2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
3PS6A 2IY0B 2DYQA 4EJNA 5E6OA 2M17A 2X18A 2G35A 4EEWA 1GNUA 1QC6A 1MKEA 1D3ZA 2YS1A 4KIKA 2LYDA 4W9JA 3KUCB 2D9ZA 2K25A 5D3XA 3VTWA 4GSWA 2N4FA 2K1FA 4W9HA 1UNRA 2Y8FA 2KMAA 1WM2A 3V6CB 1WFYA 1YQBA 2Z59B 4XWXA 2KD0A 3QAQA 2XK5B 1TTNA 1RRPB 4KSKC 3X23A 1OMWA 1Z2MA 2VRWB 4DDGD 5G2NA 2P0FA 4KSLC 2BYFA 2MBEA 4PYZA 4I6NB 4B6WA 4HAYB 1UPQA 4GOCA 3H7PA 1LB1A 5JHAA 1ZGUB 1EGXA 3KZ1A 3TJPA 2OJRA 2JP2A 2KJHB 3QC8B 2NZ8B 4GGQA 1XX0A 5DCNA 3PGEA 2ZVNA 2MBBB 3P2BA 3VQIA 2DZJA 1VD2A 5HE1A 4FJVB 3A4SC 3TMPB 4LDTB 1V88A 4A6FA 1WGGA 2GJYA 3TCAA 1WIAA 2A4ZA 2EMSA 1UPRA 5JLJB 1V5PA 1WRDB 2BYEA 2P0DA 2FJ9A 1NTVA 2JZ3B 1WYWB 2QKMA 3OJ4B 3AU4A 3PSCA 2H7EA 4IM2A 4KHBB 2RGNB 1IYFA 3JYUA 2FCNA 4DK5A 3CMMB 2ZVOA 2LVPA 4MSQB 4W9KA 2YS3A 1WI1A 5DPWA 1WJMA 2RUKB 2B3AA 4KIKB 4BKTA 2ZCBA 2LULA 2G3QB 1EVHA 3L08A 2LRWA 3DVGY 4W9IA 2LVOA 1WX8A 1FGZA 4A3PA 4IWPA 3NSUA 5JHGA 2BCJA 3H1UA 2DZMA 5E6PA 4GDLA 4CYEA 5DHFB 4G50A 3M62B 2YT0A 4MT7A 4EZJA 3DBHI 3KRXA 1WX9A 2DX1A 2ASQA 2PE9A 4II2B 4WSFA 2M1MA 4BFRA 1HB8A 2ZNVC 2YF0A 3VUWA 2ROVA 3WAPA 2L0TA 2KNBA 1YX6B 1KLVA 2HE7A 3DOWA 3O65B 5CX3A 2JY6A 2PZ1A 5D7GA 3SYXA 2LGYA 1J8CA 2CAYA 1FB8A 5J2RA 3H7PB 3WANA 1MG8A 3SU8X 4HCNB 2EKEC 2OTXA 2BGFA 2KN5A 2EJ8A 2NBWB 3X0WA 2MCNB 2CY5A 1U27A 4AJWA 1BWNA 4HAWB 2VSZA 1V61A 4A6FB 1V6EA 3BINA 4FN2A 5HE0A 2ZPNA 3SDLC 4IUMB 3MHSD 4MDKE 2D9YA 3NZUA 1EF1A 1XT9B 2I5FA 3N32A 3B08A 1ISNA 2DAFA 5C16A 4A5KA 2JWZA 4M0WB 4GIVA 3SNHA 1ZC3B 3D8FA 3ENEA 3DDCB 2VKIA 2PEAA 3L0WB 2Z0PA 5E6NA 3QQ8B 3KYCD 1E5WA 4GDLB 1WVHA 2DN6A 4DHJB 4WWNA 4KV2A 1LFDA 3PHXB 4F7UP 1Y5OA 2RLOA 2Z0QA 2RR9A 3A33B 4J6IA 1V89A 1NTYA 2PE6B 3M1IB 4XC2A 4PNKA 1KZ7A 3QWMA 1PQSA 2Q13A 1K8RB 3ML4A 4BKGA 2G4DB 3SD5A 2IO1B 1WX7A 2KTRB 2WX0A 3AI5A 1ZC4B 1UD7A 4L6EA 1JRUA 1BTNA 3N7CA 2C60A 1P9DU 2CQUA 1X86A 1CMXB 4ANVA 2COCA 4K17A 5D6JB 2P0HA 1X05A 3PV1A 2Y5BB 2KMCA 5DH9B 4W9CA 4EFOA 4FJZA 2RSUA 1G6JA 2Y7BA 5FR6A 1B55A 1E7UA 3QHTA 2WX1A 1EO6A 1AARA 3M95A 4I6LB 2JT4B 4BKSD 4C0AA 3V62A 1TGZB 3QX1A 3PSEB 3L16A 3HM6X 2K2UA 1LQBA 3IG3A 4EOYA 1U5FA 5KCVA 1WJUA 2DKPA 3AULA 1KOTA 3A8PA 2FDQA 1UELA 1J19A 4PS8A 2W9NA 2Z0OA 2JXXA 4B95A 4HB0B 3DXCA 3U8ZA 3PEGA 2M4NA 3MJWA 3K9OB 5EFXA 3UINB 2GBMA 4EZKA 2CS4A 1WM3A 2MA9B 3DVNV 4LCDE 1WGUA 4HAUB 3RUIB 2KDBA 1ACAA 3O96A 2RGFA 2KWUB 3RCZA 3M3JA 3VDZA 2K6QA 2L76A 2DYNA 3PVLA 5CHVC 3PZDA 3ZVVA 2WDTB 1OGWA 1WY8A 1UEFA 2MWSB 1V49A 1AQCA 3APFA 3GOEA 4D0NB 2IO3B 2EMTA 3FM8C 2E2XA 3VFKA 3DBSA 2DENB 2P8VA 3OLMD 4GB9A 2NCNA 3U30A 5J18A 2ZNVB 4G3XB 1DDWA 2GCJA 2DYOA 3RT3B 3FP5A 2JPHA 2YLMA 3KH0A 2ADZA 3ZVRA 1KJTA 2BKFA 1E8ZA 3JVZX 4H8SA 2XEWA 4N9F4 1MAIA 4EUTA 3QJZA 3QCAA 4DHZE 2Y8GA 4PQ0A 5AZFA 4KAXB 3SO6A 2R09A 4ZRJA 3KUZA 2KXJA 4BBNC 4W9GA 4CO7A 4K2PA 4WJPA 2MKRA 4DBGA 3W1SC 2WWZA 4MM3A 1MK9B 1WGRA 2N23A 1OQYA 2MBHA 3UQBA 3M63B 5HE3A 3VTUA 2KOXA 2V4LA 3EPYA 3R3MA 4HVBA 3ODXA 5C23A 4PYUA 5JHHA 2J0MA 3OJ3A 2K00A 3DVNU 1KM7A 2K8BA 2J0KA 3KRWA 1SIFA 2ZPYA 1V5TA 1WGQA 4HLEA 2BWES 5DHAB 3WIMA 4F7HA 4HXDA 5DPRA 4RM8A 1W1GA 4W9LA 3HQCA 1ZM0A 3AU5A 2Z0DB 2L2IA 4DDID 2GMIC 2KC2A 1MPHA 2LXCA 4PS3A 4HPMB 2W2XC 2JRIB 4GU2A 3ML8A 3DVGX 4W9EA 4BBNF 2CODA 2YS5A 4WAAA 1J0GA 1U4AA 5IA7A 2KTFA 3MDBC 3PVWA 5JZEB 2YT1A 1YIWA 4JGHB 2CHZA 2LG1A 3ZNID 2DYMA 4FLHA 2K2JA 2GOWA 1OTRB 2ABDA 1U5DA 1WZ3A 3AXCA 4WVFB 3HK0A 4KHAA 5LXHA 5TR5A 4TQ0A 1LM8B 3EC8A 4WJOA 3WAOA 2JZZA 4MK0A 2K8HA 3VUYA 5CLQB 2KLGA 3LJUX 2NVUI 4JLCA 2RSGA 2DYBA 3VVWB 3AJ4A 4B9KA 2IFSA 2CU1A 2RD0A 4MEMA 3WA0A 3UGBB 4GMXB 4FADA 2O2VB 2DZIA 3SHQA 4IM0A 4JL9A 1E90A 2O6VA 3GYPA 4TYZA 3ODWA 4JQWC 4FA6A 1P5TA 3ZDTA 1L2NA 3H6NA 2LVQA 2ZCCA 1TQZA 3IHPC 3W1SA 3GZNI 2MSED 1TJ6A 2KVRA 4CHJA 1TBEA 2D9WA 2KTRA 3OAWA 2LGDA 2KUPA 5L95C 5D3YA 3DXEA 4GPTB 1V5UA 2FNJB 4HPLB 4GN1A 4TUUA 4IG7B 3APDA 2H7DA 3PRZA 1I2HA 1V5OA 2DHZA 2MQJA 2K6DB 2V3SA 5GOWB 3T9LA 3LJ3A 4MELA 3FLVA 2I1KA 2HD5B 1FXTB 1WE7A 3VHTC 4BOZB 2MBOA 1X1GA 1WG7A 5IAAC 2LKOA 5CLLB 2BWFA 3IVFA 1RAXA 2D07B 2GBKA 5AZGA 2HRJA 5IJMA 1RJ2A 2A5UA 3G9WA 5J3YA 4ICVA 4IFSA 3L54A 2HTHA 4ANUA 3TBLD 2NPTB 5CHFA 2LBBA 3PHWB 1WF9A 3D8EA 3P7ZA 1SE9A 4ZYNA 2CB8A 3FSSA 3DXDA 2NBVB 5JH5C 4MY6A 3TL5A 3ML9A 2C7HA 2CR5A 1Y19B 2MBQA 1VCBA 4X57B 4LDTD 2MW5A 3VTVA 1PLSA 4GDKA 2HJ8A 5BO4B 3PRPB 4NNJB 2W2WA 2O6VB 3HIZA 2KWCA 3T8MA 3PP2A 2FCQA 4F7ZA 4Z2MB 1SGHA 2K39A 1R4NI 4K81A 1H4RA 3NZSA 3PREA 4KVGB 4K7UA 1FGYA 5C79A 4KHOA 2N0YA 2D4QA 2L00B 1LXDA 3ZNZB 1WXAA 4GXBA 3ZIMA 3ZRFA 3ZNHB 1WJ6A 1DDMA 2MDXA 4MGKE 4MJSB 2CRFA 2BYVE 2KQSA 5KQ1A 2FJLA 2DA0A 1RLFA 2FIDA 3R7QA 2RQ1A 2KX3A 4NPNA 1Z87A 4G0NB 3A8QA 4IOYX 4HCPB 2AEHA 3K9PB 2LZ6A 2ZJDA 4DX8A 2UZRA 5J3TA 1RFAA 4JIOU 1GG3A 3SV1A 1T0YA 1H10A 4FBJB 3B1LX 5LLIA 1Z5SB 5JP4A 2NR2A 1V5MA 2BF8B 2Z0EB 4RMAA 4ASWC 1Q1OA 1E8WA 2J59M 2ZEQA 2DHIA 3Q3FA 3H7SA 2IO0B 2AL6A 1TXDA 2HTHB 1FHXA 1QZEA 1N3HA 2J7QB 1UBQA 4RM9A 3V5WA 4TKNA 3QWZB 2GS0A 1X11A 4AJYB 3A9KA 4HB2B 4EKUA 3P6AA 1WR6E 4HAXB 4IWOA 1WH3A 4E71A 1UNPA 4GDKB 4NQLB 5JHBA 2LI5A 4F8CB 2COFA 3D32A 5FI1A 2LRUA 1NTIA 4A20A 4MSMB 3CSFA 4K7SA 2AYOB 3CF6E 4NJ7A 3DPDA 3EECA 1XODA 1ST7A 4B6HA 2WYQA 4FHKA 2COPA 2VRRB 3TVVA 5LXIB 4FULA 2QKLA 4MGIE 4NAWA 4HATB 1PMSA 2QHOA 1Q67A 1ZKHA 1E8XA 1MIZB 3RYTA 3V61A 1M7EA 3PLUA 4DHJD 2KX0A 2V76A 1OY2A 1NU2A 1NDDA 1UGMA 2MRPA 3W1YA 1P3QU 3VOQA 3BJIA 4IW0A 2C7NB 1TZ1A 2FUHB 1V2YA 3A1QB 2KGXB 4GMVA 3JW0X 1HB6A 1FHWA 2LOXA 1ZW7A 4HK2A 2D10A 1E7VA 4E3CA 4TQ1A 4HAVB 3GYOA 4KDLB 3H9DA 1X1FA 4IC7B 1NBFC 3ZDMC 1V80A 2GBRA 4OVUA 1MK7B 3FEHA 4CHKA 1XQQA 5KQ4A 2M8SA 3APCA 5D3WA 3KUDB 2KWVB 4EMOA 3JSVA 3KVFB 1XKEA 2UVMA 3A9KB 2MFQA 2G45B 2O2VA 2MLBA 1KZGA 2LASA 1GJZA 1L7YA 3ZRCA 1P3RA 2AWTA 4ZRKA 4F7GA 4WWPA 1WI0A 5CTRC 2DFKA 3NY5A 1I42A 1P98A 3S2AA 1U5EA 1DBHA 5AEKB 1P0RA 5KHOA 2LUEA 2CY4A 1Y8RC 4HJKA 4ANXA 3I3TB 1HBKA 2N7EA 3HW2B 4Y94A 2IBIB 4GZUA 3A98B 3DQVA 4BKSA 3QK0A 4ZDVA 2W2XD 5L83A 3UIOB 4BOSC 3NHEB 3L17A 2R2OA 1WGHA 2JRHA 3ODOA 3A9JB 4DWFA 2R2QA 4NJ6A 2CKHB 4G11A 4NAWB 2KDFB 4FJYA 3UQAA 3BY4B 2L05A 2MP2A 4DHZB 3RCPA 1ZSQA 2M0XA 1KI1B 3WAMA 5D3VA 1K5DB 4DXAB 4AP4C 1W1DA 2L8JA 4K1RB 4E74A 3KYDD 2IYBA 5AZHA 4WWOA 3HM3A 1XD3B 3NOBA 2D3GA 2MWNB 1AWEA 2JUOA 2AL3A 2OQBA 4FHJA 5C1ZA 2RVBB 2JF5A 4KZ0A 1C1YB 2NMBA 1GC7A 3L10B 5DPSA 5EDSA 2KJ6A 5GMVA 2M14A 3PRMB 2XQNM 1HE8A 2WH5A 3RD2A 2NPTA 1P1AA 2ZZPB 4I6PA 2FCMA 3D8DA 2I1JA 1X1MA 4A3OA 2N1WA 2DAJA 3EFUA 3JSVB 1U29A 1WMHA 2N9XA 1XR0B 3KW5B 3CIKA 3EHVA 5D2MB 3ULCA 4M8NA 3N3KB 3DBLI 1WXVA 2EC1A 4XX5A 2OOBB 5C6RA 5DIFB 4NY0A 3V6EB 2KANA 4M8MA 3VXWA 3ZLZA 5D94A 2XBBC 3PTFC 2IY1B 3ALBA 3ZKJC 2FIFA 1WGDA 2YVCA 5J3QA 4NQKE 4WJ7A 3ULBA 2ELBA 4WQOB 2COAA 1WR1A 4HHVA 1Q5WB 2LGXA 1V81A 3ZTDA 2L0FA 4MJSA 3L13A 3RZWC 3F5RA 2KFKA 2MP2B 5DPTA 3DCGA 1OQNA 3OANA 1J0WA 1C3TA 4MH0E 4K2OA 1ZVRA 4YONA 1M7RA 4HDOA 1WXSA 5D27A 2LWPA 2REXA 2K8CA 1WJ4A 2UWQA 2V1YA 1NI2A 3F0WA 2YSZA 3NS8A 4MGYE 2DX5A 2D2QA 1SHCA 5C5BA 1S3SG 3T06A 4URKA 4IWQA 2KQ7A 2KCJA 4HDQA 1M94A 1GC6A 3ZO5B 4EZLA 1YD8U 2I5CA 3PLVA 2D9VA 4A6HA 2DLWA 1WMHB 1I35A 3ZNGC 2DZKA 2UZSA 1H8CA 3QIJA 2PPHA 4IM3A 5HE2A 1BAKA 4KZCA 2BPSA 2C9WB 4LJPB 2C7MB 1QQGA 1IP9A 2KC1A 5DI9B 2FAZA 2LXAA 2D11A 4HB4B 2L1CA 3N30A 2DTCA 2RNRB 5FI0A 4ANWA 1P6SA 4XZ4A 2IZVB 1UBIA 2GBJA 3CXBB 1F9JA 3MTNB 1FAOA 1V9JA 2KZRA 3PG7A 1LW3A 3VUXA 1UZXB 1GUAB 2DHKA 1BTKA 1UH6A 2R0DA 5LOPB 1WGYA 4NSWA 4II3B 4LJOB 1OEYJ 2KFKB 1R4MI 3KSYA 4P7IA 3U7DA 2JVCA 3TO1A 2DKQA 2YRYA 2IYDB 2KKCA 1OEYA 3VAWA 4TV3A 3PT2B 3LDZE 1PFJA 4MGZE 3UIPB 1NVLA 1Q0WB 3A1QA 4WJQA 2LJ5A 2ELAA 3TFMA 1WE6A 2L7RA 3CSTA 4W9DA 3UZTA 3R66C 2MX2A 3VIAA 4PS7A 4AUQC 2ROZB 4OVVA 4AOFA 2KO3A 2N7DA 4HWIB 2UYZB 2KLCA 3PPAA 4HAZB 3QA8A 2NS5A 3RULA 2DX5B 2CHXA 5CHWA 2LOZA 5C5BB 2J0JA 2D9XA 4BBKA 2KFJA 3VH4B 2KHWB 2GBNA 2KK8A 3ECIA 4HB3B 2L3ZA 1EUVB 4A6KA 1XD4A 3Q3JA 1FOEA 1RRBA 4WJNA 4YL8A 4ZRIA 1WZ0A 3B0AA 4DX90 3WYFB 2N1VA 1S1QB 1FHOA 3MPXA 1EF5A 4DBBA 4K7WA 3R7RA 2CHWA 5KHQA 1EAZA 3PVUA 2PJHA 2XK5A 3A4RA 3ONSA 2RPQA 3IFWB 4W9FA 3V60A 1UNQA 1A5RA 1XCGA 3ZTCA 1DDVA 5G55A 3A9JA 3ZW3A 1U5GA 3KY9A 5J17A 2C5LC 4AWJA 3WALA 3DBRI 1IRSA 4ICUA 1I7AA 2NBUA 3VH3B 3HHMA 3QBVB 2LD9A 2KJRA 1YX5B 4CHMA 1E8YA 5L81A 1WXMA 1IPGA 2GCLA 4IAPA 3RZFA 3ZUNA 2O6VD 2G4SA 1U2BA 4KDIC 2BKRB 1MIXA 2DHJA 2KDEB 3IBEA 3SUZA 3TIXA 2FCSA 2M38A 5HKHA 1K5GB 3C0RB 1WJNA 1DROA 5LONB 2IO2B 4Z2NA 1W1HA 1BT0A 4F1SA 1YJ1A 2N9PC 4BVUC 1DYNA 3QARA 3UF8A 2KDIA 2N9EB 3TW1A 1V86A 1WJ1A
chains in the Genus database with same CATH superfamily
