2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
2KDEB 4KZCA 1SIFA 2CR5A 4FHJA 2KO3A 1E8XA 1E7VA 2K1FA 4HK2A 1LFDA 2BWFA 2PJHA 2FIDA 2RUKB 5CTRC 2PEAA 2L0TA 1RRPB 1HBKA 4HAVB 4HAXB 4BKGA 4GDLA 3ML4A 1J19A 1ZVRA 2LZ6A 3U7DA 3TVVA 2GOWA 1OEYJ 2VRRB 3AI5A 3NZUA 4ICVA 4ASWC 4K17A 1TXDA 3QWZB 4BBKA 3VTUA 3L13A 4FLHA 3T06A 1P0RA 1WE6A 1WGHA 2J7QB 2Y5BB 3AJ4A 4K7SA 2V4LA 5LLIA 1ZSQA 2LJ5A 2REXA 3PHWB 3PSEB 1SE9A 2YSZA 2NZ8B 2QKMA 2IO1B 3ENEA 4NAWA 4WJQA 4DHZE 1I42A 3F5RA 1HE8A 4GPTB 3H1UA 3KYDD 4KVGB 2KFKA 4GGQA 3KVFB 4NAWB 3G9WA 2KK8A 2LRWA 3WANA 4W9DA 2BYEA 2RSGA 5E6OA 2LI5A 4ANXA 2MKRA 3OJ3A 1WJ4A 4HWIB 2K8CA 1QQGA 2FUHB 4M0WB 2CHZA 2KNBA 1IRSA 1YQBA 1XQQA 3TFMA 1GNUA 2DZMA 1WMHA 4GOCA 1WGUA 3VFKA 1J0GA 1EO6A 3PEGA 2BPSA 1UNRA 2FNJB 1WH3A 3ZNHB 2XQNM 1WM3A 2WH5A 1M7RA 4F1SA 4ZRJA 4DDGD 1UBIA 2LASA 2O6VD 4WJNA 2EMSA 3N3KB 4BBNF 2V3SA 2CY4A 1S1QB 3DDCB 3PG7A 1XD4A 3V6CB 2IBIB 2ZCBA 4MELA 4WJPA 2KCJA 1RRBA 3FSSA 2MLBA 4MK0A 3SUZA 2AYOB 2N9EB 4IUMB 3VUXA 4A20A 3NSUA 2C7NB 4DHZB 5D3XA 2Z0EB 1DDMA 2Z59B 2B3AA 2EJ8A 2KLCA 1DDWA 5AZFA 1R4NI 2OQBA 3PVUA 4E3CA 3W1SC 2RGNB 1V5OA 5DPSA 2M0XA 4NQLB 1Y5OA 1NI2A 2WWZA 3VXWA 2NMBA 3SHQA 2DYNA 3FM8C 1WG7A 4AUQC 1GC6A 3KH0A 5E6NA 3CMMB 2ELAA 3MPXA 1E8YA 3L0WB 3M62B 3PS6A 2KX3A 1VCBA 5AEKB 3V5WA 1FHWA 2YT1A 2JT4B 1PLSA 4TQ1A 2C5LC 1WGYA 4MH0E 4HJKA 5D27A 3ONSA 2AEHA 2WDTB 1OY2A 4K7UA 5DPWA 1FXTB 4B6HA 3DXDA 4W9EA 2KOXA 4B6WA 3KZ1A 4GZUA 2D3GA 2JUOA 1BAKA 2D2QA 1AARA 1PQSA 2LRUA 2CQUA 4BVUC 1WGDA 1KOTA 2ABDA 1U2BA 4WJOA 1XKEA 4EJNA 1KZGA 4YONA 3HM3A 3EECA 3R3MA 2P0FA 2ELBA 2COAA 3DVNV 4KZ0A 5CHFA 1SHCA 4PNKA 2D9ZA 1TBEA 4LCDE 1UELA 3RULA 3OANA 2BCJA 4K1RB 4TQ0A 3ULBA 4HATB 2N1WA 2ZJDA 1PFJA 2ZVOA 4TYZA 2NS5A 3C0RB 5JLJB 3PLUA 1L2NA 1CMXB 3ZNZB 4HAWB 1V2YA 4G11A 2AL6A 2IYBA 3ZDTA 1V5PA 1K5DB 2K2JA 4CHJA 2N7DA 3JSVB 1WXVA 3PRMB 4MEMA 5D7GA 5DCNA 3ULCA 3T8MA 3UIOB 2IO2B 3SYXA 4HDQA 2JF5A 4GMXB 2JVCA 1J8CA 3N7CA 4I6LB 4KSLC 2MFQA 4IOYX 1LQBA 2ROZB 4A5KA 2FCNA 5GOWB 4LDTB 1I7AA 4ZRIA 1WXAA 4WVFB 2J0JA 1WVHA 2HJ8A 4KSKC 4LDTD 4AJWA 3AU5A 4HAYB 3N32A 5IJMA 1WZ0A 1XX0A 4NQKE 1RAXA 2BKFA 1VD2A 4BBNC 2DHKA 2K2UA 2JP2A 3ODOA 3QJZA 5CHVC 3VH4B 1AQCA 5CLLB 2DX1A 3HHMA 1TTNA 2LUEA 3M1IB 4KHBB 1WZ3A 4AOFA 2O6VB 2LXCA 3QHTA 4KV2A 3U8ZA 1ZC4B 2C9WB 3D8DA 5D3YA 2JXXA 2LVOA 3TMPB 2OOBB 2LOZA 1U5DA 4EFOA 1T0YA 4HB0B 2PPHA 4M8NA 1FHOA 1OGWA 3A1QA 1P98A 3PRZA 4IWPA 5J18A 2ZZPB 2RQ1A 2DN6A 3RYTA 2WX0A 2DX5A 1U5FA 1WX9A 1E90A 2K8HA 1K8RB 3A9KB 1V86A 2DAFA 1FGZA 3KYCD 4W9JA 2N23A 1V9JA 3FP5A 1V88A 3JW0X 4GB9A 4WAAA 3ZVVA 1ACAA 5D3VA 2K6QA 3ML9A 3D8FA 4K2PA 1WI0A 4DHJB 4GIVA 1OMWA 3IHPC 4F7GA 4HDOA 2JZ3B 4M8MA 3PPAA 3OJ4B 3SV1A 4F8CB 3CSFA 2HE7A 2W2XC 2EMTA 1WJ6A 2K25A 3BY4B 3R7RA 4F7ZA 2LOXA 2YS3A 1XT9B 4NNJB 1ST7A 2W2XD 5DIFB 1OQYA 3MHSD 4MM3A 4J6IA 3DBSA 3UZTA 2VSZA 4YL8A 1KI1B 5FI0A 4HCNB 2A4ZA 4FULA 1PMSA 3ZRCA 3V61A 2RNRB 3AXCA 2MBEA 4W9CA 2FAZA 2DFKA 5C6RA 4CHMA 2R2QA 2KD0A 2KTFA 4BKSA 2YVCA 2GBKA 4MJSB 3BINA 4GDKB 4WWPA 2KZRA 2LWPA 4FADA 1NDDA 3DOWA 4HXDA 2L7RA 3F0WA 1V89A 3X23A 2LVQA 2MX2A 2JPHA 4KAXB 3CF6E 1Q1OA 4RM8A 2D9WA 4BKTA 4A6FA 1HB6A 4DX8A 1V61A 2CHXA 1MK9B 2G45B 3FLVA 2DZIA 2KUPA 2KC2A 3CIKA 4W9HA 4F7HA 1Z2MA 2HRJA 1Q67A 2CRFA 1YJ1A 2NPTB 4EZJA 4JGHB 3O96A 2DENB 4MSMB 4XWXA 3ZRFA 3X0WA 4XC2A 4IW0A 3RZWC 1DDVA 4GXBA 3RCPA 2MBBB 4IM0A 5G2NA 2GBMA 2KVRA 3MTNB 4N9F4 3WAOA 4IFSA 2FCQA 2KDBA 4F7UP 4E71A 3PVLA 3U30A 2KXJA 2KJRA 4W9LA 1FOEA 2YF0A 2G4DB 1MAIA 2ZPNA 2AWTA 2NR2A 5HE0A 4EZLA 2Y7BA 2KTRA 3PV1A 1NTVA 1WJMA 1L7YA 2DYMA 2FDQA 2G4SA 1U29A 3W1SA 4KDLB 3WAPA 5KHQA 5C5BA 4NSWA 2QKLA 5TR5A 2ADZA 2MW5A 4ZDVA 4EZKA 2GJYA 5JP4A 3GOEA 5DI9B 3TW1A 3L17A 2IFSA 4ANVA 1BT0A 1KJTA 3QCAA 1WF9A 2Z0DB 4K7WA 2KQSA 1P5TA 1U5EA 5C79A 1XODA 2DLWA 1RLFA 2ASQA 2IZVB 1WXMA 1AWEA 3B0AA 3H7PA 4G3XB 1MIZB 1FGYA 2BGFA 4BFRA 2DYBA 2GBJA 2IY0B 1WY8A 3QA8A 2Y8GA 4CHKA 2ZEQA 3RUIB 3VTVA 2CS4A 4X57B 1NU2A 4II3B 2KX0A 2DZKA 2LG1A 2LVPA 2O2VA 1P6SA 3A9JA 3QX1A 4HHVA 1M7EA 4HPMB 4XX5A 1MPHA 3WAMA 4A3PA 2D9XA 3VAWA 3I3TB 5EFXA 3BJIA 3ALBA 1V81A 3VUYA 1BTKA 3QK0A 4ZYNA 2CY5A 2Y8FA 4GDLB 2GBRA 4BOZB 2DKPA 2ZPYA 2RVBB 4DBGA 3B1LX 5CHWA 2MP2A 1YX5B 5BO4B 3ZUNA 1GUAB 4MY6A 3NS8A 1E7UA 3ECIA 5L83A 3RD2A 3H9DA 1P9DU 5JHHA 2KJHB 4ANUA 4BKSD 3RT3B 4GDKA 4HAZB 2JRHA 1ISNA 2M1MA 3EC8A 4RMAA 5E6PA 4AP4C 4JIOU 1W1GA 3M63B 1YX6B 3H7PB 1WFYA 5JHGA 4HB2B 2N4FA 1E8WA 3WIMA 1X86A 2DAJA 3Q3JA 4W9IA 4CYEA 3KUZA 1FB8A 2KLGA 4NJ6A 2I5FA 3UQBA 3ZW3A 1U4AA 4HAUB 2MSED 3V60A 1EUVB 2BYVE 3VDZA 3ODXA 3T9LA 2I1JA 1ZC3B 4HCPB 3DBHI 4DWFA 1H4RA 4WSFA 2XEWA 2FJLA 1BWNA 3APFA 4LJPB 4PS3A 5D94A 4E74A 3NOBA 3VHTC 2LGYA 1JRUA 2AL3A 2K8BA 5JZEB 2IY1B 5L95C 4KDIC 1IYFA 5J17A 1DBHA 1NTYA 2CB8A 1V49A 1S3SG 2IYDB 3K9PB 2N9PC 3KY9A 2DX5B 3A9KA 4KHOA 3ZDMC 1TGZB 4W9GA 2ZNVB 4MGYE 2RSUA 2KHWB 3JVZX 3UQAA 1WGQA 2KMCA 1WR6E 4D0NB 1V5MA 3KRWA 2A5UA 4A6KA 2KC1A 2FCMA 2RR9A 2D10A 4C0AA 2O6VA 2QHOA 3TL5A 1GG3A 5HKHA 2L8JA 1OEYA 2KFJA 5LONB 2EKEC 1MK7B 4PS7A 3A8QA 1EGXA 2JRIB 5CX3A 1R4MI 2YS1A 3A33B 4Z2NA 2ZNVC 2PE9A 3DQVA 2OJRA 4MJSA 1SGHA 3KW5B 2HTHB 2FCSA 4DXAB 1FHXA 3S2AA 1WX8A 1XR0B 1OTRB 2BYFA 3HQCA 2N7EA 2MCNB 5L81A 2NVUI 2K6DB 5JHBA 2D9YA 2DYQA 4A6HA 2LGXA 5LOPB 3TBLD 5JH5C 4HPLB 4MSQB 5J2RA 1J0WA 3LJUX 2RLOA 2KWVB 1A5RA 1EVHA 1WJ1A 3SNHA 1YIWA 2YT0A 3ZNID 3L16A 1G6JA 2COCA 3DVNU 5C5BB 3PRPB 2HTHA 2G3QB 4LJOB 3WALA 1U5GA 4L6EA 2GMIC 4FBJB 1NTIA 1TQZA 2GS0A 2P8VA 4Y94A 3HM6X 1ZKHA 5C1ZA 1H8CA 2IO3B 4P7IA 3IBEA 4JQWC 3PT2B 4XZ4A 4EUTA 3GYOA 2XK5B 1QC6A 2K39A 5DPTA 4B95A 2KDFB 2KJ6A 3P2BA 3KUDB 1P3QU 3V6EB 4KHAA 2CU1A 2M38A 2WX1A 3A4RA 4MT7A 2L3ZA 2YLMA 4EKUA 1LB1A 3TCAA 1HB8A 2UZRA 3ZVRA 4IG7B 3TIXA 5IAAC 4DX90 4DK5A 3DPDA 4K2OA 4A3OA 1QZEA 3SO6A 1RFAA 1P3RA 2N9XA 1V80A 2DHIA 4EMOA 1X11A 2XBBC 2XK5A 1C1YB 2KN5A 1I35A 5HE1A 5DH9B 2R2OA 2MRPA 2V76A 1Q0WB 3R7QA 4IC7B 4PS8A 2KANA 4HB3B 5LXHA 2MWSB 3JYUA 2L00B 2I1KA 2EC1A 2KWUB 1MG8A 2PE6B 3IFWB 3VH3B 2G35A 3HW2B 2CODA 1Y8RC 4MGZE 2GBNA 1FAOA 2GCJA 4WWNA 1MKEA 4TKNA 1ZM0A 3LJ3A 3PLVA 3W1YA 2Z0PA 2L0FA 1LXDA 4W9FA 4GU2A 4URKA 2C60A 1K5GB 1KLVA 3RCZA 2MBOA 1WIAA 3DXCA 5J3TA 2C7HA 1W1DA 1NBFC 3JSVA 3DXEA 2X18A 5C16A 2FJ9A 1YD8U 4MGIE 2UZSA 5HE2A 3MDBC 4KIKA 4CO7A 4IM2A 1X1MA 5EDSA 3FEHA 2LXAA 1F9JA 2MWNB 1WR1A 1IPGA 3DVGY 4NPNA 1UPRA 3UGBB 4FJYA 2UYZB 5DHFB 4K81A 4FA6A 4RM9A 3SDLC 5KQ4A 3DCGA 4G50A 3AULA 2CAYA 2L2IA 2NBVB 1EAZA 1LW3A 1WRDB 3A1QB 1X05A 4PQ0A 2LGDA 4TV3A 1WMHB 2KDIA 1RJ2A 2M14A 5DHAB 3APDA 5J3QA 1WX7A 3EFUA 2JWZA 3UF8A 1EF1A 3H6NA 2R09A 2COFA 3PVWA 2LKOA 4GN1A 4A6FB 3M3JA 2H7EA 4GSWA 1M94A 3VVWB 2KGXB 2L76A 3KUCB 3AU4A 3GZNI 4KIKB 3ZTDA 5GMVA 4AWJA 2N1VA 2KKCA 5KHOA 2I5CA 3ZIMA 3O65B 1Z5SB 1EF5A 2P0HA 3B08A 2BWES 1B55A 2DTCA 2MDXA 2RGFA 3QC8B 1XCGA 2GCLA 1GC7A 4H8SA 2BKRB 4ICUA 2COPA 2VRWB 2KMAA 3CSTA 2DYOA 1WGRA 1DROA 3L08A 1XD3B 3NZSA 5D6JB 1WYWB 3L54A 1UPQA 2H7DA 3VOQA 2D07B 1H10A 1UGMA 1I2HA 1UZXB 4Z2MB 2DA0A 3VTWA 2KTRB 3NHEB 4MDKE 2HD5B 4II2B 3HK0A 4MGKE 3ZKJC 3WYFB 1P1AA 2M4NA 2ZCCA 2UVMA 3ODWA 1WXSA 3PP2A 3ZLZA 5KCVA 2MA9B 3UIPB 4IM3A 2JY6A 1UNPA 1N3HA 4WJ7A 1UBQA 2FIFA 2MP2B 2WYQA 3QAQA 2BF8B 5KQ1A 3MJWA 3DBLI 4G0NB 3A8PA 3K9OB 5IA7A 2D9VA 2VKIA 2M17A 4I6PA 3UINB 3ZNGC 2UWQA 3P7ZA 3ZTCA 3PSCA 2L05A 4JLCA 2CKHB 1IP9A 4IAPA 5HE3A 2NPTA 3LDZE 3ML8A 4B9KA 1U27A 1D3ZA 3KSYA 3A4SC 2OTXA 1WGGA 3A9JB 2J0MA 5FR6A 4PYZA 5LXIB 2J0KA 2R0DA 2NBWB 1GJZA 1WM2A 2J59M 3EHVA 4GMVA 3APCA 5AZGA 3VUWA 1X1GA 2ZVNA 1MIXA 3PHXB 3QQ8B 2Z0OA 2DHJA 5FI1A 2NCNA 1OQNA 3DBRI 4OVUA 5DPRA 3PTFC 3WA0A 4DDID 2KWCA 5JHAA 3TO1A 3VIAA 4DBBA 2N0YA 4FJZA 3R66C 1E8ZA 3H7SA 3N30A 1Y19B 2DZJA 1KM7A 3NY5A 4AJYB 1WE7A 3OAWA 1Q5WB 3RZFA 3L10B 4NY0A 3D8EA 5AZHA 3V62A 4BOSC 3Q3FA 2M8SA 3D32A 4OVVA 3ZO5B 3IG3A 2P0DA 2DKQA 4ZRKA 2Z0QA 3A98B 3OLMD 3CXBB 4IWQA 2W2WA 2KQ7A 5D2MB 2IO0B 2LBBA 5J3YA 2CHWA 3DVGX 1C3TA 2LYDA 3VQIA 1W1HA 4HB4B 1WJNA 1TJ6A 2E2XA 2L1CA 1UEFA 4FHKA 3PREA 1Z87A 3QARA 2NBUA 4JL9A 4W9KA 4EOYA 2YRYA 1V5TA 3QWMA 2RPQA 4FJVB 5C23A 3PGEA 4ANWA 4HVBA 1V5UA 1WI1A 1X1FA 2K00A 2LULA 1NVLA 2Q13A 2YS5A 1TZ1A 2O2VB 1DYNA 2V1YA 4TUUA 3M95A 1LM8B 2RD0A 3HIZA 4WWOA 3TJPA 4DHJD 1KZ7A 2ROVA 2MBQA 3KRXA 5D3WA 2W9NA 2C7MB 4WQOB 1UH6A 2KFKB 1UD7A 3P6AA 2LD9A 2MQJA 2MBHA 4I6NB 1ZW7A 3EPYA 3SD5A 4PYUA 3QBVB 2D4QA 2DHZA 3SU8X 4EEWA 3PZDA 5CLQB 3IVFA 2PZ1A 1V6EA 3GYPA 5G55A 4HLEA 2D11A 1WJUA 4NJ7A 3QIJA 1ZGUB 1E5WA 1BTNA 4FN2A 4IWOA 2JZZA 1UNQA
chains in the Genus database with same CATH superfamily
