1MIZB

Crystal structure of an integrin beta3-talin chimera
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords integrin beta3
publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mizB01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mizB02
1ZSQA 4ZRJA 4HB4B 3PSCA 2J0KA 1NTYA 1E5WA 3PVLA 4K81A 1FHXA 5D27A 3BJIA 5DIFB 4HDOA 4HAXB 1EVHA 2LOXA 2DN6A 2VRWB 3KZ1A 4DX8A 3CXBB 1J19A 5J3YA 2KUPA 3KY9A 3TO1A 2Y8GA 1U5FA 4P7IA 3FM8C 1IRSA 2LOZA 1UPRA 5HE3A 2HTHB 5LONB 3F0WA 4TKNA 5L81A 5EFXA 1MPHA 4GPTB 2KCJA 4HHVA 2UZSA 3RCPA 4EKUA 1DDWA 2PZ1A 3PP2A 3AJ4A 1U27A 2ZPYA 1XD4A 5DHAB 2YS1A 1NTIA 4K2PA 3CIKA 2V76A 2H7DA 4KVGB 1LW3A 1HB8A 4A6HA 1UPQA 4C0AA 2EMSA 2VKIA 1FOEA 2UZRA 1X11A 1I7AA 1NTVA 1XKEA 2M14A 2KGXB 4Z2MB 4IFSA 3T06A 3LJUX 1V5UA 4WSFA 3FLVA 3ODXA 1U5EA 5C5BA 1HBKA 2W2XC 1KI1B 2J0JA 5KQ1A 2P8VA 1B55A 1W1GA 2EJ8A 2GS0A 2QKMA 1K5DB 3OANA 4HAVB 2ROZB 2W2XD 3ML4A 4K2OA 3SV1A 4BBKA 2D10A 4PQ0A 1QQGA 2DLWA 2GCLA 2MDXA 2Z0OA 4F7GA 1MKEA 3A98B 4HB0B 1FHWA 1WJ1A 5HE2A 2RVBB 1GC7A 1OY2A 5D3YA 2MWNB 1FAOA 5C5BB 2DX1A 5HE1A 2DYQA 1XR0B 3QWMA 3VIAA 4EMOA 1MAIA 2AEHA 3NSUA 5KCVA 2L1CA 2HRJA 2DA0A 1RJ2A 1V88A 1MK7B 3SO6A 1UNPA 3M1IB 5JHHA 4L6EA 5DHFB 3AU5A 2XQNM 4HAZB 2ELAA 2AL6A 2W2WA 4KHAA 1BTKA 1WI1A 2K00A 1W1HA 5C79A 2COPA 3PEGA 2GJYA 2L2IA 2JP2A 2Y7BA 1OMWA 4CHMA 1UEFA 3DXDA 2NZ8B 1I2HA 1U2BA 3HW2B 3MDBC 1TXDA 3U8ZA 3FEHA 2ROVA 5JLJB 4KHOA 1SHCA 3D8FA 5FI1A 1ACAA 2H7EA 2IFSA 4F7UP 1DYNA 5JHGA 1WG7A 4GZUA 3V5WA 2P0HA 3WYFB 4HB3B 1Y5OA 2FDQA 4HB2B 2CQUA 2I1KA 2CODA 1V89A 2MFQA 1ZVRA 2YT1A 2D11A 2BCJA 4HAYB 1V61A 2YT0A 3A8QA 3FSSA 4XWXA 2ABDA 1EGXA 1AQCA 5FI0A 3PZDA 3DXEA 3D8DA 2D9XA 2Z0QA 2LBBA 2G35A 1PFJA 4DX90 2FJLA 4GN1A 4B6HA 1FB8A 4IOYX 4HDQA 5C16A 2RLOA 2Z0PA 1V5MA 1Q67A 4ZRIA 2YS5A 2J59M 1WJMA 3FP5A 2DKQA 2YSZA 2D4QA 1XX0A 3HQCA 5DH9B 5J3TA 1ISNA 3ULCA 5KQ4A 4MT7A 1ZM0A 2COAA 1GC6A 3O96A 1KZGA 3PG7A 2N0YA 1X86A 1WVHA 4Y94A 1EF1A 2HE7A 2M38A 1J0WA 1UNRA 2DHIA 2YVCA 4CYEA 2P0DA 3HK0A 2D9VA 2R0DA 1X1FA 1ST7A 2EMTA 3SYXA 5DI9B 2RSGA 2COCA 3AU4A 2EC1A 4WJ7A 1BWNA 1LB1A 1N3HA 1MIXA 2ELBA 4DXAB 1XCGA 1ZC3B 3U7DA 3QBVB 3F5RA 2D9WA 1EAZA 4GXBA 2YRYA 4IAPA 1X1GA 2Q13A 2OQBA 1U5DA 2MKRA 3P6AA 4ZRKA 1H4RA 3ZDTA 2CY5A 4KAXB 5D3WA 2D2QA 2VSZA 1RRPB 1V5PA 2CAYA 1W1DA 2OTXA 3QIJA 1K5GB 4MY6A 5IJMA 1UNQA 4EJNA 1U29A 1X05A 3ODWA 1NU2A 4HAWB 3G9WA 1DBHA 2DFKA 4YL8A 2K2JA 4H8SA 3X23A 2YS3A 3EPYA 2NMBA 3TFMA 2DTCA 3DXCA 5C6RA 2LKOA 1HB6A 2RQ1A 5JP4A 1TQZA 1PMSA 2K2UA 1WGQA 3TCAA 1XODA 2UVMA 2Y8FA 4K17A 2LULA 3ULBA 5CLLB 2COFA 3MPXA 1DDVA 5GOWB 2DX5A 1M7EA 5D3XA 3GYOA 1BAKA 1M7RA 3A8PA 2LYDA 4KHBB 1DDMA 4F7HA 4HAUB 2RGNB 1DROA 1NI2A 2ADZA 2I1JA 3TVVA 1SGHA 2GCJA 3N7CA 1FGYA 2WH5A 4HATB 4GMVA 1AWEA 2DKPA 3TW1A 5LOPB 2I5CA 3SUZA 1BTNA 4YONA 1WGUA 1KZ7A 4TYZA 2CY4A 3UZTA 3BINA 3SNHA 5HE0A 3ODOA 3PVUA 2X18A 1TJ6A 1GG3A 2DHJA 1P5TA 3KRXA 4A6FA 2N23A 4Z2NA 4D0NB 1NVLA 4A6KA 4GMXB 2J0MA 1QC6A 1OQNA 3ZVRA 2CRFA 3WA0A 2DYNA 1H10A 1FGZA 2IYBA 4CHJA 2FJ9A 2RNRB 4NSWA 4A5KA 3GYPA 3VOQA 3IVFA 2QKLA 5J3QA 2RUKB 4WVFB 2R09A 4A6FB 1FHOA 4NY0A 1P3RA 4DBBA 2CB8A 3D8EA 4PNKA 1MIZB 3PVWA 1ZC4B 1U5GA 5CLQB 2YF0A 2LG1A 2DHKA 3P7ZA 5D3VA 1MK9B 3KSYA 1Z87A 3KRWA 1Y19B 1P6SA 1PLSA 2P0FA 2D9YA 2E2XA 2I5FA 2D9ZA 4MK0A
