3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Merlin
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
5D7GA 2DYOA 1YD8U 1ZC3B 1M7RA 3NOBA 1OQNA 2KX3A 3N32A 4CYEA 3AU4A 1WZ3A 2PEAA 5JZEB 2Y8FA 1BTNA 5TR5A 1X1FA 5DI9B 1C3TA 1IP9A 1XD4A 1TZ1A 2NR2A 2WWZA 2LWPA 2EMSA 3OJ4B 1OMWA 4ZYNA 2NBUA 3WAOA 3R7RA 1I35A 3LJ3A 3P7ZA 2LRWA 3B0AA 1QZEA 1MIZB 3PEGA 2I5FA 1X86A 2P0FA 2LOZA 3M1IB 1V86A 1WXMA 3B08A 5CTRC 3QWMA 4M8MA 2CU1A 4ASWC 2NMBA 2V3SA 3IG3A 1LB1A 3UGBB 4X57B 2LI5A 3HW2B 1BAKA 3ONSA 4KDLB 1V9JA 1UNRA 1IYFA 2MBEA 3BJIA 5CX3A 3V6EB 1VD2A 3ZRFA 3VTVA 5LXIB 3QAQA 1D3ZA 3AXCA 1GC6A 2V1YA 3H6NA 4HK2A 3NSUA 4W9FA 3A8PA 5KHOA 2IY1B 1KI1B 1U29A 4ZRIA 3FLVA 2YS3A 2ZZPB 2JF5A 2LGYA 3H9DA 3X23A 4GGQA 5CLLB 2CHZA 2IO2B 1WH3A 3GOEA 2C5LC 4DHJB 3CMMB 2C7NB 1V5TA 3KVFB 3PT2B 4AWJA 2D2QA 3RD2A 4DXAB 3KY9A 2IYBA 2DHKA 4DBGA 4YONA 2DZJA 3OANA 4HATB 2YLMA 5JP4A 3OJ3A 4IM0A 2BWFA 2LVOA 2DHIA 2D9XA 3SUZA 2KDFB 2IO0B 2YVCA 3EPYA 4NAWA 2QKMA 5J3TA 1YQBA 2L00B 1R4NI 1I42A 1WR6E 1OTRB 3QJZA 3I3TB 2KWCA 4HJKA 1EVHA 2ZVNA 2YS5A 3A9KA 1EUVB 3HK0A 1OQYA 4PS3A 5AZGA 2Z59B 5BO4B 3BINA 2IO1B 2D9VA 3AI5A 5EFXA 2XK5A 4KZCA 4GMVA 1E90A 2KDBA 5G55A 1WJ4A 2I1KA 4HAYB 1P98A 4A6FB 2N1VA 3DVGY 2W2WA 3H7SA 3M63B 1HE8A 4K7SA 1Q0WB 2LOXA 3RYTA 2P0HA 3A9JA 4HDOA 1V5UA 5D94A 3S2AA 4E71A 1I7AA 2RGNB 2JPHA 2LJ5A 1S1QB 4PS7A 3CXBB 3F5RA 1X1MA 3AULA 4DHZB 3WYFB 1ZM0A 1DDVA 2DENB 1V5PA 2COFA 1XKEA 2UWQA 1UNQA 4B9KA 2J0JA 2DX5B 4MSMB 1WX8A 4K7WA 2K2UA 3VXWA 4EEWA 2QKLA 2KMCA 3TJPA 3ZKJC 1WJMA 3ML9A 3A98B 1WF9A 3UF8A 4EZKA 2ELBA 3X0WA 3FEHA 1KM7A 4FJVB 5IA7A 3G9WA 1UZXB 2FNJB 4W9EA 4ZDVA 3EFUA 2L1CA 5JH5C 2N0YA 1DYNA 4E3CA 1HBKA 4L6EA 1V80A 2V4LA 1WYWB 2N4FA 2Y7BA 2ZJDA 3N30A 2G45B 2O6VB 3ZO5B 1E5WA 1P6SA 4B6HA 2NVUI 4GU2A 2KLGA 5C5BA 1TGZB 4MK0A 2RNRB 5AEKB 5DPWA 1R4MI 2M0XA 2FCQA 4LDTD 4NJ7A 4WJNA 1LFDA 2N23A 1NTVA 1KJTA 4RM9A 1U5EA 5CLQB 2MQJA 3UIPB 2B3AA 2KFKA 4JLCA 3DBRI 1MIXA 2L0TA 3VVWB 1G6JA 1RAXA 3PSCA 4FHJA 1B55A 1NTYA 2EJ8A 2OQBA 4HB4B 2NS5A 3DVNV 4XZ4A 2P0DA 4WWOA 3RUIB 3SYXA 2KC2A 4BOSC 2ROVA 1KLVA 1WI0A 3ZW3A 4MGZE 1NU2A 1WXVA 2K6QA 4WJQA 2O6VA 3JW0X 2NZ8B 3RZWC 4ANUA 4DK5A 1FHOA 1KOTA 2GBJA 1UPQA 1P0RA 2JXXA 2UZSA 4KIKA 4KVGB 2VRRB 2LUEA 1OEYJ 3QIJA 4IM3A 1HB6A 3NZSA 3PP2A 1MK7B 1E8WA 2JUOA 3TW1A 5JLJB 1H10A 1UNPA 2RLOA 2UVMA 2UZRA 2M17A 3A9KB 1P3RA 3K9PB 4MEMA 3DDCB 4RM8A 2KANA 4A20A 2XK5B 5E6OA 5JHGA 4HHVA 5LXHA 1RFAA 2NBVB 2RR9A 1H8CA 3HQCA 3L54A 3ZRCA 3V61A 4N9F4 2PE9A 3T9LA 3IFWB 3VH4B 3QQ8B 3PZDA 1GUAB 3PLVA 1OY2A 2BF8B 2MBQA 2RSGA 4HCPB 2GOWA 4HVBA 1V89A 5L81A 1UELA 3TIXA 2L3ZA 4W9KA 4EZJA 3UQBA 3R66C 4IW0A 2Y5BB 3U7DA 2LG1A 2CB8A 3PG7A 2KXJA 2EC1A 4G50A 4W9JA 2LGXA 3JVZX 4NPNA 2DKQA 1OEYA 2LBBA 3TMPB 1NTIA 2NBWB 2CODA 1U2BA 3L10B 4HWIB 1V61A 4BBNF 1ZGUB 2REXA 1J0WA 3DCGA 5KCVA 4WSFA 5D3YA 1YX5B 3KUDB 1WJNA 3FSSA 5JHHA 2C7MB 2H7DA 1PLSA 4GIVA 4G3XB 3AJ4A 4HPMB 2NPTA 1AWEA 1WM3A 1VCBA 2BWES 2GCJA 3H7PA 4FHKA 1W1HA 2HTHB 2QHOA 1FHWA 3L16A 2L76A 2LGDA 4FA6A 4PQ0A 1WI1A 1MG8A 1Z5SB 3ZDTA 2LD9A 1XT9B 3VQIA 2CRFA 2RGFA 3NS8A 4KDIC 2BKFA 4Z2MB 2JWZA 1LXDA 5KQ4A 1DROA 3KUCB 1EAZA 4LCDE 4MH0E 4MGKE 2BGFA 4GSWA 1TQZA 1V49A 3TL5A 1X05A 1SIFA 2CY4A 2LXAA 2KN5A 3VTUA 3PHWB 1V2YA 2IZVB 1K5DB 2YT1A 4K17A 2ZCBA 3H7PB 1U5DA 3HM6X 3EHVA 1Z87A 5L83A 4MELA 4URKA 2K39A 4C0AA 3KH0A 1PMSA 2Z0PA 3CIKA 2HD5B 2MX2A 2D07B 5D27A 3WAPA 3WIMA 2MLBA 2GBKA 5E6NA 1UEFA 3VFKA 3VDZA 2L2IA 1U4AA 2OJRA 4AOFA 3DBLI 1P5TA 1ZKHA 3UQAA 1HB8A 2R2QA 2M14A 2KTFA 4GDKA 3UINB 5J3YA 5CHWA 1FGZA 2P8VA 3GYPA 2R2OA 2K8HA 2HJ8A 1YX6B 2KVRA 3KUZA 2K8BA 1L2NA 2AWTA 1XCGA 1I2HA 1V6EA 1WFYA 4IAPA 4W9IA 4K2PA 2CHXA 1YIWA 5D3XA 1SHCA 1WMHA 4II3B 3WALA 1Q1OA 3PLUA 2M8SA 2RUKB 3RT3B 5DIFB 1WJ6A 2KWVB 3GYOA 2D4QA 1X1GA 1WM2A 4GOCA 1X11A 4EUTA 3MPXA 2KZRA 3PHXB 1WGGA 4TV3A 2DKPA 2C7HA 4JIOU 1T0YA 1WGYA 2D9WA 3KSYA 2W9NA 2V76A 4XWXA 4IM2A 4K1RB 4BVUC 2BCJA 1WJ1A 5DPSA 4BKGA 1TXDA 4A3PA 2KO3A 4HCNB 1AQCA 3PVLA 3W1YA 3L0WB 2NCNA 4F1SA 1ZW7A 4I6NB 3A9JB 2KKCA 2MP2A 3QWZB 1WMHB 3APDA 4EKUA 4ICVA 2MDXA 2FIDA 4HLEA 4G11A 2W2XD 2GBRA 5J2RA 1EO6A 1ZVRA 2ELAA 2JRHA 3W1SC 4J6IA 4HAWB 4TQ1A 4HB3B 4YL8A 5GOWB 2N7EA 4XX5A 4W9DA 1IPGA 3MTNB 1Y5OA 5IJMA 2DYNA 2YF0A 4CHKA 4PNKA 2LZ6A 5DHAB 2N7DA 5C6RA 2D10A 4F8CB 1GC7A 3KYDD 3D32A 1P9DU 1NI2A 3D8EA 2JP2A 4GMXB 3F0WA 2C60A 3NZUA 4PS8A 4W9CA 3PGEA 3RCZA 4GXBA 1XD3B 5DPRA 4DWFA 2DAJA 2BYFA 2UYZB 1V81A 3ALBA 5C5BB 1M7EA 2I1JA 1E7UA 4EOYA 2KC1A 2ROZB 2LVQA 4MSQB 2EMTA 1XR0B 3SO6A 2PE6B 1WVHA 3ULBA 4HB0B 1S3SG 3Q3JA 4FN2A 4HAVB 2KJHB 2L0FA 3CF6E 4PYUA 2W2XC 1JRUA 2N9XA 3U30A 1UPRA 2DYMA 3D8DA 3IHPC 3ZUNA 2WH5A 2HRJA 1XX0A 1ISNA 2Z0QA 2KFJA 1WX7A 5HE0A 2MKRA 4HAUB 2BYEA 2N1WA 2DHZA 4HB2B 2XEWA 1IRSA 4K81A 3SD5A 5JHBA 4W9LA 2KWUB 3DOWA 4FULA 2GMIC 4ZRKA 3DXEA 5G2NA 3V6CB 4MJSB 4AJWA 1E7VA 3VTWA 2AL6A 2JZ3B 1L7YA 3R7QA 3UIOB 2GBNA 3SV1A 1DDMA 4DBBA 2G3QB 3DPDA 4IG7B 5FI0A 1UBIA 2CKHB 5DH9B 3TO1A 5HE2A 4F7HA 2KD0A 3PV1A 3SNHA 1PQSA 3SHQA 3VUWA 2ABDA 2ADZA 3QA8A 2XBBC 5AZHA 2FJLA 2H7EA 2M4NA 1F9JA 3PREA 4OVVA 1DBHA 4KHAA 2LULA 4MT7A 2MRPA 4W9GA 3JSVB 4KV2A 4NQKE 3QK0A 3VHTC 1W1DA 1EGXA 3A4RA 2FCMA 4I6LB 1M94A 1Z2MA 1K5GB 3C0RB 2BYVE 1WZ0A 1RRPB 3EECA 2COPA 4WVFB 4MGYE 4IOYX 3V5WA 4K2OA 2A5UA 2DX1A 1E8XA 4Y94A 2LVPA 1WIAA 1FXTB 3KZ1A 1WE6A 3QCAA 3ZTCA 2YSZA 1QC6A 1W1GA 3ZVRA 3ZIMA 3W1SA 2EKEC 3JYUA 3M3JA 4ICUA 4CHJA 3ZTDA 4I6PA 1GJZA 4NNJB 3VIAA 2IO3B 1XODA 3M62B 2COAA 2J0KA 3SU8X 1OGWA 2KCJA 4BOZB 4A6FA 2FIFA 2JY6A 2G35A 2BKRB 2J7QB 3HM3A 4E74A 3A1QA 4IFSA 3ZNZB 3DQVA 4EMOA 2D9YA 4DDID 2K8CA 4WWPA 2HTHA 2CS4A 2KQ7A 4NJ6A 1XQQA 4A3OA 4BBNC 5J18A 2JVCA 5FR6A 1TBEA 4KAXB 2KUPA 4MDKE 4MGIE 3LJUX 4IUMB 4ANWA 2RPQA 2WX1A 5C23A 4A5KA 2DHJA 1TTNA 3VAWA 3DXDA 2D3GA 1NBFC 3UZTA 3ODOA 1GNUA 2VRWB 2CR5A 2WDTB 1FHXA 2L05A 1GG3A 3BY4B 2Z0EB 3PPAA 3V60A 4CO7A 2YRYA 3ULCA 3ML4A 3IBEA 4EJNA 4II2B 2RSUA 1RJ2A 2O2VB 1ZSQA 3A1QB 5KHQA 1NVLA 2RQ1A 4H8SA 5EDSA 4DDGD 1MK9B 3Q3FA 1Y8RC 4IC7B 2CQUA 2KLCA 3N7CA 5KQ1A 2LXCA 1WRDB 4PYZA 1SGHA 3R3MA 3PVWA 3PVUA 3OAWA 4DHZE 1FOEA 4EZLA 4TKNA 2IY0B 2GBMA 2LASA 3DVGX 3A4SC 1EF5A 3CSTA 3MHSD 4G0NB 4NQLB 4BKSA 4EFOA 3QC8B 1ST7A 1UD7A 5DPTA 4FADA 3M95A 1WGDA 2D9ZA 3DVNU 4BKSD 3D8FA 2O2VA 2FCNA 1J19A 4A6HA 1MKEA 4XC2A 5CHVC 2X18A 3ZLZA 3HIZA 2K00A 3DXCA 2KDIA 2LKOA 5LONB 3QX1A 1KZ7A 1V88A 1LM8B 4KHOA 2JRIB 3TCAA 1TJ6A 4GZUA 2ZNVB 1AARA 2O6VD 2DX5A 2ZNVC 2KOXA 3ENEA 3K9OB 1ZC4B 4BBKA 4TUUA 4B6WA 1U5GA 2DFKA 2MBBB 1DDWA 3L13A 4LJPB 3ODWA 4FLHA 4M0WB 4AJYB 1MAIA 1C1YB 3VOQA 1E8ZA 4WJPA 1WGHA 1N3HA 1P3QU 3EC8A 4AP4C 2MWSB 3OLMD 5C1ZA 4A6KA 5D2MB 2KHWB 2KX0A 4HXDA 2I5CA 2PJHA 4KSLC 2KJRA 2N9PC 4NAWB 2DZIA 1FGYA 2Z0OA 3VH3B 3VUYA 2MCNB 1UBQA 5CHFA 3PRMB 5FI1A 3ML8A 4K7UA 3RCPA 2DZMA 3P6AA 1P1AA 2KK8A 4JL9A 2N9EB 1FAOA 2J59M 3KRXA 2DAFA 2ZPNA 4WWNA 1ACAA 1Q67A 1WGQA 3TVVA 5J3QA 3ZNHB 1WXAA 2CY5A 2DLWA 2JZZA 2FJ9A 2IYDB 3P2BA 2VSZA 2KTRA 4TYZA 4F7GA 2GCLA 2KFKB 3QARA 3ODXA 3L08A 5E6PA 5LLIA 1BWNA 4F7ZA 2DTCA 1WX9A 2ASQA 1QQGA 4MM3A 3T8MA 3NY5A 3T06A 2K25A 5D3VA 2MBHA 4FBJB 1K8RB 2M38A 5L95C 3ZDMC 1WY8A 3KYCD 2FAZA 4OVUA 2M1MA 4HPLB 1U5FA 3A33B 2XQNM 2WYQA 3APFA 2R0DA 1LW3A 1WJUA 3ECIA 3GZNI 3PRZA 4KSKC 3U8ZA 2HE7A 3ZVVA 2YS1A 3H1UA 1H4RA 2PZ1A 3WA0A 2KTRB 3PS6A 1SE9A 1WE7A 5HE3A 2KMAA 2KQSA 3N3KB 4MY6A 4HAZB 1EF1A 1V5MA 4CHMA 1V5OA 2J0MA 1BTKA 1KZGA 2VKIA 4WJ7A 2PPHA 5GMVA 5C16A 2K1FA 4ANXA 2L7RA 3PRPB 4KZ0A 3A8QA 1WGRA 3DBSA 1RRBA 2K2JA 4DHJD 2MWNB 2MBOA 3V62A 3WANA 4FJYA 4MJSA 4HAXB 5DCNA 1FB8A 5C79A 2L8JA 2MSED 4NY0A 2AL3A 2MW5A 2Y8GA 3FP5A 1WXSA 4Z2NA 1NDDA 1PFJA 1LQBA 4RMAA 3WAMA 2GJYA 1WR1A 2KDEB 4FJZA 2AEHA 1U27A 3QHTA 1E8YA 2CAYA 2Q13A 4GDKB 1WG7A 3QBVB 2KJ6A 2GS0A 4IWPA 3AU5A 2G4DB 4WAAA 4ZRJA 2OTXA 4KHBB 4JQWC 5HKHA 3LDZE 5LOPB 4KIKB 2AYOB 5JHAA 3JSVA 3MJWA 3APCA 4WQOB 4NSWA 2BPSA 2D11A 2A4ZA 2CHWA 2ZCCA 4BFRA 3ZNID 2C9WB 1UH6A 3DBHI 2DYQA 2DZKA 3NHEB 2K6DB 2FUHB 2IBIB 4D0NB 4B95A 2MFQA 5D3WA 5HE1A 1RLFA 4GB9A 1Y19B 4BKTA 4ANVA 5AZFA 4F7UP 1A5RA 2Z0DB 4LJOB 2G4SA 3L17A 1J8CA 2LRUA 3HHMA 3KW5B 2DA0A 1WGUA 2KGXB 1CMXB 3VUXA 2LYDA 3TFMA 4GDLB 4IWOA 5DHFB 3RZFA 3ZNGC 4M8NA 2YT0A 1YJ1A 2OOBB 2IFSA 2COCA 2MP2B 3O65B 5D6JB 2R09A 4JGHB 3PSEB 3FM8C 3CSFA 2ZPYA 4GPTB 2FCSA 1Q5WB 3IVFA 3B1LX 4W9HA 4TQ0A 2KNBA 2ZVOA 2RVBB 4IWQA 3RULA 4AUQC 4P7IA 4GN1A 4DX90 2JT4B 1MPHA 3PTFC 3MDBC 3SDLC 4HDQA 2E2XA 2DYBA 2ZEQA 5IAAC 1BT0A 3KRWA 4LDTB 5J17A 4GDLA 4WJOA 1UGMA 1J0GA 2FDQA 4DX8A 2MA9B 2WX0A 2NPTB 3O96A 3TBLD 2DN6A 2RD0A
chains in the Genus database with same CATH superfamily
