1MK7B

Crystal structure of an integrin beta3-talin chimera
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Integrin Beta3
publication title Structural Determinants of Integrin Recognition by Talin
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 192
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mk7B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mk7B02
3TO1A 1Z87A 2P0HA 2ROVA 1QQGA 2XQNM 2D4QA 1DROA 1ZC4B 1V89A 1HB6A 1SGHA 4TYZA 5FI0A 2ELAA 2J0MA 4HB2B 3PVUA 2DKPA 1WJMA 2WH5A 1MIXA 2I1JA 2EC1A 2FJ9A 3PZDA 1GG3A 4HAUB 1ZSQA 4K17A 2M14A 1P5TA 5JHHA 1BTKA 4TKNA 4A6KA 2X18A 4KAXB 2W2XD 3A8QA 4Y94A 2I5CA 1K5DB 2D9YA 4Z2MB 1U5DA 5CLQB 3UZTA 4P7IA 2P8VA 1HB8A 2M38A 2CB8A 1X1GA 2YSZA 5KQ1A 4K2OA 1FOEA 1M7EA 3AU5A 2J0JA 4YL8A 3T06A 2RLOA 1W1GA 1FB8A 4H8SA 4ZRIA 1XKEA 3PVLA 3QBVB 1I2HA 1W1HA 4GMVA 1H4RA 2VSZA 5J3YA 3ODOA 3FP5A 2IFSA 2KGXB 4HAZB 1U29A 1P6SA 3VIAA 2ABDA 1MPHA 2H7EA 1NTVA 2COCA 2COPA 2P0DA 4L6EA 1J0WA 4WJ7A 2QKLA 2DLWA 4MY6A 1XCGA 3ULCA 1KZ7A 3DXCA 2J0KA 2D9WA 3N7CA 1OY2A 2YS3A 1U5FA 1K5GB 2CY5A 4MK0A 2DN6A 1DDWA 4HATB 5GOWB 2CY4A 2OQBA 3MPXA 5FI1A 1QC6A 3DXEA 4HDQA 2EMTA 3NSUA 1UEFA 2ROZB 2QKMA 2YS1A 2HTHB 5D3VA 2W2WA 2COAA 1DYNA 1X05A 2YVCA 3KRXA 1ACAA 4DBBA 4F7HA 2D10A 2GCJA 3EPYA 3SUZA 3SNHA 2NZ8B 3SO6A 1WG7A 3SV1A 1FHWA 2GS0A 1WI1A 4BBKA 4KHOA 2D9VA 3TCAA 1AQCA 1MK7B 1M7RA 2Z0OA 3QIJA 1NVLA 3GYOA 3HK0A 3RCPA 2MWNB 5HE3A 2AEHA 4D0NB 1U5EA 5HE1A 2GJYA 3A8PA 1V5PA 2ADZA 3ZVRA 2D9ZA 1TXDA 1J19A 1V61A 1Q67A 2Y7BA 3CIKA 5EFXA 2RVBB 2ZPYA 2I1KA 5DIFB 1NI2A 4NY0A 1ST7A 4IAPA 1U2BA 1DDMA 3MDBC 3WYFB 3TW1A 2DA0A 3TVVA 1NTIA 5JLJB 3U7DA 1FHOA 1XD4A 5DI9B 1AWEA 5D3YA 3F0WA 4A5KA 2RQ1A 2COFA 4PNKA 3P7ZA 2UVMA 2FJLA 3PEGA 5DH9B 5D3XA 2OTXA 4HAXB 3OANA 4HAWB 1FGYA 4KVGB 2YF0A 1FAOA 3CXBB 2GCLA 1RJ2A 2Q13A 2CQUA 2UZRA 1V5MA 2EMSA 5KQ4A 2LOXA 4DX90 2DX1A 2L2IA 3A98B 2VKIA 2P0FA 4XWXA 2LYDA 1DBHA 1GC7A 2Y8GA 4A6HA 1EAZA 2YT0A 4C0AA 2E2XA 1TJ6A 1PLSA 2R09A 2R0DA 2RSGA 4Z2NA 5C16A 3ML4A 1ZC3B 1PFJA 5DHAB 2HE7A 4WVFB 2BCJA 1MK9B 1TQZA 5C5BA 4CHMA 1HBKA 5C5BB 4HDOA 3O96A 2DYNA 5LONB 3TFMA 3D8FA 1WGQA 4EMOA 1Y5OA 2EJ8A 3PG7A 1P3RA 4HAVB 2RUKB 4HB3B 1NU2A 1EF1A 1W1DA 4GMXB 3KRWA 4B6HA 1I7AA 1OMWA 1V5UA 2N23A 3PSCA 2Z0PA 5J3TA 4EKUA 1BAKA 1GC6A 4EJNA 2DFKA 2RNRB 2UZSA 2K2UA 3KZ1A 4A6FA 1FGZA 2HRJA 2KUPA 2MKRA 4A6FB 2V76A 2DHKA 1KI1B 3FEHA 3ULBA 2D9XA 5HE2A 3FM8C 5C79A 2W2XC 1BTNA 2J59M 1PMSA 3ODWA 5JHGA 3HW2B 2YT1A 2MFQA 3KY9A 5D3WA 1OQNA 1UPRA 4CYEA 1FHXA 1WGUA 4GZUA 1SHCA 3BJIA 3M1IB 4PQ0A 1B55A 2JP2A 1KZGA 3SYXA 1EVHA 3QWMA 5KCVA 2FDQA 1UPQA 5J3QA 1WJ1A 5C6RA 1X86A 3BINA 1XODA 2RGNB 3VOQA 3FLVA 1WVHA 1DDVA 3AU4A 3D8DA 2VRWB 2I5FA 4IOYX 4WSFA 3X23A 2LULA 2DYQA 4HHVA 1EGXA 3F5RA 4NSWA 5DHFB 2DTCA 2NMBA 2G35A 1UNPA 2IYBA 4GN1A 1Y19B 3AJ4A 2DHJA 4YONA 2LBBA 1UNRA 4F7UP 1RRPB 1ZVRA 1BWNA 4DX8A 5D27A 2K00A 2K2JA 4KHAA 3HQCA 3PP2A 2LOZA 1V88A 4DXAB 1MKEA 4K2PA 2DHIA 2DKQA 1H10A 3PVWA 3P6AA 2KCJA 4KHBB 2PZ1A 5L81A 1N3HA 2ELBA 5LOPB 4F7GA 4ZRKA 3LJUX 4GPTB 2YRYA 2MDXA 2CODA 3KSYA 2D11A 4ZRJA 3GYPA 1XX0A 5IJMA 1U5GA 4CHJA 3IVFA 1X1FA 2D2QA 3WA0A 2N0YA 3U8ZA 5CLLB 4HAYB 2YS5A 1MAIA 5HE0A 2LG1A 3FSSA 3D8EA 5JP4A 4GXBA 3G9WA 1LB1A 2H7DA 1NTYA 1MIZB 1ZM0A 2DX5A 3ODXA 1XR0B 3ZDTA 1IRSA 4MT7A 1UNQA 3V5WA 4HB4B 2LKOA 2CRFA 2AL6A 2Z0QA 4K81A 2CAYA 2L1CA 2Y8FA 1E5WA 4IFSA 1ISNA 1LW3A 3DXDA 1U27A 1X11A 4HB0B
