1MK7B

Crystal structure of an integrin beta3-talin chimera
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
b'PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 57
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk7B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk7B02
4GPTB 1TQZA 2R0DA 4YONA 1H10A 3HW2B 3HQCA 5HE3A 4EJNA 5DHFB 1ZSQA 2COCA 2RGNB 1X05A 3CXBB 5IJMA 4CYEA 2YT0A 4DX90 3AU4A 4IOYX 3O96A 3SNHA 2QKLA 2RLOA 5HE0A 2D11A 1UPQA 3KRXA 2KCJA 3ODWA 2DHKA 2Z0QA 1UNQA 1DROA 3WYFB 2K2JA 2M14A 3PVUA 4IFSA 4A6KA 2D9ZA 1XKEA 2H7DA 1FGYA 3BJIA 1Y5OA 5D3WA 1XD4A 2UVMA 2CRFA 3N7CA 1P3RA 3DXEA 1OQNA 1U29A 2D4QA 4HATB 4F7UP 2ELBA 1ST7A 5C5BB 3IVFA 4HB0B 2LKOA 2DYNA 4D0NB 1TXDA 3FM8C 3QWMA 4MK0A 1PLSA 2DA0A 3A8QA 2CQUA 3AU5A 3PG7A 1MKEA 3FEHA 4GMVA 2EMTA 2D9WA 2ADZA 3PZDA 3TO1A 3GYPA 1Q67A 1U27A 2MFQA 3MPXA 2YSZA 2G35A 2OQBA 5GOWB 2COFA 1WGQA 5C16A 2QKMA 3FSSA 4A6HA 4KVGB 1FAOA 2N23A 2I1KA 1NI2A 3WA0A 3TVVA 4H8SA 1MK9B 4PNKA 2D10A 1EF1A 1Y19B 3PEGA 1UPRA 3M1IB 5CLQB 3QBVB 1V88A 4WVFB 5D3YA 4HB3B 4KHOA 5DH9B 1H4RA 1V5UA 3ULBA 3T06A 3PVWA 5C5BA 1LB1A 1DDVA 2Y8GA 1DDMA 5JHHA 4WSFA 1IRSA 3ODOA 5C79A 5EFXA 3F5RA 2EJ8A 2DLWA 1UEFA 4C0AA 2J0MA 1DYNA 1X1GA 1SHCA 4WJ7A 2ZPYA 2X18A 4GMXB 5J3TA 4L6EA 1AWEA 4TKNA 1M7EA 2MKRA 5HE2A 2YT1A 1NTIA 3VIAA 1BWNA 2VKIA 3PSCA 1EAZA 2YS5A 4HB4B 4A6FA 2KUPA 4A5KA 2DKPA 1K5GB 3D8EA 2P0HA 4HHVA 3PVLA 4HAZB 3HK0A 1U5FA 2RVBB 5CLLB 4GXBA 5FI1A 1V89A 2YVCA 4Y94A 2CB8A 3LJUX 5JP4A 3AJ4A 2EC1A 1GC6A 3NSUA 2COAA 1MIZB 5D3VA 2CY5A 3U7DA 3CIKA 4KHBB 1FHWA 1UNPA 3D8DA 3KY9A 4XWXA 2ROZB 2I5CA 3SV1A 3A8PA 1PFJA 2GCJA 2VRWB 2CAYA 1WJ1A 1M7RA 1WGUA 1V61A 1ZC4B 5KQ1A 3ML4A 4HAYB 2UZSA 2M38A 1XODA 2J59M 1PMSA 5J3QA 3ODXA 2Q13A 2RNRB 4K2PA 3PP2A 1KZ7A 4YL8A 4DXAB 1MPHA 2WH5A 2LOXA 4Z2NA 4MT7A 2AL6A 1GC7A 5DHAB 2J0JA 1X1FA 2I5FA 2LG1A 4NSWA 2Z0OA 3BINA 4ZRJA 1HB8A 4MY6A 4ZRIA 2D9YA 2NZ8B 1BAKA 2COPA 3G9WA 1FHXA 4F7GA 4HDOA 1LW3A 3RCPA 1FB8A 1MAIA 1NU2A 1FOEA 1XX0A 2IYBA 2CODA 1XCGA 2HTHB 2UZRA 1V5MA 4Z2MB 2DHJA 1WI1A 2K00A 5LONB 1ACAA 2FJ9A 4HAWB 4ZRKA 5D27A 3GYOA 2DN6A 3KRWA 4CHMA 5HE1A 1W1GA 1DBHA 5KCVA 2W2XD 2P8VA 4KAXB 1P5TA 5C6RA 4B6HA 1GG3A 2DYQA 2OTXA 2FJLA 2W2XC 3TCAA 2DX5A 3EPYA 4HDQA 4K2OA 5JHGA 3SO6A 1B55A 1QC6A 2GJYA 3ZDTA 3QIJA 2BCJA 3MDBC 1K5DB 1X86A 2YF0A 3F0WA 1EGXA 3D8FA 4EKUA 2CY4A 5JLJB 2LULA 1NTVA 5D3XA 1TJ6A 1U5DA 1ZVRA 1RRPB 2DX1A 2ROVA 2ELAA 1BTNA 1UNRA 2LOZA 2H7EA 1W1HA 1ISNA 1AQCA 3ULCA 4TYZA 2JP2A 2AEHA 2RSGA 3P7ZA 1DDWA 5DI9B 1KZGA 4CHJA 2R09A 4NY0A 3A98B 1KI1B 1HBKA 2RUKB 3DXCA 3VOQA 2E2XA 2GS0A 2Y8FA 4PQ0A 3P6AA 4K17A 1QQGA 2IFSA 4HAVB 4F7HA 1V5PA 5FI0A 2Y7BA 2EMSA 2ABDA 3ZVRA 1RJ2A 1WJMA 4BBKA 2V76A 2K2UA 1HB6A 3FP5A 3UZTA 1MK7B 4HAUB 3SUZA 1W1DA 1I2HA 4KHAA 5J3YA 2RQ1A 5LOPB 2HE7A 1E5WA 4DX8A 4GZUA 3OANA 2LYDA 2KGXB 2DFKA 4GN1A 3V5WA 2N0YA 2YS1A 1Z87A 3X23A 1X11A 4P7IA 2P0DA 2XQNM 1OMWA 1BTKA 1U5EA 2I1JA 1EVHA 2PZ1A 3KSYA 2NMBA 1WG7A 5DIFB 1P6SA 1J0WA 2YRYA 3KZ1A 2DKQA 4A6FB 2DTCA 2MDXA 4EMOA 4IAPA 2GCLA 4K81A 5KQ4A 1MIXA 2L1CA 3SYXA 3U8ZA 1NTYA 1OY2A 2W2WA 2VSZA 2Z0PA 3TW1A 1FGZA 2D9XA 4DBBA 1WVHA 4HAXB 2LBBA 5L81A 1XR0B 2FDQA 1I7AA 1U5GA 1ZC3B 2D2QA 1SGHA 2P0FA 1N3HA 3TFMA 3DXDA 2MWNB 1NVLA 1ZM0A 2YS3A 1FHOA 2DHIA 2HRJA 2D9VA 2J0KA 3FLVA 4HB2B 1J19A 1U2BA 2L2IA