chains in the Genus database with same CATH superfamily
1ZSQA 4ZRJA 4HB4B 3PSCA 4JKDA 2J0KA 1NTYA 4KHBA 1E5WA 3PVLA 4K81A 1FHXA 5D27A 3BJIA 5DIFB 4HDOA 4HAXB 1EVHA 2LOXA 2DN6A 2VRWB 3KZ1A 4JKBA 4DX8A 3DCXA 3CXBB 1J19A 2YT2A 5J3YA 2KUPA 3FVCA 3KY9A 3TO1A 2Y8GA 1U5FA 4P7IA 3FM8C 1IRSA 2LOZA 1UPRA 5HE3A 2HTHB 5LONB 3F0WA 4TKNA 5L81A 5EFXA 1MPHA 4GPTB 2KCJA 4HHVA 4ILJA 2UZSA 1ZYIA 3RCPA 4EKUA 3ENBA 1DDWA 2PZ1A 3PP2A 3AJ4A 1U27A 4ILHA 2ZPYA 1XD4A 5DHAB 2YS1A 1NTIA 4K2PA 3CIKA 2V76A 2H7DA 4KVGB 1LW3A 2GUMA 1HB8A 4A6HA 1UPQA 4C0AA 2EMSA 2VKIA 1FOEA 2UZRA 1X11A 4CSQA 1I7AA 1NTVA 1XKEA 2M14A 2KGXB 1VBGA 4Z2MB 4IFSA 3T06A 3LJUX 1V5UA 4WSFA 3FLVA 3ODXA 1U5EA 5C5BA 1HBKA 2W2XC 1KI1B 2J0JA 5KQ1A 4JK9A 2P8VA 1B55A 1W1GA 2EJ8A 4QXAB 3NW8A 2GS0A 2QKMA 5JVLA 2Z14A 1K5DB 3OANA 4HAVB 2ROZB 4JKFA 2W2XD 3NWFA 3ML4A 4JK8A 4K2OA 3SV1A 4BBKA 2D10A 5LG4B 4PQ0A 1QQGA 2DLWA 2GCLA 2MDXA 3OHMB 2Z0OA 4F7GA 1MKEA 3A98B 4HB0B 1FHWA 1WJ1A 5HE2A 2RVBB 1GC7A 1OY2A 5D3YA 2MWNB 1FAOA 5C5BB 2DX1A 5HE1A 2DYQA 1XR0B 3QWMA 5I2MA 3VIAA 4EMOA 1MAIA 2AEHA 3NSUA 5KCVA 2L1CA 2HRJA 2DA0A 1RJ2A 1V88A 1MK7B 3SO6A 1UNPA 1JDEA 4L1RA 3M1IB 4DIXA 4QJ5B 2R2YA 5JHHA 4L6EA 5DHFB 3AU5A 2XQNM 4HAZB 2ELAA 2AL6A 2W2WA 4KHAA 1BTKA 1WI1A 2K00A 1W1HA 5C79A 4GNKB 2COPA 2KIGA 3PEGA 3E66A 2GJYA 2L2IA 2JP2A 2Y7BA 1OMWA 4CHMA 1UEFA 4JKAA 3DXDA 2NZ8B 1I2HA 1U2BA 3HW2B 3MDBC 4JKEA 1TXDA 3U8ZA 3FEHA 2ROVA 5JLJB 3E9LA 4KHOA 4HSIA 1SHCA 3D8FA 5FI1A 1ACAA 2H7EA 2IFSA 4F7UP 1DYNA 5JHGA 1WG7A 4GZUA 3V5WA 2P0HA 3WYFB 4HB3B 1Y5OA 2FDQA 2Z59A 4HB2B 2CQUA 2I1KA 2KIEA 2CODA 1V89A 2KUQA 2MFQA 2K8EA 1ZVRA 2YT1A 1KBLA 2D11A 2BCJA 4HAYB 2R82A 1V61A 2YT0A 3A8QA 3FSSA 4XWXA 2ABDA 1EGXA 1AQCA 5FI0A 3PZDA 3DXEA 3D8DA 2D9XA 2LBBA 2G35A 2Z0QA 1PFJA 4DX90 2FJLA 3NWAA 4GN1A 4B6HA 1FB8A 4IOYX 4HDQA 5C16A 2RLOA 2Z0PA 1V5MA 4JK7A 1Q67A 4ZRIA 4D6WA 2YS5A 2J59M 1WJMA 3FP5A 2DKQA 2YSZA 4JKGA 2D4QA 1XX0A 3HQCA 5DH9B 5J3TA 1ISNA 3ULCA 5KQ4A 4MT7A 1ZM0A 2COAA 1GC6A 3O96A 1KZGA 3PG7A 2N0YA 1X86A 1WVHA 4Y94A 1EF1A 2HE7A 2M38A 4QJ4B 1J0WA 1UNRA 2DHIA 2YVCA 4CYEA 2P0DA 3HK0A 2D9VA 2R0DA 1X1FA 1ST7A 2EMTA 3SYXA 5M4YB 4JKCA 5DI9B 4JKGB 2RSGA 4JKHA 2COCA 3AU4A 2EC1A 4WJ7A 1BWNA 1LB1A 1N3HA 1MIXA 2ELBA 4DXAB 1XCGA 1ZC3B 3U7DA 3QBVB 4OT1A 3F5RA 2FJUB 2D9WA 2X0SA 4GXBA 1EAZA 2YRYA 3SBGA 4IAPA 1X1GA 2Q13A 2OQBA 1U5DA 4OSNA 2MKRA 3P6AA 4ZRKA 1H4RA 3ZDTA 2CY5A 4KAXB 5D3WA 2D2QA 2VSZA 1RRPB 1V5PA 2CAYA 1W1DA 2OTXA 3QIJA 1K5GB 4MY6A 5IJMA 1UNQA 4EJNA 1U29A 1X05A 3ODWA 4QJ3B 1NU2A 4HAWB 3G9WA 1DBHA 2DFKA 4YL8A 2K2JA 4H8SA 3X23A 2YS3A 3EPYA 2Z13A 2NMBA 3TFMA 2DTCA 5IRSA 3DXCA 5C6RA 2LKOA 1HB6A 2RQ1A 5JP4A 1TQZA 1PMSA 2K2UA 1WGQA 3TCAA 1XODA 2UVMA 2RRFA 3SBTA 1T77A 3E9PA 2Y8FA 4K17A 3E9OA 3U12A 2LULA 3ULBA 5CLLB 2COFA 2KR0A 3MPXA 1DDVA 5GOWB 2DX5A 1M7EA 5D3XA 3GYOA 1BAKA 1DIKA 1M7RA 3A8PA 2LYDA 4KHBB 1DDMA 4F7HA 4HAUB 2RGNB 1DROA 1NI2A 2ADZA 2I1JA 3TVVA 1SGHA 2GCJA 3N7CA 1FGYA 3NWDA 2WH5A 4HATB 4GMVA 1AWEA 2DKPA 