2D11A

Crystal structure of the radixin ferm domain complexed with the nherf-2 c-terminal tail peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Radixin
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d11A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d11A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d11A01
2LRUA 3AI5A 3M3JA 4BFRA 2JRHA 2M4NA 4W9HA 3K9PB 3AXCA 2LOXA 1WFYA 4E3CA 2N7EA 3A4RA 2RGNB 2Y5BB 3AJ4A 2KDIA 2Z0OA 3SHQA 3TL5A 4EEWA 2C5LC 4JGHB 2L7RA 3ZNZB 2MLBA 4XWXA 1KM7A 2BCJA 2EMTA 3C0RB 1Y8RC 3ECIA 2AL6A 4LCDE 5J3TA 3PHXB 1DBHA 3O96A 2KMCA 2KN5A 3VUWA 1KJTA 3TCAA 1NI2A 4K81A 1NTIA 1W1GA 5HKHA 4TUUA 4M8NA 2FAZA 3QJZA 2HE7A 2VSZA 1U4AA 4ZRIA 1PQSA 1M7EA 3B1LX 2N7DA 1A5RA 4ANWA 2HJ8A 2L0FA 2V3SA 3LDZE 3MPXA 2K00A 2O2VB 2KTRA 2Z0QA 2YS1A 1RRBA 2FCSA 4OVUA 3UF8A 1R4NI 3HIZA 4CHKA 4HCPB 2COFA 1Y19B 4BOZB 3UGBB 1P0RA 2MP2A 2BWFA 2L1CA 4WQOB 2V76A 3QIJA 5EDSA 2JF5A 2K8HA 3ZUNA 3PGEA 2ELBA 3TVVA 2K2JA 2IYDB 1JRUA 2R2QA 2C7HA 3ALBA 3QBVB 2M17A 4MGYE 1WVHA 1GC7A 5GMVA 2N1VA 2KX3A 3PLUA 2GCLA 3DPDA 2Z0PA 3JW0X 2KQ7A 5FI0A 2A4ZA 3GZNI 2GBRA 4MGIE 4EKUA 4IWQA 2N4FA 3U7DA 2MX2A 2CQUA 3RD2A 1WGUA 4A6FB 2KTFA 4AUQC 2DYBA 5JZEB 1RLFA 2AEHA 3PHWB 3WIMA 1BWNA 1YJ1A 2KC1A 4K7UA 3HM6X 2CAYA 3RUIB 2I1JA 2L05A 4BOSC 4KV2A 4GGQA 2MDXA 2DAFA 3D32A 3ZTCA 4ANXA 1P98A 2MBOA 4ZDVA 3T9LA 2CRFA 4MSQB 4D0NB 2CHWA 4BVUC 1FGZA 1WJ4A 1GNUA 2NBWB 2LVOA 3H1UA 2L3ZA 5KCVA 2KO3A 4KIKB 4NPNA 1YX5B 4GOCA 2MWNB 2D9XA 2JZZA 1HE8A 2Y8FA 1WJ6A 5DPWA 3TBLD 1WJUA 2MA9B 2PPHA 2REXA 1E8XA 3P6AA 4ZYNA 4FBJB 3JSVB 2KLGA 4JLCA 1DDVA 2LI5A 1W1DA 4ZRJA 1XT9B 1X05A 2KX0A 2MBEA 1FOEA 3QQ8B 3KW5B 3TW1A 4PNKA 1NBFC 1XD4A 1HB6A 2YVCA 4MEMA 5C5BA 3A9KA 3A33B 2L8JA 1G6JA 4NAWB 3VQIA 2D10A 3WAMA 4IFSA 4WJOA 4KZ0A 1FB8A 2GMIC 3R7RA 4DDID 4XX5A 2XQNM 3CF6E 3OLMD 4Z2MB 1WIAA 1U2BA 4MK0A 2LGDA 3L17A 1V5OA 2O6VD 1NDDA 3WALA 3RZFA 1V5MA 1T0YA 1NU2A 4CO7A 2W2XD 2YT0A 2FIDA 1DYNA 3D8FA 4WWNA 4AWJA 1KLVA 1WX8A 4WAAA 2KFKA 5BO4B 1IP9A 2IY1B 4DX8A 3B08A 4URKA 3FSSA 4TKNA 3NOBA 5KQ1A 4WWPA 1Z87A 3ODWA 4HB4B 4BKSA 3PP2A 4FJZA 2KNBA 2D07B 4OVVA 2KJ6A 1UNQA 5D3XA 2YS3A 2VKIA 2MW5A 3ODOA 3VTUA 3M1IB 2ZVNA 4K2PA 3PTFC 4BKGA 3M63B 2H7EA 3ONSA 3OANA 2GJYA 5L83A 3T06A 4WJPA 2NCNA 1NTYA 1IPGA 2UVMA 4GMXB 2P0FA 4GU2A 2AWTA 2EMSA 4HVBA 4DXAB 5L81A 3PVUA 3L16A 3FEHA 1WE7A 1P3RA 5DIFB 2YF0A 1WXAA 2BGFA 2HRJA 2IO3B 2GCJA 1WX7A 3KYDD 4EMOA 4EZKA 3ENEA 4GDKA 2XK5B 4AJWA 3QWZB 4HJKA 1C3TA 4N9F4 2J7QB 3DBLI 2OQBA 1BTKA 5HE2A 1FHOA 2D11A 4IAPA 1UPRA 2RUKB 3VTVA 5IA7A 3NZUA 3PRPB 4W9JA 2FCNA 2IYBA 1AARA 1E7UA 1WR6E 4IM3A 5D94A 2GBNA 4AJYB 1E90A 2C9WB 1WXSA 2GBMA 3IFWB 2JZ3B 3H6NA 1E5WA 3PRMB 4HB3B 1UBQA 4KHOA 4KSKC 3ZRCA 3VXWA 1WM3A 1PMSA 1AQCA 1R4MI 5J18A 4NY0A 4EUTA 1U5FA 4F8CB 3QK0A 3FP5A 2MWSB 1E8YA 4WJNA 4MM3A 2R2OA 4E74A 2BPSA 4MJSB 1DROA 3S2AA 1I35A 5CX3A 3F5RA 2KJRA 3VTWA 2FUHB 5CTRC 2M14A 2KMAA 3DVGY 3SV1A 1V80A 1S3SG 1IYFA 1ISNA 2FNJB 2G35A 2LKOA 4DBBA 2DX5B 4EZLA 5LLIA 5IAAC 1RRPB 3CIKA 2M0XA 1KI1B 3WAOA 2O2VA 3KUZA 4RMAA 5J17A 4DHJB 4W9EA 2CHZA 1FXTB 2LWPA 3PSEB 3Q3FA 2DTCA 1WZ3A 3PLVA 3LJ3A 4KDLB 2KHWB 2RVBB 1ZSQA 3V6EB 4GN1A 4WWOA 2UZRA 1RAXA 4FLHA 3KRWA 3HK0A 2D9WA 2CODA 5AEKB 3A9JB 2L0TA 5G55A 1ZGUB 4B95A 2LGXA 2KDFB 4F1SA 2IZVB 1HB8A 1MIZB 4F7UP 1OEYA 3PPAA 2NBVB 3DXDA 2DX1A 3V6CB 4DBGA 1AWEA 1OQYA 3UIPB 3BY4B 2COAA 2P8VA 5JHBA 1WR1A 2LOZA 4KHAA 2EJ8A 4IM0A 2DZIA 2JP2A 2Q13A 1SIFA 4A6FA 1ZC3B 1TXDA 1LM8B 2FDQA 3GYOA 5E6OA 2GBKA 2KGXB 1EO6A 3APDA 5LOPB 3PS6A 1GJZA 3Q3JA 1DDWA 1EVHA 2LYDA 1S1QB 5KQ4A 4W9LA 1WGGA 3U30A 1UGMA 1P9DU 4GDLB 2JVCA 3OAWA 2JY6A 5CHVC 2KK8A 2DZKA 4HCNB 2W2WA 2ELAA 2KQSA 2EKEC 3D8EA 4FHKA 2ADZA 4KIKA 2NBUA 1E7VA 2DYQA 1WGDA 2PE6B 4HPMB 4ZRKA 2ZCCA 1X1FA 4LDTD 1KOTA 2JWZA 2NPTB 4ANVA 3HQCA 5CLLB 1WGQA 2X18A 1V5TA 5D6JB 2MRPA 1K8RB 3ZTDA 4C0AA 3R66C 3UZTA 3PV1A 3W1SC 5L95C 4GPTB 2PJHA 3JSVA 5AZHA 1J0GA 4NSWA 3A1QB 4TQ1A 3VH4B 3ZDTA 3SO6A 3AU5A 2DN6A 2I5CA 1VCBA 2CB8A 4BBNF 1MK7B 3T8MA 1UD7A 3SDLC 4W9GA 2JUOA 3VDZA 2IO2B 2K2UA 4NAWA 3RYTA 5C16A 2IO1B 5DCNA 1ST7A 3ULBA 2BKRB 1BT0A 4WVFB 2QKMA 1EUVB 1NVLA 1UH6A 2K6DB 4I6NB 3ZNGC 2FJ9A 5J2RA 1WMHB 3DVNU 2J0KA 3L08A 1Q5WB 2WDTB 4GB9A 1BTNA 3IG3A 1U29A 1YQBA 3MDBC 2YRYA 3H7PA 2DAJA 2MBQA 2JXXA 2R0DA 3PZDA 4HK2A 3RT3B 4HB0B 1TTNA 1MAIA 4G11A 3I3TB 3ZVRA 1WY8A 2GBJA 4MGKE 3QX1A 1PFJA 5LXHA 1ZW7A 4DHZB 3QA8A 2IBIB 3UIOB 2C60A 3N32A 4LJOB 4G50A 3L10B 5D3WA 2UZSA 2L76A 2D3GA 5DPTA 4P7IA 3W1YA 1XCGA 5KHQA 3QAQA 4BKSD 2FJLA 2DHZA 2RSGA 2KANA 2GS0A 4ICUA 4A3OA 3KY9A 2DHIA 4MH0E 3PT2B 1P3QU 3VAWA 1K5GB 1U27A 1Q0WB 2MQJA 4IWPA 4J6IA 1WI1A 3AU4A 3L54A 1SE9A 4JL9A 1Y5OA 4KSLC 2IO0B 1I42A 2NR2A 4MY6A 2CKHB 2XK5A 2BYFA 1L7YA 4XZ4A 2BWES 3H7PB 1OEYJ 4FA6A 4H8SA 2KD0A 1M7RA 3DXCA 4PQ0A 3GYPA 4FJYA 3NS8A 1Z5SB 4ASWC 3V61A 3KYCD 1CMXB 3SUZA 2Z0EB 4W9DA 4KDIC 3TMPB 1ZC4B 3QWMA 1GUAB 5FI1A 3EPYA 1RFAA 3EHVA 2QKLA 1WJNA 2BF8B 2ROZB 3MTNB 2FCMA 1WXVA 1EAZA 2YSZA 2KOXA 4W9FA 3KRXA 1X1GA 5D27A 3APCA 1MIXA 2WX0A 1WI0A 2RD0A 2LZ6A 3DXEA 4I6LB 4K1RB 3V62A 1IRSA 1WE6A 2CS4A 4MJSA 3OJ3A 1I2HA 2MKRA 4RM9A 2BYEA 1MK9B 1LW3A 3ZDMC 3F0WA 4HAUB 5DHAB 4AOFA 3X23A 2DX5A 3RULA 2DKPA 2ZPNA 2DENB 2YS5A 1Q1OA 2J0JA 1KZ7A 1FHXA 1H4RA 3WA0A 1N3HA 2RPQA 4EZJA 1K5DB 4IG7B 4NJ7A 3CXBB 1UELA 5CHFA 5IJMA 3G9WA 4BBKA 2ZVOA 1P6SA 3EFUA 4CHMA 3EC8A 4PYZA 4DDGD 5JHAA 5JHHA 2WWZA 4TQ0A 5J3YA 2Z0DB 4NJ6A 3KVFB 4F7ZA 5J3QA 3W1SA 2Y8GA 2CU1A 2AYOB 3A8PA 2N23A 1X11A 3A9JA 1H10A 3VVWB 4IWOA 4HAYB 4A20A 1WGHA 2HTHB 5C6RA 5TR5A 4ICVA 1RJ2A 1WJMA 5HE1A 2FIFA 4M0WB 4DHZE 1F9JA 2LASA 2QHOA 4CYEA 1FGYA 4K2OA 1QZEA 2JT4B 5HE3A 2NZ8B 4I6PA 3CMMB 1ZVRA 2DYNA 2O6VB 4HAXB 2P0DA 2KWVB 1LB1A 3NY5A 4IM2A 2M38A 2G4SA 4PS7A 1YD8U 1ACAA 3B0AA 1VD2A 1YX6B 2B3AA 1SGHA 3X0WA 4HLEA 3PVLA 4HAWB 4B6WA 4TV3A 4YL8A 3JYUA 2V4LA 4GDLA 2EC1A 1EGXA 5LONB 2JPHA 2ZEQA 1WM2A 1V5PA 2N9XA 1TZ1A 3QHTA 2RSUA 4MGZE 3PRZA 3ULCA 4M8MA 4WJ7A 1UZXB 1FHWA 2IFSA 2NPTA 3DCGA 5DH9B 2K1FA 2WH5A 3FLVA 3PEGA 5DPSA 4NQLB 1V5UA 4K7WA 1XKEA 4DWFA 3A1QA 2BKFA 1BAKA 4A6HA 1D3ZA 3VUYA 1WXMA 3V5WA 3N30A 3SD5A 2M8SA 2L00B 2RNRB 4GIVA 2JRIB 4FADA 4EOYA 3ZVVA 2ABDA 5C23A 3WYFB 2AL3A 4WJQA 2K6QA 2KJHB 3A4SC 1J8CA 5DI9B 5CHWA 4BKTA 5LXIB 3ZO5B 1V61A 5D7GA 3H7SA 1XODA 3QCAA 4HAZB 1WMHA 3V60A 5CLQB 3GOEA 2W2XC 2LUEA 4JIOU 3M62B 5DPRA 2N1WA 4PS8A 4L6EA 3AULA 4W9KA 1OTRB 2LVPA 3WANA 3UINB 4RM8A 3IBEA 2KXJA 3QC8B 3M95A 1LFDA 3IVFA 2N9PC 1V86A 1FAOA 1OQNA 2C7MB 1W1HA 1L2NA 2CY4A 2PZ1A 3CSFA 3U8ZA 2DYOA 3PVWA 3PREA 2D2QA 3DDCB 2G45B 1J0WA 4KVGB 1OMWA 2FCQA 2GOWA 3KH0A 3JVZX 4HB2B 2LVQA 1P1AA 3RCPA 2LXCA 2K8CA 1UEFA 5C1ZA 1E8ZA 5EFXA 3A8QA 4KAXB 3L0WB 1V89A 1OY2A 1SHCA 4HDQA 3HW2B 2LJ5A 4B6HA 2K8BA 1WX9A 4HATB 4IUMB 2WX1A 5D3YA 3KUDB 2L2IA 1V6EA 4FULA 2N0YA 2RR9A 3UQBA 3HM3A 2RQ1A 2IY0B 2KLCA 2UWQA 2J0MA 3TIXA 4GZUA 3OJ4B 3ML8A 2KCJA 3RZWC 2YLMA 4YONA 1NTVA 4F7HA 3ZKJC 2DZMA 1KZGA 2MCNB 3ZRFA 5C79A 4BBNC 1EF1A 1Z2MA 2W9NA 2KTRB 4MDKE 2KWUB 4F7GA 1MPHA 1XD3B 1E8WA 3SNHA 2H7DA 4A5KA 2MP2B 3DBSA 1WJ1A 4II3B 3D8DA 4FJVB 2NS5A 5JH5C 2KKCA 3ZNHB 1ZKHA 3DBRI 3TFMA 5AZGA 2DLWA 1LQBA 3BINA 4EFOA 2N9EB 4GXBA 2KDEB 1HBKA 2MSED 1XQQA 2CR5A 5E6NA 3ZLZA 2ZPYA 2DKQA 1V9JA 1U5GA 2I5FA 1WG7A 4W9IA 1TGZB 3HHMA 4G0NB 2COCA 2ROVA 3KSYA 2J59M 2LULA 3N3KB 3ML4A 4HAVB 2KVRA 2VRWB 3LJUX 4TYZA 2K39A 2BYVE 2OOBB 2OJRA 1YIWA 5JLJB 3K9OB 1B55A 3DQVA 3ODXA 4NNJB 3SYXA 2ZNVB 3TJPA 5HE0A 4MELA 4IOYX 1H8CA 4GMVA 1GG3A 4HPLB 3UQAA 2R09A 2DFKA 1UNPA 2MFQA 2LBBA 4LDTB 4DX90 2A5UA 3PG7A 1GC6A 1V2YA 5KHOA 1TBEA 3DBHI 4CHJA 1XR0B 4E71A 4MT7A 3O65B 2ZCBA 1UNRA 1I7AA 5GOWB 3P7ZA 2C7NB 1TQZA 4IW0A 2DYMA 4DHJD 2PEAA 4HHVA 3NZSA 4II2B 2LGYA 4IC7B 2RLOA 3IHPC 1MG8A 4Z2NA 1C1YB 1WRDB 4B9KA 1U5EA 2LRWA 1X1MA 3ML9A 1EF5A 3VOQA 2D9VA 3NHEB 2HTHA 3VUXA 4HDOA 2DHKA 3BJIA 2ASQA 3TO1A 2DHJA 4HXDA 4XC2A 2NMBA 4K7SA 1V88A 5C5BB 3A9KB 3FM8C 5DHFB 2DZJA 2G3QB 1Q67A 2COPA 5FR6A 2RGFA 2CHXA 5JHGA 3APFA 3WAPA 1LXDA 1WGRA 2O6VA 4PS3A 3KUCB 4WSFA 2KC2A 3DVGX 2D4QA 4A6KA 2KUPA 2YT1A 4ANUA 1WGYA 2PE9A 2D9YA 1ZM0A 3VHTC 2G4DB 2ZZPB 2DA0A 4EJNA 2ZNVC 4NQKE 1UPQA 2Z59B 3ZNID 2WYQA 5AZFA 4X57B 2KWCA 1PLSA 1V49A 2VRRB 2I1KA 1MKEA 3VFKA 2LG1A 4Y94A 2LD9A 4W9CA 2D9ZA 2KFKB 3VIAA 3DOWA 1P5TA 2MBHA 4GSWA 2OTXA 3QARA 1WF9A 2KZRA 3KZ1A 1DDMA 2M1MA 1WH3A 3DVNV 1UBIA 4FHJA 1QQGA 4KZCA 2E2XA 4KHBB 2MBBB 3RCZA 3L13A 2UYZB 4AP4C 3PSCA 2XEWA 3N7CA 3MJWA 4DK5A 4HWIB 4FN2A 3MHSD 1J19A 2HD5B 1QC6A 3H9DA 2NVUI 1WZ0A 3P2BA 5E6PA 4PYUA 4G3XB 2K25A 3A98B 1OGWA 2XBBC 4LJPB 1X86A 5D2MB 5G2NA 1XX0A 2V1YA 2LXAA 3ZIMA 2KFJA 3EECA 4K17A 3ZW3A 2P0HA 3VH3B 2KDBA 1M94A 3R7QA 1TJ6A 1WYWB 4JQWC 2ZJDA 1V81A 3CSTA 3R3MA 1U5DA 3NSUA 4GDKB 5JP4A 2CY5A 3SU8X 4MSMB 2Y7BA 4A3PA 5D3VA
chains in the Genus database with same CATH superfamily
