1MIZB

Crystal structure of an integrin beta3-talin chimera
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords integrin beta3
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mizB01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mizB02
1V89A 1GC6A 4C0AA 1FB8A 2VRWB 1FGYA 3FLVA 3KY9A 4HB4B 2HTHB 1U27A 4TKNA 2LULA 2GCJA 2KUPA 3KRWA 2MFQA 2D9WA 4KAXB 2ROZB 2DKPA 2P0FA 1I7AA 2J59M 3PVUA 2N23A 2ZPYA 3WYFB 1EGXA 3QWMA 3ODWA 2GCLA 3F0WA 2I5FA 1FHWA 1SGHA 4KHBB 1QQGA 2Q13A 1J19A 5HE2A 3SO6A 3A98B 2KCJA 2FDQA 1Y19B 4CYEA 5CLLB 1J0WA 3HQCA 2XQNM 2L1CA 5J3TA 2M14A 2ABDA 2DYNA 1ZVRA 3ULBA 2AL6A 4CHJA 2RVBB 3AU4A 3V5WA 4F7GA 4P7IA 4K17A 2EMSA 1OMWA 3A8PA 4Z2NA 1PFJA 1FHOA 4GMXB 1X1FA 2EC1A 4NSWA 1U29A 1MPHA 1FOEA 4HAWB 3FP5A 5DHAB 3ZDTA 1RJ2A 1LB1A 3SV1A 1M7RA 2I5CA 4B6HA 4IOYX 3TFMA 4HB0B 4GXBA 1EVHA 3TCAA 5KQ1A 1Y5OA 2YS5A 2MKRA 1UNRA 2LKOA 4GMVA 4IAPA 1XX0A 3ZVRA 1SHCA 5JHGA 3F5RA 2OTXA 2Y8FA 2CB8A 2K00A 2YT0A 2YVCA 2AEHA 1U5DA 3G9WA 1XKEA 3D8EA 4KHAA 4H8SA 4Z2MB 4GN1A 4HATB 4YL8A 3TW1A 1HBKA 1WI1A 5KCVA 1WG7A 2DHKA 2YSZA 4HDOA 1HB6A 1MIZB 2J0KA 4MK0A 2COAA 2OQBA 5JP4A 4ZRIA 2DLWA 2FJ9A 2MDXA 1KI1B 4EMOA 3CXBB 1UEFA 3VOQA 3FM8C 5D3VA 1GC7A 1V5MA 3MPXA 2RQ1A 4YONA 5GOWB 4D0NB 4HAVB 1K5DB 1MK9B 1LW3A 3PSCA 1UNQA 2LOZA 4F7HA 2PZ1A 2Z0PA 2RNRB 1EAZA 2VSZA 5DHFB 4DXAB 5KQ4A 2P0HA 2DA0A 2DTCA 1AQCA 4WSFA 5C6RA 1FHXA 4K81A 1W1DA 4BBKA 2W2WA 1B55A 2WH5A 1FAOA 4K2PA 3ULCA 3O96A 1WVHA 1DYNA 1DBHA 3ML4A 1BTKA 1NTIA 1DDVA 2CY5A 4KHOA 3CIKA 1M7EA 2D9ZA 1V5UA 2LYDA 3FSSA 3SNHA 4XWXA 1KZGA 4A6KA 3U8ZA 2KGXB 2ROVA 2DN6A 2RGNB 3T06A 3PVLA 1MAIA 3QIJA 2D9VA 5DIFB 2L2IA 2YS3A 3GYOA 2CQUA 2Y7BA 1ZC4B 3TVVA 5HE1A 3U7DA 1QC6A 4F7UP 2D4QA 3PVWA 2COPA 1GG3A 3PP2A 2BCJA 4WVFB 1X05A 2H7EA 2D10A 1TJ6A 4IFSA 2D11A 1P5TA 1KZ7A 1DDMA 1ZM0A 4HB3B 1BWNA 3D8FA 3IVFA 1P6SA 5L81A 3AJ4A 4ZRKA 5C16A 1X11A 1V5PA 2NZ8B 1V88A 1Q67A 2P8VA 2EJ8A 2YF0A 4HAXB 4KVGB 3DXEA 5EFXA 5FI1A 3HW2B 4A5KA 1V61A 4HAZB 2CODA 2LOXA 2Y8GA 1X86A 5DI9B 5JHHA 2QKLA 1E5WA 2DKQA 1ISNA 3PG7A 3A8QA 5D3WA 2DHIA 5FI0A 1TXDA 1MKEA 1OY2A 3KSYA 4PQ0A 1U5FA 2DFKA 4HAYB 4Y94A 2LBBA 5J3QA 2EMTA 3RCPA 2CRFA 3X23A 3MDBC 3P7ZA 4DX90 1Z87A 1FGZA 2QKMA 2D2QA 1N3HA 1ST7A 2UZRA 1WJ1A 1EF1A 3ODOA 1BAKA 3QBVB 1NVLA 5J3YA 2LG1A 2ADZA 2P0DA 2DYQA 2RLOA 2Z0OA 3D8DA 1H4RA 3UZTA 1WGQA 3EPYA 2G35A 3M1IB 1H10A 1BTNA 1ZSQA 2N0YA 2W2XD 4CHMA 3PEGA 1RRPB 1WGUA 1NU2A 2V76A 1HB8A 2K2UA 4ZRJA 3SUZA 2IYBA 4L6EA 2K2JA 3HK0A 4TYZA 2MWNB 3OANA 3PZDA 2I1JA 1UPRA 3WA0A 3NSUA 1U2BA 3P6AA 2DX1A 1DDWA 4GZUA 5DH9B 1K5GB 5CLQB 2NMBA 2I1KA 5HE0A 2ELAA 5C79A 4GPTB 1PMSA 3SYXA 2UVMA 2DX5A 5HE3A 1ACAA 3VIAA 3BINA 4K2OA 5JLJB 3BJIA 4HHVA 1I2HA 4DBBA 3N7CA 3ODXA 1WJMA 2R0DA 1U5GA 1XCGA 1XR0B 2YRYA 4HB2B 1NI2A 3LJUX 2X18A 3FEHA 2GJYA 1NTVA 5C5BA 2HE7A 1XD4A 4NY0A 2E2XA 2VKIA 5D3XA 2YS1A 1PLSA 4HAUB 2D9XA 4PNKA 1X1GA 1AWEA 2ELBA 1ZC3B 1OQNA 2GS0A 2UZSA 5LONB 2DHJA 2JP2A 2COFA 2R09A 2HRJA 1NTYA 2COCA 2D9YA 4WJ7A 2W2XC 4MT7A 1W1HA 2FJLA 3DXDA 5D27A 4A6FA 1MK7B 3GYPA 2IFSA 5LOPB 4EKUA 2J0JA 1P3RA 1UPQA 2H7DA 1IRSA 3KZ1A 5C5BB 1XODA 3DXCA 4HDQA 1UNPA 5D3YA 1TQZA 3AU5A 4MY6A 4A6HA 1MIXA 2CY4A 2J0MA 5IJMA 1U5EA 3TO1A 2RSGA 1W1GA 2Z0QA 2CAYA 4EJNA 4A6FB 2RUKB 2M38A 1DROA 4DX8A 3KRXA 2YT1A