4R3DA 3PS6A 3P4RB 2IY0B 4KHBA 2DYQA 4EJNA 3AEGB 5E6OA 1IGDA 2ZKMX 3FKYA 2M17A 2X18A 2G35A 4EEWA 1GNUA 1QC6A 1MKEA 1D3ZA 2YS1A 5IP4D 2SAKA 1JMLA 4KIKA 2LYDA 2R82A 4KGSA 4W9JA 3KUCB 1PGBA 2D9ZA 2K25A 5D3XA 3VTWA 4GSWA 4OT1A 1C76A 2N4FA 2K1FA 4W9HA 4YWGG 1FNWA 1UNRA 2Y8FA 2D3BA 2KMAA 1WM2A 1AYFA 3V6CB 3GS2A 1WFYA 1JWUD 1YQBA 2Z59B 4XWXA 2CJOA 2KD0A 3Q8FA 2XK5B 3QAQA 1TTNA 5HI1A 1RRPB 2X38A 4B0MA 3IT4B 4KSKC 2W82A 3V3XA 3X23A 1OMWA 1Z2MA 2VRWB 4DDGD 5G2NA 4OHJA 5FKAC 4YTNB 2P0FA 4KSLC 2BYFA 4M00A 3U7ZA 1ZDXA 2MBEA 4PYZA 4I6NB 4B6WA 4HAYB 1UPQA 1YQ4B 4GOCA 3H7PA 1XCQL 4C00A 2Y5CA 4YXDB 1F1HA 1LB1A 5JHAA 1ZGUB 1EGXA 4KKJA 3LYYA 4RGOS 3KZ1A 2WXLA 1XLQA 1WWTA 3TJPA 2OJRA 2JP2A 2KJHB 3QC8B 2NZ8B 4GGQA 1XX0A 1MFWA 5DCNA 4BAXA 3PGEA 3U52E 2NMQA 3Q8EA 2J4XA 2ZVNA 2MBBB 3P2BA 3VQIA 1QOFA 1MHHE 1V8CA 3ZYYX 2DZJA 1VD2A 5HE1A 2GRIA 4FJVB 3A4SC 1BUIC 3TEXA 3TMPB 1VZ7A 4LDTB 2PLPA 1V88A 4A6FA 1WGGA 2GJYA 3TCAA 1LGRA 1TY0A 1WIAA 5M4YB 2A4ZA 3O13A 2EMSA 1UPRA 5JLJB 1V5PA 2MJ3A 2WNMA 3AE1B 1WRDB 2BYEA 2P0DA 1I4RA 2FJ9A 1NTVA 1PGAA 4RCOA 3E66A 2JZ3B 1RFKA 1WYWB 2QKMA 3OJ4B 2WXPA 3AU4A 4LNOA 3PSCA 4DIXA 2H7EA 4M0WA 3NZ3A 4IM2A 4KHBB 1B9RA 2RGNB 1IYFA 3JYUA 2FCNA 4DK5A 3CMMB 4ILJA 2ZVOA 2LVPA 1SB3C 4MSQB 4W9KA 3ZQ4A 2YS3A 1WI1A 5DPWA 1WJMA 2RUKB 2B3AA 4KIKB 4BKTA 2ZCBA 2LULA 2G3QB 5JVLA 1EVHA 4GOUA 3L08A 2LRWA 3DVGY 4ZRQA 4W9IA 2LVOA 1WX8A 1FGZA 4A3PA 4IWPA 3NSUA 5JHGA 1FXIA 2BCJA 3H1UA 2DZMA 4L23A 4GDLA 4US9A 5E6PA 3RNCC 4CYEA 5DHFB 1Q10A 4G50A 3M62B 2YT0A 4MT7A 2WDVB 4EZJA 3DBHI 3KRXA 1WX9A 4A90A 2DX1A 4P6VF 2ASQA 2PE9A 4II2B 4L1RA 4N59A 4WSFA 2M1MA 1V1PA 4BFRA 1HB8A 2ZNVC 2YF0A 3VUWA 1OQQA 2ROVA 3WAPA 1CK1A 2KNBA 2L0TA 1YX6B 1KLVA 2HE7A 2KACA 3DOWA 2K49A 3O65B 1TS5A 5CX3A 4QJ5B 2PZ1A 2JY6A 4A55A 5C3JB 5D7GA 3SYXA 3GP7A 2LGYA 4A8XC 1J8CA 2CU3A 2CAYA 1FB8A 5J2RA 3H7PB 3WANA 2KR0A 2KDMA 3TUOA 1MG8A 4TMAB 3I63C 3SU8X 4O1NA 4HCNB 2EKEC 2OTXA 3ZJVA 1YOVB 2BGFA 4XGAB 2KN5A 2EJ8A 1TKYA 4P16A 1E0ZA 2NBWB 3X0WA 2MCNB 2CY5A 1U27A 4AJWA 3NWAA 2X8XX 2VH1A 4LNNA 1BWNA 4HAWB 2VSZA 1YJJA 1V61A 3NW8A 4A6FB 1V6EA 3BINA 4FN2A 4QAYA 1N60A 3AB5A 5HE0A 2ZPNA 3SDLC 4IUMB 3MHSD 3RNFC 4MDKE 2D9YA 3NZUA 1EF1A 1XT9B 1GB1A 2I5FA 3N32A 4YSYB 4JKHA 3B08A 4OZAA 1ISNA 2DAFA 2W3RA 5C16A 4A5KA 2JWZA 4M0WB 1HXYD 4GIVA 2K3UA 2MHJA 1VZ6A 3SNHA 1ZC3B 4D6WA 3D8FA 4LLGM 3ENEA 1QOGA 3DDCB 2VKIA 2PEAA 3LB8C 3AMZA 3L0WB 3SFDB 2BS2B 1ZYIA 3LXFA 5FK9C 2Q5WD 2Z0PA 4USAA 5E6NA 2BT6A 3QQ8B 3KYCD 1PYWD 1E5WA 4GDLB 1WVHA 2DN6A 3NG0A 2WXNA 2R2YA 1JALA 2V3NA 4DHJB 1EWCA 4WWNA 4KV2A 1LFDA 2ACZB 2LGSA 3PHXB 4F7UP 1ROEA 3Q14C 3MC8A 1Y5OA 2PW9A 4AS1A 3SEBA 2RLOA 2Z0QA 2K9XA 2RR9A 3A33B 1V1PB 4J6IA 1V89A 3AE5B 1NTYA 2PE6B 3M1IB 2AQ2B 4XC2A 4PNKA 1KZ7A 3QWMA 2H88B 3ZXVA 1JQ4A 1PQSA 3HVZA 4K3BA 2Q13A 1K8RB 3ML4A 4BKGA 1T0QC 5G5HA 4L2YA 3N1YC 2G4DB 1C4PA 3SD5A 2IO1B 4H2AA 5TSSA 1TKEA 4RGMA 1WX7A 2KTRB 2WX0A 3AI5A 1ZC4B 1UD7A 1YN3A 1T0SC 4L6EA 4KX6B 2INNE 1JRUA 1BTNA 3N7CA 2C60A 1P9DU 1OFFA 4IKGA 2CQUA 1X86A 2KAJA 1KLGD 1CMXB 1CZPA 4ANVA 1ZE3D 2COCA 4K17A 2QIEB 5D6JB 3URYA 3AECB 2P0HA 1X05A 1SXTA 3PV1A 2Y5BB 2KMCA 5DH9B 3DBLB 4W9CA 4EFOA 4FJZA 1L6VA 4XE0A 1TYGB 2RSUA 1G6JA 2Y7BA 3U12A 5FR6A 1B55A 2HDEA 1E7UA 3QHTA 2WX1A 1VBHA 3NS1A 1EO6A 3GZNB 1AARA 3M95A 4I6LB 1FO4A 3EA6A 2JT4B 4BKSD 4C0AA 1N6ZA 3B2FA 4C7YA 1JWMD 2WXHA 5HHDG 3V62A 1TGZB 5AUKA 3QX1A 3PSEB 4ILHA 3L16A 1AWDA 3HM6X 2K2UA 1LQBA 3IG3A 3C8YA 2I38A 3P4SB 4HRSA 2K22A 3V05A 2WGSA 3TEWA 4EOYA 1U5FA 2V4IB 5KCVA 3I57A 1WJUA 2DKPA 3AULA 1F0ZA 1KOTA 3A8PA 1CQVA 2NTTA 2FDQA 2WXQA 1UELA 1J19A 4PS8A 2W9NA 3CIRB 2Z0OA 2WLBA 1T77A 1YJIA 5HFYA 1ZXIA 2WQYB 2JXXA 4B95A 4HB0B 1IUEA 2I2YA 3DXCA 1KBLA 3U8ZA 2IGDA 3PEGA 1J7CA 2M4NA 3MJWA 3K9OB 5EFXA 3UINB 1L0XB 2MEKA 2GB1A 2GBMA 1MJDA 4EZKA 2CS4A 1WM3A 2MA9B 3DVNV 4LCDE 1WGUA 4HAUB 3RUIB 1D6EC 2KDBA 1ACAA 3O96A 1WXQA 3BK1A 2RGFA 2LMCA 2KWUB 2RRFA 3B2GA 4JKCA 3L4PA 2LJIA 3RCZA 2BVCA 1D5XC 2PVOD 3M3JA 3VDZA 2K6QA 1XEEA 1HEZE 2L76A 2DYNA 1DIKA 3PVLA 5CHVC 3PZDA 3ZVVA 4WQMA 1OQRA 2WDTB 1WRIA 1C4CA 1OGWA 1WY8A 1UEFA 2MWSB 1V49A 1AQCA 3APFA 3GOEA 4D0NB 2JZPA 2IO3B 2EMTA 3FM8C 2E2XA 3VFKA 3DBSA 2DENB 2P8VA 3OLMD 3NRZA 4QJ4B 4GB9A 2WXOA 2N9KA 2NCNA 3U30A 5J18A 2ZNVB 4G3XB 1DDWA 2GCJA 2DYOA 3DWGC 3RT3B 3FP5A 2JPHA 2YLMA 3KH0A 2KIGA 3KLSX 2ADZA 3ZVRA 1KJTA 4FXCA 2BKFA 1E8ZA 1YQ3B 1R4NB 3JVZX 4H8SA 2QDFA 2XEWA 2ICIA 4N9F4 1MAIA 2LFIA 4EUTA 3P63A 2K5PA 3QJZA 3QCAA 1JDEA 4DHZE 5BYQA 2Y8GA 3RPFC 4PQ0A 5AZFA 4KAXB 2JYTA 3SO6A 1YN5A 2R09A 4ZRJA 2GI9A 3KUZA 2KXJA 4BBNC 1FFVA 4W9GA 4CO7A 4HPPA 4K2PA 4WJPA 5C2TB 2MKRA 4DBGA 1AN8A 3W1SC 1ACCA 4RF0A 2WWZA 4MM3A 2WXGA 1MK9B 1WGRA 2N23A 1FMAD 1OQYA 2MBHA 3UQBA 3M63B 2D5GA 1DOXA 5HE3A 3VTUA 2KOXA 4ARIA 2V4LA 1FCLA 3EPYA 3R3MA 1MG4A 3ZJUA 4XWTA 4RH6A 4HVBA 2DNFA 4QXAB 3ODXA 2J42A 1J7AA 2V3PA 5C23A 3VR8B 1YNTE 1KFYB 4PYUA 5JHHA 4ILGB 1C77A 2J0MA 3OJ3A 2Z4DA 2K00A 3PZ8A 3AH7A 3DVNU 1KM7A 2K8BA 2J0KA 2IPKD 3KRWA 1SIFA 2BTEA 2JXTA 2ZPYA 1V5TA 1C9FA 1WGQA 4HLEA 1IBXB 2BWES 1T5XD 5DHAB 3WIMA 4F7HA 2Z8LA 4HXDA 1XXGA 2IDYA 5IOIA 5DPRA 4PT5A 4RM8A 1W1GA 2BS4B 1SJHD 1TZOA 4W9LA 3HQCA 4GLSC 1ZM0A 1RM6C 4MACA 3AU5A 1GPXA 2Z0DB 4S17A 4IDIA 3DWMA 2IJ0A 2L2IA 4DDID 2W54A 2GMIC 4WIPA 2KC2A 1MPHA 2G1EA 2LXCA 4PS3A 4HPMB 4NJCA 2W2XC 2JRIB 4GU2A 1WYGA 3ZJTA 3ML8A 4YSZB 1T6BX 3DVGX 2AX5A 2DWQA 5FR3A 1MPEA 4W9EA 4BBNF 1ESFA 1FM0D 2CODA 5D3IB 4REZA 2WXIA 2YS5A 4WAAA 1J0GA 1ZOYB 1U4AA 4XYCA 1EU4A 2KMMA 5IA7A 2KTFA 3MDBC 3PVWA 5JZEB 1HTQA 2YT1A 3ENBA 1YIWA 4JGHB 2CHZA 3N1XC 2RMMA 2LG1A 2ON8A 3C19A 3ZNID 1Y56A 2DYMA 1HQRD 4FLHA 2K2JA 1VLBA 2GUMA 2IGGA 2GOWA 1OTRB 2ABDA 2V0GA 2W55A 1U5DA 1WZ3A 3AXCA 1CJEA 4JKEA 2INPE 4WVFB 3ABVB 3HK0A 4KHAA 4US8A 4OZBA 2WU2B 2WXRA 5LXHA 5TR5A 2CJNA 4ZOHC 4TQ0A 2FBWB 1PDXA 1LM8B 2FUG1 3EC8A 5EE0A 2KIEA 4WJOA 3WAOA 2JZZA 3AE4B 4OW0A 4MK0A 2K8HA 4MM3B 3VUYA 5CLQB 2INDC 4M01A 2KLGA 3U2SC 2WXMA 3LJUX 2NVUI 4JLCA 2NBVA 2RSGA 2DYBA 3VVWB 5BYRA 3AJ4A 2PIAA 4B9KA 2IFSA 5T8IA 1ZDVA 2CU1A 2RD0A 4MEMA 1D4BA 3WA0A 1P7FA 3UGBB 4GMXB 4FADA 2O2VB 2DZIA 2ZW1A 4LK0M 3SHQA 4IM0A 2QSDA 4MT5A 1QKZA 4JL9A 4N6EB 1E90A 2O6VA 3GYPA 4TYZA 3ODWA 2EELA 4JQWC 4FA6A 1P5TA 3ZDTA 3EGRA 1L2NA 1SBBB 4DXFA 3H6NA 3PO0A 4OZCA 2LVQA 3RNAC 2ZCCA 1TQZA 3IHPC 2MJEA 3W1SA 3RFZB 3A58A 3GZNI 2MSED 1TJ6A 3BVGA 1FXAA 2KVRA 1B1ZA 4CHJA 2BW2A 1TBEA 2D9WA 2KTRA 3OG5A 3OAWA 2LGDA 2KUPA 5L95C 1EM7A 1DOYA 3W5UB 3RNEC 5D3YA 4CSQA 3DXEA 4GPTB 2TSSA 1RWSA 1V5UA 2FNJB 4HPLB 4GN1A 1C78A 3P4PB 4TUUA 3UI3A 4IG7B 3SBTA 2QJLA 3APDA 4RGTA 2H7DA 1A70A 1I4QA 2INCC 3PRZA 1I2HA 4DXGA 1FFUA 2EKIA 1V5OA 1PFDA 2DHZA 2MQJA 3AE2B 2OEDA 3EFCA 4ZYSA 2K6DB 3R8BA 2V3SA 5GOWB 3T9LA 3LJ3A 4MELA 3FLVA 2I1KA 2HD5B 1FXTB 2E3TA 1WE7A 3VHTC 2DIKA 4BOZB 2MBOA 1X1GA 2BYTA 1WG7A 1SE2A 5IAAC 2LKOA 5CLLB 3TEZA 3AV8A 1FPYA 2BWFA 3IVFA 1RAXA 1RYJA 2D07B 2GBKA 5D3DA 1YMHE 5AZGA 2HRJA 5IJMA 1RJ2A 2A5UA 3G9WA 5J3YA 4JK8A 2JYEA 3BVZA 4YSXB 4MH8A 4ICVA 4IFSA 2VH2A 3L54A 1I4XA 1VJKA 3P1MA 1ZXHA 2HTHA 4ANUA 3TBLD 3BVMA 1TS2A 2NPTB 4JKGB 5CHFA 3HRDD 4BZAA 2LBBA 2WDQB 3PHWB 1EU3A 1WF9A 3D8EA 3P7ZA 1HTOA 1SE9A 4ZYNA 2CB8A 1SEBD 2R61A 3FSSA 3DXDA 2NBVB 5JH5C 4MY6A 3TL5A 3FAHA 3ML9A 1KF6B 2C7HA 2CR5A 1E10A 1Y19B 4S0RA 2MBQA 1VCBA 2KVZA 2J52A 1QILA 1I7HA 3RNBC 4X57B 4LDTD 2MW5A 3VTVA 1PLSA 4GDKA 2HJ8A 5BO4B 1HZ6A 4JKAA 3PRPB 4NNJB 2W2WA 2O6VB 3HIZA 3HVDA 2KWCA 1ZP0B 3T8MA 3PP2A 2FCQA 2WS3B 4C7ZA 4F7ZA 2QEJC 4Z2MB 1SGHA 2K39A 1R4NI 4K81A 1PGXA 1H4RA 3NZSA 3PREA 4KVGB 4K7UA 5EE3A 1FGYA 1UWXA 5C79A 4KHOA 2N0YA 1XCTL 2D4QA 3OHMB 2L00B 1LXDA 3ZNZB 1FIQA 4GNKB 1WXAA 4JWSC 4GXBA 2VZKB 5G5GA 3ZIMA 3ZRFA 1N62A 3ZNHB 1WJ6A 3T3NA 1DDMA 2MDXA 1P7EA 1SIJA 4MGKE 4MJSB 2CRFA 2BYVE 2KQSA 5KQ1A 2FJLA 2DA0A 1RLFA 2FIDA 3BZDB 1TS4A 3N1ZC 4YTMB 1VZ8A 4OVZA 3R7QA 2RQ1A 2KX3A 4NPNA 2Y3AA 1Z87A 4G0NB 1VBGA 3A8QA 4IOYX 1F77A 1C4AA 4HCPB 2AEHA 3K9PB 3AM9A 2LZ6A 3KWLA 1TY2A 2ZJDA 4DX8A 2UZRA 5J3TA 1RFAA 3H8HA 4JIOU 4KGTA 1GG3A 3IAM1 4RFBA 3SV1A 1T0YA 1H10A 4KKIA 1EWYC 4JKBA 3B1LX 4FBJB 5LLIA 1Z5SB 5JP4A 2NR2A 1V5MA 2BF8B 2Z0EB 4RMAA 4TSSA 4ASWC 1Q1OA 4ZHPA 1E8WA 2J59M 2ZEQA 2DHIA 3Q3FA 3H7SA 1XLOA 2IO0B 2AL6A 3VR9B 4JK7A 4XDDA 1TXDA 2HTHB 4RGNA 2IGHA 1FHXA 1QZEA 1N3HA 3W2DA 2J7QB 1UBQA 2KYWA 3AEFB 2M56B 4RM9A 3V5WA 4TKNA 1UWMA 1QQRA 3QWZB 2GS0A 1X11A 4AJYB 3EUB2 3A9KA 4HB2B 4EKUA 3P6AA 1WSPA 2Z14A 1WR6E 4HAXB 4C4VB 3NVWA 4IWOA 3E56A 4WURA 1WH3A 4E71A 2L83A 1ZPSA 4IOIE 1YN4A 1UNPA 1E7PB 4GDKB 4NQLB 3BK2A 5H8YE 5JHBA 5IO9A 1XLNA 1N61A 2LI5A 4F8CB 2COFA 1FRDA 3D32A 3I9V1 5FI1A 4LNKA 2LRUA 1NTIA 3AE6B 1IBXA 4HSIA 3AEBB 5IKCM 4A20A 3U4EG 2RDBC 4MSMB 3CSFA 3Q6BA 4K7SA 3W5VB 2AYOB 5EE9A 3CF6E 2PKOA 4HJGE 1ET9A 2B76B 3NVZA 4NJ7A 3DPDA 3EECA 3HIEA 3R2IA 4ARCA 3MJ5A 1XODA 1V1OA 4RF1A 1ST7A 2WXKA 4B6HA 2WYQA 4FHKA 2COPA 2VRRB 3TVVA 5LXIB 4FULA 3BIID 2QKLA 4MGIE 4NAWA 5I2SA 2WP9B 1FNUA 4HATB 1XO3A 3MP9A 1PMSA 2QHOA 1Q67A 1ZKHA 1L5PA 1N5WA 1E8XA 1MIZB 2WDRB 2HJ1A 3RYTA 3V61A 1M7EA 3PLUA 1TKGA 1JWBD 4DHJD 2KX0A 1OY2A 2V76A 1NU2A 2WU5B 3B9JA 1FNVA 1NDDA 2D3AA 1UGMA 2MRPA 3W1YA 1P3QU 1L0YB 3Q2AC 3VOQA 3BJIA 4IW0A 5EE1A 2C7NB 1TZ1A 2FUHB 1V2YA 3A1QB 2KGXB 3CWIA 4GMVA 3JW0X 1HB6A 4NAMA 4WWMA 1FHWA 2LOXA 1ZW7A 1PUTA 4HK2A 2D10A 1E7VA 3SR6A 4E3CA 4TQ1A 4HAVB 3T3OA 2L1AA 3GYOA 1D5ZC 4KDLB 3H9DA 1X1FA 4IC7B 1NBFC 1VR9A 3ZDMC 4HKZE 1V80A 2GBRA 4OVUA 1MK7B 3FEHA 4CHKA 1XQQA 5KQ4A 1GOZA 1MVKA 2M8SA 1R4MB 3APCA 5D3WA 3TSSA 3KUDB 3NVVA 2KWVB 4EMOA 3JSVA 3KVFB 3MFGA 1XKEA 3WCQA 2UVMA 2DBYA 1UGJA 1NI3A 3A9KB 4B0EA 3DHHC 2MFQA 2G45B 3HSAA 5LG4B 2O2VA 2MLBA 4ACFA 3Q8AA 5BYSA 1KZGA 2LASA 3AE7B 4CQNA 3NWFA 1GJZA 1L7YA 4ZHOA 3ZRCA 4LNIA 3AE3B 1STEA 1P3RA 2AWTA 4ZRKA 4F7GA 4WWPA 4HKQA 4WAFA 4ZRPA 4KGRA 1GAQB 1WI0A 3AN1A 1UF0A 5CTRC 2DFKA 3NY5A 1I42A 2LHDA 1P98A 3S2AA 5IN7A 1JW9D 2MH7A 1U5EA 1DBHA 5AEKB 1P0RA 2JQRB 4HROA 5KHOA 2LUEA 3FVCA 2CY4A 1Y8RC 4HJKA 4ANXA 3I3TB 3NWDA 1HBKA 1D5MC 3HW2B 2N7EA 4Y94A 2IBIB 4GZUA 3N20C 3A98B 3DQVA 4LTUA 4BKSA 3QK0A 4ZDVA 2W2XD 3AE8B 2BB5A 3UIOB 5L83A 4BOSC 3NHEB 3L17A 2R2OA 1WGHA 2JRHA 4JWUC 3ODOA 3A9JB 4DWFA 2R2QA 1AW7A 2FE8A 2CKHB 4NJ6A 1KLUD 4G11A 4NAWB 2KDFB 2JX5A 4FJYA 2BQQA 1DYQA 1L6UA 4PK1A 3UQAA 3BY4B 2L05A 3Q8CA 1K50A 2MP2A 3MC9A 1QLBB 4DHZB 3RCPA 5MPOA 1ZSQA 5BMIA 4P1CC 2M0XA 1KI1B 3WAMA 1BXTA 5D3VA 4ITKA 5I4DA 1K5DB 4DXAB 4Q2JA 4AP4C 2JWUA 1W1DA 2L8JA 4HEA1 4K1RB 2ZW0A 4E74A 3KYDD 2KT7A 1QOAA 2WXJA 2IYBA 5AZHA 1NYQA 5AUIA 1DGJA 4WWOA 5LNK1 3HM3A 1XD3B 3NOBA 5BMHA 2D3GA 2MWNB 1AWEA 2JUOA 2AL3A 2D3CA 2OQBA 4FHJA 1HA5A 1MHXA 1JWSD 5C1ZA 2RVBB 2JF5A 4KZ0A 3GE3C 1SF0A 1JWAD 1N5XA 2V9HA 1C1YB 2NMBA 1GC7A 3L10B 5DPSA 5EDSA 2KJ6A 5GMVA 2M14A 3PRMB 2XQNM 1HE8A 2WH5A 2RDHA 3RD2A 2NPTA 3DBRB 4JKGA 1P1AA 2ZZPB 4I6PA 2FCMA 3KWVA 3D8DA 2I1JA 1QT9A 1X1MA 1FRRA 4A3OA 2N1WA 1T3QA 2SEBD 2DAJA 1KC7A 3EFUA 3N9YC 3JSVB 1U29A 1WGKA 1WMHA 3SFEB 2M0AA 3FILA 2N9XA 1E6EB 4WH4A 4J3OD 3IT6B 1XR0B 1ET6A 3CIKA 3KW5B 1DOIA 2K0PA 3EHVA 5D2MB 3ULCA 1KH0A 1MI0A 2YEPB 4M8NA 2BS3B 3N3KB 2JSVX 3DBLI 1WXVA 2EC1A 1L0VB 1TS3A 1GGOA 4XX5A 2OOBB 5C6RA 1KTKA 1VDVA 5DIFB 3MHZA 2HTME 4NY0A 3V6EB 