2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
b'MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
1ZW7A 2JVCA 4IWPA 3HM6X 2KDEB 3U30A 4HHVA 2COFA 2FAZA 3DBLI 1WXSA 2KDFB 2LASA 2FIDA 1P6SA 4MT7A 1BTKA 4B6HA 4W9KA 3A33B 3LJUX 3A9JA 2NS5A 1ZGUB 3D8DA 4MGZE 2N1VA 4HAZB 2NBWB 3TFMA 2DYNA 2GBNA 5DI9B 2D9XA 4WJQA 2LVOA 5DIFB 4K2OA 2K8BA 1X05A 2XK5A 4XWXA 2DLWA 2KMAA 1KJTA 3DXEA 2N1WA 4HDQA 2C5LC 2L8JA 2PJHA 3FEHA 3RULA 2GS0A 1FHXA 3WIMA 1J19A 1R4NI 2DENB 2KK8A 2H7DA 1EGXA 2DX5B 4LDTD 3A4SC 2VSZA 1WM2A 4B6WA 5G2NA 3DQVA 5GOWB 3QWMA 2RLOA 3V60A 3ZTCA 2COPA 2L7RA 4IFSA 3L16A 4I6LB 2JPHA 1H4RA 2Z0PA 1HE8A 1OQNA 2NVUI 3M3JA 1FXTB 2KANA 3WA0A 2LZ6A 2KQSA 2YT1A 4TQ1A 4TQ0A 4I6PA 2KUPA 1ZVRA 3IVFA 4W9HA 3ZW3A 1Y8RC 1P3RA 4JIOU 2ELAA 1K8RB 3GOEA 2LVQA 2G35A 5LOPB 4MY6A 3VOQA 1LXDA 2G3QB 4FJYA 3PEGA 4FJZA 2MP2A 4H8SA 3P7ZA 1H8CA 1FAOA 1ZM0A 2WWZA 3DDCB 1OMWA 4MH0E 4WAAA 2L3ZA 4HCNB 5LXHA 1EAZA 2MA9B 5L81A 3QA8A 2RSGA 1HB6A 2CHXA 4RMAA 2UYZB 2DTCA 2KFJA 2FDQA 1WGUA 2FJ9A 1WI0A 3R3MA 3SDLC 4RM8A 2COCA 5J3QA 2K1FA 4NAWB 3IBEA 2LG1A 4ZRKA 2N9EB 2Z59B 3PLUA 3A9KA 2L00B 2DAFA 3APCA 2DZKA 2P8VA 3QAQA 4ZDVA 1SIFA 1W1HA 4A3OA 1WE6A 2EMSA 2W2XC 4GSWA 5CHFA 2WYQA 1H10A 2NMBA 3MHSD 2KMCA 3ECIA 4YONA 4G3XB 3ODOA 2PE6B 4GPTB 2O2VB 1V5OA 4KZCA 2KOXA 2EMTA 2QKLA 1WF9A 4AUQC 3UGBB 3CSTA 1UEFA 4FHKA 5C79A 1KOTA 5CHVC 3OJ4B 1VD2A 3ULBA 2LOXA 4AJWA 1RLFA 2MW5A 2UVMA 4EZKA 2KN5A 3QARA 2LULA 4IW0A 1V49A 1FHWA 4HB0B 2C60A 5CX3A 1NTYA 3JYUA 1WIAA 4A6FB 3VHTC 2D4QA 2WX0A 1V88A 2D11A 1EUVB 3VH3B 1BT0A 2MBQA 1XX0A 3TO1A 2N0YA 1V5TA 2MBBB 2RD0A 2ASQA 3H1UA 4BKGA 5C5BA 4DHZE 4NNJB 4PS3A 5IAAC 2GCLA 2DFKA 1ZC3B 3P2BA 2HTHA 2LVPA 4RM9A 3KSYA 4GOCA 4GDLA 2KVRA 3KUDB 2KWVB 2JZ3B 5CTRC 4WJ7A 2LYDA 1D3ZA 2LKOA 1LW3A 3VUYA 1WGRA 2CB8A 2GCJA 4NY0A 1N3HA 1WFYA 3MTNB 2P0HA 2N9PC 4C0AA 1YD8U 3U7DA 2AL3A 1C1YB 1OY2A 4PS7A 2GJYA 1X1MA 1FOEA 1HB8A 1FGYA 5LXIB 3DVNV 4MDKE 1SE9A 1TXDA 1WE7A 2AEHA 1IPGA 2KJRA 3VDZA 1PFJA 2MX2A 1FHOA 3WAOA 4F7UP 2MWSB 2EJ8A 2ZVNA 3N3KB 3MJWA 4EKUA 4TKNA 3TL5A 1LFDA 4KIKB 1WMHB 3IHPC 4AJYB 4GDKB 2G4SA 2OJRA 1NTIA 3B1LX 3SD5A 2ABDA 1WJNA 2O6VB 2C7NB 2J0MA 1WGGA 1FGZA 4BKSA 5D3WA 2IY1B 4WQOB 1RRPB 2KD0A 4GU2A 4WJOA 4W9JA 4BKSD 3HM3A 1E8ZA 1GUAB 3VQIA 1DDMA 4PS8A 1X1FA 1R4MI 3PRMB 3M1IB 4DK5A 1MPHA 1U5DA 5D3YA 5KQ4A 4F7ZA 4HAYB 3PHXB 4NPNA 3EPYA 3L0WB 4HAXB 2M1MA 2JT4B 2J0KA 2V3SA 4DHJD 3AULA 2LOZA 3CXBB 2A4ZA 1TTNA 1OEYJ 3PVLA 4DBBA 1EF1A 1SHCA 1WJMA 3PTFC 3V6EB 3A4RA 5JHHA 1JRUA 3APDA 1UNQA 2IZVB 3PV1A 2DZMA 3ONSA 4GB9A 4IWOA 2CR5A 3DBRI 3WYFB 4II3B 2LGYA 5EDSA 3B0AA 5L83A 2KO3A 2R2QA 1AQCA 5D27A 2RPQA 4FLHA 2CY5A 1LB1A 3T06A 2OOBB 3QJZA 4F7HA 2JWZA 1UPQA 2XEWA 5CLLB 2BKFA 5EFXA 3VXWA 3AJ4A 3S2AA 5D6JB 2I1JA 2K8CA 4WWPA 4MGIE 4EZLA 1WJUA 3CSFA 1XKEA 2YT0A 4GMXB 3H7PB 3KH0A 4HAWB 2M17A 1UELA 4G0NB 4K7WA 2HE7A 3AU5A 1FB8A 1GG3A 1P1AA 3JSVA 4EMOA 2BCJA 5DHAB 1LQBA 4W9GA 3M63B 1ZC4B 2Y8GA 1V86A 1RRBA 2REXA 4HLEA 2CQUA 3PVWA 4HAUB 2BKRB 3ODXA 4WWNA 4HPMB 2YS3A 1UGMA 1OQYA 3VTWA 1U5GA 4HK2A 2K39A 1V6EA 3ZRCA 3VVWB 4FN2A 2KLGA 1WG7A 3GYOA 3APFA 3DOWA 3NS8A 4MEMA 3PT2B 1WX9A 2IY0B 3PGEA 4A6KA 2AL6A 3EC8A 4HPLB 1GNUA 1EF5A 1XODA 3V62A 1U5FA 2W9NA 5D94A 5C1ZA 4P7IA 1WJ6A 1KZ7A 3TMPB 2D9YA 5CLQB 2HRJA 1G6JA 1PMSA 3BJIA 3ML9A 2Z0OA 3VAWA 3RZFA 1K5DB 4BBNC 1WGDA 4KHBB 3H6NA 3W1SC 2FCNA 1WRDB 2KC2A 3T9LA 3SUZA 3CF6E 2Y7BA 4WVFB 3ULCA 5J3TA 2B3AA 2QKMA 2I5CA 2K25A 3SYXA 4CHKA 2J0JA 4Y94A 3NZUA 4URKA 4K7UA 3VTUA 4KDIC 2UZRA 4MJSB 5JHAA 3PP2A 5D7GA 2DX5A 2BYVE 4HVBA 2FIFA 3C0RB 5J18A 1TZ1A 1Y5OA 1V89A 1J8CA 1E7UA 5JH5C 1M7EA 2D9ZA 1TJ6A 2WH5A 3VH4B 2CRFA 2MFQA 2ZNVC 3DXCA 1KZGA 2NZ8B 4JLCA 5E6OA 4FBJB 3I3TB 2PEAA 1Q5WB 3JVZX 1X86A 1WI1A 1WGYA 1GC6A 4FULA 2MBOA 1KLVA 4NQKE 3PG7A 2N4FA 2MSED 3WAMA 2MBEA 1PLSA 4X57B 3M95A 4JGHB 3QBVB 2GBJA 1WR1A 3IFWB 4M0WB 2MRPA 1IP9A 2CODA 5JZEB 2PZ1A 2VKIA 2KNBA 3RUIB 2H7EA 4MGKE 1K5GB 4DDGD 1NI2A 4MK0A 5J2RA 3R7QA 2MLBA 3QC8B 1UPRA 2JUOA 1OTRB 2W2WA 1U4AA 3HK0A 1C3TA 3TW1A 1NVLA 5E6PA 5AZHA 2YS5A 4HATB 1WZ3A 3VUXA 1E90A 1V61A 2ELBA 3HIZA 3UINB 4NAWA 5AZGA 2C9WB 1MG8A 5FR6A 2LRWA 4ASWC 2ZCBA 3H9DA 2OTXA 3KYDD 4M8MA 3T8MA 2R09A 1T0YA 3ZUNA 4EFOA 4E3CA 2YSZA 1W1DA 2YS1A 4TUUA 2MDXA 4HDOA 3MPXA 4B9KA 2KFKB 3GYPA 3L54A 1ACAA 3D8FA 4PYUA 2DYOA 1WX7A 2K2UA 2RQ1A 3UIOB 2ZEQA 1Q67A 2O2VA 2KTRB 1TQZA 2K6QA 2IYDB 3DBHI 2CU1A 2L76A 2IFSA 1CMXB 2ZNVB 2FUHB 4DWFA 4IM3A 4NJ6A 2DYBA 4ICUA 4OVVA 1V81A 3PREA 4YL8A 1ZSQA 4G50A 3KZ1A 3UZTA 2KTFA 1S1QB 3H7SA 4A6FA 4Z2NA 1I7AA 2Y5BB 2DZIA 4CO7A 4HAVB 5HE0A 3ZTDA 3RCPA 2YRYA 2LBBA 1WXAA 2IO1B 1E8YA 2R0DA 3RT3B 2GMIC 4IC7B 5KHQA 4IG7B 1MK7B 3QHTA 2Z0EB 5JLJB 3EHVA 5D3VA 1EO6A 2JF5A 2K2JA 2IO2B 3A1QB 2FJLA 3SV1A 1OGWA 2ADZA 1UZXB 1E8WA 4KSKC 5D3XA 4M8NA 2EC1A 1KM7A 1L7YA 2JRIB 4XC2A 1E5WA 2JZZA 1WGHA 4PNKA 3ZKJC 3U8ZA 1KI1B 2KWUB 3VFKA 4WJPA 4EJNA 5LLIA 1M7RA 5DHFB 2N7EA 2LRUA 4MSQB 3A9JB 2KDIA 1P98A 2IYBA 2IBIB 3QIJA 2ZPNA 1WM3A 3FP5A 2HJ8A 3KRXA 4K7SA 4ZYNA 4KDLB 1WY8A 2V76A 3EFUA 1M94A 1U5EA 2LGDA 2I1KA 3PLVA 3RD2A 1NBFC 2XK5B 3QQ8B 1XT9B 1UNRA 3W1YA 1ST7A 1Q1OA 1E8XA 4FHJA 4LDTB 3JW0X 2RVBB 5KHOA 1UH6A 3K9PB 1OEYA 2W2XD 2V1YA 5DPRA 3EECA 4LJOB 4LCDE 3PHWB 4ANXA 4FADA 4KIKA 1WMHA 4XX5A 4GDKA 4WSFA 4AOFA 3UQBA 4PQ0A 2KJ6A 1DDWA 1TBEA 2MWNB 3HQCA 2O6VA 1TGZB 1L2NA 3ODWA 5C23A 3KY9A 4W9CA 2O6VD 1P5TA 2NBVB 3ZNHB 3TIXA 4CHJA 2JRHA 2CS4A 2KGXB 1J0GA 3OLMD 3UIPB 1MIXA 2D10A 2L2IA 1BAKA 3B08A 2L0TA 4GGQA 5J17A 1J0WA 3G9WA 3RZWC 4KHAA 2N7DA 2VRRB 4B95A 1A5RA 1Z5SB 4J6IA 1VCBA 5AEKB 3ML4A 5C6RA 5L95C 2CHWA 2GOWA 5KCVA 3KYCD 2UWQA 3FSSA 2ZZPB 2KJHB 3OJ3A 3AXCA 4FJVB 2ZCCA 2MP2B 1IYFA 3PVUA 4BBKA 3F0WA 1XCGA 5HE2A 4BFRA 2MKRA 5G55A 3V61A 2X18A 3O65B 4N9F4 3RYTA 3L10B 2WX1A 4HWIB 2LD9A 1WR6E 3L13A 1YX5B 4GZUA 3ENEA 1SGHA 1F9JA 2C7HA 4AP4C 1YJ1A 2HD5B 2DAJA 2Q13A 4ZRJA 1V5PA 4BKTA 4DX8A 4NJ7A 3UQAA 3TJPA 1UD7A 4W9IA 3VUWA 2ZVOA 3DPDA 3FM8C 2DN6A 1XR0B 3DCGA 1UBIA 1QC6A 3M62B 1WH3A 3TCAA 2M0XA 3A9KB 2UZSA 2VRWB 1X11A 3PRPB 4W9EA 2JY6A 1YQBA 3O96A 4HCPB 1RJ2A 4IOYX 4ZRIA 3PZDA 5AZFA 3ZNGC 3TBLD 2L1CA 2P0DA 5E6NA 1X1GA 4BBNF 2Y8FA 3V5WA 2L05A 1WXVA 3H7PA 4MSMB 3X23A 3PSEB 2DYMA 3F5RA 2KXJA 1Z87A 2BYEA 3NZSA 2J59M 3ZNZB 4FA6A 5IA7A 1V9JA 3ZRFA 3DXDA 2YF0A 4TYZA 3TVVA 4K2PA 1AARA 2DZJA 1AWEA 1PQSA 2OQBA 4ICVA 5J3YA 2MQJA 1I42A 2GBMA 5DCNA 2IO0B 1Q0WB 1DROA 2K00A 2NBUA 2XBBC 1P0RA 1ISNA 2CAYA 2L0FA 2D3GA 2PE9A 5C5BB 4ANVA 3HW2B 4Z2MB 1P3QU 2DHJA 3ZVVA 3FLVA 3WALA 3N7CA 2DYQA 2ROZB 2FCQA 4KV2A 4KHOA 2EKEC 2P0FA 3BINA 2HTHB 2ZPYA 2JP2A 4EEWA 5GMVA 3KW5B 2WDTB 1BWNA 2J7QB 3HHMA 2BF8B 5D2MB 4IWQA 4D0NB 2LGXA 4GDLB 4HB4B 4K81A 3ML8A 4BOSC 3DBSA 1HBKA 4MELA 4GIVA 1E7VA 2G45B 4W9LA 2KX3A 3ZIMA 5HE3A 2D07B 2COAA 1V80A 3LJ3A 3GZNI 2NR2A 1W1GA 3PSCA 4NQLB 1WX8A 1WJ1A 1U29A 2BPSA 3PRZA 2ZJDA 4HB2B 2D9WA 3ZVRA 2RNRB 4W9FA 4KVGB 1DYNA 4E74A 4IM2A 3OANA 2LUEA 3V6CB 3Q3JA 1UBQA 4HB3B 1DDVA 2I5FA 4A3PA 2XQNM 4MJSA 2Z0DB 5LONB 1XD4A 4GN1A 4ANUA 3LDZE 2FCMA 2BYFA 2AWTA 2LXCA 3QX1A 1RFAA 2KDBA 2RR9A 1NTVA 2DKPA 3Q3FA 4F1SA 2KZRA 2KKCA 3N30A 4IUMB 3KUZA 1QZEA 5FI0A 2MBHA 3X0WA 3WANA 3A8PA 1DBHA 4EUTA 4TV3A 3BY4B 1IRSA 1UNPA 5CHWA 4OVUA 2KHWB 4WJNA 4MGYE 1I35A 2KCJA 3R66C 1MKEA 5JHGA 2M14A 2R2OA 2BWES 1WGQA 2DHKA 3KRWA 4DBGA 3SNHA 5DPWA 3ZDMC 2RSUA 3CIKA 4II2B 4DHZB 4A5KA 3ZNID 4F8CB 3CMMB 1WVHA 1ZKHA 4CYEA 3QCAA 5DPTA 4JL9A 1V2YA 2RGFA 2M8SA 2E2XA 2LJ5A 4DXAB 4DHJB 1MIZB 2D9VA 1NU2A 2BWFA 2CKHB 2K8HA 2GBRA 3QK0A 4XZ4A 4IAPA 3IG3A 2DHZA 1WJ4A 2DX1A 4K17A 3A98B 5HKHA 3AI5A 2AYOB 1Z2MA 2A5UA 4EOYA 2YLMA 1GJZA 1MAIA 2FNJB 1P9DU 4A6HA 5DH9B 2KC1A 1LM8B 4BVUC 3OAWA 4AWJA 4EZJA 2BGFA 2KQ7A 5C16A 4KAXB 5FI1A 2KWCA 3KVFB 3W1SA 3QWZB 4MM3A 3D32A 2QHOA 2NPTB 2CY4A 1BTNA 3DVGX 5JP4A 3K9OB 4KZ0A 2IO3B 2M4NA 3NY5A 2V4LA 3NHEB 2C7MB 3DVGY 1QQGA 3DVNU 2ROVA 4W9DA 1Y19B 3P6AA 4NSWA 3UF8A 3ZLZA 1YX6B 3MDBC 2DHIA 3L17A 3RCZA 5DPSA 2KX0A 5BO4B 4F7GA 2GBKA 3ZDTA 2LWPA 3PPAA 2KFKA 1XD3B 2N23A 3SU8X 2G4DB 3VIAA 1EVHA 1U27A 5TR5A 4IM0A 3D8EA 2RGNB 2KTRA 4ANWA 2LI5A 2FCSA 4JQWC 3WAPA 2CHZA 1NDDA 1S3SG 4BOZB 3AU4A 2DKQA 4DX90 4DDID 1U2BA 3ZO5B 4GXBA 4WWOA 1MK9B 4E71A 4HJKA 2M38A 2NCNA 3JSVB 1WXMA 5JHBA 2KLCA 4K1RB 4A20A 1WYWB 2D2QA 1GC7A 5IJMA 2DA0A 1XQQA 2YVCA 4KSLC 4G11A 1RAXA 3ALBA 3PS6A 2PPHA 3VTVA 1V5MA 1V5UA 5KQ1A 2K6DB 1WZ0A 4L6EA 3R7RA 2RUKB 3A8QA 3L08A 4LJPB 4HXDA 3NSUA 5HE1A 2MCNB 2N9XA 3SO6A 2NPTA 3NOBA 4CHMA 3A1QA 2JXXA 4GMVA 1B55A 2LXAA 4I6NB 3KUCB 3SHQA 2Z0QA 1YIWA 4PYZA 1I2HA 3N32A
chains in the Genus database with same CATH superfamily