chains in the Genus database with same CATH superfamily
1V89A 1GC6A 4C0AA 1FB8A 2VRWB 1FGYA 3FLVA 3KY9A 5LG4B 4HB4B 2HTHB 1U27A 4TKNA 2LULA 2GCJA 2KUPA 3KRWA 5JVLA 2MFQA 2D9WA 4KAXB 2ROZB 2DKPA 3E9LA 2P0FA 1I7AA 2J59M 3PVUA 2N23A 2ZPYA 3WYFB 1EGXA 5I2SA 3QWMA 3ODWA 2GCLA 3F0WA 2I5FA 1FHWA 4GNKB 1SGHA 4KHBB 1QQGA 2Q13A 1J19A 5HE2A 3SO6A 3A98B 2KCJA 2FDQA 1Y19B 4CYEA 4JKEA 5CLLB 1J0WA 3HQCA 2YT1A 1VBHA 2XQNM 2L1CA 5J3TA 2M14A 2ABDA 4JKAA 2DYNA 1ZVRA 3ULBA 2AL6A 4CHJA 2RVBB 3AU4A 3V5WA 4F7GA 4P7IA 4K17A 2EMSA 1OMWA 3A8PA 4Z2NA 4ILJA 1PFJA 2ZKMX 1FHOA 2KUQA 4GMXB 3E9PA 1T77A 1X1FA 2EC1A 4NSWA 2Z4DA 2R82A 1U29A 1MPHA 4JK8A 2GUMA 1FOEA 4HAWB 1GGOA 3FP5A 5DHAB 3ZDTA 4OT1A 2KIEA 1RJ2A 1LB1A 3SV1A 1M7RA 4JK9A 2I5CA 4B6HA 4IOYX 3TFMA 4HB0B 4GXBA 1EVHA 3TCAA 5KQ1A 1Y5OA 2YS5A 2MKRA 1UNRA 2LKOA 4GMVA 4IAPA 1XX0A 3ZVRA 1SHCA 5JHGA 2K49A 3F5RA 2OTXA 2Y8FA 2CB8A 4HSIA 4D6WA 2K00A 4JKFA 2YT0A 2YVCA 2AEHA 1U5DA 3G9WA 1XKEA 3D8EA 4KHAA 4H8SA 3FVCA 4Z2MB 4GN1A 4HATB 4YL8A 3TW1A 1HBKA 1WI1A 5KCVA 1WG7A 2DHKA 2YSZA 4L1RA 4HDOA 1HB6A 1MIZB 2J0KA 4MK0A 2COAA 2OQBA 5JP4A 4ZRIA 2DLWA 2FJ9A 2MDXA 1KI1B 4EMOA 3CXBB 1UEFA 3VOQA 4JK7A 3FM8C 5D3VA 1GC7A 1V5MA 3MPXA 2RQ1A 4YONA 5GOWB 4D0NB 4HAVB 1K5DB 4ILHA 4DX8A 1MK9B 1LW3A 3PSCA 1UNQA 4QJ5B 5IRSA 2LOZA 4F7HA 2PZ1A 2Z0PA 2RNRB 1EAZA 2VSZA 5DHFB 4DXAB 5KQ4A 2P0HA 2DA0A 2DTCA 1AQCA 4WSFA 2K8EA 5C6RA 1FHXA 4K81A 1W1DA 1KC7A 4BBKA 2W2WA 2Z13A 1B55A 2WH5A 1FAOA 4K2PA 3ULCA 3O96A 1WVHA 3SBGA 1DYNA 1DBHA 3ML4A 1BTKA 3KRXA 1NTIA 1DDVA 2CY5A 4KHOA 3CIKA 1M7EA 1VBGA 2D9ZA 1V5UA 2LYDA 3FSSA 3SNHA 5M4YB 4XWXA 4JKGA 1KZGA 3U8ZA 4A6KA 2KGXB 2ROVA 2DN6A 2RGNB 3T06A 3PVLA 1MAIA 3QIJA 2FJUB 2D9VA 5DIFB 2L2IA 3A58A 2YS3A 3GYOA 2CQUA 2Y7BA 1ZC4B 3TVVA 5HE1A 3U7DA 1QC6A 4F7UP 2D4QA 3PVWA 2COPA 1GG3A 3PP2A 2BCJA 4DIXA 4WVFB 1X05A 2H7EA 2D10A 1TJ6A 4IFSA 2D11A 2NBVA 1P5TA 1KZ7A 1DDMA 3E9OA 1ZM0A 4HB3B 1BWNA 3D8FA 3IVFA 2DIKA 1P6SA 5L81A 3AJ4A 4ZRKA 5C16A 4JKGB 2Z59A 1X11A 1V5PA 2NZ8B 1V88A 1Q67A 2P8VA 2EJ8A 4QJ3B 2YF0A 4HAXB 4QJ4B 4KVGB 3DXEA 5EFXA 5FI1A 5I2MA 3HW2B 4A5KA 4QXAB 1V61A 4HAZB 2CODA 3DCXA 2LOXA 2Y8GA 1X86A 5DI9B 5JHHA 2QKLA 1E5WA 2DKQA 1ISNA 3PG7A 3A8QA 5D3WA 4ILGB 2DHIA 5FI0A 1TXDA 1MKEA 1OY2A 3KSYA 3NWDA 3U12A 4PQ0A 1U5FA 2DFKA 3NW8A 4HAYB 4Y94A 2LBBA 5J3QA 2EMTA 3RCPA 2CRFA 3X23A 3MDBC 3P7ZA 4DX90 1Z87A 1FGZA 2QKMA 2D2QA 3OHMB 1N3HA 2UZRA 1WJ1A 1EF1A 3ODOA 1BAKA 3QBVB 1NVLA 5J3YA 3ENBA 2LG1A 2ADZA 2P0DA 2DYQA 2RLOA 1KBLA 2Z0OA 4GOUA 3D8DA 1H4RA 3UZTA 1WGQA 3EPYA 2G35A 3M1IB 1ZYIA 1H10A 1BTNA 1ZSQA 2N0YA 2W2XD 4CHMA 3PEGA 1RRPB 1WGUA 1NU2A 2V76A 1HB8A 2K2UA 2Z14A 4ZRJA 3SUZA 2IYBA 4L6EA 2K2JA 3HK0A 4TYZA 2MWNB 3OANA 3PZDA 2I1JA 1UPRA 3WA0A 3NSUA 1U2BA 3P6AA 2DX1A 1DDWA 4GZUA 5DH9B 1K5GB 4JKCA 5CLQB 2NMBA 2I1KA 5HE0A 2ELAA 5C79A 4GPTB 3B77A 1PMSA 3SYXA 2UVMA 2DX5A 5HE3A 1ACAA 3VIAA 3SBTA 3BINA 4K2OA 5JLJB 3BJIA 4HHVA 1I2HA 4DBBA 1JDEA 3N7CA 1WJMA 2R0DA 3ODXA 1U5GA 1XCGA 1XR0B 2YRYA 