2D11A

Crystal structure of the radixin ferm domain complexed with the nherf-2 c-terminal tail peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 83
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d11A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d11A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d11A01
2O6VA 4MSMB 4MGZE 1L2NA 1LM8B 4W9DA 3KUCB 1LQBA 3JYUA 4MSQB 2ZZPB 2DTCA 2KDIA 2NBWB 3GZNI 4RMAA 3DVGX 2KC1A 1WGUA 2MW5A 4MJSA 4NY0A 3ML9A 3PV1A 1UPQA 3A1QA 1Z5SB 2KVRA 4ANXA 3SU8X 3PSCA 3H7SA 2NMBA 1U2BA 1V9JA 4LDTD 4A6HA 2Y8GA 2AEHA 2L8JA 2DFKA 1IPGA 1OY2A 3DQVA 4PS7A 3UGBB 5J3QA 1OGWA 1NTVA 1IYFA 5CHWA 4EFOA 3PHXB 2JRHA 4I6NB 3UINB 3SNHA 4WWPA 2MX2A 3APCA 1YD8U 4IWQA 1Z87A 3H1UA 2DYMA 4NSWA 4W9IA 2DHZA 3RD2A 3RYTA 3PPAA 4CO7A 2LKOA 2DAJA 1W1HA 5JZEB 4IFSA 5DH9B 2ZVOA 3KYDD 5C1ZA 2K8CA 4P7IA 1P0RA 4B9KA 1NI2A 2EC1A 1R4NI 5C16A 2MP2A 3PTFC 2BWFA 3ODXA 4EKUA 2N9EB 3M3JA 3NY5A 2ZNVB 2JF5A 3KY9A 2A5UA 1FGZA 2BYVE 3FM8C 1V5OA 2DENB 1XD3B 3NHEB 2CRFA 3UIOB 2K8BA 1MK9B 2DHJA 5J3TA 1U27A 2KFJA 4IWOA 1BTKA 2COCA 3ML8A 1WJNA 2H7DA 5DHFB 3LJ3A 5LOPB 1WM3A 2KDEB 3PT2B 2KO3A 3QX1A 4HJKA 1G6JA 2PE6B 5DHAB 1E90A 1V89A 1KI1B 1UGMA 4ANWA 2I5FA 2DHIA 2KD0A 2KMAA 1MIZB 1WY8A 3QC8B 4WAAA 4GMXB 4WJNA 4E3CA 4URKA 2RSGA 1E8YA 2EKEC 3L08A 1WIAA 4HCPB 2I5CA 3GYPA 2D07B 2HJ8A 3Q3FA 1C3TA 1OTRB 1YJ1A 3U30A 4HDQA 1Y19B 4BOSC 3KUZA 3WIMA 2WX1A 3PLUA 2Z0EB 4HWIB 4HB3B 2LD9A 4TKNA 1GC6A 3CMMB 2ABDA 1YX6B 1WZ3A 2DZIA 2MCNB 4II2B 4XX5A 3LDZE 2R2QA 4K7SA 2D4QA 2KZRA 5C5BB 1RLFA 2N9PC 3SUZA 1ST7A 4EZKA 1LB1A 2W9NA 3WAOA 2MRPA 2HTHB 4Z2NA 1NTYA 1WRDB 1I7AA 3HM3A 5JLJB 5L95C 3L10B 1Q0WB 1I42A 1PFJA 1ZC4B 4HPLB 1DDVA 4KDLB 1J0WA 2PE9A 3CF6E 4HAVB 1GUAB 3ZTCA 2JPHA 3RT3B 3ML4A 3D8DA 5E6PA 1ZVRA 2G4DB 1ZM0A 2AWTA 4I6LB 2LZ6A 3DXEA 2QHOA 5DPSA 5JHAA 3A8QA 3VTVA 2N7EA 1WMHA 2Y7BA 3B08A 4NJ7A 2NVUI 1KZ7A 1TGZB 3V6CB 4KAXB 2KXJA 2KTRB 2CAYA 3QQ8B 2D9VA 3VOQA 2KDFB 3TMPB 4KHBB 1J19A 5KHOA 2M8SA 5CHVC 3NZUA 3ULBA 4WJPA 2N4FA 2RD0A 4AJWA 2EJ8A 2MDXA 3M95A 5D7GA 3MPXA 3KW5B 1N3HA 2CU1A 2LXAA 5J17A 3CSTA 2HTHA 1KLVA 2WYQA 4NAWB 4IM2A 3TJPA 4N9F4 2RGFA 1Q1OA 2N23A 5IA7A 3V5WA 2KANA 2DYQA 1XQQA 1V5MA 4RM9A 1WM2A 5DI9B 1WXAA 3B1LX 2JT4B 4FHJA 4X57B 4IAPA 4HAZB 3FEHA 3PS6A 2V3SA 5HE3A 3ODWA 4HXDA 1UD7A 2UZSA 4GGQA 2Z0OA 1HB8A 4JGHB 1K8RB 2BYFA 4ZRKA 1PLSA 1WI0A 4GSWA 4WJ7A 4GN1A 1ACAA 4IM3A 2GOWA 1FB8A 3UQAA 4ZDVA 3GOEA 2DX5B 1VCBA 2RPQA 1TTNA 1ZGUB 2Z0DB 1W1GA 4F7GA 2KTRA 2G35A 1MAIA 2RVBB 1XODA 2JY6A 2K2UA 3A4RA 5D27A 2YS1A 4II3B 2EMSA 3ZNHB 1WH3A 3ENEA 4HB0B 4WJQA 4W9JA 5D3VA 1V5UA 2E2XA 1FHXA 2KWUB 4FJVB 1WXVA 4XC2A 1M94A 3SO6A 2LXCA 3R7RA 3QK0A 3ULCA 3N7CA 1WGYA 1GJZA 4GDKB 3BJIA 1I35A 1FHOA 4LJOB 4GU2A 5JH5C 1OEYJ 2ASQA 2CY4A 4HAXB 1SHCA 4GZUA 4HAWB 4MY6A 2IY1B 2D3GA 5IAAC 4EZLA 4BBKA 1X1GA 2LVQA 4BOZB 2WX0A 1V86A 4KVGB 1TBEA 3PRZA 4KV2A 3ZLZA 3APDA 2FJLA 3L17A 3DBHI 2FCSA 5CLLB 2FJ9A 3A8PA 2OOBB 5KHQA 1GG3A 1P3QU 3DXDA 3QCAA 2BYEA 3T06A 1D3ZA 2WWZA 5CHFA 2JVCA 2YRYA 1UELA 2CHXA 4A3PA 2D9ZA 2V1YA 4KHOA 3KH0A 1HE8A 5LONB 1V6EA 3MDBC 1AQCA 3JVZX 3B0AA 2DZJA 2CHWA 2KFKB 4BKSD 4GOCA 4AUQC 2XK5A 4LDTB 2UYZB 1AWEA 3H6NA 4FLHA 2R2OA 2WH5A 1WGRA 2D10A 3A9JA 3HIZA 3T8MA 1RRPB 5E6OA 3VUWA 4GDKA 3DVNV 3QA8A 4BKSA 1GNUA 4HATB 2LYDA 4JQWC 5HE1A 4CHJA 2KQ7A 3HK0A 3NSUA 2FNJB 1JRUA 1V81A 1UBQA 4G11A 3PRPB 2GBJA 3HW2B 3WALA 2LGXA 2KKCA 1XR0B 3F5RA 3EFUA 2MP2B 3ZRFA 3QAQA 3RZWC 2C7NB 2IZVB 3W1SA 3VUXA 5C6RA 5DCNA 4G50A 1B55A 2BPSA 2Z0QA 2NPTB 2M14A 3DVNU 2C60A 3QWMA 3OAWA 2RGNB 2AYOB 3QIJA 2ADZA 2LWPA 1LXDA 1QQGA 3A9KA 3L54A 4RM8A 5D2MB 2W2WA 4MGKE 1NU2A 3TW1A 5C79A 1MKEA 1X11A 1YIWA 2X18A 1V5TA 2KJ6A 3AU5A 3CIKA 3A98B 2MFQA 3HM6X 2L1CA 2KFKA 2D9XA 2PZ1A 2IY0B 4K2OA 1H10A 5DIFB 3EHVA 3WAPA 1V5PA 2P0FA 5DPWA 4W9KA 3IHPC 1IRSA 1WF9A 2KDBA 2YF0A 2BGFA 3V62A 2DYBA 4XZ4A 3D32A 4FN2A 3DXCA 2FAZA 3NZSA 3V6EB 3WYFB 2MLBA 2JP2A 5CX3A 2K6QA 3V61A 2JZ3B 2LI5A 2K39A 4CHKA 4TUUA 1WR6E 3SD5A 3L0WB 3QHTA 3W1YA 2L3ZA 3DCGA 2NPTA 3ZO5B 2RNRB 4Y94A 1WX9A 5D3XA 4TYZA 2CKHB 1SGHA 1RFAA 5LLIA 3OJ4B 2D2QA 1WXSA 3VIAA 4KHAA 1FHWA 1U4AA 2KUPA 1YQBA 1UPRA 3JSVA 3V60A 2QKMA 1U5EA 4FBJB 4A5KA 1DBHA 1T0YA 4IW0A 2GJYA 2CODA 2DHKA 3EC8A 3ZDTA 2M17A 3H7PA 3TL5A 3L16A 4MH0E 1EO6A 1P98A 2LGDA 3A33B 2V4LA 3PLVA 4ZRJA 3ONSA 3W1SC 2D9WA 3DPDA 3PSEB 2IYDB 1VD2A 5JHGA 1WMHB 2DYNA 2G4SA 2CQUA 4KSLC 2FIFA 4LJPB 4WQOB 1Q5WB 2LASA 4BFRA 1H4RA 3RCZA 2FDQA 2I1JA 4G0NB 3AJ4A 3TCAA 2ZPYA 1MPHA 3CXBB 4NQLB 2ROZB 3ZVRA 2K8HA 2N7DA 3N3KB 1ISNA 5GOWB 3ZNZB 2GBMA 4HAUB 1WJUA 1FAOA 4FJYA 1P5TA 2C9WB 3KYCD 1NDDA 3EPYA 3N32A 3QWZB 5D3WA 4DHZE 2LJ5A 4ANVA 2DZMA 3R3MA 2FIDA 1V80A 1GC7A 3AULA 4W9FA 2MQJA 3X23A 1OQNA 4W9LA 2DLWA 1MG8A 4WSFA 4KDIC 4DBBA 3DBRI 1Y8RC 3AXCA 2ZCBA 1Y5OA 5DPRA 1FGYA 2GBRA 3DDCB 1OQYA 5EDSA 3AI5A 2A4ZA 5L83A 4MEMA 1YX5B 4L6EA 2PJHA 3ZKJC 4DWFA 3TFMA 3ALBA 1V2YA 4DDID 2NCNA 2FCQA 1QZEA 3PG7A 2JRIB 2MBOA 1WGQA 3PGEA 2MBEA 3VHTC 5E6NA 5G2NA 1SE9A 3K9OB 4WVFB 1WJ6A 2LG1A 2HE7A 1E8ZA 2JWZA 3VXWA 4FHKA 2K1FA 3P2BA 3IG3A 3VDZA 3VTWA 4NJ6A 3RZFA 2L0FA 3MHSD 2KMCA 2KWCA 4MDKE 4LCDE 2P8VA 2BKRB 2G45B 2C7MB 2DAFA 3TVVA 1LW3A 4HDOA 5AZHA 5KQ1A 3KUDB 3DVGY 2K00A 4HVBA 2KK8A 4DHJD 4EUTA 2NBUA 1UNRA 1XT9B 1HBKA 1ZC3B 4F1SA 1WYWB 4F8CB 4BVUC 3KSYA 2KLCA 3DBLI 2R09A 2YVCA 2CY5A 4K17A 4MT7A 2KQSA 3G9WA 4TV3A 2Z59B 2P0HA 2BCJA 2VRRB 4NQKE 1WX7A 5D94A 1SIFA 1KOTA 1V61A 2HD5B 1S3SG 1OEYA 2VRWB 2JZZA 2N0YA 2KHWB 2XK5B 1BTNA 2ROVA 3T9LA 3ZTDA 4IG7B 3OANA 3PEGA 2OJRA 3A9JB 2KN5A 2DKQA 2W2XD 2IFSA 4MK0A 4PQ0A 1HB6A 3PHWB 3SHQA 4MGIE 2MWSB 3PRMB 4K81A 2HRJA 3K9PB 3FLVA 4F7ZA 4PNKA 4EMOA 2FUHB 4ICVA 4EJNA 3VH4B 2COFA 1K5GB 3VUYA 1Q67A 4G3XB 4D0NB 2PPHA 2COPA 2KTFA 2M1MA 1TJ6A 1KZGA 4PS3A 4AP4C 2UVMA 4PS8A 1WI1A 4A20A 2GBKA 3MJWA 3M62B 3A9KB 2GCJA 2XEWA 5J3YA 2ZVNA 1WGHA 3KZ1A 5LXHA 3L13A 1WJ4A 4IUMB 1AARA 2MBHA 2EMTA 2FCMA 2MWNB 2FCNA 2MBBB 3CSFA 2RSUA 4YONA 3TIXA 3RUIB 2KCJA 4JLCA 2COAA 3JW0X 2DA0A 3PREA 1NBFC 2KLGA 1XD4A 5LXIB 1X86A 1X1MA 3UIPB 1FXTB 1UNQA 4IWPA 2O6VD 5KQ4A 1NVLA 4EOYA 3KRXA 3VQIA 2GMIC 4F7UP 1XCGA 2OTXA 4M0WB 3WANA 3IFWB 1TXDA 1A5RA 1UEFA 4B6WA 4GMVA 4GPTB 1V49A 2BF8B 3HHMA 2NR2A 4WJOA 4GXBA 3D8EA 5FR6A 2D9YA 1NTIA 3ZUNA 2LRUA 1P3RA 5HE2A 4EZJA 3VH3B 4CHMA 2J0MA 3DBSA 2ZEQA 2RQ1A 2CR5A 4CYEA 2ELAA 4FADA 2ZPNA 2R0DA 4MELA 2NS5A 3P6AA 4KZ0A 3QARA 5KCVA 4YL8A 2YS3A 3JSVB 4E71A 2JXXA 4M8MA 3NOBA 2AL6A 3BY4B 2LRWA 3ZVVA 3H7PB 2YT0A 2KC2A 2W2XC 3MTNB 2XQNM 3VVWB 1WE7A 1ZKHA 1UBIA 4IC7B 5HKHA 1BAKA 4HHVA 1U29A 4KIKA 2YS5A 3Q3JA 2L05A 3HQCA 5CTRC 3R7QA 5BO4B 1DROA 1MIXA 4HAYB 4HCNB 4ZRIA 3OLMD 1J8CA 1M7EA 4MGYE 3M63B 4IOYX 4HLEA 2KWVB 4JL9A 3IVFA 3ODOA 1C1YB 3PZDA 3U7DA 3DOWA 2NZ8B 2IBIB 1P9DU 1XKEA 4J6IA 2IO1B 4HB4B 4A6FB 1WJMA 3R66C 2V76A 2LOXA 2YSZA 4I6PA 3AU4A 4WWNA 1EGXA 2D11A 1DDMA 2ZJDA 4TQ1A 2MBQA 2O2VB 3U8ZA 1EUVB 3FSSA 4HPMB 1KM7A 4DBGA 5AEKB 5EFXA 2KX3A 1F9JA 2K2JA 2J0KA 4KSKC 5JP4A 4BKTA 4HK2A 4M8NA 1P6SA 3OJ3A 1WJ1A 4NNJB 2REXA 2UZRA 2BWES 3I3TB 2CS4A 5GMVA 2GS0A 1H8CA 2RR9A 1RAXA 4AOFA 4MM3A 1RJ2A 5DPTA 3N30A 2I1KA 4WWOA 3QBVB 3FP5A 2L2IA 3ECIA 4FJZA 2AL3A 5J2RA 1XX0A 3BINA 2KX0A 3M1IB 1X1FA 2J7QB 3RCPA 2BKFA 3UF8A 4W9HA 2M4NA 3APFA 4W9CA 1ZSQA 4A3OA 3ZRCA 2N1VA 1RRBA 5HE0A 4A6FA 5J18A 1WGDA 2GCLA 1LFDA 2LGYA 1WZ0A 3D8FA 2RLOA 3C0RB 1BT0A 1QC6A 2O2VA 4ICUA 4FA6A 3WA0A 5TR5A 4W9GA 2LULA 5D3YA 1J0GA 3SDLC 1WXMA 4BKGA 2B3AA 2VSZA 1ZW7A 4K7UA 5JHBA 2OQBA 1EAZA 1DYNA 3S2AA 2KGXB 2N1WA 3KVFB 1WR1A 3QJZA 4C0AA 1CMXB 1WG7A 4IM0A 4AJYB 2YT1A 2IO0B 1E8WA 2VKIA 4DHJB 4PYZA 1W1DA 4ZYNA 1K5DB 4GIVA 2PEAA 2KJRA 4Z2MB 5FI0A 3LJUX 5L81A 1X05A 2LOZA 4ANUA 1Z2MA 2K25A 1U5FA 2C5LC 5JHHA 3ZIMA 3UQBA 4GB9A 2CB8A 2ZCCA 4FULA 2Q13A 3NS8A 1WGGA 5C5BA 2KNBA 1U5DA 2MA9B 2G3QB 4K2PA 4ASWC 3X0WA 2JUOA 4B6HA 1WX8A 2J59M 2DZKA 2IO3B 1DDWA 1E8XA 5AZFA 3VAWA 3EECA 1UNPA 2L0TA 1FOEA 2LUEA 3ZNID 2DX1A 2MSED 4K7WA 5C23A 3GYOA 2H7EA 4B95A 4GDLB 4F7HA 1M7RA 4H8SA 4PYUA 1E7UA 3KRWA 3RULA 4BBNC 3SYXA 3VTUA 1IP9A 1P1AA 2ZNVC 4JIOU 1I2HA 3PVWA 1PMSA 2XBBC 2J0JA 1OMWA 3PVLA 5AZGA 1L7YA 2M0XA 3PP2A 4OVVA 2DN6A 2QKLA 3ZNGC 1E7VA 2M38A 1E5WA 2DKPA 1TZ1A 4W9EA 2LBBA 2KJHB 1U5GA 3ZDMC 2DYOA 4NPNA 4DK5A 2K6DB 3O65B 2GBNA 4XWXA 1MK7B 2NBVB 5IJMA 3TBLD 1EF5A 4NAWA 2Y5BB 4OVUA 1R4MI 3WAMA 1KJTA 2O6VB 1WE6A 4HB2B 2IYBA 4BBNF 3O96A 4GDLA 2WDTB 3UZTA 1V88A 4DHZB 2LVOA 1UH6A 5D6JB 4DXAB 3F0WA 3ZW3A 4MJSB 3A4SC 2UWQA 3IBEA 4DDGD 2L76A 2C7HA 1S1QB 2ELBA 2RUKB 1BWNA 3P7ZA 3A1QB 2DX5A 2LVPA 4KZCA 3VFKA 1WFYA 1WVHA 4E74A 2KOXA 3SV1A 4DX90 4DX8A 4TQ0A 2N9XA 3TO1A 2Z0PA 1TQZA 1PQSA 2L00B 4A6KA 2YLMA 1EF1A 5FI1A 1EVHA 5G55A 3PVUA 5CLQB 4KIKB 2MKRA 3H9DA 4EEWA 2CHZA 1UZXB 2L7RA 4K1RB 2IO2B 4AWJA 2Y8FA 2P0DA
chains in the Genus database with same CATH superfamily