1SIFA 2MJEA 4HKQA 2PJHA 4KGTA 4BKGA 3AEBB 4D6WA 2PVGC 3MFGA 2DWQA 3Q3NC 3TVVA 3U7ZA 5I2MA 1QLBB 4ASWC 3AEFB 3AE1B 1FFVA 3PZ7A 3T06A 2Y5BB 2JX5A 4WQMA 1ZSQA 2NZ8B 2WDQB 1SJHD 3PZ8A 1F2RI 4ACFA 3OJ3A 2K8CA 2WXMA 1RWSA 2FUHB 4M0WB 2CHZA 1YQBA 1XQQA 1WMHA 4OSNA 1EO6A 2BPSA 1WH3A 2PKOA 2WH5A 1QKZA 4DHZB 2EMSA 1PGXA 1S1QB 3DDCB 4MK0A 3NSUA 2C7NB 4NAMA 2EJ8A 2KLCA 2IDYA 2WXIA 4E3CA 2M0XA 1Y5OA 2WWZA 4XGAB 3VXWA 3VR8B 5EE3A 2ELAA 3PS6A 2K9XA 1FHWA 2YT1A 2ONQA 1WGYA 2QMTA 3ZXRA 5DPWA 2AEHA 2WDTB 2LFIA 3DXDA 4B6WA 2JUOA 1AARA 1PQSA 1PFDA 1WGDA 1KOTA 1U2BA 4WJOA 1XKEA 4BZAA 4EJNA 1KZGA 4YONA 5CHFA 5AUKA 1TBEA 2GI9A 4LCDE 2TSSA 4K1RB 4TQ0A 3ULBA 2N1WA 2ZJDA 4TYZA 2NS5A 3PLUA 4US8A 3SFDB 1V2YA 3ZDTA 1BXTA 5D7GA 5D3DA 1WXVA 3NUHB 4MEMA 2INPE 3T8MA 3N7CA 4I6LB 2WXFA 4N6EB 5FKAC 2ROZB 4LDTB 5GOWB 1WXAA 4WVFB 2J0JA 1WVHA 2HJ8A 4AJWA 1FFUA 5IJMA 4JKCA 1VD2A 3HIEA 5CLLB 2CJOA 4KHBB 2EKIA 4AOFA 3U8ZA 3D8DA 2JXXA 4L1RA 1T0YA 1TKEA 4HB0B 5J18A 3BYTB 3A9KB 4W9JA 1V86A 4GB9A 1V9JA 3JW0X 1FRDA 4P16A 5D3VA 3ML9A 5EE1A 4F8CB 2K22A 2W2XC 2IJ0A 3BZDB 2K25A 1GB1A 1XT9B 1ST7A 4MM3A 5I2SA 1BMLC 2A4ZA 2BYTA 3V61A 2MBEA 4BKSA 4CHMA 2KD0A 2GBKA 3BINA 4GDKB 2LWPA 4HXDA 3F0WA 1UUPA 4A6FA 1HB6A 4DX8A 1V61A 2CHXA 2N9KA 3FLVA 4WURA 4W9HA 1MI0A 3GP7A 3MJ5A 2MHJA 2FJUB 4F7HA 3DBLB 2HRJA 1YJ1A 2DENB 4LK0M 4XWXA 3RZWC 3RCPA 4GXBA 3WAOA 2KVRA 1FD6A 2KDBA 4F7UP 1DIKA 3NS1A 4W9LA 2YF0A 2ZPNA 1L7YA 2G4SA 2JZPA 4KDLB 3PO0A 2Z13A 1HTOA 3GOEA 3L17A 1BT0A 1KJTA 3QCAA 4WH4A 4YSXB 1P5TA 4BOSC 5C79A 1XODA 4LTUA 4N58A 5AUIA 3ZIMA 3H7PA 1FNWA 2BGFA 2DYBA 2GBJA 3QA8A 2Y8GA 2ZEQA 1C77A 3KWVA 2L1AA 2CS4A 2W3SA 2JSVX 4HHVA 3WAMA 4BOZB 2DKPA 2ZPYA 2RVBB 1A70A 3BVZA 4J3OD 4MY6A 2JWUA 1ACCA 2KJHB 4IOIE 4BKSD 4JKBA 4L2YA 1ISNA 5E6PA 4AP4C 1D6EC 4JKEA 2WDVB 3WIMA 5FR3A 4W9IA 3Q3JA 1FB8A 1E7PB 2KLGA 3FAHA 4NJ6A 3UQBA 1U4AA 4MM3B 1EUVB 2BYVE 1T0RC 3NZ3A 1H4RA 4PS3A 5D94A 4ARIA 4RGMA 2LGYA 1JRUA 3ZJUA 1ZDVA 5L95C 4KDIC 2IYDB 3KY9A 3A9KA 4W9GA 4MGYE 2KHWB 3MC9A 1WGQA 2K5PA 3O13A 2FCMA 2RR9A 2D10A 2O6VA 2QHOA 1GG3A 2KFJA 4C80A 5LONB 2EKEC 3A8QA 2ZNVC 1F0ZA 2OJRA 1J7AA 1SGHA 1YJJA 2NTTA 3V3XA 5JHBA 2K6DB 1F1HA 5LOPB 4HPLB 3WCQA 2QC8A 1EVHA 2JU6X 1PDXA 3L16A 2WGSA 2G3QB 1UNSA 1NTIA 2P8VA 2WU2B 2B76B 3HM6X 5C1ZA 1L6UA 3IBEA 4P7IA 3PT2B 4XZ4A 1WSPA 1TYGB 3URYA 5DPTA 1UWXA 3IT6B 1R7SA 4RF1A 1UGJA 2RPVA 4KHAA 2L3ZA 4IG7B 3ZVRA 3AMZA 3TIXA 2JYTA 5IAAC 4DX90 1V1OA 4A3OA 5EE0A 2XK5A 2DHIA 3R7QA 2MRPA 2V76A 1Q0WB 4C4VA 4EE2A 2WU5B 1I4GA 3SBTA 5LXHA 2MWSB 2I1KA 2EC1A 2KWUB 3SFEB 2QSDA 1FAOA 1MKEA 2DNFA 1LXDA 4GLSC 2XNAC 3RCZA 3AE7B 1WIAA 2C7HA 1NBFC 1ZE3D 3HRDD 2N7JA 2UZSA 5HE2A 3MDBC 4KIKA 4CO7A 1X1MA 1UPRA 3UGBB 3E9OA 3SDLC 5KQ4A 3E9LA 2HTME 1KRHA 2L2IA 2NBVB 1SE3A 2LGDA 1WMHB 1RJ2A 3APDA 1L0YB 3MHZA 2R09A 3M3JA 3VVWB 2L76A 3IAS1 3AU4A 3GZNI 3ZTDA 4GOUA 1YNTE 5KHOA 2I5CA 1MPEA 3B08A 1ZXHA 1B55A 2DTCA 1C9FA 5IRSA 4KGSA 2RRFA 4MELA 2COPA 2VRWB 2KMAA 3BVMA 1DROA 1XD3B 1WYWB 3V05A 3VOQA 2D07B 1FEHA 4BAXA 1UGMA 1J7BA 3VTWA 4II2B 1DYQA 1FNVA 3ODWA 1JALA 1VR9A 3ZLZA 2KVZA 4IM3A 4WJ7A 3QAQA 1B1ZA 2PMVA 1YQ3B 3MJWA 3NG0A 1ET9A 4JLCA 2L05A 2VZKD 5HE3A 1K53A 4HJGE 3P4RB 2X8XX 3A9JB 3B9JA 1L6VA 1XXGA 1GJZA 3AEAB 1N5WA 2KUQA 2LGIA 1FIQA 3NJTA 3PHXB 2Z0OA 5FI1A 1OQNA 3DBRI 1VZ8A 4DDID 5JHAA 4DBBA 4C56C 1TS3A 3H7SA 2W82A 3RZFA 3R8BA 3D8EA 5AZHA 3V62A 1ZPSA 3D32A 3ZO5B 2DKQA 2Z0QA 3Q8EA 3CXBB 4IWQA 2W2WA 2KQ7A 5BMIA 2NMQA 3DVGX 2H89B 1T3QA 4HB4B 2L1CA 1UEFA 4W9KA 4HRSA 1V5TA 3QWMA 1CZPA 2RPQA 4ANWA 3PGEA 2K00A 2O2VB 1DYNA 4WWOA 2M0AA 1KZ7A 1HEZE 4IDIA 4RGNA 3P4SB 3DHGC 1UH6A 1JCKB 4I6NB 1ZW7A 1FXIA 3SD5A 1E6EB 1TS4A 3IT4B 3SU8X 3GYPA 4HLEA 3T3OA 1VBGA 4A90A 4NJ7A 3U12A 2AQ2B 1JWUD 1BTNA 1JWMD 3Q6BA 4FN2A 1XEEA 2JZZA 4H2AA 1CJEA 5BMGA 2FIDA 2RUKB 5H92C 3AN1A 5JXVA 2KMMA 1AN8A 4HAVB 4HAXB 4GDLA 3ZGZA 1J19A 1WRIA 2VRRB 4ICVA 4K17A 1OFFA 1TXDA 2QJLA 1C4CA 2J7QB 1P0RA 1WE6A 1DOYA 3I57A 5LLIA 5GXGB 3PHWB 3LXFA 2IO1B 4NAWA 1TS2A 1I42A 3F5RA 1HE8A 3B2GA 3H1UA 3KYDD 2KFKA 3E56A 3KVFB 4NAWB 3G9WA 3RN9C 2WXPA 2BYEA 4O1NA 4W9DA 4ANXA 2MKRA 4MT5A 3ZXVA 4J6IA 3TFMA 3VFKA 2RDHA 4GOCA 1WGUA 3ZNHB 1JROA 2XQNM 1ET6A 4DDGD 4WJNA 3N3KB 4BBNF 2CY4A 4ARCA 2KCJA 2MLBA 4A20A 1XLNA 1OQRA 4PK1A 1DDMA 4ILHA 2B3AA 1DDWA 4RF0A 4N59A 4HEA1 2R2YA 5DPSA 1NI2A 1TZOA 1DOIA 2DYNA 3FM8C 4AUQC 1GC6A 2ZW0A 3MPXA 3L0WB 1GAQB 1PLSA 1KH0A 4MH0E 3T3NA 1SJED 5D27A 4K7UA 1OY2A 1FXTB 4B6HA 4W9EA 2KOXA 1BAKA 2D2QA 2LRUA 2CQUA 1T77A 3HM3A 3R3MA 3EECA 2IGGA 2ELBA 3AEEB 1SHCA 3I5JC 2D9ZA 1D5XC 2BCJA 2ZVOA 3C0RB 4QAYA 4LNOA 1LO5D 4G11A 1L4DB 1V5PA 2K2JA 1K5DB 4CHJA 2N7DA 3U2SC 5DCNA 3ULCA 1ZP0B 3UIOB 2IO2B 2JVCA 4HDQA 5HG2A 2MFQA 5TSSA 2FCNA 1I7AA 1AW7A 4ZRIA 3BVGA 4LNNA 4KSKC 1XX0A 4NQKE 2LJIA 2DHKA 1QQRA 1K50A 3QJZA 2DX1A 1TTNA 2LUEA 3AEGB 4M00A 4KV2A 2WDRB 1ZC4B 2LOZA 2X38A 4OHJA 1ZDXA 4M8NA 2GLSA 1P98A 1WYGA 2RQ1A 2DN6A 2DX5A 1WX9A 2K8HA 4Q2JA 3VRAB 2DAFA 1FGZA 1V88A 2BVCA 1ACAA 3D8FA 4GIVA 4F7GA 1B9RA 4HDOA 2J53A 3PPAA 3CSFA 3BY4B 2EELA 2YS3A 3AV8A 2W2XD 5DIFB 1OQYA 2G9HD 4YL8A 1KI1B 2DBYA 1PMSA 2BS3B 3ZRCA 2DFKA 2KTFA 4WWPA 2Z8LA 2D3BA 3DOWA 2L7RA 2MX2A 1V89A 3X23A 1XLPA 4XDCA 2PLPA 4RM8A 2D9WA 2GBNA 2G45B 1PGAA 2DZIA 3EFCA 4LNIA 4RNAA 1Z2MA 2Z59A 3Q8CA 4MSMB 1XF5L 4IM0A 2GBMA 2FCQA 4E71A 3PVLA 3EGRA 3VR9B 2ACZB 2AWTA 5HE0A 2INCC 2NTSA 1NTVA 2DYMA 1U29A 3WAPA 1SEBD 1JWSD 5TR5A 2MW5A 4BBNC 4ANVA 2R82A 1HZ5A 3TSSA 2DLWA 4BFRA 4ZYSA 4CHKA 2KR0A 3TUOA 2LVPA 4DHJD 3A9JA 1M7EA 3I3TB 3ALBA 1V81A 1BTKA 4OW0A 1I7HA 2Y8FA 2BT6A 1I4XA 2GBRA 4DBGA 1KBLA 2LMCA 5CHWA 1YX5B 1E7UA 1QT9A 3ECIA 5L83A 1VJKA 3IXSA 3RD2A 1TS5A 3RT3B 1EWYC 2M1MA 4RMAA 3P4QB 3M63B 3H7PB 5JHGA 1E8WA 2DAJA 3HVZA 4YTPB 3KUZA 1CQVA 2PTLA 2I5FA 3ZW3A 2MSED 3AH7A 1ZC3B 4JWSC 3DBHI 2J4XA 1K52A 2XEWA 2FJLA 1BWNA 2BS2B 3APFA 4LJPB 3W2DA 1HTQA 2QEJC 2AL3A 1YN4A 1NTYA 2CB8A 3K9PB 5IKCM 2DX5B 3ZDMC 3KWLA 2QDFA 2RSUA 3JVZX 3AE5B 3DCXA 3ENBA 2KWDA 4C0AA 2L8JA 1SE2A 1EGXA 2YS1A 3A33B 4Z2NA 4JK8A 4L1BA 2HTHB 4DXAB 3DWGC 1XR0B 1OTRB 3I63C 5L81A 5C2TB 2DYQA 1VDVA 1FRRA 1A5RA 1J0WA 3SNHA 1YIWA 3ZNID 2J52A 2GS0A 2YEPB 2DIKA 2IO3B 4JKGA 4EUTA 2AQ3B 2XK5B 1QC6A 2CJNA 3P2BA 2GRIA 3V6EB 2KYWA 2JQRB 2YLMA 4EKUA 1LB1A 3ABVB 4DK5A 3DPDA 2KN4A 1QZEA 3RI7C 3SO6A 1V80A 1I35A 1C1YB 2KANA 4HB3B 3IFWB 1VBHA 3HW2B 2CODA 1Y8RC 4KKIA 4MGZE 4WWNA 1ZM0A 3LJ3A 5HFYA 3RNCC 1V8CA 4C7ZA 3RNBC 3DXCA 1W1DA 4MGIE 2X18A 3GE3C 2FJ9A 5EDSA 1F9JA 3DVGY 2INDC 2WXRA 4FJYA 3MC0B 1E9MA 2IGDA 4RM9A 3CWIA 3DCGA 2NBVA 2CAYA 3NVZA 1EAZA 1LW3A 1WRDB 3H8HA 2M14A 5DHAB 1JRPA 5J3QA 3H6NA 3PVWA 2LKOA 4A6FB 2KGXB 4REZA 1EF5A 2K49A 2P0HA 3QC8B 2RDBC 5EE9A 2GCLA 4M01A 3L08A 5D6JB 2DYOA 1UPQA 4A9AA 1UZXB 3HK0A 3WYFB 2ZCCA 2UVMA 2MA9B 1N3HA 2MP2B 2WYQA 1RFKA 2Z14A 4G0NB 3DBLI 1N63A 1LGRA 3A8PA 3K9OB 2KIEA 2LGSA 3ZQ4A 2Y5CA 2UWQA 3P7ZA 3ZTCA 3PSCA 1IP9A 3FVCA 3ML8A 4HPPA 3A4SC 1N6ZA 2OTXA 1WGGA 4KGRA 4M0WA 2Z4DA 2J0KA 1WM2A 3HUIA 3EHVA 1C4AA 3APCA 1X1GA 2ZVNA 1MIXA 4XDDA 1EU4A 2DHJA 3PTFC 2KWCA 3TO1A 2WQYB 3R66C 1KM7A 3NY5A 1WE7A 2V3NA 3NRZA 2BBCA 1VLBA 2W55A 2M8SA 4OVVA 3IG3A 3SR6A 3AEDB 2IO0B 1JWBD 1D5MC 1N62A 1WJNA 2NBUA 3N1XC 4EOYA 5BYSA 3Q3OC 5C23A 1KF6B 3LB8C 4HVBA 1V5UA 3KYCD 2BW2A 1HQRD 1NVLA 3VHTC 3M95A 3HIZA 2YT2A 2ROVA 2OJWA 2WXJA 2RMMA 2W9NA 2KT7A 4P6VF 2I2YA 2GB1A 2D4QA 2DHZA 5CLQB 1V6EA 3FC4A 2D11A 2ZKMX 4XE0A 1E5WA 3DBHB 1E8XA 2K1FA 4HK2A 2BWFA 2PEAA 2L0TA 1HBKA 3ML4A 2LZ6A 4JX1C 3U7DA 1V97A 2GOWA 3AI5A 3NZUA 1TJEA 3QWZB 2K8EA 3IAM1 4BBKA 3VTUA 1SSNA 3L13A 4FLHA 4K7SA 2OHFA 2LJ5A 3PSEB 3ENEA 4DHZE 1FNUA 1NI3A 4KVGB 2J42A 4GGQA 2KK8A 1T0SC 2LRWA 2I38A 1J7CA 5E6OA 3TEZA 1IBXB 2LI5A 4OZCA 4HWIB 2IPKD 1IRSA 1ENFA 4ITKA 2DZMA 1GNUA 1J0GA 3PEGA 2FNJB 1M7RA 1UBIA 2LASA 2FBWB 2L52A 1XD4A 4DXFA 1RRBA 3FSSA 3SUZA 4IUMB 3RNEC 5D3XA 1ZUD2 1V5OA 2NMBA 1WG7A 3KH0A 5E6NA 3CMMB 1E8YA 4YSZB 2KX3A 3RNAC 5AEKB 3V5WA 2JT4B 4TQ1A 2C5LC 2L83A 4HJKA 1L5PA 3ONSA 2AQ1B 3KZ1A 2D3GA 4TMAB 4BVUC 2ABDA 1UF0A 2OEDA 2LUMA 3B77A 2P0FA 4KZ0A 4PNKA 3N1YC 1UELA 3OANA 2E3TA 3Q8AA 4K3CA 4HATB 1TKGA 1PFJA 4XYCA 5JLJB 1L2NA 4HAWB 3BWUD 2AL6A 1SB3C 4YT0B 3JSVB 3SYXA 2JF5A 4KSLC 1LQBA 4GNKB 4A5KA 5T8IA 4KHBA 4LDTD 3N32A 4HAYB 4CQNA 2BKFA 4TSSA 3OWEB 1NVID 2JP2A 5CHVC 3VH4B 4DQOC 1WZ3A 2O6VB 2LXCA 1TKYA 2C9WB 1U5DA 3NVWA 4EFOA 2PPHA 3J9CA 3PRZA 2ZZPB 1KC7A 2WX0A 1E90A 5DPRA 4B95A 3NW8A 4DHJB 4K2PA 3HVDA 3GS2A 3TEXA 1YN3A 1OMWA 5BYRA 4P1BC 2WXHA 2JZ3B 4M8MA 3OJ4B 3SV1A 2HE7A 1WJ6A 3EUB2 4F7ZA 2LOXA 2V4IB 3MHSD 5IP4D 3UI3A 3UZTA 2VSZA 1VRAB 4HCNB 2VH1A 2RNRB 4W9CA 2FAZA 2BS4B 5C6RA 2R2QA 3DBRB 3Q8BA 4JK7A 1TIFA 3AB5A 5IO9A 3CF6E 4MH8A 4KAXB 1Q1OA 1MK9B 2KUPA 1E0ZA 3CIKA 1JDEA 3W5VB 2CRFA 2NPTB 1F2RC 1PGBA 3AE3B 4JGHB 3O96A 1Q10A 2Y5PA 2MBBB 4NJCA 4LLGM 3MTNB 4N9F4 3U30A 1FOEA 3ZYYX 2G4DB 1MAIA 4EZLA 3PV1A 4ZRQA 1WJMA 2FDQA 1C79A 4NSWA 4EZKA 2GJYA 5JP4A 5DI9B 3TW1A 1YQ4B 1WF9A 2Z0DB 1IBXA 2KQSA 1U5EA 2IZVB 4G3XB 1MIZB 4YSYB 1FGYA 1FCLA 2IY0B 2D5GA 1WY8A 3AE9B 3RUIB 1BUIC 1YOVB 2DZKA 2O2VA 4HPMB 1P6SA 4A3PA 1P7EA 4HROA 3BJIA 3VUYA 3QK0A 1FPYA 1MHHE 3B1LX 2MP2A 3FILB 5BO4B 3NS8A 3H9DA 3R2IA 4L23A 1P9DU 5JHHA 1D4BA 2E6XA 4GDKA 4HAZB 2JRHA 4JIOU 1W1GA 1YX6B 3BK1A 4HAUB 3ODXA 1D5ZC 4KX6B 2I1JA 3T9LA 4JK9A 4WSFA 1C4PA 1VZ7A 3NOBA 2M56B 2MJ3A 3FILA 5JZEB 1IYFA 5G5GA 1V49A 4AQ7A 2N9PC 4KHOA 1TGZB 2ZNVB 2V9HA 3TEYA 2KMCA 4R3DA 3L4PA 4UDUC 3KRWA 2A5UA 1QOGA 3P4PB 3BYYB 1MK7B 4PS7A 2JRIB 5CX3A 3DQVA 4MJSA 3S2AA 4RFBA 2BYFA 2MCNB 3HQCA 2HJ1A 2NVUI 1L4ZB 1OQQA 4K3BA 4MSQB 1JWAD 3LJUX 2KWVB 3U4EG 1L0VB 2N0SB 2COCA 3DVNU 3PRPB 4RCOA 3LYYA 5HI1A 4YWGG 3WALA 4L6EA 2PVOD 1EM7A 3GYOA 5I4DA 2KDFB 2W3RA 1P3QU 4WWMA 2CU1A 3A4RA 1G6JA 3TCAA 2UZRA 3OG5A 4S0RA 3W9CB 2N9XA 1X11A 2WHIA 2KN5A 5HE1A 4PS8A 2L00B 2K0PA 4PT5A 2BTEA 4TKNA 3PLVA 2IGHA 4GU2A 4URKA 2ON8A 2C60A 1KLVA 1ZXIA 2MBOA 1MHXA 3KQ4A 2M19A 5C16A 5BMHA 2KAJA 3E66A 4IM2A 1TT5B 1WR1A 4NPNA 1IPGA 4JKFA 4ZHOA 1SIJA 1EWCA 4FA6A 4G50A 1R4MB 1MVKA 4PQ0A 4QJ4B 4TV3A 2KDIA 1ZOYB 3UF8A 3R2TA 1QOFA 2COFA 4GN1A 3Q8FA 2H7EA 1NYQA 4LNFA 3KUCB 1C78A 5GMVA 3O65B 4QXAB 2RGFA 2MDXA 4M02A 1XCGA 2WXNA 3EA6A 4ICUA 2BKRB 3NZSA 2FE8A 1RYJA 3CSTA 2WXQA 1WGRA 3L54A 5HHDG 2VH2A 1I2HA 5H8YE 2WP9B 3NHEB 4MDKE 2HD5B 4MGKE 3ZKJC 3AE8B 1P1AA 2M4NA 3PP2A 3UIPB 2JY6A 1UNPA 2FIFA 4B0EA 2BF8B 5KQ1A 5IA7A 2WXLA 2VKIA 2M17A 3UINB 3B2FA 4ZOHC 3MC8A 3LDZE 2NPTA 4YTMB 3KSYA 1P7FA 1KLUD 4US9A 2J0MA 4RGTA 4RGOS 2NBWB 2J59M 1KLGD 4GMVA 4JKDA 5AZGA 1TY2A 2NCNA 3WA0A 2N0YA 4FJZA 1E8ZA 3N30A 1Y19B 1SF0A 4AJYB 1Q5WB 2P0DA 4ZRKA 3OLMD 1FMAD 2LBBA 3NWDA 5J3YA 2CHWA 3P1MA 1C3TA 1QOBA 2LYDA 3SEBA 3VQIA 1TJ6A 3GZNB 4JL9A 1Z87A 3QARA 1FCCC 2YRYA 2KQ4X 4OVZA 4USAA 4FJVB 1I4RA 3AM9A 1WI1A 4TUUA 1NEKB 3U52E 3TJPA 2Q5WD 1LM8B 3KRXA 4MACA 2C7MB 2MQJA 2LD9A 2RDGA 2MBHA 5MPOA 3NWAA 3PZDA 3SBGA 1WJUA 4JKAA 3QIJA 1ZGUB 1IGDA 4IWOA 4WQOB 2KDEB 4KZCA 2CR5A 4FHJA 2KO3A 1E7VA 1LFDA 1XLQA 1QILA 2D3CA 4YXDB 5CTRC 2WNMA 1RRPB 4XWWA 1ZVRA 1DGJA 1OEYJ 4A6QA 2QILA 1GB4A 2GUMA 1WGHA 4OZBA 2BB6A 3AJ4A 2V4LA 2REXA 5M4YB 3AE6B 1KFYB 1SE9A 2YSZA 2QKMA 3DHIC 3NWFA 1XO3A 3BK2A 4WJQA 4GPTB 