1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
b'MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
4CHMA 2ZPYA 2R0DA 1I7AA 4ZRIA 4B6HA 4HAWB 1ISNA 4ZRKA 5D3WA 1UNQA 1X1GA 3ML4A 1MIXA 4D0NB 2COPA 2P0DA 4MY6A 2MWNB 2YRYA 5KQ1A 2J0KA 2AL6A 2CQUA 2ADZA 2YSZA 3AU5A 4HAYB 4YONA 2MFQA 2RSGA 5J3YA 5LOPB 2DN6A 1NVLA 1V61A 1E5WA 3TCAA 1V5PA 1ZM0A 3KZ1A 4Y94A 4TKNA 4Z2NA 2DHKA 2I1JA 1UNPA 1P5TA 4HAUB 1Y19B 4TYZA 2LULA 5C5BA 1X1FA 1Z87A 1RRPB 3UZTA 2LBBA 1PFJA 1ACAA 1MAIA 4WVFB 2K2JA 2RUKB 4EKUA 3GYOA 3HQCA 1K5GB 1OY2A 1XCGA 3DXDA 1XD4A 2DHIA 1BWNA 3HW2B 2D10A 3T06A 1TXDA 5IJMA 3FSSA 3ODXA 3TW1A 4GMXB 3OANA 4K2PA 4P7IA 2Q13A 2DYNA 4YL8A 1M7RA 2H7DA 1GG3A 4GZUA 4HB2B 5C5BB 4DX8A 3P6AA 1DYNA 2EMSA 2AEHA 2GJYA 4K81A 2MKRA 4F7HA 3GYPA 2FJ9A 1WG7A 3PSCA 2Z0QA 4XWXA 2Z0OA 4C0AA 4A6KA 1DBHA 1ST7A 2VRWB 5LONB 2D9ZA 1U2BA 4IAPA 2H7EA 1KZ7A 2KCJA 3SV1A 3FP5A 1J0WA 2M38A 3NSUA 2Y7BA 5CLLB 1PMSA 2E2XA 1FHOA 1V5UA 1ZSQA 4HB3B 2Y8GA 2D9YA 5L81A 2ROVA 1HB8A 4GXBA 1PLSA 2D4QA 2ROZB 1WJ1A 2J0MA 3U7DA 1U5FA 5DHAB 2HRJA 3IVFA 3SYXA 1DDWA 2PZ1A 4HAZB 4EMOA 2COFA 1XR0B 1MK9B 4PQ0A 1TQZA 1OMWA 2V76A 5D3XA 2RNRB 2D11A 3MDBC 4ZRJA 1IRSA 2DKPA 2UVMA 5HE0A 2COAA 3KY9A 3PVLA 4HDOA 1LW3A 2YS1A 4BBKA 2IFSA 1UPQA 1K5DB 1MKEA 2N23A 1V88A 2NMBA 1EVHA 4GMVA 4GPTB 2I1KA 3PZDA 1RJ2A 2P0FA 3PVWA 4K17A 4HDQA 1EAZA 5D27A 1Q67A 2CY4A 2CODA 3RCPA 2K2UA 3DXCA 2LOXA 2UZRA 3BINA 5J3TA 5HE3A 2DKQA 2Y8FA 2D2QA 2COCA 1KZGA 1FHWA 3PEGA 1U5EA 4KHAA 4KHBB 4CYEA 2L2IA 3M1IB 5JHGA 2EC1A 2ELBA 2K00A 2EJ8A 5KCVA 2P0HA 3CIKA 1AQCA 4DXAB 5JLJB 1UPRA 2D9WA 1NI2A 2YT1A 3O96A 3QBVB 5C79A 2NZ8B 1V89A 2W2XD 2LOZA 2EMTA 4IFSA 2HE7A 3BJIA 2BCJA 3QIJA 5C16A 1HB6A 2DX1A 3TFMA 1OQNA 3ZDTA 2WH5A 4NSWA 2XQNM 1FGYA 1FOEA 2M14A 3ULCA 1WGUA 1UEFA 1NTVA 4HHVA 1W1HA 4HAVB 3HK0A 3QWMA 2CB8A 1DDVA 1FGZA 3VIAA 3DXEA 5C6RA 2YS3A 1QQGA 2QKLA 3ULBA 4KAXB 1B55A 3G9WA 1U29A 2OTXA 3SUZA 3WA0A 3PP2A 3P7ZA 4MT7A 1M7EA 4Z2MB 2I5FA 4K2OA 4NY0A 5GOWB 2LG1A 1Y5OA 4KHOA 1V5MA 1X05A 2CRFA 1ZC4B 2GS0A 1P3RA 3ODOA 3D8FA 1WGQA 1U27A 4L6EA 4CHJA 3VOQA 2DYQA 1X86A 2X18A 2J59M 1TJ6A 2KUPA 4DBBA 1J19A 3SNHA 3AJ4A 4H8SA 1ZC3B 1MPHA 2D9XA 3V5WA 3FEHA 4F7GA 1U5GA 2DFKA 2YVCA 2CY5A 3TO1A 2W2XC 2P8VA 1BAKA 3KRWA 1GC7A 5HE1A 3LJUX 1U5DA 2DX5A 4HB4B 5J3QA 2CAYA 5D3YA 5D3VA 5DI9B 4HATB 1H10A 1P6SA 1NTIA 1NTYA 1XODA 3AU4A 2L1CA 1EGXA 1BTNA 1DROA 2GCJA 5JP4A 3U8ZA 4F7UP 4DX90 2JP2A 2UZSA 3PG7A 4MK0A 3F5RA 2RQ1A 2N0YA 2RVBB 1QC6A 2RLOA 2LYDA 2KGXB 3FLVA 4EJNA 5EFXA 2GCLA 2W2WA 2Z0PA 2IYBA 3SO6A 2RGNB 2DLWA 1MIZB 3ZVRA 1DDMA 2YT0A 4A6HA 1XX0A 4HB0B 1GC6A 3KSYA 4A6FA 1FB8A 1SHCA 3N7CA 2YF0A 1SGHA 1HBKA 2G35A 2OQBA 3F0WA 1FHXA 2YS5A 3FM8C 3WYFB 4PNKA 3A8QA 3EPYA 1MK7B 2HTHB 3D8DA 3D8EA 2LKOA 1WVHA 5HE2A 1UNRA 1X11A 2DHJA 2VSZA 1BTKA 4WJ7A 3TVVA 1H4RA 5FI1A 2ELAA 3MPXA 5DHFB 4IOYX 2ABDA 5DIFB 3KRXA 3ODWA 5DH9B 2J0JA 4A6FB 1XKEA 1EF1A 4KVGB 1I2HA 1W1GA 3CXBB 1W1DA 1WI1A 5KQ4A 3X23A 1ZVRA 5JHHA 1WJMA 5FI0A 1FAOA 2DTCA 1KI1B 1N3HA 4WSFA 4GN1A 2VKIA 2FJLA 2I5CA 3A98B 3PVUA 2D9VA 1LB1A 2QKMA 2FDQA 1NU2A 1AWEA 2R09A 2DA0A 4HAXB 2MDXA 3A8PA 4A5KA 5CLQB
