2D11A

Crystal structure of the radixin ferm domain complexed with the nherf-2 c-terminal tail peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 83
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d11A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d11A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d11A01
1WE7A 2LGDA 5LLIA 4EOYA 1V88A 2A4ZA 4KZCA 2ABDA 2I1KA 2M38A 2COFA 1AARA 5FR6A 3UINB 2IY0B 3QHTA 2J0MA 4MT7A 2XQNM 4W9KA 1DDWA 1M94A 1P3QU 4MM3A 4EZKA 1V2YA 2PE6B 2BCJA 1RJ2A 3LJUX 1KM7A 2KC1A 3H7PB 4XC2A 3ZDMC 3ZKJC 4DHJD 3ZIMA 2KX0A 4FA6A 3B1LX 5D3WA 3OAWA 3QWZB 3QK0A 3VTVA 3X23A 4HB0B 1IPGA 1OTRB 1WX9A 1EAZA 1YX5B 1WGRA 2GBNA 3NHEB 4WJNA 1Z87A 1WF9A 1E8WA 1WRDB 4KHOA 4HCPB 5J18A 2IBIB 2KX3A 5GMVA 2BYVE 3QARA 3FLVA 5FI1A 2RQ1A 2D11A 3A4SC 2O2VB 2YS3A 2N9PC 1H8CA 2QKMA 3OJ4B 4GDLB 2UZSA 4W9CA 2BYFA 4CYEA 3OANA 2LJ5A 2AL3A 2Y8GA 2BF8B 3L13A 3EECA 2CY4A 3HK0A 2Z0PA 3D8DA 4XWXA 1EUVB 1DDVA 4B6HA 3PP2A 2MX2A 3A9JB 2LWPA 4Y94A 2L0FA 4TQ0A 2W2XD 1PMSA 3PTFC 4BKTA 5DPTA 3WANA 1WXAA 4WJOA 2MWNB 4CHMA 1Y8RC 3A9KA 4TYZA 2B3AA 1XR0B 1WJMA 2FUHB 2LD9A 3TW1A 2IZVB 3GYOA 3CSTA 3U30A 2LBBA 5HE3A 1EGXA 1WGDA 5HE2A 4WSFA 2DN6A 2KJRA 2HD5B 2Z0DB 4WWOA 3VQIA 4HAYB 2MA9B 1SIFA 1N3HA 2J0KA 4ANVA 3VUYA 3UF8A 1Q5WB 2N7DA 5FI0A 2D2QA 4ANXA 4IWPA 3WYFB 5J3QA 3PSCA 2IFSA 2WDTB 3VHTC 2KC2A 3ZTDA 3ONSA 5IA7A 2KTRB 2IO0B 2LGXA 4KSLC 4WJQA 4GZUA 4FJVB 3MPXA 4F7ZA 2KHWB 2KLGA 5KQ4A 3OLMD 5C23A 3N7CA 4HAUB 1YJ1A 2O6VA 2CS4A 2DKQA 3ML9A 4G3XB 5CHVC 5KHQA 3NS8A 2BGFA 2KDIA 4W9LA 2VRWB 4BBKA 3WAMA 2CAYA 3JYUA 1V61A 4IOYX 2X18A 5LOPB 2MDXA 1U4AA 2MQJA 3KW5B 5JP4A 4EZLA 4HVBA 1UBIA 1ZSQA 3L16A 1GC7A 1H10A 3DOWA 5AEKB 4A5KA 2N23A 4NSWA 4WAAA 4XZ4A 4A6FA 5JHGA 2KJ6A 3AU5A 1V6EA 2ZCCA 1LW3A 1WJ4A 4FHKA 4G11A 3A1QB 1U5FA 1RAXA 3PV1A 4PS3A 1TQZA 2RGFA 4DHZB 1U27A 3A98B 4KHBB 4MDKE 5TR5A 1I42A 2JXXA 1X05A 1BTNA 2DYBA 2L76A 4F1SA 4ANUA 4W9HA 1TXDA 1GC6A 1WG7A 2KMAA 3LDZE 4GMVA 2IYBA 2JUOA 3ODOA 4WJ7A 2DAJA 3EPYA 2N7EA 3ML8A 4GDKA 4KV2A 2ZNVB 2R0DA 4MGIE 1P6SA 2JY6A 4GGQA 2ELBA 5LONB 3QA8A 1XKEA 4HB3B 2XK5B 2QHOA 3W1SC 2H7EA 1P5TA 2CHZA 5BO4B 2KTFA 5L83A 2JRIB 2LOXA 1X1MA 2IY1B 5GOWB 1OEYJ 4K81A 2M1MA 2NBWB 3QJZA 4MSMB 4A20A 3SUZA 2N4FA 4A3PA 1V81A 4TQ1A 3M63B 2CB8A 1ZKHA 2RGNB 4HAXB 3IHPC 1L7YA 3QQ8B 5KQ1A 2LYDA 4ICVA 2GJYA 1DROA 2MW5A 5CHFA 4HAZB 2M0XA 2REXA 4GIVA 2GCLA 2ROVA 2LRUA 2LVPA 3KYDD 1Z5SB 1UBQA 5DH9B 1QC6A 3VH4B 4JLCA 3DXDA 2NR2A 1K5DB 2OQBA 1WM3A 4K2PA 2K8HA 3S2AA 1MPHA 2Y8FA 1HB6A 2C7HA 4DBGA 4HK2A 4HWIB 4CHKA 4W9IA 4MY6A 4EKUA 4CO7A 2LI5A 1WMHB 3ZVVA 4NQKE 2KJHB 2GMIC 2KGXB 3PVWA 3EFUA 1MK7B 2V3SA 3A4RA 1VD2A 4ZRIA 4JGHB 2KD0A 3V60A 3VTWA 3ZW3A 2W2XC 4BKSD 4G0NB 1WGQA 5G55A 1V89A 1UNRA 3EC8A 2DTCA 2MBOA 1XODA 3PEGA 1ISNA 2ZZPB 3GOEA 3K9PB 4JL9A 3PG7A 4KVGB 2G3QB 3NZSA 2ZEQA 1M7EA 5CTRC 3FEHA 5D6JB 3NOBA 4GDKB 4KDIC 3SHQA 2L00B 3APDA 1LQBA 1U5GA 3DXCA 2J59M 4KHAA 2QKLA 2WX1A 3N32A 3K9OB 3PHXB 4FN2A 4KIKB 4FJZA 3APCA 1UEFA 3PVUA 1YX6B 4DXAB 1K8RB 2K2UA 1IRSA 2VKIA 1R4MI 4JQWC 2COCA 3UQAA 2JF5A 1SHCA 2HTHB 2ASQA 2D3GA 3BJIA 2BWES 4LCDE 3PZDA 3U7DA 3DQVA 3VUWA 1FAOA 5J2RA 3AJ4A 4IFSA 2AWTA 2WYQA 1OQNA 2LG1A 1RFAA 2R2OA 2L1CA 2KKCA 2LUEA 4A6FB 3GZNI 4PNKA 2N9EB 4MGYE 3MDBC 4PS8A 3F0WA 3ZTCA 5L81A 1Z2MA 2R09A 3RZWC 5JZEB 1I2HA 2L2IA 5D3YA 1XX0A 4FBJB 1KLVA 1V9JA 2KDFB 1LXDA 2HE7A 2FIDA 2H7DA 3W1SA 2PJHA 2GBMA 2GCJA 1ACAA 2IO2B 2LVQA 2RR9A 3L08A 2D4QA 1TBEA 3MJWA 3Q3FA 5D3VA 1NDDA 2O6VB 4NY0A 3ZUNA 4DHZE 3ZNHB 2I5CA 2IO1B 2ZVNA 4A6HA 1U2BA 3DBSA 3M3JA 4OVUA 1WXSA 3KSYA 3X0WA 5C6RA 3TO1A 2YT0A 1EF1A 1DYNA 2KANA 2KTRA 1PFJA 1X86A 4WVFB 3B08A 4MH0E 2K2JA 3RZFA 3ECIA 5KHOA 2MWSB 1EF5A 4A6KA 4E3CA 4F7UP 4AOFA 2UWQA 4LJPB 2LOZA 4TUUA 2KMCA 1WM2A 4PYZA 5D2MB 4AUQC 1ZC3B 2CHWA 2KWCA 4CHJA 2M4NA 3D8EA 2MP2B 3JSVB 3JW0X 3KH0A 3V6EB 4DWFA 3A9KB 4F8CB 2N0YA 3LJ3A 5EFXA 3BINA 4RM9A 2KN5A 3PHWB 3PRZA 1J0GA 2L7RA 3P6AA 2YLMA 3DBRI 2EMSA 1WX7A 4IWQA 3TIXA 1F9JA 3A9JA 4JIOU 4KZ0A 5DPRA 5L95C 1RRBA 3ZLZA 4HB2B 1GJZA 2DX1A 2Z0EB 1XQQA 3RUIB 2KFJA 3VVWB 5J3TA 1UPQA 2JWZA 4MJSB 2YVCA 3ML4A 3PLVA 1Y19B 2KQSA 1BAKA 2FCQA 2LASA 2M8SA 2XEWA 2JVCA 4MJSA 4XX5A 2K6QA 1WZ0A 2NMBA 2WWZA 3VH3B 3HIZA 1K5GB 3D8FA 5C1ZA 2WX0A 2KUPA 1WXMA 3PPAA 4E74A 2UYZB 2CRFA 3RYTA 3MHSD 3H1UA 4WWNA 4AWJA 4IC7B 3JVZX 5AZHA 5J17A 3F5RA 1J8CA 3PRPB 4GPTB 3SD5A 3DVNV 5DHFB 3AI5A 3DBHI 2MP2A 2KXJA 3JSVA 4FLHA 2RD0A 3H7PA 1E5WA 3FSSA 4GN1A 2DENB 2MRPA 3N3KB 3L54A 3SNHA 4M0WB 2DA0A 2DZMA 2C7MB 5J3YA 1WH3A 2PEAA 3L17A 4X57B 2FAZA 2OJRA 3DPDA 2FJ9A 5JH5C 1KJTA 3TL5A 1C1YB 3KUDB 3UZTA 1WI0A 2KWUB 4NJ7A 1KZGA 2D9XA 5CLLB 3RD2A 3TJPA 2HJ8A 4A3OA 1OEYA 2P0HA 1V5UA 2BPSA 4FHJA 2MLBA 4FULA 2COAA 2YRYA 4BKSA 3EHVA 4K1RB 3ZNGC 1WR6E 2K8CA 1QQGA 2DHIA 3NZUA 2DZJA 1V5OA 3R7QA 3H6NA 4IM0A 3DVNU 4EMOA 2Y7BA 1WIAA 3CXBB 3PS6A 4TV3A 3V62A 4F7HA 1NBFC 2DAFA 1TTNA 4N9F4 1OGWA 4BBNF 2NPTA 4J6IA 3T9LA 1NVLA 4PS7A 1WJNA 3T8MA 4IAPA 1SE9A 5C5BA 1MG8A 2BKRB 1PQSA 2G4SA 5DPSA 4Z2MB 3ZNID 2HTHA 3HQCA 3AULA 3H9DA 4KIKA 4MGZE 1MIZB 2RLOA 4HLEA 5IJMA 1V5PA 2LVOA 1WJ6A 2DHZA 2ZJDA 3O65B 4B95A 1SGHA 2C60A 2KFKA 3G9WA 1MK9B 1U5EA 2DYNA 3B0AA 2D9YA 3DVGX 4MK0A 3OJ3A 1WYWB 2HRJA 1HE8A 1E8ZA 4Z2NA 2RUKB 2GBKA 3MTNB 3N30A 3ALBA 4G50A 4BBNC 2P8VA 4DBBA 1FXTB 2DX5B 2GBRA 4RM8A 5C16A 3PT2B 5CX3A 2BWFA 1BWNA 4HJKA 5HKHA 3QAQA 4RMAA 2VRRB 2BYEA 4GOCA 3UIOB 5DIFB 1WMHA 1MAIA 3RCPA 4I6PA 2LXCA 4W9JA 4L6EA 1NTVA 4DK5A 4AP4C 2NS5A 4I6NB 4II3B 2KDEB 3V6CB 1X11A 1DBHA 3BY4B 3KUZA 5E6PA 4DX8A 4EJNA 2D9ZA 4MEMA 4DDID 2DHKA 4BFRA 3VUXA 3ZRFA 3O96A 5CLQB 1WGUA 2MBHA 3W1YA 4AJYB 4K17A 4MSQB 2UZRA 1XT9B 4B6WA 3UQBA 3VFKA 3DXEA 3IFWB 4EZJA 3WALA 4BOZB 4M8NA 2BKFA 2CR5A 2K00A 3QX1A 2RSGA 3ODWA 1CMXB 1WXVA 4ASWC 3SO6A 1UD7A 1YQBA 4KDLB 4MGKE 1ZVRA 2RNRB 4K2OA 1S3SG 1XD3B 1ZW7A 2MSED 4W9FA 5D94A 3SYXA 4ZYNA 2LZ6A 3WAOA 1HBKA 5LXHA 4B9KA 2LXAA 2NBUA 2XK5A 2ZPYA 5AZGA 4WWPA 4HPMB 2LRWA 2P0DA 1ST7A 1V5TA 3CF6E 3KRXA 4NJ6A 1FHXA 2JRHA 3KVFB 1Q67A 1WGGA 1TGZB 2FNJB 5DCNA 3FP5A 1IYFA 1U5DA 4DX90 2K25A 3ENEA 4NPNA 1S1QB 2JP2A 1WE6A 2ZNVC 3R66C 2ROZB 4HATB 3IBEA 1Y5OA 2DFKA 1ZGUB 2KLCA 3C0RB 3PSEB 2DKPA 5E6OA 1UPRA 2K1FA 1WZ3A 2FCMA 1H4RA 1T0YA 2V1YA 1P9DU 3A1QA 3A8PA 2V4LA 2EMTA 1E7UA 1L2NA 3M62B 1UELA 3ZNZB 3DDCB 2MBEA 5DI9B 3U8ZA 3R7RA 2KQ7A 2RVBB 3AXCA 4IUMB 3Q3JA 2UVMA 3L10B 4GB9A 4OVVA 5IAAC 2D9VA 3RULA 1WJ1A 2JT4B 2K6DB 2P0FA 3M1IB 3PGEA 2WH5A 4FJYA 3T06A 5DHAB 2JZ3B 4K7WA 1U29A 4GMXB 3VIAA 1I35A 1NTYA 3DVGY 2EJ8A 4ZRJA 1V80A 4P7IA 1AQCA 3KY9A 2FDQA 2YSZA 1PLSA 2MKRA 2YS5A 5JLJB 1FHOA 2DHJA 1GUAB 1UGMA 2L05A 2DYOA 4HCNB 3TBLD 4BVUC 1OMWA 4HB4B 5JHHA 4PYUA 5JHAA 2W9NA 2M17A 3TCAA 2KK8A 4K7UA 4BOSC 2KZRA 2KNBA 2RSUA 4PQ0A 3L0WB 3VXWA 2K8BA 4KSKC 1UNQA 1YIWA 2YS1A 1ZM0A 5KCVA 2ZCBA 1V86A 1E8XA 3APFA 1J0WA 1KOTA 4MELA 2LGYA 1UH6A 3UIPB 2AEHA 1Q1OA 2ZPNA 3QIJA 2MBBB 4ZRKA 3PLUA 4IG7B 4HDQA 1W1DA 3ZRCA 1GG3A 1RLFA 1WGYA 2I1JA 2JZZA 4H8SA 2FCNA 3AU4A 3DCGA 3HM6X 4GSWA 4GXBA 4HXDA 3V61A 1BT0A 1AWEA 2EC1A 4HHVA 2N1WA 4WQOB 1GNUA 2JPHA 4GDLA 4GU2A 4DDGD 1UNPA 4FADA 2O2VA 3TMPB 1NI2A 2NVUI 5E6NA 2V76A 5CHWA 5HE0A 3TFMA 2G35A 2E2XA 1LB1A 2L8JA 4ICUA 4W9GA 4DHJB 1BTKA 2FCSA 3D32A 3M95A 3PREA 1FOEA 1M7RA 2Z0OA 2D9WA 4TKNA 1QZEA 2L3ZA 4D0NB 2M14A 5C79A 1B55A 1FGYA 1JRUA 2ADZA 2KOXA 3KZ1A 3PRMB 4W9EA 1P3RA 2MCNB 1J19A 3WIMA 3RT3B 1WFYA 1P0RA 3PVLA 3I3TB 4NQLB 5AZFA 1WGHA 3SDLC 1RRPB 2MBQA 2I5FA 1OY2A 2Z0QA 1P1AA 1ZC4B 3A33B 1I7AA 2CU1A 5D7GA 3QBVB 4KAXB 2O6VD 4HAVB 1NU2A 2COPA 3ZDTA 4YONA 2N9XA 3HHMA 1IP9A 2R2QA 3FM8C 1R4NI 1WR1A 2W2WA 2VSZA 2Z59B 3SU8X 5LXIB 1EVHA 3VTUA 2K39A 2L0TA 2KDBA 2OOBB 3IG3A 3NY5A 2J0JA 2DLWA 3ZVRA 1V5MA 3QCAA 1MKEA 2Q13A 3P2BA 5JHBA 2J7QB 2IYDB 2C7NB 1WI1A 4NNJB 4W9DA 1XCGA 2FJLA 1WX8A 3DBLI 4K7SA 3IVFA 3VAWA 4NAWB 3R3MA 2N1VA 2LKOA 5EDSA 1Q0WB 2OTXA 4IM3A 2CKHB 1C3TA 2AL6A 2NCNA 1E90A 4WJPA 2ELAA 3CIKA 1MIXA 1WVHA 2DX5A 2IO3B 2GBJA 1FB8A 3WA0A 2CODA 4EEWA 4URKA 3HW2B 2LULA 2G4DB 1G6JA 1LM8B 2AYOB 1D3ZA 1WY8A 3QWMA 5D3XA 2PE9A 2KFKB 2G45B 3NSUA 3KRWA 3GYPA 3SV1A 2A5UA 4HDOA 4I6LB 1TZ1A 2DYMA 2CY5A 4LJOB 3ODXA 4LDTB 2XBBC 2GS0A 1P98A 4E71A 1W1HA 1X1GA 2NBVB 3H7SA 2CQUA 1EO6A 4F7GA 3TVVA 2D07B 1HB8A 3VOQA 1WJUA 2KVRA 2C5LC 2C9WB 4IM2A 3ULBA 4EFOA 4ZDVA 1A5RA 4EUTA 3V5WA 1KZ7A 5C5BB 1UZXB 2EKEC 3KUCB 4II2B 1TJ6A 3WAPA 5HE1A 2CHXA 2FIFA 4AJWA 2DZIA 4YL8A 2NPTB 3RCZA 5DPWA 3KYCD 1E8YA 1XD4A 2KWVB 2D10A 2YT1A 2DYQA 1KI1B 2PZ1A 1YD8U 2DZKA 2YF0A 4C0AA 5D27A 4IWOA 2Y5BB 4M8MA 4IW0A 2NZ8B 1X1FA 2MFQA 3P7ZA 2KO3A 3CMMB 4NAWA 1V49A 3VDZA 3ZO5B 4HAWB 4BKGA 2GOWA 4LDTD 5G2NA 2RPQA 1OQYA 2ZVOA 1W1GA 3A8QA 3ULCA 1LFDA 1DDMA 4ANWA 1FHWA 1NTIA 1FGZA 4HPLB 2PPHA 3UGBB 3HM3A 3CSFA 2KCJA 3QC8B 1VCBA 1E7VA
chains in the Genus database with same CATH superfamily