3WANA 2INNE 4WAFA 4D2KA 2RSGA 1E10A 4QJ3B 1WJ4A 1QQGA 3Q3MC 2KNBA 1UNRA 1WM3A 4F1SA 1Y56A 4ZRJA 2O6VD 2V3SA 1GPXA 1I4QA 2XN9C 1M4VA 3PG7A 3V6CB 2IBIB 2ZCBA 4WJPA 2AYOB 1T6BX 2N9EB 3VUXA 3BIID 4C7YA 2Z0EB 2Z59B 3Q14C 1K51A 5AZFA 1HZ6A 1R4NI 2OQBA 3PVUA 3C19A 2WXGA 2RGNB 4NQLB 3Q2AC 3SHQA 5IN7A 3M62B 1VCBA 2CU3A 4GZUA 1QOAA 1MI1A 4S17A 1KTKA 3RMKC 2COAA 3DVNV 4YTNB 3RULA 1CMXB 2PIAA 3ZNZB 4HSIA 3MP9A 2IYBA 3C8YA 3PRMB 4CSQA 1YJIA 4C00A 2VZKB 4GMXB 1J8CA 4IOYX 4DIXA 2KACA 3AU5A 1WZ0A 1XCTL 1RAXA 4P1CC 3ODOA 2K2UA 1AQCA 3HHMA 4C4VB 3M1IB 1F52A 3QHTA 5D3YA 2LVOA 2MJDA 3TMPB 2OOBB 4QJ5B 1FHOA 1OGWA 3A1QA 4IWPA 3RNGC 3RYTA 3W1SC 1U5FA 1K8RB 3ZVVA 2N23A 1ROEA 3FP5A 4WAAA 2K6QA 1WI0A 1JQ4A 3RPFC 1XCQL 1V1PA 3IHPC 1I4HA 2BB5A 2EMTA 1TY0A 3KLSX 5IOIA 3R7RA 4NNJB 1EU3A 1NYRA 3DBSA 5FI0A 5D3IB 4FULA 1SXTA 3OHMB 3AXCA 3GB1A 1WWTA 3RNFC 2YVCA 4MJSB 4A55A 2KZRA 4FADA 1JMLA 1NDDA 1YMHE 2LVQA 2JPHA 3NVYA 4BKTA 1VZ6A 3ETRA 2KC2A 2G1EA 1JW9D 2PW9A 1Q67A 1UWMA 3ZRFA 3X0WA 3N1ZC 4IW0A 1DDVA 3E9SA 4WIPA 5G2NA 4IFSA 2FUG1 4ILJA 2KXJA 2KJRA 4ZRPA 2NR2A 4ILGB 2Y7BA 2KTRA 3GE8C 1WGKA 3P42A 3W1SA 5KHQA 5C5BA 2QKLA 4ZDVA 2ADZA 1N60A 1FXAA 2IFSA 5E6JA 4K7WA 4EZJA 1RLFA 2ASQA 3B0AA 3P63A 3AE4B 1WXMA 1AWEA 3VTVA 4X57B 1NU2A 4II3B 2KX0A 2LG1A 3QX1A 4XX5A 1ESFA 3E9PA 1MPHA 2BQQA 2MH7A 2D9XA 3VAWA 3A58A 5EFXA 4ZYNA 2CY5A 4GDLB 4ZHPA 3ZUNA 1GUAB 5LNK1 1T5XD 1STEA 2L32A 3DHHC 1F77A 4ANUA 1N5XA 3EC8A 1WFYA 2N4FA 4HB2B 1X86A 4CYEA 1IUEA 3V60A 3VDZA 2WXOA 1HXYD 4HCPB 4JKHA 4DWFA 1MFWA 4A8XC 4E74A 4B0MA 1DOXA 1PYWD 2K8BA 2IY1B 1AYFA 3AE2B 5J17A 3ZJVA 1DBHA 2DLBA 5C3JB 1S3SG 4OZAA 3I9V1 3UQAA 1WR6E 4D0NB 1V5MA 4A6KA 2KC1A 3TL5A 5HKHA 3N20C 1OEYA 4JKGB 2D3AA 2V0GA 3NVVA 1R4MI 2PE9A 2QIEB 3KW5B 2FCSA 1R4NB 1FHXA 1WX8A 2N7EA 4KKJA 2D9YA 2LGXA 4A6HA 5J2RA 3TBLD 5JH5C 2LEKA 2RLOA 1WJ1A 2YT0A 3W5UB 5C5BB 2HTHA 2KDMA 4LJOB 1U5GA 2GMIC 4FBJB 1TQZA 4Y94A 1ZKHA 1H8CA 4JQWC 2QCZA 2JXTA 2K39A 2KJ6A 3KUDB 1MJDA 2X0SA 1GOZA 2WX1A 2M38A 1SE4A 4MT7A 1QF6A 2WS3B 1HB8A 1MG4A 4K2OA 1RFAA 1P3RA 4EMOA 2XBBC 1XLOA 2R2OA 5DH9B 4IC7B 4DXGA 4HKZE 3JYUA 2PE6B 3VH3B 1MG8A 2G35A 2GCJA 3W1YA 2Z0PA 1PUTA 2L0FA 1RM6C 3CIRB 5JVLA 4W9FA 1NENB 4NZLB 1K5GB 1ZYIA 4LNKA 4JPSA 2WXKA 5BYQA 5J3TA 3JSVA 3DXEA 1YD8U 1V1PB 3FEHA 2LXAA 4IKGA 2MWNB 2HDEA 1CK1A 2UYZB 2SEBD 3Q69A 5DHFB 4K81A 2WLBA 3AULA 4OT1A 1IGCA 3A1QB 1X05A 4XWTA 1WX7A 3EFUA 2JWZA 1EF1A 5G5HA 4GSWA 1M94A 1YN5A 2SAKA 4KIKB 4AWJA 2N1VA 2KKCA 1Z5SB 2N9LA 2KIGA 2BWES 2W54A 2AX5A 1GC7A 4H8SA 2V3PA 1FO4A 1C76A 2Y3AA 1T0QC 2MEKA 2H7DA 1H10A 4AS1A 4Z2MB 2DA0A 2KTRB 4JWUC 1FM0D 3FKYA 1WXSA 5KCVA 1L0XB 1HA5A 1UBQA 4XC2A 4FXCA 2D9VA 4I6PA 3ZNGC 3RFZB 2CKHB 4IAPA 1D3ZA 4B9KA 1U27A 5FR6A 3HSAA 4PYZA 5LXIB 2R0DA 3VUWA 3QQ8B 4OVUA 2YEPF 2ZW1A 2LHDA 3VIAA 3VRBB 2H88B 1SBBB 2ICIA 2DZJA 2K3UA 3OAWA 3L10B 4NY0A 5LG4B 3Q3FA 3A98B 2JYEA 4JE3B 3DWMA 5D2MB 1GGOA 1W1HA 2E2XA 2LHEA 4FHKA 3PREA 3TEWA 1X1FA 3N9YC 2LULA 2Q13A 2YS5A 1TZ1A 2V1YA 2RD0A 2R61A 1AWDA 2MBQA 1N61A 4RH6A 5D3WA 3AECB 5FK9C 2KFKB 1UD7A 3P6AA 3EPYA 2UU7A 3ZJTA 4PYUA 3QBVB 4EEWA 3IVFA 2PZ1A 5G55A 1WXQA 1I4PA 1UNQA
chains in the Genus database with same CATH topology
1SIFA 2PJHA 4BKGA 3TVVA 4ASWC 3T06A 2Y5BB 1ZSQA 2NZ8B 3OJ3A 2K8CA 2FUHB 4M0WB 2CHZA 1YQBA 1XQQA 1WMHA 1EO6A 2BPSA 1WH3A 2WH5A 4DHZB 2EMSA 1S1QB 3DDCB 4MK0A 3NSUA 2C7NB 2EJ8A 2KLCA 4E3CA 2M0XA 1Y5OA 2WWZA 3VXWA 2ELAA 3PS6A 1FHWA 2YT1A 1WGYA 5DPWA 2AEHA 2WDTB 3DXDA 4B6WA 2JUOA 1AARA 1PQSA 1WGDA 1KOTA 1U2BA 4WJOA 1XKEA 4EJNA 1KZGA 4YONA 5CHFA 1TBEA 4LCDE 4K1RB 4TQ0A 3ULBA 2N1WA 2ZJDA 4TYZA 2NS5A 3PLUA 1V2YA 3ZDTA 5D7GA 1WXVA 4MEMA 3T8MA 3N7CA 4I6LB 2ROZB 4LDTB 5GOWB 1WXAA 4WVFB 2J0JA 1WVHA 2HJ8A 4AJWA 5IJMA 4JKCA 1VD2A 5CLLB 4KHBB 4AOFA 3U8ZA 3D8DA 2JXXA 1T0YA 4HB0B 5J18A 3A9KB 4W9JA 1V86A 4GB9A 1V9JA 3JW0X 5D3VA 3ML9A 4F8CB 2W2XC 2K25A 1XT9B 1ST7A 4MM3A 2A4ZA 3V61A 2MBEA 4BKSA 4CHMA 2KD0A 2GBKA 3BINA 4GDKB 2LWPA 4HXDA 3F0WA 4A6FA 1HB6A 4DX8A 1V61A 2CHXA 3FLVA 4W9HA 4F7HA 2HRJA 1YJ1A 2DENB 4XWXA 3RZWC 3RCPA 4GXBA 3WAOA 2KVRA 2KDBA 4F7UP 1DIKA 4W9LA 2YF0A 2ZPNA 1L7YA 2G4SA 4KDLB 3GOEA 3L17A 1BT0A 1KJTA 3QCAA 1P5TA 4BOSC 5C79A 1XODA 3ZIMA 3H7PA 2BGFA 2DYBA 2GBJA 3QA8A 2Y8GA 2ZEQA 2CS4A 4HHVA 3WAMA 4BOZB 2DKPA 2ZPYA 2RVBB 4MY6A 2KJHB 4BKSD 4JKBA 1ISNA 5E6PA 4AP4C 4JKEA 3WIMA 4W9IA 3Q3JA 1FB8A 2KLGA 4NJ6A 3UQBA 1U4AA 1EUVB 2BYVE 1H4RA 4PS3A 5D94A 2LGYA 1JRUA 5L95C 4KDIC 2IYDB 3KY9A 3A9KA 4W9GA 4MGYE 2KHWB 1WGQA 2FCMA 2RR9A 2D10A 2O6VA 2QHOA 1GG3A 2KFJA 5LONB 2EKEC 3A8QA 2ZNVC 2OJRA 1SGHA 5JHBA 2K6DB 5LOPB 4HPLB 1EVHA 3L16A 2G3QB 1NTIA 2P8VA 3HM6X 5C1ZA 3IBEA 4P7IA 3PT2B 4XZ4A 5DPTA 4KHAA 2L3ZA 4IG7B 3ZVRA 3TIXA 5IAAC 4DX90 4A3OA 2XK5A 2DHIA 3R7QA 2MRPA 2V76A 1Q0WB 3SBTA 5LXHA 2MWSB 2I1KA 2EC1A 2KWUB 1FAOA 1MKEA 1LXDA 3RCZA 1WIAA 2C7HA 1NBFC 2UZSA 5HE2A 3MDBC 4KIKA 4CO7A 1X1MA 1UPRA 3UGBB 3E9OA 3SDLC 5KQ4A 3E9LA 2L2IA 2NBVB 2LGDA 1WMHB 1RJ2A 3APDA 2R09A 3M3JA 3VVWB 2L76A 3AU4A 3GZNI 3ZTDA 5KHOA 2I5CA 3B08A 1B55A 2DTCA 4MELA 2COPA 2VRWB 2KMAA 1DROA 1XD3B 1WYWB 3VOQA 2D07B 1UGMA 3VTWA 4II2B 3ODWA 3ZLZA 4IM3A 4WJ7A 3QAQA 3MJWA 4JLCA 2L05A 5HE3A 3A9JB 1GJZA 3PHXB 2Z0OA 5FI1A 1OQNA 3DBRI 4DDID 5JHAA 4DBBA 3H7SA 3RZFA 3D8EA 5AZHA 3V62A 3D32A 3ZO5B 2DKQA 2Z0QA 3CXBB 4IWQA 2W2WA 2KQ7A 3DVGX 4HB4B 2L1CA 1UEFA 4W9KA 1V5TA 3QWMA 2RPQA 4ANWA 3PGEA 2K00A 2O2VB 1DYNA 4WWOA 1KZ7A 1UH6A 4I6NB 1ZW7A 3SD5A 3SU8X 3GYPA 4HLEA 1VBGA 4NJ7A 1BTNA 4FN2A 2JZZA 2FIDA 2RUKB 4HAVB 4HAXB 4GDLA 1J19A 2VRRB 4ICVA 4K17A 1TXDA 2J7QB 1P0RA 1WE6A 5LLIA 3PHWB 2IO1B 4NAWA 1I42A 3F5RA 1HE8A 3H1UA 3KYDD 2KFKA 3KVFB 4NAWB 3G9WA 4W9DA 2BYEA 4ANXA 2MKRA 4J6IA 3TFMA 3VFKA 4GOCA 1WGUA 3ZNHB 2XQNM 4DDGD 4WJNA 3N3KB 4BBNF 2CY4A 2KCJA 2MLBA 4A20A 1DDMA 4ILHA 2B3AA 1DDWA 5DPSA 1NI2A 2DYNA 3FM8C 4AUQC 1GC6A 3MPXA 3L0WB 1PLSA 4MH0E 4K7UA 5D27A 1OY2A 1FXTB 4B6HA 4W9EA 2KOXA 1BAKA 2D2QA 2LRUA 2CQUA 3HM3A 3R3MA 3EECA 2ELBA 1SHCA 2D9ZA 2BCJA 2ZVOA 3C0RB 4G11A 1V5PA 2K2JA 1K5DB 4CHJA 2N7DA 5DCNA 3ULCA 3UIOB 2IO2B 2JVCA 4HDQA 2MFQA 2FCNA 1I7AA 4ZRIA 4KSKC 1XX0A 4NQKE 2DHKA 3QJZA 2DX1A 1TTNA 2LUEA 4KV2A 1ZC4B 2LOZA 4M8NA 1P98A 2RQ1A 2DN6A 2DX5A 1WX9A 2K8HA 2DAFA 1FGZA 1V88A 1ACAA 3D8FA 4GIVA 4F7GA 4HDOA 3PPAA 3CSFA 3BY4B 2YS3A 2W2XD 5DIFB 1OQYA 4YL8A 1KI1B 1PMSA 3ZRCA 2DFKA 2KTFA 4WWPA 3DOWA 2L7RA 2MX2A 1V89A 3X23A 4RM8A 2D9WA 2GBNA 2G45B 2DZIA 1Z2MA 4MSMB 4IM0A 2GBMA 2FCQA 4E71A 3PVLA 2AWTA 5HE0A 1NTVA 2DYMA 1U29A 3WAPA 5TR5A 2MW5A 4BBNC 4ANVA 2R82A 2DLWA 4BFRA 4CHKA 2LVPA 4DHJD 3A9JA 1M7EA 3I3TB 3ALBA 1V81A 1BTKA 2Y8FA 2GBRA 4DBGA 1KBLA 5CHWA 1YX5B 1E7UA 3ECIA 5L83A 3RD2A 3RT3B 2M1MA 4RMAA 3M63B 3H7PB 5JHGA 1E8WA 2DAJA 3KUZA 2I5FA 3ZW3A 2MSED 1ZC3B 3DBHI 2XEWA 2FJLA 1BWNA 3APFA 4LJPB 2AL3A 1NTYA 2CB8A 3K9PB 2DX5B 3ZDMC 2RSUA 3JVZX 3ENBA 4C0AA 2L8JA 1EGXA 2YS1A 3A33B 4Z2NA 4JK8A 2HTHB 4DXAB 1XR0B 1OTRB 5L81A 2DYQA 1A5RA 1J0WA 3SNHA 1YIWA 3ZNID 2GS0A 2DIKA 2IO3B 4JKGA 4EUTA 2XK5B 1QC6A 3P2BA 3V6EB 2YLMA 4EKUA 1LB1A 4DK5A 3DPDA 1QZEA 3SO6A 1V80A 1I35A 1C1YB 2KANA 4HB3B 3IFWB 1VBHA 3HW2B 2CODA 1Y8RC 4MGZE 4WWNA 1ZM0A 3LJ3A 3DXCA 1W1DA 4MGIE 2X18A 2FJ9A 5EDSA 1F9JA 3DVGY 4FJYA 4RM9A 3DCGA 2CAYA 1EAZA 1LW3A 1WRDB 2M14A 5DHAB 5J3QA 3H6NA 3PVWA 2LKOA 4A6FB 2KGXB 1EF5A 2P0HA 3QC8B 2GCLA 3L08A 5D6JB 2DYOA 1UPQA 1UZXB 3HK0A 3WYFB 2ZCCA 2UVMA 2MA9B 1N3HA 2MP2B 2WYQA 4G0NB 3DBLI 3A8PA 3K9OB 2UWQA 3P7ZA 3ZTCA 3PSCA 1IP9A 3ML8A 3A4SC 2OTXA 1WGGA 2J0KA 1WM2A 3EHVA 3APCA 1X1GA 2ZVNA 1MIXA 2DHJA 3PTFC 2KWCA 3TO1A 3R66C 1KM7A 3NY5A 1WE7A 2M8SA 4OVVA 3IG3A 2IO0B 1WJNA 2NBUA 4EOYA 5C23A 4HVBA 1V5UA 3KYCD 3VHTC 1NVLA 3M95A 3HIZA 2ROVA 2W9NA 2D4QA 2DHZA 5CLQB 1V6EA 2D11A 1E5WA 1E8XA 2K1FA 4HK2A 2BWFA 2PEAA 2L0TA 1HBKA 3ML4A 2LZ6A 3U7DA 2GOWA 3AI5A 3NZUA 3QWZB 4BBKA 3VTUA 3L13A 4FLHA 4K7SA 2LJ5A 3PSEB 3ENEA 4DHZE 4KVGB 4GGQA 2KK8A 2LRWA 5E6OA 2LI5A 4HWIB 1IRSA 2DZMA 1GNUA 1J0GA 3PEGA 2FNJB 1M7RA 1UBIA 2LASA 1XD4A 1RRBA 3FSSA 3SUZA 4IUMB 5D3XA 1V5OA 2NMBA 1WG7A 3KH0A 5E6NA 3CMMB 1E8YA 2KX3A 5AEKB 3V5WA 2JT4B 4TQ1A 2C5LC 4HJKA 3ONSA 3KZ1A 2D3GA 4BVUC 2ABDA 2P0FA 4KZ0A 4PNKA 1UELA 3OANA 4HATB 1PFJA 5JLJB 1L2NA 4HAWB 2AL6A 3JSVB 3SYXA 2JF5A 4KSLC 1LQBA 4A5KA 4LDTD 3N32A 4HAYB 2BKFA 2JP2A 5CHVC 3VH4B 1WZ3A 2O6VB 2LXCA 2C9WB 1U5DA 4EFOA 2PPHA 3PRZA 2ZZPB 1KC7A 2WX0A 1E90A 5DPRA 4B95A 4DHJB 4K2PA 1OMWA 2JZ3B 4M8MA 3OJ4B 3SV1A 2HE7A 1WJ6A 4F7ZA 2LOXA 3MHSD 3UZTA 2VSZA 4HCNB 2RNRB 4W9CA 2FAZA 2R2QA 5C6RA 4JK7A 3CF6E 4KAXB 1Q1OA 1MK9B 2KUPA 3CIKA 1JDEA 2CRFA 2NPTB 4JGHB 3O96A 2MBBB 3MTNB 4N9F4 3U30A 1FOEA 2G4DB 1MAIA 4EZLA 3PV1A 1WJMA 2FDQA 4NSWA 4EZKA 2GJYA 5JP4A 5DI9B 3TW1A 1WF9A 2Z0DB 2KQSA 1U5EA 2IZVB 4G3XB 1MIZB 1FGYA 2IY0B 1WY8A 3RUIB 2DZKA 2O2VA 4HPMB 1P6SA 4A3PA 3BJIA 3VUYA 3QK0A 3B1LX 2MP2A 5BO4B 3NS8A 3H9DA 1P9DU 5JHHA 4GDKA 4HAZB 2JRHA 4JIOU 1W1GA 1YX6B 4HAUB 3ODXA 3T9LA 2I1JA 4JK9A 4WSFA 3NOBA 5JZEB 1IYFA 1V49A 2N9PC 4KHOA 1TGZB 2ZNVB 2KMCA 3KRWA 2A5UA 1MK7B 4PS7A 2JRIB 5CX3A 3DQVA 4MJSA 3S2AA 2BYFA 2MCNB 3HQCA 2NVUI 4MSQB 3LJUX 2KWVB 2COCA 3DVNU 3PRPB 3WALA 4L6EA 3GYOA 2KDFB 1P3QU 2CU1A 3A4RA 1G6JA 3TCAA 2UZRA 2N9XA 1X11A 2KN5A 5HE1A 4PS8A 2L00B 4TKNA 3PLVA 4GU2A 4URKA 2C60A 1KLVA 2MBOA 5C16A 3E66A 4IM2A 1WR1A 4NPNA 1IPGA 4JKFA 4FA6A 4G50A 4PQ0A 4TV3A 2KDIA 3UF8A 2COFA 4GN1A 2H7EA 3KUCB 5GMVA 3O65B 2RGFA 2MDXA 1XCGA 4ICUA 2BKRB 3NZSA 3CSTA 1WGRA 3L54A 1I2HA 3NHEB 4MDKE 2HD5B 4MGKE 3ZKJC 1P1AA 2M4NA 3PP2A 3UIPB 2JY6A 1UNPA 2FIFA 2BF8B 5KQ1A 5IA7A 3UINB 2VKIA 2M17A 3LDZE 2NPTA 3KSYA 2J0MA 2NBWB 2J59M 4GMVA 4JKDA 5AZGA 2NCNA 3WA0A 2N0YA 4FJZA 1E8ZA 3N30A 1Y19B 4AJYB 1Q5WB 2P0DA 4ZRKA 3OLMD 2LBBA 5J3YA 2CHWA 1C3TA 2LYDA 3VQIA 1TJ6A 4JL9A 1Z87A 3QARA 2YRYA 4FJVB 1WI1A 4TUUA 3TJPA 1LM8B 3KRXA 2C7MB 2MQJA 2LD9A 2MBHA 3PZDA 3SBGA 1WJUA 4JKAA 3QIJA 1ZGUB 4IWOA 4WQOB 2KDEB 4KZCA 