1MK7B

Crystal structure of an integrin beta3-talin chimera
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Integrin Beta3
total genus 57
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk7B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk7B02
3AU5A 2D10A 2L1CA 2J0MA 4IOYX 1Z87A 1AQCA 3WYFB 2PZ1A 1RRPB 2D9YA 3FP5A 2LYDA 2Q13A 4GXBA 1XX0A 3UZTA 3TCAA 5D3VA 4EKUA 2YSZA 4CHMA 3GYPA 1TQZA 1Y5OA 1NU2A 3BJIA 5EFXA 2EMTA 2P0DA 2EMSA 1MK7B 1H10A 4MT7A 5JP4A 4IFSA 1WG7A 4C0AA 1ST7A 3ODWA 1MK9B 2ROZB 4HAZB 2DFKA 1I7AA 4K2PA 3P6AA 3KZ1A 4D0NB 2N0YA 4H8SA 1N3HA 5HE1A 3KRWA 2BCJA 2Y8GA 4Z2MB 2M38A 4Y94A 4HAXB 2ADZA 3X23A 2DHIA 2D2QA 2CQUA 4KAXB 1WGUA 1OY2A 1QQGA 3FSSA 5HE2A 1X86A 3FLVA 1XODA 2VRWB 1GG3A 1X05A 1NTVA 4WJ7A 1V61A 3IVFA 2ELAA 3OANA 2GJYA 3F5RA 2D9ZA 5GOWB 2DKQA 3DXDA 2DHJA 2LKOA 1TJ6A 2YS5A 1LW3A 2W2XD 1U5DA 3PVUA 2D4QA 2DTCA 4K2OA 2W2XC 1XKEA 4A6FB 2GCJA 2IYBA 1UEFA 2J0JA 1UNRA 4DBBA 2UZSA 1DDWA 5J3YA 2MDXA 4YONA 2QKLA 1V5MA 2XQNM 4F7HA 4HB0B 1I2HA 5D3XA 2JP2A 5D3YA 3F0WA 2D9WA 3PSCA 1LB1A 2I5CA 1NTIA 3PG7A 3SUZA 2NZ8B 3TO1A 4F7UP 3ULBA 1FHOA 2K00A 4HAVB 1RJ2A 4A6HA 2AEHA 4BBKA 1ZC3B 1J0WA 3KSYA 5DHFB 4GN1A 3QBVB 4ZRJA 4WSFA 2VSZA 1UNQA 3HQCA 1U27A 1XR0B 1V89A 2LG1A 5DI9B 2H7DA 2I1JA 2COFA 2KGXB 3TW1A 1HB6A 3ZVRA 2RQ1A 1OQNA 2YRYA 3A8QA 1V88A 4KVGB 4ZRKA 1KZGA 3KY9A 1MIZB 2Z0OA 2DA0A 3DXEA 2ROVA 2LOXA 5C79A 2R0DA 1H4RA 1TXDA 2I5FA 1BTNA 1P6SA 2HTHB 4K81A 1MPHA 2MWNB 2GCLA 4KHBB 1J19A 2Y8FA 3FEHA 1DYNA 1U2BA 1FGZA 1UPRA 3PZDA 5C5BB 1FGYA 2DLWA 2COCA 5FI1A 3D8DA 1PMSA 2OQBA 4EMOA 1FHWA 3T06A 5DIFB 2D11A 3ODXA 1EVHA 2ZPYA 1X1FA 3PVLA 1WI1A 2D9XA 1ACAA 3MPXA 2Y7BA 4B6HA 2RNRB 1FHXA 2DKPA 2FJLA 1FOEA 1ISNA 1K5DB 4HAYB 3SNHA 2FDQA 5DHAB 4XWXA 4NY0A 2ELBA 1DDVA 2CY4A 2DX5A 2MKRA 1GC7A 5JHGA 3ODOA 1DDMA 1PFJA 3RCPA 2W2WA 4HB4B 2Z0PA 4TYZA 3MDBC 2G35A 2UVMA 2R09A 3SV1A 5D27A 1W1GA 2UZRA 2P8VA 2KCJA 1P3RA 4K17A 2N23A 5KCVA 5KQ4A 1GC6A 2GS0A 4HATB 5D3WA 3FM8C 1XD4A 1U5FA 1XCGA 4HHVA 2J0KA 5C5BA 4GPTB 1V5PA 2H7EA 4MY6A 2COPA 3NSUA 2YVCA 2DYNA 1SGHA 4WVFB 3GYOA 3P7ZA 5HE0A 1M7RA 1ZC4B 2YS1A 2I1KA 1X11A 1HBKA 2RLOA 1K5GB 3D8FA 1M7EA 2CODA 1V5UA 3ULCA 1EAZA 3QIJA 1KZ7A 4PQ0A 3PP2A 2LULA 1B55A 1DROA 3V5WA 1U5EA 5CLQB 5JLJB 3HW2B 4CHJA 3G9WA 1W1DA 2RUKB 4L6EA 2QKMA 2MFQA 4F7GA 3ZDTA 2RSGA 4DXAB 1FAOA 2YS3A 1NTYA 1EGXA 2IFSA 1UNPA 2EC1A 2YT0A 1Q67A 2HRJA 2DYQA 4A6KA 1MIXA 2CB8A 3HK0A 4HB3B 3TVVA 2NMBA 3O96A 2P0HA 1WJ1A 5JHHA 3A98B 3ML4A 3M1IB 4TKNA 5J3TA 1MAIA 3KRXA 4GZUA 3A8PA 1Y19B 4NSWA 1KI1B 2CRFA 1NVLA 1U5GA 3U8ZA 1PLSA 4GMVA 5LONB 2HE7A 3PEGA 3N7CA 4HAUB 3EPYA 2M14A 4HDOA 2P0FA 4PNKA 5CLLB 4DX8A 5KQ1A 2V76A 4ZRIA 2X18A 1IRSA 1SHCA 3VIAA 4DX90 1BAKA 4GMXB 4YL8A 3QWMA 2YT1A 2D9VA 5DH9B 3CIKA 5IJMA 3SO6A 2CY5A 5LOPB 1HB8A 4CYEA 1UPQA 3PVWA 1X1GA 2K2JA 3DXCA 1ZSQA 1U29A 2E2XA 1ZVRA 5C6RA 3AJ4A 2COAA 2VKIA 4HB2B 4IAPA 2AL6A 2DN6A 3D8EA 4A6FA 4HAWB 1MKEA 2OTXA 2RVBB 5C16A 1WJMA 4HDQA 3BINA 4KHAA 5FI0A 5HE3A 1E5WA 4Z2NA 2DHKA 5L81A 4P7IA 3LJUX 1FB8A 1W1HA 2ABDA 3AU4A 1ZM0A 2EJ8A 2L2IA 3VOQA 2K2UA 1NI2A 4MK0A 4EJNA 2WH5A 3U7DA 2RGNB 3SYXA 2FJ9A 1BTKA 1WGQA 1BWNA 3TFMA 2YF0A 1EF1A 1P5TA 4KHOA 5J3QA 1DBHA 2LOZA 3CXBB 3WA0A 1OMWA 2KUPA 1QC6A 2DX1A 1WVHA 2CAYA 2Z0QA 4A5KA 2LBBA 2J59M 1AWEA
