2AEHA

Focal adhesion kinase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of the FERM Domain of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2aehA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2aehA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2aehA01
4K7WA 2L05A 2MX2A 4DWFA 3M3JA 3PSCA 2B3AA 2DAJA 3WANA 5JHBA 2D9ZA 2ZNVB 1W1HA 3AU4A 1K8RB 2XBBC 4W9IA 3MTNB 5D94A 3ML4A 1RFAA 1ZKHA 1MK7B 4GU2A 4MSMB 2RGFA 1K5DB 4WWOA 1Y8RC 4LJOB 3P7ZA 2JVCA 3PRPB 1PMSA 4PS3A 2R0DA 2MA9B 1FHXA 2MLBA 3H6NA 4B95A 5LLIA 4A3PA 5LXHA 3V62A 3OJ3A 2CODA 2LI5A 1U2BA 2AEHA 3EECA 3PT2B 2UZRA 2R2QA 4DK5A 1WM3A 1AARA 2JXXA 3UIPB 1B55A 5JHHA 3TIXA 4HB2B 3PRZA 3L08A 3KYDD 2DZKA 4TUUA 3L13A 2HJ8A 2G35A 2KTFA 2KUPA 3NZUA 5KHQA 4IM2A 2DZIA 4GPTB 2ZPNA 2NMBA 3A8QA 3TL5A 1MIXA 1TGZB 3DVGX 1ZVRA 4MGYE 3LDZE 1V89A 4KSKC 5JHAA 2MBOA 3ZNGC 5KQ1A 2IO2B 4EEWA 3FP5A 5D3VA 2JUOA 3RCPA 1WX7A 2N1WA 5EDSA 5CLLB 2YT0A 4TYZA 2DENB 1UZXB 3VFKA 1OGWA 1WYWB 2WYQA 4K7SA 4GZUA 2DZJA 3LJUX 3PREA 3ZNID 3M95A 1DBHA 2N0YA 2W2XC 2LRWA 3A98B 1U5FA 1J0GA 4A6FA 1WGRA 3M62B 5D3YA 3H7PB 2IFSA 3B08A 3PHXB 1V5UA 3UINB 2N9PC 1Z2MA 2KD0A 3ZNHB 2ZEQA 2YS1A 2D9VA 4WSFA 3O65B 2XQNM 1WJMA 5JHGA 2GOWA 3ZVRA 3RULA 3KRXA 3A9KA 4CHJA 3VXWA 3QK0A 2L0TA 2P0FA 2LOXA 1WR6E 2LGYA 1UNQA 2DHKA 5D2MB 2RVBB 3A4SC 1K5GB 1MK9B 1RRPB 4WWNA 2KN5A 2K6DB 4ANWA 3ZO5B 5HKHA 1KM7A 1I2HA 2MWNB 2ZVOA 3DXCA 1Z5SB 5C16A 1KOTA 2LBBA 3CXBB 2JPHA 1WZ0A 3P2BA 2LUEA 5C79A 2JY6A 2E2XA 2D07B 2I1JA 4TV3A 4MH0E 1TXDA 4PYZA 5FR6A 1MPHA 2IYDB 1FHOA 1E8YA 3ZNZB 4HCNB 2H7DA 2D3GA 2KDIA 4EFOA 3JW0X 3OLMD 3VOQA 4GB9A 4DBBA 3T06A 3M1IB 2GBMA 1ZC3B 3SUZA 3GOEA 1LXDA 3BY4B 3RT3B 5GMVA 3Q3JA 1JRUA 4I6PA 3QA8A 4BKSA 2DKQA 3OAWA 1DYNA 1FAOA 3ZVVA 1WFYA 3K9PB 3KSYA 2MBHA 2D11A 1WGDA 1ST7A 1NVLA 2DYNA 4KDLB 4DX8A 1IYFA 5DPRA 4LDTD 3IFWB 3U8ZA 5HE2A 1OTRB 2KNBA 1J0WA 3V5WA 4K7UA 3QWZB 1XR0B 4GMXB 4PYUA 5LONB 1M7EA 3NS8A 2R09A 4HJKA 2KVRA 2N9EB 4NPNA 5D7GA 2Z0QA 2C5LC 2LYDA 3DBLI 3QCAA 4HK2A 2J0MA 1MIZB 2IO3B 1TQZA 3DBRI 2D9XA 3D8FA 3W1SC 2Z59B 3DVNV 3R3MA 4W9JA 2KFKA 4FJVB 3UGBB 4J6IA 1E8XA 3VAWA 5DPTA 4NJ7A 3QQ8B 2COCA 2K2UA 3TJPA 4URKA 1HE8A 1OQNA 4E74A 3DDCB 1NTIA 1WMHA 1E7VA 2KANA 3N32A 1WGQA 3FLVA 5FI1A 1VCBA 2I5FA 2L76A 2Z0PA 1LB1A 2OOBB 1IPGA 1UPQA 2BGFA 5G55A 1L7YA 3EPYA 5KHOA 3PLUA 4EUTA 1AWEA 1WMHB 4W9GA 5DCNA 3L54A 3QJZA 2NCNA 4OVVA 4DDGD 3PVWA 2CR5A 2JF5A 2FAZA 2JRIB 2DYMA 5IAAC 2V1YA 2LGXA 3C0RB 2FIDA 4EJNA 3VQIA 2K8BA 1XKEA 2IYBA 3R66C 3BINA 4M0WB 3UF8A 1UGMA 3PS6A 5CX3A 3JSVA 2EMTA 3AU5A 2G4DB 3AXCA 1V80A 2L2IA 1RAXA 3NSUA 1GC6A 4B9KA 2LRUA 1U4AA 4IWOA 2YVCA 1XD4A 5AZHA 2COAA 3ZTCA 4ANUA 3JSVB 1YX5B 4HAXB 4GDLA 1WJNA 4HAVB 4BOSC 3B0AA 1U5EA 1EGXA 4IUMB 1RLFA 2DHJA 2M17A 3TFMA 4NAWA 2YS3A 3FSSA 3QC8B 2KZRA 3CSFA 1A5RA 1X05A 3LJ3A 2LASA 1P6SA 4JIOU 2PZ1A 4GDLB 2BCJA 2COFA 2K8HA 2UYZB 2ZJDA 4WJNA 4YONA 2HTHA 1FGZA 3VUYA 3L0WB 3EC8A 3TO1A 2GJYA 1WJ6A 4NAWB 1FOEA 2O2VA 3ML9A 4XZ4A 2DKPA 3DBHI 2FJ9A 2ZZPB 3FEHA 3N3KB 3U30A 3DPDA 4K1RB 4K2PA 1WE7A 2M4NA 2IY0B 5D3XA 3APCA 4KSLC 3PPAA 2RQ1A 1I42A 2C7HA 4MK0A 4H8SA 3DOWA 5CHFA 2HTHB 2K25A 4X57B 2NBWB 1GNUA 1KLVA 2KWVB 1WXAA 2C60A 2JRHA 3H9DA 2AYOB 4FLHA 4G50A 2O2VB 2M14A 3QBVB 3PSEB 1OQYA 2KKCA 2DZMA 4G3XB 2JT4B 1MKEA 1UBIA 2J59M 4HAYB 2QHOA 4CO7A 3SNHA 2GBKA 1ZC4B 4MDKE 2N4FA 2GCJA 3D8DA 2YT1A 2IZVB 2WX1A 2LULA 5KCVA 3SV1A 5DHAB 4IOYX 4MT7A 3D32A 1MAIA 1QQGA 2LOZA 5DHFB 5JP4A 1GJZA 4F8CB 2KGXB 5L83A 1XCGA 4PS7A 4NQLB 1TTNA 3ULBA 2KQ7A 4HDQA 2DTCA 2NR2A 1HB6A 2ELAA 2MRPA 3V60A 2ADZA 3PP2A 2BPSA 3KRWA 5CTRC 4C0AA 5J18A 3QHTA 5TR5A 4DHJB 2FCQA 2J0KA 4BKSD 2RPQA 2BWES 2AL3A 1EVHA 3H7PA 2YSZA 3NHEB 4HAZB 1PFJA 2C7NB 1WXSA 2QKMA 4HB0B 4ICVA 2MSED 3MHSD 4RMAA 3DXDA 3O96A 4GSWA 2LXAA 1Y5OA 3F5RA 1V2YA 4KZCA 4A20A 2DHIA 2VRWB 3QAQA 3UQBA 1E90A 3AJ4A 5D27A 1OMWA 1SGHA 2DYQA 2K8CA 3ZKJC 4D0NB 5CHWA 1TJ6A 1ACAA 1Q1OA 3AULA 4FBJB 4HATB 1G6JA 2FCSA 2XK5B 3RZFA 3BJIA 3VUXA 2J7QB 2EJ8A 4K81A 3EHVA 2DYOA 4II2B 4HPMB 4MGIE 4IM0A 3ZRFA 2VRRB 4KAXB 2FJLA 1J8CA 4CHMA 4B6HA 3M63B 1ISNA 3UZTA 4KHOA 1V61A 2CRFA 4XX5A 4II3B 1S1QB 4M8NA 3ODWA 2M1MA 2DFKA 2GMIC 2Y5BB 4BFRA 2BKRB 4ZRJA 1L2NA 1Z87A 3P6AA 2LVQA 5E6NA 4FHJA 2RD0A 4PNKA 4GDKB 1W1DA 1OY2A 3NZSA 2KDEB 2CQUA 4WJPA 1CMXB 3Q3FA 4XWXA 5EFXA 4ZDVA 1LW3A 2CKHB 3KYCD 2C7MB 2GS0A 3SDLC 2BKFA 1BTKA 1WX8A 1UELA 1XODA 2P0DA 4BKGA 2BYVE 2ABDA 3CMMB 2XEWA 2R2OA 4JLCA 2PPHA 1SE9A 4MSQB 1OEYA 1R4NI 2D4QA 2KWUB 3GYPA 2RR9A 2N9XA 4WAAA 1E7UA 3U7DA 4G11A 1LFDA 4KV2A 1WJ1A 1EO6A 4WQOB 1WJ4A 4AP4C 1GC7A 3MPXA 2A5UA 3PVLA 4AJYB 5C5BA 2Y8FA 3HQCA 4K17A 5KQ4A 2CS4A 5C6RA 4FJZA 2YRYA 4DBGA 3ZDMC 1WY8A 4W9EA 3GYOA 2KLGA 2AL6A 3DQVA 1FHWA 2A4ZA 4L6EA 4IG7B 2DX1A 3HM6X 3WALA 3ZDTA 2NPTA 2ZCBA 5C5BB 3PZDA 3RCZA 2LGDA 2LD9A 3WIMA 2CU1A 2C9WB 2YS5A 1P9DU 1IRSA 2D2QA 2DA0A 4IAPA 2Z0EB 4G0NB 4N9F4 2IO1B 3R7QA 3QIJA 2MP2A 3H7SA 2O6VA 4HVBA 4M8MA 4GMVA 4AJWA 2NPTB 2EMSA 5HE0A 4RM8A 1BAKA 3SU8X 1NDDA 2KQSA 2ZNVC 4GOCA 3IVFA 1XT9B 2FNJB 2MP2B 2O6VB 3K9OB 3OJ4B 2LWPA 2BF8B 2MQJA 4RM9A 2ZVNA 3ODOA 1YQBA 1PQSA 4HHVA 4WWPA 5IA7A 2HRJA 4EZKA 4F7GA 2G3QB 4KDIC 4IFSA 1V5MA 3VH3B 1YX6B 1M7RA 5D3WA 1U29A 1WXMA 4IWQA 4DX90 2N7EA 4YL8A 3WAOA 2K6QA 3PVUA 4W9FA 1E8ZA 1J19A 2LG1A 4W9CA 1U5GA 2KX3A 3DXEA 4GGQA 1P5TA 3WA0A 2KMAA 2DHZA 3UQAA 3TCAA 1D3ZA 4HDOA 3HM3A 4FA6A 3OANA 2MFQA 2COPA 1WXVA 3KZ1A 1DDMA 3NY5A 4ASWC 2D9YA 3KUZA 4F7ZA 5CLQB 1NI2A 3T8MA 3JVZX 4WVFB 2IY1B 5AZFA 4HWIB 1V5PA 2DAFA 4DHJD 4WJOA 5LOPB 3T9LA 4DHZB 1PLSA 2CHWA 3A4RA 2KJHB 1XX0A 2GBRA 1ZSQA 3CF6E 3ZUNA 2KTRB 4E3CA 2L1CA 4GN1A 5J3QA 4FN2A 4HLEA 1S3SG 2NZ8B 2D10A 1TZ1A 2K1FA 4Z2NA 4IWPA 4MELA 1UNPA 1DDVA 2WH5A 3QARA 2N1VA 3ENEA 3ONSA 4HPLB 3L17A 5DPWA 4A3OA 4HB3B 3A1QB 1KI1B 4P7IA 4TQ0A 2W2WA 3ZIMA 4MM3A 1U5DA 1SHCA 5E6PA 1IP9A 5AEKB 1WZ3A 3SO6A 5HE3A 2DX5A 2KLCA 2JP2A 3VUWA 4EOYA 4W9HA 2EC1A 1M94A 2PE6B 4BKTA 2K2JA 1RJ2A 3AI5A 2KMCA 3EFUA 4GIVA 2G45B 4BBNF 4I6NB 1BT0A 4A5KA 1NTVA 3CIKA 1AQCA 3A9JB 2DX5B 2UZSA 1EF1A 4W9LA 2RSUA 2ELBA 5J2RA 5DI9B 3WAMA 3VTWA 2IBIB 1UPRA 2KX0A 2DLWA 4I6LB 2CB8A 4ICUA 4MGKE 2Z0OA 1H4RA 2MWSB 4ANXA 2WDTB 2OQBA 2BYFA 4EMOA 1NBFC 1WF9A 1WVHA 4W9DA 2NS5A 1BTNA 1RRBA 4TKNA 2FDQA 2YLMA 5IJMA 1WH3A 4PS8A 2RGNB 1EF5A 4LCDE 3PG7A 3SYXA 2ROVA 1DROA 1I7AA 4A6KA 4HAUB 3VDZA 4ZYNA 4HAWB 3RZWC 3ZRCA 1WIAA 2Q13A 4WJ7A 3FM8C 3ZTDA 3PLVA 1XD3B 3H1UA 4F7HA 4CHKA 2RLOA 1X1MA 4NQKE 1VD2A 1X1GA 1UD7A 1YIWA 3DBSA 4K2OA 1P0RA 5JH5C 2K00A 2X18A 1X11A 3B1LX 4KHBB 4LJPB 1XQQA 2ZPYA 2MBBB 3HW2B 3VTUA 5CHVC 2W2XD 4FJYA 3IG3A 1HBKA 1R4MI 1WGYA 4A6HA 1V6EA 2L0FA 2KHWB 1OEYJ 2GBNA 4AWJA 2M0XA 4IM3A 3SD5A 2FUHB 3IHPC 1QC6A 2GBJA 2V3SA 3CSTA 2KJ6A 4AOFA 2VSZA 3KUCB 1WG7A 4KIKA 2XK5A 5HE1A 1E8WA 2AWTA 5DPSA 4EKUA 3KH0A 1I35A 1Y19B 1HB8A 2LJ5A 3R7RA 3ZLZA 4IC7B 3HHMA 4KVGB 1WGUA 5BO4B 2PEAA 3V6EB 4GXBA 4FHKA 1P3RA 3V61A 2RNRB 1EAZA 2ASQA 2KCJA 3I3TB 4KIKB 4ANVA 4JL9A 1V81A 2LZ6A 2O6VD 1Q5WB 3WAPA 2MBEA 1Q67A 3G9WA 2L00B 4A6FB 2Z0DB 5L81A 2H7EA 2KDBA 2FCMA 4GDKA 2P0HA 3APFA 2DYBA 2N7DA 2KDFB 2I1KA 3KVFB 2MW5A 2NBVB 2KJRA 2OJRA 1V88A 4Y94A 1MG8A 2DN6A 2YF0A 3NOBA 5J17A 5L95C 2GCLA 1LQBA 1X1FA 3A9KB 3GZNI 3QX1A 2VKIA 3MDBC 2M38A 1F9JA 1DDWA 1UH6A 3ODXA 2KFJA 4BOZB 4E71A 2CHZA 3VH4B 1FB8A 2J0JA 4F1SA 4ZRIA 1WI0A 1V9JA 3L16A 1ZM0A 1WE6A 4Z2MB 2G4SA 3PV1A 2MBQA 2N23A 4DXAB 2I5CA 2JWZA 2WWZA 2HE7A 3QWMA 3D8EA 5J3YA 3S2AA 1WM2A 1QZEA 2KC1A 4IW0A 3HIZA 1Q0WB 1KJTA 3IBEA 3WYFB 3JYUA 2LVOA 4OVUA 2REXA 3X0WA 2L8JA 4B6WA 3N7CA 2V4LA 4JGHB 1V86A 1E5WA 2KWCA 3APDA 1FGYA 2V76A 1UNRA 1N3HA 4ZRKA 4NSWA 2MDXA 4DHZE 3A8PA 2PJHA 2L3ZA 5JLJB 2JZZA 3DVNU 3RD2A 1TBEA 3TBLD 3PGEA 3RYTA 4AUQC 3ECIA 4MY6A 4MEMA 1SIFA 2ROZB 4F7UP 1P3QU 2FCNA 3VTVA 5DH9B 4FULA 4NJ6A 2LXCA 4NY0A 1WX9A 2K39A 1WRDB 2CAYA 2L7RA 4MGZE 4BBNC 4KZ0A 2JZ3B 2PE9A 3F0WA 2NVUI 2FIFA 5J3TA 2OTXA 1GG3A 3KY9A 5C1ZA 4KHAA 1BWNA 4FADA 3DCGA 3X23A 1X86A 3SHQA 2KC2A 2RSGA 2QKLA 3VHTC 2D9WA 1W1GA 4MJSA 2Y7BA 2NBUA 3VIAA 3HK0A 2CHXA 2UWQA 3DVGY 1WGHA 2M8SA 4W9KA 2IO0B 3L10B 4PQ0A 2KFKB 3N30A 3ZW3A 2CY5A 3TVVA 1H8CA 3PEGA 4EZLA 3ML8A 4MJSB 2KK8A 1LM8B 4HXDA 3PTFC 2RUKB 3ULCA 4JQWC 4CYEA 1WR1A 4BVUC 2W9NA 4BBKA 5G2NA 5DIFB 3VVWB 1WI1A 3PRMB 1EUVB 3W1YA 2MKRA 3A33B 5LXIB 3PHWB 1YJ1A 2BWFA 2KTRA 1H10A 2UVMA 1V49A 2LVPA 1FXTB 3RUIB 2KOXA 4NNJB 3KUDB 2HD5B 1KZ7A 2CY4A 4DDID 4EZJA 2BYEA 3V6CB 1C3TA 3TW1A 1UBQA 5GOWB 2WX0A 1ZGUB 5FI0A 4WJQA 4TQ1A 4HCPB 1P98A 2EKEC 2KO3A 4XC2A 2LKOA 1T0YA 2MCNB 3A1QA 1YD8U 5JZEB 1GUAB 3UIOB 3MJWA 1NU2A 1NTYA 1UEFA 3TMPB 2P8VA 1U27A 1ZW7A 5C23A 3W1SA 5AZGA 1KZGA 3KW5B 1P1AA 2KXJA 1C1YB 1V5OA 4LDTB 1V5TA 3ALBA 1WGGA 5E6OA 4HB4B 3A9JA 5D6JB 1WJUA 2ZCCA 2Y8GA
chains in the Genus database with same CATH superfamily