chains in the Genus database with same CATH superfamily
4GPTB 1TQZA 2R0DA 4YONA 1H10A 3HW2B 3HQCA 5HE3A 4EJNA 5DHFB 1ZSQA 2COCA 2RGNB 1X05A 5IJMA 3CXBB 3SBGA 4CYEA 2YT0A 4DX90 3NWAA 3AU4A 4IOYX 3O96A 3SNHA 2QKLA 2RLOA 5HE0A 2D11A 4ILGB 1UPQA 3KRXA 2KCJA 3ODWA 2DHKA 2Z0QA 1VBHA 1UNQA 1DROA 3WYFB 2K2JA 2M14A 3PVUA 4IFSA 4ILHA 4A6KA 2D9ZA 4ILJA 1XKEA 2H7DA 1FGYA 3BJIA 2KIEA 1Y5OA 5D3WA 1XD4A 2UVMA 2CRFA 3N7CA 1P3RA 3DXEA 1OQNA 4JKGA 1U29A 2D4QA 4HATB 2ELBA 1ST7A 5C5BB 4F7UP 2GUMA 3IVFA 4HB0B 2LKOA 2DYNA 4D0NB 1TXDA 3FM8C 3QWMA 5LG4B 4MK0A 1PLSA 2DA0A 2ZKMX 2CQUA 3A8QA 3AU5A 1GGOA 3PG7A 1MKEA 4JKDA 3FEHA 4GMVA 2EMTA 2D9WA 2ADZA 3PZDA 3TO1A 4JK7A 3GYPA 1Q67A 1U27A 2MFQA 3MPXA 2YSZA 2G35A 2OQBA 5GOWB 2COFA 3DCXA 1WGQA 3B77A 4JKHA 5C16A 2QKMA 3FSSA 4A6HA 4KVGB 1FAOA 2N23A 2Z14A 2I1KA 4OSNA 1NI2A 3WA0A 3TVVA 4H8SA 1MK9B 4PNKA 2D10A 1EF1A 4GOUA 1Y19B 3PEGA 1UPRA 3M1IB 5CLQB 2R82A 1KC7A 3QBVB 4JKEA 1V88A 4WVFB 5D3YA 3NWFA 4HB3B 4KHOA 5DH9B 1H4RA 1V5UA 3ULBA 3T06A 3PVWA 5C5BA 1LB1A 1DDVA 2Y8GA 1DDMA 5JHHA 4WSFA 1IRSA 3ODOA 2DIKA 5C79A 5EFXA 3F5RA 2EJ8A 2DLWA 1UEFA 4C0AA 2J0MA 1DYNA 1X1GA 1SHCA 4WJ7A 2ZPYA 2X18A 4GMXB 5J3TA 4L1RA 4L6EA 1AWEA 4TKNA 1M7EA 2MKRA 5HE2A 2YT1A 1NTIA 2FJUB 3VIAA 3U12A 2RRFA 1BWNA 2VKIA 3PSCA 1EAZA 2YS5A 4HB4B 4A6FA 2R2YA 2Z59A 2KUPA 4A5KA 2DKPA 1K5GB 3D8EA 3HSAA 2P0HA 4HHVA 3PVLA 4HAZB 3HK0A 1U5FA 3ENBA 2RVBB 5CLLB 4GXBA 5FI1A 1V89A 2YVCA 4Y94A 2CB8A 3LJUX 5JP4A 3AJ4A 2EC1A 1GC6A 3NSUA 2COAA 1MIZB 5D3VA 2CY5A 3U7DA 3CIKA 4KHBB 4JK9A 1FHWA 1UNPA 3D8DA 4OT1A 3KY9A 4XWXA 2ROZB 2I5CA 3SV1A 3A8PA 1PFJA 2GCJA 2VRWB 1KBLA 4QJ5B 2CAYA 1WJ1A 1M7RA 1WGUA 1V61A 1ZC4B 5KQ1A 3ML4A 4HAYB 2UZSA 4QXAB 2M38A 1XODA 2J59M 1PMSA 5J3QA 3ODXA 2Q13A 2RNRB 4K2PA 3PP2A 1KZ7A 4YL8A 4DXAB 1MPHA 2WH5A 2LOXA 4Z2NA 4MT7A 2AL6A 1GC7A 5DHAB 4JK8A 2J0JA 1X1FA 2I5FA 2LG1A 4NSWA 2Z0OA 3BINA 4ZRJA 1HB8A 4MY6A 4ZRIA 2D9YA 2NZ8B 1BAKA 2COPA 3G9WA 4JKCA 1FHXA 4JKBA 4F7GA 4HDOA 1LW3A 3RCPA 1FB8A 1MAIA 3OHMB 1NU2A 4JKAA 1VBGA 1FOEA 1XX0A 2IYBA 2CODA 1XCGA 2HTHB 2UZRA 1V5MA 4Z2MB 1MI1A 2DHJA 1WI1A 2K00A 5LONB 1ACAA 2FJ9A 4HAWB 4ZRKA 3E9PA 2Z4DA 2KR0A 5D27A 3GYOA 2DN6A 3KRWA 2K8EA 4CHMA 5HE1A 1W1GA 1DBHA 5KCVA 2W2XD 2P8VA 4KAXB 4JKFA 1P5TA 3NWDA 5C6RA 4B6HA 1GG3A 2DYQA 3A58A 3E9LA 4HSIA 2OTXA 2FJLA 2W2XC 3TCAA 2DX5A 3EPYA 4HDQA 4K2OA 5JHGA 3SO6A 2KUQA 4GNKB 1B55A 4CSQA 2GJYA 1QC6A 3ZDTA 3QIJA 2BCJA 3MDBC 1K5DB 1X86A 2YF0A 3F0WA 1EGXA 2KIGA 4EKUA 3D8FA 2CY4A 3E9OA 5JLJB 5IRSA 2LULA 1NTVA 2NBVA 5I2SA 5D3XA 1TJ6A 1U5DA 1ZVRA 1RRPB 2DX1A 2ROVA 5JVLA 2ELAA 1BTNA 1UNRA 2LOZA 2H7EA 5M4YB 4JKGB 1W1HA 2K49A 1DIKA 1ISNA 1AQCA 3ULCA 4TYZA 2JP2A 2AEHA 2RSGA 3P7ZA 1DDWA 5DI9B 1KZGA 4CHJA 2R09A 4NY0A 3A98B 1KI1B 1HBKA 2RUKB 3DXCA 3VOQA 2E2XA 2GS0A 2Y8FA 4PQ0A 3P6AA 4K17A 1QQGA 2IFSA 4HAVB 4F7HA 1V5PA 5FI0A 2Y7BA 2EMSA 2ABDA 3ZVRA 1RJ2A 1WJMA 4BBKA 2V76A 2K2UA 1HB6A 3FP5A 3UZTA 3HIEA 1MK7B 4HAUB 3SUZA 1W1DA 1I2HA 