1MIZB

Crystal structure of an integrin beta3-talin chimera
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of integrin recognition by talin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords integrin beta3
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00373 FERM_M FERM central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1mizB01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mizB02
2J0KA 4P7IA 3TFMA 1X1GA 2LG1A 3KRWA 2RQ1A 4HB2B 2NMBA 4EJNA 1XCGA 3HQCA 3EPYA 2DA0A 1W1DA 2NZ8B 2DKPA 1MK9B 5D27A 1V88A 3HW2B 5D3YA 3U7DA 4Z2MB 2YF0A 1MIXA 4IFSA 5C5BB 4KVGB 2V76A 2GCJA 2UZRA 2QKMA 1NTIA 3KSYA 2K2UA 2E2XA 2VSZA 2HTHB 4YL8A 1FGZA 1HB8A 3CIKA 5JP4A 1I2HA 4A6HA 1NVLA 3FM8C 2D9XA 2EMTA 1AWEA 2Q13A 1BWNA 2MDXA 1P5TA 2ELBA 1BTKA 1FHOA 1UPRA 5HE1A 1X11A 4HDOA 3M1IB 1QQGA 2Y8GA 4CYEA 1OY2A 5C5BA 4K17A 2X18A 3ODOA 3FEHA 4HAWB 2RLOA 1IRSA 2UZSA 3CXBB 2W2XC 4A6FB 1UNPA 1KZGA 2ZPYA 1UPQA 2YS5A 2MFQA 2CY4A 3TVVA 1X1FA 2H7EA 5C16A 2Y7BA 1Q67A 2YS3A 5D3VA 4GZUA 1X05A 1NI2A 5FI1A 2CQUA 1LW3A 4DX8A 3KY9A 4YONA 5FI0A 4GMVA 1TXDA 2DFKA 3ODXA 1GC7A 2K00A 2M38A 2KUPA 1EAZA 2UVMA 1ISNA 2L2IA 4HAZB 1NTVA 3QWMA 2D9YA 2EJ8A 4GN1A 4GMXB 1FB8A 1DROA 2RVBB 5GOWB 3MDBC 1DYNA 1PLSA 2DX5A 1BAKA 2W2XD 4K81A 2LKOA 2DKQA 1V5MA 5JLJB 2J59M 1MK7B 2D11A 4GXBA 5DHAB 4WSFA 4Y94A 2GJYA 4KHOA 1EGXA 3IVFA 4ZRIA 2IYBA 3G9WA 1KI1B 5J3QA 5C6RA 4ZRKA 5IJMA 4EKUA 5LOPB 1H10A 1MPHA 1B55A 4C0AA 1NTYA 1XKEA 2RSGA 1M7RA 1DBHA 4GPTB 1PFJA 4A5KA 4L6EA 2H7DA 1U5EA 2P0DA 2LOZA 4CHJA 3KRXA 5KQ1A 2FJ9A 1ZM0A 2CODA 3GYOA 3PVUA 2D9WA 4B6HA 4ZRJA 3P7ZA 3NSUA 2WH5A 3ZVRA 3D8DA 2YRYA 1DDMA 1ZSQA 4MK0A 3PVLA 4DXAB 1V5UA 5CLLB 2ROVA 2COPA 2HRJA 4KHBB 2ROZB 2I5CA 1U27A 2DHJA 2LYDA 5JHGA 1Y5OA 1SGHA 4HDQA 1MAIA 1WVHA 1LB1A 2N23A 5C79A 2Z0PA 3DXCA 1U5GA 3PP2A 2COAA 3GYPA 3PVWA 5DI9B 1J19A 2DHKA 1UNRA 1GC6A 5D3WA 1XX0A 2I5FA 4Z2NA 1U5FA 2COCA 2DX1A 3VOQA 3O96A 2COFA 2LBBA 1FOEA 2DTCA 3OANA 3ULBA 2R09A 4TKNA 2D2QA 1ST7A 5LONB 4HAYB 1ACAA 3TO1A 1SHCA 3KZ1A 2HE7A 2D4QA 1U2BA 1Z87A 2GCLA 1DDWA 3ML4A 2KGXB 4H8SA 4A6KA 1UEFA 3ODWA 4HAXB 1DDVA 3WA0A 2D10A 2RGNB 1PMSA 1I7AA 4D0NB 3PZDA 4MY6A 3V5WA 2DLWA 4NSWA 4HB4B 3WYFB 3A98B 2IFSA 2VRWB 2LOXA 2J0JA 5KCVA 3SYXA 1XODA 2J0MA 1W1GA 3BINA 1GG3A 2P8VA 1X86A 3U8ZA 1HB6A 2P0HA 4TYZA 2Y8FA 2OTXA 4K2OA 3A8QA 3ULCA 4EMOA 4F7GA 1WGUA 1FAOA 4XWXA 5HE3A 2CAYA 3AJ4A 3SO6A 3DXDA 2YS1A 2VKIA 3PSCA 2EC1A 1WI1A 4HAUB 1WJ1A 2K2JA 1ZC4B 5CLQB 2P0FA 1WGQA 2DN6A 1P6SA 3HK0A 4PQ0A 2I1KA 1U29A 3QBVB 1WJMA 3SV1A 3BJIA 2Z0QA 1FGYA 5L81A 1N3HA 4MT7A 3TCAA 2MKRA 5DH9B 1TJ6A 1V61A 1EF1A 2FDQA 2ABDA 3D8EA 1V89A 1FHXA 5J3TA 1NU2A 2D9ZA 2YT1A 2QKLA 2DHIA 5D3XA 5DHFB 5J3YA 3F5RA 3VIAA 1TQZA 1MKEA 4CHMA 2M14A 2BCJA 3SUZA 4DX90 2DYNA 4F7UP 4HATB 2R0DA 3FSSA 2Z0OA 2EMSA 2GS0A 1AQCA 3FP5A 1BTNA 1EVHA 3LJUX 4NY0A 2N0YA 3FLVA 3DXEA 4F7HA 2ADZA 2RNRB 3MPXA 1KZ7A 5DIFB 1M7EA 1OQNA 1XR0B 1E5WA 2LULA 3UZTA 1J0WA 2PZ1A 2I1JA 2D9VA 4DBBA 1H4RA 4IOYX 4PNKA 3F0WA 2L1CA 3TW1A 3QIJA 1K5GB 1RJ2A 2CRFA 5EFXA 2FJLA 3SNHA 3AU4A 3PG7A 3T06A 2KCJA 4IAPA 3ZDTA 3AU5A 1RRPB 1XD4A 4HB0B 2W2WA 1W1HA 2CY5A 4HHVA 3P6AA 2JP2A 1U5DA 1FHWA 1V5PA 2RUKB 1K5DB 1UNQA 2G35A 2YVCA 4HAVB 4KAXB 2OQBA 4KHAA 2CB8A 1HBKA 2ELAA 1WG7A 2YT0A 5KQ4A 4BBKA 1ZVRA 4A6FA 4HB3B 4WVFB 5HE0A 3D8FA 3RCPA 1Y19B 2AEHA 1OMWA 2AL6A 5JHHA 1QC6A 2MWNB 3PEGA 2YSZA 3X23A 4K2PA 2XQNM 3N7CA 1P3RA 4WJ7A 1MIZB 2DYQA 3A8PA 1ZC3B 5HE2A