chains in the Genus database with same CATH superfamily
3TO1A 4ILHA 1Z87A 2P0HA 2ROVA 1QQGA 2XQNM 2D4QA 1DROA 1ZC4B 1V89A 1HB6A 1SGHA 4TYZA 5FI0A 2ELAA 2J0MA 4HB2B 3PVUA 2DKPA 1WJMA 2WH5A 3B77A 1MIXA 2I1JA 2EC1A 2FJ9A 3PZDA 1GG3A 4HAUB 1ZSQA 4K17A 3SBGA 2M14A 1P5TA 3DCXA 5JHHA 1BTKA 4TKNA 4A6KA 2X18A 4KAXB 2W2XD 3A8QA 4GOUA 4Y94A 2I5CA 1K5DB 2D9YA 3E9LA 4Z2MB 1U5DA 5CLQB 3UZTA 4P7IA 2P8VA 1HB8A 2M38A 2CB8A 1X1GA 2NBVA 2YSZA 4K2OA 5KQ1A 4JK8A 1FOEA 3NWAA 1M7EA 3AU5A 2J0JA 4YL8A 3T06A 2RLOA 1W1GA 1FB8A 2R2YA 4H8SA 4ZRIA 1XKEA 2KR0A 3PVLA 2Z4DA 3QBVB 4JKAA 1I2HA 1W1HA 4GMVA 1H4RA 2VSZA 3NWDA 5J3YA 3ODOA 3FP5A 2IFSA 2KGXB 4HAZB 1U29A 1P6SA 2X0SA 3VIAA 2ABDA 1MPHA 2H7EA 1NTVA 2COCA 4QJ4B 2COPA 2P0DA 4L6EA 2RRFA 1J0WA 4WJ7A 2QKLA 2DLWA 4MY6A 1XCGA 3ULCA 1KZ7A 3DXCA 2J0KA 1ZYIA 2D9WA 1OY2A 3N7CA 2YS3A 1U5FA 2KIEA 1K5GB 2CY5A 4MK0A 2DN6A 1DDWA 4HATB 5GOWB 2CY4A 2OQBA 3MPXA 5FI1A 1QC6A 3DXEA 4HDQA 2EMTA 3NSUA 1UEFA 2ROZB 2QKMA 2YS1A 1T77A 2HTHB 5D3VA 2W2WA 2COAA 1DYNA 1X05A 2YVCA 3FVCA 4JKGB 3KRXA 1VBGA 1ACAA 3E66A 4DBBA 4F7HA 3E9PA 2D10A 2K49A 1DIKA 2GCJA 3EPYA 3SUZA 3SNHA 2NZ8B 3SO6A 1WG7A 4QXAB 1JDEA 2GUMA 3SV1A 1FHWA 2GS0A 1WI1A 4BBKA 4KHOA 2D9VA 3TCAA 1AQCA 1MK7B 1M7RA 2Z0OA 3QIJA 1NVLA 3GYOA 3HK0A 3RCPA 2MWNB 5HE3A 2AEHA 4D0NB 1U5EA 5HE1A 2GJYA 3A8PA 1V5PA 2ADZA 3SBTA 3ZVRA 2D9ZA 1TXDA 4JKCA 1J19A 1V61A 1Q67A 2Y7BA 3CIKA 5EFXA 5IRSA 2RVBB 2ZPYA 2I1KA 5DIFB 1NI2A 4NY0A 1ST7A 4IAPA 1U2BA 1DDMA 3MDBC 3WYFB 3TW1A 2DA0A 3TVVA 1NTIA 5JLJB 2KIGA 3U7DA 2Z59A 1XD4A 1FHOA 2Z13A 5DI9B 1AWEA 5D3YA 3F0WA 4L1RA 4A5KA 4OT1A 2RQ1A 2COFA 4PNKA 3P7ZA 2UVMA 2FJLA 4JKHA 4JKEA 3PEGA 5DH9B 5D3XA 2OTXA 4HAXB 3OANA 4HAWB 1FGYA 4KVGB 2YF0A 1FAOA 3CXBB 4CSQA 2GCLA 1RJ2A 2Q13A 2CQUA 5JVLA 2UZRA 1V5MA 2EMSA 5KQ4A 1GGOA 2LOXA 4DX90 2DX1A 4JKFA 2L2IA 3A98B 2VKIA 2P0FA 4JKDA 4XWXA 2LYDA 1DBHA 4HSIA 1GC7A 2Y8GA 4A6HA 1EAZA 2YT0A 4C0AA 4JK7A 2E2XA 1TJ6A 2Z14A 1PLSA 2R09A 2R0DA 2RSGA 4Z2NA 5C16A 3ML4A 1ZC3B 1PFJA 5DHAB 2HE7A 4WVFB 2DIKA 2BCJA 1MK9B 1TQZA 5C5BA 2FJUB 4CHMA 1HBKA 5C5BB 4HDOA 4ILGB 3O96A 2DYNA 5LONB 3TFMA 3D8FA 1WGQA 4EMOA 1Y5OA 2EJ8A 3PG7A 3E9OA 1P3RA 4HAVB 4JKGA 2RUKB 4HB3B 3OHMB 1NU2A 1EF1A 1W1DA 4GMXB 3KRWA 4B6HA 1I7AA 1OMWA 1V5UA 2N23A 5I2SA 3PSCA 2Z0PA 5J3TA 4EKUA 4GNKB 1BAKA 1VBHA 1GC6A 4EJNA 2DFKA 2RNRB 5I2MA 2UZSA 2K2UA 3KZ1A 4A6FA 1FGZA 2HRJA 2KUPA 2MKRA 4A6FB 2V76A 3HIEA 2DHKA 1KI1B 3FEHA 3ULBA 2D9XA 4ILJA 5HE2A 5LG4B 3FM8C 5C79A 2W2XC 1BTNA 2J59M 3U12A 1PMSA 3ODWA 5JHGA 3HW2B 2YT1A 2MFQA 3KY9A 5D3WA 2KUQA 1OQNA 1UPRA 4CYEA 1FHXA 1WGUA 4QJ5B 4GZUA 1SHCA 3BJIA 3M1IB 4PQ0A 1B55A 2JP2A 1KZGA 3SYXA 1EVHA 3QWMA 5KCVA 2FDQA 1UPQA 3ENBA 5J3QA 1WJ1A 5C6RA 1X86A 3BINA 1XODA 2RGNB 3VOQA 3FLVA 1WVHA 4D6WA 4JK9A 2ZKMX 1DDVA 3AU4A 3D8DA 2VRWB 2I5FA 4IOYX 1MI1A 4WSFA 3X23A 2LULA 2DYQA 4HHVA 1EGXA 3F5RA 4NSWA 5DHFB 2DTCA 2NMBA 2G35A 