chains in the Genus database with same CATH superfamily
3AU5A 2D10A 2L1CA 2J0MA 2X0SA 4IOYX 1Z87A 1AQCA 3WYFB 2PZ1A 1RRPB 2D9YA 3FP5A 2LYDA 2Q13A 4GXBA 1XX0A 4JK9A 2K8EA 4KHBA 3UZTA 4JK7A 3TCAA 5D3VA 4EKUA 2YSZA 4CHMA 3GYPA 1TQZA 1Y5OA 1JDEA 1NU2A 3E9PA 3BJIA 5EFXA 3E66A 2EMTA 4HSIA 2P0DA 2EMSA 1MK7B 1H10A 4MT7A 4JKGA 4IFSA 1WG7A 5JP4A 4C0AA 2YT2A 1ST7A 3ODWA 1MK9B 2ROZB 4HAZB 2DFKA 1I7AA 4K2PA 3P6AA 3KZ1A 4D0NB 3SBGA 2N0YA 4H8SA 1N3HA 5HE1A 3KRWA 2BCJA 2Y8GA 4Z2MB 2M38A 4Y94A 4HAXB 2ADZA 3X23A 2DHIA 2D2QA 2KIEA 2CQUA 4KAXB 1WGUA 1OY2A 4JKAA 1QQGA 3FSSA 3A58A 5HE2A 1X86A 3FLVA 1XODA 2VRWB 1GG3A 1X05A 1NTVA 4WJ7A 1V61A 2NBVA 3IVFA 2ELAA 3OANA 2GJYA 1ZYIA 3F5RA 2D9ZA 5GOWB 4GNKB 3HSAA 2DKQA 2DHJA 2KIGA 3DXDA 2LKOA 1TJ6A 2YS5A 1LW3A 2W2XD 1U5DA 3PVUA 2D4QA 2DTCA 4K2OA 1VBHA 2W2XC 1VBGA 4ILJA 1XKEA 4A6FB 2GCJA 2IYBA 1UEFA 2J0JA 1UNRA 4DBBA 1DIKA 2UZSA 4L1RA 1DDWA 5J3YA 2MDXA 4YONA 2QKLA 1V5MA 2XQNM 3NWAA 4F7HA 4HB0B 1I2HA 5D3XA 4QXAB 2JP2A 5D3YA 3F0WA 4QJ5B 2D9WA 3PSCA 1LB1A 2I5CA 1NTIA 3PG7A 3SUZA 5I2SA 2NZ8B 3TO1A 4F7UP 3ULBA 1FHOA 2K00A 1KC7A 4HAVB 1RJ2A 3NW8A 4A6HA 2AEHA 3E9OA 4CSQA 4BBKA 1ZC3B 1J0WA 3KSYA 5DHFB 4GN1A 3QBVB 4ZRJA 4WSFA 2VSZA 1UNQA 3HQCA 1U27A 1XR0B 1V89A 2LG1A 5DI9B 2H7DA 3ENBA 2I1JA 2COFA 2KGXB 3TW1A 1HB6A 3ZVRA 3NWFA 2RQ1A 1OQNA 2YRYA 3A8QA 1V88A 4KVGB 4ZRKA 1KZGA 3KY9A 1MIZB 2Z0OA 2DA0A 3DXEA 2ROVA 5IRSA 2LOXA 5C79A 2R0DA 1H4RA 1TXDA 2I5FA 1BTNA 1GGOA 1P6SA 2HTHB 4K81A 2MWNB 1MPHA 2GCLA 4KHBB 1J19A 2Y8FA 3FEHA 2DIKA 1DYNA 1U2BA 1FGZA 1UPRA 3PZDA 5C5BB 1FGYA 2DLWA 2COCA 2Z14A 5FI1A 2ZKMX 3D8DA 1PMSA 2OQBA 2FJUB 1FHWA 3T06A 5DIFB 2D11A 4EMOA 1EVHA 2ZPYA 1X1FA 3ODXA 4DIXA 3PVLA 1WI1A 2D9XA 3OHMB 1ACAA 3MPXA 2Y7BA 4B6HA 3SBTA 2RNRB 1FHXA 2DKPA 2FJLA 1FOEA 1ISNA 1K5DB 4HAYB 3SNHA 2FDQA 5DHAB 4JKDA 4XWXA 4NY0A 2ELBA 1DDVA 2CY4A 2GUMA 2DX5A 2MKRA 1GC7A 3FVCA 5JHGA 3ODOA 1DDMA 1PFJA 3RCPA 1AWEA 4ILHA 2W2WA 4HB4B 2Z0PA 4GOUA 4TYZA 3MDBC 2G35A 2UVMA 2R09A 3SV1A 5D27A 1W1GA 2UZRA 2P8VA 2KCJA 1P3RA 4K17A 2N23A 5KCVA 5KQ4A 4JKBA 1GC6A 2GS0A 4HATB 5D3WA 3FM8C 1XD4A 1U5FA 1XCGA 4OSNA 4HHVA 2J0KA 5C5BA 4GPTB 1V5PA 4ILGB 2H7EA 4MY6A 2COPA 4JKEA 2YVCA 3NSUA 2DYNA 2Z4DA 1SGHA 1T77A 4WVFB 4QJ4B 3GYOA 3P7ZA 5HE0A 1M7RA 1ZC4B 2YS1A 5I2MA 2I1KA 1X11A 1HBKA 2RLOA 1K5GB 3D8FA 1M7EA 2CODA 1V5UA 3ULCA 1EAZA 3QIJA 1KZ7A 4PQ0A 3PP2A 2LULA 1B55A 2RRFA 1DROA 3V5WA 1U5EA 2R82A 5CLQB 5JLJB 3B77A 3HW2B 4CHJA 3G9WA 4JKCA 2Z13A 1W1DA 2RUKB 4L6EA 2QKMA 2KR0A 2MFQA 4F7GA 3ZDTA 2RSGA 4DXAB 1FAOA 2YS3A 1NTYA 1EGXA 2IFSA 1UNPA 2EC1A 1Q67A 2YT0A 2HRJA 2DYQA 4A6KA 1MIXA 2CB8A 3HK0A 4HB3B 3TVVA 2NMBA 3O96A 2P0HA 1WJ1A 5JHHA 3A98B 3ML4A 3M1IB 4TKNA 5J3TA 1MAIA 3KRXA 4GZUA 3A8PA 1Y19B 4NSWA 1KI1B 2CRFA 1NVLA 4JKHA 1U5GA 3U8ZA 1PLSA 4GMVA 5LONB 2HE7A 3PEGA 3N7CA 5JVLA 4HAUB 3EPYA 2M14A 4HDOA 2P0FA 2K49A 4PNKA 4JK8A 5CLLB 4DX8A 5KQ1A 4OT1A 2V76A 4ZRIA 2X18A 1IRSA 1SHCA 3VIAA 4DX90 1BAKA 4GMXB 4YL8A 3QWMA 2YT1A 