1MIZB

Crystal structure of an integrin beta3-talin chimera
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords integrin beta3
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mizB01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mizB02
3PSCA 2J0MA 4HDOA 1QC6A 3QBVB 1WGQA 4IAPA 1WVHA 1FGZA 1PLSA 2BCJA 2P8VA 4HB3B 4NSWA 4GN1A 1X05A 4C0AA 1TJ6A 1TXDA 4L6EA 4PNKA 4A6HA 5IJMA 1LW3A 1FGYA 1GG3A 1WI1A 3D8EA 1E5WA 1V88A 3AU5A 4CHMA 4MT7A 2P0DA 5L81A 1RJ2A 1W1GA 5J3TA 2DA0A 3P7ZA 1NTVA 2D9ZA 3VOQA 2R09A 1I2HA 4F7HA 4WJ7A 2J59M 4EKUA 3FP5A 1WGUA 3MPXA 2D4QA 4WSFA 2FDQA 3DXEA 3ZVRA 5C5BA 2J0KA 2CAYA 1NTYA 4A6FB 2DX1A 2NMBA 2P0HA 4HAYB 2ELAA 5FI0A 5JHGA 2YVCA 2RGNB 4KAXB 3F5RA 5HE3A 4GMXB 5DIFB 1NI2A 2Y7BA 2CY4A 3GYOA 2HE7A 3KY9A 2COCA 2D11A 1X1GA 2HTHB 3BJIA 1MK9B 5LONB 3ULCA 2W2XC 2DHJA 2VSZA 2XQNM 1GC7A 4DXAB 1ZC4B 4D0NB 3D8FA 1MKEA 4HAXB 3HQCA 2H7EA 4CHJA 1DBHA 3IVFA 1V89A 4DBBA 4IOYX 2LBBA 3G9WA 1X86A 4HDQA 2MKRA 4HHVA 1UNPA 5EFXA 2ADZA 1M7EA 3F0WA 1P6SA 2ELBA 2EC1A 2RVBB 3OANA 4A6KA 3AJ4A 2L1CA 1UNRA 1W1HA 2YS3A 3PVUA 4Z2MB 1ZSQA 3DXDA 2RQ1A 1UPQA 4BBKA 5JHHA 5GOWB 2LOXA 3PVLA 4CYEA 2DYQA 2K2UA 2M38A 1AQCA 2P0FA 2YSZA 1XODA 3RCPA 5FI1A 2DKPA 1SGHA 3ZDTA 1ZM0A 1FOEA 4TYZA 4B6HA 3ML4A 1LB1A 4P7IA 1OMWA 4MY6A 4F7UP 1BTNA 4H8SA 3KRXA 1DDWA 2OQBA 3TCAA 4YL8A 1P5TA 1PFJA 2IFSA 2X18A 3GYPA 2OTXA 2YS1A 1ST7A 3FEHA 1PMSA 4PQ0A 5D3YA 1UEFA 3HK0A 1MPHA 4HAWB 5JP4A 2EMTA 5JLJB 1Z87A 1Q67A 1XX0A 4K17A 1EGXA 1K5GB 2J0JA 2CY5A 2YF0A 1EAZA 3KRWA 4WVFB 3U7DA 5D3XA 2RNRB 2JP2A 2PZ1A 2COPA 1GC6A 1V5UA 2KGXB 4HB0B 3TFMA 1UPRA 3A8PA 2D9WA 4MK0A 1NTIA 1WJMA 1HB8A 3AU4A 2AEHA 2D9XA 2KUPA 1J19A 4ZRKA 4HB2B 1SHCA 5CLLB 3TW1A 1MIZB 2FJ9A 1V5MA 2E2XA 1AWEA 2MDXA 1V5PA 1H10A 2DFKA 1OY2A 2ROVA 2LG1A 3X23A 4TKNA 5HE0A 5DHFB 2LOZA 2GS0A 2D9VA 3KZ1A 2RUKB 2ZPYA 1TQZA 3FM8C 3PZDA 2LKOA 1MK7B 2VRWB 3ODWA 2LULA 1U5FA 1H4RA 2UVMA 3CXBB 4GXBA 1U5EA 1ZVRA 1DYNA 2Q13A 5D3WA 4A6FA 3N7CA 1FHOA 1N3HA 2GCJA 3NSUA 1QQGA 3PVWA 1ACAA 1ZC3B 3PG7A 1RRPB 1XD4A 4Y94A 1B55A 1J0WA 2DHKA 2N0YA 1WJ1A 2RSGA 3WYFB 4EJNA 1P3RA 1NU2A 2Z0PA 2UZRA 1U5GA 3V5WA 4ZRIA 4HAUB 1U5DA 3KSYA 3SUZA 2H7DA 3T06A 4ZRJA 5CLQB 3UZTA 5DI9B 4EMOA 5C16A 2I5FA 2Z0QA 2DTCA 1V61A 2Y8GA 4NY0A 2YRYA 2QKLA 2W2XD 2D2QA 1FHWA 3A98B 1U2BA 5D27A 2Z0OA 1DDVA 3WA0A 1ISNA 4K2PA 2NZ8B 3A8QA 3QWMA 5C5BB 3EPYA 3HW2B 2DHIA 4KHOA 1U27A 1Y19B 4GPTB 4DX8A 1HB6A 1IRSA 1UNQA 5J3QA 3DXCA 2I1JA 2MFQA 5HE1A 3FSSA 5J3YA 2CRFA 5D3VA 1BWNA 3TO1A 2G35A 2ROZB 4KHAA 2RLOA 2DN6A 1FAOA 2R0DA 1XR0B 2I5CA 2CODA 3PEGA 2AL6A 2DX5A 2GJYA 1W1DA 2D9YA 2Y8FA 2K2JA 1FHXA 1FB8A 1X1FA 4GMVA 1KZGA 2I1KA 4HATB 2LYDA 2UZSA 3QIJA 1U29A 1OQNA 3ODOA 5DH9B 1M7RA 4HAVB 2FJLA 2DYNA 2YT0A 5KQ4A 1K5DB 2L2IA 4HAZB 4F7GA 3FLVA 1NVLA 1DDMA 1KZ7A 2COAA 2YT1A 4GZUA 3D8DA 1XKEA 4HB4B 3U8ZA 3O96A 5LOPB 4KHBB 2K00A 2V76A 2D10A 2GCLA 1HBKA 4DX90 1WG7A 1KI1B 2ABDA 4IFSA 2DKQA 2YS5A 3CIKA 2W2WA 2EJ8A 3ULBA 5C79A 1BTKA 2IYBA 1MIXA 2MWNB 3TVVA 3SO6A 3LJUX 5KCVA 3P6AA 3SV1A 2VKIA 4XWXA 5HE2A 4K2OA 3PP2A 3SYXA 5DHAB 1EVHA 3ODXA 2CQUA 1BAKA 1MAIA 2N23A 2QKMA 1Y5OA 2HRJA 1EF1A 2COFA 5C6RA 3SNHA 4Z2NA 4K81A 2CB8A 5KQ1A 3VIAA 4A5KA 3M1IB 4KVGB 1I7AA 3BINA 1DROA 1X11A 2DLWA 3MDBC 2KCJA 2EMSA 2M14A 2WH5A 4YONA 1XCGA
