3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
3ZVRA 1I35A 2Y8GA 1WM3A 2P0HA 2REXA 4WSFA 1WGUA 5JLJB 4DDGD 2KDEB 4HPLB 4EEWA 3B0AA 2D9VA 1AARA 3APFA 1E8WA 1Q0WB 3HM3A 3PTFC 4K2OA 5EDSA 2JF5A 2M4NA 3EHVA 3KY9A 4GSWA 4BVUC 2LGDA 1WJNA 2KJRA 1NTYA 1NDDA 3R7QA 5AEKB 5JP4A 2BWES 5L95C 3RULA 2FCSA 3IBEA 4HVBA 5LXHA 2Z0PA 3TFMA 2KTFA 2RR9A 3PGEA 1ZSQA 2NBUA 3ML9A 3SNHA 3P2BA 2WX1A 5IJMA 2XBBC 1UZXB 1B55A 2Q13A 1X1MA 4MSQB 4NQKE 5C16A 2OJRA 2DAJA 5KHOA 4NNJB 1FAOA 3KSYA 5CHVC 2CY4A 3VH3B 2PE6B 2M14A 5J3TA 1FHXA 5KCVA 1P5TA 2N1VA 3PVUA 2CODA 5IAAC 4IM2A 4GMVA 2KD0A 2MLBA 2ASQA 2JY6A 4W9IA 4WWNA 2UZRA 1OGWA 4EUTA 4HB4B 2KQSA 4B9KA 2A4ZA 1WJ1A 2GBKA 2K39A 1V49A 1WXMA 2NBVB 3RD2A 1WJMA 3A98B 2ELBA 4DHJD 2FIFA 5BO4B 1DBHA 1MK7B 1S1QB 1OMWA 1ZKHA 2I1KA 3DPDA 1DROA 2D3GA 3DVGX 4KV2A 1IYFA 4ZRJA 3ZNHB 4HDOA 4MGZE 3ZTDA 3V62A 3L54A 5DH9B 4A3OA 4N9F4 2WWZA 3RUIB 2YVCA 1UBIA 2ROVA 5D27A 4A6FB 3H9DA 4W9KA 2Y7BA 1OTRB 1I2HA 2ZPYA 3D8EA 3NSUA 2P8VA 2KWVB 1X05A 2MP2B 2FCQA 1P98A 4CHMA 2O6VA 4FADA 2MBQA 4EZLA 3HHMA 1UBQA 2GBRA 3DVGY 1WJ6A 2KZRA 3ODOA 1V6EA 1WXAA 1LQBA 2D07B 2BKFA 3ZDTA 2NPTB 5D3XA 2ZJDA 3OAWA 1V5MA 3QA8A 2V3SA 1RAXA 1MK9B 4FJZA 5HE0A 2J0MA 3SV1A 1RJ2A 4BBKA 2JZ3B 1WX9A 2YRYA 2N1WA 2RQ1A 4II3B 2YS5A 3HM6X 3QCAA 1V61A 4GMXB 3VIAA 2KTRB 4HAUB 3TIXA 3MDBC 4RMAA 5EFXA 1OEYJ 3WA0A 1GG3A 3DDCB 2KGXB 5C5BB 4W9CA 2CY5A 3PVLA 2Z0OA 3HK0A 1N3HA 2COPA 3ULBA 1LFDA 2YS3A 3PT2B 3A8PA 2LOXA 2K2UA 3W1SA 4EZKA 2BYFA 5DCNA 5AZGA 2GOWA 3QHTA 3O96A 1WGQA 3T06A 2AYOB 4PYUA 2EMSA 2M8SA 3DCGA 2W9NA 4EOYA 4D0NB 4BOZB 2Y8FA 4F8CB 1SHCA 1QZEA 3P7ZA 1U29A 2Y5BB 2VSZA 2WH5A 5FI0A 1BTNA 1TQZA 2K8CA 1EUVB 3L08A 2VKIA 3A33B 4Y94A 3Q3FA 1DDVA 2KK8A 5G55A 1PQSA 2ZVOA 2IO3B 2IBIB 1TZ1A 2JZZA 1Y5OA 4MJSB 1JRUA 2MBEA 2ABDA 3ECIA 4A6KA 2LZ6A 4MGYE 3ZTCA 3VHTC 2XQNM 2NBWB 3M3JA 4A6FA 4F7HA 1WGDA 2EKEC 2KWUB 4KZCA 3VTUA 4KHOA 1UPRA 4TKNA 2PZ1A 2YT1A 1AWEA 1WX7A 2QKMA 1NI2A 2FCNA 4CHJA 2N9PC 2Z0DB 2FCMA 4TYZA 4KIKB 4IUMB 3BINA 1UGMA 4X57B 3QBVB 5CHWA 3QQ8B 3M1IB 2CAYA 3L16A 4YL8A 1HE8A 3H6NA 5HE2A 4TV3A 2V1YA 4BBNF 3HIZA 2R09A 2YSZA 3X23A 5J3YA 4IAPA 3N30A 3PS6A 4DDID 2DENB 1WGHA 4HXDA 2HE7A 3M95A 2N7DA 1YQBA 5JHHA 2KDFB 1BT0A 5CLLB 1U5GA 2KDIA 3A9KB 2IO1B 2KFKA 4EMOA 2BWFA 4GZUA 1TTNA 2UYZB 2G45B 2X18A 1OQNA 1GC7A 2CKHB 5DHAB 3A9JA 2YF0A 2KTRA 3ZIMA 3H1UA 1ST7A 3HQCA 1WF9A 2NZ8B 1EGXA 5D3WA 1WFYA 4TQ1A 4DX90 2MBHA 2BKRB 3IVFA 4ASWC 2UVMA 2JXXA 2KMCA 5LONB 4AJYB 5GMVA 2WDTB 1YIWA 4CYEA 3EPYA 3LJUX 2J0KA 2D10A 3JSVA 1KJTA 3ZNGC 2LWPA 1ZC4B 2DYQA 2KVRA 3RCPA 5DI9B 2FIDA 5J18A 3PHWB 1RFAA 5JHGA 1E7VA 5GOWB 1U5FA 3ZKJC 4W9HA 1MPHA 3AU5A 4URKA 1W1DA 3N7CA 1M7RA 2DZMA 3VUXA 2CHZA 3PSCA 2C7NB 3PP2A 2AWTA 2EMTA 3JVZX 3PSEB 4WVFB 3GYPA 1Y8RC 1H4RA 4CO7A 2BPSA 4ZRIA 3QAQA 1WE6A 3MJWA 2KX3A 3VUWA 2E2XA 3DVNU 3NHEB 1E7UA 2CR5A 3KYDD 2QHOA 4F7GA 4WJPA 4JL9A 2Z0EB 2QKLA 1V81A 3V6EB 4NJ7A 2FJ9A 1BWNA 3TBLD 2ELAA 3IG3A 4W9FA 3O65B 1UPQA 3EECA 4W9DA 3GYOA 4GDKB 2L1CA 1X86A 3ONSA 1X11A 2LVOA 5LXIB 4KVGB 1V5OA 4IM3A 3UGBB 4YONA 2MFQA 3VQIA 4FHKA 2KKCA 3ENEA 2PE9A 3WAOA 2PJHA 5E6OA 1FHWA 3DBLI 1HB6A 2C9WB 4FHJA 3QARA 1KZGA 3A8QA 1H8CA 5JH5C 4GIVA 2XEWA 1UH6A 3PG7A 4F7UP 4LJOB 2KUPA 2V4LA 2FJLA 2DX5B 3TL5A 2AL6A 3KH0A 1YD8U 3CSTA 1VD2A 2I1JA 4HDQA 1C3TA 1V9JA 4K7SA 2LGXA 2M17A 3LJ3A 1H10A 2MW5A 5FR6A 2ZVNA 2H7DA 2C7MB 5D2MB 2BYEA 2CHXA 2DA0A 4F7ZA 5KQ4A 1X1GA 4HAVB 2G35A 3B1LX 4B6WA 3OLMD 4HAZB 2HJ8A 2LOZA 4JIOU 4ANUA 2D2QA 2JVCA 2K25A 2HRJA 4KDIC 1TJ6A 2N9XA 3VOQA 1V2YA 3PRPB 2RVBB 4PYZA 2C60A 3ZUNA 1IRSA 2Z59B 3UQBA 3A1QA 4HCPB 4HPMB 4A5KA 3V5WA 3GOEA 3K9PB 1U5DA 3KVFB 1ZGUB 3DXEA 3X0WA 3ZNZB 3N32A 2W2XD 2N0YA 3FP5A 1WH3A 2K8BA 1WX8A 3B08A 1GUAB 3VUYA 4PNKA 1UNQA 1V88A 4PS8A 3FM8C 2K00A 2P0DA 4MT7A 2FUHB 2YT0A 3D8DA 2KXJA 4W9EA 1KM7A 1W1HA 1E8YA 3TVVA 2ZZPB 4K17A 1WY8A 1WGYA 2O2VB 4E3CA 3W1YA 3ZLZA 4HAWB 4IM0A 4G3XB 2D4QA 1MG8A 3WANA 3DBHI 3ZO5B 2LRWA 1NBFC 1FB8A 2GCJA 2K1FA 1V5PA 2N7EA 4WJQA 5JZEB 1WI1A 2OTXA 4K2PA 1UNPA 3NS8A 2KOXA 4DBGA 1P3RA 4G0NB 2ADZA 2NVUI 2DN6A 4DXAB 3QJZA 1IP9A 2FAZA 1XX0A 1EAZA 2RPQA 1ISNA 3VVWB 1L2NA 4H8SA 4MH0E 1WR6E 5D3YA 3VH4B 4BKSD 2LI5A 4HAYB 1KLVA 1J0WA 3TMPB 2KN5A 2KJ6A 1F9JA 5C23A 3PHXB 5DIFB 1FHOA 2L7RA 4NAWB 3PEGA 2I5FA 4GGQA 2J0JA 1SE9A 4G11A 3ODXA 2CU1A 4W9LA 5AZHA 2FNJB 4E71A 4I6PA 3U30A 1LB1A 1Z87A 3DXCA 2ZCBA 2L00B 1V86A 1Q5WB 2C5LC 3TJPA 4NPNA 2KLCA 3V60A 4GDLB 4XZ4A 2MBOA 2M1MA 2LKOA 1GJZA 1FGYA 3ML4A 5CX3A 3PREA 3HW2B 2LVPA 1ZW7A 3SD5A 4BKTA 1WVHA 1I42A 1YX5B 2L0FA 1WMHB 1V5TA 2PEAA 3PRMB 2M38A 2DYBA 1RRPB 4ZRKA 2MQJA 4DHZE 5AZFA 2BGFA 3QC8B 2KDBA 4K1RB 4M8MA 2RGNB 2MP2A 3KUCB 4BKGA 2PPHA 3M63B 4DHZB 1KOTA 1DDMA 4WQOB 1GC6A 2M0XA 4MGIE 2BCJA 4KZ0A 4HWIB 2R0DA 4DBBA 4BKSA 2KHWB 3AU4A 2D9WA 3W1SC 2G4DB 4IFSA 1Z5SB 2P0FA 2NPTA 3DOWA 1XKEA 1NU2A 4IW0A 5HE3A 4MSMB 2ZNVC 3PRZA 4IWOA 2W2WA 2DZJA 2N23A 1KI1B 2LASA 2DYOA 3ZRFA 3MHSD 1YX6B 5E6NA 4KDLB 3DXDA 3KUDB 3BY4B 2D11A 1UELA 3LDZE 5L81A 4FJVB 2G3QB 1XCGA 2KC2A 5C5BA 2IO2B 3NZSA 3CMMB 4WJ7A 2IY0B 2Z0QA 3OJ4B 3VDZA 2HTHB 1L7YA 4FBJB 2IYDB 1FOEA 1U27A 1XD4A 2DHIA 2LRUA 4BBNC 1GNUA 4MELA 2N9EB 2NCNA 1VCBA 3SO6A 2IY1B 2XK5B 2ZCCA 3RCZA 2DHJA 4HJKA 2DLWA 3D8FA 1MIXA 4FA6A 4B95A 2RUKB 4FJYA 2MWNB 1WE7A 3SHQA 1BAKA 2L2IA 4TUUA 2I5CA 2COCA 3F0WA 3GZNI 3UF8A 3CF6E 2J59M 2EJ8A 1S3SG 5L83A 1E90A 5KHQA 1SIFA 4GDLA 2HD5B 1IPGA 2DHZA 1WM2A 4NSWA 2BYVE 4PQ0A 3FEHA 1XT9B 4MJSA 4TQ0A 3NY5A 4MDKE 1PFJA 3TW1A 2KFJA 3QWMA 2H7EA 2LJ5A 4JGHB 1X1FA 2LG1A 5D6JB 1I7AA 2KX0A 4LDTB 4NY0A 4E74A 4I6LB 2O6VB 1WIAA 2CB8A 3R7RA 5J3QA 2AEHA 4KIKA 4EZJA 4P7IA 3N3KB 1NTVA 3WALA 2LVQA 4K7UA 4AJWA 2GJYA 3MTNB 5E6PA 1R4MI 2LD9A 4HB2B 2JWZA 3UZTA 1UNRA 2KANA 2IFSA 4GB9A 2MCNB 4F1SA 1ACAA 3CIKA 3K9OB 3ULCA 3A9KA 5LOPB 4IWPA 3EC8A 3FLVA 2D9ZA 5DPTA 2KQ7A 2ROZB 3U7DA 2DTCA 2NMBA 4GOCA 4PS7A 2VRWB 3QX1A 1FXTB 3RT3B 4LDTD 4BOSC 2L05A 3PPAA 2O6VD 1MKEA 2RNRB 2KJHB 2COAA 1WRDB 3U8ZA 2K8HA 4DHJB 1D3ZA 2L76A 1P6SA 1WJUA 2HTHA 4K81A 2GBJA 2KC1A 4AP4C 5IA7A 1V89A 2LGYA 4LJPB 5TR5A 4AUQC 4HLEA 4PS3A 4CHKA 1K5DB 1LXDA 5FI1A 3T9LA 3R66C 1E8ZA 1E5WA 4W9JA 2XK5A 1PMSA 2ZNVB 4AOFA 1WYWB 2MRPA 1P9DU 4JLCA 4JQWC 3M62B 2EC1A 5CHFA 2MDXA 3UIOB 2YS1A 5G2NA 3NZUA 2DFKA 1EF5A 3I3TB 4WWPA 3QIJA 3VXWA 4FULA 2DYNA 4M0WB 4WWOA 2GBNA 3ZW3A 2A5UA 2UZSA 1C1YB 2G4SA 4HB0B 2NR2A 3IHPC 3KRWA 3AI5A 1XR0B 3DBSA 1TXDA 4G50A 2LUEA 2LXCA 5C79A 4GXBA 4DWFA 3EFUA 4HHVA 2L8JA 3ZNID 3SDLC 2WX0A 2ZEQA 