2KANA 4M8MA 4UDUC 3VXWA 3ZLZA 4OSNA 5D94A 2XBBC 3PTFC 2IY1B 3ALBA 3ZKJC 2FIFA 3Q8BA 1WGDA 2H89B 3IXSA 2YVCA 5J3QA 4NQKE 3AEEB 4RNAA 4WJ7A 3ULBA 1NVID 1TJEA 2ELBA 4JX1C 2L52A 4WQOB 2COAA 2LHEA 1WR1A 4HHVA 1FD6A 1Q5WB 2LGXA 4QJ3B 2WHIA 1V81A 3ZTDA 1FEHA 2L0FA 4MJSA 3RNGC 3L13A 1V97A 1FCCC 3RZWC 3NUHB 3F5RA 1NEKB 2KFKA 2MP2B 3Q3NC 5DPTA 2RPVA 3DCGA 1OQNA 3OANA 2X0SA 1J0WA 1SE4A 1C3TA 4MH0E 3DHIC 4YT0B 4K2OA 1ZVRA 4YONA 1M7RA 4HDOA 1WXSA 5D27A 2GLSA 3R2TA 2LWPA 2BBCA 2REXA 3OWEB 2K8CA 2G9HD 3W9CB 1WJ4A 1GB4A 2UWQA 1K52A 1N63A 2V1YA 1NI2A 3F0WA 4P1BC 4EE2A 2YSZA 3NS8A 2OHFA 4MGYE 4DQOC 2DX5A 2D2QA 1SHCA 2YT2A 5C5BA 1S3SG 2DLBA 3T06A 5HG2A 4URKA 4IWQA 2KQ7A 3Q3MC 2KCJA 1TT5B 1J7BA 4HDQA 1M94A 1GC6A 3RN9C 3ZO5B 1ZUD2 4EZLA 4K3CA 1YD8U 2Z13A 2I5CA 3PLVA 2D9VA 4A6HA 2DLWA 1WMHB 2QILA 4C80A 1I35A 4C4VA 3FILB 1QF6A 3ZNGC 2DZKA 2UZSA 1H8CA 3I5JC 4JKFA 3QIJA 4NZLB 2NTSA 2PPHA 4IM3A 2ONQA 1BMLC 5HE2A 1BAKA 4KZCA 3VRBB 2BPSA 2C9WB 4LJPB 2C7MB 1QQGA 1IP9A 2LXAA 5DI9B 2FAZA 2KC1A 2XNAC 3RMKC 2D11A 4HB4B 3P4QB 2L1CA 3N30A 3NVYA 3AE9B 1SSNA 2DTCA 2RNRB 5FI0A 1M4VA 4ANWA 1P6SA 2KQ4X 4XZ4A 2IZVB 1UBIA 2GBJA 3MC0B 3CXBB 1HZ5A 1F9JA 4L1BA 3MTNB 3TEYA 1FAOA 1V9JA 1NENB 2KN4A 2KZRA 3PG7A 1LW3A 3DCXA 3VUXA 1UZXB 1NYRA 1GUAB 1TIFA 1F52A 3J9CA 2DHKA 1BTKA 5H92C 1UH6A 2R0DA 5LOPB 1F2RC 1WGYA 4NSWA 2N9LA 4II3B 4LJOB 2N0SB 1OEYJ 3DHGC 1MI1A 2LUMA 1XLPA 2KFKB 1R4MI 1XF5L 3KSYA 4P7IA 3U7DA 2JVCA 3TO1A 1I4GA 1JCKB 1VRAB 2DKQA 2YRYA 2IYDB 2KKCA 4A9AA 1OEYA 2QMTA 3VAWA 3DBHB 4TV3A 3PT2B 3LDZE 1PFJA 4MGZE 1SE3A 1K53A 3UIPB 1NVLA 1Q0WB 3A1QA 2L32A 2PVGC 4WJQA 2LJ5A 2ELAA 3B77A 3TFMA 1WE6A 2L7RA 3CSTA 3E9SA 4W9DA 3UZTA 3Q3OC 3R66C 5I2MA 2MX2A 2XN9C 1QOBA 3VIAA 4PS7A 3RI7C 3E9LA 4AUQC 2ROZB 2RDGA 4OVVA 4AOFA 2KO3A 2M19A 2N7DA 4HWIB 3IAS1 2UYZB 2KLCA 3PPAA 4HAZB 3QA8A 2QC8A 2NS5A 2LGIA 3RULA 2DX5B 2E6XA 2CHXA 5CHWA 3E9OA 2LOZA 5C5BB 2J0JA 1L4DB 2D9XA 4BBKA 2KFJA 3VH4B 1R7SA 2KHWB 2KWDA 2GBNA 3SBGA 5IRSA 2KK8A 3ECIA 1JROA 4HB3B 3PZ7A 3GB1A 2BB6A 2L3ZA 1EUVB 1UUPA 4A6KA 3HUIA 1XD4A 2QCZA 3Q3JA 1FOEA 1UNSA 4JKDA 1RRBA 3KQ4A 4WJNA 4YL8A 4ZRIA 4D2KA 1WZ0A 2OJWA 1LO5D 2KUQA 3B0AA 4DX90 1L4ZB 3WYFB 1KRHA 1I4HA 2N1VA 1S1QB 2Y5PA 1FHOA 3MPXA 1T0RC 1EF5A 4DBBA 4K7WA 3GE8C 3R7RA 2CHWA 4YTPB 5KHQA 1EAZA 2Z59A 3PVUA 2N7JA 2PJHA 2XK5A 3NJTA 3A4RA 3ONSA 2RPQA 3IFWB 3FC4A 3ETRA 2UU7A 4W9FA 3V60A 1UNQA 2AQ3B 1A5RA 1XCGA 3ZTCA 4C56C 1DDVA 3ZXRA 5G55A 1F2RI 3A9JA 3ZW3A 1IGCA 1U5GA 2WXFA 3KY9A 2FJUB 2LEKA 5J17A 2C5LC 1ENFA 1K51A 4AWJA 3WALA 3DBRI 1IRSA 3Q69A 4ICUA 2YEPF 1I4PA 1I7AA 2NBUA 3E9PA 3VH3B 3HHMA 2W3SA 3BWUD 4XDCA 5GXGB 3QBVB 2LD9A 2KJRA 1YX5B 4N58A 4CHMA 4XWWA 1E8YA 5L81A 3AEDB 1WXMA 3BYYB 2PTLA 1IPGA 1SJED 3VRAB 1JRPA 3BYTB 2GCLA 4IAPA 3RZFA 3ZUNA 4JE3B 2MJDA 2O6VD 4LNFA 5BMGA 1E9MA 3ZGZA 2PMVA 3P42A 4M02A 2G4SA 1U2BA 4KDIC 2BKRB 4JK9A 1MIXA 2DHJA 2KDEB 3IBEA 3SUZA 3TIXA 5E6JA 2FCSA 2M38A 5HKHA 1K5GB 3C0RB 1WJNA 1DROA 5LONB 2IO2B 2JU6X 4Z2NA 1W1HA 1BT0A 4F1SA 1YJ1A 2N9PC 2J53A 4BVUC 1DYNA 4A6QA 3QARA 2AQ1B 2K8EA 3UF8A 5JXVA 2KDIA 3AEAB 4JPSA 1C79A 2N9EB 3TW1A 2VZKD 4AQ7A 1V86A 1WJ1A
chains in the Genus database with same CATH topology
3PS6A 2IY0B 2DYQA 4EJNA 5E6OA 2M17A 2X18A 2G35A 4EEWA 1GNUA 1QC6A 1MKEA 1D3ZA 2YS1A 4KIKA 2LYDA 2R82A 4W9JA 3KUCB 2D9ZA 2K25A 5D3XA 3VTWA 4GSWA 2N4FA 2K1FA 4W9HA 1UNRA 2Y8FA 2KMAA 1WM2A 3V6CB 1WFYA 1YQBA 2Z59B 4XWXA 2KD0A 3QAQA 2XK5B 1TTNA 1RRPB 4KSKC 3X23A 1OMWA 1Z2MA 2VRWB 4DDGD 5G2NA 2P0FA 4KSLC 2BYFA 2MBEA 4PYZA 4I6NB 4B6WA 4HAYB 1UPQA 4GOCA 3H7PA 1LB1A 5JHAA 1ZGUB 1EGXA 3KZ1A 3TJPA 2OJRA 2JP2A 2KJHB 3QC8B 2NZ8B 4GGQA 1XX0A 5DCNA 3PGEA 2ZVNA 2MBBB 3P2BA 3VQIA 2DZJA 1VD2A 5HE1A 4FJVB 3A4SC 3TMPB 4LDTB 1V88A 4A6FA 1WGGA 2GJYA 3TCAA 1WIAA 2A4ZA 2EMSA 1UPRA 5JLJB 1V5PA 1WRDB 2BYEA 2P0DA 2FJ9A 1NTVA 3E66A 2JZ3B 1WYWB 2QKMA 3OJ4B 3AU4A 3PSCA 2H7EA 4IM2A 4KHBB 2RGNB 1IYFA 3JYUA 2FCNA 4DK5A 3CMMB 4ILJA 2ZVOA 2LVPA 4MSQB 4W9KA 2YS3A 1WI1A 5DPWA 1WJMA 2RUKB 2B3AA 4KIKB 4BKTA 2ZCBA 2LULA 2G3QB 5JVLA 1EVHA 3L08A 2LRWA 3DVGY 4W9IA 2LVOA 1WX8A 1FGZA 4A3PA 4IWPA 3NSUA 5JHGA 2BCJA 3H1UA 2DZMA 5E6PA 4GDLA 4CYEA 5DHFB 4G50A 3M62B 2YT0A 4MT7A 4EZJA 3DBHI 3KRXA 1WX9A 2DX1A 2ASQA 2PE9A 4II2B 4WSFA 2M1MA 4BFRA 1HB8A 2ZNVC 2YF0A 3VUWA 2ROVA 3WAPA 2L0TA 2KNBA 1YX6B 1KLVA 2HE7A 3DOWA 3O65B 5CX3A 2JY6A 2PZ1A 5D7GA 3SYXA 2LGYA 1J8CA 2CAYA 1FB8A 5J2RA 3H7PB 3WANA 1MG8A 3SU8X 4HCNB 2EKEC 2OTXA 2BGFA 2KN5A 2EJ8A 2NBWB 3X0WA 2MCNB 2CY5A 1U27A 4AJWA 1BWNA 4HAWB 2VSZA 1V61A 4A6FB 1V6EA 3BINA 4FN2A 5HE0A 2ZPNA 3SDLC 4IUMB 3MHSD 4MDKE 2D9YA 3NZUA 1EF1A 1XT9B 2I5FA 3N32A 4JKHA 3B08A 1ISNA 2DAFA 5C16A 4A5KA 2JWZA 4M0WB 4GIVA 3SNHA 1ZC3B 3D8FA 3ENEA 3DDCB 2VKIA 2PEAA 3L0WB 2Z0PA 5E6NA 3QQ8B 3KYCD 1E5WA 4GDLB 1WVHA 2DN6A 4DHJB 4WWNA 4KV2A 1LFDA 3PHXB 4F7UP 1Y5OA 2RLOA 2Z0QA 2RR9A 3A33B 4J6IA 1V89A 1NTYA 2PE6B 3M1IB 4XC2A 4PNKA 1KZ7A 3QWMA 1PQSA 2Q13A 1K8RB 3ML4A 4BKGA 2G4DB 3SD5A 2IO1B 1WX7A 2KTRB 2WX0A 3AI5A 1ZC4B 1UD7A 4L6EA 1JRUA 1BTNA 3N7CA 2C60A 1P9DU 2CQUA 1X86A 1CMXB 4ANVA 2COCA 4K17A 5D6JB 2P0HA 1X05A 3PV1A 2Y5BB 2KMCA 5DH9B 4W9CA 4EFOA 4FJZA 2RSUA 1G6JA 2Y7BA 5FR6A 1B55A 1E7UA 3QHTA 2WX1A 1VBHA 1EO6A 1AARA 3M95A 4I6LB 2JT4B 4BKSD 4C0AA 3V62A 1TGZB 3QX1A 3PSEB 4ILHA 3L16A 3HM6X 2K2UA 1LQBA 3IG3A 4EOYA 1U5FA 5KCVA 1WJUA 2DKPA 3AULA 1KOTA 3A8PA 2FDQA 1UELA 1J19A 4PS8A 2W9NA 2Z0OA 2JXXA 4B95A 4HB0B 3DXCA 1KBLA 3U8ZA 3PEGA 2M4NA 3MJWA 3K9OB 5EFXA 3UINB 2GBMA 4EZKA 2CS4A 1WM3A 2MA9B 3DVNV 4LCDE 1WGUA 4HAUB 3RUIB 2KDBA 1ACAA 3O96A 2RGFA 2KWUB 4JKCA 3RCZA 3M3JA 3VDZA 2K6QA 2L76A 2DYNA 1DIKA 3PVLA 5CHVC 3PZDA 3ZVVA 2WDTB 1OGWA 1WY8A 1UEFA 2MWSB 1V49A 1AQCA 3APFA 3GOEA 4D0NB 2IO3B 2EMTA 3FM8C 2E2XA 3VFKA 3DBSA 2DENB 2P8VA 3OLMD 4GB9A 2NCNA 3U30A 5J18A 2ZNVB 4G3XB 1DDWA 2GCJA 2DYOA 3RT3B 3FP5A 2JPHA 2YLMA 3KH0A 2ADZA 3ZVRA 1KJTA 2BKFA 1E8ZA 3JVZX 4H8SA 2XEWA 4N9F4 1MAIA 4EUTA 3QJZA 3QCAA 1JDEA 4DHZE 2Y8GA 4PQ0A 5AZFA 4KAXB 3SO6A 2R09A 4ZRJA 3KUZA 2KXJA 4BBNC 4W9GA 4CO7A 4K2PA 4WJPA 2MKRA 4DBGA 3W1SC 2WWZA 4MM3A 1MK9B 1WGRA 2N23A 1OQYA 2MBHA 3UQBA 3M63B 5HE3A 3VTUA 2KOXA 2V4LA 3EPYA 3R3MA 4HVBA 3ODXA 5C23A 4PYUA 5JHHA 4ILGB 2J0MA 3OJ3A 2K00A 3DVNU 1KM7A 2K8BA 2J0KA 3KRWA 1SIFA 2ZPYA 1V5TA 1WGQA 4HLEA 2BWES 5DHAB 3WIMA 4F7HA 4HXDA 5DPRA 4RM8A 1W1GA 4W9LA 3HQCA 1ZM0A 3AU5A 2Z0DB 2L2IA 4DDID 2GMIC 2KC2A 1MPHA 2LXCA 4PS3A 4HPMB 2W2XC 2JRIB 4GU2A 3ML8A 3DVGX 4W9EA 4BBNF 2CODA 2YS5A 4WAAA 1J0GA 1U4AA 5IA7A 2KTFA 3MDBC 3PVWA 5JZEB 2YT1A 3ENBA 1YIWA 4JGHB 2CHZA 2LG1A 3ZNID 2DYMA 4FLHA 2K2JA 2GOWA 1OTRB 2ABDA 1U5DA 1WZ3A 3AXCA 4JKEA 4WVFB 3HK0A 4KHAA 5LXHA 5TR5A 4TQ0A 1LM8B 3EC8A 4WJOA 3WAOA 2JZZA 4MK0A 2K8HA 3VUYA 5CLQB 2KLGA 3LJUX 2NVUI 4JLCA 2RSGA 2DYBA 3VVWB 3AJ4A 4B9KA 2IFSA 2CU1A 2RD0A 4MEMA 3WA0A 3UGBB 4GMXB 4FADA 2O2VB 2DZIA 3SHQA 4IM0A 4JL9A 1E90A 2O6VA 3GYPA 4TYZA 3ODWA 4JQWC 4FA6A 1P5TA 3ZDTA 1L2NA 3H6NA 2LVQA 2ZCCA 1TQZA 3IHPC 3W1SA 3GZNI 2MSED 1TJ6A 2KVRA 4CHJA 1TBEA 2D9WA 2KTRA 3OAWA 2LGDA 2KUPA 5L95C 5D3YA 3DXEA 4GPTB 1V5UA 2FNJB 4HPLB 4GN1A 4TUUA 4IG7B 3SBTA 3APDA 2H7DA 3PRZA 1I2HA 1V5OA 2DHZA 2MQJA 2K6DB 2V3SA 5GOWB 3T9LA 3LJ3A 4MELA 3FLVA 2I1KA 2HD5B 1FXTB 1WE7A 3VHTC 2DIKA 4BOZB 2MBOA 1X1GA 1WG7A 5IAAC 2LKOA 5CLLB 2BWFA 3IVFA 1RAXA 2D07B 2GBKA 5AZGA 2HRJA 5IJMA 1RJ2A 2A5UA 3G9WA 5J3YA 4JK8A 4ICVA 4IFSA 3L54A 2HTHA 4ANUA 3TBLD 2NPTB 4JKGB 5CHFA 2LBBA 3PHWB 1WF9A 3D8EA 3P7ZA 1SE9A 4ZYNA 2CB8A 3FSSA 3DXDA 2NBVB 5JH5C 4MY6A 3TL5A 3ML9A 2C7HA 2CR5A 1Y19B 2MBQA 1VCBA 4X57B 4LDTD 2MW5A 3VTVA 1PLSA 4GDKA 2HJ8A 5BO4B 4JKAA 3PRPB 4NNJB 2W2WA 2O6VB 3HIZA 2KWCA 3T8MA 3PP2A 2FCQA 4F7ZA 4Z2MB 1SGHA 2K39A 1R4NI 4K81A 1H4RA 3NZSA 3PREA 4KVGB 4K7UA 1FGYA 5C79A 4KHOA 2N0YA 2D4QA 2L00B 1LXDA 3ZNZB 1WXAA 4GXBA 3ZIMA 3ZRFA 3ZNHB 1WJ6A 1DDMA 2MDXA 4MGKE 4MJSB 2CRFA 2BYVE 2KQSA 5KQ1A 2FJLA 2DA0A 1RLFA 2FIDA 3R7QA 2RQ1A 2KX3A 4NPNA 1Z87A 4G0NB 1VBGA 3A8QA 4IOYX 4HCPB 2AEHA 3K9PB 2LZ6A 2ZJDA 4DX8A 2UZRA 5J3TA 1RFAA 4JIOU 1GG3A 3SV1A 1T0YA 1H10A 4JKBA 3B1LX 4FBJB 5LLIA 1Z5SB 5JP4A 2NR2A 1V5MA 2BF8B 2Z0EB 4RMAA 4ASWC 1Q1OA 1E8WA 2J59M 2ZEQA 2DHIA 3Q3FA 3H7SA 2IO0B 2AL6A 4JK7A 1TXDA 2HTHB 1FHXA 1QZEA 1N3HA 2J7QB 1UBQA 4RM9A 3V5WA 4TKNA 3QWZB 2GS0A 1X11A 4AJYB 3A9KA 4HB2B 4EKUA 3P6AA 1WR6E 4HAXB 4IWOA 1WH3A 4E71A 1UNPA 4GDKB 4NQLB 5JHBA 2LI5A 4F8CB 2COFA 3D32A 5FI1A 2LRUA 1NTIA 4A20A 4MSMB 3CSFA 4K7SA 2AYOB 3CF6E 4NJ7A 3DPDA 3EECA 1XODA 1ST7A 4B6HA 2WYQA 4FHKA 2COPA 2VRRB 3TVVA 5LXIB 4FULA 2QKLA 4MGIE 4NAWA 4HATB 1PMSA 2QHOA 1Q67A 1ZKHA 1E8XA 1MIZB 3RYTA 3V61A 1M7EA 3PLUA 4DHJD 2KX0A 1OY2A 2V76A 1NU2A 1NDDA 1UGMA 2MRPA 3W1YA 1P3QU 3VOQA 3BJIA 4IW0A 2C7NB 1TZ1A 2FUHB 1V2YA 3A1QB 2KGXB 4GMVA 3JW0X 1HB6A 1FHWA 2LOXA 1ZW7A 4HK2A 2D10A 1E7VA 4E3CA 4TQ1A 4HAVB 3GYOA 4KDLB 3H9DA 1X1FA 4IC7B 1NBFC 3ZDMC 1V80A 2GBRA 4OVUA 1MK7B 3FEHA 4CHKA 1XQQA 5KQ4A 2M8SA 3APCA 5D3WA 3KUDB 2KWVB 4EMOA 3JSVA 3KVFB 1XKEA 2UVMA 3A9KB 2MFQA 2G45B 2O2VA 2MLBA 1KZGA 2LASA 1GJZA 1L7YA 3ZRCA 1P3RA 2AWTA 4ZRKA 4F7GA 4WWPA 1WI0A 5CTRC 2DFKA 3NY5A 1I42A 1P98A 3S2AA 1U5EA 1DBHA 5AEKB 1P0RA 5KHOA 2LUEA 2CY4A 1Y8RC 4HJKA 4ANXA 3I3TB 1HBKA 2N7EA 3HW2B 4Y94A 2IBIB 4GZUA 3A98B 3DQVA 4BKSA 3QK0A 4ZDVA 2W2XD 5L83A 3UIOB 4BOSC 3NHEB 3L17A 2R2OA 1WGHA 2JRHA 3ODOA 3A9JB 4DWFA 2R2QA 4NJ6A 2CKHB 4G11A 4NAWB 2KDFB 4FJYA 3UQAA 3BY4B 2L05A 2MP2A 4DHZB 3RCPA 1ZSQA 2M0XA 1KI1B 3WAMA 5D3VA 1K5DB 4DXAB 4AP4C 1W1DA 2L8JA 4K1RB 4E74A 3KYDD 2IYBA 5AZHA 4WWOA 3HM3A 1XD3B 3NOBA 2D3GA 2MWNB 1AWEA 2JUOA 2AL3A 2OQBA 4FHJA 5C1ZA 2RVBB 2JF5A 4KZ0A 1C1YB 2NMBA 1GC7A 3L10B 5DPSA 5EDSA 2KJ6A 5GMVA 2M14A 3PRMB 2XQNM 1HE8A 2WH5A 3RD2A 2NPTA 4JKGA 1P1AA 2ZZPB 4I6PA 2FCMA 3D8DA 2I1JA 1X1MA 4A3OA 2N1WA 2DAJA 1KC7A 3EFUA 3JSVB 1U29A 1WMHA 2N9XA 1XR0B 3KW5B 3CIKA 3EHVA 5D2MB 3ULCA 4M8NA 3N3KB 3DBLI 1WXVA 2EC1A 1GGOA 4XX5A 