2D11A

Crystal structure of the radixin ferm domain complexed with the nherf-2 c-terminal tail peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 83
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d11A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d11A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d11A01
1ST7A 3QBVB 2CY4A 4NQKE 2KWCA 4JGHB 3WA0A 4GDKA 5JZEB 4CHKA 3N7CA 2PJHA 3KUZA 2W2XD 5DCNA 1P5TA 1GC6A 2DZMA 2L00B 1MG8A 2OTXA 2MBQA 2N9XA 2P8VA 1UZXB 2CHWA 4FHJA 5LXHA 1I42A 4KHAA 1ISNA 5JHGA 2HRJA 5CLLB 2IY1B 2KFKB 3HQCA 3H7PA 3G9WA 3NZSA 2DLWA 2GBMA 4I6PA 2D9VA 4TKNA 1WIAA 3SD5A 2UWQA 3DOWA 4BBNF 4BKTA 2CKHB 2D9ZA 2JZZA 2RSUA 4EZJA 1V80A 2COPA 4J6IA 2CRFA 2FJ9A 2UVMA 5C5BA 2KZRA 2XEWA 3A1QB 3DVNU 3A1QA 3EHVA 4HATB 4K1RB 1V2YA 3VUXA 2KDIA 3VTUA 3CSFA 2LKOA 4BFRA 4LDTB 5JP4A 4RM9A 3R66C 4DWFA 1X05A 3ONSA 3AI5A 2C9WB 4HK2A 4NSWA 4IAPA 2GBRA 3DPDA 2BWFA 1TJ6A 2LZ6A 2V3SA 3AJ4A 2Z0DB 1KZ7A 3V5WA 2KK8A 2CODA 4HLEA 5FI1A 1YX6B 5KHQA 4GPTB 2G3QB 2MCNB 4A3OA 1IYFA 4ZRIA 2J59M 2RNRB 4G3XB 4W9CA 4DHJB 3PSEB 1ZW7A 1H10A 4WJ7A 2D4QA 2K6DB 1R4NI 3JSVA 2MDXA 2QHOA 1I2HA 4Z2MB 1YX5B 1J19A 3N30A 5LOPB 4BVUC 5L81A 3SU8X 4EEWA 3M1IB 1WM2A 2NS5A 3QX1A 3RCZA 3CF6E 1KJTA 3NY5A 2D07B 3RCPA 3ML4A 1LXDA 1RFAA 2MBEA 2NCNA 3DCGA 3TCAA 3MJWA 2ZJDA 3O65B 1C3TA 3K9OB 3TO1A 2LULA 1K5GB 3M3JA 3D8FA 5DPRA 3TJPA 4HAUB 3DQVA 4EFOA 4CHMA 3ALBA 2AL3A 3T9LA 1V5MA 3P6AA 4HDOA 1AARA 3U8ZA 1UBQA 1WX8A 1ZGUB 3APCA 3ZDMC 4BKGA 3IBEA 4CO7A 4HDQA 3KH0A 1Y19B 3DVGX 5JHAA 1HB6A 1E7VA 1Z2MA 3ULCA 4DX8A 2BF8B 2KD0A 2ZNVC 3KYCD 3WANA 1KLVA 1WGQA 3HM6X 1P3RA 5GOWB 4MGYE 1S3SG 2BKFA 1Y8RC 2WH5A 4OVVA 5KQ4A 5L95C 4LJPB 3PZDA 2JT4B 3B08A 2JPHA 4W9FA 3RYTA 2NBVB 4EZLA 5D94A 3VVWB 1WM3A 3ZTDA 3HHMA 3PLVA 1OMWA 2FIFA 4DHJD 2Z0OA 2R0DA 3GOEA 1EVHA 3LJ3A 2KOXA 5G55A 3ZIMA 5EDSA 2PEAA 1V5UA 2HJ8A 1U5EA 2YRYA 1WR6E 4W9IA 4NY0A 3VDZA 2K6QA 3NHEB 1YQBA 1X1GA 4GXBA 3WALA 2NBUA 4AWJA 4BKSA 1WX7A 5HE3A 4FBJB 1G6JA 1NTVA 2FCMA 2I1KA 2LUEA 1MIXA 3H7SA 4IM3A 3WAMA 2KGXB 2RSGA 4KDIC 3L0WB 4K7UA 2UZSA 2MLBA 4XX5A 4ANUA 3DBLI 1WH3A 3A9JA 2DZJA 4TUUA 1WR1A 4BKSD 2RPQA 3DBRI 2LVPA 3ML8A 3PHXB 1J8CA 1KZGA 2BKRB 2MQJA 1GNUA 2LRUA 1E90A 1E8YA 2JVCA 3SHQA 2LXCA 4F1SA 4FN2A 4AP4C 2JF5A 1MPHA 2I5CA 3ZVRA 1TTNA 2G4SA 2KMCA 4II3B 3UINB 4HCPB 3BJIA 4MGZE 2FDQA 1B55A 4EJNA 2DAFA 3IHPC 4AJYB 3OJ3A 3KZ1A 3UGBB 2YS3A 2KDEB 2WYQA 1HE8A 1P6SA 2M8SA 1WYWB 2N7EA 3U7DA 2O2VB 2RVBB 4JQWC 4PS3A 3TL5A 5D27A 5FR6A 4IFSA 3DXCA 3O96A 2YSZA 1V6EA 4WSFA 2JRIB 2M38A 2KWVB 2AEHA 2NPTB 3A4SC 1A5RA 3RT3B 3PEGA 4NPNA 1KI1B 1I7AA 3QARA 4EUTA 3U30A 1Q0WB 1XX0A 3PVUA 5C79A 3A33B 4F7HA 2PE9A 3ZLZA 2FJLA 3LJUX 1NDDA 2GBJA 2N4FA 4EKUA 5DH9B 4A6FA 3V62A 3H9DA 1V88A 2E2XA 2P0DA 1BTNA 2V4LA 3QQ8B 4HXDA 4ZYNA 5LLIA 1PLSA 4DX90 4DHZE 2K2UA 4GOCA 5J17A 4K17A 2R2OA 2WX0A 4LDTD 2KANA 4ICVA 1FGZA 1WXAA 1QZEA 3V61A 2D10A 2ABDA 1OY2A 4NJ7A 3ZW3A 2KKCA 4MJSB 2JWZA 4AOFA 3KRWA 1P0RA 4HB4B 4A3PA 3L54A 1EUVB 2AL6A 1H4RA 1WJUA 3JVZX 4GU2A 4AUQC 4DBGA 2LASA 3MHSD 2LGDA 1ZC3B 3RD2A 2KNBA 4BBNC 2KTRB 4KZCA 4F8CB 4KIKB 4W9EA 4TQ0A 2N1WA 4GB9A 3DXDA 2ROZB 3APFA 1FXTB 2M1MA 1WF9A 2VKIA 5JLJB 3K9PB 5E6OA 4E74A 4ZRJA 4N9F4 1U5FA 2W2XC 1XD3B 1X1FA 1AQCA 2CHXA 2MW5A 1GC7A 1UEFA 2ZZPB 1Z87A 2ZCCA 1WGUA 2KCJA 1RAXA 1OEYJ 4GDLB 1F9JA 2KJHB 2KTFA 3AXCA 4FHKA 5E6NA 5LONB 2HTHA 3H7PB 4IM2A 3PTFC 3VAWA 3W1SA 4TV3A 2CR5A 1FB8A 1DBHA 2DX5B 3GYPA 3QAQA 4IWOA 2G45B 2DYQA 5IAAC 1RRPB 3P2BA 2GJYA 3KYDD 4HVBA 3UF8A 4MGKE 1L2NA 3FLVA 1U27A 4HAVB 2KX0A 1IP9A 1JRUA 3IVFA 2W9NA 1OTRB 1EAZA 2G35A 2VSZA 1DDWA 3VOQA 4CHJA 1LM8B 1WJ6A 2DAJA 2HD5B 2KLCA 2DX5A 3A8PA 4JL9A 4ZDVA 1XD4A 1HB8A 4HAYB 2GMIC 2V1YA 3KVFB 1YD8U 2KX3A 5J3QA 2L76A 2Q13A 2MP2A 4XC2A 4F7GA 1OQYA 1NBFC 2KVRA 2DYMA 4A6FB 2LOZA 3F0WA 4AJWA 3OANA 1V5TA 1MAIA 4K7WA 1UBIA 1BAKA 1XR0B 1VCBA 1V5OA 3M95A 3NZUA 2C7HA 5D3VA 1V5PA 2P0HA 3NOBA 3PGEA 4ANVA 2NPTA 1Q67A 1R4MI 3D32A 4K7SA 3VH4B 2ELAA 1W1GA 2KDFB 1E8XA 5IA7A 1UGMA 3SO6A 2KO3A 1WGYA 2OJRA 3VUYA 3ZNZB 3PVWA 1WJNA 4W9GA 4KHOA 2I1JA 2KFJA 1U5DA 1Y5OA 2MWSB 1WJMA 2ZCBA 2MRPA 4G0NB 3VTVA 2GBKA 3EECA 4I6LB 2N1VA 3ZDTA 3S2AA 3CSTA 1XKEA 3CXBB 2DHKA 1UD7A 1WI0A 1M94A 1W1HA 1WGHA 1WZ0A 2RLOA 4WVFB 2MFQA 1EGXA 2DENB 2ZNVB 3L08A 2J7QB 2MP2B 2O6VB 2K1FA 1EF1A 2GS0A 2M14A 1OEYA 1OGWA 4FLHA 2ASQA 5AZFA 2CY5A 3ZRFA 1MK7B 1E8WA 4RMAA 3PHWB 1WG7A 2NVUI 2K39A 2YT0A 2YS5A 2L0TA 3ZO5B 4PYUA 1Z5SB 2DFKA 4GMXB 2N23A 3ODXA 3AU5A 4K2PA 1WX9A 2LRWA 3V6CB 3UZTA 1QQGA 2AWTA 1DROA 4PS8A 4URKA 2GCJA 4WWOA 4MSMB 2I5FA 4DDID 1ZSQA 2BGFA 1IPGA 4LJOB 3QJZA 1WJ4A 4FULA 2Z0QA 2R09A 1BTKA 4L6EA 1V9JA 2ZEQA 1XQQA 2BPSA 2M4NA 3TBLD 4WJOA 1GJZA 3LDZE 5D2MB 1I35A 3SUZA 2DA0A 5KQ1A 3B1LX 3R3MA 4GDLA 4E3CA 5HKHA 2KC2A 3HIZA 5G2NA 3MTNB 4MGIE 4FJYA 2K2JA 2PZ1A 1NI2A 4HAWB 4PS7A 1UNQA 3W1YA 2K8CA 1BWNA 2R2QA 2UYZB 4W9HA 2J0MA 2FAZA 1WE7A 4H8SA 3SDLC 4XZ4A 1NTIA 2ELBA 2N0YA 3A8QA 3VIAA 4BBKA 1WXVA 3MDBC 1E5WA 4Y94A 2ZPYA 2AYOB 3PLUA 2GOWA 2L3ZA 2V76A 3PP2A 1XT9B 3KUDB 4FJVB 3RZWC 2P0FA 3WAPA 3PREA 2IY0B 2KTRA 2FNJB 2MBOA 2L2IA 2YS1A 3EC8A 3JW0X 1XCGA 1XODA 1X1MA 2IYDB 2DTCA 4B6HA 2NR2A 4I6NB 3VUWA 3FEHA 3NS8A 4BOZB 3DBHI 3JYUA 4W9LA 2MBBB 4BOSC 5AZHA 5D7GA 3OAWA 2KUPA 3RULA 5IJMA 3ZUNA 4FJZA 1FHWA 2HTHB 5DPWA 4WQOB 1X86A 3ML9A 2LI5A 4WJNA 2D9WA 2K25A 4YONA 4B95A 2XK5B 3D8EA 1WMHB 3FP5A 1MIZB 2IO0B 2KQSA 2DZIA 2BYEA 2JUOA 2JP2A 4IUMB 4KV2A 4FADA 1V61A 1WFYA 3ZRCA 3Q3JA 3V6EB 1Q5WB 3GZNI 1OQNA 5C23A 3KY9A 1V49A 3ODOA 5D6JB 3QA8A 2C5LC 2G4DB 3UQBA 1J0GA 1LFDA 2CHZA 2YT1A 4PNKA 1NU2A 4ANXA 1QC6A 2JZ3B 2MWNB 3AULA 3ZKJC 4HB0B 2LD9A 2LWPA 2N7DA 4GDKB 3VFKA 4MT7A 2WWZA 4E71A 1ZC4B 4MJSA 5FI0A 2O6VD 3PT2B 4IC7B 2EC1A 4GN1A 1TZ1A 3DXEA 2LYDA 2XK5A 3ZNHB 1GG3A 5C16A 2GCLA 3QC8B 5DPSA 1DDMA 2KQ7A 2EJ8A 4NNJB 2O6VA 2OOBB 5DPTA 5JHHA 2X18A 2Z59B 2QKMA 1ZVRA 4KAXB 5D3YA 3ZNID 3KSYA 2RUKB 3PRZA 3N32A 4MK0A 3JSVB 4A6KA 1KOTA 3WIMA 3CIKA 1RLFA 2B3AA 1EF5A 4EZKA 3QWZB 1MKEA 3VTWA 1ZM0A 2DHIA 2FCNA 2L0FA 5E6PA 5DHAB 1AWEA 3ZNGC 4DDGD 4IOYX 1P3QU 1H8CA 3OLMD 4M8MA 2YVCA 2IFSA 3APDA 3PRMB 4NQLB 5J2RA 2MKRA 4W9DA 2DYOA 1SE9A 4GGQA 3DVNV 1P1AA 2BYVE 2LOXA 1YJ1A 3PV1A 2ADZA 2IBIB 5C1ZA 1MK9B 1WXSA 2DKPA 4K2OA 3A9KA 3TMPB 4MM3A 4W9KA 4B9KA 2C7MB 2FCQA 3BINA 1M7EA 1PQSA 3PPAA 3FM8C 2WDTB 3PSCA 3H6NA 3QK0A 4JIOU 2LVOA 2IZVB 5AEKB 4IWQA 3ENEA 2QKLA 4KVGB 1L7YA 1D3ZA 4HJKA 2NMBA 1W1DA 1S1QB 1FHXA 4ICUA 5C5BB 5KCVA 3A4RA 1V81A 4DK5A 1LQBA 1T0YA 2UZRA 2MBHA 2RGNB 4PYZA 1DYNA 4A5KA 1E7UA 2M17A 2W2WA 2MX2A 3GYOA 3WYFB 4GIVA 4PQ0A 4HB3B 2DX1A 1U29A 2C7NB 4DHZB 3A9JB 2D9YA 2PPHA 3DBSA 1FAOA 2KFKA 3KW5B 2J0JA 1PMSA 1P98A 2XBBC 3SNHA 1RJ2A 5CHWA 4KIKA 1IRSA 2Y7BA 2YF0A 2EMSA 4KDLB 1PFJA 4GMVA 2IO3B 2COAA 2J0KA 5CLQB 5DI9B 1TGZB 3UQAA 4Z2NA 3OJ4B 2OQBA 5HE1A 2IO1B 2RQ1A 4OVUA 3T8MA 1RRBA 4G11A 1WVHA 4GZUA 2Y8FA 4NAWA 1LB1A 2D11A 5KHOA 1GUAB 1WMHA 1TXDA 4EMOA 1UNRA 3N3KB 1U2BA 1SIFA 2EMTA 2D9XA 1WRDB 4II2B 4IWPA 3TIXA 2KHWB 4ASWC 1DDVA 5D3WA 2KXJA 4NAWB 4MY6A 1SGHA 4A6HA 2DYBA 1UNPA 1BT0A 3TVVA 4MSQB 2YLMA 3NSUA 4GSWA 4A20A 2M0XA 5J18A 1FOEA 5J3YA 5HE0A 2FCSA 2IO2B 2N9EB 2LJ5A 2L1CA 4LCDE 4HAZB 4P7IA 3VH3B 2L7RA 4HCNB 2LG1A 4HAXB 2BWES 4WJQA 3SYXA 4D0NB 2DN6A 2Y5BB 4NJ6A 1NTYA 4DXAB 3D8DA 4X57B 5D3XA 1FGYA 1CMXB 5JHBA 3ZVVA 3VQIA 1KM7A 3F5RA 1K5DB 3QWMA 2RGFA 2MSED 3DDCB 5CHVC 3V60A 3WAOA 3ZTCA 1WGGA 2JXXA 5GMVA 5L83A 1Q1OA 2CS4A 5DIFB 2IYBA 1FHOA 2DHZA 2REXA 2BCJA 4HPLB 4HPMB 1WXMA 2LGXA 4XWXA 1UPQA 4M8NA 3PVLA 1WI1A 1E8ZA 1YIWA 2KDBA 1ACAA 2CAYA 2KMAA 3I3TB 3M62B 3HM3A 2XQNM 2KWUB 2VRRB 2Z0EB 4K81A 3ULBA 1LW3A 3FSSA 1EO6A 2JY6A 2ZVNA 4WWNA 4B6WA 3Q3FA 3QCAA 2CU1A 4ANWA 2LXAA 2N9PC 3VHTC 3HW2B 2L8JA 3IG3A 4JLCA 1WGDA 4EOYA 3A98B 4KHBB 4KSLC 3PG7A 4CYEA 1UH6A 4MH0E 5BO4B 2K00A 3EPYA 2KJRA 2ZPNA 3B0AA 5DHFB 3ECIA 3QIJA 2DKQA 3TW1A 1TBEA 3TFMA 1ZKHA 1K8RB 2C60A 2A5UA 3AU4A 4G50A 1HBKA 1U5GA 4WJPA 2O2VA 5AZGA 3T06A 1N3HA 2COFA 4TYZA 2KLGA 4F7ZA 2EKEC 3M63B 2HE7A 3VXWA 5JH5C 3C0RB 5CTRC 2D2QA 1TQZA 1WJ1A 3BY4B 1UPRA 4KSKC 3R7QA 3X0WA 4FA6A 3P7ZA 2RR9A 2GBNA 1WGRA 2LBBA 2Y8GA 2H7DA 1VD2A 3RZFA 2K8HA 3X23A 4RM8A 1NVLA 2FUHB 2BYFA 2L05A 4HHVA 3W1SC 1C1YB 2PE6B 5CX3A 4YL8A 1UELA 4HB2B 1SHCA 2VRWB 2JRHA 3IFWB 3L13A 2WX1A 3L10B 2LGYA 3L16A 2ZVOA 2CQUA 4HWIB 1V86A 2KN5A 2LVQA 3SV1A 3RUIB 1WZ3A 2K8BA 4WWPA 2ROVA 4TQ1A 4ZRKA 2CB8A 2DYNA 2A4ZA 3L17A 1P9DU 5EFXA 1J0WA 1WE6A 3ODWA 4W9JA 2DZKA 4WAAA 3UIPB 4F7UP 1U4AA 3KUCB 3PS6A 2RD0A 5CHFA 1M7RA 4IW0A 4KZ0A 3EFUA 5J3TA 2DHJA 4C0AA 4DBBA 1WY8A 2MA9B 3CMMB 4M0WB 5TR5A 3MPXA 5HE2A 3UIOB 2Z0PA 2NZ8B 2FIDA 3H1UA 3A9KB 5LXIB 3HK0A 2D3GA 1V89A 3DVGY 1X11A 2H7EA 3KRXA 3QHTA 4IM0A 2COCA 4MELA 4MDKE 4MEMA 2NBWB 4IG7B 3R7RA 3PRPB 5C6RA 2KJ6A 2KC1A
chains in the Genus database with same CATH superfamily