4K7WA 2L05A 2MX2A 4DWFA 3M3JA 3PSCA 2B3AA 2DAJA 3WANA 2KIGA 4Q2JA 3RNEC 5JHBA 2D9ZA 2ZNVB 1W1HA 1P7EA 1E7PB 2VZKB 1TKGA 1YJJA 3AU4A 2BVCA 1K8RB 3B77A 4ACFA 2XBBC 4EE2A 1YQ3B 1SE2A 4W9IA 3MTNB 5FKAC 5D94A 3ML4A 4PT5A 2WXHA 1RFAA 1WSPA 1ZKHA 1MK7B 4GU2A 3SBGA 2INNE 4MSMB 2RGFA 5IN7A 1K5DB 4WWOA 4A55A 1Y8RC 4LJOB 1I4PA 3P7ZA 2JVCA 4B0EA 3PRPB 1PMSA 4PS3A 2R0DA 4HRSA 2MA9B 1FHXA 1PGXA 5IOIA 2MLBA 3W5VB 3H6NA 4B95A 5LLIA 4KKIA 3AN1A 1T0QC 4A3PA 5LXHA 3V62A 4JWSC 3OJ3A 2CODA 1JQ4A 1SEBD 2LI5A 1U2BA 2AEHA 3EECA 3PT2B 2UZRA 2R2QA 1E10A 4DK5A 4JPSA 1I4GA 1WM3A 1AARA 3W2DA 1ZPSA 2V0GA 2JXXA 3UIPB 1B55A 5JHHA 3TIXA 2YT2A 4HB2B 3PRZA 3L08A 3KYDD 2DZKA 3TUOA 4TUUA 3L13A 1MFWA 1YN4A 2HJ8A 3AEFB 2G35A 2K8EA 3RI7C 4KHBA 2BB6A 2KTFA 2KUPA 3NZUA 4OZBA 5KHQA 1L0YB 1N63A 2SEBD 4IM2A 2DZIA 3MC8A 1T6BX 3CIRB 3VR9B 3IAS1 4GPTB 2ZPNA 4C80A 3HSAA 2NMBA 3A8QA 3TL5A 3U52E 1MIXA 1TGZB 3DVGX 1ZVRA 4MGYE 3LDZE 2KVZA 1V89A 4YTMB 4KSKC 2EKIA 5JHAA 2MBOA 3ZNGC 5KQ1A 2IO2B 3BYYB 2I2YA 4EEWA 3FP5A 5D3VA 2JUOA 1J7CA 3HVDA 4RH6A 2WXLA 2M0AA 3RCPA 1WX7A 2N1WA 5G5GA 5EDSA 1JWSD 3IT4B 5CLLB 2KUQA 2YT0A 4TYZA 2DENB 1UZXB 5E6JA 3VFKA 1OGWA 1WYWB 5AUKA 2WYQA 4K7SA 4GZUA 2DZJA 3LJUX 3PREA 1JWMD 3ZNID 3M95A 1DBHA 3N1YC 2N0YA 2BTEA 1MVKA 3P4PB 3LXFA 2W2XC 2LRWA 1U5FA 3A98B 1J0GA 5TSSA 1N60A 1R7SA 3NWDA 4C00A 4A6FA 1WGRA 3RNCC 3M62B 3MJ5A 5D3YA 2E3TA 3T3OA 3H7PB 2WDRB 3ZJVA 2IFSA 4RF1A 3B08A 3PHXB 1V5UA 3UINB 2N9PC 1Z2MA 2KD0A 3ZNHB 2ZEQA 2WXPA 1IGDA 3P4RB 3Q3MC 2YS1A 3EFCA 2D9VA 4WSFA 3O65B 2XQNM 3TEZA 1WJMA 5JHGA 2GOWA 4N59A 1ROEA 3ZVRA 3RULA 2X0SA 4HPPA 3TEWA 3KRXA 2PVGC 3A9KA 2ICIA 4CHJA 3NS1A 4C4VA 3VXWA 2MEKA 1PFDA 4QJ5B 3N1XC 4IDIA 2QCZA 3QK0A 5HI1A 2L0TA 4LNKA 2P0FA 2LOXA 1WR6E 2LGYA 1AYFA 1UNQA 1XXGA 4RGNA 2RMMA 3ENBA 2N9LA 2DHKA 3I9V1 5D2MB 2RVBB 2CJOA 1FNVA 4P1BC 3A4SC 1K5GB 1MK9B 1RRPB 2LFIA 4WWNA 3SFEB 2QDFA 2L52A 4C4VB 2KN5A 2K6DB 4ANWA 3ZO5B 3NVVA 5HKHA 1KM7A 2JYTA 1N6ZA 1TS2A 4DIXA 1I2HA 2MWNB 2ZVOA 3DXCA 1Z5SB 5BMIA 5C16A 4LNNA 1KOTA 2LBBA 3AE1B 4N58A 5HG2A 1C77A 3E56A 3CXBB 2JPHA 1WZ0A 3P2BA 1EWYC 2M56B 1WWTA 2LUEA 5C79A 4RCOA 2JY6A 2E2XA 2D07B 2I1JA 2INDC 1L4ZB 1UWXA 2CJNA 3AE2B 4ILJA 4TV3A 2UU7A 4MH0E 1GPXA 1TS3A 2PLPA 1TXDA 3PZ8A 4PYZA 5FR6A 4RFBA 4LLGM 1MPHA 3FILA 2IYDB 1FHOA 1E8YA 3ZNZB 4HCNB 2H7DA 2D3GA 2KDIA 4EFOA 3JW0X 1C9FA 1ZP0B 5IRSA 3OLMD 3VOQA 4GB9A 4DBBA 3T06A 1FNWA 3M1IB 2GBMA 1ZC3B 1NYQA 3NVYA 3SUZA 3DHGC 3GOEA 1LXDA 3BY4B 1ZXHA 2FE8A 3RT3B 4IOIE 1L0VB 5GMVA 1PGBA 1JRUA 3Q3JA 4I6PA 3QA8A 4BKSA 3E66A 4AQ7A 2DKQA 3IT6B 3OAWA 4TSSA 1DYNA 1KLUD 1HZ6A 2YEPB 1FAOA 3ZVVA 1WFYA 3K9PB 3KSYA 2MBHA 2D11A 1KC7A 1D5ZC 1WGDA 2ZW1A 1NI3A 1ST7A 3OWEB 3TEYA 1NVLA 3B2FA 2N9KA 2DYNA 4KDLB 4DX8A 1IYFA 4LTUA 5DPRA 4LDTD 1M4VA 4ARIA 3IFWB 3U8ZA 5HE2A 1OTRB 2PIAA 2KNBA 1D6EC 1J0WA 1NEKB 3V5WA 1IUEA 4K7UA 1FCLA 3QWZB 1XR0B 2WP9B 2WXOA 2D3AA 4FXCA 1F52A 3TEXA 4GMXB 4PYUA 5LONB 2G1EA 1M7EA 5M4YB 3C19A 2R09A 3NS8A 4HJKA 2BS4B 2KVRA 3AE9B 2N9EB 4NPNA 5D7GA 2Z0QA 2C5LC 2LYDA 1ZDVA 3ZGZA 2MJ3A 3DBLI 1FD6A 3QCAA 4HK2A 2J0MA 1MIZB 2IO3B 2VZKD 1FPYA 1KH0A 1TQZA 3DBRI 2D9XA 3D8FA 3RNAC 4M00A 2LGIA 3W1SC 3FAHA 2Z59B 3DVNV 3SBTA 2M19A 3R3MA 1F0ZA 1AN8A 2KFKA 4W9JA 2LUMA 4FJVB 2JWUA 3UGBB 4J6IA 1T3QA 1NENB 1PUTA 1E8XA 3VAWA 5DPTA 4NJ7A 2IGDA 3QQ8B 1QKZA 3I57A 2COCA 2K2UA 3TJPA 4URKA 1ZE3D 1HE8A 1JDEA 1OQNA 3Q8CA 5JXVA 4E74A 1FFVA 3DDCB 1NTIA 1WMHA 1E7VA 1VBHA 2KANA 3N32A 3R8BA 1CQVA 1WGQA 1J7AA 3FLVA 2V4IB 2MHJA 4OT1A 5FI1A 1VCBA 2I5FA 3ZYYX 2L76A 3NZ3A 4C7ZA 2Z0PA 1LB1A 4KX6B 2OOBB 1IPGA 1YOVB 1UPQA 2PVOD 2JZPA 2BGFA 5G55A 1SIJA 1L7YA 3EPYA 5KHOA 3PLUA 4EUTA 2PMVA 1AWEA 3L4PA 1WMHB 4W9GA 4HSIA 5DCNA 3L54A 3I63C 3QJZA 2NCNA 3KLSX 4OVVA 4DDGD 3PVWA 2CR5A 2JF5A 2FAZA 2JRIB 2LJIA 2DYMA 1QOAA 5IAAC 2GI9A 4L2YA 2V1YA 2LGXA 2OJWA 2JQRB 3C0RB 3NJTA 2FIDA 4LNIA 4EJNA 3AMZA 1FXAA 1UNSA 3VQIA 2K8BA 1PGAA 1XKEA 2L1AA 2IYBA 3R66C 3BINA 4M0WB 3UF8A 1C4CA 1UGMA 4RGOS 3PS6A 1XLOA 5CX3A 1GB1A 3JSVA 2EMTA 3AU5A 2G4DB 3Q2AC 3AXCA 1OFFA 1V80A 2V9HA 2L2IA 1VR9A 3DBLB 1FM0D 1RAXA 3NSUA 1YNTE 1FEHA 1GC6A 3DBRB 4B9KA 2LRUA 1LO5D 1U4AA 2W82A 2GLSA 4IWOA 4WQMA 4A8XC 2YVCA 1XD4A 2WQYB 5AZHA 1SE3A 2COAA 2RRFA 3ZTCA 2WXMA 4ANUA 3JSVB 3PO0A 3BK1A 1RWSA 5BYSA 1YX5B 4HAXB 4GDLA 1WJNA 4HAVB 3LYYA 3B0AA 4BOSC 1U5EA 1EGXA 4IUMB 3P4SB 1XF5L 3RFZB 1RLFA 2KN4A 3SFDB 2DHJA 2M17A 4O1NA 1WXQA 3TFMA 4NAWA 2YS3A 3FSSA 3QC8B 3B9JA 4OSNA 2KZRA 3CSFA 1A5RA 1X05A 3LJ3A 3ZJTA 2LASA 1P6SA 4JIOU 2PZ1A 4D2KA 4GDLB 2BCJA 2COFA 5C2TB 2K8HA 1PDXA 2UYZB 1EWCA 2H88B 2ZJDA 4WJNA 4JX1C 4WH4A 1T77A 3GE3C 4YONA 2HTHA 1FGZA 1MHXA 3IAM1 3L0WB 3VUYA 3EC8A 3AM9A 3TO1A 2KMMA 3E9OA 2GJYA 1WJ6A 4NAWB 1UWMA 5D3DA 3NWAA 1FOEA 2GB1A 2O2VA 3E9SA 3Q8BA 1C4AA 3ML9A 4XZ4A 2DKPA 1NVID 3DBHI 2FJ9A 2ZZPB 3TSSA 3FEHA 3N3KB 3U30A 3DPDA 4K1RB 4K2PA 2QIEB 1WE7A 2M4NA 4MT5A 2IY0B 5D3XA 3APCA 4KSLC 3PPAA 1SSNA 2RQ1A 1I42A 2C7HA 1ZOYB 1HTOA 4MK0A 3EUB2 1QOBA 4H8SA 3DOWA 5CHFA 2HTHB 2K25A 1VZ7A 2NBWB 4X57B 1GNUA 1SF0A 2KWVB 1WXAA 1KLVA 2ACZB 2C60A 2JRHA 1DOYA 3H9DA 2AYOB 1KFYB 5C3JB 4FLHA 4G50A 2O2VB 3AB5A 2M14A 4AS1A 2KR0A 3QBVB 3PSEB 3DCXA 1OQYA 2KKCA 2DZMA 1AWDA 4G3XB 2NTSA 1FRDA 2J53A 2JT4B 1MKEA 3W9CB 1UBIA 3MC0B 2J59M 4HAYB 2QHOA 4CO7A 3SNHA 2V3NA 3U12A 1ET6A 2GBKA 1ZC4B 3KQ4A 4MDKE 2QSDA 2J52A 2N4FA 2GCJA 4QXAB 5IP4D 4JKEA 3D8DA 2YT1A 2RDBC 2IZVB 1V1PB 1VZ8A 1F77A 2LULA 5KCVA 2WX1A 4JKBA 1BMLC 3SV1A 5DHAB 4IOYX 4MT7A 1N5WA 1UUPA 2R61A 1MAIA 3D32A 1QQGA 2LOZA 5DHFB 5JP4A 3ABVB 1GJZA 4F8CB 1VBGA 2KGXB 5L83A 1XCGA 4PS7A 3HIEA 4NQLB 1TTNA 3DHIC 4REZA 3ULBA 2KQ7A 4HDQA 2DTCA 2NR2A 4JKAA 1HB6A 4NAMA 1B1ZA 2ELAA 2MRPA 3V60A 2ADZA 3PP2A 2BPSA 3P63A 5I4DA 2LHEA 3ZXVA 3KRWA 1JALA 5HFYA 2FJUB 5CTRC 1YJIA 2LHDA 4C0AA 2LEKA 5J18A 2XN9C 3MFGA 4NZLB 3QHTA 5TR5A 5EE9A 4DXGA 3AEEB 4DHJB 1MI1A 2FCQA 1FCCC 2J0KA 4BKSD 4YT0B 2RPQA 5D3IB 3AE7B 3DBHB 2BWES 2AL3A 1EVHA 3H7PA 2YSZA 1SJHD 3AE5B 3NHEB 4HAZB 1PFJA 2C7NB 1WXSA 2QKMA 4HB0B 4ICVA 2MSED 4XWTA 3MHSD 4RMAA 3DXDA 3O96A 1L4DB 3AECB 1N61A 3MHZA 2AQ3B 4GSWA 2LXAA 1JMLA 1Y5OA 3F5RA 1V2YA 1JWBD 4KZCA 4A20A 2DHIA 2VRWB 3QAQA 3UQBA 1E90A 1QQRA 3AJ4A 5D27A 1OMWA 3ZJUA 1SGHA 5BYQA 2DLBA 1K51A 2L32A 2DYQA 2K8CA 3ZKJC 4D0NB 2WXQA 5CHWA 1TY2A 2FUG1 1TJ6A 1ACAA 2KT7A 3BIID 3Q14C 1Q1OA 3AULA 4FBJB 4HATB 2VH2A 1G6JA 2FCSA 2XK5B 3RZFA 3VRAB 3BJIA 3VUXA 2J7QB 2BBCA 1GB4A 2EJ8A 4K81A 3EHVA 2Y5PA 1FRRA 2DYOA 4II2B 4HPMB 4MGIE 4IM0A 3ZRFA 1RM6C 2W3SA 1I4RA 4KAXB 2JSVX 2VRRB 2FJLA 2NTTA 2N0SB 1J8CA 4ZHPA 4CHMA 2Z8LA 4B6HA 3M63B 3J9CA 1ZYIA 1ISNA 2KACA 3UZTA 4ILGB 4KHOA 1V61A 2CRFA 4XX5A 4II3B 1S1QB 3Q3OC 3ODWA 2M1MA 4M8NA 5GXGB 5BYRA 2DFKA 1C76A 4HROA 2GMIC 2Y5BB 4BFRA 2WU5B 2BKRB 1IBXB 4ZRJA 1L2NA 1Z87A 3P6AA 4CSQA 2LVQA 5E6NA 4FHJA 2RD0A 4PNKA 5IKCM 4GDKB 1W1DA 1XEEA 1OY2A 3NZSA 3SR6A 2KDEB 3AE8B 2X38A 2CQUA 2PTLA 3AE6B 4WJPA 1CMXB 3Q3FA 4XWXA 5EFXA 4ZDVA 1LW3A 2CKHB 2AX5A 3KYCD 2C7MB 2GS0A 3SDLC 2BKFA 1BTKA 1WX8A 5HHDG 3MC9A 1K50A 1UELA 1XODA 2P0DA 2JYEA 4BKGA 1YN3A 4YTNB 2INPE 2BYVE 2ABDA 1F2RC 4BZAA 3CMMB 2XEWA 1J7BA 2R2OA 4JLCA 2PPHA 1SE9A 4MSQB 3H8HA 1OEYA 2QMTA 1TT5B 3N9YC 1R4NI 3URYA 2D4QA 2KWUB 3ZQ4A 3GYPA 2RR9A 2WXNA 1OQRA 1XLPA 2E6XA 2N9XA 4WAAA 1E7UA 3P1MA 3AH7A 4JKDA 5BMGA 3U7DA 2IPKD 3AE4B 1DIKA 4G11A 4MH8A 1LFDA 4KV2A 1WJ1A 2V3PA 1EO6A 4WQOB 1WJ4A 2IGGA 4AP4C 1GC7A 3MPXA 2A5UA 3PVLA 2G9HD 2Z13A 1JROA 4AJYB 5C5BA 2Y8FA 4JE3B 3HQCA 1SBBB 4K17A 5KQ4A 2CS4A 1HEZE 5C6RA 1I7HA 2WXRA 4US8A 4FJZA 2YRYA 3CWIA 4DBGA 3ZDMC 3O13A 1WY8A 4W9EA 3GYOA 2KLGA 2AL6A 3DQVA 1FHWA 2A4ZA 4L6EA 1EU4A 4IG7B 2DX1A 3HM6X 3C8YA 3WALA 2Z59A 3ZDTA 2NPTA 2ZCBA 5C5BB 2BT6A 2YEPF 3PZDA 2ZKMX 3RCZA 2LGDA 2LGSA 2LD9A 4B0MA 3WIMA 2CU1A 3AE3B 2C9WB 2YS5A 1P9DU 5BMHA 1IRSA 2D2QA 2DA0A 4IAPA 2Z0EB 4G0NB 4QAYA 4N9F4 5FK9C 2IO1B 3NVWA 3R7QA 3KWVA 3QIJA 2MP2A 3H7SA 2O6VA 4HVBA 4M8MA 1V1OA 4GMVA 4AJWA 2NPTB 1I4XA 1VLBA 1WGKA 4M02A 4YSYB 2EMSA 5HE0A 4OZAA 2DBYA 3BVZA 2K5PA 2IDYA 4RM8A 1BAKA 3SU8X 3DHHC 1NDDA 1LGRA 2QILA 3FVCA 1V8CA 5FR3A 2KQSA 2ZNVC 3P42A 4GOCA 3IVFA 1XT9B 2FNJB 2MP2B 2O6VB 3K9OB 1QF6A 1SJED 3OJ4B 2LWPA 1DYQA 1TS4A 2BF8B 2K3UA 2MQJA 4RM9A 2ZVNA 3ODOA 1YQBA 1I4HA 2DNFA 1UF0A 5EE1A 1PQSA 4HHVA 1KBLA 4WWPA 1R4NB 5IA7A 2HRJA 4EZKA 4F7GA 2G3QB 4KDIC 3NG0A 4IFSA 4A9AA 2K22A 1V5MA 1GAQB 3VH3B 1YX6B 1M7RA 5D3WA 1TKEA 1YMHE 1U29A 2QC8A 2L83A 1WXMA 4IWQA 4DX90 2N7EA 3PZ7A 4YL8A 1ESFA 3WAOA 2K6QA 3PVUA 4W9FA 1E8ZA 1J19A 2SAKA 2LG1A 4M0WA 4W9CA 1U5GA 4UDUC 2KX3A 3DXEA 4GGQA 4RGMA 1P5TA 3WA0A 4S17A 2KMAA 2DHZA 1TKYA 2D3CA 3UQAA 3TCAA 2GRIA 1D3ZA 2KIEA 4HDOA 3HM3A 1D4BA 1FNUA 4FA6A 2KAJA 4ITKA 3OANA 2MFQA 4OZCA 3U4EG 2COPA 1WXVA 3KZ1A 2AQ2B 1DDMA 3NY5A 4ASWC 2D9YA 3KUZA 4F7ZA 2HTME 5CLQB 1NI2A 3T8MA 1T0RC 3JVZX 4WVFB 2IY1B 1ZDXA 5AZFA 4HWIB 1V5PA 4RGTA 2DAFA 2D3BA 5I2SA 4DHJD 4WJOA 5LOPB 3IXSA 3U2SC 3T9LA 3GB1A 4DHZB 4GLSC 1PLSA 2CHWA 4R3DA 3A4RA 2KJHB 4JWUC 1XX0A 2GBRA 1ZSQA 3DWGC 2WLBA 3CF6E 3ZUNA 3VR8B 4C56C 4YTPB 1E0ZA 1MHHE 3HUIA 2KTRB 1IGCA 2QEJC 2PW9A 4E3CA 2L1CA 4GN1A 5J3QA 4FN2A 1FFUA 4HLEA 1S3SG 2MH7A 4J3OD 2NZ8B 2D10A 1TZ1A 2K1FA 3NVZA 4Z2NA 4IWPA 3WCQA 1KTKA 4MELA 4KGSA 1UNPA 1T0SC 3V3XA 1DDVA 1EM7A 2WH5A 3Q3NC 3GP7A 3QARA 1P7FA 2N1VA 3ENEA 3RNFC 3ONSA 1QOFA 4HPLB 3HRDD 3L17A 5DPWA 2HJ1A 4A3OA 4HB3B 3A1QB 1L6VA 1K53A 2DWQA 1XLNA 1KI1B 2RPVA 1T5XD 4P7IA 4TQ0A 2W2WA 3ZIMA 4MM3A 1U5DA 1SHCA 5E6PA 1FXIA 3NUHB 3GE8C 1IP9A 2Y5CA 5AEKB 1WZ3A 4LNOA 1Y56A 4L1BA 1ACCA 2Q5WD 3SO6A 3DWMA 1CZPA 1OQQA 5HE3A 2DX5A 2KLCA 2JP2A 3VUWA 4EOYA 1WRIA 2DIKA 3KWLA 4W9HA 2EC1A 1M94A 2PE6B 3B2GA 4JK9A 5IO9A 1I4QA 4BKTA 2K2JA 1RJ2A 4MM3B 3AI5A 2LMCA 2KMCA 3EFUA 2WDQB 4GIVA 2G45B 4BBNF 4I6NB 1BT0A 4A5KA 2WDVB 1NTVA 3CIKA 1AQCA 3A9JB 2JU6X 1A70A 1E6EB 2DX5B 2UZSA 1EF1A 2PKOA 1JRPA 4W9LA 2RSUA 2ELBA 3I5JC 5J2RA 3AEGB 5DI9B 3WAMA 4QJ3B 3VTWA 1BXTA 2J4XA 1V1PA 1NYRA 2IBIB 1UPRA 2KX0A 2DLWA 4I6LB 2CB8A 4ICUA 4MGKE 2Z0OA 1H4RA 2MWSB 4ANXA 2WDTB 2OQBA 2BYFA 4EMOA 1N62A 1NBFC 4IKGA 3RN9C 1WF9A 1WVHA 4W9DA 2NS5A 1VDVA 1BTNA 1RRBA 4TKNA 4DQOC 4GOUA 2JX5A 5LG4B 2FDQA 2YLMA 5IJMA 1WH3A 4PS8A 2RGNB 1EF5A 4LCDE 3PG7A 4L23A 3SYXA 2ROVA 5H92C 1DROA 1I7AA 4A6KA 4HAUB 2WXJA 2KWDA 3VDZA 4ZYNA 4HAWB 3RZWC 4XDDA 2W3RA 4ZRQA 3ZRCA 1SE4A 1DOIA 1WIAA 2Q13A 4WJ7A 4JKHA 3FM8C 4NJCA 3ZTDA 2H89B 3PLVA 1XD3B 1RFKA 4F7HA 3H1UA 1DOXA 4CHKA 2RLOA 1X1MA 4NQKE 1E9MA 4HKQA 1VD2A 1X1GA 1UD7A 1YIWA 1C79A 3BWUD 1DGJA 1XCTL 1B9RA 3DBSA 4K2OA 1P0RA 5JH5C 2K00A 2X18A 2MJEA 1X11A 3B1LX 4KHBB 4LJPB 1XQQA 2ZPYA 1CJEA 3HW2B 2MBBB 4XDCA 4HEA1 3VTUA 2WXIA 2BS2B 2W2XD 2K9XA 5CHVC 2VH1A 1L0XB 4FJYA 4C7YA 3IG3A 4P6VF 3W5UB 1HBKA 1R4MI 2KDMA 1QILA 1WGYA 4A6HA 1V6EA 2L0FA 2KHWB 4JKFA 1OEYJ 2GBNA 2ZW0A 4AWJA 1ZXIA 3BVMA 4MACA 2M0XA 4IM3A 3SD5A 2FUHB 1STEA 1MJDA 3IHPC 1QC6A 2JXTA 4WAFA 1D5MC 2GBJA 2V3SA 1CK1A 1VJKA 2QJLA 3CSTA 2KJ6A 4K3BA 4AOFA 2VSZA 3KUCB 1WG7A 4KIKA 5JVLA 2XK5A 5HE1A 4K3CA 1E8WA 1XCQL 2AWTA 5DPSA 4EKUA 3KH0A 