2D9VA 5DH9B 3CIKA 5IJMA 3SO6A 2CY5A 5LOPB 1HB8A 4CYEA 1UPQA 3PVWA 1X1GA 2K2JA 4D6WA 3DXCA 1ZSQA 1U29A 2E2XA 1ZVRA 5C6RA 3AJ4A 2COAA 1MI1A 5M4YB 4QJ3B 2VKIA 4HB2B 4IAPA 2AL6A 2KUQA 2DN6A 3D8EA 4A6FA 4HAWB 2OTXA 1MKEA 2RVBB 5C16A 1WJMA 4HDQA 3BINA 4KHAA 5FI0A 5HE3A 1E5WA 4Z2NA 2DHKA 5L81A 4P7IA 4JKFA 3LJUX 2R2YA 1FB8A 1W1HA 2ABDA 3AU4A 1ZM0A 2EJ8A 2L2IA 3VOQA 2K2UA 1NI2A 4MK0A 3U12A 4EJNA 3NWDA 2WH5A 3U7DA 2RGNB 3SYXA 2FJ9A 1BTKA 1WGQA 1BWNA 3TFMA 2YF0A 1EF1A 1P5TA 4KHOA 5J3QA 5LG4B 3E9LA 1DBHA 2LOZA 4JKGB 2Z59A 3CXBB 3DCXA 3WA0A 1OMWA 2KUPA 1QC6A 2DX1A 1WVHA 2CAYA 2Z0QA 3HIEA 4A5KA 2LBBA 2J59M 1KBLA
chains in the Genus database with same CATH topology
3AU5A 2D10A 2L1CA 2J0MA 2X0SA 4IOYX 1Z87A 1AQCA 3WYFB 2PZ1A 1RRPB 2D9YA 3FP5A 2LYDA 2Q13A 4GXBA 1XX0A 4JK9A 3UZTA 4JK7A 3TCAA 5D3VA 4EKUA 2YSZA 4CHMA 3GYPA 1TQZA 1Y5OA 1JDEA 1NU2A 3E9PA 3BJIA 5EFXA 3E66A 2EMTA 2P0DA 2EMSA 1MK7B 1H10A 4MT7A 4JKGA 4IFSA 1WG7A 5JP4A 4C0AA 1ST7A 3ODWA 1MK9B 2ROZB 4HAZB 2DFKA 1I7AA 4K2PA 3P6AA 3KZ1A 4D0NB 3SBGA 2N0YA 4H8SA 1N3HA 5HE1A 3KRWA 2BCJA 2Y8GA 4Z2MB 2M38A 4Y94A 4HAXB 2ADZA 3X23A 2DHIA 2D2QA 2CQUA 4KAXB 1WGUA 1OY2A 4JKAA 1QQGA 3FSSA 5HE2A 1X86A 3FLVA 1XODA 2VRWB 1GG3A 1X05A 1NTVA 4WJ7A 1V61A 3IVFA 2ELAA 3OANA 2GJYA 3F5RA 2D9ZA 5GOWB 2DKQA 2DHJA 3DXDA 2LKOA 1TJ6A 2YS5A 1LW3A 2W2XD 1U5DA 3PVUA 2D4QA 2DTCA 4K2OA 1VBHA 2W2XC 1VBGA 4ILJA 1XKEA 4A6FB 2GCJA 2IYBA 1UEFA 2J0JA 1UNRA 4DBBA 1DIKA 2UZSA 1DDWA 5J3YA 2MDXA 4YONA 2QKLA 1V5MA 2XQNM 4F7HA 4HB0B 1I2HA 5D3XA 2JP2A 5D3YA 3F0WA 2D9WA 3PSCA 1LB1A 2I5CA 1NTIA 3PG7A 3SUZA 2NZ8B 3TO1A 4F7UP 3ULBA 1FHOA 2K00A 1KC7A 4HAVB 1RJ2A 4A6HA 2AEHA 3E9OA 4BBKA 1ZC3B 1J0WA 3KSYA 5DHFB 4GN1A 3QBVB 4ZRJA 4WSFA 2VSZA 1UNQA 3HQCA 1U27A 1XR0B 1V89A 2LG1A 5DI9B 2H7DA 3ENBA 2I1JA 2COFA 2KGXB 3TW1A 1HB6A 3ZVRA 2RQ1A 1OQNA 2YRYA 3A8QA 1V88A 4KVGB 4ZRKA 1KZGA 3KY9A 1MIZB 2Z0OA 2DA0A 3DXEA 2ROVA 2LOXA 5C79A 2R0DA 1H4RA 1TXDA 2I5FA 1BTNA 1GGOA 1P6SA 2HTHB 4K81A 2MWNB 1MPHA 2GCLA 4KHBB 1J19A 2Y8FA 3FEHA 2DIKA 1DYNA 1U2BA 1FGZA 1UPRA 3PZDA 5C5BB 1FGYA 2DLWA 2COCA 5FI1A 3D8DA 1PMSA 2OQBA 4EMOA 1FHWA 3T06A 5DIFB 2D11A 1EVHA 2ZPYA 1X1FA 3ODXA 3PVLA 1WI1A 2D9XA 1ACAA 3MPXA 2Y7BA 4B6HA 3SBTA 2RNRB 1FHXA 2DKPA 2FJLA 1FOEA 1ISNA 1K5DB 4HAYB 3SNHA 2FDQA 5DHAB 4JKDA 4XWXA 4NY0A 2ELBA 1DDVA 2CY4A 2DX5A 2MKRA 1GC7A 5JHGA 3ODOA 1DDMA 1PFJA 3RCPA 1AWEA 4ILHA 2W2WA 4HB4B 2Z0PA 4TYZA 3MDBC 2G35A 2UVMA 2R09A 3SV1A 5D27A 1W1GA 2UZRA 2P8VA 2KCJA 1P3RA 4K17A 2N23A 5KCVA 5KQ4A 4JKBA 1GC6A 2GS0A 4HATB 5D3WA 3FM8C 1XD4A 1U5FA 1XCGA 4HHVA 2J0KA 5C5BA 4GPTB 1V5PA 4ILGB 2H7EA 4MY6A 2COPA 4JKEA 2YVCA 3NSUA 2DYNA 1SGHA 4WVFB 3GYOA 3P7ZA 5HE0A 1M7RA 1ZC4B 2YS1A 2I1KA 1X11A 1HBKA 2RLOA 1K5GB 3D8FA 1M7EA 2CODA 1V5UA 3ULCA 1EAZA 3QIJA 1KZ7A 4PQ0A 3PP2A 2LULA 1B55A 1DROA 3V5WA 1U5EA 2R82A 5CLQB 5JLJB 3HW2B 4CHJA 3G9WA 4JKCA 1W1DA 2RUKB 4L6EA 2QKMA 2MFQA 4F7GA 3ZDTA 2RSGA 4DXAB 1FAOA 2YS3A 1NTYA 1EGXA 2IFSA 1UNPA 2EC1A 2YT0A 1Q67A 2HRJA 2DYQA 4A6KA 1MIXA 2CB8A 3HK0A 4HB3B 3TVVA 2NMBA 3O96A 2P0HA 1WJ1A 5JHHA 3A98B 3ML4A 3M1IB 4TKNA 5J3TA 1MAIA 3KRXA 4GZUA 3A8PA 1Y19B 