2D11A

Crystal structure of the radixin ferm domain complexed with the nherf-2 c-terminal tail peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for NHERF recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 83
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2d11A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d11A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2d11A01
2M8SA 3LJ3A 4E71A 4NSWA 1Q1OA 2HTHA 2Q13A 3APDA 3DDCB 1WI0A 5CX3A 3B1LX 1X05A 3A1QB 3VFKA 2C7NB 2LVOA 3CSTA 3W1SC 1JRUA 1QC6A 3VDZA 4BKSD 5JP4A 4HAUB 2LGDA 2YRYA 3RZFA 1R4MI 2FUHB 4HXDA 4LDTB 2MRPA 2BPSA 2DA0A 4DDID 4WJPA 4FADA 3ODOA 2N1WA 2JUOA 2N9PC 4A5KA 4AOFA 1XKEA 2LVPA 2DHJA 3ONSA 4WWPA 1K5GB 1YX6B 1KOTA 1Y5OA 3DVNU 3DOWA 2D07B 5C5BB 4F7ZA 4AUQC 2N4FA 4KIKA 2GBNA 2UZRA 1E7UA 2JRHA 3QARA 4KAXB 3ECIA 3V5WA 3RULA 2GS0A 4MJSB 2BKFA 2BWFA 2YS5A 2BYEA 4I6NB 3PRZA 3ZRCA 2LASA 2YVCA 2MDXA 3L13A 1J19A 2CRFA 1BT0A 4MSMB 2DAFA 1Z87A 3WA0A 2G4DB 4IWPA 4KSLC 1P9DU 2QKMA 2G4SA 2J7QB 2ELBA 2NBUA 3A8QA 1RFAA 3G9WA 2UYZB 2KOXA 2ZNVB 2I5FA 2XQNM 4PS7A 4ICVA 1X1MA 5CHFA 4ZYNA 1WJ1A 3SDLC 3MDBC 1OEYA 1NTVA 2O6VA 1YIWA 1WGQA 5HE1A 2COCA 3H9DA 4WAAA 5DIFB 5CTRC 2BYFA 5J3QA 2EKEC 1V5TA 1KLVA 1WJ4A 2I1JA 2V4LA 3ULBA 2K25A 2DX5B 4BOZB 3S2AA 1WJMA 1UBQA 2ASQA 5J3TA 4GDKB 4BVUC 1WX7A 3NSUA 1UNPA 3ZLZA 1U27A 3ZUNA 2MW5A 3WAPA 2ZNVC 3AU4A 4TUUA 3M63B 3BY4B 2AWTA 4GMVA 3QBVB 2K00A 2MBQA 1WGUA 4TV3A 4W9HA 2RPQA 2NS5A 4A6KA 3PRMB 3A9JA 2N23A 1E5WA 3N7CA 3PHXB 2YT0A 3CF6E 4WWNA 3DVNV 4K2OA 2MX2A 2LULA 4ZDVA 3KZ1A 3AJ4A 1WIAA 1G6JA 3V6CB 1U29A 1Q5WB 2KFKA 2I5CA 4EZJA 2DYMA 2W2WA 4PQ0A 5FI1A 4LJOB 2IO1B 2M0XA 2RQ1A 1WXAA 1WJ6A 3PV1A 4PYZA 3EC8A 3QX1A 2IFSA 4M8MA 2GBRA 1OQYA 3OAWA 1V9JA 3H7SA 1S1QB 1P3QU 2EMSA 4IM3A 2MP2A 4YL8A 2KMAA 4MT7A 2LXAA 2GBKA 5EFXA 3ZDMC 1WM2A 3SYXA 5C79A 5JH5C 1VD2A 4GB9A 4IC7B 1SGHA 1UH6A 3BINA 1XX0A 3H1UA 3NOBA 2NPTB 1OEYJ 4FLHA 4XC2A 2Z59B 4EZKA 2D9XA 1V49A 3ZTCA 4GU2A 2D9ZA 3RD2A 2JRIB 3GYOA 3PVLA 3A4SC 1XCGA 3Q3JA 3P2BA 5LLIA 3VOQA 1MAIA 1WE7A 2LGXA 3TVVA 4HAWB 3QC8B 3ML8A 3QJZA 1WZ3A 1MPHA 3QWMA 2V3SA 3KW5B 2NMBA 3UGBB 3LJUX 4Z2NA 1L7YA 2UZSA 4HDQA 5J17A 1V5OA 1LFDA 4A3PA 3DBLI 2WX1A 2YLMA 4K17A 4XZ4A 4YONA 1P5TA 1MKEA 4DHZB 2LBBA 3R3MA 2ROVA 3ZO5B 2FJLA 1I2HA 3HM6X 4HK2A 4F7GA 2MWNB 2G35A 3LDZE 4IOYX 4HB2B 4RM8A 2P0HA 2DZJA 3L08A 2LUEA 1V81A 3BJIA 2M38A 2PE6B 3VUYA 2DN6A 2K39A 3L16A 2HRJA 1MIXA 2KC2A 1WR1A 1BAKA 4GMXB 4ZRJA 3PVWA 4ASWC 4KDIC 2KFJA 4DHZE 5DI9B 1T0YA 4MH0E 4HAZB 1WGDA 3ZNID 4GIVA 4B6HA 4HCNB 2CU1A 4X57B 3DXEA 2D9YA 4GSWA 1YJ1A 2K8BA 4A3OA 4MEMA 2FJ9A 2IY1B 1FOEA 1ZSQA 4HVBA 1H4RA 2R2QA 1X11A 2WYQA 1I35A 4RMAA 2KD0A 5DHAB 2CHZA 3VXWA 4HB0B 2GBJA 3PSCA 2IO3B 3VH4B 2AEHA 3DBHI 5KHOA 3W1YA 2HE7A 1XR0B 2LD9A 4LDTD 1P1AA 3VUXA 2FCMA 3A33B 1NI2A 1FB8A 3UINB 4K81A 3CXBB 2JPHA 5AEKB 2CHXA 2PPHA 2N9EB 2LWPA 2RUKB 2KDFB 3U30A 1FHXA 4G50A 2WH5A 2VKIA 3MJWA 1Y19B 3WANA 3C0RB 4EUTA 4BKGA 1X1FA 3SV1A 2FIFA 4ANWA 1WJNA 4HDOA 1V80A 2JT4B 1BTNA 3A98B 2EJ8A 2HTHB 1K8RB 2D2QA 2L8JA 2DYQA 5HE0A 5J18A 4NY0A 3KRXA 3OANA 4MM3A 5CLLB 3PP2A 2M4NA 4DHJB 4W9EA 1KZ7A 4PS3A 4MY6A 1ZM0A 1MG8A 2ZJDA 2R09A 2MWSB 1EGXA 2Z0QA 4WSFA 1EVHA 2PE9A 3RYTA 3TFMA 1WY8A 2DFKA 5LONB 2A4ZA 2LRWA 4TKNA 2UWQA 2DZMA 3KYCD 2KTFA 3ZNHB 4WVFB 1WRDB 2CHWA 4CHJA 1NVLA 2FCSA 2L00B 4B9KA 3SD5A 5KQ1A 3TIXA 2DTCA 2MA9B 3EHVA 3D8FA 4D0NB 2FNJB 4DWFA 3DPDA 1HB6A 4IUMB 3U8ZA 1FGYA 2VRWB 1E7VA 4FA6A 3W1SA 1WF9A 1SHCA 2N7DA 1WM3A 3QAQA 1P98A 3RCPA 1DROA 4FJVB 4DK5A 1IYFA 1GUAB 1LXDA 4Y94A 3OJ4B 1WZ0A 3T8MA 2C7MB 4NAWB 3TO1A 4XX5A 3D32A 4XWXA 4K7WA 5DCNA 3QA8A 5HE3A 2DHIA 1KM7A 4FULA 2XK5A 3A1QA 2M17A 3P6AA 4PNKA 4DBGA 2KWVB 3SU8X 4A6HA 3Q3FA 2Z0DB 3WAMA 1WX9A 2AL3A 4FHKA 5JLJB 4F8CB 2LZ6A 2DYBA 2OQBA 4EKUA 3F5RA 4M8NA 2NCNA 4HB3B 2ABDA 5D3XA 2RSGA 3DQVA 2NBWB 4EJNA 3M62B 1VCBA 4GOCA 3QIJA 5C5BA 4ZRKA 3L10B 2D4QA 2KQ7A 2IO2B 2R0DA 3T9LA 2CAYA 4HAYB 3JW0X 2KK8A 3SO6A 4CYEA 4P7IA 1U5FA 2Y8FA 4DDGD 1GC7A 3SHQA 1V5PA 2RR9A 2J0KA 5DHFB 4KHBB 4MJSA 3VQIA 1OTRB 1K5DB 2DKPA 4WJ7A 4W9LA 3A9JB 4E74A 2BF8B 4IM0A 4TYZA 3GZNI 4NPNA 4ANUA 2Z0OA 4GZUA 4HAXB 4F1SA 1OY2A 1WVHA 2LYDA 2IBIB 3TMPB 3U7DA 4EOYA 5G2NA 2JZZA 4W9DA 3ZW3A 2KX0A 1ZC4B 5C16A 1J0GA 1UPQA 1FGZA 3O96A 2KMCA 3WALA 1YX5B 2DX5A 4ZRIA 4IWQA 1AARA 2IO0B 4BKSA 1P3RA 1V61A 2J59M 4K2PA 2MP2B 1WXSA 3ML9A 2JY6A 3UQAA 3PPAA 4GDKA 2NVUI 2WX0A 2L76A 1FXTB 4CO7A 1FHOA 2C5LC 2MKRA 3QWZB 4GDLB 3VIAA 2CB8A 2IZVB 1Z5SB 1UNRA 1PMSA 4NNJB 4KVGB 4PS8A 1V5MA 3ZKJC 4Z2MB 2NBVB 5CHWA 2KKCA 3PGEA 4G0NB 2OTXA 3JSVB 3SUZA 1PQSA 5D3WA 2DYOA 1BWNA 2YS3A 4G3XB 2KJHB 2C60A 4BBNC 3FLVA 4TQ0A 2NZ8B 4HCPB 1CMXB 2GCJA 5FI0A 2KZRA 4DX90 4MGKE 1QZEA 1XQQA 2KANA 4HHVA 2KDIA 2Y5BB 4E3CA 3A9KA 1PLSA 1RJ2A 3N32A 3D8EA 3B08A 2FCNA 2ZCBA 5AZFA 3H7PB 1GJZA 3ZVRA 4W9KA 2MCNB 1ZW7A 3KSYA 3UIPB 1YD8U 1TGZB 4II3B 1XD4A 3DVGX 2LKOA 1EAZA 2RNRB 3PRPB 1UD7A 4ICUA 5TR5A 5C6RA 4A6FB 4MSQB 2KN5A 5E6NA 3DXCA 2XEWA 2KVRA 4EFOA 4N9F4 2CS4A 2QHOA 2KGXB 1H10A 1WR6E 1NDDA 5JHBA 3EFUA 3L0WB 2DYNA 2D9VA 4FJYA 3FSSA 2MSED 3ZIMA 1NTIA 1WGGA 4PYUA 3DCGA 1LQBA 1MIZB 1ACAA 2P0FA 1U5GA 2PJHA 4KZ0A 3DBRI 1WMHB 2K6QA 4MGZE 2LOXA 2LGYA 1UNQA 3TBLD 4GN1A 4BBNF 4DHJD 2FCQA 2DHKA 3IHPC 2G45B 2COFA 3PLVA 2BYVE 2PEAA 2VSZA 2KNBA 1Z2MA 4AJYB 2L0FA 2LG1A 2RLOA 1EUVB 2RGNB 3TCAA 2C7HA 2Y8GA 1TQZA 1PFJA 1U5EA 3ENEA 3NS8A 3M1IB 1IP9A 1MK7B 2Z0PA 3A8PA 5KCVA 1EF5A 4I6LB 2QKLA 2Y7BA 5L95C 3PTFC 2MBHA 3CSFA 4HB4B 4F7HA 1WFYA 2GOWA 2IYBA 2XBBC 2D9WA 2ELAA 2KJ6A 3IG3A 4II2B 2CKHB 4EMOA 3RCZA 1UBIA 5D94A 3UIOB 3N30A 3O65B 3TJPA 2L3ZA 2KTRA 3MPXA 2KHWB 4K7UA 2NR2A 3AI5A 4EZLA 3TL5A 1NU2A 2W2XC 3F0WA 2E2XA 4CHKA 5J2RA 5HE2A 1WGYA 2MBOA 1M94A 5D27A 3VH3B 2JF5A 2GCLA 3HQCA 2N0YA 3IBEA 1V89A 2L2IA 4BFRA 1E8WA 2M1MA 3PSEB 1D3ZA 2KJRA 4IFSA 2EMTA 3VTVA 4KHOA 1GG3A 5D3VA 5EDSA 1DDWA 4DX8A 5DPTA 1RRPB 3IVFA 2YF0A 1DDVA 3OJ3A 1HB8A 2KXJA 1LB1A 3FP5A 1AWEA 2YS1A 2K8HA 2IY0B 2OOBB 3PEGA 3WIMA 1FHWA 1OGWA 1WH3A 3PT2B 2GJYA 1ZKHA 2O2VA 2W9NA 3ZDTA 1FAOA 3UQBA 3ZNGC 2WDTB 2ZEQA 1HBKA 4KSKC 3V62A 3TW1A 2DX1A 2N9XA 3PVUA 2H7DA 2Z0EB 2AL6A 2R2OA 3MHSD 1YQBA 2BWES 4MGYE 3QHTA 1ZVRA 5FR6A 2CQUA 3KUCB 2REXA 4FN2A 4OVUA 2ZVOA 2RSUA 1XODA 2CY4A 1C1YB 2XK5B 2L1CA 1E90A 2GBMA 3X23A 4NQKE 2D10A 4KIKB 3V60A 5JHGA 3A4RA 1WGHA 2N7EA 4L6EA 1EO6A 2FAZA 1Q67A 3HIZA 3VAWA 2K8CA 4ANVA 2IYDB 3DXDA 4KZCA 3M95A 3RT3B 4FHJA 2ZPYA 1RAXA 2WWZA 4BOSC 1V88A 2DZIA 4J6IA 3PG7A 1IRSA 4IG7B 4NJ6A 4JL9A 1SE9A 1W1DA 1AQCA 1LW3A 3VHTC 4K1RB 2ZPNA 2J0JA 3KRWA 4I6PA 5DPRA 1NTYA 5CLQB 4HPLB 1BTKA 1W1GA 2X18A 2L05A 3APFA 1C3TA 2O6VB 3ZVVA 2COAA 2OJRA 4IW0A 2ZCCA 4NAWA 2KLGA 4B95A 4BBKA 2L0TA 3HM3A 3NY5A 2KC1A 1WE6A 1V5UA 4KHAA 3KH0A 1UPRA 1B55A 2I1KA 4HAVB 5D3YA 4IM2A 2MQJA 1TXDA 2AYOB 2YSZA 1KJTA 4BKTA 2K1FA 4HLEA 4A20A 3K9OB 1E8YA 4WQOB 2KCJA 2KWUB 3FEHA 4GPTB 1L2NA 1SIFA 1ZGUB 5D6JB 1TTNA 3R7RA 4NQLB 3VUWA 1HE8A 3H6NA 4JGHB 2D3GA 4GGQA 2JXXA 4JQWC 3MTNB 4GXBA 3T06A 1KZGA 4M0WB 1ST7A 3X0WA 2GMIC 2COPA 2KFKB 3ODWA 3KYDD 4G11A 2K6DB 1TZ1A 1MK9B 2LRUA 1I42A 2A5UA 2ROZB 3PZDA 3FM8C 1IPGA 1Q0WB 5C23A 5E6PA 5LOPB 1OMWA 5J3YA 1H8CA 4C0AA 2DHZA 4DBBA 2MFQA 1V86A 4WJQA 4F7UP 2ZZPB 2PZ1A 3ML4A 1XD3B 1GC6A 3CIKA 5CHVC 1TJ6A 1UEFA 2RVBB 1UELA 2P0DA 3V6EB 1DBHA 5KHQA 1XT9B 2BCJA 2CY5A 3PREA 5LXHA 3KUZA 3VTWA 4H8SA 2BKRB 3R7QA 5JHAA 3IFWB 1ZC3B 5D7GA 4W9JA 3A9KB 3I3TB 1KI1B 5IJMA 2W2XD 3NZSA 3ZTDA 1X86A 3KUDB 3PLUA 1DDMA 2KDEB 4WWOA 4MGIE 1A5RA 3QCAA 3PHWB 2ZVNA 4W9FA 2YT1A 2FIDA 5JHHA 1I7AA 2K2JA 3GYPA 4URKA 5E6OA 4GDLA 2DZKA 2M14A 3HHMA 3DVGY 4WJOA 2KWCA 2KO3A 3VTUA 3UZTA 4ANXA 3N3KB 3JSVA 2JVCA 2DENB 4IAPA 3RUIB 4LJPB 5HKHA 3JYUA 4AP4C 1J0WA 3NHEB 1X1GA 3D8DA 4JIOU 2G3QB 3EECA 4FBJB 2NPTA 3PS6A 1M7EA 3WAOA 2CODA 2N1VA 2KDBA 4AWJA 4OVVA 3R66C 2DKQA 4EEWA 3HW2B 3L17A 2MBEA 1ISNA 2LJ5A 3H7PA 1WYWB 1M7RA 3APCA 1P0RA 1WXVA 2C9WB 3V61A 3EPYA 4HWIB 1WI1A 5L83A 1N3HA 1TBEA 1WXMA 1RLFA 2ADZA 3AULA 2MLBA 2J0MA 4A6FA 2KX3A 4JLCA 1DYNA 1S3SG 1U5DA 2JP2A 2DAJA 3L54A 3RZWC 3P7ZA 4IWOA 5C1ZA 4LCDE 2KTRB 2LI5A 1R4NI 5AZHA 2KUPA 2LXCA 4K7SA 3M3JA 2V1YA 3ODXA 3VVWB 3WYFB 2LVQA 2DLWA 2CR5A 3ZRFA 2K2UA 1RRBA 1WMHA 3NZUA 1W1HA 2P8VA 2B3AA 3B0AA 4FJZA 2V76A 1V6EA 3QQ8B 4MELA 4TQ1A 1J8CA 4CHMA 2D11A 3QK0A 2JZ3B 4W9GA 2L7RA 4RM9A 3DBSA 4KV2A 2HJ8A 1E8ZA 4HPMB 2VRRB 5IAAC 1U4AA 5GMVA 5JZEB 1WG7A 3KY9A 5IA7A 2LOZA 2JWZA 1U2BA 3ZNZB 5BO4B 2EC1A 4AJWA 3JVZX 1QQGA 2KLCA 2BGFA 1UZXB 2UVMA 5DPSA 2FDQA 3UF8A 4DXAB 2MBBB 1E8XA 2HD5B 1WGRA 3K9PB 5KQ4A 1EF1A 5LXIB 3AXCA 4W9CA 1Y8RC 5L81A 5GOWB 2RD0A 4B6WA 2KQSA 2O2VB 3SNHA 3CMMB 5AZGA 1OQNA 2H7EA 3KVFB 2O6VD 2RGFA 1NBFC 1LM8B 3OLMD 1UGMA 4W9IA 5D2MB 3HK0A 1WJUA 5DPWA 4HATB 1P6SA 5DH9B 4MK0A 4NJ7A 4WJNA 3AU5A 1V2YA 3ULCA 3GOEA 1F9JA 1WX8A 3ALBA 4MDKE 4KDLB 1GNUA 4HJKA 5G55A
chains in the Genus database with same CATH superfamily