1I35A 1Y19B 1HB8A 2LJ5A 2D5GA 1HQRD 1ET9A 3R7RA 3ZLZA 4IC7B 3HHMA 4KVGB 1WGUA 5BO4B 2PEAA 5EE3A 1QOGA 4GXBA 4FHKA 2ONQA 3V6EB 3U7ZA 4M01A 2BW2A 1P3RA 3V61A 1YN5A 2RNRB 1EAZA 2ASQA 2W55A 2KCJA 3I3TB 5AUIA 4KIKB 1JW9D 3LB8C 4ANVA 4JL9A 1V81A 2LZ6A 2O6VD 1Q5WB 3WAPA 2NBVA 1TZOA 1V97A 1FMAD 2MBEA 1Q67A 4YSXB 3G9WA 1TJEA 2L00B 1IBXA 4A6FB 1XLQA 2Z0DB 5L81A 1PYWD 2H7EA 2KDBA 2R82A 1TS5A 2FCMA 4GDKA 2P0HA 2Z4DA 1L5PA 2I38A 3APFA 4LNFA 2DYBA 3OHMB 1MG4A 3Q6BA 2N7DA 4BAXA 2KDFB 2I1KA 3KVFB 4LK0M 2MW5A 2NBVB 4HJGE 1EU3A 1GGOA 2KJRA 2CU3A 2OJRA 1V88A 4Y94A 1MG8A 5EE0A 1KF6B 2DN6A 2YF0A 3NOBA 2WGSA 5J17A 5L95C 2GCLA 1C4PA 1LQBA 2R2YA 4YXDB 1X1FA 3A9KB 3GZNI 3QX1A 3ZXRA 2VKIA 3MDBC 3T3NA 2FBWB 2WXFA 2M38A 1SXTA 1KRHA 2K0PA 1F9JA 1DDWA 1UH6A 3ODXA 2KFJA 4BOZB 4E71A 2CHZA 1R4MB 3VH4B 1YQ4B 3FC4A 1FB8A 1ZUD2 3AEBB 1QT9A 2TSSA 2J0JA 4H2AA 4F1SA 4ZRIA 3AV8A 1BUIC 1WI0A 4USAA 1V9JA 3R2TA 3L16A 3SEBA 1ZM0A 1WE6A 4Z2MB 2G4SA 1RYJA 3PV1A 4OVZA 5T8IA 2MBQA 2J42A 2N23A 2WNMA 3Q8EA 4DXAB 4RF0A 2I5CA 5I2MA 3EA6A 2IJ0A 2JWZA 2WWZA 2HE7A 3QWMA 1XO3A 3D8EA 5J3YA 3S2AA 2RDGA 4ZHOA 1WM2A 4XWWA 1QZEA 4JK7A 4N6EB 4XE0A 1HZ5A 2WHIA 2KC1A 4IW0A 4XYCA 3HIZA 1Q0WB 1KJTA 3IBEA 3WYFB 3JYUA 1HTQA 2LVOA 4OVUA 1Q10A 2REXA 3HVZA 3X0WA 3FKYA 2L8JA 4B6WA 3N7CA 2V4LA 3RMKC 4JGHB 2OEDA 1V86A 1E5WA 2KWCA 3AEAB 3APDA 4JK8A 1FGYA 2V76A 3V05A 3FILB 1TY0A 1KLGD 1UNRA 1N3HA 4ZRKA 4NSWA 2MDXA 4WURA 4DHZE 3E9LA 3P4QB 2WXKA 3A8PA 2PJHA 3BVGA 2L3ZA 3RPFC 1GOZA 5JLJB 4P1CC 4ILHA 2JZZA 1JCKB 3DVNU 3RD2A 3VRBB 1N5XA 4PK1A 1TBEA 3TBLD 3BK2A 1F2RI 3BYTB 3PGEA 3RYTA 3RNGC 4AUQC 4JKGA 3ETRA 3ECIA 4MY6A 1WYGA 4MEMA 2WS3B 1SIFA 3N20C 2ON8A 4JKCA 1TIFA 2ROZB 4F7UP 1P3QU 2FCNA 3VTVA 5DH9B 4OW0A 4FULA 1HA5A 4DXFA 2KQ4X 2OHFA 2BYTA 3GZNB 4US9A 4NJ6A 2INCC 2LXCA 4NY0A 1WX9A 2N7JA 2GUMA 2K39A 1WRDB 2CAYA 2L7RA 4MGZE 4BBNC 4KZ0A 2JZ3B 4OHJA 2PE9A 3F0WA 4JKGB 2NVUI 2FIFA 2XNAC 2MJDA 5J3TA 2OTXA 1GG3A 3NW8A 1K52A 4ZYSA 3KY9A 5C1ZA 4KHAA 1C78A 4XGAB 1TYGB 4KGTA 1BWNA 4FADA 4D6WA 3DCGA 3X23A 1QLBB 1X86A 4HKZE 3SHQA 3R2IA 1FIQA 4TMAB 2KC2A 2RSGA 2QKLA 1VZ6A 2AQ1B 3VHTC 2D9WA 1W1GA 4MJSA 2Y7BA 2NBUA 3VIAA 2IGHA 3HK0A 3UI3A 2CHXA 2UWQA 4A6QA 1SB3C 3NWFA 3DVGY 1WGHA 2M8SA 1ENFA 4W9KA 2EELA 5G5HA 2IO0B 3L10B 4PQ0A 2KFKB 2X8XX 3N30A 2WXGA 3ZW3A 4ZRPA 2CY5A 4KKJA 3TVVA 1H8CA 3PEGA 2KYWA 4EZLA 3ML8A 4MJSB 2KK8A 4L1RA 1LM8B 4HXDA 3PTFC 2RUKB 4QJ4B 3ULCA 4JQWC 4CYEA 1WR1A 5H8YE 4BVUC 2W9NA 3N1ZC 3NRZA 4BBKA 5G2NA 2HDEA 5DIFB 3VVWB 1WI1A 3PRMB 3OG5A 1EUVB 3W1YA 2MKRA 3A33B 5LXIB 2Z14A 2WU2B 3PHWB 1YJ1A 2BWFA 2KTRA 3AEDB 1H10A 2UVMA 1V49A 4P16A 2LVPA 3A58A 1JWUD 1FXTB 3EGRA 3RUIB 1MI0A 2KOXA 2W54A 4NNJB 4ZOHC 3KUDB 3Q69A 2HD5B 1KZ7A 2CY4A 4WIPA 4DDID 2BYEA 4EZJA 2Y3AA 3E9PA 3Q8AA 3V6CB 3TW1A 1C3TA 1UBQA 5GOWB 1F1HA 2WX0A 1ZGUB 5FI0A 3MP9A 4WJQA 5MPOA 2NMQA 1AW7A 4YSZB 1HXYD 4TQ1A 4HCPB 3BZDB 4A90A 1P98A 2EKEC 2KO3A 4XC2A 2LKOA 1T0YA 3GS2A 2MCNB 3A1QA 1L6UA 1YD8U 5LNK1 2BQQA 5JZEB 1UGJA 1GUAB 2B76B 3UIOB 3MJWA 1NU2A 4KGRA 4S0RA 3RNBC 1NTYA 1UEFA 3TMPB 2P8VA 1U27A 4GNKB 1ZW7A 5C23A 2BS3B 3W1SA 4YWGG 4ARCA 5AZGA 4RNAA 1KZGA 2RDHA 3KW5B 4CQNA 3Q8FA 1P1AA 2KXJA 1C1YB 1VRAB 1JWAD 1V5OA 4LDTB 1V5TA 4WWMA 2K49A 3ALBA 1MPEA 1WGGA 5E6OA 2BB5A 4HB4B 1D5XC 1FO4A 3A9JA 5D6JB 1WJUA 2ZCCA 2Y8GA
chains in the Genus database with same CATH topology
4K7WA 2L05A 2MX2A 4DWFA 3M3JA 3PSCA 2B3AA 2DAJA 3WANA 5JHBA 2D9ZA 2ZNVB 1W1HA 3AU4A 1K8RB 2XBBC 4W9IA 3MTNB 5D94A 3ML4A 1RFAA 1ZKHA 1MK7B 4GU2A 3SBGA 4MSMB 2RGFA 1K5DB 4WWOA 1Y8RC 4LJOB 3P7ZA 2JVCA 3PRPB 1PMSA 4PS3A 2R0DA 2MA9B 1FHXA 2MLBA 3H6NA 4B95A 5LLIA 4A3PA 5LXHA 3V62A 3OJ3A 2CODA 2LI5A 1U2BA 2AEHA 3EECA 3PT2B 2UZRA 2R2QA 4DK5A 1WM3A 1AARA 2JXXA 3UIPB 1B55A 5JHHA 3TIXA 4HB2B 3PRZA 3L08A 3KYDD 2DZKA 4TUUA 3L13A 2HJ8A 2G35A 2KTFA 2KUPA 3NZUA 5KHQA 4IM2A 2DZIA 4GPTB 2ZPNA 2NMBA 3A8QA 3TL5A 1MIXA 1TGZB 3DVGX 1ZVRA 4MGYE 3LDZE 1V89A 4KSKC 5JHAA 2MBOA 3ZNGC 5KQ1A 2IO2B 4EEWA 3FP5A 5D3VA 2JUOA 3RCPA 1WX7A 2N1WA 5EDSA 5CLLB 2YT0A 4TYZA 2DENB 1UZXB 3VFKA 1OGWA 1WYWB 2WYQA 4K7SA 4GZUA 2DZJA 3LJUX 3PREA 3ZNID 3M95A 1DBHA 2N0YA 2W2XC 2LRWA 1U5FA 3A98B 1J0GA 4A6FA 1WGRA 3M62B 5D3YA 3H7PB 2IFSA 3B08A 3PHXB 1V5UA 3UINB 2N9PC 1Z2MA 2KD0A 3ZNHB 2ZEQA 2YS1A 2D9VA 4WSFA 3O65B 2XQNM 1WJMA 5JHGA 2GOWA 3ZVRA 3RULA 2X0SA 3KRXA 3A9KA 4CHJA 3VXWA 3QK0A 2L0TA 2P0FA 2LOXA 1WR6E 2LGYA 1UNQA 3ENBA 2DHKA 5D2MB 2RVBB 3A4SC 1K5GB 1MK9B 1RRPB 4WWNA 2KN5A 2K6DB 4ANWA 3ZO5B 5HKHA 1KM7A 1I2HA 2MWNB 2ZVOA 3DXCA 1Z5SB 5C16A 1KOTA 2LBBA 3CXBB 2JPHA 1WZ0A 3P2BA 2LUEA 5C79A 2JY6A 2E2XA 2D07B 2I1JA 4ILJA 4TV3A 4MH0E 1TXDA 4PYZA 5FR6A 1MPHA 2IYDB 1FHOA 1E8YA 3ZNZB 4HCNB 2H7DA 2D3GA 2KDIA 4EFOA 3JW0X 3OLMD 3VOQA 4GB9A 4DBBA 3T06A 3M1IB 2GBMA 1ZC3B 3SUZA 3GOEA 1LXDA 3BY4B 3RT3B 5GMVA 3Q3JA 1JRUA 4I6PA 3QA8A 4BKSA 3E66A 2DKQA 3OAWA 1DYNA 1FAOA 3ZVVA 1WFYA 3K9PB 3KSYA 2MBHA 2D11A 1KC7A 1WGDA 1ST7A 1NVLA 2DYNA 4KDLB 4DX8A 1IYFA 5DPRA 4LDTD 3IFWB 3U8ZA 5HE2A 1OTRB 2KNBA 1J0WA 3V5WA 4K7UA 3QWZB 1XR0B 4GMXB 4PYUA 5LONB 1M7EA 3NS8A 2R09A 4HJKA 2KVRA 2N9EB 4NPNA 5D7GA 2Z0QA 2C5LC 2LYDA 3DBLI 3QCAA 4HK2A 2J0MA 1MIZB 2IO3B 1TQZA 3DBRI 2D9XA 3D8FA 3W1SC 2Z59B 3DVNV 3SBTA 3R3MA 4W9JA 2KFKA 4FJVB 3UGBB 4J6IA 1E8XA 3VAWA 5DPTA 4NJ7A 3QQ8B 2COCA 2K2UA 3TJPA 4URKA 1HE8A 1JDEA 1OQNA 4E74A 3DDCB 1NTIA 1WMHA 1E7VA 1VBHA 2KANA 3N32A 1WGQA 3FLVA 5FI1A 1VCBA 2I5FA 2L76A 2Z0PA 1LB1A 2OOBB 1IPGA 1UPQA 2BGFA 5G55A 1L7YA 3EPYA 5KHOA 3PLUA 4EUTA 1AWEA 1WMHB 4W9GA 5DCNA 3L54A 3QJZA 2NCNA 4OVVA 4DDGD 3PVWA 2CR5A 2JF5A 2FAZA 2JRIB 2DYMA 5IAAC 2V1YA 2LGXA 3C0RB 2FIDA 4EJNA 3VQIA 2K8BA 1XKEA 2IYBA 3R66C 3BINA 4M0WB 3UF8A 1UGMA 3PS6A 5CX3A 3JSVA 2EMTA 3AU5A 2G4DB 3AXCA 1V80A 2L2IA 1RAXA 3NSUA 1GC6A 4B9KA 2LRUA 1U4AA 4IWOA 2YVCA 1XD4A 5AZHA 2COAA 3ZTCA 4ANUA 3JSVB 1YX5B 4HAXB 4GDLA 1WJNA 4HAVB 4BOSC 3B0AA 1U5EA 1EGXA 4IUMB 1RLFA 2DHJA 2M17A 3TFMA 4NAWA 2YS3A 3FSSA 3QC8B 2KZRA 3CSFA 1A5RA 1X05A 3LJ3A 2LASA 1P6SA 4JIOU 2PZ1A 4GDLB 2BCJA 2COFA 2K8HA 2UYZB 2ZJDA 4WJNA 4YONA 2HTHA 1FGZA 3VUYA 3L0WB 3EC8A 3TO1A 3E9OA 2GJYA 1WJ6A 4NAWB 1FOEA 2O2VA 3ML9A 4XZ4A 2DKPA 3DBHI 2FJ9A 2ZZPB 3FEHA 3N3KB 3U30A 3DPDA 4K1RB 4K2PA 1WE7A 2M4NA 2IY0B 5D3XA 3APCA 4KSLC 3PPAA 2RQ1A 1I42A 2C7HA 4MK0A 4H8SA 3DOWA 5CHFA 2HTHB 2K25A 4X57B 2NBWB 1GNUA 1KLVA 2KWVB 1WXAA 2C60A 2JRHA 3H9DA 2AYOB 4FLHA 4G50A 2O2VB 2M14A 3QBVB 3PSEB 1OQYA 2KKCA 2DZMA 4G3XB 2JT4B 1MKEA 1UBIA 2J59M 4HAYB 2QHOA 4CO7A 3SNHA 2GBKA 1ZC4B 4MDKE 2N4FA 2GCJA 4JKEA 3D8DA 2YT1A 2IZVB 2WX1A 2LULA 5KCVA 4JKBA 3SV1A 5DHAB 4IOYX 4MT7A 3D32A 1MAIA 1QQGA 2LOZA 5DHFB 5JP4A 1GJZA 4F8CB 1VBGA 2KGXB 5L83A 1XCGA 4PS7A 4NQLB 1TTNA 3ULBA 2KQ7A 4HDQA 2DTCA 2NR2A 4JKAA 1HB6A 2ELAA 2MRPA 3V60A 2ADZA 3PP2A 2BPSA 3KRWA 5CTRC 4C0AA 5J18A 3QHTA 5TR5A 4DHJB 2FCQA 2J0KA 4BKSD 2RPQA 2BWES 2AL3A 1EVHA 3H7PA 2YSZA 3NHEB 4HAZB 1PFJA 2C7NB 1WXSA 2QKMA 4HB0B 4ICVA 2MSED 3MHSD 4RMAA 3DXDA 3O96A 4GSWA 2LXAA 1Y5OA 3F5RA 1V2YA 4KZCA 4A20A 2DHIA 2VRWB 3QAQA 3UQBA 1E90A 3AJ4A 5D27A 1OMWA 1SGHA 2DYQA 2K8CA 3ZKJC 4D0NB 5CHWA 1TJ6A 1ACAA 1Q1OA 3AULA 4FBJB 4HATB 1G6JA 2FCSA 2XK5B 3RZFA 3BJIA 3VUXA 2J7QB 2EJ8A 4K81A 3EHVA 2DYOA 4II2B 4HPMB 4MGIE 4IM0A 3ZRFA 2VRRB 4KAXB 2FJLA 1J8CA 4CHMA 4B6HA 3M63B 1ISNA 3UZTA 4ILGB 4KHOA 1V61A 2CRFA 4XX5A 4II3B 1S1QB 4M8NA 3ODWA 2M1MA 2DFKA 2GMIC 2Y5BB 4BFRA 2BKRB 4ZRJA 1L2NA 1Z87A 3P6AA 2LVQA 5E6NA 4FHJA 2RD0A 4PNKA 4GDKB 1W1DA 1OY2A 3NZSA 2KDEB 2CQUA 4WJPA 1CMXB 3Q3FA 4XWXA 5EFXA 4ZDVA 1LW3A 2CKHB 3KYCD 2C7MB 2GS0A 3SDLC 2BKFA 1BTKA 1WX8A 1UELA 1XODA 2P0DA 4BKGA 2BYVE 2ABDA 3CMMB 2XEWA 2R2OA 4JLCA 2PPHA 1SE9A 4MSQB 1OEYA 1R4NI 2D4QA 2KWUB 3GYPA 2RR9A 2N9XA 4WAAA 1E7UA 4JKDA 3U7DA 4G11A 1DIKA 1LFDA 4KV2A 1WJ1A 1EO6A 4WQOB 1WJ4A 4AP4C 1GC7A 3MPXA 2A5UA 3PVLA 4AJYB 5C5BA 2Y8FA 3HQCA 4K17A 5KQ4A 2CS4A 5C6RA 4FJZA 2YRYA 4DBGA 3ZDMC 1WY8A 4W9EA 3GYOA 2KLGA 2AL6A 3DQVA 1FHWA 2A4ZA 4L6EA 4IG7B 2DX1A 3HM6X 3WALA 3ZDTA 2NPTA 2ZCBA 5C5BB 3PZDA 3RCZA 2LGDA 2LD9A 3WIMA 2CU1A 2C9WB 2YS5A 1P9DU 1IRSA 2D2QA 2DA0A 4IAPA 2Z0EB 4G0NB 4N9F4 2IO1B 3R7QA 3QIJA 2MP2A 3H7SA 2O6VA 4HVBA 4M8MA 4GMVA 4AJWA 2NPTB 2EMSA 5HE0A 4RM8A 1BAKA 3SU8X 1NDDA 2KQSA 2ZNVC 4GOCA 3IVFA 1XT9B 2FNJB 2MP2B 2O6VB 3K9OB 3OJ4B 2LWPA 2BF8B 2MQJA 4RM9A 2ZVNA 3ODOA 1YQBA 1PQSA 4HHVA 1KBLA 4WWPA 5IA7A 2HRJA 4EZKA 4F7GA 2G3QB 4KDIC 4IFSA 1V5MA 3VH3B 1YX6B 1M7RA 5D3WA 1U29A 1WXMA 4IWQA 4DX90 2N7EA 4YL8A 3WAOA 2K6QA 3PVUA 4W9FA 1E8ZA 1J19A 2LG1A 4W9CA 1U5GA 2KX3A 3DXEA 4GGQA 1P5TA 3WA0A 2KMAA 2DHZA 3UQAA 3TCAA 1D3ZA 4HDOA 3HM3A 4FA6A 3OANA 2MFQA 2COPA 1WXVA 3KZ1A 1DDMA 3NY5A 4ASWC 2D9YA 3KUZA 4F7ZA 5CLQB 1NI2A 3T8MA 3JVZX 4WVFB 2IY1B 5AZFA 4HWIB 1V5PA 2DAFA 4DHJD 4WJOA 5LOPB 3T9LA 4DHZB 1PLSA 2CHWA 3A4RA 2KJHB 1XX0A 2GBRA 1ZSQA 3CF6E 3ZUNA 2KTRB 4E3CA 2L1CA 4GN1A 5J3QA 4FN2A 4HLEA 1S3SG 2NZ8B 2D10A 1TZ1A 2K1FA 4Z2NA 4IWPA 4MELA 1UNPA 1DDVA 2WH5A 3QARA 2N1VA 3ENEA 3ONSA 4HPLB 3L17A 5DPWA 4A3OA 4HB3B 3A1QB 1KI1B 4P7IA 4TQ0A 2W2WA 3ZIMA 4MM3A 1U5DA 1SHCA 5E6PA 1IP9A 5AEKB 1WZ3A 3SO6A 5HE3A 2DX5A 2KLCA 2JP2A 3VUWA 4EOYA 2DIKA 4W9HA 2EC1A 1M94A 2PE6B 4JK9A 4BKTA 2K2JA 1RJ2A 3AI5A 2KMCA 3EFUA 4GIVA 2G45B 4BBNF 4I6NB 1BT0A 4A5KA 1NTVA 3CIKA 1AQCA 3A9JB 2DX5B 2UZSA 1EF1A 4W9LA 2RSUA 2ELBA 5J2RA 5DI9B 3WAMA 3VTWA 2IBIB 1UPRA 2KX0A 2DLWA 4I6LB 2CB8A 4ICUA 4MGKE 2Z0OA 1H4RA 2MWSB 4ANXA 2WDTB 2OQBA 2BYFA 4EMOA 1NBFC 1WF9A 1WVHA 4W9DA 2NS5A 1BTNA 1RRBA 4TKNA 2FDQA 2YLMA 5IJMA 1WH3A 4PS8A 2RGNB 1EF5A 4LCDE 3PG7A 3SYXA 2ROVA 1DROA 1I7AA 4A6KA 4HAUB 3VDZA 4ZYNA 4HAWB 3RZWC 3ZRCA 1WIAA 2Q13A 4WJ7A 4JKHA 3FM8C 3ZTDA 3PLVA 1XD3B 3H1UA 4F7HA 4CHKA 2RLOA 1X1MA 4NQKE 1VD2A 1X1GA 1UD7A 1YIWA 3DBSA 4K2OA 1P0RA 5JH5C 2K00A 2X18A 1X11A 3B1LX 4KHBB 4LJPB 1XQQA 2ZPYA 2MBBB 3HW2B 3VTUA 5CHVC 2W2XD 4FJYA 3IG3A 1HBKA 1R4MI 1WGYA 4A6HA 1V6EA 2L0FA 2KHWB 4JKFA 1OEYJ 2GBNA 4AWJA 