1MIXA

Crystal structure of a ferm domain of talin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
206
structure length
206
Chain Sequence
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Talin
total genus 62
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mixA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mixA02
5D3XA 5HE0A 4HATB 2N23A 2RGNB 2DHIA 3AU5A 5C5BA 3VOQA 2L2IA 4WJ7A 2COCA 4YONA 1V89A 2MFQA 2ABDA 2CODA 2FJLA 3D8DA 2NMBA 5DHAB 2CRFA 2V76A 3M1IB 2D9ZA 2KCJA 2WH5A 4GXBA 3PG7A 2YSZA 3F0WA 3P6AA 5DHFB 2R0DA 1FHXA 2MKRA 1EGXA 3ZDTA 5J3TA 1EVHA 2Z0OA 4HB4B 4A5KA 2YF0A 4A6FB 4DBBA 1KZGA 1QQGA 2RSGA 1V61A 2DFKA 4HDOA 1N3HA 2QKLA 1K5GB 3CXBB 2ELBA 1NI2A 2Y8FA 2DX5A 4F7HA 2HTHB 3ZVRA 2VRWB 3DXDA 2P0DA 1PFJA 2ZPYA 4L6EA 2I5FA 3RCPA 2COPA 1MK9B 2ELAA 2K00A 4K2PA 1X11A 5LOPB 4A6FA 2K2UA 2YVCA 3TO1A 1OMWA 4C0AA 2IYBA 5C79A 2DX1A 3PZDA 1ZM0A 4XWXA 5KQ1A 2CY5A 1FOEA 2ROZB 2YS3A 3FLVA 2CAYA 4NSWA 4A6HA 1GC6A 1U2BA 3EPYA 2X18A 1RRPB 1ACAA 4HB0B 1X1FA 4CHJA 2D4QA 1X05A 1FHOA 3PSCA 1HB8A 2CB8A 4HAYB 1V88A 2COFA 4PNKA 2IFSA 1P5TA 3U7DA 1XCGA 1EF1A 1GG3A 3V5WA 4GMVA 1RJ2A 1UPRA 3PVWA 1W1DA 2BCJA 1MAIA 4HAVB 5D3WA 1WI1A 2YS5A 5D3VA 4CYEA 3KY9A 3TW1A 3TVVA 2AEHA 2COAA 2LKOA 1OQNA 2M38A 3DXCA 3N7CA 1W1HA 5J3YA 2LOXA 2Z0PA 2EMSA 2MDXA 5IJMA 4DX90 2H7EA 4IAPA 1WVHA 1BWNA 4CHMA 1H10A 2YRYA 1XKEA 3KZ1A 4HHVA 1U5EA 3G9WA 2W2XC 2DTCA 3A8PA 5HE3A 4D0NB 2R09A 1DDVA 2AL6A 1OY2A 3IVFA 2EC1A 2D2QA 2LBBA 5CLQB 3SV1A 1WJ1A 2RNRB 3TFMA 2I5CA 4EMOA 4MY6A 2MWNB 3D8EA 4ZRJA 2CQUA 1NTYA 4ZRIA 2OTXA 4GN1A 3WA0A 2D11A 1XX0A 3BINA 2RUKB 1QC6A 2Y7BA 4HAUB 1J19A 4IOYX 3FP5A 2UZSA 5FI1A 3VIAA 1FB8A 1MK7B 3A8QA 4TKNA 4KHBB 4BBKA 2KGXB 3ODXA 2YT0A 4F7UP 2DHKA 4DX8A 1H4RA 3QBVB 2GCLA 3KRWA 5JHGA 1FGYA 3KSYA 5D3YA 2UZRA 4GMXB 2P0HA 4PQ0A 1MKEA 1WGQA 5JLJB 4Z2MB 1K5DB 1MIXA 4HB2B 2VKIA 1FAOA 1E5WA 1TQZA 1DROA 2CY4A 4EKUA 4ZRKA 1SGHA 1UNRA 1ZVRA 1NTIA 2D9YA 4GPTB 2DLWA 1XD4A 3HK0A 2UVMA 4Z2NA 3OANA 2DKQA 3FSSA 2LYDA 1X1GA 4H8SA 5JHHA 3PVLA 2YS1A 3F5RA 2VSZA 1U5GA 2M14A 4MT7A 5LONB 2Z0QA 2N0YA 4K81A 4KVGB 4EJNA 1J0WA 1UPQA 3D8FA 2HRJA 2K2JA 3FEHA 3SUZA 2GJYA 2ROVA 1FGZA 5KQ4A 2OQBA 4WVFB 1I2HA 1M7RA 5C6RA 3NSUA 2LOZA 3P7ZA 1DBHA 1HB6A 4HB3B 2Y8GA 2YT1A 1PMSA 1I7AA 1MPHA 4YL8A 5HE1A 1KI1B 3GYPA 1W1GA 2P0FA 4KHOA 1TJ6A 3SO6A 1DYNA 4NY0A 1Y19B 4F7GA 1NTVA 2RQ1A 5HE2A 1NVLA 4KAXB 2D10A 1XR0B 2LULA 2H7DA 3ULBA 2FJ9A 1U5FA 3ODWA 2P8VA 3FM8C 2ADZA 1X86A 3AU4A 1U29A 3TCAA 2DYQA 1Y5OA 1UNQA 1Z87A 2J0JA 5DI9B 1ZC3B 2EJ8A 3HW2B 3ODOA 4B6HA 1P3RA 1EAZA 2PZ1A 3WYFB 2DN6A 5J3QA 3LJUX 3O96A 4DXAB 1DDWA 5CLLB 1V5UA 2J0KA 1TXDA 2EMTA 1BTNA 3PVUA 5GOWB 3SNHA 3MDBC 2RVBB 1PLSA 5D27A 3A98B 5C5BB 3ULCA 1P6SA 4TYZA 2W2XD 3UZTA 2DHJA 1V5PA 1ZSQA 1KZ7A 5EFXA 2FDQA 4KHAA 2HE7A 5JP4A 3QIJA 2DKPA 2J59M 1ST7A 1B55A 1U5DA 5DH9B 3GYOA 1Q67A 2XQNM 5KCVA 1UNPA 5FI0A 4HDQA 2Q13A 3X23A 2LG1A 3HQCA 1MIZB 1UEFA 2J0MA 4K17A 1WG7A 4MK0A 3SYXA 1SHCA 4HAXB 2RLOA 5C16A 4IFSA 2L1CA 2E2XA 4HAZB 1DDMA 3PP2A 1LW3A 1XODA 1GC7A 1ZC4B 4K2OA 1LB1A 1HBKA 3U8ZA 3QWMA 1BAKA 3AJ4A 2NZ8B 1V5MA 3BJIA 1M7EA 2DYNA 4A6KA 2GCJA 2D9VA 1ISNA 5L81A 1WJMA 3KRXA 4P7IA 3DXEA 2W2WA 2I1KA 3CIKA 2G35A 4Y94A 1FHWA 2DA0A 3PEGA 2QKMA 1AQCA 3ML4A 4WSFA 1BTKA 1IRSA 2D9WA 2KUPA 2D9XA 4GZUA 2GS0A 1U27A 2JP2A 2I1JA 3T06A 3MPXA 1AWEA 5DIFB 1NU2A 1WGUA 4HAWB