2M8SA 3LJ3A 4E71A 4NSWA 2AQ1B 1Q1OA 4OZAA 5D3DA 4D6WA 2HTHA 4NZLB 2YEPB 1QF6A 2Q13A 3APDA 3E56A 3DDCB 4RH6A 2VH2A 3R2TA 1WI0A 5CX3A 3B1LX 4BAXA 1RM6C 3MC0B 1WGKA 1X05A 3A1QB 2J53A 3TUOA 3VFKA 2C7NB 2LVOA 3CSTA 1CQVA 3W1SC 1JRUA 1ZYIA 3W9CB 1QC6A 3VDZA 3I9V1 4BKSD 5JP4A 4HAUB 1TJEA 2LGDA 3UI3A 2YRYA 1C79A 1JRPA 3RZFA 1JWAD 1R4MI 2FUHB 4HXDA 4LDTB 2MEKA 2MRPA 2BPSA 2DA0A 4DDID 4WJPA 4FADA 3ODOA 2N1WA 2JUOA 2N9PC 2KWDA 2ON8A 4A5KA 4PK1A 4AOFA 1XKEA 3VRBB 3C19A 2LVPA 2DHJA 3ONSA 1SF0A 1I4GA 4PT5A 4WWPA 1KLUD 2WXRA 1KLGD 1K5GB 1YX6B 2K22A 1KOTA 1Y5OA 3DVNU 4A55A 3DOWA 1SJHD 2MJ3A 2D07B 5C5BB 1DYQA 2AQ3B 4AUQC 4F7ZA 1JQ4A 2EKIA 1FFUA 2N4FA 4KIKA 2GBNA 2UZRA 1E7UA 1ZUD2 2JQRB 3C8YA 2JRHA 3QARA 1GGOA 4KAXB 3ECIA 3V5WA 3RULA 2GS0A 4P1CC 2PMVA 4MJSB 2ICIA 2SAKA 2BKFA 2BWFA 2YS5A 2BYEA 4I6NB 3PRZA 1SE4A 3ZRCA 2LASA 2YVCA 2MDXA 1ZXIA 3L13A 4ARIA 1J19A 2CRFA 4QXAB 1BT0A 1HZ6A 4MSMB 1TS3A 2GLSA 2DAFA 1Z87A 3WA0A 2QJLA 2G4DB 4IWPA 1I4QA 4KSLC 1P9DU 2QKMA 2G4SA 2J7QB 2ELBA 2NBUA 3A8QA 1RFAA 3G9WA 4TMAB 2UYZB 2KOXA 2ZNVB 1JCKB 1V1PB 2I5FA 2I2YA 2XQNM 4PS7A 4ICVA 2MJEA 1X1MA 5CHFA 4ZYNA 1WJ1A 3SDLC 3MDBC 1DOIA 1OEYA 2WDVB 4DXGA 1NTVA 2BS4B 2O6VA 3BYTB 4QJ4B 1YIWA 1WGQA 3U52E 5HE1A 1KH0A 2COCA 3H9DA 4WAAA 1TZOA 3AMZA 5DIFB 5CTRC 1OFFA 2BYFA 5J3QA 2EKEC 1V5TA 1KLVA 4ACFA 1WJ4A 2YEPF 3NUHB 2I1JA 2V4LA 4JK7A 3ULBA 2K25A 2DX5B 4BOZB 5BYSA 3S2AA 1WJMA 1UBQA 2ASQA 5J3TA 3VRAB 4GDKB 4BVUC 4ZHOA 1WX7A 3NSUA 2QDFA 1UNPA 3ZLZA 1U27A 4GLSC 3ZUNA 3U2SC 2MW5A 2RPVA 3WAPA 2ZNVC 3AU4A 4TUUA 1F2RC 3M63B 1YN3A 3BY4B 2AWTA 4GMVA 4KX6B 3QBVB 2K00A 2V9HA 4KHBA 1GOZA 3AM9A 2MBQA 2KUQA 1VZ6A 1WGUA 2JX5A 4TV3A 1JROA 2TSSA 4W9HA 2RPQA 2NS5A 1B1ZA 4A6KA 2VZKB 3PRMB 1RWSA 3A9JA 3LXFA 2N23A 2PW9A 1E5WA 2PLPA 1MVKA 2R2YA 3N7CA 2E6XA 3PHXB 2YT0A 3RFZB 3CF6E 3GB1A 4WWNA 3DVNV 2CU3A 4K2OA 1SSNA 2MX2A 2LULA 4ZDVA 3KZ1A 3AJ4A 3I63C 1WIAA 3RNAC 1G6JA 4M0WA 3IT4B 3V6CB 1U29A 1Q5WB 4M00A 2KFKA 2I5CA 4EZJA 2DYMA 1XF5L 2W2WA 4PQ0A 2BB6A 5FI1A 1F1HA 3HVDA 4LJOB 3ETRA 3NVYA 2IO1B 2M0XA 2RQ1A 1T3QA 1WXAA 2M0AA 1WJ6A 3PV1A 4PYZA 3EC8A 1N5WA 3QX1A 5BYRA 2IFSA 4M8MA 2GBRA 1OQYA 3OAWA 1V9JA 3H7SA 3FVCA 1S1QB 1P3QU 2LGSA 2EMSA 1WXQA 3U7ZA 4IM3A 2MP2A 4YL8A 3AE2B 2KMAA 5HG2A 4MT7A 2LXAA 2GBKA 5IRSA 4JKEA 4K3CA 2W3SA 5EFXA 3ZDMC 3ZGZA 1WM2A 3Q3NC 3SYXA 5C79A 4LK0M 5JH5C 1K50A 1VD2A 4GB9A 4WAFA 4C4VA 4IC7B 3NVWA 2LHEA 1SGHA 3MP9A 1UH6A 3BINA 1XX0A 1TYGB 4OZBA 1HTOA 3H1UA 3NOBA 1CZPA 2NPTB 1OEYJ 4WH4A 1SB3C 4FLHA 4JKHA 4XC2A 2Z59B 4EZKA 2D9XA 1V49A 2J42A 1EWYC 1DIKA 3ZTCA 4GU2A 2BYTA 2D9ZA 3RD2A 1FM0D 2JRIB 1QKZA 3GYOA 3PVLA 3A4SC 1XCGA 2KVZA 3Q3JA 3P2BA 5LLIA 3VOQA 1NENB 1MAIA 4NJCA 1UNSA 3E9PA 1WE7A 2LGXA 3AEBB 5IN7A 4C00A 2KAJA 3TVVA 4HAWB 3QC8B 3ML8A 1GPXA 3SBTA 3QJZA 5GXGB 1EU3A 1MPHA 4ILJA 1WZ3A 3P4QB 3DWGC 3QWMA 2V3SA 3KW5B 2NMBA 3UGBB 3LJUX 4Z2NA 2KMMA 1L7YA 4RF0A 2UZSA 4HDQA 5J17A 1MI0A 1V5OA 1LFDA 3IAS1 2OEDA 4A3PA 3DBLI 2WX1A 2YLMA 1JDEA 4K17A 4XZ4A 2XN9C 1TY0A 4YONA 1WWTA 2WS3B 4MH8A 1P5TA 1YJIA 1MKEA 4DHZB 4KGSA 2LBBA 3AEEB 3R3MA 3AV8A 4JX1C 5I2MA 4HROA 3NZ3A 2ROVA 4XDCA 3ZO5B 2FJLA 1I2HA 3HM6X 4HK2A 4F7GA 2MWNB 2G35A 3LDZE 4IOYX 3BIID 3VR8B 2HTME 1E7PB 4HB2B 4RM8A 1K53A 2P0HA 2DZJA 3L08A 2LUEA 2BTEA 1V81A 3BJIA 2M38A 2PE6B 4L1RA 3VUYA 2DN6A 3BVMA 2K39A 4MT5A 2K0PA 2K9XA 3L16A 2HRJA 2G9HD 1MIXA 2KC2A 3EUB2 5G5HA 2YT2A 1WR1A 1BAKA 4GMXB 1PGBA 4ZRJA 3PVWA 2JZPA 4ASWC 2WXHA 3OHMB 4KDIC 5I2SA 4JE3B 2BS3B 3W5UB 2KFJA 3Q6BA 4DHZE 3NG0A 5DI9B 1T0YA 4MH0E 2QCZA 3BZDB 4HAZB 1WGDA 1N63A 3B77A 1Y56A 4GIVA 3ZNID 4B6HA 2Y5PA 2CU1A 4HCNB 3IAM1 1ROEA 4X57B 3DXEA 2D9YA 2WQYB 1YJ1A 2HDEA 2K8BA 4GSWA 4A3OA 4WQMA 4MEMA 2FJ9A 5EE0A 5TSSA 2IY1B 4YTMB 1FOEA 1ZSQA 1FNUA 4HVBA 2LHDA 1H4RA 2R2QA 1X11A 2WYQA 1I35A 4RMAA 4K3BA 4LTUA 2KD0A 5DHAB 2CHZA 3VXWA 4HB0B 2GBJA 3PSCA 2IO3B 3VH4B 1GB4A 2AEHA 3DBHI 2WU5B 4RNAA 5KHOA 3W1YA 2HE7A 1XR0B 2LD9A 1QOGA 4LDTD 3RNCC 1XXGA 2X8XX 1P1AA 3OWEB 3VUXA 2FCMA 3A33B 1NI2A 1FB8A 3UINB 1QOAA 4K81A 4EE2A 3MC9A 3CXBB 2JPHA 5MPOA 5AEKB 2CHXA 4JK8A 2PPHA 1PGAA 2N9EB 3ZXRA 2LWPA 2RUKB 2WU2B 4XYCA 2KDFB 3U30A 1FHXA 4RCOA 4G50A 2WH5A 1N62A 2VKIA 3MJWA 1Y19B 3WANA 3C0RB 3NJTA 4EUTA 4BKGA 4JKDA 1X1FA 1TKGA 4HSIA 3SV1A 2FIFA 4HJGE 1Q10A 4ANWA 1WJNA 4HDOA 1YQ3B 1V80A 2JT4B 2K49A 1BTNA 3HIEA 3A98B 2EJ8A 2HTHB 1K8RB 2D2QA 2L8JA 2DYQA 5HE0A 3NWAA 1T0RC 5J18A 4NY0A 1PYWD 1C9FA 3KRXA 3OANA 2KIEA 4MM3A 5CLLB 2V3NA 3PP2A 2M4NA 4DHJB 4W9EA 3R2IA 1KZ7A 4PS3A 4P16A 3LYYA 4MY6A 1ZM0A 1MG8A 2ZJDA 2R09A 2MWSB 1EGXA 3AE1B 3AEFB 2Z0QA 3P63A 5D3IB 1I7HA 4WSFA 1EVHA 2PE9A 3RYTA 3TFMA 1WY8A 2DFKA 5LONB 2A4ZA 1R4NB 2LRWA 2W3RA 4TKNA 3GE3C 2UWQA 3V3XA 5BMHA 3EGRA 2DZMA 1WRIA 4YSYB 2FJUB 3KYCD 1YJJA 2KTFA 3ZNHB 4WVFB 1WRDB 2CHWA 4CHJA 1NVLA 2FCSA 2L00B 2RRFA 4B9KA 3SD5A 5KQ1A 2E3TA 3TIXA 2DTCA 2MA9B 3EHVA 4OT1A 3D8FA 4D0NB 2FNJB 3HSAA 4DWFA 3DPDA 1HB6A 4IUMB 3PO0A 3W2DA 2BQQA 4JKBA 3U8ZA 1FGYA 4C80A 4JKFA 3RNGC 2VRWB 2WXJA 1E7VA 4FA6A 1F77A 3W1SA 1WF9A 1SHCA 1GB1A 2LGIA 2N7DA 1WM3A 3QAQA 1P98A 3RCPA 1DROA 4FJVB 3Q8AA 3AE5B 4ARCA 1RYJA 4YWGG 1AW7A 4YTPB 4DK5A 1IYFA 3ZQ4A 1GUAB 1LXDA 4Y94A 3OJ4B 1WZ0A 1TS5A 3T8MA 2C7MB 2WXIA 4NAWB 3TO1A 2WLBA 4XX5A 2LFIA 2UU7A 3D32A 4AQ7A 3HVZA 4XWXA 4K7WA 5DCNA 1KRHA 2VZKD 3QA8A 1I4HA 1D5MC 1YQ4B 5HE3A 2DHIA 1KM7A 4FULA 2XK5A 3A1QA 5C3JB 2M17A 3P6AA 4PNKA 4DBGA 2KWVB 3SU8X 3DHHC 4A6HA 2L1AA 3Q3FA 1FNVA 2Z0DB 3GS2A 1ZDVA 4USAA 3WAMA 1WX9A 3TEZA 2AL3A 2ACZB 4FHKA 3KLSX 2QC8A 4JPSA 2GUMA 5JLJB 4F8CB 2LZ6A 4RGTA 2DYBA 2OQBA 4EKUA 3AH7A 3F5RA 4M8NA 2NCNA 2W82A 2HJ1A 3E66A 2BW2A 4HB3B 4A8XC 2MHJA 2ABDA 3KWLA 1B9RA 5D3XA 3AN1A 2RSGA 1T0QC 3DQVA 1PDXA 2NBWB 1TKYA 4IKGA 4EJNA 1VR9A 3M62B 1VCBA 1PUTA 2KQ4X 2NTSA 2V3PA 4GOCA 3ZJUA 3QIJA 5C5BA 4ZRKA 4JKAA 1ET6A 3L10B 2D4QA 2KQ7A 4XE0A 2IO2B 3WCQA 2R0DA 3MC8A 3T9LA 2CAYA 2IPKD 4HAYB 3N1XC 3JW0X 1I4PA 2KK8A 3SO6A 4CYEA 4P7IA 1U5FA 2Y8FA 1VJKA 4DDGD 4GNKB 1YN4A 1GC7A 2WXGA 3SHQA 1V5PA 2RR9A 3I5JC 2J0KA 1CK1A 3R8BA 5DHFB 4KHBB 4MJSA 3VQIA 4ZOHC 1OTRB 1K5DB 1C76A 1CJEA 3AEGB 2DKPA 4WJ7A 4W9LA 1QOFA 1KTKA 3A9JB 3GE8C 3FILB 3TSSA 4E74A 2BF8B 4P1BC 1F52A 4IM0A 4TYZA 3GZNI 4NPNA 2DWQA 4ANUA 2Z0OA 4GZUA 4HAXB 2DIKA 2IGHA 4F1SA 2KIGA 1OY2A 1WVHA 3Q8FA 2LYDA 2IBIB 3TMPB 4QJ5B 1R4MB 2ZKMX 3U7DA 4ZRPA 4EOYA 5G2NA 2JZZA 5BMIA 4W9DA 3T3NA 2IJ0A 2CJNA 3ZW3A 1ACCA 2KX0A 1ZC4B 5C16A 1J0GA 1UPQA 1FGZA 4WURA 3E9LA 3O96A 2KMCA 3MFGA 4XWTA 3WALA 3AEAB 1YX5B 4N59A 2DX5A 4ZRIA 4IOIE 4IWQA 3NWFA 2IO0B 1AARA 4BKSA 1P3RA 1F0ZA 1V61A 2J59M 4K2PA 2MP2B 1WXSA 4A90A 2KR0A 1EWCA 1A70A 3ML9A 2JY6A 3UQAA 3PPAA 1ZXHA 4GDKA 3DCXA 2NVUI 2WX0A 2L76A 3BYYB 1FXTB 2L32A 4CO7A 1FHOA 2C5LC 2MKRA 2INNE 4LNKA 3QWZB 2WP9B 4GDLB 3VIAA 2PIAA 2CB8A 2JU6X 4JKGB 2IZVB 1Z5SB 1UNRA 2GB1A 1PMSA 1YN5A 3SEBA 4NNJB 4KVGB 2QMTA 4PS8A 1V5MA 3ZKJC 4Z2MB 2NBVB 3AE7B 5CHWA 4JK9A 2KKCA 1VRAB 3PGEA 4G0NB 2OTXA 3JSVB 1L0XB 3SUZA 1XEEA 1PQSA 2KACA 5D3WA 1UGJA 2DYOA 3DWMA 1BWNA 1R7SA 4R3DA 2YS3A 1UUPA 4G3XB 2KJHB 2C60A 4US8A 1FCLA 4BBNC 2L83A 3NWDA 4YSZB 3FLVA 4TQ0A 2JXTA 2RMMA 2WXPA 2NZ8B 4HKQA 3TEYA 4HCPB 1CMXB 1YOVB 2GCJA 3E9OA 5FI0A 1XLNA 2KZRA 4DX90 4MGKE 1VDVA 5T8IA 3GP7A 1QZEA 1XQQA 2KANA 2WGSA 4HHVA 1HZ5A 2KDIA 2Y5BB 4HRSA 4E3CA 3A9KA 1PLSA 1RJ2A 3N32A 3D8EA 3B08A 2D3BA 2RDBC 2FCNA 5H8YE 3MHZA 1SIJA 2ZCBA 5AZFA 1ZOYB 2BS2B 1IBXB 3H7PB 1GJZA 3IT6B 1SE3A 3ZVRA 4W9KA 2MCNB 4C56C 5BYQA 1ZW7A 3KSYA 1N6ZA 3UIPB 4WIPA 3P1MA 3NS1A 1YD8U 1TGZB 2Z14A 4II3B 1XD4A 3DVGX 2LKOA 1EAZA 2RNRB 2XNAC 3PRPB 1UD7A 1JALA 4ICUA 5TR5A 5C6RA 2AQ2B 4A6FB 4MSQB 1K51A 2KN5A 5E6NA 3DXCA 2XEWA 4YTNB 4CSQA 5HI1A 2KVRA 4YXDB 4ZHPA 2KT7A 4EFOA 4N9F4 1L4ZB 2CS4A 2ZW0A 1T6BX 2H89B 2QHOA 3P4PB 2Z59A 2KGXB 1H10A 1WR6E 3BWUD 4B0EA 1I4RA 1NDDA 5JHBA 1QILA 3EFUA 3L0WB 2DYNA 2KDMA 1VZ7A 2D9VA 4FJYA 3FSSA 1D5ZC 2MSED 4KGRA 3ZIMA 1NTIA 3Q2AC 1FMAD 1SBBB 1WGGA 4PYUA 5LG4B 3DCGA 3T3OA 1LQBA 1MIZB 1VBGA 1ACAA 2P0FA 1U5GA 2PJHA 1L6VA 4KZ0A 3DBRI 1IUEA 2M56B 1FRDA 3ZXVA 1WMHB 4LNNA 2K6QA 2GRIA 1SEBD 4MGZE 3NRZA 1TY2A 2LOXA 3EFCA 2Y3AA 2LGYA 1UNQA 3TBLD 4GN1A 4BBNF 3RN9C 4DHJD 2FCQA 2DHKA 3IHPC 2G45B 1UWXA 2COFA 3PLVA 2BYVE 2PEAA 2VSZA 1HXYD 2KNBA 2BVCA 3RPFC 1Z2MA 4AJYB 2L0FA 1VLBA 2LG1A 1OQRA 2RLOA 4RGMA 1EUVB 3PZ8A 2DBYA 2RGNB 3TCAA 2C7HA 2Y8GA 5FKAC 1TQZA 1ZE3D 1PFJA 4RFBA 1U5EA 3ENEA 3NS8A 3M1IB 2QEJC 3N1ZC 1IP9A 1DOXA 1MK7B 2Z0PA 3A8PA 5KCVA 1EF5A 4I6LB 2QKLA 4M02A 2Y7BA 4DQOC 2J4XA 5L95C 3PTFC 2MBHA 3CSFA 2K5PA 4TSSA 4HB4B 4F7HA 2INDC 1WFYA 2GOWA 2IYBA 2XBBC 4ITKA 2D9WA 2ELAA 1SXTA 2KJ6A 3IG3A 4II2B 2CKHB 1BUIC 4D2KA 4EMOA 2X0SA 5IP4D 1LO5D 5EE3A 3RCZA 1UBIA 5D94A 3H8HA 3UIOB 3N30A 3O65B 3TJPA 2L3ZA 1EM7A 2KTRA 3MPXA 2KHWB 3VR9B 1D6EC 1L4DB 4K7UA 2K8EA 3PZ7A 2OJWA 2NR2A 3AI5A 4EZLA 1XLPA 5BMGA 3TL5A 1NU2A 2W2XC 3F0WA 3BVZA 2E2XA 4REZA 4CHKA 5J2RA 5HE2A 1WGYA 1MJDA 4UDUC 2MBOA 1M94A 5D27A 3SR6A 2FUG1 3VH3B 2JF5A 2GCLA 3HQCA 2N0YA 3HUIA 5IOIA 3ABVB 3IBEA 1V89A 4OZCA 3CWIA 2NTTA 2L2IA 4BFRA 1E8WA 4RGNA 1ESFA 2M1MA 3BK2A 3DBLB 1JW9D 3PSEB 2K3UA 2N0SB 1D3ZA 2KJRA 2INPE 4HKZE 4IFSA 2EMTA 2BT6A 1FNWA 3VTVA 4KHOA 1GG3A 2PVGC 5IKCM 5D3VA 1J7BA 5EDSA 1RFKA 1DDWA 3B2GA 4DX8A 2KYWA 1M4VA 5DPTA 1RRPB 3IVFA 2YF0A 1DDVA 3OJ3A 1HB8A 4O1NA 2KXJA 2WXMA 4JWUC 1LB1A 3FP5A 4WWMA 1AWEA 2YS1A 2K8HA 4QAYA 4LNFA 1EU4A 2SEBD 2IY0B 4KKIA 1C4CA 3BVGA 4MACA 2OOBB 3PEGA 3WIMA 1FHWA 1OGWA 2NMQA 5G5GA 3P42A 3NVVA 1WH3A 1K52A 1NI3A 3PT2B 2IGDA 2GJYA 1ZKHA 2JYTA 2O2VA 2W9NA 3ZDTA 1F2RI 1FAOA 4C7ZA 2Q5WD 3UQBA 2WDQB 3ZNGC 1MHXA 3TEXA 2BB5A 2DNFA 2WDTB 2ZEQA 1HBKA 5EE9A 4KSKC 3V62A 3TW1A 2DX1A 2N9XA 3L4PA 3PVUA 2H7DA 2Z0EB 3B2FA 5I4DA 2AL6A 2R2OA 3MHSD 1KFYB 4QJ3B 1YQBA 2BWES 4MGYE 3QHTA 1D5XC 1ZVRA 5FR6A 4M01A 2CQUA 3KUCB 1MFWA 2N9LA 2REXA 4FN2A 4OVUA 2ZVOA 4LLGM 2RSUA 1XODA 2CY4A 1C1YB 2XK5B 3FKYA 2L1CA 3DHGC 1E90A 4FXCA 2GBMA 3X23A 4NQKE 2D10A 4KIKB 3V60A 5JHGA 3A4RA 1WGHA 1XLOA 2ZW1A 2N7EA 4L6EA 1EO6A 2MJDA 2FAZA 2ONQA 1Q67A 3HIZA 3DBHB 1FCCC 3VAWA 2K8CA 5C2TB 4ANVA 2PVOD 2IYDB 1TT5B 3DXDA 4KZCA 3M95A 3RT3B 4FHJA 2ZPYA 2Z8LA 1RAXA 1V1OA 4A9AA 3E9SA 2WWZA 4BOSC 1V88A 2DZIA 4J6IA 3RNFC 1FFVA 3U4EG 1FXIA 1QOBA 3PG7A 2N9KA 2RDHA 1KC7A 1T0SC 1J7AA 1IRSA 4IG7B 2M19A 4NJ6A 4JL9A 1SE9A 1W1DA 1AQCA 4XWWA 3ZJVA 1LW3A 3VHTC 4K1RB 2ZPNA 2J0JA 1NEKB 3KRWA 4I6PA 5DPRA 1NTYA 5CLQB 2LMCA 4HPLB 1BTKA 2QIEB 1MG4A 1W1GA 2X18A 2L05A 3APFA 3Q3MC 2R82A 1C3TA 1ENFA 1T77A 2CJOA 2O6VB 1AYFA 3ZVVA 2COAA 1JWSD 2OJRA 5AUKA 2KN4A 4IW0A 5JVLA 3KQ4A 2ZCCA 4NAWA 2KLGA 4B95A 4BBKA 2L0TA 1TS2A 5FK9C 3HM3A 4P6VF 1N61A 3NY5A 2KC1A 4RGOS 1TS4A 1I4XA 1WE6A 2LJIA 1V5UA 4KHAA 3KH0A 1E6EB 1UPRA 1B55A 3V05A 1T5XD 1JWUD 2I1KA 4HAVB 5D3YA 3AE3B 4IM2A 2MQJA 4XGAB 4BZAA 1TXDA 1BXTA 5HFYA 2FBWB 2AYOB 2YSZA 1KJTA 1E10A 4BKTA 1HA5A 2K1FA 4HLEA 4A20A 3K9OB 5H92C 1E8YA 3P4SB 4WQOB 2KCJA 2KWUB 3FEHA 2Z13A 4GPTB 1L2NA 2VH1A 