chains in the Genus database with same CATH superfamily
4CHMA 2ZPYA 2R0DA 1I7AA 4ZRIA 4B6HA 4HAWB 2ZKMX 1ISNA 4ZRKA 5D3WA 1UNQA 1X1GA 3ML4A 1MIXA 4D0NB 2COPA 2P0DA 3NWAA 4MY6A 2MWNB 2YRYA 5KQ1A 3HIEA 2J0KA 4ILGB 1KBLA 2AL6A 2CQUA 2ADZA 2YSZA 3AU5A 4HAYB 4YONA 2MFQA 2RSGA 5J3YA 5LOPB 2DN6A 1NVLA 1V61A 1E5WA 3TCAA 1V5PA 1ZM0A 3KZ1A 4Y94A 2Z14A 4TKNA 4Z2NA 2DHKA 2I1JA 1UNPA 1P5TA 2KIEA 1Y19B 4HAUB 4TYZA 2LULA 4HSIA 5C5BA 1X1FA 1Z87A 1RRPB 3UZTA 2LBBA 1PFJA 1ACAA 1MAIA 4WVFB 2K2JA 2RUKB 4JKAA 4JKFA 4EKUA 3GYOA 3HQCA 1K5GB 1OY2A 1XCGA 3DXDA 1XD4A 2DHIA 1BWNA 3HW2B 2D10A 3T06A 1TXDA 5IJMA 3FSSA 3ODXA 3TW1A 4GMXB 3OANA 4K2PA 4P7IA 2Q13A 4JKCA 2DYNA 4YL8A 1M7RA 2H7DA 1GG3A 3SBTA 4GZUA 5IRSA 4HB2B 5C5BB 4DX8A 3P6AA 1DYNA 2KIGA 4ILJA 2EMSA 2AEHA 2GJYA 4K81A 2MKRA 4F7HA 3GYPA 2FJ9A 1WG7A 3PSCA 2Z0QA 4XWXA 2Z0OA 4C0AA 5LG4B 4A6KA 1DBHA 1ST7A 2VRWB 5LONB 1MI1A 2D9ZA 1U2BA 1GGOA 4IAPA 2H7EA 1KZ7A 2KCJA 3SV1A 3FP5A 1J0WA 2M38A 3NSUA 2Y7BA 4QXAB 5CLLB 1PMSA 4L1RA 4OT1A 2E2XA 1FHOA 1V5UA 1ZSQA 4HB3B 3U12A 2Y8GA 2D9YA 5L81A 2ROVA 1HB8A 2FJUB 4GXBA 1PLSA 2D4QA 2ROZB 1WJ1A 2J0MA 3U7DA 1U5FA 5DHAB 2HRJA 3IVFA 3SYXA 1DDWA 2PZ1A 4HAZB 4EMOA 2COFA 1XR0B 1MK9B 4PQ0A 1TQZA 1OMWA 2V76A 5D3XA 2RNRB 2D11A 3MDBC 4ZRJA 4OSNA 1IRSA 2DKPA 2UVMA 5HE0A 2COAA 3KY9A 3PVLA 1VBGA 4HDOA 1LW3A 2YS1A 4BBKA 2IFSA 1UPQA 4KHBA 1K5DB 2R2YA 4JKBA 1MKEA 2N23A 1V88A 2NMBA 1EVHA 4GMVA 5JVLA 4GPTB 2I1KA 3PZDA 1RJ2A 1T77A 2P0FA 3PVWA 4K17A 4HDQA 2Z4DA 1EAZA 5D27A 5I2SA 1Q67A 2CY4A 2CODA 3RCPA 2K2UA 3E9LA 2X0SA 3DXCA 2LOXA 2UZRA 4QJ4B 3BINA 5J3TA 5HE3A 2DKQA 3B77A 2Y8FA 2D2QA 2COCA 1KZGA 1FHWA 3PEGA 1U5EA 4KHAA 4KHBB 3NWDA 4CYEA 2L2IA 4D6WA 3M1IB 5JHGA 2EC1A 2ELBA 2K00A 2EJ8A 4GOUA 5KCVA 1JDEA 2P0HA 3CIKA 1AQCA 2K8EA 4DXAB 5JLJB 1VBHA 1UPRA 2D9WA 1NI2A 1ZYIA 2YT2A 2YT1A 3O96A 3QBVB 5C79A 2NZ8B 1V89A 2W2XD 2LOZA 2EMTA 4IFSA 2HE7A 3BJIA 2BCJA 3QIJA 5C16A 1HB6A 2DX1A 3TFMA 1OQNA 3ZDTA 2WH5A 4NSWA 2XQNM 1DIKA 1FGYA 1FOEA 2M14A 3ULCA 1WGUA 1UEFA 1NTVA 4HHVA 3E66A 1W1HA 4HAVB 3HK0A 4JK9A 3QWMA 2CB8A 4ILHA 1DDVA 2NBVA 1FGZA 3VIAA 3DXEA 5C6RA 2YS3A 1QQGA 2QKLA 3ULBA 4KAXB 1B55A 3G9WA 1U29A 2OTXA 3SUZA 3WA0A 3PP2A 3P7ZA 4QJ3B 4MT7A 1M7EA 4Z2MB 2I5FA 4K2OA 4NY0A 5GOWB 2LG1A 1Y5OA 4KHOA 1V5MA 1X05A 2CRFA 1ZC4B 2GS0A 1P3RA 3ODOA 2Z59A 3D8FA 1WGQA 1U27A 4L6EA 4CHJA 3OHMB 3VOQA 2DYQA 1X86A 2X18A 2J59M 1TJ6A 2KUPA 4DBBA 1J19A 3SNHA 3AJ4A 4H8SA 1ZC3B 1MPHA 2DIKA 2D9XA 3V5WA 3FEHA 4F7GA 1U5GA 2DFKA 2YVCA 2CY5A 3TO1A 2W2XC 2P8VA 4GNKB 1BAKA 3KRWA 1GC7A 5HE1A 3LJUX 1U5DA 2DX5A 4HB4B 5J3QA 3FVCA 3HSAA 2CAYA 1KC7A 5D3YA 5D3VA 5DI9B 4JKHA 4HATB 1H10A 1P6SA 1NTIA 1NTYA 1XODA 3AU4A 2L1CA 1EGXA 1BTNA 1DROA 2GCJA 5JP4A 5M4YB 3U8ZA 4F7UP 4DX90 2JP2A 2UZSA 3PG7A 4MK0A 3F5RA 2RQ1A 3E9PA 2N0YA 2RVBB 1QC6A 2RLOA 2LYDA 2KGXB 3FLVA 4EJNA 5EFXA 2GCLA 2W2WA 2Z0PA 2IYBA 3SO6A 2RGNB 2DLWA 1MIZB 3ZVRA 4JKEA 1DDMA 2YT0A 3DCXA 4A6HA 1XX0A 4HB0B 1GC6A 3KSYA 4A6FA 4QJ5B 1FB8A 1SHCA 3N7CA 2YF0A 4JK8A 1SGHA 1HBKA 2G35A 2OQBA 3F0WA 1FHXA 2YS5A 3FM8C 3WYFB 4PNKA 3A8QA 3EPYA 1MK7B 3A58A 