2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
1WXSA 2H7DA 2D07B 2MP2B 4GIVA 2KXJA 2D2QA 3RCPA 3PG7A 1WGDA 2JRHA 2NBUA 2MQJA 5KQ1A 1GG3A 3PZDA 4KZ0A 2M4NA 4NPNA 4DHZE 3K9OB 2RLOA 1WX9A 2XBBC 1WJ4A 2KVRA 4HDQA 1ZM0A 2CHXA 3KYDD 4W9EA 2UZRA 1TQZA 4TQ0A 3A8QA 1X05A 2RVBB 1WGGA 4IWOA 5GMVA 4E74A 5LOPB 1GNUA 1HE8A 3B0AA 1NDDA 1U5EA 4LDTB 4F8CB 2PE9A 1UBQA 2BCJA 2COAA 2KQ7A 5C16A 4WAAA 2HRJA 4HB3B 2DZKA 3W1SA 2LXAA 2Y8GA 1IRSA 3O96A 1XD3B 3KUDB 4HPMB 3H7SA 1MAIA 5D94A 1Z87A 4AOFA 4GZUA 2FIDA 1EF1A 4EJNA 2UVMA 2D9WA 4C0AA 1Q1OA 3PSEB 2AL3A 1WR1A 3NSUA 1HBKA 1TJ6A 2W2WA 2KNBA 2IY0B 4LDTD 2YVCA 2W2XC 4A6HA 1WZ3A 2G4SA 3RZFA 1EUVB 1I42A 4N9F4 4W9DA 1WFYA 2BPSA 2MCNB 4NQKE 2OTXA 2N7EA 4A6KA 4TKNA 1WXVA 3R7QA 3WANA 2ZNVC 4XC2A 1WMHB 3AJ4A 4GU2A 2ZZPB 2NCNA 2M14A 1Y5OA 3G9WA 4KAXB 3V6EB 1U5GA 2BWFA 1PMSA 4TUUA 2NS5A 4F7HA 5KQ4A 1ZC4B 2FCMA 1P1AA 2C9WB 3ZDTA 4KHAA 2MSED 1E8WA 4DDGD 2BF8B 3WALA 1TTNA 1NU2A 2KFJA 4HDOA 2LG1A 3PV1A 4II3B 3SHQA 3TW1A 2KZRA 1KZGA 3RT3B 4J6IA 4NNJB 3BINA 4NAWA 4BBNC 2NMBA 1UZXB 1UELA 1L2NA 2KD0A 2KDFB 3H7PB 2BGFA 1WH3A 1OQYA 3Q3FA 1NI2A 2K25A 4RM8A 3ZNID 1N3HA 5L81A 2V1YA 2RR9A 2D11A 4RMAA 4LJOB 2KANA 1W1GA 3LDZE 2P8VA 1X1MA 5CLLB 2K6DB 4GSWA 3AXCA 2KMAA 3RZWC 4CYEA 3VTVA 1I35A 4KVGB 1OGWA 5AZHA 1TGZB 1MIZB 3PS6A 4DBBA 2MDXA 3PLVA 1YX5B 2DLWA 2M17A 3AULA 3ODOA 2MWNB 2HTHA 5DI9B 2LZ6A 2N4FA 2ASQA 2FJLA 2KC1A 2L3ZA 4NJ7A 1B55A 3L17A 1UNPA 4IWQA 1P3RA 5TR5A 3R7RA 1MK7B 3TO1A 3VVWB 4TV3A 3TMPB 3IFWB 3QWMA 4BFRA 1X86A 3VTUA 3P6AA 4MT7A 4A6FB 2AEHA 1P9DU 5E6OA 2YS1A 3C0RB 1KJTA 5CHWA 4AUQC 4DHJB 2LOZA 2ZJDA 1E7UA 1FHXA 4DHZB 3SD5A 4A3PA 4I6NB 2PJHA 2GBRA 3WYFB 5CX3A 4BBNF 4FHKA 3RCZA 4FADA 1Q67A 2C7NB 1GUAB 2V4LA 5D6JB 1LW3A 3OJ3A 3R3MA 2GCJA 1EF5A 2R0DA 2FJ9A 2DHJA 4IG7B 4P7IA 3ZNGC 1MPHA 1UPQA 2LULA 1U5FA 2Z0OA 5DPSA 4E3CA 2LYDA 1T0YA 1WE6A 1H4RA 4W9CA 2RQ1A 3DVGX 1OEYJ 4ANUA 4BKSA 3CMMB 1FXTB 2JZ3B 2ZVNA 5C23A 3N32A 5DIFB 1J19A 4K81A 1V2YA 4B9KA 3SNHA 4FULA 1LQBA 2MP2A 2O6VB 1I2HA 2LRWA 2J59M 2ADZA 4HK2A 5LONB 4GXBA 2ROZB 5AZGA 1JRUA 1AARA 1WXAA 1WE7A 4E71A 3QX1A 2LGXA 5D7GA 4TYZA 1PQSA 1RAXA 2KC2A 4EFOA 2KWUB 3DPDA 4ZYNA 2V3SA 2EMSA 3SO6A 4I6LB 4GDLA 4PS3A 4KV2A 2DA0A 4ZRIA 2LI5A 3A4SC 3D8EA 4WJQA 1V5PA 2K8HA 3KYCD 2LBBA 3EC8A 4WVFB 4WWOA 3B08A 4B6WA 3FSSA 1LB1A 5JHAA 2B3AA 2KJ6A 1PFJA 5J2RA 4MM3A 5JZEB 2I5FA 1E8YA 3ML4A 1ZW7A 2MFQA 1WI1A 4HAWB 5CTRC 1V88A 2W2XD 4LCDE 2FCNA 3U8ZA 4L6EA 2OJRA 4MY6A 1R4MI 5DHAB 2I1JA 1ZSQA 1XR0B 2DYNA 2A4ZA 2C60A 3A1QB 4FJYA 4GOCA 4HB2B 2HD5B 1Y19B 4KSLC 1KZ7A 1OQNA 3U30A 3PEGA 3QIJA 4KIKA 3FLVA 3K9PB 4MJSA 1GJZA 2J0JA 3QA8A 4HXDA 4KHOA 2WYQA 1LFDA 3SUZA 3CSTA 3F5RA 1M7EA 2JF5A 2KJHB 2GBMA 2N1WA 3QHTA 2COPA 4ASWC 5DPWA 3HW2B 3P7ZA 1BT0A 2FAZA 4ZRJA 2BKRB 2M1MA 4NSWA 4XWXA 2KFKB 4M8MA 4PS8A 2RNRB 2YLMA 1UPRA 4A20A 1ISNA 3T8MA 1X1GA 3D8DA 2K6QA 2VRRB 3HHMA 3VHTC 4JGHB 4NQLB 3LJUX 1WX8A 1XT9B 2JZZA 3R66C 4G11A 5E6PA 4A3OA 4ANWA 2EMTA 2NBWB 1E7VA 2JXXA 2X18A 1KOTA 2FCSA 1E8ZA 5CLQB 5LXIB 2IFSA 1V61A 3M1IB 2VSZA 4HAYB 1V5OA 2DAFA 1S3SG 4F7ZA 1EO6A 2KCJA 2Z0PA 3EPYA 2KKCA 3PSCA 1NTIA 2LGDA 3NZSA 3NZUA 3PHWB 4NY0A 1J8CA 2LJ5A 5HE1A 1YD8U 4IAPA 1WGQA 2YSZA 1MG8A 2CHZA 3GOEA 3UQBA 3TJPA 1V5MA 1IPGA 2UZSA 1UBIA 2L0TA 4HJKA 1SE9A 1DDVA 4HVBA 2LVOA 2Z0QA 2CKHB 5HE3A 3U7DA 3BJIA 4WWNA 4KIKB 1GC6A 2MA9B 2D9YA 3CXBB 4CHKA 2XK5B 1WR6E 3APCA 4WJOA 3DCGA 1DROA 4D0NB 4MSQB 3TBLD 1RRBA 1OMWA 1OY2A 4K2OA 2CB8A 3F0WA 4PNKA 4YL8A 3HIZA 3L13A 3N3KB 4FJZA 3SU8X 1NBFC 1ZKHA 4II2B 1Q5WB 3QC8B 5D27A 4JLCA 3ZW3A 3MDBC 1WJUA 2JP2A 3IHPC 2N1VA 1W1HA 1Q0WB 4MGYE 3ZRFA 4AJWA 4CHMA 2BYEA 2KJRA 2MLBA 1HB8A 3CSFA 2DX5A 5J3QA 2DHZA 4K2PA 2IYDB 2R2QA 3P2BA 4W9HA 4WJ7A 2L05A 2DYBA 1CMXB 2KDEB 4LJPB 1XODA 1A5RA 2K1FA 4DX90 1P5TA 4GDLB 2R2OA 1IP9A 3L10B 4K17A 4OVUA 1M7RA 5D3VA 4PYZA 1XD4A 4GN1A 2GBNA 2UYZB 4G3XB 1ZVRA 4GMXB 2KO3A 3A33B 4K1RB 3ZVVA 1FGZA 2I5CA 2N9EB 4IM0A 1OEYA 2H7EA 1UNRA 4A5KA 1WZ0A 3PPAA 4G50A 1NVLA 4IFSA 2O6VA 4ZDVA 4HAUB 2RSGA 3M3JA 2DYMA 3GZNI 2D3GA 1IYFA 1V80A 2M38A 1U2BA 3TVVA 1WF9A 2IO3B 4FLHA 1R4NI 1DBHA 2JWZA 3DDCB 3KVFB 2OOBB 3FM8C 2IO2B 2MRPA 5C5BA 2DN6A 5D2MB 4PQ0A 1BAKA 1WGYA 3A9JA 2O2VB 1NTVA 5KHQA 2DKQA 1LM8B 4HLEA 2Z0DB 1XKEA 2KWVB 4GB9A 4JIOU 4NAWB 2DX5B 5LLIA 1WVHA 4ICUA 2NR2A 2FCQA 2ZNVB 1ACAA 3IVFA 2EJ8A 5DH9B 3W1YA 4F7GA 2CHWA 3ODXA 3M95A 2KK8A 4YONA 3KW5B 1QZEA 2Z0EB 2MW5A 3NOBA 3OLMD 1XQQA 3L0WB 1Z5SB 5G55A 1WJNA 4EZJA 3VH3B 1J0GA 4EZKA 1S1QB 3TIXA 3V62A 4IC7B 4X57B 1UNQA 3SV1A 2GMIC 3DBSA 2WX1A 3ZO5B 3IG3A 2DZJA 1X1FA 3ML9A 1V5TA 3PGEA 1G6JA 2GJYA 1KLVA 1FB8A 4IM2A 2LVQA 4KDLB 5D3YA 3VUXA 4AP4C 1HB6A 3ECIA 3NY5A 3APDA 2G35A 3W1SC 1ZGUB 4F1SA 4IUMB 4EUTA 5KCVA 3LJ3A 4ANXA 3PVUA 1WIAA 2ZPYA 2D9VA 2DHIA 2VKIA 2REXA 4ZRKA 1DDMA 2AL6A 3JYUA 2Q13A 2XQNM 2J0MA 2LVPA 1E5WA 2ELBA 2IZVB 2R09A 3A1QA 4WJNA 2DAJA 3FP5A 3N7CA 3PP2A 2KLGA 1H8CA 3WA0A 3HM6X 1V89A 3ZTDA 3PT2B 5J18A 1K5GB 2C7MB 1P98A 2KLCA 4W9KA 1SHCA 5J3YA 1WI0A 1BWNA 2DX1A 1MIXA 3X23A 3HK0A 3FEHA 1FOEA 2AYOB 4MH0E 2N9XA 4FBJB 4DK5A 3WAPA 4Z2NA 1V81A 4M0WB 2HJ8A 2KDIA 5C1ZA 2DYOA 2CQUA 3OANA 5D3WA 3ALBA 3ZVRA 2MBOA 1TXDA 4RM9A 4XX5A 2NPTA 2RPQA 5C79A 3OAWA 4DHJD 5L95C 3MPXA 1YIWA 2LRUA 4DXAB 3RULA 1K8RB 1V86A 3IBEA 5HKHA 2DFKA 1LXDA 3A9JB 2E2XA 4PYUA 1QQGA 3PVWA 2KDBA 2ZCCA 5DPTA 3TFMA 1ST7A 2KFKA 1TZ1A 2KTRB 3VAWA 2HE7A 2ABDA 5C5BB 3A9KB 3M63B 4GDKA 1E8XA 2BYVE 3RUIB 3ZUNA 1FHOA 2XK5A 4EOYA 2Y7BA 3TCAA 2CS4A 3PHXB 4CO7A 2ELAA 1OTRB 3O65B 3L08A 2M8SA 4TQ1A 3A8PA 5HE2A 3V5WA 2MX2A 4BVUC 5BO4B 4MJSB 5GOWB 3APFA 1WM3A 3SYXA 2MBQA 3DVNU 3KRXA 2IBIB 1AQCA 3EFUA 3ENEA 4DBGA 3DBRI 4GGQA 4I6PA 3H9DA 1NTYA 2DZMA 5DCNA 3UGBB 4JQWC 1GC7A 1KI1B 2KQSA 4HCNB 2L2IA 2WDTB 2K39A 3A4RA 1WM2A 2DZIA 1FHWA 3JSVB 4Y94A 3X0WA 1D3ZA 2N23A 2K2JA 1RFAA 4F7UP 1QC6A 2L8JA 4ANVA 2YRYA 4DX8A 2O2VA 3CF6E 4AWJA 2CU1A 2LKOA 2L76A 3MTNB 3ODWA 3ONSA 3QWZB 2A5UA 3QJZA 4CHJA 4K7SA 2DKPA 2COFA 2P0HA 4BOSC 2P0FA 3DBHI 2L7RA 3WAMA 4MELA 1EVHA 5JLJB 3T06A 2K8CA 4URKA 1KM7A 1MK9B 3ULCA 4IWPA 3WAOA 3QQ8B 4FHJA 2VRWB 2JRIB 2CY4A 4HAXB 2D9XA 3NS8A 2QKLA 1ZC3B 4NJ6A 1U27A 5D3XA 2NZ8B 3WIMA 3ZLZA 2IY1B 2KGXB 2O6VD 3MHSD 2NVUI 4HATB 4W9GA 4EKUA 1W1DA 4ICVA 1UD7A 3KRWA 2JT4B 2NPTB 1WG7A 4GPTB 2JY6A 1WRDB 2K8BA 3QARA 1I7AA 4W9JA 1RJ2A 2ROVA 5CHVC 2PEAA 5JP4A 3VFKA 4EMOA 5G2NA 2QKMA 4GMVA 4BBKA 2C5LC 2FNJB 2G3QB 2N7DA 2ZEQA 2JVCA 2RSUA 3UZTA 1C3TA 2JPHA 4HWIB 1U5DA 4XZ4A 3TL5A 3EHVA 3V60A 5KHOA 1EAZA 4HHVA 3L54A 4A6FA 4BKSD 2W9NA 2MBHA 2NBVB 3JVZX 1V6EA 2RGFA 3A98B 1SGHA 4MGKE 1WX7A 3JW0X 2P0DA 2CR5A 2BWES 2LUEA 3DXDA 2YT0A 2ZCBA 3H1UA 4MSMB 2LOXA 1EGXA 5FR6A 3ZRCA 3QCAA 2MKRA 5C6RA 2GBJA 4WJPA 3UF8A 2YT1A 1U4AA 2PZ1A 4KDIC 5CHFA 2LASA 5JH5C 1YQBA 2UWQA 3D32A 2BYFA 2G45B 2MBBB 3PRPB 3PLUA 3VDZA 5E6NA 1RLFA 1WJMA 3BY4B 2IYBA 3L16A 4B95A 1VD2A 1WGHA 2KN5A 1YJ1A 5DHFB 3DBLI 2FUHB 4K7WA 2I1KA 1Z2MA 4PS7A 2IO1B 2CODA 2LGYA 1H10A 3VOQA 2PPHA 1WJ1A 5AEKB 3SDLC 5J3TA 4W9LA 2D9ZA 3VTWA 4DWFA 3EECA 1P0RA 1FGYA 2AWTA 3ZTCA 5J17A 2MWSB 2KHWB 2ZVOA 4M8NA 2FDQA 3VIAA 3HM3A 3KUZA 4EZLA 4HAZB 1RRPB 2YS3A 2COCA 3PRZA 3QK0A 4W9FA 2C7HA 3ML8A 1UEFA 3ZIMA 2DENB 3AU5A 4BKTA 4WSFA 2L0FA 5EDSA 3DXEA 4W9IA 1L7YA 3PTFC 1DYNA 5HE0A 3OJ4B 4JL9A 2HTHB 2CRFA 2KTRA 4EEWA 2WX0A 3RYTA 5IA7A 1WYWB 3UQAA 2KX0A 2DYQA 1VCBA 2N0YA 2V76A 3KY9A 5DPRA 4AJYB 1WGUA 1BTKA 3DVNV 4MEMA 4WWPA 2WWZA 5IAAC 4HB0B 2LXCA 1P6SA 2PE6B 4HCPB 1WGRA 1DDWA 1FAOA 2GBKA 3ZNHB 2KUPA 4DDID 2GOWA 3VUYA 3HQCA 1UGMA 2GCLA 4FJVB 1BTNA 2GS0A 4BOZB 2IO0B 2WH5A 2Z59B 3KSYA 4HPLB 3ZNZB 1PLSA 1X11A 2J0KA 5IJMA 1XX0A 4IOYX 2EC1A 1TBEA 2RD0A 4Z2MB 4G0NB 2XEWA 3KH0A 1SIFA 3H7PA 3VUWA 2KMCA 1WJ6A 4KZCA 3PVLA 3ULBA 4HAVB 4KSKC 3KZ1A 1YX6B 1Y8RC 3GYOA 2L1CA 2YF0A 1V5UA 2RGNB 3MJWA 3T9LA 3H6NA 4OVVA 3S2AA 3QBVB 5LXHA 2CAYA 2KWCA 1MKEA 2L00B 1M94A 3GYPA 3DOWA 3ZKJC 5FI1A 4MK0A 2YS5A 2OQBA 3VH4B 5AZFA 2DTCA 2LWPA 4MGIE 3N30A 1XCGA 1E90A 1UH6A 3DVGY 1P3QU 4FN2A 3VXWA 1WY8A 2KX3A 2Y5BB 4MDKE 3B1LX 2KOXA 3KUCB 1WMHA 3M62B 1J0WA 3DXCA 2M0XA 2JUOA 2D4QA 2K00A 3A9KA 4GDKB 4WQOB 1AWEA 4KHBB 3AI5A 3VQIA 5JHBA 4MGZE 5FI0A 2LD9A 3I3TB 3PREA 3UINB 3AU4A 1F9JA 3V6CB 4FA6A 2EKEC 2Y8FA 4IW0A 2CY5A 2N9PC 3PRMB 3UIPB 4H8SA 2D10A 3ZDMC 1V9JA 2FIFA 3QAQA 1V49A 3RD2A 2ZPNA 3Q3JA 5EFXA 4BKGA 3DQVA 5JHHA 3D8FA 3JSVA 5L83A 3V61A 2QHOA 3UIOB 1WXMA 2RUKB 4IM3A 3NHEB 2BKFA 3CIKA 2KTFA 1K5DB 2DHKA 1C1YB 4HB4B 1U29A 4B6HA 2G4DB 5JHGA 4K7UA 2MBEA 2K2UA 2J7QB
chains in the Genus database with same CATH superfamily