5C3JB 1WE7A 4EOYA 1V88A 1L4DB 4C7YA 4M01A 2XQNM 4W9KA 3RFZB 1M94A 4JK8A 2BCJA 3H7PB 2KC1A 4XC2A 3ZKJC 4GNKB 3Q3MC 4FA6A 3B1LX 1WX9A 3NHEB 1WGRA 1WRDB 4KHOA 2BYVE 3FLVA 5FI1A 2D11A 2QKMA 3OJ4B 1OQRA 1XXGA 4A8XC 3Q3NC 2Y8GA 4ZHPA 3EECA 4LNKA 3D8DA 2Z0PA 2MX2A 4Y94A 1WXAA 1UGJA 4WJOA 4YWGG 4CHMA 2VZKD 2WXLA 2CJOA 3ZQ4A 1HZ6A 2IZVB 2LBBA 1KLUD 1K51A 4RH6A 1SIFA 1Q5WB 2D2QA 4IWPA 3WYFB 2WDTB 5IA7A 2KC2A 3LB8C 3ZTDA 2KTRB 2R61A 4S0RA 3OLMD 1YJ1A 5KHQA 5CHVC 1CQVA 3NS8A 3WAMA 4BBKA 2R82A 2MDXA 1TY0A 3L16A 1ZSQA 4A5KA 4NSWA 4WAAA 4XZ4A 3AE6B 1V6EA 2ZCCA 4FHKA 4G11A 1U5FA 1RAXA 1WYGA 1U27A 5IKCM 1ZOYB 2JXXA 2DYBA 5JVLA 4F1SA 4YSYB 1GC6A 1E0ZA 3ODOA 2R0DA 4GGQA 1KH0A 4HB3B 3W1SC 5L83A 2KTFA 2LEKA 2NBWB 2IY1B 4A20A 4MSMB 4K81A 4A3PA 2N4FA 1P7FA 3IHPC 1L7YA 1SSNA 2MW5A 4HAZB 4ZYSA 3BYYB 2REXA 5TSSA 2GCLA 2LVPA 4C7ZA 3VH4B 1WM3A 4XWWA 1HB6A 2C7HA 5BMIA 1FMAD 5BYSA 4ARIA 4CHKA 4MY6A 4EKUA 1FEHA 3NRZA 1WMHB 4NQKE 2KJHB 3EFUA 2KGXB 4JGHB 2W2XC 4XDCA 4G0NB 1WGQA 2M0AA 1QOFA 3GOEA 4MH8A 4MACA 3PEGA 2G3QB 1UF0A 3AE1B 2ZKMX 3NZSA 1SB3C 1E6EB 4GDKB 4EE2A 2Y5CA 1LQBA 2N9LA 3K9OB 2RDBC 1TZOA 3GE3C 3PVUA 1IRSA 2COCA 2HTHB 1GGOA 4KHBA 1T6BX 2BWES 3VUWA 4LCDE 3AE4B 3U7DA 3DQVA 3HVDA 4LNIA 2LUEA 4A6FB 3TSSA 4MGYE 3MDBC 2PIAA 2R09A 4HKZE 2DNFA 1I2HA 5JZEB 2QJLA 1ACCA 1LXDA 2FIDA 3W1SA 1ENFA 2KDMA 2RR9A 3Q3FA 4OVZA 4DHZE 2INPE 2V3NA 4OVUA 1U2BA 2Y3AA 3M3JA 2KT7A 5D3IB 5C6RA 3TO1A 2KANA 4MH0E 2J52A 4DIXA 2N0SB 3RZFA 1T77A 2MWSB 4WIPA 4F7UP 4AOFA 4LJPB 2KWDA 4PYZA 3LJ3A 3PHWB 4ZRPA 1RRBA 3ZLZA 2MEKA 2KFJA 1UPQA 2JWZA 2KQSA 3VRAB 3GB1A 5HG2A 2WWZA 5FK9C 3VH3B 4HJGE 3D8FA 2WX0A 3PPAA 3W2DA 2QMTA 4E74A 3RYTA 5AUIA 3H1UA 4WWNA 4IC7B 1J8CA 3F5RA 2WXIA 5DHFB 2OHFA 3DVNV 4FLHA 2KXJA 3E9SA 1UWMA 2K49A 5HHDG 2C7MB 5J3YA 3AECB 1KJTA 3TL5A 3KUDB 2KWUB 4NJ7A 2QSDA 2HJ8A 3DBLB 1VZ7A 4A3OA 4FULA 2COAA 2YRYA 1WGKA 1WR6E 2GRIA 3CXBB 3MFGA 4RGTA 3T9LA 4IAPA 3NJTA 1FO4A 4NAMA 3HQCA 4N6EB 2NBVA 2DIKA 1ZXIA 1V5PA 2DHZA 2D9YA 4MK0A 1WYWB 3MTNB 2RUKB 3U4EG 1J7BA 3ALBA 4DBBA 1FXTB 2GBRA 5C16A 1I4GA 4HJKA 1BWNA 2KN4A 5HKHA 3C8YA 4GOCA 4Q2JA 3BK1A 1MAIA 2QEJC 3AEAB 4L6EA 4RF0A 3I5JC 2KDEB 3V6CB 4JPSA 1X11A 1DBHA 3KUZA 5E6PA 4DDID 2Z59A 2DHKA 2GI9A 4HEA1 3W1YA 4OHJA 2UZRA 4EZJA 3IFWB 3WALA 2CR5A 2K00A 3QX1A 1YQBA 4B0MA 1ZW7A 2MSED 4ANWA 2KMMA 3WAOA 5EE0A 2YT2A 4A9AA 2LXAA 4OZAA 3EA6A 3OHMB 4HPMB 2WXMA 1FHXA 3FP5A 1E10A 3TMPB 3R66C 2ZNVC 4O1NA 1TIFA 3PSEB 2DKPA 3DHGC 1WZ3A 2FCMA 3A1QA 3A8PA 2V4LA 3Q69A 2EMTA 3AM9A 3M62B 3E9PA 3ZNZB 5DI9B 4YXDB 2MJ3A 1FRDA 3AXCA 2UVMA 3L10B 3Q8EA 5DHAB 4K7WA 1U29A 3VIAA 1I35A 1NTYA 1XEEA 3Q8CA 2MKRA 2FDQA 1PLSA 3KY9A 2YS5A 5JLJB 1T3QA 4RGOS 1UGMA 1D4BA 2DYOA 4HCNB 1OMWA 4HB4B 1DOYA 3TCAA 1L4ZB 2BYTA 2KZRA 2WGSA 3SBGA 2ZCBA 3AE3B 4JKDA 1NI3A 2LGYA 2ZPNA 4HDQA 2SAKA 3HIEA 1KLVA 4H8SA 4GSWA 2WXKA 3V61A 4WQOB 1GNUA 1IBXA 1QOBA 5E6NA 1ZDVA 4JK9A 3TFMA 2L8JA 1LB1A 2FCSA 1M7RA 2L3ZA 2MHJA 2X0SA 4C80A 5DPSA 3PRMB 1JRUA 3TEZA 1EWYC 1J19A 4RGMA 3RT3B 2J42A 1WGHA 2NMQA 2I38A 1OY2A 2JYTA 2O6VD 1PGAA 1NU2A 2COPA 4YONA 1I7HA 4K3BA 2PVOD 3SU8X 1MI1A 3AEGB 3N1YC 1C78A 1V5MA 3QCAA 1MKEA 2Q13A 2J7QB 1SF0A 1WI1A 1XCGA 3DBLI 1K50A 1WX8A 4K7SA 3VAWA 2JXTA 3ZJUA 2LKOA 1ZDXA 4QJ4B 4IM3A 2CKHB 2AL6A 4WJPA 2AQ2B 4EEWA 2GBJA 1FB8A 3WA0A 2CODA 1NYRA 2LHDA 1HXYD 2AYOB 3N9YC 1E7PB 1YN4A 3NSUA 4I6LB 3RI7C 1TZ1A 1T0SC 2DYMA 3ODXA 1MHHE 2XBBC 1X1GA 3N1ZC 4F7GA 2W82A 4XDDA 3BK2A 1UZXB 2EKEC 1C76A 2FIFA 4YL8A 5DPWA 1E8YA 1D5ZC 1XF5L 3Q6BA 3RN9C 3U2SC 4IWOA 4M8MA 2N7JA 3EGRA 2NZ8B 2MFQA 2KO3A 4KGRA 3R2IA 5AEKB 2GOWA 4ZRQA 5G2NA 1OQYA 1XLOA 3A8QA 1DDMA 3TEYA 1NTIA 3UGBB 2FUG1 3BIID 3CSFA 3QC8B 2AX5A 5H92C 4BKSD 3MC8A 3RNBC 2M38A 2I1KA 2COFA 2KIEA 3QHTA 1DDWA 4LLGM 1P3QU 4EZKA 1V2YA 3LJUX 1RJ2A 1KM7A 4DHJD 3ZIMA 5D3WA 3QK0A 3X23A 1IPGA 1OTRB 4WJNA 1WF9A 4HCPB 1E8WA 2IBIB 3NVVA 4WURA 1IBXB 2RQ1A 1JWMD 3A4SC 2YS3A 2WU2B 4GDLB 4W9CA 1HTQA 3P4RB 4CYEA 2BF8B 2HTME 1EUVB 3FAHA 1STEA 1DDVA 3A9JB 3PP2A 4TQ0A 2LWPA 1TKEA 2L52A 2W2XD 3PTFC 3WANA 2B3AA 1XR0B 2FUHB 2Z4DA 1RFKA 5HE2A 1ZE3D 4WWOA 2HD5B 3VQIA 1I4RA 2MA9B 1N3HA 4ANVA 2FJUB 3UF8A 2N7DA 4FADA 5LNK1 3PSCA 4OZCA 2QIEB 3MPXA 3AEFB 2KHWB 2KLGA 5KQ4A 2O6VA 2DKQA 4JWUC 4G3XB 3BVGA 1PDXA 1V61A 4IOYX 1U4AA 4EZLA 5BMHA 1F2RI 4A6FA 1PFDA 5JHGA 5T8IA 5MPOA 1LW3A 1WJ4A 3A1QB 3SEBA 4DHZB 4JX1C 4MDKE 4CSQA 3TUOA 4W9HA 1VLBA 3AMZA 4ARCA 1OQQA 5M4YB 4GMVA 4P16A 2JUOA 1D6EC 4MGIE 2JY6A 1F52A 2ELBA 3P42A 5IN7A 1XKEA 2QHOA 1P5TA 2CHZA 2HJ1A 2LOXA 1JRPA 1OEYJ 2M1MA 3QJZA 3IAS1 1ZKHA 2RGNB 3QQ8B 5CHFA 4L1RA 2M0XA 4GIVA 2LRUA 4ITKA 2NTSA 4D2KA 2BVCA 3B77A 1KLGD 4K2PA 2W3SA 1ESFA 1YJJA 2LGIA 5GXGB 4YTMB 4W9IA 3ZJTA 2LI5A 2PLPA 3SFEB 2GMIC 3PVWA 1MK7B 3A4RA 3VTWA 3ZW3A 4ZRIA 2INDC 1XCTL 2MBOA 3K9PB 1XODA 5DPTA 1ISNA 5J17A 4TMAB 1YJIA 2J59M 4KHAA 3N32A 2WX1A 3APCA 1UEFA 1YX6B 4DXAB 1K8RB 2VKIA 1R4MI 5I4DA 3UQAA 3O13A 3BJIA 3PZDA 2IGGA 1FAOA 1V1OA 1OQNA 1QKZA 1RFAA 4ILHA 1ZYIA 2R2OA 3SBTA 2N9EB 4PS8A 3F0WA 5L81A 2KDFB 2HE7A 4CQNA 2LVQA 1L5PA 1UUPA 1NDDA 4C4VB 4A6HA 3WCQA 1WXSA 3KSYA 2DLBA 3ENBA 1KF6B 1EF1A 1J7AA 1PFJA 4WVFB 1K52A 3EFCA 2K2JA 2D3AA 2IDYA 1EF5A 4A6KA 1JWBD 4TUUA 5H8YE 3V6EB 2MP2B 3JSVB 3GS2A 3P4QB 4RM9A 2KN5A 4S17A 3P6AA 2YLMA 1N63A 3DBRI 4IWQA 3TIXA 4KZ0A 1KC7A 4HB2B 3FVCA 4HPPA 4N59A 5J3TA 2LMCA 3VVWB 1NENB 3AEBB 2YVCA 3PLVA 4JQWC 1Y19B 2M8SA 2XEWA 4XX5A 1XO3A 2K6QA 1WZ0A 1K5GB 5C1ZA 3I9V1 1N60A 1F0ZA 2UYZB 2WXPA 4DXFA 5AZHA 1QF6A 3PRPB 3H7PA 1E5WA 3I63C 2DENB 2DA0A 4LNOA 2PEAA 4X57B 2FAZA 3DPDA 4OSNA 2FJ9A 5JH5C 5I2SA 4KKIA 3UZTA 2OJWA 2D9XA 5CLLB 3RD2A 4J3OD 4FHJA 1V5UA 2MLBA 1IGDA 1FPYA 2QDFA 1XLQA 4DQOC 3H6NA 4IM0A 4TV3A 3PS6A 1NBFC 4BBNF 2X38A 4PS7A 2BKRB 5C5BA 1MG8A 2LUMA 1PQSA 3BYTB 4Z2MB 1I4QA 1TYGB 4UDUC 3DBHB 4MGZE 4HLEA 4KIKA 2ZJDA 1U5EA 1MK9B 3B0AA 3DVGX 3OJ3A 3NZUA 1E8ZA 1F2RC 3LXFA 3NVZA 4G50A 4BBNC 2P8VA 1I4XA 2CU3A 3AH7A 2DX5B 5CX3A 4HKQA 4RMAA 1N6ZA 3DHIC 2BYEA 4HSIA 4W9JA 1NTVA 1R7SA 4DK5A 2WXOA 2NS5A 4I6NB 2BBCA 4ILGB 4EJNA 2LJIA 4P1BC 3DHHC 3ZRFA 1E9MA 1FFVA 4K17A 4B6WA 3UQBA 3DXEA 3U52E 4AS1A 1CMXB 1WXVA 2JYEA 1UD7A 5LLIA 3V62A 2RNRB 4K2OA 1S3SG 3SYXA 3ZYYX 3PO0A 5IOIA 1TS2A 4B9KA 1SEBD 2NBUA 1C4AA 2P0DA 3HSAA 3KVFB 1Q67A 2FNJB 1AWDA 1IYFA 4DX90 3U12A 3ENEA 4NPNA 3IBEA 4HATB 1Y5OA 3CWIA 1ZGUB 2KLCA 2WXNA 1UPRA 2K1FA 1H4RA 1T0YA 2WNMA 1E7UA 3DDCB 2RVBB 2V4IB 3NG0A 2JWUA 2D9VA 3RULA 3HVZA 4FJYA 4QAYA 2JZ3B 2EJ8A 2ZW0A 1HEZE 4P7IA 1OEYA 1FHOA 1GUAB 4CO7A 2DHJA 4ZHOA 2BS3B 3L4PA 3MJ5A 1FD6A 3SFDB 1RYJA 2KK8A 4K7UA 4BOSC 4PK1A 4KGSA 2KNBA 3L0WB 1RWSA 1UNQA 1YIWA 3AEDB 1EU4A 2WDVB 3APFA 1UH6A 1DGJA 1TY2A 2AEHA 1Q1OA 1XCQL 4IG7B 1GG3A 2INNE 1RLFA 1F1HA 2I1JA 5JXVA 3AU4A 1N5XA 1AWEA 1UNPA 1NI2A 2NVUI 1V97A 2V76A 5CHWA 5HE0A 2E2XA 1MPEA 4ICUA 4W9GA 3PREA 2Z0OA 2D9WA 3Q8BA 4D0NB 2ADZA 2R2YA 1WFYA 3I3TB 4NQLB 2EKIA 5AZFA 3SDLC 2MBQA 2Z0QA 1VJKA 3A33B 1I7AA 5D7GA 2N9XA 1JWSD 2LGSA 4WWMA 2R2QA 3FM8C 1WR1A 1EVHA 2K39A 3IG3A 3MP9A 2PVGC 3NY5A 1GPXA 4ILJA 5JHBA 2IYDB 2C7NB 3HUIA 2K5PA 4NAWB 3AE5B 3NWFA 5EDSA 4AQ7A 4L2YA 2BQQA 2NCNA 1XLNA 3CIKA 1YQ3B 4WH4A 3RNEC 3IT4B 1GB4A 3HW2B 2G4DB 1G6JA 1D3ZA 2PE9A 2KFKB 2E3TA 3AV8A 3KRWA 4N58A 4B0EA 3AB5A 1JROA 2CY5A 4LJOB 4E71A 1P98A 2B76B 2CQUA 4HRSA 1HB8A 1WJUA 2KVRA 4ZDVA 4IM2A 2BTEA 1Y56A 3MHZA 1ZXHA 5C5BB 4A90A 5HE1A 2CHXA 1CK1A 1JCKB 1VZ6A 2NPTB 3RCZA 4REZA 2KWVB 2D10A 2DYQA 2YF0A 1QOGA 2LFIA 1X1FA 4NAWA 3B2FA 4HAWB 5BMGA 2RPQA 3P4SB 2K3UA 4RNAA 3J9CA 1FM0D 1YNTE 2PPHA 2JX5A 2JRHA 1TJEA 5IP4D 2WU5B 2A4ZA 4KZCA 1ET9A 1AARA 2IY0B 4MT7A 1YN5A 2PE6B 3ZDMC 1C77A 2KX0A 3QWZB 2KVZA 4HB0B 1EAZA 1YX5B 2EELA 5GMVA 2ACZB 2N9PC 1H8CA 1HTOA 2KUQA 2SEBD 3OANA 2LJ5A 2AL3A 3L13A 3ETRA 4XWXA 4B6HA 2YEPB 4BKTA 2D5GA 2MWNB 3A9KA 4TYZA 3VR9B 1WJMA 2IGDA 2LD9A 3GYOA 3U30A 5HE3A 1JQ4A 3DWGC 1TS3A 4HAYB 2J0KA 4ANXA 5J3QA 3FILB 3ONSA 2IO0B 4KSLC 4WJQA 4GZUA 4FJVB 4WAFA 5C23A 3N7CA 3ML9A 2CS4A 4C4VA 1MFWA 2BGFA 4W9LA 2VRWB 3DCXA 3JYUA 1AYFA 2MQJA 5JP4A 1GC7A 3DOWA 2K9XA 1PUTA 1MVKA 2KJ6A 4JKHA 2WXQA 1TQZA 2RGFA 1L6UA 1D5MC 2INCC 1DIKA 5EE3A 1I42A 1X05A 3VRBB 1TXDA 2KMAA 3LDZE 3ZXVA 3AE8B 4JKEA 1UNSA 2PW9A 2H89B 4WJ7A 2DAJA 5LONB 3QA8A 2Z13A 3IAM1 1JWAD 2XK5B 2H7EA 5GOWB 1DYQA 3IT6B 3B9JA 4JKBA 3SUZA 4OW0A 2BS2B 3M63B 2CB8A 1V1PB 1L0XB 5KQ1A 1SBBB 2GJYA 1DROA 4PT5A 5EE1A 2ROVA 1FNWA 2OEDA 3KYDD 4LK0M 5FKAC 1WRIA 1UBQA 5DH9B 1QC6A 2L32A 4JLCA 3DXDA 2NR2A 3LYYA 2OQBA 2GLSA 3S2AA 1NYQA 2K8HA 3OG5A 1MPHA 3ABVB 4L23A 3ZVVA 1J7CA 1ZUD2 3ZGZA 3V60A 5G55A 3EC8A 2DTCA 2ZZPB 4JL9A 1WXQA 3PG7A 2ZEQA 1M7EA 3FEHA 3SHQA 3APDA 4US8A 1FFUA 3ZJVA 3DXCA 2NTTA 2QKLA 3PHXB 3KWLA 4FN2A 4RCOA 4KIKB 4FJZA 2K2UA 2ASQA 2D3GA 5J2RA 3AJ4A 2WYQA 2LG1A 2WDRB 4XYCA 1Z2MA 2WXGA 2L2IA 1XX0A 4FBJB 2MH7A 1KTKA 2H7DA 3MC0B 2TSSA 1ACAA 2D3BA 2IO2B 2D4QA 5D3VA 2O6VB 3ZUNA 3DBSA 1IGCA 1DYNA 3HRDD 1X86A 3B08A 1FCLA 3ECIA 5KHOA 4LTUA 2D3CA 2LOZA 4M0WA 1HZ5A 1PYWD 1WM2A 4AUQC 1ZC3B 2M4NA 3JW0X 3NWAA 5BYRA 2N0YA 2RDGA 1YQ4B 3PRZA 2L7RA 2GUMA 5L95C 5DPRA 3A9JA 4JIOU 5LG4B 3N20C 1TKGA 2DX1A 1T0QC 1XQQA 3RUIB 4MJSB 2LHEA 1BAKA 2FCQA 2LASA 2JVCA 4USAA 1VZ8A 4LNFA 4GPTB 1ROEA 2L83A 3AI5A 3DBHI 2MP2A 3JSVA 3FSSA 1VDVA 4MM3B 3L54A 1N5WA 3L17A 3BZDB 1C1YB 1KZGA 1D5XC 2P0HA 3AE9B 4BKSA 3EHVA 3KQ4A 3C19A 1QQGA 2DHIA 1EM7A 4HROA 3R7QA 1ET6A 3DVNU 4EMOA 1WIAA 2ON8A 3RPFC 2FE8A 1TTNA 1WJNA 3T8MA 1L0YB 1T0RC 2G4SA 3RMKC 2WXFA 2WQYB 3GE8C 3H9DA 4P1CC 1MIZB 2RLOA 2UU7A 4YSZB 3O65B 1QLBB 4B95A 2H88B 3AE7B 1DOIA 1OFFA 2GBKA 2GB1A 2M19A 3PZ8A 4RM8A 2E6XA 3PT2B 1BUIC 2AQ3B 3UIOB 2FBWB 3RCPA 3PZ7A 2LXCA 4IDIA 4AP4C 2G9HD 2D9ZA 4MEMA 1Q10A 3VUXA 5CLQB 3P63A 4MSQB 3VFKA 1YN3A 2BKFA 2RSGA 3ODWA 3SO6A 4KDLB 4MGKE 5D94A 3BVZA 3DBRB 5LXHA 1HBKA 2ZPYA 4A6QA 5AZGA 4WWPA 1ST7A 1V5TA 3CF6E 4JKFA 1ZP0B 4M02A 2WHIA 2K8EA 2RRFA 1CJEA 2K25A 1S1QB 1WE6A 4YT0B 2DFKA 3C0RB 1L2NA 3GP7A 2MBEA 3U8ZA 4JKCA 3Q3JA 4GB9A 2K6DB 3M1IB 3PGEA 2WH5A 4KX6B 1VBHA 4KKJA 4ZRJA 1V80A 1AQCA 2L05A 4BVUC 5JHHA 2W9NA 1MI0A 2RSUA 4PQ0A 2W3RA 4GLSC 2YS1A 1ZM0A 5KCVA 1V86A 1E8XA 4QXAB 1J0WA 3BWUD 1KOTA 2JSVX 3DWMA 3QIJA 2MBBB 4ZRKA 3PLUA 1NVID 3TEXA 3ZRCA 2V9HA 2FCNA 3HM6X 2X8XX 4HHVA 1C4PA 2N1WA 4DDGD 2JPHA 4GDLA 4GU2A 2O2VA 2G35A 2CJNA 1A70A 3D32A 2WXHA 2KOXA 1B55A 4W9EA 3RNGC 2MCNB 4BFRA 3WIMA 2K0PA 1RRPB 3QBVB 3HHMA 4HAVB 2I2YA 2Z59B 2L0TA 4TSSA 2J0JA 3E66A 2DLWA 3ZVRA 1SE3A 3P2BA 4W9DA 4NNJB 4NJCA 3R8BA 2N1VA 1QT9A 2J53A 1BXTA 3IXSA 1C3TA 2PMVA 3FC4A 2WDQB 1WVHA 2IO3B 2WXRA 2G1EA 2WS3B 1YOVB 2BW2A 2RDHA 1WY8A 3QWMA 4JKGB 2A5UA 4HDOA 2GS0A 2NBVB 2HDEA 3TVVA 2D07B 1VR9A 4JKGA 2C5LC 2C9WB 1N61A 3ULBA 3P1MA 3ZXRA 1A5RA 3W5UB 3V5WA 3GZNB 1KZ7A 3KUCB 1DOXA 1XD4A 1MG4A 1YD8U 4C0AA 2Y5BB 4IW0A 2W55A 3P7ZA 4BKGA 3ZO5B 1V49A 2ZVOA 1W1GA 3R2TA 3ULCA 1LFDA 2YEPF 1FHWA 2VH2A 1FGZA 4HPLB 4QJ3B 3HM3A 2KCJA 1E7VA 2LGDA 2JZPA 2ABDA 3UINB 2QCZA 3RNFC 2J0MA 1TS5A 4MM3A 3OAWA 2XNAC 3VTVA 5I2MA 1FXIA 2GBNA 1SJED 