1SIFA 1ZGUB 2DLBA 4LNOA 1TTNA 5D6JB 3R7RA 4NQLB 3VUWA 2R61A 1HE8A 3H6NA 4JGHB 4CQNA 2D3GA 4GGQA 3O13A 2JXXA 4JQWC 4JKCA 3MTNB 4GXBA 3T06A 1KZGA 1FXAA 4M0WB 1ST7A 3X0WA 2GMIC 4S17A 2COPA 1V1PA 2KFKB 3ODWA 3KYDD 1HQRD 2X38A 1FPYA 4G11A 4L1BA 2LEKA 2K6DB 1TZ1A 1MK9B 1DOYA 3Q69A 2LRUA 1STEA 2A5UA 1I42A 2ROZB 3PZDA 3J9CA 2QILA 3FM8C 1IPGA 5JXVA 1Q0WB 5C23A 5E6PA 5LOPB 1OMWA 1XCQL 5J3YA 3DHIC 1H8CA 2WXFA 2V0GA 4C0AA 2DHZA 4RF1A 4XDDA 4DBBA 1QLBB 3HRDD 2MFQA 1V86A 4WJQA 2LUMA 4ZYSA 3FILA 1FEHA 4F7UP 2ZZPB 2PZ1A 3ML4A 3N1YC 1WSPA 1XD3B 1GC6A 3CIKA 2Z4DA 5CHVC 1TJ6A 1MHHE 1UEFA 1E0ZA 2D3CA 2RVBB 1UELA 3RI7C 3ENBA 4S0RA 2P0DA 4N58A 3V6EB 4C4VB 1DBHA 3ZJTA 5KHQA 1XT9B 2BCJA 2CY5A 3IXSA 3PREA 4L2YA 5LXHA 2WXQA 3KUZA 2W54A 3VTWA 4H8SA 3I57A 3N20C 2BKRB 4OVZA 4OSNA 3FC4A 3R7QA 5JHAA 3IFWB 1ZC3B 2WDRB 2I38A 5D7GA 4W9JA 1NYQA 1D4BA 2WXKA 3A9KB 5EE1A 3I3TB 4HPPA 1KI1B 1IGCA 5IJMA 4A6QA 4US9A 1P7FA 3MJ5A 4IDIA 2W2XD 3NZSA 3CIRB 1DGJA 1L0VB 3ZTDA 1X86A 2WHIA 4KGTA 3KUDB 3PLUA 1DDMA 2KDEB 2WNMA 1HEZE 3N9YC 4MGIE 4WWOA 1A5RA 1TIFA 3QCAA 1C4AA 1J7CA 3Q8BA 3PHWB 2ZVNA 3P4RB 4ZRQA 4W9FA 2YT1A 2FIDA 5JHHA 1I7AA 1KBLA 2K2JA 3GYPA 4URKA 4L23A 5E6OA 1L5PA 4GDLA 1JWMD 2DZKA 2M14A 4N6EB 3HHMA 4JKGA 3DVGY 4WJOA 2KWCA 1ET9A 3EA6A 1XLQA 2KO3A 2NBVA 1ZDXA 3LB8C 3VTUA 3UZTA 4ANXA 3N3KB 3JSVA 2JVCA 4OHJA 2D5GA 3FAHA 3AE6B 3W5VB 2DENB 3GZNB 5AUIA 4IAPA 3RUIB 4LJPB 5HKHA 3JYUA 4AS1A 4AP4C 1J0WA 3NHEB 3TEWA 1X1GA 3D8DA 2BBCA 2N7JA 1VZ8A 1XO3A 4JIOU 2WXOA 2G3QB 3EECA 4FBJB 2NPTA 3KWVA 1FRRA 3PS6A 1M7EA 3WAOA 1PFDA 2CODA 2N1VA 2KDBA 4AWJA 4DIXA 4HEA1 3R66C 4OVVA 2DKQA 1UF0A 1N60A 4Q2JA 1YNTE 3AE4B 3AEDB 3Q3OC 2WXLA 4EEWA 3HW2B 3L17A 5IO9A 2MBEA 1YMHE 1ISNA 2JSVX 2LJ5A 3H7PA 1IBXA 1WYWB 1M7RA 3APCA 4YSXB 5FR3A 1P0RA 1WXVA 1E9MA 2C9WB 3V61A 3EPYA 2W55A 4HWIB 1WI1A 5L83A 1N3HA 1TBEA 1WXMA 1TKEA 1RLFA 2ADZA 3AULA 2MLBA 1QQRA 1JMLA 2J0MA 4A6FA 2RDGA 1FIQA 2KX3A 4JLCA 1DYNA 1S3SG 1U5DA 2JP2A 3AECB 2DAJA 3L54A 1MI1A 3RZWC 3URYA 1QT9A 3P7ZA 2H88B 4YT0B 4IWOA 3RMKC 5C1ZA 4LCDE 3SBGA 2OHFA 2KTRB 2LI5A 1C77A 4B0MA 1R4NI 3A58A 4NAMA 5AZHA 2KUPA 2LXCA 1MPEA 4K7SA 3M3JA 3RNBC 2V1YA 3ODXA 3VVWB 2FE8A 1WYGA 1V97A 3WYFB 1P7EA 2LVQA 2DLWA 2CR5A 1VBHA 1FD6A 5HHDG 2JWUA 3ZRFA 2K2UA 1RRBA 1WMHA 3NZUA 3Q8CA 3RNEC 1W1HA 2P8VA 2B3AA 4LNIA 1SJED 2INCC 1HTQA 1C4PA 3B0AA 4FJZA 2V76A 1V6EA 3QQ8B 4MELA 1SE2A 4TQ1A 1AN8A 3BK1A 1J8CA 4ILGB 4CHMA 2D11A 3NW8A 2EELA 5LNK1 3QK0A 1XCTL 1PGXA 1L0YB 2JZ3B 4W9GA 2L7RA 4RM9A 3DBSA 3Q8EA 4KV2A 1OQQA 2HJ8A 1E8ZA 4HPMB 2VRRB 2L52A 5IAAC 1U4AA 1LGRA 1C78A 5GMVA 5JZEB 1WG7A 3KY9A 5IA7A 2LOZA 2JWZA 2WXNA 1NYRA 5M4YB 1U2BA 4OW0A 3ZNZB 2PKOA 4DXFA 5BO4B 2EC1A 4AJWA 2QSDA 2G1EA 3JVZX 4C7YA 1QQGA 4MM3B 1L6UA 2BGFA 2KLCA 1UZXB 2AX5A 2PTLA 2UVMA 4KKJA 1V8CA 5DPSA 3NVZA 1AWDA 2FDQA 1IGDA 3UF8A 4DXAB 3ZYYX 2MBBB 1E8XA 2HD5B 1WGRA 3K9PB 2IGGA 5KQ4A 1EF1A 5LXIB 3AXCA 1GAQB 1BMLC 4W9CA 4GOUA 1Y8RC 5L81A 2J52A 5GOWB 2RD0A 1N5XA 2B76B 4B6WA 3Q14C 5E6JA 2KQSA 1KF6B 2D3AA 2O2VB 3SNHA 3CMMB 1NVID 5AZGA 1OQNA 3SFEB 2JYEA 2H7EA 3KVFB 2O6VD 2V4IB 2IDYA 3AE9B 2RGFA 1NBFC 3AB5A 3AE8B 3SFDB 1LM8B 3DBRB 3OLMD 1UGMA 4W9IA 1ZP0B 5D2MB 3HK0A 4ILHA 4J3OD 1WJUA 5DPWA 4HATB 1FO4A 1UWMA 1P6SA 5DH9B 4MK0A 4JWSC 3B9JA 3OG5A 4NJ7A 1JWBD 4WJNA 3AU5A 1V2YA 3ULCA 3GOEA 1F9JA 2Y5CA 1WX8A 2MH7A 3ALBA 4H2AA 4MDKE 4KDLB 1GNUA 2GI9A 1ZPSA 4HJKA 5G55A 3U12A
chains in the Genus database with same CATH topology
2M8SA 3LJ3A 4E71A 4NSWA 1Q1OA 2HTHA 2Q13A 3APDA 3DDCB 1WI0A 5CX3A 3B1LX 1X05A 3A1QB 3VFKA 2C7NB 2LVOA 3CSTA 3W1SC 1JRUA 1QC6A 3VDZA 4BKSD 5JP4A 4HAUB 2LGDA 2YRYA 3RZFA 1R4MI 2FUHB 4HXDA 4LDTB 2MRPA 2BPSA 2DA0A 4DDID 4WJPA 4FADA 3ODOA 2N1WA 2JUOA 2N9PC 4A5KA 4AOFA 1XKEA 2LVPA 2DHJA 3ONSA 4WWPA 1K5GB 1YX6B 1KOTA 1Y5OA 3DVNU 3DOWA 2D07B 5C5BB 4F7ZA 4AUQC 2N4FA 4KIKA 2GBNA 2UZRA 1E7UA 2JRHA 3QARA 1GGOA 4KAXB 3ECIA 3V5WA 3RULA 2GS0A 4MJSB 2BKFA 2BWFA 2YS5A 2BYEA 4I6NB 3PRZA 3ZRCA 2LASA 2YVCA 2MDXA 3L13A 1J19A 2CRFA 1BT0A 4MSMB 2DAFA 1Z87A 3WA0A 2G4DB 4IWPA 4KSLC 1P9DU 2QKMA 2G4SA 2J7QB 2ELBA 2NBUA 3A8QA 1RFAA 3G9WA 2UYZB 2KOXA 2ZNVB 2I5FA 2XQNM 4PS7A 4ICVA 1X1MA 5CHFA 4ZYNA 1WJ1A 3SDLC 3MDBC 1OEYA 1NTVA 2O6VA 1YIWA 1WGQA 5HE1A 2COCA 3H9DA 4WAAA 5DIFB 5CTRC 2BYFA 5J3QA 2EKEC 1V5TA 1KLVA 1WJ4A 2I1JA 2V4LA 4JK7A 3ULBA 2K25A 2DX5B 4BOZB 3S2AA 1WJMA 1UBQA 2ASQA 5J3TA 4GDKB 4BVUC 1WX7A 3NSUA 1UNPA 3ZLZA 1U27A 3ZUNA 2MW5A 3WAPA 2ZNVC 3AU4A 4TUUA 3M63B 3BY4B 2AWTA 4GMVA 3QBVB 2K00A 2MBQA 1WGUA 4TV3A 4W9HA 2RPQA 2NS5A 4A6KA 3PRMB 3A9JA 2N23A 1E5WA 3N7CA 3PHXB 2YT0A 3CF6E 4WWNA 3DVNV 4K2OA 2MX2A 2LULA 4ZDVA 3KZ1A 3AJ4A 1WIAA 1G6JA 3V6CB 1U29A 1Q5WB 2KFKA 2I5CA 4EZJA 2DYMA 2W2WA 4PQ0A 5FI1A 4LJOB 2IO1B 2M0XA 2RQ1A 1WXAA 1WJ6A 3PV1A 4PYZA 3EC8A 3QX1A 2IFSA 4M8MA 2GBRA 1OQYA 3OAWA 1V9JA 3H7SA 1S1QB 1P3QU 2EMSA 4IM3A 2MP2A 4YL8A 2KMAA 4MT7A 2LXAA 2GBKA 4JKEA 5EFXA 3ZDMC 1WM2A 3SYXA 5C79A 5JH5C 1VD2A 4GB9A 4IC7B 1SGHA 1UH6A 3BINA 1XX0A 3H1UA 3NOBA 2NPTB 1OEYJ 4FLHA 4JKHA 4XC2A 2Z59B 4EZKA 2D9XA 1V49A 1DIKA 3ZTCA 4GU2A 2D9ZA 3RD2A 2JRIB 3GYOA 3PVLA 3A4SC 1XCGA 3Q3JA 3P2BA 5LLIA 3VOQA 1MAIA 3E9PA 1WE7A 2LGXA 3TVVA 4HAWB 3QC8B 3ML8A 3SBTA 3QJZA 1WZ3A 1MPHA 4ILJA 3QWMA 2V3SA 3KW5B 2NMBA 3UGBB 3LJUX 4Z2NA 1L7YA 2UZSA 4HDQA 5J17A 1V5OA 1LFDA 4A3PA 3DBLI 2WX1A 2YLMA 1JDEA 4K17A 4XZ4A 4YONA 1P5TA 1MKEA 4DHZB 2LBBA 3R3MA 2ROVA 3ZO5B 2FJLA 1I2HA 3HM6X 4HK2A 4F7GA 2MWNB 2G35A 3LDZE 4IOYX 4HB2B 4RM8A 2P0HA 2DZJA 3L08A 2LUEA 1V81A 3BJIA 2M38A 2PE6B 3VUYA 2DN6A 2K39A 3L16A 2HRJA 1MIXA 2KC2A 1WR1A 1BAKA 4GMXB 4ZRJA 3PVWA 4ASWC 4KDIC 2KFJA 4DHZE 5DI9B 1T0YA 4MH0E 4HAZB 1WGDA 3ZNID 4GIVA 4B6HA 4HCNB 2CU1A 4X57B 3DXEA 2D9YA 4GSWA 1YJ1A 2K8BA 4A3OA 4MEMA 2FJ9A 2IY1B 1FOEA 1ZSQA 4HVBA 1H4RA 2R2QA 1X11A 2WYQA 1I35A 4RMAA 2KD0A 5DHAB 2CHZA 3VXWA 4HB0B 2GBJA 3PSCA 2IO3B 3VH4B 2AEHA 3DBHI 5KHOA 3W1YA 2HE7A 1XR0B 2LD9A 4LDTD 1P1AA 3VUXA 2FCMA 3A33B 1NI2A 1FB8A 3UINB 4K81A 3CXBB 2JPHA 5AEKB 2CHXA 4JK8A 2PPHA 2N9EB 2LWPA 2RUKB 2KDFB 3U30A 1FHXA 4G50A 2WH5A 2VKIA 3MJWA 1Y19B 3WANA 3C0RB 4EUTA 4BKGA 4JKDA 1X1FA 3SV1A 2FIFA 4ANWA 1WJNA 4HDOA 1V80A 2JT4B 1BTNA 3A98B 2EJ8A 2HTHB 1K8RB 2D2QA 2L8JA 2DYQA 5HE0A 5J18A 4NY0A 3KRXA 3OANA 4MM3A 5CLLB 3PP2A 2M4NA 4DHJB 4W9EA 1KZ7A 4PS3A 4MY6A 1ZM0A 1MG8A 2ZJDA 2R09A 2MWSB 1EGXA 2Z0QA 4WSFA 1EVHA 2PE9A 3RYTA 3TFMA 1WY8A 2DFKA 5LONB 2A4ZA 2LRWA 4TKNA 2UWQA 2DZMA 3KYCD 2KTFA 3ZNHB 4WVFB 1WRDB 2CHWA 4CHJA 1NVLA 2FCSA 2L00B 4B9KA 3SD5A 5KQ1A 3TIXA 2DTCA 2MA9B 3EHVA 3D8FA 4D0NB 2FNJB 4DWFA 3DPDA 1HB6A 4IUMB 4JKBA 3U8ZA 1FGYA 4JKFA 2VRWB 1E7VA 4FA6A 3W1SA 1WF9A 1SHCA 2N7DA 1WM3A 3QAQA 1P98A 3RCPA 1DROA 4FJVB 4DK5A 1IYFA 1GUAB 1LXDA 4Y94A 3OJ4B 1WZ0A 3T8MA 2C7MB 4NAWB 3TO1A 4XX5A 3D32A 4XWXA 4K7WA 5DCNA 3QA8A 5HE3A 2DHIA 1KM7A 4FULA 2XK5A 3A1QA 2M17A 3P6AA 4PNKA 4DBGA 2KWVB 3SU8X 4A6HA 3Q3FA 2Z0DB 3WAMA 1WX9A 2AL3A 4FHKA 5JLJB 4F8CB 2LZ6A 2DYBA 2OQBA 4EKUA 3F5RA 4M8NA 2NCNA 3E66A 4HB3B 2ABDA 5D3XA 2RSGA 3DQVA 2NBWB 4EJNA 3M62B 1VCBA 4GOCA 3QIJA 5C5BA 4ZRKA 4JKAA 3L10B 2D4QA 2KQ7A 2IO2B 2R0DA 3T9LA 2CAYA 4HAYB 3JW0X 2KK8A 3SO6A 4CYEA 4P7IA 1U5FA 2Y8FA 4DDGD 1GC7A 3SHQA 1V5PA 2RR9A 2J0KA 5DHFB 4KHBB 4MJSA 3VQIA 1OTRB 1K5DB 2DKPA 4WJ7A 4W9LA 3A9JB 4E74A 2BF8B 4IM0A 4TYZA 3GZNI 4NPNA 4ANUA 2Z0OA 4GZUA 4HAXB 2DIKA 4F1SA 1OY2A 1WVHA 2LYDA 2IBIB 3TMPB 3U7DA 4EOYA 5G2NA 2JZZA 4W9DA 3ZW3A 2KX0A 1ZC4B 5C16A 1J0GA 1UPQA 1FGZA 3E9LA 3O96A 2KMCA 3WALA 1YX5B 2DX5A 4ZRIA 4IWQA 1AARA 2IO0B 4BKSA 1P3RA 1V61A 2J59M 4K2PA 2MP2B 1WXSA 3ML9A 2JY6A 3UQAA 3PPAA 4GDKA 2NVUI 2WX0A 2L76A 1FXTB 4CO7A 1FHOA 2C5LC 2MKRA 3QWZB 4GDLB 3VIAA 2CB8A 4JKGB 2IZVB 1Z5SB 1UNRA 1PMSA 4NNJB 4KVGB 4PS8A 1V5MA 3ZKJC 4Z2MB 2NBVB 5CHWA 4JK9A 2KKCA 3PGEA 4G0NB 2OTXA 3JSVB 3SUZA 1PQSA 5D3WA 2DYOA 1BWNA 2YS3A 4G3XB 2KJHB 2C60A 4BBNC 3FLVA 4TQ0A 2NZ8B 4HCPB 1CMXB 2GCJA 3E9OA 5FI0A 2KZRA 4DX90 4MGKE 1QZEA 1XQQA 2KANA 4HHVA 2KDIA 2Y5BB 4E3CA 3A9KA 1PLSA 1RJ2A 3N32A 3D8EA 3B08A 2FCNA 2ZCBA 5AZFA 3H7PB 1GJZA 3ZVRA 4W9KA 2MCNB 1ZW7A 3KSYA 3UIPB 1YD8U 1TGZB 4II3B 1XD4A 3DVGX 2LKOA 1EAZA 2RNRB 3PRPB 1UD7A 4ICUA 5TR5A 5C6RA 4A6FB 4MSQB 2KN5A 5E6NA 3DXCA 2XEWA 2KVRA 4EFOA 4N9F4 2CS4A 2QHOA 2KGXB 1H10A 1WR6E 1NDDA 5JHBA 3EFUA 3L0WB 2DYNA 2D9VA 4FJYA 3FSSA 2MSED 3ZIMA 1NTIA 1WGGA 4PYUA 3DCGA 1LQBA 1MIZB 1VBGA 1ACAA 2P0FA 1U5GA 2PJHA 4KZ0A 3DBRI 1WMHB 2K6QA 4MGZE 2LOXA 2LGYA 1UNQA 3TBLD 4GN1A 4BBNF 4DHJD 2FCQA 2DHKA 3IHPC 2G45B 2COFA 3PLVA 2BYVE 2PEAA 2VSZA 2KNBA 1Z2MA 4AJYB 2L0FA 2LG1A 2RLOA 1EUVB 2RGNB 3TCAA 2C7HA 2Y8GA 1TQZA 1PFJA 1U5EA 3ENEA 3NS8A 3M1IB 1IP9A 1MK7B 2Z0PA 3A8PA 5KCVA 1EF5A 4I6LB 2QKLA 2Y7BA 5L95C 3PTFC 2MBHA 3CSFA 4HB4B 4F7HA 1WFYA 2GOWA 2IYBA 2XBBC 2D9WA 2ELAA 2KJ6A 3IG3A 4II2B 2CKHB 4EMOA 2X0SA 3RCZA 1UBIA 5D94A 3UIOB 3N30A 3O65B 3TJPA 2L3ZA 2KTRA 3MPXA 2KHWB 4K7UA 2NR2A 3AI5A 4EZLA 3TL5A 1NU2A 2W2XC 3F0WA 2E2XA 4CHKA 5J2RA 5HE2A 1WGYA 2MBOA 1M94A 5D27A 3VH3B 2JF5A 2GCLA 3HQCA 2N0YA 3IBEA 1V89A 2L2IA 4BFRA 1E8WA 2M1MA 3PSEB 1D3ZA 2KJRA 4IFSA 2EMTA 3VTVA 4KHOA 1GG3A 5D3VA 5EDSA 1DDWA 4DX8A 5DPTA 1RRPB 3IVFA 2YF0A 1DDVA 3OJ3A 1HB8A 2KXJA 1LB1A 3FP5A 1AWEA 2YS1A 2K8HA 2IY0B 2OOBB 3PEGA 3WIMA 1FHWA 1OGWA 1WH3A 3PT2B 2GJYA 1ZKHA 2O2VA 2W9NA 3ZDTA 1FAOA 3UQBA 3ZNGC 2WDTB 2ZEQA 1HBKA 4KSKC 3V62A 3TW1A 2DX1A 2N9XA 3PVUA 2H7DA 2Z0EB 2AL6A 2R2OA 3MHSD 1YQBA 2BWES 4MGYE 3QHTA 1ZVRA 5FR6A 2CQUA 3KUCB 2REXA 4FN2A 4OVUA 2ZVOA 2RSUA 1XODA 2CY4A 1C1YB 2XK5B 2L1CA 1E90A 2GBMA 3X23A 4NQKE 2D10A 4KIKB 3V60A 5JHGA 3A4RA 1WGHA 2N7EA 4L6EA 1EO6A 2FAZA 1Q67A 3HIZA 3VAWA 2K8CA 4ANVA 2IYDB 3DXDA 4KZCA 3M95A 3RT3B 4FHJA 2ZPYA 1RAXA 2WWZA 4BOSC 1V88A 2DZIA 4J6IA 3PG7A 1KC7A 1IRSA 4IG7B 4NJ6A 4JL9A 1SE9A 1W1DA 1AQCA 1LW3A 3VHTC 4K1RB 2ZPNA 2J0JA 3KRWA 4I6PA 5DPRA 1NTYA 5CLQB 4HPLB 1BTKA 1W1GA 2X18A 2L05A 3APFA 2R82A 1C3TA 2O6VB 3ZVVA 2COAA 2OJRA 4IW0A 5JVLA 2ZCCA 4NAWA 