3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Merlin
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
4MJSA 3CSTA 3MTNB 1B55A 4MDKE 2DZMA 2KDIA 4MSMB 1RAXA 2C7NB 1M7RA 2LOXA 3DVGX 2V3SA 3PSCA 2KX0A 2NVUI 1LXDA 1E8XA 4K2PA 3ZLZA 1V88A 5FI0A 2HD5B 2ASQA 2DHZA 3TCAA 1UD7A 2KTRB 2LJ5A 1WXAA 4LDTB 4W9EA 2KUPA 3MPXA 4W9JA 5L83A 2KGXB 5HE2A 1WJMA 1XD3B 2Z0OA 4HVBA 2UZSA 2KDFB 3LDZE 4NNJB 1FGYA 2DZJA 2IO0B 3ML8A 2J0MA 3N30A 1V81A 2KD0A 2DX5A 1XCGA 2MBEA 4KHBB 4TUUA 3PHWB 3M62B 4EFOA 1SHCA 1UNPA 3DBSA 2AWTA 3VFKA 2RSGA 2LUEA 3VUYA 5HKHA 4MH0E 2ELBA 2G45B 2V4LA 4HLEA 5JHAA 2JVCA 3W1SA 4EZKA 1YQBA 1V5MA 3T8MA 2OQBA 4KAXB 1DDVA 1TZ1A 3D8EA 2JY6A 1EGXA 2KJHB 3V6CB 1UELA 2KN5A 4F7ZA 4CHMA 1UBIA 2DHIA 3QHTA 5AEKB 2O6VB 2IO1B 1NDDA 4HDOA 3ODWA 1MKEA 4WSFA 1OTRB 5DHFB 1VCBA 3A9KB 3AI5A 4G0NB 3TJPA 2CR5A 1UPQA 1OEYJ 3KYCD 3ALBA 4LDTD 2RPQA 2GBJA 1U2BA 2KTRA 2MKRA 1NBFC 1XODA 4EZJA 5JH5C 1HBKA 1UPRA 3BINA 1E90A 2KX3A 2I1KA 4GMVA 2ZNVC 3M63B 4HB0B 3PHXB 2KFJA 2M0XA 2GMIC 1U5DA 1WGQA 1DDMA 3UIPB 1KOTA 3DXDA 3ZDTA 3PP2A 3X23A 5KQ1A 3CMMB 5E6PA 4HAUB 4MJSB 1H10A 1WG7A 5KHQA 4ANXA 5CX3A 3KY9A 2DN6A 4MT7A 3N3KB 3ZTCA 3QWZB 3LJUX 2WX1A 1J19A 2R09A 2FJLA 3KUCB 4BOZB 3TO1A 1OQNA 2LRWA 4P7IA 2QKLA 2O6VA 3NZSA 3PRPB 3QK0A 2OOBB 1L2NA 3FM8C 4IWQA 2IZVB 2BF8B 3ZRFA 1V5PA 1C3TA 2LGYA 3WYFB 2NS5A 1FAOA 3SV1A 4DHZB 1MG8A 1P9DU 5C79A 1WMHA 2QHOA 4EMOA 4ANUA 2K6QA 1V80A 2MBHA 2N7EA 5LXHA 4IWPA 3KRWA 1WI0A 3AU5A 4Y94A 1FXTB 4URKA 1WE7A 3ONSA 4WWPA 5G2NA 4AJWA 2N7DA 4E71A 2PZ1A 1ZM0A 3GYOA 3BY4B 3WIMA 4NAWA 1MIXA 2J0JA 4WJPA 1BTNA 3R66C 1I2HA 4AUQC 2GS0A 2RLOA 2V76A 2MQJA 1GJZA 1N3HA 3PS6A 4ICVA 2FJ9A 1XT9B 2E2XA 4JL9A 1OY2A 2D07B 2JZZA 2CU1A 4MGKE 2KQSA 5C23A 1G6JA 1X11A 2KVRA 1FOEA 2COAA 1QZEA 1NVLA 5FI1A 2DAFA 4HWIB 5IAAC 4BKGA 5IA7A 4DHZE 5BO4B 3C0RB 2LXAA 3PVWA 3ZVRA 4F1SA 1FB8A 2BYEA 3TFMA 1QC6A 2W2XD 3N32A 4FN2A 1WMHB 4L6EA 1I35A 3AULA 3F5RA 2NMBA 5KHOA 1TJ6A 5DPTA 4YONA 4IWOA 5CHWA 2MSED 3H7PB 5EDSA 1E8YA 2J7QB 2KNBA 4HPMB 1ZSQA 3P6AA 5CLQB 1WGHA 5C6RA 5D3YA 2FIFA 2RD0A 2KLGA 4K2OA 3JVZX 2LULA 2GBRA 2JZ3B 2ZEQA 2R2QA 4IC7B 2MWNB 4HAYB 3AU4A 4ZRJA 1TGZB 5LLIA 3F0WA 2UZRA 2G3QB 3DPDA 1XR0B 4B9KA 1U4AA 2NBVB 4K7SA 4NJ6A 2N9EB 2M14A 2KO3A 1P98A 2JT4B 2CKHB 1E7UA 2KK8A 2KFKB 3M3JA 4DBBA 3H6NA 3OJ3A 4BOSC 5J18A 4A6HA 1MAIA 2COCA 4CO7A 3U8ZA 4I6NB 2XEWA 4JGHB 1GC6A 1WX7A 1P0RA 1LQBA 3H9DA 4NQLB 3RCPA 2ZCCA 3APDA 3DBHI 3VTVA 2RVBB 4K7UA 1EAZA 3P7ZA 2FIDA 2KDEB 4ZRKA 2LVQA 2NR2A 3A33B 4K1RB 2LD9A 4W9DA 5JLJB 3D8FA 4E74A 1NI2A 1XQQA 1WYWB 1WRDB 3RZWC 1XKEA 2IYDB 4WAAA 3R3MA 5TR5A 4HJKA 3APFA 2KKCA 3QA8A 3SHQA 1ZC4B 2DYOA 1LB1A 2LZ6A 1EUVB 1Q5WB 3R7QA 3W1SC 3A9JB 1V6EA 2C60A 1UGMA 2BWFA 2KWUB 2LYDA 2VKIA 2MBBB 3KUDB 2MDXA 4A20A 4EKUA 3VH3B 4TQ1A 3VXWA 4MK0A 4A6FB 4F7GA 1GG3A 5LONB 3RULA 1WR6E 1LFDA 2NPTA 4BKTA 1E5WA 1SE9A 1QQGA 1WE6A 3KUZA 4F8CB 5GOWB 2I1JA 4KHOA 3UQAA 4XC2A 5D27A 3ZNGC 1FGZA 4XWXA 5DIFB 4M0WB 5AZFA 2DAJA 2C7MB 1XX0A 3WA0A 2BKFA 3NOBA 3P2BA 5C5BB 1Y8RC 2K6DB 3KVFB 2W9NA 4K17A 1AARA 2W2XC 4G3XB 3ZRCA 2GOWA 2ZNVB 1D3ZA 4PYZA 3MDBC 2P0DA 4W9IA 2PE9A 2IY0B 2LI5A 3JYUA 2KCJA 1YIWA 3WALA 1RRPB 1WR1A 3IVFA 2ROVA 2A4ZA 2KANA 3ML9A 3QAQA 1EF1A 3TMPB 3L10B 4II2B 2KQ7A 4HAVB 1XD4A 5JP4A 2MLBA 1WJUA 2P0FA 2D9VA 3KSYA 3NY5A 5D7GA 3AJ4A 1MK7B 2D11A 1DBHA 4K81A 2LGXA 2MW5A 2ZZPB 3H7SA 5GMVA 2CHWA 4M8MA 5LXIB 2FDQA 2JPHA 2MP2A 2MX2A 4RM8A 2XQNM 5KCVA 5J3QA 1WJ4A 4FBJB 2MBOA 1PQSA 2YLMA 1TBEA 2D3GA 2DZKA 4A6KA 2HTHA 3PSEB 2LBBA 1WI1A 2MRPA 3APCA 3ZNHB 4F7UP 1IYFA 3MJWA 2L00B 3Q3JA 5AZHA 3T9LA 4GN1A 4TKNA 5HE3A 1UH6A 3VUWA 1KLVA 2YSZA 2AEHA 2K1FA 3DXEA 1RRBA 3N7CA 3CXBB 2DYMA 1DROA 2ELAA 1WX9A 2CY4A 2DKPA 5D3WA 2BCJA 2RQ1A 2IBIB 3PRZA 4GDKA 1K5DB 3TL5A 5JZEB 4PNKA 2FCSA 5E6NA 1JRUA 1WM2A 1KM7A 2R2OA 2ZVNA 2I5CA 2CHXA 3PTFC 1IP9A 2Y7BA 1PLSA 3PVLA 2DLWA 3QX1A 2D4QA 3T06A 1WIAA 1P3RA 3DDCB 4PS7A 4BFRA 4DHJD 1OGWA 1V86A 2I5FA 3DVNV 2VRWB 2DA0A 4XZ4A 4NJ7A 5DPWA 3HM6X 1DYNA 3RT3B 4MEMA 1WGUA 3EC8A 3L0WB 3OAWA 2AYOB 4BKSA 4EJNA 4IM2A 4HAWB 4IM3A 1RJ2A 1ACAA 1YJ1A 4TQ0A 2RR9A 1ZVRA 2Y8FA 4GMXB 1AQCA 1RLFA 4NPNA 3HM3A 1ZW7A 4KV2A 4GPTB 1SIFA 4ASWC 2NBUA 2X18A 3FEHA 2FAZA 3H1UA 5D6JB 3D32A 4JIOU 3VTUA 1F9JA 3L13A 3AXCA 3RCZA 2VRRB 1WXSA 4J6IA 3BJIA 3ZNZB 2CB8A 1S1QB 2JF5A 4RM9A 2WH5A 1U5EA 3U7DA 5C16A 3QBVB 4CHJA 3PV1A 3RYTA 1ZGUB 2FCMA 2JRHA 3M95A 2RGFA 2Z0PA 1W1HA 2OTXA 2GBNA 2RSUA 2CY5A 2KWVB 3QQ8B 5DHAB 2D10A 1K8RB 5D94A 1J0GA 2D9YA 4ZDVA 2W2WA 2KMCA 2YVCA 2C5LC 2G4DB 4FHJA 2M38A 2XBBC 3Q3FA 3KRXA 2MBQA 3UF8A 1FHXA 4XX5A 1M94A 2CRFA 4MY6A 4FJZA 2LVPA 4JLCA 4FA6A 3A1QB 2O2VA 1WVHA 2UVMA 4TV3A 2DFKA 1Q67A 4FJVB 4KIKB 3V5WA 3PPAA 1KZ7A 2KHWB 3OLMD 5JHHA 4GDLB 3VDZA 1SGHA 1Y19B 3RZFA 1WZ3A 3PVUA 1KJTA 3ZDMC 1WXVA 4Z2NA 2BGFA 4KZCA 2ROZB 2K8CA 2LKOA 3VUXA 2O6VD 2IFSA 5DPSA 4EZLA 3IFWB 3CSFA 3ZKJC 4AJYB 1E8ZA 3PGEA 2JP2A 4W9KA 2DZIA 5DH9B 3B0AA 3DCGA 4G11A 2Y8GA 2JXXA 2KC1A 3SD5A 1U27A 2RNRB 1OMWA 1Z87A 4KHAA 1OQYA 2L8JA 1NTIA 2MP2B 2K39A 3MHSD 4KSKC 1P6SA 2M1MA 1GNUA 2Y5BB 3B08A 3FP5A 3B1LX 2LOZA 4KIKA 5FR6A 4F7HA 3VQIA 3EECA 2PEAA 1WFYA 1BT0A 2FNJB 3NHEB 4OVVA 4AWJA 4NY0A 5HE1A 2C9WB 4HK2A 2DHJA 3VHTC 3NZUA 4PS8A 3ZW3A 2RUKB 4FLHA 1DDWA 3JW0X 1OEYA 4LCDE 3WAMA 4B6HA 1WJ6A 3JSVA 5E6OA 2L1CA 2DENB 2M8SA 3A4SC 4WJOA 1GUAB 2G4SA 2IYBA 4HATB 3W1YA 1W1GA 2XK5B 3SUZA 5LOPB 2CHZA 3VOQA 1Z5SB 5KQ4A 3CIKA 4DXAB 1X1FA 4FADA 1BTKA 3JSVB 1HB8A 1BWNA 2K2UA 1U29A 4HAXB 3X0WA 4E3CA 5IJMA 4GOCA 3VVWB 4II3B 2ABDA 5L95C 4MGZE 3QARA 1LW3A 1H8CA 4DWFA 1C1YB 4WWOA 2UWQA 4IG7B 1EF5A 1HE8A 3EFUA 2N9XA 4C0AA 2QKMA 4FULA 4ICUA 1WZ0A 2NPTB 4KDIC 4DDID 3PZDA 2PJHA 3V6EB 3TW1A 2BKRB 3SYXA 4A3PA 5DI9B 4WVFB 4A6FA 1WGGA 4YL8A 2MCNB 1ISNA 2OJRA 2LASA 2EKEC 3QC8B 2K25A 4BBNF 1TXDA 1U5GA 4W9FA 5CHFA 4DHJB 1P5TA 2PE6B 2VSZA 3CF6E 4I6LB 4NQKE 4FHKA 2CODA 3KZ1A 2KLCA 2CQUA 3FSSA 2ZCBA 2WDTB 4ZRIA 2GCLA 1UZXB 3O65B 4GDLA 4MGIE 4CYEA 1WH3A 4GGQA 4WJNA 2DHKA 3EPYA 1V9JA 2MA9B 2YT1A 4KVGB 3UQBA 2YS5A 2FCQA 1MK9B 2COPA 3DBLI 2M4NA 4HPLB 3A1QA 3A98B 2D2QA 3A8PA 5JHBA 4MELA 3GOEA 3ULCA 2GBMA 3SO6A 4TYZA 3A8QA 3ULBA 4GDKB 4W9HA 2YS3A 3L54A 2HJ8A 2LVOA 3QCAA 2LXCA 1L7YA 1FHOA 1T0YA 2DX1A 4W9CA 4GXBA 4DDGD 3HK0A 3FLVA 1P1AA 3PG7A 2P8VA 3KH0A 2Q13A 5J3YA 4IFSA 1E8WA 2YT0A 3PT2B 4M8NA 3RD2A 2A5UA 3ZNID 2Z0EB 4HCNB 4Z2MB 4W9LA 2CAYA 2KZRA 3VIAA 2P0HA 2KOXA 1J8CA 3QWMA 2IO3B 3ENEA 3ZTDA 5L81A 3K9PB 3PRMB 4GU2A 2KWCA 2KXJA 1FHWA 1WJ1A 3ML4A 4IUMB 2D9WA 1V61A 1EO6A 1Y5OA 2GCJA 3SU8X 2IY1B 2D9ZA 1I42A 3VAWA 4HB2B 5CHVC 5D3XA 4HHVA 2MFQA 2N1VA 3PLVA 3V61A 2LG1A 2L2IA 2DTCA 4FJYA 2K2JA 1PFJA 4EEWA 4HAZB 4GSWA 3ECIA 4HDQA 1WJNA 3DBRI 2V1YA 2AL6A 4A5KA 2L7RA 2XK5A 2COFA 1UBQA 2BYVE 3DOWA 1K5GB 1NTVA 2Z0DB 3GZNI 5J17A 1HB6A 1E7VA 3PREA 2L76A 4D0NB 4H8SA 2WWZA 1YD8U 3PLUA 2J59M 3ZVVA 2EMSA 5C5BA 2ZJDA 3OANA 1X86A 4WWNA 4A3OA 1WGYA 2BWES 1V5UA 1W1DA 4PYUA 4MSQB 4B95A 1ST7A 1MPHA 5CLLB 3UGBB 1UNQA 3NSUA 1R4NI 2K8HA 3K9OB 4AP4C 3ODXA 2PPHA 1ZKHA 2REXA 1M7EA 5EFXA 4BKSD 2KTFA 4BVUC 2N9PC 2K00A 5D3VA 3A4RA 4CHKA 2YRYA 2Z0QA 1X1MA 4LJPB 3DVGY 1WGDA 1KZGA 2YF0A 4WJQA 2JRIB 3GYPA 1WY8A 3RUIB 4ANVA 1R4MI 2ZVOA 4DK5A 2HTHB 1I7AA 1WF9A 3A9JA 3EHVA 1NU2A 2L0TA 2ADZA 5DCNA 3UIOB 2D9XA 2L0FA 2HRJA 4NSWA 4DX8A 1CMXB 4PS3A 5AZGA 2JWZA 4HB4B 2N4FA 1J0WA 3M1IB 1UNRA 2O2VB 5DPRA 4WJ7A 2MWSB 5G55A 3ODOA 1IRSA 3KYDD 4X57B 1YX6B 4IOYX 1WGRA 1V49A 3DQVA 4KDLB 4HB3B 3DXCA 1LM8B 2H7EA 3TVVA 2ZPNA 3HW2B 2KMAA 1Q1OA 2BYFA 2NCNA 4W9GA 5CTRC 4GB9A 2HE7A 3ZUNA 4DBGA 3R7RA 1WX8A 1RFAA 4ANWA 3HIZA 3UINB 3D8DA 5C1ZA 3V60A 3QJZA 1BAKA 3NS8A 1V5OA 2KJ6A 3WAOA 4GZUA 3ZO5B 4B6WA 4ZYNA 2DYNA 2DYQA 2EJ8A 3A9KA 1AWEA 1VD2A 2UYZB 2Z59B 4GIVA 4MGYE 2DKQA 2JUOA 4EUTA 1TQZA 1S3SG 3IG3A 1TTNA 3H7PA 2B3AA 3TBLD 5D2MB 5HE0A 4RMAA 4WQOB 2WX0A 2NZ8B 2IO2B 3QIJA 2R0DA 2FCNA 3KW5B 2N0YA 4EOYA 5J3TA 4BBNC 1H4RA 1P3QU 1V5TA 3OJ4B 2KDBA 4IM0A 3IBEA 3IHPC 2L05A 4DX90 1WM3A 4JQWC 4MM3A 2DX5B 1GC7A 3HQCA 3DVNU 2LWPA 3WANA 5JHGA 4PQ0A 3LJ3A 3L16A 2BPSA 3L08A 4BBKA 2N1WA 4HXDA 4IW0A 2FUHB 4K7WA 1X05A 4NAWB 1KI1B 1PMSA 3TIXA 4AOFA 2RGNB 4I6PA 3L17A 3V62A 3SNHA 1X1GA 4KSLC 2N23A 1MIZB 3HHMA 4N9F4 3S2AA 3ZIMA 2KFKA 3G9WA 2GBKA 2J0KA 4HCPB 2NBWB 2LRUA 2CS4A 2KC2A 3SDLC 2G35A 3WAPA 5J2RA 1EVHA 2H7DA 1YX5B 1IPGA 2EMTA 1WXMA 2WYQA 4LJOB 2AL3A 1A5RA 1U5FA 1UEFA 3I3TB 4OVUA 2L3ZA 2LGDA 1Q0WB 1V89A 3VH4B 3PEGA 2K8BA 4IAPA 3UZTA 1NTYA 4G50A 2YS1A 1Z2MA 1V2YA 2ZPYA 3VTWA 2DYBA 4KZ0A 2EC1A 3O96A 1ZC3B 2GJYA 2C7HA 2M17A 3U30A 2KJRA
chains in the Genus database with same CATH superfamily
