1MK7B

Crystal structure of an integrin beta3-talin chimera
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Integrin Beta3
total genus 57
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk7B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk7B02
4GN1A 1WGQA 2ADZA 2JP2A 2N23A 1U2BA 1X05A 4K17A 4HAXB 5KQ4A 2Z0OA 3TFMA 1GG3A 1RRPB 5HE0A 2CB8A 1PLSA 1Z87A 2DLWA 2GS0A 3CIKA 5JHHA 1QC6A 2J0KA 2YRYA 1H4RA 1LW3A 1WI1A 5DHAB 2W2XC 1V89A 1NTVA 2DN6A 1EF1A 2OQBA 3KY9A 1P5TA 1J0WA 2YF0A 1XCGA 1NU2A 1WG7A 2VSZA 4F7HA 1X1GA 1KZ7A 3U8ZA 4GPTB 4PQ0A 2FJLA 2DKPA 2KGXB 4H8SA 2RUKB 3SYXA 1ZSQA 1K5DB 3QBVB 4HHVA 2RSGA 4HB2B 5HE2A 3KRXA 3A8PA 2ELBA 4HAZB 2L2IA 2PZ1A 1SHCA 1OY2A 4DX90 2AL6A 3ZDTA 2D9ZA 2ROVA 2G35A 1ISNA 4NY0A 3D8FA 1FOEA 4WJ7A 4CHJA 5L81A 4WSFA 5D3XA 5C79A 4MY6A 1FHXA 1DDVA 3FLVA 1UNPA 5DH9B 4L6EA 1HBKA 5EFXA 1B55A 2DYQA 2D11A 2BCJA 2HTHB 3HW2B 5D27A 3OANA 1MK7B 1FHWA 5J3YA 2DTCA 1P6SA 1V5UA 3PEGA 2CAYA 2KCJA 5HE1A 2LULA 1H10A 4MK0A 4MT7A 2D9YA 2YS5A 2HRJA 1PMSA 2VRWB 4Z2NA 2COAA 3PSCA 3ODXA 1AQCA 1WGUA 1ACAA 5CLQB 2K00A 3PVLA 3AU4A 4K2OA 2MFQA 1KZGA 1P3RA 3CXBB 2YVCA 5C5BA 2I1KA 1I2HA 4CYEA 3TCAA 1V5MA 2LOXA 1MIZB 2FDQA 5LOPB 1U5GA 2LYDA 2EJ8A 1UPQA 4KAXB 4GZUA 1UEFA 4P7IA 2N0YA 3P6AA 1UPRA 2IYBA 1NI2A 4K81A 2R0DA 3FSSA 3TW1A 3RCPA 4EKUA 4PNKA 3WYFB 4HAYB 3AJ4A 1K5GB 2DX1A 2W2WA 2YT1A 4WVFB 1V5PA 5D3WA 4A6FB 5FI1A 1I7AA 2P0FA 1SGHA 2ELAA 1E5WA 3QIJA 5KQ1A 2CY4A 2Y8GA 2EC1A 1X86A 3KSYA 2RVBB 1QQGA 2J0JA 2DHJA 2ROZB 1BTNA 3FP5A 2K2UA 1EGXA 4HAWB 3HQCA 2DHKA 3MPXA 4HB4B 1EVHA 1FB8A 2P0DA 2W2XD 3IVFA 1MK9B 4KHBB 1NVLA 2M14A 2CQUA 2I5FA 2MKRA 3KRWA 4EJNA 1U5DA 2CODA 5DHFB 3D8DA 4DXAB 3BINA 2ZPYA 2H7EA 4YONA 5D3YA 2MWNB 4ZRKA 2YS3A 2YT0A 3P7ZA 1DBHA 2V76A 3WA0A 2R09A 2D2QA 4HAUB 4A6KA 1U27A 4GMVA 4KHOA 5JP4A 2Q13A 2FJ9A 1V61A 2UVMA 2UZRA 3SUZA 5HE3A 4IFSA 5J3QA 3DXEA 1HB6A 3HK0A 3G9WA 2OTXA 2COCA 1ZVRA 5JLJB 1W1GA 2CRFA 3M1IB 1N3HA 1RJ2A 1ZC4B 1FHOA 1U29A 4A6HA 4F7UP 3AU5A 2RLOA 1U5FA 2M38A 5J3TA 3PVWA 3O96A 3LJUX 3F0WA 2K2JA 2KUPA 4A5KA 5FI0A 1UNQA 4EMOA 3PG7A 1ZC3B 4D0NB 1MPHA 4GMXB 1OMWA 4HB3B 2DA0A 2RNRB 3FEHA 4HDOA 2LBBA 3ZVRA 4F7GA 2P0HA 3PP2A 4XWXA 3NSUA 1BWNA 3EPYA 4B6HA 2P8VA 1FAOA 2I5CA 4HB0B 2ABDA 5D3VA 2GCLA 1PFJA 2YS1A 3F5RA 1Y5OA 3DXDA 2NMBA 1GC7A 1Y19B 4IAPA 4DBBA 1U5EA 1XD4A 1DYNA 2VKIA 1TXDA 4HAVB 4TKNA 4ZRJA 5IJMA 4TYZA 3A8QA 2NZ8B 2Z0QA 2AEHA 3SNHA 1ST7A 2WH5A 2YSZA 2DYNA 2DX5A 3GYPA 5KCVA 1XKEA 2MDXA 1X1FA 2D9VA 1TJ6A 2Y7BA 1IRSA 2UZSA 3TO1A 3GYOA 1GC6A 4ZRIA 1Q67A 2I1JA 4NSWA 2LOZA 3ODOA 1FGZA 2EMSA 1XX0A 1MIXA 2L1CA 5C5BB 2D9WA 3ODWA 3SO6A 3MDBC 1ZM0A 2X18A 3A98B 2EMTA 3VOQA 2D9XA 2J0MA 1BTKA 1DDMA 2J59M 2H7DA 2DKQA 1XR0B 1DROA 2GCJA 1WJ1A 3ULCA 1V88A 4HDQA 4CHMA 1NTYA 3PVUA 5DIFB 2COPA 1NTIA 2E2XA 3N7CA 2Z0PA 2CY5A 5C6RA 4KVGB 1W1DA 3BJIA 2DFKA 4YL8A 1M7RA 1OQNA 1HB8A 1J19A 4HATB 1EAZA 1UNRA 2Y8FA 2RQ1A 1WJMA 5CLLB 3ULBA 3ML4A 3DXCA 4KHAA 2GJYA 2LKOA 4K2PA 4Y94A 5DI9B 1AWEA 2HE7A 2QKMA 1W1HA 5C16A 1X11A 3VIAA 2DHIA 3UZTA 1FGYA 2IFSA 4GXBA 4A6FA 4BBKA 1TQZA 1MAIA 3TVVA 1MKEA 3PZDA 2D4QA 2QKLA 4Z2MB 3U7DA 1WVHA 5LONB 2D10A 4IOYX 3KZ1A 1BAKA 3V5WA 3QWMA 1M7EA 2RGNB 5JHGA 1LB1A 1KI1B 2XQNM 1XODA 3X23A 3FM8C 4DX8A 2LG1A 3D8EA 4C0AA 3SV1A 1DDWA 2COFA 5GOWB 3T06A