2M0XA 4IM3A 3SD5A 2FUHB 3IHPC 1QC6A 2GBJA 2V3SA 3CSTA 2KJ6A 4AOFA 2VSZA 3KUCB 1WG7A 4KIKA 5JVLA 2XK5A 5HE1A 1E8WA 2AWTA 5DPSA 4EKUA 3KH0A 1I35A 1Y19B 1HB8A 2LJ5A 3R7RA 3ZLZA 4IC7B 3HHMA 4KVGB 1WGUA 5BO4B 2PEAA 3V6EB 4GXBA 4FHKA 1P3RA 3V61A 2RNRB 1EAZA 2ASQA 2KCJA 3I3TB 4KIKB 4ANVA 4JL9A 1V81A 2LZ6A 2O6VD 1Q5WB 3WAPA 2MBEA 1Q67A 3G9WA 2L00B 4A6FB 2Z0DB 5L81A 2H7EA 2KDBA 2R82A 2FCMA 4GDKA 2P0HA 3APFA 2DYBA 2N7DA 2KDFB 2I1KA 3KVFB 2MW5A 2NBVB 1GGOA 2KJRA 2OJRA 1V88A 4Y94A 1MG8A 2DN6A 2YF0A 3NOBA 5J17A 5L95C 2GCLA 1LQBA 1X1FA 3A9KB 3GZNI 3QX1A 2VKIA 3MDBC 2M38A 1F9JA 1DDWA 1UH6A 3ODXA 2KFJA 4BOZB 4E71A 2CHZA 3VH4B 1FB8A 2J0JA 4F1SA 4ZRIA 1WI0A 1V9JA 3L16A 1ZM0A 1WE6A 4Z2MB 2G4SA 3PV1A 2MBQA 2N23A 4DXAB 2I5CA 2JWZA 2WWZA 2HE7A 3QWMA 3D8EA 5J3YA 3S2AA 1WM2A 1QZEA 4JK7A 2KC1A 4IW0A 3HIZA 1Q0WB 1KJTA 3IBEA 3WYFB 3JYUA 2LVOA 4OVUA 2REXA 3X0WA 2L8JA 4B6WA 3N7CA 2V4LA 4JGHB 1V86A 1E5WA 2KWCA 3APDA 4JK8A 1FGYA 2V76A 1UNRA 1N3HA 4ZRKA 4NSWA 2MDXA 4DHZE 3E9LA 3A8PA 2PJHA 2L3ZA 5JLJB 4ILHA 2JZZA 3DVNU 3RD2A 1TBEA 3TBLD 3PGEA 3RYTA 4AUQC 4JKGA 3ECIA 4MY6A 4MEMA 1SIFA 4JKCA 2ROZB 4F7UP 1P3QU 2FCNA 3VTVA 5DH9B 4FULA 4NJ6A 2LXCA 4NY0A 1WX9A 2K39A 1WRDB 2CAYA 2L7RA 4MGZE 4BBNC 4KZ0A 2JZ3B 2PE9A 3F0WA 4JKGB 2NVUI 2FIFA 5J3TA 2OTXA 1GG3A 3KY9A 5C1ZA 4KHAA 1BWNA 4FADA 3DCGA 3X23A 1X86A 3SHQA 2KC2A 2RSGA 2QKLA 3VHTC 2D9WA 1W1GA 4MJSA 2Y7BA 2NBUA 3VIAA 3HK0A 2CHXA 2UWQA 3DVGY 1WGHA 2M8SA 4W9KA 2IO0B 3L10B 4PQ0A 2KFKB 3N30A 3ZW3A 2CY5A 3TVVA 1H8CA 3PEGA 4EZLA 3ML8A 4MJSB 2KK8A 1LM8B 4HXDA 3PTFC 2RUKB 3ULCA 4JQWC 4CYEA 1WR1A 4BVUC 2W9NA 4BBKA 5G2NA 5DIFB 3VVWB 1WI1A 3PRMB 1EUVB 3W1YA 2MKRA 3A33B 5LXIB 3PHWB 1YJ1A 2BWFA 2KTRA 1H10A 2UVMA 1V49A 2LVPA 1FXTB 3RUIB 2KOXA 4NNJB 3KUDB 2HD5B 1KZ7A 2CY4A 4DDID 4EZJA 2BYEA 3V6CB 3E9PA 1C3TA 3TW1A 1UBQA 5GOWB 2WX0A 1ZGUB 5FI0A 4WJQA 4TQ1A 4HCPB 1P98A 2EKEC 2KO3A 4XC2A 2LKOA 1T0YA 2MCNB 3A1QA 1YD8U 5JZEB 1GUAB 3UIOB 3MJWA 1NU2A 1NTYA 1UEFA 3TMPB 2P8VA 1U27A 1ZW7A 5C23A 3W1SA 5AZGA 1KZGA 3KW5B 1P1AA 2KXJA 1C1YB 1V5OA 4LDTB 1V5TA 3ALBA 1WGGA 5E6OA 4HB4B 3A9JA 5D6JB 1WJUA 2ZCCA 2Y8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7W A;  2L05 A;  2MX2 A;  4DWF A;  3M3J A;  3PSC A;  2B3A A;  2DAJ A;  3WAN A;  5JHB A;  2D9Z A;  2ZNV B;  1W1H A;  3AU4 A;  1K8R B;  2XBB C;  4W9I A;  3MTN B;  5D94 A;  3ML4 A;  1RFA A;  1ZKH A;  1MK7 B;  4GU2 A;  4MSM B;  2RGF A;  1K5D B;  4WWO A;  1Y8R C;  4LJO B;  3P7Z A;  2JVC A;  3PRP B;  1PMS A;  4PS3 A;  2R0D A;  2MA9 B;  1FHX A;  2MLB A;  3H6N A;  4B95 A;  5LLI A;  4A3P A;  5LXH A;  3V62 A;  3OJ3 A;  2COD A;  2LI5 A;  1U2B A;  2AEH A;  3EEC A;  3PT2 B;  2UZR A;  2R2Q A;  4DK5 A;  1WM3 A;  1AAR A;  2JXX A;  3UIP B;  1B55 A;  5JHH A;  3TIX A;  4HB2 B;  3PRZ A;  3L08 A;  3KYD D;  2DZK A;  4TUU A;  3L13 A;  2HJ8 A;  2G35 A;  2KTF A;  2KUP A;  3NZU A;  5KHQ A;  4IM2 A;  2DZI A;  4GPT B;  2ZPN A;  2NMB A;  3A8Q A;  3TL5 A;  1MIX A;  1TGZ B;  3DVG X;  1ZVR A;  4MGY E;  3LDZ E;  1V89 A;  4KSK C;  5JHA A;  2MBO A;  3ZNG C;  5KQ1 A;  2IO2 B;  4EEW A;  3FP5 A;  5D3V A;  2JUO A;  3RCP A;  1WX7 A;  2N1W A;  5EDS A;  5CLL B;  2YT0 A;  4TYZ A;  2DEN B;  1UZX B;  3VFK A;  1OGW A;  1WYW B;  2WYQ A;  4K7S A;  4GZU A;  2DZJ A;  3LJU X;  3PRE A;  3ZNI D;  3M95 A;  1DBH A;  2N0Y A;  2W2X C;  2LRW A;  3A98 B;  1U5F A;  1J0G A;  4A6F A;  1WGR A;  3M62 B;  5D3Y A;  3H7P B;  2IFS A;  3B08 A;  3PHX B;  1V5U A;  3UIN B;  2N9P C;  1Z2M A;  2KD0 A;  3ZNH B;  2ZEQ A;  2YS1 A;  2D9V A;  4WSF A;  3O65 B;  2XQN M;  1WJM A;  5JHG A;  2GOW A;  3ZVR A;  3RUL A;  3KRX A;  3A9K A;  4CHJ A;  3VXW A;  3QK0 A;  2L0T A;  2P0F A;  2LOX A;  1WR6 E;  2LGY A;  1UNQ A;  2DHK A;  5D2M B;  2RVB B;  3A4S C;  1K5G B;  1MK9 B;  1RRP B;  4WWN A;  2KN5 A;  2K6D B;  4ANW A;  3ZO5 B;  5HKH A;  1KM7 A;  1I2H A;  2MWN B;  2ZVO A;  3DXC A;  1Z5S B;  5C16 A;  1KOT A;  2LBB A;  3CXB B;  2JPH A;  1WZ0 A;  3P2B A;  2LUE A;  5C79 A;  2JY6 A;  2E2X A;  2D07 B;  2I1J A;  4TV3 A;  4MH0 E;  1TXD A;  4PYZ A;  5FR6 A;  1MPH A;  2IYD B;  1FHO A;  1E8Y A;  3ZNZ B;  4HCN B;  2H7D A;  2D3G A;  2KDI A;  4EFO A;  3JW0 X;  3OLM D;  3VOQ A;  4GB9 A;  4DBB A;  3T06 A;  3M1I B;  2GBM A;  1ZC3 B;  3SUZ A;  3GOE A;  1LXD A;  3BY4 B;  3RT3 B;  5GMV A;  3Q3J A;  1JRU A;  4I6P A;  3QA8 A;  4BKS A;  2DKQ A;  3OAW A;  1DYN A;  1FAO A;  3ZVV A;  1WFY A;  3K9P B;  3KSY A;  2MBH A;  2D11 A;  1WGD A;  1ST7 A;  1NVL A;  2DYN A;  4KDL B;  4DX8 A;  1IYF A;  5DPR A;  4LDT D;  3IFW B;  3U8Z A;  5HE2 A;  1OTR B;  2KNB A;  1J0W A;  3V5W A;  4K7U A;  3QWZ B;  1XR0 B;  4GMX B;  4PYU A;  5LON B;  1M7E A;  3NS8 A;  2R09 A;  4HJK A;  2KVR A;  2N9E B;  4NPN A;  5D7G A;  2Z0Q A;  2C5L C;  2LYD A;  3DBL I;  3QCA A;  4HK2 A;  2J0M A;  1MIZ B;  2IO3 B;  1TQZ A;  3DBR I;  2D9X A;  3D8F A;  3W1S C;  2Z59 B;  3DVN V;  3R3M A;  4W9J A;  2KFK A;  4FJV B;  3UGB B;  4J6I A;  1E8X A;  3VAW A;  5DPT A;  4NJ7 A;  3QQ8 B;  2COC A;  2K2U A;  3TJP A;  4URK A;  1HE8 A;  1OQN A;  4E74 A;  3DDC B;  1NTI A;  1WMH A;  1E7V A;  2KAN A;  3N32 A;  1WGQ A;  3FLV A;  5FI1 A;  1VCB A;  2I5F A;  2L76 A;  2Z0P A;  1LB1 A;  2OOB B;  1IPG A;  1UPQ A;  2BGF A;  5G55 A;  1L7Y A;  3EPY A;  5KHO A;  3PLU A;  4EUT A;  1AWE A;  1WMH B;  4W9G A;  5DCN A;  3L54 A;  3QJZ A;  2NCN A;  4OVV A;  4DDG D;  3PVW A;  2CR5 A;  2JF5 A;  2FAZ A;  2JRI B;  2DYM A;  5IAA C;  2V1Y A;  2LGX A;  3C0R B;  2FID A;  4EJN A;  3VQI A;  2K8B A;  1XKE A;  2IYB A;  3R66 C;  3BIN A;  4M0W B;  3UF8 A;  1UGM A;  3PS6 A;  5CX3 A;  3JSV A;  2EMT A;  3AU5 A;  2G4D B;  3AXC A;  1V80 A;  2L2I A;  1RAX A;  3NSU A;  1GC6 A;  4B9K A;  2LRU A;  1U4A A;  4IWO A;  2YVC A;  1XD4 A;  5AZH A;  2COA A;  3ZTC A;  4ANU A;  3JSV B;  1YX5 B;  4HAX B;  4GDL A;  1WJN A;  4HAV B;  4BOS C;  3B0A A;  1U5E A;  1EGX A;  4IUM B;  1RLF A;  2DHJ A;  2M17 A;  3TFM A;  4NAW A;  2YS3 A;  3FSS A;  3QC8 B;  2KZR A;  3CSF A;  1A5R A;  1X05 A;  3LJ3 A;  2LAS A;  1P6S A;  4JIO U;  2PZ1 A;  4GDL B;  2BCJ A;  2COF A;  2K8H A;  2UYZ B;  2ZJD A;  4WJN A;  4YON A;  2HTH A;  1FGZ A;  3VUY A;  3L0W B;  3EC8 A;  3TO1 A;  2GJY A;  1WJ6 A;  4NAW B;  1FOE A;  2O2V A;  3ML9 A;  4XZ4 A;  2DKP A;  3DBH I;  2FJ9 A;  2ZZP B;  3FEH A;  3N3K B;  3U30 A;  3DPD A;  4K1R B;  4K2P A;  1WE7 A;  2M4N A;  2IY0 B;  5D3X A;  3APC A;  4KSL C;  3PPA A;  2RQ1 A;  1I42 A;  2C7H A;  4MK0 A;  4H8S A;  3DOW A;  5CHF A;  2HTH B;  2K25 A;  4X57 B;  2NBW B;  1GNU A;  1KLV A;  2KWV B;  1WXA A;  2C60 A;  2JRH A;  3H9D A;  2AYO B;  4FLH A;  4G50 A;  2O2V B;  2M14 A;  3QBV B;  3PSE B;  1OQY A;  2KKC A;  2DZM A;  4G3X B;  2JT4 B;  1MKE A;  1UBI A;  2J59 M;  4HAY B;  2QHO A;  4CO7 A;  3SNH A;  2GBK A;  1ZC4 B;  4MDK E;  2N4F A;  2GCJ A;  3D8D A;  2YT1 A;  2IZV B;  2WX1 A;  2LUL A;  5KCV A;  3SV1 A;  5DHA B;  4IOY X;  4MT7 A;  3D32 A;  1MAI A;  1QQG A;  2LOZ A;  5DHF B;  5JP4 A;  1GJZ A;  4F8C B;  2KGX B;  5L83 A;  1XCG A;  4PS7 A;  4NQL B;  1TTN A;  3ULB A;  2KQ7 A;  4HDQ A;  2DTC A;  2NR2 A;  1HB6 A;  2ELA A;  2MRP A;  3V60 A;  2ADZ A;  3PP2 A;  2BPS A;  3KRW A;  5CTR C;  4C0A A;  5J18 A;  3QHT A;  5TR5 A;  4DHJ B;  2FCQ A;  2J0K A;  4BKS D;  2RPQ A;  2BWE S;  2AL3 A;  1EVH A;  3H7P A;  2YSZ A;  3NHE B;  4HAZ B;  1PFJ A;  2C7N B;  1WXS A;  2QKM A;  4HB0 B;  4ICV A;  2MSE D;  3MHS D;  4RMA A;  3DXD A;  3O96 A;  4GSW A;  2LXA A;  1Y5O A;  3F5R A;  1V2Y A;  4KZC A;  4A20 A;  2DHI A;  2VRW B;  3QAQ A;  3UQB A;  1E90 A;  3AJ4 A;  5D27 A;  1OMW A;  1SGH A;  2DYQ A;  2K8C A;  3ZKJ C;  4D0N B;  5CHW A;  1TJ6 A;  1ACA A;  1Q1O A;  3AUL A;  4FBJ B;  4HAT B;  1G6J A;  2FCS A;  2XK5 B;  3RZF A;  3BJI A;  3VUX A;  2J7Q B;  2EJ8 A;  4K81 A;  3EHV A;  2DYO A;  4II2 B;  4HPM B;  4MGI E;  4IM0 A;  3ZRF A;  2VRR B;  4KAX B;  2FJL A;  1J8C A;  4CHM A;  4B6H A;  3M63 B;  1ISN A;  3UZT A;  4KHO A;  1V61 A;  2CRF A;  4XX5 A;  4II3 B;  1S1Q B;  4M8N A;  3ODW A;  2M1M A;  2DFK A;  2GMI C;  2Y5B B;  4BFR A;  2BKR B;  4ZRJ A;  1L2N A;  1Z87 A;  3P6A A;  2LVQ A;  5E6N A;  4FHJ A;  2RD0 A;  4PNK A;  4GDK B;  1W1D A;  1OY2 A;  3NZS A;  2KDE B;  2CQU A;  4WJP A;  1CMX B;  3Q3F A;  4XWX A;  5EFX A;  4ZDV A;  1LW3 A;  2CKH B;  3KYC D;  2C7M B;  2GS0 A;  3SDL C;  2BKF A;  1BTK A;  1WX8 A;  1UEL A;  1XOD A;  2P0D A;  4BKG A;  2BYV E;  2ABD A;  3CMM B;  2XEW A;  2R2O A;  4JLC A;  2PPH A;  1SE9 A;  4MSQ B;  1OEY A;  1R4N I;  2D4Q A;  2KWU B;  3GYP A;  2RR9 A;  2N9X A;  4WAA A;  1E7U A;  3U7D A;  4G11 A;  1LFD A;  4KV2 A;  1WJ1 A;  1EO6 A;  4WQO B;  1WJ4 A;  4AP4 C;  1GC7 A;  3MPX A;  2A5U A;  3PVL A;  4AJY B;  5C5B A;  2Y8F A;  3HQC A;  4K17 A;  5KQ4 A;  2CS4 A;  5C6R A;  4FJZ A;  2YRY A;  4DBG A;  3ZDM C;  1WY8 A;  4W9E A;  3GYO A;  2KLG A;  2AL6 A;  3DQV A;  1FHW A;  2A4Z A;  4L6E A;  4IG7 B;  2DX1 A;  3HM6 X;  3WAL A;  3ZDT A;  2NPT A;  2ZCB A;  5C5B B;  3PZD A;  3RCZ A;  2LGD A;  2LD9 A;  3WIM A;  2CU1 A;  2C9W B;  2YS5 A;  1P9D U;  1IRS A;  2D2Q A;  2DA0 A;  4IAP A;  2Z0E B;  4G0N B;  4N9F 4;  2IO1 B;  3R7Q A;  3QIJ A;  2MP2 A;  3H7S A;  2O6V A;  4HVB A;  4M8M A;  4GMV A;  4AJW A;  2NPT B;  2EMS A;  5HE0 A;  4RM8 A;  1BAK A;  3SU8 X;  1NDD A;  2KQS A;  2ZNV C;  4GOC A;  3IVF A;  1XT9 B;  2FNJ B;  2MP2 B;  2O6V B;  3K9O B;  3OJ4 B;  2LWP A;  2BF8 B;  2MQJ A;  4RM9 A;  2ZVN A;  3ODO A;  1YQB A;  1PQS A;  4HHV A;  4WWP A;  5IA7 A;  2HRJ A;  4EZK A;  4F7G A;  2G3Q B;  4KDI C;  4IFS A;  1V5M A;  3VH3 B;  1YX6 B;  1M7R A;  5D3W A;  1U29 A;  1WXM A;  4IWQ A;  4DX9 0;  2N7E A;  4YL8 A;  3WAO A;  2K6Q A;  3PVU A;  4W9F A;  1E8Z A;  1J19 A;  2LG1 A;  4W9C A;  1U5G A;  2KX3 A;  3DXE A;  4GGQ A;  1P5T A;  3WA0 A;  2KMA A;  2DHZ A;  3UQA A;  3TCA A;  1D3Z A;  4HDO A;  3HM3 A;  4FA6 A;  3OAN A;  2MFQ A;  2COP A;  1WXV A;  3KZ1 A;  1DDM A;  3NY5 A;  