4HB2B 1NI2A 1MI1A 3LJUX 2X18A 3FEHA 2GJYA 1NTVA 2YT2A 5C5BA 2HE7A 1XD4A 4NY0A 2E2XA 2VKIA 5D3XA 3E66A 2YS1A 1PLSA 4JKBA 4HAUB 2D9XA 4PNKA 4OSNA 1X1GA 2X0SA 1DIKA 1AWEA 2ELBA 1ZC3B 1OQNA 2GS0A 2UZSA 5LONB 2JP2A 2DHJA 4JKHA 2COFA 2R09A 2HRJA 1NTYA 2COCA 2D9YA 4WJ7A 2W2XC 4MT7A 1W1HA 2FJLA 3DXDA 5D27A 2R2YA 4A6FA 1MK7B 3GYPA 2IFSA 5LOPB 4EKUA 4CSQA 2J0JA 4JKDA 2H7DA 1P3RA 1UPQA 1IRSA 3KZ1A 5C5BB 1XODA 3DXCA 4HDQA 3NWFA 1UNPA 5D3YA 1TQZA 3AU5A 4MY6A 4A6HA 2KIGA 1MIXA 3NWAA 3HIEA 2CY4A 2RRFA 2J0MA 5IJMA 1U5EA 3TO1A 2RSGA 2KR0A 1W1GA 2Z0QA 2CAYA 4EJNA 4A6FB 2RUKB 2M38A 1DROA 4KHBA 3HSAA 1ST7A
chains in the Genus database with same CATH topology
1V89A 1GC6A 4C0AA 1FB8A 2VRWB 1FGYA 3FLVA 3KY9A 4HB4B 2HTHB 1U27A 4TKNA 2LULA 2GCJA 2KUPA 3KRWA 5JVLA 2MFQA 2D9WA 4KAXB 2ROZB 2DKPA 3E9LA 2P0FA 1I7AA 2J59M 3PVUA 2N23A 2ZPYA 3WYFB 1EGXA 3QWMA 3ODWA 2GCLA 3F0WA 2I5FA 1FHWA 1SGHA 4KHBB 1QQGA 2Q13A 1J19A 5HE2A 3SO6A 3A98B 2KCJA 2FDQA 1Y19B 4CYEA 4JKEA 5CLLB 1J0WA 3HQCA 2YT1A 1VBHA 2XQNM 2L1CA 5J3TA 2M14A 2ABDA 4JKAA 2DYNA 1ZVRA 3ULBA 2AL6A 4CHJA 2RVBB 3AU4A 3V5WA 4F7GA 4P7IA 4K17A 2EMSA 1OMWA 3A8PA 4Z2NA 4ILJA 1PFJA 1FHOA 4GMXB 3E9PA 1X1FA 2EC1A 4NSWA 2R82A 1U29A 1MPHA 4JK8A 1FOEA 4HAWB 1GGOA 3FP5A 5DHAB 3ZDTA 1RJ2A 1LB1A 3SV1A 1M7RA 4JK9A 2I5CA 4B6HA 4IOYX 3TFMA 4HB0B 4GXBA 1EVHA 3TCAA 5KQ1A 1Y5OA 2YS5A 2MKRA 1UNRA 2LKOA 4GMVA 4IAPA 1XX0A 3ZVRA 1SHCA 5JHGA 3F5RA 2OTXA 2Y8FA 2CB8A 2K00A 4JKFA 2YT0A 2YVCA 2AEHA 1U5DA 3G9WA 1XKEA 3D8EA 4KHAA 4H8SA 4Z2MB 4GN1A 4HATB 4YL8A 3TW1A 1HBKA 1WI1A 5KCVA 1WG7A 2DHKA 2YSZA 4HDOA 1HB6A 1MIZB 2J0KA 4MK0A 2COAA 2OQBA 5JP4A 4ZRIA 2DLWA 2FJ9A 2MDXA 1KI1B 4EMOA 3CXBB 1UEFA 3VOQA 4JK7A 3FM8C 5D3VA 1GC7A 1V5MA 3MPXA 2RQ1A 4YONA 5GOWB 4D0NB 4HAVB 1K5DB 4ILHA 1MK9B 1LW3A 3PSCA 1UNQA 2LOZA 4F7HA 2PZ1A 2Z0PA 2RNRB 1EAZA 2VSZA 5DHFB 4DXAB 5KQ4A 2P0HA 2DA0A 2DTCA 1AQCA 4WSFA 5C6RA 1FHXA 4K81A 1W1DA 1KC7A 4BBKA 2W2WA 1B55A 2WH5A 1FAOA 4K2PA 3ULCA 3O96A 1WVHA 3SBGA 1DYNA 1DBHA 3ML4A 1BTKA 1NTIA 1DDVA 2CY5A 4KHOA 3CIKA 1M7EA 1VBGA 2D9ZA 1V5UA 2LYDA 3FSSA 3SNHA 4XWXA 4JKGA 1KZGA 3U8ZA 4A6KA 2KGXB 2ROVA 2DN6A 2RGNB 3T06A 3PVLA 1MAIA 3QIJA 2D9VA 5DIFB 2L2IA 2YS3A 3GYOA 2CQUA 2Y7BA 1ZC4B 3TVVA 5HE1A 3U7DA 1QC6A 4F7UP 2D4QA 3PVWA 2COPA 1GG3A 3PP2A 2BCJA 4WVFB 1X05A 2H7EA 2D10A 1TJ6A 4IFSA 2D11A 1P5TA 1KZ7A 1DDMA 3E9OA 1ZM0A 4HB3B 1BWNA 3D8FA 3IVFA 2DIKA 1P6SA 5L81A 3AJ4A 4ZRKA 5C16A 4JKGB 1X11A 1V5PA 2NZ8B 1V88A 1Q67A 2P8VA 2EJ8A 2YF0A 4HAXB 4KVGB 3DXEA 5EFXA 5FI1A 3HW2B 4A5KA 1V61A 4HAZB 2CODA 2LOXA 2Y8GA 1X86A 5DI9B 5JHHA 2QKLA 1E5WA 2DKQA 1ISNA 3PG7A 3A8QA 5D3WA 4ILGB 2DHIA 5FI0A 1TXDA 1MKEA 1OY2A 3KSYA 4PQ0A 1U5FA 2DFKA 4HAYB 4Y94A 2LBBA 5J3QA 2EMTA 3RCPA 2CRFA 3X23A 3MDBC 3P7ZA 4DX90 1Z87A 1FGZA 2QKMA 2D2QA 1N3HA 2UZRA 1WJ1A 1EF1A 3ODOA 1BAKA 3QBVB 1NVLA 5J3YA 3ENBA 2LG1A 2ADZA 2P0DA 2DYQA 2RLOA 1KBLA 2Z0OA 3D8DA 1H4RA 3UZTA 1WGQA 3EPYA 2G35A 3M1IB 1H10A 1BTNA 1ZSQA 2N0YA 2W2XD 4CHMA 3PEGA 1RRPB 1WGUA 1NU2A 2V76A 1HB8A 2K2UA 4ZRJA 3SUZA 2IYBA 4L6EA 2K2JA 3HK0A 4TYZA 2MWNB 3OANA 3PZDA 2I1JA 1UPRA 3WA0A 3NSUA 1U2BA 3P6AA 2DX1A 1DDWA 