2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
2ADZA 4HB3B 4B6HA 2IZVB 3L08A 2D9WA 1XT9B 1P3RA 2DYQA 2MQJA 2IFSA 2YSZA 4IOYX 1MPHA 1NU2A 1E8ZA 2KD0A 2LULA 4GZUA 3PREA 2RLOA 1S3SG 1P98A 1MIZB 4XX5A 1E5WA 4XWXA 1GC6A 3FLVA 5J2RA 3BINA 5HE2A 1U27A 1W1DA 4OVVA 4IW0A 1EGXA 1T0YA 4KZCA 3NY5A 4HVBA 1V2YA 1WXMA 2GOWA 4A3PA 5LONB 3UIPB 4Y94A 2WX0A 4EZJA 1UH6A 3DVNV 4W9CA 4HDQA 4W9KA 2DZMA 5CHFA 3ODWA 3BY4B 5FI1A 5LXHA 3A4SC 4AOFA 1YJ1A 3R3MA 2GBMA 2MBEA 1ST7A 3FM8C 3D8FA 2JXXA 1MIXA 1LM8B 2L7RA 5D94A 1X1GA 2XEWA 1RRBA 1GUAB 4CYEA 1XODA 3VAWA 1SHCA 4IUMB 5DPWA 2L1CA 4FJZA 3C0RB 2FIDA 4DWFA 3PG7A 3M1IB 1MK7B 1ZC4B 4WJNA 4W9LA 4AUQC 5FR6A 2Z0DB 3TBLD 1KZ7A 2K2JA 1OQNA 4GDKB 1WR1A 2MBBB 3JVZX 1V61A 1IRSA 5AZFA 2K2UA 2DYOA 2MP2A 3ZRFA 2ZVOA 1QQGA 2DENB 3WYFB 2JY6A 2C7NB 4ICVA 3WAOA 4BBNC 2YT0A 5DPSA 4ANWA 2W9NA 4MGIE 3ULBA 4IM3A 5L95C 5J3TA 4W9IA 2KN5A 1W1HA 3H7SA 1WYWB 5JHBA 1LXDA 2N0YA 3TW1A 2AL3A 2DKPA 2Z0PA 4HB2B 4TUUA 4NJ6A 4DBBA 1V80A 2CHWA 2CHXA 2P8VA 2EMTA 3NHEB 3A8QA 2ZCCA 1SGHA 2MW5A 3RD2A 2BYFA 3P2BA 4BKSA 4DHJD 2KCJA 1X11A 1KJTA 2X18A 3IFWB 4C0AA 4A20A 3RT3B 2J0JA 3T06A 4WJ7A 2J59M 4AP4C 3DDCB 3P6AA 4KSLC 2H7EA 4PS8A 2NS5A 1FHWA 3PRPB 2CS4A 1OQYA 1WI0A 1YX6B 2J0KA 2DLWA 2KDFB 2JPHA 3U8ZA 4HWIB 1XX0A 2LJ5A 3FP5A 2WWZA 1CMXB 1V5UA 5D2MB 4ANVA 2KXJA 1WJNA 4LCDE 2BCJA 5KQ1A 4LJPB 1TBEA 1V88A 5E6NA 2DX5B 1J0GA 2RUKB 2MX2A 3APCA 2FDQA 3RCPA 2XBBC 2MFQA 2K8HA 2K25A 1PQSA 2MSED 4F7UP 5C79A 1WJ6A 3HM3A 2DZIA 3VTWA 4RM8A 4FBJB 1XR0B 1Z87A 4EZKA 3ZDTA 1WVHA 1U5GA 4BKSD 2R2QA 4RMAA 3PV1A 1Q0WB 4MSMB 1E8WA 4IM0A 4K81A 1X86A 4GSWA 2C5LC 2NCNA 2KHWB 3VTUA 2JVCA 4G11A 1ZSQA 1EUVB 2Y8GA 5DHAB 2Y5BB 2EJ8A 1RJ2A 1TTNA 1Q1OA 3QIJA 3L17A 4PS7A 2A5UA 3G9WA 1FHOA 3B1LX 2ABDA 4F8CB 2UZSA 2COAA 3QWMA 1LQBA 2FCNA 3VOQA 2DYMA 1RLFA 1XKEA 3UINB 2JP2A 3D8EA 2FJ9A 4MELA 4AWJA 4II3B 1WR6E 2L3ZA 2K00A 2IBIB 2M14A 2NMBA 3QBVB 2Q13A 1V6EA 2KWUB 4KDLB 1S1QB 2W2WA 2DHJA 4G3XB 4F7ZA 1Y5OA 3PS6A 4A6FA 2PJHA 2FNJB 5AZHA 1LFDA 1HB6A 5JP4A 3AULA 4HAUB 5DPRA 2M38A 5GMVA 3NSUA 1YX5B 2RSUA 3L10B 2KLCA 3R7RA 2COPA 4PYZA 1SIFA 3CSFA 2LBBA 5AEKB 4WVFB 4GMVA 4WAAA 4II2B 2Y8FA 3MPXA 4HPMB 1YQBA 3PVLA 4AJYB 2N9EB 3ZTCA 3SV1A 3ML4A 2D3GA 2Z0QA 3DVGX 2CU1A 4K2PA 2RQ1A 1UBIA 1MG8A 4FN2A 3QJZA 4ASWC 2K8BA 2GJYA 4MEMA 1F9JA 2L0FA 2D11A 2JZZA 2Z0EB 3UIOB 2LOXA 2GBRA 4RM9A 4DDGD 2QKMA 4EOYA 2ZJDA 2MBOA 3PVUA 2KWVB 5GOWB 1TQZA 1OGWA 1E90A 4KSKC 4MSQB 2PE6B 4TQ1A 3V5WA 5KHOA 4GIVA 5D6JB 2RPQA 2L00B 1NTYA 3PLUA 3KYCD 2ZVNA 5EFXA 3LDZE 4KV2A 3ZO5B 1DDWA 5AZGA 5LOPB 3SD5A 1A5RA 1FGZA 2MWSB 2CB8A 2FIFA 4FJVB 2DHKA 5JZEB 3H9DA 3L16A 4DHJB 3P7ZA 2KTFA 4HCPB 3VTVA 3DQVA 3IHPC 4MH0E 2ZCBA 3VHTC 2N7DA 4HAZB 1WZ0A 3ZDMC 4ZRKA 4FHJA 1RFAA 5D3VA 2IYBA 1TJ6A 4MT7A 3CXBB 1OEYA 4ANUA 5TR5A 2LGYA 3I3TB 4W9HA 2WH5A 1I2HA 3RCZA 3SO6A 3JSVA 1PMSA 2FJLA 2O6VB 2RGFA 1EF5A 3ONSA 3ZVRA 2I1KA 1YIWA 3PPAA 2LGDA 1U29A 3Q3JA 3DOWA 1OEYJ 4HK2A 1K5DB 2LOZA 1TXDA 1OY2A 4H8SA 2DX1A 4HPLB 2ZEQA 3D8DA 1WH3A 1E8YA 3KZ1A 3VH4B 2D9VA 3VUXA 3RZWC 3QWZB 4NQLB 4EEWA 2R09A 3RUIB 5DPTA 3KRXA 3EHVA 1D3ZA 3N3KB 2N9XA 3VH3B 2IY0B 3EPYA 2KJ6A 5LLIA 2VRRB 4WSFA 3V61A 4DXAB 4DDID 1JRUA 3Q3FA 2N1WA 3IG3A 2G3QB 1IP9A 4IWOA 2KLGA 4JL9A 3ODXA 3KUZA 3TJPA 3KW5B 4BKGA 3A9JA 1IYFA 1P1AA 4WWPA 1WGUA 2O2VB 5JLJB 3UF8A 1WF9A 3ZKJC 3PSEB 1HE8A 2ZPNA 2W2XC 3CF6E 1EF1A 3HM6X 4HXDA 1I42A 4HAXB 1UPQA 4ZRJA 1V81A 4A6HA 4M0WB 3AJ4A 2FAZA 3ZNZB 2KVRA 1XD4A 2GBJA 2QKLA 4DHZB 1WGGA 1V5PA 4BFRA 3KUCB 3PGEA 5DI9B 2GS0A 4K1RB 1R4NI 2O6VA 1QC6A 3SNHA 2DAFA 3DCGA 4HAVB 4KZ0A 1WJ1A 2D9ZA 4HCNB 4BBNF 3ALBA 2ROVA 4DK5A 2H7DA 3PVWA 1KI1B 3DXDA 4KVGB 1MK9B 2YF0A 3CMMB 2KANA 1BTNA 2R0DA 3F5RA 1L2NA 2JRIB 2I5FA 2BF8B 4DX90 4CHKA 5DIFB 2J7QB 1P9DU 3KY9A 3EC8A 2JT4B 2V3SA 3EECA 1HB8A 4MGZE 3T8MA 3A1QB 4EZLA 3S2AA 3PRMB 1BWNA 1X1MA 3GOEA 4FADA 2ZZPB 2EMSA 3OJ3A 2KJHB 3PTFC 2KK8A 1WXSA 5DCNA 4B6WA 2YS3A 1FHXA 2KGXB 4A6FB 4KHOA 2RGNB 2KFKB 2AYOB 5CTRC 3SDLC 3KYDD 4DBGA 5BO4B 3OJ4B 2O6VD 1WI1A 2O2VA 1WM2A 4LDTD 4WJPA 4P7IA 1N3HA 3O65B 5IA7A 4K2OA 1UELA 1NVLA 1WRDB 3ZRCA 2EC1A 4WWOA 1L7YA 2KC2A 3EFUA 1G6JA 4KHBB 3A9KA 4GN1A 5D3WA 1ZC3B 2L2IA 3SUZA 1SE9A 4BOSC 2CODA 2D9YA 2BKRB 3V60A 2COCA 3OAWA 1WGYA 4ZRIA 2DHZA 2LUEA 1WGQA 3ENEA 4MM3A 1QZEA 4PYUA 2L76A 2IO2B 2BWFA 3ECIA 1WE7A 4GPTB 3A4RA 2AL6A 3ZUNA 3SHQA 2N7EA 4IWQA 4GDLA 3UQAA 3DVNU 3WAMA 2G4SA 5JH5C 5LXIB 4NSWA 3AU5A 2DAJA 3DXCA 4HHVA 1DROA 2KQ7A 4EJNA 4NPNA 1AWEA 4TYZA 2KX3A 4MY6A 1FXTB 2DYBA 4W9GA 2DZJA 2MRPA 3NZUA 1Q67A 2YS1A 1DDMA 2FUHB 2XK5B 4G50A 4EMOA 3A1QA 2UVMA 1ISNA 3ZNGC 2KMCA 1MAIA 5C16A 4GMXB 2HJ8A 2NZ8B 2C7HA 2FCQA 4X57B 2MBHA 4J6IA 1I35A 3PSCA 2JUOA 4GOCA 4E71A 5D27A 2KFKA 2M4NA 3TFMA 2V4LA 1AARA 3A33B 1WX7A 4URKA 5DH9B 3UQBA 4DX8A 2COFA 3TO1A 4NAWA 2GMIC 1NTVA 5IAAC 3AU4A 3ZIMA 2KDBA 3DBHI 3KSYA 1R4MI 2B3AA 3JSVB 4E74A 1OTRB 4YL8A 3KVFB 3RYTA 4EKUA 2HRJA 1FOEA 1WJUA 5C1ZA 3KUDB 1KM7A 1U5DA 1M7RA 2LRUA 1X1FA 2WX1A 1K5GB 4JQWC 5L81A 3HW2B 4HATB 3A98B 3CIKA 3WALA 2L0TA 3L0WB 1BT0A 4NJ7A 2KDEB 3ZVVA 2IO0B 2NPTB 5L83A 3QHTA 2RNRB 4TKNA 1P5TA 3SU8X 1WY8A 1U4AA 2NBUA 2D4QA 4HJKA 4IG7B 1ACAA 3PEGA 2L05A 2LKOA 3L54A 2CRFA 5J3QA 4XC2A 2JZ3B 3X0WA 2K8CA 2VKIA 3LJ3A 3A9JB 2IO3B 2UWQA 2XK5A 1WGHA 2K6DB 1TGZB 1J19A 3B08A 4CO7A 3K9OB 4I6NB 2CR5A 4W9DA 2ZNVC 3H1UA 3ML8A 3W1SC 2CQUA 3AI5A 4NNJB 2DHIA 3HK0A 1EO6A 1ZGUB 1K8RB 1LB1A 4KHAA 2JWZA 1GNUA 2BYEA 4PS3A 2KX0A 1WJ4A 4MK0A 3CSTA 2DN6A 2Z59B 2GBNA 5EDSA 3FEHA 2N23A 1DYNA 2WYQA 1W1GA 5E6OA 3NZSA 3ZLZA 3QQ8B 4K7WA 3TIXA 2IO1B 2LVQA 3ZNID 1PFJA 2ELBA 2MDXA 4TQ0A 3KH0A 3X23A 4LDTB 3HIZA 4FA6A 2DFKA 2UZRA 5CX3A 4PQ0A 2G4DB 1VD2A 4YONA 4EUTA 3GYOA 3BJIA 3D32A 3MJWA 3NOBA 3OANA 1EVHA 3QAQA 4F7GA 4JGHB 1U5EA 2JF5A 3OLMD 3ML9A 5HKHA 2M0XA 2DKQA 3ZW3A 1UBQA 4HDOA 2I1JA 4WQOB 1J8CA 1J0WA 2LRWA 4HAWB 1WE6A 1UNPA 2NBWB 4LJOB 2HE7A 2Z0OA 2NPTA 4KIKA 4B9KA 2OOBB 1EAZA 4K17A 1WMHB 2HD5B 4TV3A 4MGKE 3TVVA 2GCJA 2M17A 1ZKHA 1MKEA 3V6EB 3M62B 2C7MB 1V5OA 3APFA 2LGXA 1GJZA 2HTHA 4PNKA 3VUWA 4IWPA 3HHMA 5G2NA 3V62A 3MHSD 3HQCA 3VVWB 5D3XA 5JHHA 3IVFA 1V86A 3TL5A 1FB8A 1FGYA 1VCBA 2KO3A 2KDIA 3R7QA 4HB0B 2RVBB 1UNRA 2LXCA 2P0HA 2D9XA 4GGQA 2CAYA 3VQIA 2KKCA 1U2BA 2KTRA 2NVUI 1WX9A 1XCGA 1PLSA 3B0AA 2D2QA 2VRWB 1RAXA 2AWTA 3TMPB 4K7UA 2ASQA 4EFOA 2CY5A 3A9KB 5C5BB 2K6QA 4F1SA 4IFSA 5HE0A 2NBVB 1WG7A 3DBRI 3ZNHB 1NDDA 1ZVRA 5IJMA 5J17A 1DDVA 2LZ6A 1Q5WB 3H7PA 3T9LA 2G35A 2KMAA 2BYVE 4D0NB 5JHAA 2PPHA 2N4FA 1E7UA 3PT2B 2P0DA 3QCAA 3QK0A 4GDLB 2PE9A 2W2XD 1V89A 3RULA 1H4RA 1XD3B 1UEFA 5CHVC 2MCNB 1P6SA 1RRPB 3WIMA 4BBKA 2LI5A 2P0FA 4ICUA 4JIOU 2MBQA 2L8JA 1YD8U 3TCAA 4FULA 3LJUX 1XQQA 3VUYA 4MDKE 2V76A 3M63B 3FSSA 3V6CB 1WMHA 1LW3A 3F0WA 4DHZE 1TZ1A 4A5KA 1NTIA 3DBLI 5CHWA 3NS8A 3KRWA 3A8PA 5JHGA 4ANXA 2KQSA 1C1YB 5CLLB 1V49A 2C9WB 1ZM0A 2C60A 5J3YA 4GU2A 4NY0A 3GYPA 3RZFA 2MKRA 1WM3A 2UYZB 2MWNB 4F7HA 2WDTB 4FHKA 3R66C 4BOZB 2OQBA 2CKHB 4NAWB 4WJOA 2JRHA 1V5MA 3ODOA 2DZKA 3N7CA 3PZDA 4ZYNA 1KOTA 1UZXB 3K9PB 4NQKE 2KNBA 3U7DA 5C5BA 1E8XA 2YT1A 1KLVA 4M8MA 2FCMA 5DHFB 3L13A 2OTXA 4GDKA 4W9EA 5KCVA 3WANA 2KFJA 4XZ4A 4K7SA 2BWES 4I6LB 2RR9A 3JYUA 1WX8A 2KWCA 3DPDA 3VXWA 4E3CA 2IYDB 4IC7B 1X05A 2LASA 3DXEA 2LXAA 4B95A 4G0NB 5G55A 3VFKA 4IM2A 1M7EA 2Y7BA 2OJRA 1FAOA 2BKFA 2G45B 4IAPA 3ULCA 4MJSB 2PZ1A 2K1FA 1E7VA 3QX1A 3PHWB 2CY4A 5FI0A 4JLCA 2REXA 3IBEA 2ZNVB 3JW0X 5KHQA 2GCLA 5C6RA 1WFYA 3N32A 1BAKA 1KZGA 1NI2A 4N9F4 2DA0A 1P0RA 1Y19B 1P3QU 1Z2MA 2KZRA 2ELAA 1Y8RC 2KUPA 2QHOA 3M95A 1Z5SB 1WGDA 3U30A 5KQ4A 4HB4B 3WA0A 3SYXA 4HLEA 4Z2NA 5CLQB 1H8CA 4A3OA 4Z2MB 4WJQA 3PRZA 2ROZB 3N30A 2KC1A 5E6PA 5HE3A 3VDZA 1AQCA 1GG3A 3MDBC 3QC8B 1C3TA 3DVGY 4ZDVA 5J18A 2DX5A 2MA9B 1M94A 2CHZA 2YS5A 5C23A 1V5TA 2D07B 4BVUC 3DBSA 2ZPYA 3PP2A 1ZW7A 4A6KA 4KDIC 1UNQA 1DBHA 2PEAA 1OMWA 1WZ3A 3AXCA 2GBKA 2E2XA 1V9JA 1H10A 4GB9A 2VSZA 4MGYE 2M8SA 1WIAA 2RD0A 2BPSA 1I7AA 1HBKA 4KAXB 3H6NA 3O96A 2KJRA 5D3YA 4W9FA 3PLVA 2LVPA 2N9PC 4KIKB 2YLMA 5D7GA 1NBFC 3M3JA 2FCSA 2EKEC 4AJWA 1B55A 3WAPA 2LG1A 2A4ZA 2YVCA 4MJSA 2LD9A 2HTHB 2N1VA 4CHJA 1BTKA 2BGFA 3W1SA 4OVUA 2M1MA 4BKTA 3QARA 2J0MA 2R2OA 5HE1A 1WXAA 1UPRA 1UGMA 2V1YA 2LYDA 2KOXA 2XQNM 2DTCA 4HAYB 4W9JA 3GZNI 2LWPA 4WWNA 3W1YA 2YRYA 3UGBB 2LVOA 1WXVA 4CHMA 4L6EA 2KTRB 4FLHA 4M8NA 3QA8A 2RSGA 1UD7A 3UZTA 3MTNB 3ZTDA 2MLBA 3PHXB 2NR2A 3VIAA 3APDA 2I5CA 4GXBA 1WGRA 2IY1B 4FJYA 1WJMA 2D10A 2DYNA 4I6PA 2AEHA 3H7PB 1U5FA 1GC7A 2K39A 2MP2B 1IPGA
chains in the Genus database with same CATH superfamily