chains in the Genus database with same CATH superfamily
4GN1A 1WGQA 2ADZA 2JP2A 2N23A 1U2BA 1X05A 2Z14A 4K17A 4HAXB 5KQ4A 2R2YA 2Z0OA 1GGOA 5IRSA 3TFMA 1GG3A 2KR0A 1RRPB 5HE0A 2CB8A 1PLSA 1Z87A 2DLWA 2GS0A 3CIKA 5LG4B 5JHHA 1QC6A 2J0KA 2YRYA 1H4RA 1LW3A 1WI1A 5DHAB 2W2XC 1V89A 1NTVA 2DN6A 1EF1A 2OQBA 3KY9A 4OSNA 1P5TA 5JVLA 1J0WA 2YF0A 1XCGA 1NU2A 1WG7A 2VSZA 3U12A 4F7HA 1X1GA 1KZ7A 3U8ZA 4GPTB 4PQ0A 2FJLA 2DKPA 2KGXB 4H8SA 2RUKB 3SYXA 1ZSQA 1K5DB 3QBVB 4HHVA 2RSGA 4HB2B 5HE2A 3KRXA 3A8PA 2ELBA 4HAZB 2NBVA 2L2IA 2PZ1A 2FJUB 1SHCA 4D6WA 1OY2A 4DX90 2AL6A 3ZDTA 2D9ZA 3NWFA 2ROVA 2G35A 1ISNA 4NY0A 3D8FA 1FOEA 4WJ7A 4CHJA 4QXAB 5L81A 4WSFA 5D3XA 5C79A 4MY6A 1FHXA 4GNKB 4JKFA 1DDVA 3FLVA 1UNPA 5DH9B 4L6EA 1HBKA 5EFXA 1B55A 3E9OA 2DYQA 2D11A 2BCJA 2HTHB 3HW2B 5D27A 3OANA 1MK7B 1FHWA 5J3YA 2KIGA 2DTCA 1P6SA 1V5UA 3PEGA 2CAYA 2KCJA 5HE1A 2Z4DA 2LULA 1H10A 4MK0A 4MT7A 2D9YA 2YS5A 2HRJA 2Z59A 1PMSA 2VRWB 4Z2NA 2COAA 3PSCA 3ODXA 4JK8A 1AQCA 1WGUA 1ACAA 5CLQB 2K00A 3PVLA 3AU4A 4K2OA 2MFQA 5I2MA 4ILJA 1KZGA 1P3RA 3CXBB 2YVCA 5C5BA 2ZKMX 2I1KA 1I2HA 4CYEA 3TCAA 1V5MA 2LOXA 1MIZB 2FDQA 1JDEA 1DIKA 5LOPB 1U5GA 2LYDA 2EJ8A 1T77A 1UPQA 2KIEA 4KAXB 4GZUA 1UEFA 4P7IA 4QJ4B 2N0YA 3P6AA 1UPRA 2IYBA 1NI2A 4K81A 2R0DA 3FSSA 3TW1A 3RCPA 4EKUA 4PNKA 3WYFB 3NWDA 4HAYB 3AJ4A 1K5GB 3ENBA 2DX1A 2W2WA 2YT1A 4WVFB 1V5PA 4JKGA 5D3WA 4A6FB 4JKEA 5FI1A 1I7AA 2P0FA 1SGHA 2ELAA 1E5WA 3QIJA 5KQ1A 2CY4A 2Y8GA 2EC1A 1X86A 3KSYA 2RVBB 1QQGA 2J0JA 2DHJA 2ROZB 4CSQA 1BTNA 3FP5A 2K2UA 3FVCA 1EGXA 4HAWB 3A58A 3HQCA 2DHKA 3MPXA 4HB4B 1EVHA 1KC7A 1FB8A 2P0DA 2W2XD 4ILHA 3IVFA 1MK9B 4KHBB 1NVLA 2M14A 2CQUA 2I5FA 2MKRA 2GUMA 3KRWA 4EJNA 1U5DA 2CODA 1ZYIA 5DHFB 3D8DA 3E9PA 4DXAB 3BINA 2ZPYA 2H7EA 4YONA 5D3YA 4DIXA 2MWNB 4ZRKA 2YS3A 2YT0A 3SBTA 3P7ZA 1DBHA 2V76A 3WA0A 2R09A 2D2QA 4HAUB 4A6KA 1U27A 4GMVA 4KHOA 5JP4A 2Q13A 2FJ9A 1V61A 2UVMA 2UZRA 3SUZA 5HE3A 4IFSA 5J3QA 3DXEA 1HB6A 4HSIA 3HK0A 3G9WA 2OTXA 2COCA 5I2SA 1ZVRA 4OT1A 1VBGA 5JLJB 1W1GA 4JKDA 2CRFA 3M1IB 1N3HA 1RJ2A 1ZC4B 2K8EA 1FHOA 1U29A 4A6HA 4F7UP 3AU5A 2RLOA 1U5FA 2M38A 5J3TA 3PVWA 3O96A 3LJUX 3F0WA 2K2JA 2KUPA 4A5KA 5FI0A 1UNQA 4EMOA 4JKAA 3PG7A 1ZC3B 4D0NB 2RRFA 1MPHA 4GMXB 1OMWA 4HB3B 2DA0A 2RNRB 3FEHA 4HDOA 3HIEA 1VBHA 2LBBA 4KHBA 3ZVRA 4F7GA 2P0HA 3PP2A 4XWXA 3NSUA 1BWNA 3EPYA 4B6HA 4QJ5B 2P8VA 1FAOA 2I5CA 4HB0B 2ABDA 5D3VA 2GCLA 1PFJA 2YS1A 3F5RA 4JK7A 1Y5OA 2NMBA 1GC7A 1Y19B 3DXDA 4IAPA 4DBBA 1U5EA 1XD4A 1DYNA 2X0SA 2VKIA 3DCXA 1TXDA 4HAVB 4TKNA 4ZRJA 5IJMA 4TYZA 3A8QA 2NZ8B 2Z0QA 2AEHA 3SNHA 1ST7A 2WH5A 2YSZA 5M4YB 1MI1A 2Z13A 2DYNA 2DX5A 3GYPA 5KCVA 1XKEA 2MDXA 1X1FA 2D9VA 1TJ6A 2Y7BA 1IRSA 2R82A 2UZSA 3TO1A 3GYOA 1GC6A 4ZRIA 1Q67A 2I1JA 4NSWA 3NWAA 2LOZA 3ODOA 1FGZA 3OHMB 2EMSA 1XX0A 1MIXA 2L1CA 3NW8A 5C5BB 2D9WA 3ODWA 3SO6A 3MDBC 1ZM0A 2X18A 3A98B 2EMTA 3VOQA 2D9XA 2J0MA 1BTKA 1DDMA 2J59M 2H7DA 2DKQA 1XR0B 1DROA 2GCJA 1WJ1A 3ULCA 2KUQA 1V88A 4HDQA 4CHMA 1NTYA 3PVUA 4L1RA 