1MK7B

Crystal structure of an integrin beta3-talin chimera
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 57
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk7B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk7B02
2VKIA 3SYXA 4A5KA 1ZC4B 1GC7A 1V61A 1I2HA 1H10A 2Y8GA 2ROVA 3ODOA 2UZSA 3TCAA 1AWEA 2AL6A 1NVLA 2XQNM 1AQCA 4MK0A 2CY4A 1U29A 5KQ4A 2KGXB 4CYEA 1DYNA 1X11A 2W2XD 1WVHA 1MAIA 4GMXB 1GG3A 2D11A 2I1KA 4HAZB 2W2WA 1I7AA 4F7GA 2OQBA 3IVFA 2LYDA 2P8VA 3SUZA 4H8SA 2DX5A 1DROA 2GJYA 2CAYA 3HK0A 1SGHA 1U2BA 5JLJB 2Q13A 4IAPA 2LOZA 2LKOA 2DKPA 1ZC3B 3LJUX 2VRWB 4GN1A 3T06A 2Z0QA 1LW3A 2I5FA 3F5RA 3SO6A 3PEGA 4DX90 2V76A 4DX8A 4D0NB 3QBVB 1WI1A 1XR0B 2DHIA 2RQ1A 2YF0A 2BCJA 2MKRA 2J0JA 3P6AA 5D3WA 3ULBA 2MDXA 2P0HA 5DHFB 2RGNB 1RJ2A 2YT1A 2DX1A 2ADZA 1MIXA 5KQ1A 5D3VA 3D8FA 2L2IA 5D3YA 4HAXB 2OTXA 2K00A 1EF1A 4HB4B 4C0AA 2CODA 3A8QA 1BWNA 1OQNA 2NMBA 4PQ0A 5HE3A 4K2PA 5DI9B 1XKEA 5J3YA 3BJIA 2COPA 1TQZA 4TKNA 3PZDA 3DXCA 2DYQA 1Y19B 2RNRB 2K2UA 1WJMA 2I5CA 2G35A 2RLOA 3TW1A 3FEHA 2EMTA 2Z0PA 3M1IB 2YS1A 3PVUA 4L6EA 4WVFB 2EMSA 4HHVA 4KHBB 1UNRA 2GCJA 4TYZA 1QC6A 1Y5OA 2DLWA 3PVWA 4HAWB 4EMOA 5DH9B 2H7DA 1ZM0A 1V5UA 4CHMA 4GMVA 1PFJA 5C5BA 1PLSA 2N0YA 1X05A 1X1GA 2N23A 2YS3A 1UPRA 2MWNB 4HDOA 2QKLA 4Z2MB 1KZGA 1DDWA 3KZ1A 1XCGA 3FLVA 2M14A 1HBKA 2YSZA 2J59M 4HB3B 2DHKA 3KRXA 1DBHA 3U8ZA 1U5GA 2D9WA 4GPTB 3QIJA 1QQGA 3BINA 5FI0A 5D27A 2W2XC 4A6HA 3AU5A 2HE7A 1BTKA 3DXEA 3ODWA 3CIKA 1MKEA 1K5GB 1FB8A 4EJNA 1RRPB 2DTCA 2JP2A 1V5MA 1KI1B 1M7EA 2FJ9A 2K2JA 1KZ7A 3GYOA 2Y7BA 3PP2A 2UVMA 1P3RA 1TXDA 2MFQA 1K5DB 3ODXA 2COFA 2KUPA 4EKUA 4GXBA 3D8EA 1MIZB 1M7RA 2EC1A 5DIFB 4Z2NA 3GYPA 2X18A 3D8DA 5HE1A 3WA0A 5HE2A 4XWXA 1FHWA 2YRYA 3TVVA 4WSFA 1MK9B 1OY2A 4DBBA 1BAKA 1UPQA 4WJ7A 1UEFA 1WGQA 1EGXA 5D3XA 3RCPA 1U27A 2H7EA 4NSWA 4KHOA 1EAZA 2COCA 3A98B 4MY6A 1NTVA 1HB8A 2FDQA 3U7DA 1XODA 2E2XA 1XD4A 3ML4A 3HW2B 4B6HA 1NTYA 2CY5A 5J3QA 2L1CA 2RVBB 3PVLA 4BBKA 3O96A 4IOYX 1NU2A 4IFSA 3WYFB 3VIAA 1Q67A 2D4QA 1N3HA 2FJLA 5C79A 1FGYA 2I1JA 4DXAB 3KSYA 4YL8A 1W1DA 3MDBC 5C6RA 2D10A 3NSUA 3AU4A 2ROZB 1U5FA 5JHGA 2CRFA 1TJ6A 5FI1A 3SNHA 1BTNA 1Z87A 3FSSA 5CLLB 2ZPYA 1XX0A 3PSCA 2YS5A 4A6FB 4A6FA 2CQUA 1V89A 3KRWA 1DDMA 4HB2B 4HB0B 3MPXA 3A8PA 1V88A 3UZTA 1GC6A 2P0FA 2GS0A 1B55A 4K2OA 3N7CA 3G9WA 2D9XA 1V5PA 1NI2A 1NTIA 4ZRJA 3ZVRA 1W1HA 2Z0OA 2R0DA 2LULA 5EFXA 1ISNA 1FAOA 4F7UP 2DA0A 1FGZA 2ABDA 5L81A 3OANA 2Y8FA 1ZSQA 4HDQA 1EVHA 1FHXA 4HAVB 2RUKB 2RSGA 3PG7A 3EPYA 2IYBA 1WGUA 1P5TA 1ST7A 4PNKA 4ZRIA 5KCVA 1FHOA 1X1FA 4Y94A 5C16A 1J0WA 2AEHA 4HATB 2HRJA 2J0KA 5IJMA 1MPHA 1U5DA 4HAYB 4K81A 3P7ZA 2LOXA 1PMSA 4NY0A 3FM8C 1X86A 2R09A 3X23A 2DN6A 5DHAB 2KCJA 1E5WA 2YVCA 4MT7A 2LBBA 5LONB 1FOEA 2WH5A 4KHAA 1H4RA 2QKMA 2DYNA 1DDVA 2D9ZA 4P7IA 2DHJA 1P6SA 1OMWA 2P0DA 1UNQA 1SHCA 2EJ8A 1ZVRA 3AJ4A 5GOWB 1W1GA 3TO1A 2ELAA 2D2QA 3KY9A 3ZDTA 2M38A 3CXBB 4KAXB 3F0WA 2D9VA 4GZUA 3QWMA 2IFSA 5JHHA 1ACAA 4KVGB 2HTHB 2DFKA 4F7HA 2CB8A 4K17A 3TFMA 5LOPB 2LG1A 2ELBA 2NZ8B 3SV1A 3ULCA 3V5WA 4HAUB 5HE0A 2YT0A 2GCLA 3VOQA 2DKQA 5CLQB 1U5EA 3FP5A 5J3TA 1WG7A 1MK7B 4A6KA 3DXDA 2D9YA 1J19A 1HB6A 2UZRA 4YONA 2PZ1A 1IRSA 3HQCA 2VSZA 2J0MA 2COAA 1UNPA 4CHJA 5JP4A 4ZRKA 1LB1A 1WJ1A 5C5BB