3TW1A 5LOPB 2I5CA 3SUZA 1BTNA 4YONA 1WGUA 1KZ7A 4TYZA 2CY4A 3UZTA 3BINA 3SNHA 5HE0A 3ODOA 3PVUA 2X18A 1TJ6A 1GG3A 2DHJA 1P5TA 3KRXA 3HIEA 4A6FA 2NBVA 4ILGB 2K49A 2N23A 4Z2NA 4D0NB 1NVLA 4A6KA 4GMXB 1MI1A 2J0MA 1QC6A 2ZKMX 1OQNA 3HSAA 3ZVRA 2CRFA 3WA0A 4GOUA 2DYNA 1H10A 1FGZA 2IYBA 4CHJA 2FJ9A 2RNRB 4NSWA 4A5KA 3GYPA 3VOQA 3IVFA 2DIKA 2QKLA 5J3QA 2RUKB 4WVFB 2R09A 4A6FB 1VBHA 1KC7A 1FHOA 4NY0A 1P3RA 4DBBA 1GGOA 2CB8A 3D8EA 4PNKA 1MIZB 3B77A 3PVWA 1ZC4B 1U5GA 5CLQB 2YF0A 2LG1A 2DHKA 3P7ZA 5D3VA 1MK9B 3KSYA 3A58A 5I2SA 1Z87A 2Z4DA 3KRWA 1Y19B 1P6SA 1PLSA 2P0FA 2D9YA 2E2XA 2I5FA 2D9ZA 4MK0A
chains in the Genus database with same CATH topology
1ZSQA 4ZRJA 4HB4B 3PSCA 4JKDA 2J0KA 1NTYA 1E5WA 3PVLA 4K81A 1FHXA 5D27A 3BJIA 5DIFB 4HDOA 4HAXB 1EVHA 2LOXA 2DN6A 2VRWB 3KZ1A 4JKBA 4DX8A 3CXBB 1J19A 5J3YA 2KUPA 3KY9A 3TO1A 2Y8GA 1U5FA 4P7IA 3FM8C 1IRSA 2LOZA 1UPRA 5HE3A 2HTHB 5LONB 3F0WA 4TKNA 5L81A 5EFXA 1MPHA 4GPTB 2KCJA 4HHVA 4ILJA 2UZSA 3RCPA 4EKUA 3ENBA 1DDWA 2PZ1A 3PP2A 3AJ4A 1U27A 4ILHA 2ZPYA 1XD4A 5DHAB 2YS1A 1NTIA 4K2PA 3CIKA 2V76A 2H7DA 4KVGB 1LW3A 1HB8A 4A6HA 1UPQA 4C0AA 2EMSA 2VKIA 1FOEA 2UZRA 1X11A 1I7AA 1NTVA 1XKEA 2M14A 2KGXB 1VBGA 4Z2MB 4IFSA 3T06A 3LJUX 1V5UA 4WSFA 3FLVA 3ODXA 1U5EA 5C5BA 1HBKA 2W2XC 1KI1B 2J0JA 5KQ1A 4JK9A 2P8VA 1B55A 1W1GA 2EJ8A 2GS0A 2QKMA 5JVLA 1K5DB 3OANA 4HAVB 2ROZB 4JKFA 2W2XD 3ML4A 4JK8A 4K2OA 3SV1A 4BBKA 2D10A 4PQ0A 1QQGA 2DLWA 2GCLA 2MDXA 2Z0OA 4F7GA 1MKEA 3A98B 4HB0B 1FHWA 1WJ1A 5HE2A 2RVBB 1GC7A 1OY2A 5D3YA 2MWNB 1FAOA 5C5BB 2DX1A 5HE1A 2DYQA 1XR0B 3QWMA 3VIAA 4EMOA 1MAIA 2AEHA 3NSUA 5KCVA 2L1CA 2HRJA 2DA0A 1RJ2A 1V88A 1MK7B 3SO6A 1UNPA 1JDEA 3M1IB 5JHHA 4L6EA 5DHFB 3AU5A 2XQNM 4HAZB 2ELAA 2AL6A 2W2WA 4KHAA 1BTKA 1WI1A 2K00A 1W1HA 5C79A 2COPA 3PEGA 3E66A 2GJYA 2L2IA 2JP2A 2Y7BA 1OMWA 4CHMA 1UEFA 4JKAA 3DXDA 2NZ8B 1I2HA 1U2BA 3HW2B 3MDBC 4JKEA 1TXDA 3U8ZA 3FEHA 2ROVA 5JLJB 3E9LA 4KHOA 1SHCA 3D8FA 5FI1A 1ACAA 2H7EA 2IFSA 4F7UP 1DYNA 5JHGA 1WG7A 4GZUA 3V5WA 2P0HA 3WYFB 4HB3B 1Y5OA 2FDQA 4HB2B 2CQUA 2I1KA 2CODA 1V89A 2MFQA 1ZVRA 2YT1A 1KBLA 2D11A 2BCJA 4HAYB 2R82A 1V61A 2YT0A 3A8QA 3FSSA 4XWXA 2ABDA 1EGXA 1AQCA 5FI0A 3PZDA 3DXEA 3D8DA 2D9XA 2LBBA 2G35A 2Z0QA 1PFJA 4DX90 2FJLA 4GN1A 4B6HA 1FB8A 4IOYX 4HDQA 5C16A 2RLOA 2Z0PA 1V5MA 4JK7A 1Q67A 4ZRIA 2YS5A 2J59M 1WJMA 3FP5A 2DKQA 2YSZA 4JKGA 2D4QA 1XX0A 3HQCA 5DH9B 5J3TA 1ISNA 3ULCA 5KQ4A 4MT7A 1ZM0A 2COAA 1GC6A 3O96A 1KZGA 3PG7A 2N0YA 1X86A 1WVHA 4Y94A 1EF1A 2HE7A 2M38A 1J0WA 1UNRA 2DHIA 2YVCA 4CYEA 2P0DA 3HK0A 2D9VA 2R0DA 1X1FA 1ST7A 2EMTA 3SYXA 4JKCA 5DI9B 4JKGB 2RSGA 4JKHA 2COCA 3AU4A 2EC1A 4WJ7A 1BWNA 1LB1A 1N3HA 1MIXA 2ELBA 4DXAB 1XCGA 1ZC3B 3U7DA 3QBVB 3F5RA 2D9WA 2X0SA 4GXBA 1EAZA 2YRYA 3SBGA 4IAPA 1X1GA 2Q13A 2OQBA 1U5DA 2MKRA 3P6AA 4ZRKA 1H4RA 3ZDTA 2CY5A 4KAXB 5D3WA 2D2QA 2VSZA 1RRPB 1V5PA 2CAYA 1W1DA 2OTXA 3QIJA 1K5GB 4MY6A 5IJMA 1UNQA 4EJNA 1U29A 1X05A 3ODWA 1NU2A 4HAWB 3G9WA 1DBHA 2DFKA 4YL8A 2K2JA 4H8SA 3X23A 2YS3A 3EPYA 2NMBA 3TFMA 2DTCA 3DXCA 5C6RA 2LKOA 1HB6A 2RQ1A 5JP4A 1TQZA 1PMSA 2K2UA 1WGQA 3TCAA 1XODA 2UVMA 3SBTA 3E9PA 2Y8FA 4K17A 3E9OA 2LULA 