chains in the Genus database with same CATH superfamily
3HSAA 2J0KA 4P7IA 3TFMA 1X1GA 3FVCA 2LG1A 3KRWA 2RQ1A 4HB2B 2NMBA 4EJNA 2K49A 1XCGA 3HQCA 3EPYA 2DA0A 1W1DA 2NZ8B 2DKPA 1MK9B 2KR0A 5D27A 1V88A 3HW2B 5D3YA 4OT1A 3U7DA 4Z2MB 2YF0A 1MIXA 4IFSA 5I2MA 3E66A 5C5BB 4KVGB 2V76A 2GCJA 2UZRA 2QKMA 4ILJA 1NTIA 3KSYA 2K2UA 2E2XA 2VSZA 2HTHB 4YL8A 1FGZA 1HB8A 3CIKA 5JP4A 4JKCA 1I2HA 3NW8A 4ILHA 4A6HA 1NVLA 3FM8C 2D9XA 5I2SA 2EMTA 1AWEA 2Q13A 1BWNA 2MDXA 1P5TA 2ELBA 2K8EA 1BTKA 1FHOA 1UPRA 5HE1A 4JKDA 1X11A 4HDOA 1GGOA 3M1IB 1QQGA 2Y8GA 4CYEA 1OY2A 5C5BA 4K17A 2X18A 3ODOA 3FEHA 4HAWB 2RLOA 1IRSA 2UZSA 3CXBB 4JKGA 2W2XC 4A6FB 1UNPA 2Z4DA 1KZGA 2ZPYA 1UPQA 1T77A 2YS5A 2MFQA 2CY4A 3TVVA 1X1FA 2H7EA 5C16A 2Y7BA 1Q67A 2YS3A 3NWAA 5D3VA 5LG4B 4GZUA 1X05A 1NI2A 5FI1A 2CQUA 1LW3A 4DX8A 3KY9A 4YONA 5FI0A 4GMVA 1TXDA 2DFKA 3NWFA 1GC7A 3ODXA 2K00A 2M38A 2KUPA 1EAZA 4JKGB 2UVMA 1ISNA 2L2IA 4HAZB 1NTVA 3QWMA 2D9YA 5M4YB 2EJ8A 4GN1A 4GMXB 1FB8A 3DCXA 1DROA 2RVBB 3NWDA 5GOWB 3MDBC 4KHBA 1DYNA 1PLSA 2DX5A 1BAKA 2W2XD 4K81A 2LKOA 2DKQA 1V5MA 5JLJB 2J59M 1MK7B 2D11A 4GXBA 5DHAB 4WSFA 1ZYIA 4Y94A 2GJYA 4KHOA 1EGXA 3IVFA 4ZRIA 4ILGB 2IYBA 3G9WA 1KI1B 2Z14A 2ZKMX 5J3QA 5C6RA 4ZRKA 5IJMA 4EKUA 5LOPB 1H10A 1MPHA 1B55A 4C0AA 1NTYA 1XKEA 2RSGA 1M7RA 4QJ3B 1KC7A 1DBHA 2KIGA 4GPTB 1PFJA 4A5KA 4L6EA 2H7DA 1U5EA 2P0DA 2LOZA 4DIXA 4CHJA 3KRXA 5KQ1A 2FJ9A 1ZM0A 2CODA 3GYOA 3PVUA 2D9WA 4B6HA 4ZRJA 3P7ZA 3NSUA 2WH5A 3ZVRA 4CSQA 4OSNA 2YRYA 3D8DA 1DDMA 1ZSQA 4JKAA 4MK0A 3PVLA 3SBGA 2R82A 4DXAB 1V5UA 5CLLB 2ROVA 2COPA 2HRJA 4KHBB 2ROZB 5IRSA 1VBHA 2I5CA 1U27A 2DHJA 2LYDA 5JHGA 1Y5OA 4HDQA 1SGHA 1MAIA 3E9PA 1JDEA 1WVHA 1LB1A 2N23A 4QJ4B 5C79A 2Z0PA 3DXCA 1U5GA 1VBGA 3PP2A 2COAA 3GYPA 3PVWA 5DI9B 1J19A 2DHKA 1UNRA 1GC6A 3HIEA 5D3WA 4QXAB 1XX0A 2I5FA 4Z2NA 1U5FA 4JKFA 2COCA 2DX1A 3VOQA 3O96A 2COFA 2LBBA 1FOEA 2DTCA 3OANA 3ULBA 2R09A 4TKNA 2D2QA 1ST7A 5LONB 4QJ5B 4HAYB 1ACAA 3TO1A 1SHCA 3KZ1A 2HE7A 3E9OA 2D4QA 1U2BA 3OHMB 1Z87A 2GCLA 1DDWA 3ML4A 2KGXB 4H8SA 4A6KA 1UEFA 3ODWA 4HAXB 1DDVA 3WA0A 2D10A 2RGNB 1PMSA 1I7AA 4D0NB 3PZDA 4MY6A 3V5WA 2DLWA 4NSWA 4HB4B 3WYFB 3A98B 2IFSA 2VRWB 2LOXA 2J0JA 5KCVA 3SYXA 1DIKA 1XODA 4JK8A 3ENBA 2J0MA 4GOUA 2X0SA 1W1GA 3BINA 1GG3A 2P8VA 1X86A 3U8ZA 1HB6A 2P0HA 4GNKB 4TYZA 3SBTA 2Y8FA 3U12A 2OTXA 4K2OA 3A8QA 2R2YA 3ULCA 4EMOA 4JK7A 4F7GA 1WGUA 1FAOA 4XWXA 5HE3A 4D6WA 2CAYA 3AJ4A 3SO6A 3DXDA 2YS1A 2VKIA 3PSCA 2EC1A 1WI1A 2KIEA 4HAUB 1WJ1A 2K2JA 1ZC4B 5CLQB 2P0FA 1WGQA 2DN6A 1P6SA 3HK0A 4PQ0A 2I1KA 1U29A 3QBVB 1WJMA 3SV1A 2Z0QA 3BJIA 1FGYA 5L81A 3A58A 2Z59A 1N3HA 4MT7A 3TCAA 2MKRA 5DH9B 1TJ6A 1V61A 4JK9A 1EF1A 2FDQA 2ABDA 3D8EA 2FJUB 1V89A 1FHXA 5J3TA 1NU2A 2D9ZA 2YT1A 2QKLA 2DHIA 2NBVA 5D3XA 2GUMA 5DHFB 5J3YA 3F5RA 3VIAA 1TQZA 1MKEA 4CHMA 2M14A 2BCJA 3SUZA 4DX90 2KUQA 2DYNA 4F7UP 4HATB 2R0DA 