1JQ4A 2KWCA 3WA0A 1J7CA 2MBQA 1GC6A 2DZMA 1KFYB 2N9XA 4FHJA 3TUOA 1UZXB 4KHAA 5JHGA 4I6PA 4BBNF 2H88B 2D9VA 3DOWA 1YN3A 3R8BA 1V80A 2GB1A 1KH0A 2FJ9A 3EHVA 2J4XA 2PVGC 3VUXA 2KDIA 4BFRA 1X05A 3DBLB 2WXMA 4RGOS 2GBRA 2KDMA 3AJ4A 1JWSD 1KZ7A 2Z0DB 4JKEA 2H89B 1YX6B 4GPTB 2G3QB 3OWEB 3PSEB 1ZW7A 4NPNA 4ANXA 2D4QA 1R4NI 2MEKA 4ZHPA 4C7ZA 5LOPB 4BVUC 5L81A 3QX1A 3RCZA 5LG4B 1FMAD 2D07B 3RCPA 1LXDA 2KT7A 2MBEA 3WCQA 1C3TA 4C80A 2W3RA 3IAS1 1D4BA 3TJPA 4EFOA 2HDEA 2WXPA 4BKGA 3APCA 5JHAA 1E7VA 3ULCA 4DX8A 2ZNVC 3PO0A 2WH5A 4CSQA 5L95C 1Q10A 3PZDA 2JT4B 3ZTDA 1EU4A 1OMWA 4KGSA 2Z0OA 2IPKD 3GOEA 3Q14C 5G55A 4W9IA 4NY0A 4HRSA 3AE1B 3WALA 4BKSA 1WX7A 5HE3A 1G6JA 1NTVA 2I1KA 1MIXA 2MLBA 4BKSD 4WQMA 2MQJA 2LRUA 1E90A 1E8YA 1V1PB 4WH4A 3SHQA 4II3B 3VRBB 4MGZE 3RNCC 4AJYB 3OJ3A 3KZ1A 3UGBB 2YS3A 2KDEB 2WYQA 2M8SA 3IAM1 3ENBA 2RVBB 3AEDB 4JQWC 2YSZA 4WSFA 2KWVB 1ENFA 4EUTA 1KI1B 4HLEA 1Q0WB 4F7HA 1L6VA 2WXQA 3BK1A 4EKUA 3HUIA 3V62A 2WP9B 3QQ8B 2P0DA 1TS2A 4HXDA 1PLSA 1F77A 2K2UA 1CZPA 3GS2A 4GOCA 2R2OA 4LDTD 2KANA 1N62A 4NJ7A 1IBXB 3KRWA 4A3PA 4GU2A 4C7YA 2LASA 2LGDA 1ZC3B 1ZE3D 4KZCA 4F8CB 4W9EA 3DXDA 3N20C 2M1MA 3K9PB 2VKIA 5JLJB 1C4CA 4PT5A 5E6OA 5C2TB 1XD3B 2CHXA 4NZLB 1Z87A 2ZCCA 1WGUA 2IGHA 4GDLB 4FHKA 4AQ7A 3VR9B 3EFCA 1FB8A 1DBHA 3GYPA 1RRPB 1L0YB 1JDEA 4MGKE 1U27A 3E9PA 3IVFA 2WNMA 2G35A 3VOQA 1LM8B 2BB6A 3A8PA 4OZCA 1FCLA 5IN7A 1SF0A 2V1YA 5HFYA 2L76A 4XC2A 2N0SB 4F7GA 1OQYA 1NBFC 4DQOC 3AN1A 2KVRA 4HSIA 5M4YB 2GI9A 4OVZA 1UBIA 3M95A 1TS4A 2P0HA 3PGEA 2G9HD 1Q67A 3D32A 1KLGD 2RMMA 1E8XA 1WGYA 2OJRA 4IDIA 4P16A 3ZNZB 2HTME 1I4HA 1YJJA 3TEXA 2I1JA 2MWSB 2KR0A 2N1VA 1UD7A 1W1HA 2ZNVB 3BWUD 4LJOB 4WVFB 1EGXA 4F7ZA 3P42A 2J7QB 3PHWB 2NVUI 1AWDA 2QSDA 4GMXB 3ODXA 2D5GA 3V6CB 3DHIC 1QQGA 1DROA 1ZSQA 2NTTA 2ZEQA 1GJZA 2BPSA 4WJOA 3LDZE 4JK8A 3SUZA 3R3MA 4E3CA 4MACA 3MTNB 4PS7A 5I2SA 1VDVA 2K8CA 2J0MA 4HKZE 1QOBA 4H8SA 3SDLC 4YWGG 3U2SC 3A8QA 4BBKA 1WXVA 3FILB 3MDBC 1ZOYB 2ZPYA 3R2IA 2L3ZA 3WAPA 4ILGB 1MHXA 2L2IA 4KHBA 4OW0A 1I4QA 5AZHA 3AB5A 4NAMA 3ZUNA 2PVOD 1FHWA 2HTHB 4WQOB 3ML9A 4WJNA 2LI5A 2D9WA 4YONA 3AE6B 1TT5B 2XK5B 1YJIA 3FP5A 1BXTA 1MIZB 4YSZB 2MJ3A 2IO0B 2BYEA 4KV2A 1V61A 1WFYA 3ZRCA 2WXHA 5HG2A 5C23A 3KY9A 5D6JB 1DYQA 2YT2A 2CHZA 5JXVA 3ZGZA 3VFKA 4MT7A 4E71A 1ZC4B 4IC7B 1N5WA 2XK5A 3ZNHB 2AQ2B 5C16A 4NNJB 2OOBB 4HPPA 4WWMA 5JHHA 3ZNID 2Z59B 2QKMA 4KAXB 2CU3A 2WXRA 3N32A 3TSSA 3B9JA 1AWEA 5MPOA 4NQLB 2MKRA 2DYOA 1SBBB 3U12A 1P1AA 2LOXA 1YJ1A 4N58A 1WXSA 2DKPA 1F1HA 4L1RA 3PSCA 2VH1A 4TMAB 2L32A 4KVGB 2FE8A 1L7YA 2NMBA 1FHXA 5C5BB 2UZRA 3T3NA 2M17A 2W2WA 1GPXA 2DX1A 4DHZB 3A9JB 1T3QA 1KRHA 1FAOA 2KFKA 3VVWB 1PMSA 3SNHA 1RJ2A 2Y5CA 4KIKA 1IRSA 2YF0A 4N6EB 1XLNA 2IO3B 5CLQB 2IO1B 5HE1A 4L2YA 2D11A 1WMHA 1TXDA 5EE1A 3URYA 3N3KB 3AE8B 1SIFA 3NZ3A 4QJ4B 4P6VF 2PLPA 5D3WA 1ACCA 3IT6B 4M0WA 2KAJA 2ZW1A 3RFZB 2L1CA 4HAZB 5BYRA 2L7RA 4JKAA 4HCNB 2LG1A 4HAXB 3SYXA 4YTNB 1D6EC 1NTYA 3VQIA 3NWAA 2WDRB 5CHVC 2RGFA 3Q8FA 3V60A 3BYTB 1C9FA 2JXXA 1V1PA 1WXMA 4XWXA 1UPQA 4M8NA 3DWMA 2KMAA 2CAYA 4K81A 3ULBA 1E9MA 1KLUD 3RN9C 1EO6A 4WWNA 4B6WA 3VHTC 4O1NA 4KHBB 4KSLC 4CYEA 3ECIA 2C60A 2DKQA 1QOFA 1VZ6A 4WJPA 5AZGA 5C3JB 4TYZA 2KLGA 2D3BA 2BQQA 5CTRC 1TQZA 2XNAC 1WSPA 2GBNA 4RM8A 2OHFA 4HHVA 2PE6B 1UELA 2VRWB 1UWXA 4HWIB 3SV1A 3ZJTA 4P1BC 5E6JA 2CB8A 2SEBD 1J0WA 1FRDA 1U4AA 3PS6A 2DLBA 5CHFA 1M7RA 4KZ0A 3EFUA 5J3TA 2DHJA 3UIOB 4YSYB 4CQNA 4MEMA 1R4NB 4IG7B 1VBGA 3RPFC 2KJ6A 1XLQA 4NQKE 5JZEB 4CHKA 3ZXVA 2PJHA 3KUZA 2WXLA 2W2XD 2N9LA 1P5TA 3LYYA 2OTXA 4C4VB 2P8VA 4B0MA 1FFVA 2KFKB 1EWCA 5CHWA 5CLLB 1MI0A 2IY1B 3G9WA 2DLWA 4TKNA 4EZJA 2D9ZA 2CRFA 4W9KA 1PDXA 3A1QA 2E6XA 1V2YA 3VTUA 1D5XC 4LDTB 4DWFA 3AI5A 4HK2A 4NSWA 4S0RA 2KK8A 2CODA 1AN8A 1IYFA 4DHJB 2RNRB 4RH6A 4G3XB 2BS2B 3SBTA 2ZW0A 3N30A 3AE3B 4EEWA 1WM2A 2M19A 3MJWA 3TCAA 2Z59A 3M3JA 5DPRA 1IUEA 1B1ZA 1V5MA 3P6AA 1UBQA 2CJOA 3MP9A 1C79A 4JX1C 2PW9A 4NJCA 1VR9A 4US8A 3IBEA 4HDQA 1Y19B 1R4MB 2KD0A 2BF8B 1KLVA 1FCCC 1P3RA 5GOWB 4MGYE 4OVVA 4LJPB 2WXOA 4OHJA 2JPHA 3HVDA 3PZ8A 3PLVA 4DHJD 2R0DA 1EVHA 1L0VB 1V5UA 3NHEB 1YQBA 2QMTA 1ZPSA 4ZDVA 3H7SA 2KGXB 2RSGA 2UZSA 4ANUA 3DBLI 1WH3A 3A9JA 4TUUA 1SJED 4M01A 4XDDA 2JVCA 4ARCA 2LXCA 2I38A 4F1SA 4AP4C 2G4SA 2KMCA 4JWUC 4HCPB 2FDQA 2BVCA 1P6SA 2CJNA 4IKGA 1F0ZA 2JRIB 1L5PA 3AV8A 3A4SC 3PEGA 3QARA 1GB1A 3PVUA 5C79A 4D2KA 1DGJA 3LJUX 4A6FA 3H9DA 2E2XA 2V4LA 1BTNA 4ZYNA 2KUQA 4DX90 2INPE 1JALA 1DOXA 4ICVA 4GNKB 4EE2A 2D10A 2FBWB 4MJSB 4AOFA 2JXTA 3ZYYX 3W5UB 1P0RA 3L54A 3JVZX 4AUQC 4DBGA 3MHSD 4ARIA 2KNBA 4BBNC 2KTRB 4TQ0A 4GB9A 3BVZA 5TSSA 3APFA 1FXTB 1GOZA 4ZRJA 4ACFA 3MC9A 1X1FA 5T8IA 2MW5A 1GC7A 1UEFA 2ZZPB 5BMIA 2KCJA 1XCQL 1F9JA 1IGDA 5E6NA 2BT6A 2B76B 2HTHA 4IM2A 4JE3B 1TY2A 2CR5A 2DX5B 5HI1A 2DYQA 3W5VB 3P2BA 4XWWA 1L2NA 4PK1A 2KX0A 1IP9A 2W9NA 2VSZA 1ZYIA 1SE4A 2WU5B 2DX5A 4JL9A 2R82A 1HB8A 5HHDG 5D3DA 1YD8U 2KX3A 2GLSA 2Q13A 2HJ1A 1STEA 5BYSA 4M02A 3OANA 1V5TA 2X38A 1BAKA 1XR0B 1VCBA 2WDVB 3NZUA 5D3VA 3KLSX 1YMHE 4K3CA 1HZ5A 1R4MI 3VH4B 2ELAA 1NI3A 1UGMA 2KO3A 3BIID 3PVWA 1NENB 2GUMA 2KFJA 2RRFA 2MRPA 4G0NB 4ILHA 3ZDTA 2QILA 4B0EA 2WS3B 1M94A 1WZ0A 2RLOA 2MP2B 2O6VB 2M14A 4WURA 5AZFA 2CY5A 1MK7B 4JKFA 1E8WA 4RMAA 2WLBA 4OSNA 3ZO5B 4PYUA 2DFKA 2LRWA 3AU5A 3VRAB 2AWTA 4PS8A 2GCJA 3FILA 4DDID 2M0AA 3QJZA 2Z0QA 4L6EA 1BTKA 1V9JA 4WIPA 2M4NA 3TBLD 5D2MB 3B1LX 5HKHA 2KC2A 3HIZA 2PZ1A 1NI2A 4HAWB 1TIFA 4W9HA 3Q8AA 2Z14A 2FAZA 3B2GA 1NTIA 2N0YA 4Y94A 2PIAA 2WXFA 3RZWC 3Q2AC 3PREA 2IY0B 2FNJB 2YS1A 3RMKC 2IYDB 4B6HA 4DXGA 3JYUA 4W9LA 1SSNA 3CIRB 1HXYD 1DOIA 5D7GA 3OAWA 3KQ4A 5IJMA 1RM6C 4WAFA 2INCC 2Y5PA 4FJZA 1MHHE 1KF6B 3CWIA 3GE3C 4B95A 2IJ0A 3AE4B 1WMHB 1T0RC 2DZIA 4IUMB 4YTMB 4FADA 5LNK1 3Q3JA 3NG0A 3BK2A 1V49A 3ODOA 3HRDD 2C5LC 1J0GA 2YT1A 1NU2A 1GAQB 3GZNB 1JWAD 2JZ3B 3ZKJC 4EOYA 2LD9A 2LWPA 2N7DA 4GDKB 1ESFA 2WWZA 4MJSA 2MJDA 2O6VD 1YQ4B 4GN1A 3DWGC 1HEZE 1K53A 5DPSA 2KQ7A 2EJ8A 1SB3C 2O6VA 2X18A 5D3YA 1HA5A 1E10A 1FXIA 1T0QC 2RUKB 4MK0A 3JSVB 4XWTA 2DWQA 4RF1A 1MKEA 2DHIA 2L0FA 2V3PA 4DDGD 1H8CA 1P3QU 2YVCA 2IFSA 3PRMB 5J2RA 1SE9A 2BYVE 3PV1A 2IBIB 2ON8A 5C1ZA 2MJEA 4K2OA 3TMPB 1NYQA 3BINA 3PPAA 3FM8C 3H6NA 5AEKB 2IZVB 2TSSA 3ENEA 4HJKA 1W1DA 4ICUA 5KCVA 4DK5A 1LQBA 2MBHA 2YEPB 1UNSA 4PYZA 4A5KA 2MX2A 2K8EA 4PQ0A 1U29A 2C7NB 1ZXHA 3DBSA 1P98A 2COAA 3BVGA 4JKDA 4Z2NA 1T6BX 2RQ1A 2W54A 1RRBA 4G11A 2Y8FA 1K50A 1GUAB 4YXDB 1UNRA 1QT9A 1U2BA 4IWPA 2D9XA 1MG4A 1N63A 2KXJA 3NVVA 4MY6A 1JRPA 1BT0A 1SJHD 2YLMA 3NSUA 4GSWA 4A20A 2M0XA 1FOEA 2N9EB 3VH3B 3O13A 3TEWA 4D0NB 4DXAB 4ZYSA 5JHBA 5D3XA 1CMXB 3GP7A 1K5DB 1WGGA 3MC8A 3EGRA 5DIFB 1FHOA 1D5ZC 2BCJA 3Q8CA 3PVLA 2NMQA 2KDBA 2RDHA 1ACAA 3M62B 3HM3A 2VRRB 1AW7A 2Z0EB 1MJDA 1FXAA 3FSSA 2ZVNA 2JY6A 3Q3FA 3QCAA 4ANWA 2N9PC 2L8JA 1WGDA 4JKHA 3PG7A 1YNTE 3EPYA 2ZPNA 5DHFB 3TW1A 1TBEA 2A5UA 1N3HA 3C0RB 4IOIE 2D2QA 4XGAB 4KSKC 4FA6A 3X0WA 4RGTA 4DIXA 3P7ZA 1TYGB 1WGRA 2LBBA 3RNFC 3RZFA 3X23A 3BVMA 1NVLA 1A70A 3W1SC 1VJKA 4USAA 4YL8A 2JRHA 5G5HA 2KIEA 2J52A 3L10B 2ZVOA 4K3BA 3HVZA 1V86A 2EELA 3RUIB 4GOUA 2K8BA 4ITKA 4ZRKA 2DYNA 2A4ZA 2PTLA 4W9JA 4A9AA 3CMMB 1WY8A 2MA9B 3FVCA 4M0WB 5HE2A 3A9KB 3SFEB 4XDCA 2YEPF 3DVGY 4MDKE 1B9RA 1L0XB 5C6RA 2KIGA 2KC1A 2CY4A 4JGHB 3N1ZC 1TS5A 3N7CA 3P1MA 5DCNA 4LNNA 1MG8A 1V97A 1I42A 2CHWA 5LXHA 1ISNA 2HRJA 3NZSA 1ET6A 2GBMA 3OHMB 1WIAA 4BKTA 1QILA 2RSUA 1MI1A 4J6IA 5C5BA 2UVMA 3B2FA 2XEWA 3CSFA 2LKOA 4KGTA 4KGRA 3ZXRA 1FIQA 3C19A 1VBHA 3IT4B 2JWUA 2XN9C 5KHQA 4LNIA 1F52A 2MCNB 4ZRIA 4W9CA 1H10A 4WJ7A 4OZAA 2K6DB 3JSVA 2QHOA 1I2HA 4Z2MB 1YX5B 1J19A 3SU8X 3E56A 1E7PB 2NS5A 1QF6A 4BZAA 5J18A 3ML4A 2Z4DA 1RFAA 2NCNA 3TEYA 1BUIC 4MH8A 3K9OB 3D8FA 2VZKD 4HAUB 1ZDXA 3DQVA 4CHMA 3ALBA 1PGAA 3T9LA 1AARA 4HDOA 1ZGUB 3Q8BA 3ZDMC 4MT5A 4CO7A 3KH0A 3N1YC 1GB4A 5AUKA 1Z2MA 3KYCD 3WANA 1WGQA 3HM6X 1QQRA 1J7BA 1Y56A 5D94A 1WM3A 3HHMA 2R2YA 2FIFA 1XCTL 3GB1A 1ZP0B 3LJ3A 1YOVB 4GLSC 2HJ8A 1U5EA 1WR6E 5H92C 3VDZA 2K6QA 1N60A 4AWJA 2FCMA 3WAMA 4IM3A 4EZKA 4KDIC 4XX5A 2DZJA 3N1XC 1WR1A 2RPQA 3DBRI 3ML8A 4FXCA 1GNUA 4FN2A 2JF5A 1B55A 1CJEA 4JKBA 2N7EA 2O2VB 4PS3A 3DXCA 4ZRQA 2JSVX 1SEBD 3RT3B 4XYCA 1I7AA 3NVYA 3U30A 1DOYA 5FR3A 3A33B 2PE9A 1MVKA 1JMLA 2GBJA 2N4FA 5DH9B 1XEEA 2JYEA 5IRSA 4DHZE 2X8XX 3AH7A 1FGZA 3V61A 3E9LA 4A55A 1OY2A 3ZW3A 4HB4B 1NVID 1MPEA 1H4RA 1JW9D 4L23A 5IP4D 3RD2A 1QLBB 4ZRPA 2WHIA 1TKGA 1I4GA 4C00A 4E74A 4DXFA 2W2XC 1AQCA 3NRZA 1OEYJ 1J7AA 2KJHB 1FNVA 5LONB 1L4DB 1T5XD 3PTFC 3VAWA 3W1SA 1E6EB 4TV3A 3QAQA 4TSSA 4IWOA 1HTQA 2G45B 4A90A 3KYDD 1PUTA 3UF8A 1BMLC 1EAZA 1WJ6A 1DDWA 3E9OA 2HD5B 2INDC 1XD4A 4HAYB 3KVFB 3ABVB 1NEKB 3HIEA 2LUMA 2LOZA 4AJWA 2DBYA 1MAIA 1V5OA 3NUHB 1V5PA 4H2AA 4ANVA 2NPTA 4HKQA 2KDFB 4S17A 1SE2A 1I4PA 2L83A 4W9GA 1C4AA 1V8CA 1Y5OA 1YQ3B 2ZCBA 5EE9A 3VTVA 1JWUD 3S2AA 1N61A 4HROA 3CSTA 1TJEA 2SAKA 1WI0A 2Q5WD 3E66A 1WGHA 2DENB 1QOGA 2V0GA 3L08A 2K1FA 2GS0A 2JZPA 4XE0A 1VZ8A 2LHEA 1WG7A 4OT1A 2YS5A 2L0TA 2YT0A 1RWSA 1Z5SB 1WX9A 1KC7A 2N23A 4K2PA 3DBRB 2KYWA 2Z8LA 4URKA 3BYYB 2I5FA 2BGFA 1IPGA 2QC8A 1WJ4A 4FULA 2R09A 3P4SB 1XQQA 1I35A 2OJWA 2DA0A 2GRIA 5FKAC 2QCZA 3AM9A 5G2NA 4FJYA 4A6QA 1UNQA 3W1YA 4XZ4A 1JROA 1HZ6A 3U7ZA 2AYOB 3PLUA 4FJVB 1WYGA 2GOWA 3KUDB 1HQRD 1HTOA 3QC8B 3EC8A 3JW0X 1XCGA 1XODA 2NR2A 3NVWA 3VUWA 3FEHA 3NS8A 2K9XA 3DBHI 1I4RA 1UF0A 2EKIA 2L1AA 2LGSA 3RULA 1AYFA 1X86A 4MM3B 3U4EG 2LMCA 5EE3A 2WXNA 2WQYB 1XLOA 2UU7A 1XO3A 2BYTA 2V3NA 2KQSA 2JUOA 2JP2A 2V4IB 1XXGA 1Q5WB 3GZNI 1TKYA 3UQBA 1LFDA 2D3CA 3AULA 2E3TA 2WXJA 5FI0A 1TZ1A 3DXEA 2LYDA 2K5PA 4JPSA 1GG3A 2GCLA 3KSYA 3SBGA 3NVZA 3AE9B 1KOTA 3WIMA 4RF0A 2AQ3B 3CIKA 3RI7C 3QWZB 3ZLZA 3R2TA 1ZM0A 2FCNA 3OLMD 4M8MA 3GE8C 4W9DA 1FNWA 3DVNV 2WXKA 2ADZA 1MK9B 1PGBA 2W82A 2FCQA 1M7EA 2WDTB 3QK0A 2LVOA 2QKLA 1D3ZA 4KKIA 1K52A 3A4RA 1T0YA 2RGNB 1DYNA 1E7UA 3WYFB 4HB3B 4C4VA 1V1OA 4YT0B 3RNEC 2PPHA 3KW5B 3RNBC 1I4XA 3KWVA 2EMSA 4KDLB 1PFJA 4GMVA 2J0KA 5DI9B 5FK9C 3T8MA 1WVHA 4NAWA 1LB1A 5GXGB 5KHOA 4EMOA 1FO4A 2EMTA 5IO9A 2KHWB 1ET9A 4ASWC 1DDVA 2ONQA 4MSQB 2KVZA 5HE0A 2FCSA 3NWFA 2IO2B 1YN5A 4LCDE 4P7IA 4JWSC 3Q69A 2BWES 2G1EA 4WJQA 2W55A 2DN6A 2NTSA 3D8DA 4RFBA 1FGYA 4OZBA 3ZVVA 1KM7A 3F5RA 3ZTCA 3WAOA 4REZA 2WXIA 5GMVA 5I4DA 5L83A 1Q1OA 2IYBA 2LFIA 2REXA 4HPLB 1FD6A 4HPMB 2LGXA 1E8ZA 1YIWA 3I3TB 2XQNM 2KWUB 2PKOA 4JKGA 1RYJA 4JLCA 3H8HA 3AEGB 4D6WA 3B0AA 3QIJA 3AU4A 2D3AA 1HBKA 1U5GA 2COFA 4L1BA 1R7SA 3RNAC 2EKEC 3VXWA 4LTUA 1WJ1A 1UPRA 2K8HA 3Q3NC 2BYFA 2L05A 2N9KA 1C1YB 5CX3A 2BS4B 4J3OD 5EE0A 4JKCA 4QXAB 2LGYA 2LVQA 2M56B 1WZ3A 4TQ1A 1P9DU 5EFXA 3ODWA 2VH2A 2DZKA 2WXGA 1KBLA 3UIPB 4C56C 2RD0A 1IBXA 3HSAA 4C0AA 4DBBA 2W3SA 3MPXA 3UI3A 2Z0PA 3IXSA 3ZJVA 5LXIB 2MHJA 2D3GA 1V89A 1X11A 1N5XA 4IM0A 2COCA 1PFDA 3AECB 1FPYA 3NW8A 1ST7A 3QBVB 4GDKA 2L00B 1FNUA 3I57A 4A3OA 3H7PA 3HQCA 3DHGC 3SD5A 2UWQA 2CKHB 2JZZA 2COPA 2BS3B 2KZRA 3A1QB 4K1RB 3DVNU 3FAHA 4HATB 4QJ3B 4RM9A 5JP4A 3R66C 3ONSA 