chains in the Genus database with same CATH superfamily
3NW8A 5D3XA 1DIKA 5HE0A 4HATB 2N23A 2RGNB 2DHIA 3AU5A 5C5BA 3VOQA 2L2IA 4WJ7A 2COCA 4YONA 1V89A 2MFQA 2ABDA 2CODA 2FJLA 3D8DA 2NMBA 5DHAB 2CRFA 4GNKB 2V76A 2ZKMX 3M1IB 5IRSA 2D9ZA 2YT2A 3SBTA 2K49A 2KCJA 2WH5A 1VBGA 4GXBA 3PG7A 2YSZA 3F0WA 3P6AA 5DHFB 2Z13A 2R0DA 1FHXA 2MKRA 1EGXA 3ZDTA 5J3TA 3E9PA 1EVHA 2Z0OA 4GOUA 4HB4B 4A5KA 2YF0A 2FJUB 4A6FB 4DBBA 1KZGA 1QQGA 2RSGA 1V61A 2DFKA 4HDOA 1N3HA 2QKLA 1K5GB 3CXBB 2ELBA 1NI2A 2Y8FA 2DX5A 4F7HA 3E66A 2HTHB 3ZVRA 2VRWB 3DXDA 2P0DA 1PFJA 2ZPYA 4L6EA 2I5FA 4JK9A 3RCPA 4JK8A 2COPA 1MK9B 2ELAA 2K00A 4K2PA 1X11A 5LOPB 4A6FA 2K2UA 2YVCA 3TO1A 1OMWA 4C0AA 2IYBA 4QXAB 5C79A 2DX1A 3PZDA 1ZM0A 4XWXA 4JKFA 2R2YA 5KQ1A 2CY5A 1FOEA 2ROZB 2YS3A 3FLVA 2CAYA 4NSWA 3U12A 4A6HA 1GC6A 1U2BA 3EPYA 2X18A 1RRPB 1ACAA 4HB0B 1X1FA 4CHJA 2D4QA 2RRFA 2Z59A 1X05A 1FHOA 1GGOA 3PSCA 1HB8A 4JK7A 2CB8A 4HAYB 1V88A 2COFA 4ILHA 1KBLA 4PNKA 3E9LA 3B77A 2IFSA 1P5TA 3U7DA 1XCGA 1EF1A 2R82A 1GG3A 3V5WA 3FVCA 4GMVA 4JKGB 1RJ2A 1UPRA 3PVWA 1W1DA 2BCJA 4QJ3B 3SBGA 1MAIA 4HAVB 5D3WA 1WI1A 4JKAA 2YS5A 5D3VA 4CYEA 3KY9A 3TW1A 3TVVA 1MI1A 2AEHA 2COAA 2LKOA 1OQNA 2M38A 3DXCA 3N7CA 1W1HA 5J3YA 2LOXA 5I2SA 2Z0PA 2EMSA 2MDXA 5I2MA 5IJMA 4DX90 4DIXA 2H7EA 3NWFA 4IAPA 1WVHA 1BWNA 4CHMA 1H10A 2YRYA 1XKEA 3KZ1A 4HHVA 1U5EA 3G9WA 2W2XC 2DTCA 3A8PA 5HE3A 4D0NB 2R09A 2AL6A 1DDVA 1OY2A 4ILGB 2KR0A 3IVFA 2EC1A 2D2QA 2LBBA 5CLQB 3SV1A 1WJ1A 2RNRB 3TFMA 2I5CA 4KHBA 4D6WA 4EMOA 4MY6A 2MWNB 3D8EA 4ZRJA 3A58A 2CQUA 1NTYA 1VBHA 4ZRIA 2OTXA 4GN1A 3WA0A 2D11A 2Y7BA 1XX0A 3BINA 1QC6A 2RUKB 4HAUB 1J19A 4IOYX 3FP5A 2UZSA 5FI1A 3VIAA 1FB8A 1MK7B 2KIEA 4TKNA 3A8QA 4KHBB 4BBKA 2KGXB 3ODXA 2YT0A 4F7UP 5M4YB 2DHKA 4DX8A 1H4RA 3HSAA 3QBVB 2GCLA 3KRWA 5JHGA 1FGYA 3KSYA 5D3YA 2UZRA 4GMXB 2P0HA 4PQ0A 1MKEA 1WGQA 5JLJB 4Z2MB 3E9OA 1K5DB 1MIXA 4HB2B 2VKIA 1FAOA 1E5WA 1TQZA 3DCXA 1DROA 2CY4A 4EKUA 4ZRKA 1SGHA 1UNRA 1ZVRA 1NTIA 2D9YA 4GPTB 2DLWA 1XD4A 4JKGA 3HK0A 2UVMA 4Z2NA 3OANA 2DKQA 4HSIA 3FSSA 2LYDA 1X1GA 4H8SA 5JHHA 4QJ4B 3PVLA 2YS1A 3F5RA 2VSZA 4QJ5B 1U5GA 2M14A 4MT7A 5LONB 2DIKA 2Z0QA 2N0YA 4K81A 3OHMB 4KVGB 4EJNA 1J0WA 1UPQA 3D8FA 2HRJA 2K2JA 3FEHA 3SUZA 2GJYA 2ROVA 1FGZA 5KQ4A 2OQBA 4WVFB 1I2HA 1M7RA 5C6RA 3NSUA 2LOZA 3P7ZA 1DBHA 2KIGA 4ILJA 1HB6A 4HB3B 2Y8GA 2YT1A 1PMSA 1I7AA 1MPHA 4YL8A 5HE1A 1KI1B 3GYPA 1W1GA 4L1RA 1T77A 2P0FA 3NWAA 4KHOA 1TJ6A 3SO6A 1DYNA 4JKHA 4NY0A 1Y19B 4F7GA 1NTVA 2RQ1A 5HE2A 1NVLA 4KAXB 2D10A 1XR0B 4OSNA 2LULA 2H7DA 3ULBA 2FJ9A 1U5FA 3ODWA 2P8VA 4OT1A 3FM8C 2ADZA 1X86A 3AU4A 1U29A 3TCAA 2DYQA 1Y5OA 2Z14A 1UNQA 1Z87A 2J0JA 5DI9B 1ZC3B 2EJ8A 3HW2B 3ODOA 1JDEA 4B6HA 1P3RA 1EAZA 2PZ1A 5LG4B 3WYFB 2DN6A 5J3QA 3LJUX 3O96A 4DXAB 1DDWA 2K8EA 5CLLB 1V5UA 2J0KA 1TXDA 2EMTA 1BTNA 3PVUA 5GOWB 3SNHA 5JVLA 3MDBC 4JKEA 2KUQA 2RVBB 2NBVA 1PLSA 5D27A 3A98B 5C5BB 3ULCA 1P6SA 4TYZA 4CSQA 4JKDA 2W2XD 