2O6VA 4MSMB 4MGZE 2WLBA 1L2NA 1LM8B 2CU3A 4W9DA 3KUCB 1LQBA 3JYUA 4MSQB 2ZZPB 3NJTA 2DTCA 4OZAA 2KDIA 2NBWB 3GZNI 4N59A 4RMAA 2BB5A 3DVGX 1KLUD 2KC1A 1WGUA 3RNGC 2MW5A 4MJSA 2WDVB 4NY0A 3ML9A 2FBWB 3PV1A 3Q3NC 1UPQA 1JMLA 1NVID 3A1QA 1MG4A 1Z5SB 2KVRA 4K3BA 4US9A 4ANXA 1AYFA 2H89B 2KMMA 3SU8X 2Z14A 3PSCA 4C7YA 3H7SA 1P7FA 2NMBA 1QOGA 2PMVA 1U2BA 1V9JA 4LDTD 4A6HA 2UU7A 1YJJA 2Y8GA 2AEHA 1QT9A 3FILA 1L5PA 4YTPB 2L8JA 2LHDA 1T5XD 2DFKA 1IPGA 1OY2A 1ENFA 3Q8AA 3DQVA 4PS7A 3UGBB 5J3QA 1OGWA 1UF0A 4PT5A 2V4IB 1NTVA 1IYFA 5CHWA 1DOYA 1NYRA 4EFOA 3PHXB 4ARCA 2JRHA 3NW8A 4I6NB 3UINB 3SNHA 4WWPA 3SBGA 1SBBB 2MX2A 2DLBA 3APCA 1PGAA 1YD8U 1YQ4B 4IWQA 1Z87A 3ZXRA 3H1UA 2DYMA 4NSWA 4W9IA 2YEPB 2DHZA 3RD2A 3RYTA 2GLSA 1E9MA 3PPAA 4CO7A 2LKOA 2DAJA 2ICIA 2WXFA 4XDDA 1W1HA 5JZEB 4IFSA 1T0QC 5DH9B 1NENB 2ZVOA 3KYDD 2WXQA 3PZ7A 3SR6A 5C1ZA 2KT7A 3ZJTA 2K8CA 4P7IA 1P0RA 4B9KA 1NI2A 2EC1A 1R4NI 5C16A 2MP2A 1FXIA 3PTFC 2BWFA 3ODXA 4EKUA 1HXYD 2N9EB 2WXNA 3M3JA 3NY5A 2ZNVB 2INNE 2K5PA 3HIEA 3KY9A 2JF5A 1L6UA 2A5UA 3NVZA 2L1AA 4JKGB 1FGZA 2BYVE 3FM8C 5HG2A 4GLSC 1V5OA 2DENB 2N7JA 3I5JC 1XD3B 3NHEB 2CRFA 5IN7A 3UIOB 2K8BA 3N1YC 1MK9B 2DHJA 5J3TA 1N5XA 3FAHA 1U27A 2KFJA 1BTKA 2COCA 4IWOA 3ML8A 1WJNA 2H7DA 1C78A 5DHFB 3LJ3A 1JDEA 4LNIA 5LOPB 4YTNB 1WM3A 2KQ4X 2KDEB 3PT2B 2KO3A 3QX1A 1YOVB 4HJKA 1G6JA 2PE6B 5DHAB 1TIFA 1TKEA 1E90A 3ENBA 1V89A 1KI1B 1UGMA 4ANWA 2I5FA 1D6EC 2DHIA 2KD0A 2KMAA 5IOIA 1MIZB 1WY8A 3QC8B 4WAAA 4TSSA 4GMXB 4WJNA 4E3CA 3AE4B 4URKA 2RSGA 1E8YA 3DWMA 2EKEC 3L08A 1WIAA 4HCPB 3LYYA 1R4MB 2I5CA 3GYPA 2D07B 2HJ8A 3Q3FA 1C3TA 1OTRB 1QOBA 1YJ1A 3U30A 3EA6A 2WDQB 1JWSD 2LGSA 2Y3AA 4HDQA 1Y19B 4BOSC 3KUZA 3WIMA 4YSZB 2LHEA 1MJDA 4OSNA 2WX1A 2KUQA 3PLUA 5H8YE 4A55A 2Z0EB 2QMTA 2N0SB 4HWIB 4HB3B 2H88B 2LD9A 3Q3MC 4TKNA 1GC6A 3CMMB 2ABDA 4C80A 3I9V1 1YX6B 1WZ3A 3IAM1 3RNBC 3DHIC 2DZIA 2WDRB 1KTKA 2MCNB 4II2B 4XX5A 2K8EA 3LDZE 2PLPA 2R2QA 1RFKA 4JKGA 2D4QA 2KZRA 5C5BB 1RLFA 4K7SA 2BW2A 2N9PC 3Q8BA 1M4VA 5HHDG 2V3NA 3SUZA 4ARIA 2L52A 1ST7A 4EZKA 1LB1A 3Q8CA 2ZW0A 2W9NA 3WAOA 3O13A 2MRPA 2HTHB 4Z2NA 2Q5WD 2JU6X 4USAA 1NTYA 1WRDB 1I7AA 3HM3A 5JLJB 5L95C 3L10B 1T0SC 1Q0WB 1I42A 1PFJA 3KWVA 1ZC4B 4HPLB 1DDVA 4KDLB 3Q14C 4P16A 1J0WA 2PE9A 3CF6E 2FJUB 5JVLA 4HAVB 3LXFA 4N58A 1GUAB 4EE2A 1RYJA 3ZTCA 2PIAA 1QLBB 2JPHA 3RT3B 2MEKA 3ML4A 3D8DA 2BT6A 3Q8EA 5E6PA 1ZVRA 2G4DB 2J42A 2MJDA 1ZM0A 2AWTA 2GRIA 4XDCA 4I6LB 2LZ6A 4JKFA 3DXEA 2QHOA 5DPSA 1JWAD 5JHAA 1XLQA 3A8QA 3VTVA 2N7EA 1C77A 1WMHA 2Y7BA 3B08A 3AE8B 4NJ7A 2NVUI 3U7ZA 1KZ7A 1TGZB 3ZGZA 3V6CB 4KAXB 3OG5A 2KXJA 1FEHA 2KTRB 3GZNB 2CAYA 3QQ8B 2D9VA 1I4XA 3VOQA 2KIEA 2W3RA 5D3IB 2KDFB 3RNEC 3TMPB 4KHBB 1J19A 5KHOA 3DCXA 2M8SA 5CHVC 3NZUA 1B9RA 4KX6B 3ULBA 4WJPA 4WAFA 2N4FA 1FD6A 2RD0A 4AJWA 2EJ8A 2DBYA 2MDXA 3M95A 5D7GA 3MPXA 3KW5B 4Q2JA 1FO4A 2ZW1A 1N3HA 3NWAA 3T3NA 2CU1A 2LXAA 2WXKA 1UNSA 5J17A 3CSTA 2HDEA 2HTHA 1KLVA 2WYQA 4NAWB 4IM2A 3TJPA 4N9F4 2RGFA 1Q1OA 2N23A 4UDUC 5IA7A 3V5WA 2KANA 3ZJUA 2DYQA 1XQQA 3TEWA 1V5MA 4RM9A 1WM2A 3AEAB 5DI9B 5FK9C 5MPOA 1WXAA 1TKYA 3B1LX 2JT4B 4FHJA 4X57B 4IAPA 4HAZB 3FEHA 3PS6A 2FE8A 2V3SA 5HE3A 3ODWA 4HXDA 3NVVA 1UD7A 2VH1A 2UZSA 4GGQA 2Z0OA 1ZUD2 4REZA 4MACA 1HB8A 5IKCM 2BYTA 4JGHB 1K8RB 2BYFA 4ZRKA 2BS4B 2INDC 2GB1A 1PLSA 1WI0A 4GSWA 4WJ7A 4GN1A 1ACAA 4IM3A 2GOWA 1FB8A 3UQAA 4ZDVA 3GOEA 2DX5B 1VCBA 2RPQA 1TTNA 1ZGUB 2Z0DB 1W1GA 4ILHA 5AUKA 2PVOD 4F7GA 2KTRA 2BTEA 2G35A 3E9OA 3AEEB 1MAIA 4P6VF 2RVBB 3Q6BA 4JK7A 1XODA 1VBGA 4L1RA 4DXGA 2QEJC 2JY6A 2K2UA 3A4RA 2QSDA 5D27A 2YS1A 2WXIA 4II3B 2EMSA 3ZNHB 1WH3A 5IP4D 3SEBA 3ENEA 4HB0B 3NVWA 4WJQA 5GXGB 4JWSC 4W9JA 5D3VA 1V5UA 2E2XA 1SEBD 1FHXA 4LNKA 1EWYC 2KWUB 4FJVB 1WXVA 2QILA 1FCLA 4XC2A 1M94A 4JPSA 3SO6A 2LXCA 3R7RA 3QK0A 3ULCA 2KR0A 3N7CA 1WGYA 1GJZA 4GDKB 4AS1A 3BJIA 1Q10A 1I35A 2I38A 1FHOA 4LJOB 2SEBD 2NTTA 4GU2A 5JH5C 1OEYJ 2ASQA 1UWXA 3KLSX 1QKZA 2CY4A 3VR9B 1YQ3B 4HAXB 1SJHD 2KDMA 1TS3A 1SHCA 4GZUA 4HAWB 4MY6A 2IY1B 2D3GA 5IAAC 4EZLA 4BBKA 1X1GA 1OQQA 2LVQA 4BOZB 4HEA1 2WX0A 4XE0A 3NRZA 1V86A 4KVGB 1TBEA 1JWMD 2MJEA 3PRZA 4KV2A 3ZLZA 3APDA 4QJ4B 2FJLA 1J7CA 3L17A 1MPEA 3DBHI 2IJ0A 2FCSA 2X8XX 1SJED 5CLLB 2FJ9A 3A8PA 1JWUD 2OOBB 5KHQA 1GG3A 5G5HA 1P3QU 1PGBA 4JKHA 3NG0A 3DXDA 1QQRA 3QCAA 2WHIA 2BYEA 3T06A 1D3ZA 3Q2AC 4XWWA 2WWZA 3U12A 5CHFA 1YJIA 4YSYB 1K50A 2JVCA 2YRYA 1UELA 2CHXA 4A3PA 3DWGC 1E10A 1ZP0B 2D9ZA 1K52A 2V1YA 2PW9A 4KHOA 2Z59A 3KH0A 1HE8A 5LONB 1V6EA 3MDBC 1AQCA 1R7SA 1V97A 3JVZX 3B0AA 3P42A 2DZJA 2LUMA 2CHWA 1E0ZA 2KFKB 4BKSD 4GOCA 1FRRA 1SE4A 4AUQC 2XK5A 4LDTB 2UYZB 3RFZB 4RH6A 4NJCA 4PK1A 3NS1A 1AWEA 3H6NA 1FRDA 2LFIA 4FLHA 2R2OA 2WH5A 1WGRA 2D10A 1WRIA 3A9JA 3HIZA 3T8MA 1RRPB 5E6OA 3VUWA 4GDKA 3DVNV 3QA8A 4BKSA 1GNUA 4HATB 2LYDA 4JQWC 1J7AA 3LB8C 4A90A 5HE1A 3P4SB 2VZKB 4CHJA 2KQ7A 2NMQA 3HK0A 3NSUA 2FNJB 2WXOA 1JRUA 1V81A 1UBQA 3UI3A 4G11A 3PRPB 2GBJA 3E9LA 4JK9A 2GUMA 3HW2B 3WALA 2LGXA 2KKCA 1XR0B 4R3DA 1C4PA 1GAQB 2JZPA 3F5RA 1EWCA 3EFUA 4S17A 2MP2B 4YXDB 3ZRFA 3QAQA 2KAJA 3RZWC 3W5UB 2C7NB 1BXTA 2IZVB 1CK1A 3W1SA 2PKOA 3VUXA 1JRPA 1XLNA 2DWQA 2LMCA 3FC4A 5C6RA 4G50A 1L6VA 5DCNA 1JQ4A 1B55A 2BPSA 2Z0QA 2INCC 2NPTB 2M14A 3DVNU 2C60A 3QWMA 3OAWA 1VZ7A 3BZDB 2RGNB 2OHFA 5EE0A 2AYOB 3QIJA 2V9HA 2ADZA 3IT6B 4RGTA 2LWPA 1LXDA 1QQGA 1PGXA 3A9KA 3L54A 3AECB 4RM8A 5D2MB 2W2WA 4MGKE 5M4YB 1NU2A 3TW1A 5C79A 4WQMA 1MKEA 1X11A 1YIWA 3DHGC 4KGTA 2X18A 1V5TA 3B2FA 2KJ6A 3AU5A 3CIKA 4XGAB 3A98B 2JQRB 2MFQA 3HM6X 2L1CA 4DIXA 4O1NA 2KFKA 2D9XA 2W55A 2PZ1A 1TJEA 2IY0B 4K2OA 2B76B 1HZ5A 1KFYB 1IBXA 1H10A 5DIFB 2VZKD 3EHVA 3WAPA 1V5PA 2K49A 2P0FA 5DPWA 4W9KA 3IHPC 1IRSA 3U2SC 1WF9A 1VRAB 4YTMB 1CJEA 2KDBA 3HUIA 2YF0A 2BGFA 1TT5B 3V62A 2DYBA 4XZ4A 3D32A 1ZYIA 2L83A 1BUIC 1JWBD 4FN2A 1QF6A 2D3AA 3DXCA 2FAZA 2J52A 3AEGB 3NZSA 1HZ6A 3V6EB 3WYFB 1TS5A 2MLBA 1LGRA 2JP2A 5CX3A 2K6QA 3V61A 2JZ3B 2LI5A 4RCOA 2WS3B 2K39A 4CHKA 1TY2A 4TUUA 3RPFC 1WR6E 3TUOA 3SD5A 3L0WB 3QHTA 2IPKD 3W1YA 2L3ZA 1MI1A 3DCGA 2NPTA 3I63C 3ZO5B 2WXRA 2RNRB 5I4DA 4Y94A 4OW0A 4JK8A 1WX9A 1N63A 3IT4B 5D3XA 4TYZA 2CKHB 4WWMA 2R82A 1SGHA 1RFAA 5LLIA 2GI9A 4XWTA 3OJ4B 2D2QA 1WXSA 4US8A 4H2AA 3VIAA 4KHAA 1FHWA 1U4AA 1D5XC 2KUPA 3PO0A 4KKIA 4LTUA 1YQBA 1UPRA 1VJKA 2K0PA 3KWLA 3JSVA 3V60A 2QKMA 1U5EA 4FBJB 4A5KA 1DBHA 1T0YA 1DIKA 2XNAC 4IW0A 2GJYA 2CODA 2DHKA 3EC8A 3ZDTA 2YT2A 2M17A 1DOXA 1ROEA 3HSAA 3H7PA 3TL5A 3W5VB 1ZDVA 3L16A 1SE3A 4MH0E 1EO6A 1P98A 2LGDA 3A33B 3B77A 3AV8A 4C7ZA 2V4LA 3AE1B 3PLVA 4ZRJA 3ONSA 3W1SC 2D9WA 3DPDA 3C8YA 3H8HA 5JXVA 3PSEB 2IYDB 1VD2A 5JHGA 1WMHB 2KYWA 4JKAA 2DYNA 2G4SA 2CQUA 4KSLC 1F52A 2FIFA 4LJPB 4WQOB 1Q5WB 2LASA 4BFRA 1H4RA 3RCZA 2FDQA 2I1JA 2Z13A 4G0NB 1TY0A 3AJ4A 3DBHB 3TCAA 2ZPYA 4QAYA 4ZRPA 4LNNA 1MPHA 3CXBB 1XO3A 4NQLB 2ROZB 3ZVRA 1ET9A 4YWGG 1FPYA 4JKDA 1NI3A 2K8HA 2N7DA 4HJGE 1ISNA 3N3KB 5GOWB 3ZNZB 2BS3B 1C79A 1FNWA 2GBMA 5H92C 4HAUB 1WJUA 1FAOA 4FJYA 1P5TA 2X0SA 1UWMA 2C9WB 4QJ3B 3KYCD 1NDDA 3EPYA 3N32A 3T3OA 3VR8B 3QWZB 5D3WA 4DHZE 4LK0M 2KACA 2LJ5A 4ANVA 2DZMA 1QOAA 3R3MA 4DQOC 2FIDA 1V80A 2W82A 3ZYYX 5BMHA 1GC7A 3AULA 3HVDA 2HTME 2MQJA 4W9FA 3X23A 1OQNA 4HROA 4W9LA 2DLWA 1MG8A 4WSFA 4KDIC 4DBBA 3DBRI 4M00A 1Y8RC 3BK1A 3AXCA 2ZCBA 4D2KA 1PFDA 1Y5OA 4RGNA 1SF0A 1LO5D 5DPRA 2BS2B 1FGYA 1ZPSA 2GBRA 3DDCB 1OQYA 3NWDA 5EE3A 3AI5A 5EDSA 2RRFA 1F2RC 2A4ZA 1GGOA 5L83A 1A70A 4MEMA 1YX5B 4L6EA 2PJHA 3ZKJC 4DWFA 3TFMA 1VLBA 3A58A 3ALBA 1V2YA 1I4RA 3BVGA 4DDID 2NCNA 3MHZA 2G9HD 2FCQA 3FKYA 1QZEA 2WGSA 3PG7A 2JRIB 2MBOA 1UUPA 1WGQA 3ZXVA 3PGEA 2MBEA 3AE3B 3VHTC 4RGOS 5E6NA 3TSSA 1SXTA 5G2NA 1SE9A 3K9OB 1T0RC 4WVFB 1WJ6A 5E6JA 3U4EG 2LG1A 3I57A 2ZKMX 2HE7A 1E8ZA 3L4PA 2JWZA 3VXWA 5I2MA 1EU4A 2Z8LA 4IKGA 5TSSA 4FHKA 2K1FA 4YT0B 4DXFA 3P2BA 2D3CA 3IG3A 5G5GA 1KF6B 3VDZA 1ZDXA 3VTWA 1D5ZC 4NJ6A 3RZFA 2L0FA 3MHSD 3FVCA 1L0YB 2WXJA 2FUG1 2KMCA 4MH8A 2KWCA 4MDKE 4XYCA 4LCDE 2P8VA 2BKRB 1WXQA 2G45B 2C7MB 2DAFA 1FNUA 3TVVA 1MHXA 2JX5A 1LW3A 1WWTA 1HA5A 4HDOA 5AZHA 2WNMA 5HFYA 3AN1A 5KQ1A 3E56A 3KUDB 3DVGY 2K00A 1J7BA 4HVBA 1C9FA 2KK8A 5HI1A 4DHJD 4EUTA 2NBUA 3RNAC 1UNRA 3MC8A 1CQVA 1XT9B 2MHJA 1KRHA 4L1BA 3BVMA 2V0GA 1HBKA 1ZC3B 1JW9D 4RF1A 4F1SA 3KQ4A 3PZ8A 1WYWB 4F8CB 4BVUC 2DNFA 3P4PB 1D4BA 3KSYA 4TMAB 2KLCA 3DBLI 4P1CC 2R09A 2YVCA 1T6BX 2CY5A 4K17A 5BYRA 4MT7A 2KQSA 3AE7B 3G9WA 2RDHA 4TV3A 2Z59B 2P0HA 2BCJA 2VRRB 4NQKE 1FCCC 1WX7A 5D94A 1SIFA 2JSVX 1KOTA 1V61A 2HD5B 3AEBB 1S3SG 1OEYA 4C4VA 2VRWB 2JZZA 2N0YA 2KHWB 1VZ6A 2XK5B 1BTNA 1WSPA 4KGSA 2ROVA 2WXPA 3T9LA 3ZTDA 4IG7B 5D3DA 3OANA 3PEGA 2BQQA 4BZAA 2OJRA 3A9JB 3IAS1 2KN5A 4OT1A 2SAKA 1HEZE 2DKQA 5EE9A 1JALA 1NYQA 2W2XD 3SFDB 2IFSA 4MK0A 4PQ0A 1HB6A 3PHWB 3Q8FA 2WXLA 3SHQA 1CZPA 4MGIE 2MWSB 3PRMB 3W9CB 1C76A 4K81A 2HRJA 3K9PB 3MFGA 4ZHOA 3FLVA 3BIID 2KWDA 4F7ZA 4PNKA 2PVGC 4EMOA 4RFBA 2FUHB 4ICVA 1C4AA 4EJNA 1V1PB 4ILJA 4ILGB 3VH4B 2COFA 1K5GB 3VUYA 1Q67A 4G3XB 3CIRB 4D0NB 2PPHA 2COPA 2KTFA 2M1MA 3HVZA 1KZGA 1TJ6A 1TYGB 4PS3A 4AP4C 2UVMA 4PS8A 1WI1A 1IGDA 1MHHE 4A20A 2GBKA 4M01A 3MJWA 3M62B 3A9KB 2GCJA 2XEWA 2WQYB 3EGRA 5J3YA 2ZVNA 1WGHA 3KZ1A 1TS4A 5LXHA 3L13A 1WJ4A 4IUMB 1FFUA 1AARA 2MBHA 2EMTA 4ZYSA 1ESFA 2FCMA 2MWNB 2FCNA 1AWDA 2MBBB 1FFVA 3CSFA 2RSUA 4YONA 4OZCA 3TIXA 1OFFA 1FM0D 3RUIB 1DGJA 2KCJA 4BAXA 1IBXB 4JLCA 2COAA 4B0MA 3JW0X 3Q3OC 1I4GA 2DA0A 3PREA 1NBFC 3R8BA 2M0AA 2KLGA 1XD4A 2JWUA 2Y5PA 5LXIB 1STEA 1X86A 4B0EA 1Y56A 1X1MA 3RMKC 5IRSA 3UIPB 2KVZA 1FXTB 1UNQA 4IWPA 2O6VD 5BYSA 3J9CA 1QOFA 5KQ4A 3DBRB 1B1ZA 4A9AA 2JXTA 2NBVA 2IGDA 1NVLA 4EOYA 3NVYA 3KRXA 3VQIA 2I2YA 3HRDD 4CQNA 4JKCA 2GMIC 2KN4A 2AQ3B 3E9PA 4F7UP 1XCGA 3MC9A 2OTXA 4M0WB 3WANA 3AM9A 4YSXB 3IFWB 3MP9A 1I7HA 1TXDA 2G1EA 1ACCA 1A5RA 1UEFA 1TZOA 4D6WA 1V1PA 4B6WA 1FMAD 4GMVA 4GPTB 1V49A 2BF8B 3GE8C 3HHMA 1N5WA 2D5GA 2NR2A 1P7EA 4WJOA 4GXBA 3D8EA 3V3XA 2VH2A 5FR6A 2D9YA 4A8XC 1NTIA 3ZUNA 2LRUA 1P3RA 5HE2A 4EZJA 3VH3B 4CHMA 2J0MA 2OEDA 3DBSA 2ZEQA 2LEKA 2RQ1A 1BMLC 3MJ5A 3RNFC 1FIQA 4OZBA 4HKQA 2BVCA 3AEFB 2CR5A 4CYEA 2ELAA 4FADA 4QXAB 2ZPNA 2R0DA 4MELA 2NS5A 3P6AA 2ON8A 4KZ0A 3QARA 5KCVA 4YL8A 2YS3A 3AE5B 3JSVB 3B2GA 4E71A 2JXXA 4M8MA 3NOBA 2K9XA 3TEZA 2AL6A 3BY4B 5LNK1 1T77A 2LRWA 3ZVVA 3H7PB 2YT0A 2KC2A 2W2XC 3MTNB 2XQNM 1F0ZA 5AUIA 1WE7A 3VVWB 2L32A 1ZKHA 1UBIA 4IC7B 5HKHA 5BMGA 1BAKA 4HHVA 1U29A 3W2DA 4KIKA 2YS5A 3Q3JA 4MM3B 3AMZA 1MFWA 1L4ZB 4GNKB 3ZQ4A 2WP9B 2L05A 1D5MC 4N6EB 3HQCA 2M56B 5CTRC 3R7QA 1UGJA 5BO4B 1DROA 1MIXA 4HAYB 4LNFA 1EM7A 4HCNB 4IDIA 1OQRA 4ZRIA 1KC7A 2XN9C 4M0WA 4WURA 3OLMD 1J8CA 1M7EA 1PUTA 3OWEB 3N9YC 1E6EB 4IOYX 3M63B 4MGYE 4HLEA 3P4QB 3C19A 2KWVB 4JL9A 3IVFA 4KGRA 3ODOA 1C1YB 4ZOHC 1QILA 3PZDA 3U7DA 4RF0A 5IO9A 3DOWA 2OJWA 2AQ1B 4FXCA 3DBLB 2NZ8B 2IBIB 1P9DU 3GE3C 1XKEA 4J6IA 3N1ZC 2AQ2B 2IO1B 4JE3B 4HB4B 4A6FB 3VRBB 1WJMA 3R66C 2V76A 2LOXA 4JX1C 5EE1A 2YSZA 4OVZA 5FKAC 5BMIA 1GPXA 1T3QA 2IGGA 4I6PA 3AU4A 4WWNA 1SSNA 1E7PB 1EGXA 