4KHAA 5J3YA 2RQ1A 5LOPB 2HE7A 1E5WA 4DX8A 4GZUA 3OANA 2YT2A 2LYDA 2KGXB 3FVCA 2DFKA 4GN1A 3V5WA 2N0YA 2YS1A 1Z87A 3X23A 1X11A 4P7IA 2P0DA 2Z13A 4QJ3B 2XQNM 4KHBA 1OMWA 1BTKA 1U5EA 2I1JA 1EVHA 2PZ1A 3KSYA 2NMBA 1WG7A 4QJ4B 5DIFB 1P6SA 1J0WA 2YRYA 3KZ1A 4D6WA 2DKQA 4A6FB 1JDEA 2DTCA 2MDXA 4EMOA 4IAPA 2X0SA 2GCLA 4K81A 5I2MA 5KQ4A 1MIXA 2L1CA 3SYXA 3U8ZA 1NTYA 1OY2A 2W2WA 2VSZA 2Z0PA 3TW1A 1FGZA 2D9XA 4DBBA 1WVHA 4HAXB 3E66A 2LBBA 5L81A 1XR0B 2FDQA 1I7AA 1U5GA 1ZYIA 1ZC3B 2D2QA 1SGHA 2P0FA 1N3HA 3SBTA 3TFMA 1T77A 4DIXA 3DXDA 2MWNB 1NVLA 1ZM0A 2YS3A 1FHOA 2DHIA 2HRJA 3NW8A 2D9VA 2J0KA 3FLVA 4HB2B 1J19A 1U2BA 2L2IA
chains in the Genus database with same CATH topology
4GPTB 1TQZA 2R0DA 4YONA 1H10A 3HW2B 3HQCA 5HE3A 4EJNA 5DHFB 1ZSQA 2COCA 2RGNB 1X05A 5IJMA 3CXBB 3SBGA 4CYEA 2YT0A 4DX90 3AU4A 4IOYX 3O96A 3SNHA 2QKLA 2RLOA 5HE0A 2D11A 4ILGB 1UPQA 3KRXA 2KCJA 3ODWA 2DHKA 2Z0QA 1VBHA 1UNQA 1DROA 3WYFB 2K2JA 2M14A 3PVUA 4IFSA 4ILHA 4A6KA 2D9ZA 4ILJA 1XKEA 2H7DA 1FGYA 3BJIA 1Y5OA 5D3WA 1XD4A 2UVMA 2CRFA 3N7CA 1P3RA 3DXEA 1OQNA 4JKGA 1U29A 2D4QA 4HATB 2ELBA 1ST7A 5C5BB 4F7UP 3IVFA 4HB0B 2LKOA 2DYNA 4D0NB 1TXDA 3FM8C 3QWMA 4MK0A 1PLSA 2DA0A 3A8QA 2CQUA 3AU5A 1GGOA 3PG7A 1MKEA 4JKDA 3FEHA 4GMVA 2EMTA 2D9WA 2ADZA 3PZDA 3TO1A 4JK7A 3GYPA 1Q67A 1U27A 2MFQA 3MPXA 2YSZA 2G35A 2OQBA 5GOWB 2COFA 1WGQA 4JKHA 5C16A 2QKMA 3FSSA 4A6HA 4KVGB 1FAOA 2N23A 2I1KA 1NI2A 3WA0A 3TVVA 4H8SA 1MK9B 4PNKA 2D10A 1EF1A 1Y19B 3PEGA 1UPRA 3M1IB 5CLQB 2R82A 1KC7A 3QBVB 4JKEA 1V88A 4WVFB 5D3YA 4HB3B 4KHOA 5DH9B 1H4RA 1V5UA 3ULBA 3T06A 3PVWA 5C5BA 1LB1A 1DDVA 2Y8GA 1DDMA 5JHHA 4WSFA 1IRSA 3ODOA 2DIKA 5C79A 5EFXA 3F5RA 2EJ8A 2DLWA 1UEFA 4C0AA 2J0MA 1DYNA 1X1GA 1SHCA 4WJ7A 2ZPYA 2X18A 4GMXB 5J3TA 4L6EA 1AWEA 4TKNA 1M7EA 2MKRA 5HE2A 2YT1A 1NTIA 3VIAA 1BWNA 2VKIA 3PSCA 1EAZA 2YS5A 4HB4B 4A6FA 2KUPA 4A5KA 2DKPA 1K5GB 3D8EA 2P0HA 4HHVA 3PVLA 4HAZB 3HK0A 1U5FA 3ENBA 2RVBB 5CLLB 4GXBA 5FI1A 1V89A 2YVCA 4Y94A 2CB8A 3LJUX 5JP4A 3AJ4A 2EC1A 1GC6A 3NSUA 2COAA 1MIZB 5D3VA 2CY5A 3U7DA 3CIKA 4KHBB 4JK9A 1FHWA 1UNPA 3D8DA 3KY9A 4XWXA 2ROZB 2I5CA 3SV1A 3A8PA 1PFJA 2GCJA 2VRWB 1KBLA 2CAYA 1WJ1A 1M7RA 1WGUA 1V61A 1ZC4B 5KQ1A 3ML4A 4HAYB 2UZSA 2M38A 1XODA 2J59M 1PMSA 5J3QA 3ODXA 2Q13A 2RNRB 4K2PA 3PP2A 1KZ7A 4YL8A 4DXAB 1MPHA 2WH5A 2LOXA 4Z2NA 4MT7A 2AL6A 1GC7A 5DHAB 4JK8A 2J0JA 1X1FA 2I5FA 2LG1A 4NSWA 2Z0OA 3BINA 4ZRJA 1HB8A 4MY6A 4ZRIA 2D9YA 2NZ8B 1BAKA 2COPA 3G9WA 4JKCA 1FHXA 4JKBA 4F7GA 4HDOA 1LW3A 3RCPA 1FB8A 1MAIA 1NU2A 4JKAA 1VBGA 1FOEA 1XX0A 2IYBA 2CODA 1XCGA 2HTHB 2UZRA 1V5MA 4Z2MB 2DHJA 1WI1A 2K00A 5LONB 1ACAA 2FJ9A 4HAWB 4ZRKA 3E9PA 5D27A 3GYOA 2DN6A 3KRWA 4CHMA 5HE1A 1W1GA 1DBHA 5KCVA 2W2XD 2P8VA 4KAXB 4JKFA 1P5TA 5C6RA 4B6HA 1GG3A 2DYQA 3E9LA 2OTXA 2FJLA 2W2XC 3TCAA 2DX5A 3EPYA 4HDQA 4K2OA 5JHGA 3SO6A 1B55A 2GJYA 1QC6A 3ZDTA 3QIJA 2BCJA 3MDBC 1K5DB 1X86A 2YF0A 3F0WA 1EGXA 3D8FA 4EKUA 2CY4A 3E9OA 5JLJB 2LULA 1NTVA 5D3XA 1TJ6A 1U5DA 1ZVRA 1RRPB 2DX1A 2ROVA 5JVLA 2ELAA 1BTNA 1UNRA 2LOZA 2H7EA 4JKGB 1W1HA 1DIKA 1ISNA 1AQCA 3ULCA 4TYZA 2JP2A 2AEHA 2RSGA 3P7ZA 1DDWA 5DI9B 1KZGA 4CHJA 2R09A 4NY0A 