3HSAA 5D3DA 4MSMB 2V3SA 1LXDA 2LJ5A 4W9EA 2KUPA 2KGXB 2DZJA 3ML8A 3Q8AA 1V81A 2QSDA 4XWTA 1QLBB 3PHWB 3DBSA 3NZ3A 2AWTA 3PO0A 2RSGA 2LUEA 4JKCA 4MH0E 3B77A 5JHAA 4KKJA 2JVCA 4OHJA 4EZKA 1V5MA 4KAXB 3V6CB 2JY6A 3MC8A 2KN5A 1ET6A 1C76A 1UBIA 1VZ7A 5I2MA 2IO1B 1MKEA 1VCBA 4G0NB 1UPQA 1OEYJ 3KYCD 4OZAA 1SF0A 4EZJA 5H8YE 1HBKA 4HB0B 1YN5A 2KFJA 2GMIC 2M0XA 1WGQA 1T0QC 2WXFA 4ANXA 5CX3A 1XF5L 3SR6A 3QWZB 3KUCB 4BOZB 3AEEB 3PRPB 2PLPA 2IZVB 2LGYA 3WYFB 4MACA 4JKEA 2NS5A 1MG8A 4EMOA 2MBHA 5LXHA 3I5JC 2KYWA 1JQ4A 4URKA 1YJIA 1ET9A 5G2NA 2N7DA 3GYOA 4JWUC 2PIAA 4NAWA 3TEZA 2J0JA 1XLOA 1GJZA 4C56C 1I2HA 2V76A 1N3HA 4KX6B 1XT9B 1OY2A 3KWLA 1HA5A 2CU1A 4MGKE 1X11A 2KVRA 4HWIB 1NVLA 5FI1A 4F1SA 1FB8A 2BYEA 3TFMA 4FN2A 2W2XD 4C4VB 4L6EA 3AULA 3F5RA 5BYQA 5DPTA 4IWOA 5FKAC 2MSED 1E8YA 4HPMB 4WURA 3P6AA 2RD0A 2ZEQA 4IC7B 3W9CB 1KLUD 1XR0B 1TS2A 3UI3A 2N9EB 2KO3A 2CKHB 2KFKB 3M3JA 4A6HA 2COCA 2RDHA 2JU6X 2G9HD 4NQLB 1LQBA 2ZCCA 1WSPA 2RVBB 2NR2A 3P7ZA 2DWQA 3D8FA 1IUEA 2YT2A 3APFA 1F1HA 2MJDA 3SFEB 3W1SC 2DLBA 2C60A 2KWUB 2BWFA 2MDXA 1ZYIA 3NRZA 4N58A 3VXWA 4MK0A 2DNFA 2QIEB 2NPTA 4KHBA 5JVLA 1E5WA 2GUMA 1C77A 3KQ4A 4F8CB 2I1JA 2XN9C 3UQAA 4XC2A 3ZNGC 4M0WB 1DGJA 2IGGA 2BT6A 3P2BA 3KVFB 2W9NA 2H88B 2W2XC 2GOWA 1EU3A 2PE9A 2LI5A 3JYUA 3WALA 2KCJA 1RRPB 2KANA 3QAQA 1CZPA 1V97A 2R82A 1IBXB 5D7GA 1DBHA 2ZZPB 3H7SA 1ROEA 2MX2A 2MP2A 4RGNA 2XQNM 4P1BC 2Z13A 1TBEA 2D3GA 1C3TA 1UUPA 2L1AA 4F7UP 2L00B 2WLBA 4GN1A 3N1XC 2AEHA 3N7CA 1DROA 3AE8B 3PRZA 2BCJA 4PNKA 2FCSA 4MH8A 3PTFC 3PVLA 3QX1A 3T06A 3DDCB 1P3RA 4MM3B 2I5FA 4XZ4A 4ILJA 1DYNA 1WGUA 3OAWA 2RDBC 4IM2A 4IM3A 4TQ0A 1N60A 1ZW7A 1L0VB 4GPTB 2BYTA 5IOIA 3FEHA 3RMKC 3D32A 2VRRB 3RNAC 1K53A 3QBVB 4CHJA 3HUIA 1ZGUB 2FCMA 2JRHA 2OTXA 1P7FA 3AE7B 1FRDA 2D10A 4ZDVA 2YVCA 2C5LC 1PDXA 2M38A 2XBBC 4JLCA 3A1QB 1WVHA 3E9SA 4YSYB 1Q67A 2MEKA 3BYYB 1J7CA 5H92C 4GDLB 3AN1A 3VDZA 1SGHA 1Y19B 3RZFA 1WZ3A 1SEBD 1KJTA 4P6VF 1OQQA 4Z2NA 1XO3A 2N0SB 2LKOA 2BS4B 4AJYB 3PGEA 2JP2A 4W9KA 1VZ8A 4KHAA 3QK0A 3B1LX 2QILA 4F7HA 1WFYA 4OVVA 4HK2A 4PS8A 4XDDA 2RUKB 4A55A 2W55A 1WJ6A 4WJOA 2IYBA 1TYGB 5KQ4A 3CIKA 3L4PA 4FADA 1MI1A 2K2UA 1F52A 3VVWB 3P42A 1EWCA 1Q10A 1M4VA 5AZGA 4C0AA 2QKMA 2OJWA 2BKRB 3SYXA 4A3PA 3ETRA 3QC8B 3I57A 4BBNF 3IAS1 1P7EA 1ENFA 4I6LB 3SBGA 4NQKE 2CODA 3KZ1A 2KLCA 3FSSA 2WDTB 2GCLA 3EUB2 2DHKA 2MA9B 1MK9B 5JHBA 1C9FA 2GBMA 2JX5A 3SO6A 4NZLB 2HJ1A 2HJ8A 1PFDA 2LVOA 2LXCA 2ZKMX 3HK0A 4DDGD 3NUHB 3PG7A 1FNWA 1E8WA 1YQ3B 3ZNID 2Z0EB 1N5XA 4Z2MB 4W9LA 3VIAA 3QWMA 2IO3B 5L81A 4GOUA 1EO6A 2RPVA 1I42A 3Q8FA 2WXGA 4HHVA 2WXIA 4WH4A 2MFQA 4QJ5B 3PLVA 2PW9A 4FJYA 4EEWA 1FXAA 2JQRB 3DBRI 1UBQA 4HEA1 1HB6A 4H8SA 4YSZB 2J59M 3R2IA 5C5BA 1X86A 4YTMB 3RNBC 2BS3B 1W1DA 1ST7A 3LYYA 1E10A 2AQ1B 2K8HA 1C78A 2K5PA 2N9PC 1D5MC 3GZNB 1UGJA 2Z0QA 1X1MA 1WGDA 2JRIB 4ZOHC 3RUIB 2ZVOA 2JSVX 4A90A 4DK5A 1JROA 3EHVA 2RDGA 1K51A 4OT1A 2D9XA 4LNNA 4HB4B 4PK1A 3ODOA 1IRSA 3AE9B 1QT9A 1LM8B 2NCNA 3ZQ4A 3R7RA 2M19A 3UINB 3D8DA 2W82A 3Q6BA 3QJZA 3NS8A 2KJ6A 3ZO5B 4M0WA 3E9OA 3E9PA 2EJ8A 3A9KA 1SE2A 2MJEA 2Z59B 4GIVA 2DKQA 3EA6A 1KRHA 5D2MB 4RMAA 4WQOB 2X38A 3Q2AC 2K8EA 2NZ8B 1UF0A 4EOYA 1H4RA 1P3QU 3OJ4B 3IBEA 1STEA 3IHPC 1MHXA 1SXTA 1WM3A 1FO4A 1GC7A 1VR9A 3WANA 4PQ0A 1ZOYB 1VLBA 1HXYD 2V9HA 4BBKA 1KI1B 3BVGA 4KSLC 1X1GA 1NI3A 4HCPB 1WRIA 2J0KA 2X0SA 2LRUA 2G35A 2H7DA 1IPGA 2DIKA 2WXMA 5AUKA 5IRSA 1A5RA 1U5FA 4HKQA 1TY2A 2D3BA 1V89A 1XLQA 1NTYA 2YS1A 1YNTE 3IAM1 4KZ0A 2PVGC 3O96A 3KLSX 5LXIB 5I2SA 3CSTA 4MDKE 2N9KA 2DZMA 1T77A 1RAXA 2C7NB 5IO9A 2Z14A 3DVGX 2NVUI 4XE0A 3BWUD 4K2PA 3GE8C 1V88A 2KTRB 2ASQA 1UD7A 4LDTB 5IN7A 4H2AA 1XCQL 3N30A 1HTQA 1XCGA 2EKIA 1GB4A 4EE2A 2EELA 1J7AA 5EE1A 1TS3A 4HLEA 1T0RC 3RNEC 1FRRA 2DBYA 2OQBA 3AMZA 2KJHB 1QF6A 1EGXA 4CHMA 5AEKB 1OTRB 1GPXA 2W3RA 2BB6A 2KIGA 3ALBA 4LDTD 2RPQA 4N59A 4JK7A 1NBFC 2VZKD 3M63B 5GXGB 1DDMA 1KOTA 3UIPB 3PP2A 3CMMB 4HAUB 1H10A 1WG7A 1JRPA 5KHQA 3KY9A 3N3KB 3LJUX 1J19A 2INCC 3TO1A 3DBLB 2LRWA 1L2NA 1NYQA 1V5PA 1QKZA 4ARCA 1TS5A 2QHOA 5G5GA 4ANUA 2N7EA 2ICIA 4IWPA 3AU5A 5AUIA 4E71A 4AJWA 1ZM0A 1MIXA 4AUQC 2FBWB 4ICVA 5C2TB 1YMHE 2FJ9A 1E9MA 4JL9A 2J42A 2E3TA 1AYFA 1G6JA 1JWAD 4HJGE 2WXRA 1N6ZA 4BKGA 5BO4B 3C0RB 2GB1A 1I35A 1WMHB 1KC7A 1SB3C 2BVCA 2J7QB 2KNBA 1ZSQA 5CLQB 3FKYA 2D3AA 5C6RA 3SBTA 2GBRA 2R2QA 4ZRJA 4YXDB 5LLIA 3F0WA 3Q3MC 2G3QB 2NBVB 1TY0A 1J7BA 1P98A 4WQMA 1MPEA 2KK8A 3OJ3A 5J18A 3H6NA 1FXIA 1MAIA 4CO7A 2AX5A 3VTVA 1NEKB 1EAZA 3FILA 1SSNA 2LVQA 3FC4A 4K1RB 4E74A 5IP4D 1V1OA 1NI2A 1XQQA 3RZWC 2IYDB 1D5ZC 3R3MA 2KKCA 3QA8A 2AQ2B 4YTNB 3KUDB 4A20A 1UGMA 4TQ1A 4A6FB 1GG3A 5LONB 1UWMA 4BKTA 1QQGA 2Z59A 3KUZA 4XDCA 5GOWB 1HZ5A 1FGZA 5DIFB 4A6QA 3BK1A 2WXNA 3NOBA 4S0RA 3RPFC 1FD6A 1AARA 3ZUNA 3ZXVA 2WXQA 3IVFA 2A4ZA 4II2B 2KQ7A 4HAVB 2MLBA 4LNIA 2D9VA 2D5GA 2LGXA 2MW5A 3ZJUA 1JWSD 4RM8A 1WJ4A 1FFUA 4A6KA 5M4YB 3ZNHB 3T9LA 2PKOA 2KUQA 2Z8LA 3VUWA 4US9A 3VRBB 2DYMA 1WX9A 2CY4A 1E7PB 2DKPA 2IBIB 2Q5WD 4M01A 3Q8BA 5HHDG 1KM7A 2I5CA 3NVYA 2D4QA 1WIAA 2QMTA 2KQ4X 2VRWB 4NJ7A 3RT3B 4MEMA 3EC8A 3L0WB 2PMVA 4BKSA 4HAWB 3NVVA 1YJ1A 1ZVRA 4GMXB 1AQCA 2QCZA 3HM3A 2FAZA 5D6JB 4JIOU 3L13A 2MHJA 3AXCA 3RCZA 3DWMA 1WXSA 3BJIA 2CB8A 2JF5A 2UU7A 3RNFC 5C16A 1DOXA 2RGFA 1W1HA 1YJJA 1YQ4B 2RSUA 2ACZB 5DHAB 1K8RB 4A9AA 3HIEA 1KH0A 4FHJA 2G4DB 4QJ4B 3E66A 1VDVA 3KRXA 1M94A 4FJZA 4FA6A 2O2VA 3B9JA 2UVMA 3DCXA 4TV3A 5E6JA 2KHWB 3E9LA 2KR0A 2FUG1 3VUXA 2IFSA 5DPSA 3ZKJC 4XGAB 2DZIA 3DCGA 2Y8GA 2JXXA 1TS4A 1U27A 3HRDD 2L8JA 1XXGA 5TSSA 1NTIA 5HKHA 2K39A 1P6SA 2M1MA 3N1YC 4KIKA 2LOZA 1BT0A 1PGAA 5HE1A 1NENB 3NZUA 3ZW3A 4FLHA 1DDWA 3JW0X 1OEYA 3WAMA 1JWUD 1FCCC 2DENB 2M8SA 1GUAB 4HATB 2XK5B 3SUZA 2OEDA 3VOQA 1Z5SB 4ZHOA 1ZDXA 1BWNA 4HAXB 1U29A 3X0WA 2CJNA 2FE8A 4GOCA 2ABDA 5L95C 1K50A 1LW3A 1JMLA 1H8CA 4WWOA 3EFUA 1HE8A 4RGMA 2N9XA 3VTUA 2NPTB 3V6EB 2GRIA 4WVFB 4L23A 4A6FA 2OJRA 2EKEC 2K25A 1TXDA 1U5GA 3P63A 4W9FA 3ZYYX 5CHFA 1P5TA 3CF6E 4HPPA 4N6EB 2CQUA 1ZPSA 2ZCBA 3O65B 4GDLA 4MGIE 3N20C 2WXPA 4GGQA 2JYTA 2FCQA 4HPLB 3A1QA 2YEPB 2CJOA 3FILB 1JDEA 3GOEA 4TYZA 3ULBA 1FHOA 2V4IB 1T0YA 5HI1A 2J4XA 4GXBA 3J9CA 1P1AA 3KH0A 2L83A 3RD2A 2A5UA 2LFIA 2IDYA 1J8CA 3K9PB 1WJ1A 4RFBA 3W5VB 3OWEB 2D9ZA 2HTME 2N1VA 3V61A 2LG1A 2RRFA 2DTCA 4LNOA 4C4VA 4HAZB 4RNAA 1FMAD 4GSWA 2V1YA 2AL6A 4A5KA 2XK5A 2BYVE 3EFCA 1NTVA 1OFFA 5J17A 1E7VA 2VH1A 3IT6B 2ZJDA 1GOZA 3OANA 1VRAB 1WGYA 2BWES 4MSQB 5CLLB 1R4NI 3ODXA 2PPHA 1ZKHA 1SE4A 1M7EA 5EFXA 4RH6A 1E0ZA 2K00A 4JKGA 3PZ8A 2YRYA 3DVGY 2YF0A 1WF9A 1I7AA 3A9JA 2WDQB 4JK9A 5DCNA 3UIOB 4NSWA 3MC0B 4DQOC 2N4FA 1UNRA 2O2VB 3NG0A 3EGRA 3KYDD 1YX6B 3DQVA 3P4SB 1VBHA 1V49A 1DOYA 4K7WA 3DXCA 2H7EA 5FK9C 1C79A 5LNK1 3DBHB 1PYWD 1ACCA 1RFAA 2NBVA 2M56B 4YSXB 5C1ZA 1BAKA 2X8XX 1V5OA 4RF1A 3WAOA 4GZUA 2Y5PA 3P4RB 4MGYE 2JUOA 1TQZA 1TTNA 1DYQA 3DWGC 3TBLD 5HE0A 1A70A 2WX0A 2IO2B 2FCNA 3C8YA 2N0YA 5J3TA 4UDUC 2KDBA 2L05A 4O1NA 3BK2A 4DX90 3A58A 2KVZA 1TKEA 3L08A 2N1WA 1X05A 2RGNB 3Q14C 3S2AA 3ZIMA 2KFKA 3G9WA 2NBWB 2KC2A 3SDLC 5J2RA 1EVHA 1WXMA 1UNSA 1UEFA 1F77A 2L3ZA 2LGDA 4IAPA 1VJKA 4D2KA 2ZPYA 1TJEA 2D3CA 2EC1A 1K52A 1T3QA 2GJYA 2C7HA 4HROA 4BKSD 3U30A 4MJSA 4US8A 1B55A 1E8XA 3NWFA 5FI0A 2HD5B 3TCAA 1ZXHA 5L83A 3MPXA 5HE2A 1XD3B 1WJMA 1MJDA 2UZSA 1RM6C 1FGYA 2IO0B 5BMIA 2KD0A 4TUUA 4KHBB 4R3DA 1TKYA 3CWIA 3M62B 1SHCA 4EFOA 2I38A 4GLSC 3VUYA 2J53A 3T8MA 1F0ZA 3AEFB 2DHIA 2O6VB 1NDDA 4HDOA 3ODWA 4WSFA 4ARIA 3A9KB 4LLGM 3TJPA 1LO5D 3WCQA 4B0EA 4DIXA 2KTRA 2MKRA 1XODA 1L4ZB 1YN4A 2K22A 3P4PB 2NMQA 2KX3A 5JH5C 2I1KA 4GMVA 2ZNVC 3NJTA 3PHXB 1U5DA 1DOIA 5E6PA 4MJSB 5HG2A 4L2YA 3E56A 2R09A 2FJLA 1OQNA 3ABVB 2OOBB 4K3BA 3FM8C 1QILA 4IWQA 3ZRFA 1WGKA 3SV1A 1FPYA 1P9DU 1WMHA 2K6QA 1V80A 1UWXA 4ZRQA 1WI0A 2VH2A 1FXTB 3AB5A 1QQRA 4WWPA 3BY4B 3RNGC 3AE3B 2INDC 4WJPA 2LMCA 1BTNA 3R66C 2MQJA 4REZA 4JPSA 1JALA 1VBGA 2D07B 2JZZA 2KQSA 1SIJA 4P1CC 1QZEA 1SE3A 5IA7A 3NWDA 4C80A 4DHZE 3PVWA 1QC6A 3Q8CA 2NMBA 1I4GA 1TT5B 5KHOA 5EDSA 1PGXA 1WGHA 5D3YA 2FIFA 2KLGA 4K2OA 3JVZX 5G5HA 2WP9B 2MWNB 4HAYB 2WNMA 3Q69A 2WHIA 3DHIC 4B9KA 3DPDA 1U4AA 2M14A 1XEEA 2ZW0A 2KACA 2WDVB 4OVZA 1P0RA 3RCPA 3APDA 3DBHI 2KN4A 3A33B 2KDEB 4ZRKA 4W9DA 5JLJB 3DHGC 1XKEA 5TR5A 4HJKA 3RI7C 3SHQA 1LB1A 1EM7A 1EUVB 1Q5WB 2LZ6A 3MFGA 3A9JB 1V6EA 2MBBB 2LYDA 2VKIA 3VH3B 4DXGA 4F7GA 3HVDA 1R4MB 1DIKA 1WR6E 3RULA 1LFDA 4Q2JA 4D6WA 3GE3C 1SE9A 1WE6A 5D27A 5AZFA 1V1PA 2DAJA 2C7MB 1XX0A 3WA0A 1L0YB 1MG4A 2BKFA 5C5BB 1Y8RC 2VZKB 2K6DB 2OHFA 1B1ZA 4K17A 3ZRCA 2INPE 2ZNVB 2Z4DA 2P0DA 3GB1A 1MI0A 2IY0B 2MH7A 1YIWA 1WR1A 3ML9A 3TMPB 1EF1A 1FIQA 1XD4A 5JP4A 1WJUA 3NY5A 3KSYA 4IKGA 3AJ4A 1MK7B 2D11A 4K81A 4M8MA 2FDQA 1F2RC 5KCVA 5J3QA 1PQSA 2YLMA 3PSEB 2DZKA 1IYFA 2HTHA 3TEWA 2MRPA 2M0AA 3Q3JA 5D3IB 4TKNA 5HE3A 1MHHE 1UH6A 2WXHA 3U52E 4CQNA 2YSZA 1RRBA 3CXBB 4JKDA 5D3WA 3TL5A 2RQ1A 4JKFA 1K5DB 5E6NA 1JRUA 1WM2A 2ZVNA 1C4PA 2DLWA 4DHJD 4PS7A 4BFRA 1OGWA 1V86A 2DA0A 5DPWA 3HM6X 4ZYSA 2AYOB 4EJNA 1RJ2A 2RR9A 2Y8FA 2LUMA 4NPNA 4KV2A 3U7ZA 1SIFA 4ASWC 2NBUA 2X18A 3H1UA 1WWTA 4J6IA 4RM9A 4LNKA 3PV1A 3RYTA 3M95A 2MJ3A 2W2WA 2BBCA 3N1ZC 1T5XD 2MBQA 2INNE 1FHXA 2CRFA 4MY6A 2N9LA 1ZXIA 1TIFA 2WU2B 2DFKA 4KIKB 1NYRA 3ENBA 3FVCA 3PVUA 5BMHA 2ROZB 2K8CA 4EZLA 1RWSA 3CSFA 3AECB 1E8ZA 5DH9B 3B0AA 3MP9A 2R61A 4G11A 3SD5A 2KC1A 2RNRB 3MHSD 5FR6A 1OQYA 2MP2B 2Y5BB 3VQIA 3EECA 3Q3OC 2W3SA 2FNJB 2BW2A 4NY0A 2QEJC 3VHTC 2R2YA 1FNUA 4C00A 3JSVA 5E6OA 4ZHPA 2L1CA 3A4SC 3W1YA 1W1GA 5LOPB 3OHMB 1X1FA 3JSVB 2H89B 2QDFA 3AE5B 5EE0A 3T3OA 1C4AA 4II3B 3ZGZA 1I4QA 1C1YB 2N7JA 2UWQA 4IG7B 4FULA 3VR8B 2PJHA 3TW1A 5DI9B 4YL8A 4LNFA 1ISNA 4DHJB 2PE6B 2VSZA 3TEXA 2B76B 4JWSC 2K9XA 3P1MA 1I4HA 4WJNA 5BMGA 4CYEA 1V9JA 2YEPF 4USAA 2COPA 2D2QA 3A8PA 4MELA 3ULCA 3A8QA 1RFKA 2YS3A 1CQVA 3L54A 3QCAA 1L7YA 4RCOA 2LEKA 1L4DB 3FLVA 4JKAA 2P8VA 5J3YA 4IFSA 4TSSA 2YT0A 3PT2B 2QC8A 1D6EC 2CAYA 2KOXA 2P0HA 3ENEA 3ZTDA 1FHWA 3SEBA 1HQRD 3OG5A 1Y5OA 4JE3B 2IY1B 4S17A 3V05A 4HB2B 5D3XA 1VZ6A 1FM0D 2IGHA 2L7RA 2COFA 2FJUB 1K5GB 2Z0DB 3GZNI 2G1EA 4D0NB 3PLUA 2WWZA 3ZVVA 2EMSA 1Y56A 2LHEA 4A3OA 3TUOA 4XYCA 4B95A 2WXJA 1MPHA 3UGBB 5FR3A 1N61A 3NSUA 2SEBD 3K9OB 4AP4C 4FXCA 2REXA 5MPOA 2KTFA 3GS2A 3A4RA 4CHKA 4LJPB 1KZGA 3GYPA 1R4MI 4RGOS 2L0TA 2ADZA 2KWDA 1CMXB 2JWZA 3AE4B 1J0WA 3M1IB 2MWSB 1R4NB 4X57B 2JYEA 4KDLB 3HW2B 2BYFA 2QJLA 2V3NA 1XCTL 1EU4A 1WX8A 4C7ZA 4ANWA 1HZ6A 3HIZA 2KAJA 2L32A 4ZYNA 2DYNA 2DYQA 4ZRPA 2W54A 2UYZB 3FAHA 4J3OD 3V3XA 1QOFA 1QOBA 4TMAB 1IGCA 3KW5B 3QIJA 2NTSA 4ILGB 4BBNC 1V5TA 4MM3A 5JXVA 3HQCA 2LWPA 5JHGA 3LJ3A 3IT4B 3L16A 2BPSA 4NAWB 3TSSA 1PMSA 4AOFA 4I6PA 3U2SC 2IJ0A 3V62A 1TZOA 3LB8C 3IXSA 2CS4A 3WAPA 1YX5B 1JCKB 3R2TA 2EMTA 4LJOB 2AL3A 2XNAC 3KWVA 3I3TB 4CSQA 1Q0WB 5BYRA 3PEGA 3UZTA 1L6VA 4KGTA 1JWMD 1V2YA 3VTWA 1KFYB 2LGIA 1IBXA 1KF6B 4AQ7A 2M17A 2KJRA 1EWYC 3RN9C 4K3CA 3MTNB 2KDIA 3ZJTA 1M7RA 2LOXA 1HTOA 4WAFA 3PSCA 2KX0A 3BIID 1XLNA 3ZLZA 3SFDB 2AQ3B 2DHZA 1WXAA 4W9JA 1QOGA 2Z0OA 4HVBA 2KDFB 3LDZE 4NNJB 1E6EB 2J0MA 3NS1A 4ACFA 2DX5A 2MBEA 2I2YA 3MHZA 1UNPA 3U12A 3VFKA 1L6UA 2JZPA 2ELBA 2CU3A 2G45B 