1Z87A 5J18A 4C00A 2KX3A 4LNNA 3QARA 2BS4B 2O2VB 2IJ0A 1P7EA 3Q8AA 2UZSA 2BYFA 3KWVA 2CY4A 3HK0A 3Q2AC 2L0FA 1PMSA 1Y8RC 3NWDA 3TW1A 3CSTA 1EGXA 1WGDA 4H2AA 4WSFA 2DN6A 2KJRA 2Z0DB 4OZBA 5C2TB 4XE0A 3VUYA 5FI0A 2JQRB 3VHTC 2IFSA 3AE2B 2LGXA 1N62A 1C79A 1QILA 4F7ZA 5FR3A 2PTLA 4GOUA 4HAUB 4ACFA 2KDIA 1TT5B 2CAYA 2BB5A 1WWTA 5LOPB 2Y5PA 2X18A 1C4CA 3KW5B 4HVBA 2MJEA 1UBIA 1H10A 2N23A 3AU5A 4L1BA 4PS3A 3PV1A 3AN1A 3A98B 4KHBB 5TR5A 1BTNA 2L76A 1JWUD 4ANUA 1GB1A 1WG7A 1SE2A 2IYBA 2KQ4X 2N7EA 3EPYA 3ML8A 4GDKA 4KV2A 2ZNVB 2W54A 1P6SA 1MJDA 4JKAA 2VH1A 5BO4B 2JRIB 1X1MA 1RM6C 1V81A 4HAXB 4ICVA 2LYDA 5G5GA 2RMMA 1Z5SB 3V05A 1K5DB 3U7ZA 4RGNA 4DBGA 2Y8FA 3I57A 1C9FA 4HK2A 4HWIB 3Q8FA 2V3SA 1VD2A 2KD0A 4YTNB 1V89A 1UNRA 2ICIA 4ZYNA 1JMLA 3KLSX 4KVGB 5CTRC 5D6JB 3NOBA 4KDIC 2L00B 1U5GA 2N9KA 3UI3A 1I4PA 2JF5A 1SHCA 4R3DA 1FNUA 4IFSA 2AWTA 3E9LA 1IUEA 1UWXA 2L1CA 2KKCA 3GZNI 4PNKA 1YMHE 3E56A 3ZTCA 3RZWC 5D3YA 1VBGA 1V9JA 3B2GA 3V3XA 2PJHA 2GBMA 2GCJA 3L08A 1TBEA 3MJWA 4NY0A 3ZNHB 2I5CA 2IO1B 2Q5WD 2ZVNA 4BAXA 3X0WA 2YT0A 2KTRA 3FILA 1V8CA 3NW8A 3N1XC 4E3CA 1CZPA 1JW9D 2UWQA 3URYA 2KMCA 4RFBA 5D2MB 4P6VF 2CHWA 2KWCA 4CHJA 3D8EA 4DWFA 3KH0A 1QQRA 4F8CB 3A9KB 2BT6A 2KAJA 1T5XD 5EFXA 3BINA 3TEWA 3BVMA 1ZPSA 1HA5A 1J0GA 2EMSA 1GOZA 1WX7A 3NS1A 1F9JA 1L0VB 1WSPA 2Z0EB 1GJZA 1TS4A 3ML4A 3CIRB 1L6VA 4MJSA 4ZOHC 5EE9A 1PGBA 2NMBA 1FXAA 3HIZA 3NUHB 2KUPA 2ZW1A 1WXMA 3MC9A 4KGTA 2CRFA 3MHSD 4AWJA 3JVZX 4YTPB 3SD5A 2BB6A 2IGHA 2RD0A 4GN1A 2MRPA 3N3KB 3SNHA 4M0WB 4WQMA 1MHXA 1SXTA 2DZMA 1WH3A 2OJRA 3FKYA 1EWCA 3RNCC 5HFYA 1VRAB 1WI0A 2VZKB 3TJPA 1FCCC 2BPSA 3E9OA 4K1RB 3ZNGC 4FXCA 2K8CA 2Z8LA 2DZJA 1V5OA 2L1AA 2Y7BA 4F7HA 3AEEB 2DAFA 2XN9C 1OGWA 4N9F4 2NPTA 4J6IA 1NVLA 1PGXA 1SE9A 3T3OA 1KRHA 3ZNID 2HTHA 2IPKD 4RF1A 3AULA 2J4XA 1AN8A 5IJMA 2LVOA 1WJ6A 4NZLB 1SGHA 1EU3A 2C60A 3G9WA 2DYNA 2KFKA 2M56B 2HRJA 1HE8A 4Z2NA 3N30A 5D3DA 3EUB2 2BWFA 1BMLC 2DBYA 3QAQA 2VRRB 1SE4A 5DIFB 1WMHA 2KIGA 1FRRA 2AQ1B 4I6PA 3H8HA 1I4HA 4II3B 1B1ZA 3BY4B 4DX8A 2QC8A 2Z14A 4XWTA 1HQRD 2K22A 3O96A 1WGUA 2MBHA 4AJYB 4DXGA 1XT9B 3SR6A 4BOZB 4M8NA 4ASWC 3Q14C 1V1PA 1JALA 1ZVRA 1XD3B 5BYQA 4W9FA 2LZ6A 1LGRA 1R4MB 2XK5A 4XGAB 2LRWA 5AUKA 3KRXA 4NJ6A 1WGGA 1TGZB 4JWSC 5DCNA 1U5DA 5IO9A 2JP2A 2ROZB 5E6OA 3VR8B 2V1YA 1P9DU 4IKGA 1UELA 3T3NA 3R7RA 2WXJA 2KQ7A 4IUMB 4OT1A 5IAAC 4OVVA 1WJ1A 2JT4B 2P0FA 1NEKB 4IOIE 3W5VB 3T06A 1XLPA 4GMXB 5IRSA 3NVYA 3DVGY 2KYWA 2YSZA 3TBLD 4PYUA 3P4PB 5JHAA 3NZ3A 2ONQA 2M17A 3OWEB 3VXWA 2K8BA 4KSKC 3Q3OC 3W9CB 4MELA 3UIPB 4C56C 1W1DA 1WGYA 2JZZA 3DCGA 4HXDA 4GXBA 1KFYB 1BT0A 4QJ5B 2EC1A 4JE3B 1FIQA 4JK7A 2V3PA 1R4NB 3RNAC 1BTKA 4DHJB 3M95A 4TKNA 1FOEA 1QZEA 2M14A 5C79A 1FGYA 5E6JA 3KZ1A 1P3RA 1JDEA 1P0RA 3PVLA 4M00A 2I5FA 1P1AA 2V0GA 1ZC4B 1K53A 2CU1A 1SIJA 5G5HA 4KAXB 3ZDTA 1IP9A 2KACA 1R4NI 4K3CA 1F77A 2W2WA 2VSZA 1TKYA 5LXIB 2RPVA 4BZAA 3VTUA 3A58A 3NVWA 2KDBA 2OOBB 4MT5A 1B9RA 5FR6A 2FJLA 3IVFA 3R3MA 4YSXB 2KR0A 1Q0WB 2WP9B 2WLBA 2OTXA 1FNVA 1M4VA 1E90A 2ELAA 1MIXA 2DX5A 4URKA 2JU6X 2LULA 2QILA 1LM8B 5D3XA 2G45B 3GYPA 3SV1A 1SJHD 2PKOA 4LDTB 1LO5D 1W1HA 3H7SA 1EO6A 4A55A 3VOQA 4D6WA 4EFOA 1GAQB 4EUTA 4II2B 3WAPA 5HI1A 4AJWA 1TJ6A 2DZIA 3KYCD 1QOAA 2YT1A 1KI1B 2PZ1A 2DZKA 4TQ1A 5D27A 3CMMB 2MJDA 3VDZA 2DWQA 4LDTD 1AW7A 4US9A 1KBLA 1VCBA
chains in the Genus database with same CATH topology
1WE7A 4EOYA 1V88A 2XQNM 4W9KA 1M94A 4JK8A 2BCJA 3H7PB 2KC1A 4XC2A 3ZKJC 4FA6A 3B1LX 1WX9A 3NHEB 1WGRA 1WRDB 4KHOA 2BYVE 3FLVA 5FI1A 2D11A 2QKMA 3OJ4B 2Y8GA 3EECA 3D8DA 2Z0PA 2MX2A 4Y94A 1WXAA 4WJOA 4CHMA 2IZVB 2LBBA 1SIFA 1Q5WB 2D2QA 4IWPA 3WYFB 2WDTB 5IA7A 2KC2A 3ZTDA 2KTRB 3OLMD 1YJ1A 5KHQA 5CHVC 3NS8A 3WAMA 4BBKA 2R82A 2MDXA 3L16A 1ZSQA 4A5KA 4NSWA 4WAAA 4XZ4A 1V6EA 2ZCCA 4FHKA 4G11A 1U5FA 1RAXA 1U27A 2JXXA 2DYBA 5JVLA 4F1SA 1GC6A 3ODOA 2R0DA 4GGQA 4HB3B 3W1SC 5L83A 2KTFA 2NBWB 2IY1B 4A20A 4MSMB 4K81A 4A3PA 2N4FA 3IHPC 1L7YA 2MW5A 4HAZB 2REXA 2GCLA 2LVPA 3VH4B 1WM3A 1HB6A 2C7HA 4CHKA 4MY6A 4EKUA 1WMHB 4NQKE 2KJHB 3EFUA 2KGXB 4JGHB 2W2XC 4G0NB 1WGQA 3GOEA 3PEGA 2G3QB 3NZSA 4GDKB 1LQBA 3K9OB 3PVUA 1IRSA 2COCA 2HTHB 1GGOA 3VUWA 2BWES 4LCDE 3U7DA 3DQVA 2LUEA 4A6FB 4MGYE 3MDBC 2R09A 5JZEB 1I2HA 1LXDA 2FIDA 3W1SA 2RR9A 3Q3FA 4DHZE 4OVUA 1U2BA 3M3JA 5C6RA 3TO1A 2KANA 4MH0E 3RZFA 2MWSB 4F7UP 4AOFA 4LJPB 4PYZA 3LJ3A 3PHWB 1RRBA 3ZLZA 2KFJA 1UPQA 2JWZA 2KQSA 2WWZA 3VH3B 3D8FA 2WX0A 3PPAA 4E74A 3RYTA 3H1UA 4WWNA 4IC7B 1J8CA 3F5RA 3DVNV 5DHFB 4FLHA 2KXJA 2C7MB 5J3YA 1KJTA 3TL5A 3KUDB 2KWUB 4NJ7A 4A3OA 2HJ8A 4FULA 2COAA 2YRYA 1WR6E 3CXBB 3T9LA 4IAPA 3HQCA 2DIKA 1V5PA 2DHZA 2D9YA 4MK0A 1WYWB 3MTNB 2RUKB 3ALBA 4DBBA 1FXTB 2GBRA 5C16A 4HJKA 1BWNA 5HKHA 4GOCA 1MAIA 4L6EA 2KDEB 3V6CB 1X11A 1DBHA 3KUZA 5E6PA 4DDID 2DHKA 3W1YA 2UZRA 4EZJA 3IFWB 3WALA 2CR5A 2K00A 3QX1A 1YQBA 1ZW7A 2MSED 4ANWA 3WAOA 2LXAA 4HPMB 1FHXA 3FP5A 3TMPB 3R66C 2ZNVC 3PSEB 2DKPA 1WZ3A 2FCMA 3A1QA 3A8PA 2V4LA 2EMTA 3M62B 3E9PA 3ZNZB 5DI9B 3AXCA 2UVMA 3L10B 5DHAB 4K7WA 1U29A 3VIAA 1I35A 1NTYA 2MKRA 2FDQA 1PLSA 3KY9A 2YS5A 5JLJB 1UGMA 2DYOA 4HCNB 1OMWA 4HB4B 3TCAA 2KZRA 3SBGA 2ZCBA 4JKDA 2LGYA 2ZPNA 4HDQA 1KLVA 4H8SA 4GSWA 3V61A 4WQOB 1GNUA 5E6NA 4JK9A 3TFMA 2L8JA 1LB1A 2FCSA 1M7RA 2L3ZA 2X0SA 5DPSA 3PRMB 1JRUA 1J19A 3RT3B 1WGHA 1OY2A 2O6VD 1NU2A 2COPA 4YONA 3SU8X 1V5MA 3QCAA 1MKEA 2Q13A 2J7QB 1WI1A 1XCGA 3DBLI 1WX8A 4K7SA 3VAWA 2LKOA 4IM3A 2CKHB 2AL6A 4WJPA 4EEWA 2GBJA 1FB8A 3WA0A 2CODA 2AYOB 3NSUA 4I6LB 1TZ1A 2DYMA 3ODXA 2XBBC 1X1GA 4F7GA 1UZXB 2EKEC 2FIFA 4YL8A 5DPWA 1E8YA 4IWOA 4M8MA 2NZ8B 2MFQA 5AEKB 2KO3A 2GOWA 5G2NA 1OQYA 3A8QA 1DDMA 1NTIA 3UGBB 3CSFA 3QC8B 4BKSD 2M38A 2I1KA 2COFA 3QHTA 1DDWA 1P3QU 4EZKA 1V2YA 3LJUX 1RJ2A 1KM7A 4DHJD 3ZIMA 5D3WA 3QK0A 3X23A 1IPGA 1OTRB 4WJNA 1WF9A 4HCPB 1E8WA 2IBIB 2RQ1A 3A4SC 2YS3A 4GDLB 4W9CA 4CYEA 2BF8B 1EUVB 1DDVA 3A9JB 3PP2A 4TQ0A 2LWPA 2W2XD 3PTFC 3WANA 2B3AA 1XR0B 2FUHB 5HE2A 4WWOA 2HD5B 3VQIA 2MA9B 1N3HA 4ANVA 3UF8A 2N7DA 4FADA 3PSCA 3MPXA 2KHWB 2KLGA 5KQ4A 2O6VA 2DKQA 4G3XB 1V61A 4IOYX 1U4AA 4EZLA 4A6FA 5JHGA 1LW3A 1WJ4A 3A1QB 4DHZB 4MDKE 4W9HA 4GMVA 2JUOA 4MGIE 2JY6A 2ELBA 1XKEA 2QHOA 1P5TA 2CHZA 2LOXA 1OEYJ 2M1MA 3QJZA 1ZKHA 2RGNB 3QQ8B 5CHFA 2M0XA 4GIVA 2LRUA 4K2PA 4W9IA 2LI5A 2GMIC 3PVWA 1MK7B 3A4RA 3VTWA 3ZW3A 4ZRIA 3K9PB 5DPTA 2MBOA 1XODA 5J17A 1ISNA 2J59M 4KHAA 3N32A 2WX1A 3APCA 1UEFA 1YX6B 4DXAB 1K8RB 2VKIA 1R4MI 3UQAA 3BJIA 3PZDA 1FAOA 1OQNA 1RFAA 4ILHA 2R2OA 3SBTA 2N9EB 4PS8A 3F0WA 5L81A 2KDFB 2HE7A 2LVQA 1NDDA 4A6HA 1WXSA 3KSYA 3ENBA 1EF1A 1PFJA 4WVFB 2K2JA 1EF5A 4A6KA 4TUUA 3V6EB 2MP2B 3JSVB 4RM9A 2KN5A 3P6AA 2YLMA 3DBRI 4IWQA 3TIXA 4KZ0A 1KC7A 4HB2B 3VVWB 5J3TA 4JQWC 2YVCA 3PLVA 1Y19B 2M8SA 2XEWA 4XX5A 2K6QA 1WZ0A 1K5GB 5C1ZA 2UYZB 5AZHA 3PRPB 3H7PA 1E5WA 2DENB 2DA0A 2PEAA 4X57B 2FAZA 3DPDA 2FJ9A 5JH5C 3UZTA 2D9XA 5CLLB 3RD2A 4FHJA 1V5UA 2MLBA 3H6NA 4IM0A 4TV3A 3PS6A 1NBFC 4BBNF 4PS7A 2BKRB 5C5BA 1MG8A 1PQSA 4Z2MB 4MGZE 4HLEA 4KIKA 2ZJDA 1U5EA 1MK9B 3B0AA 3DVGX 3NZUA 3OJ3A 1E8ZA 4G50A 4BBNC 2P8VA 2DX5B 5CX3A 4RMAA 2BYEA 4W9JA 1NTVA 4DK5A 2NS5A 4I6NB 4ILGB 4EJNA 3ZRFA 4K17A 4B6WA 3UQBA 3DXEA 1CMXB 1WXVA 5LLIA 1UD7A 3V62A 2RNRB 4K2OA 1S3SG 3SYXA 4B9KA 2NBUA 2P0DA 3KVFB 1Q67A 2FNJB 1IYFA 4DX90 3ENEA 4NPNA 3IBEA 4HATB 1Y5OA 1ZGUB 2KLCA 1UPRA 2K1FA 1H4RA 1T0YA 1E7UA 3DDCB 2RVBB 2D9VA 3RULA 4FJYA 2JZ3B 2EJ8A 4P7IA 1OEYA 1FHOA 1GUAB 4CO7A 2DHJA 2KK8A 4K7UA 4BOSC 2KNBA 3L0WB 1UNQA 1YIWA 3APFA 1UH6A 2AEHA 1Q1OA 4IG7B 1GG3A 1RLFA 2I1JA 3AU4A 1AWEA 1UNPA 1NI2A 2NVUI 2V76A 5CHWA 5HE0A 2E2XA 4ICUA 4W9GA 3PREA 2Z0OA 2D9WA 4D0NB 2ADZA 1WFYA 3I3TB 4NQLB 5AZFA 3SDLC 2MBQA 2Z0QA 3A33B 1I7AA 5D7GA 2N9XA 2R2QA 3FM8C 1WR1A 1EVHA 2K39A 3IG3A 3NY5A 4ILJA 5JHBA 2IYDB 2C7NB 4NAWB 5EDSA 2NCNA 3CIKA 3HW2B 2G4DB 1G6JA 1D3ZA 2PE9A 2KFKB 3KRWA 2CY5A 4LJOB 4E71A 1P98A 2CQUA 1HB8A 1WJUA 2KVRA 4ZDVA 4IM2A 5C5BB 5HE1A 2CHXA 2NPTB 3RCZA 2KWVB 2D10A 2DYQA 2YF0A 1X1FA 4NAWA 4HAWB 2RPQA 2PPHA 2JRHA 2A4ZA 4KZCA 1AARA 2IY0B 4MT7A 2PE6B 3ZDMC 2KX0A 3QWZB 4HB0B 1EAZA 1YX5B 5GMVA 2N9PC 1H8CA 3OANA 2LJ5A 2AL3A 3L13A 4XWXA 4B6HA 4BKTA 2MWNB 3A9KA 4TYZA 1WJMA 2LD9A 3GYOA 3U30A 5HE3A 4HAYB 2J0KA 4ANXA 5J3QA 3ONSA 2IO0B 4KSLC 4WJQA 4GZUA 4FJVB 5C23A 3N7CA 3ML9A 2CS4A 2BGFA 4W9LA 2VRWB 3JYUA 2MQJA 5JP4A 1GC7A 3DOWA 2KJ6A 4JKHA 1TQZA 2RGFA 1DIKA 1I42A 1X05A 1TXDA 2KMAA 3LDZE 4JKEA 4WJ7A 2DAJA 5LONB 3QA8A 2XK5B 2H7EA 5GOWB 4JKBA 3SUZA 3M63B 2CB8A 5KQ1A 2GJYA 1DROA 2ROVA 3KYDD 1UBQA 5DH9B 1QC6A 4JLCA 3DXDA 2NR2A 2OQBA 3S2AA 2K8HA 1MPHA 3ZVVA 3V60A 5G55A 3EC8A 2DTCA 2ZZPB 4JL9A 3PG7A 2ZEQA 1M7EA 3FEHA 3SHQA 3APDA 3DXCA 2QKLA 3PHXB 4FN2A 4KIKB 4FJZA 2K2UA 2ASQA 2D3GA 5J2RA 3AJ4A 2WYQA 2LG1A 1Z2MA 2L2IA 1XX0A 4FBJB 2H7DA 1ACAA 2IO2B 2D4QA 5D3VA 2O6VB 3ZUNA 3DBSA 1DYNA 1X86A 3B08A 3ECIA 5KHOA 2LOZA 1WM2A 4AUQC 1ZC3B 2M4NA 3JW0X 2N0YA 3PRZA 2L7RA 5L95C 5DPRA 3A9JA 4JIOU 2DX1A 3RUIB 1XQQA 4MJSB 1BAKA 2FCQA 2LASA 2JVCA 4GPTB 3AI5A 3DBHI 2MP2A 3JSVA 3FSSA 3L54A 3L17A 1C1YB 1KZGA 2P0HA 4BKSA 3EHVA 1QQGA 2DHIA 3R7QA 3DVNU 4EMOA 1WIAA 1TTNA 1WJNA 3T8MA 2G4SA 3H9DA 1MIZB 2RLOA 3O65B 4B95A 2GBKA 4RM8A 3PT2B 3UIOB 3RCPA 2LXCA 4AP4C 2D9ZA 4MEMA 3VUXA 5CLQB 4MSQB 3VFKA 2BKFA 2RSGA 3ODWA 3SO6A 4KDLB 4MGKE 5D94A 5LXHA 1HBKA 2ZPYA 5AZGA 4WWPA 1ST7A 1V5TA 3CF6E 4JKFA 2K25A 1S1QB 1WE6A 2DFKA 3C0RB 1L2NA 2MBEA 3U8ZA 4JKCA 3Q3JA 4GB9A 2K6DB 3M1IB 3PGEA 2WH5A 1VBHA 4ZRJA 1V80A 1AQCA 2L05A 4BVUC 5JHHA 2W9NA 2RSUA 4PQ0A 2YS1A 1ZM0A 5KCVA 1V86A 1E8XA 1J0WA 1KOTA 3QIJA 2MBBB 4ZRKA 3PLUA 3ZRCA 2FCNA 3HM6X 4HHVA 2N1WA 4DDGD 2JPHA 4GDLA 4GU2A 2O2VA 2G35A 3D32A 2KOXA 1B55A 4W9EA 4BFRA 2MCNB 3WIMA 1RRPB 3QBVB 3HHMA 4HAVB 2Z59B 2L0TA 2J0JA 3E66A 2DLWA 3ZVRA 3P2BA 4W9DA 4NNJB 2N1VA 1C3TA 1WVHA 2IO3B 1WY8A 3QWMA 4JKGB 2A5UA 4HDOA 2GS0A 2NBVB 3TVVA 2D07B 4JKGA 2C5LC 2C9WB 1A5RA 3ULBA 3V5WA 1KZ7A 3KUCB 1XD4A 1YD8U 4C0AA 