2C9WB 4IAPA 3DPDA 2BWFA 1TJ6A 2LZ6A 2V3SA 3V5WA 1C4PA 1EWYC 5FI1A 1IGCA 3Q6BA 2J59M 3AMZA 2MDXA 1FFUA 3A58A 2K49A 2BW2A 2J42A 3M1IB 3I63C 3CF6E 1KJTA 3N9YC 3NY5A 3DCGA 4MM3A 1OFFA 3O65B 2WGSA 2ZJDA 3TO1A 2LULA 1K5GB 3SR6A 2AL3A 3U8ZA 1WX8A 3L4PA 2JX5A 3DVGX 1HB6A 3VR8B 2QIEB 1S3SG 2BKFA 1Y8RC 3FC4A 3AE7B 5KQ4A 3B08A 4W9FA 2ICIA 3RYTA 2NBVB 4EZLA 2Z13A 3AEFB 2VZKB 2KOXA 3ZIMA 5EDSA 2PEAA 1T77A 2YRYA 1NYRA 3DCXA 2LEKA 1X1GA 4GXBA 2N7JA 2FJUB 2NBUA 4FBJB 3DBHB 2L52A 2LUEA 3L0WB 4K7UA 1J8CA 2LVPA 3PHXB 1L4ZB 3EUB2 1KZGA 2BKRB 1L6UA 1MPHA 2I5CA 3ZVRA 1TTNA 3AEAB 1C78A 1CQVA 3UINB 2IGGA 2INNE 3BJIA 3IHPC 2DAFA 4EJNA 5BMGA 4ZHOA 1VRAB 1EM7A 2KN4A 1WYWB 3U7DA 3TL5A 5D27A 5FR6A 1UWMA 4IFSA 3O96A 1V6EA 2M38A 2IDYA 2AEHA 4BAXA 2NPTB 1A5RA 1XX0A 1FRRA 2FJLA 1QKZA 1NDDA 3MHZA 5D3IB 1XLPA 1V88A 3V3XA 5LLIA 2BTEA 3NS1A 5J17A 5JVLA 4K17A 2WX0A 3MJ5A 1WXAA 1QZEA 4LK0M 4LNKA 1VLBA 2ABDA 1FEHA 2KMMA 3ETRA 2KKCA 2JWZA 4HEA1 4ILJA 1EUVB 2AL6A 1WJUA 4KIKB 2N1WA 2ROZB 1WF9A 1C76A 4N9F4 1U5FA 2Y3AA 1OQQA 1RFKA 1TS3A 3E9SA 1RAXA 1OQRA 2KTFA 3AXCA 1FM0D 5BMHA 3H7PB 3P63A 1K51A 5IAAC 5IOIA 3SEBA 4HVBA 2GJYA 1ROEA 2JQRB 3FLVA 5AUIA 4HAVB 1JRUA 1OTRB 2DAJA 3R7QA 4CHJA 2KLCA 3AE5B 1XF5L 2GMIC 1WXQA 5J3QA 2MP2A 4N59A 2DYMA 4A6FB 3P4RB 4M00A 3F0WA 3AE2B 3J9CA 4K7WA 2C7HA 3T3OA 3NOBA 4K7SA 1W1GA 1MFWA 5IA7A 3FKYA 3SO6A 2KACA 4Q2JA 3VUYA 1WJNA 2BBCA 4KHOA 1GGOA 1U5DA 1WJMA 2ACZB 3NJTA 2GBKA 3EECA 4I6LB 3NWDA 2QDFA 1XKEA 3CXBB 2DHKA 1TZOA 1UGJA 2MFQA 2RDGA 1EF1A 1OEYA 1OGWA 4FLHA 2ASQA 3ZRFA 2FUG1 2K39A 3LXFA 4QJ5B 3UZTA 2AQ1B 4WWOA 4MSMB 1WWTA 3ZJUA 5KQ1A 4GDLA 5I2MA 4MGIE 2K2JA 2PMVA 3W2DA 1BWNA 2R2QA 2UYZB 4AS1A 2WDQB 1TY0A 1WE7A 2ELBA 3VIAA 4HJGE 1E5WA 2V76A 3PP2A 1XT9B 4LNFA 2P0FA 2KTRA 2K0PA 2MBOA 4I6NB 1X1MA 2DTCA 4JK9A 4RGNA 4BOZB 2MBBB 4BOSC 2KUPA 2K22A 4A8XC 3DHHC 5DPWA 2K25A 3SFDB 3U52E 2V9HA 1PGXA 3D8EA 1PYWD 2NBVA 2DIKA 3V6EB 1OQNA 3P4QB 2BB5A 1ZXIA 3QA8A 2G4DB 4QAYA 4PNKA 1QC6A 2MWNB 1YN4A 4HB0B 1VZ7A 3PT2B 2EC1A 2MH7A 5BYQA 1JWBD 3PZ7A 3MFGA 1DDMA 5DPTA 4YSXB 1CK1A 1ZVRA 3PRZA 2DNFA 4A6KA 2JYTA 3AEEB 1RLFA 2B3AA 1EF5A 3ZNGC 3VTWA 5E6PA 5DHAB 4IOYX 3APDA 3LB8C 4GGQA 3BZDB 1C77A 4LLGM 3A9KA 4B9KA 2C7MB 1PQSA 1EU3A 2JU6X 4JIOU 4IWQA 3MC0B 1P7EA 1S1QB 2QJLA 1V81A 1M4VA 3GYOA 3KWLA 4GIVA 3OG5A 4ZOHC 2D9YA 2LGIA 1DIKA 2J0JA 2XBBC 1TKEA 4RGMA 2Y7BA 3Q3OC 2AX5A 1TGZB 2K3UA 3UQAA 3OJ4B 2OQBA 4OVUA 1D5MC 5IKCM 4GZUA 4RNAA 4KX6B 1JCKB 1SIJA 1WRDB 4II2B 3TIXA 4KKJA 4NAWB 2J53A 1QOAA 1ZDVA 3V05A 1SGHA 4A6HA 2DYBA 3RNGC 1UNPA 3Q3MC 3TVVA 5J3YA 1LO5D 2LJ5A 1I7HA 3P4PB 1P7FA 1T0SC 2Y5BB 4NJ6A 3C8YA 4X57B 2KQ4X 1WGKA 3QWMA 3DDCB 1JWMD 2MSED 2X0SA 2CS4A 2ZKMX 4UDUC 1WRIA 2DHZA 1SXTA 4LNOA 1WI1A 2KWDA 1SE3A 2IGDA 1LW3A 1UUPA 3Q8EA 2CU1A 1ZUD2 2LXAA 3HW2B 2RDBC 3IG3A 3A98B 3I9V1 3AEBB 4RCOA 4JKGB 1UH6A 4MH0E 5BO4B 2K00A 2KJRA 1ZKHA 3TFMA 4G50A 1K8RB 1KTKA 3EA6A 2O2VA 3T06A 5JH5C 3M63B 2HE7A 2WU2B 2LJIA 3BY4B 3ZQ4A 2RR9A 5G5GA 2Y8GA 2H7DA 1VD2A 2FUHB 4JK7A 2I2YA 4YTPB 1F2RC 4R3DA 4HB2B 1SHCA 3IFWB 1F2RI 3L13A 2WX1A 3L16A 2CQUA 2KN5A 1N6ZA 4WWPA 4P1CC 2ROVA 2QEJC 3L17A 1WE6A 4WAAA 2OEDA 4F7UP 3KUCB 1E0ZA 4IW0A 2RPVA 2LHDA 5TR5A 5H8YE 2NZ8B 2FIDA 3H1UA 4US9A 3HK0A 4MELA 2H7EA 3KRXA 3I5JC 3QHTA 3W9CB 1LGRA 3B77A 2NBWB 3R7RA 3PRPB 2R61A 1HE8A 3TEZA
chains in the Genus database with same CATH topology
2KWCA 3WA0A 2MBQA 1GC6A 2DZMA 2N9XA 4FHJA 1UZXB 4KHAA 5JHGA 4I6PA 4BBNF 2D9VA 3DOWA 1V80A 2FJ9A 3EHVA 3VUXA 2KDIA 4BFRA 1X05A 2GBRA 3AJ4A 2Z0DB 1KZ7A 4JKEA 1YX6B 4GPTB 2G3QB 3PSEB 1ZW7A 4NPNA 4ANXA 2D4QA 1R4NI 5LOPB 4BVUC 5L81A 3QX1A 3RCZA 2D07B 3RCPA 1LXDA 2MBEA 1C3TA 3TJPA 4EFOA 4BKGA 3APCA 5JHAA 1E7VA 3ULCA 4DX8A 2ZNVC 2WH5A 5L95C 3PZDA 2JT4B 3ZTDA 1OMWA 2Z0OA 3GOEA 5G55A 4W9IA 4NY0A 3WALA 4BKSA 1WX7A 5HE3A 1G6JA 1NTVA 2I1KA 1MIXA 2MLBA 4BKSD 2MQJA 2LRUA 1E90A 1E8YA 3SHQA 4II3B 4MGZE 4AJYB 3OJ3A 3KZ1A 3UGBB 2YS3A 2KDEB 2WYQA 2M8SA 3ENBA 2RVBB 4JQWC 2YSZA 4WSFA 2KWVB 4EUTA 1KI1B 4HLEA 1Q0WB 4F7HA 4EKUA 3V62A 3QQ8B 2P0DA 4HXDA 1PLSA 2K2UA 4GOCA 2R2OA 4LDTD 2KANA 4NJ7A 3KRWA 4A3PA 4GU2A 2LASA 2LGDA 1ZC3B 4KZCA 4F8CB 4W9EA 3DXDA 2M1MA 3K9PB 2VKIA 5JLJB 5E6OA 1XD3B 2CHXA 1Z87A 2ZCCA 1WGUA 4GDLB 4FHKA 1FB8A 1DBHA 3GYPA 1RRPB 1JDEA 4MGKE 1U27A 3E9PA 3IVFA 2G35A 3VOQA 1LM8B 3A8PA 2V1YA 2L76A 4XC2A 4F7GA 1OQYA 1NBFC 2KVRA 1UBIA 3M95A 2P0HA 3PGEA 1Q67A 3D32A 1E8XA 1WGYA 2OJRA 3ZNZB 2I1JA 2MWSB 2N1VA 1UD7A 1W1HA 2ZNVB 4LJOB 4WVFB 1EGXA 4F7ZA 2J7QB 3PHWB 2NVUI 4GMXB 3ODXA 3V6CB 1QQGA 1DROA 1ZSQA 2ZEQA 1GJZA 2BPSA 4WJOA 3LDZE 4JK8A 3SUZA 3R3MA 4E3CA 3MTNB 4PS7A 2K8CA 2J0MA 4H8SA 3SDLC 3A8QA 4BBKA 1WXVA 3MDBC 2ZPYA 2L3ZA 3WAPA 4ILGB 2L2IA 5AZHA 3ZUNA 1FHWA 2HTHB 4WQOB 3ML9A 4WJNA 2LI5A 2D9WA 4YONA 2XK5B 3FP5A 1MIZB 2IO0B 2BYEA 4KV2A 1V61A 1WFYA 3ZRCA 5C23A 3KY9A 5D6JB 2CHZA 3VFKA 4MT7A 4E71A 1ZC4B 4IC7B 2XK5A 3ZNHB 5C16A 4NNJB 2OOBB 5JHHA 3ZNID 2Z59B 2QKMA 4KAXB 3N32A 1AWEA 4NQLB 2MKRA 2DYOA 1P1AA 2LOXA 1YJ1A 1WXSA 2DKPA 3PSCA 4KVGB 1L7YA 2NMBA 1FHXA 5C5BB 2UZRA 2M17A 2W2WA 2DX1A 4DHZB 3A9JB 1FAOA 2KFKA 3VVWB 1PMSA 3SNHA 1RJ2A 4KIKA 1IRSA 2YF0A 2IO3B 5CLQB 2IO1B 5HE1A 2D11A 1WMHA 1TXDA 3N3KB 1SIFA 5D3WA 2L1CA 4HAZB 2L7RA 4JKAA 4HCNB 2LG1A 4HAXB 3SYXA 1NTYA 3VQIA 5CHVC 2RGFA 3V60A 2JXXA 1WXMA 4XWXA 1UPQA 4M8NA 2KMAA 2CAYA 4K81A 3ULBA 1EO6A 4WWNA 4B6WA 3VHTC 4KHBB 4KSLC 4CYEA 3ECIA 2DKQA 2C60A 4WJPA 5AZGA 4TYZA 2KLGA 5CTRC 1TQZA 2GBNA 4RM8A 4HHVA 2PE6B 1UELA 2VRWB 4HWIB 3SV1A 2CB8A 1J0WA 1U4AA 3PS6A 5CHFA 1M7RA 4KZ0A 3EFUA 5J3TA 2DHJA 3UIOB 4MEMA 4IG7B 1VBGA 2KJ6A 4NQKE 5JZEB 4CHKA 2PJHA 3KUZA 2W2XD 1P5TA 2OTXA 2P8VA 2KFKB 5CHWA 5CLLB 2IY1B 3G9WA 2DLWA 4TKNA 4EZJA 2D9ZA 2CRFA 4W9KA 3A1QA 1V2YA 3VTUA 4LDTB 4DWFA 3AI5A 4HK2A 4NSWA 2KK8A 2CODA 1IYFA 4DHJB 2RNRB 4G3XB 3SBTA 3N30A 4EEWA 1WM2A 3MJWA 3TCAA 3M3JA 5DPRA 1V5MA 3P6AA 1UBQA 3IBEA 4HDQA 1Y19B 2KD0A 2BF8B 1KLVA 1P3RA 5GOWB 4MGYE 4OVVA 4LJPB 2JPHA 3PLVA 4DHJD 2R0DA 1EVHA 1V5UA 3NHEB 1YQBA 4ZDVA 3H7SA 2KGXB 2RSGA 2UZSA 4ANUA 3DBLI 1WH3A 3A9JA 4TUUA 2JVCA 2LXCA 4F1SA 4AP4C 2G4SA 2KMCA 4HCPB 2FDQA 1P6SA 2JRIB 3A4SC 3PEGA 3QARA 3PVUA 5C79A 3LJUX 4A6FA 3H9DA 2E2XA 2V4LA 1BTNA 4ZYNA 4DX90 4ICVA 2D10A 4MJSB 4AOFA 1P0RA 3L54A 3JVZX 4AUQC 4DBGA 3MHSD 2KNBA 4BBNC 2KTRB 4TQ0A 4GB9A 3APFA 1FXTB 4ZRJA 1X1FA 2MW5A 1GC7A 1UEFA 2ZZPB 2KCJA 1F9JA 5E6NA 2HTHA 4IM2A 2CR5A 2DX5B 2DYQA 3P2BA 1L2NA 2KX0A 1IP9A 2W9NA 2VSZA 2DX5A 4JL9A 2R82A 1HB8A 1YD8U 2KX3A 2Q13A 3OANA 1V5TA 1BAKA 1XR0B 1VCBA 3NZUA 5D3VA 1R4MI 3VH4B 2ELAA 1UGMA 2KO3A 3PVWA 2KFJA 2MRPA 4G0NB 4ILHA 3ZDTA 1M94A 1WZ0A 2RLOA 2MP2B 2O6VB 2M14A 5AZFA 2CY5A 1MK7B 4JKFA 1E8WA 4RMAA 3ZO5B 4PYUA 2DFKA 2LRWA 3AU5A 2AWTA 4PS8A 2GCJA 4DDID 3QJZA 2Z0QA 4L6EA 1BTKA 1V9JA 2M4NA 3TBLD 5D2MB 3B1LX 5HKHA 2KC2A 3HIZA 2PZ1A 1NI2A 4HAWB 4W9HA 2FAZA 1NTIA 2N0YA 4Y94A 3RZWC 3PREA 2IY0B 2FNJB 2YS1A 2IYDB 4B6HA 3JYUA 4W9LA 5D7GA 3OAWA 5IJMA 4FJZA 4B95A 1WMHB 2DZIA 4IUMB 4FADA 3Q3JA 1V49A 3ODOA 2C5LC 1J0GA 2YT1A 1NU2A 2JZ3B 3ZKJC 4EOYA 2LD9A 2LWPA 2N7DA 4GDKB 2WWZA 4MJSA 2O6VD 4GN1A 5DPSA 2KQ7A 2EJ8A 2O6VA 2X18A 5D3YA 2RUKB 4MK0A 3JSVB 1MKEA 2DHIA 2L0FA 4DDGD 1H8CA 1P3QU 2YVCA 2IFSA 3PRMB 5J2RA 1SE9A 2BYVE 3PV1A 2IBIB 5C1ZA 4K2OA 3TMPB 3BINA 3PPAA 3FM8C 3H6NA 5AEKB 2IZVB 3ENEA 4HJKA 1W1DA 4ICUA 5KCVA 4DK5A 1LQBA 2MBHA 4PYZA 4A5KA 2MX2A 4PQ0A 2C7NB 1U29A 3DBSA 1P98A 2COAA 4JKDA 4Z2NA 2RQ1A 1RRBA 4G11A 2Y8FA 1GUAB 1UNRA 4IWPA 1U2BA 2D9XA 2KXJA 4MY6A 1BT0A 2YLMA 3NSUA 4GSWA 4A20A 2M0XA 1FOEA 2N9EB 3VH3B 4D0NB 4DXAB 5JHBA 5D3XA 1CMXB 1K5DB 1WGGA 5DIFB 1FHOA 2BCJA 3PVLA 2KDBA 1ACAA 3M62B 3HM3A 2VRRB 2Z0EB 3FSSA 2ZVNA 2JY6A 3Q3FA 3QCAA 4ANWA 2N9PC 2L8JA 1WGDA 4JKHA 3PG7A 3EPYA 2ZPNA 5DHFB 3TW1A 1TBEA 2A5UA 1N3HA 3C0RB 2D2QA 4KSKC 4FA6A 3X0WA 3P7ZA 1WGRA 2LBBA 3RZFA 3X23A 1NVLA 3W1SC 4YL8A 2JRHA 3L10B 2ZVOA 1V86A 3RUIB 2K8BA 4ZRKA 2DYNA 2A4ZA 4W9JA 3CMMB 1WY8A 2MA9B 4M0WB 5HE2A 3A9KB 3DVGY 4MDKE 5C6RA 2KC1A 2CY4A 4JGHB 3N7CA 5DCNA 1MG8A 1I42A 2CHWA 5LXHA 1ISNA 2HRJA 3NZSA 2GBMA 1WIAA 4BKTA 2RSUA 4J6IA 5C5BA 2UVMA 2XEWA 3CSFA 2LKOA 1VBHA 5KHQA 2MCNB 4ZRIA 4W9CA 1H10A 4WJ7A 2K6DB 3JSVA 2QHOA 1I2HA 4Z2MB 1YX5B 1J19A 3SU8X 2NS5A 5J18A 3ML4A 1RFAA 2NCNA 3K9OB 3D8FA 4HAUB 3DQVA 4CHMA 3ALBA 3T9LA 1AARA 4HDOA 1ZGUB 3ZDMC 4CO7A 3KH0A 1Z2MA 3KYCD 3WANA 1WGQA 3HM6X 5D94A 1WM3A 3HHMA 2FIFA 3LJ3A 2HJ8A 1U5EA 1WR6E 3VDZA 2K6QA 4AWJA 2FCMA 3WAMA 4IM3A 4EZKA 4KDIC 4XX5A 2DZJA 1WR1A 2RPQA 3DBRI 3ML8A 1GNUA 4FN2A 2JF5A 1B55A 4JKBA 2N7EA 2O2VB 4PS3A 3DXCA 3RT3B 1I7AA 3U30A 3A33B 2PE9A 2GBJA 2N4FA 5DH9B 4DHZE 1FGZA 3V61A 3E9LA 1OY2A 3ZW3A 4HB4B 1H4RA 3RD2A 4E74A 2W2XC 1AQCA 1OEYJ 2KJHB 5LONB 3PTFC 3VAWA 3W1SA 4TV3A 3QAQA 4IWOA 2G45B 3KYDD 3UF8A 1EAZA 1WJ6A 1DDWA 3E9OA 2HD5B 1XD4A 4HAYB 3KVFB 2LOZA 4AJWA 1MAIA 1V5OA 1V5PA 4ANVA 2NPTA 2KDFB 4W9GA 1Y5OA 2ZCBA 3VTVA 3S2AA 3CSTA 1WI0A 3E66A 1WGHA 2DENB 3L08A 2K1FA 2GS0A 1WG7A 2YT0A 2YS5A 2L0TA 1Z5SB 1WX9A 1KC7A 2N23A 4K2PA 4URKA 2I5FA 2BGFA 1IPGA 1WJ4A 4FULA 2R09A 1XQQA 1I35A 2DA0A 5G2NA 4FJYA 1UNQA 3W1YA 4XZ4A 2AYOB 3PLUA 4FJVB 2GOWA 3KUDB 3QC8B 3EC8A 3JW0X 1XCGA 1XODA 2NR2A 3VUWA 3FEHA 3NS8A 3DBHI 3RULA 1X86A 2KQSA 2JUOA 2JP2A 1Q5WB 3GZNI 3UQBA 1LFDA 3AULA 5FI0A 1TZ1A 3DXEA 2LYDA 1GG3A 2GCLA 3KSYA 3SBGA 1KOTA 3WIMA 3CIKA 3ZLZA 3QWZB 1ZM0A 2FCNA 3OLMD 4M8MA 4W9DA 3DVNV 2ADZA 1MK9B 2FCQA 1M7EA 2WDTB 3QK0A 2LVOA 2QKLA 1D3ZA 3A4RA 1T0YA 2RGNB 1DYNA 1E7UA 3WYFB 4HB3B 2PPHA 3KW5B 2EMSA 4KDLB 1PFJA 4GMVA 2J0KA 5DI9B 3T8MA 1WVHA 4NAWA 1LB1A 5KHOA 4EMOA 2EMTA 2KHWB 4ASWC 1DDVA 4MSQB 5HE0A 2FCSA 2IO2B 4LCDE 4P7IA 2BWES 4WJQA 2DN6A 3D8DA 1FGYA 3ZVVA 1KM7A 3F5RA 3ZTCA 3WAOA 5GMVA 5L83A 1Q1OA 2IYBA 2REXA 4HPLB 4HPMB 2LGXA 1E8ZA 1YIWA 3I3TB 2XQNM 2KWUB 4JKGA 4JLCA 3B0AA 3QIJA 3AU4A 1HBKA 1U5GA 2COFA 2EKEC 3VXWA 1WJ1A 1UPRA 2K8HA 2BYFA 2L05A 1C1YB 5CX3A 4JKCA 2LGYA 2LVQA 1WZ3A 4TQ1A 1P9DU 5EFXA 3ODWA 