3FSSA 4JKHA 2Z0OA 2RRFA 2EMSA 2GS0A 1AQCA 3FP5A 1BTNA 1EVHA 4HSIA 3LJUX 4NY0A 2N0YA 3FLVA 5JVLA 3DXEA 4F7HA 2ADZA 2RNRB 3MPXA 1KZ7A 5DIFB 1M7EA 1OQNA 1XR0B 1E5WA 2LULA 3UZTA 1J0WA 2PZ1A 4L1RA 2I1JA 2D9VA 2DIKA 1H4RA 4DBBA 4IOYX 4PNKA 3F0WA 2L1CA 3TW1A 3QIJA 1K5GB 1RJ2A 2CRFA 5EFXA 4JKBA 2FJLA 3SNHA 3AU4A 3PG7A 3T06A 2KCJA 4IAPA 3ZDTA 3AU5A 2YT2A 1RRPB 1XD4A 3E9LA 4HB0B 2W2WA 1W1HA 2CY5A 4HHVA 3P6AA 2JP2A 1U5DA 1FHWA 1V5PA 2RUKB 1K5DB 1UNQA 2G35A 2YVCA 4HAVB 4KAXB 2OQBA 4KHAA 2CB8A 1HBKA 2ELAA 1KBLA 1WG7A 2YT0A 5KQ4A 4BBKA 1ZVRA 4A6FA 4HB3B 4WVFB 5HE0A 1MI1A 3D8FA 3RCPA 1Y19B 2AEHA 2Z13A 1OMWA 3B77A 2AL6A 5JHHA 1QC6A 2MWNB 3PEGA 2YSZA 3X23A 4K2PA 2XQNM 1P3RA 3N7CA 4WJ7A 1MIZB 4JKEA 2DYQA 3A8PA 1ZC3B 5HE2A
chains in the Genus database with same CATH topology
2J0KA 4P7IA 3TFMA 1X1GA 2LG1A 3KRWA 2RQ1A 4HB2B 2NMBA 4EJNA 1XCGA 3HQCA 3EPYA 2DA0A 1W1DA 2NZ8B 2DKPA 1MK9B 5D27A 1V88A 3HW2B 5D3YA 3U7DA 4Z2MB 2YF0A 1MIXA 4IFSA 3E66A 5C5BB 4KVGB 2V76A 2GCJA 2UZRA 2QKMA 4ILJA 1NTIA 3KSYA 2K2UA 2E2XA 2VSZA 2HTHB 4YL8A 1FGZA 1HB8A 3CIKA 5JP4A 4JKCA 1I2HA 4ILHA 4A6HA 1NVLA 3FM8C 2D9XA 2EMTA 1AWEA 2Q13A 1BWNA 2MDXA 1P5TA 2ELBA 1BTKA 1FHOA 1UPRA 5HE1A 4JKDA 1X11A 4HDOA 1GGOA 3M1IB 1QQGA 2Y8GA 4CYEA 1OY2A 5C5BA 4K17A 2X18A 3ODOA 3FEHA 4HAWB 2RLOA 1IRSA 2UZSA 3CXBB 4JKGA 2W2XC 4A6FB 1UNPA 1KZGA 2ZPYA 1UPQA 2YS5A 2MFQA 2CY4A 3TVVA 1X1FA 2H7EA 5C16A 2Y7BA 1Q67A 2YS3A 5D3VA 4GZUA 1X05A 1NI2A 5FI1A 2CQUA 1LW3A 4DX8A 3KY9A 4YONA 5FI0A 4GMVA 1TXDA 2DFKA 3ODXA 1GC7A 2K00A 2M38A 2KUPA 1EAZA 4JKGB 2UVMA 1ISNA 2L2IA 4HAZB 1NTVA 3QWMA 2D9YA 2EJ8A 4GN1A 4GMXB 1FB8A 1DROA 2RVBB 5GOWB 3MDBC 1DYNA 1PLSA 2DX5A 1BAKA 2W2XD 4K81A 2LKOA 2DKQA 1V5MA 5JLJB 2J59M 1MK7B 2D11A 4GXBA 5DHAB 4WSFA 4Y94A 2GJYA 4KHOA 1EGXA 3IVFA 4ZRIA 4ILGB 2IYBA 3G9WA 1KI1B 5J3QA 5C6RA 4ZRKA 5IJMA 4EKUA 5LOPB 1H10A 1MPHA 1B55A 4C0AA 1NTYA 1XKEA 2RSGA 1M7RA 1KC7A 1DBHA 4GPTB 1PFJA 4A5KA 4L6EA 2H7DA 1U5EA 2P0DA 2LOZA 4CHJA 3KRXA 5KQ1A 2FJ9A 1ZM0A 2CODA 3GYOA 3PVUA 2D9WA 4B6HA 4ZRJA 3P7ZA 3NSUA 2WH5A 3ZVRA 2YRYA 3D8DA 1DDMA 1ZSQA 4JKAA 4MK0A 3PVLA 3SBGA 2R82A 4DXAB 1V5UA 5CLLB 2ROVA 2COPA 2HRJA 4KHBB 2ROZB 1VBHA 2I5CA 1U27A 2DHJA 2LYDA 5JHGA 1Y5OA 4HDQA 1SGHA 1MAIA 3E9PA 1JDEA 1WVHA 1LB1A 2N23A 5C79A 2Z0PA 3DXCA 1U5GA 1VBGA 3PP2A 2COAA 3GYPA 3PVWA 5DI9B 1J19A 2DHKA 1UNRA 1GC6A 5D3WA 1XX0A 2I5FA 4Z2NA 1U5FA 4JKFA 2COCA 2DX1A 3VOQA 3O96A 2COFA 2LBBA 1FOEA 2DTCA 3OANA 3ULBA 2R09A 4TKNA 2D2QA 1ST7A 5LONB 4HAYB 1ACAA 3TO1A 1SHCA 3KZ1A 2HE7A 3E9OA 2D4QA 1U2BA 1Z87A 2GCLA 1DDWA 3ML4A 2KGXB 4H8SA 4A6KA 1UEFA 3ODWA 4HAXB 1DDVA 3WA0A 2D10A 2RGNB 1PMSA 1I7AA 4D0NB 3PZDA 4MY6A 3V5WA 2DLWA 4NSWA 4HB4B 3WYFB 3A98B 2IFSA 2VRWB 2LOXA 2J0JA 5KCVA 3SYXA 1DIKA 1XODA 4JK8A 3ENBA 2J0MA 2X0SA 1W1GA 3BINA 1GG3A 2P8VA 1X86A 3U8ZA 1HB6A 2P0HA 4TYZA 3SBTA 2Y8FA 2OTXA 4K2OA 3A8QA 3ULCA 4EMOA 4JK7A 4F7GA 1WGUA 1FAOA 4XWXA 5HE3A 2CAYA 3AJ4A 3SO6A 3DXDA 2YS1A 2VKIA 3PSCA 2EC1A 1WI1A 4HAUB 1WJ1A 2K2JA 1ZC4B 5CLQB 2P0FA 1WGQA 2DN6A 1P6SA 3HK0A 4PQ0A 2I1KA 1U29A 3QBVB 1WJMA 3SV1A 2Z0QA 3BJIA 1FGYA 5L81A 1N3HA 4MT7A 3TCAA 2MKRA 5DH9B 1TJ6A 1V61A 4JK9A 1EF1A 