2OOBB 5C6RA 5DIFB 4NY0A 3V6EB 2KANA 4M8MA 3VXWA 3ZLZA 5D94A 2XBBC 3PTFC 2IY1B 3ALBA 3ZKJC 2FIFA 1WGDA 2YVCA 5J3QA 4NQKE 4WJ7A 3ULBA 2ELBA 4WQOB 2COAA 1WR1A 4HHVA 1Q5WB 2LGXA 1V81A 3ZTDA 2L0FA 4MJSA 3L13A 3RZWC 3F5RA 2KFKA 2MP2B 5DPTA 3DCGA 1OQNA 3OANA 2X0SA 1J0WA 1C3TA 4MH0E 4K2OA 1ZVRA 4YONA 1M7RA 4HDOA 1WXSA 5D27A 2LWPA 2REXA 2K8CA 1WJ4A 2UWQA 2V1YA 1NI2A 3F0WA 2YSZA 3NS8A 4MGYE 2DX5A 2D2QA 1SHCA 5C5BA 1S3SG 3T06A 4URKA 4IWQA 2KQ7A 2KCJA 4HDQA 1M94A 1GC6A 3ZO5B 4EZLA 1YD8U 2I5CA 3PLVA 2D9VA 4A6HA 2DLWA 1WMHB 1I35A 3ZNGC 2DZKA 2UZSA 1H8CA 4JKFA 3QIJA 2PPHA 4IM3A 5HE2A 1BAKA 4KZCA 2BPSA 2C9WB 4LJPB 2C7MB 1QQGA 1IP9A 2KC1A 5DI9B 2FAZA 2LXAA 2D11A 4HB4B 2L1CA 3N30A 2DTCA 2RNRB 5FI0A 4ANWA 1P6SA 4XZ4A 2IZVB 1UBIA 2GBJA 3CXBB 1F9JA 3MTNB 1FAOA 1V9JA 2KZRA 3PG7A 1LW3A 3VUXA 1UZXB 1GUAB 2DHKA 1BTKA 1UH6A 2R0DA 5LOPB 1WGYA 4NSWA 4II3B 4LJOB 1OEYJ 2KFKB 1R4MI 3KSYA 4P7IA 3U7DA 2JVCA 3TO1A 2DKQA 2YRYA 2IYDB 2KKCA 1OEYA 3VAWA 4TV3A 3PT2B 3LDZE 1PFJA 4MGZE 3UIPB 1NVLA 1Q0WB 3A1QA 4WJQA 2LJ5A 2ELAA 3TFMA 1WE6A 2L7RA 3CSTA 4W9DA 3UZTA 3R66C 2MX2A 3VIAA 4PS7A 3E9LA 4AUQC 2ROZB 4OVVA 4AOFA 2KO3A 2N7DA 4HWIB 2UYZB 2KLCA 3PPAA 4HAZB 3QA8A 2NS5A 3RULA 2DX5B 2CHXA 5CHWA 3E9OA 2LOZA 5C5BB 2J0JA 2D9XA 4BBKA 2KFJA 3VH4B 2KHWB 2GBNA 3SBGA 2KK8A 3ECIA 4HB3B 2L3ZA 1EUVB 4A6KA 1XD4A 3Q3JA 1FOEA 4JKDA 1RRBA 4WJNA 4YL8A 4ZRIA 1WZ0A 3B0AA 4DX90 3WYFB 2N1VA 1S1QB 1FHOA 3MPXA 1EF5A 4DBBA 4K7WA 3R7RA 2CHWA 5KHQA 1EAZA 3PVUA 2PJHA 2XK5A 3A4RA 3ONSA 2RPQA 3IFWB 4W9FA 3V60A 1UNQA 1A5RA 1XCGA 3ZTCA 1DDVA 5G55A 3A9JA 3ZW3A 1U5GA 3KY9A 5J17A 2C5LC 4AWJA 3WALA 3DBRI 1IRSA 4ICUA 1I7AA 2NBUA 3E9PA 3VH3B 3HHMA 3QBVB 2LD9A 2KJRA 1YX5B 4CHMA 1E8YA 5L81A 1WXMA 1IPGA 2GCLA 4IAPA 3RZFA 3ZUNA 2O6VD 2G4SA 1U2BA 4KDIC 2BKRB 4JK9A 1MIXA 2DHJA 2KDEB 3IBEA 3SUZA 3TIXA 2FCSA 2M38A 5HKHA 1K5GB 3C0RB 1WJNA 1DROA 5LONB 2IO2B 4Z2NA 1W1HA 1BT0A 4F1SA 1YJ1A 2N9PC 4BVUC 1DYNA 3QARA 3UF8A 2KDIA 2N9EB 3TW1A 1V86A 1WJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS6 A;  2IY0 B;  2DYQ A;  4EJN A;  5E6O A;  2M17 A;  2X18 A;  2G35 A;  4EEW A;  1GNU A;  1QC6 A;  1MKE A;  1D3Z A;  2YS1 A;  4KIK A;  2LYD A;  4W9J A;  3KUC B;  2D9Z A;  2K25 A;  5D3X A;  3VTW A;  4GSW A;  2N4F A;  2K1F A;  4W9H A;  1UNR A;  2Y8F A;  2KMA A;  1WM2 A;  3V6C B;  1WFY A;  1YQB A;  2Z59 B;  4XWX A;  2KD0 A;  3QAQ A;  2XK5 B;  1TTN A;  1RRP B;  4KSK C;  3X23 A;  1OMW A;  1Z2M A;  2VRW B;  4DDG D;  5G2N A;  2P0F A;  4KSL C;  2BYF A;  2MBE A;  4PYZ A;  4I6N B;  4B6W A;  4HAY B;  1UPQ A;  4GOC A;  3H7P A;  1LB1 A;  5JHA A;  1ZGU B;  1EGX A;  3KZ1 A;  3TJP A;  2OJR A;  2JP2 A;  2KJH B;  3QC8 B;  2NZ8 B;  4GGQ A;  1XX0 A;  5DCN A;  3PGE A;  2ZVN A;  2MBB B;  3P2B A;  3VQI A;  2DZJ A;  1VD2 A;  5HE1 A;  4FJV B;  3A4S C;  3TMP B;  4LDT B;  1V88 A;  4A6F A;  1WGG A;  2GJY A;  3TCA A;  1WIA A;  2A4Z A;  2EMS A;  1UPR A;  5JLJ B;  1V5P A;  1WRD B;  2BYE A;  2P0D A;  2FJ9 A;  1NTV A;  2JZ3 B;  1WYW B;  2QKM A;  3OJ4 B;  3AU4 A;  3PSC A;  2H7E A;  4IM2 A;  4KHB B;  2RGN B;  1IYF A;  3JYU A;  2FCN A;  4DK5 A;  3CMM B;  2ZVO A;  2LVP A;  4MSQ B;  4W9K A;  2YS3 A;  1WI1 A;  5DPW A;  1WJM A;  2RUK B;  2B3A A;  4KIK B;  4BKT A;  2ZCB A;  2LUL A;  2G3Q B;  1EVH A;  3L08 A;  2LRW A;  3DVG Y;  4W9I A;  2LVO A;  1WX8 A;  1FGZ A;  4A3P A;  4IWP A;  3NSU A;  5JHG A;  2BCJ A;  3H1U A;  2DZM A;  5E6P A;  4GDL A;  4CYE A;  5DHF B;  4G50 A;  3M62 B;  2YT0 A;  4MT7 A;  4EZJ A;  3DBH I;  3KRX A;  1WX9 A;  2DX1 A;  2ASQ A;  2PE9 A;  4II2 B;  4WSF A;  2M1M A;  4BFR A;  1HB8 A;  2ZNV C;  2YF0 A;  3VUW A;  2ROV A;  3WAP A;  2L0T A;  2KNB A;  1YX6 B;  1KLV A;  2HE7 A;  3DOW A;  3O65 B;  5CX3 A;  2JY6 A;  2PZ1 A;  5D7G A;  3SYX A;  2LGY A;  1J8C A;  2CAY A;  1FB8 A;  5J2R A;  3H7P B;  3WAN A;  1MG8 A;  3SU8 X;  4HCN B;  2EKE C;  2OTX A;  2BGF A;  2KN5 A;  2EJ8 A;  2NBW B;  3X0W A;  2MCN B;  2CY5 A;  1U27 A;  4AJW A;  1BWN A;  4HAW B;  2VSZ A;  1V61 A;  4A6F B;  1V6E A;  3BIN A;  4FN2 A;  5HE0 A;  2ZPN A;  3SDL C;  4IUM B;  3MHS D;  4MDK E;  2D9Y A;  3NZU A;  1EF1 A;  1XT9 B;  2I5F A;  3N32 A;  3B08 A;  1ISN A;  2DAF A;  5C16 A;  4A5K A;  2JWZ A;  4M0W B;  4GIV A;  3SNH A;  1ZC3 B;  3D8F A;  3ENE A;  3DDC B;  2VKI A;  2PEA A;  3L0W B;  2Z0P A;  5E6N A;  3QQ8 B;  3KYC D;  1E5W A;  4GDL B;  1WVH A;  2DN6 A;  4DHJ B;  4WWN A;  4KV2 A;  1LFD A;  3PHX B;  4F7U P;  1Y5O A;  2RLO A;  2Z0Q A;  2RR9 A;  3A33 B;  4J6I A;  1V89 A;  1NTY A;  2PE6 B;  3M1I B;  4XC2 A;  4PNK A;  1KZ7 A;  3QWM A;  1PQS A;  2Q13 A;  1K8R B;  3ML4 A;  4BKG A;  2G4D B;  3SD5 A;  2IO1 B;  1WX7 A;  2KTR B;  2WX0 A;  3AI5 A;  1ZC4 B;  1UD7 A;  4L6E A;  1JRU A;  1BTN A;  3N7C A;  2C60 A;  1P9D U;  2CQU A;  1X86 A;  1CMX B;  4ANV A;  2COC A;  4K17 A;  5D6J B;  2P0H A;  1X05 A;  3PV1 A;  2Y5B B;  2KMC A;  5DH9 B;  4W9C A;  4EFO A;  4FJZ A;  2RSU A;  1G6J A;  2Y7B A;  5FR6 A;  1B55 A;  1E7U A;  3QHT A;  2WX1 A;  1EO6 A;  1AAR A;  3M95 A;  4I6L B;  2JT4 B;  4BKS D;  4C0A A;  3V62 A;  1TGZ B;  3QX1 A;  3PSE B;  3L16 A;  3HM6 X;  2K2U A;  1LQB A;  3IG3 A;  4EOY A;  1U5F A;  5KCV A;  1WJU A;  2DKP A;  3AUL A;  1KOT A;  3A8P A;  2FDQ A;  1UEL A;  1J19 A;  4PS8 A;  2W9N A;  2Z0O A;  2JXX A;  4B95 A;  4HB0 B;  3DXC A;  3U8Z A;  3PEG A;  2M4N A;  3MJW A;  3K9O B;  5EFX A;  3UIN B;  2GBM A;  4EZK A;  2CS4 A;  1WM3 A;  2MA9 B;  3DVN V;  4LCD E;  1WGU A;  4HAU B;  3RUI B;  2KDB A;  1ACA A;  3O96 A;  2RGF A;  2KWU B;  3RCZ A;  3M3J A;  3VDZ A;  2K6Q A;  2L76 A;  2DYN A;  3PVL A;  5CHV C;  3PZD A;  3ZVV A;  2WDT B;  1OGW A;  1WY8 A;  1UEF A;  2MWS B;  1V49 A;  1AQC A;  3APF A;  3GOE A;  4D0N B;  2IO3 B;  2EMT A;  3FM8 C;  2E2X A;  3VFK A;  3DBS A;  2DEN B;  2P8V A;  3OLM D;  4GB9 A;  2NCN A;  3U30 A;  5J18 A;  2ZNV B;  4G3X B;  1DDW A;  2GCJ A;  2DYO A;  3RT3 B;  3FP5 A;  2JPH A;  2YLM A;  3KH0 A;  2ADZ A;  3ZVR A;  1KJT A;  2BKF A;  1E8Z A;  3JVZ X;  4H8S A;  2XEW A;  4N9F 4;  1MAI A;  4EUT A;  3QJZ A;  3QCA A;  4DHZ E;  2Y8G A;  4PQ0 A;  5AZF A;  4KAX B;  3SO6 A;  2R09 A;  4ZRJ A;  3KUZ A;  2KXJ A;  4BBN C;  4W9G A;  4CO7 A;  4K2P A;  4WJP A;  2MKR A;  4DBG A;  3W1S C;  2WWZ A;  4MM3 A;  1MK9 B;  1WGR A;  2N23 A;  1OQY A;  2MBH A;  3UQB A;  3M63 B;  5HE3 A;  3VTU A;  2KOX A;  2V4L A;  3EPY A;  3R3M A;  4HVB A;  3ODX A;  5C23 A;  4PYU A;  5JHH A;  2J0M A;  3OJ3 A;  2K00 A;  3DVN U;  1KM7 A;  2K8B A;  2J0K A;  3KRW A;  1SIF A;  2ZPY A;  1V5T A;  1WGQ A;  4HLE A;  2BWE S;  5DHA B;  3WIM A;  4F7H A;  4HXD A;  5DPR A;  4RM8 A;  1W1G A;  4W9L A;  3HQC A;  1ZM0 A;  3AU5 A;  2Z0D B;  2L2I A;  4DDI D;  2GMI C;  2KC2 A;  1MPH A;  2LXC A;  4PS3 A;  4HPM B;  2W2X C;  2JRI B;  4GU2 A;  3ML8 A;  3DVG X;  4W9E A;  4BBN F;  2COD A;  2YS5 A;  4WAA A;  1J0G A;  1U4A A;  5IA7 A;  2KTF A;  3MDB C;  3PVW A;  5JZE B;  2YT1 A;  1YIW A;  4JGH B;  2CHZ A;  2LG1 A;  3ZNI D;  2DYM A;  4FLH A;  2K2J A;  2GOW A;  1OTR B;  2ABD A;  1U5D A;  1WZ3 A;  3AXC A;  4WVF B;  3HK0 A;  4KHA A;  5LXH A;  5TR5 A;  4TQ0 A;  1LM8 B;  3EC8 A;  4WJO A;  3WAO A;  2JZZ A;  4MK0 A;  2K8H A;  3VUY A;  5CLQ B;  2KLG A;  3LJU X;  2NVU I;  4JLC A;  2RSG A;  2DYB A;  3VVW B;  3AJ4 A;  4B9K A;  2IFS A;  2CU1 A;  2RD0 A;  4MEM A;  3WA0 A;  3UGB B;  4GMX B;  4FAD A;  2O2V B;  2DZI A;  3SHQ A;  4IM0 A;  4JL9 A;  1E90 A;  2O6V A;  3GYP A;  4TYZ A;  3ODW A;  4JQW C;  4FA6 A;  1P5T A;  3ZDT A;  1L2N A;  3H6N A;  2LVQ A;  2ZCC A;  1TQZ A;  3IHP C;  3W1S A;  3GZN I;  2MSE D;  1TJ6 A;  2KVR A;  4CHJ A;  1TBE A;  2D9W A;  2KTR A;  3OAW A;  2LGD A;  2KUP A;  5L95 C;  5D3Y A;  3DXE A;  4GPT B;  1V5U A;  2FNJ B;  4HPL B;  4GN1 A;  4TUU A;  4IG7 B;  3APD A;  2H7D A;  3PRZ A;  1I2H A;  1V5O A;  2DHZ A;  2MQJ A;  2K6D B;  2V3S A;  5GOW B;  3T9L A;  3LJ3 A;  4MEL A;  3FLV A;  2I1K A;  2HD5 B;  1FXT B;  1WE7 A;  3VHT C;  4BOZ B;  2MBO A;  1X1G A;  1WG7 A;  5IAA C;  2LKO A;  5CLL B;  2BWF A;  3IVF A;  1RAX A;  2D07 B;  2GBK A;  5AZG A;  2HRJ A;  5IJM A;  1RJ2 A;  2A5U A;  3G9W A;  5J3Y A;  4ICV A;  4IFS A;  3L54 A;  2HTH A;  4ANU A;  3TBL D;  2NPT B;  5CHF A;  2LBB A;  3PHW B;  1WF9 A;  3D8E A;  3P7Z A;  1SE9 A;  4ZYN A;  2CB8 A;  3FSS A;  3DXD A;  2NBV B;  5JH5 C;  4MY6 A;  3TL5 A;  3ML9 A;  2C7H A;  2CR5 A;  1Y19 B;  2MBQ A;  1VCB A;  4X57 B;  4LDT D;  2MW5 A;  3VTV A;  1PLS A;  4GDK A;  2HJ8 A;  5BO4 B;  3PRP B;  4NNJ B;  2W2W A;  2O6V B;  3HIZ A;  2KWC A;  3T8M A;  3PP2 A;  2FCQ A;  4F7Z A;  4Z2M B;  1SGH A;  2K39 A;  1R4N I;  4K81 A;  1H4R A;  3NZS A;  3PRE A;  4KVG B;  4K7U A;  1FGY A;  5C79 A;  4KHO A;  2N0Y A;  2D4Q A;  2L00 B;  1LXD A;  3ZNZ B;  1WXA A;  4GXB A;  3ZIM A;  3ZRF A;  3ZNH B;  1WJ6 A;  1DDM A;  2MDX A;  4MGK E;  4MJS B;  2CRF A;  2BYV E;  2KQS A;  5KQ1 A;  2FJL A;  2DA0 A;  1RLF A;  2FID A;  3R7Q A;  2RQ1 A;  2KX3 A;  4NPN A;  1Z87 A;  4G0N B;  3A8Q A;  4IOY X;  4HCP B;  2AEH A;  3K9P B;  2LZ6 A;  2ZJD A;  4DX8 A;  2UZR A;  5J3T A;  1RFA A;  4JIO U;  1GG3 A;  3SV1 A;  1T0Y A;  1H10 A;  4FBJ B;  3B1L X;  5LLI A;  1Z5S B;  5JP4 A;  2NR2 A;  1V5M A;  2BF8 B;  2Z0E B;  4RMA A;  4ASW C;  1Q1O A;  1E8W A;  2J59 M;  2ZEQ A;  2DHI A;  3Q3F A;  3H7S A;  2IO0 B;  2AL6 A;  1TXD A;  2HTH B;  1FHX A;  1QZE A;  1N3H A;  2J7Q B;  1UBQ A;  4RM9 A;  3V5W A;  4TKN A;  3QWZ B;  2GS0 A;  1X11 A;  4AJY B;  3A9K A;  4HB2 B;  4EKU A;  3P6A A;  1WR6 E;  4HAX B;  4IWO A;  1WH3 A;  4E71 A;  1UNP A;  4GDK B;  4NQL B;  5JHB A;  2LI5 A;  4F8C B;  2COF A;  3D32 A;  5FI1 A;  2LRU A;  1NTI A;  4A20 A;  4MSM B;  3CSF A;  4K7S A;  2AYO B;  3CF6 E;  4NJ7 A;  3DPD A;  3EEC A;  1XOD A;  1ST7 A;  4B6H A;  2WYQ A;  4FHK A;  2COP A;  2VRR B;  3TVV A;  5LXI B;  4FUL A;  2QKL A;  4MGI E;  4NAW A;  4HAT B;  1PMS A;  2QHO A;  1Q67 A;  1ZKH