2DHKA 3A4RA 4MK0A 3V6CB 3SUZA 1EVHA 2D9YA 2RD0A 3BJIA 3D32A 2KWCA 2L0TA 4W9GA 2RSUA 2OQBA 1P3QU 3AULA 5C1ZA 4KHBB 3IFWB 1PLSA 1WR1A 3UQAA 3AXCA 1M7EA 3MPXA 3UIPB 3H7PB 4GDKA 2L3ZA 3SU8X 4FN2A 1J0GA 1WGGA 4Z2MB 4C0AA 3KYCD 1WG7A 3KZ1A 3OJ3A 5JHBA 1QC6A 5KQ1A 3WAPA 2KFKB 3L13A 2R2OA 2FDQA 1XD3B 2KNBA 2K6DB 2MWSB 2JRHA 1U4AA 4DX8A 1K5GB 3QWZB 1UEFA 2MSED 3A9JB 3CSFA 5D7GA 3VAWA 4MM3A 2JT4B 3G9WA 4IG7B 4ANXA 1DYNA 3APDA 2UWQA 5CLQB 3A4SC 1WZ0A 4GPTB 5J2RA 2DX5A 2JPHA 2DYMA 3ZRCA 2DZIA 1P1AA 2CS4A 3VTWA 1LW3A 2R2QA 4I6NB 4GN1A 1V5UA 4B6HA 1YJ1A 3CXBB 2IYBA 2D9XA 4XWXA 4ANVA 1SGHA 1BTKA 3L0WB 2MKRA 1WJ4A 1P0RA 1V80A 4EKUA 3JSVB 5HE1A 2K6QA 4OVVA 3PV1A 3ODWA 4KSKC 4HCNB 4MGKE 4GU2A 1FGZA 5D3VA 2NS5A 3WIMA 2J7QB 2N4FA 1AQCA 2LYDA 2B3AA 1WXVA 2YLMA 4IC7B 1WI0A 3SYXA 1RLFA 1J8CA 1U2BA 4RM9A 1HB8A 1NTIA 4II2B 2RGFA 1T0YA 1KZ7A 3VFKA 1EO6A 4OVUA 4WJNA 3DBRI 2DKPA 1U5EA 1E8XA 3P6AA 4BFRA 4AWJA 2DZKA 3DVNV 1K8RB 3KW5B 1ZM0A 3APCA 2BF8B 2KMAA 2LXAA 4A20A 1G6JA 4KAXB 1Q1OA 4FLHA 4KSLC 3PZDA 4IWQA 2AL3A 2MA9B 4ICUA 2JUOA 5DHFB 3UINB 2CRFA 3ML8A 3NOBA 1WZ3A 1TGZB 1UD7A 3KUZA 3JYUA 1OQYA 2O2VA 3PVWA 4ZDVA 2K2JA 5DPSA 4WJOA 1TBEA 3Q3JA 2DAFA 5CTRC 1HBKA 2C7HA 5LLIA 1LM8B 3JW0X 3H7PA 4RM8A 1M94A 2MBBB 2KLGA 2GS0A 2W2XC 4MEMA 2GCLA 2IO0B 3ALBA 3RZFA 3FSSA 2KO3A 3TO1A 4ZYNA 4LCDE 1WGRA 4L6EA 3R3MA 2RLOA 3RYTA 2JP2A 4EJNA 2IZVB 3ZDMC 4HAXB 2VRRB 1XQQA 2CHWA 3S2AA 1XODA 5D94A 1EF1A 3WYFB 3WAMA 4Z2NA 4HB3B 1A5RA 1Z2MA 4NQLB 4M8NA 3OANA 1RRBA 3VTVA 5DPRA 4HK2A 2CQUA 3AJ4A 4NAWA 3TCAA 4K7WA 3PLUA 1ZVRA 4DK5A 2ZPNA 1WXSA 1NVLA 3H7SA 3T8MA 5J17A 4ANWA 4XC2A 1DDWA 1OEYA 4J6IA 2V76A 2LBBA 1ZC3B 4IOYX 2DKQA 4KHAA 2OOBB 2KCJA 2RSGA 2COFA 2JRIB 5DPWA 1CMXB 1OY2A 1QQGA 1R4NI 3L17A 3F5RA 3DQVA 3RZWC 3V61A 1MIZB 1Y19B 2DX1A 2LULA 3ZVVA 1MAIA 2GMIC 2GBMA 4XX5A 3L10B 1Q67A 3QK0A 3A1QB 1WMHA 4WAAA 1W1GA 4ICVA 5HKHA 3C0RB 5JHAA 2WYQA 4A6HA 5C6RA 4MY6A 4HATB 4A3PA 2MX2A 4NJ6A 3PLVA 3KRXA 1J19A 4EFOA
chains in the Genus database with same CATH superfamily
2FE8A 3ZVRA 2OEDA 1I35A 2Y8GA 1WM3A 1FEHA 2WP9B 2P0HA 2REXA 5IOIA 4WSFA 1WGUA 5JLJB 3MP9A 4DDGD 3CWIA 5LNK1 2KDEB 4HPLB 4EEWA 3RNAC 3B0AA 2D9VA 1AARA 3APFA 1E8WA 2ZW0A 3J9CA 1Q0WB 3HM3A 3PTFC 4K2OA 5EDSA 2JF5A 2MHJA 2M4NA 3EHVA 3KY9A 2WDRB 1EU4A 3P63A 4GSWA 3NVYA 4BVUC 2LGDA 1WJNA 1SF0A 4K3BA 2KJRA 1NTYA 1NDDA 3R7QA 2NMQA 5AEKB 5JP4A 2BWES 5L95C 4QJ5B 1XLNA 3RULA 2FCSA 3P4RB 3P42A 3IBEA 4HVBA 5LXHA 2Z0PA 3TFMA 2KTFA 5HG2A 3RNFC 2RR9A 2WQYB 3PGEA 1ZSQA 2NBUA 3ML9A 3SNHA 3I63C 3P2BA 2WX1A 3SFDB 5IJMA 1WWTA 2XBBC 1UZXB 1B55A 2VH2A 2Q13A 4NZLB 1I4PA 4USAA 1X1MA 1TKGA 4MSQB 4NQKE 4B0EA 5C16A 1QT9A 2OJRA 2DAJA 5KHOA 3AE8B 3TSSA 2JYTA 4NNJB 1FAOA 3KSYA 5T8IA 5CHVC 4ILJA 2CY4A 3VH3B 2PE6B 2M14A 5J3TA 1FHXA 5KCVA 3HIEA 1P5TA 2MJEA 2N1VA 3KLSX 3PVUA 2CODA 5IAAC 4IM2A 4OHJA 4GMVA 2KD0A 2MLBA 4S0RA 2ASQA 2JY6A 4W9IA 4WWNA 2KIEA 1MPEA 1QKZA 4P6VF 1GPXA 4YT0B 4JX1C 2UZRA 1OGWA 1UGJA 4EUTA 4HB4B 2KQSA 2W3SA 4B9KA 4LNKA 1QF6A 2A4ZA 3PZ8A 1WJ1A 3BYYB 2GBKA 3NRZA 2K39A 1V49A 1WXMA 2NBVB 1C4AA 3RD2A 1WJMA 4REZA 3A98B 2ELBA 3LXFA 4DHJD 2FIFA 5BO4B 1DBHA 1MK7B 1S1QB 1OMWA 4HJGE 1ZKHA 2I1KA 3DPDA 1DROA 3UI3A 5AUKA 2D3GA 5EE1A 3DVGX 4KV2A 5GXGB 1IYFA 4ZRJA 3ZNHB 4HDOA 3P4QB 4MGZE 3ZTDA 1GGOA 2RMMA 3V62A 4TMAB 3VRBB 3L54A 5DH9B 2TSSA 3Q8FA 4QAYA 4A3OA 4N9F4 2WWZA 4P1BC 3RUIB 3Q8BA 3FILB 2YVCA 1UBIA 2QIEB 2ROVA 5D27A 2R2YA 4KGTA 1KRHA 4A6FB 3H9DA 4W9KA 2Y7BA 1OTRB 1I2HA 2ZPYA 3D8EA 3NSUA 2P8VA 3Q8CA 2KWVB 1X05A 4YSZB 2MP2B 2FCQA 1E6EB 1P98A 3FVCA 4CHMA 1ZPSA 2O6VA 1FO4A 3N1XC 1BUIC 4FADA 1CK1A 1TS2A 2MBQA 3RNCC 4EZLA 3NW8A 3HHMA 1RFKA 2HDEA 1UBQA 2GBRA 1JWBD 3DVGY 1WJ6A 3AE2B 2KZRA 4JK7A 4JE3B 3ODOA 1V6EA 2QCZA 1WXAA 1LQBA 1PFDA 2D07B 2BKFA 3ZDTA 2NPTB 4A55A 2N9LA 5D3XA 2ZJDA 3L4PA 3OAWA 1V5MA 3QA8A 2V3SA 3EFCA 1RAXA 1MK9B 4FJZA 5HE0A 2J0MA 3SV1A 5D3IB 1F77A 1HEZE 1RJ2A 4BBKA 3URYA 3ABVB 2JZ3B 2K5PA 1WX9A 2YRYA 1PGBA 1WYGA 2N1WA 2RQ1A 4II3B 2YS5A 3HM6X 3N9YC 2KYWA 5HI1A 3ZQ4A 1N5XA 1IGCA 1L0VB 1V61A 3QCAA 4GMXB 4N6EB 2FJUB 3VIAA 2KTRB 4HAUB 4ILHA 3Q8AA 3TIXA 1I4XA 2KN4A 3MDBC 2MH7A 4RMAA 5EFXA 4MH8A 1OEYJ 3WA0A 1GG3A 3DDCB 2KGXB 3KWVA 5C5BB 4W9CA 2CY5A 3PVLA 2Z0OA 2WXQA 3HK0A 1N3HA 2COPA 4LTUA 3ULBA 1LFDA 2YS3A 2WDQB 3PT2B 3AE6B 3A8PA 5I2SA 2LOXA 3MC9A 1HTQA 2K2UA 3W1SA 1L0XB 4EZKA 2BYFA 1F2RI 5DCNA 1SJED 5AZGA 2GB1A 2GOWA 2L1AA 2KAJA 4RFBA 3QHTA 3O96A 1WGQA 3DHGC 3TEXA 3T06A 2AYOB 4PYUA 2EMSA 2M8SA 3C19A 3DCGA 3CIRB 2KVZA 2W9NA 4KKJA 1N60A 4EOYA 4D0NB 3I9V1 4BOZB 2Y8FA 4F8CB 1SHCA 1MI1A 1VZ6A 1QZEA 3P7ZA 4KGSA 3SBGA 1U29A 2Y5BB 2VSZA 2BQQA 3I57A 2M56B 2Q5WD 2WH5A 4HSIA 5FI0A 3DBHB 1AYFA 2ONQA 1BTNA 1TQZA 3KQ4A 2K8CA 1ESFA 3W5UB 3B2GA 1UF0A 1EUVB 4M0WA 1EM7A 1YQ4B 3RI7C 3L08A 1TT5B 1F52A 2VKIA 3A33B 2K0PA 1IBXA 4Y94A 3BYTB 3Q3FA 1MJDA 1JWAD 2BTEA 1J7AA 1DDVA 3OHMB 2KK8A 2X8XX 4XWTA 5G55A 1PQSA 2ZVOA 5IO9A 2IO3B 2IBIB 1TZ1A 2JZZA 1Y5OA 4BZAA 4MJSB 1JRUA 1UWXA 2MBEA 2ABDA 3ECIA 2WGSA 4A6KA 1T77A 2LZ6A 3LYYA 4MGYE 4MACA 4LNNA 4K3CA 3ZTCA 3VHTC 2XQNM 1AN8A 2NBWB 3FILA 2KACA 2NTTA 3M3JA 5BYSA 4JKDA 4A6FA 4F7HA 1WGDA 2EKEC 1I7HA 1XXGA 2KWUB 4KZCA 2K8EA 4HKQA 1F1HA 3VTUA 2ON8A 1VRAB 4KHOA 1UPRA 4TKNA 2PZ1A 2YT1A 1AWEA 1WX7A 2QKMA 1NI2A 2FCNA 4CHJA 2N9PC 2Z0DB 2FCMA 2INPE 4TYZA 3OG5A 4KIKB 4RGMA 2J52A 1QOFA 1YOVB 3BINA 4IUMB 2LGIA 2WXMA 1UGMA 4X57B 3QBVB 2KWDA 3AE5B 5CHWA 3QQ8B 1N62A 3M1IB 2CAYA 3L16A 4YL8A 1C77A 1HE8A 2GRIA 3H6NA 5HE2A 2BS3B 2ZW1A 3E9LA 4TV3A 2V1YA 2J42A 4BBNF 2W55A 5C3JB 4D2KA 3HIZA 2KQ4X 2R09A 3A58A 2YSZA 3X23A 5J3YA 4IAPA 3N30A 3PS6A 4DDID 2DENB 1MFWA 4YSXB 1WGHA 1E0ZA 4HXDA 3IAM1 4LNIA 2HE7A 3M95A 1V1PB 2N7DA 1YQBA 2Y5CA 5JHHA 2KDFB 1BT0A 5CLLB 1U5GA 2KDIA 4PK1A 4ILGB 1ZXHA 2IO1B 3A9KB 2KFKA 4EMOA 1WGKA 3NZ3A 2BWFA 4GZUA 1L4DB 1TTNA 2UYZB 2G45B 2RDGA 2X18A 1OQNA 1GC7A 2CKHB 3TEWA 5DHAB 2UU7A 3A9JA 2LHDA 2YF0A 2KTRA 4M00A 4OZCA 3ZIMA 3H1UA 1MG4A 3TEYA 1ST7A 3HQCA 1WF9A 2NZ8B 2BW2A 4N59A 1V8CA 4TSSA 4L23A 1EGXA 2QSDA 2LEKA 5D3WA 1WFYA 4TQ1A 2Z13A 4DX90 2MBHA 1TJEA 2BKRB 3AECB 1L4ZB 2L83A 3IVFA 4ASWC 2UVMA 2JXXA 2M0AA 2KMCA 1ZXIA 5IKCM 5LONB 4AJYB 5GMVA 1PUTA 1KFYB 2WDTB 1YIWA 4CYEA 2IGGA 1SSNA 3EPYA 1QILA 1XCQL 3LJUX 2J0KA 2D10A 5HHDG 3JSVA 1WRIA 1KJTA 3ZNGC 4IKGA 4ARIA 1JWSD 2LWPA 2QDFA 1ZC4B 2DYQA 2HJ1A 2KVRA 2OHFA 1VDVA 3HRDD 3RCPA 3RNBC 5DI9B 2FIDA 4DXFA 3MJ5A 3RNGC 5J18A 3PHWB 1RFAA 2E3TA 5HFYA 1SE3A 5JHGA 1E7VA 5GOWB 1SXTA 1U5FA 3ZKJC 4W9HA 1MPHA 3AU5A 