2D11A 1DDMA 2ZJDA 4TQ1A 2MBQA 2RDGA 2O2VB 3U8ZA 1EUVB 4NZLB 4GOUA 3E9SA 3FSSA 3GS2A 2JYEA 4HPMB 2BB6A 1KM7A 1SIJA 4NAMA 5FR3A 4DBGA 5AEKB 5EFXA 2KX3A 1F9JA 2K2JA 2J0KA 1NEKB 3OHMB 1HQRD 4KSKC 1L0XB 5JP4A 4BKTA 2Z4DA 2LGIA 4HK2A 4M8NA 1P6SA 3OJ3A 1WJ1A 4NNJB 2REXA 1YN5A 2UZRA 1ZOYB 2BWES 2TSSA 3B9JA 3I3TB 4L2YA 4C00A 2CS4A 5GMVA 2GS0A 2W3SA 1H8CA 2RR9A 5LG4B 3AH7A 1RAXA 4AOFA 4MM3A 1RJ2A 5DPTA 4ZRQA 3N20C 3N30A 2I1KA 3RNCC 3NUHB 4WWOA 3QBVB 3FP5A 1N61A 2WXHA 1K53A 4WIPA 3R2IA 2L2IA 3NWFA 4A6QA 3ECIA 4FJZA 5T8IA 4IOIE 2E3TA 2AL3A 5J2RA 1MI0A 1N60A 2WXMA 1IGCA 1XX0A 2K22A 3BINA 3VRAB 2KX0A 3M1IB 1X1FA 2J7QB 2RPVA 1TKGA 1DYQA 3RCPA 2BKFA 3UF8A 1SB3C 2M4NA 3AE9B 3APFA 4W9HA 4W9CA 1ZSQA 4A3OA 2CJNA 2E6XA 3ZRCA 2N1VA 5C3JB 2N9LA 1RRBA 5HE0A 4A6FA 2LJIA 5J18A 1WGDA 3ETRA 1GOZA 2GCLA 1LFDA 2LGYA 3BYTB 4M02A 1WZ0A 1JROA 3D8FA 2RLOA 4WH4A 3C0RB 1ZE3D 1BT0A 1QC6A 2O2VA 4ICUA 3EUB2 2JYTA 4FA6A 2R61A 3WA0A 5TR5A 4W9GA 2D3BA 2LULA 1N62A 5D3YA 1J0GA 1ZXIA 3SDLC 1WXMA 1VBHA 4BKGA 2B3AA 2VSZA 1ZW7A 1RM6C 4K7UA 3U52E 5JHBA 1V8CA 4HSIA 1XEEA 2OQBA 1EAZA 1DYNA 2WXGA 1F2RI 3S2AA 2KGXB 1JCKB 2N1WA 3KVFB 4RNAA 1WR1A 2X38A 2HJ1A 3DHHC 3QJZA 4C0AA 1CMXB 1WG7A 4IM0A 4AJYB 2YT1A 2IO0B 1E8WA 2VKIA 4RGMA 2IGHA 4DHJB 4PYZA 1I4PA 1W1DA 4ZYNA 2J53A 1K5DB 1C4CA 1V1OA 4GIVA 5BYQA 1XCTL 2PEAA 2QIEB 3BVZA 4JKEA 2KJRA 2N9KA 4OHJA 4Z2MB 3AE6B 2EELA 5C2TB 5FI0A 3LJUX 2QC8A 1I4HA 4C4VB 5L81A 1X05A 2LOZA 1YN3A 2R2YA 2QDFA 4ANUA 1Z2MA 2K25A 3IXSA 1U5FA 2C5LC 5JHHA 3ZIMA 3UQBA 4GB9A 1ZXHA 2CB8A 2ZCCA 4FULA 4QJ5B 2Q13A 3NS8A 1VR9A 3P63A 1WGGA 3RI7C 4AQ7A 1MVKA 1VDVA 2J4XA 5C5BA 2KNBA 1U5DA 2MA9B 1XF5L 3RN9C 2G3QB 3BK2A 4K2PA 2QCZA 3X0WA 4ASWC 2K3UA 2JUOA 4B6HA 1FXAA 1WX8A 2J59M 2DZKA 2M19A 4HKZE 2IO3B 1F77A 1HTQA 2ACZB 1DDWA 1E8XA 5AZFA 3VAWA 3EECA 1DOIA 1UNPA 3GB1A 2RMMA 3P1MA 4ACFA 2L0TA 1FOEA 1VZ8A 3GP7A 2LUEA 3ZNID 2DX1A 2MSED 1L0VB 4K7WA 3ABVB 1KBLA 5C23A 3GYOA 2H7EA 4B95A 4GDLB 3E66A 4F7HA 2QJLA 3MC0B 1KLGD 1M7RA 2BBCA 4H8SA 4PYUA 3ZJVA 4J3OD 2Y5CA 1E7UA 3KRWA 3RULA 4BBNC 3SYXA 1F1HA 3N1XC 1GB4A 1WYGA 3VTUA 1IP9A 1P1AA 2ZNVC 1YN4A 4JIOU 1I2HA 3PVWA 1PMSA 2XBBC 2J0JA 1OMWA 3PVLA 1PYWD 3EFCA 5AZGA 1L7YA 2M0XA 3PP2A 2V3PA 4OVVA 3TEXA 2IDYA 2DN6A 4P1BC 4HRSA 3CWIA 1HTOA 1R4NB 2QKLA 3ZNGC 1E7VA 2M38A 1E5WA 4ITKA 2DKPA 1TZ1A 4W9EA 2LBBA 4KHBA 2KJHB 2KIGA 3P4RB 1U5GA 3ZDMC 2DYOA 4NPNA 2PTLA 2AX5A 1N6ZA 4DK5A 1TS2A 2K6DB 1IUEA 3O65B 2GBNA 4XWXA 1MK7B 3URYA 2NBVB 1AN8A 3TEYA 1EU3A 5IJMA 3SBTA 3TBLD 1YMHE 2YEPF 1EF5A 5I2SA 4NAWA 2Y5BB 4ZHPA 4OVUA 1YNTE 1R4MI 3WAMA 1FNVA 1KJTA 2EKIA 2O6VB 4C56C 2MH7A 1WE6A 1K51A 3SFEB 1GB1A 4HB2B 2NTSA 1WGKA 2IYBA 3V05A 4BBNF 3O96A 4GDLA 2CJOA 1XXGA 4LLGM 2WDTB 3UZTA 1V88A 4DHZB 2LVOA 4L23A 1RWSA 1UH6A 1PDXA 5D6JB 4DXAB 3F0WA 1KH0A 3BYYB 2WU2B 2W54A 3ZW3A 4MJSB 3A4SC 2UWQA 3IBEA 4DDGD 2L76A 2C7HA 1S1QB 2ELBA 2RUKB 1BWNA 4LNOA 3P7ZA 3A1QB 3BWUD 2DX5A 2LVPA 4KZCA 4CSQA 4S0RA 1I4QA 3VFKA 1WFYA 1WVHA 2INPE 2ONQA 2DIKA 4HPPA 3FILB 1L4DB 4K3CA 2WU5B 4E74A 2KOXA 3SV1A 4DX90 4DX8A 4TQ0A 2N9XA 3AEDB 3TO1A 2MJ3A 1XLOA 2Z0PA 1TQZA 1PQSA 2L00B 4KKJA 4A6KA 2YLMA 1EF1A 5FI1A 1EVHA 3AB5A 4JWUC 4MT5A 3PVUA 5G55A 5CLQB 1ET6A 3Q69A 4KIKB 2MKRA 3H9DA 3AE2B 2RDBC 3NZ3A 4EEWA 2CHZA 1UZXB 2L7RA 4K1RB 2IO2B 3WCQA 1AW7A 1XLPA 1XCQL 4AWJA 3R2TA 1SE2A 4JKBA 2Y8FA 2P0DA
chains in the Genus database with same CATH topology
2O6VA 4MSMB 4MGZE 1L2NA 1LM8B 4W9DA 3KUCB 1LQBA 3JYUA 4MSQB 2ZZPB 2DTCA 2KDIA 2NBWB 3GZNI 4RMAA 3DVGX 2KC1A 1WGUA 2MW5A 4MJSA 4NY0A 3ML9A 3PV1A 1UPQA 3A1QA 1Z5SB 2KVRA 4ANXA 3SU8X 3PSCA 3H7SA 2NMBA 1U2BA 1V9JA 4LDTD 4A6HA 2Y8GA 2AEHA 2L8JA 2DFKA 1IPGA 1OY2A 3DQVA 4PS7A 3UGBB 5J3QA 1OGWA 1NTVA 1IYFA 5CHWA 4EFOA 3PHXB 2JRHA 4I6NB 3UINB 3SNHA 4WWPA 3SBGA 2MX2A 3APCA 1YD8U 4IWQA 1Z87A 3H1UA 2DYMA 4NSWA 4W9IA 2DHZA 3RD2A 3RYTA 3PPAA 4CO7A 2LKOA 2DAJA 1W1HA 5JZEB 4IFSA 5DH9B 2ZVOA 3KYDD 5C1ZA 2K8CA 4P7IA 1P0RA 4B9KA 1NI2A 2EC1A 1R4NI 5C16A 2MP2A 3PTFC 2BWFA 3ODXA 4EKUA 2N9EB 3M3JA 3NY5A 2ZNVB 2JF5A 3KY9A 2A5UA 4JKGB 1FGZA 2BYVE 3FM8C 1V5OA 2DENB 1XD3B 3NHEB 2CRFA 3UIOB 2K8BA 1MK9B 2DHJA 5J3TA 1U27A 2KFJA 4IWOA 1BTKA 2COCA 3ML8A 1WJNA 2H7DA 5DHFB 3LJ3A 1JDEA 5LOPB 1WM3A 2KDEB 3PT2B 2KO3A 3QX1A 4HJKA 1G6JA 2PE6B 5DHAB 1E90A 3ENBA 1V89A 1KI1B 1UGMA 4ANWA 2I5FA 2DHIA 2KD0A 2KMAA 1MIZB 1WY8A 3QC8B 4WAAA 4GMXB 4WJNA 4E3CA 4URKA 2RSGA 1E8YA 2EKEC 3L08A 1WIAA 4HCPB 2I5CA 3GYPA 2D07B 2HJ8A 3Q3FA 1C3TA 1OTRB 1YJ1A 3U30A 4HDQA 1Y19B 4BOSC 3KUZA 3WIMA 2WX1A 3PLUA 2Z0EB 4HWIB 4HB3B 2LD9A 4TKNA 1GC6A 3CMMB 2ABDA 1YX6B 1WZ3A 2DZIA 2MCNB 4II2B 4XX5A 3LDZE 2R2QA 4K7SA 4JKGA 2D4QA 2KZRA 5C5BB 1RLFA 2N9PC 3SUZA 1ST7A 4EZKA 1LB1A 2W9NA 3WAOA 2MRPA 2HTHB 4Z2NA 1NTYA 1WRDB 1I7AA 3HM3A 5JLJB 5L95C 3L10B 1Q0WB 1I42A 1PFJA 1ZC4B 4HPLB 1DDVA 4KDLB 1J0WA 2PE9A 3CF6E 5JVLA 4HAVB 1GUAB 3ZTCA 2JPHA 3RT3B 3ML4A 3D8DA 5E6PA 1ZVRA 2G4DB 1ZM0A 2AWTA 4I6LB 2LZ6A 4JKFA 3DXEA 2QHOA 5DPSA 5JHAA 3A8QA 3VTVA 2N7EA 1WMHA 2Y7BA 3B08A 4NJ7A 2NVUI 1KZ7A 1TGZB 3V6CB 4KAXB 2KXJA 2KTRB 2CAYA 3QQ8B 2D9VA 3VOQA 2KDFB 3TMPB 4KHBB 1J19A 5KHOA 2M8SA 5CHVC 3NZUA 3ULBA 4WJPA 2N4FA 2RD0A 4AJWA 2EJ8A 2MDXA 3M95A 5D7GA 3MPXA 3KW5B 1N3HA 2CU1A 2LXAA 5J17A 3CSTA 2HTHA 1KLVA 2WYQA 4NAWB 4IM2A 3TJPA 4N9F4 2RGFA 1Q1OA 2N23A 5IA7A 3V5WA 2KANA 2DYQA 1XQQA 1V5MA 4RM9A 1WM2A 5DI9B 1WXAA 3B1LX 2JT4B 4FHJA 4X57B 4IAPA 4HAZB 3FEHA 3PS6A 2V3SA 5HE3A 3ODWA 4HXDA 1UD7A 2UZSA 4GGQA 2Z0OA 1HB8A 4JGHB 1K8RB 2BYFA 4ZRKA 1PLSA 1WI0A 4GSWA 4WJ7A 4GN1A 1ACAA 4IM3A 2GOWA 1FB8A 3UQAA 4ZDVA 3GOEA 2DX5B 1VCBA 2RPQA 1TTNA 1ZGUB 2Z0DB 1W1GA 4ILHA 4F7GA 2KTRA 2G35A 3E9OA 1MAIA 2RVBB 4JK7A 1XODA 1VBGA 2JY6A 2K2UA 3A4RA 5D27A 2YS1A 4II3B 2EMSA 3ZNHB 1WH3A 3ENEA 4HB0B 4WJQA 4W9JA 5D3VA 1V5UA 2E2XA 1FHXA 2KWUB 4FJVB 1WXVA 4XC2A 1M94A 3SO6A 2LXCA 3R7RA 3QK0A 3ULCA 3N7CA 1WGYA 1GJZA 4GDKB 3BJIA 1I35A 1FHOA 4LJOB 4GU2A 5JH5C 1OEYJ 2ASQA 2CY4A 4HAXB 1SHCA 4GZUA 4HAWB 4MY6A 2IY1B 2D3GA 5IAAC 4EZLA 4BBKA 1X1GA 2LVQA 4BOZB 2WX0A 1V86A 4KVGB 1TBEA 3PRZA 4KV2A 3ZLZA 3APDA 2FJLA 3L17A 3DBHI 2FCSA 5CLLB 2FJ9A 3A8PA 2OOBB 5KHQA 1GG3A 1P3QU 4JKHA 3DXDA 3QCAA 2BYEA 3T06A 1D3ZA 2WWZA 5CHFA 2JVCA 2YRYA 1UELA 2CHXA 4A3PA 2D9ZA 2V1YA 4KHOA 3KH0A 1HE8A 5LONB 1V6EA 3MDBC 1AQCA 3JVZX 3B0AA 2DZJA 2CHWA 2KFKB 4BKSD 4GOCA 4AUQC 2XK5A 4LDTB 2UYZB 1AWEA 3H6NA 4FLHA 2R2OA 2WH5A 1WGRA 2D10A 3A9JA 3HIZA 3T8MA 1RRPB 5E6OA 3VUWA 4GDKA 3DVNV 3QA8A 4BKSA 1GNUA 4HATB 2LYDA 4JQWC 5HE1A 4CHJA 2KQ7A 3HK0A 3NSUA 2FNJB 1JRUA 1V81A 1UBQA 4G11A 3PRPB 2GBJA 3E9LA 4JK9A 3HW2B 3WALA 2LGXA 2KKCA 1XR0B 3F5RA 3EFUA 2MP2B 3ZRFA 3QAQA 3RZWC 2C7NB 2IZVB 3W1SA 3VUXA 5C6RA 5DCNA 4G50A 1B55A 2BPSA 2Z0QA 2NPTB 2M14A 3DVNU 2C60A 3QWMA 3OAWA 2RGNB 2AYOB 3QIJA 2ADZA 2LWPA 1LXDA 1QQGA 3A9KA 3L54A 4RM8A 5D2MB 2W2WA 4MGKE 1NU2A 3TW1A 5C79A 1MKEA 1X11A 1YIWA 2X18A 1V5TA 2KJ6A 3AU5A 3CIKA 3A98B 2MFQA 3HM6X 2L1CA 2KFKA 2D9XA 2PZ1A 2IY0B 4K2OA 1H10A 5DIFB 3EHVA 3WAPA 1V5PA 2P0FA 5DPWA 4W9KA 3IHPC 1IRSA 1WF9A 2KDBA 2YF0A 2BGFA 3V62A 2DYBA 4XZ4A 3D32A 4FN2A 3DXCA 2FAZA 3NZSA 3V6EB 3WYFB 2MLBA 2JP2A 5CX3A 2K6QA 3V61A 2JZ3B 2LI5A 2K39A 4CHKA 4TUUA 1WR6E 3SD5A 3L0WB 3QHTA 3W1YA 2L3ZA 3DCGA 2NPTA 3ZO5B 2RNRB 4Y94A 4JK8A 1WX9A 5D3XA 4TYZA 2CKHB 2R82A 1SGHA 1RFAA 5LLIA 3OJ4B 2D2QA 1WXSA 3VIAA 4KHAA 1FHWA 1U4AA 2KUPA 1YQBA 1UPRA 3JSVA 3V60A 2QKMA 1U5EA 4FBJB 4A5KA 1DBHA 1T0YA 1DIKA 4IW0A 2GJYA 2CODA 2DHKA 3EC8A 3ZDTA 2M17A 3H7PA 3TL5A 3L16A 4MH0E 1EO6A 1P98A 2LGDA 3A33B 2V4LA 3PLVA 4ZRJA 3ONSA 3W1SC 2D9WA 3DPDA 3PSEB 2IYDB 1VD2A 5JHGA 1WMHB 4JKAA 2DYNA 2G4SA 2CQUA 4KSLC 2FIFA 4LJPB 4WQOB 1Q5WB 2LASA 4BFRA 1H4RA 3RCZA 2FDQA 2I1JA 4G0NB 3AJ4A 3TCAA 2ZPYA 1MPHA 3CXBB 4NQLB 2ROZB 3ZVRA 4JKDA 2K8HA 2N7DA 3N3KB 1ISNA 5GOWB 3ZNZB 2GBMA 4HAUB 1WJUA 1FAOA 4FJYA 1P5TA 2X0SA 2C9WB 3KYCD 1NDDA 3EPYA 3N32A 3QWZB 5D3WA 4DHZE 2LJ5A 4ANVA 2DZMA 3R3MA 2FIDA 1V80A 1GC7A 3AULA 4W9FA 2MQJA 3X23A 1OQNA 4W9LA 2DLWA 1MG8A 4WSFA 4KDIC 4DBBA 3DBRI 1Y8RC 3AXCA 2ZCBA 1Y5OA 5DPRA 1FGYA 2GBRA 3DDCB 1OQYA 5EDSA 3AI5A 2A4ZA 1GGOA 5L83A 4MEMA 1YX5B 4L6EA 2PJHA 3ZKJC 4DWFA 3TFMA 3ALBA 1V2YA 4DDID 2NCNA 2FCQA 1QZEA 3PG7A 2JRIB 2MBOA 1WGQA 3PGEA 2MBEA 3VHTC 5E6NA 5G2NA 1SE9A 3K9OB 4WVFB 1WJ6A 2LG1A 2HE7A 1E8ZA 2JWZA 3VXWA 4FHKA 2K1FA 3P2BA 3IG3A 3VDZA 3VTWA 4NJ6A 3RZFA 2L0FA 3MHSD 2KMCA 2KWCA 4MDKE 4LCDE 2P8VA 2BKRB 2G45B 2C7MB 2DAFA 3TVVA 1LW3A 4HDOA 5AZHA 5KQ1A 3KUDB 3DVGY 2K00A 4HVBA 2KK8A 4DHJD 4EUTA 2NBUA 1UNRA 1XT9B 1HBKA 1ZC3B 4F1SA 1WYWB 4F8CB 4BVUC 3KSYA 2KLCA 3DBLI 2R09A 2YVCA 2CY5A 4K17A 4MT7A 2KQSA 3G9WA 4TV3A 2Z59B 2P0HA 2BCJA 2VRRB 4NQKE 1WX7A 5D94A 1SIFA 1KOTA 1V61A 2HD5B 1S3SG 1OEYA 2VRWB 2JZZA 2N0YA 2KHWB 2XK5B 1BTNA 2ROVA 3T9LA 3ZTDA 4IG7B 3OANA 3PEGA 2OJRA 3A9JB 2KN5A 2DKQA 2W2XD 2IFSA 4MK0A 4PQ0A 1HB6A 3PHWB 3SHQA 4MGIE 2MWSB 3PRMB 4K81A 2HRJA 3K9PB 3FLVA 4F7ZA 4PNKA 4EMOA 2FUHB 4ICVA 4EJNA 4ILJA 4ILGB 3VH4B 2COFA 1K5GB 3VUYA 1Q67A 4G3XB 4D0NB 2PPHA 2COPA 2KTFA 2M1MA 1KZGA 1TJ6A 4PS3A 4AP4C 2UVMA 4PS8A 1WI1A 4A20A 2GBKA 3MJWA 3M62B 3A9KB 2GCJA 2XEWA 5J3YA 2ZVNA 1WGHA 3KZ1A 5LXHA 3L13A 1WJ4A 4IUMB 1AARA 2MBHA 2EMTA 2FCMA 2MWNB 2FCNA 2MBBB 3CSFA 2RSUA 4YONA 3TIXA 3RUIB 2KCJA 4JLCA 2COAA 3JW0X 2DA0A 3PREA 1NBFC 2KLGA 1XD4A 5LXIB 1X86A 1X1MA 3UIPB 1FXTB 1UNQA 4IWPA 2O6VD 5KQ4A 1NVLA 4EOYA 3KRXA 3VQIA 4JKCA 2GMIC 3E9PA 4F7UP 1XCGA 2OTXA 4M0WB 3WANA 3IFWB 1TXDA 1A5RA 1UEFA 4B6WA 4GMVA 4GPTB 1V49A 2BF8B 3HHMA 2NR2A 4WJOA 4GXBA 3D8EA 5FR6A 2D9YA 1NTIA 3ZUNA 2LRUA 1P3RA 5HE2A 4EZJA 3VH3B 4CHMA 2J0MA 3DBSA 2ZEQA 2RQ1A 2CR5A 4CYEA 2ELAA 4FADA 2ZPNA 2R0DA 4MELA 2NS5A 3P6AA 4KZ0A 3QARA 5KCVA 4YL8A 2YS3A 3JSVB 4E71A 2JXXA 4M8MA 3NOBA 2AL6A 3BY4B 2LRWA 3ZVVA 3H7PB 2YT0A 2KC2A 2W2XC 3MTNB 2XQNM 3VVWB 1WE7A 1ZKHA 1UBIA 4IC7B 5HKHA 1BAKA 4HHVA 1U29A 4KIKA 2YS5A 3Q3JA 2L05A 3HQCA 5CTRC 3R7QA 5BO4B 1DROA 1MIXA 4HAYB 4HCNB 4ZRIA 