3A98B 1KI1B 1HBKA 2RUKB 3DXCA 3VOQA 2E2XA 2GS0A 2Y8FA 4PQ0A 3P6AA 4K17A 1QQGA 2IFSA 4HAVB 4F7HA 1V5PA 5FI0A 2Y7BA 2EMSA 2ABDA 3ZVRA 1RJ2A 1WJMA 4BBKA 2V76A 2K2UA 1HB6A 3FP5A 3UZTA 1MK7B 4HAUB 3SUZA 1W1DA 1I2HA 4KHAA 5J3YA 2RQ1A 5LOPB 2HE7A 1E5WA 4DX8A 4GZUA 3OANA 2LYDA 2KGXB 2DFKA 4GN1A 3V5WA 2N0YA 2YS1A 1Z87A 3X23A 1X11A 4P7IA 2P0DA 2XQNM 1OMWA 1BTKA 1U5EA 2I1JA 1EVHA 2PZ1A 3KSYA 2NMBA 1WG7A 5DIFB 1P6SA 1J0WA 2YRYA 3KZ1A 2DKQA 4A6FB 1JDEA 2DTCA 2MDXA 4EMOA 4IAPA 2X0SA 2GCLA 4K81A 5KQ4A 1MIXA 2L1CA 3SYXA 3U8ZA 1NTYA 1OY2A 2W2WA 2VSZA 2Z0PA 3TW1A 1FGZA 2D9XA 4DBBA 1WVHA 4HAXB 3E66A 2LBBA 5L81A 1XR0B 2FDQA 1I7AA 1U5GA 1ZC3B 2D2QA 1SGHA 2P0FA 1N3HA 3SBTA 3TFMA 3DXDA 2MWNB 1NVLA 1ZM0A 2YS3A 1FHOA 2DHIA 2HRJA 2D9VA 2J0KA 3FLVA 4HB2B 1J19A 1U2BA 2L2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPT B;  1TQZ A;  2R0D A;  4YON A;  1H10 A;  3HW2 B;  3HQC A;  5HE3 A;  4EJN A;  5DHF B;  1ZSQ A;  2COC A;  2RGN B;  1X05 A;  3CXB B;  5IJM A;  4CYE A;  2YT0 A;  4DX9 0;  3AU4 A;  4IOY X;  3O96 A;  3SNH A;  2QKL A;  2RLO A;  5HE0 A;  2D11 A;  1UPQ A;  3KRX A;  2KCJ A;  3ODW A;  2DHK A;  2Z0Q A;  1UNQ A;  1DRO A;  3WYF B;  2K2J A;  2M14 A;  3PVU A;  4IFS A;  4A6K A;  2D9Z A;  1XKE A;  2H7D A;  1FGY A;  3BJI A;  1Y5O A;  5D3W A;  1XD4 A;  2UVM A;  2CRF A;  3N7C A;  1P3R A;  3DXE A;  1OQN A;  1U29 A;  2D4Q A;  4HAT B;  4F7U P;  2ELB A;  1ST7 A;  5C5B B;  3IVF A;  4HB0 B;  2LKO A;  2DYN A;  4D0N B;  1TXD A;  3FM8 C;  3QWM A;  4MK0 A;  1PLS A;  2DA0 A;  3A8Q A;  2CQU A;  3AU5 A;  3PG7 A;  1MKE A;  3FEH A;  4GMV A;  2EMT A;  2D9W A;  2ADZ A;  3PZD A;  3TO1 A;  3GYP A;  1Q67 A;  1U27 A;  2MFQ A;  3MPX A;  2YSZ A;  2G35 A;  2OQB A;  5GOW B;  2COF A;  1WGQ A;  5C16 A;  2QKM A;  3FSS A;  4A6H A;  4KVG B;  1FAO A;  2N23 A;  2I1K A;  1NI2 A;  3WA0 A;  3TVV A;  4H8S A;  1MK9 B;  4PNK A;  2D10 A;  1EF1 A;  1Y19 B;  3PEG A;  1UPR A;  3M1I B;  5CLQ B;  3QBV B;  1V88 A;  4WVF B;  5D3Y A;  4HB3 B;  4KHO A;  5DH9 B;  1H4R A;  1V5U A;  3ULB A;  3T06 A;  3PVW A;  5C5B A;  1LB1 A;  1DDV A;  2Y8G A;  1DDM A;  5JHH A;  4WSF A;  1IRS A;  3ODO A;  5C79 A;  5EFX A;  3F5R A;  2EJ8 A;  2DLW A;  1UEF A;  4C0A A;  2J0M A;  1DYN A;  1X1G A;  1SHC A;  4WJ7 A;  2ZPY A;  2X18 A;  4GMX B;  5J3T A;  4L6E A;  1AWE A;  4TKN A;  1M7E A;  2MKR A;  5HE2 A;  2YT1 A;  1NTI A;  3VIA A;  1BWN A;  2VKI A;  3PSC A;  1EAZ A;  2YS5 A;  4HB4 B;  4A6F A;  2KUP A;  4A5K A;  2DKP A;  1K5G B;  3D8E A;  2P0H A;  4HHV A;  3PVL A;  4HAZ B;  3HK0 A;  1U5F A;  2RVB B;  5CLL B;  4GXB A;  5FI1 A;  1V89 A;  2YVC A;  4Y94 A;  2CB8 A;  3LJU X;  5JP4 A;  3AJ4 A;  2EC1 A;  1GC6 A;  3NSU A;  2COA A;  1MIZ B;  5D3V A;  2CY5 A;  3U7D A;  3CIK A;  4KHB B;  1FHW A;  1UNP A;  3D8D A;  3KY9 A;  4XWX A;  2ROZ B;  2I5C A;  3SV1 A;  3A8P A;  1PFJ A;  2GCJ A;  2VRW B;  2CAY A;  1WJ1 A;  1M7R A;  1WGU A;  1V61 A;  1ZC4 B;  5KQ1 A;  3ML4 A;  4HAY B;  2UZS A;  2M38 A;  1XOD A;  2J59 M;  1PMS A;  5J3Q A;  3ODX A;  2Q13 A;  2RNR B;  4K2P A;  3PP2 A;  1KZ7 A;  4YL8 A;  4DXA B;  1MPH A;  2WH5 A;  2LOX A;  4Z2N A;  4MT7 A;  2AL6 A;  1GC7 