2R82A 2HTHB 3D8DA 3D8EA 2LKOA 1WVHA 5HE2A 1UNRA 3SBGA 1X11A 2DHJA 2VSZA 1BTKA 2KR0A 4WJ7A 2RRFA 3TVVA 1H4RA 5FI1A 2ELAA 3MPXA 5DHFB 4IOYX 3NWFA 2ABDA 5DIFB 3KRXA 3ODWA 2Z13A 4JKGA 5DH9B 4CSQA 2J0JA 4A6FB 1XKEA 1EF1A 4KVGB 1I2HA 1W1GA 3CXBB 1W1DA 5I2MA 1WI1A 5KQ4A 4JKDA 3X23A 1ZVRA 3NW8A 5JHHA 1WJMA 2GUMA 2KUQA 5FI0A 1FAOA 2DTCA 1KI1B 1N3HA 4WSFA 4GN1A 2VKIA 2FJLA 3ENBA 2I5CA 3A98B 4JK7A 3PVUA 2D9VA 4JKGB 1LB1A 2QKMA 2FDQA 1NU2A 1AWEA 2R09A 2K49A 2DA0A 4HAXB 4DIXA 2MDXA 3A8PA 4A5KA 3E9OA 5CLQB
chains in the Genus database with same CATH topology
4CHMA 2ZPYA 2R0DA 1I7AA 4ZRIA 4B6HA 4HAWB 1ISNA 4ZRKA 5D3WA 1UNQA 1X1GA 3ML4A 1MIXA 4D0NB 2COPA 2P0DA 4MY6A 2MWNB 2YRYA 5KQ1A 2J0KA 4ILGB 1KBLA 2AL6A 2CQUA 2ADZA 2YSZA 3AU5A 4HAYB 4YONA 2MFQA 2RSGA 5J3YA 5LOPB 2DN6A 1NVLA 1V61A 1E5WA 3TCAA 1V5PA 1ZM0A 3KZ1A 4Y94A 4TKNA 4Z2NA 2DHKA 2I1JA 1UNPA 1P5TA 4HAUB 1Y19B 4TYZA 2LULA 5C5BA 1X1FA 1Z87A 1RRPB 3UZTA 2LBBA 1PFJA 1ACAA 1MAIA 4WVFB 2K2JA 2RUKB 4JKAA 4JKFA 4EKUA 3GYOA 3HQCA 1K5GB 1OY2A 1XCGA 3DXDA 1XD4A 2DHIA 1BWNA 3HW2B 2D10A 3T06A 1TXDA 5IJMA 3FSSA 3ODXA 3TW1A 4GMXB 3OANA 4K2PA 4P7IA 2Q13A 4JKCA 2DYNA 4YL8A 1M7RA 2H7DA 1GG3A 3SBTA 4GZUA 4HB2B 5C5BB 4DX8A 3P6AA 1DYNA 4ILJA 2EMSA 2AEHA 2GJYA 4K81A 2MKRA 4F7HA 3GYPA 2FJ9A 1WG7A 3PSCA 2Z0QA 4XWXA 2Z0OA 4C0AA 4A6KA 1DBHA 1ST7A 2VRWB 5LONB 2D9ZA 1U2BA 1GGOA 4IAPA 2H7EA 1KZ7A 2KCJA 3SV1A 3FP5A 1J0WA 2M38A 3NSUA 2Y7BA 5CLLB 1PMSA 2E2XA 1FHOA 1V5UA 1ZSQA 4HB3B 2Y8GA 2D9YA 5L81A 2ROVA 1HB8A 4GXBA 1PLSA 2D4QA 2ROZB 1WJ1A 2J0MA 3U7DA 1U5FA 5DHAB 2HRJA 3IVFA 3SYXA 1DDWA 2PZ1A 4HAZB 4EMOA 2COFA 1XR0B 1MK9B 4PQ0A 1TQZA 1OMWA 2V76A 5D3XA 2RNRB 2D11A 3MDBC 4ZRJA 1IRSA 2DKPA 2UVMA 5HE0A 2COAA 3KY9A 3PVLA 1VBGA 4HDOA 1LW3A 2YS1A 4BBKA 2IFSA 1UPQA 1K5DB 4JKBA 1MKEA 2N23A 1V88A 2NMBA 1EVHA 4GMVA 5JVLA 4GPTB 2I1KA 3PZDA 1RJ2A 2P0FA 3PVWA 4K17A 4HDQA 1EAZA 5D27A 1Q67A 2CY4A 2CODA 3RCPA 2K2UA 3E9LA 2X0SA 3DXCA 2LOXA 2UZRA 3BINA 5J3TA 5HE3A 2DKQA 2Y8FA 2D2QA 2COCA 1KZGA 1FHWA 3PEGA 1U5EA 4KHAA 4KHBB 4CYEA 2L2IA 3M1IB 5JHGA 2EC1A 2ELBA 2K00A 2EJ8A 5KCVA 1JDEA 2P0HA 3CIKA 1AQCA 4DXAB 5JLJB 1VBHA 1UPRA 2D9WA 1NI2A 2YT1A 3O96A 3QBVB 5C79A 2NZ8B 1V89A 2W2XD 2LOZA 2EMTA 4IFSA 2HE7A 3BJIA 2BCJA 3QIJA 5C16A 1HB6A 2DX1A 3TFMA 1OQNA 3ZDTA 2WH5A 4NSWA 2XQNM 1DIKA 1FGYA 1FOEA 2M14A 3ULCA 1WGUA 1UEFA 1NTVA 4HHVA 3E66A 1W1HA 4HAVB 3HK0A 4JK9A 3QWMA 2CB8A 4ILHA 1DDVA 1FGZA 3VIAA 3DXEA 5C6RA 2YS3A 1QQGA 2QKLA 3ULBA 4KAXB 1B55A 3G9WA 1U29A 2OTXA 3SUZA 3WA0A 3PP2A 3P7ZA 4MT7A 1M7EA 4Z2MB 2I5FA 4K2OA 4NY0A 5GOWB 2LG1A 1Y5OA 4KHOA 1V5MA 1X05A 2CRFA 1ZC4B 2GS0A 1P3RA 3ODOA 3D8FA 1WGQA 1U27A 4L6EA 4CHJA 3VOQA 2DYQA 1X86A 2X18A 2J59M 1TJ6A 2KUPA 4DBBA 1J19A 3SNHA 3AJ4A 4H8SA 1ZC3B 1MPHA 2DIKA 2D9XA 3V5WA 3FEHA 4F7GA 1U5GA 2DFKA 2YVCA 2CY5A 3TO1A 2W2XC 2P8VA 1BAKA 3KRWA 1GC7A 5HE1A 3LJUX 1U5DA 2DX5A 4HB4B 5J3QA 2CAYA 1KC7A 5D3YA 5D3VA 5DI9B 4JKHA 4HATB 1H10A 1P6SA 1NTIA 1NTYA 1XODA 3AU4A 2L1CA 1EGXA 1BTNA 1DROA 2GCJA 5JP4A 3U8ZA 4F7UP 4DX90 2JP2A 2UZSA 3PG7A 4MK0A 3F5RA 2RQ1A 3E9PA 2N0YA 2RVBB 1QC6A 2RLOA 2LYDA 2KGXB 3FLVA 