2CR5A 4FHJA 2KO3A 1E7VA 1LFDA 5CTRC 1RRPB 1ZVRA 1OEYJ 1WGHA 3AJ4A 2V4LA 2REXA 1SE9A 2YSZA 2QKMA 4WJQA 4GPTB 3WANA 2RSGA 1WJ4A 1QQGA 2KNBA 1UNRA 1WM3A 4F1SA 4ZRJA 2O6VD 2V3SA 3PG7A 3V6CB 2IBIB 2ZCBA 4WJPA 2AYOB 2N9EB 3VUXA 2Z0EB 2Z59B 5AZFA 1R4NI 2OQBA 3PVUA 2RGNB 4NQLB 3SHQA 3M62B 1VCBA 4GZUA 2COAA 3DVNV 3RULA 1CMXB 3ZNZB 2IYBA 3PRMB 4GMXB 1J8CA 4IOYX 3AU5A 1WZ0A 1RAXA 3ODOA 2K2UA 1AQCA 3HHMA 3M1IB 3QHTA 5D3YA 2LVOA 3TMPB 2OOBB 1FHOA 1OGWA 3A1QA 4IWPA 3RYTA 3W1SC 1U5FA 1K8RB 3ZVVA 2N23A 3FP5A 4WAAA 2K6QA 1WI0A 3IHPC 2EMTA 3R7RA 4NNJB 3DBSA 5FI0A 4FULA 3AXCA 2YVCA 4MJSB 2KZRA 4FADA 1NDDA 2LVQA 2JPHA 4BKTA 2KC2A 1Q67A 3ZRFA 3X0WA 4IW0A 1DDVA 5G2NA 4IFSA 4ILJA 2KXJA 2KJRA 2NR2A 4ILGB 2Y7BA 2KTRA 3W1SA 5KHQA 5C5BA 2QKLA 4ZDVA 2ADZA 2IFSA 4K7WA 4EZJA 1RLFA 2ASQA 3B0AA 1WXMA 1AWEA 3VTVA 4X57B 1NU2A 4II3B 2KX0A 2LG1A 3QX1A 4XX5A 3E9PA 1MPHA 2D9XA 3VAWA 5EFXA 4ZYNA 2CY5A 4GDLB 3ZUNA 1GUAB 4ANUA 3EC8A 1WFYA 2N4FA 4HB2B 1X86A 4CYEA 3V60A 3VDZA 4HCPB 4JKHA 4DWFA 4E74A 2K8BA 2IY1B 5J17A 1DBHA 1S3SG 3UQAA 1WR6E 4D0NB 1V5MA 4A6KA 2KC1A 3TL5A 5HKHA 1OEYA 4JKGB 1R4MI 2PE9A 3KW5B 2FCSA 1FHXA 1WX8A 2N7EA 2D9YA 2LGXA 4A6HA 5J2RA 3TBLD 5JH5C 2RLOA 1WJ1A 2YT0A 5C5BB 2HTHA 4LJOB 1U5GA 2GMIC 4FBJB 1TQZA 4Y94A 1ZKHA 1H8CA 4JQWC 2K39A 2KJ6A 3KUDB 2X0SA 2M38A 2WX1A 4MT7A 1HB8A 4K2OA 1RFAA 1P3RA 4EMOA 2XBBC 2R2OA 5DH9B 4IC7B 3JYUA 2PE6B 3VH3B 1MG8A 2G35A 2GCJA 3W1YA 2Z0PA 2L0FA 5JVLA 4W9FA 1K5GB 5J3TA 3JSVA 3DXEA 1YD8U 3FEHA 2LXAA 2MWNB 2UYZB 5DHFB 4K81A 3AULA 3A1QB 1X05A 1WX7A 3EFUA 2JWZA 1EF1A 4GSWA 1M94A 4KIKB 4AWJA 2N1VA 2KKCA 1Z5SB 2BWES 1GC7A 4H8SA 2H7DA 1H10A 4Z2MB 2DA0A 2KTRB 1WXSA 5KCVA 4XC2A 1UBQA 2D9VA 4I6PA 3ZNGC 2CKHB 4IAPA 1D3ZA 4B9KA 1U27A 5FR6A 4PYZA 5LXIB 2R0DA 3VUWA 3QQ8B 4OVUA 3VIAA 2DZJA 3OAWA 3L10B 4NY0A 3Q3FA 3A98B 5D2MB 1GGOA 1W1HA 2E2XA 4FHKA 3PREA 1X1FA 2LULA 2Q13A 2YS5A 1TZ1A 2V1YA 2RD0A 2MBQA 5D3WA 2KFKB 1UD7A 3P6AA 3EPYA 4PYUA 3QBVB 4EEWA 3IVFA 2PZ1A 5G55A 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDE B;  4KZC A;  1SIF A;  2CR5 A;  4FHJ A;  2KO3 A;  1E8X A;  1E7V A;  2K1F A;  4HK2 A;  1LFD A;  2BWF A;  2PJH A;  2FID A;  2RUK B;  5CTR C;  2PEA A;  2L0T A;  1RRP B;  1HBK A;  4HAV B;  4HAX B;  4BKG A;  4GDL A;  3ML4 A;  1J19 A;  1ZVR A;  2LZ6 A;  3U7D A;  3TVV A;  2GOW A;  1OEY J;  2VRR B;  3AI5 A;  3NZU A;  4ICV A;  4ASW C;  4K17 A;  1TXD A;  3QWZ B;  4BBK A;  3VTU A;  3L13 A;  4FLH A;  3T06 A;  1P0R A;  1WE6 A;  1WGH A;  2J7Q B;  2Y5B B;  3AJ4 A;  4K7S A;  2V4L A;  5LLI A;  1ZSQ A;  2LJ5 A;  2REX A;  3PHW B;  3PSE B;  1SE9 A;  2YSZ A;  2NZ8 B;  2QKM A;  2IO1 B;  3ENE A;  4NAW A;  4WJQ A;  4DHZ E;  1I42 A;  3F5R A;  1HE8 A;  4GPT B;  3H1U A;  3KYD D;  4KVG B;  2KFK A;  4GGQ A;  3KVF B;  4NAW B;  3G9W A;  2KK8 A;  2LRW A;  3WAN A;  4W9D A;  2BYE A;  2RSG A;  5E6O A;  2LI5 A;  4ANX A;  2MKR A;  3OJ3 A;  1WJ4 A;  4HWI B;  2K8C A;  1QQG A;  2FUH B;  4M0W B;  2CHZ A;  2KNB A;  1IRS A;  1YQB A;  1XQQ A;  3TFM A;  1GNU A;  2DZM A;  1WMH A;  4GOC A;  1WGU A;  3VFK A;  1J0G A;  1EO6 A;  3PEG A;  2BPS A;  1UNR A;  2FNJ B;  1WH3 A;  3ZNH B;  2XQN M;  1WM3 A;  2WH5 A;  1M7R A;  4F1S A;  4ZRJ A;  4DDG D;  1UBI A;  2LAS A;  2O6V D;  4WJN A;  2EMS A;  3N3K B;  4BBN F;  2V3S A;  2CY4 A;  1S1Q B;  3DDC B;  3PG7 A;  1XD4 A;  3V6C B;  2IBI B;  2ZCB A;  4MEL A;  4WJP A;  2KCJ A;  1RRB A;  3FSS A;  2MLB A;  4MK0 A;  3SUZ A;  2AYO B;  2N9E B;  4IUM B;  3VUX A;  4A20 A;  3NSU A;  2C7N B;  4DHZ B;  5D3X A;  2Z0E B;  1DDM A;  2Z59 B;  2B3A A;  2EJ8 A;  2KLC A;  1DDW A;  5AZF A;  1R4N I;  2OQB A;  3PVU A;  4E3C A;  3W1S C;  2RGN B;  1V5O A;  5DPS A;  2M0X A;  4NQL B;  1Y5O A;  1NI2 A;  2WWZ A;  3VXW A;  2NMB A;  3SHQ A;  2DYN A;  3FM8 C;  1WG7 A;  4AUQ C;  1GC6 A;  3KH0 A;  5E6N A;  3CMM B;  2ELA A;  3MPX A;  1E8Y A;  3L0W B;  3M62 B;  3PS6 A;  2KX3 A;  1VCB A;  5AEK B;  3V5W A;  1FHW A;  2YT1 A;  2JT4 B;  1PLS A;  4TQ1 A;  2C5L C;  1WGY A;  4MH0 E;  4HJK A;  5D27 A;  3ONS A;  2AEH A;  2WDT B;  1OY2 A;  4K7U A;  5DPW A;  1FXT B;  4B6H A;  3DXD A;  4W9E A;  2KOX A;  4B6W A;  3KZ1 A;  4GZU A;  2D3G A;  2JUO A;  1BAK A;  2D2Q A;  1AAR A;  1PQS A;  2LRU A;  2CQU A;  4BVU C;  1WGD A;  1KOT A;  2ABD A;  1U2B A;  4WJO A;  1XKE A;  4EJN A;  1KZG A;  4YON A;  3HM3 A;  3EEC A;  3R3M A;  2P0F A;  2ELB A;  2COA A;  3DVN V;  4KZ0 A;  5CHF A;  1SHC A;  4PNK A;  2D9Z A;  1TBE A;  4LCD E;  1UEL A;  3RUL A;  3OAN A;  2BCJ A;  4K1R B;  4TQ0 A;  3ULB A;  4HAT B;  2N1W A;  2ZJD A;  1PFJ A;  2ZVO A;  4TYZ A;  2NS5 A;  3C0R B;  5JLJ B;  3PLU A;  1L2N A;  1CMX B;  3ZNZ B;  4HAW B;  1V2Y A;  4G11 A;  2AL6 A;  2IYB A;  3ZDT A;  1V5P A;  1K5D B;  2K2J A;  4CHJ A;  2N7D A;  3JSV B;  1WXV A;  3PRM B;  4MEM A;  5D7G A;  5DCN A;  3ULC A;  3T8M A;  3UIO B;  2IO2 B;  3SYX A;  4HDQ A;  2JF5 A;  4GMX B;  2JVC A;  1J8C A;  3N7C A;  4I6L B;  4KSL C;  2MFQ A;  4IOY X;  1LQB A;  2ROZ B;  4A5K A;  2FCN A;  5GOW B;  4LDT B;  1I7A A;  4ZRI A;  1WXA A;  4WVF B;  2J0J A;  1WVH A;  2HJ8 A;  4KSK C;  4LDT D;  4AJW A;  3AU5 A;  4HAY B;  3N32 A;  5IJM A;  1WZ0 A;  1XX0 A;  4NQK E;  1RAX A;  2BKF A;  1VD2 A;  4BBN C;  2DHK A;  2K2U A;  2JP2 A;  3ODO A;  3QJZ A;  5CHV C;  3VH4 B;  1AQC A;  5CLL B;  2DX1 A;  3HHM A;  1TTN A;  2LUE A;  3M1I B;  4KHB B;  1WZ3 A;  4AOF A;  2O6V B;  2LXC A;  3QHT A;  4KV2 A;  3U8Z A;  1ZC4 B;  2C9W B;  3D8D A;  5D3Y A;  2JXX A;  2LVO A;  3TMP B;  2OOB B;  2LOZ A;  1U5D A;  4EFO A;  1T0Y A;  4HB0 B;  2PPH A;  4M8N A;  1FHO A;  1OGW A;  3A1Q A;  1P98 A;  3PRZ A;  4IWP A;  5J18 A;  2ZZP B;  2RQ1 A;  2DN6 A;  3RYT A;  2WX0 A;  2DX5 A;  1U5F A;  1WX9 A;  1E90 A;  2K8H A;  1K8R B;  3A9K B;  1V86 A;  2DAF A;  1FGZ A;  3KYC D;  4W9J A;  2N23 A;  1V9J A;  3FP5 A;  1V88 A;  3JW0 X;  4GB9 A;  4WAA A;  3ZVV A;  1ACA A;  5D3V A;  2K6Q A;  3ML9 A;  3D8F A;  4K2P A;  1WI0 A;  4DHJ B;  4GIV A;  1OMW A;  3IHP C;  4F7G A;  4HDO A;  2JZ3 B;  4M8M A;  3PPA A;  3OJ4 B;  3SV1 A;  4F8C B;  3CSF A;  2HE7 A;  2W2X C;  2EMT A;  1WJ6 A;  2K25 A;  3BY4 B;  3R7R A;  4F7Z A;  2LOX A;  2YS3 A;  1XT9 B;  4NNJ B;  1ST7 A;  2W2X D;  5DIF B;  1OQY A;  3MHS D;  4MM3 A;  4J6I A;  3DBS A;  3UZT A;  2VSZ A;  4YL8 A;  1KI1 B;  5FI0 A;  4HCN B;  2A4Z A;  4FUL A;  1PMS A;  3ZRC A;  3V61 A;  2RNR B;  3AXC A;  2MBE A;  4W9C A;  2FAZ A;  2DFK A;  5C6R A;  4CHM A;  2R2Q A;  2KD0 A;  2KTF A;  4BKS A;  2YVC A;  2GBK A;  4MJS B;  3BIN A;  4GDK B;  4WWP A;  2KZR A;  2LWP A;  4FAD A;  1NDD A;  3DOW A;  4HXD A;  2L7R A;  3F0W A;  1V89 A;  3X23 A;  2LVQ A;  2MX2 A;  2JPH A;  4KAX B;  3CF6 E;  1Q1O A;  4RM8 A;  2D9W A;  4BKT A;  4A6F A;  1HB6 A;  4DX8 A;  1V61 A;  2CHX A;  1MK9 B;  2G45 B;  3FLV A;  2DZI A;  2KUP A;  2KC2 A;  3CIK A;  4W9H A;  4F7H A;  1Z2M A;  2HRJ A;  1Q67 A;  2CRF A;  1YJ1 A;  2NPT B;  4EZJ A;  4JGH B;  3O96 A;  2DEN B;  4MSM B;  4XWX A;  3ZRF A;  3X0W A;  4XC2 A;  4IW0 A;  3RZW C;  1DDV A;  4GXB A;  3RCP A;  2MBB B;  4IM0 A;  5G2N A;  2GBM A;  2KVR A;  3MTN B;  4N9F 4;  3WAO A;  4IFS A;  2FCQ A;  2KDB A;  4F7U P;  4E71 A;  3PVL A;  3U30 A;  2KXJ A;  2KJR A;  4W9L A;  1FOE A;  2YF0 A;  2G4D B;  1MAI A;  2ZPN A;  2AWT A;  2NR2 A;  5HE0 A;  4EZL A;  2Y7B A;  2KTR A;  3PV1 A;  1NTV A;  1WJM A;  1L7Y A;  2DYM A;  2FDQ A;  2G4S A;  1U29 A;  3W1S A;  4KDL B;  3WAP A;  5KHQ A;  5C5B A;  4NSW A;  2QKL A;  5TR5 A;  2ADZ A;  2MW5 A;  4ZDV A;  4EZK A;  2GJY A;  5JP4 A;  3GOE A;  5DI9 B;  3TW1 A;  3L17 A;  2IFS A;  4ANV A;  1BT0 A;  1KJT A;  3QCA A;  1WF9 A;  2Z0D B;  4K7W A;  2KQS A;  1P5T A;  1U5E A;  5C79 A;  1XOD A;  2DLW A;  1RLF A;  2ASQ A;  2IZV B;  1WXM A;  1AWE A;  3B0A A;  3H7P A;  4G3X B;  1MIZ B;  1FGY A;  2BGF A;  4BFR A;  2DYB A;  2GBJ A;  2IY0 B;  1WY8 A;  3QA8 A;  2Y8G A;  4CHK A;  2ZEQ A;  3RUI B;  3VTV A;  2CS4 A;  4X57 B;  1NU2 A;  4II3 B;  2KX0 A;  2DZK A;  2LG1 A;  2LVP A;  2O2V A;  1P6S A;  3A9J A;  3QX1 A;  4HHV A;  1M7E A;  4HPM B;  4XX5 A;  1MPH A;  3WAM A;  4A3P A;  2D9X A;  3VAW A;  3I3T B;  5EFX A;  3BJI A;  3ALB A;  1V81 A;  3VUY A;  1BTK A;  3QK0 A;  4ZYN A;  2CY5 A;  2Y8F A;  4GDL B;  2GBR A;  4BOZ B;  2DKP A;  2ZPY A;  2RVB B;  4DBG A;  3B1L X;  5CHW A;  2MP2 A;  1YX5 B;  5BO4 B;  3ZUN A;  1GUA B;  4MY6 A;  3NS8 A;  1E7U A;  3ECI A;  5L83 A;  3RD2 A;  3H9D A;  1P9D U;  5JHH A;  2KJH B;  4ANU A;  4BKS D;  3RT3 B;  4GDK A;  4HAZ B;  2JRH A;  1ISN A;  2M1M A;  3EC8 A;  4RMA A;  5E6P A;  4AP4 C;  4JIO U;  1W1G A;  3M63 B;  1YX6 B;  3H7P B;  1WFY A;  5JHG A;  4HB2 B;  2N4F A;  1E8W A;  3WIM A;  1X86 A;  2DAJ A;  3Q3J A;  4W9I A;  4CYE A;  3KUZ A;  1FB8 A;  2KLG A;  4NJ6 A;  2I5F A;  3UQB A;  3ZW3 A;  1U4A A;  4HAU B;  2MSE D;  3V60 A;  1EUV B;  2BYV E;  3VDZ A;  3ODX A;  3T9L A;  2I1J A;  1ZC3 B;  4HCP B;  3DBH I;  4DWF A;  1H4R A;  4WSF A;  2XEW A;  2FJL A;  1BWN A;  3APF A;  4LJP B;  4PS3 A;  5D94 A;  4E74 A;  3NOB A;  3VHT C;  2LGY A;  1JRU A;  2AL3 A;  2K8B A;  5JZE B;  2IY1 B;  5L95 C;  4KDI C;  1IYF A;  5J17 A;  1DBH A;  1NTY A;  2CB8 A;  1V49 A;  1S3S G;  2IYD B;  3K9P B;  2N9P C;  3KY9 A;  2DX5 B;  3A9K A;  4KHO A;  3ZDM C;  1TGZ B;  4W9G A;  2ZNV B;  4MGY E;  2RSU A;  2KHW B;  3JVZ X;  3UQA A;  1WGQ A;  2KMC A;  1WR6 E;  4D0N B;  1V5M A;  3KRW A;  2A5U A;  4A6K A;  2KC1 A;  2FCM A;  2RR9 A;  2D10 A;  4C0A A;  2O6V A;  2QHO A;  3TL5 A;  1GG3 A;  5HKH A;  2L8J A;  1OEY A;  2KFJ A;  5LON B;  2EKE C;  1MK7 B;  4PS7 A;  3A8Q A;  1EGX A;  2JRI B;  5CX3 A;  1R4M I;  2YS1 A;  3A33 B;  4Z2N A;  2ZNV C;  2PE9 A;  3DQV A;  2OJR A;  4MJS A;  1SGH A;  3KW5 B;  2HTH B;  2FCS A;  4DXA B;  1FHX A;  3S2A A;  1WX8 A;  1XR0 B;  1OTR B;  2BYF A;  3HQC A;  2N7E A;  2MCN B;  5L81 A;  2NVU I;  2K6D B;  5JHB A;  2D9Y A;  2DYQ A;  4A6H