4GZUA 5DH9B 1K5GB 4JKCA 5CLQB 2NMBA 2I1KA 5HE0A 2ELAA 5C79A 4GPTB 1PMSA 3SYXA 2UVMA 2DX5A 5HE3A 1ACAA 3VIAA 3SBTA 3BINA 4K2OA 5JLJB 3BJIA 4HHVA 1I2HA 4DBBA 1JDEA 3N7CA 1WJMA 2R0DA 3ODXA 1U5GA 1XCGA 1XR0B 2YRYA 4HB2B 1NI2A 3LJUX 2X18A 3FEHA 2GJYA 1NTVA 5C5BA 2HE7A 1XD4A 4NY0A 2E2XA 2VKIA 5D3XA 3E66A 2YS1A 1PLSA 4JKBA 4HAUB 2D9XA 4PNKA 1X1GA 2X0SA 1DIKA 1AWEA 2ELBA 1ZC3B 1OQNA 2GS0A 2UZSA 5LONB 2JP2A 2DHJA 4JKHA 2COFA 2R09A 2HRJA 1NTYA 2COCA 2D9YA 4WJ7A 2W2XC 4MT7A 1W1HA 2FJLA 3DXDA 5D27A 4A6FA 1MK7B 3GYPA 2IFSA 5LOPB 4EKUA 2J0JA 4JKDA 2H7DA 1P3RA 1UPQA 1IRSA 3KZ1A 5C5BB 1XODA 3DXCA 4HDQA 1UNPA 5D3YA 1TQZA 3AU5A 4MY6A 4A6HA 1MIXA 2CY4A 2J0MA 5IJMA 1U5EA 3TO1A 2RSGA 1W1GA 2Z0QA 2CAYA 4EJNA 4A6FB 2RUKB 2M38A 1DROA 4DX8A 3KRXA 1ST7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V89 A;  1GC6 A;  4C0A A;  1FB8 A;  2VRW B;  1FGY A;  3FLV A;  3KY9 A;  4HB4 B;  2HTH B;  1U27 A;  4TKN A;  2LUL A;  2GCJ A;  2KUP A;  3KRW A;  2MFQ A;  2D9W A;  4KAX B;  2ROZ B;  2DKP A;  2P0F A;  1I7A A;  2J59 M;  3PVU A;  2N23 A;  2ZPY A;  3WYF B;  1EGX A;  3QWM A;  3ODW A;  2GCL A;  3F0W A;  2I5F A;  1FHW A;  1SGH A;  4KHB B;  1QQG A;  2Q13 A;  1J19 A;  5HE2 A;  3SO6 A;  3A98 B;  2KCJ A;  2FDQ A;  1Y19 B;  4CYE A;  5CLL B;  1J0W A;  3HQC A;  2XQN M;  2L1C A;  5J3T A;  2M14 A;  2ABD A;  2DYN A;  1ZVR A;  3ULB A;  2AL6 A;  4CHJ A;  2RVB B;  3AU4 A;  3V5W A;  4F7G A;  4P7I A;  4K17 A;  2EMS A;  1OMW A;  3A8P A;  4Z2N A;  1PFJ A;  1FHO A;  4GMX B;  1X1F A;  2EC1 A;  4NSW A;  1U29 A;  1MPH A;  1FOE A;  4HAW B;  3FP5 A;  5DHA B;  3ZDT A;  1RJ2 A;  1LB1 A;  3SV1 A;  1M7R A;  2I5C A;  4B6H A;  4IOY X;  3TFM A;  4HB0 B;  4GXB A;  1EVH A;  3TCA A;  5KQ1 A;  1Y5O A;  2YS5 A;  2MKR A;  1UNR A;  2LKO A;  4GMV A;  4IAP A;  1XX0 A;  3ZVR A;  1SHC A;  5JHG A;  3F5R A;  2OTX A;  2Y8F A;  2CB8 A;  2K00 A;  2YT0 A;  2YVC A;  2AEH A;  1U5D A;  3G9W A;  1XKE A;  3D8E A;  4KHA A;  4H8S A;  4Z2M B;  4GN1 A;  4HAT B;  4YL8 A;  3TW1 A;  1HBK A;  1WI1 A;  5KCV A;  1WG7 A;  2DHK A;  2YSZ A;  4HDO A;  1HB6 A;  1MIZ B;  2J0K A;  4MK0 A;  2COA A;  2OQB A;  5JP4 A;  4ZRI A;  2DLW A;  2FJ9 A;  2MDX A;  1KI1 B;  4EMO A;  3CXB B;  1UEF A;  3VOQ A;  3FM8 C;  5D3V A;  1GC7 A;  1V5M A;  3MPX A;  2RQ1 A;  4YON A;  5GOW B;  4D0N B;  4HAV B;  1K5D B;  1MK9 B;  1LW3 A;  3PSC A;  1UNQ A;  2LOZ A;  4F7H A;  2PZ1 A;  2Z0P A;  2RNR B;  1EAZ A;  2VSZ A;  5DHF B;  4DXA B;  5KQ4 A;  2P0H A;  2DA0 A;  2DTC A;  1AQC A;  4WSF A;  5C6R A;  1FHX A;  4K81 A;  1W1D A;  4BBK A;  2W2W A;  1B55 A;  2WH5 A;  1FAO A;  4K2P A;  3ULC A;  3O96 A;  1WVH A;  1DYN A;  1DBH A;  3ML4 A;  1BTK A;  1NTI A;  1DDV A;  2CY5 A;  4KHO A;  3CIK A;  1M7E A;  2D9Z A;  1V5U A;  2LYD A;  3FSS A;  3SNH A;  4XWX A;  1KZG A;  4A6K A;  3U8Z A;  2KGX B;  2ROV A;  2DN6 A;  2RGN B;  3T06 A;  3PVL A;  1MAI A;  3QIJ A;  2D9V A;  5DIF B;  2L2I A;  2YS3 A;  3GYO A;  2CQU A;  2Y7B A;  1ZC4 B;  3TVV A;  5HE1 A;  3U7D A;  1QC6 A;  4F7U P;  2D4Q A;  3PVW A;  2COP A;  1GG3 A;  3PP2 A;  2BCJ A;  4WVF B;  1X05 A;  2H7E A;  2D10 A;  1TJ6 A;  4IFS A;  2D11 A;  