1L4ZB 2H7DA 4WIPA 2D2QA 2NBUA 4A55A 4DHZE 3RFZB 3K9OB 2RDHA 1WJ4A 2WXOA 2UZRA 1TQZA 1WGGA 2WNMA 5GMVA 1SSNA 1F2RI 3Q8AA 3RNGC 1HE8A 2E3TA 2BCJA 3W1SA 1C9FA 4HPMB 1XD3B 5D94A 3H7SA 2PMVA 1Z87A 4GZUA 1EF1A 3PSEB 3NSUA 3NVZA 4YWGG 1I42A 4OHJA 2MCNB 3AECB 2ZNVC 4XC2A 4XDDA 1WMHB 2M14A 1R4NB 4KAXB 1PMSA 2V4IB 1CJEA 1I7HA 1P1AA 2C9WB 4A8XC 2LG1A 2PTLA 2KZRA 4J6IA 5IO9A 2NMBA 2BGFA 1NI2A 1F52A 5HI1A 3LDZE 1X1MA 5CLLB 1I35A 2KMAA 1OGWA 5AZHA 2NMQA 2N4FA 2FJLA 3EUB2 2CU3A 4A9AA 3I5JC 3IFWB 3MFGA 3TEZA 3VTUA 3P6AA 5E6OA 2YS1A 1VDVA 1KJTA 3C0RB 4DHZB 2ZJDA 2EELA 2GBRA 3WYFB 5CX3A 1Q67A 1LW3A 3OJ3A 4YTMB 2GCJA 3IXSA 3ZNGC 1MPHA 4E3CA 2Z0OA 3FILB 3GS2A 4ILHA 1FXTB 2ZVNA 5DIFB 1J19A 4XYCA 3SNHA 1FXIA 4TSSA 1RAXA 3DPDA 3P4SB 1YJIA 3NUHB 4P16A 4GDLA 1HA5A 5BMGA 2DA0A 4ZRIA 4JKGA 2BT6A 2QJLA 3A4SC 1V5PA 4RH6A 2V3NA 1SE4A 3B08A 2R2YA 3FSSA 1QOBA 2Y5CA 2KQ4X 2B3AA 4DQOC 1F2RC 2AX5A 1PFJA 5JZEB 2I5FA 1ZW7A 1V88A 2INNE 4LCDE 2FCNA 2OJRA 1R4MI 5DHAB 1ZSQA 2DYNA 1XR0B 2M56B 4GOCA 4KSLC 4HB2B 2HD5B 4L2YA 1KZ7A 1OQNA 3QIJA 3QA8A 2WYQA 1LFDA 3F5RA 3P4PB 2COPA 5DPWA 3RNBC 2BKRB 4PS8A 4M8MA 2XN9C 2R82A 1IYFA 4LK0M 4NQLB 5E6PA 4G11A 1XT9B 1ZDXA 2JZZA 4A3OA 2EMTA 1E7VA 2B76B 3LXFA 1E8ZA 5LXIB 1KTKA 1V5OA 1A70A 1LGRA 2L32A 3GB1A 4F7ZA 2KCJA 1GGOA 2LGDA 3NJTA 1JWSD 3NZSA 4RCOA 1YN5A 3DCXA 1WGQA 2YSZA 3GOEA 1B1ZA 3TJPA 1IPGA 4JE3B 2UZSA 2N9KA 3AE4B 2TSSA 1NYQA 4CHKA 2JX5A 3APCA 4WJOA 3DCGA 1TKEA 4D0NB 5T8IA 3TBLD 2R61A 4PNKA 3P4QB 2NBVA 3N3KB 4FJZA 1ZKHA 3GP7A 3ZJVA 2JP2A 3AV8A 3W5UB 1I4RA 3ZRFA 4CHMA 2MLBA 2DX5A 1PGAA 2IYDB 1CMXB 5JVLA 4LJPB 2XNAC 1XODA 3L10B 5D3VA 4GN1A 2KO3A 4K1RB 4L1BA 1XCTL 4G50A 4ZDVA 4A5KA 1NVLA 4IFSA 1C4CA 3GZNI 1DBHA 2ICIA 2KIGA 1KBLA 2L1AA 2MRPA 2DIKA 5C5BA 1T0RC 2HJ1A 5D2MB 4D2KA 1NTVA 3U4EG 2DX5B 3ZJTA 2NR2A 1E10A 2IPKD 5DH9B 2CHWA 4PYZA 2KAJA 4Q2JA 4FHKA 3KW5B 2Z0EB 2MW5A 3L0WB 1TZOA 1WJNA 4EZKA 1UNQA 3DBSA 2WX1A 2OEDA 3IG3A 2LUMA 3ML9A 3PGEA 1ZXHA 1KLVA 4KDLB 5D3YA 1HB6A 3Q8EA 4EUTA 3LJ3A 2ZPYA 1FFVA 1DDMA 3SBGA 4HEA1 2LVPA 1GB1A 1E5WA 2ELBA 3VRBB 4REZA 2DAJA 1K5GB 2C7MB 2H88B 4YSYB 4N58A 1WI0A 5G5HA 1MIXA 3FEHA 2LHEA 4JK8A 4FBJB 2Q5WD 2N9XA 2K49A 4Z2NA 2CQUA 4XX5A 1C79A 4RM9A 4DHJD 1TXDA 5BYSA 2NPTA 2RPQA 5C79A 1FCLA 2EKIA 3RULA 1N6ZA 1K8RB 1V86A 2DFKA 1LXDA 3A9JB 1CZPA 2KFKA 3M63B 3IAM1 3ZUNA 4HKQA 3TCAA 3PHXB 3DBRB 3L08A 4TQ1A 5HE2A 3V5WA 5BO4B 4JKCA 5GOWB 3AE5B 1B9RA 4DBGA 4GGQA 3NWFA 1FNVA 1GC7A 1K53A 5C3JB 2WDTB 4DXFA 4J3OD 1RFAA 3HSAA 1FIQA 3CF6E 1J7AA 3QWZB 4CHJA 3DWMA 2DKPA 1FNWA 3WAMA 2BS4B 1EVHA 2K8CA 3T06A 5LNK1 4URKA 3QQ8B 2D9XA 1ZC3B 1KLUD 2JQRB 2IDYA 4WH4A 4EKUA 1T5XD 2JT4B 1WG7A 2K8BA 1WRDB 2WXMA 2WU5B 4W9JA 4EMOA 2C5LC 2N7DA 2ZEQA 1C3TA 2JPHA 4PK1A 1TS4A 3JVZX 1WX7A 4MSMB 1EGXA 2MKRA 2GBJA 1ZUD2 1U4AA 2LASA 2UWQA 2G45B 2N9LA 1IUEA 1VRAB 3VDZA 1WJMA 1WGHA 1N5XA 2JZPA 2FUHB 3ZXVA 1I4GA 3BWUD 1XLQA 1P7EA 3KLSX 2D9ZA 1P0RA 1FGYA 4P1CC 1NI3A 3KUZA 1XLPA 2V3PA 3ML8A 1UEFA 3ZIMA 2DENB 4C7ZA 3DXEA 4W9IA 1CQVA 3OJ4B 2CRFA 2WX0A 3RYTA 1WYWB 2KX0A 3KY9A 5DPRA 1BTKA 3DVNV 1FFUA 4HB0B 2PE6B 4JWSC 1UGMA 2PKOA 2FUG1 3RI7C 5IJMA 2RD0A 2JSVX 3VUWA 3KH0A 3H7PA 4LNFA 4HJGE 1WJ6A 3B2GA 1SF0A 5G5GA 2L1CA 4R3DA 2N0SB 2RGNB 3T9LA 4M02A 5LXHA 3QBVB 2CAYA 3H8HA 5I2SA 4OVZA 3CIRB 2WU2B 3DWGC 2YS5A 1HZ5A 4JX1C 2DTCA 4JKEA 4FN2A 1FCCC 1YJJA 1WY8A 2KOXA 1L4DB 2CJOA 2V0GA 2DBYA 2I2YA 4CQNA 4GDKB 4JKBA 1AYFA 3CWIA 3I9V1 1F9JA 4FA6A 4H8SA 1MHXA 3QAQA 4BKGA 3NVVA 5JHHA 3NS1A 2KWDA 1AWDA 2QHOA 2RUKB 3CIKA 3Q69A 1VR9A 1TS3A 2NTSA 2J53A 1U29A 2G4DB 3AN1A 4K7UA 4ZRQA 2K2UA 1WXSA 4GIVA 3RCPA 5KQ1A 1GG3A 3PZDA 2RPVA 1WX9A 1CK1A 2CHXA 5MPOA 4TQ0A 1X05A 4IWOA 1L0YB 4US8A 2PE9A 2COAA 1ET9A 5D3IB 2Y8GA 2FIDA 4EJNA 1Q1OA 2KVZA 2D9WA 3VR9B 1WR1A 1HBKA 2W2WA 2IY0B 2W2XC 4A6HA 2G4SA 4W9DA 4NQKE 3DHIC 3R7QA 1WXVA 4QJ4B 3WANA 3AJ4A 4GU2A 2ZZPB 1Y5OA 3BK1A 3G9WA 3V6EB 1TIFA 2IGDA 5KQ4A 2MSED 3ZDTA 4ZHOA 1E8WA 2BF8B 3Q3MC 1NU2A 1DOIA 3PV1A 2BB5A 3TW1A 1KZGA 4S17A 3MJ5A 1UELA 4XWTA 3H7PB 1WH3A 3Q3FA 3BVZA 2K25A 4LNOA 2V1YA 3DHGC 4DIXA 3KWVA 2DLBA 2K6DB 3AXCA 2CJNA 4KVGB 4A90A 3J9CA 1MIZB 3PS6A 2MDXA 1YX5B 3AULA 3ODOA 4KX6B 2LZ6A 4NJ7A 1N5WA 2ASQA 3RPFC 1VZ6A 2WXJA 4IWQA 1UNPA 4HKZE 3VVWB 3R7RA 1MK7B 1V1PB 3TMPB 4BFRA 1X86A 4DHJB 2INPE 2BBCA 2PJHA 1JRPA 5EE1A 4HSIA 4DXGA 2C7NB 1GUAB 2PW9A 3R3MA 2L83A 1EF5A 2DHJA 4P7IA 1FMAD 1WE6A 2KDMA 4W9CA 1H4RA 4BKSA 2RQ1A 5IKCM 5C23A 3N32A 1V2YA 1LQBA 2LRWA 3ZXRA 2ROZB 2BW2A 1E0ZA 1AARA 1WXAA 3I63C 2FJUB 3SFEB 1PQSA 2YT2A 4ITKA 4EFOA 2KWUB 1N60A 2WGSA 1MG4A 1VLBA 5H92C 4YT0B 3RNAC 3SO6A 4PS3A 4KV2A 3EC8A 4WWOA 1QOGA 4ILJA 5IRSA 5JHAA 1FXAA 1E8YA 2MFQA 4HAWB 4L6EA 4MY6A 2LHDA 2A4ZA 2ZW0A 2C60A 3Q8BA 2WDQB 4KIKA 1GJZA 1TYGB 4HXDA 3SUZA 2KJHB 2GBMA 1N63A 2N1WA 5AUKA 3FC4A 4NSWA 4XWXA 1Y56A 2J42A 1SE3A 4DDGD 4A20A 3D8DA 2VRRB 3HHMA 4JKFA 1ESFA 1SIJA 2JXXA 3LB8C 4C4VB 1V61A 2ACZB 2VSZA 1KFYB 4KGRA 3NZUA 3EPYA 4YTPB 1NTIA 2LJ5A 4IAPA 1V5MA 1UBIA 3N1YC 2Z0QA 3U7DA 3BJIA 3ZJUA 4WWNA 4KIKB 2MA9B 3CXBB 1SJHD 4US9A 3FILA 3NVYA 3L13A 3IT6B 2KMMA 3QC8B 1WJUA 4AJWA 3CSFA 1HB8A 5J3QA 4K2PA 2R2QA 4WJ7A 2K0PA 3NZ3A 2NTTA 2R2OA 4GDLB 3OHMB 1ZXIA 4K17A 1YMHE 1V1PA 2LEKA 1C76A 2KYWA 1VJKA 3N20C 4GMXB 2BB6A 2I5CA 2H7EA 2QEJC 2M38A 1U2BA 3NWAA 1WF9A 2IO3B 3DDCB 5FR3A 3FM8C 3E66A 2DN6A 4C80A 2X0SA 3SR6A 4PQ0A 2O2VB 4HLEA 1FEHA 4CSQA 1XKEA 4JIOU 1ZP0B 3ABVB 4L23A 3IVFA 2EJ8A 2KK8A 4OVVA 1QZEA 3OLMD 1J0GA 3TIXA 4IC7B 5AUIA 2GMIC 3ZO5B 1HZ6A 2DZJA 1G6JA 1KRHA 1V5TA 1FB8A 2LVQA 3VUXA 2VH1A 3ECIA 2G35A 1ZGUB 4JK9A 5KCVA 3PVUA 1WIAA 4ZRKA 2Q13A 2XQNM 2IZVB 3A1QA 4WJNA 2MJ3A 3HM6X 1C77A 2Z13A 4W9KA 1SHCA 1T3QA 1FOEA 3N1ZC 3WAPA 1V81A 1BXTA 2HJ8A 2DYOA 3OANA 2W3RA 1YIWA 1YQ3B 5HKHA 2E2XA 1NYRA 2KDBA 5DPTA 2MJDA 3TFMA 1QT9A 3AEAB 1N61A 2KTRB 1OQRA 4GDKA 2ABDA 1T0QC 3N1XC 2BYVE 4EOYA 2Y7BA 3V05A 4CO7A 2ELAA 1ET6A 1L6UA 4BVUC 4MJSB 3OG5A 3PZ7A 1ZYIA 1WM3A 3DBRI 4I6PA 3H9DA 5DCNA 1T6BX 4JQWC 1KI1B 1JALA 2L2IA 2K39A 3A4RA 1WM2A 2VZKD 3RMKC 2N23A 4OZAA 2PVOD 5D3DA 4DX8A 2L76A 2LKOA 3MTNB 3ODWA 4PT5A 3MP9A 4K7SA 4YSZB 4EE2A 2BQQA 2L7RA 4MELA 5JLJB 1VBHA 1MK9B 3NG0A 4IWPA 4FHJA 1MJDA 3NS8A 4NJ6A 5D6JB 3SFDB 2BYTA 2KGXB 2O6VD 4GPTB 2JY6A 2ONQA 2ROVA 2LJIA 5G2NA 4GMVA 4BBKA 1MHHE 2G3QB 3UZTA 4QJ3B 3EHVA 1EAZA 2MBHA 2NBVB 1V6EA 2RGFA 3A98B 4MGKE 3NVWA 1YOVB 2LOXA 5FR6A 3ZRCA 1V97A 3UF8A 4WJPA 5IP4D 2WQYB 4KDIC 2PZ1A 5CHFA 1QLBB 1YQBA 3RN9C 3D32A 3Q8FA 4OZBA 4XDCA 3PLUA 3EA6A 4ZYSA 1VD2A 2KN5A 1E7PB 5DHFB 2I1KA 4PS7A 2IO1B 2CODA 1K52A 1WJ1A 3ZGZA 3VTWA 4MT5A 2AWTA 5J17A 2MWSB 1WXQA 2ZVOA 3HM3A 2IGGA 1RRPB 2YS3A 2COCA 3QK0A 2WXGA 4BKTA 1QILA 1DYNA 1AN8A 4EEWA 5I4DA 2KTRA 1FRDA 2DYQA 1VCBA 2V76A 1WGUA 2PIAA 4WWPA 2WWZA 1P7FA 4HCPB 1P6SA 5H8YE 1WGRA 1DDWA 1FAOA 2KUPA 4RGNA 2Y3AA 3VUYA 1HEZE 3E9LA 1PLSA 1XX0A 3UIOB 4IOYX 4Z2MB 2XEWA 1SIFA 3MC0B 3MC9A 4KZCA 2OJWA 3KZ1A 1FO4A 3GYOA 3H6NA 1D5ZC 2KWCA 2L00B 3DOWA 3GYPA 1NVID 2M0AA 2WDVB 2INDC 3VH4B 4MGIE 2W82A 1E90A 3DVGY 1UH6A 1P3QU 1MFWA 3VXWA 1FRRA 3KUCB 3M62B 1J0WA 3DXCA 2D4QA 2K00A 2QIEB 1IBXA 1AWEA 4KHBB 4MGZE 5FI0A 3AEFB 3I3TB 3UINB 3PREA 3V6CB 2Y8FA 1BUIC 4M00A 2N9PC 1YN4A 3PRMB 3RD2A 2ZPNA 5EFXA 5L83A 3DQVA 3EFCA 3V61A 4IM3A 5LG4B 4KGTA 1K5DB 2DHKA 3E9SA 5JHGA 2MBEA 1PFDA 3Q14C 3GE8C 2D07B 1FNUA 1WGDA 2JRHA 2MQJA 4KZ0A 2M4NA 2XBBC 2KVRA 3KQ4A 4HDQA 3Q3NC 3KYDD 4W9EA 1ENFA 4E74A 5LOPB 1GNUA 3B0AA 1U5EA 4LDTB 4F8CB 2KQ7A 5C16A 2DZKA 4HB3B 2LXAA 1IRSA 3KUDB 4AOFA 1UGJA 2UVMA 4C0AA 1TJ6A 2YVCA 2WXKA 2Z8LA 3TEYA 1WFYA 4OW0A 2OTXA 2N7EA 4A6KA 4TKNA 2NCNA 1U5GA 3AE9B 3AE1B 2SEBD 2WHIA 4TUUA 3VR8B 1ZC4B 1L6VA 3AE3B 4D6WA 3WALA 1GB4A 2GI9A 1C78A 4HDOA 3SHQA 1L0XB 3P63A 2WXRA 3RT3B 4NNJB 3BINA 2KD0A 2J4XA 1OQYA 1N3HA 5L81A 2RR9A 1QOFA 3RNEC 4LJOB 4RGOS 4GSWA 2P8VA 1PGXA 3RZWC 4CYEA 3W2DA 1FM0D 4JWUC 1F77A 1TGZB 1UUPA 4ACFA 2G1EA 2MWNB 5DI9B 1C4PA 1JWMD 2L3ZA 1GAQB 1P3RA 2W55A 5EE3A 3TO1A 1HXYD 2GLSA 2PVGC 1P9DU 2AEHA 2LOZA 3SD5A 4A3PA 4I6NB 3KWLA 3C8YA 4FADA 1I4XA 1T0SC 2V4LA 3HRDD 4IG7B 1MVKA 2R0DA 2FJ9A 2IGHA 2LYDA 3ZYYX 3DVGX 4WURA 3CMMB 3E9PA 5HFYA 4B9KA 2AQ3B 3E9OA 2J59M 4HK2A 5LONB 5AZGA 1JRUA 1WE7A 4WQMA 4E71A 5D7GA 5BYRA 2KC2A 4MM3B 1NEKB 1VZ8A 2HDEA 2EMSA 2V3SA 4ZYNA 4A6QA 3AMZA 3AB5A 2LI5A 3NRZA 1R7SA 4WJQA 1K51A 2LBBA 4WVFB 3P42A 1XO3A 2JU6X 2KJ6A 5J2RA 3DHHC 4MM3A 4OT1A 1WI1A 3U8ZA 2I1JA 1HTQA 1Y19B 3RNFC 1D6EC 4K3BA 4MJSA 2J0JA 3NWDA 4JPSA 4KHOA 1EM7A 3CSTA 3QHTA 4MH8A 3HW2B 3AEEB 3P7ZA 4ZRJA 2GUMA 4H2AA 2M1MA 4UDUC 2RNRB 1UPRA 3T8MA 2RDGA 3LJUX 1WYGA 3Q8CA 2NBWB 2X18A 4JKAA 2IFSA 2DAFA 3M1IB 4HAYB 4M0WA 2Z0PA 2QSDA 2OHFA 2D3BA 1J8CA 5HE1A 1MG8A 2CHZA 4HJKA 2L0TA 4RFBA 3V3XA 1DDVA 4HVBA 5I2MA 2LVOA 4B0EA 5HE3A 2KACA 2UU7A 3Q3OC 1RRBA 1OMWA 4K2OA 2J52A 2CB8A 3SU8X 4P1BC 1FD6A 1NBFC 3B77A 1JWUD 4JLCA 1Q5WB 5D27A 3MDBC 3IHPC 1F0ZA 3FVCA 1W1HA 1Q0WB 1XXGA 2BYEA 3P2BA 2L05A 2DYBA 2KDEB 4YXDB 1P5TA 3T3OA 2UYZB 1MI0A 4G3XB 1ZVRA 3ZVVA 1FGZA 4IM0A 1WZ0A 4NJCA 2DYMA 3LYYA 1V80A 1BMLC 3FAHA 4FLHA 3KVFB 2KUQA 4NAMA 4XGAB 1BAKA 1WGYA 5KHQA 3ETRA 2Z0DB 5LLIA 2KWVB 1WVHA 1HTOA 1ACAA 1XCQL 4YONA 3NOBA 3VH3B 1S1QB 3V62A 2JXTA 1ACCA 1KC7A 1X1FA 3OWEB 4GNKB 2GJYA 4IM2A 3NY5A 3W1SC 2QC8A 4IUMB 2VKIA 2D9VA 1KLGD 2WXFA 4RF1A 2AQ1B 2R09A 4B0MA 1UNSA 3N7CA 3PP2A 2KLGA 4IDIA 1H8CA 1V89A 3ZTDA 3PT2B 2JYTA 5J18A 2KLCA 1BWNA 2DX1A 4NZLB 2AYOB 4DK5A 1D5MC 1I4PA 4K3CA 4M0WB 2KDIA 3ALBA 2MBOA 2KIEA 3OAWA 2YEPF 3MPXA 5BMIA 4GLSC 3BIID 1QQGA 2W54A 2ZCCA 1SJED 3VAWA 2HE7A 3A9KB 1TT5B 2X8XX 1E8XA 5JXVA 2WDRB 1OTRB 2M8SA 2MX2A 3TUOA 1UWMA 3SYXA 3DVNU 2IBIB 1GPXA 1E9MA 4LNIA 3JSVB 2DZIA 1MPEA 4Y94A 2K2JA 4HRSA 4F7UP 1AW7A 4KKIA 1QC6A 2CU1A 4BZAA 5IOIA 2W3SA 2COFA 4AS1A 3ZQ4A 3ULCA 4P6VF 5M4YB 2VRWB 2JRIB 3MC8A 2QKLA 1PUTA 3WIMA 4M01A 3ZLZA 2Z4DA 1JROA 4HATB 1YNTE 1W1DA 5C2TB 1UD7A 3QARA 1I7AA 1RJ2A 5GXGB 5JP4A 3N9YC 2FNJB 2JYEA 2JVCA 2RSUA 4WWMA 4HWIB 4XZ4A 2WXQA 3BVGA 1IGCA 1SBBB 3L54A 4A6FA 2W9NA 1EWYC 1SGHA 3U52E 4L1RA 3JW0X 2P0DA 2BWES 2LUEA 3DXDA 2MHJA 2ZCBA 3H1UA 2WXIA 3QCAA 3NW8A 2BS3B 2YT1A 2MBBB 4C56C 3PRPB 3BY4B 2IYBA 2L52A 3L16A 1YJ1A 5BMHA 4K7WA 1Z2MA 1SEBD 4YTNB 3AE6B 5J3TA 4JKHA 2LFIA 4W9LA 3SDLC 4DWFA 1EU4A 3GZNB 1YN3A 1DYQA 2FDQA 5TSSA 4IKGA 3AEBB 2L0FA 1L7YA 3PTFC 5HE0A 3AE7B 2KT7A 4BAXA 3W5VB 3ZNHB 1SE2A 5BYQA 4FJVB 1BTNA 4BOZB 2IO0B 3KSYA 2J0KA 2QILA 4G0NB 2EC1A 4MSQB 2HTME 2VZKB 2KMCA 3ULBA 4HAVB 4KSKC 1YX6B 3BZDB 4AQ7A 3U12A 1JDEA 3ZKJC 4MK0A 3VRAB 5AZFA 1XCGA 2KN4A 1WMHA 1R4MB 3W9CB 2PLPA 2JUOA 1SXTA 1MI1A 3PZ8A 4WQOB 3VQIA 3AI5A 5JHBA 1GOZA 2MJEA 2LD9A 2WXHA 2EKEC 4IW0A 1TS5A 1V9JA 3A58A 1V49A 4C4VA 3EGRA 2DNFA 1FPYA 1WXMA 3NHEB 3HUIA 4HB4B 1VZ7A 3P4RB 4B6HA 2MP2B 2KXJA 3PG7A 4NPNA 2RLOA 1QQRA 5EE9A 1ZM0A 1JWAD 3A8QA 2FBWB 2RVBB 2K9XA 1KH0A 1NDDA 2WXPA 1VBGA 1ZDVA 1UBQA 2Y5PA 4WAAA 4LNNA 2HRJA 3O96A 1NENB 1MAIA 2AL3A 4LDTD 2KNBA 3RZFA 2K3UA 1WZ3A 1EUVB 3L4PA 1V8CA 4N9F4 3URYA 2BPSA 3R2IA 2BWFA 2NS5A 4F7HA 2FCMA 4KHAA 1WWTA 4USAA 1TTNA 2KFJA 4II3B 2IJ0A 2FE8A 2E6XA 4BBNC 4NAWA 1UZXB 1TJEA 3T3NA 1IBXB 1L2NA 2KDFB 1HQRD 4RM8A 3ZNID 2D11A 2LGIA 1WSPA 4RMAA 2KANA 1W1GA 2M19A 3BYYB 3VTVA 2MH7A 