chains in the Genus database with same CATH superfamily
3PSCA 2J0MA 4HDOA 1QC6A 3QBVB 1WGQA 4JKGA 4IAPA 1WVHA 4JK8A 1FGZA 1PLSA 2BCJA 2P8VA 4HB3B 4NSWA 4GN1A 1X05A 2K8EA 4C0AA 1TJ6A 1TXDA 4HSIA 4L6EA 4PNKA 4A6HA 5IJMA 4DIXA 3NWDA 1LW3A 1FGYA 1GG3A 1WI1A 3HIEA 3D8EA 1E5WA 1V88A 3AU5A 4CHMA 4MT7A 2P0DA 5L81A 1RJ2A 1W1GA 4L1RA 5J3TA 2DA0A 3P7ZA 1NTVA 2D9ZA 3VOQA 2R09A 1I2HA 4F7HA 4WJ7A 4ILGB 1KBLA 2J59M 4EKUA 3FP5A 1WGUA 3MPXA 2D4QA 4WSFA 2FDQA 3DXEA 3ZVRA 2DIKA 5C5BA 2J0KA 2CAYA 1NTYA 4GNKB 4A6FB 2DX1A 2NMBA 2P0HA 4HAYB 2ELAA 5FI0A 5JHGA 2YVCA 4JKFA 2RGNB 3F5RA 4ILJA 4KAXB 4QJ3B 5HE3A 4GMXB 5DIFB 1NI2A 2Y7BA 2CY4A 3GYOA 2HE7A 3KY9A 2COCA 2D11A 1X1GA 2HTHB 3BJIA 1MK9B 5LONB 3ULCA 2X0SA 2W2XC 2DHJA 2VSZA 3OHMB 2XQNM 1GC7A 4DXAB 1ZC4B 4D0NB 3D8FA 1MKEA 4HAXB 3HQCA 3E66A 2H7EA 4CHJA 1DBHA 4JKHA 3IVFA 1V89A 4QXAB 4DBBA 4IOYX 2LBBA 3G9WA 1X86A 4HDQA 3FVCA 2MKRA 4HHVA 4JKAA 1UNPA 5EFXA 2ADZA 3DCXA 1M7EA 3F0WA 1P6SA 2ELBA 2EC1A 2RVBB 2RRFA 3OANA 3AJ4A 4A6KA 2L1CA 1UNRA 1W1HA 2YS3A 3PVUA 5I2MA 4Z2MB 1ZSQA 3DXDA 2RQ1A 4QJ4B 4JKCA 1UPQA 4BBKA 4OT1A 5JHHA 5GOWB 2LOXA 3PVLA 4CYEA 2KIEA 2DYQA 2K2UA 2M38A 1AQCA 2P0FA 2YSZA 1XODA 4KHBA 3RCPA 4JKBA 5FI1A 2DKPA 1SGHA 3ZDTA 1ZM0A 1FOEA 4TYZA 4B6HA 3ML4A 1LB1A 4P7IA 2K49A 1OMWA 1ZYIA 4MY6A 4F7UP 1BTNA 4H8SA 2Z4DA 3KRXA 1DIKA 1DDWA 2OQBA 3TCAA 4YL8A 1P5TA 1PFJA 2IFSA 2X18A 3GYPA 2OTXA 2YS1A 1ST7A 3FEHA 1PMSA 4PQ0A 5D3YA 1UEFA 3HK0A 1MPHA 4HAWB 5JP4A 2EMTA 5JLJB 1Z87A 1Q67A 2KR0A 1XX0A 4K17A 4JK7A 1K5GB 2FJUB 1EGXA 4GOUA 2J0JA 2CY5A 2YF0A 1EAZA 3KRWA 4WVFB 3U7DA 2GUMA 5D3XA 2RNRB 2JP2A 2PZ1A 2COPA 1GC6A 1V5UA 2KGXB 4HB0B 3TFMA 1UPRA 3A8PA 2D9WA 4MK0A 1NTIA 1WJMA 1HB8A 3AU4A 2AEHA 3E9PA 2D9XA 2KUPA 1J19A 3E9LA 4ZRKA 4HB2B 1SHCA 5CLLB 3TW1A 1MIZB 2FJ9A 1V5MA 1KC7A 2E2XA 1AWEA 2MDXA 1V5PA 1H10A 2DFKA 1OY2A 2ROVA 2LG1A 4TKNA 3X23A 5HE0A 5DHFB 2LOZA 2GS0A 2D9VA 1T77A 2R2YA 3KZ1A 2RUKB 2ZPYA 1TQZA 3FM8C 3PZDA 2LKOA 1MK7B 2VRWB 1MI1A 3ODWA 2NBVA 2LULA 1U5FA 1H4RA 2UVMA 3CXBB 4GXBA 1U5EA 1ZVRA 1DYNA 2Q13A 5D3WA 4A6FA 3N7CA 1FHOA 1N3HA 2GCJA 3NSUA 1QQGA 5I2SA 2Z13A 3PVWA 1ACAA 1ZC3B 3PG7A 4D6WA 1RRPB 1XD4A 4Y94A 2R82A 1B55A 1J0WA 2DHKA 2N0YA 5M4YB 1WJ1A 2Z59A 4JKGB 2RSGA 3WYFB 4EJNA 1P3RA 1NU2A 2Z0PA 2UZRA 1U5GA 3V5WA 4ZRIA 4HAUB 1U5DA 3KSYA 3SUZA 2H7DA 3T06A 4ZRJA 4JKDA 5CLQB 3UZTA 5DI9B 4EMOA 5C16A 2I5FA 2Z0QA 3A58A 2DTCA 1V61A 2Y8GA 4NY0A 2YRYA 2QKLA 4JK9A 2W2XD 2D2QA 5JVLA 2Z14A 1FHWA 3A98B 1U2BA 5D27A 4ILHA 2Z0OA 1DDVA 3WA0A 1ISNA 4K2PA 2NZ8B 3A8QA 3QWMA 5C5BB 2KIGA 3EPYA 3HW2B 2DHIA 4KHOA 1U27A 1Y19B 4GPTB 4DX8A 3ENBA 1HB6A 2KUQA 1IRSA 1UNQA 5J3QA 3DXCA 2I1JA 2MFQA 5HE1A 3FSSA 5J3YA 2CRFA 5D3VA 1BWNA 3TO1A 2G35A 2ROZB 1JDEA 4KHAA 2RLOA 2DN6A 1FAOA 2R0DA 2YT2A 1XR0B 2I5CA 2CODA 3PEGA 2AL6A 2DX5A 2GJYA 2ZKMX 1W1DA 2D9YA 3U12A 2Y8FA 2K2JA 1FHXA 1FB8A 1X1FA 4GMVA 4CSQA 1KZGA 2I1KA 4HATB 2LYDA 4OSNA 2UZSA 3QIJA 1U29A 1OQNA 3ODOA 5DH9B 1M7RA 4HAVB 2FJLA 2DYNA 2YT0A 5KQ4A 5IRSA 