4ASW C;  2D9Y A;  3KUZ A;  4F7Z A;  5CLQ B;  1NI2 A;  3T8M A;  3JVZ X;  4WVF B;  2IY1 B;  5AZF A;  4HWI B;  1V5P A;  2DAF A;  4DHJ D;  4WJO A;  5LOP B;  3T9L A;  4DHZ B;  1PLS A;  2CHW A;  3A4R A;  2KJH B;  1XX0 A;  2GBR A;  1ZSQ A;  3CF6 E;  3ZUN A;  2KTR B;  4E3C A;  2L1C A;  4GN1 A;  5J3Q A;  4FN2 A;  4HLE A;  1S3S G;  2NZ8 B;  2D10 A;  1TZ1 A;  2K1F A;  4Z2N A;  4IWP A;  4MEL A;  1UNP A;  1DDV A;  2WH5 A;  3QAR A;  2N1V A;  3ENE A;  3ONS A;  4HPL B;  3L17 A;  5DPW A;  4A3O A;  4HB3 B;  3A1Q B;  1KI1 B;  4P7I A;  4TQ0 A;  2W2W A;  3ZIM A;  4MM3 A;  1U5D A;  1SHC A;  5E6P A;  1IP9 A;  5AEK B;  1WZ3 A;  3SO6 A;  5HE3 A;  2DX5 A;  2KLC A;  2JP2 A;  3VUW A;  4EOY A;  4W9H A;  2EC1 A;  1M94 A;  2PE6 B;  4BKT A;  2K2J A;  1RJ2 A;  3AI5 A;  2KMC A;  3EFU A;  4GIV A;  2G45 B;  4BBN F;  4I6N B;  1BT0 A;  4A5K A;  1NTV A;  3CIK A;  1AQC A;  3A9J B;  2DX5 B;  2UZS A;  1EF1 A;  4W9L A;  2RSU A;  2ELB A;  5J2R A;  5DI9 B;  3WAM A;  3VTW A;  2IBI B;  1UPR A;  2KX0 A;  2DLW A;  4I6L B;  2CB8 A;  4ICU A;  4MGK E;  2Z0O A;  1H4R A;  2MWS B;  4ANX A;  2WDT B;  2OQB A;  2BYF A;  4EMO A;  1NBF C;  1WF9 A;  1WVH A;  4W9D A;  2NS5 A;  1BTN A;  1RRB A;  4TKN A;  2FDQ A;  2YLM A;  5IJM A;  1WH3 A;  4PS8 A;  2RGN B;  1EF5 A;  4LCD E;  3PG7 A;  3SYX A;  2ROV A;  1DRO A;  1I7A A;  4A6K A;  4HAU B;  3VDZ A;  4ZYN A;  4HAW B;  3RZW C;  3ZRC A;  1WIA A;  2Q13 A;  4WJ7 A;  3FM8 C;  3ZTD A;  3PLV A;  1XD3 B;  3H1U A;  4F7H A;  4CHK A;  2RLO A;  1X1M A;  4NQK E;  1VD2 A;  1X1G A;  1UD7 A;  1YIW A;  3DBS A;  4K2O A;  1P0R A;  5JH5 C;  2K00 A;  2X18 A;  1X11 A;  3B1L X;  4KHB B;  4LJP B;  1XQQ A;  2ZPY A;  2MBB B;  3HW2 B;  3VTU A;  5CHV C;  2W2X D;  4FJY A;  3IG3 A;  1HBK A;  1R4M I;  1WGY A;  4A6H A;  1V6E A;  2L0F A;  2KHW B;  1OEY J;  2GBN A;  4AWJ A;  2M0X A;  4IM3 A;  3SD5 A;  2FUH B;  3IHP C;  1QC6 A;  2GBJ A;  2V3S A;  3CST A;  2KJ6 A;  4AOF A;  2VSZ A;  3KUC B;  1WG7 A;  4KIK A;  2XK5 A;  5HE1 A;  1E8W A;  2AWT A;  5DPS A;  4EKU A;  3KH0 A;  1I35 A;  1Y19 B;  1HB8 A;  2LJ5 A;  3R7R A;  3ZLZ A;  4IC7 B;  3HHM A;  4KVG B;  1WGU A;  5BO4 B;  2PEA A;  3V6E B;  4GXB A;  4FHK A;  1P3R A;  3V61 A;  2RNR B;  1EAZ A;  2ASQ A;  2KCJ A;  3I3T B;  4KIK B;  4ANV A;  4JL9 A;  1V81 A;  2LZ6 A;  2O6V D;  1Q5W B;  3WAP A;  2MBE A;  1Q67 A;  3G9W A;  2L00 B;  4A6F B;  2Z0D B;  5L81 A;  2H7E A;  2KDB A;  2FCM A;  4GDK A;  2P0H A;  3APF A;  2DYB A;  2N7D A;  2KDF B;  2I1K A;  3KVF B;  2MW5 A;  2NBV B;  2KJR A;  2OJR A;  1V88 A;  4Y94 A;  1MG8 A;  2DN6 A;  2YF0 A;  3NOB A;  5J17 A;  5L95 C;  2GCL A;  1LQB A;  1X1F A;  3A9K B;  3GZN I;  3QX1 A;  2VKI A;  3MDB C;  2M38 A;  1F9J A;  1DDW A;  1UH6 A;  3ODX A;  2KFJ A;  4BOZ B;  4E71 A;  2CHZ A;  3VH4 B;  1FB8 A;  2J0J A;  4F1S A;  4ZRI A;  1WI0 A;  1V9J A;  3L16 A;  1ZM0 A;  1WE6 A;  4Z2M B;  2G4S A;  3PV1 A;  2MBQ A;  2N23 A;  4DXA B;  2I5C A;  2JWZ A;  2WWZ A;  2HE7 A;  3QWM A;  3D8E A;  5J3Y A;  3S2A A;  1WM2 A;  1QZE A;  2KC1 A;  4IW0 A;  3HIZ A;  1Q0W B;  1KJT A;  3IBE A;  3WYF B;  3JYU A;  2LVO A;  4OVU A;  2REX A;  3X0W A;  2L8J A;  4B6W A;  3N7C A;  2V4L A;  4JGH B;  1V86 A;  1E5W A;  2KWC A;  3APD A;  1FGY A;  2V76 A;  1UNR A;  1N3H A;  4ZRK A;  4NSW A;  2MDX A;  4DHZ E;  3A8P A;  2PJH A;  2L3Z A;  5JLJ B;  2JZZ A;  3DVN U;  3RD2 A;  1TBE A;  3TBL D;  3PGE A;  3RYT A;  4AUQ C;  3ECI A;  4MY6 A;  4MEM A;  1SIF A;  2ROZ B;  4F7U P;  1P3Q U;  2FCN A;  3VTV A;  5DH9 B;  4FUL A;  4NJ6 A;  2LXC A;  4NY0 A;  1WX9 A;  2K39 A;  1WRD B;  2CAY A;  2L7R A;  4MGZ E;  4BBN C;  4KZ0 A;  2JZ3 B;  2PE9 A;  3F0W A;  2NVU I;  2FIF A;  5J3T A;  2OTX A;  1GG3 A;  3KY9 A;  5C1Z A;  4KHA A;  1BWN A;  4FAD A;  3DCG A;  3X23 A;  1X86 A;  3SHQ A;  2KC2 A;  2RSG A;  2QKL A;  3VHT C;  2D9W A;  1W1G A;  4MJS A;  2Y7B A;  2NBU A;  3VIA A;  3HK0 A;  2CHX A;  2UWQ A;  3DVG Y;  1WGH A;  2M8S A;  4W9K A;  2IO0 B;  3L10 B;  4PQ0 A;  2KFK B;  3N30 A;  3ZW3 A;  2CY5 A;  3TVV A;  1H8C A;  3PEG A;  4EZL A;  3ML8 A;  4MJS B;  2KK8 A;  1LM8 B;  4HXD A;  3PTF C;  2RUK B;  3ULC A;  4JQW C;  4CYE A;  1WR1 A;  4BVU C;  2W9N A;  4BBK A;  5G2N A;  5DIF B;  3VVW B;  1WI1 A;  3PRM B;  1EUV B;  3W1Y A;  2MKR A;  3A33 B;  5LXI B;  3PHW B;  1YJ1 A;  2BWF A;  2KTR A;  1H10 A;  2UVM A;  1V49 A;  2LVP A;  1FXT B;  3RUI B;  2KOX A;  4NNJ B;  3KUD B;  2HD5 B;  1KZ7 A;  2CY4 A;  4DDI D;  4EZJ A;  2BYE A;  3V6C B;  1C3T A;  3TW1 A;  1UBQ A;  5GOW B;  2WX0 A;  1ZGU B;  5FI0 A;  4WJQ A;  4TQ1 A;  4HCP B;  1P98 A;  2EKE C;  2KO3 A;  4XC2 A;  2LKO A;  1T0Y A;  2MCN B;  3A1Q A;  1YD8 U;  5JZE B;  1GUA B;  3UIO B;  3MJW A;  1NU2 A;  1NTY A;  1UEF A;  3TMP B;  2P8V A;  1U27 A;  1ZW7 A;  5C23 A;  3W1S A;  5AZG A;  1KZG A;  3KW5 B;  1P1A A;  2KXJ A;  1C1Y B;  1V5O A;  4LDT B;  1V5T A;  3ALB A;  1WGG A;  5E6O A;  4HB4 B;  3A9J A;  5D6J B;  1WJU A;  2ZCC A;  2Y8G A; 
#chains in the Genus database with same CATH topology
 4K7W A;  2L05 A;  2MX2 A;  4DWF A;  3M3J A;  3PSC A;  2B3A A;  2DAJ A;  3WAN A;  2KIG A;  4Q2J A;  3RNE C;  5JHB A;  2D9Z A;  2ZNV B;  1W1H A;  1P7E A;  1E7P B;  2VZK B;  1TKG A;  1YJJ A;  3AU4 A;  2BVC A;  1K8R B;  3B77 A;  4ACF A;  2XBB C;  4EE2 A;  1YQ3 B;  1SE2 A;  4W9I A;  3MTN B;  5FKA C;  5D94 A;  3ML4 A;  4PT5 A;  2WXH A;  1RFA A;  1WSP A;  1ZKH A;  1MK7 B;  4GU2 A;  3SBG A;  2INN E;  4MSM B;  2RGF A;  5IN7 A;  1K5D B;  4WWO A;  4A55 A;  1Y8R C;  4LJO B;  1I4P A;  3P7Z A;  2JVC A;  4B0E A;  3PRP B;  1PMS A;  4PS3 A;  2R0D A;  4HRS A;  2MA9 B;  1FHX A;  1PGX A;  5IOI A;  2MLB A;  3W5V B;  3H6N A;  4B95 A;  5LLI A;  4KKI A;  3AN1 A;  1T0Q C;  4A3P A;  5LXH A;  3V62 A;  4JWS C;  3OJ3 A;  2COD A;  1JQ4 A;  1SEB D;  2LI5 A;  1U2B A;  2AEH A;  3EEC A;  3PT2 B;  2UZR A;  2R2Q A;  1E10 A;  4DK5 A;  4JPS A;  1I4G A;  1WM3 A;  1AAR A;  3W2D A;  1ZPS A;  2V0G A;  2JXX A;  3UIP B;  1B55 A;  5JHH A;  3TIX A;  2YT2 A;  4HB2 B;  3PRZ A;  3L08 A;  3KYD D;  2DZK A;  3TUO A;  4TUU A;  3L13 A;  1MFW A;  1YN4 A;  2HJ8 A;  3AEF B;  2G35 A;  2K8E A;  3RI7 C;  4KHB A;  2BB6 A;  2KTF A;  2KUP A;  3NZU A;  4OZB A;  5KHQ A;  1L0Y B;  1N63 A;  2SEB D;  4IM2 A;  2DZI A;  3MC8 A;  1T6B X;  3CIR B;  3VR9 B;  3IAS 1;  4GPT B;  2ZPN A;  4C80 A;  3HSA A;  2NMB A;  3A8Q A;  3TL5 A;  3U52 E;  1MIX A;  1TGZ B;  3DVG X;  1ZVR A;  4MGY E;  3LDZ E;  2KVZ A;  1V89 A;  4YTM B;  4KSK C;  2EKI A;  5JHA A;  2MBO A;  3ZNG C;  5KQ1 A;  2IO2 B;  3BYY B;  2I2Y A;  4EEW A;  3FP5 A;  5D3V A;  2JUO A;  1J7C A;  3HVD A;  4RH6 A;  2WXL A;  2M0A A;  3RCP A;  1WX7 A;  2N1W A;  5G5G A;  5EDS A;  1JWS D;  3IT4 B;  5CLL B;  2KUQ A;  2YT0 A;  4TYZ A;  2DEN B;  1UZX B;  5E6J A;  3VFK A;  1OGW A;  1WYW B;  5AUK A;  2WYQ A;  4K7S A;  4GZU A;  2DZJ A;  3LJU X;  3PRE A;  1JWM D;  3ZNI D;  3M95 A;  1DBH A;  3N1Y C;  2N0Y A;  2BTE A;  1MVK A;  3P4P B;  3LXF A;  2W2X C;  2LRW A;  1U5F A;  3A98 B;  1J0G A;  5TSS A;  1N60 A;  1R7S A;  3NWD A;  4C00 A;  4A6F A;  1WGR A;  3RNC C;  3M62 B;  3MJ5 A;  5D3Y A;  2E3T A;  3T3O A;  3H7P B;  2WDR B;  3ZJV A;  2IFS A;  4RF1 A;  3B08 A;  3PHX B;  1V5U A;  3UIN B;  2N9P C;  1Z2M A;  2KD0 A;  3ZNH B;  2ZEQ A;  2WXP A;  1IGD A;  3P4R B;  3Q3M C;  2YS1 A;  3EFC A;  2D9V A;  4WSF A;  3O65 B;  2XQN M;  3TEZ A;  1WJM A;  5JHG A;  2GOW A;  4N59 A;  1ROE A;  3ZVR A;  3RUL A;  2X0S A;  4HPP A;  3TEW A;  3KRX A;  2PVG C;  3A9K A;  2ICI A;  4CHJ A;  3NS1 A;  4C4V A;  3VXW A;  2MEK A;  1PFD A;  4QJ5 B;  3N1X C;  4IDI A;  2QCZ A;  3QK0 A;  5HI1 A;  2L0T A;  4LNK A;  2P0F A;  2LOX A;  1WR6 E;  2LGY A;  1AYF A;  1UNQ A;  1XXG A;  4RGN A;  2RMM A;  3ENB A;  2N9L A;  2DHK A;  3I9V 1;  5D2M B;  2RVB B;  2CJO A;  1FNV A;  4P1B C;  3A4S C;  1K5G B;  1MK9 B;  1RRP B;  2LFI A;  4WWN A;  3SFE B;  2QDF A;  2L52 A;  4C4V B;  2KN5 A;  2K6D B;  4ANW A;  3ZO5 B;  3NVV A;  5HKH A;  1KM7 A;  2JYT A;  1N6Z A;  1TS2 A;  4DIX A;  1I2H A;  2MWN B;  2ZVO A;  3DXC A;  1Z5S B;  5BMI A;  5C16 A;  4LNN A;  1KOT A;  2LBB A;  3AE1 B;  4N58 A;  5HG2 A;  1C77 A;  3E56 A;  3CXB B;  2JPH A;  1WZ0 A;  3P2B A;  1EWY C;  2M56 B;  1WWT A;  2LUE A;  5C79 A;  4RCO A;  2JY6 A;  2E2X A;  2D07 B;  2I1J A;  2IND C;  1L4Z B;  1UWX A;  2CJN A;  3AE2 B;  4ILJ A;  4TV3 A;  2UU7 A;  4MH0 E;  1GPX A;  1TS3 A;  2PLP A;  1TXD A;  3PZ8 A;  4PYZ A;  5FR6 A;  4RFB A;  4LLG M;  1MPH A;  3FIL A;  2IYD B;  1FHO A;  1E8Y A;  3ZNZ B;  4HCN B;  2H7D A;  2D3G A;  2KDI A;  4EFO A;  3JW0 X;  1C9F A;  1ZP0 B;  5IRS A;  3OLM D;  3VOQ A;  4GB9 A;  4DBB A;  3T06 A;  1FNW A;  3M1I B;  2GBM A;  1ZC3 B;  1NYQ A;  3NVY A;  3SUZ A;  3DHG C;  3GOE A;  1LXD A;  3BY4 B;  1ZXH A;  2FE8 A;  3RT3 B;  4IOI E;  1L0V B;  5GMV A;  1PGB A;  1JRU A;  3Q3J A;  4I6P A;  3QA8 A;  4BKS A;  3E66 A;  4AQ7 A;  2DKQ A;  3IT6 B;  3OAW A;  4TSS A;  1DYN A;  1KLU D;  1HZ6 A;  2YEP B;  1FAO A;  3ZVV A;  1WFY A;  3K9P B;  3KSY A;  2MBH A;  2D11 A;  1KC7 A;  1D5Z C;  1WGD A;  2ZW1 A;  1NI3 A;  1ST7 A;  3OWE B;  3TEY A;  1NVL A;  3B2F A;  2N9K A;  2DYN A;  4KDL B;  4DX8 A;  1IYF A;  4LTU A;  5DPR A;  4LDT D;  1M4V A;  4ARI A;  3IFW B;  3U8Z A;  5HE2 A;  1OTR B;  2PIA A;  2KNB A;  1D6E C;  1J0W A;  1NEK B;  3V5W A;  1IUE A;  4K7U A;  1FCL A;  3QWZ B;  1XR0 B;  2WP9 B;  2WXO A;  2D3A A;  4FXC A;  1F52 A;  3TEX A;  4GMX B;  4PYU A;  5LON B;  2G1E A;  1M7E A;  5M4Y B;  3C19 A;  2R09 A;  3NS8 A;  4HJK A;  2BS4 B;  2KVR A;  3AE9 B;  2N9E B;  4NPN A;  5D7G A;  2Z0Q A;  2C5L C;  2LYD A;  1ZDV A;  3ZGZ A;  2MJ3 A;  3DBL I;  1FD6 A;  3QCA A;  4HK2 A;  2J0M A;  1MIZ B;  2IO3 B;  2VZK D;  1FPY A;  1KH0 A;  1TQZ A;  3DBR I;  2D9X A;  3D8F A;  3RNA C;  4M00 A;  2LGI A;  3W1S C;  3FAH A;  2Z59 B;  3DVN V;  3SBT A;  2M19 A;  3R3M A;  1F0Z A;  1AN8 A;  2KFK A;  4W9J A;  2LUM A;  4FJV B;  