4JKBA 5DIFB 3B77A 2COPA 1NTIA 2E2XA 4GOUA 3N7CA 2K49A 2Z0PA 2CY5A 5C6RA 4KVGB 1W1DA 3BJIA 2DFKA 4YL8A 1M7RA 1OQNA 4QJ3B 1HB8A 1J19A 4HATB 1EAZA 1UNRA 2Y8FA 2RQ1A 1WJMA 5CLLB 3ULBA 3ML4A 3DXCA 4KHAA 2GJYA 2LKOA 4K2PA 4Y94A 4JKCA 5DI9B 1AWEA 2HE7A 2QKMA 1W1HA 5C16A 1X11A 3VIAA 2DHIA 3UZTA 1FGYA 4GXBA 2IFSA 4JKGB 4A6FA 4JK9A 4BBKA 1TQZA 3E66A 1MAIA 3TVVA 1KBLA 2DIKA 1MKEA 3PZDA 2D4QA 2QKLA 4Z2MB 2YT2A 3U7DA 1WVHA 5LONB 2D10A 4IOYX 3KZ1A 1BAKA 3V5WA 3QWMA 1M7EA 4ILGB 2RGNB 5JHGA 1LB1A 3SBGA 1KI1B 2XQNM 1XODA 3X23A 3FM8C 4DX8A 4JKHA 2LG1A 3D8EA 4C0AA 3SV1A 1DDWA 3E9LA 2COFA 5GOWB 3HSAA 3T06A
chains in the Genus database with same CATH topology
4GN1A 1WGQA 2ADZA 2JP2A 2N23A 1U2BA 1X05A 4K17A 4HAXB 5KQ4A 2Z0OA 1GGOA 3TFMA 1GG3A 1RRPB 5HE0A 2CB8A 1PLSA 1Z87A 2DLWA 2GS0A 3CIKA 5JHHA 1QC6A 2J0KA 2YRYA 1H4RA 1LW3A 1WI1A 5DHAB 2W2XC 1V89A 1NTVA 2DN6A 1EF1A 2OQBA 3KY9A 1P5TA 5JVLA 1J0WA 2YF0A 1XCGA 1NU2A 1WG7A 2VSZA 4F7HA 1X1GA 1KZ7A 3U8ZA 4GPTB 4PQ0A 2FJLA 2DKPA 2KGXB 4H8SA 2RUKB 3SYXA 1ZSQA 1K5DB 3QBVB 4HHVA 2RSGA 4HB2B 5HE2A 3KRXA 3A8PA 2ELBA 4HAZB 2L2IA 2PZ1A 1SHCA 1OY2A 4DX90 2AL6A 3ZDTA 2D9ZA 2ROVA 2G35A 1ISNA 4NY0A 3D8FA 1FOEA 4WJ7A 4CHJA 5L81A 4WSFA 5D3XA 5C79A 4MY6A 1FHXA 4JKFA 1DDVA 3FLVA 1UNPA 5DH9B 4L6EA 1HBKA 5EFXA 1B55A 3E9OA 2DYQA 2D11A 2BCJA 2HTHB 3HW2B 5D27A 3OANA 1MK7B 1FHWA 5J3YA 2DTCA 1P6SA 1V5UA 3PEGA 2CAYA 2KCJA 5HE1A 2LULA 1H10A 4MK0A 4MT7A 2D9YA 2YS5A 2HRJA 1PMSA 2VRWB 4Z2NA 2COAA 3PSCA 3ODXA 4JK8A 1AQCA 1WGUA 1ACAA 5CLQB 2K00A 3PVLA 3AU4A 4K2OA 2MFQA 4ILJA 1KZGA 1P3RA 3CXBB 2YVCA 5C5BA 2I1KA 1I2HA 4CYEA 3TCAA 1V5MA 2LOXA 1MIZB 2FDQA 1JDEA 1DIKA 5LOPB 1U5GA 2LYDA 2EJ8A 1UPQA 4KAXB 4GZUA 1UEFA 4P7IA 2N0YA 3P6AA 1UPRA 2IYBA 1NI2A 4K81A 2R0DA 3FSSA 3TW1A 3RCPA 4EKUA 4PNKA 3WYFB 4HAYB 3AJ4A 1K5GB 3ENBA 2DX1A 2W2WA 2YT1A 4WVFB 1V5PA 4JKGA 5D3WA 4A6FB 4JKEA 5FI1A 1I7AA 2P0FA 1SGHA 2ELAA 1E5WA 3QIJA 5KQ1A 2CY4A 2Y8GA 2EC1A 1X86A 3KSYA 2RVBB 1QQGA 2J0JA 2DHJA 2ROZB 1BTNA 3FP5A 2K2UA 1EGXA 4HAWB 3HQCA 2DHKA 3MPXA 4HB4B 1EVHA 1KC7A 1FB8A 2P0DA 2W2XD 4ILHA 3IVFA 1MK9B 4KHBB 1NVLA 2M14A 2CQUA 2I5FA 2MKRA 3KRWA 4EJNA 1U5DA 2CODA 5DHFB 3D8DA 3E9PA 4DXAB 3BINA 2ZPYA 2H7EA 4YONA 5D3YA 2MWNB 4ZRKA 2YS3A 2YT0A 3SBTA 3P7ZA 1DBHA 2V76A 3WA0A 2R09A 2D2QA 4HAUB 4A6KA 1U27A 4GMVA 4KHOA 5JP4A 2Q13A 2FJ9A 1V61A 2UVMA 2UZRA 3SUZA 5HE3A 4IFSA 5J3QA 3DXEA 1HB6A 3HK0A 3G9WA 2OTXA 2COCA 1ZVRA 1VBGA 5JLJB 1W1GA 4JKDA 2CRFA 3M1IB 1N3HA 1RJ2A 1ZC4B 1FHOA 1U29A 4A6HA 4F7UP 3AU5A 2RLOA 1U5FA 2M38A 5J3TA 3PVWA 3O96A 3LJUX 3F0WA 2K2JA 2KUPA 4A5KA 5FI0A 1UNQA 4EMOA 4JKAA 3PG7A 1ZC3B 4D0NB 1MPHA 4GMXB 1OMWA 4HB3B 2DA0A 2RNRB 3FEHA 4HDOA 1VBHA 2LBBA 3ZVRA 4F7GA 2P0HA 3PP2A 4XWXA 3NSUA 1BWNA 3EPYA 4B6HA 2P8VA 1FAOA 2I5CA 4HB0B 2ABDA 5D3VA 2GCLA 1PFJA 2YS1A 3F5RA 4JK7A 1Y5OA 2NMBA 1GC7A 1Y19B 3DXDA 4IAPA 4DBBA 1U5EA 1XD4A 1DYNA 2X0SA 2VKIA 1TXDA 4HAVB 4TKNA 4ZRJA 5IJMA 4TYZA 3A8QA 2NZ8B 2Z0QA 2AEHA 3SNHA 1ST7A 2WH5A 2YSZA 2DYNA 2DX5A 3GYPA 5KCVA 1XKEA 2MDXA 1X1FA 2D9VA 1TJ6A 2Y7BA 1IRSA 2R82A 2UZSA 3TO1A 3GYOA 1GC6A 4ZRIA 1Q67A 2I1JA 4NSWA 2LOZA 3ODOA 1FGZA 2EMSA 1XX0A 