4EJNA 5EFXA 2GCLA 2W2WA 2Z0PA 2IYBA 3SO6A 2RGNB 2DLWA 1MIZB 3ZVRA 4JKEA 1DDMA 2YT0A 4A6HA 1XX0A 4HB0B 1GC6A 3KSYA 4A6FA 1FB8A 1SHCA 3N7CA 2YF0A 4JK8A 1SGHA 1HBKA 2G35A 2OQBA 3F0WA 1FHXA 2YS5A 3FM8C 3WYFB 4PNKA 3A8QA 3EPYA 1MK7B 2R82A 2HTHB 3D8DA 3D8EA 2LKOA 1WVHA 5HE2A 1UNRA 3SBGA 1X11A 2DHJA 2VSZA 1BTKA 4WJ7A 3TVVA 1H4RA 5FI1A 2ELAA 3MPXA 5DHFB 4IOYX 2ABDA 5DIFB 3KRXA 3ODWA 4JKGA 5DH9B 2J0JA 4A6FB 1XKEA 1EF1A 4KVGB 1I2HA 1W1GA 3CXBB 1W1DA 1WI1A 5KQ4A 4JKDA 3X23A 1ZVRA 5JHHA 1WJMA 5FI0A 1FAOA 2DTCA 1KI1B 1N3HA 4WSFA 4GN1A 2VKIA 2FJLA 3ENBA 2I5CA 3A98B 4JK7A 3PVUA 2D9VA 4JKGB 1LB1A 2QKMA 2FDQA 1NU2A 1AWEA 2R09A 2DA0A 4HAXB 2MDXA 3A8PA 4A5KA 3E9OA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  2ZPY A;  2R0D A;  1I7A A;  4ZRI A;  4B6H A;  4HAW B;  1ISN A;  4ZRK A;  5D3W A;  1UNQ A;  1X1G A;  3ML4 A;  1MIX A;  4D0N B;  2COP A;  2P0D A;  4MY6 A;  2MWN B;  2YRY A;  5KQ1 A;  2J0K A;  2AL6 A;  2CQU A;  2ADZ A;  2YSZ A;  3AU5 A;  4HAY B;  4YON A;  2MFQ A;  2RSG A;  5J3Y A;  5LOP B;  2DN6 A;  1NVL A;  1V61 A;  1E5W A;  3TCA A;  1V5P A;  1ZM0 A;  3KZ1 A;  4Y94 A;  4TKN A;  4Z2N A;  2DHK A;  2I1J A;  1UNP A;  1P5T A;  4HAU B;  1Y19 B;  4TYZ A;  2LUL A;  5C5B A;  1X1F A;  1Z87 A;  1RRP B;  3UZT A;  2LBB A;  1PFJ A;  1ACA A;  1MAI A;  4WVF B;  2K2J A;  2RUK B;  4EKU A;  3GYO A;  3HQC A;  1K5G B;  1OY2 A;  1XCG A;  3DXD A;  1XD4 A;  2DHI A;  1BWN A;  3HW2 B;  2D10 A;  3T06 A;  1TXD A;  5IJM A;  3FSS A;  3ODX A;  3TW1 A;  4GMX B;  3OAN A;  4K2P A;  4P7I A;  2Q13 A;  2DYN A;  4YL8 A;  1M7R A;  2H7D A;  1GG3 A;  4GZU A;  4HB2 B;  5C5B B;  4DX8 A;  3P6A A;  1DYN A;  2EMS A;  2AEH A;  2GJY A;  4K81 A;  2MKR A;  4F7H A;  3GYP A;  2FJ9 A;  1WG7 A;  3PSC A;  2Z0Q A;  4XWX A;  2Z0O A;  4C0A A;  4A6K A;  1DBH A;  1ST7 A;  2VRW B;  5LON B;  2D9Z A;  1U2B A;  4IAP A;  2H7E A;  1KZ7 A;  2KCJ A;  3SV1 A;  3FP5 A;  1J0W A;  2M38 A;  3NSU A;  2Y7B A;  5CLL B;  1PMS A;  2E2X A;  1FHO A;  1V5U A;  1ZSQ A;  4HB3 B;  2Y8G A;  2D9Y A;  5L81 A;  2ROV A;  1HB8 A;  4GXB A;  1PLS A;  2D4Q A;  2ROZ B;  1WJ1 A;  2J0M A;  3U7D A;  1U5F A;  5DHA B;  2HRJ A;  3IVF A;  3SYX A;  1DDW A;  2PZ1 A;  4HAZ B;  4EMO A;  2COF A;  1XR0 B;  1MK9 B;  4PQ0 A;  1TQZ A;  1OMW A;  2V76 A;  5D3X A;  2RNR B;  2D11 A;  3MDB C;  4ZRJ A;  1IRS A;  2DKP A;  2UVM A;  5HE0 A;  2COA A;  3KY9 A;  3PVL A;  4HDO A;  1LW3 A;  2YS1 A;  4BBK A;  2IFS A;  1UPQ A;  1K5D B;  1MKE A;  2N23 A;  1V88 A;  2NMB A;  1EVH A;  4GMV A;  4GPT B;  2I1K A;  3PZD A;  1RJ2 A;  2P0F A;  3PVW A;  4K17 A;  4HDQ A;  1EAZ A;  5D27 A;  1Q67 A;  2CY4 A;  2COD A;  3RCP A;  2K2U A;  3DXC A;  2LOX A;  2UZR A;  3BIN A;  5J3T A;  5HE3 A;  2DKQ A;  2Y8F A;  2D2Q A;  2COC A;  1KZG A;  1FHW A;  3PEG A;  1U5E A;  4KHA A;  4KHB B;  4CYE A;  2L2I A;  3M1I B;  5JHG A;  2EC1 A;  2ELB A;  2K00 A;  2EJ8 A;  5KCV A;  2P0H A;  3CIK A;  1AQC A;  4DXA B;  5JLJ B;  1UPR A;  2D9W A;  1NI2 A;  2YT1 A;  3O96 A;  3QBV B;  5C79 A;  2NZ8 B;  1V89 A;  2W2X D;  2LOZ A;  2EMT A;  4IFS A;  2HE7 A;  3BJI A;  2BCJ A;  3QIJ A;  5C16 A;  