3FAHA 4URKA 2D3CA 3GS2A 1W1DA 3N7CA 1M7RA 2WU2B 1M4VA 2BB6A 1BXTA 1L6VA 2DZMA 4NJCA 3BZDB 3VUXA 2CHZA 2BS2B 2AQ1B 3AEFB 3PSCA 1QLBB 1STEA 4OZAA 2C7NB 5JXVA 3PP2A 5M4YB 2FBWB 2AWTA 2LHEA 1ZDXA 1EU3A 3AM9A 2EMTA 3JVZX 2K9XA 3PSEB 4WVFB 1PDXA 3GYPA 1Y8RC 1H4RA 4CO7A 2BPSA 4ZRIA 3QAQA 3NWFA 1WE6A 3MJWA 2KX3A 3I5JC 3VUWA 2E2XA 1OQRA 3DVNU 3NHEB 4RCOA 1E7UA 4JKAA 2PW9A 1DOYA 2CR5A 3KYDD 2QHOA 4F7GA 4WJPA 4JL9A 2Z0EB 2QKLA 4L1RA 1NI3A 1V81A 2DIKA 3V6EB 4NJ7A 2FJ9A 1BWNA 3TBLD 2ELAA 2AQ3B 3IG3A 1AW7A 4W9FA 3O65B 1UPQA 3EECA 4W9DA 3GYOA 4GDKB 3U4EG 2L1CA 1YN5A 3P1MA 3GP7A 3HUIA 1X86A 1YJIA 3Q3MC 3ONSA 1X11A 2LVOA 5LXIB 4KVGB 1V5OA 2X38A 4IM3A 3UGBB 4YONA 2MFQA 3VQIA 4FHKA 3W2DA 3PO0A 2GLSA 2KKCA 3ENEA 1FNUA 5BYQA 1F0ZA 1KBLA 2N0SB 2PE9A 3GZNB 3WAOA 4C7ZA 2PJHA 1V1PA 1UWMA 2EELA 2XNAC 5IN7A 1MHXA 5E6OA 1RWSA 1FHWA 2INCC 3DBLI 1HB6A 2C9WB 4FHJA 3QARA 1FNWA 1KZGA 1SIJA 3A8QA 4JKHA 2V4IB 3ZJUA 1H8CA 2RDHA 5JH5C 4AQ7A 4H2AA 1OFFA 4N58A 4GIVA 4MM3B 2XEWA 2BB5A 3TUOA 1UH6A 2BT6A 5I4DA 3PG7A 2BBCA 4F7UP 4LJOB 2KUPA 3BVGA 4JK8A 2V4LA 2FJLA 2DX5B 3Q14C 3NWDA 3TL5A 2AL6A 3E9OA 3KH0A 1YD8U 3CSTA 3AEDB 3IXSA 1VD2A 1ENFA 2PVOD 1NEKB 2MJ3A 2I1JA 4HDQA 4JWSC 1C3TA 1FXIA 1V9JA 2KIGA 4WURA 1Q10A 1FPYA 4K7SA 2DLBA 2LGXA 2M17A 3LJ3A 1H10A 2MW5A 5FR6A 2ZVNA 2H7DA 4C80A 2C7MB 5D2MB 2BYEA 4LNOA 4XYCA 2CHXA 2M19A 3WCQA 2DA0A 4F7ZA 2JYEA 5KQ4A 1X1GA 1F2RC 4HAVB 2WXFA 2G35A 3B1LX 4B6WA 3OLMD 1R4MB 4HAZB 2SAKA 3H8HA 2D5GA 1HTOA 2HJ8A 2LOZA 4JIOU 1ZP0B 3AEEB 4ANUA 4ARCA 2D2QA 4ZHPA 2JVCA 2K25A 2HRJA 2WXPA 1JMLA 4KDIC 1TJ6A 1JCKB 2N9XA 3VOQA 1V2YA 4J3OD 3PRPB 2RVBB 4PYZA 2C60A 4XDCA 3ZUNA 1IRSA 2Z59B 4HEA1 1UNSA 5BMGA 3UQBA 3A1QA 4HCPB 4HPMB 1BMLC 4A5KA 3V5WA 3BVMA 3GOEA 3K9PB 4AS1A 1U5DA 3KVFB 1ZGUB 3DXEA 3X0WA 4ZHOA 3KWLA 3NVVA 2EKIA 3ZNZB 1HXYD 3N32A 2INDC 2W2XD 2N0YA 4OSNA 4LK0M 2WLBA 3FP5A 1WH3A 2K8BA 1WX8A 1KLGD 3B08A 4QXAB 1DIKA 1B9RA 1HZ5A 1GUAB 3VUYA 4PNKA 4LLGM 2WXLA 1UNQA 1V88A 1WSPA 3FM8C 2K00A 4PS8A 3U12A 2P0DA 4MT7A 1YNTE 2FUHB 3DWGC 2YT0A 3D8DA 2KXJA 4W9EA 2DNFA 1MI0A 1FCCC 1KM7A 1TZOA 1W1HA 1E8YA 2JWUA 3TVVA 2ZZPB 4K17A 1WY8A 1WGYA 2O2VB 1MHHE 3SR6A 4E3CA 1J7CA 3W1YA 3W9CB 3ZLZA 4HAWB 1L0YB 4IM0A 4G3XB 2L32A 2D4QA 1MG8A 3WANA 3DBHI 3ZO5B 1FCLA 3AMZA 3MHZA 4WIPA 2LRWA 1NBFC 1QQRA 1FB8A 2GCJA 1HZ6A 1ROEA 3R2TA 2K1FA 1V5PA 3EUB2 2PTLA 2SEBD 2N7EA 4WJQA 5JZEB 1WI1A 2OTXA 4K2PA 1UNPA 3NS8A 2KOXA 4RH6A 4DBGA 1P3RA 4WQMA 4G0NB 2ADZA 3NVWA 2NVUI 2DN6A 4DXAB 2G9HD 3B77A 3OWEB 3QJZA 1KH0A 1K50A 4US9A 1IP9A 2FAZA 1XX0A 1RM6C 1EAZA 2RPQA 1ISNA 3VVWB 1K51A 1JDEA 3GE3C 1L2NA 4H8SA 4MH0E 4NAMA 1L6UA 1LGRA 1WR6E 1TYGB 5TSSA 3HVDA 2LFIA 5D3YA 3VH4B 4BKSD 2LI5A 1VLBA 1FM0D 2J4XA 4HAYB 1KLVA 1J0WA 4JPSA 2BYTA 2WXIA 3TMPB 1TS5A 2KN5A 2KJ6A 1F9JA 5C23A 3PHXB 5DIFB 1FHOA 3MFGA 2L7RA 1XLQA 4NAWB 3PEGA 5MPOA 4Q2JA 2I5FA 2Z8LA 4GGQA 5D3DA 2J0JA 1SE9A 1D5ZC 1VZ8A 2Y3AA 3ODXA 1T5XD 4G11A 4GOUA 2CU1A 2DWQA 4W9LA 5AZHA 2FNJB 1V1OA 4E71A 3N1ZC 4I6PA 3AB5A 3VRAB 3U30A 4PT5A 1LB1A 1Z87A 3DXCA 2ZCBA 1KTKA 2L00B 1C9FA 1D5XC 1V86A 1FXAA 2NBVA 5G5GA 1V97A 3AEAB 2E6XA 1Q5WB 2C5LC 2RPVA 4NPNA 2KLCA 3TJPA 5E6JA 3V60A 4GDLB 4XZ4A 2MBOA 2M1MA 2LKOA 4JKBA 1GJZA 1FGYA 3TEZA 3ML4A 3NJTA 3ZXVA 3DWMA 2B76B 5CX3A 3PREA 3HW2B 4EE2A 2LVPA 4C7YA 4DQOC 1ZW7A 3SD5A 4BKTA 2Z59A 1WVHA 1I42A 1ZE3D 1YX5B 1P7FA 2L0FA 1WMHB 1V5TA 2PEAA 1QOBA 3PRMB 2M38A 1NYRA 2DYBA 1RRPB 4ZRKA 2MQJA 2IDYA 3AV8A 2R82A 4DHZE 1N6ZA 4OW0A 4C4VB 5AZFA 1N61A 2BGFA 3QC8B 2KDBA 4K1RB 4IDIA 5LG4B 4M8MA 2RGNB 2MP2A 4HPPA 3KUCB 4BKGA 2PPHA 3M63B 2Z4DA 4DHZB 1KOTA 1DDMA 4WQOB 1GC6A 2M0XA 4MGIE 2BCJA 3N20C 4L1BA 1NYQA 4KZ0A 4HWIB 2R0DA 4DBBA 4BKSA 2KHWB 3AU4A 1FRDA 4C56C 2D9WA 1JALA 3W1SC 3E9PA 2G4DB 4IFSA 2QMTA 1DGJA 2G1EA 3AE3B 4LNFA 4CQNA 1Z5SB 4OZBA 2P0FA 1HA5A 3ZYYX 4D6WA 2GI9A 2NPTA 2INNE 3DOWA 1XKEA 4XDDA 1NU2A 2AQ2B 4IW0A 5HE3A 4MSMB 2ZNVC 3PRZA 4IWOA 4RGOS 2W2WA 2WXOA 2DZJA 2VZKB 2N23A 1KI1B 2LASA 3VR8B 1KLUD 2DYOA 1EWCA 3ZRFA 3MHSD 1YX6B 4A90A 1YN4A 5E6NA 3BK2A 1YMHE 4KDLB 3DXDA 1DOXA 3KUDB 4L2YA 3BY4B 2D11A 1UELA 3LDZE 2JZPA 5L81A 4RGTA 4FJVB 4WAFA 2G3QB 1XCGA 1E10A 2KC2A 1TIFA 3DBRB 5C5BA 2V3NA 2IO2B 3NZSA 3CMMB 4JKCA 2WXKA 3MC8A 4WJ7A 2IY0B 2Z0QA 3OJ4B 3VDZA 3RN9C 2HTHB 3U52E 1L7YA 4FBJB 1UUPA 2IYDB 3EGRA 1E7PB 3ETRA 2W82A 1FOEA 1U27A 1XD4A 2Z14A 2K22A 2DHIA 2LRUA 2WU5B 1D5MC 4BBNC 1GNUA 4MELA 2N9EB 2NCNA 1VCBA 3SO6A 2IY1B 2XK5B 2ZCCA 3RCZA 2DHJA 2GUMA 4RF1A 4HJKA 1ACCA 2DLWA 3FC4A 3D8FA 2VZKD 2L52A 1MIXA 4FA6A 4B0MA 4B95A 2RUKB 2KDMA 4FJYA 2MWNB 1WE7A 3SHQA 1BAKA 3V3XA 2L2IA 4O1NA 1QOGA 1TY0A 4TUUA 4XGAB 3R8BA 1ZUD2 2I5CA 2COCA 3ZJVA 3F0WA 2DBYA 3GZNI 3UF8A 2YT2A 2WS3B 3CF6E 2J59M 2EJ8A 3Q3OC 1S3SG 1JROA 1XLOA 2WDVB 5L83A 1E90A 5KHQA 1SIFA 3NS1A 4GDLA 2HD5B 5H92C 1IPGA 2DHZA 1A70A 1WM2A 4NSWA 2BYVE 4PQ0A 3FEHA 1XT9B 1TKEA 5JVLA 4MJSA 4TQ0A 3NG0A 3NY5A 1PYWD 3U7ZA 4MDKE 2LJIA 4M01A 1PFJA 3TW1A 3Q3NC 2WXJA 2KFJA 3QWMA 1FFUA 2H7EA 2LJ5A 2AX5A 1SB3C 3GB1A 4JGHB 1Y56A 1XLPA 1X1FA 2LG1A 5D6JB 4S17A 1I7AA 2KX0A 4LDTB 4NY0A 4E74A 4I6LB 1CJEA 2O6VB 5FK9C 1WIAA 2CB8A 3R7RA 5J3QA 2KMMA 2AEHA 5FR3A 4KIKA 4EZJA 3DHHC 4P7IA 5AUIA 4WWMA 3N3KB 1NTVA 1C78A 3WALA 4C00A 3P4PB 2LVQA 4K7UA 2BVCA 4AJWA 5H8YE 1VZ7A 2GJYA 5IRSA 3ENBA 3MTNB 3MC0B 5E6PA 3Q69A 2JQRB 1R4MI 2LD9A 4HB2B 2JWZA 3UZTA 3AN1A 1UNRA 1JW9D 2KANA 2IFSA 4GB9A 4A8XC 2MCNB 1R4NB 4F1SA 1ACAA 1DYQA 3CIKA 3K9OB 3ULCA 3A9KA 5LOPB 1T3QA 3N1YC 4IWPA 5BMIA 1XO3A 4YTMB 3E9SA 3EC8A 3FLVA 2D9ZA 5DPTA 2KQ7A 2ROZB 4JK9A 4HRSA 3ZGZA 4A6QA 3U7DA 3HVZA 3AE4B 2DTCA 3T3NA 2NMBA 4GOCA 2VRWB 3QX1A 4PS7A 1FXTB 2N7JA 4ZRPA 3RPFC 3VR9B 4LDTD 3Q2AC 3RT3B 4BOSC 2L05A 3PPAA 4GLSC 4ITKA 2O6VD 1MKEA 2RNRB 4ZYSA 2KJHB 2COAA 1WRDB 3U8ZA 4CSQA 2K8HA 4DHJB 1D3ZA 1C76A 2L76A 1C4PA 1P6SA 1I4QA 1WJUA 2HTHA 4K81A 1L5PA 2GBJA 3AE1B 2KC1A 4BAXA 4AP4C 5IA7A 1V89A 4RNAA 2LGYA 4LJPB 4ZRQA 5TR5A 4AUQC 4HLEA 4PS3A 4CHKA 1K5DB 2OJWA 1LXDA 5FI1A 1T0SC 2JU6X 4XE0A 3T9LA 3R66C 1E8ZA 1E5WA 4W9JA 2XK5A 1PMSA 2ZNVB 3SFEB 4AOFA 1WYWB 2MRPA 1P9DU 4UDUC 3AEBB 4JLCA 1IUEA 1T0QC 4DIXA 4JQWC 4RGNA 1FFVA 3O13A 3M62B 1NENB 2V9HA 2EC1A 5CHFA 1D6EC 3DCXA 1RYJA 2MDXA 3UIOB 2QEJC 2YS1A 5G2NA 3NZUA 2DFKA 2RRFA 4R3DA 1EF5A 3I3TB 3PZ7A 4WWPA 3QIJA 1PGXA 3VXWA 4FULA 1QOAA 4QJ3B 2DYNA 4M0WB 2WXRA 4WWOA 3BVZA 2GBNA 3ZW3A 2A5UA 2UZSA 1C1YB 2G4SA 1IBXB 3BK1A 1T0RC 4HB0B 2MJDA 2NR2A 3KRWA 2QC8A 3IHPC 2YEPB 1K52A 3AI5A 1PGAA 1XR0B 2Y5PA 2HTME 3DBSA 5C2TB 1TXDA 2W3RA 3NVZA 