4NSWA 1KI1B 2CRFA 1NVLA 4JKHA 1U5GA 3U8ZA 1PLSA 4GMVA 5LONB 2HE7A 3PEGA 3N7CA 5JVLA 4HAUB 3EPYA 2M14A 4HDOA 2P0FA 4PNKA 4JK8A 5CLLB 4DX8A 5KQ1A 2V76A 4ZRIA 2X18A 1IRSA 1SHCA 3VIAA 4DX90 1BAKA 4GMXB 4YL8A 3QWMA 2YT1A 2D9VA 5DH9B 3CIKA 5IJMA 3SO6A 2CY5A 5LOPB 1HB8A 4CYEA 1UPQA 3PVWA 1X1GA 2K2JA 3DXCA 1ZSQA 1U29A 2E2XA 1ZVRA 5C6RA 3AJ4A 2COAA 2VKIA 4HB2B 4IAPA 2AL6A 2DN6A 3D8EA 4A6FA 4HAWB 1MKEA 2OTXA 2RVBB 5C16A 1WJMA 4HDQA 3BINA 4KHAA 5FI0A 5HE3A 1E5WA 4Z2NA 2DHKA 5L81A 4P7IA 4JKFA 3LJUX 1FB8A 1W1HA 2ABDA 3AU4A 1ZM0A 2EJ8A 2L2IA 3VOQA 2K2UA 1NI2A 4MK0A 4EJNA 2WH5A 3U7DA 2RGNB 3SYXA 2FJ9A 1BTKA 1WGQA 1BWNA 3TFMA 2YF0A 1EF1A 1P5TA 4KHOA 5J3QA 3E9LA 1DBHA 2LOZA 4JKGB 3CXBB 3WA0A 1OMWA 2KUPA 1QC6A 2DX1A 1WVHA 2CAYA 2Z0QA 4A5KA 2LBBA 2J59M 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  2D10 A;  2L1C A;  2J0M A;  4IOY X;  1Z87 A;  1AQC A;  3WYF B;  2PZ1 A;  1RRP B;  2D9Y A;  3FP5 A;  2LYD A;  2Q13 A;  4GXB A;  1XX0 A;  3UZT A;  3TCA A;  5D3V A;  4EKU A;  2YSZ A;  4CHM A;  3GYP A;  1TQZ A;  1Y5O A;  1NU2 A;  3BJI A;  5EFX A;  2EMT A;  2P0D A;  2EMS A;  1MK7 B;  1H10 A;  4MT7 A;  5JP4 A;  4IFS A;  1WG7 A;  4C0A A;  1ST7 A;  3ODW A;  1MK9 B;  2ROZ B;  4HAZ B;  2DFK A;  1I7A A;  4K2P A;  3P6A A;  3KZ1 A;  4D0N B;  2N0Y A;  4H8S A;  1N3H A;  5HE1 A;  3KRW A;  2BCJ A;  2Y8G A;  4Z2M B;  2M38 A;  4Y94 A;  4HAX B;  2ADZ A;  3X23 A;  2DHI A;  2D2Q A;  2CQU A;  4KAX B;  1WGU A;  1OY2 A;  1QQG A;  3FSS A;  5HE2 A;  1X86 A;  3FLV A;  1XOD A;  2VRW B;  1GG3 A;  1X05 A;  1NTV A;  4WJ7 A;  1V61 A;  3IVF A;  2ELA A;  3OAN A;  2GJY A;  3F5R A;  2D9Z A;  5GOW B;  2DKQ A;  3DXD A;  2DHJ A;  2LKO A;  1TJ6 A;  2YS5 A;  1LW3 A;  2W2X D;  1U5D A;  3PVU A;  2D4Q A;  2DTC A;  4K2O A;  2W2X C;  1XKE A;  4A6F B;  2GCJ A;  2IYB A;  1UEF A;  2J0J A;  1UNR A;  4DBB A;  2UZS A;  1DDW A;  5J3Y A;  2MDX A;  4YON A;  2QKL A;  1V5M A;  2XQN M;  4F7H A;  4HB0 B;  1I2H A;  5D3X A;  2JP2 A;  5D3Y A;  3F0W A;  2D9W A;  3PSC A;  1LB1 A;  2I5C A;  1NTI A;  3PG7 A;  3SUZ A;  2NZ8 B;  3TO1 A;  4F7U P;  3ULB A;  1FHO A;  2K00 A;  4HAV B;  1RJ2 A;  4A6H A;  2AEH A;  4BBK A;  1ZC3 B;  1J0W A;  3KSY A;  5DHF B;  4GN1 A;  3QBV B;  4ZRJ A;  4WSF A;  2VSZ A;  1UNQ A;  3HQC A;  1U27 A;  1XR0 B;  1V89 A;  2LG1 A;  5DI9 B;  2H7D A;  2I1J A;  2COF A;  2KGX B;  3TW1 A;  1HB6 A;  3ZVR A;  2RQ1 A;  1OQN A;  2YRY A;  3A8Q A;  1V88 A;  4KVG B;  4ZRK A;  1KZG A;  3KY9 A;  1MIZ B;  2Z0O A;  2DA0 A;  3DXE A;  2ROV A;  2LOX A;  5C79 A;  2R0D A;  1H4R A;  1TXD A;  2I5F A;  1BTN A;  1P6S A;  2HTH B;  4K81 A;  1MPH A;  2MWN B;  2GCL A;  4KHB B;  1J19 A;  2Y8F A;  3FEH A;  1DYN A;  1U2B A;  1FGZ A;  1UPR A;  3PZD A;  5C5B B;  1FGY A;  2DLW A;  2COC A;  5FI1 A;  3D8D A;  1PMS A;  2OQB A;  4EMO A;  1FHW A;  3T06 A;  5DIF B;  2D11 A;  3ODX A;  1EVH A;  2ZPY A;  1X1F A;  3PVL A;  1WI1 A;  2D9X A;  1ACA A;  3MPX A;  2Y7B A;  4B6H A;  2RNR B;  1FHX A;  2DKP A;  2FJL A;  1FOE A;  1ISN A;  1K5D B;  4HAY B;  3SNH A;  2FDQ A;  5DHA B;  4XWX A;  4NY0 A;  2ELB A;  1DDV A;  2CY4 A;  2DX5 A;  2MKR A;  1GC7 A;  