2LRUA 2OEDA 3AH7A 3N9YC 3AI5A 3M3JA 3AM9A 4BFRA 2JRHA 4S0RA 2M4NA 4W9HA 3Q8FA 4JKFA 1RWSA 3K9PB 3AXCA 2LOXA 1WFYA 4E3CA 2N7EA 3A4RA 2RGNB 4WURA 1VLBA 2Y5BB 3AJ4A 2KDIA 3N1XC 1VBHA 2BB6A 2Z0OA 3SHQA 4DQOC 3TL5A 1XLNA 4EEWA 4JKHA 2C5LC 4JGHB 2BB5A 2L7RA 3ZNZB 2PTLA 2PLPA 4ZRQA 2MLBA 4XWXA 1KM7A 2BCJA 1I4QA 2EMTA 2UU7A 3C0RB 1Y8RC 3ECIA 2AL6A 1TS3A 4LCDE 2J42A 5J3TA 3PHXB 1DBHA 3O96A 2KMCA 2KN5A 4OZBA 3VUWA 1KJTA 3TCAA 1NI2A 4K81A 1NTIA 3P4PB 4NZLB 1W1GA 5HKHA 3BK1A 4MM3B 3B2GA 4TUUA 2LEKA 4M8NA 2FAZA 3QJZA 3AEFB 1C78A 2HE7A 1XCQL 2VSZA 1U4AA 1F0ZA 4ZRIA 2VH1A 1PQSA 1UWXA 3J9CA 1M7EA 3B1LX 2N7DA 1A5RA 4ANWA 1XLQA 1SXTA 2WXOA 2HJ8A 3E9PA 3IAS1 2L0FA 3FILB 2L52A 2V3SA 1FM0D 3LDZE 3MPXA 2K00A 2O2VB 2KTRA 2L32A 2TSSA 1SJED 4YSYB 2Z0QA 2YS1A 1RRBA 2FCSA 4OVUA 2WXLA 3UF8A 1R4NI 3AN1A 2KIEA 3HIZA 4CHKA 4HCPB 2COFA 1Y19B 4BOZB 3UGBB 3SEBA 4A90A 1P0RA 4LNNA 1FO4A 2MP2A 2BWFA 5T8IA 4ZHPA 2L1CA 4WQOB 3RMKC 2V76A 3QIJA 3AE1B 5EDSA 3TEXA 2JF5A 1MJDA 1TZOA 2K8HA 3ZUNA 3PGEA 1FFVA 2ELBA 4PT5A 3TVVA 1GGOA 1I4HA 2K2JA 1C76A 3V3XA 2IYDB 5BYRA 1WWTA 1JRUA 2R2QA 5BYQA 3TEYA 1ENFA 5C2TB 2V3PA 2C7HA 3ALBA 3QBVB 5H8YE 2M17A 4MGYE 4XGAB 1WVHA 1GC7A 5GMVA 2N1VA 3VRAB 2KX3A 3N1YC 3PLUA 1E9MA 2GCLA 3DPDA 2Z0PA 2EELA 3JW0X 4UDUC 4YTNB 1SEBD 4P6VF 2KQ7A 2DBYA 5FI0A 2A4ZA 3GZNI 2GBRA 2V0GA 4MGIE 3O13A 4EKUA 4IWQA 2N4FA 3U7DA 2MX2A 2CQUA 3Q3NC 4ITKA 3RD2A 1WGUA 2FE8A 4A6FB 1EM7A 3RPFC 1FRDA 3P4QB 1V1OA 2KTFA 4AUQC 2DYBA 5JZEB 1RLFA 2AEHA 3HUIA 2Y3AA 3PHWB 2QMTA 3WIMA 3T3NA 1BWNA 3MC9A 1YJ1A 1MFWA 3RN9C 2BS2B 2KC1A 1KTKA 4K7UA 3HM6X 2CAYA 2JWUA 3HRDD 4YTPB 3RUIB 2MH7A 2I1JA 2PVGC 4TSSA 3OHMB 2L05A 4BOSC 4CQNA 4KV2A 4GGQA 2MDXA 1XO3A 1GAQB 2DAFA 2QEJC 1QQRA 2HTME 3D32A 2FUG1 3ZTCA 4ANXA 1P98A 2WQYB 4RGNA 2GI9A 2MBOA 4ZDVA 4D2KA 3T9LA 2CRFA 4MSQB 5MPOA 4D0NB 2CHWA 4BVUC 1FGZA 1WJ4A 1GNUA 4YXDB 2NBWB 2LVOA 3NW8A 5IN7A 3H1UA 1SE2A 2L3ZA 5KCVA 2KO3A 2LFIA 4KIKB 4NPNA 1YX5B 4GOCA 1ZYIA 5BYSA 2MWNB 3C8YA 2D9XA 5I2MA 2JZZA 1HE8A 2Y8FA 1MHHE 1WJ6A 5DPWA 2AQ3B 3TBLD 4HPPA 1WJUA 2MA9B 3DBLB 2N0SB 4LNKA 2PPHA 3Q8BA 3URYA 2REXA 1KLUD 1E8XA 3NRZA 2NTTA 3P6AA 1DOXA 4ZYNA 2W3SA 4FBJB 2WDRB 3JSVB 2KLGA 4JLCA 4C7YA 1DDVA 4D6WA 2INCC 2LI5A 1W1DA 4ZRJA 4YTMB 1XT9B 1X05A 5IOIA 2KUQA 2KX0A 2MBEA 1FOEA 3QQ8B 3KW5B 3TW1A 4PNKA 1NBFC 1QOAA 1XD4A 2KMMA 5HHDG 5HG2A 2K9XA 1HB6A 2YVCA 4MEMA 5C5BA 3A9KA 2BTEA 1JWBD 2CU3A 3A33B 4JK7A 2L8JA 1G6JA 4DIXA 2WXIA 4NAWB 3VQIA 2WHIA 1JMLA 2D10A 2H89B 3WAMA 4IFSA 4WJOA 4XYCA 4KZ0A 1FB8A 2GMIC 3R7RA 3CWIA 4DDID 4OSNA 4XX5A 2XQNM 3CF6E 1HTOA 1R4MB 3OLMD 4Z2MB 1WIAA 1U2BA 1FMAD 2WXGA 5H92C 4MK0A 2LGDA 1VZ8A 5G5HA 1N63A 3L17A 2SEBD 2KACA 2E6XA 1V5OA 2O6VD 1NDDA 5D3DA 3WALA 1TT5B 3RZFA 1V5MA 3IT4B 1J7BA 2IJ0A 2Z59A 1T0YA 1NU2A 4CO7A 2W2XD 1VRAB 2YT0A 2FIDA 1UNSA 1A70A 3FAHA 1DYNA 2K3UA 3D8FA 4WWNA 4AWJA 1ZUD2 1KLVA 1FIQA 1WX8A 1F2RC 4WAAA 3LB8C 2KFKA 3NVYA 2BVCA 5BO4B 1F1HA 3Q8EA 1IP9A 2IY1B 4DX8A 3B08A 4L2YA 4URKA 3FSSA 2W3RA 1FCCC 4TKNA 3NOBA 4AQ7A 2R61A 5KQ1A 4WWPA 1Z87A 3ODWA 4HB4B 2W55A 3P42A 4BKSA 5BMIA 3PP2A 4FJZA 2KNBA 3VR8B 3MP9A 2D07B 1JWSD 4OVVA 2KJ6A 1UNQA 4NJCA 2D3CA 5D3XA 2YS3A 2KIGA 2SAKA 2VKIA 2B76B 2MW5A 3ODOA 4OVZA 3VTUA 3M1IB 2ZVNA 1I4GA 4KHBA 2J52A 4K2PA 3PTFC 2BS3B 2QSDA 4BKGA 2W54A 3M63B 1FNUA 2H7EA 2RDGA 3ONSA 3OANA 2GJYA 5L83A 1B1ZA 1NEKB 4JK8A 3T06A 4WJPA 4XWTA 2NCNA 1CJEA 1NTYA 1IPGA 2UVMA 1PFDA 4K3CA 4GMXB 2WS3B 2P0FA 4GU2A 2AWTA 2EMSA 2GB1A 4HVBA 3HIEA 4DXAB 4P1CC 5L81A 3N20C 3U12A 1WGKA 3PVUA 2D3BA 1F2RI 4KGRA 3L16A 3FEHA 1WE7A 1P3RA 5DIFB 2YF0A 1WXAA 4QJ3B 2BGFA 2HRJA 2IO3B 2GCJA 1EWCA 1F77A 1WX7A 3KYDD 4EMOA 3ZXVA 4EZKA 2WXPA 2K5PA 1ZDVA 3ENEA 3ZQ4A 4GDKA 2WXQA 2XK5B 4AJWA 3QWZB 4HJKA 1C3TA 2X0SA 3AEGB 4N9F4 2J7QB 3DBLI 2GRIA 2OQBA 1BTKA 5HE2A 4JKAA 1FHOA 1LO5D 2D11A 2WGSA 4RH6A 4IAPA 1UPRA 2RUKB 3KLSX 3VTVA 2MJDA 5IA7A 3Q3MC 3NWAA 1ZDXA 3NZUA 3PRPB 4W9JA 2FCNA 1NENB 1T5XD 1I4XA 1IGDA 2IYBA 1AARA 4XE0A 5M4YB 1E7UA 1WR6E 4IM3A 3LXFA 5EE0A 5D94A 4A6QA 2GBNA 4AJYB 4RGTA 1PUTA 4HKZE 1E90A 2C9WB 3KQ4A 4DXFA 1WXSA 2GBMA 2K49A 1TS5A 3IFWB 2JZ3B 3H6NA 1E5WA 3PRMB 4HB3B 1UBQA 1XF5L 3TEWA 1STEA 4KHOA 4KSKC 3ZRCA 4GOUA 3VXWA 1WM3A 1PMSA 1AQCA 2D5GA 1R4MI 5J18A 4NY0A 4EUTA 4JE3B 1U5FA 4F8CB 3QK0A 3U7ZA 3FP5A 2LGSA 2MWSB 1E8YA 4WJNA 1YN5A 4MM3A 2R2OA 4E74A 2BPSA 4MJSB 2ICIA 1DROA 3S2AA 1FFUA 5D3IB 1I35A 1EU3A 5CX3A 3F5RA 2PVOD 3E9SA 2WLBA 3NUHB 2KJRA 3AEEB 3VTWA 1J7CA 2FUHB 4M02A 5CTRC 2M14A 4JPSA 2KMAA 3FKYA 3DVGY 1QLBB 2K8EA 3SV1A 1V80A 1S3SG 1IYFA 1ISNA 2FNJB 4B0EA 2G35A 2LKOA 4DBBA 1HZ6A 2DX5B 3FILA 2GUMA 4EZLA 5LLIA 5IAAC 1OFFA 1RRPB 2Z14A 3CIKA 2M0XA 1KI1B 3WAOA 2O2VA 3KUZA 4RMAA 5J17A 2QDFA 4DHJB 4W9EA 2CHZA 1FXTB 2LWPA 2BT6A 3PSEB 3NWDA 3Q3FA 2DTCA 1C79A 1J7AA 1WZ3A 1F52A 3PLVA 3LJ3A 4KDLB 2KHWB 4L1RA 1TYGB 2RVBB 1KF6B 4C80A 1ZSQA 3V6EB 4GN1A 2V4IB 4WWOA 2UZRA 1RAXA 1C77A 4FLHA 3KRWA 3HK0A 2D9WA 5FK9C 4KGSA 3GE3C 2CODA 3Q69A 2ZW1A 1NYRA 5AEKB 4KKJA 3A9JB 4LNFA 4QAYA 1R7SA 2L0TA 2QIEB 1N62A 5G55A 2V9HA 1ZGUB 4B95A 1B9RA 2LGXA 2KDFB 4F1SA 2IZVB 1HB8A 2JX5A 1MIZB 4F7UP 1OEYA 3PPAA 4A55A 3SBTA 2NBVB 3DXDA 4A8XC 3Q2AC 2DX1A 3V6CB 4DBGA 1AWEA 1OQYA 5HFYA 3UIPB 3BY4B 3KWLA 2COAA 1UUPA 2P8VA 5JHBA 1WR1A 2LOZA 4MT5A 4KHAA 1BXTA 2EJ8A 1SF0A 4IM0A 1E10A 2DZIA 5IKCM 2JP2A 3AEBB 2Q13A 1SIFA 3W5VB 4A6FA 1V97A 1Q10A 1TS4A 3FVCA 1ZC3B 1K53A 1TXDA 1LM8B 2FDQA 3BWUD 4C7ZA 3AB5A 3GYOA 5E6OA 2GBKA 2KGXB 1EO6A 3GS2A 4OW0A 3APDA 3R8BA 5LOPB 2I2YA 3EGRA 3PS6A 1MG4A 1GJZA 3Q3JA 1DDWA 4CSQA 1HQRD 4HROA 1EVHA 2LYDA 1S1QB 5KQ4A 3A58A 4W9LA 2R2YA 2ZKMX 1WGGA 1D5MC 3U30A 2RRFA 1UGMA 1P9DU 1YN3A 2JVCA 4GDLB 3OAWA 3NG0A 2JY6A 5CHVC 1V8CA 2KK8A 2DZKA 4HCNB 2W2WA 2ELAA 2KQSA 1UF0A 2WXRA 5FKAC 2EKEC 1TS2A 3D8EA 4FHKA 2ADZA 4WQMA 4KIKA 2BQQA 1E7VA 2IGDA 2NBUA 2DYQA 1WGDA 2PE6B 4HPMB 4ZRKA 4RFBA 2ZCCA 4JKGA 5JVLA 1X1FA 4LDTD 2OHFA 1KOTA 2JWZA 1VZ7A 2NPTB 2HDEA 4ANVA 3MC8A 3HQCA 1FNWA 5CLLB 1K51A 1WGQA 4P1BC 1L4ZB 2X18A 1V5TA 5D6JB 2MRPA 1CZPA 1K8RB 5HI1A 5TSSA 3BIID 4C0AA 3R66C 3UZTA 3ZTDA 3BYYB 3PV1A 2JQRB 2DLBA 3W1SC 5L95C 4GPTB 2PJHA 3JSVA 3RNAC 5AZHA 4L23A 1J0GA 4NSWA 3NVVA 3ZGZA 1ZXHA 1YJJA 2I38A 3A1QB 4TQ1A 3VH4B 3ZDTA 3RFZB 3SO6A 3AU5A 2DN6A 2X38A 2I5CA 2KR0A 1VCBA 2CB8A 4BBNF 1MK7B 3T8MA 1UD7A 2G9HD 3BK2A 1KLGD 2LUMA 4RCOA 3SDLC 4W9GA 3Q14C 1AW7A 2JUOA 3VDZA 2IO2B 1L5PA 2K2UA 4K3BA 4NAWA 3RYTA 5C16A 2IO1B 5DCNA 1ST7A 3ULBA 2BKRB 3U52E 1BT0A 4WVFB 1K52A 2QKMA 1CK1A 1EUVB 3E9LA 1NVLA 1UH6A 3DHGC 2K6DB 4QXAB 1AN8A 3DHIC 4I6NB 3ZNGC 2FJ9A 5J2RA 4N6EB 1WMHB 3DVNU 3AE9B 2J0KA 3L08A 1Q5WB 3ABVB 2WDTB 3UI3A 4GB9A 1BTNA 4N58A 2N9LA 1T0SC 3IG3A 1WXQA 1U29A 1YQBA 1JW9D 3MDBC 2YRYA 3H7PA 1E7PB 4GLSC 5JXVA 2DAJA 4JKGB 2MBQA 2JXXA 1ZOYB 2R0DA 3PZDA 3HVZA 4HK2A 3RT3B 4HB0B 1WRIA 1RM6C 1TTNA 2WU2B 1MAIA 1YQ4B 3L4PA 1L4DB 2JZPA 3TEZA 4G11A 3I3TB 3ZVRA 1WY8A 2GBJA 4MGKE 1IBXB 3QX1A 1PFJA 5LXHA 1ZW7A 4DHZB 3QA8A 2IBIB 3UIOB 2C60A 2BW2A 3N32A 4LJOB 1WSPA 1T77A 4G50A 3L10B 4A9AA 1JALA 1YOVB 5D3WA 2UZSA 2L76A 4C4VB 4L1BA 2D3GA 5DPTA 4KKIA 4P7IA 1P7FA 3W1YA 1XCGA 5KHQA 2QILA 3QAQA 4BKSD 2FJLA 2DHZA 2AQ1B 1KRHA 2RSGA 2KANA 2GS0A 4ICUA 2CJOA 4A3OA 2WXHA 4C00A 3KY9A 2DHIA 4GNKB 4MH0E 1PGAA 3PT2B 2N7JA 1P3QU 2RDHA 2WNMA 1K5GB 3VAWA 2PKOA 1U27A 1Q0WB 3NVWA 2MQJA 3ETRA 3BVGA 4IWPA 4J6IA 2QCZA 4KX6B 4US8A 2J53A 1WI1A 3AU4A 4RF1A 3L54A 1SE9A 2BS4B 4Q2JA 5EE3A 4JL9A 1Y5OA 4KSLC 2IO0B 3AE8B 3SFDB 1I42A 2NR2A 4MY6A 2CKHB 3IAM1 2KVZA 3I57A 3C19A 2XK5A 2BYFA 2FJUB 1L7YA 1MPEA 4XZ4A 2BWES 3RI7C 1YMHE 3H7PB 3MC0B 4KGTA 3NJTA 3PO0A 1OEYJ 2PIAA 4FA6A 1SE3A 4H8SA 2KD0A 2ACZB 1M7RA 3DXCA 4PQ0A 5BMHA 3KWVA 2VZKD 1QKZA 3Q8CA 1JQ4A 3GYPA 3AMZA 4FJYA 4HKQA 4JKCA 3OWEB 3NS8A 1Z5SB 4ASWC 4IDIA 3V61A 3KYCD 1CMXB 3SUZA 3BYTB 2Z0EB 4W9DA 4KDIC 2KDMA 3TMPB 1ZC4B 3QWMA 1GUAB 5FI1A 1FCLA 3EPYA 1RFAA 1TIFA 3EHVA 2QKLA 1N61A 4C56C 3P63A 1WJNA 2BF8B 2ROZB 1I7HA 3MTNB 2FCMA 3ZJTA 1WXVA 1EAZA 2YSZA 2KOXA 4W9FA 3KRXA 1X1GA 5D27A 3AECB 3MJ5A 3APCA 1MIXA 2WX0A 1WI0A 2RD0A 2LZ6A 3PZ8A 4HEA1 3DXEA 2WU5B 4I6LB 5IO9A 4K1RB 3V62A 1IRSA 1WE6A 2CS4A 2JSVX 1SBBB 1C4PA 2VH2A 4MJSA 3OJ3A 4OT1A 2G1EA 3RNBC 1I2HA 3BVMA 2MKRA 2RMMA 1TJEA 2YT2A 4QJ5B 4RM9A 2BYEA 1MK9B 2JXTA 2XNAC 3AEDB 1LW3A 4HRSA 3ZDMC 3F0WA 2INDC 4HAUB 2IPKD 5DHAB 4AOFA 3X23A 2DX5A 3DHHC 3RULA 1ROEA 2DKPA 1N5WA 1T0RC 2ZPNA 3N1ZC 2DENB 4MH8A 2YS5A 1Q1OA 3Q6BA 2J0JA 1KZ7A 1FHXA 1H4RA 1OQQA 3WA0A 2WDQB 1N3HA 2RPQA 4EZJA 1K5DB 1TY2A 4NAMA 4IG7B 1QILA 4NJ7A 1GB4A 3CXBB 1UELA 5CHFA 5IJMA 3G9WA 4BBKA 2ZVOA 1P6SA 3EFUA 4CHMA 3EC8A 4PYZA 4LTUA 4DDGD 5JHAA 5JHHA 1FXIA 4LNIA 2X8XX 2WWZA 4JKBA 3WCQA 4TQ0A 5J3YA 2Z0DB 4NJ6A 3KVFB 4F7ZA 5J3QA 3W1SA 2Y8GA 2CU1A 1E6EB 2AYOB 3A8PA 3AEAB 2N23A 1X11A 3A9JA 1H10A 5GXGB 3VVWB 4IWOA 4HAYB 4A20A 1GB1A 3GB1A 1WGHA 2E3TA 3AE6B 1TKEA 2HTHB 2NBVA 5C6RA 5TR5A 1ZPSA 3NVZA 4ICVA 4XDDA 4YSXB 2LMCA 1QT9A 1RJ2A 1WJMA 5HE1A 2FIFA 2GLSA 4M0WB 4DHZE 1F9JA 3VR9B 1WYGA 2JU6X 2LASA 2M19A 2QHOA 4CYEA 1D4BA 1FGYA 4K2OA 2PMVA 1L0YB 2FBWB 1QZEA 2JT4B 5E6JA 4HSIA 5HE3A 2NMQA 2NZ8B 3EUB2 4I6PA 2OJWA 3CMMB 1JWUD 1V1PB 1ZVRA 2DYNA 2O6VB 4LLGM 4HAXB 1VR9A 2P0DA 2DNFA 2KWVB 1LB1A 3NY5A 1VJKA 4IM2A 4YWGG 4DXGA 2M38A 2G4SA 4PS7A 1YD8U 1P7EA 1ACAA 3B0AA 1VD2A 5AUIA 3Q8AA 4IOIE 4B0MA 1YX6B 2B3AA 1SGHA 3X0WA 4HLEA 1DGJA 3PVLA 4HAWB 4B6WA 2L83A 4TV3A 4YL8A 3JYUA 2V4LA 4ARCA 4GDLA 4JK9A 2EC1A 1EGXA 3DWMA 5LONB 3EFCA 2JPHA 2ZEQA 4M01A 1WM2A 2KN4A 1V5PA 2N9XA 1PDXA 1TZ1A 3QHTA 4ILGB 2WXJA 2RSUA 2W82A 4MGZE 2LHDA 4LK0M 3PRZA 3ULCA 3NS1A 5IP4D 4M8MA 1JCKB 4WJ7A 1UZXB 1FHWA 4H2AA 1Y56A 3TSSA 2IFSA 2NTSA 2NPTA 3DCGA 5DH9B 2K1FA 2WH5A 1M4VA 3FLVA 1ZE3D 3PEGA 5DPSA 1IGCA 2QJLA 4NQLB 5I4DA 5AUKA 2WXNA 1V5UA 4K7WA 1YN4A 2L1AA 2K0PA 3HVDA 1XKEA 4DWFA 4XDCA 4XWWA 4RNAA 3A1QA 2BKFA 1BAKA 4A6HA 3GE8C 1D3ZA 1LGRA 1ESFA 2AX5A 2RPVA 3AE5B 2WXKA 3VUYA 1WXMA 1BMLC 3AE7B 3V5WA 3N30A 2MJEA 3SD5A 2WXFA 3DBRB 4WWMA 2M8SA 2PW9A 4WAFA 3ZJVA 1NVID 1GPXA 2L00B 3BVZA 2RNRB 3R2TA 4GIVA 2JRIB 3SR6A 1D5ZC 1D6EC 3SFEB 4EOYA 4FADA 3ZVVA 2ABDA 1HXYD 5C23A 2YEPF 2LHEA 3WYFB 2AL3A 2J4XA 4WJQA 3U2SC 4WH4A 2K6QA 2KJHB 3A4SC 1J8CA 1VZ6A 5DI9B 3E66A 5CHWA 1UWMA 2AQ2B 4BKTA 4PK1A 5LXIB 3ZO5B 1V61A 4USAA 4ILHA 5D7GA 3H7SA 1ET9A 1XODA 3QCAA 1JDEA 4HAZB 1WMHA 3V60A 5CLQB 1JROA 3GOEA 2W2XC 2LUEA 2K22A 4JIOU 2XN9C 3M62B 5DPRA 2N1WA 1JWAD 4PS8A 4L6EA 2KWDA 3AULA 3DWGC 4W9KA 1ZXIA 1OTRB 2Y5CA 2LVPA 3WANA 3UINB 1QF6A 4RM8A 3IBEA 2KXJA 3QC8B 1MI1A 3M95A 4US9A 5FR3A 1LFDA 4JWSC 3IVFA 3U4EG 2N9PC 1V86A 1FAOA 1OQNA 2C7MB 1W1HA 1L2NA 1N5XA 5EE9A 3NZ3A 1C4AA 3RNFC 2CY4A 4ARIA 2PZ1A 1XEEA 2IGGA 3CSFA 1SIJA 3U8ZA 1SSNA 1IBXA 2DYOA 3PVWA 3PREA 3I63C 3AE2B 2D2QA 1N60A 3DDCB 4EE2A 1PYWD 1J0WA 4KVGB 1OMWA 2G45B 2FCQA 3CIRB 2GOWA 3KH0A 1GOZA 4R3DA 3JVZX 4HB2B 2LVQA 2WDVB 3DBHB 1P1AA 4JKDA 3RCPA 3W5UB 2LXCA 4P16A 2K8CA 3RNEC 1UEFA 5C1ZA 4C4VA 1E8ZA 5EFXA 3A8QA 4KAXB 3L0WB 1V89A 1OY2A 