5D7GA 2DYOA 3NOBA 1OQNA 2KX3A 1ZDVA 3NUHB 2KR0A 1RM6C 2Y8FA 4HSIA 1I35A 3DBRB 3BYTB 2LRWA 2L52A 1QZEA 3ZNZB 1IP9A 1X86A 2XN9C 4M8MA 2CU1A 2NMBA 3IG3A 3URYA 2JX5A 1LB1A 3VRAB 1BAKA 2MBEA 1D3ZA 3H6NA 1GC6A 4HK2A 2IY1B 1KI1B 1VDVA 1U29A 2JU6X 2IO2B 4OSNA 1V97A 3BVZA 4C56C 3KY9A 2DZJA 4HATB 5JP4A 1FPYA 3SUZA 2KDFB 4TMAB 4HEA1 3AE4B 5BMGA 2ZVNA 4PS3A 3BVGA 1EUVB 3HK0A 4O1NA 2Z59B 2IO1B 3AI5A 5EFXA 2W55A 4KZCA 5G55A 3VTUA 2I1KA 4HAYB 2M19A 4A6FB 3H7SA 3WAMA 2LOXA 4LNIA 4M0WA 1V5PA 2INDC 3ZGZA 1WX8A 4EEWA 3ZYYX 1WF9A 2FNJB 2N0YA 2PIAA 1AWDA 3DHGC 1HBKA 1I4GA 1WYWB 1JDEA 2Y7BA 2L32A 1E6EB 2O6VB 1E5WA 4GU2A 4YTMB 3B2FA 1ESFA 1HEZE 3P4QB 5DPWA 2BT6A 2FCQA 4NJ7A 4WJNA 4FBJB 1NTVA 2QILA 4JLCA 4FHJA 2G1EA 2EJ8A 3RPFC 2OQBA 2KC2A 3VRBB 2ROVA 3ZW3A 2O6VA 3JW0X 4HRSA 2VRRB 2LUEA 3QIJA 3NZSA 4S0RA 3EUB2 3PP2A 3KUCB 3K9PB 2M17A 4RM8A 1QKZA 5AUKA 3Q8AA 1YN4A 5E6OA 4HHVA 1JALA 5LXHA 2NBVB 1H8CA 3L54A 3ZRCA 3V61A 3QQ8B 3PLVA 1QOFA 2GOWA 1UELA 3UQBA 4EZJA 4WWMA 3IXSA 4IW0A 2KXJA 3PG7A 2LGXA 4OW0A 2LBBA 1NTIA 1N63A 4BBNF 1PGXA 4RGOS 1WRIA 1E0ZA 5KCVA 3TEZA 4WQMA 3FSSA 2PVGC 1PLSA 4GIVA 1AWEA 1WM3A 2BWES 3H7PA 2GCJA 4M02A 1FHWA 2LGDA 2BKFA 2JWZA 1LXDA 4BOSC 3TL5A 4GSWA 1V49A 1SIFA 2CY4A 4JWUC 1V2YA 2YT1A 3H7PB 2RPVA 1U5DA 5C3JB 1QF6A 4C0AA 2Z0PA 4UDUC 5D27A 2L2IA 1U4AA 1ZKHA 4Q2JA 3GYPA 2PVOD 1ZOYB 2K8HA 4L1BA 1QT9A 1V6EA 2GI9A 2CHXA 1SHCA 1I4XA 1WJ6A 4HKZE 1WM2A 4EUTA 3MPXA 3BVMA 3R2IA 4JIOU 1T0YA 3KSYA 4IM2A 1P7FA 4BVUC 2OHFA 4HCNB 2MH7A 4F1SA 3DCXA 2QEJC 4JE3B 1JRPA 4QXAB 3RMKC 4ILHA 5J2RA 3NVZA 1EO6A 2JRHA 2N7EA 3MTNB 3LB8C 5AUIA 5IJMA 2YF0A 4CHKA 2N7DA 3RNCC 2D10A 1GC7A 3D32A 1P9DU 1NI2A 4GMXB 4RGNA 4PS8A 4C7YA 2K5PA 2BW2A 1TKYA 5C5BB 1M7EA 3LYYA 2KC1A 1JQ4A 3SO6A 2L0FA 2WH5A 2HRJA 1XX0A 2WS3B 1ISNA 2Z0QA 2KFJA 1E10A 1MHHE 2N1WA 5HE0A 2MKRA 2DHZA 4KGSA 4HB2B 4K3CA 4W9LA 1TZOA 3DOWA 3DXEA 4AJWA 1JCKB 3MC0B 1L7YA 1DDMA 4DBBA 3DPDA 4LTUA 3Q8FA 2CKHB 5DH9B 3TO1A 3PV1A 3VUWA 2W3RA 2ADZA 4YTNB 2FJLA 4KHAA 2MRPA 1VLBA 1XO3A 4A9AA 2BYVE 3EECA 2IDYA 4WVFB 1ZYIA 4K2OA 3QCAA 1WE6A 2YSZA 3ZVRA 2EKEC 3JYUA 4CHJA 1NYQA 2IO3B 3M62B 2COAA 3A1QA 4XE0A 1JW9D 3P1MA 1DGJA 2CS4A 4NJ6A 4BBNC 1XQQA 2JVCA 5FR6A 1TBEA 2VZKB 3LJUX 1HA5A 4IUMB 2RPQA 4A5KA 1SB3C 1TTNA 3HUIA 3VAWA 3ODOA 1KFYB 4KGRA 2WDTB 1FHXA 3Q8EA 3V60A 3AEAB 4II2B 1RJ2A 2O2VB 1ZSQA 2JXTA 2WXRA 1MHXA 4IC7B 3Q3FA 1Y8RC 1RWSA 2KLCA 3N7CA 4PYZA 1SGHA 3OAWA 1FOEA 2IY0B 2LASA 3DVGX 3A4SC 3MHSD 4NQLB 4BKSA 1ST7A 4FADA 2QDFA 3ZLZA 2O2VA 1J19A 3SEBA 1XLQA 3HIZA 4LLGM 1T3QA 2K00A 1CJEA 1YN5A 1KZ7A 1V88A 3EGRA 4YSYB 4B6WA 2DX5A 3NS1A 2D3BA 2DFKA 4M0WB 3L13A 1DDWA 2LJIA 3ODWA 4HROA 1WGHA 1N3HA 4AP4C 4A6KA 1P7EA 5D2MB 3V3XA 2KHWB 4HXDA 2QIEB 2N9PC 3Q14C 4C00A 1UBQA 2CJNA 1R7SA 2CJOA 5IO9A 1WGQA 1WXAA 4PK1A 2KTRA 3L08A 2Y3AA 1E7PB 3NY5A 5D3VA 2MBHA 2M38A 5L95C 4ZRPA 3KYCD 1HZ6A 3APFA 2R0DA 1LW3A 2PMVA 1EU4A 3ZVVA 3U8ZA 4L1RA 1JWBD 3WA0A 4RFBA 1SE9A 2KQSA 5HE3A 1MJDA 1V5OA 4MM3B 1KRHA 2JYEA 1FRDA 1QILA 3PRPB 3I5JC 1A70A 1BXTA 1J7BA 4DHJD 2MBOA 5C79A 4JKGA 2QJLA 2KVZA 1WXSA 2W3SA 2KIEA 1LQBA 4KKIA 4RMAA 1T0SC 2GJYA 2KDEB 5EE0A 2AEHA 1E8YA 4QJ4B 4GDKB 5T8IA 4HKQA 1K50A 3LDZE 5LOPB 3JSVA 4NSWA 2A4ZA 4BFRA 2K3UA 2C9WB 3NHEB 3W9CB 1TJEA 2FUHB 4BKTA 4D0NB 5HFYA 5D3WA 1ET6A 1A5RA 1GB4A 1SSNA 1Y56A 5AZFA 4ANVA 2Z0DB 4LJOB 3HHMA 2DA0A 1YNTE 2LYDA 1TIFA 4IWOA 4JKAA 1VRAB 4IOIE 2INCC 4M8NA 2YT0A 3ZNGC 3O65B 2IFSA 4N59A 3AE2B 1Q5WB 4IDIA 2KNBA 4IWQA 5HG2A 3RULA 4P7IA 4DX90 3U2SC 3PTFC 2E2XA 2DYBA 4JWSC 5IAAC 1WGKA 5J17A 2WLBA 1J0GA 2WX0A 2NPTB 4B0EA 3TBLD 2DN6A 2RD0A 5J18A 2WU5B 5H8YE 2WXNA 4CYEA 3DWMA 5JZEB 4K3BA 1XD4A 4ZYNA 2LWPA 2EMSA 2NBUA 3AE3B 2JQRB 3M1IB 1WXMA 1IBXA 3QWMA 4ASWC 3P42A 4C4VB 2LI5A 4KDLB 1V9JA 4US9A 3VTVA 3ZRFA 4JPSA 5TSSA 3NSUA 4W9FA 3A8PA 3FILB 2I2YA 4RF0A 2YS3A 2JF5A 3H9DA 1FXAA 4EE2A 1IBXB 3I63C 1V5TA 3RI7C 2LHDA 1QQRA 2BB6A 4NAWA 1PUTA 2L00B 1R4NI 1WR6E 3QJZA 2KWCA 2L1AA 5I2MA 3AV8A 2XK5A 4GMVA 1E90A 2H88B 1JWUD 2BBCA 1WJ4A 3M63B 3ZUNA 4JKEA 1HE8A 1UNSA 2P0HA 4E71A 1I7AA 2JPHA 2LJ5A 1F1HA 3WYFB 1YQ4B 2QC8A 2V4IB 1DDVA 1XKEA 2DLBA 2UWQA 2WXFA 4JX1C 2DX5B 4IKGA 2DNFA 1WJMA 4EZKA 3X0WA 5IA7A 4QAYA 5LG4B 1UZXB 4ZDVA 2L1CA 1DYNA 1ROEA 3NVYA 4E3CA 1V80A 1P6SA 2ONQA 2NVUI 2AQ2B 3IAS1 3BIID 1LFDA 1KJTA 4BZAA 2MQJA 5CLQB 2B3AA 3VVWB 4HB4B 4XZ4A 3Q3OC 1WI0A 4WJQA 1N6ZA 2K6QA 2DWQA 2NTSA 2GBJA 2JXXA 2UZSA 4KIKA 2GUMA 3OG5A 1L2NA 1E8WA 2RLOA 1H10A 1UNPA 3DDCB 2KANA 5JHGA 3BZDB 1CZPA 1TY0A 2MBQA 3TIXA 2L3ZA 3KWVA 2X0SA 5LNK1 2Y5BB 2CB8A 4W9JA 2DKQA 1OEYA 1V1PB 4JK8A 4HWIB 3ENBA 1V61A 2IGGA 1ZGUB 2UU7A 4WSFA 5D3YA 3J9CA 2C7MB 2PLPA 2H7DA 4FHKA 4RGMA 2ACZB 1GOZA 1MI1A 4A8XC 3IT4B 4Z2MB 4RGTA 5KQ4A 1EAZA 4LCDE 4MGKE 1TQZA 2LMCA 2KN5A 2RMMA 4K17A 2ZCBA 1OQQA 3HM6X 3EHVA 2DIKA 1Z87A 5L83A 4MELA 1FNUA 2KMMA 2MX2A 4L23A 3WIMA 2GBKA 4P16A 3VDZA 4S17A 1P5TA 1HB8A 2R2QA 4GDKA 5J3YA 2V3PA 5CHWA 1FGZA 2P8VA 3SFEB 1YX6B 2KVRA 2AWTA 1XCGA 3NZ3A 1WFYA 3NVWA 1C78A 4D2KA 5D3XA 2WXKA 3RT3B 2RUKB 1X1GA 4GOCA 1X11A 2KZRA 2HJ1A 1WGYA 4CSQA 4N58A 1E9MA 4XWXA 2B76B 2BCJA 1WJ1A 1ZPSA 5DPSA 3RFZB 1UF0A 3U52E 3PVLA 3L0WB 1PFDA 4I6NB 3A9JB 2MP2A 3MP9A 2X8XX 4ICVA 1ZUD2 2FIDA 4G11A 2I38A 3P63A 3SBTA 4TQ1A 4HB3B 1Y5OA 5DHAB 4F8CB 3DHIC 3D8EA 2C60A 3NZUA 3RCZA 2ZW1A 1UWXA 2KAJA 1XD3B 4DWFA 2UYZB 1DOYA 2ZKMX 1V1OA 1E7UA 2VH1A 4EOYA 2BS4B 2LVQA 4MSQB 2EMTA 1XR0B 2PE6B 4WJPA 1WVHA 4HB0B 4PYUA 3CF6E 3U30A 1C79A 1K53A 3AB5A 3I57A 1WX7A 2BYEA 1PYWD 1FRRA 4RCOA 2GMIC 4ZRKA 1E7VA 4LNKA 2JZ3B 1JWSD 3N1YC 3UIOB 4IG7B 1PGAA 1UBIA 2KD0A 3SHQA 1PQSA 3VR8B 2NBVA 5FKAC 2E3TA 3MJ5A 4B0MA 2H7EA 4OVVA 1NVID 2LULA 3VHTC 4OT1A 3JSVB 2Q5WD 2IGDA 1EGXA 3A4RA 4I6LB 1M94A 1Z2MA 2A5UA 1E8XA 3KZ1A 5BYQA 3ZTCA 1QC6A 2M56B 3M3JA 3ZTDA 2N9KA 5M4YB 4NNJB 1FD6A 3SU8X 4BOZB 1OGWA 4A6FA 3HM3A 2G35A 1B9RA 4IFSA 2G9HD 2K8CA 4WWPA 4A3OA 1YN3A 2K22A 4KAXB 2KUPA 4MGIE 2DHJA 1TS5A 3FILA 3DXDA 4REZA 2VRWB 3BY4B 4A90A 4WAFA 4CO7A 3BWUD 2Z0EB 1JWAD 2YRYA 3ULCA 2RSUA 4H8SA 1VZ8A 1MK9B 2KQ4X 3OWEB 2CQUA 1FCLA 5KQ1A 2LXCA 1WRDB 3E9SA 3R3MA 3PVUA 4EZLA 1EF5A 2WXMA 1L6VA 3FC4A 3QC8B 5DPTA 2INNE 3R2TA 2QCZA 4BKSD 1MKEA 3ZXVA 2WXJA 2X18A 3PZ7A 2K49A 3U12A 2J4XA 1T6BX 2KDIA 3NG0A 4KHOA 3K9OB 2KOXA 4E74A 4H2AA 4FLHA 3P4SB 4AJYB 1C1YB 3NW8A 1E8ZA 5D3IB 1P3QU 1XLOA 2MWSB 5C1ZA 2PJHA 4KSLC 2CU3A 2KJRA 1FGYA 1CQVA 1J7CA 5CHFA 4JKFA 3PRMB 5FI1A 3ML8A 2KUQA 3P6AA 1P1AA 2KK8A 2N9EB 1FAOA 2ZPNA 1ACAA 2Z8LA 3TVVA 2JZZA 3P2BA 2FJ9A 2PW9A 2N9LA 3AE7B 2KT7A 1L5PA 2GCLA 1SBBB 3B2GA 3ODXA 1T0RC 2DTCA 2ASQA 1QQGA 2K25A 2HTME 5EE3A 4OVUA 4JKGB 2M1MA 5I2SA 2WYQA 3GZNI 2HE7A 5H92C 3B77A 2PZ1A 3PS6A 2JYTA 3PO0A 1EF1A 1V5MA 1RFKA 1JWMD 4WJ7A 1MPEA 3MHZA 5GMVA 3NWDA 2K1FA 4ANXA 2QSDA 3Q69A 2MWNB 3V62A 2LEKA 5DCNA 1QOAA 2L8JA 4QJ5B 4YTPB 2Y8GA 4XDCA 4OZBA 1PFJA 1QLBB 3QBVB 4IWPA 2LFIA 4ZRJA 4KHBB 1C77A 5HKHA 4NZLB 2JSVX 1KC7A 2AYOB 3MJWA 2BPSA 2ZCCA 2CHWA 5D3DA 3Q3NC 3AEDB 1BUIC 2DYQA 1ZDXA 1FMAD 2DZKA 2K9XA 2K6DB 1D4BA 3N20C 1SE3A 1Y19B 1J8CA 4F7UP 1EM7A 1WGUA 2KGXB 3P4PB 5DHFB 2BVCA 2OOBB 2COCA 5IRSA 1OFFA 2DBYA 3TUOA 3CWIA 4JGHB 2ZPYA 4GPTB 2FCSA 1SEBD 3B1LX 4TQ0A 2JT4B 1MPHA 5EE1A 2ZEQA 3SDLC 2IGHA 2KDMA 1CK1A 2MA9B 4DX8A 3E56A 3ZXRA 3SR6A 5FR3A 1YD8U 1ZC3B 1BMLC 4TSSA 3MC9A 4L2YA 2PEAA 1WSPA 2MJEA 4R3DA 3C19A 3OJ4B 1OMWA 5FK9C 3R7RA 3LJ3A 3P7ZA 2YEPB 3DBHB 1V86A 5CTRC 3AN1A 1DOXA 1JMLA 1MFWA 3UGBB 4X57B 3HW2B 1YMHE 1UNRA 3ZJVA 1VD2A 3AXCA 2WDQB 4ZRIA 2ZZPB 2LGYA 5CLLB 4DHJB 1XCQL 1WH3A 3CMMB 4YSXB 4AWJA 2D2QA 1ZXIA 3OANA 3OJ3A 2LVOA 2DHIA 2D9XA 2NTTA 2IO0B 2BQQA 3NJTA 5J3TA 1FFUA 1YQBA 1I42A 1ZP0B 1MG4A 3I3TB 2LUMA 2OEDA 3A9KA 3BINA 2D9VA 2WHIA 1WYGA 1P98A 2JWUA 3RNGC 2W2WA 2N0SB 1Q0WB 3A9JA 3HIEA 5D94A 1L0YB 1N62A 4DHZB 4PS7A 3CXBB 3F5RA 3AULA 3GE8C 1ZM0A 3HSAA 3Q8CA 2DENB 2COFA 3Q8BA 2NMQA 2J0JA 2RDBC 2K2UA 2KMCA 3TJPA 3ZKJC 3ML9A 3A98B 4NAMA 4YSZB 3UF8A 1AN8A 3FEHA 1KM7A 4FJVB 1VJKA 3EFUA 4L6EA 3DBLB 3ZO5B 4B6HA 4JKBA 2KLGA 1SE4A 5AEKB 2M0XA 4LDTD 3CIRB 4RM9A 2INPE 2KFKA 2L0TA 4MGYE 3DVNV 1LO5D 2FE8A 2NS5A 2RRFA 1YQ3B 1XF5L 4DK5A 1FHOA 1KOTA 1P0RA 3TSSA 5I4DA 1OEYJ 4IM3A 4P1CC 1HB6A 2H89B 3TW1A 5JLJB 4MEMA 3E9PA 1F77A 2Y5CA 1P3RA 2ON8A 4NJCA 4ZRQA 4A20A 2XK5B 1KLUD 4USAA 3HQCA 2PE9A 1D6EC 3VH4B 1GUAB 2BF8B 3W5UB 4XGAB 1V89A 5L81A 4W9KA 4GOUA 2LG1A 4G50A 3JVZX 4NPNA 3N9YC 2CODA 1U2BA 1J0WA 4A55A 3AE6B 1WJNA 1C76A 2N7JA 4G3XB 3AJ4A 4HPMB 1C4PA 2NPTA 3GP7A 1W1HA 1F0ZA 2QHOA 2LHEA 4FA6A 3ZDTA 2LD9A 3RNBC 3VQIA 3NS8A 4KDIC 4WIPA 4XDDA 3UINB 1VBGA 1DROA 1SE2A 2BGFA 4KGTA 1FEHA 4ILGB 3FVCA 3KH0A 2MLBA 4MACA 5E6NA 1R4MB 1UEFA 3VFKA 4AOFA 3DBLI 3AEGB 1L4ZB 3UQAA 2M14A 2KTFA 2HJ8A 1TKGA 3KUZA 2K8BA 3Q6BA 3AECB 4MT5A 3ZJUA 4W9IA 1C4AA 1WMHA 4II3B 3WALA 2RDHA 3PLUA 2M8SA 3GYOA 2D4QA 4ITKA 1T77A 1WGGA 4TV3A 4DQOC 2DKPA 1Q10A 3DHHC 2WGSA 5HI1A 4BKGA 1TXDA 2KO3A 1ZW7A 1EWCA 3QWZB 1WMHB 1EU3A 4EKUA 4HLEA 2GBRA 2LGIA 1ZVRA 4WH4A 2J42A 4J6IA 4HAWB 4YL8A 5GOWB 4XX5A 4W9DA 2KWDA 1IPGA 1F52A 3KYDD 4W9CA 2JP2A 3F0WA 4KHBA 2AQ3B 2W54A 3ALBA 4HPPA 2V9HA 3Q3JA 3ULBA 4FN2A 3AE5B 5JVLA 4HAVB 2KJHB 2W2XC 2N9XA 1UPRA 4JKDA 2DYMA 3IHPC 4YWGG 3ETRA 3TEWA 4DXFA 4ACFA 4HAUB 4ZHOA 4C4VA 4K81A 5JHBA 1YOVB 2VH2A 2ICIA 4FULA 4MJSB 1L6UA 1V8CA 1YJJA 3VTWA 1FFVA 1MI0A 2GBNA 2G3QB 1KTKA 5FI0A 4DDGD 4LNNA 2ABDA 2XBBC 1FIQA 2RDGA 4YT0B 1NI3A 2M4NA 1PGBA 4ILJA 2AX5A 1XCTL 1DBHA 1XEEA 4MT7A 4W9GA 4KV2A 4NQKE 1IUEA 3QK0A 2WXQA 3C0RB 4XWTA 1T5XD 1WZ0A 2COPA 2LVPA 4Y94A 1FXTB 1STEA 1W1GA 2WXLA 3ZIMA 4ICUA 2BB5A 1LGRA 3VIAA 1KH0A 1XODA 2FUG1 2KCJA 2JY6A 2J7QB 1F2RC 4DDID 3RN9C 2HTHA 1N61A 2KQ7A 5IOIA 4AQ7A 1L4DB 2WX1A 5C23A 5BMHA 2D3GA 2CR5A 2L05A 2KIGA 3Q2AC 3ML4A 3IBEA 5KHQA 3A1QB 1HTOA 1ENFA 1FO4A 2GBMA 4G0NB 2AQ1B 5BYSA 3FKYA 2Z59A 3D8FA 2FCNA 4A6HA 4XC2A 5CHVC 4XWWA 5BYRA 3MC8A 3AE1B 3ZJTA 4ARIA 3AEBB 1LM8B 2LGSA 2ZNVB 2JRIB 4CQNA 4GZUA 4TUUA 4QJ3B 1GB1A 2MBBB 1MAIA 2M0AA 3EC8A 3OLMD 1UWMA 5IKCM 4N6EB 3VUYA 2Z0OA 2MCNB 3RCPA 4JL9A 2J59M 3KRXA 2KN4A 5E6JA 1Q67A 2JZPA 3PZ8A 5BMIA 3W5VB 2FBWB 2VSZA 3QARA 4TYZA 4F7GA 2KFKB 1SF0A 5LLIA 4F7ZA 1BWNA 1WX9A 4MM3A 4JKCA 3RNFC 3ZDMC 1J7AA 2Y5PA 2FAZA 2ZW0A 1U5FA 1WJUA 4KSKC 3PRZA 2YS1A 3BK1A 3KLSX 1D5XC 2KTRB 1WE7A 1I4QA 2KYWA 3N1XC 4MY6A 4HAZB 4CHMA 2J0MA 1BTKA 1N5XA 2PPHA 1KZGA 2L7RA 3GB1A 4KX6B 1WGRA 1TS3A 2K2JA 3WANA 4HAXB 1RYJA 1FB8A 4NY0A 1DIKA 1NDDA 1K52A 4A6QA 2VZKD 3QHTA 2CAYA 3ABVB 1WG7A 2KJ6A 4WAAA 3AU5A 2G4DB 2OTXA 3BK2A 4P1BC 4JQWC 3NRZA 1KLGD 2WDRB 4B95A 2MFQA 4GB9A 1RLFA 1IGDA 3VUXA 2MHJA 5HHDG 1SJHD 1NENB 5JXVA 2YT2A 2SEBD 2BTEA 1FCCC 2MP2B 5D6JB 2X38A 3CSFA 3ZQ4A 3IVFA 2RVBB 2R2YA 2SAKA 1XXGA 2GLSA 3E9OA 4HDQA 1BT0A 3KRWA 4WJOA 2FDQA 3A33B 3O96A 3RZFA 3PREA 3LXFA 4ZOHC 1M7RA 3N32A 1T0QC 3AU4A 1WZ3A 1BTNA 5TR5A 1X1FA 5DI9B 1OQRA 1ZXHA 5IP4D 1L0XB 1TZ1A 2NR2A 2WWZA 3WAOA 3EFCA 1I4HA 3T3NA 1FM0D 4RH6A 3B0AA 2L83A 4JKHA 1MIZB 3PEGA 2I5FA 2P0FA 2W82A 2LOZA 3UI3A 3B08A 2MJDA 2V3SA 1FXIA 1I4PA 2MEKA 3ONSA 1IYFA 5CX3A 3BJIA 3V6EB 5LXIB 3QAQA 4P6VF 4D6WA 5KHOA 4GLSC 4MH8A 3FLVA 3X23A 4GGQA 2CHZA 3GOEA 2C5LC 2C7NB 3KVFB 