A;  1E8X A;  1MIZ B;  3RYT A;  3V61 A;  1M7E A;  3PLU A;  4DHJ D;  2KX0 A;  2V76 A;  1OY2 A;  1NU2 A;  1NDD A;  1UGM A;  2MRP A;  3W1Y A;  1P3Q U;  3VOQ A;  3BJI A;  4IW0 A;  2C7N B;  1TZ1 A;  2FUH B;  1V2Y A;  3A1Q B;  2KGX B;  4GMV A;  3JW0 X;  1HB6 A;  1FHW A;  2LOX A;  1ZW7 A;  4HK2 A;  2D10 A;  1E7V A;  4E3C A;  4TQ1 A;  4HAV B;  3GYO A;  4KDL B;  3H9D A;  1X1F A;  4IC7 B;  1NBF C;  3ZDM C;  1V80 A;  2GBR A;  4OVU A;  1MK7 B;  3FEH A;  4CHK A;  1XQQ A;  5KQ4 A;  2M8S A;  3APC A;  5D3W A;  3KUD B;  2KWV B;  4EMO A;  3JSV A;  3KVF B;  1XKE A;  2UVM A;  3A9K B;  2MFQ A;  2G45 B;  2O2V A;  2MLB A;  1KZG A;  2LAS A;  1GJZ A;  1L7Y A;  3ZRC A;  1P3R A;  2AWT A;  4ZRK A;  4F7G A;  4WWP A;  1WI0 A;  5CTR C;  2DFK A;  3NY5 A;  1I42 A;  1P98 A;  3S2A A;  1U5E A;  1DBH A;  5AEK B;  1P0R A;  5KHO A;  2LUE A;  2CY4 A;  1Y8R C;  4HJK A;  4ANX A;  3I3T B;  1HBK A;  2N7E A;  3HW2 B;  4Y94 A;  2IBI B;  4GZU A;  3A98 B;  3DQV A;  4BKS A;  3QK0 A;  4ZDV A;  2W2X D;  5L83 A;  3UIO B;  4BOS C;  3NHE B;  3L17 A;  2R2O A;  1WGH A;  2JRH A;  3ODO A;  3A9J B;  4DWF A;  2R2Q A;  4NJ6 A;  2CKH B;  4G11 A;  4NAW B;  2KDF B;  4FJY A;  3UQA A;  3BY4 B;  2L05 A;  2MP2 A;  4DHZ B;  3RCP A;  1ZSQ A;  2M0X A;  1KI1 B;  3WAM A;  5D3V A;  1K5D B;  4DXA B;  4AP4 C;  1W1D A;  2L8J A;  4K1R B;  4E74 A;  3KYD D;  2IYB A;  5AZH A;  4WWO A;  3HM3 A;  1XD3 B;  3NOB A;  2D3G A;  2MWN B;  1AWE A;  2JUO A;  2AL3 A;  2OQB A;  4FHJ A;  5C1Z A;  2RVB B;  2JF5 A;  4KZ0 A;  1C1Y B;  2NMB A;  1GC7 A;  3L10 B;  5DPS A;  5EDS A;  2KJ6 A;  5GMV A;  2M14 A;  3PRM B;  2XQN M;  1HE8 A;  2WH5 A;  3RD2 A;  2NPT A;  1P1A A;  2ZZP B;  4I6P A;  2FCM A;  3D8D A;  2I1J A;  1X1M A;  4A3O A;  2N1W A;  2DAJ A;  3EFU A;  3JSV B;  1U29 A;  1WMH A;  2N9X A;  1XR0 B;  3KW5 B;  3CIK A;  3EHV A;  5D2M B;  3ULC A;  4M8N A;  3N3K B;  3DBL I;  1WXV A;  2EC1 A;  4XX5 A;  2OOB B;  5C6R A;  5DIF B;  4NY0 A;  3V6E B;  2KAN A;  4M8M A;  3VXW A;  3ZLZ A;  5D94 A;  2XBB C;  3PTF C;  2IY1 B;  3ALB A;  3ZKJ C;  2FIF A;  1WGD A;  2YVC A;  5J3Q A;  4NQK E;  4WJ7 A;  3ULB A;  2ELB A;  4WQO B;  2COA A;  1WR1 A;  4HHV A;  1Q5W B;  2LGX A;  1V81 A;  3ZTD A;  2L0F A;  4MJS A;  3L13 A;  3RZW C;  3F5R A;  2KFK A;  2MP2 B;  5DPT A;  3DCG A;  1OQN A;  3OAN A;  1J0W A;  1C3T A;  4MH0 E;  4K2O A;  1ZVR A;  4YON A;  1M7R A;  4HDO A;  1WXS A;  5D27 A;  2LWP A;  2REX A;  2K8C A;  1WJ4 A;  2UWQ A;  2V1Y A;  1NI2 A;  3F0W A;  2YSZ A;  3NS8 A;  4MGY E;  2DX5 A;  2D2Q A;  1SHC A;  5C5B A;  1S3S G;  3T06 A;  4URK A;  4IWQ A;  2KQ7 A;  2KCJ A;  4HDQ A;  1M94 A;  1GC6 A;  3ZO5 B;  4EZL A;  1YD8 U;  2I5C A;  3PLV A;  2D9V A;  4A6H A;  2DLW A;  1WMH B;  1I35 A;  3ZNG C;  2DZK A;  2UZS A;  1H8C A;  3QIJ A;  2PPH A;  4IM3 A;  5HE2 A;  1BAK A;  4KZC A;  2BPS A;  2C9W B;  4LJP B;  2C7M B;  1QQG A;  1IP9 A;  2KC1 A;  5DI9 B;  2FAZ A;  2LXA A;  2D11 A;  4HB4 B;  2L1C A;  3N30 A;  2DTC A;  2RNR B;  5FI0 A;  4ANW A;  1P6S A;  4XZ4 A;  2IZV B;  1UBI A;  2GBJ A;  3CXB B;  1F9J A;  3MTN B;  1FAO A;  1V9J A;  2KZR A;  3PG7 A;  1LW3 A;  3VUX A;  1UZX B;  1GUA B;  2DHK A;  1BTK A;  1UH6 A;  2R0D A;  5LOP B;  1WGY A;  4NSW A;  4II3 B;  4LJO B;  1OEY J;  2KFK B;  1R4M I;  3KSY A;  4P7I A;  3U7D A;  2JVC A;  3TO1 A;  2DKQ A;  2YRY A;  2IYD B;  2KKC A;  1OEY A;  3VAW A;  4TV3 A;  3PT2 B;  3LDZ E;  1PFJ A;  4MGZ E;  3UIP B;  1NVL A;  1Q0W B;  3A1Q A;  4WJQ A;  2LJ5 A;  2ELA A;  3TFM A;  1WE6 A;  2L7R A;  3CST A;  4W9D A;  3UZT A;  3R66 C;  2MX2 A;  3VIA A;  4PS7 A;  4AUQ C;  2ROZ B;  4OVV A;  4AOF A;  2KO3 A;  2N7D A;  4HWI B;  2UYZ B;  2KLC A;  3PPA A;  4HAZ B;  3QA8 A;  2NS5 A;  3RUL A;  2DX5 B;  2CHX A;  5CHW A;  2LOZ A;  5C5B B;  2J0J A;  2D9X A;  4BBK A;  2KFJ A;  3VH4 B;  2KHW B;  2GBN A;  2KK8 A;  3ECI A;  4HB3 B;  2L3Z A;  1EUV B;  4A6K A;  1XD4 A;  3Q3J A;  1FOE A;  1RRB A;  4WJN A;  4YL8 A;  4ZRI A;  1WZ0 A;  3B0A A;  4DX9 0;  3WYF B;  2N1V A;  1S1Q B;  1FHO A;  3MPX A;  1EF5 A;  4DBB A;  4K7W A;  3R7R A;  2CHW A;  5KHQ A;  1EAZ A;  3PVU A;  2PJH A;  2XK5 A;  3A4R A;  3ONS A;  2RPQ A;  3IFW B;  4W9F A;  3V60 A;  1UNQ A;  1A5R A;  1XCG A;  3ZTC A;  1DDV A;  5G55 A;  3A9J A;  3ZW3 A;  1U5G A;  3KY9 A;  5J17 A;  2C5L C;  4AWJ A;  3WAL A;  3DBR I;  1IRS A;  4ICU A;  1I7A A;  2NBU A;  3VH3 B;  3HHM A;  3QBV B;  2LD9 A;  2KJR A;  1YX5 B;  4CHM A;  1E8Y A;  5L81 A;  1WXM A;  1IPG A;  2GCL A;  4IAP A;  3RZF A;  3ZUN A;  2O6V D;  2G4S A;  1U2B A;  4KDI C;  2BKR B;  1MIX A;  2DHJ A;  2KDE B;  3IBE A;  3SUZ A;  3TIX A;  2FCS A;  2M38 A;  5HKH A;  1K5G B;  3C0R B;  1WJN A;  1DRO A;  5LON B;  2IO2 B;  4Z2N A;  1W1H A;  1BT0 A;  4F1S A;  1YJ1 A;  2N9P C;  4BVU C;  1DYN A;  3QAR A;  3UF8 A;  2KDI A;  2N9E B;  3TW1 A;  1V86 A;  1WJ1 A; 
#chains in the Genus database with same CATH topology
 4R3D A;  3PS6 A;  3P4R B;  2IY0 B;  4KHB A;  2DYQ A;  4EJN A;  3AEG B;  5E6O A;  1IGD A;  2ZKM X;  3FKY A;  2M17 A;  2X18 A;  2G35 A;  4EEW A;  1GNU A;  1QC6 A;  1MKE A;  1D3Z A;  2YS1 A;  5IP4 D;  2SAK A;  1JML A;  4KIK A;  2LYD A;  2R82 A;  4KGS A;  4W9J A;  3KUC B;  1PGB A;  2D9Z A;  2K25 A;  5D3X A;  3VTW A;  4GSW A;  4OT1 A;  1C76 A;  2N4F A;  2K1F A;  4W9H A;  4YWG G;  1FNW A;  1UNR A;  2Y8F A;  2D3B A;  2KMA A;  1WM2 A;  1AYF A;  3V6C B;  3GS2 A;  1WFY A;  1JWU D;  1YQB A;  2Z59 B;  4XWX A;  2CJO A;  2KD0 A;  3Q8F A;  2XK5 B;  3QAQ A;  1TTN A;  5HI1 A;  1RRP B;  2X38 A;  4B0M A;  3IT4 B;  4KSK C;  2W82 A;  3V3X A;  3X23 A;  1OMW A;  1Z2M A;  2VRW B;  4DDG D;  5G2N A;  4OHJ A;  5FKA C;  4YTN B;  2P0F A;  4KSL C;  2BYF A;  4M00 A;  3U7Z A;  1ZDX A;  2MBE A;  4PYZ A;  4I6N B;  4B6W A;  4HAY B;  1UPQ A;  1YQ4 B;  4GOC A;  3H7P A;  1XCQ L;  4C00 A;  2Y5C A;  4YXD B;  1F1H A;  1LB1 A;  5JHA A;  1ZGU B;  1EGX A;  4KKJ A;  3LYY A;  4RGO S;  3KZ1 A;  2WXL A;  1XLQ A;  1WWT A;  3TJP A;  2OJR A;  2JP2 A;  2KJH B;  3QC8 B;  2NZ8 B;  4GGQ A;  1XX0 A;  1MFW A;  5DCN A;  4BAX A;  3PGE A;  3U52 E;  2NMQ A;  3Q8E A;  2J4X A;  2ZVN A;  2MBB B;  3P2B A;  3VQI A;  1QOF A;  1MHH E;  1V8C A;  3ZYY X;  2DZJ A;  1VD2 A;  5HE1 A;  2GRI A;  4FJV B;  3A4S C;  1BUI C;  3TEX A;  3TMP B;  1VZ7 A;  4LDT B;  2PLP A;  1V88 A;  4A6F A;  1WGG A;  2GJY A;  3TCA A;  1LGR A;  1TY0 A;  1WIA A;  5M4Y B;  2A4Z A;  3O13 A;  2EMS A;  1UPR A;  5JLJ B;  1V5P A;  2MJ3 A;  2WNM A;  3AE1 B;  1WRD B;  2BYE A;  2P0D A;  1I4R A;  2FJ9 A;  1NTV A;  1PGA A;  4RCO A;  3E66 A;  2JZ3 B;  1RFK A;  1WYW B;  2QKM A;  3OJ4 B;  2WXP A;  3AU4 A;  4LNO A;  3PSC A;  4DIX A;  2H7E A;  4M0W A;  3NZ3 A;  4IM2 A;  4KHB B;  1B9R A;  2RGN B;  1IYF A;  3JYU A;  2FCN A;  4DK5 A;  3CMM B;  4ILJ A;  2ZVO A;  2LVP A;  1SB3 C;  4MSQ B;  4W9K A;  3ZQ4 A;  2YS3 A;  1WI1 A;  5DPW A;  1WJM A;  2RUK B;  2B3A A;  4KIK B;  4BKT A;  2ZCB A;  2LUL A;  2G3Q B;  5JVL A;  1EVH A;  4GOU A;  3L08 A;  2LRW A;  3DVG Y;  4ZRQ A;  4W9I A;  2LVO A;  1WX8 A;  1FGZ A;  4A3P A;  4IWP A;  3NSU A;  5JHG A;  1FXI A;  2BCJ A;  3H1U A;  2DZM A;  4L23 A;  4GDL A;  4US9 A;  5E6P A;  3RNC C;  4CYE A;  5DHF B;  1Q10 A;  4G50 A;  3M62 B;  2YT0 A;  4MT7 A;  2WDV B;  4EZJ A;  3DBH I;  3KRX A;  1WX9 A;  4A90 A;  2DX1 A;  4P6V F;  2ASQ A;  2PE9 A;  4II2 B;  4L1R A;  4N59 A;  4WSF A;  2M1M A;  1V1P A;  4BFR A;  1HB8 A;  2ZNV C;  2YF0 A;  3VUW A;  1OQQ A;  2ROV A;  3WAP A;  1CK1 A;  2KNB A;  2L0T A;  1YX6 B;  1KLV A;  2HE7 A;  2KAC A;  3DOW A;  2K49 A;  3O65 B;  1TS5 A;  5CX3 A;  4QJ5 B;  2PZ1 A;  2JY6 A;  4A55 A;  5C3J B;  5D7G A;  3SYX A;  3GP7 A;  2LGY A;  4A8X C;  1J8C A;  2CU3 A;  2CAY A;  1FB8 A;  5J2R A;  3H7P B;  3WAN A;  2KR0 A;  2KDM A;  3TUO A;  1MG8 A;  4TMA B;  3I63 C;  3SU8 X;  4O1N A;  4HCN B;  2EKE C;  2OTX A;  3ZJV A;  1YOV B;  2BGF A;  4XGA B;  2KN5 A;  2EJ8 A;  1TKY A;  4P16 A;  1E0Z A;  2NBW B;  3X0W A;  2MCN B;  2CY5 A;  1U27 A;  4AJW A;  3NWA A;  2X8X X;  2VH1 A;  4LNN A;  1BWN A;  4HAW B;  2VSZ A;  1YJJ A;  1V61 A;  3NW8 A;  4A6F B;  1V6E A;  3BIN A;  4FN2 A;  4QAY A;  1N60 A;  3AB5 A;  5HE0 A;  2ZPN A;  3SDL C;  4IUM B;  3MHS D;  3RNF C;  4MDK E;  2D9Y A;  3NZU A;  1EF1 A;  1XT9 B;  1GB1 A;  2I5F A;  3N32 A;  4YSY B;  4JKH A;  3B08 A;  4OZA A;  1ISN A;  2DAF A;  2W3R A;  5C16 A;  4A5K A;  2JWZ A;  4M0W B;  1HXY D;  4GIV A;  2K3U A;  2MHJ A;  1VZ6 A;  3SNH A;  1ZC3 B;  4D6W A;  3D8F A;  4LLG M;  3ENE A;  1QOG A;  3DDC B;  2VKI A;  2PEA A;  3LB8 C;  3AMZ A;  3L0W B;  3SFD B;  2BS2 B;  1ZYI A;  3LXF A;  5FK9 C;  2Q5W D;  2Z0P A;  4USA A;  5E6N A;  2BT6 A;  3QQ8 B;  3KYC D;  1PYW D;  1E5W A;  4GDL B;  1WVH A;  2DN6 A;  3NG0 A;  2WXN A;  2R2Y A;  1JAL A;  2V3N A;  4DHJ B;  1EWC A;  4WWN A;  4KV2 A;  1LFD A;  2ACZ B;  2LGS A;  3PHX B;  4F7U P;  1ROE A;  3Q14 C;  3MC8 A;  1Y5O A;  2PW9 A;  4AS1 A;  3SEB A;  2RLO A;  2Z0Q A;  2K9X A;  2RR9 A;  3A33 B;  1V1P B;  4J6I A;  1V89 A;  3AE5 B;  1NTY A;  2PE6 B;  3M1I B;  2AQ2 B;  4XC2 A;  4PNK A;  1KZ7 A;  3QWM A;  2H88 B;  3ZXV A;  1JQ4 A;  1PQS A;  3HVZ A;  4K3B A;  2Q13 A;  1K8R B;  3ML4 A;  4BKG A;  1T0Q C;  5G5H A;  4L2Y A;  3N1Y C;  2G4D B;  1C4P A;  3SD5 A;  2IO1 B;  4H2A A;  5TSS A;  1TKE A;  4RGM A;  1WX7 A;  2KTR B;  2WX0 A;  3AI5 A;  1ZC4 B;  1UD7 A;  1YN3 A;  1T0S C;  4L6E A;  4KX6 B;  2INN E;  1JRU A;  1BTN A;  3N7C A;  2C60 A;  1P9D U;  1OFF A;  4IKG A;  2CQU A;  1X86 A;  2KAJ A;  1KLG D;  1CMX B;  1CZP A;  4ANV A;  1ZE3 D;  2COC A;  4K17 A;  2QIE B;  5D6J B;  3URY A;  3AEC B;  2P0H A;  1X05 A;  1SXT A;  3PV1 A;  2Y5B B;  2KMC A;  5DH9 B;  3DBL B;  4W9C A;  4EFO A;  4FJZ A;  1L6V A;  4XE0 A;  1TYG B;  2RSU A;  1G6J A;  2Y7B A;  3U12 A;  5FR6 A;  1B55 A;  2HDE A;  1E7U A;  3QHT A;  2WX1 A;  1VBH A;  3NS1 A;  1EO6 A;  3GZN B;  1AAR A;  3M95 A;  4I6L