3UZTA 2DHJA 1V5PA 1ZSQA 1KZ7A 5EFXA 2FDQA 4KHAA 2HE7A 5JP4A 3QIJA 2DKPA 2J59M 3ENBA 1ST7A 1B55A 1U5DA 5DH9B 1ZYIA 3GYOA 1Q67A 2XQNM 5KCVA 1UNPA 5FI0A 3NWDA 1KC7A 4HDQA 2Q13A 3X23A 2LG1A 3HQCA 1MIZB 1UEFA 2J0MA 4K17A 1WG7A 4MK0A 3SYXA 1SHCA 4HAXB 2RLOA 5C16A 4IFSA 2L1CA 2E2XA 4HAZB 1DDMA 3PP2A 2Z4DA 1LW3A 1XODA 1GC7A 1ZC4B 4K2OA 1LB1A 2GUMA 1HBKA 4JKBA 4JKCA 3U8ZA 3QWMA 1BAKA 3AJ4A 2NZ8B 1V5MA 3BJIA 1M7EA 2X0SA 2DYNA 4A6KA 2GCJA 2D9VA 1ISNA 5L81A 3HIEA 1WJMA 3KRXA 4P7IA 3DXEA 2W2WA 2I1KA 3CIKA 2G35A 4Y94A 1FHWA 2DA0A 3PEGA 2QKMA 1AQCA 3ML4A 4WSFA 1BTKA 1IRSA 2D9WA 2KUPA 2D9XA 4GZUA 2GS0A 1U27A 2JP2A 2I1JA 3T06A 3MPXA 1AWEA 5DIFB 1NU2A 1WGUA 4HAWB
chains in the Genus database with same CATH topology
5D3XA 1DIKA 5HE0A 4HATB 2N23A 2RGNB 2DHIA 3AU5A 5C5BA 3VOQA 2L2IA 4WJ7A 2COCA 4YONA 1V89A 2MFQA 2ABDA 2CODA 2FJLA 3D8DA 2NMBA 5DHAB 2CRFA 2V76A 3M1IB 2D9ZA 3SBTA 2KCJA 2WH5A 1VBGA 4GXBA 3PG7A 2YSZA 3F0WA 3P6AA 5DHFB 2R0DA 1FHXA 2MKRA 1EGXA 3ZDTA 5J3TA 3E9PA 1EVHA 2Z0OA 4HB4B 4A5KA 2YF0A 4A6FB 4DBBA 1KZGA 1QQGA 2RSGA 1V61A 2DFKA 4HDOA 1N3HA 2QKLA 1K5GB 3CXBB 2ELBA 1NI2A 2Y8FA 2DX5A 4F7HA 3E66A 2HTHB 3ZVRA 2VRWB 3DXDA 2P0DA 1PFJA 2ZPYA 4L6EA 2I5FA 4JK9A 3RCPA 4JK8A 2COPA 1MK9B 2ELAA 2K00A 4K2PA 1X11A 5LOPB 4A6FA 2K2UA 2YVCA 3TO1A 1OMWA 4C0AA 2IYBA 5C79A 2DX1A 3PZDA 1ZM0A 4XWXA 4JKFA 5KQ1A 2CY5A 1FOEA 2ROZB 2YS3A 3FLVA 2CAYA 4NSWA 4A6HA 1GC6A 1U2BA 3EPYA 2X18A 1RRPB 1ACAA 4HB0B 1X1FA 4CHJA 2D4QA 1X05A 1FHOA 1GGOA 3PSCA 1HB8A 4JK7A 2CB8A 4HAYB 1V88A 2COFA 4ILHA 1KBLA 4PNKA 3E9LA 2IFSA 1P5TA 3U7DA 1XCGA 1EF1A 2R82A 1GG3A 3V5WA 4GMVA 4JKGB 1RJ2A 1UPRA 3PVWA 1W1DA 2BCJA 3SBGA 1MAIA 4HAVB 5D3WA 1WI1A 4JKAA 2YS5A 5D3VA 4CYEA 3KY9A 3TW1A 3TVVA 2AEHA 2COAA 2LKOA 1OQNA 2M38A 3DXCA 3N7CA 1W1HA 5J3YA 2LOXA 2Z0PA 2EMSA 2MDXA 5IJMA 4DX90 2H7EA 4IAPA 1WVHA 1BWNA 4CHMA 1H10A 2YRYA 1XKEA 3KZ1A 4HHVA 1U5EA 3G9WA 2W2XC 2DTCA 3A8PA 5HE3A 4D0NB 2R09A 2AL6A 1DDVA 1OY2A 4ILGB 3IVFA 2EC1A 2D2QA 2LBBA 5CLQB 3SV1A 1WJ1A 2RNRB 3TFMA 2I5CA 4EMOA 4MY6A 2MWNB 3D8EA 4ZRJA 2CQUA 1NTYA 1VBHA 4ZRIA 2OTXA 4GN1A 3WA0A 2D11A 2Y7BA 1XX0A 3BINA 1QC6A 2RUKB 4HAUB 1J19A 4IOYX 3FP5A 2UZSA 5FI1A 3VIAA 1FB8A 1MK7B 3A8QA 4TKNA 4KHBB 4BBKA 2KGXB 3ODXA 2YT0A 4F7UP 2DHKA 4DX8A 1H4RA 3QBVB 2GCLA 3KRWA 5JHGA 1FGYA 3KSYA 5D3YA 2UZRA 4GMXB 2P0HA 4PQ0A 1MKEA 1WGQA 5JLJB 4Z2MB 3E9OA 1K5DB 1MIXA 4HB2B 2VKIA 1FAOA 1E5WA 1TQZA 1DROA 2CY4A 4EKUA 4ZRKA 1SGHA 1UNRA 1ZVRA 1NTIA 2D9YA 4GPTB 2DLWA 1XD4A 4JKGA 3HK0A 2UVMA 4Z2NA 3OANA 2DKQA 3FSSA 2LYDA 1X1GA 4H8SA 5JHHA 3PVLA 2YS1A 3F5RA 2VSZA 1U5GA 2M14A 4MT7A 5LONB 2DIKA 2Z0QA 2N0YA 4K81A 4KVGB 4EJNA 1J0WA 1UPQA 3D8FA 2HRJA 2K2JA 3FEHA 3SUZA 2GJYA 2ROVA 1FGZA 5KQ4A 2OQBA 4WVFB 1I2HA 1M7RA 5C6RA 3NSUA 2LOZA 3P7ZA 1DBHA 4ILJA 1HB6A 4HB3B 2Y8GA 2YT1A 1PMSA 1I7AA 1MPHA 4YL8A 5HE1A 1KI1B 3GYPA 1W1GA 2P0FA 4KHOA 1TJ6A 3SO6A 1DYNA 4JKHA 4NY0A 1Y19B 4F7GA 1NTVA 2RQ1A 5HE2A 1NVLA 4KAXB 2D10A 1XR0B 2LULA 2H7DA 3ULBA 2FJ9A 1U5FA 3ODWA 2P8VA 3FM8C 2ADZA 1X86A 3AU4A 1U29A 3TCAA 2DYQA 1Y5OA 1UNQA 1Z87A 2J0JA 5DI9B 1ZC3B 2EJ8A 3HW2B 3ODOA 1JDEA 4B6HA 1P3RA 1EAZA 2PZ1A 3WYFB 2DN6A 5J3QA 