1P5T A;  1KZ7 A;  1DDM A;  1ZM0 A;  4HB3 B;  1BWN A;  3D8F A;  3IVF A;  1P6S A;  5L81 A;  3AJ4 A;  4ZRK A;  5C16 A;  1X11 A;  1V5P A;  2NZ8 B;  1V88 A;  1Q67 A;  2P8V A;  2EJ8 A;  2YF0 A;  4HAX B;  4KVG B;  3DXE A;  5EFX A;  5FI1 A;  3HW2 B;  4A5K A;  1V61 A;  4HAZ B;  2COD A;  2LOX A;  2Y8G A;  1X86 A;  5DI9 B;  5JHH A;  2QKL A;  1E5W A;  2DKQ A;  1ISN A;  3PG7 A;  3A8Q A;  5D3W A;  2DHI A;  5FI0 A;  1TXD A;  1MKE A;  1OY2 A;  3KSY A;  4PQ0 A;  1U5F A;  2DFK A;  4HAY B;  4Y94 A;  2LBB A;  5J3Q A;  2EMT A;  3RCP A;  2CRF A;  3X23 A;  3MDB C;  3P7Z A;  4DX9 0;  1Z87 A;  1FGZ A;  2QKM A;  2D2Q A;  1N3H A;  1ST7 A;  2UZR A;  1WJ1 A;  1EF1 A;  3ODO A;  1BAK A;  3QBV B;  1NVL A;  5J3Y A;  2LG1 A;  2ADZ A;  2P0D A;  2DYQ A;  2RLO A;  2Z0O A;  3D8D A;  1H4R A;  3UZT A;  1WGQ A;  3EPY A;  2G35 A;  3M1I B;  1H10 A;  1BTN A;  1ZSQ A;  2N0Y A;  2W2X D;  4CHM A;  3PEG A;  1RRP B;  1WGU A;  1NU2 A;  2V76 A;  1HB8 A;  2K2U A;  4ZRJ A;  3SUZ A;  2IYB A;  4L6E A;  2K2J A;  3HK0 A;  4TYZ A;  2MWN B;  3OAN A;  3PZD A;  2I1J A;  1UPR A;  3WA0 A;  3NSU A;  1U2B A;  3P6A A;  2DX1 A;  1DDW A;  4GZU A;  5DH9 B;  1K5G B;  5CLQ B;  2NMB A;  2I1K A;  5HE0 A;  2ELA A;  5C79 A;  4GPT B;  1PMS A;  3SYX A;  2UVM A;  2DX5 A;  5HE3 A;  1ACA A;  3VIA A;  3BIN A;  4K2O A;  5JLJ B;  3BJI A;  4HHV A;  1I2H A;  4DBB A;  3N7C A;  3ODX A;  1WJM A;  2R0D A;  1U5G A;  1XCG A;  1XR0 B;  2YRY A;  4HB2 B;  1NI2 A;  3LJU X;  2X18 A;  3FEH A;  2GJY A;  1NTV A;  5C5B A;  2HE7 A;  1XD4 A;  4NY0 A;  2E2X A;  2VKI A;  5D3X A;  2YS1 A;  1PLS A;  4HAU B;  2D9X A;  4PNK A;  1X1G A;  1AWE A;  2ELB A;  1ZC3 B;  1OQN A;  2GS0 A;  2UZS A;  5LON B;  2DHJ A;  2JP2 A;  2COF A;  2R09 A;  2HRJ A;  1NTY A;  2COC A;  2D9Y A;  4WJ7 A;  2W2X C;  4MT7 A;  1W1H A;  2FJL A;  3DXD A;  5D27 A;  4A6F A;  1MK7 B;  3GYP A;  2IFS A;  5LOP B;  4EKU A;  2J0J A;  1P3R A;  1UPQ A;  2H7D A;  1IRS A;  3KZ1 A;  5C5B B;  1XOD A;  3DXC A;  4HDQ A;  1UNP A;  5D3Y A;  1TQZ A;  3AU5 A;  4MY6 A;  4A6H A;  1MIX A;  2CY4 A;  2J0M A;  5IJM A;  1U5E A;  3TO1 A;  2RSG A;  1W1G A;  2Z0Q A;  2CAY A;  4EJN A;  4A6F B;  2RUK B;  2M38 A;  1DRO A;  4DX8 A;  3KRX A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 1V89 A;  1GC6 A;  4C0A A;  1FB8 A;  2VRW B;  1FGY A;  3FLV A;  3KY9 A;  5LG4 B;  4HB4 B;  2HTH B;  1U27 A;  4TKN A;  2LUL A;  2GCJ A;  2KUP A;  3KRW A;  5JVL A;  2MFQ A;  2D9W A;  4KAX B;  2ROZ B;  2DKP A;  3E9L A;  2P0F A;  1I7A A;  2J59 M;  3PVU A;  2N23 A;  2ZPY A;  3WYF B;  1EGX A;  5I2S A;  3QWM A;  3ODW A;  2GCL A;  3F0W A;  2I5F A;  1FHW A;  4GNK B;  1SGH A;  4KHB B;  1QQG A;  2Q13 A;  1J19 A;  5HE2 A;  3SO6 A;  3A98 B;  2KCJ A;  2FDQ A;  1Y19 B;  4CYE A;  4JKE A;  5CLL B;  1J0W A;  3HQC A;  2YT1 A;  1VBH A;  2XQN M;  2L1C A;  5J3T A;  2M14 A;  2ABD A;  4JKA A;  2DYN A;  1ZVR A;  3ULB A;  2AL6 A;  4CHJ A;  2RVB B;  3AU4 A;  3V5W A;  4F7G A;  4P7I A;  4K17 A;  2EMS A;  1OMW A;  3A8P A;  4Z2N A;  4ILJ A;  1PFJ A;  2ZKM X;  1FHO A;  2KUQ A;  4GMX B;  3E9P A;  1T77 A;  1X1F A;  2EC1 A;  4NSW A;  2Z4D A;  2R82 A;  1U29 