2FDQA 2ABDA 3D8EA 1V89A 1FHXA 5J3TA 1NU2A 2D9ZA 2YT1A 2QKLA 2DHIA 5D3XA 5DHFB 5J3YA 3F5RA 3VIAA 1TQZA 1MKEA 4CHMA 2M14A 2BCJA 3SUZA 4DX90 2DYNA 4F7UP 4HATB 2R0DA 3FSSA 4JKHA 2Z0OA 2EMSA 2GS0A 1AQCA 3FP5A 1BTNA 1EVHA 3LJUX 4NY0A 2N0YA 3FLVA 5JVLA 3DXEA 4F7HA 2ADZA 2RNRB 3MPXA 1KZ7A 5DIFB 1M7EA 1OQNA 1XR0B 1E5WA 2LULA 3UZTA 1J0WA 2PZ1A 2I1JA 2D9VA 2DIKA 1H4RA 4DBBA 4IOYX 4PNKA 3F0WA 2L1CA 3TW1A 3QIJA 1K5GB 1RJ2A 2CRFA 5EFXA 4JKBA 2FJLA 3SNHA 3AU4A 3PG7A 3T06A 2KCJA 4IAPA 3ZDTA 3AU5A 1RRPB 1XD4A 3E9LA 4HB0B 2W2WA 1W1HA 2CY5A 4HHVA 3P6AA 2JP2A 1U5DA 1FHWA 1V5PA 2RUKB 1K5DB 1UNQA 2G35A 2YVCA 4HAVB 4KAXB 2OQBA 4KHAA 2CB8A 1HBKA 2ELAA 1KBLA 1WG7A 2YT0A 5KQ4A 4BBKA 1ZVRA 4A6FA 4HB3B 4WVFB 5HE0A 3D8FA 3RCPA 1Y19B 2AEHA 1OMWA 2AL6A 5JHHA 1QC6A 2MWNB 3PEGA 2YSZA 3X23A 4K2PA 2XQNM 1P3RA 3N7CA 4WJ7A 1MIZB 4JKEA 2DYQA 3A8PA 1ZC3B 5HE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  4P7I A;  3TFM A;  1X1G A;  2LG1 A;  3KRW A;  2RQ1 A;  4HB2 B;  2NMB A;  4EJN A;  1XCG A;  3HQC A;  3EPY A;  2DA0 A;  1W1D A;  2NZ8 B;  2DKP A;  1MK9 B;  5D27 A;  1V88 A;  3HW2 B;  5D3Y A;  3U7D A;  4Z2M B;  2YF0 A;  1MIX A;  4IFS A;  5C5B B;  4KVG B;  2V76 A;  2GCJ A;  2UZR A;  2QKM A;  1NTI A;  3KSY A;  2K2U A;  2E2X A;  2VSZ A;  2HTH B;  4YL8 A;  1FGZ A;  1HB8 A;  3CIK A;  5JP4 A;  1I2H A;  4A6H A;  1NVL A;  3FM8 C;  2D9X A;  2EMT A;  1AWE A;  2Q13 A;  1BWN A;  2MDX A;  1P5T A;  2ELB A;  1BTK A;  1FHO A;  1UPR A;  5HE1 A;  1X11 A;  4HDO A;  3M1I B;  1QQG A;  2Y8G A;  4CYE A;  1OY2 A;  5C5B A;  4K17 A;  2X18 A;  3ODO A;  3FEH A;  4HAW B;  2RLO A;  1IRS A;  2UZS A;  3CXB B;  2W2X C;  4A6F B;  1UNP A;  1KZG A;  2ZPY A;  1UPQ A;  2YS5 A;  2MFQ A;  2CY4 A;  3TVV A;  1X1F A;  2H7E A;  5C16 A;  2Y7B A;  1Q67 A;  2YS3 A;  5D3V A;  4GZU A;  1X05 A;  1NI2 A;  5FI1 A;  2CQU A;  1LW3 A;  4DX8 A;  3KY9 A;  4YON A;  5FI0 A;  4GMV A;  1TXD A;  2DFK A;  3ODX A;  1GC7 A;  2K00 A;  2M38 A;  2KUP A;  1EAZ A;  2UVM A;  1ISN A;  2L2I A;  4HAZ B;  1NTV A;  3QWM A;  2D9Y A;  2EJ8 A;  4GN1 A;  4GMX B;  1FB8 A;  1DRO A;  2RVB B;  5GOW B;  3MDB C;  1DYN A;  1PLS A;  2DX5 A;  1BAK A;  2W2X D;  4K81 A;  2LKO A;  2DKQ A;  1V5M A;  5JLJ B;  2J59 M;  1MK7 B;  2D11 A;  4GXB A;  5DHA B;  4WSF A;  4Y94 A;  2GJY A;  4KHO A;  1EGX A;  3IVF A;  4ZRI A;  2IYB A;  3G9W A;  1KI1 B;  5J3Q A;  5C6R A;  4ZRK A;  5IJM A;  4EKU A;  5LOP B;  1H10 A;  1MPH A;  1B55 A;  4C0A A;  1NTY A;  1XKE A;  2RSG A;  1M7R A;  1DBH A;  4GPT B;  1PFJ A;  4A5K A;  4L6E A;  2H7D A;  1U5E A;  2P0D A;  2LOZ A;  4CHJ A;  3KRX A;  5KQ1 A;  2FJ9 A;  1ZM0 A;  2COD A;  3GYO A;  3PVU A;  2D9W A;  4B6H A;  4ZRJ A;  3P7Z A;  3NSU A;  2WH5 A;  3ZVR A;  3D8D A;  2YRY A;  1DDM A;  1ZSQ A;  4MK0 A;  3PVL A;  4DXA B;  1V5U A;  5CLL B;  2ROV A;  2COP A;  2HRJ A;  4KHB B;  2ROZ B;  2I5C A;  1U27 A;  2DHJ A;  2LYD A;  5JHG A;  1Y5O A;  1SGH A;  4HDQ A;  1MAI A;  1WVH A;  1LB1 A;  2N23 A;  5C79 A;  2Z0P A;  3DXC A;  1U5G A;  3PP2 A;  2COA A;  3GYP A;  3PVW A;  5DI9 B;  1J19 A;  2DHK A;  1UNR A;  1GC6 A;  5D3W A;  1XX0 A;  2I5F A;  4Z2N A;  1U5F A;  2COC A;  2DX1 A;  