3LJUX 3O96A 4DXAB 1DDWA 5CLLB 1V5UA 2J0KA 1TXDA 2EMTA 1BTNA 3PVUA 5GOWB 3SNHA 5JVLA 3MDBC 4JKEA 2RVBB 1PLSA 5D27A 3A98B 5C5BB 3ULCA 1P6SA 4TYZA 4JKDA 2W2XD 3UZTA 2DHJA 1V5PA 1ZSQA 1KZ7A 5EFXA 2FDQA 4KHAA 2HE7A 5JP4A 3QIJA 2DKPA 2J59M 3ENBA 1ST7A 1B55A 1U5DA 5DH9B 3GYOA 1Q67A 2XQNM 5KCVA 1UNPA 5FI0A 1KC7A 4HDQA 2Q13A 3X23A 2LG1A 3HQCA 1MIZB 1UEFA 2J0MA 4K17A 1WG7A 4MK0A 3SYXA 1SHCA 4HAXB 2RLOA 5C16A 4IFSA 2L1CA 2E2XA 4HAZB 1DDMA 3PP2A 1LW3A 1XODA 1GC7A 1ZC4B 4K2OA 1LB1A 1HBKA 4JKBA 4JKCA 3U8ZA 3QWMA 1BAKA 3AJ4A 2NZ8B 1V5MA 3BJIA 1M7EA 2X0SA 2DYNA 4A6KA 2GCJA 2D9VA 1ISNA 5L81A 1WJMA 3KRXA 4P7IA 3DXEA 2W2WA 2I1KA 3CIKA 2G35A 4Y94A 1FHWA 2DA0A 3PEGA 2QKMA 1AQCA 3ML4A 4WSFA 1BTKA 1IRSA 2D9WA 2KUPA 2D9XA 4GZUA 2GS0A 1U27A 2JP2A 2I1JA 3T06A 3MPXA 1AWEA 5DIFB 1NU2A 1WGUA 4HAWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3X A;  5HE0 A;  4HAT B;  2N23 A;  2RGN B;  2DHI A;  3AU5 A;  5C5B A;  3VOQ A;  2L2I A;  4WJ7 A;  2COC A;  4YON A;  1V89 A;  2MFQ A;  2ABD A;  2COD A;  2FJL A;  3D8D A;  2NMB A;  5DHA B;  2CRF A;  2V76 A;  3M1I B;  2D9Z A;  2KCJ A;  2WH5 A;  4GXB A;  3PG7 A;  2YSZ A;  3F0W A;  3P6A A;  5DHF B;  2R0D A;  1FHX A;  2MKR A;  1EGX A;  3ZDT A;  5J3T A;  1EVH A;  2Z0O A;  4HB4 B;  4A5K A;  2YF0 A;  4A6F B;  4DBB A;  1KZG A;  1QQG A;  2RSG A;  1V61 A;  2DFK A;  4HDO A;  1N3H A;  2QKL A;  1K5G B;  3CXB B;  2ELB A;  1NI2 A;  2Y8F A;  2DX5 A;  4F7H A;  2HTH B;  3ZVR A;  2VRW B;  3DXD A;  2P0D A;  1PFJ A;  2ZPY A;  4L6E A;  2I5F A;  3RCP A;  2COP A;  1MK9 B;  2ELA A;  2K00 A;  4K2P A;  1X11 A;  5LOP B;  4A6F A;  2K2U A;  2YVC A;  3TO1 A;  1OMW A;  4C0A A;  2IYB A;  5C79 A;  2DX1 A;  3PZD A;  1ZM0 A;  4XWX A;  5KQ1 A;  2CY5 A;  1FOE A;  2ROZ B;  2YS3 A;  3FLV A;  2CAY A;  4NSW A;  4A6H A;  1GC6 A;  1U2B A;  3EPY A;  2X18 A;  1RRP B;  1ACA A;  4HB0 B;  1X1F A;  4CHJ A;  2D4Q A;  1X05 A;  1FHO A;  3PSC A;  1HB8 A;  2CB8 A;  4HAY B;  1V88 A;  2COF A;  4PNK A;  2IFS A;  1P5T A;  3U7D A;  1XCG A;  1EF1 A;  1GG3 A;  3V5W A;  4GMV A;  1RJ2 A;  1UPR A;  3PVW A;  1W1D A;  2BCJ A;  1MAI A;  4HAV B;  5D3W A;  1WI1 A;  2YS5 A;  5D3V A;  4CYE A;  3KY9 A;  3TW1 A;  3TVV A;  2AEH A;  2COA A;  2LKO A;  1OQN A;  2M38 A;  3DXC A;  3N7C A;  1W1H A;  5J3Y A;  2LOX A;  2Z0P A;  2EMS A;  2MDX A;  5IJM A;  4DX9 0;  2H7E A;  4IAP A;  1WVH A;  1BWN A;  4CHM A;  1H10 A;  2YRY A;  1XKE A;  3KZ1 A;  4HHV A;  1U5E A;  3G9W A;  2W2X C;  2DTC A;  3A8P A;  5HE3 A;  4D0N B;  2R09 A;  1DDV A;  2AL6 A;  1OY2 A;  3IVF A;  2EC1 A;  2D2Q A;  2LBB A;  5CLQ B;  3SV1 A;  1WJ1 A;  2RNR B;  3TFM A;  2I5C A;  4EMO A;  4MY6 A;  2MWN B;  3D8E A;  4ZRJ A;  2CQU A;  1NTY A;  4ZRI A;  2OTX A;  4GN1 A;  3WA0 A;  2D11 A;  1XX0 A;  3BIN A;  2RUK B;  1QC6 A;  2Y7B A;  4HAU B;  1J19 A;  4IOY X;  3FP5 A;  2UZS A;  5FI1 A;  3VIA A;  1FB8 A;  1MK7 B;  3A8Q A;  4TKN A;  4KHB B;  4BBK A;  2KGX B;  3ODX A;  2YT0 A;  4F7U P;  2DHK A;  4DX8 A;  1H4R A;  3QBV B;  2GCL A;  3KRW A;  5JHG A;  1FGY A;  3KSY A;  5D3Y A;  2UZR A;  4GMX B;  2P0H A;  4PQ0 A;  1MKE A;  1WGQ A;  5JLJ B;  4Z2M B;  1K5D B;  1MIX A;  