2Y5BB 4IW0A 3P7ZA 4BKGA 3ZO5B 1V49A 2ZVOA 1W1GA 3ULCA 1LFDA 1FHWA 1FGZA 4HPLB 3HM3A 2KCJA 1E7VA 2LGDA 2ABDA 3UINB 2J0MA 4MM3A 3OAWA 3VTVA 2GBNA 1Z87A 5J18A 2KX3A 3QARA 2O2VB 2UZSA 2BYFA 2CY4A 3HK0A 2L0FA 1PMSA 1Y8RC 3TW1A 3CSTA 1EGXA 1WGDA 4WSFA 2DN6A 2KJRA 2Z0DB 3VUYA 5FI0A 3VHTC 2IFSA 2LGXA 4F7ZA 4HAUB 2KDIA 2CAYA 5LOPB 2X18A 3KW5B 4HVBA 1UBIA 1H10A 2N23A 3AU5A 4PS3A 3PV1A 3A98B 4KHBB 5TR5A 1BTNA 2L76A 4ANUA 1WG7A 2IYBA 2N7EA 3EPYA 3ML8A 4GDKA 4KV2A 2ZNVB 1P6SA 4JKAA 5BO4B 2JRIB 1X1MA 1V81A 4HAXB 4ICVA 2LYDA 1Z5SB 1K5DB 4DBGA 2Y8FA 4HK2A 4HWIB 2V3SA 1VD2A 2KD0A 1V89A 1UNRA 4ZYNA 4KVGB 5CTRC 5D6JB 3NOBA 4KDIC 2L00B 1U5GA 2JF5A 1SHCA 4IFSA 2AWTA 3E9LA 2L1CA 2KKCA 3GZNI 4PNKA 3ZTCA 3RZWC 5D3YA 1VBGA 1V9JA 2PJHA 2GBMA 2GCJA 3L08A 1TBEA 3MJWA 4NY0A 3ZNHB 2I5CA 2IO1B 2ZVNA 3X0WA 2YT0A 2KTRA 4E3CA 2UWQA 2KMCA 5D2MB 2CHWA 2KWCA 4CHJA 3D8EA 4DWFA 3KH0A 4F8CB 3A9KB 5EFXA 3BINA 1J0GA 2EMSA 1WX7A 1F9JA 1GJZA 2Z0EB 3ML4A 4MJSA 2NMBA 3HIZA 2KUPA 1WXMA 2CRFA 3MHSD 4AWJA 3JVZX 3SD5A 2RD0A 4GN1A 2MRPA 3N3KB 3SNHA 4M0WB 2DZMA 1WH3A 2OJRA 1WI0A 3TJPA 2BPSA 3E9OA 4K1RB 3ZNGC 2K8CA 2DZJA 1V5OA 2Y7BA 4F7HA 2DAFA 4N9F4 1OGWA 2NPTA 4J6IA 1NVLA 1SE9A 3ZNID 2HTHA 3AULA 5IJMA 2LVOA 1WJ6A 1SGHA 2C60A 2KFKA 3G9WA 2DYNA 2HRJA 1HE8A 4Z2NA 3N30A 2BWFA 3QAQA 2VRRB 5DIFB 1WMHA 4I6PA 4II3B 3BY4B 4DX8A 3O96A 1WGUA 2MBHA 4AJYB 1XT9B 4BOZB 4M8NA 4ASWC 1ZVRA 1XD3B 4W9FA 2LZ6A 2XK5A 2LRWA 3KRXA 4NJ6A 1WGGA 1TGZB 5DCNA 1U5DA 2JP2A 2ROZB 5E6OA 2V1YA 1P9DU 1UELA 3R7RA 2KQ7A 4IUMB 5IAAC 4OVVA 1WJ1A 2JT4B 2P0FA 3T06A 4GMXB 3DVGY 2YSZA 3TBLD 4PYUA 5JHAA 2M17A 3VXWA 2K8BA 4KSKC 4MELA 3UIPB 1W1DA 1WGYA 2JZZA 3DCGA 4HXDA 4GXBA 1BT0A 2EC1A 4JK7A 4DHJB 1BTKA 3M95A 4TKNA 1FOEA 1QZEA 2M14A 5C79A 1FGYA 3KZ1A 1P3RA 1JDEA 1P0RA 3PVLA 2I5FA 1P1AA 1ZC4B 2CU1A 4KAXB 3ZDTA 1IP9A 1R4NI 2W2WA 2VSZA 5LXIB 3VTUA 2KDBA 2OOBB 5FR6A 2FJLA 3IVFA 3R3MA 1Q0WB 2OTXA 1E90A 2ELAA 1MIXA 2DX5A 4URKA 2LULA 1LM8B 5D3XA 2G45B 3GYPA 3SV1A 4LDTB 1W1HA 3H7SA 1EO6A 3VOQA 4EFOA 4EUTA 4II2B 3WAPA 4AJWA 1TJ6A 2DZIA 3KYCD 2YT1A 1KI1B 2PZ1A 2DZKA 4TQ1A 5D27A 3CMMB 3VDZA 4LDTD 1KBLA 1VCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE7 A;  2LGD A;  5LLI A;  4EOY A;  1V88 A;  2A4Z A;  4KZC A;  2ABD A;  2I1K A;  2M38 A;  2COF A;  1AAR A;  5FR6 A;  3UIN B;  2IY0 B;  3QHT A;  2J0M A;  4MT7 A;  2XQN M;  4W9K A;  1DDW A;  1M94 A;  1P3Q U;  4MM3 A;  4EZK A;  1V2Y A;  2PE6 B;  2BCJ A;  1RJ2 A;  3LJU X;  1KM7 A;  2KC1 A;  3H7P B;  4XC2 A;  3ZDM C;  3ZKJ C;  4DHJ D;  3ZIM A;  2KX0 A;  4FA6 A;  3B1L X;  5D3W A;  3OAW A;  3QWZ B;  3QK0 A;  3VTV A;  3X23 A;  4HB0 B;  1IPG A;  1OTR B;  1WX9 A;  1EAZ A;  1YX5 B;  1WGR A;  2GBN A;  3NHE B;  4WJN A;  1Z87 A;  1WF9 A;  1E8W A;  1WRD B;  4KHO A;  4HCP B;  5J18 A;  2IBI B;  2KX3 A;  5GMV A;  2BYV E;  3QAR A;  3FLV A;  5FI1 A;  2RQ1 A;  2D11 A;  3A4S C;  2O2V B;  2YS3 A;  2N9P C;  1H8C A;  2QKM A;  3OJ4 B;  4GDL B;  2UZS A;  4W9C A;  2BYF A;  4CYE A;  3OAN A;  2LJ5 A;  2AL3 A;  2Y8G A;  2BF8 B;  3L13 A;  3EEC A;  2CY4 A;  3HK0 A;  2Z0P A;  3D8D A;  4XWX A;  1EUV B;  1DDV A;  4B6H A;  3PP2 A;  2MX2 A;  3A9J B;  2LWP A;  4Y94 A;  2L0F A;  4TQ0 A;  2W2X D;  1PMS A;  3PTF C;  4BKT A;  5DPT A;  3WAN A;  1WXA A;  4WJO A;  2MWN B;  4CHM A;  1Y8R C;  3A9K A;  4TYZ A;  2B3A A;  1XR0 B;  1WJM A;  2FUH B;  2LD9 A;  3TW1 A;  2IZV B;  3GYO A;  3CST A;  3U30 A;  2LBB A;  5HE3 A;  1EGX A;  1WGD A;  5HE2 A;  4WSF A;  2DN6 A;  2KJR A;  2HD5 B;  2Z0D B;  4WWO A;  3VQI A;  4HAY B;  2MA9 B;  1SIF A;  1N3H A;  2J0K A;  4ANV A;  3VUY A;  3UF8 A;  1Q5W B;  2N7D A;  5FI0 A;  2D2Q A;  4ANX A;  4IWP A;  3WYF B;  5J3Q A;  3PSC A;  2IFS A;  2WDT B;  3VHT C;  2KC2 A;  3ZTD A;  3ONS A;  5IA7 A;  2KTR B;  2IO0 B;  2LGX A;  4KSL C;  4WJQ A;  4GZU A;  4FJV B;  3MPX A;  4F7Z A;  2KHW B;  2KLG A;  5KQ4 A;  3OLM D;  5C23 A;  3N7C A;  4HAU B;  1YJ1 A;  2O6V A;  2CS4 A;  2DKQ A;  3ML9 A;  4G3X B;  5CHV C;  5KHQ A;  3NS8 A;  2BGF A;  2KDI A;  4W9L A;  2VRW B;  4BBK A;  3WAM A;  2CAY A;  3JYU A;  1V61 A;  4IOY X;  2X18 A;  5LOP B;  2MDX A;  1U4A A;  2MQJ A;  3KW5 B;  5JP4 A;  4EZL A;  4HVB A;  1UBI A;  1ZSQ A;  3L16 A;  1GC7 A;  1H10 A;  3DOW A;  5AEK B;  4A5K A;  2N23 A;  4NSW A;  4WAA A;  4XZ4 A;  4A6F A;  5JHG A;  2KJ6 A;  3AU5 A;  1V6E A;  2ZCC A;  1LW3 A;  1WJ4 A;  4FHK A;  4G11 A;  3A1Q B;  1U5F A;  1RAX A;  3PV1 A;  4PS3 A;  1TQZ A;  2RGF A;  4DHZ B;  1U27 A;  3A98 B;  4KHB B;  4MDK E;  5TR5 A;  1I42 A;  2JXX A;  1X05 A;  1BTN A;  2DYB A;  2L76 A;  4F1S A;  4ANU A;  4W9H A;  1TXD A;  1GC6 A;  1WG7 A;  2KMA A;  3LDZ E;  4GMV A;  2IYB A;  2JUO A;  3ODO A;  4WJ7 A;  2DAJ A;  3EPY A;  2N7E A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  2R0D A;  4MGI E;  1P6S A;  2JY6 A;  4GGQ A;  2ELB A;  5LON B;  3QA8 A;  1XKE A;  4HB3 B;  2XK5 B;  2QHO A;  3W1S C;  2H7E A;  1P5T A;  2CHZ A;  5BO4 B;  2KTF A;  5L83 A;  2JRI B;  2LOX A;  1X1M A;  2IY1 B;  5GOW B;  1OEY J;  4K81 A;  2M1M A;  2NBW B;  3QJZ A;  4MSM B;  4A20 A;  3SUZ A;  2N4F A;  4A3P A;  1V81 A;  4TQ1 A;  3M63 B;  2CB8 A;  1ZKH A;  2RGN B;  4HAX B;  3IHP C;  1L7Y A;  3QQ8 B;  5KQ1 A;  2LYD A;  4ICV A;  2GJY A;  1DRO A;  2MW5 A;  5CHF A;  4HAZ B;  2M0X A;  2REX A;  4GIV A;  2GCL A;  2ROV A;  2LRU A;  2LVP A;  3KYD D;  1Z5S B;  1UBQ A;  5DH9 B;  1QC6 A;  3VH4 B;  4JLC A;  3DXD A;  2NR2 A;  1K5D B;  2OQB A;  1WM3 A;  4K2P A;  2K8H A;  3S2A A;  1MPH A;  2Y8F A;  1HB6 A;  2C7H A;  4DBG A;  4HK2 A;  4HWI B;  4CHK A;  4W9I A;  4MY6 A;  4EKU A;  4CO7 A;  2LI5 A;  1WMH B;  3ZVV A;  4NQK E;  2KJH B;  2GMI C;  2KGX B;  3PVW A;  3EFU A;  1MK7 B;  2V3S A;  3A4R A;  1VD2 A;  4ZRI A;  4JGH B;  2KD0 A;  3V60 A;  3VTW A;  3ZW3 A;  2W2X C;  4BKS D;  4G0N B;  1WGQ A;  5G55 A;  1V89 A;  1UNR A;  3EC8 A;  2DTC A;  2MBO A;  1XOD A;  3PEG A;  1ISN A;  2ZZP B;  3GOE A;  3K9P B;  4JL9 A;  3PG7 A;  4KVG B;  2G3Q B;  3NZS A;  2ZEQ A;  1M7E A;  5CTR C;  3FEH A;  5D6J B;  3NOB A;  4GDK B;  4KDI C;  3SHQ A;  2L00 B;  3APD A;  1LQB A;  1U5G A;  3DXC A;  2J59 M;  4KHA A;  2QKL A;  2WX1 A;  3N32 A;  3K9O B;  3PHX B;  4FN2 A;  4KIK B;  4FJZ A;  3APC A;  1UEF A;  3PVU A;  1YX6 B;  4DXA B;  1K8R B;  2K2U A;  1IRS A;  2VKI A;  1R4M I;  4JQW C;  2COC A;  3UQA A;  2JF5 A;  1SHC A;  2HTH B;  2ASQ A;  2D3G A;  3BJI A;  2BWE S;  4LCD E;  3PZD A;  3U7D A;  3DQV A;  3VUW A;  1FAO A;  5J2R A;  3AJ4 A;  4IFS A;  2AWT A;  2WYQ A;  1OQN A;  2LG1 A;  1RFA A;  2R2O A;  2L1C A;  2KKC A;  2LUE A;  4A6F B;  3GZN I;  4PNK A;  2N9E B;  4MGY E;  3MDB C;  4PS8 A;  3F0W A;  3ZTC A;  5L81 A;  1Z2M A;  2R09 A;  3RZW C;  5JZE B;  1I2H A;  2L2I A;  5D3Y A;  1XX0 A;  4FBJ B;  1KLV A;  1V9J A;  2KDF B;  1LXD A;  2HE7 A;  2FID A;  2H7D A;  3W1S A;  2PJH A;  2GBM A;  2GCJ A;  1ACA A;  2IO2 B;  2LVQ A;  2RR9 A;  3L08 A;  2D4Q A;  1TBE A;  3MJW A;  3Q3F A;  5D3V A;  1NDD A;  2O6V B;  4NY0 A;  3ZUN A;  4DHZ E;  3ZNH B;  2I5C A;  2IO1 B;  2ZVN A;  4A6H A;  1U2B A;  3DBS A;  3M3J A;  4OVU A;  1WXS A;  3KSY A;  3X0W A;  5C6R A;  3TO1 A;  2YT0 A;  1EF1 A;  1DYN A;  2KAN A;  2KTR A;  1PFJ A;  1X86 A;  4WVF B;  3B08 A;  4MH0 E;  2K2J A;  3RZF A;  3ECI A;  5KHO A;  2MWS B;  1EF5 A;  4A6K A;  4E3C A;  4F7U P;  4AOF A;  2UWQ A;  4LJP B;  2LOZ A;  4TUU A;  2KMC A;  1WM2 A;  4PYZ A;  5D2M B;  4AUQ C;  1ZC3 B;  2CHW A;  2KWC A;  4CHJ A;  2M4N A;  3D8E A;  2MP2 B;  3JSV B;  3JW0 X;  3KH0 A;  3V6E B;  4DWF A;  3A9K B;  4F8C B;  2N0Y A;  3LJ3 A;  5EFX A;  3BIN A;  4RM9 A;  2KN5 A;  3PHW B;  3PRZ A;  1J0G A;  2L7R A;  3P6A A;  2YLM A;  3DBR I;  2EMS A;  1WX7 A;  4IWQ A;  3TIX A;  1F9J A;  3A9J A;  4JIO U;  4KZ0 A;  5DPR A;  5L95 C;  1RRB A;  3ZLZ A;  4HB2 B;  1GJZ A;  2DX1 A;  2Z0E B;  1XQQ A;  3RUI B;  2KFJ A;  3VVW B;  5J3T A;  1UPQ A;  2JWZ A;  4MJS B;  2YVC A;  3ML4 A;  3PLV A;  1Y19 B;  2KQS A;  1BAK A;  2FCQ A;  2LAS A;  2M8S A;  2XEW A;  2JVC A;  4MJS A;  4XX5 A;  2K6Q A;  1WZ0 A;  2NMB A;  2WWZ A;  3VH3 B;  3HIZ A;  1K5G B;  3D8F A;  5C1Z A;  2WX0 A;  2KUP A;  1WXM A;  3PPA A;  4E74 A;  2UYZ B;  2CRF A;  3RYT A;  3MHS D;  3H1U A;  4WWN A;  4AWJ A;  4IC7 B;  3JVZ X;  5AZH A;  5J17 A;  3F5R A;  1J8C A;  3PRP B;  4GPT B;  3SD5 A;  3DVN V;  5DHF B;  3AI5 A;  3DBH I;  2MP2 A;  2KXJ A;  3JSV A;  4FLH A;  2RD0 A;  3H7P A;  1E5W A;  3FSS A;  4GN1 A;  2DEN B;  2MRP A;  3N3K B;  3L54 A;  3SNH A;  4M0W B;  2DA0 A;  2DZM A;  2C7M B;  5J3Y A;  1WH3 A;  2PEA A;  3L17 A;  4X57 B;  2FAZ A;  2OJR A;  3DPD A;  2FJ9 A;  5JH5 C;  1KJT A;  3TL5 A;  1C1Y B;  3KUD B;  3UZT A;  1WI0 A;  2KWU B;  4NJ7 A;  1KZG A;  2D9X A;  5CLL B;  3RD2 A;  3TJP A;  2HJ8 A;  4A3O A;  1OEY A;  2P0H A;  1V5U A;  2BPS A;  4FHJ A;  2MLB A;  4FUL A;  2COA A;  2YRY A;  4BKS A;  3EHV A;  4K1R B;  3ZNG C;  1WR6 E;  2K8C A;  1QQG A;  2DHI A;  3NZU A;  2DZJ A;  1V5O A;  3R7Q A;  3H6N A;  4IM0 A;  3DVN U;  4EMO A;  2Y7B A;  1WIA A;  3CXB B;  3PS6 A;  4TV3 A;  3V62 A;  4F7H A;  1NBF C;  2DAF A;  1TTN A;  4N9F 4;  1OGW A;  4BBN F;  2NPT A;  4J6I A;  3T9L A;  1NVL A;  4PS7 A;  1WJN A;  3T8M A;  4IAP A;  1SE9 A;  5C5B A;  1MG8 A;  2BKR B;  1PQS A;  2G4S A;  5DPS A;  4Z2M B;  3ZNI D;  2HTH A;  3HQC A;  3AUL A;  3H9D A;  4KIK A;  4MGZ E;  1MIZ B;  2RLO A;  4HLE A;  5IJM A;  1V5P A;  2LVO A;  1WJ6 A;  2DHZ A;  2ZJD A;  3O65 B;  4B95 A;  1SGH A;  2C60 A;  2KFK A;  3G9W A;  1MK9 B;  1U5E A;  2DYN A;  3B0A A;  2D9Y A;  3DVG X;  4MK0 A;  3OJ3 A;  1WYW B;  2HRJ A;  1HE8 A;  1E8Z A;  4Z2N A;  2RUK B;  2GBK A;  3MTN B;  3N30 A;  3ALB A;  4G50 A;  4BBN C;  2P8V A;  4DBB A;  1FXT B;  2DX5 B;  2GBR A;  4RM8 A;  5C16 A;  3PT2 B;  5CX3 A;  2BWF A;  1BWN A;  4HJK A;  5HKH A;  3QAQ A;  4RMA A;  2VRR B;  2BYE A;  4GOC A;  3UIO B;  5DIF B;  1WMH A;  1MAI A;  3RCP A;  4I6P A;  2LXC A;  4W9J A;  