1HB6 A;  2DX1 A;  3TFM A;  1OQN A;  3ZDT A;  2WH5 A;  4NSW A;  2XQN M;  1FGY A;  1FOE A;  2M14 A;  3ULC A;  1WGU A;  1UEF A;  1NTV A;  4HHV A;  1W1H A;  4HAV B;  3HK0 A;  3QWM A;  2CB8 A;  1DDV A;  1FGZ A;  3VIA A;  3DXE A;  5C6R A;  2YS3 A;  1QQG A;  2QKL A;  3ULB A;  4KAX B;  1B55 A;  3G9W A;  1U29 A;  2OTX A;  3SUZ A;  3WA0 A;  3PP2 A;  3P7Z A;  4MT7 A;  1M7E A;  4Z2M B;  2I5F A;  4K2O A;  4NY0 A;  5GOW B;  2LG1 A;  1Y5O A;  4KHO A;  1V5M A;  1X05 A;  2CRF A;  1ZC4 B;  2GS0 A;  1P3R A;  3ODO A;  3D8F A;  1WGQ A;  1U27 A;  4L6E A;  4CHJ A;  3VOQ A;  2DYQ A;  1X86 A;  2X18 A;  2J59 M;  1TJ6 A;  2KUP A;  4DBB A;  1J19 A;  3SNH A;  3AJ4 A;  4H8S A;  1ZC3 B;  1MPH A;  2D9X A;  3V5W A;  3FEH A;  4F7G A;  1U5G A;  2DFK A;  2YVC A;  2CY5 A;  3TO1 A;  2W2X C;  2P8V A;  1BAK A;  3KRW A;  1GC7 A;  5HE1 A;  3LJU X;  1U5D A;  2DX5 A;  4HB4 B;  5J3Q A;  2CAY A;  5D3Y A;  5D3V A;  5DI9 B;  4HAT B;  1H10 A;  1P6S A;  1NTI A;  1NTY A;  1XOD A;  3AU4 A;  2L1C A;  1EGX A;  1BTN A;  1DRO A;  2GCJ A;  5JP4 A;  3U8Z A;  4F7U P;  4DX9 0;  2JP2 A;  2UZS A;  3PG7 A;  4MK0 A;  3F5R A;  2RQ1 A;  2N0Y A;  2RVB B;  1QC6 A;  2RLO A;  2LYD A;  2KGX B;  3FLV A;  4EJN A;  5EFX A;  2GCL A;  2W2W A;  2Z0P A;  2IYB A;  3SO6 A;  2RGN B;  2DLW A;  1MIZ B;  3ZVR A;  1DDM A;  2YT0 A;  4A6H A;  1XX0 A;  4HB0 B;  1GC6 A;  3KSY A;  4A6F A;  1FB8 A;  1SHC A;  3N7C A;  2YF0 A;  1SGH A;  1HBK A;  2G35 A;  2OQB A;  3F0W A;  1FHX A;  2YS5 A;  3FM8 C;  3WYF B;  4PNK A;  3A8Q A;  3EPY A;  1MK7 B;  2HTH B;  3D8D A;  3D8E A;  2LKO A;  1WVH A;  5HE2 A;  1UNR A;  1X11 A;  2DHJ A;  2VSZ A;  1BTK A;  4WJ7 A;  3TVV A;  1H4R A;  5FI1 A;  2ELA A;  3MPX A;  5DHF B;  4IOY X;  2ABD A;  5DIF B;  3KRX A;  3ODW A;  5DH9 B;  2J0J A;  4A6F B;  1XKE A;  1EF1 A;  4KVG B;  1I2H A;  1W1G A;  3CXB B;  1W1D A;  1WI1 A;  5KQ4 A;  3X23 A;  1ZVR A;  5JHH A;  1WJM A;  5FI0 A;  1FAO A;  2DTC A;  1KI1 B;  1N3H A;  4WSF A;  4GN1 A;  2VKI A;  2FJL A;  2I5C A;  3A98 B;  3PVU A;  2D9V A;  1LB1 A;  2QKM A;  2FDQ A;  1NU2 A;  1AWE A;  2R09 A;  2DA0 A;  4HAX B;  2MDX A;  3A8P A;  4A5K A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 4CHM A;  2ZPY A;  2R0D A;  1I7A A;  4ZRI A;  4B6H A;  4HAW B;  2ZKM X;  1ISN A;  4ZRK A;  5D3W A;  1UNQ A;  1X1G A;  3ML4 A;  1MIX A;  4D0N B;  2COP A;  2P0D A;  3NWA A;  4MY6 A;  2MWN B;  2YRY A;  5KQ1 A;  3HIE A;  2J0K A;  4ILG B;  1KBL A;  2AL6 A;  2CQU A;  2ADZ A;  2YSZ A;  3AU5 A;  4HAY B;  4YON A;  2MFQ A;  2RSG A;  5J3Y A;  5LOP B;  2DN6 A;  1NVL A;  1V61 A;  1E5W A;  3TCA A;  1V5P A;  1ZM0 A;  3KZ1 A;  4Y94 A;  2Z14 A;  4TKN A;  4Z2N A;  2DHK A;  2I1J A;  1UNP A;  1P5T A;  2KIE A;  1Y19 B;  4HAU B;  4TYZ A;  2LUL A;  4HSI A;  5C5B A;  1X1F A;  1Z87 A;  1RRP B;  3UZT A;  2LBB A;  1PFJ A;  1ACA A;  1MAI A;  4WVF B;  2K2J A;  2RUK B;  4JKA A;  4JKF A;  4EKU A;  3GYO A;  3HQC A;  1K5G B;  1OY2 A;  1XCG A;  3DXD A;  1XD4 A;  2DHI A;  1BWN A;  3HW2 B;  2D10 A;  3T06 A;  1TXD A;  5IJM A;  3FSS A;  3ODX A;  3TW1 A;  4GMX B;  3OAN A;  4K2P A;  4P7I A;  2Q13 A;  