A;  2LGX A;  5LOP B;  3TBL D;  5JH5 C;  4HPL B;  4MSQ B;  5J2R A;  1J0W A;  3LJU X;  2RLO A;  2KWV B;  1A5R A;  1EVH A;  1WJ1 A;  3SNH A;  1YIW A;  2YT0 A;  3ZNI D;  3L16 A;  1G6J A;  2COC A;  3DVN U;  5C5B B;  3PRP B;  2HTH A;  2G3Q B;  4LJO B;  3WAL A;  1U5G A;  4L6E A;  2GMI C;  4FBJ B;  1NTI A;  1TQZ A;  2GS0 A;  2P8V A;  4Y94 A;  3HM6 X;  1ZKH A;  5C1Z A;  1H8C A;  2IO3 B;  4P7I A;  3IBE A;  4JQW C;  3PT2 B;  4XZ4 A;  4EUT A;  3GYO A;  2XK5 B;  1QC6 A;  2K39 A;  5DPT A;  4B95 A;  2KDF B;  2KJ6 A;  3P2B A;  3KUD B;  1P3Q U;  3V6E B;  4KHA A;  2CU1 A;  2M38 A;  2WX1 A;  3A4R A;  4MT7 A;  2L3Z A;  2YLM A;  4EKU A;  1LB1 A;  3TCA A;  1HB8 A;  2UZR A;  3ZVR A;  4IG7 B;  3TIX A;  5IAA C;  4DX9 0;  4DK5 A;  3DPD A;  4K2O A;  4A3O A;  1QZE A;  3SO6 A;  1RFA A;  1P3R A;  2N9X A;  1V80 A;  2DHI A;  4EMO A;  1X11 A;  2XBB C;  2XK5 A;  1C1Y B;  2KN5 A;  1I35 A;  5HE1 A;  5DH9 B;  2R2O A;  2MRP A;  2V76 A;  1Q0W B;  3R7Q A;  4IC7 B;  4PS8 A;  2KAN A;  4HB3 B;  5LXH A;  2MWS B;  3JYU A;  2L00 B;  2I1K A;  2EC1 A;  2KWU B;  1MG8 A;  2PE6 B;  3IFW B;  3VH3 B;  2G35 A;  3HW2 B;  2COD A;  1Y8R C;  4MGZ E;  2GBN A;  1FAO A;  2GCJ A;  4WWN A;  1MKE A;  4TKN A;  1ZM0 A;  3LJ3 A;  3PLV A;  3W1Y A;  2Z0P A;  2L0F A;  1LXD A;  4W9F A;  4GU2 A;  4URK A;  2C60 A;  1K5G B;  1KLV A;  3RCZ A;  2MBO A;  1WIA A;  3DXC A;  5J3T A;  2C7H A;  1W1D A;  1NBF C;  3JSV A;  3DXE A;  2X18 A;  5C16 A;  2FJ9 A;  1YD8 U;  4MGI E;  2UZS A;  5HE2 A;  3MDB C;  4KIK A;  4CO7 A;  4IM2 A;  1X1M A;  5EDS A;  3FEH A;  2LXA A;  1F9J A;  2MWN B;  1WR1 A;  1IPG A;  3DVG Y;  4NPN A;  1UPR A;  3UGB B;  4FJY A;  2UYZ B;  5DHF B;  4K81 A;  4FA6 A;  4RM9 A;  3SDL C;  5KQ4 A;  3DCG A;  4G50 A;  3AUL A;  2CAY A;  2L2I A;  2NBV B;  1EAZ A;  1LW3 A;  1WRD B;  3A1Q B;  1X05 A;  4PQ0 A;  2LGD A;  4TV3 A;  1WMH B;  2KDI A;  1RJ2 A;  2M14 A;  5DHA B;  3APD A;  5J3Q A;  1WX7 A;  3EFU A;  2JWZ A;  3UF8 A;  1EF1 A;  3H6N A;  2R09 A;  2COF A;  3PVW A;  2LKO A;  4GN1 A;  4A6F B;  3M3J A;  2H7E A;  4GSW A;  1M94 A;  3VVW B;  2KGX B;  2L76 A;  3KUC B;  3AU4 A;  3GZN I;  4KIK B;  3ZTD A;  5GMV A;  4AWJ A;  2N1V A;  2KKC A;  5KHO A;  2I5C A;  3ZIM A;  3O65 B;  1Z5S B;  1EF5 A;  2P0H A;  3B08 A;  2BWE S;  1B55 A;  2DTC A;  2MDX A;  2RGF A;  3QC8 B;  1XCG A;  2GCL A;  1GC7 A;  4H8S A;  2BKR B;  4ICU A;  2COP A;  2VRW B;  2KMA A;  3CST A;  2DYO A;  1WGR A;  1DRO A;  3L08 A;  1XD3 B;  3NZS A;  5D6J B;  1WYW B;  3L54 A;  1UPQ A;  2H7D A;  3VOQ A;  2D07 B;  1H10 A;  1UGM A;  1I2H A;  1UZX B;  4Z2M B;  2DA0 A;  3VTW A;  2KTR B;  3NHE B;  4MDK E;  2HD5 B;  4II2 B;  3HK0 A;  4MGK E;  3ZKJ C;  3WYF B;  1P1A A;  2M4N A;  2ZCC A;  2UVM A;  3ODW A;  1WXS A;  3PP2 A;  3ZLZ A;  5KCV A;  2MA9 B;  3UIP B;  4IM3 A;  2JY6 A;  1UNP A;  1N3H A;  4WJ7 A;  1UBQ A;  2FIF A;  2MP2 B;  2WYQ A;  3QAQ A;  2BF8 B;  5KQ1 A;  3MJW A;  3DBL I;  4G0N B;  3A8P A;  3K9O B;  5IA7 A;  2D9V A;  2VKI A;  2M17 A;  4I6P A;  3UIN B;  3ZNG C;  2UWQ A;  3P7Z A;  3ZTC A;  3PSC A;  2L05 A;  4JLC A;  2CKH B;  1IP9 A;  4IAP A;  5HE3 A;  2NPT A;  3LDZ E;  3ML8 A;  4B9K A;  1U27 A;  1D3Z A;  3KSY A;  3A4S C;  2OTX A;  1WGG A;  3A9J B;  2J0M A;  5FR6 A;  4PYZ A;  5LXI B;  2J0K A;  2R0D A;  2NBW B;  1GJZ A;  1WM2 A;  2J59 M;  3EHV A;  4GMV A;  3APC A;  5AZG A;  3VUW A;  1X1G A;  2ZVN A;  1MIX A;  3PHX B;  3QQ8 B;  2Z0O A;  2DHJ A;  5FI1 A;  2NCN A;  1OQN A;  3DBR I;  4OVU A;  5DPR A;  3PTF C;  3WA0 A;  4DDI D;  2KWC A;  5JHA A;  3TO1 A;  3VIA A;  4DBB A;  2N0Y A;  4FJZ A;  3R66 C;  1E8Z A;  3H7S A;  3N30 A;  1Y19 B;  2DZJ A;  1KM7 A;  3NY5 A;  4AJY B;  1WE7 A;  3OAW A;  1Q5W B;  3RZF A;  3L10 B;  4NY0 A;  3D8E A;  5AZH A;  3V62 A;  4BOS C;  3Q3F A;  2M8S A;  3D32 A;  4OVV A;  3ZO5 B;  3IG3 A;  2P0D A;  2DKQ A;  4ZRK A;  2Z0Q A;  3A98 B;  3OLM D;  3CXB B;  4IWQ A;  2W2W A;  2KQ7 A;  5D2M B;  2IO0 B;  2LBB A;  5J3Y A;  2CHW A;  3DVG X;  1C3T A;  2LYD A;  3VQI A;  1W1H A;  4HB4 B;  1WJN A;  1TJ6 A;  2E2X A;  2L1C A;  1UEF A;  4FHK A;  3PRE A;  1Z87 A;  3QAR A;  2NBU A;  4JL9 A;  4W9K A;  4EOY A;  2YRY A;  1V5T A;  3QWM A;  2RPQ A;  4FJV B;  5C23 A;  3PGE A;  4ANW A;  4HVB A;  1V5U A;  1WI1 A;  1X1F A;  2K00 A;  2LUL A;  1NVL A;  2Q13 A;  2YS5 A;  1TZ1 A;  2O2V B;  1DYN A;  2V1Y A;  4TUU A;  3M95 A;  1LM8 B;  2RD0 A;  3HIZ A;  4WWO A;  3TJP A;  4DHJ D;  1KZ7 A;  2ROV A;  2MBQ A;  3KRX A;  5D3W A;  2W9N A;  2C7M B;  4WQO B;  1UH6 A;  2KFK B;  1UD7 A;  3P6A A;  2LD9 A;  2MQJ A;  2MBH A;  4I6N B;  1ZW7 A;  3EPY A;  3SD5 A;  4PYU A;  3QBV B;  2D4Q A;  2DHZ A;  3SU8 X;  4EEW A;  3PZD A;  5CLQ B;  3IVF A;  2PZ1 A;  1V6E A;  3GYP A;  5G55 A;  4HLE A;  2D11 A;  1WJU A;  4NJ7 A;  3QIJ A;  1ZGU B;  1E5W A;  1BTN A;  4FN2 A;  4IWO A;  2JZZ A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 1SIF A;  2MJE A;  4HKQ A;  2PJH A;  4KGT A;  4BKG A;  3AEB B;  4D6W A;  2PVG C;  3MFG A;  2DWQ A;  3Q3N C;  3TVV A;  3U7Z A;  5I2M A;  1QLB B;  4ASW C;  3AEF B;  3AE1 B;  1FFV A;  3PZ7 A;  3T06 A;  2Y5B B;  2JX5 A;  4WQM A;  1ZSQ A;  2NZ8 B;  2WDQ B;  1SJH D;  3PZ8 A;  1F2R I;  4ACF A;  3OJ3 A;  2K8C A;  2WXM A;  1RWS A;  2FUH B;  4M0W B;  2CHZ A;  1YQB A;  1XQQ A;  1WMH A;  4OSN A;  1EO6 A;  2BPS A;  1WH3 A;  2PKO A;  2WH5 A;  1QKZ A;  4DHZ B;  2EMS A;  1PGX A;  1S1Q B;  3DDC B;  4MK0 A;  3NSU A;  2C7N B;  4NAM A;  2EJ8 A;  2KLC A;  2IDY A;  2WXI A;  4E3C A;  2M0X A;  1Y5O A;  2WWZ A;  4XGA B;  3VXW A;  3VR8 B;  5EE3 A;  2ELA A;  3PS6 A;  2K9X A;  1FHW A;  2YT1 A;  2ONQ A;  1WGY A;  2QMT A;  3ZXR A;  5DPW A;  2AEH A;  2WDT B;  2LFI A;  3DXD A;  4B6W A;  2JUO A;  1AAR A;  1PQS A;  1PFD A;  1WGD A;  1KOT A;  1U2B A;  4WJO A;  1XKE A;  4BZA A;  4EJN A;  1KZG A;  4YON A;  5CHF A;  5AUK A;  1TBE A;  2GI9 A;  4LCD E;  2TSS A;  4K1R B;  4TQ0 A;  3ULB A;  2N1W A;  2ZJD A;  4TYZ A;  2NS5 A;  3PLU A;  4US8 A;  3SFD B;  1V2Y A;  3ZDT A;  1BXT A;  5D7G A;  5D3D A;  1WXV A;  3NUH B;  4MEM A;  2INP E;  3T8M A;  3N7C A;  4I6L B;  2WXF A;  4N6E B;  5FKA C;  2ROZ B;  4LDT B;  5GOW B;  1WXA A;  4WVF B;  2J0J A;  1WVH A;  2HJ8 A;  4AJW A;  1FFU A;  5IJM A;  4JKC A;  1VD2 A;  3HIE A;  5CLL B;  2CJO A;  4KHB B;  2EKI A;  4AOF A;  3U8Z A;  3D8D A;  2JXX A;  4L1R A;  1T0Y A;  1TKE A;  4HB0 B;  5J18 A;  3BYT B;  3A9K B;  4W9J A;  1V86 A;  4GB9 A;  1V9J A;  3JW0 X;  1FRD A;  4P16 A;  5D3V A;  3ML9 A;  5EE1 A;  4F8C B;  2K22 A;  2W2X C;  2IJ0 A;  3BZD B;  2K25 A;  1GB1 A;  1XT9 B;  1ST7 A;  4MM3 A;  5I2S A;  1BML C;  2A4Z A;  2BYT A;  3V61 A;  2MBE A;  4BKS A;  4CHM A;  2KD0 A;  2GBK A;  3BIN A;  4GDK B;  2LWP A;  4HXD A;  3F0W A;  1UUP A;  4A6F A;  1HB6 A;  4DX8 A;  1V61 A;  2CHX A;  2N9K A;  3FLV A;  4WUR A;  4W9H A;  1MI0 A;  3GP7 A;  3MJ5 A;  2MHJ A;  2FJU B;  4F7H A;  3DBL B;  2HRJ A;  1YJ1 A;  2DEN B;  4LK0 M;  4XWX A;  3RZW C;  3RCP A;  4GXB A;  3WAO A;  2KVR A;  1FD6 A;  2KDB A;  4F7U P;  1DIK A;  3NS1 A;  4W9L A;  2YF0 A;  2ZPN A;  1L7Y A;  2G4S A;  2JZP A;  4KDL B;  3PO0 A;  2Z13 A;  1HTO A;  3GOE A;  3L17 A;  1BT0 A;  1KJT A;  3QCA A;  4WH4 A;  4YSX B;  1P5T A;  4BOS C;  5C79 A;  1XOD A;  4LTU A;  4N58 A;  5AUI A;  3ZIM A;  3H7P A;  1FNW A;  2BGF A;  2DYB A;  2GBJ A;  3QA8 A;  2Y8G A;  2ZEQ A;  1C77 A;  3KWV A;  2L1A A;  2CS4 A;  2W3S A;  2JSV X;  4HHV A;  3WAM A;  4BOZ B;  2DKP A;  2ZPY A;  2RVB B;  1A70 A;  3BVZ A;  4J3O D;  4MY6 A;  2JWU A;  1ACC A;  2KJH B;  4IOI E;  4BKS D;  4JKB A;  4L2Y A;  1ISN A;  5E6P A;  4AP4 C;  1D6E C;  4JKE A;  2WDV B;  3WIM A;  5FR3 A;  4W9I A;  3Q3J A;  1FB8 A;  1E7P B;  2KLG A;  3FAH A;  4NJ6 A;  3UQB A;  1U4A A;  4MM3 B;  1EUV B;  2BYV E;  1T0R C;  3NZ3 A;  1H4R A;  4PS3 A;  5D94 A;  4ARI A;  4RGM A;  2LGY A;  1JRU A;  3ZJU A;  1ZDV A;  5L95 C;  4KDI C;  2IYD B;  3KY9 A;  3A9K A;  4W9G A;  4MGY E;  2KHW B;  3MC9 A;  1WGQ A;  2K5P A;  3O13 A;  2FCM A;  2RR9 A;  2D10 A;  2O6V A;  2QHO A;  1GG3 A;  2KFJ A;  4C80 A;  5LON B;  2EKE C;  3A8Q A;  2ZNV C;  1F0Z A;  2OJR A;  1J7A A;  1SGH A;  1YJJ A;  2NTT A;  3V3X A;  5JHB A;  2K6D B;  1F1H A;  5LOP B;  4HPL B;  3WCQ A;  2QC8 A;  1EVH A;  2JU6 X;  1PDX A;  3L16 A;  2WGS A;  2G3Q B;  1UNS A;  1NTI A;  2P8V A;  2WU2 B;  2B76 B;  3HM6 X;  5C1Z A;  1L6U A;  3IBE A;  4P7I A;  3PT2 B;  4XZ4 A;  1WSP A;  1TYG B;  3URY A;  5DPT A;  1UWX A;  3IT6 B;  1R7S A;  4RF1 A;  1UGJ A;  2RPV A;  4KHA A;  2L3Z A;  4IG7 B;  3ZVR A;  3AMZ A;  3TIX A;  2JYT A;  5IAA C;  4DX9 0;  1V1O A;  4A3O A;  5EE0 A;  2XK5 A;  2DHI A;  3R7Q A;  2MRP A;  2V76 A;  1Q0W B;  4C4V A;  4EE2 A;  2WU5 B;  1I4G A;  3SBT A;  5LXH A;  2MWS B;  2I1K A;  2EC1 A;  2KWU B;  3SFE B;  2QSD A;  1FAO A;  1MKE A;  2DNF A;  1LXD A;  4GLS C;  2XNA C;  3RCZ A;  3AE7 B;  1WIA A;  2C7H A;  1NBF C;  1ZE3 D;  3HRD D;  2N7J A;  2UZS A;  5HE2 A;  3MDB C;  4KIK A;  4CO7 A;  1X1M A;  1UPR A;  3UGB B;  3E9O A;  3SDL C;  5KQ4 A;  3E9L A;  2HTM E;  1KRH A;  2L2I A;  2NBV B;  1SE3 A;  2LGD A;  1WMH B;  1RJ2 A;  3APD A;  1L0Y B;  3MHZ A;  2R09 A;  3M3J A;  3VVW B;  2L76 A;  3IAS 1;  3AU4 A;  3GZN I;  3ZTD A;  4GOU A;  1YNT E;  5KHO A;  2I5C A;  1MPE A;  3B08 A;  1ZXH A;  1B55 A;  2DTC A;  1C9F A;  5IRS A;  4KGS A;  2RRF A;  4MEL A;  2COP A;  2VRW B;  2KMA A;  3BVM A;  1DRO A;  1XD3 B;  1WYW B;  3V05 A;  3VOQ A;  2D07 B;  1FEH A;  4BAX A;  1UGM A;  1J7B A;  3VTW A;  4II2 B;  1DYQ A;  1FNV A;  3ODW A;  1JAL A;  1VR9 A;  3ZLZ A;  2KVZ A;  4IM3 A;  4WJ7 A;  3QAQ A;  1B1Z A;  2PMV A;  1YQ3 B;  3MJW A;  3NG0 A;  1ET9 A;  4JLC A;  2L05 A;  2VZK D;  5HE3 A;  1K53 A;  4HJG E;  3P4R B;  2X8X X;  3A9J B;  3B9J A;  1L6V A;  1XXG A;  1GJZ A;  3AEA B;  1N5W A;  2KUQ A;  2LGI A;  1FIQ A;  3NJT A;  3PHX B;  2Z0O A;  5FI1 A;  1OQN A;  3DBR