5JHG A;  3ODO A;  1DDM A;  1PFJ A;  3RCP A;  2W2W A;  4HB4 B;  2Z0P A;  4TYZ A;  3MDB C;  2G35 A;  2UVM A;  2R09 A;  3SV1 A;  5D27 A;  1W1G A;  2UZR A;  2P8V A;  2KCJ A;  1P3R A;  4K17 A;  2N23 A;  5KCV A;  5KQ4 A;  1GC6 A;  2GS0 A;  4HAT B;  5D3W A;  3FM8 C;  1XD4 A;  1U5F A;  1XCG A;  4HHV A;  2J0K A;  5C5B A;  4GPT B;  1V5P A;  2H7E A;  4MY6 A;  2COP A;  3NSU A;  2YVC A;  2DYN A;  1SGH A;  4WVF B;  3GYO A;  3P7Z A;  5HE0 A;  1M7R A;  1ZC4 B;  2YS1 A;  2I1K A;  1X11 A;  1HBK A;  2RLO A;  1K5G B;  3D8F A;  1M7E A;  2COD A;  1V5U A;  3ULC A;  1EAZ A;  3QIJ A;  1KZ7 A;  4PQ0 A;  3PP2 A;  2LUL A;  1B55 A;  1DRO A;  3V5W A;  1U5E A;  5CLQ B;  5JLJ B;  3HW2 B;  4CHJ A;  3G9W A;  1W1D A;  2RUK B;  4L6E A;  2QKM A;  2MFQ A;  4F7G A;  3ZDT A;  2RSG A;  4DXA B;  1FAO A;  2YS3 A;  1NTY A;  1EGX A;  2IFS A;  1UNP A;  2EC1 A;  2YT0 A;  1Q67 A;  2HRJ A;  2DYQ A;  4A6K A;  1MIX A;  2CB8 A;  3HK0 A;  4HB3 B;  3TVV A;  2NMB A;  3O96 A;  2P0H A;  1WJ1 A;  5JHH A;  3A98 B;  3ML4 A;  3M1I B;  4TKN A;  5J3T A;  1MAI A;  3KRX A;  4GZU A;  3A8P A;  1Y19 B;  4NSW A;  1KI1 B;  2CRF A;  1NVL A;  1U5G A;  3U8Z A;  1PLS A;  4GMV A;  5LON B;  2HE7 A;  3PEG A;  3N7C A;  4HAU B;  3EPY A;  2M14 A;  4HDO A;  2P0F A;  4PNK A;  5CLL B;  4DX8 A;  5KQ1 A;  2V76 A;  4ZRI A;  2X18 A;  1IRS A;  1SHC A;  3VIA A;  4DX9 0;  1BAK A;  4GMX B;  4YL8 A;  3QWM A;  2YT1 A;  2D9V A;  5DH9 B;  3CIK A;  5IJM A;  3SO6 A;  2CY5 A;  5LOP B;  1HB8 A;  4CYE A;  1UPQ A;  3PVW A;  1X1G A;  2K2J A;  3DXC A;  1ZSQ A;  1U29 A;  2E2X A;  1ZVR A;  5C6R A;  3AJ4 A;  2COA A;  2VKI A;  4HB2 B;  4IAP A;  2AL6 A;  2DN6 A;  3D8E A;  4A6F A;  4HAW B;  1MKE A;  2OTX A;  2RVB B;  5C16 A;  1WJM A;  4HDQ A;  3BIN A;  4KHA A;  5FI0 A;  5HE3 A;  1E5W A;  4Z2N A;  2DHK A;  5L81 A;  4P7I A;  3LJU X;  1FB8 A;  1W1H A;  2ABD A;  3AU4 A;  1ZM0 A;  2EJ8 A;  2L2I A;  3VOQ A;  2K2U A;  1NI2 A;  4MK0 A;  4EJN A;  2WH5 A;  3U7D A;  2RGN B;  3SYX A;  2FJ9 A;  1BTK A;  1WGQ A;  1BWN A;  3TFM A;  2YF0 A;  1EF1 A;  1P5T A;  4KHO A;  5J3Q A;  1DBH A;  2LOZ A;  3CXB B;  3WA0 A;  1OMW A;  2KUP A;  1QC6 A;  2DX1 A;  1WVH A;  2CAY A;  2Z0Q A;  4A5K A;  2LBB A;  2J59 M;  1AWE A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  2D10 A;  2L1C A;  2J0M A;  2X0S A;  4IOY X;  1Z87 A;  1AQC A;  3WYF B;  2PZ1 A;  1RRP B;  2D9Y A;  3FP5 A;  2LYD A;  2Q13 A;  4GXB A;  1XX0 A;  4JK9 A;  2K8E A;  4KHB A;  3UZT A;  4JK7 A;  3TCA A;  5D3V A;  4EKU A;  2YSZ A;  4CHM A;  3GYP A;  1TQZ A;  1Y5O A;  1JDE A;  1NU2 A;  3E9P A;  3BJI A;  5EFX A;  3E66 A;  2EMT A;  4HSI A;  2P0D A;  2EMS A;  1MK7 B;  1H10 A;  4MT7 A;  4JKG A;  4IFS A;  1WG7 A;  5JP4 A;  4C0A A;  2YT2 A;  1ST7 A;  3ODW A;  1MK9 B;  2ROZ B;  4HAZ B;  2DFK A;  1I7A A;  4K2P A;  3P6A A;  3KZ1 A;  4D0N B;  3SBG A;  2N0Y A;  4H8S A;  1N3H A;  5HE1 A;  3KRW A;  2BCJ A;  2Y8G A;  4Z2M B;  2M38 A;  4Y94 A;  4HAX B;  2ADZ A;  3X23 A;  2DHI A;  2D2Q A;  2KIE A;  2CQU A;  4KAX B;  1WGU A;  1OY2 A;  4JKA A;  1QQG A;  3FSS A;  3A58 A;  5HE2 A;  1X86 A;  3FLV A;  1XOD A;  2VRW B;  1GG3 A;  