4JKC A;  2DYN A;  4YL8 A;  1M7R A;  2H7D A;  1GG3 A;  3SBT A;  4GZU A;  5IRS A;  4HB2 B;  5C5B B;  4DX8 A;  3P6A A;  1DYN A;  2KIG A;  4ILJ A;  2EMS A;  2AEH A;  2GJY A;  4K81 A;  2MKR A;  4F7H A;  3GYP A;  2FJ9 A;  1WG7 A;  3PSC A;  2Z0Q A;  4XWX A;  2Z0O A;  4C0A A;  5LG4 B;  4A6K A;  1DBH A;  1ST7 A;  2VRW B;  5LON B;  1MI1 A;  2D9Z A;  1U2B A;  1GGO A;  4IAP A;  2H7E A;  1KZ7 A;  2KCJ A;  3SV1 A;  3FP5 A;  1J0W A;  2M38 A;  3NSU A;  2Y7B A;  4QXA B;  5CLL B;  1PMS A;  4L1R A;  4OT1 A;  2E2X A;  1FHO A;  1V5U A;  1ZSQ A;  4HB3 B;  3U12 A;  2Y8G A;  2D9Y A;  5L81 A;  2ROV A;  1HB8 A;  2FJU B;  4GXB A;  1PLS A;  2D4Q A;  2ROZ B;  1WJ1 A;  2J0M A;  3U7D A;  1U5F A;  5DHA B;  2HRJ A;  3IVF A;  3SYX A;  1DDW A;  2PZ1 A;  4HAZ B;  4EMO A;  2COF A;  1XR0 B;  1MK9 B;  4PQ0 A;  1TQZ A;  1OMW A;  2V76 A;  5D3X A;  2RNR B;  2D11 A;  3MDB C;  4ZRJ A;  4OSN A;  1IRS A;  2DKP A;  2UVM A;  5HE0 A;  2COA A;  3KY9 A;  3PVL A;  1VBG A;  4HDO A;  1LW3 A;  2YS1 A;  4BBK A;  2IFS A;  1UPQ A;  4KHB A;  1K5D B;  2R2Y A;  4JKB A;  1MKE A;  2N23 A;  1V88 A;  2NMB A;  1EVH A;  4GMV A;  5JVL A;  4GPT B;  2I1K A;  3PZD A;  1RJ2 A;  1T77 A;  2P0F A;  3PVW A;  4K17 A;  4HDQ A;  2Z4D A;  1EAZ A;  5D27 A;  5I2S A;  1Q67 A;  2CY4 A;  2COD A;  3RCP A;  2K2U A;  3E9L A;  2X0S A;  3DXC A;  2LOX A;  2UZR A;  4QJ4 B;  3BIN A;  5J3T A;  5HE3 A;  2DKQ A;  3B77 A;  2Y8F A;  2D2Q A;  2COC A;  1KZG A;  1FHW A;  3PEG A;  1U5E A;  4KHA A;  4KHB B;  3NWD A;  4CYE A;  2L2I A;  4D6W A;  3M1I B;  5JHG A;  2EC1 A;  2ELB A;  2K00 A;  2EJ8 A;  4GOU A;  5KCV A;  1JDE A;  2P0H A;  3CIK A;  1AQC A;  2K8E A;  4DXA B;  5JLJ B;  1VBH A;  1UPR A;  2D9W A;  1NI2 A;  1ZYI A;  2YT2 A;  2YT1 A;  3O96 A;  3QBV B;  5C79 A;  2NZ8 B;  1V89 A;  2W2X D;  2LOZ A;  2EMT A;  4IFS A;  2HE7 A;  3BJI A;  2BCJ A;  3QIJ A;  5C16 A;  1HB6 A;  2DX1 A;  3TFM A;  1OQN A;  3ZDT A;  2WH5 A;  4NSW A;  2XQN M;  1DIK A;  1FGY A;  1FOE A;  2M14 A;  3ULC A;  1WGU A;  1UEF A;  1NTV A;  4HHV A;  3E66 A;  1W1H A;  4HAV B;  3HK0 A;  4JK9 A;  3QWM A;  2CB8 A;  4ILH A;  1DDV A;  2NBV A;  1FGZ A;  3VIA A;  3DXE A;  5C6R A;  2YS3 A;  1QQG A;  2QKL A;  3ULB A;  4KAX B;  1B55 A;  3G9W A;  1U29 A;  2OTX A;  3SUZ A;  3WA0 A;  3PP2 A;  3P7Z A;  4QJ3 B;  4MT7 A;  1M7E A;  4Z2M B;  2I5F A;  4K2O A;  4NY0 A;  5GOW B;  2LG1 A;  1Y5O A;  4KHO A;  1V5M A;  1X05 A;  2CRF A;  1ZC4 B;  2GS0 A;  1P3R A;  3ODO A;  2Z59 A;  3D8F A;  1WGQ A;  1U27 A;  4L6E A;  4CHJ A;  3OHM B;  3VOQ A;  2DYQ A;  1X86 A;  2X18 A;  2J59 M;  1TJ6 A;  2KUP A;  4DBB A;  1J19 A;  3SNH A;  3AJ4 A;  4H8S A;  1ZC3 B;  1MPH A;  2DIK A;  2D9X A;  3V5W A;  3FEH A;  4F7G A;  1U5G A;  2DFK A;  2YVC A;  2CY5 A;  3TO1 A;  2W2X C;  2P8V A;  4GNK B;  1BAK A;  3KRW A;  1GC7 A;  5HE1 A;  3LJU X;  1U5D A;  2DX5 A;  4HB4 B;  5J3Q A;  3FVC A;  3HSA A;  2CAY A;  1KC7 A;  5D3Y A;  5D3V A;  5DI9 B;  4JKH A;  4HAT B;  1H10 A;  1P6S A;  1NTI A;  1NTY A;  1XOD A;  3AU4 A;  2L1C A;  1EGX A;  1BTN A;  1DRO A;  2GCJ A;  5JP4 A;  5M4Y B;  3U8Z A;  4F7U P;  4DX9 0;  2JP2 A;  