1SHCA 1I4RA 4HDQA 3HW2B 4JWUC 2R82A 4OZAA 5G5GA 2LJ5A 4B6HA 2K8BA 1AYFA 1WX9A 1IUEA 4HATB 4IUMB 2WX1A 5D3YA 3KUDB 1E0ZA 2L2IA 1VBGA 1V6EA 3E9OA 4FULA 2N0YA 2RR9A 3UQBA 1FEHA 3HM3A 2RQ1A 3FC4A 2KQ4X 2IY0B 1RFKA 2KLCA 3H8HA 2UWQA 2RDBC 4ZYSA 2J0MA 3TIXA 4GZUA 1YQ3B 3OJ4B 3ML8A 4OZCA 2KCJA 4RGMA 2WP9B 2YLMA 3RZWC 4YONA 1NTVA 4F7HA 4ZHOA 3ZKJC 1KBLA 2DZMA 1KZGA 2MCNB 3ZRFA 5C79A 4FXCA 4BBNC 1EF1A 1XCTL 3OG5A 1Z2MA 4ZRPA 2W9NA 2KTRB 2V3NA 4MDKE 4YSZB 2KWUB 4F7GA 2M56B 2M0AA 1MPHA 4TMAB 1XD3B 1E8WA 3SNHA 5BMGA 2H7DA 4A5KA 3ZYYX 2MP2B 3DBSA 2INNE 1WJ1A 4II3B 4N59A 4REZA 3D8DA 3ZJUA 3VRBB 4FJVB 3R2IA 2NS5A 1QOGA 2ZW0A 5JH5C 2KKCA 1PGXA 1AWDA 1MVKA 3ZNHB 1TY0A 1ZKHA 3TFMA 3DBRI 5AZGA 2DLWA 1LQBA 3BINA 4EFOA 2N9EB 4GXBA 2KDEB 1HBKA 1ET6A 2MSED 1XQQA 4JX1C 1L6UA 1XXGA 2CR5A 5E6NA 3ZLZA 4IKGA 2ZPYA 3MFGA 4ILJA 4OHJA 2DKQA 1V9JA 2ON8A 1U5GA 1HZ5A 1UGJA 2I5FA 3AV8A 1WG7A 2Z13A 4W9IA 1TGZB 3HHMA 4RGOS 4G0NB 2COCA 2ROVA 3KSYA 2J59M 1T6BX 5I2SA 2LULA 3N3KB 3ML4A 4HAVB 2KVRA 2VRWB 3LJUX 1C9FA 4TYZA 1L6VA 2HJ1A 2K39A 3NWFA 2LGIA 2BYVE 2OOBB 2OJRA 1FD6A 2Z8LA 3IT6B 1YIWA 5JLJB 3K9OB 1L0VB 5EE1A 1B55A 3DQVA 3ODXA 1NYQA 4NNJB 3SYXA 2Q5WD 2ZNVB 3TJPA 3I9V1 5HE0A 2D3AA 4MELA 4HJGE 4IOYX 1H8CA 4GMVA 2WXMA 1GG3A 4HPLB 3UQAA 5LG4B 1YNTE 2R09A 2DFKA 1DOYA 1UNPA 1KH0A 2MFQA 2LBBA 1NI3A 4JKEA 4LDTB 2BBCA 4DX90 2A5UA 3PG7A 2IDYA 3B2FA 1GC6A 1YJIA 1V2YA 1K50A 2KT7A 5KHOA 1TBEA 3DBHI 4CHJA 1XR0B 4E71A 4MT7A 3O65B 1XLOA 1MI0A 3I5JC 3ENBA 2ZCBA 3P4SB 1UNRA 1I7AA 5GOWB 3P7ZA 2C7NB 1TQZA 5IRSA 4IW0A 4RF0A 2DYMA 2EKIA 3MHZA 4DHJD 2PEAA 4HHVA 3NZSA 3E56A 4II2B 2LGYA 4IC7B 2RLOA 3IHPC 1MG8A 3B9JA 1T3QA 3ZXRA 2KYWA 4Z2NA 1L0XB 1C1YB 1PGBA 1FXAA 1WRDB 2JYEA 3T3OA 4B9KA 1U5EA 2LRWA 1X1MA 3P1MA 1I4PA 1TKGA 3ML9A 1EF5A 3VOQA 2D9VA 3NHEB 4LNOA 2HTHA 3VUXA 4HDOA 2JYTA 4O1NA 1FNVA 2DHKA 1SB3C 3BJIA 2ASQA 3TO1A 2DHJA 4HXDA 1FRRA 2IGHA 1C4CA 2CJNA 4M0WA 1KC7A 4XC2A 2NMBA 4K7SA 3V05A 1V88A 1HEZE 1RYJA 3W2DA 5C5BB 3A9KB 1N6ZA 3FM8C 5DHFB 2DZJA 2G3QB 3AE3B 1Q67A 2COPA 1XLPA 5FR6A 2RGFA 2CHXA 5JHGA 3APFA 1ZP0B 1V1PA 3WAPA 1LXDA 1WGRA 2O6VA 3RNGC 4PS3A 3KUCB 4WSFA 2KC2A 3DVGX 2D4QA 4A6KA 2KUPA 2YT1A 4ANUA 1WGYA 2PE9A 1CQVA 2D9YA 2KAJA 1ZM0A 3VHTC 3TUOA 1OQRA 2Y5PA 4YT0B 3B77A 2G4DB 3LYYA 2H88B 2ZZPB 2DA0A 4EJNA 2ZNVC 4NQKE 3BZDB 2BYTA 1UPQA 1MHXA 2Z59B 3ZNID 4BAXA 2WYQA 1QOFA 1DOIA 5AZFA 4ACFA 1KFYB 4X57B 1QOBA 1PLSA 2KWCA 1V49A 4AS1A 1HTQA 2VRRB 2I1KA 1MKEA 1JRPA 2ONQA 3VFKA 2LG1A 4Y94A 2LD9A 4W9CA 2D9ZA 2DWQA 3SBGA 2KFKB 4S17A 3VIAA 3DOWA 1P5TA 1D5XC 2MBHA 4GSWA 2OTXA 3QARA 3Q3OC 1WF9A 2KZRA 3KZ1A 1SE4A 1DDMA 2M1MA 1WH3A 1R4NB 1VDVA 3EA6A 3DVNV 3HSAA 4ZOHC 3PZ7A 1JWMD 1UBIA 4FHJA 1QQGA 4KZCA 1EWYC 2E2XA 4KHBB 3AE4B 2MBBB 3RCZA 3L13A 2UYZB 4AP4C 3PSCA 2XEWA 1BUIC 2Z4DA 3N7CA 3MJWA 3P4RB 4DK5A 4HWIB 4FN2A 3MHSD 1J19A 2HD5B 2MHJA 1QC6A 3H9DA 2NVUI 1SJHD 1WZ0A 3P2BA 4PYUA 3IXSA 5E6PA 4G3XB 4MACA 3RNCC 2K25A 3A98B 1OGWA 1HA5A 2XBBC 4LJPB 1EU4A 2DIKA 1X86A 5D2MB 5G2NA 4BZAA 1XX0A 2V1YA 2MEKA 2LXAA 3ZIMA 2INPE 2KFJA 4QJ4B 2QC8A 3EECA 1T0QC 1FPYA 2MJ3A 1TKYA 4K17A 3ZW3A 2N9KA 4J3OD 2P0HA 4M00A 2KDBA 3VH3B 1DIKA 1M94A 3R7QA 1TJ6A 3GZNB 1WYWB 4JQWC 1ACCA 1DYQA 2ZJDA 1V81A 3CSTA 3R3MA 5LNK1 1U5DA 3DCXA 3NSUA 4GDKB 5JP4A 2CY5A 3W9CB 5C3JB 2LJIA 3GP7A 3SU8X 4MSMB 2VZKB 2Y7BA 2YEPB 4A3PA 5D3VA 4WIPA
chains in the Genus database with same CATH topology
2LRUA 3AI5A 3M3JA 4BFRA 2JRHA 2M4NA 4W9HA 4JKFA 3K9PB 3AXCA 2LOXA 1WFYA 4E3CA 2N7EA 3A4RA 2RGNB 2Y5BB 3AJ4A 2KDIA 1VBHA 2Z0OA 3SHQA 3TL5A 4EEWA 4JKHA 2C5LC 4JGHB 2L7RA 3ZNZB 2MLBA 4XWXA 1KM7A 2BCJA 2EMTA 3C0RB 1Y8RC 3ECIA 2AL6A 4LCDE 5J3TA 3PHXB 1DBHA 3O96A 2KMCA 2KN5A 3VUWA 1KJTA 3TCAA 1NI2A 4K81A 1NTIA 1W1GA 5HKHA 4TUUA 4M8NA 2FAZA 3QJZA 2HE7A 2VSZA 1U4AA 4ZRIA 1PQSA 1M7EA 3B1LX 2N7DA 1A5RA 4ANWA 2HJ8A 3E9PA 2L0FA 2V3SA 3LDZE 3MPXA 2K00A 2O2VB 2KTRA 2Z0QA 2YS1A 1RRBA 2FCSA 4OVUA 3UF8A 1R4NI 3HIZA 4CHKA 4HCPB 2COFA 1Y19B 4BOZB 3UGBB 1P0RA 2MP2A 2BWFA 2L1CA 4WQOB 2V76A 3QIJA 5EDSA 2JF5A 2K8HA 3ZUNA 3PGEA 2ELBA 3TVVA 1GGOA 2K2JA 2IYDB 1JRUA 2R2QA 2C7HA 3ALBA 3QBVB 2M17A 4MGYE 1WVHA 1GC7A 5GMVA 2N1VA 2KX3A 3PLUA 2GCLA 3DPDA 2Z0PA 3JW0X 2KQ7A 5FI0A 2A4ZA 3GZNI 2GBRA 4MGIE 4EKUA 4IWQA 2N4FA 3U7DA 2MX2A 2CQUA 3RD2A 1WGUA 4A6FB 2KTFA 4AUQC 2DYBA 5JZEB 1RLFA 2AEHA 3PHWB 3WIMA 1BWNA 1YJ1A 2KC1A 4K7UA 3HM6X 2CAYA 3RUIB 2I1JA 2L05A 4BOSC 4KV2A 4GGQA 2MDXA 2DAFA 3D32A 3ZTCA 4ANXA 1P98A 2MBOA 4ZDVA 3T9LA 2CRFA 4MSQB 4D0NB 2CHWA 4BVUC 1FGZA 1WJ4A 1GNUA 2NBWB 2LVOA 3H1UA 2L3ZA 5KCVA 2KO3A 4KIKB 4NPNA 1YX5B 4GOCA 2MWNB 2D9XA 2JZZA 1HE8A 2Y8FA 1WJ6A 5DPWA 3TBLD 1WJUA 2MA9B 2PPHA 2REXA 1E8XA 3P6AA 4ZYNA 4FBJB 3JSVB 2KLGA 4JLCA 1DDVA 2LI5A 1W1DA 4ZRJA 1XT9B 1X05A 2KX0A 2MBEA 1FOEA 3QQ8B 3KW5B 3TW1A 4PNKA 1NBFC 1XD4A 1HB6A 2YVCA 4MEMA 5C5BA 3A9KA 3A33B 4JK7A 2L8JA 1G6JA 4NAWB 3VQIA 2D10A 3WAMA 4IFSA 4WJOA 4KZ0A 1FB8A 2GMIC 3R7RA 4DDID 4XX5A 2XQNM 3CF6E 3OLMD 4Z2MB 1WIAA 1U2BA 4MK0A 2LGDA 3L17A 1V5OA 2O6VD 1NDDA 3WALA 3RZFA 1V5MA 1T0YA 1NU2A 4CO7A 2W2XD 2YT0A 2FIDA 1DYNA 3D8FA 4WWNA 4AWJA 1KLVA 1WX8A 4WAAA 2KFKA 5BO4B 1IP9A 2IY1B 4DX8A 3B08A 4URKA 3FSSA 4TKNA 3NOBA 5KQ1A 4WWPA 1Z87A 3ODWA 4HB4B 4BKSA 3PP2A 4FJZA 2KNBA 2D07B 4OVVA 2KJ6A 1UNQA 5D3XA 2YS3A 2VKIA 2MW5A 3ODOA 3VTUA 3M1IB 2ZVNA 4K2PA 3PTFC 4BKGA 3M63B 2H7EA 3ONSA 3OANA 2GJYA 5L83A 4JK8A 3T06A 4WJPA 2NCNA 1NTYA 1IPGA 2UVMA 4GMXB 2P0FA 4GU2A 2AWTA 2EMSA 4HVBA 4DXAB 5L81A 3PVUA 3L16A 3FEHA 1WE7A 1P3RA 5DIFB 2YF0A 1WXAA 2BGFA 2HRJA 2IO3B 2GCJA 1WX7A 3KYDD 4EMOA 4EZKA 3ENEA 4GDKA 2XK5B 4AJWA 3QWZB 4HJKA 1C3TA 2X0SA 4N9F4 2J7QB 3DBLI 2OQBA 1BTKA 5HE2A 4JKAA 1FHOA 2D11A 4IAPA 1UPRA 2RUKB 3VTVA 5IA7A 3NZUA 3PRPB 4W9JA 2FCNA 2IYBA 1AARA 1E7UA 1WR6E 4IM3A 5D94A 2GBNA 4AJYB 1E90A 2C9WB 1WXSA 2GBMA 3IFWB 2JZ3B 3H6NA 1E5WA 3PRMB 4HB3B 1UBQA 4KHOA 4KSKC 3ZRCA 3VXWA 1WM3A 1PMSA 1AQCA 1R4MI 5J18A 4NY0A 4EUTA 1U5FA 4F8CB 3QK0A 3FP5A 2MWSB 1E8YA 4WJNA 4MM3A 2R2OA 4E74A 2BPSA 4MJSB 1DROA 3S2AA 1I35A 5CX3A 3F5RA 2KJRA 3VTWA 2FUHB 5CTRC 2M14A 2KMAA 3DVGY 3SV1A 1V80A 1S3SG 1IYFA 1ISNA 2FNJB 2G35A 2LKOA 4DBBA 2DX5B 4EZLA 5LLIA 5IAAC 1RRPB 3CIKA 2M0XA 1KI1B 3WAOA 2O2VA 3KUZA 4RMAA 5J17A 4DHJB 4W9EA 2CHZA 1FXTB 2LWPA 3PSEB 3Q3FA 2DTCA 1WZ3A 3PLVA 3LJ3A 4KDLB 2KHWB 2RVBB 1ZSQA 3V6EB 4GN1A 4WWOA 2UZRA 1RAXA 4FLHA 3KRWA 3HK0A 2D9WA 2CODA 5AEKB 3A9JB 2L0TA 5G55A 1ZGUB 4B95A 2LGXA 2KDFB 4F1SA 2IZVB 1HB8A 1MIZB 4F7UP 1OEYA 3PPAA 3SBTA 2NBVB 3DXDA 2DX1A 3V6CB 4DBGA 1AWEA 1OQYA 3UIPB 3BY4B 2COAA 2P8VA 5JHBA 1WR1A 2LOZA 4KHAA 2EJ8A 4IM0A 2DZIA 2JP2A 2Q13A 1SIFA 4A6FA 1ZC3B 1TXDA 1LM8B 2FDQA 3GYOA 5E6OA 2GBKA 2KGXB 1EO6A 3APDA 5LOPB 3PS6A 1GJZA 3Q3JA 1DDWA 1EVHA 2LYDA 1S1QB 5KQ4A 4W9LA 1WGGA 3U30A 1UGMA 1P9DU 4GDLB 2JVCA 3OAWA 2JY6A 5CHVC 2KK8A 2DZKA 4HCNB 2W2WA 2ELAA 2KQSA 2EKEC 3D8EA 4FHKA 2ADZA 4KIKA 2NBUA 1E7VA 2DYQA 1WGDA 2PE6B 4HPMB 4ZRKA 2ZCCA 4JKGA 5JVLA 1X1FA 4LDTD 1KOTA 2JWZA 2NPTB 4ANVA 3HQCA 5CLLB 1WGQA 2X18A 1V5TA 5D6JB 2MRPA 1K8RB 3ZTDA 4C0AA 3R66C 3UZTA 3PV1A 3W1SC 5L95C 4GPTB 2PJHA 3JSVA 5AZHA 1J0GA 4NSWA 3A1QB 4TQ1A 3VH4B 3ZDTA 3SO6A 3AU5A 2DN6A 2I5CA 1VCBA 2CB8A 4BBNF 1MK7B 3T8MA 1UD7A 3SDLC 4W9GA 2JUOA 3VDZA 2IO2B 2K2UA 4NAWA 3RYTA 5C16A 2IO1B 5DCNA 1ST7A 3ULBA 2BKRB 1BT0A 4WVFB 2QKMA 1EUVB 3E9LA 1NVLA 1UH6A 2K6DB 4I6NB 3ZNGC 2FJ9A 5J2RA 1WMHB 3DVNU 2J0KA 3L08A 1Q5WB 2WDTB 4GB9A 1BTNA 3IG3A 1U29A 1YQBA 3MDBC 2YRYA 3H7PA 2DAJA 4JKGB 2MBQA 2JXXA 2R0DA 3PZDA 4HK2A 3RT3B 4HB0B 1TTNA 1MAIA 4G11A 3I3TB 3ZVRA 1WY8A 2GBJA 4MGKE 3QX1A 1PFJA 5LXHA 1ZW7A 4DHZB 3QA8A 2IBIB 3UIOB 2C60A 3N32A 4LJOB 4G50A 3L10B 5D3WA 2UZSA 2L76A 2D3GA 5DPTA 4P7IA 3W1YA 1XCGA 5KHQA 3QAQA 4BKSD 2FJLA 2DHZA 2RSGA 2KANA 2GS0A 4ICUA 4A3OA 3KY9A 2DHIA 4MH0E 3PT2B 1P3QU 3VAWA 1K5GB 1U27A 1Q0WB 2MQJA 4IWPA 4J6IA 1WI1A 3AU4A 3L54A 1SE9A 4JL9A 1Y5OA 4KSLC 2IO0B 1I42A 2NR2A 4MY6A 2CKHB 2XK5A 2BYFA 1L7YA 4XZ4A 2BWES 3H7PB 1OEYJ 4FA6A 4H8SA 2KD0A 1M7RA 3DXCA 4PQ0A 3GYPA 4FJYA 4JKCA 3NS8A 1Z5SB 4ASWC 3V61A 3KYCD 1CMXB 3SUZA 2Z0EB 4W9DA 4KDIC 3TMPB 1ZC4B 3QWMA 1GUAB 5FI1A 3EPYA 1RFAA 3EHVA 2QKLA 1WJNA 2BF8B 2ROZB 3MTNB 2FCMA 1WXVA 1EAZA 2YSZA 2KOXA 4W9FA 3KRXA 1X1GA 5D27A 3APCA 1MIXA 2WX0A 1WI0A 2RD0A 2LZ6A 3DXEA 4I6LB 4K1RB 3V62A 1IRSA 1WE6A 2CS4A 4MJSA 3OJ3A 1I2HA 2MKRA 4RM9A 2BYEA 1MK9B 1LW3A 3ZDMC 3F0WA 4HAUB 5DHAB 4AOFA 3X23A 2DX5A 3RULA 2DKPA 2ZPNA 2DENB 2YS5A 1Q1OA 2J0JA 1KZ7A 1FHXA 1H4RA 3WA0A 1N3HA 2RPQA 4EZJA 1K5DB 4IG7B 4NJ7A 3CXBB 1UELA 5CHFA 5IJMA 3G9WA 4BBKA 2ZVOA 1P6SA 3EFUA 4CHMA 3EC8A 4PYZA 4DDGD 5JHAA 5JHHA 2WWZA 4JKBA 4TQ0A 5J3YA 2Z0DB 4NJ6A 3KVFB 4F7ZA 5J3QA 3W1SA 2Y8GA 2CU1A 2AYOB 3A8PA 2N23A 1X11A 3A9JA 1H10A 3VVWB 4IWOA 4HAYB 4A20A 1WGHA 2HTHB 5C6RA 5TR5A 4ICVA 1RJ2A 1WJMA 5HE1A 2FIFA 4M0WB 4DHZE 1F9JA 2LASA 2QHOA 4CYEA 1FGYA 4K2OA 1QZEA 2JT4B 5HE3A 2NZ8B 4I6PA 3CMMB 1ZVRA 2DYNA 2O6VB 4HAXB 2P0DA 2KWVB 1LB1A 3NY5A 4IM2A 2M38A 2G4SA 4PS7A 1YD8U 1ACAA 3B0AA 1VD2A 1YX6B 2B3AA 1SGHA 3X0WA 4HLEA 3PVLA 4HAWB 4B6WA 4TV3A 4YL8A 3JYUA 2V4LA 4GDLA 4JK9A 2EC1A 1EGXA 5LONB 2JPHA 2ZEQA 1WM2A 1V5PA 2N9XA 1TZ1A 3QHTA 4ILGB 2RSUA 4MGZE 3PRZA 3ULCA 4M8MA 4WJ7A 1UZXB 1FHWA 2IFSA 2NPTA 3DCGA 5DH9B 2K1FA 2WH5A 3FLVA 3PEGA 5DPSA 4NQLB 1V5UA 4K7WA 1XKEA 4DWFA 3A1QA 2BKFA 1BAKA 4A6HA 1D3ZA 3VUYA 1WXMA 3V5WA 3N30A 3SD5A 2M8SA 2L00B 2RNRB 4GIVA 2JRIB 4FADA 4EOYA 3ZVVA 2ABDA 5C23A 3WYFB 2AL3A 4WJQA 2K6QA 2KJHB 3A4SC 1J8CA 5DI9B 3E66A 5CHWA 4BKTA 5LXIB 3ZO5B 1V61A 5D7GA 4ILHA 3H7SA 1XODA 3QCAA 1JDEA 4HAZB 1WMHA 3V60A 5CLQB 3GOEA 2W2XC 2LUEA 4JIOU 3M62B 5DPRA 2N1WA 4PS8A 4L6EA 3AULA 4W9KA 1OTRB 2LVPA 3WANA 3UINB 4RM8A 3IBEA 2KXJA 3QC8B 3M95A 1LFDA 3IVFA 2N9PC 1V86A 1FAOA 1OQNA 2C7MB 1W1HA 1L2NA 2CY4A 2PZ1A 3CSFA 3U8ZA 2DYOA 3PVWA 3PREA 2D2QA 3DDCB 2G45B 1J0WA 4KVGB 1OMWA 2FCQA 2GOWA 3KH0A 3JVZX 4HB2B 2LVQA 1P1AA 4JKDA 3RCPA 2LXCA 2K8CA 1UEFA 5C1ZA 1E8ZA 