2KLGA 4B95A 4BBKA 2L0TA 3HM3A 3NY5A 2KC1A 1WE6A 1V5UA 4KHAA 3KH0A 1UPRA 1B55A 2I1KA 4HAVB 5D3YA 4IM2A 2MQJA 1TXDA 2AYOB 2YSZA 1KJTA 4BKTA 2K1FA 4HLEA 4A20A 3K9OB 1E8YA 4WQOB 2KCJA 2KWUB 3FEHA 4GPTB 1L2NA 1SIFA 1ZGUB 5D6JB 1TTNA 3R7RA 4NQLB 3VUWA 1HE8A 3H6NA 4JGHB 2D3GA 4GGQA 2JXXA 4JQWC 4JKCA 3MTNB 4GXBA 3T06A 1KZGA 4M0WB 1ST7A 3X0WA 2GMIC 2COPA 2KFKB 3ODWA 3KYDD 4G11A 2K6DB 1TZ1A 1MK9B 2LRUA 1I42A 2A5UA 2ROZB 3PZDA 3FM8C 1IPGA 1Q0WB 5C23A 5E6PA 5LOPB 1OMWA 5J3YA 1H8CA 4C0AA 2DHZA 4DBBA 2MFQA 1V86A 4WJQA 4F7UP 2ZZPB 2PZ1A 3ML4A 1XD3B 1GC6A 3CIKA 5CHVC 1TJ6A 1UEFA 2RVBB 1UELA 3ENBA 2P0DA 3V6EB 1DBHA 5KHQA 1XT9B 2BCJA 2CY5A 3PREA 5LXHA 3KUZA 3VTWA 4H8SA 2BKRB 3R7QA 5JHAA 3IFWB 1ZC3B 5D7GA 4W9JA 3A9KB 3I3TB 1KI1B 5IJMA 2W2XD 3NZSA 3ZTDA 1X86A 3KUDB 3PLUA 1DDMA 2KDEB 4WWOA 4MGIE 1A5RA 3QCAA 3PHWB 2ZVNA 4W9FA 2YT1A 2FIDA 5JHHA 1I7AA 1KBLA 2K2JA 3GYPA 4URKA 5E6OA 4GDLA 2DZKA 2M14A 3HHMA 4JKGA 3DVGY 4WJOA 2KWCA 2KO3A 3VTUA 3UZTA 4ANXA 3N3KB 3JSVA 2JVCA 2DENB 4IAPA 3RUIB 4LJPB 5HKHA 3JYUA 4AP4C 1J0WA 3NHEB 1X1GA 3D8DA 4JIOU 2G3QB 3EECA 4FBJB 2NPTA 3PS6A 1M7EA 3WAOA 2CODA 2N1VA 2KDBA 4AWJA 4OVVA 3R66C 2DKQA 4EEWA 3HW2B 3L17A 2MBEA 1ISNA 2LJ5A 3H7PA 1WYWB 1M7RA 3APCA 1P0RA 1WXVA 2C9WB 3V61A 3EPYA 4HWIB 1WI1A 5L83A 1N3HA 1TBEA 1WXMA 1RLFA 2ADZA 3AULA 2MLBA 2J0MA 4A6FA 2KX3A 4JLCA 1DYNA 1S3SG 1U5DA 2JP2A 2DAJA 3L54A 3RZWC 3P7ZA 4IWOA 5C1ZA 4LCDE 3SBGA 2KTRB 2LI5A 1R4NI 5AZHA 2KUPA 2LXCA 4K7SA 3M3JA 2V1YA 3ODXA 3VVWB 3WYFB 2LVQA 2DLWA 2CR5A 1VBHA 3ZRFA 2K2UA 1RRBA 1WMHA 3NZUA 1W1HA 2P8VA 2B3AA 3B0AA 4FJZA 2V76A 1V6EA 3QQ8B 4MELA 4TQ1A 1J8CA 4ILGB 4CHMA 2D11A 3QK0A 2JZ3B 4W9GA 2L7RA 4RM9A 3DBSA 4KV2A 2HJ8A 1E8ZA 4HPMB 2VRRB 5IAAC 1U4AA 5GMVA 5JZEB 1WG7A 3KY9A 5IA7A 2LOZA 2JWZA 1U2BA 3ZNZB 5BO4B 2EC1A 4AJWA 3JVZX 1QQGA 2KLCA 2BGFA 1UZXB 2UVMA 5DPSA 2FDQA 3UF8A 4DXAB 2MBBB 1E8XA 2HD5B 1WGRA 3K9PB 5KQ4A 1EF1A 5LXIB 3AXCA 4W9CA 1Y8RC 5L81A 5GOWB 2RD0A 4B6WA 2KQSA 2O2VB 3SNHA 3CMMB 5AZGA 1OQNA 2H7EA 3KVFB 2O6VD 2RGFA 1NBFC 1LM8B 3OLMD 1UGMA 4W9IA 5D2MB 3HK0A 4ILHA 1WJUA 5DPWA 4HATB 1P6SA 5DH9B 4MK0A 4NJ7A 4WJNA 3AU5A 1V2YA 3ULCA 3GOEA 1F9JA 1WX8A 3ALBA 4MDKE 4KDLB 1GNUA 4HJKA 5G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8S A;  3LJ3 A;  4E71 A;  4NSW A;  1Q1O A;  2HTH A;  2Q13 A;  3APD A;  3DDC B;  1WI0 A;  5CX3 A;  3B1L X;  1X05 A;  3A1Q B;  3VFK A;  2C7N B;  2LVO A;  3CST A;  3W1S C;  1JRU A;  1QC6 A;  3VDZ A;  4BKS D;  5JP4 A;  4HAU B;  2LGD A;  2YRY A;  3RZF A;  1R4M I;  2FUH B;  4HXD A;  4LDT B;  2MRP A;  2BPS A;  2DA0 A;  4DDI D;  4WJP A;  4FAD A;  3ODO A;  2N1W A;  2JUO A;  2N9P C;  4A5K A;  4AOF A;  1XKE A;  2LVP A;  2DHJ A;  3ONS A;  4WWP A;  1K5G B;  1YX6 B;  1KOT A;  1Y5O A;  3DVN U;  3DOW A;  2D07 B;  5C5B B;  4F7Z A;  4AUQ C;  2N4F A;  4KIK A;  2GBN A;  2UZR A;  1E7U A;  2JRH A;  3QAR A;  4KAX B;  3ECI A;  3V5W A;  3RUL A;  2GS0 A;  4MJS B;  2BKF A;  2BWF A;  2YS5 A;  2BYE A;  4I6N B;  3PRZ A;  3ZRC A;  2LAS A;  2YVC A;  2MDX A;  3L13 A;  1J19 A;  2CRF A;  1BT0 A;  4MSM B;  2DAF A;  1Z87 A;  3WA0 A;  2G4D B;  4IWP A;  4KSL C;  1P9D U;  2QKM A;  2G4S A;  2J7Q B;  2ELB A;  2NBU A;  3A8Q A;  1RFA A;  3G9W A;  2UYZ B;  2KOX A;  2ZNV B;  2I5F A;  2XQN M;  4PS7 A;  4ICV A;  1X1M A;  5CHF A;  4ZYN A;  1WJ1 A;  3SDL C;  3MDB C;  1OEY A;  1NTV A;  2O6V A;  1YIW A;  1WGQ A;  5HE1 A;  2COC A;  3H9D A;  4WAA A;  5DIF B;  5CTR C;  2BYF A;  5J3Q A;  2EKE C;  1V5T A;  1KLV A;  1WJ4 A;  2I1J A;  2V4L A;  3ULB A;  2K25 A;  2DX5 B;  4BOZ B;  3S2A A;  1WJM A;  1UBQ A;  2ASQ A;  5J3T A;  4GDK B;  4BVU C;  1WX7 A;  3NSU A;  1UNP A;  3ZLZ A;  1U27 A;  3ZUN A;  2MW5 A;  3WAP A;  2ZNV C;  3AU4 A;  4TUU A;  3M63 B;  3BY4 B;  2AWT A;  4GMV A;  3QBV B;  2K00 A;  2MBQ A;  1WGU A;  4TV3 A;  4W9H A;  2RPQ A;  2NS5 A;  4A6K A;  3PRM B;  3A9J A;  2N23 A;  1E5W A;  3N7C A;  3PHX B;  2YT0 A;  3CF6 E;  4WWN A;  3DVN V;  4K2O A;  2MX2 A;  2LUL A;  4ZDV A;  3KZ1 A;  3AJ4 A;  1WIA A;  1G6J A;  3V6C B;  1U29 A;  1Q5W B;  2KFK A;  2I5C A;  4EZJ A;  2DYM A;  2W2W A;  4PQ0 A;  5FI1 A;  4LJO B;  2IO1 B;  2M0X A;  2RQ1 A;  1WXA A;  1WJ6 A;  3PV1 A;  4PYZ A;  3EC8 A;  3QX1 A;  2IFS A;  4M8M A;  2GBR A;  1OQY A;  3OAW A;  1V9J A;  3H7S A;  1S1Q B;  1P3Q U;  2EMS A;  4IM3 A;  2MP2 A;  4YL8 A;  2KMA A;  4MT7 A;  2LXA A;  2GBK A;  5EFX A;  3ZDM C;  1WM2 A;  3SYX A;  5C79 A;  5JH5 C;  1VD2 A;  4GB9 A;  4IC7 B;  1SGH A;  1UH6 A;  3BIN A;  1XX0 A;  3H1U A;  3NOB A;  2NPT B;  1OEY J;  4FLH A;  4XC2 A;  2Z59 B;  4EZK A;  2D9X A;  1V49 A;  3ZTC A;  4GU2 A;  2D9Z A;  3RD2 A;  2JRI B;  3GYO A;  3PVL A;  3A4S C;  1XCG A;  3Q3J A;  3P2B A;  5LLI A;  3VOQ A;  1MAI A;  1WE7 A;  2LGX A;  3TVV A;  4HAW B;  3QC8 B;  3ML8 A;  3QJZ A;  1WZ3 A;  1MPH A;  3QWM A;  2V3S A;  3KW5 B;  2NMB A;  3UGB B;  3LJU X;  4Z2N A;  1L7Y A;  2UZS A;  4HDQ A;  5J17 A;  1V5O A;  1LFD A;  4A3P A;  3DBL I;  2WX1 A;  2YLM A;  4K17 A;  4XZ4 A;  4YON A;  1P5T A;  1MKE A;  4DHZ B;  2LBB A;  3R3M A;  2ROV A;  3ZO5 B;  2FJL A;  1I2H A;  3HM6 X;  4HK2 A;  4F7G A;  2MWN B;  2G35 A;  3LDZ E;  4IOY X;  4HB2 B;  4RM8 A;  2P0H A;  2DZJ A;  3L08 A;  2LUE A;  1V81 A;  3BJI A;  2M38 A;  2PE6 B;  3VUY A;  2DN6 A;  2K39 A;  3L16 A;  2HRJ A;  1MIX A;  2KC2 A;  1WR1 A;  1BAK A;  4GMX B;  4ZRJ A;  3PVW A;  4ASW C;  4KDI C;  2KFJ A;  4DHZ E;  5DI9 B;  1T0Y A;  4MH0 E;  4HAZ B;  1WGD A;  3ZNI D;  4GIV A;  4B6H A;  4HCN B;  2CU1 A;  4X57 B;  3DXE A;  2D9Y A;  4GSW A;  1YJ1 A;  2K8B A;  4A3O A;  4MEM A;  2FJ9 A;  2IY1 B;  1FOE A;  1ZSQ A;  4HVB A;  1H4R A;  2R2Q A;  1X11 A;  2WYQ A;  1I35 A;  4RMA A;  2KD0 A;  5DHA B;  2CHZ A;  3VXW A;  4HB0 B;  2GBJ A;  3PSC A;  2IO3 B;  3VH4 B;  2AEH A;  3DBH I;  5KHO A;  3W1Y A;  2HE7 A;  1XR0 B;  2LD9 A;  4LDT D;  1P1A A;  3VUX A;  2FCM A;  3A33 B;  1NI2 A;  1FB8 A;  3UIN B;  4K81 A;  3CXB B;  2JPH A;  5AEK B;  2CHX A;  2PPH A;  2N9E B;  2LWP A;  2RUK B;  2KDF B;  3U30 A;  1FHX A;  4G50 A;  2WH5 A;  2VKI A;  3MJW A;  1Y19 B;  3WAN A;  3C0R B;  4EUT A;  4BKG A;  1X1F A;  3SV1 A;  2FIF A;  4ANW A;  1WJN A;  4HDO A;  1V80 A;  2JT4 B;  1BTN A;  3A98 B;  2EJ8 A;  2HTH B;  1K8R B;  2D2Q A;  2L8J A;  2DYQ A;  5HE0 A;  5J18 A;  4NY0 A;  3KRX A;  3OAN A;  4MM3 A;  5CLL B;  3PP2 A;  2M4N A;  4DHJ B;  4W9E A;  1KZ7 A;  4PS3 A;  4MY6 A;  1ZM0 A;  1MG8 A;  2ZJD A;  2R09 A;  2MWS B;  1EGX A;  2Z0Q A;  4WSF A;  1EVH A;  2PE9 A;  3RYT A;  3TFM A;  1WY8 A;  2DFK A;  5LON B;  2A4Z A;  2LRW A;  4TKN A;  2UWQ A;  2DZM A;  3KYC D;  2KTF A;  3ZNH B;  4WVF B;  1WRD B;  2CHW A;  4CHJ A;  1NVL A;  2FCS A;  2L00 B;  4B9K A;  3SD5 A;  5KQ1 A;  3TIX A;  2DTC A;  2MA9 B;  3EHV A;  3D8F A;  4D0N B;  2FNJ B;  4DWF A;  3DPD A;  1HB6 A;  4IUM B;  3U8Z A;  1FGY A;  2VRW B;  1E7V A;  4FA6 A;  3W1S A;  1WF9 A;  1SHC A;  2N7D A;  1WM3 A;  3QAQ A;  1P98 A;  3RCP A;  1DRO A;  4FJV B;  4DK5 A;  1IYF A;  1GUA B;  1LXD A;  4Y94 A;  3OJ4 B;  1WZ0 A;  3T8M A;  2C7M B;  4NAW B;  3TO1 A;  4XX5 A;  3D32 A;  4XWX A;  4K7W A;  5DCN A;  3QA8 A;  5HE3 A;  2DHI A;  1KM7 A;  4FUL A;  2XK5 A;  3A1Q A;  2M17 A;  3P6A A;  4PNK A;  4DBG A;  2KWV B;  3SU8 X;  4A6H A;  3Q3F A;  2Z0D B;  3WAM A;  1WX9 A;  2AL3 A;  4FHK A;  5JLJ B;  4F8C B;  2LZ6 A;  2DYB A;  2OQB A;  4EKU A;  3F5R A;  4M8N A;  2NCN A;  4HB3 B;  2ABD A;  5D3X A;  2RSG A;  3DQV A;  2NBW B;  4EJN A;  3M62 B;  1VCB A;  4GOC A;  3QIJ A;  5C5B A;  4ZRK A;  3L10 B;  2D4Q A;  2KQ7 A;  2IO2 B;  2R0D A;  3T9L A;  2CAY A;  4HAY B;  3JW0 X;  2KK8 A;  3SO6 A;  4CYE A;  4P7I A;  1U5F A;  2Y8F A;  4DDG D;  1GC7 A;  3SHQ A;  1V5P A;  2RR9 A;  2J0K A;  5DHF B;  4KHB B;  4MJS A;  3VQI A;  1OTR B;  1K5D B;  2DKP A;  4WJ7 A;  4W9L A;  3A9J B;  4E74 A;  2BF8 B;  4IM0 A;  4TYZ A;  3GZN I;  4NPN A;  4ANU A;  2Z0O A;  4GZU A;  4HAX B;  4F1S A;  1OY2 A;  1WVH A;  2LYD A;  2IBI B;  3TMP B;  3U7D A;  4EOY A;  5G2N A;  2JZZ A;  4W9D A;  3ZW3 A;  2KX0 A;  1ZC4 B;  5C16 A;  1J0G A;  1UPQ A;  1FGZ A;  3O96 A;  2KMC A;  3WAL A;  1YX5 B;  2DX5 A;  4ZRI A;  4IWQ A;  1AAR A;  2IO0 B;  4BKS A;  1P3R A;  1V61 A;  2J59 M;  4K2P A;  2MP2 B;  1WXS A;  3ML9 A;  2JY6 A;  3UQA A;  3PPA A;  4GDK A;  2NVU I;  2WX0 A;  2L76 A;  1FXT B;  4CO7 A;  1FHO A;  2C5L C;  2MKR A;  3QWZ B;  4GDL B;  3VIA A;  2CB8 A;  2IZV B;  1Z5S B;  1UNR A;  1PMS A;  4NNJ B;  4KVG B;  4PS8 A;  1V5M A;  3ZKJ C;  4Z2M B;  2NBV B;  5CHW A;  2KKC A;  3PGE A;  4G0N B;  2OTX A;  3JSV B;  3SUZ A;  1PQS A;  5D3W A;  2DYO A;  1BWN A;  2YS3 A;  4G3X B;  2KJH B;  2C60 A;  4BBN C;  3FLV A;  4TQ0 A;  2NZ8 B;  4HCP B;  1CMX B;  2GCJ A;  5FI0 A;  2KZR A;  4DX9 0;  4MGK E;  1QZE A;  1XQQ A;  2KAN A;  4HHV A;  2KDI A;  2Y5B B;  4E3C A;  3A9K A;  1PLS A;  1RJ2 A;  3N32 A;  3D8E A;  3B08 A;  2FCN A;  2ZCB A;  5AZF A;  3H7P B;  1GJZ A;  3ZVR A;  4W9K A;  2MCN B;  1ZW7 A;  3KSY A;  3UIP B;  1YD8 U;  1TGZ B;  4II3 B;  1XD4 A;  3DVG X;  2LKO A;  1EAZ A;  2RNR B;  3PRP B;  1UD7 A;  4ICU A;  5TR5 A;  5C6R A;  4A6F B;  4MSQ B;  2KN5 A;  5E6N A;  3DXC A;  2XEW A;  2KVR A;  4EFO A;  4N9F 4;  2CS4 A;  2QHO A;  2KGX B;  1H10 A;  1WR6 E;  1NDD A;  5JHB A;  3EFU A;  3L0W B;  2DYN A;  2D9V A;  4FJY A;  3FSS A;  2MSE D;  3ZIM A;  1NTI A;  1WGG A;  4PYU A;  3DCG A;  1LQB A;  1MIZ B;  1ACA A;  2P0F A;  1U5G A;  2PJH A;  4KZ0 A;  3DBR I;  1WMH B;  2K6Q A;  4MGZ E;  2LOX A;  2LGY A;  1UNQ A;  3TBL D;  4GN1 A;  4BBN F;  4DHJ D;  2FCQ A;  2DHK A;  3IHP C;  2G45 B;  2COF A;  3PLV A;  2BYV E;  2PEA A;  2VSZ A;  2KNB A;  1Z2M A;  4AJY B;  2L0F A;  2LG1 A;  2RLO A;  1EUV B;  2RGN B;  3TCA A;  2C7H A;  2Y8G A;  1TQZ A;  1PFJ A;  1U5E A;  3ENE A;  3NS8 A;  3M1I B;  1IP9 A;  1MK7 B;  2Z0P A;  3A8P A;  5KCV A;  1EF5 A;  4I6L B;  2QKL A;  2Y7B A;  5L95 C;  3PTF C;  2MBH A;  3CSF A;  4HB4 B;  4F7H