3VOQ A;  3O96 A;  2COF A;  2LBB A;  1FOE A;  2DTC A;  3OAN A;  3ULB A;  2R09 A;  4TKN A;  2D2Q A;  1ST7 A;  5LON B;  4HAY B;  1ACA A;  3TO1 A;  1SHC A;  3KZ1 A;  2HE7 A;  2D4Q A;  1U2B A;  1Z87 A;  2GCL A;  1DDW A;  3ML4 A;  2KGX B;  4H8S A;  4A6K A;  1UEF A;  3ODW A;  4HAX B;  1DDV A;  3WA0 A;  2D10 A;  2RGN B;  1PMS A;  1I7A A;  4D0N B;  3PZD A;  4MY6 A;  3V5W A;  2DLW A;  4NSW A;  4HB4 B;  3WYF B;  3A98 B;  2IFS A;  2VRW B;  2LOX A;  2J0J A;  5KCV A;  3SYX A;  1XOD A;  2J0M A;  1W1G A;  3BIN A;  1GG3 A;  2P8V A;  1X86 A;  3U8Z A;  1HB6 A;  2P0H A;  4TYZ A;  2Y8F A;  2OTX A;  4K2O A;  3A8Q A;  3ULC A;  4EMO A;  4F7G A;  1WGU A;  1FAO A;  4XWX A;  5HE3 A;  2CAY A;  3AJ4 A;  3SO6 A;  3DXD A;  2YS1 A;  2VKI A;  3PSC A;  2EC1 A;  1WI1 A;  4HAU B;  1WJ1 A;  2K2J A;  1ZC4 B;  5CLQ B;  2P0F A;  1WGQ A;  2DN6 A;  1P6S A;  3HK0 A;  4PQ0 A;  2I1K A;  1U29 A;  3QBV B;  1WJM A;  3SV1 A;  3BJI A;  2Z0Q A;  1FGY A;  5L81 A;  1N3H A;  4MT7 A;  3TCA A;  2MKR A;  5DH9 B;  1TJ6 A;  1V61 A;  1EF1 A;  2FDQ A;  2ABD A;  3D8E A;  1V89 A;  1FHX A;  5J3T A;  1NU2 A;  2D9Z A;  2YT1 A;  2QKL A;  2DHI A;  5D3X A;  5DHF B;  5J3Y A;  3F5R A;  3VIA A;  1TQZ A;  1MKE A;  4CHM A;  2M14 A;  2BCJ A;  3SUZ A;  4DX9 0;  2DYN A;  4F7U P;  4HAT B;  2R0D A;  3FSS A;  2Z0O A;  2EMS A;  2GS0 A;  1AQC A;  3FP5 A;  1BTN A;  1EVH A;  3LJU X;  4NY0 A;  2N0Y A;  3FLV A;  3DXE A;  4F7H A;  2ADZ A;  2RNR B;  3MPX A;  1KZ7 A;  5DIF B;  1M7E A;  1OQN A;  1XR0 B;  1E5W A;  2LUL A;  3UZT A;  1J0W A;  2PZ1 A;  2I1J A;  2D9V A;  4DBB A;  1H4R A;  4IOY X;  4PNK A;  3F0W A;  2L1C A;  3TW1 A;  3QIJ A;  1K5G B;  1RJ2 A;  2CRF A;  5EFX A;  2FJL A;  3SNH A;  3AU4 A;  3PG7 A;  3T06 A;  2KCJ A;  4IAP A;  3ZDT A;  3AU5 A;  1RRP B;  1XD4 A;  4HB0 B;  2W2W A;  1W1H A;  2CY5 A;  4HHV A;  3P6A A;  2JP2 A;  1U5D A;  1FHW A;  1V5P A;  2RUK B;  1K5D B;  1UNQ A;  2G35 A;  2YVC A;  4HAV B;  4KAX B;  2OQB A;  4KHA A;  2CB8 A;  1HBK A;  2ELA A;  1WG7 A;  2YT0 A;  5KQ4 A;  4BBK A;  1ZVR A;  4A6F A;  4HB3 B;  4WVF B;  5HE0 A;  3D8F A;  3RCP A;  1Y19 B;  2AEH A;  1OMW A;  2AL6 A;  5JHH A;  1QC6 A;  2MWN B;  3PEG A;  2YSZ A;  3X23 A;  4K2P A;  2XQN M;  3N7C A;  1P3R A;  4WJ7 A;  1MIZ B;  2DYQ A;  3A8P A;  1ZC3 B;  5HE2 A; 
#chains in the Genus database with same CATH topology
 3HSA A;  2J0K A;  4P7I A;  3TFM A;  1X1G A;  3FVC A;  2LG1 A;  3KRW A;  2RQ1 A;  4HB2 B;  2NMB A;  4EJN A;  2K49 A;  1XCG A;  3HQC A;  3EPY A;  2DA0 A;  1W1D A;  2NZ8 B;  2DKP A;  1MK9 B;  2KR0 A;  5D27 A;  1V88 A;  3HW2 B;  5D3Y A;  4OT1 A;  3U7D A;  4Z2M B;  2YF0 A;  1MIX A;  4IFS A;  5I2M A;  3E66 A;  5C5B B;  4KVG B;  2V76 A;  2GCJ A;  2UZR A;  2QKM A;  4ILJ A;  1NTI A;  3KSY A;  2K2U A;  2E2X A;  2VSZ A;  2HTH B;  4YL8 A;  1FGZ A;  1HB8 A;  3CIK A;  5JP4 A;  4JKC A;  1I2H A;  3NW8 A;  4ILH A;  4A6H A;  1NVL A;  3FM8 C;  2D9X A;  5I2S A;  2EMT A;  1AWE A;  2Q13 A;  1BWN A;  2MDX A;  1P5T A;  2ELB A;  2K8E A;  1BTK A;  1FHO A;  1UPR A;  5HE1 A;  4JKD A;  1X11 A;  4HDO A;  1GGO A;  3M1I B;  1QQG A;  2Y8G A;  4CYE A;  1OY2 A;  5C5B A;  4K17 A;  2X18 A;  