I;  1VZ8 A;  4DDI D;  5JHA A;  4DBB A;  4C56 C;  1TS3 A;  3H7S A;  2W82 A;  3RZF A;  3R8B A;  3D8E A;  5AZH A;  3V62 A;  1ZPS A;  3D32 A;  3ZO5 B;  2DKQ A;  2Z0Q A;  3Q8E A;  3CXB B;  4IWQ A;  2W2W A;  2KQ7 A;  5BMI A;  2NMQ A;  3DVG X;  2H89 B;  1T3Q A;  4HB4 B;  2L1C A;  1UEF A;  4W9K A;  4HRS A;  1V5T A;  3QWM A;  1CZP A;  2RPQ A;  4ANW A;  3PGE A;  2K00 A;  2O2V B;  1DYN A;  4WWO A;  2M0A A;  1KZ7 A;  1HEZ E;  4IDI A;  4RGN A;  3P4S B;  3DHG C;  1UH6 A;  1JCK B;  4I6N B;  1ZW7 A;  1FXI A;  3SD5 A;  1E6E B;  1TS4 A;  3IT4 B;  3SU8 X;  3GYP A;  4HLE A;  3T3O A;  1VBG A;  4A90 A;  4NJ7 A;  3U12 A;  2AQ2 B;  1JWU D;  1BTN A;  1JWM D;  3Q6B A;  4FN2 A;  1XEE A;  2JZZ A;  4H2A A;  1CJE A;  5BMG A;  2FID A;  2RUK B;  5H92 C;  3AN1 A;  5JXV A;  2KMM A;  1AN8 A;  4HAV B;  4HAX B;  4GDL A;  3ZGZ A;  1J19 A;  1WRI A;  2VRR B;  4ICV A;  4K17 A;  1OFF A;  1TXD A;  2QJL A;  1C4C A;  2J7Q B;  1P0R A;  1WE6 A;  1DOY A;  3I57 A;  5LLI A;  5GXG B;  3PHW B;  3LXF A;  2IO1 B;  4NAW A;  1TS2 A;  1I42 A;  3F5R A;  1HE8 A;  3B2G A;  3H1U A;  3KYD D;  2KFK A;  3E56 A;  3KVF B;  4NAW B;  3G9W A;  3RN9 C;  2WXP A;  2BYE A;  4O1N A;  4W9D A;  4ANX A;  2MKR A;  4MT5 A;  3ZXV A;  4J6I A;  3TFM A;  3VFK A;  2RDH A;  4GOC A;  1WGU A;  3ZNH B;  1JRO A;  2XQN M;  1ET6 A;  4DDG D;  4WJN A;  3N3K B;  4BBN F;  2CY4 A;  4ARC A;  2KCJ A;  2MLB A;  4A20 A;  1XLN A;  1OQR A;  4PK1 A;  1DDM A;  4ILH A;  2B3A A;  1DDW A;  4RF0 A;  4N59 A;  4HEA 1;  2R2Y A;  5DPS A;  1NI2 A;  1TZO A;  1DOI A;  2DYN A;  3FM8 C;  4AUQ C;  1GC6 A;  2ZW0 A;  3MPX A;  3L0W B;  1GAQ B;  1PLS A;  1KH0 A;  4MH0 E;  3T3N A;  1SJE D;  5D27 A;  4K7U A;  1OY2 A;  1FXT B;  4B6H A;  4W9E A;  2KOX A;  1BAK A;  2D2Q A;  2LRU A;  2CQU A;  1T77 A;  3HM3 A;  3R3M A;  3EEC A;  2IGG A;  2ELB A;  3AEE B;  1SHC A;  3I5J C;  2D9Z A;  1D5X C;  2BCJ A;  2ZVO A;  3C0R B;  4QAY A;  4LNO A;  1LO5 D;  4G11 A;  1L4D B;  1V5P A;  2K2J A;  1K5D B;  4CHJ A;  2N7D A;  3U2S C;  5DCN A;  3ULC A;  1ZP0 B;  3UIO B;  2IO2 B;  2JVC A;  4HDQ A;  5HG2 A;  2MFQ A;  5TSS A;  2FCN A;  1I7A A;  1AW7 A;  4ZRI A;  3BVG A;  4LNN A;  4KSK C;  1XX0 A;  4NQK E;  2LJI A;  2DHK A;  1QQR A;  1K50 A;  3QJZ A;  2DX1 A;  1TTN A;  2LUE A;  3AEG B;  4M00 A;  4KV2 A;  2WDR B;  1ZC4 B;  2LOZ A;  2X38 A;  4OHJ A;  1ZDX A;  4M8N A;  2GLS A;  1P98 A;  1WYG A;  2RQ1 A;  2DN6 A;  2DX5 A;  1WX9 A;  2K8H A;  4Q2J A;  3VRA B;  2DAF A;  1FGZ A;  1V88 A;  2BVC A;  1ACA A;  3D8F A;  4GIV A;  4F7G A;  1B9R A;  4HDO A;  2J53 A;  3PPA A;  3CSF A;  3BY4 B;  2EEL A;  2YS3 A;  3AV8 A;  2W2X D;  5DIF B;  1OQY A;  2G9H D;  4YL8 A;  1KI1 B;  2DBY A;  1PMS A;  2BS3 B;  3ZRC A;  2DFK A;  2KTF A;  4WWP A;  2Z8L A;  2D3B A;  3DOW A;  2L7R A;  2MX2 A;  1V89 A;  3X23 A;  1XLP A;  4XDC A;  2PLP A;  4RM8 A;  2D9W A;  2GBN A;  2G45 B;  1PGA A;  2DZI A;  3EFC A;  4LNI A;  4RNA A;  1Z2M A;  2Z59 A;  3Q8C A;  4MSM B;  1XF5 L;  4IM0 A;  2GBM A;  2FCQ A;  4E71 A;  3PVL A;  3EGR A;  3VR9 B;  2ACZ B;  2AWT A;  5HE0 A;  2INC C;  2NTS A;  1NTV A;  2DYM A;  1U29 A;  3WAP A;  1SEB D;  1JWS D;  5TR5 A;  2MW5 A;  4BBN C;  4ANV A;  2R82 A;  1HZ5 A;  3TSS A;  2DLW A;  4BFR A;  4ZYS A;  4CHK A;  2KR0 A;  3TUO A;  2LVP A;  4DHJ D;  3A9J A;  1M7E A;  3I3T B;  3ALB A;  1V81 A;  1BTK A;  4OW0 A;  1I7H A;  2Y8F A;  2BT6 A;  1I4X A;  2GBR A;  4DBG A;  1KBL A;  2LMC A;  5CHW A;  1YX5 B;  1E7U A;  1QT9 A;  3ECI A;  5L83 A;  1VJK A;  3IXS A;  3RD2 A;  1TS5 A;  3RT3 B;  1EWY C;  2M1M A;  4RMA A;  3P4Q B;  3M63 B;  3H7P B;  5JHG A;  1E8W A;  2DAJ A;  3HVZ A;  4YTP B;  3KUZ A;  1CQV A;  2PTL A;  2I5F A;  3ZW3 A;  2MSE D;  3AH7 A;  1ZC3 B;  4JWS C;  3DBH I;  2J4X A;  1K52 A;  2XEW A;  2FJL A;  1BWN A;  2BS2 B;  3APF A;  4LJP B;  3W2D A;  1HTQ A;  2QEJ C;  2AL3 A;  1YN4 A;  1NTY A;  2CB8 A;  3K9P B;  5IKC M;  2DX5 B;  3ZDM C;  3KWL A;  2QDF A;  2RSU A;  3JVZ X;  3AE5 B;  3DCX A;  3ENB A;  2KWD A;  4C0A A;  2L8J A;  1SE2 A;  1EGX A;  2YS1 A;  3A33 B;  4Z2N A;  4JK8 A;  4L1B A;  2HTH B;  4DXA B;  3DWG C;  1XR0 B;  1OTR B;  3I63 C;  5L81 A;  5C2T B;  2DYQ A;  1VDV A;  1FRR A;  1A5R A;  1J0W A;  3SNH A;  1YIW A;  3ZNI D;  2J52 A;  2GS0 A;  2YEP B;  2DIK A;  2IO3 B;  4JKG A;  4EUT A;  2AQ3 B;  2XK5 B;  1QC6 A;  2CJN A;  3P2B A;  2GRI A;  3V6E B;  2KYW A;  2JQR B;  2YLM A;  4EKU A;  1LB1 A;  3ABV B;  4DK5 A;  3DPD A;  2KN4 A;  1QZE A;  3RI7 C;  3SO6 A;  1V80 A;  1I35 A;  1C1Y B;  2KAN A;  4HB3 B;  3IFW B;  1VBH A;  3HW2 B;  2COD A;  1Y8R C;  4KKI A;  4MGZ E;  4WWN A;  1ZM0 A;  3LJ3 A;  5HFY A;  3RNC C;  1V8C A;  4C7Z A;  3RNB C;  3DXC A;  1W1D A;  4MGI E;  2X18 A;  3GE3 C;  2FJ9 A;  5EDS A;  1F9J A;  3DVG Y;  2IND C;  2WXR A;  4FJY A;  3MC0 B;  1E9M A;  2IGD A;  4RM9 A;  3CWI A;  3DCG A;  2NBV A;  2CAY A;  3NVZ A;  1EAZ A;  1LW3 A;  1WRD B;  3H8H A;  2M14 A;  5DHA B;  1JRP A;  5J3Q A;  3H6N A;  3PVW A;  2LKO A;  4A6F B;  2KGX B;  4REZ A;  1EF5 A;  2K49 A;  2P0H A;  3QC8 B;  2RDB C;  5EE9 A;  2GCL A;  4M01 A;  3L08 A;  5D6J B;  2DYO A;  1UPQ A;  4A9A A;  1UZX B;  3HK0 A;  3WYF B;  2ZCC A;  2UVM A;  2MA9 B;  1N3H A;  2MP2 B;  2WYQ A;  1RFK A;  2Z14 A;  4G0N B;  3DBL I;  1N63 A;  1LGR A;  3A8P A;  3K9O B;  2KIE A;  2LGS A;  3ZQ4 A;  2Y5C A;  2UWQ A;  3P7Z A;  3ZTC A;  3PSC A;  1IP9 A;  3FVC A;  3ML8 A;  4HPP A;  3A4S C;  1N6Z A;  2OTX A;  1WGG A;  4KGR A;  4M0W A;  2Z4D A;  2J0K A;  1WM2 A;  3HUI A;  3EHV A;  1C4A A;  3APC A;  1X1G A;  2ZVN A;  1MIX A;  4XDD A;  1EU4 A;  2DHJ A;  3PTF C;  2KWC A;  3TO1 A;  2WQY B;  3R66 C;  1KM7 A;  3NY5 A;  1WE7 A;  2V3N A;  3NRZ A;  2BBC A;  1VLB A;  2W55 A;  2M8S A;  4OVV A;  3IG3 A;  3SR6 A;  3AED B;  2IO0 B;  1JWB D;  1D5M C;  1N62 A;  1WJN A;  2NBU A;  3N1X C;  4EOY A;  5BYS A;  3Q3O C;  5C23 A;  1KF6 B;  3LB8 C;  4HVB A;  1V5U A;  3KYC D;  2BW2 A;  1HQR D;  1NVL A;  3VHT C;  3M95 A;  3HIZ A;  2YT2 A;  2ROV A;  2OJW A;  2WXJ A;  2RMM A;  2W9N A;  2KT7 A;  4P6V F;  2I2Y A;  2GB1 A;  2D4Q A;  2DHZ A;  5CLQ B;  1V6E A;  3FC4 A;  2D11 A;  2ZKM X;  4XE0 A;  1E5W A;  3DBH B;  1E8X A;  2K1F A;  4HK2 A;  2BWF A;  2PEA A;  2L0T A;  1HBK A;  3ML4 A;  2LZ6 A;  4JX1 C;  3U7D A;  1V97 A;  2GOW A;  3AI5 A;  3NZU A;  1TJE A;  3QWZ B;  2K8E A;  3IAM 1;  4BBK A;  3VTU A;  1SSN A;  3L13 A;  4FLH A;  4K7S A;  2OHF A;  2LJ5 A;  3PSE B;  3ENE A;  4DHZ E;  1FNU A;  1NI3 A;  4KVG B;  2J42 A;  4GGQ A;  2KK8 A;  1T0S C;  2LRW A;  2I38 A;  1J7C A;  5E6O A;  3TEZ A;  1IBX B;  2LI5 A;  4OZC A;  4HWI B;  2IPK D;  1IRS A;  1ENF A;  4ITK A;  2DZM A;  1GNU A;  1J0G A;  3PEG A;  2FNJ B;  1M7R A;  1UBI A;  2LAS A;  2FBW B;  2L52 A;  1XD4 A;  4DXF A;  1RRB A;  3FSS A;  3SUZ A;  4IUM B;  3RNE C;  5D3X A;  1ZUD 2;  1V5O A;  2NMB A;  1WG7 A;  3KH0 A;  5E6N A;  3CMM B;  1E8Y A;  4YSZ B;  2KX3 A;  3RNA C;  5AEK B;  3V5W A;  2JT4 B;  4TQ1 A;  2C5L C;  2L83 A;  4HJK A;  1L5P A;  3ONS A;  2AQ1 B;  3KZ1 A;  2D3G A;  4TMA B;  4BVU C;  2ABD A;  1UF0 A;  2OED A;  2LUM A;  3B77 A;  2P0F A;  4KZ0 A;  4PNK A;  3N1Y C;  1UEL A;  3OAN A;  2E3T A;  3Q8A A;  4K3C A;  4HAT B;  1TKG A;  1PFJ A;  4XYC A;  5JLJ B;  1L2N A;  4HAW B;  3BWU D;  2AL6 A;  1SB3 C;  4YT0 B;  3JSV B;  3SYX A;  2JF5 A;  4KSL C;  1LQB A;  4GNK B;  4A5K A;  5T8I A;  4KHB A;  4LDT D;  3N32 A;  4HAY B;  4CQN A;  2BKF A;  4TSS A;  3OWE B;  1NVI D;  2JP2 A;  5CHV C;  3VH4 B;  4DQO C;  1WZ3 A;  2O6V B;  2LXC A;  1TKY A;  2C9W B;  1U5D A;  3NVW A;  4EFO A;  2PPH A;  3J9C A;  3PRZ A;  2ZZP B;  1KC7 A;  2WX0 A;  1E90 A;  5DPR A;  4B95 A;  3NW8 A;  4DHJ B;  4K2P A;  3HVD A;  3GS2 A;  3TEX A;  1YN3 A;  1OMW A;  5BYR A;  4P1B C;  2WXH A;  2JZ3 B;  4M8M A;  3OJ4 B;  3SV1 A;  2HE7 A;  1WJ6 A;  3EUB 2;  4F7Z A;  2LOX A;  2V4I B;  3MHS D;  5IP4 D;  3UI3 A;  3UZT A;  2VSZ A;  1VRA B;  4HCN B;  2VH1 A;  2RNR B;  4W9C A;  2FAZ A;  2BS4 B;  5C6R A;  2R2Q A;  3DBR B;  3Q8B A;  4JK7 A;  1TIF A;  3AB5 A;  5IO9 A;  3CF6 E;  4MH8 A;  4KAX B;  1Q1O A;  1MK9 B;  2KUP A;  1E0Z A;  3CIK A;  1JDE A;  3W5V B;  2CRF A;  2NPT B;  1F2R C;  1PGB A;  3AE3 B;  4JGH B;  3O96 A;  1Q10 A;  2Y5P A;  2MBB B;  4NJC A;  4LLG M;  3MTN B;  4N9F 4;  3U30 A;  1FOE A;  3ZYY X;  2G4D B;  1MAI A;  4EZL A;  3PV1 A;  4ZRQ A;  1WJM A;  2FDQ A;  1C79 A;  4NSW A;  4EZK A;  2GJY A;  5JP4 A;  5DI9 B;  3TW1 A;  1YQ4 B;  1WF9 A;  2Z0D B;  1IBX A;  2KQS A;  1U5E A;  2IZV B;  4G3X B;  1MIZ B;  4YSY B;  1FGY A;  1FCL A;  2IY0 B;  2D5G A;  1WY8 A;  3AE9 B;  3RUI B;  1BUI C;  1YOV B;  2DZK A;  2O2V A;  4HPM B;  1P6S A;  4A3P A;  1P7E A;  4HRO A;  3BJI A;  3VUY A;  3QK0 A;  1FPY A;  1MHH E;  3B1L X;  2MP2 A;  3FIL B;  5BO4 B;  3NS8 A;  3H9D A;  3R2I A;  4L23 A;  1P9D U;  5JHH A;  1D4B A;  2E6X A;  4GDK A;  4HAZ B;  2JRH A;  4JIO U;  1W1G A;  1YX6 B;  3BK1 A;  4HAU B;  3ODX A;  1D5Z C;  4KX6 B;  2I1J A;  3T9L A;  4JK9 A;  4WSF A;  1C4P A;  1VZ7 A;  3NOB A;  2M56 B;  2MJ3 A;  3FIL A;  5JZE B;  1IYF A;  5G5G A;  1V49 A;  4AQ7 A;  2N9P C;  4KHO A;  1TGZ B;  2ZNV B;  2V9H A;  3TEY A;  2KMC A;  4R3D A;  3L4P A;  4UDU C;  3KRW A;  2A5U A;  1QOG A;  3P4P B;  3BYY B;  1MK7 B;  4PS7 A;  2JRI B;  5CX3 A;  3DQV A;  4MJS A;  3S2A A;  4RFB A;  2BYF A;  2MCN B;  3HQC A;  2HJ1 A;  2NVU I;  1L4Z B;  1OQQ A;  4K3B A;  4MSQ B;  1JWA D;  3LJU X;  2KWV B;  3U4E G;  1L0V B;  2N0S B;  2COC A;  3DVN U;  3PRP B;  4RCO A;  3LYY A;  5HI1 A;  4YWG G;  3WAL A;  4L6E A;  2PVO D;  1EM7 A;  3GYO A;  5I4D A;  2KDF B;  2W3R A;  1P3Q U;  4WWM A;  2CU1 A;  3A4R A;  1G6J A;  3TCA A;  2UZR A;  3OG5 A;  4S0R A;  3W9C B;  2N9X A;  1X11 A;  2WHI A;  2KN5 A;  5HE1 A;  4PS8 A;  2L00 B;  2K0P A;  4PT5 A;  2BTE A;  4TKN A;  3PLV A;  2IGH A;  4GU2 A;  4URK A;  2ON8 A;  2C60 A;  1KLV A;  1ZXI A;  2MBO A;  