1KC7A 3OLMD 1J8CA 1M7EA 4MGYE 3M63B 4IOYX 4HLEA 2KWVB 4JL9A 3IVFA 3ODOA 1C1YB 3PZDA 3U7DA 3DOWA 2NZ8B 2IBIB 1P9DU 1XKEA 4J6IA 2IO1B 4HB4B 4A6FB 1WJMA 3R66C 2V76A 2LOXA 2YSZA 4I6PA 3AU4A 4WWNA 1EGXA 2D11A 1DDMA 2ZJDA 4TQ1A 2MBQA 2O2VB 3U8ZA 1EUVB 3FSSA 4HPMB 1KM7A 4DBGA 5AEKB 5EFXA 2KX3A 1F9JA 2K2JA 2J0KA 4KSKC 5JP4A 4BKTA 4HK2A 4M8NA 1P6SA 3OJ3A 1WJ1A 4NNJB 2REXA 2UZRA 2BWES 3I3TB 2CS4A 5GMVA 2GS0A 1H8CA 2RR9A 1RAXA 4AOFA 4MM3A 1RJ2A 5DPTA 3N30A 2I1KA 4WWOA 3QBVB 3FP5A 2L2IA 3ECIA 4FJZA 2AL3A 5J2RA 1XX0A 3BINA 2KX0A 3M1IB 1X1FA 2J7QB 3RCPA 2BKFA 3UF8A 4W9HA 2M4NA 3APFA 4W9CA 1ZSQA 4A3OA 3ZRCA 2N1VA 1RRBA 5HE0A 4A6FA 5J18A 1WGDA 2GCLA 1LFDA 2LGYA 1WZ0A 3D8FA 2RLOA 3C0RB 1BT0A 1QC6A 2O2VA 4ICUA 4FA6A 3WA0A 5TR5A 4W9GA 2LULA 5D3YA 1J0GA 3SDLC 1WXMA 1VBHA 4BKGA 2B3AA 2VSZA 1ZW7A 4K7UA 5JHBA 2OQBA 1EAZA 1DYNA 3S2AA 2KGXB 2N1WA 3KVFB 1WR1A 3QJZA 4C0AA 1CMXB 1WG7A 4IM0A 4AJYB 2YT1A 2IO0B 1E8WA 2VKIA 4DHJB 4PYZA 1W1DA 4ZYNA 1K5DB 4GIVA 2PEAA 4JKEA 2KJRA 4Z2MB 5FI0A 3LJUX 5L81A 1X05A 2LOZA 4ANUA 1Z2MA 2K25A 1U5FA 2C5LC 5JHHA 3ZIMA 3UQBA 4GB9A 2CB8A 2ZCCA 4FULA 2Q13A 3NS8A 1WGGA 5C5BA 2KNBA 1U5DA 2MA9B 2G3QB 4K2PA 4ASWC 3X0WA 2JUOA 4B6HA 1WX8A 2J59M 2DZKA 2IO3B 1DDWA 1E8XA 5AZFA 3VAWA 3EECA 1UNPA 2L0TA 1FOEA 2LUEA 3ZNID 2DX1A 2MSED 4K7WA 1KBLA 5C23A 3GYOA 2H7EA 4B95A 4GDLB 3E66A 4F7HA 1M7RA 4H8SA 4PYUA 1E7UA 3KRWA 3RULA 4BBNC 3SYXA 3VTUA 1IP9A 1P1AA 2ZNVC 4JIOU 1I2HA 3PVWA 1PMSA 2XBBC 2J0JA 1OMWA 3PVLA 5AZGA 1L7YA 2M0XA 3PP2A 4OVVA 2DN6A 2QKLA 3ZNGC 1E7VA 2M38A 1E5WA 2DKPA 1TZ1A 4W9EA 2LBBA 2KJHB 1U5GA 3ZDMC 2DYOA 4NPNA 4DK5A 2K6DB 3O65B 2GBNA 4XWXA 1MK7B 2NBVB 5IJMA 3SBTA 3TBLD 1EF5A 4NAWA 2Y5BB 4OVUA 1R4MI 3WAMA 1KJTA 2O6VB 1WE6A 4HB2B 2IYBA 4BBNF 3O96A 4GDLA 2WDTB 3UZTA 1V88A 4DHZB 2LVOA 1UH6A 5D6JB 4DXAB 3F0WA 3ZW3A 4MJSB 3A4SC 2UWQA 3IBEA 4DDGD 2L76A 2C7HA 1S1QB 2ELBA 2RUKB 1BWNA 3P7ZA 3A1QB 2DX5A 2LVPA 4KZCA 3VFKA 1WFYA 1WVHA 2DIKA 4E74A 2KOXA 3SV1A 4DX90 4DX8A 4TQ0A 2N9XA 3TO1A 2Z0PA 1TQZA 1PQSA 2L00B 4A6KA 2YLMA 1EF1A 5FI1A 1EVHA 5G55A 3PVUA 5CLQB 4KIKB 2MKRA 3H9DA 4EEWA 2CHZA 1UZXB 2L7RA 4K1RB 2IO2B 4AWJA 4JKBA 2Y8FA 2P0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V A;  4MSM B;  4MGZ E;  1L2N A;  1LM8 B;  4W9D A;  3KUC B;  1LQB A;  3JYU A;  4MSQ B;  2ZZP B;  2DTC A;  2KDI A;  2NBW B;  3GZN I;  4RMA A;  3DVG X;  2KC1 A;  1WGU A;  2MW5 A;  4MJS A;  4NY0 A;  3ML9 A;  3PV1 A;  1UPQ A;  3A1Q A;  1Z5S B;  2KVR A;  4ANX A;  3SU8 X;  3PSC A;  3H7S A;  2NMB A;  1U2B A;  1V9J A;  4LDT D;  4A6H A;  2Y8G A;  2AEH A;  2L8J A;  2DFK A;  1IPG A;  1OY2 A;  3DQV A;  4PS7 A;  3UGB B;  5J3Q A;  1OGW A;  1NTV A;  1IYF A;  5CHW A;  4EFO A;  3PHX B;  2JRH A;  4I6N B;  3UIN B;  3SNH A;  4WWP A;  2MX2 A;  3APC A;  1YD8 U;  4IWQ A;  1Z87 A;  3H1U A;  2DYM A;  4NSW A;  4W9I A;  2DHZ A;  3RD2 A;  3RYT A;  3PPA A;  4CO7 A;  2LKO A;  2DAJ A;  1W1H A;  5JZE B;  4IFS A;  5DH9 B;  2ZVO A;  3KYD D;  5C1Z A;  2K8C A;  4P7I A;  1P0R A;  4B9K A;  1NI2 A;  2EC1 A;  1R4N I;  5C16 A;  2MP2 A;  3PTF C;  2BWF A;  3ODX A;  4EKU A;  2N9E B;  3M3J A;  3NY5 A;  2ZNV B;  2JF5 A;  3KY9 A;  2A5U A;  1FGZ A;  2BYV E;  3FM8 C;  1V5O A;  2DEN B;  1XD3 B;  3NHE B;  2CRF A;  3UIO B;  2K8B A;  1MK9 B;  2DHJ A;  5J3T A;  1U27 A;  2KFJ A;  4IWO A;  1BTK A;  2COC A;  3ML8 A;  1WJN A;  2H7D A;  5DHF B;  3LJ3 A;  5LOP B;  1WM3 A;  2KDE B;  3PT2 B;  2KO3 A;  3QX1 A;  4HJK A;  1G6J A;  2PE6 B;  5DHA B;  1E90 A;  1V89 A;  1KI1 B;  1UGM A;  4ANW A;  2I5F A;  2DHI A;  2KD0 A;  2KMA A;  1MIZ B;  1WY8 A;  3QC8 B;  4WAA A;  4GMX B;  4WJN A;  4E3C A;  4URK A;  2RSG A;  1E8Y A;  2EKE C;  3L08 A;  1WIA A;  4HCP B;  2I5C A;  3GYP A;  2D07 B;  2HJ8 A;  3Q3F A;  1C3T A;  1OTR B;  1YJ1 A;  3U30 A;  4HDQ A;  1Y19 B;  4BOS C;  3KUZ A;  3WIM A;  2WX1 A;  3PLU A;  2Z0E B;  4HWI B;  4HB3 B;  2LD9 A;  4TKN A;  1GC6 A;  3CMM B;  2ABD A;  1YX6 B;  1WZ3 A;  2DZI A;  2MCN B;  4II2 B;  4XX5 A;  3LDZ E;  2R2Q A;  4K7S A;  2D4Q A;  2KZR A;  5C5B B;  1RLF A;  2N9P C;  3SUZ A;  1ST7 A;  4EZK A;  1LB1 A;  2W9N A;  3WAO A;  2MRP A;  2HTH B;  4Z2N A;  1NTY A;  1WRD B;  1I7A A;  3HM3 A;  5JLJ B;  5L95 C;  3L10 B;  1Q0W B;  1I42 A;  1PFJ A;  1ZC4 B;  4HPL B;  1DDV A;  4KDL B;  1J0W A;  2PE9 A;  3CF6 E;  4HAV B;  1GUA B;  3ZTC A;  2JPH A;  3RT3 B;  3ML4 A;  3D8D A;  5E6P A;  1ZVR A;  2G4D B;  1ZM0 A;  2AWT A;  4I6L B;  2LZ6 A;  3DXE A;  2QHO A;  5DPS A;  5JHA A;  3A8Q A;  3VTV A;  2N7E A;  1WMH A;  2Y7B A;  3B08 A;  4NJ7 A;  2NVU I;  1KZ7 A;  1TGZ B;  3V6C B;  4KAX B;  2KXJ A;  2KTR B;  2CAY A;  3QQ8 B;  2D9V A;  3VOQ A;  2KDF B;  3TMP B;  4KHB B;  1J19 A;  5KHO A;  2M8S A;  5CHV C;  3NZU A;  3ULB A;  4WJP A;  2N4F A;  2RD0 A;  4AJW A;  2EJ8 A;  2MDX A;  3M95 A;  5D7G A;  3MPX A;  3KW5 B;  1N3H A;  2CU1 A;  2LXA A;  5J17 A;  3CST A;  2HTH A;  1KLV A;  2WYQ A;  4NAW B;  4IM2 A;  3TJP A;  4N9F 4;  2RGF A;  1Q1O A;  2N23 A;  5IA7 A;  3V5W A;  2KAN A;  2DYQ A;  1XQQ A;  1V5M A;  4RM9 A;  1WM2 A;  5DI9 B;  1WXA A;  3B1L X;  2JT4 B;  4FHJ A;  4X57 B;  4IAP A;  4HAZ B;  3FEH A;  3PS6 A;  2V3S A;  5HE3 A;  3ODW A;  4HXD A;  1UD7 A;  2UZS A;  4GGQ A;  2Z0O A;  1HB8 A;  4JGH B;  1K8R B;  2BYF A;  4ZRK A;  1PLS A;  1WI0 A;  4GSW A;  4WJ7 A;  4GN1 A;  1ACA A;  4IM3 A;  2GOW A;  1FB8 A;  3UQA A;  4ZDV A;  3GOE A;  2DX5 B;  1VCB A;  2RPQ A;  1TTN A;  1ZGU B;  2Z0D B;  1W1G A;  4F7G A;  2KTR A;  2G35 A;  1MAI A;  2RVB B;  1XOD A;  2JY6 A;  2K2U A;  3A4R A;  5D27 A;  2YS1 A;  4II3 B;  2EMS A;  3ZNH B;  1WH3 A;  3ENE A;  4HB0 B;  4WJQ A;  4W9J A;  5D3V A;  1V5U A;  2E2X A;  1FHX A;  2KWU B;  4FJV B;  1WXV A;  4XC2 A;  1M94 A;  3SO6 A;  2LXC A;  3R7R A;  3QK0 A;  3ULC A;  3N7C A;  1WGY A;  1GJZ A;  4GDK B;  3BJI A;  1I35 A;  1FHO A;  4LJO B;  4GU2 A;  5JH5 C;  1OEY J;  2ASQ A;  2CY4 A;  4HAX B;  1SHC A;  4GZU A;  4HAW B;  4MY6 A;  2IY1 B;  2D3G A;  5IAA C;  4EZL A;  4BBK A;  1X1G A;  2LVQ A;  4BOZ B;  2WX0 A;  1V86 A;  4KVG B;  1TBE A;  3PRZ A;  4KV2 A;  3ZLZ A;  3APD A;  2FJL A;  3L17 A;  3DBH I;  2FCS A;  5CLL B;  2FJ9 A;  3A8P A;  2OOB B;  5KHQ A;  1GG3 A;  1P3Q U;  3DXD A;  3QCA A;  2BYE A;  3T06 A;  1D3Z A;  2WWZ A;  5CHF A;  2JVC A;  2YRY A;  1UEL A;  2CHX A;  4A3P A;  2D9Z A;  2V1Y A;  4KHO A;  3KH0 A;  1HE8 A;  5LON B;  1V6E A;  3MDB C;  1AQC A;  3JVZ X;  3B0A A;  2DZJ A;  2CHW A;  2KFK B;  4BKS D;  4GOC A;  4AUQ C;  2XK5 A;  4LDT B;  2UYZ B;  1AWE A;  3H6N A;  4FLH A;  2R2O A;  2WH5 A;  1WGR A;  2D10 A;  3A9J A;  3HIZ A;  3T8M A;  1RRP B;  5E6O A;  3VUW A;  4GDK A;  3DVN V;  3QA8 A;  4BKS A;  1GNU A;  4HAT B;  2LYD A;  4JQW C;  5HE1 A;  4CHJ A;  2KQ7 A;  3HK0 A;  3NSU A;  2FNJ B;  1JRU A;  1V81 A;  1UBQ A;  4G11 A;  3PRP B;  2GBJ A;  3HW2 B;  3WAL A;  2LGX A;  2KKC A;  1XR0 B;  3F5R A;  3EFU A;  2MP2 B;  3ZRF A;  3QAQ A;  3RZW C;  2C7N B;  2IZV B;  3W1S A;  3VUX A;  5C6R A;  5DCN A;  4G50 A;  1B55 A;  2BPS A;  2Z0Q A;  2NPT B;  2M14 A;  3DVN U;  2C60 A;  3QWM A;  3OAW A;  2RGN B;  2AYO B;  3QIJ A;  2ADZ A;  2LWP A;  1LXD A;  1QQG A;  3A9K A;  3L54 A;  4RM8 A;  5D2M B;  2W2W A;  4MGK E;  1NU2 A;  3TW1 A;  5C79 A;  1MKE A;  1X11 A;  1YIW A;  2X18 A;  1V5T A;  2KJ6 A;  3AU5 A;  3CIK A;  3A98 B;  2MFQ A;  3HM6 X;  2L1C A;  2KFK A;  2D9X A;  2PZ1 A;  2IY0 B;  4K2O A;  1H10 A;  5DIF B;  3EHV A;  3WAP A;  1V5P A;  2P0F A;  5DPW A;  4W9K A;  3IHP C;  1IRS A;  1WF9 A;  2KDB A;  2YF0 A;  2BGF A;  3V62 A;  2DYB A;  4XZ4 A;  3D32 A;  4FN2 A;  3DXC A;  2FAZ A;  3NZS A;  3V6E B;  3WYF B;  2MLB A;  2JP2 A;  5CX3 A;  2K6Q A;  3V61 A;  2JZ3 B;  2LI5 A;  2K39 A;  4CHK A;  4TUU A;  1WR6 E;  3SD5 A;  3L0W B;  3QHT A;  3W1Y A;  2L3Z A;  3DCG A;  2NPT A;  3ZO5 B;  2RNR B;  4Y94 A;  1WX9 A;  5D3X A;  4TYZ A;  2CKH B;  1SGH A;  1RFA A;  5LLI A;  3OJ4 B;  2D2Q A;  1WXS A;  3VIA A;  4KHA A;  1FHW A;  1U4A A;  2KUP A;  1YQB A;  1UPR A;  3JSV A;  3V60 A;  2QKM A;  1U5E A;  4FBJ B;  4A5K A;  1DBH A;  1T0Y A;  4IW0 A;  2GJY A;  2COD A;  2DHK A;  3EC8 A;  3ZDT A;  2M17 A;  3H7P A;  3TL5 A;  3L16 A;  4MH0 E;  1EO6 A;  1P98 A;  2LGD A;  3A33 B;  2V4L A;  3PLV A;  4ZRJ A;  3ONS A;  3W1S C;  2D9W A;  3DPD A;  3PSE B;  2IYD B;  1VD2 A;  5JHG A;  1WMH B;  2DYN A;  2G4S A;  2CQU A;  4KSL C;  2FIF A;  4LJP B;  4WQO B;  1Q5W B;  2LAS A;  4BFR A;  1H4R A;  3RCZ A;  2FDQ A;  2I1J A;  4G0N B;  3AJ4 A;  3TCA A;  2ZPY A;  1MPH A;  3CXB B;  4NQL B;  2ROZ B;  3ZVR A;  2K8H A;  2N7D A;  3N3K B;  1ISN A;  5GOW B;  3ZNZ B;  2GBM A;  4HAU B;  1WJU A;  1FAO A;  4FJY A;  1P5T A;  2C9W B;  3KYC D;  1NDD A;  3EPY A;  3N32 A;  3QWZ B;  5D3W A;  4DHZ E;  2LJ5 A;  4ANV A;  2DZM A;  3R3M A;  2FID A;  1V80 A;  1GC7 A;  3AUL A;  4W9F A;  2MQJ A;  3X23 A;  1OQN A;  4W9L A;  2DLW A;  1MG8 A;  4WSF A;  4KDI C;  4DBB A;  3DBR I;  1Y8R C;  3AXC A;  2ZCB A;  1Y5O A;  5DPR A;  1FGY A;  2GBR A;  3DDC B;  1OQY A;  5EDS A;  3AI5 A;  2A4Z A;  5L83 A;  4MEM A;  1YX5 B;  4L6E A;  2PJH A;  3ZKJ C;  4DWF A;  3TFM A;  3ALB A;  1V2Y A;  4DDI D;  2NCN A;  2FCQ A;  1QZE A;  3PG7 A;  2JRI B;  2MBO A;  1WGQ A;  3PGE A;  2MBE A;  3VHT C;  5E6N A;  5G2N A;  1SE9 A;  3K9O B;  4WVF B;  1WJ6 A;  2LG1 A;  2HE7 A;  1E8Z A;  2JWZ A;  3VXW A;  4FHK A;  2K1F A;  3P2B A;  3IG3 A;  3VDZ A;  3VTW A;  4NJ6 A;  3RZF A;  2L0F A;  3MHS D;  2KMC A;  2KWC A;  4MDK E;  4LCD E;  2P8V A;  2BKR B;  2G45 B;  2C7M B;  2DAF A;  3TVV A;  1LW3 A;  4HDO A;  5AZH A;  5KQ1 A;  3KUD B;  3DVG Y;  2K00 A;  4HVB A;  2KK8 A;  4DHJ D;  4EUT A;  2NBU A;  1UNR A;  1XT9 B;  1HBK A;  1ZC3 B;  4F1S A;  1WYW B;  4F8C B;  4BVU C;  3KSY A;  2KLC A;  3DBL I;  2R09 A;  2YVC A;  2CY5 A;  4K17 A;  4MT7 A;  2KQS A;  3G9W A;  4TV3 A;  2Z59 B;  2P0H A;  2BCJ A;  2VRR B;  4NQK E;  1WX7 A;  5D94 A;  1SIF A;  1KOT A;  1V61 A;  2HD5 B;  