2JWU A;  3UGB B;  4J6I A;  1T3Q A;  1NEN B;  1PUT A;  1E8X A;  3VAW A;  5DPT A;  4NJ7 A;  2IGD A;  3QQ8 B;  1QKZ A;  3I57 A;  2COC A;  2K2U A;  3TJP A;  4URK A;  1ZE3 D;  1HE8 A;  1JDE A;  1OQN A;  3Q8C A;  5JXV A;  4E74 A;  1FFV A;  3DDC B;  1NTI A;  1WMH A;  1E7V A;  1VBH A;  2KAN A;  3N32 A;  3R8B A;  1CQV A;  1WGQ A;  1J7A A;  3FLV A;  2V4I B;  2MHJ A;  4OT1 A;  5FI1 A;  1VCB A;  2I5F A;  3ZYY X;  2L76 A;  3NZ3 A;  4C7Z A;  2Z0P A;  1LB1 A;  4KX6 B;  2OOB B;  1IPG A;  1YOV B;  1UPQ A;  2PVO D;  2JZP A;  2BGF A;  5G55 A;  1SIJ A;  1L7Y A;  3EPY A;  5KHO A;  3PLU A;  4EUT A;  2PMV A;  1AWE A;  3L4P A;  1WMH B;  4W9G A;  4HSI A;  5DCN A;  3L54 A;  3I63 C;  3QJZ A;  2NCN A;  3KLS X;  4OVV A;  4DDG D;  3PVW A;  2CR5 A;  2JF5 A;  2FAZ A;  2JRI B;  2LJI A;  2DYM A;  1QOA A;  5IAA C;  2GI9 A;  4L2Y A;  2V1Y A;  2LGX A;  2OJW A;  2JQR B;  3C0R B;  3NJT A;  2FID A;  4LNI A;  4EJN A;  3AMZ A;  1FXA A;  1UNS A;  3VQI A;  2K8B A;  1PGA A;  1XKE A;  2L1A A;  2IYB A;  3R66 C;  3BIN A;  4M0W B;  3UF8 A;  1C4C A;  1UGM A;  4RGO S;  3PS6 A;  1XLO A;  5CX3 A;  1GB1 A;  3JSV A;  2EMT A;  3AU5 A;  2G4D B;  3Q2A C;  3AXC A;  1OFF A;  1V80 A;  2V9H A;  2L2I A;  1VR9 A;  3DBL B;  1FM0 D;  1RAX A;  3NSU A;  1YNT E;  1FEH A;  1GC6 A;  3DBR B;  4B9K A;  2LRU A;  1LO5 D;  1U4A A;  2W82 A;  2GLS A;  4IWO A;  4WQM A;  4A8X C;  2YVC A;  1XD4 A;  2WQY B;  5AZH A;  1SE3 A;  2COA A;  2RRF A;  3ZTC A;  2WXM A;  4ANU A;  3JSV B;  3PO0 A;  3BK1 A;  1RWS A;  5BYS A;  1YX5 B;  4HAX B;  4GDL A;  1WJN A;  4HAV B;  3LYY A;  3B0A A;  4BOS C;  1U5E A;  1EGX A;  4IUM B;  3P4S B;  1XF5 L;  3RFZ B;  1RLF A;  2KN4 A;  3SFD B;  2DHJ A;  2M17 A;  4O1N A;  1WXQ A;  3TFM A;  4NAW A;  2YS3 A;  3FSS A;  3QC8 B;  3B9J A;  4OSN A;  2KZR A;  3CSF A;  1A5R A;  1X05 A;  3LJ3 A;  3ZJT A;  2LAS A;  1P6S A;  4JIO U;  2PZ1 A;  4D2K A;  4GDL B;  2BCJ A;  2COF A;  5C2T B;  2K8H A;  1PDX A;  2UYZ B;  1EWC A;  2H88 B;  2ZJD A;  4WJN A;  4JX1 C;  4WH4 A;  1T77 A;  3GE3 C;  4YON A;  2HTH A;  1FGZ A;  1MHX A;  3IAM 1;  3L0W B;  3VUY A;  3EC8 A;  3AM9 A;  3TO1 A;  2KMM A;  3E9O A;  2GJY A;  1WJ6 A;  4NAW B;  1UWM A;  5D3D A;  3NWA A;  1FOE A;  2GB1 A;  2O2V A;  3E9S A;  3Q8B A;  1C4A A;  3ML9 A;  4XZ4 A;  2DKP A;  1NVI D;  3DBH I;  2FJ9 A;  2ZZP B;  3TSS A;  3FEH A;  3N3K B;  3U30 A;  3DPD A;  4K1R B;  4K2P A;  2QIE B;  1WE7 A;  2M4N A;  4MT5 A;  2IY0 B;  5D3X A;  3APC A;  4KSL C;  3PPA A;  1SSN A;  2RQ1 A;  1I42 A;  2C7H A;  1ZOY B;  1HTO A;  4MK0 A;  3EUB 2;  1QOB A;  4H8S A;  3DOW A;  5CHF A;  2HTH B;  2K25 A;  1VZ7 A;  2NBW B;  4X57 B;  1GNU A;  1SF0 A;  2KWV B;  1WXA A;  1KLV A;  2ACZ B;  2C60 A;  2JRH A;  1DOY A;  3H9D A;  2AYO B;  1KFY B;  5C3J B;  4FLH A;  4G50 A;  2O2V B;  3AB5 A;  2M14 A;  4AS1 A;  2KR0 A;  3QBV B;  3PSE B;  3DCX A;  1OQY A;  2KKC A;  2DZM A;  1AWD A;  4G3X B;  2NTS A;  1FRD A;  2J53 A;  2JT4 B;  1MKE A;  3W9C B;  1UBI A;  3MC0 B;  2J59 M;  4HAY B;  2QHO A;  4CO7 A;  3SNH A;  2V3N A;  3U12 A;  1ET6 A;  2GBK A;  1ZC4 B;  3KQ4 A;  4MDK E;  2QSD A;  2J52 A;  2N4F A;  2GCJ A;  4QXA B;  5IP4 D;  4JKE A;  3D8D A;  2YT1 A;  2RDB C;  2IZV B;  1V1P B;  1VZ8 A;  1F77 A;  2LUL A;  5KCV A;  2WX1 A;  4JKB A;  1BML C;  3SV1 A;  5DHA B;  4IOY X;  4MT7 A;  1N5W A;  1UUP A;  2R61 A;  1MAI A;  3D32 A;  1QQG A;  2LOZ A;  5DHF B;  5JP4 A;  3ABV B;  1GJZ A;  4F8C B;  1VBG A;  2KGX B;  5L83 A;  1XCG A;  4PS7 A;  3HIE A;  4NQL B;  1TTN A;  3DHI C;  4REZ A;  3ULB A;  2KQ7 A;  4HDQ A;  2DTC A;  2NR2 A;  4JKA A;  1HB6 A;  4NAM A;  1B1Z A;  2ELA A;  2MRP A;  3V60 A;  2ADZ A;  3PP2 A;  2BPS A;  3P63 A;  5I4D A;  2LHE A;  3ZXV A;  3KRW A;  1JAL A;  5HFY A;  2FJU B;  5CTR C;  1YJI A;  2LHD A;  4C0A A;  2LEK A;  5J18 A;  2XN9 C;  3MFG A;  4NZL B;  3QHT A;  5TR5 A;  5EE9 A;  4DXG A;  3AEE B;  4DHJ B;  1MI1 A;  2FCQ A;  1FCC C;  2J0K A;  4BKS D;  4YT0 B;  2RPQ A;  5D3I B;  3AE7 B;  3DBH B;  2BWE S;  2AL3 A;  1EVH A;  3H7P A;  2YSZ A;  1SJH D;  3AE5 B;  3NHE B;  4HAZ B;  1PFJ A;  2C7N B;  1WXS A;  2QKM A;  4HB0 B;  4ICV A;  2MSE D;  4XWT A;  3MHS D;  4RMA A;  3DXD A;  3O96 A;  1L4D B;  3AEC B;  1N61 A;  3MHZ A;  2AQ3 B;  4GSW A;  2LXA A;  1JML A;  1Y5O A;  3F5R A;  1V2Y A;  1JWB D;  4KZC A;  4A20 A;  2DHI A;  2VRW B;  3QAQ A;  3UQB A;  1E90 A;  1QQR A;  3AJ4 A;  5D27 A;  1OMW A;  3ZJU A;  1SGH A;  5BYQ A;  2DLB A;  1K51 A;  2L32 A;  2DYQ A;  2K8C A;  3ZKJ C;  4D0N B;  2WXQ A;  5CHW A;  1TY2 A;  2FUG 1;  1TJ6 A;  1ACA A;  2KT7 A;  3BII D;  3Q14 C;  1Q1O A;  3AUL A;  4FBJ B;  4HAT B;  2VH2 A;  1G6J A;  2FCS A;  2XK5 B;  3RZF A;  3VRA B;  3BJI A;  3VUX A;  2J7Q B;  2BBC A;  1GB4 A;  2EJ8 A;  4K81 A;  3EHV A;  2Y5P A;  1FRR A;  2DYO A;  4II2 B;  4HPM B;  4MGI E;  4IM0 A;  3ZRF A;  1RM6 C;  2W3S A;  1I4R A;  4KAX B;  2JSV X;  2VRR B;  2FJL A;  2NTT A;  2N0S B;  1J8C A;  4ZHP A;  4CHM A;  2Z8L A;  4B6H A;  3M63 B;  3J9C A;  1ZYI A;  1ISN A;  2KAC A;  3UZT A;  4ILG B;  4KHO A;  1V61 A;  2CRF A;  4XX5 A;  4II3 B;  1S1Q B;  3Q3O C;  3ODW A;  2M1M A;  4M8N A;  5GXG B;  5BYR A;  2DFK A;  1C76 A;  4HRO A;  2GMI C;  2Y5B B;  4BFR A;  2WU5 B;  2BKR B;  1IBX B;  4ZRJ A;  1L2N A;  1Z87 A;  3P6A A;  4CSQ A;  2LVQ A;  5E6N A;  4FHJ A;  2RD0 A;  4PNK A;  5IKC M;  4GDK B;  1W1D A;  1XEE A;  1OY2 A;  3NZS A;  3SR6 A;  2KDE B;  3AE8 B;  2X38 A;  2CQU A;  2PTL A;  3AE6 B;  4WJP A;  1CMX B;  3Q3F A;  4XWX A;  5EFX A;  4ZDV A;  1LW3 A;  2CKH B;  2AX5 A;  3KYC D;  2C7M B;  2GS0 A;  3SDL C;  2BKF A;  1BTK A;  1WX8 A;  5HHD G;  3MC9 A;  1K50 A;  1UEL A;  1XOD A;  2P0D A;  2JYE A;  4BKG A;  1YN3 A;  4YTN B;  2INP E;  2BYV E;  2ABD A;  1F2R C;  4BZA A;  3CMM B;  2XEW A;  1J7B A;  2R2O A;  4JLC A;  2PPH A;  1SE9 A;  4MSQ B;  3H8H A;  1OEY A;  2QMT A;  1TT5 B;  3N9Y C;  1R4N I;  3URY A;  2D4Q A;  2KWU B;  3ZQ4 A;  3GYP A;  2RR9 A;  2WXN A;  1OQR A;  1XLP A;  2E6X A;  2N9X A;  4WAA A;  1E7U A;  3P1M A;  3AH7 A;  4JKD A;  5BMG A;  3U7D A;  2IPK D;  3AE4 B;  1DIK A;  4G11 A;  4MH8 A;  1LFD A;  4KV2 A;  1WJ1 A;  2V3P A;  1EO6 A;  4WQO B;  1WJ4 A;  2IGG A;  4AP4 C;  1GC7 A;  3MPX A;  2A5U A;  3PVL A;  2G9H D;  2Z13 A;  1JRO A;  4AJY B;  5C5B A;  2Y8F A;  4JE3 B;  3HQC A;  1SBB B;  4K17 A;  5KQ4 A;  2CS4 A;  1HEZ E;  5C6R A;  1I7H A;  2WXR A;  4US8 A;  4FJZ A;  2YRY A;  3CWI A;  4DBG A;  3ZDM C;  3O13 A;  1WY8 A;  4W9E A;  3GYO A;  2KLG A;  2AL6 A;  3DQV A;  1FHW A;  2A4Z A;  4L6E A;  1EU4 A;  4IG7 B;  2DX1 A;  3HM6 X;  3C8Y A;  3WAL A;  2Z59 A;  3ZDT A;  2NPT A;  2ZCB A;  5C5B B;  2BT6 A;  2YEP F;  3PZD A;  2ZKM X;  3RCZ A;  2LGD A;  2LGS A;  2LD9 A;  4B0M A;  3WIM A;  2CU1 A;  3AE3 B;  2C9W B;  2YS5 A;  1P9D U;  5BMH A;  1IRS A;  2D2Q A;  2DA0 A;  4IAP A;  2Z0E B;  4G0N B;  4QAY A;  4N9F 4;  5FK9 C;  2IO1 B;  3NVW A;  3R7Q A;  3KWV A;  3QIJ A;  2MP2 A;  3H7S A;  2O6V A;  4HVB A;  4M8M A;  1V1O A;  4GMV A;  4AJW A;  2NPT B;  1I4X A;  1VLB A;  1WGK A;  4M02 A;  4YSY B;  2EMS A;  5HE0 A;  4OZA A;  2DBY A;  3BVZ A;  2K5P A;  2IDY A;  4RM8 A;  1BAK A;  3SU8 X;  3DHH C;  1NDD A;  1LGR A;  2QIL A;  3FVC A;  1V8C A;  5FR3 A;  2KQS A;  2ZNV C;  3P42 A;  4GOC A;  3IVF A;  1XT9 B;  2FNJ B;  2MP2 B;  2O6V B;  3K9O B;  1QF6 A;  1SJE D;  3OJ4 B;  2LWP A;  1DYQ A;  1TS4 A;  2BF8 B;  2K3U A;  2MQJ A;  4RM9 A;  2ZVN A;  3ODO A;  1YQB A;  1I4H A;  2DNF A;  1UF0 A;  5EE1 A;  1PQS A;  4HHV A;  1KBL A;  4WWP A;  1R4N B;  5IA7 A;  2HRJ A;  4EZK A;  4F7G A;  2G3Q B;  4KDI C;  3NG0 A;  4IFS A;  4A9A A;  2K22 A;  1V5M A;  1GAQ B;  3VH3 B;  1YX6 B;  1M7R A;  5D3W A;  1TKE A;  1YMH E;  1U29 A;  2QC8 A;  2L83 A;  1WXM A;  4IWQ A;  4DX9 0;  2N7E A;  3PZ7 A;  4YL8 A;  1ESF A;  3WAO A;  2K6Q A;  3PVU A;  4W9F A;  1E8Z A;  1J19 A;  2SAK A;  2LG1 A;  4M0W A;  4W9C A;  1U5G A;  4UDU C;  2KX3 A;  3DXE A;  4GGQ A;  4RGM A;  1P5T A;  3WA0 A;  4S17 A;  2KMA A;  2DHZ A;  1TKY A;  2D3C A;  3UQA A;  3TCA A;  2GRI A;  1D3Z A;  2KIE A;  4HDO A;  3HM3 A;  1D4B A;  1FNU A;  4FA6 A;  2KAJ A;  4ITK A;  3OAN A;  2MFQ A;  4OZC A;  3U4E G;  2COP A;  1WXV A;  3KZ1 A;  2AQ2 B;  1DDM A;  3NY5 A;  4ASW C;  2D9Y A;  3KUZ A;  4F7Z A;  2HTM E;  5CLQ B;  1NI2 A;  3T8M A;  1T0R C;  3JVZ X;  4WVF B;  2IY1 B;  1ZDX A;  5AZF A;  4HWI B;  1V5P A;  4RGT A;  2DAF A;  2D3B A;  5I2S A;  4DHJ D;  4WJO A;  5LOP B;  3IXS A;  3U2S C;  3T9L A;  3GB1 A;  4DHZ B;  4GLS C;  1PLS A;  2CHW A;  4R3D A;  3A4R A;  2KJH B;  4JWU C;  1XX0 A;  2GBR A;  1ZSQ A;  3DWG C;  2WLB A;  3CF6 E;  3ZUN A;  3VR8 B;  4C56 C;  4YTP B;  1E0Z A;  1MHH E;  3HUI A;  2KTR B;  1IGC A;  2QEJ C;  2PW9 A;  4E3C A;  2L1C A;  4GN1 A;  5J3Q A;  4FN2 A;  1FFU A;  4HLE A;  1S3S G;  2MH7 A;  4J3O D;  2NZ8 B;  2D10 A;  1TZ1 A;  2K1F A;  3NVZ A;  4Z2N A;  4IWP A;  3WCQ A;  1KTK A;  4MEL A;  4KGS A;  1UNP A;  1T0S C;  3V3X A;  1DDV A;  1EM7 A;  2WH5 A;  3Q3N C;  3GP7 A;  3QAR A;  1P7F A;  2N1V A;  3ENE A;  3RNF C;  3ONS A;  1QOF A;  4HPL B;  3HRD D;  3L17 A;  5DPW A;  2HJ1 A;  4A3O A;  4HB3 B;  3A1Q B;  1L6V A;  1K53 A;  2DWQ A;  1XLN A;  1KI1 B;  2RPV A;  1T5X D;  4P7I A;  4TQ0 A;  2W2W A;  3ZIM A;  4MM3 A;  1U5D A;  1SHC A;  5E6P A;  1FXI A;  3NUH B;  3GE8 C;  1IP9 A;  2Y5C A;  5AEK B;  1WZ3 A;  4LNO A;  1Y56 A;  4L1B A;  1ACC A;  2Q5W D;  3SO6 A;  3DWM A;  1CZP A;  1OQQ A;  5HE3 A;  2DX5 A;  2KLC A;  2JP2 A;  3VUW A;  4EOY A;  1WRI A;  2DIK A;  3KWL A;  4W9H A;  2EC1 A;  1M94 A;  2PE6 B;  3B2G A;  4JK9 A;  5IO9 A;  1I4Q A;  4BKT A;  2K2J A;  1RJ2 A;  4MM3 B;  3AI5 A;  2LMC A;  2KMC A;  3EFU A;  2WDQ B;  4GIV A;  2G45 B;  4BBN F;  4I6N B;  1BT0 A;  4A5K A;  2WDV B;  1NTV A;  3CIK A;  1AQC A;  3A9J B;  2JU6 X;  1A70 A;  1E6E B;  2DX5 B;  2UZS A;  1EF1 A;  2PKO A;  1JRP A;  4W9L A;  2RSU A;  2ELB A;  3I5J C;  5J2R A;  