3PT2B 3RD2A 4DBGA 1VBHA 4DXAB 2IYBA 2DHKA 3I9V1 4YONA 1UUPA 1HTQA 2YLMA 4IM0A 2BWFA 2YVCA 3EPYA 2QKMA 2WQYB 1OTRB 4AS1A 2YEPF 4YXDB 4HJKA 1EVHA 2YS5A 1OQYA 5AZGA 5BO4B 4LNFA 2KDBA 4LNOA 4K7SA 1KLVA 2N1VA 3DVGY 5G5HA 3RYTA 4HDOA 1V5UA 3S2AA 2RGNB 3NVVA 1S1QB 1X1MA 1UNQA 2V0GA 4B9KA 4MSMB 4K7WA 3VXWA 2QKLA 3E9LA 2D5GA 2ELBA 3G9WA 4RNAA 4W9EA 5JH5C 2V4LA 2ZJDA 3N30A 2N4FA 3R8BA 2G45B 2TSSA 1DYQA 5C5BA 4OZCA 1TGZB 4MK0A 2RNRB 3SBGA 1XLPA 2IJ0A 1R4MI 1VZ7A 3VR9B 1R4NB 2N23A 1ZE3D 3UIPB 1U5EA 1GPXA 1G6JA 3DBRI 1MIXA 1RAXA 3PSCA 1C3TA 1B55A 1NTYA 2PTLA 3RUIB 5MPOA 2P0DA 4WWOA 3SYXA 1IGCA 4MGZE 1NU2A 1WXVA 3RZWC 2NZ8B 4ANUA 2R82A 1UPQA 3E66A 1D5ZC 4KVGB 1WXQA 1HXYD 2V1YA 1MK7B 2JUOA 1C9FA 3A9KB 2UVMA 2UZRA 1RFAA 2RR9A 4J3OD 3T9LA 3IFWB 3PZDA 4HCPB 1OY2A 4HVBA 2RSGA 2WXGA 2XNAC 2OJWA 3R66C 1HZ5A 3U7DA 3KQ4A 2EC1A 3TMPB 2WXHA 2NBWB 4DXGA 5GXGB 3L10B 4ZHPA 2REXA 3KWLA 3DCGA 3KUDB 1YX5B 5JHHA 3GZNB 3U7ZA 1VCBA 3RNAC 2HTHB 1I4RA 2EKIA 3L16A 2L76A 4PQ0A 1WI1A 1MG8A 1Z5SB 1XT9B 2CRFA 2RGFA 3AEEB 4MH0E 1X05A 2LXAA 1AW7A 4RF1A 3PHWB 2IZVB 2GB1A 1K5DB 4HJGE 4URKA 2WU2B 2K39A 1PMSA 3CIKA 2HD5B 3IT6B 2D07B 3WAPA 1SXTA 5G5GA 1NEKB 2MJ3A 2OJRA 1GAQB 1K51A 1N60A 1TS2A 1N5WA 3AMZA 2R2OA 4JK7A 2KACA 1I2HA 1XLNA 3AH7A 2BYTA 4IAPA 3DWGC 4K2PA 1YIWA 2V3NA 1Q1OA 5DIFB 1KBLA 2KWVB 2WXPA 1F2RI 3PHXB 3U4EG 2C7HA 2BS3B 2D9WA 2W9NA 4K1RB 2V76A 3AEFB 4A3PA 1TS4A 1AQCA 3W1YA 2NCNA 2KKCA 1JROA 3SFDB 3APDA 2MDXA 4PT5A 1ACCA 2W2XD 3Q3MC 2ELAA 2J52A 3W1SC 1QOBA 2DYNA 4PNKA 2LZ6A 5C6RA 3FAHA 3V05A 3PGEA 4GXBA 5DPRA 2DAJA 2WDVB 4OZAA 2BYFA 1ET9A 1V81A 2I1JA 2ROZB 1HQRD 1S3SG 1JRUA 4LK0M 3D8DA 4BAXA 3C8YA 2WXOA 3NWAA 3T3OA 2XEWA 1IRSA 1FNWA 3SD5A 4M01A 2KWUB 2PKOA 5G2NA 3V6CB 2AL6A 3R7QA 3SV1A 4F7HA 5HE2A 3SNHA 1KF6B 3QA8A 5AZHA 3AE9B 1F9JA 4JK9A 1AYFA 1W1DA 2FCMA 1K5GB 1RRPB 1M4VA 4IOYX 3V5WA 1SJED 2DX1A 1TKEA 1WIAA 3TEXA 3W1SA 4I6PA 1GJZA 3IAM1 4WURA 2J53A 4XYCA 4ZYSA 2J0KA 2Z4DA 1MVKA 2FIFA 2BKRB 4GNKB 3DQVA 4EMOA 2D9YA 1FNVA 1D5MC 1UGJA 4MDKE 2WP9B 4ANWA 1VZ6A 2FJUB 3NWFA 1NBFC 3UZTA 1GNUA 3L17A 3W2DA 3AE8B 1GG3A 3PPAA 3B9JA 3BYYB 4EJNA 3AM9A 1NYRA 1NVLA 2RQ1A 2BS2B 5EDSA 2R61A 3O13A 4DHZE 3PVWA 4TKNA 3CSTA 4EFOA 2E6XA 1UD7A 2QMTA 4FXCA 1V1PA 1L0VB 3M95A 1WGDA 2D9ZA 3DVNU 1VR9A 3GE3C 1B1ZA 3OHMB 1YJIA 3DXCA 2LKOA 5LONB 3QX1A 3TCAA 1TJ6A 1AARA 2O6VD 2ZNVC 3ENEA 2Z14A 3H8HA 1ZC4B 4BBKA 5EE9A 1U5GA 4LJPB 4KKJA 3VOQA 3HRDD 2KX0A 2I5CA 4NAWB 2DZIA 3VH3B 4K7UA 2DZMA 4WWNA 2DAFA 5J3QA 3ZNHB 3WCQA 4ARCA 2CY5A 2DLWA 2Z13A 2IYDB 3TEYA 1TY2A 5E6PA 2GRIA 1C4CA 3GS2A 3T8MA 3T06A 4C7ZA 2K8EA 3P4RB 1K8RB 3A58A 1WY8A 1EWYC 5C2TB 4HPLB 4C80A 3ECIA 2XQNM 4N9F4 1SIJA 1I7HA 2EELA 3H1UA 2D3CA 1H4RA 3N1ZC 2KMAA 2WXIA 1TT5B 3N3KB 3MFGA 2VKIA 1GGOA 5C16A 4KZ0A 5IN7A 3A8QA 4OHJA 2K0PA 3DBSA 1RRBA 4FJYA 4MJSA 1PDXA 2HDEA 2MSED 3HVDA 2AL3A 2MW5A 3FP5A 4Z2NA 1WR1A 4FJZA 1U27A 2Q13A 2WNMA 2GS0A 4KIKB 5JHAA 4WQOB 3APCA 3L4PA 1DOIA 2D11A 3ZNID 1TYGB 3HVZA 1UH6A 3DBHI 3EA6A 2D3AA 2IBIB 5HE1A 2G4SA 3RNEC 2LRUA 3KW5B 1CMXB 4US8A 3TFMA 4GDLB 1YJ1A 2R09A 4M00A 3PSEB 3FM8C 1WWTA 4W9HA 1QOGA 2ZVOA 4AUQC 4GN1A 3MDBC 4DIXA 4LDTB 2IPKD 4GDLA 1UGMA 4OVZA
chains in the Genus database with same CATH topology
5D7GA 2DYOA 3NOBA 1OQNA 2KX3A 2Y8FA 1I35A 2LRWA 1QZEA 1IP9A 3ZNZB 1X86A 4M8MA 2CU1A 2NMBA 3IG3A 1LB1A 1BAKA 2MBEA 1D3ZA 3H6NA 1GC6A 4HK2A 2IY1B 1KI1B 1U29A 2IO2B 3KY9A 2DZJA 4HATB 5JP4A 3SUZA 2KDFB 2ZVNA 4PS3A 1EUVB 3HK0A 2Z59B 2IO1B 3AI5A 5EFXA 4KZCA 5G55A 3VTUA 2I1KA 4HAYB 4A6FB 3H7SA 3WAMA 2LOXA 1V5PA 1WX8A 4EEWA 1WF9A 2FNJB 2N0YA 1HBKA 1WYWB 1JDEA 2Y7BA 2O6VB 1E5WA 4GU2A 5DPWA 2FCQA 4NJ7A 4WJNA 4FBJB 1NTVA 4JLCA 4FHJA 2EJ8A 2OQBA 2KC2A 2ROVA 3ZW3A 2O6VA 3JW0X 2VRRB 2LUEA 3QIJA 3NZSA 3PP2A 3KUCB 3K9PB 2M17A 4RM8A 5E6OA 4HHVA 5LXHA 1H8CA 2NBVB 3L54A 3ZRCA 3V61A 3QQ8B 3PLVA 2GOWA 1UELA 3UQBA 4EZJA 4IW0A 2KXJA 3PG7A 2LGXA 2LBBA 1NTIA 4BBNF 5KCVA 3FSSA 1PLSA 4GIVA 1AWEA 1WM3A 2BWES 3H7PA 2GCJA 1FHWA 2LGDA 2BKFA 2JWZA 1LXDA 4BOSC 3TL5A 4GSWA 1V49A 1SIFA 2CY4A 1V2YA 2YT1A 3H7PB 1U5DA 4C0AA 2Z0PA 5D27A 2L2IA 1U4AA 1ZKHA 3GYPA 2K8HA 1V6EA 2CHXA 1SHCA 1WJ6A 1WM2A 4EUTA 3MPXA 4JIOU 1T0YA 3KSYA 4IM2A 4BVUC 4HCNB 4F1SA 4ILHA 5J2RA 1EO6A 2JRHA 2N7EA 3MTNB 5IJMA 2YF0A 4CHKA 2N7DA 2D10A 1GC7A 3D32A 1P9DU 1NI2A 4GMXB 4PS8A 5C5BB 1M7EA 2KC1A 3SO6A 2L0FA 2WH5A 2HRJA 1XX0A 1ISNA 2Z0QA 2KFJA 2N1WA 5HE0A 2MKRA 2DHZA 4HB2B 4W9LA 3DOWA 3DXEA 4AJWA 1L7YA 1DDMA 4DBBA 3DPDA 2CKHB 5DH9B 3TO1A 3PV1A 3VUWA 2ADZA 2FJLA 4KHAA 2MRPA 2BYVE 3EECA 4WVFB 4K2OA 3QCAA 1WE6A 2YSZA 3ZVRA 2EKEC 3JYUA 4CHJA 2IO3B 3M62B 2COAA 3A1QA 2CS4A 4NJ6A 4BBNC 1XQQA 2JVCA 5FR6A 1TBEA 3LJUX 4IUMB 2RPQA 4A5KA 1TTNA 3VAWA 3ODOA 2WDTB 1FHXA 3V60A 4II2B 1RJ2A 2O2VB 1ZSQA 4IC7B 3Q3FA 1Y8RC 2KLCA 3N7CA 4PYZA 1SGHA 3OAWA 1FOEA 2IY0B 2LASA 3DVGX 3A4SC 3MHSD 4NQLB 4BKSA 1ST7A 4FADA 3ZLZA 2O2VA 1J19A 3HIZA 2K00A 1KZ7A 1V88A 4B6WA 2DX5A 2DFKA 4M0WB 3L13A 1DDWA 3ODWA 1WGHA 1N3HA 4AP4C 4A6KA 5D2MB 2KHWB 4HXDA 2N9PC 1UBQA 1WGQA 1WXAA 2KTRA 3L08A 3NY5A 5D3VA 2MBHA 2M38A 5L95C 3KYCD 3APFA 2R0DA 1LW3A 3ZVVA 3U8ZA 3WA0A 1SE9A 2KQSA 5HE3A 1V5OA 3PRPB 4DHJD 2MBOA 5C79A 4JKGA 1WXSA 4RMAA 1LQBA 2GJYA 2KDEB 2AEHA 1E8YA 4GDKB 3LDZE 5LOPB 3JSVA 4NSWA 2A4ZA 4BFRA 2C9WB 3NHEB 2FUHB 4BKTA 4D0NB 5D3WA 1A5RA 4ANVA 5AZFA 2Z0DB 4LJOB 3HHMA 2DA0A 2LYDA 4IWOA 4JKAA 3ZNGC 4M8NA 2YT0A 3O65B 2IFSA 1Q5WB 2KNBA 4IWQA 3RULA 4P7IA 4DX90 3PTFC 2E2XA 2DYBA 5IAAC 5J17A 1J0GA 2WX0A 2NPTB 3TBLD 5J18A 2DN6A 2RD0A 4CYEA 5JZEB 1XD4A 4ZYNA 2LWPA 2EMSA 2NBUA 3M1IB 1WXMA 3QWMA 4ASWC 2LI5A 4KDLB 1V9JA 3ZRFA 3VTVA 3NSUA 4W9FA 3A8PA 2YS3A 2JF5A 3H9DA 1V5TA 4NAWA 2L00B 1R4NI 1WR6E 3QJZA 2KWCA 2XK5A 4GMVA 1E90A 1WJ4A 3M63B 3ZUNA 4JKEA 1HE8A 2P0HA 4E71A 1I7AA 2JPHA 2LJ5A 3WYFB 1DDVA 1XKEA 2UWQA 2DX5B 1WJMA 4EZKA 3X0WA 5IA7A 1UZXB 4ZDVA 2L1CA 1DYNA 4E3CA 1V80A 1P6SA 2NVUI 1LFDA 1KJTA 2MQJA 5CLQB 2B3AA 3VVWB 4HB4B 4XZ4A 1WI0A 4WJQA 2K6QA 2GBJA 2JXXA 2UZSA 4KIKA 1L2NA 1E8WA 2RLOA 1H10A 1UNPA 3DDCB 2KANA 5JHGA 2MBQA 3TIXA 2L3ZA 2X0SA 2Y5BB 2CB8A 4W9JA 2DKQA 1OEYA 4JK8A 4HWIB 3ENBA 1V61A 1ZGUB 4WSFA 5D3YA 2C7MB 2H7DA 4FHKA 4Z2MB 5KQ4A 1EAZA 4LCDE 4MGKE 1TQZA 2KN5A 4K17A 2ZCBA 3HM6X 3EHVA 2DIKA 1Z87A 5L83A 4MELA 2MX2A 3WIMA 2GBKA 3VDZA 1P5TA 1HB8A 2R2QA 4GDKA 5J3YA 5CHWA 1FGZA 2P8VA 1YX6B 2KVRA 2AWTA 1XCGA 1WFYA 5D3XA 3RT3B 2RUKB 1X1GA 4GOCA 1X11A 2KZRA 1WGYA 4XWXA 2BCJA 1WJ1A 5DPSA 3PVLA 3L0WB 4I6NB 3A9JB 2MP2A 4ICVA 2FIDA 4G11A 3SBTA 4TQ1A 4HB3B 1Y5OA 5DHAB 4F8CB 3D8EA 2C60A 3NZUA 3RCZA 1XD3B 4DWFA 2UYZB 1E7UA 4EOYA 4MSQB 2LVQA 4WJPA 2EMTA 1XR0B 2PE6B 1WVHA 4HB0B 4PYUA 3CF6E 3U30A 1WX7A 2BYEA 2GMIC 4ZRKA 1E7VA 2JZ3B 3UIOB 4IG7B 1UBIA 2KD0A 3SHQA 1PQSA 2H7EA 4OVVA 2LULA 3VHTC 3JSVB 1EGXA 3A4RA 4I6LB 1M94A 1Z2MA 2A5UA 1E8XA 3KZ1A 3ZTCA 1QC6A 3M3JA 3ZTDA 4NNJB 3SU8X 4BOZB 1OGWA 4A6FA 3HM3A 2G35A 4IFSA 2K8CA 4WWPA 4A3OA 4KAXB 2KUPA 4MGIE 2DHJA 3DXDA 2VRWB 3BY4B 4CO7A 2Z0EB 2YRYA 3ULCA 2RSUA 4H8SA 1MK9B 2CQUA 5KQ1A 2LXCA 1WRDB 3R3MA 3PVUA 4EZLA 1EF5A 3QC8B 5DPTA 4BKSD 1MKEA 2X18A 2KDIA 4KHOA 3K9OB 2KOXA 4E74A 4FLHA 4AJYB 1C1YB 1E8ZA 1P3QU 2MWSB 5C1ZA 2PJHA 4KSLC 2KJRA 1FGYA 5CHFA 4JKFA 3PRMB 5FI1A 3ML8A 3P6AA 1P1AA 2KK8A 2N9EB 1FAOA 2ZPNA 1ACAA 3TVVA 2JZZA 3P2BA 2FJ9A 2GCLA 3ODXA 2DTCA 2ASQA 1QQGA 2K25A 4OVUA 4JKGB 2M1MA 2WYQA 3GZNI 2HE7A 2PZ1A 3PS6A 1EF1A 1V5MA 4WJ7A 5GMVA 2K1FA 4ANXA 2MWNB 3V62A 5DCNA 2L8JA 2Y8GA 1PFJA 3QBVB 4IWPA 4ZRJA 4KHBB 5HKHA 1KC7A 2AYOB 3MJWA 2BPSA 2ZCCA 2CHWA 2DYQA 2DZKA 2K6DB 1Y19B 1J8CA 4F7UP 1WGUA 2KGXB 5DHFB 2OOBB 2COCA 4JGHB 2ZPYA 4GPTB 2FCSA 3B1LX 4TQ0A 2JT4B 1MPHA 3SDLC 2ZEQA 2MA9B 4DX8A 1YD8U 1ZC3B 2PEAA 3OJ4B 1OMWA 3R7RA 3LJ3A 3P7ZA 1V86A 5CTRC 3UGBB 4X57B 3HW2B 1UNRA 1VD2A 3AXCA 4ZRIA 2ZZPB 2LGYA 5CLLB 4DHJB 1WH3A 3CMMB 4AWJA 2D2QA 3OANA 3OJ3A 2LVOA 2DHIA 2D9XA 2IO0B 5J3TA 1YQBA 1I42A 3I3TB 3A9KA 3BINA 2D9VA 1P98A 2W2WA 1Q0WB 3A9JA 5D94A 4DHZB 4PS7A 3CXBB 3F5RA 3AULA 1ZM0A 2DENB 2COFA 2J0JA 2K2UA 2KMCA 3TJPA 3ZKJC 3ML9A 3A98B 3UF8A 3FEHA 1KM7A 4FJVB 3EFUA 4L6EA 3ZO5B 4B6HA 4JKBA 2KLGA 5AEKB 2M0XA 4LDTD 4RM9A 2KFKA 2L0TA 4MGYE 3DVNV 2NS5A 4DK5A 1FHOA 1KOTA 1P0RA 1OEYJ 4IM3A 1HB6A 3TW1A 5JLJB 4MEMA 3E9PA 1P3RA 4A20A 2XK5B 3HQCA 2PE9A 3VH4B 1GUAB 2BF8B 1V89A 5L81A 4W9KA 2LG1A 4G50A 3JVZX 4NPNA 2CODA 1U2BA 1J0WA 1WJNA 4G3XB 3AJ4A 4HPMB 2NPTA 1W1HA 2QHOA 4FA6A 3ZDTA 2LD9A 3VQIA 3NS8A 4KDIC 3UINB 1VBGA 1DROA 2BGFA 4ILGB 3KH0A 2MLBA 5E6NA 1UEFA 3VFKA 4AOFA 3DBLI 3UQAA 2M14A 2KTFA 2HJ8A 3KUZA 2K8BA 4W9IA 1WMHA 4II3B 3WALA 3PLUA 2M8SA 3GYOA 2D4QA 1WGGA 4TV3A 2DKPA 4BKGA 1TXDA 2KO3A 1ZW7A 3QWZB 1WMHB 4EKUA 4HLEA 2GBRA 1ZVRA 4J6IA 4HAWB 4YL8A 5GOWB 4XX5A 4W9DA 1IPGA 3KYDD 4W9CA 2JP2A 3F0WA 3ALBA 3Q3JA 3ULBA 4FN2A 5JVLA 4HAVB 2KJHB 2W2XC 2N9XA 1UPRA 4JKDA 2DYMA 3IHPC 4HAUB 4K81A 5JHBA 4FULA 4MJSB 3VTWA 2GBNA 2G3QB 5FI0A 4DDGD 2ABDA 2XBBC 2M4NA 4ILJA 1DBHA 4MT7A 4W9GA 4KV2A 4NQKE 3QK0A 3C0RB 1WZ0A 2COPA 2LVPA 4Y94A 1FXTB 1W1GA 3ZIMA 4ICUA 3VIAA 1XODA 2KCJA 2JY6A 2J7QB 4DDID 2HTHA 2KQ7A 2WX1A 5C23A 2D3GA 2CR5A 2L05A 3ML4A 3IBEA 5KHQA 3A1QB 2GBMA 4G0NB 3D8FA 2FCNA 4A6HA 4XC2A 5CHVC 1LM8B 2ZNVB 2JRIB 4GZUA 4TUUA 2MBBB 1MAIA 3EC8A 3OLMD 3VUYA 2Z0OA 2MCNB 3RCPA 4JL9A 2J59M 3KRXA 1Q67A 2VSZA 3QARA 4TYZA 4F7GA 2KFKB 5LLIA 4F7ZA 1BWNA 1WX9A 4MM3A 4JKCA 3ZDMC 2FAZA 1U5FA 1WJUA 4KSKC 3PRZA 2YS1A 2KTRB 1WE7A 4MY6A 4HAZB 4CHMA 2J0MA 1BTKA 1KZGA 2PPHA 2L7RA 1WGRA 2K2JA 3WANA 4HAXB 1FB8A 4NY0A 1DIKA 1NDDA 3QHTA 2CAYA 1WG7A 2KJ6A 4WAAA 3AU5A 2G4DB 2OTXA 4JQWC 4B95A 2MFQA 4GB9A 1RLFA 3VUXA 2MP2B 5D6JB 3CSFA 3IVFA 2RVBB 3E9OA 4HDQA 1BT0A 3KRWA 4WJOA 2FDQA 3A33B 3RZFA 3O96A 3PREA 1M7RA 3N32A 1WZ3A 3AU4A 1BTNA 5TR5A 1X1FA 5DI9B 1TZ1A 2NR2A 2WWZA 3WAOA 3B0AA 4JKHA 1MIZB 3PEGA 2I5FA 2P0FA 2LOZA 3B08A 2V3SA 3ONSA 1IYFA 5CX3A 3BJIA 3V6EB 5LXIB 3QAQA 5KHOA 3FLVA 3X23A 4GGQA 