1X05 A;  1NTV A;  4WJ7 A;  1V61 A;  2NBV A;  3IVF A;  2ELA A;  3OAN A;  2GJY A;  1ZYI A;  3F5R A;  2D9Z A;  5GOW B;  4GNK B;  3HSA A;  2DKQ A;  2DHJ A;  2KIG A;  3DXD A;  2LKO A;  1TJ6 A;  2YS5 A;  1LW3 A;  2W2X D;  1U5D A;  3PVU A;  2D4Q A;  2DTC A;  4K2O A;  1VBH A;  2W2X C;  1VBG A;  4ILJ A;  1XKE A;  4A6F B;  2GCJ A;  2IYB A;  1UEF A;  2J0J A;  1UNR A;  4DBB A;  1DIK A;  2UZS A;  4L1R A;  1DDW A;  5J3Y A;  2MDX A;  4YON A;  2QKL A;  1V5M A;  2XQN M;  3NWA A;  4F7H A;  4HB0 B;  1I2H A;  5D3X A;  4QXA B;  2JP2 A;  5D3Y A;  3F0W A;  4QJ5 B;  2D9W A;  3PSC A;  1LB1 A;  2I5C A;  1NTI A;  3PG7 A;  3SUZ A;  5I2S A;  2NZ8 B;  3TO1 A;  4F7U P;  3ULB A;  1FHO A;  2K00 A;  1KC7 A;  4HAV B;  1RJ2 A;  3NW8 A;  4A6H A;  2AEH A;  3E9O A;  4CSQ A;  4BBK A;  1ZC3 B;  1J0W A;  3KSY A;  5DHF B;  4GN1 A;  3QBV B;  4ZRJ A;  4WSF A;  2VSZ A;  1UNQ A;  3HQC A;  1U27 A;  1XR0 B;  1V89 A;  2LG1 A;  5DI9 B;  2H7D A;  3ENB A;  2I1J A;  2COF A;  2KGX B;  3TW1 A;  1HB6 A;  3ZVR A;  3NWF A;  2RQ1 A;  1OQN A;  2YRY A;  3A8Q A;  1V88 A;  4KVG B;  4ZRK A;  1KZG A;  3KY9 A;  1MIZ B;  2Z0O A;  2DA0 A;  3DXE A;  2ROV A;  5IRS A;  2LOX A;  5C79 A;  2R0D A;  1H4R A;  1TXD A;  2I5F A;  1BTN A;  1GGO A;  1P6S A;  2HTH B;  4K81 A;  2MWN B;  1MPH A;  2GCL A;  4KHB B;  1J19 A;  2Y8F A;  3FEH A;  2DIK A;  1DYN A;  1U2B A;  1FGZ A;  1UPR A;  3PZD A;  5C5B B;  1FGY A;  2DLW A;  2COC A;  2Z14 A;  5FI1 A;  2ZKM X;  3D8D A;  1PMS A;  2OQB A;  2FJU B;  1FHW A;  3T06 A;  5DIF B;  2D11 A;  4EMO A;  1EVH A;  2ZPY A;  1X1F A;  3ODX A;  4DIX A;  3PVL A;  1WI1 A;  2D9X A;  3OHM B;  1ACA A;  3MPX A;  2Y7B A;  4B6H A;  3SBT A;  2RNR B;  1FHX A;  2DKP A;  2FJL A;  1FOE A;  1ISN A;  1K5D B;  4HAY B;  3SNH A;  2FDQ A;  5DHA B;  4JKD A;  4XWX A;  4NY0 A;  2ELB A;  1DDV A;  2CY4 A;  2GUM A;  2DX5 A;  2MKR A;  1GC7 A;  3FVC A;  5JHG A;  3ODO A;  1DDM A;  1PFJ A;  3RCP A;  1AWE A;  4ILH A;  2W2W A;  4HB4 B;  2Z0P A;  4GOU A;  4TYZ A;  3MDB C;  2G35 A;  2UVM A;  2R09 A;  3SV1 A;  5D27 A;  1W1G A;  2UZR A;  2P8V A;  2KCJ A;  1P3R A;  4K17 A;  2N23 A;  5KCV A;  5KQ4 A;  4JKB A;  1GC6 A;  2GS0 A;  4HAT B;  5D3W A;  3FM8 C;  1XD4 A;  1U5F A;  1XCG A;  4OSN A;  4HHV A;  2J0K A;  5C5B A;  4GPT B;  1V5P A;  4ILG B;  2H7E A;  4MY6 A;  2COP A;  4JKE A;  2YVC A;  3NSU A;  2DYN A;  2Z4D A;  1SGH A;  1T77 A;  4WVF B;  4QJ4 B;  3GYO A;  3P7Z A;  5HE0 A;  1M7R A;  1ZC4 B;  2YS1 A;  5I2M A;  2I1K A;  1X11 A;  1HBK A;  2RLO A;  1K5G B;  3D8F A;  1M7E A;  2COD A;  1V5U A;  3ULC A;  1EAZ A;  3QIJ A;  1KZ7 A;  4PQ0 A;  3PP2 A;  2LUL A;  1B55 A;  2RRF A;  1DRO A;  3V5W A;  1U5E A;  2R82 A;  5CLQ B;  5JLJ B;  3B77 A;  3HW2 B;  4CHJ A;  3G9W A;  4JKC A;  2Z13 A;  1W1D A;  2RUK B;  4L6E A;  2QKM A;  2KR0 A;  2MFQ A;  4F7G A;  3ZDT A;  2RSG A;  4DXA B;  1FAO A;  2YS3 A;  1NTY A;  1EGX A;  2IFS A;  1UNP A;  2EC1 A;  1Q67 A;  2YT0 A;  2HRJ A;  2DYQ A;  4A6K A;  1MIX A;  2CB8 A;  3HK0 A;  4HB3 B;  3TVV A;  2NMB A;  3O96 A;  2P0H A;  1WJ1 A;  5JHH A;  3A98 B;  3ML4 A;  3M1I B;  4TKN A;  5J3T A;  1MAI A;  3KRX A;  4GZU A;  