3E9OA 1K5DB 2L2IA 4HAZB 4F7GA 3FLVA 1NVLA 1GGOA 4QJ5B 1DDMA 1KZ7A 2COAA 2YT1A 4GZUA 3D8DA 1XKEA 3SBGA 4HB4B 3U8ZA 3O96A 5LOPB 4KHBB 2K00A 2V76A 2D10A 2GCLA 1HBKA 4DX90 1WG7A 1KI1B 2ABDA 4IFSA 2DKQA 2YS5A 4JKEA 3CIKA 2W2WA 2EJ8A 3SBTA 3ULBA 5C79A 1BTKA 2IYBA 1MIXA 2MWNB 3TVVA 3SO6A 3LJUX 5KCVA 1VBHA 3HSAA 3P6AA 3SV1A 2VKIA 4XWXA 5HE2A 4K2OA 3B77A 3PP2A 3SYXA 3NWFA 5DHAB 1EVHA 3ODXA 2CQUA 3NWAA 1BAKA 1MAIA 2N23A 2QKMA 1Y5OA 2HRJA 1EF1A 2COFA 5C6RA 3SNHA 4Z2NA 5LG4B 3NW8A 4K81A 2CB8A 5KQ1A 3VIAA 4A5KA 3M1IB 4KVGB 1I7AA 3BINA 1DROA 1X11A 2DLWA 3MDBC 2KCJA 2EMSA 1VBGA 2M14A 2WH5A 4YONA 1XCGA
chains in the Genus database with same CATH topology
3PSCA 2J0MA 4HDOA 1QC6A 3QBVB 1WGQA 4JKGA 4IAPA 1WVHA 4JK8A 1FGZA 1PLSA 2BCJA 2P8VA 4HB3B 4NSWA 4GN1A 1X05A 4C0AA 1TJ6A 1TXDA 4L6EA 4PNKA 4A6HA 5IJMA 1LW3A 1FGYA 1GG3A 1WI1A 3D8EA 1E5WA 1V88A 3AU5A 4CHMA 4MT7A 2P0DA 5L81A 1RJ2A 1W1GA 5J3TA 2DA0A 3P7ZA 1NTVA 2D9ZA 3VOQA 2R09A 1I2HA 4F7HA 4WJ7A 4ILGB 1KBLA 2J59M 4EKUA 3FP5A 1WGUA 3MPXA 2D4QA 4WSFA 2FDQA 3DXEA 3ZVRA 2DIKA 5C5BA 2J0KA 2CAYA 1NTYA 4A6FB 2DX1A 2NMBA 2P0HA 4HAYB 2ELAA 5FI0A 5JHGA 2YVCA 4JKFA 2RGNB 3F5RA 4ILJA 4KAXB 5HE3A 4GMXB 5DIFB 1NI2A 2Y7BA 2CY4A 3GYOA 2HE7A 3KY9A 2COCA 2D11A 1X1GA 2HTHB 3BJIA 1MK9B 5LONB 3ULCA 2X0SA 2W2XC 2DHJA 2VSZA 2XQNM 1GC7A 4DXAB 1ZC4B 4D0NB 3D8FA 1MKEA 4HAXB 3HQCA 3E66A 2H7EA 4CHJA 1DBHA 4JKHA 3IVFA 1V89A 4DBBA 4IOYX 2LBBA 3G9WA 1X86A 4HDQA 2MKRA 4HHVA 4JKAA 1UNPA 5EFXA 2ADZA 1M7EA 3F0WA 1P6SA 2ELBA 2EC1A 2RVBB 3OANA 4A6KA 3AJ4A 2L1CA 1UNRA 1W1HA 2YS3A 3PVUA 4Z2MB 1ZSQA 3DXDA 2RQ1A 4JKCA 1UPQA 4BBKA 5JHHA 5GOWB 2LOXA 3PVLA 4CYEA 2DYQA 2K2UA 2M38A 1AQCA 2P0FA 2YSZA 1XODA 3RCPA 4JKBA 5FI1A 2DKPA 1SGHA 3ZDTA 1ZM0A 1FOEA 4TYZA 4B6HA 3ML4A 1LB1A 4P7IA 1OMWA 4MY6A 4F7UP 1BTNA 4H8SA 3KRXA 1DIKA 1DDWA 2OQBA 3TCAA 4YL8A 1P5TA 1PFJA 2IFSA 2X18A 3GYPA 2OTXA 2YS1A 1ST7A 3FEHA 1PMSA 4PQ0A 5D3YA 1UEFA 3HK0A 1MPHA 4HAWB 5JP4A 2EMTA 5JLJB 1Z87A 1Q67A 1XX0A 4K17A 4JK7A 1K5GB 1EGXA 2J0JA 2CY5A 2YF0A 1EAZA 3KRWA 4WVFB 3U7DA 5D3XA 2RNRB 2JP2A 2PZ1A 2COPA 1GC6A 1V5UA 2KGXB 4HB0B 3TFMA 1UPRA 3A8PA 2D9WA 4MK0A 1NTIA 1WJMA 1HB8A 3AU4A 2AEHA 3E9PA 2D9XA 2KUPA 1J19A 3E9LA 4ZRKA 4HB2B 1SHCA 5CLLB 3TW1A 1MIZB 2FJ9A 1V5MA 1KC7A 2E2XA 1AWEA 2MDXA 1V5PA 1H10A 2DFKA 1OY2A 2ROVA 2LG1A 4TKNA 3X23A 5HE0A 5DHFB 2LOZA 2GS0A 2D9VA 3KZ1A 2RUKB 2ZPYA 1TQZA 3FM8C 3PZDA 2LKOA 1MK7B 2VRWB 3ODWA 2LULA 1U5FA 1H4RA 2UVMA 3CXBB 4GXBA 1U5EA 1ZVRA 1DYNA 2Q13A 5D3WA 4A6FA 3N7CA 1FHOA 1N3HA 2GCJA 3NSUA 1QQGA 3PVWA 1ACAA 1ZC3B 3PG7A 1RRPB 1XD4A 4Y94A 2R82A 1B55A 1J0WA 2DHKA 2N0YA 1WJ1A 4JKGB 2RSGA 3WYFB 4EJNA 1P3RA 1NU2A 2Z0PA 2UZRA 1U5GA 3V5WA 4ZRIA 4HAUB 1U5DA 3KSYA 3SUZA 2H7DA 3T06A 4ZRJA 4JKDA 5CLQB 3UZTA 5DI9B 4EMOA 5C16A 2I5FA 2Z0QA 2DTCA 1V61A 2Y8GA 4NY0A 2YRYA 2QKLA 4JK9A 2W2XD 2D2QA 5JVLA 1FHWA 3A98B 1U2BA 5D27A 4ILHA 2Z0OA 1DDVA 3WA0A 1ISNA 4K2PA 2NZ8B 3A8QA 3QWMA 5C5BB 3EPYA 3HW2B 2DHIA 4KHOA 1U27A 1Y19B 4GPTB 4DX8A 3ENBA 1HB6A 1IRSA 1UNQA 5J3QA 3DXCA 2I1JA 2MFQA 5HE1A 3FSSA 5J3YA 2CRFA 5D3VA 1BWNA 3TO1A 2G35A 2ROZB 1JDEA 4KHAA 2RLOA 2DN6A 1FAOA 2R0DA 1XR0B 