1ZW7A 2JVCA 4IWPA 1B9RA 3HM6X 2KDEB 2WXIA 3U30A 4HHVA 4M00A 3MHZA 5FK9C 1ZDVA 4D2KA 2COFA 1JWUD 2FAZA 3GP7A 3DBLI 5BMIA 1N63A 1WXSA 2KDFB 2L52A 1EWYC 2LASA 2FIDA 1JALA 1P6SA 4MT7A 1BTKA 4B6HA 3AEFB 4W9KA 3AMZA 3A33B 3LJUX 2WDQB 3A9JA 2NS5A 1ZGUB 3D8DA 1A70A 4MGZE 2N1VA 4LK0M 4HAZB 2NBWB 3TFMA 2DYNA 3V05A 3HVDA 2GBNA 1VLBA 3BVMA 5DI9B 2D9XA 3N1YC 4WJQA 2LVOA 5DIFB 3B2FA 4K2OA 1FIQA 4RCOA 5HFYA 1HA5A 1VZ6A 2K8BA 2LMCA 3HRDD 3P4SB 1X05A 3R8BA 2XK5A 2LGIA 2ON8A 4XWXA 2DLWA 2KMAA 1I4GA 3V3XA 1KJTA 4QAYA 3DXEA 1AWDA 2N1WA 1TS3A 4HDQA 2LGSA 2C5LC 3NVYA 2JX5A 2L8JA 2PJHA 3N9YC 4RGTA 3FEHA 3RULA 2GS0A 2KACA 1FHXA 3WIMA 5AUIA 1AW7A 1J19A 1R4NI 2WXFA 2PTLA 3GZNB 2DENB 2RPVA 1FMAD 2KK8A 2H7DA 1EGXA 4GLSC 2DX5B 2CJNA 1UNSA 4LDTD 1VJKA 2I2YA 3A4SC 5FR3A 2VSZA 1WM2A 4B6WA 5G2NA 3DQVA 4A90A 4YSZB 3UI3A 5GOWB 3QWMA 2RLOA 1SE2A 1F1HA 1JWMD 3V60A 3ZTCA 2COPA 2L7RA 3NZ3A 2D3BA 4IFSA 2AQ1B 1MI0A 3L16A 4I6LB 3BVGA 2JPHA 2NBVA 4RF0A 1H4RA 2Z0PA 2FE8A 1HE8A 1OQNA 2NVUI 1QF6A 1MI1A 1FXTB 3M3JA 2XN9C 2KANA 3WA0A 5I4DA 1D4BA 1F2RI 2LZ6A 2KQSA 2YT1A 4TQ1A 4TQ0A 3IAS1 1MPEA 4I6PA 1C78A 2KUPA 2KVZA 2Y5CA 3AE7B 1ZVRA 3AB5A 3IVFA 2HTME 4W9HA 3ZW3A 3ZXRA 1Y8RC 1P3RA 4JIOU 5T8IA 4H2AA 2ELAA 1K8RB 3AM9A 3GOEA 2BS4B 3TEYA 2LVQA 4MT5A 5IP4D 1FRRA 1YN3A 2G35A 5LOPB 4MY6A 3VOQA 1LXDA 2G3QB 3T3NA 1SBBB 4FJYA 4PK1A 3PEGA 4FJZA 3NUHB 2MP2A 4H8SA 1TYGB 3P7ZA 1VRAB 2JU6X 3HIEA 1H8CA 1FAOA 3AECB 1YNTE 4M01A 1ZM0A 2WWZA 3DDCB 5TSSA 1OMWA 4MH0E 4WAAA 2L3ZA 2PW9A 4HCNB 5LXHA 1EAZA 2MA9B 2R61A 5L81A 1VZ7A 3QA8A 1P7FA 2RSGA 1FD6A 1QKZA 3NS1A 1VR9A 2IDYA 1HB6A 1KLUD 2CHXA 4RMAA 2UYZB 2DTCA 2KFJA 1OQRA 2FDQA 1WGUA 1FXIA 2FJ9A 1WI0A 3R3MA 3SDLC 4RM8A 2AQ3B 2COCA 5J3QA 1V1OA 2K1FA 3OG5A 1LGRA 3Q2AC 4NAWB 4JKFA 3AE9B 3P4PB 1OQQA 1N5XA 3IBEA 1N61A 1YQ4B 2LG1A 1I4QA 5HHDG 4ZRKA 2N9EB 2IGGA 2Z59B 4C80A 3PLUA 3NRZA 1OFFA 3A9KA 2L00B 2DAFA 3APCA 2DZKA 2P8VA 3QAQA 4ZDVA 1AN8A 1SIFA 1W1HA 3GS2A 4A3OA 1WE6A 3BYTB 2EMSA 2W2XC 5BMHA 4GSWA 2W82A 1T0SC 5CHFA 2WYQA 1H10A 2NMBA 1GPXA 1FNUA 3MHSD 2KMCA 4OHJA 3ECIA 4YONA 2FUG1 4G3XB 1IBXB 5BMGA 3ODOA 2PE6B 4GPTB 2O2VB 1V5OA 4KZCA 2KOXA 4TSSA 2EMTA 2QKLA 2V4IB 3BZDB 3TEWA 1WF9A 4HPPA 4AUQC 1FM0D 3UGBB 2ICIA 3CSTA 1UEFA 1YN4A 4FHKA 4IDIA 3I9V1 5C79A 1RWSA 3W9CB 1KOTA 1DOYA 5CHVC 3OJ4B 1VD2A 3ULBA 2LOXA 4AJWA 1RLFA 2MW5A 2UVMA 2J4XA 4EZKA 2KN5A 3IAM1 3ZXVA 3C19A 2W55A 3QARA 1GB1A 2LULA 1CQVA 3AEBB 4IW0A 1V49A 1KBLA 1FHWA 4HB0B 2C60A 5CX3A 1NTYA 2BVCA 4ILJA 1TY0A 3JYUA 1WIAA 4A6FB 3VHTC 2D4QA 2WX0A 1V88A 3CWIA 2D11A 1EUVB 3VH3B 1BT0A 2MBQA 1XX0A 1MJDA 3TO1A 2N0YA 1V5TA 2MBBB 2RD0A 2ASQA 3H1UA 4BKGA 5C5BA 4DHZE 5M4YB 4NNJB 1UGJA 2KMMA 4B0MA 4PS3A 5IAAC 2GCLA 2M19A 1HTQA 4HROA 2DFKA 2K8EA 1ZC3B 3P2BA 2HTHA 2LVPA 4RM9A 2R2YA 3AE2B 1HQRD 3KSYA 4GOCA 1GAQB 4GDLA 2KVRA 3KUDB 4LLGM 1MVKA 2KWVB 3E9OA 3U7ZA 3B77A 2JZ3B 5CTRC 4WJ7A 2LYDA 1D3ZA 2LKOA 1LW3A 1B1ZA 3VUYA 1WGRA 2CB8A 2WU5B 3P4RB 2GCJA 2K9XA 4ZRQA 4O1NA 4NY0A 1N3HA 1WFYA 3MTNB 2P0HA 2N9PC 4S0RA 4C0AA 4NAMA 1YD8U 3U7DA 2YEPF 2AL3A 1C1YB 1OY2A 4PS7A 4OW0A 2GJYA 1X1MA 1FOEA 1HB8A 1FGYA 5LXIB 3DVNV 1J7BA 2L83A 4MDKE 3RN9C 1SE9A 3DBLB 3Q8AA 1TXDA 3Q8FA 1WE7A 2AEHA 2KJRA 1IPGA 5JVLA 3VDZA 1QQRA 4WQMA 1PFJA 2MX2A 1FHOA 3WAOA 1UWXA 4F7UP 2MWSB 2EJ8A 1N62A 5D3DA 2ZVNA 3FVCA 1PGAA 2W3SA 3A58A 3N3KB 1VDVA 3MJWA 1QOFA 4EKUA 4UDUC 4TKNA 3NVZA 4J3OD 3TL5A 1LFDA 2E3TA 2HDEA 4KIKB 1WMHB 3IHPC 4AJYB 2KWDA 4GDKB 2G4SA 1FPYA 2OJRA 2QJLA 1ZOYB 1NTIA 2LJIA 3B1LX 3SD5A 2ABDA 1WJNA 1EM7A 2O6VB 2C7NB 2J0MA 1WGGA 1FGZA 1ACCA 4BKSA 3N20C 3RNBC 1ZYIA 1J7CA 5D3WA 4RNAA 2GB1A 2IY1B 4WQOB 1RRPB 2KD0A 2MHJA 4M02A 4GU2A 2W3RA 1QILA 4WJOA 4Q2JA 4W9JA 4BKSD 1HTOA 3HM3A 1E8ZA 4YTPB 1GUAB 1XEEA 3VQIA 1DDMA 4YT0B 4PS8A 1YQ3B 1X1FA 1R4MI 3SEBA 3PRMB 3M1IB 1NENB 1WYGA 4DK5A 1MPHA 1U5DA 1ESFA 2Z13A 2QC8A 2WHIA 5D3YA 3O13A 2V3PA 5KQ4A 4F7ZA 4HAYB 3PHXB 4NPNA 4MACA 4D6WA 4N58A 3EPYA 3L0WB 4HAXB 2AQ2B 2M1MA 2JT4B 2WXPA 3TUOA 2J0KA 2V3SA 4DHJD 3AULA 2LOZA 2WXJA 3CXBB 2D3CA 2A4ZA 4US9A 1TTNA 5BYQA 1TKEA 1OEYJ 3PVLA 4DBBA 1MG4A 1EF1A 1SHCA 1WJMA 3PTFC 3V6EB 3A4RA 5JHHA 3C8YA 1JRUA 3APDA 2BQQA 1BMLC 3AN1A 4ILHA 1UNQA 2GI9A 2IZVB 4XDDA 2PVGC 2BB6A 3PV1A 2DZMA 2K49A 3ONSA 4GB9A 4LNOA 4S17A 4IWOA 2CR5A 3DBRI 3WYFB 4II3B 2LGYA 2WLBA 5EDSA 1FCCC 3URYA 2INNE 2MH7A 3B0AA 5L83A 2KO3A 2R2QA 1AQCA 5D27A 2RPQA 4LNIA 1BUIC 4FLHA 3B2GA 1YN5A 2DLBA 2UU7A 2CY5A 1LB1A 3T06A 2OOBB 4USAA 3QJZA 4F7HA 1PUTA 2J52A 1KFYB 2JWZA 1UPQA 1KH0A 1QOBA 2XEWA 1K52A 4QJ3B 3E9SA 5CLLB 2BKFA 5EFXA 3VXWA 3R2TA 3AJ4A 5EE1A 1WRIA 1J7AA 3BWUD 3S2AA 5D6JB 2I1JA 1CJEA 5I2MA 2K8CA 4WWPA 4MGIE 4L1BA 4EZLA 3KWVA 1C4AA 2OEDA 2VH2A 1QT9A 1WJUA 4JKAA 3CSFA 1XKEA 2YT0A 1TS4A 3NWAA 3FILB 4GMXB 3EGRA 2K5PA 3H7PB 3KH0A 4HAWB 2M17A 1UELA 4G0NB 4K7WA 2HE7A 2WXMA 3AU5A 1FB8A 1GG3A 1P1AA 3JSVA 4WIPA 4PT5A 4EMOA 5JXVA 3RNEC 2BCJA 5DHAB 1LQBA 1L6UA 1T0QC 3WCQA 4W9GA 3M63B 1ZC4B 2Y8GA 1V86A 1DOXA 1RRBA 2REXA 1FEHA 4HLEA 2CQUA 3PVWA 4DXGA 2LEKA 4HAUB 2BKRB 3ODXA 2I38A 4WWNA 2VZKD 1TKGA 2M56B 1IGCA 4HPMB 2YS3A 5IO9A 2IJ0A 1XF5L 3VRBB 1UGMA 1OQYA 3VTWA 3AE8B 1ROEA 1U5GA 4HK2A 3J9CA 2K39A 1V6EA 3ZRCA 1K50A 4XYCA 1WSPA 3KQ4A 3VVWB 4FN2A 3ZQ4A 2KLGA 1WG7A 1Y56A 3GYOA 3APFA 3DOWA 3NS8A 4MEMA 3PT2B 1WX9A 1XCQL 2IY0B 3PGEA 4A6KA 2AL6A 3MC9A 3EC8A 2VH1A 3DWMA 4HPLB 1GNUA 1EF5A 1XODA 3V62A 2DBYA 1U5FA 2W9NA 5D94A 5C1ZA 3ZJUA 2G1EA 3RNGC 3ZYYX 4P7IA 1WJ6A 1SE4A 1KZ7A 3TMPB 2D9YA 5CLQB 2HRJA 3IT4B 4KGSA 1G6JA 4K3CA 1PMSA 4L2YA 3BJIA 3ML9A 2Z0OA 3VAWA 3RZFA 1C76A 1T6BX 1K5DB 4BBNC 1WGDA 4KHBB 5EE9A 3AEEB 3H6NA 1SJED 3W1SC 1V1PB 3IXSA 2K3UA 2FCNA 1WRDB 2KC2A 1LO5D 1VBGA 2WNMA 4NJCA 1KC7A 4CSQA 1MHHE 3T9LA 3SUZA 2LFIA 2WXRA 3CF6E 2Y7BA 4WVFB 4JWSC 3ULCA 4TMAB 4JKGB 2J42A 5J3TA 2B3AA 3L4PA 2QKMA 2I5CA 2K25A 1UF0A 3SYXA 2RDHA 4ITKA 2INCC 4RGOS 2JYEA 4CHKA 1SIJA 3HUIA 2J0JA 3SFDB 4Y94A 3NZUA 4URKA 4K7UA 3VTUA 4KDIC 2UZRA 4MJSB 1XCTL 5JHAA 3PP2A 2Q5WD 3NVWA 5D7GA 2IPKD 2DX5A 3H8HA 2BYVE 4HVBA 2FIFA 3C0RB 5J18A 1NYRA 1C77A 1TZ1A 1Y5OA 1QOAA 1V89A 1J8CA 1E7UA 5JH5C 2JSVX 1M7EA 2QCZA 2D9ZA 1TJ6A 1PYWD 1XO3A 2WH5A 3VH4B 2CRFA 1JWSD 2MFQA 2ZNVC 3DXCA 1KZGA 2YT2A 1DGJA 2NZ8B 4C00A 4JLCA 2WP9B 5E6OA 5C3JB 2SEBD 4FBJB 3I3TB 2PEAA 1Q5WB 3JVZX 1TKYA 1X86A 2QIEB 1WI1A 2KUQA 1WGYA 3MP9A 1GC6A 4FULA 2KYWA 2MBOA 1KLVA 3ENBA 4NQKE 3PG7A 2N4FA 3EA6A 2MSED 3WAMA 2MBEA 2ZW0A 1PLSA 1XXGA 3M95A 4X57B 4XGAB 1ET6A 1PGXA 4JGHB 2WXGA 1CK1A 3QBVB 2GBJA 1WR1A 3IFWB 4M0WB 1P7EA 2MRPA 1IP9A 2CODA 5JZEB 3SBTA 2PZ1A 2VKIA 2KNBA 1L0VB 2CU3A 3RUIB 2H7EA 4MGKE 5D3IB 3Q8EA 2KR0A 1K5GB 2V3NA 3Q8BA 4C7YA 4DDGD 1NI2A 1V8CA 4MK0A 5J2RA 4HRSA 3R7QA 2MLBA 4XDCA 3Q3NC 2MJ3A 2N9KA 3QC8B 1UPRA 3SFEB 4AQ7A 2JUOA 3SBGA 1OTRB 2W2WA 1QOGA 1U4AA 3HK0A 1C3TA 3TW1A 1NVLA 2JYTA 5E6PA 2WDRB 2W54A 5AZHA 2YS5A 3AE4B 3RFZB 4HATB 5LNK1 1WZ3A 3VUXA 1E90A 1ZUD2 1V61A 2ELBA 4ARCA 2WXHA 1RM6C 4MM3B 2G9HD 3HIZA 3UINB 2WXNA 1FCLA 4NAWA 1E0ZA 1T0RC 5AZGA 4P6VF 2C9WB 1MG8A 5FR6A 3EUB2 2LRWA 4ASWC 1F2RC 3ZGZA 1GB4A 2ZCBA 2QEJC 3H9DA 2Z59A 2OTXA 3KYDD 4M8MA 4KGTA 3T8MA 2R09A 4A55A 1T0YA 2WS3B 3ZUNA 1KF6B 5AUKA 4EFOA 2LUMA 3OHMB 4E3CA 2YSZA 4JK7A 2X38A 2R82A 1W1DA 2YS1A 4TUUA 2MDXA 3DBRB 4HDOA 3MPXA 4B9KA 4BZAA 2KFKB 3GYPA 4A8XC 3L54A 1ACAA 3D8FA 3I57A 4PYUA 3RNAC 2DYOA 1WX7A 2K2UA 2RQ1A 3UIOB 2ZEQA 1IBXA 3TSSA 1Q67A 2O2VA 2KTRB 4M0WA 1TQZA 5HG2A 2WGSA 2K6QA 2JXTA 2IYDB 3IT6B 3DBHI 2CU1A 1WGKA 2L76A 2IFSA 1VZ8A 3AE1B 1EU3A 1CMXB 5C2TB 2ZNVB 4KGRA 1TS5A 2FUHB 4LNNA 4ZHPA 4A9AA 4DWFA 4LTUA 3ZJTA 4IM3A 3AEDB 1STEA 4NJ6A 2DYBA 4ICUA 4OVVA 1N60A 4ACFA 1V81A 3PREA 4YL8A 1ZSQA 4G50A 1M4VA 3KZ1A 3UZTA 2KTFA 1S1QB 2PVOD 1IUEA 1FFVA 3H7SA 1N6ZA 4A6FA 2BB5A 4Z2NA 4B0EA 1I7AA 2Y5BB 2DZIA 3AE3B 4CO7A 4HAVB 5HE0A 4P16A 2N7JA 3ZTDA 3RCPA 2YRYA 2LBBA 1WXAA 2IO1B 1E8YA 2KN4A 3NW8A 2R0DA 3RT3B 3MC8A 2GMIC 1QLBB 4IC7B 1TY2A 2RRFA 5KHQA 2BT6A 4IG7B 1F77A 1MK7B 3QHTA 4DQOC 2Z0EB 5JLJB 5MPOA 3EHVA 5D3VA 1EO6A 2JF5A 2IO2B 2K2JA 1L5PA 4JX1C 3A1QB 3E9LA 3FAHA 4C7ZA 1R4NB 2FJLA 3SV1A 3U12A 2ADZA 1OGWA 4JK8A 1UZXB 4JKCA 1E8WA 4KSKC 2BS2B 5D3XA 3MC0B 4M8NA 4C4VB 2EC1A 1KM7A 1L7YA 2JRIB 4XC2A 1E5WA 4IOIE 2JZZA 1E10A 2ZKMX 1WGHA 4QJ5B 4PNKA 2RMMA 1FRDA 5H8YE 3ZKJC 3U8ZA 1KI1B 2KWUB 3VFKA 1ZDXA 4OZCA 4WJPA 4EJNA 4WURA 5LLIA 1RYJA 1M7RA 5DHFB 2N7EA 2LRUA 2ZW1A 4MSQB 3A9JB 2KDIA 1P98A 2IYBA 2IBIB 3B9JA 3QIJA 2DNFA 2ZPNA 1WM3A 3FP5A 4HSIA 2HJ8A 3KRXA 3KWLA 4K7SA 4ZOHC 4ZYNA 4KX6B 4KDLB 1UWMA 3W2DA 1WY8A 2V76A 3EFUA 1JCKB 3U52E 1M94A 1U5EA 3DHGC 2LGDA 1TZOA 2I1KA 2Y3AA 3PLVA 3RD2A 1NBFC 1SEBD 2XK5B 4JKDA 2WU2B 1I4RA 2NMQA 3QQ8B 1XT9B 2EKIA 4C56C 2N9LA 4AS1A 2Z4DA 2LHDA 1UNRA 3W1YA 3RNFC 1ST7A 1Q1OA 1E8XA 1PDXA 4FHJA 4LDTB 3JW0X 2RVBB 5KHOA 1UH6A 2WDVB 3MFGA 3K9PB 3Q6BA 3BK2A 3AV8A 1OEYA 1E6EB 2W2XD 2V1YA 5DPRA 3EECA 4LJOB 4LCDE 3PHWB 4ANXA 4FADA 4KIKA 1WMHA 4XX5A 2X0SA 1WWTA 4GDKA 1L4ZB 4QJ4B 4WSFA 4AOFA 1XLNA 3BK1A 2N0SB 4QXAB 3UQBA 4PQ0A 2KJ6A 1DDWA 2YEPB 1D5MC 4US8A 1TBEA 2MWNB 3HQCA 2O6VA 1TGZB 1T77A 1L2NA 2TSSA 3ODWA 5C23A 3KY9A 4W9CA 2O6VD 4OVZA 1P5TA 2NBVB 3ZNHB 1SJHD 3TIXA 4OZBA 4CHJA 2JRHA 2CS4A 2KGXB 3AE5B 3OWEB 1J0GA 2H88B 3OLMD 3UIPB 4JK9A 1MIXA 2L32A 4KKIA 2D10A 2L2IA 1BAKA 3B08A 4JKHA 2L0TA 1YJIA 4GGQA 5J17A 1J0WA 2E6XA 3G9WA 3AEAB 4DIXA 3RZWC 2BYTA 3FC4A 4KHAA 2N7DA 2VRRB 4B95A 1A5RA 1Z5SB 4J6IA 1HZ6A 1VCBA 5AEKB 3EFCA 3ML4A 5C6RA 1FNWA 5L95C 3RNCC 2D5GA 2CHWA 2GOWA 2INPE 5KCVA 3KYCD 1D6EC 2UWQA 1AYFA 3FSSA 2KAJA 2ZZPB 1NYQA 2KJHB 3OJ3A 3AXCA 1L0YB 4HJGE 4FJVB 2ZCCA 2MP2B 3VR8B 1IYFA 3PVUA 4BBKA 3F0WA 2RDBC 1XCGA 5HE2A 4BFRA 2V0GA 2MKRA 3E56A 4RGMA 5G55A 1JRPA 3V61A 2X18A 3O65B 4N9F4 4WWMA 3RYTA 2MJDA 3PZ8A 1CZPA 2WX1A 3L10B 4RH6A 4HWIB 2LD9A 3P63A 2BBCA 4REZA 5E6JA 3GE8C 2SAKA 4L23A 1WR6E 1HXYD 3L13A 1YX5B 1ZXHA 4GZUA 3ZJVA 2AX5A 3ENEA 1SGHA 1PGBA 1F9JA 2C7HA 4AP4C 1YJ1A 2HD5B 3LYYA 1D5ZC 2DAJA 4P1CC 3GB1A 2Q13A 4ZRJA 1V5PA 4BKTA 4DX8A 4NJ7A 3UQAA 3TJPA 3Q69A 1UD7A 4W9IA 1N5WA 4XWTA 1TIFA 3RMKC 3VUWA 2ZVOA 3DPDA 3FM8C 2DN6A 1XR0B 3DCGA 2K0PA 1ENFA 1UBIA 1QC6A 3M62B 4OT1A 1WH3A 3TCAA 2X8XX 1I4HA 2M0XA 2KIGA 2K22A 1XLOA 2GLSA 2H89B 3A9KB 2UZSA 2VRWB 4YTMB 1X11A 3PRPB 2RDGA 3P1MA 2FBWB 4W9EA 1ZPSA 2JY6A 1YQBA 3HVZA 4HKZE 3O96A 4HCPB 4EE2A 1RJ2A 1MHXA 1SE3A 4IOYX 4ZRIA 3PZDA 5AZFA 3ZNGC 1DIKA 2L1CA 2P0DA 3TBLD 5E6NA 1X1GA 1I7HA 4BBNF 2BW2A 1K53A 2Y8FA 3V5WA 3Q14C 2L05A 1WXVA 3FILA 3HSAA 1GGOA 4N6EB 3H7PA 4MSMB 3X23A 3PSEB 2ONQA 2DYMA 3F5RA 2KXJA 1Z87A 2BYEA 2PLPA 2WQYB 5LG4B 1TJEA 3NZSA 2J59M 3ZNZB 4FA6A 5IA7A 1V9JA 1NI3A 3ZRFA 3DXDA 2YF0A 4TYZA 3TVVA 1PFDA 4K2PA 1AARA 3DHHC 2DZJA 1AWEA 1PQSA 2OQBA 1JROA 4ICVA 1V97A 5J3YA 5HI1A 2MQJA 2KIEA 1UUPA 3DBHB 1I42A 1NEKB 2GBMA 2D3AA 5BYRA 5DCNA 2IO0B 3NJTA 1Q0WB 1DROA 4N59A 1WXQA 2K00A 2DIKA 2NBUA 5G5GA 2PMVA 2XBBC 1P0RA 1JDEA 5IKCM 1ISNA 2CAYA 4BAXA 2L0FA 2FJUB 2D3GA 5G5HA 2PE9A 2JWUA 5C5BB 1KLGD 3HW2B 4ANVA 4Z2MB 1P3QU 4ZHOA 2DHJA 3ZVVA 3FLVA 2CJOA 3WALA 4JKBA 3N7CA 2DYQA 2ROZB 2FCQA 3MJ5A 4KV2A 4KHOA 3PZ7A 2EKEC 2P0FA 3BINA 2HTHB 2ZPYA 3NWDA 4NZLB 2JP2A 4WAFA 4EEWA 2GUMA 5GMVA 1GOZA 