;  3AJ4 A;  3WYF B;  1GC6 A;  3ODO A;  5D27 A;  2YS3 A;  5C6R A;  2RUK B;  1DIK A;  2X18 A;  2COC A;  2DLW A;  1KI1 B;  2YRY A;  4D0N B;  2RLO A;  5KQ4 A;  1DBH A;  3PG7 A;  3PP2 A;  1FHX A;  5J3T A;  2H7D A;  1U5F A;  4KHA A;  3D8E A;  4EMO A;  1UNQ A;  2V76 A;  4GMV A;  2CY5 A;  2W2W A;  4KHB B;  3F5R A;  3F0W A;  3KZ1 A;  3G9W A;  1ACA A;  5IJM A;  1MIZ B;  2X0S A;  3FP5 A;  3ULB A;  2D4Q A;  3UZT A;  2P0F A;  1WGU A;  1VBH A;  1P3R A;  5JVL A;  4KAX B;  2OQB A;  1N3H A;  3TCA A;  1QC6 A;  4DIX A;  1QQG A;  3PVU A; 
#chains in the Genus database with same CATH homology
 2KGX B;  1ST7 A;  1OY2 A;  4HHV A;  5CLQ B;  2DYN A;  2QKM A;  2L2I A;  1NI2 A;  3ULC A;  1X1G A;  4GPT B;  1NTY A;  2WH5 A;  1KBL A;  2IFS A;  1W1D A;  2P0H A;  1H10 A;  3LJU X;  3A98 B;  3TO1 A;  2LOZ A;  4MT7 A;  3BIN A;  4ILJ A;  4EKU A;  5CLL B;  2DTC A;  4ZRK A;  5HE2 A;  1WG7 A;  2M38 A;  1UNR A;  5J3Y A;  2Z0P A;  2EJ8 A;  4A6K A;  4P7I A;  3PVL A;  1V61 A;  2XQN M;  1GGO A;  1XX0 A;  1DYN A;  2VSZ A;  2GS0 A;  3GYO A;  3O96 A;  5DHF B;  1WGQ A;  1U5G A;  4K2O A;  5C5B A;  2W2X D;  4A6F B;  2LOX A;  2CAY A;  4KHO A;  3HK0 A;  5HE3 A;  2LBB A;  5HE0 A;  5FI1 A;  5DH9 B;  1DDV A;  2ELB A;  1UNP A;  1TXD A;  2DHI A;  3FSS A;  1HB6 A;  2DA0 A;  2MKR A;  1GC7 A;  1WJM A;  2Y8F A;  2K2U A;  3FLV A;  3X23 A;  1BTN A;  2GCL A;  1FAO A;  2L1C A;  1H4R A;  4PQ0 A;  4F7H A;  2LKO A;  3RCP A;  1MAI A;  1MKE A;  2YT0 A;  2E2X A;  4HAY B;  3E9O A;  1B55 A;  1FGY A;  4B6H A;  1U5D A;  4YL8 A;  1MIX A;  1EGX A;  2D2Q A;  1ZVR A;  3SO6 A;  3TFM A;  4JKA A;  1OQN A;  1X11 A;  5JLJ B;  1ISN A;  2CB8 A;  4PNK A;  4HB4 B;  4L6E A;  4Y94 A;  2KUP A;  4GMX B;  4JKF A;  2COA A;  2ROV A;  3KRX A;  2K2J A;  1TJ6 A;  4JKD A;  4HAZ B;  5HE1 A;  1U29 A;  2W2X C;  4JK8 A;  4HB2 B;  5JHH A;  3SYX A;  4JK7 A;  1XR0 B;  3NSU A;  1V5U A;  4XWX A;  2RQ1 A;  1V89 A;  1BTK A;  3U8Z A;  4GN1 A;  5D3X A;  3VIA A;  4YON A;  3GYP A;  1HB8 A;  4EJN A;  1UEF A;  4DBB A;  2I1K A;  4HAU B;  2Z0Q A;  1MK7 B;  1ZSQ A;  3M1I B;  3ZDT A;  1X05 A;  3MPX A;  5J3Q A;  3SNH A;  1RRP B;  4JKH A;  2CRF A;  1JDE A;  1KZ7 A;  1I2H A;  1U27 A;  2R0D A;  4MK0 A;  2YT1 A;  3SV1 A;  4DX8 A;  1J19 A;  1X86 A;  2JP2 A;  1K5D B;  3TVV A;  2D9Z A;  2J0J A;  2OTX A;  1XOD A;  1W1G A;  1BWN A;  2YSZ A;  1Q67 A;  2UZS A;  5C5B B;  2HE7 A;  2D9Y A;  2DKQ A;  1WJ1 A;  4IFS A;  2YF0 A;  1Y5O A;  2EMS A;  3KY9 A;  1AWE A;  2LUL A;  5DI9 B;  2ELA A;  2BCJ A;  2P8V A;  2D10 A;  2YS1 A;  2R09 A;  5C79 A;  2FJL A;  2J0M A;  2Q13 A;  4TKN A;  5KQ1 A;  2YVC A;  2D9W A;  2I5F A;  3E9L A;  3BJI A;  4K81 A;  4IAP A;  3D8F A;  5C16 A;  4GZU A;  1FHW A;  4ILG B;  1FOE A;  1M7R A;  