2BS4B 1SJHD 1ZXHA 2ADZA 1KLUD 2INCC 4HB3B 4B6HA 2IZVB 1FCLA 3L08A 2D9WA 1XT9B 1P3RA 2DYQA 1C78A 2PTLA 2MQJA 2LGSA 2IFSA 2YSZA 4IOYX 1MPHA 2INNE 1NU2A 1E8ZA 2KD0A 2LULA 1F1HA 4GZUA 2RDGA 3PREA 5AUIA 1VBGA 2RLOA 4FXCA 1S3SG 4EE2A 1P98A 1MIZB 4XX5A 1E5WA 4XWXA 5D3IB 1GC6A 3ZXVA 3FLVA 5J2RA 2KDMA 2JSVX 2E3TA 3IT6B 4O1NA 1MHHE 3BINA 5HE2A 1U27A 1W1DA 1FFVA 3PO0A 4OVVA 4IW0A 2MJDA 1EGXA 1T0YA 3SEBA 4KZCA 2IDYA 3NY5A 4HVBA 1V2YA 4REZA 1GB1A 1T0RC 1WXMA 2GOWA 1UUPA 4A3PA 5LONB 2WXJA 3UIPB 4Y94A 1ZDXA 5D3DA 2WX0A 4EZJA 1TS2A 1UH6A 3FKYA 3DVNV 3LYYA 4W9CA 3PZ7A 4HDQA 4W9KA 2DZMA 5CHFA 2GI9A 1KFYB 3AE3B 3ODWA 4OSNA 3BY4B 4YSZB 2LHDA 5FI1A 4RGMA 3FAHA 1XLQA 5LXHA 3A4SC 4AOFA 1YJ1A 2BS3B 2DBYA 3R3MA 2JYTA 3ENBA 2GUMA 2GBMA 2K9XA 1RM6C 2MBEA 1T6BX 1ST7A 3FM8C 3D8FA 2JXXA 1MIXA 1LM8B 3EA6A 2L7RA 5D94A 2BB5A 1X1GA 2XEWA 1P7EA 1GUAB 1RRBA 4CYEA 3DHIC 5GXGB 2GRIA 2WXQA 2QSDA 1KTKA 5C2TB 1XODA 4JKGA 3VAWA 3TUOA 1SHCA 2DLBA 4IUMB 4MT5A 5HHDG 1JRPA 5DPWA 1TJEA 2L1CA 4FJZA 3C0RB 4C7YA 2FIDA 4DWFA 3PG7A 3M1IB 4YXDB 4ILGB 1MK7B 1ZC4B 4WJNA 4W9LA 4AUQC 4B0EA 5FR6A 2Z0DB 1V1PB 1R7SA 3TBLD 1KZ7A 2K2JA 4JPSA 1HA5A 4K3CA 1OQNA 4GDKB 1WR1A 2WQYB 2EKIA 4JKEA 2MBBB 3JVZX 1V61A 4RH6A 1IRSA 3ZGZA 5AZFA 2Z4DA 1MI0A 2K2UA 4R3DA 1YJJA 2DYOA 2MP2A 3Q6BA 3ZRFA 2DWQA 1IGDA 4YSYB 2ZVOA 1QQGA 2DENB 3WYFB 2JY6A 2K49A 2C7NB 3Q69A 4ICVA 2QEJC 3Q2AC 3WAOA 4BBNC 2YT0A 1VRAB 1VJKA 1JALA 5DPSA 4ANWA 2W9NA 4MGIE 3ULBA 1P7FA 4IM3A 5L95C 5J3TA 4W9IA 2KN5A 1W1HA 1OQQA 2N9LA 3H7SA 1WYWB 3KQ4A 2AQ1B 5EE3A 5JHBA 1STEA 1QOBA 1LXDA 2J42A 2N0YA 3TW1A 2AL3A 2DKPA 3SBGA 2Z0PA 1J7CA 2DIKA 4HB2B 4TUUA 4NJ6A 4A8XC 4DBBA 2V3NA 3N1YC 2V4IB 1V80A 2CHWA 2CHXA 2P8VA 2EMTA 3NHEB 3A8QA 4JK7A 2ZCCA 3I5JC 1E7PB 1SGHA 2MW5A 3RD2A 2BYFA 3P2BA 1N61A 4BKSA 4DHJD 2KCJA 4Q2JA 1X11A 1KJTA 2X18A 3IFWB 4C0AA 4A20A 3RT3B 4OZAA 2J0JA 3T06A 1FMAD 4WJ7A 1FCCC 2J59M 4AP4C 3HIEA 1EWYC 2WS3B 4LNFA 4RF0A 3DDCB 3P6AA 2H7EA 4KSLC 1DIKA 2NS5A 1FHWA 4PS8A 1JROA 3PRPB 3AB5A 5E6JA 1M4VA 2CS4A 1OQYA 1WI0A 2ON8A 1YX6B 1F0ZA 2J0KA 2DLWA 1EU4A 2KDFB 2JPHA 3U8ZA 4HWIB 3ZXRA 1XX0A 1FM0D 3AECB 5EE1A 2LJ5A 3FP5A 2WWZA 1CMXB 1V5UA 5D2MB 4ANVA 2KXJA 1WJNA 4LCDE 2BCJA 5KQ1A 4LJPB 1TBEA 3Q3OC 1V88A 4QXAB 4XWWA 5E6NA 4JWUC 3IT4B 2DX5B 1J0GA 1YQ3B 2RUKB 2MX2A 3P42A 1HTQA 3APCA 2FDQA 3RCPA 4DIXA 2MFQA 2XBBC 2K8HA 2K25A 1PQSA 2MSED 4F7UP 5C79A 1WJ6A 3T3NA 3HM3A 1V1PA 2DZIA 3VTWA 1MJDA 1HEZE 2AQ2B 2WP9B 4RM8A 4FBJB 2Z13A 2MH7A 2Q5WD 2XN9C 1XR0B 1Z87A 4EZKA 3ZDTA 1WVHA 1U5GA 4BKSD 2R2QA 1CZPA 3RPFC 4RMAA 3PV1A 1Q0WB 4MSMB 1IBXB 1E8WA 4IM0A 5IO9A 3R8BA 4K81A 1NEKB 5I4DA 2OEDA 1X86A 2N7JA 1XF5L 3T3OA 2QMTA 4GSWA 2C5LC 1PFDA 2NCNA 2XNAC 2KHWB 1RWSA 3VTUA 2JVCA 4G11A 2H89B 1ZSQA 1EUVB 2Y8GA 5DHAB 4HEA1 2Y5BB 2EJ8A 2PVOD 2LFIA 1RJ2A 1TTNA 2K3UA 1C4PA 3RNCC 3DBHB 1Q1OA 1ROEA 3Q14C 2X38A 3QIJA 3L17A 4PS7A 2A5UA 3G9WA 2KYWA 2KR0A 1FHOA 3B1LX 2ABDA 1NYQA 4USAA 4F8CB 2UZSA 2COAA 3QWMA 1LQBA 3Q8FA 5BYRA 1GB4A 2FCNA 3VOQA 2DYMA 3AV8A 2X8XX 1RLFA 1XKEA 2QCZA 3UINB 1C4AA 2JP2A 1D5ZC 3E9PA 3D8EA 2FJ9A 4MELA 4AWJA 4II3B 1WR6E 2L3ZA 2K00A 2IBIB 2M14A 3BVGA 3AEAB 2NMBA 2KWUB 3QBVB 2Q13A 1V6EA 4KDLB 1S1QB 2MHJA 4JK8A 2BTEA 2W2WA 4JKHA 1JWBD 3GB1A 2DHJA 4G3XB 4GLSC 3ZQ4A 4F7ZA 3C19A 1Y5OA 3PS6A 4KGRA 4A6FA 5BMGA 2PJHA 2FNJB 5AZHA 1V1OA 2E6XA 1LFDA 3KLSX 1HB6A 2N9KA 5JP4A 4AS1A 2JQRB 3AULA 3OG5A 4HAUB 5DPRA 3E66A 2M38A 1YMHE 2YT2A 5GMVA 3NSUA 1YX5B 4HKZE 4YTNB 2RSUA 3L10B 2KLCA 3R7RA 2COPA 4PYZA 4IOIE 2ZKMX 1SIFA 3CSFA 2LBBA 5AEKB 4WVFB 4GMVA 4WAAA 4II2B 2Y8FA 3MPXA 4HPMB 1YQBA 2PVGC 3V05A 3PVLA 4GNKB 1UNSA 4KHBA 4AJYB 2N9EB 3ZTCA 2Y5PA 3SV1A 3ML4A 1TY2A 2D3GA 5G5HA 2Z0QA 3DVGX 2CU1A 2WXFA 4K2PA 2RQ1A 3E9LA 1FXAA 1IBXA 1UBIA 3I57A 1MG8A 5BMHA 4FN2A 3QJZA 2NTTA 4ASWC 2K8BA 2GJYA 4MEMA 3U2SC 1F9JA 1D5MC 2K5PA 2L0FA 2D11A 2JZZA 3NWDA 2Z0EB 3UIOB 2LOXA 2GBRA 4RM9A 4DDGD 3NS1A 3MP9A 2QKMA 4EOYA 2ZJDA 2MBOA 3PVUA 3NZ3A 2KWVB 1B1ZA 2QIEB 5GOWB 1TQZA 3ZJTA 4IKGA 1OGWA 2KAJA 4DXGA 1E90A 4KSKC 1I4XA 4MSQB 2PE6B 4TQ1A 3V5WA 5KHOA 4GIVA 5D6JB 2RMMA 2RPQA 2L00B 4LNOA 4YWGG 1NTYA 3PLUA 1TS5A 3KYCD 2QDFA 2W55A 2ZVNA 5EFXA 3LDZE 1V8CA 4KV2A 3ZO5B 4NAMA 1IUEA 4C80A 3DHGC 4OHJA 1DDWA 5AZGA 5LOPB 2KIEA 3SD5A 1A5RA 1FGZA 2MWSB 2CB8A 2FIFA 1I4GA 3R2IA 4FJVB 2GB1A 2DHKA 5JZEB 1HZ6A 3H9DA 4P6VF 3L16A 4XDDA 2W3SA 4DHJB 3P7ZA 2KTFA 4HCPB 4N58A 4QAYA 1NENB 3VTVA 3DQVA 3IHPC 4MH0E 2ZCBA 3VHTC 3TEYA 2N7DA 2K8EA 1N63A 4HAZB 1WZ0A 1XXGA 3W5VB 3ZDMC 3FC4A 2L52A 4YTPB 4M00A 4ZRKA 1XLOA 4QJ3B 1D4BA 4FHJA 1RFAA 1QKZA 3P4RB 1VBHA 5D3VA 2IYBA 4B0MA 2NMQA 3BYTB 1TJ6A 1RYJA 4MT7A 3DWGC 3CXBB 1YJIA 2G1EA 1OEYA 1ZP0B 4WWMA 4ANUA 3URYA 1T3QA 2AQ3B 1E9MA 5TR5A 2LGYA 3I3TB 4W9HA 2WH5A 1I2HA 3RCZA 2HTME 3SO6A 3N1ZC 3JSVA 1PMSA 2FJLA 2G9HD 2O6VB 2RGFA 3AN1A 4HSIA 1EF5A 3ONSA 3ZVRA 2I1KA 1YIWA 2ZW1A 3PPAA 2LGDA 1U29A 2J53A 2WDVB 3Q3JA 1YQ4B 3DOWA 1OEYJ 5HFYA 1EU3A 1T0SC 3V3XA 4HK2A 1K5DB 3VR8B 2LOZA 1TXDA 1BMLC 1OY2A 5IRSA 4H8SA 2DX1A 3U52E 3NWAA 4HPLB 2ZEQA 1JQ4A 3D8DA 1FFUA 1LO5D 1WH3A 1E8YA 3W2DA 3KZ1A 3VH4B 2D9VA 3VUXA 5I2MA 2LHEA 3RZWC 2TSSA 4LNKA 1DOIA 3QWZB 4NQLB 4EEWA 1F52A 2R09A 3RUIB 5DPTA 2IGHA 3KWVA 1K52A 5BYQA 1VZ6A 3KRXA 2BW2A 3EHVA 1D3ZA 1QOAA 3N3KB 2N9XA 4JKDA 1JWUD 1QQRA 3VH3B 3GE8C 2IY0B 3EPYA 2KJ6A 5LLIA 2VRRB 4WSFA 3V61A 1GGOA 4DXAB 4DDID 1L6UA 1JRUA 2BYTA 3Q3FA 1R4NB 2N1WA 3OWEB 1A70A 3IG3A 5M4YB 2G3QB 1IP9A 4IWOA 4ACFA 2R2YA 2KLGA 4JL9A 2HDEA 3AE8B 3ODXA 3KUZA 3L4PA 2I38A 2JX5A 3TJPA 3KW5B 3U7ZA 4BKGA 3A9JA 1MI1A 4ZHOA 1IYFA 1P1AA 4WWPA 1WGUA 2O2VB 2OJWA 5JLJB 3UF8A 1WF9A 3ZKJC 3AE5B 3NG0A 3PSEB 1HE8A 1AW7A 2ZPNA 2W2XC 1L6VA 1ZE3D 1EF1A 3CF6E 4XWTA 3HVZA 3HM6X 4HXDA 1I42A 4HAXB 2ZW0A 1UPQA 4ZRJA 1V81A 4A6HA 4M0WB 5FR3A 3AJ4A 1AWDA 2FAZA 4YSXB 3LB8C 3ZNZB 1FO4A 4RCOA 3SFEB 2KVRA 1XD4A 2GBJA 2QKLA 3E56A 4DHZB 5FK9C 2Z59A 1WGGA 1TKEA 1N5XA 5JVLA 2M0AA 1V5PA 4BFRA 3P4PB 3KUCB 3PGEA 5DI9B 2WU5B 2GS0A 4K1RB 4DXFA 1R4NI 2O6VA 1E0ZA 1QC6A 3SNHA 2DAFA 1N62A 3DCGA 4HAVB 2D3AA 2RDBC 4S17A 2OHFA 4KZ0A 1WJ1A 2D9ZA 4HCNB 4ARCA 4BBNF 1UF0A 3ALBA 4JK9A 2ROVA 4ILJA 1N5WA 1SE4A 4DK5A 2H7DA 3PVWA 4OZCA 1KI1B 1C77A 3DXDA 2CJOA 1ZDVA 4KVGB 4YT0B 1MK9B 2YF0A 2FE8A 2KANA 3CMMB 2BT6A 1N6ZA 1BTNA 2R0DA 3F5RA 5FKAC 4LK0M 3BIID 4KGSA 2JRIB 2I5FA 1L2NA 4L23A 2BF8B 1DOYA 2SEBD 4DX90 3DHHC 1QLBB 4CHKA 1YN4A 5DIFB 4L1RA 2J7QB 3ZJVA 1P9DU 3KY9A 3EC8A 1XEEA 2JT4B 4AQ7A 2Z8LA 2V3SA 3EGRA 3EECA 2IGDA 1HB8A 4MGZE 3T8MA 1MFWA 3A1QB 4EZLA 3S2AA 4ZHPA 3NVVA 2PLPA 3PRMB 1BWNA 1X1MA 3GOEA 4HPPA 2QILA 1YOVB 4FADA 2ZZPB 2LUMA 4XE0A 2EMSA 3OJ3A 2KJHB 3PTFC 2WXIA 2KK8A 3MC8A 1WXSA 1L5PA 5DCNA 4B6WA 2YS3A 1GAQB 1FHXA 2KGXB 4A6FB 1ET6A 4KHOA 2BQQA 2RGNB 2KFKB 2AYOB 3NUHB 5CTRC 3AE1B 3SDLC 2QC8A 1C9FA 3KYDD 4DBGA 5BO4B 3OJ4B 1I7HA 3U4EG 2O6VD 1WI1A 2O2VA 1WM2A 4LDTD 4M02A 1YNTE 2KT7A 4WJPA 4MACA 4P7IA 1N3HA 3P4QB 3O65B 4WH4A 5IA7A 4K2OA 1UELA 1NVLA 3NJTA 4ARIA 4XGAB 4QJ5B 1WRDB 2ICIA 4M0WA 1KC7A 3ZRCA 2EC1A 4WWOA 2EELA 1L7YA 2KC2A 3HRDD 3EFUA 3AH7A 1G6JA 3ZJUA 4KHBB 3A9KA 2MJ3A 4GN1A 4JWSC 1XLNA 5D3WA 4GOUA 1ZC3B 1KBLA 3LXFA 2L2IA 1ESFA 3SUZA 1SE9A 2M56B 4BOSC 1FRRA 2CODA 1UGJA 2PIAA 4D2KA 1TT5B 3IAM1 5MPOA 4A9AA 5IN7A 2D9YA 2CJNA 2BKRB 5HI1A 3V60A 2COCA 3OAWA 2PKOA 1F2RC 1K50A 1WGYA 4ZRIA 2DHZA 3RI7C 2LUEA 1WGQA 3ENEA 4TMAB 4MM3A 1QZEA 4PYUA 3TEZA 1BUIC 2L76A 2IO2B 4OT1A 2BWFA 1FIQA 2JYEA 3PZ8A 3ECIA 1WE7A 4GPTB 4RGTA 4HKQA 3OHMB 3A4RA 2AL6A 3ZUNA 3SHQA 2N7EA 4IWQA 4GDLA 4PK1A 3UQAA 4RFBA 2WXKA 3DVNU 3WAMA 2G4SA 1R4MB 1JWMD 5HG2A 5JH5C 2WXPA 5LXIB 4NSWA 4OW0A 3AU5A 1T0QC 2DAJA 1MVKA 3BYYB 3DXCA 2L32A 3MJ5A 4HHVA 1DROA 2KQ7A 3TEXA 4EJNA 4NPNA 1AWEA 4TYZA 2KX3A 1XCTL 3TSSA 2WU2B 4MY6A 1K51A 1FXTB 2DYBA 2INPE 4K3BA 1SXTA 4W9GA 2DZJA 3EUB2 4XYCA 4J3OD 2MRPA 1CQVA 1LGRA 3NZUA 1Q67A 2YS1A 1DDMA 3C8YA 2FUHB 2XK5B 4G50A 2D3CA 4EMOA 3A1QA 2UVMA 1FNWA 3CWIA 1ISNA 2FUG1 4JX1C 4NZLB 3ZNGC 4S0RA 2KMCA 1MAIA 5C16A 4GMXB 2HJ8A 3Q8EA 2NZ8B 1VLBA 2C7HA 2JWUA 2FCQA 4X57B 1QT9A 1HXYD 2MBHA 4J6IA 3J9CA 1I35A 3PSCA 4M01A 2JUOA 4GOCA 1JDEA 4E71A 3GS2A 3N20C 1ZYIA 5D27A 2KFKA 2M4NA 3TFMA 4L2YA 4PT5A 1PUTA 2V4LA 1DOXA 1AARA 1PGXA 3A33B 1WX7A 4URKA 5DH9B 2N0SB 4DX8A 3AE9B 3UQBA 2COFA 3P4SB 3TO1A 2PMVA 4NAWA 2GMIC 3AEBB 1NTVA 3NVWA 5IAAC 4DQOC 4ZRPA 3AU4A 3MC0B 3Q8AA 3ZIMA 2KDBA 3DBHI 3KSYA 1R4MI 2B3AA 3JSVB 4C00A 4P1CC 4E74A 1OTRB 4YL8A 2V3PA 3KVFB 1TY0A 3RYTA 1D5XC 4EKUA 2JZPA 3NVZA 2HRJA 3MHZA 1FOEA 1VZ8A 1WJUA 4UDUC 1PGBA 5C1ZA 1JCKB 3AE7B 1WRIA 1FNVA 3KUDB 1TS3A 3HVDA 1KM7A 1U5DA 3BVMA 1XO3A 3VRBB 1M7RA 3RMKC 1MPEA 1NI3A 5LNK1 2W54A 1WSPA 2LRUA 1X1FA 1E10A 2WX1A 4N59A 4OZBA 1K5GB 1T77A 4JQWC 5L81A 3HW2B 3VRAB 2WXMA 4NJCA 2M19A 4HATB 3A98B 5H8YE 3CIKA 3WALA 1FXIA 2L0TA 2MJEA 3BZDB 4H2AA 2FBWB 3L0WB 2HJ1A 1BT0A 1JW9D 4NJ7A 2KQ4X 2KDEB 3ZVVA 1MG4A 2IO0B 3FILA 2NPTB 5L83A 3QHTA 4TKNA 2RNRB 4D6WA 1P5TA 3SU8X 1WY8A 1J7AA 1U4AA 1TIFA 2NBUA 1QILA 2D4QA 4XDCA 4HJKA 4IG7B 2J4XA 1ACAA 5I2SA 3PEGA 2L05A 3H8HA 1V97A 2LKOA 3L54A 2CRFA 5J3QA 4KKIA 4XC2A 3RNAC 1I4PA 2X0SA 2JZ3B 1OQRA 3X0WA 2K8CA 2VKIA 3LJ3A 2KVZA 3A9JB 2IO3B 2UWQA 2XK5A 1WGHA 3IAS1 1F77A 2K6DB 1WXQA 1TGZB 1J19A 3B08A 4CO7A 3K9OB 4I6NB 2CR5A 4W9DA 3A58A 3CIRB 2ZNVC 3H1UA 4ILHA 3ML8A 3W1SC 3W9CB 2CQUA 3AI5A 4NNJB 2DHIA 3HK0A 1EO6A 3Q3NC 3UI3A 1ZGUB 1TKGA 4WAFA 1K8RB 1LB1A 2D3BA 4KHAA 2JWZA 1GNUA 2BYEA 1ZUD2 3AMZA 4PS3A 2KX0A 1WJ4A 4CSQA 3MFGA 4MK0A 2CU3A 3CSTA 2DN6A 2Z59B 2RDHA 2GBNA 5EDSA 3FEHA 2N23A 1DYNA 2VZKD 2WYQA 1W1GA 5E6OA 3NZSA 3ZLZA 3QQ8B 4K7WA 3TIXA 2IO1B 3U12A 2YEPB 2LVQA 3ZNID 1PFJA 2ELBA 3NRZA 2LJIA 2MDXA 4A6QA 4TQ0A 4OVZA 3KH0A 4QJ4B 2L1AA 3X23A 3VR9B 4LDTB 3HIZA 4FA6A 2DFKA 2UZRA 5CX3A 4PQ0A 2G4DB 2V9HA 1VD2A 2B76B 4YONA 1J7BA 2PW9A 4EUTA 3GYOA 3BJIA 3AE2B 3D32A 4HJGE 3MJWA 3NOBA 1WYGA 3OANA 1EVHA 3QAQA 4F7GA 2H88B 2BVCA 1FPYA 2LEKA 4JGHB 3AE6B 1U5EA 2JF5A 5C3JB 3OLMD 3ML9A 5HKHA 2M0XA 2DKQA 1HQRD 3ZW3A 1AYFA 1UBQA 4HDOA 2I1JA 1D6EC 2D5GA 4WQOB 2Y3AA 1J8CA 1J0WA 2LRWA 1EM7A 1KF6B 1N60A 4HAWB 2GLSA 1JWAD 2Y5CA 3DBRB 1WE6A 2K22A 1UNPA 2NBWB 4LJOB 2HE7A 2Z0OA 1JMLA 2NPTA 4KIKA 4B9KA 1BXTA 3ZYYX 2OOBB 1TS4A 1ET9A 4US8A 1EAZA 2INDC 4LNNA 4K17A 1WMHB 2HD5B 4TV3A 4MGKE 3TVVA 2GCJA 2KIGA 2WLBA 3N9YC 2M17A 3SBTA 1ZKHA 1MKEA 3V6EB 1C4CA 3M62B 2C7MB 1V5OA 5TSSA 3APFA 2LGXA 1GJZA 2HTHA 4PNKA 3VUWA 4IWPA 3HHMA 5G2NA 3V62A 3MHSD 3HQCA 5T8IA 3VVWB 5D3XA 5JHHA 3IVFA 2VH1A 1QF6A 1V86A 3TL5A 1FB8A 1FGYA 3I9V1 2VH2A 1VCBA 2KO3A 2KDIA 2L83A 4HROA 1PGAA 3R2TA 3R7QA 4HB0B 5EE0A 4KGTA 2K0PA 1E6EB 2RVBB 1UNRA 2LXCA 2P0HA 2D9XA 4GGQA 2CAYA 1C76A 3SR6A 3VQIA 1GOZA 2KKCA 1SE3A 1U2BA 2KTRA 2WDRB 2NVUI 1WX9A 1XCGA 1PLSA 3B0AA 2D2QA 1UWMA 2VRWB 1RAXA 2AWTA 3TMPB 4K7UA 2ASQA 4EFOA 3KWLA 2CY5A 3A9KB 3DCXA 2WXRA 5C5BB 2K6QA 4WIPA 4F1SA 4IFSA 2WXLA 5HE0A 2NBVB 1RFKA 3DBLB 1EWCA 3DWMA 1WG7A 3DBRI 1AN8A 3ZNHB 1NDDA 2Z14A 1ZVRA 4HRSA 5IJMA 4KKJA 5J17A 1DDVA 2LZ6A 3P1MA 1Q5WB 1XLPA 2DNFA 5G5GA 4L1BA 3H7PA 3T9LA 3O13A 2G35A 4BZAA 2KMAA 4MM3B 2BYVE 4D0NB 5JHAA 4RNAA 2PPHA 2N4FA 1E7UA 3PT2B 4A90A 3B77A 3RNGC 2P0DA 2WDQB 3QCAA 1CK1A 3QK0A 4GDLB 2PE9A 2W2XD 3IXSA 3FVCA 1V89A 5BMIA 2LMCA 