3KW5B 2WDTB 1BWNA 1FNVA 2J7QB 3HHMA 2BF8B 5D2MB 3AEGB 4IWQA 4ZRPA 4D0NB 2V9HA 2LGXA 4GDLB 2JQRB 4HB4B 4K81A 1T5XD 3ML8A 4KHBA 4BOSC 3W5VB 3DBSA 1HBKA 4MELA 4GIVA 1V1PA 2JZPA 4MH8A 1E7VA 2G45B 2OJWA 4W9LA 4HKQA 2KX3A 1YMHE 3ZIMA 5HE3A 3R2IA 2NTSA 2D07B 2COAA 1V80A 2IGHA 2M0AA 3LJ3A 3GZNI 1E9MA 1F52A 2NR2A 1W1GA 3PSCA 3E66A 3TEXA 4NQLB 1I4XA 1WX8A 4JKGA 1WJ1A 1U29A 2BPSA 3Q3OC 4YSYB 3PRZA 2ZJDA 4HB2B 1ET9A 4LNFA 2D9WA 4R3DA 4ZYSA 3ZVRA 2RNRB 4W9FA 3BYYB 4XWWA 4KVGB 1YOVB 1DYNA 1R4MB 4E74A 1EU4A 4IM2A 5IN7A 3OANA 2LUEA 3V6CB 3T3OA 3Q3JA 1UBQA 4HB3B 1DDVA 2I5FA 4A3PA 2XQNM 2BS3B 3VR9B 4GOUA 4KKJA 4MJSA 4HEA1 2Z8LA 2Z0DB 5LONB 1XD4A 2KDMA 4GN1A 4ANUA 3LDZE 3BVZA 3FKYA 4RF1A 1JWAD 2FCMA 2BYFA 2AWTA 2LXCA 4YTNB 3P42A 1RFAA 3QX1A 3ETRA 3Q3MC 2KDBA 2RR9A 1ZP0B 1NTVA 2OHFA 2DKPA 3AE6B 3Q3FA 4F1SA 2KZRA 2KKCA 3U4EG 3N30A 2MJEA 3KUZA 1QZEA 4IUMB 5FI0A 2MBHA 1D5XC 3X0WA 3WANA 3DWGC 5EE0A 3A8PA 1IGDA 1DBHA 2NTTA 4EUTA 4ILGB 4TV3A 3BY4B 1IRSA 1UNPA 5CHWA 3DCXA 4OVUA 2KHWB 4WJNA 4MGYE 2BTEA 3U2SC 1I35A 2KCJA 3R66C 4GNKB 1MKEA 1YJJA 5JHGA 3LXFA 4WH4A 2M14A 2R2OA 4CQNA 2HJ1A 2BWES 1WGQA 2DHKA 3KRWA 1RFKA 1KTKA 4DBGA 2KQ4X 3SNHA 1R7SA 2KT7A 5DPWA 1TS2A 3ZDMC 2RSUA 3CIKA 4II2B 4DHZB 4A5KA 1L6VA 3ZNID 4F8CB 3CMMB 1JWBD 1WVHA 3DHIC 3I63C 1ZKHA 4CYEA 1BXTA 3QCAA 5DPTA 3KLSX 1V2YA 1XLPA 2RGFA 2M8SA 2E2XA 4JL9A 2LJ5A 4DXAB 4DHJB 1FXAA 3CIRB 1MIZB 2D9VA 1NU2A 1JMLA 2BWFA 2CKHB 1VBHA 1C9FA 2K8HA 4ARIA 2GBRA 3QK0A 2INDC 4XZ4A 4K3BA 4IAPA 1KRHA 1I4PA 3IG3A 2DHZA 1WJ4A 1FO4A 2DX1A 4K17A 3A98B 2Z14A 5HKHA 3AI5A 3N1ZC 3BIID 2AYOB 1Z2MA 2A5UA 4EOYA 2LHEA 2YLMA 1GJZA 1MAIA 1C79A 1SSNA 2FNJB 1P9DU 4A6HA 4LNKA 5DH9B 2PKOA 4RFBA 5IOIA 2KC1A 1LM8B 4BVUC 3OAWA 1SF0A 4AWJA 4EZJA 2BGFA 4IKGA 1T3QA 2KQ7A 5C16A 4KAXB 1DOIA 5FI1A 3RPFC 3ABVB 2KWCA 3KVFB 3W1SA 3QWZB 4L1RA 4MM3A 3D32A 3LB8C 2WXLA 2QHOA 2NPTB 2CY4A 1BTNA 2Y5PA 3DVGX 5JP4A 4YXDB 3N1XC 3K9OB 4JWUC 4KZ0A 2IO3B 2M4NA 3NY5A 5I2SA 2V4LA 2PIAA 3NHEB 2C7MB 4OSNA 3DVGY 1QQGA 1JQ4A 3DVNU 2ROVA 4W9DA 1Y19B 3P6AA 1FFUA 1TT5B 3NWFA 2QDFA 4NSWA 1EWCA 4OZAA 3VRAB 3UF8A 3ZLZA 4YWGG 5GXGB 1YX6B 3MDBC 2L1AA 5FKAC 2QILA 2DHIA 4FXCA 3RI7C 3L17A 3RCZA 5DPSA 3AH7A 2KX0A 5BO4B 1L4DB 4F7GA 2GBKA 3ZDTA 2LWPA 3P4QB 3PPAA 5EE3A 5BYSA 2KFKA 1XD3B 1ZXIA 2QMTA 2N23A 3SU8X 4A6QA 2G4DB 3VIAA 1EVHA 1JW9D 1U27A 2B76B 5TR5A 2WXOA 4IM0A 3D8EA 2RGNB 3I5JC 2KTRA 3PO0A 4RGNA 1ZE3D 1HZ5A 4ANWA 1C4PA 4YSXB 2LI5A 2FCSA 4JQWC 3WAPA 2CHZA 1K51A 2IGDA 1NDDA 1S3SG 4BOZB 3AU4A 3TEZA 2DKQA 4DX90 5IRSA 4DDID 1U2BA 3ZO5B 4GXBA 4WWOA 1MK9B 2XNAC 4E71A 4HJKA 2M38A 1E7PB 2NCNA 2MEKA 3JSVB 1WXMA 5JHBA 2GRIA 2KLCA 4XE0A 4K1RB 4A20A 1WYWB 4JE3B 4DXFA 2D2QA 2WXKA 1GC7A 5IJMA 5H92C 2DA0A 1XQQA 2YVCA 2ACZB 2VZKB 4KSLC 4G11A 1RAXA 1XLQA 3ALBA 3PS6A 3NG0A 2PPHA 3E9PA 3VTVA 1F0ZA 1V5MA 1V5UA 5KQ1A 1L0XB 2EELA 2K6DB 1WZ0A 2J53A 4L6EA 3R7RA 2RUKB 3A8QA 1HEZE 3L08A 4LJPB 3GE3C 4HXDA 3NSUA 5HE1A 1Q10A 2MCNB 2N9XA 3SO6A 1SB3C 2NPTA 3SR6A 1DYQA 3NOBA 4CHMA 3A1QA 3W5UB 1C4CA 3NVVA 2JXXA 2QSDA 4GMVA 3Q8CA 1B55A 2LXAA 2WXQA 3KUCB 4I6NB 3SHQA 2Z0QA 1YIWA 4PYZA 1SXTA 2DWQA 1MFWA 1I2HA 4C4VA 4JKEA 3N32A 4P1BC 4JPSA 1NVID
chains in the Genus database with same CATH topology
1ZW7A 2JVCA 4IWPA 3HM6X 2KDEB 3U30A 4HHVA 2COFA 2FAZA 3DBLI 1WXSA 2KDFB 2LASA 2FIDA 1P6SA 4MT7A 1BTKA 4B6HA 4W9KA 3A33B 3LJUX 3A9JA 2NS5A 1ZGUB 3D8DA 4MGZE 2N1VA 4HAZB 2NBWB 3TFMA 2DYNA 2GBNA 5DI9B 2D9XA 4WJQA 2LVOA 5DIFB 4K2OA 2K8BA 1X05A 2XK5A 4XWXA 2DLWA 2KMAA 1KJTA 3DXEA 2N1WA 4HDQA 2C5LC 2L8JA 2PJHA 3FEHA 3RULA 2GS0A 1FHXA 3WIMA 1J19A 1R4NI 2DENB 2KK8A 2H7DA 1EGXA 2DX5B 4LDTD 3A4SC 2VSZA 1WM2A 4B6WA 5G2NA 3DQVA 5GOWB 3QWMA 2RLOA 3V60A 3ZTCA 2COPA 2L7RA 4IFSA 3L16A 4I6LB 2JPHA 1H4RA 2Z0PA 1HE8A 1OQNA 2NVUI 3M3JA 1FXTB 2KANA 3WA0A 2LZ6A 2KQSA 2YT1A 4TQ1A 4TQ0A 4I6PA 2KUPA 1ZVRA 3IVFA 4W9HA 3ZW3A 1Y8RC 1P3RA 4JIOU 2ELAA 1K8RB 3GOEA 2LVQA 2G35A 5LOPB 4MY6A 3VOQA 1LXDA 2G3QB 4FJYA 3PEGA 4FJZA 2MP2A 4H8SA 3P7ZA 1H8CA 1FAOA 1ZM0A 2WWZA 3DDCB 1OMWA 4MH0E 4WAAA 2L3ZA 4HCNB 5LXHA 1EAZA 2MA9B 5L81A 3QA8A 2RSGA 1HB6A 2CHXA 4RMAA 2UYZB 2DTCA 2KFJA 2FDQA 1WGUA 2FJ9A 1WI0A 3R3MA 3SDLC 4RM8A 2COCA 5J3QA 2K1FA 4NAWB 4JKFA 3IBEA 2LG1A 4ZRKA 2N9EB 2Z59B 3PLUA 3A9KA 2L00B 2DAFA 3APCA 2DZKA 2P8VA 3QAQA 4ZDVA 1SIFA 1W1HA 4A3OA 1WE6A 2EMSA 2W2XC 4GSWA 5CHFA 2WYQA 1H10A 2NMBA 3MHSD 2KMCA 3ECIA 4YONA 4G3XB 3ODOA 2PE6B 4GPTB 2O2VB 1V5OA 4KZCA 2KOXA 2EMTA 2QKLA 1WF9A 4AUQC 3UGBB 3CSTA 1UEFA 4FHKA 5C79A 1KOTA 5CHVC 3OJ4B 1VD2A 3ULBA 2LOXA 4AJWA 1RLFA 2MW5A 2UVMA 4EZKA 2KN5A 3QARA 2LULA 4IW0A 1V49A 1KBLA 1FHWA 4HB0B 2C60A 5CX3A 1NTYA 4ILJA 3JYUA 1WIAA 4A6FB 3VHTC 2D4QA 2WX0A 1V88A 2D11A 1EUVB 3VH3B 1BT0A 2MBQA 1XX0A 3TO1A 2N0YA 1V5TA 2MBBB 2RD0A 2ASQA 3H1UA 4BKGA 5C5BA 4DHZE 4NNJB 4PS3A 5IAAC 2GCLA 2DFKA 1ZC3B 3P2BA 2HTHA 2LVPA 4RM9A 3KSYA 4GOCA 4GDLA 2KVRA 3KUDB 2KWVB 3E9OA 2JZ3B 5CTRC 4WJ7A 2LYDA 1D3ZA 2LKOA 1LW3A 3VUYA 1WGRA 2CB8A 2GCJA 4NY0A 1N3HA 1WFYA 3MTNB 2P0HA 2N9PC 4C0AA 1YD8U 3U7DA 2AL3A 1C1YB 1OY2A 4PS7A 2GJYA 1X1MA 1FOEA 1HB8A 1FGYA 5LXIB 3DVNV 4MDKE 1SE9A 1TXDA 1WE7A 2AEHA 1IPGA 2KJRA 5JVLA 3VDZA 1PFJA 2MX2A 1FHOA 3WAOA 4F7UP 2MWSB 2EJ8A 2ZVNA 3N3KB 3MJWA 4EKUA 4TKNA 3TL5A 1LFDA 4KIKB 1WMHB 3IHPC 4AJYB 4GDKB 2G4SA 2OJRA 1NTIA 3B1LX 3SD5A 2ABDA 1WJNA 2O6VB 2C7NB 2J0MA 1WGGA 1FGZA 4BKSA 5D3WA 2IY1B 4WQOB 1RRPB 2KD0A 4GU2A 4WJOA 4W9JA 4BKSD 3HM3A 1E8ZA 1GUAB 3VQIA 1DDMA 4PS8A 1X1FA 1R4MI 3PRMB 3M1IB 4DK5A 1MPHA 1U5DA 5D3YA 5KQ4A 4F7ZA 4HAYB 3PHXB 4NPNA 3EPYA 3L0WB 4HAXB 2M1MA 2JT4B 2J0KA 2V3SA 4DHJD 3AULA 2LOZA 3CXBB 2A4ZA 1TTNA 1OEYJ 3PVLA 4DBBA 1EF1A 1SHCA 1WJMA 3PTFC 3V6EB 3A4RA 5JHHA 1JRUA 3APDA 4ILHA 1UNQA 2IZVB 3PV1A 2DZMA 3ONSA 4GB9A 4IWOA 2CR5A 3DBRI 3WYFB 4II3B 2LGYA 5EDSA 3B0AA 5L83A 2KO3A 2R2QA 1AQCA 5D27A 2RPQA 4FLHA 2CY5A 1LB1A 3T06A 2OOBB 3QJZA 4F7HA 2JWZA 1UPQA 2XEWA 5CLLB 2BKFA 5EFXA 3VXWA 3AJ4A 3S2AA 5D6JB 2I1JA 2K8CA 4WWPA 4MGIE 4EZLA 1WJUA 4JKAA 3CSFA 1XKEA 2YT0A 4GMXB 3H7PB 3KH0A 4HAWB 2M17A 1UELA 4G0NB 4K7WA 2HE7A 3AU5A 1FB8A 1GG3A 1P1AA 3JSVA 4EMOA 2BCJA 5DHAB 1LQBA 4W9GA 3M63B 1ZC4B 2Y8GA 1V86A 1RRBA 2REXA 4HLEA 2CQUA 3PVWA 4HAUB 2BKRB 3ODXA 4WWNA 4HPMB 2YS3A 1UGMA 1OQYA 3VTWA 1U5GA 4HK2A 2K39A 1V6EA 3ZRCA 3VVWB 4FN2A 2KLGA 1WG7A 3GYOA 3APFA 3DOWA 3NS8A 4MEMA 3PT2B 1WX9A 2IY0B 3PGEA 4A6KA 2AL6A 3EC8A 4HPLB 1GNUA 1EF5A 1XODA 3V62A 1U5FA 2W9NA 5D94A 5C1ZA 4P7IA 1WJ6A 1KZ7A 3TMPB 2D9YA 5CLQB 2HRJA 1G6JA 1PMSA 3BJIA 3ML9A 2Z0OA 3VAWA 3RZFA 1K5DB 4BBNC 1WGDA 4KHBB 3H6NA 3W1SC 2FCNA 1WRDB 2KC2A 1VBGA 1KC7A 3T9LA 3SUZA 3CF6E 2Y7BA 4WVFB 3ULCA 4JKGB 5J3TA 2B3AA 2QKMA 2I5CA 2K25A 3SYXA 4CHKA 2J0JA 4Y94A 3NZUA 4URKA 4K7UA 3VTUA 4KDIC 2UZRA 4MJSB 5JHAA 3PP2A 5D7GA 2DX5A 2BYVE 4HVBA 2FIFA 3C0RB 5J18A 1TZ1A 1Y5OA 1V89A 1J8CA 1E7UA 5JH5C 1M7EA 2D9ZA 1TJ6A 2WH5A 3VH4B 2CRFA 2MFQA 2ZNVC 3DXCA 1KZGA 2NZ8B 4JLCA 5E6OA 4FBJB 3I3TB 2PEAA 1Q5WB 3JVZX 1X86A 1WI1A 1WGYA 1GC6A 4FULA 2MBOA 1KLVA 3ENBA 4NQKE 3PG7A 2N4FA 2MSED 3WAMA 2MBEA 1PLSA 4X57B 3M95A 4JGHB 3QBVB 2GBJA 1WR1A 3IFWB 4M0WB 2MRPA 1IP9A 2CODA 5JZEB 3SBTA 2PZ1A 2VKIA 2KNBA 3RUIB 2H7EA 4MGKE 1K5GB 4DDGD 1NI2A 4MK0A 5J2RA 3R7QA 2MLBA 3QC8B 1UPRA 2JUOA 3SBGA 1OTRB 2W2WA 1U4AA 3HK0A 1C3TA 3TW1A 1NVLA 5E6PA 5AZHA 2YS5A 4HATB 1WZ3A 3VUXA 1E90A 1V61A 2ELBA 3HIZA 3UINB 4NAWA 5AZGA 2C9WB 1MG8A 5FR6A 2LRWA 4ASWC 2ZCBA 3H9DA 2OTXA 3KYDD 4M8MA 3T8MA 2R09A 1T0YA 3ZUNA 4EFOA 4E3CA 2YSZA 4JK7A 2R82A 1W1DA 2YS1A 4TUUA 2MDXA 4HDOA 3MPXA 4B9KA 2KFKB 3GYPA 3L54A 1ACAA 3D8FA 4PYUA 2DYOA 1WX7A 2K2UA 2RQ1A 3UIOB 2ZEQA 1Q67A 2O2VA 2KTRB 1TQZA 2K6QA 2IYDB 3DBHI 2CU1A 2L76A 2IFSA 1CMXB 2ZNVB 2FUHB 4DWFA 4IM3A 4NJ6A 2DYBA 4ICUA 4OVVA 1V81A 3PREA 4YL8A 1ZSQA 4G50A 3KZ1A 3UZTA 2KTFA 1S1QB 3H7SA 4A6FA 4Z2NA 1I7AA 2Y5BB 2DZIA 4CO7A 4HAVB 5HE0A 3ZTDA 3RCPA 2YRYA 2LBBA 1WXAA 2IO1B 1E8YA 2R0DA 3RT3B 2GMIC 4IC7B 5KHQA 4IG7B 1MK7B 3QHTA 2Z0EB 5JLJB 3EHVA 5D3VA 1EO6A 2JF5A 2K2JA 2IO2B 3A1QB 3E9LA 2FJLA 3SV1A 1OGWA 2ADZA 4JK8A 1UZXB 4JKCA 1E8WA 4KSKC 5D3XA 4M8NA 2EC1A 1KM7A 1L7YA 2JRIB 4XC2A 1E5WA 2JZZA 1WGHA 4PNKA 3ZKJC 3U8ZA 1KI1B 2KWUB 3VFKA 4WJPA 4EJNA 5LLIA 1M7RA 5DHFB 2N7EA 2LRUA 4MSQB 3A9JB 2KDIA 1P98A 2IYBA 2IBIB 3QIJA 2ZPNA 1WM3A 3FP5A 2HJ8A 3KRXA 4K7SA 4ZYNA 4KDLB 1WY8A 2V76A 3EFUA 1M94A 1U5EA 2LGDA 2I1KA 3PLVA 3RD2A 1NBFC 2XK5B 4JKDA 3QQ8B 1XT9B 1UNRA 3W1YA 1ST7A 1Q1OA 1E8XA 4FHJA 4LDTB 3JW0X 2RVBB 5KHOA 1UH6A 3K9PB 1OEYA 2W2XD 2V1YA 5DPRA 3EECA 4LJOB 4LCDE 3PHWB 4ANXA 4FADA 4KIKA 1WMHA 4XX5A 2X0SA 4GDKA 4WSFA 4AOFA 3UQBA 4PQ0A 2KJ6A 1DDWA 1TBEA 2MWNB 3HQCA 2O6VA 1TGZB 1L2NA 3ODWA 5C23A 3KY9A 4W9CA 2O6VD 1P5TA 2NBVB 3ZNHB 3TIXA 4CHJA 2JRHA 2CS4A 2KGXB 1J0GA 3OLMD 3UIPB 4JK9A 1MIXA 2D10A 2L2IA 1BAKA 3B08A 4JKHA 2L0TA 4GGQA 5J17A 1J0WA 3G9WA 3RZWC 4KHAA 2N7DA 2VRRB 4B95A 1A5RA 1Z5SB 4J6IA 1VCBA 5AEKB 3ML4A 5C6RA 5L95C 2CHWA 2GOWA 5KCVA 3KYCD 2UWQA 3FSSA 2ZZPB 2KJHB 3OJ3A 3AXCA 4FJVB 2ZCCA 2MP2B 1IYFA 3PVUA 4BBKA 3F0WA 1XCGA 5HE2A 4BFRA 2MKRA 5G55A 3V61A 2X18A 3O65B 4N9F4 3RYTA 3L10B 2WX1A 4HWIB 2LD9A 1WR6E 3L13A 1YX5B 4GZUA 3ENEA 1SGHA 1F9JA 2C7HA 4AP4C 1YJ1A 2HD5B 2DAJA 2Q13A 4ZRJA 1V5PA 4BKTA 4DX8A 4NJ7A 3UQAA 3TJPA 1UD7A 4W9IA 3VUWA 2ZVOA 3DPDA 3FM8C 2DN6A 1XR0B 3DCGA 1UBIA 1QC6A 3M62B 1WH3A 3TCAA 2M0XA 3A9KB 2UZSA 2VRWB 1X11A 3PRPB 4W9EA 2JY6A 1YQBA 3O96A 4HCPB 1RJ2A 4IOYX 4ZRIA 3PZDA 5AZFA 3ZNGC 1DIKA 2L1CA 2P0DA 3TBLD 5E6NA 1X1GA 4BBNF 2Y8FA 3V5WA 2L05A 1WXVA 1GGOA 3H7PA 4MSMB 3X23A 3PSEB 2DYMA 3F5RA 2KXJA 1Z87A 2BYEA 3NZSA 2J59M 3ZNZB 4FA6A 5IA7A 1V9JA 3ZRFA 3DXDA 2YF0A 4TYZA 3TVVA 4K2PA 1AARA 2DZJA 1AWEA 1PQSA 2OQBA 4ICVA 5J3YA 2MQJA 1I42A 2GBMA 5DCNA 2IO0B 1Q0WB 1DROA 2K00A 2DIKA 2NBUA 2XBBC 1P0RA 1JDEA 1ISNA 2CAYA 2L0FA 2D3GA 2PE9A 5C5BB 4ANVA 3HW2B 4Z2MB 1P3QU 2DHJA 3ZVVA 3FLVA 3WALA 4JKBA 3N7CA 2DYQA 2ROZB 2FCQA 4KV2A 4KHOA 2EKEC 