2V4LA 3R8BA 3W1SA 1YQBA 4HSIA 4YWGG 2GLSA 1TZ1A 1DDVA 3D8EA 4F7ZA 1UELA 1LGRA 3QHTA 1BUIC 3ECIA 3AI5A 5DHFB 2CR5A 1GGOA 2GBJA 2KT7A 2E6XA 1U2BA 1KLGD 1UPRA 3BINA 1E90A 2J52A 1KBLA 1V8CA 2ON8A 3DXDA 3ZDTA 5KQ1A 3X23A 2DN6A 4MT7A 2HDEA 1PGBA 3ZTCA 2WX1A 1AWDA 1HEZE 4P7IA 2QKLA 2O6VA 3NZSA 2BF8B 1FAOA 4DHZB 5C79A 3W2DA 4HRSA 3URYA 3KRWA 4Y94A 1FNVA 1WE7A 1AW7A 3ONSA 4ILHA 2PZ1A 4L1BA 1IGDA 2IGDA 3WIMA 2GS0A 2RLOA 1BMLC 3PS6A 2E2XA 3LXFA 2WU5B 1GAQB 5C23A 1FOEA 2COAA 2BB5A 5IAAC 2DAFA 1YOVB 2LXAA 3ZVRA 3AM9A 3N32A 4DXFA 2Y5CA 1D5XC 1TJ6A 4LTUA 4YONA 1JW9D 5CHWA 3AV8A 3H7PB 2WQYB 2K0PA 3MC9A 2LULA 2JZ3B 1SJHD 1SJED 1MFWA 3AU4A 1TGZB 1ZUD2 2JXTA 2UZRA 4K7SA 2K49A 4NJ6A 3O13A 2JT4B 4RGTA 4BOSC 1E7UA 3PZ7A 4DBBA 3U4EG 4JKHA 3U8ZA 4I6NB 2XEWA 4C7YA 4JGHB 1GC6A 1WX7A 3H9DA 2WGSA 1L0XB 4K7UA 2FIDA 5BYSA 2LD9A 4QJ3B 1WRDB 1WYWB 1NVID 1FFVA 4WAAA 4OZCA 4AS1A 4YTPB 1ZC4B 2DYOA 3R7QA 4EKUA 1N5WA 2GI9A 1OQRA 3RNCC 3VR9B 4KHOA 4WIPA 4XWXA 4JK8A 1T6BX 4PT5A 4G3XB 1D3ZA 1AN8A 4PYZA 3MDBC 4W9IA 2BTEA 1I7HA 2ROVA 2LGSA 3L10B 2P0FA 4P16A 3AEGB 5GMVA 2CHWA 1ZP0B 2JPHA 1BXTA 3I9V1 4QAYA 4FBJB 2MBOA 2LBBA 1WI1A 3APCA 3MJWA 5AZHA 1KLVA 4JKGB 1WYGA 2K1FA 2WDRB 3DXEA 2ELAA 5JZEB 1ZDVA 4GDKA 1ESFA 3ZXRA 4OW0A 1TKGA 2R2OA 2CHXA 1IP9A 2Y7BA 3AE6B 1PLSA 3DVNV 2PTLA 3Q3NC 4XWWA 4M02A 1ACAA 4MT5A 1RLFA 3MJ5A 4GNKB 1F9JA 1ZE3D 3ZNZB 1S1QB 2WS3B 2WH5A 1U5EA 3U7DA 2JWUA 3C19A 2L52A 2Z0PA 4JKBA 2GBNA 2CY5A 2KWVB 3QQ8B 5D94A 2D9YA 2KMCA 3Q3FA 3UF8A 4BAXA 4M00A 4XX5A 1QOAA 2LVPA 3W5UB 1GB1A 4FJVB 1RYJA 3V5WA 3PPAA 1KZ7A 3OLMD 5JHHA 1SBBB 1PUTA 3H8HA 3ZDMC 1WXVA 2BGFA 4KZCA 3NW8A 2O6VD 2Y3AA 3NVZA 3IFWB 2KIEA 1OMWA 1Z87A 3I63C 4WWMA 5CHVC 4KSKC 3VRAB 1GNUA 4BZAA 3B08A 3FP5A 4NAMA 5IKCM 2PEAA 3NHEB 4AWJA 2C9WB 2DHJA 1C4CA 4OSNA 4LCDE 2IPKD 4B6HA 3BYTB 2SAKA 2G4SA 2CHZA 3BVMA 5C3JB 4DXAB 1L5PA 2TSSA 1BTKA 1HB8A 5T8IA 1CJEA 4E3CA 5IJMA 1V1PB 3DBRB 4MGZE 3QARA 2KDMA 3NWAA 4DWFA 4JQWC 1EF5A 4ICUA 1WZ0A 4KDIC 4DDID 3PZDA 2KMMA 1WGGA 2MCNB 4KGRA 2LASA 3CIRB 1D4BA 5I4DA 3HVZA 4FHKA 4ZRIA 4ITKA 1UZXB 1WH3A 3EPYA 2YT1A 4KVGB 3UQBA 2YS5A 1F2RI 2ZW1A 2M4NA 3DBLI 3A98B 2V3PA 4GDKB 4YT0B 4IDIA 4W9HA 2DX1A 5EE3A 4W9CA 3B2GA 2Q13A 4M8NA 1T0SC 3P4QB 1JWBD 5LG4B 4HCNB 3N9YC 2KZRA 3PRMB 4GU2A 2KWCA 2KXJA 4OZBA 2BS2B 1MVKA 3ML4A 4IUMB 2D9WA 1V61A 1I4PA 2GCJA 3SU8X 3GP7A 3VAWA 3AE2B 5HFYA 2L2IA 2K2JA 1PFJA 4HDQA 1WJNA 1I4RA 3DOWA 4HKZE 4NJCA 3PREA 2L76A 1YD8U 4WWNA 1FCLA 1V5UA 4PYUA 3ZJVA 1XLPA 1UNQA 3AEBB 1I4XA 4KKIA 2PVOD 4BVUC 2K3UA 5D3VA 4WJQA 1B9RA 1WY8A 4ANVA 2HTHB 4IOIE 1NU2A 1FEHA 2WXOA 4L1RA 2L0FA 2HRJA 4DX8A 4PS3A 2LJIA 4B0MA 5DPRA 4WJ7A 5G55A 3B2FA 1N63A 2BQQA 4IOYX 1WGRA 2WXLA 3RFZB 5EE9A 4HB3B 5CTRC 3TVVA 2ZPNA 2KMAA 4W9GA 1Q1OA 1J0GA 3AE1B 4GB9A 2HE7A 1N62A 4DBGA 2RMMA 3T3NA 3AEAB 3AH7A 4LK0M 3TEYA 3V60A 3BZDB 2WXKA 4B6WA 3DHHC 1AWEA 1VD2A 2V0GA 4A8XC 4EUTA 1S3SG 3IG3A 3H7PA 2LHDA 2B3AA 2NTTA 2R0DA 1KTKA 1R7SA 4IM0A 1YN3A 2DX5B 1WXQA 3DVNU 4JX1C 3NVWA 4HXDA 3TIXA 4IW0A 2FUHB 4QXAB 3L17A 3SNHA 2N23A 1MIZB 3HHMA 4N9F4 3Q8EA 2GBKA 1CK1A 2ONQA 2WYQA 4KGSA 4OVUA 3VH4B 2K8BA 3BVZA 4G50A 1Z2MA 4RF0A 2DYBA 1ZC3B 3AEDB
chains in the Genus database with same CATH topology
4MSMB 2V3SA 1LXDA 2LJ5A 4W9EA 2KUPA 2KGXB 2DZJA 3ML8A 1V81A 3PHWB 3DBSA 2AWTA 2RSGA 2LUEA 4JKCA 4MH0E 5JHAA 2JVCA 4EZKA 1V5MA 4KAXB 3V6CB 2JY6A 2KN5A 1UBIA 2IO1B 1MKEA 1VCBA 4G0NB 1UPQA 1OEYJ 3KYCD 4EZJA 1HBKA 4HB0B 2KFJA 2M0XA 2GMIC 1WGQA 4ANXA 5CX3A 3QWZB 3KUCB 4BOZB 3PRPB 2IZVB 2LGYA 3WYFB 4JKEA 2NS5A 1MG8A 4EMOA 2MBHA 5LXHA 4URKA 5G2NA 2N7DA 3GYOA 4NAWA 2J0JA 1GJZA 1I2HA 2V76A 1N3HA 1XT9B 1OY2A 2CU1A 4MGKE 1X11A 2KVRA 4HWIB 1NVLA 5FI1A 4F1SA 1FB8A 2BYEA 3TFMA 4FN2A 2W2XD 4L6EA 3AULA 3F5RA 5DPTA 4IWOA 2MSED 1E8YA 4HPMB 3P6AA 2RD0A 2ZEQA 4IC7B 1XR0B 2N9EB 2KO3A 2CKHB 2KFKB 3M3JA 4A6HA 2COCA 4NQLB 1LQBA 2ZCCA 2RVBB 2NR2A 3P7ZA 3D8FA 3APFA 3W1SC 2C60A 2KWUB 2BWFA 2MDXA 3VXWA 4MK0A 2NPTA 5JVLA 1E5WA 4F8CB 2I1JA 3UQAA 4XC2A 3ZNGC 4M0WB 3P2BA 3KVFB 2W9NA 2W2XC 2GOWA 2PE9A 2LI5A 3JYUA 3WALA 2KCJA 1RRPB 2KANA 3QAQA 2R82A 5D7GA 1DBHA 2ZZPB 3H7SA 2MX2A 2MP2A 2XQNM 1TBEA 1C3TA 2D3GA 4F7UP 2L00B 4GN1A 2AEHA 3N7CA 1DROA 3PRZA 2BCJA 4PNKA 2FCSA 3PTFC 3PVLA 3QX1A 3T06A 3DDCB 1P3RA 2I5FA 4XZ4A 4ILJA 1DYNA 1WGUA 3OAWA 4IM2A 4IM3A 4TQ0A 1ZW7A 4GPTB 3FEHA 3D32A 2VRRB 3QBVB 4CHJA 1ZGUB 2FCMA 2JRHA 2OTXA 2D10A 4ZDVA 2YVCA 2C5LC 2M38A 2XBBC 4JLCA 3A1QB 1WVHA 1Q67A 4GDLB 3VDZA 1SGHA 1Y19B 3RZFA 1WZ3A 1KJTA 4Z2NA 2LKOA 4AJYB 3PGEA 2JP2A 4W9KA 3QK0A 4KHAA 3B1LX 4F7HA 1WFYA 4OVVA 4HK2A 4PS8A 2RUKB 1WJ6A 4WJOA 2IYBA 5KQ4A 3CIKA 4FADA 2K2UA 3VVWB 5AZGA 4C0AA 2QKMA 2BKRB 3SYXA 4A3PA 3QC8B 4BBNF 4I6LB 3SBGA 4NQKE 2CODA 3KZ1A 2KLCA 3FSSA 2WDTB 2GCLA 2DHKA 2MA9B 1MK9B 5JHBA 2GBMA 3SO6A 2HJ8A 2LVOA 2LXCA 4DDGD 3HK0A 3PG7A 1E8WA 3ZNID 2Z0EB 4W9LA 4Z2MB 3VIAA 3QWMA 2IO3B 5L81A 1EO6A 1I42A 4HHVA 2MFQA 3PLVA 4FJYA 4EEWA 3DBRI 1UBQA 1HB6A 4H8SA 2J59M 5C5BA 1X86A 1W1DA 1ST7A 2K8HA 2N9PC 2Z0QA 1X1MA 1WGDA 2JRIB 3RUIB 2ZVOA 4DK5A 3EHVA 2D9XA 4HB4B 3ODOA 1IRSA 1LM8B 2NCNA 3R7RA 3UINB 3D8DA 3QJZA 3NS8A 2KJ6A 3ZO5B 3E9OA 3E9PA 2EJ8A 3A9KA 2Z59B 4GIVA 2DKQA 5D2MB 4RMAA 4WQOB 2NZ8B 4EOYA 1H4RA 1P3QU 3OJ4B 3IBEA 3IHPC 1WM3A 1GC7A 3WANA 4PQ0A 4BBKA 1KI1B 4KSLC 1X1GA 4HCPB 2J0KA 2X0SA 2LRUA 2G35A 2H7DA 1IPGA 2DIKA 1A5RA 1U5FA 1V89A 1NTYA 2YS1A 4KZ0A 3O96A 5LXIB 3CSTA 4MDKE 2DZMA 1RAXA 2C7NB 3DVGX 2NVUI 4K2PA 1V88A 2KTRB 2ASQA 1UD7A 4LDTB 3N30A 1XCGA 4HLEA 2OQBA 2KJHB 1EGXA 4CHMA 5AEKB 1OTRB 3ALBA 4LDTD 2RPQA 4JK7A 1NBFC 3M63B 1DDMA 1KOTA 3UIPB 3PP2A 3CMMB 4HAUB 1H10A 1WG7A 5KHQA 3KY9A 3N3KB 3LJUX 1J19A 3TO1A 2LRWA 1L2NA 1V5PA 2QHOA 4ANUA 2N7EA 4IWPA 3AU5A 4E71A 4AJWA 1ZM0A 1MIXA 4AUQC 4ICVA 2FJ9A 4JL9A 1G6JA 4BKGA 5BO4B 3C0RB 1I35A 1WMHB 1KC7A 2J7QB 2KNBA 1ZSQA 5CLQB 5C6RA 3SBTA 2GBRA 2R2QA 4ZRJA 5LLIA 3F0WA 2G3QB 2NBVB 1P98A 2KK8A 3OJ3A 5J18A 3H6NA 1MAIA 4CO7A 3VTVA 1EAZA 2LVQA 4K1RB 4E74A 1NI2A 1XQQA 3RZWC 2IYDB 3R3MA 2KKCA 3QA8A 3KUDB 4A20A 1UGMA 4TQ1A 4A6FB 1GG3A 5LONB 4BKTA 1QQGA 3KUZA 5GOWB 1FGZA 5DIFB 3NOBA 1AARA 3ZUNA 3IVFA 2A4ZA 4II2B 2KQ7A 4HAVB 2MLBA 2D9VA 2LGXA 2MW5A 4RM8A 1WJ4A 4A6KA 3ZNHB 3T9LA 3VUWA 2DYMA 1WX9A 2CY4A 2DKPA 2IBIB 1KM7A 2I5CA 2D4QA 1WIAA 2VRWB 4NJ7A 3RT3B 4MEMA 3EC8A 3L0WB 4BKSA 4HAWB 1YJ1A 1ZVRA 4GMXB 1AQCA 3HM3A 2FAZA 5D6JB 4JIOU 3L13A 3AXCA 3RCZA 1WXSA 3BJIA 2CB8A 2JF5A 5C16A 2RGFA 1W1HA 2RSUA 5DHAB 1K8RB 4FHJA 2G4DB 3E66A 3KRXA 1M94A 4FJZA 4FA6A 2O2VA 2UVMA 4TV3A 2KHWB 3E9LA 3VUXA 2IFSA 5DPSA 3ZKJC 2DZIA 3DCGA 2Y8GA 2JXXA 1U27A 2L8JA 5HKHA 1NTIA 2K39A 1P6SA 2M1MA 4KIKA 2LOZA 1BT0A 5HE1A 3NZUA 3ZW3A 4FLHA 1DDWA 3JW0X 1OEYA 3WAMA 2DENB 2M8SA 1GUAB 4HATB 2XK5B 3SUZA 3VOQA 1Z5SB 1BWNA 4HAXB 1U29A 3X0WA 4GOCA 2ABDA 5L95C 1LW3A 1H8CA 4WWOA 3VTUA 1HE8A 3EFUA 2N9XA 2NPTB 3V6EB 4WVFB 4A6FA 2OJRA 2EKEC 2K25A 1TXDA 1U5GA 4W9FA 5CHFA 1P5TA 3CF6E 2CQUA 2ZCBA 4MGIE 3O65B 4GDLA 4GGQA 2FCQA 4HPLB 3A1QA 3GOEA 1JDEA 4TYZA 3ULBA 1FHOA 1T0YA 4GXBA 1P1AA 3KH0A 3RD2A 2A5UA 1J8CA 3K9PB 1WJ1A 2D9ZA 3V61A 2N1VA 2LG1A 2DTCA 4HAZB 4GSWA 2V1YA 2AL6A 4A5KA 2XK5A 2BYVE 1NTVA 5J17A 1E7VA 2ZJDA 3OANA 1WGYA 2BWES 4MSQB 5CLLB 1R4NI 3ODXA 2PPHA 1ZKHA 1M7EA 5EFXA 2K00A 4JKGA 2YRYA 3DVGY 2YF0A 1WF9A 1I7AA 3A9JA 4JK9A 5DCNA 3UIOB 4NSWA 2N4FA 1UNRA 2O2VB 3KYDD 1YX6B 3DQVA 1VBHA 1V49A 4K7WA 3DXCA 2H7EA 1RFAA 5C1ZA 1BAKA 1V5OA 3WAOA 4GZUA 4MGYE 2JUOA 1TQZA 1TTNA 3TBLD 5HE0A 2WX0A 2IO2B 2FCNA 2N0YA 5J3TA 2KDBA 2L05A 4DX90 3L08A 2N1WA 1X05A 2RGNB 3S2AA 3ZIMA 2KFKA 3G9WA 2NBWB 2KC2A 3SDLC 5J2RA 1EVHA 1WXMA 1UEFA 2L3ZA 2LGDA 4IAPA 2ZPYA 2EC1A 2GJYA 2C7HA 4BKSD 3U30A 4MJSA 1B55A 1E8XA 5FI0A 2HD5B 3TCAA 5L83A 3MPXA 5HE2A 1XD3B 1WJMA 2UZSA 1FGYA 2IO0B 2KD0A 4TUUA 4KHBB 3M62B 4EFOA 1SHCA 3VUYA 3T8MA 2DHIA 2O6VB 1NDDA 4HDOA 3ODWA 4WSFA 3A9KB 3TJPA 2KTRA 2MKRA 1XODA 5JH5C 2KX3A 2I1KA 4GMVA 2ZNVC 3PHXB 1U5DA 5E6PA 4MJSB 2R09A 2FJLA 1OQNA 2OOBB 3FM8C 4IWQA 3ZRFA 3SV1A 1P9DU 1WMHA 2K6QA 1V80A 1WI0A 1FXTB 4WWPA 3BY4B 4WJPA 1BTNA 3R66C 2MQJA 1VBGA 2D07B 2JZZA 2KQSA 1QZEA 5IA7A 4DHZE 3PVWA 1QC6A 2NMBA 5KHOA 5EDSA 1WGHA 5D3YA 2FIFA 2KLGA 4K2OA 3JVZX 2MWNB 4HAYB 4B9KA 3DPDA 1U4AA 2M14A 1P0RA 3RCPA 3APDA 3DBHI 3A33B 2KDEB 4ZRKA 4W9DA 5JLJB 1XKEA 5TR5A 4HJKA 3SHQA 1LB1A 2LZ6A 1EUVB 1Q5WB 3A9JB 1V6EA 2MBBB 2LYDA 2VKIA 3VH3B 4F7GA 1DIKA 1WR6E 3RULA 1LFDA 1SE9A 1WE6A 5D27A 5AZFA 2DAJA 2C7MB 1XX0A 3WA0A 2BKFA 5C5BB 1Y8RC 2K6DB 4K17A 3ZRCA 2ZNVB 2P0DA 2IY0B 1YIWA 1WR1A 3ML9A 3TMPB 1EF1A 1XD4A 5JP4A 1WJUA 3NY5A 3KSYA 3AJ4A 1MK7B 2D11A 4K81A 4M8MA 2FDQA 5KCVA 5J3QA 1PQSA 2YLMA 3PSEB 2DZKA 1IYFA 2HTHA 2MRPA 3Q3JA 4TKNA 5HE3A 1UH6A 2YSZA 1RRBA 3CXBB 4JKDA 5D3WA 3TL5A 2RQ1A 4JKFA 1K5DB 5E6NA 1JRUA 1WM2A 2ZVNA 2DLWA 4DHJD 4PS7A 4BFRA 1OGWA 1V86A 2DA0A 5DPWA 3HM6X 2AYOB 4EJNA 1RJ2A 2RR9A 2Y8FA 4NPNA 4KV2A 1SIFA 4ASWC 2NBUA 2X18A 3H1UA 4J6IA 4RM9A 3PV1A 3RYTA 3M95A 2W2WA 2MBQA 1FHXA 2CRFA 4MY6A 2DFKA 4KIKB 3ENBA 3PVUA 2ROZB 2K8CA 4EZLA 3CSFA 1E8ZA 5DH9B 3B0AA 4G11A 3SD5A 2KC1A 2RNRB 3MHSD 5FR6A 1OQYA 2MP2B 2Y5BB 3VQIA 3EECA 2FNJB 4NY0A 3VHTC 3JSVA 5E6OA 2L1CA 3A4SC 3W1YA 1W1GA 5LOPB 1X1FA 3JSVB 4II3B 1C1YB 2UWQA 4IG7B 4FULA 2PJHA 3TW1A 5DI9B 4YL8A 1ISNA 4DHJB 2PE6B 2VSZA 4WJNA 4CYEA 1V9JA 2COPA 2D2QA 3A8PA 4MELA 3ULCA 3A8QA 2YS3A 3L54A 3QCAA 1L7YA 3FLVA 4JKAA 2P8VA 5J3YA 4IFSA 2YT0A 3PT2B 2CAYA 2KOXA 2P0HA 3ENEA 3ZTDA 1FHWA 1Y5OA 2IY1B 4HB2B 5D3XA 2L7RA 2COFA 1K5GB 2Z0DB 3GZNI 4D0NB 3PLUA 2WWZA 3ZVVA 2EMSA 4A3OA 4B95A 1MPHA 3UGBB 3NSUA 3K9OB 4AP4C 2REXA 2KTFA 3A4RA 4CHKA 4LJPB 1KZGA 3GYPA 1R4MI 2L0TA 2ADZA 1CMXB 2JWZA 1J0WA 3M1IB 2MWSB 4X57B 4KDLB 3HW2B 2BYFA 1WX8A 4ANWA 3HIZA 4ZYNA 2DYNA 2DYQA 2UYZB 3KW5B 3QIJA 4ILGB 4BBNC 1V5TA 4MM3A 3HQCA 2LWPA 5JHGA 3LJ3A 3L16A 2BPSA 4NAWB 1PMSA 4AOFA 4I6PA 3V62A 2CS4A 3WAPA 1YX5B 2EMTA 4LJOB 2AL3A 3I3TB 1Q0WB 3PEGA 3UZTA 