4HB2 B;  2VKI A;  1FAO A;  1E5W A;  1TQZ A;  1DRO A;  2CY4 A;  4EKU A;  4ZRK A;  1SGH A;  1UNR A;  1ZVR A;  1NTI A;  2D9Y A;  4GPT B;  2DLW A;  1XD4 A;  3HK0 A;  2UVM A;  4Z2N A;  3OAN A;  2DKQ A;  3FSS A;  2LYD A;  1X1G A;  4H8S A;  5JHH A;  3PVL A;  2YS1 A;  3F5R A;  2VSZ A;  1U5G A;  2M14 A;  4MT7 A;  5LON B;  2Z0Q A;  2N0Y A;  4K81 A;  4KVG B;  4EJN A;  1J0W A;  1UPQ A;  3D8F A;  2HRJ A;  2K2J A;  3FEH A;  3SUZ A;  2GJY A;  2ROV A;  1FGZ A;  5KQ4 A;  2OQB A;  4WVF B;  1I2H A;  1M7R A;  5C6R A;  3NSU A;  2LOZ A;  3P7Z A;  1DBH A;  1HB6 A;  4HB3 B;  2Y8G A;  2YT1 A;  1PMS A;  1I7A A;  1MPH A;  4YL8 A;  5HE1 A;  1KI1 B;  3GYP A;  1W1G A;  2P0F A;  4KHO A;  1TJ6 A;  3SO6 A;  1DYN A;  4NY0 A;  1Y19 B;  4F7G A;  1NTV A;  2RQ1 A;  5HE2 A;  1NVL A;  4KAX B;  2D10 A;  1XR0 B;  2LUL A;  2H7D A;  3ULB A;  2FJ9 A;  1U5F A;  3ODW A;  2P8V A;  3FM8 C;  2ADZ A;  1X86 A;  3AU4 A;  1U29 A;  3TCA A;  2DYQ A;  1Y5O A;  1UNQ A;  1Z87 A;  2J0J A;  5DI9 B;  1ZC3 B;  2EJ8 A;  3HW2 B;  3ODO A;  4B6H A;  1P3R A;  1EAZ A;  2PZ1 A;  3WYF B;  2DN6 A;  5J3Q A;  3LJU X;  3O96 A;  4DXA B;  1DDW A;  5CLL B;  1V5U A;  2J0K A;  1TXD A;  2EMT A;  1BTN A;  3PVU A;  5GOW B;  3SNH A;  3MDB C;  2RVB B;  1PLS A;  5D27 A;  3A98 B;  5C5B B;  3ULC A;  1P6S A;  4TYZ A;  2W2X D;  3UZT A;  2DHJ A;  1V5P A;  1ZSQ A;  1KZ7 A;  5EFX A;  2FDQ A;  4KHA A;  2HE7 A;  5JP4 A;  3QIJ A;  2DKP A;  2J59 M;  1ST7 A;  1B55 A;  1U5D A;  5DH9 B;  3GYO A;  1Q67 A;  2XQN M;  5KCV A;  1UNP A;  5FI0 A;  4HDQ A;  2Q13 A;  3X23 A;  2LG1 A;  3HQC A;  1MIZ B;  1UEF A;  2J0M A;  4K17 A;  1WG7 A;  4MK0 A;  3SYX A;  1SHC A;  4HAX B;  2RLO A;  5C16 A;  4IFS A;  2L1C A;  2E2X A;  4HAZ B;  1DDM A;  3PP2 A;  1LW3 A;  1XOD A;  1GC7 A;  1ZC4 B;  4K2O A;  1LB1 A;  1HBK A;  3U8Z A;  3QWM A;  1BAK A;  3AJ4 A;  2NZ8 B;  1V5M A;  3BJI A;  1M7E A;  2DYN A;  4A6K A;  2GCJ A;  2D9V A;  1ISN A;  5L81 A;  1WJM A;  3KRX A;  4P7I A;  3DXE A;  2W2W A;  2I1K A;  3CIK A;  2G35 A;  4Y94 A;  1FHW A;  2DA0 A;  3PEG A;  2QKM A;  1AQC A;  3ML4 A;  4WSF A;  1BTK A;  1IRS A;  2D9W A;  2KUP A;  2D9X A;  4GZU A;  2GS0 A;  1U27 A;  2JP2 A;  2I1J A;  3T06 A;  3MPX A;  1AWE A;  5DIF B;  1NU2 A;  1WGU A;  4HAW B; 
#chains in the Genus database with same CATH topology
 3NW8 A;  5D3X A;  1DIK A;  5HE0 A;  4HAT B;  2N23 A;  2RGN B;  2DHI A;  3AU5 A;  5C5B A;  3VOQ A;  2L2I A;  4WJ7 A;  2COC A;  4YON A;  1V89 A;  2MFQ A;  2ABD A;  2COD A;  2FJL A;  3D8D A;  2NMB A;  5DHA B;  2CRF A;  4GNK B;  2V76 A;  2ZKM X;  3M1I B;  5IRS A;  2D9Z A;  2YT2 A;  3SBT A;  2K49 A;  2KCJ A;  2WH5 A;  1VBG A;  4GXB A;  3PG7 A;  2YSZ A;  3F0W A;  3P6A A;  5DHF B;  2Z13 A;  2R0D A;  1FHX A;  2MKR A;  1EGX A;  3ZDT A;  5J3T A;  3E9P A;  1EVH A;  2Z0O A;  4GOU A;  4HB4 B;  4A5K A;  2YF0 A;  2FJU B;  4A6F B;  4DBB A;  1KZG A;  1QQG A;  2RSG A;  1V61 A;  2DFK A;  4HDO A;  1N3H A;  2QKL A;  1K5G B;  3CXB B;  2ELB A;  1NI2 A;  2Y8F A;  2DX5 A;  4F7H A;  3E66 A;  2HTH B;  3ZVR A;  2VRW B;  3DXD A;  2P0D A;  1PFJ A;  2ZPY A;  4L6E A;  2I5F A;  4JK9 A;  3RCP A;  4JK8 A;  2COP A;  1MK9 