chains in the Genus database with same CATH superfamily
2VKIA 3SYXA 4A5KA 1ZC4B 1GC7A 2K49A 1V61A 1I2HA 1H10A 2Y8GA 2ROVA 3ODOA 2DIKA 2UZSA 3TCAA 1AWEA 3U12A 2AL6A 1NVLA 2XQNM 1AQCA 4MK0A 2CY4A 1U29A 5KQ4A 2KGXB 4CYEA 1DYNA 1X11A 2W2XD 5I2SA 3ENBA 1WVHA 1MAIA 4JKBA 4GMXB 1GG3A 2D11A 2I1KA 2FJUB 4HAZB 2W2WA 3HIEA 1I7AA 4F7GA 2OQBA 3IVFA 2LYDA 2P8VA 3SUZA 4H8SA 2DX5A 1VBGA 1DROA 2GJYA 2CAYA 3HK0A 1SGHA 1U2BA 5JLJB 2Q13A 4IAPA 2LOZA 2LKOA 2DKPA 1ZC3B 3LJUX 2VRWB 3NWDA 4GN1A 3T06A 2Z0QA 1LW3A 2I5FA 3F5RA 3SO6A 3PEGA 4DX90 2V76A 4DX8A 4D0NB 2Z59A 4JKHA 3QBVB 4JKGB 1WI1A 1XR0B 4JKGA 4DIXA 2DHIA 2RQ1A 2YF0A 2BCJA 2MKRA 2J0JA 3P6AA 5D3WA 3ULBA 2MDXA 2P0HA 5DHFB 2RGNB 1ZYIA 1RJ2A 2YT1A 2DX1A 2ADZA 1MIXA 5KQ1A 5D3VA 3D8FA 2L2IA 3OHMB 5D3YA 4JKDA 4HAXB 2OTXA 4JKCA 5M4YB 2K00A 1EF1A 4HB4B 4C0AA 2CODA 2KIEA 3A8QA 1BWNA 1OQNA 2NMBA 4PQ0A 5HE3A 4K2PA 5DI9B 1XKEA 5J3YA 3BJIA 2COPA 4TKNA 1TQZA 3PZDA 3DXCA 2DYQA 2R2YA 1Y19B 2RNRB 2K2UA 1WJMA 2I5CA 2G35A 2RLOA 3TW1A 3FEHA 2EMTA 2Z0PA 2Z4DA 2YS1A 2Z13A 3M1IB 3PVUA 4L6EA 4WVFB 2EMSA 4HHVA 2ZKMX 4KHBB 1UNRA 4KHBA 2GCJA 4ILHA 4TYZA 1QC6A 1Y5OA 2DLWA 3PVWA 2GUMA 4HAWB 4EMOA 4D6WA 5DH9B 2H7DA 4JKAA 1ZM0A 1V5UA 4CHMA 4GMVA 1PFJA 5C5BA 5I2MA 1PLSA 2N0YA 1X05A 1X1GA 2N23A 2YS3A 3A58A 1UPRA 2MWNB 4HDOA 2QKLA 4Z2MB 1KZGA 4CSQA 1DDWA 2NBVA 3KZ1A 1XCGA 3FLVA 2M14A 4JK9A 1HBKA 3E9OA 2YSZA 2J59M 3B77A 4HB3B 2DHKA 3KRXA 1DBHA 3U8ZA 1U5GA 2D9WA 4GPTB 3QIJA 1QQGA 3BINA 5FI0A 5D27A 2W2XC 4A6HA 3AU5A 2HE7A 2KIGA 1BTKA 3DXEA 3ODWA 3CIKA 1MKEA 1K5GB 5JVLA 1FB8A 4EJNA 1RRPB 5IRSA 2DTCA 2JP2A 1V5MA 1KI1B 1M7EA 2FJ9A 4QJ3B 2K2JA 1KZ7A 3GYOA 2Y7BA 3PP2A 3SBTA 2UVMA 1P3RA 2RRFA 1TXDA 2MFQA 1K5DB 3ODXA 2COFA 2KUPA 5LG4B 4EKUA 4GXBA 3D8EA 1MIZB 1M7RA 2EC1A 2K8EA 5DIFB 4Z2NA 3GYPA 2X18A 3D8DA 5HE1A 3WA0A 5HE2A 4OT1A 4XWXA 1FHWA 2YRYA 3TVVA 4WSFA 1MK9B 1OY2A 4DBBA 1BAKA 1UPQA 4QJ4B 4WJ7A 1UEFA 1WGQA 1EGXA 5D3XA 3RCPA 1JDEA 1U27A 2H7EA 4NSWA 4KHOA 1EAZA 2COCA 3A98B 3SBGA 4MY6A 1NTVA 1HB8A 2FDQA 3U7DA 1XODA 2E2XA 1KBLA 1XD4A 3NWAA 3ML4A 3HW2B 4B6HA 1NTYA 2CY5A 5J3QA 2L1CA 2RVBB 3PVLA 4BBKA 3O96A 4IOYX 1NU2A 4IFSA 4JKEA 3WYFB 3VIAA 1Q67A 4GNKB 4HSIA 3E66A 2D4QA 1N3HA 2FJLA 5C79A 1FGYA 2I1JA 4DXAB 3KSYA 4YL8A 1W1DA 3MDBC 5C6RA 2D10A 2Z14A 3NSUA 3AU4A 2ROZB 1U5FA 5JHGA 4GOUA 4QJ5B 1DIKA 1TJ6A 2CRFA 5FI1A 3SNHA 1BTNA 1Z87A 3FSSA 5CLLB 2ZPYA 1GGOA 1XX0A 3PSCA 2YS5A 4A6FB 4A6FA 2CQUA 1V89A 3KRWA 1T77A 4HB2B 4HB0B 1DDMA 3MPXA 3A8PA 4JK8A 1V88A 3UZTA 1VBHA 4L1RA 1GC6A 2P0FA 2GS0A 1B55A 4K2OA 3N7CA 3G9WA 2D9XA 1V5PA 2YT2A 1NI2A 1NTIA 4ZRJA 3ZVRA 1W1HA 2Z0OA 2R0DA 2LULA 5EFXA 1ISNA 1FAOA 4F7UP 2DA0A 1FGZA 2ABDA 5L81A 3OANA 2X0SA 2Y8FA 1ZSQA 4HDQA 1EVHA 1FHXA 4HAVB 2R82A 2RUKB 2RSGA 1MI1A 3PG7A 3EPYA 2IYBA 4JKFA 1WGUA 1P5TA 1ST7A 3NWFA 4PNKA 4ZRIA 4JK7A 5KCVA 1FHOA 1X1FA 4Y94A 5C16A 3E9PA 1J0WA 2AEHA 4HATB 2HRJA 2J0KA 5IJMA 1MPHA 1U5DA 3FVCA 4HAYB 4K81A 3P7ZA 2LOXA 1PMSA 4NY0A 3FM8C 1X86A 2R09A 3X23A 2DN6A 5DHAB 2KCJA 1E5WA 