1V2YA 3VTWA 2M17A 2KJRA 3MTNB 2KDIA 1M7RA 2LOXA 3PSCA 2KX0A 3ZLZA 2DHZA 1WXAA 4W9JA 2Z0OA 4HVBA 2KDFB 3LDZE 4NNJB 2J0MA 2DX5A 2MBEA 1UNPA 3VFKA 2ELBA 2G45B 2V4LA 3W1SA 1YQBA 1TZ1A 1DDVA 3D8EA 4F7ZA 1UELA 3QHTA 3ECIA 3AI5A 5DHFB 2CR5A 1GGOA 2GBJA 1U2BA 1UPRA 3BINA 1E90A 1KBLA 3DXDA 3ZDTA 5KQ1A 3X23A 2DN6A 4MT7A 3ZTCA 2WX1A 4P7IA 2QKLA 2O6VA 3NZSA 2BF8B 1FAOA 4DHZB 5C79A 3KRWA 4Y94A 1WE7A 3ONSA 4ILHA 2PZ1A 3WIMA 2GS0A 2RLOA 3PS6A 2E2XA 5C23A 1FOEA 2COAA 5IAAC 2DAFA 2LXAA 3ZVRA 3N32A 1TJ6A 4YONA 5CHWA 3H7PB 2LULA 2JZ3B 3AU4A 1TGZB 2UZRA 4K7SA 4NJ6A 2JT4B 4BOSC 1E7UA 4DBBA 4JKHA 3U8ZA 4I6NB 2XEWA 4JGHB 1GC6A 1WX7A 3H9DA 4K7UA 2FIDA 2LD9A 1WYWB 1WRDB 4WAAA 1ZC4B 2DYOA 3R7QA 4EKUA 4KHOA 4XWXA 4JK8A 4G3XB 1D3ZA 4PYZA 3MDBC 4W9IA 2ROVA 3L10B 2P0FA 5GMVA 2CHWA 2JPHA 4FBJB 2MBOA 2LBBA 1WI1A 3APCA 3MJWA 5AZHA 1KLVA 4JKGB 2K1FA 3DXEA 2ELAA 5JZEB 4GDKA 2R2OA 2CHXA 1IP9A 2Y7BA 1PLSA 3DVNV 1ACAA 1RLFA 1F9JA 3ZNZB 1S1QB 2WH5A 1U5EA 3U7DA 2Z0PA 4JKBA 2GBNA 2CY5A 2KWVB 3QQ8B 5D94A 2D9YA 2KMCA 3Q3FA 3UF8A 4XX5A 2LVPA 4FJVB 3V5WA 3PPAA 1KZ7A 3OLMD 5JHHA 3ZDMC 1WXVA 2BGFA 4KZCA 2O6VD 3IFWB 1OMWA 1Z87A 5CHVC 4KSKC 1GNUA 3B08A 3FP5A 2PEAA 3NHEB 4AWJA 2C9WB 2DHJA 4LCDE 4B6HA 2G4SA 2CHZA 4DXAB 1BTKA 1HB8A 4E3CA 5IJMA 4MGZE 3QARA 4DWFA 4JQWC 1EF5A 4ICUA 1WZ0A 4KDIC 4DDID 3PZDA 1WGGA 2MCNB 2LASA 4FHKA 4ZRIA 1UZXB 1WH3A 3EPYA 2YT1A 4KVGB 3UQBA 2YS5A 3DBLI 2M4NA 3A98B 4GDKB 4W9HA 2DX1A 4W9CA 2Q13A 4M8NA 4HCNB 2KZRA 3PRMB 4GU2A 2KWCA 2KXJA 3ML4A 4IUMB 2D9WA 1V61A 3SU8X 2GCJA 3VAWA 2L2IA 2K2JA 1PFJA 4HDQA 1WJNA 3DOWA 3PREA 2L76A 1YD8U 4WWNA 1V5UA 4PYUA 1UNQA 4BVUC 5D3VA 4WJQA 1WY8A 4ANVA 2HTHB 1NU2A 2L0FA 2HRJA 4DX8A 4PS3A 5DPRA 4WJ7A 5G55A 4IOYX 1WGRA 4HB3B 5CTRC 1J0GA 3TVVA 2ZPNA 2KMAA 1Q1OA 4W9GA 4GB9A 2HE7A 4DBGA 3V60A 4B6WA 1AWEA 1VD2A 4EUTA 1S3SG 3IG3A 3H7PA 2B3AA 2R0DA 4IM0A 2DX5B 3DVNU 4HXDA 3TIXA 4IW0A 2FUHB 3L17A 3SNHA 2N23A 1MIZB 3HHMA 4N9F4 2GBKA 2WYQA 4OVUA 3VH4B 2K8BA 4G50A 1Z2MA 2DYBA 1ZC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS A;  3CST A;  3MTN B;  1B55 A;  4MDK E;  2DZM A;  2KDI A;  4MSM B;  1RAX A;  2C7N B;  1M7R A;  2LOX A;  3DVG X;  2V3S A;  3PSC A;  2KX0 A;  2NVU I;  1LXD A;  1E8X A;  4K2P A;  3ZLZ A;  1V88 A;  5FI0 A;  2HD5 B;  2ASQ A;  2DHZ A;  3TCA A;  1UD7 A;  2KTR B;  2LJ5 A;  1WXA A;  4LDT B;  4W9E A;  2KUP A;  3MPX A;  4W9J A;  5L83 A;  2KGX B;  5HE2 A;  1WJM A;  1XD3 B;  2Z0O A;  4HVB A;  2UZS A;  2KDF B;  3LDZ E;  4NNJ B;  1FGY A;  2DZJ A;  2IO0 B;  3ML8 A;  2J0M A;  3N30 A;  1V81 A;  2KD0 A;  2DX5 A;  1XCG A;  2MBE A;  4KHB B;  4TUU A;  3PHW B;  3M62 B;  4EFO A;  1SHC A;  1UNP A;  3DBS A;  2AWT A;  3VFK A;  2RSG A;  2LUE A;  3VUY A;  5HKH A;  4MH0 E;  2ELB A;  2G45 B;  2V4L A;  4HLE A;  5JHA A;  2JVC A;  3W1S A;  4EZK A;  1YQB A;  1V5M A;  3T8M A;  2OQB A;  4KAX B;  1DDV A;  1TZ1 A;  3D8E A;  2JY6 A;  1EGX A;  2KJH B;  3V6C B;  1UEL A;  2KN5 A;  4F7Z A;  4CHM A;  1UBI A;  2DHI A;  3QHT A;  5AEK B;  2O6V B;  2IO1 B;  1NDD A;  4HDO A;  3ODW A;  1MKE A;  4WSF A;  1OTR B;  5DHF B;  1VCB A;  3A9K B;  3AI5 A;  4G0N B;  3TJP A;  2CR5 A;  1UPQ A;  1OEY J;  3KYC D;  3ALB A;  4LDT D;  2RPQ A;  2GBJ A;  1U2B A;  2KTR A;  2MKR A;  1NBF C;  1XOD A;  4EZJ A;  5JH5 C;  1HBK A;  1UPR A;  3BIN A;  1E90 A;  2KX3 A;  2I1K A;  4GMV A;  2ZNV C;  3M63 B;  4HB0 B;  3PHX B;  2KFJ A;  2M0X A;  2GMI C;  1U5D A;  1WGQ A;  1DDM A;  3UIP B;  1KOT A;  3DXD A;  3ZDT A;  3PP2 A;  3X23 A;  5KQ1 A;  3CMM B;  5E6P A;  4HAU B;  4MJS B;  1H10 A;  1WG7 A;  5KHQ A;  4ANX A;  5CX3 A;  3KY9 A;  2DN6 A;  4MT7 A;  3N3K B;  3ZTC A;  3QWZ B;  3LJU X;  2WX1 A;  1J19 A;  2R09 A;  2FJL A;  3KUC B;  4BOZ B;  3TO1 A;  1OQN A;  2LRW A;  4P7I A;  2QKL A;  2O6V A;  3NZS A;  3PRP B;  3QK0 A;  2OOB B;  1L2N A;  3FM8 C;  4IWQ A;  2IZV B;  2BF8 B;  3ZRF A;  1V5P A;  1C3T A;  2LGY A;  3WYF B;  2NS5 A;  1FAO A;  3SV1 A;  4DHZ B;  1MG8 A;  1P9D U;  5C79 A;  1WMH A;  2QHO A;  4EMO A;  4ANU A;  2K6Q A;  1V80 A;  2MBH A;  2N7E A;  5LXH A;  4IWP A;  3KRW A;  1WI0 A;  3AU5 A;  4Y94 A;  1FXT B;  4URK A;  1WE7 A;  3ONS A;  4WWP A;  5G2N A;  4AJW A;  2N7D A;  4E71 A;  2PZ1 A;  1ZM0 A;  3GYO A;  3BY4 B;  3WIM A;  4NAW A;  1MIX A;  2J0J A;  4WJP A;  1BTN A;  3R66 C;  1I2H A;  4AUQ C;  2GS0 A;  2RLO A;  2V76 A;  2MQJ A;  1GJZ A;  1N3H A;  3PS6 A;  4ICV A;  2FJ9 A;  1XT9 B;  2E2X A;  4JL9 A;  1OY2 A;  2D07 B;  2JZZ A;  2CU1 A;  4MGK E;  2KQS A;  5C23 A;  1G6J A;  1X11 A;  2KVR A;  1FOE A;  2COA A;  1QZE A;  1NVL A;  5FI1 A;  2DAF A;  4HWI B;  5IAA C;  4BKG A;  5IA7 A;  4DHZ E;  5BO4 B;  3C0R B;  2LXA A;  3PVW A;  3ZVR A;  4F1S A;  1FB8 A;  2BYE A;  3TFM A;  1QC6 A;  2W2X D;  3N32 A;  4FN2 A;  1WMH B;  4L6E A;  1I35 A;  3AUL A;  3F5R A;  2NMB A;  5KHO A;  1TJ6 A;  5DPT A;  4YON A;  4IWO A;  5CHW A;  2MSE D;  3H7P B;  5EDS A;  1E8Y A;  2J7Q B;  2KNB A;  4HPM B;  1ZSQ A;  3P6A A;  5CLQ B;  1WGH A;  5C6R A;  5D3Y A;  2FIF A;  2RD0 A;  2KLG A;  4K2O A;  3JVZ X;  2LUL A;  2GBR A;  2JZ3 B;  2ZEQ A;  2R2Q A;  4IC7 B;  2MWN B;  4HAY B;  3AU4 A;  4ZRJ A;  1TGZ B;  5LLI A;  3F0W A;  2UZR A;  2G3Q B;  3DPD A;  1XR0 B;  4B9K A;  1U4A A;  2NBV B;  4K7S A;  4NJ6 A;  2N9E B;  2M14 A;  2KO3 A;  1P98 A;  2JT4 B;  2CKH B;  1E7U A;  2KK8 A;  2KFK B;  3M3J A;  4DBB A;  3H6N A;  3OJ3 A;  4BOS C;  5J18 A;  4A6H A;  1MAI A;  2COC A;  4CO7 A;  3U8Z A;  4I6N B;  2XEW A;  4JGH B;  1GC6 A;  1WX7 A;  1P0R A;  1LQB A;  3H9D A;  4NQL B;  3RCP A;  2ZCC A;  3APD A;  3DBH I;  3VTV A;  2RVB B;  4K7U A;  1EAZ A;  3P7Z A;  2FID A;  2KDE B;  4ZRK A;  2LVQ A;  2NR2 A;  3A33 B;  4K1R B;  2LD9 A;  4W9D A;  5JLJ B;  3D8F A;  4E74 A;  1NI2 A;  1XQQ A;  1WYW B;  1WRD B;  3RZW C;  1XKE A;  2IYD B;  4WAA A;  3R3M A;  5TR5 A;  4HJK A;  3APF A;  2KKC A;  3QA8 A;  3SHQ A;  1ZC4 B;  2DYO A;  1LB1 A;  2LZ6 A;  1EUV B;  1Q5W B;  3R7Q A;  3W1S C;  3A9J B;  1V6E A;  2C60 A;  1UGM A;  2BWF A;  2KWU B;  2LYD A;  2VKI A;  2MBB B;  3KUD B;  2MDX A;  4A20 A;  4EKU A;  3VH3 B;  4TQ1 A;  3VXW A;  4MK0 A;  4A6F B;  4F7G A;  1GG3 A;  5LON B;  3RUL A;  1WR6 E;  1LFD A;  2NPT A;  4BKT A;  1E5W A;  1SE9 A;  1QQG A;  1WE6 A;  3KUZ A;  4F8C B;  5GOW B;  2I1J A;  4KHO A;  3UQA A;  4XC2 A;  5D27 A;  3ZNG C;  1FGZ A;  4XWX A;  5DIF B;  4M0W B;  5AZF A;  2DAJ A;  2C7M B;  1XX0 A;  3WA0 A;  2BKF A;  3NOB A;  3P2B A;  5C5B B;  1Y8R C;  2K6D B;  3KVF B;  2W9N A;  4K17 A;  1AAR A;  2W2X C;  4G3X B;  3ZRC A;  2GOW A;  2ZNV B;  1D3Z A;  4PYZ A;  3MDB C;  2P0D A;  4W9I A;  2PE9 A;  2IY0 B;  2LI5 A;  3JYU A;  2KCJ A;  1YIW A;  3WAL A;  1RRP B;  1WR1 A;  3IVF A;  2ROV A;  2A4Z A;  2KAN A;  3ML9 A;  3QAQ A;  1EF1 A;  3TMP B;  3L10 B;  4II2 B;  2KQ7 A;  4HAV B;  1XD4 A;  5JP4 A;  2MLB A;  1WJU A;  2P0F A;  2D9V A;  3KSY A;  3NY5 A;  5D7G A;  3AJ4 A;  1MK7 B;  2D11 A;  1DBH A;  4K81 A;  2LGX A;  2MW5 A;  2ZZP B;  3H7S A;  5GMV A;  2CHW A;  4M8M A;  5LXI B;  2FDQ A;  2JPH A;  2MP2 A;  2MX2 A;  4RM8 A;  2XQN M;  5KCV A;  5J3Q A;  1WJ4 A;  4FBJ B;  2MBO A;  1PQS A;  2YLM A;  1TBE A;  2D3G A;  2DZK A;  4A6K A;  2HTH A;  3PSE B;  2LBB A;  1WI1 A;  2MRP A;  3APC A;  3ZNH B;  4F7U P;  1IYF A;  3MJW A;  2L00 B;  3Q3J A;  5AZH A;  3T9L A;  4GN1 A;  4TKN A;  5HE3 A;  1UH6 A;  3VUW A;  1KLV A;  2YSZ A;  2AEH A;  2K1F A;  3DXE A;  1RRB A;  3N7C A;  3CXB B;  2DYM A;  1DRO A;  2ELA A;  1WX9 A;  2CY4 A;  2DKP A;  5D3W A;  2BCJ A;  2RQ1 A;  2IBI B;  3PRZ A;  4GDK A;  1K5D B;  3TL5 A;  5JZE B;  4PNK A;  2FCS A;  5E6N A;  1JRU A;  1WM2 A;  1KM7 A;  2R2O A;  2ZVN A;  2I5C A;  2CHX A;  3PTF C;  1IP9 A;  2Y7B A;  1PLS A;  3PVL A;  2DLW A;  3QX1 A;  2D4Q A;  3T06 A;  1WIA A;  1P3R A;  3DDC B;  4PS7 A;  4BFR A;  4DHJ D;  1OGW A;  1V86 A;  2I5F A;  3DVN V;  2VRW B;  2DA0 A;  4XZ4 A;  4NJ7 A;  5DPW A;  3HM6 X;  1DYN A;  3RT3 B;  4MEM A;  1WGU A;  3EC8 A;  3L0W B;  3OAW A;  2AYO B;  4BKS A;  4EJN A;  4IM2 A;  4HAW B;  4IM3 A;  1RJ2 A;  1ACA A;  1YJ1 A;  4TQ0 A;  2RR9 A;  1ZVR A;  2Y8F A;  4GMX B;  1AQC A;  1RLF A;  4NPN A;  3HM3 A;  1ZW7 A;  4KV2 A;  4GPT B;  1SIF A;  4ASW C;  2NBU A;  2X18 A;  3FEH A;  2FAZ A;  3H1U A;  5D6J B;  3D32 A;  4JIO U;  3VTU A;  1F9J A;  3L13 A;  3AXC A;  3RCZ A;  2VRR B;  1WXS A;  4J6I A;  3BJI A;  3ZNZ B;  2CB8 A;  1S1Q B;  2JF5 A;  4RM9 A;  2WH5 A;  1U5E A;  3U7D A;  5C16 A;  3QBV B;  4CHJ A;  3PV1 A;  3RYT A;  1ZGU B;  2FCM A;  2JRH A;  3M95 A;  2RGF A;  2Z0P A;  1W1H A;  2OTX A;  2GBN A;  2RSU A;  2CY5 A;  2KWV B;  3QQ8 B;  5DHA B;  2D10 A;  1K8R B;  5D94 A;  1J0G A;  2D9Y A;  4ZDV A;  2W2W A;  2KMC A;  2YVC A;  2C5L C;  2G4D B;  4FHJ A;  2M38 A;  2XBB C;  3Q3F A;  3KRX A;  2MBQ A;  3UF8 A;  1FHX A;  4XX5 A;  1M94 A;  2CRF A;  4MY6 A;  4FJZ A;  2LVP A;  4JLC A;  4FA6 A;  3A1Q B;  2O2V A;  1WVH A;  2UVM A;  4TV3 A;  2DFK A;  1Q67 A;  4FJV B;  4KIK B;  3V5W A;  3PPA A;  1KZ7 A;  2KHW B;  3OLM D;  5JHH A;  4GDL B;  3VDZ A;  1SGH A;  1Y19 B;  3RZF A;  1WZ3 A;  3PVU A;  1KJT A;  3ZDM C;  1WXV A;  4Z2N A;  2BGF A;  4KZC A;  2ROZ B;  2K8C A;  2LKO A;  3VUX A;  2O6V D;  2IFS A;  5DPS A;  4EZL A;  3IFW B;  3CSF A;  3ZKJ C;  4AJY B;  1E8Z A;  3PGE A;  2JP2 A;  4W9K A;  2DZI A;  5DH9 B;  3B0A A;  3DCG A;  4G11 A;  2Y8G A;  2JXX A;  2KC1 A;  3SD5 A;  1U27 A;  2RNR B;  1OMW A;  1Z87 A;  4KHA A;  1OQY A;  2L8J A;  1NTI A;  2MP2 B;  2K39 A;  3MHS D;  4KSK C;  1P6S A;  2M1M A;  1GNU A;  2Y5B B;  3B08 A;  3FP5 A;  3B1L X;  2LOZ A;  4KIK A;  5FR6 A;  4F7H A;  3VQI A;  3EEC A;  2PEA A;  1WFY A;  1BT0 A;  2FNJ B;  3NHE B;  4OVV A;  4AWJ A;  4NY0 A;  5HE1 A;  2C9W B;  4HK2 A;  2DHJ A;  3VHT C;  3NZU A;  4PS8 A;  3ZW3 A;  2RUK B;  4FLH A;  1DDW A;  3JW0 X;  1OEY A;  4LCD E;  3WAM A;  4B6H A;  1WJ6 A;  3JSV A;  5E6O A;  2L1C A;  2DEN B;  