2P0FA 3BINA 2HTHB 2ZPYA 2JP2A 4EEWA 5GMVA 3KW5B 2WDTB 1BWNA 2J7QB 3HHMA 2BF8B 5D2MB 4IWQA 4D0NB 2LGXA 4GDLB 4HB4B 4K81A 3ML8A 4BOSC 3DBSA 1HBKA 4MELA 4GIVA 1E7VA 2G45B 4W9LA 2KX3A 3ZIMA 5HE3A 2D07B 2COAA 1V80A 3LJ3A 3GZNI 2NR2A 1W1GA 3PSCA 3E66A 4NQLB 1WX8A 4JKGA 1WJ1A 1U29A 2BPSA 3PRZA 2ZJDA 4HB2B 2D9WA 3ZVRA 2RNRB 4W9FA 4KVGB 1DYNA 4E74A 4IM2A 3OANA 2LUEA 3V6CB 3Q3JA 1UBQA 4HB3B 1DDVA 2I5FA 4A3PA 2XQNM 4MJSA 2Z0DB 5LONB 1XD4A 4GN1A 4ANUA 3LDZE 2FCMA 2BYFA 2AWTA 2LXCA 3QX1A 1RFAA 2KDBA 2RR9A 1NTVA 2DKPA 3Q3FA 4F1SA 2KZRA 2KKCA 3N30A 4IUMB 3KUZA 1QZEA 5FI0A 2MBHA 3X0WA 3WANA 3A8PA 1DBHA 4EUTA 4ILGB 4TV3A 3BY4B 1IRSA 1UNPA 5CHWA 4OVUA 2KHWB 4WJNA 4MGYE 1I35A 2KCJA 3R66C 1MKEA 5JHGA 2M14A 2R2OA 2BWES 1WGQA 2DHKA 3KRWA 4DBGA 3SNHA 5DPWA 3ZDMC 2RSUA 3CIKA 4II2B 4DHZB 4A5KA 3ZNID 4F8CB 3CMMB 1WVHA 1ZKHA 4CYEA 3QCAA 5DPTA 4JL9A 1V2YA 2RGFA 2M8SA 2E2XA 2LJ5A 4DXAB 4DHJB 1MIZB 2D9VA 1NU2A 2BWFA 2CKHB 1VBHA 2K8HA 2GBRA 3QK0A 4XZ4A 4IAPA 3IG3A 2DHZA 1WJ4A 2DX1A 4K17A 3A98B 5HKHA 3AI5A 2AYOB 1Z2MA 2A5UA 4EOYA 2YLMA 1GJZA 1MAIA 2FNJB 1P9DU 4A6HA 5DH9B 2KC1A 1LM8B 4BVUC 3OAWA 4AWJA 4EZJA 2BGFA 2KQ7A 5C16A 4KAXB 5FI1A 2KWCA 3KVFB 3W1SA 3QWZB 4MM3A 3D32A 2QHOA 2NPTB 2CY4A 1BTNA 3DVGX 5JP4A 3K9OB 4KZ0A 2IO3B 2M4NA 3NY5A 2V4LA 3NHEB 2C7MB 3DVGY 1QQGA 3DVNU 2ROVA 4W9DA 1Y19B 3P6AA 4NSWA 3UF8A 3ZLZA 1YX6B 3MDBC 2DHIA 3L17A 3RCZA 5DPSA 2KX0A 5BO4B 4F7GA 2GBKA 3ZDTA 2LWPA 3PPAA 2KFKA 1XD3B 2N23A 3SU8X 2G4DB 3VIAA 1EVHA 1U27A 5TR5A 4IM0A 3D8EA 2RGNB 2KTRA 4ANWA 2LI5A 2FCSA 4JQWC 3WAPA 2CHZA 1NDDA 1S3SG 4BOZB 3AU4A 2DKQA 4DX90 4DDID 1U2BA 3ZO5B 4GXBA 4WWOA 1MK9B 4E71A 4HJKA 2M38A 2NCNA 3JSVB 1WXMA 5JHBA 2KLCA 4K1RB 4A20A 1WYWB 2D2QA 1GC7A 5IJMA 2DA0A 1XQQA 2YVCA 4KSLC 4G11A 1RAXA 3ALBA 3PS6A 2PPHA 3E9PA 3VTVA 1V5MA 1V5UA 5KQ1A 2K6DB 1WZ0A 4L6EA 3R7RA 2RUKB 3A8QA 3L08A 4LJPB 4HXDA 2MCNB 3NSUA 5HE1A 2N9XA 3SO6A 2NPTA 3NOBA 4CHMA 3A1QA 2JXXA 4GMVA 1B55A 2LXAA 4I6NB 3KUCB 3SHQA 2Z0QA 1YIWA 4PYZA 1I2HA 4JKEA 3N32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW7 A;  2JVC A;  4IWP A;  3HM6 X;  2KDE B;  3U30 A;  4HHV A;  2COF A;  2FAZ A;  3DBL I;  1WXS A;  2KDF B;  2LAS A;  2FID A;  1P6S A;  4MT7 A;  1BTK A;  4B6H A;  4W9K A;  3A33 B;  3LJU X;  3A9J A;  2NS5 A;  1ZGU B;  3D8D A;  4MGZ E;  2N1V A;  4HAZ B;  2NBW B;  3TFM A;  2DYN A;  2GBN A;  5DI9 B;  2D9X A;  4WJQ A;  2LVO A;  5DIF B;  4K2O A;  2K8B A;  1X05 A;  2XK5 A;  4XWX A;  2DLW A;  2KMA A;  1KJT A;  3DXE A;  2N1W A;  4HDQ A;  2C5L C;  2L8J A;  2PJH A;  3FEH A;  3RUL A;  2GS0 A;  1FHX A;  3WIM A;  1J19 A;  1R4N I;  2DEN B;  2KK8 A;  2H7D A;  1EGX A;  2DX5 B;  4LDT D;  3A4S C;  2VSZ A;  1WM2 A;  4B6W A;  5G2N A;  3DQV A;  5GOW B;  3QWM A;  2RLO A;  3V60 A;  3ZTC A;  2COP A;  2L7R A;  4IFS A;  3L16 A;  4I6L B;  2JPH A;  1H4R A;  2Z0P A;  1HE8 A;  1OQN A;  2NVU I;  3M3J A;  1FXT B;  2KAN A;  3WA0 A;  2LZ6 A;  2KQS A;  2YT1 A;  4TQ1 A;  4TQ0 A;  4I6P A;  2KUP A;  1ZVR A;  3IVF A;  4W9H A;  3ZW3 A;  1Y8R C;  1P3R A;  4JIO U;  2ELA A;  1K8R B;  3GOE A;  2LVQ A;  2G35 A;  5LOP B;  4MY6 A;  3VOQ A;  1LXD A;  2G3Q B;  4FJY A;  3PEG A;  4FJZ A;  2MP2 A;  4H8S A;  3P7Z A;  1H8C A;  1FAO A;  1ZM0 A;  2WWZ A;  3DDC B;  1OMW A;  4MH0 E;  4WAA A;  2L3Z A;  4HCN B;  5LXH A;  1EAZ A;  2MA9 B;  5L81 A;  3QA8 A;  2RSG A;  1HB6 A;  2CHX A;  4RMA A;  2UYZ B;  2DTC A;  2KFJ A;  2FDQ A;  1WGU A;  2FJ9 A;  1WI0 A;  3R3M A;  3SDL C;  4RM8 A;  2COC A;  5J3Q A;  2K1F A;  4NAW B;  3IBE A;  2LG1 A;  4ZRK A;  2N9E B;  2Z59 B;  3PLU A;  3A9K A;  2L00 B;  2DAF A;  3APC A;  2DZK A;  2P8V A;  3QAQ A;  4ZDV A;  1SIF A;  1W1H A;  4A3O A;  1WE6 A;  2EMS A;  2W2X C;  4GSW A;  5CHF A;  2WYQ A;  1H10 A;  2NMB A;  3MHS D;  2KMC A;  3ECI A;  4YON A;  4G3X B;  3ODO A;  2PE6 B;  4GPT B;  2O2V B;  1V5O A;  4KZC A;  2KOX A;  2EMT A;  2QKL A;  1WF9 A;  4AUQ C;  3UGB B;  3CST A;  1UEF A;  4FHK A;  5C79 A;  1KOT A;  5CHV C;  3OJ4 B;  1VD2 A;  3ULB A;  2LOX A;  4AJW A;  1RLF A;  2MW5 A;  2UVM A;  4EZK A;  2KN5 A;  3QAR A;  2LUL A;  4IW0 A;  1V49 A;  1FHW A;  4HB0 B;  2C60 A;  5CX3 A;  1NTY A;  3JYU A;  1WIA A;  4A6F B;  3VHT C;  2D4Q A;  2WX0 A;  1V88 A;  2D11 A;  1EUV B;  3VH3 B;  1BT0 A;  2MBQ A;  1XX0 A;  3TO1 A;  2N0Y A;  1V5T A;  2MBB B;  2RD0 A;  2ASQ A;  3H1U A;  4BKG A;  5C5B A;  4DHZ E;  4NNJ B;  4PS3 A;  5IAA C;  2GCL A;  2DFK A;  1ZC3 B;  3P2B A;  2HTH A;  2LVP A;  4RM9 A;  3KSY A;  4GOC A;  4GDL A;  2KVR A;  3KUD B;  2KWV B;  2JZ3 B;  5CTR C;  4WJ7 A;  2LYD A;  1D3Z A;  2LKO A;  1LW3 A;  3VUY A;  1WGR A;  2CB8 A;  2GCJ A;  4NY0 A;  1N3H A;  1WFY A;  3MTN B;  2P0H A;  2N9P C;  4C0A A;  1YD8 U;  3U7D A;  2AL3 A;  1C1Y B;  1OY2 A;  4PS7 A;  2GJY A;  1X1M A;  1FOE A;  1HB8 A;  1FGY A;  5LXI B;  3DVN V;  4MDK E;  1SE9 A;  1TXD A;  1WE7 A;  2AEH A;  1IPG A;  2KJR A;  3VDZ A;  1PFJ A;  2MX2 A;  1FHO A;  3WAO A;  4F7U P;  2MWS B;  2EJ8 A;  2ZVN A;  3N3K B;  3MJW A;  4EKU A;  4TKN A;  3TL5 A;  1LFD A;  4KIK B;  1WMH B;  3IHP C;  4AJY B;  4GDK B;  2G4S A;  2OJR A;  1NTI A;  3B1L X;  3SD5 A;  2ABD A;  1WJN A;  2O6V B;  2C7N B;  2J0M A;  1WGG A;  1FGZ A;  4BKS A;  5D3W A;  2IY1 B;  4WQO B;  1RRP B;  2KD0 A;  4GU2 A;  4WJO A;  4W9J A;  4BKS D;  3HM3 A;  1E8Z A;  1GUA B;  3VQI A;  1DDM A;  4PS8 A;  1X1F A;  1R4M I;  3PRM B;  3M1I B;  4DK5 A;  1MPH A;  1U5D A;  5D3Y A;  5KQ4 A;  4F7Z A;  4HAY B;  3PHX B;  4NPN A;  3EPY A;  3L0W B;  4HAX B;  2M1M A;  2JT4 B;  2J0K A;  2V3S A;  4DHJ D;  3AUL A;  2LOZ A;  3CXB B;  2A4Z A;  1TTN A;  1OEY J;  3PVL A;  4DBB A;  1EF1 A;  1SHC A;  1WJM A;  3PTF C;  3V6E B;  3A4R A;  5JHH A;  1JRU A;  3APD A;  1UNQ A;  2IZV B;  3PV1 A;  2DZM A;  3ONS A;  4GB9 A;  4IWO A;  2CR5 A;  3DBR I;  3WYF B;  4II3 B;  2LGY A;  5EDS A;  3B0A A;  5L83 A;  2KO3 A;  2R2Q A;  1AQC A;  5D27 A;  2RPQ A;  4FLH A;  2CY5 A;  1LB1 A;  3T06 A;  2OOB B;  3QJZ A;  4F7H A;  2JWZ A;  1UPQ A;  2XEW A;  5CLL B;  2BKF A;  5EFX A;  3VXW A;  3AJ4 A;  3S2A A;  5D6J B;  2I1J A;  2K8C A;  4WWP A;  4MGI E;  4EZL A;  1WJU A;  3CSF A;  1XKE A;  2YT0 A;  4GMX B;  3H7P B;  3KH0 A;  4HAW B;  2M17 A;  1UEL A;  4G0N B;  4K7W A;  2HE7 A;  3AU5 A;  1FB8 A;  1GG3 A;  1P1A A;  3JSV A;  4EMO A;  2BCJ A;  5DHA B;  1LQB A;  4W9G A;  3M63 B;  1ZC4 B;  2Y8G A;  1V86 A;  1RRB A;  2REX A;  4HLE A;  2CQU A;  3PVW A;  4HAU B;  2BKR B;  3ODX A;  4WWN A;  4HPM B;  2YS3 A;  1UGM A;  1OQY A;  3VTW A;  1U5G A;  4HK2 A;  2K39 A;  1V6E A;  3ZRC A;  3VVW B;  4FN2 A;  2KLG A;  1WG7 A;  3GYO A;  3APF A;  3DOW A;  3NS8 A;  4MEM A;  3PT2 B;  1WX9 A;  2IY0 B;  3PGE A;  4A6K A;  2AL6 A;  3EC8 A;  4HPL B;  1GNU A;  1EF5 A;  1XOD A;  3V62 A;  1U5F A;  2W9N A;  5D94 A;  5C1Z A;  4P7I A;  1WJ6 A;  1KZ7 A;  3TMP B;  2D9Y A;  5CLQ B;  2HRJ A;  1G6J A;  1PMS A;  3BJI A;  3ML9 A;  2Z0O A;  3VAW A;  3RZF A;  1K5D B;  4BBN C;  1WGD A;  4KHB B;  3H6N A;  3W1S C;  2FCN A;  1WRD B;  2KC2 A;  3T9L A;  3SUZ A;  3CF6 E;  2Y7B A;  4WVF B;  3ULC A;  5J3T A;  2B3A A;  2QKM A;  2I5C A;  2K25 A;  3SYX A;  4CHK A;  2J0J A;  4Y94 A;  3NZU A;  4URK A;  4K7U A;  3VTU A;  4KDI C;  2UZR A;  4MJS B;  5JHA A;  3PP2 A;  5D7G A;  2DX5 A;  2BYV E;  4HVB A;  2FIF A;  3C0R B;  5J18 A;  1TZ1 A;  1Y5O A;  1V89 A;  1J8C A;  1E7U A;  5JH5 C;  1M7E A;  2D9Z A;  1TJ6 A;  2WH5 A;  3VH4 B;  2CRF A;  2MFQ A;  2ZNV C;  3DXC A;  1KZG A;  2NZ8 B;  4JLC A;  5E6O A;  4FBJ B;  3I3T B;  2PEA A;  1Q5W B;  3JVZ X;  1X86 A;  1WI1 A;  1WGY A;  1GC6 A;  4FUL A;  2MBO A;  1KLV A;  4NQK E;  3PG7 A;  2N4F A;  2MSE D;  3WAM A;  2MBE A;  1PLS A;  4X57 B;  3M95 A;  4JGH B;  3QBV B;  2GBJ A;  1WR1 A;  3IFW B;  4M0W B;  2MRP A;  1IP9 A;  2COD A;  5JZE B;  2PZ1 A;  2VKI A;  2KNB A;  3RUI B;  2H7E A;  4MGK E;  1K5G B;  4DDG D;  1NI2 A;  4MK0 A;  5J2R A;  3R7Q A;  2MLB A;  3QC8 B;  1UPR A;  2JUO A;  1OTR B;  2W2W A;  1U4A A;  3HK0 A;  1C3T A;  3TW1 A;  1NVL A;  5E6P A;  5AZH A;  2YS5 A;  4HAT B;  1WZ3 A;  3VUX A;  1E90 A;  1V61 A;  2ELB A;  3HIZ A;  3UIN B;  4NAW A;  5AZG A;  2C9W B;  1MG8 A;  5FR6 A;  2LRW A;  4ASW C;  2ZCB A;  3H9D A;  2OTX A;  3KYD D;  4M8M A;  3T8M A;  2R09 A;  1T0Y A;  3ZUN A;  4EFO A;  4E3C A;  2YSZ A;  1W1D A;  2YS1 A;  4TUU A;  2MDX A;  4HDO A;  3MPX A;  4B9K A;  2KFK B;  3GYP A;  3L54 A;  1ACA A;  3D8F A;  4PYU A;  2DYO A;  1WX7 A;  2K2U A;  2RQ1 A;  3UIO B;  2ZEQ A;  1Q67 A;  2O2V A;  2KTR B;  1TQZ A;  2K6Q A;  2IYD B;  3DBH I;  2CU1 A;  2L76 A;  2IFS A;  1CMX B;  2ZNV B;  2FUH B;  4DWF A;  4IM3 A;  4NJ6 A;  2DYB A;  4ICU A;  4OVV A;  1V81 A;  3PRE A;  4YL8 A;  1ZSQ A;  4G50 A;  3KZ1 A;  3UZT A;  2KTF A;  1S1Q B;  3H7S A;  4A6F A;  4Z2N A;  1I7A A;  2Y5B B;  2DZI A;  4CO7 A;  4HAV B;  5HE0 A;  3ZTD A;  3RCP A;  2YRY A;  2LBB A;  1WXA A;  2IO1 B;  1E8Y A;  2R0D A;  3RT3 B;  2GMI C;  4IC7 B;  5KHQ A;  4IG7 B;  1MK7 B;  3QHT A;  2Z0E B;  5JLJ B;  3EHV A;  5D3V A;  1EO6 A;  2JF5 A;  2K2J A;  2IO2 B;  3A1Q B;  2FJL A;  3SV1 A;  1OGW A;  2ADZ A;  1UZX B;  1E8W A;  4KSK C;  5D3X A;  4M8N A;  2EC1 A;  1KM7 A;  1L7Y A;  2JRI B;  4XC2 A;  1E5W A;  2JZZ A;  1WGH A;  4PNK A;  3ZKJ C;  3U8Z A;  1KI1 B;  2KWU B;  3VFK A;  4WJP A;  4EJN A;  5LLI A;  1M7R A;  5DHF B;  2N7E A;  2LRU A;  4MSQ B;  3A9J B;  2KDI A;  1P98 A;  2IYB A;  2IBI B;  3QIJ A;  2ZPN A;  1WM3 A;  3FP5 A;  2HJ8 A;  3KRX A;  4K7S A;  4ZYN A;  4KDL B;  1WY8 A;  2V76 A;  3EFU A;  1M94 A;  1U5E A;  2LGD A;  2I1K A;  3PLV A;  3RD2 A;  1NBF C;  2XK5 B;  3QQ8 B;  1XT9 B;  1UNR A;  3W1Y A;  1ST7 A;  1Q1O A;  1E8X A;  4FHJ A;  4LDT B;  3JW0 X;  2RVB B;  5KHO A;  1UH6 A;  3K9P B;  1OEY A;  2W2X D;  2V1Y A;  5DPR A;  3EEC A;  4LJO B;  4LCD E;  3PHW B;  4ANX A;  4FAD A;  4KIK A;  1WMH A;  4XX5 A;  4GDK A;  4WSF A;  4AOF A;  3UQB A;  4PQ0 A;  