3DXD A;  4JKC A;  2D9X A;  3U7D A;  5KCV A;  2K00 A;  2DKP A;  1KZG A;  2MWN B;  4JKG A;  3D8D A;  2LYD A;  2RGN B;  3AU5 A;  2Z0O A;  2ABD A;  4Z2M B;  5EFX A;  4HDO A;  3E9P A;  1NVL A;  3QBV B;  2COF A;  1V5M A;  3KSY A;  2GCJ A;  4JKE A;  2ROZ B;  2D11 A;  1X1F A;  1TQZ A;  4Z2N A;  2CY4 A;  2NMB A;  2DFK A;  2M14 A;  5GOW B;  3IVF A;  1WI1 A;  2NZ8 B;  1W1H A;  1EF1 A;  4F7G A;  1FHO A;  4WVF B;  3QIJ A;  2ZPY A;  3PVW A;  2FDQ A;  1V88 A;  1SGH A;  3OAN A;  4WJ7 A;  3VOQ A;  3DXC A;  2MDX A;  3CIK A;  2DX5 A;  2HTH B;  2H7E A;  5LON B;  1DDM A;  1PFJ A;  3ODW A;  5LOP B;  2EC1 A;  1LB1 A;  4CHJ A;  1PLS A;  1UPR A;  3HQC A;  4JKB A;  4HDQ A;  4HAT B;  5D3V A;  1XCG A;  2AL6 A;  1HBK A;  4IOY X;  1DDW A;  4HAW B;  1NTI A;  3ODX A;  4K17 A;  3P7Z A;  4CYE A;  2I5C A;  5JHG A;  2QKL A;  1U2B A;  4ZRI A;  2RNR B;  1SHC A;  3KRW A;  2N23 A;  3MDB C;  2D9V A;  4HAX B;  3A8P A;  1K5G B;  1RJ2 A;  5DHA B;  5D3Y A;  1WVH A;  2IYB A;  2PZ1 A;  3A8Q A;  2DX1 A;  3PSC A;  4NSW A;  1V5P A;  4BBK A;  3TW1 A;  3T06 A;  4GXB A;  1XKE A;  3V5W A;  2Y7B A;  3PEG A;  4MY6 A;  3SBT A;  2R82 A;  1IRS A;  2LG1 A;  2I1J A;  4KVG B;  1VBG A;  2CQU A;  2J0K A;  1J0W A;  3ML4 A;  3SBG A;  3FM8 C;  1P6S A;  1NTV A;  1FGZ A;  5D3W A;  2GJY A;  2COP A;  4CHM A;  4JKG B;  2COD A;  1ZM0 A;  3DXE A;  4TYZ A;  3QWM A;  1FB8 A;  3CXB B;  3HW2 B;  3N7C A;  4DX9 0;  4ZRJ A;  2RVB B;  2YS5 A;  3ZVR A;  1Z87 A;  1EAZ A;  3ENB A;  4A5K A;  3SUZ A;  1EVH A;  5DIF B;  2J59 M;  1ZC4 B;  1I7A A;  1DRO A;  2UZR A;  1Y19 B;  4HAV B;  2DHK A;  3EPY A;  1AQC A;  2P0D A;  2ADZ A;  4HB3 B;  2RSG A;  3PZD A;  5FI0 A;  2HRJ A;  2EMT A;  2FJ9 A;  2DYQ A;  1GG3 A;  1LW3 A;  1PMS A;  2DHJ A;  4WSF A;  3P6A A;  4ILH A;  4A6H A;  1E5W A;  1XD4 A;  2UVM A;  3AU4 A;  3E66 A;  4A6F A;  1BAK A;  2DN6 A;  2DIK A;  2AEH A;  2Y8G A;  1NU2 A;  3FEH A;  2N0Y A;  5JP4 A;  2G35 A;  2MFQ A;  1OMW A;  5L81 A;  4HB0 B;  4F7U P;  1MK9 B;  4NY0 A;  1U5E A;  2KCJ A;  1KC7 A;  1P5T A;  2VKI A;  4H8S A;  4C0A A;  3WA0 A;  4DXA B;  1M7E A;  4K2P A;  1ZC3 B;  1MPH A;  4JK9 A;  1UPQ A;  2VRW B;  3AJ4 A;  3WYF B;  1GC6 A;  3ODO A;  5D27 A;  2YS3 A;  5C6R A;  2RUK B;  1DIK A;  2X18 A;  2COC A;  2DLW A;  1KI1 B;  2YRY A;  4D0N B;  2RLO A;  5KQ4 A;  1DBH A;  3PG7 A;  3PP2 A;  1FHX A;  5J3T A;  2H7D A;  1U5F A;  4KHA A;  3D8E A;  4EMO A;  1UNQ A;  2V76 A;  4GMV A;  2CY5 A;  2W2W A;  4KHB B;  3F5R A;  3F0W A;  3KZ1 A;  3G9W A;  1ACA A;  5IJM A;  1MIZ B;  2X0S A;  3FP5 A;  3ULB A;  2D4Q A;  3UZT A;  2P0F A;  1WGU A;  1VBH A;  1P3R A;  5JVL A;  4KAX B;  2OQB A;  1N3H A;  3TCA A;  1QC6 A;  1QQG A;  3PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...