B;  2ELA A;  2K00 A;  4K2P A;  1X11 A;  5LOP B;  4A6F A;  2K2U A;  2YVC A;  3TO1 A;  1OMW A;  4C0A A;  2IYB A;  4QXA B;  5C79 A;  2DX1 A;  3PZD A;  1ZM0 A;  4XWX A;  4JKF A;  2R2Y A;  5KQ1 A;  2CY5 A;  1FOE A;  2ROZ B;  2YS3 A;  3FLV A;  2CAY A;  4NSW A;  3U12 A;  4A6H A;  1GC6 A;  1U2B A;  3EPY A;  2X18 A;  1RRP B;  1ACA A;  4HB0 B;  1X1F A;  4CHJ A;  2D4Q A;  2RRF A;  2Z59 A;  1X05 A;  1FHO A;  1GGO A;  3PSC A;  1HB8 A;  4JK7 A;  2CB8 A;  4HAY B;  1V88 A;  2COF A;  4ILH A;  1KBL A;  4PNK A;  3E9L A;  3B77 A;  2IFS A;  1P5T A;  3U7D A;  1XCG A;  1EF1 A;  2R82 A;  1GG3 A;  3V5W A;  3FVC A;  4GMV A;  4JKG B;  1RJ2 A;  1UPR A;  3PVW A;  1W1D A;  2BCJ A;  4QJ3 B;  3SBG A;  1MAI A;  4HAV B;  5D3W A;  1WI1 A;  4JKA A;  2YS5 A;  5D3V A;  4CYE A;  3KY9 A;  3TW1 A;  3TVV A;  1MI1 A;  2AEH A;  2COA A;  2LKO A;  1OQN A;  2M38 A;  3DXC A;  3N7C A;  1W1H A;  5J3Y A;  2LOX A;  5I2S A;  2Z0P A;  2EMS A;  2MDX A;  5I2M A;  5IJM A;  4DX9 0;  4DIX A;  2H7E A;  3NWF A;  4IAP A;  1WVH A;  1BWN A;  4CHM A;  1H10 A;  2YRY A;  1XKE A;  3KZ1 A;  4HHV A;  1U5E A;  3G9W A;  2W2X C;  2DTC A;  3A8P A;  5HE3 A;  4D0N B;  2R09 A;  2AL6 A;  1DDV A;  1OY2 A;  4ILG B;  2KR0 A;  3IVF A;  2EC1 A;  2D2Q A;  2LBB A;  5CLQ B;  3SV1 A;  1WJ1 A;  2RNR B;  3TFM A;  2I5C A;  4KHB A;  4D6W A;  4EMO A;  4MY6 A;  2MWN B;  3D8E A;  4ZRJ A;  3A58 A;  2CQU A;  1NTY A;  1VBH A;  4ZRI A;  2OTX A;  4GN1 A;  3WA0 A;  2D11 A;  2Y7B A;  1XX0 A;  3BIN A;  1QC6 A;  2RUK B;  4HAU B;  1J19 A;  4IOY X;  3FP5 A;  2UZS A;  5FI1 A;  3VIA A;  1FB8 A;  1MK7 B;  2KIE A;  4TKN A;  3A8Q A;  4KHB B;  4BBK A;  2KGX B;  3ODX A;  2YT0 A;  4F7U P;  5M4Y B;  2DHK A;  4DX8 A;  1H4R A;  3HSA A;  3QBV B;  2GCL A;  3KRW A;  5JHG A;  1FGY A;  3KSY A;  5D3Y A;  2UZR A;  4GMX B;  2P0H A;  4PQ0 A;  1MKE A;  1WGQ A;  5JLJ B;  4Z2M B;  3E9O A;  1K5D B;  1MIX A;  4HB2 B;  2VKI A;  1FAO A;  1E5W A;  1TQZ A;  3DCX A;  1DRO A;  2CY4 A;  4EKU A;  4ZRK A;  1SGH A;  1UNR A;  1ZVR A;  1NTI A;  2D9Y A;  4GPT B;  2DLW A;  1XD4 A;  4JKG A;  3HK0 A;  2UVM A;  4Z2N A;  3OAN A;  2DKQ A;  4HSI A;  3FSS A;  2LYD A;  1X1G A;  4H8S A;  5JHH A;  4QJ4 B;  3PVL A;  2YS1 A;  3F5R A;  2VSZ A;  4QJ5 B;  1U5G A;  2M14 A;  4MT7 A;  5LON B;  2DIK A;  2Z0Q A;  2N0Y A;  4K81 A;  3OHM B;  4KVG B;  4EJN A;  1J0W A;  1UPQ A;  3D8F A;  2HRJ A;  2K2J A;  3FEH A;  3SUZ A;  2GJY A;  2ROV A;  1FGZ A;  5KQ4 A;  2OQB A;  4WVF B;  1I2H A;  1M7R A;  5C6R A;  3NSU A;  2LOZ A;  3P7Z A;  1DBH A;  2KIG A;  4ILJ A;  1HB6 A;  4HB3 B;  2Y8G A;  2YT1 A;  1PMS A;  1I7A A;  1MPH A;  4YL8 A;  5HE1 A;  1KI1 B;  3GYP A;  1W1G A;  4L1R A;  1T77 A;  2P0F A;  3NWA A;  4KHO A;  1TJ6 A;  3SO6 A;  1DYN A;  4JKH A;  4NY0 A;  1Y19 B;  4F7G A;  1NTV A;  2RQ1 A;  5HE2 A;  1NVL A;  4KAX B;  2D10 A;  1XR0 B;  4OSN A;  2LUL A;  2H7D A;  3ULB A;  2FJ9 A;  1U5F A;  3ODW A;  2P8V A;  4OT1 A;  3FM8 C;  2ADZ A;  1X86 A;  3AU4 A;  1U29 A;  3TCA A;  2DYQ A;  1Y5O A;  2Z14 A;  1UNQ A;  1Z87 A;  2J0J A;  5DI9 B;  1ZC3 B;  2EJ8 A;  3HW2 B;  3ODO A;  1JDE A;  4B6H A;  1P3R A;  1EAZ A;  2PZ1 A;  5LG4 B;  