A;  5DHA B;  2J0J A;  1X1F A;  2I5F A;  2LG1 A;  4NSW A;  2Z0O A;  3BIN A;  4ZRJ A;  1HB8 A;  4MY6 A;  4ZRI A;  2D9Y A;  2NZ8 B;  1BAK A;  2COP A;  3G9W A;  1FHX A;  4F7G A;  4HDO A;  1LW3 A;  3RCP A;  1FB8 A;  1MAI A;  1NU2 A;  1FOE A;  1XX0 A;  2IYB A;  2COD A;  1XCG A;  2HTH B;  2UZR A;  1V5M A;  4Z2M B;  2DHJ A;  1WI1 A;  2K00 A;  5LON B;  1ACA A;  2FJ9 A;  4HAW B;  4ZRK A;  5D27 A;  3GYO A;  2DN6 A;  3KRW A;  4CHM A;  5HE1 A;  1W1G A;  1DBH A;  5KCV A;  2W2X D;  2P8V A;  4KAX B;  1P5T A;  5C6R A;  4B6H A;  1GG3 A;  2DYQ A;  2OTX A;  2FJL A;  2W2X C;  3TCA A;  2DX5 A;  3EPY A;  4HDQ A;  4K2O A;  5JHG A;  3SO6 A;  1B55 A;  1QC6 A;  2GJY A;  3ZDT A;  3QIJ A;  2BCJ A;  3MDB C;  1K5D B;  1X86 A;  2YF0 A;  3F0W A;  1EGX A;  3D8F A;  4EKU A;  2CY4 A;  5JLJ B;  2LUL A;  1NTV A;  5D3X A;  1TJ6 A;  1U5D A;  1ZVR A;  1RRP B;  2DX1 A;  2ROV A;  2ELA A;  1BTN A;  1UNR A;  2LOZ A;  2H7E A;  1W1H A;  1ISN A;  1AQC A;  3ULC A;  4TYZ A;  2JP2 A;  2AEH A;  2RSG A;  3P7Z A;  1DDW A;  5DI9 B;  1KZG A;  4CHJ A;  2R09 A;  4NY0 A;  3A98 B;  1KI1 B;  1HBK A;  2RUK B;  3DXC A;  3VOQ A;  2E2X A;  2GS0 A;  2Y8F A;  4PQ0 A;  3P6A A;  4K17 A;  1QQG A;  2IFS A;  4HAV B;  4F7H A;  1V5P A;  5FI0 A;  2Y7B A;  2EMS A;  2ABD A;  3ZVR A;  1RJ2 A;  1WJM A;  4BBK A;  2V76 A;  2K2U A;  1HB6 A;  3FP5 A;  3UZT A;  1MK7 B;  4HAU B;  3SUZ A;  1W1D A;  1I2H A;  4KHA A;  5J3Y A;  2RQ1 A;  5LOP B;  2HE7 A;  1E5W A;  4DX8 A;  4GZU A;  3OAN A;  2LYD A;  2KGX B;  2DFK A;  4GN1 A;  3V5W A;  2N0Y A;  2YS1 A;  1Z87 A;  3X23 A;  1X11 A;  4P7I A;  2P0D A;  2XQN M;  1OMW A;  1BTK A;  1U5E A;  2I1J A;  1EVH A;  2PZ1 A;  3KSY A;  2NMB A;  1WG7 A;  5DIF B;  1P6S A;  1J0W A;  2YRY A;  3KZ1 A;  2DKQ A;  4A6F B;  2DTC A;  2MDX A;  4EMO A;  4IAP A;  2GCL A;  4K81 A;  5KQ4 A;  1MIX A;  2L1C A;  3SYX A;  3U8Z A;  1NTY A;  1OY2 A;  2W2W A;  2VSZ A;  2Z0P A;  3TW1 A;  1FGZ A;  2D9X A;  4DBB A;  1WVH A;  4HAX B;  2LBB A;  5L81 A;  1XR0 B;  2FDQ A;  1I7A A;  1U5G A;  1ZC3 B;  2D2Q A;  1SGH A;  2P0F A;  1N3H A;  3TFM A;  3DXD A;  2MWN B;  1NVL A;  1ZM0 A;  2YS3 A;  1FHO A;  2DHI A;  2HRJ A;  2D9V A;  2J0K A;  3FLV A;  4HB2 B;  1J19 A;  1U2B A;  2L2I A; 
#chains in the Genus database with same CATH topology
 4GPT B;  1TQZ A;  2R0D A;  4YON A;  1H10 A;  3HW2 B;  3HQC A;  5HE3 A;  4EJN A;  5DHF B;  1ZSQ A;  2COC A;  2RGN B;  1X05 A;  5IJM A;  3CXB B;  3SBG A;  4CYE A;  2YT0 A;  4DX9 0;  3NWA A;  3AU4 A;  4IOY X;  3O96 A;  3SNH A;  2QKL A;  2RLO A;  5HE0 A;  2D11 A;  4ILG B;  1UPQ A;  3KRX A;  2KCJ A;  3ODW A;  2DHK A;  2Z0Q A;  1VBH A;  1UNQ A;  1DRO A;  3WYF B;  2K2J A;  2M14 A;  3PVU A;  4IFS A;  4ILH A;  4A6K A;  2D9Z A;  4ILJ A;  1XKE A;  2H7D A;  1FGY A;  3BJI A;  2KIE A;  1Y5O A;  5D3W A;  1XD4 A;  2UVM A;  2CRF A;  3N7C A;  1P3R A;  3DXE A;  1OQN A;  4JKG A;  1U29 A;  2D4Q A;  4HAT B;  2ELB A;  1ST7 A;  5C5B B;  4F7U P;  2GUM A;  3IVF A;  4HB0 B;  2LKO A;  2DYN A;  4D0N B;  1TXD A;  3FM8 C;  3QWM A;  5LG4 B;  4MK0 A;  1PLS A;  2DA0 A;  2ZKM X;  2CQU A;  3A8Q A;  3AU5 A;  1GGO A;  3PG7 A;  1MKE A;  4JKD