3ULBA 5CLLB 2COFA 3MPXA 1DDVA 5GOWB 2DX5A 1M7EA 5D3XA 3GYOA 1BAKA 1DIKA 1M7RA 3A8PA 2LYDA 4KHBB 1DDMA 4F7HA 4HAUB 2RGNB 1DROA 1NI2A 2ADZA 2I1JA 3TVVA 1SGHA 2GCJA 3N7CA 1FGYA 2WH5A 4HATB 4GMVA 1AWEA 2DKPA 3TW1A 5LOPB 2I5CA 3SUZA 1BTNA 4YONA 1WGUA 1KZ7A 4TYZA 2CY4A 3UZTA 3BINA 3SNHA 5HE0A 3ODOA 3PVUA 2X18A 1TJ6A 1GG3A 2DHJA 1P5TA 3KRXA 4A6FA 4ILGB 2N23A 4Z2NA 4D0NB 1NVLA 4A6KA 4GMXB 2J0MA 1QC6A 1OQNA 3ZVRA 2CRFA 3WA0A 2DYNA 1H10A 1FGZA 2IYBA 4CHJA 2FJ9A 2RNRB 4NSWA 4A5KA 3GYPA 3VOQA 3IVFA 2DIKA 2QKLA 5J3QA 2RUKB 4WVFB 2R09A 4A6FB 1VBHA 1KC7A 1FHOA 4NY0A 1P3RA 4DBBA 1GGOA 2CB8A 3D8EA 4PNKA 1MIZB 3PVWA 1ZC4B 1U5GA 5CLQB 2YF0A 2LG1A 2DHKA 3P7ZA 5D3VA 1MK9B 3KSYA 1Z87A 3KRWA 1Y19B 1P6SA 1PLSA 2P0FA 2D9YA 2E2XA 2I5FA 2D9ZA 4MK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSQ A;  4ZRJ A;  4HB4 B;  3PSC A;  2J0K A;  1NTY A;  1E5W A;  3PVL A;  4K81 A;  1FHX A;  5D27 A;  3BJI A;  5DIF B;  4HDO A;  4HAX B;  1EVH A;  2LOX A;  2DN6 A;  2VRW B;  3KZ1 A;  4DX8 A;  3CXB B;  1J19 A;  5J3Y A;  2KUP A;  3KY9 A;  3TO1 A;  2Y8G A;  1U5F A;  4P7I A;  3FM8 C;  1IRS A;  2LOZ A;  1UPR A;  5HE3 A;  2HTH B;  5LON B;  3F0W A;  4TKN A;  5L81 A;  5EFX A;  1MPH A;  4GPT B;  2KCJ A;  4HHV A;  2UZS A;  3RCP A;  4EKU A;  1DDW A;  2PZ1 A;  3PP2 A;  3AJ4 A;  1U27 A;  2ZPY A;  1XD4 A;  5DHA B;  2YS1 A;  1NTI A;  4K2P A;  3CIK A;  2V76 A;  2H7D A;  4KVG B;  1LW3 A;  1HB8 A;  4A6H A;  1UPQ A;  4C0A A;  2EMS A;  2VKI A;  1FOE A;  2UZR A;  1X11 A;  1I7A A;  1NTV A;  1XKE A;  2M14 A;  2KGX B;  4Z2M B;  4IFS A;  3T06 A;  3LJU X;  1V5U A;  4WSF A;  3FLV A;  3ODX A;  1U5E A;  5C5B A;  1HBK A;  2W2X C;  1KI1 B;  2J0J A;  5KQ1 A;  2P8V A;  1B55 A;  1W1G A;  2EJ8 A;  2GS0 A;  2QKM A;  1K5D B;  3OAN A;  4HAV B;  2ROZ B;  2W2X D;  3ML4 A;  4K2O A;  3SV1 A;  4BBK A;  2D10 A;  4PQ0 A;  1QQG A;  2DLW A;  2GCL A;  2MDX A;  2Z0O A;  4F7G A;  1MKE A;  3A98 B;  4HB0 B;  1FHW A;  1WJ1 A;  5HE2 A;  2RVB B;  1GC7 A;  1OY2 A;  5D3Y A;  2MWN B;  1FAO A;  5C5B B;  2DX1 A;  5HE1 A;  2DYQ A;  1XR0 B;  3QWM A;  3VIA A;  4EMO A;  1MAI A;  2AEH A;  3NSU A;  5KCV A;  2L1C A;  2HRJ A;  2DA0 A;  1RJ2 A;  1V88 A;  1MK7 B;  3SO6 A;  1UNP A;  3M1I B;  5JHH A;  4L6E A;  5DHF B;  3AU5 A;  2XQN M;  4HAZ B;  2ELA A;  2AL6 A;  2W2W A;  4KHA A;  1BTK A;  1WI1 A;  2K00 A;  1W1H A;  5C79 A;  2COP A;  3PEG A;  2GJY A;  2L2I A;  2JP2 A;  2Y7B A;  1OMW A;  4CHM A;  1UEF A;  3DXD A;  2NZ8 B;  1I2H A;  1U2B A;  3HW2 B;  3MDB C;  1TXD A;  3U8Z A;  3FEH A;  2ROV A;  5JLJ B;  4KHO A;  1SHC A;  3D8F A;  5FI1 A;  1ACA A;  2H7E A;  2IFS A;  4F7U P;  1DYN A;  5JHG A;  1WG7 A;  4GZU A;  3V5W A;  2P0H A;  3WYF B;  4HB3 B;  1Y5O A;  2FDQ A;  4HB2 B;  2CQU A;  2I1K A;  2COD A;  1V89 A;  2MFQ A;  1ZVR A;  2YT1 A;  2D11 A;  2BCJ A;  4HAY B;  1V61 A;  2YT0 A;  3A8Q A;  3FSS A;  4XWX A;  2ABD A;  1EGX A;  1AQC A;  5FI0 A;  3PZD A;  3DXE A;  3D8D A;  2D9X A;  2Z0Q A;  2LBB A;  2G35 A;  1PFJ A;  4DX9 0;  2FJL A;  4GN1 A;  4B6H A;  1FB8 A;  4IOY X;  4HDQ A;  5C16 A;  2RLO A;  2Z0P A;  1V5M A;  1Q67 A;  4ZRI A;  2YS5 A;  2J59 M;  1WJM