1MIXA 2L1CA 5C5BB 2D9WA 3ODWA 3SO6A 3MDBC 1ZM0A 2X18A 3A98B 2EMTA 3VOQA 2D9XA 2J0MA 1BTKA 1DDMA 2J59M 2H7DA 2DKQA 1XR0B 1DROA 2GCJA 1WJ1A 3ULCA 1V88A 4HDQA 4CHMA 1NTYA 3PVUA 4JKBA 5DIFB 2COPA 1NTIA 2E2XA 3N7CA 2Z0PA 2CY5A 5C6RA 4KVGB 1W1DA 3BJIA 2DFKA 4YL8A 1M7RA 1OQNA 1HB8A 1J19A 4HATB 1EAZA 1UNRA 2Y8FA 2RQ1A 1WJMA 5CLLB 3ULBA 3ML4A 3DXCA 4KHAA 2GJYA 2LKOA 4K2PA 4Y94A 4JKCA 5DI9B 1AWEA 2HE7A 2QKMA 1W1HA 5C16A 1X11A 3VIAA 2DHIA 3UZTA 1FGYA 4GXBA 2IFSA 4JKGB 4A6FA 4JK9A 4BBKA 1TQZA 3E66A 1MAIA 3TVVA 1KBLA 2DIKA 1MKEA 3PZDA 2D4QA 2QKLA 4Z2MB 3U7DA 1WVHA 5LONB 2D10A 4IOYX 3KZ1A 1BAKA 3V5WA 3QWMA 1M7EA 4ILGB 2RGNB 5JHGA 1LB1A 3SBGA 1KI1B 2XQNM 1XODA 3X23A 3FM8C 4DX8A 4JKHA 2LG1A 3D8EA 4C0AA 3SV1A 1DDWA 3E9LA 2COFA 5GOWB 3T06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN1 A;  1WGQ A;  2ADZ A;  2JP2 A;  2N23 A;  1U2B A;  1X05 A;  4K17 A;  4HAX B;  5KQ4 A;  2Z0O A;  3TFM A;  1GG3 A;  1RRP B;  5HE0 A;  2CB8 A;  1PLS A;  1Z87 A;  2DLW A;  2GS0 A;  3CIK A;  5JHH A;  1QC6 A;  2J0K A;  2YRY A;  1H4R A;  1LW3 A;  1WI1 A;  5DHA B;  2W2X C;  1V89 A;  1NTV A;  2DN6 A;  1EF1 A;  2OQB A;  3KY9 A;  1P5T A;  1J0W A;  2YF0 A;  1XCG A;  1NU2 A;  1WG7 A;  2VSZ A;  4F7H A;  1X1G A;  1KZ7 A;  3U8Z A;  4GPT B;  4PQ0 A;  2FJL A;  2DKP A;  2KGX B;  4H8S A;  2RUK B;  3SYX A;  1ZSQ A;  1K5D B;  3QBV B;  4HHV A;  2RSG A;  4HB2 B;  5HE2 A;  3KRX A;  3A8P A;  2ELB A;  4HAZ B;  2L2I A;  2PZ1 A;  1SHC A;  1OY2 A;  4DX9 0;  2AL6 A;  3ZDT A;  2D9Z A;  2ROV A;  2G35 A;  1ISN A;  4NY0 A;  3D8F A;  1FOE A;  4WJ7 A;  4CHJ A;  5L81 A;  4WSF A;  5D3X A;  5C79 A;  4MY6 A;  1FHX A;  1DDV A;  3FLV A;  1UNP A;  5DH9 B;  4L6E A;  1HBK A;  5EFX A;  1B55 A;  2DYQ A;  2D11 A;  2BCJ A;  2HTH B;  3HW2 B;  5D27 A;  3OAN A;  1MK7 B;  1FHW A;  5J3Y A;  2DTC A;  1P6S A;  1V5U A;  3PEG A;  2CAY A;  2KCJ A;  5HE1 A;  2LUL A;  1H10 A;  4MK0 A;  4MT7 A;  2D9Y A;  2YS5 A;  2HRJ A;  1PMS A;  2VRW B;  4Z2N A;  2COA A;  3PSC A;  3ODX A;  1AQC A;  1WGU A;  1ACA A;  5CLQ B;  2K00 A;  3PVL A;  3AU4 A;  4K2O A;  2MFQ A;  1KZG A;  1P3R A;  3CXB B;  2YVC A;  5C5B A;  2I1K A;  1I2H A;  4CYE A;  3TCA A;  1V5M A;  2LOX A;  1MIZ B;  2FDQ A;  5LOP B;  1U5G A;  2LYD A;  2EJ8 A;  1UPQ A;  4KAX B;  4GZU A;  1UEF A;  4P7I A;  2N0Y A;  3P6A A;  1UPR A;  2IYB A;  1NI2 A;  4K81 A;  2R0D A;  3FSS A;  3TW1 A;  3RCP A;  4EKU A;  4PNK A;  3WYF B;  4HAY B;  3AJ4 A;  1K5G B;  2DX1 A;  2W2W A;  2YT1 A;  4WVF B;  1V5P A;  5D3W A;  4A6F B;  5FI1 A;  1I7A A;  2P0F A;  1SGH A;  2ELA A;  1E5W A;  3QIJ A;  5KQ1 A;  2CY4 A;  2Y8G A;  2EC1 A;  1X86 A;  3KSY A;  2RVB B;  1QQG A;  2J0J A;  2DHJ A;  2ROZ B;  1BTN A;  3FP5 A;  2K2U A;  1EGX A;  4HAW B;  3HQC A;  2DHK A;  3MPX A;  4HB4 B;  1EVH A;  1FB8 A;  2P0D A;  2W2X D;  3IVF A;  1MK9 B;  4KHB B;  1NVL A;  2M14 A;  2CQU A;  2I5F A;  2MKR A;  3KRW A;  4EJN A;  1U5D A;  2COD A;  5DHF B;  3D8D A;  4DXA B;  3BIN A;  2ZPY A;  2H7E A;  4YON A;  5D3Y A;  2MWN B;  4ZRK A;  2YS3 A;  2YT0 A;  3P7Z A;  1DBH A;  2V76 A;  3WA0 A;  2R09 A;  2D2Q A;  4HAU B;  4A6K A;  1U27 A;  4GMV A;  4KHO