B;  1FO4 A;  3EA6 A;  2JT4 B;  4BKS D;  4C0A A;  1N6Z A;  3B2F A;  4C7Y A;  1JWM D;  2WXH A;  5HHD G;  3V62 A;  1TGZ B;  5AUK A;  3QX1 A;  3PSE B;  4ILH A;  3L16 A;  1AWD A;  3HM6 X;  2K2U A;  1LQB A;  3IG3 A;  3C8Y A;  2I38 A;  3P4S B;  4HRS A;  2K22 A;  3V05 A;  2WGS A;  3TEW A;  4EOY A;  1U5F A;  2V4I B;  5KCV A;  3I57 A;  1WJU A;  2DKP A;  3AUL A;  1F0Z A;  1KOT A;  3A8P A;  1CQV A;  2NTT A;  2FDQ A;  2WXQ A;  1UEL A;  1J19 A;  4PS8 A;  2W9N A;  3CIR B;  2Z0O A;  2WLB A;  1T77 A;  1YJI A;  5HFY A;  1ZXI A;  2WQY B;  2JXX A;  4B95 A;  4HB0 B;  1IUE A;  2I2Y A;  3DXC A;  1KBL A;  3U8Z A;  2IGD A;  3PEG A;  1J7C A;  2M4N A;  3MJW A;  3K9O B;  5EFX A;  3UIN B;  1L0X B;  2MEK A;  2GB1 A;  2GBM A;  1MJD A;  4EZK A;  2CS4 A;  1WM3 A;  2MA9 B;  3DVN V;  4LCD E;  1WGU A;  4HAU B;  3RUI B;  1D6E C;  2KDB A;  1ACA A;  3O96 A;  1WXQ A;  3BK1 A;  2RGF A;  2LMC A;  2KWU B;  2RRF A;  3B2G A;  4JKC A;  3L4P A;  2LJI A;  3RCZ A;  2BVC A;  1D5X C;  2PVO D;  3M3J A;  3VDZ A;  2K6Q A;  1XEE A;  1HEZ E;  2L76 A;  2DYN A;  1DIK A;  3PVL A;  5CHV C;  3PZD A;  3ZVV A;  4WQM A;  1OQR A;  2WDT B;  1WRI A;  1C4C A;  1OGW A;  1WY8 A;  1UEF A;  2MWS B;  1V49 A;  1AQC A;  3APF A;  3GOE A;  4D0N B;  2JZP A;  2IO3 B;  2EMT A;  3FM8 C;  2E2X A;  3VFK A;  3DBS A;  2DEN B;  2P8V A;  3OLM D;  3NRZ A;  4QJ4 B;  4GB9 A;  2WXO A;  2N9K A;  2NCN A;  3U30 A;  5J18 A;  2ZNV B;  4G3X B;  1DDW A;  2GCJ A;  2DYO A;  3DWG C;  3RT3 B;  3FP5 A;  2JPH A;  2YLM A;  3KH0 A;  2KIG A;  3KLS X;  2ADZ A;  3ZVR A;  1KJT A;  4FXC A;  2BKF A;  1E8Z A;  1YQ3 B;  1R4N B;  3JVZ X;  4H8S A;  2QDF A;  2XEW A;  2ICI A;  4N9F 4;  1MAI A;  2LFI A;  4EUT A;  3P63 A;  2K5P A;  3QJZ A;  3QCA A;  1JDE A;  4DHZ E;  5BYQ A;  2Y8G A;  3RPF C;  4PQ0 A;  5AZF A;  4KAX B;  2JYT A;  3SO6 A;  1YN5 A;  2R09 A;  4ZRJ A;  2GI9 A;  3KUZ A;  2KXJ A;  4BBN C;  1FFV A;  4W9G A;  4CO7 A;  4HPP A;  4K2P A;  4WJP A;  5C2T B;  2MKR A;  4DBG A;  1AN8 A;  3W1S C;  1ACC A;  4RF0 A;  2WWZ A;  4MM3 A;  2WXG A;  1MK9 B;  1WGR A;  2N23 A;  1FMA D;  1OQY A;  2MBH A;  3UQB A;  3M63 B;  2D5G A;  1DOX A;  5HE3 A;  3VTU A;  2KOX A;  4ARI A;  2V4L A;  1FCL A;  3EPY A;  3R3M A;  1MG4 A;  3ZJU A;  4XWT A;  4RH6 A;  4HVB A;  2DNF A;  4QXA B;  3ODX A;  2J42 A;  1J7A A;  2V3P A;  5C23 A;  3VR8 B;  1YNT E;  1KFY B;  4PYU A;  5JHH A;  4ILG B;  1C77 A;  2J0M A;  3OJ3 A;  2Z4D A;  2K00 A;  3PZ8 A;  3AH7 A;  3DVN U;  1KM7 A;  2K8B A;  2J0K A;  2IPK D;  3KRW A;  1SIF A;  2BTE A;  2JXT A;  2ZPY A;  1V5T A;  1C9F A;  1WGQ A;  4HLE A;  1IBX B;  2BWE S;  1T5X D;  5DHA B;  3WIM A;  4F7H A;  2Z8L A;  4HXD A;  1XXG A;  2IDY A;  5IOI A;  5DPR A;  4PT5 A;  4RM8 A;  1W1G A;  2BS4 B;  1SJH D;  1TZO A;  4W9L A;  3HQC A;  4GLS C;  1ZM0 A;  1RM6 C;  4MAC A;  3AU5 A;  1GPX A;  2Z0D B;  4S17 A;  4IDI A;  3DWM A;  2IJ0 A;  2L2I A;  4DDI D;  2W54 A;  2GMI C;  4WIP A;  2KC2 A;  1MPH A;  2G1E A;  2LXC A;  4PS3 A;  4HPM B;  4NJC A;  2W2X C;  2JRI B;  4GU2 A;  1WYG A;  3ZJT A;  3ML8 A;  4YSZ B;  1T6B X;  3DVG X;  2AX5 A;  2DWQ A;  5FR3 A;  1MPE A;  4W9E A;  4BBN F;  1ESF A;  1FM0 D;  2COD A;  5D3I B;  4REZ A;  2WXI A;  2YS5 A;  4WAA A;  1J0G A;  1ZOY B;  1U4A A;  4XYC A;  1EU4 A;  2KMM A;  5IA7 A;  2KTF A;  3MDB C;  3PVW A;  5JZE B;  1HTQ A;  2YT1 A;  3ENB A;  1YIW A;  4JGH B;  2CHZ A;  3N1X C;  2RMM A;  2LG1 A;  2ON8 A;  3C19 A;  3ZNI D;  1Y56 A;  2DYM A;  1HQR D;  4FLH A;  2K2J A;  1VLB A;  2GUM A;  2IGG A;  2GOW A;  1OTR B;  2ABD A;  2V0G A;  2W55 A;  1U5D A;  1WZ3 A;  3AXC A;  1CJE A;  4JKE A;  2INP E;  4WVF B;  3ABV B;  3HK0 A;  4KHA A;  4US8 A;  4OZB A;  2WU2 B;  2WXR A;  5LXH A;  5TR5 A;  2CJN A;  4ZOH C;  4TQ0 A;  2FBW B;  1PDX A;  1LM8 B;  2FUG 1;  3EC8 A;  5EE0 A;  2KIE A;  4WJO A;  3WAO A;  2JZZ A;  3AE4 B;  4OW0 A;  4MK0 A;  2K8H A;  4MM3 B;  3VUY A;  5CLQ B;  2IND C;  4M01 A;  2KLG A;  3U2S C;  2WXM A;  3LJU X;  2NVU I;  4JLC A;  2NBV A;  2RSG A;  2DYB A;  3VVW B;  5BYR A;  3AJ4 A;  2PIA A;  4B9K A;  2IFS A;  5T8I A;  1ZDV A;  2CU1 A;  2RD0 A;  4MEM A;  1D4B A;  3WA0 A;  1P7F A;  3UGB B;  4GMX B;  4FAD A;  2O2V B;  2DZI A;  2ZW1 A;  4LK0 M;  3SHQ A;  4IM0 A;  2QSD A;  4MT5 A;  1QKZ A;  4JL9 A;  4N6E B;  1E90 A;  2O6V A;  3GYP A;  4TYZ A;  3ODW A;  2EEL A;  4JQW C;  4FA6 A;  1P5T A;  3ZDT A;  3EGR A;  1L2N A;  1SBB B;  4DXF A;  3H6N A;  3PO0 A;  4OZC A;  2LVQ A;  3RNA C;  2ZCC A;  1TQZ A;  3IHP C;  2MJE A;  3W1S A;  3RFZ B;  3A58 A;  3GZN I;  2MSE D;  1TJ6 A;  3BVG A;  1FXA A;  2KVR A;  1B1Z A;  4CHJ A;  2BW2 A;  1TBE A;  2D9W A;  2KTR A;  3OG5 A;  3OAW A;  2LGD A;  2KUP A;  5L95 C;  1EM7 A;  1DOY A;  3W5U B;  3RNE C;  5D3Y A;  4CSQ A;  3DXE A;  4GPT B;  2TSS A;  1RWS A;  1V5U A;  2FNJ B;  4HPL B;  4GN1 A;  1C78 A;  3P4P B;  4TUU A;  3UI3 A;  4IG7 B;  3SBT A;  2QJL A;  3APD A;  4RGT A;  2H7D A;  1A70 A;  1I4Q A;  2INC C;  3PRZ A;  1I2H A;  4DXG A;  1FFU A;  2EKI A;  1V5O A;  1PFD A;  2DHZ A;  2MQJ A;  3AE2 B;  2OED A;  3EFC A;  4ZYS A;  2K6D B;  3R8B A;  2V3S A;  5GOW B;  3T9L A;  3LJ3 A;  4MEL A;  3FLV A;  2I1K A;  2HD5 B;  1FXT B;  2E3T A;  1WE7 A;  3VHT C;  2DIK A;  4BOZ B;  2MBO A;  1X1G A;  2BYT A;  1WG7 A;  1SE2 A;  5IAA C;  2LKO A;  5CLL B;  3TEZ A;  3AV8 A;  1FPY A;  2BWF A;  3IVF A;  1RAX A;  1RYJ A;  2D07 B;  2GBK A;  5D3D A;  1YMH E;  5AZG A;  2HRJ A;  5IJM A;  1RJ2 A;  2A5U A;  3G9W A;  5J3Y A;  4JK8 A;  2JYE A;  3BVZ A;  4YSX B;  4MH8 A;  4ICV A;  4IFS A;  2VH2 A;  3L54 A;  1I4X A;  1VJK A;  3P1M A;  1ZXH A;  2HTH A;  4ANU A;  3TBL D;  3BVM A;  1TS2 A;  2NPT B;  4JKG B;  5CHF A;  3HRD D;  4BZA A;  2LBB A;  2WDQ B;  3PHW B;  1EU3 A;  1WF9 A;  3D8E A;  3P7Z A;  1HTO A;  1SE9 A;  4ZYN A;  2CB8 A;  1SEB D;  2R61 A;  3FSS A;  3DXD A;  2NBV B;  5JH5 C;  4MY6 A;  3TL5 A;  3FAH A;  3ML9 A;  1KF6 B;  2C7H A;  2CR5 A;  1E10 A;  1Y19 B;  4S0R A;  2MBQ A;  1VCB A;  2KVZ A;  2J52 A;  1QIL A;  1I7H A;  3RNB C;  4X57 B;  4LDT D;  2MW5 A;  3VTV A;  1PLS A;  4GDK A;  2HJ8 A;  5BO4 B;  1HZ6 A;  4JKA A;  3PRP B;  4NNJ B;  2W2W A;  2O6V B;  3HIZ A;  3HVD A;  2KWC A;  1ZP0 B;  3T8M A;  3PP2 A;  2FCQ A;  2WS3 B;  4C7Z A;  4F7Z A;  2QEJ C;  4Z2M B;  1SGH A;  2K39 A;  1R4N I;  4K81 A;  1PGX A;  1H4R A;  3NZS A;  3PRE A;  4KVG B;  4K7U A;  5EE3 A;  1FGY A;  1UWX A;  5C79 A;  4KHO A;  2N0Y A;  1XCT L;  2D4Q A;  3OHM B;  2L00 B;  1LXD A;  3ZNZ B;  1FIQ A;  4GNK B;  1WXA A;  4JWS C;  4GXB A;  2VZK B;  5G5G A;  3ZIM A;  3ZRF A;  1N62 A;  3ZNH B;  1WJ6 A;  3T3N A;  1DDM A;  2MDX A;  1P7E A;  1SIJ A;  4MGK E;  4MJS B;  2CRF A;  2BYV E;  2KQS A;  5KQ1 A;  2FJL A;  2DA0 A;  1RLF A;  2FID A;  3BZD B;  1TS4 A;  3N1Z C;  4YTM B;  1VZ8 A;  4OVZ A;  3R7Q A;  2RQ1 A;  2KX3 A;  4NPN A;  2Y3A A;  1Z87 A;  4G0N B;  1VBG A;  3A8Q A;  4IOY X;  1F77 A;  1C4A A;  4HCP B;  2AEH A;  3K9P B;  3AM9 A;  2LZ6 A;  3KWL A;  1TY2 A;  2ZJD A;  4DX8 A;  2UZR A;  5J3T A;  1RFA A;  3H8H A;  4JIO U;  4KGT A;  1GG3 A;  3IAM 1;  4RFB A;  3SV1 A;  1T0Y A;  1H10 A;  4KKI A;  1EWY C;  4JKB A;  3B1L X;  4FBJ B;  5LLI A;  1Z5S B;  5JP4 A;  2NR2 A;  1V5M A;  2BF8 B;  2Z0E B;  4RMA A;  4TSS A;  4ASW C;  1Q1O A;  4ZHP A;  1E8W A;  2J59 M;  2ZEQ A;  2DHI A;  3Q3F A;  3H7S A;  1XLO A;  2IO0 B;  2AL6 A;  3VR9 B;  4JK7 A;  4XDD A;  1TXD A;  2HTH B;  4RGN A;  2IGH A;  1FHX A;  1QZE A;  1N3H A;  3W2D A;  2J7Q B;  1UBQ A;  2KYW A;  3AEF B;  2M56 B;  4RM9 A;  3V5W A;  4TKN A;  1UWM A;  1QQR A;  3QWZ B;  2GS0 A;  1X11 A;  4AJY B;  3EUB 2;  3A9K A;  4HB2 B;  4EKU A;  3P6A A;  1WSP A;  2Z14 A;  1WR6 E;  4HAX B;  4C4V B;  3NVW A;  4IWO A;  3E56 A;  4WUR A;  1WH3 A;  4E71 A;  2L83 A;  1ZPS A;  4IOI E;  1YN4 A;  1UNP A;  1E7P B;  4GDK B;  4NQL B;  3BK2 A;  5H8Y E;  5JHB A;  5IO9 A;  1XLN A;  1N61 A;  2LI5 A;  4F8C B;  2COF A;  1FRD A;  3D32 A;  3I9V 1;  5FI1 A;  4LNK A;  2LRU A;  1NTI A;  3AE6 B;  1IBX A;  4HSI A;  3AEB B;  5IKC M;  4A20 A;  3U4E G;  2RDB C;  4MSM B;  3CSF A;  3Q6B A;  4K7S A;  3W5V B;  2AYO B;  5EE9 A;  3CF6 E;  2PKO A;  4HJG E;  1ET9 A;  2B76 B;  3NVZ A;  4NJ7 A;  3DPD A;  3EEC A;  3HIE A;  3R2I A;  4ARC A;  3MJ5 A;  1XOD A;  1V1O A;  4RF1 A;  1ST7 A;  2WXK A;  4B6H A;  2WYQ A;  4FHK A;  2COP A;  2VRR B;  3TVV A;  5LXI B;  4FUL A;  3BII D;  2QKL A;  4MGI E;  4NAW A;  5I2S A;  2WP9 B;  1FNU A;  4HAT B;  1XO3 A;  3MP9 A;  1PMS A;  2QHO A;  1Q67 A;  1ZKH A;  1L5P A;  1N5W A;  1E8X A;  1MIZ B;  2WDR B;  2HJ1 A;  3RYT A;  3V61 A;  1M7E A;  3PLU A;  1TKG A;  1JWB D;  4DHJ D;  2KX0 A;  1OY2 A;  2V76 A;  1NU2 A;  2WU5 B;  3B9J A;  1FNV A;  1NDD A;  2D3A A;  1UGM A;  2MRP A;  3W1Y A;  1P3Q U;  1L0Y B;  3Q2A C;  3VOQ A;  3BJI A;  4IW0 A;  5EE1 A;  2C7N B;  1TZ1 A;  2FUH B;  1V2Y A;  3A1Q B;  2KGX B;  3CWI A;  4GMV A;  3JW0 X;  1HB6 A;  4NAM A;  4WWM A;  1FHW A;  2LOX A;  1ZW7 A;  1PUT A;  4HK2 A;  2D10 A;  1E7V A;  3SR6 A;  4E3C A;  4TQ1 A;  4HAV B;  3T3O A;  2L1A A;  3GYO A;  1D5Z C;  4KDL B;  3H9D A;  1X1F A;  4IC7 B;  1NBF C;  1VR9 A;  3ZDM C;  4HKZ E;  1V80 A;  2GBR A;  4OVU A;  1MK7 B;  3FEH A;  4CHK A;  1XQQ A;  5KQ4 A;  1GOZ A;  1MVK A;  2M8S A;  1R4M B;  3APC A;  5D3W A;  3TSS A;  3KUD B;  3NVV A;  2KWV B;  4EMO A;  3JSV A;  3KVF B;  3MFG A;  1XKE A;  3WCQ A;  2UVM A;  2DBY A;  1UGJ A;  1NI3 A;  3A9K B;  4B0E A;  3DHH C;  2MFQ A;  2G45 B;  3HSA A;  5LG4 B;  2O2V A;  2MLB A;  4ACF A;  3Q8A A;  5BYS A;  1KZG A;  2LAS A;  3AE7 B;  4CQN A;  3NWF A;  1GJZ A;  1L7Y A;  4ZHO A;  3ZRC A;  4LNI A;  3AE3 B;  1STE A;  1P3R A;  2AWT A;  4ZRK A;  4F7G A;  4WWP A;  4HKQ A;  4WAF A;  4ZRP A;  4KGR A;  1GAQ B;  1WI0 A;  3AN1 A;  1UF0 A;  5CTR C;  2DFK A;  3NY5 A;  1I42 A;  2LHD A;  1P98 A;  3S2A A;  5IN7 A;  1JW9 D;  2MH7 A;  1U5E A;  1DBH A;  5AEK B;  1P0R