2M8S A;  3A4S C;  4WJO A;  1GUA B;  2G4S A;  2IYB A;  4HAT B;  3W1Y A;  1W1G A;  2XK5 B;  3SUZ A;  5LOP B;  2CHZ A;  3VOQ A;  1Z5S B;  5KQ4 A;  3CIK A;  4DXA B;  1X1F A;  4FAD A;  1BTK A;  3JSV B;  1HB8 A;  1BWN A;  2K2U A;  1U29 A;  4HAX B;  3X0W A;  4E3C A;  5IJM A;  4GOC A;  3VVW B;  4II3 B;  2ABD A;  5L95 C;  4MGZ E;  3QAR A;  1LW3 A;  1H8C A;  4DWF A;  1C1Y B;  4WWO A;  2UWQ A;  4IG7 B;  1EF5 A;  1HE8 A;  3EFU A;  2N9X A;  4C0A A;  2QKM A;  4FUL A;  4ICU A;  1WZ0 A;  2NPT B;  4KDI C;  4DDI D;  3PZD A;  2PJH A;  3V6E B;  3TW1 A;  2BKR B;  3SYX A;  4A3P A;  5DI9 B;  4WVF B;  4A6F A;  1WGG A;  4YL8 A;  2MCN B;  1ISN A;  2OJR A;  2LAS A;  2EKE C;  3QC8 B;  2K25 A;  4BBN F;  1TXD A;  1U5G A;  4W9F A;  5CHF A;  4DHJ B;  1P5T A;  2PE6 B;  2VSZ A;  3CF6 E;  4I6L B;  4NQK E;  4FHK A;  2COD A;  3KZ1 A;  2KLC A;  2CQU A;  3FSS A;  2ZCB A;  2WDT B;  4ZRI A;  2GCL A;  1UZX B;  3O65 B;  4GDL A;  4MGI E;  4CYE A;  1WH3 A;  4GGQ A;  4WJN A;  2DHK A;  3EPY A;  1V9J A;  2MA9 B;  2YT1 A;  4KVG B;  3UQB A;  2YS5 A;  2FCQ A;  1MK9 B;  2COP A;  3DBL I;  2M4N A;  4HPL B;  3A1Q A;  3A98 B;  2D2Q A;  3A8P A;  5JHB A;  4MEL A;  3GOE A;  3ULC A;  2GBM A;  3SO6 A;  4TYZ A;  3A8Q A;  3ULB A;  4GDK B;  4W9H A;  2YS3 A;  3L54 A;  2HJ8 A;  2LVO A;  3QCA A;  2LXC A;  1L7Y A;  1FHO A;  1T0Y A;  2DX1 A;  4W9C A;  4GXB A;  4DDG D;  3HK0 A;  3FLV A;  1P1A A;  3PG7 A;  2P8V A;  3KH0 A;  2Q13 A;  5J3Y A;  4IFS A;  1E8W A;  2YT0 A;  3PT2 B;  4M8N A;  3RD2 A;  2A5U A;  3ZNI D;  2Z0E B;  4HCN B;  4Z2M B;  4W9L A;  2CAY A;  2KZR A;  3VIA A;  2P0H A;  2KOX A;  1J8C A;  3QWM A;  2IO3 B;  3ENE A;  3ZTD A;  5L81 A;  3K9P B;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  1FHW A;  1WJ1 A;  3ML4 A;  4IUM B;  2D9W A;  1V61 A;  1EO6 A;  1Y5O A;  2GCJ A;  3SU8 X;  2IY1 B;  2D9Z A;  1I42 A;  3VAW A;  4HB2 B;  5CHV C;  5D3X A;  4HHV A;  2MFQ A;  2N1V A;  3PLV A;  3V61 A;  2LG1 A;  2L2I A;  2DTC A;  4FJY A;  2K2J A;  1PFJ A;  4EEW A;  4HAZ B;  4GSW A;  3ECI A;  4HDQ A;  1WJN A;  3DBR I;  2V1Y A;  2AL6 A;  4A5K A;  2L7R A;  2XK5 A;  2COF A;  1UBQ A;  2BYV E;  3DOW A;  1K5G B;  1NTV A;  2Z0D B;  3GZN I;  5J17 A;  1HB6 A;  1E7V A;  3PRE A;  2L76 A;  4D0N B;  4H8S A;  2WWZ A;  1YD8 U;  3PLU A;  2J59 M;  3ZVV A;  2EMS A;  5C5B A;  2ZJD A;  3OAN A;  1X86 A;  4WWN A;  4A3O A;  1WGY A;  2BWE S;  1V5U A;  1W1D A;  4PYU A;  4MSQ B;  4B95 A;  1ST7 A;  1MPH A;  5CLL B;  3UGB B;  1UNQ A;  3NSU A;  1R4N I;  2K8H A;  3K9O B;  4AP4 C;  3ODX A;  2PPH A;  1ZKH A;  2REX A;  1M7E A;  5EFX A;  4BKS D;  2KTF A;  4BVU C;  2N9P C;  2K00 A;  5D3V A;  3A4R A;  4CHK A;  2YRY A;  2Z0Q A;  1X1M A;  4LJP B;  3DVG Y;  1WGD A;  1KZG A;  2YF0 A;  4WJQ A;  2JRI B;  3GYP A;  1WY8 A;  3RUI B;  4ANV A;  1R4M I;  2ZVO A;  4DK5 A;  2HTH B;  1I7A A;  1WF9 A;  3A9J A;  3EHV A;  1NU2 A;  2L0T A;  2ADZ A;  5DCN A;  3UIO B;  2D9X A;  2L0F A;  2HRJ A;  4NSW A;  4DX8 A;  1CMX B;  4PS3 A;  5AZG A;  2JWZ A;  4HB4 B;  2N4F A;  1J0W A;  3M1I B;  1UNR A;  2O2V B;  5DPR A;  4WJ7 A;  2MWS B;  5G55 A;  3ODO A;  1IRS A;  3KYD D;  4X57 B;  1YX6 B;  4IOY X;  1WGR A;  1V49 A;  3DQV A;  4KDL B;  4HB3 B;  3DXC A;  1LM8 B;  2H7E A;  3TVV A;  2ZPN A;  3HW2 B;  2KMA A;  1Q1O A;  2BYF A;  2NCN A;  4W9G A;  5CTR C;  4GB9 A;  2HE7 A;  3ZUN A;  4DBG A;  3R7R A;  1WX8 A;  1RFA A;  4ANW A;  3HIZ A;  3UIN B;  3D8D A;  5C1Z A;  3V60 A;  3QJZ A;  1BAK A;  3NS8 A;  1V5O A;  2KJ6 A;  3WAO A;  4GZU A;  3ZO5 B;  4B6W A;  4ZYN A;  2DYN A;  2DYQ A;  2EJ8 A;  3A9K A;  1AWE A;  1VD2 A;  2UYZ B;  2Z59 B;  4GIV A;  4MGY E;  2DKQ A;  2JUO A;  4EUT A;  1TQZ A;  1S3S G;  3IG3 A;  1TTN A;  3H7P A;  2B3A A;  3TBL D;  5D2M B;  5HE0 A;  4RMA A;  4WQO B;  2WX0 A;  2NZ8 B;  2IO2 B;  3QIJ A;  2R0D A;  2FCN A;  3KW5 B;  2N0Y A;  4EOY A;  5J3T A;  4BBN C;  1H4R A;  1P3Q U;  1V5T A;  3OJ4 B;  2KDB A;  4IM0 A;  3IBE A;  3IHP C;  2L05 A;  4DX9 0;  1WM3 A;  4JQW C;  4MM3 A;  2DX5 B;  1GC7 A;  3HQC A;  3DVN U;  2LWP A;  3WAN A;  5JHG A;  4PQ0 A;  3LJ3 A;  3L16 A;  2BPS A;  3L08 A;  4BBK A;  2N1W A;  4HXD A;  4IW0 A;  2FUH B;  4K7W A;  1X05 A;  4NAW B;  1KI1 B;  1PMS A;  3TIX A;  4AOF A;  2RGN B;  4I6P A;  3L17 A;  3V62 A;  3SNH A;  1X1G A;  4KSL C;  2N23 A;  1MIZ B;  3HHM A;  4N9F 4;  3S2A A;  3ZIM A;  2KFK A;  3G9W A;  2GBK A;  2J0K A;  4HCP B;  2NBW B;  2LRU A;  2CS4 A;  2KC2 A;  3SDL C;  2G35 A;  3WAP A;  5J2R A;  1EVH A;  2H7D A;  1YX5 B;  1IPG A;  2EMT A;  1WXM A;  2WYQ A;  4LJO B;  2AL3 A;  1A5R A;  1U5F A;  1UEF A;  3I3T B;  4OVU A;  2L3Z A;  2LGD A;  1Q0W B;  1V89 A;  3VH4 B;  3PEG A;  2K8B A;  4IAP A;  3UZT A;  1NTY A;  4G50 A;  2YS1 A;  1Z2M A;  1V2Y A;  2ZPY A;  3VTW A;  2DYB A;  4KZ0 A;  2EC1 A;  3O96 A;  1ZC3 B;  2GJY A;  2C7H A;  2M17 A;  3U30 A;  2KJR A; 
#chains in the Genus database with same CATH topology
 3HSA A;  5D3D A;  4MSM B;  2V3S A;  1LXD A;  2LJ5 A;  4W9E A;  2KUP A;  2KGX B;  2DZJ A;  3ML8 A;  3Q8A A;  1V81 A;  2QSD A;  4XWT A;  1QLB B;  3PHW B;  3DBS A;  3NZ3 A;  2AWT A;  3PO0 A;  2RSG A;  2LUE A;  4JKC A;  4MH0 E;  3B77 A;  5JHA A;  4KKJ A;  2JVC A;  4OHJ A;  4EZK A;  1V5M A;  4KAX B;  3V6C B;  2JY6 A;  3MC8 A;  2KN5 A;  1ET6 A;  1C76 A;  1UBI A;  1VZ7 A;  5I2M A;  2IO1 B;  1MKE A;  1VCB A;  4G0N B;  1UPQ A;  1OEY J;  3KYC D;  4OZA A;  1SF0 A;  4EZJ A;  5H8Y E;  1HBK A;  4HB0 B;  1YN5 A;  2KFJ A;  2GMI C;  2M0X A;  1WGQ A;  1T0Q C;  2WXF A;  4ANX A;  5CX3 A;  1XF5 L;  3SR6 A;  3QWZ B;  3KUC B;  4BOZ B;  3AEE B;  3PRP B;  2PLP A;  2IZV B;  2LGY A;  3WYF B;  4MAC A;  4JKE A;  2NS5 A;  1MG8 A;  4EMO A;  2MBH A;  5LXH A;  3I5J C;  2KYW A;  1JQ4 A;  4URK A;  1YJI A;  1ET9 A;  5G2N A;  2N7D A;  3GYO A;  4JWU C;  2PIA A;  4NAW A;  3TEZ A;  2J0J A;  1XLO A;  1GJZ A;  4C56 C;  1I2H A;  2V76 A;  1N3H A;  4KX6 B;  1XT9 B;  1OY2 A;  3KWL A;  1HA5 A;  2CU1 A;  4MGK E;  1X11 A;  2KVR A;  4HWI B;  1NVL A;  5FI1 A;  4F1S A;  1FB8 A;  2BYE A;  3TFM A;  4FN2 A;  2W2X D;  4C4V B;  4L6E A;  3AUL A;  3F5R A;  5BYQ A;  5DPT A;  4IWO A;  5FKA C;  2MSE D;  1E8Y A;  4HPM B;  4WUR A;  3P6A A;  2RD0 A;  2ZEQ A;  4IC7 B;  3W9C B;  1KLU D;  1XR0 B;  1TS2 A;  3UI3 A;  2N9E B;  2KO3 A;  2CKH B;  2KFK B;  3M3J A;  4A6H A;  2COC A;  2RDH A;  2JU6 X;  2G9H D;  4NQL B;  1LQB A;  2ZCC A;  1WSP A;  2RVB B;  2NR2 A;  3P7Z A;  2DWQ A;  3D8F A;  1IUE A;  2YT2 A;  3APF A;  1F1H A;  2MJD A;  3SFE B;  3W1S C;  2DLB A;  2C60 A;  2KWU B;  2BWF A;  2MDX A;  1ZYI A;  3NRZ A;  4N58 A;  3VXW A;  4MK0 A;  2DNF A;  2QIE B;  2NPT A;  4KHB A;  5JVL A;  1E5W A;  2GUM A;  1C77 A;  3KQ4 A;  4F8C B;  2I1J A;  2XN9 C;  3UQA A;  4XC2 A;  3ZNG C;  4M0W B;  1DGJ A;  2IGG A;  2BT6 A;  3P2B A;  3KVF B;  2W9N A;  2H88 B;  2W2X C;  2GOW A;  1EU3 A;  2PE9 A;  2LI5 A;  3JYU A;  3WAL A;  2KCJ A;  1RRP B;  2KAN A;  3QAQ A;  1CZP A;  1V97 A;  2R82 A;  1IBX B;  5D7G A;  1DBH A;  2ZZP B;  3H7S A;  1ROE A;  2MX2 A;  2MP2 A;  4RGN A;  2XQN M;  4P1B C;  2Z13 A;  1TBE A;  2D3G A;  1C3T A;  1UUP A;  2L1A A;  4F7U P;  2L00 B;  2WLB A;  4GN1 A;  3N1X C;  2AEH A;  3N7C A;  1DRO A;  3AE8 B;  3PRZ A;  2BCJ A;  4PNK A;  2FCS A;  4MH8 A;  3PTF C;  3PVL A;  3QX1 A;  3T06 A;  3DDC B;  1P3R A;  4MM3 B;  2I5F A;  4XZ4 A;  4ILJ A;  1DYN A;  1WGU A;  3OAW A;  2RDB C;  4IM2 A;  4IM3 A;  4TQ0 A;  1N60 A;  1ZW7 A;  1L0V B;  4GPT B;  2BYT A;  5IOI A;  3FEH A;  3RMK C;  3D32 A;  2VRR B;  3RNA C;  1K53 A;  3QBV B;  4CHJ A;  3HUI A;  1ZGU B;  2FCM A;  2JRH A;  2OTX A;  1P7F A;  3AE7 B;  1FRD A;  2D10 A;  4ZDV A;  2YVC A;  2C5L C;  1PDX A;  2M38 A;  2XBB C;  4JLC A;  3A1Q B;  1WVH A;  3E9S A;  4YSY B;  1Q67 A;  2MEK A;  3BYY B;  1J7C A;  5H92 C;  4GDL B;  3AN1 A;  3VDZ A;  1SGH A;  1Y19 B;  3RZF A;  1WZ3 A;  1SEB D;  1KJT A;  4P6V F;  1OQQ A;  4Z2N A;  1XO3 A;  2N0S B;  2LKO A;  2BS4 B;  4AJY B;  3PGE A;  2JP2 A;  4W9K A;  1VZ8 A;  4KHA A;  3QK0 A;  3B1L X;  2QIL A;  4F7H A;  1WFY A;  4OVV A;  4HK2 A;  4PS8 A;  4XDD A;  2RUK B;  4A55 A;  2W55 A;  1WJ6 A;  4WJO A;  2IYB A;  1TYG B;  5KQ4 A;  3CIK A;  3L4P A;  4FAD A;  1MI1 A;  2K2U A;  1F52 A;  3VVW B;  3P42 A;  1EWC A;  1Q10 A;  1M4V A;  5AZG A;  4C0A A;  2QKM A;  2OJW A;  2BKR B;  3SYX A;  4A3P A;  3ETR A;  3QC8 B;  3I57 A;  4BBN F;  3IAS 1;  1P7E A;  1ENF A;  4I6L B;  3SBG A;  4NQK E;  2COD A;  3KZ1 A;  2KLC A;  3FSS A;  2WDT B;  2GCL A;  3EUB 2;  2DHK A;  2MA9 B;  1MK9 B;  5JHB A;  1C9F A;  2GBM A;  2JX5 A;  3SO6 A;  4NZL B;  2HJ1 A;  2HJ8 A;  1PFD A;  2LVO A;  2LXC A;  2ZKM X;  3HK0 A;  4DDG D;  3NUH B;  3PG7 A;  1FNW A;  1E8W A;  1YQ3 B;  3ZNI D;  2Z0E B;  1N5X A;  4Z2M B;  4W9L A;  3VIA A;  3QWM A;  2IO3 B;  5L81 A;  4GOU A;  1EO6 A;  2RPV A;  1I42 A;  3Q8F A;  2WXG A;  4HHV A;  2WXI A;  4WH4 A;  2MFQ A;  4QJ5 B;  3PLV A;  2PW9 A;  4FJY A;  4EEW A;  1FXA A;  2JQR B;  3DBR I;  1UBQ A;  4HEA 1;  1HB6 A;  4H8S A;  4YSZ B;  2J59 M;  3R2I A;  5C5B A;  1X86 A;  4YTM B;  3RNB C;  2BS3 B;  1W1D A;  1ST7 A;  3LYY A;  1E10 A;  2AQ1 B;  2K8H A;  1C78 A;  2K5P A;  2N9P C;  1D5M C;  3GZN B;  1UGJ A;  2Z0Q A;  1X1M A;  1WGD A;  2JRI B;  4ZOH C;  3RUI B;  2ZVO A;  2JSV X;  4A90 A;  4DK5 A;  1JRO A;  3EHV A;  2RDG A;  1K51 A;  4OT1 A;  2D9X A;  4LNN A;  4HB4 B;  4PK1 A;  3ODO A;  1IRS A;  3AE9 B;  1QT9 A;  1LM8 B;  2NCN A;  3ZQ4 A;  3R7R A;  2M19 A;  3UIN B;  3D8D A;  2W82 A;  3Q6B A;  3QJZ A;  3NS8 A;  2KJ6 A;  3ZO5 B;  4M0W A;  3E9O A;  3E9P A;  2EJ8 A;  3A9K A;  1SE2 A;  2MJE A;  2Z59 B;  4GIV A;  2DKQ A;  3EA6 A;  1KRH A;  5D2M B;  4RMA A;  4WQO B;  2X38 A;  3Q2A C;  2K8E A;  2NZ8 B;  1UF0 A;  4EOY A;  1H4R A;  1P3Q U;  3OJ4 B;  3IBE A;  1STE A;  3IHP C;  1MHX A;  1SXT A;  1WM3 A;  1FO4 A;  1GC7 A;  1VR9 A;  3WAN A;  4PQ0 A;  1ZOY B;  1VLB A;  1HXY