1L0XB 1DYQA 3RULA 1H4RA 1XD3B 1UEFA 5CHVC 2MCNB 1P6SA 1RRPB 3WIMA 4BBKA 2YEPF 2LI5A 2P0FA 4ICUA 4JIOU 5IKCM 2W82A 4JKAA 2MBQA 2L8JA 1YD8U 4RF1A 3TCAA 4FULA 4ITKA 4A55A 3E9SA 3LJUX 1XQQA 3VUYA 4MDKE 2V76A 3M63B 3FSSA 3V6CB 5LG4B 1Y56A 1WMHA 1F2RI 4RGOS 1IGCA 1C79A 1ENFA 1LW3A 3F0WA 4DHZE 2KMMA 1TZ1A 4A5KA 1NTIA 3DBLI 5CHWA 3NS8A 4TSSA 3KRWA 3A8PA 5JHGA 3B2FA 4WURA 4ANXA 2KQSA 1C1YB 5CLLB 1JWSD 1V49A 1FNUA 1KH0A 2C9WB 3Q8CA 5BYSA 1ZM0A 1MHXA 2C60A 2J52A 5J3YA 5IP4D 3B9JA 4GU2A 4NY0A 3GYPA 3RZFA 2MKRA 1WM3A 2UYZB 2MWNB 4F7HA 1L4DB 1TKYA 2WDTB 4FHKA 3R66C 4BOZB 1PDXA 3BVZA 2OQBA 4C7ZA 2CKHB 1CJEA 4NAWB 2WGSA 2I2YA 4WJOA 2JRHA 1V5MA 3ODOA 2DZKA 4LNIA 3N7CA 1T5XD 3E9OA 3PZDA 4ZYNA 1PYWD 2WXGA 2AX5A 1KOTA 3AEFB 1UZXB 3K9PB 4NQKE 2KNBA 3U7DA 3B2GA 3HSAA 5C5BA 3AEGB 4LLGM 2V0GA 2WXHA 2IGGA 1E8XA 1QOGA 2YT1A 2NBVA 1KLVA 4M8MA 1VZ7A 2FCMA 1YN3A 1B9RA 5DHFB 3L13A 1L0VB 1SJED 2OTXA 1VR9A 3AE4B 4RGNA 1SB3C 4GDKA 4YTMB 4W9EA 1OFFA 5KCVA 3WANA 2KFJA 4XZ4A 1SF0A 1FD6A 2KWDA 4K7SA 4JE3B 1I4RA 2BWES 4I6LB 2RR9A 3JYUA 1WX8A 4CQNA 2KWCA 3DPDA 4IDIA 3VXWA 2FJUB 2VZKB 4E3CA 2IYDB 4IC7B 1SE2A 1X05A 2LASA 4N6EB 3DXEA 3FILB 3RNFC 2LXAA 4B95A 1KRHA 3W5UB 4G0NB 2MEKA 5G55A 3VFKA 4IM2A 4WQMA 1M7EA 2Y7BA 2OJRA 1FAOA 2BKFA 2G45B 4IAPA 3ULCA 4MJSB 2PZ1A 3Q3MC 2K1FA 3AEEB 5JXVA 1E7VA 3QX1A 4C4VB 3PHWB 2CY4A 5FI0A 2KACA 2UU7A 4JLCA 1XCQL 3GP7A 2REXA 3IBEA 2ZNVB 3JW0X 4JKFA 5KHQA 3RFZB 2GCLA 5C6RA 1WFYA 3I63C 3N32A 1KLGD 4ZRQA 1BAKA 3EFCA 1I4HA 1KZGA 1NI2A 2R82A 3NWFA 4N9F4 2DA0A 1P0RA 1Y19B 1P3QU 1Z2MA 2JXTA 5EE9A 2KZRA 2ELAA 2LGIA 1Y8RC 2KUPA 2QHOA 3M95A 1Z5SB 1WGDA 3U30A 5KQ4A 3ETRA 4HB4B 3WA0A 3SYXA 1YN5A 2W3RA 4HLEA 4Z2NA 5CLQB 1H8CA 4A3OA 4Z2MB 4WJQA 3PRZA 2ROZB 3N30A 4ZYSA 2KC1A 5E6PA 2KUQA 3BWUD 1HTOA 1K53A 1VDVA 5H92C 5HE3A 2WHIA 3VDZA 2ACZB 2SAKA 1AQCA 1GG3A 1FEHA 3MDBC 3QC8B 4US9A 3Q8BA 3BK1A 1C3TA 3DVGY 4ZDVA 3WCQA 5J18A 3AM9A 1NVID 2DX5A 2MA9B 3SFDB 1M94A 3P63A 2CHZA 3BK2A 2YS5A 4LTUA 5C23A 1V5TA 2D07B 3RNEC 3GZNB 4BVUC 3DBSA 2ZPYA 3PP2A 1ZW7A 4A6KA 4KDIC 1UNQA 1SIJA 1DBHA 2PEAA 4JKCA 2BB6A 1OMWA 1WZ3A 3AXCA 2GBKA 2E2XA 1V9JA 1H10A 4GB9A 2VSZA 1NYRA 4MGYE 2M8SA 1ZPSA 4MH8A 1WIAA 2RD0A 2BPSA 1I7AA 1HBKA 3MC9A 4KAXB 1L4ZB 3RN9C 3H6NA 3O96A 2KJRA 5D3YA 1QOFA 4W9FA 1FRDA 2JU6X 3PLVA 2R61A 1GPXA 2BS2B 2LVPA 2N9PC 4KIKB 1Q10A 2YLMA 5D7GA 1NBFC 2WXNA 3M3JA 2FCSA 2EKEC 4AJWA 4C56C 1B55A 4JKBA 3WAPA 2IPKD 2LG1A 2A4ZA 2YVCA 4MJSA 2LD9A 2HTHB 2N1VA 4C4VA 4CHJA 2BBCA 2WNMA 1BTKA 4P16A 2BGFA 1TZOA 3W1SA 4OVUA 2M1MA 2ONQA 4BKTA 3QARA 2J0MA 2R2OA 5HE1A 1WXAA 3TEWA 3HUIA 4BAXA 1UPRA 1HZ5A 1UGMA 2V1YA 2LYDA 5IOIA 2KOXA 3AEDB 2XQNM 2DTCA 4HAYB 1SBBB 2RPVA 4W9JA 3GZNI 2LWPA 4WWNA 3W1YA 2YRYA 1ACCA 3N1XC 1DGJA 4ZOHC 3NW8A 3UGBB 1ZOYB 2LVOA 1WXVA 1SEBD 4CHMA 4L6EA 2KTRB 4FLHA 4KX6B 4M8NA 3QA8A 3ABVB 4JKGB 1TYGB 2QJLA 4P1BC 2RSGA 1UD7A 3UZTA 3MTNB 3ZTDA 1WWTA 2KN4A 1L0YB 5AUKA 2MLBA 1I4QA 3PHXB 2NR2A 2IJ0A 3VIAA 3APDA 2I5CA 4GXBA 1SSNA 1WGRA 2IY1B 3RNBC 2NTSA 4FJYA 2RRFA 1WJMA 3NVYA 2D10A 1ZXIA 2WXOA 1UWXA 3GE3C 2DYNA 1WGKA 4I6PA 2AEHA 3H7PB 1U5FA 1GC7A 2K39A 2MP2B 1IPGA
chains in the Genus database with same CATH topology
2ADZA 4HB3B 4B6HA 2IZVB 3L08A 2D9WA 1XT9B 1P3RA 2DYQA 2MQJA 2IFSA 2YSZA 4IOYX 1MPHA 1NU2A 1E8ZA 2KD0A 2LULA 4GZUA 3PREA 1VBGA 2RLOA 1S3SG 1P98A 1MIZB 4XX5A 1E5WA 4XWXA 1GC6A 3FLVA 5J2RA 3BINA 5HE2A 1U27A 1W1DA 4OVVA 4IW0A 1EGXA 1T0YA 4KZCA 3NY5A 4HVBA 1V2YA 1WXMA 2GOWA 4A3PA 5LONB 3UIPB 4Y94A 2WX0A 4EZJA 1UH6A 3DVNV 4W9CA 4HDQA 4W9KA 2DZMA 5CHFA 3ODWA 3BY4B 5FI1A 5LXHA 3A4SC 4AOFA 1YJ1A 3R3MA 3ENBA 2GBMA 2MBEA 1ST7A 3FM8C 3D8FA 2JXXA 1MIXA 1LM8B 2L7RA 5D94A 1X1GA 2XEWA 1RRBA 1GUAB 4CYEA 1XODA 4JKGA 3VAWA 1SHCA 4IUMB 5DPWA 2L1CA 4FJZA 3C0RB 2FIDA 4DWFA 3PG7A 3M1IB 4ILGB 1MK7B 1ZC4B 4WJNA 4W9LA 4AUQC 5FR6A 2Z0DB 3TBLD 1KZ7A 2K2JA 1OQNA 4GDKB 1WR1A 4JKEA 2MBBB 3JVZX 1V61A 1IRSA 5AZFA 2K2UA 2DYOA 2MP2A 3ZRFA 2ZVOA 1QQGA 2DENB 3WYFB 2JY6A 2C7NB 4ICVA 3WAOA 4BBNC 2YT0A 5DPSA 4ANWA 2W9NA 4MGIE 3ULBA 4IM3A 5L95C 5J3TA 4W9IA 2KN5A 1W1HA 3H7SA 1WYWB 5JHBA 1LXDA 2N0YA 3TW1A 2AL3A 2DKPA 3SBGA 2Z0PA 2DIKA 4HB2B 4TUUA 4NJ6A 4DBBA 1V80A 2CHWA 2CHXA 2P8VA 2EMTA 3NHEB 3A8QA 4JK7A 2ZCCA 1SGHA 2MW5A 3RD2A 2BYFA 3P2BA 4BKSA 4DHJD 2KCJA 1X11A 1KJTA 2X18A 3IFWB 4C0AA 4A20A 3RT3B 2J0JA 3T06A 4WJ7A 2J59M 4AP4C 3DDCB 3P6AA 4KSLC 2H7EA 1DIKA 2NS5A 1FHWA 4PS8A 3PRPB 2CS4A 1OQYA 1WI0A 1YX6B 2J0KA 2DLWA 2KDFB 2JPHA 3U8ZA 4HWIB 1XX0A 2LJ5A 3FP5A 2WWZA 1CMXB 1V5UA 5D2MB 4ANVA 2KXJA 1WJNA 4LCDE 2BCJA 5KQ1A 4LJPB 1TBEA 1V88A 5E6NA 2DX5B 1J0GA 2RUKB 2MX2A 3APCA 2FDQA 3RCPA 2XBBC 2MFQA 2K8HA 2K25A 1PQSA 2MSED 4F7UP 5C79A 1WJ6A 3HM3A 2DZIA 3VTWA 4RM8A 4FBJB 1XR0B 1Z87A 4EZKA 3ZDTA 1WVHA 1U5GA 4BKSD 2R2QA 4RMAA 3PV1A 1Q0WB 4MSMB 1E8WA 4IM0A 4K81A 1X86A 4GSWA 2C5LC 2NCNA 2KHWB 3VTUA 2JVCA 4G11A 1ZSQA 1EUVB 2Y8GA 5DHAB 2Y5BB 2EJ8A 1RJ2A 1TTNA 1Q1OA 3QIJA 3L17A 4PS7A 2A5UA 3G9WA 1FHOA 3B1LX 2ABDA 4F8CB 2UZSA 2COAA 3QWMA 1LQBA 2FCNA 3VOQA 2DYMA 1RLFA 1XKEA 3UINB 2JP2A 3E9PA 3D8EA 2FJ9A 4MELA 4AWJA 4II3B 1WR6E 2L3ZA 2K00A 2IBIB 2M14A 2NMBA 3QBVB 2Q13A 1V6EA 2KWUB 4KDLB 1S1QB 4JK8A 2W2WA 4JKHA 2DHJA 4G3XB 4F7ZA 1Y5OA 3PS6A 4A6FA 2PJHA 2FNJB 5AZHA 1LFDA 1HB6A 5JP4A 3AULA 4HAUB 5DPRA 3E66A 2M38A 5GMVA 3NSUA 1YX5B 2RSUA 3L10B 2KLCA 3R7RA 2COPA 4PYZA 1SIFA 3CSFA 2LBBA 5AEKB 4WVFB 4GMVA 4WAAA 4II2B 2Y8FA 3MPXA 4HPMB 1YQBA 3PVLA 4AJYB 2N9EB 3ZTCA 3SV1A 3ML4A 2D3GA 2Z0QA 3DVGX 2CU1A 4K2PA 2RQ1A 3E9LA 1UBIA 1MG8A 4FN2A 3QJZA 4ASWC 2K8BA 2GJYA 4MEMA 1F9JA 2L0FA 2D11A 2JZZA 2Z0EB 3UIOB 2LOXA 2GBRA 4RM9A 4DDGD 2QKMA 4EOYA 2ZJDA 2MBOA 3PVUA 2KWVB 5GOWB 1TQZA 1OGWA 1E90A 4KSKC 4MSQB 2PE6B 4TQ1A 3V5WA 5KHOA 4GIVA 5D6JB 2RPQA 2L00B 1NTYA 3PLUA 3KYCD 2ZVNA 5EFXA 3LDZE 4KV2A 3ZO5B 1DDWA 5AZGA 5LOPB 3SD5A 1A5RA 1FGZA 2MWSB 2CB8A 2FIFA 4FJVB 2DHKA 5JZEB 3H9DA 3L16A 4DHJB 3P7ZA 2KTFA 4HCPB 3VTVA 3DQVA 3IHPC 4MH0E 2ZCBA 3VHTC 2N7DA 4HAZB 1WZ0A 3ZDMC 4ZRKA 4FHJA 1RFAA 1VBHA 5D3VA 2IYBA 1TJ6A 4MT7A 3CXBB 1OEYA 4ANUA 5TR5A 2LGYA 3I3TB 4W9HA 2WH5A 1I2HA 3RCZA 3SO6A 3JSVA 1PMSA 2FJLA 2O6VB 2RGFA 1EF5A 3ONSA 3ZVRA 2I1KA 1YIWA 3PPAA 2LGDA 1U29A 3Q3JA 3DOWA 1OEYJ 4HK2A 1K5DB 2LOZA 1TXDA 1OY2A 4H8SA 2DX1A 4HPLB 2ZEQA 3D8DA 1WH3A 1E8YA 3KZ1A 3VH4B 2D9VA 3VUXA 3RZWC 3QWZB 4NQLB 4EEWA 2R09A 3RUIB 5DPTA 3KRXA 3EHVA 1D3ZA 3N3KB 2N9XA 4JKDA 3VH3B 2IY0B 3EPYA 2KJ6A 5LLIA 2VRRB 4WSFA 3V61A 1GGOA 4DXAB 4DDID 1JRUA 3Q3FA 2N1WA 3IG3A 2G3QB 1IP9A 4IWOA 2KLGA 4JL9A 3ODXA 3KUZA 3TJPA 3KW5B 4BKGA 3A9JA 1IYFA 1P1AA 4WWPA 1WGUA 2O2VB 5JLJB 3UF8A 1WF9A 3ZKJC 3PSEB 1HE8A 2ZPNA 2W2XC 3CF6E 1EF1A 3HM6X 4HXDA 1I42A 4HAXB 1UPQA 4ZRJA 1V81A 4A6HA 4M0WB 3AJ4A 2FAZA 3ZNZB 2KVRA 1XD4A 2GBJA 2QKLA 4DHZB 1WGGA 5JVLA 1V5PA 4BFRA 3KUCB 3PGEA 5DI9B 2GS0A 4K1RB 1R4NI 2O6VA 1QC6A 3SNHA 2DAFA 3DCGA 4HAVB 4KZ0A 1WJ1A 2D9ZA 4HCNB 4BBNF 3ALBA 4JK9A 2ROVA 4ILJA 4DK5A 2H7DA 3PVWA 1KI1B 3DXDA 4KVGB 1MK9B 2YF0A 3CMMB 2KANA 1BTNA 2R0DA 3F5RA 1L2NA 2JRIB 2I5FA 2BF8B 4DX90 4CHKA 5DIFB 2J7QB 1P9DU 3KY9A 3EC8A 2JT4B 2V3SA 3EECA 1HB8A 4MGZE 3T8MA 3A1QB 4EZLA 3S2AA 3PRMB 1BWNA 1X1MA 3GOEA 4FADA 2ZZPB 2EMSA 3OJ3A 2KJHB 3PTFC 2KK8A 1WXSA 5DCNA 4B6WA 2YS3A 1FHXA 2KGXB 4A6FB 4KHOA 2RGNB 2KFKB 2AYOB 5CTRC 3SDLC 3KYDD 4DBGA 5BO4B 3OJ4B 2O6VD 1WI1A 2O2VA 1WM2A 4LDTD 4WJPA 4P7IA 1N3HA 3O65B 5IA7A 4K2OA 1UELA 1NVLA 1WRDB 1KC7A 3ZRCA 2EC1A 4WWOA 1L7YA 2KC2A 3EFUA 1G6JA 4KHBB 3A9KA 4GN1A 5D3WA 1ZC3B 1KBLA 2L2IA 3SUZA 1SE9A 4BOSC 2CODA 2D9YA 2BKRB 3V60A 2COCA 3OAWA 1WGYA 4ZRIA 2DHZA 2LUEA 1WGQA 3ENEA 4MM3A 1QZEA 4PYUA 2L76A 2IO2B 2BWFA 3ECIA 1WE7A 4GPTB 3A4RA 2AL6A 3ZUNA 3SHQA 2N7EA 4IWQA 4GDLA 3UQAA 3DVNU 3WAMA 2G4SA 5JH5C 5LXIB 4NSWA 3AU5A 2DAJA 3DXCA 4HHVA 1DROA 2KQ7A 4EJNA 4NPNA 1AWEA 4TYZA 2KX3A 4MY6A 1FXTB 2DYBA 4W9GA 2DZJA 2MRPA 3NZUA 1Q67A 2YS1A 1DDMA 2FUHB 2XK5B 4G50A 4EMOA 3A1QA 2UVMA 1ISNA 3ZNGC 2KMCA 1MAIA 5C16A 4GMXB 2HJ8A 2NZ8B 2C7HA 2FCQA 4X57B 2MBHA 4J6IA 1I35A 3PSCA 2JUOA 4GOCA 1JDEA 4E71A 5D27A 2KFKA 2M4NA 3TFMA 2V4LA 1AARA 3A33B 1WX7A 4URKA 5DH9B 3UQBA 4DX8A 2COFA 3TO1A 4NAWA 2GMIC 1NTVA 5IAAC 3AU4A 3ZIMA 2KDBA 3DBHI 3KSYA 1R4MI 2B3AA 3JSVB 4E74A 1OTRB 4YL8A 3KVFB 3RYTA 4EKUA 2HRJA 1FOEA 1WJUA 5C1ZA 3KUDB 1KM7A 1U5DA 1M7RA 2LRUA 1X1FA 2WX1A 1K5GB 4JQWC 5L81A 3HW2B 4HATB 3A98B 3CIKA 3WALA 2L0TA 3L0WB 1BT0A 4NJ7A 2KDEB 3ZVVA 2IO0B 2NPTB 5L83A 3QHTA 4TKNA 2RNRB 1P5TA 3SU8X 1WY8A 1U4AA 2NBUA 2D4QA 4HJKA 4IG7B 1ACAA 3PEGA 2L05A 2LKOA 3L54A 2CRFA 5J3QA 4XC2A 2X0SA 2JZ3B 3X0WA 2K8CA 2VKIA 3LJ3A 3A9JB 2IO3B 2UWQA 2XK5A 1WGHA 2K6DB 1TGZB 1J19A 3B08A 4CO7A 3K9OB 4I6NB 2CR5A 4W9DA 2ZNVC 3H1UA 4ILHA 3ML8A 3W1SC 2CQUA 3AI5A 4NNJB 2DHIA 3HK0A 1EO6A 1ZGUB 1K8RB 1LB1A 4KHAA 2JWZA 1GNUA 2BYEA 4PS3A 2KX0A 1WJ4A 4MK0A 3CSTA 2DN6A 2Z59B 2GBNA 5EDSA 3FEHA 2N23A 1DYNA 2WYQA 1W1GA 5E6OA 3NZSA 3ZLZA 3QQ8B 4K7WA 3TIXA 2IO1B 2LVQA 3ZNID 1PFJA 2ELBA 2MDXA 4TQ0A 3KH0A 3X23A 4LDTB 3HIZA 4FA6A 2DFKA 2UZRA 5CX3A 4PQ0A 2G4DB 1VD2A 4YONA 4EUTA 3GYOA 3BJIA 3D32A 3MJWA 3NOBA 3OANA 1EVHA 3QAQA 4F7GA 4JGHB 1U5EA 2JF5A 3OLMD 3ML9A 5HKHA 2M0XA 2DKQA 3ZW3A 1UBQA 4HDOA 2I1JA 4WQOB 1J8CA 1J0WA 2LRWA 4HAWB 1WE6A 1UNPA 2NBWB 4LJOB 2HE7A 2Z0OA 2NPTA 4KIKA 4B9KA 2OOBB 1EAZA 4K17A 1WMHB 2HD5B 4TV3A 4MGKE 3TVVA 2GCJA 2M17A 3SBTA 1ZKHA 1MKEA 3V6EB 3M62B 2C7MB 1V5OA 3APFA 2LGXA 1GJZA 2HTHA 4PNKA 3VUWA 4IWPA 3HHMA 5G2NA 3V62A 3MHSD 3HQCA 3VVWB 5D3XA 5JHHA 3IVFA 1V86A 3TL5A 1FB8A 1FGYA 1VCBA 2KO3A 2KDIA 3R7QA 4HB0B 2RVBB 1UNRA 2LXCA 2P0HA 2D9XA 4GGQA 2CAYA 3VQIA 2KKCA 1U2BA 2KTRA 2NVUI 1WX9A 1XCGA 1PLSA 3B0AA 2D2QA 2VRWB 1RAXA 2AWTA 3TMPB 4K7UA 2ASQA 4EFOA 2CY5A 3A9KB 5C5BB 2K6QA 4F1SA 4IFSA 5HE0A 2NBVB 1WG7A 3DBRI 3ZNHB 1NDDA 1ZVRA 5IJMA 5J17A 1DDVA 2LZ6A 1Q5WB 3H7PA 3T9LA 2G35A 2KMAA 2BYVE 4D0NB 5JHAA 2PPHA 2N4FA 1E7UA 3PT2B 2P0DA 3QCAA 3QK0A 4GDLB 2PE9A 2W2XD 