A;  3FP5 A;  2DKQ A;  2YSZ A;  2D4Q A;  1XX0 A;  3HQC A;  5DH9 B;  5J3T A;  1ISN A;  3ULC A;  5KQ4 A;  4MT7 A;  1ZM0 A;  2COA A;  1GC6 A;  3O96 A;  1KZG A;  3PG7 A;  2N0Y A;  1X86 A;  1WVH A;  4Y94 A;  1EF1 A;  2HE7 A;  2M38 A;  1J0W A;  1UNR A;  2DHI A;  2YVC A;  4CYE A;  2P0D A;  3HK0 A;  2D9V A;  2R0D A;  1X1F A;  1ST7 A;  2EMT A;  3SYX A;  5DI9 B;  2RSG A;  2COC A;  3AU4 A;  2EC1 A;  4WJ7 A;  1BWN A;  1LB1 A;  1N3H A;  1MIX A;  2ELB A;  4DXA B;  1XCG A;  1ZC3 B;  3U7D A;  3QBV B;  3F5R A;  2D9W A;  1EAZ A;  4GXB A;  2YRY A;  4IAP A;  1X1G A;  2Q13 A;  2OQB A;  1U5D A;  2MKR A;  3P6A A;  4ZRK A;  1H4R A;  3ZDT A;  2CY5 A;  4KAX B;  5D3W A;  2D2Q A;  2VSZ A;  1RRP B;  1V5P A;  2CAY A;  1W1D A;  2OTX A;  3QIJ A;  1K5G B;  4MY6 A;  5IJM A;  1UNQ A;  4EJN A;  1U29 A;  1X05 A;  3ODW A;  1NU2 A;  4HAW B;  3G9W A;  1DBH A;  2DFK A;  4YL8 A;  2K2J A;  4H8S A;  3X23 A;  2YS3 A;  3EPY A;  2NMB A;  3TFM A;  2DTC A;  3DXC A;  5C6R A;  2LKO A;  1HB6 A;  2RQ1 A;  5JP4 A;  1TQZ A;  1PMS A;  2K2U A;  1WGQ A;  3TCA A;  1XOD A;  2UVM A;  2Y8F A;  4K17 A;  2LUL A;  3ULB A;  5CLL B;  2COF A;  3MPX A;  1DDV A;  5GOW B;  2DX5 A;  1M7E A;  5D3X A;  3GYO A;  1BAK A;  1M7R A;  3A8P A;  2LYD A;  4KHB B;  1DDM A;  4F7H A;  4HAU B;  2RGN B;  1DRO A;  1NI2 A;  2ADZ A;  2I1J A;  3TVV A;  1SGH A;  2GCJ A;  3N7C A;  1FGY A;  2WH5 A;  4HAT B;  4GMV A;  1AWE A;  2DKP A;  3TW1 A;  5LOP B;  2I5C A;  3SUZ A;  1BTN A;  4YON A;  1WGU A;  1KZ7 A;  4TYZ A;  2CY4 A;  3UZT A;  3BIN A;  3SNH A;  5HE0 A;  3ODO A;  3PVU A;  2X18 A;  1TJ6 A;  1GG3 A;  2DHJ A;  1P5T A;  3KRX A;  4A6F A;  2N23 A;  4Z2N A;  4D0N B;  1NVL A;  4A6K A;  4GMX B;  2J0M A;  1QC6 A;  1OQN A;  3ZVR A;  2CRF A;  3WA0 A;  2DYN A;  1H10 A;  1FGZ A;  2IYB A;  4CHJ A;  2FJ9 A;  2RNR B;  4NSW A;  4A5K A;  3GYP A;  3VOQ A;  3IVF A;  2QKL A;  5J3Q A;  2RUK B;  4WVF B;  2R09 A;  4A6F B;  1FHO A;  4NY0 A;  1P3R A;  4DBB A;  2CB8 A;  3D8E A;  4PNK A;  1MIZ B;  3PVW A;  1ZC4 B;  1U5G A;  5CLQ B;  2YF0 A;  2LG1 A;  2DHK A;  3P7Z A;  5D3V A;  1MK9 B;  3KSY A;  1Z87 A;  3KRW A;  1Y19 B;  1P6S A;  1PLS A;  2P0F A;  2D9Y A;  2E2X A;  2I5F A;  2D9Z A;  4MK0 A; 
#chains in the Genus database with same CATH topology
 1ZSQ A;  4ZRJ A;  4HB4 B;  3PSC A;  4JKD A;  2J0K A;  1NTY A;  4KHB A;  1E5W A;  3PVL A;  4K81 A;  1FHX A;  5D27 A;  3BJI A;  5DIF B;  4HDO A;  4HAX B;  1EVH A;  2LOX A;  2DN6 A;  2VRW B;  3KZ1 A;  4JKB A;  4DX8 A;  3DCX A;  3CXB B;  1J19 A;  2YT2 A;  5J3Y A;  2KUP A;  3FVC A;  3KY9 A;  3TO1 A;  2Y8G A;  1U5F A;  4P7I A;  3FM8 C;  1IRS A;  2LOZ A;  1UPR A;  5HE3 A;  2HTH B;  5LON B;  3F0W A;  4TKN A;  5L81 A;  5EFX A;  1MPH A;  4GPT B;  2KCJ A;  4HHV A;  4ILJ A;  2UZS A;  1ZYI A;  3RCP A;  4EKU A;  3ENB A;  1DDW A;  2PZ1 A;  3PP2 A;  3AJ4 A;  1U27 A;  4ILH A;  2ZPY A;  1XD4 A;  5DHA B;  2YS1 A;  1NTI A;  4K2P A;  3CIK A;  2V76 A;  2H7D A;  4KVG B;  1LW3 A;  2GUM A;  1HB8 A;  4A6H A;  1UPQ A;  4C0A A;  2EMS A;  2VKI A;  1FOE A;  2UZR A;  1X11 A;  4CSQ A;  1I7A A;  1NTV A;  1XKE A;  2M14 A;  2KGX B;  1VBG A;  4Z2M