3ODO A;  3FEH A;  4HAW B;  2RLO A;  1IRS A;  2UZS A;  3CXB B;  4JKG A;  2W2X C;  4A6F B;  1UNP A;  2Z4D A;  1KZG A;  2ZPY A;  1UPQ A;  1T77 A;  2YS5 A;  2MFQ A;  2CY4 A;  3TVV A;  1X1F A;  2H7E A;  5C16 A;  2Y7B A;  1Q67 A;  2YS3 A;  3NWA A;  5D3V A;  5LG4 B;  4GZU A;  1X05 A;  1NI2 A;  5FI1 A;  2CQU A;  1LW3 A;  4DX8 A;  3KY9 A;  4YON A;  5FI0 A;  4GMV A;  1TXD A;  2DFK A;  3NWF A;  1GC7 A;  3ODX A;  2K00 A;  2M38 A;  2KUP A;  1EAZ A;  4JKG B;  2UVM A;  1ISN A;  2L2I A;  4HAZ B;  1NTV A;  3QWM A;  2D9Y A;  5M4Y B;  2EJ8 A;  4GN1 A;  4GMX B;  1FB8 A;  3DCX A;  1DRO A;  2RVB B;  3NWD A;  5GOW B;  3MDB C;  4KHB A;  1DYN A;  1PLS A;  2DX5 A;  1BAK A;  2W2X D;  4K81 A;  2LKO A;  2DKQ A;  1V5M A;  5JLJ B;  2J59 M;  1MK7 B;  2D11 A;  4GXB A;  5DHA B;  4WSF A;  1ZYI A;  4Y94 A;  2GJY A;  4KHO A;  1EGX A;  3IVF A;  4ZRI A;  4ILG B;  2IYB A;  3G9W A;  1KI1 B;  2Z14 A;  2ZKM X;  5J3Q A;  5C6R A;  4ZRK A;  5IJM A;  4EKU A;  5LOP B;  1H10 A;  1MPH A;  1B55 A;  4C0A A;  1NTY A;  1XKE A;  2RSG A;  1M7R A;  4QJ3 B;  1KC7 A;  1DBH A;  2KIG A;  4GPT B;  1PFJ A;  4A5K A;  4L6E A;  2H7D A;  1U5E A;  2P0D A;  2LOZ A;  4DIX A;  4CHJ A;  3KRX A;  5KQ1 A;  2FJ9 A;  1ZM0 A;  2COD A;  3GYO A;  3PVU A;  2D9W A;  4B6H A;  4ZRJ A;  3P7Z A;  3NSU A;  2WH5 A;  3ZVR A;  4CSQ A;  4OSN A;  2YRY A;  3D8D A;  1DDM A;  1ZSQ A;  4JKA A;  4MK0 A;  3PVL A;  3SBG A;  2R82 A;  4DXA B;  1V5U A;  5CLL B;  2ROV A;  2COP A;  2HRJ A;  4KHB B;  2ROZ B;  5IRS A;  1VBH A;  2I5C A;  1U27 A;  2DHJ A;  2LYD A;  5JHG A;  1Y5O A;  4HDQ A;  1SGH A;  1MAI A;  3E9P A;  1JDE A;  1WVH A;  1LB1 A;  2N23 A;  4QJ4 B;  5C79 A;  2Z0P A;  3DXC A;  1U5G A;  1VBG A;  3PP2 A;  2COA A;  3GYP A;  3PVW A;  5DI9 B;  1J19 A;  2DHK A;  1UNR A;  1GC6 A;  3HIE A;  5D3W A;  4QXA B;  1XX0 A;  2I5F A;  4Z2N A;  1U5F A;  4JKF A;  2COC A;  2DX1 A;  3VOQ A;  3O96 A;  2COF A;  2LBB A;  1FOE A;  2DTC A;  3OAN A;  3ULB A;  2R09 A;  4TKN A;  2D2Q A;  1ST7 A;  5LON B;  4QJ5 B;  4HAY B;  1ACA A;  3TO1 A;  1SHC A;  3KZ1 A;  2HE7 A;  3E9O A;  2D4Q A;  1U2B A;  3OHM B;  1Z87 A;  2GCL A;  1DDW A;  3ML4 A;  2KGX B;  4H8S A;  4A6K A;  1UEF A;  3ODW A;  4HAX B;  1DDV A;  3WA0 A;  2D10 A;  2RGN B;  1PMS A;  1I7A A;  4D0N B;  3PZD A;  4MY6 A;  3V5W A;  2DLW A;  4NSW A;  4HB4 B;  3WYF B;  3A98 B;  2IFS A;  2VRW B;  2LOX A;  2J0J A;  5KCV A;  3SYX A;  1DIK A;  1XOD A;  4JK8 A;  3ENB A;  2J0M A;  4GOU A;  2X0S A;  1W1G A;  3BIN A;  1GG3 A;  2P8V A;  1X86 A;  3U8Z A;  1HB6 A;  2P0H A;  4GNK B;  4TYZ A;  3SBT A;  2Y8F A;  3U12 A;  2OTX A;  4K2O A;  3A8Q A;  2R2Y A;  3ULC A;  4EMO A;  4JK7 A;  4F7G A;  1WGU A;  1FAO A;  4XWX A;  5HE3 A;  4D6W A;  2CAY A;  3AJ4 A;  3SO6 A;  3DXD A;  2YS1 A;  2VKI A;  3PSC A;  2EC1 A;  1WI1 A;  2KIE A;  4HAU B;  1WJ1 A;  2K2J A;  1ZC4 B;  5CLQ B;  2P0F A;  1WGQ A;  2DN6 A;  1P6S A;  3HK0 A;  4PQ0 A;  2I1K A;  1U29 A;  3QBV B;  1WJM A;  3SV1 A;  2Z0Q A;  3BJI A;  1FGY A;  5L81 A;  3A58 A;  2Z59 A;  1N3H A;  4MT7 A;  3TCA A;  2MKR A;  5DH9 B;  1TJ6 A;  1V61 A;  4JK9 A;  1EF1 A;  2FDQ A;  2ABD A;  3D8E A;  2FJU B;  1V89 A;  1FHX