4DBBA 1XF5L 4JK7A 3PLVA 2DLWA 2M17A 2HTHA 2QCZA 2KC1A 3RNCC 1B55A 3L17A 5TR5A 2QDFA 4TV3A 4ZOHC 2DWQA 3QWMA 2N7JA 4MT7A 4A6FB 4AUQC 5CHWA 1E7UA 1FHXA 1XLOA 1TY2A 4MACA 3P1MA 4BBNF 5FK9C 3RCZA 1DOYA 1UPQA 2LULA 1U5FA 5DPSA 1T0YA 4ANUA 1E6EB 2X38A 1OEYJ 4C7YA 2INCC 2JZ3B 1F1HA 1JMLA 4K81A 1RFKA 3R2TA 3BYTB 4FULA 2MP2A 2O6VB 1I2HA 2ADZA 1ROEA 4GXBA 3Q6BA 3QX1A 2LGXA 4TYZA 4RNAA 3AE8B 4LTUA 3AM9A 1JQ4A 3D8EA 1PDXA 2K8HA 3KYCD 3BVMA 5HHDG 4B6WA 1LB1A 2GRIA 4KHBA 1QKZA 3ML4A 1TKGA 5CTRC 2W2XD 2H89B 2YEPB 1UWXA 2Z14A 3A1QB 3PO0A 4FJYA 3U30A 3PEGA 3FLVA 3K9PB 1OFFA 2JF5A 1M7EA 2WS3B 4ASWC 1BT0A 2FAZA 2KFKB 2MEKA 2YLMA 3C19A 3IT4B 1ISNA 2ON8A 1X1GA 2K6QA 3VHTC 4YSXB 4JGHB 4XE0A 1WX8A 1L5PA 4ANWA 3R66C 1EU3A 1D5XC 1RYJA 1KOTA 2FCSA 5CLQB 2K8EA 1S3SG 1EO6A 2KKCA 3PSCA 3PHWB 4NY0A 1YD8U 3UQBA 2QMTA 1SE9A 2CKHB 3AEDB 1GC6A 2D9YA 4C00A 2XK5B 1WR6E 1DROA 2D5GA 1TS2A 1OY2A 3HIZA 3F0WA 4YL8A 4II2B 3ZW3A 2N1VA 2K5PA 4MGYE 2KJRA 1TKYA 2DHZA 4W9HA 3HIEA 1A5RA 2K1FA 4DX90 4HPPA 4QAYA 1IP9A 4OVUA 1M7RA 3Q2AC 1XD4A 2GBNA 4ARCA 3E56A 4KKJA 1JCKB 3A33B 2N9EB 1OEYA 3PPAA 1UNRA 3HVZA 2O6VA 4HAUB 2RSGA 3M3JA 2D3GA 3TVVA 4FXCA 1R4NI 2JWZA 1XEEA 1JW9D 3TEXA 2OOBB 2IO2B 3HVDA 1STEA 1Q10A 3A9JA 2DKQA 1LM8B 4NAWB 4GB9A 3AEGB 4ZRPA 4ICUA 2FCQA 1DOXA 2ZNVB 3W1YA 4F7GA 3ODXA 1YQ4B 3M95A 4OZCA 5G55A 1XQQA 3SEBA 1Z5SB 4EZJA 1M4VA 2WLBA 4X57B 3SV1A 2D3CA 4HROA 4AP4C 2BS2B 3APDA 4F1SA 2ZKMX 4ANXA 2REXA 2DHIA 3JYUA 2AL6A 4LLGM 2J0MA 1I4HA 4RGTA 3FP5A 4ILGB 1SB3C 5FKAC 1N62A 3WA0A 4N59A 2D3AA 4JKGB 1P98A 4GOUA 5J3YA 3X23A 3HK0A 4ZHPA 4MH0E 2I38A 1RM6C 5C1ZA 5D3WA 3ZVRA 2LMCA 5L95C 2LRUA 4DXAB 3IBEA 1D4BA 4PYUA 3PVWA 1RWSA 2ZW1A 1ST7A 1TZ1A 1WGKA 5C5BB 4TMAB 3RUIB 2WP9B 1FHOA 2XK5A 2CS4A 4QJ5B 3O65B 3A8PA 4IOIE 1J7BA 3APFA 3ENEA 2MBQA 3EFUA 3KRXA 1AQCA 4O1NA 1JWBD 1NTYA 2DZMA 4RF0A 3UGBB 2KQSA 4HCNB 2V9HA 2Z59A 3X0WA 1D3ZA 1FHWA 4JKDA 1I4QA 3TEWA 4WAFA 2L8JA 4ANVA 2RDBC 2G9HD 2YRYA 2O2VA 4AWJA 4RGMA 3ONSA 1KF6B 2A5UA 1ZE3D 3QJZA 1XLNA 2P0HA 4BOSC 2P0FA 3DBHI 3UI3A 4XWWA 4N6EB 1KM7A 1UF0A 1J7CA 3WAOA 4I6LB 3B9JA 2CY4A 4HAXB 1U27A 5D3XA 2NZ8B 2IY1B 3MHSD 3WCQA 5HG2A 2NVUI 4W9GA 3U7ZA 2BVCA 2VH2A 4ICVA 3U2SC 3KRWA 2NPTB 1T77A 3AE2B 5CHVC 2PEAA 2K22A 3VFKA 2QKMA 3AH7A 1ZOYB 1U5DA 1DIKA 3TL5A 3V60A 5KHOA 4HHVA 4BKSD 2SAKA 3BK2A 4KGSA 3B2FA 2CR5A 1QF6A 2YT0A 1QOAA 5C6RA 1PYWD 3IAS1 5JH5C 2BYFA 1TY0A 5E6JA 2LGSA 5E6NA 1RLFA 4B95A 1WRIA 1EWCA 3DBLI 4LNKA 2LGYA 1H10A 3VOQA 2PPHA 5AEKB 2BTEA 2GB1A 3EECA 3GE3C 3ZTCA 1DGJA 2KHWB 4M8NA 3VIAA 4EZLA 4HAZB 3PRZA 4W9FA 2C7HA 5IN7A 3AU5A 5EDSA 4WSFA 1IGDA 1C4AA 4JL9A 5IA7A 2HTHB 3UQAA 2WXNA 3DBHB 2N0YA 3MHZA 3R8BA 4AJYB 4MEMA 5IAAC 2LXCA 2GBKA 4DDID 5EE0A 2KR0A 2GOWA 3HQCA 3TSSA 2GCLA 1V1OA 2GS0A 2Z59B 2WH5A 4ARIA 4HPLB 3ZNZB 1X11A 1TBEA 1OQQA 1L0VB 3PVLA 3SBTA 1Y8RC 1ZPSA 2YF0A 1V5UA 3MJWA 3S2AA 1MKEA 1M94A 5FI1A 2AQ2B 2OQBA 2LWPA 3ENBA 2WXLA 3N30A 2KX3A 2Y5BB 4MDKE 2RRFA 3B1LX 2M0XA 3A9KA 4S0RA 2RMMA 3I57A 3AU4A 3O13A 1K50A 4QXAB 3ZDMC 2CY5A 3UIPB 2D10A 2FIFA 3Q3JA 1PGBA 4OSNA 3JSVA 3D8FA 3DBLB 2BKFA 2KTFA 1C1YB 3FKYA 2JWUA 1LO5D 2J7QB
chains in the Genus database with same CATH topology
2H7DA 2D2QA 2NBUA 4DHZE 3K9OB 1WJ4A 2UZRA 1TQZA 1WGGA 5GMVA 1HE8A 2BCJA 3W1SA 4HPMB 1XD3B 5D94A 3H7SA 1Z87A 4GZUA 1EF1A 3PSEB 3NSUA 1I42A 2MCNB 2ZNVC 4XC2A 1WMHB 2M14A 4KAXB 1PMSA 1P1AA 2C9WB 2LG1A 2KZRA 4J6IA 2NMBA 2BGFA 1NI2A 3LDZE 1X1MA 5CLLB 1I35A 2KMAA 1OGWA 5AZHA 2N4FA 2FJLA 3IFWB 3VTUA 3P6AA 5E6OA 2YS1A 3C0RB 1KJTA 4DHZB 2ZJDA 2GBRA 3WYFB 5CX3A 1Q67A 1LW3A 3OJ3A 2GCJA 3ZNGC 1MPHA 4E3CA 2Z0OA 4ILHA 1FXTB 2ZVNA 5DIFB 1J19A 3SNHA 1RAXA 3DPDA 4GDLA 2DA0A 4ZRIA 4JKGA 3A4SC 1V5PA 3B08A 3FSSA 2B3AA 1PFJA 5JZEB 2I5FA 1ZW7A 1V88A 4LCDE 2FCNA 2OJRA 1R4MI 5DHAB 1ZSQA 2DYNA 1XR0B 4GOCA 4KSLC 4HB2B 2HD5B 1KZ7A 1OQNA 3QIJA 3QA8A 2WYQA 1LFDA 3F5RA 2COPA 5DPWA 2BKRB 4PS8A 4M8MA 2R82A 1IYFA 4NQLB 5E6PA 4G11A 1XT9B 2JZZA 4A3OA 2EMTA 1E7VA 1E8ZA 5LXIB 1V5OA 4F7ZA 2KCJA 1GGOA 2LGDA 3NZSA 1WGQA 2YSZA 3GOEA 3TJPA 1IPGA 2UZSA 4CHKA 4WJOA 3APCA 3DCGA 4D0NB 3TBLD 4PNKA 3N3KB 4FJZA 1ZKHA 2JP2A 3ZRFA 4CHMA 2MLBA 2DX5A 2IYDB 1CMXB 5JVLA 4LJPB 1XODA 3L10B 5D3VA 4GN1A 2KO3A 4K1RB 4G50A 4ZDVA 4A5KA 1NVLA 4IFSA 3GZNI 1DBHA 1KBLA 2MRPA 2DIKA 5C5BA 5D2MB 1NTVA 2DX5B 2NR2A 5DH9B 4PYZA 2CHWA 4FHKA 3KW5B 2Z0EB 2MW5A 3L0WB 1WJNA 4EZKA 1UNQA 3DBSA 2WX1A 3IG3A 3ML9A 3PGEA 1KLVA 4KDLB 5D3YA 1HB6A 4EUTA 3LJ3A 2ZPYA 1DDMA 3SBGA 2LVPA 1E5WA 2ELBA 2DAJA 1K5GB 2C7MB 1WI0A 1MIXA 3FEHA 4FBJB 4JK8A 2N9XA 4Z2NA 2CQUA 4XX5A 4RM9A 4DHJD 1TXDA 2NPTA 2RPQA 5C79A 3RULA 1K8RB 1V86A 2DFKA 1LXDA 3A9JB 2KFKA 3M63B 3ZUNA 3TCAA 3PHXB 3L08A 4TQ1A 5HE2A 3V5WA 5BO4B 4JKCA 5GOWB 4DBGA 4GGQA 1GC7A 2WDTB 1RFAA 3CF6E 3QWZB 4CHJA 2DKPA 3WAMA 1EVHA 2K8CA 3T06A 4URKA 3QQ8B 2D9XA 1ZC3B 4EKUA 2JT4B 1WG7A 2K8BA 1WRDB 4W9JA 4EMOA 2C5LC 2N7DA 2ZEQA 1C3TA 2JPHA 3JVZX 1WX7A 4MSMB 1EGXA 2MKRA 2GBJA 1U4AA 2LASA 2UWQA 2G45B 3VDZA 1WJMA 1WGHA 2FUHB 2D9ZA 1P0RA 1FGYA 3KUZA 3ML8A 1UEFA 3ZIMA 2DENB 3DXEA 4W9IA 3OJ4B 2CRFA 2WX0A 3RYTA 1WYWB 2KX0A 3KY9A 5DPRA 1BTKA 3DVNV 4HB0B 2PE6B 1UGMA 5IJMA 2RD0A 3VUWA 3KH0A 3H7PA 1WJ6A 2L1CA 2RGNB 3T9LA 5LXHA 3QBVB 2CAYA 2YS5A 2DTCA 4JKEA 4FN2A 1WY8A 2KOXA 4GDKB 4JKBA 1F9JA 4FA6A 4H8SA 3QAQA 4BKGA 5JHHA 2QHOA 2RUKB 3CIKA 1U29A 2G4DB 4K7UA 2K2UA 1WXSA 4GIVA 3RCPA 5KQ1A 1GG3A 3PZDA 1WX9A 2CHXA 4TQ0A 1X05A 4IWOA 2PE9A 2COAA 2Y8GA 2FIDA 4EJNA 1Q1OA 2D9WA 1WR1A 1HBKA 2W2WA 2IY0B 2W2XC 4A6HA 2G4SA 4W9DA 4NQKE 3R7QA 1WXVA 3WANA 3AJ4A 4GU2A 2ZZPB 1Y5OA 3G9WA 3V6EB 5KQ4A 2MSED 3ZDTA 1E8WA 2BF8B 1NU2A 3PV1A 3TW1A 1KZGA 1UELA 3H7PB 1WH3A 3Q3FA 2K25A 2V1YA 2K6DB 3AXCA 4KVGB 1MIZB 3PS6A 2MDXA 1YX5B 3AULA 3ODOA 4NJ7A 2LZ6A 2ASQA 4IWQA 1UNPA 3VVWB 3R7RA 1MK7B 3TMPB 4BFRA 1X86A 4DHJB 2PJHA 2C7NB 1GUAB 3R3MA 1EF5A 2DHJA 4P7IA 1WE6A 4W9CA 4BKSA 1H4RA 2RQ1A 5C23A 3N32A 1V2YA 1LQBA 2LRWA 2ROZB 1AARA 1WXAA 1PQSA 4EFOA 2KWUB 3SO6A 4PS3A 4KV2A 3EC8A 4WWOA 4ILJA 5JHAA 1E8YA 2MFQA 4HAWB 4L6EA 4MY6A 2A4ZA 2C60A 4KIKA 1GJZA 4HXDA 3SUZA 2KJHB 2GBMA 2N1WA 4NSWA 4XWXA 4DDGD 4A20A 3D8DA 2VRRB 3HHMA 4JKFA 2JXXA 1V61A 2VSZA 3NZUA 3EPYA 1NTIA 2LJ5A 4IAPA 1V5MA 1UBIA 2Z0QA 3U7DA 3BJIA 4WWNA 4KIKB 2MA9B 3CXBB 3L13A 3QC8B 1WJUA 4AJWA 3CSFA 1HB8A 5J3QA 4K2PA 2R2QA 4WJ7A 4GDLB 2R2OA 4K17A 4GMXB 2I5CA 2H7EA 2M38A 1U2BA 1WF9A 2IO3B 3DDCB 3FM8C 3E66A 2DN6A 2X0SA 4PQ0A 2O2VB 4HLEA 1XKEA 4JIOU 3IVFA 2EJ8A 2KK8A 4OVVA 1QZEA 3OLMD 1J0GA 3TIXA 4IC7B 2GMIC 3ZO5B 2DZJA 1G6JA 1V5TA 1FB8A 2LVQA 3VUXA 3ECIA 2G35A 1ZGUB 4JK9A 5KCVA 3PVUA 1WIAA 4ZRKA 2Q13A 2XQNM 2IZVB 3A1QA 4WJNA 3HM6X 4W9KA 1SHCA 1FOEA 3WAPA 1V81A 2HJ8A 2DYOA 3OANA 1YIWA 5HKHA 2E2XA 2KDBA 5DPTA 3TFMA 2KTRB 4GDKA 2ABDA 2BYVE 4EOYA 2Y7BA 4CO7A 2ELAA 4BVUC 4MJSB 1WM3A 3DBRI 4I6PA 3H9DA 5DCNA 4JQWC 1KI1B 2L2IA 2K39A 3A4RA 1WM2A 2N23A 4DX8A 2L76A 2LKOA 3MTNB 3ODWA 4K7SA 2L7RA 4MELA 5JLJB 1VBHA 1MK9B 4IWPA 4FHJA 5D6JB 3NS8A 4NJ6A 2KGXB 2O6VD 4GPTB 2JY6A 2ROVA 5G2NA 4GMVA 4BBKA 2G3QB 3UZTA 3EHVA 1EAZA 2MBHA 2NBVB 1V6EA 2RGFA 3A98B 4MGKE 2LOXA 5FR6A 3ZRCA 3UF8A 4WJPA 4KDIC 2PZ1A 5CHFA 1YQBA 3D32A 3PLUA 1VD2A 2KN5A 5DHFB 2I1KA 4PS7A 2IO1B 2CODA 1WJ1A 3VTWA 2AWTA 5J17A 2MWSB 2ZVOA 3HM3A 1RRPB 2YS3A 2COCA 3QK0A 4BKTA 1DYNA 4EEWA 2KTRA 2DYQA 1VCBA 2V76A 1WGUA 4WWPA 2WWZA 4HCPB 1P6SA 1WGRA 1DDWA 1FAOA 2KUPA 3VUYA 3E9LA 1PLSA 1XX0A 3UIOB 4IOYX 4Z2MB 2XEWA 1SIFA 4KZCA 3KZ1A 3GYOA 3H6NA 2KWCA 2L00B 3DOWA 3GYPA 3VH4B 4MGIE 1E90A 3DVGY 1UH6A 1P3QU 3VXWA 3KUCB 3M62B 1J0WA 3DXCA 2D4QA 2K00A 1AWEA 4KHBB 4MGZE 5FI0A 3I3TB 3UINB 3PREA 3V6CB 2Y8FA 2N9PC 3PRMB 3RD2A 2ZPNA 5EFXA 5L83A 3DQVA 3V61A 4IM3A 1K5DB 2DHKA 5JHGA 2MBEA 2D07B 1WGDA 2JRHA 2MQJA 4KZ0A 2M4NA 2XBBC 2KVRA 4HDQA 3KYDD 4W9EA 4E74A 5LOPB 1GNUA 3B0AA 1U5EA 4LDTB 4F8CB 2KQ7A 5C16A 2DZKA 4HB3B 2LXAA 1IRSA 3KUDB 4AOFA 2UVMA 4C0AA 1TJ6A 2YVCA 1WFYA 2OTXA 2N7EA 4A6KA 4TKNA 2NCNA 1U5GA 4TUUA 1ZC4B 3WALA 4HDOA 3SHQA 3RT3B 4NNJB 3BINA 2KD0A 1OQYA 1N3HA 5L81A 2RR9A 4LJOB 4GSWA 2P8VA 3RZWC 4CYEA 1TGZB 2MWNB 5DI9B 2L3ZA 1P3RA 3TO1A 1P9DU 2AEHA 2LOZA 3SD5A 4A3PA 4I6NB 4FADA 2V4LA 4IG7B 2R0DA 2FJ9A 2LYDA 3DVGX 3CMMB 3E9PA 4B9KA 3E9OA 2J59M 4HK2A 5LONB 5AZGA 1JRUA 1WE7A 4E71A 5D7GA 2KC2A 4ZYNA 2V3SA 2EMSA 2LI5A 4WJQA 2LBBA 4WVFB 2KJ6A 5J2RA 4MM3A 1WI1A 3U8ZA 2I1JA 1Y19B 4MJSA 2J0JA 4KHOA 3CSTA 3QHTA 3HW2B 3P7ZA 4ZRJA 2M1MA 2RNRB 1UPRA 3T8MA 3LJUX 2NBWB 2X18A 4JKAA 2IFSA 2DAFA 3M1IB 4HAYB 2Z0PA 1J8CA 5HE1A 1MG8A 2CHZA 4HJKA 2L0TA 1DDVA 4HVBA 2LVOA 5HE3A 1RRBA 1OMWA 4K2OA 2CB8A 3SU8X 1NBFC 4JLCA 1Q5WB 5D27A 3MDBC 3IHPC 1W1HA 1Q0WB 2BYEA 3P2BA 2L05A 2DYBA 2KDEB 1P5TA 2UYZB 4G3XB 1ZVRA 3ZVVA 1FGZA 4IM0A 1WZ0A 2DYMA 1V80A 4FLHA 3KVFB 1BAKA 1WGYA 5KHQA 2Z0DB 5LLIA 2KWVB 1WVHA 1ACAA 4YONA 3NOBA 3VH3B 1S1QB 3V62A 1KC7A 1X1FA 2GJYA 4IM2A 3NY5A 3W1SC 4IUMB 2VKIA 2D9VA 2R09A 3N7CA 3PP2A 2KLGA 1H8CA 1V89A 3ZTDA 3PT2B 5J18A 2KLCA 1BWNA 2DX1A 2AYOB 4DK5A 4M0WB 2KDIA 3ALBA 2MBOA 3OAWA 3MPXA 1QQGA 2ZCCA 3VAWA 2HE7A 3A9KB 1E8XA 1OTRB 2M8SA 2MX2A 3SYXA 3DVNU 2IBIB 3JSVB 2DZIA 4Y94A 2K2JA 4F7UP 1QC6A 2CU1A 2COFA 3ULCA 2VRWB 2JRIB 2QKLA 3WIMA 3ZLZA 4HATB 1W1DA 1UD7A 3QARA 1I7AA 1RJ2A 5JP4A 2FNJB 2JVCA 2RSUA 4HWIB 4XZ4A 3L54A 4A6FA 2W9NA 1SGHA 3JW0X 2P0DA 2BWES 2LUEA 3DXDA 2ZCBA 3H1UA 3QCAA 2YT1A 2MBBB 3PRPB 3BY4B 2IYBA 3L16A 1YJ1A 4K7WA 1Z2MA 3SDLC 5J3TA 4JKHA 4W9LA 4DWFA 2FDQA 2L0FA 1L7YA 3PTFC 5HE0A 3ZNHB 4FJVB 1BTNA 4BOZB 2IO0B 3KSYA 2J0KA 4MSQB 2EC1A 4G0NB 2KMCA 3ULBA 4HAVB 4KSKC 1YX6B 1JDEA 3ZKJC 4MK0A 5AZFA 1XCGA 1WMHA 2JUOA 4WQOB 3VQIA 3AI5A 5JHBA 2LD9A 2EKEC 4IW0A 1V9JA 1V49A 1WXMA 3NHEB 4HB4B 4B6HA 2MP2B 2KXJA 3PG7A 4NPNA 2RLOA 1ZM0A 3A8QA 2RVBB 1NDDA 1VBGA 1UBQA 4WAAA 2HRJA 3O96A 1MAIA 2AL3A 4LDTD 2KNBA 3RZFA 1WZ3A 1EUVB 4N9F4 2BPSA 2BWFA 2NS5A 4F7HA 2FCMA 4KHAA 1TTNA 2KFJA 4II3B 4BBNC 4NAWA 1UZXB 1L2NA 2KDFB 4RM8A 3ZNID 2D11A 4RMAA 2KANA 1W1GA 3VTVA 4DBBA 4JK7A 3PLVA 2DLWA 2M17A 2HTHA 2KC1A 1B55A 3L17A 5TR5A 4TV3A 3QWMA 4MT7A 4A6FB 4AUQC 5CHWA 1E7UA 1FHXA 4BBNF 3RCZA 1UPQA 2LULA 1U5FA 5DPSA 1T0YA 4ANUA 1OEYJ 2JZ3B 4K81A 4FULA 2MP2A 2O6VB 1I2HA 2ADZA 4GXBA 3QX1A 2LGXA 4TYZA 3D8EA 2K8HA 3KYCD 4B6WA 1LB1A 3ML4A 5CTRC 2W2XD 3A1QB 4FJYA 3U30A 3PEGA 3FLVA 3K9PB 2JF5A 1M7EA 4ASWC 1BT0A 2FAZA 2KFKB 2YLMA 1ISNA 3VHTC 1X1GA 2K6QA 4JGHB 1WX8A 4ANWA 3R66C 1KOTA 2FCSA 5CLQB 1S3SG 1EO6A 2KKCA 3PSCA 3PHWB 4NY0A 1YD8U 3UQBA 1SE9A 2CKHB 1GC6A 2D9YA 2XK5B 1WR6E 1DROA 1OY2A 3HIZA 3F0WA 4YL8A 4II2B 3ZW3A 2N1VA 4MGYE 2KJRA 2DHZA 4W9HA 1A5RA 2K1FA 4DX90 1IP9A 4OVUA 1M7RA 1XD4A 2GBNA 3A33B 2N9EB 1OEYA 3PPAA 1UNRA 2O6VA 4HAUB 2RSGA 3M3JA 2D3GA 3TVVA 1R4NI 2JWZA 2OOBB 2IO2B 3A9JA 2DKQA 1LM8B 4NAWB 4GB9A 4ICUA 2FCQA 2ZNVB 3W1YA 4F7GA 3ODXA 3M95A 5G55A 1XQQA 4EZJA 1Z5SB 4X57B 3SV1A 4AP4C 3APDA 4F1SA 4ANXA 2REXA 2DHIA 3JYUA 2AL6A 2J0MA 3FP5A 4ILGB 3WA0A 4JKGB 1P98A 5J3YA 3X23A 3HK0A 4MH0E 5C1ZA 5D3WA 3ZVRA 5L95C 2LRUA 4DXAB 3IBEA 4PYUA 3PVWA 1ST7A 1TZ1A 5C5BB 3RUIB 1FHOA 2XK5A 2CS4A 3O65B 3A8PA 3APFA 3ENEA 2MBQA 3EFUA 3KRXA 1AQCA 1NTYA 2DZMA 3UGBB 2KQSA 4HCNB 3X0WA 1D3ZA 1FHWA 4JKDA 2L8JA 4ANVA 2YRYA 2O2VA 4AWJA 3ONSA 2A5UA 3QJZA 2P0HA 4BOSC 2P0FA 3DBHI 1KM7A 3WAOA 4I6LB 2CY4A 4HAXB 1U27A 5D3XA 2NZ8B 2IY1B 3MHSD 2NVUI 4W9GA 4ICVA 3KRWA 2NPTB 5CHVC 2PEAA 3VFKA 2QKMA 1U5DA 1DIKA 3TL5A 3V60A 5KHOA 4HHVA 4BKSD 2CR5A 2YT0A 5C6RA 5JH5C 2BYFA 5E6NA 1RLFA 4B95A 3DBLI 2LGYA 1H10A 3VOQA 2PPHA 5AEKB 3EECA 3ZTCA 2KHWB 4M8NA 3VIAA 4EZLA 4HAZB 3PRZA 4W9FA 2C7HA 3AU5A 5EDSA 4WSFA 4JL9A 5IA7A 2HTHB 3UQAA 2N0YA 4AJYB 4MEMA 5IAAC 2LXCA 2GBKA 4DDID 2GOWA 3HQCA 2GCLA 2GS0A 2Z59B 2WH5A 4HPLB 3ZNZB 1X11A 1TBEA 3PVLA 3SBTA 1Y8RC 2YF0A 1V5UA 3MJWA 3S2AA 1MKEA 1M94A 5FI1A 2OQBA 2LWPA 3ENBA 3N30A 2KX3A 2Y5BB 4MDKE 3B1LX 2M0XA 3A9KA 3AU4A 3ZDMC 2CY5A 3UIPB 2D10A 2FIFA 3Q3JA 3JSVA 3D8FA 2BKFA 2KTFA 1C1YB 2J7QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXS A;  2H7D A;  2D07 B;  2MP2 B;  4GIV A;  2KXJ A;  2D2Q A;  3RCP A;  3PG7 A;  1WGD A;  2JRH A;  2NBU A;  2MQJ A;  5KQ1 A;  1GG3 A;  3PZD A;  4KZ0 A;  2M4N A;  4NPN A;  4DHZ E;  3K9O B;  2RLO A;  1WX9 A;  2XBB C;  1WJ4 A;  2KVR A;  4HDQ A;  1ZM0 A;  2CHX A;  3KYD D;  4W9E A;  2UZR A;  1TQZ A;  4TQ0 A;  3A8Q A;  1X05 A;  2RVB B;  1WGG A;  4IWO A;  5GMV A;  4E74 A;  5LOP B;  1GNU A;  1HE8 A;  3B0A A;  1NDD A;  1U5E A;  4LDT B;  4F8C B;  2PE9 A;  1UBQ A;  2BCJ A;  2COA A;  2KQ7 A;  5C16 A;  4WAA A;  2HRJ A;  4HB3 B;  2DZK A;  3W1S A;  2LXA A;  2Y8G A;  1IRS A;  3O96 A;  1XD3 B;  3KUD B;  4HPM B;  3H7S A;  1MAI A;  5D94 A;  1Z87 A;  4AOF A;  4GZU A;  2FID A;  1EF1 A;  4EJN A;  2UVM A;  2D9W A;  4C0A A;  1Q1O A;  3PSE B;  2AL3 A;  1WR1 A;  3NSU A;  1HBK A;  1TJ6 A;  2W2W A;  2KNB A;  2IY0 B;  4LDT D;  2YVC A;  2W2X C;  4A6H A;  1WZ3 A;  2G4S A;  3RZF A;  1EUV B;  1I42 A;  4N9F 4;  4W9D A;  1WFY A;  2BPS A;  2MCN B;  4NQK E;  2OTX A;  2N7E A;  4A6K A;  4TKN A;  1WXV A;  3R7Q A;  3WAN A;  2ZNV C;  4XC2 A;  1WMH B;  3AJ4 A;  4GU2 A;  2ZZP B;  2NCN A;  2M14 A;  1Y5O A;  3G9W A;  4KAX B;  3V6E B;  1U5G A;  2BWF A;  1PMS A;  4TUU A;  2NS5 A;  4F7H A;  5KQ4 A;  1ZC4 B;  2FCM A;  1P1A A;  2C9W B;  3ZDT A;  4KHA A;  2MSE D;  1E8W A;  4DDG D;  2BF8 B;  3WAL A;  1TTN A;  1NU2 A;  2KFJ A;  4HDO A;  2LG1 A;  3PV1 A;  4II3 B;  3SHQ A;  3TW1 A;  2KZR A;  1KZG A;  3RT3 B;  4J6I A;  4NNJ B;  3BIN A;  4NAW A;  4BBN C;  2NMB A;  1UZX B;  1UEL A;  1L2N A;  2KD0 A;  2KDF B;  3H7P B;  2BGF A;  1WH3 A;  1OQY A;  3Q3F A;  1NI2 A;  2K25 A;  4RM8 A;  3ZNI D;  1N3H A;  5L81 A;  2V1Y A;  2RR9 A;  2D11 A;  4RMA A;  4LJO B;  2KAN A;  1W1G A;  3LDZ E;  2P8V A;  1X1M A;  5CLL B;  2K6D B;  4GSW A;  3AXC A;  2KMA A;  3RZW C;  4CYE A;  3VTV A;  1I35 A;  4KVG B;  1OGW A;  5AZH A;  1TGZ B;  1MIZ B;  3PS6 A;  4DBB A;  2MDX A;  3PLV A;  1YX5 B;  2DLW A;  2M17 A;  3AUL A;  3ODO A;  2MWN B;  2HTH A;  5DI9 B;  2LZ6 A;  2N4F A;  2ASQ A;  2FJL A;  2KC1 A;  2L3Z A;  4NJ7 A;  1B55 A;  3L17 A;  1UNP A;  4IWQ A;  1P3R A;  5TR5 A;  3R7R A;  1MK7 B;  3TO1 A;  3VVW B;  4TV3 A;  3TMP B;  3IFW B;  3QWM A;  4BFR A;  1X86 A;  3VTU A;  3P6A A;  4MT7 A;  4A6F B;  2AEH A;  1P9D U;  5E6O A;  2YS1 A;  3C0R B;  1KJT A;  5CHW A;  4AUQ C;  4DHJ B;  2LOZ A;  2ZJD A;  1E7U A;  1FHX A;  4DHZ B;  3SD5 A;  4A3P A;  4I6N B;  2PJH A;  2GBR A;  3WYF B;  5CX3 A;  4BBN F;  4FHK A;  3RCZ A;  4FAD A;  1Q67 A;  2C7N B;  1GUA B;  2V4L A;  5D6J B;  1LW3 A;  3OJ3 A;  3R3M A;  2GCJ A;  1EF5 A;  2R0D A;  2FJ9 A;  2DHJ A;  4IG7 B;  4P7I A;  3ZNG C;  1MPH A;  1UPQ A;  2LUL A;  1U5F A;  2Z0O A;  5DPS A;  4E3C A;  2LYD A;  1T0Y A;  1WE6 A;  1H4R A;  4W9C A;  2RQ1 A;  3DVG X;  1OEY J;  4ANU A;  4BKS A;  3CMM B;  1FXT B;  2JZ3 B;  2ZVN A;  5C23 A;  3N32 A;  5DIF B;  1J19 A;  4K81 A;  1V2Y A;  4B9K A;  3SNH A;  4FUL A;  1LQB A;  2MP2 A;  2O6V B;  1I2H A;  2LRW A;  2J59 M;  2ADZ A;  4HK2 A;  5LON B;  4GXB A;  2ROZ B;  5AZG A;  1JRU A;  1AAR A;  1WXA A;  1WE7 A;  4E71 A;  3QX1 A;  2LGX A;  5D7G A;  4TYZ A;  1PQS A;  1RAX A;  2KC2 A;  4EFO A;  2KWU B;  3DPD A;  4ZYN A;  2V3S A;  2EMS A;  3SO6 A;  4I6L B;  4GDL A;  4PS3 A;  4KV2 A;  2DA0 A;  4ZRI A;  2LI5 A;  3A4S C;  3D8E A;  4WJQ A;  1V5P A;  2K8H A;  3KYC D;  2LBB A;  3EC8 A;  4WVF B;  4WWO A;  3B08 A;  4B6W A;  3FSS A;  1LB1 A;  5JHA A;  2B3A A;  2KJ6 A;  1PFJ A;  5J2R A;  4MM3 A;  5JZE B;  2I5F A;  1E8Y A;  3ML4 A;  1ZW7 A;  2MFQ A;  1WI1 A;  4HAW B;  5CTR C;  1V88 A;  2W2X D;  4LCD E;  2FCN A;  3U8Z A;  4L6E A;  2OJR A;  4MY6 A;  1R4M I;  5DHA B;  2I1J A;  1ZSQ A;  1XR0 B;  2DYN A;  2A4Z A;  2C60 A;  3A1Q B;  4FJY A;  4GOC A;  4HB2 B;  2HD5 B;  1Y19 B;  4KSL C;  1KZ7 A;  1OQN A;  3U30 A;  3PEG A;  3QIJ A;  4KIK A;  3FLV A;  3K9P B;  4MJS A;  1GJZ A;  2J0J A;  3QA8 A;  4HXD A;  4KHO A;  2WYQ A;  1LFD A;  3SUZ A;  3CST A;  3F5R A;  1M7E A;  2JF5 A;  2KJH B;  2GBM A;  2N1W A;  3QHT A;  2COP A;  4ASW C;  5DPW A;  3HW2 B;  3P7Z A;  1BT0 A;  2FAZ A;  4ZRJ A;  2BKR B;  2M1M A;  4NSW A;  4XWX A;  2KFK B;  4M8M A;  4PS8 A;  2RNR B;  2YLM A;  1UPR A;  4A20 A;  1ISN A;  3T8M A;  1X1G A;  3D8D A;  2K6Q A;  2VRR B;  3HHM A;  3VHT C;  4JGH B;  4NQL B;  3LJU X;  1WX8 A;  1XT9 B;  2JZZ A;  3R66 C;  4G11 A;  5E6P A;  4A3O A;  4ANW A;  2EMT A;  2NBW B;  1E7V A;  2JXX A;  2X18 A;  1KOT A;  2FCS A;  1E8Z A;  5CLQ B;  5LXI B;  2IFS A;  1V61 A;  3M1I B;  2VSZ A;  4HAY B;  1V5O A;  2DAF A;  1S3S G;  4F7Z A;  1EO6 A;  2KCJ A;  2Z0P A;  3EPY A;  2KKC A;  3PSC A;  1NTI A;  2LGD A;  3NZS A;  3NZU A;  3PHW B;  4NY0 A;  1J8C A;  2LJ5 A;  5HE1 A;  1YD8 U;  4IAP A;  1WGQ A;  2YSZ A;  1MG8 A;  2CHZ A;  3GOE A;  3UQB A;  3TJP A;  1V5M A;  1IPG A;  2UZS A;  1UBI A;  2L0T A;  4HJK A;  1SE9 A;  1DDV A;  4HVB A;  2LVO A;  2Z0Q A;  2CKH B;  5HE3 A;  3U7D A;  3BJI A;  4WWN A;  4KIK B;  1GC6 A;  2MA9 B;  2D9Y A;  3CXB B;  4CHK A;  2XK5 B;  1WR6 E;  3APC A;  4WJO A;  3DCG A;  1DRO A;  4D0N B;  4MSQ B;  3TBL D;  1RRB A;  1OMW A;  1OY2 A;  4K2O A;  2CB8 A;  3F0W A;  4PNK A;  4YL8 A;  3HIZ A;  3L13 A;  3N3K B;  4FJZ A;  3SU8 X;  1NBF C;  1ZKH A;  4II2 B;  1Q5W B;  3QC8 B;  5D27 A;  4JLC A;  3ZW3 A;  3MDB C;  1WJU A;  2JP2 A;  3IHP C;  2N1V A;  1W1H A;  1Q0W B;  4MGY E;  3ZRF A;  4AJW A;  4CHM A;  2BYE A;  2KJR A;  2MLB A;  1HB8 A;  3CSF A;  2DX5 A;  5J3Q A;  2DHZ A;  4K2P A;  2IYD B;  2R2Q A;  3P2B A;  4W9H A;  4WJ7 A;  2L05 A;  2DYB A;  1CMX B;  2KDE B;  4LJP B;  1XOD A;  1A5R A;  2K1F A;  4DX9 0;  1P5T A;  4GDL B;  2R2O A;  1IP9 A;  3L10 B;  4K17 A;  4OVU A;  1M7R A;  5D3V A;  4PYZ A;  1XD4 A;  4GN1 A;  2GBN A;  2UYZ B;  4G3X B;  1ZVR A;  4GMX B;  2KO3 A;  3A33 B;  4K1R B;  3ZVV A;  1FGZ A;  2I5C A;  2N9E B;  4IM0 A;  1OEY A;  2H7E A;  1UNR A;  4A5K A;  1WZ0 A;  3PPA A;  4G50 A;  1NVL A;  4IFS A;  2O6V A;  4ZDV A;  4HAU B;  2RSG A;  3M3J A;  2DYM A;  3GZN I;  2D3G A;  1IYF A;  1V80 A;  2M38 A;  1U2B A;  3TVV A;  1WF9 A;  2IO3 B;  4FLH A;  1R4N I;  1DBH A;  2JWZ A;  3DDC B;  3KVF B;  2OOB B;  3FM8 C;  2IO2 B;  2MRP A;  5C5B A;  2DN6 A;  5D2M B;  4PQ0 A;  1BAK A;  1WGY A;  3A9J A;  2O2V B;  1NTV A;  5KHQ A;  2DKQ A;  1LM8 B;  4HLE A;  2Z0D B;  1XKE A;  2KWV B;  4GB9 A;  4JIO U;  4NAW B;  2DX5 B;  5LLI A;  1WVH A;  4ICU A;  2NR2 A;  2FCQ A;  2ZNV B;  1ACA A;  3IVF A;  2EJ8 A;  5DH9 B;  3W1Y A;  4F7G A;  2CHW A;  3ODX A;  3M95 A;  2KK8 A;  4YON A;  3KW5 B;  1QZE A;  2Z0E B;  2MW5 A;  3NOB A;  3OLM D;  1XQQ A;  3L0W B;  1Z5S B;  5G55 A;  1WJN A;  4EZJ A;  3VH3 B;  1J0G A;  4EZK A;  1S1Q B;  3TIX A;  3V62 A;  4IC7 B;  4X57 B;  1UNQ A;  3SV1 A;  2GMI C;  3DBS A;  2WX1 A;  3ZO5 B;  3IG3 A;  2DZJ A;  1X1F A;  3ML9 A;  1V5T A;  3PGE A;  1G6J A;  2GJY A;  1KLV A;  1FB8 A;  4IM2 A;  2LVQ A;  4KDL B;  5D3Y A;  3VUX A;  4AP4 C;  1HB6 A;  3ECI A;  3NY5 A;  3APD A;  2G35 A;  3W1S C;  1ZGU B;  4F1S A;  4IUM B;  4EUT A;  5KCV A;  3LJ3 A;  4ANX A;  3PVU A;  1WIA A;  2ZPY A;  2D9V A;  2DHI A;  2VKI A;  2REX A;  4ZRK A;  1DDM A;  2AL6 A;  3JYU A;  2Q13 A;  2XQN M;  2J0M A;  2LVP A;  1E5W A;  2ELB A;  2IZV B;  2R09 A;  3A1Q A;  4WJN A;  2DAJ A;  3FP5 A;  3N7C A;  3PP2 A;  2KLG A;  1H8C A;  3WA0 A;  3HM6 X;  1V89 A;  3ZTD A;  3PT2 B;  5J18 A;  1K5G B;  2C7M B;  1P98 A;  2KLC A;  4W9K A;  1SHC A;  5J3Y A;  1WI0 A;  1BWN A;  2DX1 A;  1MIX A;  3X23 A;  3HK0 A;  3FEH A;  1FOE A;  2AYO B;  4MH0 E;  2N9X A;  4FBJ B;  4DK5 A;  3WAP A;  4Z2N A;  1V81 A;  4M0W B;  2HJ8 A;  2KDI A;  5C1Z A;  2DYO A;  2CQU A;  3OAN A;  5D3W A;  3ALB A;  3ZVR A;  2MBO A;  1TXD A;  4RM9 A;  4XX5 A;  2NPT A;  2RPQ A;  5C79 A;  3OAW A;  4DHJ D;  5L95 C;  3MPX A;  1YIW A;  2LRU A;  4DXA B;  3RUL A;  1K8R B;  