2CHZA 3GOEA 2C5LC 2C7NB 3KVFB 3PT2B 3RD2A 4DBGA 1VBHA 4DXAB 2IYBA 2DHKA 4YONA 2YLMA 4IM0A 2BWFA 2YVCA 3EPYA 2QKMA 1OTRB 4HJKA 1EVHA 2YS5A 1OQYA 5AZGA 5BO4B 2KDBA 4K7SA 1KLVA 2N1VA 3DVGY 3RYTA 4HDOA 1V5UA 3S2AA 2RGNB 1S1QB 1X1MA 1UNQA 4B9KA 4MSMB 4K7WA 3VXWA 2QKLA 3E9LA 2ELBA 3G9WA 5JH5C 4W9EA 2V4LA 2ZJDA 3N30A 2N4FA 2G45B 5C5BA 1TGZB 4MK0A 2RNRB 3SBGA 1R4MI 2N23A 3UIPB 1U5EA 1G6JA 3DBRI 1MIXA 1C3TA 1RAXA 3PSCA 1B55A 1NTYA 3RUIB 2P0DA 4WWOA 3SYXA 4MGZE 1NU2A 1WXVA 3RZWC 2NZ8B 4ANUA 2R82A 1UPQA 3E66A 4KVGB 2V1YA 1MK7B 2JUOA 3A9KB 2UVMA 2UZRA 1RFAA 2RR9A 3T9LA 3IFWB 3PZDA 4HCPB 1OY2A 4HVBA 2RSGA 3R66C 3U7DA 2EC1A 3TMPB 2NBWB 3L10B 2REXA 3DCGA 3KUDB 1YX5B 5JHHA 1VCBA 2HTHB 3L16A 2L76A 4PQ0A 1WI1A 1MG8A 1Z5SB 1XT9B 2CRFA 2RGFA 4MH0E 1X05A 2LXAA 3PHWB 2IZVB 1K5DB 4URKA 2K39A 1PMSA 3CIKA 2HD5B 2D07B 3WAPA 2OJRA 2R2OA 4JK7A 1I2HA 4IAPA 4K2PA 1YIWA 1Q1OA 5DIFB 1KBLA 2KWVB 3PHXB 2C7HA 2D9WA 2W9NA 4K1RB 2V76A 4A3PA 1AQCA 3W1YA 2NCNA 2KKCA 3APDA 2MDXA 2W2XD 2ELAA 3W1SC 2DYNA 4PNKA 2LZ6A 5C6RA 3PGEA 4GXBA 5DPRA 2DAJA 2BYFA 1V81A 2I1JA 2ROZB 1S3SG 1JRUA 3D8DA 2XEWA 1IRSA 3SD5A 2KWUB 5G2NA 3V6CB 2AL6A 3R7QA 3SV1A 4F7HA 5HE2A 3SNHA 3QA8A 5AZHA 1F9JA 4JK9A 1W1DA 2FCMA 1K5GB 1RRPB 4IOYX 3V5WA 2DX1A 1WIAA 3W1SA 4I6PA 1GJZA 2J0KA 2FIFA 2BKRB 3DQVA 4EMOA 2D9YA 4MDKE 4ANWA 1NBFC 3UZTA 1GNUA 3L17A 1GG3A 3PPAA 4EJNA 1NVLA 2RQ1A 5EDSA 4DHZE 3PVWA 4TKNA 3CSTA 4EFOA 1UD7A 3M95A 1WGDA 2D9ZA 3DVNU 3DXCA 2LKOA 5LONB 3QX1A 3TCAA 1TJ6A 1AARA 2O6VD 2ZNVC 3ENEA 1ZC4B 4BBKA 1U5GA 4LJPB 3VOQA 2KX0A 2I5CA 4NAWB 2DZIA 3VH3B 4K7UA 2DZMA 4WWNA 2DAFA 5J3QA 3ZNHB 2CY5A 2DLWA 2IYDB 5E6PA 3T8MA 3T06A 1K8RB 1WY8A 4HPLB 3ECIA 2XQNM 4N9F4 3H1UA 1H4RA 2KMAA 3N3KB 2VKIA 1GGOA 5C16A 4KZ0A 3A8QA 3DBSA 1RRBA 4FJYA 4MJSA 2MSED 2AL3A 2MW5A 3FP5A 4Z2NA 1WR1A 4FJZA 1U27A 2Q13A 2GS0A 4KIKB 5JHAA 4WQOB 3APCA 2D11A 3ZNID 1UH6A 3DBHI 2IBIB 5HE1A 2G4SA 2LRUA 3KW5B 1CMXB 3TFMA 4GDLB 1YJ1A 2R09A 3PSEB 3FM8C 4W9HA 2ZVOA 4AUQC 4GN1A 3MDBC 4LDTB 4GDLA 1UGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7G A;  2DYO A;  1YD8 U;  1ZC3 B;  1M7R A;  3NOB A;  1OQN A;  2KX3 A;  3N32 A;  4CYE A;  3AU4 A;  1WZ3 A;  2PEA A;  5JZE B;  2Y8F A;  1BTN A;  5TR5 A;  1X1F A;  5DI9 B;  1C3T A;  1IP9 A;  1XD4 A;  1TZ1 A;  2NR2 A;  2WWZ A;  2LWP A;  2EMS A;  3OJ4 B;  1OMW A;  4ZYN A;  2NBU A;  3WAO A;  3R7R A;  1I35 A;  3LJ3 A;  3P7Z A;  2LRW A;  3B0A A;  1QZE A;  1MIZ B;  3PEG A;  2I5F A;  1X86 A;  2P0F A;  2LOZ A;  3M1I B;  1V86 A;  1WXM A;  3B08 A;  5CTR C;  3QWM A;  4M8M A;  2CU1 A;  4ASW C;  2NMB A;  2V3S A;  3IG3 A;  1LB1 A;  3UGB B;  4X57 B;  2LI5 A;  3HW2 B;  1BAK A;  3ONS A;  4KDL B;  1V9J A;  1UNR A;  1IYF A;  2MBE A;  3BJI A;  5CX3 A;  3V6E B;  1VD2 A;  3ZRF A;  3VTV A;  5LXI B;  3QAQ A;  1D3Z A;  3AXC A;  1GC6 A;  2V1Y A;  3H6N A;  4HK2 A;  3NSU A;  4W9F A;  3A8P A;  5KHO A;  2IY1 B;  1KI1 B;  1U29 A;  4ZRI A;  3FLV A;  2YS3 A;  2ZZP B;  2JF5 A;  2LGY A;  3H9D A;  3X23 A;  4GGQ A;  5CLL B;  2CHZ A;  2IO2 B;  1WH3 A;  3GOE A;  2C5L C;  4DHJ B;  3CMM B;  2C7N B;  1V5T A;  3KVF B;  3PT2 B;  4AWJ A;  2D2Q A;  3RD2 A;  4DXA B;  3KY9 A;  2IYB A;  2DHK A;  4DBG A;  4YON A;  2DZJ A;  3OAN A;  4HAT B;  2YLM A;  5JP4 A;  3OJ3 A;  4IM0 A;  2BWF A;  2LVO A;  2DHI A;  2D9X A;  3SUZ A;  2KDF B;  2IO0 B;  2YVC A;  3EPY A;  4NAW A;  2QKM A;  5J3T A;  1YQB A;  2L00 B;  1R4N I;  1I42 A;  1WR6 E;  1OTR B;  3QJZ A;  3I3T B;  2KWC A;  4HJK A;  1EVH A;  2ZVN A;  2YS5 A;  3A9K A;  1EUV B;  3HK0 A;  1OQY A;  4PS3 A;  5AZG A;  2Z59 B;  5BO4 B;  3BIN A;  2IO1 B;  2D9V A;  3AI5 A;  5EFX A;  2XK5 A;  4KZC A;  4GMV A;  1E90 A;  2KDB A;  5G55 A;  1WJ4 A;  2I1K A;  4HAY B;  1P98 A;  4A6F B;  2N1V A;  3DVG Y;  2W2W A;  3H7S A;  3M63 B;  1HE8 A;  4K7S A;  1Q0W B;  2LOX A;  3RYT A;  2P0H A;  3A9J A;  4HDO A;  1V5U A;  5D94 A;  3S2A A;  4E71 A;  1I7A A;  2RGN B;  2JPH A;  2LJ5 A;  1S1Q B;  4PS7 A;  3CXB B;  3F5R A;  1X1M A;  3AUL A;  4DHZ B;  3WYF B;  1ZM0 A;  1DDV A;  2DEN B;  1V5P A;  2COF A;  1XKE A;  2UWQ A;  1UNQ A;  4B9K A;  2J0J A;  2DX5 B;  4MSM B;  1WX8 A;  4K7W A;  2K2U A;  3VXW A;  4EEW A;  2QKL A;  2KMC A;  3TJP A;  3ZKJ C;  1WJM A;  3ML9 A;  3A98 B;  1WF9 A;  3UF8 A;  4EZK A;  2ELB A;  3X0W A;  3FEH A;  1KM7 A;  4FJV B;  5IA7 A;  3G9W A;  1UZX B;  2FNJ B;  4W9E A;  4ZDV A;  3EFU A;  2L1C A;  5JH5 C;  2N0Y A;  1DYN A;  4E3C A;  1HBK A;  4L6E A;  1V80 A;  2V4L A;  1WYW B;  2N4F A;  2Y7B A;  2ZJD A;  3N30 A;  2G45 B;  2O6V B;  3ZO5 B;  1E5W A;  1P6S A;  4B6H A;  2NVU I;  4GU2 A;  2KLG A;  5C5B A;  1TGZ B;  4MK0 A;  2RNR B;  5AEK B;  5DPW A;  1R4M I;  2M0X A;  2FCQ A;  4LDT D;  4NJ7 A;  4WJN A;  1LFD A;  2N23 A;  1NTV A;  1KJT A;  4RM9 A;  1U5E A;  5CLQ B;  2MQJ A;  3UIP B;  2B3A A;  2KFK A;  4JLC A;  3DBR I;  1MIX A;  2L0T A;  3VVW B;  1G6J A;  1RAX A;  3PSC A;  4FHJ A;  1B55 A;  1NTY A;  2EJ8 A;  2OQB A;  4HB4 B;  2NS5 A;  3DVN V;  4XZ4 A;  2P0D A;  4WWO A;  3RUI B;  3SYX A;  2KC2 A;  4BOS C;  2ROV A;  1KLV A;  1WI0 A;  3ZW3 A;  4MGZ E;  1NU2 A;  1WXV A;  2K6Q A;  4WJQ A;  2O6V A;  3JW0 X;  2NZ8 B;  3RZW C;  4ANU A;  4DK5 A;  1FHO A;  1KOT A;  2GBJ A;  1UPQ A;  1P0R A;  2JXX A;  2UZS A;  4KIK A;  4KVG B;  2VRR B;  2LUE A;  1OEY J;  3QIJ A;  4IM3 A;  1HB6 A;  3NZS A;  3PP2 A;  1MK7 B;  1E8W A;  2JUO A;  3TW1 A;  5JLJ B;  1H10 A;  1UNP A;  2RLO A;  2UVM A;  2UZR A;  2M17 A;  3A9K B;  1P3R A;  3K9P B;  4MEM A;  3DDC B;  4RM8 A;  2KAN A;  4A20 A;  2XK5 B;  5E6O A;  5JHG A;  4HHV A;  5LXH A;  1RFA A;  2NBV B;  2RR9 A;  1H8C A;  3HQC A;  3L54 A;  3ZRC A;  3V61 A;  4N9F 4;  2PE9 A;  3T9L A;  3IFW B;  3VH4 B;  3QQ8 B;  3PZD A;  1GUA B;  3PLV A;  1OY2 A;  2BF8 B;  2MBQ A;  2RSG A;  4HCP B;  2GOW A;  4HVB A;  1V89 A;  5L81 A;  1UEL A;  3TIX A;  2L3Z A;  4W9K A;  4EZJ A;  3UQB A;  3R66 C;  4IW0 A;  2Y5B B;  3U7D A;  2LG1 A;  2CB8 A;  3PG7 A;  2KXJ A;  2EC1 A;  4G50 A;  4W9J A;  2LGX A;  3JVZ X;  4NPN A;  2DKQ A;  1OEY A;  2LBB A;  3TMP B;  1NTI A;  2NBW B;  2COD A;  1U2B A;  3L10 B;  4HWI B;  1V61 A;  4BBN F;  1ZGU B;  2REX A;  1J0W A;  3DCG A;  5KCV A;  4WSF A;  5D3Y A;  1YX5 B;  3KUD B;  1WJN A;  3FSS A;  5JHH A;  2C7M B;  2H7D A;  1PLS A;  4GIV A;  4G3X B;  3AJ4 A;  4HPM B;  2NPT A;  1AWE A;  1WM3 A;  1VCB A;  2BWE S;  2GCJ A;  3H7P A;  4FHK A;  1W1H A;  2HTH B;  2QHO A;  1FHW A;  3L16 A;  2L76 A;  2LGD A;  4FA6 A;  4PQ0 A;  1WI1 A;  1MG8 A;  1Z5S B;  3ZDT A;  2LD9 A;  1XT9 B;  3VQI A;  2CRF A;  2RGF A;  3NS8 A;  4KDI C;  2BKF A;  4Z2M B;  2JWZ A;  1LXD A;  5KQ4 A;  1DRO A;  3KUC B;  1EAZ A;  4LCD E;  4MH0 E;  4MGK E;  2BGF A;  4GSW A;  1TQZ A;  1V49 A;  3TL5 A;  1X05 A;  1SIF A;  2CY4 A;  2LXA A;  2KN5 A;  3VTU A;  3PHW B;  1V2Y A;  2IZV B;  1K5D B;  2YT1 A;  4K17 A;  2ZCB A;  3H7P B;  1U5D A;  3HM6 X;  3EHV A;  1Z87 A;  5L83 A;  4MEL A;  4URK A;  2K39 A;  4C0A A;  3KH0 A;  1PMS A;  2Z0P A;  3CIK A;  2HD5 B;  2MX2 A;  2D07 B;  5D27 A;  3WAP A;  3WIM A;  2MLB A;  2GBK A;  5E6N A;  1UEF A;  3VFK A;  3VDZ A;  2L2I A;  1U4A A;  2OJR A;  4AOF A;  3DBL I;  1P5T A;  1ZKH A;  3UQA A;  1HB8 A;  2R2Q A;  2M14 A;  2KTF A;  4GDK A;  3UIN B;  5J3Y A;  5CHW A;  1FGZ A;  2P8V A;  3GYP A;  2R2O A;  2K8H A;  2HJ8 A;  1YX6 B;  2KVR A;  3KUZ A;  2K8B A;  1L2N A;  2AWT A;  1XCG A;  1I2H A;  1V6E A;  1WFY A;  4IAP A;  4W9I A;  4K2P A;  2CHX A;  1YIW A;  5D3X A;  1SHC A;  1WMH A;  4II3 B;  3WAL A;  1Q1O A;  3PLU A;  2M8S A;  2RUK B;  3RT3 B;  5DIF B;  1WJ6 A;  2KWV B;  3GYO A;  2D4Q A;  1X1G A;  1WM2 A;  4GOC A;  1X11 A;  4EUT A;  3MPX A;  2KZR A;  3PHX B;  1WGG A;  4TV3 A;  2DKP A;  2C7H A;  4JIO U;  1T0Y A;  1WGY A;  2D9W A;  3KSY A;  2W9N A;  2V76 A;  4XWX A;  4IM2 A;  4K1R B;  4BVU C;  2BCJ A;  1WJ1 A;  5DPS A;  4BKG A;  1TXD A;  4A3P A;  2KO3 A;  4HCN B;  1AQC A;  3PVL A;  3W1Y A;  3L0W B;  2NCN A;  4F1S A;  1ZW7 A;  4I6N B;  3A9J B;  2KKC A;  2MP2 A;  3QWZ B;  1WMH B;  3APD A;  4EKU A;  4ICV A;  2MDX A;  2FID A;  4HLE A;  4G11 A;  2W2X D;  2GBR A;  5J2R A;  1EO6 A;  1ZVR A;  2ELA A;  2JRH A;  3W1S C;  4J6I A;  4HAW B;  4TQ1 A;  4HB3 B;  4YL8 A;  5GOW B;  2N7E A;  4XX5 A;  4W9D A;  1IPG A;  3MTN B;  1Y5O A;  5IJM A;  2DYN A;  2YF0 A;  4CHK A;  4PNK A;  2LZ6 A;  5DHA B;  2N7D A;  5C6R A;  2D10 A;  4F8C B;  1GC7 A;  3KYD D;  3D32 A;  1P9D U;  1NI2 A;  3D8E A;  2JP2 A;  4GMX B;  3F0W A;  2C60 A;  3NZU A;  4PS8 A;  4W9C A;  3PGE A;  3RCZ A;  4GXB A;  1XD3 B;  5DPR A;  4DWF A;  2DAJ A;  2BYF A;  2UYZ B;  1V81 A;  3ALB A;  5C5B B;  1M7E A;  2I1J A;  1E7U A;  4EOY A;  2KC1 A;  2ROZ B;  2LVQ A;  4MSQ B;  2EMT A;  1XR0 B;  3SO6 A;  2PE6 B;  1WVH A;  3ULB A;  4HB0 B;  1S3S G;  3Q3J A;  4FN2 A;  4HAV B;  2KJH B;  2L0F A;  3CF6 E;  4PYU A;  2W2X C;  1JRU A;  2N9X A;  3U30 A;  1UPR A;  2DYM A;  3D8D A;  3IHP C;  3ZUN A;  2WH5 A;  2HRJ A;  1XX0 A;  1ISN A;  2Z0Q A;  2KFJ A;  1WX7 A;  5HE0 A;  2MKR A;  4HAU B;  2BYE A;  2N1W A;  2DHZ A;  4HB2 B;  2XEW A;  1IRS A;  4K81 A;  3SD5 A;  5JHB A;  4W9L A;  2KWU B;  3DOW A;  4FUL A;  2GMI C;  4ZRK A;  3DXE A;  5G2N A;  3V6C B;  4MJS B;  4AJW A;  1E7V A;  3VTW A;  2AL6 A;  2JZ3 B;  1L7Y A;  3R7Q A;  3UIO B;  2GBN A;  3SV1 A;  1DDM A;  4DBB A;  2G3Q B;  3DPD A;  4IG7 B;  5FI0 A;  1UBI A;  2CKH B;  5DH9 B;  3TO1 A;  5HE2 A;  4F7H A;  2KD0 A;  3PV1 A;  3SNH A;  1PQS A;  3SHQ A;  3VUW A;  2ABD A;  2ADZ A;  3QA8 A;  2XBB C;  5AZH A;  2FJL A;  2H7E A;  2M4N A;  1F9J A;  3PRE A;  4OVV A;  1DBH A;  4KHA A;  2LUL A;  4MT7 A;  2MRP A;  4W9G A;  3JSV B;  4KV2 A;  4NQK E;  3QK0 A;  3VHT C;  1W1D A;  1EGX A;  3A4R A;  2FCM A;  4I6L B;  1M94 A;  1Z2M A;  1K5G B;  3C0R B;  2BYV E;  1WZ0 A;  1RRP B;  3EEC A;  2COP A;  4WVF B;  4MGY E;  4IOY X;  3V5W A;  4K2O A;  2A5U A;  2DX1 A;  1E8X A;  