1UNPA 2IYBA 4GN1A 4JKBA 1Y19B 3NW8A 3AJ4A 2DHJA 4YONA 2LBBA 1UNRA 1KC7A 4F7UP 1RRPB 3NWFA 4DIXA 1ZVRA 1BWNA 4DX8A 5D27A 2K00A 2K2JA 4KHAA 3HQCA 3PP2A 2YT2A 2LOZA 1V88A 4DXAB 1MKEA 4K2PA 1KBLA 2DHIA 2R82A 4KHBA 2DKQA 3A58A 1H10A 3PVWA 3P6AA 2KCJA 4KHBB 2PZ1A 5L81A 1N3HA 3HSAA 2ELBA 5LOPB 4F7GA 4ZRKA 3LJUX 4GPTB 2YRYA 2MDXA 4OSNA 2CODA 3KSYA 2D11A 4ZRJA 3GYPA 1XX0A 5IJMA 1U5GA 4CHJA 3IVFA 1X1FA 2D2QA 3WA0A 2N0YA 3U8ZA 5CLLB 4HAYB 2YS5A 1MAIA 5HE0A 2LG1A 3FSSA 3D8EA 5JP4A 4GXBA 3G9WA 1LB1A 2H7DA 1NTYA 1MIZB 1ZM0A 2DX5A 3ODXA 1XR0B 3ZDTA 1IRSA 4MT7A 1UNQA 3V5WA 5M4YB 4HB4B 2LKOA 2CRFA 2AL6A 2Z0QA 4QJ3B 4K81A 2K8EA 2CAYA 2L1CA 2Y8FA 1E5WA 4IFSA 1ISNA 1LW3A 3DXDA 1U27A 1X11A 4HB0B
chains in the Genus database with same CATH topology
3TO1A 4ILHA 1Z87A 2P0HA 2ROVA 1QQGA 2XQNM 2D4QA 1DROA 1ZC4B 1V89A 1HB6A 1SGHA 4TYZA 5FI0A 2ELAA 2J0MA 4HB2B 3PVUA 2DKPA 1WJMA 2WH5A 1MIXA 2I1JA 2EC1A 2FJ9A 3PZDA 1GG3A 4HAUB 1ZSQA 4K17A 3SBGA 2M14A 1P5TA 5JHHA 1BTKA 4TKNA 4A6KA 2X18A 4KAXB 2W2XD 3A8QA 4Y94A 2I5CA 1K5DB 2D9YA 3E9LA 4Z2MB 1U5DA 5CLQB 3UZTA 4P7IA 2P8VA 1HB8A 2M38A 2CB8A 1X1GA 2YSZA 5KQ1A 4K2OA 4JK8A 1FOEA 1M7EA 3AU5A 2J0JA 4YL8A 3T06A 2RLOA 1W1GA 1FB8A 4H8SA 4ZRIA 1XKEA 3PVLA 3QBVB 4JKAA 1I2HA 1W1HA 4GMVA 1H4RA 2VSZA 5J3YA 3ODOA 3FP5A 2IFSA 2KGXB 4HAZB 1U29A 1P6SA 2X0SA 3VIAA 2ABDA 1MPHA 2H7EA 1NTVA 2COCA 2COPA 2P0DA 4L6EA 1J0WA 4WJ7A 2QKLA 2DLWA 4MY6A 1XCGA 3ULCA 1KZ7A 3DXCA 2J0KA 2D9WA 3N7CA 1OY2A 2YS3A 1U5FA 1K5GB 2CY5A 4MK0A 2DN6A 1DDWA 4HATB 5GOWB 2CY4A 2OQBA 3MPXA 5FI1A 1QC6A 3DXEA 4HDQA 2EMTA 3NSUA 1UEFA 2ROZB 2QKMA 2YS1A 2HTHB 5D3VA 2W2WA 2COAA 1DYNA 1X05A 2YVCA 4JKGB 3KRXA 1VBGA 1ACAA 3E66A 4DBBA 4F7HA 3E9PA 2D10A 1DIKA 2GCJA 3EPYA 3SUZA 3SNHA 2NZ8B 3SO6A 1WG7A 1JDEA 3SV1A 1FHWA 2GS0A 1WI1A 4BBKA 4KHOA 2D9VA 3TCAA 1AQCA 1MK7B 1M7RA 2Z0OA 3QIJA 1NVLA 3GYOA 3HK0A 3RCPA 2MWNB 5HE3A 2AEHA 4D0NB 1U5EA 5HE1A 2GJYA 3A8PA 1V5PA 2ADZA 3SBTA 3ZVRA 2D9ZA 1TXDA 4JKCA 1J19A 1V61A 1Q67A 2Y7BA 3CIKA 5EFXA 2RVBB 2ZPYA 2I1KA 5DIFB 1NI2A 4NY0A 1ST7A 4IAPA 1U2BA 1DDMA 3MDBC 3WYFB 3TW1A 2DA0A 3TVVA 1NTIA 5JLJB 3U7DA 1FHOA 1XD4A 5DI9B 1AWEA 5D3YA 3F0WA 4A5KA 2RQ1A 2COFA 4PNKA 3P7ZA 2UVMA 2FJLA 4JKHA 4JKEA 3PEGA 5DH9B 5D3XA 2OTXA 4HAXB 3OANA 4HAWB 1FGYA 4KVGB 2YF0A 1FAOA 3CXBB 2GCLA 1RJ2A 2Q13A 2CQUA 5JVLA 2UZRA 1V5MA 2EMSA 5KQ4A 1GGOA 2LOXA 4DX90 2DX1A 4JKFA 2L2IA 3A98B 2VKIA 2P0FA 4JKDA 4XWXA 2LYDA 1DBHA 1GC7A 2Y8GA 4A6HA 1EAZA 2YT0A 4C0AA 4JK7A 2E2XA 1TJ6A 1PLSA 2R09A 2R0DA 2RSGA 4Z2NA 5C16A 3ML4A 1ZC3B 1PFJA 5DHAB 2HE7A 4WVFB 2DIKA 2BCJA 1MK9B 1TQZA 5C5BA 4CHMA 1HBKA 5C5BB 4HDOA 4ILGB 3O96A 2DYNA 5LONB 3TFMA 3D8FA 1WGQA 4EMOA 1Y5OA 2EJ8A 3PG7A 3E9OA 1P3RA 4HAVB 4JKGA 2RUKB 4HB3B 1NU2A 1EF1A 1W1DA 4GMXB 3KRWA 4B6HA 1I7AA 1OMWA 1V5UA 2N23A 3PSCA 2Z0PA 5J3TA 4EKUA 1BAKA 1VBHA 1GC6A 4EJNA 2DFKA 2RNRB 2UZSA 2K2UA 3KZ1A 4A6FA 1FGZA 2HRJA 2KUPA 2MKRA 4A6FB 2V76A 2DHKA 1KI1B 3FEHA 3ULBA 2D9XA 4ILJA 5HE2A 3FM8C 5C79A 2W2XC 1BTNA 2J59M 1PMSA 3ODWA 5JHGA 3HW2B 2YT1A 2MFQA 3KY9A 5D3WA 1OQNA 1UPRA 4CYEA 1FHXA 1WGUA 4GZUA 1SHCA 3BJIA 3M1IB 4PQ0A 1B55A 2JP2A 1KZGA 3SYXA 1EVHA 3QWMA 5KCVA 