1S3S G;  1OEY A;  2VRW B;  2JZZ A;  2N0Y A;  2KHW B;  2XK5 B;  1BTN A;  2ROV A;  3T9L A;  3ZTD A;  4IG7 B;  3OAN A;  3PEG A;  2OJR A;  3A9J B;  2KN5 A;  2DKQ A;  2W2X D;  2IFS A;  4MK0 A;  4PQ0 A;  1HB6 A;  3PHW B;  3SHQ A;  4MGI E;  2MWS B;  3PRM B;  4K81 A;  2HRJ A;  3K9P B;  3FLV A;  4F7Z A;  4PNK A;  4EMO A;  2FUH B;  4ICV A;  4EJN A;  3VH4 B;  2COF A;  1K5G B;  3VUY A;  1Q67 A;  4G3X B;  4D0N B;  2PPH A;  2COP A;  2KTF A;  2M1M A;  1TJ6 A;  1KZG A;  4PS3 A;  4AP4 C;  2UVM A;  4PS8 A;  1WI1 A;  4A20 A;  2GBK A;  3MJW A;  3M62 B;  3A9K B;  2GCJ A;  2XEW A;  5J3Y A;  2ZVN A;  1WGH A;  3KZ1 A;  5LXH A;  3L13 A;  1WJ4 A;  4IUM B;  1AAR A;  2MBH A;  2EMT A;  2FCM A;  2MWN B;  2FCN A;  2MBB B;  3CSF A;  2RSU A;  4YON A;  3TIX A;  3RUI B;  2KCJ A;  4JLC A;  2COA A;  3JW0 X;  2DA0 A;  3PRE A;  1NBF C;  2KLG A;  1XD4 A;  5LXI B;  1X86 A;  1X1M A;  3UIP B;  1FXT B;  1UNQ A;  4IWP A;  2O6V D;  5KQ4 A;  1NVL A;  4EOY A;  3KRX A;  3VQI A;  2GMI C;  4F7U P;  1XCG A;  2OTX A;  4M0W B;  3WAN A;  3IFW B;  1TXD A;  1A5R A;  1UEF A;  4B6W A;  4GMV A;  4GPT B;  1V49 A;  2BF8 B;  3HHM A;  2NR2 A;  4WJO A;  4GXB A;  3D8E A;  5FR6 A;  2D9Y A;  1NTI A;  3ZUN A;  2LRU A;  1P3R A;  5HE2 A;  4EZJ A;  3VH3 B;  4CHM A;  2J0M A;  3DBS A;  2ZEQ A;  2RQ1 A;  2CR5 A;  4CYE A;  2ELA A;  4FAD A;  2ZPN A;  2R0D A;  4MEL A;  2NS5 A;  3P6A A;  4KZ0 A;  3QAR A;  5KCV A;  4YL8 A;  2YS3 A;  3JSV B;  4E71 A;  2JXX A;  4M8M A;  3NOB A;  2AL6 A;  3BY4 B;  2LRW A;  3ZVV A;  3H7P B;  2YT0 A;  2KC2 A;  2W2X C;  3MTN B;  2XQN M;  3VVW B;  1WE7 A;  1ZKH A;  1UBI A;  4IC7 B;  5HKH A;  1BAK A;  4HHV A;  1U29 A;  4KIK A;  2YS5 A;  3Q3J A;  2L05 A;  3HQC A;  5CTR C;  3R7Q A;  5BO4 B;  1DRO A;  1MIX A;  4HAY B;  4HCN B;  4ZRI A;  3OLM D;  1J8C A;  1M7E A;  4MGY E;  3M63 B;  4IOY X;  4HLE A;  2KWV B;  4JL9 A;  3IVF A;  3ODO A;  1C1Y B;  3PZD A;  3U7D A;  3DOW A;  2NZ8 B;  2IBI B;  1P9D U;  1XKE A;  4J6I A;  2IO1 B;  4HB4 B;  4A6F B;  1WJM A;  3R66 C;  2V76 A;  2LOX A;  2YSZ A;  4I6P A;  3AU4 A;  4WWN A;  1EGX A;  2D11 A;  1DDM A;  2ZJD A;  4TQ1 A;  2MBQ A;  2O2V B;  3U8Z A;  1EUV B;  3FSS A;  4HPM B;  1KM7 A;  4DBG A;  5AEK B;  5EFX A;  2KX3 A;  1F9J A;  2K2J A;  2J0K A;  4KSK C;  5JP4 A;  4BKT A;  4HK2 A;  4M8N A;  1P6S A;  3OJ3 A;  1WJ1 A;  4NNJ B;  2REX A;  2UZR A;  2BWE S;  3I3T B;  2CS4 A;  5GMV A;  2GS0 A;  1H8C A;  2RR9 A;  1RAX A;  4AOF A;  4MM3 A;  1RJ2 A;  5DPT A;  3N30 A;  2I1K A;  4WWO A;  3QBV B;  3FP5 A;  2L2I A;  3ECI A;  4FJZ A;  2AL3 A;  5J2R A;  1XX0 A;  3BIN A;  2KX0 A;  3M1I B;  1X1F A;  2J7Q B;  3RCP A;  2BKF A;  3UF8 A;  4W9H A;  2M4N A;  3APF A;  4W9C A;  1ZSQ A;  4A3O A;  3ZRC A;  2N1V A;  1RRB A;  5HE0 A;  4A6F A;  5J18 A;  1WGD A;  2GCL A;  1LFD A;  2LGY A;  1WZ0 A;  3D8F A;  2RLO A;  3C0R B;  1BT0 A;  1QC6 A;  2O2V A;  4ICU A;  4FA6 A;  3WA0 A;  5TR5 A;  4W9G A;  2LUL A;  5D3Y A;  1J0G A;  3SDL C;  1WXM A;  4BKG A;  2B3A A;  2VSZ A;  1ZW7 A;  4K7U A;  5JHB A;  2OQB A;  1EAZ A;  1DYN A;  3S2A A;  2KGX B;  2N1W A;  3KVF B;  1WR1 A;  3QJZ A;  4C0A A;  1CMX B;  1WG7 A;  4IM0 A;  4AJY B;  2YT1 A;  2IO0 B;  1E8W A;  2VKI A;  4DHJ B;  4PYZ A;  1W1D A;  4ZYN A;  1K5D B;  4GIV A;  2PEA A;  2KJR A;  4Z2M B;  5FI0 A;  3LJU X;  5L81 A;  1X05 A;  2LOZ A;  4ANU A;  1Z2M A;  2K25 A;  1U5F A;  2C5L C;  5JHH A;  3ZIM A;  3UQB A;  4GB9 A;  2CB8 A;  2ZCC A;  4FUL A;  2Q13 A;  3NS8 A;  1WGG A;  5C5B A;  2KNB A;  1U5D A;  2MA9 B;  2G3Q B;  4K2P A;  4ASW C;  3X0W A;  2JUO A;  4B6H A;  1WX8 A;  2J59 M;  2DZK A;  2IO3 B;  1DDW A;  1E8X A;  5AZF A;  3VAW A;  3EEC A;  1UNP A;  2L0T A;  1FOE A;  2LUE A;  3ZNI D;  2DX1 A;  2MSE D;  4K7W A;  5C23 A;  3GYO A;  2H7E A;  4B95 A;  4GDL B;  4F7H A;  1M7R A;  4H8S A;  4PYU A;  1E7U A;  3KRW A;  3RUL A;  4BBN C;  3SYX A;  3VTU A;  1IP9 A;  1P1A A;  2ZNV C;  4JIO U;  1I2H A;  3PVW A;  1PMS A;  2XBB C;  2J0J A;  1OMW A;  3PVL A;  5AZG A;  1L7Y A;  2M0X A;  3PP2 A;  4OVV A;  2DN6 A;  2QKL A;  3ZNG C;  1E7V A;  2M38 A;  1E5W A;  2DKP A;  1TZ1 A;  4W9E A;  2LBB A;  2KJH B;  1U5G A;  3ZDM C;  2DYO A;  4NPN A;  4DK5 A;  2K6D B;  3O65 B;  2GBN A;  4XWX A;  1MK7 B;  2NBV B;  5IJM A;  3TBL D;  1EF5 A;  4NAW A;  2Y5B B;  4OVU A;  1R4M I;  3WAM A;  1KJT A;  2O6V B;  1WE6 A;  4HB2 B;  2IYB A;  4BBN F;  3O96 A;  4GDL A;  2WDT B;  3UZT A;  1V88 A;  4DHZ B;  2LVO A;  1UH6 A;  5D6J B;  4DXA B;  3F0W A;  3ZW3 A;  4MJS B;  3A4S C;  2UWQ A;  3IBE A;  4DDG D;  2L76 A;  2C7H A;  1S1Q B;  2ELB A;  2RUK B;  1BWN A;  3P7Z A;  3A1Q B;  2DX5 A;  2LVP A;  4KZC A;  3VFK A;  1WFY A;  1WVH A;  4E74 A;  2KOX A;  3SV1 A;  4DX9 0;  4DX8 A;  4TQ0 A;  2N9X A;  3TO1 A;  2Z0P A;  1TQZ A;  1PQS A;  2L00 B;  4A6K A;  2YLM A;  1EF1 A;  5FI1 A;  1EVH A;  5G55 A;  3PVU A;  5CLQ B;  4KIK B;  2MKR A;  3H9D A;  4EEW A;  2CHZ A;  1UZX B;  2L7R A;  4K1R B;  2IO2 B;  4AWJ A;  2Y8F A;  2P0D A; 
#chains in the Genus database with same CATH topology
 2O6V A;  4MSM B;  4MGZ E;  2WLB A;  1L2N A;  1LM8 B;  2CU3 A;  4W9D A;  3KUC B;  1LQB A;  3JYU A;  4MSQ B;  2ZZP B;  3NJT A;  2DTC A;  4OZA A;  2KDI A;  2NBW B;  3GZN I;  4N59 A;  4RMA A;  2BB5 A;  3DVG X;  1KLU D;  2KC1 A;  1WGU A;  3RNG C;  2MW5 A;  4MJS A;  2WDV B;  4NY0 A;  3ML9 A;  2FBW B;  3PV1 A;  3Q3N C;  1UPQ A;  1JML A;  1NVI D;  3A1Q A;  1MG4 A;  1Z5S B;  2KVR A;  4K3B A;  4US9 A;  4ANX A;  1AYF A;  2H89 B;  2KMM A;  3SU8 X;  2Z14 A;  3PSC A;  4C7Y A;  3H7S A;  1P7F A;  2NMB A;  1QOG A;  2PMV A;  1U2B A;  1V9J A;  4LDT D;  4A6H A;  2UU7 A;  1YJJ A;  2Y8G A;  2AEH A;  1QT9 A;  3FIL A;  1L5P A;  4YTP B;  2L8J A;  2LHD A;  1T5X D;  2DFK A;  1IPG A;  1OY2 A;  1ENF A;  3Q8A A;  3DQV A;  4PS7 A;  3UGB B;  5J3Q A;  1OGW A;  1UF0 A;  4PT5 A;  2V4I B;  1NTV A;  1IYF A;  5CHW A;  1DOY A;  1NYR A;  4EFO A;  3PHX B;  4ARC A;  2JRH A;  3NW8 A;  4I6N B;  3UIN B;  3SNH A;  4WWP A;  3SBG A;  1SBB B;  2MX2 A;  2DLB A;  3APC A;  1PGA A;  1YD8 U;  1YQ4 B;  4IWQ A;  1Z87 A;  3ZXR A;  3H1U A;  2DYM A;  4NSW A;  4W9I A;  2YEP B;  2DHZ A;  3RD2 A;  3RYT A;  2GLS A;  1E9M A;  3PPA A;  4CO7 A;  2LKO A;  2DAJ A;  2ICI A;  2WXF A;  4XDD A;  1W1H A;  5JZE B;  4IFS A;  1T0Q C;  5DH9 B;  1NEN B;  2ZVO A;  3KYD D;  2WXQ A;  3PZ7 A;  3SR6 A;  5C1Z A;  2KT7 A;  3ZJT A;  2K8C A;  4P7I A;  1P0R A;  4B9K A;  1NI2 A;  2EC1 A;  1R4N I;  5C16 A;  2MP2 A;  1FXI A;  3PTF C;  2BWF A;  3ODX A;  4EKU A;  1HXY D;  2N9E B;  2WXN A;  3M3J A;  3NY5 A;  2ZNV B;  2INN E;  2K5P A;  3HIE A;  3KY9 A;  2JF5 A;  1L6U A;  2A5U A;  3NVZ A;  2L1A A;  4JKG B;  1FGZ A;  2BYV E;  3FM8 C;  5HG2 A;  4GLS C;  1V5O A;  2DEN B;  2N7J A;  3I5J C;  1XD3 B;  3NHE B;  2CRF A;  5IN7 A;  3UIO B;  2K8B A;  3N1Y C;  1MK9 B;  2DHJ A;  5J3T A;  1N5X A;  3FAH A;  1U27 A;  2KFJ A;  1BTK A;  2COC A;  4IWO A;  3ML8 A;  1WJN A;  2H7D A;  1C78 A;  5DHF B;  3LJ3 A;  1JDE A;  4LNI A;  5LOP B;  4YTN B;  1WM3 A;  2KQ4 X;  2KDE B;  3PT2 B;  2KO3 A;  3QX1 A;  1YOV B;  4HJK A;  1G6J A;  2PE6 B;  5DHA B;  1TIF A;  1TKE A;  1E90 A;  3ENB A;  1V89 A;  1KI1 B;  1UGM A;  4ANW A;  2I5F A;  1D6E C;  2DHI A;  2KD0 A;  2KMA A;  5IOI A;  1MIZ B;  1WY8 A;  3QC8 B;  4WAA A;  4TSS A;  4GMX B;  4WJN A;  4E3C A;  3AE4 B;  4URK A;  2RSG A;  1E8Y A;  3DWM A;  2EKE C;  3L08 A;  1WIA A;  4HCP B;  3LYY A;  1R4M B;  2I5C A;  3GYP A;  2D07 B;  2HJ8 A;  3Q3F A;  1C3T A;  1OTR B;  1QOB A;  1YJ1 A;  3U30 A;  3EA6 A;  2WDQ B;  1JWS D;  2LGS A;  2Y3A A;  4HDQ A;  1Y19 B;  4BOS C;  3KUZ A;  3WIM A;  4YSZ B;  2LHE A;  1MJD A;  4OSN A;  2WX1 A;  2KUQ A;  3PLU A;  5H8Y E;  4A55 A;  2Z0E B;  2QMT A;  2N0S B;  4HWI B;  4HB3 B;  2H88 B;  2LD9 A;  3Q3M C;  4TKN A;  1GC6 A;  3CMM B;  2ABD A;  4C80 A;  3I9V 1;  1YX6 B;  1WZ3 A;  3IAM 1;  3RNB C;  3DHI C;  2DZI A;  2WDR B;  1KTK A;  2MCN B;  4II2 B;  4XX5 A;  2K8E A;  3LDZ E;  2PLP A;  2R2Q A;  1RFK A;  4JKG A;  2D4Q A;  2KZR A;  5C5B B;  1RLF A;  4K7S A;  2BW2 A;  2N9P C;  3Q8B A;  1M4V A;  5HHD G;  2V3N A;  3SUZ A;  4ARI A;  2L52 A;  1ST7 A;  4EZK A;  1LB1 A;  3Q8C A;  2ZW0 A;  2W9N A;  3WAO A;  3O13 A;  2MRP A;  2HTH B;  4Z2N A;  2Q5W D;  2JU6 X;  4USA A;  1NTY A;  1WRD B;  1I7A A;  3HM3 A;  5JLJ B;  5L95 C;  3L10 B;  1T0S C;  1Q0W B;  1I42 A;  1PFJ A;  3KWV A;  1ZC4 B;  4HPL B;  1DDV A;  4KDL B;  3Q14 C;  4P16 A;  1J0W A;  2PE9 A;  3CF6 E;  2FJU B;  5JVL A;  4HAV B;  3LXF A;  4N58 A;  1GUA B;  4EE2 A;  1RYJ A;  3ZTC A;  2PIA A;  1QLB B;  2JPH A;  3RT3 B;  2MEK A;  3ML4 A;  3D8D A;  2BT6 A;  3Q8E A;  5E6P A;  1ZVR A;  2G4D B;  2J42 A;  2MJD A;  1ZM0 A;  2AWT A;  2GRI A;  4XDC A;  4I6L B;  2LZ6 A;  4JKF A;  3DXE A;  2QHO A;  5DPS A;  1JWA D;  5JHA A;  1XLQ A;  3A8Q A;  3VTV A;  2N7E A;  1C77 A;  1WMH A;  2Y7B A;  3B08 A;  3AE8 B;  4NJ7 A;  2NVU I;  3U7Z A;  1KZ7 A;  1TGZ B;  3ZGZ A;  3V6C B;  4KAX B;  3OG5 A;  2KXJ A;  1FEH A;  2KTR B;  3GZN B;  2CAY A;  3QQ8 B;  2D9V A;  1I4X A;  3VOQ A;  2KIE A;  2W3R A;  5D3I B;  2KDF B;  3RNE C;  3TMP B;  4KHB B;  1J19 A;  5KHO A;  3DCX A;  2M8S A;  5CHV C;  3NZU A;  1B9R A;  4KX6 B;  3ULB A;  4WJP A;  4WAF A;  2N4F A;  1FD6 A;  2RD0 A;  4AJW A;  2EJ8 A;  2DBY A;  2MDX A;  3M95 A;  5D7G A;  3MPX A;  3KW5 B;  4Q2J A;  1FO4 A;  2ZW1 A;  1N3H A;  3NWA A;  3T3N A;  2CU1 A;  2LXA A;  2WXK A;  1UNS A;  5J17 A;  3CST A;  2HDE A;  2HTH A;  1KLV A;  2WYQ A;  4NAW B;  4IM2 A;  3TJP A;  4N9F 4;  2RGF A;  1Q1O A;  2N23 A;  4UDU C;  5IA7 A;  3V5W A;  2KAN A;  3ZJU A;  2DYQ A;  1XQQ A;  3TEW A;  1V5M A;  4RM9 A;  1WM2 A;  3AEA B;  5DI9 B;  5FK9 C;  5MPO A;  1WXA A;  1TKY A;  3B1L X;  2JT4 B;  4FHJ A;  4X57 B;  4IAP A;  4HAZ B;  3FEH A;  3PS6 A;  2FE8 A;  2V3S A;  5HE3 A;  3ODW A;  4HXD A;  3NVV A;  1UD7 A;  2VH1 A;  2UZS A;  4GGQ A;  2Z0O A;  1ZUD 2;  4REZ A;  