4L6E A;  1NTV A;  4DK5 A;  4AP4 C;  2NS5 A;  4I6N B;  4II3 B;  2KDE B;  3V6C B;  1X11 A;  1DBH A;  3BY4 B;  3KUZ A;  5E6P A;  4DX8 A;  4EJN A;  2D9Z A;  4MEM A;  4DDI D;  2DHK A;  4BFR A;  3VUX A;  3ZRF A;  3O96 A;  5CLQ B;  1WGU A;  2MBH A;  3W1Y A;  4AJY B;  4K17 A;  4MSQ B;  2UZR A;  1XT9 B;  4B6W A;  3UQB A;  3VFK A;  3DXE A;  3IFW B;  4EZJ A;  3WAL A;  4BOZ B;  4M8N A;  2BKF A;  2CR5 A;  2K00 A;  3QX1 A;  2RSG A;  3ODW A;  1CMX B;  1WXV A;  4ASW C;  3SO6 A;  1UD7 A;  1YQB A;  4KDL B;  4MGK E;  1ZVR A;  2RNR B;  4K2O A;  1S3S G;  1XD3 B;  1ZW7 A;  2MSE D;  4W9F A;  5D94 A;  3SYX A;  4ZYN A;  2LZ6 A;  3WAO A;  1HBK A;  5LXH A;  4B9K A;  2LXA A;  2NBU A;  2XK5 A;  2ZPY A;  5AZG A;  4WWP A;  4HPM B;  2LRW A;  2P0D A;  1ST7 A;  1V5T A;  3CF6 E;  3KRX A;  4NJ6 A;  1FHX A;  2JRH A;  3KVF B;  1Q67 A;  1WGG A;  1TGZ B;  2FNJ B;  5DCN A;  3FP5 A;  1IYF A;  1U5D A;  4DX9 0;  2K25 A;  3ENE A;  4NPN A;  1S1Q B;  2JP2 A;  1WE6 A;  2ZNV C;  3R66 C;  2ROZ B;  4HAT B;  3IBE A;  1Y5O A;  2DFK A;  1ZGU B;  2KLC A;  3C0R B;  3PSE B;  2DKP A;  5E6O A;  1UPR A;  2K1F A;  1WZ3 A;  2FCM A;  1H4R A;  1T0Y A;  2V1Y A;  1P9D U;  3A1Q A;  3A8P A;  2V4L A;  2EMT A;  1E7U A;  1L2N A;  3M62 B;  1UEL A;  3ZNZ B;  3DDC B;  2MBE A;  5DI9 B;  3U8Z A;  3R7R A;  2KQ7 A;  2RVB B;  3AXC A;  4IUM B;  3Q3J A;  2UVM A;  3L10 B;  4GB9 A;  4OVV A;  5IAA C;  2D9V A;  3RUL A;  1WJ1 A;  2JT4 B;  2K6D B;  2P0F A;  3M1I B;  3PGE A;  2WH5 A;  4FJY A;  3T06 A;  5DHA B;  2JZ3 B;  4K7W A;  1U29 A;  4GMX B;  3VIA A;  1I35 A;  1NTY A;  3DVG Y;  2EJ8 A;  4ZRJ A;  1V80 A;  4P7I A;  1AQC A;  3KY9 A;  2FDQ A;  2YSZ A;  1PLS A;  2MKR A;  2YS5 A;  5JLJ B;  1FHO A;  2DHJ A;  1GUA B;  1UGM A;  2L05 A;  2DYO A;  4HCN B;  3TBL D;  4BVU C;  1OMW A;  4HB4 B;  5JHH A;  4PYU A;  5JHA A;  2W9N A;  2M17 A;  3TCA A;  2KK8 A;  4K7U A;  4BOS C;  2KZR A;  2KNB A;  2RSU A;  4PQ0 A;  3L0W B;  3VXW A;  2K8B A;  4KSK C;  1UNQ A;  1YIW A;  2YS1 A;  1ZM0 A;  5KCV A;  2ZCB A;  1V86 A;  1E8X A;  3APF A;  1J0W A;  1KOT A;  4MEL A;  2LGY A;  1UH6 A;  3UIP B;  2AEH A;  1Q1O A;  2ZPN A;  3QIJ A;  2MBB B;  4ZRK A;  3PLU A;  4IG7 B;  4HDQ A;  1W1D A;  3ZRC A;  1GG3 A;  1RLF A;  1WGY A;  2I1J A;  2JZZ A;  4H8S A;  2FCN A;  3AU4 A;  3DCG A;  3HM6 X;  4GSW A;  4GXB A;  4HXD A;  3V61 A;  1BT0 A;  1AWE A;  2EC1 A;  4HHV A;  2N1W A;  4WQO B;  1GNU A;  2JPH A;  4GDL A;  4GU2 A;  4DDG D;  1UNP A;  4FAD A;  2O2V A;  3TMP B;  1NI2 A;  2NVU I;  5E6N A;  2V76 A;  5CHW A;  5HE0 A;  3TFM A;  2G35 A;  2E2X A;  1LB1 A;  2L8J A;  4ICU A;  4W9G A;  4DHJ B;  1BTK A;  2FCS A;  3D32 A;  3M95 A;  3PRE A;  1FOE A;  1M7R A;  2Z0O A;  2D9W A;  4TKN A;  1QZE A;  2L3Z A;  4D0N B;  2M14 A;  5C79 A;  1B55 A;  1FGY A;  1JRU A;  2ADZ A;  2KOX A;  3KZ1 A;  3PRM B;  4W9E A;  1P3R A;  2MCN B;  1J19 A;  3WIM A;  3RT3 B;  1WFY A;  1P0R A;  3PVL A;  3I3T B;  4NQL B;  5AZF A;  1WGH A;  3SDL C;  1RRP B;  2MBQ A;  2I5F A;  1OY2 A;  2Z0Q A;  1P1A A;  1ZC4 B;  3A33 B;  1I7A A;  2CU1 A;  5D7G A;  3QBV B;  4KAX B;  2O6V D;  4HAV B;  1NU2 A;  2COP A;  3ZDT A;  4YON A;  2N9X A;  3HHM A;  1IP9 A;  2R2Q A;  3FM8 C;  1R4N I;  1WR1 A;  2W2W A;  2VSZ A;  2Z59 B;  3SU8 X;  5LXI B;  1EVH A;  3VTU A;  2K39 A;  2L0T A;  2KDB A;  2OOB B;  3IG3 A;  3NY5 A;  2J0J A;  2DLW A;  3ZVR A;  1V5M A;  3QCA A;  1MKE A;  2Q13 A;  3P2B A;  5JHB A;  2J7Q B;  2IYD B;  2C7N B;  1WI1 A;  4NNJ B;  4W9D A;  1XCG A;  2FJL A;  1WX8 A;  3DBL I;  4K7S A;  3IVF A;  3VAW A;  4NAW B;  3R3M A;  2N1V A;  2LKO A;  5EDS A;  1Q0W B;  2OTX A;  4IM3 A;  2CKH B;  1C3T A;  2AL6 A;  2NCN A;  1E90 A;  4WJP A;  2ELA A;  3CIK A;  1MIX A;  1WVH A;  2DX5 A;  2IO3 B;  2GBJ A;  1FB8 A;  3WA0 A;  2COD A;  4EEW A;  4URK A;  3HW2 B;  2LUL A;  2G4D B;  1G6J A;  1LM8 B;  2AYO B;  1D3Z A;  1WY8 A;  3QWM A;  5D3X A;  2PE9 A;  2KFK B;  2G45 B;  3NSU A;  3KRW A;  3GYP A;  3SV1 A;  2A5U A;  4HDO A;  4I6L B;  1TZ1 A;  2DYM A;  2CY5 A;  4LJO B;  3ODX A;  4LDT B;  2XBB C;  2GS0 A;  1P98 A;  4E71 A;  1W1H A;  1X1G A;  2NBV B;  3H7S A;  2CQU A;  1EO6 A;  4F7G A;  3TVV A;  2D07 B;  1HB8 A;  3VOQ A;  1WJU A;  2KVR A;  2C5L C;  2C9W B;  4IM2 A;  3ULB A;  4EFO A;  4ZDV A;  1A5R A;  4EUT A;  3V5W A;  1KZ7 A;  5C5B B;  1UZX B;  2EKE C;  3KUC B;  4II2 B;  1TJ6 A;  3WAP A;  5HE1 A;  2CHX A;  2FIF A;  4AJW A;  2DZI A;  4YL8 A;  2NPT B;  3RCZ A;  5DPW A;  3KYC D;  1E8Y A;  1XD4 A;  2KWV B;  2D10 A;  2YT1 A;  2DYQ A;  1KI1 B;  2PZ1 A;  1YD8 U;  2DZK A;  2YF0 A;  4C0A A;  5D27 A;  4IWO A;  2Y5B B;  4M8M A;  4IW0 A;  2NZ8 B;  1X1F A;  2MFQ A;  3P7Z A;  2KO3 A;  3CMM B;  4NAW A;  1V49 A;  3VDZ A;  3ZO5 B;  4HAW B;  4BKG A;  2GOW A;  4LDT D;  5G2N A;  2RPQ A;  1OQY A;  2ZVO A;  1W1G A;  3A8Q A;  3ULC A;  1LFD A;  1DDM A;  4ANW A;  1FHW A;  1NTI A;  1FGZ A;  4HPL B;  2PPH A;  3UGB B;  3HM3 A;  3CSF A;  2KCJ A;  3QC8 B;  1VCB A;  1E7V A; 
#chains in the Genus database with same CATH topology
 5C3J B;  1WE7 A;  4EOY A;  1V88 A;  1L4D B;  4C7Y A;  4M01 A;  2XQN M;  4W9K A;  3RFZ B;  1M94 A;  4JK8 A;  2BCJ A;  3H7P B;  2KC1 A;  4XC2 A;  3ZKJ C;  4GNK B;  3Q3M C;  4FA6 A;  3B1L X;  1WX9 A;  3NHE B;  1WGR A;  1WRD B;  4KHO A;  2BYV E;  3FLV A;  5FI1 A;  2D11 A;  2QKM A;  3OJ4 B;  1OQR A;  1XXG A;  4A8X C;  3Q3N C;  2Y8G A;  4ZHP A;  3EEC A;  4LNK A;  3D8D A;  2Z0P A;  2MX2 A;  4Y94 A;  1WXA A;  1UGJ A;  4WJO A;  4YWG G;  4CHM A;  2VZK D;  2WXL A;  2CJO A;  3ZQ4 A;  1HZ6 A;  2IZV B;  2LBB A;  1KLU D;  1K51 A;  4RH6 A;  1SIF A;  1Q5W B;  2D2Q A;  4IWP A;  3WYF B;  2WDT B;  5IA7 A;  2KC2 A;  3LB8 C;  3ZTD A;  2KTR B;  2R61 A;  4S0R A;  3OLM D;  1YJ1 A;  5KHQ A;  5CHV C;  1CQV A;  3NS8 A;  3WAM A;  4BBK A;  2R82 A;  2MDX A;  1TY0 A;  3L16 A;  1ZSQ A;  4A5K A;  4NSW A;  4WAA A;  4XZ4 A;  3AE6 B;  1V6E A;  2ZCC A;  4FHK A;  4G11 A;  1U5F A;  1RAX A;  1WYG A;  1U27 A;  5IKC M;  1ZOY B;  2JXX A;  2DYB A;  5JVL A;  4F1S A;  4YSY B;  1GC6 A;  1E0Z A;  3ODO A;  2R0D A;  4GGQ A;  1KH0 A;  4HB3 B;  3W1S C;  5L83 A;  2KTF A;  2LEK A;  2NBW B;  2IY1 B;  4A20 A;  4MSM B;  4K81 A;  4A3P A;  2N4F A;  1P7F A;  3IHP C;  1L7Y A;  1SSN A;  2MW5 A;  4HAZ B;  4ZYS A;  3BYY B;  2REX A;  5TSS A;  2GCL A;  2LVP A;  4C7Z A;  3VH4 B;  1WM3 A;  4XWW A;  1HB6 A;  2C7H A;  5BMI A;  1FMA D;  5BYS A;  4ARI A;  4CHK A;  4MY6 A;  4EKU A;  1FEH A;  3NRZ A;  1WMH B;  4NQK E;  2KJH B;  3EFU A;  2KGX B;  4JGH B;  2W2X C;  4XDC A;  4G0N B;  1WGQ A;  2M0A A;  1QOF A;  3GOE A;  4MH8 A;  4MAC A;  3PEG A;  2G3Q B;  1UF0 A;  3AE1 B;  2ZKM X;  3NZS A;  1SB3 C;  1E6E B;  4GDK B;  4EE2 A;  2Y5C A;  1LQB A;  2N9L A;  3K9O B;  2RDB C;  1TZO A;  3GE3 C;  3PVU A;  1IRS A;  2COC A;  2HTH B;  1GGO A;  4KHB A;  1T6B X;  2BWE S;  3VUW A;  4LCD E;  3AE4 B;  3U7D A;  3DQV A;  3HVD A;  4LNI A;  2LUE A;  4A6F B;  3TSS A;  4MGY E;  3MDB C;  2PIA A;  2R09 A;  4HKZ E;  2DNF A;  1I2H A;  5JZE B;  2QJL A;  1ACC A;  1LXD A;  2FID A;  3W1S A;  1ENF A;  2KDM A;  2RR9 A;  3Q3F A;  4OVZ A;  4DHZ E;  2INP E;  2V3N A;  4OVU A;  1U2B A;  2Y3A A;  3M3J A;  2KT7 A;  5D3I B;  5C6R A;  3TO1 A;  2KAN A;  4MH0 E;  2J52 A;  4DIX A;  2N0S B;  3RZF A;  1T77 A;  2MWS B;  4WIP A;  4F7U P;  4AOF A;  4LJP B;  2KWD A;  4PYZ A;  3LJ3 A;  3PHW B;  4ZRP A;  1RRB A;  3ZLZ A;  2MEK A;  2KFJ A;  1UPQ A;  2JWZ A;  2KQS A;  3VRA B;  3GB1 A;  5HG2 A;  2WWZ A;  5FK9 C;  3VH3 B;  4HJG E;  3D8F A;  2WX0 A;  3PPA A;  3W2D A;  2QMT A;  4E74 A;  3RYT A;  5AUI A;  3H1U A;  4WWN A;  4IC7 B;  1J8C A;  3F5R A;  2WXI A;  5DHF B;  2OHF A;  3DVN V;  4FLH A;  2KXJ A;  3E9S A;  1UWM A;  2K49 A;  5HHD G;  2C7M B;  5J3Y A;  3AEC B;  1KJT A;  3TL5 A;  3KUD B;  2KWU B;  4NJ7 A;  2QSD A;  2HJ8 A;  3DBL B;  1VZ7 A;  4A3O A;  4FUL A;  2COA A;  2YRY A;  1WGK A;  1WR6 E;  2GRI A;  3CXB B;  3MFG A;  4RGT A;  3T9L A;  4IAP A;  3NJT A;  1FO4 A;  4NAM A;  3HQC A;  4N6E B;  2NBV A;  2DIK A;  1ZXI A;  1V5P A;  2DHZ A;  2D9Y A;  4MK0 A;  1WYW B;  3MTN B;  2RUK B;  3U4E G;  1J7B A;  3ALB A;  4DBB A;  1FXT B;  2GBR A;  5C16 A;  1I4G A;  4HJK A;  1BWN A;  2KN4 A;  5HKH A;  3C8Y A;  4GOC A;  4Q2J A;  3BK1 A;  1MAI A;  2QEJ C;  3AEA B;  4L6E A;  4RF0 A;  3I5J C;  2KDE B;  3V6C B;  4JPS A;  1X11 A;  1DBH A;  3KUZ A;  5E6P A;  4DDI D;  2Z59 A;  2DHK A;  2GI9 A;  4HEA 1;  3W1Y A;  4OHJ A;  2UZR A;  4EZJ A;  3IFW B;  3WAL A;  2CR5 A;  2K00 A;  3QX1 A;  1YQB A;  4B0M A;  1ZW7 A;  2MSE D;  4ANW A;  2KMM A;  3WAO A;  5EE0 A;  2YT2 A;  4A9A A;  2LXA A;  4OZA A;  3EA6 A;  3OHM B;  4HPM B;  2WXM A;  1FHX A;  3FP5 A;  1E10 A;  3TMP B;  3R66 C;  2ZNV C;  4O1N A;  1TIF A;  3PSE B;  2DKP A;  3DHG C;  1WZ3 A;  2FCM A;  3A1Q A;  3A8P A;  2V4L A;  3Q69 A;  2EMT A;  3AM9 A;  3M62 B;  3E9P A;  3ZNZ B;  5DI9 B;  4YXD B;  2MJ3 A;  1FRD A;  3AXC A;  2UVM A;  3L10 B;  3Q8E A;  5DHA B;  4K7W A;  1U29 A;  3VIA A;  1I35 A;  1NTY A;  1XEE A;  3Q8C A;  2MKR A;  2FDQ A;  1PLS A;  3KY9 A;  2YS5 A;  5JLJ B;  1T3Q A;  4RGO S;  1UGM A;  1D4B A;  2DYO A;  4HCN B;  1OMW A;  4HB4 B;  1DOY A;  3TCA A;  1L4Z B;  2BYT A;  2KZR A;  2WGS A;  3SBG A;  2ZCB A;  3AE3 B;  4JKD A;  1NI3 A;  2LGY A;  2ZPN A;  4HDQ A;  2SAK A;  3HIE A;  1KLV A;  4H8S A;  4GSW A;  2WXK A;  3V61 A;  4WQO B;  1GNU A;  1IBX A;  1QOB A;  5E6N A;  1ZDV A;  4JK9 A;  3TFM A;  2L8J A;  1LB1 A;  2FCS A;  1M7R A;  2L3Z A;  2MHJ A;  2X0S A;  4C80 A;  5DPS A;  3PRM B;  1JRU A;  3TEZ A;  1EWY C;  1J19 A;  4RGM A;  3RT3 B;  2J42 A;  1WGH A;  2NMQ A;  2I38 A;  1OY2 A;  2JYT A;  2O6V D;  1PGA A;  1NU2 A;  2COP A;  4YON A;  1I7H A;  4K3B A;  2PVO D;  3SU8 X;  1MI1 A;  3AEG B;  3N1Y C;  1C78 A;  1V5M A;  3QCA A;  1MKE A;  2Q13 A;  2J7Q B;  1SF0 A;  1WI1 A;  1XCG A;  3DBL I;  1K50 A;  1WX8 A;  4K7S A;  3VAW A;  2JXT A;  3ZJU A;  2LKO A;  1ZDX