A;  1WFY A;  2GOW A;  2IYB A;  2XBB C;  2D9W A;  2ELA A;  2KJ6 A;  3IG3 A;  4II2 B;  2CKH B;  4EMO A;  3RCZ A;  1UBI A;  5D94 A;  3UIO B;  3N30 A;  3O65 B;  3TJP A;  2L3Z A;  2KTR A;  3MPX A;  2KHW B;  4K7U A;  2NR2 A;  3AI5 A;  4EZL A;  3TL5 A;  1NU2 A;  2W2X C;  3F0W A;  2E2X A;  4CHK A;  5J2R A;  5HE2 A;  1WGY A;  2MBO A;  1M94 A;  5D27 A;  3VH3 B;  2JF5 A;  2GCL A;  3HQC A;  2N0Y A;  3IBE A;  1V89 A;  2L2I A;  4BFR A;  1E8W A;  2M1M A;  3PSE B;  1D3Z A;  2KJR A;  4IFS A;  2EMT A;  3VTV A;  4KHO A;  1GG3 A;  5D3V A;  5EDS A;  1DDW A;  4DX8 A;  5DPT A;  1RRP B;  3IVF A;  2YF0 A;  1DDV A;  3OJ3 A;  1HB8 A;  2KXJ A;  1LB1 A;  3FP5 A;  1AWE A;  2YS1 A;  2K8H A;  2IY0 B;  2OOB B;  3PEG A;  3WIM A;  1FHW A;  1OGW A;  1WH3 A;  3PT2 B;  2GJY A;  1ZKH A;  2O2V A;  2W9N A;  3ZDT A;  1FAO A;  3UQB A;  3ZNG C;  2WDT B;  2ZEQ A;  1HBK A;  4KSK C;  3V62 A;  3TW1 A;  2DX1 A;  2N9X A;  3PVU A;  2H7D A;  2Z0E B;  2AL6 A;  2R2O A;  3MHS D;  1YQB A;  2BWE S;  4MGY E;  3QHT A;  1ZVR A;  5FR6 A;  2CQU A;  3KUC B;  2REX A;  4FN2 A;  4OVU A;  2ZVO A;  2RSU A;  1XOD A;  2CY4 A;  1C1Y B;  2XK5 B;  2L1C A;  1E90 A;  2GBM A;  3X23 A;  4NQK E;  2D10 A;  4KIK B;  3V60 A;  5JHG A;  3A4R A;  1WGH A;  2N7E A;  4L6E A;  1EO6 A;  2FAZ A;  1Q67 A;  3HIZ A;  3VAW A;  2K8C A;  4ANV A;  2IYD B;  3DXD A;  4KZC A;  3M95 A;  3RT3 B;  4FHJ A;  2ZPY A;  1RAX A;  2WWZ A;  4BOS C;  1V88 A;  2DZI A;  4J6I A;  3PG7 A;  1IRS A;  4IG7 B;  4NJ6 A;  4JL9 A;  1SE9 A;  1W1D A;  1AQC A;  1LW3 A;  3VHT C;  4K1R B;  2ZPN A;  2J0J A;  3KRW A;  4I6P A;  5DPR A;  1NTY A;  5CLQ B;  4HPL B;  1BTK A;  1W1G A;  2X18 A;  2L05 A;  3APF A;  1C3T A;  2O6V B;  3ZVV A;  2COA A;  2OJR A;  4IW0 A;  2ZCC A;  4NAW A;  2KLG A;  4B95 A;  4BBK A;  2L0T A;  3HM3 A;  3NY5 A;  2KC1 A;  1WE6 A;  1V5U A;  4KHA A;  3KH0 A;  1UPR A;  1B55 A;  2I1K A;  4HAV B;  5D3Y A;  4IM2 A;  2MQJ A;  1TXD A;  2AYO B;  2YSZ A;  1KJT A;  4BKT A;  2K1F A;  4HLE A;  4A20 A;  3K9O B;  1E8Y A;  4WQO B;  2KCJ A;  2KWU B;  3FEH A;  4GPT B;  1L2N A;  1SIF A;  1ZGU B;  5D6J B;  1TTN A;  3R7R A;  4NQL B;  3VUW A;  1HE8 A;  3H6N A;  4JGH B;  2D3G A;  4GGQ A;  2JXX A;  4JQW C;  3MTN B;  4GXB A;  3T06 A;  1KZG A;  4M0W B;  1ST7 A;  3X0W A;  2GMI C;  2COP A;  2KFK B;  3ODW A;  3KYD D;  4G11 A;  2K6D B;  1TZ1 A;  1MK9 B;  2LRU A;  1I42 A;  2A5U A;  2ROZ B;  3PZD A;  3FM8 C;  1IPG A;  1Q0W B;  5C23 A;  5E6P A;  5LOP B;  1OMW A;  5J3Y A;  1H8C A;  4C0A A;  2DHZ A;  4DBB A;  2MFQ A;  1V86 A;  4WJQ A;  4F7U P;  2ZZP B;  2PZ1 A;  3ML4 A;  1XD3 B;  1GC6 A;  3CIK A;  5CHV C;  1TJ6 A;  1UEF A;  2RVB B;  1UEL A;  2P0D A;  3V6E B;  1DBH A;  5KHQ A;  1XT9 B;  2BCJ A;  2CY5 A;  3PRE A;  5LXH A;  3KUZ A;  3VTW A;  4H8S A;  2BKR B;  3R7Q A;  5JHA A;  3IFW B;  1ZC3 B;  5D7G A;  4W9J A;  3A9K B;  3I3T B;  1KI1 B;  5IJM A;  2W2X D;  3NZS A;  3ZTD A;  1X86 A;  3KUD B;  3PLU A;  1DDM A;  2KDE B;  4WWO A;  4MGI E;  1A5R A;  3QCA A;  3PHW B;  2ZVN A;  4W9F A;  2YT1 A;  2FID A;  5JHH A;  1I7A A;  2K2J A;  3GYP A;  4URK A;  5E6O A;  4GDL A;  2DZK A;  2M14 A;  3HHM A;  3DVG Y;  4WJO A;  2KWC A;  2KO3 A;  3VTU A;  3UZT A;  4ANX A;  3N3K B;  3JSV A;  2JVC A;  2DEN B;  4IAP A;  3RUI B;  4LJP B;  5HKH A;  3JYU A;  4AP4 C;  1J0W A;  3NHE B;  1X1G A;  3D8D A;  4JIO U;  2G3Q B;  3EEC A;  4FBJ B;  2NPT A;  3PS6 A;  1M7E A;  3WAO A;  2COD A;  2N1V A;  2KDB A;  4AWJ A;  4OVV A;  3R66 C;  2DKQ A;  4EEW A;  3HW2 B;  3L17 A;  2MBE A;  1ISN A;  2LJ5 A;  3H7P A;  1WYW B;  1M7R A;  3APC A;  1P0R A;  1WXV A;  2C9W B;  3V61 A;  3EPY A;  4HWI B;  1WI1 A;  5L83 A;  1N3H A;  1TBE A;  1WXM A;  1RLF A;  2ADZ A;  3AUL A;  2MLB A;  2J0M A;  4A6F A;  2KX3 A;  4JLC A;  1DYN A;  1S3S G;  1U5D A;  2JP2 A;  2DAJ A;  3L54 A;  3RZW C;  3P7Z A;  4IWO A;  5C1Z A;  4LCD E;  2KTR B;  2LI5 A;  1R4N I;  5AZH A;  2KUP A;  2LXC A;  4K7S A;  3M3J A;  2V1Y A;  3ODX A;  3VVW B;  3WYF B;  2LVQ A;  2DLW A;  2CR5 A;  3ZRF A;  2K2U A;  1RRB A;  1WMH A;  3NZU A;  1W1H A;  2P8V A;  2B3A A;  3B0A A;  4FJZ A;  2V76 A;  1V6E A;  3QQ8 B;  4MEL A;  4TQ1 A;  1J8C A;  4CHM A;  2D11 A;  3QK0 A;  2JZ3 B;  4W9G A;  2L7R A;  4RM9 A;  3DBS A;  4KV2 A;  2HJ8 A;  1E8Z A;  4HPM B;  2VRR B;  5IAA C;  1U4A A;  5GMV A;  5JZE B;  1WG7 A;  3KY9 A;  5IA7 A;  2LOZ A;  2JWZ A;  1U2B A;  3ZNZ B;  5BO4 B;  2EC1 A;  4AJW A;  3JVZ X;  1QQG A;  2KLC A;  2BGF A;  1UZX B;  2UVM A;  5DPS A;  2FDQ A;  3UF8 A;  4DXA B;  2MBB B;  1E8X A;  2HD5 B;  1WGR A;  3K9P B;  5KQ4 A;  1EF1 A;  5LXI B;  3AXC A;  4W9C A;  1Y8R C;  5L81 A;  5GOW B;  2RD0 A;  4B6W A;  2KQS A;  2O2V B;  3SNH A;  3CMM B;  5AZG A;  1OQN A;  2H7E A;  3KVF B;  2O6V D;  2RGF A;  1NBF C;  1LM8 B;  3OLM D;  1UGM A;  4W9I A;  5D2M B;  3HK0 A;  1WJU A;  5DPW A;  4HAT B;  1P6S A;  5DH9 B;  4MK0 A;  4NJ7 A;  4WJN A;  3AU5 A;  1V2Y A;  3ULC A;  3GOE A;  1F9J A;  1WX8 A;  3ALB A;  4MDK E;  4KDL B;  1GNU A;  4HJK A;  5G55 A; 
#chains in the Genus database with same CATH topology
 2M8S A;  3LJ3 A;  4E71 A;  4NSW A;  2AQ1 B;  1Q1O A;  4OZA A;  5D3D A;  4D6W A;  2HTH A;  4NZL B;  2YEP B;  1QF6 A;  2Q13 A;  3APD A;  3E56 A;  3DDC B;  4RH6 A;  2VH2 A;  3R2T A;  1WI0 A;  5CX3 A;  3B1L X;  4BAX A;  1RM6 C;  3MC0 B;  1WGK A;  1X05 A;  3A1Q B;  2J53 A;  3TUO A;  3VFK A;  2C7N B;  2LVO A;  3CST A;  1CQV A;  3W1S C;  1JRU A;  1ZYI A;  3W9C B;  1QC6 A;  3VDZ A;  3I9V 1;  4BKS D;  5JP4 A;  4HAU B;  1TJE A;  2LGD A;  3UI3 A;  2YRY A;  1C79 A;  1JRP A;  3RZF A;  1JWA D;  1R4M I;  2FUH B;  4HXD A;  4LDT B;  2MEK A;  2MRP A;  2BPS A;  2DA0 A;  4DDI D;  4WJP A;  4FAD A;  3ODO A;  2N1W A;  2JUO A;  2N9P C;  2KWD A;  2ON8 A;  4A5K A;  4PK1 A;  4AOF A;  1XKE A;  3VRB B;  3C19 A;  2LVP A;  2DHJ A;  3ONS A;  1SF0 A;  1I4G A;  4PT5 A;  4WWP A;  1KLU D;  2WXR A;  1KLG D;  1K5G B;  1YX6 B;  2K22 A;  1KOT A;  1Y5O A;  3DVN U;  4A55 A;  3DOW A;  1SJH D;  2MJ3 A;  2D07 B;  5C5B B;  1DYQ A;  2AQ3 B;  4AUQ C;  4F7Z A;  1JQ4 A;  2EKI A;  1FFU A;  2N4F A;  4KIK A;  2GBN A;  2UZR A;  1E7U A;  1ZUD 2;  2JQR B;  3C8Y A;  2JRH A;  3QAR A;  1GGO A;  4KAX B;  3ECI A;  3V5W A;  3RUL A;  2GS0 A;  4P1C C;  2PMV A;  4MJS B;  2ICI A;  2SAK A;  2BKF A;  2BWF A;  2YS5 A;  2BYE A;  4I6N B;  3PRZ A;  1SE4 A;  3ZRC A;  2LAS A;  2YVC A;  2MDX A;  1ZXI A;  3L13 A;  4ARI A;  1J19 A;  2CRF A;  4QXA B;  1BT0 A;  1HZ6 A;  4MSM B;  1TS3 A;  2GLS A;  2DAF A;  1Z87 A;  3WA0 A;  2QJL A;  2G4D B;  4IWP A;  1I4Q A;  4KSL C;  1P9D U;  2QKM A;  2G4S A;  2J7Q B;  2ELB A;  2NBU A;  3A8Q A;  1RFA A;  3G9W A;  4TMA B;  2UYZ B;  2KOX A;  2ZNV B;  1JCK B;  1V1P B;  2I5F A;  2I2Y A;  2XQN M;  4PS7 A;  4ICV A;  2MJE A;  1X1M A;  5CHF A;  4ZYN A;  1WJ1 A;  3SDL C;  3MDB C;  1DOI A;  1OEY A;  2WDV B;  4DXG A;  1NTV A;  2BS4 B;  2O6V A;  3BYT B;  4QJ4 B;  1YIW A;  1WGQ A;  3U52 E;  5HE1 A;  1KH0 A;  2COC A;  3H9D A;  4WAA A;  1TZO A;  3AMZ A;  5DIF B;  5CTR C;  1OFF A;  2BYF A;  5J3Q A;  2EKE C;  1V5T A;  1KLV A;  4ACF A;  1WJ4 A;  2YEP F;  3NUH B;  2I1J A;  2V4L A;  4JK7 A;  3ULB A;  2K25 A;  2DX5 B;  4BOZ B;  5BYS A;  3S2A A;  1WJM A;  1UBQ A;  2ASQ A;  5J3T A;  3VRA B;  4GDK B;  4BVU C;  4ZHO A;  1WX7 A;  3NSU A;  2QDF A;  1UNP A;  3ZLZ A;  1U27 A;  4GLS C;  3ZUN A;  3U2S C;  2MW5 A;  2RPV A;  3WAP A;  2ZNV C;  3AU4 A;  4TUU A;  1F2R C;  3M63 B;  1YN3 A;  3BY4 B;  2AWT A;  4GMV A;  4KX6 B;  3QBV B;  2K00 A;  2V9H A;  4KHB A;  1GOZ A;  3AM9 A;  2MBQ A;  2KUQ A;  1VZ6 A;  1WGU A;  2JX5 A;  4TV3 A;  1JRO A;  2TSS A;  4W9H A;  2RPQ A;  2NS5 A;  1B1Z A;  4A6K A;  2VZK B;  3PRM B;  1RWS A;  3A9J A;  3LXF A;  2N23 A;  2PW9 A;  1E5W A;  2PLP A;  1MVK A;  2R2Y A;  3N7C A;  2E6X A;  3PHX B;  2YT0 A;  3RFZ B;  3CF6 E;  3GB1 A;  4WWN A;  3DVN V;  2CU3 A;  4K2O A;  1SSN A;  2MX2 A;  2LUL A;  4ZDV A;  3KZ1 A;  3AJ4 A;  3I63 C;  1WIA A;  3RNA C;  1G6J A;  4M0W A;  3IT4 B;  3V6C B;  1U29 A;  1Q5W B;  4M00 A;  2KFK A;  2I5C A;  4EZJ A;  2DYM A;  1XF5 L;  2W2W A;  4PQ0 A;  2BB6 A;  5FI1 A;  1F1H A;  3HVD A;  4LJO B;  3ETR A;  3NVY A;  2IO1 B;  2M0X A;  2RQ1 A;  1T3Q A;  1WXA A;  2M0A A;  1WJ6 A;  3PV1 A;  4PYZ A;  3EC8 A;  1N5W A;  3QX1 A;  5BYR A;  2IFS A;  4M8M A;  2GBR A;  1OQY A;  3OAW A;  1V9J A;  3H7S A;  3FVC A;  1S1Q B;  1P3Q U;  2LGS A;  2EMS A;  1WXQ A;  3U7Z A;  4IM3 A;  2MP2 A;  4YL8 A;  3AE2 B;  2KMA A;  5HG2 A;  4MT7 A;  2LXA A;  2GBK A;  5IRS A;  4JKE A;  4K3C A;  2W3S A;  5EFX A;  3ZDM C;  3ZGZ A;  1WM2 A;  3Q3N C;  3SYX A;  5C79 A;  4LK0 M;  5JH5 C;  1K50 A;  1VD2 A;  4GB9 A;  4WAF A;  4C4V A;  4IC7 B;  3NVW A;  2LHE A;  1SGH A;  3MP9 A;  1UH6 A;  3BIN A;  1XX0 A;  1TYG B;  4OZB A;  1HTO A;  3H1U A;  3NOB A;  1CZP A;  2NPT B;  1OEY J;  4WH4 A;  1SB3 C;  4FLH A;  4JKH A;  4XC2 A;  2Z59 B;  4EZK A;  2D9X A;  1V49 A;  2J42 A;  1EWY C;  1DIK A;  3ZTC A;  4GU2 A;  2BYT A;  2D9Z A;  3RD2 A;  1FM0 D;  2JRI B;  1QKZ A;  3GYO A;  3PVL A;  3A4S C;  1XCG A;  2KVZ A;  3Q3J A;  3P2B A;  5LLI A;  3VOQ A;  1NEN B;  1MAI A;  4NJC A;  1UNS A;  3E9P A;  1WE7 A;  2LGX A;  3AEB B;  5IN7 A;  4C00 A;  2KAJ A;  3TVV A;  4HAW B;  3QC8 B;  3ML8 A;  1GPX A;  3SBT A;  3QJZ A;  5GXG B;  1EU3 A;  1MPH A;  4ILJ A;  1WZ3 A;  3P4Q B;  3DWG C;  3QWM A;  2V3S A;  3KW5 B;  2NMB A;  3UGB B;  3LJU X;  4Z2N A;  2KMM A;  1L7Y A;  4RF0 A;  2UZS A;  4HDQ A;  5J17 A;  1MI0 A;  1V5O A;  1LFD A;  3IAS 1;  2OED A;  4A3P A;  3DBL I;  2WX1 A;  2YLM A;  1JDE A;  4K17 A;  4XZ4 A;  2XN9 C;  1TY0 A;  4YON A;  1WWT A;  2WS3 B;  4MH8 A;  1P5T A;  1YJI A;  1MKE A;  4DHZ B;  4KGS A;  2LBB A;  3AEE B;  3R3M A;  3AV8 A;  4JX1 C;  5I2M A;  4HRO A;  3NZ3 A;  2ROV A;  4XDC A;  3ZO5 B;  2FJL A;  1I2H A;  3HM6 X;  4HK2 A;  4F7G A;  2MWN B;  2G35 A;  3LDZ E;  4IOY X;  3BII D;  3VR8 B;  2HTM E;  1E7P B;  