1V89A 3RULA 1H4RA 1XD3B 1UEFA 5CHVC 2MCNB 1P6SA 1RRPB 3WIMA 4BBKA 2LI5A 2P0FA 4ICUA 4JIOU 4JKAA 2MBQA 2L8JA 1YD8U 3TCAA 4FULA 3LJUX 1XQQA 3VUYA 4MDKE 2V76A 3M63B 3FSSA 3V6CB 1WMHA 1LW3A 3F0WA 4DHZE 1TZ1A 4A5KA 1NTIA 3DBLI 5CHWA 3NS8A 3KRWA 3A8PA 5JHGA 4ANXA 2KQSA 1C1YB 5CLLB 1V49A 2C9WB 1ZM0A 2C60A 5J3YA 4GU2A 4NY0A 3GYPA 3RZFA 2MKRA 1WM3A 2UYZB 2MWNB 4F7HA 2WDTB 4FHKA 3R66C 4BOZB 2OQBA 2CKHB 4NAWB 4WJOA 2JRHA 1V5MA 3ODOA 2DZKA 3N7CA 3E9OA 3PZDA 4ZYNA 1KOTA 1UZXB 3K9PB 4NQKE 2KNBA 3U7DA 5C5BA 1E8XA 2YT1A 1KLVA 4M8MA 2FCMA 5DHFB 3L13A 2OTXA 4GDKA 4W9EA 5KCVA 3WANA 2KFJA 4XZ4A 4K7SA 2BWES 4I6LB 2RR9A 3JYUA 1WX8A 2KWCA 3DPDA 3VXWA 4E3CA 2IYDB 4IC7B 1X05A 2LASA 3DXEA 2LXAA 4B95A 4G0NB 5G55A 3VFKA 4IM2A 1M7EA 2Y7BA 2OJRA 1FAOA 2BKFA 2G45B 4IAPA 3ULCA 4MJSB 2PZ1A 2K1FA 1E7VA 3QX1A 3PHWB 2CY4A 5FI0A 4JLCA 2REXA 3IBEA 2ZNVB 3JW0X 4JKFA 5KHQA 2GCLA 5C6RA 1WFYA 3N32A 1BAKA 1KZGA 1NI2A 2R82A 4N9F4 2DA0A 1P0RA 1Y19B 1P3QU 1Z2MA 2KZRA 2ELAA 1Y8RC 2KUPA 2QHOA 3M95A 1Z5SB 1WGDA 3U30A 5KQ4A 4HB4B 3WA0A 3SYXA 4HLEA 4Z2NA 5CLQB 1H8CA 4A3OA 4Z2MB 4WJQA 3PRZA 2ROZB 3N30A 2KC1A 5E6PA 5HE3A 3VDZA 1AQCA 1GG3A 3MDBC 3QC8B 1C3TA 3DVGY 4ZDVA 5J18A 2DX5A 2MA9B 1M94A 2CHZA 2YS5A 5C23A 1V5TA 2D07B 4BVUC 3DBSA 2ZPYA 3PP2A 1ZW7A 4A6KA 4KDIC 1UNQA 1DBHA 2PEAA 4JKCA 1OMWA 1WZ3A 3AXCA 2GBKA 2E2XA 1V9JA 1H10A 4GB9A 2VSZA 4MGYE 2M8SA 1WIAA 2RD0A 2BPSA 1I7AA 1HBKA 4KAXB 3H6NA 3O96A 2KJRA 5D3YA 4W9FA 3PLVA 2LVPA 2N9PC 4KIKB 2YLMA 5D7GA 1NBFC 3M3JA 2FCSA 2EKEC 4AJWA 1B55A 4JKBA 3WAPA 2LG1A 2A4ZA 2YVCA 4MJSA 2LD9A 2HTHB 2N1VA 4CHJA 1BTKA 2BGFA 3W1SA 4OVUA 2M1MA 4BKTA 3QARA 2J0MA 2R2OA 5HE1A 1WXAA 1UPRA 1UGMA 2V1YA 2LYDA 2KOXA 2XQNM 2DTCA 4HAYB 4W9JA 3GZNI 2LWPA 4WWNA 3W1YA 2YRYA 3UGBB 2LVOA 1WXVA 4CHMA 4L6EA 2KTRB 4FLHA 4M8NA 3QA8A 4JKGB 2RSGA 1UD7A 3UZTA 3MTNB 3ZTDA 2MLBA 3PHXB 2NR2A 3VIAA 3APDA 2I5CA 4GXBA 1WGRA 2IY1B 4FJYA 1WJMA 2D10A 2DYNA 4I6PA 2AEHA 3H7PB 1U5FA 1GC7A 2K39A 2MP2B 1IPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADZ A;  4HB3 B;  4B6H A;  2IZV B;  3L08 A;  2D9W A;  1XT9 B;  1P3R A;  2DYQ A;  2MQJ A;  2IFS A;  2YSZ A;  4IOY X;  1MPH A;  1NU2 A;  1E8Z A;  2KD0 A;  2LUL A;  4GZU A;  3PRE A;  2RLO A;  1S3S G;  1P98 A;  1MIZ B;  4XX5 A;  1E5W A;  4XWX A;  1GC6 A;  3FLV A;  5J2R A;  3BIN A;  5HE2 A;  1U27 A;  1W1D A;  4OVV A;  4IW0 A;  1EGX A;  1T0Y A;  4KZC A;  3NY5 A;  4HVB A;  1V2Y A;  1WXM A;  2GOW A;  4A3P A;  5LON B;  3UIP B;  4Y94 A;  2WX0 A;  4EZJ A;  1UH6 A;  3DVN V;  4W9C A;  4HDQ A;  4W9K A;  2DZM A;  5CHF A;  3ODW A;  3BY4 B;  5FI1 A;  5LXH A;  3A4S C;  4AOF A;  1YJ1 A;  3R3M A;  2GBM A;  2MBE A;  1ST7 A;  3FM8 C;  3D8F A;  2JXX A;  1MIX A;  1LM8 B;  2L7R A;  5D94 A;  1X1G A;  2XEW A;  1RRB A;  1GUA B;  4CYE A;  1XOD A;  3VAW A;  1SHC A;  4IUM B;  5DPW A;  2L1C A;  4FJZ A;  3C0R B;  2FID A;  4DWF A;  3PG7 A;  3M1I B;  1MK7 B;  1ZC4 B;  4WJN A;  4W9L A;  4AUQ C;  5FR6 A;  2Z0D B;  3TBL D;  1KZ7 A;  2K2J A;  1OQN A;  4GDK B;  1WR1 A;  2MBB B;  3JVZ X;  1V61 A;  1IRS A;  5AZF A;  2K2U A;  2DYO A;  2MP2 A;  3ZRF A;  2ZVO A;  1QQG A;  2DEN B;  3WYF B;  2JY6 A;  2C7N B;  4ICV A;  3WAO A;  4BBN C;  2YT0 A;  5DPS A;  4ANW A;  2W9N A;  4MGI E;  3ULB A;  4IM3 A;  5L95 C;  5J3T A;  4W9I A;  2KN5 A;  1W1H A;  3H7S A;  1WYW B;  5JHB A;  1LXD A;  2N0Y A;  3TW1 A;  2AL3 A;  2DKP A;  2Z0P A;  4HB2 B;  4TUU A;  4NJ6 A;  4DBB A;  1V80 A;  2CHW A;  2CHX A;  2P8V A;  2EMT A;  3NHE B;  3A8Q A;  2ZCC A;  1SGH A;  2MW5 A;  3RD2 A;  2BYF A;  3P2B A;  4BKS A;  4DHJ D;  2KCJ A;  1X11 A;  1KJT A;  2X18 A;  3IFW B;  4C0A A;  4A20 A;  3RT3 B;  2J0J A;  3T06 A;  4WJ7 A;  2J59 M;  4AP4 C;  3DDC B;  3P6A A;  4KSL C;  2H7E A;  4PS8 A;  2NS5 A;  1FHW A;  3PRP B;  2CS4 A;  1OQY A;  1WI0 A;  1YX6 B;  2J0K A;  2DLW A;  2KDF B;  2JPH A;  3U8Z A;  4HWI B;  1XX0 A;  2LJ5 A;  3FP5 A;  2WWZ A;  1CMX B;  1V5U A;  5D2M B;  4ANV A;  2KXJ A;  1WJN A;  4LCD E;  2BCJ A;  5KQ1 A;  4LJP B;  1TBE A;  1V88 A;  5E6N A;  2DX5 B;  1J0G A;  2RUK B;  2MX2 A;  3APC A;  2FDQ A;  3RCP A;  2XBB C;  2MFQ A;  2K8H A;  2K25 A;  1PQS A;  2MSE D;  4F7U P;  5C79 A;  1WJ6 A;  3HM3 A;  2DZI A;  3VTW A;  4RM8 A;  4FBJ B;  1XR0 B;  1Z87 A;  4EZK A;  3ZDT A;  1WVH A;  1U5G A;  4BKS D;  2R2Q A;  4RMA A;  3PV1 A;  1Q0W B;  4MSM B;  1E8W A;  4IM0 A;  4K81 A;  1X86 A;  4GSW A;  2C5L C;  2NCN A;  2KHW B;  3VTU A;  2JVC A;  4G11 A;  1ZSQ A;  1EUV B;  2Y8G A;  5DHA B;  2Y5B B;  2EJ8 A;  1RJ2 A;  1TTN A;  1Q1O A;  3QIJ A;  3L17 A;  4PS7 A;  2A5U A;  3G9W A;  1FHO A;  3B1L X;  2ABD A;  4F8C B;  2UZS A;  2COA A;  3QWM A;  1LQB A;  2FCN A;  3VOQ A;  2DYM A;  1RLF A;  1XKE A;  3UIN B;  2JP2 A;  3D8E A;  2FJ9 A;  4MEL A;  4AWJ A;  4II3 B;  1WR6 E;  2L3Z A;  2K00 A;  2IBI B;  2M14 A;  2NMB A;  3QBV B;  2Q13 A;  1V6E A;  2KWU B;  4KDL B;  1S1Q B;  2W2W A;  2DHJ A;  4G3X B;  4F7Z A;  1Y5O A;  3PS6 A;  4A6F A;  2PJH A;  2FNJ B;  5AZH A;  1LFD A;  1HB6 A;  5JP4 A;  3AUL A;  4HAU B;  5DPR A;  2M38 A;  5GMV A;  3NSU A;  1YX5 B;  2RSU A;  3L10 B;  2KLC A;  3R7R A;  2COP A;  4PYZ A;  1SIF A;  3CSF A;  2LBB A;  5AEK B;  4WVF B;  4GMV A;  4WAA A;  4II2 B;  2Y8F A;  3MPX A;  4HPM B;  1YQB A;  3PVL A;  4AJY B;  2N9E B;  3ZTC A;  3SV1 A;  3ML4 A;  2D3G A;  2Z0Q A;  3DVG X;  2CU1 A;  4K2P A;  2RQ1 A;  1UBI A;  1MG8 A;  4FN2 A;  3QJZ A;  4ASW C;  2K8B A;  2GJY A;  4MEM A;  1F9J A;  2L0F A;  2D11 A;  2JZZ A;  2Z0E B;  3UIO B;  2LOX A;  2GBR A;  4RM9 A;  4DDG D;  2QKM A;  4EOY A;  2ZJD A;  2MBO A;  3PVU A;  2KWV B;  5GOW B;  1TQZ A;  1OGW A;  1E90 A;  4KSK C;  4MSQ B;  2PE6 B;  4TQ1 A;  3V5W A;  5KHO A;  4GIV A;  5D6J B;  2RPQ A;  2L00 B;  1NTY A;  3PLU A;  3KYC D;  2ZVN A;  5EFX A;  3LDZ E;  4KV2 A;  3ZO5 B;  1DDW A;  5AZG A;  5LOP B;  3SD5 A;  1A5R A;  1FGZ A;  2MWS B;  2CB8 A;  2FIF A;  4FJV B;  2DHK A;  5JZE B;  3H9D A;  3L16 A;  4DHJ B;  3P7Z A;  2KTF A;  4HCP B;  3VTV A;  3DQV A;  3IHP C;  4MH0 E;  2ZCB A;  3VHT C;  2N7D A;  4HAZ B;  1WZ0 A;  3ZDM C;  4ZRK A;  4FHJ A;  1RFA A;  5D3V A;  2IYB A;  1TJ6 A;  4MT7 A;  3CXB B;  1OEY A;  4ANU A;  5TR5 A;  2LGY A;  3I3T B;  4W9H A;  2WH5 A;  1I2H A;  3RCZ A;  3SO6 A;  3JSV A;  1PMS A;  2FJL A;  2O6V B;  2RGF A;  1EF5 A;  3ONS A;  3ZVR A;  2I1K A;  1YIW A;  3PPA A;  2LGD A;  1U29 A;  3Q3J A;  3DOW A;  1OEY J;  4HK2 A;  1K5D B;  2LOZ A;  1TXD A;  1OY2 A;  4H8S A;  2DX1 A;  4HPL B;  2ZEQ A;  3D8D A;  1WH3 A;  1E8Y A;  3KZ1 A;  3VH4 B;  2D9V A;  3VUX A;  3RZW C;  3QWZ B;  4NQL B;  4EEW A;  2R09 A;  3RUI B;  5DPT A;  3KRX A;  3EHV A;  1D3Z A;  3N3K B;  2N9X A;  3VH3 B;  2IY0 B;  3EPY A;  2KJ6 A;  5LLI A;  2VRR B;  4WSF A;  3V61 A;  4DXA B;  4DDI D;  1JRU A;  3Q3F A;  2N1W A;  3IG3 A;  2G3Q B;  1IP9 A;  4IWO A;  2KLG A;  4JL9 A;  3ODX A;  3KUZ A;  3TJP A;  3KW5 B;  4BKG A;  3A9J A;  1IYF A;  1P1A A;  4WWP A;  1WGU A;  2O2V B;  5JLJ B;  3UF8 A;  1WF9 A;  3ZKJ C;  3PSE B;  1HE8 A;  2ZPN A;  2W2X C;  3CF6 E;  1EF1 A;  3HM6 X;  4HXD A;  1I42 A;  4HAX B;  1UPQ A;  4ZRJ A;  1V81 A;  4A6H A;  4M0W B;  3AJ4 A;  2FAZ A;  3ZNZ B;  2KVR A;  1XD4 A;  2GBJ A;  2QKL A;  4DHZ B;  1WGG A;  1V5P A;  4BFR A;  3KUC B;  3PGE A;  5DI9 B;  2GS0 A;  4K1R B;  1R4N I;  2O6V A;  1QC6 A;  3SNH A;  2DAF A;  3DCG A;  4HAV B;  4KZ0 A;  1WJ1 A;  2D9Z A;  4HCN B;  4BBN F;  3ALB A;  2ROV A;  4DK5 A;  2H7D A;  3PVW A;  1KI1 B;  3DXD A;  4KVG B;  1MK9 B;  2YF0 A;  3CMM B;  2KAN A;  1BTN A;  2R0D A;  3F5R A;  1L2N A;  2JRI B;  2I5F A;  2BF8 B;  4DX9 0;  4CHK A;  5DIF B;  2J7Q B;  1P9D U;  3KY9 A;  3EC8 A;  2JT4 B;  2V3S A;  3EEC A;  1HB8 A;  4MGZ E;  3T8M A;  3A1Q B;  4EZL A;  3S2A A;  3PRM B;  1BWN A;  1X1M A;  3GOE A;  4FAD A;  2ZZP B;  2EMS A;  3OJ3 A;  2KJH B;  3PTF C;  2KK8 A;  1WXS A;  5DCN A;  4B6W A;  2YS3 A;  1FHX A;  2KGX B;  4A6F B;  4KHO A;  2RGN B;  2KFK B;  2AYO B;  5CTR C;  3SDL C;  3KYD D;  4DBG A;  5BO4 B;  3OJ4 B;  2O6V D;  1WI1 A;  2O2V A;  1WM2 A;  4LDT D;  4WJP A;  4P7I A;  1N3H A;  3O65 B;  5IA7 A;  4K2O A;  1UEL A;  1NVL A;  1WRD B;  3ZRC A;  2EC1 A;  4WWO A;  1L7Y A;  2KC2 A;  3EFU A;  1G6J A;  4KHB B;  3A9K A;  4GN1 A;  5D3W A;  1ZC3 B;  2L2I A;  3SUZ A;  1SE9 A;  4BOS C;  2COD A;  2D9Y A;  2BKR B;  3V60 A;  2COC A;  3OAW A;  1WGY A;  4ZRI A;  2DHZ A;  2LUE A;  1WGQ A;  3ENE A;  4MM3 A;  1QZE A;  4PYU A;  2L76 A;  2IO2 B;  2BWF A;  3ECI A;  1WE7 A;  4GPT B;  3A4R A;  2AL6 A;  3ZUN A;  3SHQ A;  2N7E A;  4IWQ A;  4GDL A;  3UQA A;  3DVN U;  3WAM A;  2G4S A;  5JH5 C;  5LXI B;  4NSW A;  3AU5 A;  2DAJ A;  3DXC A;  4HHV A;  1DRO A;  2KQ7 A;  4EJN A;  4NPN A;  1AWE A;  4TYZ A;  2KX3 A;  4MY6 A;  1FXT B;  2DYB A;  4W9G A;  2DZJ A;  2MRP A;  3NZU A;  1Q67 A;  2YS1 A;  1DDM A;  2FUH B;  2XK5 B;  4G50 A;  4EMO A;  3A1Q A;  2UVM A;  1ISN A;  3ZNG C;  2KMC A;  1MAI A;  5C16 A;  4GMX B;  2HJ8 A;  2NZ8 B;  2C7H A;  2FCQ A;  4X57 B;  2MBH A;  4J6I A;  1I35 A;  3PSC A;  2JUO A;  4GOC A;  4E71 A;  5D27 A;  2KFK A;  2M4N A;  3TFM A;  2V4L A;  1AAR A;  3A33 B;  1WX7 A;  4URK A;  5DH9 B;  3UQB A;  4DX8 A;  2COF A;  3TO1 A;  4NAW A;  2GMI C;  1NTV A;  5IAA C;  3AU4 A;  3ZIM A;  2KDB A;  3DBH I;  3KSY A;  1R4M I;  2B3A A;  3JSV B;  4E74 A;  1OTR B;  4YL8 A;  3KVF B;  3RYT A;  4EKU A;  2HRJ A;  1FOE A;  1WJU A;  5C1Z A;  3KUD B;  1KM7 A;  1U5D A;  1M7R A;  2LRU A;  1X1F A;  2WX1 A;  1K5G B;  4JQW C;  5L81 A;  3HW2 B;  4HAT B;  3A98 B;  3CIK A;  3WAL A;  2L0T A;  3L0W B;  1BT0 A;  4NJ7 A;  2KDE B;  3ZVV A;  2IO0 B;  2NPT B;  5L83 A;  3QHT A;  2RNR B;  4TKN A;  1P5T A;  3SU8 X;  1WY8 A;  1U4A A;  2NBU A;  2D4Q A;  4HJK A;  4IG7 B;  1ACA A;  3PEG A;  2L05 A;  2LKO A;  3L54 A;  2CRF A;  5J3Q A;  4XC2 A;  2JZ3 B;  3X0W A;  2K8C A;  2VKI A;  3LJ3 A;  3A9J B;  2IO3 B;  2UWQ A;  