A;  3FEH A;  4GMV A;  2EMT A;  2D9W A;  2ADZ A;  3PZD A;  3TO1 A;  4JK7 A;  3GYP A;  1Q67 A;  1U27 A;  2MFQ A;  3MPX A;  2YSZ A;  2G35 A;  2OQB A;  5GOW B;  2COF A;  3DCX A;  1WGQ A;  3B77 A;  4JKH A;  5C16 A;  2QKM A;  3FSS A;  4A6H A;  4KVG B;  1FAO A;  2N23 A;  2Z14 A;  2I1K A;  4OSN A;  1NI2 A;  3WA0 A;  3TVV A;  4H8S A;  1MK9 B;  4PNK A;  2D10 A;  1EF1 A;  4GOU A;  1Y19 B;  3PEG A;  1UPR A;  3M1I B;  5CLQ B;  2R82 A;  1KC7 A;  3QBV B;  4JKE A;  1V88 A;  4WVF B;  5D3Y A;  3NWF A;  4HB3 B;  4KHO A;  5DH9 B;  1H4R A;  1V5U A;  3ULB A;  3T06 A;  3PVW A;  5C5B A;  1LB1 A;  1DDV A;  2Y8G A;  1DDM A;  5JHH A;  4WSF A;  1IRS A;  3ODO A;  2DIK A;  5C79 A;  5EFX A;  3F5R A;  2EJ8 A;  2DLW A;  1UEF A;  4C0A A;  2J0M A;  1DYN A;  1X1G A;  1SHC A;  4WJ7 A;  2ZPY A;  2X18 A;  4GMX B;  5J3T A;  4L1R A;  4L6E A;  1AWE A;  4TKN A;  1M7E A;  2MKR A;  5HE2 A;  2YT1 A;  1NTI A;  2FJU B;  3VIA A;  3U12 A;  2RRF A;  1BWN A;  2VKI A;  3PSC A;  1EAZ A;  2YS5 A;  4HB4 B;  4A6F A;  2R2Y A;  2Z59 A;  2KUP A;  4A5K A;  2DKP A;  1K5G B;  3D8E A;  3HSA A;  2P0H A;  4HHV A;  3PVL A;  4HAZ B;  3HK0 A;  1U5F A;  3ENB A;  2RVB B;  5CLL B;  4GXB A;  5FI1 A;  1V89 A;  2YVC A;  4Y94 A;  2CB8 A;  3LJU X;  5JP4 A;  3AJ4 A;  2EC1 A;  1GC6 A;  3NSU A;  2COA A;  1MIZ B;  5D3V A;  2CY5 A;  3U7D A;  3CIK A;  4KHB B;  4JK9 A;  1FHW A;  1UNP A;  3D8D A;  4OT1 A;  3KY9 A;  4XWX A;  2ROZ B;  2I5C A;  3SV1 A;  3A8P A;  1PFJ A;  2GCJ A;  2VRW B;  1KBL A;  4QJ5 B;  2CAY A;  1WJ1 A;  1M7R A;  1WGU A;  1V61 A;  1ZC4 B;  5KQ1 A;  3ML4 A;  4HAY B;  2UZS A;  4QXA B;  2M38 A;  1XOD A;  2J59 M;  1PMS A;  5J3Q A;  3ODX A;  2Q13 A;  2RNR B;  4K2P A;  3PP2 A;  1KZ7 A;  4YL8 A;  4DXA B;  1MPH A;  2WH5 A;  2LOX A;  4Z2N A;  4MT7 A;  2AL6 A;  1GC7 A;  5DHA B;  4JK8 A;  2J0J A;  1X1F A;  2I5F A;  2LG1 A;  4NSW A;  2Z0O A;  3BIN A;  4ZRJ A;  1HB8 A;  4MY6 A;  4ZRI A;  2D9Y A;  2NZ8 B;  1BAK A;  2COP A;  3G9W A;  4JKC A;  1FHX A;  4JKB A;  4F7G A;  4HDO A;  1LW3 A;  3RCP A;  1FB8 A;  1MAI A;  3OHM B;  1NU2 A;  4JKA A;  1VBG A;  1FOE A;  1XX0 A;  2IYB A;  2COD A;  1XCG A;  2HTH B;  2UZR A;  1V5M A;  4Z2M B;  1MI1 A;  2DHJ A;  1WI1 A;  2K00 A;  5LON B;  1ACA A;  2FJ9 A;  4HAW B;  4ZRK A;  3E9P A;  2Z4D A;  2KR0 A;  5D27 A;  3GYO A;  2DN6 A;  3KRW A;  2K8E A;  4CHM A;  5HE1 A;  1W1G A;  1DBH A;  5KCV A;  2W2X D;  2P8V A;  4KAX B;  4JKF A;  1P5T A;  3NWD A;  5C6R A;  4B6H A;  1GG3 A;  2DYQ A;  3A58 A;  3E9L A;  4HSI A;  2OTX A;  2FJL A;  2W2X C;  3TCA A;  2DX5 A;  3EPY A;  4HDQ A;  4K2O A;  5JHG A;  3SO6 A;  2KUQ A;  4GNK B;  1B55 A;  4CSQ A;  2GJY A;  1QC6 A;  3ZDT A;  3QIJ A;  2BCJ A;  3MDB C;  1K5D B;  1X86 A;  2YF0 A;  3F0W A;  1EGX A;  2KIG A;  4EKU A;  3D8F A;  2CY4 A;  3E9O A;  5JLJ B;  5IRS A;  2LUL A;  1NTV A;  2NBV A;  5I2S A;  5D3X A;  1TJ6 A;  1U5D A;  1ZVR A;  1RRP B;  2DX1 A;  2ROV A;  5JVL A;  2ELA A;  1BTN A;  1UNR A;  2LOZ A;  2H7E A;  5M4Y B;  4JKG B;  1W1H A;  2K49 A;  1DIK A;  1ISN A;  1AQC A;  3ULC A;  4TYZ A;  2JP2 A;  2AEH A;  2RSG A;  3P7Z A;  1DDW A;  5DI9 B;  1KZG A;  4CHJ A;  