2I5CA 2CODA 3PEGA 2AL6A 2DX5A 2GJYA 1W1DA 2D9YA 2Y8FA 2K2JA 1FHXA 1FB8A 1X1FA 4GMVA 1KZGA 2I1KA 4HATB 2LYDA 2UZSA 3QIJA 1U29A 1OQNA 3ODOA 5DH9B 1M7RA 4HAVB 2FJLA 2DYNA 2YT0A 5KQ4A 3E9OA 1K5DB 2L2IA 4HAZB 4F7GA 3FLVA 1NVLA 1GGOA 1DDMA 1KZ7A 2COAA 2YT1A 4GZUA 3D8DA 1XKEA 3SBGA 4HB4B 3U8ZA 3O96A 5LOPB 4KHBB 2K00A 2V76A 2D10A 2GCLA 1HBKA 4DX90 1WG7A 1KI1B 2ABDA 4IFSA 2DKQA 2YS5A 4JKEA 3CIKA 2W2WA 2EJ8A 3SBTA 3ULBA 5C79A 1BTKA 2IYBA 1MIXA 2MWNB 3TVVA 3SO6A 3LJUX 5KCVA 1VBHA 3P6AA 3SV1A 2VKIA 4XWXA 5HE2A 4K2OA 3PP2A 3SYXA 5DHAB 1EVHA 3ODXA 2CQUA 1BAKA 1MAIA 2N23A 2QKMA 1Y5OA 2HRJA 1EF1A 2COFA 5C6RA 3SNHA 4Z2NA 4K81A 2CB8A 5KQ1A 3VIAA 4A5KA 3M1IB 4KVGB 1I7AA 3BINA 1DROA 1X11A 2DLWA 3MDBC 2KCJA 2EMSA 1VBGA 2M14A 2WH5A 4YONA 1XCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSC A;  2J0M A;  4HDO A;  1QC6 A;  3QBV B;  1WGQ A;  4IAP A;  1WVH A;  1FGZ A;  1PLS A;  2BCJ A;  2P8V A;  4HB3 B;  4NSW A;  4GN1 A;  1X05 A;  4C0A A;  1TJ6 A;  1TXD A;  4L6E A;  4PNK A;  4A6H A;  5IJM A;  1LW3 A;  1FGY A;  1GG3 A;  1WI1 A;  3D8E A;  1E5W A;  1V88 A;  3AU5 A;  4CHM A;  4MT7 A;  2P0D A;  5L81 A;  1RJ2 A;  1W1G A;  5J3T A;  2DA0 A;  3P7Z A;  1NTV A;  2D9Z A;  3VOQ A;  2R09 A;  1I2H A;  4F7H A;  4WJ7 A;  2J59 M;  4EKU A;  3FP5 A;  1WGU A;  3MPX A;  2D4Q A;  4WSF A;  2FDQ A;  3DXE A;  3ZVR A;  5C5B A;  2J0K A;  2CAY A;  1NTY A;  4A6F B;  2DX1 A;  2NMB A;  2P0H A;  4HAY B;  2ELA A;  5FI0 A;  5JHG A;  2YVC A;  2RGN B;  4KAX B;  3F5R A;  5HE3 A;  4GMX B;  5DIF B;  1NI2 A;  2Y7B A;  2CY4 A;  3GYO A;  2HE7 A;  3KY9 A;  2COC A;  2D11 A;  1X1G A;  2HTH B;  3BJI A;  1MK9 B;  5LON B;  3ULC A;  2W2X C;  2DHJ A;  2VSZ A;  2XQN M;  1GC7 A;  4DXA B;  1ZC4 B;  4D0N B;  3D8F A;  1MKE A;  4HAX B;  3HQC A;  2H7E A;  4CHJ A;  1DBH A;  3IVF A;  1V89 A;  4DBB A;  4IOY X;  2LBB A;  3G9W A;  1X86 A;  4HDQ A;  2MKR A;  4HHV A;  1UNP A;  5EFX A;  2ADZ A;  1M7E A;  3F0W A;  1P6S A;  2ELB A;  2EC1 A;  2RVB B;  3OAN A;  4A6K A;  3AJ4 A;  2L1C A;  1UNR A;  1W1H A;  2YS3 A;  3PVU A;  4Z2M B;  1ZSQ A;  3DXD A;  2RQ1 A;  1UPQ A;  4BBK A;  5JHH A;  5GOW B;  2LOX A;  3PVL A;  4CYE A;  2DYQ A;  2K2U A;  2M38 A;  1AQC A;  2P0F A;  2YSZ A;  1XOD A;  3RCP A;  5FI1 A;  2DKP A;  1SGH A;  3ZDT A;  1ZM0 A;  1FOE A;  4TYZ A;  4B6H A;  3ML4 A;  1LB1 A;  4P7I A;  1OMW A;  4MY6 A;  4F7U P;  1BTN A;  4H8S A;  3KRX A;  1DDW A;  2OQB A;  3TCA A;  4YL8 A;  1P5T A;  1PFJ A;  2IFS A;  2X18 A;  3GYP A;  2OTX A;  2YS1 A;  1ST7 A;  3FEH A;  1PMS A;  4PQ0 A;  5D3Y A;  1UEF A;  3HK0 A;  1MPH A;  4HAW B;  5JP4 A;  2EMT A;  5JLJ B;  1Z87 A;  1Q67 A;  1XX0 A;  4K17 A;  1EGX A;  1K5G B;  2J0J A;  2CY5 A;  2YF0 A;  1EAZ A;  3KRW A;  4WVF B;  3U7D A;  5D3X A;  2RNR B;  2JP2 A;  2PZ1 A;  2COP A;  1GC6 A;  1V5U A;  2KGX B;  4HB0 B;  3TFM A;  1UPR A;  3A8P A;  2D9W A;  4MK0 A;  1NTI A;  1WJM A;  1HB8 A;  3AU4 A;  2AEH A;  2D9X A;  2KUP A;  1J19 A;  4ZRK A;  4HB2 B;  1SHC A;  5CLL B;  3TW1 A;  1MIZ B;  2FJ9 A;  1V5M A;  2E2X A;  1AWE A;  2MDX A;  1V5P A;  1H10 A;  2DFK A;  1OY2 A;  2ROV A;  2LG1 A;  3X23 A;  4TKN A;  5HE0 