4G50A 2LUEA 2LXCA 5C79A 4GXBA 3DBLB 4DWFA 3EFUA 4HHVA 2L8JA 2MEKA 4JKFA 2H89B 3ZNID 1I4HA 3SDLC 2WX0A 4KKIA 4YSYB 2ZEQA 2DHKA 3A4RA 4JKGB 2I2YA 4MK0A 3V6CB 3SUZA 3AH7A 1EVHA 2D9YA 2RD0A 3BJIA 3V05A 3D32A 2KWCA 1B1ZA 2L0TA 1T6BX 1OQQA 2BS4B 4W9GA 2RSUA 1C79A 2OQBA 1P3QU 4RF0A 3AULA 4YTNB 1ET9A 5C1ZA 1IGDA 4KHBB 3AEGB 3IFWB 1DOIA 1PLSA 1WR1A 3UQAA 3AXCA 1M7EA 2ZKMX 3MPXA 2LGSA 3UIPB 3H7PB 1D4BA 4GDKA 2L3ZA 3SU8X 5G5HA 1TKYA 4FN2A 4YXDB 1KF6B 1J0GA 1WGGA 4Z2MB 4C0AA 3KYCD 1WG7A 3KZ1A 2FUG1 3IT6B 1AWDA 3OJ3A 2X0SA 1TS3A 5JHBA 4FXCA 1QC6A 4M02A 4JWUC 5KQ1A 1HQRD 3WAPA 2KFKB 3L13A 2R2OA 2FDQA 1K53A 1YQ3B 3BWUD 4IOIE 1XD3B 2KNBA 2K6DB 2MWSB 2JRHA 1U4AA 1SBBB 4DX8A 1K5GB 3QWZB 1UEFA 4OT1A 2MSED 3A9JB 3CSFA 5D7GA 4GNKB 3Q6BA 3VAWA 4MM3A 2KT7A 2JT4B 3G9WA 3B9JA 4P16A 4IG7B 4ANXA 1DYNA 3Q8EA 3APDA 1ET6A 2UWQA 5CLQB 3A4SC 1LO5D 3C8YA 2LUMA 3ZJTA 1WZ0A 4GPTB 5J2RA 2DX5A 2JPHA 2DYMA 3ZRCA 1GOZA 4XWWA 4ZOHC 2DZIA 1CZPA 1P1AA 2CS4A 3VTWA 1LW3A 2IJ0A 2IPKD 5BYRA 2R2QA 4I6NB 4GN1A 1MVKA 1V5UA 4B6HA 1YJ1A 3CXBB 2IYBA 2D9XA 2QJLA 4XWXA 4ANVA 1SGHA 1SEBD 1BTKA 2JX5A 3L0WB 2MKRA 4ACFA 1E9MA 1WJ4A 1P0RA 1V80A 4EKUA 5EE3A 3JSVB 2WXNA 5HE1A 2WNMA 2J53A 3LB8C 2D3BA 2K6QA 4OVVA 4OVZA 2ICIA 3PV1A 3ODWA 4KSKC 2WXGA 4HCNB 1VBHA 4MGKE 4GU2A 1FGZA 5D3VA 2NS5A 2CU3A 3WIMA 2I38A 2J7QB 2N4FA 1AQCA 4JKEA 2PLPA 2LYDA 3RFZB 2B3AA 4WH4A 1WXVA 2YLMA 3P4SB 1C4CA 4IC7B 2K3UA 1WI0A 3SYXA 1RLFA 1J8CA 1U2BA 1JWMD 1XEEA 2H88B 4RM9A 5EE9A 1FMAD 2NTSA 1HB8A 1NTIA 2N9KA 4II2B 2RGFA 1T0YA 1KZ7A 3VFKA 1EO6A 2PIAA 4OVUA 4WJNA 1YJJA 1FIQA 5I2MA 2KR0A 3DBRI 2DKPA 2R61A 1U5EA 1E8XA 3ZXRA 3NWAA 2D3AA 2V3PA 3P6AA 1ZOYB 2WXHA 4BFRA 2JXTA 4AWJA 2DZKA 2V0GA 3DVNV 1JRPA 1K8RB 2JSVX 3KW5B 1ZM0A 3APCA 1FRRA 5EE0A 2BF8B 2PKOA 3FKYA 2KMAA 4YTPB 2LXAA 4A20A 1G6JA 1JQ4A 4KAXB 4MT5A 1Q1OA 4JKGA 4FLHA 4KSLC 3PZDA 4IWQA 2AL3A 2MA9B 2KUQA 4ICUA 2JUOA 5DHFB 1R7SA 3UINB 2CRFA 3ML8A 3NOBA 1WZ3A 3SEBA 1TGZB 1UD7A 3KUZA 3JYUA 1GB4A 1OQYA 2O2VA 4KHBA 3PVWA 4ZDVA 2K2JA 5DPSA 3GE8C 2YEPF 1TBEA 3Q3JA 4WJOA 3T3OA 2DAFA 5CTRC 1SE2A 3E56A 1HBKA 2C7HA 5LLIA 1LM8B 3JW0X 3H7PA 4RM8A 1KC7A 1M94A 2MBBB 3DHIC 2LMCA 4KGRA 2KLGA 2GS0A 2W2XC 4MEMA 2GCLA 2IO0B 1P7EA 4US8A 3ALBA 1VBGA 3RZFA 3FSSA 2KO3A 3TO1A 2CJNA 4ZYNA 4LCDE 1WGRA 4L6EA 1WXQA 3AE7B 3R3MA 1FNVA 2RLOA 3RYTA 2JP2A 4EJNA 2IZVB 2ACZB 4HAXB 3ZDMC 2VRRB 1XQQA 2CHWA 1ZYIA 3S2AA 1XODA 1JWUD 5D94A 1EF1A 1I4GA 1N63A 1GAQB 1GB1A 3WYFB 3WAMA 3W5VB 4Z2NA 4HB3B 1TY2A 3R2IA 1A5RA 1Z2MA 4NQLB 4M8NA 1SJHD 3NUHB 3OANA 1RRBA 3VTVA 5DPRA 2RDBC 4HK2A 2CQUA 3AJ4A 4NAWA 3TCAA 1VJKA 4K7WA 2QILA 3PLUA 1ZVRA 3AE9B 2PVGC 4DK5A 2ZPNA 1WXSA 1YN3A 1NVLA 3H7SA 3T8MA 5J17A 4ANWA 3E66A 1J7BA 3IT4B 4QJ4B 4XC2A 1DDWA 1OEYA 4J6IA 2V76A 2LBBA 2IGHA 1ZC3B 4IOYX 4KX6B 5IP4D 3SBTA 2DKQA 4KHAA 2OOBB 2KCJA 1EWYC 2IGDA 2RSGA 2COFA 4DXGA 2JRIB 3HSAA 5DPWA 1CMXB 3RNEC 1OY2A 3U2SC 1QQGA 1R4NI 3L17A 3F5RA 3DQVA 5BMHA 1FD6A 3RZWC 3V61A 1VR9A 1SE4A 1MIZB 2K49A 3BIID 1Y19B 3IAS1 2DX1A 2LULA 1ZDVA 3B2FA 3ZVVA 1MAIA 4HKZE 2GMIC 2GBMA 4XX5A 3L10B 1TS4A 4HROA 1XCTL 1Q67A 2W54A 1I4RA 3QK0A 4YWGG 3A1QB 2PMVA 2VH1A 1NVID 1WMHA 4WAAA 1W1GA 4ICVA 5HKHA 2WHIA 4P1CC 3C0RB 3RMKC 4A9AA 1XF5L 5JHAA 2WYQA 4A6HA 5C6RA 2CJOA 4MY6A 2XN9C 4HATB 4C4VA 4A3PA 2MX2A 4NJ6A 3EA6A 3PLVA 3KRXA 5FKAC 1J19A 1N5WA 1CQVA 4EFOA
chains in the Genus database with same CATH topology
3ZVRA 1I35A 2Y8GA 1WM3A 2P0HA 2REXA 4WSFA 1WGUA 5JLJB 4DDGD 2KDEB 4HPLB 4EEWA 3B0AA 2D9VA 1AARA 3APFA 1E8WA 1Q0WB 3HM3A 3PTFC 4K2OA 5EDSA 2JF5A 2M4NA 3EHVA 3KY9A 4GSWA 4BVUC 2LGDA 1WJNA 2KJRA 1NTYA 1NDDA 3R7QA 5AEKB 5JP4A 2BWES 5L95C 3RULA 2FCSA 3IBEA 4HVBA 5LXHA 2Z0PA 3TFMA 2KTFA 2RR9A 3PGEA 1ZSQA 2NBUA 3ML9A 3SNHA 3P2BA 2WX1A 5IJMA 2XBBC 1UZXB 1B55A 2Q13A 1X1MA 4MSQB 4NQKE 5C16A 2OJRA 2DAJA 5KHOA 4NNJB 1FAOA 3KSYA 5CHVC 4ILJA 2CY4A 3VH3B 2PE6B 2M14A 5J3TA 1FHXA 5KCVA 1P5TA 2N1VA 3PVUA 2CODA 5IAAC 4IM2A 4GMVA 2KD0A 2MLBA 2ASQA 2JY6A 4W9IA 4WWNA 2UZRA 1OGWA 4EUTA 4HB4B 2KQSA 4B9KA 2A4ZA 1WJ1A 2GBKA 2K39A 1V49A 1WXMA 2NBVB 3RD2A 1WJMA 3A98B 2ELBA 4DHJD 2FIFA 5BO4B 1DBHA 1MK7B 1S1QB 1OMWA 1ZKHA 2I1KA 3DPDA 1DROA 2D3GA 3DVGX 4KV2A 1IYFA 4ZRJA 3ZNHB 4HDOA 4MGZE 3ZTDA 1GGOA 3V62A 3L54A 5DH9B 4A3OA 4N9F4 2WWZA 3RUIB 2YVCA 1UBIA 2ROVA 5D27A 4A6FB 3H9DA 4W9KA 2Y7BA 1OTRB 1I2HA 2ZPYA 3D8EA 3NSUA 2P8VA 2KWVB 1X05A 2MP2B 2FCQA 1P98A 4CHMA 2O6VA 4FADA 2MBQA 4EZLA 3HHMA 1UBQA 2GBRA 3DVGY 1WJ6A 2KZRA 4JK7A 3ODOA 1V6EA 1WXAA 1LQBA 2D07B 2BKFA 3ZDTA 2NPTB 5D3XA 2ZJDA 3OAWA 1V5MA 3QA8A 2V3SA 1RAXA 1MK9B 4FJZA 5HE0A 2J0MA 3SV1A 1RJ2A 4BBKA 2JZ3B 1WX9A 2YRYA 2N1WA 2RQ1A 4II3B 2YS5A 3HM6X 3QCAA 1V61A 4GMXB 3VIAA 2KTRB 4HAUB 4ILHA 3TIXA 3MDBC 4RMAA 5EFXA 1OEYJ 3WA0A 1GG3A 3DDCB 2KGXB 5C5BB 4W9CA 2CY5A 3PVLA 2Z0OA 3HK0A 1N3HA 2COPA 3ULBA 1LFDA 2YS3A 3PT2B 3A8PA 2LOXA 2K2UA 3W1SA 4EZKA 2BYFA 5DCNA 5AZGA 2GOWA 3QHTA 3O96A 1WGQA 3T06A 2AYOB 4PYUA 2EMSA 2M8SA 3DCGA 2W9NA 4EOYA 4D0NB 4BOZB 2Y8FA 4F8CB 1SHCA 1QZEA 3P7ZA 3SBGA 1U29A 2Y5BB 2VSZA 2WH5A 5FI0A 1BTNA 1TQZA 2K8CA 1EUVB 3L08A 2VKIA 3A33B 4Y94A 3Q3FA 1DDVA 2KK8A 5G55A 1PQSA 2ZVOA 2IO3B 2IBIB 1TZ1A 2JZZA 1Y5OA 4MJSB 1JRUA 2MBEA 2ABDA 3ECIA 4A6KA 2LZ6A 4MGYE 3ZTCA 3VHTC 2XQNM 2NBWB 3M3JA 4JKDA 4A6FA 4F7HA 1WGDA 2EKEC 2KWUB 4KZCA 3VTUA 4KHOA 1UPRA 4TKNA 2PZ1A 2YT1A 1AWEA 1WX7A 2QKMA 1NI2A 2FCNA 4CHJA 2N9PC 2Z0DB 2FCMA 4TYZA 4KIKB 4IUMB 3BINA 1UGMA 4X57B 3QBVB 5CHWA 3QQ8B 3M1IB 2CAYA 3L16A 4YL8A 1HE8A 3H6NA 5HE2A 3E9LA 4TV3A 2V1YA 4BBNF 3HIZA 2R09A 2YSZA 3X23A 5J3YA 4IAPA 3N30A 3PS6A 4DDID 2DENB 1WGHA 4HXDA 2HE7A 3M95A 2N7DA 1YQBA 5JHHA 2KDFB 1BT0A 5CLLB 1U5GA 2KDIA 4ILGB 3A9KB 2IO1B 2KFKA 4EMOA 2BWFA 4GZUA 1TTNA 2UYZB 2G45B 2X18A 1OQNA 1GC7A 2CKHB 5DHAB 3A9JA 2YF0A 2KTRA 3ZIMA 3H1UA 1ST7A 3HQCA 1WF9A 2NZ8B 1EGXA 5D3WA 1WFYA 4TQ1A 4DX90 2MBHA 2BKRB 3IVFA 4ASWC 2UVMA 2JXXA 2KMCA 5LONB 4AJYB 5GMVA 2WDTB 1YIWA 4CYEA 3EPYA 3LJUX 2J0KA 2D10A 3JSVA 1KJTA 3ZNGC 2LWPA 1ZC4B 2DYQA 2KVRA 3RCPA 5DI9B 2FIDA 5J18A 3PHWB 1RFAA 5JHGA 1E7VA 5GOWB 1U5FA 3ZKJC 4W9HA 1MPHA 3AU5A 4URKA 1W1DA 3N7CA 1M7RA 2DZMA 3VUXA 2CHZA 3PSCA 2C7NB 3PP2A 2AWTA 2EMTA 3JVZX 3PSEB 4WVFB 3GYPA 1Y8RC 1H4RA 4CO7A 2BPSA 4ZRIA 3QAQA 1WE6A 3MJWA 2KX3A 3VUWA 2E2XA 3DVNU 3NHEB 1E7UA 4JKAA 2CR5A 3KYDD 2QHOA 4F7GA 4WJPA 4JL9A 2Z0EB 2QKLA 1V81A 2DIKA 3V6EB 4NJ7A 2FJ9A 1BWNA 3TBLD 2ELAA 3IG3A 4W9FA 3O65B 1UPQA 3EECA 4W9DA 3GYOA 4GDKB 2L1CA 1X86A 3ONSA 1X11A 2LVOA 5LXIB 4KVGB 1V5OA 4IM3A 3UGBB 4YONA 2MFQA 