3WYF B;  2DN6 A;  5J3Q A;  3LJU X;  3O96 A;  4DXA B;  1DDW A;  2K8E A;  5CLL B;  1V5U A;  2J0K A;  1TXD A;  2EMT A;  1BTN A;  3PVU A;  5GOW B;  3SNH A;  5JVL A;  3MDB C;  4JKE A;  2KUQ A;  2RVB B;  2NBV A;  1PLS A;  5D27 A;  3A98 B;  5C5B B;  3ULC A;  1P6S A;  4TYZ A;  4CSQ A;  4JKD A;  2W2X D;  3UZT A;  2DHJ A;  1V5P A;  1ZSQ A;  1KZ7 A;  5EFX A;  2FDQ A;  4KHA A;  2HE7 A;  5JP4 A;  3QIJ A;  2DKP A;  2J59 M;  3ENB A;  1ST7 A;  1B55 A;  1U5D A;  5DH9 B;  1ZYI A;  3GYO A;  1Q67 A;  2XQN M;  5KCV A;  1UNP A;  5FI0 A;  3NWD A;  1KC7 A;  4HDQ A;  2Q13 A;  3X23 A;  2LG1 A;  3HQC A;  1MIZ B;  1UEF A;  2J0M A;  4K17 A;  1WG7 A;  4MK0 A;  3SYX A;  1SHC A;  4HAX B;  2RLO A;  5C16 A;  4IFS A;  2L1C A;  2E2X A;  4HAZ B;  1DDM A;  3PP2 A;  2Z4D A;  1LW3 A;  1XOD A;  1GC7 A;  1ZC4 B;  4K2O A;  1LB1 A;  2GUM A;  1HBK A;  4JKB A;  4JKC A;  3U8Z A;  3QWM A;  1BAK A;  3AJ4 A;  2NZ8 B;  1V5M A;  3BJI A;  1M7E A;  2X0S A;  2DYN A;  4A6K A;  2GCJ A;  2D9V A;  1ISN A;  5L81 A;  3HIE A;  1WJM A;  3KRX A;  4P7I A;  3DXE A;  2W2W A;  2I1K A;  3CIK A;  2G35 A;  4Y94 A;  1FHW A;  2DA0 A;  3PEG A;  2QKM A;  1AQC A;  3ML4 A;  4WSF A;  1BTK A;  1IRS A;  2D9W A;  2KUP A;  2D9X A;  4GZU A;  2GS0 A;  1U27 A;  2JP2 A;  2I1J A;  3T06 A;  3MPX A;  1AWE A;  5DIF B;  1NU2 A;  1WGU A;  4HAW B; 
#chains in the Genus database with same CATH homology
 5D3X A;  1DIK A;  5HE0 A;  4HAT B;  2N23 A;  2RGN B;  2DHI A;  3AU5 A;  5C5B A;  3VOQ A;  2L2I A;  4WJ7 A;  2COC A;  4YON A;  1V89 A;  2MFQ A;  2ABD A;  2COD A;  2FJL A;  3D8D A;  2NMB A;  5DHA B;  2CRF A;  2V76 A;  3M1I B;  2D9Z A;  3SBT A;  2KCJ A;  2WH5 A;  1VBG A;  4GXB A;  3PG7 A;  2YSZ A;  3F0W A;  3P6A A;  5DHF B;  2R0D A;  1FHX A;  2MKR A;  1EGX A;  3ZDT A;  5J3T A;  3E9P A;  1EVH A;  2Z0O A;  4HB4 B;  4A5K A;  2YF0 A;  4A6F B;  4DBB A;  1KZG A;  1QQG A;  2RSG A;  1V61 A;  2DFK A;  4HDO A;  1N3H A;  2QKL A;  1K5G B;  3CXB B;  2ELB A;  1NI2 A;  2Y8F A;  2DX5 A;  4F7H A;  3E66 A;  2HTH B;  3ZVR A;  2VRW B;  3DXD A;  2P0D A;  1PFJ A;  2ZPY A;  4L6E A;  2I5F A;  4JK9 A;  3RCP A;  4JK8 A;  2COP A;  1MK9 B;  2ELA A;  2K00 A;  4K2P A;  1X11 A;  5LOP B;  4A6F A;  2K2U A;  2YVC A;  3TO1 A;  1OMW A;  4C0A A;  2IYB A;  5C79 A;  2DX1 A;  3PZD A;  1ZM0 A;  4XWX A;  4JKF A;  5KQ1 A;  2CY5 A;  1FOE A;  2ROZ B;  2YS3 A;  3FLV A;  2CAY A;  4NSW A;  4A6H A;  1GC6 A;  1U2B A;  3EPY A;  2X18 A;  1RRP B;  1ACA A;  4HB0 B;  1X1F A;  4CHJ A;  2D4Q A;  1X05 A;  1FHO A;  1GGO A;  3PSC A;  1HB8 A;  4JK7 A;  2CB8 A;  4HAY B;  1V88 A;  2COF A;  4ILH A;  1KBL A;  4PNK A;  3E9L A;  2IFS A;  1P5T A;  3U7D A;  1XCG A;  1EF1 A;  2R82 A;  1GG3 A;  3V5W A;  4GMV A;  4JKG B;  1RJ2 A;  1UPR A;  3PVW A;  1W1D A;  2BCJ A;  3SBG A;  1MAI A;  4HAV B;  5D3W A;  1WI1 A;  4JKA A;  2YS5 A;  5D3V A;  4CYE A;  3KY9 A;  3TW1 A;  3TVV A;  2AEH A;  2COA A;  2LKO A;  1OQN A;  2M38 A;  3DXC A;  3N7C A;  1W1H A;  5J3Y A;  2LOX A;  2Z0P A;  2EMS A;  2MDX A;  5IJM A;  4DX9 0;  2H7E A;  4IAP A;  1WVH A;  1BWN A;  4CHM A;  1H10 A;  2YRY A;  1XKE A;  3KZ1 A;  4HHV A;  1U5E A;  3G9W A;  