5EFXA 3A8QA 4KAXB 3L0WB 1V89A 1OY2A 1SHCA 4HDQA 3HW2B 2R82A 2LJ5A 4B6HA 2K8BA 1WX9A 4HATB 4IUMB 2WX1A 5D3YA 3KUDB 2L2IA 1VBGA 1V6EA 3E9OA 4FULA 2N0YA 2RR9A 3UQBA 3HM3A 2RQ1A 2IY0B 2KLCA 2UWQA 2J0MA 3TIXA 4GZUA 3OJ4B 3ML8A 2KCJA 3RZWC 2YLMA 4YONA 1NTVA 4F7HA 3ZKJC 1KBLA 2DZMA 1KZGA 2MCNB 3ZRFA 5C79A 4BBNC 1EF1A 1Z2MA 2W9NA 2KTRB 4MDKE 2KWUB 4F7GA 1MPHA 1XD3B 1E8WA 3SNHA 2H7DA 4A5KA 2MP2B 3DBSA 1WJ1A 4II3B 3D8DA 4FJVB 2NS5A 5JH5C 2KKCA 3ZNHB 1ZKHA 3DBRI 3TFMA 5AZGA 2DLWA 1LQBA 3BINA 4EFOA 2N9EB 4GXBA 2KDEB 1HBKA 2MSED 1XQQA 2CR5A 5E6NA 3ZLZA 2ZPYA 4ILJA 2DKQA 1V9JA 1U5GA 2I5FA 1WG7A 4W9IA 1TGZB 3HHMA 4G0NB 2COCA 2ROVA 3KSYA 2J59M 2LULA 3N3KB 3ML4A 4HAVB 2KVRA 2VRWB 3LJUX 4TYZA 2K39A 2BYVE 2OOBB 2OJRA 1YIWA 5JLJB 3K9OB 1B55A 3DQVA 3ODXA 4NNJB 3SYXA 2ZNVB 3TJPA 5HE0A 4MELA 4IOYX 1H8CA 4GMVA 1GG3A 4HPLB 3UQAA 2R09A 2DFKA 1UNPA 2MFQA 2LBBA 4LDTB 4JKEA 4DX90 2A5UA 3PG7A 1GC6A 1V2YA 5KHOA 1TBEA 3DBHI 4CHJA 1XR0B 4E71A 4MT7A 3O65B 3ENBA 2ZCBA 1UNRA 1I7AA 5GOWB 3P7ZA 2C7NB 1TQZA 4IW0A 2DYMA 4DHJD 2PEAA 4HHVA 3NZSA 4II2B 2LGYA 4IC7B 2RLOA 3IHPC 1MG8A 4Z2NA 1C1YB 1WRDB 4B9KA 1U5EA 2LRWA 1X1MA 3ML9A 1EF5A 3VOQA 2D9VA 3NHEB 2HTHA 3VUXA 4HDOA 2DHKA 3BJIA 2ASQA 3TO1A 2DHJA 4HXDA 1KC7A 4XC2A 2NMBA 4K7SA 1V88A 5C5BB 3A9KB 3FM8C 5DHFB 2DZJA 2G3QB 1Q67A 2COPA 5FR6A 2RGFA 2CHXA 5JHGA 3APFA 3WAPA 1LXDA 1WGRA 2O6VA 4PS3A 3KUCB 4WSFA 2KC2A 3DVGX 2D4QA 4A6KA 2KUPA 2YT1A 4ANUA 1WGYA 2PE9A 2D9YA 1ZM0A 3VHTC 2G4DB 2ZZPB 2DA0A 4EJNA 2ZNVC 4NQKE 1UPQA 2Z59B 3ZNID 2WYQA 5AZFA 4X57B 2KWCA 1PLSA 1V49A 2VRRB 2I1KA 1MKEA 3VFKA 2LG1A 4Y94A 2LD9A 4W9CA 2D9ZA 3SBGA 2KFKB 3VIAA 3DOWA 1P5TA 2MBHA 4GSWA 2OTXA 3QARA 1WF9A 2KZRA 3KZ1A 1DDMA 2M1MA 1WH3A 3DVNV 1UBIA 4FHJA 1QQGA 4KZCA 2E2XA 4KHBB 2MBBB 3RCZA 3L13A 2UYZB 4AP4C 3PSCA 2XEWA 3N7CA 3MJWA 4DK5A 4HWIB 4FN2A 3MHSD 1J19A 2HD5B 1QC6A 3H9DA 2NVUI 1WZ0A 3P2BA 5E6PA 4PYUA 4G3XB 2K25A 3A98B 1OGWA 2XBBC 4LJPB 2DIKA 1X86A 5D2MB 5G2NA 1XX0A 2V1YA 2LXAA 3ZIMA 2KFJA 3EECA 4K17A 3ZW3A 2P0HA 3VH3B 2KDBA 1DIKA 3R7QA 1M94A 1TJ6A 1WYWB 4JQWC 2ZJDA 1V81A 3CSTA 3R3MA 1U5DA 3NSUA 4GDKB 5JP4A 2CY5A 3SU8X 4MSMB 2Y7BA 4A3PA 5D3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRU A;  3AI5 A;  3M3J A;  4BFR A;  2JRH A;  2M4N A;  4W9H A;  3K9P B;  3AXC A;  2LOX A;  1WFY A;  4E3C A;  2N7E A;  3A4R A;  2RGN B;  2Y5B B;  3AJ4 A;  2KDI A;  2Z0O A;  3SHQ A;  3TL5 A;  4EEW A;  2C5L C;  4JGH B;  2L7R A;  3ZNZ B;  2MLB A;  4XWX A;  1KM7 A;  2BCJ A;  2EMT A;  3C0R B;  1Y8R C;  3ECI A;  2AL6 A;  4LCD E;  5J3T A;  3PHX B;  1DBH A;  3O96 A;  2KMC A;  2KN5 A;  3VUW A;  1KJT A;  3TCA A;  1NI2 A;  4K81 A;  1NTI A;  1W1G A;  5HKH A;  4TUU A;  4M8N A;  2FAZ A;  3QJZ A;  2HE7 A;  2VSZ A;  1U4A A;  4ZRI A;  1PQS A;  1M7E A;  3B1L X;  2N7D A;  1A5R A;  4ANW A;  2HJ8 A;  2L0F A;  2V3S A;  3LDZ E;  3MPX A;  2K00 A;  2O2V B;  2KTR A;  2Z0Q A;  2YS1 A;  1RRB A;  2FCS A;  4OVU A;  3UF8 A;  1R4N I;  3HIZ A;  4CHK A;  4HCP B;  2COF A;  1Y19 B;  4BOZ B;  3UGB B;  1P0R A;  2MP2 A;  2BWF A;  2L1C A;  4WQO B;  2V76 A;  3QIJ A;  5EDS A;  2JF5 A;  2K8H A;  3ZUN A;  3PGE A;  2ELB A;  3TVV A;  2K2J A;  2IYD B;  1JRU A;  2R2Q A;  2C7H A;  3ALB A;  3QBV B;  2M17 A;  4MGY E;  1WVH A;  1GC7 A;  5GMV A;  2N1V A;  2KX3 A;  3PLU A;  2GCL A;  3DPD A;  2Z0P A;  3JW0 X;  2KQ7 A;  5FI0 A;  2A4Z A;  3GZN I;  2GBR A;  4MGI E;  4EKU A;  4IWQ A;  2N4F A;  3U7D A;  2MX2 A;  2CQU A;  3RD2 A;  1WGU A;  4A6F B;  2KTF A;  4AUQ C;  2DYB A;  5JZE B;  1RLF A;  2AEH A;  3PHW B;  3WIM A;  1BWN A;  1YJ1 A;  2KC1 A;  4K7U A;  3HM6 X;  2CAY A;  3RUI B;  2I1J A;  2L05 A;  4BOS C;  4KV2 A;  4GGQ A;  2MDX A;  2DAF A;  3D32 A;  3ZTC A;  4ANX A;  1P98 A;  2MBO A;  4ZDV A;  3T9L A;  2CRF A;  4MSQ B;  4D0N B;  2CHW A;  4BVU C;  1FGZ A;  1WJ4 A;  1GNU A;  2NBW B;  2LVO A;  3H1U A;  2L3Z A;  5KCV A;  2KO3 A;  4KIK B;  4NPN A;  1YX5 B;  4GOC A;  2MWN B;  2D9X A;  2JZZ A;  1HE8 A;  2Y8F A;  1WJ6 A;  5DPW A;  3TBL D;  1WJU A;  2MA9 B;  2PPH A;  2REX A;  1E8X A;  3P6A A;  4ZYN A;  4FBJ B;  3JSV B;  2KLG A;  4JLC A;  1DDV A;  2LI5 A;  1W1D A;  4ZRJ A;  1XT9 B;  1X05 A;  2KX0 A;  2MBE A;  1FOE A;  3QQ8 B;  3KW5 B;  3TW1 A;  4PNK A;  1NBF C;  1XD4 A;  1HB6 A;  2YVC A;  4MEM A;  5C5B A;  3A9K A;  3A33 B;  2L8J A;  1G6J A;  4NAW B;  3VQI A;  2D10 A;  3WAM A;  4IFS A;  4WJO A;  4KZ0 A;  1FB8 A;  2GMI C;  3R7R A;  4DDI D;  4XX5 A;  2XQN M;  3CF6 E;  3OLM D;  4Z2M B;  1WIA A;  1U2B A;  4MK0 A;  2LGD A;  3L17 A;  1V5O A;  2O6V D;  1NDD A;  3WAL A;  3RZF A;  1V5M A;  1T0Y A;  1NU2 A;  4CO7 A;  2W2X D;  2YT0 A;  2FID A;  1DYN A;  3D8F A;  4WWN A;  4AWJ A;  1KLV A;  1WX8 A;  4WAA A;  2KFK A;  5BO4 B;  1IP9 A;  2IY1 B;  4DX8 A;  3B08 A;  4URK A;  3FSS A;  4TKN A;  3NOB A;  5KQ1 A;  4WWP A;  1Z87 A;  3ODW A;  4HB4 B;  4BKS A;  3PP2 A;  4FJZ A;  2KNB A;  2D07 B;  4OVV A;  2KJ6 A;  1UNQ A;  5D3X A;  2YS3 A;  2VKI A;  2MW5 A;  3ODO A;  3VTU A;  3M1I B;  2ZVN A;  4K2P A;  3PTF C;  4BKG A;  3M63 B;  2H7E A;  3ONS A;  3OAN A;  2GJY A;  5L83 A;  3T06 A;  4WJP A;  2NCN A;  1NTY A;  1IPG A;  2UVM A;  4GMX B;  2P0F A;  4GU2 A;  2AWT A;  2EMS A;  4HVB A;  4DXA B;  5L81 A;  3PVU A;  3L16 A;  3FEH A;  1WE7 A;  1P3R A;  5DIF B;  2YF0 A;  1WXA A;  2BGF A;  2HRJ A;  2IO3 B;  2GCJ A;  1WX7 A;  3KYD D;  4EMO A;  4EZK A;  3ENE A;  4GDK A;  2XK5 B;  4AJW A;  3QWZ B;  4HJK A;  1C3T A;  4N9F 4;  2J7Q B;  3DBL I;  2OQB A;  1BTK A;  5HE2 A;  1FHO A;  2D11 A;  4IAP A;  1UPR A;  2RUK B;  3VTV A;  5IA7 A;  3NZU A;  3PRP B;  4W9J A;  2FCN A;  2IYB A;  1AAR A;  1E7U A;  1WR6 E;  4IM3 A;  5D94 A;  2GBN A;  4AJY B;  1E90 A;  2C9W B;  1WXS A;  2GBM A;  3IFW B;  2JZ3 B;  3H6N A;  1E5W A;  3PRM B;  4HB3 B;  1UBQ A;  4KHO A;  4KSK C;  3ZRC A;  3VXW A;  1WM3 A;  1PMS A;  1AQC A;  1R4M I;  5J18 A;  4NY0 A;  4EUT A;  1U5F A;  4F8C B;  3QK0 A;  3FP5 A;  2MWS B;  1E8Y A;  4WJN A;  4MM3 A;  2R2O A;  4E74 A;  2BPS A;  4MJS B;  1DRO A;  3S2A A;  1I35 A;  5CX3 A;  3F5R A;  2KJR A;  3VTW A;  2FUH B;  5CTR C;  2M14 A;  2KMA A;  3DVG Y;  3SV1 A;  1V80 A;  1S3S G;  1IYF A;  1ISN A;  2FNJ B;  2G35 A;  2LKO A;  4DBB A;  2DX5 B;  4EZL A;  5LLI A;  5IAA C;  1RRP B;  3CIK A;  2M0X A;  1KI1 B;  3WAO A;  2O2V A;  3KUZ A;  4RMA A;  5J17 A;  4DHJ B;  4W9E A;  2CHZ A;  1FXT B;  2LWP A;  3PSE B;  3Q3F A;  2DTC A;  1WZ3 A;  3PLV A;  3LJ3 A;  4KDL B;  2KHW B;  2RVB B;  1ZSQ A;  3V6E B;  4GN1 A;  4WWO A;  2UZR A;  1RAX A;  4FLH A;  3KRW A;  3HK0 A;  2D9W A;  2COD A;  5AEK B;  3A9J B;  2L0T A;  5G55 A;  1ZGU B;  4B95 A;  2LGX A;  2KDF B;  4F1S A;  2IZV B;  1HB8 A;  1MIZ B;  4F7U P;  1OEY A;  3PPA A;  2NBV B;  3DXD A;  2DX1 A;  3V6C B;  4DBG A;  1AWE A;  1OQY A;  3UIP B;  3BY4 B;  2COA A;  2P8V A;  5JHB A;  1WR1 A;  2LOZ A;  4KHA A;  2EJ8 A;  4IM0 A;  2DZI A;  2JP2 A;  2Q13 A;  1SIF A;  4A6F A;  1ZC3 B;  1TXD A;  1LM8 B;  2FDQ A;  3GYO A;  5E6O A;  2GBK A;  2KGX B;  1EO6 A;  3APD A;  5LOP B;  3PS6 A;  1GJZ A;  3Q3J A;  1DDW A;  1EVH A;  2LYD A;  1S1Q B;  5KQ4 A;  4W9L A;  1WGG A;  3U30 A;  1UGM A;  1P9D U;  4GDL B;  2JVC A;  3OAW A;  2JY6 A;  5CHV C;  2KK8 A;  2DZK A;  4HCN B;  2W2W A;  2ELA A;  2KQS A;  2EKE C;  3D8E A;  4FHK A;  2ADZ A;  4KIK A;  2NBU A;  1E7V A;  2DYQ A;  1WGD A;  2PE6 B;  4HPM B;  4ZRK A;  2ZCC A;  1X1F A;  4LDT D;  1KOT A;  2JWZ A;  2NPT B;  4ANV A;  3HQC A;  5CLL B;  1WGQ A;  2X18 A;  1V5T A;  5D6J B;  2MRP A;  1K8R B;  3ZTD A;  4C0A A;  3R66 C;  3UZT A;  3PV1 A;  3W1S C;  5L95 C;  4GPT B;  2PJH A;  3JSV A;  5AZH A;  1J0G A;  4NSW A;  3A1Q B;  4TQ1 A;  3VH4 B;  3ZDT A;  3SO6 A;  3AU5 A;  2DN6 A;  2I5C A;  1VCB A;  2CB8 A;  4BBN F;  1MK7 B;  3T8M A;  1UD7 A;  3SDL C;  4W9G A;  2JUO A;  3VDZ A;  2IO2 B;  2K2U A;  4NAW A;  3RYT A;  5C16 A;  2IO1 B;  5DCN A;  1ST7 A;  3ULB A;  2BKR B;  1BT0 A;  4WVF B;  2QKM A;  1EUV B;  1NVL A;  1UH6 A;  2K6D B;  4I6N B;  3ZNG C;  2FJ9 A;  5J2R A;  1WMH B;  3DVN U;  2J0K A;  3L08 A;  1Q5W B;  2WDT B;  4GB9 A;  1BTN A;  3IG3 A;  1U29 A;  1YQB A;  3MDB C;  2YRY A;  3H7P A;  2DAJ A;  2MBQ A;  2JXX A;  2R0D A;  3PZD A;  4HK2 A;  3RT3 B;  4HB0 B;  1TTN A;  1MAI A;  4G11 A;  3I3T B;  3ZVR A;  1WY8 A;  2GBJ A;  4MGK E;  3QX1 A;  1PFJ A;  5LXH A;  1ZW7 A;  4DHZ B;  3QA8 A;  2IBI B;  3UIO B;  2C60 A;  3N32 A;  4LJO B;  4G50 A;  3L10 B;  5D3W A;  2UZS A;  2L76 A;  2D3G A;  5DPT A;  4P7I A;  3W1Y A;  1XCG A;  5KHQ A;  3QAQ A;  4BKS D;  2FJL A;  2DHZ A;  2RSG A;  2KAN A;  2GS0 A;  4ICU A;  4A3O A;  3KY9 A;  2DHI A;  4MH0 E;  3PT2 B;  1P3Q U;  3VAW A;  1K5G B;  1U27 A;  1Q0W B;  2MQJ A;  4IWP A;  4J6I A;  1WI1 A;  3AU4 A;  3L54 A;  1SE9 A;  4JL9 A;  1Y5O A;  4KSL C;  2IO0 B;  1I42 A;  2NR2 A;  4MY6 A;  2CKH B;  2XK5 A;  2BYF A;  1L7Y A;  4XZ4 A;  2BWE S;  3H7P B;  1OEY J;  4FA6 A;  4H8S A;  2KD0 A;  1M7R A;  3DXC A;  4PQ0 A;  3GYP A;  4FJY A;  3NS8 A;  1Z5S B;  4ASW C;  3V61 A;  3KYC D;  1CMX B;  3SUZ A;  2Z0E B;  4W9D A;  4KDI C;  3TMP B;  1ZC4 B;  3QWM A;  1GUA B;  5FI1 A;  3EPY A;  1RFA A;  3EHV A;  2QKL A;  1WJN A;  2BF8 B;  2ROZ B;  3MTN B;  2FCM A;  1WXV A;  1EAZ A;  2YSZ A;  2KOX A;  4W9F A;  3KRX A;  1X1G A;  5D27 A;  3APC A;  1MIX A;  2WX0 A;  1WI0 A;  2RD0 A;  2LZ6 A;  3DXE A;  4I6L B;  4K1R B;  3V62 A;  1IRS A;  1WE6 A;  2CS4 A;  4MJS A;  3OJ3 A;  1I2H A;  2MKR A;  4RM9 A;  2BYE A;  1MK9 B;  1LW3 A;  3ZDM C;  3F0W A;  4HAU B;  5DHA B;  4AOF A;  3X23 A;  2DX5 A;  3RUL A;  2DKP A;  2ZPN A;  2DEN B;  2YS5 A;  1Q1O A;  2J0J A;  1KZ7 A;  1FHX A;  1H4R A;  3WA0 A;  1N3H A;  2RPQ A;  4EZJ A;  1K5D B;  4IG7 B;  4NJ7 A;  3CXB B;  1UEL A;  5CHF A;  5IJM A;  3G9W A;  4BBK A;  2ZVO A;  1P6S A;  3EFU A;  4CHM A;  3EC8 A;  4PYZ A;  4DDG D;  5JHA A;  5JHH A;  2WWZ A;  4TQ0 A;  5J3Y A;  2Z0D B;  4NJ6 A;  3KVF B;  4F7Z A;  5J3Q A;  