2FDQA 1UPQA 3ENBA 5J3QA 1WJ1A 5C6RA 1X86A 3BINA 1XODA 2RGNB 3VOQA 3FLVA 1WVHA 4JK9A 1DDVA 3AU4A 3D8DA 2VRWB 2I5FA 4IOYX 4WSFA 3X23A 2LULA 2DYQA 4HHVA 1EGXA 3F5RA 4NSWA 5DHFB 2DTCA 2NMBA 2G35A 1UNPA 2IYBA 4GN1A 4JKBA 1Y19B 3AJ4A 2DHJA 4YONA 2LBBA 1UNRA 1KC7A 4F7UP 1RRPB 1ZVRA 1BWNA 4DX8A 5D27A 2K00A 2K2JA 4KHAA 3HQCA 3PP2A 2LOZA 1V88A 4DXAB 1MKEA 4K2PA 1KBLA 2DHIA 2R82A 2DKQA 1H10A 3PVWA 3P6AA 2KCJA 4KHBB 2PZ1A 5L81A 1N3HA 2ELBA 5LOPB 4F7GA 4ZRKA 3LJUX 4GPTB 2YRYA 2MDXA 2CODA 3KSYA 2D11A 4ZRJA 3GYPA 1XX0A 5IJMA 1U5GA 4CHJA 3IVFA 1X1FA 2D2QA 3WA0A 2N0YA 3U8ZA 5CLLB 4HAYB 2YS5A 1MAIA 5HE0A 2LG1A 3FSSA 3D8EA 5JP4A 4GXBA 3G9WA 1LB1A 2H7DA 1NTYA 1MIZB 1ZM0A 2DX5A 3ODXA 1XR0B 3ZDTA 1IRSA 4MT7A 1UNQA 3V5WA 4HB4B 2LKOA 2CRFA 2AL6A 2Z0QA 4K81A 2CAYA 2L1CA 2Y8FA 1E5WA 4IFSA 1ISNA 1LW3A 3DXDA 1U27A 1X11A 4HB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO1 A;  1Z87 A;  2P0H A;  2ROV A;  1QQG A;  2XQN M;  2D4Q A;  1DRO A;  1ZC4 B;  1V89 A;  1HB6 A;  1SGH A;  4TYZ A;  5FI0 A;  2ELA A;  2J0M A;  4HB2 B;  3PVU A;  2DKP A;  1WJM A;  2WH5 A;  1MIX A;  2I1J A;  2EC1 A;  2FJ9 A;  3PZD A;  1GG3 A;  4HAU B;  1ZSQ A;  4K17 A;  2M14 A;  1P5T A;  5JHH A;  1BTK A;  4TKN A;  4A6K A;  2X18 A;  4KAX B;  2W2X D;  3A8Q A;  4Y94 A;  2I5C A;  1K5D B;  2D9Y A;  4Z2M B;  1U5D A;  5CLQ B;  3UZT A;  4P7I A;  2P8V A;  1HB8 A;  2M38 A;  2CB8 A;  1X1G A;  2YSZ A;  5KQ1 A;  4K2O A;  1FOE A;  1M7E A;  3AU5 A;  2J0J A;  4YL8 A;  3T06 A;  2RLO A;  1W1G A;  1FB8 A;  4H8S A;  4ZRI A;  1XKE A;  3PVL A;  3QBV B;  1I2H A;  1W1H A;  4GMV A;  1H4R A;  2VSZ A;  5J3Y A;  3ODO A;  3FP5 A;  2IFS A;  2KGX B;  4HAZ B;  1U29 A;  1P6S A;  3VIA A;  2ABD A;  1MPH A;  2H7E A;  1NTV A;  2COC A;  2COP A;  2P0D A;  4L6E A;  1J0W A;  4WJ7 A;  2QKL A;  2DLW A;  4MY6 A;  1XCG A;  3ULC A;  1KZ7 A;  3DXC A;  2J0K A;  2D9W A;  3N7C A;  1OY2 A;  2YS3 A;  1U5F A;  1K5G B;  2CY5 A;  4MK0 A;  2DN6 A;  1DDW A;  4HAT B;  5GOW B;  2CY4 A;  2OQB A;  3MPX A;  5FI1 A;  1QC6 A;  3DXE A;  4HDQ A;  2EMT A;  3NSU A;  1UEF A;  2ROZ B;  2QKM A;  2YS1 A;  2HTH B;  5D3V A;  2W2W A;  2COA A;  1DYN A;  1X05 A;  2YVC A;  3KRX A;  1ACA A;  4DBB A;  4F7H A;  2D10 A;  2GCJ A;  3EPY A;  3SUZ A;  3SNH A;  2NZ8 B;  3SO6 A;  1WG7 A;  3SV1 A;  1FHW A;  2GS0 A;  1WI1 A;  4BBK A;  4KHO A;  2D9V A;  3TCA A;  1AQC A;  1MK7 B;  1M7R A;  2Z0O A;  3QIJ A;  1NVL A;  3GYO A;  3HK0 A;  3RCP A;  2MWN B;  5HE3 A;  2AEH A;  4D0N B;  1U5E A;  5HE1 A;  2GJY A;  3A8P A;  1V5P A;  2ADZ A;  3ZVR A;  2D9Z A;  1TXD A;  1J19 A;  1V61 A;  1Q67 A;  2Y7B A;  3CIK A;  5EFX A;  2RVB B;  2ZPY A;  2I1K A;  5DIF B;  1NI2 A;  4NY0 A;  1ST7 A;  4IAP A;  1U2B A;  1DDM A;  3MDB C;  3WYF B;  3TW1 A;  2DA0 A;  3TVV A;  1NTI A;  5JLJ B;  3U7D A;  1FHO A;  1XD4 A;  5DI9 B;  1AWE A;  5D3Y A;  3F0W A;  4A5K A;  2RQ1 A;  2COF A;  4PNK A;  3P7Z A;  2UVM A;  2FJL A;  3PEG A;  5DH9 B;  5D3X A;  2OTX A;  4HAX B;  3OAN A;  4HAW B;  1FGY A;  4KVG B;  2YF0 A;  1FAO A;  3CXB B;  2GCL A;  1RJ2 A;  2Q13 A;  2CQU A;  2UZR A;  1V5M A;  2EMS A;  5KQ4 A;  2LOX A;  4DX9 0;  2DX1 A;  2L2I A;  3A98 