3UIPB 2DZKA 1KBLA 2RD0A 4C0AA 4DBBA 3MPXA 2Z0PA 5LXIB 2D3GA 1V89A 1X11A 4IM0A 2COCA 1ST7A 3QBVB 4GDKA 2L00B 4A3OA 3H7PA 3HQCA 3SD5A 2UWQA 2CKHB 2JZZA 2COPA 2KZRA 3A1QB 4K1RB 3DVNU 4HATB 4RM9A 5JP4A 3R66C 3ONSA 2C9WB 4IAPA 3DPDA 2BWFA 1TJ6A 2LZ6A 2V3SA 3V5WA 5FI1A 2J59M 2MDXA 3M1IB 3CF6E 1KJTA 3NY5A 3DCGA 4MM3A 3O65B 2ZJDA 3TO1A 2LULA 1K5GB 2AL3A 3U8ZA 1WX8A 3DVGX 1HB6A 1S3SG 2BKFA 1Y8RC 5KQ4A 3B08A 4W9FA 3RYTA 2NBVB 4EZLA 2KOXA 3ZIMA 5EDSA 2PEAA 2YRYA 1X1GA 4GXBA 2NBUA 4FBJB 2LUEA 3L0WB 4K7UA 1J8CA 2LVPA 3PHXB 1KZGA 2BKRB 1MPHA 2I5CA 3ZVRA 1TTNA 3UINB 3BJIA 3IHPC 2DAFA 4EJNA 1WYWB 3U7DA 3TL5A 5D27A 5FR6A 4IFSA 3O96A 1V6EA 2M38A 2AEHA 2NPTB 1A5RA 1XX0A 2FJLA 1NDDA 1V88A 5LLIA 5J17A 5JVLA 4K17A 2WX0A 1WXAA 1QZEA 2ABDA 2KKCA 2JWZA 4ILJA 1EUVB 2AL6A 1WJUA 4KIKB 2N1WA 2ROZB 1WF9A 4N9F4 1U5FA 1RAXA 2KTFA 3AXCA 3H7PB 5IAAC 4HVBA 2GJYA 3FLVA 4HAVB 1JRUA 1OTRB 2DAJA 3R7QA 4CHJA 2KLCA 2GMIC 5J3QA 2MP2A 2DYMA 4A6FB 3F0WA 4K7WA 2C7HA 3NOBA 4K7SA 1W1GA 5IA7A 3SO6A 3VUYA 1WJNA 4KHOA 1GGOA 1U5DA 1WJMA 2GBKA 3EECA 4I6LB 1XKEA 3CXBB 2DHKA 2MFQA 1EF1A 1OEYA 1OGWA 4FLHA 2ASQA 3ZRFA 2K39A 3UZTA 4WWOA 4MSMB 5KQ1A 4GDLA 4MGIE 2K2JA 1BWNA 2R2QA 2UYZB 1WE7A 2ELBA 3VIAA 1E5WA 2V76A 3PP2A 1XT9B 2P0FA 2KTRA 2MBOA 4I6NB 1X1MA 2DTCA 4JK9A 4BOZB 2MBBB 4BOSC 2KUPA 5DPWA 2K25A 3D8EA 2DIKA 3V6EB 1OQNA 3QA8A 2G4DB 4PNKA 1QC6A 2MWNB 4HB0B 3PT2B 2EC1A 1DDMA 5DPTA 1ZVRA 3PRZA 4A6KA 1RLFA 2B3AA 1EF5A 3ZNGC 3VTWA 5E6PA 5DHAB 4IOYX 3APDA 4GGQA 3A9KA 4B9KA 2C7MB 1PQSA 4JIOU 4IWQA 1S1QB 1V81A 3GYOA 4GIVA 2D9YA 1DIKA 2J0JA 2XBBC 2Y7BA 1TGZB 3UQAA 3OJ4B 2OQBA 4OVUA 4GZUA 1WRDB 4II2B 3TIXA 4NAWB 1SGHA 4A6HA 2DYBA 1UNPA 3TVVA 5J3YA 2LJ5A 2Y5BB 4NJ6A 4X57B 3QWMA 3DDCB 2MSED 2X0SA 2CS4A 2DHZA 1WI1A 1LW3A 2CU1A 2LXAA 3HW2B 3IG3A 3A98B 4JKGB 1UH6A 4MH0E 5BO4B 2K00A 2KJRA 1ZKHA 3TFMA 4G50A 1K8RB 2O2VA 3T06A 5JH5C 3M63B 2HE7A 3BY4B 2RR9A 2Y8GA 2H7DA 1VD2A 2FUHB 4JK7A 4HB2B 1SHCA 3IFWB 3L13A 2WX1A 3L16A 2CQUA 2KN5A 4WWPA 2ROVA 3L17A 1WE6A 4WAAA 4F7UP 3KUCB 4IW0A 5TR5A 2NZ8B 2FIDA 3H1UA 3HK0A 4MELA 2H7EA 3KRXA 3QHTA 2NBWB 3R7RA 3PRPB 1HE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST7 A;  3QBV B;  2CY4 A;  4NQK E;  2KWC A;  4JGH B;  3WA0 A;  4GDK A;  5JZE B;  4CHK A;  3N7C A;  2PJH A;  3KUZ A;  2W2X D;  5DCN A;  1P5T A;  1GC6 A;  2DZM A;  2L00 B;  1MG8 A;  2OTX A;  2MBQ A;  2N9X A;  2P8V A;  1UZX B;  2CHW A;  4FHJ A;  5LXH A;  1I42 A;  4KHA A;  1ISN A;  5JHG A;  2HRJ A;  5CLL B;  2IY1 B;  2KFK B;  3HQC A;  3H7P A;  3G9W A;  3NZS A;  2DLW A;  2GBM A;  4I6P A;  2D9V A;  4TKN A;  1WIA A;  3SD5 A;  2UWQ A;  3DOW A;  4BBN F;  4BKT A;  2CKH B;  2D9Z A;  2JZZ A;  2RSU A;  4EZJ A;  1V80 A;  2COP A;  4J6I A;  2CRF A;  2FJ9 A;  2UVM A;  5C5B A;  2KZR A;  2XEW A;  3A1Q B;  3DVN U;  3A1Q A;  3EHV A;  4HAT B;  4K1R B;  1V2Y A;  3VUX A;  2KDI A;  3VTU A;  3CSF A;  2LKO A;  4BFR A;  4LDT B;  5JP4 A;  4RM9 A;  3R66 C;  4DWF A;  1X05 A;  3ONS A;  3AI5 A;  2C9W B;  4HK2 A;  4NSW A;  4IAP A;  2GBR A;  3DPD A;  2BWF A;  1TJ6 A;  2LZ6 A;  2V3S A;  3AJ4 A;  2Z0D B;  1KZ7 A;  3V5W A;  2KK8 A;  2COD A;  4HLE A;  5FI1 A;  1YX6 B;  5KHQ A;  4GPT B;  2G3Q B;  2MCN B;  4A3O A;  1IYF A;  4ZRI A;  2J59 M;  2RNR B;  4G3X B;  4W9C A;  4DHJ B;  3PSE B;  1ZW7 A;  1H10 A;  4WJ7 A;  2D4Q A;  2K6D B;  1R4N I;  3JSV A;  2MDX A;  2QHO A;  1I2H A;  4Z2M B;  1YX5 B;  1J19 A;  3N30 A;  5LOP B;  4BVU C;  5L81 A;  3SU8 X;  4EEW A;  3M1I B;  1WM2 A;  2NS5 A;  3QX1 A;  3RCZ A;  3CF6 E;  1KJT A;  3NY5 A;  2D07 B;  3RCP A;  3ML4 A;  1LXD A;  1RFA A;  2MBE A;  2NCN A;  3DCG A;  3TCA A;  3MJW A;  2ZJD A;  3O65 B;  1C3T A;  3K9O B;  3TO1 A;  2LUL A;  1K5G B;  3M3J A;  3D8F A;  5DPR A;  3TJP A;  4HAU B;  3DQV A;  4EFO A;  4CHM A;  3ALB A;  2AL3 A;  3T9L A;  1V5M A;  3P6A A;  4HDO A;  1AAR A;  3U8Z A;  1UBQ A;  1WX8 A;  1ZGU B;  3APC A;  3ZDM C;  4BKG A;  3IBE A;  4CO7 A;  4HDQ A;  3KH0 A;  1Y19 B;  3DVG X;  5JHA A;  1HB6 A;  1E7V A;  1Z2M A;  3ULC A;  4DX8 A;  2BF8 B;  2KD0 A;  2ZNV C;  3KYC D;  3WAN A;  1KLV A;  1WGQ A;  3HM6 X;  1P3R A;  5GOW B;  4MGY E;  1S3S G;  2BKF A;  1Y8R C;  2WH5 A;  4OVV A;  5KQ4 A;  5L95 C;  4LJP B;  3PZD A;  2JT4 B;  3B08 A;  2JPH A;  4W9F A;  3RYT A;  2NBV B;  4EZL A;  5D94 A;  3VVW B;  1WM3 A;  3ZTD A;  3HHM A;  3PLV A;  1OMW A;  2FIF A;  4DHJ D;  2Z0O A;  2R0D A;  3GOE A;  1EVH A;  3LJ3 A;  2KOX A;  5G55 A;  3ZIM A;  5EDS A;  2PEA A;  1V5U A;  2HJ8 A;  1U5E A;  2YRY A;  1WR6 E;  4W9I A;  4NY0 A;  3VDZ A;  2K6Q A;  3NHE B;  1YQB A;  1X1G A;  4GXB A;  3WAL A;  2NBU A;  4AWJ A;  4BKS A;  1WX7 A;  5HE3 A;  4FBJ B;  1G6J A;  1NTV A;  2FCM A;  2I1K A;  2LUE A;  1MIX A;  3H7S A;  4IM3 A;  3WAM A;  2KGX B;  2RSG A;  4KDI C;  3L0W B;  4K7U A;  2UZS A;  2MLB A;  4XX5 A;  4ANU A;  3DBL I;  1WH3 A;  3A9J A;  2DZJ A;  4TUU A;  1WR1 A;  4BKS D;  2RPQ A;  3DBR I;  2LVP A;  3ML8 A;  3PHX B;  1J8C A;  1KZG A;  2BKR B;  2MQJ A;  1GNU A;  2LRU A;  1E90 A;  1E8Y A;  2JVC A;  3SHQ A;  2LXC A;  4F1S A;  4FN2 A;  4AP4 C;  2JF5 A;  1MPH A;  2I5C A;  3ZVR A;  1TTN A;  2G4S A;  2KMC A;  4II3 B;  3UIN B;  4HCP B;  3BJI A;  4MGZ E;  2FDQ A;  1B55 A;  4EJN A;  2DAF A;  3IHP C;  4AJY B;  3OJ3 A;  3KZ1 A;  3UGB B;  2YS3 A;  2KDE B;  2WYQ A;  1HE8 A;  1P6S A;  2M8S A;  1WYW B;  2N7E A;  3U7D A;  2O2V B;  2RVB B;  4JQW C;  4PS3 A;  3TL5 A;  5D27 A;  5FR6 A;  4IFS A;  3DXC A;  3O96 A;  2YSZ A;  1V6E A;  4WSF A;  2JRI B;  2M38 A;  2KWV B;  2AEH A;  2NPT B;  3A4S C;  1A5R A;  3RT3 B;  3PEG A;  4NPN A;  1KI1 B;  1I7A A;  3QAR A;  4EUT A;  3U30 A;  1Q0W B;  1XX0 A;  3PVU A;  5C79 A;  3A33 B;  4F7H A;  2PE9 A;  3ZLZ A;  2FJL A;  3LJU X;  1NDD A;  2GBJ A;  2N4F A;  4EKU A;  5DH9 B;  4A6F A;  3V62 A;  3H9D A;  1V88 A;  2E2X A;  2P0D A;  1BTN A;  2V4L A;  3QQ8 B;  4HXD A;  4ZYN A;  5LLI A;  1PLS A;  4DX9 0;  4DHZ E;  2K2U A;  4GOC A;  5J17 A;  4K17 A;  2R2O A;  2WX0 A;  4LDT D;  2KAN A;  4ICV A;  1FGZ A;  1WXA A;  1QZE A;  3V61 A;  2D10 A;  2ABD A;  1OY2 A;  4NJ7 A;  3ZW3 A;  2KKC A;  4MJS B;  2JWZ A;  4AOF A;  3KRW A;  1P0R A;  4HB4 B;  4A3P A;  3L54 A;  1EUV B;  2AL6 A;  1H4R A;  1WJU A;  3JVZ X;  4GU2 A;  4AUQ C;  4DBG A;  2LAS A;  3MHS D;  2LGD A;  1ZC3 B;  3RD2 A;  2KNB A;  4BBN C;  2KTR B;  4KZC A;  4F8C B;  4KIK B;  4W9E A;  4TQ0 A;  2N1W A;  4GB9 A;  3DXD A;  2ROZ B;  3APF A;  1FXT B;  2M1M A;  1WF9 A;  2VKI A;  5JLJ B;  3K9P B;  5E6O A;  4E74 A;  4ZRJ A;  4N9F 4;  1U5F A;  2W2X C;  1XD3 B;  1X1F A;  1AQC A;  2CHX A;  2MW5 A;  1GC7 A;  1UEF A;  2ZZP B;  1Z87 A;  2ZCC A;  1WGU A;  2KCJ A;  1RAX A;  1OEY J;  4GDL B;  1F9J A;  2KJH B;  2KTF A;  3AXC A;  4FHK A;  5E6N A;  5LON B;  2HTH A;  3H7P B;  4IM2 A;  3PTF C;  3VAW A;  3W1S A;  4TV3 A;  2CR5 A;  1FB8 A;  1DBH A;  2DX5 B;  3GYP A;  3QAQ A;  4IWO A;  2G45 B;  2DYQ A;  5IAA C;  1RRP B;  3P2B A;  2GJY A;  3KYD D;  4HVB A;  3UF8 A;  4MGK E;  1L2N A;  3FLV A;  1U27 A;  4HAV B;  2KX0 A;  1IP9 A;  1JRU A;  3IVF A;  2W9N A;  1OTR B;  1EAZ A;  2G35 A;  2VSZ A;  1DDW A;  3VOQ A;  4CHJ A;  1LM8 B;  1WJ6 A;  2DAJ A;  2HD5 B;  2KLC A;  2DX5 A;  3A8P A;  4JL9 A;  4ZDV A;  1XD4 A;  1HB8 A;  4HAY B;  2GMI C;  2V1Y A;  3KVF B;  1YD8 U;  2KX3 A;  5J3Q A;  2L76 A;  2Q13 A;  2MP2 A;  4XC2 A;  4F7G A;  1OQY A;  1NBF C;  2KVR A;  2DYM A;  4A6F B;  2LOZ A;  3F0W A;  4AJW A;  3OAN A;  1V5T A;  1MAI A;  4K7W A;  1UBI A;  1BAK A;  1XR0 B;  1VCB A;  1V5O A;  3M95 A;  3NZU A;  2C7H A;  5D3V A;  1V5P A;  2P0H A;  3NOB A;  3PGE A;  4ANV A;  2NPT A;  1Q67 A;  1R4M I;  3D32 A;  4K7S A;  3VH4 B;  2ELA A;  1W1G A;  2KDF B;  1E8X A;  5IA7 A;  1UGM A;  3SO6 A;  2KO3 A;  1WGY A;  2OJR A;  3VUY A;  3ZNZ B;  3PVW A;  1WJN A;  4W9G A;  4KHO A;  2I1J A;  2KFJ A;  1U5D A;  1Y5O A;  2MWS B;  1WJM A;  2ZCB A;  2MRP A;  4G0N B;  3VTV A;  2GBK A;  3EEC A;  4I6L B;  2N1V A;  3ZDT A;  3S2A A;  3CST A;  1XKE A;  3CXB B;  2DHK A;  1UD7 A;  1WI0 A;  1M94 A;  1W1H A;  1WGH A;  1WZ0 A;  2RLO A;  4WVF B;  2MFQ A;  1EGX A;  2DEN B;  2ZNV B;  3L08 A;  2J7Q B;  2MP2 B;  2O6V B;  2K1F A;  1EF1 A;  2GS0 A;  2M14 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  5AZF A;  2CY5 A;  3ZRF A;  1MK7 B;  1E8W A;  4RMA A;  3PHW B;  1WG7 A;  2NVU I;  2K39 A;  2YT0 A;  2YS5 A;  2L0T A;  3ZO5 B;  4PYU A;  1Z5S B;  2DFK A;  4GMX B;  2N23 A;  3ODX A;  3AU5 A;  4K2P A;  1WX9 A;  2LRW A;  3V6C B;  3UZT A;  1QQG A;  2AWT A;  1DRO A;  4PS8 A;  4URK A;  2GCJ A;  4WWO A;  4MSM B;  2I5F A;  4DDI D;  1ZSQ A;  2BGF A;  1IPG A;  4LJO B;  3QJZ A;  1WJ4 A;  4FUL A;  2Z0Q A;  2R09 A;  1BTK A;  4L6E A;  1V9J A;  2ZEQ A;  1XQQ A;  2BPS A;  2M4N A;  3TBL D;  4WJO A;  1GJZ A;  3LDZ E;  5D2M B;  1I35 A;  3SUZ A;  2DA0 A;  5KQ1 A;  3B1L X;  3R3M A;  4GDL A;  4E3C A;  5HKH A;  2KC2 A;  3HIZ A;  5G2N A;  3MTN B;  4MGI E;  4FJY A;  2K2J A;  2PZ1 A;  1NI2 A;  4HAW B;  4PS7 A;  1UNQ A;  3W1Y A;  2K8C A;  1BWN A;  2R2Q A;  2UYZ B;  4W9H A;  2J0M A;  2FAZ A;  1WE7 A;  4H8S A;  3SDL C;  4XZ4 A;  1NTI A;  2ELB A;  2N0Y A;  3A8Q A;  3VIA A;  4BBK A;  1WXV A;  3MDB C;  1E5W A;  4Y94 A;  2ZPY A;  2AYO B;  3PLU A;  2GOW A;  2L3Z A;  2V76 A;  3PP2 A;  1XT9 B;  3KUD B;  4FJV B;  3RZW C;  2P0F A;  3WAP A;  3PRE A;  2IY0 B;  2KTR A;  2FNJ B;  2MBO A;  2L2I A;  2YS1 A;  3EC8 A;  3JW0 X;  1XCG A;  1XOD A;  1X1M A;  2IYD B;  2DTC A;  4B6H A;  2NR2 A;  4I6N B;  3VUW A;  3FEH A;  3NS8 A;  4BOZ B;  3DBH I;  3JYU A;  4W9L A;  2MBB B;  4BOS C;  5AZH A;  5D7G A;  3OAW A;  2KUP A;  3RUL A;  5IJM A;  3ZUN A;  4FJZ A;  1FHW A;  2HTH B;  5DPW A;  4WQO B;  1X86 A;  3ML9 A;  2LI5 A;  4WJN A;  2D9W A;  2K25 A;  4YON A;  4B95 A;  2XK5 B;  3D8E A;  1WMH B;  3FP5 A;  1MIZ B;  2IO0 B;  2KQS A;  2DZI A;  2BYE A;  2JUO A;  2JP2 A;  4IUM B;  4KV2 A;  4FAD A;  1V61 A;  1WFY A;  3ZRC A;  3Q3J