A;  5DHF B;  2LOZ A;  2GS0 A;  2D9V A;  3KZ1 A;  2RUK B;  2ZPY A;  1TQZ A;  3FM8 C;  3PZD A;  2LKO A;  1MK7 B;  2VRW B;  3ODW A;  2LUL A;  1U5F A;  1H4R A;  2UVM A;  3CXB B;  4GXB A;  1U5E A;  1ZVR A;  1DYN A;  2Q13 A;  5D3W A;  4A6F A;  3N7C A;  1FHO A;  1N3H A;  2GCJ A;  3NSU A;  1QQG A;  3PVW A;  1ACA A;  1ZC3 B;  3PG7 A;  1RRP B;  1XD4 A;  4Y94 A;  1B55 A;  1J0W A;  2DHK A;  2N0Y A;  1WJ1 A;  2RSG A;  3WYF B;  4EJN A;  1P3R A;  1NU2 A;  2Z0P A;  2UZR A;  1U5G A;  3V5W A;  4ZRI A;  4HAU B;  1U5D A;  3KSY A;  3SUZ A;  2H7D A;  3T06 A;  4ZRJ A;  5CLQ B;  3UZT A;  5DI9 B;  4EMO A;  5C16 A;  2I5F A;  2Z0Q A;  2DTC A;  1V61 A;  2Y8G A;  4NY0 A;  2YRY A;  2QKL A;  2W2X D;  2D2Q A;  1FHW A;  3A98 B;  1U2B A;  5D27 A;  2Z0O A;  1DDV A;  3WA0 A;  1ISN A;  4K2P A;  2NZ8 B;  3A8Q A;  3QWM A;  5C5B B;  3EPY A;  3HW2 B;  2DHI A;  4KHO A;  1U27 A;  1Y19 B;  4GPT B;  4DX8 A;  1HB6 A;  1IRS A;  1UNQ A;  5J3Q A;  3DXC A;  2I1J A;  2MFQ A;  5HE1 A;  3FSS A;  5J3Y A;  2CRF A;  5D3V A;  1BWN A;  3TO1 A;  2G35 A;  2ROZ B;  4KHA A;  2RLO A;  2DN6 A;  1FAO A;  2R0D A;  1XR0 B;  2I5C A;  2COD A;  3PEG A;  2AL6 A;  2DX5 A;  2GJY A;  1W1D A;  2D9Y A;  2Y8F A;  2K2J A;  1FHX A;  1FB8 A;  1X1F A;  4GMV A;  1KZG A;  2I1K A;  4HAT B;  2LYD A;  2UZS A;  3QIJ A;  1U29 A;  1OQN A;  3ODO A;  5DH9 B;  1M7R A;  4HAV B;  2FJL A;  2DYN A;  2YT0 A;  5KQ4 A;  1K5D B;  2L2I A;  4HAZ B;  4F7G A;  3FLV A;  1NVL A;  1DDM A;  1KZ7 A;  2COA A;  2YT1 A;  4GZU A;  3D8D A;  1XKE A;  4HB4 B;  3U8Z A;  3O96 A;  5LOP B;  4KHB B;  2K00 A;  2V76 A;  2D10 A;  2GCL A;  1HBK A;  4DX9 0;  1WG7 A;  1KI1 B;  2ABD A;  4IFS A;  2DKQ A;  2YS5 A;  3CIK A;  2W2W A;  2EJ8 A;  3ULB A;  5C79 A;  1BTK A;  2IYB A;  1MIX A;  2MWN B;  3TVV A;  3SO6 A;  3LJU X;  5KCV A;  3P6A A;  3SV1 A;  2VKI A;  4XWX A;  5HE2 A;  4K2O A;  3PP2 A;  3SYX A;  5DHA B;  1EVH A;  3ODX A;  2CQU A;  1BAK A;  1MAI A;  2N23 A;  2QKM A;  1Y5O A;  2HRJ A;  1EF1 A;  2COF A;  5C6R A;  3SNH A;  4Z2N A;  4K81 A;  2CB8 A;  5KQ1 A;  3VIA A;  4A5K A;  3M1I B;  4KVG B;  1I7A A;  3BIN A;  1DRO A;  1X11 A;  2DLW A;  3MDB C;  2KCJ A;  2EMS A;  2M14 A;  2WH5 A;  4YON A;  1XCG A; 
#chains in the Genus database with same CATH topology
 3PSC A;  2J0M A;  4HDO A;  1QC6 A;  3QBV B;  1WGQ A;  4JKG A;  4IAP A;  1WVH A;  4JK8 A;  1FGZ A;  1PLS A;  2BCJ A;  2P8V A;  4HB3 B;  4NSW A;  4GN1 A;  1X05 A;  2K8E A;  4C0A A;  1TJ6 A;  1TXD A;  4HSI A;  4L6E A;  4PNK A;  4A6H A;  5IJM A;  4DIX A;  3NWD A;  1LW3 A;  1FGY A;  1GG3 A;  1WI1 A;  3HIE A;  3D8E A;  1E5W A;  1V88 A;  3AU5 A;  4CHM A;  4MT7 A;  2P0D A;  5L81 A;  1RJ2 A;  1W1G A;  4L1R A;  5J3T A;  2DA0 A;  3P7Z A;  1NTV A;  2D9Z A;  3VOQ A;  2R09 A;  1I2H A;  4F7H A;  4WJ7 A;  4ILG B;  1KBL A;  2J59 M;  4EKU A;  3FP5 A;  1WGU A;  3MPX A;  2D4Q A;  4WSF A;  2FDQ A;  3DXE A;  3ZVR A;  2DIK A;  5C5B A;  2J0K A;  2CAY A;  1NTY A;  4GNK B;  4A6F B;  2DX1 A;  2NMB A;  2P0H A;  4HAY B;  2ELA A;  5FI0 A;  5JHG A;  2YVC A;  4JKF A;  2RGN B;  3F5R A;  4ILJ A;  4KAX B;  4QJ3 B;  5HE3 A;  4GMX B;  5DIF B;  1NI2 A;  