3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Merlin
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
1NTIA 2M8SA 2N1VA 1E8WA 3BY4B 3DVGX 4GIVA 3D8DA 5E6NA 2LOXA 2IFSA 1WY8A 4TYZA 1TGZB 4CO7A 1L7YA 1PQSA 5J18A 4Z2NA 1ZKHA 2WYQA 1EAZA 1TTNA 3GZNI 4MGKE 5CHWA 2N0YA 2A4ZA 3PSCA 1FB8A 1WGRA 4M8NA 2PE9A 4LJOB 2N9XA 2DZIA 2YS5A 4HCNB 4W9GA 1ZW7A 1WFYA 2A5UA 3H6NA 3A33B 3DVGY 2IO1B 5E6PA 4LDTD 3ZUNA 4PYZA 4JLCA 1P5TA 2HE7A 2RUKB 4KHAA 3F0WA 1YQBA 2O2VA 4MM3A 4IWPA 2KWCA 2QHOA 2D9YA 3PLVA 3CXBB 4WWPA 3DVNU 3ODOA 2C5LC 2CR5A 1Z2MA 3U8ZA 2DYQA 2R0DA 2CS4A 2JXXA 1V5UA 2LOZA 2JZZA 4DDGD 3N32A 3WAOA 3BJIA 2KFJA 2ROZB 1E8YA 2KDIA 1WMHA 2PE6B 1FGYA 3B08A 1RFAA 3KY9A 3NS8A 1RAXA 1Y8RC 2KJ6A 2KMAA 2V1YA 5HE0A 3CSTA 3H9DA 4JGHB 5FR6A 2HRJA 2E2XA 1YX6B 3PTFC 3ZO5B 1ISNA 3PEGA 2MFQA 2GBKA 4ICVA 3MDBC 1V9JA 2H7DA 2LJ5A 4FN2A 1WJMA 2G4DB 3DDCB 3RCPA 3QHTA 4KVGB 4Z2MB 3H7PB 2HTHA 4F7HA 1Q5WB 2PPHA 1WJ1A 1R4MI 5LONB 4KAXB 1WX8A 2DYBA 2KFKA 4J6IA 5J17A 2D9WA 2LKOA 1OEYA 2IO3B 2LZ6A 3ZNGC 4F1SA 4II2B 2CHXA 2MP2B 5CHFA 4GDLB 1N3HA 4EMOA 2Y5BB 3N3KB 3DBHI 1Z87A 3L0WB 4HPMB 4DBGA 2C9WB 1WXVA 1EF1A 1BT0A 4GGQA 1W1HA 5D3VA 2J0KA 4WJ7A 5HE2A 2XK5A 3H7PA 1P1AA 4I6LB 2IBIB 2M4NA 3UF8A 4EUTA 2I1KA 2QKMA 3ML4A 1GUAB 3PLUA 1W1GA 5CHVC 4EZJA 1OY2A 4RM8A 3VUWA 3R7RA 3QWMA 1OQYA 4M0WB 4EZLA 2MSED 1VD2A 2MQJA 1EO6A 4HAYB 3H7SA 3CIKA 3OLMD 4CHJA 2DX5B 4BOSC 2H7EA 4HB4B 2GBMA 1MKEA 2V3SA 1E7VA 3K9PB 4W9DA 2OQBA 1EUVB 3W1YA 1T0YA 4HDOA 4ASWC 1J19A 2UZRA 2MBBB 2KTRA 4BKSD 3D8EA 3AXCA 1RLFA 2BYVE 3ZLZA 2KWUB 2JY6A 3A4RA 4K2PA 3V5WA 1H4RA 2D9ZA 3ZIMA 4A20A 2DZJA 1YD8U 1Y5OA 2D07B 1E5WA 2FCQA 2IY1B 3ODXA 2JF5A 2Y8GA 1DYNA 2LASA 3V62A 4IM0A 2NBWB 1I7AA 1DROA 2KQ7A 1E7UA 2KC1A 5JH5C 1XCGA 3Q3FA 4IG7B 5D3WA 2NS5A 4KV2A 2VRWB 3TL5A 2WDTB 1GNUA 1VCBA 4N9F4 1V86A 2CAYA 2AYOB 2L76A 3VQIA 2FJ9A 4L6EA 1OQNA 1XD4A 1V5PA 1V89A 3PP2A 2G3QB 3TMPB 3P7ZA 1MAIA 4WJNA 1KLVA 4KDIC 1QQGA 3U7DA 5J3TA 4ANXA 1JRUA 3F5RA 2V4LA 3UQBA 1QC6A 1AWEA 1SHCA 3W1SC 4EFOA 4W9JA 1FHXA 2L2IA 2NCNA 2NZ8B 4DHJB 2KDBA 1FOEA 2L0FA 3FSSA 3NZSA 4DX8A 4F7UP 2JP2A 1WJNA 3D32A 1J8CA 3I3TB 3VUYA 2V76A 3HQCA 2KN5A 1KM7A 3JSVA 1HBKA 1RRBA 2BWES 2L3ZA 1DDWA 2PEAA 2WWZA 1V80A 3PVWA 3DBLI 3NZUA 4RM9A 4W9LA 2DA0A 3ZVRA 1SE9A 2BKFA 1ZSQA 2W2XC 1UZXB 2O2VB 4CYEA 2ZEQA 2N9PC 3QCAA 2DYNA 1WE6A 4NPNA 5D2MB 3ML8A 4LCDE 3DXCA 1XQQA 3NHEB 3ZDMC 4TQ0A 1I35A 2JPHA 3OJ3A 3V6CB 3WANA 3PT2B 2AWTA 3EFUA 4DXAB 4EKUA 3VDZA 4HVBA 5D27A 2P0FA 2RVBB 1NVLA 1WXAA 1DBHA 3WYFB 3UZTA 2GS0A 2LI5A 2KDFB 5HE3A 2N9EB 4IC7B 1IRSA 3PGEA 1Q67A 2DFKA 2KCJA 4A5KA 3RT3B 3VVWB 3W1SA 1WR6E 3PHWB 1YIWA 5LLIA 3AULA 2K8HA 2LVQA 4MK0A 2DAFA 2ZJDA 2MWNB 2BYFA 2GCLA 4FLHA 1WR1A 1NU2A 1FAOA 4GOCA 2BPSA 3KRWA 2R2QA 3EHVA 4B9KA 2MWSB 2JZ3B 3ECIA 2RLOA 3N7CA 1BAKA 4WJOA 2MCNB 2COCA 2ROVA 2Z59B 2PJHA 3VOQA 2KFKB 1WXSA 1GC6A 1MK7B 1C3TA 3SYXA 3VH3B 3VH4B 4KSLC 3QARA 2MP2A 1XR0B 2ZPYA 4HWIB 1WGHA 2VKIA 2ELBA 4ANVA 4MGZE 2JUOA 4MJSA 3TO1A 4NJ6A 2BYEA 1UPQA 4RMAA 2MBHA 1ZGUB 4BOZB 2LD9A 2K2JA 4DDID 1G6JA 5DIFB 2KKCA 3PRPB 3WA0A 2KVRA 2LWPA 3C0RB 2LRWA 3PVLA 3L08A 3AJ4A 4EOYA 2Q13A 5JHHA 3OJ4B 1V5OA 2L8JA 1UBQA 2KANA 3HM6X 1C1YB 5FI0A 3DOWA 5KHQA 4B95A 3Q3JA 4ZRIA 1WG7A 2UVMA 2CKHB 2MRPA 1J0GA 4BBNF 5AEKB 3DQVA 4KSKC 2RQ1A 2JT4B 2LGYA 5C5BA 2KX0A 5DHAB 5IA7A 5JHAA 5DI9B 1ACAA 3ZRFA 3ZRCA 4WJQA 1WRDB 1WJ6A 1WX9A 4DK5A 2D11A 2MBOA 1GJZA 1ZC4B 3N30A 5J2RA 1MIXA 4PS8A 4TV3A 4A3OA 4HAWB 4HATB 2G35A 4HB0B 2C7NB 2EKEC 3UGBB 2AL6A 2CHWA 2MA9B 3JVZX 2CRFA 2KO3A 4IAPA 2R2OA 2P0DA 3DXEA 3TFMA 1P3QU 5BO4B 3LJUX 4K7WA 1X1FA 1V61A 3GOEA 2GCJA 3TVVA 1OMWA 1WGDA 5J3QA 1H10A 2KHWB 1U4AA 1FXTB 2RD0A 4FA6A 3VAWA 2Z0PA 2KD0A 2D3GA 2GBJA 1WJUA 2LULA 2R09A 2MDXA 1OTRB 5KCVA 1E8ZA 2LXCA 1YX5B 1BWNA 4GZUA 2O6VD 2WX1A 4KHBB 3KVFB 1L2NA 2MKRA 2KDEB 2ZPNA 5JP4A 1UPRA 3ALBA 5CTRC 1U27A 3TCAA 3AI5A 2RR9A 3OANA 1K5GB 2GBNA 1KOTA 3ZNZB 4MY6A 3JSVB 2LGDA 3JW0X 3EPYA 1X05A 3TW1A 2J0JA 4XZ4A 2DTCA 4G50A 4IOYX 2G4SA 3VFKA 2BCJA 2NBUA 2GOWA 1KI1B 1P98A 2LVPA 3FP5A 2C60A 4G11A 4K7UA 4K81A 2N7EA 4MGYE 2EMSA 5L95C 3V60A 3FEHA 2FCMA 3HW2B 3KRXA 4KZCA 4KZ0A 4EZKA 4MEMA 4JL9A 3R66C 2D9XA 1E90A 2YVCA 2K25A 2ZCCA 3P6AA 2I1JA 1WZ3A 1GC7A 2JRIB 2KX3A 2D9VA 3D8FA 2IZVB 2IYBA 4NSWA 4NJ7A 3ZW3A 3PHXB 2MLBA 4MGIE 2CHZA 3UIOB 5CX3A 1J0WA 3TJPA 4FBJB 1RRPB 4GDKB 4AWJA 4HB3B 2C7MB 3PPAA 3TBLD 1BTKA 5DPTA 3RCZA 4IM3A 2LYDA 2C7HA 2ASQA 2FCSA 3MHSD 3G9WA 2YF0A 2J7QB 2P8VA 4PS7A 4W9HA 5D6JB 4LJPB 3NSUA 3VXWA 4TUUA 4B6WA 2DN6A 3SU8X 3T06A 4ZDVA 2LGXA 2COAA 3MPXA 3VTWA 4DX90 2NBVB 5G2NA 4GDKA 1K8RB 5GOWB 2I5CA 2LUEA 3QAQA 3RYTA 1Y19B 5J3YA 3K9OB 1U29A 3O96A 1E8XA 2MBEA 4MJSB 3QX1A 4E3CA 2HTHB 3ZVVA 1UBIA 5L81A 4MH0E 2OOBB 4B6HA 5E6OA 1HE8A 2DAJA 1EVHA 3X23A 1R4NI 3AU4A 1WYWB 4JIOU 4ZYNA 3RD2A 4IWQA 1U5FA 2K8BA 2M0XA 1MPHA 1ZC3B 4GXBA 4WSFA 3ULCA 3QBVB 4YONA 5C16A 4HAUB 1V49A 2M17A 2P0HA 5DPSA 5AZFA 2DKPA 4AUQC 2COFA 3UQAA 2IO0B 3A1QA 1WI0A 1X86A 2UYZB 2XK5B 3M62B 3SDLC 3PG7A 3V61A 3VTUA 2DYMA 4IW0A 4FHKA 2CODA 4HK2A 4W9CA 3R3MA 3SNHA 3VTVA 4ANWA 1IYFA 1WXMA 4HCPB 1XT9B 4HXDA 2PZ1A 2ZVNA 3QK0A 4GU2A 2G45B 1M7EA 1TJ6A 4IUMB 2M1MA 2XEWA 3IG3A 4MSMB 4WWOA 5AZHA 1UNPA 2KJHB 2W9NA 1W1DA 2UZSA 4NNJB 3KUDB 3SV1A 1MG8A 1SIFA 2AL3A 1U5GA 3CMMB 3RUIB 3ZTDA 2IO2B 2VRRB 2KGXB 4W9FA 4I6NB 1OEYJ 1GG3A 3FM8C 4YL8A 2N7DA 4FHJA 2YS3A 4XC2A 3X0WA 2LG1A 3A4SC 3APDA 3IHPC 5CLLB 4BBKA 3L54A 3KW5B 4MDKE 5C1ZA 2L05A 3SD5A 4FJVB 5C23A 1TZ1A 2Z0QA 1WM2A 2N1WA 2RGFA 3LDZE 4OVVA 4AJWA 5DCNA 2YSZA 5D3XA 4FADA 3KZ1A 3ODWA 4GSWA 5KQ1A 4A6KA 3PVUA 2ABDA 2YT1A 2UWQA 4HAZB 3KH0A 2COPA 1UNRA 4NAWA 4P7IA 2GMIC 2GJYA 5D3YA 4XWXA 1LFDA 5C5BB 4MSQB 3MTNB 5L83A 3DPDA 2GBRA 4W9IA 2RSGA 2FCNA 4DHZE 5GMVA 1UNQA 3L13A 3WAPA 2DENB 5D7GA 2NR2A 4HAXB 1P3RA 5DPRA 4W9KA 4BKSA 3SO6A 2BKRB 2OJRA 3M95A 1WVHA 2RGNB 3ENEA 2FDQA 1KZ7A 2WH5A 4CHKA 5EFXA 4HAVB 3IFWB 2BWFA 1FHOA 1ZM0A 1AARA 1NTVA 4F7ZA 4BKGA 2KTRB 4IWOA 4WJPA 1WGUA 5LOPB 2J59M 4C0AA 2FUHB 2YS1A 4IM2A 5CLQB 2K6DB 1XKEA 2J0MA 5JHGA 2Y8FA 4DHJD 4ICUA 2Z0OA 3A8QA 3HIZA 3RULA 3QC8B 3U30A 2WX0A 2ZCBA 5AZGA 3PRZA 3QJZA 1I2HA 2L0TA 3GYPA 2KLGA 2DHKA 5JZEB 4ZRKA 3VIAA 1V88A 3KYDD 1V2YA 3PRMB 3DCGA 3A9KA 2RNRB 1Q0WB 2MBQA 1NBFC 3P2BA 2MX2A 4A6HA 2MW5A 5C79A 2EMTA 2DHZA 3EC8A 4MELA 1PMSA 2ADZA 2KUPA 3WAMA 2KXJA 4TKNA 5DH9B 4KIKB 3OAWA 1LW3A 1P0RA 3M63B 2NVUI 1IP9A 1KJTA 2CU1A 4M8MA 4Y94A 1KZGA 3ZNHB 1ST7A 1DDMA 2QKLA 2DYOA 5LXIB 3GYOA 2L1CA 3A9KB 2B3AA 4AOFA 1P9DU 4HLEA 1UELA 2CY5A 1HB8A 1FGZA 1TQZA 4PNKA 4K17A 1SGHA 2DHIA 2W2WA 5FI1A 1UD7A 1S3SG 4K1RB 1V81A 4KIKA 3A9JA 2D2QA 3ZDTA 3EECA 4URKA 3MJWA 1PLSA 2M38A 5LXHA 4BKTA 3ONSA 2W2XD 2YLMA 2AEHA 4H8SA 2ZVOA 4HB2B 5JHBA 1M7RA 4FJZA 4WAAA 1WI1A 4WWNA 2Y7BA 1OGWA 2LXAA 4DBBA 3KUZA 5JLJB 1EF5A 3APFA 3VUXA 5KHOA 2DKQA 2EC1A 4MT7A 4PYUA 3UINB 3DBRI 2ZNVC 4GB9A 2M14A 4G3XB 4ZRJA 3ML9A 4EJNA 2N4FA 3A98B 3BINA 2CB8A 2NPTA 4E74A 3A1QB 4WVFB 1CMXB 3ZNID 3DXDA 2FAZA 1AQCA 5C6RA 3LJ3A 2L7RA 3V6EB 3AU5A 4KDLB 2Z0EB 4X57B 3ZTCA 2KZRA 3ULBA 3L16A 3RZWC 2LBBA 3WIMA 1IPGA 1XD3B 1I42A 3QIJA 4HDQA 3NY5A 2DHJA 3IBEA 4I6PA 3A8PA 3M3JA 3HHMA 2BGFA 4JQWC 1PFJA 4GN1A 4PS3A 1DDVA 1TXDA 4A6FB 1TBEA 1WGYA 2NPTB 3KUCB 3PSEB 4EEWA 2K39A 1HB6A 1V5TA 1WMHB 3DBSA 1FHWA 4IFSA 2CQUA 1UH6A 4CHMA 1QZEA 4GPTB 2Z0DB 4GMVA 4K2OA 4KHOA 2D10A 3CSFA 1UGMA 4TQ1A 2KWVB 3B0AA 4GMXB 4XX5A 2DZKA 3TIXA 3DVNV 3QQ8B 1K5DB 1LM8B 4HJKA 4A6FA 2KNBA 4D0NB 1MK9B 1BTNA 1WJ4A 2DX5A 2K1FA 2OTXA 4OVUA 1NI2A 4HHVA 3RZFA 2RPQA 5EDSA 2I5FA 1H8CA 4NAWB 4F8CB 1P6SA 1Q1OA 3SUZA 1WF9A 1LB1A 2CY4A 2DZMA 2JVCA 2LRUA 1WGGA 3HM3A 4II3B 4A3PA 4GDLA 4PQ0A 1WGQA 3KYCD 4NQLB 1U5DA 3NOBA 1RJ2A 1WE7A 1WX7A 4G0NB 2KMCA 1MIZB 2K00A 2NMBA 2XBBC 4FJYA 1U2BA 1WH3A 2X18A 4BFRA 1M94A 2YT0A 2XQNM 2IY0B 3JYUA 3L10B 2KK8A 1S1QB 2L00B 3PS6A 2ZZPB 2KTFA 3WALA 3FLVA 1WM3A 2K6QA 5IAAC 3UIPB 1X1MA 2HJ8A 1NTYA 2BF8B 4BVUC 3KSYA 3L17A 4DWFA 1X11A 4NQKE 5HKHA 1D3ZA 1LQBA 3B1LX 1X1GA 3HK0A 4FULA 4AP4C 4F7GA 5HE1A 2FIFA 1ZVRA 4NY0A 2ELAA 2FNJB 2D4QA 2K8CA 4K7SA 4LDTB 2YRYA 3PZDA 3SHQA 4HPLB 3IVFA 1F9JA 4BBNC 2FJLA 2O6VA 5IJMA 3H1UA 1XODA 1B55A 1V5MA 3M1IB 1V6EA 2FIDA 2KLCA 2KQSA 3R7QA 2VSZA 2KOXA 2HD5B 4WQOB 3PV1A 3ZKJC 2KC2A 1YJ1A 1A5RA 5DHFB 1Z5SB 3APCA 3QWZB 4E71A 2LVOA 4AJYB 1LXDA 5D94A 1EGXA 5G55A 2K2UA 2RSUA 2ZNVB 3S2AA 3CF6E 5KQ4A 2DX1A 2N23A 2O6VB 2IYDB 3O65B 3QA8A 4W9EA 2JWZA 3VHTC 2EJ8A 1NDDA 3T8MA 5TR5A 1WIAA 3T9LA 2JRHA 2REXA 2KJRA 1XX0A 2DLWA 3A9JB 1U5EA 4DHZB 3PREA 4ANUA 1WZ0A 5DPWA 1UEFA
chains in the Genus database with same CATH superfamily