2YVCA 4MT7A 2LBBA 5LONB 4ILGB 1FOEA 2WH5A 4KHAA 1H4RA 2QKMA 2DYNA 1DDVA 2D9ZA 3NW8A 4P7IA 2DHJA 1P6SA 1OMWA 2P0DA 4ILJA 1UNQA 1SHCA 4OSNA 2EJ8A 1ZVRA 3AJ4A 5GOWB 1W1GA 3TO1A 2ELAA 3E9LA 2D2QA 3KY9A 3ZDTA 2M38A 4QXAB 1KC7A 2KR0A 3CXBB 4KAXB 3F0WA 2D9VA 4GZUA 3QWMA 2IFSA 5JHHA 1ACAA 4KVGB 2HTHB 2DFKA 4F7HA 2CB8A 4K17A 3TFMA 5LOPB 3DCXA 2LG1A 2ELBA 2NZ8B 3SV1A 3ULCA 3V5WA 4HAUB 5HE0A 2YT0A 2GCLA 3VOQA 2DKQA 5CLQB 1U5EA 3FP5A 2KUQA 5J3TA 1WG7A 1MK7B 4A6KA 3DXDA 2D9YA 1J19A 1HB6A 2UZRA 4YONA 2PZ1A 1IRSA 3HQCA 2VSZA 2J0MA 2COAA 1UNPA 4CHJA 5JP4A 4ZRKA 1LB1A 1WJ1A 5C5BB 3HSAA
chains in the Genus database with same CATH topology
2VKIA 3SYXA 4A5KA 1ZC4B 1GC7A 1V61A 1I2HA 1H10A 2Y8GA 2ROVA 3ODOA 2DIKA 2UZSA 3TCAA 1AWEA 2AL6A 1NVLA 2XQNM 1AQCA 4MK0A 2CY4A 1U29A 5KQ4A 2KGXB 4CYEA 1DYNA 1X11A 2W2XD 3ENBA 1WVHA 1MAIA 4JKBA 4GMXB 1GG3A 2D11A 2I1KA 4HAZB 2W2WA 1I7AA 4F7GA 2OQBA 3IVFA 2LYDA 2P8VA 3SUZA 4H8SA 2DX5A 1VBGA 1DROA 2GJYA 2CAYA 3HK0A 1SGHA 1U2BA 5JLJB 2Q13A 4IAPA 2LOZA 2LKOA 2DKPA 1ZC3B 3LJUX 2VRWB 4GN1A 3T06A 2Z0QA 1LW3A 2I5FA 3F5RA 3SO6A 3PEGA 4DX90 2V76A 4DX8A 4D0NB 4JKHA 3QBVB 4JKGB 1WI1A 1XR0B 4JKGA 2DHIA 2RQ1A 2YF0A 2BCJA 2MKRA 2J0JA 3P6AA 5D3WA 3ULBA 2MDXA 2P0HA 5DHFB 2RGNB 1RJ2A 2YT1A 2DX1A 2ADZA 1MIXA 5KQ1A 5D3VA 3D8FA 2L2IA 5D3YA 4JKDA 4HAXB 2OTXA 4JKCA 2K00A 1EF1A 4HB4B 4C0AA 2CODA 3A8QA 1BWNA 1OQNA 2NMBA 4PQ0A 5HE3A 4K2PA 5DI9B 1XKEA 5J3YA 3BJIA 2COPA 4TKNA 1TQZA 3PZDA 3DXCA 2DYQA 1Y19B 2RNRB 2K2UA 1WJMA 2I5CA 2G35A 2RLOA 3TW1A 3FEHA 2EMTA 2Z0PA 3M1IB 2YS1A 3PVUA 4L6EA 4WVFB 2EMSA 4HHVA 4KHBB 1UNRA 2GCJA 4ILHA 4TYZA 1QC6A 1Y5OA 2DLWA 3PVWA 4HAWB 4EMOA 5DH9B 2H7DA 4JKAA 1ZM0A 1V5UA 4CHMA 4GMVA 1PFJA 5C5BA 1PLSA 2N0YA 1X05A 1X1GA 2N23A 2YS3A 1UPRA 2MWNB 4HDOA 2QKLA 4Z2MB 1KZGA 1DDWA 3KZ1A 1XCGA 3FLVA 2M14A 4JK9A 1HBKA 3E9OA 2YSZA 2J59M 4HB3B 2DHKA 3KRXA 1DBHA 3U8ZA 1U5GA 2D9WA 4GPTB 3QIJA 1QQGA 3BINA 5FI0A 5D27A 2W2XC 4A6HA 3AU5A 2HE7A 1BTKA 3DXEA 3ODWA 3CIKA 1MKEA 1K5GB 5JVLA 1FB8A 4EJNA 1RRPB 2DTCA 2JP2A 1V5MA 1KI1B 1M7EA 2FJ9A 2K2JA 1KZ7A 3GYOA 2Y7BA 3PP2A 3SBTA 2UVMA 1P3RA 1TXDA 2MFQA 1K5DB 3ODXA 2COFA 2KUPA 4EKUA 4GXBA 3D8EA 1MIZB 1M7RA 2EC1A 5DIFB 4Z2NA 3GYPA 2X18A 3D8DA 5HE1A 3WA0A 5HE2A 4XWXA 1FHWA 2YRYA 3TVVA 4WSFA 1MK9B 1OY2A 4DBBA 1BAKA 1UPQA 4WJ7A 1UEFA 1WGQA 1EGXA 5D3XA 3RCPA 1JDEA 1U27A 2H7EA 4NSWA 4KHOA 1EAZA 2COCA 3A98B 3SBGA 4MY6A 1NTVA 1HB8A 2FDQA 3U7DA 1XODA 2E2XA 1KBLA 1XD4A 3ML4A 3HW2B 4B6HA 1NTYA 2CY5A 5J3QA 2L1CA 2RVBB 3PVLA 4BBKA 3O96A 4IOYX 1NU2A 4IFSA 4JKEA 3WYFB 3VIAA 1Q67A 3E66A 2D4QA 1N3HA 2FJLA 5C79A 1FGYA 2I1JA 4DXAB 3KSYA 4YL8A 1W1DA 3MDBC 5C6RA 2D10A 3NSUA 3AU4A 2ROZB 1U5FA 5JHGA 1DIKA 1TJ6A 2CRFA 5FI1A 3SNHA 1BTNA 1Z87A 3FSSA 5CLLB 2ZPYA 1GGOA 1XX0A 3PSCA 2YS5A 4A6FB 4A6FA 2CQUA 1V89A 3KRWA 1DDMA 4HB2B 4HB0B 3MPXA 3A8PA 4JK8A 1V88A 3UZTA 1VBHA 1GC6A 2P0FA 2GS0A 1B55A 4K2OA 3N7CA 3G9WA 2D9XA 1V5PA 1NI2A 1NTIA 4ZRJA 3ZVRA 1W1HA 2Z0OA 2R0DA 2LULA 5EFXA 1ISNA 1FAOA 4F7UP 2DA0A 1FGZA 2ABDA 5L81A 3OANA 2X0SA 2Y8FA 1ZSQA 4HDQA 1EVHA 1FHXA 4HAVB 2R82A 2RUKB 2RSGA 3PG7A 3EPYA 2IYBA 4JKFA 1WGUA 1P5TA 1ST7A 