3VQIA 4FHKA 2KKCA 3ENEA 1KBLA 2PE9A 3WAOA 2PJHA 5E6OA 1FHWA 3DBLI 1HB6A 2C9WB 4FHJA 3QARA 1KZGA 3A8QA 4JKHA 1H8CA 5JH5C 4GIVA 2XEWA 1UH6A 3PG7A 4F7UP 4LJOB 2KUPA 4JK8A 2V4LA 2FJLA 2DX5B 3TL5A 2AL6A 3E9OA 3KH0A 1YD8U 3CSTA 1VD2A 2I1JA 4HDQA 1C3TA 1V9JA 4K7SA 2LGXA 2M17A 3LJ3A 1H10A 2MW5A 5FR6A 2ZVNA 2H7DA 2C7MB 5D2MB 2BYEA 2CHXA 2DA0A 4F7ZA 5KQ4A 1X1GA 4HAVB 2G35A 3B1LX 4B6WA 3OLMD 4HAZB 2HJ8A 2LOZA 4JIOU 4ANUA 2D2QA 2JVCA 2K25A 2HRJA 4KDIC 1TJ6A 2N9XA 3VOQA 1V2YA 3PRPB 2RVBB 4PYZA 2C60A 3ZUNA 1IRSA 2Z59B 3UQBA 3A1QA 4HCPB 4HPMB 4A5KA 3V5WA 3GOEA 3K9PB 1U5DA 3KVFB 1ZGUB 3DXEA 3X0WA 3ZNZB 3N32A 2W2XD 2N0YA 3FP5A 1WH3A 2K8BA 1WX8A 3B08A 1DIKA 1GUAB 3VUYA 4PNKA 1UNQA 1V88A 4PS8A 3FM8C 2K00A 2P0DA 4MT7A 2FUHB 2YT0A 3D8DA 2KXJA 4W9EA 1KM7A 1W1HA 1E8YA 3TVVA 2ZZPB 4K17A 1WY8A 1WGYA 2O2VB 4E3CA 3W1YA 3ZLZA 4HAWB 4IM0A 4G3XB 2D4QA 1MG8A 3WANA 3DBHI 3ZO5B 2LRWA 1NBFC 1FB8A 2GCJA 2K1FA 1V5PA 2N7EA 4WJQA 5JZEB 1WI1A 2OTXA 4K2PA 1UNPA 3NS8A 2KOXA 4DBGA 1P3RA 4G0NB 2ADZA 2NVUI 2DN6A 4DXAB 3QJZA 1IP9A 2FAZA 1XX0A 1EAZA 2RPQA 1ISNA 3VVWB 1JDEA 1L2NA 4H8SA 4MH0E 1WR6E 5D3YA 3VH4B 4BKSD 2LI5A 4HAYB 1KLVA 1J0WA 3TMPB 2KN5A 2KJ6A 1F9JA 5C23A 3PHXB 5DIFB 1FHOA 2L7RA 4NAWB 3PEGA 2I5FA 4GGQA 2J0JA 1SE9A 4G11A 3ODXA 2CU1A 4W9LA 5AZHA 2FNJB 4E71A 4I6PA 3U30A 1LB1A 1Z87A 3DXCA 2ZCBA 2L00B 1V86A 1Q5WB 2C5LC 3TJPA 4NPNA 2KLCA 3V60A 4GDLB 4XZ4A 2MBOA 2M1MA 2LKOA 4JKBA 1GJZA 1FGYA 3ML4A 5CX3A 3PREA 3HW2B 2LVPA 1ZW7A 3SD5A 4BKTA 1WVHA 1I42A 1YX5B 2L0FA 1WMHB 1V5TA 2PEAA 3PRMB 2M38A 2DYBA 1RRPB 4ZRKA 2MQJA 2R82A 4DHZE 5AZFA 2BGFA 3QC8B 2KDBA 4K1RB 4M8MA 2RGNB 2MP2A 3KUCB 4BKGA 2PPHA 3M63B 4DHZB 1KOTA 1DDMA 4WQOB 1GC6A 2M0XA 4MGIE 2BCJA 4KZ0A 4HWIB 2R0DA 4DBBA 4BKSA 2KHWB 3AU4A 2D9WA 3W1SC 3E9PA 2G4DB 4IFSA 1Z5SB 2P0FA 2NPTA 3DOWA 1XKEA 1NU2A 4IW0A 5HE3A 4MSMB 2ZNVC 3PRZA 4IWOA 2W2WA 2DZJA 2N23A 1KI1B 2LASA 2DYOA 3ZRFA 3MHSD 1YX6B 5E6NA 4KDLB 3DXDA 3KUDB 3BY4B 2D11A 1UELA 3LDZE 5L81A 4FJVB 2G3QB 1XCGA 2KC2A 5C5BA 2IO2B 3NZSA 3CMMB 4JKCA 4WJ7A 2IY0B 2Z0QA 3OJ4B 3VDZA 2HTHB 1L7YA 4FBJB 2IYDB 1FOEA 1U27A 1XD4A 2DHIA 2LRUA 4BBNC 1GNUA 4MELA 2N9EB 2NCNA 1VCBA 3SO6A 2IY1B 2XK5B 2ZCCA 3RCZA 2DHJA 4HJKA 2DLWA 3D8FA 1MIXA 4FA6A 4B95A 2RUKB 4FJYA 2MWNB 1WE7A 3SHQA 1BAKA 2L2IA 4TUUA 2I5CA 2COCA 3F0WA 3GZNI 3UF8A 3CF6E 2J59M 2EJ8A 1S3SG 5L83A 1E90A 5KHQA 1SIFA 4GDLA 2HD5B 1IPGA 2DHZA 1WM2A 4NSWA 2BYVE 4PQ0A 3FEHA 1XT9B 5JVLA 4MJSA 4TQ0A 3NY5A 4MDKE 1PFJA 3TW1A 2KFJA 3QWMA 2H7EA 2LJ5A 4JGHB 1X1FA 2LG1A 5D6JB 1I7AA 2KX0A 4LDTB 4NY0A 4E74A 4I6LB 2O6VB 1WIAA 2CB8A 3R7RA 5J3QA 2AEHA 4KIKA 4EZJA 4P7IA 3N3KB 1NTVA 3WALA 2LVQA 4K7UA 4AJWA 2GJYA 3MTNB 3ENBA 5E6PA 1R4MI 2LD9A 4HB2B 2JWZA 3UZTA 1UNRA 2KANA 2IFSA 4GB9A 2MCNB 4F1SA 1ACAA 3CIKA 3K9OB 3ULCA 3A9KA 5LOPB 4IWPA 3EC8A 3FLVA 2D9ZA 5DPTA 2KQ7A 2ROZB 4JK9A 3U7DA 2DTCA 2NMBA 4GOCA 4PS7A 2VRWB 3QX1A 1FXTB 3RT3B 4LDTD 4BOSC 2L05A 3PPAA 2O6VD 1MKEA 2RNRB 2KJHB 2COAA 1WRDB 3U8ZA 2K8HA 4DHJB 1D3ZA 2L76A 1P6SA 1WJUA 2HTHA 4K81A 2GBJA 2KC1A 4AP4C 5IA7A 1V89A 2LGYA 4LJPB 5TR5A 4AUQC 4HLEA 4PS3A 4CHKA 1K5DB 1LXDA 5FI1A 3T9LA 3R66C 1E8ZA 1E5WA 4W9JA 2XK5A 1PMSA 2ZNVB 4AOFA 1WYWB 2MRPA 1P9DU 4JLCA 4JQWC 3M62B 2EC1A 5CHFA 2MDXA 3UIOB 2YS1A 5G2NA 3NZUA 2DFKA 1EF5A 3I3TB 4WWPA 3QIJA 3VXWA 4FULA 2DYNA 4M0WB 4WWOA 2GBNA 3ZW3A 2A5UA 2UZSA 1C1YB 2G4SA 4HB0B 2NR2A 3IHPC 3KRWA 3AI5A 1XR0B 3DBSA 1TXDA 4G50A 2LUEA 2LXCA 5C79A 4GXBA 4DWFA 3EFUA 4HHVA 2L8JA 4JKFA 3ZNID 3SDLC 2WX0A 2ZEQA 2DHKA 3A4RA 4JKGB 4MK0A 3V6CB 3SUZA 1EVHA 2D9YA 2RD0A 3BJIA 3D32A 2KWCA 2L0TA 4W9GA 2RSUA 2OQBA 1P3QU 3AULA 5C1ZA 4KHBB 3IFWB 1PLSA 1WR1A 3UQAA 3AXCA 1M7EA 3MPXA 3UIPB 3H7PB 4GDKA 2L3ZA 3SU8X 4FN2A 1J0GA 1WGGA 4Z2MB 4C0AA 3KYCD 1WG7A 3KZ1A 3OJ3A 2X0SA 5JHBA 1QC6A 5KQ1A 3WAPA 2KFKB 3L13A 2R2OA 2FDQA 1XD3B 2KNBA 2K6DB 2MWSB 2JRHA 1U4AA 4DX8A 1K5GB 3QWZB 1UEFA 2MSED 3A9JB 3CSFA 5D7GA 3VAWA 4MM3A 2JT4B 3G9WA 4IG7B 4ANXA 1DYNA 3APDA 2UWQA 5CLQB 3A4SC 1WZ0A 4GPTB 5J2RA 2DX5A 2JPHA 2DYMA 3ZRCA 2DZIA 1P1AA 2CS4A 3VTWA 1LW3A 2R2QA 4I6NB 4GN1A 1V5UA 4B6HA 1YJ1A 3CXBB 2IYBA 2D9XA 4XWXA 4ANVA 1SGHA 1BTKA 3L0WB 2MKRA 1WJ4A 1P0RA 1V80A 4EKUA 3JSVB 5HE1A 2K6QA 4OVVA 3PV1A 3ODWA 4KSKC 4HCNB 1VBHA 4MGKE 4GU2A 1FGZA 5D3VA 2NS5A 3WIMA 2J7QB 2N4FA 1AQCA 4JKEA 2LYDA 2B3AA 1WXVA 2YLMA 4IC7B 1WI0A 3SYXA 1RLFA 1J8CA 1U2BA 4RM9A 1HB8A 1NTIA 4II2B 2RGFA 1T0YA 1KZ7A 3VFKA 1EO6A 4OVUA 4WJNA 3DBRI 2DKPA 1U5EA 1E8XA 3P6AA 4BFRA 4AWJA 2DZKA 3DVNV 1K8RB 3KW5B 1ZM0A 3APCA 2BF8B 2KMAA 2LXAA 4A20A 1G6JA 4KAXB 1Q1OA 4JKGA 4FLHA 4KSLC 3PZDA 4IWQA 2AL3A 2MA9B 4ICUA 2JUOA 5DHFB 3UINB 2CRFA 3ML8A 3NOBA 1WZ3A 1TGZB 1UD7A 3KUZA 3JYUA 1OQYA 2O2VA 3PVWA 4ZDVA 2K2JA 5DPSA 4WJOA 1TBEA 3Q3JA 2DAFA 5CTRC 1HBKA 2C7HA 5LLIA 1LM8B 3JW0X 3H7PA 4RM8A 1KC7A 1M94A 2MBBB 2KLGA 2GS0A 2W2XC 4MEMA 2GCLA 2IO0B 3ALBA 1VBGA 3RZFA 3FSSA 2KO3A 3TO1A 4ZYNA 4LCDE 1WGRA 4L6EA 3R3MA 2RLOA 3RYTA 2JP2A 4EJNA 2IZVB 3ZDMC 4HAXB 2VRRB 1XQQA 2CHWA 3S2AA 1XODA 5D94A 1EF1A 3WYFB 3WAMA 4Z2NA 4HB3B 1A5RA 1Z2MA 4NQLB 4M8NA 3OANA 1RRBA 3VTVA 5DPRA 4HK2A 2CQUA 3AJ4A 4NAWA 3TCAA 4K7WA 3PLUA 1ZVRA 4DK5A 2ZPNA 1WXSA 1NVLA 3H7SA 3T8MA 5J17A 4ANWA 3E66A 4XC2A 1DDWA 1OEYA 4J6IA 2V76A 2LBBA 1ZC3B 4IOYX 3SBTA 2DKQA 4KHAA 2OOBB 2KCJA 2RSGA 2COFA 2JRIB 5DPWA 1CMXB 1OY2A 1QQGA 1R4NI 3L17A 3F5RA 3DQVA 3RZWC 3V61A 1MIZB 1Y19B 2DX1A 2LULA 3ZVVA 1MAIA 2GMIC 2GBMA 4XX5A 3L10B 1Q67A 3QK0A 3A1QB 1WMHA 4WAAA 1W1GA 4ICVA 5HKHA 3C0RB 5JHAA 2WYQA 4A6HA 5C6RA 4MY6A 4HATB 4A3PA 2MX2A 4NJ6A 3PLVA 3KRXA 1J19A 4EFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  1I35 A;  2Y8G A;  1WM3 A;  2P0H A;  2REX A;  4WSF A;  1WGU A;  5JLJ B;  4DDG D;  2KDE B;  4HPL B;  4EEW A;  3B0A A;  2D9V A;  1AAR A;  3APF A;  1E8W A;  1Q0W B;  3HM3 A;  3PTF C;  4K2O A;  5EDS A;  2JF5 A;  2M4N A;  3EHV A;  3KY9 A;  4GSW A;  4BVU C;  2LGD A;  1WJN A;  2KJR A;  1NTY A;  1NDD A;  3R7Q A;  5AEK B;  5JP4 A;  2BWE S;  5L95 C;  3RUL A;  2FCS A;  3IBE A;  4HVB A;  5LXH A;  2Z0P A;  3TFM A;  2KTF A;  2RR9 A;  3PGE A;  1ZSQ A;  2NBU A;  3ML9 A;  3SNH A;  3P2B A;  2WX1 A;  5IJM A;  2XBB C;  1UZX B;  1B55 A;  2Q13 A;  1X1M A;  4MSQ B;  4NQK E;  5C16 A;  2OJR A;  2DAJ A;  5KHO A;  4NNJ B;  1FAO A;  3KSY A;  5CHV C;  2CY4 A;  3VH3 B;  2PE6 B;  2M14 A;  5J3T A;  1FHX A;  5KCV A;  1P5T A;  2N1V A;  3PVU A;  2COD A;  5IAA C;  4IM2 A;  4GMV A;  2KD0 A;  2MLB A;  2ASQ A;  2JY6 A;  4W9I A;  4WWN A;  2UZR A;  1OGW A;  4EUT A;  4HB4 B;  2KQS