4Y94 A;  2LVP A;  1WIA A;  1FXT B;  3KZ1 A;  1WE6 A;  3QCA A;  3ZTC A;  2YSZ A;  1QC6 A;  1W1G A;  3ZVR A;  3ZIM A;  3W1S A;  2EKE C;  3JYU A;  3M3J A;  4ICU A;  4CHJ A;  3ZTD A;  4I6P A;  1GJZ A;  4NNJ B;  3VIA A;  2IO3 B;  1XOD A;  3M62 B;  2COA A;  2J0K A;  3SU8 X;  1OGW A;  2KCJ A;  4BOZ B;  4A6F A;  2FIF A;  2JY6 A;  2G35 A;  2BKR B;  2J7Q B;  3HM3 A;  4E74 A;  3A1Q A;  4IFS A;  3ZNZ B;  3DQV A;  4EMO A;  2D9Y A;  4DDI D;  2K8C A;  4WWP A;  2HTH A;  2CS4 A;  2KQ7 A;  4NJ6 A;  1XQQ A;  4A3O A;  4BBN C;  5J18 A;  2JVC A;  5FR6 A;  1TBE A;  4KAX B;  2KUP A;  4MDK E;  4MGI E;  3LJU X;  4IUM B;  4ANW A;  2RPQ A;  2WX1 A;  5C23 A;  4A5K A;  2DHJ A;  1TTN A;  3VAW A;  3DXD A;  2D3G A;  1NBF C;  3UZT A;  3ODO A;  1GNU A;  2VRW B;  2CR5 A;  2WDT B;  1FHX A;  2L05 A;  1GG3 A;  3BY4 B;  2Z0E B;  3PPA A;  3V60 A;  4CO7 A;  2YRY A;  3ULC A;  3ML4 A;  3IBE A;  4EJN A;  4II2 B;  2RSU A;  1RJ2 A;  2O2V B;  1ZSQ A;  3A1Q B;  5KHQ A;  1NVL A;  2RQ1 A;  4H8S A;  5EDS A;  4DDG D;  1MK9 B;  3Q3F A;  1Y8R C;  4IC7 B;  2CQU A;  2KLC A;  3N7C A;  5KQ1 A;  2LXC A;  1WRD B;  4PYZ A;  1SGH A;  3R3M A;  3PVW A;  3PVU A;  3OAW A;  4DHZ E;  1FOE A;  4EZL A;  4TKN A;  2IY0 B;  2GBM A;  2LAS A;  3DVG X;  3A4S C;  1EF5 A;  3CST A;  3MHS D;  4G0N B;  4NQL B;  4BKS A;  4EFO A;  3QC8 B;  1ST7 A;  1UD7 A;  5DPT A;  4FAD A;  3M95 A;  1WGD A;  2D9Z A;  3DVN U;  4BKS D;  3D8F A;  2O2V A;  2FCN A;  1J19 A;  4A6H A;  1MKE A;  4XC2 A;  5CHV C;  2X18 A;  3ZLZ A;  3HIZ A;  2K00 A;  3DXC A;  2KDI A;  2LKO A;  5LON B;  3QX1 A;  1KZ7 A;  1V88 A;  1LM8 B;  4KHO A;  2JRI B;  3TCA A;  1TJ6 A;  4GZU A;  2ZNV B;  1AAR A;  2O6V D;  2DX5 A;  2ZNV C;  2KOX A;  3ENE A;  3K9O B;  1ZC4 B;  4BBK A;  4TUU A;  4B6W A;  1U5G A;  2DFK A;  2MBB B;  1DDW A;  3L13 A;  4LJP B;  3ODW A;  4FLH A;  4M0W B;  4AJY B;  1MAI A;  1C1Y B;  3VOQ A;  1E8Z A;  4WJP A;  1WGH A;  1N3H A;  1P3Q U;  3EC8 A;  4AP4 C;  2MWS B;  3OLM D;  5C1Z A;  4A6K A;  5D2M B;  2KHW B;  2KX0 A;  4HXD A;  2I5C A;  2PJH A;  4KSL C;  2KJR A;  2N9P C;  4NAW B;  2DZI A;  1FGY A;  2Z0O A;  3VH3 B;  3VUY A;  2MCN B;  1UBQ A;  5CHF A;  3PRM B;  5FI1 A;  3ML8 A;  4K7U A;  3RCP A;  2DZM A;  3P6A A;  1P1A A;  2KK8 A;  4JL9 A;  2N9E B;  1FAO A;  2J59 M;  3KRX A;  2DAF A;  2ZPN A;  4WWN A;  1ACA A;  1Q67 A;  1WGQ A;  3TVV A;  5J3Q A;  3ZNH B;  1WXA A;  2CY5 A;  2DLW A;  2JZZ A;  2FJ9 A;  2IYD B;  3P2B A;  2VSZ A;  2KTR A;  4TYZ A;  4F7G A;  2GCL A;  2KFK B;  3QAR A;  3ODX A;  3L08 A;  5E6P A;  5LLI A;  1BWN A;  4F7Z A;  2DTC A;  1WX9 A;  2ASQ A;  1QQG A;  4MM3 A;  3T8M A;  3NY5 A;  3T06 A;  2K25 A;  5D3V A;  2MBH A;  4FBJ B;  1K8R B;  2M38 A;  5L95 C;  3ZDM C;  1WY8 A;  3KYC D;  2FAZ A;  4OVU A;  2M1M A;  4HPL B;  1U5F A;  3A33 B;  2XQN M;  2WYQ A;  3APF A;  2R0D A;  1LW3 A;  1WJU A;  3ECI A;  3GZN I;  3PRZ A;  4KSK C;  3U8Z A;  2HE7 A;  3ZVV A;  2YS1 A;  3H1U A;  1H4R A;  2PZ1 A;  3WA0 A;  2KTR B;  3PS6 A;  1SE9 A;  1WE7 A;  5HE3 A;  2KMA A;  2KQS A;  3N3K B;  4MY6 A;  4HAZ B;  1EF1 A;  1V5M A;  4CHM A;  1V5O A;  2J0M A;  1BTK A;  1KZG A;  2VKI A;  4WJ7 A;  2PPH A;  5GMV A;  5C16 A;  2K1F A;  4ANX A;  2L7R A;  3PRP B;  4KZ0 A;  3A8Q A;  1WGR A;  3DBS A;  1RRB A;  2K2J A;  4DHJ D;  2MWN B;  2MBO A;  3V62 A;  3WAN A;  4FJY A;  4MJS A;  4HAX B;  5DCN A;  1FB8 A;  5C79 A;  2L8J A;  2MSE D;  4NY0 A;  2AL3 A;  2MW5 A;  2Y8G A;  3FP5 A;  1WXS A;  4Z2N A;  1NDD A;  1PFJ A;  1LQB A;  4RMA A;  3WAM A;  2GJY A;  1WR1 A;  2KDE B;  4FJZ A;  2AEH A;  1U27 A;  3QHT A;  1E8Y A;  2CAY A;  2Q13 A;  4GDK B;  1WG7 A;  3QBV B;  2KJ6 A;  2GS0 A;  4IWP A;  3AU5 A;  2G4D B;  4WAA A;  4ZRJ A;  2OTX A;  4KHB B;  4JQW C;  5HKH A;  3LDZ E;  5LOP B;  4KIK B;  2AYO B;  5JHA A;  3JSV A;  3MJW A;  3APC A;  4WQO B;  4NSW A;  2BPS A;  2D11 A;  2A4Z A;  2CHW A;  2ZCC A;  4BFR A;  3ZNI D;  2C9W B;  1UH6 A;  3DBH I;  2DYQ A;  2DZK A;  3NHE B;  2K6D B;  2FUH B;  2IBI B;  4D0N B;  4B95 A;  2MFQ A;  5D3W A;  5HE1 A;  1RLF A;  4GB9 A;  1Y19 B;  4BKT A;  4ANV A;  5AZF A;  4F7U P;  1A5R A;  2Z0D B;  4LJO B;  2G4S A;  3L17 A;  1J8C A;  2LRU A;  3HHM A;  3KW5 B;  2DA0 A;  1WGU A;  2KGX B;  1CMX B;  3VUX A;  2LYD A;  3TFM A;  4GDL B;  4IWO A;  5DHF B;  3RZF A;  3ZNG C;  4M8N A;  2YT0 A;  1YJ1 A;  2OOB B;  2IFS A;  2COC A;  2MP2 B;  3O65 B;  5D6J B;  2R09 A;  4JGH B;  3PSE B;  3FM8 C;  3CSF A;  2ZPY A;  4GPT B;  2FCS A;  1Q5W B;  3IVF A;  3B1L X;  4W9H A;  4TQ0 A;  2KNB A;  2ZVO A;  2RVB B;  4IWQ A;  3RUL A;  4AUQ C;  4P7I A;  4GN1 A;  4DX9 0;  2JT4 B;  1MPH A;  3PTF C;  3MDB C;  3SDL C;  4HDQ A;  2E2X A;  2DYB A;  2ZEQ A;  5IAA C;  1BT0 A;  3KRW A;  4LDT B;  5J17 A;  4GDL A;  4WJO A;  1UGM A;  1J0G A;  2FDQ A;  4DX8 A;  2MA9 B;  2WX0 A;  2NPT B;  3O96 A;  3TBL D;  2DN6 A;  2RD0 A; 
#chains in the Genus database with same CATH topology
 5D7G A;  2DYO A;  3NOB A;  1OQN A;  2KX3 A;  1ZDV A;  3NUH B;  2KR0 A;  1RM6 C;  2Y8F A;  4HSI A;  1I35 A;  3DBR B;  3BYT B;  2LRW A;  2L52 A;  1QZE A;  3ZNZ B;  1IP9 A;  1X86 A;  2XN9 C;  4M8M A;  2CU1 A;  2NMB A;  3IG3 A;  3URY A;  2JX5 A;  1LB1 A;  3VRA B;  1BAK A;  2MBE A;  1D3Z A;  3H6N A;  1GC6 A;  4HK2 A;  2IY1 B;  1KI1 B;  1VDV A;  1U29 A;  2JU6 X;  2IO2 B;  4OSN A;  1V97 A;  3BVZ A;  4C56 C;  3KY9 A;  2DZJ A;  4HAT B;  5JP4 A;  1FPY A;  3SUZ A;  2KDF B;  4TMA B;  4HEA 1;  3AE4 B;  5BMG A;  2ZVN A;  4PS3 A;  3BVG A;  1EUV B;  3HK0 A;  4O1N A;  2Z59 B;  2IO1 B;  3AI5 A;  5EFX A;  2W55 A;  4KZC A;  5G55 A;  3VTU A;  2I1K A;  4HAY B;  2M19 A;  4A6F B;  3H7S A;  3WAM A;  2LOX A;  4LNI A;  4M0W A;  1V5P A;  2IND C;  3ZGZ A;  1WX8 A;  4EEW A;  3ZYY X;  1WF9 A;  2FNJ B;  2N0Y A;  2PIA A;  1AWD A;  3DHG C;  1HBK A;  1I4G A;  1WYW B;  1JDE A;  2Y7B A;  2L32 A;  1E6E B;  2O6V B;  1E5W A;  4GU2 A;  4YTM B;  3B2F A;  1ESF A;  1HEZ E;  3P4Q B;  5DPW A;  2BT6 A;  2FCQ A;  4NJ7 A;  4WJN A;  4FBJ B;  1NTV A;  2QIL A;  4JLC A;  4FHJ A;  2G1E A;  2EJ8 A;  3RPF C;  2OQB A;  2KC2 A;  3VRB B;  2ROV A;  3ZW3 A;  2O6V A;  3JW0 X;  4HRS A;  2VRR B;  2LUE A;  3QIJ A;  3NZS A;  4S0R A;  3EUB 2;  3PP2 A;  3KUC B;  3K9P B;  2M17 A;  4RM8 A;  1QKZ A;  5AUK A;  3Q8A A;  1YN4 A;  5E6O A;  4HHV A;  1JAL A;  5LXH A;  2NBV B;  1H8C A;  3L54 A;  3ZRC A;  3V61 A;  3QQ8 B;  3PLV A;  1QOF A;  2GOW A;  1UEL A;  3UQB A;  4EZJ A;  4WWM A;  3IXS A;  4IW0 A;  2KXJ A;  3PG7 A;  2LGX A;  4OW0 A;  2LBB A;  1NTI A;  1N63 A;  4BBN F;  1PGX A;  4RGO S;  1WRI A;  1E0Z A;  5KCV A;  3TEZ A;  4WQM A;  3FSS A;  2PVG C;  1PLS A;  4GIV A;  1AWE A;  1WM3 A;  2BWE S;  3H7P A;  2GCJ A;  4M02 A;  1FHW A;  2LGD A;  2BKF A;  2JWZ A;  1LXD A;  4BOS C;  3TL5 A;  4GSW A;  1V49 A;  1SIF A;  2CY4 A;  4JWU C;  1V2Y A;  2YT1 A;  3H7P B;  2RPV A;  1U5D A;  5C3J B;  1QF6 A;  4C0A A;  2Z0P A;  4UDU C;  5D27 A;  2L2I A;  1U4A A;  1ZKH A;  4Q2J A;  3GYP A;  2PVO D;  1ZOY B;  2K8H A;  4L1B A;  1QT9 A;  1V6E A;  2GI9 A;  2CHX A;  1SHC A;  1I4X A;  1WJ6 A;  4HKZ E;  1WM2 A;  4EUT A;  3MPX A;  3BVM A;  3R2I A;  4JIO U;  1T0Y A;  3KSY A;  4IM2 A;  1P7F A;  4BVU C;  2OHF A;  4HCN B;  2MH7 A;  4F1S A;  3DCX A;  2QEJ C;  4JE3 B;  1JRP A;  4QXA B;  3RMK C;  4ILH A;  5J2R A;  3NVZ A;  1EO6 A;  2JRH A;  2N7E A;  3MTN B;  3LB8 C;  5AUI A;  5IJM A;  2YF0 A;  4CHK A;  2N7D A;  3RNC C;  2D10 A;  1GC7 A;  3D32 A;  1P9D U;  1NI2 A;  4GMX B;  4RGN A;  4PS8 A;  4C7Y A;  2K5P A;  2BW2 A;  1TKY A;  5C5B B;  1M7E A;  3LYY A;  2KC1 A;  1JQ4 A;  3SO6 A;  2L0F A;  2WH5 A;  2HRJ A;  1XX0 A;  2WS3 B;  1ISN A;  2Z0Q A;  2KFJ A;  1E10 A;  1MHH E;  2N1W A;  5HE0 A;  2MKR A;  2DHZ A;  4KGS A;  4HB2 B;  4K3C A;  4W9L A;  1TZO A;  3DOW A;  3DXE A;  4AJW A;  1JCK B;  3MC0 B;  1L7Y A;  1DDM A;  4DBB A;  3DPD A;  4LTU A;  3Q8F A;  2CKH B;  5DH9 B;  3TO1 A;  3PV1 A;  3VUW A;  2W3R A;  2ADZ A;  4YTN B;  2FJL A;  4KHA A;  2MRP A;  1VLB A;  1XO3 A;  4A9A A;  2BYV E;  3EEC A;  2IDY A;  4WVF B;  1ZYI A;  4K2O A;  3QCA A;  1WE6 A;  2YSZ A;  3ZVR A;  2EKE C;  3JYU A;  4CHJ A;  1NYQ A;  2IO3 B;  3M62 B;  2COA A;  3A1Q A;  4XE0 A;  1JW9 D;  3P1M A;  1DGJ A;  2CS4 A;  4NJ6 A;  4BBN C;  1XQQ A;  2JVC A;  5FR6 A;  1TBE A;  2VZK B;  3LJU X;  1HA5 A;  4IUM B;  2RPQ A;  4A5K A;  1SB3 C;  1TTN A;  3HUI A;  3VAW A;  3ODO A;  1KFY B;  4KGR A;  2WDT B;  1FHX A;  3Q8E A;  3V60 A;  3AEA B;  4II2 B;  1RJ2 A;  2O2V B;  1ZSQ A;  2JXT A;  2WXR A;  1MHX A;  4IC7 B;  3Q3F A;  1Y8R C;  1RWS A;  2KLC A;  3N7C A;  4PYZ A;  1SGH A;  3OAW A;  1FOE A;  2IY0 B;  2LAS A;  3DVG X;  3A4S C;  3MHS D;  4NQL B;  4BKS A;  1ST7 A;  4FAD A;  2QDF A;  3ZLZ A;  2O2V A;  1J19 A;  3SEB A;  1XLQ A;  3HIZ A;  4LLG M;  1T3Q A;  2K00 A;  1CJE A;  1YN5 A;  1KZ7 A;  1V88 A;  3EGR A;  4YSY B;  4B6W A;  2DX5 A;  3NS1 A;  2D3B A;  2DFK A;  4M0W B;  3L13 A;  1DDW A;  2LJI A;  3ODW A;  4HRO A;  1WGH A;  1N3H A;  4AP4 C;  4A6K A;  1P7E A;  5D2M B;  3V3X A;  2KHW B;  4HXD A;  2QIE B;  2N9P C;  3Q14 C;  4C00 A;  1UBQ A;  2CJN A;  1R7S A;  2CJO A;  5IO9 A;  1WGQ A;  1WXA A;  4PK1 A;  2KTR A;  3L08 A;  2Y3A A;  1E7P B;  3NY5 A;  5D3V A;  2MBH A;  2M38 A;  5L95 C;  4ZRP A;  3KYC D;  1HZ6 A;  3APF A;  2R0D A;  1LW3 A;  2PMV A;  1EU4 A;  3ZVV A;  3U8Z A;  4L1R A;  1JWB D;  3WA0 A;  4RFB A;  1SE9 A;  2KQS A;  5HE3 A;  1MJD A;  1V5O A;  4MM3 B;  1KRH A;  2JYE A;  1FRD A;  1QIL A;  3PRP B;  3I5J C;  1A70 A;  1BXT A;  1J7B A;  4DHJ D;  2MBO A;  5C79 A;  4JKG A;  2QJL A;  2KVZ A;  1WXS A;  2W3S A;  2KIE A;  1LQB A;  4KKI A;  4RMA A;  1T0S C;  2GJY A;  2KDE B;  5EE0 A;  2AEH A;  1E8Y A;  4QJ4 B;  4GDK B;  5T8I A;  4HKQ A;  1K50 A;  3LDZ E;  5LOP B;  3JSV A;  4NSW A;  2A4Z A;  4BFR A;  2K3U A;  2C9W B;  3NHE B;  3W9C B;  1TJE A;  2FUH B;  4BKT A;  4D0N B;  5HFY A;  5D3W A;  