B;  4IFS A;  3T06 A;  3LJU X;  1V5U A;  4WSF A;  3FLV A;  3ODX A;  1U5E A;  5C5B A;  1HBK A;  2W2X C;  1KI1 B;  2J0J A;  5KQ1 A;  4JK9 A;  2P8V A;  1B55 A;  1W1G A;  2EJ8 A;  4QXA B;  3NW8 A;  2GS0 A;  2QKM A;  5JVL A;  2Z14 A;  1K5D B;  3OAN A;  4HAV B;  2ROZ B;  4JKF A;  2W2X D;  3NWF A;  3ML4 A;  4JK8 A;  4K2O A;  3SV1 A;  4BBK A;  2D10 A;  5LG4 B;  4PQ0 A;  1QQG A;  2DLW A;  2GCL A;  2MDX A;  3OHM B;  2Z0O A;  4F7G A;  1MKE A;  3A98 B;  4HB0 B;  1FHW A;  1WJ1 A;  5HE2 A;  2RVB B;  1GC7 A;  1OY2 A;  5D3Y A;  2MWN B;  1FAO A;  5C5B B;  2DX1 A;  5HE1 A;  2DYQ A;  1XR0 B;  3QWM A;  5I2M A;  3VIA A;  4EMO A;  1MAI A;  2AEH A;  3NSU A;  5KCV A;  2L1C A;  2HRJ A;  2DA0 A;  1RJ2 A;  1V88 A;  1MK7 B;  3SO6 A;  1UNP A;  1JDE A;  4L1R A;  3M1I B;  4DIX A;  4QJ5 B;  2R2Y A;  5JHH A;  4L6E A;  5DHF B;  3AU5 A;  2XQN M;  4HAZ B;  2ELA A;  2AL6 A;  2W2W A;  4KHA A;  1BTK A;  1WI1 A;  2K00 A;  1W1H A;  5C79 A;  4GNK B;  2COP A;  2KIG A;  3PEG A;  3E66 A;  2GJY A;  2L2I A;  2JP2 A;  2Y7B A;  1OMW A;  4CHM A;  1UEF A;  4JKA A;  3DXD A;  2NZ8 B;  1I2H A;  1U2B A;  3HW2 B;  3MDB C;  4JKE A;  1TXD A;  3U8Z A;  3FEH A;  2ROV A;  5JLJ B;  3E9L A;  4KHO A;  4HSI A;  1SHC A;  3D8F A;  5FI1 A;  1ACA A;  2H7E A;  2IFS A;  4F7U P;  1DYN A;  5JHG A;  1WG7 A;  4GZU A;  3V5W A;  2P0H A;  3WYF B;  4HB3 B;  1Y5O A;  2FDQ A;  2Z59 A;  4HB2 B;  2CQU A;  2I1K A;  2KIE A;  2COD A;  1V89 A;  2KUQ A;  2MFQ A;  2K8E A;  1ZVR A;  2YT1 A;  1KBL A;  2D11 A;  2BCJ A;  4HAY B;  2R82 A;  1V61 A;  2YT0 A;  3A8Q A;  3FSS A;  4XWX A;  2ABD A;  1EGX A;  1AQC A;  5FI0 A;  3PZD A;  3DXE A;  3D8D A;  2D9X A;  2LBB A;  2G35 A;  2Z0Q A;  1PFJ A;  4DX9 0;  2FJL A;  3NWA A;  4GN1 A;  4B6H A;  1FB8 A;  4IOY X;  4HDQ A;  5C16 A;  2RLO A;  2Z0P A;  1V5M A;  4JK7 A;  1Q67 A;  4ZRI A;  4D6W A;  2YS5 A;  2J59 M;  1WJM A;  3FP5 A;  2DKQ A;  2YSZ A;  4JKG A;  2D4Q A;  1XX0 A;  3HQC A;  5DH9 B;  5J3T A;  1ISN A;  3ULC A;  5KQ4 A;  4MT7 A;  1ZM0 A;  2COA A;  1GC6 A;  3O96 A;  1KZG A;  3PG7 A;  2N0Y A;  1X86 A;  1WVH A;  4Y94 A;  1EF1 A;  2HE7 A;  2M38 A;  4QJ4 B;  1J0W A;  1UNR A;  2DHI A;  2YVC A;  4CYE A;  2P0D A;  3HK0 A;  2D9V A;  2R0D A;  1X1F A;  1ST7 A;  2EMT A;  3SYX A;  5M4Y B;  4JKC A;  5DI9 B;  4JKG B;  2RSG A;  4JKH A;  2COC A;  3AU4 A;  2EC1 A;  4WJ7 A;  1BWN A;  1LB1 A;  1N3H A;  1MIX A;  2ELB A;  4DXA B;  1XCG A;  1ZC3 B;  3U7D A;  3QBV B;  4OT1 A;  3F5R A;  2FJU B;  2D9W A;  2X0S A;  4GXB A;  1EAZ A;  2YRY A;  3SBG A;  4IAP A;  1X1G A;  2Q13 A;  2OQB A;  1U5D A;  4OSN A;  2MKR A;  3P6A A;  4ZRK A;  1H4R A;  3ZDT A;  2CY5 A;  4KAX B;  5D3W A;  2D2Q A;  2VSZ A;  1RRP B;  1V5P A;  2CAY A;  1W1D A;  2OTX A;  3QIJ A;  1K5G B;  4MY6 A;  5IJM A;  1UNQ A;  4EJN A;  1U29 A;  1X05 A;  3ODW A;  4QJ3 B;  1NU2 A;  4HAW B;  3G9W A;  1DBH A;  2DFK A;  4YL8 A;  2K2J A;  4H8S A;  3X23 A;  2YS3 A;  3EPY A;  2Z13 A;  2NMB A;  3TFM A;  2DTC A;  5IRS A;  3DXC A;  5C6R A;  2LKO A;  1HB6 A;  2RQ1 A;  5JP4 A;  1TQZ A;  1PMS A;  2K2U A;  1WGQ A;  3TCA A;  1XOD A;  2UVM A;  2RRF A;  3SBT A;  1T77 A;  3E9P A;  