2W2X C;  2DTC A;  3A8P A;  5HE3 A;  4D0N B;  2R09 A;  2AL6 A;  1DDV A;  1OY2 A;  4ILG B;  3IVF A;  2EC1 A;  2D2Q A;  2LBB A;  5CLQ B;  3SV1 A;  1WJ1 A;  2RNR B;  3TFM A;  2I5C A;  4EMO A;  4MY6 A;  2MWN B;  3D8E A;  4ZRJ A;  2CQU A;  1NTY A;  1VBH A;  4ZRI A;  2OTX A;  4GN1 A;  3WA0 A;  2D11 A;  2Y7B A;  1XX0 A;  3BIN A;  1QC6 A;  2RUK B;  4HAU B;  1J19 A;  4IOY X;  3FP5 A;  2UZS A;  5FI1 A;  3VIA A;  1FB8 A;  1MK7 B;  3A8Q A;  4TKN A;  4KHB B;  4BBK A;  2KGX B;  3ODX A;  2YT0 A;  4F7U P;  2DHK A;  4DX8 A;  1H4R A;  3QBV B;  2GCL A;  3KRW A;  5JHG A;  1FGY A;  3KSY A;  5D3Y A;  2UZR A;  4GMX B;  2P0H A;  4PQ0 A;  1MKE A;  1WGQ A;  5JLJ B;  4Z2M B;  3E9O A;  1K5D B;  1MIX A;  4HB2 B;  2VKI A;  1FAO A;  1E5W A;  1TQZ A;  1DRO A;  2CY4 A;  4EKU A;  4ZRK A;  1SGH A;  1UNR A;  1ZVR A;  1NTI A;  2D9Y A;  4GPT B;  2DLW A;  1XD4 A;  4JKG A;  3HK0 A;  2UVM A;  4Z2N A;  3OAN A;  2DKQ A;  3FSS A;  2LYD A;  1X1G A;  4H8S A;  5JHH A;  3PVL A;  2YS1 A;  3F5R A;  2VSZ A;  1U5G A;  2M14 A;  4MT7 A;  5LON B;  2DIK A;  2Z0Q A;  2N0Y A;  4K81 A;  4KVG B;  4EJN A;  1J0W A;  1UPQ A;  3D8F A;  2HRJ A;  2K2J A;  3FEH A;  3SUZ A;  2GJY A;  2ROV A;  1FGZ A;  5KQ4 A;  2OQB A;  4WVF B;  1I2H A;  1M7R A;  5C6R A;  3NSU A;  2LOZ A;  3P7Z A;  1DBH A;  4ILJ A;  1HB6 A;  4HB3 B;  2Y8G A;  2YT1 A;  1PMS A;  1I7A A;  1MPH A;  4YL8 A;  5HE1 A;  1KI1 B;  3GYP A;  1W1G A;  2P0F A;  4KHO A;  1TJ6 A;  3SO6 A;  1DYN A;  4JKH A;  4NY0 A;  1Y19 B;  4F7G A;  1NTV A;  2RQ1 A;  5HE2 A;  1NVL A;  4KAX B;  2D10 A;  1XR0 B;  2LUL A;  2H7D A;  3ULB A;  2FJ9 A;  1U5F A;  3ODW A;  2P8V A;  3FM8 C;  2ADZ A;  1X86 A;  3AU4 A;  1U29 A;  3TCA A;  2DYQ A;  1Y5O A;  1UNQ A;  1Z87 A;  2J0J A;  5DI9 B;  1ZC3 B;  2EJ8 A;  3HW2 B;  3ODO A;  1JDE A;  4B6H A;  1P3R A;  1EAZ A;  2PZ1 A;  3WYF B;  2DN6 A;  5J3Q A;  3LJU X;  3O96 A;  4DXA B;  1DDW A;  5CLL B;  1V5U A;  2J0K A;  1TXD A;  2EMT A;  1BTN A;  3PVU A;  5GOW B;  3SNH A;  5JVL A;  3MDB C;  4JKE A;  2RVB B;  1PLS A;  5D27 A;  3A98 B;  5C5B B;  3ULC A;  1P6S A;  4TYZ A;  4JKD A;  2W2X D;  3UZT A;  2DHJ A;  1V5P A;  1ZSQ A;  1KZ7 A;  5EFX A;  2FDQ A;  4KHA A;  2HE7 A;  5JP4 A;  3QIJ A;  2DKP A;  2J59 M;  3ENB A;  1ST7 A;  1B55 A;  1U5D A;  5DH9 B;  3GYO A;  1Q67 A;  2XQN M;  5KCV A;  1UNP A;  5FI0 A;  1KC7 A;  4HDQ A;  2Q13 A;  3X23 A;  2LG1 A;  3HQC A;  1MIZ B;  1UEF A;  2J0M A;  4K17 A;  1WG7 A;  4MK0 A;  3SYX A;  1SHC A;  4HAX B;  2RLO A;  5C16 A;  4IFS A;  2L1C A;  2E2X A;  4HAZ B;  1DDM A;  3PP2 A;  1LW3 A;  1XOD A;  1GC7 A;  1ZC4 B;  4K2O A;  1LB1 A;  1HBK A;  4JKB A;  4JKC A;  3U8Z A;  3QWM A;  1BAK A;  3AJ4 A;  2NZ8 B;  1V5M A;  3BJI A;  1M7E A;  2X0S A;  2DYN A;  4A6K A;  2GCJ A;  2D9V A;  1ISN A;  5L81 A;  1WJM A;  3KRX A;  4P7I A;  3DXE A;  2W2W A;  2I1K A;  3CIK A;  2G35 A;  4Y94 A;  1FHW A;  2DA0 A;  3PEG A;  2QKM A;  1AQC A;  3ML4 A;  4WSF A;  1BTK A;  1IRS A;  2D9W A;  2KUP A;  2D9X A;  4GZU A;  2GS0 A;  1U27 A;  2JP2 A;  2I1J A;  3T06 A;  3MPX A;  1AWE A;  5DIF B;  1NU2 A;  1WGU A;  4HAW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...