A;  2JQR B;  4HRO A;  5KHO A;  2LUE A;  3FVC A;  2CY4 A;  1Y8R C;  4HJK A;  4ANX A;  3I3T B;  3NWD A;  1HBK A;  1D5M C;  3HW2 B;  2N7E A;  4Y94 A;  2IBI B;  4GZU A;  3N20 C;  3A98 B;  3DQV A;  4LTU A;  4BKS A;  3QK0 A;  4ZDV A;  2W2X D;  3AE8 B;  2BB5 A;  3UIO B;  5L83 A;  4BOS C;  3NHE B;  3L17 A;  2R2O A;  1WGH A;  2JRH A;  4JWU C;  3ODO A;  3A9J B;  4DWF A;  2R2Q A;  1AW7 A;  2FE8 A;  2CKH B;  4NJ6 A;  1KLU D;  4G11 A;  4NAW B;  2KDF B;  2JX5 A;  4FJY A;  2BQQ A;  1DYQ A;  1L6U A;  4PK1 A;  3UQA A;  3BY4 B;  2L05 A;  3Q8C A;  1K50 A;  2MP2 A;  3MC9 A;  1QLB B;  4DHZ B;  3RCP A;  5MPO A;  1ZSQ A;  5BMI A;  4P1C C;  2M0X A;  1KI1 B;  3WAM A;  1BXT A;  5D3V A;  4ITK A;  5I4D A;  1K5D B;  4DXA B;  4Q2J A;  4AP4 C;  2JWU A;  1W1D A;  2L8J A;  4HEA 1;  4K1R B;  2ZW0 A;  4E74 A;  3KYD D;  2KT7 A;  1QOA A;  2WXJ A;  2IYB A;  5AZH A;  1NYQ A;  5AUI A;  1DGJ A;  4WWO A;  5LNK 1;  3HM3 A;  1XD3 B;  3NOB A;  5BMH A;  2D3G A;  2MWN B;  1AWE A;  2JUO A;  2AL3 A;  2D3C A;  2OQB A;  4FHJ A;  1HA5 A;  1MHX A;  1JWS D;  5C1Z A;  2RVB B;  2JF5 A;  4KZ0 A;  3GE3 C;  1SF0 A;  1JWA D;  1N5X A;  2V9H A;  1C1Y B;  2NMB A;  1GC7 A;  3L10 B;  5DPS A;  5EDS A;  2KJ6 A;  5GMV A;  2M14 A;  3PRM B;  2XQN M;  1HE8 A;  2WH5 A;  2RDH A;  3RD2 A;  2NPT A;  3DBR B;  4JKG A;  1P1A A;  2ZZP B;  4I6P A;  2FCM A;  3KWV A;  3D8D A;  2I1J A;  1QT9 A;  1X1M A;  1FRR A;  4A3O A;  2N1W A;  1T3Q A;  2SEB D;  2DAJ A;  1KC7 A;  3EFU A;  3N9Y C;  3JSV B;  1U29 A;  1WGK A;  1WMH A;  3SFE B;  2M0A A;  3FIL A;  2N9X A;  1E6E B;  4WH4 A;  4J3O D;  3IT6 B;  1XR0 B;  1ET6 A;  3CIK A;  3KW5 B;  1DOI A;  2K0P A;  3EHV A;  5D2M B;  3ULC A;  1KH0 A;  1MI0 A;  2YEP B;  4M8N A;  2BS3 B;  3N3K B;  2JSV X;  3DBL I;  1WXV A;  2EC1 A;  1L0V B;  1TS3 A;  1GGO A;  4XX5 A;  2OOB B;  5C6R A;  1KTK A;  1VDV A;  5DIF B;  3MHZ A;  2HTM E;  4NY0 A;  3V6E B;  2KAN A;  4M8M A;  4UDU C;  3VXW A;  3ZLZ A;  4OSN A;  5D94 A;  2XBB C;  3PTF C;  2IY1 B;  3ALB A;  3ZKJ C;  2FIF A;  3Q8B A;  1WGD A;  2H89 B;  3IXS A;  2YVC A;  5J3Q A;  4NQK E;  3AEE B;  4RNA A;  4WJ7 A;  3ULB A;  1NVI D;  1TJE A;  2ELB A;  4JX1 C;  2L52 A;  4WQO B;  2COA A;  2LHE A;  1WR1 A;  4HHV A;  1FD6 A;  1Q5W B;  2LGX A;  4QJ3 B;  2WHI A;  1V81 A;  3ZTD A;  1FEH A;  2L0F A;  4MJS A;  3RNG C;  3L13 A;  1V97 A;  1FCC C;  3RZW C;  3NUH B;  3F5R A;  1NEK B;  2KFK A;  2MP2 B;  3Q3N C;  5DPT A;  2RPV A;  3DCG A;  1OQN A;  3OAN A;  2X0S A;  1J0W A;  1SE4 A;  1C3T A;  4MH0 E;  3DHI C;  4YT0 B;  4K2O A;  1ZVR A;  4YON A;  1M7R A;  4HDO A;  1WXS A;  5D27 A;  2GLS A;  3R2T A;  2LWP A;  2BBC A;  2REX A;  3OWE B;  2K8C A;  2G9H D;  3W9C B;  1WJ4 A;  1GB4 A;  2UWQ A;  1K52 A;  1N63 A;  2V1Y A;  1NI2 A;  3F0W A;  4P1B C;  4EE2 A;  2YSZ A;  3NS8 A;  2OHF A;  4MGY E;  4DQO C;  2DX5 A;  2D2Q A;  1SHC A;  2YT2 A;  5C5B A;  1S3S G;  2DLB A;  3T06 A;  5HG2 A;  4URK A;  4IWQ A;  2KQ7 A;  3Q3M C;  2KCJ A;  1TT5 B;  1J7B A;  4HDQ A;  1M94 A;  1GC6 A;  3RN9 C;  3ZO5 B;  1ZUD 2;  4EZL A;  4K3C A;  1YD8 U;  2Z13 A;  2I5C A;  3PLV A;  2D9V A;  4A6H A;  2DLW A;  1WMH B;  2QIL A;  4C80 A;  1I35 A;  4C4V A;  3FIL B;  1QF6 A;  3ZNG C;  2DZK A;  2UZS A;  1H8C A;  3I5J C;  4JKF A;  3QIJ A;  4NZL B;  2NTS A;  2PPH A;  4IM3 A;  2ONQ A;  1BML C;  5HE2 A;  1BAK A;  4KZC A;  3VRB B;  2BPS A;  2C9W B;  4LJP B;  2C7M B;  1QQG A;  1IP9 A;  2LXA A;  5DI9 B;  2FAZ A;  2KC1 A;  2XNA C;  3RMK C;  2D11 A;  4HB4 B;  3P4Q B;  2L1C A;  3N30 A;  3NVY A;  3AE9 B;  1SSN A;  2DTC A;  2RNR B;  5FI0 A;  1M4V A;  4ANW A;  1P6S A;  2KQ4 X;  4XZ4 A;  2IZV B;  1UBI A;  2GBJ A;  3MC0 B;  3CXB B;  1HZ5 A;  1F9J A;  4L1B A;  3MTN B;  3TEY A;  1FAO A;  1V9J A;  1NEN B;  2KN4 A;  2KZR A;  3PG7 A;  1LW3 A;  3DCX A;  3VUX A;  1UZX B;  1NYR A;  1GUA B;  1TIF A;  1F52 A;  3J9C A;  2DHK A;  1BTK A;  5H92 C;  1UH6 A;  2R0D A;  5LOP B;  1F2R C;  1WGY A;  4NSW A;  2N9L A;  4II3 B;  4LJO B;  2N0S B;  1OEY J;  3DHG C;  1MI1 A;  2LUM A;  1XLP A;  2KFK B;  1R4M I;  1XF5 L;  3KSY A;  4P7I A;  3U7D A;  2JVC A;  3TO1 A;  1I4G A;  1JCK B;  1VRA B;  2DKQ A;  2YRY A;  2IYD B;  2KKC A;  4A9A A;  1OEY A;  2QMT A;  3VAW A;  3DBH B;  4TV3 A;  3PT2 B;  3LDZ E;  1PFJ A;  4MGZ E;  1SE3 A;  1K53 A;  3UIP B;  1NVL A;  1Q0W B;  3A1Q A;  2L32 A;  2PVG C;  4WJQ A;  2LJ5 A;  2ELA A;  3B77 A;  3TFM A;  1WE6 A;  2L7R A;  3CST A;  3E9S A;  4W9D A;  3UZT A;  3Q3O C;  3R66 C;  5I2M A;  2MX2 A;  2XN9 C;  1QOB A;  3VIA A;  4PS7 A;  3RI7 C;  3E9L A;  4AUQ C;  2ROZ B;  2RDG A;  4OVV A;  4AOF A;  2KO3 A;  2M19 A;  2N7D A;  4HWI B;  3IAS 1;  2UYZ B;  2KLC A;  3PPA A;  4HAZ B;  3QA8 A;  2QC8 A;  2NS5 A;  2LGI A;  3RUL A;  2DX5 B;  2E6X A;  2CHX A;  5CHW A;  3E9O A;  2LOZ A;  5C5B B;  2J0J A;  1L4D B;  2D9X A;  4BBK A;  2KFJ A;  3VH4 B;  1R7S A;  2KHW B;  2KWD A;  2GBN A;  3SBG A;  5IRS A;  2KK8 A;  3ECI A;  1JRO A;  4HB3 B;  3PZ7 A;  3GB1 A;  2BB6 A;  2L3Z A;  1EUV B;  1UUP A;  4A6K A;  3HUI A;  1XD4 A;  2QCZ A;  3Q3J A;  1FOE A;  1UNS A;  4JKD A;  1RRB A;  3KQ4 A;  4WJN A;  4YL8 A;  4ZRI A;  4D2K A;  1WZ0 A;  2OJW A;  1LO5 D;  2KUQ A;  3B0A A;  4DX9 0;  1L4Z B;  3WYF B;  1KRH A;  1I4H A;  2N1V A;  1S1Q B;  2Y5P A;  1FHO A;  3MPX A;  1T0R C;  1EF5 A;  4DBB A;  4K7W A;  3GE8 C;  3R7R A;  2CHW A;  4YTP B;  5KHQ A;  1EAZ A;  2Z59 A;  3PVU A;  2N7J A;  2PJH A;  2XK5 A;  3NJT A;  3A4R A;  3ONS A;  2RPQ A;  3IFW B;  3FC4 A;  3ETR A;  2UU7 A;  4W9F A;  3V60 A;  1UNQ A;  2AQ3 B;  1A5R A;  1XCG A;  3ZTC A;  4C56 C;  1DDV A;  3ZXR A;  5G55 A;  1F2R I;  3A9J A;  3ZW3 A;  1IGC A;  1U5G A;  2WXF A;  3KY9 A;  2FJU B;  2LEK A;  5J17 A;  2C5L C;  1ENF A;  1K51 A;  4AWJ A;  3WAL A;  3DBR I;  1IRS A;  3Q69 A;  4ICU A;  2YEP F;  1I4P A;  1I7A A;  2NBU A;  3E9P A;  3VH3 B;  3HHM A;  2W3S A;  3BWU D;  4XDC A;  5GXG B;  3QBV B;  2LD9 A;  2KJR A;  1YX5 B;  4N58 A;  4CHM A;  4XWW A;  1E8Y A;  5L81 A;  3AED B;  1WXM A;  3BYY B;  2PTL A;  1IPG A;  1SJE D;  3VRA B;  1JRP A;  3BYT B;  2GCL A;  4IAP A;  3RZF A;  3ZUN A;  4JE3 B;  2MJD A;  2O6V D;  4LNF A;  5BMG A;  1E9M A;  3ZGZ A;  2PMV A;  3P42 A;  4M02 A;  2G4S A;  1U2B A;  4KDI C;  2BKR B;  4JK9 A;  1MIX A;  2DHJ A;  2KDE B;  3IBE A;  3SUZ A;  3TIX A;  5E6J A;  2FCS A;  2M38 A;  5HKH A;  1K5G B;  3C0R B;  1WJN A;  1DRO A;  5LON B;  2IO2 B;  2JU6 X;  4Z2N A;  1W1H A;  1BT0 A;  4F1S A;  1YJ1 A;  2N9P C;  2J53 A;  4BVU C;  1DYN A;  4A6Q A;  3QAR A;  2AQ1 B;  2K8E A;  3UF8 A;  5JXV A;  2KDI A;  3AEA B;  4JPS A;  1C79 A;  2N9E B;  3TW1 A;  2VZK D;  4AQ7 A;  1V86 A;  1WJ1 A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  2IY0 B;  2DYQ A;  4EJN A;  5E6O A;  2M17 A;  2X18 A;  2G35 A;  4EEW A;  1GNU A;  1QC6 A;  1MKE A;  1D3Z A;  2YS1 A;  4KIK A;  2LYD A;  2R82 A;  4W9J A;  3KUC B;  2D9Z A;  2K25 A;  5D3X A;  3VTW A;  4GSW A;  2N4F A;  2K1F A;  4W9H A;  1UNR A;  2Y8F A;  2KMA A;  1WM2 A;  3V6C B;  1WFY A;  1YQB A;  2Z59 B;  4XWX A;  2KD0 A;  3QAQ A;  2XK5 B;  1TTN A;  1RRP B;  4KSK C;  3X23 A;  1OMW A;  1Z2M A;  2VRW B;  4DDG D;  5G2N A;  2P0F A;  4KSL C;  2BYF A;  2MBE A;  4PYZ A;  4I6N B;  4B6W A;  4HAY B;  1UPQ A;  4GOC A;  3H7P A;  1LB1 A;  5JHA A;  1ZGU B;  1EGX A;  3KZ1 A;  3TJP A;  2OJR A;  2JP2 A;  2KJH B;  3QC8 B;  2NZ8 B;  4GGQ A;  1XX0 A;  5DCN A;  3PGE A;  2ZVN A;  2MBB B;  3P2B A;  3VQI A;  2DZJ A;  1VD2 A;  5HE1 A;  4FJV B;  3A4S C;  3TMP B;  4LDT B;  1V88 A;  4A6F A;  1WGG A;  2GJY A;  3TCA A;  1WIA A;  2A4Z A;  2EMS A;  1UPR A;  5JLJ B;  1V5P A;  1WRD B;  2BYE A;  2P0D A;  2FJ9 A;  1NTV A;  3E66 A;  2JZ3 B;  1WYW B;  2QKM A;  3OJ4 B;  3AU4 A;  3PSC A;  2H7E A;  4IM2 A;  4KHB B;  2RGN B;  1IYF A;  3JYU A;  2FCN A;  4DK5 A;  3CMM B;  4ILJ A;  2ZVO A;  2LVP A;  4MSQ B;  4W9K A;  2YS3 A;  1WI1 A;  5DPW A;  1WJM A;  2RUK B;  2B3A A;  4KIK B;  4BKT A;  2ZCB A;  2LUL A;  2G3Q B;  5JVL A;  1EVH A;  3L08 A;  2LRW A;  3DVG Y;  4W9I A;  2LVO A;  1WX8 A;  1FGZ A;  4A3P A;  4IWP A;  3NSU A;  5JHG A;  2BCJ A;  3H1U A;  2DZM A;  5E6P A;  4GDL A;  4CYE A;  5DHF B;  4G50 A;  3M62 B;  2YT0 A;  4MT7 A;  4EZJ A;  3DBH I;  3KRX A;  1WX9 A;  2DX1 A;  2ASQ A;  2PE9 A;  4II2 B;  4WSF A;  2M1M A;  4BFR A;  1HB8 A;  2ZNV C;  2YF0 A;  3VUW A;  2ROV A;  3WAP A;  2L0T A;  2KNB A;  1YX6 B;  1KLV A;  2HE7 A;  3DOW A;  3O65 B;  5CX3 A;  2JY6 A;  2PZ1 A;  5D7G A;  3SYX A;  2LGY A;  1J8C A;  2CAY A;  1FB8 A;  5J2R A;  3H7P B;  3WAN A;  1MG8 A;  3SU8 X;  4HCN B;  2EKE C;  2OTX A;  2BGF A;  2KN5 A;  2EJ8 A;  2NBW B;  3X0W A;  2MCN B;  2CY5 A;  1U27 A;  4AJW A;  1BWN A;  4HAW B;  2VSZ A;  1V61 A;  4A6F B;  1V6E A;  3BIN A;  4FN2 A;  5HE0 A;  2ZPN A;  3SDL C;  4IUM B;  3MHS D;  4MDK E;  2D9Y A;  3NZU A;  1EF1 A;  1XT9 B;  2I5F A;  3N32 A;  4JKH A;  3B08 A;  1ISN A;  2DAF A;  5C16 A;  4A5K A;  2JWZ A;  4M0W B;  4GIV A;  3SNH A;  1ZC3 B;  3D8F A;  3ENE A;  3DDC B;  2VKI A;  2PEA A;  3L0W B;  2Z0P A;  5E6N A;  3QQ8 B;  3KYC D;  1E5W A;  4GDL B;  1WVH A;  2DN6 A;  4DHJ B;  4WWN A;  4KV2 A;  1LFD A;  3PHX B;  4F7U P;  1Y5O A;  2RLO A;  2Z0Q A;  2RR9 A;  3A33 B;  4J6I A;  1V89 A;  1NTY A;  2PE6 B;  3M1I B;  4XC2 A;  4PNK A;  1KZ7 A;  3QWM A;  1PQS A;  2Q13 A;  1K8R B;  3ML4 A;  4BKG A;  2G4D B;  3SD5 A;  2IO1 B;  1WX7 A;  2KTR B;  2WX0 A;  3AI5 A;  1ZC4 B;  1UD7 A;  4L6E A;  1JRU A;  1BTN A;  3N7C A;  2C60 A;  1P9D U;  2CQU A;  1X86 A;  1CMX B;  4ANV A;  2COC A;  4K17 A;  5D6J B;  2P0H A;  1X05 A;  3PV1 A;  2Y5B B;  2KMC A;  5DH9 B;  4W9C A;  4EFO A;  4FJZ A;  2RSU A;  1G6J A;  2Y7B A;  5FR6 A;  1B55 A;  1E7U A;  3QHT A;  2WX1 A;  1VBH A;  1EO6 A;  1AAR A;  3M95 A;  4I6L B;  2JT4 B;  4BKS D;  4C0A A;  3V62 A;  1TGZ B;  3QX1 A;  3PSE B;  4ILH A;  3L16 A;  3HM6 X;  2K2U A;  1LQB A;  3IG3 