A;  4B9K A;  2A4Z A;  1WJ1 A;  2GBK A;  2K39 A;  1V49 A;  1WXM A;  2NBV B;  3RD2 A;  1WJM A;  3A98 B;  2ELB A;  4DHJ D;  2FIF A;  5BO4 B;  1DBH A;  1MK7 B;  1S1Q B;  1OMW A;  1ZKH A;  2I1K A;  3DPD A;  1DRO A;  2D3G A;  3DVG X;  4KV2 A;  1IYF A;  4ZRJ A;  3ZNH B;  4HDO A;  4MGZ E;  3ZTD A;  3V62 A;  3L54 A;  5DH9 B;  4A3O A;  4N9F 4;  2WWZ A;  3RUI B;  2YVC A;  1UBI A;  2ROV A;  5D27 A;  4A6F B;  3H9D A;  4W9K A;  2Y7B A;  1OTR B;  1I2H A;  2ZPY A;  3D8E A;  3NSU A;  2P8V A;  2KWV B;  1X05 A;  2MP2 B;  2FCQ A;  1P98 A;  4CHM A;  2O6V A;  4FAD A;  2MBQ A;  4EZL A;  3HHM A;  1UBQ A;  2GBR A;  3DVG Y;  1WJ6 A;  2KZR A;  3ODO A;  1V6E A;  1WXA A;  1LQB A;  2D07 B;  2BKF A;  3ZDT A;  2NPT B;  5D3X A;  2ZJD A;  3OAW A;  1V5M A;  3QA8 A;  2V3S A;  1RAX A;  1MK9 B;  4FJZ A;  5HE0 A;  2J0M A;  3SV1 A;  1RJ2 A;  4BBK A;  2JZ3 B;  1WX9 A;  2YRY A;  2N1W A;  2RQ1 A;  4II3 B;  2YS5 A;  3HM6 X;  3QCA A;  1V61 A;  4GMX B;  3VIA A;  2KTR B;  4HAU B;  3TIX A;  3MDB C;  4RMA A;  5EFX A;  1OEY J;  3WA0 A;  1GG3 A;  3DDC B;  2KGX B;  5C5B B;  4W9C A;  2CY5 A;  3PVL A;  2Z0O A;  3HK0 A;  1N3H A;  2COP A;  3ULB A;  1LFD A;  2YS3 A;  3PT2 B;  3A8P A;  2LOX A;  2K2U A;  3W1S A;  4EZK A;  2BYF A;  5DCN A;  5AZG A;  2GOW A;  3QHT A;  3O96 A;  1WGQ A;  3T06 A;  2AYO B;  4PYU A;  2EMS A;  2M8S A;  3DCG A;  2W9N A;  4EOY A;  4D0N B;  4BOZ B;  2Y8F A;  4F8C B;  1SHC A;  1QZE A;  3P7Z A;  1U29 A;  2Y5B B;  2VSZ A;  2WH5 A;  5FI0 A;  1BTN A;  1TQZ A;  2K8C A;  1EUV B;  3L08 A;  2VKI A;  3A33 B;  4Y94 A;  3Q3F A;  1DDV A;  2KK8 A;  5G55 A;  1PQS A;  2ZVO A;  2IO3 B;  2IBI B;  1TZ1 A;  2JZZ A;  1Y5O A;  4MJS B;  1JRU A;  2MBE A;  2ABD A;  3ECI A;  4A6K A;  2LZ6 A;  4MGY E;  3ZTC A;  3VHT C;  2XQN M;  2NBW B;  3M3J A;  4A6F A;  4F7H A;  1WGD A;  2EKE C;  2KWU B;  4KZC A;  3VTU A;  4KHO A;  1UPR A;  4TKN A;  2PZ1 A;  2YT1 A;  1AWE A;  1WX7 A;  2QKM A;  1NI2 A;  2FCN A;  4CHJ A;  2N9P C;  2Z0D B;  2FCM A;  4TYZ A;  4KIK B;  4IUM B;  3BIN A;  1UGM A;  4X57 B;  3QBV B;  5CHW A;  3QQ8 B;  3M1I B;  2CAY A;  3L16 A;  4YL8 A;  1HE8 A;  3H6N A;  5HE2 A;  4TV3 A;  2V1Y A;  4BBN F;  3HIZ A;  2R09 A;  2YSZ A;  3X23 A;  5J3Y A;  4IAP A;  3N30 A;  3PS6 A;  4DDI D;  2DEN B;  1WGH A;  4HXD A;  2HE7 A;  3M95 A;  2N7D A;  1YQB A;  5JHH A;  2KDF B;  1BT0 A;  5CLL B;  1U5G A;  2KDI A;  3A9K B;  2IO1 B;  2KFK A;  4EMO A;  2BWF A;  4GZU A;  1TTN A;  2UYZ B;  2G45 B;  2X18 A;  1OQN A;  1GC7 A;  2CKH B;  5DHA B;  3A9J A;  2YF0 A;  2KTR A;  3ZIM A;  3H1U A;  1ST7 A;  3HQC A;  1WF9 A;  2NZ8 B;  1EGX A;  5D3W A;  1WFY A;  4TQ1 A;  4DX9 0;  2MBH A;  2BKR B;  3IVF A;  4ASW C;  2UVM A;  2JXX A;  2KMC A;  5LON B;  4AJY B;  5GMV A;  2WDT B;  1YIW A;  4CYE A;  3EPY A;  3LJU X;  2J0K A;  2D10 A;  3JSV A;  1KJT A;  3ZNG C;  2LWP A;  1ZC4 B;  2DYQ A;  2KVR A;  3RCP A;  5DI9 B;  2FID A;  5J18 A;  3PHW B;  1RFA A;  5JHG A;  1E7V A;  5GOW B;  1U5F A;  3ZKJ C;  4W9H A;  1MPH A;  3AU5 A;  4URK A;  1W1D A;  3N7C A;  1M7R A;  2DZM A;  3VUX A;  2CHZ A;  3PSC A;  2C7N B;  3PP2 A;  2AWT A;  2EMT A;  3JVZ X;  3PSE B;  4WVF B;  3GYP A;  1Y8R C;  1H4R A;  4CO7 A;  2BPS A;  4ZRI A;  3QAQ A;  1WE6 A;  3MJW A;  2KX3 A;  3VUW A;  2E2X A;  3DVN U;  3NHE B;  1E7U A;  2CR5 A;  3KYD D;  2QHO A;  4F7G A;  4WJP A;  4JL9 A;  2Z0E B;  2QKL A;  1V81 A;  3V6E B;  4NJ7 A;  2FJ9 A;  1BWN A;  3TBL D;  2ELA A;  3IG3 A;  4W9F A;  3O65 B;  1UPQ A;  3EEC A;  4W9D A;  3GYO A;  4GDK B;  2L1C A;  1X86 A;  3ONS A;  1X11 A;  2LVO A;  5LXI B;  4KVG B;  1V5O A;  4IM3 A;  3UGB B;  4YON A;  2MFQ A;  3VQI A;  4FHK A;  2KKC A;  3ENE A;  2PE9 A;  3WAO A;  2PJH A;  5E6O A;  1FHW A;  3DBL I;  1HB6 A;  2C9W B;  4FHJ A;  3QAR A;  1KZG A;  3A8Q A;  1H8C A;  5JH5 C;  4GIV A;  2XEW A;  1UH6 A;  3PG7 A;  4F7U P;  4LJO B;  2KUP A;  2V4L A;  2FJL A;  2DX5 B;  3TL5 A;  2AL6 A;  3KH0 A;  1YD8 U;  3CST A;  1VD2 A;  2I1J A;  4HDQ A;  1C3T A;  1V9J A;  4K7S A;  2LGX A;  2M17 A;  3LJ3 A;  1H10 A;  2MW5 A;  5FR6 A;  2ZVN A;  2H7D A;  2C7M B;  5D2M B;  2BYE A;  2CHX A;  2DA0 A;  4F7Z A;  5KQ4 A;  1X1G A;  4HAV B;  2G35 A;  3B1L X;  4B6W A;  3OLM D;  4HAZ B;  2HJ8 A;  2LOZ A;  4JIO U;  4ANU A;  2D2Q A;  2JVC A;  2K25 A;  2HRJ A;  4KDI C;  1TJ6 A;  2N9X A;  3VOQ A;  1V2Y A;  3PRP B;  2RVB B;  4PYZ A;  2C60 A;  3ZUN A;  1IRS A;  2Z59 B;  3UQB A;  3A1Q A;  4HCP B;  4HPM B;  4A5K A;  3V5W A;  3GOE A;  3K9P B;  1U5D A;  3KVF B;  1ZGU B;  3DXE A;  3X0W A;  3ZNZ B;  3N32 A;  2W2X D;  2N0Y A;  3FP5 A;  1WH3 A;  2K8B A;  1WX8 A;  3B08 A;  1GUA B;  3VUY A;  4PNK A;  1UNQ A;  1V88 A;  4PS8 A;  3FM8 C;  2K00 A;  2P0D A;  4MT7 A;  2FUH B;  2YT0 A;  3D8D A;  2KXJ A;  4W9E A;  1KM7 A;  1W1H A;  1E8Y A;  3TVV A;  2ZZP B;  4K17 A;  1WY8 A;  1WGY A;  2O2V B;  4E3C A;  3W1Y A;  3ZLZ A;  4HAW B;  4IM0 A;  4G3X B;  2D4Q A;  1MG8 A;  3WAN A;  3DBH I;  3ZO5 B;  2LRW A;  1NBF C;  1FB8 A;  2GCJ A;  2K1F A;  1V5P A;  2N7E A;  4WJQ A;  5JZE B;  1WI1 A;  2OTX A;  4K2P A;  1UNP A;  3NS8 A;  2KOX A;  4DBG A;  1P3R A;  4G0N B;  2ADZ A;  2NVU I;  2DN6 A;  4DXA B;  3QJZ A;  1IP9 A;  2FAZ A;  1XX0 A;  1EAZ A;  2RPQ A;  1ISN A;  3VVW B;  1L2N A;  4H8S A;  4MH0 E;  1WR6 E;  5D3Y A;  3VH4 B;  4BKS D;  2LI5 A;  4HAY B;  1KLV A;  1J0W A;  3TMP B;  2KN5 A;  2KJ6 A;  1F9J A;  5C23 A;  3PHX B;  5DIF B;  1FHO A;  2L7R A;  4NAW B;  3PEG A;  2I5F A;  4GGQ A;  2J0J A;  1SE9 A;  4G11 A;  3ODX A;  2CU1 A;  4W9L A;  5AZH A;  2FNJ B;  4E71 A;  4I6P A;  3U30 A;  1LB1 A;  1Z87 A;  3DXC A;  2ZCB A;  2L00 B;  1V86 A;  1Q5W B;  2C5L C;  3TJP A;  4NPN A;  2KLC A;  3V60 A;  4GDL B;  4XZ4 A;  2MBO A;  2M1M A;  2LKO A;  1GJZ A;  1FGY A;  3ML4 A;  5CX3 A;  3PRE A;  3HW2 B;  2LVP A;  1ZW7 A;  3SD5 A;  4BKT A;  1WVH A;  1I42 A;  1YX5 B;  2L0F A;  1WMH B;  1V5T A;  2PEA A;  3PRM B;  2M38 A;  2DYB A;  1RRP B;  4ZRK A;  2MQJ A;  4DHZ E;  5AZF A;  2BGF A;  3QC8 B;  2KDB A;  4K1R B;  4M8M A;  2RGN B;  2MP2 A;  3KUC B;  4BKG A;  2PPH A;  3M63 B;  4DHZ B;  1KOT A;  1DDM A;  4WQO B;  1GC6 A;  2M0X A;  4MGI E;  2BCJ A;  4KZ0 A;  4HWI B;  2R0D A;  4DBB A;  4BKS A;  2KHW B;  3AU4 A;  2D9W A;  3W1S C;  2G4D B;  4IFS A;  1Z5S B;  2P0F A;  2NPT A;  3DOW A;  1XKE A;  1NU2 A;  4IW0 A;  5HE3 A;  4MSM B;  2ZNV C;  3PRZ A;  4IWO A;  2W2W A;  2DZJ A;  2N23 A;  1KI1 B;  2LAS A;  2DYO A;  3ZRF A;  3MHS D;  1YX6 B;  5E6N A;  4KDL B;  3DXD A;  3KUD B;  3BY4 B;  2D11 A;  