4MAC A;  1HB8 A;  5IKC M;  2BYT A;  4JGH B;  1K8R B;  2BYF A;  4ZRK A;  2BS4 B;  2IND C;  2GB1 A;  1PLS A;  1WI0 A;  4GSW A;  4WJ7 A;  4GN1 A;  1ACA A;  4IM3 A;  2GOW A;  1FB8 A;  3UQA A;  4ZDV A;  3GOE A;  2DX5 B;  1VCB A;  2RPQ A;  1TTN A;  1ZGU B;  2Z0D B;  1W1G A;  4ILH A;  5AUK A;  2PVO D;  4F7G A;  2KTR A;  2BTE A;  2G35 A;  3E9O A;  3AEE B;  1MAI A;  4P6V F;  2RVB B;  3Q6B A;  4JK7 A;  1XOD A;  1VBG A;  4L1R A;  4DXG A;  2QEJ C;  2JY6 A;  2K2U A;  3A4R A;  2QSD A;  5D27 A;  2YS1 A;  2WXI A;  4II3 B;  2EMS A;  3ZNH B;  1WH3 A;  5IP4 D;  3SEB A;  3ENE A;  4HB0 B;  3NVW A;  4WJQ A;  5GXG B;  4JWS C;  4W9J A;  5D3V A;  1V5U A;  2E2X A;  1SEB D;  1FHX A;  4LNK A;  1EWY C;  2KWU B;  4FJV B;  1WXV A;  2QIL A;  1FCL A;  4XC2 A;  1M94 A;  4JPS A;  3SO6 A;  2LXC A;  3R7R A;  3QK0 A;  3ULC A;  2KR0 A;  3N7C A;  1WGY A;  1GJZ A;  4GDK B;  4AS1 A;  3BJI A;  1Q10 A;  1I35 A;  2I38 A;  1FHO A;  4LJO B;  2SEB D;  2NTT A;  4GU2 A;  5JH5 C;  1OEY J;  2ASQ A;  1UWX A;  3KLS X;  1QKZ A;  2CY4 A;  3VR9 B;  1YQ3 B;  4HAX B;  1SJH D;  2KDM A;  1TS3 A;  1SHC A;  4GZU A;  4HAW B;  4MY6 A;  2IY1 B;  2D3G A;  5IAA C;  4EZL A;  4BBK A;  1X1G A;  1OQQ A;  2LVQ A;  4BOZ B;  4HEA 1;  2WX0 A;  4XE0 A;  3NRZ A;  1V86 A;  4KVG B;  1TBE A;  1JWM D;  2MJE A;  3PRZ A;  4KV2 A;  3ZLZ A;  3APD A;  4QJ4 B;  2FJL A;  1J7C A;  3L17 A;  1MPE A;  3DBH I;  2IJ0 A;  2FCS A;  2X8X X;  1SJE D;  5CLL B;  2FJ9 A;  3A8P A;  1JWU D;  2OOB B;  5KHQ A;  1GG3 A;  5G5H A;  1P3Q U;  1PGB A;  4JKH A;  3NG0 A;  3DXD A;  1QQR A;  3QCA A;  2WHI A;  2BYE A;  3T06 A;  1D3Z A;  3Q2A C;  4XWW A;  2WWZ A;  3U12 A;  5CHF A;  1YJI A;  4YSY B;  1K50 A;  2JVC A;  2YRY A;  1UEL A;  2CHX A;  4A3P A;  3DWG C;  1E10 A;  1ZP0 B;  2D9Z A;  1K52 A;  2V1Y A;  2PW9 A;  4KHO A;  2Z59 A;  3KH0 A;  1HE8 A;  5LON B;  1V6E A;  3MDB C;  1AQC A;  1R7S A;  1V97 A;  3JVZ X;  3B0A A;  3P42 A;  2DZJ A;  2LUM A;  2CHW A;  1E0Z A;  2KFK B;  4BKS D;  4GOC A;  1FRR A;  1SE4 A;  4AUQ C;  2XK5 A;  4LDT B;  2UYZ B;  3RFZ B;  4RH6 A;  4NJC A;  4PK1 A;  3NS1 A;  1AWE A;  3H6N A;  1FRD A;  2LFI A;  4FLH A;  2R2O A;  2WH5 A;  1WGR A;  2D10 A;  1WRI A;  3A9J A;  3HIZ A;  3T8M A;  1RRP B;  5E6O A;  3VUW A;  4GDK A;  3DVN V;  3QA8 A;  4BKS A;  1GNU A;  4HAT B;  2LYD A;  4JQW C;  1J7A A;  3LB8 C;  4A90 A;  5HE1 A;  3P4S B;  2VZK B;  4CHJ A;  2KQ7 A;  2NMQ A;  3HK0 A;  3NSU A;  2FNJ B;  2WXO A;  1JRU A;  1V81 A;  1UBQ A;  3UI3 A;  4G11 A;  3PRP B;  2GBJ A;  3E9L A;  4JK9 A;  2GUM A;  3HW2 B;  3WAL A;  2LGX A;  2KKC A;  1XR0 B;  4R3D A;  1C4P A;  1GAQ B;  2JZP A;  3F5R A;  1EWC A;  3EFU A;  4S17 A;  2MP2 B;  4YXD B;  3ZRF A;  3QAQ A;  2KAJ A;  3RZW C;  3W5U B;  2C7N B;  1BXT A;  2IZV B;  1CK1 A;  3W1S A;  2PKO A;  3VUX A;  1JRP A;  1XLN A;  2DWQ A;  2LMC A;  3FC4 A;  5C6R A;  4G50 A;  1L6V A;  5DCN A;  1JQ4 A;  1B55 A;  2BPS A;  2Z0Q A;  2INC C;  2NPT B;  2M14 A;  3DVN U;  2C60 A;  3QWM A;  3OAW A;  1VZ7 A;  3BZD B;  2RGN B;  2OHF A;  5EE0 A;  2AYO B;  3QIJ A;  2V9H A;  2ADZ A;  3IT6 B;  4RGT A;  2LWP A;  1LXD A;  1QQG A;  1PGX A;  3A9K A;  3L54 A;  3AEC B;  4RM8 A;  5D2M B;  2W2W A;  4MGK E;  5M4Y B;  1NU2 A;  3TW1 A;  5C79 A;  4WQM A;  1MKE A;  1X11 A;  1YIW A;  3DHG C;  4KGT A;  2X18 A;  1V5T A;  3B2F A;  2KJ6 A;  3AU5 A;  3CIK A;  4XGA B;  3A98 B;  2JQR B;  2MFQ A;  3HM6 X;  2L1C A;  4DIX A;  4O1N A;  2KFK A;  2D9X A;  2W55 A;  2PZ1 A;  1TJE A;  2IY0 B;  4K2O A;  2B76 B;  1HZ5 A;  1KFY B;  1IBX A;  1H10 A;  5DIF B;  2VZK D;  3EHV A;  3WAP A;  1V5P A;  2K49 A;  2P0F A;  5DPW A;  4W9K A;  3IHP C;  1IRS A;  3U2S C;  1WF9 A;  1VRA B;  4YTM B;  1CJE A;  2KDB A;  3HUI A;  2YF0 A;  2BGF A;  1TT5 B;  3V62 A;  2DYB A;  4XZ4 A;  3D32 A;  1ZYI A;  2L83 A;  1BUI C;  1JWB D;  4FN2 A;  1QF6 A;  2D3A A;  3DXC A;  2FAZ A;  2J52 A;  3AEG B;  3NZS A;  1HZ6 A;  3V6E B;  3WYF B;  1TS5 A;  2MLB A;  1LGR A;  2JP2 A;  5CX3 A;  2K6Q A;  3V61 A;  2JZ3 B;  2LI5 A;  4RCO A;  2WS3 B;  2K39 A;  4CHK A;  1TY2 A;  4TUU A;  3RPF C;  1WR6 E;  3TUO A;  3SD5 A;  3L0W B;  3QHT A;  2IPK D;  3W1Y A;  2L3Z A;  1MI1 A;  3DCG A;  2NPT A;  3I63 C;  3ZO5 B;  2WXR A;  2RNR B;  5I4D A;  4Y94 A;  4OW0 A;  4JK8 A;  1WX9 A;  1N63 A;  3IT4 B;  5D3X A;  4TYZ A;  2CKH B;  4WWM A;  2R82 A;  1SGH A;  1RFA A;  5LLI A;  2GI9 A;  4XWT A;  3OJ4 B;  2D2Q A;  1WXS A;  4US8 A;  4H2A A;  3VIA A;  4KHA A;  1FHW A;  1U4A A;  1D5X C;  2KUP A;  3PO0 A;  4KKI A;  4LTU A;  1YQB A;  1UPR A;  1VJK A;  2K0P A;  3KWL A;  3JSV A;  3V60 A;  2QKM A;  1U5E A;  4FBJ B;  4A5K A;  1DBH A;  1T0Y A;  1DIK A;  2XNA C;  4IW0 A;  2GJY A;  2COD A;  2DHK A;  3EC8 A;  3ZDT A;  2YT2 A;  2M17 A;  1DOX A;  1ROE A;  3HSA A;  3H7P A;  3TL5 A;  3W5V B;  1ZDV A;  3L16 A;  1SE3 A;  4MH0 E;  1EO6 A;  1P98 A;  2LGD A;  3A33 B;  3B77 A;  3AV8 A;  4C7Z A;  2V4L A;  3AE1 B;  3PLV A;  4ZRJ A;  3ONS A;  3W1S C;  2D9W A;  3DPD A;  3C8Y A;  3H8H A;  5JXV A;  3PSE B;  2IYD B;  1VD2 A;  5JHG A;  1WMH B;  2KYW A;  4JKA A;  2DYN A;  2G4S A;  2CQU A;  4KSL C;  1F52 A;  2FIF A;  4LJP B;  4WQO B;  1Q5W B;  2LAS A;  4BFR A;  1H4R A;  3RCZ A;  2FDQ A;  2I1J A;  2Z13 A;  4G0N B;  1TY0 A;  3AJ4 A;  3DBH B;  3TCA A;  2ZPY A;  4QAY A;  4ZRP A;  4LNN A;  1MPH A;  3CXB B;  1XO3 A;  4NQL B;  2ROZ B;  3ZVR A;  1ET9 A;  4YWG G;  1FPY A;  4JKD A;  1NI3 A;  2K8H A;  2N7D A;  4HJG E;  1ISN A;  3N3K B;  5GOW B;  3ZNZ B;  2BS3 B;  1C79 A;  1FNW A;  2GBM A;  5H92 C;  4HAU B;  1WJU A;  1FAO A;  4FJY A;  1P5T A;  2X0S A;  1UWM A;  2C9W B;  4QJ3 B;  3KYC D;  1NDD A;  3EPY A;  3N32 A;  3T3O A;  3VR8 B;  3QWZ B;  5D3W A;  4DHZ E;  4LK0 M;  2KAC A;  2LJ5 A;  4ANV A;  2DZM A;  1QOA A;  3R3M A;  4DQO C;  2FID A;  1V80 A;  2W82 A;  3ZYY X;  5BMH A;  1GC7 A;  3AUL A;  3HVD A;  2HTM E;  2MQJ A;  4W9F A;  3X23 A;  1OQN A;  4HRO A;  4W9L A;  2DLW A;  1MG8 A;  4WSF A;  4KDI C;  4DBB A;  3DBR I;  4M00 A;  1Y8R C;  3BK1 A;  3AXC A;  2ZCB A;  4D2K A;  1PFD A;  1Y5O A;  4RGN A;  1SF0 A;  1LO5 D;  5DPR A;  2BS2 B;  1FGY A;  1ZPS A;  2GBR A;  3DDC B;  1OQY A;  3NWD A;  5EE3 A;  3AI5 A;  5EDS A;  2RRF A;  1F2R C;  2A4Z A;  1GGO A;  5L83 A;  1A70 A;  4MEM A;  1YX5 B;  4L6E A;  2PJH A;  3ZKJ C;  4DWF A;  3TFM A;  1VLB A;  3A58 A;  3ALB A;  1V2Y A;  1I4R A;  3BVG A;  4DDI D;  2NCN A;  3MHZ A;  2G9H D;  2FCQ A;  3FKY A;  1QZE A;  2WGS A;  3PG7 A;  2JRI B;  2MBO A;  1UUP A;  1WGQ A;  3ZXV A;  3PGE A;  2MBE A;  3AE3 B;  3VHT C;  4RGO S;  5E6N A;  3TSS A;  1SXT A;  5G2N A;  1SE9 A;  3K9O B;  1T0R C;  4WVF B;  1WJ6 A;  5E6J A;  3U4E G;  2LG1 A;  3I57 A;  2ZKM X;  2HE7 A;  1E8Z A;  3L4P A;  2JWZ A;  3VXW A;  5I2M A;  1EU4 A;  2Z8L A;  4IKG A;  5TSS A;  4FHK A;  2K1F A;  4YT0 B;  4DXF A;  3P2B A;  2D3C A;  3IG3 A;  5G5G A;  1KF6 B;  3VDZ A;  1ZDX A;  3VTW A;  1D5Z C;  4NJ6 A;  3RZF A;  2L0F A;  3MHS D;  3FVC A;  1L0Y B;  2WXJ A;  2FUG 1;  2KMC A;  4MH8 A;  2KWC A;  4MDK E;  4XYC A;  4LCD E;  2P8V A;  2BKR B;  1WXQ A;  2G45 B;  2C7M B;  2DAF A;  1FNU A;  3TVV A;  1MHX A;  2JX5 A;  1LW3 A;  1WWT A;  1HA5 A;  4HDO A;  5AZH A;  2WNM A;  5HFY A;  3AN1 A;  5KQ1 A;  3E56 A;  3KUD B;  3DVG Y;  2K00 A;  1J7B A;  4HVB A;  1C9F A;  2KK8 A;  5HI1 A;  4DHJ D;  4EUT A;  2NBU A;  3RNA C;  1UNR A;  3MC8 A;  1CQV A;  1XT9 B;  2MHJ A;  1KRH A;  4L1B A;  3BVM A;  2V0G A;  1HBK A;  1ZC3 B;  1JW9 D;  4RF1 A;  4F1S A;  3KQ4 A;  3PZ8 A;  1WYW B;  4F8C B;  4BVU C;  2DNF A;  3P4P B;  1D4B A;  3KSY A;  4TMA B;  2KLC A;  3DBL I;  4P1C C;  2R09 A;  2YVC A;  1T6B X;  2CY5 A;  4K17 A;  5BYR A;  4MT7 A;  2KQS A;  3AE7 B;  3G9W A;  2RDH A;  4TV3 A;  2Z59 B;  2P0H A;  2BCJ A;  2VRR B;  4NQK E;  1FCC C;  1WX7 A;  5D94 A;  1SIF A;  2JSV X;  1KOT A;  1V61 A;  2HD5 B;  3AEB B;  1S3S G;  1OEY A;  4C4V A;  2VRW B;  2JZZ A;  2N0Y A;  2KHW B;  1VZ6 A;  2XK5 B;  1BTN A;  1WSP A;  4KGS A;  2ROV A;  2WXP A;  3T9L A;  3ZTD A;  4IG7 B;  5D3D A;  3OAN A;  3PEG A;  2BQQ A;  4BZA A;  2OJR A;  3A9J B;  3IAS 1;  2KN5 A;  4OT1 A;  2SAK A;  1HEZ E;  2DKQ A;  5EE9 A;  1JAL A;  1NYQ A;  2W2X D;  3SFD B;  2IFS A;  4MK0 A;  4PQ0 A;  1HB6 A;  3PHW B;  3Q8F A;  2WXL A;  3SHQ A;  1CZP A;  4MGI E;  2MWS B;  3PRM B;  3W9C B;  1C76 A;  4K81 A;  2HRJ A;  3K9P B;  3MFG A;  4ZHO A;  3FLV A;  3BII D;  2KWD A;  4F7Z A;  4PNK A;  2PVG C;  4EMO A;  4RFB A;  2FUH B;  4ICV A;  1C4A A;  4EJN A;  1V1P B;  4ILJ A;  4ILG B;  3VH4 B;  2COF A;  1K5G B;  3VUY A;  1Q67 A;  4G3X B;  3CIR B;  4D0N B;  2PPH A;  2COP A;  2KTF A;  2M1M A;  3HVZ A;  1KZG A;  1TJ6 A;  1TYG B;  4PS3 A;  4AP4 C;  2UVM A;  4PS8 A;  1WI1 A;  1IGD A;  1MHH E;  4A20 A;  2GBK A;  4M01 A;  3MJW A;  3M62 B;  3A9K B;  2GCJ A;  2XEW A;  2WQY B;  3EGR A;  5J3Y A;  2ZVN A;  1WGH A;  3KZ1 A;  1TS4 A;  5LXH A;  3L13 A;  1WJ4 A;  4IUM B;  1FFU A;  1AAR A;  2MBH A;  2EMT A;  4ZYS A;  1ESF A;  2FCM A;  2MWN B;  2FCN A;  1AWD A;  2MBB B;  1FFV A;  3CSF A;  2RSU A;  4YON A;  4OZC A;  3TIX A;  1OFF A;  1FM0 D;  3RUI B;  1DGJ A;  2KCJ A;  4BAX A;  1IBX B;  4JLC A;  2COA A;  4B0M A;  3JW0 X;  3Q3O C;  1I4G A;  2DA0 A;  3PRE A;  1NBF C;  3R8B A;  2M0A A;  2KLG A;  1XD4 A;  2JWU A;  2Y5P A;  5LXI B;  1STE A;  1X86 A;  4B0E A;  1Y56 A;  1X1M A;  3RMK C;  5IRS A;  3UIP B;  2KVZ A;  1FXT B;  1UNQ A;  4IWP A;  2O6V D;  5BYS A;  3J9C A;  1QOF A;  5KQ4 A;  3DBR B;  1B1Z A;  4A9A A;  2JXT A;  2NBV A;  2IGD A;  1NVL A;  4EOY A;  3NVY A;  3KRX A;  3VQI A;  2I2Y A;  3HRD D;  4CQN A;  4JKC A;  2GMI C;  2KN4 A;  2AQ3 B;  3E9P A;  4F7U P;  1XCG A;  3MC9 A;  2OTX A;  4M0W B;  3WAN A;  3AM9 A;  4YSX B;  3IFW B;  3MP9 A;  1I7H A;  1TXD A;  2G1E A;  1ACC A;  1A5R A;  1UEF A;  1TZO A;  4D6W A;  1V1P A;  4B6W A;  1FMA D;  4GMV A;  4GPT B;  1V49 A;  2BF8 B;  3GE8 C;  3HHM A;  1N5W A;  2D5G A;  2NR2 A;  