A;  4EOY A;  1U5F A;  5KCV A;  1WJU A;  2DKP A;  3AUL A;  1KOT A;  3A8P A;  2FDQ A;  1UEL A;  1J19 A;  4PS8 A;  2W9N A;  2Z0O A;  2JXX A;  4B95 A;  4HB0 B;  3DXC A;  1KBL A;  3U8Z A;  3PEG A;  2M4N A;  3MJW A;  3K9O B;  5EFX A;  3UIN B;  2GBM A;  4EZK A;  2CS4 A;  1WM3 A;  2MA9 B;  3DVN V;  4LCD E;  1WGU A;  4HAU B;  3RUI B;  2KDB A;  1ACA A;  3O96 A;  2RGF A;  2KWU B;  4JKC A;  3RCZ A;  3M3J A;  3VDZ A;  2K6Q A;  2L76 A;  2DYN A;  1DIK A;  3PVL A;  5CHV C;  3PZD A;  3ZVV A;  2WDT B;  1OGW A;  1WY8 A;  1UEF A;  2MWS B;  1V49 A;  1AQC A;  3APF A;  3GOE A;  4D0N B;  2IO3 B;  2EMT A;  3FM8 C;  2E2X A;  3VFK A;  3DBS A;  2DEN B;  2P8V A;  3OLM D;  4GB9 A;  2NCN A;  3U30 A;  5J18 A;  2ZNV B;  4G3X B;  1DDW A;  2GCJ A;  2DYO A;  3RT3 B;  3FP5 A;  2JPH A;  2YLM A;  3KH0 A;  2ADZ A;  3ZVR A;  1KJT A;  2BKF A;  1E8Z A;  3JVZ X;  4H8S A;  2XEW A;  4N9F 4;  1MAI A;  4EUT A;  3QJZ A;  3QCA A;  1JDE A;  4DHZ E;  2Y8G A;  4PQ0 A;  5AZF A;  4KAX B;  3SO6 A;  2R09 A;  4ZRJ A;  3KUZ A;  2KXJ A;  4BBN C;  4W9G A;  4CO7 A;  4K2P A;  4WJP A;  2MKR A;  4DBG A;  3W1S C;  2WWZ A;  4MM3 A;  1MK9 B;  1WGR A;  2N23 A;  1OQY A;  2MBH A;  3UQB A;  3M63 B;  5HE3 A;  3VTU A;  2KOX A;  2V4L A;  3EPY A;  3R3M A;  4HVB A;  3ODX A;  5C23 A;  4PYU A;  5JHH A;  4ILG B;  2J0M A;  3OJ3 A;  2K00 A;  3DVN U;  1KM7 A;  2K8B A;  2J0K A;  3KRW A;  1SIF A;  2ZPY A;  1V5T A;  1WGQ A;  4HLE A;  2BWE S;  5DHA B;  3WIM A;  4F7H A;  4HXD A;  5DPR A;  4RM8 A;  1W1G A;  4W9L A;  3HQC A;  1ZM0 A;  3AU5 A;  2Z0D B;  2L2I A;  4DDI D;  2GMI C;  2KC2 A;  1MPH A;  2LXC A;  4PS3 A;  4HPM B;  2W2X C;  2JRI B;  4GU2 A;  3ML8 A;  3DVG X;  4W9E A;  4BBN F;  2COD A;  2YS5 A;  4WAA A;  1J0G A;  1U4A A;  5IA7 A;  2KTF A;  3MDB C;  3PVW A;  5JZE B;  2YT1 A;  3ENB A;  1YIW A;  4JGH B;  2CHZ A;  2LG1 A;  3ZNI D;  2DYM A;  4FLH A;  2K2J A;  2GOW A;  1OTR B;  2ABD A;  1U5D A;  1WZ3 A;  3AXC A;  4JKE A;  4WVF B;  3HK0 A;  4KHA A;  5LXH A;  5TR5 A;  4TQ0 A;  1LM8 B;  3EC8 A;  4WJO A;  3WAO A;  2JZZ A;  4MK0 A;  2K8H A;  3VUY A;  5CLQ B;  2KLG A;  3LJU X;  2NVU I;  4JLC A;  2RSG A;  2DYB A;  3VVW B;  3AJ4 A;  4B9K A;  2IFS A;  2CU1 A;  2RD0 A;  4MEM A;  3WA0 A;  3UGB B;  4GMX B;  4FAD A;  2O2V B;  2DZI A;  3SHQ A;  4IM0 A;  4JL9 A;  1E90 A;  2O6V A;  3GYP A;  4TYZ A;  3ODW A;  4JQW C;  4FA6 A;  1P5T A;  3ZDT A;  1L2N A;  3H6N A;  2LVQ A;  2ZCC A;  1TQZ A;  3IHP C;  3W1S A;  3GZN I;  2MSE D;  1TJ6 A;  2KVR A;  4CHJ A;  1TBE A;  2D9W A;  2KTR A;  3OAW A;  2LGD A;  2KUP A;  5L95 C;  5D3Y A;  3DXE A;  4GPT B;  1V5U A;  2FNJ B;  4HPL B;  4GN1 A;  4TUU A;  4IG7 B;  3SBT A;  3APD A;  2H7D A;  3PRZ A;  1I2H A;  1V5O A;  2DHZ A;  2MQJ A;  2K6D B;  2V3S A;  5GOW B;  3T9L A;  3LJ3 A;  4MEL A;  3FLV A;  2I1K A;  2HD5 B;  1FXT B;  1WE7 A;  3VHT C;  2DIK A;  4BOZ B;  2MBO A;  1X1G A;  1WG7 A;  5IAA C;  2LKO A;  5CLL B;  2BWF A;  3IVF A;  1RAX A;  2D07 B;  2GBK A;  5AZG A;  2HRJ A;  5IJM A;  1RJ2 A;  2A5U A;  3G9W A;  5J3Y A;  4JK8 A;  4ICV A;  4IFS A;  3L54 A;  2HTH A;  4ANU A;  3TBL D;  2NPT B;  4JKG B;  5CHF A;  2LBB A;  3PHW B;  1WF9 A;  3D8E A;  3P7Z A;  1SE9 A;  4ZYN A;  2CB8 A;  3FSS A;  3DXD A;  2NBV B;  5JH5 C;  4MY6 A;  3TL5 A;  3ML9 A;  2C7H A;  2CR5 A;  1Y19 B;  2MBQ A;  1VCB A;  4X57 B;  4LDT D;  2MW5 A;  3VTV A;  1PLS A;  4GDK A;  2HJ8 A;  5BO4 B;  4JKA A;  3PRP B;  4NNJ B;  2W2W A;  2O6V B;  3HIZ A;  2KWC A;  3T8M A;  3PP2 A;  2FCQ A;  4F7Z A;  4Z2M B;  1SGH A;  2K39 A;  1R4N I;  4K81 A;  1H4R A;  3NZS A;  3PRE A;  4KVG B;  4K7U A;  1FGY A;  5C79 A;  4KHO A;  2N0Y A;  2D4Q A;  2L00 B;  1LXD A;  3ZNZ B;  1WXA A;  4GXB A;  3ZIM A;  3ZRF A;  3ZNH B;  1WJ6 A;  1DDM A;  2MDX A;  4MGK E;  4MJS B;  2CRF A;  2BYV E;  2KQS A;  5KQ1 A;  2FJL A;  2DA0 A;  1RLF A;  2FID A;  3R7Q A;  2RQ1 A;  2KX3 A;  4NPN A;  1Z87 A;  4G0N B;  1VBG A;  3A8Q A;  4IOY X;  4HCP B;  2AEH A;  3K9P B;  2LZ6 A;  2ZJD A;  4DX8 A;  2UZR A;  5J3T A;  1RFA A;  4JIO U;  1GG3 A;  3SV1 A;  1T0Y A;  1H10 A;  4JKB A;  3B1L X;  4FBJ B;  5LLI A;  1Z5S B;  5JP4 A;  2NR2 A;  1V5M A;  2BF8 B;  2Z0E B;  4RMA A;  4ASW C;  1Q1O A;  1E8W A;  2J59 M;  2ZEQ A;  2DHI A;  3Q3F A;  3H7S A;  2IO0 B;  2AL6 A;  4JK7 A;  1TXD A;  2HTH B;  1FHX A;  1QZE A;  1N3H A;  2J7Q B;  1UBQ A;  4RM9 A;  3V5W A;  4TKN A;  3QWZ B;  2GS0 A;  1X11 A;  4AJY B;  3A9K A;  4HB2 B;  4EKU A;  3P6A A;  1WR6 E;  4HAX B;  4IWO A;  1WH3 A;  4E71 A;  1UNP A;  4GDK B;  4NQL B;  5JHB A;  2LI5 A;  4F8C B;  2COF A;  3D32 A;  5FI1 A;  2LRU A;  1NTI A;  4A20 A;  4MSM B;  3CSF A;  4K7S A;  2AYO B;  3CF6 E;  4NJ7 A;  3DPD A;  3EEC A;  1XOD A;  1ST7 A;  4B6H A;  2WYQ A;  4FHK A;  2COP A;  2VRR B;  3TVV A;  5LXI B;  4FUL A;  2QKL A;  4MGI E;  4NAW A;  4HAT B;  1PMS A;  2QHO A;  1Q67 A;  1ZKH A;  1E8X A;  1MIZ B;  3RYT A;  3V61 A;  1M7E A;  3PLU A;  4DHJ D;  2KX0 A;  1OY2 A;  2V76 A;  1NU2 A;  1NDD A;  1UGM A;  2MRP A;  3W1Y A;  1P3Q U;  3VOQ A;  3BJI A;  4IW0 A;  2C7N B;  1TZ1 A;  2FUH B;  1V2Y A;  3A1Q B;  2KGX B;  4GMV A;  3JW0 X;  1HB6 A;  1FHW A;  2LOX A;  1ZW7 A;  4HK2 A;  2D10 A;  1E7V A;  4E3C A;  4TQ1 A;  4HAV B;  3GYO A;  4KDL B;  3H9D A;  1X1F A;  4IC7 B;  1NBF C;  3ZDM C;  1V80 A;  2GBR A;  4OVU A;  1MK7 B;  3FEH A;  4CHK A;  1XQQ A;  5KQ4 A;  2M8S A;  3APC A;  5D3W A;  3KUD B;  2KWV B;  4EMO A;  3JSV A;  3KVF B;  1XKE A;  2UVM A;  3A9K B;  2MFQ A;  2G45 B;  2O2V A;  2MLB A;  1KZG A;  2LAS A;  1GJZ A;  1L7Y A;  3ZRC A;  1P3R A;  2AWT A;  4ZRK A;  4F7G A;  4WWP A;  1WI0 A;  5CTR C;  2DFK A;  3NY5 A;  1I42 A;  1P98 A;  3S2A A;  1U5E A;  1DBH A;  5AEK B;  1P0R A;  5KHO A;  2LUE A;  2CY4 A;  1Y8R C;  4HJK A;  4ANX A;  3I3T B;  1HBK A;  2N7E A;  3HW2 B;  4Y94 A;  2IBI B;  4GZU A;  3A98 B;  3DQV A;  4BKS A;  3QK0 A;  4ZDV A;  2W2X D;  5L83 A;  3UIO B;  4BOS C;  3NHE B;  3L17 A;  2R2O A;  1WGH A;  2JRH A;  3ODO A;  3A9J B;  4DWF A;  2R2Q A;  4NJ6 A;  2CKH B;  4G11 A;  4NAW B;  2KDF B;  4FJY A;  3UQA A;  3BY4 B;  2L05 A;  2MP2 A;  4DHZ B;  3RCP A;  1ZSQ A;  2M0X A;  1KI1 B;  3WAM A;  5D3V A;  1K5D B;  4DXA B;  4AP4 C;  1W1D A;  2L8J A;  4K1R B;  4E74 A;  3KYD D;  2IYB A;  5AZH A;  4WWO A;  3HM3 A;  1XD3 B;  3NOB A;  2D3G A;  2MWN B;  1AWE A;  2JUO A;  2AL3 A;  2OQB A;  4FHJ A;  5C1Z A;  2RVB B;  2JF5 A;  4KZ0 A;  1C1Y B;  2NMB A;  1GC7 A;  3L10 B;  5DPS A;  5EDS A;  2KJ6 A;  5GMV A;  2M14 A;  3PRM B;  2XQN M;  1HE8 A;  2WH5 A;  3RD2 A;  2NPT A;  4JKG A;  1P1A A;  2ZZP B;  4I6P A;  2FCM A;  3D8D A;  2I1J A;  1X1M A;  4A3O A;  2N1W A;  2DAJ A;  1KC7 A;  3EFU A;  3JSV B;  1U29 A;  1WMH A;  2N9X A;  1XR0 B;  3KW5 B;  3CIK A;  3EHV A;  5D2M B;  3ULC A;  4M8N A;  3N3K B;  3DBL I;  1WXV A;  2EC1 A;  1GGO A;  4XX5 A;  2OOB B;  5C6R A;  5DIF B;  4NY0 A;  3V6E B;  2KAN A;  4M8M A;  3VXW A;  3ZLZ A;  5D94 A;  2XBB C;  3PTF C;  2IY1 B;  3ALB A;  3ZKJ C;  2FIF A;  1WGD A;  2YVC A;  5J3Q A;  4NQK E;  4WJ7 A;  3ULB A;  2ELB A;  4WQO B;  2COA A;  1WR1 A;  4HHV A;  1Q5W B;  2LGX A;  1V81 A;  3ZTD A;  2L0F A;  4MJS A;  3L13 A;  3RZW C;  3F5R A;  2KFK A;  2MP2 B;  5DPT A;  3DCG A;  1OQN A;  3OAN A;  2X0S A;  1J0W A;  1C3T A;  4MH0 E;  4K2O A;  1ZVR A;  4YON A;  1M7R A;  4HDO A;  1WXS A;  5D27 A;  2LWP A;  2REX A;  2K8C A;  1WJ4 A;  2UWQ A;  2V1Y A;  1NI2 A;  3F0W A;  2YSZ A;  3NS8 A;  4MGY E;  2DX5 A;  2D2Q A;  1SHC A;  5C5B A;  1S3S G;  3T06 A;  4URK A;  4IWQ A;  2KQ7 A;  2KCJ A;  4HDQ A;  1M94 A;  1GC6 A;  3ZO5 B;  4EZL A;  1YD8 U;  2I5C A;  3PLV A;  2D9V A;  4A6H A;  2DLW A;  1WMH B;  1I35 A;  3ZNG C;  2DZK A;  2UZS A;  1H8C A;  4JKF A;  3QIJ A;  2PPH A;  4IM3 A;  5HE2 A;  1BAK A;  4KZC A;  2BPS A;  2C9W B;  4LJP B;  2C7M B;  1QQG A;  1IP9 A;  2KC1 A;  5DI9 B;  2FAZ A;  2LXA A;  2D11 A;  4HB4 B;  2L1C A;  3N30 A;  2DTC A;  2RNR B;  5FI0 A;  4ANW A;  1P6S A;  4XZ4 A;  2IZV B;  1UBI A;  2GBJ A;  3CXB B;  1F9J A;  3MTN B;  1FAO A;  1V9J A;  2KZR A;  3PG7 A;  1LW3 A;  3VUX A;  1UZX B;  1GUA B;  2DHK A;  1BTK A;  1UH6 A;  2R0D A;  5LOP B;  1WGY A;  4NSW A;  4II3 B;  4LJO B;  1OEY J;  2KFK B;  1R4M I;  3KSY A;  4P7I A;  3U7D A;  2JVC A;  3TO1 A;  2DKQ A;  2YRY A;  2IYD B;  2KKC A;  1OEY A;  3VAW A;  4TV3 A;  3PT2 B;  3LDZ E;  1PFJ A;  4MGZ E;  3UIP B;  1NVL A;  1Q0W B;  3A1Q A;  4WJQ A;  2LJ5 A;  2ELA A;  3TFM A;  1WE6 A;  2L7R A;  3CST A;  4W9D A;  3UZT A;  3R66 C;  2MX2 A;  3VIA A;  4PS7 A;  3E9L A;  4AUQ C;  2ROZ B;  4OVV A;  4AOF A;  2KO3 A;  2N7D A;  4HWI B;  2UYZ B;  2KLC A;  3PPA A;  4HAZ B;  3QA8 A;  2NS5 A;  3RUL A;  2DX5 B;  2CHX A;  5CHW A;  3E9O A;  2LOZ A;  5C5B B;  2J0J A;  2D9X A;  4BBK A;  2KFJ A;  3VH4 B;  2KHW B;  2GBN A;  3SBG A;  2KK8 A;  3ECI A;  4HB3 B;  2L3Z A;  1EUV B;  4A6K A;  1XD4 A;  3Q3J A;  1FOE A;  4JKD A;  1RRB A;  4WJN A;  4YL8 A;  4ZRI A;  1WZ0 A;  3B0A A;  4DX9 0;  3WYF B;  2N1V A;  1S1Q B;  1FHO A;  3MPX A;  1EF5 A;  4DBB A;  4K7W A;  3R7R A;  2CHW A;  5KHQ A;  1EAZ A;  3PVU A;  2PJH A;  2XK5 A;  3A4R A;  3ONS A;  2RPQ A;  3IFW B;  4W9F A;  3V60 A;  1UNQ A;  1A5R A;  1XCG A;  3ZTC A;  1DDV A;  5G55 A;  3A9J A;  3ZW3 A;  1U5G A;  3KY9 A;  5J17 A;  2C5L C;  4AWJ A;  3WAL A;  3DBR I;  1IRS A;  4ICU A;  1I7A A;  2NBU A;  3E9P A;  3VH3 B;  3HHM A;  3QBV B;  2LD9 A;  2KJR A;  1YX5 B;  4CHM A;  1E8Y A;  5L81 A;  1WXM A;  1IPG A;  2GCL A;  4IAP A;  3RZF A;  3ZUN A;  2O6V D;  2G4S A;  1U2B A;  4KDI C;  2BKR B;  4JK9 A;  1MIX A;  2DHJ A;  2KDE B;  3IBE A;  3SUZ A;  3TIX A;  2FCS A;  2M38 A;  5HKH A;  1K5G B;  3C0R B;  1WJN A;  1DRO A;  5LON B;  2IO2 B;  4Z2N A;  1W1H A;  1BT0 A;  4F1S A;  1YJ1 A;  2N9P C;  4BVU C;  1DYN A;  3QAR A;  3UF8 A;  2KDI A;  2N9E B;  3TW1 A;  1V86 A;  1WJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...