1UEL A;  3LDZ E;  5L81 A;  4FJV B;  2G3Q B;  1XCG A;  2KC2 A;  5C5B A;  2IO2 B;  3NZS A;  3CMM B;  4WJ7 A;  2IY0 B;  2Z0Q A;  3OJ4 B;  3VDZ A;  2HTH B;  1L7Y A;  4FBJ B;  2IYD B;  1FOE A;  1U27 A;  1XD4 A;  2DHI A;  2LRU A;  4BBN C;  1GNU A;  4MEL A;  2N9E B;  2NCN A;  1VCB A;  3SO6 A;  2IY1 B;  2XK5 B;  2ZCC A;  3RCZ A;  2DHJ A;  4HJK A;  2DLW A;  3D8F A;  1MIX A;  4FA6 A;  4B95 A;  2RUK B;  4FJY A;  2MWN B;  1WE7 A;  3SHQ A;  1BAK A;  2L2I A;  4TUU A;  2I5C A;  2COC A;  3F0W A;  3GZN I;  3UF8 A;  3CF6 E;  2J59 M;  2EJ8 A;  1S3S G;  5L83 A;  1E90 A;  5KHQ A;  1SIF A;  4GDL A;  2HD5 B;  1IPG A;  2DHZ A;  1WM2 A;  4NSW A;  2BYV E;  4PQ0 A;  3FEH A;  1XT9 B;  4MJS A;  4TQ0 A;  3NY5 A;  4MDK E;  1PFJ A;  3TW1 A;  2KFJ A;  3QWM A;  2H7E A;  2LJ5 A;  4JGH B;  1X1F A;  2LG1 A;  5D6J B;  1I7A A;  2KX0 A;  4LDT B;  4NY0 A;  4E74 A;  4I6L B;  2O6V B;  1WIA A;  2CB8 A;  3R7R A;  5J3Q A;  2AEH A;  4KIK A;  4EZJ A;  4P7I A;  3N3K B;  1NTV A;  3WAL A;  2LVQ A;  4K7U A;  4AJW A;  2GJY A;  3MTN B;  5E6P A;  1R4M I;  2LD9 A;  4HB2 B;  2JWZ A;  3UZT A;  1UNR A;  2KAN A;  2IFS A;  4GB9 A;  2MCN B;  4F1S A;  1ACA A;  3CIK A;  3K9O B;  3ULC A;  3A9K A;  5LOP B;  4IWP A;  3EC8 A;  3FLV A;  2D9Z A;  5DPT A;  2KQ7 A;  2ROZ B;  3U7D A;  2DTC A;  2NMB A;  4GOC A;  4PS7 A;  2VRW B;  3QX1 A;  1FXT B;  3RT3 B;  4LDT D;  4BOS C;  2L05 A;  3PPA A;  2O6V D;  1MKE A;  2RNR B;  2KJH B;  2COA A;  1WRD B;  3U8Z A;  2K8H A;  4DHJ B;  1D3Z A;  2L76 A;  1P6S A;  1WJU A;  2HTH A;  4K81 A;  2GBJ A;  2KC1 A;  4AP4 C;  5IA7 A;  1V89 A;  2LGY A;  4LJP B;  5TR5 A;  4AUQ C;  4HLE A;  4PS3 A;  4CHK A;  1K5D B;  1LXD A;  5FI1 A;  3T9L A;  3R66 C;  1E8Z A;  1E5W A;  4W9J A;  2XK5 A;  1PMS A;  2ZNV B;  4AOF A;  1WYW B;  2MRP A;  1P9D U;  4JLC A;  4JQW C;  3M62 B;  2EC1 A;  5CHF A;  2MDX A;  3UIO B;  2YS1 A;  5G2N A;  3NZU A;  2DFK A;  1EF5 A;  3I3T B;  4WWP A;  3QIJ A;  3VXW A;  4FUL A;  2DYN A;  4M0W B;  4WWO A;  2GBN A;  3ZW3 A;  2A5U A;  2UZS A;  1C1Y B;  2G4S A;  4HB0 B;  2NR2 A;  3IHP C;  3KRW A;  3AI5 A;  1XR0 B;  3DBS A;  1TXD A;  4G50 A;  2LUE A;  2LXC A;  5C79 A;  4GXB A;  4DWF A;  3EFU A;  4HHV A;  2L8J A;  3ZNI D;  3SDL C;  2WX0 A;  2ZEQ A;  2DHK A;  3A4R A;  4MK0 A;  3V6C B;  3SUZ A;  1EVH A;  2D9Y A;  2RD0 A;  3BJI A;  3D32 A;  2KWC A;  2L0T A;  4W9G A;  2RSU A;  2OQB A;  1P3Q U;  3AUL A;  5C1Z A;  4KHB B;  3IFW B;  1PLS A;  1WR1 A;  3UQA A;  3AXC A;  1M7E A;  3MPX A;  3UIP B;  3H7P B;  4GDK A;  2L3Z A;  3SU8 X;  4FN2 A;  1J0G A;  1WGG A;  4Z2M B;  4C0A A;  3KYC D;  1WG7 A;  3KZ1 A;  3OJ3 A;  5JHB A;  1QC6 A;  5KQ1 A;  3WAP A;  2KFK B;  3L13 A;  2R2O A;  2FDQ A;  1XD3 B;  2KNB A;  2K6D B;  2MWS B;  2JRH A;  1U4A A;  4DX8 A;  1K5G B;  3QWZ B;  1UEF A;  2MSE D;  3A9J B;  3CSF A;  5D7G A;  3VAW A;  4MM3 A;  2JT4 B;  3G9W A;  4IG7 B;  4ANX A;  1DYN A;  3APD A;  2UWQ A;  5CLQ B;  3A4S C;  1WZ0 A;  4GPT B;  5J2R A;  2DX5 A;  2JPH A;  2DYM A;  3ZRC A;  2DZI A;  1P1A A;  2CS4 A;  3VTW A;  1LW3 A;  2R2Q A;  4I6N B;  4GN1 A;  1V5U A;  4B6H A;  1YJ1 A;  3CXB B;  2IYB A;  2D9X A;  4XWX A;  4ANV A;  1SGH A;  1BTK A;  3L0W B;  2MKR A;  1WJ4 A;  1P0R A;  1V80 A;  4EKU A;  3JSV B;  5HE1 A;  2K6Q A;  4OVV A;  3PV1 A;  3ODW A;  4KSK C;  4HCN B;  4MGK E;  4GU2 A;  1FGZ A;  5D3V A;  2NS5 A;  3WIM A;  2J7Q B;  2N4F A;  1AQC A;  2LYD A;  2B3A A;  1WXV A;  2YLM A;  4IC7 B;  1WI0 A;  3SYX A;  1RLF A;  1J8C A;  1U2B A;  4RM9 A;  1HB8 A;  1NTI A;  4II2 B;  2RGF A;  1T0Y A;  1KZ7 A;  3VFK A;  1EO6 A;  4OVU A;  4WJN A;  3DBR I;  2DKP A;  1U5E A;  1E8X A;  3P6A A;  4BFR A;  4AWJ A;  2DZK A;  3DVN V;  1K8R B;  3KW5 B;  1ZM0 A;  3APC A;  2BF8 B;  2KMA A;  2LXA A;  4A20 A;  1G6J A;  4KAX B;  1Q1O A;  4FLH A;  4KSL C;  3PZD A;  4IWQ A;  2AL3 A;  2MA9 B;  4ICU A;  2JUO A;  5DHF B;  3UIN B;  2CRF A;  3ML8 A;  3NOB A;  1WZ3 A;  1TGZ B;  1UD7 A;  3KUZ A;  3JYU A;  1OQY A;  2O2V A;  3PVW A;  4ZDV A;  2K2J A;  5DPS A;  4WJO A;  1TBE A;  3Q3J A;  2DAF A;  5CTR C;  1HBK A;  2C7H A;  5LLI A;  1LM8 B;  3JW0 X;  3H7P A;  4RM8 A;  1M94 A;  2MBB B;  2KLG A;  2GS0 A;  2W2X C;  4MEM A;  2GCL A;  2IO0 B;  3ALB A;  3RZF A;  3FSS A;  2KO3 A;  3TO1 A;  4ZYN A;  4LCD E;  1WGR A;  4L6E A;  3R3M A;  2RLO A;  3RYT A;  2JP2 A;  4EJN A;  2IZV B;  3ZDM C;  4HAX B;  2VRR B;  1XQQ A;  2CHW A;  3S2A A;  1XOD A;  5D94 A;  1EF1 A;  3WYF B;  3WAM A;  4Z2N A;  4HB3 B;  1A5R A;  1Z2M A;  4NQL B;  4M8N A;  3OAN A;  1RRB A;  3VTV A;  5DPR A;  4HK2 A;  2CQU A;  3AJ4 A;  4NAW A;  3TCA A;  4K7W A;  3PLU A;  1ZVR A;  4DK5 A;  2ZPN A;  1WXS A;  1NVL A;  3H7S A;  3T8M A;  5J17 A;  4ANW A;  4XC2 A;  1DDW A;  1OEY A;  4J6I A;  2V76 A;  2LBB A;  1ZC3 B;  4IOY X;  2DKQ A;  4KHA A;  2OOB B;  2KCJ A;  2RSG A;  2COF A;  2JRI B;  5DPW A;  1CMX B;  1OY2 A;  1QQG A;  1R4N I;  3L17 A;  3F5R A;  3DQV A;  3RZW C;  3V61 A;  1MIZ B;  1Y19 B;  2DX1 A;  2LUL A;  3ZVV A;  1MAI A;  2GMI C;  2GBM A;  4XX5 A;  3L10 B;  1Q67 A;  3QK0 A;  3A1Q B;  1WMH A;  4WAA A;  1W1G A;  4ICV A;  5HKH A;  3C0R B;  5JHA A;  2WYQ A;  4A6H A;  5C6R A;  4MY6 A;  4HAT B;  4A3P A;  2MX2 A;  4NJ6 A;  3PLV A;  3KRX A;  1J19 A;  4EFO A; 
#chains in the Genus database with same CATH topology
 2FE8 A;  3ZVR A;  2OED A;  1I35 A;  2Y8G A;  1WM3 A;  1FEH A;  2WP9 B;  2P0H A;  2REX A;  5IOI A;  4WSF A;  1WGU A;  5JLJ B;  3MP9 A;  4DDG D;  3CWI A;  5LNK 1;  2KDE B;  4HPL B;  4EEW A;  3RNA C;  3B0A A;  2D9V A;  1AAR A;  3APF A;  1E8W A;  2ZW0 A;  3J9C A;  1Q0W B;  3HM3 A;  3PTF C;  4K2O A;  5EDS A;  2JF5 A;  2MHJ A;  2M4N A;  3EHV A;  3KY9 A;  2WDR B;  1EU4 A;  3P63 A;  4GSW A;  3NVY A;  4BVU C;  2LGD A;  1WJN A;  1SF0 A;  4K3B A;  2KJR A;  1NTY A;  1NDD A;  3R7Q A;  2NMQ A;  5AEK B;  5JP4 A;  2BWE S;  5L95 C;  4QJ5 B;  1XLN A;  3RUL A;  2FCS A;  3P4R B;  3P42 A;  3IBE A;  4HVB A;  5LXH A;  2Z0P A;  3TFM A;  2KTF A;  5HG2 A;  3RNF C;  2RR9 A;  2WQY B;  3PGE A;  1ZSQ A;  2NBU A;  3ML9 A;  3SNH A;  3I63 C;  3P2B A;  2WX1 A;  3SFD B;  5IJM A;  1WWT A;  2XBB C;  1UZX B;  1B55 A;  2VH2 A;  2Q13 A;  4NZL B;  1I4P A;  4USA A;  1X1M A;  1TKG A;  4MSQ B;  4NQK E;  4B0E A;  5C16 A;  1QT9 A;  2OJR A;  2DAJ A;  5KHO A;  3AE8 B;  3TSS A;  2JYT A;  4NNJ B;  1FAO A;  3KSY A;  5T8I A;  5CHV C;  4ILJ A;  2CY4 A;  3VH3 B;  2PE6 B;  2M14 A;  5J3T A;  1FHX A;  5KCV A;  3HIE A;  1P5T A;  2MJE A;  2N1V A;  3KLS X;  3PVU A;  2COD A;  