3W1S A;  2Y8G A;  2CU1 A;  2AYO B;  3A8P A;  2N23 A;  1X11 A;  3A9J A;  1H10 A;  3VVW B;  4IWO A;  4HAY B;  4A20 A;  1WGH A;  2HTH B;  5C6R A;  5TR5 A;  4ICV A;  1RJ2 A;  1WJM A;  5HE1 A;  2FIF A;  4M0W B;  4DHZ E;  1F9J A;  2LAS A;  2QHO A;  4CYE A;  1FGY A;  4K2O A;  1QZE A;  2JT4 B;  5HE3 A;  2NZ8 B;  4I6P A;  3CMM B;  1ZVR A;  2DYN A;  2O6V B;  4HAX B;  2P0D A;  2KWV B;  1LB1 A;  3NY5 A;  4IM2 A;  2M38 A;  2G4S A;  4PS7 A;  1YD8 U;  1ACA A;  3B0A A;  1VD2 A;  1YX6 B;  2B3A A;  1SGH A;  3X0W A;  4HLE A;  3PVL A;  4HAW B;  4B6W A;  4TV3 A;  4YL8 A;  3JYU A;  2V4L A;  4GDL A;  2EC1 A;  1EGX A;  5LON B;  2JPH A;  2ZEQ A;  1WM2 A;  1V5P A;  2N9X A;  1TZ1 A;  3QHT A;  2RSU A;  4MGZ E;  3PRZ A;  3ULC A;  4M8M A;  4WJ7 A;  1UZX B;  1FHW A;  2IFS A;  2NPT A;  3DCG A;  5DH9 B;  2K1F A;  2WH5 A;  3FLV A;  3PEG A;  5DPS A;  4NQL B;  1V5U A;  4K7W A;  1XKE A;  4DWF A;  3A1Q A;  2BKF A;  1BAK A;  4A6H A;  1D3Z A;  3VUY A;  1WXM A;  3V5W A;  3N30 A;  3SD5 A;  2M8S A;  2L00 B;  2RNR B;  4GIV A;  2JRI B;  4FAD A;  4EOY A;  3ZVV A;  2ABD A;  5C23 A;  3WYF B;  2AL3 A;  4WJQ A;  2K6Q A;  2KJH B;  3A4S C;  1J8C A;  5DI9 B;  5CHW A;  4BKT A;  5LXI B;  3ZO5 B;  1V61 A;  5D7G A;  3H7S A;  1XOD A;  3QCA A;  4HAZ B;  1WMH A;  3V60 A;  5CLQ B;  3GOE A;  2W2X C;  2LUE A;  4JIO U;  3M62 B;  5DPR A;  2N1W A;  4PS8 A;  4L6E A;  3AUL A;  4W9K A;  1OTR B;  2LVP A;  3WAN A;  3UIN B;  4RM8 A;  3IBE A;  2KXJ A;  3QC8 B;  3M95 A;  1LFD A;  3IVF A;  2N9P C;  1V86 A;  1FAO A;  1OQN A;  2C7M B;  1W1H A;  1L2N A;  2CY4 A;  2PZ1 A;  3CSF A;  3U8Z A;  2DYO A;  3PVW A;  3PRE A;  2D2Q A;  3DDC B;  2G45 B;  1J0W A;  4KVG B;  1OMW A;  2FCQ A;  2GOW A;  3KH0 A;  3JVZ X;  4HB2 B;  2LVQ A;  1P1A A;  3RCP A;  2LXC A;  2K8C A;  1UEF A;  5C1Z A;  1E8Z A;  5EFX A;  3A8Q A;  4KAX B;  3L0W B;  1V89 A;  1OY2 A;  1SHC A;  4HDQ A;  3HW2 B;  2LJ5 A;  4B6H A;  2K8B A;  1WX9 A;  4HAT B;  4IUM B;  2WX1 A;  5D3Y A;  3KUD B;  2L2I A;  1V6E A;  4FUL A;  2N0Y A;  2RR9 A;  3UQB A;  3HM3 A;  2RQ1 A;  2IY0 B;  2KLC A;  2UWQ A;  2J0M A;  3TIX A;  4GZU A;  3OJ4 B;  3ML8 A;  2KCJ A;  3RZW C;  2YLM A;  4YON A;  1NTV A;  4F7H A;  3ZKJ C;  2DZM A;  1KZG A;  2MCN B;  3ZRF A;  5C79 A;  4BBN C;  1EF1 A;  1Z2M A;  2W9N A;  2KTR B;  4MDK E;  2KWU B;  4F7G A;  1MPH A;  1XD3 B;  1E8W A;  3SNH A;  2H7D A;  4A5K A;  2MP2 B;  3DBS A;  1WJ1 A;  4II3 B;  3D8D A;  4FJV B;  2NS5 A;  5JH5 C;  2KKC A;  3ZNH B;  1ZKH A;  3DBR I;  3TFM A;  5AZG A;  2DLW A;  1LQB A;  3BIN A;  4EFO A;  2N9E B;  4GXB A;  2KDE B;  1HBK A;  2MSE D;  1XQQ A;  2CR5 A;  5E6N A;  3ZLZ A;  2ZPY A;  2DKQ A;  1V9J A;  1U5G A;  2I5F A;  1WG7 A;  4W9I A;  1TGZ B;  3HHM A;  4G0N B;  2COC A;  2ROV A;  3KSY A;  2J59 M;  2LUL A;  3N3K B;  3ML4 A;  4HAV B;  2KVR A;  2VRW B;  3LJU X;  4TYZ A;  2K39 A;  2BYV E;  2OOB B;  2OJR A;  1YIW A;  5JLJ B;  3K9O B;  1B55 A;  3DQV A;  3ODX A;  4NNJ B;  3SYX A;  2ZNV B;  3TJP A;  5HE0 A;  4MEL A;  4IOY X;  1H8C A;  4GMV A;  1GG3 A;  4HPL B;  3UQA A;  2R09 A;  2DFK A;  1UNP A;  2MFQ A;  2LBB A;  4LDT B;  4DX9 0;  2A5U A;  3PG7 A;  1GC6 A;  1V2Y A;  5KHO A;  1TBE A;  3DBH I;  4CHJ A;  1XR0 B;  4E71 A;  4MT7 A;  3O65 B;  2ZCB A;  1UNR A;  1I7A A;  5GOW B;  3P7Z A;  2C7N B;  1TQZ A;  4IW0 A;  2DYM A;  4DHJ D;  2PEA A;  4HHV A;  3NZS A;  4II2 B;  2LGY A;  4IC7 B;  2RLO A;  3IHP C;  1MG8 A;  4Z2N A;  1C1Y B;  1WRD B;  4B9K A;  1U5E A;  2LRW A;  1X1M A;  3ML9 A;  1EF5 A;  3VOQ A;  2D9V A;  3NHE B;  2HTH A;  3VUX A;  4HDO A;  2DHK A;  3BJI A;  2ASQ A;  3TO1 A;  2DHJ A;  4HXD A;  4XC2 A;  2NMB A;  4K7S A;  1V88 A;  5C5B B;  3A9K B;  3FM8 C;  5DHF B;  2DZJ A;  2G3Q B;  1Q67 A;  2COP A;  5FR6 A;  2RGF A;  2CHX A;  5JHG A;  3APF A;  3WAP A;  1LXD A;  1WGR A;  2O6V A;  4PS3 A;  3KUC B;  4WSF A;  2KC2 A;  3DVG X;  2D4Q A;  4A6K A;  2KUP A;  2YT1 A;  4ANU A;  1WGY A;  2PE9 A;  2D9Y A;  1ZM0 A;  3VHT C;  2G4D B;  2ZZP B;  2DA0 A;  4EJN A;  2ZNV C;  4NQK E;  1UPQ A;  2Z59 B;  3ZNI D;  2WYQ A;  5AZF A;  4X57 B;  2KWC A;  1PLS A;  1V49 A;  2VRR B;  2I1K A;  1MKE A;  3VFK A;  2LG1 A;  4Y94 A;  2LD9 A;  4W9C A;  2D9Z A;  2KFK B;  3VIA A;  3DOW A;  1P5T A;  2MBH A;  4GSW A;  2OTX A;  3QAR A;  1WF9 A;  2KZR A;  3KZ1 A;  1DDM A;  2M1M A;  1WH3 A;  3DVN V;  1UBI A;  4FHJ A;  1QQG A;  4KZC A;  2E2X A;  4KHB B;  2MBB B;  3RCZ A;  3L13 A;  2UYZ B;  4AP4 C;  3PSC A;  2XEW A;  3N7C A;  3MJW A;  4DK5 A;  4HWI B;  4FN2 A;  3MHS D;  1J19 A;  2HD5 B;  1QC6 A;  3H9D A;  2NVU I;  1WZ0 A;  3P2B A;  5E6P A;  4PYU A;  4G3X B;  2K25 A;  3A98 B;  1OGW A;  2XBB C;  4LJP B;  1X86 A;  5D2M B;  5G2N A;  1XX0 A;  2V1Y A;  2LXA A;  3ZIM A;  2KFJ A;  3EEC A;  4K17 A;  3ZW3 A;  2P0H A;  3VH3 B;  2KDB A;  1M94 A;  3R7Q A;  1TJ6 A;  1WYW B;  4JQW C;  2ZJD A;  1V81 A;  3CST A;  3R3M A;  1U5D A;  3NSU A;  4GDK B;  5JP4 A;  2CY5 A;  3SU8 X;  4MSM B;  2Y7B A;  4A3P A;  5D3V A; 
#chains in the Genus database with same CATH topology
 2LRU A;  2OED A;  3AH7 A;  3N9Y C;  3AI5 A;  3M3J A;  3AM9 A;  4BFR A;  2JRH A;  4S0R A;  2M4N A;  4W9H A;  3Q8F A;  4JKF A;  1RWS A;  3K9P B;  3AXC A;  2LOX A;  1WFY A;  4E3C A;  2N7E A;  3A4R A;  2RGN B;  4WUR A;  1VLB A;  2Y5B B;  3AJ4 A;  2KDI A;  3N1X C;  1VBH A;  2BB6 A;  2Z0O A;  3SHQ A;  4DQO C;  3TL5 A;  1XLN A;  4EEW A;  4JKH A;  2C5L C;  4JGH B;  2BB5 A;  2L7R A;  3ZNZ B;  2PTL A;  2PLP A;  4ZRQ A;  2MLB A;  4XWX A;  1KM7 A;  2BCJ A;  1I4Q A;  2EMT A;  2UU7 A;  3C0R B;  1Y8R C;  3ECI A;  2AL6 A;  1TS3 A;  4LCD E;  2J42 A;  5J3T A;  3PHX B;  1DBH A;  3O96 A;  2KMC A;  2KN5 A;  4OZB A;  3VUW A;  1KJT A;  3TCA A;  1NI2 A;  4K81 A;  1NTI A;  3P4P B;  4NZL B;  1W1G A;  5HKH A;  3BK1 A;  4MM3 B;  3B2G A;  4TUU A;  2LEK A;  4M8N A;  2FAZ A;  3QJZ A;  3AEF B;  1C78 A;  2HE7 A;  1XCQ L;  2VSZ A;  1U4A A;  1F0Z A;  4ZRI A;  2VH1 A;  1PQS A;  1UWX A;  3J9C A;  1M7E A;  3B1L X;  2N7D A;  1A5R A;  4ANW A;  1XLQ A;  1SXT A;  2WXO A;  2HJ8 A;  3E9P A;  3IAS 1;  2L0F A;  3FIL B;  2L52 A;  2V3S A;  1FM0 D;  3LDZ E;  3MPX A;  2K00 A;  2O2V B;  2KTR A;  2L32 A;  2TSS A;  1SJE D;  4YSY B;  2Z0Q A;  2YS1 A;  1RRB A;  2FCS A;  4OVU A;  2WXL A;  3UF8 A;  1R4N I;  3AN1 A;  2KIE A;  3HIZ A;  4CHK A;  4HCP B;  2COF A;  1Y19 B;  4BOZ B;  3UGB B;  3SEB A;  4A90 A;  1P0R A;  4LNN A;  1FO4 A;  2MP2 A;  2BWF A;  5T8I A;  4ZHP A;  2L1C A;  4WQO B;  3RMK C;  2V76 A;  3QIJ A;  3AE1 B;  5EDS A;  3TEX A;  2JF5 A;  1MJD A;  1TZO A;  2K8H A;  3ZUN A;  3PGE A;  1FFV A;  2ELB A;  4PT5 A;  3TVV A;  1GGO A;  1I4H A;  2K2J A;  1C76 A;  3V3X A;  2IYD B;  5BYR A;  1WWT A;  1JRU A;  2R2Q A;  5BYQ A;  3TEY A;  1ENF A;  5C2T B;  2V3P A;  2C7H A;  3ALB A;  3QBV B;  5H8Y E;  2M17 A;  4MGY E;  4XGA B;  1WVH A;  1GC7 A;  5GMV A;  2N1V A;  3VRA B;  2KX3 A;  3N1Y C;  3PLU A;  1E9M A;  2GCL A;  3DPD A;  2Z0P A;  2EEL A;  3JW0 X;  4UDU C;  4YTN B;  1SEB D;  4P6V F;  2KQ7 A;  2DBY A;  5FI0 A;  2A4Z A;  3GZN I;  2GBR A;  2V0G A;  4MGI E;  3O13 A;  4EKU A;  4IWQ A;  2N4F A;  3U7D A;  2MX2 A;  2CQU A;  3Q3N C;  4ITK A;  3RD2 A;  1WGU A;  2FE8 A;  4A6F B;  1EM7 A;  3RPF C;  1FRD A;  3P4Q B;  1V1O A;  2KTF A;  4AUQ C;  2DYB A;  5JZE B;  1RLF A;  2AEH A;  3HUI A;  2Y3A A;  3PHW B;  2QMT A;  3WIM A;  3T3N A;  1BWN A;  3MC9 A;  1YJ1 A;  1MFW A;  3RN9 C;  2BS2 B;  2KC1 A;  1KTK A;  4K7U A;  3HM6 X;  2CAY A;  2JWU A;  3HRD D;  4YTP B;  3RUI B;  2MH7 A;  2I1J A;  2PVG C;  4TSS A;  3OHM B;  2L05 A;  4BOS C;  4CQN A;  4KV2 A;  4GGQ A;  2MDX A;  1XO3 A;  1GAQ B;  2DAF A;  2QEJ C;  1QQR A;  2HTM E;  3D32 A;  2FUG 1;  3ZTC A;  4ANX A;  1P98 A;  2WQY B;  4RGN A;  2GI9 A;  2MBO A;  4ZDV A;  4D2K A;  3T9L A;  2CRF A;  4MSQ B;  5MPO A;  4D0N B;  2CHW A;  4BVU C;  1FGZ A;  1WJ4 A;  1GNU A;  4YXD B;  2NBW B;  2LVO A;  3NW8 A;  5IN7 A;  3H1U A;  1SE2 A;  2L3Z A;  5KCV A;  2KO3 A;  2LFI A;  4KIK B;  4NPN A;  1YX5 B;  4GOC A;  1ZYI A;  5BYS A;  2MWN B;  3C8Y A;  2D9X A;  5I2M A;  2JZZ A;  1HE8 A;  2Y8F A;  1MHH E;  1WJ6 A;  5DPW A;  2AQ3 B;  3TBL D;  4HPP A;  1WJU A;  2MA9 B;  3DBL B;  2N0S B;  4LNK A;  2PPH A;  3Q8B A;  3URY A;  2REX A;  1KLU D;  1E8X A;  3NRZ A;  2NTT A;  3P6A A;  1DOX A;  4ZYN A;  2W3S A;  4FBJ B;  2WDR B;  3JSV B;  2KLG A;  4JLC A;  4C7Y A;  1DDV A;  4D6W A;  2INC C;  2LI5 A;  1W1D A;  4ZRJ A;  4YTM B;  1XT9 B;  1X05 A;  5IOI A;  2KUQ A;  2KX0 A;  2MBE A;  1FOE A;  3QQ8 B;  3KW5 B;  3TW1 A;  4PNK A;  1NBF C;  1QOA A;  1XD4 A;  2KMM A;  5HHD G;  5HG2 A;  2K9X A;  1HB6 A;  2YVC A;  4MEM A;  5C5B A;  3A9K A;  2BTE A;  1JWB D;  2CU3 A;  3A33 B;  4JK7 A;  2L8J A;  1G6J A;  4DIX A;  2WXI A;  4NAW B;  3VQI A;  2WHI A;  1JML A;  2D10 A;  2H89 B;  3WAM A;  4IFS A;  4WJO A;  4XYC A;  4KZ0 A;  1FB8 A;  2GMI C;  3R7R A;  3CWI A;  4DDI D;  4OSN A;  4XX5 A;  2XQN M;  3CF6 E;  1HTO A;  1R4M B;  3OLM D;  4Z2M B;  1WIA A;  1U2B A;  1FMA D;  2WXG A;  5H92 C;  4MK0 A;  2LGD A;  1VZ8 A;  5G5H A;  1N63 A;  3L17 A;  2SEB D;  2KAC A;  2E6X A;  1V5O A;  2O6V D;  1NDD A;  5D3D A;  3WAL A;  1TT5 B;  3RZF A;  1V5M A;  3IT4 B;  1J7B A;  2IJ0 A;  2Z59 A;  1T0Y A;  1NU2 A;  4CO7 A;  2W2X D;  1VRA B;  2YT0 A;  2FID A;  1UNS A;  1A70 A;  3FAH A;  1DYN A;  2K3U A;  3D8F A;  4WWN A;  4AWJ A;  1ZUD 2;  1KLV A;  1FIQ A;  1WX8 A;  1F2R C;  4WAA A;  3LB8 C;  2KFK A;  3NVY A;  2BVC A;  5BO4 B;  1F1H A;  3Q8E A;  1IP9 A;  2IY1 B;  4DX8 A;  3B08 A;  4L2Y A;  4URK A;  3FSS A;  2W3R A;  1FCC C;  4TKN A;  3NOB A;  4AQ7 A;  2R61 A;  5KQ1 A;  4WWP A;  1Z87 A;  3ODW A;  4HB4 B;  2W55 A;  3P42 A;  4BKS A;  5BMI A;  3PP2 A;  4FJZ A;  2KNB A;  3VR8 B;  3MP9 A;  2D07 B;  1JWS D;  4OVV A;  2KJ6 A;  1UNQ A;  4NJC A;  2D3C A;  5D3X A;  2YS3 A;  2KIG A;  2SAK A;  2VKI A;  2B76 B;  2MW5 A;  3ODO A;  4OVZ A;  3VTU A;  3M1I