2UZS A;  3PG7 A;  4MK0 A;  3F5R A;  2RQ1 A;  3E9P A;  2N0Y A;  2RVB B;  1QC6 A;  2RLO A;  2LYD A;  2KGX B;  3FLV A;  4EJN A;  5EFX A;  2GCL A;  2W2W A;  2Z0P A;  2IYB A;  3SO6 A;  2RGN B;  2DLW A;  1MIZ B;  3ZVR A;  4JKE A;  1DDM A;  2YT0 A;  3DCX A;  4A6H A;  1XX0 A;  4HB0 B;  1GC6 A;  3KSY A;  4A6F A;  4QJ5 B;  1FB8 A;  1SHC A;  3N7C A;  2YF0 A;  4JK8 A;  1SGH A;  1HBK A;  2G35 A;  2OQB A;  3F0W A;  1FHX A;  2YS5 A;  3FM8 C;  3WYF B;  4PNK A;  3A8Q A;  3EPY A;  1MK7 B;  3A58 A;  2R82 A;  2HTH B;  3D8D A;  3D8E A;  2LKO A;  1WVH A;  5HE2 A;  1UNR A;  3SBG A;  1X11 A;  2DHJ A;  2VSZ A;  1BTK A;  2KR0 A;  4WJ7 A;  2RRF A;  3TVV A;  1H4R A;  5FI1 A;  2ELA A;  3MPX A;  5DHF B;  4IOY X;  3NWF A;  2ABD A;  5DIF B;  3KRX A;  3ODW A;  2Z13 A;  4JKG A;  5DH9 B;  4CSQ A;  2J0J A;  4A6F B;  1XKE A;  1EF1 A;  4KVG B;  1I2H A;  1W1G A;  3CXB B;  1W1D A;  5I2M A;  1WI1 A;  5KQ4 A;  4JKD A;  3X23 A;  1ZVR A;  3NW8 A;  5JHH A;  1WJM A;  2GUM A;  2KUQ A;  5FI0 A;  1FAO A;  2DTC A;  1KI1 B;  1N3H A;  4WSF A;  4GN1 A;  2VKI A;  2FJL A;  3ENB A;  2I5C A;  3A98 B;  4JK7 A;  3PVU A;  2D9V A;  4JKG B;  1LB1 A;  2QKM A;  2FDQ A;  1NU2 A;  1AWE A;  2R09 A;  2K49 A;  2DA0 A;  4HAX B;  4DIX A;  2MDX A;  3A8P A;  4A5K A;  3E9O A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 4CHM A;  2ZPY A;  2R0D A;  1I7A A;  4ZRI A;  4B6H A;  4HAW B;  1ISN A;  4ZRK A;  5D3W A;  1UNQ A;  1X1G A;  3ML4 A;  1MIX A;  4D0N B;  2COP A;  2P0D A;  4MY6 A;  2MWN B;  2YRY A;  5KQ1 A;  2J0K A;  4ILG B;  1KBL A;  2AL6 A;  2CQU A;  2ADZ A;  2YSZ A;  3AU5 A;  4HAY B;  4YON A;  2MFQ A;  2RSG A;  5J3Y A;  5LOP B;  2DN6 A;  1NVL A;  1V61 A;  1E5W A;  3TCA A;  1V5P A;  1ZM0 A;  3KZ1 A;  4Y94 A;  4TKN A;  4Z2N A;  2DHK A;  2I1J A;  1UNP A;  1P5T A;  4HAU B;  1Y19 B;  4TYZ A;  2LUL A;  5C5B A;  1X1F A;  1Z87 A;  1RRP B;  3UZT A;  2LBB A;  1PFJ A;  1ACA A;  1MAI A;  4WVF B;  2K2J A;  2RUK B;  4JKA A;  4JKF A;  4EKU A;  3GYO A;  3HQC A;  1K5G B;  1OY2 A;  1XCG A;  3DXD A;  1XD4 A;  2DHI A;  1BWN A;  3HW2 B;  2D10 A;  3T06 A;  1TXD A;  5IJM A;  3FSS A;  3ODX A;  3TW1 A;  4GMX B;  3OAN A;  4K2P A;  4P7I A;  2Q13 A;  4JKC A;  2DYN A;  4YL8 A;  1M7R A;  2H7D A;  1GG3 A;  3SBT A;  4GZU A;  4HB2 B;  5C5B B;  4DX8 A;  3P6A A;  1DYN A;  4ILJ A;  2EMS A;  2AEH A;  2GJY A;  4K81 A;  2MKR A;  4F7H A;  3GYP A;  2FJ9 A;  1WG7 A;  3PSC A;  2Z0Q A;  4XWX A;  2Z0O A;  4C0A A;  4A6K A;  1DBH A;  1ST7 A;  2VRW B;  5LON B;  2D9Z A;  1U2B A;  1GGO A;  4IAP A;  2H7E A;  1KZ7 A;  2KCJ A;  3SV1 A;  3FP5 A;  1J0W A;  2M38 A;  3NSU A;  2Y7B A;  5CLL B;  1PMS A;  2E2X A;  1FHO A;  1V5U A;  1ZSQ A;  4HB3 B;  2Y8G A;  2D9Y A;  5L81 A;  2ROV A;  1HB8 A;  4GXB A;  1PLS A;  2D4Q A;  2ROZ B;  1WJ1 A;  2J0M A;  3U7D A;  1U5F A;  5DHA B;  2HRJ A;  3IVF A;  3SYX A;  1DDW A;  2PZ1 A;  4HAZ B;  4EMO A;  2COF A;  1XR0 B;  1MK9 B;  4PQ0 A;  1TQZ A;  1OMW A;  2V76 A;  5D3X A;  2RNR B;  2D11 A;  3MDB C;  4ZRJ A;  1IRS A;  2DKP A;  2UVM A;  5HE0 A;  2COA A;  3KY9 A;  3PVL A;  1VBG A;  4HDO A;  1LW3 A;  2YS1 A;  