2N1VA 3BY4B 4GIVA 3NVWA 5IOIA 1WY8A 2BS3B 1QT9A 1L7YA 1ZXIA 2WYQA 1EAZA 1TTNA 3P1MA 4MGKE 5CHWA 4HKQA 1TZOA 2A4ZA 1FB8A 1JROA 1WWTA 4M8NA 1SE2A 2PE9A 2N9XA 4W9GA 2G1EA 4PT5A 1ZW7A 1C9FA 2ZW0A 2MH7A 2W54A 2IO1B 5E6PA 1P5TA 3F0WA 1FNVA 2D9YA 4WWPA 3ODOA 2CR5A 1Z2MA 2JXXA 3P4SB 4DDGD 3N32A 1KFYB 1FGYA 1L4ZB 1Y8RC 1HTOA 1N62A 2HTME 3CSTA 5FR6A 1YX6B 2JYTA 5AUKA 4P1BC 1ISNA 3PEGA 2MFQA 3MDBC 2H7DA 2LJ5A 1WJMA 4YSZB 1R4MI 2DYBA 4XDCA 5J17A 1R4NB 4F1SA 3NRZA 4EMOA 1FCLA 4DBGA 1BT0A 2J0KA 1XXGA 2BQQA 3I9V1 3N1YC 2M4NA 1W1GA 4HJGE 4RM8A 4HROA 4UDUC 1DOXA 2VH2A 3RPFC 3OLMD 1MKEA 3K9PB 1T0YA 2UZRA 3D8EA 2KWUB 1YD8U 2FCQA 2D07B 2IY1B 4G3XB 2Y8GA 1UWMA 2TSSA 5LNK1 2KQ7A 1E7UA 5JH5C 4K3BA 1XCGA 4ACFA 4IG7B 2WU2B 1ZDVA 3TL5A 1YQ4B 3VQIA 4L6EA 1JWBD 3PP2A 1EWCA 3P7ZA 3AN1A 4JK8A 4KDIC 5C2TB 2IDYA 4JKBA 2KACA 3U7DA 2JQRB 2JZPA 3Q14C 1UWXA 3TSSA 4KHBA 4W9JA 2NCNA 3PO0A 2IJ0A 2L0FA 3NZSA 2DBYA 4F7UP 4QJ5B 5HG2A 3D32A 1J8CA 2V76A 2KN5A 2PIAA 2V9HA 4CSQA 3NG0A 5IO9A 5I4DA 3ABVB 1ZSQA 5E6JA 4CYEA 2N9PC 3ZDMC 4TQ0A 3NHEB 3V6CB 3WANA 4DXAB 5D27A 2L32A 4US9A 5H8YE 2K49A 2KYWA 5JVLA 2LI5A 2J4XA 4IC7B 4JK9A 2DFKA 1HZ6A 3RT3B 1WR6E 2M56B 2KUQA 3T3OA 4MK0A 2BYFA 2R2QA 2MWSB 1JWSD 1V1PA 3N7CA 1BAKA 2JZ3B 5FK9C 2MCNB 2ROVA 1HTQA 2EELA 1GC6A 1MK7B 4JKCA 3SYXA 4QJ4B 4YXDB 4KSLC 3Q69A 2QILA 4ANVA 3W2DA 3TO1A 4RMAA 1VJKA 1F1HA 2LD9A 2KKCA 3C0RB 3AV8A 4KKJA 3GP7A 1PFDA 3SR6A 1V5OA 1SF0A 3Q3JA 4ZRIA 4S0RA 1J0GA 3AEFB 3RNEC 4BBNF 5AEKB 2LGIA 1V8CA 2RQ1A 2LGYA 5C5BA 1DYQA 5DHAB 5IA7A 5DI9B 1ACAA 3ZRFA 4WJQA 1GAQB 2MBOA 1ZC4B 4A3OA 4J3OD 3NWDA 4HATB 2G35A 2C7NB 1JW9D 1MVKA 3NWAA 1X1FA 3TVVA 2LFIA 5J3QA 3ZJTA 1U4AA 1FXTB 1C76A 2RD0A 1DOYA 2D3GA 2FE8A 1E8ZA 1BWNA 2QCZA 4KHBB 2ZPNA 1U27A 4D2KA 3R2TA 1E9MA 3ZNZB 3EPYA 3BK1A 2J0JA 5M4YB 2BCJA 2C60A 4K7UA 2N7EA 2EMSA 3MHZA 3FEHA 1XO3A 3KRXA 1HA5A 2FCMA 3I63C 1E0ZA 2JU6X 2D9XA 1E90A 4OZBA 3KWLA 3P6AA 2JRIB 4IKGA 2IYBA 2LMCA 4NSWA 4NJ7A 3C8YA 2MLBA 3NW8A 4MGIE 5CX3A 4ZOHC 1CZPA 1J0WA 4FBJB 1RRPB 2C7MB 5IP4D 4IM3A 4RH6A 5D6JB 2YF0A 1R7SA 4W9HA 3VXWA 2WHIA 5H92C 4ZDVA 3T06A 2FJUB 3VTWA 3MPXA 1N61A 2QDFA 4GDKA 2BTEA 2PKOA 3IAM1 1Y19B 3K9OB 2MBEA 2PTLA 3ZVVA 4MH0E 1HQRD 3SFEB 4EZJA 5C1ZA 1EVHA 3AU4A 3DBRB 2QMTA 4WSFA 1ZC3B 3QBVB 5DPSA 4AUQC 3C19A 2IO0B 3P4QB 2KR0A 1K53A 3VTUA 3V61A 2R2YA 2DYMA 4IW0A 4FHKA 2CODA 3R3MA 1WXMA 1DIKA 4HCPB 2WDRB 1TJ6A 2OHFA 2M1MA 4MSMB 3IG3A 5AZHA 1UNPA 1W1DA 2WDVB 1MG8A 1SIFA 2AL3A 1U5GA 3ZTDA 2IO2B 2YS3A 2OEDA 3APDA 3IHPC 3PZ7A 3Q8EA 3L54A 1I4GA 4FJVB 1TZ1A 2Z0QA 2RGFA 2N1WA 3Q8BA 4OVVA 1QKZA 5DCNA 3I57A 3KZ1A 3ODWA 2N0SB 5KQ1A 1E10A 3KH0A 3PVUA 3WAOA 4HAZB 5L83A 2GBRA 3DCXA 1P3RA 4ZHOA 4RGNA 2WH5A 3IFWB 2KQ4X 2CU3A 4QXAB 1VBGA 3DBLB 2YS1A 3FKYA 4IM2A 3HIZA 2K9XA 3U30A 3PRZA 3GYPA 1JDEA 5JZEB 1QLBB 1V2YA 3P2BA 3A9KA 2Y5CA 1FXIA 2W55A 3BYYB 2DHZA 2KXJA 4TKNA 4KIKB 3OAWA 1LW3A 3OG5A 1KZGA 1ST7A 1DDMA 2QKLA 2DYOA 5LXIB 4AOFA 1UELA 4AS1A 4K17A 1S3SG 1V81A 3A9JA 3ZDTA 5LXHA 3ONSA 2W2XD 2YLMA 4H8SA 1L0XB 1OGWA 3RFZB 3KUZA 5JLJB 4REZA 5KHOA 3AE3B 4OHJA 5HFYA 2M14A 3ML9A 2N4FA 2WQYB 1CMXB 1HXYD 2WDQB 2LBBA 3WIMA 1XD3B 1MHXA 4PS3A 3HHMA 4USAA 1TXDA 2NPTB 3PSEB 1HB6A 1GOZA 1V5TA 1AWDA 1UH6A 2KT7A 4GPTB 1XLPA 2D10A 3B0AA 4GMXB 1SE4A 1K51A 4XYCA 1K5DB 4A6FA 3NUHB 1MK9B 2OTXA 4OVUA 1NI2A 2RPQA 5EDSA 3MFGA 1Q1OA 2RPVA 1WF9A 2DZMA 3HM3A 4PK1A 4PQ0A 1WGQA 4NQLB 1U5DA 1WE7A 1WX7A 2K00A 2NMBA 2X18A 4BFRA 1M94A 2YT0A 1DOIA 3L10B 5HHDG 3FLVA 2K6QA 4JKFA 2N9KA 1C4PA 3AB5A 2HJ8A 4DXFA 4ARCA 1D3ZA 4AP4C 5HE1A 4HSIA 1ZVRA 2FNJB 2YRYA 1P7EA 1WGKA 3O13A 2FJLA 5IJMA 2JX5A 2FIDA 3M1IB 2KQSA 5BMHA 1FD6A 2KC2A 1YJ1A 2K8EA 1Z5SB 1TS4A 3APCA 4E71A 1LXDA 5D94A 3CF6E 5KQ4A 3HSAA 3O65B 3QA8A 1FPYA 2QJLA 1NDDA 1UGJA 1FXAA 2KJRA 1XX0A 2R61A 4QJ3B 1U5EA 4N59A 5D3IB 3DVGX 3RNGC 2LOXA 4TYZA 1WYGA 4NAMA 1ZKHA 2W3RA 3GZNI 1JWMD 4LJOB 4HCNB 2YS5A 1WFYA 5TSSA 3H6NA 3A33B 3DVGY 4MACA 4JLCA 1C79A 2LHEA 2GB1A 3CXBB 3U12A 3U8ZA 2DYQA 2R0DA 2KFJA 2ROZB 3B08A 1RFAA 1RAXA 1JRPA 4JGHB 3UI3A 4C7ZA 1V9JA 1ZOYB 3DDCB 1KLUD 1NENB 3H7PB 4H2AA 4ARIA 1Q5WB 5LONB 1WX8A 2WXQA 1OEYA 2IO3B 1PGBA 2CHXA 4GDLB 2Y5BB 1IBXB 2D3BA 1ZPSA 2XK5A 3BWUD 4I6LB 4AWJA 1STEA 2IBIB 4EUTA 2I1KA 1JALA 3PLUA 5CHVC 3VUWA 3TEWA 4JKGA 3QWMA 4M0WB 4EZLA 1VD2A 3H7SA 3B9JA 3Q2AC 4CHJA 4BOSC 2H7EA 4HB4B 1TS3A 1E7VA 3AEBB 2OQBA 2KN4A 1J19A 4P6VF 4BKSD 1N5WA 5IKCM 1KBLA 4GOUA 4K2PA 3V5WA 2JF5A 1E5WA 1DYNA 4IM0A 2UU7A 2KMMA 3Q3FA 2INDC 4KV2A 2VRWB 2WDTB 4DIXA 1VCBA 2WP9B 2WLBA 1XF5L 1KLVA 1MAIA 1VBHA 4WJNA 5J3TA 1JRUA 1TYGB 2DIKA 1KC7A 1AWEA 1SHCA 1FHXA 3GS2A 2NZ8B 3KQ4A 1N63A 1WJNA 1T3QA 1KF6B 3JSVA 1DDWA 2RMMA 2BKFA 2ZEQA 2W2XC 1UZXB 4NPNA 3NWFA 2JXTA 1I35A 2AWTA 3EFUA 4HVBA 2RVBB 1NVLA 1OFFA 1V1PB 1B1ZA 3W1SA 4N58A 1ZE3D 3KLSX 1YIWA 3AE6B 2K8HA 3RMKC 2MWNB 4GOCA 1FAOA 2BPSA 2HDEA 3ZGZA 3E9SA 4NZLB 3ECIA 2RLOA 2COCA 2Z59B 3VOQA 2KFKB 1C3TA 2MEKA 1N6ZA 2MP2A 2ZPYA 1TT5B 1NVID 2BYEA 2MBHA 1AN8A 1FM0D 3PRPB 1TIFA 2Z13A 2L8JA 1RYJA 1UBQA 4JE3B 4B95A 2UVMA 1WG7A 2MRPA 1NYQA 2LJIA 4KSKC 2JT4B 1K52A 4ILJA 4DXGA 3FVCA 1WJ6A 4DK5A 2D11A 3N30A 4PS8A 4HAWB 3ENBA 4HB0B 3UGBB 2AL6A 2CRFA 5BO4B 3LJUX 1EU4A 4K7WA 3GOEA 2GCJA 3W5UB 1H10A 2KHWB 4YT0B 2Z0PA 2GBJA 1WJUA 4XDDA 2MDXA 1OTRB 1JCKB 3DHHC 2O6VD 3B2FA 3KVFB 2K0PA 5JP4A 1UPRA 3ALBA 4WAFA 5CTRC 3TCAA 1K5GB 1KOTA 2LGDA 3JW0X 2DTCA 4G50A 3VFKA 1KI1B 1P98A 2LVPA 4HRSA 4MGYE 2NMQA 4KZCA 4KGRA 4JL9A 1FNUA 2K25A 4L2YA 2ZCCA 2I1JA 1XLQA 5BYRA 2KX3A 2D9VA 3AEDB 3UIOB 2BS2B 4HB3B 1IGCA 5DPTA 2LYDA 1FNWA 3G9WA 4C00A 2EKIA 3NSUA 1L0VB 2HJ1A 4DX90 2NBVB 5FKAC 1XLNA 4ILHA 2I5CA 2LUEA 3RYTA 5J3YA 3VR8B 4MJSB 3QX1A 2HTHB 3DBHB 5L81A 1HE8A 1J7BA 4ZYNA 4JIOU 1I42A 2K8BA 4MGZE 4YONA 1V49A 1F0ZA 2DKPA 2INPE 3A1QA 4RCOA 2UYZB 3N1XC 1ZDXA 3VTVA 1TJEA 4HXDA 3HVDA 2PZ1A 2XEWA 3MC9A 3CMMB 5G5GA 2VRRB 1PGAA 4W9FA 4I6NB 4FHJA 4XC2A 2AQ2B 2WS3B 2LG1A 5CLLB 3VR9B 2BYTA 4JKHA 2PW9A 4AJWA 1L0YB 2YSZA 4GSWA 3HVZA 4A6KA 4M01A 2YT1A 2COPA 3T9LA 5D3YA 1QOBA 1UNSA 3MTNB 3EGRA 2FCNA 3SBTA 1FEHA 2KDMA 4HPPA 5HI1A 5DPRA 4HAXB 3FAHA 4L23A 3SO6A 2OJRA 3M95A 1WVHA 2GRIA 4YSYB 5EFXA 2RDBC 2WXHA 4IWOA 4LNIA 4XWTA 3E56A 1I4QA 2J0MA 4DHJD 3R8BA 1ZP0B 2QEJC 1TS2A 5AZGA 3QJZA 2L0TA 4A55A 3VIAA 3DCGA 1UUPA 2RNRB 2MBQA 4N9F4 3NJTA 2EMTA 4IOIE 2K5PA 2G9HD 5DH9B 1SBBB 3LB8C 1A70A 1YOVB 4JK7A 2L1CA 3A9KB 1BXTA 4XE0A 4PNKA 3U4EG 4KIKA 2AEHA 1QILA 1F2RC 3LYYA 3CIRB 4HB2B 5JHBA 1VR9A 4ZRQA 4DBBA 3VUXA 3APFA 3A58A 4MT7A 3Q8AA 4JX1C 3UINB 4RF0A 2IPKD 1VDVA 4GB9A 2ONQA 3Q6BA 4WVFB 3ZNID 3DXDA 1AYFA 5C6RA 3V6EB 3GB1A 4X57B 2KZRA 3L16A 2JWUA 2DHJA 3IBEA 4TQ1A 3ZNGC 3M3JA 4YTMB 1IBXA 4ILGB 1PFJA 3X0WA 4A8XC 3MJ5A 1WGYA 2WXFA 4O1NA 1KTKA 4US8A 2XN9C 2SEBD 2Z59A 1IUEA 1QZEA 2Z0DB 2ICIA 1UGMA 3H8HA 4XX5A 3AM9A 2DX5A 4HHVA 4NAWB 1MFWA 2LRUA 1LB1A 2JVCA 1WGGA 1RJ2A 1VRAB 1MIZB 2IY0B 3PS6A 2XQNM 3JYUA 2KK8A 1S1QB 2L00B 2KIGA 2ZZPB 3WALA 2Y5PA 2K3UA 1X1MA 1NTYA 2BF8B 3VRBB 4DWFA 1LGRA 4A6QA 5HKHA 1LQBA 1X1GA 3HK0A 4FULA 1E6EB 4N6EB 4NY0A 5IRSA 4LDTB 4K7SA 3IVFA 1RM6C 4NJCA 1F9JA 1JMLA 1V6EA 1V5MA 3VRAB 2VSZA 2M19A 2HD5B 4WQOB 3PV1A 3ZKJC 1EGXA 5G55A 2RSUA 3S2AA 2DX1A 2N23A 2WXGA 4RGTA 2EJ8A 5C3JB 5TR5A 3AE2B 1B9RA 4ITKA 2DLWA 2D5GA 4L1RA 3PREA 2MJDA 3AULA 2M8SA 5GXGB 1E8WA 5E6NA 2IFSA 3IXSA 1N5XA 4ZYSA 4Z2NA 2WXKA 3SEBA 4B0EA 1TY0A 3ZUNA 4QAYA 4PYZA 2FBWB 1XCQL 2HE7A 2RUKB 1YQBA 2O2VA 4MM3A 4IWPA 2KWCA 2QHOA 2V4IB 2LOZA 3E9LA 3BJIA 1E8YA 5EE3A 1WMHA 2Z8LA 3KY9A 3BK2A 2KMAA 2V1YA 2WXJA 5HE0A 3IAS1 2CJNA 3ZO5B 4LNFA 2NTSA 4YTNB 1SB3C 2GLSA 3QHTA 3RCPA 1V1OA 1YQ3B 2HTHA 2PPHA 1WJ1A 2D9WA 1QF6A 3N20C 4II2B 5CHFA 3RNFC 1N3HA 4ANUA 4HPMB 2C9WB 1WXVA 1W1HA 3H7PA 3UF8A 3P4PB 2QKMA 3MC0B 2BVCA 1VLBA 3R7RA 2MQJA 4HAYB 3ZJVA 3E9OA 2GBMA 2MBBB 2KTRA 1RLFA 2BYVE 1KRHA 3AH7A 4M0WA 4KKIA 3U52E 1FFUA 2IGGA 1NI3A 1SJED 2D9ZA 4A20A 3AEAB 2REXA 1Y5OA 1ENFA 3ODXA 1JWAD 2NBWB 1DROA 1FIQA 5D3WA 2Z14A 1GNUA 1V86A 2NTTA 2CAYA 2L76A 1V5PA 1V89A 2G3QB 2JYEA 2B76B 1QC6A 4EFOA 3OHMB 2L2IA 3ZYYX 4KX6B 1FOEA 1EM7A 4DX8A 1SXTA 3I3TB 3VUYA 3HQCA 1TKEA 1KM7A 2V3PA 1RRBA 2BWES 2PMVA 2L3ZA 5BYQA 2WWZA 3PVWA 3NZUA 1ZUD2 4RM9A 2CJOA 4W9LA 3ZVRA 1SE9A 2O2VB 3ZLZA 2DYNA 1WE6A 5D2MB 3ML8A 2Z4DA 1QQRA 2RDGA 4EKUA 3VDZA 2P0FA 1WXAA 3WYFB 3UZTA 2OJWA 5HE3A 2N9EB 1Q67A 4A5KA 3VVWB 3PHWB 2ZJDA 2DAFA 3KRWA 3EHVA 3HIEA 3W9CB 1T0RC 2WXRA 3U2SC 1JQ4A 1XR0B 4HWIB 3HRDD 2VKIA 2ELBA 2JUOA 1VZ7A 2BS4B 4Q2JA 2K2JA 1G6JA 2LWPA 5G5HA 4M02A 3OJ4B 1I4PA 3HM6X 4GNKB 1C1YB 5FI0A 2GI9A 4LLGM 1SE3A 3LXFA 5BYSA 4C56C 4JKEA 2KX0A 4R3DA 1D6EC 1I4RA 2QIEB 1WRDB 2DWQA 1WX9A 1F2RI 1MIXA 4JWUC 4RFBA 2CHWA 1MI1A 4JWSC 2KO3A 4IAPA 2P0DA 3RNAC 1SEBD 1V61A 1OQRA 1WGDA 1YN5A 3GZNB 2KD0A 1EU3A 2R09A 2LXCA 2WX1A 1L2NA 2MKRA 1C4AA 3Q3NC 3AI5A 2GBNA 4L1BA 4MY6A 4XZ4A 4WH4A 3TW1A 4IOYX 3IT6B 2GOWA 2D3AA 3FP5A 5L95C 3AMZA 3BVZA 1ROEA 4KZ0A 4MEMA 2YVCA 3AEGB 3ZXVA 1WZ3A 3AEEB 2BB6A 3PHXB 3NVZA 2AQ3B 3TBLD 4TSSA 3RCZA 2C7HA 4YTPB 1M4VA 2ASQA 4PS7A 3MHSD 1QOAA 2P8VA 3SU8X 1R4MB 2LGXA 4AQ7A 2COAA 5G2NA 1GPXA 1K8RB 1K50A 1U29A 4E3CA 4MH8A 4B6HA 1WYWB 4MM3B 4IWQA 2M0XA 2W9NA 4GXBA 3ULCA 5C16A 2WXIA 2COFA 3E9PA 1PYWD 1X86A 2XK5B 4MT5A 3SDLC 3PG7A 1YN4A 4HK2A 3SNHA 4CQNA 2MJ3A 2G45B 1M7EA 2H89B 3AE4B 1GB4A 4JKGB 2KJHB 2UZSA 4NNJB 3KUDB 3SV1A 3RUIB 1L5PA 4ZRPA 1OEYJ 3FM8C 2R82A 2N7DA 2GUMA 4BBKA 4MDKE 2L05A 3SD5A 2KAJA 3RI7C 1HEZE 1WM2A 5BMGA 3BVMA 1OQQA 1KH0A 5D3XA 4FADA 1J7AA 1UNRA 4P7IA 2GMIC 2GJYA 1LFDA 4XWXA 4P16A 2M0AA 3DPDA 1E7PB 2BT6A 2RSGA 1MG4A 4DHZE 5GMVA 1UNQA 5D7GA 2NR2A 2BKRB 2FDQA 4HAVB 1NTVA 2KTRB 1WGUA 5LOPB 2J59M 4C0AA 3TEXA 4A90A 5CLQB 2K6DB 2Y8FA 4ICUA 3RULA 3A8QA 2LEKA 2WX0A 2ZCBA 5FR3A 2IGHA 2KLGA 2DHKA 4ZRKA 1Q0WB 4OZCA 4A6HA 2MW5A 5C79A 4BAXA 3WAMA 1PMSA 2ADZA 2KUPA 2WXOA 1NEKB 1P0RA 3P42A 2NVUI 1IP9A 2CU1A 4M8MA 2YEPF 1YJIA 2B3AA 1FGZA 1TQZA 1SGHA 2DHIA 1UD7A 4K1RB 3CWIA 2J53A 4URKA 3EECA 3TEYA 3MJWA 2M38A 2AQ1B 2ZVOA 3N1ZC 3ETRA 1M7RA 4FJZA 4WAAA 1T0QC 3BIID 2ZKMX 2EC1A 4IDIA 4ZRJA 3HUIA 4EJNA 1TY2A 3A98B 3BINA 2BB5A 4E74A 3GE8C 2FAZA 1AQCA 2L7RA 4KDLB 2Z0EB 2X8XX 3ULBA 3GE3C 1IPGA 3FILB 3QIJA 4I6PA 3A8PA 2BGFA 3AE8B 1TBEA 1L6VA 1ZXHA 2CQUA 3AE1B 4GMVA 4K2OA 3CSFA 4K3CA 4KGTA 3DVNV 3QQ8B 1LM8B 4HJKA 4EE2A 2YT2A 2QC8A 2KNBA 4D0NB 1WJ4A 2I5FA 1H8CA 4F8CB 1P6SA 3SUZA 4GDLA 4G0NB 4FJYA 1U2BA 2INCC 5BMIA 2BW2A 2KTFA 2L52A 2D3CA 3UIPB 4BVUC 3KSYA 2FUG1 3L17A 3E66A 3B1LX 1MJDA 1MI0A 2N7JA 4F7GA 3SHQA 2K8CA 2D4QA 3PZDA 2O6VA 3H1UA 1XODA 3EUB2 1A5RA 3AE9B 5DHFB 2LVOA 2ZNVB 1P7FA 1PUTA 2JWZA 2JRHA 3A9JB 1WZ0A 1PGXA 1NTIA 2WNMA 3D8DA 1TGZB 4CO7A 5J18A 1PQSA 4M00A 1T5XD 2N0YA 3PSCA 1WGRA 3BYTB 2ON8A 4C4VB 2DZIA 2A5UA 4RNAA 2E3TA 4LDTD 1FMAD 4KHAA 1FRDA 3PLVA 3DVNU 2C5LC 1SSNA 1WSPA 2CS4A 1V5UA 2JZZA 1FCCC 2KDIA 1C78A 2PE6B 3NS8A 2KJ6A 3H9DA 2HRJA 2E2XA 3PTFC 2GBKA 4ICVA 1BUIC 2G4DB 4FN2A 4KVGB 4Z2MB 4F7HA 4KAXB 2KFKA 2DNFA 4J6IA 2LKOA 2LZ6A 4BZAA 2MP2B 1XEEA 3N3KB 3DBHI 1Z87A 1SIJA 3L0WB 3N9YC 4XGAB 4GGQA 1EF1A 5D3VA 4WJ7A 5HE2A 1P1AA 3ML4A 1GUAB 2KVZA 1OY2A 4LK0M 2V3NA 4LNOA 1OQYA 2MSED 2V0GA 1EO6A 