1ET6 A;  1A5R A;  1GB4 A;  1SSN A;  1Y56 A;  5AZF A;  4ANV A;  2Z0D B;  4LJO B;  3HHM A;  2DA0 A;  1YNT E;  2LYD A;  1TIF A;  4IWO A;  4JKA A;  1VRA B;  4IOI E;  2INC C;  4M8N A;  2YT0 A;  3ZNG C;  3O65 B;  2IFS A;  4N59 A;  3AE2 B;  1Q5W B;  4IDI A;  2KNB A;  4IWQ A;  5HG2 A;  3RUL A;  4P7I A;  4DX9 0;  3U2S C;  3PTF C;  2E2X A;  2DYB A;  4JWS C;  5IAA C;  1WGK A;  5J17 A;  2WLB A;  1J0G A;  2WX0 A;  2NPT B;  4B0E A;  3TBL D;  2DN6 A;  2RD0 A;  5J18 A;  2WU5 B;  5H8Y E;  2WXN A;  4CYE A;  3DWM A;  5JZE B;  4K3B A;  1XD4 A;  4ZYN A;  2LWP A;  2EMS A;  2NBU A;  3AE3 B;  2JQR B;  3M1I B;  1WXM A;  1IBX A;  3QWM A;  4ASW C;  3P42 A;  4C4V B;  2LI5 A;  4KDL B;  1V9J A;  4US9 A;  3VTV A;  3ZRF A;  4JPS A;  5TSS A;  3NSU A;  4W9F A;  3A8P A;  3FIL B;  2I2Y A;  4RF0 A;  2YS3 A;  2JF5 A;  3H9D A;  1FXA A;  4EE2 A;  1IBX B;  3I63 C;  1V5T A;  3RI7 C;  2LHD A;  1QQR A;  2BB6 A;  4NAW A;  1PUT A;  2L00 B;  1R4N I;  1WR6 E;  3QJZ A;  2KWC A;  2L1A A;  5I2M A;  3AV8 A;  2XK5 A;  4GMV A;  1E90 A;  2H88 B;  1JWU D;  2BBC A;  1WJ4 A;  3M63 B;  3ZUN A;  4JKE A;  1HE8 A;  1UNS A;  2P0H A;  4E71 A;  1I7A A;  2JPH A;  2LJ5 A;  1F1H A;  3WYF B;  1YQ4 B;  2QC8 A;  2V4I B;  1DDV A;  1XKE A;  2DLB A;  2UWQ A;  2WXF A;  4JX1 C;  2DX5 B;  4IKG A;  2DNF A;  1WJM A;  4EZK A;  3X0W A;  5IA7 A;  4QAY A;  5LG4 B;  1UZX B;  4ZDV A;  2L1C A;  1DYN A;  1ROE A;  3NVY A;  4E3C A;  1V80 A;  1P6S A;  2ONQ A;  2NVU I;  2AQ2 B;  3IAS 1;  3BII D;  1LFD A;  1KJT A;  4BZA A;  2MQJ A;  5CLQ B;  2B3A A;  3VVW B;  4HB4 B;  4XZ4 A;  3Q3O C;  1WI0 A;  4WJQ A;  1N6Z A;  2K6Q A;  2DWQ A;  2NTS A;  2GBJ A;  2JXX A;  2UZS A;  4KIK A;  2GUM A;  3OG5 A;  1L2N A;  1E8W A;  2RLO A;  1H10 A;  1UNP A;  3DDC B;  2KAN A;  5JHG A;  3BZD B;  1CZP A;  1TY0 A;  2MBQ A;  3TIX A;  2L3Z A;  3KWV A;  2X0S A;  5LNK 1;  2Y5B B;  2CB8 A;  4W9J A;  2DKQ A;  1OEY A;  1V1P B;  4JK8 A;  4HWI B;  3ENB A;  1V61 A;  2IGG A;  1ZGU B;  2UU7 A;  4WSF A;  5D3Y A;  3J9C A;  2C7M B;  2PLP A;  2H7D A;  4FHK A;  4RGM A;  2ACZ B;  1GOZ A;  1MI1 A;  4A8X C;  3IT4 B;  4Z2M B;  4RGT A;  5KQ4 A;  1EAZ A;  4LCD E;  4MGK E;  1TQZ A;  2LMC A;  2KN5 A;  2RMM A;  4K17 A;  2ZCB A;  1OQQ A;  3HM6 X;  3EHV A;  2DIK A;  1Z87 A;  5L83 A;  4MEL A;  1FNU A;  2KMM A;  2MX2 A;  4L23 A;  3WIM A;  2GBK A;  4P16 A;  3VDZ A;  4S17 A;  1P5T A;  1HB8 A;  2R2Q A;  4GDK A;  5J3Y A;  2V3P A;  5CHW A;  1FGZ A;  2P8V A;  3SFE B;  1YX6 B;  2KVR A;  2AWT A;  1XCG A;  3NZ3 A;  1WFY A;  3NVW A;  1C78 A;  4D2K A;  5D3X A;  2WXK A;  3RT3 B;  2RUK B;  1X1G A;  4GOC A;  1X11 A;  2KZR A;  2HJ1 A;  1WGY A;  4CSQ A;  4N58 A;  1E9M A;  4XWX A;  2B76 B;  2BCJ A;  1WJ1 A;  1ZPS A;  5DPS A;  3RFZ B;  1UF0 A;  3U52 E;  3PVL A;  3L0W B;  1PFD A;  4I6N B;  3A9J B;  2MP2 A;  3MP9 A;  2X8X X;  4ICV A;  1ZUD 2;  2FID A;  4G11 A;  2I38 A;  3P63 A;  3SBT A;  4TQ1 A;  4HB3 B;  1Y5O A;  5DHA B;  4F8C B;  3DHI C;  3D8E A;  2C60 A;  3NZU A;  3RCZ A;  2ZW1 A;  1UWX A;  2KAJ A;  1XD3 B;  4DWF A;  2UYZ B;  1DOY A;  2ZKM X;  1V1O A;  1E7U A;  2VH1 A;  4EOY A;  2BS4 B;  2LVQ A;  4MSQ B;  2EMT A;  1XR0 B;  2PE6 B;  4WJP A;  1WVH A;  4HB0 B;  4PYU A;  3CF6 E;  3U30 A;  1C79 A;  1K53 A;  3AB5 A;  3I57 A;  1WX7 A;  2BYE A;  1PYW D;  1FRR A;  4RCO A;  2GMI C;  4ZRK A;  1E7V A;  4LNK A;  2JZ3 B;  1JWS D;  3N1Y C;  3UIO B;  4IG7 B;  1PGA A;  1UBI A;  2KD0 A;  3SHQ A;  1PQS A;  3VR8 B;  2NBV A;  5FKA C;  2E3T A;  3MJ5 A;  4B0M A;  2H7E A;  4OVV A;  1NVI D;  2LUL A;  3VHT C;  4OT1 A;  3JSV B;  2Q5W D;  2IGD A;  1EGX A;  3A4R A;  4I6L B;  1M94 A;  1Z2M A;  2A5U A;  1E8X A;  3KZ1 A;  5BYQ A;  3ZTC A;  1QC6 A;  2M56 B;  3M3J A;  3ZTD A;  2N9K A;  5M4Y B;  4NNJ B;  1FD6 A;  3SU8 X;  4BOZ B;  1OGW A;  4A6F A;  3HM3 A;  2G35 A;  1B9R A;  4IFS A;  2G9H D;  2K8C A;  4WWP A;  4A3O A;  1YN3 A;  2K22 A;  4KAX B;  2KUP A;  4MGI E;  2DHJ A;  1TS5 A;  3FIL A;  3DXD A;  4REZ A;  2VRW B;  3BY4 B;  4A90 A;  4WAF A;  4CO7 A;  3BWU D;  2Z0E B;  1JWA D;  2YRY A;  3ULC A;  2RSU A;  4H8S A;  1VZ8 A;  1MK9 B;  2KQ4 X;  3OWE B;  2CQU A;  1FCL A;  5KQ1 A;  2LXC A;  1WRD B;  3E9S A;  3R3M A;  3PVU A;  4EZL A;  1EF5 A;  2WXM A;  1L6V A;  3FC4 A;  3QC8 B;  5DPT A;  2INN E;  3R2T A;  2QCZ A;  4BKS D;  1MKE A;  3ZXV A;  2WXJ A;  2X18 A;  3PZ7 A;  2K49 A;  3U12 A;  2J4X A;  1T6B X;  2KDI A;  3NG0 A;  4KHO A;  3K9O B;  2KOX A;  4E74 A;  4H2A A;  4FLH A;  3P4S B;  4AJY B;  1C1Y B;  3NW8 A;  1E8Z A;  5D3I B;  1P3Q U;  1XLO A;  2MWS B;  5C1Z A;  2PJH A;  4KSL C;  2CU3 A;  2KJR A;  1FGY A;  1CQV A;  1J7C A;  5CHF A;  4JKF A;  3PRM B;  5FI1 A;  3ML8 A;  2KUQ A;  3P6A A;  1P1A A;  2KK8 A;  2N9E B;  1FAO A;  2ZPN A;  1ACA A;  2Z8L A;  3TVV A;  2JZZ A;  3P2B A;  2FJ9 A;  2PW9 A;  2N9L A;  3AE7 B;  2KT7 A;  1L5P A;  2GCL A;  1SBB B;  3B2G A;  3ODX A;  1T0R C;  2DTC A;  2ASQ A;  1QQG A;  2K25 A;  2HTM E;  5EE3 A;  4OVU A;  4JKG B;  2M1M A;  5I2S A;  2WYQ A;  3GZN I;  2HE7 A;  5H92 C;  3B77 A;  2PZ1 A;  3PS6 A;  2JYT A;  3PO0 A;  1EF1 A;  1V5M A;  1RFK A;  1JWM D;  4WJ7 A;  1MPE A;  3MHZ A;  5GMV A;  3NWD A;  2K1F A;  4ANX A;  2QSD A;  3Q69 A;  2MWN B;  3V62 A;  2LEK A;  5DCN A;  1QOA A;  2L8J A;  4QJ5 B;  4YTP B;  2Y8G A;  4XDC A;  4OZB A;  1PFJ A;  1QLB B;  3QBV B;  4IWP A;  2LFI A;  4ZRJ A;  4KHB B;  1C77 A;  5HKH A;  4NZL B;  2JSV X;  1KC7 A;  2AYO B;  3MJW A;  2BPS A;  2ZCC A;  2CHW A;  5D3D A;  3Q3N C;  3AED B;  1BUI C;  2DYQ A;  1ZDX A;  1FMA D;  2DZK A;  2K9X A;  2K6D B;  1D4B A;  3N20 C;  1SE3 A;  1Y19 B;  1J8C A;  4F7U P;  1EM7 A;  1WGU A;  2KGX B;  3P4P B;  5DHF B;  2BVC A;  2OOB B;  2COC A;  5IRS A;  1OFF A;  2DBY A;  3TUO A;  3CWI A;  4JGH B;  2ZPY A;  4GPT B;  2FCS A;  1SEB D;  3B1L X;  4TQ0 A;  2JT4 B;  1MPH A;  5EE1 A;  2ZEQ A;  3SDL C;  2IGH A;  2KDM A;  1CK1 A;  2MA9 B;  4DX8 A;  3E56 A;  3ZXR A;  3SR6 A;  5FR3 A;  1YD8 U;  1ZC3 B;  1BML C;  4TSS A;  3MC9 A;  4L2Y A;  2PEA A;  1WSP A;  2MJE A;  4R3D A;  3C19 A;  3OJ4 B;  1OMW A;  5FK9 C;  3R7R A;  3LJ3 A;  3P7Z A;  2YEP B;  3DBH B;  1V86 A;  5CTR C;  3AN1 A;  1DOX A;  1JML A;  1MFW A;  3UGB B;  4X57 B;  3HW2 B;  1YMH E;  1UNR A;  3ZJV A;  1VD2 A;  3AXC A;  2WDQ B;  4ZRI A;  2ZZP B;  2LGY A;  5CLL B;  4DHJ B;  1XCQ L;  1WH3 A;  3CMM B;  4YSX B;  4AWJ A;  2D2Q A;  1ZXI A;  3OAN A;  3OJ3 A;  2LVO A;  2DHI A;  2D9X A;  2NTT A;  2IO0 B;  2BQQ A;  3NJT A;  5J3T A;  1FFU A;  1YQB A;  1I42 A;  1ZP0 B;  1MG4 A;  3I3T B;  2LUM A;  2OED A;  3A9K A;  3BIN A;  2D9V A;  2WHI A;  1WYG A;  1P98 A;  2JWU A;  3RNG C;  2W2W A;  2N0S B;  1Q0W B;  3A9J A;  3HIE A;  5D94 A;  1L0Y B;  1N62 A;  4DHZ B;  4PS7 A;  3CXB B;  3F5R A;  3AUL A;  3GE8 C;  1ZM0 A;  3HSA A;  3Q8C A;  2DEN B;  2COF A;  3Q8B A;  2NMQ A;  2J0J A;  2RDB C;  2K2U A;  2KMC A;  3TJP A;  3ZKJ C;  3ML9 A;  3A98 B;  4NAM A;  4YSZ B;  3UF8 A;  1AN8 A;  3FEH A;  1KM7 A;  4FJV B;  1VJK A;  3EFU A;  4L6E A;  3DBL B;  3ZO5 B;  4B6H A;  4JKB A;  2KLG A;  1SE4 A;  5AEK B;  2M0X A;  4LDT D;  3CIR B;  4RM9 A;  2INP E;  2KFK A;  2L0T A;  4MGY E;  3DVN V;  1LO5 D;  2FE8 A;  2NS5 A;  2RRF A;  1YQ3 B;  1XF5 L;  4DK5 A;  1FHO A;  1KOT A;  1P0R A;  3TSS A;  5I4D A;  1OEY J;  4IM3 A;  4P1C C;  1HB6 A;  2H89 B;  3TW1 A;  5JLJ B;  4MEM A;  3E9P A;  1F77 A;  2Y5C A;  1P3R A;  2ON8 A;  4NJC A;  4ZRQ A;  4A20 A;  2XK5 B;  1KLU D;  4USA A;  3HQC A;  2PE9 A;  1D6E C;  3VH4 B;  1GUA B;  2BF8 B;  3W5U B;  4XGA B;  1V89 A;  5L81 A;  4W9K A;  4GOU A;  2LG1 A;  4G50 A;  3JVZ X;  4NPN A;  3N9Y C;  2COD A;  1U2B A;  1J0W A;  4A55 A;  3AE6 B;  1WJN A;  1C76 A;  2N7J A;  4G3X B;  3AJ4 A;  4HPM B;  1C4P A;  2NPT A;  3GP7 A;  1W1H A;  1F0Z A;  2QHO A;  2LHE A;  4FA6 A;  3ZDT A;  2LD9 A;  3RNB C;  3VQI A;  3NS8 A;  4KDI C;  4WIP A;  4XDD A;  3UIN B;  1VBG A;  1DRO A;  1SE2 A;  2BGF A;  4KGT A;  1FEH A;  4ILG B;  3FVC A;  3KH0 A;  2MLB A;  4MAC A;  5E6N A;  1R4M B;  1UEF A;  3VFK A;  4AOF A;  3DBL I;  3AEG B;  1L4Z B;  3UQA A;  2M14 A;  2KTF A;  2HJ8 A;  1TKG A;  3KUZ A;  2K8B A;  3Q6B A;  3AEC B;  4MT5 A;  3ZJU A;  4W9I A;  1C4A A;  1WMH A;  4II3 B;  3WAL A;  2RDH A;  3PLU A;  2M8S A;  3GYO A;  2D4Q A;  4ITK A;  1T77 A;  1WGG A;  4TV3 A;  4DQO C;  2DKP A;  1Q10 A;  3DHH C;  2WGS A;  5HI1 A;  4BKG A;  1TXD A;  2KO3 A;  1ZW7 A;  1EWC A;  3QWZ B;  1WMH B;  1EU3 A;  4EKU A;  4HLE A;  2GBR A;  2LGI A;  1ZVR A;  4WH4 A;  2J42 A;  4J6I A;  4HAW B;  4YL8 A;  5GOW B;  4XX5 A;  4W9D A;  2KWD A;  1IPG A;  1F52 A;  3KYD D;  4W9C A;  2JP2 A;  3F0W A;  4KHB A;  2AQ3 B;  2W54 A;  3ALB A;  4HPP A;  2V9H A;  3Q3J A;  3ULB A;  4FN2 A;  3AE5 B;  5JVL A;  4HAV B;  2KJH B;  2W2X C;  2N9X A;  1UPR A;  4JKD A;  2DYM A;  3IHP C;  4YWG G;  3ETR A;  3TEW A;  4DXF A;  4ACF A;  4HAU B;  4ZHO A;  4C4V A;  4K81 A;  5JHB A;  1YOV B;  2VH2 A;  2ICI A;  4FUL A;  4MJS B;  1L6U A;  1V8C A;  1YJJ A;  3VTW A;  1FFV A;  1MI0 A;  2GBN A;  2G3Q B;  1KTK A;  5FI0 A;  4DDG D;  4LNN A;  2ABD A;  2XBB C;  1FIQ A;  2RDG A;  4YT0 B;  1NI3 A;  2M4N A;  1PGB A;  4ILJ A;  2AX5 A;  1XCT L;  1DBH A;  1XEE A;  4MT7 A;  4W9G A;  4KV2 A;  4NQK E;  1IUE A;  3QK0 A;  2WXQ A;  3C0R B;  4XWT A;  1T5X D;  1WZ0 A;  2COP A;  2LVP A;  4Y94 A;  1FXT B;  1STE A;  1W1G A;  2WXL A;  3ZIM A;  4ICU A;  2BB5 A;  1LGR A;  3VIA A;  1KH0 A;  1XOD A;  2FUG 1;  2KCJ A;  2JY6 A;  2J7Q B;  1F2R C;  4DDI D;  3RN9 C;  2HTH A;  1N61 A;  2KQ7 A;  5IOI A;  4AQ7 A;  1L4D B;  2WX1 A;  5C23 A;  5BMH A;  2D3G A;  2CR5 A;  2L05 A;  2KIG A;  3Q2A C;  3ML4 A;  3IBE A;  5KHQ A;  3A1Q B;  1HTO A;  1ENF A;  1FO4 A;  2GBM A;  4G0N B;  2AQ1 B;  5BYS A;  3FKY A;  2Z59 A;  3D8F A;  2FCN A;  4A6H A;  4XC2 A;  5CHV C;  4XWW A;  5BYR A;  3MC8 A;  3AE1 B;  3ZJT A;  4ARI A;  3AEB B;  1LM8 B;  2LGS