A;  5JP4 A;  2Q13 A;  2FJ9 A;  1V61 A;  2UVM A;  2UZR A;  3SUZ A;  5HE3 A;  4IFS A;  5J3Q A;  3DXE A;  1HB6 A;  3HK0 A;  3G9W A;  2OTX A;  2COC A;  1ZVR A;  5JLJ B;  1W1G A;  2CRF A;  3M1I B;  1N3H A;  1RJ2 A;  1ZC4 B;  1FHO A;  1U29 A;  4A6H A;  4F7U P;  3AU5 A;  2RLO A;  1U5F A;  2M38 A;  5J3T A;  3PVW A;  3O96 A;  3LJU X;  3F0W A;  2K2J A;  2KUP A;  4A5K A;  5FI0 A;  1UNQ A;  4EMO A;  3PG7 A;  1ZC3 B;  4D0N B;  1MPH A;  4GMX B;  1OMW A;  4HB3 B;  2DA0 A;  2RNR B;  3FEH A;  4HDO A;  2LBB A;  3ZVR A;  4F7G A;  2P0H A;  3PP2 A;  4XWX A;  3NSU A;  1BWN A;  3EPY A;  4B6H A;  2P8V A;  1FAO A;  2I5C A;  4HB0 B;  2ABD A;  5D3V A;  2GCL A;  1PFJ A;  2YS1 A;  3F5R A;  1Y5O A;  3DXD A;  2NMB A;  1GC7 A;  1Y19 B;  4IAP A;  4DBB A;  1U5E A;  1XD4 A;  1DYN A;  2VKI A;  1TXD A;  4HAV B;  4TKN A;  4ZRJ A;  5IJM A;  4TYZ A;  3A8Q A;  2NZ8 B;  2Z0Q A;  2AEH A;  3SNH A;  1ST7 A;  2WH5 A;  2YSZ A;  2DYN A;  2DX5 A;  3GYP A;  5KCV A;  1XKE A;  2MDX A;  1X1F A;  2D9V A;  1TJ6 A;  2Y7B A;  1IRS A;  2UZS A;  3TO1 A;  3GYO A;  1GC6 A;  4ZRI A;  1Q67 A;  2I1J A;  4NSW A;  2LOZ A;  3ODO A;  1FGZ A;  2EMS A;  1XX0 A;  1MIX A;  2L1C A;  5C5B B;  2D9W A;  3ODW A;  3SO6 A;  3MDB C;  1ZM0 A;  2X18 A;  3A98 B;  2EMT A;  3VOQ A;  2D9X A;  2J0M A;  1BTK A;  1DDM A;  2J59 M;  2H7D A;  2DKQ A;  1XR0 B;  1DRO A;  2GCJ A;  1WJ1 A;  3ULC A;  1V88 A;  4HDQ A;  4CHM A;  1NTY A;  3PVU A;  5DIF B;  2COP A;  1NTI A;  2E2X A;  3N7C A;  2Z0P A;  2CY5 A;  5C6R A;  4KVG B;  1W1D A;  3BJI A;  2DFK A;  4YL8 A;  1M7R A;  1OQN A;  1HB8 A;  1J19 A;  4HAT B;  1EAZ A;  1UNR A;  2Y8F A;  2RQ1 A;  1WJM A;  5CLL B;  3ULB A;  3ML4 A;  3DXC A;  4KHA A;  2GJY A;  2LKO A;  4K2P A;  4Y94 A;  5DI9 B;  1AWE A;  2HE7 A;  2QKM A;  1W1H A;  5C16 A;  1X11 A;  3VIA A;  2DHI A;  3UZT A;  1FGY A;  2IFS A;  4GXB A;  4A6F A;  4BBK A;  1TQZ A;  1MAI A;  3TVV A;  1MKE A;  3PZD A;  2D4Q A;  2QKL A;  4Z2M B;  3U7D A;  1WVH A;  5LON B;  2D10 A;  4IOY X;  3KZ1 A;  1BAK A;  3V5W A;  3QWM A;  1M7E A;  2RGN B;  5JHG A;  1LB1 A;  1KI1 B;  2XQN M;  1XOD A;  3X23 A;  3FM8 C;  4DX8 A;  2LG1 A;  3D8E A;  4C0A A;  3SV1 A;  1DDW A;  2COF A;  5GOW B;  3T06 A; 
#chains in the Genus database with same CATH topology
 4GN1 A;  1WGQ A;  2ADZ A;  2JP2 A;  2N23 A;  1U2B A;  1X05 A;  2Z14 A;  4K17 A;  4HAX B;  5KQ4 A;  2R2Y A;  2Z0O A;  1GGO A;  5IRS A;  3TFM A;  1GG3 A;  2KR0 A;  1RRP B;  5HE0 A;  2CB8 A;  1PLS A;  1Z87 A;  2DLW A;  2GS0 A;  3CIK A;  5LG4 B;  5JHH A;  1QC6 A;  2J0K A;  2YRY A;  1H4R A;  1LW3 A;  1WI1 A;  5DHA B;  2W2X C;  1V89 A;  1NTV A;  2DN6 A;  1EF1 A;  2OQB A;  3KY9 A;  4OSN A;  1P5T A;  5JVL A;  1J0W A;  2YF0 A;  1XCG A;  1NU2 A;  1WG7 A;  2VSZ A;  3U12 A;  4F7H A;  1X1G A;  1KZ7 A;  3U8Z A;  4GPT B;  4PQ0 A;  2FJL A;  2DKP A;  2KGX B;  4H8S A;  2RUK B;  3SYX A;  1ZSQ A;  1K5D B;  3QBV B;  4HHV A;  2RSG A;  4HB2 B;  5HE2 A;  3KRX A;  3A8P A;  2ELB A;  4HAZ B;  2NBV A;  2L2I A;  2PZ1 A;  2FJU B;  1SHC A;  4D6W A;  1OY2 A;  4DX9 0;  2AL6 A;  3ZDT A;  2D9Z A;  3NWF A;  2ROV A;  2G35 A;  1ISN A;  4NY0 A;  3D8F