3A8P A;  1Y19 B;  4NSW A;  1KI1 B;  2CRF A;  1NVL A;  4JKH A;  1U5G A;  3U8Z A;  1PLS A;  4GMV A;  5LON B;  2HE7 A;  3PEG A;  3N7C A;  5JVL A;  4HAU B;  3EPY A;  2M14 A;  4HDO A;  2P0F A;  2K49 A;  4PNK A;  4JK8 A;  5CLL B;  4DX8 A;  5KQ1 A;  4OT1 A;  2V76 A;  4ZRI A;  2X18 A;  1IRS A;  1SHC A;  3VIA A;  4DX9 0;  1BAK A;  4GMX B;  4YL8 A;  3QWM A;  2YT1 A;  2D9V A;  5DH9 B;  3CIK A;  5IJM A;  3SO6 A;  2CY5 A;  5LOP B;  1HB8 A;  4CYE A;  1UPQ A;  3PVW A;  1X1G A;  2K2J A;  4D6W A;  3DXC A;  1ZSQ A;  1U29 A;  2E2X A;  1ZVR A;  5C6R A;  3AJ4 A;  2COA A;  1MI1 A;  5M4Y B;  4QJ3 B;  2VKI A;  4HB2 B;  4IAP A;  2AL6 A;  2KUQ A;  2DN6 A;  3D8E A;  4A6F A;  4HAW B;  2OTX A;  1MKE A;  2RVB B;  5C16 A;  1WJM A;  4HDQ A;  3BIN A;  4KHA A;  5FI0 A;  5HE3 A;  1E5W A;  4Z2N A;  2DHK A;  5L81 A;  4P7I A;  4JKF A;  3LJU X;  2R2Y A;  1FB8 A;  1W1H A;  2ABD A;  3AU4 A;  1ZM0 A;  2EJ8 A;  2L2I A;  3VOQ A;  2K2U A;  1NI2 A;  4MK0 A;  3U12 A;  4EJN A;  3NWD A;  2WH5 A;  3U7D A;  2RGN B;  3SYX A;  2FJ9 A;  1BTK A;  1WGQ A;  1BWN A;  3TFM A;  2YF0 A;  1EF1 A;  1P5T A;  4KHO A;  5J3Q A;  5LG4 B;  3E9L A;  1DBH A;  2LOZ A;  4JKG B;  2Z59 A;  3CXB B;  3DCX A;  3WA0 A;  1OMW A;  2KUP A;  1QC6 A;  2DX1 A;  1WVH A;  2CAY A;  2Z0Q A;  3HIE A;  4A5K A;  2LBB A;  2J59 M;  1KBL A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  2D10 A;  2L1C A;  2J0M A;  2X0S A;  4IOY X;  1Z87 A;  1AQC A;  3WYF B;  2PZ1 A;  1RRP B;  2D9Y A;  3FP5 A;  2LYD A;  2Q13 A;  4GXB A;  1XX0 A;  4JK9 A;  3UZT A;  4JK7 A;  3TCA A;  5D3V A;  4EKU A;  2YSZ A;  4CHM A;  3GYP A;  1TQZ A;  1Y5O A;  1JDE A;  1NU2 A;  3E9P A;  3BJI A;  5EFX A;  3E66 A;  2EMT A;  2P0D A;  2EMS A;  1MK7 B;  1H10 A;  4MT7 A;  4JKG A;  4IFS A;  1WG7 A;  5JP4 A;  4C0A A;  1ST7 A;  3ODW A;  1MK9 B;  2ROZ B;  4HAZ B;  2DFK A;  1I7A A;  4K2P A;  3P6A A;  3KZ1 A;  4D0N B;  3SBG A;  2N0Y A;  4H8S A;  1N3H A;  5HE1 A;  3KRW A;  2BCJ A;  2Y8G A;  4Z2M B;  2M38 A;  4Y94 A;  4HAX B;  2ADZ A;  3X23 A;  2DHI A;  2D2Q A;  2CQU A;  4KAX B;  1WGU A;  1OY2 A;  4JKA A;  1QQG A;  3FSS A;  5HE2 A;  1X86 A;  3FLV A;  1XOD A;  2VRW B;  1GG3 A;  1X05 A;  1NTV A;  4WJ7 A;  1V61 A;  3IVF A;  2ELA A;  3OAN A;  2GJY A;  3F5R A;  2D9Z A;  5GOW B;  2DKQ A;  2DHJ A;  3DXD A;  2LKO A;  1TJ6 A;  2YS5 A;  1LW3 A;  2W2X D;  1U5D A;  3PVU A;  2D4Q A;  2DTC A;  4K2O A;  1VBH A;  2W2X C;  1VBG A;  4ILJ A;  1XKE A;  4A6F B;  2GCJ A;  2IYB A;  1UEF A;  2J0J A;  1UNR A;  4DBB A;  1DIK A;  2UZS A;  1DDW A;  5J3Y A;  2MDX A;  4YON A;  2QKL A;  1V5M A;  2XQN M;  4F7H A;  4HB0 B;  1I2H A;  5D3X A;  2JP2 A;  5D3Y A;  3F0W A;  2D9W A;  3PSC A;  1LB1 A;  2I5C A;  1NTI A;  3PG7 A;  3SUZ A;  2NZ8 B;  3TO1 A;  4F7U P;  3ULB A;  1FHO A;  2K00 A;  1KC7 A;  4HAV B;  1RJ2 A;  4A6H A;  2AEH A;  3E9O A;  4BBK A;  1ZC3 B;  1J0W A;  3KSY A;  5DHF B;  4GN1 A;  3QBV B;  4ZRJ A;  4WSF A;  2VSZ A;  1UNQ A;  3HQC A;  1U27 A;  1XR0 B;  1V89 A;  2LG1 A;  5DI9 B;  2H7D A;  3ENB A;  2I1J A;  2COF A;  2KGX B;  3TW1 A;  1HB6 A;  3ZVR A;  2RQ1 A;  1OQN A;  2YRY A;  3A8Q A;  1V88 A;  