2KJ6 A;  1DDW A;  1TBE A;  2MWN B;  3HQC A;  2O6V A;  1TGZ B;  1L2N A;  3ODW A;  5C23 A;  3KY9 A;  4W9C A;  2O6V D;  1P5T A;  2NBV B;  3ZNH B;  3TIX A;  4CHJ A;  2JRH A;  2CS4 A;  2KGX B;  1J0G A;  3OLM D;  3UIP B;  1MIX A;  2D10 A;  2L2I A;  1BAK A;  3B08 A;  2L0T A;  4GGQ A;  5J17 A;  1J0W A;  3G9W A;  3RZW C;  4KHA A;  2N7D A;  2VRR B;  4B95 A;  1A5R A;  1Z5S B;  4J6I A;  1VCB A;  5AEK B;  3ML4 A;  5C6R A;  5L95 C;  2CHW A;  2GOW A;  5KCV A;  3KYC D;  2UWQ A;  3FSS A;  2ZZP B;  2KJH B;  3OJ3 A;  3AXC A;  4FJV B;  2ZCC A;  2MP2 B;  1IYF A;  3PVU A;  4BBK A;  3F0W A;  1XCG A;  5HE2 A;  4BFR A;  2MKR A;  5G55 A;  3V61 A;  2X18 A;  3O65 B;  4N9F 4;  3RYT A;  3L10 B;  2WX1 A;  4HWI B;  2LD9 A;  1WR6 E;  3L13 A;  1YX5 B;  4GZU A;  3ENE A;  1SGH A;  1F9J A;  2C7H A;  4AP4 C;  1YJ1 A;  2HD5 B;  2DAJ A;  2Q13 A;  4ZRJ A;  1V5P A;  4BKT A;  4DX8 A;  4NJ7 A;  3UQA A;  3TJP A;  1UD7 A;  4W9I A;  3VUW A;  2ZVO A;  3DPD A;  3FM8 C;  2DN6 A;  1XR0 B;  3DCG A;  1UBI A;  1QC6 A;  3M62 B;  1WH3 A;  3TCA A;  2M0X A;  3A9K B;  2UZS A;  2VRW B;  1X11 A;  3PRP B;  4W9E A;  2JY6 A;  1YQB A;  3O96 A;  4HCP B;  1RJ2 A;  4IOY X;  4ZRI A;  3PZD A;  5AZF A;  3ZNG C;  3TBL D;  2L1C A;  2P0D A;  5E6N A;  1X1G A;  4BBN F;  2Y8F A;  3V5W A;  2L05 A;  1WXV A;  3H7P A;  4MSM B;  3X23 A;  3PSE B;  2DYM A;  3F5R A;  2KXJ A;  1Z87 A;  2BYE A;  3NZS A;  2J59 M;  3ZNZ B;  4FA6 A;  5IA7 A;  1V9J A;  3ZRF A;  3DXD A;  2YF0 A;  4TYZ A;  3TVV A;  4K2P A;  1AAR A;  2DZJ A;  1AWE A;  1PQS A;  2OQB A;  4ICV A;  5J3Y A;  2MQJ A;  1I42 A;  2GBM A;  5DCN A;  2IO0 B;  1Q0W B;  1DRO A;  2K00 A;  2NBU A;  2XBB C;  1P0R A;  1ISN A;  2CAY A;  2L0F A;  2D3G A;  2PE9 A;  5C5B B;  4ANV A;  3HW2 B;  4Z2M B;  1P3Q U;  2DHJ A;  3ZVV A;  3FLV A;  3WAL A;  3N7C A;  2DYQ A;  2ROZ B;  2FCQ A;  4KV2 A;  4KHO A;  2EKE C;  2P0F A;  3BIN A;  2HTH B;  2ZPY A;  2JP2 A;  4EEW A;  5GMV A;  3KW5 B;  2WDT B;  1BWN A;  2J7Q B;  3HHM A;  2BF8 B;  5D2M B;  4IWQ A;  4D0N B;  2LGX A;  4GDL B;  4HB4 B;  4K81 A;  3ML8 A;  4BOS C;  3DBS A;  1HBK A;  4MEL A;  4GIV A;  1E7V A;  2G45 B;  4W9L A;  2KX3 A;  3ZIM A;  5HE3 A;  2D07 B;  2COA A;  1V80 A;  3LJ3 A;  3GZN I;  2NR2 A;  1W1G A;  3PSC A;  4NQL B;  1WX8 A;  1WJ1 A;  1U29 A;  2BPS A;  3PRZ A;  2ZJD A;  4HB2 B;  2D9W A;  3ZVR A;  2RNR B;  4W9F A;  4KVG B;  1DYN A;  4E74 A;  4IM2 A;  3OAN A;  2LUE A;  3V6C B;  3Q3J A;  1UBQ A;  4HB3 B;  1DDV A;  2I5F A;  4A3P A;  2XQN M;  4MJS A;  2Z0D B;  5LON B;  1XD4 A;  4GN1 A;  4ANU A;  3LDZ E;  2FCM A;  2BYF A;  2AWT A;  2LXC A;  3QX1 A;  1RFA A;  2KDB A;  2RR9 A;  1NTV A;  2DKP A;  3Q3F A;  4F1S A;  2KZR A;  2KKC A;  3N30 A;  4IUM B;  3KUZ A;  1QZE A;  5FI0 A;  2MBH A;  3X0W A;  3WAN A;  3A8P A;  1DBH A;  4EUT A;  4TV3 A;  3BY4 B;  1IRS A;  1UNP A;  5CHW A;  4OVU A;  2KHW B;  4WJN A;  4MGY E;  1I35 A;  2KCJ A;  3R66 C;  1MKE A;  5JHG A;  2M14 A;  2R2O A;  2BWE S;  1WGQ A;  2DHK A;  3KRW A;  4DBG A;  3SNH A;  5DPW A;  3ZDM C;  2RSU A;  3CIK A;  4II2 B;  4DHZ B;  4A5K A;  3ZNI D;  4F8C B;  3CMM B;  1WVH A;  1ZKH A;  4CYE A;  3QCA A;  5DPT A;  4JL9 A;  1V2Y A;  2RGF A;  2M8S A;  2E2X A;  2LJ5 A;  4DXA B;  4DHJ B;  1MIZ B;  2D9V A;  1NU2 A;  2BWF A;  2CKH B;  2K8H A;  2GBR A;  3QK0 A;  4XZ4 A;  4IAP A;  3IG3 A;  2DHZ A;  1WJ4 A;  2DX1 A;  4K17 A;  3A98 B;  5HKH A;  3AI5 A;  2AYO B;  1Z2M A;  2A5U A;  4EOY A;  2YLM A;  1GJZ A;  1MAI A;  2FNJ B;  1P9D U;  4A6H A;  5DH9 B;  2KC1 A;  1LM8 B;  4BVU C;  3OAW A;  4AWJ A;  4EZJ A;  2BGF A;  2KQ7 A;  5C16 A;  4KAX B;  5FI1 A;  2KWC A;  3KVF B;  3W1S A;  3QWZ B;  4MM3 A;  3D32 A;  2QHO A;  2NPT B;  2CY4 A;  1BTN A;  3DVG X;  5JP4 A;  3K9O B;  4KZ0 A;  2IO3 B;  2M4N A;  3NY5 A;  2V4L A;  3NHE B;  2C7M B;  3DVG Y;  1QQG A;  3DVN U;  2ROV A;  4W9D A;  1Y19 B;  3P6A A;  4NSW A;  3UF8 A;  3ZLZ A;  1YX6 B;  3MDB C;  2DHI A;  3L17 A;  3RCZ A;  5DPS A;  2KX0 A;  5BO4 B;  4F7G A;  2GBK A;  3ZDT A;  2LWP A;  3PPA A;  2KFK A;  1XD3 B;  2N23 A;  3SU8 X;  2G4D B;  3VIA A;  1EVH A;  1U27 A;  5TR5 A;  4IM0 A;  3D8E A;  2RGN B;  2KTR A;  4ANW A;  2LI5 A;  2FCS A;  4JQW C;  3WAP A;  2CHZ A;  1NDD A;  1S3S G;  4BOZ B;  3AU4 A;  2DKQ A;  4DX9 0;  4DDI D;  1U2B A;  3ZO5 B;  4GXB A;  4WWO A;  1MK9 B;  4E71 A;  4HJK A;  2M38 A;  2NCN A;  3JSV B;  1WXM A;  5JHB A;  2KLC A;  4K1R B;  4A20 A;  1WYW B;  2D2Q A;  1GC7 A;  5IJM A;  2DA0 A;  1XQQ A;  2YVC A;  4KSL C;  4G11 A;  1RAX A;  3ALB A;  3PS6 A;  2PPH A;  3VTV A;  1V5M A;  1V5U A;  5KQ1 A;  2K6D B;  1WZ0 A;  4L6E A;  3R7R A;  2RUK B;  3A8Q A;  3L08 A;  4LJP B;  4HXD A;  3NSU A;  5HE1 A;  2MCN B;  2N9X A;  3SO6 A;  2NPT A;  3NOB A;  4CHM A;  3A1Q A;  2JXX A;  4GMV A;  1B55 A;  2LXA A;  4I6N B;  3KUC B;  3SHQ A;  2Z0Q A;  1YIW A;  4PYZ A;  1I2H A;  3N32 A; 
#chains in the Genus database with same CATH topology
 1ZW7 A;  2JVC A;  4IWP A;  1B9R A;  3HM6 X;  2KDE B;  2WXI A;  3U30 A;  4HHV A;  4M00 A;  3MHZ A;  5FK9 C;  1ZDV A;  4D2K A;  2COF A;  1JWU D;  2FAZ A;  3GP7 A;  3DBL I;  5BMI A;  1N63 A;  1WXS A;  2KDF B;  2L52 A;  1EWY C;  2LAS A;  2FID A;  1JAL A;  1P6S A;  4MT7 A;  1BTK A;  4B6H A;  3AEF B;  4W9K A;  3AMZ A;  3A33 B;  3LJU X;  2WDQ B;  3A9J A;  2NS5 A;  1ZGU B;  3D8D A;  1A70 A;  4MGZ E;  2N1V A;  4LK0 M;  4HAZ B;  2NBW B;  3TFM A;  2DYN A;  3V05 A;  3HVD A;  2GBN A;  1VLB A;  3BVM A;  5DI9 B;  2D9X A;  3N1Y C;  4WJQ A;  2LVO A;  5DIF B;  3B2F A;  4K2O A;  1FIQ A;  4RCO A;  5HFY A;  1HA5 A;  1VZ6 A;  2K8B A;  2LMC A;  3HRD D;  3P4S B;  1X05 A;  3R8B A;  2XK5 A;  2LGI A;  2ON8 A;  4XWX A;  2DLW A;  2KMA A;  1I4G A;  3V3X A;  1KJT A;  4QAY A;  3DXE A;  1AWD A;  2N1W A;  1TS3 A;  4HDQ A;  2LGS A;  2C5L C;  3NVY A;  2JX5 A;  2L8J A;  2PJH A;  3N9Y C;  4RGT A;  3FEH A;  3RUL A;  2GS0 A;  2KAC A;  1FHX A;  3WIM A;  5AUI A;  1AW7 A;  1J19 A;  1R4N I;  2WXF A;  2PTL A;  3GZN B;  2DEN B;  2RPV A;  1FMA D;  2KK8 A;  2H7D A;  1EGX A;  4GLS C;  2DX5 B;  2CJN A;  1UNS A;  4LDT D;  1VJK A;  2I2Y A;  3A4S C;  5FR3 A;  2VSZ A;  1WM2 A;  4B6W A;  5G2N A;  3DQV A;  4A90 A;  4YSZ B;  3UI3 A;  5GOW B;  3QWM A;  2RLO A;  1SE2 A;  1F1H A;  1JWM D;  3V60 A;  3ZTC A;  2COP A;  2L7R A;  3NZ3 A;  2D3B A;  4IFS A;  2AQ1 B;  1MI0 A;  3L16 A;  4I6L B;  3BVG A;  2JPH A;  2NBV A;  4RF0 A;  1H4R A;  2Z0P A;  2FE8 A;  1HE8 A;  1OQN A;  2NVU I;  1QF6 A;  1MI1 A;  1FXT B;  3M3J A;  2XN9 C;  2KAN A;  3WA0 A;  5I4D A;  1D4B A;  1F2R I;  2LZ6 A;  2KQS A;  2YT1 A;  4TQ1 A;  4TQ0 A;  3IAS 1;  1MPE A;  4I6P A;  1C78 A;  2KUP A;  2KVZ A;  2Y5C A;  3AE7 B;  1ZVR A;  3AB5 A;  3IVF A;  2HTM E;  4W9H A;  3ZW3 A;  3ZXR A;  1Y8R C;  1P3R A;  4JIO U;  5T8I A;  4H2A A;  2ELA A;  1K8R B;  3AM9 A;  3GOE A;  2BS4 B;  3TEY A;  2LVQ A;  4MT5 A;  5IP4 D;  1FRR A;  1YN3 A;  2G35 A;  5LOP B;  4MY6 A;  3VOQ A;  1LXD A;  2G3Q B;  3T3N A;  1SBB B;  4FJY A;  4PK1 A;  3PEG A;  4FJZ A;  3NUH B;  2MP2 A;  4H8S A;  1TYG B;  3P7Z A;  1VRA B;  2JU6 X;  3HIE A;  1H8C A;  1FAO A;  3AEC B;  1YNT E;  4M01 A;  1ZM0 A;  2WWZ A;  3DDC B;  5TSS A;  1OMW A;  4MH0 E;  4WAA A;  2L3Z A;  2PW9 A;  4HCN B;  5LXH A;  1EAZ A;  2MA9 B;  2R61 A;  5L81 A;  1VZ7 A;  3QA8 A;  1P7F A;  2RSG A;  1FD6 A;  1QKZ A;  3NS1 A;  1VR9 A;  2IDY A;  1HB6 A;  1KLU D;  2CHX A;  4RMA A;  2UYZ B;  2DTC A;  2KFJ A;  1OQR A;  2FDQ A;  1WGU A;  1FXI A;  2FJ9 A;  1WI0 A;  3R3M A;  3SDL C;  4RM8 A;  2AQ3 B;  2COC A;  5J3Q A;  1V1O A;  2K1F A;  3OG5 A;  1LGR A;  3Q2A C;  4NAW B;  4JKF A;  3AE9 B;  3P4P B;  1OQQ A;  1N5X A;  3IBE A;  1N61 A;  1YQ4 B;  2LG1 A;  1I4Q A;  5HHD G;  4ZRK A;  2N9E B;  2IGG A;  2Z59 B;  4C80 A;  3PLU A;  3NRZ A;  1OFF A;  3A9K A;  2L00 B;  2DAF A;  3APC A;  2DZK A;  2P8V A;  3QAQ A;  4ZDV A;  1AN8 A;  1SIF A;  1W1H A;  3GS2 A;  4A3O A;  1WE6 A;  3BYT B;  2EMS A;  2W2X C;  5BMH A;  4GSW A;  2W82 A;  1T0S C;  5CHF A;  2WYQ A;  1H10 A;  2NMB A;  1GPX A;  1FNU A;  3MHS D;  2KMC A;  4OHJ A;  3ECI A;  4YON A;  2FUG 1;  4G3X B;  1IBX B;  5BMG A;  3ODO A;  2PE6 B;  4GPT B;  2O2V B;  1V5O A;  4KZC A;  2KOX A;  4TSS A;  2EMT A;  2QKL A;  2V4I B;  3BZD B;  3TEW A;  1WF9 A;  4HPP A;  4AUQ C;  1FM0 D;  3UGB B;  2ICI A;  3CST A;  1UEF A;  1YN4 A;  4FHK A;  4IDI A;  3I9V 1;  5C79 A;  1RWS A;  3W9C B;  1KOT A;  1DOY A;  5CHV C;  3OJ4 B;  1VD2 A;  3ULB A;  2LOX A;  4AJW A;  1RLF A;  2MW5 A;  2UVM A;  2J4X A;  4EZK A;  2KN5 A;  3IAM 1;  3ZXV A;  3C19 A;  2W55 A;  3QAR A;  1GB1 A;  2LUL A;  1CQV A;  3AEB B;  4IW0 A;  1V49 A;  1KBL A;  1FHW A;  4HB0 B;  2C60 A;  5CX3 A;  1NTY A;  2BVC A;  4ILJ A;  1TY0 A;  3JYU A;  1WIA A;  4A6F B;  3VHT C;  2D4Q A;  2WX0 A;  1V88 A;  3CWI A;  2D11 A;  1EUV B;  3VH3 B;  1BT0 A;  2MBQ A;  1XX0 A;  1MJD A;  3TO1 A;  2N0Y A;  1V5T A;  2MBB B;  2RD0 A;  2ASQ A;  3H1U A;  4BKG A;  5C5B A;  4DHZ E;  5M4Y B;  4NNJ B;  1UGJ A;  2KMM A;  4B0M A;  4PS3 A;  5IAA C;  2GCL A;  2M19 A;  1HTQ A;  4HRO A;  2DFK A;  2K8E A;  1ZC3 B;  3P2B A;  2HTH A;  2LVP A;  4RM9 A;  2R2Y A;  3AE2 B;  1HQR D;  3KSY A;  4GOC A;  1GAQ B;  4GDL A;  2KVR A;  3KUD B;  4LLG M;  1MVK A;  2KWV B;  3E9O A;  3U7Z A;  3B77 A;  2JZ3 B;  5CTR C;  4WJ7 A;  2LYD A;  1D3Z A;  2LKO A;  1LW3 A;  1B1Z A;  3VUY A;  1WGR A;  2CB8 A;  2WU5 B;  3P4R B;  2GCJ A;  2K9X A;  4ZRQ A;  4O1N A;  4NY0 A;  1N3H A;  1WFY A;  3MTN B;  2P0H A;  2N9P C;  4S0R A;  4C0A A;  4NAM A;  1YD8 U;  3U7D A;  2YEP F;  2AL3 A;  1C1Y B;  1OY2 A;  4PS7 A;  4OW0 A;  2GJY A;  1X1M A;  1FOE A;  1HB8 A;  1FGY A;  5LXI B;  3DVN V;  1J7B A;  2L83 A;  4MDK E;  3RN9 C;  1SE9 A;  3DBL B;  3Q8A A;  1TXD A;  3Q8F A;  1WE7 A;  2AEH A;  2KJR A;  1IPG A;  5JVL A;  3VDZ A;  1QQR A;  4WQM A;  1PFJ A;  2MX2 A;  1FHO A;  3WAO A;  1UWX A;  4F7U P;  2MWS B;  2EJ8 A;  