4PNKA 4ZRIA 4JK7A 5KCVA 1FHOA 1X1FA 4Y94A 5C16A 3E9PA 1J0WA 2AEHA 4HATB 2HRJA 2J0KA 5IJMA 1MPHA 1U5DA 4HAYB 4K81A 3P7ZA 2LOXA 1PMSA 4NY0A 3FM8C 1X86A 2R09A 3X23A 2DN6A 5DHAB 2KCJA 1E5WA 2YVCA 4MT7A 2LBBA 5LONB 4ILGB 1FOEA 2WH5A 4KHAA 1H4RA 2QKMA 2DYNA 1DDVA 2D9ZA 4P7IA 2DHJA 1P6SA 1OMWA 2P0DA 4ILJA 1UNQA 1SHCA 2EJ8A 1ZVRA 3AJ4A 5GOWB 1W1GA 3TO1A 2ELAA 3E9LA 2D2QA 3KY9A 3ZDTA 2M38A 1KC7A 3CXBB 4KAXB 3F0WA 2D9VA 4GZUA 3QWMA 2IFSA 5JHHA 1ACAA 4KVGB 2HTHB 2DFKA 4F7HA 2CB8A 4K17A 3TFMA 5LOPB 2LG1A 2ELBA 2NZ8B 3SV1A 3ULCA 3V5WA 4HAUB 5HE0A 2YT0A 2GCLA 3VOQA 2DKQA 5CLQB 1U5EA 3FP5A 5J3TA 1WG7A 1MK7B 4A6KA 3DXDA 2D9YA 1J19A 1HB6A 2UZRA 4YONA 2PZ1A 1IRSA 3HQCA 2VSZA 2J0MA 2COAA 1UNPA 4CHJA 5JP4A 4ZRKA 1LB1A 1WJ1A 5C5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKI A;  3SYX A;  4A5K A;  1ZC4 B;  1GC7 A;  1V61 A;  1I2H A;  1H10 A;  2Y8G A;  2ROV A;  3ODO A;  2UZS A;  3TCA A;  1AWE A;  2AL6 A;  1NVL A;  2XQN M;  1AQC A;  4MK0 A;  2CY4 A;  1U29 A;  5KQ4 A;  2KGX B;  4CYE A;  1DYN A;  1X11 A;  2W2X D;  1WVH A;  1MAI A;  4GMX B;  1GG3 A;  2D11 A;  2I1K A;  4HAZ B;  2W2W A;  1I7A A;  4F7G A;  2OQB A;  3IVF A;  2LYD A;  2P8V A;  3SUZ A;  4H8S A;  2DX5 A;  1DRO A;  2GJY A;  2CAY A;  3HK0 A;  1SGH A;  1U2B A;  5JLJ B;  2Q13 A;  4IAP A;  2LOZ A;  2LKO A;  2DKP A;  1ZC3 B;  3LJU X;  2VRW B;  4GN1 A;  3T06 A;  2Z0Q A;  1LW3 A;  2I5F A;  3F5R A;  3SO6 A;  3PEG A;  4DX9 0;  2V76 A;  4DX8 A;  4D0N B;  3QBV B;  1WI1 A;  1XR0 B;  2DHI A;  2RQ1 A;  2YF0 A;  2BCJ A;  2MKR A;  2J0J A;  3P6A A;  5D3W A;  3ULB A;  2MDX A;  2P0H A;  5DHF B;  2RGN B;  1RJ2 A;  2YT1 A;  2DX1 A;  2ADZ A;  1MIX A;  5KQ1 A;  5D3V A;  3D8F A;  2L2I A;  5D3Y A;  4HAX B;  2OTX A;  2K00 A;  1EF1 A;  4HB4 B;  4C0A A;  2COD A;  3A8Q A;  1BWN A;  1OQN A;  2NMB A;  4PQ0 A;  5HE3 A;  4K2P A;  5DI9 B;  1XKE A;  5J3Y A;  3BJI A;  2COP A;  1TQZ A;  4TKN A;  3PZD A;  3DXC A;  2DYQ A;  1Y19 B;  2RNR B;  2K2U A;  1WJM A;  2I5C A;  2G35 A;  2RLO A;  3TW1 A;  3FEH A;  2EMT A;  2Z0P A;  3M1I B;  2YS1 A;  3PVU A;  4L6E A;  4WVF B;  2EMS A;  4HHV A;  4KHB B;  1UNR A;  2GCJ A;  4TYZ A;  1QC6 A;  1Y5O A;  2DLW A;  3PVW A;  4HAW B;  4EMO A;  5DH9 B;  2H7D A;  1ZM0 A;  1V5U A;  4CHM A;  4GMV A;  1PFJ A;  5C5B A;  1PLS A;  2N0Y A;  1X05 A;  1X1G A;  2N23 A;  2YS3 A;  1UPR A;  2MWN B;  4HDO A;  2QKL A;  4Z2M B;  1KZG A;  1DDW A;  3KZ1 A;  1XCG A;  3FLV A;  2M14 A;  1HBK A;  2YSZ A;  2J59 M;  4HB3 B;  2DHK A;  3KRX A;  1DBH A;  3U8Z A;  1U5G A;  2D9W A;  4GPT B;  3QIJ A;  1QQG A;  3BIN A;  5FI0 A;  5D27 A;  2W2X C;  4A6H A;  3AU5 A;  2HE7 A;  1BTK A;  3DXE A;  3ODW A;  3CIK A;  1MKE A;  1K5G B;  1FB8 A;  4EJN A;  1RRP B;  2DTC A;  2JP2 A;  1V5M A;  1KI1 B;  1M7E A;  2FJ9 A;  2K2J A;  1KZ7 A;  3GYO A;  2Y7B A;  3PP2 A;  2UVM A;  1P3R A;  1TXD A;  2MFQ A;  1K5D B;  3ODX A;  2COF A;  2KUP A;  4EKU A;  4GXB A;  3D8E A;  1MIZ B;  1M7R A;  2EC1 A;  5DIF B;  4Z2N A;  3GYP A;  2X18 A;  3D8D A;  5HE1 A;  3WA0 A;  5HE2 A;  4XWX A;  1FHW A;  2YRY A;  3TVV A;  4WSF A;  1MK9 B;  1OY2 A;  4DBB A;  1BAK A;  1UPQ A;  4WJ7 