A;  1MPH A;  4JK8 A;  2GUM A;  1FOE A;  4HAW B;  1GGO A;  3FP5 A;  5DHA B;  3ZDT A;  4OT1 A;  2KIE A;  1RJ2 A;  1LB1 A;  3SV1 A;  1M7R A;  4JK9 A;  2I5C A;  4B6H A;  4IOY X;  3TFM A;  4HB0 B;  4GXB A;  1EVH A;  3TCA A;  5KQ1 A;  1Y5O A;  2YS5 A;  2MKR A;  1UNR A;  2LKO A;  4GMV A;  4IAP A;  1XX0 A;  3ZVR A;  1SHC A;  5JHG A;  2K49 A;  3F5R A;  2OTX A;  2Y8F A;  2CB8 A;  4HSI A;  4D6W A;  2K00 A;  4JKF A;  2YT0 A;  2YVC A;  2AEH A;  1U5D A;  3G9W A;  1XKE A;  3D8E A;  4KHA A;  4H8S A;  3FVC A;  4Z2M B;  4GN1 A;  4HAT B;  4YL8 A;  3TW1 A;  1HBK A;  1WI1 A;  5KCV A;  1WG7 A;  2DHK A;  2YSZ A;  4L1R A;  4HDO A;  1HB6 A;  1MIZ B;  2J0K A;  4MK0 A;  2COA A;  2OQB A;  5JP4 A;  4ZRI A;  2DLW A;  2FJ9 A;  2MDX A;  1KI1 B;  4EMO A;  3CXB B;  1UEF A;  3VOQ A;  4JK7 A;  3FM8 C;  5D3V A;  1GC7 A;  1V5M A;  3MPX A;  2RQ1 A;  4YON A;  5GOW B;  4D0N B;  4HAV B;  1K5D B;  4ILH A;  4DX8 A;  1MK9 B;  1LW3 A;  3PSC A;  1UNQ A;  4QJ5 B;  5IRS A;  2LOZ A;  4F7H A;  2PZ1 A;  2Z0P A;  2RNR B;  1EAZ A;  2VSZ A;  5DHF B;  4DXA B;  5KQ4 A;  2P0H A;  2DA0 A;  2DTC A;  1AQC A;  4WSF A;  2K8E A;  5C6R A;  1FHX A;  4K81 A;  1W1D A;  1KC7 A;  4BBK A;  2W2W A;  2Z13 A;  1B55 A;  2WH5 A;  1FAO A;  4K2P A;  3ULC A;  3O96 A;  1WVH A;  3SBG A;  1DYN A;  1DBH A;  3ML4 A;  1BTK A;  3KRX A;  1NTI A;  1DDV A;  2CY5 A;  4KHO A;  3CIK A;  1M7E A;  1VBG A;  2D9Z A;  1V5U A;  2LYD A;  3FSS A;  3SNH A;  5M4Y B;  4XWX A;  4JKG A;  1KZG A;  3U8Z A;  4A6K A;  2KGX B;  2ROV A;  2DN6 A;  2RGN B;  3T06 A;  3PVL A;  1MAI A;  3QIJ A;  2FJU B;  2D9V A;  5DIF B;  2L2I A;  3A58 A;  2YS3 A;  3GYO A;  2CQU A;  2Y7B A;  1ZC4 B;  3TVV A;  5HE1 A;  3U7D A;  1QC6 A;  4F7U P;  2D4Q A;  3PVW A;  2COP A;  1GG3 A;  3PP2 A;  2BCJ A;  4DIX A;  4WVF B;  1X05 A;  2H7E A;  2D10 A;  1TJ6 A;  4IFS A;  2D11 A;  2NBV A;  1P5T A;  1KZ7 A;  1DDM A;  3E9O A;  1ZM0 A;  4HB3 B;  1BWN A;  3D8F A;  3IVF A;  2DIK A;  1P6S A;  5L81 A;  3AJ4 A;  4ZRK A;  5C16 A;  4JKG B;  2Z59 A;  1X11 A;  1V5P A;  2NZ8 B;  1V88 A;  1Q67 A;  2P8V A;  2EJ8 A;  4QJ3 B;  2YF0 A;  4HAX B;  4QJ4 B;  4KVG B;  3DXE A;  5EFX A;  5FI1 A;  5I2M A;  3HW2 B;  4A5K A;  4QXA B;  1V61 A;  4HAZ B;  2COD A;  3DCX A;  2LOX A;  2Y8G A;  1X86 A;  5DI9 B;  5JHH A;  2QKL A;  1E5W A;  2DKQ A;  1ISN A;  3PG7 A;  3A8Q A;  5D3W A;  4ILG B;  2DHI A;  5FI0 A;  1TXD A;  1MKE A;  1OY2 A;  3KSY A;  3NWD A;  3U12 A;  4PQ0 A;  1U5F A;  2DFK A;  3NW8 A;  4HAY B;  4Y94 A;  2LBB A;  5J3Q A;  2EMT A;  3RCP A;  2CRF A;  3X23 A;  3MDB C;  3P7Z A;  4DX9 0;  1Z87 A;  1FGZ A;  2QKM A;  2D2Q A;  3OHM B;  1N3H A;  2UZR A;  1WJ1 A;  1EF1 A;  3ODO A;  1BAK A;  3QBV B;  1NVL A;  5J3Y A;  3ENB A;  2LG1 A;  2ADZ A;  2P0D A;  2DYQ A;  2RLO A;  1KBL A;  2Z0O A;  4GOU A;  3D8D A;  1H4R A;  3UZT A;  1WGQ A;  3EPY A;  2G35 A;  3M1I B;  1ZYI A;  1H10 A;  1BTN A;  1ZSQ A;  2N0Y A;  2W2X D;  4CHM A;  3PEG A;  1RRP B;  1WGU A;  1NU2 A;  2V76 A;  1HB8 A;  2K2U A;  2Z14 A;  4ZRJ A;  3SUZ A;  2IYB A;  4L6E A;  2K2J A;  3HK0 A;  4TYZ A;  2MWN B;  3OAN A;  3PZD A;  2I1J A;  1UPR A;  3WA0 A;  3NSU A;  1U2B A;  3P6A A;  2DX1 A;  1DDW A;  4GZU A;  5DH9 B;  1K5G B;  4JKC A;  5CLQ B;  2NMB A;  2I1K A;  5HE0 A;  2ELA A;  5C79 A;  4GPT B;  3B77 A;  1PMS A;  3SYX A;  2UVM A;  2DX5 A;  5HE3 A;  1ACA A;  3VIA A;  3SBT A;  3BIN A;  4K2O A;  5JLJ B;  3BJI A;  4HHV A;  1I2H A;  4DBB A;  1JDE A;  3N7C A;  1WJM A;  2R0D A;  3ODX A;  1U5G A;  1XCG A;  1XR0 B;  2YRY A;  4HB2 B;  1NI2 A;  1MI1 A;  3LJU X;  2X18 A;  3FEH A;  2GJY A;  1NTV A;  2YT2 A;  5C5B A;  2HE7 A;  1XD4 A;  4NY0 A;  2E2X A;  2VKI A;  5D3X A;  3E66 A;  2YS1 A;  1PLS A;  4JKB A;  4HAU B;  2D9X A;  4PNK A;  4OSN A;  1X1G A;  2X0S A;  1DIK A;  1AWE A;  2ELB A;  1ZC3 B;  1OQN A;  2GS0 A;  2UZS A;  5LON B;  2JP2 A;  2DHJ A;  4JKH A;  2COF A;  2R09 A;  2HRJ A;  1NTY A;  2COC A;  2D9Y A;  4WJ7 A;  2W2X C;  4MT7 A;  1W1H A;  2FJL A;  3DXD A;  5D27 A;  2R2Y A;  4A6F A;  1MK7 B;  3GYP A;  2IFS A;  5LOP B;  4EKU A;  4CSQ A;  2J0J A;  4JKD A;  2H7D A;  1P3R A;  1UPQ A;  1IRS A;  3KZ1 A;  5C5B B;  1XOD A;  3DXC A;  4HDQ A;  3NWF A;  1UNP A;  5D3Y A;  1TQZ A;  3AU5 A;  4MY6 A;  4A6H A;  2KIG A;  1MIX A;  3NWA A;  3HIE A;  2CY4 A;  2RRF A;  2J0M A;  5IJM A;  1U5E A;  3TO1 A;  2RSG A;  2KR0 A;  1W1G A;  2Z0Q A;  2CAY A;  4EJN A;  4A6F B;  2RUK B;  2M38 A;  1DRO A;  4KHB A;  3HSA A;  1ST7 A; 
#chains in the Genus database with same CATH homology
 1V89 A;  1GC6 A;  4C0A A;  1FB8 A;  2VRW B;  1FGY A;  3FLV A;  3KY9 A;  4HB4 B;  2HTH B;  1U27 A;  4TKN A;  2LUL A;  2GCJ A;  2KUP A;  3KRW A;  5JVL A;  2MFQ A;  2D9W A;  4KAX B;  2ROZ B;  2DKP A;  3E9L A;  2P0F A;  1I7A A;  2J59 M;  3PVU A;  2N23 A;  2ZPY A;  3WYF B;  1EGX A;  3QWM A;  3ODW A;  2GCL A;  3F0W A;  2I5F A;  1FHW A;  1SGH A;  4KHB B;  1QQG A;  2Q13 A;  1J19 A;  5HE2 A;  3SO6 A;  3A98 B;  2KCJ A;  2FDQ A;  1Y19 B;  4CYE A;  4JKE A;  5CLL B;  1J0W A;  3HQC A;  2YT1 A;  1VBH A;  2XQN M;  2L1C A;  5J3T A;  2M14 A;  2ABD A;  4JKA A;  2DYN A;  1ZVR A;  3ULB A;  2AL6 A;  4CHJ A;  2RVB B;  3AU4 A;  3V5W A;  4F7G A;  4P7I A;  4K17 A;  2EMS A;  1OMW A;  3A8P A;  4Z2N A;  4ILJ A;  1PFJ A;  1FHO A;  4GMX B;  3E9P A;  1X1F A;  2EC1 A;  4NSW A;  2R82 A;  1U29 A;  1MPH A;  4JK8 A;  1FOE A;  4HAW B;  1GGO A;  3FP5 A;  5DHA B;  3ZDT A;  1RJ2 A;  1LB1 A;  3SV1 A;  1M7R A;  4JK9 A;  2I5C A;  4B6H A;  4IOY X;  3TFM A;  4HB0 B;  4GXB A;  1EVH A;  3TCA A;  5KQ1 A;  1Y5O A;  2YS5 A;  2MKR A;  1UNR A;  2LKO A;  4GMV A;  4IAP A;  1XX0 A;  3ZVR A;  1SHC A;  5JHG A;  3F5R A;  2OTX A;  2Y8F A;  2CB8 A;  2K00 A;  4JKF A;  2YT0 A;  2YVC A;  2AEH A;  1U5D A;  3G9W A;  1XKE A;  3D8E A;  4KHA A;  4H8S A;  4Z2M B;  4GN1 A;  4HAT B;  4YL8 A;  3TW1 A;  1HBK A;  1WI1 A;  5KCV A;  1WG7 A;  2DHK A;  2YSZ A;  4HDO A;  1HB6 A;  1MIZ B;  2J0K A;  4MK0 A;  2COA A;  2OQB A;  5JP4 A;  4ZRI A;  2DLW A;  2FJ9 A;  2MDX A;  1KI1 B;  4EMO A;  3CXB B;  1UEF A;  3VOQ A;  4JK7 A;  3FM8 C;  5D3V A;  1GC7 A;  1V5M A;  3MPX A;  2RQ1 A;  4YON A;  5GOW B;  4D0N B;  4HAV B;  1K5D B;  4ILH A;  1MK9 B;  1LW3 A;  3PSC A;  1UNQ A;  2LOZ A;  4F7H A;  2PZ1 A;  2Z0P A;  2RNR B;  1EAZ A;  2VSZ A;  5DHF