4KVG B;  4ZRK A;  1KZG A;  3KY9 A;  1MIZ B;  2Z0O A;  2DA0 A;  3DXE A;  2ROV A;  2LOX A;  5C79 A;  2R0D A;  1H4R A;  1TXD A;  2I5F A;  1BTN A;  1GGO A;  1P6S A;  2HTH B;  4K81 A;  2MWN B;  1MPH A;  2GCL A;  4KHB B;  1J19 A;  2Y8F A;  3FEH A;  2DIK A;  1DYN A;  1U2B A;  1FGZ A;  1UPR A;  3PZD A;  5C5B B;  1FGY A;  2DLW A;  2COC A;  5FI1 A;  3D8D A;  1PMS A;  2OQB A;  4EMO A;  1FHW A;  3T06 A;  5DIF B;  2D11 A;  1EVH A;  2ZPY A;  1X1F A;  3ODX A;  3PVL A;  1WI1 A;  2D9X A;  1ACA A;  3MPX A;  2Y7B A;  4B6H A;  3SBT A;  2RNR B;  1FHX A;  2DKP A;  2FJL A;  1FOE A;  1ISN A;  1K5D B;  4HAY B;  3SNH A;  2FDQ A;  5DHA B;  4JKD A;  4XWX A;  4NY0 A;  2ELB A;  1DDV A;  2CY4 A;  2DX5 A;  2MKR A;  1GC7 A;  5JHG A;  3ODO A;  1DDM A;  1PFJ A;  3RCP A;  1AWE A;  4ILH A;  2W2W A;  4HB4 B;  2Z0P A;  4TYZ A;  3MDB C;  2G35 A;  2UVM A;  2R09 A;  3SV1 A;  5D27 A;  1W1G A;  2UZR A;  2P8V A;  2KCJ A;  1P3R A;  4K17 A;  2N23 A;  5KCV A;  5KQ4 A;  4JKB A;  1GC6 A;  2GS0 A;  4HAT B;  5D3W A;  3FM8 C;  1XD4 A;  1U5F A;  1XCG A;  4HHV A;  2J0K A;  5C5B A;  4GPT B;  1V5P A;  4ILG B;  2H7E A;  4MY6 A;  2COP A;  4JKE A;  2YVC A;  3NSU A;  2DYN A;  1SGH A;  4WVF B;  3GYO A;  3P7Z A;  5HE0 A;  1M7R A;  1ZC4 B;  2YS1 A;  2I1K A;  1X11 A;  1HBK A;  2RLO A;  1K5G B;  3D8F A;  1M7E A;  2COD A;  1V5U A;  3ULC A;  1EAZ A;  3QIJ A;  1KZ7 A;  4PQ0 A;  3PP2 A;  2LUL A;  1B55 A;  1DRO A;  3V5W A;  1U5E A;  2R82 A;  5CLQ B;  5JLJ B;  3HW2 B;  4CHJ A;  3G9W A;  4JKC A;  1W1D A;  2RUK B;  4L6E A;  2QKM A;  2MFQ A;  4F7G A;  3ZDT A;  2RSG A;  4DXA B;  1FAO A;  2YS3 A;  1NTY A;  1EGX A;  2IFS A;  1UNP A;  2EC1 A;  2YT0 A;  1Q67 A;  2HRJ A;  2DYQ A;  4A6K A;  1MIX A;  2CB8 A;  3HK0 A;  4HB3 B;  3TVV A;  2NMB A;  3O96 A;  2P0H A;  1WJ1 A;  5JHH A;  3A98 B;  3ML4 A;  3M1I B;  4TKN A;  5J3T A;  1MAI A;  3KRX A;  4GZU A;  3A8P A;  1Y19 B;  4NSW A;  1KI1 B;  2CRF A;  1NVL A;  4JKH A;  1U5G A;  3U8Z A;  1PLS A;  4GMV A;  5LON B;  2HE7 A;  3PEG A;  3N7C A;  5JVL A;  4HAU B;  3EPY A;  2M14 A;  4HDO A;  2P0F A;  4PNK A;  4JK8 A;  5CLL B;  4DX8 A;  5KQ1 A;  2V76 A;  4ZRI A;  2X18 A;  1IRS A;  1SHC A;  3VIA A;  4DX9 0;  1BAK A;  4GMX B;  4YL8 A;  3QWM A;  2YT1 A;  2D9V A;  5DH9 B;  3CIK A;  5IJM A;  3SO6 A;  2CY5 A;  5LOP B;  1HB8 A;  4CYE A;  1UPQ A;  3PVW A;  1X1G A;  2K2J A;  3DXC A;  1ZSQ A;  1U29 A;  2E2X A;  1ZVR A;  5C6R A;  3AJ4 A;  2COA A;  2VKI A;  4HB2 B;  4IAP A;  2AL6 A;  2DN6 A;  3D8E A;  4A6F A;  4HAW B;  1MKE A;  2OTX A;  2RVB B;  5C16 A;  1WJM A;  4HDQ A;  3BIN A;  4KHA A;  5FI0 A;  5HE3 A;  1E5W A;  4Z2N A;  2DHK A;  5L81 A;  4P7I A;  4JKF A;  3LJU X;  1FB8 A;  1W1H A;  2ABD A;  3AU4 A;  1ZM0 A;  2EJ8 A;  2L2I A;  3VOQ A;  2K2U A;  1NI2 A;  4MK0 A;  4EJN A;  2WH5 A;  3U7D A;  2RGN B;  3SYX A;  2FJ9 A;  1BTK A;  1WGQ A;  1BWN A;  3TFM A;  2YF0 A;  1EF1 A;  1P5T A;  4KHO A;  5J3Q A;  3E9L A;  1DBH A;  2LOZ A;  4JKG B;  3CXB B;  3WA0 A;  1OMW A;  2KUP A;  1QC6 A;  2DX1 A;  1WVH A;  2CAY A;  2Z0Q A;  4A5K A;  2LBB A;  2J59 M;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...