B;  2VKI A;  2P0F A;  4XWX A;  2LYD A;  1DBH A;  1GC7 A;  2Y8G A;  4A6H A;  1EAZ A;  2YT0 A;  4C0A A;  2E2X A;  1TJ6 A;  1PLS A;  2R09 A;  2R0D A;  2RSG A;  4Z2N A;  5C16 A;  3ML4 A;  1ZC3 B;  1PFJ A;  5DHA B;  2HE7 A;  4WVF B;  2BCJ A;  1MK9 B;  1TQZ A;  5C5B A;  4CHM A;  1HBK A;  5C5B B;  4HDO A;  3O96 A;  2DYN A;  5LON B;  3TFM A;  3D8F A;  1WGQ A;  4EMO A;  1Y5O A;  2EJ8 A;  3PG7 A;  1P3R A;  4HAV B;  2RUK B;  4HB3 B;  1NU2 A;  1EF1 A;  1W1D A;  4GMX B;  3KRW A;  4B6H A;  1I7A A;  1OMW A;  1V5U A;  2N23 A;  3PSC A;  2Z0P A;  5J3T A;  4EKU A;  1BAK A;  1GC6 A;  4EJN A;  2DFK A;  2RNR B;  2UZS A;  2K2U A;  3KZ1 A;  4A6F A;  1FGZ A;  2HRJ A;  2KUP A;  2MKR A;  4A6F B;  2V76 A;  2DHK A;  1KI1 B;  3FEH A;  3ULB A;  2D9X A;  5HE2 A;  3FM8 C;  5C79 A;  2W2X C;  1BTN A;  2J59 M;  1PMS A;  3ODW A;  5JHG A;  3HW2 B;  2YT1 A;  2MFQ A;  3KY9 A;  5D3W A;  1OQN A;  1UPR A;  4CYE A;  1FHX A;  1WGU A;  4GZU A;  1SHC A;  3BJI A;  3M1I B;  4PQ0 A;  1B55 A;  2JP2 A;  1KZG A;  3SYX A;  1EVH A;  3QWM A;  5KCV A;  2FDQ A;  1UPQ A;  5J3Q A;  1WJ1 A;  5C6R A;  1X86 A;  3BIN A;  1XOD A;  2RGN B;  3VOQ A;  3FLV A;  1WVH A;  1DDV A;  3AU4 A;  3D8D A;  2VRW B;  2I5F A;  4IOY X;  4WSF A;  3X23 A;  2LUL A;  2DYQ A;  4HHV A;  1EGX A;  3F5R A;  4NSW A;  5DHF B;  2DTC A;  2NMB A;  2G35 A;  1UNP A;  2IYB A;  4GN1 A;  1Y19 B;  3AJ4 A;  2DHJ A;  4YON A;  2LBB A;  1UNR A;  4F7U P;  1RRP B;  1ZVR A;  1BWN A;  4DX8 A;  5D27 A;  2K00 A;  2K2J A;  4KHA A;  3HQC A;  3PP2 A;  2LOZ A;  1V88 A;  4DXA B;  1MKE A;  4K2P A;  2DHI A;  2DKQ A;  1H10 A;  3PVW A;  3P6A A;  2KCJ A;  4KHB B;  2PZ1 A;  5L81 A;  1N3H A;  2ELB A;  5LOP B;  4F7G A;  4ZRK A;  3LJU X;  4GPT B;  2YRY A;  2MDX A;  2COD A;  3KSY A;  2D11 A;  4ZRJ A;  3GYP A;  1XX0 A;  5IJM A;  1U5G A;  4CHJ A;  3IVF A;  1X1F A;  2D2Q A;  3WA0 A;  2N0Y A;  3U8Z A;  5CLL B;  4HAY B;  2YS5 A;  1MAI A;  5HE0 A;  2LG1 A;  3FSS A;  3D8E A;  5JP4 A;  4GXB A;  3G9W A;  1LB1 A;  2H7D A;  1NTY A;  1MIZ B;  1ZM0 A;  2DX5 A;  3ODX A;  1XR0 B;  3ZDT A;  1IRS A;  4MT7 A;  1UNQ A;  3V5W A;  4HB4 B;  2LKO A;  2CRF A;  2AL6 A;  2Z0Q A;  4K81 A;  2CAY A;  2L1C A;  2Y8F A;  1E5W A;  4IFS A;  1ISN A;  1LW3 A;  3DXD A;  1U27 A;  1X11 A;  4HB0 B; 
#chains in the Genus database with same CATH topology
 3TO1 A;  4ILH A;  1Z87 A;  2P0H A;  2ROV A;  1QQG A;  2XQN M;  2D4Q A;  1DRO A;  1ZC4 B;  1V89 A;  1HB6 A;  1SGH A;  4TYZ A;  5FI0 A;  2ELA A;  2J0M A;  4HB2 B;  3PVU A;  2DKP A;  1WJM A;  2WH5 A;  3B77 A;  1MIX A;  2I1J A;  2EC1 A;  2FJ9 A;  3PZD A;  1GG3 A;  4HAU B;  1ZSQ A;  4K17 A;  3SBG A;  2M14 A;  1P5T A;  3DCX A;  5JHH A;  1BTK A;  4TKN A;  4A6K A;  2X18 A;  4KAX B;  2W2X D;  3A8Q A;  4GOU A;  4Y94 A;  2I5C A;  1K5D B;  2D9Y A;  3E9L A;  4Z2M B;  1U5D A;  5CLQ B;  3UZT A;  4P7I A;  2P8V A;  1HB8 A;  2M38 A;  2CB8 A;  1X1G A;  2NBV A;  2YSZ A;  4K2O A;  5KQ1 A;  4JK8 A;  1FOE A;  3NWA A;  1M7E A;  3AU5 A;  2J0J A;  4YL8 A;  3T06 A;  2RLO A;  1W1G A;  1FB8 A;  2R2Y A;  4H8S A;  4ZRI A;  1XKE A;  2KR0 A;  3PVL A;  2Z4D A;  3QBV B;  4JKA A;  1I2H A;  1W1H A;  4GMV