2XK5 A;  1WGH A;  2K6D B;  1TGZ B;  1J19 A;  3B08 A;  4CO7 A;  3K9O B;  4I6N B;  2CR5 A;  4W9D A;  2ZNV C;  3H1U A;  3ML8 A;  3W1S C;  2CQU A;  3AI5 A;  4NNJ B;  2DHI A;  3HK0 A;  1EO6 A;  1ZGU B;  1K8R B;  1LB1 A;  4KHA A;  2JWZ A;  1GNU A;  2BYE A;  4PS3 A;  2KX0 A;  1WJ4 A;  4MK0 A;  3CST A;  2DN6 A;  2Z59 B;  2GBN A;  5EDS A;  3FEH A;  2N23 A;  1DYN A;  2WYQ A;  1W1G A;  5E6O A;  3NZS A;  3ZLZ A;  3QQ8 B;  4K7W A;  3TIX A;  2IO1 B;  2LVQ A;  3ZNI D;  1PFJ A;  2ELB A;  2MDX A;  4TQ0 A;  3KH0 A;  3X23 A;  4LDT B;  3HIZ A;  4FA6 A;  2DFK A;  2UZR A;  5CX3 A;  4PQ0 A;  2G4D B;  1VD2 A;  4YON A;  4EUT A;  3GYO A;  3BJI A;  3D32 A;  3MJW A;  3NOB A;  3OAN A;  1EVH A;  3QAQ A;  4F7G A;  4JGH B;  1U5E A;  2JF5 A;  3OLM D;  3ML9 A;  5HKH A;  2M0X A;  2DKQ A;  3ZW3 A;  1UBQ A;  4HDO A;  2I1J A;  4WQO B;  1J8C A;  1J0W A;  2LRW A;  4HAW B;  1WE6 A;  1UNP A;  2NBW B;  4LJO B;  2HE7 A;  2Z0O A;  2NPT A;  4KIK A;  4B9K A;  2OOB B;  1EAZ A;  4K17 A;  1WMH B;  2HD5 B;  4TV3 A;  4MGK E;  3TVV A;  2GCJ A;  2M17 A;  1ZKH A;  1MKE A;  3V6E B;  3M62 B;  2C7M B;  1V5O A;  3APF A;  2LGX A;  1GJZ A;  2HTH A;  4PNK A;  3VUW A;  4IWP A;  3HHM A;  5G2N A;  3V62 A;  3MHS D;  3HQC A;  3VVW B;  5D3X A;  5JHH A;  3IVF A;  1V86 A;  3TL5 A;  1FB8 A;  1FGY A;  1VCB A;  2KO3 A;  2KDI A;  3R7Q A;  4HB0 B;  2RVB B;  1UNR A;  2LXC A;  2P0H A;  2D9X A;  4GGQ A;  2CAY A;  3VQI A;  2KKC A;  1U2B A;  2KTR A;  2NVU I;  1WX9 A;  1XCG A;  1PLS A;  3B0A A;  2D2Q A;  2VRW B;  1RAX A;  2AWT A;  3TMP B;  4K7U A;  2ASQ A;  4EFO A;  2CY5 A;  3A9K B;  5C5B B;  2K6Q A;  4F1S A;  4IFS A;  5HE0 A;  2NBV B;  1WG7 A;  3DBR I;  3ZNH B;  1NDD A;  1ZVR A;  5IJM A;  5J17 A;  1DDV A;  2LZ6 A;  1Q5W B;  3H7P A;  3T9L A;  2G35 A;  2KMA A;  2BYV E;  4D0N B;  5JHA A;  2PPH A;  2N4F A;  1E7U A;  3PT2 B;  2P0D A;  3QCA A;  3QK0 A;  4GDL B;  2PE9 A;  2W2X D;  1V89 A;  3RUL A;  1H4R A;  1XD3 B;  1UEF A;  5CHV C;  2MCN B;  1P6S A;  1RRP B;  3WIM A;  4BBK A;  2LI5 A;  2P0F A;  4ICU A;  4JIO U;  2MBQ A;  2L8J A;  1YD8 U;  3TCA A;  4FUL A;  3LJU X;  1XQQ A;  3VUY A;  4MDK E;  2V76 A;  3M63 B;  3FSS A;  3V6C B;  1WMH A;  1LW3 A;  3F0W A;  4DHZ E;  1TZ1 A;  4A5K A;  1NTI A;  3DBL I;  5CHW A;  3NS8 A;  3KRW A;  3A8P A;  5JHG A;  4ANX A;  2KQS A;  1C1Y B;  5CLL B;  1V49 A;  2C9W B;  1ZM0 A;  2C60 A;  5J3Y A;  4GU2 A;  4NY0 A;  3GYP A;  3RZF A;  2MKR A;  1WM3 A;  2UYZ B;  2MWN B;  4F7H A;  2WDT B;  4FHK A;  3R66 C;  4BOZ B;  2OQB A;  2CKH B;  4NAW B;  4WJO A;  2JRH A;  1V5M A;  3ODO A;  2DZK A;  3N7C A;  3PZD A;  4ZYN A;  1KOT A;  1UZX B;  3K9P B;  4NQK E;  2KNB A;  3U7D A;  5C5B A;  1E8X A;  2YT1 A;  1KLV A;  4M8M A;  2FCM A;  5DHF B;  3L13 A;  2OTX A;  4GDK A;  4W9E A;  5KCV A;  3WAN A;  2KFJ A;  4XZ4 A;  4K7S A;  2BWE S;  4I6L B;  2RR9 A;  3JYU A;  1WX8 A;  2KWC A;  3DPD A;  3VXW A;  4E3C A;  2IYD B;  4IC7 B;  1X05 A;  2LAS A;  3DXE A;  2LXA A;  4B95 A;  4G0N B;  5G55 A;  3VFK A;  4IM2 A;  1M7E A;  2Y7B A;  2OJR A;  1FAO A;  2BKF A;  2G45 B;  4IAP A;  3ULC A;  4MJS B;  2PZ1 A;  2K1F A;  1E7V A;  3QX1 A;  3PHW B;  2CY4 A;  5FI0 A;  4JLC A;  2REX A;  3IBE A;  2ZNV B;  3JW0 X;  5KHQ A;  2GCL A;  5C6R A;  1WFY A;  3N32 A;  1BAK A;  1KZG A;  1NI2 A;  4N9F 4;  2DA0 A;  1P0R A;  1Y19 B;  1P3Q U;  1Z2M A;  2KZR A;  2ELA A;  1Y8R C;  2KUP A;  2QHO A;  3M95 A;  1Z5S B;  1WGD A;  3U30 A;  5KQ4 A;  4HB4 B;  3WA0 A;  3SYX A;  4HLE A;  4Z2N A;  5CLQ B;  1H8C A;  4A3O A;  4Z2M B;  4WJQ A;  3PRZ A;  2ROZ B;  3N30 A;  2KC1 A;  5E6P A;  5HE3 A;  3VDZ A;  1AQC A;  1GG3 A;  3MDB C;  3QC8 B;  1C3T A;  3DVG Y;  4ZDV A;  5J18 A;  2DX5 A;  2MA9 B;  1M94 A;  2CHZ A;  2YS5 A;  5C23 A;  1V5T A;  2D07 B;  4BVU C;  3DBS A;  2ZPY A;  3PP2 A;  1ZW7 A;  4A6K A;  4KDI C;  1UNQ A;  1DBH A;  2PEA A;  1OMW A;  1WZ3 A;  3AXC A;  2GBK A;  2E2X A;  1V9J A;  1H10 A;  4GB9 A;  2VSZ A;  4MGY E;  2M8S A;  1WIA A;  2RD0 A;  2BPS A;  1I7A A;  1HBK A;  4KAX B;  3H6N A;  3O96 A;  2KJR A;  5D3Y A;  4W9F A;  3PLV A;  2LVP A;  2N9P C;  4KIK B;  2YLM A;  5D7G A;  1NBF C;  3M3J A;  2FCS A;  2EKE C;  4AJW A;  1B55 A;  3WAP A;  2LG1 A;  2A4Z A;  2YVC A;  4MJS A;  2LD9 A;  2HTH B;  2N1V A;  4CHJ A;  1BTK A;  2BGF A;  3W1S A;  4OVU A;  2M1M A;  4BKT A;  3QAR A;  2J0M A;  2R2O A;  5HE1 A;  1WXA A;  1UPR A;  1UGM A;  2V1Y A;  2LYD A;  2KOX A;  2XQN M;  2DTC A;  4HAY B;  4W9J A;  3GZN I;  2LWP A;  4WWN A;  3W1Y A;  2YRY A;  3UGB B;  2LVO A;  1WXV A;  4CHM A;  4L6E A;  2KTR B;  4FLH A;  4M8N A;  3QA8 A;  2RSG A;  1UD7 A;  3UZT A;  3MTN B;  3ZTD A;  2MLB A;  3PHX B;  2NR2 A;  3VIA A;  3APD A;  2I5C A;  4GXB A;  1WGR A;  2IY1 B;  4FJY A;  1WJM A;  2D10 A;  2DYN A;  4I6P A;  2AEH A;  3H7P B;  1U5F A;  1GC7 A;  2K39 A;  2MP2 B;  1IPG A; 
#chains in the Genus database with same CATH topology
 2BS4 B;  1SJH D;  1ZXH A;  2ADZ A;  1KLU D;  2INC C;  4HB3 B;  4B6H A;  2IZV B;  1FCL A;  3L08 A;  2D9W A;  1XT9 B;  1P3R A;  2DYQ A;  1C78 A;  2PTL A;  2MQJ A;  2LGS A;  2IFS A;  2YSZ A;  4IOY X;  1MPH A;  2INN E;  1NU2 A;  1E8Z A;  2KD0 A;  2LUL A;  1F1H A;  4GZU A;  2RDG A;  3PRE A;  5AUI A;  1VBG A;  2RLO A;  4FXC A;  1S3S G;  4EE2 A;  1P98 A;  1MIZ B;  4XX5 A;  1E5W A;  4XWX A;  5D3I B;  1GC6 A;  3ZXV A;  3FLV A;  5J2R A;  2KDM A;  2JSV X;  2E3T A;  3IT6 B;  4O1N A;  1MHH E;  3BIN A;  5HE2 A;  1U27 A;  1W1D A;  1FFV A;  3PO0 A;  4OVV A;  4IW0 A;  2MJD A;  1EGX A;  1T0Y A;  3SEB A;  4KZC A;  2IDY A;  3NY5 A;  4HVB A;  1V2Y A;  4REZ A;  1GB1 A;  1T0R C;  1WXM A;  2GOW A;  1UUP A;  4A3P A;  5LON B;  2WXJ A;  3UIP B;  4Y94 A;  1ZDX A;  5D3D A;  2WX0 A;  4EZJ A;  1TS2 A;  1UH6 A;  3FKY A;  3DVN V;  3LYY A;  4W9C A;  3PZ7 A;  4HDQ A;  4W9K A;  2DZM A;  5CHF A;  2GI9 A;  1KFY B;  3AE3 B;  3ODW A;  4OSN A;  3BY4 B;  4YSZ B;  2LHD A;  5FI1 A;  4RGM A;  3FAH A;  1XLQ A;  5LXH A;  3A4S C;  4AOF A;  1YJ1 A;  2BS3 B;  2DBY A;  3R3M A;  2JYT A;  3ENB A;  2GUM A;  2GBM A;  2K9X A;  1RM6 C;  2MBE A;  1T6B X;  1ST7 A;  3FM8 C;  3D8F A;  2JXX A;  1MIX A;  1LM8 B;  3EA6 A;  2L7R A;  5D94 A;  2BB5 A;  1X1G A;  2XEW A;  1P7E A;  1GUA B;  1RRB A;  4CYE A;  3DHI C;  5GXG B;  2GRI A;  2WXQ A;  2QSD A;  1KTK A;  5C2T B;  1XOD A;  4JKG A;  3VAW A;  3TUO A;  1SHC A;  2DLB A;  4IUM B;  4MT5 A;  5HHD G;  1JRP A;  5DPW A;  1TJE A;  2L1C A;  4FJZ A;  3C0R B;  4C7Y A;  2FID A;  4DWF A;  3PG7 A;  3M1I B;  4YXD B;  4ILG B;  1MK7 B;  1ZC4 B;  4WJN A;  4W9L A;  4AUQ C;  4B0E A;  5FR6 A;  2Z0D B;  1V1P B;  1R7S A;  3TBL D;  1KZ7 A;  2K2J A;  4JPS A;  1HA5 A;  4K3C A;  1OQN A;  4GDK B;  1WR1 A;  2WQY B;  2EKI A;  4JKE A;  2MBB B;  3JVZ X;  1V61 A;  4RH6 A;  1IRS A;  3ZGZ A;  5AZF A;  2Z4D A;  1MI0 A;  2K2U A;  4R3D A;  1YJJ A;  2DYO A;  2MP2 A;  3Q6B A;  3ZRF A;  2DWQ A;  1IGD A;  4YSY B;  2ZVO A;  1QQG A;  2DEN B;  3WYF B;  2JY6 A;  2K49 A;  2C7N B;  3Q69 A;  4ICV A;  2QEJ C;  3Q2A C;  3WAO A;  4BBN C;  2YT0 A;  1VRA B;  1VJK A;  1JAL A;  5DPS A;  4ANW A;  2W9N A;  4MGI E;  3ULB A;  1P7F A;  4IM3 A;  5L95 C;  5J3T A;  4W9I A;  2KN5 A;  1W1H A;  1OQQ A;  2N9L A;  3H7S A;  1WYW B;  3KQ4 A;  2AQ1 B;  5EE3 A;  5JHB A;  1STE A;  1QOB A;  1LXD A;  2J42 A;  2N0Y A;  3TW1 A;  2AL3 A;  2DKP A;  3SBG A;  2Z0P A;  1J7C A;  2DIK A;  4HB2 B;  4TUU A;  4NJ6 A;  4A8X C;  4DBB A;  2V3N A;  3N1Y C;  2V4I B;  1V80 A;  2CHW A;  2CHX A;  2P8V A;  2EMT A;  3NHE B;  3A8Q A;  4JK7 A;  2ZCC A;  3I5J C;  1E7P B;  1SGH A;  2MW5 A;  3RD2 A;  2BYF A;  3P2B A;  1N61 A;  4BKS A;  4DHJ D;  2KCJ A;  4Q2J A;  1X11 A;  1KJT A;  2X18 A;  3IFW B;  4C0A A;  4A20 A;  3RT3 B;  4OZA A;  2J0J A;  3T06 A;  1FMA D;  4WJ7 A;  1FCC C;  2J59 M;  4AP4 C;  3HIE A;  1EWY C;  2WS3 B;  4LNF A;  4RF0 A;  3DDC B;  3P6A A;  2H7E A;  4KSL C;  1DIK A;  2NS5 A;  1FHW A;  4PS8 A;  1JRO A;  3PRP B;  3AB5 A;  5E6J A;  1M4V A;  2CS4 A;  1OQY A;  1WI0 A;  2ON8 A;  1YX6 B;  1F0Z A;  2J0K A;  2DLW A;  1EU4 A;  2KDF B;  2JPH A;  3U8Z A;  4HWI B;  3ZXR A;  1XX0 A;  1FM0 D;  3AEC B;  5EE1 A;  2LJ5 A;  3FP5 A;  2WWZ A;  1CMX B;  1V5U A;  5D2M B;  4ANV A;  2KXJ A;  1WJN A;  4LCD E;  2BCJ A;  5KQ1 A;  4LJP B;  1TBE A;  3Q3O C;  1V88 A;  4QXA B;  4XWW A;  5E6N A;  4JWU C;  3IT4 B;  2DX5 B;  1J0G A;  1YQ3 B;  2RUK B;  2MX2 A;  3P42 A;  1HTQ A;  3APC A;  2FDQ A;  3RCP A;  4DIX A;  2MFQ A;  2XBB C;  2K8H A;  2K25 A;  1PQS A;  2MSE D;  4F7U P;  5C79 A;  1WJ6 A;  3T3N A;  3HM3 A;  1V1P A;  2DZI A;  3VTW A;  1MJD A;  1HEZ E;  2AQ2 B;  2WP9 B;  4RM8 A;  4FBJ B;  2Z13 A;  2MH7 A;  2Q5W D;  2XN9 C;  1XR0 B;  1Z87 A;  4EZK A;  3ZDT A;  1WVH A;  1U5G A;  4BKS D;  2R2Q A;  1CZP A;  3RPF C;  4RMA A;  3PV1 A;  1Q0W B;  4MSM B;  1IBX B;  1E8W A;  4IM0 A;  5IO9 A;  3R8B A;  4K81 A;  1NEK B;  5I4D A;  2OED A;  1X86 A;  2N7J A;  1XF5 L;  3T3O A;  2QMT A;  4GSW A;  2C5L C;  1PFD A;  2NCN A;  2XNA C;  2KHW B;  1RWS A;  3VTU A;  2JVC A;  4G11 A;  2H89 B;  1ZSQ A;  1EUV B;  2Y8G A;  5DHA B;  4HEA 1;  2Y5B B;  2EJ8 A;  2PVO D;  2LFI A;  1RJ2 A;  1TTN A;  2K3U A;  1C4P A;  3RNC C;  3DBH B;  1Q1O A;  1ROE A;  3Q14 C;  2X38 A;  3QIJ A;  3L17 A;  4PS7 A;  2A5U A;  3G9W A;  2KYW A;  2KR0 A;  1FHO A;  3B1L X;  2ABD A;  1NYQ A;  4USA A;  4F8C B;  2UZS A;  2COA A;  3QWM A;  1LQB A;  3Q8F A;  5BYR A;  1GB4 A;  2FCN A;  3VOQ A;  2DYM A;  3AV8 A;  2X8X X;  1RLF A;  1XKE A;  2QCZ A;  3UIN B;  1C4A A;  2JP2 A;  1D5Z C;  3E9P A;  3D8E A;  2FJ9 A;  4MEL A;  4AWJ A;  4II3 B;  1WR6 E;  2L3Z A;  2K00 A;  2IBI B;  2M14 A;  3BVG A;  3AEA B;  2NMB A;  2KWU B;  3QBV B;  2Q13 A;  1V6E A;  4KDL B;  1S1Q B;  2MHJ A;  4JK8 A;  2BTE A;  2W2W A;  4JKH A;  1JWB D;  3GB1 A;  2DHJ A;  4G3X B;  4GLS C;  3ZQ4 A;  4F7Z A;  3C19 A;  1Y5O A;  3PS6 A;  4KGR A;  4A6F A;  5BMG A;  