4HB2 B;  4RM8 A;  1K53 A;  2P0H A;  2DZJ A;  3L08 A;  2LUE A;  2BTE A;  1V81 A;  3BJI A;  2M38 A;  2PE6 B;  4L1R A;  3VUY A;  2DN6 A;  3BVM A;  2K39 A;  4MT5 A;  2K0P A;  2K9X A;  3L16 A;  2HRJ A;  2G9H D;  1MIX A;  2KC2 A;  3EUB 2;  5G5H A;  2YT2 A;  1WR1 A;  1BAK A;  4GMX B;  1PGB A;  4ZRJ A;  3PVW A;  2JZP A;  4ASW C;  2WXH A;  3OHM B;  4KDI C;  5I2S A;  4JE3 B;  2BS3 B;  3W5U B;  2KFJ A;  3Q6B A;  4DHZ E;  3NG0 A;  5DI9 B;  1T0Y A;  4MH0 E;  2QCZ A;  3BZD B;  4HAZ B;  1WGD A;  1N63 A;  3B77 A;  1Y56 A;  4GIV A;  3ZNI D;  4B6H A;  2Y5P A;  2CU1 A;  4HCN B;  3IAM 1;  1ROE A;  4X57 B;  3DXE A;  2D9Y A;  2WQY B;  1YJ1 A;  2HDE A;  2K8B A;  4GSW A;  4A3O A;  4WQM A;  4MEM A;  2FJ9 A;  5EE0 A;  5TSS A;  2IY1 B;  4YTM B;  1FOE A;  1ZSQ A;  1FNU A;  4HVB A;  2LHD A;  1H4R A;  2R2Q A;  1X11 A;  2WYQ A;  1I35 A;  4RMA A;  4K3B A;  4LTU A;  2KD0 A;  5DHA B;  2CHZ A;  3VXW A;  4HB0 B;  2GBJ A;  3PSC A;  2IO3 B;  3VH4 B;  1GB4 A;  2AEH A;  3DBH I;  2WU5 B;  4RNA A;  5KHO A;  3W1Y A;  2HE7 A;  1XR0 B;  2LD9 A;  1QOG A;  4LDT D;  3RNC C;  1XXG A;  2X8X X;  1P1A A;  3OWE B;  3VUX A;  2FCM A;  3A33 B;  1NI2 A;  1FB8 A;  3UIN B;  1QOA A;  4K81 A;  4EE2 A;  3MC9 A;  3CXB B;  2JPH A;  5MPO A;  5AEK B;  2CHX A;  4JK8 A;  2PPH A;  1PGA A;  2N9E B;  3ZXR A;  2LWP A;  2RUK B;  2WU2 B;  4XYC A;  2KDF B;  3U30 A;  1FHX A;  4RCO A;  4G50 A;  2WH5 A;  1N62 A;  2VKI A;  3MJW A;  1Y19 B;  3WAN A;  3C0R B;  3NJT A;  4EUT A;  4BKG A;  4JKD A;  1X1F A;  1TKG A;  4HSI A;  3SV1 A;  2FIF A;  4HJG E;  1Q10 A;  4ANW A;  1WJN A;  4HDO A;  1YQ3 B;  1V80 A;  2JT4 B;  2K49 A;  1BTN A;  3HIE A;  3A98 B;  2EJ8 A;  2HTH B;  1K8R B;  2D2Q A;  2L8J A;  2DYQ A;  5HE0 A;  3NWA A;  1T0R C;  5J18 A;  4NY0 A;  1PYW D;  1C9F A;  3KRX A;  3OAN A;  2KIE A;  4MM3 A;  5CLL B;  2V3N A;  3PP2 A;  2M4N A;  4DHJ B;  4W9E A;  3R2I A;  1KZ7 A;  4PS3 A;  4P16 A;  3LYY A;  4MY6 A;  1ZM0 A;  1MG8 A;  2ZJD A;  2R09 A;  2MWS B;  1EGX A;  3AE1 B;  3AEF B;  2Z0Q A;  3P63 A;  5D3I B;  1I7H A;  4WSF A;  1EVH A;  2PE9 A;  3RYT A;  3TFM A;  1WY8 A;  2DFK A;  5LON B;  2A4Z A;  1R4N B;  2LRW A;  2W3R A;  4TKN A;  3GE3 C;  2UWQ A;  3V3X A;  5BMH A;  3EGR A;  2DZM A;  1WRI A;  4YSY B;  2FJU B;  3KYC D;  1YJJ A;  2KTF A;  3ZNH B;  4WVF B;  1WRD B;  2CHW A;  4CHJ A;  1NVL A;  2FCS A;  2L00 B;  2RRF A;  4B9K A;  3SD5 A;  5KQ1 A;  2E3T A;  3TIX A;  2DTC A;  2MA9 B;  3EHV A;  4OT1 A;  3D8F A;  4D0N B;  2FNJ B;  3HSA A;  4DWF A;  3DPD A;  1HB6 A;  4IUM B;  3PO0 A;  3W2D A;  2BQQ A;  4JKB A;  3U8Z A;  1FGY A;  4C80 A;  4JKF A;  3RNG C;  2VRW B;  2WXJ A;  1E7V A;  4FA6 A;  1F77 A;  3W1S A;  1WF9 A;  1SHC A;  1GB1 A;  2LGI A;  2N7D A;  1WM3 A;  3QAQ A;  1P98 A;  3RCP A;  1DRO A;  4FJV B;  3Q8A A;  3AE5 B;  4ARC A;  1RYJ A;  4YWG G;  1AW7 A;  4YTP B;  4DK5 A;  1IYF A;  3ZQ4 A;  1GUA B;  1LXD A;  4Y94 A;  3OJ4 B;  1WZ0 A;  1TS5 A;  3T8M A;  2C7M B;  2WXI A;  4NAW B;  3TO1 A;  2WLB A;  4XX5 A;  2LFI A;  2UU7 A;  3D32 A;  4AQ7 A;  3HVZ A;  4XWX A;  4K7W A;  5DCN A;  1KRH A;  2VZK D;  3QA8 A;  1I4H A;  1D5M C;  1YQ4 B;  5HE3 A;  2DHI A;  1KM7 A;  4FUL A;  2XK5 A;  3A1Q A;  5C3J B;  2M17 A;  3P6A A;  4PNK A;  4DBG A;  2KWV B;  3SU8 X;  3DHH C;  4A6H A;  2L1A A;  3Q3F A;  1FNV A;  2Z0D B;  3GS2 A;  1ZDV A;  4USA A;  3WAM A;  1WX9 A;  3TEZ A;  2AL3 A;  2ACZ B;  4FHK A;  3KLS X;  2QC8 A;  4JPS A;  2GUM A;  5JLJ B;  4F8C B;  2LZ6 A;  4RGT A;  2DYB A;  2OQB A;  4EKU A;  3AH7 A;  3F5R A;  4M8N A;  2NCN A;  2W82 A;  2HJ1 A;  3E66 A;  2BW2 A;  4HB3 B;  4A8X C;  2MHJ A;  2ABD A;  3KWL A;  1B9R A;  5D3X A;  3AN1 A;  2RSG A;  1T0Q C;  3DQV A;  1PDX A;  2NBW B;  1TKY A;  4IKG A;  4EJN A;  1VR9 A;  3M62 B;  1VCB A;  1PUT A;  2KQ4 X;  2NTS A;  2V3P A;  4GOC A;  3ZJU A;  3QIJ A;  5C5B A;  4ZRK A;  4JKA A;  1ET6 A;  3L10 B;  2D4Q A;  2KQ7 A;  4XE0 A;  2IO2 B;  3WCQ A;  2R0D A;  3MC8 A;  3T9L A;  2CAY A;  2IPK D;  4HAY B;  3N1X C;  3JW0 X;  1I4P A;  2KK8 A;  3SO6 A;  4CYE A;  4P7I A;  1U5F A;  2Y8F A;  1VJK A;  4DDG D;  4GNK B;  1YN4 A;  1GC7 A;  2WXG A;  3SHQ A;  1V5P A;  2RR9 A;  3I5J C;  2J0K A;  1CK1 A;  3R8B A;  5DHF B;  4KHB B;  4MJS A;  3VQI A;  4ZOH C;  1OTR B;  1K5D B;  1C76 A;  1CJE A;  3AEG B;  2DKP A;  4WJ7 A;  4W9L A;  1QOF A;  1KTK A;  3A9J B;  3GE8 C;  3FIL B;  3TSS A;  4E74 A;  2BF8 B;  4P1B C;  1F52 A;  4IM0 A;  4TYZ A;  3GZN I;  4NPN A;  2DWQ A;  4ANU A;  2Z0O A;  4GZU A;  4HAX B;  2DIK A;  2IGH A;  4F1S A;  2KIG A;  1OY2 A;  1WVH A;  3Q8F A;  2LYD A;  2IBI B;  3TMP B;  4QJ5 B;  1R4M B;  2ZKM X;  3U7D A;  4ZRP A;  4EOY A;  5G2N A;  2JZZ A;  5BMI A;  4W9D A;  3T3N A;  2IJ0 A;  2CJN A;  3ZW3 A;  1ACC A;  2KX0 A;  1ZC4 B;  5C16 A;  1J0G A;  1UPQ A;  1FGZ A;  4WUR A;  3E9L A;  3O96 A;  2KMC A;  3MFG A;  4XWT A;  3WAL A;  3AEA B;  1YX5 B;  4N59 A;  2DX5 A;  4ZRI A;  4IOI E;  4IWQ A;  3NWF A;  2IO0 B;  1AAR A;  4BKS A;  1P3R A;  1F0Z A;  1V61 A;  2J59 M;  4K2P A;  2MP2 B;  1WXS A;  4A90 A;  2KR0 A;  1EWC A;  1A70 A;  3ML9 A;  2JY6 A;  3UQA A;  3PPA A;  1ZXH A;  4GDK A;  3DCX A;  2NVU I;  2WX0 A;  2L76 A;  3BYY B;  1FXT B;  2L32 A;  4CO7 A;  1FHO A;  2C5L C;  2MKR A;  2INN E;  4LNK A;  3QWZ B;  2WP9 B;  4GDL B;  3VIA A;  2PIA A;  2CB8 A;  2JU6 X;  4JKG B;  2IZV B;  1Z5S B;  1UNR A;  2GB1 A;  1PMS A;  1YN5 A;  3SEB A;  4NNJ B;  4KVG B;  2QMT A;  4PS8 A;  1V5M A;  3ZKJ C;  4Z2M B;  2NBV B;  3AE7 B;  5CHW A;  4JK9 A;  2KKC A;  1VRA B;  3PGE A;  4G0N B;  2OTX A;  3JSV B;  1L0X B;  3SUZ A;  1XEE A;  1PQS A;  2KAC A;  5D3W A;  1UGJ A;  2DYO A;  3DWM A;  1BWN A;  1R7S A;  4R3D A;  2YS3 A;  1UUP A;  4G3X B;  2KJH B;  2C60 A;  4US8 A;  1FCL A;  4BBN C;  2L83 A;  3NWD A;  4YSZ B;  3FLV A;  4TQ0 A;  2JXT A;  2RMM A;  2WXP A;  2NZ8 B;  4HKQ A;  3TEY A;  4HCP B;  1CMX B;  1YOV B;  2GCJ A;  3E9O A;  5FI0 A;  1XLN A;  2KZR A;  4DX9 0;  4MGK E;  1VDV A;  5T8I A;  3GP7 A;  1QZE A;  1XQQ A;  2KAN A;  2WGS A;  4HHV A;  1HZ5 A;  2KDI A;  2Y5B B;  4HRS A;  4E3C A;  3A9K A;  1PLS A;  1RJ2 A;  3N32 A;  3D8E A;  3B08 A;  2D3B A;  2RDB C;  2FCN A;  5H8Y E;  3MHZ A;  1SIJ A;  2ZCB A;  5AZF A;  1ZOY B;  2BS2 B;  1IBX B;  3H7P B;  1GJZ A;  3IT6 B;  1SE3 A;  3ZVR A;  4W9K A;  2MCN B;  4C56 C;  5BYQ A;  1ZW7 A;  3KSY A;  1N6Z A;  3UIP B;  4WIP A;  3P1M A;  3NS1 A;  1YD8 U;  1TGZ B;  2Z14 A;  4II3 B;  1XD4 A;  3DVG X;  2LKO A;  1EAZ A;  2RNR B;  2XNA C;  3PRP B;  1UD7 A;  1JAL A;  4ICU A;  5TR5 A;  5C6R A;  2AQ2 B;  4A6F B;  4MSQ B;  1K51 A;  2KN5 A;  5E6N A;  3DXC A;  2XEW A;  4YTN B;  4CSQ A;  5HI1 A;  2KVR A;  4YXD B;  4ZHP A;  2KT7 A;  4EFO A;  4N9F 4;  1L4Z B;  2CS4 A;  2ZW0 A;  1T6B X;  2H89 B;  2QHO A;  3P4P B;  2Z59 A;  2KGX B;  1H10 A;  1WR6 E;  3BWU D;  4B0E A;  1I4R A;  1NDD A;  5JHB A;  1QIL A;  3EFU A;  3L0W B;  2DYN A;  2KDM A;  1VZ7 A;  2D9V A;  4FJY A;  3FSS A;  1D5Z C;  2MSE D;  4KGR A;  3ZIM A;  1NTI A;  3Q2A C;  1FMA D;  1SBB B;  1WGG A;  4PYU A;  5LG4 B;  3DCG A;  3T3O A;  1LQB A;  1MIZ B;  1VBG A;  1ACA A;  2P0F A;  1U5G A;  2PJH A;  1L6V A;  4KZ0 A;  3DBR I;  1IUE A;  2M56 B;  1FRD A;  3ZXV A;  1WMH B;  4LNN A;  2K6Q A;  2GRI A;  1SEB D;  4MGZ E;  3NRZ A;  1TY2 A;  2LOX A;  3EFC A;  2Y3A A;  2LGY A;  1UNQ A;  3TBL D;  4GN1 A;  4BBN F;  3RN9 C;  4DHJ D;  2FCQ A;  2DHK A;  3IHP C;  2G45 B;  1UWX A;  2COF A;  3PLV A;  2BYV E;  2PEA A;  2VSZ A;  1HXY D;  2KNB A;  2BVC A;  3RPF C;  1Z2M A;  4AJY B;  2L0F A;  1VLB A;  2LG1 A;  1OQR A;  2RLO A;  4RGM A;  1EUV B;  3PZ8 A;  2DBY A;  2RGN B;  3TCA A;  2C7H A;  2Y8G A;  5FKA C;  1TQZ A;  1ZE3 D;  1PFJ A;  4RFB A;  1U5E A;  3ENE A;  3NS8 A;  3M1I B;  2QEJ C;  3N1Z C;  1IP9 A;  1DOX A;  1MK7 B;  2Z0P A;  3A8P A;  5KCV A;  1EF5 A;  4I6L B;  2QKL A;  4M02 A;  2Y7B A;  4DQO C;  2J4X A;  5L95 C;  3PTF C;  2MBH A;  3CSF A;  2K5P A;  4TSS A;  4HB4 B;  4F7H A;  2IND C;  1WFY A;  2GOW A;  2IYB A;  2XBB C;  4ITK A;  2D9W A;  2ELA A;  1SXT A;  2KJ6 A;  3IG3 A;  4II2 B;  2CKH B;  1BUI C;  4D2K A;  4EMO A;  2X0S A;  5IP4 D;  1LO5 D;  5EE3 A;  3RCZ A;  1UBI A;  5D94 A;  3H8H A;  3UIO B;  3N30 A;  3O65 B;  3TJP A;  2L3Z A;  1EM7 A;  2KTR A;  3MPX A;  2KHW B;  3VR9 B;  1D6E C;  1L4D B;  4K7U A;  2K8E A;  3PZ7 A;  2OJW A;  2NR2 A;  3AI5 A;  4EZL A;  1XLP A;  5BMG A;  3TL5 A;  1NU2 A;  2W2X C;  3F0W A;  3BVZ A;  2E2X A;  4REZ A;  4CHK A;  5J2R A;  5HE2 A;  1WGY A;  1MJD A;  4UDU C;  2MBO A;  1M94 A;  5D27 A;  3SR6 A;  2FUG 1;  3VH3 B;  2JF5 A;  2GCL A;  3HQC A;  2N0Y A;  3HUI A;  5IOI A;  3ABV B;  3IBE A;  1V89 A;  4OZC A;  3CWI A;  2NTT A;  2L2I A;  4BFR A;  1E8W A;  4RGN A;  1ESF A;  2M1M A;  3BK2 A;  3DBL B;  1JW9 D;  3PSE B;  2K3U A;  2N0S B;  1D3Z A;  2KJR A;  2INP E;  4HKZ E;  4IFS A;  2EMT A;  2BT6 A;  1FNW A;  3VTV A;  4KHO A;  1GG3 A;  2PVG C;  5IKC M;  5D3V A;  1J7B A;  5EDS A;  1RFK A;  1DDW A;  3B2G A;  4DX8 A;  2KYW A;  1M4V A;  5DPT A;  1RRP B;  3IVF A;  2YF0 A;  1DDV A;  3OJ3 A;  1HB8 A;  4O1N A;  2KXJ A;  2WXM A;  4JWU C;  1LB1 A;  3FP5 A;  4WWM A;  1AWE A;  2YS1 A;  2K8H A;  4QAY A;  4LNF A;  1EU4 A;  2SEB D;  2IY0 B;  4KKI A;  1C4C A;  3BVG A;  4MAC A;  2OOB B;  3PEG A;  3WIM A;  1FHW A;  1OGW A;  2NMQ A;  5G5G A;  3P42 A;  3NVV A;  1WH3 A;  1K52 A;  1NI3 A;  3PT2 B;  2IGD A;  2GJY A;  1ZKH A;  2JYT A;  2O2V A;  2W9N A;  3ZDT A;  1F2R I;  1FAO A;  4C7Z A;  2Q5W D;  3UQB A;  2WDQ B;  3ZNG C;  1MHX A;  3TEX A;  2BB5 A;  2DNF A;  2WDT B;  2ZEQ A;  1HBK A;  5EE9 A;  4KSK C;  3V62 A;  3TW1 A;  2DX1 A;  2N9X A;  3L4P A;  3PVU A;  2H7D A;  2Z0E B;  3B2F A;  5I4D A;  2AL6 A;  2R2O A;  3MHS D;  1KFY B;  4QJ3 B;  1YQB A;  2BWE S;  4MGY E;  3QHT A;  1D5X C;  1ZVR A;  5FR6 A;  4M01 A;  2CQU A;  3KUC B;  1MFW A;  2N9L A;  2REX A;  4FN2 A;  4OVU A;  2ZVO A;  4LLG M;  2RSU A;  1XOD A;  2CY4 A;  