1P7E A;  4WJO A;  4GXB A;  3D8E A;  3V3X A;  2VH2 A;  5FR6 A;  2D9Y A;  4A8X C;  1NTI A;  3ZUN A;  2LRU A;  1P3R A;  5HE2 A;  4EZJ A;  3VH3 B;  4CHM A;  2J0M A;  2OED A;  3DBS A;  2ZEQ A;  2LEK A;  2RQ1 A;  1BML C;  3MJ5 A;  3RNF C;  1FIQ A;  4OZB A;  4HKQ A;  2BVC A;  3AEF B;  2CR5 A;  4CYE A;  2ELA A;  4FAD A;  4QXA B;  2ZPN A;  2R0D A;  4MEL A;  2NS5 A;  3P6A A;  2ON8 A;  4KZ0 A;  3QAR A;  5KCV A;  4YL8 A;  2YS3 A;  3AE5 B;  3JSV B;  3B2G A;  4E71 A;  2JXX A;  4M8M A;  3NOB A;  2K9X A;  3TEZ A;  2AL6 A;  3BY4 B;  5LNK 1;  1T77 A;  2LRW A;  3ZVV A;  3H7P B;  2YT0 A;  2KC2 A;  2W2X C;  3MTN B;  2XQN M;  1F0Z A;  5AUI A;  1WE7 A;  3VVW B;  2L32 A;  1ZKH A;  1UBI A;  4IC7 B;  5HKH A;  5BMG A;  1BAK A;  4HHV A;  1U29 A;  3W2D A;  4KIK A;  2YS5 A;  3Q3J A;  4MM3 B;  3AMZ A;  1MFW A;  1L4Z B;  4GNK B;  3ZQ4 A;  2WP9 B;  2L05 A;  1D5M C;  4N6E B;  3HQC A;  2M56 B;  5CTR C;  3R7Q A;  1UGJ A;  5BO4 B;  1DRO A;  1MIX A;  4HAY B;  4LNF A;  1EM7 A;  4HCN B;  4IDI A;  1OQR A;  4ZRI A;  1KC7 A;  2XN9 C;  4M0W A;  4WUR A;  3OLM D;  1J8C A;  1M7E A;  1PUT A;  3OWE B;  3N9Y C;  1E6E B;  4IOY X;  3M63 B;  4MGY E;  4HLE A;  3P4Q B;  3C19 A;  2KWV B;  4JL9 A;  3IVF A;  4KGR A;  3ODO A;  1C1Y B;  4ZOH C;  1QIL A;  3PZD A;  3U7D A;  4RF0 A;  5IO9 A;  3DOW A;  2OJW A;  2AQ1 B;  4FXC A;  3DBL B;  2NZ8 B;  2IBI B;  1P9D U;  3GE3 C;  1XKE A;  4J6I A;  3N1Z C;  2AQ2 B;  2IO1 B;  4JE3 B;  4HB4 B;  4A6F B;  3VRB B;  1WJM A;  3R66 C;  2V76 A;  2LOX A;  4JX1 C;  5EE1 A;  2YSZ A;  4OVZ A;  5FKA C;  5BMI A;  1GPX A;  1T3Q A;  2IGG A;  4I6P A;  3AU4 A;  4WWN A;  1SSN A;  1E7P B;  1EGX A;  2D11 A;  1DDM A;  2ZJD A;  4TQ1 A;  2MBQ A;  2RDG A;  2O2V B;  3U8Z A;  1EUV B;  4NZL B;  4GOU A;  3E9S A;  3FSS A;  3GS2 A;  2JYE A;  4HPM B;  2BB6 A;  1KM7 A;  1SIJ A;  4NAM A;  5FR3 A;  4DBG A;  5AEK B;  5EFX A;  2KX3 A;  1F9J A;  2K2J A;  2J0K A;  1NEK B;  3OHM B;  1HQR D;  4KSK C;  1L0X B;  5JP4 A;  4BKT A;  2Z4D A;  2LGI A;  4HK2 A;  4M8N A;  1P6S A;  3OJ3 A;  1WJ1 A;  4NNJ B;  2REX A;  1YN5 A;  2UZR A;  1ZOY B;  2BWE S;  2TSS A;  3B9J A;  3I3T B;  4L2Y A;  4C00 A;  2CS4 A;  5GMV A;  2GS0 A;  2W3S A;  1H8C A;  2RR9 A;  5LG4 B;  3AH7 A;  1RAX A;  4AOF A;  4MM3 A;  1RJ2 A;  5DPT A;  4ZRQ A;  3N20 C;  3N30 A;  2I1K A;  3RNC C;  3NUH B;  4WWO A;  3QBV B;  3FP5 A;  1N61 A;  2WXH A;  1K53 A;  4WIP A;  3R2I A;  2L2I A;  3NWF A;  4A6Q A;  3ECI A;  4FJZ A;  5T8I A;  4IOI E;  2E3T A;  2AL3 A;  5J2R A;  1MI0 A;  1N60 A;  2WXM A;  1IGC A;  1XX0 A;  2K22 A;  3BIN A;  3VRA B;  2KX0 A;  3M1I B;  1X1F A;  2J7Q B;  2RPV A;  1TKG A;  1DYQ A;  3RCP A;  2BKF A;  3UF8 A;  1SB3 C;  2M4N A;  3AE9 B;  3APF A;  4W9H A;  4W9C A;  1ZSQ A;  4A3O A;  2CJN A;  2E6X A;  3ZRC A;  2N1V A;  5C3J B;  2N9L A;  1RRB A;  5HE0 A;  4A6F A;  2LJI A;  5J18 A;  1WGD A;  3ETR A;  1GOZ A;  2GCL A;  1LFD A;  2LGY A;  3BYT B;  4M02 A;  1WZ0 A;  1JRO A;  3D8F A;  2RLO A;  4WH4 A;  3C0R B;  1ZE3 D;  1BT0 A;  1QC6 A;  2O2V A;  4ICU A;  3EUB 2;  2JYT A;  4FA6 A;  2R61 A;  3WA0 A;  5TR5 A;  4W9G A;  2D3B A;  2LUL A;  1N62 A;  5D3Y A;  1J0G A;  1ZXI A;  3SDL C;  1WXM A;  1VBH A;  4BKG A;  2B3A A;  2VSZ A;  1ZW7 A;  1RM6 C;  4K7U A;  3U52 E;  5JHB A;  1V8C A;  4HSI A;  1XEE A;  2OQB A;  1EAZ A;  1DYN A;  2WXG A;  1F2R I;  3S2A A;  2KGX B;  1JCK B;  2N1W A;  3KVF B;  4RNA A;  1WR1 A;  2X38 A;  2HJ1 A;  3DHH C;  3QJZ A;  4C0A A;  1CMX B;  1WG7 A;  4IM0 A;  4AJY B;  2YT1 A;  2IO0 B;  1E8W A;  2VKI A;  4RGM A;  2IGH A;  4DHJ B;  4PYZ A;  1I4P A;  1W1D A;  4ZYN A;  2J53 A;  1K5D B;  1C4C A;  1V1O A;  4GIV A;  5BYQ A;  1XCT L;  2PEA A;  2QIE B;  3BVZ A;  4JKE A;  2KJR A;  2N9K A;  4OHJ A;  4Z2M B;  3AE6 B;  2EEL A;  5C2T B;  5FI0 A;  3LJU X;  2QC8 A;  1I4H A;  4C4V B;  5L81 A;  1X05 A;  2LOZ A;  1YN3 A;  2R2Y A;  2QDF A;  4ANU A;  1Z2M A;  2K25 A;  3IXS A;  1U5F A;  2C5L C;  5JHH A;  3ZIM A;  3UQB A;  4GB9 A;  1ZXH A;  2CB8 A;  2ZCC A;  4FUL A;  4QJ5 B;  2Q13 A;  3NS8 A;  1VR9 A;  3P63 A;  1WGG A;  3RI7 C;  4AQ7 A;  1MVK A;  1VDV A;  2J4X A;  5C5B A;  2KNB A;  1U5D A;  2MA9 B;  1XF5 L;  3RN9 C;  2G3Q B;  3BK2 A;  4K2P A;  2QCZ A;  3X0W A;  4ASW C;  2K3U A;  2JUO A;  4B6H A;  1FXA A;  1WX8 A;  2J59 M;  2DZK A;  2M19 A;  4HKZ E;  2IO3 B;  1F77 A;  1HTQ A;  2ACZ B;  1DDW A;  1E8X A;  5AZF A;  3VAW A;  3EEC A;  1DOI A;  1UNP A;  3GB1 A;  2RMM A;  3P1M A;  4ACF A;  2L0T A;  1FOE A;  1VZ8 A;  3GP7 A;  2LUE A;  3ZNI D;  2DX1 A;  2MSE D;  1L0V B;  4K7W A;  3ABV B;  1KBL A;  5C23 A;  3GYO A;  2H7E A;  4B95 A;  4GDL B;  3E66 A;  4F7H A;  2QJL A;  3MC0 B;  1KLG D;  1M7R A;  2BBC A;  4H8S A;  4PYU A;  3ZJV A;  4J3O D;  2Y5C A;  1E7U A;  3KRW A;  3RUL A;  4BBN C;  3SYX A;  1F1H A;  3N1X C;  1GB4 A;  1WYG A;  3VTU A;  1IP9 A;  1P1A A;  2ZNV C;  1YN4 A;  4JIO U;  1I2H A;  3PVW A;  1PMS A;  2XBB C;  2J0J A;  1OMW A;  3PVL A;  1PYW D;  3EFC A;  5AZG A;  1L7Y A;  2M0X A;  3PP2 A;  2V3P A;  4OVV A;  3TEX A;  2IDY A;  2DN6 A;  4P1B C;  4HRS A;  3CWI A;  1HTO A;  1R4N B;  2QKL A;  3ZNG C;  1E7V A;  2M38 A;  1E5W A;  4ITK A;  2DKP A;  1TZ1 A;  4W9E A;  2LBB A;  4KHB A;  2KJH B;  2KIG A;  3P4R B;  1U5G A;  3ZDM C;  2DYO A;  4NPN A;  2PTL A;  2AX5 A;  1N6Z A;  4DK5 A;  1TS2 A;  2K6D B;  1IUE A;  3O65 B;  2GBN A;  4XWX A;  1MK7 B;  3URY A;  2NBV B;  1AN8 A;  3TEY A;  1EU3 A;  5IJM A;  3SBT A;  3TBL D;  1YMH E;  2YEP F;  1EF5 A;  5I2S A;  4NAW A;  2Y5B B;  4ZHP A;  4OVU A;  1YNT E;  1R4M I;  3WAM A;  1FNV A;  1KJT A;  2EKI A;  2O6V B;  4C56 C;  2MH7 A;  1WE6 A;  1K51 A;  3SFE B;  1GB1 A;  4HB2 B;  2NTS A;  1WGK A;  2IYB A;  3V05 A;  4BBN F;  3O96 A;  4GDL A;  2CJO A;  1XXG A;  4LLG M;  2WDT B;  3UZT A;  1V88 A;  4DHZ B;  2LVO A;  4L23 A;  1RWS A;  1UH6 A;  1PDX A;  5D6J B;  4DXA B;  3F0W A;  1KH0 A;  3BYY B;  2WU2 B;  2W54 A;  3ZW3 A;  4MJS B;  3A4S C;  2UWQ A;  3IBE A;  4DDG D;  2L76 A;  2C7H A;  1S1Q B;  2ELB A;  2RUK B;  1BWN A;  4LNO A;  3P7Z A;  3A1Q B;  3BWU D;  2DX5 A;  2LVP A;  4KZC A;  4CSQ A;  4S0R A;  1I4Q A;  3VFK A;  1WFY A;  1WVH A;  2INP E;  2ONQ A;  2DIK A;  4HPP A;  3FIL B;  1L4D B;  4K3C A;  2WU5 B;  4E74 A;  2KOX A;  3SV1 A;  4DX9 0;  4DX8 A;  4TQ0 A;  2N9X A;  3AED B;  3TO1 A;  2MJ3 A;  1XLO A;  2Z0P A;  1TQZ A;  1PQS A;  2L00 B;  4KKJ A;  4A6K A;  2YLM A;  1EF1 A;  5FI1 A;  1EVH A;  3AB5 A;  4JWU C;  4MT5 A;  3PVU A;  5G55 A;  5CLQ B;  1ET6 A;  3Q69 A;  4KIK B;  2MKR A;  3H9D A;  3AE2 B;  2RDB C;  3NZ3 A;  4EEW A;  2CHZ A;  1UZX B;  2L7R A;  4K1R B;  2IO2 B;  3WCQ A;  1AW7 A;  1XLP A;  1XCQ L;  4AWJ A;  3R2T A;  1SE2 A;  4JKB A;  2Y8F A;  2P0D A; 
#chains in the Genus database with same CATH homology
 2O6V A;  4MSM B;  4MGZ E;  1L2N A;  1LM8 B;  4W9D A;  3KUC B;  1LQB A;  3JYU A;  4MSQ B;  2ZZP B;  2DTC A;  2KDI A;  2NBW B;  3GZN I;  4RMA A;  3DVG X;  2KC1 A;  1WGU A;  2MW5 A;  4MJS A;  4NY0 A;  3ML9 A;  3PV1 A;  1UPQ A;  3A1Q A;  1Z5S B;  2KVR A;  4ANX A;  3SU8 X;  3PSC A;  3H7S A;  2NMB A;  1U2B A;  1V9J A;  4LDT D;  4A6H A;  2Y8G A;  2AEH A;  2L8J A;  2DFK A;  1IPG A;  1OY2 A;  3DQV A;  4PS7 A;  3UGB B;  5J3Q A;  1OGW A;  1NTV A;  1IYF A;  5CHW A;  4EFO A;  3PHX B;  2JRH A;  4I6N B;  3UIN B;  3SNH A;  4WWP A;  3SBG A;  2MX2 A;  3APC A;  1YD8 U;  4IWQ A;  1Z87 A;  3H1U A;  2DYM A;  4NSW A;  4W9I A;  2DHZ A;  3RD2 A;  3RYT A;  3PPA A;  4CO7 A;  2LKO A;  2DAJ A;  1W1H A;  5JZE B;  4IFS A;  5DH9 B;  2ZVO A;  3KYD D;  5C1Z A;  2K8C A;  4P7I A;  1P0R A;  4B9K A;  1NI2 A;  2EC1 A;  1R4N I;  5C16 A;  2MP2 A;  3PTF C;  2BWF A;  3ODX A;  4EKU A;  2N9E B;  3M3J A;  3NY5 A;  2ZNV B;  2JF5 A;  3KY9 A;  2A5U A;  4JKG B;  1FGZ A;  2BYV E;  3FM8 C;  1V5O A;  2DEN B;  1XD3 B;  3NHE B;  2CRF A;  3UIO B;  2K8B A;  1MK9 B;  2DHJ A;  5J3T A;  1U27 A;  2KFJ A;  4IWO A;  1BTK A;  2COC A;  3ML8 A;  1WJN A;  2H7D A;  5DHF B;  3LJ3 A;  1JDE A;  5LOP B;  1WM3 A;  2KDE B;  3PT2 B;  2KO3 A;  3QX1 A;  4HJK A;  1G6J A;  2PE6 B;  5DHA B;  1E90 A;  3ENB A;  1V89 A;  1KI1 B;  1UGM A;  4ANW A;  2I5F A;  2DHI A;  2KD0 A;  2KMA A;  1MIZ B;  1WY8 A;  3QC8 B;  4WAA A;  4GMX B;  4WJN A;  4E3C A;  4URK A;  2RSG A;  1E8Y A;  2EKE C;  3L08 A;  1WIA A;  4HCP B;  2I5C A;  3GYP A;  2D07 B;  2HJ8 A;  3Q3F A;  1C3T A;  1OTR B;  1YJ1 A;  3U30 A;  4HDQ A;  1Y19 B;  4BOS C;  3KUZ A;  3WIM A;  2WX1 A;  3PLU A;  2Z0E B;  4HWI B;  4HB3 B;  2LD9 A;  4TKN A;  1GC6 A;  3CMM B;  2ABD A;  1YX6 B;  1WZ3 A;  2DZI A;  2MCN B;  4II2 B;  4XX5 A;  3LDZ E;  2R2Q A;  4K7S A;  4JKG A;  2D4Q A;  2KZR A;  5C5B B;  1RLF A;  2N9P C;  3SUZ A;  1ST7 A;  4EZK A;  1LB1 A;  2W9N A;  3WAO A;  2MRP A;  2HTH B;  4Z2N A;  1NTY A;  1WRD B;  1I7A A;  3HM3 A;  5JLJ B;  5L95 C;  3L10 B;  1Q0W B;  1I42 A;  1PFJ A;  1ZC4 B;  4HPL B;  1DDV A;  4KDL B;  1J0W A;  2PE9 A;  3CF6 E;  5JVL A;  4HAV B;  1GUA B;  3ZTC A;  2JPH A;  3RT3 B;  3ML4 A;  3D8D A;  5E6P A;  1ZVR A;  2G4D B;  1ZM0 A;  2AWT A;  4I6L B;  2LZ6 A;  4JKF A;  3DXE A;  2QHO A;  5DPS A;  5JHA A;  3A8Q A;  3VTV A;  2N7E A;  1WMH A;  2Y7B A;  3B08 A;  4NJ7 A;  2NVU I;  1KZ7 A;  1TGZ B;  3V6C B;  4KAX B;  2KXJ A;  2KTR B;  2CAY A;  3QQ8 B;  2D9V A;  3VOQ A;  2KDF B;  3TMP B;  4KHB B;  1J19 A;  5KHO A;  2M8S A;  5CHV C;  3NZU A;  3ULB A;  4WJP A;  2N4F A;  2RD0 A;  4AJW A;  2EJ8 A;  2MDX A;  3M95 A;  5D7G A;  3MPX A;  3KW5 B;  1N3H A;  2CU1 A;  2LXA A;  5J17 A;  3CST A;  2HTH A;  1KLV A;  2WYQ A;  4NAW B;  4IM2 A;  3TJP A;  4N9F 4;  2RGF A;  1Q1O A;  2N23 A;  5IA7 A;  3V5W A;  2KAN A;  2DYQ A;  1XQQ A;  1V5M A;  4RM9 A;  1WM2 A;  5DI9 B;  1WXA A;  3B1L X;  2JT4 B;  4FHJ A;  4X57 B;  4IAP A;  4HAZ B;  3FEH A;  3PS6 A;  2V3S A;  5HE3 A;  3ODW A;  4HXD A;  1UD7 A;  2UZS A;  4GGQ A;  2Z0O A;  1HB8 A;  4JGH B;  1K8R B;  2BYF A;  4ZRK A;  1PLS