2PJH A;  2FNJ B;  5AZH A;  1V1O A;  2E6X A;  1LFD A;  3KLS X;  1HB6 A;  2N9K A;  5JP4 A;  4AS1 A;  2JQR B;  3AUL A;  3OG5 A;  4HAU B;  5DPR A;  3E66 A;  2M38 A;  1YMH E;  2YT2 A;  5GMV A;  3NSU A;  1YX5 B;  4HKZ E;  4YTN B;  2RSU A;  3L10 B;  2KLC A;  3R7R A;  2COP A;  4PYZ A;  4IOI E;  2ZKM X;  1SIF A;  3CSF A;  2LBB A;  5AEK B;  4WVF B;  4GMV A;  4WAA A;  4II2 B;  2Y8F A;  3MPX A;  4HPM B;  1YQB A;  2PVG C;  3V05 A;  3PVL A;  4GNK B;  1UNS A;  4KHB A;  4AJY B;  2N9E B;  3ZTC A;  2Y5P A;  3SV1 A;  3ML4 A;  1TY2 A;  2D3G A;  5G5H A;  2Z0Q A;  3DVG X;  2CU1 A;  2WXF A;  4K2P A;  2RQ1 A;  3E9L A;  1FXA A;  1IBX A;  1UBI A;  3I57 A;  1MG8 A;  5BMH A;  4FN2 A;  3QJZ A;  2NTT A;  4ASW C;  2K8B A;  2GJY A;  4MEM A;  3U2S C;  1F9J A;  1D5M C;  2K5P A;  2L0F A;  2D11 A;  2JZZ A;  3NWD A;  2Z0E B;  3UIO B;  2LOX A;  2GBR A;  4RM9 A;  4DDG D;  3NS1 A;  3MP9 A;  2QKM A;  4EOY A;  2ZJD A;  2MBO A;  3PVU A;  3NZ3 A;  2KWV B;  1B1Z A;  2QIE B;  5GOW B;  1TQZ A;  3ZJT A;  4IKG A;  1OGW A;  2KAJ A;  4DXG A;  1E90 A;  4KSK C;  1I4X A;  4MSQ B;  2PE6 B;  4TQ1 A;  3V5W A;  5KHO A;  4GIV A;  5D6J B;  2RMM A;  2RPQ A;  2L00 B;  4LNO A;  4YWG G;  1NTY A;  3PLU A;  1TS5 A;  3KYC D;  2QDF A;  2W55 A;  2ZVN A;  5EFX A;  3LDZ E;  1V8C A;  4KV2 A;  3ZO5 B;  4NAM A;  1IUE A;  4C80 A;  3DHG C;  4OHJ A;  1DDW A;  5AZG A;  5LOP B;  2KIE A;  3SD5 A;  1A5R A;  1FGZ A;  2MWS B;  2CB8 A;  2FIF A;  1I4G A;  3R2I A;  4FJV B;  2GB1 A;  2DHK A;  5JZE B;  1HZ6 A;  3H9D A;  4P6V F;  3L16 A;  4XDD A;  2W3S A;  4DHJ B;  3P7Z A;  2KTF A;  4HCP B;  4N58 A;  4QAY A;  1NEN B;  3VTV A;  3DQV A;  3IHP C;  4MH0 E;  2ZCB A;  3VHT C;  3TEY A;  2N7D A;  2K8E A;  1N63 A;  4HAZ B;  1WZ0 A;  1XXG A;  3W5V B;  3ZDM C;  3FC4 A;  2L52 A;  4YTP B;  4M00 A;  4ZRK A;  1XLO A;  4QJ3 B;  1D4B A;  4FHJ A;  1RFA A;  1QKZ A;  3P4R B;  1VBH A;  5D3V A;  2IYB A;  4B0M A;  2NMQ A;  3BYT B;  1TJ6 A;  1RYJ A;  4MT7 A;  3DWG C;  3CXB B;  1YJI A;  2G1E A;  1OEY A;  1ZP0 B;  4WWM A;  4ANU A;  3URY A;  1T3Q A;  2AQ3 B;  1E9M A;  5TR5 A;  2LGY A;  3I3T B;  4W9H A;  2WH5 A;  1I2H A;  3RCZ A;  2HTM E;  3SO6 A;  3N1Z C;  3JSV A;  1PMS A;  2FJL A;  2G9H D;  2O6V B;  2RGF A;  3AN1 A;  4HSI A;  1EF5 A;  3ONS A;  3ZVR A;  2I1K A;  1YIW A;  2ZW1 A;  3PPA A;  2LGD A;  1U29 A;  2J53 A;  2WDV B;  3Q3J A;  1YQ4 B;  3DOW A;  1OEY J;  5HFY A;  1EU3 A;  1T0S C;  3V3X A;  4HK2 A;  1K5D B;  3VR8 B;  2LOZ A;  1TXD A;  1BML C;  1OY2 A;  5IRS A;  4H8S A;  2DX1 A;  3U52 E;  3NWA A;  4HPL B;  2ZEQ A;  1JQ4 A;  3D8D A;  1FFU A;  1LO5 D;  1WH3 A;  1E8Y A;  3W2D A;  3KZ1 A;  3VH4 B;  2D9V A;  3VUX A;  5I2M A;  2LHE A;  3RZW C;  2TSS A;  4LNK A;  1DOI A;  3QWZ B;  4NQL B;  4EEW A;  1F52 A;  2R09 A;  3RUI B;  5DPT A;  2IGH A;  3KWV A;  1K52 A;  5BYQ A;  1VZ6 A;  3KRX A;  2BW2 A;  3EHV A;  1D3Z A;  1QOA A;  3N3K B;  2N9X A;  4JKD A;  1JWU D;  1QQR A;  3VH3 B;  3GE8 C;  2IY0 B;  3EPY A;  2KJ6 A;  5LLI A;  2VRR B;  4WSF A;  3V61 A;  1GGO A;  4DXA B;  4DDI D;  1L6U A;  1JRU A;  2BYT A;  3Q3F A;  1R4N B;  2N1W A;  3OWE B;  1A70 A;  3IG3 A;  5M4Y B;  2G3Q B;  1IP9 A;  4IWO A;  4ACF A;  2R2Y A;  2KLG A;  4JL9 A;  2HDE A;  3AE8 B;  3ODX A;  3KUZ A;  3L4P A;  2I38 A;  2JX5 A;  3TJP A;  3KW5 B;  3U7Z A;  4BKG A;  3A9J A;  1MI1 A;  4ZHO A;  1IYF A;  1P1A A;  4WWP A;  1WGU A;  2O2V B;  2OJW A;  5JLJ B;  3UF8 A;  1WF9 A;  3ZKJ C;  3AE5 B;  3NG0 A;  3PSE B;  1HE8 A;  1AW7 A;  2ZPN A;  2W2X C;  1L6V A;  1ZE3 D;  1EF1 A;  3CF6 E;  4XWT A;  3HVZ A;  3HM6 X;  4HXD A;  1I42 A;  4HAX B;  2ZW0 A;  1UPQ A;  4ZRJ A;  1V81 A;  4A6H A;  4M0W B;  5FR3 A;  3AJ4 A;  1AWD A;  2FAZ A;  4YSX B;  3LB8 C;  3ZNZ B;  1FO4 A;  4RCO A;  3SFE B;  2KVR A;  1XD4 A;  2GBJ A;  2QKL A;  3E56 A;  4DHZ B;  5FK9 C;  2Z59 A;  1WGG A;  1TKE A;  1N5X A;  5JVL A;  2M0A A;  1V5P A;  4BFR A;  3P4P B;  3KUC B;  3PGE A;  5DI9 B;  2WU5 B;  2GS0 A;  4K1R B;  4DXF A;  1R4N I;  2O6V A;  1E0Z A;  1QC6 A;  3SNH A;  2DAF A;  1N62 A;  3DCG A;  4HAV B;  2D3A A;  2RDB C;  4S17 A;  2OHF A;  4KZ0 A;  1WJ1 A;  2D9Z A;  4HCN B;  4ARC A;  4BBN F;  1UF0 A;  3ALB A;  4JK9 A;  2ROV A;  4ILJ A;  1N5W A;  1SE4 A;  4DK5 A;  2H7D A;  3PVW A;  4OZC A;  1KI1 B;  1C77 A;  3DXD A;  2CJO A;  1ZDV A;  4KVG B;  4YT0 B;  1MK9 B;  2YF0 A;  2FE8 A;  2KAN A;  3CMM B;  2BT6 A;  1N6Z A;  1BTN A;  2R0D A;  3F5R A;  5FKA C;  4LK0 M;  3BII D;  4KGS A;  2JRI B;  2I5F A;  1L2N A;  4L23 A;  2BF8 B;  1DOY A;  2SEB D;  4DX9 0;  3DHH C;  1QLB B;  4CHK A;  1YN4 A;  5DIF B;  4L1R A;  2J7Q B;  3ZJV A;  1P9D U;  3KY9 A;  3EC8 A;  1XEE A;  2JT4 B;  4AQ7 A;  2Z8L A;  2V3S A;  3EGR A;  3EEC A;  2IGD A;  1HB8 A;  4MGZ E;  3T8M A;  1MFW A;  3A1Q B;  4EZL A;  3S2A A;  4ZHP A;  3NVV A;  2PLP A;  3PRM B;  1BWN A;  1X1M A;  3GOE A;  4HPP A;  2QIL A;  1YOV B;  4FAD A;  2ZZP B;  2LUM A;  4XE0 A;  2EMS A;  3OJ3 A;  2KJH B;  3PTF C;  2WXI A;  2KK8 A;  3MC8 A;  1WXS A;  1L5P A;  5DCN A;  4B6W A;  2YS3 A;  1GAQ B;  1FHX A;  2KGX B;  4A6F B;  1ET6 A;  4KHO A;  2BQQ A;  2RGN B;  2KFK B;  2AYO B;  3NUH B;  5CTR C;  3AE1 B;  3SDL C;  2QC8 A;  1C9F A;  3KYD D;  4DBG A;  5BO4 B;  3OJ4 B;  1I7H A;  3U4E G;  2O6V D;  1WI1 A;  2O2V A;  1WM2 A;  4LDT D;  4M02 A;  1YNT E;  2KT7 A;  4WJP A;  4MAC A;  4P7I A;  1N3H A;  3P4Q B;  3O65 B;  4WH4 A;  5IA7 A;  4K2O A;  1UEL A;  1NVL A;  3NJT A;  4ARI A;  4XGA B;  4QJ5 B;  1WRD B;  2ICI A;  4M0W A;  1KC7 A;  3ZRC A;  2EC1 A;  4WWO A;  2EEL A;  1L7Y A;  2KC2 A;  3HRD D;  3EFU A;  3AH7 A;  1G6J A;  3ZJU A;  4KHB B;  3A9K A;  2MJ3 A;  4GN1 A;  4JWS C;  1XLN A;  5D3W A;  4GOU A;  1ZC3 B;  1KBL A;  3LXF A;  2L2I A;  1ESF A;  3SUZ A;  1SE9 A;  2M56 B;  4BOS C;  1FRR A;  2COD A;  1UGJ A;  2PIA A;  4D2K A;  1TT5 B;  3IAM 1;  5MPO A;  4A9A A;  5IN7 A;  2D9Y A;  2CJN A;  2BKR B;  5HI1 A;  3V60 A;  2COC A;  3OAW A;  2PKO A;  1F2R C;  1K50 A;  1WGY A;  4ZRI A;  2DHZ A;  3RI7 C;  2LUE A;  1WGQ A;  3ENE A;  4TMA B;  4MM3 A;  1QZE A;  4PYU A;  3TEZ A;  1BUI C;  2L76 A;  2IO2 B;  4OT1 A;  2BWF A;  1FIQ A;  2JYE A;  3PZ8 A;  3ECI A;  1WE7 A;  4GPT B;  4RGT A;  4HKQ A;  3OHM B;  3A4R A;  2AL6 A;  3ZUN A;  3SHQ A;  2N7E A;  4IWQ A;  4GDL A;  4PK1 A;  3UQA A;  4RFB A;  2WXK A;  3DVN U;  3WAM A;  2G4S A;  1R4M B;  1JWM D;  5HG2 A;  5JH5 C;  2WXP A;  5LXI B;  4NSW A;  4OW0 A;  3AU5 A;  1T0Q C;  2DAJ A;  1MVK A;  3BYY B;  3DXC A;  2L32 A;  3MJ5 A;  4HHV A;  1DRO A;  2KQ7 A;  3TEX A;  4EJN A;  4NPN A;  1AWE A;  4TYZ A;  2KX3 A;  1XCT L;  3TSS A;  2WU2 B;  4MY6 A;  1K51 A;  1FXT B;  2DYB A;  2INP E;  4K3B A;  1SXT A;  4W9G A;  2DZJ A;  3EUB 2;  4XYC A;  4J3O D;  2MRP A;  1CQV A;  1LGR A;  3NZU A;  1Q67 A;  2YS1 A;  1DDM A;  3C8Y A;  2FUH B;  2XK5 B;  4G50 A;  2D3C A;  4EMO A;  3A1Q A;  2UVM A;  1FNW A;  3CWI A;  1ISN A;  2FUG 1;  4JX1 C;  4NZL B;  3ZNG C;  4S0R A;  2KMC A;  1MAI A;  5C16 A;  4GMX B;  2HJ8 A;  3Q8E A;  2NZ8 B;  1VLB A;  2C7H A;  2JWU A;  2FCQ A;  4X57 B;  1QT9 A;  1HXY D;  2MBH A;  4J6I A;  3J9C A;  1I35 A;  3PSC A;  4M01 A;  2JUO A;  4GOC A;  1JDE A;  4E71 A;  3GS2 A;  3N20 C;  1ZYI A;  5D27 A;  2KFK A;  2M4N A;  3TFM A;  4L2Y A;  4PT5 A;  1PUT A;  2V4L A;  1DOX A;  1AAR A;  1PGX A;  3A33 B;  1WX7 A;  4URK A;  5DH9 B;  2N0S B;  4DX8 A;  3AE9 B;  3UQB A;  2COF A;  3P4S B;  3TO1 A;  2PMV A;  4NAW A;  2GMI C;  3AEB B;  1NTV A;  3NVW A;  5IAA C;  4DQO C;  4ZRP A;  3AU4 A;  3MC0 B;  3Q8A A;  3ZIM A;  2KDB A;  3DBH I;  3KSY A;  1R4M I;  2B3A A;  3JSV B;  4C00 A;  4P1C C;  4E74 A;  1OTR B;  4YL8 A;  2V3P A;  3KVF B;  1TY0 A;  3RYT A;  1D5X C;  4EKU A;  2JZP A;  3NVZ A;  2HRJ A;  3MHZ A;  1FOE A;  1VZ8 A;  1WJU A;  4UDU C;  1PGB A;  5C1Z A;  1JCK B;  3AE7 B;  1WRI A;  1FNV A;  3KUD B;  1TS3 A;  3HVD A;  1KM7 A;  1U5D A;  3BVM A;  1XO3 A;  3VRB B;  1M7R A;  3RMK C;  1MPE A;  1NI3 A;  5LNK 1;  2W54 A;  1WSP A;  2LRU A;  1X1F A;  1E10 A;  2WX1 A;  4N59 A;  4OZB A;  1K5G B;  1T77 A;  4JQW C;  5L81 A;  3HW2 B;  3VRA B;  2WXM A;  4NJC A;  2M19 A;  4HAT B;  3A98 B;  5H8Y E;  3CIK A;  3WAL A;  1FXI A;  2L0T A;  2MJE A;  3BZD B;  4H2A A;  2FBW B;  3L0W B;  2HJ1 A;  1BT0 A;  1JW9 D;  4NJ7 A;  2KQ4 X;  2KDE B;  3ZVV A;  1MG4 A;  2IO0 B;  3FIL A;  2NPT B;  5L83 A;  3QHT A;  4TKN A;  2RNR B;  4D6W A;  1P5T A;  3SU8 X;  1WY8 A;  1J7A A;  1U4A A;  1TIF A;  2NBU A;  1QIL A;  2D4Q A;  4XDC A;  4HJK A;  4IG7 B;  2J4X A;  1ACA A;  5I2S A;  3PEG A;  2L05 A;  3H8H A;  1V97 A;  2LKO A;  3L54 A;  2CRF A;  5J3Q A;  4KKI A;  4XC2 A;  3RNA C;  1I4P A;  2X0S A;  2JZ3 B;  1OQR A;  3X0W A;  2K8C A;  2VKI A;  3LJ3 A;  2KVZ A;  3A9J B;  2IO3 B;  2UWQ A;  2XK5 A;  1WGH A;  3IAS 1;  1F77 A;  2K6D B;  1WXQ A;  1TGZ B;  1J19 A;  3B08 A;  4CO7 A;  3K9O B;  4I6N B;  2CR5 A;  4W9D A;  3A58 A;  3CIR B;  2ZNV C;  3H1U A;  4ILH A;  3ML8 A;  3W1S C;  3W9C B;  2CQU A;  3AI5 A;  4NNJ B;  2DHI A;  3HK0 A;  1EO6 A;  3Q3N C;  3UI3 A;  1ZGU B;  1TKG A;  4WAF A;  1K8R B;  1LB1 A;  2D3B A;  4KHA A;  2JWZ A;  1GNU A;  2BYE A;  1ZUD 2;  3AMZ A;  4PS3 A;  2KX0 A;  1WJ4 A;  4CSQ A;  3MFG A;  4MK0 A;  2CU3 A;  3CST A;  2DN6 A;  2Z59 B;  2RDH A;  2GBN A;  5EDS A;  3FEH A;  2N23 A;  1DYN A;  2VZK D;  2WYQ A;  1W1G A;  5E6O A;  3NZS A;  3ZLZ A;  3QQ8 B;  4K7W A;  3TIX A;  2IO1 B;  3U12 A;  2YEP B;  2LVQ A;  3ZNI D;  1PFJ A;  2ELB A;  3NRZ A;  2LJI A;  2MDX A;  4A6Q A;  4TQ0 A;  4OVZ A;  3KH0 A;  4QJ4 B;  2L1A A;  3X23 A;  3VR9 B;  4LDT B;  3HIZ A;  4FA6 A;  2DFK A;  2UZR A;  5CX3 A;  4PQ0 A;  2G4D B;  2V9H A;  1VD2 A;  2B76 B;  4YON A;  1J7B A;  2PW9 A;  4EUT A;  3GYO A;  3BJI A;  3AE2 B;  3D32 A;  4HJG E;  3MJW A;  3NOB A;  1WYG A;  3OAN A;  1EVH A;  3QAQ A;  4F7G A;  2H88 B;  2BVC A;  1FPY A;  2LEK A;  4JGH B;  3AE6 B;  1U5E A;  2JF5 