2Y8F A;  4K17 A;  3E9O A;  3U12 A;  2LUL A;  3ULB A;  5CLL B;  2COF A;  2KR0 A;  3MPX A;  1DDV A;  5GOW B;  2DX5 A;  1M7E A;  5D3X A;  3GYO A;  1BAK A;  1DIK A;  1M7R A;  3A8P A;  2LYD A;  4KHB B;  1DDM A;  4F7H A;  4HAU B;  2RGN B;  1DRO A;  1NI2 A;  2ADZ A;  2I1J A;  3TVV A;  1SGH A;  2GCJ A;  3N7C A;  1FGY A;  3NWD A;  2WH5 A;  4HAT B;  4GMV A;  1AWE A;  2DKP A;  3TW1 A;  5LOP B;  2I5C A;  3SUZ A;  1BTN A;  4YON A;  1WGU A;  1KZ7 A;  4TYZ A;  2CY4 A;  3UZT A;  3BIN A;  3SNH A;  5HE0 A;  3ODO A;  3PVU A;  2X18 A;  1TJ6 A;  1GG3 A;  2DHJ A;  1P5T A;  3KRX A;  3HIE A;  4A6F A;  2NBV A;  4ILG B;  2K49 A;  2N23 A;  4Z2N A;  4D0N B;  1NVL A;  4A6K A;  4GMX B;  1MI1 A;  2J0M A;  1QC6 A;  2ZKM X;  1OQN A;  3HSA A;  3ZVR A;  2CRF A;  3WA0 A;  4GOU A;  2DYN A;  1H10 A;  1FGZ A;  2IYB A;  4CHJ A;  2FJ9 A;  2RNR B;  4NSW A;  4A5K A;  3GYP A;  3VOQ A;  3IVF A;  2DIK A;  2QKL A;  5J3Q A;  2RUK B;  4WVF B;  2R09 A;  4A6F B;  1VBH A;  1KC7 A;  1FHO A;  4NY0 A;  1P3R A;  4DBB A;  1GGO A;  2CB8 A;  3D8E A;  4PNK A;  1MIZ B;  3B77 A;  3PVW A;  1ZC4 B;  1U5G A;  5CLQ B;  2YF0 A;  2LG1 A;  2DHK A;  3P7Z A;  5D3V A;  1MK9 B;  3KSY A;  3A58 A;  5I2S A;  1Z87 A;  2Z4D A;  3KRW A;  1Y19 B;  1P6S A;  1PLS A;  2P0F A;  2D9Y A;  2E2X A;  2I5F A;  2D9Z A;  4MK0 A; 
#chains in the Genus database with same CATH homology
 1ZSQ A;  4ZRJ A;  4HB4 B;  3PSC A;  4JKD A;  2J0K A;  1NTY A;  1E5W A;  3PVL A;  4K81 A;  1FHX A;  5D27 A;  3BJI A;  5DIF B;  4HDO A;  4HAX B;  1EVH A;  2LOX A;  2DN6 A;  2VRW B;  3KZ1 A;  4JKB A;  4DX8 A;  3CXB B;  1J19 A;  5J3Y A;  2KUP A;  3KY9 A;  3TO1 A;  2Y8G A;  1U5F A;  4P7I A;  3FM8 C;  1IRS A;  2LOZ A;  1UPR A;  5HE3 A;  2HTH B;  5LON B;  3F0W A;  4TKN A;  5L81 A;  5EFX A;  1MPH A;  4GPT B;  2KCJ A;  4HHV A;  4ILJ A;  2UZS A;  3RCP A;  4EKU A;  3ENB A;  1DDW A;  2PZ1 A;  3PP2 A;  3AJ4 A;  1U27 A;  4ILH A;  2ZPY A;  1XD4 A;  5DHA B;  2YS1 A;  1NTI A;  4K2P A;  3CIK A;  2V76 A;  2H7D A;  4KVG B;  1LW3 A;  1HB8 A;  4A6H A;  1UPQ A;  4C0A A;  2EMS A;  2VKI A;  1FOE A;  2UZR A;  1X11 A;  1I7A A;  1NTV A;  1XKE A;  2M14 A;  2KGX B;  1VBG A;  4Z2M B;  4IFS A;  3T06 A;  3LJU X;  1V5U A;  4WSF A;  3FLV A;  3ODX A;  1U5E A;  5C5B A;  1HBK A;  2W2X C;  1KI1 B;  2J0J A;  5KQ1 A;  4JK9 A;  2P8V A;  1B55 A;  1W1G A;  2EJ8 A;  2GS0 A;  2QKM A;  5JVL A;  1K5D B;  3OAN A;  4HAV B;  2ROZ B;  4JKF A;  2W2X D;  3ML4 A;  4JK8 A;  4K2O A;  3SV1 A;  4BBK A;  2D10 A;  4PQ0 A;  1QQG A;  2DLW A;  2GCL A;  2MDX A;  2Z0O A;  4F7G A;  1MKE A;  3A98 B;  4HB0 B;  1FHW A;  1WJ1 A;  5HE2 A;  2RVB B;  1GC7 A;  1OY2 A;  5D3Y A;  2MWN B;  1FAO A;  5C5B B;  2DX1 A;  5HE1 A;  2DYQ A;  1XR0 B;  3QWM A;  3VIA A;  4EMO A;  1MAI A;  2AEH A;  3NSU A;  5KCV A;  2L1C A;  2HRJ A;  2DA0 A;  1RJ2 A;  1V88 A;  1MK7 B;  3SO6 A;  1UNP A;  1JDE A;  3M1I B;  5JHH A;  4L6E A;  5DHF B;  3AU5 A;  2XQN M;  4HAZ B;  2ELA A;  2AL6 A;  2W2W A;  4KHA A;  1BTK A;  1WI1 A;  2K00 A;  1W1H A;  5C79 A;  2COP A;  3PEG A;  3E66 A;  2GJY A;  2L2I A;  2JP2 A;  2Y7B A;  1OMW A;  4CHM A;  1UEF A;  4JKA A;  