A;  3V6E B;  1Q5W B;  3GZN I;  1OQN A;  5C23 A;  3KY9 A;  1V49 A;  3ODO A;  5D6J B;  3QA8 A;  2C5L C;  2G4D B;  3UQB A;  1J0G A;  1LFD A;  2CHZ A;  2YT1 A;  4PNK A;  1NU2 A;  4ANX A;  1QC6 A;  2JZ3 B;  2MWN B;  3AUL A;  3ZKJ C;  4HB0 B;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  3VFK A;  4MT7 A;  2WWZ A;  4E71 A;  1ZC4 B;  4MJS A;  5FI0 A;  2O6V D;  3PT2 B;  4IC7 B;  2EC1 A;  4GN1 A;  1TZ1 A;  3DXE A;  2LYD A;  2XK5 A;  3ZNH B;  1GG3 A;  5C16 A;  2GCL A;  3QC8 B;  5DPS A;  1DDM A;  2KQ7 A;  2EJ8 A;  4NNJ B;  2O6V A;  2OOB B;  5DPT A;  5JHH A;  2X18 A;  2Z59 B;  2QKM A;  1ZVR A;  4KAX B;  5D3Y A;  3ZNI D;  3KSY A;  2RUK B;  3PRZ A;  3N32 A;  4MK0 A;  3JSV B;  4A6K A;  1KOT A;  3WIM A;  3CIK A;  1RLF A;  2B3A A;  1EF5 A;  4EZK A;  3QWZ B;  1MKE A;  3VTW A;  1ZM0 A;  2DHI A;  2FCN A;  2L0F A;  5E6P A;  5DHA B;  1AWE A;  3ZNG C;  4DDG D;  4IOY X;  1P3Q U;  1H8C A;  3OLM D;  4M8M A;  2YVC A;  2IFS A;  3APD A;  3PRM B;  4NQL B;  5J2R A;  2MKR A;  4W9D A;  2DYO A;  1SE9 A;  4GGQ A;  3DVN V;  1P1A A;  2BYV E;  2LOX A;  1YJ1 A;  3PV1 A;  2ADZ A;  2IBI B;  5C1Z A;  1MK9 B;  1WXS A;  2DKP A;  4K2O A;  3A9K A;  3TMP B;  4MM3 A;  4W9K A;  4B9K A;  2C7M B;  2FCQ A;  3BIN A;  1M7E A;  1PQS A;  3PPA A;  3FM8 C;  2WDT B;  3PSC A;  3H6N A;  3QK0 A;  4JIO U;  2LVO A;  2IZV B;  5AEK B;  4IWQ A;  3ENE A;  2QKL A;  4KVG B;  1L7Y A;  1D3Z A;  4HJK A;  2NMB A;  1W1D A;  1S1Q B;  1FHX A;  4ICU A;  5C5B B;  5KCV A;  3A4R A;  1V81 A;  4DK5 A;  1LQB A;  1T0Y A;  2UZR A;  2MBH A;  2RGN B;  4PYZ A;  1DYN A;  4A5K A;  1E7U A;  2M17 A;  2W2W A;  2MX2 A;  3GYO A;  3WYF B;  4GIV A;  4PQ0 A;  4HB3 B;  2DX1 A;  1U29 A;  2C7N B;  4DHZ B;  3A9J B;  2D9Y A;  2PPH A;  3DBS A;  1FAO A;  2KFK A;  3KW5 B;  2J0J A;  1PMS A;  1P98 A;  2XBB C;  3SNH A;  1RJ2 A;  5CHW A;  4KIK A;  1IRS A;  2Y7B A;  2YF0 A;  2EMS A;  4KDL B;  1PFJ A;  4GMV A;  2IO3 B;  2COA A;  2J0K A;  5CLQ B;  5DI9 B;  1TGZ B;  3UQA A;  4Z2N A;  3OJ4 B;  2OQB A;  5HE1 A;  2IO1 B;  2RQ1 A;  4OVU A;  3T8M A;  1RRB A;  4G11 A;  1WVH A;  4GZU A;  2Y8F A;  4NAW A;  1LB1 A;  2D11 A;  5KHO A;  1GUA B;  1WMH A;  1TXD A;  4EMO A;  1UNR A;  3N3K B;  1U2B A;  1SIF A;  2EMT A;  2D9X A;  1WRD B;  4II2 B;  4IWP A;  3TIX A;  2KHW B;  4ASW C;  1DDV A;  5D3W A;  2KXJ A;  4NAW B;  4MY6 A;  1SGH A;  4A6H A;  2DYB A;  1UNP A;  1BT0 A;  3TVV A;  4MSQ B;  2YLM A;  3NSU A;  4GSW A;  4A20 A;  2M0X A;  5J18 A;  1FOE A;  5J3Y A;  5HE0 A;  2FCS A;  2IO2 B;  2N9E B;  2LJ5 A;  2L1C A;  4LCD E;  4HAZ B;  4P7I A;  3VH3 B;  2L7R A;  4HCN B;  2LG1 A;  4HAX B;  2BWE S;  4WJQ A;  3SYX A;  4D0N B;  2DN6 A;  2Y5B B;  4NJ6 A;  1NTY A;  4DXA B;  3D8D A;  4X57 B;  5D3X A;  1FGY A;  1CMX B;  5JHB A;  3ZVV A;  3VQI A;  1KM7 A;  3F5R A;  1K5D B;  3QWM A;  2RGF A;  2MSE D;  3DDC B;  5CHV C;  3V60 A;  3WAO A;  3ZTC A;  1WGG A;  2JXX A;  5GMV A;  5L83 A;  1Q1O A;  2CS4 A;  5DIF B;  2IYB A;  1FHO A;  2DHZ A;  2REX A;  2BCJ A;  4HPL B;  4HPM B;  1WXM A;  2LGX A;  4XWX A;  1UPQ A;  4M8N A;  3PVL A;  1WI1 A;  1E8Z A;  1YIW A;  2KDB A;  1ACA A;  2CAY A;  2KMA A;  3I3T B;  3M62 B;  3HM3 A;  2XQN M;  2KWU B;  2VRR B;  2Z0E B;  4K81 A;  3ULB A;  1LW3 A;  3FSS A;  1EO6 A;  2JY6 A;  2ZVN A;  4WWN A;  4B6W A;  3Q3F A;  3QCA A;  2CU1 A;  4ANW A;  2LXA A;  2N9P C;  3VHT C;  3HW2 B;  2L8J A;  3IG3 A;  4JLC A;  1WGD A;  4EOY A;  3A98 B;  4KHB B;  4KSL C;  3PG7 A;  4CYE A;  1UH6 A;  4MH0 E;  5BO4 B;  2K00 A;  3EPY A;  2KJR A;  2ZPN A;  3B0A A;  5DHF B;  3ECI A;  3QIJ A;  2DKQ A;  3TW1 A;  1TBE A;  3TFM A;  1ZKH A;  1K8R B;  2C60 A;  2A5U A;  3AU4 A;  4G50 A;  1HBK A;  1U5G A;  4WJP A;  2O2V A;  5AZG A;  3T06 A;  1N3H A;  2COF A;  4TYZ A;  2KLG A;  4F7Z A;  2EKE C;  3M63 B;  2HE7 A;  3VXW A;  5JH5 C;  3C0R B;  5CTR C;  2D2Q A;  1TQZ A;  1WJ1 A;  3BY4 B;  1UPR A;  4KSK C;  3R7Q A;  3X0W A;  4FA6 A;  3P7Z A;  2RR9 A;  2GBN A;  1WGR A;  2LBB A;  2Y8G A;  2H7D A;  1VD2 A;  3RZF A;  2K8H A;  3X23 A;  4RM8 A;  1NVL A;  2FUH B;  2BYF A;  2L05 A;  4HHV A;  3W1S C;  1C1Y B;  2PE6 B;  5CX3 A;  4YL8 A;  1UEL A;  4HB2 B;  1SHC A;  2VRW B;  2JRH A;  3IFW B;  3L13 A;  2WX1 A;  3L10 B;  2LGY A;  3L16 A;  2ZVO A;  2CQU A;  4HWI B;  1V86 A;  2KN5 A;  2LVQ A;  3SV1 A;  3RUI B;  1WZ3 A;  2K8B A;  4WWP A;  2ROV A;  4TQ1 A;  4ZRK A;  2CB8 A;  2DYN A;  2A4Z A;  3L17 A;  1P9D U;  5EFX A;  1J0W A;  1WE6 A;  3ODW A;  4W9J A;  2DZK A;  4WAA A;  3UIP B;  4F7U P;  1U4A A;  3KUC B;  3PS6 A;  2RD0 A;  5CHF A;  1M7R A;  4IW0 A;  4KZ0 A;  3EFU A;  5J3T A;  2DHJ A;  4C0A A;  4DBB A;  1WY8 A;  2MA9 B;  3CMM B;  4M0W B;  5TR5 A;  3MPX A;  5HE2 A;  3UIO B;  2Z0P A;  2NZ8 B;  2FID A;  3H1U A;  3A9K B;  5LXI B;  3HK0 A;  2D3G A;  1V89 A;  3DVG Y;  1X11 A;  2H7E A;  3KRX A;  3QHT A;  4IM0 A;  2COC A;  4MEL A;  4MDK E;  4MEM A;  2NBW B;  4IG7 B;  3R7R A;  3PRP B;  5C6R A;  2KJ6 A;  2KC1 A; 
#chains in the Genus database with same CATH topology
 1JQ4 A;  2KWC A;  3WA0 A;  1J7C A;  2MBQ A;  1GC6 A;  2DZM A;  1KFY B;  2N9X A;  4FHJ A;  3TUO A;  1UZX B;  4KHA A;  5JHG A;  4I6P A;  4BBN F;  2H88 B;  2D9V A;  3DOW A;  1YN3 A;  3R8B A;  1V80 A;  2GB1 A;  1KH0 A;  2FJ9 A;  3EHV A;  2J4X A;  2PVG C;  3VUX A;  2KDI A;  4BFR A;  1X05 A;  3DBL B;  2WXM A;  4RGO S;  2GBR A;  2KDM A;  3AJ4 A;  1JWS D;  1KZ7 A;  2Z0D B;  4JKE A;  2H89 B;  1YX6 B;  4GPT B;  2G3Q B;  3OWE B;  3PSE B;  1ZW7 A;  4NPN A;  4ANX A;  2D4Q A;  1R4N I;  2MEK A;  4ZHP A;  4C7Z A;  5LOP B;  4BVU C;  5L81 A;  3QX1 A;  3RCZ A;  5LG4 B;  1FMA D;  2D07 B;  3RCP A;  1LXD A;  2KT7 A;  2MBE A;  3WCQ A;  1C3T A;  4C80 A;  2W3R A;  3IAS 1;  1D4B A;  3TJP A;  4EFO A;  2HDE A;  2WXP A;  4BKG A;  3APC A;  5JHA A;  1E7V A;  3ULC A;  4DX8 A;  2ZNV C;  3PO0 A;  2WH5 A;  4CSQ A;  5L95 C;  1Q10 A;  3PZD A;  2JT4 B;  3ZTD A;  1EU4 A;  1OMW A;  4KGS A;  2Z0O A;  2IPK D;  3GOE A;  3Q14 C;  5G55 A;  4W9I A;  4NY0 A;  4HRS A;  3AE1 B;  3WAL A;  4BKS A;  1WX7 A;  5HE3 A;  1G6J A;  1NTV A;  2I1K A;  1MIX A;  2MLB A;  4BKS D;  4WQM A;  2MQJ A;  2LRU A;  1E90 A;  1E8Y A;  1V1P B;  4WH4 A;  3SHQ A;  4II3 B;  3VRB B;  4MGZ E;  3RNC C;  4AJY B;  3OJ3 A;  3KZ1 A;  3UGB B;  2YS3 A;  2KDE B;  2WYQ A;  2M8S A;  3IAM 1;  3ENB A;  2RVB B;  3AED B;  4JQW C;  2YSZ A;  4WSF A;  2KWV B;  1ENF A;  4EUT A;  1KI1 B;  4HLE A;  1Q0W B;  4F7H A;  1L6V A;  2WXQ A;  3BK1 A;  4EKU A;  3HUI A;  3V62 A;  2WP9 B;  3QQ8 B;  2P0D A;  1TS2 A;  4HXD A;  1PLS A;  1F77 A;  2K2U A;  1CZP A;  3GS2 A;  4GOC A;  2R2O A;  4LDT D;  2KAN A;  1N62 A;  4NJ7 A;  1IBX B;  3KRW A;  4A3P A;  4GU2 A;  4C7Y A;  2LAS A;  2LGD A;  1ZC3 B;  1ZE3 D;  4KZC A;  4F8C B;  4W9E A;  3DXD A;  3N20 C;  2M1M A;  3K9P B;  2VKI A;  5JLJ B;  1C4C A;  4PT5 A;  5E6O A;  5C2T B;  1XD3 B;  2CHX A;  4NZL B;  1Z87 A;  2ZCC A;  1WGU A;  2IGH A;  4GDL B;  4FHK A;  4AQ7 A;  3VR9 B;  3EFC A;  1FB8 A;  1DBH A;  3GYP A;  1RRP B;  1L0Y B;  1JDE A;  4MGK E;  1U27 A;  3E9P A;  3IVF A;  2WNM A;  2G35 A;  3VOQ A;  1LM8 B;  2BB6 A;  3A8P A;  4OZC A;  1FCL A;  5IN7 A;  1SF0 A;  2V1Y A;  5HFY A;  2L76 A;  4XC2 A;  2N0S B;  4F7G A;  1OQY A;  1NBF C;  4DQO C;  3AN1 A;  2KVR A;  4HSI A;  5M4Y B;  2GI9 A;  4OVZ A;  1UBI A;  3M95 A;  1TS4 A;  2P0H A;  3PGE A;  2G9H D;  1Q67 A;  3D32 A;  1KLG D;  2RMM A;  1E8X A;  1WGY A;  2OJR A;  4IDI A;  4P16 A;  3ZNZ B;  2HTM E;  1I4H A;  1YJJ A;  3TEX A;  2I1J A;  2MWS B;  2KR0 A;  2N1V A;  1UD7 A;  1W1H A;  2ZNV B;  3BWU D;  4LJO B;  4WVF B;  1EGX A;  4F7Z A;  3P42 A;  2J7Q B;  3PHW B;  2NVU I;  1AWD A;  2QSD A;  4GMX B;  3ODX A;  2D5G A;  3V6C B;  3DHI C;  1QQG A;  1DRO A;  1ZSQ A;  2NTT A;  2ZEQ A;  1GJZ A;  2BPS A;  4WJO A;  3LDZ E;  4JK8 A;  3SUZ A;  3R3M A;  4E3C A;  4MAC A;  3MTN B;  4PS7 A;  5I2S A;  1VDV A;  2K8C A;  2J0M A;  4HKZ E;  1QOB A;  4H8S A;  3SDL C;  4YWG G;  3U2S C;  3A8Q A;  4BBK A;  1WXV A;  3FIL B;  3MDB C;  1ZOY B;  2ZPY A;  3R2I A;  2L3Z A;  3WAP A;  4ILG B;  1MHX A;  2L2I A;  4KHB A;  4OW0 A;  1I4Q A;  5AZH A;  3AB5 A;  4NAM A;  3ZUN A;  2PVO D;  1FHW A;  2HTH B;  4WQO B;  3ML9 A;  4WJN A;  2LI5 A;  2D9W A;  4YON A;  3AE6 B;  1TT5 B;  2XK5 B;  1YJI A;  3FP5 A;  1BXT A;  1MIZ B;  4YSZ B;  2MJ3 A;  2IO0 B;  2BYE A;  4KV2 A;  1V61 A;  1WFY A;  3ZRC A;  2WXH A;  5HG2 A;  5C23 A;  3KY9 A;  5D6J B;  1DYQ A;  2YT2 A;  2CHZ A;  5JXV A;  3ZGZ A;  3VFK A;  4MT7 A;  4E71 A;  1ZC4 B;  4IC7 B;  1N5W A;  2XK5 A;  3ZNH B;  2AQ2 B;  5C16 A;  4NNJ B;  2OOB B;  4HPP A;  4WWM A;  5JHH A;  3ZNI D;  2Z59 B;  2QKM A;  4KAX B;  2CU3 A;  2WXR A;  3N32 A;  3TSS A;  3B9J A;  1AWE A;  5MPO A;  4NQL B;  2MKR A;  2DYO A;  1SBB B;  3U12 A;  1P1A A;  2LOX A;  1YJ1 A;  4N58 A;  1WXS A;  2DKP A;  1F1H A;  4L1R A;  3PSC A;  2VH1 A;  4TMA B;  2L32 A;  4KVG B;  2FE8 A;  1L7Y A;  2NMB A;  1FHX A;  5C5B B;  2UZR A;  3T3N A;  2M17 A;  2W2W A;  1GPX A;  2DX1 A;  4DHZ B;  3A9J B;  1T3Q A;  1KRH A;  1FAO A;  2KFK A;  3VVW B;  1PMS A;  3SNH A;  1RJ2 A;  2Y5C A;  4KIK A;  1IRS A;  2YF0 A;  4N6E B;  1XLN A;  2IO3 B;  5CLQ B;  2IO1 B;  5HE1 A;  4L2Y A;  2D11 A;  1WMH A;  1TXD A;  5EE1 A;  3URY A;  3N3K B;  3AE8 B;  1SIF A;  3NZ3 A;  4QJ4 B;  4P6V F;  2PLP A;  5D3W A;  1ACC A;  3IT6 B;  4M0W A;  2KAJ A;  2ZW1 A;  3RFZ B;  2L1C A;  4HAZ B;  5BYR A;  2L7R A;  4JKA A;  4HCN B;  2LG1 A;  4HAX B;  3SYX A;  4YTN B;  1D6E C;  1NTY A;  3VQI A;  3NWA A;  2WDR B;  5CHV C;  2RGF A;  3Q8F A;  3V60 A;  3BYT B;  1C9F A;  2JXX A;  1V1P A;  1WXM A;  4XWX A;  1UPQ A;  4M8N A;  3DWM A;  2KMA A;  2CAY A;  4K81 A;  3ULB A;  1E9M A;  1KLU D;  3RN9 C;  1EO6 A;  4WWN A;  4B6W A;  3VHT C;  4O1N A;  4KHB B;  4KSL C;  4CYE A;  3ECI A;  2C60 A;  2DKQ A;  1QOF A;  1VZ6 A;  4WJP A;  5AZG A;  5C3J B;  4TYZ A;  2KLG A;  2D3B A;  2BQQ A;  5CTR C;  1TQZ A;  