5I2SA 3CIKA 2DX5B 1QOFA 2V3SA 3W1YA 4W9DA 1EUVB 3SBGA 4HDOA 4ASWC 3SFDB 3AXCA 1FO4A 2JY6A 3A4RA 1H4RA 3ZIMA 3AECB 2DZJA 2LASA 3V62A 1I7AA 1SJHD 2KC1A 3IT4B 3NZ3A 2NS5A 5LG4B 2K22A 2AYOB 4WIPA 2FJ9A 1OQNA 2PLPA 1XD4A 3TMPB 1QQGA 1WRIA 2L83A 4ANXA 3F5RA 2V4LA 3UQBA 3W1SC 1MHHE 3OWEB 1HZ5A 4DHJB 2KDBA 3FSSA 2JP2A 1ET9A 1HBKA 2PEAA 1FFVA 1D5XC 5EE0A 3TUOA 1V80A 3DBLI 1YNTE 5T8IA 2DA0A 3QCAA 2BBCA 3Q3MC 4LCDE 3DXCA 1XQQA 2J52A 2JPHA 3OJ3A 3PT2B 2KIEA 1QOGA 1DBHA 2Q5WD 2GS0A 2KDFB 3DWGC 1IRSA 3PGEA 2KCJA 2X0SA 1T6BX 5LLIA 1JWUD 4FLHA 2LVQA 5JHAA 2GCLA 1WR1A 1NU2A 4B9KA 4WJOA 1Q10A 1VZ8A 2PJHA 1WXSA 3VH3B 1TKYA 4WQMA 3VH4B 4ZHPA 3QARA 1WGHA 3NVYA 1C4CA 4MJSA 1N60A 4NJ6A 1UPQA 2KWDA 3MP9A 4FXCA 1ZGUB 4BOZB 4DDID 5DIFB 3WA0A 2KVRA 2LRWA 3PVLA 3FILA 2ACZB 3L08A 3AJ4A 4EOYA 2Q13A 5JHHA 1DGJA 2KANA 2WXPA 3BZDB 3DOWA 5KHQA 3ZXRA 2CKHB 3DQVA 3V3XA 1I7HA 2WXNA 4WURA 2IGDA 3EA6A 1MPEA 1I4XA 4A9AA 4TMAB 1GJZA 1KLGD 5J2RA 4TV3A 2WXMA 2EKEC 4KGSA 2E6XA 2MA9B 3JVZX 2R2OA 4DQOC 3DXEA 3TFMA 1P3QU 2PVGC 1C77A 1OMWA 1FRRA 2VH1A 3VAWA 4FA6A 4OSNA 2LULA 5KCVA 1YX5B 5EE9A 4GZUA 3RN9C 3RNCC 2KDEB 3EFCA 1D4BA 1UF0A 2RR9A 3OANA 5I2MA 3JSVB 1X05A 2WU5B 1ESFA 1YJJA 4LNKA 1XLOA 2G4SA 2NBUA 3L4PA 4G11A 2L1AA 4K81A 2PVOD 3V60A 3HW2B 3R66C 2X38A 4C7YA 1GC7A 3D8FA 2IZVB 1RFKA 1ZYIA 3ZW3A 3DHIC 2CHZA 1CK1A 3TJPA 4GDKB 3PPAA 1BTKA 2AX5A 3DWMA 2FCSA 2J7QB 3KWVA 5AUIA 4LJPB 3B2GA 1YN3A 4TUUA 4B6WA 2DN6A 4XWWA 3T3NA 5GOWB 3QAQA 4YWGG 1LO5D 3O96A 1E8XA 1TKGA 1NYRA 3AE7B 1UBIA 2OOBB 5E6OA 2DAJA 3X23A 1R4NI 4HKZE 3RD2A 1U5FA 1MPHA 5AZFA 2XNAC 2M17A 4HAUB 2P0HA 2RRFA 1ACCA 3UQAA 1WI0A 3M62B 4LTUA 4W9CA 1AW7A 4ANWA 1IYFA 1XT9B 1VZ6A 3U7ZA 2ZVNA 3QK0A 4GU2A 4IUMB 1ET6A 3J9CA 4WWOA 1YMHE 2KGXB 1GG3A 4YL8A 3A4SC 2SAKA 1GB1A 3KW5B 5C23A 3LDZE 4JKAA 4D6WA 4OVZA 1L4DB 2UWQA 2ABDA 4NAWA 5C5BB 2Y3AA 4MSQB 4RGMA 2ZW1A 4W9IA 4C80A 3L13A 1CQVA 3WAPA 2DENB 4BKSA 3Q8CA 2J42A 4LNNA 1V97A 4W9KA 3ENEA 2RGNB 1KZ7A 4CHKA 2BWFA 1FHOA 1ZM0A 1AARA 4F7ZA 4BKGA 4WJPA 1BMLC 2FUHB 4RGOS 3DHGC 1XKEA 5JHGA 2YEPB 3B77A 2Z0OA 4YSXB 3P63A 3QC8B 2MHJA 1I2HA 4B0MA 1D5ZC 2VZKB 1V88A 3KYDD 3PRMB 4OZAA 3NS1A 1NBFC 3ZRCA 2MX2A 3EC8A 4MELA 2I38A 3M63B 3BVGA 1KJTA 1CJEA 4Y94A 3ZNHB 4C4VA 1GGOA 1EWYC 3GYOA 2H88B 4HLEA 1P9DU 2CY5A 1HB8A 1T77A 3PZ8A 2W2WA 5FI1A 3RNBC 2QSDA 2MJEA 2D2QA 1PLSA 4BKTA 2NBVA 1XCTL 3MC8A 4OT1A 3TEZA 1WI1A 4WWNA 2Y7BA 2LXAA 1EF5A 2LUMA 1PDXA 2LHDA 2DKQA 4PYUA 3DBRI 2ZNVC 5D3DA 3ZJUA 1TS5A 2CB8A 2NPTA 3A1QB 2I2YA 3R2IA 3LJ3A 3Q3OC 3AU5A 3ZTCA 4EZKA 2WGSA 3RZWC 5MPOA 4HDQA 3NY5A 4JQWC 4GN1A 1DDVA 2DLBA 4JKDA 4A6FB 4EEWA 3KUCB 2K39A 5IN7A 1WMHB 3DBSA 3URYA 1FHWA 4IFSA 3W5VB 4CHMA 4KHOA 1Y56A 2KWVB 2DZKA 3AE5B 3TIXA 5EE1A 4RF1A 1L6UA 1BTNA 2K1FA 5JXVA 3RZFA 3WCQA 1IGDA 2CY4A 4II3B 2LGSA 3ZQ4A 4A3PA 3P4RB 4OW0A 3KYCD 3NOBA 2KMCA 2XBBC 4GLSC 1WH3A 2INNE 1WM3A 5IAAC 1J7CA 1X11A 4NQKE 2N9LA 3Q8FA 3I5JC 2FIFA 2WXLA 2ELAA 2VZKD 4JPSA 4HPLB 2W82A 4BBNC 1I4HA 1B55A 1F77A 2KLCA 3R7QA 2KOXA 1T0SC 3QWZB 4HEA1 4AJYB 3NVVA 2K2UA 1RWSA 2JSVX 2O6VB 3V05A 2IYDB 4W9EA 3VHTC 2W3SA 3T8MA 1D5MC 1WIAA 4S17A 2RDHA 3FC4A 4DHZB 1F52A 4P1CC 4WWMA 1WXQA 5DPWA 1UEFA
chains in the Genus database with same CATH topology
2N1VA 3BY4B 4GIVA 1WY8A 1L7YA 2WYQA 1EAZA 1TTNA 4MGKE 5CHWA 2A4ZA 1FB8A 4M8NA 2PE9A 2N9XA 4W9GA 1ZW7A 2IO1B 5E6PA 1P5TA 3F0WA 2D9YA 4WWPA 3ODOA 2CR5A 1Z2MA 2JXXA 4DDGD 3N32A 1FGYA 1Y8RC 3CSTA 5FR6A 1YX6B 1ISNA 3PEGA 2MFQA 3MDBC 2H7DA 2LJ5A 1WJMA 1R4MI 2DYBA 5J17A 4F1SA 4EMOA 4DBGA 1BT0A 2J0KA 2M4NA 1W1GA 4RM8A 3OLMD 1MKEA 3K9PB 1T0YA 2UZRA 3D8EA 2KWUB 1YD8U 2FCQA 2D07B 2IY1B 4G3XB 2Y8GA 2KQ7A 1E7UA 5JH5C 1XCGA 4IG7B 3TL5A 3VQIA 4L6EA 3PP2A 3P7ZA 4JK8A 4KDIC 4JKBA 3U7DA 4W9JA 2NCNA 2L0FA 3NZSA 4F7UP 3D32A 2V76A 2KN5A 1ZSQA 4CYEA 2N9PC 3ZDMC 4TQ0A 3NHEB 3V6CB 3WANA 4DXAB 5D27A 5JVLA 2LI5A 4IC7B 4JK9A 2DFKA 3RT3B 1WR6E 4MK0A 2BYFA 2R2QA 2MWSB 2JZ3B 3N7CA 1BAKA 2MCNB 2ROVA 1GC6A 1MK7B 4JKCA 3SYXA 4KSLC 4ANVA 3TO1A 4RMAA 2LD9A 2KKCA 3C0RB 1V5OA 3Q3JA 4ZRIA 1J0GA 4BBNF 5AEKB 2RQ1A 2LGYA 5C5BA 5DHAB 5IA7A 5DI9B 1ACAA 3ZRFA 4WJQA 2MBOA 1ZC4B 4A3OA 4HATB 2G35A 2C7NB 1X1FA 3TVVA 5J3QA 1U4AA 1FXTB 2RD0A 2D3GA 1E8ZA 1BWNA 4KHBB 2ZPNA 1U27A 3ZNZB 3EPYA 2J0JA 2BCJA 2C60A 4K7UA 2N7EA 2EMSA 3FEHA 2FCMA 3KRXA 2D9XA 1E90A 3P6AA 2JRIB 2IYBA 4NSWA 4NJ7A 2MLBA 4MGIE 5CX3A 1J0WA 4FBJB 1RRPB 2C7MB 4IM3A 5D6JB 2YF0A 4W9HA 3VXWA 4ZDVA 3T06A 3VTWA 3MPXA 4GDKA 1Y19B 3K9OB 2MBEA 3ZVVA 4MH0E 4EZJA 5C1ZA 1EVHA 3AU4A 4WSFA 1ZC3B 3QBVB 5DPSA 4AUQC 2IO0B 3VTUA 3V61A 2DYMA 4IW0A 4FHKA 2CODA 3R3MA 1WXMA 1DIKA 4HCPB 1TJ6A 2M1MA 4MSMB 3IG3A 5AZHA 1UNPA 1W1DA 1MG8A 1SIFA 2AL3A 1U5GA 3ZTDA 2IO2B 2YS3A 3APDA 3IHPC 3L54A 4FJVB 1TZ1A 2Z0QA 2N1WA 2RGFA 4OVVA 5DCNA 3KZ1A 3ODWA 5KQ1A 3KH0A 3PVUA 3WAOA 4HAZB 5L83A 2GBRA 1P3RA 2WH5A 3IFWB 1VBGA 2YS1A 4IM2A 3HIZA 3U30A 3PRZA 3GYPA 1JDEA 5JZEB 1V2YA 3P2BA 3A9KA 2DHZA 2KXJA 4TKNA 4KIKB 3OAWA 1LW3A 1KZGA 1ST7A 1DDMA 2QKLA 2DYOA 5LXIB 4AOFA 1UELA 4K17A 1S3SG 1V81A 3A9JA 3ZDTA 5LXHA 3ONSA 2W2XD 2YLMA 4H8SA 1OGWA 3KUZA 5JLJB 5KHOA 2M14A 3ML9A 2N4FA 1CMXB 2LBBA 3WIMA 1XD3B 4PS3A 3HHMA 1TXDA 2NPTB 3PSEB 1HB6A 1V5TA 1UH6A 4GPTB 2D10A 3B0AA 4GMXB 1K5DB 4A6FA 1MK9B 2OTXA 4OVUA 1NI2A 2RPQA 5EDSA 1Q1OA 1WF9A 3HM3A 2DZMA 4PQ0A 1WGQA 4NQLB 1U5DA 1WE7A 1WX7A 2K00A 2NMBA 2X18A 4BFRA 1M94A 2YT0A 3L10B 3FLVA 2K6QA 4JKFA 2HJ8A 1D3ZA 4AP4C 5HE1A 1ZVRA 2FNJB 2YRYA 2FJLA 5IJMA 2FIDA 3M1IB 2KQSA 2KC2A 1YJ1A 1Z5SB 3APCA 4E71A 1LXDA 5D94A 3CF6E 5KQ4A 3O65B 3QA8A 1NDDA 2KJRA 1XX0A 1U5EA 3DVGX 2LOXA 4TYZA 1ZKHA 3GZNI 4LJOB 4HCNB 2YS5A 1WFYA 3H6NA 3A33B 3DVGY 4JLCA 3CXBB 3U8ZA 2DYQA 2R0DA 2KFJA 2ROZB 3B08A 1RFAA 1RAXA 4JGHB 1V9JA 3DDCB 3H7PB 1Q5WB 5LONB 1WX8A 1OEYA 2IO3B 2CHXA 4GDLB 2Y5BB 2XK5A 4I6LB 4AWJA 2IBIB 4EUTA 2I1KA 3PLUA 5CHVC 3VUWA 4JKGA 3QWMA 4M0WB 4EZLA 1VD2A 3H7SA 4CHJA 4BOSC 2H7EA 4HB4B 1E7VA 2OQBA 1J19A 4BKSD 1KBLA 4K2PA 3V5WA 2JF5A 1E5WA 1DYNA 4IM0A 3Q3FA 4KV2A 2VRWB 2WDTB 1VCBA 1KLVA 1MAIA 1VBHA 4WJNA 5J3TA 1JRUA 2DIKA 1KC7A 1AWEA 1SHCA 1FHXA 2NZ8B 1WJNA 3JSVA 1DDWA 2BKFA 2ZEQA 2W2XC 1UZXB 4NPNA 1I35A 2AWTA 3EFUA 4HVBA 2RVBB 1NVLA 3W1SA 1YIWA 2K8HA 2MWNB 4GOCA 1FAOA 2BPSA 3ECIA 2RLOA 2COCA 2Z59B 3VOQA 2KFKB 1C3TA 2MP2A 2ZPYA 2BYEA 2MBHA 3PRPB 2L8JA 1UBQA 5DPWA 4B95A 2UVMA 1WG7A 2MRPA 4KSKC 2JT4B 4ILJA 1WJ6A 4DK5A 2D11A 3N30A 4PS8A 4HAWB 3ENBA 4HB0B 3UGBB 2AL6A 2CRFA 5BO4B 3LJUX 4K7WA 3GOEA 2GCJA 1H10A 2KHWB 2Z0PA 2GBJA 1WJUA 2MDXA 1OTRB 2O6VD 3KVFB 5JP4A 1UPRA 3ALBA 5CTRC 3TCAA 1K5GB 1KOTA 2LGDA 3JW0X 2DTCA 4G50A 3VFKA 1KI1B 1P98A 2LVPA 4MGYE 4KZCA 4JL9A 2K25A 2ZCCA 2I1JA 2KX3A 2D9VA 3UIOB 4HB3B 5DPTA 2LYDA 3G9WA 3NSUA 4DX90 2NBVB 4ILHA 2I5CA 2LUEA 3RYTA 5J3YA 4MJSB 3QX1A 2HTHB 5L81A 1HE8A 4ZYNA 4JIOU 1I42A 2K8BA 4MGZE 4YONA 1V49A 2DKPA 3A1QA 2UYZB 3VTVA 4HXDA 2PZ1A 2XEWA 3CMMB 2VRRB 4W9FA 4I6NB 4FHJA 4XC2A 2LG1A 5CLLB 4JKHA 4AJWA 2YSZA 4GSWA 4A6KA 2YT1A 2COPA 3T9LA 5D3YA 3MTNB 2FCNA 3SBTA 5DPRA 4HAXB 3SO6A 2OJRA 3M95A 1WVHA 5EFXA 4IWOA 2J0MA 4DHJD 5AZGA 3QJZA 2L0TA 3VIAA 3DCGA 2RNRB 2MBQA 4N9F4 2EMTA 5DH9B 4JK7A 2L1CA 3A9KB 4PNKA 4KIKA 2AEHA 4HB2B 5JHBA 4DBBA 3VUXA 3APFA 4MT7A 3UINB 4GB9A 4WVFB 3ZNID 3DXDA 5C6RA 3V6EB 4X57B 2KZRA 3L16A 3ZNGC 2DHJA 3IBEA 4TQ1A 3M3JA 4ILGB 1PFJA 3X0WA 1WGYA 1QZEA 2Z0DB 1UGMA 4XX5A 2DX5A 4HHVA 4NAWB 2LRUA 1LB1A 2JVCA 1WGGA 1RJ2A 1MIZB 2IY0B 3PS6A 2XQNM 3JYUA 2KK8A 1S1QB 2L00B 3WALA 2ZZPB 1X1MA 1NTYA 2BF8B 4DWFA 5HKHA 1LQBA 1X1GA 3HK0A 4FULA 4NY0A 4LDTB 4K7SA 3IVFA 1F9JA 1V6EA 1V5MA 2VSZA 4WQOB 2HD5B 3ZKJC 3PV1A 1EGXA 5G55A 2RSUA 3S2AA 2DX1A 2N23A 2EJ8A 5TR5A 2DLWA 3PREA 3AULA 2M8SA 1E8WA 5E6NA 2IFSA 4Z2NA 3ZUNA 4PYZA 2HE7A 2RUKB 1YQBA 2O2VA 4MM3A 4IWPA 2KWCA 2QHOA 2LOZA 3E9LA 3BJIA 1E8YA 1WMHA 3KY9A 2KMAA 2V1YA 5HE0A 3ZO5B 3QHTA 3RCPA 2HTHA 2PPHA 1WJ1A 2D9WA 4II2B 5CHFA 1N3HA 4HPMB 2C9WB 1WXVA 1W1HA 3H7PA 3UF8A 2QKMA 3R7RA 2MQJA 4HAYB 3E9OA 2GBMA 2MBBB 2KTRA 1RLFA 2BYVE 2D9ZA 4A20A 2REXA 1Y5OA 3ODXA 2NBWB 1DROA 5D3WA 1GNUA 1V86A 2CAYA 2L76A 1V5PA 1V89A 2G3QB 1QC6A 4EFOA 2L2IA 1FOEA 4DX8A 3I3TB 3VUYA 3HQCA 1KM7A 1RRBA 2BWES 2L3ZA 2WWZA 3PVWA 3NZUA 4RM9A 4W9LA 3ZVRA 1SE9A 2O2VB 3ZLZA 2DYNA 1WE6A 5D2MB 3ML8A 4EKUA 3VDZA 2P0FA 1WXAA 3WYFB 3UZTA 5HE3A 2N9EB 1Q67A 4A5KA 3VVWB 3PHWB 2ZJDA 2DAFA 3KRWA 3EHVA 1XR0B 4HWIB 2VKIA 2ELBA 2JUOA 1G6JA 2K2JA 2LWPA 3OJ4B 3HM6X 1C1YB 5FI0A 4JKEA 2KX0A 1WRDB 1WX9A 1MIXA 2CHWA 2KO3A 4IAPA 2P0DA 1V61A 1WGDA 2KD0A 2R09A 2LXCA 2WX1A 1L2NA 2MKRA 3AI5A 2GBNA 4MY6A 4XZ4A 3TW1A 4IOYX 2GOWA 3FP5A 5L95C 4KZ0A 4MEMA 2YVCA 1WZ3A 3PHXB 3TBLD 3RCZA 2C7HA 2ASQA 4PS7A 3MHSD 2P8VA 3SU8X 2LGXA 2COAA 5G2NA 1K8RB 1U29A 4E3CA 4B6HA 1WYWB 4IWQA 2M0XA 2W9NA 4GXBA 3ULCA 5C16A 2COFA 3E9PA 1X86A 2XK5B 3SDLC 3PG7A 4HK2A 3SNHA 2G45B 1M7EA 4JKGB 2KJHB 2UZSA 4NNJB 3KUDB 3SV1A 3RUIB 1OEYJ 3FM8C 2R82A 2N7DA 4BBKA 4MDKE 2L05A 3SD5A 1WM2A 5D3XA 4FADA 1UNRA 4P7IA 2GMIC 2GJYA 1LFDA 4XWXA 3DPDA 2RSGA 4DHZE 5GMVA 1UNQA 5D7GA 2NR2A 2BKRB 2FDQA 4HAVB 1NTVA 2KTRB 1WGUA 5LOPB 2J59M 4C0AA 5CLQB 2K6DB 2Y8FA 4ICUA 3RULA 3A8QA 2WX0A 2ZCBA 2KLGA 2DHKA 4ZRKA 1Q0WB 4A6HA 2MW5A 5C79A 3WAMA 1PMSA 2ADZA 2KUPA 1P0RA 2NVUI 1IP9A 2CU1A 4M8MA 2B3AA 1FGZA 1TQZA 1SGHA 2DHIA 1UD7A 4K1RB 4URKA 3EECA 3MJWA 2M38A 2ZVOA 1M7RA 4FJZA 4WAAA 2EC1A 4ZRJA 4EJNA 3A98B 3BINA 4E74A 2FAZA 1AQCA 2L7RA 4KDLB 2Z0EB 3ULBA 1IPGA 3QIJA 4I6PA 3A8PA 2BGFA 1TBEA 2CQUA 4GMVA 4K2OA 3CSFA 3DVNV 3QQ8B 1LM8B 4HJKA 2KNBA 4D0NB 1WJ4A 2I5FA 1H8CA 4F8CB 1P6SA 3SUZA 4GDLA 4G0NB 4FJYA 1U2BA 2KTFA 3UIPB 4BVUC 3KSYA 3L17A 3E66A 3B1LX 4F7GA 3SHQA 2K8CA 2D4QA 3PZDA 2O6VA 3H1UA 1XODA 1A5RA 5DHFB 2LVOA 2ZNVB 2JWZA 2JRHA 3A9JB 1WZ0A 1NTIA 3D8DA 1TGZB 4CO7A 5J18A 1PQSA 2N0YA 3PSCA 1WGRA 2DZIA 2A5UA 4LDTD 4KHAA 3PLVA 3DVNU 2C5LC 2CS4A 1V5UA 2JZZA 2KDIA 2PE6B 3NS8A 2KJ6A 3H9DA 2HRJA 2E2XA 3PTFC 2GBKA 4ICVA 