A;  2ZNV B;  2JRI B;  4CQN A;  4GZU A;  4TUU A;  4QJ3 B;  1GB1 A;  2MBB B;  1MAI A;  2M0A A;  3EC8 A;  3OLM D;  1UWM A;  5IKC M;  4N6E B;  3VUY A;  2Z0O A;  2MCN B;  3RCP A;  4JL9 A;  2J59 M;  3KRX A;  2KN4 A;  5E6J A;  1Q67 A;  2JZP A;  3PZ8 A;  5BMI A;  3W5V B;  2FBW B;  2VSZ A;  3QAR A;  4TYZ A;  4F7G A;  2KFK B;  1SF0 A;  5LLI A;  4F7Z A;  1BWN A;  1WX9 A;  4MM3 A;  4JKC A;  3RNF C;  3ZDM C;  1J7A A;  2Y5P A;  2FAZ A;  2ZW0 A;  1U5F A;  1WJU A;  4KSK C;  3PRZ A;  2YS1 A;  3BK1 A;  3KLS X;  1D5X C;  2KTR B;  1WE7 A;  1I4Q A;  2KYW A;  3N1X C;  4MY6 A;  4HAZ B;  4CHM A;  2J0M A;  1BTK A;  1N5X A;  2PPH A;  1KZG A;  2L7R A;  3GB1 A;  4KX6 B;  1WGR A;  1TS3 A;  2K2J A;  3WAN A;  4HAX B;  1RYJ A;  1FB8 A;  4NY0 A;  1DIK A;  1NDD A;  1K52 A;  4A6Q A;  2VZK D;  3QHT A;  2CAY A;  3ABV B;  1WG7 A;  2KJ6 A;  4WAA A;  3AU5 A;  2G4D B;  2OTX A;  3BK2 A;  4P1B C;  4JQW C;  3NRZ A;  1KLG D;  2WDR B;  4B95 A;  2MFQ A;  4GB9 A;  1RLF A;  1IGD A;  3VUX A;  2MHJ A;  5HHD G;  1SJH D;  1NEN B;  5JXV A;  2YT2 A;  2SEB D;  2BTE A;  1FCC C;  2MP2 B;  5D6J B;  2X38 A;  3CSF A;  3ZQ4 A;  3IVF A;  2RVB B;  2R2Y A;  2SAK A;  1XXG A;  2GLS A;  3E9O A;  4HDQ A;  1BT0 A;  3KRW A;  4WJO A;  2FDQ A;  3A33 B;  3O96 A;  3RZF A;  3PRE A;  3LXF A;  4ZOH C;  1M7R A;  3N32 A;  1T0Q C;  3AU4 A;  1WZ3 A;  1BTN A;  5TR5 A;  1X1F A;  5DI9 B;  1OQR A;  1ZXH A;  5IP4 D;  1L0X B;  1TZ1 A;  2NR2 A;  2WWZ A;  3WAO A;  3EFC A;  1I4H A;  3T3N A;  1FM0 D;  4RH6 A;  3B0A A;  2L83 A;  4JKH A;  1MIZ B;  3PEG A;  2I5F A;  2P0F A;  2W82 A;  2LOZ A;  3UI3 A;  3B08 A;  2MJD A;  2V3S A;  1FXI A;  1I4P A;  2MEK A;  3ONS A;  1IYF A;  5CX3 A;  3BJI A;  3V6E B;  5LXI B;  3QAQ A;  4P6V F;  4D6W A;  5KHO A;  4GLS C;  4MH8 A;  3FLV A;  3X23 A;  4GGQ A;  2CHZ A;  3GOE A;  2C5L C;  2C7N B;  3KVF B;  3PT2 B;  3RD2 A;  4DBG A;  1VBH A;  4DXA B;  2IYB A;  2DHK A;  3I9V 1;  4YON A;  1UUP A;  1HTQ A;  2YLM A;  4IM0 A;  2BWF A;  2YVC A;  3EPY A;  2QKM A;  2WQY B;  1OTR B;  4AS1 A;  2YEP F;  4YXD B;  4HJK A;  1EVH A;  2YS5 A;  1OQY A;  5AZG A;  5BO4 B;  4LNF A;  2KDB A;  4LNO A;  4K7S A;  1KLV A;  2N1V A;  3DVG Y;  5G5H A;  3RYT A;  4HDO A;  1V5U A;  3S2A A;  2RGN B;  3NVV A;  1S1Q B;  1X1M A;  1UNQ A;  2V0G A;  4B9K A;  4MSM B;  4K7W A;  3VXW A;  2QKL A;  3E9L A;  2D5G A;  2ELB A;  3G9W A;  4RNA A;  4W9E A;  5JH5 C;  2V4L A;  2ZJD A;  3N30 A;  2N4F A;  3R8B A;  2G45 B;  2TSS A;  1DYQ A;  5C5B A;  4OZC A;  1TGZ B;  4MK0 A;  2RNR B;  3SBG A;  1XLP A;  2IJ0 A;  1R4M I;  1VZ7 A;  3VR9 B;  1R4N B;  2N23 A;  1ZE3 D;  3UIP B;  1U5E A;  1GPX A;  1G6J A;  3DBR I;  1MIX A;  1RAX A;  3PSC A;  1C3T A;  1B55 A;  1NTY A;  2PTL A;  3RUI B;  5MPO A;  2P0D A;  4WWO A;  3SYX A;  1IGC A;  4MGZ E;  1NU2 A;  1WXV A;  3RZW C;  2NZ8 B;  4ANU A;  2R82 A;  1UPQ A;  3E66 A;  1D5Z C;  4KVG B;  1WXQ A;  1HXY D;  2V1Y A;  1MK7 B;  2JUO A;  1C9F A;  3A9K B;  2UVM A;  2UZR A;  1RFA A;  2RR9 A;  4J3O D;  3T9L A;  3IFW B;  3PZD A;  4HCP B;  1OY2 A;  4HVB A;  2RSG A;  2WXG A;  2XNA C;  2OJW A;  3R66 C;  1HZ5 A;  3U7D A;  3KQ4 A;  2EC1 A;  3TMP B;  2WXH A;  2NBW B;  4DXG A;  5GXG B;  3L10 B;  4ZHP A;  2REX A;  3KWL A;  3DCG A;  3KUD B;  1YX5 B;  5JHH A;  3GZN B;  3U7Z A;  1VCB A;  3RNA C;  2HTH B;  1I4R A;  2EKI A;  3L16 A;  2L76 A;  4PQ0 A;  1WI1 A;  1MG8 A;  1Z5S B;  1XT9 B;  2CRF A;  2RGF A;  3AEE B;  4MH0 E;  1X05 A;  2LXA A;  1AW7 A;  4RF1 A;  3PHW B;  2IZV B;  2GB1 A;  1K5D B;  4HJG E;  4URK A;  2WU2 B;  2K39 A;  1PMS A;  3CIK A;  2HD5 B;  3IT6 B;  2D07 B;  3WAP A;  1SXT A;  5G5G A;  1NEK B;  2MJ3 A;  2OJR A;  1GAQ B;  1K51 A;  1N60 A;  1TS2 A;  1N5W A;  3AMZ A;  2R2O A;  4JK7 A;  2KAC A;  1I2H A;  1XLN A;  3AH7 A;  2BYT A;  4IAP A;  3DWG C;  4K2P A;  1YIW A;  2V3N A;  1Q1O A;  5DIF B;  1KBL A;  2KWV B;  2WXP A;  1F2R I;  3PHX B;  3U4E G;  2C7H A;  2BS3 B;  2D9W A;  2W9N A;  4K1R B;  2V76 A;  3AEF B;  4A3P A;  1TS4 A;  1AQC A;  3W1Y A;  2NCN A;  2KKC A;  1JRO A;  3SFD B;  3APD A;  2MDX A;  4PT5 A;  1ACC A;  2W2X D;  3Q3M C;  2ELA A;  2J52 A;  3W1S C;  1QOB A;  2DYN A;  4PNK A;  2LZ6 A;  5C6R A;  3FAH A;  3V05 A;  3PGE A;  4GXB A;  5DPR A;  2DAJ A;  2WDV B;  4OZA A;  2BYF A;  1ET9 A;  1V81 A;  2I1J A;  2ROZ B;  1HQR D;  1S3S G;  1JRU A;  4LK0 M;  3D8D A;  4BAX A;  3C8Y A;  2WXO A;  3NWA A;  3T3O A;  2XEW A;  1IRS A;  1FNW A;  3SD5 A;  4M01 A;  2KWU B;  2PKO A;  5G2N A;  3V6C B;  2AL6 A;  3R7Q A;  3SV1 A;  4F7H A;  5HE2 A;  3SNH A;  1KF6 B;  3QA8 A;  5AZH A;  3AE9 B;  1F9J A;  4JK9 A;  1AYF A;  1W1D A;  2FCM A;  1K5G B;  1RRP B;  1M4V A;  4IOY X;  3V5W A;  1SJE D;  2DX1 A;  1TKE A;  1WIA A;  3TEX A;  3W1S A;  4I6P A;  1GJZ A;  3IAM 1;  4WUR A;  2J53 A;  4XYC A;  4ZYS A;  2J0K A;  2Z4D A;  1MVK A;  2FIF A;  2BKR B;  4GNK B;  3DQV A;  4EMO A;  2D9Y A;  1FNV A;  1D5M C;  1UGJ A;  4MDK E;  2WP9 B;  4ANW A;  1VZ6 A;  2FJU B;  3NWF A;  1NBF C;  3UZT A;  1GNU A;  3L17 A;  3W2D A;  3AE8 B;  1GG3 A;  3PPA A;  3B9J A;  3BYY B;  4EJN A;  3AM9 A;  1NYR A;  1NVL A;  2RQ1 A;  2BS2 B;  5EDS A;  2R61 A;  3O13 A;  4DHZ E;  3PVW A;  4TKN A;  3CST A;  4EFO A;  2E6X A;  1UD7 A;  2QMT A;  4FXC A;  1V1P A;  1L0V B;  3M95 A;  1WGD A;  2D9Z A;  3DVN U;  1VR9 A;  3GE3 C;  1B1Z A;  3OHM B;  1YJI A;  3DXC A;  2LKO A;  5LON B;  3QX1 A;  3TCA A;  1TJ6 A;  1AAR A;  2O6V D;  2ZNV C;  3ENE A;  2Z14 A;  3H8H A;  1ZC4 B;  4BBK A;  5EE9 A;  1U5G A;  4LJP B;  4KKJ A;  3VOQ A;  3HRD D;  2KX0 A;  2I5C A;  4NAW B;  2DZI A;  3VH3 B;  4K7U A;  2DZM A;  4WWN A;  2DAF A;  5J3Q A;  3ZNH B;  3WCQ A;  4ARC A;  2CY5 A;  2DLW A;  2Z13 A;  2IYD B;  3TEY A;  1TY2 A;  5E6P A;  2GRI A;  1C4C A;  3GS2 A;  3T8M A;  3T06 A;  4C7Z A;  2K8E A;  3P4R B;  1K8R B;  3A58 A;  1WY8 A;  1EWY C;  5C2T B;  4HPL B;  4C80 A;  3ECI A;  2XQN M;  4N9F 4;  1SIJ A;  1I7H A;  2EEL A;  3H1U A;  2D3C A;  1H4R A;  3N1Z C;  2KMA A;  2WXI A;  1TT5 B;  3N3K B;  3MFG A;  2VKI A;  1GGO A;  5C16 A;  4KZ0 A;  5IN7 A;  3A8Q A;  4OHJ A;  2K0P A;  3DBS A;  1RRB A;  4FJY A;  4MJS A;  1PDX A;  2HDE A;  2MSE D;  3HVD A;  2AL3 A;  2MW5 A;  3FP5 A;  4Z2N A;  1WR1 A;  4FJZ A;  1U27 A;  2Q13 A;  2WNM A;  2GS0 A;  4KIK B;  5JHA A;  4WQO B;  3APC A;  3L4P A;  1DOI A;  2D11 A;  3ZNI D;  1TYG B;  3HVZ A;  1UH6 A;  3DBH I;  3EA6 A;  2D3A A;  2IBI B;  5HE1 A;  2G4S A;  3RNE C;  2LRU A;  3KW5 B;  1CMX B;  4US8 A;  3TFM A;  4GDL B;  1YJ1 A;  2R09 A;  4M00 A;  3PSE B;  3FM8 C;  1WWT A;  4W9H A;  1QOG A;  2ZVO A;  4AUQ C;  4GN1 A;  3MDB C;  4DIX A;  4LDT B;  2IPK D;  4GDL A;  1UGM A;  4OVZ A; 
#chains in the Genus database with same CATH homology
 5D7G A;  2DYO A;  3NOB A;  1OQN A;  2KX3 A;  2Y8F A;  1I35 A;  2LRW A;  1QZE A;  1IP9 A;  3ZNZ B;  1X86 A;  4M8M A;  2CU1 A;  2NMB A;  3IG3 A;  1LB1 A;  1BAK A;  2MBE A;  1D3Z A;  3H6N A;  1GC6 A;  4HK2 A;  2IY1 B;  1KI1 B;  1U29 A;  2IO2 B;  3KY9 A;  2DZJ A;  4HAT B;  5JP4 A;  3SUZ A;  2KDF B;  2ZVN A;  4PS3 A;  1EUV B;  3HK0 A;  2Z59 B;  2IO1 B;  3AI5 A;  5EFX A;  4KZC A;  5G55 A;  3VTU A;  2I1K A;  4HAY B;  4A6F B;  3H7S A;  3WAM A;  2LOX A;  1V5P A;  1WX8 A;  4EEW A;  1WF9 A;  2FNJ B;  2N0Y A;  1HBK A;  1WYW B;  1JDE A;  2Y7B A;  2O6V B;  1E5W A;  4GU2 A;  5DPW A;  2FCQ A;  4NJ7 A;  4WJN A;  4FBJ B;  1NTV A;  4JLC A;  4FHJ A;  2EJ8 A;  2OQB A;  2KC2 A;  2ROV A;  3ZW3 A;  2O6V A;  3JW0 X;  2VRR B;  2LUE A;  3QIJ A;  3NZS A;  3PP2 A;  3KUC B;  3K9P B;  2M17 A;  4RM8 A;  5E6O A;  4HHV A;  5LXH A;  1H8C A;  2NBV B;  3L54 A;  3ZRC A;  3V61 A;  3QQ8 B;  3PLV A;  2GOW A;  1UEL A;  3UQB A;  4EZJ A;  4IW0 A;  2KXJ A;  3PG7 A;  2LGX A;  2LBB A;  1NTI A;  4BBN F;  5KCV A;  3FSS A;  1PLS A;  4GIV A;  1AWE A;  1WM3 A;  2BWE S;  3H7P A;  2GCJ A;  1FHW A;  2LGD A;  2BKF A;  2JWZ A;  1LXD A;  4BOS C;  3TL5 A;  4GSW A;  1V49 A;  1SIF A;  2CY4 A;  1V2Y A;  2YT1 A;  3H7P B;  1U5D A;  4C0A A;  2Z0P A;  5D27 A;  2L2I A;  1U4A A;  1ZKH A;  3GYP A;  2K8H A;  1V6E A;  2CHX A;  1SHC A;  1WJ6 A;  1WM2 A;  4EUT A;  3MPX A;  4JIO U;  1T0Y A;  3KSY A;  4IM2 A;  4BVU C;  4HCN B;  4F1S A;  4ILH A;  5J2R A;  1EO6 A;  2JRH A;  2N7E A;  3MTN B;  5IJM A;  2YF0 A;  4CHK A;  2N7D A;  2D10 A;  1GC7 A;  3D32 A;  1P9D U;  1NI2 A;  4GMX B;  4PS8 A;  5C5B B;  1M7E A;  2KC1 A;  3SO6 A;  2L0F A;  2WH5 A;  2HRJ A;  1XX0 A;  1ISN A;  2Z0Q A;  2KFJ A;  2N1W A;  5HE0 A;  2MKR A;  2DHZ A;  4HB2 B;  4W9L A;  3DOW A;  3DXE A;  4AJW A;  1L7Y A;  1DDM A;  4DBB A;  3DPD A;  2CKH B;  5DH9 B;  3TO1 A;  3PV1 A;  3VUW A;  2ADZ A;  2FJL A;  4KHA A;  2MRP A;  2BYV E;  3EEC A;  4WVF B;  4K2O A;  3QCA A;  1WE6 A;  2YSZ A;  3ZVR A;  2EKE C;  3JYU A;  4CHJ A;  2IO3 B;  3M62 B;  2COA A;  3A1Q A;  2CS4 A;  4NJ6 A;  4BBN C;  1XQQ A;  2JVC A;  5FR6 A;  1TBE A;  3LJU X;  4IUM B;  2RPQ A;  4A5K A;  1TTN A;  3VAW A;  3ODO A;  2WDT B;  1FHX A;  3V60 A;  4II2 B;  1RJ2 A;  2O2V B;  1ZSQ A;  4IC7 B;  3Q3F A;  1Y8R C;  2KLC A;  3N7C A;  4PYZ A;  1SGH A;  3OAW A;  1FOE A;  2IY0 B;  2LAS A;  3DVG X;  3A4S C;  3MHS D;  4NQL B;  4BKS A;  1ST7 A;  4FAD A;  3ZLZ A;  2O2V A;  1J19 A;  3HIZ A;  2K00 A;  1KZ7 A;  1V88 A;  4B6W A;  2DX5 A;  2DFK A;  4M0W B;  3L13 A;  1DDW A;  3ODW A;  1WGH A;  1N3H A;  4AP4 C;  4A6K A;  5D2M B;  2KHW B;  4HXD A;  2N9P C;  1UBQ A;  1WGQ A;  1WXA A;  2KTR A;  3L08 A;  3NY5 A;  5D3V A;  2MBH A;  2M38 A;  5L95 C;  3KYC D;  3APF A;  2R0D A;  1LW3 A;  3ZVV A;  3U8Z A;  3WA0 A;  1SE9 A;  2KQS A;  5HE3 A;  1V5O A;  3PRP B;  4DHJ D;  2MBO A;  5C79 A;  4JKG A;  1WXS A;  4RMA A;  1LQB A;  2GJY A;  2KDE B;  2AEH A;  1E8Y A;  4GDK B;  3LDZ E;  5LOP B;  3JSV A;  4NSW A;  2A4Z A;  4BFR A;  2C9W B;  3NHE B;  2FUH B;  4BKT A;  4D0N B;  5D3W A;  1A5R A;  4ANV A;  5AZF A;  2Z0D B;  4LJO B;  3HHM A;  2DA0 