2R09 A;  4NY0 A;  3A98 B;  1KI1 B;  1HBK A;  2RUK B;  3DXC A;  3VOQ A;  2E2X A;  2GS0 A;  2Y8F A;  4PQ0 A;  3P6A A;  4K17 A;  1QQG A;  2IFS A;  4HAV B;  4F7H A;  1V5P A;  5FI0 A;  2Y7B A;  2EMS A;  2ABD A;  3ZVR A;  1RJ2 A;  1WJM A;  4BBK A;  2V76 A;  2K2U A;  1HB6 A;  3FP5 A;  3UZT A;  3HIE A;  1MK7 B;  4HAU B;  3SUZ A;  1W1D A;  1I2H A;  4KHA A;  5J3Y A;  2RQ1 A;  5LOP B;  2HE7 A;  1E5W A;  4DX8 A;  4GZU A;  3OAN A;  2YT2 A;  2LYD A;  2KGX B;  3FVC A;  2DFK A;  4GN1 A;  3V5W A;  2N0Y A;  2YS1 A;  1Z87 A;  3X23 A;  1X11 A;  4P7I A;  2P0D A;  2Z13 A;  4QJ3 B;  2XQN M;  4KHB A;  1OMW A;  1BTK A;  1U5E A;  2I1J A;  1EVH A;  2PZ1 A;  3KSY A;  2NMB A;  1WG7 A;  4QJ4 B;  5DIF B;  1P6S A;  1J0W A;  2YRY A;  3KZ1 A;  4D6W A;  2DKQ A;  4A6F B;  1JDE A;  2DTC A;  2MDX A;  4EMO A;  4IAP A;  2X0S A;  2GCL A;  4K81 A;  5I2M A;  5KQ4 A;  1MIX A;  2L1C A;  3SYX A;  3U8Z A;  1NTY A;  1OY2 A;  2W2W A;  2VSZ A;  2Z0P A;  3TW1 A;  1FGZ A;  2D9X A;  4DBB A;  1WVH A;  4HAX B;  3E66 A;  2LBB A;  5L81 A;  1XR0 B;  2FDQ A;  1I7A A;  1U5G A;  1ZYI A;  1ZC3 B;  2D2Q A;  1SGH A;  2P0F A;  1N3H A;  3SBT A;  3TFM A;  1T77 A;  4DIX A;  3DXD A;  2MWN B;  1NVL A;  1ZM0 A;  2YS3 A;  1FHO A;  2DHI A;  2HRJ A;  3NW8 A;  2D9V A;  2J0K A;  3FLV A;  4HB2 B;  1J19 A;  1U2B A;  2L2I A; 
#chains in the Genus database with same CATH homology
 4GPT B;  1TQZ A;  2R0D A;  4YON A;  1H10 A;  3HW2 B;  3HQC A;  5HE3 A;  4EJN A;  5DHF B;  1ZSQ A;  2COC A;  2RGN B;  1X05 A;  5IJM A;  3CXB B;  3SBG A;  4CYE A;  2YT0 A;  4DX9 0;  3AU4 A;  4IOY X;  3O96 A;  3SNH A;  2QKL A;  2RLO A;  5HE0 A;  2D11 A;  4ILG B;  1UPQ A;  3KRX A;  2KCJ A;  3ODW A;  2DHK A;  2Z0Q A;  1VBH A;  1UNQ A;  1DRO A;  3WYF B;  2K2J A;  2M14 A;  3PVU A;  4IFS A;  4ILH A;  4A6K A;  2D9Z A;  4ILJ A;  1XKE A;  2H7D A;  1FGY A;  3BJI A;  1Y5O A;  5D3W A;  1XD4 A;  2UVM A;  2CRF A;  3N7C A;  1P3R A;  3DXE A;  1OQN A;  4JKG A;  1U29 A;  2D4Q A;  4HAT B;  2ELB A;  1ST7 A;  5C5B B;  4F7U P;  3IVF A;  4HB0 B;  2LKO A;  2DYN A;  4D0N B;  1TXD A;  3FM8 C;  3QWM A;  4MK0 A;  1PLS A;  2DA0 A;  3A8Q A;  2CQU A;  3AU5 A;  1GGO A;  3PG7 A;  1MKE A;  4JKD A;  3FEH A;  4GMV A;  2EMT A;  2D9W A;  2ADZ A;  3PZD A;  3TO1 A;  4JK7 A;  3GYP A;  1Q67 A;  1U27 A;  2MFQ A;  3MPX A;  2YSZ A;  2G35 A;  2OQB A;  5GOW B;  2COF A;  1WGQ A;  4JKH A;  5C16 A;  2QKM A;  3FSS A;  4A6H A;  4KVG B;  1FAO A;  2N23 A;  2I1K A;  1NI2 A;  3WA0 A;  3TVV A;  4H8S A;  1MK9 B;  4PNK A;  2D10 A;  1EF1 A;  1Y19 B;  3PEG A;  1UPR A;  3M1I B;  5CLQ B;  2R82 A;  1KC7 A;  3QBV B;  4JKE A;  1V88 A;  4WVF B;  5D3Y A;  4HB3 B;  4KHO A;  5DH9 B;  1H4R A;  1V5U A;  3ULB A;  3T06 A;  3PVW A;  5C5B A;  1LB1 A;  1DDV A;  2Y8G A;  1DDM A;  5JHH A;  4WSF A;  1IRS A;  3ODO A;  2DIK A;  5C79 A;  5EFX A;  3F5R A;  2EJ8 A;  2DLW A;  1UEF A;  4C0A A;  2J0M A;  1DYN A;  1X1G A;  1SHC A;  4WJ7 A;  2ZPY A;  2X18 A;  4GMX B;  5J3T A;  4L6E A;  1AWE A;  4TKN A;  1M7E A;  2MKR A;  5HE2 A;  2YT1 A;  1NTI A;  3VIA A;  1BWN A;  2VKI A;  3PSC A;  1EAZ A;  2YS5 A;  4HB4 B;  4A6F A;  2KUP A;  4A5K