A;  5C3J B;  3OLM D;  3ML9 A;  5HKH A;  2M0X A;  2DKQ A;  1HQR D;  3ZW3 A;  1AYF A;  1UBQ A;  4HDO A;  2I1J A;  1D6E C;  2D5G A;  4WQO B;  2Y3A A;  1J8C A;  1J0W A;  2LRW A;  1EM7 A;  1KF6 B;  1N60 A;  4HAW B;  2GLS A;  1JWA D;  2Y5C A;  3DBR B;  1WE6 A;  2K22 A;  1UNP A;  2NBW B;  4LJO B;  2HE7 A;  2Z0O A;  1JML A;  2NPT A;  4KIK A;  4B9K A;  1BXT A;  3ZYY X;  2OOB B;  1TS4 A;  1ET9 A;  4US8 A;  1EAZ A;  2IND C;  4LNN A;  4K17 A;  1WMH B;  2HD5 B;  4TV3 A;  4MGK E;  3TVV A;  2GCJ A;  2KIG A;  2WLB A;  3N9Y C;  2M17 A;  3SBT A;  1ZKH A;  1MKE A;  3V6E B;  1C4C A;  3M62 B;  2C7M B;  1V5O A;  5TSS A;  3APF A;  2LGX A;  1GJZ A;  2HTH A;  4PNK A;  3VUW A;  4IWP A;  3HHM A;  5G2N A;  3V62 A;  3MHS D;  3HQC A;  5T8I A;  3VVW B;  5D3X A;  5JHH A;  3IVF A;  2VH1 A;  1QF6 A;  1V86 A;  3TL5 A;  1FB8 A;  1FGY A;  3I9V 1;  2VH2 A;  1VCB A;  2KO3 A;  2KDI A;  2L83 A;  4HRO A;  1PGA A;  3R2T A;  3R7Q A;  4HB0 B;  5EE0 A;  4KGT A;  2K0P A;  1E6E B;  2RVB B;  1UNR A;  2LXC A;  2P0H A;  2D9X A;  4GGQ A;  2CAY A;  1C76 A;  3SR6 A;  3VQI A;  1GOZ A;  2KKC A;  1SE3 A;  1U2B A;  2KTR A;  2WDR B;  2NVU I;  1WX9 A;  1XCG A;  1PLS A;  3B0A A;  2D2Q A;  1UWM A;  2VRW B;  1RAX A;  2AWT A;  3TMP B;  4K7U A;  2ASQ A;  4EFO A;  3KWL A;  2CY5 A;  3A9K B;  3DCX A;  2WXR A;  5C5B B;  2K6Q A;  4WIP A;  4F1S A;  4IFS A;  2WXL A;  5HE0 A;  2NBV B;  1RFK A;  3DBL B;  1EWC A;  3DWM A;  1WG7 A;  3DBR I;  1AN8 A;  3ZNH B;  1NDD A;  2Z14 A;  1ZVR A;  4HRS A;  5IJM A;  4KKJ A;  5J17 A;  1DDV A;  2LZ6 A;  3P1M A;  1Q5W B;  1XLP A;  2DNF A;  5G5G A;  4L1B A;  3H7P A;  3T9L A;  3O13 A;  2G35 A;  4BZA A;  2KMA A;  4MM3 B;  2BYV E;  4D0N B;  5JHA A;  4RNA A;  2PPH A;  2N4F A;  1E7U A;  3PT2 B;  4A90 A;  3B77 A;  3RNG C;  2P0D A;  2WDQ B;  3QCA A;  1CK1 A;  3QK0 A;  4GDL B;  2PE9 A;  2W2X D;  3IXS A;  3FVC A;  1V89 A;  5BMI A;  2LMC A;  1L0X B;  1DYQ A;  3RUL A;  1H4R A;  1XD3 B;  1UEF A;  5CHV C;  2MCN B;  1P6S A;  1RRP B;  3WIM A;  4BBK A;  2YEP F;  2LI5 A;  2P0F A;  4ICU A;  4JIO U;  5IKC M;  2W82 A;  4JKA A;  2MBQ A;  2L8J A;  1YD8 U;  4RF1 A;  3TCA A;  4FUL A;  4ITK A;  4A55 A;  3E9S A;  3LJU X;  1XQQ A;  3VUY A;  4MDK E;  2V76 A;  3M63 B;  3FSS A;  3V6C B;  5LG4 B;  1Y56 A;  1WMH A;  1F2R I;  4RGO S;  1IGC A;  1C79 A;  1ENF A;  1LW3 A;  3F0W A;  4DHZ E;  2KMM A;  1TZ1 A;  4A5K A;  1NTI A;  3DBL I;  5CHW A;  3NS8 A;  4TSS A;  3KRW A;  3A8P A;  5JHG A;  3B2F A;  4WUR A;  4ANX A;  2KQS A;  1C1Y B;  5CLL B;  1JWS D;  1V49 A;  1FNU A;  1KH0 A;  2C9W B;  3Q8C A;  5BYS A;  1ZM0 A;  1MHX A;  2C60 A;  2J52 A;  5J3Y A;  5IP4 D;  3B9J A;  4GU2 A;  4NY0 A;  3GYP A;  3RZF A;  2MKR A;  1WM3 A;  2UYZ B;  2MWN B;  4F7H A;  1L4D B;  1TKY A;  2WDT B;  4FHK A;  3R66 C;  4BOZ B;  1PDX A;  3BVZ A;  2OQB A;  4C7Z A;  2CKH B;  1CJE A;  4NAW B;  2WGS A;  2I2Y A;  4WJO A;  2JRH A;  1V5M A;  3ODO A;  2DZK A;  4LNI A;  3N7C A;  1T5X D;  3E9O A;  3PZD A;  4ZYN A;  1PYW D;  2WXG A;  2AX5 A;  1KOT A;  3AEF B;  1UZX B;  3K9P B;  4NQK E;  2KNB A;  3U7D A;  3B2G A;  3HSA A;  5C5B A;  3AEG B;  4LLG M;  2V0G A;  2WXH A;  2IGG A;  1E8X A;  1QOG A;  2YT1 A;  2NBV A;  1KLV A;  4M8M A;  1VZ7 A;  2FCM A;  1YN3 A;  1B9R A;  5DHF B;  3L13 A;  1L0V B;  1SJE D;  2OTX A;  1VR9 A;  3AE4 B;  4RGN A;  1SB3 C;  4GDK A;  4YTM B;  4W9E A;  1OFF A;  5KCV A;  3WAN A;  2KFJ A;  4XZ4 A;  1SF0 A;  1FD6 A;  2KWD A;  4K7S A;  4JE3 B;  1I4R A;  2BWE S;  4I6L B;  2RR9 A;  3JYU A;  1WX8 A;  4CQN A;  2KWC A;  3DPD A;  4IDI A;  3VXW A;  2FJU B;  2VZK B;  4E3C A;  2IYD B;  4IC7 B;  1SE2 A;  1X05 A;  2LAS A;  4N6E B;  3DXE A;  3FIL B;  3RNF C;  2LXA A;  4B95 A;  1KRH A;  3W5U B;  4G0N B;  2MEK A;  5G55 A;  3VFK A;  4IM2 A;  4WQM A;  1M7E A;  2Y7B A;  2OJR A;  1FAO A;  2BKF A;  2G45 B;  4IAP A;  3ULC A;  4MJS B;  2PZ1 A;  3Q3M C;  2K1F A;  3AEE B;  5JXV A;  1E7V A;  3QX1 A;  4C4V B;  3PHW B;  2CY4 A;  5FI0 A;  2KAC A;  2UU7 A;  4JLC A;  1XCQ L;  3GP7 A;  2REX A;  3IBE A;  2ZNV B;  3JW0 X;  4JKF A;  5KHQ A;  3RFZ B;  2GCL A;  5C6R A;  1WFY A;  3I63 C;  3N32 A;  1KLG D;  4ZRQ A;  1BAK A;  3EFC A;  1I4H A;  1KZG A;  1NI2 A;  2R82 A;  3NWF A;  4N9F 4;  2DA0 A;  1P0R A;  1Y19 B;  1P3Q U;  1Z2M A;  2JXT A;  5EE9 A;  2KZR A;  2ELA A;  2LGI A;  1Y8R C;  2KUP A;  2QHO A;  3M95 A;  1Z5S B;  1WGD A;  3U30 A;  5KQ4 A;  3ETR A;  4HB4 B;  3WA0 A;  3SYX A;  1YN5 A;  2W3R A;  4HLE A;  4Z2N A;  5CLQ B;  1H8C A;  4A3O A;  4Z2M B;  4WJQ A;  3PRZ A;  2ROZ B;  3N30 A;  4ZYS A;  2KC1 A;  5E6P A;  2KUQ A;  3BWU D;  1HTO A;  1K53 A;  1VDV A;  5H92 C;  5HE3 A;  2WHI A;  3VDZ A;  2ACZ B;  2SAK A;  1AQC A;  1GG3 A;  1FEH A;  3MDB C;  3QC8 B;  4US9 A;  3Q8B A;  3BK1 A;  1C3T A;  3DVG Y;  4ZDV A;  3WCQ A;  5J18 A;  3AM9 A;  1NVI D;  2DX5 A;  2MA9 B;  3SFD B;  1M94 A;  3P63 A;  2CHZ A;  3BK2 A;  2YS5 A;  4LTU A;  5C23 A;  1V5T A;  2D07 B;  3RNE C;  3GZN B;  4BVU C;  3DBS A;  2ZPY A;  3PP2 A;  1ZW7 A;  4A6K A;  4KDI C;  1UNQ A;  1SIJ A;  1DBH A;  2PEA A;  4JKC A;  2BB6 A;  1OMW A;  1WZ3 A;  3AXC A;  2GBK A;  2E2X A;  1V9J A;  1H10 A;  4GB9 A;  2VSZ A;  1NYR A;  4MGY E;  2M8S A;  1ZPS A;  4MH8 A;  1WIA A;  2RD0 A;  2BPS A;  1I7A A;  1HBK A;  3MC9 A;  4KAX B;  1L4Z B;  3RN9 C;  3H6N A;  3O96 A;  2KJR A;  5D3Y A;  1QOF A;  4W9F A;  1FRD A;  2JU6 X;  3PLV A;  2R61 A;  1GPX A;  2BS2 B;  2LVP A;  2N9P C;  4KIK B;  1Q10 A;  2YLM A;  5D7G A;  1NBF C;  2WXN A;  3M3J A;  2FCS A;  2EKE C;  4AJW A;  4C56 C;  1B55 A;  4JKB A;  3WAP A;  2IPK D;  2LG1 A;  2A4Z A;  2YVC A;  4MJS A;  2LD9 A;  2HTH B;  2N1V A;  4C4V A;  4CHJ A;  2BBC A;  2WNM A;  1BTK A;  4P16 A;  2BGF A;  1TZO A;  3W1S A;  4OVU A;  2M1M A;  2ONQ A;  4BKT A;  3QAR A;  2J0M A;  2R2O A;  5HE1 A;  1WXA A;  3TEW A;  3HUI A;  4BAX A;  1UPR A;  1HZ5 A;  1UGM A;  2V1Y A;  2LYD A;  5IOI A;  2KOX A;  3AED B;  2XQN M;  2DTC A;  4HAY B;  1SBB B;  2RPV A;  4W9J A;  3GZN I;  2LWP A;  4WWN A;  3W1Y A;  2YRY A;  1ACC A;  3N1X C;  1DGJ A;  4ZOH C;  3NW8 A;  3UGB B;  1ZOY B;  2LVO A;  1WXV A;  1SEB D;  4CHM A;  4L6E A;  2KTR B;  4FLH A;  4KX6 B;  4M8N A;  3QA8 A;  3ABV B;  4JKG B;  1TYG B;  2QJL A;  4P1B C;  2RSG A;  1UD7 A;  3UZT A;  3MTN B;  3ZTD A;  1WWT A;  2KN4 A;  1L0Y B;  5AUK A;  2MLB A;  1I4Q A;  3PHX B;  2NR2 A;  2IJ0 A;  3VIA A;  3APD A;  2I5C A;  4GXB A;  1SSN A;  1WGR A;  2IY1 B;  3RNB C;  2NTS A;  4FJY A;  2RRF A;  1WJM A;  3NVY A;  2D10 A;  1ZXI A;  2WXO A;  1UWX A;  3GE3 C;  2DYN A;  1WGK A;  4I6P A;  2AEH A;  3H7P B;  1U5F A;  1GC7 A;  2K39 A;  2MP2 B;  1IPG A; 
#chains in the Genus database with same CATH homology
 2ADZ A;  4HB3 B;  4B6H A;  2IZV B;  3L08 A;  2D9W A;  1XT9 B;  1P3R A;  2DYQ A;  2MQJ A;  2IFS A;  2YSZ A;  4IOY X;  1MPH A;  1NU2 A;  1E8Z A;  2KD0 A;  2LUL A;  4GZU A;  3PRE A;  1VBG A;  2RLO A;  1S3S G;  1P98 A;  1MIZ B;  4XX5 A;  1E5W A;  4XWX A;  1GC6 A;  3FLV A;  5J2R A;  3BIN A;  5HE2 A;  1U27 A;  1W1D A;  4OVV A;  4IW0 A;  1EGX A;  1T0Y A;  4KZC A;  3NY5 A;  4HVB A;  1V2Y A;  1WXM A;  2GOW A;  4A3P A;  5LON B;  3UIP B;  4Y94 A;  2WX0 A;  4EZJ A;  1UH6 A;  3DVN V;  4W9C A;  4HDQ A;  4W9K A;  2DZM A;  5CHF A;  3ODW A;  3BY4 B;  5FI1 A;  5LXH A;  3A4S C;  4AOF A;  1YJ1 A;  3R3M A;  3ENB A;  2GBM A;  2MBE A;  1ST7 A;  3FM8 C;  3D8F A;  2JXX A;  1MIX A;  1LM8 B;  2L7R A;  5D94 A;  1X1G A;  2XEW A;  1RRB A;  1GUA B;  4CYE A;  1XOD A;  4JKG A;  3VAW A;  1SHC A;  4IUM B;  5DPW A;  2L1C A;  4FJZ A;  3C0R B;  2FID A;  4DWF A;  3PG7 A;  3M1I B;  4ILG B;  1MK7 B;  1ZC4 B;  4WJN A;  4W9L A;  4AUQ C;  5FR6 A;  2Z0D B;  3TBL D;  1KZ7 A;  2K2J A;  1OQN A;  4GDK B;  1WR1 A;  4JKE A;  2MBB B;  3JVZ X;  1V61 A;  1IRS A;  5AZF A;  2K2U A;  2DYO A;  2MP2 A;  3ZRF A;  2ZVO A;  1QQG A;  2DEN B;  3WYF B;  2JY6 A;  2C7N B;  4ICV A;  3WAO A;  4BBN C;  2YT0 A;  5DPS A;  4ANW A;  2W9N A;  4MGI E;  3ULB A;  4IM3 A;  5L95 C;  5J3T A;  4W9I A;  2KN5 A;  1W1H A;  3H7S A;  1WYW B;  5JHB A;  1LXD A;  2N0Y A;  3TW1 A;  2AL3 A;  2DKP A;  3SBG A;  2Z0P A;  2DIK A;  4HB2 B;  4TUU A;  4NJ6 A;  4DBB A;  1V80 A;  2CHW A;  2CHX A;  2P8V A;  2EMT A;  3NHE B;  3A8Q A;  4JK7 A;  2ZCC A;  1SGH A;  2MW5 A;  3RD2 A;  2BYF A;  3P2B A;  4BKS A;  4DHJ D;  2KCJ A;  1X11 A;  1KJT A;  2X18 A;  3IFW B;  4C0A A;  4A20 A;  3RT3 B;  2J0J A;  3T06 A;  4WJ7 A;  2J59 M;  4AP4 C;  3DDC B;  3P6A A;  4KSL C;  2H7E A;  1DIK A;  2NS5 A;  1FHW A;  4PS8 A;  3PRP B;  2CS4 A;  1OQY A;  1WI0 A;  1YX6 B;  2J0K A;  2DLW A;  2KDF B;  2JPH A;  3U8Z A;  4HWI B;  1XX0 A;  2LJ5 A;  3FP5 A;  2WWZ A;  1CMX B;  1V5U A;  5D2M B;  4ANV A;  2KXJ A;  1WJN A;  4LCD E;  2BCJ A;  5KQ1 A;  4LJP B;  1TBE A;  1V88 A;  5E6N A;  2DX5 B;  1J0G A;  2RUK B;  2MX2 A;  3APC A;  2FDQ A;  3RCP A;  2XBB C;  2MFQ A;  2K8H A;  2K25 A;  1PQS A;  2MSE D;  4F7U P;  5C79 A;  1WJ6 A;  3HM3 A;  2DZI A;  3VTW A;  4RM8 A;  4FBJ B;  1XR0 B;  1Z87 A;  4EZK A;  3ZDT A;  1WVH A;  1U5G A;  4BKS D;  2R2Q A;  4RMA A;  3PV1 A;  1Q0W B;  4MSM B;  1E8W A;  4IM0 A;  4K81 A;  1X86 A;  4GSW A;  2C5L C;  2NCN A;  2KHW B;  3VTU A;  2JVC A;  4G11 A;  1ZSQ A;  1EUV B;  2Y8G A;  5DHA B;  2Y5B B;  2EJ8 A;  1RJ2 A;  1TTN A;  1Q1O A;  3QIJ A;  3L17 A;  4PS7 A;  2A5U A;  3G9W A;  1FHO A;  3B1L X;  2ABD A;  4F8C B;  2UZS A;  2COA A;  3QWM A;  1LQB A;  2FCN A;  3VOQ A;  2DYM A;  1RLF A;  1XKE A;  3UIN B;  2JP2 A;  3E9P A;  3D8E A;  2FJ9 A;  4MEL A;  4AWJ A;  4II3 B;  1WR6 E;  2L3Z A;  2K00 A;  2IBI B;  2M14 A;  2NMB A;  3QBV B;  2Q13 A;  1V6E A;  2KWU B;  4KDL B;  1S1Q B;  4JK8 A;  2W2W A;  4JKH A;  2DHJ A;  4G3X B;  4F7Z A;  1Y5O A;  3PS6 A;  4A6F A;  2PJH A;  2FNJ B;  5AZH A;  1LFD A;  1HB6 A;  5JP4 A;  3AUL A;  4HAU B;  5DPR A;  3E66 A;  2M38 A;  5GMV A;  3NSU A;  1YX5 