A;  1FOE A;  4WJ7 A;  4CHJ A;  4QXA B;  5L81 A;  4WSF A;  5D3X A;  5C79 A;  4MY6 A;  1FHX A;  4GNK B;  4JKF A;  1DDV A;  3FLV A;  1UNP A;  5DH9 B;  4L6E A;  1HBK A;  5EFX A;  1B55 A;  3E9O A;  2DYQ A;  2D11 A;  2BCJ A;  2HTH B;  3HW2 B;  5D27 A;  3OAN A;  1MK7 B;  1FHW A;  5J3Y A;  2KIG A;  2DTC A;  1P6S A;  1V5U A;  3PEG A;  2CAY A;  2KCJ A;  5HE1 A;  2Z4D A;  2LUL A;  1H10 A;  4MK0 A;  4MT7 A;  2D9Y A;  2YS5 A;  2HRJ A;  2Z59 A;  1PMS A;  2VRW B;  4Z2N A;  2COA A;  3PSC A;  3ODX A;  4JK8 A;  1AQC A;  1WGU A;  1ACA A;  5CLQ B;  2K00 A;  3PVL A;  3AU4 A;  4K2O A;  2MFQ A;  5I2M A;  4ILJ A;  1KZG A;  1P3R A;  3CXB B;  2YVC A;  5C5B A;  2ZKM X;  2I1K A;  1I2H A;  4CYE A;  3TCA A;  1V5M A;  2LOX A;  1MIZ B;  2FDQ A;  1JDE A;  1DIK A;  5LOP B;  1U5G A;  2LYD A;  2EJ8 A;  1T77 A;  1UPQ A;  2KIE A;  4KAX B;  4GZU A;  1UEF A;  4P7I A;  4QJ4 B;  2N0Y A;  3P6A A;  1UPR A;  2IYB A;  1NI2 A;  4K81 A;  2R0D A;  3FSS A;  3TW1 A;  3RCP A;  4EKU A;  4PNK A;  3WYF B;  3NWD A;  4HAY B;  3AJ4 A;  1K5G B;  3ENB A;  2DX1 A;  2W2W A;  2YT1 A;  4WVF B;  1V5P A;  4JKG A;  5D3W A;  4A6F B;  4JKE A;  5FI1 A;  1I7A A;  2P0F A;  1SGH A;  2ELA A;  1E5W A;  3QIJ A;  5KQ1 A;  2CY4 A;  2Y8G A;  2EC1 A;  1X86 A;  3KSY A;  2RVB B;  1QQG A;  2J0J A;  2DHJ A;  2ROZ B;  4CSQ A;  1BTN A;  3FP5 A;  2K2U A;  3FVC A;  1EGX A;  4HAW B;  3A58 A;  3HQC A;  2DHK A;  3MPX A;  4HB4 B;  1EVH A;  1KC7 A;  1FB8 A;  2P0D A;  2W2X D;  4ILH A;  3IVF A;  1MK9 B;  4KHB B;  1NVL A;  2M14 A;  2CQU A;  2I5F A;  2MKR A;  2GUM A;  3KRW A;  4EJN A;  1U5D A;  2COD A;  1ZYI A;  5DHF B;  3D8D A;  3E9P A;  4DXA B;  3BIN A;  2ZPY A;  2H7E A;  4YON A;  5D3Y A;  4DIX A;  2MWN B;  4ZRK A;  2YS3 A;  2YT0 A;  3SBT A;  3P7Z A;  1DBH A;  2V76 A;  3WA0 A;  2R09 A;  2D2Q A;  4HAU B;  4A6K A;  1U27 A;  4GMV A;  4KHO A;  5JP4 A;  2Q13 A;  2FJ9 A;  1V61 A;  2UVM A;  2UZR A;  3SUZ A;  5HE3 A;  4IFS A;  5J3Q A;  3DXE A;  1HB6 A;  4HSI A;  3HK0 A;  3G9W A;  2OTX A;  2COC A;  5I2S A;  1ZVR A;  4OT1 A;  1VBG A;  5JLJ B;  1W1G A;  4JKD A;  2CRF A;  3M1I B;  1N3H A;  1RJ2 A;  1ZC4 B;  2K8E A;  1FHO A;  1U29 A;  4A6H A;  4F7U P;  3AU5 A;  2RLO A;  1U5F A;  2M38 A;  5J3T A;  3PVW A;  3O96 A;  3LJU X;  3F0W A;  2K2J A;  2KUP A;  4A5K A;  5FI0 A;  1UNQ A;  4EMO A;  4JKA A;  3PG7 A;  1ZC3 B;  4D0N B;  2RRF A;  1MPH A;  4GMX B;  1OMW A;  4HB3 B;  2DA0 A;  2RNR B;  3FEH A;  4HDO A;  3HIE A;  1VBH A;  2LBB A;  4KHB A;  3ZVR A;  4F7G A;  2P0H A;  3PP2 A;  4XWX A;  3NSU A;  1BWN A;  3EPY A;  4B6H A;  4QJ5 B;  2P8V A;  1FAO A;  2I5C A;  4HB0 B;  2ABD A;  5D3V A;  2GCL A;  1PFJ A;  2YS1 A;  3F5R A;  4JK7 A;  1Y5O A;  2NMB A;  1GC7 A;  1Y19 B;  3DXD A;  4IAP A;  4DBB A;  1U5E A;  1XD4 A;  1DYN A;  2X0S A;  2VKI A;  3DCX A;  1TXD A;  4HAV B;  4TKN A;  4ZRJ A;  5IJM A;  4TYZ A;  3A8Q A;  2NZ8 B;  2Z0Q A;  2AEH A;  3SNH A;  1ST7 A;  2WH5 A;  2YSZ A;  5M4Y B;  1MI1 A;  2Z13 A;  2DYN A;  2DX5 A;  3GYP A;  5KCV A;  1XKE A;  2MDX A;  1X1F A;  2D9V A;  1TJ6 A;  2Y7B A;  1IRS A;  2R82 A;  2UZS A;  3TO1 A;  3GYO A;  1GC6 A;  4ZRI A;  1Q67 A;  