A;  1UEF A;  1WGQ A;  1EGX A;  5D3X A;  3RCP A;  1U27 A;  2H7E A;  4NSW A;  4KHO A;  1EAZ A;  2COC A;  3A98 B;  4MY6 A;  1NTV A;  1HB8 A;  2FDQ A;  3U7D A;  1XOD A;  2E2X A;  1XD4 A;  3ML4 A;  3HW2 B;  4B6H A;  1NTY A;  2CY5 A;  5J3Q A;  2L1C A;  2RVB B;  3PVL A;  4BBK A;  3O96 A;  4IOY X;  1NU2 A;  4IFS A;  3WYF B;  3VIA A;  1Q67 A;  2D4Q A;  1N3H A;  2FJL A;  5C79 A;  1FGY A;  2I1J A;  4DXA B;  3KSY A;  4YL8 A;  1W1D A;  3MDB C;  5C6R A;  2D10 A;  3NSU A;  3AU4 A;  2ROZ B;  1U5F A;  5JHG A;  2CRF A;  1TJ6 A;  5FI1 A;  3SNH A;  1BTN A;  1Z87 A;  3FSS A;  5CLL B;  2ZPY A;  1XX0 A;  3PSC A;  2YS5 A;  4A6F B;  4A6F A;  2CQU A;  1V89 A;  3KRW A;  1DDM A;  4HB2 B;  4HB0 B;  3MPX A;  3A8P A;  1V88 A;  3UZT A;  1GC6 A;  2P0F A;  2GS0 A;  1B55 A;  4K2O A;  3N7C A;  3G9W A;  2D9X A;  1V5P A;  1NI2 A;  1NTI A;  4ZRJ A;  3ZVR A;  1W1H A;  2Z0O A;  2R0D A;  2LUL A;  5EFX A;  1ISN A;  1FAO A;  4F7U P;  2DA0 A;  1FGZ A;  2ABD A;  5L81 A;  3OAN A;  2Y8F A;  1ZSQ A;  4HDQ A;  1EVH A;  1FHX A;  4HAV B;  2RUK B;  2RSG A;  3PG7 A;  3EPY A;  2IYB A;  1WGU A;  1P5T A;  1ST7 A;  4PNK A;  4ZRI A;  5KCV A;  1FHO A;  1X1F A;  4Y94 A;  5C16 A;  1J0W A;  2AEH A;  4HAT B;  2HRJ A;  2J0K A;  5IJM A;  1MPH A;  1U5D A;  4HAY B;  4K81 A;  3P7Z A;  2LOX A;  1PMS A;  4NY0 A;  3FM8 C;  1X86 A;  2R09 A;  3X23 A;  2DN6 A;  5DHA B;  2KCJ A;  1E5W A;  2YVC A;  4MT7 A;  2LBB A;  5LON B;  1FOE A;  2WH5 A;  4KHA A;  1H4R A;  2QKM A;  2DYN A;  1DDV A;  2D9Z A;  4P7I A;  2DHJ A;  1P6S A;  1OMW A;  2P0D A;  1UNQ A;  1SHC A;  2EJ8 A;  1ZVR A;  3AJ4 A;  5GOW B;  1W1G A;  3TO1 A;  2ELA A;  2D2Q A;  3KY9 A;  3ZDT A;  2M38 A;  3CXB B;  4KAX B;  3F0W A;  2D9V A;  4GZU A;  3QWM A;  2IFS A;  5JHH A;  1ACA A;  4KVG B;  2HTH B;  2DFK A;  4F7H A;  2CB8 A;  4K17 A;  3TFM A;  5LOP B;  2LG1 A;  2ELB A;  2NZ8 B;  3SV1 A;  3ULC A;  3V5W A;  4HAU B;  5HE0 A;  2YT0 A;  2GCL A;  3VOQ A;  2DKQ A;  5CLQ B;  1U5E A;  3FP5 A;  5J3T A;  1WG7 A;  1MK7 B;  4A6K A;  3DXD A;  2D9Y A;  1J19 A;  1HB6 A;  2UZR A;  4YON A;  2PZ1 A;  1IRS A;  3HQC A;  2VSZ A;  2J0M A;  2COA A;  1UNP A;  4CHJ A;  5JP4 A;  4ZRK A;  1LB1 A;  1WJ1 A;  5C5B B; 
#chains in the Genus database with same CATH topology
 2VKI A;  3SYX A;  4A5K A;  1ZC4 B;  1GC7 A;  2K49 A;  1V61 A;  1I2H A;  1H10 A;  2Y8G A;  2ROV A;  3ODO A;  2DIK A;  2UZS A;  3TCA A;  1AWE A;  3U12 A;  2AL6 A;  1NVL A;  2XQN M;  1AQC A;  4MK0 A;  2CY4 A;  1U29 A;  5KQ4 A;  2KGX B;  4CYE A;  1DYN A;  1X11 A;  2W2X D;  5I2S A;  3ENB A;  1WVH A;  1MAI A;  4JKB A;  4GMX B;  1GG3 A;  2D11 A;  2I1K A;  2FJU B;  4HAZ B;  2W2W A;  3HIE A;  1I7A A;  4F7G A;  2OQB A;  3IVF A;  2LYD A;  2P8V A;  3SUZ A;  4H8S A;  2DX5 A;  1VBG A;  1DRO A;  2GJY A;  2CAY A;  3HK0 A;  1SGH A;  1U2B A;  5JLJ B;  2Q13 A;  4IAP A;  2LOZ A;  2LKO A;  2DKP A;  1ZC3 B;  3LJU X;  2VRW B;  3NWD A;  4GN1 A;  3T06 A;  2Z0Q A;  1LW3 A;  2I5F A;  3F5R A;  3SO6 A;  3PEG A;  4DX9 0;  2V76 A;  4DX8 A;  4D0N B;  2Z59 A;  4JKH A;  3QBV B;  4JKG B;  1WI1 A;  1XR0 B;  4JKG A;  4DIX A;  2DHI A;  2RQ1 A;  2YF0 A;  2BCJ A;  2MKR A;  2J0J A;  3P6A A;  5D3W A;  3ULB A;  2MDX A;  2P0H A;  5DHF B;  2RGN B;  1ZYI A;  1RJ2 A;  2YT1 A;  2DX1 A;  2ADZ A;  1MIX A;  5KQ1 A;  5D3V A;  3D8F A;  2L2I A;  3OHM B;  5D3Y A;  4JKD A;  4HAX B;  2OTX A;  4JKC A;  5M4Y B;  2K00 A;  1EF1 A;  4HB4 B;  4C0A A;  2COD A;  2KIE A;  3A8Q A;  1BWN A;  1OQN A;  2NMB A;  4PQ0 A;  5HE3 A;  4K2P A;  5DI9 B;  1XKE A;  5J3Y A;  3BJI A;  2COP A;  4TKN A;  1TQZ A;  3PZD A;  3DXC A;  2DYQ A;  2R2Y A;  1Y19 B;  2RNR B;  2K2U A;  1WJM A;  2I5C A;  2G35 A;  2RLO A;  3TW1 A;  3FEH A;  2EMT A;  2Z0P A;  2Z4D A;  2YS1 A;  2Z13 A;  3M1I B;  3PVU A;  4L6E A;  4WVF B;  2EMS A;  4HHV A;  2ZKM X;  4KHB B;  1UNR A;  4KHB A;  2GCJ A;  4ILH A;  4TYZ A;  1QC6 A;  1Y5O A;  2DLW A;  3PVW A;  2GUM A;  4HAW B;  4EMO A;  4D6W A;  5DH9 B;  2H7D A;  4JKA A;  1ZM0 A;  1V5U A;  4CHM A;  4GMV A;  1PFJ A;  5C5B A;  5I2M A;  1PLS A;  2N0Y A;  1X05 A;  1X1G A;  2N23 A;  2YS3 A;  3A58 A;  1UPR A;  2MWN B;  4HDO A;  2QKL A;  4Z2M B;  1KZG A;  4CSQ A;  1DDW A;  2NBV A;  3KZ1 A;  1XCG A;  3FLV A;  2M14 A;  4JK9 A;  1HBK A;  3E9O A;  2YSZ A;  2J59 M;  3B77 A;  4HB3 B;  2DHK A;  3KRX A;  1DBH A;  3U8Z A;  1U5G A;  2D9W A;  4GPT B;  3QIJ A;  1QQG A;  3BIN A;  5FI0 A;  5D27 A;  2W2X C;  4A6H A;  3AU5 A;  2HE7 A;  2KIG A;  1BTK A;  3DXE A;  3ODW A;  3CIK A;  1MKE A;  1K5G B;  5JVL A;  1FB8 A;  4EJN A;  1RRP B;  5IRS A;  2DTC A;  2JP2 A;  1V5M A;  1KI1 B;  1M7E A;  2FJ9 A;  4QJ3 B;  2K2J A;  1KZ7 A;  3GYO A;  2Y7B A;  3PP2 A;  3SBT A;  2UVM A;  1P3R A;  2RRF A;  1TXD A;  2MFQ A;  1K5D B;  3ODX A;  2COF A;  2KUP A;  5LG4 B;  4EKU A;  4GXB A;  3D8E A;  1MIZ B;  1M7R A;  2EC1 A;  2K8E A;  5DIF B;  4Z2N A;  3GYP A;  2X18 A;  3D8D A;  5HE1 A;  3WA0 A;  5HE2 A;  4OT1 A;  4XWX A;  1FHW A;  2YRY A;  3TVV A;  4WSF A;  1MK9 B;  1OY2 A;  4DBB A;  1BAK A;  1UPQ A;  4QJ4 B;  4WJ7 A;  1UEF A;  1WGQ A;  1EGX A;  5D3X A;  3RCP A;  1JDE A;  1U27 A;  2H7E A;  4NSW A;  4KHO A;  1EAZ A;  2COC A;  3A98 B;  3SBG A;  4MY6 A;  1NTV A;  1HB8 A;  2FDQ A;  3U7D A;  1XOD A;  2E2X A;  1KBL A;  1XD4 A;  3NWA A;  3ML4 A;  3HW2 B;  4B6H A;  1NTY A;  2CY5 A;  5J3Q A;  2L1C A;  2RVB B;  3PVL A;  4BBK A;  3O96 A;  4IOY X;  1NU2 A;  4IFS A;  4JKE A;  3WYF B;  3VIA A;  1Q67 A;  4GNK B;  4HSI A;  3E66 A;  2D4Q A;  1N3H A;  2FJL A;  5C79 A;  1FGY A;  2I1J A;  4DXA B;  3KSY A;  4YL8 A;  1W1D A;  3MDB C;  5C6R A;  2D10 A;  2Z14 A;  3NSU A;  3AU4 A;  2ROZ B;  1U5F A;  5JHG A;  4GOU A;  4QJ5 B;  1DIK A;  1TJ6 A;  2CRF A;  5FI1 A;  3SNH A;  1BTN A;  1Z87 A;  3FSS A;  5CLL B;  2ZPY A;  1GGO A;  1XX0 A;  3PSC A;  2YS5 A;  4A6F B;  4A6F A;  2CQU A;  1V89 A;  3KRW A;  1T77 A;  4HB2 B;  4HB0 B;  1DDM A;  3MPX A;  3A8P A;  4JK8 A;  1V88 A;  3UZT A;  1VBH A;  4L1R A;  1GC6 A;  2P0F A;  2GS0 A;  1B55 A;  4K2O A;  3N7C A;  3G9W A;  2D9X A;  1V5P A;  2YT2 A;  1NI2 A;  1NTI A;  4ZRJ A;  3ZVR A;  1W1H A;  2Z0O A;  2R0D A;  2LUL A;  5EFX A;  1ISN A;  1FAO A;  4F7U P;  2DA0 A;  1FGZ A;  2ABD A;  5L81 A;  3OAN A;  2X0S A;  2Y8F A;  1ZSQ A;  4HDQ A;  1EVH A;  1FHX A;  4HAV B;  2R82 