D;  2V9H A;  4BBK A;  1KI1 B;  3BVG A;  4KSL C;  1X1G A;  1NI3 A;  4HCP B;  1WRI A;  2J0K A;  2X0S A;  2LRU A;  2G35 A;  2H7D A;  1IPG A;  2DIK A;  2WXM A;  5AUK A;  5IRS A;  1A5R A;  1U5F A;  4HKQ A;  1TY2 A;  2D3B A;  1V89 A;  1XLQ A;  1NTY A;  2YS1 A;  1YNT E;  3IAM 1;  4KZ0 A;  2PVG C;  3O96 A;  3KLS X;  5LXI B;  5I2S A;  3CST A;  4MDK E;  2N9K A;  2DZM A;  1T77 A;  1RAX A;  2C7N B;  5IO9 A;  2Z14 A;  3DVG X;  2NVU I;  4XE0 A;  3BWU D;  4K2P A;  3GE8 C;  1V88 A;  2KTR B;  2ASQ A;  1UD7 A;  4LDT B;  5IN7 A;  4H2A A;  1XCQ L;  3N30 A;  1HTQ A;  1XCG A;  2EKI A;  1GB4 A;  4EE2 A;  2EEL A;  1J7A A;  5EE1 A;  1TS3 A;  4HLE A;  1T0R C;  3RNE C;  1FRR A;  2DBY A;  2OQB A;  3AMZ A;  2KJH B;  1QF6 A;  1EGX A;  4CHM A;  5AEK B;  1OTR B;  1GPX A;  2W3R A;  2BB6 A;  2KIG A;  3ALB A;  4LDT D;  2RPQ A;  4N59 A;  4JK7 A;  1NBF C;  2VZK D;  3M63 B;  5GXG B;  1DDM A;  1KOT A;  3UIP B;  3PP2 A;  3CMM B;  4HAU B;  1H10 A;  1WG7 A;  1JRP A;  5KHQ A;  3KY9 A;  3N3K B;  3LJU X;  1J19 A;  2INC C;  3TO1 A;  3DBL B;  2LRW A;  1L2N A;  1NYQ A;  1V5P A;  1QKZ A;  4ARC A;  1TS5 A;  2QHO A;  5G5G A;  4ANU A;  2N7E A;  2ICI A;  4IWP A;  3AU5 A;  5AUI A;  4E71 A;  4AJW A;  1ZM0 A;  1MIX A;  4AUQ C;  2FBW B;  4ICV A;  5C2T B;  1YMH E;  2FJ9 A;  1E9M A;  4JL9 A;  2J42 A;  2E3T A;  1AYF A;  1G6J A;  1JWA D;  4HJG E;  2WXR A;  1N6Z A;  4BKG A;  5BO4 B;  3C0R B;  2GB1 A;  1I35 A;  1WMH B;  1KC7 A;  1SB3 C;  2BVC A;  2J7Q B;  2KNB A;  1ZSQ A;  5CLQ B;  3FKY A;  2D3A A;  5C6R A;  3SBT A;  2GBR A;  2R2Q A;  4ZRJ A;  4YXD B;  5LLI A;  3F0W A;  3Q3M C;  2G3Q B;  2NBV B;  1TY0 A;  1J7B A;  1P98 A;  4WQM A;  1MPE A;  2KK8 A;  3OJ3 A;  5J18 A;  3H6N A;  1FXI A;  1MAI A;  4CO7 A;  2AX5 A;  3VTV A;  1NEK B;  1EAZ A;  3FIL A;  1SSN A;  2LVQ A;  3FC4 A;  4K1R B;  4E74 A;  5IP4 D;  1V1O A;  1NI2 A;  1XQQ A;  3RZW C;  2IYD B;  1D5Z C;  3R3M A;  2KKC A;  3QA8 A;  2AQ2 B;  4YTN B;  3KUD B;  4A20 A;  1UGM A;  4TQ1 A;  4A6F B;  1GG3 A;  5LON B;  1UWM A;  4BKT A;  1QQG A;  2Z59 A;  3KUZ A;  4XDC A;  5GOW B;  1HZ5 A;  1FGZ A;  5DIF B;  4A6Q A;  3BK1 A;  2WXN A;  3NOB A;  4S0R A;  3RPF C;  1FD6 A;  1AAR A;  3ZUN A;  3ZXV A;  2WXQ A;  3IVF A;  2A4Z A;  4II2 B;  2KQ7 A;  4HAV B;  2MLB A;  4LNI A;  2D9V A;  2D5G A;  2LGX A;  2MW5 A;  3ZJU A;  1JWS D;  4RM8 A;  1WJ4 A;  1FFU A;  4A6K A;  5M4Y B;  3ZNH B;  3T9L A;  2PKO A;  2KUQ A;  2Z8L A;  3VUW A;  4US9 A;  3VRB B;  2DYM A;  1WX9 A;  2CY4 A;  1E7P B;  2DKP A;  2IBI B;  2Q5W D;  4M01 A;  3Q8B A;  5HHD G;  1KM7 A;  2I5C A;  3NVY A;  2D4Q A;  1WIA A;  2QMT A;  2KQ4 X;  2VRW B;  4NJ7 A;  3RT3 B;  4MEM A;  3EC8 A;  3L0W B;  2PMV A;  4BKS A;  4HAW B;  3NVV A;  1YJ1 A;  1ZVR A;  4GMX B;  1AQC A;  2QCZ A;  3HM3 A;  2FAZ A;  5D6J B;  4JIO U;  3L13 A;  2MHJ A;  3AXC A;  3RCZ A;  3DWM A;  1WXS A;  3BJI A;  2CB8 A;  2JF5 A;  2UU7 A;  3RNF C;  5C16 A;  1DOX A;  2RGF A;  1W1H A;  1YJJ A;  1YQ4 B;  2RSU A;  2ACZ B;  5DHA B;  1K8R B;  4A9A A;  3HIE A;  1KH0 A;  4FHJ A;  2G4D B;  4QJ4 B;  3E66 A;  1VDV A;  3KRX A;  1M94 A;  4FJZ A;  4FA6 A;  2O2V A;  3B9J A;  2UVM A;  3DCX A;  4TV3 A;  5E6J A;  2KHW B;  3E9L A;  2KR0 A;  2FUG 1;  3VUX A;  2IFS A;  5DPS A;  3ZKJ C;  4XGA B;  2DZI A;  3DCG A;  2Y8G A;  2JXX A;  1TS4 A;  1U27 A;  3HRD D;  2L8J A;  1XXG A;  5TSS A;  1NTI A;  5HKH A;  2K39 A;  1P6S A;  2M1M A;  3N1Y C;  4KIK A;  2LOZ A;  1BT0 A;  1PGA A;  5HE1 A;  1NEN B;  3NZU A;  3ZW3 A;  4FLH A;  1DDW A;  3JW0 X;  1OEY A;  3WAM A;  1JWU D;  1FCC C;  2DEN B;  2M8S A;  1GUA B;  4HAT B;  2XK5 B;  3SUZ A;  2OED A;  3VOQ A;  1Z5S B;  4ZHO A;  1ZDX A;  1BWN A;  4HAX B;  1U29 A;  3X0W A;  2CJN A;  2FE8 A;  4GOC A;  2ABD A;  5L95 C;  1K50 A;  1LW3 A;  1JML A;  1H8C A;  4WWO A;  3EFU A;  1HE8 A;  4RGM A;  2N9X A;  3VTU A;  2NPT B;  3V6E B;  2GRI A;  4WVF B;  4L23 A;  4A6F A;  2OJR A;  2EKE C;  2K25 A;  1TXD A;  1U5G A;  3P63 A;  4W9F A;  3ZYY X;  5CHF A;  1P5T A;  3CF6 E;  4HPP A;  4N6E B;  2CQU A;  1ZPS A;  2ZCB A;  3O65 B;  4GDL A;  4MGI E;  3N20 C;  2WXP A;  4GGQ A;  2JYT A;  2FCQ A;  4HPL B;  3A1Q A;  2YEP B;  2CJO A;  3FIL B;  1JDE A;  3GOE A;  4TYZ A;  3ULB A;  1FHO A;  2V4I B;  1T0Y A;  5HI1 A;  2J4X A;  4GXB A;  3J9C A;  1P1A A;  3KH0 A;  2L83 A;  3RD2 A;  2A5U A;  2LFI A;  2IDY A;  1J8C A;  3K9P B;  1WJ1 A;  4RFB A;  3W5V B;  3OWE B;  2D9Z A;  2HTM E;  2N1V A;  3V61 A;  2LG1 A;  2RRF A;  2DTC A;  4LNO A;  4C4V A;  4HAZ B;  4RNA A;  1FMA D;  4GSW A;  2V1Y A;  2AL6 A;  4A5K A;  2XK5 A;  2BYV E;  3EFC A;  1NTV A;  1OFF A;  5J17 A;  1E7V A;  2VH1 A;  3IT6 B;  2ZJD A;  1GOZ A;  3OAN A;  1VRA B;  1WGY A;  2BWE S;  4MSQ B;  5CLL B;  1R4N I;  3ODX A;  2PPH A;  1ZKH A;  1SE4 A;  1M7E A;  5EFX A;  4RH6 A;  1E0Z A;  2K00 A;  4JKG A;  3PZ8 A;  2YRY A;  3DVG Y;  2YF0 A;  1WF9 A;  1I7A A;  3A9J A;  2WDQ B;  4JK9 A;  5DCN A;  3UIO B;  4NSW A;  3MC0 B;  4DQO C;  2N4F A;  1UNR A;  2O2V B;  3NG0 A;  3EGR A;  3KYD D;  1YX6 B;  3DQV A;  3P4S B;  1VBH A;  1V49 A;  1DOY A;  4K7W A;  3DXC A;  2H7E A;  5FK9 C;  1C79 A;  5LNK 1;  3DBH B;  1PYW D;  1ACC A;  1RFA A;  2NBV A;  2M56 B;  4YSX B;  5C1Z A;  1BAK A;  2X8X X;  1V5O A;  4RF1 A;  3WAO A;  4GZU A;  2Y5P A;  3P4R B;  4MGY E;  2JUO A;  1TQZ A;  1TTN A;  1DYQ A;  3DWG C;  3TBL D;  5HE0 A;  1A70 A;  2WX0 A;  2IO2 B;  2FCN A;  3C8Y A;  2N0Y A;  5J3T A;  4UDU C;  2KDB A;  2L05 A;  4O1N A;  3BK2 A;  4DX9 0;  3A58 A;  2KVZ A;  1TKE A;  3L08 A;  2N1W A;  1X05 A;  2RGN B;  3Q14 C;  3S2A A;  3ZIM A;  2KFK A;  3G9W A;  2NBW B;  2KC2 A;  3SDL C;  5J2R A;  1EVH A;  1WXM A;  1UNS A;  1UEF A;  1F77 A;  2L3Z A;  2LGD A;  4IAP A;  1VJK A;  4D2K A;  2ZPY A;  1TJE A;  2D3C A;  2EC1 A;  1K52 A;  1T3Q A;  2GJY A;  2C7H A;  4HRO A;  4BKS D;  3U30 A;  4MJS A;  4US8 A;  1B55 A;  1E8X A;  3NWF A;  5FI0 A;  2HD5 B;  3TCA A;  1ZXH A;  5L83 A;  3MPX A;  5HE2 A;  1XD3 B;  1WJM A;  1MJD A;  2UZS A;  1RM6 C;  1FGY A;  2IO0 B;  5BMI A;  2KD0 A;  4TUU A;  4KHB B;  4R3D A;  1TKY A;  3CWI A;  3M62 B;  1SHC A;  4EFO A;  2I38 A;  4GLS C;  3VUY A;  2J53 A;  3T8M A;  1F0Z A;  3AEF B;  2DHI A;  2O6V B;  1NDD A;  4HDO A;  3ODW A;  4WSF A;  4ARI A;  3A9K B;  4LLG M;  3TJP A;  1LO5 D;  3WCQ A;  4B0E A;  4DIX A;  2KTR A;  2MKR A;  1XOD A;  1L4Z B;  1YN4 A;  2K22 A;  3P4P B;  2NMQ A;  2KX3 A;  5JH5 C;  2I1K A;  4GMV A;  2ZNV C;  3NJT A;  3PHX B;  1U5D A;  1DOI A;  5E6P A;  4MJS B;  5HG2 A;  4L2Y A;  3E56 A;  2R09 A;  2FJL A;  1OQN A;  3ABV B;  2OOB B;  4K3B A;  3FM8 C;  1QIL A;  4IWQ A;  3ZRF A;  1WGK A;  3SV1 A;  1FPY A;  1P9D U;  1WMH A;  2K6Q A;  1V80 A;  1UWX A;  4ZRQ A;  1WI0 A;  2VH2 A;  1FXT B;  3AB5 A;  1QQR A;  4WWP A;  3BY4 B;  3RNG C;  3AE3 B;  2IND C;  4WJP A;  2LMC A;  1BTN A;  3R66 C;  2MQJ A;  4REZ A;  4JPS A;  1JAL A;  1VBG A;  2D07 B;  2JZZ A;  2KQS A;  1SIJ A;  4P1C C;  1QZE A;  1SE3 A;  5IA7 A;  3NWD A;  4C80 A;  4DHZ E;  3PVW A;  1QC6 A;  3Q8C A;  2NMB A;  1I4G A;  1TT5 B;  5KHO A;  5EDS A;  1PGX A;  1WGH A;  5D3Y A;  2FIF A;  2KLG A;  4K2O A;  3JVZ X;  5G5H A;  2WP9 B;  2MWN B;  4HAY B;  2WNM A;  3Q69 A;  2WHI A;  3DHI C;  4B9K A;  3DPD A;  1U4A A;  2M14 A;  1XEE A;  2ZW0 A;  2KAC A;  2WDV B;  4OVZ A;  1P0R A;  3RCP A;  3APD A;  3DBH I;  2KN4 A;  3A33 B;  2KDE B;  4ZRK A;  4W9D A;  5JLJ B;  3DHG C;  1XKE A;  5TR5 A;  4HJK A;  3RI7 C;  3SHQ A;  1LB1 A;  1EM7 A;  1EUV B;  1Q5W B;  2LZ6 A;  3MFG A;  3A9J B;  1V6E A;  2MBB B;  2LYD A;  2VKI A;  3VH3 B;  4DXG A;  4F7G A;  3HVD A;  1R4M B;  1DIK A;  1WR6 E;  3RUL A;  1LFD A;  4Q2J A;  4D6W A;  3GE3 C;  1SE9 A;  1WE6 A;  5D27 A;  5AZF A;  1V1P A;  2DAJ A;  2C7M B;  1XX0 A;  3WA0 A;  1L0Y B;  1MG4 A;  2BKF A;  5C5B B;  1Y8R C;  2VZK B;  2K6D B;  2OHF A;  1B1Z A;  4K17 A;  3ZRC A;  2INP E;  2ZNV B;  2Z4D A;  2P0D A;  3GB1 A;  1MI0 A;  2IY0 B;  2MH7 A;  1YIW A;  1WR1 A;  3ML9 A;  3TMP B;  1EF1 A;  1FIQ A;  1XD4 A;  5JP4 A;  1WJU A;  3NY5 A;  3KSY A;  4IKG A;  3AJ4 A;  1MK7 B;  2D11 A;  4K81 A;  4M8M A;  2FDQ A;  1F2R C;  5KCV A;  5J3Q A;  1PQS A;  2YLM A;  3PSE B;  2DZK A;  1IYF A;  2HTH A;  3TEW A;  2MRP A;  2M0A A;  3Q3J A;  5D3I B;  4TKN A;  5HE3 A;  1MHH E;  1UH6 A;  2WXH A;  3U52 E;  4CQN A;  2YSZ A;  1RRB A;  3CXB B;  4JKD A;  5D3W A;  3TL5 A;  2RQ1 A;  4JKF A;  1K5D B;  5E6N A;  1JRU A;  1WM2 A;  2ZVN A;  1C4P A;  2DLW A;  4DHJ D;  4PS7 A;  4BFR A;  1OGW A;  1V86 A;  2DA0 A;  5DPW A;  3HM6 X;  4ZYS A;  2AYO B;  4EJN A;  1RJ2 A;  2RR9 A;  2Y8F A;  2LUM A;  4NPN A;  4KV2 A;  3U7Z A;  1SIF A;  4ASW C;  2NBU A;  2X18 A;  3H1U A;  1WWT A;  4J6I A;  4RM9 A;  4LNK A;  3PV1 A;  3RYT A;  3M95 A;  2MJ3 A;  2W2W A;  2BBC A;  3N1Z C;  1T5X D;  2MBQ A;  2INN E;  1FHX A;  2CRF A;  4MY6 A;  2N9L A;  1ZXI A;  1TIF A;  2WU2 B;  2DFK A;  4KIK B;  1NYR A;  3ENB A;  3FVC A;  3PVU A;  5BMH A;  2ROZ B;  2K8C A;  4EZL A;  1RWS A;  3CSF A;  3AEC B;  1E8Z A;  5DH9 B;  3B0A A;  3MP9 A;  2R61 A;  4G11 A;  3SD5 A;  2KC1 A;  2RNR B;  3MHS D;  5FR6 A;  1OQY A;  2MP2 B;  2Y5B B;  3VQI A;  3EEC A;  3Q3O C;  2W3S A;  2FNJ B;  2BW2 A;  4NY0 A;  2QEJ C;  3VHT C;  2R2Y A;  1FNU A;  4C00 A;  3JSV A;  5E6O A;  4ZHP A;  2L1C A;  3A4S C;  3W1Y A;  1W1G A;  5LOP B;  3OHM B;  1X1F A;  3JSV B;  2H89 B;  2QDF A;  3AE5 B;  5EE0 A;  3T3O A;  1C4A A;  4II3 B;  3ZGZ A;  1I4Q A;  1C1Y B;  2N7J A;  2UWQ A;  4IG7 B;  4FUL A;  3VR8 B;  2PJH A;  3TW1 A;  5DI9 B;  4YL8 A;  4LNF A;  1ISN A;  4DHJ B;  2PE6 B;  2VSZ A;  3TEX A;  2B76 B;  4JWS C;  2K9X A;  3P1M A;  1I4H A;  4WJN A;  5BMG A;  4CYE A;  1V9J A;  2YEP F;  4USA A;  2COP A;  2D2Q A;  3A8P A;  4MEL A;  3ULC A;  3A8Q A;  1RFK A;  2YS3 A;  1CQV A;  3L54 A;  3QCA A;  1L7Y A;  4RCO A;  2LEK A;  1L4D B;  3FLV A;  4JKA A;  2P8V A;  5J3Y A;  4IFS A;  4TSS