B;  2ZVN A;  1I4G A;  4KHB A;  2J52 A;  4K2P A;  3PTF C;  2BS3 B;  2QSD A;  4BKG A;  2W54 A;  3M63 B;  1FNU A;  2H7E A;  2RDG A;  3ONS A;  3OAN A;  2GJY A;  5L83 A;  1B1Z A;  1NEK B;  4JK8 A;  3T06 A;  4WJP A;  4XWT A;  2NCN A;  1CJE A;  1NTY A;  1IPG A;  2UVM A;  1PFD A;  4K3C A;  4GMX B;  2WS3 B;  2P0F A;  4GU2 A;  2AWT A;  2EMS A;  2GB1 A;  4HVB A;  3HIE A;  4DXA B;  4P1C C;  5L81 A;  3N20 C;  3U12 A;  1WGK A;  3PVU A;  2D3B A;  1F2R I;  4KGR A;  3L16 A;  3FEH A;  1WE7 A;  1P3R A;  5DIF B;  2YF0 A;  1WXA A;  4QJ3 B;  2BGF A;  2HRJ A;  2IO3 B;  2GCJ A;  1EWC A;  1F77 A;  1WX7 A;  3KYD D;  4EMO A;  3ZXV A;  4EZK A;  2WXP A;  2K5P A;  1ZDV A;  3ENE A;  3ZQ4 A;  4GDK A;  2WXQ A;  2XK5 B;  4AJW A;  3QWZ B;  4HJK A;  1C3T A;  2X0S A;  3AEG B;  4N9F 4;  2J7Q B;  3DBL I;  2GRI A;  2OQB A;  1BTK A;  5HE2 A;  4JKA A;  1FHO A;  1LO5 D;  2D11 A;  2WGS A;  4RH6 A;  4IAP A;  1UPR A;  2RUK B;  3KLS X;  3VTV A;  2MJD A;  5IA7 A;  3Q3M C;  3NWA A;  1ZDX A;  3NZU A;  3PRP B;  4W9J A;  2FCN A;  1NEN B;  1T5X D;  1I4X A;  1IGD A;  2IYB A;  1AAR A;  4XE0 A;  5M4Y B;  1E7U A;  1WR6 E;  4IM3 A;  3LXF A;  5EE0 A;  5D94 A;  4A6Q A;  2GBN A;  4AJY B;  4RGT A;  1PUT A;  4HKZ E;  1E90 A;  2C9W B;  3KQ4 A;  4DXF A;  1WXS A;  2GBM A;  2K49 A;  1TS5 A;  3IFW B;  2JZ3 B;  3H6N A;  1E5W A;  3PRM B;  4HB3 B;  1UBQ A;  1XF5 L;  3TEW A;  1STE A;  4KHO A;  4KSK C;  3ZRC A;  4GOU A;  3VXW A;  1WM3 A;  1PMS A;  1AQC A;  2D5G A;  1R4M I;  5J18 A;  4NY0 A;  4EUT A;  4JE3 B;  1U5F A;  4F8C B;  3QK0 A;  3U7Z A;  3FP5 A;  2LGS A;  2MWS B;  1E8Y A;  4WJN A;  1YN5 A;  4MM3 A;  2R2O A;  4E74 A;  2BPS A;  4MJS B;  2ICI A;  1DRO A;  3S2A A;  1FFU A;  5D3I B;  1I35 A;  1EU3 A;  5CX3 A;  3F5R A;  2PVO D;  3E9S A;  2WLB A;  3NUH B;  2KJR A;  3AEE B;  3VTW A;  1J7C A;  2FUH B;  4M02 A;  5CTR C;  2M14 A;  4JPS A;  2KMA A;  3FKY A;  3DVG Y;  1QLB B;  2K8E A;  3SV1 A;  1V80 A;  1S3S G;  1IYF A;  1ISN A;  2FNJ B;  4B0E A;  2G35 A;  2LKO A;  4DBB A;  1HZ6 A;  2DX5 B;  3FIL A;  2GUM A;  4EZL A;  5LLI A;  5IAA C;  1OFF A;  1RRP B;  2Z14 A;  3CIK A;  2M0X A;  1KI1 B;  3WAO A;  2O2V A;  3KUZ A;  4RMA A;  5J17 A;  2QDF A;  4DHJ B;  4W9E A;  2CHZ A;  1FXT B;  2LWP A;  2BT6 A;  3PSE B;  3NWD A;  3Q3F A;  2DTC A;  1C79 A;  1J7A A;  1WZ3 A;  1F52 A;  3PLV A;  3LJ3 A;  4KDL B;  2KHW B;  4L1R A;  1TYG B;  2RVB B;  1KF6 B;  4C80 A;  1ZSQ A;  3V6E B;  4GN1 A;  2V4I B;  4WWO A;  2UZR A;  1RAX A;  1C77 A;  4FLH A;  3KRW A;  3HK0 A;  2D9W A;  5FK9 C;  4KGS A;  3GE3 C;  2COD A;  3Q69 A;  2ZW1 A;  1NYR A;  5AEK B;  4KKJ A;  3A9J B;  4LNF A;  4QAY A;  1R7S A;  2L0T A;  2QIE B;  1N62 A;  5G55 A;  2V9H A;  1ZGU B;  4B95 A;  1B9R A;  2LGX A;  2KDF B;  4F1S A;  2IZV B;  1HB8 A;  2JX5 A;  1MIZ B;  4F7U P;  1OEY A;  3PPA A;  4A55 A;  3SBT A;  2NBV B;  3DXD A;  4A8X C;  3Q2A C;  2DX1 A;  3V6C B;  4DBG A;  1AWE A;  1OQY A;  5HFY A;  3UIP B;  3BY4 B;  3KWL A;  2COA A;  1UUP A;  2P8V A;  5JHB A;  1WR1 A;  2LOZ A;  4MT5 A;  4KHA A;  1BXT A;  2EJ8 A;  1SF0 A;  4IM0 A;  1E10 A;  2DZI A;  5IKC M;  2JP2 A;  3AEB B;  2Q13 A;  1SIF A;  3W5V B;  4A6F A;  1V97 A;  1Q10 A;  1TS4 A;  3FVC A;  1ZC3 B;  1K53 A;  1TXD A;  1LM8 B;  2FDQ A;  3BWU D;  4C7Z A;  3AB5 A;  3GYO A;  5E6O A;  2GBK A;  2KGX B;  1EO6 A;  3GS2 A;  4OW0 A;  3APD A;  3R8B A;  5LOP B;  2I2Y A;  3EGR A;  3PS6 A;  1MG4 A;  1GJZ A;  3Q3J A;  1DDW A;  4CSQ A;  1HQR D;  4HRO A;  1EVH A;  2LYD A;  1S1Q B;  5KQ4 A;  3A58 A;  4W9L A;  2R2Y A;  2ZKM X;  1WGG A;  1D5M C;  3U30 A;  2RRF A;  1UGM A;  1P9D U;  1YN3 A;  2JVC A;  4GDL B;  3OAW A;  3NG0 A;  2JY6 A;  5CHV C;  1V8C A;  2KK8 A;  2DZK A;  4HCN B;  2W2W A;  2ELA A;  2KQS A;  1UF0 A;  2WXR A;  5FKA C;  2EKE C;  1TS2 A;  3D8E A;  4FHK A;  2ADZ A;  4WQM A;  4KIK A;  2BQQ A;  1E7V A;  2IGD A;  2NBU A;  2DYQ A;  1WGD A;  2PE6 B;  4HPM B;  4ZRK A;  4RFB A;  2ZCC A;  4JKG A;  5JVL A;  1X1F A;  4LDT D;  2OHF A;  1KOT A;  2JWZ A;  1VZ7 A;  2NPT B;  2HDE A;  4ANV A;  3MC8 A;  3HQC A;  1FNW A;  5CLL B;  1K51 A;  1WGQ A;  4P1B C;  1L4Z B;  2X18 A;  1V5T A;  5D6J B;  2MRP A;  1CZP A;  1K8R B;  5HI1 A;  5TSS A;  3BII D;  4C0A A;  3R66 C;  3UZT A;  3ZTD A;  3BYY B;  3PV1 A;  2JQR B;  2DLB A;  3W1S C;  5L95 C;  4GPT B;  2PJH A;  3JSV A;  3RNA C;  5AZH A;  4L23 A;  1J0G A;  4NSW A;  3NVV A;  3ZGZ A;  1ZXH A;  1YJJ A;  2I38 A;  3A1Q B;  4TQ1 A;  3VH4 B;  3ZDT A;  3RFZ B;  3SO6 A;  3AU5 A;  2DN6 A;  2X38 A;  2I5C A;  2KR0 A;  1VCB A;  2CB8 A;  4BBN F;  1MK7 B;  3T8M A;  1UD7 A;  2G9H D;  3BK2 A;  1KLG D;  2LUM A;  4RCO A;  3SDL C;  4W9G A;  3Q14 C;  1AW7 A;  2JUO A;  3VDZ A;  2IO2 B;  1L5P A;  2K2U A;  4K3B A;  4NAW A;  3RYT A;  5C16 A;  2IO1 B;  5DCN A;  1ST7 A;  3ULB A;  2BKR B;  3U52 E;  1BT0 A;  4WVF B;  1K52 A;  2QKM A;  1CK1 A;  1EUV B;  3E9L A;  1NVL A;  1UH6 A;  3DHG C;  2K6D B;  4QXA B;  1AN8 A;  3DHI C;  4I6N B;  3ZNG C;  2FJ9 A;  5J2R A;  4N6E B;  1WMH B;  3DVN U;  3AE9 B;  2J0K A;  3L08 A;  1Q5W B;  3ABV B;  2WDT B;  3UI3 A;  4GB9 A;  1BTN A;  4N58 A;  2N9L A;  1T0S C;  3IG3 A;  1WXQ A;  1U29 A;  1YQB A;  1JW9 D;  3MDB C;  2YRY A;  3H7P A;  1E7P B;  4GLS C;  5JXV A;  2DAJ A;  4JKG B;  2MBQ A;  2JXX A;  1ZOY B;  2R0D A;  3PZD A;  3HVZ A;  4HK2 A;  3RT3 B;  4HB0 B;  1WRI A;  1RM6 C;  1TTN A;  2WU2 B;  1MAI A;  1YQ4 B;  3L4P A;  1L4D B;  2JZP A;  3TEZ A;  4G11 A;  3I3T B;  3ZVR A;  1WY8 A;  2GBJ A;  4MGK E;  1IBX B;  3QX1 A;  1PFJ A;  5LXH A;  1ZW7 A;  4DHZ B;  3QA8 A;  2IBI B;  3UIO B;  2C60 A;  2BW2 A;  3N32 A;  4LJO B;  1WSP A;  1T77 A;  4G50 A;  3L10 B;  4A9A A;  1JAL A;  1YOV B;  5D3W A;  2UZS A;  2L76 A;  4C4V B;  4L1B A;  2D3G A;  5DPT A;  4KKI A;  4P7I A;  1P7F A;  3W1Y A;  1XCG A;  5KHQ A;  2QIL A;  3QAQ A;  4BKS D;  2FJL A;  2DHZ A;  2AQ1 B;  1KRH A;  2RSG A;  2KAN A;  2GS0 A;  4ICU A;  2CJO A;  4A3O A;  2WXH A;  4C00 A;  3KY9 A;  2DHI A;  4GNK B;  4MH0 E;  1PGA A;  3PT2 B;  2N7J A;  1P3Q U;  2RDH A;  2WNM A;  1K5G B;  3VAW A;  2PKO A;  1U27 A;  1Q0W B;  3NVW A;  2MQJ A;  3ETR A;  3BVG A;  4IWP A;  4J6I A;  2QCZ A;  4KX6 B;  4US8 A;  2J53 A;  1WI1 A;  3AU4 A;  4RF1 A;  3L54 A;  1SE9 A;  2BS4 B;  4Q2J A;  5EE3 A;  4JL9 A;  1Y5O A;  4KSL C;  2IO0 B;  3AE8 B;  3SFD B;  1I42 A;  2NR2 A;  4MY6 A;  2CKH B;  3IAM 1;  2KVZ A;  3I57 A;  3C19 A;  2XK5 A;  2BYF A;  2FJU B;  1L7Y A;  1MPE A;  4XZ4 A;  2BWE S;  3RI7 C;  1YMH E;  3H7P B;  3MC0 B;  4KGT A;  3NJT A;  3PO0 A;  1OEY J;  2PIA A;  4FA6 A;  1SE3 A;  4H8S A;  2KD0 A;  2ACZ B;  1M7R A;  3DXC A;  4PQ0 A;  5BMH A;  3KWV A;  2VZK D;  1QKZ A;  3Q8C A;  1JQ4 A;  3GYP A;  3AMZ A;  4FJY A;  4HKQ A;  4JKC A;  3OWE B;  3NS8 A;  1Z5S B;  4ASW C;  4IDI A;  3V61 A;  3KYC D;  1CMX B;  3SUZ A;  3BYT B;  2Z0E B;  4W9D A;  4KDI C;  2KDM A;  3TMP B;  1ZC4 B;  3QWM A;  1GUA B;  5FI1 A;  1FCL A;  3EPY A;  1RFA A;  1TIF A;  3EHV A;  2QKL A;  1N61 A;  4C56 C;  3P63 A;  1WJN A;  2BF8 B;  2ROZ B;  1I7H A;  3MTN B;  2FCM A;  3ZJT A;  1WXV A;  1EAZ A;  2YSZ A;  2KOX A;  4W9F A;  3KRX A;  1X1G A;  5D27 A;  3AEC B;  3MJ5 A;  3APC A;  1MIX A;  2WX0 A;  1WI0 A;  2RD0 A;  2LZ6 A;  3PZ8 A;  4HEA 1;  3DXE A;  2WU5 B;  4I6L B;  5IO9 A;  4K1R B;  3V62 A;  1IRS A;  1WE6 A;  2CS4 A;  2JSV X;  1SBB B;  1C4P A;  2VH2 A;  4MJS A;  3OJ3 A;  4OT1 A;  2G1E A;  3RNB C;  1I2H A;  3BVM A;  2MKR A;  2RMM A;  1TJE A;  2YT2 A;  4QJ5 B;  4RM9 A;  2BYE A;  1MK9 B;  2JXT A;  2XNA C;  3AED B;  1LW3 A;  4HRS A;  3ZDM C;  3F0W A;  2IND C;  4HAU B;  2IPK D;  5DHA B;  4AOF A;  3X23 A;  2DX5 A;  3DHH C;  3RUL A;  1ROE A;  2DKP A;  1N5W A;  1T0R C;  2ZPN A;  3N1Z C;  2DEN B;  4MH8 A;  2YS5 A;  1Q1O A;  3Q6B A;  2J0J A;  1KZ7 A;  1FHX A;  1H4R A;  1OQQ A;  3WA0 A;  2WDQ B;  1N3H A;  2RPQ A;  4EZJ A;  1K5D B;  1TY2 A;  4NAM A;  4IG7 B;  1QIL A;  4NJ7 A;  1GB4 A;  3CXB B;  1UEL A;  5CHF A;  5IJM A;  3G9W A;  4BBK A;  2ZVO A;  1P6S A;  3EFU A;  4CHM A;  3EC8 A;  4PYZ A;  4LTU A;  4DDG D;  5JHA A;  5JHH A;  1FXI A;  4LNI A;  2X8X X;  2WWZ A;  4JKB A;  3WCQ A;  4TQ0 A;  5J3Y A;  2Z0D B;  4NJ6 A;  3KVF B;  4F7Z A;  5J3Q A;  3W1S A;  2Y8G A;  2CU1 A;  1E6E B;  2AYO B;  3A8P A;  3AEA B;  2N23 A;  1X11 A;  3A9J A;  1H10 A;  5GXG B;  3VVW B;  4IWO A;  4HAY B;  4A20 A;  1GB1 A;  3GB1 A;  1WGH A;  2E3T A;  3AE6 B;  1TKE A;  2HTH B;  2NBV A;  5C6R A;  5TR5 A;  1ZPS A;  3NVZ A;  4ICV A;  4XDD A;  4YSX B;  2LMC A;  1QT9 A;  1RJ2 A;  1WJM A;  5HE1 A;  2FIF A;  2GLS A;  4M0W B;  4DHZ E;  1F9J A;  3VR9 B;  1WYG A;  2JU6 X;  2LAS A;  2M19 A;  2QHO A;  4CYE A;  1D4B A;  1FGY A;  4K2O A;  2PMV A;  1L0Y B;  2FBW B;  1QZE A;  2JT4 B;  5E6J A;  4HSI A;  5HE3 A;  2NMQ A;  2NZ8 B;  3EUB 2;  4I6P A;  2OJW A;  3CMM B;  1JWU D;  1V1P B;  1ZVR A;  2DYN A;  2O6V B;  4LLG M;  4HAX B;  1VR9 A;  2P0D A;  2DNF A;  2KWV B;  1LB1 A;  3NY5 A;  1VJK A;  4IM2 A;  4YWG G;  4DXG A;  2M38 A;  2G4S A;  4PS7 A;  1YD8 U;  1P7E A;  1ACA A;  3B0A A;  1VD2 A;  5AUI A;  3Q8A A;  4IOI E;  4B0M A;  1YX6 B;  2B3A A;  1SGH A;  3X0W A;  4HLE A;  1DGJ A;  3PVL A;  4HAW B;  4B6W A;  2L83 A;  4TV3 A;  4YL8 A;  3JYU A;  2V4L A;  4ARC A;  4GDL A;  4JK9 A;  2EC1 A;  1EGX A;  3DWM A;  5LON B;  3EFC A;  2JPH A;  2ZEQ A;  4M01 A;  1WM2 A;  2KN4 A;  1V5P A;  2N9X A;  1PDX A;  1TZ1 A;  3QHT A;  4ILG B;  2WXJ A;  2RSU A;  2W82 A;  4MGZ E;  2LHD A;  4LK0 M;  3PRZ A;  3ULC A;  3NS1 A;  5IP4 D;  4M8M A;  1JCK B;  4WJ7 A;  1UZX B;  1FHW A;  4H2A A;  1Y56 A;  3TSS A;  2IFS A;  2NTS A;  2NPT A;  3DCG A;  5DH9 B;  2K1F A;  2WH5 A;  1M4V A;  3FLV A;  1ZE3 D;  3PEG A;  5DPS A;  1IGC A;  2QJL A;  4NQL B;  5I4D A;  5AUK A;  2WXN A;  1V5U A;  4K7W A;  1YN4 A;  2L1A A;  2K0P A;  3HVD A;  1XKE A;  4DWF A;  4XDC A;  4XWW A;  4RNA A;  3A1Q A;  2BKF A;  1BAK A;  4A6H A;  3GE8 C;  1D3Z