A;  4QJ4 B;  4IM3 A;  2CKH B;  2AL6 A;  4WJP A;  2AQ2 B;  4EEW A;  2GBJ A;  1FB8 A;  3WA0 A;  2COD A;  1NYR A;  2LHD A;  1HXY D;  2AYO B;  3N9Y C;  1E7P B;  1YN4 A;  3NSU A;  4I6L B;  3RI7 C;  1TZ1 A;  1T0S C;  2DYM A;  3ODX A;  1MHH E;  2XBB C;  1X1G A;  3N1Z C;  4F7G A;  2W82 A;  4XDD A;  3BK2 A;  1UZX B;  2EKE C;  1C76 A;  2FIF A;  4YL8 A;  5DPW A;  1E8Y A;  1D5Z C;  1XF5 L;  3Q6B A;  3RN9 C;  3U2S C;  4IWO A;  4M8M A;  2N7J A;  3EGR A;  2NZ8 B;  2MFQ A;  2KO3 A;  4KGR A;  3R2I A;  5AEK B;  2GOW A;  4ZRQ A;  5G2N A;  1OQY A;  1XLO A;  3A8Q A;  1DDM A;  3TEY A;  1NTI A;  3UGB B;  2FUG 1;  3BII D;  3CSF A;  3QC8 B;  2AX5 A;  5H92 C;  4BKS D;  3MC8 A;  3RNB C;  2M38 A;  2I1K A;  2COF A;  2KIE A;  3QHT A;  1DDW A;  4LLG M;  1P3Q U;  4EZK A;  1V2Y A;  3LJU X;  1RJ2 A;  1KM7 A;  4DHJ D;  3ZIM A;  5D3W A;  3QK0 A;  3X23 A;  1IPG A;  1OTR B;  4WJN A;  1WF9 A;  4HCP B;  1E8W A;  2IBI B;  3NVV A;  4WUR A;  1IBX B;  2RQ1 A;  1JWM D;  3A4S C;  2YS3 A;  2WU2 B;  4GDL B;  4W9C A;  1HTQ A;  3P4R B;  4CYE A;  2BF8 B;  2HTM E;  1EUV B;  3FAH A;  1STE A;  1DDV A;  3A9J B;  3PP2 A;  4TQ0 A;  2LWP A;  1TKE A;  2L52 A;  2W2X D;  3PTF C;  3WAN A;  2B3A A;  1XR0 B;  2FUH B;  2Z4D A;  1RFK A;  5HE2 A;  1ZE3 D;  4WWO A;  2HD5 B;  3VQI A;  1I4R A;  2MA9 B;  1N3H A;  4ANV A;  2FJU B;  3UF8 A;  2N7D A;  4FAD A;  5LNK 1;  3PSC A;  4OZC A;  2QIE B;  3MPX A;  3AEF B;  2KHW B;  2KLG A;  5KQ4 A;  2O6V A;  2DKQ A;  4JWU C;  4G3X B;  3BVG A;  1PDX A;  1V61 A;  4IOY X;  1U4A A;  4EZL A;  5BMH A;  1F2R I;  4A6F A;  1PFD A;  5JHG A;  5T8I A;  5MPO A;  1LW3 A;  1WJ4 A;  3A1Q B;  3SEB A;  4DHZ B;  4JX1 C;  4MDK E;  4CSQ A;  3TUO A;  4W9H A;  1VLB A;  3AMZ A;  4ARC A;  1OQQ A;  5M4Y B;  4GMV A;  4P16 A;  2JUO A;  1D6E C;  4MGI E;  2JY6 A;  1F52 A;  2ELB A;  3P42 A;  5IN7 A;  1XKE A;  2QHO A;  1P5T A;  2CHZ A;  2HJ1 A;  2LOX A;  1JRP A;  1OEY J;  2M1M A;  3QJZ A;  3IAS 1;  1ZKH A;  2RGN B;  3QQ8 B;  5CHF A;  4L1R A;  2M0X A;  4GIV A;  2LRU A;  4ITK A;  2NTS A;  4D2K A;  2BVC A;  3B77 A;  1KLG D;  4K2P A;  2W3S A;  1ESF A;  1YJJ A;  2LGI A;  5GXG B;  4YTM B;  4W9I A;  3ZJT A;  2LI5 A;  2PLP A;  3SFE B;  2GMI C;  3PVW A;  1MK7 B;  3A4R A;  3VTW A;  3ZW3 A;  4ZRI A;  2IND C;  1XCT L;  2MBO A;  3K9P B;  1XOD A;  5DPT A;  1ISN A;  5J17 A;  4TMA B;  1YJI A;  2J59 M;  4KHA A;  3N32 A;  2WX1 A;  3APC A;  1UEF A;  1YX6 B;  4DXA B;  1K8R B;  2VKI A;  1R4M I;  5I4D A;  3UQA A;  3O13 A;  3BJI A;  3PZD A;  2IGG A;  1FAO A;  1V1O A;  1OQN A;  1QKZ A;  1RFA A;  4ILH A;  1ZYI A;  2R2O A;  3SBT A;  2N9E B;  4PS8 A;  3F0W A;  5L81 A;  2KDF B;  2HE7 A;  4CQN A;  2LVQ A;  1L5P A;  1UUP A;  1NDD A;  4C4V B;  4A6H A;  3WCQ A;  1WXS A;  3KSY A;  2DLB A;  3ENB A;  1KF6 B;  1EF1 A;  1J7A A;  1PFJ A;  4WVF B;  1K52 A;  3EFC A;  2K2J A;  2D3A A;  2IDY A;  1EF5 A;  4A6K A;  1JWB D;  4TUU A;  5H8Y E;  3V6E B;  2MP2 B;  3JSV B;  3GS2 A;  3P4Q B;  4RM9 A;  2KN5 A;  4S17 A;  3P6A A;  2YLM A;  1N63 A;  3DBR I;  4IWQ A;  3TIX A;  4KZ0 A;  1KC7 A;  4HB2 B;  3FVC A;  4HPP A;  4N59 A;  5J3T A;  2LMC A;  3VVW B;  1NEN B;  3AEB B;  2YVC A;  3PLV A;  4JQW C;  1Y19 B;  2M8S A;  2XEW A;  4XX5 A;  1XO3 A;  2K6Q A;  1WZ0 A;  1K5G B;  5C1Z A;  3I9V 1;  1N60 A;  1F0Z A;  2UYZ B;  2WXP A;  4DXF A;  5AZH A;  1QF6 A;  3PRP B;  3H7P A;  1E5W A;  3I63 C;  2DEN B;  2DA0 A;  4LNO A;  2PEA A;  4X57 B;  2FAZ A;  3DPD A;  4OSN A;  2FJ9 A;  5JH5 C;  5I2S A;  4KKI A;  3UZT A;  2OJW A;  2D9X A;  5CLL B;  3RD2 A;  4J3O D;  4FHJ A;  1V5U A;  2MLB A;  1IGD A;  1FPY A;  2QDF A;  1XLQ A;  4DQO C;  3H6N A;  4IM0 A;  4TV3 A;  3PS6 A;  1NBF C;  4BBN F;  2X38 A;  4PS7 A;  2BKR B;  5C5B A;  1MG8 A;  2LUM A;  1PQS A;  3BYT B;  4Z2M B;  1I4Q A;  1TYG B;  4UDU C;  3DBH B;  4MGZ E;  4HLE A;  4KIK A;  2ZJD A;  1U5E A;  1MK9 B;  3B0A A;  3DVG X;  3OJ3 A;  3NZU A;  1E8Z A;  1F2R C;  3LXF A;  3NVZ A;  4G50 A;  4BBN C;  2P8V A;  1I4X A;  2CU3 A;  3AH7 A;  2DX5 B;  5CX3 A;  4HKQ A;  4RMA A;  1N6Z A;  3DHI C;  2BYE A;  4HSI A;  4W9J A;  1NTV A;  1R7S A;  4DK5 A;  2WXO A;  2NS5 A;  4I6N B;  2BBC A;  4ILG B;  4EJN A;  2LJI A;  4P1B C;  3DHH C;  3ZRF A;  1E9M A;  1FFV A;  4K17 A;  4B6W A;  3UQB A;  3DXE A;  3U52 E;  4AS1 A;  1CMX B;  1WXV A;  2JYE A;  1UD7 A;  5LLI A;  3V62 A;  2RNR B;  4K2O A;  1S3S G;  3SYX A;  3ZYY X;  3PO0 A;  5IOI A;  1TS2 A;  4B9K A;  1SEB D;  2NBU A;  1C4A A;  2P0D A;  3HSA A;  3KVF B;  1Q67 A;  2FNJ B;  1AWD A;  1IYF A;  4DX9 0;  3U12 A;  3ENE A;  4NPN A;  3IBE A;  4HAT B;  1Y5O A;  3CWI A;  1ZGU B;  2KLC A;  2WXN A;  1UPR A;  2K1F A;  1H4R A;  1T0Y A;  2WNM A;  1E7U A;  3DDC B;  2RVB B;  2V4I B;  3NG0 A;  2JWU A;  2D9V A;  3RUL A;  3HVZ A;  4FJY A;  4QAY A;  2JZ3 B;  2EJ8 A;  2ZW0 A;  1HEZ E;  4P7I A;  1OEY A;  1FHO A;  1GUA B;  4CO7 A;  2DHJ A;  4ZHO A;  2BS3 B;  3L4P A;  3MJ5 A;  1FD6 A;  3SFD B;  1RYJ A;  2KK8 A;  4K7U A;  4BOS C;  4PK1 A;  4KGS A;  2KNB A;  3L0W B;  1RWS A;  1UNQ A;  1YIW A;  3AED B;  1EU4 A;  2WDV B;  3APF A;  1UH6 A;  1DGJ A;  1TY2 A;  2AEH A;  1Q1O A;  1XCQ L;  4IG7 B;  1GG3 A;  2INN E;  1RLF A;  1F1H A;  2I1J A;  5JXV A;  3AU4 A;  1N5X A;  1AWE A;  1UNP A;  1NI2 A;  2NVU I;  1V97 A;  2V76 A;  5CHW A;  5HE0 A;  2E2X A;  1MPE A;  4ICU A;  4W9G A;  3PRE A;  2Z0O A;  2D9W A;  3Q8B A;  4D0N B;  2ADZ A;  2R2Y A;  1WFY A;  3I3T B;  4NQL B;  2EKI A;  5AZF A;  3SDL C;  2MBQ A;  2Z0Q A;  1VJK A;  3A33 B;  1I7A A;  5D7G A;  2N9X A;  1JWS D;  2LGS A;  4WWM A;  2R2Q A;  3FM8 C;  1WR1 A;  1EVH A;  2K39 A;  3IG3 A;  3MP9 A;  2PVG C;  3NY5 A;  1GPX A;  4ILJ A;  5JHB A;  2IYD B;  2C7N B;  3HUI A;  2K5P A;  4NAW B;  3AE5 B;  3NWF A;  5EDS A;  4AQ7 A;  4L2Y A;  2BQQ A;  2NCN A;  1XLN A;  3CIK A;  1YQ3 B;  4WH4 A;  3RNE C;  3IT4 B;  1GB4 A;  3HW2 B;  2G4D B;  1G6J A;  1D3Z A;  2PE9 A;  2KFK B;  2E3T A;  3AV8 A;  3KRW A;  4N58 A;  4B0E A;  3AB5 A;  1JRO A;  2CY5 A;  4LJO B;  4E71 A;  1P98 A;  2B76 B;  2CQU A;  4HRS A;  1HB8 A;  1WJU A;  2KVR A;  4ZDV A;  4IM2 A;  2BTE A;  1Y56 A;  3MHZ A;  1ZXH A;  5C5B B;  4A90 A;  5HE1 A;  2CHX A;  1CK1 A;  1JCK B;  1VZ6 A;  2NPT B;  3RCZ A;  4REZ A;  2KWV B;  2D10 A;  2DYQ A;  2YF0 A;  1QOG A;  2LFI A;  1X1F A;  4NAW A;  3B2F A;  4HAW B;  5BMG A;  2RPQ A;  3P4S B;  2K3U A;  4RNA A;  3J9C A;  1FM0 D;  1YNT E;  2PPH A;  2JX5 A;  2JRH A;  1TJE A;  5IP4 D;  2WU5 B;  2A4Z A;  4KZC A;  1ET9 A;  1AAR A;  2IY0 B;  4MT7 A;  1YN5 A;  2PE6 B;  3ZDM C;  1C77 A;  2KX0 A;  3QWZ B;  2KVZ A;  4HB0 B;  1EAZ A;  1YX5 B;  2EEL A;  5GMV A;  2ACZ B;  2N9P C;  1H8C A;  1HTO A;  2KUQ A;  2SEB D;  3OAN A;  2LJ5 A;  2AL3 A;  3L13 A;  3ETR A;  4XWX A;  4B6H A;  2YEP B;  4BKT A;  2D5G A;  2MWN B;  3A9K A;  4TYZ A;  3VR9 B;  1WJM A;  2IGD A;  2LD9 A;  3GYO A;  3U30 A;  5HE3 A;  1JQ4 A;  3DWG C;  1TS3 A;  4HAY B;  2J0K A;  4ANX A;  5J3Q A;  3FIL B;  3ONS A;  2IO0 B;  4KSL C;  4WJQ A;  4GZU A;  4FJV B;  4WAF A;  5C23 A;  3N7C A;  3ML9 A;  2CS4 A;  4C4V A;  1MFW A;  2BGF A;  4W9L A;  2VRW B;  3DCX A;  3JYU A;  1AYF A;  2MQJ A;  5JP4 A;  1GC7 A;  3DOW A;  2K9X A;  1PUT A;  1MVK A;  2KJ6 A;  4JKH A;  2WXQ A;  1TQZ A;  2RGF A;  1L6U A;  1D5M C;  2INC C;  1DIK A;  5EE3 A;  1I42 A;  1X05 A;  3VRB B;  1TXD A;  2KMA A;  3LDZ E;  3ZXV A;  3AE8 B;  4JKE A;  1UNS A;  2PW9 A;  2H89 B;  4WJ7 A;  2DAJ A;  5LON B;  3QA8 A;  2Z13 A;  3IAM 1;  1JWA D;  2XK5 B;  2H7E A;  5GOW B;  1DYQ A;  3IT6 B;  3B9J A;  4JKB A;  3SUZ A;  4OW0 A;  2BS2 B;  3M63 B;  2CB8 A;  1V1P B;  1L0X B;  5KQ1 A;  1SBB B;  2GJY A;  1DRO A;  4PT5 A;  5EE1 A;  2ROV A;  1FNW A;  2OED A;  3KYD D;  4LK0 M;  5FKA C;  1WRI A;  1UBQ A;  5DH9 B;  1QC6 A;  2L32 A;  4JLC A;  3DXD A;  2NR2 A;  3LYY A;  2OQB A;  2GLS A;  3S2A A;  1NYQ A;  2K8H A;  3OG5 A;  1MPH A;  3ABV B;  4L23 A;  3ZVV A;  1J7C A;  1ZUD 2;  3ZGZ A;  3V60 A;  5G55 A;  3EC8 A;  2DTC A;  2ZZP B;  4JL9 A;  1WXQ A;  3PG7 A;  2ZEQ A;  1M7E A;  3FEH A;  3SHQ A;  3APD A;  4US8 A;  1FFU A;  3ZJV A;  3DXC A;  2NTT A;  2QKL A;  3PHX B;  3KWL A;  4FN2 A;  4RCO A;  4KIK B;  4FJZ A;  2K2U A;  2ASQ A;  2D3G A;  5J2R A;  3AJ4 A;  2WYQ A;  2LG1 A;  2WDR B;  4XYC A;  1Z2M A;  2WXG A;  2L2I A;  1XX0 A;  4FBJ B;  2MH7 A;  1KTK A;  2H7D A;  3MC0 B;  2TSS A;  1ACA A;  2D3B A;  2IO2 B;  2D4Q A;  5D3V A;  2O6V B;  3ZUN A;  3DBS A;  1IGC A;  1DYN A;  3HRD D;  1X86 A;  3B08 A;  1FCL A;  3ECI A;  5KHO A;  4LTU A;  2D3C A;  2LOZ A;  4M0W A;  1HZ5 A;  1PYW D;  1WM2 A;  4AUQ C;  1ZC3 B;  2M4N A;  3JW0 X;  3NWA A;  5BYR A;  2N0Y A;  2RDG A;  1YQ4 B;  3PRZ A;  2L7R A;  2GUM A;  5L95 C;  5DPR A;  3A9J A;  4JIO U;  5LG4 B;  3N20 C;  1TKG A;  2DX1 A;  1T0Q C;  1XQQ A;  3RUI B;  4MJS B;  2LHE A;  1BAK A;  2FCQ A;  2LAS A;  2JVC A;  4USA A;  1VZ8 A;  4LNF A;  4GPT B;  1ROE A;  2L83 A;  3AI5 A;  3DBH I;  2MP2 A;  3JSV A;  3FSS A;  1VDV A;  4MM3 B;  3L54 A;  1N5W A;  3L17 A;  3BZD B;  1C1Y B;  1KZG A;  1D5X C;  2P0H A;  3AE9 B;  4BKS A;  3EHV A;  3KQ4 A;  3C19 A;  1QQG A;  2DHI A;  1EM7 A;  4HRO A;  3R7Q A;  1ET6 A;  3DVN U;  4EMO A;  1WIA A;  2ON8 A;  3RPF C;  2FE8 A;  1TTN A;  1WJN A;  3T8M A;  1L0Y B;  1T0R C;  2G4S A;  3RMK C;  2WXF A;  2WQY B;  3GE8 C;  3H9D A;  4P1C C;  1MIZ B;  2RLO A;  2UU7 A;  4YSZ B;  3O65 B;  1QLB B;  4B95 A;  2H88 B;  3AE7 B;  1DOI A;  1OFF A;  2GBK A;  2GB1 A;  2M19 A;  3PZ8 A;  4RM8 A;  2E6X A;  3PT2 B;  1BUI C;  2AQ3 B;  3UIO B;  2FBW B;  3RCP A;  3PZ7 A;  2LXC A;  4IDI A;  4AP4 C;  2G9H D;  2D9Z A;  4MEM A;  1Q10 A;  3VUX A;  5CLQ B;  3P63 A;  4MSQ B;  3VFK A;  1YN3 A;  2BKF A;  2RSG A;  3ODW A;  3SO6 A;  4KDL B;  4MGK E;  5D94 A;  3BVZ A;  3DBR B;  5LXH A;  1HBK A;  2ZPY A;  4A6Q A;  5AZG A;  4WWP A;  1ST7 A;  1V5T A;  3CF6 E;  4JKF A;  1ZP0 B;  4M02 A;  2WHI A;  2K8E A;  2RRF A;  1CJE A;  