A;  2YT0 A;  3PT2 B;  2QC8 A;  1D6E C;  2CAY A;  2KOX A;  2P0H A;  3ENE A;  3ZTD A;  1FHW A;  3SEB A;  1HQR D;  3OG5 A;  1Y5O A;  4JE3 B;  2IY1 B;  4S17 A;  3V05 A;  4HB2 B;  5D3X A;  1VZ6 A;  1FM0 D;  2IGH A;  2L7R A;  2COF A;  2FJU B;  1K5G B;  2Z0D B;  3GZN I;  2G1E A;  4D0N B;  3PLU A;  2WWZ A;  3ZVV A;  2EMS A;  1Y56 A;  2LHE A;  4A3O A;  3TUO A;  4XYC A;  4B95 A;  2WXJ A;  1MPH A;  3UGB B;  5FR3 A;  1N61 A;  3NSU A;  2SEB D;  3K9O B;  4AP4 C;  4FXC A;  2REX A;  5MPO A;  2KTF A;  3GS2 A;  3A4R A;  4CHK A;  4LJP B;  1KZG A;  3GYP A;  1R4M I;  4RGO S;  2L0T A;  2ADZ A;  2KWD A;  1CMX B;  2JWZ A;  3AE4 B;  1J0W A;  3M1I B;  2MWS B;  1R4N B;  4X57 B;  2JYE A;  4KDL B;  3HW2 B;  2BYF A;  2QJL A;  2V3N A;  1XCT L;  1EU4 A;  1WX8 A;  4C7Z A;  4ANW A;  1HZ6 A;  3HIZ A;  2KAJ A;  2L32 A;  4ZYN A;  2DYN A;  2DYQ A;  4ZRP A;  2W54 A;  2UYZ B;  3FAH A;  4J3O D;  3V3X A;  1QOF A;  1QOB A;  4TMA B;  1IGC A;  3KW5 B;  3QIJ A;  2NTS A;  4ILG B;  4BBN C;  1V5T A;  4MM3 A;  5JXV A;  3HQC A;  2LWP A;  5JHG A;  3LJ3 A;  3IT4 B;  3L16 A;  2BPS A;  4NAW B;  3TSS A;  1PMS A;  4AOF A;  4I6P A;  3U2S C;  2IJ0 A;  3V62 A;  1TZO A;  3LB8 C;  3IXS A;  2CS4 A;  3WAP A;  1YX5 B;  1JCK B;  3R2T A;  2EMT A;  4LJO B;  2AL3 A;  2XNA C;  3KWV A;  3I3T B;  4CSQ A;  1Q0W B;  5BYR A;  3PEG A;  3UZT A;  1L6V A;  4KGT A;  1JWM D;  1V2Y A;  3VTW A;  1KFY B;  2LGI A;  1IBX A;  1KF6 B;  4AQ7 A;  2M17 A;  2KJR A;  1EWY C;  3RN9 C;  4K3C A;  3MTN B;  2KDI A;  3ZJT A;  1M7R A;  2LOX A;  1HTO A;  4WAF A;  3PSC A;  2KX0 A;  3BII D;  1XLN A;  3ZLZ A;  3SFD B;  2AQ3 B;  2DHZ A;  1WXA A;  4W9J A;  1QOG A;  2Z0O A;  4HVB A;  2KDF B;  3LDZ E;  4NNJ B;  1E6E B;  2J0M A;  3NS1 A;  4ACF A;  2DX5 A;  2MBE A;  2I2Y A;  3MHZ A;  1UNP A;  3U12 A;  3VFK A;  1L6U A;  2JZP A;  2ELB A;  2CU3 A;  2G45 B;  2V4L A;  3R8B A;  3W1S A;  1YQB A;  4HSI A;  4YWG G;  2GLS A;  1TZ1 A;  1DDV A;  3D8E A;  4F7Z A;  1UEL A;  1LGR A;  3QHT A;  1BUI C;  3ECI A;  3AI5 A;  5DHF B;  2CR5 A;  1GGO A;  2GBJ A;  2KT7 A;  2E6X A;  1U2B A;  1KLG D;  1UPR A;  3BIN A;  1E90 A;  2J52 A;  1KBL A;  1V8C A;  2ON8 A;  3DXD A;  3ZDT A;  5KQ1 A;  3X23 A;  2DN6 A;  4MT7 A;  2HDE A;  1PGB A;  3ZTC A;  2WX1 A;  1AWD A;  1HEZ E;  4P7I A;  2QKL A;  2O6V A;  3NZS A;  2BF8 B;  1FAO A;  4DHZ B;  5C79 A;  3W2D A;  4HRS A;  3URY A;  3KRW A;  4Y94 A;  1FNV A;  1WE7 A;  1AW7 A;  3ONS A;  4ILH A;  2PZ1 A;  4L1B A;  1IGD A;  2IGD A;  3WIM A;  2GS0 A;  2RLO A;  1BML C;  3PS6 A;  2E2X A;  3LXF A;  2WU5 B;  1GAQ B;  5C23 A;  1FOE A;  2COA A;  2BB5 A;  5IAA C;  2DAF A;  1YOV B;  2LXA A;  3ZVR A;  3AM9 A;  3N32 A;  4DXF A;  2Y5C A;  1D5X C;  1TJ6 A;  4LTU A;  4YON A;  1JW9 D;  5CHW A;  3AV8 A;  3H7P B;  2WQY B;  2K0P A;  3MC9 A;  2LUL A;  2JZ3 B;  1SJH D;  1SJE D;  1MFW A;  3AU4 A;  1TGZ B;  1ZUD 2;  2JXT A;  2UZR A;  4K7S A;  2K49 A;  4NJ6 A;  3O13 A;  2JT4 B;  4RGT A;  4BOS C;  1E7U A;  3PZ7 A;  4DBB A;  3U4E G;  4JKH A;  3U8Z A;  4I6N B;  2XEW A;  4C7Y A;  4JGH B;  1GC6 A;  1WX7 A;  3H9D A;  2WGS A;  1L0X B;  4K7U A;  2FID A;  5BYS A;  2LD9 A;  4QJ3 B;  1WRD B;  1WYW B;  1NVI D;  1FFV A;  4WAA A;  4OZC A;  4AS1 A;  4YTP B;  1ZC4 B;  2DYO A;  3R7Q A;  4EKU A;  1N5W A;  2GI9 A;  1OQR A;  3RNC C;  3VR9 B;  4KHO A;  4WIP A;  4XWX A;  4JK8 A;  1T6B X;  4PT5 A;  4G3X B;  1D3Z A;  1AN8 A;  4PYZ A;  3MDB C;  4W9I A;  2BTE A;  1I7H A;  2ROV A;  2LGS A;  3L10 B;  2P0F A;  4P16 A;  3AEG B;  5GMV A;  2CHW A;  1ZP0 B;  2JPH A;  1BXT A;  3I9V 1;  4QAY A;  4FBJ B;  2MBO A;  2LBB A;  1WI1 A;  3APC A;  3MJW A;  5AZH A;  1KLV A;  4JKG B;  1WYG A;  2K1F A;  2WDR B;  3DXE A;  2ELA A;  5JZE B;  1ZDV A;  4GDK A;  1ESF A;  3ZXR A;  4OW0 A;  1TKG A;  2R2O A;  2CHX A;  1IP9 A;  2Y7B A;  3AE6 B;  1PLS A;  3DVN V;  2PTL A;  3Q3N C;  4XWW A;  4M02 A;  1ACA A;  4MT5 A;  1RLF A;  3MJ5 A;  4GNK B;  1F9J A;  1ZE3 D;  3ZNZ B;  1S1Q B;  2WS3 B;  2WH5 A;  1U5E A;  3U7D A;  2JWU A;  3C19 A;  2L52 A;  2Z0P A;  4JKB A;  2GBN A;  2CY5 A;  2KWV B;  3QQ8 B;  5D94 A;  2D9Y A;  2KMC A;  3Q3F A;  3UF8 A;  4BAX A;  4M00 A;  4XX5 A;  1QOA A;  2LVP A;  3W5U B;  1GB1 A;  4FJV B;  1RYJ A;  3V5W A;  3PPA A;  1KZ7 A;  3OLM D;  5JHH A;  1SBB B;  1PUT A;  3H8H A;  3ZDM C;  1WXV A;  2BGF A;  4KZC A;  3NW8 A;  2O6V D;  2Y3A A;  3NVZ A;  3IFW B;  2KIE A;  1OMW A;  1Z87 A;  3I63 C;  4WWM A;  5CHV C;  4KSK C;  3VRA B;  1GNU A;  4BZA A;  3B08 A;  3FP5 A;  4NAM A;  5IKC M;  2PEA A;  3NHE B;  4AWJ A;  2C9W B;  2DHJ A;  1C4C A;  4OSN A;  4LCD E;  2IPK D;  4B6H A;  3BYT B;  2SAK A;  2G4S A;  2CHZ A;  3BVM A;  5C3J B;  4DXA B;  1L5P A;  2TSS A;  1BTK A;  1HB8 A;  5T8I A;  1CJE A;  4E3C A;  5IJM A;  1V1P B;  3DBR B;  4MGZ E;  3QAR A;  2KDM A;  3NWA A;  4DWF A;  4JQW C;  1EF5 A;  4ICU A;  1WZ0 A;  4KDI C;  4DDI D;  3PZD A;  2KMM A;  1WGG A;  2MCN B;  4KGR A;  2LAS A;  3CIR B;  1D4B A;  5I4D A;  3HVZ A;  4FHK A;  4ZRI A;  4ITK A;  1UZX B;  1WH3 A;  3EPY A;  2YT1 A;  4KVG B;  3UQB A;  2YS5 A;  1F2R I;  2ZW1 A;  2M4N A;  3DBL I;  3A98 B;  2V3P A;  4GDK B;  4YT0 B;  4IDI A;  4W9H A;  2DX1 A;  5EE3 A;  4W9C A;  3B2G A;  2Q13 A;  4M8N A;  1T0S C;  3P4Q B;  1JWB D;  5LG4 B;  4HCN B;  3N9Y C;  2KZR A;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  4OZB A;  2BS2 B;  1MVK A;  3ML4 A;  4IUM B;  2D9W A;  1V61 A;  1I4P A;  2GCJ A;  3SU8 X;  3GP7 A;  3VAW A;  3AE2 B;  5HFY A;  2L2I A;  2K2J A;  1PFJ A;  4HDQ A;  1WJN A;  1I4R A;  3DOW A;  4HKZ E;  4NJC A;  3PRE A;  2L76 A;  1YD8 U;  4WWN A;  1FCL A;  1V5U A;  4PYU A;  3ZJV A;  1XLP A;  1UNQ A;  3AEB B;  1I4X A;  4KKI A;  2PVO D;  4BVU C;  2K3U A;  5D3V A;  4WJQ A;  1B9R A;  1WY8 A;  4ANV A;  2HTH B;  4IOI E;  1NU2 A;  1FEH A;  2WXO A;  4L1R A;  2L0F A;  2HRJ A;  4DX8 A;  4PS3 A;  2LJI A;  4B0M A;  5DPR A;  4WJ7 A;  5G55 A;  3B2F A;  1N63 A;  2BQQ A;  4IOY X;  1WGR A;  2WXL A;  3RFZ B;  5EE9 A;  4HB3 B;  5CTR C;  3TVV A;  2ZPN A;  2KMA A;  4W9G A;  1Q1O A;  1J0G A;  3AE1 B;  4GB9 A;  2HE7 A;  1N62 A;  4DBG A;  2RMM A;  3T3N A;  3AEA B;  3AH7 A;  4LK0 M;  3TEY A;  3V60 A;  3BZD B;  2WXK A;  4B6W A;  3DHH C;  1AWE A;  1VD2 A;  2V0G A;  4A8X C;  4EUT A;  1S3S G;  3IG3 A;  3H7P A;  2LHD A;  2B3A A;  2NTT A;  2R0D A;  1KTK A;  1R7S A;  4IM0 A;  1YN3 A;  2DX5 B;  1WXQ A;  3DVN U;  4JX1 C;  3NVW A;  4HXD A;  3TIX A;  4IW0 A;  2FUH B;  4QXA B;  3L17 A;  3SNH A;  2N23 A;  1MIZ B;  3HHM A;  4N9F 4;  3Q8E A;  2GBK A;  1CK1 A;  2ONQ A;  2WYQ A;  4KGS A;  4OVU A;  3VH4 B;  2K8B A;  3BVZ A;  4G50 A;  1Z2M A;  4RF0 A;  2DYB A;  1ZC3 B;  3AED B; 
#chains in the Genus database with same CATH homology
 4MSM B;  2V3S A;  1LXD A;  2LJ5 A;  4W9E A;  2KUP A;  2KGX B;  2DZJ A;  3ML8 A;  1V81 A;  3PHW B;  3DBS A;  2AWT A;  2RSG A;  2LUE A;  4JKC A;  4MH0 E;  5JHA A;  2JVC A;  4EZK A;  1V5M A;  4KAX B;  3V6C B;  2JY6 A;  2KN5 A;  1UBI A;  2IO1 B;  1MKE A;  1VCB A;  4G0N B;  1UPQ A;  1OEY J;  3KYC D;  4EZJ A;  1HBK A;  4HB0 B;  2KFJ A;  2M0X A;  2GMI C;  1WGQ A;  4ANX A;  5CX3 A;  3QWZ B;  3KUC B;  4BOZ B;  3PRP B;  2IZV B;  2LGY A;  3WYF B;  4JKE A;  2NS5 A;  1MG8 A;  4EMO A;  2MBH A;  5LXH A;  4URK A;  5G2N A;  2N7D A;  3GYO A;  4NAW A;  2J0J A;  1GJZ A;  1I2H A;  2V76 A;  1N3H A;  1XT9 B;  1OY2 A;  2CU1 A;  4MGK E;  1X11 A;  2KVR A;  4HWI B;  1NVL A;  5FI1 A;  4F1S A;  1FB8 A;  2BYE A;  3TFM A;  4FN2 A;  2W2X D;  4L6E A;  3AUL A;  3F5R A;  5DPT A;  4IWO A;  2MSE D;  1E8Y A;  4HPM B;  3P6A A;  2RD0 A;  2ZEQ A;  4IC7 B;  1XR0 B;  2N9E B;  2KO3 A;  2CKH B;  2KFK B;  3M3J A;  4A6H A;  2COC A;  4NQL B;  1LQB A;  2ZCC A;  2RVB B;  2NR2 A;  3P7Z A;  3D8F A;  3APF A;  3W1S C;  2C60 A;  2KWU B;  2BWF A;  2MDX A;  3VXW A;  4MK0 A;  2NPT A;  5JVL A;  1E5W A;  4F8C B;  2I1J A;  3UQA A;  4XC2 A;  3ZNG C;  4M0W B;  3P2B A;  3KVF B;  2W9N A;  2W2X C;  2GOW A;  2PE9 A;  2LI5 A;  3JYU A;  3WAL A;  2KCJ A;  1RRP B;  2KAN A;  3QAQ A;  2R82 A;  5D7G A;  1DBH A;  2ZZP B;  3H7S A;  2MX2 A;  2MP2 A;  2XQN M;  1TBE A;  1C3T A;  2D3G A;  4F7U P;  2L00 B;  4GN1 A;  2AEH A;  3N7C A;  1DRO A;  3PRZ A;  2BCJ A;  4PNK A;  2FCS A;  3PTF C;  3PVL A;  3QX1 A;  3T06 A;  3DDC B;  1P3R A;  2I5F A;  4XZ4 A;  4ILJ A;  1DYN A;  1WGU A;  3OAW A;  4IM2 A;  4IM3 A;  4TQ0 A;  1ZW7 A;  4GPT B;  3FEH A;  3D32 A;  2VRR B;  3QBV B;  4CHJ A;  1ZGU B;  2FCM A;  2JRH A;  2OTX A;  2D10 A;  4ZDV A;  2YVC A;  2C5L C;  2M38 A;  2XBB C;  4JLC A;  3A1Q B;  1WVH A;  1Q67 A;  4GDL B;  3VDZ A;  1SGH A;  1Y19 B;  3RZF A;  1WZ3 A;  1KJT A;  4Z2N A;  2LKO A;  4AJY B;  3PGE A;  2JP2 A;  4W9K A;  3QK0 A;  4KHA A;  3B1L X;  4F7H A;  1WFY A;  4OVV A;  4HK2 A;  4PS8 A;  2RUK B;  1WJ6 A;  4WJO A;  2IYB A;  5KQ4 A;  3CIK A;  4FAD A;  2K2U A;  3VVW B;  5AZG A;  4C0A A;  2QKM A;  2BKR B;  3SYX A;  4A3P A;  3QC8 B;  4BBN F;  4I6L B;  3SBG A;  4NQK E;  2COD A;  3KZ1 A;  2KLC A;  3FSS A;  2WDT B;  2GCL A;  2DHK A;  2MA9 B;  1MK9 B;  5JHB A;  2GBM A;  3SO6 A;  2HJ8 A;  2LVO A;  2LXC A;  4DDG D;  3HK0 A;  3PG7 A;  1E8W A;  3ZNI D;  2Z0E B;  4W9L A;  4Z2M B;  3VIA A;  3QWM A;  2IO3 B;  5L81 A;  1EO6 A;  1I42 A;  4HHV A;  2MFQ A;  3PLV A;  4FJY A;  4EEW A;  3DBR I;  1UBQ A;  1HB6 A;  4H8S A;  2J59 M;  5C5B A;  1X86 A;  1W1D A;  1ST7 A;  2K8H A;  2N9P C;  2Z0Q A;  1X1M A;  1WGD A;  2JRI B;  3RUI B;  2ZVO A;  4DK5 A;  3EHV A;  2D9X A;  4HB4 B;  3ODO A;  1IRS A;  1LM8 B;  2NCN A;  3R7R A;  3UIN B;  3D8D A;  3QJZ A;  3NS8 A;  2KJ6 A;  3ZO5 B;  3E9O A;  3E9P A;  2EJ8 A;  3A9K A;  2Z59 B;  4GIV A;  2DKQ A;  5D2M B;  4RMA A;  4WQO B;  2NZ8 B;  4EOY A;  1H4R A;  1P3Q U;  3OJ4 B;  3IBE A;  3IHP C;  1WM3 A;  1GC7 A;  3WAN A;  4PQ0 A;  4BBK A;  1KI1 B;  4KSL C;  1X1G A;  4HCP B;  2J0K A;  2X0S A;  2LRU A;  2G35 A;  2H7D A;  