2Y7B A;  2CY4 A;  3GYO A;  2HE7 A;  3KY9 A;  2COC A;  2D11 A;  1X1G A;  2HTH B;  3BJI A;  1MK9 B;  5LON B;  3ULC A;  2X0S A;  2W2X C;  2DHJ A;  2VSZ A;  3OHM B;  2XQN M;  1GC7 A;  4DXA B;  1ZC4 B;  4D0N B;  3D8F A;  1MKE A;  4HAX B;  3HQC A;  3E66 A;  2H7E A;  4CHJ A;  1DBH A;  4JKH A;  3IVF A;  1V89 A;  4QXA B;  4DBB A;  4IOY X;  2LBB A;  3G9W A;  1X86 A;  4HDQ A;  3FVC A;  2MKR A;  4HHV A;  4JKA A;  1UNP A;  5EFX A;  2ADZ A;  3DCX A;  1M7E A;  3F0W A;  1P6S A;  2ELB A;  2EC1 A;  2RVB B;  2RRF A;  3OAN A;  3AJ4 A;  4A6K A;  2L1C A;  1UNR A;  1W1H A;  2YS3 A;  3PVU A;  5I2M A;  4Z2M B;  1ZSQ A;  3DXD A;  2RQ1 A;  4QJ4 B;  4JKC A;  1UPQ A;  4BBK A;  4OT1 A;  5JHH A;  5GOW B;  2LOX A;  3PVL A;  4CYE A;  2KIE A;  2DYQ A;  2K2U A;  2M38 A;  1AQC A;  2P0F A;  2YSZ A;  1XOD A;  4KHB A;  3RCP A;  4JKB A;  5FI1 A;  2DKP A;  1SGH A;  3ZDT A;  1ZM0 A;  1FOE A;  4TYZ A;  4B6H A;  3ML4 A;  1LB1 A;  4P7I A;  2K49 A;  1OMW A;  1ZYI A;  4MY6 A;  4F7U P;  1BTN A;  4H8S A;  2Z4D A;  3KRX A;  1DIK A;  1DDW A;  2OQB A;  3TCA A;  4YL8 A;  1P5T A;  1PFJ A;  2IFS A;  2X18 A;  3GYP A;  2OTX A;  2YS1 A;  1ST7 A;  3FEH A;  1PMS A;  4PQ0 A;  5D3Y A;  1UEF A;  3HK0 A;  1MPH A;  4HAW B;  5JP4 A;  2EMT A;  5JLJ B;  1Z87 A;  1Q67 A;  2KR0 A;  1XX0 A;  4K17 A;  4JK7 A;  1K5G B;  2FJU B;  1EGX A;  4GOU A;  2J0J A;  2CY5 A;  2YF0 A;  1EAZ A;  3KRW A;  4WVF B;  3U7D A;  2GUM A;  5D3X A;  2RNR B;  2JP2 A;  2PZ1 A;  2COP A;  1GC6 A;  1V5U A;  2KGX B;  4HB0 B;  3TFM A;  1UPR A;  3A8P A;  2D9W A;  4MK0 A;  1NTI A;  1WJM A;  1HB8 A;  3AU4 A;  2AEH A;  3E9P A;  2D9X A;  2KUP A;  1J19 A;  3E9L A;  4ZRK A;  4HB2 B;  1SHC A;  5CLL B;  3TW1 A;  1MIZ B;  2FJ9 A;  1V5M A;  1KC7 A;  2E2X A;  1AWE A;  2MDX A;  1V5P A;  1H10 A;  2DFK A;  1OY2 A;  2ROV A;  2LG1 A;  4TKN A;  3X23 A;  5HE0 A;  5DHF B;  2LOZ A;  2GS0 A;  2D9V A;  1T77 A;  2R2Y A;  3KZ1 A;  2RUK B;  2ZPY A;  1TQZ A;  3FM8 C;  3PZD A;  2LKO A;  1MK7 B;  2VRW B;  1MI1 A;  3ODW A;  2NBV A;  2LUL A;  1U5F A;  1H4R A;  2UVM A;  3CXB B;  4GXB A;  1U5E A;  1ZVR A;  1DYN A;  2Q13 A;  5D3W A;  4A6F A;  3N7C A;  1FHO A;  1N3H A;  2GCJ A;  3NSU A;  1QQG A;  5I2S A;  2Z13 A;  3PVW A;  1ACA A;  1ZC3 B;  3PG7 A;  4D6W A;  1RRP B;  1XD4 A;  4Y94 A;  2R82 A;  1B55 A;  1J0W A;  2DHK A;  2N0Y A;  5M4Y B;  1WJ1 A;  2Z59 A;  4JKG B;  2RSG A;  3WYF B;  4EJN A;  1P3R A;  1NU2 A;  2Z0P A;  2UZR A;  1U5G A;  3V5W A;  4ZRI A;  4HAU B;  1U5D A;  3KSY A;  3SUZ A;  2H7D A;  3T06 A;  4ZRJ A;  4JKD A;  5CLQ B;  3UZT A;  5DI9 B;  4EMO A;  5C16 A;  2I5F A;  2Z0Q A;  3A58 A;  2DTC A;  1V61 A;  2Y8G A;  4NY0 A;  2YRY A;  2QKL A;  4JK9 A;  2W2X D;  2D2Q A;  5JVL A;  2Z14 A;  1FHW A;  3A98 B;  1U2B A;  5D27 A;  4ILH A;  2Z0O A;  1DDV A;  3WA0 A;  1ISN A;  4K2P A;  2NZ8 B;  3A8Q A;  3QWM A;  5C5B B;  2KIG A;  3EPY A;  3HW2 B;  2DHI A;  4KHO A;  1U27 A;  1Y19 B;  4GPT B;  4DX8 A;  3ENB A;  1HB6 A;  2KUQ A;  1IRS A;  1UNQ A;  5J3Q A;  3DXC A;  2I1J A;  2MFQ A;  5HE1 A;  3FSS A;  5J3Y A;  2CRF A;  5D3V A;  1BWN A;  3TO1 A;  2G35 A;  2ROZ B;  1JDE A;  4KHA A;  