A;  2LYD A;  4IWO A;  4JKA A;  3ZNG C;  4M8N A;  2YT0 A;  3O65 B;  2IFS A;  1Q5W B;  2KNB A;  4IWQ A;  3RUL A;  4P7I A;  4DX9 0;  3PTF C;  2E2X A;  2DYB A;  5IAA C;  5J17 A;  1J0G A;  2WX0 A;  2NPT B;  3TBL D;  5J18 A;  2DN6 A;  2RD0 A;  4CYE A;  5JZE B;  1XD4 A;  4ZYN A;  2LWP A;  2EMS A;  2NBU A;  3M1I B;  1WXM A;  3QWM A;  4ASW C;  2LI5 A;  4KDL B;  1V9J A;  3ZRF A;  3VTV A;  3NSU A;  4W9F A;  3A8P A;  2YS3 A;  2JF5 A;  3H9D A;  1V5T A;  4NAW A;  2L00 B;  1R4N I;  1WR6 E;  3QJZ A;  2KWC A;  2XK5 A;  4GMV A;  1E90 A;  1WJ4 A;  3M63 B;  3ZUN A;  4JKE A;  1HE8 A;  2P0H A;  4E71 A;  1I7A A;  2JPH A;  2LJ5 A;  3WYF B;  1DDV A;  1XKE A;  2UWQ A;  2DX5 B;  1WJM A;  4EZK A;  3X0W A;  5IA7 A;  1UZX B;  4ZDV A;  2L1C A;  1DYN A;  4E3C A;  1V80 A;  1P6S A;  2NVU I;  1LFD A;  1KJT A;  2MQJ A;  5CLQ B;  2B3A A;  3VVW B;  4HB4 B;  4XZ4 A;  1WI0 A;  4WJQ A;  2K6Q A;  2GBJ A;  2JXX A;  2UZS A;  4KIK A;  1L2N A;  1E8W A;  2RLO A;  1H10 A;  1UNP A;  3DDC B;  2KAN A;  5JHG A;  2MBQ A;  3TIX A;  2L3Z A;  2X0S A;  2Y5B B;  2CB8 A;  4W9J A;  2DKQ A;  1OEY A;  4JK8 A;  4HWI B;  3ENB A;  1V61 A;  1ZGU B;  4WSF A;  5D3Y A;  2C7M B;  2H7D A;  4FHK A;  4Z2M B;  5KQ4 A;  1EAZ A;  4LCD E;  4MGK E;  1TQZ A;  2KN5 A;  4K17 A;  2ZCB A;  3HM6 X;  3EHV A;  2DIK A;  1Z87 A;  5L83 A;  4MEL A;  2MX2 A;  3WIM A;  2GBK A;  3VDZ A;  1P5T A;  1HB8 A;  2R2Q A;  4GDK A;  5J3Y A;  5CHW A;  1FGZ A;  2P8V A;  1YX6 B;  2KVR A;  2AWT A;  1XCG A;  1WFY A;  5D3X A;  3RT3 B;  2RUK B;  1X1G A;  4GOC A;  1X11 A;  2KZR A;  1WGY A;  4XWX A;  2BCJ A;  1WJ1 A;  5DPS A;  3PVL A;  3L0W B;  4I6N B;  3A9J B;  2MP2 A;  4ICV A;  2FID A;  4G11 A;  3SBT A;  4TQ1 A;  4HB3 B;  1Y5O A;  5DHA B;  4F8C B;  3D8E A;  2C60 A;  3NZU A;  3RCZ A;  1XD3 B;  4DWF A;  2UYZ B;  1E7U A;  4EOY A;  4MSQ B;  2LVQ A;  4WJP A;  2EMT A;  1XR0 B;  2PE6 B;  1WVH A;  4HB0 B;  4PYU A;  3CF6 E;  3U30 A;  1WX7 A;  2BYE A;  2GMI C;  4ZRK A;  1E7V A;  2JZ3 B;  3UIO B;  4IG7 B;  1UBI A;  2KD0 A;  3SHQ A;  1PQS A;  2H7E A;  4OVV A;  2LUL A;  3VHT C;  3JSV B;  1EGX A;  3A4R A;  4I6L B;  1M94 A;  1Z2M A;  2A5U A;  1E8X A;  3KZ1 A;  3ZTC A;  1QC6 A;  3M3J A;  3ZTD A;  4NNJ B;  3SU8 X;  4BOZ B;  1OGW A;  4A6F A;  3HM3 A;  2G35 A;  4IFS A;  2K8C A;  4WWP A;  4A3O A;  4KAX B;  2KUP A;  4MGI E;  2DHJ A;  3DXD A;  2VRW B;  3BY4 B;  4CO7 A;  2Z0E B;  2YRY A;  3ULC A;  2RSU A;  4H8S A;  1MK9 B;  2CQU A;  5KQ1 A;  2LXC A;  1WRD B;  3R3M A;  3PVU A;  4EZL A;  1EF5 A;  3QC8 B;  5DPT A;  4BKS D;  1MKE A;  2X18 A;  2KDI A;  4KHO A;  3K9O B;  2KOX A;  4E74 A;  4FLH A;  4AJY B;  1C1Y B;  1E8Z A;  1P3Q U;  2MWS B;  5C1Z A;  2PJH A;  4KSL C;  2KJR A;  1FGY A;  5CHF A;  4JKF A;  3PRM B;  5FI1 A;  3ML8 A;  3P6A A;  1P1A A;  2KK8 A;  2N9E B;  1FAO A;  2ZPN A;  1ACA A;  3TVV A;  2JZZ A;  3P2B A;  2FJ9 A;  2GCL A;  3ODX A;  2DTC A;  2ASQ A;  1QQG A;  2K25 A;  4OVU A;  4JKG B;  2M1M A;  2WYQ A;  3GZN I;  2HE7 A;  2PZ1 A;  3PS6 A;  1EF1 A;  1V5M A;  4WJ7 A;  5GMV A;  2K1F A;  4ANX A;  2MWN B;  3V62 A;  5DCN A;  2L8J A;  2Y8G A;  1PFJ A;  3QBV B;  4IWP A;  4ZRJ A;  4KHB B;  5HKH A;  1KC7 A;  2AYO B;  3MJW A;  2BPS A;  2ZCC A;  2CHW A;  2DYQ A;  2DZK A;  2K6D B;  1Y19 B;  1J8C A;  4F7U P;  1WGU A;  2KGX B;  5DHF B;  2OOB B;  2COC A;  4JGH B;  2ZPY A;  4GPT B;  2FCS A;  3B1L X;  4TQ0 A;  2JT4 B;  1MPH A;  3SDL C;  2ZEQ A;  2MA9 B;  4DX8 A;  1YD8 U;  1ZC3 B;  2PEA A;  3OJ4 B;  1OMW A;  3R7R A;  3LJ3 A;  3P7Z A;  1V86 A;  5CTR C;  3UGB B;  4X57 B;  3HW2 B;  1UNR A;  1VD2 A;  3AXC A;  4ZRI A;  2ZZP B;  2LGY A;  5CLL B;  4DHJ B;  1WH3 A;  3CMM B;  4AWJ A;  2D2Q A;  3OAN A;  3OJ3 A;  2LVO A;  2DHI A;  2D9X A;  2IO0 B;  5J3T A;  1YQB A;  1I42 A;  3I3T B;  3A9K A;  3BIN A;  2D9V A;  1P98 A;  2W2W A;  1Q0W B;  3A9J A;  5D94 A;  4DHZ B;  4PS7 A;  3CXB B;  3F5R A;  3AUL A;  1ZM0 A;  2DEN B;  2COF A;  2J0J A;  2K2U A;  2KMC A;  3TJP A;  3ZKJ C;  3ML9 A;  3A98 B;  3UF8 A;  3FEH A;  1KM7 A;  4FJV B;  3EFU A;  4L6E A;  3ZO5 B;  4B6H A;  4JKB A;  2KLG A;  5AEK B;  2M0X A;  4LDT D;  4RM9 A;  2KFK A;  2L0T A;  4MGY E;  3DVN V;  2NS5 A;  4DK5 A;  1FHO A;  1KOT A;  1P0R A;  1OEY J;  4IM3 A;  1HB6 A;  3TW1 A;  5JLJ B;  4MEM A;  3E9P A;  1P3R A;  4A20 A;  2XK5 B;  3HQC A;  2PE9 A;  3VH4 B;  1GUA B;  2BF8 B;  1V89 A;  5L81 A;  4W9K A;  2LG1 A;  4G50 A;  3JVZ X;  4NPN A;  2COD A;  1U2B A;  1J0W A;  1WJN A;  4G3X B;  3AJ4 A;  4HPM B;  2NPT A;  1W1H A;  2QHO A;  4FA6 A;  3ZDT A;  2LD9 A;  3VQI A;  3NS8 A;  4KDI C;  3UIN B;  1VBG A;  1DRO A;  2BGF A;  4ILG B;  3KH0 A;  2MLB A;  5E6N A;  1UEF A;  3VFK A;  4AOF A;  3DBL I;  3UQA A;  2M14 A;  2KTF A;  2HJ8 A;  3KUZ A;  2K8B A;  4W9I A;  1WMH A;  4II3 B;  3WAL A;  3PLU A;  2M8S A;  3GYO A;  2D4Q A;  1WGG A;  4TV3 A;  2DKP A;  4BKG A;  1TXD A;  2KO3 A;  1ZW7 A;  3QWZ B;  1WMH B;  4EKU A;  4HLE A;  2GBR A;  1ZVR A;  4J6I A;  4HAW B;  4YL8 A;  5GOW B;  4XX5 A;  4W9D A;  1IPG A;  3KYD D;  4W9C A;  2JP2 A;  3F0W A;  3ALB A;  3Q3J A;  3ULB A;  4FN2 A;  5JVL A;  4HAV B;  2KJH B;  2W2X C;  2N9X A;  1UPR A;  4JKD A;  2DYM A;  3IHP C;  4HAU B;  4K81 A;  5JHB A;  4FUL A;  4MJS B;  3VTW A;  2GBN A;  2G3Q B;  5FI0 A;  4DDG D;  2ABD A;  2XBB C;  2M4N A;  4ILJ A;  1DBH A;  4MT7 A;  4W9G A;  4KV2 A;  4NQK E;  3QK0 A;  3C0R B;  1WZ0 A;  2COP A;  2LVP A;  4Y94 A;  1FXT B;  1W1G A;  3ZIM A;  4ICU A;  3VIA A;  1XOD A;  2KCJ A;  2JY6 A;  2J7Q B;  4DDI D;  2HTH A;  2KQ7 A;  2WX1 A;  5C23 A;  2D3G A;  2CR5 A;  2L05 A;  3ML4 A;  3IBE A;  5KHQ A;  3A1Q B;  2GBM A;  4G0N B;  3D8F A;  2FCN A;  4A6H A;  4XC2 A;  5CHV C;  1LM8 B;  2ZNV B;  2JRI B;  4GZU A;  4TUU A;  2MBB B;  1MAI A;  3EC8 A;  3OLM D;  3VUY A;  2Z0O A;  2MCN B;  3RCP A;  4JL9 A;  2J59 M;  3KRX A;  1Q67 A;  2VSZ A;  3QAR A;  4TYZ A;  4F7G A;  2KFK B;  5LLI A;  4F7Z A;  1BWN A;  1WX9 A;  4MM3 A;  4JKC A;  3ZDM C;  2FAZ A;  1U5F A;  1WJU A;  4KSK C;  3PRZ A;  2YS1 A;  2KTR B;  1WE7 A;  4MY6 A;  4HAZ B;  4CHM A;  2J0M A;  1BTK A;  1KZG A;  2PPH A;  2L7R A;  1WGR A;  2K2J A;  3WAN A;  4HAX B;  1FB8 A;  4NY0 A;  1DIK A;  1NDD A;  3QHT A;  2CAY A;  1WG7 A;  2KJ6 A;  4WAA A;  3AU5 A;  2G4D B;  2OTX A;  4JQW C;  4B95 A;  2MFQ A;  4GB9 A;  1RLF A;  3VUX A;  2MP2 B;  5D6J B;  3CSF A;  3IVF A;  2RVB B;  3E9O A;  4HDQ A;  1BT0 A;  3KRW A;  4WJO A;  2FDQ A;  3A33 B;  3RZF A;  3O96 A;  3PRE A;  1M7R A;  3N32 A;  1WZ3 A;  3AU4 A;  1BTN A;  5TR5 A;  1X1F A;  5DI9 B;  1TZ1 A;  2NR2 A;  2WWZ A;  3WAO A;  3B0A A;  4JKH A;  1MIZ B;  3PEG A;  2I5F A;  2P0F A;  2LOZ A;  3B08 A;  2V3S A;  3ONS A;  1IYF A;  5CX3 A;  3BJI A;  3V6E B;  5LXI B;  3QAQ A;  5KHO A;  3FLV A;  3X23 A;  4GGQ A;  2CHZ A;  3GOE A;  2C5L C;  2C7N B;  3KVF B;  3PT2 B;  3RD2 A;  4DBG A;  1VBH A;  4DXA B;  2IYB A;  2DHK A;  4YON A;  2YLM A;  4IM0 A;  2BWF A;  2YVC A;  3EPY A;  2QKM A;  1OTR B;  4HJK A;  1EVH A;  2YS5 A;  1OQY A;  5AZG A;  5BO4 B;  2KDB A;  4K7S A;  1KLV A;  2N1V A;  3DVG Y;  3RYT A;  4HDO A;  1V5U A;  3S2A A;  2RGN B;  1S1Q B;  1X1M A;  1UNQ A;  4B9K A;  4MSM B;  4K7W A;  3VXW A;  2QKL A;  3E9L A;  2ELB A;  3G9W A;  5JH5 C;  4W9E A;  2V4L A;  2ZJD A;  3N30 A;  2N4F A;  2G45 B;  5C5B A;  1TGZ B;  4MK0 A;  2RNR B;  3SBG A;  1R4M I;  2N23 A;  3UIP B;  1U5E A;  1G6J A;  3DBR I;  1MIX A;  1C3T A;  1RAX A;  3PSC A;  1B55 A;  1NTY A;  3RUI B;  2P0D A;  4WWO A;  3SYX A;  4MGZ E;  1NU2 A;  1WXV A;  3RZW C;  2NZ8 B;  4ANU A;  2R82 A;  1UPQ A;  3E66 A;  4KVG B;  2V1Y A;  1MK7 B;  2JUO A;  3A9K B;  2UVM A;  2UZR A;  1RFA A;  2RR9 A;  3T9L A;  3IFW B;  3PZD A;  4HCP B;  1OY2 A;  4HVB A;  2RSG A;  3R66 C;  3U7D A;  2EC1 A;  3TMP B;  2NBW B;  3L10 B;  2REX A;  3DCG A;  3KUD B;  1YX5 B;  5JHH A;  1VCB A;  2HTH B;  3L16 A;  2L76 A;  4PQ0 A;  1WI1 A;  1MG8 A;  1Z5S B;  1XT9 B;  2CRF A;  2RGF A;  4MH0 E;  1X05 A;  2LXA A;  3PHW B;  2IZV B;  1K5D B;  4URK A;  2K39 A;  1PMS A;  3CIK A;  2HD5 B;  2D07 B;  3WAP A;  2OJR A;  2R2O A;  4JK7 A;  1I2H A;  4IAP A;  4K2P A;  1YIW A;  1Q1O A;  5DIF B;  1KBL A;  2KWV B;  3PHX B;  2C7H A;  2D9W A;  2W9N A;  4K1R B;  2V76 A;  4A3P A;  1AQC A;  3W1Y A;  2NCN A;  2KKC A;  3APD A;  2MDX A;  2W2X D;  2ELA A;  3W1S C;  2DYN A;  4PNK A;  2LZ6 A;  5C6R A;  3PGE A;  4GXB A;  5DPR A;  2DAJ A;  2BYF A;  1V81 A;  2I1J A;  2ROZ B;  1S3S G;  1JRU A;  3D8D A;  2XEW A;  1IRS A;  3SD5 A;  2KWU B;  5G2N A;  3V6C B;  2AL6 A;  3R7Q A;  3SV1 A;  4F7H A;  5HE2 A;  3SNH A;  3QA8 A;  5AZH A;  1F9J A;  4JK9 A;  1W1D A;  2FCM A;  1K5G B;  1RRP B;  4IOY X;  3V5W A;  2DX1 A;  1WIA A;  3W1S A;  4I6P A;  1GJZ A;  2J0K A;  2FIF A;  2BKR B;  3DQV A;  4EMO A;  2D9Y A;  4MDK E;  4ANW A;  1NBF C;  3UZT A;  1GNU A;  3L17 A;  1GG3 A;  3PPA A;  4EJN A;  1NVL A;  2RQ1 A;  5EDS A;  4DHZ E;  3PVW A;  4TKN A;  3CST A;  4EFO A;  1UD7 A;  3M95 A;  1WGD A;  2D9Z A;  3DVN U;  3DXC A;  2LKO A;  5LON B;  3QX1 A;  3TCA A;  1TJ6 A;  1AAR A;  2O6V D;  2ZNV C;  3ENE A;  1ZC4 B;  4BBK A;  1U5G A;  4LJP B;  3VOQ A;  2KX0 A;  2I5C A;  4NAW B;  2DZI A;  3VH3 B;  4K7U A;  2DZM A;  4WWN A;  2DAF A;  5J3Q A;  3ZNH B;  2CY5 A;  2DLW A;  2IYD B;  5E6P A;  3T8M A;  3T06 A;  1K8R B;  1WY8 A;  4HPL B;  3ECI A;  2XQN M;  4N9F 4;  3H1U A;  1H4R A;  2KMA A;  3N3K B;  2VKI A;  1GGO A;  5C16 A;  4KZ0 A;  3A8Q A;  3DBS A;  1RRB A;  4FJY A;  4MJS A;  2MSE D;  2AL3 A;  2MW5 A;  3FP5 A;  4Z2N A;  1WR1 A;  4FJZ A;  1U27 A;  2Q13 A;  2GS0 A;  4KIK B;  5JHA A;  4WQO B;  3APC A;  2D11 A;  3ZNI D;  1UH6 A;  3DBH I;  2IBI B;  5HE1 A;  2G4S A;  2LRU A;  3KW5 B;  1CMX B;  3TFM A;  4GDL B;  1YJ1 A;  2R09 A;  3PSE B;  3FM8 C;  4W9H A;  2ZVO A;  4AUQ C;  4GN1 A;  3MDB C;  4LDT B;  4GDL A;  1UGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...