1C1Y B;  2XK5 B;  3FKY A;  2L1C A;  3DHG C;  1E90 A;  4FXC A;  2GBM A;  3X23 A;  4NQK E;  2D10 A;  4KIK B;  3V60 A;  5JHG A;  3A4R A;  1WGH A;  1XLO A;  2ZW1 A;  2N7E A;  4L6E A;  1EO6 A;  2MJD A;  2FAZ A;  2ONQ A;  1Q67 A;  3HIZ A;  3DBH B;  1FCC C;  3VAW A;  2K8C A;  5C2T B;  4ANV A;  2PVO D;  2IYD B;  1TT5 B;  3DXD A;  4KZC A;  3M95 A;  3RT3 B;  4FHJ A;  2ZPY A;  2Z8L A;  1RAX A;  1V1O A;  4A9A A;  3E9S A;  2WWZ A;  4BOS C;  1V88 A;  2DZI A;  4J6I A;  3RNF C;  1FFV A;  3U4E G;  1FXI A;  1QOB A;  3PG7 A;  2N9K A;  2RDH A;  1KC7 A;  1T0S C;  1J7A A;  1IRS A;  4IG7 B;  2M19 A;  4NJ6 A;  4JL9 A;  1SE9 A;  1W1D A;  1AQC A;  4XWW A;  3ZJV A;  1LW3 A;  3VHT C;  4K1R B;  2ZPN A;  2J0J A;  1NEK B;  3KRW A;  4I6P A;  5DPR A;  1NTY A;  5CLQ B;  2LMC A;  4HPL B;  1BTK A;  2QIE B;  1MG4 A;  1W1G A;  2X18 A;  2L05 A;  3APF A;  3Q3M C;  2R82 A;  1C3T A;  1ENF A;  1T77 A;  2CJO A;  2O6V B;  1AYF A;  3ZVV A;  2COA A;  1JWS D;  2OJR A;  5AUK A;  2KN4 A;  4IW0 A;  5JVL A;  3KQ4 A;  2ZCC A;  4NAW A;  2KLG A;  4B95 A;  4BBK A;  2L0T A;  1TS2 A;  5FK9 C;  3HM3 A;  4P6V F;  1N61 A;  3NY5 A;  2KC1 A;  4RGO S;  1TS4 A;  1I4X A;  1WE6 A;  2LJI A;  1V5U A;  4KHA A;  3KH0 A;  1E6E B;  1UPR A;  1B55 A;  3V05 A;  1T5X D;  1JWU D;  2I1K A;  4HAV B;  5D3Y A;  3AE3 B;  4IM2 A;  2MQJ A;  4XGA B;  4BZA A;  1TXD A;  1BXT A;  5HFY A;  2FBW B;  2AYO B;  2YSZ A;  1KJT A;  1E10 A;  4BKT A;  1HA5 A;  2K1F A;  4HLE A;  4A20 A;  3K9O B;  5H92 C;  1E8Y A;  3P4S B;  4WQO B;  2KCJ A;  2KWU B;  3FEH A;  2Z13 A;  4GPT B;  1L2N A;  2VH1 A;  1SIF A;  1ZGU B;  2DLB A;  4LNO A;  1TTN A;  5D6J B;  3R7R A;  4NQL B;  3VUW A;  2R61 A;  1HE8 A;  3H6N A;  4JGH B;  4CQN A;  2D3G A;  4GGQ A;  3O13 A;  2JXX A;  4JQW C;  4JKC A;  3MTN B;  4GXB A;  3T06 A;  1KZG A;  1FXA A;  4M0W B;  1ST7 A;  3X0W A;  2GMI C;  4S17 A;  2COP A;  1V1P A;  2KFK B;  3ODW A;  3KYD D;  1HQR D;  2X38 A;  1FPY A;  4G11 A;  4L1B A;  2LEK A;  2K6D B;  1TZ1 A;  1MK9 B;  1DOY A;  3Q69 A;  2LRU A;  1STE A;  2A5U A;  1I42 A;  2ROZ B;  3PZD A;  3J9C A;  2QIL A;  3FM8 C;  1IPG A;  5JXV A;  1Q0W B;  5C23 A;  5E6P A;  5LOP B;  1OMW A;  1XCQ L;  5J3Y A;  3DHI C;  1H8C A;  2WXF A;  2V0G A;  4C0A A;  2DHZ A;  4RF1 A;  4XDD A;  4DBB A;  1QLB B;  3HRD D;  2MFQ A;  1V86 A;  4WJQ A;  2LUM A;  4ZYS A;  3FIL A;  1FEH A;  4F7U P;  2ZZP B;  2PZ1 A;  3ML4 A;  3N1Y C;  1WSP A;  1XD3 B;  1GC6 A;  3CIK A;  2Z4D A;  5CHV C;  1TJ6 A;  1MHH E;  1UEF A;  1E0Z A;  2D3C A;  2RVB B;  1UEL A;  3RI7 C;  3ENB A;  4S0R A;  2P0D A;  4N58 A;  3V6E B;  4C4V B;  1DBH A;  3ZJT A;  5KHQ A;  1XT9 B;  2BCJ A;  2CY5 A;  3IXS A;  3PRE A;  4L2Y A;  5LXH A;  2WXQ A;  3KUZ A;  2W54 A;  3VTW A;  4H8S A;  3I57 A;  3N20 C;  2BKR B;  4OVZ A;  4OSN A;  3FC4 A;  3R7Q A;  5JHA A;  3IFW B;  1ZC3 B;  2WDR B;  2I38 A;  5D7G A;  4W9J A;  1NYQ A;  1D4B A;  2WXK A;  3A9K B;  5EE1 A;  3I3T B;  4HPP A;  1KI1 B;  1IGC A;  5IJM A;  4A6Q A;  4US9 A;  1P7F A;  3MJ5 A;  4IDI A;  2W2X D;  3NZS A;  3CIR B;  1DGJ A;  1L0V B;  3ZTD A;  1X86 A;  2WHI A;  4KGT A;  3KUD B;  3PLU A;  1DDM A;  2KDE B;  2WNM A;  1HEZ E;  3N9Y C;  4MGI E;  4WWO A;  1A5R A;  1TIF A;  3QCA A;  1C4A A;  1J7C A;  3Q8B A;  3PHW B;  2ZVN A;  3P4R B;  4ZRQ A;  4W9F A;  2YT1 A;  2FID A;  5JHH A;  1I7A A;  1KBL A;  2K2J A;  3GYP A;  4URK A;  4L23 A;  5E6O A;  1L5P A;  4GDL A;  1JWM D;  2DZK A;  2M14 A;  4N6E B;  3HHM A;  4JKG A;  3DVG Y;  4WJO A;  2KWC A;  1ET9 A;  3EA6 A;  1XLQ A;  2KO3 A;  2NBV A;  1ZDX A;  3LB8 C;  3VTU A;  3UZT A;  4ANX A;  3N3K B;  3JSV A;  2JVC A;  4OHJ A;  2D5G A;  3FAH A;  3AE6 B;  3W5V B;  2DEN B;  3GZN B;  5AUI A;  4IAP A;  3RUI B;  4LJP B;  5HKH A;  3JYU A;  4AS1 A;  4AP4 C;  1J0W A;  3NHE B;  3TEW A;  1X1G A;  3D8D A;  2BBC A;  2N7J A;  1VZ8 A;  1XO3 A;  4JIO U;  2WXO A;  2G3Q B;  3EEC A;  4FBJ B;  2NPT A;  3KWV A;  1FRR A;  3PS6 A;  1M7E A;  3WAO A;  1PFD A;  2COD A;  2N1V A;  2KDB A;  4AWJ A;  4DIX A;  4HEA 1;  3R66 C;  4OVV A;  2DKQ A;  1UF0 A;  1N60 A;  4Q2J A;  1YNT E;  3AE4 B;  3AED B;  3Q3O C;  2WXL A;  4EEW A;  3HW2 B;  3L17 A;  5IO9 A;  2MBE A;  1YMH E;  1ISN A;  2JSV X;  2LJ5 A;  3H7P A;  1IBX A;  1WYW B;  1M7R A;  3APC A;  4YSX B;  5FR3 A;  1P0R A;  1WXV A;  1E9M A;  2C9W B;  3V61 A;  3EPY A;  2W55 A;  4HWI B;  1WI1 A;  5L83 A;  1N3H A;  1TBE A;  1WXM A;  1TKE A;  1RLF A;  2ADZ A;  3AUL A;  2MLB A;  1QQR A;  1JML A;  2J0M A;  4A6F A;  2RDG A;  1FIQ A;  2KX3 A;  4JLC A;  1DYN A;  1S3S G;  1U5D A;  2JP2 A;  3AEC B;  2DAJ A;  3L54 A;  1MI1 A;  3RZW C;  3URY A;  1QT9 A;  3P7Z A;  2H88 B;  4YT0 B;  4IWO A;  3RMK C;  5C1Z A;  4LCD E;  3SBG A;  2OHF A;  2KTR B;  2LI5 A;  1C77 A;  4B0M A;  1R4N I;  3A58 A;  4NAM A;  5AZH A;  2KUP A;  2LXC A;  1MPE A;  4K7S A;  3M3J A;  3RNB C;  2V1Y A;  3ODX A;  3VVW B;  2FE8 A;  1WYG A;  1V97 A;  3WYF B;  1P7E A;  2LVQ A;  2DLW A;  2CR5 A;  1VBH A;  1FD6 A;  5HHD G;  2JWU A;  3ZRF A;  2K2U A;  1RRB A;  1WMH A;  3NZU A;  3Q8C A;  3RNE C;  1W1H A;  2P8V A;  2B3A A;  4LNI A;  1SJE D;  2INC C;  1HTQ A;  1C4P A;  3B0A A;  4FJZ A;  2V76 A;  1V6E A;  3QQ8 B;  4MEL A;  1SE2 A;  4TQ1 A;  1AN8 A;  3BK1 A;  1J8C A;  4ILG B;  4CHM A;  2D11 A;  3NW8 A;  2EEL A;  5LNK 1;  3QK0 A;  1XCT L;  1PGX A;  1L0Y B;  2JZ3 B;  4W9G A;  2L7R A;  4RM9 A;  3DBS A;  3Q8E A;  4KV2 A;  1OQQ A;  2HJ8 A;  1E8Z A;  4HPM B;  2VRR B;  2L52 A;  5IAA C;  1U4A A;  1LGR A;  1C78 A;  5GMV A;  5JZE B;  1WG7 A;  3KY9 A;  5IA7 A;  2LOZ A;  2JWZ A;  2WXN A;  1NYR A;  5M4Y B;  1U2B A;  4OW0 A;  3ZNZ B;  2PKO A;  4DXF A;  5BO4 B;  2EC1 A;  4AJW A;  2QSD A;  2G1E A;  3JVZ X;  4C7Y A;  1QQG A;  4MM3 B;  1L6U A;  2BGF A;  2KLC A;  1UZX B;  2AX5 A;  2PTL A;  2UVM A;  4KKJ A;  1V8C A;  5DPS A;  3NVZ A;  1AWD A;  2FDQ A;  1IGD A;  3UF8 A;  4DXA B;  3ZYY X;  2MBB B;  1E8X A;  2HD5 B;  1WGR A;  3K9P B;  2IGG A;  5KQ4 A;  1EF1 A;  5LXI B;  3AXC A;  1GAQ B;  1BML C;  4W9C A;  4GOU A;  1Y8R C;  5L81 A;  2J52 A;  5GOW B;  2RD0 A;  1N5X A;  2B76 B;  4B6W A;  3Q14 C;  5E6J A;  2KQS A;  1KF6 B;  2D3A A;  2O2V B;  3SNH A;  3CMM B;  1NVI D;  5AZG A;  1OQN A;  3SFE B;  2JYE A;  2H7E A;  3KVF B;  2O6V D;  2V4I B;  2IDY A;  3AE9 B;  2RGF A;  1NBF C;  3AB5 A;  3AE8 B;  3SFD B;  1LM8 B;  3DBR B;  3OLM D;  1UGM A;  4W9I A;  1ZP0 B;  5D2M B;  3HK0 A;  4ILH A;  4J3O D;  1WJU A;  5DPW A;  4HAT B;  1FO4 A;  1UWM A;  1P6S A;  5DH9 B;  4MK0 A;  4JWS C;  3B9J A;  3OG5 A;  4NJ7 A;  1JWB D;  4WJN A;  3AU5 A;  1V2Y A;  3ULC A;  3GOE A;  1F9J A;  2Y5C A;  1WX8 A;  2MH7 A;  3ALB A;  4H2A A;  4MDK E;  4KDL B;  1GNU A;  2GI9 A;  1ZPS A;  4HJK A;  5G55 A;  3U12 A; 
#chains in the Genus database with same CATH homology
 2M8S A;  3LJ3 A;  4E71 A;  4NSW A;  1Q1O A;  2HTH A;  2Q13 A;  3APD A;  3DDC B;  1WI0 A;  5CX3 A;  3B1L X;  1X05 A;  3A1Q B;  3VFK A;  2C7N B;  2LVO A;  3CST A;  3W1S C;  1JRU A;  1QC6 A;  3VDZ A;  4BKS D;  5JP4 A;  4HAU B;  2LGD A;  2YRY A;  3RZF A;  1R4M I;  2FUH B;  4HXD A;  4LDT B;  2MRP A;  2BPS A;  2DA0 A;  4DDI D;  4WJP A;  4FAD A;  3ODO A;  2N1W A;  2JUO A;  2N9P C;  4A5K A;  4AOF A;  1XKE A;  2LVP A;  2DHJ A;  3ONS A;  4WWP A;  1K5G B;  1YX6 B;  1KOT A;  1Y5O A;  3DVN U;  3DOW A;  2D07 B;  5C5B B;  4F7Z A;  4AUQ C;  2N4F A;  4KIK A;  2GBN A;  2UZR A;  1E7U A;  2JRH A;  3QAR A;  1GGO A;  4KAX B;  3ECI A;  3V5W A;  3RUL A;  2GS0 A;  4MJS B;  2BKF A;  2BWF A;  2YS5 A;  2BYE A;  4I6N B;  3PRZ A;  3ZRC A;  2LAS A;  2YVC A;  2MDX A;  3L13 A;  1J19 A;  2CRF A;  1BT0 A;  4MSM B;  2DAF A;  1Z87 A;  3WA0 A;  2G4D B;  4IWP A;  4KSL C;  1P9D U;  2QKM A;  2G4S A;  2J7Q B;  2ELB A;  2NBU A;  3A8Q A;  1RFA A;  3G9W A;  2UYZ B;  2KOX A;  2ZNV B;  2I5F A;  2XQN M;  4PS7 A;  4ICV A;  1X1M A;  5CHF A;  4ZYN A;  1WJ1 A;  3SDL C;  3MDB C;  1OEY A;  1NTV A;  2O6V A;  1YIW A;  1WGQ A;  5HE1 A;  2COC A;  3H9D A;  4WAA A;  5DIF B;  5CTR C;  2BYF A;  5J3Q A;  2EKE C;  1V5T A;  1KLV A;  1WJ4 A;  2I1J A;  2V4L A;  4JK7 A;  3ULB A;  2K25 A;  2DX5 B;  4BOZ B;  3S2A A;  1WJM A;  1UBQ A;  2ASQ A;  5J3T A;  4GDK B;  4BVU C;  1WX7 A;  3NSU A;  1UNP A;  3ZLZ A;  1U27 A;  3ZUN A;  2MW5 A;  3WAP A;  2ZNV C;  3AU4 A;  4TUU A;  3M63 B;  3BY4 B;  2AWT A;  4GMV A;  3QBV B;  2K00 A;  2MBQ A;  1WGU A;  4TV3 A;  4W9H A;  2RPQ A;  2NS5 A;  4A6K A;  3PRM B;  3A9J A;  2N23 A;  1E5W A;  3N7C A;  3PHX B;  2YT0 A;  3CF6 E;  4WWN A;  3DVN V;  4K2O A;  2MX2 A;  2LUL A;  4ZDV A;  3KZ1 A;  3AJ4 A;  1WIA A;  1G6J A;  3V6C B;  1U29 A;  1Q5W B;  2KFK A;  2I5C A;  4EZJ A;  2DYM A;  2W2W A;  4PQ0 A;  5FI1 A;  4LJO B;  2IO1 B;  2M0X A;  2RQ1 A;  1WXA A;  1WJ6 A;  3PV1 A;  4PYZ A;  3EC8 A;  3QX1 A;  2IFS A;  4M8M A;  2GBR A;  1OQY A;  3OAW A;  1V9J A;  3H7S A;  1S1Q B;  1P3Q U;  2EMS A;  4IM3 A;  2MP2 A;  4YL8 A;  2KMA A;  4MT7 A;  2LXA A;  2GBK A;  4JKE A;  5EFX A;  3ZDM C;  1WM2 A;  3SYX A;  5C79 A;  5JH5 C;  1VD2 A;  4GB9 A;  4IC7 B;  1SGH A;  1UH6 A;  3BIN A;  1XX0 A;  3H1U A;  3NOB A;  2NPT B;  1OEY J;  4FLH A;  4JKH A;  4XC2 A;  2Z59 B;  4EZK A;  2D9X A;  1V49 A;  1DIK A;  3ZTC A;  4GU2 A;  2D9Z A;  3RD2 A;  2JRI B;  3GYO A;  3PVL A;  3A4S C;  1XCG A;  3Q3J A;  3P2B A;  5LLI A;  3VOQ A;  1MAI A;  3E9P A;  1WE7 A;  2LGX A;  3TVV A;  4HAW B;  3QC8 B;  3ML8 A;  3SBT A;  3QJZ A;  1WZ3 A;  1MPH A;  4ILJ A;  3QWM A;  2V3S A;  3KW5 B;  2NMB A;  3UGB B;  3LJU X;  4Z2N A;  1L7Y A;  2UZS A;  4HDQ A;  5J17 A;  1V5O A;  1LFD A;  4A3P A;  3DBL I;  2WX1 A;  2YLM A;  1JDE A;  4K17 A;  4XZ4 A;  4YON A;  1P5T A;  1MKE A;  4DHZ B;  2LBB A;  3R3M A;  2ROV A;  3ZO5 B;  2FJL A;  1I2H A;  3HM6 X;  4HK2 A;  4F7G A;  2MWN B;  2G35 A;  3LDZ E;  4IOY X;  4HB2 B;  4RM8 A;  2P0H A;  2DZJ A;  3L08 A;  2LUE A;  1V81 A;  3BJI A;  2M38 A;  2PE6 B;  3VUY A;  2DN6 A;  2K39 A;  3L16 