1V86 A;  3IBE A;  5HKH A;  2DFK A;  1LXD A;  3A9J B;  2E2X A;  4PYU A;  1QQG A;  3PVW A;  2KDB A;  2ZCC A;  5DPT A;  3TFM A;  1ST7 A;  2KFK A;  1TZ1 A;  2KTR B;  3VAW A;  2HE7 A;  2ABD A;  5C5B B;  3A9K B;  3M63 B;  4GDK A;  1E8X A;  2BYV E;  3RUI B;  3ZUN A;  1FHO A;  2XK5 A;  4EOY A;  2Y7B A;  3TCA A;  2CS4 A;  3PHX B;  4CO7 A;  2ELA A;  1OTR B;  3O65 B;  3L08 A;  2M8S A;  4TQ1 A;  3A8P A;  5HE2 A;  3V5W A;  2MX2 A;  4BVU C;  5BO4 B;  4MJS B;  5GOW B;  3APF A;  1WM3 A;  3SYX A;  2MBQ A;  3DVN U;  3KRX A;  2IBI B;  1AQC A;  3EFU A;  3ENE A;  4DBG A;  3DBR I;  4GGQ A;  4I6P A;  3H9D A;  1NTY A;  2DZM A;  5DCN A;  3UGB B;  4JQW C;  1GC7 A;  1KI1 B;  2KQS A;  4HCN B;  2L2I A;  2WDT B;  2K39 A;  3A4R A;  1WM2 A;  2DZI A;  1FHW A;  3JSV B;  4Y94 A;  3X0W A;  1D3Z A;  2N23 A;  2K2J A;  1RFA A;  4F7U P;  1QC6 A;  2L8J A;  4ANV A;  2YRY A;  4DX8 A;  2O2V A;  3CF6 E;  4AWJ A;  2CU1 A;  2LKO A;  2L76 A;  3MTN B;  3ODW A;  3ONS A;  3QWZ B;  2A5U A;  3QJZ A;  4CHJ A;  4K7S A;  2DKP A;  2COF A;  2P0H A;  4BOS C;  2P0F A;  3DBH I;  2L7R A;  3WAM A;  4MEL A;  1EVH A;  5JLJ B;  3T06 A;  2K8C A;  4URK A;  1KM7 A;  1MK9 B;  3ULC A;  4IWP A;  3WAO A;  3QQ8 B;  4FHJ A;  2VRW B;  2JRI B;  2CY4 A;  4HAX B;  2D9X A;  3NS8 A;  2QKL A;  1ZC3 B;  4NJ6 A;  1U27 A;  5D3X A;  2NZ8 B;  3WIM A;  3ZLZ A;  2IY1 B;  2KGX B;  2O6V D;  3MHS D;  2NVU I;  4HAT B;  4W9G A;  4EKU A;  1W1D A;  4ICV A;  1UD7 A;  3KRW A;  2JT4 B;  2NPT B;  1WG7 A;  4GPT B;  2JY6 A;  1WRD B;  2K8B A;  3QAR A;  1I7A A;  4W9J A;  1RJ2 A;  2ROV A;  5CHV C;  2PEA A;  5JP4 A;  3VFK A;  4EMO A;  5G2N A;  2QKM A;  4GMV A;  4BBK A;  2C5L C;  2FNJ B;  2G3Q B;  2N7D A;  2ZEQ A;  2JVC A;  2RSU A;  3UZT A;  1C3T A;  2JPH A;  4HWI B;  1U5D A;  4XZ4 A;  3TL5 A;  3EHV A;  3V60 A;  5KHO A;  1EAZ A;  4HHV A;  3L54 A;  4A6F A;  4BKS D;  2W9N A;  2MBH A;  2NBV B;  3JVZ X;  1V6E A;  2RGF A;  3A98 B;  1SGH A;  4MGK E;  1WX7 A;  3JW0 X;  2P0D A;  2CR5 A;  2BWE S;  2LUE A;  3DXD A;  2YT0 A;  2ZCB A;  3H1U A;  4MSM B;  2LOX A;  1EGX A;  5FR6 A;  3ZRC A;  3QCA A;  2MKR A;  5C6R A;  2GBJ A;  4WJP A;  3UF8 A;  2YT1 A;  1U4A A;  2PZ1 A;  4KDI C;  5CHF A;  2LAS A;  5JH5 C;  1YQB A;  2UWQ A;  3D32 A;  2BYF A;  2G45 B;  2MBB B;  3PRP B;  3PLU A;  3VDZ A;  5E6N A;  1RLF A;  1WJM A;  3BY4 B;  2IYB A;  3L16 A;  4B95 A;  1VD2 A;  1WGH A;  2KN5 A;  1YJ1 A;  5DHF B;  3DBL I;  2FUH B;  4K7W A;  2I1K A;  1Z2M A;  4PS7 A;  2IO1 B;  2COD A;  2LGY A;  1H10 A;  3VOQ A;  2PPH A;  1WJ1 A;  5AEK B;  3SDL C;  5J3T A;  4W9L A;  2D9Z A;  3VTW A;  4DWF A;  3EEC A;  1P0R A;  1FGY A;  2AWT A;  3ZTC A;  5J17 A;  2MWS B;  2KHW B;  2ZVO A;  4M8N A;  2FDQ A;  3VIA A;  3HM3 A;  3KUZ A;  4EZL A;  4HAZ B;  1RRP B;  2YS3 A;  2COC A;  3PRZ A;  3QK0 A;  4W9F A;  2C7H A;  3ML8 A;  1UEF A;  3ZIM A;  2DEN B;  3AU5 A;  4BKT A;  4WSF A;  2L0F A;  5EDS A;  3DXE A;  4W9I A;  1L7Y A;  3PTF C;  1DYN A;  5HE0 A;  3OJ4 B;  4JL9 A;  2HTH B;  2CRF A;  2KTR A;  4EEW A;  2WX0 A;  3RYT A;  5IA7 A;  1WYW B;  3UQA A;  2KX0 A;  2DYQ A;  1VCB A;  2N0Y A;  2V76 A;  3KY9 A;  5DPR A;  4AJY B;  1WGU A;  1BTK A;  3DVN V;  4MEM A;  4WWP A;  2WWZ A;  5IAA C;  4HB0 B;  2LXC A;  1P6S A;  2PE6 B;  4HCP B;  1WGR A;  1DDW A;  1FAO A;  2GBK A;  3ZNH B;  2KUP A;  4DDI D;  2GOW A;  3VUY A;  3HQC A;  1UGM A;  2GCL A;  4FJV B;  1BTN A;  2GS0 A;  4BOZ B;  2IO0 B;  2WH5 A;  2Z59 B;  3KSY A;  4HPL B;  3ZNZ B;  1PLS A;  1X11 A;  2J0K A;  5IJM A;  1XX0 A;  4IOY X;  2EC1 A;  1TBE A;  2RD0 A;  4Z2M B;  4G0N B;  2XEW A;  3KH0 A;  1SIF A;  3H7P A;  3VUW A;  2KMC A;  1WJ6 A;  4KZC A;  3PVL A;  3ULB A;  4HAV B;  4KSK C;  3KZ1 A;  1YX6 B;  1Y8R C;  3GYO A;  2L1C A;  2YF0 A;  1V5U A;  2RGN B;  3MJW A;  3T9L A;  3H6N A;  4OVV A;  3S2A A;  3QBV B;  5LXH A;  2CAY A;  2KWC A;  1MKE A;  2L00 B;  1M94 A;  3GYP A;  3DOW A;  3ZKJ C;  5FI1 A;  4MK0 A;  2YS5 A;  2OQB A;  3VH4 B;  5AZF A;  2DTC A;  2LWP A;  4MGI E;  3N30 A;  1XCG A;  1E90 A;  1UH6 A;  3DVG Y;  1P3Q U;  4FN2 A;  3VXW A;  1WY8 A;  2KX3 A;  2Y5B B;  4MDK E;  3B1L X;  2KOX A;  3KUC B;  1WMH A;  3M62 B;  1J0W A;  3DXC A;  2M0X A;  2JUO A;  2D4Q A;  2K00 A;  3A9K A;  4GDK B;  4WQO B;  1AWE A;  4KHB B;  3AI5 A;  3VQI A;  5JHB A;  4MGZ E;  5FI0 A;  2LD9 A;  3I3T B;  3PRE A;  3UIN B;  3AU4 A;  1F9J A;  3V6C B;  4FA6 A;  2EKE C;  2Y8F A;  4IW0 A;  2CY5 A;  2N9P C;  3PRM B;  3UIP B;  4H8S A;  2D10 A;  3ZDM C;  1V9J A;  2FIF A;  3QAQ A;  1V49 A;  3RD2 A;  2ZPN A;  3Q3J A;  5EFX A;  4BKG A;  3DQV A;  5JHH A;  3D8F A;  3JSV A;  5L83 A;  3V61 A;  2QHO A;  3UIO B;  1WXM A;  2RUK B;  4IM3 A;  3NHE B;  2BKF A;  3CIK A;  2KTF A;  1K5D B;  2DHK A;  1C1Y B;  4HB4 B;  1U29 A;  4B6H A;  2G4D B;  5JHG A;  4K7U A;  2MBE A;  2K2U A;  2J7Q B; 
#chains in the Genus database with same CATH topology
 1L4Z B;  2H7D A;  4WIP A;  2D2Q A;  2NBU A;  4A55 A;  4DHZ E;  3RFZ B;  3K9O B;  2RDH A;  1WJ4 A;  2WXO A;  2UZR A;  1TQZ A;  1WGG A;  2WNM A;  5GMV A;  1SSN A;  1F2R I;  3Q8A A;  3RNG C;  1HE8 A;  2E3T A;  2BCJ A;  3W1S A;  1C9F A;  4HPM B;  1XD3 B;  5D94 A;  3H7S A;  2PMV A;  1Z87 A;  4GZU A;  1EF1 A;  3PSE B;  3NSU A;  3NVZ A;  4YWG G;  1I42 A;  4OHJ A;  2MCN B;  3AEC B;  2ZNV C;  4XC2 A;  4XDD A;  1WMH B;  2M14 A;  1R4N B;  4KAX B;  1PMS A;  2V4I B;  1CJE A;  1I7H A;  1P1A A;  2C9W B;  4A8X C;  2LG1 A;  2PTL A;  2KZR A;  4J6I A;  5IO9 A;  2NMB A;  2BGF A;  1NI2 A;  1F52 A;  5HI1 A;  3LDZ E;  1X1M A;  5CLL B;  1I35 A;  2KMA A;  1OGW A;  5AZH A;  2NMQ A;  2N4F A;  2FJL A;  3EUB 2;  2CU3 A;  4A9A A;  3I5J C;  3IFW B;  3MFG A;  3TEZ A;  3VTU A;  3P6A A;  5E6O A;  2YS1 A;  1VDV A;  1KJT A;  3C0R B;  4DHZ B;  2ZJD A;  2EEL A;  2GBR A;  3WYF B;  5CX3 A;  1Q67 A;  1LW3 A;  3OJ3 A;  4YTM B;  2GCJ A;  3IXS A;  3ZNG C;  1MPH A;  4E3C A;  2Z0O A;  3FIL B;  3GS2 A;  4ILH A;  1FXT B;  2ZVN A;  5DIF B;  1J19 A;  4XYC A;  3SNH A;  1FXI A;  4TSS A;  1RAX A;  3DPD A;  3P4S B;  1YJI A;  3NUH B;  4P16 A;  4GDL A;  1HA5 A;  5BMG A;  2DA0 A;  4ZRI A;  4JKG A;  2BT6 A;  2QJL A;  3A4S C;  1V5P A;  4RH6 A;  2V3N A;  1SE4 A;  3B08 A;  2R2Y A;  3FSS A;  1QOB A;  2Y5C A;  2KQ4 X;  2B3A A;  4DQO C;  1F2R C;  2AX5 A;  1PFJ A;  5JZE B;  2I5F A;  1ZW7 A;  1V88 A;  2INN E;  4LCD E;  2FCN A;  2OJR A;  1R4M I;  5DHA B;  1ZSQ A;  2DYN A;  1XR0 B;  2M56 B;  4GOC A;  4KSL C;  4HB2 B;  2HD5 B;  4L2Y A;  1KZ7 A;  1OQN A;  3QIJ A;  3QA8 A;  2WYQ A;  1LFD A;  3F5R A;  3P4P B;  2COP A;  5DPW A;  3RNB C;  2BKR B;  4PS8 A;  4M8M A;  2XN9 C;  2R82 A;  1IYF A;  4LK0 M;  4NQL B;  5E6P A;  4G11 A;  1XT9 B;  1ZDX A;  2JZZ A;  4A3O A;  2EMT A;  1E7V A;  2B76 B;  3LXF A;  1E8Z A;  5LXI B;  1KTK A;  1V5O A;  1A70 A;  1LGR A;  2L32 A;  3GB1 A;  4F7Z A;  2KCJ A;  1GGO A;  2LGD A;  3NJT A;  1JWS D;  3NZS A;  4RCO A;  1YN5 A;  3DCX A;  1WGQ A;  2YSZ A;  3GOE A;  1B1Z A;  3TJP A;  1IPG A;  4JE3 B;  2UZS A;  2N9K A;  3AE4 B;  2TSS A;  1NYQ A;  4CHK A;  2JX5 A;  3APC A;  4WJO A;  3DCG A;  1TKE A;  4D0N B;  5T8I A;  3TBL D;  2R61 A;  4PNK A;  3P4Q B;  2NBV A;  3N3K B;  4FJZ A;  1ZKH A;  3GP7 A;  3ZJV A;  2JP2 A;  3AV8 A;  3W5U B;  1I4R A;  3ZRF A;  4CHM A;  2MLB A;  2DX5 A;  1PGA A;  2IYD B;  1CMX B;  5JVL A;  4LJP B;  2XNA C;  1XOD A;  3L10 B;  5D3V A;  4GN1 A;  2KO3 A;  4K1R B;  4L1B A;  1XCT L;  4G50 A;  4ZDV A;  4A5K A;  1NVL A;  4IFS A;  1C4C A;  3GZN I;  1DBH A;  2ICI A;  2KIG A;  1KBL A;  2L1A A;  2MRP A;  2DIK A;  5C5B A;  1T0R C;  2HJ1 A;  5D2M B;  4D2K A;  1NTV A;  3U4E G;  2DX5 B;  3ZJT A;  2NR2 A;  1E10 A;  2IPK D;  5DH9 B;  2CHW A;  4PYZ A;  2KAJ A;  4Q2J A;  4FHK A;  3KW5 B;  2Z0E B;  2MW5 A;  3L0W B;  1TZO A;  1WJN A;  4EZK A;  1UNQ A;  3DBS A;  2WX1 A;  2OED A;  3IG3 A;  2LUM A;  3ML9 A;  3PGE A;  1ZXH A;  1KLV A;  4KDL B;  5D3Y A;  1HB6 A;  3Q8E A;  4EUT A;  3LJ3 A;  2ZPY A;  1FFV A;  1DDM A;  3SBG A;  4HEA 1;  2LVP A;  1GB1 A;  1E5W A;  2ELB A;  3VRB B;  4REZ A;  2DAJ A;  1K5G B;  2C7M B;  2H88 B;  4YSY B;  4N58 A;  1WI0 A;  5G5H A;  1MIX A;  3FEH A;  2LHE A;  4JK8 A;  4FBJ B;  2Q5W D;  2N9X A;  2K49 A;  4Z2N A;  2CQU A;  4XX5 A;  1C79 A;  4RM9 A;  4DHJ D;  1TXD A;  5BYS A;  2NPT A;  2RPQ A;  5C79 A;  1FCL A;  2EKI A;  3RUL A;  1N6Z A;  1K8R B;  1V86 A;  2DFK A;  1LXD A;  3A9J B;  1CZP A;  2KFK A;  3M63 B;  3IAM 1;  3ZUN A;  4HKQ A;  3TCA A;  3PHX B;  3DBR B;  3L08 A;  4TQ1 A;  5HE2 A;  3V5W A;  5BO4 B;  4JKC A;  5GOW B;  3AE5 B;  1B9R A;  4DBG A;  4GGQ A;  3NWF A;  1FNV A;  1GC7 A;  1K53 A;  5C3J B;  2WDT B;  4DXF A;  4J3O D;  1RFA A;  3HSA A;  1FIQ A;  3CF6 E;  1J7A A;  3QWZ B;  4CHJ A;  3DWM A;  2DKP A;  1FNW A;  3WAM A;  2BS4 B;  1EVH A;  2K8C A;  3T06 A;  5LNK 1;  4URK A;  3QQ8 B;  2D9X A;  1ZC3 B;  1KLU D;  2JQR B;  2IDY A;  4WH4 A;  4EKU A;  1T5X D;  2JT4 B;  1WG7 A;  2K8B A;  1WRD B;  2WXM A;  2WU5 B;  4W9J A;  4EMO A;  2C5L C;  2N7D A;  2ZEQ A;  1C3T A;  2JPH A;  4PK1 A;  1TS4 A;  3JVZ X;  1WX7 A;  4MSM B;  1EGX A;  2MKR A;  2GBJ A;  1ZUD 2;  1U4A A;  2LAS A;  2UWQ A;  2G45 B;  2N9L A;  1IUE A;  1VRA B;  3VDZ A;  1WJM A;  1WGH A;  1N5X A;  2JZP A;  2FUH B;  3ZXV A;  1I4G A;  3BWU D;  1XLQ A;  1P7E A;  3KLS X;  2D9Z A;  1P0R A;  1FGY A;  4P1C C;  1NI3 A;  3KUZ A;  1XLP A;  2V3P A;  3ML8 A;  1UEF A;  3ZIM A;  2DEN B;  4C7Z A;  3DXE A;  4W9I A;  1CQV A;  3OJ4 B;  2CRF A;  2WX0 A;  3RYT A;  1WYW B;  2KX0 A;  3KY9 A;  5DPR A;  1BTK A;  3DVN V;  1FFU A;  4HB0 B;  2PE6 B;  4JWS C;  1UGM A;  2PKO A;  2FUG 1;  3RI7 C;  5IJM A;  2RD0 A;  2JSV X;  3VUW A;  3KH0 A;  3H7P A;  4LNF A;  4HJG E;  1WJ6 A;  3B2G A;  1SF0 A;  5G5G A;  2L1C A;  4R3D A;  2N0S B;  2RGN B;  3T9L A;  4M02 A;  5LXH A;  3QBV B;  2CAY A;  3H8H A;  5I2S A;  4OVZ A;  3CIR B;  2WU2 B;  3DWG C;  