2RLO A;  2DN6 A;  1FAO A;  2R0D A;  2YT2 A;  1XR0 B;  2I5C A;  2COD A;  3PEG A;  2AL6 A;  2DX5 A;  2GJY A;  2ZKM X;  1W1D A;  2D9Y A;  3U12 A;  2Y8F A;  2K2J A;  1FHX A;  1FB8 A;  1X1F A;  4GMV A;  4CSQ A;  1KZG A;  2I1K A;  4HAT B;  2LYD A;  4OSN A;  2UZS A;  3QIJ A;  1U29 A;  1OQN A;  3ODO A;  5DH9 B;  1M7R A;  4HAV B;  2FJL A;  2DYN A;  2YT0 A;  5KQ4 A;  5IRS A;  3E9O A;  1K5D B;  2L2I A;  4HAZ B;  4F7G A;  3FLV A;  1NVL A;  1GGO A;  4QJ5 B;  1DDM A;  1KZ7 A;  2COA A;  2YT1 A;  4GZU A;  3D8D A;  1XKE A;  3SBG A;  4HB4 B;  3U8Z A;  3O96 A;  5LOP B;  4KHB B;  2K00 A;  2V76 A;  2D10 A;  2GCL A;  1HBK A;  4DX9 0;  1WG7 A;  1KI1 B;  2ABD A;  4IFS A;  2DKQ A;  2YS5 A;  4JKE A;  3CIK A;  2W2W A;  2EJ8 A;  3SBT A;  3ULB A;  5C79 A;  1BTK A;  2IYB A;  1MIX A;  2MWN B;  3TVV A;  3SO6 A;  3LJU X;  5KCV A;  1VBH A;  3HSA A;  3P6A A;  3SV1 A;  2VKI A;  4XWX A;  5HE2 A;  4K2O A;  3B77 A;  3PP2 A;  3SYX A;  3NWF A;  5DHA B;  1EVH A;  3ODX A;  2CQU A;  3NWA A;  1BAK A;  1MAI A;  2N23 A;  2QKM A;  1Y5O A;  2HRJ A;  1EF1 A;  2COF A;  5C6R A;  3SNH A;  4Z2N A;  5LG4 B;  3NW8 A;  4K81 A;  2CB8 A;  5KQ1 A;  3VIA A;  4A5K A;  3M1I B;  4KVG B;  1I7A A;  3BIN A;  1DRO A;  1X11 A;  2DLW A;  3MDB C;  2KCJ A;  2EMS A;  1VBG A;  2M14 A;  2WH5 A;  4YON A;  1XCG A; 
#chains in the Genus database with same CATH homology
 3PSC A;  2J0M A;  4HDO A;  1QC6 A;  3QBV B;  1WGQ A;  4JKG A;  4IAP A;  1WVH A;  4JK8 A;  1FGZ A;  1PLS A;  2BCJ A;  2P8V A;  4HB3 B;  4NSW A;  4GN1 A;  1X05 A;  4C0A A;  1TJ6 A;  1TXD A;  4L6E A;  4PNK A;  4A6H A;  5IJM A;  1LW3 A;  1FGY A;  1GG3 A;  1WI1 A;  3D8E A;  1E5W A;  1V88 A;  3AU5 A;  4CHM A;  4MT7 A;  2P0D A;  5L81 A;  1RJ2 A;  1W1G A;  5J3T A;  2DA0 A;  3P7Z A;  1NTV A;  2D9Z A;  3VOQ A;  2R09 A;  1I2H A;  4F7H A;  4WJ7 A;  4ILG B;  1KBL A;  2J59 M;  4EKU A;  3FP5 A;  1WGU A;  3MPX A;  2D4Q A;  4WSF A;  2FDQ A;  3DXE A;  3ZVR A;  2DIK A;  5C5B A;  2J0K A;  2CAY A;  1NTY A;  4A6F B;  2DX1 A;  2NMB A;  2P0H A;  4HAY B;  2ELA A;  5FI0 A;  5JHG A;  2YVC A;  4JKF A;  2RGN B;  3F5R A;  4ILJ A;  4KAX B;  5HE3 A;  4GMX B;  5DIF B;  1NI2 A;  2Y7B A;  2CY4 A;  3GYO A;  2HE7 A;  3KY9 A;  2COC A;  2D11 A;  1X1G A;  2HTH B;  3BJI A;  1MK9 B;  5LON B;  3ULC A;  2X0S A;  2W2X C;  2DHJ A;  2VSZ A;  2XQN M;  1GC7 A;  4DXA B;  1ZC4 B;  4D0N B;  3D8F A;  1MKE A;  4HAX B;  3HQC A;  3E66 A;  2H7E A;  4CHJ A;  1DBH A;  4JKH A;  3IVF A;  1V89 A;  4DBB A;  4IOY X;  2LBB A;  3G9W A;  1X86 A;  4HDQ A;  2MKR A;  4HHV A;  4JKA A;  1UNP A;  5EFX A;  2ADZ A;  1M7E A;  3F0W A;  1P6S A;  2ELB A;  2EC1 A;  2RVB B;  3OAN A;  4A6K A;  3AJ4 A;  2L1C A;  1UNR A;  1W1H A;  2YS3 A;  3PVU A;  4Z2M B;  1ZSQ A;  3DXD A;  2RQ1 A;  4JKC A;  1UPQ A;  4BBK A;  5JHH A;  5GOW B;  2LOX A;  3PVL A;  4CYE A;  2DYQ A;  2K2U A;  2M38 A;  1AQC A;  2P0F A;  2YSZ A;  1XOD A;  3RCP A;  4JKB A;  5FI1 A;  2DKP A;  1SGH A;  3ZDT A;  1ZM0 A;  1FOE A;  4TYZ A;  4B6H A;  3ML4 A;  1LB1 A;  4P7I A;  1OMW A;  4MY6 A;  4F7U P;  1BTN A;  4H8S A;  3KRX A;  1DIK A;  1DDW A;  2OQB A;  3TCA A;  4YL8 A;  