1N62 A;  5D3D A;  2ZVN A;  3FVC A;  1PGA A;  2W3S A;  3A58 A;  3N3K B;  1VDV A;  3MJW A;  1QOF A;  4EKU A;  4UDU C;  4TKN A;  3NVZ A;  4J3O D;  3TL5 A;  1LFD A;  2E3T A;  2HDE A;  4KIK B;  1WMH B;  3IHP C;  4AJY B;  2KWD A;  4GDK B;  2G4S A;  1FPY A;  2OJR A;  2QJL A;  1ZOY B;  1NTI A;  2LJI A;  3B1L X;  3SD5 A;  2ABD A;  1WJN A;  1EM7 A;  2O6V B;  2C7N B;  2J0M A;  1WGG A;  1FGZ A;  1ACC A;  4BKS A;  3N20 C;  3RNB C;  1ZYI A;  1J7C A;  5D3W A;  4RNA A;  2GB1 A;  2IY1 B;  4WQO B;  1RRP B;  2KD0 A;  2MHJ A;  4M02 A;  4GU2 A;  2W3R A;  1QIL A;  4WJO A;  4Q2J A;  4W9J A;  4BKS D;  1HTO A;  3HM3 A;  1E8Z A;  4YTP B;  1GUA B;  1XEE A;  3VQI A;  1DDM A;  4YT0 B;  4PS8 A;  1YQ3 B;  1X1F A;  1R4M I;  3SEB A;  3PRM B;  3M1I B;  1NEN B;  1WYG A;  4DK5 A;  1MPH A;  1U5D A;  1ESF A;  2Z13 A;  2QC8 A;  2WHI A;  5D3Y A;  3O13 A;  2V3P A;  5KQ4 A;  4F7Z A;  4HAY B;  3PHX B;  4NPN A;  4MAC A;  4D6W A;  4N58 A;  3EPY A;  3L0W B;  4HAX B;  2AQ2 B;  2M1M A;  2JT4 B;  2WXP A;  3TUO A;  2J0K A;  2V3S A;  4DHJ D;  3AUL A;  2LOZ A;  2WXJ A;  3CXB B;  2D3C A;  2A4Z A;  4US9 A;  1TTN A;  5BYQ A;  1TKE A;  1OEY J;  3PVL A;  4DBB A;  1MG4 A;  1EF1 A;  1SHC A;  1WJM A;  3PTF C;  3V6E B;  3A4R A;  5JHH A;  3C8Y A;  1JRU A;  3APD A;  2BQQ A;  1BML C;  3AN1 A;  4ILH A;  1UNQ A;  2GI9 A;  2IZV B;  4XDD A;  2PVG C;  2BB6 A;  3PV1 A;  2DZM A;  2K49 A;  3ONS A;  4GB9 A;  4LNO A;  4S17 A;  4IWO A;  2CR5 A;  3DBR I;  3WYF B;  4II3 B;  2LGY A;  2WLB A;  5EDS A;  1FCC C;  3URY A;  2INN E;  2MH7 A;  3B0A A;  5L83 A;  2KO3 A;  2R2Q A;  1AQC A;  5D27 A;  2RPQ A;  4LNI A;  1BUI C;  4FLH A;  3B2G A;  1YN5 A;  2DLB A;  2UU7 A;  2CY5 A;  1LB1 A;  3T06 A;  2OOB B;  4USA A;  3QJZ A;  4F7H A;  1PUT A;  2J52 A;  1KFY B;  2JWZ A;  1UPQ A;  1KH0 A;  1QOB A;  2XEW A;  1K52 A;  4QJ3 B;  3E9S A;  5CLL B;  2BKF A;  5EFX A;  3VXW A;  3R2T A;  3AJ4 A;  5EE1 A;  1WRI A;  1J7A A;  3BWU D;  3S2A A;  5D6J B;  2I1J A;  1CJE A;  5I2M A;  2K8C A;  4WWP A;  4MGI E;  4L1B A;  4EZL A;  3KWV A;  1C4A A;  2OED A;  2VH2 A;  1QT9 A;  1WJU A;  4JKA A;  3CSF A;  1XKE A;  2YT0 A;  1TS4 A;  3NWA A;  3FIL B;  4GMX B;  3EGR A;  2K5P A;  3H7P B;  3KH0 A;  4HAW B;  2M17 A;  1UEL A;  4G0N B;  4K7W A;  2HE7 A;  2WXM A;  3AU5 A;  1FB8 A;  1GG3 A;  1P1A A;  3JSV A;  4WIP A;  4PT5 A;  4EMO A;  5JXV A;  3RNE C;  2BCJ A;  5DHA B;  1LQB A;  1L6U A;  1T0Q C;  3WCQ A;  4W9G A;  3M63 B;  1ZC4 B;  2Y8G A;  1V86 A;  1DOX A;  1RRB A;  2REX A;  1FEH A;  4HLE A;  2CQU A;  3PVW A;  4DXG A;  2LEK A;  4HAU B;  2BKR B;  3ODX A;  2I38 A;  4WWN A;  2VZK D;  1TKG A;  2M56 B;  1IGC A;  4HPM B;  2YS3 A;  5IO9 A;  2IJ0 A;  1XF5 L;  3VRB B;  1UGM A;  1OQY A;  3VTW A;  3AE8 B;  1ROE A;  1U5G A;  4HK2 A;  3J9C A;  2K39 A;  1V6E A;  3ZRC A;  1K50 A;  4XYC A;  1WSP A;  3KQ4 A;  3VVW B;  4FN2 A;  3ZQ4 A;  2KLG A;  1WG7 A;  1Y56 A;  3GYO A;  3APF A;  3DOW A;  3NS8 A;  4MEM A;  3PT2 B;  1WX9 A;  1XCQ L;  2IY0 B;  3PGE A;  4A6K A;  2AL6 A;  3MC9 A;  3EC8 A;  2VH1 A;  3DWM A;  4HPL B;  1GNU A;  1EF5 A;  1XOD A;  3V62 A;  2DBY A;  1U5F A;  2W9N A;  5D94 A;  5C1Z A;  3ZJU A;  2G1E A;  3RNG C;  3ZYY X;  4P7I A;  1WJ6 A;  1SE4 A;  1KZ7 A;  3TMP B;  2D9Y A;  5CLQ B;  2HRJ A;  3IT4 B;  4KGS A;  1G6J A;  4K3C A;  1PMS A;  4L2Y A;  3BJI A;  3ML9 A;  2Z0O A;  3VAW A;  3RZF A;  1C76 A;  1T6B X;  1K5D B;  4BBN C;  1WGD A;  4KHB B;  5EE9 A;  3AEE B;  3H6N A;  1SJE D;  3W1S C;  1V1P B;  3IXS A;  2K3U A;  2FCN A;  1WRD B;  2KC2 A;  1LO5 D;  1VBG A;  2WNM A;  4NJC A;  1KC7 A;  4CSQ A;  1MHH E;  3T9L A;  3SUZ A;  2LFI A;  2WXR A;  3CF6 E;  2Y7B A;  4WVF B;  4JWS C;  3ULC A;  4TMA B;  4JKG B;  2J42 A;  5J3T A;  2B3A A;  3L4P A;  2QKM A;  2I5C A;  2K25 A;  1UF0 A;  3SYX A;  2RDH A;  4ITK A;  2INC C;  4RGO S;  2JYE A;  4CHK A;  1SIJ A;  3HUI A;  2J0J A;  3SFD B;  4Y94 A;  3NZU A;  4URK A;  4K7U A;  3VTU A;  4KDI C;  2UZR A;  4MJS B;  1XCT L;  5JHA A;  3PP2 A;  2Q5W D;  3NVW A;  5D7G A;  2IPK D;  2DX5 A;  3H8H A;  2BYV E;  4HVB A;  2FIF A;  3C0R B;  5J18 A;  1NYR A;  1C77 A;  1TZ1 A;  1Y5O A;  1QOA A;  1V89 A;  1J8C A;  1E7U A;  5JH5 C;  2JSV X;  1M7E A;  2QCZ A;  2D9Z A;  1TJ6 A;  1PYW D;  1XO3 A;  2WH5 A;  3VH4 B;  2CRF A;  1JWS D;  2MFQ A;  2ZNV C;  3DXC A;  1KZG A;  2YT2 A;  1DGJ A;  2NZ8 B;  4C00 A;  4JLC A;  2WP9 B;  5E6O A;  5C3J B;  2SEB D;  4FBJ B;  3I3T B;  2PEA A;  1Q5W B;  3JVZ X;  1TKY A;  1X86 A;  2QIE B;  1WI1 A;  2KUQ A;  1WGY A;  3MP9 A;  1GC6 A;  4FUL A;  2KYW A;  2MBO A;  1KLV A;  3ENB A;  4NQK E;  3PG7 A;  2N4F A;  3EA6 A;  2MSE D;  3WAM A;  2MBE A;  2ZW0 A;  1PLS A;  1XXG A;  3M95 A;  4X57 B;  4XGA B;  1ET6 A;  1PGX A;  4JGH B;  2WXG A;  1CK1 A;  3QBV B;  2GBJ A;  1WR1 A;  3IFW B;  4M0W B;  1P7E A;  2MRP A;  1IP9 A;  2COD A;  5JZE B;  3SBT A;  2PZ1 A;  2VKI A;  2KNB A;  1L0V B;  2CU3 A;  3RUI B;  2H7E A;  4MGK E;  5D3I B;  3Q8E A;  2KR0 A;  1K5G B;  2V3N A;  3Q8B A;  4C7Y A;  4DDG D;  1NI2 A;  1V8C A;  4MK0 A;  5J2R A;  4HRS A;  3R7Q A;  2MLB A;  4XDC A;  3Q3N C;  2MJ3 A;  2N9K A;  3QC8 B;  1UPR A;  3SFE B;  4AQ7 A;  2JUO A;  3SBG A;  1OTR B;  2W2W A;  1QOG A;  1U4A A;  3HK0 A;  1C3T A;  3TW1 A;  1NVL A;  2JYT A;  5E6P A;  2WDR B;  2W54 A;  5AZH A;  2YS5 A;  3AE4 B;  3RFZ B;  4HAT B;  5LNK 1;  1WZ3 A;  3VUX A;  1E90 A;  1ZUD 2;  1V61 A;  2ELB A;  4ARC A;  2WXH A;  1RM6 C;  4MM3 B;  2G9H D;  3HIZ A;  3UIN B;  2WXN A;  1FCL A;  4NAW A;  1E0Z A;  1T0R C;  5AZG A;  4P6V F;  2C9W B;  1MG8 A;  5FR6 A;  3EUB 2;  2LRW A;  4ASW C;  1F2R C;  3ZGZ A;  1GB4 A;  2ZCB A;  2QEJ C;  3H9D A;  2Z59 A;  2OTX A;  3KYD D;  4M8M A;  4KGT A;  3T8M A;  2R09 A;  4A55 A;  1T0Y A;  2WS3 B;  3ZUN A;  1KF6 B;  5AUK A;  4EFO A;  2LUM A;  3OHM B;  4E3C A;  2YSZ A;  4JK7 A;  2X38 A;  2R82 A;  1W1D A;  2YS1 A;  4TUU A;  2MDX A;  3DBR B;  4HDO A;  3MPX A;  4B9K A;  4BZA A;  2KFK B;  3GYP A;  4A8X C;  3L54 A;  1ACA A;  3D8F A;  3I57 A;  4PYU A;  3RNA C;  2DYO A;  1WX7 A;  2K2U A;  2RQ1 A;  3UIO B;  2ZEQ A;  1IBX A;  3TSS A;  1Q67 A;  2O2V A;  2KTR B;  4M0W A;  1TQZ A;  5HG2 A;  2WGS A;  2K6Q A;  2JXT A;  2IYD B;  3IT6 B;  3DBH I;  2CU1 A;  1WGK A;  2L76 A;  2IFS A;  1VZ8 A;  3AE1 B;  1EU3 A;  1CMX B;  5C2T B;  2ZNV B;  4KGR A;  1TS5 A;  2FUH B;  4LNN A;  4ZHP A;  4A9A A;  4DWF A;  4LTU A;  3ZJT A;  4IM3 A;  3AED B;  1STE A;  4NJ6 A;  2DYB A;  4ICU A;  4OVV A;  1N60 A;  4ACF A;  1V81 A;  3PRE A;  4YL8 A;  1ZSQ A;  4G50 A;  1M4V A;  3KZ1 A;  3UZT A;  2KTF A;  1S1Q B;  2PVO D;  1IUE A;  1FFV A;  3H7S A;  1N6Z A;  4A6F A;  2BB5 A;  4Z2N A;  4B0E A;  1I7A A;  2Y5B B;  2DZI A;  3AE3 B;  4CO7 A;  4HAV B;  5HE0 A;  4P16 A;  2N7J A;  3ZTD A;  3RCP A;  2YRY A;  2LBB A;  1WXA A;  2IO1 B;  1E8Y A;  2KN4 A;  3NW8 A;  2R0D A;  3RT3 B;  3MC8 A;  2GMI C;  1QLB B;  4IC7 B;  1TY2 A;  2RRF A;  5KHQ A;  2BT6 A;  4IG7 B;  1F77 A;  1MK7 B;  3QHT A;  4DQO C;  2Z0E B;  5JLJ B;  5MPO A;  3EHV A;  5D3V A;  1EO6 A;  2JF5 A;  2IO2 B;  2K2J A;  1L5P A;  4JX1 C;  3A1Q B;  3E9L A;  3FAH A;  4C7Z A;  1R4N B;  2FJL A;  3SV1 A;  3U12 A;  2ADZ A;  1OGW A;  4JK8 A;  1UZX B;  4JKC A;  1E8W A;  4KSK C;  2BS2 B;  5D3X A;  3MC0 B;  4M8N A;  4C4V B;  2EC1 A;  1KM7 A;  1L7Y A;  2JRI B;  4XC2 A;  1E5W A;  4IOI E;  2JZZ A;  1E10 A;  2ZKM X;  1WGH A;  4QJ5 B;  4PNK A;  2RMM A;  1FRD A;  5H8Y E;  3ZKJ C;  3U8Z A;  1KI1 B;  2KWU B;  3VFK A;  1ZDX A;  4OZC A;  4WJP A;  4EJN A;  4WUR A;  5LLI A;  1RYJ A;  1M7R A;  5DHF B;  2N7E A;  2LRU A;  2ZW1 A;  4MSQ B;  3A9J B;  2KDI A;  1P98 A;  2IYB A;  2IBI B;  3B9J A;  3QIJ A;  2DNF A;  2ZPN A;  1WM3 A;  3FP5 A;  4HSI A;  2HJ8 A;  3KRX A;  3KWL A;  4K7S A;  4ZOH C;  4ZYN A;  4KX6 B;  4KDL B;  1UWM A;  3W2D A;  1WY8 A;  2V76 A;  3EFU A;  1JCK B;  3U52 E;  1M94 A;  1U5E A;  3DHG C;  2LGD A;  1TZO A;  2I1K A;  2Y3A A;  3PLV A;  3RD2 A;  1NBF C;  1SEB D;  2XK5 B;  4JKD A;  2WU2 B;  1I4R A;  2NMQ A;  3QQ8 B;  1XT9 B;  2EKI A;  4C56 C;  2N9L A;  4AS1 A;  2Z4D A;  2LHD A;  1UNR A;  3W1Y A;  3RNF C;  1ST7 A;  1Q1O A;  1E8X A;  1PDX A;  4FHJ A;  4LDT B;  3JW0 X;  2RVB B;  5KHO A;  1UH6 A;  2WDV B;  3MFG A;  3K9P B;  3Q6B A;  3BK2 A;  3AV8 A;  1OEY A;  1E6E B;  2W2X D;  2V1Y A;  5DPR A;  3EEC A;  4LJO B;  4LCD E;  3PHW B;  4ANX A;  4FAD A;  4KIK A;  1WMH A;  4XX5 A;  2X0S A;  1WWT A;  4GDK A;  1L4Z B;  4QJ4 B;  4WSF A;  4AOF A;  1XLN A;  3BK1 A;  2N0S B;  4QXA B;  3UQB A;  4PQ0 A;  2KJ6 A;  1DDW A;  2YEP B;  1D5M C;  4US8 A;  1TBE A;  2MWN B;  3HQC A;  2O6V A;  1TGZ B;  1T77 A;  1L2N A;  2TSS A;  3ODW A;  5C23 A;  3KY9 A;  4W9C A;  2O6V D;  4OVZ A;  1P5T A;  2NBV B;  3ZNH B;  1SJH D;  3TIX A;  4OZB A;  4CHJ A;  2JRH A;  2CS4 A;  2KGX B;  3AE5 B;  3OWE B;  1J0G A;  2H88 B;  3OLM D;  3UIP B;  4JK9 A;  1MIX A;  2L32 A;  4KKI A;  2D10 A;  2L2I A;  1BAK A;  3B08 A;  4JKH A;  2L0T A;  1YJI A;  4GGQ A;  5J17 A;  1J0W A;  2E6X A;  3G9W A;  3AEA B;  4DIX A;  3RZW C;  2BYT A;  3FC4 A;  4KHA A;  2N7D A;  2VRR B;  4B95 A;  1A5R A;  1Z5S B;  4J6I A;  1HZ6 A;  1VCB A;  5AEK B;  3EFC A;  3ML4 A;  5C6R A;  1FNW A;  5L95 C;  3RNC C;  2D5G A;  2CHW A;  2GOW A;  2INP E;  5KCV A;  3KYC D;  1D6E C;  2UWQ A;  1AYF A;  3FSS A;  2KAJ A;  2ZZP B;  1NYQ A;  2KJH B;  3OJ3 A;  3AXC A;  1L0Y B;  4HJG E;  4FJV B;  2ZCC A;  2MP2 B;  3VR8 B;  1IYF A;  3PVU A;  4BBK A;  3F0W A;  2RDB C;  1XCG A;  5HE2 A;  4BFR A;  2V0G A;  2MKR A;  3E56 A;  4RGM A;  5G55 A;  1JRP A;  3V61 A;  2X18 A;  3O65 B;  4N9F 4;  4WWM A;  3RYT A;  2MJD A;  3PZ8 A;  1CZP A;  2WX1 A;  3L10 B;  4RH6 A;  4HWI B;  2LD9 A;  3P63 A;  2BBC A;  4REZ A;  5E6J A;  3GE8 C;  2SAK A;  4L23 A;  1WR6 E;  1HXY D;  3L13 A;  1YX5 B;  1ZXH A;  4GZU A;  3ZJV A;  2AX5 A;  3ENE A;  1SGH A;  1PGB A;  1F9J A;  2C7H A;  4AP4 C;  