4BBK A;  2IFS A;  1UPQ A;  1K5D B;  4JKB A;  1MKE A;  2N23 A;  1V88 A;  2NMB A;  1EVH A;  4GMV A;  5JVL A;  4GPT B;  2I1K A;  3PZD A;  1RJ2 A;  2P0F A;  3PVW A;  4K17 A;  4HDQ A;  1EAZ A;  5D27 A;  1Q67 A;  2CY4 A;  2COD A;  3RCP A;  2K2U A;  3E9L A;  2X0S A;  3DXC A;  2LOX A;  2UZR A;  3BIN A;  5J3T A;  5HE3 A;  2DKQ A;  2Y8F A;  2D2Q A;  2COC A;  1KZG A;  1FHW A;  3PEG A;  1U5E A;  4KHA A;  4KHB B;  4CYE A;  2L2I A;  3M1I B;  5JHG A;  2EC1 A;  2ELB A;  2K00 A;  2EJ8 A;  5KCV A;  1JDE A;  2P0H A;  3CIK A;  1AQC A;  4DXA B;  5JLJ B;  1VBH A;  1UPR A;  2D9W A;  1NI2 A;  2YT1 A;  3O96 A;  3QBV B;  5C79 A;  2NZ8 B;  1V89 A;  2W2X D;  2LOZ A;  2EMT A;  4IFS A;  2HE7 A;  3BJI A;  2BCJ A;  3QIJ A;  5C16 A;  1HB6 A;  2DX1 A;  3TFM A;  1OQN A;  3ZDT A;  2WH5 A;  4NSW A;  2XQN M;  1DIK A;  1FGY A;  1FOE A;  2M14 A;  3ULC A;  1WGU A;  1UEF A;  1NTV A;  4HHV A;  3E66 A;  1W1H A;  4HAV B;  3HK0 A;  4JK9 A;  3QWM A;  2CB8 A;  4ILH A;  1DDV A;  1FGZ A;  3VIA A;  3DXE A;  5C6R A;  2YS3 A;  1QQG A;  2QKL A;  3ULB A;  4KAX B;  1B55 A;  3G9W A;  1U29 A;  2OTX A;  3SUZ A;  3WA0 A;  3PP2 A;  3P7Z A;  4MT7 A;  1M7E A;  4Z2M B;  2I5F A;  4K2O A;  4NY0 A;  5GOW B;  2LG1 A;  1Y5O A;  4KHO A;  1V5M A;  1X05 A;  2CRF A;  1ZC4 B;  2GS0 A;  1P3R A;  3ODO A;  3D8F A;  1WGQ A;  1U27 A;  4L6E A;  4CHJ A;  3VOQ A;  2DYQ A;  1X86 A;  2X18 A;  2J59 M;  1TJ6 A;  2KUP A;  4DBB A;  1J19 A;  3SNH A;  3AJ4 A;  4H8S A;  1ZC3 B;  1MPH A;  2DIK A;  2D9X A;  3V5W A;  3FEH A;  4F7G A;  1U5G A;  2DFK A;  2YVC A;  2CY5 A;  3TO1 A;  2W2X C;  2P8V A;  1BAK A;  3KRW A;  1GC7 A;  5HE1 A;  3LJU X;  1U5D A;  2DX5 A;  4HB4 B;  5J3Q A;  2CAY A;  1KC7 A;  5D3Y A;  5D3V A;  5DI9 B;  4JKH A;  4HAT B;  1H10 A;  1P6S A;  1NTI A;  1NTY A;  1XOD A;  3AU4 A;  2L1C A;  1EGX A;  1BTN A;  1DRO A;  2GCJ A;  5JP4 A;  3U8Z A;  4F7U P;  4DX9 0;  2JP2 A;  2UZS A;  3PG7 A;  4MK0 A;  3F5R A;  2RQ1 A;  3E9P A;  2N0Y A;  2RVB B;  1QC6 A;  2RLO A;  2LYD A;  2KGX B;  3FLV A;  4EJN A;  5EFX A;  2GCL A;  2W2W A;  2Z0P A;  2IYB A;  3SO6 A;  2RGN B;  2DLW A;  1MIZ B;  3ZVR A;  4JKE A;  1DDM A;  2YT0 A;  4A6H A;  1XX0 A;  4HB0 B;  1GC6 A;  3KSY A;  4A6F A;  1FB8 A;  1SHC A;  3N7C A;  2YF0 A;  4JK8 A;  1SGH A;  1HBK A;  2G35 A;  2OQB A;  3F0W A;  1FHX A;  2YS5 A;  3FM8 C;  3WYF B;  4PNK A;  3A8Q A;  3EPY A;  1MK7 B;  2R82 A;  2HTH B;  3D8D A;  3D8E A;  2LKO A;  1WVH A;  5HE2 A;  1UNR A;  3SBG A;  1X11 A;  2DHJ A;  2VSZ A;  1BTK A;  4WJ7 A;  3TVV A;  1H4R A;  5FI1 A;  2ELA A;  3MPX A;  5DHF B;  4IOY X;  2ABD A;  5DIF B;  3KRX A;  3ODW A;  4JKG A;  5DH9 B;  2J0J A;  4A6F B;  1XKE A;  1EF1 A;  4KVG B;  1I2H A;  1W1G A;  3CXB B;  1W1D A;  1WI1 A;  5KQ4 A;  4JKD A;  3X23 A;  1ZVR A;  5JHH A;  1WJM A;  5FI0 A;  1FAO A;  2DTC A;  1KI1 B;  1N3H A;  4WSF A;  4GN1 A;  2VKI A;  2FJL A;  3ENB A;  2I5C A;  3A98 B;  4JK7 A;  3PVU A;  2D9V A;  4JKG B;  1LB1 A;  2QKM A;  2FDQ A;  1NU2 A;  1AWE A;  2R09 A;  2DA0 A;  4HAX B;  2MDX A;  3A8P A;  4A5K A;  3E9O A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...