A;  2RUK B;  2RSG A;  1MI1 A;  3PG7 A;  3EPY A;  2IYB A;  4JKF A;  1WGU A;  1P5T A;  1ST7 A;  3NWF A;  4PNK A;  4ZRI A;  4JK7 A;  5KCV A;  1FHO A;  1X1F A;  4Y94 A;  5C16 A;  3E9P A;  1J0W A;  2AEH A;  4HAT B;  2HRJ A;  2J0K A;  5IJM A;  1MPH A;  1U5D A;  3FVC A;  4HAY B;  4K81 A;  3P7Z A;  2LOX A;  1PMS A;  4NY0 A;  3FM8 C;  1X86 A;  2R09 A;  3X23 A;  2DN6 A;  5DHA B;  2KCJ A;  1E5W A;  2YVC A;  4MT7 A;  2LBB A;  5LON B;  4ILG B;  1FOE A;  2WH5 A;  4KHA A;  1H4R A;  2QKM A;  2DYN A;  1DDV A;  2D9Z A;  3NW8 A;  4P7I A;  2DHJ A;  1P6S A;  1OMW A;  2P0D A;  4ILJ A;  1UNQ A;  1SHC A;  4OSN A;  2EJ8 A;  1ZVR A;  3AJ4 A;  5GOW B;  1W1G A;  3TO1 A;  2ELA A;  3E9L A;  2D2Q A;  3KY9 A;  3ZDT A;  2M38 A;  4QXA B;  1KC7 A;  2KR0 A;  3CXB B;  4KAX B;  3F0W A;  2D9V A;  4GZU A;  3QWM A;  2IFS A;  5JHH A;  1ACA A;  4KVG B;  2HTH B;  2DFK A;  4F7H A;  2CB8 A;  4K17 A;  3TFM A;  5LOP B;  3DCX A;  2LG1 A;  2ELB A;  2NZ8 B;  3SV1 A;  3ULC A;  3V5W A;  4HAU B;  5HE0 A;  2YT0 A;  2GCL A;  3VOQ A;  2DKQ A;  5CLQ B;  1U5E A;  3FP5 A;  2KUQ A;  5J3T A;  1WG7 A;  1MK7 B;  4A6K A;  3DXD A;  2D9Y A;  1J19 A;  1HB6 A;  2UZR A;  4YON A;  2PZ1 A;  1IRS A;  3HQC A;  2VSZ A;  2J0M A;  2COA A;  1UNP A;  4CHJ A;  5JP4 A;  4ZRK A;  1LB1 A;  1WJ1 A;  5C5B B;  3HSA A; 
#chains in the Genus database with same CATH homology
 2VKI A;  3SYX A;  4A5K A;  1ZC4 B;  1GC7 A;  1V61 A;  1I2H A;  1H10 A;  2Y8G A;  2ROV A;  3ODO A;  2DIK A;  2UZS A;  3TCA A;  1AWE A;  2AL6 A;  1NVL A;  2XQN M;  1AQC A;  4MK0 A;  2CY4 A;  1U29 A;  5KQ4 A;  2KGX B;  4CYE A;  1DYN A;  1X11 A;  2W2X D;  3ENB A;  1WVH A;  1MAI A;  4JKB A;  4GMX B;  1GG3 A;  2D11 A;  2I1K A;  4HAZ B;  2W2W A;  1I7A A;  4F7G A;  2OQB A;  3IVF A;  2LYD A;  2P8V A;  3SUZ A;  4H8S A;  2DX5 A;  1VBG A;  1DRO A;  2GJY A;  2CAY A;  3HK0 A;  1SGH A;  1U2B A;  5JLJ B;  2Q13 A;  4IAP A;  2LOZ A;  2LKO A;  2DKP A;  1ZC3 B;  3LJU X;  2VRW B;  4GN1 A;  3T06 A;  2Z0Q A;  1LW3 A;  2I5F A;  3F5R A;  3SO6 A;  3PEG A;  4DX9 0;  2V76 A;  4DX8 A;  4D0N B;  4JKH A;  3QBV B;  4JKG B;  1WI1 A;  1XR0 B;  4JKG A;  2DHI A;  2RQ1 A;  2YF0 A;  2BCJ A;  2MKR A;  2J0J A;  3P6A A;  5D3W A;  3ULB A;  2MDX A;  2P0H A;  5DHF B;  2RGN B;  1RJ2 A;  2YT1 A;  2DX1 A;  2ADZ A;  1MIX A;  5KQ1 A;  5D3V A;  3D8F A;  2L2I A;  5D3Y A;  4JKD A;  4HAX B;  2OTX A;  4JKC A;  2K00 A;  1EF1 A;  4HB4 B;  4C0A A;  2COD A;  3A8Q A;  1BWN A;  1OQN A;  2NMB A;  4PQ0 A;  5HE3 A;  4K2P A;  5DI9 B;  1XKE A;  5J3Y A;  3BJI A;  2COP A;  4TKN A;  1TQZ A;  3PZD A;  3DXC A;  2DYQ A;  1Y19 B;  2RNR B;  2K2U A;  1WJM A;  2I5C A;  2G35 A;  2RLO A;  3TW1 A;  3FEH A;  2EMT A;  2Z0P A;  3M1I B;  2YS1 A;  3PVU A;  4L6E A;  4WVF B;  2EMS A;  4HHV A;  4KHB B;  1UNR A;  2GCJ A;  4ILH A;  4TYZ A;  1QC6 A;  1Y5O A;  2DLW A;  3PVW A;  4HAW B;  4EMO A;  5DH9 B;  2H7D A;  4JKA A;  1ZM0 A;  1V5U A;  4CHM A;  4GMV A;  1PFJ A;  5C5B A;  1PLS A;  2N0Y A;  1X05 A;  1X1G A;  2N23 A;  2YS3 A;  1UPR A;  2MWN B;  4HDO A;  2QKL A;  4Z2M B;  1KZG A;  1DDW A;  3KZ1 A;  1XCG A;  3FLV A;  2M14 A;  4JK9 A;  1HBK