A;  1LGR A;  1ESF A;  2AX5 A;  2RPV A;  3AE5 B;  2WXK A;  3VUY A;  1WXM A;  1BML C;  3AE7 B;  3V5W A;  3N30 A;  2MJE A;  3SD5 A;  2WXF A;  3DBR B;  4WWM A;  2M8S A;  2PW9 A;  4WAF A;  3ZJV A;  1NVI D;  1GPX A;  2L00 B;  3BVZ A;  2RNR B;  3R2T A;  4GIV A;  2JRI B;  3SR6 A;  1D5Z C;  1D6E C;  3SFE B;  4EOY A;  4FAD A;  3ZVV A;  2ABD A;  1HXY D;  5C23 A;  2YEP F;  2LHE A;  3WYF B;  2AL3 A;  2J4X A;  4WJQ A;  3U2S C;  4WH4 A;  2K6Q A;  2KJH B;  3A4S C;  1J8C A;  1VZ6 A;  5DI9 B;  3E66 A;  5CHW A;  1UWM A;  2AQ2 B;  4BKT A;  4PK1 A;  5LXI B;  3ZO5 B;  1V61 A;  4USA A;  4ILH A;  5D7G A;  3H7S A;  1ET9 A;  1XOD A;  3QCA A;  1JDE A;  4HAZ B;  1WMH A;  3V60 A;  5CLQ B;  1JRO A;  3GOE A;  2W2X C;  2LUE A;  2K22 A;  4JIO U;  2XN9 C;  3M62 B;  5DPR A;  2N1W A;  1JWA D;  4PS8 A;  4L6E A;  2KWD A;  3AUL A;  3DWG C;  4W9K A;  1ZXI A;  1OTR B;  2Y5C A;  2LVP A;  3WAN A;  3UIN B;  1QF6 A;  4RM8 A;  3IBE A;  2KXJ A;  3QC8 B;  1MI1 A;  3M95 A;  4US9 A;  5FR3 A;  1LFD A;  4JWS C;  3IVF A;  3U4E G;  2N9P C;  1V86 A;  1FAO A;  1OQN A;  2C7M B;  1W1H A;  1L2N A;  1N5X A;  5EE9 A;  3NZ3 A;  1C4A A;  3RNF C;  2CY4 A;  4ARI A;  2PZ1 A;  1XEE A;  2IGG A;  3CSF A;  1SIJ A;  3U8Z A;  1SSN A;  1IBX A;  2DYO A;  3PVW A;  3PRE A;  3I63 C;  3AE2 B;  2D2Q A;  1N60 A;  3DDC B;  4EE2 A;  1PYW D;  1J0W A;  4KVG B;  1OMW A;  2G45 B;  2FCQ A;  3CIR B;  2GOW A;  3KH0 A;  1GOZ A;  4R3D A;  3JVZ X;  4HB2 B;  2LVQ A;  2WDV B;  3DBH B;  1P1A A;  4JKD A;  3RCP A;  3W5U B;  2LXC A;  4P16 A;  2K8C A;  3RNE C;  1UEF A;  5C1Z A;  4C4V A;  1E8Z A;  5EFX A;  3A8Q A;  4KAX B;  3L0W B;  1V89 A;  1OY2 A;  1SHC A;  1I4R A;  4HDQ A;  3HW2 B;  4JWU C;  2R82 A;  4OZA A;  5G5G A;  2LJ5 A;  4B6H A;  2K8B A;  1AYF A;  1WX9 A;  1IUE A;  4HAT B;  4IUM B;  2WX1 A;  5D3Y A;  3KUD B;  1E0Z A;  2L2I A;  1VBG A;  1V6E A;  3E9O A;  4FUL A;  2N0Y A;  2RR9 A;  3UQB A;  1FEH A;  3HM3 A;  2RQ1 A;  3FC4 A;  2KQ4 X;  2IY0 B;  1RFK A;  2KLC A;  3H8H A;  2UWQ A;  2RDB C;  4ZYS A;  2J0M A;  3TIX A;  4GZU A;  1YQ3 B;  3OJ4 B;  3ML8 A;  4OZC A;  2KCJ A;  4RGM A;  2WP9 B;  2YLM A;  3RZW C;  4YON A;  1NTV A;  4F7H A;  4ZHO A;  3ZKJ C;  1KBL A;  2DZM A;  1KZG A;  2MCN B;  3ZRF A;  5C79 A;  4FXC A;  4BBN C;  1EF1 A;  1XCT L;  3OG5 A;  1Z2M A;  4ZRP A;  2W9N A;  2KTR B;  2V3N A;  4MDK E;  4YSZ B;  2KWU B;  4F7G A;  2M56 B;  2M0A A;  1MPH A;  4TMA B;  1XD3 B;  1E8W A;  3SNH A;  5BMG A;  2H7D A;  4A5K A;  3ZYY X;  2MP2 B;  3DBS A;  2INN E;  1WJ1 A;  4II3 B;  4N59 A;  4REZ A;  3D8D A;  3ZJU A;  3VRB B;  4FJV B;  3R2I A;  2NS5 A;  1QOG A;  2ZW0 A;  5JH5 C;  2KKC A;  1PGX A;  1AWD A;  1MVK A;  3ZNH B;  1TY0 A;  1ZKH A;  3TFM A;  3DBR I;  5AZG A;  2DLW A;  1LQB A;  3BIN A;  4EFO A;  2N9E B;  4GXB A;  2KDE B;  1HBK A;  1ET6 A;  2MSE D;  1XQQ A;  4JX1 C;  1L6U A;  1XXG A;  2CR5 A;  5E6N A;  3ZLZ A;  4IKG A;  2ZPY A;  3MFG A;  4ILJ A;  4OHJ A;  2DKQ A;  1V9J A;  2ON8 A;  1U5G A;  1HZ5 A;  1UGJ A;  2I5F A;  3AV8 A;  1WG7 A;  2Z13 A;  4W9I A;  1TGZ B;  3HHM A;  4RGO S;  4G0N B;  2COC A;  2ROV A;  3KSY A;  2J59 M;  1T6B X;  5I2S A;  2LUL A;  3N3K B;  3ML4 A;  4HAV B;  2KVR A;  2VRW B;  3LJU X;  1C9F A;  4TYZ A;  1L6V A;  2HJ1 A;  2K39 A;  3NWF A;  2LGI A;  2BYV E;  2OOB B;  2OJR A;  1FD6 A;  2Z8L A;  3IT6 B;  1YIW A;  5JLJ B;  3K9O B;  1L0V B;  5EE1 A;  1B55 A;  3DQV A;  3ODX A;  1NYQ A;  4NNJ B;  3SYX A;  2Q5W D;  2ZNV B;  3TJP A;  3I9V 1;  5HE0 A;  2D3A A;  4MEL A;  4HJG E;  4IOY X;  1H8C A;  4GMV A;  2WXM A;  1GG3 A;  4HPL B;  3UQA A;  5LG4 B;  1YNT E;  2R09 A;  2DFK A;  1DOY A;  1UNP A;  1KH0 A;  2MFQ A;  2LBB A;  1NI3 A;  4JKE A;  4LDT B;  2BBC A;  4DX9 0;  2A5U A;  3PG7 A;  2IDY A;  3B2F A;  1GC6 A;  1YJI A;  1V2Y A;  1K50 A;  2KT7 A;  5KHO A;  1TBE A;  3DBH I;  4CHJ A;  1XR0 B;  4E71 A;  4MT7 A;  3O65 B;  1XLO A;  1MI0 A;  3I5J C;  3ENB A;  2ZCB A;  3P4S B;  1UNR A;  1I7A A;  5GOW B;  3P7Z A;  2C7N B;  1TQZ A;  5IRS A;  4IW0 A;  4RF0 A;  2DYM A;  2EKI A;  3MHZ A;  4DHJ D;  2PEA A;  4HHV A;  3NZS A;  3E56 A;  4II2 B;  2LGY A;  4IC7 B;  2RLO A;  3IHP C;  1MG8 A;  3B9J A;  1T3Q A;  3ZXR A;  2KYW A;  4Z2N A;  1L0X B;  1C1Y B;  1PGB A;  1FXA A;  1WRD B;  2JYE A;  3T3O A;  4B9K A;  1U5E A;  2LRW A;  1X1M A;  3P1M A;  1I4P A;  1TKG A;  3ML9 A;  1EF5 A;  3VOQ A;  2D9V A;  3NHE B;  4LNO A;  2HTH A;  3VUX A;  4HDO A;  2JYT A;  4O1N A;  1FNV A;  2DHK A;  1SB3 C;  3BJI A;  2ASQ A;  3TO1 A;  2DHJ A;  4HXD A;  1FRR A;  2IGH A;  1C4C A;  2CJN A;  4M0W A;  1KC7 A;  4XC2 A;  2NMB A;  4K7S A;  3V05 A;  1V88 A;  1HEZ E;  1RYJ A;  3W2D A;  5C5B B;  3A9K B;  1N6Z A;  3FM8 C;  5DHF B;  2DZJ A;  2G3Q B;  3AE3 B;  1Q67 A;  2COP A;  1XLP A;  5FR6 A;  2RGF A;  2CHX A;  5JHG A;  3APF A;  1ZP0 B;  1V1P A;  3WAP A;  1LXD A;  1WGR A;  2O6V A;  3RNG C;  4PS3 A;  3KUC B;  4WSF A;  2KC2 A;  3DVG X;  2D4Q A;  4A6K A;  2KUP A;  2YT1 A;  4ANU A;  1WGY A;  2PE9 A;  1CQV A;  2D9Y A;  2KAJ A;  1ZM0 A;  3VHT C;  3TUO A;  1OQR A;  2Y5P A;  4YT0 B;  3B77 A;  2G4D B;  3LYY A;  2H88 B;  2ZZP B;  2DA0 A;  4EJN A;  2ZNV C;  4NQK E;  3BZD B;  2BYT A;  1UPQ A;  1MHX A;  2Z59 B;  3ZNI D;  4BAX A;  2WYQ A;  1QOF A;  1DOI A;  5AZF A;  4ACF A;  1KFY B;  4X57 B;  1QOB A;  1PLS A;  2KWC A;  1V49 A;  4AS1 A;  1HTQ A;  2VRR B;  2I1K A;  1MKE A;  1JRP A;  2ONQ A;  3VFK A;  2LG1 A;  4Y94 A;  2LD9 A;  4W9C A;  2D9Z A;  2DWQ A;  3SBG A;  2KFK B;  4S17 A;  3VIA A;  3DOW A;  1P5T A;  1D5X C;  2MBH A;  4GSW A;  2OTX A;  3QAR A;  3Q3O C;  1WF9 A;  2KZR A;  3KZ1 A;  1SE4 A;  1DDM A;  2M1M A;  1WH3 A;  1R4N B;  1VDV A;  3EA6 A;  3DVN V;  3HSA A;  4ZOH C;  3PZ7 A;  1JWM D;  1UBI A;  4FHJ A;  1QQG A;  4KZC A;  1EWY C;  2E2X A;  4KHB B;  3AE4 B;  2MBB B;  3RCZ A;  3L13 A;  2UYZ B;  4AP4 C;  3PSC A;  2XEW A;  1BUI C;  2Z4D A;  3N7C A;  3MJW A;  3P4R B;  4DK5 A;  4HWI B;  4FN2 A;  3MHS D;  1J19 A;  2HD5 B;  2MHJ A;  1QC6 A;  3H9D A;  2NVU I;  1SJH D;  1WZ0 A;  3P2B A;  4PYU A;  3IXS A;  5E6P A;  4G3X B;  4MAC A;  3RNC C;  2K25 A;  3A98 B;  1OGW A;  1HA5 A;  2XBB C;  4LJP B;  1EU4 A;  2DIK A;  1X86 A;  5D2M B;  5G2N A;  4BZA A;  1XX0 A;  2V1Y A;  2MEK A;  2LXA A;  3ZIM A;  2INP E;  2KFJ A;  4QJ4 B;  2QC8 A;  3EEC A;  1T0Q C;  1FPY A;  2MJ3 A;  1TKY A;  4K17 A;  3ZW3 A;  2N9K A;  4J3O D;  2P0H A;  4M00 A;  2KDB A;  3VH3 B;  1DIK A;  1M94 A;  3R7Q A;  1TJ6 A;  3GZN B;  1WYW B;  4JQW C;  1ACC A;  1DYQ A;  2ZJD A;  1V81 A;  3CST A;  3R3M A;  5LNK 1;  1U5D A;  3DCX A;  3NSU A;  4GDK B;  5JP4 A;  2CY5 A;  3W9C B;  5C3J B;  2LJI A;  3GP7 A;  3SU8 X;  4MSM B;  2VZK B;  2Y7B A;  2YEP B;  4A3P A;  5D3V A;  4WIP A; 
#chains in the Genus database with same CATH homology
 2LRU A;  3AI5 A;  3M3J A;  4BFR A;  2JRH A;  2M4N A;  4W9H A;  4JKF A;  3K9P B;  3AXC A;  2LOX A;  1WFY A;  4E3C A;  2N7E A;  3A4R A;  2RGN B;  2Y5B B;  3AJ4 A;  2KDI A;  1VBH A;  2Z0O A;  3SHQ A;  3TL5 A;  4EEW A;  4JKH A;  2C5L C;  4JGH B;  2L7R A;  3ZNZ B;  2MLB A;  4XWX A;  1KM7 A;  2BCJ A;  2EMT A;  3C0R B;  1Y8R C;  3ECI A;  2AL6 A;  4LCD E;  5J3T A;  3PHX B;  1DBH A;  3O96 A;  2KMC A;  2KN5 A;  3VUW A;  1KJT A;  3TCA A;  1NI2 A;  4K81 A;  1NTI A;  1W1G A;  5HKH A;  4TUU A;  4M8N A;  2FAZ A;  3QJZ A;  2HE7 A;  2VSZ A;  1U4A A;  4ZRI A;  1PQS A;  1M7E A;  3B1L X;  2N7D A;  1A5R A;  4ANW A;  2HJ8 A;  3E9P A;  2L0F A;  2V3S A;  3LDZ E;  3MPX A;  2K00 A;  2O2V B;  2KTR A;  2Z0Q A;  2YS1 A;  1RRB A;  2FCS A;  4OVU A;  3UF8 A;  1R4N I;  3HIZ A;  4CHK A;  4HCP B;  2COF A;  1Y19 B;  4BOZ B;  3UGB B;  1P0R A;  2MP2 A;  2BWF A;  2L1C A;  4WQO B;  2V76 A;  3QIJ A;  5EDS A;  2JF5 A;  2K8H A;  3ZUN A;  3PGE A;  2ELB A;  3TVV A;  1GGO A;  2K2J A;  2IYD B;  1JRU A;  2R2Q A;  2C7H A;  3ALB A;  3QBV B;  2M17 A;  4MGY E;  1WVH A;  1GC7 A;  5GMV A;  2N1V A;  2KX3 A;  3PLU A;  2GCL A;  3DPD A;  2Z0P A;  3JW0 X;  2KQ7 A;  5FI0 A;  2A4Z A;  3GZN I;  2GBR A;  4MGI E;  4EKU A;  4IWQ A;  2N4F A;  3U7D A;  2MX2 A;  2CQU A;  3RD2 A;  1WGU A;  4A6F B;  2KTF A;  4AUQ C;  2DYB A;  5JZE B;  1RLF A;  2AEH A;  3PHW B;  3WIM A;  1BWN A;  1YJ1 A;  2KC1 A;  4K7U A;  3HM6 X;  2CAY A;  3RUI B;  2I1J A;  2L05 A;  4BOS C;  4KV2 A;  4GGQ A;  2MDX A;  2DAF A;  3D32 A;  3ZTC A;  4ANX A;  1P98 A;  2MBO A;  4ZDV A;  3T9L A;  2CRF A;  4MSQ B;  4D0N B;  2CHW A;  4BVU C;  1FGZ A;  1WJ4 A;  1GNU A;  2NBW B;  2LVO A;  3H1U A;  2L3Z A;  5KCV A;  2KO3 A;  4KIK B;  4NPN A;  1YX5 B;  4GOC A;  2MWN B;  2D9X A;  2JZZ A;  1HE8 A;  2Y8F A;  1WJ6 A;  5DPW A;  3TBL D;  1WJU A;  2MA9 B;  2PPH A;  2REX A;  1E8X A;  3P6A A;  4ZYN A;  4FBJ B;  3JSV B;  2KLG A;  4JLC A;  1DDV A;  2LI5 A;  1W1D A;  4ZRJ A;  1XT9 B;  1X05 A;  2KX0 A;  2MBE A;  1FOE A;  3QQ8 B;  3KW5 B;  3TW1 A;  4PNK A;  1NBF C;  1XD4 A;  1HB6 A;  2YVC A;  4MEM A;  5C5B A;  3A9K A;  3A33 B;  4JK7 A;  2L8J A;  1G6J A;  4NAW B;  3VQI A;  2D10 A;  3WAM A;  4IFS A;  4WJO A;  4KZ0 A;  1FB8 A;  2GMI C;  3R7R A;  4DDI D;  4XX5 A;  2XQN M;  3CF6 E;  3OLM D;  4Z2M B;  1WIA A;  1U2B A;  4MK0 A;  2LGD A;  3L17 A;  1V5O A;  2O6V D;  1NDD A;  3WAL A;  3RZF A;  1V5M A;  1T0Y A;  1NU2 A;  4CO7 A;  2W2X D;  2YT0 A;  2FID A;  1DYN A;  3D8F A;  4WWN A;  4AWJ A;  1KLV A;  1WX8 A;  4WAA A;  2KFK A;  5BO4 B;  1IP9 A;  2IY1 B;  4DX8 A;  3B08 A;  4URK A;  3FSS A;  4TKN A;  3NOB A;  5KQ1 A;  4WWP A;  1Z87 A;  3ODW A;  4HB4 B;  4BKS A;  3PP2 A;  4FJZ A;  2KNB A;  2D07 B;  4OVV A;  2KJ6 A;  1UNQ A;  5D3X A;  2YS3 A;  2VKI A;  2MW5 A;  3ODO A;  3VTU A;  3M1I B;  2ZVN A;  4K2P A;  3PTF C;  4BKG A;  3M63 B;  2H7E A;  3ONS A;  3OAN A;  2GJY A;  5L83 A;  4JK8 A;  3T06 A;  4WJP A;  2NCN A;  1NTY A;  1IPG A;  2UVM A;  4GMX B;  2P0F A;  4GU2 A;  2AWT A;  2EMS A;  4HVB A;  4DXA B;  5L81 A;  3PVU A;  3L16 A;  3FEH A;  1WE7 A;  1P3R A;  5DIF