2I1J A;  4NSW A;  3NWA A;  2LOZ A;  3ODO A;  1FGZ A;  3OHM B;  2EMS A;  1XX0 A;  1MIX A;  2L1C A;  3NW8 A;  5C5B B;  2D9W A;  3ODW A;  3SO6 A;  3MDB C;  1ZM0 A;  2X18 A;  3A98 B;  2EMT A;  3VOQ A;  2D9X A;  2J0M A;  1BTK A;  1DDM A;  2J59 M;  2H7D A;  2DKQ A;  1XR0 B;  1DRO A;  2GCJ A;  1WJ1 A;  3ULC A;  2KUQ A;  1V88 A;  4HDQ A;  4CHM A;  1NTY A;  3PVU A;  4L1R A;  4JKB A;  5DIF B;  3B77 A;  2COP A;  1NTI A;  2E2X A;  4GOU A;  3N7C A;  2K49 A;  2Z0P A;  2CY5 A;  5C6R A;  4KVG B;  1W1D A;  3BJI A;  2DFK A;  4YL8 A;  1M7R A;  1OQN A;  4QJ3 B;  1HB8 A;  1J19 A;  4HAT B;  1EAZ A;  1UNR A;  2Y8F A;  2RQ1 A;  1WJM A;  5CLL B;  3ULB A;  3ML4 A;  3DXC A;  4KHA A;  2GJY A;  2LKO A;  4K2P A;  4Y94 A;  4JKC A;  5DI9 B;  1AWE A;  2HE7 A;  2QKM A;  1W1H A;  5C16 A;  1X11 A;  3VIA A;  2DHI A;  3UZT A;  1FGY A;  4GXB A;  2IFS A;  4JKG B;  4A6F A;  4JK9 A;  4BBK A;  1TQZ A;  3E66 A;  1MAI A;  3TVV A;  1KBL A;  2DIK A;  1MKE A;  3PZD A;  2D4Q A;  2QKL A;  4Z2M B;  2YT2 A;  3U7D A;  1WVH A;  5LON B;  2D10 A;  4IOY X;  3KZ1 A;  1BAK A;  3V5W A;  3QWM A;  1M7E A;  4ILG B;  2RGN B;  5JHG A;  1LB1 A;  3SBG A;  1KI1 B;  2XQN M;  1XOD A;  3X23 A;  3FM8 C;  4DX8 A;  4JKH A;  2LG1 A;  3D8E A;  4C0A A;  3SV1 A;  1DDW A;  3E9L A;  2COF A;  5GOW B;  3HSA A;  3T06 A; 
#chains in the Genus database with same CATH homology
 4GN1 A;  1WGQ A;  2ADZ A;  2JP2 A;  2N23 A;  1U2B A;  1X05 A;  4K17 A;  4HAX B;  5KQ4 A;  2Z0O A;  1GGO A;  3TFM A;  1GG3 A;  1RRP B;  5HE0 A;  2CB8 A;  1PLS A;  1Z87 A;  2DLW A;  2GS0 A;  3CIK A;  5JHH A;  1QC6 A;  2J0K A;  2YRY A;  1H4R A;  1LW3 A;  1WI1 A;  5DHA B;  2W2X C;  1V89 A;  1NTV A;  2DN6 A;  1EF1 A;  2OQB A;  3KY9 A;  1P5T A;  5JVL A;  1J0W A;  2YF0 A;  1XCG A;  1NU2 A;  1WG7 A;  2VSZ A;  4F7H A;  1X1G A;  1KZ7 A;  3U8Z A;  4GPT B;  4PQ0 A;  2FJL A;  2DKP A;  2KGX B;  4H8S A;  2RUK B;  3SYX A;  1ZSQ A;  1K5D B;  3QBV B;  4HHV A;  2RSG A;  4HB2 B;  5HE2 A;  3KRX A;  3A8P A;  2ELB A;  4HAZ B;  2L2I A;  2PZ1 A;  1SHC A;  1OY2 A;  4DX9 0;  2AL6 A;  3ZDT A;  2D9Z A;  2ROV A;  2G35 A;  1ISN A;  4NY0 A;  3D8F A;  1FOE A;  4WJ7 A;  4CHJ A;  5L81 A;  4WSF A;  5D3X A;  5C79 A;  4MY6 A;  1FHX A;  4JKF A;  1DDV A;  3FLV A;  1UNP A;  5DH9 B;  4L6E A;  1HBK A;  5EFX A;  1B55 A;  3E9O A;  2DYQ A;  2D11 A;  2BCJ A;  2HTH B;  3HW2 B;  5D27 A;  3OAN A;  1MK7 B;  1FHW A;  5J3Y A;  2DTC A;  1P6S A;  1V5U A;  3PEG A;  2CAY A;  2KCJ A;  5HE1 A;  2LUL A;  1H10 A;  4MK0 A;  4MT7 A;  2D9Y A;  2YS5 A;  2HRJ A;  1PMS A;  2VRW B;  4Z2N A;  2COA A;  3PSC A;  3ODX A;  4JK8 A;  1AQC A;  1WGU A;  1ACA A;  5CLQ B;  2K00 A;  3PVL A;  3AU4 A;  4K2O A;  2MFQ A;  4ILJ A;  1KZG A;  1P3R A;  3CXB B;  2YVC A;  5C5B A;  2I1K A;  1I2H A;  4CYE A;  3TCA A;  1V5M A;  2LOX A;  1MIZ B;  2FDQ A;  1JDE A;  1DIK A;  5LOP B;  1U5G A;  2LYD A;  2EJ8 A;  1UPQ A;  4KAX B;  4GZU A;  1UEF A;  4P7I A;  2N0Y A;  3P6A A;  1UPR A;  2IYB A;  1NI2 A;  4K81 A;  2R0D A;  3FSS A;  3TW1 A;  3RCP A;  4EKU A;  4PNK A;  3WYF B;  4HAY B;  3AJ4 A;  1K5G B;  3ENB A;  2DX1 A;  2W2W A;  2YT1 A;  4WVF B;  