A;  3E9O A;  2YSZ A;  2J59 M;  4HB3 B;  2DHK A;  3KRX A;  1DBH A;  3U8Z A;  1U5G A;  2D9W A;  4GPT B;  3QIJ A;  1QQG A;  3BIN A;  5FI0 A;  5D27 A;  2W2X C;  4A6H A;  3AU5 A;  2HE7 A;  1BTK A;  3DXE A;  3ODW A;  3CIK A;  1MKE A;  1K5G B;  5JVL A;  1FB8 A;  4EJN A;  1RRP B;  2DTC A;  2JP2 A;  1V5M A;  1KI1 B;  1M7E A;  2FJ9 A;  2K2J A;  1KZ7 A;  3GYO A;  2Y7B A;  3PP2 A;  3SBT A;  2UVM A;  1P3R A;  1TXD A;  2MFQ A;  1K5D B;  3ODX A;  2COF A;  2KUP A;  4EKU A;  4GXB A;  3D8E A;  1MIZ B;  1M7R A;  2EC1 A;  5DIF B;  4Z2N A;  3GYP A;  2X18 A;  3D8D A;  5HE1 A;  3WA0 A;  5HE2 A;  4XWX A;  1FHW A;  2YRY A;  3TVV A;  4WSF A;  1MK9 B;  1OY2 A;  4DBB A;  1BAK A;  1UPQ A;  4WJ7 A;  1UEF A;  1WGQ A;  1EGX A;  5D3X A;  3RCP A;  1JDE A;  1U27 A;  2H7E A;  4NSW A;  4KHO A;  1EAZ A;  2COC A;  3A98 B;  3SBG A;  4MY6 A;  1NTV A;  1HB8 A;  2FDQ A;  3U7D A;  1XOD A;  2E2X A;  1KBL A;  1XD4 A;  3ML4 A;  3HW2 B;  4B6H A;  1NTY A;  2CY5 A;  5J3Q A;  2L1C A;  2RVB B;  3PVL A;  4BBK A;  3O96 A;  4IOY X;  1NU2 A;  4IFS A;  4JKE A;  3WYF B;  3VIA A;  1Q67 A;  3E66 A;  2D4Q A;  1N3H A;  2FJL A;  5C79 A;  1FGY A;  2I1J A;  4DXA B;  3KSY A;  4YL8 A;  1W1D A;  3MDB C;  5C6R A;  2D10 A;  3NSU A;  3AU4 A;  2ROZ B;  1U5F A;  5JHG A;  1DIK A;  1TJ6 A;  2CRF A;  5FI1 A;  3SNH A;  1BTN A;  1Z87 A;  3FSS A;  5CLL B;  2ZPY A;  1GGO A;  1XX0 A;  3PSC A;  2YS5 A;  4A6F B;  4A6F A;  2CQU A;  1V89 A;  3KRW A;  1DDM A;  4HB2 B;  4HB0 B;  3MPX A;  3A8P A;  4JK8 A;  1V88 A;  3UZT A;  1VBH A;  1GC6 A;  2P0F A;  2GS0 A;  1B55 A;  4K2O A;  3N7C A;  3G9W A;  2D9X A;  1V5P A;  1NI2 A;  1NTI A;  4ZRJ A;  3ZVR A;  1W1H A;  2Z0O A;  2R0D A;  2LUL A;  5EFX A;  1ISN A;  1FAO A;  4F7U P;  2DA0 A;  1FGZ A;  2ABD A;  5L81 A;  3OAN A;  2X0S A;  2Y8F A;  1ZSQ A;  4HDQ A;  1EVH A;  1FHX A;  4HAV B;  2R82 A;  2RUK B;  2RSG A;  3PG7 A;  3EPY A;  2IYB A;  4JKF A;  1WGU A;  1P5T A;  1ST7 A;  4PNK A;  4ZRI A;  4JK7 A;  5KCV A;  1FHO A;  1X1F A;  4Y94 A;  5C16 A;  3E9P A;  1J0W A;  2AEH A;  4HAT B;  2HRJ A;  2J0K A;  5IJM A;  1MPH A;  1U5D A;  4HAY B;  4K81 A;  3P7Z A;  2LOX A;  1PMS A;  4NY0 A;  3FM8 C;  1X86 A;  2R09 A;  3X23 A;  2DN6 A;  5DHA B;  2KCJ A;  1E5W A;  2YVC A;  4MT7 A;  2LBB A;  5LON B;  4ILG B;  1FOE A;  2WH5 A;  4KHA A;  1H4R A;  2QKM A;  2DYN A;  1DDV A;  2D9Z A;  4P7I A;  2DHJ A;  1P6S A;  1OMW A;  2P0D A;  4ILJ A;  1UNQ A;  1SHC A;  2EJ8 A;  1ZVR A;  3AJ4 A;  5GOW B;  1W1G A;  3TO1 A;  2ELA A;  3E9L A;  2D2Q A;  3KY9 A;  3ZDT A;  2M38 A;  1KC7 A;  3CXB B;  4KAX B;  3F0W A;  2D9V A;  4GZU A;  3QWM A;  2IFS A;  5JHH A;  1ACA A;  4KVG B;  2HTH B;  2DFK A;  4F7H A;  2CB8 A;  4K17 A;  3TFM A;  5LOP B;  2LG1 A;  2ELB A;  2NZ8 B;  3SV1 A;  3ULC A;  3V5W A;  4HAU B;  5HE0 A;  2YT0 A;  2GCL A;  3VOQ A;  2DKQ A;  5CLQ B;  1U5E A;  3FP5 A;  5J3T A;  1WG7 A;  1MK7 B;  4A6K A;  3DXD A;  2D9Y A;  1J19 A;  1HB6 A;  2UZR A;  4YON A;  2PZ1 A;  1IRS A;  3HQC A;  2VSZ A;  2J0M A;  2COA A;  1UNP A;  4CHJ A;  5JP4 A;  4ZRK A;  1LB1 A;  1WJ1 A;  5C5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...