4FN2A 2G4DB 4KVGB 4Z2MB 4F7HA 4KAXB 2KFKA 4J6IA 2LKOA 2LZ6A 2MP2B 3N3KB 3DBHI 1Z87A 3L0WB 4GGQA 1EF1A 5D3VA 4WJ7A 5HE2A 1P1AA 3ML4A 1GUAB 1OY2A 1OQYA 2MSED 1EO6A 3CIKA 2DX5B 2V3SA 3W1YA 4W9DA 1EUVB 3SBGA 4HDOA 4ASWC 3AXCA 2JY6A 3A4RA 1H4RA 3ZIMA 2DZJA 2LASA 3V62A 1I7AA 2KC1A 2NS5A 2AYOB 2FJ9A 1OQNA 1XD4A 3TMPB 1QQGA 4ANXA 3F5RA 2V4LA 3UQBA 3W1SC 4DHJB 2KDBA 3FSSA 2JP2A 1HBKA 2PEAA 1V80A 3DBLI 2DA0A 3QCAA 4LCDE 3DXCA 1XQQA 2JPHA 3OJ3A 3PT2B 1DBHA 2GS0A 2KDFB 1IRSA 3PGEA 2KCJA 2X0SA 5LLIA 4FLHA 2LVQA 5JHAA 2GCLA 1WR1A 1NU2A 4B9KA 4WJOA 2PJHA 1WXSA 3VH3B 3VH4B 3QARA 1WGHA 4MJSA 4NJ6A 1UPQA 1ZGUB 4BOZB 4DDID 5DIFB 3WA0A 2KVRA 2LRWA 3PVLA 3L08A 3AJ4A 4EOYA 2Q13A 5JHHA 2KANA 3DOWA 5KHQA 2CKHB 3DQVA 1GJZA 5J2RA 4TV3A 2EKEC 2MA9B 3JVZX 2R2OA 3DXEA 3TFMA 1P3QU 1OMWA 4FA6A 3VAWA 2LULA 5KCVA 1YX5B 4GZUA 2KDEB 2RR9A 3OANA 3JSVB 1X05A 2G4SA 2NBUA 4G11A 4K81A 3V60A 3HW2B 3R66C 1GC7A 3D8FA 2IZVB 3ZW3A 2CHZA 3TJPA 4GDKB 3PPAA 1BTKA 2FCSA 2J7QB 4LJPB 4TUUA 4B6WA 2DN6A 5GOWB 3QAQA 3O96A 1E8XA 1UBIA 2OOBB 5E6OA 2DAJA 3X23A 1R4NI 3RD2A 1U5FA 1MPHA 5AZFA 2M17A 4HAUB 2P0HA 3UQAA 1WI0A 3M62B 4W9CA 4ANWA 1IYFA 1XT9B 2ZVNA 3QK0A 4GU2A 4IUMB 4WWOA 2KGXB 1GG3A 4YL8A 3A4SC 3KW5B 5C23A 3LDZE 4JKAA 2UWQA 2ABDA 4NAWA 5C5BB 4MSQB 4W9IA 3L13A 3WAPA 2DENB 4BKSA 4W9KA 3ENEA 2RGNB 1KZ7A 4CHKA 2BWFA 1FHOA 1ZM0A 1AARA 4F7ZA 4BKGA 4WJPA 2FUHB 1XKEA 5JHGA 2Z0OA 3QC8B 1I2HA 1V88A 3KYDD 3PRMB 1NBFC 3ZRCA 2MX2A 3EC8A 4MELA 3M63B 1KJTA 4Y94A 3ZNHB 1GGOA 3GYOA 4HLEA 1P9DU 2CY5A 1HB8A 2W2WA 5FI1A 2D2QA 1PLSA 4BKTA 1WI1A 4WWNA 2Y7BA 2LXAA 1EF5A 2DKQA 4PYUA 3DBRI 2ZNVC 2CB8A 2NPTA 3A1QB 3LJ3A 3AU5A 3ZTCA 4EZKA 3RZWC 4JQWC 4HDQA 3NY5A 4GN1A 1DDVA 4EEWA 4JKDA 4A6FB 3KUCB 2K39A 1WMHB 3DBSA 1FHWA 4IFSA 4CHMA 4KHOA 2KWVB 2DZKA 3TIXA 1BTNA 2K1FA 3RZFA 2CY4A 4II3B 4A3PA 3KYCD 3NOBA 2KMCA 2XBBC 1WH3A 1WM3A 5IAAC 1X11A 4NQKE 2FIFA 2ELAA 4HPLB 4BBNC 1B55A 2KLCA 3R7QA 2KOXA 3QWZB 4AJYB 2K2UA 2O6VB 2IYDB 4W9EA 3VHTC 3T8MA 1WIAA 4DHZB 4ANUA 1J8CA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTI A;  2M8S A;  2N1V A;  1E8W A;  3BY4 B;  3DVG X;  4GIV A;  3D8D A;  5E6N A;  2LOX A;  2IFS A;  1WY8 A;  4TYZ A;  1TGZ B;  4CO7 A;  1L7Y A;  1PQS A;  5J18 A;  4Z2N A;  1ZKH A;  2WYQ A;  1EAZ A;  1TTN A;  3GZN I;  4MGK E;  5CHW A;  2N0Y A;  2A4Z A;  3PSC A;  1FB8 A;  1WGR A;  4M8N A;  2PE9 A;  4LJO B;  2N9X A;  2DZI A;  2YS5 A;  4HCN B;  4W9G A;  1ZW7 A;  1WFY A;  2A5U A;  3H6N A;  3A33 B;  3DVG Y;  2IO1 B;  5E6P A;  4LDT D;  3ZUN A;  4PYZ A;  4JLC A;  1P5T A;  2HE7 A;  2RUK B;  4KHA A;  3F0W A;  1YQB A;  2O2V A;  4MM3 A;  4IWP A;  2KWC A;  2QHO A;  2D9Y A;  3PLV A;  3CXB B;  4WWP A;  3DVN U;  3ODO A;  2C5L C;  2CR5 A;  1Z2M A;  3U8Z A;  2DYQ A;  2R0D A;  2CS4 A;  2JXX A;  1V5U A;  2LOZ A;  2JZZ A;  4DDG D;  3N32 A;  3WAO A;  3BJI A;  2KFJ A;  2ROZ B;  1E8Y A;  2KDI A;  1WMH A;  2PE6 B;  1FGY A;  3B08 A;  1RFA A;  3KY9 A;  3NS8 A;  1RAX A;  1Y8R C;  2KJ6 A;  2KMA A;  2V1Y A;  5HE0 A;  3CST A;  3H9D A;  4JGH B;  5FR6 A;  2HRJ A;  2E2X A;  1YX6 B;  3PTF C;  3ZO5 B;  1ISN A;  3PEG A;  2MFQ A;  2GBK A;  4ICV A;  3MDB C;  1V9J A;  2H7D A;  2LJ5 A;  4FN2 A;  1WJM A;  2G4D B;  3DDC B;  3RCP A;  3QHT A;  4KVG B;  4Z2M B;  3H7P B;  2HTH A;  4F7H A;  1Q5W B;  2PPH A;  1WJ1 A;  1R4M I;  5LON B;  4KAX B;  1WX8 A;  2DYB A;  2KFK A;  4J6I A;  5J17 A;  2D9W A;  2LKO A;  1OEY A;  2IO3 B;  2LZ6 A;  3ZNG C;  4F1S A;  4II2 B;  2CHX A;  2MP2 B;  5CHF A;  4GDL B;  1N3H A;  4EMO A;  2Y5B B;  3N3K B;  3DBH I;  1Z87 A;  3L0W B;  4HPM B;  4DBG A;  2C9W B;  1WXV A;  1EF1 A;  1BT0 A;  4GGQ A;  1W1H A;  5D3V A;  2J0K A;  4WJ7 A;  5HE2 A;  2XK5 A;  3H7P A;  1P1A A;  4I6L B;  2IBI B;  2M4N A;  3UF8 A;  4EUT A;  2I1K A;  2QKM A;  3ML4 A;  1GUA B;  3PLU A;  1W1G A;  5CHV C;  4EZJ A;  1OY2 A;  4RM8 A;  3VUW A;  3R7R A;  3QWM A;  1OQY A;  4M0W B;  4EZL A;  2MSE D;  1VD2 A;  2MQJ A;  1EO6 A;  4HAY B;  3H7S A;  3CIK A;  3OLM D;  4CHJ A;  2DX5 B;  4BOS C;  2H7E A;  4HB4 B;  2GBM A;  1MKE A;  2V3S A;  1E7V A;  3K9P B;  4W9D A;  2OQB A;  1EUV B;  3W1Y A;  1T0Y A;  4HDO A;  4ASW C;  1J19 A;  2UZR A;  2MBB B;  2KTR A;  4BKS D;  3D8E A;  3AXC A;  1RLF A;  2BYV E;  3ZLZ A;  2KWU B;  2JY6 A;  3A4R A;  4K2P A;  3V5W A;  1H4R A;  2D9Z A;  3ZIM A;  4A20 A;  2DZJ A;  1YD8 U;  1Y5O A;  2D07 B;  1E5W A;  2FCQ A;  2IY1 B;  3ODX A;  2JF5 A;  2Y8G A;  1DYN A;  2LAS A;  3V62 A;  4IM0 A;  2NBW B;  1I7A A;  1DRO A;  2KQ7 A;  1E7U A;  2KC1 A;  5JH5 C;  1XCG A;  3Q3F A;  4IG7 B;  5D3W A;  2NS5 A;  4KV2 A;  2VRW B;  3TL5 A;  2WDT B;  1GNU A;  1VCB A;  4N9F 4;  1V86 A;  2CAY A;  2AYO B;  2L76 A;  3VQI A;  2FJ9 A;  4L6E A;  1OQN A;  1XD4 A;  1V5P A;  1V89 A;  3PP2 A;  2G3Q B;  3TMP B;  3P7Z A;  1MAI A;  4WJN A;  1KLV A;  4KDI C;  1QQG A;  3U7D A;  5J3T A;  4ANX A;  1JRU A;  3F5R A;  2V4L A;  3UQB A;  1QC6 A;  1AWE A;  1SHC A;  3W1S C;  4EFO A;  4W9J A;  1FHX A;  2L2I A;  2NCN A;  2NZ8 B;  4DHJ B;  2KDB A;  1FOE A;  2L0F A;  3FSS A;  3NZS A;  4DX8 A;  4F7U P;  2JP2 A;  1WJN A;  3D32 A;  1J8C A;  3I3T B;  3VUY A;  2V76 A;  3HQC A;  2KN5 A;  1KM7 A;  3JSV A;  1HBK A;  1RRB A;  2BWE S;  2L3Z A;  1DDW A;  2PEA A;  2WWZ A;  1V80 A;  3PVW A;  3DBL I;  3NZU A;  4RM9 A;  4W9L A;  2DA0 A;  3ZVR A;  1SE9 A;  2BKF A;  1ZSQ A;  2W2X C;  1UZX B;  2O2V B;  4CYE A;  2ZEQ A;  2N9P C;  3QCA A;  2DYN A;  1WE6 A;  4NPN A;  5D2M B;  3ML8 A;  4LCD E;  3DXC A;  1XQQ A;  3NHE B;  3ZDM C;  4TQ0 A;  1I35 A;  2JPH A;  3OJ3 A;  3V6C B;  3WAN A;  3PT2 B;  2AWT A;  3EFU A;  4DXA B;  4EKU A;  3VDZ A;  4HVB A;  5D27 A;  2P0F A;  2RVB B;  1NVL A;  1WXA A;  1DBH A;  3WYF B;  3UZT A;  2GS0 A;  2LI5 A;  2KDF B;  5HE3 A;  2N9E B;  4IC7 B;  1IRS A;  3PGE A;  1Q67 A;  2DFK A;  2KCJ A;  4A5K A;  3RT3 B;  3VVW B;  3W1S A;  1WR6 E;  3PHW B;  1YIW A;  5LLI A;  3AUL A;  2K8H A;  2LVQ A;  4MK0 A;  2DAF A;  2ZJD A;  2MWN B;  2BYF A;  2GCL A;  4FLH A;  1WR1 A;  1NU2 A;  1FAO A;  4GOC A;  2BPS A;  3KRW A;  2R2Q A;  3EHV A;  4B9K A;  2MWS B;  2JZ3 B;  3ECI A;  2RLO A;  3N7C A;  1BAK A;  4WJO A;  2MCN B;  2COC A;  2ROV A;  2Z59 B;  2PJH A;  3VOQ A;  2KFK B;  1WXS A;  1GC6 A;  1MK7 B;  1C3T A;  3SYX A;  3VH3 B;  3VH4 B;  4KSL C;  3QAR A;  2MP2 A;  1XR0 B;  2ZPY A;  4HWI B;  1WGH A;  2VKI A;  2ELB A;  4ANV A;  4MGZ E;  2JUO A;  4MJS A;  3TO1 A;  4NJ6 A;  2BYE A;  1UPQ A;  4RMA A;  2MBH A;  1ZGU B;  4BOZ B;  2LD9 A;  2K2J A;  4DDI D;  1G6J A;  5DIF B;  2KKC A;  3PRP B;  3WA0 A;  2KVR A;  2LWP A;  3C0R B;  2LRW A;  3PVL A;  3L08 A;  3AJ4 A;  4EOY A;  2Q13 A;  5JHH A;  3OJ4 B;  1V5O A;  2L8J A;  1UBQ A;  2KAN A;  3HM6 X;  1C1Y B;  5FI0 A;  3DOW A;  5KHQ A;  4B95 A;  3Q3J A;  4ZRI A;  1WG7 A;  2UVM A;  2CKH B;  2MRP A;  1J0G A;  4BBN F;  5AEK B;  3DQV A;  4KSK C;  2RQ1 A;  2JT4 B;  2LGY A;  5C5B A;  2KX0 A;  5DHA B;  5IA7 A;  5JHA A;  5DI9 B;  1ACA A;  3ZRF A;  3ZRC A;  4WJQ A;  1WRD B;  1WJ6 A;  1WX9 A;  4DK5 A;  2D11 A;  2MBO A;  1GJZ A;  1ZC4 B;  3N30 A;  5J2R A;  1MIX A;  4PS8 A;  4TV3 A;  4A3O A;  4HAW B;  4HAT B;  2G35 A;  4HB0 B;  2C7N B;  2EKE C;  3UGB B;  2AL6 A;  2CHW A;  2MA9 B;  3JVZ X;  2CRF A;  2KO3 A;  4IAP A;  2R2O A;  2P0D A;  3DXE A;  3TFM A;  1P3Q U;  5BO4 B;  3LJU X;  4K7W A;  1X1F A;  1V61 A;  3GOE A;  2GCJ A;  3TVV A;  1OMW A;  1WGD A;  5J3Q A;  1H10 A;  2KHW B;  1U4A A;  1FXT B;  2RD0 A;  4FA6 A;  3VAW A;  2Z0P A;  2KD0 A;  2D3G A;  2GBJ A;  1WJU A;  2LUL A;  2R09 A;  2MDX A;  1OTR B;  5KCV A;  1E8Z A;  2LXC A;  1YX5 B;  1BWN A;  4GZU A;  2O6V D;  2WX1 A;  4KHB B;  3KVF B;  1L2N A;  2MKR A;  2KDE B;  2ZPN A;  5JP4 A;  1UPR A;  3ALB A;  5CTR C;  1U27 A;  3TCA A;  3AI5 A;  2RR9 A;  3OAN A;  1K5G B;  2GBN A;  1KOT A;  3ZNZ B;  4MY6 A;  3JSV B;  2LGD A;  3JW0 X;  3EPY A;  1X05 A;  3TW1 A;  2J0J A;  4XZ4 A;  2DTC A;  4G50 A;  4IOY X;  2G4S A;  3VFK A;  2BCJ A;  2NBU A;  2GOW A;  1KI1 B;  1P98 A;  2LVP A;  3FP5 A;  2C60 A;  4G11 A;  4K7U A;  4K81 A;  2N7E A;  4MGY E;  2EMS A;  5L95 C;  3V60 A;  3FEH A;  2FCM A;  3HW2 B;  3KRX A;  4KZC A;  4KZ0 A;  4EZK A;  4MEM A;  4JL9 A;  3R66 C;  2D9X A;  1E90 A;  2YVC A;  2K25 A;  2ZCC A;  3P6A A;  2I1J A;  1WZ3 A;  1GC7 A;  2JRI B;  2KX3 A;  2D9V A;  3D8F A;  2IZV B;  2IYB A;  4NSW A;  4NJ7 A;  3ZW3 A;  3PHX B;  2MLB A;  4MGI E;  2CHZ A;  3UIO B;  5CX3 A;  1J0W A;  3TJP A;  4FBJ B;  1RRP B;  4GDK B;  4AWJ A;  4HB3 B;  2C7M B;  3PPA A;  3TBL D;  1BTK A;  5DPT A;  3RCZ A;  4IM3 A;  2LYD A;  2C7H A;  2ASQ A;  2FCS A;  3MHS D;  3G9W A;  2YF0 A;  2J7Q B;  2P8V A;  4PS7 A;  4W9H A;  5D6J B;  4LJP B;  3NSU A;  3VXW A;  4TUU A;  4B6W A;  2DN6 A;  3SU8 X;  3T06 A;  4ZDV A;  2LGX A;  2COA A;  3MPX A;  3VTW A;  4DX9 0;  2NBV B;  5G2N A;  4GDK A;  1K8R B;  5GOW B;  2I5C A;  2LUE A;  3QAQ A;  3RYT A;  1Y19 B;  5J3Y A;  3K9O B;  1U29 A;  3O96 A;  1E8X A;  2MBE A;  4MJS B;  3QX1 A;  4E3C A;  2HTH B;  3ZVV A;  1UBI A;  5L81 A;  4MH0 E;  2OOB B;  4B6H A;  5E6O A;  1HE8 A;  2DAJ A;  1EVH A;  3X23 A;  1R4N I;  3AU4 A;  1WYW B;  4JIO U;  4ZYN A;  3RD2 A;  4IWQ A;  1U5F A;  2K8B A;  2M0X A;  1MPH A;  1ZC3 B;  4GXB A;  4WSF A;  3ULC A;  3QBV B;  4YON A;  5C16 A;  4HAU B;  1V49 A;  2M17 A;  2P0H A;  5DPS A;  5AZF A;  2DKP A;  4AUQ C;  2COF A;  3UQA A;  2IO0 B;  3A1Q A;  1WI0 A;  1X86 A;  2UYZ B;  2XK5 B;  3M62 B;  3SDL C;  3PG7 A;  3V61 A;  3VTU A;  2DYM A;  4IW0 A;  4FHK A;  2COD A;  4HK2 A;  4W9C A;  3R3M A;  3SNH A;  3VTV A;  4ANW A;  1IYF A;  1WXM A;  4HCP B;  1XT9 B;  4HXD A;  2PZ1 A;  2ZVN A;  3QK0 A;  4GU2 A;  2G45 B;  1M7E A;  1TJ6 A;  4IUM B;  2M1M A;  2XEW A;  3IG3 A;  4MSM B;  4WWO A;  5AZH A;  1UNP A;  2KJH B;  2W9N A;  1W1D A;  2UZS A;  4NNJ B;  3KUD B;  3SV1 A;  1MG8 A;  1SIF A;  2AL3 A;  1U5G A;  3CMM B;  3RUI B;  