2K25 A;  1S1Q B;  1WE6 A;  4YT0 B;  2DFK A;  3C0R B;  1L2N A;  3GP7 A;  2MBE A;  3U8Z A;  4JKC A;  3Q3J A;  4GB9 A;  2K6D B;  3M1I B;  3PGE A;  2WH5 A;  4KX6 B;  1VBH A;  4KKJ A;  4ZRJ A;  1V80 A;  1AQC A;  2L05 A;  4BVU C;  5JHH A;  2W9N A;  1MI0 A;  2RSU A;  4PQ0 A;  2W3R A;  4GLS C;  2YS1 A;  1ZM0 A;  5KCV A;  1V86 A;  1E8X A;  4QXA B;  1J0W A;  3BWU D;  1KOT A;  2JSV X;  3DWM A;  3QIJ A;  2MBB B;  4ZRK A;  3PLU A;  1NVI D;  3TEX A;  3ZRC A;  2V9H A;  2FCN A;  3HM6 X;  2X8X X;  4HHV A;  1C4P A;  2N1W A;  4DDG D;  2JPH A;  4GDL A;  4GU2 A;  2O2V A;  2G35 A;  2CJN A;  1A70 A;  3D32 A;  2WXH A;  2KOX A;  1B55 A;  4W9E A;  3RNG C;  2MCN B;  4BFR A;  3WIM A;  2K0P A;  1RRP B;  3QBV B;  3HHM A;  4HAV B;  2I2Y A;  2Z59 B;  2L0T A;  4TSS A;  2J0J A;  3E66 A;  2DLW A;  3ZVR A;  1SE3 A;  3P2B A;  4W9D A;  4NNJ B;  4NJC A;  3R8B A;  2N1V A;  1QT9 A;  2J53 A;  1BXT A;  3IXS A;  1C3T A;  2PMV A;  3FC4 A;  2WDQ B;  1WVH A;  2IO3 B;  2WXR A;  2G1E A;  2WS3 B;  1YOV B;  2BW2 A;  2RDH A;  1WY8 A;  3QWM A;  4JKG B;  2A5U A;  4HDO A;  2GS0 A;  2NBV B;  2HDE A;  3TVV A;  2D07 B;  1VR9 A;  4JKG A;  2C5L C;  2C9W B;  1N61 A;  3ULB A;  3P1M A;  3ZXR A;  1A5R A;  3W5U B;  3V5W A;  3GZN B;  1KZ7 A;  3KUC B;  1DOX A;  1XD4 A;  1MG4 A;  1YD8 U;  4C0A A;  2Y5B B;  4IW0 A;  2W55 A;  3P7Z A;  4BKG A;  3ZO5 B;  1V49 A;  2ZVO A;  1W1G A;  3R2T A;  3ULC A;  1LFD A;  2YEP F;  1FHW A;  2VH2 A;  1FGZ A;  4HPL B;  4QJ3 B;  3HM3 A;  2KCJ A;  1E7V A;  2LGD A;  2JZP A;  2ABD A;  3UIN B;  2QCZ A;  3RNF C;  2J0M A;  1TS5 A;  4MM3 A;  3OAW A;  2XNA C;  3VTV A;  5I2M A;  1FXI A;  2GBN A;  1SJE D;  1Z87 A;  5J18 A;  4C00 A;  2KX3 A;  4LNN A;  3QAR A;  2BS4 B;  2O2V B;  2IJ0 A;  1P7E A;  3Q8A A;  2UZS A;  2BYF A;  3KWV A;  2CY4 A;  3HK0 A;  3Q2A C;  2L0F A;  1PMS A;  1Y8R C;  3NWD A;  3TW1 A;  3CST A;  1EGX A;  1WGD A;  4H2A A;  4WSF A;  2DN6 A;  2KJR A;  2Z0D B;  4OZB A;  5C2T B;  4XE0 A;  3VUY A;  5FI0 A;  2JQR B;  3VHT C;  2IFS A;  3AE2 B;  2LGX A;  1N62 A;  1C79 A;  1QIL A;  4F7Z A;  5FR3 A;  2PTL A;  4GOU A;  4HAU B;  4ACF A;  2KDI A;  1TT5 B;  2CAY A;  2BB5 A;  1WWT A;  5LOP B;  2Y5P A;  2X18 A;  1C4C A;  3KW5 B;  4HVB A;  2MJE A;  1UBI A;  1H10 A;  2N23 A;  3AU5 A;  4L1B A;  4PS3 A;  3PV1 A;  3AN1 A;  3A98 B;  4KHB B;  5TR5 A;  1BTN A;  2L76 A;  1JWU D;  4ANU A;  1GB1 A;  1WG7 A;  1SE2 A;  2IYB A;  2KQ4 X;  2N7E A;  3EPY A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  2W54 A;  1P6S A;  1MJD A;  4JKA A;  2VH1 A;  5BO4 B;  2JRI B;  1X1M A;  1RM6 C;  1V81 A;  4HAX B;  4ICV A;  2LYD A;  5G5G A;  2RMM A;  1Z5S B;  3V05 A;  1K5D B;  3U7Z A;  4RGN A;  4DBG A;  2Y8F A;  3I57 A;  1C9F A;  4HK2 A;  4HWI B;  3Q8F A;  2V3S A;  1VD2 A;  2KD0 A;  4YTN B;  1V89 A;  1UNR A;  2ICI A;  4ZYN A;  1JML A;  3KLS X;  4KVG B;  5CTR C;  5D6J B;  3NOB A;  4KDI C;  2L00 B;  1U5G A;  2N9K A;  3UI3 A;  1I4P A;  2JF5 A;  1SHC A;  4R3D A;  1FNU A;  4IFS A;  2AWT A;  3E9L A;  1IUE A;  1UWX A;  2L1C A;  2KKC A;  3GZN I;  4PNK A;  1YMH E;  3E56 A;  3ZTC A;  3RZW C;  5D3Y A;  1VBG A;  1V9J A;  3B2G A;  3V3X A;  2PJH A;  2GBM A;  2GCJ A;  3L08 A;  1TBE A;  3MJW A;  4NY0 A;  3ZNH B;  2I5C A;  2IO1 B;  2Q5W D;  2ZVN A;  4BAX A;  3X0W A;  2YT0 A;  2KTR A;  3FIL A;  1V8C A;  3NW8 A;  3N1X C;  4E3C A;  1CZP A;  1JW9 D;  2UWQ A;  3URY A;  2KMC A;  4RFB A;  5D2M B;  4P6V F;  2CHW A;  2KWC A;  4CHJ A;  3D8E A;  4DWF A;  3KH0 A;  1QQR A;  4F8C B;  3A9K B;  2BT6 A;  2KAJ A;  1T5X D;  5EFX A;  3BIN A;  3TEW A;  3BVM A;  1ZPS A;  1HA5 A;  1J0G A;  2EMS A;  1GOZ A;  1WX7 A;  3NS1 A;  1F9J A;  1L0V B;  1WSP A;  2Z0E B;  1GJZ A;  1TS4 A;  3ML4 A;  3CIR B;  1L6V A;  4MJS A;  4ZOH C;  5EE9 A;  1PGB A;  2NMB A;  1FXA A;  3HIZ A;  3NUH B;  2KUP A;  2ZW1 A;  1WXM A;  3MC9 A;  4KGT A;  2CRF A;  3MHS D;  4AWJ A;  3JVZ X;  4YTP B;  3SD5 A;  2BB6 A;  2IGH A;  2RD0 A;  4GN1 A;  2MRP A;  3N3K B;  3SNH A;  4M0W B;  4WQM A;  1MHX A;  1SXT A;  2DZM A;  1WH3 A;  2OJR A;  3FKY A;  1EWC A;  3RNC C;  5HFY A;  1VRA B;  1WI0 A;  2VZK B;  3TJP A;  1FCC C;  2BPS A;  3E9O A;  4K1R B;  3ZNG C;  4FXC A;  2K8C A;  2Z8L A;  2DZJ A;  1V5O A;  2L1A A;  2Y7B A;  4F7H A;  3AEE B;  2DAF A;  2XN9 C;  1OGW A;  4N9F 4;  2NPT A;  4J6I A;  1NVL A;  1PGX A;  1SE9 A;  3T3O A;  1KRH A;  3ZNI D;  2HTH A;  2IPK D;  4RF1 A;  3AUL A;  2J4X A;  1AN8 A;  5IJM A;  2LVO A;  1WJ6 A;  4NZL B;  1SGH A;  1EU3 A;  2C60 A;  3G9W A;  2DYN A;  2KFK A;  2M56 B;  2HRJ A;  1HE8 A;  4Z2N A;  3N30 A;  5D3D A;  3EUB 2;  2BWF A;  1BML C;  2DBY A;  3QAQ A;  2VRR B;  1SE4 A;  5DIF B;  1WMH A;  2KIG A;  1FRR A;  2AQ1 B;  4I6P A;  3H8H A;  1I4H A;  4II3 B;  1B1Z A;  3BY4 B;  4DX8 A;  2QC8 A;  2Z14 A;  4XWT A;  1HQR D;  2K22 A;  3O96 A;  1WGU A;  2MBH A;  4AJY B;  4DXG A;  1XT9 B;  3SR6 A;  4BOZ B;  4M8N A;  4ASW C;  3Q14 C;  1V1P A;  1JAL A;  1ZVR A;  1XD3 B;  5BYQ A;  4W9F A;  2LZ6 A;  1LGR A;  1R4M B;  2XK5 A;  4XGA B;  2LRW A;  5AUK A;  3KRX A;  4NJ6 A;  1WGG A;  1TGZ B;  4JWS C;  5DCN A;  1U5D A;  5IO9 A;  2JP2 A;  2ROZ B;  5E6O A;  3VR8 B;  2V1Y A;  1P9D U;  4IKG A;  1UEL A;  3T3N A;  3R7R A;  2WXJ A;  2KQ7 A;  4IUM B;  4OT1 A;  5IAA C;  4OVV A;  1WJ1 A;  2JT4 B;  2P0F A;  1NEK B;  4IOI E;  3W5V B;  3T06 A;  1XLP A;  4GMX B;  5IRS A;  3NVY A;  3DVG Y;  2KYW A;  2YSZ A;  3TBL D;  4PYU A;  3P4P B;  5JHA A;  3NZ3 A;  2ONQ A;  2M17 A;  3OWE B;  3VXW A;  2K8B A;  4KSK C;  3Q3O C;  3W9C B;  4MEL A;  3UIP B;  4C56 C;  1W1D A;  1WGY A;  2JZZ A;  3DCG A;  4HXD A;  4GXB A;  1KFY B;  1BT0 A;  4QJ5 B;  2EC1 A;  4JE3 B;  1FIQ A;  4JK7 A;  2V3P A;  1R4N B;  3RNA C;  1BTK A;  4DHJ B;  3M95 A;  4TKN A;  1FOE A;  1QZE A;  2M14 A;  5C79 A;  1FGY A;  5E6J A;  3KZ1 A;  1P3R A;  1JDE A;  1P0R A;  3PVL A;  4M00 A;  2I5F A;  1P1A A;  2V0G A;  1ZC4 B;  1K53 A;  2CU1 A;  1SIJ A;  5G5H A;  4KAX B;  3ZDT A;  1IP9 A;  2KAC A;  1R4N I;  4K3C A;  1F77 A;  2W2W A;  2VSZ A;  1TKY A;  5LXI B;  2RPV A;  4BZA A;  3VTU A;  3A58 A;  3NVW A;  2KDB A;  2OOB B;  4MT5 A;  1B9R A;  5FR6 A;  2FJL A;  3IVF A;  3R3M A;  4YSX B;  2KR0 A;  1Q0W B;  2WP9 B;  2WLB A;  2OTX A;  1FNV A;  1M4V A;  1E90 A;  2ELA A;  1MIX A;  2DX5 A;  4URK A;  2JU6 X;  2LUL A;  2QIL A;  1LM8 B;  5D3X A;  2G45 B;  3GYP A;  3SV1 A;  1SJH D;  2PKO A;  4LDT B;  1LO5 D;  1W1H A;  3H7S A;  1EO6 A;  4A55 A;  3VOQ A;  4D6W A;  4EFO A;  1GAQ B;  4EUT A;  4II2 B;  3WAP A;  5HI1 A;  4AJW A;  1TJ6 A;  2DZI A;  3KYC D;  1QOA A;  2YT1 A;  1KI1 B;  2PZ1 A;  2DZK A;  4TQ1 A;  5D27 A;  3CMM B;  2MJD A;  3VDZ A;  2DWQ A;  4LDT D;  1AW7 A;  4US9 A;  1KBL A;  1VCB A; 
#chains in the Genus database with same CATH homology
 1WE7 A;  4EOY A;  1V88 A;  2XQN M;  4W9K A;  1M94 A;  4JK8 A;  2BCJ A;  3H7P B;  2KC1 A;  4XC2 A;  3ZKJ C;  4FA6 A;  3B1L X;  1WX9 A;  3NHE B;  1WGR A;  1WRD B;  4KHO A;  2BYV E;  3FLV A;  5FI1 A;  2D11 A;  2QKM A;  3OJ4 B;  2Y8G A;  3EEC A;  3D8D A;  2Z0P A;  2MX2 A;  4Y94 A;  1WXA A;  4WJO A;  4CHM A;  2IZV B;  2LBB A;  1SIF A;  1Q5W B;  2D2Q A;  4IWP A;  3WYF B;  2WDT B;  5IA7 A;  2KC2 A;  3ZTD A;  2KTR B;  3OLM D;  1YJ1 A;  5KHQ A;  5CHV C;  3NS8 A;  3WAM A;  4BBK A;  2R82 A;  2MDX A;  3L16 A;  1ZSQ A;  4A5K A;  4NSW A;  4WAA A;  4XZ4 A;  1V6E A;  2ZCC A;  4FHK A;  4G11 A;  1U5F A;  1RAX A;  1U27 A;  2JXX A;  2DYB A;  5JVL A;  4F1S A;  1GC6 A;  3ODO A;  2R0D A;  4GGQ A;  4HB3 B;  3W1S C;  5L83 A;  2KTF A;  2NBW B;  2IY1 B;  4A20 A;  4MSM B;  4K81 A;  4A3P A;  2N4F A;  3IHP C;  1L7Y A;  2MW5 A;  4HAZ B;  2REX A;  2GCL A;  2LVP A;  3VH4 B;  1WM3 A;  1HB6 A;  2C7H A;  4CHK A;  4MY6 A;  4EKU A;  1WMH B;  4NQK E;  2KJH B;  3EFU A;  2KGX B;  4JGH B;  2W2X C;  4G0N B;  1WGQ A;  3GOE A;  3PEG A;  2G3Q B;  3NZS A;  4GDK B;  1LQB A;  3K9O B;  3PVU A;  1IRS A;  2COC A;  2HTH B;  1GGO A;  3VUW A;  2BWE S;  4LCD E;  3U7D A;  3DQV A;  2LUE A;  4A6F B;  4MGY E;  3MDB C;  2R09 A;  5JZE B;  1I2H A;  1LXD A;  2FID A;  3W1S A;  2RR9 A;  3Q3F A;  4DHZ E;  4OVU A;  1U2B A;  3M3J A;  5C6R A;  3TO1 A;  2KAN A;  4MH0 E;  3RZF A;  2MWS B;  4F7U P;  4AOF A;  4LJP B;  4PYZ A;  3LJ3 A;  3PHW B;  1RRB A;  3ZLZ A;  2KFJ A;  1UPQ A;  2JWZ A;  2KQS A;  2WWZ A;  3VH3 B;  3D8F A;  2WX0 A;  3PPA A;  4E74 A;  3RYT A;  3H1U A;  4WWN A;  4IC7 B;  1J8C A;  3F5R A;  3DVN V;  5DHF B;  4FLH A;  2KXJ A;  2C7M B;  5J3Y A;  1KJT A;  3TL5 A;  3KUD B;  2KWU B;  4NJ7 A;  4A3O A;  2HJ8 A;  4FUL A;  2COA A;  2YRY A;  1WR6 E;  3CXB B;  3T9L A;  4IAP A;  3HQC A;  2DIK A;  1V5P A;  2DHZ A;  2D9Y A;  4MK0 A;  1WYW B;  3MTN B;  2RUK B;  3ALB A;  4DBB A;  1FXT B;  2GBR A;  5C16 A;  4HJK A;  1BWN A;  5HKH A;  4GOC A;  1MAI A;  4L6E A;  2KDE B;  3V6C B;  1X11 A;  1DBH A;  3KUZ A;  5E6P A;  4DDI D;  2DHK A;  3W1Y A;  2UZR A;  4EZJ A;  3IFW B;  3WAL A;  2CR5 A;  2K00 A;  3QX1 A;  1YQB A;  1ZW7 A;  2MSE D;  4ANW A;  3WAO A;  2LXA A;  4HPM B;  1FHX A;  3FP5 A;  3TMP B;  3R66 C;  2ZNV C;  3PSE B;  2DKP A;  1WZ3 A;  2FCM A;  3A1Q A;  3A8P A;  2V4L A;  2EMT A;  3M62 B;  3E9P A;  3ZNZ B;  5DI9 B;  3AXC A;  2UVM A;  3L10 B;  5DHA B;  4K7W A;  1U29 A;  3VIA A;  1I35 A;  1NTY A;  2MKR A;  2FDQ A;  1PLS A;  3KY9 A;  2YS5 A;  5JLJ B;  1UGM A;  2DYO A;  4HCN B;  1OMW A;  4HB4 B;  3TCA A;  2KZR A;  3SBG A;  2ZCB A;  4JKD A;  2LGY A;  2ZPN A;  4HDQ A;  1KLV A;  4H8S A;  4GSW A;  3V61 A;  4WQO B;  1GNU A;  5E6N A;  4JK9 A;  3TFM A;  2L8J A;  1LB1 A;  2FCS A;  1M7R A;  2L3Z A;  2X0S A;  5DPS A;  3PRM B;  1JRU A;  1J19 A;  3RT3 B;  1WGH A;  1OY2 A;  2O6V D;  1NU2 A;  2COP A;  4YON A;  3SU8 X;  1V5M A;  3QCA A;  1MKE A;  2Q13 A;  2J7Q B;  1WI1 A;  1XCG A;  3DBL I;  1WX8 A;  4K7S A;  3VAW A;  2LKO A;  4IM3 A;  2CKH B;  2AL6 A;  4WJP A;  4EEW A;  2GBJ A;  1FB8 A;  3WA0 A;  2COD A;  2AYO B;  3NSU