2YS5 A;  1HZ5 A;  4JX1 C;  2DTC A;  4JKE A;  4FN2 A;  1FCC C;  1YJJ A;  1WY8 A;  2KOX A;  1L4D B;  2CJO A;  2V0G A;  2DBY A;  2I2Y A;  4CQN A;  4GDK B;  4JKB A;  1AYF A;  3CWI A;  3I9V 1;  1F9J A;  4FA6 A;  4H8S A;  1MHX A;  3QAQ A;  4BKG A;  3NVV A;  5JHH A;  3NS1 A;  2KWD A;  1AWD A;  2QHO A;  2RUK B;  3CIK A;  3Q69 A;  1VR9 A;  1TS3 A;  2NTS A;  2J53 A;  1U29 A;  2G4D B;  3AN1 A;  4K7U A;  4ZRQ A;  2K2U A;  1WXS A;  4GIV A;  3RCP A;  5KQ1 A;  1GG3 A;  3PZD A;  2RPV A;  1WX9 A;  1CK1 A;  2CHX A;  5MPO A;  4TQ0 A;  1X05 A;  4IWO A;  1L0Y B;  4US8 A;  2PE9 A;  2COA A;  1ET9 A;  5D3I B;  2Y8G A;  2FID A;  4EJN A;  1Q1O A;  2KVZ A;  2D9W A;  3VR9 B;  1WR1 A;  1HBK A;  2W2W A;  2IY0 B;  2W2X C;  4A6H A;  2G4S A;  4W9D A;  4NQK E;  3DHI C;  3R7Q A;  1WXV A;  4QJ4 B;  3WAN A;  3AJ4 A;  4GU2 A;  2ZZP B;  1Y5O A;  3BK1 A;  3G9W A;  3V6E B;  1TIF A;  2IGD A;  5KQ4 A;  2MSE D;  3ZDT A;  4ZHO A;  1E8W A;  2BF8 B;  3Q3M C;  1NU2 A;  1DOI A;  3PV1 A;  2BB5 A;  3TW1 A;  1KZG A;  4S17 A;  3MJ5 A;  1UEL A;  4XWT A;  3H7P B;  1WH3 A;  3Q3F A;  3BVZ A;  2K25 A;  4LNO A;  2V1Y A;  3DHG C;  4DIX A;  3KWV A;  2DLB A;  2K6D B;  3AXC A;  2CJN A;  4KVG B;  4A90 A;  3J9C A;  1MIZ B;  3PS6 A;  2MDX A;  1YX5 B;  3AUL A;  3ODO A;  4KX6 B;  2LZ6 A;  4NJ7 A;  1N5W A;  2ASQ A;  3RPF C;  1VZ6 A;  2WXJ A;  4IWQ A;  1UNP A;  4HKZ E;  3VVW B;  3R7R A;  1MK7 B;  1V1P B;  3TMP B;  4BFR A;  1X86 A;  4DHJ B;  2INP E;  2BBC A;  2PJH A;  1JRP A;  5EE1 A;  4HSI A;  4DXG A;  2C7N B;  1GUA B;  2PW9 A;  3R3M A;  2L83 A;  1EF5 A;  2DHJ A;  4P7I A;  1FMA D;  1WE6 A;  2KDM A;  4W9C A;  1H4R A;  4BKS A;  2RQ1 A;  5IKC M;  5C23 A;  3N32 A;  1V2Y A;  1LQB A;  2LRW A;  3ZXR A;  2ROZ B;  2BW2 A;  1E0Z A;  1AAR A;  1WXA A;  3I63 C;  2FJU B;  3SFE B;  1PQS A;  2YT2 A;  4ITK A;  4EFO A;  2KWU B;  1N60 A;  2WGS A;  1MG4 A;  1VLB A;  5H92 C;  4YT0 B;  3RNA C;  3SO6 A;  4PS3 A;  4KV2 A;  3EC8 A;  4WWO A;  1QOG A;  4ILJ A;  5IRS A;  5JHA A;  1FXA A;  1E8Y A;  2MFQ A;  4HAW B;  4L6E A;  4MY6 A;  2LHD A;  2A4Z A;  2ZW0 A;  2C60 A;  3Q8B A;  2WDQ B;  4KIK A;  1GJZ A;  1TYG B;  4HXD A;  3SUZ A;  2KJH B;  2GBM A;  1N63 A;  2N1W A;  5AUK A;  3FC4 A;  4NSW A;  4XWX A;  1Y56 A;  2J42 A;  1SE3 A;  4DDG D;  4A20 A;  3D8D A;  2VRR B;  3HHM A;  4JKF A;  1ESF A;  1SIJ A;  2JXX A;  3LB8 C;  4C4V B;  1V61 A;  2ACZ B;  2VSZ A;  1KFY B;  4KGR A;  3NZU A;  3EPY A;  4YTP B;  1NTI A;  2LJ5 A;  4IAP A;  1V5M A;  1UBI A;  3N1Y C;  2Z0Q A;  3U7D A;  3BJI A;  3ZJU A;  4WWN A;  4KIK B;  2MA9 B;  3CXB B;  1SJH D;  4US9 A;  3FIL A;  3NVY A;  3L13 A;  3IT6 B;  2KMM A;  3QC8 B;  1WJU A;  4AJW A;  3CSF A;  1HB8 A;  5J3Q A;  4K2P A;  2R2Q A;  4WJ7 A;  2K0P A;  3NZ3 A;  2NTT A;  2R2O A;  4GDL B;  3OHM B;  1ZXI A;  4K17 A;  1YMH E;  1V1P A;  2LEK A;  1C76 A;  2KYW A;  1VJK A;  3N20 C;  4GMX B;  2BB6 A;  2I5C A;  2H7E A;  2QEJ C;  2M38 A;  1U2B A;  3NWA A;  1WF9 A;  2IO3 B;  3DDC B;  5FR3 A;  3FM8 C;  3E66 A;  2DN6 A;  4C80 A;  2X0S A;  3SR6 A;  4PQ0 A;  2O2V B;  4HLE A;  1FEH A;  4CSQ A;  1XKE A;  4JIO U;  1ZP0 B;  3ABV B;  4L23 A;  3IVF A;  2EJ8 A;  2KK8 A;  4OVV A;  1QZE A;  3OLM D;  1J0G A;  3TIX A;  4IC7 B;  5AUI A;  2GMI C;  3ZO5 B;  1HZ6 A;  2DZJ A;  1G6J A;  1KRH A;  1V5T A;  1FB8 A;  2LVQ A;  3VUX A;  2VH1 A;  3ECI A;  2G35 A;  1ZGU B;  4JK9 A;  5KCV A;  3PVU A;  1WIA A;  4ZRK A;  2Q13 A;  2XQN M;  2IZV B;  3A1Q A;  4WJN A;  2MJ3 A;  3HM6 X;  1C77 A;  2Z13 A;  4W9K A;  1SHC A;  1T3Q A;  1FOE A;  3N1Z C;  3WAP A;  1V81 A;  1BXT A;  2HJ8 A;  2DYO A;  3OAN A;  2W3R A;  1YIW A;  1YQ3 B;  5HKH A;  2E2X A;  1NYR A;  2KDB A;  5DPT A;  2MJD A;  3TFM A;  1QT9 A;  3AEA B;  1N61 A;  2KTR B;  1OQR A;  4GDK A;  2ABD A;  1T0Q C;  3N1X C;  2BYV E;  4EOY A;  2Y7B A;  3V05 A;  4CO7 A;  2ELA A;  1ET6 A;  1L6U A;  4BVU C;  4MJS B;  3OG5 A;  3PZ7 A;  1ZYI A;  1WM3 A;  3DBR I;  4I6P A;  3H9D A;  5DCN A;  1T6B X;  4JQW C;  1KI1 B;  1JAL A;  2L2I A;  2K39 A;  3A4R A;  1WM2 A;  2VZK D;  3RMK C;  2N23 A;  4OZA A;  2PVO D;  5D3D A;  4DX8 A;  2L76 A;  2LKO A;  3MTN B;  3ODW A;  4PT5 A;  3MP9 A;  4K7S A;  4YSZ B;  4EE2 A;  2BQQ A;  2L7R A;  4MEL A;  5JLJ B;  1VBH A;  1MK9 B;  3NG0 A;  4IWP A;  4FHJ A;  1MJD A;  3NS8 A;  4NJ6 A;  5D6J B;  3SFD B;  2BYT A;  2KGX B;  2O6V D;  4GPT B;  2JY6 A;  2ONQ A;  2ROV A;  2LJI A;  5G2N A;  4GMV A;  4BBK A;  1MHH E;  2G3Q B;  3UZT A;  4QJ3 B;  3EHV A;  1EAZ A;  2MBH A;  2NBV B;  1V6E A;  2RGF A;  3A98 B;  4MGK E;  3NVW A;  1YOV B;  2LOX A;  5FR6 A;  3ZRC A;  1V97 A;  3UF8 A;  4WJP A;  5IP4 D;  2WQY B;  4KDI C;  2PZ1 A;  5CHF A;  1QLB B;  1YQB A;  3RN9 C;  3D32 A;  3Q8F A;  4OZB A;  4XDC A;  3PLU A;  3EA6 A;  4ZYS A;  1VD2 A;  2KN5 A;  1E7P B;  5DHF B;  2I1K A;  4PS7 A;  2IO1 B;  2COD A;  1K52 A;  1WJ1 A;  3ZGZ A;  3VTW A;  4MT5 A;  2AWT A;  5J17 A;  2MWS B;  1WXQ A;  2ZVO A;  3HM3 A;  2IGG A;  1RRP B;  2YS3 A;  2COC A;  3QK0 A;  2WXG A;  4BKT A;  1QIL A;  1DYN A;  1AN8 A;  4EEW A;  5I4D A;  2KTR A;  1FRD A;  2DYQ A;  1VCB A;  2V76 A;  1WGU A;  2PIA A;  4WWP A;  2WWZ A;  1P7F A;  4HCP B;  1P6S A;  5H8Y E;  1WGR A;  1DDW A;  1FAO A;  2KUP A;  4RGN A;  2Y3A A;  3VUY A;  1HEZ E;  3E9L A;  1PLS A;  1XX0 A;  3UIO B;  4IOY X;  4Z2M B;  2XEW A;  1SIF A;  3MC0 B;  3MC9 A;  4KZC A;  2OJW A;  3KZ1 A;  1FO4 A;  3GYO A;  3H6N A;  1D5Z C;  2KWC A;  2L00 B;  3DOW A;  3GYP A;  1NVI D;  2M0A A;  2WDV B;  2IND C;  3VH4 B;  4MGI E;  2W82 A;  1E90 A;  3DVG Y;  1UH6 A;  1P3Q U;  1MFW A;  3VXW A;  1FRR A;  3KUC B;  3M62 B;  1J0W A;  3DXC A;  2D4Q A;  2K00 A;  2QIE B;  1IBX A;  1AWE A;  4KHB B;  4MGZ E;  5FI0 A;  3AEF B;  3I3T B;  3UIN B;  3PRE A;  3V6C B;  2Y8F A;  1BUI C;  4M00 A;  2N9P C;  1YN4 A;  3PRM B;  3RD2 A;  2ZPN A;  5EFX A;  5L83 A;  3DQV A;  3EFC A;  3V61 A;  4IM3 A;  5LG4 B;  4KGT A;  1K5D B;  2DHK A;  3E9S A;  5JHG A;  2MBE A;  1PFD A;  3Q14 C;  3GE8 C;  2D07 B;  1FNU A;  1WGD A;  2JRH A;  2MQJ A;  4KZ0 A;  2M4N A;  2XBB C;  2KVR A;  3KQ4 A;  4HDQ A;  3Q3N C;  3KYD D;  4W9E A;  1ENF A;  4E74 A;  5LOP B;  1GNU A;  3B0A A;  1U5E A;  4LDT B;  4F8C B;  2KQ7 A;  5C16 A;  2DZK A;  4HB3 B;  2LXA A;  1IRS A;  3KUD B;  4AOF A;  1UGJ A;  2UVM A;  4C0A A;  1TJ6 A;  2YVC A;  2WXK A;  2Z8L A;  3TEY A;  1WFY A;  4OW0 A;  2OTX A;  2N7E A;  4A6K A;  4TKN A;  2NCN A;  1U5G A;  3AE9 B;  3AE1 B;  2SEB D;  2WHI A;  4TUU A;  3VR8 B;  1ZC4 B;  1L6V A;  3AE3 B;  4D6W A;  3WAL A;  1GB4 A;  2GI9 A;  1C78 A;  4HDO A;  3SHQ A;  1L0X B;  3P63 A;  2WXR A;  3RT3 B;  4NNJ B;  3BIN A;  2KD0 A;  2J4X A;  1OQY A;  1N3H A;  5L81 A;  2RR9 A;  1QOF A;  3RNE C;  4LJO B;  4RGO S;  4GSW A;  2P8V A;  1PGX A;  3RZW C;  4CYE A;  3W2D A;  1FM0 D;  4JWU C;  1F77 A;  1TGZ B;  1UUP A;  4ACF A;  2G1E A;  2MWN B;  5DI9 B;  1C4P A;  1JWM D;  2L3Z A;  1GAQ B;  1P3R A;  2W55 A;  5EE3 A;  3TO1 A;  1HXY D;  2GLS A;  2PVG C;  1P9D U;  2AEH A;  2LOZ A;  3SD5 A;  4A3P A;  4I6N B;  3KWL A;  3C8Y A;  4FAD A;  1I4X A;  1T0S C;  2V4L A;  3HRD D;  4IG7 B;  1MVK A;  2R0D A;  2FJ9 A;  2IGH A;  2LYD A;  3ZYY X;  3DVG X;  4WUR A;  3CMM B;  3E9P A;  5HFY A;  4B9K A;  2AQ3 B;  3E9O A;  2J59 M;  4HK2 A;  5LON B;  5AZG A;  1JRU A;  1WE7 A;  4WQM A;  4E71 A;  5D7G A;  5BYR A;  2KC2 A;  4MM3 B;  1NEK B;  1VZ8 A;  2HDE A;  2EMS A;  2V3S A;  4ZYN A;  4A6Q A;  3AMZ A;  3AB5 A;  2LI5 A;  3NRZ A;  1R7S A;  4WJQ A;  1K51 A;  2LBB A;  4WVF B;  3P42 A;  1XO3 A;  2JU6 X;  2KJ6 A;  5J2R A;  3DHH C;  4MM3 A;  4OT1 A;  1WI1 A;  3U8Z A;  2I1J A;  1HTQ A;  1Y19 B;  3RNF C;  1D6E C;  4K3B A;  4MJS A;  2J0J A;  3NWD A;  4JPS A;  4KHO A;  1EM7 A;  3CST A;  3QHT A;  4MH8 A;  3HW2 B;  3AEE B;  3P7Z A;  4ZRJ A;  2GUM A;  4H2A A;  2M1M A;  4UDU C;  2RNR B;  1UPR A;  3T8M A;  2RDG A;  3LJU X;  1WYG A;  3Q8C A;  2NBW B;  2X18 A;  4JKA A;  2IFS A;  2DAF A;  3M1I B;  4HAY B;  4M0W A;  2Z0P A;  2QSD A;  2OHF A;  2D3B A;  1J8C A;  5HE1 A;  1MG8 A;  2CHZ A;  4HJK A;  2L0T A;  4RFB A;  3V3X A;  1DDV A;  4HVB A;  5I2M A;  2LVO A;  4B0E A;  5HE3 A;  2KAC A;  2UU7 A;  3Q3O C;  1RRB A;  1OMW A;  4K2O A;  2J52 A;  2CB8 A;  3SU8 X;  4P1B C;  1FD6 A;  1NBF C;  3B77 A;  1JWU D;  4JLC A;  1Q5W B;  5D27 A;  3MDB C;  3IHP C;  1F0Z A;  3FVC A;  1W1H A;  1Q0W B;  1XXG A;  2BYE A;  3P2B A;  2L05 A;  2DYB A;  2KDE B;  4YXD B;  1P5T A;  3T3O A;  2UYZ B;  1MI0 A;  4G3X B;  1ZVR A;  3ZVV A;  1FGZ A;  4IM0 A;  1WZ0 A;  4NJC A;  2DYM A;  3LYY A;  1V80 A;  1BML C;  3FAH A;  4FLH A;  3KVF B;  2KUQ A;  4NAM A;  4XGA B;  1BAK A;  1WGY A;  5KHQ A;  3ETR A;  2Z0D B;  5LLI A;  2KWV B;  1WVH A;  1HTO A;  1ACA A;  1XCQ L;  4YON A;  3NOB A;  3VH3 B;  1S1Q B;  3V62 A;  2JXT A;  1ACC A;  1KC7 A;  1X1F A;  3OWE B;  4GNK B;  2GJY A;  4IM2 A;  3NY5 A;  3W1S C;  2QC8 A;  4IUM B;  2VKI A;  2D9V A;  1KLG D;  2WXF A;  4RF1 A;  2AQ1 B;  2R09 A;  4B0M A;  1UNS A;  3N7C A;  3PP2 A;  2KLG A;  4IDI A;  1H8C A;  1V89 A;  3ZTD A;  3PT2 B;  2JYT A;  5J18 A;  2KLC A;  1BWN A;  2DX1 A;  4NZL B;  2AYO B;  4DK5 A;  1D5M C;  1I4P A;  4K3C A;  4M0W B;  2KDI A;  3ALB A;  2MBO A;  2KIE A;  3OAW A;  2YEP F;  3MPX A;  5BMI A;  4GLS C;  3BII D;  1QQG A;  2W54 A;  2ZCC A;  1SJE D;  3VAW A;  2HE7 A;  3A9K B;  1TT5 B;  2X8X X;  1E8X A;  5JXV A;  2WDR B;  1OTR B;  2M8S A;  2MX2 A;  3TUO A;  1UWM A;  3SYX A;  3DVN U;  2IBI B;  1GPX A;  1E9M A;  4LNI A;  3JSV B;  2DZI A;  1MPE A;  4Y94 A;  2K2J A;  4HRS A;  4F7U P;  1AW7 A;  4KKI A;  1QC6 A;  2CU1 A;  4BZA A;  5IOI A;  2W3S A;  2COF A;  4AS1 A;  3ZQ4 A;  3ULC A;  4P6V F;  5M4Y B;  2VRW B;  2JRI B;  3MC8 A;  2QKL A;  1PUT A;  3WIM A;  4M01 A;  3ZLZ A;  2Z4D A;  1JRO A;  4HAT B;  1YNT E;  1W1D A;  5C2T B;  1UD7 A;  3QAR A;  1I7A A;  1RJ2 A;  5GXG B;  5JP4 A;  3N9Y C;  2FNJ B;  2JYE A;  2JVC A;  2RSU A;  4WWM A;  4HWI B;  4XZ4 A;  2WXQ A;  3BVG A;  1IGC A;  1SBB B;  3L54 A;  4A6F A;  2W9N A;  1EWY C;  1SGH A;  3U52 E;  4L1R A;  3JW0 X;  2P0D A;  2BWE S;  2LUE A;  3DXD A;  2MHJ A;  2ZCB A;  3H1U A;  2WXI A;  3QCA A;  3NW8 A;  2BS3 B;  2YT1 A;  2MBB B;  4C56 C;  3PRP B;  3BY4 B;  2IYB A;  2L52 A;  3L16 A;  1YJ1 A;  5BMH A;  4K7W A;  1Z2M A;  1SEB D;  4YTN B;  3AE6 B;  5J3T A;  4JKH A;  2LFI A;  4W9L A;  3SDL C;  4DWF A;  1EU4 A;  3GZN B;  1YN3 A;  1DYQ A;  2FDQ A;  5TSS A;  4IKG A;  3AEB B;  2L0F A;  1L7Y A;  3PTF C;  5HE0 A;  3AE7 B;  2KT7 A;  4BAX A;  3W5V B;  3ZNH B;  1SE2 A;  5BYQ A;  4FJV B;  1BTN A;  4BOZ B;  2IO0 B;  3KSY A;  2J0K A;  2QIL A;  4G0N B;  2EC1 A;  4MSQ B;  2HTM E;  2VZK B;  2KMC A;  3ULB A;  4HAV B;  4KSK C;  1YX6 B;  3BZD B;  4AQ7 A;  3U12 A;  1JDE A;  3ZKJ C;  4MK0 A;  3VRA B;  5AZF A;  1XCG A;  2KN4 A;  1WMH A;  1R4M B;  3W9C B;  2PLP A;  2JUO A;  1SXT A;  1MI1 A;  3PZ8 A;  4WQO B;  3VQI A;  3AI5 A;  5JHB A;  1GOZ A;  2MJE A;  2LD9 A;  2WXH A;  2EKE C;  4IW0 A;  1TS5 A;  1V9J A;  3A58 A;  1V49 A;  4C4V A;  3EGR A;  2DNF A;  1FPY A;  1WXM A;  3NHE B;  3HUI A;  4HB4 B;  1VZ7 A;  3P4R B;  4B6H A;  2MP2 B;  2KXJ A;  3PG7 A;  4NPN A;  2RLO A;  1QQR A;  5EE9 A;  1ZM0 A;  1JWA D;  3A8Q A;  2FBW B;  2RVB B;  2K9X A;  1KH0 A;  1NDD A;  2WXP A;  1VBG A;  1ZDV A;  1UBQ A;  2Y5P A;  4WAA A;  4LNN A;  2HRJ A;  3O96 A;  1NEN B;  1MAI A;  2AL3 A;  4LDT D;  2KNB A;  3RZF A;  2K3U A;  1WZ3 A;  1EUV B;  3L4P A;  1V8C A;  4N9F 4;  3URY A;  2BPS A;  3R2I A;  2BWF A;  2NS5 A;  4F7H A;  2FCM A;  4KHA A;  1WWT A;  4USA A;  1TTN A;  2KFJ A;  4II3 B;  2IJ0 A;  2FE8 A;  2E6X A;  4BBN C;  4NAW A;  1UZX B;  1TJE A;  3T3N A;  1IBX B;  1L2N A;  2KDF B;  1HQR D;  4RM8 A;  3ZNI D;  2D11 A;  2LGI A;  1WSP A;  4RMA A;  2KAN A;  1W1G A;  2M19 A;  3BYY B;  3VTV A;  2MH7 A;  4DBB A;  1XF5 L;  4JK7 A;  3PLV A;  2DLW A;  2M17 A;  2HTH A;  2QCZ A;  2KC1 A;  3RNC C;  1B55 A;  3L17 A;  5TR5 A;  2QDF A;  4TV3 A;  4ZOH C;  2DWQ A;  3QWM A;  2N7J A;  4MT7 A;  4A6F B;  4AUQ C;  5CHW A;  1E7U A;  1FHX A;  1XLO A;  1TY2 A;  4MAC A;  3P1M A;  4BBN F;  5FK9 C;  3RCZ A;  1DOY A;  1UPQ A;  2LUL A;  1U5F A;  5DPS A;  1T0Y A;  4ANU A;  1E6E B;  2X38 A;  1OEY J;  4C7Y A;  2INC C;  2JZ3 B;  1F1H A;  1JML A;  4K81 A;  1RFK A;  3R2T A;  3BYT B;  4FUL A;  2MP2 A;  2O6V B;  1I2H A;  2ADZ A;  1ROE A;  4GXB A;  3Q6B A;  3QX1 A;  2LGX A;  4TYZ A;  4RNA A;  3AE8 B;  4LTU A;  3AM9 A;  1JQ4 A;  3D8E A;  1PDX A;  2K8H A;  3KYC D;  3BVM A;  5HHD G;  4B6W A;  1LB1 A;  2GRI A;  4KHB A;  1QKZ A;  3ML4 A;  1TKG A;  5CTR C;  2W2X D;  2H89 B;  2YEP B;  1UWX A;  2Z14 A;  3A1Q B;  3PO0 A;  4FJY A;  3U30 A;  3PEG A;  3FLV A;  3K9P B;  1OFF A;  2JF5 A;  1M7E A;  2WS3 B;  4ASW C;  1BT0 A;  2FAZ A;  2KFK B;  2MEK A;  2YLM A;  3C19 A;  3IT4 B;  1ISN A;  2ON8 A;  1X1G A;  2K6Q A;  3VHT C;  4YSX B;  4JGH B;  4XE0 A;  1WX8 A;  1L5P A;  4ANW A;  3R66 C;  1EU3 A;  1D5X C;  1RYJ A;  1KOT A;  2FCS A;  5CLQ B;  2K8E A;  1S3S G;  1EO6 A;  2KKC A;  3PSC A;  3PHW B;  4NY0 A;  1YD8 U;  3UQB A;  2QMT A;  1SE9 A;  2CKH B;  3AED B;  1GC6 A;  2D9Y A;  4C00 A;  2XK5 B;  1WR6 E;  1DRO A;  2D5G A;  1TS2 A;  1OY2 A;  3HIZ A;  3F0W A;  4YL8 A;  4II2 B;  3ZW3 A;  2N1V A;  2K5P A;  4MGY E;  2KJR A;  1TKY A;  2DHZ A;  4W9H A;  3HIE A;  1A5R A;  2K1F A;  4DX9 0;  4HPP A;  4QAY A;  1IP9 A;  4OVU A;  1M7R A;  3Q2A C;  1XD4 A;  2GBN A;  4ARC A;  3E56 A;  4KKJ A;  1JCK B;  3A33 B;  2N9E B;  1OEY A;  3PPA A;  1UNR A;  3HVZ A;  2O6V A;  4HAU B;  2RSG A;  3M3J A;  2D3G A;  3TVV A;  4FXC A;  1R4N I;  2JWZ A;  1XEE A;  1JW9 D;  3TEX A;  2OOB B;  2IO2 B;  3HVD A;  1STE A;  1Q10 A;  3A9J A;  2DKQ A;  1LM8 B;  4NAW B;  4GB9 A;  3AEG B;  4ZRP A;  4ICU A;  2FCQ A;  1DOX A;  2ZNV B;  3W1Y A;  4F7G A;  3ODX A;  1YQ4 B;  3M95 A;  4OZC A;  5G55 A;  1XQQ A;  3SEB A;  1Z5S B;  4EZJ A;  1M4V A;  2WLB A;  4X57 B;  3SV1 A;  2D3C A;  4HRO A;  4AP4 C;  2BS2 B;  3APD A;  4F1S A;  2ZKM X;  4ANX A;  2REX A;  2DHI A;  3JYU A;  2AL6 A;  4LLG M;  2J0M A;  1I4H A;  4RGT A;  3FP5 A;  4ILG B;  1SB3 C;  5FKA C;  1N62 A;  3WA0 A;  4N59 A;  2D3A A;  4JKG B;  1P98 A;  4GOU A;  5J3Y A;  3X23 A;  3HK0 A;  4ZHP A;  4MH0 E;  2I38 A;  1RM6 C;  5C1Z A;  5D3W A;  3ZVR A;  2LMC A;  5L95 C;  2LRU A;  4DXA B;  3IBE A;  1D4B A;  4PYU A;  3PVW A;  1RWS A;  2ZW1 A;  1ST7 A;  1TZ1 A;  1WGK A;  5C5B B;  4TMA B;  3RUI B;  2WP9 B;  1FHO A;  2XK5 A;  2CS4 A;  4QJ5 B;  3O65 B;  3A8P A;  4IOI E;  1J7B A;  3APF A;  3ENE A;  2MBQ A;  3EFU A;  3KRX A;  1AQC A;  4O1N A;  1JWB D;  1NTY A;  2DZM A;  4RF0 A;  3UGB B;  2KQS A;  4HCN B;  2V9H A;  2Z59 A;  3X0W A;  1D3Z A;  1FHW A;  4JKD A;  1I4Q A;  3TEW A;  4WAF A;  2L8J A;  4ANV A;  2RDB C;  2G9H D;  2YRY A;  2O2V A;  4AWJ A;  4RGM A;  3ONS A;  1KF6 B;  2A5U A;  1ZE3 D;  3QJZ A;  1XLN A;  2P0H A;  4BOS C;  2P0F A;  3DBH I;  3UI3 A;  4XWW A;  4N6E B;  1KM7 A;  1UF0 A;  1J7C A;  3WAO A;  4I6L B;  3B9J A;  2CY4 A;  4HAX B;  1U27 A;  5D3X A;  2NZ8 B;  2IY1 B;  3MHS D;  3WCQ A;  5HG2 A;  2NVU I;  4W9G A;  3U7Z A;  2BVC A;  2VH2 A;  4ICV A;  3U2S C;  3KRW A;  2NPT B;  1T77 A;  3AE2 B;  5CHV C;  2PEA A;  2K22 A;  3VFK A;  2QKM A;  3AH7 A;  1ZOY B;  1U5D A;  1DIK A;  3TL5 A;  3V60 A;  5KHO A;  4HHV A;  4BKS D;  2SAK A;  3BK2 A;  4KGS A;  3B2F A;  2CR5 A;  1QF6 A;  2YT0 A;  1QOA A;  5C6R A;  1PYW D;  3IAS 1;  5JH5 C;  2BYF A;  1TY0 A;  5E6J A;  2LGS A;  5E6N A;  1RLF A;  4B95 A;  1WRI A;  1EWC A;  3DBL I;  4LNK A;  2LGY A;  1H10 A;  3VOQ A;  2PPH A;  5AEK B;  2BTE A;  2GB1 A;  3EEC A;  3GE3 C;  3ZTC A;  1DGJ A;  2KHW B;  4M8N A;  3VIA A;  4EZL A;  4HAZ B;  3PRZ A;  4W9F A;  2C7H A;  5IN7 A;  3AU5 A;  5EDS A;  4WSF A;  1IGD A;  1C4A A;  4JL9 A;  5IA7 A;  2HTH B;  3UQA A;  2WXN A;  3DBH B;  2N0Y A;  3MHZ A;  3R8B A;  4AJY B;  4MEM A;  5IAA C;  2LXC A;  2GBK A;  4DDI D;  5EE0 A;  2KR0 A;  2GOW A;  3HQC A;  3TSS A;  2GCL A;  1V1O A;  2GS0 A;  2Z59 B;  2WH5 A;  4ARI A;  4HPL B;  3ZNZ B;  1X11 A;  1TBE A;  1OQQ A;  1L0V B;  3PVL A;  3SBT A;  1Y8R C;  1ZPS A;  2YF0 A;  1V5U A;  3MJW A;  3S2A A;  1MKE A;  1M94 A;  5FI1 A;  2AQ2 B;  2OQB A;  2LWP A;  3ENB A;  2WXL A;  3N30 A;  2KX3 A;  2Y5B B;  4MDK E;  2RRF A;  3B1L X;  2M0X A;  3A9K A;  4S0R A;  2RMM A;  3I57 A;  3AU4 A;  3O13 A;  1K50 A;  4QXA B;  3ZDM C;  2CY5 A;  3UIP B;  2D10 A;  2FIF A;  3Q3J A;  1PGB A;  4OSN A;  3JSV A;  3D8F A;  3DBL B;  2BKF A;  2KTF A;  1C1Y B;  3FKY A;  2JWU A;  1LO5 D;  2J7Q B; 
#chains in the Genus database with same CATH homology
 2H7D A;  2D2Q A;  2NBU A;  4DHZ E;  3K9O B;  1WJ4 A;  2UZR A;  1TQZ A;  1WGG A;  5GMV A;  1HE8 A;  2BCJ A;  3W1S A;  4HPM B;  1XD3 B;  5D94 A;  3H7S A;  1Z87 A;  4GZU A;  1EF1 A;  3PSE B;  3NSU A;  1I42 A;  2MCN B;  2ZNV C;  4XC2 A;  1WMH B;  2M14 A;  4KAX B;  1PMS A;  1P1A A;  2C9W B;  2LG1 A;  2KZR A;  4J6I A;  2NMB A;  2BGF A;  1NI2 A;  3LDZ E;  1X1M A;  5CLL B;  1I35 A;  2KMA A;  1OGW A;  5AZH A;  2N4F A;  2FJL A;  3IFW B;  3VTU A;  3P6A A;  5E6O A;  2YS1 A;  3C0R B;  1KJT A;  4DHZ B;  2ZJD A;  2GBR A;  3WYF B;  5CX3 A;  1Q67 A;  1LW3 A;  3OJ3 A;  2GCJ A;  3ZNG C;  1MPH A;  4E3C A;  2Z0O A;  4ILH A;  1FXT B;  2ZVN A;  5DIF B;  1J19 A;  3SNH A;  1RAX A;  3DPD A;  4GDL A;  2DA0 A;  4ZRI A;  4JKG A;  3A4S C;  1V5P A;  3B08 A;  3FSS A;  2B3A A;  1PFJ A;  5JZE B;  2I5F A;  1ZW7 A;  1V88 A;  4LCD E;  2FCN A;  2OJR A;  1R4M I;  5DHA B;  1ZSQ A;  2DYN A;  1XR0 B;  4GOC A;  4KSL C;  4HB2 B;  2HD5 B;  1KZ7 A;  1OQN A;  3QIJ A;  3QA8 A;  2WYQ A;  1LFD A;  3F5R A;  2COP A;  5DPW A;  2BKR B;  4PS8 A;  4M8M A;  2R82 A;  1IYF A;  4NQL B;  5E6P A;  4G11 A;  1XT9 B;  2JZZ A;  4A3O A;  2EMT A;  1E7V A;  1E8Z A;  5LXI B;  1V5O A;  4F7Z A;  2KCJ A;  1GGO A;  2LGD A;  3NZS A;  1WGQ A;  2YSZ A;  3GOE A;  3TJP A;  1IPG A;  2UZS A;  4CHK A;  4WJO A;  3APC A;  3DCG A;  4D0N B;  3TBL D;  4PNK A;  3N3K B;  4FJZ A;  1ZKH A;  2JP2 A;  3ZRF A;  4CHM A;  2MLB A;  2DX5 A;  2IYD B;  1CMX B;  5JVL A;  4LJP B;  1XOD A;  3L10 B;  5D3V A;  4GN1 A;  2KO3 A;  4K1R B;  4G50 A;  4ZDV A;  4A5K A;  1NVL A;  4IFS A;  3GZN I;  1DBH A;  1KBL A;  2MRP A;  2DIK A;  5C5B A;  5D2M B;  1NTV A;  2DX5 B;  2NR2 A;  5DH9 B;  4PYZ A;  2CHW A;  4FHK A;  3KW5 B;  2Z0E B;  2MW5 A;  3L0W B;  1WJN A;  4EZK A;  1UNQ A;  3DBS A;  2WX1 A;  3IG3 A;  3ML9 A;  3PGE A;  1KLV A;  4KDL B;  5D3Y A;  1HB6 A;  4EUT A;  3LJ3 A;  2ZPY A;  1DDM A;  3SBG A;  2LVP A;  1E5W A;  2ELB A;  2DAJ A;  1K5G B;  2C7M B;  1WI0 A;  1MIX A;  3FEH A;  4FBJ B;  4JK8 A;  2N9X A;  4Z2N A;  2CQU A;  4XX5 A;  4RM9 A;  4DHJ D;  1TXD A;  2NPT A;  2RPQ A;  5C79 A;  3RUL A;  1K8R B;  1V86 A;  2DFK A;  1LXD A;  3A9J B;  2KFK A;  3M63 B;  3ZUN A;  3TCA A;  3PHX B;  3L08 A;  4TQ1 A;  5HE2 A;  3V5W A;  5BO4 B;  4JKC A;  5GOW B;  4DBG A;  4GGQ A;  1GC7 A;  2WDT B;  1RFA A;  3CF6 E;  3QWZ B;  4CHJ A;  2DKP A;  3WAM A;  1EVH A;  2K8C A;  3T06 A;  4URK A;  3QQ8 B;  2D9X A;  1ZC3 B;  4EKU A;  2JT4 B;  1WG7 A;  2K8B A;  1WRD B;  4W9J A;  4EMO A;  2C5L C;  2N7D A;  2ZEQ A;  1C3T A;  2JPH A;  3JVZ X;  1WX7 A;  4MSM B;  1EGX A;  2MKR A;  2GBJ A;  1U4A A;  2LAS A;  2UWQ A;  2G45 B;  3VDZ A;  1WJM A;  1WGH A;  2FUH B;  2D9Z A;  1P0R A;  1FGY A;  3KUZ A;  3ML8 A;  1UEF A;  3ZIM A;  2DEN B;  3DXE A;  4W9I A;  3OJ4 B;  2CRF A;  2WX0 A;  3RYT A;  1WYW B;  2KX0 A;  3KY9 A;  5DPR A;  1BTK A;  3DVN V;  4HB0 B;  2PE6 B;  1UGM A;  5IJM A;  2RD0 A;  3VUW A;  3KH0 A;  3H7P A;  1WJ6 A;  2L1C A;  2RGN B;  3T9L A;  5LXH A;  3QBV B;  2CAY A;  2YS5 A;  2DTC A;  4JKE A;  4FN2 A;  1WY8 A;  2KOX A;  4GDK B;  4JKB A;  1F9J A;  4FA6 A;  4H8S A;  3QAQ A;  4BKG A;  5JHH A;  2QHO