B;  2YF0 A;  1WXA A;  2BGF A;  2HRJ A;  2IO3 B;  2GCJ A;  1WX7 A;  3KYD D;  4EMO A;  4EZK A;  3ENE A;  4GDK A;  2XK5 B;  4AJW A;  3QWZ B;  4HJK A;  1C3T A;  2X0S A;  4N9F 4;  2J7Q B;  3DBL I;  2OQB A;  1BTK A;  5HE2 A;  4JKA A;  1FHO A;  2D11 A;  4IAP A;  1UPR A;  2RUK B;  3VTV A;  5IA7 A;  3NZU A;  3PRP B;  4W9J A;  2FCN A;  2IYB A;  1AAR A;  1E7U A;  1WR6 E;  4IM3 A;  5D94 A;  2GBN A;  4AJY B;  1E90 A;  2C9W B;  1WXS A;  2GBM A;  3IFW B;  2JZ3 B;  3H6N A;  1E5W A;  3PRM B;  4HB3 B;  1UBQ A;  4KHO A;  4KSK C;  3ZRC A;  3VXW A;  1WM3 A;  1PMS A;  1AQC A;  1R4M I;  5J18 A;  4NY0 A;  4EUT A;  1U5F A;  4F8C B;  3QK0 A;  3FP5 A;  2MWS B;  1E8Y A;  4WJN A;  4MM3 A;  2R2O A;  4E74 A;  2BPS A;  4MJS B;  1DRO A;  3S2A A;  1I35 A;  5CX3 A;  3F5R A;  2KJR A;  3VTW A;  2FUH B;  5CTR C;  2M14 A;  2KMA A;  3DVG Y;  3SV1 A;  1V80 A;  1S3S G;  1IYF A;  1ISN A;  2FNJ B;  2G35 A;  2LKO A;  4DBB A;  2DX5 B;  4EZL A;  5LLI A;  5IAA C;  1RRP B;  3CIK A;  2M0X A;  1KI1 B;  3WAO A;  2O2V A;  3KUZ A;  4RMA A;  5J17 A;  4DHJ B;  4W9E A;  2CHZ A;  1FXT B;  2LWP A;  3PSE B;  3Q3F A;  2DTC A;  1WZ3 A;  3PLV A;  3LJ3 A;  4KDL B;  2KHW B;  2RVB B;  1ZSQ A;  3V6E B;  4GN1 A;  4WWO A;  2UZR A;  1RAX A;  4FLH A;  3KRW A;  3HK0 A;  2D9W A;  2COD A;  5AEK B;  3A9J B;  2L0T A;  5G55 A;  1ZGU B;  4B95 A;  2LGX A;  2KDF B;  4F1S A;  2IZV B;  1HB8 A;  1MIZ B;  4F7U P;  1OEY A;  3PPA A;  3SBT A;  2NBV B;  3DXD A;  2DX1 A;  3V6C B;  4DBG A;  1AWE A;  1OQY A;  3UIP B;  3BY4 B;  2COA A;  2P8V A;  5JHB A;  1WR1 A;  2LOZ A;  4KHA A;  2EJ8 A;  4IM0 A;  2DZI A;  2JP2 A;  2Q13 A;  1SIF A;  4A6F A;  1ZC3 B;  1TXD A;  1LM8 B;  2FDQ A;  3GYO A;  5E6O A;  2GBK A;  2KGX B;  1EO6 A;  3APD A;  5LOP B;  3PS6 A;  1GJZ A;  3Q3J A;  1DDW A;  1EVH A;  2LYD A;  1S1Q B;  5KQ4 A;  4W9L A;  1WGG A;  3U30 A;  1UGM A;  1P9D U;  4GDL B;  2JVC A;  3OAW A;  2JY6 A;  5CHV C;  2KK8 A;  2DZK A;  4HCN B;  2W2W A;  2ELA A;  2KQS A;  2EKE C;  3D8E A;  4FHK A;  2ADZ A;  4KIK A;  2NBU A;  1E7V A;  2DYQ A;  1WGD A;  2PE6 B;  4HPM B;  4ZRK A;  2ZCC A;  4JKG A;  5JVL A;  1X1F A;  4LDT D;  1KOT A;  2JWZ A;  2NPT B;  4ANV A;  3HQC A;  5CLL B;  1WGQ A;  2X18 A;  1V5T A;  5D6J B;  2MRP A;  1K8R B;  3ZTD A;  4C0A A;  3R66 C;  3UZT A;  3PV1 A;  3W1S C;  5L95 C;  4GPT B;  2PJH A;  3JSV A;  5AZH A;  1J0G A;  4NSW A;  3A1Q B;  4TQ1 A;  3VH4 B;  3ZDT A;  3SO6 A;  3AU5 A;  2DN6 A;  2I5C A;  1VCB A;  2CB8 A;  4BBN F;  1MK7 B;  3T8M A;  1UD7 A;  3SDL C;  4W9G A;  2JUO A;  3VDZ A;  2IO2 B;  2K2U A;  4NAW A;  3RYT A;  5C16 A;  2IO1 B;  5DCN A;  1ST7 A;  3ULB A;  2BKR B;  1BT0 A;  4WVF B;  2QKM A;  1EUV B;  3E9L A;  1NVL A;  1UH6 A;  2K6D B;  4I6N B;  3ZNG C;  2FJ9 A;  5J2R A;  1WMH B;  3DVN U;  2J0K A;  3L08 A;  1Q5W B;  2WDT B;  4GB9 A;  1BTN A;  3IG3 A;  1U29 A;  1YQB A;  3MDB C;  2YRY A;  3H7P A;  2DAJ A;  4JKG B;  2MBQ A;  2JXX A;  2R0D A;  3PZD A;  4HK2 A;  3RT3 B;  4HB0 B;  1TTN A;  1MAI A;  4G11 A;  3I3T B;  3ZVR A;  1WY8 A;  2GBJ A;  4MGK E;  3QX1 A;  1PFJ A;  5LXH A;  1ZW7 A;  4DHZ B;  3QA8 A;  2IBI B;  3UIO B;  2C60 A;  3N32 A;  4LJO B;  4G50 A;  3L10 B;  5D3W A;  2UZS A;  2L76 A;  2D3G A;  5DPT A;  4P7I A;  3W1Y A;  1XCG A;  5KHQ A;  3QAQ A;  4BKS D;  2FJL A;  2DHZ A;  2RSG A;  2KAN A;  2GS0 A;  4ICU A;  4A3O A;  3KY9 A;  2DHI A;  4MH0 E;  3PT2 B;  1P3Q U;  3VAW A;  1K5G B;  1U27 A;  1Q0W B;  2MQJ A;  4IWP A;  4J6I A;  1WI1 A;  3AU4 A;  3L54 A;  1SE9 A;  4JL9 A;  1Y5O A;  4KSL C;  2IO0 B;  1I42 A;  2NR2 A;  4MY6 A;  2CKH B;  2XK5 A;  2BYF A;  1L7Y A;  4XZ4 A;  2BWE S;  3H7P B;  1OEY J;  4FA6 A;  4H8S A;  2KD0 A;  1M7R A;  3DXC A;  4PQ0 A;  3GYP A;  4FJY A;  4JKC A;  3NS8 A;  1Z5S B;  4ASW C;  3V61 A;  3KYC D;  1CMX B;  3SUZ A;  2Z0E B;  4W9D A;  4KDI C;  3TMP B;  1ZC4 B;  3QWM A;  1GUA B;  5FI1 A;  3EPY A;  1RFA A;  3EHV A;  2QKL A;  1WJN A;  2BF8 B;  2ROZ B;  3MTN B;  2FCM A;  1WXV A;  1EAZ A;  2YSZ A;  2KOX A;  4W9F A;  3KRX A;  1X1G A;  5D27 A;  3APC A;  1MIX A;  2WX0 A;  1WI0 A;  2RD0 A;  2LZ6 A;  3DXE A;  4I6L B;  4K1R B;  3V62 A;  1IRS A;  1WE6 A;  2CS4 A;  4MJS A;  3OJ3 A;  1I2H A;  2MKR A;  4RM9 A;  2BYE A;  1MK9 B;  1LW3 A;  3ZDM C;  3F0W A;  4HAU B;  5DHA B;  4AOF A;  3X23 A;  2DX5 A;  3RUL A;  2DKP A;  2ZPN A;  2DEN B;  2YS5 A;  1Q1O A;  2J0J A;  1KZ7 A;  1FHX A;  1H4R A;  3WA0 A;  1N3H A;  2RPQ A;  4EZJ A;  1K5D B;  4IG7 B;  4NJ7 A;  3CXB B;  1UEL A;  5CHF A;  5IJM A;  3G9W A;  4BBK A;  2ZVO A;  1P6S A;  3EFU A;  4CHM A;  3EC8 A;  4PYZ A;  4DDG D;  5JHA A;  5JHH A;  2WWZ A;  4JKB A;  4TQ0 A;  5J3Y A;  2Z0D B;  4NJ6 A;  3KVF B;  4F7Z A;  5J3Q A;  3W1S A;  2Y8G A;  2CU1 A;  2AYO B;  3A8P A;  2N23 A;  1X11 A;  3A9J A;  1H10 A;  3VVW B;  4IWO A;  4HAY B;  4A20 A;  1WGH A;  2HTH B;  5C6R A;  5TR5 A;  4ICV A;  1RJ2 A;  1WJM A;  5HE1 A;  2FIF A;  4M0W B;  4DHZ E;  1F9J A;  2LAS A;  2QHO A;  4CYE A;  1FGY A;  4K2O A;  1QZE A;  2JT4 B;  5HE3 A;  2NZ8 B;  4I6P A;  3CMM B;  1ZVR A;  2DYN A;  2O6V B;  4HAX B;  2P0D A;  2KWV B;  1LB1 A;  3NY5 A;  4IM2 A;  2M38 A;  2G4S A;  4PS7 A;  1YD8 U;  1ACA A;  3B0A A;  1VD2 A;  1YX6 B;  2B3A A;  1SGH A;  3X0W A;  4HLE A;  3PVL A;  4HAW B;  4B6W A;  4TV3 A;  4YL8 A;  3JYU A;  2V4L A;  4GDL A;  4JK9 A;  2EC1 A;  1EGX A;  5LON B;  2JPH A;  2ZEQ A;  1WM2 A;  1V5P A;  2N9X A;  1TZ1 A;  3QHT A;  4ILG B;  2RSU A;  4MGZ E;  3PRZ A;  3ULC A;  4M8M A;  4WJ7 A;  1UZX B;  1FHW A;  2IFS A;  2NPT A;  3DCG A;  5DH9 B;  2K1F A;  2WH5 A;  3FLV A;  3PEG A;  5DPS A;  4NQL B;  1V5U A;  4K7W A;  1XKE A;  4DWF A;  3A1Q A;  2BKF A;  1BAK A;  4A6H A;  1D3Z A;  3VUY A;  1WXM A;  3V5W A;  3N30 A;  3SD5 A;  2M8S A;  2L00 B;  2RNR B;  4GIV A;  2JRI B;  4FAD A;  4EOY A;  3ZVV A;  2ABD A;  5C23 A;  3WYF B;  2AL3 A;  4WJQ A;  2K6Q A;  2KJH B;  3A4S C;  1J8C A;  5DI9 B;  3E66 A;  5CHW A;  4BKT A;  5LXI B;  3ZO5 B;  1V61 A;  5D7G A;  4ILH A;  3H7S A;  1XOD A;  3QCA A;  1JDE A;  4HAZ B;  1WMH A;  3V60 A;  5CLQ B;  3GOE A;  2W2X C;  2LUE A;  4JIO U;  3M62 B;  5DPR A;  2N1W A;  4PS8 A;  4L6E A;  3AUL A;  4W9K A;  1OTR B;  2LVP A;  3WAN A;  3UIN B;  4RM8 A;  3IBE A;  2KXJ A;  3QC8 B;  3M95 A;  1LFD A;  3IVF A;  2N9P C;  1V86 A;  1FAO A;  1OQN A;  2C7M B;  1W1H A;  1L2N A;  2CY4 A;  2PZ1 A;  3CSF A;  3U8Z A;  2DYO A;  3PVW A;  3PRE A;  2D2Q A;  3DDC B;  2G45 B;  1J0W A;  4KVG B;  1OMW A;  2FCQ A;  2GOW A;  3KH0 A;  3JVZ X;  4HB2 B;  2LVQ A;  1P1A A;  4JKD A;  3RCP A;  2LXC A;  2K8C A;  1UEF A;  5C1Z A;  1E8Z A;  5EFX A;  3A8Q A;  4KAX B;  3L0W B;  1V89 A;  1OY2 A;  1SHC A;  4HDQ A;  3HW2 B;  2R82 A;  2LJ5 A;  4B6H A;  2K8B A;  1WX9 A;  4HAT B;  4IUM B;  2WX1 A;  5D3Y A;  3KUD B;  2L2I A;  1VBG A;  1V6E A;  3E9O A;  4FUL A;  2N0Y A;  2RR9 A;  3UQB A;  3HM3 A;  2RQ1 A;  2IY0 B;  2KLC A;  2UWQ A;  2J0M A;  3TIX A;  4GZU A;  3OJ4 B;  3ML8 A;  2KCJ A;  3RZW C;  2YLM A;  4YON A;  1NTV A;  4F7H A;  3ZKJ C;  1KBL A;  2DZM A;  1KZG A;  2MCN B;  3ZRF A;  5C79 A;  4BBN C;  1EF1 A;  1Z2M A;  2W9N A;  2KTR B;  4MDK E;  2KWU B;  4F7G A;  1MPH A;  1XD3 B;  1E8W A;  3SNH A;  2H7D A;  4A5K A;  2MP2 B;  3DBS A;  1WJ1 A;  4II3 B;  3D8D A;  4FJV B;  2NS5 A;  5JH5 C;  2KKC A;  3ZNH B;  1ZKH A;  3DBR I;  3TFM A;  5AZG A;  2DLW A;  1LQB A;  3BIN A;  4EFO A;  2N9E B;  4GXB A;  2KDE B;  1HBK A;  2MSE D;  1XQQ A;  2CR5 A;  5E6N A;  3ZLZ A;  2ZPY A;  4ILJ A;  2DKQ A;  1V9J A;  1U5G A;  2I5F A;  1WG7 A;  4W9I A;  1TGZ B;  3HHM A;  4G0N B;  2COC A;  2ROV A;  3KSY A;  2J59 M;  2LUL A;  3N3K B;  3ML4 A;  4HAV B;  2KVR A;  2VRW B;  3LJU X;  4TYZ A;  2K39 A;  2BYV E;  2OOB B;  2OJR A;  1YIW A;  5JLJ B;  3K9O B;  1B55 A;  3DQV A;  3ODX A;  4NNJ B;  3SYX A;  2ZNV B;  3TJP A;  5HE0 A;  4MEL A;  4IOY X;  1H8C A;  4GMV A;  1GG3 A;  4HPL B;  3UQA A;  2R09 A;  2DFK A;  1UNP A;  2MFQ A;  2LBB A;  4LDT B;  4JKE A;  4DX9 0;  2A5U A;  3PG7 A;  1GC6 A;  1V2Y A;  5KHO A;  1TBE A;  3DBH I;  4CHJ A;  1XR0 B;  4E71 A;  4MT7 A;  3O65 B;  3ENB A;  2ZCB A;  1UNR A;  1I7A A;  5GOW B;  3P7Z A;  2C7N B;  1TQZ A;  4IW0 A;  2DYM A;  4DHJ D;  2PEA A;  4HHV A;  3NZS A;  4II2 B;  2LGY A;  4IC7 B;  2RLO A;  3IHP C;  1MG8 A;  4Z2N A;  1C1Y B;  1WRD B;  4B9K A;  1U5E A;  2LRW A;  1X1M A;  3ML9 A;  1EF5 A;  3VOQ A;  2D9V A;  3NHE B;  2HTH A;  3VUX A;  4HDO A;  2DHK A;  3BJI A;  2ASQ A;  3TO1 A;  2DHJ A;  4HXD A;  1KC7 A;  4XC2 A;  2NMB A;  4K7S A;  1V88 A;  5C5B B;  3A9K B;  3FM8 C;  5DHF B;  2DZJ A;  2G3Q B;  1Q67 A;  2COP A;  5FR6 A;  2RGF A;  2CHX A;  5JHG A;  3APF A;  3WAP A;  1LXD A;  1WGR A;  2O6V A;  4PS3 A;  3KUC B;  4WSF A;  2KC2 A;  3DVG X;  2D4Q A;  4A6K A;  2KUP A;  2YT1 A;  4ANU A;  1WGY A;  2PE9 A;  2D9Y A;  1ZM0 A;  3VHT C;  2G4D B;  2ZZP B;  2DA0 A;  4EJN A;  2ZNV C;  4NQK E;  1UPQ A;  2Z59 B;  3ZNI D;  2WYQ A;  5AZF A;  4X57 B;  2KWC A;  1PLS A;  1V49 A;  2VRR B;  2I1K A;  1MKE A;  3VFK A;  2LG1 A;  4Y94 A;  2LD9 A;  4W9C A;  2D9Z A;  3SBG A;  2KFK B;  3VIA A;  3DOW A;  1P5T A;  2MBH A;  4GSW A;  2OTX A;  3QAR A;  1WF9 A;  2KZR A;  3KZ1 A;  1DDM A;  2M1M A;  1WH3 A;  3DVN V;  1UBI A;  4FHJ A;  1QQG A;  4KZC A;  2E2X A;  4KHB B;  2MBB B;  3RCZ A;  3L13 A;  2UYZ B;  4AP4 C;  3PSC A;  2XEW A;  3N7C A;  3MJW A;  4DK5 A;  4HWI B;  4FN2 A;  3MHS D;  1J19 A;  2HD5 B;  1QC6 A;  3H9D A;  2NVU I;  1WZ0 A;  3P2B A;  5E6P A;  4PYU A;  4G3X B;  2K25 A;  3A98 B;  1OGW A;  2XBB C;  4LJP B;  2DIK A;  1X86 A;  5D2M B;  5G2N A;  1XX0 A;  2V1Y A;  2LXA A;  3ZIM A;  2KFJ A;  3EEC A;  4K17 A;  3ZW3 A;  2P0H A;  3VH3 B;  2KDB A;  1DIK A;  3R7Q A;  1M94 A;  1TJ6 A;  1WYW B;  4JQW C;  2ZJD A;  1V81 A;  3CST A;  3R3M A;  1U5D A;  3NSU A;  4GDK B;  5JP4 A;  2CY5 A;  3SU8 X;  4MSM B;  2Y7B A;  4A3P A;  5D3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...