A;  5J3T A;  1NU2 A;  2D9Z A;  2YT1 A;  2QKL A;  2DHI A;  2NBV A;  5D3X A;  2GUM A;  5DHF B;  5J3Y A;  3F5R A;  3VIA A;  1TQZ A;  1MKE A;  4CHM A;  2M14 A;  2BCJ A;  3SUZ A;  4DX9 0;  2KUQ A;  2DYN A;  4F7U P;  4HAT B;  2R0D A;  3FSS A;  4JKH A;  2Z0O A;  2RRF A;  2EMS A;  2GS0 A;  1AQC A;  3FP5 A;  1BTN A;  1EVH A;  4HSI A;  3LJU X;  4NY0 A;  2N0Y A;  3FLV A;  5JVL A;  3DXE A;  4F7H A;  2ADZ A;  2RNR B;  3MPX A;  1KZ7 A;  5DIF B;  1M7E A;  1OQN A;  1XR0 B;  1E5W A;  2LUL A;  3UZT A;  1J0W A;  2PZ1 A;  4L1R A;  2I1J A;  2D9V A;  2DIK A;  1H4R A;  4DBB A;  4IOY X;  4PNK A;  3F0W A;  2L1C A;  3TW1 A;  3QIJ A;  1K5G B;  1RJ2 A;  2CRF A;  5EFX A;  4JKB A;  2FJL A;  3SNH A;  3AU4 A;  3PG7 A;  3T06 A;  2KCJ A;  4IAP A;  3ZDT A;  3AU5 A;  2YT2 A;  1RRP B;  1XD4 A;  3E9L A;  4HB0 B;  2W2W A;  1W1H A;  2CY5 A;  4HHV A;  3P6A A;  2JP2 A;  1U5D A;  1FHW A;  1V5P A;  2RUK B;  1K5D B;  1UNQ A;  2G35 A;  2YVC A;  4HAV B;  4KAX B;  2OQB A;  4KHA A;  2CB8 A;  1HBK A;  2ELA A;  1KBL A;  1WG7 A;  2YT0 A;  5KQ4 A;  4BBK A;  1ZVR A;  4A6F A;  4HB3 B;  4WVF B;  5HE0 A;  1MI1 A;  3D8F A;  3RCP A;  1Y19 B;  2AEH A;  2Z13 A;  1OMW A;  3B77 A;  2AL6 A;  5JHH A;  1QC6 A;  2MWN B;  3PEG A;  2YSZ A;  3X23 A;  4K2P A;  2XQN M;  1P3R A;  3N7C A;  4WJ7 A;  1MIZ B;  4JKE A;  2DYQ A;  3A8P A;  1ZC3 B;  5HE2 A; 
#chains in the Genus database with same CATH homology
 2J0K A;  4P7I A;  3TFM A;  1X1G A;  2LG1 A;  3KRW A;  2RQ1 A;  4HB2 B;  2NMB A;  4EJN A;  1XCG A;  3HQC A;  3EPY A;  2DA0 A;  1W1D A;  2NZ8 B;  2DKP A;  1MK9 B;  5D27 A;  1V88 A;  3HW2 B;  5D3Y A;  3U7D A;  4Z2M B;  2YF0 A;  1MIX A;  4IFS A;  3E66 A;  5C5B B;  4KVG B;  2V76 A;  2GCJ A;  2UZR A;  2QKM A;  4ILJ A;  1NTI A;  3KSY A;  2K2U A;  2E2X A;  2VSZ A;  2HTH B;  4YL8 A;  1FGZ A;  1HB8 A;  3CIK A;  5JP4 A;  4JKC A;  1I2H A;  4ILH A;  4A6H A;  1NVL A;  3FM8 C;  2D9X A;  2EMT A;  1AWE A;  2Q13 A;  1BWN A;  2MDX A;  1P5T A;  2ELB A;  1BTK A;  1FHO A;  1UPR A;  5HE1 A;  4JKD A;  1X11 A;  4HDO A;  1GGO A;  3M1I B;  1QQG A;  2Y8G A;  4CYE A;  1OY2 A;  5C5B A;  4K17 A;  2X18 A;  3ODO A;  3FEH A;  4HAW B;  2RLO A;  1IRS A;  2UZS A;  3CXB B;  4JKG A;  2W2X C;  4A6F B;  1UNP A;  1KZG A;  2ZPY A;  1UPQ A;  2YS5 A;  2MFQ A;  2CY4 A;  3TVV A;  1X1F A;  2H7E A;  5C16 A;  2Y7B A;  1Q67 A;  2YS3 A;  5D3V A;  4GZU A;  1X05 A;  1NI2 A;  5FI1 A;  2CQU A;  1LW3 A;  4DX8 A;  3KY9 A;  4YON A;  5FI0 A;  4GMV A;  1TXD A;  2DFK A;  3ODX A;  1GC7 A;  2K00 A;  2M38 A;  2KUP A;  1EAZ A;  4JKG B;  2UVM A;  1ISN A;  2L2I A;  4HAZ B;  1NTV A;  3QWM A;  2D9Y A;  2EJ8 A;  4GN1 A;  4GMX B;  1FB8 A;  1DRO A;  2RVB B;  5GOW B;  3MDB C;  1DYN A;  1PLS A;  2DX5 A;  1BAK A;  2W2X D;  4K81 A;  2LKO A;  2DKQ A;  1V5M A;  5JLJ B;  2J59 M;  1MK7 B;  2D11 A;  4GXB A;  5DHA B;  4WSF A;  4Y94 A;  2GJY A;  4KHO A;  1EGX A;  3IVF A;  4ZRI A;  4ILG B;  2IYB A;  3G9W A;  1KI1 B;  5J3Q A;  5C6R A;  4ZRK A;  5IJM A;  4EKU A;  5LOP B;  1H10 A;  1MPH A;  1B55 A;  4C0A A;  1NTY A;  1XKE A;  2RSG A;  1M7R A;  1KC7 A;  1DBH A;  4GPT B;  1PFJ A;  4A5K A;  4L6E A;  2H7D A;  1U5E A;  