1IPG A;  2DIK A;  1A5R A;  1U5F A;  1V89 A;  1NTY A;  2YS1 A;  4KZ0 A;  3O96 A;  5LXI B;  3CST A;  4MDK E;  2DZM A;  1RAX A;  2C7N B;  3DVG X;  2NVU I;  4K2P A;  1V88 A;  2KTR B;  2ASQ A;  1UD7 A;  4LDT B;  3N30 A;  1XCG A;  4HLE A;  2OQB A;  2KJH B;  1EGX A;  4CHM A;  5AEK B;  1OTR B;  3ALB A;  4LDT D;  2RPQ A;  4JK7 A;  1NBF C;  3M63 B;  1DDM A;  1KOT A;  3UIP B;  3PP2 A;  3CMM B;  4HAU B;  1H10 A;  1WG7 A;  5KHQ A;  3KY9 A;  3N3K B;  3LJU X;  1J19 A;  3TO1 A;  2LRW A;  1L2N A;  1V5P A;  2QHO A;  4ANU A;  2N7E A;  4IWP A;  3AU5 A;  4E71 A;  4AJW A;  1ZM0 A;  1MIX A;  4AUQ C;  4ICV A;  2FJ9 A;  4JL9 A;  1G6J A;  4BKG A;  5BO4 B;  3C0R B;  1I35 A;  1WMH B;  1KC7 A;  2J7Q B;  2KNB A;  1ZSQ A;  5CLQ B;  5C6R A;  3SBT A;  2GBR A;  2R2Q A;  4ZRJ A;  5LLI A;  3F0W A;  2G3Q B;  2NBV B;  1P98 A;  2KK8 A;  3OJ3 A;  5J18 A;  3H6N A;  1MAI A;  4CO7 A;  3VTV A;  1EAZ A;  2LVQ A;  4K1R B;  4E74 A;  1NI2 A;  1XQQ A;  3RZW C;  2IYD B;  3R3M A;  2KKC A;  3QA8 A;  3KUD B;  4A20 A;  1UGM A;  4TQ1 A;  4A6F B;  1GG3 A;  5LON B;  4BKT A;  1QQG A;  3KUZ A;  5GOW B;  1FGZ A;  5DIF B;  3NOB A;  1AAR A;  3ZUN A;  3IVF A;  2A4Z A;  4II2 B;  2KQ7 A;  4HAV B;  2MLB A;  2D9V A;  2LGX A;  2MW5 A;  4RM8 A;  1WJ4 A;  4A6K A;  3ZNH B;  3T9L A;  3VUW A;  2DYM A;  1WX9 A;  2CY4 A;  2DKP A;  2IBI B;  1KM7 A;  2I5C A;  2D4Q A;  1WIA A;  2VRW B;  4NJ7 A;  3RT3 B;  4MEM A;  3EC8 A;  3L0W B;  4BKS A;  4HAW B;  1YJ1 A;  1ZVR A;  4GMX B;  1AQC A;  3HM3 A;  2FAZ A;  5D6J B;  4JIO U;  3L13 A;  3AXC A;  3RCZ A;  1WXS A;  3BJI A;  2CB8 A;  2JF5 A;  5C16 A;  2RGF A;  1W1H A;  2RSU A;  5DHA B;  1K8R B;  4FHJ A;  2G4D B;  3E66 A;  3KRX A;  1M94 A;  4FJZ A;  4FA6 A;  2O2V A;  2UVM A;  4TV3 A;  2KHW B;  3E9L A;  3VUX A;  2IFS A;  5DPS A;  3ZKJ C;  2DZI A;  3DCG A;  2Y8G A;  2JXX A;  1U27 A;  2L8J A;  5HKH A;  1NTI A;  2K39 A;  1P6S A;  2M1M A;  4KIK A;  2LOZ A;  1BT0 A;  5HE1 A;  3NZU A;  3ZW3 A;  4FLH A;  1DDW A;  3JW0 X;  1OEY A;  3WAM A;  2DEN B;  2M8S A;  1GUA B;  4HAT B;  2XK5 B;  3SUZ A;  3VOQ A;  1Z5S B;  1BWN A;  4HAX B;  1U29 A;  3X0W A;  4GOC A;  2ABD A;  5L95 C;  1LW3 A;  1H8C A;  4WWO A;  3VTU A;  1HE8 A;  3EFU A;  2N9X A;  2NPT B;  3V6E B;  4WVF B;  4A6F A;  2OJR A;  2EKE C;  2K25 A;  1TXD A;  1U5G A;  4W9F A;  5CHF A;  1P5T A;  3CF6 E;  2CQU A;  2ZCB A;  4MGI E;  3O65 B;  4GDL A;  4GGQ A;  2FCQ A;  4HPL B;  3A1Q A;  3GOE A;  1JDE A;  4TYZ A;  3ULB A;  1FHO A;  1T0Y A;  4GXB A;  1P1A A;  3KH0 A;  3RD2 A;  2A5U A;  1J8C A;  3K9P B;  1WJ1 A;  2D9Z A;  3V61 A;  2N1V A;  2LG1 A;  2DTC A;  4HAZ B;  4GSW A;  2V1Y A;  2AL6 A;  4A5K A;  2XK5 A;  2BYV E;  1NTV A;  5J17 A;  1E7V A;  2ZJD A;  3OAN A;  1WGY A;  2BWE S;  4MSQ B;  5CLL B;  1R4N I;  3ODX A;  2PPH A;  1ZKH A;  1M7E A;  5EFX A;  2K00 A;  4JKG A;  2YRY A;  3DVG Y;  2YF0 A;  1WF9 A;  1I7A A;  3A9J A;  4JK9 A;  5DCN A;  3UIO B;  4NSW A;  2N4F A;  1UNR A;  2O2V B;  3KYD D;  1YX6 B;  3DQV A;  1VBH A;  1V49 A;  4K7W A;  3DXC A;  2H7E A;  1RFA A;  5C1Z A;  1BAK A;  1V5O A;  3WAO A;  4GZU A;  4MGY E;  2JUO A;  1TQZ A;  1TTN A;  3TBL D;  5HE0 A;  2WX0 A;  2IO2 B;  2FCN A;  2N0Y A;  5J3T A;  2KDB A;  2L05 A;  4DX9 0;  3L08 A;  2N1W A;  1X05 A;  2RGN B;  3S2A A;  3ZIM A;  2KFK A;  3G9W A;  2NBW B;  2KC2 A;  3SDL C;  5J2R A;  1EVH A;  1WXM A;  1UEF A;  2L3Z A;  2LGD A;  4IAP A;  2ZPY A;  2EC1 A;  2GJY A;  2C7H A;  4BKS D;  3U30 A;  4MJS A;  1B55 A;  1E8X A;  5FI0 A;  2HD5 B;  3TCA A;  5L83 A;  3MPX A;  5HE2 A;  1XD3 B;  1WJM A;  2UZS A;  1FGY A;  2IO0 B;  2KD0 A;  4TUU A;  4KHB B;  3M62 B;  4EFO A;  1SHC A;  3VUY A;  3T8M A;  2DHI A;  2O6V B;  1NDD A;  4HDO A;  3ODW A;  4WSF A;  3A9K B;  3TJP A;  2KTR A;  2MKR A;  1XOD A;  5JH5 C;  2KX3 A;  2I1K A;  4GMV A;  2ZNV C;  3PHX B;  1U5D A;  5E6P A;  4MJS B;  2R09 A;  2FJL A;  1OQN A;  2OOB B;  3FM8 C;  4IWQ A;  3ZRF A;  3SV1 A;  1P9D U;  1WMH A;  2K6Q A;  1V80 A;  1WI0 A;  1FXT B;  4WWP A;  3BY4 B;  4WJP A;  1BTN A;  3R66 C;  2MQJ A;  1VBG A;  2D07 B;  2JZZ A;  2KQS A;  1QZE A;  5IA7 A;  4DHZ E;  3PVW A;  1QC6 A;  2NMB A;  5KHO A;  5EDS A;  1WGH A;  5D3Y A;  2FIF A;  2KLG A;  4K2O A;  3JVZ X;  2MWN B;  4HAY B;  4B9K A;  3DPD A;  1U4A A;  2M14 A;  1P0R A;  3RCP A;  3APD A;  3DBH I;  3A33 B;  2KDE B;  4ZRK A;  4W9D A;  5JLJ B;  1XKE A;  5TR5 A;  4HJK A;  3SHQ A;  1LB1 A;  2LZ6 A;  1EUV B;  1Q5W B;  3A9J B;  1V6E A;  2MBB B;  2LYD A;  2VKI A;  3VH3 B;  4F7G A;  1DIK A;  1WR6 E;  3RUL A;  1LFD A;  1SE9 A;  1WE6 A;  5D27 A;  5AZF A;  2DAJ A;  2C7M B;  1XX0 A;  3WA0 A;  2BKF A;  5C5B B;  1Y8R C;  2K6D B;  4K17 A;  3ZRC A;  2ZNV B;  2P0D A;  2IY0 B;  1YIW A;  1WR1 A;  3ML9 A;  3TMP B;  1EF1 A;  1XD4 A;  5JP4 A;  1WJU A;  3NY5 A;  3KSY A;  3AJ4 A;  1MK7 B;  2D11 A;  4K81 A;  4M8M A;  2FDQ A;  5KCV A;  5J3Q A;  1PQS A;  2YLM A;  3PSE B;  2DZK A;  1IYF A;  2HTH A;  2MRP A;  3Q3J A;  4TKN A;  5HE3 A;  1UH6 A;  2YSZ A;  1RRB A;  3CXB B;  4JKD A;  5D3W A;  3TL5 A;  2RQ1 A;  4JKF A;  1K5D B;  5E6N A;  1JRU A;  1WM2 A;  2ZVN A;  2DLW A;  4DHJ D;  4PS7 A;  4BFR A;  1OGW A;  1V86 A;  2DA0 A;  5DPW A;  3HM6 X;  2AYO B;  4EJN A;  1RJ2 A;  2RR9 A;  2Y8F A;  4NPN A;  4KV2 A;  1SIF A;  4ASW C;  2NBU A;  2X18 A;  3H1U A;  4J6I A;  4RM9 A;  3PV1 A;  3RYT A;  3M95 A;  2W2W A;  2MBQ A;  1FHX A;  2CRF A;  4MY6 A;  2DFK A;  4KIK B;  3ENB A;  3PVU A;  2ROZ B;  2K8C A;  4EZL A;  3CSF A;  1E8Z A;  5DH9 B;  3B0A A;  4G11 A;  3SD5 A;  2KC1 A;  2RNR B;  3MHS D;  5FR6 A;  1OQY A;  2MP2 B;  2Y5B B;  3VQI A;  3EEC A;  2FNJ B;  4NY0 A;  3VHT C;  3JSV A;  5E6O A;  2L1C A;  3A4S C;  3W1Y A;  1W1G A;  5LOP B;  1X1F A;  3JSV B;  4II3 B;  1C1Y B;  2UWQ A;  4IG7 B;  4FUL A;  2PJH A;  3TW1 A;  5DI9 B;  4YL8 A;  1ISN A;  4DHJ B;  2PE6 B;  2VSZ A;  4WJN A;  4CYE A;  1V9J A;  2COP A;  2D2Q A;  3A8P A;  4MEL A;  3ULC A;  3A8Q A;  2YS3 A;  3L54 A;  3QCA A;  1L7Y A;  3FLV A;  4JKA A;  2P8V A;  5J3Y A;  4IFS A;  2YT0 A;  3PT2 B;  2CAY A;  2KOX A;  2P0H A;  3ENE A;  3ZTD A;  1FHW A;  1Y5O A;  2IY1 B;  4HB2 B;  5D3X A;  2L7R A;  2COF A;  1K5G B;  2Z0D B;  3GZN I;  4D0N B;  3PLU A;  2WWZ A;  3ZVV A;  2EMS A;  4A3O A;  4B95 A;  1MPH A;  3UGB B;  3NSU A;  3K9O B;  4AP4 C;  2REX A;  2KTF A;  3A4R A;  4CHK A;  4LJP B;  1KZG A;  3GYP A;  1R4M I;  2L0T A;  2ADZ A;  1CMX B;  2JWZ A;  1J0W A;  3M1I B;  2MWS B;  4X57 B;  4KDL B;  3HW2 B;  2BYF A;  1WX8 A;  4ANW A;  3HIZ A;  4ZYN A;  2DYN A;  2DYQ A;  2UYZ B;  3KW5 B;  3QIJ A;  4ILG B;  4BBN C;  1V5T A;  4MM3 A;  3HQC A;  2LWP A;  5JHG A;  3LJ3 A;  3L16 A;  2BPS A;  4NAW B;  1PMS A;  4AOF A;  4I6P A;  3V62 A;  2CS4 A;  3WAP A;  1YX5 B;  2EMT A;  4LJO B;  2AL3 A;  3I3T B;  1Q0W B;  3PEG A;  3UZT A;  1V2Y A;  3VTW A;  2M17 A;  2KJR A;  3MTN B;  2KDI A;  1M7R A;  2LOX A;  3PSC A;  2KX0 A;  3ZLZ A;  2DHZ A;  1WXA A;  4W9J A;  2Z0O A;  4HVB A;  2KDF B;  3LDZ E;  4NNJ B;  2J0M A;  2DX5 A;  2MBE A;  1UNP A;  3VFK A;  2ELB A;  2G45 B;  2V4L A;  3W1S A;  1YQB A;  1TZ1 A;  1DDV A;  3D8E A;  4F7Z A;  1UEL A;  3QHT A;  3ECI A;  3AI5 A;  5DHF B;  2CR5 A;  1GGO A;  2GBJ A;  1U2B A;  1UPR A;  3BIN A;  1E90 A;  1KBL A;  3DXD A;  3ZDT A;  5KQ1 A;  3X23 A;  2DN6 A;  4MT7 A;  3ZTC A;  2WX1 A;  4P7I A;  2QKL A;  2O6V A;  3NZS A;  2BF8 B;  1FAO A;  4DHZ B;  5C79 A;  3KRW A;  4Y94 A;  1WE7 A;  3ONS A;  4ILH A;  2PZ1 A;  3WIM A;  2GS0 A;  2RLO A;  3PS6 A;  2E2X A;  5C23 A;  1FOE A;  2COA A;  5IAA C;  2DAF A;  2LXA A;  3ZVR A;  3N32 A;  1TJ6 A;  4YON A;  5CHW A;  3H7P B;  2LUL A;  2JZ3 B;  3AU4 A;  1TGZ B;  2UZR A;  4K7S A;  4NJ6 A;  2JT4 B;  4BOS C;  1E7U A;  4DBB A;  4JKH A;  3U8Z A;  4I6N B;  2XEW A;  4JGH B;  1GC6 A;  1WX7 A;  3H9D A;  4K7U A;  2FID A;  2LD9 A;  1WYW B;  1WRD B;  4WAA A;  1ZC4 B;  2DYO A;  3R7Q A;  4EKU A;  4KHO A;  4XWX A;  4JK8 A;  4G3X B;  1D3Z A;  4PYZ A;  3MDB C;  4W9I A;  2ROV A;  3L10 B;  2P0F A;  5GMV A;  2CHW A;  2JPH A;  4FBJ B;  2MBO A;  2LBB A;  1WI1 A;  3APC A;  3MJW A;  5AZH A;  1KLV A;  4JKG B;  2K1F A;  3DXE A;  2ELA A;  5JZE B;  4GDK A;  2R2O A;  2CHX A;  1IP9 A;  2Y7B A;  1PLS A;  3DVN V;  1ACA A;  1RLF A;  1F9J A;  3ZNZ B;  1S1Q B;  2WH5 A;  1U5E A;  3U7D A;  2Z0P A;  4JKB A;  2GBN A;  2CY5 A;  2KWV B;  3QQ8 B;  5D94 A;  2D9Y A;  2KMC A;  3Q3F A;  3UF8 A;  4XX5 A;  2LVP A;  4FJV B;  3V5W A;  3PPA A;  1KZ7 A;  3OLM D;  5JHH A;  3ZDM C;  1WXV A;  2BGF A;  4KZC A;  2O6V D;  3IFW B;  1OMW A;  1Z87 A;  5CHV C;  4KSK C;  1GNU A;  3B08 A;  3FP5 A;  2PEA A;  3NHE B;  4AWJ A;  2C9W B;  2DHJ A;  4LCD E;  4B6H A;  2G4S A;  2CHZ A;  4DXA B;  1BTK A;  1HB8 A;  4E3C A;  5IJM A;  4MGZ E;  3QAR A;  4DWF A;  4JQW C;  1EF5 A;  4ICU A;  1WZ0 A;  4KDI C;  4DDI D;  3PZD A;  1WGG A;  2MCN B;  2LAS A;  4FHK A;  4ZRI A;  1UZX B;  1WH3 A;  3EPY A;  2YT1 A;  4KVG B;  3UQB A;  2YS5 A;  3DBL I;  2M4N A;  3A98 B;  4GDK B;  4W9H A;  2DX1 A;  4W9C A;  2Q13 A;  4M8N A;  4HCN B;  2KZR A;  3PRM B;  4GU2 A;  2KWC A;  2KXJ A;  3ML4 A;  4IUM B;  2D9W A;  1V61 A;  3SU8 X;  2GCJ A;  3VAW A;  2L2I A;  2K2J A;  1PFJ A;  4HDQ A;  1WJN A;  3DOW A;  3PRE A;  2L76 A;  1YD8 U;  4WWN A;  1V5U A;  4PYU A;  1UNQ A;  4BVU C;  5D3V A;  4WJQ A;  1WY8 A;  4ANV A;  2HTH B;  1NU2 A;  2L0F A;  2HRJ A;  4DX8 A;  4PS3 A;  5DPR A;  4WJ7 A;  5G55 A;  4IOY X;  1WGR A;  4HB3 B;  5CTR C;  1J0G A;  3TVV A;  2ZPN A;  2KMA A;  1Q1O A;  4W9G A;  4GB9 A;  2HE7 A;  4DBG A;  3V60 A;  4B6W A;  1AWE A;  1VD2 A;  4EUT A;  1S3S G;  3IG3 A;  3H7P A;  2B3A A;  2R0D A;  4IM0 A;  2DX5 B;  3DVN U;  4HXD A;  3TIX A;  4IW0 A;  2FUH B;  3L17 A;  3SNH A;  2N23 A;  1MIZ B;  3HHM A;  4N9F 4;  2GBK A;  2WYQ A;  4OVU A;  3VH4 B;  2K8B A;  4G50 A;  1Z2M A;  2DYB A;  1ZC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...