1YJ1 A;  2HD5 B;  3LYY A;  1D5Z C;  2DAJ A;  4P1C C;  3GB1 A;  2Q13 A;  4ZRJ A;  1V5P A;  4BKT A;  4DX8 A;  4NJ7 A;  3UQA A;  3TJP A;  3Q69 A;  1UD7 A;  4W9I A;  1N5W A;  4XWT A;  1TIF A;  3RMK C;  3VUW A;  2ZVO A;  3DPD A;  3FM8 C;  2DN6 A;  1XR0 B;  3DCG A;  2K0P A;  1ENF A;  1UBI A;  1QC6 A;  3M62 B;  4OT1 A;  1WH3 A;  3TCA A;  2X8X X;  1I4H A;  2M0X A;  2KIG A;  2K22 A;  1XLO A;  2GLS A;  2H89 B;  3A9K B;  2UZS A;  2VRW B;  4YTM B;  1X11 A;  3PRP B;  2RDG A;  3P1M A;  2FBW B;  4W9E A;  1ZPS A;  2JY6 A;  1YQB A;  3HVZ A;  4HKZ E;  3O96 A;  4HCP B;  4EE2 A;  1RJ2 A;  1MHX A;  1SE3 A;  4IOY X;  4ZRI A;  3PZD A;  5AZF A;  3ZNG C;  1DIK A;  2L1C A;  2P0D A;  3TBL D;  5E6N A;  1X1G A;  1I7H A;  4BBN F;  2BW2 A;  1K53 A;  2Y8F A;  3V5W A;  3Q14 C;  2L05 A;  1WXV A;  3FIL A;  3HSA A;  1GGO A;  4N6E B;  3H7P A;  4MSM B;  3X23 A;  3PSE B;  2ONQ A;  2DYM A;  3F5R A;  2KXJ A;  1Z87 A;  2BYE A;  2PLP A;  2WQY B;  5LG4 B;  1TJE A;  3NZS A;  2J59 M;  3ZNZ B;  4FA6 A;  5IA7 A;  1V9J A;  1NI3 A;  3ZRF A;  3DXD A;  2YF0 A;  4TYZ A;  3TVV A;  1PFD A;  4K2P A;  1AAR A;  3DHH C;  2DZJ A;  1AWE A;  1PQS A;  2OQB A;  1JRO A;  4ICV A;  1V97 A;  5J3Y A;  5HI1 A;  2MQJ A;  2KIE A;  1UUP A;  3DBH B;  1I42 A;  1NEK B;  2GBM A;  2D3A A;  5BYR A;  5DCN A;  2IO0 B;  3NJT A;  1Q0W B;  1DRO A;  4N59 A;  1WXQ A;  2K00 A;  2DIK A;  2NBU A;  5G5G A;  2PMV A;  2XBB C;  1P0R A;  1JDE A;  5IKC M;  1ISN A;  2CAY A;  4BAX A;  2L0F A;  2FJU B;  2D3G A;  5G5H A;  2PE9 A;  2JWU A;  5C5B B;  1KLG D;  3HW2 B;  4ANV A;  4Z2M B;  1P3Q U;  4ZHO A;  2DHJ A;  3ZVV A;  3FLV A;  2CJO A;  3WAL A;  4JKB A;  3N7C A;  2DYQ A;  2ROZ B;  2FCQ A;  3MJ5 A;  4KV2 A;  4KHO A;  3PZ7 A;  2EKE C;  2P0F A;  3BIN A;  2HTH B;  2ZPY A;  3NWD A;  4NZL B;  2JP2 A;  4WAF A;  4EEW A;  2GUM A;  5GMV A;  1GOZ A;  3KW5 B;  2WDT B;  1BWN A;  1FNV A;  2J7Q B;  3HHM A;  2BF8 B;  5D2M B;  3AEG B;  4IWQ A;  4ZRP A;  4D0N B;  2V9H A;  2LGX A;  4GDL B;  2JQR B;  4HB4 B;  4K81 A;  1T5X D;  3ML8 A;  4KHB A;  4BOS C;  3W5V B;  3DBS A;  1HBK A;  4MEL A;  4GIV A;  1V1P A;  2JZP A;  4MH8 A;  1E7V A;  2G45 B;  2OJW A;  4W9L A;  4HKQ A;  2KX3 A;  1YMH E;  3ZIM A;  5HE3 A;  3R2I A;  2NTS A;  2D07 B;  2COA A;  1V80 A;  2IGH A;  2M0A A;  3LJ3 A;  3GZN I;  1E9M A;  1F52 A;  2NR2 A;  1W1G A;  3PSC A;  3E66 A;  3TEX A;  4NQL B;  1I4X A;  1WX8 A;  4JKG A;  1WJ1 A;  1U29 A;  2BPS A;  3Q3O C;  4YSY B;  3PRZ A;  2ZJD A;  4HB2 B;  1ET9 A;  4LNF A;  2D9W A;  4R3D A;  4ZYS A;  3ZVR A;  2RNR B;  4W9F A;  3BYY B;  4XWW A;  4KVG B;  1YOV B;  1DYN A;  1R4M B;  4E74 A;  1EU4 A;  4IM2 A;  5IN7 A;  3OAN A;  2LUE A;  3V6C B;  3T3O A;  3Q3J A;  1UBQ A;  4HB3 B;  1DDV A;  2I5F A;  4A3P A;  2XQN M;  2BS3 B;  3VR9 B;  4GOU A;  4KKJ A;  4MJS A;  4HEA 1;  2Z8L A;  2Z0D B;  5LON B;  1XD4 A;  2KDM A;  4GN1 A;  4ANU A;  3LDZ E;  3BVZ A;  3FKY A;  4RF1 A;  1JWA D;  2FCM A;  2BYF A;  2AWT A;  2LXC A;  4YTN B;  3P42 A;  1RFA A;  3QX1 A;  3ETR A;  3Q3M C;  2KDB A;  2RR9 A;  1ZP0 B;  1NTV A;  2OHF A;  2DKP A;  3AE6 B;  3Q3F A;  4F1S A;  2KZR A;  2KKC A;  3U4E G;  3N30 A;  2MJE A;  3KUZ A;  1QZE A;  4IUM B;  5FI0 A;  2MBH A;  1D5X C;  3X0W A;  3WAN A;  3DWG C;  5EE0 A;  3A8P A;  1IGD A;  1DBH A;  2NTT A;  4EUT A;  4ILG B;  4TV3 A;  3BY4 B;  1IRS A;  1UNP A;  5CHW A;  3DCX A;  4OVU A;  2KHW B;  4WJN A;  4MGY E;  2BTE A;  3U2S C;  1I35 A;  2KCJ A;  3R66 C;  4GNK B;  1MKE A;  1YJJ A;  5JHG A;  3LXF A;  4WH4 A;  2M14 A;  2R2O A;  4CQN A;  2HJ1 A;  2BWE S;  1WGQ A;  2DHK A;  3KRW A;  1RFK A;  1KTK A;  4DBG A;  2KQ4 X;  3SNH A;  1R7S A;  2KT7 A;  5DPW A;  1TS2 A;  3ZDM C;  2RSU A;  3CIK A;  4II2 B;  4DHZ B;  4A5K A;  1L6V A;  3ZNI D;  4F8C B;  3CMM B;  1JWB D;  1WVH A;  3DHI C;  3I63 C;  1ZKH A;  4CYE A;  1BXT A;  3QCA A;  5DPT A;  3KLS X;  1V2Y A;  1XLP A;  2RGF A;  2M8S A;  2E2X A;  4JL9 A;  2LJ5 A;  4DXA B;  4DHJ B;  1FXA A;  3CIR B;  1MIZ B;  2D9V A;  1NU2 A;  1JML A;  2BWF A;  2CKH B;  1VBH A;  1C9F A;  2K8H A;  4ARI A;  2GBR A;  3QK0 A;  2IND C;  4XZ4 A;  4K3B A;  4IAP A;  1KRH A;  1I4P A;  3IG3 A;  2DHZ A;  1WJ4 A;  1FO4 A;  2DX1 A;  4K17 A;  3A98 B;  2Z14 A;  5HKH A;  3AI5 A;  3N1Z C;  3BII D;  2AYO B;  1Z2M A;  2A5U A;  4EOY A;  2LHE A;  2YLM A;  1GJZ A;  1MAI A;  1C79 A;  1SSN A;  2FNJ B;  1P9D U;  4A6H A;  4LNK A;  5DH9 B;  2PKO A;  4RFB A;  5IOI A;  2KC1 A;  1LM8 B;  4BVU C;  3OAW A;  1SF0 A;  4AWJ A;  4EZJ A;  2BGF A;  4IKG A;  1T3Q A;  2KQ7 A;  5C16 A;  4KAX B;  1DOI A;  5FI1 A;  3RPF C;  3ABV B;  2KWC A;  3KVF B;  3W1S A;  3QWZ B;  4L1R A;  4MM3 A;  3D32 A;  3LB8 C;  2WXL A;  2QHO A;  2NPT B;  2CY4 A;  1BTN A;  2Y5P A;  3DVG X;  5JP4 A;  4YXD B;  3N1X C;  3K9O B;  4JWU C;  4KZ0 A;  2IO3 B;  2M4N A;  3NY5 A;  5I2S A;  2V4L A;  2PIA A;  3NHE B;  2C7M B;  4OSN A;  3DVG Y;  1QQG A;  1JQ4 A;  3DVN U;  2ROV A;  4W9D A;  1Y19 B;  3P6A A;  1FFU A;  1TT5 B;  3NWF A;  2QDF A;  4NSW A;  1EWC A;  4OZA A;  3VRA B;  3UF8 A;  3ZLZ A;  4YWG G;  5GXG B;  1YX6 B;  3MDB C;  2L1A A;  5FKA C;  2QIL A;  2DHI A;  4FXC A;  3RI7 C;  3L17 A;  3RCZ A;  5DPS A;  3AH7 A;  2KX0 A;  5BO4 B;  1L4D B;  4F7G A;  2GBK A;  3ZDT A;  2LWP A;  3P4Q B;  3PPA A;  5EE3 A;  5BYS A;  2KFK A;  1XD3 B;  1ZXI A;  2QMT A;  2N23 A;  3SU8 X;  4A6Q A;  2G4D B;  3VIA A;  1EVH A;  1JW9 D;  1U27 A;  2B76 B;  5TR5 A;  2WXO A;  4IM0 A;  3D8E A;  2RGN B;  3I5J C;  2KTR A;  3PO0 A;  4RGN A;  1ZE3 D;  1HZ5 A;  4ANW A;  1C4P A;  4YSX B;  2LI5 A;  2FCS A;  4JQW C;  3WAP A;  2CHZ A;  1K51 A;  2IGD A;  1NDD A;  1S3S G;  4BOZ B;  3AU4 A;  3TEZ A;  2DKQ A;  4DX9 0;  5IRS A;  4DDI D;  1U2B A;  3ZO5 B;  4GXB A;  4WWO A;  1MK9 B;  2XNA C;  4E71 A;  4HJK A;  2M38 A;  1E7P B;  2NCN A;  2MEK A;  3JSV B;  1WXM A;  5JHB A;  2GRI A;  2KLC A;  4XE0 A;  4K1R B;  4A20 A;  1WYW B;  4JE3 B;  4DXF A;  2D2Q A;  2WXK A;  1GC7 A;  5IJM A;  5H92 C;  2DA0 A;  1XQQ A;  2YVC A;  2ACZ B;  2VZK B;  4KSL C;  4G11 A;  1RAX A;  1XLQ A;  3ALB A;  3PS6 A;  3NG0 A;  2PPH A;  3E9P A;  3VTV A;  1F0Z A;  1V5M A;  1V5U A;  5KQ1 A;  1L0X B;  2EEL A;  2K6D B;  1WZ0 A;  2J53 A;  4L6E A;  3R7R A;  2RUK B;  3A8Q A;  1HEZ E;  3L08 A;  4LJP B;  3GE3 C;  4HXD A;  3NSU A;  5HE1 A;  1Q10 A;  2MCN B;  2N9X A;  3SO6 A;  1SB3 C;  2NPT A;  3SR6 A;  1DYQ A;  3NOB A;  4CHM A;  3A1Q A;  3W5U B;  1C4C A;  3NVV A;  2JXX A;  2QSD A;  4GMV A;  3Q8C A;  1B55 A;  2LXA A;  2WXQ A;  3KUC B;  4I6N B;  3SHQ A;  2Z0Q A;  1YIW A;  4PYZ A;  1SXT A;  2DWQ A;  1MFW A;  1I2H A;  4C4V A;  4JKE A;  3N32 A;  4P1B C;  4JPS A;  1NVI D; 
#chains in the Genus database with same CATH homology
 1ZW7 A;  2JVC A;  4IWP A;  3HM6 X;  2KDE B;  3U30 A;  4HHV A;  2COF A;  2FAZ A;  3DBL I;  1WXS A;  2KDF B;  2LAS A;  2FID A;  1P6S A;  4MT7 A;  1BTK A;  4B6H A;  4W9K A;  3A33 B;  3LJU X;  3A9J A;  2NS5 A;  1ZGU B;  3D8D A;  4MGZ E;  2N1V A;  4HAZ B;  2NBW B;  3TFM A;  2DYN A;  2GBN A;  5DI9 B;  2D9X A;  4WJQ A;  2LVO A;  5DIF B;  4K2O A;  2K8B A;  1X05 A;  2XK5 A;  4XWX A;  2DLW A;  2KMA A;  1KJT A;  3DXE A;  2N1W A;  4HDQ A;  2C5L C;  2L8J A;  2PJH A;  3FEH A;  3RUL A;  2GS0 A;  1FHX A;  3WIM A;  1J19 A;  1R4N I;  2DEN B;  2KK8 A;  2H7D A;  1EGX A;  2DX5 B;  4LDT D;  3A4S C;  2VSZ A;  1WM2 A;  4B6W A;  5G2N A;  3DQV A;  5GOW B;  3QWM A;  2RLO A;  3V60 A;  3ZTC A;  2COP A;  2L7R A;  4IFS A;  3L16 A;  4I6L B;  2JPH A;  1H4R A;  2Z0P A;  1HE8 A;  1OQN A;  2NVU I;  3M3J A;  1FXT B;  2KAN A;  3WA0 A;  2LZ6 A;  2KQS A;  2YT1 A;  4TQ1 A;  4TQ0 A;  4I6P A;  2KUP A;  1ZVR A;  3IVF A;  4W9H A;  3ZW3 A;  1Y8R C;  1P3R A;  4JIO U;  2ELA A;  1K8R B;  3GOE A;  2LVQ A;  2G35 A;  5LOP B;  4MY6 A;  3VOQ A;  1LXD A;  2G3Q B;  4FJY A;  3PEG A;  4FJZ A;  2MP2 A;  4H8S A;  3P7Z A;  1H8C A;  1FAO A;  1ZM0 A;  2WWZ A;  3DDC B;  1OMW A;  4MH0 E;  4WAA A;  2L3Z A;  4HCN B;  5LXH A;  1EAZ A;  2MA9 B;  5L81 A;  3QA8 A;  2RSG A;  1HB6 A;  2CHX A;  4RMA A;  2UYZ B;  2DTC A;  2KFJ A;  2FDQ A;  1WGU A;  2FJ9 A;  1WI0 A;  3R3M A;  3SDL C;  4RM8 A;  2COC A;  5J3Q A;  2K1F A;  4NAW B;  4JKF A;  3IBE A;  2LG1 A;  4ZRK A;  2N9E B;  2Z59 B;  3PLU A;  3A9K A;  2L00 B;  2DAF A;  3APC A;  2DZK A;  2P8V A;  3QAQ A;  4ZDV A;  1SIF A;  1W1H A;  4A3O A;  1WE6 A;  2EMS A;  2W2X C;  4GSW A;  5CHF A;  2WYQ A;  1H10 A;  2NMB A;  3MHS D;  2KMC A;  3ECI A;  4YON A;  4G3X B;  3ODO A;  2PE6 B;  4GPT B;  2O2V B;  1V5O A;  4KZC A;  2KOX A;  2EMT A;  2QKL A;  1WF9 A;  4AUQ C;  3UGB B;  3CST A;  1UEF A;  4FHK A;  5C79 A;  1KOT A;  5CHV C;  3OJ4 B;  1VD2 A;  3ULB A;  2LOX A;  4AJW A;  1RLF A;  2MW5 A;  2UVM A;  4EZK A;  2KN5 A;  3QAR A;  2LUL A;  4IW0 A;  1V49 A;  1KBL A;  1FHW A;  4HB0 B;  2C60 A;  5CX3 A;  1NTY A;  4ILJ A;  3JYU A;  1WIA A;  4A6F B;  3VHT C;  2D4Q A;  2WX0 A;  1V88 A;  2D11 A;  1EUV B;  3VH3 B;  1BT0 A;  2MBQ A;  1XX0 A;  3TO1 A;  2N0Y A;  1V5T A;  2MBB B;  2RD0 A;  2ASQ A;  3H1U A;  4BKG A;  5C5B A;  4DHZ E;  4NNJ B;  4PS3 A;  5IAA C;  2GCL A;  2DFK A;  1ZC3 B;  3P2B A;  2HTH A;  2LVP A;  4RM9 A;  3KSY A;  4GOC A;  4GDL A;  2KVR A;  3KUD B;  2KWV B;  3E9O A;  2JZ3 B;  5CTR C;  4WJ7 A;  2LYD A;  1D3Z A;  2LKO A;  1LW3 A;  3VUY A;  1WGR A;  2CB8 A;  2GCJ A;  4NY0 A;  1N3H A;  1WFY A;  3MTN B;  2P0H A;  2N9P C;  4C0A A;  1YD8 U;  3U7D A;  2AL3 A;  1C1Y B;  1OY2 A;  4PS7 A;  2GJY A;  1X1M A;  1FOE A;  1HB8 A;  1FGY A;  5LXI B;  3DVN V;  4MDK E;  1SE9 A;  1TXD A;  1WE7 A;  2AEH A;  1IPG A;  2KJR A;  5JVL A;  3VDZ A;  1PFJ A;  2MX2 A;  1FHO A;  3WAO A;  4F7U P;  2MWS B;  2EJ8 A;  2ZVN A;  3N3K B;  3MJW A;  4EKU A;  4TKN A;  3TL5 A;  1LFD A;  4KIK B;  1WMH B;  3IHP C;  4AJY B;  4GDK B;  2G4S A;  2OJR A;  1NTI A;  3B1L X;  3SD5 A;  2ABD A;  1WJN A;  2O6V B;  2C7N B;  2J0M A;  1WGG