A;  1H4R A;  2VSZ A;  3NWD A;  5J3Y A;  3ODO A;  3FP5 A;  2IFS A;  2KGX B;  4HAZ B;  1U29 A;  1P6S A;  2X0S A;  3VIA A;  2ABD A;  1MPH A;  2H7E A;  1NTV A;  2COC A;  4QJ4 B;  2COP A;  2P0D A;  4L6E A;  2RRF A;  1J0W A;  4WJ7 A;  2QKL A;  2DLW A;  4MY6 A;  1XCG A;  3ULC A;  1KZ7 A;  3DXC A;  2J0K A;  1ZYI A;  2D9W A;  1OY2 A;  3N7C A;  2YS3 A;  1U5F A;  2KIE A;  1K5G B;  2CY5 A;  4MK0 A;  2DN6 A;  1DDW A;  4HAT B;  5GOW B;  2CY4 A;  2OQB A;  3MPX A;  5FI1 A;  1QC6 A;  3DXE A;  4HDQ A;  2EMT A;  3NSU A;  1UEF A;  2ROZ B;  2QKM A;  2YS1 A;  1T77 A;  2HTH B;  5D3V A;  2W2W A;  2COA A;  1DYN A;  1X05 A;  2YVC A;  3FVC A;  4JKG B;  3KRX A;  1VBG A;  1ACA A;  3E66 A;  4DBB A;  4F7H A;  3E9P A;  2D10 A;  2K49 A;  1DIK A;  2GCJ A;  3EPY A;  3SUZ A;  3SNH A;  2NZ8 B;  3SO6 A;  1WG7 A;  4QXA B;  1JDE A;  2GUM A;  3SV1 A;  1FHW A;  2GS0 A;  1WI1 A;  4BBK A;  4KHO A;  2D9V A;  3TCA A;  1AQC A;  1MK7 B;  1M7R A;  2Z0O A;  3QIJ A;  1NVL A;  3GYO A;  3HK0 A;  3RCP A;  2MWN B;  5HE3 A;  2AEH A;  4D0N B;  1U5E A;  5HE1 A;  2GJY A;  3A8P A;  1V5P A;  2ADZ A;  3SBT A;  3ZVR A;  2D9Z A;  1TXD A;  4JKC A;  1J19 A;  1V61 A;  1Q67 A;  2Y7B A;  3CIK A;  5EFX A;  5IRS A;  2RVB B;  2ZPY A;  2I1K A;  5DIF B;  1NI2 A;  4NY0 A;  1ST7 A;  4IAP A;  1U2B A;  1DDM A;  3MDB C;  3WYF B;  3TW1 A;  2DA0 A;  3TVV A;  1NTI A;  5JLJ B;  2KIG A;  3U7D A;  2Z59 A;  1XD4 A;  1FHO A;  2Z13 A;  5DI9 B;  1AWE A;  5D3Y A;  3F0W A;  4L1R A;  4A5K A;  4OT1 A;  2RQ1 A;  2COF A;  4PNK A;  3P7Z A;  2UVM A;  2FJL A;  4JKH A;  4JKE A;  3PEG A;  5DH9 B;  5D3X A;  2OTX A;  4HAX B;  3OAN A;  4HAW B;  1FGY A;  4KVG B;  2YF0 A;  1FAO A;  3CXB B;  4CSQ A;  2GCL A;  1RJ2 A;  2Q13 A;  2CQU A;  5JVL A;  2UZR A;  1V5M A;  2EMS A;  5KQ4 A;  1GGO A;  2LOX A;  4DX9 0;  2DX1 A;  4JKF A;  2L2I A;  3A98 B;  2VKI A;  2P0F A;  4JKD A;  4XWX A;  2LYD A;  1DBH A;  4HSI A;  1GC7 A;  2Y8G A;  4A6H A;  1EAZ A;  2YT0 A;  4C0A A;  4JK7 A;  2E2X A;  1TJ6 A;  2Z14 A;  1PLS A;  2R09 A;  2R0D A;  2RSG A;  4Z2N A;  5C16 A;  3ML4 A;  1ZC3 B;  1PFJ A;  5DHA B;  2HE7 A;  4WVF B;  2DIK A;  2BCJ A;  1MK9 B;  1TQZ A;  5C5B A;  2FJU B;  4CHM A;  1HBK A;  5C5B B;  4HDO A;  4ILG B;  3O96 A;  2DYN A;  5LON B;  3TFM A;  3D8F A;  1WGQ A;  4EMO A;  1Y5O A;  2EJ8 A;  3PG7 A;  3E9O A;  1P3R A;  4HAV B;  4JKG A;  2RUK B;  4HB3 B;  3OHM B;  1NU2 A;  1EF1 A;  1W1D A;  4GMX B;  3KRW A;  4B6H A;  1I7A A;  1OMW A;  1V5U A;  2N23 A;  5I2S A;  3PSC A;  2Z0P A;  5J3T A;  4EKU A;  4GNK B;  1BAK A;  1VBH A;  1GC6 A;  4EJN A;  2DFK A;  2RNR B;  5I2M A;  2UZS A;  2K2U A;  3KZ1 A;  4A6F A;  1FGZ A;  2HRJ A;  2KUP A;  2MKR A;  4A6F B;  2V76 A;  3HIE A;  2DHK A;  1KI1 B;  3FEH A;  3ULB A;  2D9X A;  4ILJ A;  5HE2 A;  5LG4 B;  3FM8 C;  5C79 A;  2W2X C;  1BTN A;  2J59 M;  3U12 A;  1PMS A;  3ODW A;  5JHG A;  3HW2 B;  2YT1 A;  2MFQ A;  3KY9 A;  5D3W A;  2KUQ A;  1OQN A;  1UPR A;  4CYE A;  1FHX A;  1WGU A;  4QJ5 B;  4GZU A;  1SHC A;  3BJI A;  3M1I B;  4PQ0 A;  1B55 A;  2JP2 A;  1KZG A;  3SYX A;  1EVH A;  3QWM A;  5KCV A;  2FDQ A;  1UPQ A;  3ENB A;  5J3Q A;  1WJ1 A;  5C6R