3DXD A;  2NZ8 B;  1I2H A;  1U2B A;  3HW2 B;  3MDB C;  4JKE A;  1TXD A;  3U8Z A;  3FEH A;  2ROV A;  5JLJ B;  3E9L A;  4KHO A;  1SHC A;  3D8F A;  5FI1 A;  1ACA A;  2H7E A;  2IFS A;  4F7U P;  1DYN A;  5JHG A;  1WG7 A;  4GZU A;  3V5W A;  2P0H A;  3WYF B;  4HB3 B;  1Y5O A;  2FDQ A;  4HB2 B;  2CQU A;  2I1K A;  2COD A;  1V89 A;  2MFQ A;  1ZVR A;  2YT1 A;  1KBL A;  2D11 A;  2BCJ A;  4HAY B;  2R82 A;  1V61 A;  2YT0 A;  3A8Q A;  3FSS A;  4XWX A;  2ABD A;  1EGX A;  1AQC A;  5FI0 A;  3PZD A;  3DXE A;  3D8D A;  2D9X A;  2LBB A;  2G35 A;  2Z0Q A;  1PFJ A;  4DX9 0;  2FJL A;  4GN1 A;  4B6H A;  1FB8 A;  4IOY X;  4HDQ A;  5C16 A;  2RLO A;  2Z0P A;  1V5M A;  4JK7 A;  1Q67 A;  4ZRI A;  2YS5 A;  2J59 M;  1WJM A;  3FP5 A;  2DKQ A;  2YSZ A;  4JKG A;  2D4Q A;  1XX0 A;  3HQC A;  5DH9 B;  5J3T A;  1ISN A;  3ULC A;  5KQ4 A;  4MT7 A;  1ZM0 A;  2COA A;  1GC6 A;  3O96 A;  1KZG A;  3PG7 A;  2N0Y A;  1X86 A;  1WVH A;  4Y94 A;  1EF1 A;  2HE7 A;  2M38 A;  1J0W A;  1UNR A;  2DHI A;  2YVC A;  4CYE A;  2P0D A;  3HK0 A;  2D9V A;  2R0D A;  1X1F A;  1ST7 A;  2EMT A;  3SYX A;  4JKC A;  5DI9 B;  4JKG B;  2RSG A;  4JKH A;  2COC A;  3AU4 A;  2EC1 A;  4WJ7 A;  1BWN A;  1LB1 A;  1N3H A;  1MIX A;  2ELB A;  4DXA B;  1XCG A;  1ZC3 B;  3U7D A;  3QBV B;  3F5R A;  2D9W A;  2X0S A;  4GXB A;  1EAZ A;  2YRY A;  3SBG A;  4IAP A;  1X1G A;  2Q13 A;  2OQB A;  1U5D A;  2MKR A;  3P6A A;  4ZRK A;  1H4R A;  3ZDT A;  2CY5 A;  4KAX B;  5D3W A;  2D2Q A;  2VSZ A;  1RRP B;  1V5P A;  2CAY A;  1W1D A;  2OTX A;  3QIJ A;  1K5G B;  4MY6 A;  5IJM A;  1UNQ A;  4EJN A;  1U29 A;  1X05 A;  3ODW A;  1NU2 A;  4HAW B;  3G9W A;  1DBH A;  2DFK A;  4YL8 A;  2K2J A;  4H8S A;  3X23 A;  2YS3 A;  3EPY A;  2NMB A;  3TFM A;  2DTC A;  3DXC A;  5C6R A;  2LKO A;  1HB6 A;  2RQ1 A;  5JP4 A;  1TQZ A;  1PMS A;  2K2U A;  1WGQ A;  3TCA A;  1XOD A;  2UVM A;  3SBT A;  3E9P A;  2Y8F A;  4K17 A;  3E9O A;  2LUL A;  3ULB A;  5CLL B;  2COF A;  3MPX A;  1DDV A;  5GOW B;  2DX5 A;  1M7E A;  5D3X A;  3GYO A;  1BAK A;  1DIK A;  1M7R A;  3A8P A;  2LYD A;  4KHB B;  1DDM A;  4F7H A;  4HAU B;  2RGN B;  1DRO A;  1NI2 A;  2ADZ A;  2I1J A;  3TVV A;  1SGH A;  2GCJ A;  3N7C A;  1FGY A;  2WH5 A;  4HAT B;  4GMV A;  1AWE A;  2DKP A;  3TW1 A;  5LOP B;  2I5C A;  3SUZ A;  1BTN A;  4YON A;  1WGU A;  1KZ7 A;  4TYZ A;  2CY4 A;  3UZT A;  3BIN A;  3SNH A;  5HE0 A;  3ODO A;  3PVU A;  2X18 A;  1TJ6 A;  1GG3 A;  2DHJ A;  1P5T A;  3KRX A;  4A6F A;  4ILG B;  2N23 A;  4Z2N A;  4D0N B;  1NVL A;  4A6K A;  4GMX B;  2J0M A;  1QC6 A;  1OQN A;  3ZVR A;  2CRF A;  3WA0 A;  2DYN A;  1H10 A;  1FGZ A;  2IYB A;  4CHJ A;  2FJ9 A;  2RNR B;  4NSW A;  4A5K A;  3GYP A;  3VOQ A;  3IVF A;  2DIK A;  2QKL A;  5J3Q A;  2RUK B;  4WVF B;  2R09 A;  4A6F B;  1VBH A;  1KC7 A;  1FHO A;  4NY0 A;  1P3R A;  4DBB A;  1GGO A;  2CB8 A;  3D8E A;  4PNK A;  1MIZ B;  3PVW A;  1ZC4 B;  1U5G A;  5CLQ B;  2YF0 A;  2LG1 A;  2DHK A;  3P7Z A;  5D3V A;  1MK9 B;  3KSY A;  1Z87 A;  3KRW A;  1Y19 B;  1P6S A;  1PLS A;  2P0F A;  2D9Y A;  2E2X A;  2I5F A;  2D9Z A;  4MK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...