A;  1FGZ A;  4BKS A;  5D3W A;  2IY1 B;  4WQO B;  1RRP B;  2KD0 A;  4GU2 A;  4WJO A;  4W9J A;  4BKS D;  3HM3 A;  1E8Z A;  1GUA B;  3VQI A;  1DDM A;  4PS8 A;  1X1F A;  1R4M I;  3PRM B;  3M1I B;  4DK5 A;  1MPH A;  1U5D A;  5D3Y A;  5KQ4 A;  4F7Z A;  4HAY B;  3PHX B;  4NPN A;  3EPY A;  3L0W B;  4HAX B;  2M1M A;  2JT4 B;  2J0K A;  2V3S A;  4DHJ D;  3AUL A;  2LOZ A;  3CXB B;  2A4Z A;  1TTN A;  1OEY J;  3PVL A;  4DBB A;  1EF1 A;  1SHC A;  1WJM A;  3PTF C;  3V6E B;  3A4R A;  5JHH A;  1JRU A;  3APD A;  4ILH A;  1UNQ A;  2IZV B;  3PV1 A;  2DZM A;  3ONS A;  4GB9 A;  4IWO A;  2CR5 A;  3DBR I;  3WYF B;  4II3 B;  2LGY A;  5EDS A;  3B0A A;  5L83 A;  2KO3 A;  2R2Q A;  1AQC A;  5D27 A;  2RPQ A;  4FLH A;  2CY5 A;  1LB1 A;  3T06 A;  2OOB B;  3QJZ A;  4F7H A;  2JWZ A;  1UPQ A;  2XEW A;  5CLL B;  2BKF A;  5EFX A;  3VXW A;  3AJ4 A;  3S2A A;  5D6J B;  2I1J A;  2K8C A;  4WWP A;  4MGI E;  4EZL A;  1WJU A;  4JKA A;  3CSF A;  1XKE A;  2YT0 A;  4GMX B;  3H7P B;  3KH0 A;  4HAW B;  2M17 A;  1UEL A;  4G0N B;  4K7W A;  2HE7 A;  3AU5 A;  1FB8 A;  1GG3 A;  1P1A A;  3JSV A;  4EMO A;  2BCJ A;  5DHA B;  1LQB A;  4W9G A;  3M63 B;  1ZC4 B;  2Y8G A;  1V86 A;  1RRB A;  2REX A;  4HLE A;  2CQU A;  3PVW A;  4HAU B;  2BKR B;  3ODX A;  4WWN A;  4HPM B;  2YS3 A;  1UGM A;  1OQY A;  3VTW A;  1U5G A;  4HK2 A;  2K39 A;  1V6E A;  3ZRC A;  3VVW B;  4FN2 A;  2KLG A;  1WG7 A;  3GYO A;  3APF A;  3DOW A;  3NS8 A;  4MEM A;  3PT2 B;  1WX9 A;  2IY0 B;  3PGE A;  4A6K A;  2AL6 A;  3EC8 A;  4HPL B;  1GNU A;  1EF5 A;  1XOD A;  3V62 A;  1U5F A;  2W9N A;  5D94 A;  5C1Z A;  4P7I A;  1WJ6 A;  1KZ7 A;  3TMP B;  2D9Y A;  5CLQ B;  2HRJ A;  1G6J A;  1PMS A;  3BJI A;  3ML9 A;  2Z0O A;  3VAW A;  3RZF A;  1K5D B;  4BBN C;  1WGD A;  4KHB B;  3H6N A;  3W1S C;  2FCN A;  1WRD B;  2KC2 A;  1VBG A;  1KC7 A;  3T9L A;  3SUZ A;  3CF6 E;  2Y7B A;  4WVF B;  3ULC A;  4JKG B;  5J3T A;  2B3A A;  2QKM A;  2I5C A;  2K25 A;  3SYX A;  4CHK A;  2J0J A;  4Y94 A;  3NZU A;  4URK A;  4K7U A;  3VTU A;  4KDI C;  2UZR A;  4MJS B;  5JHA A;  3PP2 A;  5D7G A;  2DX5 A;  2BYV E;  4HVB A;  2FIF A;  3C0R B;  5J18 A;  1TZ1 A;  1Y5O A;  1V89 A;  1J8C A;  1E7U A;  5JH5 C;  1M7E A;  2D9Z A;  1TJ6 A;  2WH5 A;  3VH4 B;  2CRF A;  2MFQ A;  2ZNV C;  3DXC A;  1KZG A;  2NZ8 B;  4JLC A;  5E6O A;  4FBJ B;  3I3T B;  2PEA A;  1Q5W B;  3JVZ X;  1X86 A;  1WI1 A;  1WGY A;  1GC6 A;  4FUL A;  2MBO A;  1KLV A;  3ENB A;  4NQK E;  3PG7 A;  2N4F A;  2MSE D;  3WAM A;  2MBE A;  1PLS A;  4X57 B;  3M95 A;  4JGH B;  3QBV B;  2GBJ A;  1WR1 A;  3IFW B;  4M0W B;  2MRP A;  1IP9 A;  2COD A;  5JZE B;  3SBT A;  2PZ1 A;  2VKI A;  2KNB A;  3RUI B;  2H7E A;  4MGK E;  1K5G B;  4DDG D;  1NI2 A;  4MK0 A;  5J2R A;  3R7Q A;  2MLB A;  3QC8 B;  1UPR A;  2JUO A;  3SBG A;  1OTR B;  2W2W A;  1U4A A;  3HK0 A;  1C3T A;  3TW1 A;  1NVL A;  5E6P A;  5AZH A;  2YS5 A;  4HAT B;  1WZ3 A;  3VUX A;  1E90 A;  1V61 A;  2ELB A;  3HIZ A;  3UIN B;  4NAW A;  5AZG A;  2C9W B;  1MG8 A;  5FR6 A;  2LRW A;  4ASW C;  2ZCB A;  3H9D A;  2OTX A;  3KYD D;  4M8M A;  3T8M A;  2R09 A;  1T0Y A;  3ZUN A;  4EFO A;  4E3C A;  2YSZ A;  4JK7 A;  2R82 A;  1W1D A;  2YS1 A;  4TUU A;  2MDX A;  4HDO A;  3MPX A;  4B9K A;  2KFK B;  3GYP A;  3L54 A;  1ACA A;  3D8F A;  4PYU A;  2DYO A;  1WX7 A;  2K2U A;  2RQ1 A;  3UIO B;  2ZEQ A;  1Q67 A;  2O2V A;  2KTR B;  1TQZ A;  2K6Q A;  2IYD B;  3DBH I;  2CU1 A;  2L76 A;  2IFS A;  1CMX B;  2ZNV B;  2FUH B;  4DWF A;  4IM3 A;  4NJ6 A;  2DYB A;  4ICU A;  4OVV A;  1V81 A;  3PRE A;  4YL8 A;  1ZSQ A;  4G50 A;  3KZ1 A;  3UZT A;  2KTF A;  1S1Q B;  3H7S A;  4A6F A;  4Z2N A;  1I7A A;  2Y5B B;  2DZI A;  4CO7 A;  4HAV B;  5HE0 A;  3ZTD A;  3RCP A;  2YRY A;  2LBB A;  1WXA A;  2IO1 B;  1E8Y A;  2R0D A;  3RT3 B;  2GMI C;  4IC7 B;  5KHQ A;  4IG7 B;  1MK7 B;  3QHT A;  2Z0E B;  5JLJ B;  3EHV A;  5D3V A;  1EO6 A;  2JF5 A;  2K2J A;  2IO2 B;  3A1Q B;  3E9L A;  2FJL A;  3SV1 A;  1OGW A;  2ADZ A;  4JK8 A;  1UZX B;  4JKC A;  1E8W A;  4KSK C;  5D3X A;  4M8N A;  2EC1 A;  1KM7 A;  1L7Y A;  2JRI B;  4XC2 A;  1E5W A;  2JZZ A;  1WGH A;  4PNK A;  3ZKJ C;  3U8Z A;  1KI1 B;  2KWU B;  3VFK A;  4WJP A;  4EJN A;  5LLI A;  1M7R A;  5DHF B;  2N7E A;  2LRU A;  4MSQ B;  3A9J B;  2KDI A;  1P98 A;  2IYB A;  2IBI B;  3QIJ A;  2ZPN A;  1WM3 A;  3FP5 A;  2HJ8 A;  3KRX A;  4K7S A;  4ZYN A;  4KDL B;  1WY8 A;  2V76 A;  3EFU A;  1M94 A;  1U5E A;  2LGD A;  2I1K A;  3PLV A;  3RD2 A;  1NBF C;  2XK5 B;  4JKD A;  3QQ8 B;  1XT9 B;  1UNR A;  3W1Y A;  1ST7 A;  1Q1O A;  1E8X A;  4FHJ A;  4LDT B;  3JW0 X;  2RVB B;  5KHO A;  1UH6 A;  3K9P B;  1OEY A;  2W2X D;  2V1Y A;  5DPR A;  3EEC A;  4LJO B;  4LCD E;  3PHW B;  4ANX A;  4FAD A;  4KIK A;  1WMH A;  4XX5 A;  2X0S A;  4GDK A;  4WSF A;  4AOF A;  3UQB A;  4PQ0 A;  2KJ6 A;  1DDW A;  1TBE A;  2MWN B;  3HQC A;  2O6V A;  1TGZ B;  1L2N A;  3ODW A;  5C23 A;  3KY9 A;  4W9C A;  2O6V D;  1P5T A;  2NBV B;  3ZNH B;  3TIX A;  4CHJ A;  2JRH A;  2CS4 A;  2KGX B;  1J0G A;  3OLM D;  3UIP B;  4JK9 A;  1MIX A;  2D10 A;  2L2I A;  1BAK A;  3B08 A;  4JKH A;  2L0T A;  4GGQ A;  5J17 A;  1J0W A;  3G9W A;  3RZW C;  4KHA A;  2N7D A;  2VRR B;  4B95 A;  1A5R A;  1Z5S B;  4J6I A;  1VCB A;  5AEK B;  3ML4 A;  5C6R A;  5L95 C;  2CHW A;  2GOW A;  5KCV A;  3KYC D;  2UWQ A;  3FSS A;  2ZZP B;  2KJH B;  3OJ3 A;  3AXC A;  4FJV B;  2ZCC A;  2MP2 B;  1IYF A;  3PVU A;  4BBK A;  3F0W A;  1XCG A;  5HE2 A;  4BFR A;  2MKR A;  5G55 A;  3V61 A;  2X18 A;  3O65 B;  4N9F 4;  3RYT A;  3L10 B;  2WX1 A;  4HWI B;  2LD9 A;  1WR6 E;  3L13 A;  1YX5 B;  4GZU A;  3ENE A;  1SGH A;  1F9J A;  2C7H A;  4AP4 C;  1YJ1 A;  2HD5 B;  2DAJ A;  2Q13 A;  4ZRJ A;  1V5P A;  4BKT A;  4DX8 A;  4NJ7 A;  3UQA A;  3TJP A;  1UD7 A;  4W9I A;  3VUW A;  2ZVO A;  3DPD A;  3FM8 C;  2DN6 A;  1XR0 B;  3DCG A;  1UBI A;  1QC6 A;  3M62 B;  1WH3 A;  3TCA A;  2M0X A;  3A9K B;  2UZS A;  2VRW B;  1X11 A;  3PRP B;  4W9E A;  2JY6 A;  1YQB A;  3O96 A;  4HCP B;  1RJ2 A;  4IOY X;  4ZRI A;  3PZD A;  5AZF A;  3ZNG C;  1DIK A;  2L1C A;  2P0D A;  3TBL D;  5E6N A;  1X1G A;  4BBN F;  2Y8F A;  3V5W A;  2L05 A;  1WXV A;  1GGO A;  3H7P A;  4MSM B;  3X23 A;  3PSE B;  2DYM A;  3F5R A;  2KXJ A;  1Z87 A;  2BYE A;  3NZS A;  2J59 M;  3ZNZ B;  4FA6 A;  5IA7 A;  1V9J A;  3ZRF A;  3DXD A;  2YF0 A;  4TYZ A;  3TVV A;  4K2P A;  1AAR A;  2DZJ A;  1AWE A;  1PQS A;  2OQB A;  4ICV A;  5J3Y A;  2MQJ A;  1I42 A;  2GBM A;  5DCN A;  2IO0 B;  1Q0W B;  1DRO A;  2K00 A;  2DIK A;  2NBU A;  2XBB C;  1P0R A;  1JDE A;  1ISN A;  2CAY A;  2L0F A;  2D3G A;  2PE9 A;  5C5B B;  4ANV A;  3HW2 B;  4Z2M B;  1P3Q U;  2DHJ A;  3ZVV A;  3FLV A;  3WAL A;  4JKB A;  3N7C A;  2DYQ A;  2ROZ B;  2FCQ A;  4KV2 A;  4KHO A;  2EKE C;  2P0F A;  3BIN A;  2HTH B;  2ZPY A;  2JP2 A;  4EEW A;  5GMV A;  3KW5 B;  2WDT B;  1BWN A;  2J7Q B;  3HHM A;  2BF8 B;  5D2M B;  4IWQ A;  4D0N B;  2LGX A;  4GDL B;  4HB4 B;  4K81 A;  3ML8 A;  4BOS C;  3DBS A;  1HBK A;  4MEL A;  4GIV A;  1E7V A;  2G45 B;  4W9L A;  2KX3 A;  3ZIM A;  5HE3 A;  2D07 B;  2COA A;  1V80 A;  3LJ3 A;  3GZN I;  2NR2 A;  1W1G A;  3PSC A;  3E66 A;  4NQL B;  1WX8 A;  4JKG A;  1WJ1 A;  1U29 A;  2BPS A;  3PRZ A;  2ZJD A;  4HB2 B;  2D9W A;  3ZVR A;  2RNR B;  4W9F A;  4KVG B;  1DYN A;  4E74 A;  4IM2 A;  3OAN A;  2LUE A;  3V6C B;  3Q3J A;  1UBQ A;  4HB3 B;  1DDV A;  2I5F A;  4A3P A;  2XQN M;  4MJS A;  2Z0D B;  5LON B;  1XD4 A;  4GN1 A;  4ANU A;  3LDZ E;  2FCM A;  2BYF A;  2AWT A;  2LXC A;  3QX1 A;  1RFA A;  2KDB A;  2RR9 A;  1NTV A;  2DKP A;  3Q3F A;  4F1S A;  2KZR A;  2KKC A;  3N30 A;  4IUM B;  3KUZ A;  1QZE A;  5FI0 A;  2MBH A;  3X0W A;  3WAN A;  3A8P A;  1DBH A;  4EUT A;  4ILG B;  4TV3 A;  3BY4 B;  1IRS A;  1UNP A;  5CHW A;  4OVU A;  2KHW B;  4WJN A;  4MGY E;  1I35 A;  2KCJ A;  3R66 C;  1MKE A;  5JHG A;  2M14 A;  2R2O A;  2BWE S;  1WGQ A;  2DHK A;  3KRW A;  4DBG A;  3SNH A;  5DPW A;  3ZDM C;  2RSU A;  3CIK A;  4II2 B;  4DHZ B;  4A5K A;  3ZNI D;  4F8C B;  3CMM B;  1WVH A;  1ZKH A;  4CYE A;  3QCA A;  5DPT A;  4JL9 A;  1V2Y A;  2RGF A;  2M8S A;  2E2X A;  2LJ5 A;  4DXA B;  4DHJ B;  1MIZ B;  2D9V A;  1NU2 A;  2BWF A;  2CKH B;  1VBH A;  2K8H A;  2GBR A;  3QK0 A;  4XZ4 A;  4IAP A;  3IG3 A;  2DHZ A;  1WJ4 A;  2DX1 A;  4K17 A;  3A98 B;  5HKH A;  3AI5 A;  2AYO B;  1Z2M A;  2A5U A;  4EOY A;  2YLM A;  1GJZ A;  1MAI A;  2FNJ B;  1P9D U;  4A6H A;  5DH9 B;  2KC1 A;  1LM8 B;  4BVU C;  3OAW A;  4AWJ A;  4EZJ A;  2BGF A;  2KQ7 A;  5C16 A;  4KAX B;  5FI1 A;  2KWC A;  3KVF B;  3W1S A;  3QWZ B;  4MM3 A;  3D32 A;  2QHO A;  2NPT B;  2CY4 A;  1BTN A;  3DVG X;  5JP4 A;  3K9O B;  4KZ0 A;  2IO3 B;  2M4N A;  3NY5 A;  2V4L A;  3NHE B;  2C7M B;  3DVG Y;  1QQG A;  3DVN U;  2ROV A;  4W9D A;  1Y19 B;  3P6A A;  4NSW A;  3UF8 A;  3ZLZ A;  1YX6 B;  3MDB C;  2DHI A;  3L17 A;  3RCZ A;  5DPS A;  2KX0 A;  5BO4 B;  4F7G A;  2GBK A;  3ZDT A;  2LWP A;  3PPA A;  2KFK A;  1XD3 B;  2N23 A;  3SU8 X;  2G4D B;  3VIA A;  1EVH A;  1U27 A;  5TR5 A;  4IM0 A;  3D8E A;  2RGN B;  2KTR A;  4ANW A;  2LI5 A;  2FCS A;  4JQW C;  3WAP A;  2CHZ A;  1NDD A;  1S3S G;  4BOZ B;  3AU4 A;  2DKQ A;  4DX9 0;  4DDI D;  1U2B A;  3ZO5 B;  4GXB A;  4WWO A;  1MK9 B;  4E71 A;  4HJK A;  2M38 A;  2NCN A;  3JSV B;  1WXM A;  5JHB A;  2KLC A;  4K1R B;  4A20 A;  1WYW B;  2D2Q A;  1GC7 A;  5IJM A;  2DA0 A;  1XQQ A;  2YVC A;  4KSL C;  4G11 A;  1RAX A;  3ALB A;  3PS6 A;  2PPH A;  3E9P A;  3VTV A;  1V5M A;  1V5U A;  5KQ1 A;  2K6D B;  1WZ0 A;  4L6E A;  3R7R A;  2RUK B;  3A8Q A;  3L08 A;  4LJP B;  4HXD A;  2MCN B;  3NSU A;  5HE1 A;  2N9X A;  3SO6 A;  2NPT A;  3NOB A;  4CHM A;  3A1Q A;  2JXX A;  4GMV A;  1B55 A;  2LXA A;  4I6N B;  3KUC B;  3SHQ A;  2Z0Q A;  1YIW A;  4PYZ A;  1I2H A;  4JKE A;  3N32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...