A;  1X86 A;  3BIN A;  1XOD A;  2RGN B;  3VOQ A;  3FLV A;  1WVH A;  4D6W A;  4JK9 A;  2ZKM X;  1DDV A;  3AU4 A;  3D8D A;  2VRW B;  2I5F A;  4IOY X;  1MI1 A;  4WSF A;  3X23 A;  2LUL A;  2DYQ A;  4HHV A;  1EGX A;  3F5R A;  4NSW A;  5DHF B;  2DTC A;  2NMB A;  2G35 A;  1UNP A;  2IYB A;  4GN1 A;  4JKB A;  1Y19 B;  3NW8 A;  3AJ4 A;  2DHJ A;  4YON A;  2LBB A;  1UNR A;  1KC7 A;  4F7U P;  1RRP B;  3NWF A;  4DIX A;  1ZVR A;  1BWN A;  4DX8 A;  5D27 A;  2K00 A;  2K2J A;  4KHA A;  3HQC A;  3PP2 A;  2YT2 A;  2LOZ A;  1V88 A;  4DXA B;  1MKE A;  4K2P A;  1KBL A;  2DHI A;  2R82 A;  4KHB A;  2DKQ A;  3A58 A;  1H10 A;  3PVW A;  3P6A A;  2KCJ A;  4KHB B;  2PZ1 A;  5L81 A;  1N3H A;  3HSA A;  2ELB A;  5LOP B;  4F7G A;  4ZRK A;  3LJU X;  4GPT B;  2YRY A;  2MDX A;  4OSN A;  2COD A;  3KSY A;  2D11 A;  4ZRJ A;  3GYP A;  1XX0 A;  5IJM A;  1U5G A;  4CHJ A;  3IVF A;  1X1F A;  2D2Q A;  3WA0 A;  2N0Y A;  3U8Z A;  5CLL B;  4HAY B;  2YS5 A;  1MAI A;  5HE0 A;  2LG1 A;  3FSS A;  3D8E A;  5JP4 A;  4GXB A;  3G9W A;  1LB1 A;  2H7D A;  1NTY A;  1MIZ B;  1ZM0 A;  2DX5 A;  3ODX A;  1XR0 B;  3ZDT A;  1IRS A;  4MT7 A;  1UNQ A;  3V5W A;  5M4Y B;  4HB4 B;  2LKO A;  2CRF A;  2AL6 A;  2Z0Q A;  4QJ3 B;  4K81 A;  2K8E A;  2CAY A;  2L1C A;  2Y8F A;  1E5W A;  4IFS A;  1ISN A;  1LW3 A;  3DXD A;  1U27 A;  1X11 A;  4HB0 B; 
#chains in the Genus database with same CATH homology
 3TO1 A;  4ILH A;  1Z87 A;  2P0H A;  2ROV A;  1QQG A;  2XQN M;  2D4Q A;  1DRO A;  1ZC4 B;  1V89 A;  1HB6 A;  1SGH A;  4TYZ A;  5FI0 A;  2ELA A;  2J0M A;  4HB2 B;  3PVU A;  2DKP A;  1WJM A;  2WH5 A;  1MIX A;  2I1J A;  2EC1 A;  2FJ9 A;  3PZD A;  1GG3 A;  4HAU B;  1ZSQ A;  4K17 A;  3SBG A;  2M14 A;  1P5T A;  5JHH A;  1BTK A;  4TKN A;  4A6K A;  2X18 A;  4KAX B;  2W2X D;  3A8Q A;  4Y94 A;  2I5C A;  1K5D B;  2D9Y A;  3E9L A;  4Z2M B;  1U5D A;  5CLQ B;  3UZT A;  4P7I A;  2P8V A;  1HB8 A;  2M38 A;  2CB8 A;  1X1G A;  2YSZ A;  5KQ1 A;  4K2O A;  4JK8 A;  1FOE A;  1M7E A;  3AU5 A;  2J0J A;  4YL8 A;  3T06 A;  2RLO A;  1W1G A;  1FB8 A;  4H8S A;  4ZRI A;  1XKE A;  3PVL A;  3QBV B;  4JKA A;  1I2H A;  1W1H A;  4GMV A;  1H4R A;  2VSZ A;  5J3Y A;  3ODO A;  3FP5 A;  2IFS A;  2KGX B;  4HAZ B;  1U29 A;  1P6S A;  2X0S A;  3VIA A;  2ABD A;  1MPH A;  2H7E A;  1NTV A;  2COC A;  2COP A;  2P0D A;  4L6E A;  1J0W A;  4WJ7 A;  2QKL A;  2DLW A;  4MY6 A;  1XCG A;  3ULC A;  1KZ7 A;  3DXC A;  2J0K A;  2D9W A;  3N7C A;  1OY2 A;  2YS3 A;  1U5F A;  1K5G B;  2CY5 A;  4MK0 A;  2DN6 A;  1DDW A;  4HAT B;  5GOW B;  2CY4 A;  2OQB A;  3MPX A;  5FI1 A;  1QC6 A;  3DXE A;  4HDQ A;  2EMT A;  3NSU A;  1UEF A;  2ROZ B;  2QKM A;  2YS1 A;  2HTH B;  5D3V A;  2W2W A;  2COA A;  1DYN A;  1X05 A;  2YVC A;  4JKG B;  3KRX A;  1VBG A;  1ACA A;  3E66 A;  4DBB A;  4F7H A;  3E9P A;  2D10 A;  1DIK A;  2GCJ A;  3EPY A;  3SUZ A;  3SNH A;  2NZ8 B;  3SO6 A;  1WG7 A;  1JDE A;  3SV1 A;  1FHW A;  2GS0 A;  1WI1 A;  4BBK A;  4KHO A;  2D9V A;  3TCA A;  1AQC A;  1MK7 B;  1M7R A;  2Z0O A;  3QIJ A;  1NVL A;  3GYO A;  3HK0 A;  3RCP A;  2MWN B;  5HE3 A;  2AEH A;  4D0N B;  1U5E A;  5HE1 A;  2GJY A;  3A8P A;  1V5P