A;  4I6L B;  1TZ1 A;  2DYM A;  3ODX A;  2XBB C;  1X1G A;  4F7G A;  1UZX B;  2EKE C;  2FIF A;  4YL8 A;  5DPW A;  1E8Y A;  4IWO A;  4M8M A;  2NZ8 B;  2MFQ A;  5AEK B;  2KO3 A;  2GOW A;  5G2N A;  1OQY A;  3A8Q A;  1DDM A;  1NTI A;  3UGB B;  3CSF A;  3QC8 B;  4BKS D;  2M38 A;  2I1K A;  2COF A;  3QHT A;  1DDW A;  1P3Q U;  4EZK A;  1V2Y A;  3LJU X;  1RJ2 A;  1KM7 A;  4DHJ D;  3ZIM A;  5D3W A;  3QK0 A;  3X23 A;  1IPG A;  1OTR B;  4WJN A;  1WF9 A;  4HCP B;  1E8W A;  2IBI B;  2RQ1 A;  3A4S C;  2YS3 A;  4GDL B;  4W9C A;  4CYE A;  2BF8 B;  1EUV B;  1DDV A;  3A9J B;  3PP2 A;  4TQ0 A;  2LWP A;  2W2X D;  3PTF C;  3WAN A;  2B3A A;  1XR0 B;  2FUH B;  5HE2 A;  4WWO A;  2HD5 B;  3VQI A;  2MA9 B;  1N3H A;  4ANV A;  3UF8 A;  2N7D A;  4FAD A;  3PSC A;  3MPX A;  2KHW B;  2KLG A;  5KQ4 A;  2O6V A;  2DKQ A;  4G3X B;  1V61 A;  4IOY X;  1U4A A;  4EZL A;  4A6F A;  5JHG A;  1LW3 A;  1WJ4 A;  3A1Q B;  4DHZ B;  4MDK E;  4W9H A;  4GMV A;  2JUO A;  4MGI E;  2JY6 A;  2ELB A;  1XKE A;  2QHO A;  1P5T A;  2CHZ A;  2LOX A;  1OEY J;  2M1M A;  3QJZ A;  1ZKH A;  2RGN B;  3QQ8 B;  5CHF A;  2M0X A;  4GIV A;  2LRU A;  4K2P A;  4W9I A;  2LI5 A;  2GMI C;  3PVW A;  1MK7 B;  3A4R A;  3VTW A;  3ZW3 A;  4ZRI A;  3K9P B;  5DPT A;  2MBO A;  1XOD A;  5J17 A;  1ISN A;  2J59 M;  4KHA A;  3N32 A;  2WX1 A;  3APC A;  1UEF A;  1YX6 B;  4DXA B;  1K8R B;  2VKI A;  1R4M I;  3UQA A;  3BJI A;  3PZD A;  1FAO A;  1OQN A;  1RFA A;  4ILH A;  2R2O A;  3SBT A;  2N9E B;  4PS8 A;  3F0W A;  5L81 A;  2KDF B;  2HE7 A;  2LVQ A;  1NDD A;  4A6H A;  1WXS A;  3KSY A;  3ENB A;  1EF1 A;  1PFJ A;  4WVF B;  2K2J A;  1EF5 A;  4A6K A;  4TUU A;  3V6E B;  2MP2 B;  3JSV B;  4RM9 A;  2KN5 A;  3P6A A;  2YLM A;  3DBR I;  4IWQ A;  3TIX A;  4KZ0 A;  1KC7 A;  4HB2 B;  3VVW B;  5J3T A;  4JQW C;  2YVC A;  3PLV A;  1Y19 B;  2M8S A;  2XEW A;  4XX5 A;  2K6Q A;  1WZ0 A;  1K5G B;  5C1Z A;  2UYZ B;  5AZH A;  3PRP B;  3H7P A;  1E5W A;  2DEN B;  2DA0 A;  2PEA A;  4X57 B;  2FAZ A;  3DPD A;  2FJ9 A;  5JH5 C;  3UZT A;  2D9X A;  5CLL B;  3RD2 A;  4FHJ A;  1V5U A;  2MLB A;  3H6N A;  4IM0 A;  4TV3 A;  3PS6 A;  1NBF C;  4BBN F;  4PS7 A;  2BKR B;  5C5B A;  1MG8 A;  1PQS A;  4Z2M B;  4MGZ E;  4HLE A;  4KIK A;  2ZJD A;  1U5E A;  1MK9 B;  3B0A A;  3DVG X;  3NZU A;  3OJ3 A;  1E8Z A;  4G50 A;  4BBN C;  2P8V A;  2DX5 B;  5CX3 A;  4RMA A;  2BYE A;  4W9J A;  1NTV A;  4DK5 A;  2NS5 A;  4I6N B;  4ILG B;  4EJN A;  3ZRF A;  4K17 A;  4B6W A;  3UQB A;  3DXE A;  1CMX B;  1WXV A;  5LLI A;  1UD7 A;  3V62 A;  2RNR B;  4K2O A;  1S3S G;  3SYX A;  4B9K A;  2NBU A;  2P0D A;  3KVF B;  1Q67 A;  2FNJ B;  1IYF A;  4DX9 0;  3ENE A;  4NPN A;  3IBE A;  4HAT B;  1Y5O A;  1ZGU B;  2KLC A;  1UPR A;  2K1F A;  1H4R A;  1T0Y A;  1E7U A;  3DDC B;  2RVB B;  2D9V A;  3RUL A;  4FJY A;  2JZ3 B;  2EJ8 A;  4P7I A;  1OEY A;  1FHO A;  1GUA B;  4CO7 A;  2DHJ A;  2KK8 A;  4K7U A;  4BOS C;  2KNB A;  3L0W B;  1UNQ A;  1YIW A;  3APF A;  1UH6 A;  2AEH A;  1Q1O A;  4IG7 B;  1GG3 A;  1RLF A;  2I1J A;  3AU4 A;  1AWE A;  1UNP A;  1NI2 A;  2NVU I;  2V76 A;  5CHW A;  5HE0 A;  2E2X A;  4ICU A;  4W9G A;  3PRE A;  2Z0O A;  2D9W A;  4D0N B;  2ADZ A;  1WFY A;  3I3T B;  4NQL B;  5AZF A;  3SDL C;  2MBQ A;  2Z0Q A;  3A33 B;  1I7A A;  5D7G A;  2N9X A;  2R2Q A;  3FM8 C;  1WR1 A;  1EVH A;  2K39 A;  3IG3 A;  3NY5 A;  4ILJ A;  5JHB A;  2IYD B;  2C7N B;  4NAW B;  5EDS A;  2NCN A;  3CIK A;  3HW2 B;  2G4D B;  1G6J A;  1D3Z A;  2PE9 A;  2KFK B;  3KRW A;  2CY5 A;  4LJO B;  4E71 A;  1P98 A;  2CQU A;  1HB8 A;  1WJU A;  2KVR A;  4ZDV A;  4IM2 A;  5C5B B;  5HE1 A;  2CHX A;  2NPT B;  3RCZ A;  2KWV B;  2D10 A;  2DYQ A;  2YF0 A;  1X1F A;  4NAW A;  4HAW B;  2RPQ A;  2PPH A;  2JRH A;  2A4Z A;  4KZC A;  1AAR A;  2IY0 B;  4MT7 A;  2PE6 B;  3ZDM C;  2KX0 A;  3QWZ B;  4HB0 B;  1EAZ A;  1YX5 B;  5GMV A;  2N9P C;  1H8C A;  3OAN A;  2LJ5 A;  2AL3 A;  3L13 A;  4XWX A;  4B6H A;  4BKT A;  2MWN B;  3A9K A;  4TYZ A;  1WJM A;  2LD9 A;  3GYO A;  3U30 A;  5HE3 A;  4HAY B;  2J0K A;  4ANX A;  5J3Q A;  3ONS A;  2IO0 B;  4KSL C;  4WJQ A;  4GZU A;  4FJV B;  5C23 A;  3N7C A;  3ML9 A;  2CS4 A;  2BGF A;  4W9L A;  2VRW B;  3JYU A;  2MQJ A;  5JP4 A;  1GC7 A;  3DOW A;  2KJ6 A;  4JKH A;  1TQZ A;  2RGF A;  1DIK A;  1I42 A;  1X05 A;  1TXD A;  2KMA A;  3LDZ E;  4JKE A;  4WJ7 A;  2DAJ A;  5LON B;  3QA8 A;  2XK5 B;  2H7E A;  5GOW B;  4JKB A;  3SUZ A;  3M63 B;  2CB8 A;  5KQ1 A;  2GJY A;  1DRO A;  2ROV A;  3KYD D;  1UBQ A;  5DH9 B;  1QC6 A;  4JLC A;  3DXD A;  2NR2 A;  2OQB A;  3S2A A;  2K8H A;  1MPH A;  3ZVV A;  3V60 A;  5G55 A;  3EC8 A;  2DTC A;  2ZZP B;  4JL9 A;  3PG7 A;  2ZEQ A;  1M7E A;  3FEH A;  3SHQ A;  3APD A;  3DXC A;  2QKL A;  3PHX B;  4FN2 A;  4KIK B;  4FJZ A;  2K2U A;  2ASQ A;  2D3G A;  5J2R A;  3AJ4 A;  2WYQ A;  2LG1 A;  1Z2M A;  2L2I A;  1XX0 A;  4FBJ B;  2H7D A;  1ACA A;  2IO2 B;  2D4Q A;  5D3V A;  2O6V B;  3ZUN A;  3DBS A;  1DYN A;  1X86 A;  3B08 A;  3ECI A;  5KHO A;  2LOZ A;  1WM2 A;  4AUQ C;  1ZC3 B;  2M4N A;  3JW0 X;  2N0Y A;  3PRZ A;  2L7R A;  5L95 C;  5DPR A;  3A9J A;  4JIO U;  2DX1 A;  3RUI B;  1XQQ A;  4MJS B;  1BAK A;  2FCQ A;  2LAS A;  2JVC A;  4GPT B;  3AI5 A;  3DBH I;  2MP2 A;  3JSV A;  3FSS A;  3L54 A;  3L17 A;  1C1Y B;  1KZG A;  2P0H A;  4BKS A;  3EHV A;  1QQG A;  2DHI A;  3R7Q A;  3DVN U;  4EMO A;  1WIA A;  1TTN A;  1WJN A;  3T8M A;  2G4S A;  3H9D A;  1MIZ B;  2RLO A;  3O65 B;  4B95 A;  2GBK A;  4RM8 A;  3PT2 B;  3UIO B;  3RCP A;  2LXC A;  4AP4 C;  2D9Z A;  4MEM A;  3VUX A;  5CLQ B;  4MSQ B;  3VFK A;  2BKF A;  2RSG A;  3ODW A;  3SO6 A;  4KDL B;  4MGK E;  5D94 A;  5LXH A;  1HBK A;  2ZPY A;  5AZG A;  4WWP A;  1ST7 A;  1V5T A;  3CF6 E;  4JKF A;  2K25 A;  1S1Q B;  1WE6 A;  2DFK A;  3C0R B;  1L2N A;  2MBE A;  3U8Z A;  4JKC A;  3Q3J A;  4GB9 A;  2K6D B;  3M1I B;  3PGE A;  2WH5 A;  1VBH A;  4ZRJ A;  1V80 A;  1AQC A;  2L05 A;  4BVU C;  5JHH A;  2W9N A;  2RSU A;  4PQ0 A;  2YS1 A;  1ZM0 A;  5KCV A;  1V86 A;  1E8X A;  1J0W A;  1KOT A;  3QIJ A;  2MBB B;  4ZRK A;  3PLU A;  3ZRC A;  2FCN A;  3HM6 X;  4HHV A;  2N1W A;  4DDG D;  2JPH A;  4GDL A;  4GU2 A;  2O2V A;  2G35 A;  3D32 A;  2KOX A;  1B55 A;  4W9E A;  4BFR A;  2MCN B;  3WIM A;  1RRP B;  3QBV B;  3HHM A;  4HAV B;  2Z59 B;  2L0T A;  2J0J A;  3E66 A;  2DLW A;  3ZVR A;  3P2B A;  4W9D A;  4NNJ B;  2N1V A;  1C3T A;  1WVH A;  2IO3 B;  1WY8 A;  3QWM A;  4JKG B;  2A5U A;  4HDO A;  2GS0 A;  2NBV B;  3TVV A;  2D07 B;  4JKG A;  2C5L C;  2C9W B;  1A5R A;  3ULB A;  3V5W A;  1KZ7 A;  3KUC B;  1XD4 A;  1YD8 U;  4C0A A;  2Y5B B;  4IW0 A;  3P7Z A;  4BKG A;  3ZO5 B;  1V49 A;  2ZVO A;  1W1G A;  3ULC A;  1LFD A;  1FHW A;  1FGZ A;  4HPL B;  3HM3 A;  2KCJ A;  1E7V A;  2LGD A;  2ABD A;  3UIN B;  2J0M A;  4MM3 A;  3OAW A;  3VTV A;  2GBN A;  1Z87 A;  5J18 A;  2KX3 A;  3QAR A;  2O2V B;  2UZS A;  2BYF A;  2CY4 A;  3HK0 A;  2L0F A;  1PMS A;  1Y8R C;  3TW1 A;  3CST A;  1EGX A;  1WGD A;  4WSF A;  2DN6 A;  2KJR A;  2Z0D B;  3VUY A;  5FI0 A;  3VHT C;  2IFS A;  2LGX A;  4F7Z A;  4HAU B;  2KDI A;  2CAY A;  5LOP B;  2X18 A;  3KW5 B;  4HVB A;  1UBI A;  1H10 A;  2N23 A;  3AU5 A;  4PS3 A;  3PV1 A;  3A98 B;  4KHB B;  5TR5 A;  1BTN A;  2L76 A;  4ANU A;  1WG7 A;  2IYB A;  2N7E A;  3EPY A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  1P6S A;  4JKA A;  5BO4 B;  2JRI B;  1X1M A;  1V81 A;  4HAX B;  4ICV A;  2LYD A;  1Z5S B;  1K5D B;  4DBG A;  2Y8F A;  4HK2 A;  4HWI B;  2V3S A;  1VD2 A;  2KD0 A;  1V89 A;  1UNR A;  4ZYN A;  4KVG B;  5CTR C;  5D6J B;  3NOB A;  4KDI C;  2L00 B;  1U5G A;  2JF5 A;  1SHC A;  4IFS A;  2AWT A;  3E9L A;  2L1C A;  2KKC A;  3GZN I;  4PNK A;  3ZTC A;  3RZW C;  5D3Y A;  1VBG A;  1V9J A;  2PJH A;  2GBM A;  2GCJ A;  3L08 A;  1TBE A;  3MJW A;  4NY0 A;  3ZNH B;  2I5C A;  2IO1 B;  2ZVN A;  3X0W A;  2YT0 A;  2KTR A;  4E3C A;  2UWQ A;  2KMC A;  5D2M B;  2CHW A;  2KWC A;  4CHJ A;  3D8E A;  4DWF A;  3KH0 A;  4F8C B;  3A9K B;  5EFX A;  3BIN A;  1J0G A;  2EMS A;  1WX7 A;  1F9J A;  1GJZ A;  2Z0E B;  3ML4 A;  4MJS A;  2NMB A;  3HIZ A;  2KUP A;  1WXM A;  2CRF A;  3MHS D;  4AWJ A;  3JVZ X;  3SD5 A;  2RD0 A;  4GN1 A;  2MRP A;  3N3K B;  3SNH A;  4M0W B;  2DZM A;  1WH3 A;  2OJR A;  1WI0 A;  3TJP A;  2BPS A;  3E9O A;  4K1R B;  3ZNG C;  2K8C A;  2DZJ A;  1V5O A;  2Y7B A;  4F7H A;  2DAF A;  4N9F 4;  1OGW A;  2NPT A;  4J6I A;  1NVL A;  1SE9 A;  3ZNI D;  2HTH A;  3AUL A;  5IJM A;  2LVO A;  1WJ6 A;  1SGH A;  2C60 A;  2KFK A;  3G9W A;  2DYN A;  2HRJ A;  1HE8 A;  4Z2N A;  3N30 A;  2BWF A;  3QAQ A;  2VRR B;  5DIF B;  1WMH A;  4I6P A;  4II3 B;  3BY4 B;  4DX8 A;  3O96 A;  1WGU A;  2MBH A;  4AJY B;  1XT9 B;  4BOZ B;  4M8N A;  4ASW C;  1ZVR A;  1XD3 B;  4W9F A;  2LZ6 A;  2XK5 A;  2LRW A;  3KRX A;  4NJ6 A;  1WGG A;  1TGZ B;  5DCN A;  1U5D A;  2JP2 A;  2ROZ B;  5E6O A;  2V1Y A;  1P9D U;  1UEL A;  3R7R A;  2KQ7 A;  4IUM B;  5IAA C;  4OVV A;  1WJ1 A;  2JT4 B;  2P0F A;  3T06 A;  4GMX B;  3DVG Y;  2YSZ A;  3TBL D;  4PYU A;  5JHA A;  2M17 A;  3VXW A;  2K8B A;  4KSK C;  4MEL A;  3UIP B;  1W1D A;  1WGY A;  2JZZ A;  3DCG A;  4HXD A;  4GXB A;  1BT0 A;  2EC1 A;  4JK7 A;  4DHJ B;  1BTK A;  3M95 A;  4TKN A;  1FOE A;  1QZE A;  2M14 A;  5C79 A;  1FGY A;  3KZ1 A;  1P3R A;  1JDE A;  1P0R A;  3PVL A;  2I5F A;  1P1A A;  1ZC4 B;  2CU1 A;  4KAX B;  3ZDT A;  1IP9 A;  1R4N I;  2W2W A;  2VSZ A;  5LXI B;  3VTU A;  2KDB A;  2OOB B;  5FR6 A;  2FJL A;  3IVF A;  3R3M A;  1Q0W B;  2OTX A;  1E90 A;  2ELA A;  1MIX A;  2DX5 A;  4URK A;  2LUL A;  1LM8 B;  5D3X A;  2G45 B;  3GYP A;  3SV1 A;  4LDT B;  1W1H A;  3H7S A;  1EO6 A;  3VOQ A;  4EFO A;  4EUT A;  4II2 B;  3WAP A;  4AJW A;  1TJ6 A;  2DZI A;  3KYC D;  2YT1 A;  1KI1 B;  2PZ1 A;  2DZK A;  4TQ1 A;  5D27 A;  3CMM B;  3VDZ A;  4LDT D;  1KBL A;  1VCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...