1MHX A;  3KQ4 A;  2M19 A;  5C16 A;  5BMH A;  2KAJ A;  3E66 A;  4IM2 A;  1TT5 B;  1WR1 A;  4NPN A;  1IPG A;  4JKF A;  4ZHO A;  1SIJ A;  1EWC A;  4FA6 A;  4G50 A;  1R4M B;  1MVK A;  4PQ0 A;  4QJ4 B;  4TV3 A;  2KDI A;  1ZOY B;  3UF8 A;  3R2T A;  1QOF A;  2COF A;  4GN1 A;  3Q8F A;  2H7E A;  1NYQ A;  4LNF A;  3KUC B;  1C78 A;  5GMV A;  3O65 B;  4QXA B;  2RGF A;  2MDX A;  4M02 A;  1XCG A;  2WXN A;  3EA6 A;  4ICU A;  2BKR B;  3NZS A;  2FE8 A;  1RYJ A;  3CST A;  2WXQ A;  1WGR A;  3L54 A;  5HHD G;  2VH2 A;  1I2H A;  5H8Y E;  2WP9 B;  3NHE B;  4MDK E;  2HD5 B;  4MGK E;  3ZKJ C;  3AE8 B;  1P1A A;  2M4N A;  3PP2 A;  3UIP B;  2JY6 A;  1UNP A;  2FIF A;  4B0E A;  2BF8 B;  5KQ1 A;  5IA7 A;  2WXL A;  2VKI A;  2M17 A;  3UIN B;  3B2F A;  4ZOH C;  3MC8 A;  3LDZ E;  2NPT A;  4YTM B;  3KSY A;  1P7F A;  1KLU D;  4US9 A;  2J0M A;  4RGT A;  4RGO S;  2NBW B;  2J59 M;  1KLG D;  4GMV A;  4JKD A;  5AZG A;  1TY2 A;  2NCN A;  3WA0 A;  2N0Y A;  4FJZ A;  1E8Z A;  3N30 A;  1Y19 B;  1SF0 A;  4AJY B;  1Q5W B;  2P0D A;  4ZRK A;  3OLM D;  1FMA D;  2LBB A;  3NWD A;  5J3Y A;  2CHW A;  3P1M A;  1C3T A;  1QOB A;  2LYD A;  3SEB A;  3VQI A;  1TJ6 A;  3GZN B;  4JL9 A;  1Z87 A;  3QAR A;  1FCC C;  2YRY A;  2KQ4 X;  4OVZ A;  4USA A;  4FJV B;  1I4R A;  3AM9 A;  1WI1 A;  4TUU A;  1NEK B;  3U52 E;  3TJP A;  2Q5W D;  1LM8 B;  3KRX A;  4MAC A;  2C7M B;  2MQJ A;  2LD9 A;  2RDG A;  2MBH A;  5MPO A;  3NWA A;  3PZD A;  3SBG A;  1WJU A;  4JKA A;  3QIJ A;  1ZGU B;  1IGD A;  4IWO A;  4WQO B;  2KDE B;  4KZC A;  2CR5 A;  4FHJ A;  2KO3 A;  1E7V A;  1LFD A;  1XLQ A;  1QIL A;  2D3C A;  4YXD B;  5CTR C;  2WNM A;  1RRP B;  4XWW A;  1ZVR A;  1DGJ A;  1OEY J;  4A6Q A;  2QIL A;  1GB4 A;  2GUM A;  1WGH A;  4OZB A;  2BB6 A;  3AJ4 A;  2V4L A;  2REX A;  5M4Y B;  3AE6 B;  1KFY B;  1SE9 A;  2YSZ A;  2QKM A;  3DHI C;  3NWF A;  1XO3 A;  3BK2 A;  4WJQ A;  4GPT B;  3WAN A;  2INN E;  4WAF A;  4D2K A;  2RSG A;  1E10 A;  4QJ3 B;  1WJ4 A;  1QQG A;  3Q3M C;  2KNB A;  1UNR A;  1WM3 A;  4F1S A;  1Y56 A;  4ZRJ A;  2O6V D;  2V3S A;  1GPX A;  1I4Q A;  2XN9 C;  1M4V A;  3PG7 A;  3V6C B;  2IBI B;  2ZCB A;  4WJP A;  2AYO B;  1T6B X;  2N9E B;  3VUX A;  3BII D;  4C7Y A;  2Z0E B;  2Z59 B;  3Q14 C;  1K51 A;  5AZF A;  1HZ6 A;  1R4N I;  2OQB A;  3PVU A;  3C19 A;  2WXG A;  2RGN B;  4NQL B;  3Q2A C;  3SHQ A;  5IN7 A;  3M62 B;  1VCB A;  2CU3 A;  4GZU A;  1QOA A;  1MI1 A;  4S17 A;  1KTK A;  3RMK C;  2COA A;  3DVN V;  4YTN B;  3RUL A;  1CMX B;  2PIA A;  3ZNZ B;  4HSI A;  3MP9 A;  2IYB A;  3C8Y A;  3PRM B;  4CSQ A;  1YJI A;  4C00 A;  2VZK B;  4GMX B;  1J8C A;  4IOY X;  4DIX A;  2KAC A;  3AU5 A;  1WZ0 A;  1XCT L;  1RAX A;  4P1C C;  3ODO A;  2K2U A;  1AQC A;  3HHM A;  4C4V B;  3M1I B;  1F52 A;  3QHT A;  5D3Y A;  2LVO A;  2MJD A;  3TMP B;  2OOB B;  4QJ5 B;  1FHO A;  1OGW A;  3A1Q A;  4IWP A;  3RNG C;  3RYT A;  3W1S C;  1U5F A;  1K8R B;  3ZVV A;  2N23 A;  1ROE A;  3FP5 A;  4WAA A;  2K6Q A;  1WI0 A;  1JQ4 A;  3RPF C;  1XCQ L;  1V1P A;  3IHP C;  1I4H A;  2BB5 A;  2EMT A;  1TY0 A;  3KLS X;  5IOI A;  3R7R A;  4NNJ B;  1EU3 A;  1NYR A;  3DBS A;  5FI0 A;  5D3I B;  4FUL A;  1SXT A;  3OHM B;  3AXC A;  3GB1 A;  1WWT A;  3RNF C;  2YVC A;  4MJS B;  4A55 A;  2KZR A;  4FAD A;  1JML A;  1NDD A;  1YMH E;  2LVQ A;  2JPH A;  3NVY A;  4BKT A;  1VZ6 A;  3ETR A;  2KC2 A;  2G1E A;  1JW9 D;  2PW9 A;  1Q67 A;  1UWM A;  3ZRF A;  3X0W A;  3N1Z C;  4IW0 A;  1DDV A;  3E9S A;  4WIP A;  5G2N A;  4IFS A;  2FUG 1;  4ILJ A;  2KXJ A;  2KJR A;  4ZRP A;  2NR2 A;  4ILG B;  2Y7B A;  2KTR A;  3GE8 C;  1WGK A;  3P42 A;  3W1S A;  5KHQ A;  5C5B A;  2QKL A;  4ZDV A;  2ADZ A;  1N60 A;  1FXA A;  2IFS A;  5E6J A;  4K7W A;  4EZJ A;  1RLF A;  2ASQ A;  3B0A A;  3P63 A;  3AE4 B;  1WXM A;  1AWE A;  3VTV A;  4X57 B;  1NU2 A;  4II3 B;  2KX0 A;  2LG1 A;  3QX1 A;  4XX5 A;  1ESF A;  3E9P A;  1MPH A;  2BQQ A;  2MH7 A;  2D9X A;  3VAW A;  3A58 A;  5EFX A;  4ZYN A;  2CY5 A;  4GDL B;  4ZHP A;  3ZUN A;  1GUA B;  5LNK 1;  1T5X D;  1STE A;  2L32 A;  3DHH C;  1F77 A;  4ANU A;  1N5X A;  3EC8 A;  1WFY A;  2N4F A;  4HB2 B;  1X86 A;  4CYE A;  1IUE A;  3V60 A;  3VDZ A;  2WXO A;  1HXY D;  4HCP B;  4JKH A;  4DWF A;  1MFW A;  4A8X C;  4E74 A;  4B0M A;  1DOX A;  1PYW D;  2K8B A;  2IY1 B;  1AYF A;  3AE2 B;  5J17 A;  3ZJV A;  1DBH A;  2DLB A;  5C3J B;  1S3S G;  4OZA A;  3I9V 1;  3UQA A;  1WR6 E;  4D0N B;  1V5M A;  4A6K A;  2KC1 A;  3TL5 A;  5HKH A;  3N20 C;  1OEY A;  4JKG B;  2D3A A;  2V0G A;  3NVV A;  1R4M I;  2PE9 A;  2QIE B;  3KW5 B;  2FCS A;  1R4N B;  1FHX A;  1WX8 A;  2N7E A;  4KKJ A;  2D9Y A;  2LGX A;  4A6H A;  5J2R A;  3TBL D;  5JH5 C;  2LEK A;  2RLO A;  1WJ1 A;  2YT0 A;  3W5U B;  5C5B B;  2HTH A;  2KDM A;  4LJO B;  1U5G A;  2GMI C;  4FBJ B;  1TQZ A;  4Y94 A;  1ZKH A;  1H8C A;  4JQW C;  2QCZ A;  2JXT A;  2K39 A;  2KJ6 A;  3KUD B;  1MJD A;  2X0S A;  1GOZ A;  2WX1 A;  2M38 A;  1SE4 A;  4MT7 A;  1QF6 A;  2WS3 B;  1HB8 A;  1MG4 A;  4K2O A;  1RFA A;  1P3R A;  4EMO A;  2XBB C;  1XLO A;  2R2O A;  5DH9 B;  4IC7 B;  4DXG A;  4HKZ E;  3JYU A;  2PE6 B;  3VH3 B;  1MG8 A;  2G35 A;  2GCJ A;  3W1Y A;  2Z0P A;  1PUT A;  2L0F A;  1RM6 C;  3CIR B;  5JVL A;  4W9F A;  1NEN B;  4NZL B;  1K5G B;  1ZYI A;  4LNK A;  4JPS A;  2WXK A;  5BYQ A;  5J3T A;  3JSV A;  3DXE A;  1YD8 U;  1V1P B;  3FEH A;  2LXA A;  4IKG A;  2MWN B;  2HDE A;  1CK1 A;  2UYZ B;  2SEB D;  3Q69 A;  5DHF B;  4K81 A;  2WLB A;  3AUL A;  4OT1 A;  1IGC A;  3A1Q B;  1X05 A;  4XWT A;  1WX7 A;  3EFU A;  2JWZ A;  1EF1 A;  5G5H A;  4GSW A;  1M94 A;  1YN5 A;  2SAK A;  4KIK B;  4AWJ A;  2N1V A;  2KKC A;  1Z5S B;  2N9L A;  2KIG A;  2BWE S;  2W54 A;  2AX5 A;  1GC7 A;  4H8S A;  2V3P A;  1FO4 A;  1C76 A;  2Y3A A;  1T0Q C;  2MEK A;  2H7D A;  1H10 A;  4AS1 A;  4Z2M B;  2DA0 A;  2KTR B;  4JWU C;  1FM0 D;  3FKY A;  1WXS A;  5KCV A;  1L0X B;  1HA5 A;  1UBQ A;  4XC2 A;  4FXC A;  2D9V A;  4I6P A;  3ZNG C;  3RFZ B;  2CKH B;  4IAP A;  1D3Z A;  4B9K A;  1U27 A;  5FR6 A;  3HSA A;  4PYZ A;  5LXI B;  2R0D A;  3VUW A;  3QQ8 B;  4OVU A;  2YEP F;  2ZW1 A;  2LHD A;  3VIA A;  3VRB B;  2H88 B;  1SBB B;  2ICI A;  2DZJ A;  2K3U A;  3OAW A;  3L10 B;  4NY0 A;  5LG4 B;  3Q3F A;  3A98 B;  2JYE A;  4JE3 B;  3DWM A;  5D2M B;  1GGO A;  1W1H A;  2E2X A;  2LHE A;  4FHK A;  3PRE A;  3TEW A;  1X1F A;  3N9Y C;  2LUL A;  2Q13 A;  2YS5 A;  1TZ1 A;  2V1Y A;  2RD0 A;  2R61 A;  1AWD A;  2MBQ A;  1N61 A;  4RH6 A;  5D3W A;  3AEC B;  5FK9 C;  2KFK B;  1UD7 A;  3P6A A;  3EPY A;  2UU7 A;  3ZJT A;  4PYU A;  3QBV B;  4EEW A;  3IVF A;  2PZ1 A;  5G55 A;  1WXQ A;  1I4P A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 1SIF A;  2PJH A;  4BKG A;  3TVV A;  4ASW C;  3T06 A;  2Y5B B;  1ZSQ A;  2NZ8 B;  3OJ3 A;  2K8C A;  2FUH B;  4M0W B;  2CHZ A;  1YQB A;  1XQQ A;  1WMH A;  1EO6 A;  2BPS A;  1WH3 A;  2WH5 A;  4DHZ B;  2EMS A;  1S1Q B;  3DDC B;  4MK0 A;  3NSU A;  2C7N B;  2EJ8 A;  2KLC A;  4E3C A;  2M0X A;  1Y5O A;  2WWZ A;  3VXW A;  2ELA A;  3PS6 A;  1FHW A;  2YT1 A;  1WGY A;  5DPW A;  2AEH A;  2WDT B;  3DXD A;  4B6W A;  2JUO A;  1AAR A;  1PQS A;  1WGD A;  1KOT A;  1U2B A;  4WJO A;  1XKE A;  4EJN A;  1KZG A;  4YON A;  5CHF A;  1TBE A;  4LCD E;  4K1R B;  4TQ0 A;  3ULB A;  2N1W A;  2ZJD A;  4TYZ A;  2NS5 A;  3PLU A;  1V2Y A;  3ZDT A;  5D7G A;  1WXV A;  4MEM A;  3T8M A;  3N7C A;  4I6L B;  2ROZ B;  4LDT B;  5GOW B;  1WXA A;  4WVF B;  2J0J A;  1WVH A;  2HJ8 A;  4AJW A;  5IJM A;  4JKC A;  1VD2 A;  5CLL B;  4KHB B;  4AOF A;  3U8Z A;  3D8D A;  2JXX A;  1T0Y A;  4HB0 B;  5J18 A;  3A9K B;  4W9J A;  1V86 A;  4GB9 A;  1V9J A;  3JW0 X;  5D3V A;  3ML9 A;  4F8C B;  2W2X C;  2K25 A;  1XT9 B;  1ST7 A;  4MM3 A;  2A4Z A;  3V61 A;  2MBE A;  4BKS A;  4CHM A;  2KD0 A;  2GBK A;  3BIN A;  4GDK B;  2LWP A;  4HXD A;  3F0W A;  4A6F A;  1HB6 A;  4DX8 A;  1V61 A;  2CHX A;  3FLV A;  4W9H A;  4F7H A;  2HRJ A;  1YJ1 A;  2DEN B;  4XWX A;  3RZW C;  3RCP A;  4GXB A;  3WAO A;  2KVR A;  2KDB A;  4F7U P;  1DIK A;  4W9L A;  2YF0 A;  2ZPN A;  1L7Y A;  2G4S A;  4KDL B;  3GOE A;  3L17 A;  1BT0 A;  1KJT A;  3QCA A;  1P5T A;  4BOS C;  5C79 A;  1XOD A;  3ZIM A;  3H7P A;  2BGF A;  2DYB A;  2GBJ A;  3QA8 A;  2Y8G A;  2ZEQ A;  2CS4 A;  4HHV A;  3WAM A;  4BOZ B;  2DKP A;  2ZPY A;  2RVB B;  4MY6 A;  2KJH B;  4BKS D;  4JKB A;  1ISN A;  5E6P A;  4AP4 C;  4JKE A;  3WIM A;  4W9I A;  3Q3J A;  1FB8 A;  2KLG A;  4NJ6 A;  3UQB A;  1U4A A;  1EUV B;  2BYV E;  1H4R A;  4PS3 A;  5D94 A;  2LGY A;  1JRU A;  5L95 C;  4KDI C;  2IYD B;  3KY9 A;  3A9K A;  4W9G A;  4MGY E;  2KHW B;  1WGQ A;  2FCM A;  2RR9 A;  2D10 A;  2O6V A;  2QHO A;  1GG3 A;  2KFJ A;  5LON B;  2EKE C;  3A8Q A;  2ZNV C;  2OJR A;  1SGH A;  5JHB A;  2K6D B;  5LOP B;  4HPL B;  1EVH A;  3L16 A;  2G3Q B;  1NTI A;  2P8V A;  3HM6 X;  5C1Z A;  3IBE A;  4P7I A;  3PT2 B;  4XZ4 A;  5DPT A;  4KHA A;  2L3Z A;  4IG7 B;  3ZVR A;  3TIX A;  5IAA C;  4DX9 0;  4A3O A;  2XK5 A;  2DHI A;  3R7Q A;  2MRP A;  2V76 A;  1Q0W B;  3SBT A;  5LXH A;  2MWS B;  2I1K A;  2EC1 A;  2KWU B;  1FAO A;  1MKE A;  1LXD A;  3RCZ A;  1WIA A;  2C7H A;  1NBF C;  2UZS A;  5HE2 A;  3MDB C;  4KIK A;  4CO7 A;  1X1M A;  1UPR A;  3UGB B;  3E9O A;  3SDL C;  5KQ4 A;  3E9L A;  2L2I A;  2NBV B;  2LGD A;  1WMH B;  1RJ2 A;  3APD A;  2R09 A;  3M3J A;  3VVW B;  2L76 A;  3AU4 A;  3GZN I;  3ZTD A;  5KHO A;  2I5C A;  3B08 A;  1B55 A;  2DTC A;  4MEL A;  2COP A;  2VRW B;  2KMA A;  1DRO A;  1XD3 B;  1WYW B;  3VOQ A;  2D07 B;  1UGM A;  3VTW A;  4II2 B;  3ODW A;  3ZLZ A;  4IM3 A;  4WJ7 A;  3QAQ A;  3MJW A;  4JLC A;  2L05 A;  5HE3 A;  3A9J B;  1GJZ A;  3PHX B;  2Z0O A;  5FI1 A;  1OQN A;  3DBR I;  4DDI D;  5JHA A;  4DBB A;  3H7S A;  3RZF A;  3D8E A;  5AZH A;  3V62 A;  3D32 A;  3ZO5 B;  2DKQ A;  2Z0Q A;  3CXB B;  4IWQ A;  2W2W A;  