A;  2ADZ A;  3SBT A;  3ZVR A;  2D9Z A;  1TXD A;  4JKC A;  1J19 A;  1V61 A;  1Q67 A;  2Y7B A;  3CIK A;  5EFX A;  2RVB B;  2ZPY A;  2I1K A;  5DIF B;  1NI2 A;  4NY0 A;  1ST7 A;  4IAP A;  1U2B A;  1DDM A;  3MDB C;  3WYF B;  3TW1 A;  2DA0 A;  3TVV A;  1NTI A;  5JLJ B;  3U7D A;  1FHO A;  1XD4 A;  5DI9 B;  1AWE A;  5D3Y A;  3F0W A;  4A5K A;  2RQ1 A;  2COF A;  4PNK A;  3P7Z A;  2UVM A;  2FJL A;  4JKH A;  4JKE A;  3PEG A;  5DH9 B;  5D3X A;  2OTX A;  4HAX B;  3OAN A;  4HAW B;  1FGY A;  4KVG B;  2YF0 A;  1FAO A;  3CXB B;  2GCL A;  1RJ2 A;  2Q13 A;  2CQU A;  5JVL A;  2UZR A;  1V5M A;  2EMS A;  5KQ4 A;  1GGO A;  2LOX A;  4DX9 0;  2DX1 A;  4JKF A;  2L2I A;  3A98 B;  2VKI A;  2P0F A;  4JKD A;  4XWX A;  2LYD A;  1DBH A;  1GC7 A;  2Y8G A;  4A6H A;  1EAZ A;  2YT0 A;  4C0A A;  4JK7 A;  2E2X A;  1TJ6 A;  1PLS A;  2R09 A;  2R0D A;  2RSG A;  4Z2N A;  5C16 A;  3ML4 A;  1ZC3 B;  1PFJ A;  5DHA B;  2HE7 A;  4WVF B;  2DIK A;  2BCJ A;  1MK9 B;  1TQZ A;  5C5B A;  4CHM A;  1HBK A;  5C5B B;  4HDO A;  4ILG B;  3O96 A;  2DYN A;  5LON B;  3TFM A;  3D8F A;  1WGQ A;  4EMO A;  1Y5O A;  2EJ8 A;  3PG7 A;  3E9O A;  1P3R A;  4HAV B;  4JKG A;  2RUK B;  4HB3 B;  1NU2 A;  1EF1 A;  1W1D A;  4GMX B;  3KRW A;  4B6H A;  1I7A A;  1OMW A;  1V5U A;  2N23 A;  3PSC A;  2Z0P A;  5J3T A;  4EKU A;  1BAK A;  1VBH A;  1GC6 A;  4EJN A;  2DFK A;  2RNR B;  2UZS A;  2K2U A;  3KZ1 A;  4A6F A;  1FGZ A;  2HRJ A;  2KUP A;  2MKR A;  4A6F B;  2V76 A;  2DHK A;  1KI1 B;  3FEH A;  3ULB A;  2D9X A;  4ILJ A;  5HE2 A;  3FM8 C;  5C79 A;  2W2X C;  1BTN A;  2J59 M;  1PMS A;  3ODW A;  5JHG A;  3HW2 B;  2YT1 A;  2MFQ A;  3KY9 A;  5D3W A;  1OQN A;  1UPR A;  4CYE A;  1FHX A;  1WGU A;  4GZU A;  1SHC A;  3BJI A;  3M1I B;  4PQ0 A;  1B55 A;  2JP2 A;  1KZG A;  3SYX A;  1EVH A;  3QWM A;  5KCV A;  2FDQ A;  1UPQ A;  3ENB A;  5J3Q A;  1WJ1 A;  5C6R A;  1X86 A;  3BIN A;  1XOD A;  2RGN B;  3VOQ A;  3FLV A;  1WVH A;  4JK9 A;  1DDV A;  3AU4 A;  3D8D A;  2VRW B;  2I5F A;  4IOY X;  4WSF A;  3X23 A;  2LUL A;  2DYQ A;  4HHV A;  1EGX A;  3F5R A;  4NSW A;  5DHF B;  2DTC A;  2NMB A;  2G35 A;  1UNP A;  2IYB A;  4GN1 A;  4JKB A;  1Y19 B;  3AJ4 A;  2DHJ A;  4YON A;  2LBB A;  1UNR A;  1KC7 A;  4F7U P;  1RRP B;  1ZVR A;  1BWN A;  4DX8 A;  5D27 A;  2K00 A;  2K2J A;  4KHA A;  3HQC A;  3PP2 A;  2LOZ A;  1V88 A;  4DXA B;  1MKE A;  4K2P A;  1KBL A;  2DHI A;  2R82 A;  2DKQ A;  1H10 A;  3PVW A;  3P6A A;  2KCJ A;  4KHB B;  2PZ1 A;  5L81 A;  1N3H A;  2ELB A;  5LOP B;  4F7G A;  4ZRK A;  3LJU X;  4GPT B;  2YRY A;  2MDX A;  2COD A;  3KSY A;  2D11 A;  4ZRJ A;  3GYP A;  1XX0 A;  5IJM A;  1U5G A;  4CHJ A;  3IVF A;  1X1F A;  2D2Q A;  3WA0 A;  2N0Y A;  3U8Z A;  5CLL B;  4HAY B;  2YS5 A;  1MAI A;  5HE0 A;  2LG1 A;  3FSS A;  3D8E A;  5JP4 A;  4GXB A;  3G9W A;  1LB1 A;  2H7D A;  1NTY A;  1MIZ B;  1ZM0 A;  2DX5 A;  3ODX A;  1XR0 B;  3ZDT A;  1IRS A;  4MT7 A;  1UNQ A;  3V5W A;  4HB4 B;  2LKO A;  2CRF A;  2AL6 A;  2Z0Q A;  4K81 A;  2CAY A;  2L1C A;  2Y8F A;  1E5W A;  4IFS A;  1ISN A;  1LW3 A;  3DXD A;  1U27 A;  1X11 A;  4HB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...