3ZTD A;  2IO2 B;  2VRR B;  2KGX B;  4W9F A;  4I6N B;  1OEY J;  1GG3 A;  3FM8 C;  4YL8 A;  2N7D A;  4FHJ A;  2YS3 A;  4XC2 A;  3X0W A;  2LG1 A;  3A4S C;  3APD A;  3IHP C;  5CLL B;  4BBK A;  3L54 A;  3KW5 B;  4MDK E;  5C1Z A;  2L05 A;  3SD5 A;  4FJV B;  5C23 A;  1TZ1 A;  2Z0Q A;  1WM2 A;  2N1W A;  2RGF A;  3LDZ E;  4OVV A;  4AJW A;  5DCN A;  2YSZ A;  5D3X A;  4FAD A;  3KZ1 A;  3ODW A;  4GSW A;  5KQ1 A;  4A6K A;  3PVU A;  2ABD A;  2YT1 A;  2UWQ A;  4HAZ B;  3KH0 A;  2COP A;  1UNR A;  4NAW A;  4P7I A;  2GMI C;  2GJY A;  5D3Y A;  4XWX A;  1LFD A;  5C5B B;  4MSQ B;  3MTN B;  5L83 A;  3DPD A;  2GBR A;  4W9I A;  2RSG A;  2FCN A;  4DHZ E;  5GMV A;  1UNQ A;  3L13 A;  3WAP A;  2DEN B;  5D7G A;  2NR2 A;  4HAX B;  1P3R A;  5DPR A;  4W9K A;  4BKS A;  3SO6 A;  2BKR B;  2OJR A;  3M95 A;  1WVH A;  2RGN B;  3ENE A;  2FDQ A;  1KZ7 A;  2WH5 A;  4CHK A;  5EFX A;  4HAV B;  3IFW B;  2BWF A;  1FHO A;  1ZM0 A;  1AAR A;  1NTV A;  4F7Z A;  4BKG A;  2KTR B;  4IWO A;  4WJP A;  1WGU A;  5LOP B;  2J59 M;  4C0A A;  2FUH B;  2YS1 A;  4IM2 A;  5CLQ B;  2K6D B;  1XKE A;  2J0M A;  5JHG A;  2Y8F A;  4DHJ D;  4ICU A;  2Z0O A;  3A8Q A;  3HIZ A;  3RUL A;  3QC8 B;  3U30 A;  2WX0 A;  2ZCB A;  5AZG A;  3PRZ A;  3QJZ A;  1I2H A;  2L0T A;  3GYP A;  2KLG A;  2DHK A;  5JZE B;  4ZRK A;  3VIA A;  1V88 A;  3KYD D;  1V2Y A;  3PRM B;  3DCG A;  3A9K A;  2RNR B;  1Q0W B;  2MBQ A;  1NBF C;  3P2B A;  2MX2 A;  4A6H A;  2MW5 A;  5C79 A;  2EMT A;  2DHZ A;  3EC8 A;  4MEL A;  1PMS A;  2ADZ A;  2KUP A;  3WAM A;  2KXJ A;  4TKN A;  5DH9 B;  4KIK B;  3OAW A;  1LW3 A;  1P0R A;  3M63 B;  2NVU I;  1IP9 A;  1KJT A;  2CU1 A;  4M8M A;  4Y94 A;  1KZG A;  3ZNH B;  1ST7 A;  1DDM A;  2QKL A;  2DYO A;  5LXI B;  3GYO A;  2L1C A;  3A9K B;  2B3A A;  4AOF A;  1P9D U;  4HLE A;  1UEL A;  2CY5 A;  1HB8 A;  1FGZ A;  1TQZ A;  4PNK A;  4K17 A;  1SGH A;  2DHI A;  2W2W A;  5FI1 A;  1UD7 A;  1S3S G;  4K1R B;  1V81 A;  4KIK A;  3A9J A;  2D2Q A;  3ZDT A;  3EEC A;  4URK A;  3MJW A;  1PLS A;  2M38 A;  5LXH A;  4BKT A;  3ONS A;  2W2X D;  2YLM A;  2AEH A;  4H8S A;  2ZVO A;  4HB2 B;  5JHB A;  1M7R A;  4FJZ A;  4WAA A;  1WI1 A;  4WWN A;  2Y7B A;  1OGW A;  2LXA A;  4DBB A;  3KUZ A;  5JLJ B;  1EF5 A;  3APF A;  3VUX A;  5KHO A;  2DKQ A;  2EC1 A;  4MT7 A;  4PYU A;  3UIN B;  3DBR I;  2ZNV C;  4GB9 A;  2M14 A;  4G3X B;  4ZRJ A;  3ML9 A;  4EJN A;  2N4F A;  3A98 B;  3BIN A;  2CB8 A;  2NPT A;  4E74 A;  3A1Q B;  4WVF B;  1CMX B;  3ZNI D;  3DXD A;  2FAZ A;  1AQC A;  5C6R A;  3LJ3 A;  2L7R A;  3V6E B;  3AU5 A;  4KDL B;  2Z0E B;  4X57 B;  3ZTC A;  2KZR A;  3ULB A;  3L16 A;  3RZW C;  2LBB A;  3WIM A;  1IPG A;  1XD3 B;  1I42 A;  3QIJ A;  4HDQ A;  3NY5 A;  2DHJ A;  3IBE A;  4I6P A;  3A8P A;  3M3J A;  3HHM A;  2BGF A;  4JQW C;  1PFJ A;  4GN1 A;  4PS3 A;  1DDV A;  1TXD A;  4A6F B;  1TBE A;  1WGY A;  2NPT B;  3KUC B;  3PSE B;  4EEW A;  2K39 A;  1HB6 A;  1V5T A;  1WMH B;  3DBS A;  1FHW A;  4IFS A;  2CQU A;  1UH6 A;  4CHM A;  1QZE A;  4GPT B;  2Z0D B;  4GMV A;  4K2O A;  4KHO A;  2D10 A;  3CSF A;  1UGM A;  4TQ1 A;  2KWV B;  3B0A A;  4GMX B;  4XX5 A;  2DZK A;  3TIX A;  3DVN V;  3QQ8 B;  1K5D B;  1LM8 B;  4HJK A;  4A6F A;  2KNB A;  4D0N B;  1MK9 B;  1BTN A;  1WJ4 A;  2DX5 A;  2K1F A;  2OTX A;  4OVU A;  1NI2 A;  4HHV A;  3RZF A;  2RPQ A;  5EDS A;  2I5F A;  1H8C A;  4NAW B;  4F8C B;  1P6S A;  1Q1O A;  3SUZ A;  1WF9 A;  1LB1 A;  2CY4 A;  2DZM A;  2JVC A;  2LRU A;  1WGG A;  3HM3 A;  4II3 B;  4A3P A;  4GDL A;  4PQ0 A;  1WGQ A;  3KYC D;  4NQL B;  1U5D A;  3NOB A;  1RJ2 A;  1WE7 A;  1WX7 A;  4G0N B;  2KMC A;  1MIZ B;  2K00 A;  2NMB A;  2XBB C;  4FJY A;  1U2B A;  1WH3 A;  2X18 A;  4BFR A;  1M94 A;  2YT0 A;  2XQN M;  2IY0 B;  3JYU A;  3L10 B;  2KK8 A;  1S1Q B;  2L00 B;  3PS6 A;  2ZZP B;  2KTF A;  3WAL A;  3FLV A;  1WM3 A;  2K6Q A;  5IAA C;  3UIP B;  1X1M A;  2HJ8 A;  1NTY A;  2BF8 B;  4BVU C;  3KSY A;  3L17 A;  4DWF A;  1X11 A;  4NQK E;  5HKH A;  1D3Z A;  1LQB A;  3B1L X;  1X1G A;  3HK0 A;  4FUL A;  4AP4 C;  4F7G A;  5HE1 A;  2FIF A;  1ZVR A;  4NY0 A;  2ELA A;  2FNJ B;  2D4Q A;  2K8C A;  4K7S A;  4LDT B;  2YRY A;  3PZD A;  3SHQ A;  4HPL B;  3IVF A;  1F9J A;  4BBN C;  2FJL A;  2O6V A;  5IJM A;  3H1U A;  1XOD A;  1B55 A;  1V5M A;  3M1I B;  1V6E A;  2FID A;  2KLC A;  2KQS A;  3R7Q A;  2VSZ A;  2KOX A;  2HD5 B;  4WQO B;  3PV1 A;  3ZKJ C;  2KC2 A;  1YJ1 A;  1A5R A;  5DHF B;  1Z5S B;  3APC A;  3QWZ B;  4E71 A;  2LVO A;  4AJY B;  1LXD A;  5D94 A;  1EGX A;  5G55 A;  2K2U A;  2RSU A;  2ZNV B;  3S2A A;  3CF6 E;  5KQ4 A;  2DX1 A;  2N23 A;  2O6V B;  2IYD B;  3O65 B;  3QA8 A;  4W9E A;  2JWZ A;  3VHT C;  2EJ8 A;  1NDD A;  3T8M A;  5TR5 A;  1WIA A;  3T9L A;  2JRH A;  2REX A;  2KJR A;  1XX0 A;  2DLW A;  3A9J B;  1U5E A;  4DHZ B;  3PRE A;  4ANU A;  1WZ0 A;  5DPW A;  1UEF A; 
#chains in the Genus database with same CATH topology
 2N1V A;  3BY4 B;  4GIV A;  3NVW A;  5IOI A;  1WY8 A;  2BS3 B;  1QT9 A;  1L7Y A;  1ZXI A;  2WYQ A;  1EAZ A;  1TTN A;  3P1M A;  4MGK E;  5CHW A;  4HKQ A;  1TZO A;  2A4Z A;  1FB8 A;  1JRO A;  1WWT A;  4M8N A;  1SE2 A;  2PE9 A;  2N9X A;  4W9G A;  2G1E A;  4PT5 A;  1ZW7 A;  1C9F A;  2ZW0 A;  2MH7 A;  2W54 A;  2IO1 B;  5E6P A;  1P5T A;  3F0W A;  1FNV A;  2D9Y A;  4WWP A;  3ODO A;  2CR5 A;  1Z2M A;  2JXX A;  3P4S B;  4DDG D;  3N32 A;  1KFY B;  1FGY A;  1L4Z B;  1Y8R C;  1HTO A;  1N62 A;  2HTM E;  3CST A;  5FR6 A;  1YX6 B;  2JYT A;  5AUK A;  4P1B C;  1ISN A;  3PEG A;  2MFQ A;  3MDB C;  2H7D A;  2LJ5 A;  1WJM A;  4YSZ B;  1R4M I;  2DYB A;  4XDC A;  5J17 A;  1R4N B;  4F1S A;  3NRZ A;  4EMO A;  1FCL A;  4DBG A;  1BT0 A;  2J0K A;  1XXG A;  2BQQ A;  3I9V 1;  3N1Y C;  2M4N A;  1W1G A;  4HJG E;  4RM8 A;  4HRO A;  4UDU C;  1DOX A;  2VH2 A;  3RPF C;  3OLM D;  1MKE A;  3K9P B;  1T0Y A;  2UZR A;  3D8E A;  2KWU B;  1YD8 U;  2FCQ A;  2D07 B;  2IY1 B;  4G3X B;  2Y8G A;  1UWM A;  2TSS A;  5LNK 1;  2KQ7 A;  1E7U A;  5JH5 C;  4K3B A;  1XCG A;  4ACF A;  4IG7 B;  2WU2 B;  1ZDV A;  3TL5 A;  1YQ4 B;  3VQI A;  4L6E A;  1JWB D;  3PP2 A;  1EWC A;  3P7Z A;  3AN1 A;  4JK8 A;  4KDI C;  5C2T B;  2IDY A;  4JKB A;  2KAC A;  3U7D A;  2JQR B;  2JZP A;  3Q14 C;  1UWX A;  3TSS A;  4KHB A;  4W9J A;  2NCN A;  3PO0 A;  2IJ0 A;  2L0F A;  3NZS A;  2DBY A;  4F7U P;  4QJ5 B;  5HG2 A;  3D32 A;  1J8C A;  2V76 A;  2KN5 A;  2PIA A;  2V9H A;  4CSQ A;  3NG0 A;  5IO9 A;  5I4D A;  3ABV B;  1ZSQ A;  5E6J A;  4CYE A;  2N9P C;  3ZDM C;  4TQ0 A;  3NHE B;  3V6C B;  3WAN A;  4DXA B;  5D27 A;  2L32 A;  4US9 A;  5H8Y E;  2K49 A;  2KYW A;  5JVL A;  2LI5 A;  2J4X A;  4IC7 B;  4JK9 A;  2DFK A;  1HZ6 A;  3RT3 B;  1WR6 E;  2M56 B;  2KUQ A;  3T3O A;  4MK0 A;  2BYF A;  2R2Q A;  2MWS B;  1JWS D;  1V1P A;  3N7C A;  1BAK A;  2JZ3 B;  5FK9 C;  2MCN B;  2ROV A;  1HTQ A;  2EEL A;  1GC6 A;  1MK7 B;  4JKC A;  3SYX A;  4QJ4 B;  4YXD B;  4KSL C;  3Q69 A;  2QIL A;  4ANV A;  3W2D A;  3TO1 A;  4RMA A;  1VJK A;  1F1H A;  2LD9 A;  2KKC A;  3C0R B;  3AV8 A;  4KKJ A;  3GP7 A;  1PFD A;  3SR6 A;  1V5O A;  1SF0 A;  3Q3J A;  4ZRI A;  4S0R A;  1J0G A;  3AEF B;  3RNE C;  4BBN F;  5AEK B;  2LGI A;  1V8C A;  2RQ1 A;  2LGY A;  5C5B A;  1DYQ A;  5DHA B;  5IA7 A;  5DI9 B;  1ACA A;  3ZRF A;  4WJQ A;  1GAQ B;  2MBO A;  1ZC4 B;  4A3O A;  4J3O D;  3NWD A;  4HAT B;  2G35 A;  2C7N B;  1JW9 D;  1MVK A;  3NWA A;  1X1F A;  3TVV A;  2LFI A;  5J3Q A;  3ZJT A;  1U4A A;  1FXT B;  1C76 A;  2RD0 A;  1DOY A;  2D3G A;  2FE8 A;  1E8Z A;  1BWN A;  2QCZ A;  4KHB B;  2ZPN A;  1U27 A;  4D2K A;  3R2T A;  1E9M A;  3ZNZ B;  3EPY A;  3BK1 A;  2J0J A;  5M4Y B;  2BCJ A;  2C60 A;  4K7U A;  2N7E A;  2EMS A;  3MHZ A;  3FEH A;  1XO3 A;  3KRX A;  1HA5 A;  2FCM A;  3I63 C;  1E0Z A;  2JU6 X;  2D9X A;  1E90 A;  4OZB A;  3KWL A;  3P6A A;  2JRI B;  4IKG A;  2IYB A;  2LMC A;  4NSW A;  4NJ7 A;  3C8Y A;  2MLB A;  3NW8 A;  4MGI E;  5CX3 A;  4ZOH C;  1CZP A;  1J0W A;  4FBJ B;  1RRP B;  2C7M B;  5IP4 D;  4IM3 A;  4RH6 A;  5D6J B;  2YF0 A;  1R7S A;  4W9H A;  3VXW A;  2WHI A;  5H92 C;  4ZDV A;  3T06 A;  2FJU B;  3VTW A;  3MPX A;  1N61 A;  2QDF A;  4GDK A;  2BTE A;  2PKO A;  3IAM 1;  1Y19 B;  3K9O B;  2MBE A;  2PTL A;  3ZVV A;  4MH0 E;  1HQR D;  3SFE B;  4EZJ A;  5C1Z A;  1EVH A;  3AU4 A;  3DBR B;  2QMT A;  4WSF A;  1ZC3 B;  3QBV B;  5DPS A;  4AUQ C;  3C19 A;  2IO0 B;  3P4Q B;  2KR0 A;  1K53 A;  3VTU A;  3V61 A;  2R2Y A;  2DYM A;  4IW0 A;  4FHK A;  2COD A;  3R3M A;  1WXM A;  1DIK A;  4HCP B;  2WDR B;  1TJ6 A;  2OHF A;  2M1M A;  4MSM B;  3IG3 A;  5AZH A;  1UNP A;  1W1D A;  2WDV B;  1MG8 A;  1SIF A;  2AL3 A;  1U5G A;  3ZTD A;  2IO2 B;  2YS3 A;  2OED A;  3APD A;  3IHP C;  3PZ7 A;  3Q8E A;  3L54 A;  1I4G A;  4FJV B;  1TZ1 A;  2Z0Q A;  2RGF A;  2N1W A;  3Q8B A;  4OVV A;  1QKZ A;  5DCN A;  3I57 A;  3KZ1 A;  3ODW A;  2N0S B;  5KQ1 A;  1E10 A;  3KH0 A;  3PVU A;  3WAO A;  4HAZ B;  5L83 A;  2GBR A;  3DCX A;  1P3R A;  4ZHO A;  4RGN A;  2WH5 A;  3IFW B;  2KQ4 X;  2CU3 A;  4QXA B;  1VBG A;  3DBL B;  2YS1 A;  3FKY A;  4IM2 A;  3HIZ A;  2K9X A;  3U30 A;  3PRZ A;  3GYP A;  1JDE A;  5JZE B;  1QLB B;  1V2Y A;  3P2B A;  3A9K A;  2Y5C A;  1FXI A;  2W55 A;  3BYY B;  2DHZ A;  2KXJ A;  4TKN A;  4KIK B;  3OAW A;  1LW3 A;  3OG5 A;  1KZG A;  1ST7 A;  1DDM A;  2QKL A;  2DYO A;  5LXI B;  4AOF A;  1UEL A;  4AS1 A;  4K17 A;  1S3S G;  1V81 A;  3A9J A;  3ZDT A;  5LXH A;  3ONS A;  2W2X D;  2YLM A;  4H8S A;  1L0X B;  1OGW A;  3RFZ B;  3KUZ A;  5JLJ B;  4REZ A;  5KHO A;  3AE3 B;  4OHJ A;  5HFY A;  2M14 A;  3ML9 A;  2N4F A;  2WQY B;  1CMX B;  1HXY D;  2WDQ B;  2LBB A;  3WIM A;  1XD3 B;  1MHX A;  4PS3 A;  3HHM A;  4USA A;  1TXD A;  2NPT B;  3PSE B;  1HB6 A;  1GOZ A;  1V5T A;  1AWD A;  1UH6 A;  2KT7 A;  4GPT B;  1XLP A;  2D10 A;  3B0A A;  4GMX B;  1SE4 A;  1K51 A;  4XYC A;  1K5D