B;  2RSU A;  3L10 B;  2KLC A;  3R7R A;  2COP A;  4PYZ A;  1SIF A;  3CSF A;  2LBB A;  5AEK B;  4WVF B;  4GMV A;  4WAA A;  4II2 B;  2Y8F A;  3MPX A;  4HPM B;  1YQB A;  3PVL A;  4AJY B;  2N9E B;  3ZTC A;  3SV1 A;  3ML4 A;  2D3G A;  2Z0Q A;  3DVG X;  2CU1 A;  4K2P A;  2RQ1 A;  3E9L A;  1UBI A;  1MG8 A;  4FN2 A;  3QJZ A;  4ASW C;  2K8B A;  2GJY A;  4MEM A;  1F9J A;  2L0F A;  2D11 A;  2JZZ A;  2Z0E B;  3UIO B;  2LOX A;  2GBR A;  4RM9 A;  4DDG D;  2QKM A;  4EOY A;  2ZJD A;  2MBO A;  3PVU A;  2KWV B;  5GOW B;  1TQZ A;  1OGW A;  1E90 A;  4KSK C;  4MSQ B;  2PE6 B;  4TQ1 A;  3V5W A;  5KHO A;  4GIV A;  5D6J B;  2RPQ A;  2L00 B;  1NTY A;  3PLU A;  3KYC D;  2ZVN A;  5EFX A;  3LDZ E;  4KV2 A;  3ZO5 B;  1DDW A;  5AZG A;  5LOP B;  3SD5 A;  1A5R A;  1FGZ A;  2MWS B;  2CB8 A;  2FIF A;  4FJV B;  2DHK A;  5JZE B;  3H9D A;  3L16 A;  4DHJ B;  3P7Z A;  2KTF A;  4HCP B;  3VTV A;  3DQV A;  3IHP C;  4MH0 E;  2ZCB A;  3VHT C;  2N7D A;  4HAZ B;  1WZ0 A;  3ZDM C;  4ZRK A;  4FHJ A;  1RFA A;  1VBH A;  5D3V A;  2IYB A;  1TJ6 A;  4MT7 A;  3CXB B;  1OEY A;  4ANU A;  5TR5 A;  2LGY A;  3I3T B;  4W9H A;  2WH5 A;  1I2H A;  3RCZ A;  3SO6 A;  3JSV A;  1PMS A;  2FJL A;  2O6V B;  2RGF A;  1EF5 A;  3ONS A;  3ZVR A;  2I1K A;  1YIW A;  3PPA A;  2LGD A;  1U29 A;  3Q3J A;  3DOW A;  1OEY J;  4HK2 A;  1K5D B;  2LOZ A;  1TXD A;  1OY2 A;  4H8S A;  2DX1 A;  4HPL B;  2ZEQ A;  3D8D A;  1WH3 A;  1E8Y A;  3KZ1 A;  3VH4 B;  2D9V A;  3VUX A;  3RZW C;  3QWZ B;  4NQL B;  4EEW A;  2R09 A;  3RUI B;  5DPT A;  3KRX A;  3EHV A;  1D3Z A;  3N3K B;  2N9X A;  4JKD A;  3VH3 B;  2IY0 B;  3EPY A;  2KJ6 A;  5LLI A;  2VRR B;  4WSF A;  3V61 A;  1GGO A;  4DXA B;  4DDI D;  1JRU A;  3Q3F A;  2N1W A;  3IG3 A;  2G3Q B;  1IP9 A;  4IWO A;  2KLG A;  4JL9 A;  3ODX A;  3KUZ A;  3TJP A;  3KW5 B;  4BKG A;  3A9J A;  1IYF A;  1P1A A;  4WWP A;  1WGU A;  2O2V B;  5JLJ B;  3UF8 A;  1WF9 A;  3ZKJ C;  3PSE B;  1HE8 A;  2ZPN A;  2W2X C;  3CF6 E;  1EF1 A;  3HM6 X;  4HXD A;  1I42 A;  4HAX B;  1UPQ A;  4ZRJ A;  1V81 A;  4A6H A;  4M0W B;  3AJ4 A;  2FAZ A;  3ZNZ B;  2KVR A;  1XD4 A;  2GBJ A;  2QKL A;  4DHZ B;  1WGG A;  5JVL A;  1V5P A;  4BFR A;  3KUC B;  3PGE A;  5DI9 B;  2GS0 A;  4K1R B;  1R4N I;  2O6V A;  1QC6 A;  3SNH A;  2DAF A;  3DCG A;  4HAV B;  4KZ0 A;  1WJ1 A;  2D9Z A;  4HCN B;  4BBN F;  3ALB A;  4JK9 A;  2ROV A;  4ILJ A;  4DK5 A;  2H7D A;  3PVW A;  1KI1 B;  3DXD A;  4KVG B;  1MK9 B;  2YF0 A;  3CMM B;  2KAN A;  1BTN A;  2R0D A;  3F5R A;  1L2N A;  2JRI B;  2I5F A;  2BF8 B;  4DX9 0;  4CHK A;  5DIF B;  2J7Q B;  1P9D U;  3KY9 A;  3EC8 A;  2JT4 B;  2V3S A;  3EEC A;  1HB8 A;  4MGZ E;  3T8M A;  3A1Q B;  4EZL A;  3S2A A;  3PRM B;  1BWN A;  1X1M A;  3GOE A;  4FAD A;  2ZZP B;  2EMS A;  3OJ3 A;  2KJH B;  3PTF C;  2KK8 A;  1WXS A;  5DCN A;  4B6W A;  2YS3 A;  1FHX A;  2KGX B;  4A6F B;  4KHO A;  2RGN B;  2KFK B;  2AYO B;  5CTR C;  3SDL C;  3KYD D;  4DBG A;  5BO4 B;  3OJ4 B;  2O6V D;  1WI1 A;  2O2V A;  1WM2 A;  4LDT D;  4WJP A;  4P7I A;  1N3H A;  3O65 B;  5IA7 A;  4K2O A;  1UEL A;  1NVL A;  1WRD B;  1KC7 A;  3ZRC A;  2EC1 A;  4WWO A;  1L7Y A;  2KC2 A;  3EFU A;  1G6J A;  4KHB B;  3A9K A;  4GN1 A;  5D3W A;  1ZC3 B;  1KBL A;  2L2I A;  3SUZ A;  1SE9 A;  4BOS C;  2COD A;  2D9Y A;  2BKR B;  3V60 A;  2COC A;  3OAW A;  1WGY A;  4ZRI A;  2DHZ A;  2LUE A;  1WGQ A;  3ENE A;  4MM3 A;  1QZE A;  4PYU A;  2L76 A;  2IO2 B;  2BWF A;  3ECI A;  1WE7 A;  4GPT B;  3A4R A;  2AL6 A;  3ZUN A;  3SHQ A;  2N7E A;  4IWQ A;  4GDL A;  3UQA A;  3DVN U;  3WAM A;  2G4S A;  5JH5 C;  5LXI B;  4NSW A;  3AU5 A;  2DAJ A;  3DXC A;  4HHV A;  1DRO A;  2KQ7 A;  4EJN A;  4NPN A;  1AWE A;  4TYZ A;  2KX3 A;  4MY6 A;  1FXT B;  2DYB A;  4W9G A;  2DZJ A;  2MRP A;  3NZU A;  1Q67 A;  2YS1 A;  1DDM A;  2FUH B;  2XK5 B;  4G50 A;  4EMO A;  3A1Q A;  2UVM A;  1ISN A;  3ZNG C;  2KMC A;  1MAI A;  5C16 A;  4GMX B;  2HJ8 A;  2NZ8 B;  2C7H A;  2FCQ A;  4X57 B;  2MBH A;  4J6I A;  1I35 A;  3PSC A;  2JUO A;  4GOC A;  1JDE A;  4E71 A;  5D27 A;  2KFK A;  2M4N A;  3TFM A;  2V4L A;  1AAR A;  3A33 B;  1WX7 A;  4URK A;  5DH9 B;  3UQB A;  4DX8 A;  2COF A;  3TO1 A;  4NAW A;  2GMI C;  1NTV A;  5IAA C;  3AU4 A;  3ZIM A;  2KDB A;  3DBH I;  3KSY A;  1R4M I;  2B3A A;  3JSV B;  4E74 A;  1OTR B;  4YL8 A;  3KVF B;  3RYT A;  4EKU A;  2HRJ A;  1FOE A;  1WJU A;  5C1Z A;  3KUD B;  1KM7 A;  1U5D A;  1M7R A;  2LRU A;  1X1F A;  2WX1 A;  1K5G B;  4JQW C;  5L81 A;  3HW2 B;  4HAT B;  3A98 B;  3CIK A;  3WAL A;  2L0T A;  3L0W B;  1BT0 A;  4NJ7 A;  2KDE B;  3ZVV A;  2IO0 B;  2NPT B;  5L83 A;  3QHT A;  4TKN A;  2RNR B;  1P5T A;  3SU8 X;  1WY8 A;  1U4A A;  2NBU A;  2D4Q A;  4HJK A;  4IG7 B;  1ACA A;  3PEG A;  2L05 A;  2LKO A;  3L54 A;  2CRF A;  5J3Q A;  4XC2 A;  2X0S A;  2JZ3 B;  3X0W A;  2K8C A;  2VKI A;  3LJ3 A;  3A9J B;  2IO3 B;  2UWQ A;  2XK5 A;  1WGH A;  2K6D B;  1TGZ B;  1J19 A;  3B08 A;  4CO7 A;  3K9O B;  4I6N B;  2CR5 A;  4W9D A;  2ZNV C;  3H1U A;  4ILH A;  3ML8 A;  3W1S C;  2CQU A;  3AI5 A;  4NNJ B;  2DHI A;  3HK0 A;  1EO6 A;  1ZGU B;  1K8R B;  1LB1 A;  4KHA A;  2JWZ A;  1GNU A;  2BYE A;  4PS3 A;  2KX0 A;  1WJ4 A;  4MK0 A;  3CST A;  2DN6 A;  2Z59 B;  2GBN A;  5EDS A;  3FEH A;  2N23 A;  1DYN A;  2WYQ A;  1W1G A;  5E6O A;  3NZS A;  3ZLZ A;  3QQ8 B;  4K7W A;  3TIX A;  2IO1 B;  2LVQ A;  3ZNI D;  1PFJ A;  2ELB A;  2MDX A;  4TQ0 A;  3KH0 A;  3X23 A;  4LDT B;  3HIZ A;  4FA6 A;  2DFK A;  2UZR A;  5CX3 A;  4PQ0 A;  2G4D B;  1VD2 A;  4YON A;  4EUT A;  3GYO A;  3BJI A;  3D32 A;  3MJW A;  3NOB A;  3OAN A;  1EVH A;  3QAQ A;  4F7G A;  4JGH B;  1U5E A;  2JF5 A;  3OLM D;  3ML9 A;  5HKH A;  2M0X A;  2DKQ A;  3ZW3 A;  1UBQ A;  4HDO A;  2I1J A;  4WQO B;  1J8C A;  1J0W A;  2LRW A;  4HAW B;  1WE6 A;  1UNP A;  2NBW B;  4LJO B;  2HE7 A;  2Z0O A;  2NPT A;  4KIK A;  4B9K A;  2OOB B;  1EAZ A;  4K17 A;  1WMH B;  2HD5 B;  4TV3 A;  4MGK E;  3TVV A;  2GCJ A;  2M17 A;  3SBT A;  1ZKH A;  1MKE A;  3V6E B;  3M62 B;  2C7M B;  1V5O A;  3APF A;  2LGX A;  1GJZ A;  2HTH A;  4PNK A;  3VUW A;  4IWP A;  3HHM A;  5G2N A;  3V62 A;  3MHS D;  3HQC A;  3VVW B;  5D3X A;  5JHH A;  3IVF A;  1V86 A;  3TL5 A;  1FB8 A;  1FGY A;  1VCB A;  2KO3 A;  2KDI A;  3R7Q A;  4HB0 B;  2RVB B;  1UNR A;  2LXC A;  2P0H A;  2D9X A;  4GGQ A;  2CAY A;  3VQI A;  2KKC A;  1U2B A;  2KTR A;  2NVU I;  1WX9 A;  1XCG A;  1PLS A;  3B0A A;  2D2Q A;  2VRW B;  1RAX A;  2AWT A;  3TMP B;  4K7U A;  2ASQ A;  4EFO A;  2CY5 A;  3A9K B;  5C5B B;  2K6Q A;  4F1S A;  4IFS A;  5HE0 A;  2NBV B;  1WG7 A;  3DBR I;  3ZNH B;  1NDD A;  1ZVR A;  5IJM A;  5J17 A;  1DDV A;  2LZ6 A;  1Q5W B;  3H7P A;  3T9L A;  2G35 A;  2KMA A;  2BYV E;  4D0N B;  5JHA A;  2PPH A;  2N4F A;  1E7U A;  3PT2 B;  2P0D A;  3QCA A;  3QK0 A;  4GDL B;  2PE9 A;  2W2X D;  1V89 A;  3RUL A;  1H4R A;  1XD3 B;  1UEF A;  5CHV C;  2MCN B;  1P6S A;  1RRP B;  3WIM A;  4BBK A;  2LI5 A;  2P0F A;  4ICU A;  4JIO U;  4JKA A;  2MBQ A;  2L8J A;  1YD8 U;  3TCA A;  4FUL A;  3LJU X;  1XQQ A;  3VUY A;  4MDK E;  2V76 A;  3M63 B;  3FSS A;  3V6C B;  1WMH A;  1LW3 A;  3F0W A;  4DHZ E;  1TZ1 A;  4A5K A;  1NTI A;  3DBL I;  5CHW A;  3NS8 A;  3KRW A;  3A8P A;  5JHG A;  4ANX A;  2KQS A;  1C1Y B;  5CLL B;  1V49 A;  2C9W B;  1ZM0 A;  2C60 A;  5J3Y A;  4GU2 A;  4NY0 A;  3GYP A;  3RZF A;  2MKR A;  1WM3 A;  2UYZ B;  2MWN B;  4F7H A;  2WDT B;  4FHK A;  3R66 C;  4BOZ B;  2OQB A;  2CKH B;  4NAW B;  4WJO A;  2JRH A;  1V5M A;  3ODO A;  2DZK A;  3N7C A;  3E9O A;  3PZD A;  4ZYN A;  1KOT A;  1UZX B;  3K9P B;  4NQK E;  2KNB A;  3U7D A;  5C5B A;  1E8X A;  2YT1 A;  1KLV A;  4M8M A;  2FCM A;  5DHF B;  3L13 A;  2OTX A;  4GDK A;  4W9E A;  5KCV A;  3WAN A;  2KFJ A;  4XZ4 A;  4K7S A;  2BWE S;  4I6L B;  2RR9 A;  3JYU A;  1WX8 A;  2KWC A;  3DPD A;  3VXW A;  4E3C A;  2IYD B;  4IC7 B;  1X05 A;  2LAS A;  3DXE A;  2LXA A;  4B95 A;  4G0N B;  5G55 A;  3VFK A;  4IM2 A;  1M7E A;  2Y7B A;  2OJR A;  1FAO A;  2BKF A;  2G45 B;  4IAP A;  3ULC A;  4MJS B;  2PZ1 A;  2K1F A;  1E7V A;  3QX1 A;  3PHW B;  2CY4 A;  5FI0 A;  4JLC A;  2REX A;  3IBE A;  2ZNV B;  3JW0 X;  4JKF A;  5KHQ A;  2GCL A;  5C6R A;  1WFY A;  3N32 A;  1BAK A;  1KZG A;  1NI2 A;  2R82 A;  4N9F 4;  2DA0 A;  1P0R A;  1Y19 B;  1P3Q U;  1Z2M A;  2KZR A;  2ELA A;  1Y8R C;  2KUP A;  2QHO A;  3M95 A;  1Z5S B;  1WGD A;  3U30 A;  5KQ4 A;  4HB4 B;  3WA0 A;  3SYX A;  4HLE A;  4Z2N A;  5CLQ B;  1H8C A;  4A3O A;  4Z2M B;  4WJQ A;  3PRZ A;  2ROZ B;  3N30 A;  2KC1 A;  5E6P A;  5HE3 A;  3VDZ A;  1AQC A;  1GG3 A;  3MDB C;  3QC8 B;  1C3T A;  3DVG Y;  4ZDV A;  5J18 A;  2DX5 A;  2MA9 B;  1M94 A;  2CHZ A;  2YS5 A;  5C23 A;  1V5T A;  2D07 B;  4BVU C;  3DBS A;  2ZPY A;  3PP2 A;  1ZW7 A;  4A6K A;  4KDI C;  1UNQ A;  1DBH A;  2PEA A;  4JKC A;  1OMW A;  1WZ3 A;  3AXC A;  2GBK A;  2E2X A;  1V9J A;  1H10 A;  4GB9 A;  2VSZ A;  4MGY E;  2M8S A;  1WIA A;  2RD0 A;  2BPS A;  1I7A A;  1HBK A;  4KAX B;  3H6N A;  3O96 A;  2KJR A;  5D3Y A;  4W9F A;  3PLV A;  2LVP A;  2N9P C;  4KIK B;  2YLM A;  5D7G A;  1NBF C;  3M3J A;  2FCS A;  2EKE C;  4AJW A;  1B55 A;  4JKB A;  3WAP A;  2LG1 A;  2A4Z A;  2YVC A;  4MJS A;  2LD9 A;  2HTH B;  2N1V A;  4CHJ A;  1BTK A;  2BGF A;  3W1S A;  4OVU A;  2M1M A;  4BKT A;  3QAR A;  2J0M A;  2R2O A;  5HE1 A;  1WXA A;  1UPR A;  1UGM A;  2V1Y A;  2LYD A;  2KOX A;  2XQN M;  2DTC A;  4HAY B;  4W9J A;  3GZN I;  2LWP A;  4WWN A;  3W1Y A;  2YRY A;  3UGB B;  2LVO A;  1WXV A;  4CHM A;  4L6E A;  2KTR B;  4FLH A;  4M8N A;  3QA8 A;  4JKG B;  2RSG A;  1UD7 A;  3UZT A;  3MTN B;  3ZTD A;  2MLB A;  3PHX B;  2NR2 A;  3VIA A;  3APD A;  2I5C A;  4GXB A;  1WGR A;  2IY1 B;  4FJY A;  1WJM A;  2D10 A;  2DYN A;  4I6P A;  2AEH A;  3H7P B;  1U5F A;  1GC7 A;  2K39 A;  2MP2 B;  1IPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...