2KQ7 A;  3DVG X;  4HB4 B;  2L1C A;  1UEF A;  4W9K A;  1V5T A;  3QWM A;  2RPQ A;  4ANW A;  3PGE A;  2K00 A;  2O2V B;  1DYN A;  4WWO A;  1KZ7 A;  1UH6 A;  4I6N B;  1ZW7 A;  3SD5 A;  3SU8 X;  3GYP A;  4HLE A;  1VBG A;  4NJ7 A;  1BTN A;  4FN2 A;  2JZZ A;  2FID A;  2RUK B;  4HAV B;  4HAX B;  4GDL A;  1J19 A;  2VRR B;  4ICV A;  4K17 A;  1TXD A;  2J7Q B;  1P0R A;  1WE6 A;  5LLI A;  3PHW B;  2IO1 B;  4NAW A;  1I42 A;  3F5R A;  1HE8 A;  3H1U A;  3KYD D;  2KFK A;  3KVF B;  4NAW B;  3G9W A;  4W9D A;  2BYE A;  4ANX A;  2MKR A;  4J6I A;  3TFM A;  3VFK A;  4GOC A;  1WGU A;  3ZNH B;  2XQN M;  4DDG D;  4WJN A;  3N3K B;  4BBN F;  2CY4 A;  2KCJ A;  2MLB A;  4A20 A;  1DDM A;  4ILH A;  2B3A A;  1DDW A;  5DPS A;  1NI2 A;  2DYN A;  3FM8 C;  4AUQ C;  1GC6 A;  3MPX A;  3L0W B;  1PLS A;  4MH0 E;  4K7U A;  5D27 A;  1OY2 A;  1FXT B;  4B6H A;  4W9E A;  2KOX A;  1BAK A;  2D2Q A;  2LRU A;  2CQU A;  3HM3 A;  3R3M A;  3EEC A;  2ELB A;  1SHC A;  2D9Z A;  2BCJ A;  2ZVO A;  3C0R B;  4G11 A;  1V5P A;  2K2J A;  1K5D B;  4CHJ A;  2N7D A;  5DCN A;  3ULC A;  3UIO B;  2IO2 B;  2JVC A;  4HDQ A;  2MFQ A;  2FCN A;  1I7A A;  4ZRI A;  4KSK C;  1XX0 A;  4NQK E;  2DHK A;  3QJZ A;  2DX1 A;  1TTN A;  2LUE A;  4KV2 A;  1ZC4 B;  2LOZ A;  4M8N A;  1P98 A;  2RQ1 A;  2DN6 A;  2DX5 A;  1WX9 A;  2K8H A;  2DAF A;  1FGZ A;  1V88 A;  1ACA A;  3D8F A;  4GIV A;  4F7G A;  4HDO A;  3PPA A;  3CSF A;  3BY4 B;  2YS3 A;  2W2X D;  5DIF B;  1OQY A;  4YL8 A;  1KI1 B;  1PMS A;  3ZRC A;  2DFK A;  2KTF A;  4WWP A;  3DOW A;  2L7R A;  2MX2 A;  1V89 A;  3X23 A;  4RM8 A;  2D9W A;  2GBN A;  2G45 B;  2DZI A;  1Z2M A;  4MSM B;  4IM0 A;  2GBM A;  2FCQ A;  4E71 A;  3PVL A;  2AWT A;  5HE0 A;  1NTV A;  2DYM A;  1U29 A;  3WAP A;  5TR5 A;  2MW5 A;  4BBN C;  4ANV A;  2R82 A;  2DLW A;  4BFR A;  4CHK A;  2LVP A;  4DHJ D;  3A9J A;  1M7E A;  3I3T B;  3ALB A;  1V81 A;  1BTK A;  2Y8F A;  2GBR A;  4DBG A;  1KBL A;  5CHW A;  1YX5 B;  1E7U A;  3ECI A;  5L83 A;  3RD2 A;  3RT3 B;  2M1M A;  4RMA A;  3M63 B;  3H7P B;  5JHG A;  1E8W A;  2DAJ A;  3KUZ A;  2I5F A;  3ZW3 A;  2MSE D;  1ZC3 B;  3DBH I;  2XEW A;  2FJL A;  1BWN A;  3APF A;  4LJP B;  2AL3 A;  1NTY A;  2CB8 A;  3K9P B;  2DX5 B;  3ZDM C;  2RSU A;  3JVZ X;  3ENB A;  4C0A A;  2L8J A;  1EGX A;  2YS1 A;  3A33 B;  4Z2N A;  4JK8 A;  2HTH B;  4DXA B;  1XR0 B;  1OTR B;  5L81 A;  2DYQ A;  1A5R A;  1J0W A;  3SNH A;  1YIW A;  3ZNI D;  2GS0 A;  2DIK A;  2IO3 B;  4JKG A;  4EUT A;  2XK5 B;  1QC6 A;  3P2B A;  3V6E B;  2YLM A;  4EKU A;  1LB1 A;  4DK5 A;  3DPD A;  1QZE A;  3SO6 A;  1V80 A;  1I35 A;  1C1Y B;  2KAN A;  4HB3 B;  3IFW B;  1VBH A;  3HW2 B;  2COD A;  1Y8R C;  4MGZ E;  4WWN A;  1ZM0 A;  3LJ3 A;  3DXC A;  1W1D A;  4MGI E;  2X18 A;  2FJ9 A;  5EDS A;  1F9J A;  3DVG Y;  4FJY A;  4RM9 A;  3DCG A;  2CAY A;  1EAZ A;  1LW3 A;  1WRD B;  2M14 A;  5DHA B;  5J3Q A;  3H6N A;  3PVW A;  2LKO A;  4A6F B;  2KGX B;  1EF5 A;  2P0H A;  3QC8 B;  2GCL A;  3L08 A;  5D6J B;  2DYO A;  1UPQ A;  1UZX B;  3HK0 A;  3WYF B;  2ZCC A;  2UVM A;  2MA9 B;  1N3H A;  2MP2 B;  2WYQ A;  4G0N B;  3DBL I;  3A8P A;  3K9O B;  2UWQ A;  3P7Z A;  3ZTC A;  3PSC A;  1IP9 A;  3ML8 A;  3A4S C;  2OTX A;  1WGG A;  2J0K A;  1WM2 A;  3EHV A;  3APC A;  1X1G A;  2ZVN A;  1MIX A;  2DHJ A;  3PTF C;  2KWC A;  3TO1 A;  3R66 C;  1KM7 A;  3NY5 A;  1WE7 A;  2M8S A;  4OVV A;  3IG3 A;  2IO0 B;  1WJN A;  2NBU A;  4EOY A;  5C23 A;  4HVB A;  1V5U A;  3KYC D;  3VHT C;  1NVL A;  3M95 A;  3HIZ A;  2ROV A;  2W9N A;  2D4Q A;  2DHZ A;  5CLQ B;  1V6E A;  2D11 A;  1E5W A;  1E8X A;  2K1F A;  4HK2 A;  2BWF A;  2PEA A;  2L0T A;  1HBK A;  3ML4 A;  2LZ6 A;  3U7D A;  2GOW A;  3AI5 A;  3NZU A;  3QWZ B;  4BBK A;  3VTU A;  3L13 A;  4FLH A;  4K7S A;  2LJ5 A;  3PSE B;  3ENE A;  4DHZ E;  4KVG B;  4GGQ A;  2KK8 A;  2LRW A;  5E6O A;  2LI5 A;  4HWI B;  1IRS A;  2DZM A;  1GNU A;  1J0G A;  3PEG A;  2FNJ B;  1M7R A;  1UBI A;  2LAS A;  1XD4 A;  1RRB A;  3FSS A;  3SUZ A;  4IUM B;  5D3X A;  1V5O A;  2NMB A;  1WG7 A;  3KH0 A;  5E6N A;  3CMM B;  1E8Y A;  2KX3 A;  5AEK B;  3V5W A;  2JT4 B;  4TQ1 A;  2C5L C;  4HJK A;  3ONS A;  3KZ1 A;  2D3G A;  4BVU C;  2ABD A;  2P0F A;  4KZ0 A;  4PNK A;  1UEL A;  3OAN A;  4HAT B;  1PFJ A;  5JLJ B;  1L2N A;  4HAW B;  2AL6 A;  3JSV B;  3SYX A;  2JF5 A;  4KSL C;  1LQB A;  4A5K A;  4LDT D;  3N32 A;  4HAY B;  2BKF A;  2JP2 A;  5CHV C;  3VH4 B;  1WZ3 A;  2O6V B;  2LXC A;  2C9W B;  1U5D A;  4EFO A;  2PPH A;  3PRZ A;  2ZZP B;  1KC7 A;  2WX0 A;  1E90 A;  5DPR A;  4B95 A;  4DHJ B;  4K2P A;  1OMW A;  2JZ3 B;  4M8M A;  3OJ4 B;  3SV1 A;  2HE7 A;  1WJ6 A;  4F7Z A;  2LOX A;  3MHS D;  3UZT A;  2VSZ A;  4HCN B;  2RNR B;  4W9C A;  2FAZ A;  2R2Q A;  5C6R A;  4JK7 A;  3CF6 E;  4KAX B;  1Q1O A;  1MK9 B;  2KUP A;  3CIK A;  1JDE A;  2CRF A;  2NPT B;  4JGH B;  3O96 A;  2MBB B;  3MTN B;  4N9F 4;  3U30 A;  1FOE A;  2G4D B;  1MAI A;  4EZL A;  3PV1 A;  1WJM A;  2FDQ A;  4NSW A;  4EZK A;  2GJY A;  5JP4 A;  5DI9 B;  3TW1 A;  1WF9 A;  2Z0D B;  2KQS A;  1U5E A;  2IZV B;  4G3X B;  1MIZ B;  1FGY A;  2IY0 B;  1WY8 A;  3RUI B;  2DZK A;  2O2V A;  4HPM B;  1P6S A;  4A3P A;  3BJI A;  3VUY A;  3QK0 A;  3B1L X;  2MP2 A;  5BO4 B;  3NS8 A;  3H9D A;  1P9D U;  5JHH A;  4GDK A;  4HAZ B;  2JRH A;  4JIO U;  1W1G A;  1YX6 B;  4HAU B;  3ODX A;  3T9L A;  2I1J A;  4JK9 A;  4WSF A;  3NOB A;  5JZE B;  1IYF A;  1V49 A;  2N9P C;  4KHO A;  1TGZ B;  2ZNV B;  2KMC A;  3KRW A;  2A5U A;  1MK7 B;  4PS7 A;  2JRI B;  5CX3 A;  3DQV A;  4MJS A;  3S2A A;  2BYF A;  2MCN B;  3HQC A;  2NVU I;  4MSQ B;  3LJU X;  2KWV B;  2COC A;  3DVN U;  3PRP B;  3WAL A;  4L6E A;  3GYO A;  2KDF B;  1P3Q U;  2CU1 A;  3A4R A;  1G6J A;  3TCA A;  2UZR A;  2N9X A;  1X11 A;  2KN5 A;  5HE1 A;  4PS8 A;  2L00 B;  4TKN A;  3PLV A;  4GU2 A;  4URK A;  2C60 A;  1KLV A;  2MBO A;  5C16 A;  3E66 A;  4IM2 A;  1WR1 A;  4NPN A;  1IPG A;  4JKF A;  4FA6 A;  4G50 A;  4PQ0 A;  4TV3 A;  2KDI A;  3UF8 A;  2COF A;  4GN1 A;  2H7E A;  3KUC B;  5GMV A;  3O65 B;  2RGF A;  2MDX A;  1XCG A;  4ICU A;  2BKR B;  3NZS A;  3CST A;  1WGR A;  3L54 A;  1I2H A;  3NHE B;  4MDK E;  2HD5 B;  4MGK E;  3ZKJ C;  1P1A A;  2M4N A;  3PP2 A;  3UIP B;  2JY6 A;  1UNP A;  2FIF A;  2BF8 B;  5KQ1 A;  5IA7 A;  3UIN B;  2VKI A;  2M17 A;  3LDZ E;  2NPT A;  3KSY A;  2J0M A;  2NBW B;  2J59 M;  4GMV A;  4JKD A;  5AZG A;  2NCN A;  3WA0 A;  2N0Y A;  4FJZ A;  1E8Z A;  3N30 A;  1Y19 B;  4AJY B;  1Q5W B;  2P0D A;  4ZRK A;  3OLM D;  2LBB A;  5J3Y A;  2CHW A;  1C3T A;  2LYD A;  3VQI A;  1TJ6 A;  4JL9 A;  1Z87 A;  3QAR A;  2YRY A;  4FJV B;  1WI1 A;  4TUU A;  3TJP A;  1LM8 B;  3KRX A;  2C7M B;  2MQJ A;  2LD9 A;  2MBH A;  3PZD A;  3SBG A;  1WJU A;  4JKA A;  3QIJ A;  1ZGU B;  4IWO A;  4WQO B;  2KDE B;  4KZC A;  2CR5 A;  4FHJ A;  2KO3 A;  1E7V A;  1LFD A;  5CTR C;  1RRP B;  1ZVR A;  1OEY J;  1WGH A;  3AJ4 A;  2V4L A;  2REX A;  1SE9 A;  2YSZ A;  2QKM A;  4WJQ A;  4GPT B;  3WAN A;  2RSG A;  1WJ4 A;  1QQG A;  2KNB A;  1UNR A;  1WM3 A;  4F1S A;  4ZRJ A;  2O6V D;  2V3S A;  3PG7 A;  3V6C B;  2IBI B;  2ZCB A;  4WJP A;  2AYO B;  2N9E B;  3VUX A;  2Z0E B;  2Z59 B;  5AZF A;  1R4N I;  2OQB A;  3PVU A;  2RGN B;  4NQL B;  3SHQ A;  3M62 B;  1VCB A;  4GZU A;  2COA A;  3DVN V;  3RUL A;  1CMX B;  3ZNZ B;  2IYB A;  3PRM B;  4GMX B;  1J8C A;  4IOY X;  3AU5 A;  1WZ0 A;  1RAX A;  3ODO A;  2K2U A;  1AQC A;  3HHM A;  3M1I B;  3QHT A;  5D3Y A;  2LVO A;  3TMP B;  2OOB B;  1FHO A;  1OGW A;  3A1Q A;  4IWP A;  3RYT A;  3W1S C;  1U5F A;  1K8R B;  3ZVV A;  2N23 A;  3FP5 A;  4WAA A;  2K6Q A;  1WI0 A;  3IHP C;  2EMT A;  3R7R A;  4NNJ B;  3DBS A;  5FI0 A;  4FUL A;  3AXC A;  2YVC A;  4MJS B;  2KZR A;  4FAD A;  1NDD A;  2LVQ A;  2JPH A;  4BKT A;  2KC2 A;  1Q67 A;  3ZRF A;  3X0W A;  4IW0 A;  1DDV A;  5G2N A;  4IFS A;  4ILJ A;  2KXJ A;  2KJR A;  2NR2 A;  4ILG B;  2Y7B A;  2KTR A;  3W1S A;  5KHQ A;  5C5B A;  2QKL A;  4ZDV A;  2ADZ A;  2IFS A;  4K7W A;  4EZJ A;  1RLF A;  2ASQ A;  3B0A A;  1WXM A;  1AWE A;  3VTV A;  4X57 B;  1NU2 A;  4II3 B;  2KX0 A;  2LG1 A;  3QX1 A;  4XX5 A;  3E9P A;  1MPH A;  2D9X A;  3VAW A;  5EFX A;  4ZYN A;  2CY5 A;  4GDL B;  3ZUN A;  1GUA B;  4ANU A;  3EC8 A;  1WFY A;  2N4F A;  4HB2 B;  1X86 A;  4CYE A;  3V60 A;  3VDZ A;  4HCP B;  4JKH A;  4DWF A;  4E74 A;  2K8B A;  2IY1 B;  5J17 A;  1DBH A;  1S3S G;  3UQA A;  1WR6 E;  4D0N B;  1V5M A;  4A6K A;  2KC1 A;  3TL5 A;  5HKH A;  1OEY A;  4JKG B;  1R4M I;  2PE9 A;  3KW5 B;  2FCS A;  1FHX A;  1WX8 A;  2N7E A;  2D9Y A;  2LGX A;  4A6H A;  5J2R A;  3TBL D;  5JH5 C;  2RLO A;  1WJ1 A;  2YT0 A;  5C5B B;  2HTH A;  4LJO B;  1U5G A;  2GMI C;  4FBJ B;  1TQZ A;  4Y94 A;  1ZKH A;  1H8C A;  4JQW C;  2K39 A;  2KJ6 A;  3KUD B;  2X0S A;  2M38 A;  2WX1 A;  4MT7 A;  1HB8 A;  4K2O A;  1RFA A;  1P3R A;  4EMO A;  2XBB C;  2R2O A;  5DH9 B;  4IC7 B;  3JYU A;  2PE6 B;  3VH3 B;  1MG8 A;  2G35 A;  2GCJ A;  3W1Y A;  2Z0P A;  2L0F A;  5JVL A;  4W9F A;  1K5G B;  5J3T A;  3JSV A;  3DXE A;  1YD8 U;  3FEH A;  2LXA A;  2MWN B;  2UYZ B;  5DHF B;  4K81 A;  3AUL A;  3A1Q B;  1X05 A;  1WX7 A;  3EFU A;  2JWZ A;  1EF1 A;  4GSW A;  1M94 A;  4KIK B;  4AWJ A;  2N1V A;  2KKC A;  1Z5S B;  2BWE S;  1GC7 A;  4H8S A;  2H7D A;  1H10 A;  4Z2M B;  2DA0 A;  2KTR B;  1WXS A;  5KCV A;  4XC2 A;  1UBQ A;  2D9V A;  4I6P A;  3ZNG C;  2CKH B;  4IAP A;  1D3Z A;  4B9K A;  1U27 A;  5FR6 A;  4PYZ A;  5LXI B;  2R0D A;  3VUW A;  3QQ8 B;  4OVU A;  3VIA A;  2DZJ A;  3OAW A;  3L10 B;  4NY0 A;  3Q3F A;  3A98 B;  5D2M B;  1GGO A;  1W1H A;  2E2X A;  4FHK A;  3PRE A;  1X1F A;  2LUL A;  2Q13 A;  2YS5 A;  1TZ1 A;  2V1Y A;  2RD0 A;  2MBQ A;  5D3W A;  2KFK B;  1UD7 A;  3P6A A;  3EPY A;  4PYU A;  3QBV B;  4EEW A;  3IVF A;  2PZ1 A;  5G55 A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...