B;  4A6F A;  3NUH B;  1MK9 B;  2OTX A;  4OVU A;  1NI2 A;  2RPQ A;  5EDS A;  3MFG A;  1Q1O A;  2RPV A;  1WF9 A;  2DZM A;  3HM3 A;  4PK1 A;  4PQ0 A;  1WGQ A;  4NQL B;  1U5D A;  1WE7 A;  1WX7 A;  2K00 A;  2NMB A;  2X18 A;  4BFR A;  1M94 A;  2YT0 A;  1DOI A;  3L10 B;  5HHD G;  3FLV A;  2K6Q A;  4JKF A;  2N9K A;  1C4P A;  3AB5 A;  2HJ8 A;  4DXF A;  4ARC A;  1D3Z A;  4AP4 C;  5HE1 A;  4HSI A;  1ZVR A;  2FNJ B;  2YRY A;  1P7E A;  1WGK A;  3O13 A;  2FJL A;  5IJM A;  2JX5 A;  2FID A;  3M1I B;  2KQS A;  5BMH A;  1FD6 A;  2KC2 A;  1YJ1 A;  2K8E A;  1Z5S B;  1TS4 A;  3APC A;  4E71 A;  1LXD A;  5D94 A;  3CF6 E;  5KQ4 A;  3HSA A;  3O65 B;  3QA8 A;  1FPY A;  2QJL A;  1NDD A;  1UGJ A;  1FXA A;  2KJR A;  1XX0 A;  2R61 A;  4QJ3 B;  1U5E A;  4N59 A;  5D3I B;  3DVG X;  3RNG C;  2LOX A;  4TYZ A;  1WYG A;  4NAM A;  1ZKH A;  2W3R A;  3GZN I;  1JWM D;  4LJO B;  4HCN B;  2YS5 A;  1WFY A;  5TSS A;  3H6N A;  3A33 B;  3DVG Y;  4MAC A;  4JLC A;  1C79 A;  2LHE A;  2GB1 A;  3CXB B;  3U12 A;  3U8Z A;  2DYQ A;  2R0D A;  2KFJ A;  2ROZ B;  3B08 A;  1RFA A;  1RAX A;  1JRP A;  4JGH B;  3UI3 A;  4C7Z A;  1V9J A;  1ZOY B;  3DDC B;  1KLU D;  1NEN B;  3H7P B;  4H2A A;  4ARI A;  1Q5W B;  5LON B;  1WX8 A;  2WXQ A;  1OEY A;  2IO3 B;  1PGB A;  2CHX A;  4GDL B;  2Y5B B;  1IBX B;  2D3B A;  1ZPS A;  2XK5 A;  3BWU D;  4I6L B;  4AWJ A;  1STE A;  2IBI B;  4EUT A;  2I1K A;  1JAL A;  3PLU A;  5CHV C;  3VUW A;  3TEW A;  4JKG A;  3QWM A;  4M0W B;  4EZL A;  1VD2 A;  3H7S A;  3B9J A;  3Q2A C;  4CHJ A;  4BOS C;  2H7E A;  4HB4 B;  1TS3 A;  1E7V A;  3AEB B;  2OQB A;  2KN4 A;  1J19 A;  4P6V F;  4BKS D;  1N5W A;  5IKC M;  1KBL A;  4GOU A;  4K2P A;  3V5W A;  2JF5 A;  1E5W A;  1DYN A;  4IM0 A;  2UU7 A;  2KMM A;  3Q3F A;  2IND C;  4KV2 A;  2VRW B;  2WDT B;  4DIX A;  1VCB A;  2WP9 B;  2WLB A;  1XF5 L;  1KLV A;  1MAI A;  1VBH A;  4WJN A;  5J3T A;  1JRU A;  1TYG B;  2DIK A;  1KC7 A;  1AWE A;  1SHC A;  1FHX A;  3GS2 A;  2NZ8 B;  3KQ4 A;  1N63 A;  1WJN A;  1T3Q A;  1KF6 B;  3JSV A;  1DDW A;  2RMM A;  2BKF A;  2ZEQ A;  2W2X C;  1UZX B;  4NPN A;  3NWF A;  2JXT A;  1I35 A;  2AWT A;  3EFU A;  4HVB A;  2RVB B;  1NVL A;  1OFF A;  1V1P B;  1B1Z A;  3W1S A;  4N58 A;  1ZE3 D;  3KLS X;  1YIW A;  3AE6 B;  2K8H A;  3RMK C;  2MWN B;  4GOC A;  1FAO A;  2BPS A;  2HDE A;  3ZGZ A;  3E9S A;  4NZL B;  3ECI A;  2RLO A;  2COC A;  2Z59 B;  3VOQ A;  2KFK B;  1C3T A;  2MEK A;  1N6Z A;  2MP2 A;  2ZPY A;  1TT5 B;  1NVI D;  2BYE A;  2MBH A;  1AN8 A;  1FM0 D;  3PRP B;  1TIF A;  2Z13 A;  2L8J A;  1RYJ A;  1UBQ A;  4JE3 B;  4B95 A;  2UVM A;  1WG7 A;  2MRP A;  1NYQ A;  2LJI A;  4KSK C;  2JT4 B;  1K52 A;  4ILJ A;  4DXG A;  3FVC A;  1WJ6 A;  4DK5 A;  2D11 A;  3N30 A;  4PS8 A;  4HAW B;  3ENB A;  4HB0 B;  3UGB B;  2AL6 A;  2CRF A;  5BO4 B;  3LJU X;  1EU4 A;  4K7W A;  3GOE A;  2GCJ A;  3W5U B;  1H10 A;  2KHW B;  4YT0 B;  2Z0P A;  2GBJ A;  1WJU A;  4XDD A;  2MDX A;  1OTR B;  1JCK B;  3DHH C;  2O6V D;  3B2F A;  3KVF B;  2K0P A;  5JP4 A;  1UPR A;  3ALB A;  4WAF A;  5CTR C;  3TCA A;  1K5G B;  1KOT A;  2LGD A;  3JW0 X;  2DTC A;  4G50 A;  3VFK A;  1KI1 B;  1P98 A;  2LVP A;  4HRS A;  4MGY E;  2NMQ A;  4KZC A;  4KGR A;  4JL9 A;  1FNU A;  2K25 A;  4L2Y A;  2ZCC A;  2I1J A;  1XLQ A;  5BYR A;  2KX3 A;  2D9V A;  3AED B;  3UIO B;  2BS2 B;  4HB3 B;  1IGC A;  5DPT A;  2LYD A;  1FNW A;  3G9W A;  4C00 A;  2EKI A;  3NSU A;  1L0V B;  2HJ1 A;  4DX9 0;  2NBV B;  5FKA C;  1XLN A;  4ILH A;  2I5C A;  2LUE A;  3RYT A;  5J3Y A;  3VR8 B;  4MJS B;  3QX1 A;  2HTH B;  3DBH B;  5L81 A;  1HE8 A;  1J7B A;  4ZYN A;  4JIO U;  1I42 A;  2K8B A;  4MGZ E;  4YON A;  1V49 A;  1F0Z A;  2DKP A;  2INP E;  3A1Q A;  4RCO A;  2UYZ B;  3N1X C;  1ZDX A;  3VTV A;  1TJE A;  4HXD A;  3HVD A;  2PZ1 A;  2XEW A;  3MC9 A;  3CMM B;  5G5G A;  2VRR B;  1PGA A;  4W9F A;  4I6N B;  4FHJ A;  4XC2 A;  2AQ2 B;  2WS3 B;  2LG1 A;  5CLL B;  3VR9 B;  2BYT A;  4JKH A;  2PW9 A;  4AJW A;  1L0Y B;  2YSZ A;  4GSW A;  3HVZ A;  4A6K A;  4M01 A;  2YT1 A;  2COP A;  3T9L A;  5D3Y A;  1QOB A;  1UNS A;  3MTN B;  3EGR A;  2FCN A;  3SBT A;  1FEH A;  2KDM A;  4HPP A;  5HI1 A;  5DPR A;  4HAX B;  3FAH A;  4L23 A;  3SO6 A;  2OJR A;  3M95 A;  1WVH A;  2GRI A;  4YSY B;  5EFX A;  2RDB C;  2WXH A;  4IWO A;  4LNI A;  4XWT A;  3E56 A;  1I4Q A;  2J0M A;  4DHJ D;  3R8B A;  1ZP0 B;  2QEJ C;  1TS2 A;  5AZG A;  3QJZ A;  2L0T A;  4A55 A;  3VIA A;  3DCG A;  1UUP A;  2RNR B;  2MBQ A;  4N9F 4;  3NJT A;  2EMT A;  4IOI E;  2K5P A;  2G9H D;  5DH9 B;  1SBB B;  3LB8 C;  1A70 A;  1YOV B;  4JK7 A;  2L1C A;  3A9K B;  1BXT A;  4XE0 A;  4PNK A;  3U4E G;  4KIK A;  2AEH A;  1QIL A;  1F2R C;  3LYY A;  3CIR B;  4HB2 B;  5JHB A;  1VR9 A;  4ZRQ A;  4DBB A;  3VUX A;  3APF A;  3A58 A;  4MT7 A;  3Q8A A;  4JX1 C;  3UIN B;  4RF0 A;  2IPK D;  1VDV A;  4GB9 A;  2ONQ A;  3Q6B A;  4WVF B;  3ZNI D;  3DXD A;  1AYF A;  5C6R A;  3V6E B;  3GB1 A;  4X57 B;  2KZR A;  3L16 A;  2JWU A;  2DHJ A;  3IBE A;  4TQ1 A;  3ZNG C;  3M3J A;  4YTM B;  1IBX A;  4ILG B;  1PFJ A;  3X0W A;  4A8X C;  3MJ5 A;  1WGY A;  2WXF A;  4O1N A;  1KTK A;  4US8 A;  2XN9 C;  2SEB D;  2Z59 A;  1IUE A;  1QZE A;  2Z0D B;  2ICI A;  1UGM A;  3H8H A;  4XX5 A;  3AM9 A;  2DX5 A;  4HHV A;  4NAW B;  1MFW A;  2LRU A;  1LB1 A;  2JVC A;  1WGG A;  1RJ2 A;  1VRA B;  1MIZ B;  2IY0 B;  3PS6 A;  2XQN M;  3JYU A;  2KK8 A;  1S1Q B;  2L00 B;  2KIG A;  2ZZP B;  3WAL A;  2Y5P A;  2K3U A;  1X1M A;  1NTY A;  2BF8 B;  3VRB B;  4DWF A;  1LGR A;  4A6Q A;  5HKH A;  1LQB A;  1X1G A;  3HK0 A;  4FUL A;  1E6E B;  4N6E B;  4NY0 A;  5IRS A;  4LDT B;  4K7S A;  3IVF A;  1RM6 C;  4NJC A;  1F9J A;  1JML A;  1V6E A;  1V5M A;  3VRA B;  2VSZ A;  2M19 A;  2HD5 B;  4WQO B;  3PV1 A;  3ZKJ C;  1EGX A;  5G55 A;  2RSU A;  3S2A A;  2DX1 A;  2N23 A;  2WXG A;  4RGT A;  2EJ8 A;  5C3J B;  5TR5 A;  3AE2 B;  1B9R A;  4ITK A;  2DLW A;  2D5G A;  4L1R A;  3PRE A;  2MJD A;  3AUL A;  2M8S A;  5GXG B;  1E8W A;  5E6N A;  2IFS A;  3IXS A;  1N5X A;  4ZYS A;  4Z2N A;  2WXK A;  3SEB A;  4B0E A;  1TY0 A;  3ZUN A;  4QAY A;  4PYZ A;  2FBW B;  1XCQ L;  2HE7 A;  2RUK B;  1YQB A;  2O2V A;  4MM3 A;  4IWP A;  2KWC A;  2QHO A;  2V4I B;  2LOZ A;  3E9L A;  3BJI A;  1E8Y A;  5EE3 A;  1WMH A;  2Z8L A;  3KY9 A;  3BK2 A;  2KMA A;  2V1Y A;  2WXJ A;  5HE0 A;  3IAS 1;  2CJN A;  3ZO5 B;  4LNF A;  2NTS A;  4YTN B;  1SB3 C;  2GLS A;  3QHT A;  3RCP A;  1V1O A;  1YQ3 B;  2HTH A;  2PPH A;  1WJ1 A;  2D9W A;  1QF6 A;  3N20 C;  4II2 B;  5CHF A;  3RNF C;  1N3H A;  4ANU A;  4HPM B;  2C9W B;  1WXV A;  1W1H A;  3H7P A;  3UF8 A;  3P4P B;  2QKM A;  3MC0 B;  2BVC A;  1VLB A;  3R7R A;  2MQJ A;  4HAY B;  3ZJV A;  3E9O A;  2GBM A;  2MBB B;  2KTR A;  1RLF A;  2BYV E;  1KRH A;  3AH7 A;  4M0W A;  4KKI A;  3U52 E;  1FFU A;  2IGG A;  1NI3 A;  1SJE D;  2D9Z A;  4A20 A;  3AEA B;  2REX A;  1Y5O A;  1ENF A;  3ODX A;  1JWA D;  2NBW B;  1DRO A;  1FIQ A;  5D3W A;  2Z14 A;  1GNU A;  1V86 A;  2NTT A;  2CAY A;  2L76 A;  1V5P A;  1V89 A;  2G3Q B;  2JYE A;  2B76 B;  1QC6 A;  4EFO A;  3OHM B;  2L2I A;  3ZYY X;  4KX6 B;  1FOE A;  1EM7 A;  4DX8 A;  1SXT A;  3I3T B;  3VUY A;  3HQC A;  1TKE A;  1KM7 A;  2V3P A;  1RRB A;  2BWE S;  2PMV A;  2L3Z A;  5BYQ A;  2WWZ A;  3PVW A;  3NZU A;  1ZUD 2;  4RM9 A;  2CJO A;  4W9L A;  3ZVR A;  1SE9 A;  2O2V B;  3ZLZ A;  2DYN A;  1WE6 A;  5D2M B;  3ML8 A;  2Z4D A;  1QQR A;  2RDG A;  4EKU A;  3VDZ A;  2P0F A;  1WXA A;  3WYF B;  3UZT A;  2OJW A;  5HE3 A;  2N9E B;  1Q67 A;  4A5K A;  3VVW B;  3PHW B;  2ZJD A;  2DAF A;  3KRW A;  3EHV A;  3HIE A;  3W9C B;  1T0R C;  2WXR A;  3U2S C;  1JQ4 A;  1XR0 B;  4HWI B;  3HRD D;  2VKI A;  2ELB A;  2JUO A;  1VZ7 A;  2BS4 B;  4Q2J A;  2K2J A;  1G6J A;  2LWP A;  5G5H A;  4M02 A;  3OJ4 B;  1I4P A;  3HM6 X;  4GNK B;  1C1Y B;  5FI0 A;  2GI9 A;  4LLG M;  1SE3 A;  3LXF A;  5BYS A;  4C56 C;  4JKE A;  2KX0 A;  4R3D A;  1D6E C;  1I4R A;  2QIE B;  1WRD B;  2DWQ A;  1WX9 A;  1F2R I;  1MIX A;  4JWU C;  4RFB A;  2CHW A;  1MI1 A;  4JWS C;  2KO3 A;  4IAP A;  2P0D A;  3RNA C;  1SEB D;  1V61 A;  1OQR A;  1WGD A;  1YN5 A;  3GZN B;  2KD0 A;  1EU3 A;  2R09 A;  2LXC A;  2WX1 A;  1L2N A;  2MKR A;  1C4A A;  3Q3N C;  3AI5 A;  2GBN A;  4L1B A;  4MY6 A;  4XZ4 A;  4WH4 A;  3TW1 A;  4IOY X;  3IT6 B;  2GOW A;  2D3A A;  3FP5 A;  5L95 C;  3AMZ A;  3BVZ A;  1ROE A;  4KZ0 A;  4MEM A;  2YVC A;  3AEG B;  3ZXV A;  1WZ3 A;  3AEE B;  2BB6 A;  3PHX B;  3NVZ A;  2AQ3 B;  3TBL D;  4TSS A;  3RCZ A;  2C7H A;  4YTP B;  1M4V A;  2ASQ A;  4PS7 A;  3MHS D;  1QOA A;  2P8V A;  3SU8 X;  1R4M B;  2LGX A;  4AQ7 A;  2COA A;  5G2N A;  1GPX A;  1K8R B;  1K50 A;  1U29 A;  4E3C A;  4MH8 A;  4B6H A;  1WYW B;  4MM3 B;  4IWQ A;  2M0X A;  2W9N A;  4GXB A;  3ULC A;  5C16 A;  2WXI A;  2COF A;  3E9P A;  1PYW D;  1X86 A;  2XK5 B;  4MT5 A;  3SDL C;  3PG7 A;  1YN4 A;  4HK2 A;  3SNH A;  4CQN A;  2MJ3 A;  2G45 B;  1M7E A;  2H89 B;  3AE4 B;  1GB4 A;  4JKG B;  2KJH B;  2UZS A;  4NNJ B;  3KUD B;  3SV1 A;  3RUI B;  1L5P A;  4ZRP A;  1OEY J;  3FM8 C;  2R82 A;  2N7D A;  2GUM A;  4BBK A;  4MDK E;  2L05 A;  3SD5 A;  2KAJ A;  3RI7 C;  1HEZ E;  1WM2 A;  5BMG A;  3BVM A;  1OQQ A;  1KH0 A;  5D3X A;  4FAD A;  1J7A A;  1UNR A;  4P7I A;  2GMI C;  2GJY A;  1LFD A;  4XWX A;  4P16 A;  2M0A A;  3DPD A;  1E7P B;  2BT6 A;  2RSG A;  1MG4 A;  4DHZ E;  5GMV A;  1UNQ A;  5D7G A;  2NR2 A;  2BKR B;  2FDQ A;  4HAV B;  1NTV A;  2KTR B;  1WGU A;  5LOP B;  2J59 M;  4C0A A;  3TEX A;  4A90 A;  5CLQ B;  2K6D B;  2Y8F A;  4ICU A;  3RUL A;  3A8Q A;  2LEK A;  2WX0 A;  2ZCB A;  5FR3 A;  2IGH A;  2KLG A;  2DHK A;  4ZRK A;  1Q0W B;  4OZC A;  4A6H A;  2MW5 A;  5C79 A;  4BAX A;  3WAM A;  1PMS A;  2ADZ A;  2KUP A;  2WXO A;  1NEK B;  1P0R A;  3P42 A;  2NVU I;  1IP9 A;  2CU1 A;  4M8M A;  2YEP F;  1YJI A;  2B3A A;  1FGZ A;  1TQZ A;  1SGH A;  2DHI A;  1UD7 A;  4K1R B;  3CWI A;  2J53 A;  4URK A;  3EEC A;  3TEY A;  3MJW A;  2M38 A;  2AQ1 B;  2ZVO A;  3N1Z C;  3ETR A;  1M7R A;  4FJZ A;  4WAA A;  1T0Q C;  3BII D;  2ZKM X;  2EC1 A;  4IDI A;  4ZRJ A;  3HUI A;  4EJN A;  1TY2 A;  3A98 B;  3BIN A;  2BB5 A;  4E74 A;  3GE8 C;  2FAZ A;  1AQC A;  2L7R A;  4KDL B;  2Z0E B;  2X8X X;  3ULB A;  3GE3 C;  1IPG A;  3FIL B;  3QIJ A;  4I6P A;  3A8P A;  2BGF A;  3AE8 B;  1TBE A;  1L6V A;  1ZXH A;  2CQU A;  3AE1 B;  4GMV A;  4K2O A;  3CSF A;  4K3C A;  4KGT A;  3DVN V;  3QQ8 B;  1LM8 B;  4HJK A;  4EE2 A;  2YT2 A;  2QC8 A;  2KNB A;  4D0N B;  1WJ4 A;  2I5F A;  1H8C A;  4F8C B;  1P6S A;  3SUZ A;  4GDL A;  4G0N B;  4FJY A;  1U2B A;  2INC C;  5BMI A;  2BW2 A;  2KTF A;  2L52 A;  2D3C A;  3UIP B;  4BVU C;  3KSY A;  2FUG 1;  3L17 A;  3E66 A;  3B1L X;  1MJD A;  1MI0 A;  2N7J A;  4F7G A;  3SHQ A;  2K8C A;  2D4Q A;  3PZD A;  2O6V A;  3H1U A;  1XOD A;  3EUB 2;  1A5R A;  3AE9 B;  5DHF B;  2LVO A;  2ZNV B;  1P7F A;  1PUT A;  2JWZ A;  2JRH A;  3A9J B;  1WZ0 A;  1PGX A;  1NTI A;  2WNM A;  3D8D A;  1TGZ B;  4CO7 A;  5J18 A;  1PQS A;  4M00 A;  1T5X D;  2N0Y A;  3PSC A;  1WGR A;  3BYT B;  2ON8 A;  4C4V B;  2DZI A;  2A5U A;  4RNA A;  2E3T A;  4LDT D;  1FMA D;  4KHA A;  1FRD A;  3PLV A;  3DVN U;  2C5L C;  1SSN A;  1WSP A;  2CS4 A;  1V5U A;  2JZZ A;  1FCC C;  2KDI A;  1C78 A;  2PE6 B;  3NS8 A;  2KJ6 A;  3H9D A;  2HRJ A;  2E2X A;  3PTF C;  2GBK A;  4ICV A;  1BUI C;  2G4D B;  4FN2 A;  4KVG B;  4Z2M B;  4F7H A;  4KAX B;  2KFK A;  2DNF A;  4J6I A;  2LKO A;  2LZ6 A;  4BZA A;  2MP2 B;  1XEE A;  3N3K B;  3DBH I;  1Z87 A;  1SIJ A;  3L0W B;  3N9Y C;  4XGA B;  4GGQ A;  1EF1 A;  5D3V A;  4WJ7 A;  5HE2 A;  1P1A A;  3ML4 A;  1GUA B;  2KVZ A;  1OY2 A;  4LK0 M;  2V3N A;  4LNO A;  1OQY A;  2MSE D;  2V0G A;  1EO6 A;  5I2S A;  3CIK A;  2DX5 B;  1QOF A;  2V3S A;  3W1Y A;  4W9D A;  1EUV B;  3SBG A;  4HDO A;  4ASW C;  3SFD B;  3AXC A;  1FO4 A;  2JY6 A;  3A4R A;  1H4R A;  3ZIM A;  3AEC B;  2DZJ A;  2LAS A;  3V62 A;  1I7A A;  1SJH D;  2KC1 A;  3IT4 B;  3NZ3 A;  2NS5 A;  5LG4 B;  2K22 A;  2AYO B;  4WIP A;  2FJ9 A;  1OQN A;  2PLP A;  1XD4 A;  3TMP B;  1QQG A;  1WRI A;  2L83 A;  4ANX A;  3F5R A;  2V4L A;  3UQB A;  3W1S C;  1MHH E;  3OWE B;  1HZ5 A;  4DHJ B;  2KDB A;  3FSS A;  2JP2 A;  1ET9 A;  1HBK A;  2PEA A;  1FFV A;  1D5X C;  5EE0 A;  3TUO A;  1V80 A;  3DBL I;  1YNT E;  5T8I A;  2DA0 A;  3QCA A;  2BBC A;  3Q3M C;  4LCD E;  3DXC A;  1XQQ A;  2J52 A;  2JPH A;  3OJ3 A;  3PT2 B;  2KIE A;  1QOG A;  1DBH A;  2Q5W D;  2GS0 A;  2KDF B;  3DWG C;  1IRS A;  3PGE A;  2KCJ A;  2X0S A;  1T6B X;  5LLI A;  1JWU D;  4FLH A;  2LVQ A;  5JHA A;  2GCL A;  1WR1 A;  1NU2 A;  4B9K A;  4WJO A;  1Q10 A;  1VZ8 A;  2PJH A;  1WXS A;  3VH3 B;  1TKY A;  4WQM A;  3VH4 B;  4ZHP A;  3QAR A;  1WGH A;  3NVY A;  1C4C A;  4MJS A;  1N60 A;  4NJ6 A;  1UPQ A;  2KWD A;  3MP9 A;  4FXC A;  1ZGU B;  4BOZ B;  4DDI D;  5DIF B;  3WA0 A;  2KVR A;  2LRW A;  3PVL A;  3FIL A;  2ACZ B;  3L08 A;  3AJ4 A;  4EOY A;  2Q13 A;  5JHH A;  1DGJ A;  2KAN A;  2WXP A;  3BZD B;  3DOW A;  5KHQ A;  3ZXR A;  2CKH B;  3DQV A;  3V3X A;  1I7H A;  2WXN A;  4WUR A;  2IGD A;  3EA6 A;  1MPE A;  1I4X A;  4A9A A;  4TMA B;  1GJZ A;  1KLG D;  5J2R A;  4TV3 A;  2WXM A;  2EKE C;  4KGS A;  2E6X A;  2MA9 B;  3JVZ X;  2R2O A;  4DQO C;  3DXE A;  3TFM A;  1P3Q U;  2PVG C;  1C77 A;  1OMW A;  1FRR A;  2VH1 A;  3VAW A;  4FA6 A;  4OSN A;  2LUL A;  5KCV A;  1YX5 B;  5EE9 A;  4GZU A;  3RN9 C;  3RNC C;  2KDE B;  3EFC A;  1D4B A;  1UF0 A;  2RR9 A;  3OAN A;  5I2M A;  3JSV B;  1X05 A;  2WU5 B;  1ESF A;  1YJJ A;  4LNK A;  1XLO A;  2G4S A;  2NBU A;  3L4P A;  4G11 A;  2L1A A;  4K81 A;  2PVO D;  3V60 A;  3HW2 B;  3R66 C;  2X38 A;  4C7Y A;  1GC7 A;  3D8F A;  2IZV B;  1RFK A;  1ZYI A;  3ZW3 A;  3DHI C;  2CHZ A;  1CK1 A;  3TJP A;  4GDK B;  3PPA A;  1BTK A;  2AX5 A;  3DWM A;  2FCS A;  2J7Q B;  3KWV A;  5AUI A;  4LJP B;  3B2G A;  1YN3 A;  4TUU A;  4B6W A;  2DN6 A;  4XWW A;  3T3N A;  5GOW B;  3QAQ A;  4YWG G;  1LO5 D;  3O96 A;  1E8X A;  1TKG A;  1NYR A;  3AE7 B;  1UBI A;  2OOB B;  5E6O A;  2DAJ A;  3X23 A;  1R4N I;  4HKZ E;  3RD2 A;  1U5F A;  1MPH A;  5AZF A;  2XNA C;  2M17 A;  4HAU B;  2P0H A;  2RRF A;  1ACC A;  3UQA A;  1WI0 A;  3M62 B;  4LTU A;  4W9C A;  1AW7 A;  4ANW A;  1IYF A;  1XT9 B;  1VZ6 A;  3U7Z A;  2ZVN A;  3QK0 A;  4GU2 A;  4IUM B;  1ET6 A;  3J9C A;  4WWO A;  1YMH E;  2KGX B;  1GG3 A;  4YL8 A;  3A4S C;  2SAK A;  1GB1 A;  3KW5 B;  5C23 A;  3LDZ E;  4JKA A;  4D6W A;  4OVZ A;  1L4D B;  2UWQ A;  2ABD A;  4NAW A;  5C5B B;  2Y3A A;  4MSQ B;  4RGM A;  2ZW1 A;  4W9I A;  4C80 A;  3L13 A;  1CQV A;  3WAP A;  2DEN B;  4BKS A;  3Q8C A;  2J42 A;  4LNN A;  1V97 A;  4W9K A;  3ENE A;  2RGN B;  1KZ7 A;  4CHK A;  2BWF A;  1FHO A;  1ZM0 A;  1AAR A;  4F7Z A;  4BKG A;  4WJP A;  1BML C;  2FUH B;  4RGO S;  3DHG C;  1XKE A;  5JHG A;  2YEP B;  3B77 A;  2Z0O A;  4YSX B;  3P63 A;  3QC8 B;  2MHJ A;  1I2H A;  4B0M A;  1D5Z C;  2VZK B;  1V88 A;  3KYD D;  3PRM B;  4OZA A;  3NS1 A;  1NBF C;  3ZRC A;  2MX2 A;  3EC8 A;  4MEL A;  2I38 A;  3M63 B;  3BVG A;  1KJT A;  1CJE A;  4Y94 A;  3ZNH B;  4C4V A;  1GGO A;  1EWY C;  3GYO A;  2H88 B;  4HLE A;  1P9D U;  2CY5 A;  1HB8 A;  1T77 A;  3PZ8 A;  2W2W A;  5FI1 A;  3RNB C;  2QSD A;  2MJE A;  2D2Q A;  1PLS A;  4BKT A;  2NBV A;  1XCT L;  3MC8 A;  4OT1 A;  3TEZ A;  1WI1 A;  4WWN A;  2Y7B A;  2LXA A;  1EF5 A;  2LUM A;  1PDX A;  2LHD A;  2DKQ A;  4PYU A;  3DBR I;  2ZNV C;  5D3D A;  3ZJU A;  1TS5 A;  2CB8 A;  2NPT A;  3A1Q B;  2I2Y A;  3R2I A;  3LJ3 A;  3Q3O C;  3AU5 A;  3ZTC A;  4EZK A;  2WGS A;  3RZW C;  5MPO A;  4HDQ A;  3NY5 A;  4JQW C;  4GN1 A;  1DDV A;  2DLB A;  4JKD A;  4A6F B;  4EEW A;  3KUC B;  2K39 A;  5IN7 A;  1WMH B;  3DBS A;  3URY A;  1FHW A;  4IFS A;  3W5V B;  4CHM A;  4KHO A;  1Y56 A;  2KWV B;  2DZK A;  3AE5 B;  3TIX A;  5EE1 A;  4RF1 A;  1L6U A;  1BTN A;  2K1F A;  5JXV A;  3RZF A;  3WCQ A;  1IGD A;  2CY4 A;  4II3 B;  2LGS A;  3ZQ4 A;  4A3P A;  3P4R B;  4OW0 A;  3KYC D;  3NOB A;  2KMC A;  2XBB C;  4GLS C;  1WH3 A;  2INN E;  1WM3 A;  5IAA C;  1J7C A;  1X11 A;  4NQK E;  2N9L A;  3Q8F A;  3I5J C;  2FIF A;  2WXL A;  2ELA A;  2VZK D;  4JPS A;  4HPL B;  2W82 A;  4BBN C;  1I4H A;  1B55 A;  1F77 A;  2KLC A;  3R7Q A;  2KOX A;  1T0S C;  3QWZ B;  4HEA 1;  4AJY B;  3NVV A;  2K2U A;  1RWS A;  2JSV X;  2O6V B;  3V05 A;  2IYD B;  4W9E A;  3VHT C;  2W3S A;  3T8M A;  1D5M C;  1WIA A;  4S17 A;  2RDH A;  3FC4 A;  4DHZ B;  1F52 A;  4P1C C;  4WWM A;  1WXQ A;  5DPW A;  1UEF A; 
#chains in the Genus database with same CATH homology
 2N1V A;  3BY4 B;  4GIV A;  1WY8 A;  1L7Y A;  2WYQ A;  1EAZ A;  1TTN A;  4MGK E;  5CHW A;  2A4Z A;  1FB8 A;  4M8N A;  2PE9 A;  2N9X A;  4W9G A;  1ZW7 A;  2IO1 B;  5E6P A;  1P5T A;  3F0W A;  2D9Y A;  4WWP A;  3ODO A;  2CR5 A;  1Z2M A;  2JXX A;  4DDG D;  3N32 A;  1FGY A;  1Y8R C;  3CST A;  5FR6 A;  1YX6 B;  1ISN A;  3PEG A;  2MFQ A;  3MDB C;  2H7D A;  2LJ5 A;  1WJM A;  1R4M I;  2DYB A;  5J17 A;  4F1S A;  4EMO A;  4DBG A;  1BT0 A;  2J0K A;  2M4N A;  1W1G A;  4RM8 A;  3OLM D;  1MKE A;  3K9P B;  1T0Y A;  2UZR A;  3D8E A;  2KWU B;  1YD8 U;  2FCQ A;  2D07 B;  2IY1 B;  4G3X B;  2Y8G A;  2KQ7 A;  1E7U A;  5JH5 C;  1XCG A;  4IG7 B;  3TL5 A;  3VQI A;  4L6E A;  3PP2 A;  3P7Z A;  4JK8 A;  4KDI C;  4JKB A;  3U7D A;  4W9J A;  2NCN A;  2L0F A;  3NZS A;  4F7U P;  3D32 A;  2V76 A;  2KN5 A;  1ZSQ A;  4CYE A;  2N9P C;  3ZDM C;  4TQ0 A;  3NHE B;  3V6C B;  3WAN A;  4DXA B;  5D27 A;  5JVL A;  2LI5 A;  4IC7 B;  4JK9 A;  2DFK A;  3RT3 B;  1WR6 E;  4MK0 A;  2BYF A;  2R2Q A;  2MWS B;  2JZ3 B;  3N7C A;  1BAK A;  2MCN B;  2ROV A;  1GC6 A;  1MK7 B;  4JKC A;  3SYX A;  4KSL C;  4ANV A;  3TO1 A;  4RMA A;  2LD9 A;  2KKC A;  3C0R B;  1V5O A;  3Q3J A;  4ZRI A;  1J0G A;  4BBN F;  5AEK B;  2RQ1 A;  2LGY A;  5C5B A;  5DHA B;  5IA7 A;  5DI9 B;  1ACA A;  3ZRF A;  4WJQ A;  2MBO A;  1ZC4 B;  4A3O A;  4HAT B;  2G35 A;  2C7N B;  1X1F A;  3TVV A;  5J3Q A;  1U4A A;  1FXT B;  2RD0 A;  2D3G A;  1E8Z A;  1BWN A;  4KHB B;  2ZPN A;  1U27 A;  3ZNZ B;  3EPY A;  2J0J A;  2BCJ A;  2C60 A;  4K7U A;  2N7E A;  2EMS A;  3FEH A;  2FCM A;  3KRX A;  2D9X A;  1E90 A;  3P6A A;  2JRI B;  2IYB A;  4NSW A;  4NJ7 A;  2MLB A;  4MGI E;  5CX3 A;  1J0W A;  4FBJ B;  1RRP B;  2C7M B;  4IM3 A;  5D6J B;  2YF0 A;  4W9H A;  3VXW A;  4ZDV A;  3T06 A;  3VTW A;  3MPX A;  4GDK A;  1Y19 B;  3K9O B;  2MBE A;  3ZVV A;  4MH0 E;  4EZJ A;  5C1Z A;  1EVH A;  3AU4 A;  4WSF A;  1ZC3 B;  3QBV B;  5DPS A;  4AUQ C;  2IO0 B;  3VTU A;  3V61 A;  2DYM A;  4IW0 A;  4FHK A;  2COD A;  3R3M A;  1WXM A;  1DIK A;  4HCP B;  1TJ6 A;  2M1M A;  4MSM B;  3IG3 A;  5AZH A;  1UNP A;  1W1D A;  1MG8 A;  1SIF A;  2AL3 A;  1U5G A;  3ZTD A;  2IO2 B;  2YS3 A;  3APD A;  3IHP C;  3L54 A;  4FJV B;  1TZ1 A;  2Z0Q A;  2N1W A;  2RGF A;  4OVV A;  5DCN A;  3KZ1 A;  3ODW A;  5KQ1 A;  3KH0 A;  3PVU A;  3WAO A;  4HAZ B;  5L83 A;  2GBR A;  1P3R A;  2WH5 A;  3IFW B;  1VBG A;  2YS1 A;  4IM2 A;  3HIZ A;  3U30 A;  3PRZ A;  3GYP A;  1JDE A;  5JZE B;  1V2Y A;  3P2B A;  3A9K A;  2DHZ A;  2KXJ A;  4TKN A;  4KIK B;  3OAW A;  1LW3 A;  1KZG A;  1ST7 A;  1DDM A;  2QKL A;  2DYO A;  5LXI B;  4AOF A;  1UEL A;  4K17 A;  1S3S G;  1V81 A;  3A9J A;  3ZDT A;  5LXH A;  3ONS A;  2W2X D;  2YLM A;  4H8S A;  1OGW A;  3KUZ A;  5JLJ B;  5KHO A;  2M14 A;  3ML9 A;  2N4F A;  1CMX B;  2LBB A;  3WIM A;  1XD3 B;  4PS3 A;  3HHM A;  1TXD A;  2NPT B;  3PSE B;  1HB6 A;  1V5T A;  1UH6 A;  4GPT B;  2D10 A;  3B0A A;  4GMX B;  1K5D B;  4A6F A;  1MK9 B;  2OTX A;  4OVU A;  1NI2 A;  2RPQ A;  5EDS A;  1Q1O A;  1WF9 A;  3HM3 A;  2DZM A;  4PQ0 A;  1WGQ A;  4NQL B;  1U5D A;  1WE7 A;  1WX7 A;  2K00 A;  2NMB A;  