A;  2DKP A;  1K5G B;  3D8E A;  2P0H A;  4HHV A;  3PVL A;  4HAZ B;  3HK0 A;  1U5F A;  3ENB A;  2RVB B;  5CLL B;  4GXB A;  5FI1 A;  1V89 A;  2YVC A;  4Y94 A;  2CB8 A;  3LJU X;  5JP4 A;  3AJ4 A;  2EC1 A;  1GC6 A;  3NSU A;  2COA A;  1MIZ B;  5D3V A;  2CY5 A;  3U7D A;  3CIK A;  4KHB B;  4JK9 A;  1FHW A;  1UNP A;  3D8D A;  3KY9 A;  4XWX A;  2ROZ B;  2I5C A;  3SV1 A;  3A8P A;  1PFJ A;  2GCJ A;  2VRW B;  1KBL A;  2CAY A;  1WJ1 A;  1M7R A;  1WGU A;  1V61 A;  1ZC4 B;  5KQ1 A;  3ML4 A;  4HAY B;  2UZS A;  2M38 A;  1XOD A;  2J59 M;  1PMS A;  5J3Q A;  3ODX A;  2Q13 A;  2RNR B;  4K2P A;  3PP2 A;  1KZ7 A;  4YL8 A;  4DXA B;  1MPH A;  2WH5 A;  2LOX A;  4Z2N A;  4MT7 A;  2AL6 A;  1GC7 A;  5DHA B;  4JK8 A;  2J0J A;  1X1F A;  2I5F A;  2LG1 A;  4NSW A;  2Z0O A;  3BIN A;  4ZRJ A;  1HB8 A;  4MY6 A;  4ZRI A;  2D9Y A;  2NZ8 B;  1BAK A;  2COP A;  3G9W A;  4JKC A;  1FHX A;  4JKB A;  4F7G A;  4HDO A;  1LW3 A;  3RCP A;  1FB8 A;  1MAI A;  1NU2 A;  4JKA A;  1VBG A;  1FOE A;  1XX0 A;  2IYB A;  2COD A;  1XCG A;  2HTH B;  2UZR A;  1V5M A;  4Z2M B;  2DHJ A;  1WI1 A;  2K00 A;  5LON B;  1ACA A;  2FJ9 A;  4HAW B;  4ZRK A;  3E9P A;  5D27 A;  3GYO A;  2DN6 A;  3KRW A;  4CHM A;  5HE1 A;  1W1G A;  1DBH A;  5KCV A;  2W2X D;  2P8V A;  4KAX B;  4JKF A;  1P5T A;  5C6R A;  4B6H A;  1GG3 A;  2DYQ A;  3E9L A;  2OTX A;  2FJL A;  2W2X C;  3TCA A;  2DX5 A;  3EPY A;  4HDQ A;  4K2O A;  5JHG A;  3SO6 A;  1B55 A;  2GJY A;  1QC6 A;  3ZDT A;  3QIJ A;  2BCJ A;  3MDB C;  1K5D B;  1X86 A;  2YF0 A;  3F0W A;  1EGX A;  3D8F A;  4EKU A;  2CY4 A;  3E9O A;  5JLJ B;  2LUL A;  1NTV A;  5D3X A;  1TJ6 A;  1U5D A;  1ZVR A;  1RRP B;  2DX1 A;  2ROV A;  5JVL A;  2ELA A;  1BTN A;  1UNR A;  2LOZ A;  2H7E A;  4JKG B;  1W1H A;  1DIK A;  1ISN A;  1AQC A;  3ULC A;  4TYZ A;  2JP2 A;  2AEH A;  2RSG A;  3P7Z A;  1DDW A;  5DI9 B;  1KZG A;  4CHJ A;  2R09 A;  4NY0 A;  3A98 B;  1KI1 B;  1HBK A;  2RUK B;  3DXC A;  3VOQ A;  2E2X A;  2GS0 A;  2Y8F A;  4PQ0 A;  3P6A A;  4K17 A;  1QQG A;  2IFS A;  4HAV B;  4F7H A;  1V5P A;  5FI0 A;  2Y7B A;  2EMS A;  2ABD A;  3ZVR A;  1RJ2 A;  1WJM A;  4BBK A;  2V76 A;  2K2U A;  1HB6 A;  3FP5 A;  3UZT A;  1MK7 B;  4HAU B;  3SUZ A;  1W1D A;  1I2H A;  4KHA A;  5J3Y A;  2RQ1 A;  5LOP B;  2HE7 A;  1E5W A;  4DX8 A;  4GZU A;  3OAN A;  2LYD A;  2KGX B;  2DFK A;  4GN1 A;  3V5W A;  2N0Y A;  2YS1 A;  1Z87 A;  3X23 A;  1X11 A;  4P7I A;  2P0D A;  2XQN M;  1OMW A;  1BTK A;  1U5E A;  2I1J A;  1EVH A;  2PZ1 A;  3KSY A;  2NMB A;  1WG7 A;  5DIF B;  1P6S A;  1J0W A;  2YRY A;  3KZ1 A;  2DKQ A;  4A6F B;  1JDE A;  2DTC A;  2MDX A;  4EMO A;  4IAP A;  2X0S A;  2GCL A;  4K81 A;  5KQ4 A;  1MIX A;  2L1C A;  3SYX A;  3U8Z A;  1NTY A;  1OY2 A;  2W2W A;  2VSZ A;  2Z0P A;  3TW1 A;  1FGZ A;  2D9X A;  4DBB A;  1WVH A;  4HAX B;  3E66 A;  2LBB A;  5L81 A;  1XR0 B;  2FDQ A;  1I7A A;  1U5G A;  1ZC3 B;  2D2Q A;  1SGH A;  2P0F A;  1N3H A;  3SBT A;  3TFM A;  3DXD A;  2MWN B;  1NVL A;  1ZM0 A;  2YS3 A;  1FHO A;  2DHI A;  2HRJ A;  2D9V A;  2J0K A;  3FLV A;  4HB2 B;  1J19 A;  1U2B A;  2L2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...