B;  4DXA B;  5KQ4 A;  2P0H A;  2DA0 A;  2DTC A;  1AQC A;  4WSF A;  5C6R A;  1FHX A;  4K81 A;  1W1D A;  1KC7 A;  4BBK A;  2W2W A;  1B55 A;  2WH5 A;  1FAO A;  4K2P A;  3ULC A;  3O96 A;  1WVH A;  3SBG A;  1DYN A;  1DBH A;  3ML4 A;  1BTK A;  1NTI A;  1DDV A;  2CY5 A;  4KHO A;  3CIK A;  1M7E A;  1VBG A;  2D9Z A;  1V5U A;  2LYD A;  3FSS A;  3SNH A;  4XWX A;  4JKG A;  1KZG A;  3U8Z A;  4A6K A;  2KGX B;  2ROV A;  2DN6 A;  2RGN B;  3T06 A;  3PVL A;  1MAI A;  3QIJ A;  2D9V A;  5DIF B;  2L2I A;  2YS3 A;  3GYO A;  2CQU A;  2Y7B A;  1ZC4 B;  3TVV A;  5HE1 A;  3U7D A;  1QC6 A;  4F7U P;  2D4Q A;  3PVW A;  2COP A;  1GG3 A;  3PP2 A;  2BCJ A;  4WVF B;  1X05 A;  2H7E A;  2D10 A;  1TJ6 A;  4IFS A;  2D11 A;  1P5T A;  1KZ7 A;  1DDM A;  3E9O A;  1ZM0 A;  4HB3 B;  1BWN A;  3D8F A;  3IVF A;  2DIK A;  1P6S A;  5L81 A;  3AJ4 A;  4ZRK A;  5C16 A;  4JKG B;  1X11 A;  1V5P A;  2NZ8 B;  1V88 A;  1Q67 A;  2P8V A;  2EJ8 A;  2YF0 A;  4HAX B;  4KVG B;  3DXE A;  5EFX A;  5FI1 A;  3HW2 B;  4A5K A;  1V61 A;  4HAZ B;  2COD A;  2LOX A;  2Y8G A;  1X86 A;  5DI9 B;  5JHH A;  2QKL A;  1E5W A;  2DKQ A;  1ISN A;  3PG7 A;  3A8Q A;  5D3W A;  4ILG B;  2DHI A;  5FI0 A;  1TXD A;  1MKE A;  1OY2 A;  3KSY A;  4PQ0 A;  1U5F A;  2DFK A;  4HAY B;  4Y94 A;  2LBB A;  5J3Q A;  2EMT A;  3RCP A;  2CRF A;  3X23 A;  3MDB C;  3P7Z A;  4DX9 0;  1Z87 A;  1FGZ A;  2QKM A;  2D2Q A;  1N3H A;  2UZR A;  1WJ1 A;  1EF1 A;  3ODO A;  1BAK A;  3QBV B;  1NVL A;  5J3Y A;  3ENB A;  2LG1 A;  2ADZ A;  2P0D A;  2DYQ A;  2RLO A;  1KBL A;  2Z0O A;  3D8D A;  1H4R A;  3UZT A;  1WGQ A;  3EPY A;  2G35 A;  3M1I B;  1H10 A;  1BTN A;  1ZSQ A;  2N0Y A;  2W2X D;  4CHM A;  3PEG A;  1RRP B;  1WGU A;  1NU2 A;  2V76 A;  1HB8 A;  2K2U A;  4ZRJ A;  3SUZ A;  2IYB A;  4L6E A;  2K2J A;  3HK0 A;  4TYZ A;  2MWN B;  3OAN A;  3PZD A;  2I1J A;  1UPR A;  3WA0 A;  3NSU A;  1U2B A;  3P6A A;  2DX1 A;  1DDW A;  4GZU A;  5DH9 B;  1K5G B;  4JKC A;  5CLQ B;  2NMB A;  2I1K A;  5HE0 A;  2ELA A;  5C79 A;  4GPT B;  1PMS A;  3SYX A;  2UVM A;  2DX5 A;  5HE3 A;  1ACA A;  3VIA A;  3SBT A;  3BIN A;  4K2O A;  5JLJ B;  3BJI A;  4HHV A;  1I2H A;  4DBB A;  1JDE A;  3N7C A;  1WJM A;  2R0D A;  3ODX A;  1U5G A;  1XCG A;  1XR0 B;  2YRY A;  4HB2 B;  1NI2 A;  3LJU X;  2X18 A;  3FEH A;  2GJY A;  1NTV A;  5C5B A;  2HE7 A;  1XD4 A;  4NY0 A;  2E2X A;  2VKI A;  5D3X A;  3E66 A;  2YS1 A;  1PLS A;  4JKB A;  4HAU B;  2D9X A;  4PNK A;  1X1G A;  2X0S A;  1DIK A;  1AWE A;  2ELB A;  1ZC3 B;  1OQN A;  2GS0 A;  2UZS A;  5LON B;  2JP2 A;  2DHJ A;  4JKH A;  2COF A;  2R09 A;  2HRJ A;  1NTY A;  2COC A;  2D9Y A;  4WJ7 A;  2W2X C;  4MT7 A;  1W1H A;  2FJL A;  3DXD A;  5D27 A;  4A6F A;  1MK7 B;  3GYP A;  2IFS A;  5LOP B;  4EKU A;  2J0J A;  4JKD A;  2H7D A;  1P3R A;  1UPQ A;  1IRS A;  3KZ1 A;  5C5B B;  1XOD A;  3DXC A;  4HDQ A;  1UNP A;  5D3Y A;  1TQZ A;  3AU5 A;  4MY6 A;  4A6H A;  1MIX A;  2CY4 A;  2J0M A;  5IJM A;  1U5E A;  3TO1 A;  2RSG A;  1W1G A;  2Z0Q A;  2CAY A;  4EJN A;  4A6F B;  2RUK B;  2M38 A;  1DRO A;  4DX8 A;  3KRX A;  1ST7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...