1V5P A;  4JKG A;  5D3W A;  4A6F B;  4JKE A;  5FI1 A;  1I7A A;  2P0F A;  1SGH A;  2ELA A;  1E5W A;  3QIJ A;  5KQ1 A;  2CY4 A;  2Y8G A;  2EC1 A;  1X86 A;  3KSY A;  2RVB B;  1QQG A;  2J0J A;  2DHJ A;  2ROZ B;  1BTN A;  3FP5 A;  2K2U A;  1EGX A;  4HAW B;  3HQC A;  2DHK A;  3MPX A;  4HB4 B;  1EVH A;  1KC7 A;  1FB8 A;  2P0D A;  2W2X D;  4ILH A;  3IVF A;  1MK9 B;  4KHB B;  1NVL A;  2M14 A;  2CQU A;  2I5F A;  2MKR A;  3KRW A;  4EJN A;  1U5D A;  2COD A;  5DHF B;  3D8D A;  3E9P A;  4DXA B;  3BIN A;  2ZPY A;  2H7E A;  4YON A;  5D3Y A;  2MWN B;  4ZRK A;  2YS3 A;  2YT0 A;  3SBT A;  3P7Z A;  1DBH A;  2V76 A;  3WA0 A;  2R09 A;  2D2Q A;  4HAU B;  4A6K A;  1U27 A;  4GMV A;  4KHO A;  5JP4 A;  2Q13 A;  2FJ9 A;  1V61 A;  2UVM A;  2UZR A;  3SUZ A;  5HE3 A;  4IFS A;  5J3Q A;  3DXE A;  1HB6 A;  3HK0 A;  3G9W A;  2OTX A;  2COC A;  1ZVR A;  1VBG A;  5JLJ B;  1W1G A;  4JKD A;  2CRF A;  3M1I B;  1N3H A;  1RJ2 A;  1ZC4 B;  1FHO A;  1U29 A;  4A6H A;  4F7U P;  3AU5 A;  2RLO A;  1U5F A;  2M38 A;  5J3T A;  3PVW A;  3O96 A;  3LJU X;  3F0W A;  2K2J A;  2KUP A;  4A5K A;  5FI0 A;  1UNQ A;  4EMO A;  4JKA A;  3PG7 A;  1ZC3 B;  4D0N B;  1MPH A;  4GMX B;  1OMW A;  4HB3 B;  2DA0 A;  2RNR B;  3FEH A;  4HDO A;  1VBH A;  2LBB A;  3ZVR A;  4F7G A;  2P0H A;  3PP2 A;  4XWX A;  3NSU A;  1BWN A;  3EPY A;  4B6H A;  2P8V A;  1FAO A;  2I5C A;  4HB0 B;  2ABD A;  5D3V A;  2GCL A;  1PFJ A;  2YS1 A;  3F5R A;  4JK7 A;  1Y5O A;  2NMB A;  1GC7 A;  1Y19 B;  3DXD A;  4IAP A;  4DBB A;  1U5E A;  1XD4 A;  1DYN A;  2X0S A;  2VKI A;  1TXD A;  4HAV B;  4TKN A;  4ZRJ A;  5IJM A;  4TYZ A;  3A8Q A;  2NZ8 B;  2Z0Q A;  2AEH A;  3SNH A;  1ST7 A;  2WH5 A;  2YSZ A;  2DYN A;  2DX5 A;  3GYP A;  5KCV A;  1XKE A;  2MDX A;  1X1F A;  2D9V A;  1TJ6 A;  2Y7B A;  1IRS A;  2R82 A;  2UZS A;  3TO1 A;  3GYO A;  1GC6 A;  4ZRI A;  1Q67 A;  2I1J A;  4NSW A;  2LOZ A;  3ODO A;  1FGZ A;  2EMS A;  1XX0 A;  1MIX A;  2L1C A;  5C5B B;  2D9W A;  3ODW A;  3SO6 A;  3MDB C;  1ZM0 A;  2X18 A;  3A98 B;  2EMT A;  3VOQ A;  2D9X A;  2J0M A;  1BTK A;  1DDM A;  2J59 M;  2H7D A;  2DKQ A;  1XR0 B;  1DRO A;  2GCJ A;  1WJ1 A;  3ULC A;  1V88 A;  4HDQ A;  4CHM A;  1NTY A;  3PVU A;  4JKB A;  5DIF B;  2COP A;  1NTI A;  2E2X A;  3N7C A;  2Z0P A;  2CY5 A;  5C6R A;  4KVG B;  1W1D A;  3BJI A;  2DFK A;  4YL8 A;  1M7R A;  1OQN A;  1HB8 A;  1J19 A;  4HAT B;  1EAZ A;  1UNR A;  2Y8F A;  2RQ1 A;  1WJM A;  5CLL B;  3ULB A;  3ML4 A;  3DXC A;  4KHA A;  2GJY A;  2LKO A;  4K2P A;  4Y94 A;  4JKC A;  5DI9 B;  1AWE A;  2HE7 A;  2QKM A;  1W1H A;  5C16 A;  1X11 A;  3VIA A;  2DHI A;  3UZT A;  1FGY A;  4GXB A;  2IFS A;  4JKG B;  4A6F A;  4JK9 A;  4BBK A;  1TQZ A;  3E66 A;  1MAI A;  3TVV A;  1KBL A;  2DIK A;  1MKE A;  3PZD A;  2D4Q A;  2QKL A;  4Z2M B;  3U7D A;  1WVH A;  5LON B;  2D10 A;  4IOY X;  3KZ1 A;  1BAK A;  3V5W A;  3QWM A;  1M7E A;  4ILG B;  2RGN B;  5JHG A;  1LB1 A;  3SBG A;  1KI1 B;  2XQN M;  1XOD A;  3X23 A;  3FM8 C;  4DX8 A;  4JKH A;  2LG1 A;  3D8E A;  4C0A A;  3SV1 A;  1DDW A;  3E9L A;  2COF A;  5GOW B;  3T06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...