A;  1WI0 A;  4GSW A;  4WJ7 A;  4GN1 A;  1ACA A;  4IM3 A;  2GOW A;  1FB8 A;  3UQA A;  4ZDV A;  3GOE A;  2DX5 B;  1VCB A;  2RPQ A;  1TTN A;  1ZGU B;  2Z0D B;  1W1G A;  4ILH A;  4F7G A;  2KTR A;  2G35 A;  3E9O A;  1MAI A;  2RVB B;  4JK7 A;  1XOD A;  1VBG A;  2JY6 A;  2K2U A;  3A4R A;  5D27 A;  2YS1 A;  4II3 B;  2EMS A;  3ZNH B;  1WH3 A;  3ENE A;  4HB0 B;  4WJQ A;  4W9J A;  5D3V A;  1V5U A;  2E2X A;  1FHX A;  2KWU B;  4FJV B;  1WXV A;  4XC2 A;  1M94 A;  3SO6 A;  2LXC A;  3R7R A;  3QK0 A;  3ULC A;  3N7C A;  1WGY A;  1GJZ A;  4GDK B;  3BJI A;  1I35 A;  1FHO A;  4LJO B;  4GU2 A;  5JH5 C;  1OEY J;  2ASQ A;  2CY4 A;  4HAX B;  1SHC A;  4GZU A;  4HAW B;  4MY6 A;  2IY1 B;  2D3G A;  5IAA C;  4EZL A;  4BBK A;  1X1G A;  2LVQ A;  4BOZ B;  2WX0 A;  1V86 A;  4KVG B;  1TBE A;  3PRZ A;  4KV2 A;  3ZLZ A;  3APD A;  2FJL A;  3L17 A;  3DBH I;  2FCS A;  5CLL B;  2FJ9 A;  3A8P A;  2OOB B;  5KHQ A;  1GG3 A;  1P3Q U;  4JKH A;  3DXD A;  3QCA A;  2BYE A;  3T06 A;  1D3Z A;  2WWZ A;  5CHF A;  2JVC A;  2YRY A;  1UEL A;  2CHX A;  4A3P A;  2D9Z A;  2V1Y A;  4KHO A;  3KH0 A;  1HE8 A;  5LON B;  1V6E A;  3MDB C;  1AQC A;  3JVZ X;  3B0A A;  2DZJ A;  2CHW A;  2KFK B;  4BKS D;  4GOC A;  4AUQ C;  2XK5 A;  4LDT B;  2UYZ B;  1AWE A;  3H6N A;  4FLH A;  2R2O A;  2WH5 A;  1WGR A;  2D10 A;  3A9J A;  3HIZ A;  3T8M A;  1RRP B;  5E6O A;  3VUW A;  4GDK A;  3DVN V;  3QA8 A;  4BKS A;  1GNU A;  4HAT B;  2LYD A;  4JQW C;  5HE1 A;  4CHJ A;  2KQ7 A;  3HK0 A;  3NSU A;  2FNJ B;  1JRU A;  1V81 A;  1UBQ A;  4G11 A;  3PRP B;  2GBJ A;  3E9L A;  4JK9 A;  3HW2 B;  3WAL A;  2LGX A;  2KKC A;  1XR0 B;  3F5R A;  3EFU A;  2MP2 B;  3ZRF A;  3QAQ A;  3RZW C;  2C7N B;  2IZV B;  3W1S A;  3VUX A;  5C6R A;  5DCN A;  4G50 A;  1B55 A;  2BPS A;  2Z0Q A;  2NPT B;  2M14 A;  3DVN U;  2C60 A;  3QWM A;  3OAW A;  2RGN B;  2AYO B;  3QIJ A;  2ADZ A;  2LWP A;  1LXD A;  1QQG A;  3A9K A;  3L54 A;  4RM8 A;  5D2M B;  2W2W A;  4MGK E;  1NU2 A;  3TW1 A;  5C79 A;  1MKE A;  1X11 A;  1YIW A;  2X18 A;  1V5T A;  2KJ6 A;  3AU5 A;  3CIK A;  3A98 B;  2MFQ A;  3HM6 X;  2L1C A;  2KFK A;  2D9X A;  2PZ1 A;  2IY0 B;  4K2O A;  1H10 A;  5DIF B;  3EHV A;  3WAP A;  1V5P A;  2P0F A;  5DPW A;  4W9K A;  3IHP C;  1IRS A;  1WF9 A;  2KDB A;  2YF0 A;  2BGF A;  3V62 A;  2DYB A;  4XZ4 A;  3D32 A;  4FN2 A;  3DXC A;  2FAZ A;  3NZS A;  3V6E B;  3WYF B;  2MLB A;  2JP2 A;  5CX3 A;  2K6Q A;  3V61 A;  2JZ3 B;  2LI5 A;  2K39 A;  4CHK A;  4TUU A;  1WR6 E;  3SD5 A;  3L0W B;  3QHT A;  3W1Y A;  2L3Z A;  3DCG A;  2NPT A;  3ZO5 B;  2RNR B;  4Y94 A;  4JK8 A;  1WX9 A;  5D3X A;  4TYZ A;  2CKH B;  2R82 A;  1SGH A;  1RFA A;  5LLI A;  3OJ4 B;  2D2Q A;  1WXS A;  3VIA A;  4KHA A;  1FHW A;  1U4A A;  2KUP A;  1YQB A;  1UPR A;  3JSV A;  3V60 A;  2QKM A;  1U5E A;  4FBJ B;  4A5K A;  1DBH A;  1T0Y A;  1DIK A;  4IW0 A;  2GJY A;  2COD A;  2DHK A;  3EC8 A;  3ZDT A;  2M17 A;  3H7P A;  3TL5 A;  3L16 A;  4MH0 E;  1EO6 A;  1P98 A;  2LGD A;  3A33 B;  2V4L A;  3PLV A;  4ZRJ A;  3ONS A;  3W1S C;  2D9W A;  3DPD A;  3PSE B;  2IYD B;  1VD2 A;  5JHG A;  1WMH B;  4JKA A;  2DYN A;  2G4S A;  2CQU A;  4KSL C;  2FIF A;  4LJP B;  4WQO B;  1Q5W B;  2LAS A;  4BFR A;  1H4R A;  3RCZ A;  2FDQ A;  2I1J A;  4G0N B;  3AJ4 A;  3TCA A;  2ZPY A;  1MPH A;  3CXB B;  4NQL B;  2ROZ B;  3ZVR A;  4JKD A;  2K8H A;  2N7D A;  3N3K B;  1ISN A;  5GOW B;  3ZNZ B;  2GBM A;  4HAU B;  1WJU A;  1FAO A;  4FJY A;  1P5T A;  2X0S A;  2C9W B;  3KYC D;  1NDD A;  3EPY A;  3N32 A;  3QWZ B;  5D3W A;  4DHZ E;  2LJ5 A;  4ANV A;  2DZM A;  3R3M A;  2FID A;  1V80 A;  1GC7 A;  3AUL A;  4W9F A;  2MQJ A;  3X23 A;  1OQN A;  4W9L A;  2DLW A;  1MG8 A;  4WSF A;  4KDI C;  4DBB A;  3DBR I;  1Y8R C;  3AXC A;  2ZCB A;  1Y5O A;  5DPR A;  1FGY A;  2GBR A;  3DDC B;  1OQY A;  5EDS A;  3AI5 A;  2A4Z A;  1GGO A;  5L83 A;  4MEM A;  1YX5 B;  4L6E A;  2PJH A;  3ZKJ C;  4DWF A;  3TFM A;  3ALB A;  1V2Y A;  4DDI D;  2NCN A;  2FCQ A;  1QZE A;  3PG7 A;  2JRI B;  2MBO A;  1WGQ A;  3PGE A;  2MBE A;  3VHT C;  5E6N A;  5G2N A;  1SE9 A;  3K9O B;  4WVF B;  1WJ6 A;  2LG1 A;  2HE7 A;  1E8Z A;  2JWZ A;  3VXW A;  4FHK A;  2K1F A;  3P2B A;  3IG3 A;  3VDZ A;  3VTW A;  4NJ6 A;  3RZF A;  2L0F A;  3MHS D;  2KMC A;  2KWC A;  4MDK E;  4LCD E;  2P8V A;  2BKR B;  2G45 B;  2C7M B;  2DAF A;  3TVV A;  1LW3 A;  4HDO A;  5AZH A;  5KQ1 A;  3KUD B;  3DVG Y;  2K00 A;  4HVB A;  2KK8 A;  4DHJ D;  4EUT A;  2NBU A;  1UNR A;  1XT9 B;  1HBK A;  1ZC3 B;  4F1S A;  1WYW B;  4F8C B;  4BVU C;  3KSY A;  2KLC A;  3DBL I;  2R09 A;  2YVC A;  2CY5 A;  4K17 A;  4MT7 A;  2KQS A;  3G9W A;  4TV3 A;  2Z59 B;  2P0H A;  2BCJ A;  2VRR B;  4NQK E;  1WX7 A;  5D94 A;  1SIF A;  1KOT A;  1V61 A;  2HD5 B;  1S3S G;  1OEY A;  2VRW B;  2JZZ A;  2N0Y A;  2KHW B;  2XK5 B;  1BTN A;  2ROV A;  3T9L A;  3ZTD A;  4IG7 B;  3OAN A;  3PEG A;  2OJR A;  3A9J B;  2KN5 A;  2DKQ A;  2W2X D;  2IFS A;  4MK0 A;  4PQ0 A;  1HB6 A;  3PHW B;  3SHQ A;  4MGI E;  2MWS B;  3PRM B;  4K81 A;  2HRJ A;  3K9P B;  3FLV A;  4F7Z A;  4PNK A;  4EMO A;  2FUH B;  4ICV A;  4EJN A;  4ILJ A;  4ILG B;  3VH4 B;  2COF A;  1K5G B;  3VUY A;  1Q67 A;  4G3X B;  4D0N B;  2PPH A;  2COP A;  2KTF A;  2M1M A;  1KZG A;  1TJ6 A;  4PS3 A;  4AP4 C;  2UVM A;  4PS8 A;  1WI1 A;  4A20 A;  2GBK A;  3MJW A;  3M62 B;  3A9K B;  2GCJ A;  2XEW A;  5J3Y A;  2ZVN A;  1WGH A;  3KZ1 A;  5LXH A;  3L13 A;  1WJ4 A;  4IUM B;  1AAR A;  2MBH A;  2EMT A;  2FCM A;  2MWN B;  2FCN A;  2MBB B;  3CSF A;  2RSU A;  4YON A;  3TIX A;  3RUI B;  2KCJ A;  4JLC A;  2COA A;  3JW0 X;  2DA0 A;  3PRE A;  1NBF C;  2KLG A;  1XD4 A;  5LXI B;  1X86 A;  1X1M A;  3UIP B;  1FXT B;  1UNQ A;  4IWP A;  2O6V D;  5KQ4 A;  1NVL A;  4EOY A;  3KRX A;  3VQI A;  4JKC A;  2GMI C;  3E9P A;  4F7U P;  1XCG A;  2OTX A;  4M0W B;  3WAN A;  3IFW B;  1TXD A;  1A5R A;  1UEF A;  4B6W A;  4GMV A;  4GPT B;  1V49 A;  2BF8 B;  3HHM A;  2NR2 A;  4WJO A;  4GXB A;  3D8E A;  5FR6 A;  2D9Y A;  1NTI A;  3ZUN A;  2LRU A;  1P3R A;  5HE2 A;  4EZJ A;  3VH3 B;  4CHM A;  2J0M A;  3DBS A;  2ZEQ A;  2RQ1 A;  2CR5 A;  4CYE A;  2ELA A;  4FAD A;  2ZPN A;  2R0D A;  4MEL A;  2NS5 A;  3P6A A;  4KZ0 A;  3QAR A;  5KCV A;  4YL8 A;  2YS3 A;  3JSV B;  4E71 A;  2JXX A;  4M8M A;  3NOB A;  2AL6 A;  3BY4 B;  2LRW A;  3ZVV A;  3H7P B;  2YT0 A;  2KC2 A;  2W2X C;  3MTN B;  2XQN M;  3VVW B;  1WE7 A;  1ZKH A;  1UBI A;  4IC7 B;  5HKH A;  1BAK A;  4HHV A;  1U29 A;  4KIK A;  2YS5 A;  3Q3J A;  2L05 A;  3HQC A;  5CTR C;  3R7Q A;  5BO4 B;  1DRO A;  1MIX A;  4HAY B;  4HCN B;  4ZRI A;  1KC7 A;  3OLM D;  1J8C A;  1M7E A;  4MGY E;  3M63 B;  4IOY X;  4HLE A;  2KWV B;  4JL9 A;  3IVF A;  3ODO A;  1C1Y B;  3PZD A;  3U7D A;  3DOW A;  2NZ8 B;  2IBI B;  1P9D U;  1XKE A;  4J6I A;  2IO1 B;  4HB4 B;  4A6F B;  1WJM A;  3R66 C;  2V76 A;  2LOX A;  2YSZ A;  4I6P A;  3AU4 A;  4WWN A;  1EGX A;  2D11 A;  1DDM A;  2ZJD A;  4TQ1 A;  2MBQ A;  2O2V B;  3U8Z A;  1EUV B;  3FSS A;  4HPM B;  1KM7 A;  4DBG A;  5AEK B;  5EFX A;  2KX3 A;  1F9J A;  2K2J A;  2J0K A;  4KSK C;  5JP4 A;  4BKT A;  4HK2 A;  4M8N A;  1P6S A;  3OJ3 A;  1WJ1 A;  4NNJ B;  2REX A;  2UZR A;  2BWE S;  3I3T B;  2CS4 A;  5GMV A;  2GS0 A;  1H8C A;  2RR9 A;  1RAX A;  4AOF A;  4MM3 A;  1RJ2 A;  5DPT A;  3N30 A;  2I1K A;  4WWO A;  3QBV B;  3FP5 A;  2L2I A;  3ECI A;  4FJZ A;  2AL3 A;  5J2R A;  1XX0 A;  3BIN A;  2KX0 A;  3M1I B;  1X1F A;  2J7Q B;  3RCP A;  2BKF A;  3UF8 A;  4W9H A;  2M4N A;  3APF A;  4W9C A;  1ZSQ A;  4A3O A;  3ZRC A;  2N1V A;  1RRB A;  5HE0 A;  4A6F A;  5J18 A;  1WGD A;  2GCL A;  1LFD A;  2LGY A;  1WZ0 A;  3D8F A;  2RLO A;  3C0R B;  1BT0 A;  1QC6 A;  2O2V A;  4ICU A;  4FA6 A;  3WA0 A;  5TR5 A;  4W9G A;  2LUL A;  5D3Y A;  1J0G A;  3SDL C;  1WXM A;  1VBH A;  4BKG A;  2B3A A;  2VSZ A;  1ZW7 A;  4K7U A;  5JHB A;  2OQB A;  1EAZ A;  1DYN A;  3S2A A;  2KGX B;  2N1W A;  3KVF B;  1WR1 A;  3QJZ A;  4C0A A;  1CMX B;  1WG7 A;  4IM0 A;  4AJY B;  2YT1 A;  2IO0 B;  1E8W A;  2VKI A;  4DHJ B;  4PYZ A;  1W1D A;  4ZYN A;  1K5D B;  4GIV A;  2PEA A;  4JKE A;  2KJR A;  4Z2M B;  5FI0 A;  3LJU X;  5L81 A;  1X05 A;  2LOZ A;  4ANU A;  1Z2M A;  2K25 A;  1U5F A;  2C5L C;  5JHH A;  3ZIM A;  3UQB A;  4GB9 A;  2CB8 A;  2ZCC A;  4FUL A;  2Q13 A;  3NS8 A;  1WGG A;  5C5B A;  2KNB A;  1U5D A;  2MA9 B;  2G3Q B;  4K2P A;  4ASW C;  3X0W A;  2JUO A;  4B6H A;  1WX8 A;  2J59 M;  2DZK A;  2IO3 B;  1DDW A;  1E8X A;  5AZF A;  3VAW A;  3EEC A;  1UNP A;  2L0T A;  1FOE A;  2LUE A;  3ZNI D;  2DX1 A;  2MSE D;  4K7W A;  1KBL A;  5C23 A;  3GYO A;  2H7E A;  4B95 A;  4GDL B;  3E66 A;  4F7H A;  1M7R A;  4H8S A;  4PYU A;  1E7U A;  3KRW A;  3RUL A;  4BBN C;  3SYX A;  3VTU A;  1IP9 A;  1P1A A;  2ZNV C;  4JIO U;  1I2H A;  3PVW A;  1PMS A;  2XBB C;  2J0J A;  1OMW A;  3PVL A;  5AZG A;  1L7Y A;  2M0X A;  3PP2 A;  4OVV A;  2DN6 A;  2QKL A;  3ZNG C;  1E7V A;  2M38 A;  1E5W A;  2DKP A;  1TZ1 A;  4W9E A;  2LBB A;  2KJH B;  1U5G A;  3ZDM C;  2DYO A;  4NPN A;  4DK5 A;  2K6D B;  3O65 B;  2GBN A;  4XWX A;  1MK7 B;  2NBV B;  5IJM A;  3SBT A;  3TBL D;  1EF5 A;  4NAW A;  2Y5B B;  4OVU A;  1R4M I;  3WAM A;  1KJT A;  2O6V B;  1WE6 A;  4HB2 B;  2IYB A;  4BBN F;  3O96 A;  4GDL A;  2WDT B;  3UZT A;  1V88 A;  4DHZ B;  2LVO A;  1UH6 A;  5D6J B;  4DXA B;  3F0W A;  3ZW3 A;  4MJS B;  3A4S C;  2UWQ A;  3IBE A;  4DDG D;  2L76 A;  2C7H A;  1S1Q B;  2ELB A;  2RUK B;  1BWN A;  3P7Z A;  3A1Q B;  2DX5 A;  2LVP A;  4KZC A;  3VFK A;  1WFY A;  1WVH A;  2DIK A;  4E74 A;  2KOX A;  3SV1 A;  4DX9 0;  4DX8 A;  4TQ0 A;  2N9X A;  3TO1 A;  2Z0P A;  1TQZ A;  1PQS A;  2L00 B;  4A6K A;  2YLM A;  1EF1 A;  5FI1 A;  1EVH A;  5G55 A;  3PVU A;  5CLQ B;  4KIK B;  2MKR A;  3H9D A;  4EEW A;  2CHZ A;  1UZX B;  2L7R A;  4K1R B;  2IO2 B;  4AWJ A;  4JKB A;  2Y8F A;  2P0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...