1P5T A;  1PFJ A;  2IFS A;  2X18 A;  3GYP A;  2OTX A;  2YS1 A;  1ST7 A;  3FEH A;  1PMS A;  4PQ0 A;  5D3Y A;  1UEF A;  3HK0 A;  1MPH A;  4HAW B;  5JP4 A;  2EMT A;  5JLJ B;  1Z87 A;  1Q67 A;  1XX0 A;  4K17 A;  4JK7 A;  1K5G B;  1EGX A;  2J0J A;  2CY5 A;  2YF0 A;  1EAZ A;  3KRW A;  4WVF B;  3U7D A;  5D3X A;  2RNR B;  2JP2 A;  2PZ1 A;  2COP A;  1GC6 A;  1V5U A;  2KGX B;  4HB0 B;  3TFM A;  1UPR A;  3A8P A;  2D9W A;  4MK0 A;  1NTI A;  1WJM A;  1HB8 A;  3AU4 A;  2AEH A;  3E9P A;  2D9X A;  2KUP A;  1J19 A;  3E9L A;  4ZRK A;  4HB2 B;  1SHC A;  5CLL B;  3TW1 A;  1MIZ B;  2FJ9 A;  1V5M A;  1KC7 A;  2E2X A;  1AWE A;  2MDX A;  1V5P A;  1H10 A;  2DFK A;  1OY2 A;  2ROV A;  2LG1 A;  4TKN A;  3X23 A;  5HE0 A;  5DHF B;  2LOZ A;  2GS0 A;  2D9V A;  3KZ1 A;  2RUK B;  2ZPY A;  1TQZ A;  3FM8 C;  3PZD A;  2LKO A;  1MK7 B;  2VRW B;  3ODW A;  2LUL A;  1U5F A;  1H4R A;  2UVM A;  3CXB B;  4GXB A;  1U5E A;  1ZVR A;  1DYN A;  2Q13 A;  5D3W A;  4A6F A;  3N7C A;  1FHO A;  1N3H A;  2GCJ A;  3NSU A;  1QQG A;  3PVW A;  1ACA A;  1ZC3 B;  3PG7 A;  1RRP B;  1XD4 A;  4Y94 A;  2R82 A;  1B55 A;  1J0W A;  2DHK A;  2N0Y A;  1WJ1 A;  4JKG B;  2RSG A;  3WYF B;  4EJN A;  1P3R A;  1NU2 A;  2Z0P A;  2UZR A;  1U5G A;  3V5W A;  4ZRI A;  4HAU B;  1U5D A;  3KSY A;  3SUZ A;  2H7D A;  3T06 A;  4ZRJ A;  4JKD A;  5CLQ B;  3UZT A;  5DI9 B;  4EMO A;  5C16 A;  2I5F A;  2Z0Q A;  2DTC A;  1V61 A;  2Y8G A;  4NY0 A;  2YRY A;  2QKL A;  4JK9 A;  2W2X D;  2D2Q A;  5JVL A;  1FHW A;  3A98 B;  1U2B A;  5D27 A;  4ILH A;  2Z0O A;  1DDV A;  3WA0 A;  1ISN A;  4K2P A;  2NZ8 B;  3A8Q A;  3QWM A;  5C5B B;  3EPY A;  3HW2 B;  2DHI A;  4KHO A;  1U27 A;  1Y19 B;  4GPT B;  4DX8 A;  3ENB A;  1HB6 A;  1IRS A;  1UNQ A;  5J3Q A;  3DXC A;  2I1J A;  2MFQ A;  5HE1 A;  3FSS A;  5J3Y A;  2CRF A;  5D3V A;  1BWN A;  3TO1 A;  2G35 A;  2ROZ B;  1JDE A;  4KHA A;  2RLO A;  2DN6 A;  1FAO A;  2R0D A;  1XR0 B;  2I5C A;  2COD A;  3PEG A;  2AL6 A;  2DX5 A;  2GJY A;  1W1D A;  2D9Y A;  2Y8F A;  2K2J A;  1FHX A;  1FB8 A;  1X1F A;  4GMV A;  1KZG A;  2I1K A;  4HAT B;  2LYD A;  2UZS A;  3QIJ A;  1U29 A;  1OQN A;  3ODO A;  5DH9 B;  1M7R A;  4HAV B;  2FJL A;  2DYN A;  2YT0 A;  5KQ4 A;  3E9O A;  1K5D B;  2L2I A;  4HAZ B;  4F7G A;  3FLV A;  1NVL A;  1GGO A;  1DDM A;  1KZ7 A;  2COA A;  2YT1 A;  4GZU A;  3D8D A;  1XKE A;  3SBG A;  4HB4 B;  3U8Z A;  3O96 A;  5LOP B;  4KHB B;  2K00 A;  2V76 A;  2D10 A;  2GCL A;  1HBK A;  4DX9 0;  1WG7 A;  1KI1 B;  2ABD A;  4IFS A;  2DKQ A;  2YS5 A;  4JKE A;  3CIK A;  2W2W A;  2EJ8 A;  3SBT A;  3ULB A;  5C79 A;  1BTK A;  2IYB A;  1MIX A;  2MWN B;  3TVV A;  3SO6 A;  3LJU X;  5KCV A;  1VBH A;  3P6A A;  3SV1 A;  2VKI A;  4XWX A;  5HE2 A;  4K2O A;  3PP2 A;  3SYX A;  5DHA B;  1EVH A;  3ODX A;  2CQU A;  1BAK A;  1MAI A;  2N23 A;  2QKM A;  1Y5O A;  2HRJ A;  1EF1 A;  2COF A;  5C6R A;  3SNH A;  4Z2N A;  4K81 A;  2CB8 A;  5KQ1 A;  3VIA A;  4A5K A;  3M1I B;  4KVG B;  1I7A A;  3BIN A;  1DRO A;  1X11 A;  2DLW A;  3MDB C;  2KCJ A;  2EMS A;  1VBG A;  2M14 A;  2WH5 A;  4YON A;  1XCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...