2X18 A;  4BFR A;  1M94 A;  2YT0 A;  3L10 B;  3FLV A;  2K6Q A;  4JKF A;  2HJ8 A;  1D3Z A;  4AP4 C;  5HE1 A;  1ZVR A;  2FNJ B;  2YRY A;  2FJL A;  5IJM A;  2FID A;  3M1I B;  2KQS A;  2KC2 A;  1YJ1 A;  1Z5S B;  3APC A;  4E71 A;  1LXD A;  5D94 A;  3CF6 E;  5KQ4 A;  3O65 B;  3QA8 A;  1NDD A;  2KJR A;  1XX0 A;  1U5E A;  3DVG X;  2LOX A;  4TYZ A;  1ZKH A;  3GZN I;  4LJO B;  4HCN B;  2YS5 A;  1WFY A;  3H6N A;  3A33 B;  3DVG Y;  4JLC A;  3CXB B;  3U8Z A;  2DYQ A;  2R0D A;  2KFJ A;  2ROZ B;  3B08 A;  1RFA A;  1RAX A;  4JGH B;  1V9J A;  3DDC B;  3H7P B;  1Q5W B;  5LON B;  1WX8 A;  1OEY A;  2IO3 B;  2CHX A;  4GDL B;  2Y5B B;  2XK5 A;  4I6L B;  4AWJ A;  2IBI B;  4EUT A;  2I1K A;  3PLU A;  5CHV C;  3VUW A;  4JKG A;  3QWM A;  4M0W B;  4EZL A;  1VD2 A;  3H7S A;  4CHJ A;  4BOS C;  2H7E A;  4HB4 B;  1E7V A;  2OQB A;  1J19 A;  4BKS D;  1KBL A;  4K2P A;  3V5W A;  2JF5 A;  1E5W A;  1DYN A;  4IM0 A;  3Q3F A;  4KV2 A;  2VRW B;  2WDT B;  1VCB A;  1KLV A;  1MAI A;  1VBH A;  4WJN A;  5J3T A;  1JRU A;  2DIK A;  1KC7 A;  1AWE A;  1SHC A;  1FHX A;  2NZ8 B;  1WJN A;  3JSV A;  1DDW A;  2BKF A;  2ZEQ A;  2W2X C;  1UZX B;  4NPN A;  1I35 A;  2AWT A;  3EFU A;  4HVB A;  2RVB B;  1NVL A;  3W1S A;  1YIW A;  2K8H A;  2MWN B;  4GOC A;  1FAO A;  2BPS A;  3ECI A;  2RLO A;  2COC A;  2Z59 B;  3VOQ A;  2KFK B;  1C3T A;  2MP2 A;  2ZPY A;  2BYE A;  2MBH A;  3PRP B;  2L8J A;  1UBQ A;  5DPW A;  4B95 A;  2UVM A;  1WG7 A;  2MRP A;  4KSK C;  2JT4 B;  4ILJ A;  1WJ6 A;  4DK5 A;  2D11 A;  3N30 A;  4PS8 A;  4HAW B;  3ENB A;  4HB0 B;  3UGB B;  2AL6 A;  2CRF A;  5BO4 B;  3LJU X;  4K7W A;  3GOE A;  2GCJ A;  1H10 A;  2KHW B;  2Z0P A;  2GBJ A;  1WJU A;  2MDX A;  1OTR B;  2O6V D;  3KVF B;  5JP4 A;  1UPR A;  3ALB A;  5CTR C;  3TCA A;  1K5G B;  1KOT A;  2LGD A;  3JW0 X;  2DTC A;  4G50 A;  3VFK A;  1KI1 B;  1P98 A;  2LVP A;  4MGY E;  4KZC A;  4JL9 A;  2K25 A;  2ZCC A;  2I1J A;  2KX3 A;  2D9V A;  3UIO B;  4HB3 B;  5DPT A;  2LYD A;  3G9W A;  3NSU A;  4DX9 0;  2NBV B;  4ILH A;  2I5C A;  2LUE A;  3RYT A;  5J3Y A;  4MJS B;  3QX1 A;  2HTH B;  5L81 A;  1HE8 A;  4ZYN A;  4JIO U;  1I42 A;  2K8B A;  4MGZ E;  4YON A;  1V49 A;  2DKP A;  3A1Q A;  2UYZ B;  3VTV A;  4HXD A;  2PZ1 A;  2XEW A;  3CMM B;  2VRR B;  4W9F A;  4I6N B;  4FHJ A;  4XC2 A;  2LG1 A;  5CLL B;  4JKH A;  4AJW A;  2YSZ A;  4GSW A;  4A6K A;  2YT1 A;  2COP A;  3T9L A;  5D3Y A;  3MTN B;  2FCN A;  3SBT A;  5DPR A;  4HAX B;  3SO6 A;  2OJR A;  3M95 A;  1WVH A;  5EFX A;  4IWO A;  2J0M A;  4DHJ D;  5AZG A;  3QJZ A;  2L0T A;  3VIA A;  3DCG A;  2RNR B;  2MBQ A;  4N9F 4;  2EMT A;  5DH9 B;  4JK7 A;  2L1C A;  3A9K B;  4PNK A;  4KIK A;  2AEH A;  4HB2 B;  5JHB A;  4DBB A;  3VUX A;  3APF A;  4MT7 A;  3UIN B;  4GB9 A;  4WVF B;  3ZNI D;  3DXD A;  5C6R A;  3V6E B;  4X57 B;  2KZR A;  3L16 A;  3ZNG C;  2DHJ A;  3IBE A;  4TQ1 A;  3M3J A;  4ILG B;  1PFJ A;  3X0W A;  1WGY A;  1QZE A;  2Z0D B;  1UGM A;  4XX5 A;  2DX5 A;  4HHV A;  4NAW B;  2LRU A;  1LB1 A;  2JVC A;  1WGG A;  1RJ2 A;  1MIZ B;  2IY0 B;  3PS6 A;  2XQN M;  3JYU A;  2KK8 A;  1S1Q B;  2L00 B;  3WAL A;  2ZZP B;  1X1M A;  1NTY A;  2BF8 B;  4DWF A;  5HKH A;  1LQB A;  1X1G A;  3HK0 A;  4FUL A;  4NY0 A;  4LDT B;  4K7S A;  3IVF A;  1F9J A;  1V6E A;  1V5M A;  2VSZ A;  4WQO B;  2HD5 B;  3ZKJ C;  3PV1 A;  1EGX A;  5G55 A;  2RSU A;  3S2A A;  2DX1 A;  2N23 A;  2EJ8 A;  5TR5 A;  2DLW A;  3PRE A;  3AUL A;  2M8S A;  1E8W A;  5E6N A;  2IFS A;  4Z2N A;  3ZUN A;  4PYZ A;  2HE7 A;  2RUK B;  1YQB A;  2O2V A;  4MM3 A;  4IWP A;  2KWC A;  2QHO A;  2LOZ A;  3E9L A;  3BJI A;  1E8Y A;  1WMH A;  3KY9 A;  2KMA A;  2V1Y A;  5HE0 A;  3ZO5 B;  3QHT A;  3RCP A;  2HTH A;  2PPH A;  1WJ1 A;  2D9W A;  4II2 B;  5CHF A;  1N3H A;  4HPM B;  2C9W B;  1WXV A;  1W1H A;  3H7P A;  3UF8 A;  2QKM A;  3R7R A;  2MQJ A;  4HAY B;  3E9O A;  2GBM A;  2MBB B;  2KTR A;  1RLF A;  2BYV E;  2D9Z A;  4A20 A;  2REX A;  1Y5O A;  3ODX A;  2NBW B;  1DRO A;  5D3W A;  1GNU A;  1V86 A;  2CAY A;  2L76 A;  1V5P A;  1V89 A;  2G3Q B;  1QC6 A;  4EFO A;  2L2I A;  1FOE A;  4DX8 A;  3I3T B;  3VUY A;  3HQC A;  1KM7 A;  1RRB A;  2BWE S;  2L3Z A;  2WWZ A;  3PVW A;  3NZU A;  4RM9 A;  4W9L A;  3ZVR A;  1SE9 A;  2O2V B;  3ZLZ A;  2DYN A;  1WE6 A;  5D2M B;  3ML8 A;  4EKU A;  3VDZ A;  2P0F A;  1WXA A;  3WYF B;  3UZT A;  5HE3 A;  2N9E B;  1Q67 A;  4A5K A;  3VVW B;  3PHW B;  2ZJD A;  2DAF A;  3KRW A;  3EHV A;  1XR0 B;  4HWI B;  2VKI A;  2ELB A;  2JUO A;  1G6J A;  2K2J A;  2LWP A;  3OJ4 B;  3HM6 X;  1C1Y B;  5FI0 A;  4JKE A;  2KX0 A;  1WRD B;  1WX9 A;  1MIX A;  2CHW A;  2KO3 A;  4IAP A;  2P0D A;  1V61 A;  1WGD A;  2KD0 A;  2R09 A;  2LXC A;  2WX1 A;  1L2N A;  2MKR A;  3AI5 A;  2GBN A;  4MY6 A;  4XZ4 A;  3TW1 A;  4IOY X;  2GOW A;  3FP5 A;  5L95 C;  4KZ0 A;  4MEM A;  2YVC A;  1WZ3 A;  3PHX B;  3TBL D;  3RCZ A;  2C7H A;  2ASQ A;  4PS7 A;  3MHS D;  2P8V A;  3SU8 X;  2LGX A;  2COA A;  5G2N A;  1K8R B;  1U29 A;  4E3C A;  4B6H A;  1WYW B;  4IWQ A;  2M0X A;  2W9N A;  4GXB A;  3ULC A;  5C16 A;  2COF A;  3E9P A;  1X86 A;  2XK5 B;  3SDL C;  3PG7 A;  4HK2 A;  3SNH A;  2G45 B;  1M7E A;  4JKG B;  2KJH B;  2UZS A;  4NNJ B;  3KUD B;  3SV1 A;  3RUI B;  1OEY J;  3FM8 C;  2R82 A;  2N7D A;  4BBK A;  4MDK E;  2L05 A;  3SD5 A;  1WM2 A;  5D3X A;  4FAD A;  1UNR A;  4P7I A;  2GMI C;  2GJY A;  1LFD A;  4XWX A;  3DPD A;  2RSG A;  4DHZ E;  5GMV A;  1UNQ A;  5D7G A;  2NR2 A;  2BKR B;  2FDQ A;  4HAV B;  1NTV A;  2KTR B;  1WGU A;  5LOP B;  2J59 M;  4C0A A;  5CLQ B;  2K6D B;  2Y8F A;  4ICU A;  3RUL A;  3A8Q A;  2WX0 A;  2ZCB A;  2KLG A;  2DHK A;  4ZRK A;  1Q0W B;  4A6H A;  2MW5 A;  5C79 A;  3WAM A;  1PMS A;  2ADZ A;  2KUP A;  1P0R A;  2NVU I;  1IP9 A;  2CU1 A;  4M8M A;  2B3A A;  1FGZ A;  1TQZ A;  1SGH A;  2DHI A;  1UD7 A;  4K1R B;  4URK A;  3EEC A;  3MJW A;  2M38 A;  2ZVO A;  1M7R A;  4FJZ A;  4WAA A;  2EC1 A;  4ZRJ A;  4EJN A;  3A98 B;  3BIN A;  4E74 A;  2FAZ A;  1AQC A;  2L7R A;  4KDL B;  2Z0E B;  3ULB A;  1IPG A;  3QIJ A;  4I6P A;  3A8P A;  2BGF A;  1TBE A;  2CQU A;  4GMV A;  4K2O A;  3CSF A;  3DVN V;  3QQ8 B;  1LM8 B;  4HJK A;  2KNB A;  4D0N B;  1WJ4 A;  2I5F A;  1H8C A;  4F8C B;  1P6S A;  3SUZ A;  4GDL A;  4G0N B;  4FJY A;  1U2B A;  2KTF A;  3UIP B;  4BVU C;  3KSY A;  3L17 A;  3E66 A;  3B1L X;  4F7G A;  3SHQ A;  2K8C A;  2D4Q A;  3PZD A;  2O6V A;  3H1U A;  1XOD A;  1A5R A;  5DHF B;  2LVO A;  2ZNV B;  2JWZ A;  2JRH A;  3A9J B;  1WZ0 A;  1NTI A;  3D8D A;  1TGZ B;  4CO7 A;  5J18 A;  1PQS A;  2N0Y A;  3PSC A;  1WGR A;  2DZI A;  2A5U A;  4LDT D;  4KHA A;  3PLV A;  3DVN U;  2C5L C;  2CS4 A;  1V5U A;  2JZZ A;  2KDI A;  2PE6 B;  3NS8 A;  2KJ6 A;  3H9D A;  2HRJ A;  2E2X A;  3PTF C;  2GBK A;  4ICV A;  4FN2 A;  2G4D B;  4KVG B;  4Z2M B;  4F7H A;  4KAX B;  2KFK A;  4J6I A;  2LKO A;  2LZ6 A;  2MP2 B;  3N3K B;  3DBH I;  1Z87 A;  3L0W B;  4GGQ A;  1EF1 A;  5D3V A;  4WJ7 A;  5HE2 A;  1P1A A;  3ML4 A;  1GUA B;  1OY2 A;  1OQY A;  2MSE D;  1EO6 A;  3CIK A;  2DX5 B;  2V3S A;  3W1Y A;  4W9D A;  1EUV B;  3SBG A;  4HDO A;  4ASW C;  3AXC A;  2JY6 A;  3A4R A;  1H4R A;  3ZIM A;  2DZJ A;  2LAS A;  3V62 A;  1I7A A;  2KC1 A;  2NS5 A;  2AYO B;  2FJ9 A;  1OQN A;  1XD4 A;  3TMP B;  1QQG A;  4ANX A;  3F5R A;  2V4L A;  3UQB A;  3W1S C;  4DHJ B;  2KDB A;  3FSS A;  2JP2 A;  1HBK A;  2PEA A;  1V80 A;  3DBL I;  2DA0 A;  3QCA A;  4LCD E;  3DXC A;  1XQQ A;  2JPH A;  3OJ3 A;  3PT2 B;  1DBH A;  2GS0 A;  2KDF B;  1IRS A;  3PGE A;  2KCJ A;  2X0S A;  5LLI A;  4FLH A;  2LVQ A;  5JHA A;  2GCL A;  1WR1 A;  1NU2 A;  4B9K A;  4WJO A;  2PJH A;  1WXS A;  3VH3 B;  3VH4 B;  3QAR A;  1WGH A;  4MJS A;  4NJ6 A;  1UPQ A;  1ZGU B;  4BOZ B;  4DDI D;  5DIF B;  3WA0 A;  2KVR A;  2LRW A;  3PVL A;  3L08 A;  3AJ4 A;  4EOY A;  2Q13 A;  5JHH A;  2KAN A;  3DOW A;  5KHQ A;  2CKH B;  3DQV A;  1GJZ A;  5J2R A;  4TV3 A;  2EKE C;  2MA9 B;  3JVZ X;  2R2O A;  3DXE A;  3TFM A;  1P3Q U;  1OMW A;  4FA6 A;  3VAW A;  2LUL A;  5KCV A;  1YX5 B;  4GZU A;  2KDE B;  2RR9 A;  3OAN A;  3JSV B;  1X05 A;  2G4S A;  2NBU A;  4G11 A;  4K81 A;  3V60 A;  3HW2 B;  3R66 C;  1GC7 A;  3D8F A;  2IZV B;  3ZW3 A;  2CHZ A;  3TJP A;  4GDK B;  3PPA A;  1BTK A;  2FCS A;  2J7Q B;  4LJP B;  4TUU A;  4B6W A;  2DN6 A;  5GOW B;  3QAQ A;  3O96 A;  1E8X A;  1UBI A;  2OOB B;  5E6O A;  2DAJ A;  3X23 A;  1R4N I;  3RD2 A;  1U5F A;  1MPH A;  5AZF A;  2M17 A;  4HAU B;  2P0H A;  3UQA A;  1WI0 A;  3M62 B;  4W9C A;  4ANW A;  1IYF A;  1XT9 B;  2ZVN A;  3QK0 A;  4GU2 A;  4IUM B;  4WWO A;  2KGX B;  1GG3 A;  4YL8 A;  3A4S C;  3KW5 B;  5C23 A;  3LDZ E;  4JKA A;  2UWQ A;  2ABD A;  4NAW A;  5C5B B;  4MSQ B;  4W9I A;  3L13 A;  3WAP A;  2DEN B;  4BKS A;  4W9K A;  3ENE A;  2RGN B;  1KZ7 A;  4CHK A;  2BWF A;  1FHO A;  1ZM0 A;  1AAR A;  4F7Z A;  4BKG A;  4WJP A;  2FUH B;  1XKE A;  5JHG A;  2Z0O A;  3QC8 B;  1I2H A;  1V88 A;  3KYD D;  3PRM B;  1NBF C;  3ZRC A;  2MX2 A;  3EC8 A;  4MEL A;  3M63 B;  1KJT A;  4Y94 A;  3ZNH B;  1GGO A;  3GYO A;  4HLE A;  1P9D U;  2CY5 A;  1HB8 A;  2W2W A;  5FI1 A;  2D2Q A;  1PLS A;  4BKT A;  1WI1 A;  4WWN A;  2Y7B A;  2LXA A;  1EF5 A;  2DKQ A;  4PYU A;  3DBR I;  2ZNV C;  2CB8 A;  2NPT A;  3A1Q B;  3LJ3 A;  3AU5 A;  3ZTC A;  4EZK A;  3RZW C;  4JQW C;  4HDQ A;  3NY5 A;  4GN1 A;  1DDV A;  4EEW A;  4JKD A;  4A6F B;  3KUC B;  2K39 A;  1WMH B;  3DBS A;  1FHW A;  4IFS A;  4CHM A;  4KHO A;  2KWV B;  2DZK A;  3TIX A;  1BTN A;  2K1F A;  3RZF A;  2CY4 A;  4II3 B;  4A3P A;  3KYC D;  3NOB A;  2KMC A;  2XBB C;  1WH3 A;  1WM3 A;  5IAA C;  1X11 A;  4NQK E;  2FIF A;  2ELA A;  4HPL B;  4BBN C;  1B55 A;  2KLC A;  3R7Q A;  2KOX A;  3QWZ B;  4AJY B;  2K2U A;  2O6V B;  2IYD B;  4W9E A;  3VHT C;  3T8M A;  1WIA A;  4DHZ B;  4ANU A;  1J8C A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...