A;  2RUK B;  3CIK A;  1U29 A;  2G4D B;  4K7U A;  2K2U A;  1WXS A;  4GIV A;  3RCP A;  5KQ1 A;  1GG3 A;  3PZD A;  1WX9 A;  2CHX A;  4TQ0 A;  1X05 A;  4IWO A;  2PE9 A;  2COA A;  2Y8G A;  2FID A;  4EJN A;  1Q1O A;  2D9W A;  1WR1 A;  1HBK A;  2W2W A;  2IY0 B;  2W2X C;  4A6H A;  2G4S A;  4W9D A;  4NQK E;  3R7Q A;  1WXV A;  3WAN A;  3AJ4 A;  4GU2 A;  2ZZP B;  1Y5O A;  3G9W A;  3V6E B;  5KQ4 A;  2MSE D;  3ZDT A;  1E8W A;  2BF8 B;  1NU2 A;  3PV1 A;  3TW1 A;  1KZG A;  1UEL A;  3H7P B;  1WH3 A;  3Q3F A;  2K25 A;  2V1Y A;  2K6D B;  3AXC A;  4KVG B;  1MIZ B;  3PS6 A;  2MDX A;  1YX5 B;  3AUL A;  3ODO A;  4NJ7 A;  2LZ6 A;  2ASQ A;  4IWQ A;  1UNP A;  3VVW B;  3R7R A;  1MK7 B;  3TMP B;  4BFR A;  1X86 A;  4DHJ B;  2PJH A;  2C7N B;  1GUA B;  3R3M A;  1EF5 A;  2DHJ A;  4P7I A;  1WE6 A;  4W9C A;  4BKS A;  1H4R A;  2RQ1 A;  5C23 A;  3N32 A;  1V2Y A;  1LQB A;  2LRW A;  2ROZ B;  1AAR A;  1WXA A;  1PQS A;  4EFO A;  2KWU B;  3SO6 A;  4PS3 A;  4KV2 A;  3EC8 A;  4WWO A;  4ILJ A;  5JHA A;  1E8Y A;  2MFQ A;  4HAW B;  4L6E A;  4MY6 A;  2A4Z A;  2C60 A;  4KIK A;  1GJZ A;  4HXD A;  3SUZ A;  2KJH B;  2GBM A;  2N1W A;  4NSW A;  4XWX A;  4DDG D;  4A20 A;  3D8D A;  2VRR B;  3HHM A;  4JKF A;  2JXX A;  1V61 A;  2VSZ A;  3NZU A;  3EPY A;  1NTI A;  2LJ5 A;  4IAP A;  1V5M A;  1UBI A;  2Z0Q A;  3U7D A;  3BJI A;  4WWN A;  4KIK B;  2MA9 B;  3CXB B;  3L13 A;  3QC8 B;  1WJU A;  4AJW A;  3CSF A;  1HB8 A;  5J3Q A;  4K2P A;  2R2Q A;  4WJ7 A;  4GDL B;  2R2O A;  4K17 A;  4GMX B;  2I5C A;  2H7E A;  2M38 A;  1U2B A;  1WF9 A;  2IO3 B;  3DDC B;  3FM8 C;  3E66 A;  2DN6 A;  2X0S A;  4PQ0 A;  2O2V B;  4HLE A;  1XKE A;  4JIO U;  3IVF A;  2EJ8 A;  2KK8 A;  4OVV A;  1QZE A;  3OLM D;  1J0G A;  3TIX A;  4IC7 B;  2GMI C;  3ZO5 B;  2DZJ A;  1G6J A;  1V5T A;  1FB8 A;  2LVQ A;  3VUX A;  3ECI A;  2G35 A;  1ZGU B;  4JK9 A;  5KCV A;  3PVU A;  1WIA A;  4ZRK A;  2Q13 A;  2XQN M;  2IZV B;  3A1Q A;  4WJN A;  3HM6 X;  4W9K A;  1SHC A;  1FOE A;  3WAP A;  1V81 A;  2HJ8 A;  2DYO A;  3OAN A;  1YIW A;  5HKH A;  2E2X A;  2KDB A;  5DPT A;  3TFM A;  2KTR B;  4GDK A;  2ABD A;  2BYV E;  4EOY A;  2Y7B A;  4CO7 A;  2ELA A;  4BVU C;  4MJS B;  1WM3 A;  3DBR I;  4I6P A;  3H9D A;  5DCN A;  4JQW C;  1KI1 B;  2L2I A;  2K39 A;  3A4R A;  1WM2 A;  2N23 A;  4DX8 A;  2L76 A;  2LKO A;  3MTN B;  3ODW A;  4K7S A;  2L7R A;  4MEL A;  5JLJ B;  1VBH A;  1MK9 B;  4IWP A;  4FHJ A;  5D6J B;  3NS8 A;  4NJ6 A;  2KGX B;  2O6V D;  4GPT B;  2JY6 A;  2ROV A;  5G2N A;  4GMV A;  4BBK A;  2G3Q B;  3UZT A;  3EHV A;  1EAZ A;  2MBH A;  2NBV B;  1V6E A;  2RGF A;  3A98 B;  4MGK E;  2LOX A;  5FR6 A;  3ZRC A;  3UF8 A;  4WJP A;  4KDI C;  2PZ1 A;  5CHF A;  1YQB A;  3D32 A;  3PLU A;  1VD2 A;  2KN5 A;  5DHF B;  2I1K A;  4PS7 A;  2IO1 B;  2COD A;  1WJ1 A;  3VTW A;  2AWT A;  5J17 A;  2MWS B;  2ZVO A;  3HM3 A;  1RRP B;  2YS3 A;  2COC A;  3QK0 A;  4BKT A;  1DYN A;  4EEW A;  2KTR A;  2DYQ A;  1VCB A;  2V76 A;  1WGU A;  4WWP A;  2WWZ A;  4HCP B;  1P6S A;  1WGR A;  1DDW A;  1FAO A;  2KUP A;  3VUY A;  3E9L A;  1PLS A;  1XX0 A;  3UIO B;  4IOY X;  4Z2M B;  2XEW A;  1SIF A;  4KZC A;  3KZ1 A;  3GYO A;  3H6N A;  2KWC A;  2L00 B;  3DOW A;  3GYP A;  3VH4 B;  4MGI E;  1E90 A;  3DVG Y;  1UH6 A;  1P3Q U;  3VXW A;  3KUC B;  3M62 B;  1J0W A;  3DXC A;  2D4Q A;  2K00 A;  1AWE A;  4KHB B;  4MGZ E;  5FI0 A;  3I3T B;  3UIN B;  3PRE A;  3V6C B;  2Y8F A;  2N9P C;  3PRM B;  3RD2 A;  2ZPN A;  5EFX A;  5L83 A;  3DQV A;  3V61 A;  4IM3 A;  1K5D B;  2DHK A;  5JHG A;  2MBE A;  2D07 B;  1WGD A;  2JRH A;  2MQJ A;  4KZ0 A;  2M4N A;  2XBB C;  2KVR A;  4HDQ A;  3KYD D;  4W9E A;  4E74 A;  5LOP B;  1GNU A;  3B0A A;  1U5E A;  4LDT B;  4F8C B;  2KQ7 A;  5C16 A;  2DZK A;  4HB3 B;  2LXA A;  1IRS A;  3KUD B;  4AOF A;  2UVM A;  4C0A A;  1TJ6 A;  2YVC A;  1WFY A;  2OTX A;  2N7E A;  4A6K A;  4TKN A;  2NCN A;  1U5G A;  4TUU A;  1ZC4 B;  3WAL A;  4HDO A;  3SHQ A;  3RT3 B;  4NNJ B;  3BIN A;  2KD0 A;  1OQY A;  1N3H A;  5L81 A;  2RR9 A;  4LJO B;  4GSW A;  2P8V A;  3RZW C;  4CYE A;  1TGZ B;  2MWN B;  5DI9 B;  2L3Z A;  1P3R A;  3TO1 A;  1P9D U;  2AEH A;  2LOZ A;  3SD5 A;  4A3P A;  4I6N B;  4FAD A;  2V4L A;  4IG7 B;  2R0D A;  2FJ9 A;  2LYD A;  3DVG X;  3CMM B;  3E9P A;  4B9K A;  3E9O A;  2J59 M;  4HK2 A;  5LON B;  5AZG A;  1JRU A;  1WE7 A;  4E71 A;  5D7G A;  2KC2 A;  4ZYN A;  2V3S A;  2EMS A;  2LI5 A;  4WJQ A;  2LBB A;  4WVF B;  2KJ6 A;  5J2R A;  4MM3 A;  1WI1 A;  3U8Z A;  2I1J A;  1Y19 B;  4MJS A;  2J0J A;  4KHO A;  3CST A;  3QHT A;  3HW2 B;  3P7Z A;  4ZRJ A;  2M1M A;  2RNR B;  1UPR A;  3T8M A;  3LJU X;  2NBW B;  2X18 A;  4JKA A;  2IFS A;  2DAF A;  3M1I B;  4HAY B;  2Z0P A;  1J8C A;  5HE1 A;  1MG8 A;  2CHZ A;  4HJK A;  2L0T A;  1DDV A;  4HVB A;  2LVO A;  5HE3 A;  1RRB A;  1OMW A;  4K2O A;  2CB8 A;  3SU8 X;  1NBF C;  4JLC A;  1Q5W B;  5D27 A;  3MDB C;  3IHP C;  1W1H A;  1Q0W B;  2BYE A;  3P2B A;  2L05 A;  2DYB A;  2KDE B;  1P5T A;  2UYZ B;  4G3X B;  1ZVR A;  3ZVV A;  1FGZ A;  4IM0 A;  1WZ0 A;  2DYM A;  1V80 A;  4FLH A;  3KVF B;  1BAK A;  1WGY A;  5KHQ A;  2Z0D B;  5LLI A;  2KWV B;  1WVH A;  1ACA A;  4YON A;  3NOB A;  3VH3 B;  1S1Q B;  3V62 A;  1KC7 A;  1X1F A;  2GJY A;  4IM2 A;  3NY5 A;  3W1S C;  4IUM B;  2VKI A;  2D9V A;  2R09 A;  3N7C A;  3PP2 A;  2KLG A;  1H8C A;  1V89 A;  3ZTD A;  3PT2 B;  5J18 A;  2KLC A;  1BWN A;  2DX1 A;  2AYO B;  4DK5 A;  4M0W B;  2KDI A;  3ALB A;  2MBO A;  3OAW A;  3MPX A;  1QQG A;  2ZCC A;  3VAW A;  2HE7 A;  3A9K B;  1E8X A;  1OTR B;  2M8S A;  2MX2 A;  3SYX A;  3DVN U;  2IBI B;  3JSV B;  2DZI A;  4Y94 A;  2K2J A;  4F7U P;  1QC6 A;  2CU1 A;  2COF A;  3ULC A;  2VRW B;  2JRI B;  2QKL A;  3WIM A;  3ZLZ A;  4HAT B;  1W1D A;  1UD7 A;  3QAR A;  1I7A A;  1RJ2 A;  5JP4 A;  2FNJ B;  2JVC A;  2RSU A;  4HWI B;  4XZ4 A;  3L54 A;  4A6F A;  2W9N A;  1SGH A;  3JW0 X;  2P0D A;  2BWE S;  2LUE A;  3DXD A;  2ZCB A;  3H1U A;  3QCA A;  2YT1 A;  2MBB B;  3PRP B;  3BY4 B;  2IYB A;  3L16 A;  1YJ1 A;  4K7W A;  1Z2M A;  3SDL C;  5J3T A;  4JKH A;  4W9L A;  4DWF A;  2FDQ A;  2L0F A;  1L7Y A;  3PTF C;  5HE0 A;  3ZNH B;  4FJV B;  1BTN A;  4BOZ B;  2IO0 B;  3KSY A;  2J0K A;  4MSQ B;  2EC1 A;  4G0N B;  2KMC A;  3ULB A;  4HAV B;  4KSK C;  1YX6 B;  1JDE A;  3ZKJ C;  4MK0 A;  5AZF A;  1XCG A;  1WMH A;  2JUO A;  4WQO B;  3VQI A;  3AI5 A;  5JHB A;  2LD9 A;  2EKE C;  4IW0 A;  1V9J A;  1V49 A;  1WXM A;  3NHE B;  4HB4 B;  4B6H A;  2MP2 B;  2KXJ A;  3PG7 A;  4NPN A;  2RLO A;  1ZM0 A;  3A8Q A;  2RVB B;  1NDD A;  1VBG A;  1UBQ A;  4WAA A;  2HRJ A;  3O96 A;  1MAI A;  2AL3 A;  4LDT D;  2KNB A;  3RZF A;  1WZ3 A;  1EUV B;  4N9F 4;  2BPS A;  2BWF A;  2NS5 A;  4F7H A;  2FCM A;  4KHA A;  1TTN A;  2KFJ A;  4II3 B;  4BBN C;  4NAW A;  1UZX B;  1L2N A;  2KDF B;  4RM8 A;  3ZNI D;  2D11 A;  4RMA A;  2KAN A;  1W1G A;  3VTV A;  4DBB A;  4JK7 A;  3PLV A;  2DLW A;  2M17 A;  2HTH A;  2KC1 A;  1B55 A;  3L17 A;  5TR5 A;  4TV3 A;  3QWM A;  4MT7 A;  4A6F B;  4AUQ C;  5CHW A;  1E7U A;  1FHX A;  4BBN F;  3RCZ A;  1UPQ A;  2LUL A;  1U5F A;  5DPS A;  1T0Y A;  4ANU A;  1OEY J;  2JZ3 B;  4K81 A;  4FUL A;  2MP2 A;  2O6V B;  1I2H A;  2ADZ A;  4GXB A;  3QX1 A;  2LGX A;  4TYZ A;  3D8E A;  2K8H A;  3KYC D;  4B6W A;  1LB1 A;  3ML4 A;  5CTR C;  2W2X D;  3A1Q B;  4FJY A;  3U30 A;  3PEG A;  3FLV A;  3K9P B;  2JF5 A;  1M7E A;  4ASW C;  1BT0 A;  2FAZ A;  2KFK B;  2YLM A;  1ISN A;  3VHT C;  1X1G A;  2K6Q A;  4JGH B;  1WX8 A;  4ANW A;  3R66 C;  1KOT A;  2FCS A;  5CLQ B;  1S3S G;  1EO6 A;  2KKC A;  3PSC A;  3PHW B;  4NY0 A;  1YD8 U;  3UQB A;  1SE9 A;  2CKH B;  1GC6 A;  2D9Y A;  2XK5 B;  1WR6 E;  1DRO A;  1OY2 A;  3HIZ A;  3F0W A;  4YL8 A;  4II2 B;  3ZW3 A;  2N1V A;  4MGY E;  2KJR A;  2DHZ A;  4W9H A;  1A5R A;  2K1F A;  4DX9 0;  1IP9 A;  4OVU A;  1M7R A;  1XD4 A;  2GBN A;  3A33 B;  2N9E B;  1OEY A;  3PPA A;  1UNR A;  2O6V A;  4HAU B;  2RSG A;  3M3J A;  2D3G A;  3TVV A;  1R4N I;  2JWZ A;  2OOB B;  2IO2 B;  3A9J A;  2DKQ A;  1LM8 B;  4NAW B;  4GB9 A;  4ICU A;  2FCQ A;  2ZNV B;  3W1Y A;  4F7G A;  3ODX A;  3M95 A;  5G55 A;  1XQQ A;  4EZJ A;  1Z5S B;  4X57 B;  3SV1 A;  4AP4 C;  3APD A;  4F1S A;  4ANX A;  2REX A;  2DHI A;  3JYU A;  2AL6 A;  2J0M A;  3FP5 A;  4ILG B;  3WA0 A;  4JKG B;  1P98 A;  5J3Y A;  3X23 A;  3HK0 A;  4MH0 E;  5C1Z A;  5D3W A;  3ZVR A;  5L95 C;  2LRU A;  4DXA B;  3IBE A;  4PYU A;  3PVW A;  1ST7 A;  1TZ1 A;  5C5B B;  3RUI B;  1FHO A;  2XK5 A;  2CS4 A;  3O65 B;  3A8P A;  3APF A;  3ENE A;  2MBQ A;  3EFU A;  3KRX A;  1AQC A;  1NTY A;  2DZM A;  3UGB B;  2KQS A;  4HCN B;  3X0W A;  1D3Z A;  1FHW A;  4JKD A;  2L8J A;  4ANV A;  2YRY A;  2O2V A;  4AWJ A;  3ONS A;  2A5U A;  3QJZ A;  2P0H A;  4BOS C;  2P0F A;  3DBH I;  1KM7 A;  3WAO A;  4I6L B;  2CY4 A;  4HAX B;  1U27 A;  5D3X A;  2NZ8 B;  2IY1 B;  3MHS D;  2NVU I;  4W9G A;  4ICV A;  3KRW A;  2NPT B;  5CHV C;  2PEA A;  3VFK A;  2QKM A;  1U5D A;  1DIK A;  3TL5 A;  3V60 A;  5KHO A;  4HHV A;  4BKS D;  2CR5 A;  2YT0 A;  5C6R A;  5JH5 C;  2BYF A;  5E6N A;  1RLF A;  4B95 A;  3DBL I;  2LGY A;  1H10 A;  3VOQ A;  2PPH A;  5AEK B;  3EEC A;  3ZTC A;  2KHW B;  4M8N A;  3VIA A;  4EZL A;  4HAZ B;  3PRZ A;  4W9F A;  2C7H A;  3AU5 A;  5EDS A;  4WSF A;  4JL9 A;  5IA7 A;  2HTH B;  3UQA A;  2N0Y A;  4AJY B;  4MEM A;  5IAA C;  2LXC A;  2GBK A;  4DDI D;  2GOW A;  3HQC A;  2GCL A;  2GS0 A;  2Z59 B;  2WH5 A;  4HPL B;  3ZNZ B;  1X11 A;  1TBE A;  3PVL A;  3SBT A;  1Y8R C;  2YF0 A;  1V5U A;  3MJW A;  3S2A A;  1MKE A;  1M94 A;  5FI1 A;  2OQB A;  2LWP A;  3ENB A;  3N30 A;  2KX3 A;  2Y5B B;  4MDK E;  3B1L X;  2M0X A;  3A9K A;  3AU4 A;  3ZDM C;  2CY5 A;  3UIP B;  2D10 A;  2FIF A;  3Q3J A;  3JSV A;  3D8F A;  2BKF A;  2KTF A;  1C1Y B;  2J7Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...