2XNA C;  1WSP A;  2GBN A;  4RM8 A;  2OHF A;  4HHV A;  2PE6 B;  1UEL A;  2VRW B;  1UWX A;  4HWI B;  3SV1 A;  3ZJT A;  4P1B C;  5E6J A;  2CB8 A;  2SEB D;  1J0W A;  1FRD A;  1U4A A;  3PS6 A;  2DLB A;  5CHF A;  1M7R A;  4KZ0 A;  3EFU A;  5J3T A;  2DHJ A;  3UIO B;  4YSY B;  4CQN A;  4MEM A;  1R4N B;  4IG7 B;  1VBG A;  3RPF C;  2KJ6 A;  1XLQ A;  4NQK E;  5JZE B;  4CHK A;  3ZXV A;  2PJH A;  3KUZ A;  2WXL A;  2W2X D;  2N9L A;  1P5T A;  3LYY A;  2OTX A;  4C4V B;  2P8V A;  4B0M A;  1FFV A;  2KFK B;  1EWC A;  5CHW A;  5CLL B;  1MI0 A;  2IY1 B;  3G9W A;  2DLW A;  4TKN A;  4EZJ A;  2D9Z A;  2CRF A;  4W9K A;  1PDX A;  3A1Q A;  2E6X A;  1V2Y A;  3VTU A;  1D5X C;  4LDT B;  4DWF A;  3AI5 A;  4HK2 A;  4NSW A;  4S0R A;  2KK8 A;  2COD A;  1AN8 A;  1IYF A;  4DHJ B;  2RNR B;  4RH6 A;  4G3X B;  2BS2 B;  3SBT A;  2ZW0 A;  3N30 A;  3AE3 B;  4EEW A;  1WM2 A;  2M19 A;  3MJW A;  3TCA A;  2Z59 A;  3M3J A;  5DPR A;  1IUE A;  1B1Z A;  1V5M A;  3P6A A;  1UBQ A;  2CJO A;  3MP9 A;  1C79 A;  4JX1 C;  2PW9 A;  4NJC A;  1VR9 A;  4US8 A;  3IBE A;  4HDQ A;  1Y19 B;  1R4M B;  2KD0 A;  2BF8 B;  1KLV A;  1FCC C;  1P3R A;  5GOW B;  4MGY E;  4OVV A;  4LJP B;  2WXO A;  4OHJ A;  2JPH A;  3HVD A;  3PZ8 A;  3PLV A;  4DHJ D;  2R0D A;  1EVH A;  1L0V B;  1V5U A;  3NHE B;  1YQB A;  2QMT A;  1ZPS A;  4ZDV A;  3H7S A;  2KGX B;  2RSG A;  2UZS A;  4ANU A;  3DBL I;  1WH3 A;  3A9J A;  4TUU A;  1SJE D;  4M01 A;  4XDD A;  2JVC A;  4ARC A;  2LXC A;  2I38 A;  4F1S A;  4AP4 C;  2G4S A;  2KMC A;  4JWU C;  4HCP B;  2FDQ A;  2BVC A;  1P6S A;  2CJN A;  4IKG A;  1F0Z A;  2JRI B;  1L5P A;  3AV8 A;  3A4S C;  3PEG A;  3QAR A;  1GB1 A;  3PVU A;  5C79 A;  4D2K A;  1DGJ A;  3LJU X;  4A6F A;  3H9D A;  2E2X A;  2V4L A;  1BTN A;  4ZYN A;  2KUQ A;  4DX9 0;  2INP E;  1JAL A;  1DOX A;  4ICV A;  4GNK B;  4EE2 A;  2D10 A;  2FBW B;  4MJS B;  4AOF A;  2JXT A;  3ZYY X;  3W5U B;  1P0R A;  3L54 A;  3JVZ X;  4AUQ C;  4DBG A;  3MHS D;  4ARI A;  2KNB A;  4BBN C;  2KTR B;  4TQ0 A;  4GB9 A;  3BVZ A;  5TSS A;  3APF A;  1FXT B;  1GOZ A;  4ZRJ A;  4ACF A;  3MC9 A;  1X1F A;  5T8I A;  2MW5 A;  1GC7 A;  1UEF A;  2ZZP B;  5BMI A;  2KCJ A;  1XCQ L;  1F9J A;  1IGD A;  5E6N A;  2BT6 A;  2B76 B;  2HTH A;  4IM2 A;  4JE3 B;  1TY2 A;  2CR5 A;  2DX5 B;  5HI1 A;  2DYQ A;  3W5V B;  3P2B A;  4XWW A;  1L2N A;  4PK1 A;  2KX0 A;  1IP9 A;  2W9N A;  2VSZ A;  1ZYI A;  1SE4 A;  2WU5 B;  2DX5 A;  4JL9 A;  2R82 A;  1HB8 A;  5HHD G;  5D3D A;  1YD8 U;  2KX3 A;  2GLS A;  2Q13 A;  2HJ1 A;  1STE A;  5BYS A;  4M02 A;  3OAN A;  1V5T A;  2X38 A;  1BAK A;  1XR0 B;  1VCB A;  2WDV B;  3NZU A;  5D3V A;  3KLS X;  1YMH E;  4K3C A;  1HZ5 A;  1R4M I;  3VH4 B;  2ELA A;  1NI3 A;  1UGM A;  2KO3 A;  3BII D;  3PVW A;  1NEN B;  2GUM A;  2KFJ A;  2RRF A;  2MRP A;  4G0N B;  4ILH A;  3ZDT A;  2QIL A;  4B0E A;  2WS3 B;  1M94 A;  1WZ0 A;  2RLO A;  2MP2 B;  2O6V B;  2M14 A;  4WUR A;  5AZF A;  2CY5 A;  1MK7 B;  4JKF A;  1E8W A;  4RMA A;  2WLB A;  4OSN A;  3ZO5 B;  4PYU A;  2DFK A;  2LRW A;  3AU5 A;  3VRA B;  2AWT A;  4PS8 A;  2GCJ A;  3FIL A;  4DDI D;  2M0A A;  3QJZ A;  2Z0Q A;  4L6E A;  1BTK A;  1V9J A;  4WIP A;  2M4N A;  3TBL D;  5D2M B;  3B1L X;  5HKH A;  2KC2 A;  3HIZ A;  2PZ1 A;  1NI2 A;  4HAW B;  1TIF A;  4W9H A;  3Q8A A;  2Z14 A;  2FAZ A;  3B2G A;  1NTI A;  2N0Y A;  4Y94 A;  2PIA A;  2WXF A;  3RZW C;  3Q2A C;  3PRE A;  2IY0 B;  2FNJ B;  2YS1 A;  3RMK C;  2IYD B;  4B6H A;  4DXG A;  3JYU A;  4W9L A;  1SSN A;  3CIR B;  1HXY D;  1DOI A;  5D7G A;  3OAW A;  3KQ4 A;  5IJM A;  1RM6 C;  4WAF A;  2INC C;  2Y5P A;  4FJZ A;  1MHH E;  1KF6 B;  3CWI A;  3GE3 C;  4B95 A;  2IJ0 A;  3AE4 B;  1WMH B;  1T0R C;  2DZI A;  4IUM B;  4YTM B;  4FAD A;  5LNK 1;  3Q3J A;  3NG0 A;  3BK2 A;  1V49 A;  3ODO A;  3HRD D;  2C5L C;  1J0G A;  2YT1 A;  1NU2 A;  1GAQ B;  3GZN B;  1JWA D;  2JZ3 B;  3ZKJ C;  4EOY A;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  1ESF A;  2WWZ A;  4MJS A;  2MJD A;  2O6V D;  1YQ4 B;  4GN1 A;  3DWG C;  1HEZ E;  1K53 A;  5DPS A;  2KQ7 A;  2EJ8 A;  1SB3 C;  2O6V A;  2X18 A;  5D3Y A;  1HA5 A;  1E10 A;  1FXI A;  1T0Q C;  2RUK B;  4MK0 A;  3JSV B;  4XWT A;  2DWQ A;  4RF1 A;  1MKE A;  2DHI A;  2L0F A;  2V3P A;  4DDG D;  1H8C A;  1P3Q U;  2YVC A;  2IFS A;  3PRM B;  5J2R A;  1SE9 A;  2BYV E;  3PV1 A;  2IBI B;  2ON8 A;  5C1Z A;  2MJE A;  4K2O A;  3TMP B;  1NYQ A;  3BIN A;  3PPA A;  3FM8 C;  3H6N A;  5AEK B;  2IZV B;  2TSS A;  3ENE A;  4HJK A;  1W1D A;  4ICU A;  5KCV A;  4DK5 A;  1LQB A;  2MBH A;  2YEP B;  1UNS A;  4PYZ A;  4A5K A;  2MX2 A;  2K8E A;  4PQ0 A;  1U29 A;  2C7N B;  1ZXH A;  3DBS A;  1P98 A;  2COA A;  3BVG A;  4JKD A;  4Z2N A;  1T6B X;  2RQ1 A;  2W54 A;  1RRB A;  4G11 A;  2Y8F A;  1K50 A;  1GUA B;  4YXD B;  1UNR A;  1QT9 A;  1U2B A;  4IWP A;  2D9X A;  1MG4 A;  1N63 A;  2KXJ A;  3NVV A;  4MY6 A;  1JRP A;  1BT0 A;  1SJH D;  2YLM A;  3NSU A;  4GSW A;  4A20 A;  2M0X A;  1FOE A;  2N9E B;  3VH3 B;  3O13 A;  3TEW A;  4D0N B;  4DXA B;  4ZYS A;  5JHB A;  5D3X A;  1CMX B;  3GP7 A;  1K5D B;  1WGG A;  3MC8 A;  3EGR A;  5DIF B;  1FHO A;  1D5Z C;  2BCJ A;  3Q8C A;  3PVL A;  2NMQ A;  2KDB A;  2RDH A;  1ACA A;  3M62 B;  3HM3 A;  2VRR B;  1AW7 A;  2Z0E B;  1MJD A;  1FXA A;  3FSS A;  2ZVN A;  2JY6 A;  3Q3F A;  3QCA A;  4ANW A;  2N9P C;  2L8J A;  1WGD A;  4JKH A;  3PG7 A;  1YNT E;  3EPY A;  2ZPN A;  5DHF B;  3TW1 A;  1TBE A;  2A5U A;  1N3H A;  3C0R B;  4IOI E;  2D2Q A;  4XGA B;  4KSK C;  4FA6 A;  3X0W A;  4RGT A;  4DIX A;  3P7Z A;  1TYG B;  1WGR A;  2LBB A;  3RNF C;  3RZF A;  3X23 A;  3BVM A;  1NVL A;  1A70 A;  3W1S C;  1VJK A;  4USA A;  4YL8 A;  2JRH A;  5G5H A;  2KIE A;  2J52 A;  3L10 B;  2ZVO A;  4K3B A;  3HVZ A;  1V86 A;  2EEL A;  3RUI B;  4GOU A;  2K8B A;  4ITK A;  4ZRK A;  2DYN A;  2A4Z A;  2PTL A;  4W9J A;  4A9A A;  3CMM B;  1WY8 A;  2MA9 B;  3FVC A;  4M0W B;  5HE2 A;  3A9K B;  3SFE B;  4XDC A;  2YEP F;  3DVG Y;  4MDK E;  1B9R A;  1L0X B;  5C6R A;  2KIG A;  2KC1 A;  2CY4 A;  4JGH B;  3N1Z C;  1TS5 A;  3N7C A;  3P1M A;  5DCN A;  4LNN A;  1MG8 A;  1V97 A;  1I42 A;  2CHW A;  5LXH A;  1ISN A;  2HRJ A;  3NZS A;  1ET6 A;  2GBM A;  3OHM B;  1WIA A;  4BKT A;  1QIL A;  2RSU A;  1MI1 A;  4J6I A;  5C5B A;  2UVM A;  3B2F A;  2XEW A;  3CSF A;  2LKO A;  4KGT A;  4KGR A;  3ZXR A;  1FIQ A;  3C19 A;  1VBH A;  3IT4 B;  2JWU A;  2XN9 C;  5KHQ A;  4LNI A;  1F52 A;  2MCN B;  4ZRI A;  4W9C A;  1H10 A;  4WJ7 A;  4OZA A;  2K6D B;  3JSV A;  2QHO A;  1I2H A;  4Z2M B;  1YX5 B;  1J19 A;  3SU8 X;  3E56 A;  1E7P B;  2NS5 A;  1QF6 A;  4BZA A;  5J18 A;  3ML4 A;  2Z4D A;  1RFA A;  2NCN A;  3TEY A;  1BUI C;  4MH8 A;  3K9O B;  3D8F A;  2VZK D;  4HAU B;  1ZDX A;  3DQV A;  4CHM A;  3ALB A;  1PGA A;  3T9L A;  1AAR A;  4HDO A;  1ZGU B;  3Q8B A;  3ZDM C;  4MT5 A;  4CO7 A;  3KH0 A;  3N1Y C;  1GB4 A;  5AUK A;  1Z2M A;  3KYC D;  3WAN A;  1WGQ A;  3HM6 X;  1QQR A;  1J7B A;  1Y56 A;  5D94 A;  1WM3 A;  3HHM A;  2R2Y A;  2FIF A;  1XCT L;  3GB1 A;  1ZP0 B;  3LJ3 A;  1YOV B;  4GLS C;  2HJ8 A;  1U5E A;  1WR6 E;  5H92 C;  3VDZ A;  2K6Q A;  1N60 A;  4AWJ A;  2FCM A;  3WAM A;  4IM3 A;  4EZK A;  4KDI C;  4XX5 A;  2DZJ A;  3N1X C;  1WR1 A;  2RPQ A;  3DBR I;  3ML8 A;  4FXC A;  1GNU A;  4FN2 A;  2JF5 A;  1B55 A;  1CJE A;  4JKB A;  2N7E A;  2O2V B;  4PS3 A;  3DXC A;  4ZRQ A;  2JSV X;  1SEB D;  3RT3 B;  4XYC A;  1I7A A;  3NVY A;  3U30 A;  1DOY A;  5FR3 A;  3A33 B;  2PE9 A;  1MVK A;  1JML A;  2GBJ A;  2N4F A;  5DH9 B;  1XEE A;  2JYE A;  5IRS A;  4DHZ E;  2X8X X;  3AH7 A;  1FGZ A;  3V61 A;  3E9L A;  4A55 A;  1OY2 A;  3ZW3 A;  4HB4 B;  1NVI D;  1MPE A;  1H4R A;  1JW9 D;  4L23 A;  5IP4 D;  3RD2 A;  1QLB B;  4ZRP A;  2WHI A;  1TKG A;  1I4G A;  4C00 A;  4E74 A;  4DXF A;  2W2X C;  1AQC A;  3NRZ A;  1OEY J;  1J7A A;  2KJH B;  1FNV A;  5LON B;  1L4D B;  1T5X D;  3PTF C;  3VAW A;  3W1S A;  1E6E B;  4TV3 A;  3QAQ A;  4TSS A;  4IWO A;  1HTQ A;  2G45 B;  4A90 A;  3KYD D;  1PUT A;  3UF8 A;  1BML C;  1EAZ A;  1WJ6 A;  1DDW A;  3E9O A;  2HD5 B;  2IND C;  1XD4 A;  4HAY B;  3KVF B;  3ABV B;  1NEK B;  3HIE A;  2LUM A;  2LOZ A;  4AJW A;  2DBY A;  1MAI A;  1V5O A;  3NUH B;  1V5P A;  4H2A A;  4ANV A;  2NPT A;  4HKQ A;  2KDF B;  4S17 A;  1SE2 A;  1I4P A;  2L83 A;  4W9G A;  1C4A A;  1V8C A;  1Y5O A;  1YQ3 B;  2ZCB A;  5EE9 A;  3VTV A;  1JWU D;  3S2A A;  1N61 A;  4HRO A;  3CST A;  1TJE A;  2SAK A;  1WI0 A;  2Q5W D;  3E66 A;  1WGH A;  2DEN B;  1QOG A;  2V0G A;  3L08 A;  2K1F A;  2GS0 A;  2JZP A;  4XE0 A;  1VZ8 A;  2LHE A;  1WG7 A;  4OT1 A;  2YS5 A;  2L0T A;  2YT0 A;  1RWS A;  1Z5S B;  1WX9 A;  1KC7 A;  2N23 A;  4K2P A;  3DBR B;  2KYW A;  2Z8L A;  4URK A;  3BYY B;  2I5F A;  2BGF A;  1IPG A;  2QC8 A;  1WJ4 A;  4FUL A;  2R09 A;  3P4S B;  1XQQ A;  1I35 A;  2OJW A;  2DA0 A;  2GRI A;  5FKA C;  2QCZ A;  3AM9 A;  5G2N A;  4FJY A;  4A6Q A;  1UNQ A;  3W1Y A;  4XZ4 A;  1JRO A;  1HZ6 A;  3U7Z A;  2AYO B;  3PLU A;  4FJV B;  1WYG A;  2GOW A;  3KUD B;  1HQR D;  1HTO A;  3QC8 B;  3EC8 A;  3JW0 X;  1XCG A;  1XOD A;  2NR2 A;  3NVW A;  3VUW A;  3FEH A;  3NS8 A;  2K9X A;  3DBH I;  1I4R A;  1UF0 A;  2EKI A;  2L1A A;  2LGS A;  3RUL A;  1AYF A;  1X86 A;  4MM3 B;  3U4E G;  2LMC A;  5EE3 A;  2WXN A;  2WQY B;  1XLO A;  2UU7 A;  1XO3 A;  2BYT A;  2V3N A;  2KQS A;  2JUO A;  2JP2 A;  2V4I B;  1XXG A;  1Q5W B;  3GZN I;  1TKY A;  3UQB A;  1LFD A;  2D3C A;  3AUL A;  2E3T A;  2WXJ A;  5FI0 A;  1TZ1 A;  3DXE A;  2LYD A;  2K5P A;  4JPS A;  1GG3 A;  2GCL A;  3KSY A;  3SBG A;  3NVZ A;  3AE9 B;  1KOT A;  3WIM A;  4RF0 A;  2AQ3 B;  3CIK A;  3RI7 C;  3QWZ B;  3ZLZ A;  3R2T A;  1ZM0 A;  2FCN A;  3OLM D;  4M8M A;  3GE8 C;  4W9D A;  1FNW A;  3DVN V;  2WXK A;  2ADZ A;  1MK9 B;  1PGB A;  2W82 A;  2FCQ A;  1M7E A;  2WDT B;  3QK0 A;  2LVO A;  2QKL A;  1D3Z A;  4KKI A;  1K52 A;  3A4R A;  1T0Y A;  2RGN