A;  2HRJ A;  1MIX A;  2KC2 A;  1WR1 A;  1BAK A;  4GMX B;  4ZRJ A;  3PVW A;  4ASW C;  4KDI C;  2KFJ A;  4DHZ E;  5DI9 B;  1T0Y A;  4MH0 E;  4HAZ B;  1WGD A;  3ZNI D;  4GIV A;  4B6H A;  4HCN B;  2CU1 A;  4X57 B;  3DXE A;  2D9Y A;  4GSW A;  1YJ1 A;  2K8B A;  4A3O A;  4MEM A;  2FJ9 A;  2IY1 B;  1FOE A;  1ZSQ A;  4HVB A;  1H4R A;  2R2Q A;  1X11 A;  2WYQ A;  1I35 A;  4RMA A;  2KD0 A;  5DHA B;  2CHZ A;  3VXW A;  4HB0 B;  2GBJ A;  3PSC A;  2IO3 B;  3VH4 B;  2AEH A;  3DBH I;  5KHO A;  3W1Y A;  2HE7 A;  1XR0 B;  2LD9 A;  4LDT D;  1P1A A;  3VUX A;  2FCM A;  3A33 B;  1NI2 A;  1FB8 A;  3UIN B;  4K81 A;  3CXB B;  2JPH A;  5AEK B;  2CHX A;  4JK8 A;  2PPH A;  2N9E B;  2LWP A;  2RUK B;  2KDF B;  3U30 A;  1FHX A;  4G50 A;  2WH5 A;  2VKI A;  3MJW A;  1Y19 B;  3WAN A;  3C0R B;  4EUT A;  4BKG A;  4JKD A;  1X1F A;  3SV1 A;  2FIF A;  4ANW A;  1WJN A;  4HDO A;  1V80 A;  2JT4 B;  1BTN A;  3A98 B;  2EJ8 A;  2HTH B;  1K8R B;  2D2Q A;  2L8J A;  2DYQ A;  5HE0 A;  5J18 A;  4NY0 A;  3KRX A;  3OAN A;  4MM3 A;  5CLL B;  3PP2 A;  2M4N A;  4DHJ B;  4W9E A;  1KZ7 A;  4PS3 A;  4MY6 A;  1ZM0 A;  1MG8 A;  2ZJD A;  2R09 A;  2MWS B;  1EGX A;  2Z0Q A;  4WSF A;  1EVH A;  2PE9 A;  3RYT A;  3TFM A;  1WY8 A;  2DFK A;  5LON B;  2A4Z A;  2LRW A;  4TKN A;  2UWQ A;  2DZM A;  3KYC D;  2KTF A;  3ZNH B;  4WVF B;  1WRD B;  2CHW A;  4CHJ A;  1NVL A;  2FCS A;  2L00 B;  4B9K A;  3SD5 A;  5KQ1 A;  3TIX A;  2DTC A;  2MA9 B;  3EHV A;  3D8F A;  4D0N B;  2FNJ B;  4DWF A;  3DPD A;  1HB6 A;  4IUM B;  4JKB A;  3U8Z A;  1FGY A;  4JKF A;  2VRW B;  1E7V A;  4FA6 A;  3W1S A;  1WF9 A;  1SHC A;  2N7D A;  1WM3 A;  3QAQ A;  1P98 A;  3RCP A;  1DRO A;  4FJV B;  4DK5 A;  1IYF A;  1GUA B;  1LXD A;  4Y94 A;  3OJ4 B;  1WZ0 A;  3T8M A;  2C7M B;  4NAW B;  3TO1 A;  4XX5 A;  3D32 A;  4XWX A;  4K7W A;  5DCN A;  3QA8 A;  5HE3 A;  2DHI A;  1KM7 A;  4FUL A;  2XK5 A;  3A1Q A;  2M17 A;  3P6A A;  4PNK A;  4DBG A;  2KWV B;  3SU8 X;  4A6H A;  3Q3F A;  2Z0D B;  3WAM A;  1WX9 A;  2AL3 A;  4FHK A;  5JLJ B;  4F8C B;  2LZ6 A;  2DYB A;  2OQB A;  4EKU A;  3F5R A;  4M8N A;  2NCN A;  3E66 A;  4HB3 B;  2ABD A;  5D3X A;  2RSG A;  3DQV A;  2NBW B;  4EJN A;  3M62 B;  1VCB A;  4GOC A;  3QIJ A;  5C5B A;  4ZRK A;  4JKA A;  3L10 B;  2D4Q A;  2KQ7 A;  2IO2 B;  2R0D A;  3T9L A;  2CAY A;  4HAY B;  3JW0 X;  2KK8 A;  3SO6 A;  4CYE A;  4P7I A;  1U5F A;  2Y8F A;  4DDG D;  1GC7 A;  3SHQ A;  1V5P A;  2RR9 A;  2J0K A;  5DHF B;  4KHB B;  4MJS A;  3VQI A;  1OTR B;  1K5D B;  2DKP A;  4WJ7 A;  4W9L A;  3A9J B;  4E74 A;  2BF8 B;  4IM0 A;  4TYZ A;  3GZN I;  4NPN A;  4ANU A;  2Z0O A;  4GZU A;  4HAX B;  2DIK A;  4F1S A;  1OY2 A;  1WVH A;  2LYD A;  2IBI B;  3TMP B;  3U7D A;  4EOY A;  5G2N A;  2JZZ A;  4W9D A;  3ZW3 A;  2KX0 A;  1ZC4 B;  5C16 A;  1J0G A;  1UPQ A;  1FGZ A;  3E9L A;  3O96 A;  2KMC A;  3WAL A;  1YX5 B;  2DX5 A;  4ZRI A;  4IWQ A;  1AAR A;  2IO0 B;  4BKS A;  1P3R A;  1V61 A;  2J59 M;  4K2P A;  2MP2 B;  1WXS A;  3ML9 A;  2JY6 A;  3UQA A;  3PPA A;  4GDK A;  2NVU I;  2WX0 A;  2L76 A;  1FXT B;  4CO7 A;  1FHO A;  2C5L C;  2MKR A;  3QWZ B;  4GDL B;  3VIA A;  2CB8 A;  4JKG B;  2IZV B;  1Z5S B;  1UNR A;  1PMS A;  4NNJ B;  4KVG B;  4PS8 A;  1V5M A;  3ZKJ C;  4Z2M B;  2NBV B;  5CHW A;  4JK9 A;  2KKC A;  3PGE A;  4G0N B;  2OTX A;  3JSV B;  3SUZ A;  1PQS A;  5D3W A;  2DYO A;  1BWN A;  2YS3 A;  4G3X B;  2KJH B;  2C60 A;  4BBN C;  3FLV A;  4TQ0 A;  2NZ8 B;  4HCP B;  1CMX B;  2GCJ A;  3E9O A;  5FI0 A;  2KZR A;  4DX9 0;  4MGK E;  1QZE A;  1XQQ A;  2KAN A;  4HHV A;  2KDI A;  2Y5B B;  4E3C A;  3A9K A;  1PLS A;  1RJ2 A;  3N32 A;  3D8E A;  3B08 A;  2FCN A;  2ZCB A;  5AZF A;  3H7P B;  1GJZ A;  3ZVR A;  4W9K A;  2MCN B;  1ZW7 A;  3KSY A;  3UIP B;  1YD8 U;  1TGZ B;  4II3 B;  1XD4 A;  3DVG X;  2LKO A;  1EAZ A;  2RNR B;  3PRP B;  1UD7 A;  4ICU A;  5TR5 A;  5C6R A;  4A6F B;  4MSQ B;  2KN5 A;  5E6N A;  3DXC A;  2XEW A;  2KVR A;  4EFO A;  4N9F 4;  2CS4 A;  2QHO A;  2KGX B;  1H10 A;  1WR6 E;  1NDD A;  5JHB A;  3EFU A;  3L0W B;  2DYN A;  2D9V A;  4FJY A;  3FSS A;  2MSE D;  3ZIM A;  1NTI A;  1WGG A;  4PYU A;  3DCG A;  1LQB A;  1MIZ B;  1VBG A;  1ACA A;  2P0F A;  1U5G A;  2PJH A;  4KZ0 A;  3DBR I;  1WMH B;  2K6Q A;  4MGZ E;  2LOX A;  2LGY A;  1UNQ A;  3TBL D;  4GN1 A;  4BBN F;  4DHJ D;  2FCQ A;  2DHK A;  3IHP C;  2G45 B;  2COF A;  3PLV A;  2BYV E;  2PEA A;  2VSZ A;  2KNB A;  1Z2M A;  4AJY B;  2L0F A;  2LG1 A;  2RLO A;  1EUV B;  2RGN B;  3TCA A;  2C7H A;  2Y8G A;  1TQZ A;  1PFJ A;  1U5E A;  3ENE A;  3NS8 A;  3M1I B;  1IP9 A;  1MK7 B;  2Z0P A;  3A8P A;  5KCV A;  1EF5 A;  4I6L B;  2QKL A;  2Y7B A;  5L95 C;  3PTF C;  2MBH A;  3CSF A;  4HB4 B;  4F7H A;  1WFY A;  2GOW A;  2IYB A;  2XBB C;  2D9W A;  2ELA A;  2KJ6 A;  3IG3 A;  4II2 B;  2CKH B;  4EMO A;  2X0S A;  3RCZ A;  1UBI A;  5D94 A;  3UIO B;  3N30 A;  3O65 B;  3TJP A;  2L3Z A;  2KTR A;  3MPX A;  2KHW B;  4K7U A;  2NR2 A;  3AI5 A;  4EZL A;  3TL5 A;  1NU2 A;  2W2X C;  3F0W A;  2E2X A;  4CHK A;  5J2R A;  5HE2 A;  1WGY A;  2MBO A;  1M94 A;  5D27 A;  3VH3 B;  2JF5 A;  2GCL A;  3HQC A;  2N0Y A;  3IBE A;  1V89 A;  2L2I A;  4BFR A;  1E8W A;  2M1M A;  3PSE B;  1D3Z A;  2KJR A;  4IFS A;  2EMT A;  3VTV A;  4KHO A;  1GG3 A;  5D3V A;  5EDS A;  1DDW A;  4DX8 A;  5DPT A;  1RRP B;  3IVF A;  2YF0 A;  1DDV A;  3OJ3 A;  1HB8 A;  2KXJ A;  1LB1 A;  3FP5 A;  1AWE A;  2YS1 A;  2K8H A;  2IY0 B;  2OOB B;  3PEG A;  3WIM A;  1FHW A;  1OGW A;  1WH3 A;  3PT2 B;  2GJY A;  1ZKH A;  2O2V A;  2W9N A;  3ZDT A;  1FAO A;  3UQB A;  3ZNG C;  2WDT B;  2ZEQ A;  1HBK A;  4KSK C;  3V62 A;  3TW1 A;  2DX1 A;  2N9X A;  3PVU A;  2H7D A;  2Z0E B;  2AL6 A;  2R2O A;  3MHS D;  1YQB A;  2BWE S;  4MGY E;  3QHT A;  1ZVR A;  5FR6 A;  2CQU A;  3KUC B;  2REX A;  4FN2 A;  4OVU A;  2ZVO A;  2RSU A;  1XOD A;  2CY4 A;  1C1Y B;  2XK5 B;  2L1C A;  1E90 A;  2GBM A;  3X23 A;  4NQK E;  2D10 A;  4KIK B;  3V60 A;  5JHG A;  3A4R A;  1WGH A;  2N7E A;  4L6E A;  1EO6 A;  2FAZ A;  1Q67 A;  3HIZ A;  3VAW A;  2K8C A;  4ANV A;  2IYD B;  3DXD A;  4KZC A;  3M95 A;  3RT3 B;  4FHJ A;  2ZPY A;  1RAX A;  2WWZ A;  4BOS C;  1V88 A;  2DZI A;  4J6I A;  3PG7 A;  1KC7 A;  1IRS A;  4IG7 B;  4NJ6 A;  4JL9 A;  1SE9 A;  1W1D A;  1AQC A;  1LW3 A;  3VHT C;  4K1R B;  2ZPN A;  2J0J A;  3KRW A;  4I6P A;  5DPR A;  1NTY A;  5CLQ B;  4HPL B;  1BTK A;  1W1G A;  2X18 A;  2L05 A;  3APF A;  2R82 A;  1C3T A;  2O6V B;  3ZVV A;  2COA A;  2OJR A;  4IW0 A;  5JVL A;  2ZCC A;  4NAW A;  2KLG A;  4B95 A;  4BBK A;  2L0T A;  3HM3 A;  3NY5 A;  2KC1 A;  1WE6 A;  1V5U A;  4KHA A;  3KH0 A;  1UPR A;  1B55 A;  2I1K A;  4HAV B;  5D3Y A;  4IM2 A;  2MQJ A;  1TXD A;  2AYO B;  2YSZ A;  1KJT A;  4BKT A;  2K1F A;  4HLE A;  4A20 A;  3K9O B;  1E8Y A;  4WQO B;  2KCJ A;  2KWU B;  3FEH A;  4GPT B;  1L2N A;  1SIF A;  1ZGU B;  5D6J B;  1TTN A;  3R7R A;  4NQL B;  3VUW A;  1HE8 A;  3H6N A;  4JGH B;  2D3G A;  4GGQ A;  2JXX A;  4JQW C;  4JKC A;  3MTN B;  4GXB A;  3T06 A;  1KZG A;  4M0W B;  1ST7 A;  3X0W A;  2GMI C;  2COP A;  2KFK B;  3ODW A;  3KYD D;  4G11 A;  2K6D B;  1TZ1 A;  1MK9 B;  2LRU A;  1I42 A;  2A5U A;  2ROZ B;  3PZD A;  3FM8 C;  1IPG A;  1Q0W B;  5C23 A;  5E6P A;  5LOP B;  1OMW A;  5J3Y A;  1H8C A;  4C0A A;  2DHZ A;  4DBB A;  2MFQ A;  1V86 A;  4WJQ A;  4F7U P;  2ZZP B;  2PZ1 A;  3ML4 A;  1XD3 B;  1GC6 A;  3CIK A;  5CHV C;  1TJ6 A;  1UEF A;  2RVB B;  1UEL A;  3ENB A;  2P0D A;  3V6E B;  1DBH A;  5KHQ A;  1XT9 B;  2BCJ A;  2CY5 A;  3PRE A;  5LXH A;  3KUZ A;  3VTW A;  4H8S A;  2BKR B;  3R7Q A;  5JHA A;  3IFW B;  1ZC3 B;  5D7G A;  4W9J A;  3A9K B;  3I3T B;  1KI1 B;  5IJM A;  2W2X D;  3NZS A;  3ZTD A;  1X86 A;  3KUD B;  3PLU A;  1DDM A;  2KDE B;  4WWO A;  4MGI E;  1A5R A;  3QCA A;  3PHW B;  2ZVN A;  4W9F A;  2YT1 A;  2FID A;  5JHH A;  1I7A A;  1KBL A;  2K2J A;  3GYP A;  4URK A;  5E6O A;  4GDL A;  2DZK A;  2M14 A;  3HHM A;  4JKG A;  3DVG Y;  4WJO A;  2KWC A;  2KO3 A;  3VTU A;  3UZT A;  4ANX A;  3N3K B;  3JSV A;  2JVC A;  2DEN B;  4IAP A;  3RUI B;  4LJP B;  5HKH A;  3JYU A;  4AP4 C;  1J0W A;  3NHE B;  1X1G A;  3D8D A;  4JIO U;  2G3Q B;  3EEC A;  4FBJ B;  2NPT A;  3PS6 A;  1M7E A;  3WAO A;  2COD A;  2N1V A;  2KDB A;  4AWJ A;  4OVV A;  3R66 C;  2DKQ A;  4EEW A;  3HW2 B;  3L17 A;  2MBE A;  1ISN A;  2LJ5 A;  3H7P A;  1WYW B;  1M7R A;  3APC A;  1P0R A;  1WXV A;  2C9W B;  3V61 A;  3EPY A;  4HWI B;  1WI1 A;  5L83 A;  1N3H A;  1TBE A;  1WXM A;  1RLF A;  2ADZ A;  3AUL A;  2MLB A;  2J0M A;  4A6F A;  2KX3 A;  4JLC A;  1DYN A;  1S3S G;  1U5D A;  2JP2 A;  2DAJ A;  3L54 A;  3RZW C;  3P7Z A;  4IWO A;  5C1Z A;  4LCD E;  3SBG A;  2KTR B;  2LI5 A;  1R4N I;  5AZH A;  2KUP A;  2LXC A;  4K7S A;  3M3J A;  2V1Y A;  3ODX A;  3VVW B;  3WYF B;  2LVQ A;  2DLW A;  2CR5 A;  1VBH A;  3ZRF A;  2K2U A;  1RRB A;  1WMH A;  3NZU A;  1W1H A;  2P8V A;  2B3A A;  3B0A A;  4FJZ A;  2V76 A;  1V6E A;  3QQ8 B;  4MEL A;  4TQ1 A;  1J8C A;  4ILG B;  4CHM A;  2D11 A;  3QK0 A;  2JZ3 B;  4W9G A;  2L7R A;  4RM9 A;  3DBS A;  4KV2 A;  2HJ8 A;  1E8Z A;  4HPM B;  2VRR B;  5IAA C;  1U4A A;  5GMV A;  5JZE B;  1WG7 A;  3KY9 A;  5IA7 A;  2LOZ A;  2JWZ A;  1U2B A;  3ZNZ B;  5BO4 B;  2EC1 A;  4AJW A;  3JVZ X;  1QQG A;  2KLC A;  2BGF A;  1UZX B;  2UVM A;  5DPS A;  2FDQ A;  3UF8 A;  4DXA B;  2MBB B;  1E8X A;  2HD5 B;  1WGR A;  3K9P B;  5KQ4 A;  1EF1 A;  5LXI B;  3AXC A;  4W9C A;  1Y8R C;  5L81 A;  5GOW B;  2RD0 A;  4B6W A;  2KQS A;  2O2V B;  3SNH A;  3CMM B;  5AZG A;  1OQN A;  2H7E A;  3KVF B;  2O6V D;  2RGF A;  1NBF C;  1LM8 B;  3OLM D;  1UGM A;  4W9I A;  5D2M B;  3HK0 A;  4ILH A;  1WJU A;  5DPW A;  4HAT B;  1P6S A;  5DH9 B;  4MK0 A;  4NJ7 A;  4WJN A;  3AU5 A;  1V2Y A;  3ULC A;  3GOE A;  1F9J A;  1WX8 A;  3ALB A;  4MDK E;  4KDL B;  1GNU A;  4HJK A;  5G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...