2P0D A;  2LOZ A;  4CHJ A;  3KRX A;  5KQ1 A;  2FJ9 A;  1ZM0 A;  2COD A;  3GYO A;  3PVU A;  2D9W A;  4B6H A;  4ZRJ A;  3P7Z A;  3NSU A;  2WH5 A;  3ZVR A;  2YRY A;  3D8D A;  1DDM A;  1ZSQ A;  4JKA A;  4MK0 A;  3PVL A;  3SBG A;  2R82 A;  4DXA B;  1V5U A;  5CLL B;  2ROV A;  2COP A;  2HRJ A;  4KHB B;  2ROZ B;  1VBH A;  2I5C A;  1U27 A;  2DHJ A;  2LYD A;  5JHG A;  1Y5O A;  4HDQ A;  1SGH A;  1MAI A;  3E9P A;  1JDE A;  1WVH A;  1LB1 A;  2N23 A;  5C79 A;  2Z0P A;  3DXC A;  1U5G A;  1VBG A;  3PP2 A;  2COA A;  3GYP A;  3PVW A;  5DI9 B;  1J19 A;  2DHK A;  1UNR A;  1GC6 A;  5D3W A;  1XX0 A;  2I5F A;  4Z2N A;  1U5F A;  4JKF A;  2COC A;  2DX1 A;  3VOQ A;  3O96 A;  2COF A;  2LBB A;  1FOE A;  2DTC A;  3OAN A;  3ULB A;  2R09 A;  4TKN A;  2D2Q A;  1ST7 A;  5LON B;  4HAY B;  1ACA A;  3TO1 A;  1SHC A;  3KZ1 A;  2HE7 A;  3E9O A;  2D4Q A;  1U2B A;  1Z87 A;  2GCL A;  1DDW A;  3ML4 A;  2KGX B;  4H8S A;  4A6K A;  1UEF A;  3ODW A;  4HAX B;  1DDV A;  3WA0 A;  2D10 A;  2RGN B;  1PMS A;  1I7A A;  4D0N B;  3PZD A;  4MY6 A;  3V5W A;  2DLW A;  4NSW A;  4HB4 B;  3WYF B;  3A98 B;  2IFS A;  2VRW B;  2LOX A;  2J0J A;  5KCV A;  3SYX A;  1DIK A;  1XOD A;  4JK8 A;  3ENB A;  2J0M A;  2X0S A;  1W1G A;  3BIN A;  1GG3 A;  2P8V A;  1X86 A;  3U8Z A;  1HB6 A;  2P0H A;  4TYZ A;  3SBT A;  2Y8F A;  2OTX A;  4K2O A;  3A8Q A;  3ULC A;  4EMO A;  4JK7 A;  4F7G A;  1WGU A;  1FAO A;  4XWX A;  5HE3 A;  2CAY A;  3AJ4 A;  3SO6 A;  3DXD A;  2YS1 A;  2VKI A;  3PSC A;  2EC1 A;  1WI1 A;  4HAU B;  1WJ1 A;  2K2J A;  1ZC4 B;  5CLQ B;  2P0F A;  1WGQ A;  2DN6 A;  1P6S A;  3HK0 A;  4PQ0 A;  2I1K A;  1U29 A;  3QBV B;  1WJM A;  3SV1 A;  2Z0Q A;  3BJI A;  1FGY A;  5L81 A;  1N3H A;  4MT7 A;  3TCA A;  2MKR A;  5DH9 B;  1TJ6 A;  1V61 A;  4JK9 A;  1EF1 A;  2FDQ A;  2ABD A;  3D8E A;  1V89 A;  1FHX A;  5J3T A;  1NU2 A;  2D9Z A;  2YT1 A;  2QKL A;  2DHI A;  5D3X A;  5DHF B;  5J3Y A;  3F5R A;  3VIA A;  1TQZ A;  1MKE A;  4CHM A;  2M14 A;  2BCJ A;  3SUZ A;  4DX9 0;  2DYN A;  4F7U P;  4HAT B;  2R0D A;  3FSS A;  4JKH A;  2Z0O A;  2EMS A;  2GS0 A;  1AQC A;  3FP5 A;  1BTN A;  1EVH A;  3LJU X;  4NY0 A;  2N0Y A;  3FLV A;  5JVL A;  3DXE A;  4F7H A;  2ADZ A;  2RNR B;  3MPX A;  1KZ7 A;  5DIF B;  1M7E A;  1OQN A;  1XR0 B;  1E5W A;  2LUL A;  3UZT A;  1J0W A;  2PZ1 A;  2I1J A;  2D9V A;  2DIK A;  1H4R A;  4DBB A;  4IOY X;  4PNK A;  3F0W A;  2L1C A;  3TW1 A;  3QIJ A;  1K5G B;  1RJ2 A;  2CRF A;  5EFX A;  4JKB A;  2FJL A;  3SNH A;  3AU4 A;  3PG7 A;  3T06 A;  2KCJ A;  4IAP A;  3ZDT A;  3AU5 A;  1RRP B;  1XD4 A;  3E9L A;  4HB0 B;  2W2W A;  1W1H A;  2CY5 A;  4HHV A;  3P6A A;  2JP2 A;  1U5D A;  1FHW A;  1V5P A;  2RUK B;  1K5D B;  1UNQ A;  2G35 A;  2YVC A;  4HAV B;  4KAX B;  2OQB A;  4KHA A;  2CB8 A;  1HBK A;  2ELA A;  1KBL A;  1WG7 A;  2YT0 A;  5KQ4 A;  4BBK A;  1ZVR A;  4A6F A;  4HB3 B;  4WVF B;  5HE0 A;  3D8F A;  3RCP A;  1Y19 B;  2AEH A;  1OMW A;  2AL6 A;  5JHH A;  1QC6 A;  2MWN B;  3PEG A;  2YSZ A;  3X23 A;  4K2P A;  2XQN M;  1P3R A;  3N7C A;  4WJ7 A;  1MIZ B;  4JKE A;  2DYQ A;  3A8P A;  1ZC3 B;  5HE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...