3AEG B;  5DI9 B;  3WAM A;  4QJ3 B;  3VTW A;  1BXT A;  2J4X A;  1V1P A;  1NYR A;  2IBI B;  1UPR A;  2KX0 A;  2DLW A;  4I6L B;  2CB8 A;  4ICU A;  4MGK E;  2Z0O A;  1H4R A;  2MWS B;  4ANX A;  2WDT B;  2OQB A;  2BYF A;  4EMO A;  1N62 A;  1NBF C;  4IKG A;  3RN9 C;  1WF9 A;  1WVH A;  4W9D A;  2NS5 A;  1VDV A;  1BTN A;  1RRB A;  4TKN A;  4DQO C;  4GOU A;  2JX5 A;  5LG4 B;  2FDQ A;  2YLM A;  5IJM A;  1WH3 A;  4PS8 A;  2RGN B;  1EF5 A;  4LCD E;  3PG7 A;  4L23 A;  3SYX A;  2ROV A;  5H92 C;  1DRO A;  1I7A A;  4A6K A;  4HAU B;  2WXJ A;  2KWD A;  3VDZ A;  4ZYN A;  4HAW B;  3RZW C;  4XDD A;  2W3R A;  4ZRQ A;  3ZRC A;  1SE4 A;  1DOI A;  1WIA A;  2Q13 A;  4WJ7 A;  4JKH A;  3FM8 C;  4NJC A;  3ZTD A;  2H89 B;  3PLV A;  1XD3 B;  1RFK A;  4F7H A;  3H1U A;  1DOX A;  4CHK A;  2RLO A;  1X1M A;  4NQK E;  1E9M A;  4HKQ A;  1VD2 A;  1X1G A;  1UD7 A;  1YIW A;  1C79 A;  3BWU D;  1DGJ A;  1XCT L;  1B9R A;  3DBS A;  4K2O A;  1P0R A;  5JH5 C;  2K00 A;  2X18 A;  2MJE A;  1X11 A;  3B1L X;  4KHB B;  4LJP B;  1XQQ A;  2ZPY A;  1CJE A;  3HW2 B;  2MBB B;  4XDC A;  4HEA 1;  3VTU A;  2WXI A;  2BS2 B;  2W2X D;  2K9X A;  5CHV C;  2VH1 A;  1L0X B;  4FJY A;  4C7Y A;  3IG3 A;  4P6V F;  3W5U B;  1HBK A;  1R4M I;  2KDM A;  1QIL A;  1WGY A;  4A6H A;  1V6E A;  2L0F A;  2KHW B;  4JKF A;  1OEY J;  2GBN A;  2ZW0 A;  4AWJ A;  1ZXI A;  3BVM A;  4MAC A;  2M0X A;  4IM3 A;  3SD5 A;  2FUH B;  1STE A;  1MJD A;  3IHP C;  1QC6 A;  2JXT A;  4WAF A;  1D5M C;  2GBJ A;  2V3S A;  1CK1 A;  1VJK A;  2QJL A;  3CST A;  2KJ6 A;  4K3B A;  4AOF A;  2VSZ A;  3KUC B;  1WG7 A;  4KIK A;  5JVL A;  2XK5 A;  5HE1 A;  4K3C A;  1E8W A;  1XCQ L;  2AWT A;  5DPS A;  4EKU A;  3KH0 A;  1I35 A;  1Y19 B;  1HB8 A;  2LJ5 A;  2D5G A;  1HQR D;  1ET9 A;  3R7R A;  3ZLZ A;  4IC7 B;  3HHM A;  4KVG B;  1WGU A;  5BO4 B;  2PEA A;  5EE3 A;  1QOG A;  4GXB A;  4FHK A;  2ONQ A;  3V6E B;  3U7Z A;  4M01 A;  2BW2 A;  1P3R A;  3V61 A;  1YN5 A;  2RNR B;  1EAZ A;  2ASQ A;  2W55 A;  2KCJ A;  3I3T B;  5AUI A;  4KIK B;  1JW9 D;  3LB8 C;  4ANV A;  4JL9 A;  1V81 A;  2LZ6 A;  2O6V D;  1Q5W B;  3WAP A;  2NBV A;  1TZO A;  1V97 A;  1FMA D;  2MBE A;  1Q67 A;  4YSX B;  3G9W A;  1TJE A;  2L00 B;  1IBX A;  4A6F B;  1XLQ A;  2Z0D B;  5L81 A;  1PYW D;  2H7E A;  2KDB A;  2R82 A;  1TS5 A;  2FCM A;  4GDK A;  2P0H A;  2Z4D A;  1L5P A;  2I38 A;  3APF A;  4LNF A;  2DYB A;  3OHM B;  1MG4 A;  3Q6B A;  2N7D A;  4BAX A;  2KDF B;  2I1K A;  3KVF B;  4LK0 M;  2MW5 A;  2NBV B;  4HJG E;  1EU3 A;  1GGO A;  2KJR A;  2CU3 A;  2OJR A;  1V88 A;  4Y94 A;  1MG8 A;  5EE0 A;  1KF6 B;  2DN6 A;  2YF0 A;  3NOB A;  2WGS A;  5J17 A;  5L95 C;  2GCL A;  1C4P A;  1LQB A;  2R2Y A;  4YXD B;  1X1F A;  3A9K B;  3GZN I;  3QX1 A;  3ZXR A;  2VKI A;  3MDB C;  3T3N A;  2FBW B;  2WXF A;  2M38 A;  1SXT A;  1KRH A;  2K0P A;  1F9J A;  1DDW A;  1UH6 A;  3ODX A;  2KFJ A;  4BOZ B;  4E71 A;  2CHZ A;  1R4M B;  3VH4 B;  1YQ4 B;  3FC4 A;  1FB8 A;  1ZUD 2;  3AEB B;  1QT9 A;  2TSS A;  2J0J A;  4H2A A;  4F1S A;  4ZRI A;  3AV8 A;  1BUI C;  1WI0 A;  4USA A;  1V9J A;  3R2T A;  3L16 A;  3SEB A;  1ZM0 A;  1WE6 A;  4Z2M B;  2G4S A;  1RYJ A;  3PV1 A;  4OVZ A;  5T8I A;  2MBQ A;  2J42 A;  2N23 A;  2WNM A;  3Q8E A;  4DXA B;  4RF0 A;  2I5C A;  5I2M A;  3EA6 A;  2IJ0 A;  2JWZ A;  2WWZ A;  2HE7 A;  3QWM A;  1XO3 A;  3D8E A;  5J3Y A;  3S2A A;  2RDG A;  4ZHO A;  1WM2 A;  4XWW A;  1QZE A;  4JK7 A;  4N6E B;  4XE0 A;  1HZ5 A;  2WHI A;  2KC1 A;  4IW0 A;  4XYC A;  3HIZ A;  1Q0W B;  1KJT A;  3IBE A;  3WYF B;  3JYU A;  1HTQ A;  2LVO A;  4OVU A;  1Q10 A;  2REX A;  3HVZ A;  3X0W A;  3FKY A;  2L8J A;  4B6W A;  3N7C A;  2V4L A;  3RMK C;  4JGH B;  2OED A;  1V86 A;  1E5W A;  2KWC A;  3AEA B;  3APD A;  4JK8 A;  1FGY A;  2V76 A;  3V05 A;  3FIL B;  1TY0 A;  1KLG D;  1UNR A;  1N3H A;  4ZRK A;  4NSW A;  2MDX A;  4WUR A;  4DHZ E;  3E9L A;  3P4Q B;  2WXK A;  3A8P A;  2PJH A;  3BVG A;  2L3Z A;  3RPF C;  1GOZ A;  5JLJ B;  4P1C C;  4ILH A;  2JZZ A;  1JCK B;  3DVN U;  3RD2 A;  3VRB B;  1N5X A;  4PK1 A;  1TBE A;  3TBL D;  3BK2 A;  1F2R I;  3BYT B;  3PGE A;  3RYT A;  3RNG C;  4AUQ C;  4JKG A;  3ETR A;  3ECI A;  4MY6 A;  1WYG A;  4MEM A;  2WS3 B;  1SIF A;  3N20 C;  2ON8 A;  4JKC A;  1TIF A;  2ROZ B;  4F7U P;  1P3Q U;  2FCN A;  3VTV A;  5DH9 B;  4OW0 A;  4FUL A;  1HA5 A;  4DXF A;  2KQ4 X;  2OHF A;  2BYT A;  3GZN B;  4US9 A;  4NJ6 A;  2INC C;  2LXC A;  4NY0 A;  1WX9 A;  2N7J A;  2GUM A;  2K39 A;  1WRD B;  2CAY A;  2L7R A;  4MGZ E;  4BBN C;  4KZ0 A;  2JZ3 B;  4OHJ A;  2PE9 A;  3F0W A;  4JKG B;  2NVU I;  2FIF A;  2XNA C;  2MJD A;  5J3T A;  2OTX A;  1GG3 A;  3NW8 A;  1K52 A;  4ZYS A;  3KY9 A;  5C1Z A;  4KHA A;  1C78 A;  4XGA B;  1TYG B;  4KGT A;  1BWN A;  4FAD A;  4D6W A;  3DCG A;  3X23 A;  1QLB B;  1X86 A;  4HKZ E;  3SHQ A;  3R2I A;  1FIQ A;  4TMA B;  2KC2 A;  2RSG A;  2QKL A;  1VZ6 A;  2AQ1 B;  3VHT C;  2D9W A;  1W1G A;  4MJS A;  2Y7B A;  2NBU A;  3VIA A;  2IGH A;  3HK0 A;  3UI3 A;  2CHX A;  2UWQ A;  4A6Q A;  1SB3 C;  3NWF A;  3DVG Y;  1WGH A;  2M8S A;  1ENF A;  4W9K A;  2EEL A;  5G5H A;  2IO0 B;  3L10 B;  4PQ0 A;  2KFK B;  2X8X X;  3N30 A;  2WXG A;  3ZW3 A;  4ZRP A;  2CY5 A;  4KKJ A;  3TVV A;  1H8C A;  3PEG A;  2KYW A;  4EZL A;  3ML8 A;  4MJS B;  2KK8 A;  4L1R A;  1LM8 B;  4HXD A;  3PTF C;  2RUK B;  4QJ4 B;  3ULC A;  4JQW C;  4CYE A;  1WR1 A;  5H8Y E;  4BVU C;  2W9N A;  3N1Z C;  3NRZ A;  4BBK A;  5G2N A;  2HDE A;  5DIF B;  3VVW B;  1WI1 A;  3PRM B;  3OG5 A;  1EUV B;  3W1Y A;  2MKR A;  3A33 B;  5LXI B;  2Z14 A;  2WU2 B;  3PHW B;  1YJ1 A;  2BWF A;  2KTR A;  3AED B;  1H10 A;  2UVM A;  1V49 A;  4P16 A;  2LVP A;  3A58 A;  1JWU D;  1FXT B;  3EGR A;  3RUI B;  1MI0 A;  2KOX A;  2W54 A;  4NNJ B;  4ZOH C;  3KUD B;  3Q69 A;  2HD5 B;  1KZ7 A;  2CY4 A;  4WIP A;  4DDI D;  2BYE A;  4EZJ A;  2Y3A A;  3E9P A;  3Q8A A;  3V6C B;  3TW1 A;  1C3T A;  1UBQ A;  5GOW B;  1F1H A;  2WX0 A;  1ZGU B;  5FI0 A;  3MP9 A;  4WJQ A;  5MPO A;  2NMQ A;  1AW7 A;  4YSZ B;  1HXY D;  4TQ1 A;  4HCP B;  3BZD B;  4A90 A;  1P98 A;  2EKE C;  2KO3 A;  4XC2 A;  2LKO A;  1T0Y A;  3GS2 A;  2MCN B;  3A1Q A;  1L6U A;  1YD8 U;  5LNK 1;  2BQQ A;  5JZE B;  1UGJ A;  1GUA B;  2B76 B;  3UIO B;  3MJW A;  1NU2 A;  4KGR A;  4S0R A;  3RNB C;  1NTY A;  1UEF A;  3TMP B;  2P8V A;  1U27 A;  4GNK B;  1ZW7 A;  5C23 A;  2BS3 B;  3W1S A;  4YWG G;  4ARC A;  5AZG A;  4RNA A;  1KZG A;  2RDH A;  3KW5 B;  4CQN A;  3Q8F A;  1P1A A;  2KXJ A;  1C1Y B;  1VRA B;  1JWA D;  1V5O A;  4LDT B;  1V5T A;  4WWM A;  2K49 A;  3ALB A;  1MPE A;  1WGG A;  5E6O A;  2BB5 A;  4HB4 B;  1D5X C;  1FO4 A;  3A9J A;  5D6J B;  1WJU A;  2ZCC A;  2Y8G A; 
#chains in the Genus database with same CATH homology
 4K7W A;  2L05 A;  2MX2 A;  4DWF A;  3M3J A;  3PSC A;  2B3A A;  2DAJ A;  3WAN A;  5JHB A;  2D9Z A;  2ZNV B;  1W1H A;  3AU4 A;  1K8R B;  2XBB C;  4W9I A;  3MTN B;  5D94 A;  3ML4 A;  1RFA A;  1ZKH A;  1MK7 B;  4GU2 A;  3SBG A;  4MSM B;  2RGF A;  1K5D B;  4WWO A;  1Y8R C;  4LJO B;  3P7Z A;  2JVC A;  3PRP B;  1PMS A;  4PS3 A;  2R0D A;  2MA9 B;  1FHX A;  2MLB A;  3H6N A;  4B95 A;  5LLI A;  4A3P A;  5LXH A;  3V62 A;  3OJ3 A;  2COD A;  2LI5 A;  1U2B A;  2AEH A;  3EEC A;  3PT2 B;  2UZR A;  2R2Q A;  4DK5 A;  1WM3 A;  1AAR A;  2JXX A;  3UIP B;  1B55 A;  5JHH A;  3TIX A;  4HB2 B;  3PRZ A;  3L08 A;  3KYD D;  2DZK A;  4TUU A;  3L13 A;  2HJ8 A;  2G35 A;  2KTF A;  2KUP A;  3NZU A;  5KHQ A;  4IM2 A;  2DZI A;  4GPT B;  2ZPN A;  2NMB A;  3A8Q A;  3TL5 A;  1MIX A;  1TGZ B;  3DVG X;  1ZVR A;  4MGY E;  3LDZ E;  1V89 A;  4KSK C;  5JHA A;  2MBO A;  3ZNG C;  5KQ1 A;  2IO2 B;  4EEW A;  3FP5 A;  5D3V A;  2JUO A;  3RCP A;  1WX7 A;  2N1W A;  5EDS A;  5CLL B;  2YT0 A;  4TYZ A;  2DEN B;  1UZX B;  3VFK A;  1OGW A;  1WYW B;  2WYQ A;  4K7S A;  4GZU A;  2DZJ A;  3LJU X;  3PRE A;  3ZNI D;  3M95 A;  1DBH A;  2N0Y A;  2W2X C;  2LRW A;  1U5F A;  3A98 B;  1J0G A;  4A6F A;  1WGR A;  3M62 B;  5D3Y A;  3H7P B;  2IFS A;  3B08 A;  3PHX B;  1V5U A;  3UIN B;  2N9P C;  1Z2M A;  2KD0 A;  3ZNH B;  2ZEQ A;  2YS1 A;  2D9V A;  4WSF A;  3O65 B;  2XQN M;  1WJM A;  5JHG A;  2GOW A;  3ZVR A;  3RUL A;  2X0S A;  3KRX A;  3A9K A;  4CHJ A;  3VXW A;  3QK0 A;  2L0T A;  2P0F A;  2LOX A;  1WR6 E;  2LGY A;  1UNQ A;  3ENB A;  2DHK A;  5D2M B;  2RVB B;  3A4S C;  1K5G B;  1MK9 B;  1RRP B;  4WWN A;  2KN5 A;  2K6D B;  4ANW A;  3ZO5 B;  5HKH A;  1KM7 A;  1I2H A;  2MWN B;  2ZVO A;  3DXC A;  1Z5S B;  5C16 A;  1KOT A;  2LBB A;  3CXB B;  2JPH A;  1WZ0 A;  3P2B A;  2LUE A;  5C79 A;  2JY6 A;  2E2X A;  2D07 B;  2I1J A;  4ILJ A;  4TV3 A;  4MH0 E;  1TXD A;  4PYZ A;  5FR6 A;  1MPH A;  2IYD B;  1FHO A;  1E8Y A;  3ZNZ B;  4HCN B;  2H7D A;  2D3G A;  2KDI A;  4EFO A;  3JW0 X;  3OLM D;  3VOQ A;  4GB9 A;  4DBB A;  3T06 A;  3M1I B;  2GBM A;  1ZC3 B;  3SUZ A;  3GOE A;  1LXD A;  3BY4 B;  3RT3 B;  5GMV A;  3Q3J A;  1JRU A;  4I6P A;  3QA8 A;  4BKS A;  3E66 A;  2DKQ A;  3OAW A;  1DYN A;  1FAO A;  3ZVV A;  1WFY A;  3K9P B;  3KSY A;  2MBH A;  2D11 A;  1KC7 A;  1WGD A;  1ST7 A;  1NVL A;  2DYN A;  4KDL B;  4DX8 A;  1IYF A;  5DPR A;  4LDT D;  3IFW B;  3U8Z A;  5HE2 A;  1OTR B;  2KNB A;  1J0W A;  3V5W A;  4K7U A;  3QWZ B;  1XR0 B;  4GMX B;  4PYU A;  5LON B;  1M7E A;  3NS8 A;  2R09 A;  4HJK A;  2KVR A;  2N9E B;  4NPN A;  5D7G A;  2Z0Q A;  2C5L C;  2LYD A;  3DBL I;  3QCA A;  4HK2 A;  2J0M A;  1MIZ B;  2IO3 B;  1TQZ A;  3DBR I;  2D9X A;  3D8F A;  3W1S C;  2Z59 B;  3DVN V;  3SBT A;  3R3M A;  4W9J A;  2KFK A;  4FJV B;  3UGB B;  4J6I A;  1E8X A;  3VAW A;  5DPT A;  4NJ7 A;  3QQ8 B;  2COC A;  2K2U A;  3TJP A;  4URK A;  1HE8 A;  1JDE A;  1OQN A;  4E74 A;  3DDC B;  1NTI A;  1WMH A;  1E7V A;  1VBH A;  2KAN A;  3N32 A;  1WGQ A;  3FLV A;  5FI1 A;  1VCB A;  2I5F A;  2L76 A;  2Z0P A;  1LB1 A;  2OOB B;  1IPG A;  1UPQ A;  2BGF A;  5G55 