B;  1DYN A;  1E7U A;  3WYF B;  4HB3 B;  4C4V A;  1V1O A;  4YT0 B;  3RNE C;  2PPH A;  3KW5 B;  3RNB C;  1I4X A;  3KWV A;  2EMS A;  4KDL B;  1PFJ A;  4GMV A;  2J0K A;  5DI9 B;  5FK9 C;  3T8M A;  1WVH A;  4NAW A;  1LB1 A;  5GXG B;  5KHO A;  4EMO A;  1FO4 A;  2EMT A;  5IO9 A;  2KHW B;  1ET9 A;  4ASW C;  1DDV A;  2ONQ A;  4MSQ B;  2KVZ A;  5HE0 A;  2FCS A;  3NWF A;  2IO2 B;  1YN5 A;  4LCD E;  4P7I A;  4JWS C;  3Q69 A;  2BWE S;  2G1E A;  4WJQ A;  2W55 A;  2DN6 A;  2NTS A;  3D8D A;  4RFB A;  1FGY A;  4OZB A;  3ZVV A;  1KM7 A;  3F5R A;  3ZTC A;  3WAO A;  4REZ A;  2WXI A;  5GMV A;  5I4D A;  5L83 A;  1Q1O A;  2IYB A;  2LFI A;  2REX A;  4HPL B;  1FD6 A;  4HPM B;  2LGX A;  1E8Z A;  1YIW A;  3I3T B;  2XQN M;  2KWU B;  2PKO A;  4JKG A;  1RYJ A;  4JLC A;  3H8H A;  3AEG B;  4D6W A;  3B0A A;  3QIJ A;  3AU4 A;  2D3A A;  1HBK A;  1U5G A;  2COF A;  4L1B A;  1R7S A;  3RNA C;  2EKE C;  3VXW A;  4LTU A;  1WJ1 A;  1UPR A;  2K8H A;  3Q3N C;  2BYF A;  2L05 A;  2N9K A;  1C1Y B;  5CX3 A;  2BS4 B;  4J3O D;  5EE0 A;  4JKC A;  4QXA B;  2LGY A;  2LVQ A;  2M56 B;  1WZ3 A;  4TQ1 A;  1P9D U;  5EFX A;  3ODW A;  2VH2 A;  2DZK A;  2WXG A;  1KBL A;  3UIP B;  4C56 C;  2RD0 A;  1IBX A;  3HSA A;  4C0A A;  4DBB A;  2W3S A;  3MPX A;  3UI3 A;  2Z0P A;  3IXS A;  3ZJV A;  5LXI B;  2MHJ A;  2D3G A;  1V89 A;  1X11 A;  1N5X A;  4IM0 A;  2COC A;  1PFD A;  3AEC B;  1FPY A;  3NW8 A;  1ST7 A;  3QBV B;  4GDK A;  2L00 B;  1FNU A;  3I57 A;  4A3O A;  3H7P A;  3HQC A;  3DHG C;  3SD5 A;  2UWQ A;  2CKH B;  2JZZ A;  2COP A;  2BS3 B;  2KZR A;  3A1Q B;  4K1R B;  3DVN U;  3FAH A;  4HAT B;  4QJ3 B;  4RM9 A;  5JP4 A;  3R66 C;  3ONS A;  2C9W B;  4IAP A;  3DPD A;  2BWF A;  1TJ6 A;  2LZ6 A;  2V3S A;  3V5W A;  1C4P A;  1EWY C;  5FI1 A;  1IGC A;  3Q6B A;  2J59 M;  3AMZ A;  2MDX A;  1FFU A;  3A58 A;  2K49 A;  2BW2 A;  2J42 A;  3M1I B;  3I63 C;  3CF6 E;  1KJT A;  3N9Y C;  3NY5 A;  3DCG A;  4MM3 A;  1OFF A;  3O65 B;  2WGS A;  2ZJD A;  3TO1 A;  2LUL A;  1K5G B;  3SR6 A;  2AL3 A;  3U8Z A;  1WX8 A;  3L4P A;  2JX5 A;  3DVG X;  1HB6 A;  3VR8 B;  2QIE B;  1S3S G;  2BKF A;  1Y8R C;  3FC4 A;  3AE7 B;  5KQ4 A;  3B08 A;  4W9F A;  2ICI A;  3RYT A;  2NBV B;  4EZL A;  2Z13 A;  3AEF B;  2VZK B;  2KOX A;  3ZIM A;  5EDS A;  2PEA A;  1T77 A;  2YRY A;  1NYR A;  3DCX A;  2LEK A;  1X1G A;  4GXB A;  2N7J A;  2FJU B;  2NBU A;  4FBJ B;  3DBH B;  2L52 A;  2LUE A;  3L0W B;  4K7U A;  1J8C A;  2LVP A;  3PHX B;  1L4Z B;  3EUB 2;  1KZG A;  2BKR B;  1L6U A;  1MPH A;  2I5C A;  3ZVR A;  1TTN A;  3AEA B;  1C78 A;  1CQV A;  3UIN B;  2IGG A;  2INN E;  3BJI A;  3IHP C;  2DAF A;  4EJN A;  5BMG A;  4ZHO A;  1VRA B;  1EM7 A;  2KN4 A;  1WYW B;  3U7D A;  3TL5 A;  5D27 A;  5FR6 A;  1UWM A;  4IFS A;  3O96 A;  1V6E A;  2M38 A;  2IDY A;  2AEH A;  4BAX A;  2NPT B;  1A5R A;  1XX0 A;  1FRR A;  2FJL A;  1QKZ A;  1NDD A;  3MHZ A;  5D3I B;  1XLP A;  1V88 A;  3V3X A;  5LLI A;  2BTE A;  3NS1 A;  5J17 A;  5JVL A;  4K17 A;  2WX0 A;  3MJ5 A;  1WXA A;  1QZE A;  4LK0 M;  4LNK A;  1VLB A;  2ABD A;  1FEH A;  2KMM A;  3ETR A;  2KKC A;  2JWZ A;  4HEA 1;  4ILJ A;  1EUV B;  2AL6 A;  1WJU A;  4KIK B;  2N1W A;  2ROZ B;  1WF9 A;  1C76 A;  4N9F 4;  1U5F A;  2Y3A A;  1OQQ A;  1RFK A;  1TS3 A;  3E9S A;  1RAX A;  1OQR A;  2KTF A;  3AXC A;  1FM0 D;  5BMH A;  3H7P B;  3P63 A;  1K51 A;  5IAA C;  5IOI A;  3SEB A;  4HVB A;  2GJY A;  1ROE A;  2JQR B;  3FLV A;  5AUI A;  4HAV B;  1JRU A;  1OTR B;  2DAJ A;  3R7Q A;  4CHJ A;  2KLC A;  3AE5 B;  1XF5 L;  2GMI C;  1WXQ A;  5J3Q A;  2MP2 A;  4N59 A;  2DYM A;  4A6F B;  3P4R B;  4M00 A;  3F0W A;  3AE2 B;  3J9C A;  4K7W A;  2C7H A;  3T3O A;  3NOB A;  4K7S A;  1W1G A;  1MFW A;  5IA7 A;  3FKY A;  3SO6 A;  2KAC A;  4Q2J A;  3VUY A;  1WJN A;  2BBC A;  4KHO A;  1GGO A;  1U5D A;  1WJM A;  2ACZ B;  3NJT A;  2GBK A;  3EEC A;  4I6L B;  3NWD A;  2QDF A;  1XKE A;  3CXB B;  2DHK A;  1TZO A;  1UGJ A;  2MFQ A;  2RDG A;  1EF1 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  3ZRF A;  2FUG 1;  2K39 A;  3LXF A;  4QJ5 B;  3UZT A;  2AQ1 B;  4WWO A;  4MSM B;  1WWT A;  3ZJU A;  5KQ1 A;  4GDL A;  5I2M A;  4MGI E;  2K2J A;  2PMV A;  3W2D A;  1BWN A;  2R2Q A;  2UYZ B;  4AS1 A;  2WDQ B;  1TY0 A;  1WE7 A;  2ELB A;  3VIA A;  4HJG E;  1E5W A;  2V76 A;  3PP2 A;  1XT9 B;  4LNF A;  2P0F A;  2KTR A;  2K0P A;  2MBO A;  4I6N B;  1X1M A;  2DTC A;  4JK9 A;  4RGN A;  4BOZ B;  2MBB B;  4BOS C;  2KUP A;  2K22 A;  4A8X C;  3DHH C;  5DPW A;  2K25 A;  3SFD B;  3U52 E;  2V9H A;  1PGX A;  3D8E A;  1PYW D;  2NBV A;  2DIK A;  3V6E B;  1OQN A;  3P4Q B;  2BB5 A;  1ZXI A;  3QA8 A;  2G4D B;  4QAY A;  4PNK A;  1QC6 A;  2MWN B;  1YN4 A;  4HB0 B;  1VZ7 A;  3PT2 B;  2EC1 A;  2MH7 A;  5BYQ A;  1JWB D;  3PZ7 A;  3MFG A;  1DDM A;  5DPT A;  4YSX B;  1CK1 A;  1ZVR A;  3PRZ A;  2DNF A;  4A6K A;  2JYT A;  3AEE B;  1RLF A;  2B3A A;  1EF5 A;  3ZNG C;  3VTW A;  5E6P A;  5DHA B;  4IOY X;  3APD A;  3LB8 C;  4GGQ A;  3BZD B;  1C77 A;  4LLG M;  3A9K A;  4B9K A;  2C7M B;  1PQS A;  1EU3 A;  2JU6 X;  4JIO U;  4IWQ A;  3MC0 B;  1P7E A;  1S1Q B;  2QJL A;  1V81 A;  1M4V A;  3GYO A;  3KWL A;  4GIV A;  3OG5 A;  4ZOH C;  2D9Y A;  2LGI A;  1DIK A;  2J0J A;  2XBB C;  1TKE A;  4RGM A;  2Y7B A;  3Q3O C;  2AX5 A;  1TGZ B;  2K3U A;  3UQA A;  3OJ4 B;  2OQB A;  4OVU A;  1D5M C;  5IKC M;  4GZU A;  4RNA A;  4KX6 B;  1JCK B;  1SIJ A;  1WRD B;  4II2 B;  3TIX A;  4KKJ A;  4NAW B;  2J53 A;  1QOA A;  1ZDV A;  3V05 A;  1SGH A;  4A6H A;  2DYB A;  3RNG C;  1UNP A;  3Q3M C;  3TVV A;  5J3Y A;  1LO5 D;  2LJ5 A;  1I7H A;  3P4P B;  1P7F A;  1T0S C;  2Y5B B;  4NJ6 A;  3C8Y A;  4X57 B;  2KQ4 X;  1WGK A;  3QWM A;  3DDC B;  1JWM D;  2MSE D;  2X0S A;  2CS4 A;  2ZKM X;  4UDU C;  1WRI A;  2DHZ A;  1SXT A;  4LNO A;  1WI1 A;  2KWD A;  1SE3 A;  2IGD A;  1LW3 A;  1UUP A;  3Q8E A;  2CU1 A;  1ZUD 2;  2LXA A;  3HW2 B;  2RDB C;  3IG3 A;  3A98 B;  3I9V 1;  3AEB B;  4RCO A;  4JKG B;  1UH6 A;  4MH0 E;  5BO4 B;  2K00 A;  2KJR A;  1ZKH A;  3TFM A;  4G50 A;  1K8R B;  1KTK A;  3EA6 A;  2O2V A;  3T06 A;  5JH5 C;  3M63 B;  2HE7 A;  2WU2 B;  2LJI A;  3BY4 B;  3ZQ4 A;  2RR9 A;  5G5G A;  2Y8G A;  2H7D A;  1VD2 A;  2FUH B;  4JK7 A;  2I2Y A;  4YTP B;  1F2R C;  4R3D A;  4HB2 B;  1SHC A;  3IFW B;  1F2R I;  3L13 A;  2WX1 A;  3L16 A;  2CQU A;  2KN5 A;  1N6Z A;  4WWP A;  4P1C C;  2ROV A;  2QEJ C;  3L17 A;  1WE6 A;  4WAA A;  2OED A;  4F7U P;  3KUC B;  1E0Z A;  4IW0 A;  2RPV A;  2LHD A;  5TR5 A;  5H8Y E;  2NZ8 B;  2FID A;  3H1U A;  4US9 A;  3HK0 A;  4MEL A;  2H7E A;  3KRX A;  3I5J C;  3QHT A;  3W9C B;  1LGR A;  3B77 A;  2NBW B;  3R7R A;  3PRP B;  2R61 A;  1HE8 A;  3TEZ A; 
#chains in the Genus database with same CATH homology
 2KWC A;  3WA0 A;  2MBQ A;  1GC6 A;  2DZM A;  2N9X A;  4FHJ A;  1UZX B;  4KHA A;  5JHG A;  4I6P A;  4BBN F;  2D9V A;  3DOW A;  1V80 A;  2FJ9 A;  3EHV A;  3VUX A;  2KDI A;  4BFR A;  1X05 A;  2GBR A;  3AJ4 A;  2Z0D B;  1KZ7 A;  4JKE A;  1YX6 B;  4GPT B;  2G3Q B;  3PSE B;  1ZW7 A;  4NPN A;  4ANX A;  2D4Q A;  1R4N I;  5LOP B;  4BVU C;  5L81 A;  3QX1 A;  3RCZ A;  2D07 B;  3RCP A;  1LXD A;  2MBE A;  1C3T A;  3TJP A;  4EFO A;  4BKG A;  3APC A;  5JHA A;  1E7V A;  3ULC A;  4DX8 A;  2ZNV C;  2WH5 A;  5L95 C;  3PZD A;  2JT4 B;  3ZTD A;  1OMW A;  2Z0O A;  3GOE A;  5G55 A;  4W9I A;  4NY0 A;  3WAL A;  4BKS A;  1WX7 A;  5HE3 A;  1G6J A;  1NTV A;  2I1K A;  1MIX A;  2MLB A;  4BKS D;  2MQJ A;  2LRU A;  1E90 A;  1E8Y A;  3SHQ A;  4II3 B;  4MGZ E;  4AJY B;  3OJ3 A;  3KZ1 A;  3UGB B;  2YS3 A;  2KDE B;  2WYQ A;  2M8S A;  3ENB A;  2RVB B;  4JQW C;  2YSZ A;  4WSF A;  2KWV B;  4EUT A;  1KI1 B;  4HLE A;  1Q0W B;  4F7H A;  4EKU A;  3V62 A;  3QQ8 B;  2P0D A;  4HXD A;  1PLS A;  2K2U A;  4GOC A;  2R2O A;  4LDT D;  2KAN A;  4NJ7 A;  3KRW A;  4A3P A;  4GU2 A;  2LAS A;  2LGD A;  1ZC3 B;  4KZC A;  4F8C B;  4W9E A;  3DXD A;  2M1M A;  3K9P B;  2VKI A;  5JLJ B;  5E6O A;  1XD3 B;  2CHX A;  1Z87 A;  2ZCC A;  1WGU A;  4GDL B;  4FHK A;  1FB8 A;  1DBH A;  3GYP A;  1RRP B;  1JDE A;  4MGK E;  1U27 A;  3E9P A;  3IVF A;  2G35 A;  3VOQ A;  1LM8 B;  3A8P A;  2V1Y A;  2L76 A;  4XC2 A;  4F7G A;  1OQY A;  1NBF C;  2KVR A;  1UBI A;  3M95 A;  2P0H A;  3PGE A;  1Q67 A;  3D32 A;  1E8X A;  1WGY A;  2OJR A;  3ZNZ B;  2I1J A;  2MWS B;  2N1V A;  1UD7 A;  1W1H A;  2ZNV B;  4LJO B;  4WVF B;  1EGX A;  4F7Z A;  2J7Q B;  3PHW B;  2NVU I;  4GMX B;  3ODX A;  3V6C B;  1QQG A;  1DRO A;  1ZSQ A;  2ZEQ A;  1GJZ A;  2BPS A;  4WJO A;  3LDZ E;  4JK8 A;  3SUZ A;  3R3M A;  4E3C A;  3MTN B;  4PS7 A;  2K8C A;  2J0M A;  4H8S A;  3SDL C;  3A8Q A;  4BBK A;  1WXV A;  3MDB C;  2ZPY A;  2L3Z A;  3WAP A;  4ILG B;  2L2I A;  5AZH A;  3ZUN A;  1FHW A;  2HTH B;  4WQO B;  3ML9 A;  4WJN A;  2LI5 A;  2D9W A;  4YON A;  2XK5 B;  3FP5 A;  1MIZ B;  2IO0 B;  2BYE A;  4KV2 A;  1V61 A;  1WFY A;  3ZRC A;  5C23 A;  3KY9 A;  5D6J B;  2CHZ A;  3VFK A;  4MT7 A;  4E71 A;  1ZC4 B;  4IC7 B;  2XK5 A;  3ZNH B;  5C16 A;  4NNJ B;  2OOB B;  5JHH A;  3ZNI D;  2Z59 B;  2QKM A;  4KAX B;  3N32 A;  1AWE A;  4NQL B;  2MKR A;  2DYO A;  1P1A A;  2LOX A;  1YJ1 A;  1WXS A;  2DKP A;  3PSC A;  4KVG B;  1L7Y A;  2NMB A;  1FHX A;  5C5B B;  2UZR A;  2M17 A;  2W2W A;  2DX1 A;  4DHZ B;  3A9J B;  1FAO A;  2KFK A;  3VVW B;  1PMS A;  3SNH A;  1RJ2 A;  4KIK A;  1IRS A;  2YF0 A;  2IO3 B;  5CLQ B;  2IO1 B;  5HE1 A;  2D11 A;  1WMH A;  1TXD A;  3N3K B;  1SIF A;  5D3W A;  2L1C A;  4HAZ B;  2L7R A;  4JKA A;  4HCN B;  2LG1 A;  4HAX B;  3SYX A;  1NTY A;  3VQI A;  5CHV C;  2RGF A;  3V60 A;  2JXX A;  1WXM A;  4XWX A;  1UPQ A;  4M8N A;  2KMA A;  2CAY A;  4K81 A;  3ULB A;  1EO6 A;  4WWN A;  4B6W A;  3VHT C;  4KHB B;  4KSL C;  4CYE A;  3ECI A;  2DKQ A;  2C60 A;  4WJP A;  5AZG A;  4TYZ A;  2KLG A;  5CTR C;  1TQZ A;  2GBN A;  4RM8 A;  4HHV A;  2PE6 B;  1UEL A;  2VRW B;  4HWI B;  3SV1 A;  2CB8 A;  1J0W A;  1U4A A;  3PS6 A;  5CHF A;  1M7R A;  4KZ0 A;  3EFU A;  5J3T A;  2DHJ A;  3UIO B;  4MEM A;  4IG7 B;  1VBG A;  2KJ6 A;  4NQK E;  5JZE B;  4CHK A;  2PJH A;  3KUZ A;  2W2X D;  1P5T A;  2OTX A;  2P8V A;  2KFK B;  5CHW A;  5CLL B;  2IY1 B;  3G9W A;  2DLW A;  4TKN A;  4EZJ A;  2D9Z A;  2CRF A;  4W9K A;  3A1Q A;  1V2Y A;  3VTU A;  4LDT B;  4DWF A;  3AI5 A;  4HK2 A;  4NSW A;  2KK8 A;  2COD A;  1IYF A;  4DHJ B;  2RNR B;  4G3X B;  3SBT A;  3N30 A;  4EEW A;  1WM2 A;  3MJW A;  3TCA A;  3M3J A;  5DPR A;  1V5M A;  3P6A A;  1UBQ A;  3IBE A;  4HDQ A;  1Y19 B;  2KD0 A;  2BF8 B;  1KLV A;  1P3R A;  5GOW B;  4MGY E;  4OVV A;  4LJP B;  2JPH A;  3PLV A;  4DHJ D;  2R0D A;  1EVH A;  1V5U A;  3NHE B;  1YQB A;  4ZDV A;  3H7S A;  2KGX B;  2RSG A;  2UZS A;  4ANU A;  3DBL I;  1WH3 A;  3A9J A;  4TUU A;  2JVC A;  2LXC A;  4F1S A;  4AP4 C;  2G4S A;  2KMC A;  4HCP B;  2FDQ A;  1P6S A;  2JRI B;  3A4S C;  3PEG A;  3QAR A;  3PVU A;  5C79 A;  3LJU X;  4A6F A;  3H9D A;  2E2X A;  2V4L A;  1BTN A;  4ZYN A;  4DX9 0;  4ICV A;  2D10 A;  4MJS B;  4AOF A;  1P0R A;  3L54 A;  3JVZ X;  4AUQ C;  4DBG A;  3MHS D;  2KNB A;  4BBN C;  2KTR B;  4TQ0 A;  4GB9 A;  3APF A;  1FXT B;  4ZRJ A;  1X1F A;  2MW5 A;  1GC7 A;  1UEF A;  2ZZP B;  2KCJ A;  1F9J A;  5E6N A;  2HTH A;  4IM2 A;  2CR5 A;  2DX5 B;  2DYQ A;  3P2B A;  1L2N A;  2KX0 A;  1IP9 A;  2W9N A;  2VSZ A;  2DX5 A;  4JL9 A;  2R82 A;  1HB8 A;  1YD8 U;  2KX3 A;  2Q13 A;  3OAN A;  1V5T A;  1BAK A;  1XR0 B;  1VCB A;  3NZU A;  5D3V A;  1R4M I;  3VH4 B;  2ELA A;  1UGM A;  2KO3 A;  3PVW A;  2KFJ A;  2MRP A;  4G0N B;  4ILH A;  3ZDT A;  1M94 A;  1WZ0 A;  2RLO A;  2MP2 B;  2O6V B;  2M14 A;  5AZF A;  2CY5 A;  1MK7 B;  4JKF A;  1E8W A;  4RMA A;  3ZO5 B;  4PYU A;  2DFK A;  2LRW A;  3AU5 A;  2AWT A;  4PS8 A;  2GCJ A;  4DDI D;  3QJZ A;  2Z0Q A;  4L6E A;  1BTK A;  1V9J A;  2M4N A;  3TBL D;  5D2M B;  3B1L X;  5HKH A;  2KC2 A;  3HIZ A;  2PZ1 A;  1NI2 A;  4HAW B;  4W9H A;  2FAZ A;  1NTI A;  2N0Y A;  4Y94 A;  3RZW C;  3PRE A;  2IY0 B;  2FNJ B;  2YS1 A;  2IYD B;  4B6H A;  3JYU A;  4W9L A;  5D7G A;  3OAW A;  5IJM A;  4FJZ A;  4B95 A;  1WMH B;  2DZI A;  4IUM B;  4FAD A;  3Q3J A;  1V49 A;  3ODO A;  2C5L C;  1J0G A;  2YT1 A;  1NU2 A;  2JZ3 B;  3ZKJ C;  4EOY A;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  2WWZ A;  4MJS A;  2O6V D;  4GN1 A;  5DPS A;  2KQ7 A;  2EJ8 A;  2O6V A;  2X18 A;  5D3Y A;  2RUK B;  4MK0 A;  3JSV B;  1MKE A;  2DHI A;  2L0F A;  4DDG D;  1H8C A;  1P3Q U;  2YVC A;  2IFS A;  3PRM B;  5J2R A;  1SE9 A;  2BYV E;  3PV1 A;  2IBI B;  5C1Z A;  4K2O A;  3TMP B;  3BIN A;  3PPA A;  3FM8 C;  3H6N A;  5AEK B;  2IZV B;  3ENE A;  4HJK A;  1W1D A;  4ICU A;  5KCV A;  4DK5 A;  1LQB A;  2MBH A;  4PYZ A;  4A5K A;  2MX2 A;  4PQ0 A;  2C7N B;  1U29 A;  3DBS A;  1P98 A;  2COA A;  4JKD A;  4Z2N A;  2RQ1 A;  1RRB A;  4G11 A;  2Y8F A;  1GUA B;  1UNR A;  4IWP A;  1U2B A;  2D9X A;  2KXJ A;  4MY6 A;  1BT0 A;  2YLM A;  3NSU A;  4GSW A;  4A20 A;  2M0X A;  1FOE A;  2N9E B;  3VH3 B;  4D0N B;  4DXA B;  5JHB A;  5D3X A;  1CMX B;  1K5D B;  1WGG A;  5DIF B;  1FHO A;  2BCJ A;  3PVL A;  2KDB A;  1ACA A;  3M62 B;  3HM3 A;  2VRR B;  2Z0E B;  3FSS A;  2ZVN A;  2JY6 A;  3Q3F A;  3QCA A;  4ANW A;  2N9P C;  2L8J A;  1WGD A;  4JKH A;  3PG7 A;  3EPY A;  2ZPN A;  5DHF B;  3TW1 A;  1TBE A;  2A5U A;  1N3H A;  3C0R B;  2D2Q A;  4KSK C;  4FA6 A;  3X0W A;  3P7Z A;  1WGR A;  2LBB A;  3RZF A;  3X23 A;  1NVL A;  3W1S C;  4YL8 A;  2JRH A;  3L10 B;  2ZVO A;  1V86 A;  3RUI B;  2K8B A;  4ZRK A;  2DYN A;  2A4Z A;  4W9J A;  3CMM B;  1WY8 A;  2MA9 B;  4M0W B;  5HE2 A;  3A9K B;  3DVG Y;  4MDK E;  5C6R A;  2KC1 A;  2CY4 A;  4JGH B;  3N7C A;  5DCN A;  1MG8 A;  1I42 A;  2CHW A;  5LXH A;  1ISN A;  2HRJ A;  3NZS A;  2GBM A;  1WIA A;  4BKT A;  2RSU A;  4J6I A;  5C5B A;  2UVM A;  2XEW A;  3CSF A;  2LKO A;  1VBH A;  5KHQ A;  2MCN B;  4ZRI A;  4W9C A;  1H10 A;  4WJ7 A;  2K6D B;  3JSV A;  2QHO A;  1I2H A;  4Z2M B;  1YX5 B;  1J19 A;  3SU8 X;  2NS5 A;  5J18 A;  3ML4 A;  1RFA A;  2NCN A;  3K9O B;  3D8F A;  4HAU B;  3DQV A;  4CHM A;  3ALB A;  3T9L A;  1AAR A;  4HDO A;  1ZGU B;  3ZDM C;  4CO7 A;  3KH0 A;  1Z2M A;  3KYC D;  3WAN A;  1WGQ A;  3HM6 X;  5D94 A;  1WM3 A;  3HHM A;  2FIF A;  3LJ3 A;  2HJ8 A;  1U5E A;  1WR6 E;  3VDZ A;  2K6Q A;  4AWJ A;  2FCM A;  3WAM A;  4IM3 A;  4EZK A;  4KDI C;  4XX5 A;  2DZJ A;  1WR1 A;  2RPQ A;  3DBR I;  3ML8 A;  1GNU A;  4FN2 A;  2JF5 A;  1B55 A;  4JKB A;  2N7E A;  2O2V B;  4PS3 A;  3DXC A;  3RT3 B;  1I7A A;  3U30 A;  3A33 B;  2PE9 A;  2GBJ A;  2N4F A;  5DH9 B;  4DHZ E;  1FGZ A;  3V61 A;  3E9L A;  1OY2 A;  3ZW3 A;  4HB4 B;  1H4R A;  3RD2 A;  4E74 A;  2W2X C;  1AQC A;  1OEY J;  2KJH B;  5LON B;  3PTF C;  3VAW A;  3W1S A;  4TV3 A;  3QAQ A;  4IWO A;  2G45 B;  3KYD D;  3UF8 A;  1EAZ A;  1WJ6 A;  1DDW A;  3E9O A;  2HD5 B;  1XD4 A;  4HAY B;  3KVF B;  2LOZ A;  4AJW A;  1MAI A;  1V5O A;  1V5P A;  4ANV A;  2NPT A;  2KDF B;  4W9G A;  1Y5O A;  2ZCB A;  3VTV A;  3S2A A;  3CST A;  1WI0 A;  3E66 A;  1WGH A;  2DEN B;  3L08 A;  2K1F A;  2GS0 A;  1WG7 A;  2YT0 A;  2YS5 A;  2L0T A;  1Z5S B;  1WX9 A;  1KC7 A;  2N23 A;  4K2P A;  4URK A;  2I5F A;  2BGF A;  1IPG A;  1WJ4 A;  4FUL A;  2R09 A;  1XQQ A;  1I35 A;  2DA0 A;  5G2N A;  4FJY A;  1UNQ A;  3W1Y A;  4XZ4 A;  2AYO B;  3PLU A;  4FJV B;  2GOW A;  3KUD B;  3QC8 B;  3EC8 A;  3JW0 X;  1XCG A;  1XOD A;  2NR2 A;  3VUW A;  3FEH A;  3NS8 A;  3DBH I;  3RUL A;  1X86 A;  2KQS A;  2JUO A;  2JP2 A;  1Q5W B;  3GZN I;  3UQB A;  1LFD A;  3AUL A;  5FI0 A;  1TZ1 A;  3DXE A;  2LYD A;  1GG3 A;  2GCL A;  3KSY A;  3SBG A;  1KOT A;  3WIM A;  3CIK A;  3ZLZ A;  3QWZ B;  1ZM0 A;  2FCN A;  3OLM D;  4M8M A;  4W9D A;  3DVN V;  2ADZ A;  1MK9 B;  2FCQ A;  1M7E A;  2WDT B;  3QK0 A;  2LVO A;  2QKL A;  1D3Z A;  3A4R A;  1T0Y A;  2RGN B;  1DYN A;  1E7U A;  3WYF B;  4HB3 B;  2PPH A;  3KW5 B;  2EMS A;  4KDL B;  1PFJ A;  4GMV A;  2J0K A;  5DI9 B;  3T8M A;  1WVH A;  4NAW A;  1LB1 A;  5KHO A;  4EMO A;  2EMT A;  2KHW B;  4ASW C;  1DDV A;  4MSQ B;  5HE0 A;  2FCS A;  2IO2 B;  4LCD E;  4P7I A;  2BWE S;  4WJQ A;  2DN6 A;  3D8D A;  1FGY A;  3ZVV A;  1KM7 A;  3F5R A;  3ZTC A;  3WAO A;  5GMV A;  5L83 A;  1Q1O A;  2IYB A;  2REX A;  4HPL B;  4HPM B;  2LGX A;  1E8Z A;  1YIW A;  3I3T B;  2XQN M;  2KWU B;  4JKG A;  4JLC A;  3B0A A;  3QIJ A;  3AU4 A;  1HBK A;  1U5G A;  2COF A;  2EKE C;  3VXW A;  1WJ1 A;  1UPR A;  2K8H A;  2BYF A;  2L05 A;  1C1Y B;  5CX3 A;  4JKC A;  2LGY A;  2LVQ A;  1WZ3 A;  4TQ1 A;  1P9D U;  5EFX A;  3ODW A;  3UIP B;  2DZK A;  1KBL A;  2RD0 A;  4C0A A;  4DBB A;  3MPX A;  2Z0P A;  5LXI B;  2D3G A;  1V89 A;  1X11 A;  4IM0 A;  2COC A;  1ST7 A;  3QBV B;  4GDK A;  2L00 B;  4A3O A;  3H7P A;  3HQC A;  3SD5 A;  2UWQ A;  2CKH B;  2JZZ A;  2COP A;  2KZR A;  3A1Q B;  4K1R B;  3DVN U;  4HAT B;  4RM9 A;  5JP4 A;  3R66 C;  3ONS A;  2C9W B;  4IAP A;  3DPD A;  2BWF A;  1TJ6 A;  2LZ6 A;  2V3S A;  3V5W A;  5FI1 A;  2J59 M;  2MDX A;  3M1I B;  3CF6 E;  1KJT A;  3NY5 A;  3DCG A;  4MM3 A;  3O65 B;  2ZJD A;  3TO1 A;  2LUL A;  1K5G B;  2AL3 A;  3U8Z A;  1WX8 A;  3DVG X;  1HB6 A;  1S3S G;  2BKF A;  1Y8R C;  5KQ4 A;  3B08 A;  4W9F A;  3RYT A;  2NBV B;  4EZL A;  2KOX A;  3ZIM A;  5EDS A;  2PEA A;  2YRY A;  1X1G A;  4GXB A;  2NBU A;  4FBJ B;  2LUE A;  3L0W B;  4K7U A;  1J8C A;  2LVP A;  3PHX B;  1KZG A;  2BKR B;  1MPH A;  2I5C A;  3ZVR A;  1TTN A;  3UIN B;  3BJI A;  3IHP C;  2DAF A;  4EJN A;  1WYW B;  3U7D A;  3TL5 A;  5D27 A;  5FR6 A;  4IFS A;  3O96 A;  1V6E A;  2M38 A;  2AEH A;  2NPT B;  1A5R A;  1XX0 A;  2FJL A;  1NDD A;  1V88 A;  5LLI A;  5J17 A;  5JVL A;  4K17 A;  2WX0 A;  1WXA A;  1QZE A;  2ABD A;  2KKC A;  2JWZ A;  4ILJ A;  1EUV B;  2AL6 A;  1WJU A;  4KIK B;  2N1W A;  2ROZ B;  1WF9 A;  4N9F 4;  1U5F A;  1RAX A;  2KTF A;  3AXC A;  3H7P B;  5IAA C;  4HVB A;  2GJY A;  3FLV A;  4HAV B;  1JRU A;  1OTR B;  2DAJ A;  3R7Q A;  4CHJ A;  2KLC A;  2GMI C;  5J3Q A;  2MP2 A;  2DYM A;  4A6F B;  3F0W A;  4K7W A;  2C7H A;  3NOB A;  4K7S A;  1W1G A;  5IA7 A;  3SO6 A;  3VUY A;  1WJN A;  4KHO A;  1GGO A;  1U5D A;  1WJM A;  2GBK A;  3EEC A;  4I6L B;  1XKE A;  3CXB B;  2DHK A;  2MFQ A;  1EF1 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  3ZRF A;  2K39 A;  3UZT A;  4WWO A;  4MSM B;  5KQ1 A;  4GDL A;  4MGI E;  2K2J A;  1BWN A;  2R2Q A;  2UYZ B;  1WE7 A;  2ELB A;  3VIA A;  1E5W A;  2V76 A;  3PP2 A;  1XT9 B;  2P0F A;  2KTR A;  2MBO A;  4I6N B;  1X1M A;  2DTC A;  4JK9 A;  4BOZ B;  2MBB B;  4BOS C;  2KUP A;  5DPW A;  2K25 A;  3D8E A;  2DIK A;  3V6E B;  1OQN A;  3QA8 A;  2G4D B;  4PNK A;  1QC6 A;  2MWN B;  4HB0 B;  3PT2 B;  2EC1 A;  1DDM A;  5DPT A;  1ZVR A;  3PRZ A;  4A6K A;  1RLF A;  2B3A A;  1EF5 A;  3ZNG C;  3VTW A;  5E6P A;  5DHA B;  4IOY X;  3APD A;  4GGQ A;  3A9K A;  4B9K A;  2C7M B;  1PQS A;  4JIO U;  4IWQ A;  1S1Q B;  1V81 A;  3GYO A;  4GIV A;  2D9Y A;  1DIK A;  2J0J A;  2XBB C;  2Y7B A;  1TGZ B;  3UQA A;  3OJ4 B;  2OQB A;  4OVU A;  4GZU A;  1WRD B;  4II2 B;  3TIX A;  4NAW B;  1SGH A;  4A6H A;  2DYB A;  1UNP A;  3TVV A;  5J3Y A;  2LJ5 A;  2Y5B B;  4NJ6 A;  4X57 B;  3QWM A;  3DDC B;  2MSE D;  2X0S A;  2CS4 A;  2DHZ A;  1WI1 A;  1LW3 A;  2CU1 A;  2LXA A;  3HW2 B;  3IG3 A;  3A98 B;  4JKG B;  1UH6 A;  4MH0 E;  5BO4 B;  2K00 A;  2KJR A;  1ZKH A;  3TFM A;  4G50 A;  1K8R B;  2O2V A;  3T06 A;  5JH5 C;  3M63 B;  2HE7 A;  3BY4 B;  2RR9 A;  2Y8G A;  2H7D A;  1VD2 A;  2FUH B;  4JK7 A;  4HB2 B;  1SHC A;  3IFW B;  3L13 A;  2WX1 A;  3L16 A;  2CQU A;  2KN5 A;  4WWP A;  2ROV A;  3L17 A;  1WE6 A;  4WAA A;  4F7U P;  3KUC B;  4IW0 A;  5TR5 A;  2NZ8 B;  2FID A;  3H1U A;  3HK0 A;  4MEL A;  2H7E A;  3KRX A;  3QHT A;  2NBW B;  3R7R A;  3PRP B;  1HE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...