A;  1L7Y A;  3EPY A;  5KHO A;  3PLU A;  4EUT A;  1AWE A;  1WMH B;  4W9G A;  5DCN A;  3L54 A;  3QJZ A;  2NCN A;  4OVV A;  4DDG D;  3PVW A;  2CR5 A;  2JF5 A;  2FAZ A;  2JRI B;  2DYM A;  5IAA C;  2V1Y A;  2LGX A;  3C0R B;  2FID A;  4EJN A;  3VQI A;  2K8B A;  1XKE A;  2IYB A;  3R66 C;  3BIN A;  4M0W B;  3UF8 A;  1UGM A;  3PS6 A;  5CX3 A;  3JSV A;  2EMT A;  3AU5 A;  2G4D B;  3AXC A;  1V80 A;  2L2I A;  1RAX A;  3NSU A;  1GC6 A;  4B9K A;  2LRU A;  1U4A A;  4IWO A;  2YVC A;  1XD4 A;  5AZH A;  2COA A;  3ZTC A;  4ANU A;  3JSV B;  1YX5 B;  4HAX B;  4GDL A;  1WJN A;  4HAV B;  4BOS C;  3B0A A;  1U5E A;  1EGX A;  4IUM B;  1RLF A;  2DHJ A;  2M17 A;  3TFM A;  4NAW A;  2YS3 A;  3FSS A;  3QC8 B;  2KZR A;  3CSF A;  1A5R A;  1X05 A;  3LJ3 A;  2LAS A;  1P6S A;  4JIO U;  2PZ1 A;  4GDL B;  2BCJ A;  2COF A;  2K8H A;  2UYZ B;  2ZJD A;  4WJN A;  4YON A;  2HTH A;  1FGZ A;  3VUY A;  3L0W B;  3EC8 A;  3TO1 A;  3E9O A;  2GJY A;  1WJ6 A;  4NAW B;  1FOE A;  2O2V A;  3ML9 A;  4XZ4 A;  2DKP A;  3DBH I;  2FJ9 A;  2ZZP B;  3FEH A;  3N3K B;  3U30 A;  3DPD A;  4K1R B;  4K2P A;  1WE7 A;  2M4N A;  2IY0 B;  5D3X A;  3APC A;  4KSL C;  3PPA A;  2RQ1 A;  1I42 A;  2C7H A;  4MK0 A;  4H8S A;  3DOW A;  5CHF A;  2HTH B;  2K25 A;  4X57 B;  2NBW B;  1GNU A;  1KLV A;  2KWV B;  1WXA A;  2C60 A;  2JRH A;  3H9D A;  2AYO B;  4FLH A;  4G50 A;  2O2V B;  2M14 A;  3QBV B;  3PSE B;  1OQY A;  2KKC A;  2DZM A;  4G3X B;  2JT4 B;  1MKE A;  1UBI A;  2J59 M;  4HAY B;  2QHO A;  4CO7 A;  3SNH A;  2GBK A;  1ZC4 B;  4MDK E;  2N4F A;  2GCJ A;  4JKE A;  3D8D A;  2YT1 A;  2IZV B;  2WX1 A;  2LUL A;  5KCV A;  4JKB A;  3SV1 A;  5DHA B;  4IOY X;  4MT7 A;  3D32 A;  1MAI A;  1QQG A;  2LOZ A;  5DHF B;  5JP4 A;  1GJZ A;  4F8C B;  1VBG A;  2KGX B;  5L83 A;  1XCG A;  4PS7 A;  4NQL B;  1TTN A;  3ULB A;  2KQ7 A;  4HDQ A;  2DTC A;  2NR2 A;  4JKA A;  1HB6 A;  2ELA A;  2MRP A;  3V60 A;  2ADZ A;  3PP2 A;  2BPS A;  3KRW A;  5CTR C;  4C0A A;  5J18 A;  3QHT A;  5TR5 A;  4DHJ B;  2FCQ A;  2J0K A;  4BKS D;  2RPQ A;  2BWE S;  2AL3 A;  1EVH A;  3H7P A;  2YSZ A;  3NHE B;  4HAZ B;  1PFJ A;  2C7N B;  1WXS A;  2QKM A;  4HB0 B;  4ICV A;  2MSE D;  3MHS D;  4RMA A;  3DXD A;  3O96 A;  4GSW A;  2LXA A;  1Y5O A;  3F5R A;  1V2Y A;  4KZC A;  4A20 A;  2DHI A;  2VRW B;  3QAQ A;  3UQB A;  1E90 A;  3AJ4 A;  5D27 A;  1OMW A;  1SGH A;  2DYQ A;  2K8C A;  3ZKJ C;  4D0N B;  5CHW A;  1TJ6 A;  1ACA A;  1Q1O A;  3AUL A;  4FBJ B;  4HAT B;  1G6J A;  2FCS A;  2XK5 B;  3RZF A;  3BJI A;  3VUX A;  2J7Q B;  2EJ8 A;  4K81 A;  3EHV A;  2DYO A;  4II2 B;  4HPM B;  4MGI E;  4IM0 A;  3ZRF A;  2VRR B;  4KAX B;  2FJL A;  1J8C A;  4CHM A;  4B6H A;  3M63 B;  1ISN A;  3UZT A;  4ILG B;  4KHO A;  1V61 A;  2CRF A;  4XX5 A;  4II3 B;  1S1Q B;  4M8N A;  3ODW A;  2M1M A;  2DFK A;  2GMI C;  2Y5B B;  4BFR A;  2BKR B;  4ZRJ A;  1L2N A;  1Z87 A;  3P6A A;  2LVQ A;  5E6N A;  4FHJ A;  2RD0 A;  4PNK A;  4GDK B;  1W1D A;  1OY2 A;  3NZS A;  2KDE B;  2CQU A;  4WJP A;  1CMX B;  3Q3F A;  4XWX A;  5EFX A;  4ZDV A;  1LW3 A;  2CKH B;  3KYC D;  2C7M B;  2GS0 A;  3SDL C;  2BKF A;  1BTK A;  1WX8 A;  1UEL A;  1XOD A;  2P0D A;  4BKG A;  2BYV E;  2ABD A;  3CMM B;  2XEW A;  2R2O A;  4JLC A;  2PPH A;  1SE9 A;  4MSQ B;  1OEY A;  1R4N I;  2D4Q A;  2KWU B;  3GYP A;  2RR9 A;  2N9X A;  4WAA A;  1E7U A;  4JKD A;  3U7D A;  4G11 A;  1DIK A;  1LFD A;  4KV2 A;  1WJ1 A;  1EO6 A;  4WQO B;  1WJ4 A;  4AP4 C;  1GC7 A;  3MPX A;  2A5U A;  3PVL A;  4AJY B;  5C5B A;  2Y8F A;  3HQC A;  4K17 A;  5KQ4 A;  2CS4 A;  5C6R A;  4FJZ A;  2YRY A;  4DBG A;  3ZDM C;  1WY8 A;  4W9E A;  3GYO A;  2KLG A;  2AL6 A;  3DQV A;  1FHW A;  2A4Z A;  4L6E A;  4IG7 B;  2DX1 A;  3HM6 X;  3WAL A;  3ZDT A;  2NPT A;  2ZCB A;  5C5B B;  3PZD A;  3RCZ A;  2LGD A;  2LD9 A;  3WIM A;  2CU1 A;  2C9W B;  2YS5 A;  1P9D U;  1IRS A;  2D2Q A;  2DA0 A;  4IAP A;  2Z0E B;  4G0N B;  4N9F 4;  2IO1 B;  3R7Q A;  3QIJ A;  2MP2 A;  3H7S A;  2O6V A;  4HVB A;  4M8M A;  4GMV A;  4AJW A;  2NPT B;  2EMS A;  5HE0 A;  4RM8 A;  1BAK A;  3SU8 X;  1NDD A;  2KQS A;  2ZNV C;  4GOC A;  3IVF A;  1XT9 B;  2FNJ B;  2MP2 B;  2O6V B;  3K9O B;  3OJ4 B;  2LWP A;  2BF8 B;  2MQJ A;  4RM9 A;  2ZVN A;  3ODO A;  1YQB A;  1PQS A;  4HHV A;  1KBL A;  4WWP A;  5IA7 A;  2HRJ A;  4EZK A;  4F7G A;  2G3Q B;  4KDI C;  4IFS A;  1V5M A;  3VH3 B;  1YX6 B;  1M7R A;  5D3W A;  1U29 A;  1WXM A;  4IWQ A;  4DX9 0;  2N7E A;  4YL8 A;  3WAO A;  2K6Q A;  3PVU A;  4W9F A;  1E8Z A;  1J19 A;  2LG1 A;  4W9C A;  1U5G A;  2KX3 A;  3DXE A;  4GGQ A;  1P5T A;  3WA0 A;  2KMA A;  2DHZ A;  3UQA A;  3TCA A;  1D3Z A;  4HDO A;  3HM3 A;  4FA6 A;  3OAN A;  2MFQ A;  2COP A;  1WXV A;  3KZ1 A;  1DDM A;  3NY5 A;  4ASW C;  2D9Y A;  3KUZ A;  4F7Z A;  5CLQ B;  1NI2 A;  3T8M A;  3JVZ X;  4WVF B;  2IY1 B;  5AZF A;  4HWI B;  1V5P A;  2DAF A;  4DHJ D;  4WJO A;  5LOP B;  3T9L A;  4DHZ B;  1PLS A;  2CHW A;  3A4R A;  2KJH B;  1XX0 A;  2GBR A;  1ZSQ A;  3CF6 E;  3ZUN A;  2KTR B;  4E3C A;  2L1C A;  4GN1 A;  5J3Q A;  4FN2 A;  4HLE A;  1S3S G;  2NZ8 B;  2D10 A;  1TZ1 A;  2K1F A;  4Z2N A;  4IWP A;  4MEL A;  1UNP A;  1DDV A;  2WH5 A;  3QAR A;  2N1V A;  3ENE A;  3ONS A;  4HPL B;  3L17 A;  5DPW A;  4A3O A;  4HB3 B;  3A1Q B;  1KI1 B;  4P7I A;  4TQ0 A;  2W2W A;  3ZIM A;  4MM3 A;  1U5D A;  1SHC A;  5E6P A;  1IP9 A;  5AEK B;  1WZ3 A;  3SO6 A;  5HE3 A;  2DX5 A;  2KLC A;  2JP2 A;  3VUW A;  4EOY A;  2DIK A;  4W9H A;  2EC1 A;  1M94 A;  2PE6 B;  4JK9 A;  4BKT A;  2K2J A;  1RJ2 A;  3AI5 A;  2KMC A;  3EFU A;  4GIV A;  2G45 B;  4BBN F;  4I6N B;  1BT0 A;  4A5K A;  1NTV A;  3CIK A;  1AQC A;  3A9J B;  2DX5 B;  2UZS A;  1EF1 A;  4W9L A;  2RSU A;  2ELB A;  5J2R A;  5DI9 B;  3WAM A;  3VTW A;  2IBI B;  1UPR A;  2KX0 A;  2DLW A;  4I6L B;  2CB8 A;  4ICU A;  4MGK E;  2Z0O A;  1H4R A;  2MWS B;  4ANX A;  2WDT B;  2OQB A;  2BYF A;  4EMO A;  1NBF C;  1WF9 A;  1WVH A;  4W9D A;  2NS5 A;  1BTN A;  1RRB A;  4TKN A;  2FDQ A;  2YLM A;  5IJM A;  1WH3 A;  4PS8 A;  2RGN B;  1EF5 A;  4LCD E;  3PG7 A;  3SYX A;  2ROV A;  1DRO A;  1I7A A;  4A6K A;  4HAU B;  3VDZ A;  4ZYN A;  4HAW B;  3RZW C;  3ZRC A;  1WIA A;  2Q13 A;  4WJ7 A;  4JKH A;  3FM8 C;  3ZTD A;  3PLV A;  1XD3 B;  3H1U A;  4F7H A;  4CHK A;  2RLO A;  1X1M A;  4NQK E;  1VD2 A;  1X1G A;  1UD7 A;  1YIW A;  3DBS A;  4K2O A;  1P0R A;  5JH5 C;  2K00 A;  2X18 A;  1X11 A;  3B1L X;  4KHB B;  4LJP B;  1XQQ A;  2ZPY A;  2MBB B;  3HW2 B;  3VTU A;  5CHV C;  2W2X D;  4FJY A;  3IG3 A;  1HBK A;  1R4M I;  1WGY A;  4A6H A;  1V6E A;  2L0F A;  2KHW B;  4JKF A;  1OEY J;  2GBN A;  4AWJ A;  2M0X A;  4IM3 A;  3SD5 A;  2FUH B;  3IHP C;  1QC6 A;  2GBJ A;  2V3S A;  3CST A;  2KJ6 A;  4AOF A;  2VSZ A;  3KUC B;  1WG7 A;  4KIK A;  5JVL A;  2XK5 A;  5HE1 A;  1E8W A;  2AWT A;  5DPS A;  4EKU A;  3KH0 A;  1I35 A;  1Y19 B;  1HB8 A;  2LJ5 A;  3R7R A;  3ZLZ A;  4IC7 B;  3HHM A;  4KVG B;  1WGU A;  5BO4 B;  2PEA A;  3V6E B;  4GXB A;  4FHK A;  1P3R A;  3V61 A;  2RNR B;  1EAZ A;  2ASQ A;  2KCJ A;  3I3T B;  4KIK B;  4ANV A;  4JL9 A;  1V81 A;  2LZ6 A;  2O6V D;  1Q5W B;  3WAP A;  2MBE A;  1Q67 A;  3G9W A;  2L00 B;  4A6F B;  2Z0D B;  5L81 A;  2H7E A;  2KDB A;  2R82 A;  2FCM A;  4GDK A;  2P0H A;  3APF A;  2DYB A;  2N7D A;  2KDF B;  2I1K A;  3KVF B;  2MW5 A;  2NBV B;  1GGO A;  2KJR A;  2OJR A;  1V88 A;  4Y94 A;  1MG8 A;  2DN6 A;  2YF0 A;  3NOB A;  5J17 A;  5L95 C;  2GCL A;  1LQB A;  1X1F A;  3A9K B;  3GZN I;  3QX1 A;  2VKI A;  3MDB C;  2M38 A;  1F9J A;  1DDW A;  1UH6 A;  3ODX A;  2KFJ A;  4BOZ B;  4E71 A;  2CHZ A;  3VH4 B;  1FB8 A;  2J0J A;  4F1S A;  4ZRI A;  1WI0 A;  1V9J A;  3L16 A;  1ZM0 A;  1WE6 A;  4Z2M B;  2G4S A;  3PV1 A;  2MBQ A;  2N23 A;  4DXA B;  2I5C A;  2JWZ A;  2WWZ A;  2HE7 A;  3QWM A;  3D8E A;  5J3Y A;  3S2A A;  1WM2 A;  1QZE A;  4JK7 A;  2KC1 A;  4IW0 A;  3HIZ A;  1Q0W B;  1KJT A;  3IBE A;  3WYF B;  3JYU A;  2LVO A;  4OVU A;  2REX A;  3X0W A;  2L8J A;  4B6W A;  3N7C A;  2V4L A;  4JGH B;  1V86 A;  1E5W A;  2KWC A;  3APD A;  4JK8 A;  1FGY A;  2V76 A;  1UNR A;  1N3H A;  4ZRK A;  4NSW A;  2MDX A;  4DHZ E;  3E9L A;  3A8P A;  2PJH A;  2L3Z A;  5JLJ B;  4ILH A;  2JZZ A;  3DVN U;  3RD2 A;  1TBE A;  3TBL D;  3PGE A;  3RYT A;  4AUQ C;  4JKG A;  3ECI A;  4MY6 A;  4MEM A;  1SIF A;  4JKC A;  2ROZ B;  4F7U P;  1P3Q U;  2FCN A;  3VTV A;  5DH9 B;  4FUL A;  4NJ6 A;  2LXC A;  4NY0 A;  1WX9 A;  2K39 A;  1WRD B;  2CAY A;  2L7R A;  4MGZ E;  4BBN C;  4KZ0 A;  2JZ3 B;  2PE9 A;  3F0W A;  4JKG B;  2NVU I;  2FIF A;  5J3T A;  2OTX A;  1GG3 A;  3KY9 A;  5C1Z A;  4KHA A;  1BWN A;  4FAD A;  3DCG A;  3X23 A;  1X86 A;  3SHQ A;  2KC2 A;  2RSG A;  2QKL A;  3VHT C;  2D9W A;  1W1G A;  4MJS A;  2Y7B A;  2NBU A;  3VIA A;  3HK0 A;  2CHX A;  2UWQ A;  3DVG Y;  1WGH A;  2M8S A;  4W9K A;  2IO0 B;  3L10 B;  4PQ0 A;  2KFK B;  3N30 A;  3ZW3 A;  2CY5 A;  3TVV A;  1H8C A;  3PEG A;  4EZL A;  3ML8 A;  4MJS B;  2KK8 A;  1LM8 B;  4HXD A;  3PTF C;  2RUK B;  3ULC A;  4JQW C;  4CYE A;  1WR1 A;  4BVU C;  2W9N A;  4BBK A;  5G2N A;  5DIF B;  3VVW B;  1WI1 A;  3PRM B;  1EUV B;  3W1Y A;  2MKR A;  3A33 B;  5LXI B;  3PHW B;  1YJ1 A;  2BWF A;  2KTR A;  1H10 A;  2UVM A;  1V49 A;  2LVP A;  1FXT B;  3RUI B;  2KOX A;  4NNJ B;  3KUD B;  2HD5 B;  1KZ7 A;  2CY4 A;  4DDI D;  4EZJ A;  2BYE A;  3V6C B;  3E9P A;  1C3T A;  3TW1 A;  1UBQ A;  5GOW B;  2WX0 A;  1ZGU B;  5FI0 A;  4WJQ A;  4TQ1 A;  4HCP B;  1P98 A;  2EKE C;  2KO3 A;  4XC2 A;  2LKO A;  1T0Y A;  2MCN B;  3A1Q A;  1YD8 U;  5JZE B;  1GUA B;  3UIO B;  3MJW A;  1NU2 A;  1NTY A;  1UEF A;  3TMP B;  2P8V A;  1U27 A;  1ZW7 A;  5C23 A;  3W1S A;  5AZG A;  1KZG A;  3KW5 B;  1P1A A;  2KXJ A;  1C1Y B;  1V5O A;  4LDT B;  1V5T A;  3ALB A;  1WGG A;  5E6O A;  4HB4 B;  3A9J A;  5D6J B;  1WJU A;  2ZCC A;  2Y8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...