5IAA C;  4IM2 A;  4OHJ A;  4GMV A;  2KD0 A;  2MLB A;  4S0R A;  2ASQ A;  2JY6 A;  4W9I A;  4WWN A;  2KIE A;  1MPE A;  1QKZ A;  4P6V F;  1GPX A;  4YT0 B;  4JX1 C;  2UZR A;  1OGW A;  1UGJ A;  4EUT A;  4HB4 B;  2KQS A;  2W3S A;  4B9K A;  4LNK A;  1QF6 A;  2A4Z A;  3PZ8 A;  1WJ1 A;  3BYY B;  2GBK A;  3NRZ A;  2K39 A;  1V49 A;  1WXM A;  2NBV B;  1C4A A;  3RD2 A;  1WJM A;  4REZ A;  3A98 B;  2ELB A;  3LXF A;  4DHJ D;  2FIF A;  5BO4 B;  1DBH A;  1MK7 B;  1S1Q B;  1OMW A;  4HJG E;  1ZKH A;  2I1K A;  3DPD A;  1DRO A;  3UI3 A;  5AUK A;  2D3G A;  5EE1 A;  3DVG X;  4KV2 A;  5GXG B;  1IYF A;  4ZRJ A;  3ZNH B;  4HDO A;  3P4Q B;  4MGZ E;  3ZTD A;  1GGO A;  2RMM A;  3V62 A;  4TMA B;  3VRB B;  3L54 A;  5DH9 B;  2TSS A;  3Q8F A;  4QAY A;  4A3O A;  4N9F 4;  2WWZ A;  4P1B C;  3RUI B;  3Q8B A;  3FIL B;  2YVC A;  1UBI A;  2QIE B;  2ROV A;  5D27 A;  2R2Y A;  4KGT A;  1KRH A;  4A6F B;  3H9D A;  4W9K A;  2Y7B A;  1OTR B;  1I2H A;  2ZPY A;  3D8E A;  3NSU A;  2P8V A;  3Q8C A;  2KWV B;  1X05 A;  4YSZ B;  2MP2 B;  2FCQ A;  1E6E B;  1P98 A;  3FVC A;  4CHM A;  1ZPS A;  2O6V A;  1FO4 A;  3N1X C;  1BUI C;  4FAD A;  1CK1 A;  1TS2 A;  2MBQ A;  3RNC C;  4EZL A;  3NW8 A;  3HHM A;  1RFK A;  2HDE A;  1UBQ A;  2GBR A;  1JWB D;  3DVG Y;  1WJ6 A;  3AE2 B;  2KZR A;  4JK7 A;  4JE3 B;  3ODO A;  1V6E A;  2QCZ A;  1WXA A;  1LQB A;  1PFD A;  2D07 B;  2BKF A;  3ZDT A;  2NPT B;  4A55 A;  2N9L A;  5D3X A;  2ZJD A;  3L4P A;  3OAW A;  1V5M A;  3QA8 A;  2V3S A;  3EFC A;  1RAX A;  1MK9 B;  4FJZ A;  5HE0 A;  2J0M A;  3SV1 A;  5D3I B;  1F77 A;  1HEZ E;  1RJ2 A;  4BBK A;  3URY A;  3ABV B;  2JZ3 B;  2K5P A;  1WX9 A;  2YRY A;  1PGB A;  1WYG A;  2N1W A;  2RQ1 A;  4II3 B;  2YS5 A;  3HM6 X;  3N9Y C;  2KYW A;  5HI1 A;  3ZQ4 A;  1N5X A;  1IGC A;  1L0V B;  1V61 A;  3QCA A;  4GMX B;  4N6E B;  2FJU B;  3VIA A;  2KTR B;  4HAU B;  4ILH A;  3Q8A A;  3TIX A;  1I4X A;  2KN4 A;  3MDB C;  2MH7 A;  4RMA A;  5EFX A;  4MH8 A;  1OEY J;  3WA0 A;  1GG3 A;  3DDC B;  2KGX B;  3KWV A;  5C5B B;  4W9C A;  2CY5 A;  3PVL A;  2Z0O A;  2WXQ A;  3HK0 A;  1N3H A;  2COP A;  4LTU A;  3ULB A;  1LFD A;  2YS3 A;  2WDQ B;  3PT2 B;  3AE6 B;  3A8P A;  5I2S A;  2LOX A;  3MC9 A;  1HTQ A;  2K2U A;  3W1S A;  1L0X B;  4EZK A;  2BYF A;  1F2R I;  5DCN A;  1SJE D;  5AZG A;  2GB1 A;  2GOW A;  2L1A A;  2KAJ A;  4RFB A;  3QHT A;  3O96 A;  1WGQ A;  3DHG C;  3TEX A;  3T06 A;  2AYO B;  4PYU A;  2EMS A;  2M8S A;  3C19 A;  3DCG A;  3CIR B;  2KVZ A;  2W9N A;  4KKJ A;  1N60 A;  4EOY A;  4D0N B;  3I9V 1;  4BOZ B;  2Y8F A;  4F8C B;  1SHC A;  1MI1 A;  1VZ6 A;  1QZE A;  3P7Z A;  4KGS A;  3SBG A;  1U29 A;  2Y5B B;  2VSZ A;  2BQQ A;  3I57 A;  2M56 B;  2Q5W D;  2WH5 A;  4HSI A;  5FI0 A;  3DBH B;  1AYF A;  2ONQ A;  1BTN A;  1TQZ A;  3KQ4 A;  2K8C A;  1ESF A;  3W5U B;  3B2G A;  1UF0 A;  1EUV B;  4M0W A;  1EM7 A;  1YQ4 B;  3RI7 C;  3L08 A;  1TT5 B;  1F52 A;  2VKI A;  3A33 B;  2K0P A;  1IBX A;  4Y94 A;  3BYT B;  3Q3F A;  1MJD A;  1JWA D;  2BTE A;  1J7A A;  1DDV A;  3OHM B;  2KK8 A;  2X8X X;  4XWT A;  5G55 A;  1PQS A;  2ZVO A;  5IO9 A;  2IO3 B;  2IBI B;  1TZ1 A;  2JZZ A;  1Y5O A;  4BZA A;  4MJS B;  1JRU A;  1UWX A;  2MBE A;  2ABD A;  3ECI A;  2WGS A;  4A6K A;  1T77 A;  2LZ6 A;  3LYY A;  4MGY E;  4MAC A;  4LNN A;  4K3C A;  3ZTC A;  3VHT C;  2XQN M;  1AN8 A;  2NBW B;  3FIL A;  2KAC A;  2NTT A;  3M3J A;  5BYS A;  4JKD A;  4A6F A;  4F7H A;  1WGD A;  2EKE C;  1I7H A;  1XXG A;  2KWU B;  4KZC A;  2K8E A;  4HKQ A;  1F1H A;  3VTU A;  2ON8 A;  1VRA B;  4KHO A;  1UPR A;  4TKN A;  2PZ1 A;  2YT1 A;  1AWE A;  1WX7 A;  2QKM A;  1NI2 A;  2FCN A;  4CHJ A;  2N9P C;  2Z0D B;  2FCM A;  2INP E;  4TYZ A;  3OG5 A;  4KIK B;  4RGM A;  2J52 A;  1QOF A;  1YOV B;  3BIN A;  4IUM B;  2LGI A;  2WXM A;  1UGM A;  4X57 B;  3QBV B;  2KWD A;  3AE5 B;  5CHW A;  3QQ8 B;  1N62 A;  3M1I B;  2CAY A;  3L16 A;  4YL8 A;  1C77 A;  1HE8 A;  2GRI A;  3H6N A;  5HE2 A;  2BS3 B;  2ZW1 A;  3E9L A;  4TV3 A;  2V1Y A;  2J42 A;  4BBN F;  2W55 A;  5C3J B;  4D2K A;  3HIZ A;  2KQ4 X;  2R09 A;  3A58 A;  2YSZ A;  3X23 A;  5J3Y A;  4IAP A;  3N30 A;  3PS6 A;  4DDI D;  2DEN B;  1MFW A;  4YSX B;  1WGH A;  1E0Z A;  4HXD A;  3IAM 1;  4LNI A;  2HE7 A;  3M95 A;  1V1P B;  2N7D A;  1YQB A;  2Y5C A;  5JHH A;  2KDF B;  1BT0 A;  5CLL B;  1U5G A;  2KDI A;  4PK1 A;  4ILG B;  1ZXH A;  2IO1 B;  3A9K B;  2KFK A;  4EMO A;  1WGK A;  3NZ3 A;  2BWF A;  4GZU A;  1L4D B;  1TTN A;  2UYZ B;  2G45 B;  2RDG A;  2X18 A;  1OQN A;  1GC7 A;  2CKH B;  3TEW A;  5DHA B;  2UU7 A;  3A9J A;  2LHD A;  2YF0 A;  2KTR A;  4M00 A;  4OZC A;  3ZIM A;  3H1U A;  1MG4 A;  3TEY A;  1ST7 A;  3HQC A;  1WF9 A;  2NZ8 B;  2BW2 A;  4N59 A;  1V8C A;  4TSS A;  4L23 A;  1EGX A;  2QSD A;  2LEK A;  5D3W A;  1WFY A;  4TQ1 A;  2Z13 A;  4DX9 0;  2MBH A;  1TJE A;  2BKR B;  3AEC B;  1L4Z B;  2L83 A;  3IVF A;  4ASW C;  2UVM A;  2JXX A;  2M0A A;  2KMC A;  1ZXI A;  5IKC M;  5LON B;  4AJY B;  5GMV A;  1PUT A;  1KFY B;  2WDT B;  1YIW A;  4CYE A;  2IGG A;  1SSN A;  3EPY A;  1QIL A;  1XCQ L;  3LJU X;  2J0K A;  2D10 A;  5HHD G;  3JSV A;  1WRI A;  1KJT A;  3ZNG C;  4IKG A;  4ARI A;  1JWS D;  2LWP A;  2QDF A;  1ZC4 B;  2DYQ A;  2HJ1 A;  2KVR A;  2OHF A;  1VDV A;  3HRD D;  3RCP A;  3RNB C;  5DI9 B;  2FID A;  4DXF A;  3MJ5 A;  3RNG C;  5J18 A;  3PHW B;  1RFA A;  2E3T A;  5HFY A;  1SE3 A;  5JHG A;  1E7V A;  5GOW B;  1SXT A;  1U5F A;  3ZKJ C;  4W9H A;  1MPH A;  3AU5 A;  3FAH A;  4URK A;  2D3C A;  3GS2 A;  1W1D A;  3N7C A;  1M7R A;  2WU2 B;  1M4V A;  2BB6 A;  1BXT A;  1L6V A;  2DZM A;  4NJC A;  3BZD B;  3VUX A;  2CHZ A;  2BS2 B;  2AQ1 B;  3AEF B;  3PSC A;  1QLB B;  1STE A;  4OZA A;  2C7N B;  5JXV A;  3PP2 A;  5M4Y B;  2FBW B;  2AWT A;  2LHE A;  1ZDX A;  1EU3 A;  3AM9 A;  2EMT A;  3JVZ X;  2K9X A;  3PSE B;  4WVF B;  1PDX A;  3GYP A;  1Y8R C;  1H4R A;  4CO7 A;  2BPS A;  4ZRI A;  3QAQ A;  3NWF A;  1WE6 A;  3MJW A;  2KX3 A;  3I5J C;  3VUW A;  2E2X A;  1OQR A;  3DVN U;  3NHE B;  4RCO A;  1E7U A;  4JKA A;  2PW9 A;  1DOY A;  2CR5 A;  3KYD D;  2QHO A;  4F7G A;  4WJP A;  4JL9 A;  2Z0E B;  2QKL A;  4L1R A;  1NI3 A;  1V81 A;  2DIK A;  3V6E B;  4NJ7 A;  2FJ9 A;  1BWN A;  3TBL D;  2ELA A;  2AQ3 B;  3IG3 A;  1AW7 A;  4W9F A;  3O65 B;  1UPQ A;  3EEC A;  4W9D A;  3GYO A;  4GDK B;  3U4E G;  2L1C A;  1YN5 A;  3P1M A;  3GP7 A;  3HUI A;  1X86 A;  1YJI A;  3Q3M C;  3ONS A;  1X11 A;  2LVO A;  5LXI B;  4KVG B;  1V5O A;  2X38 A;  4IM3 A;  3UGB B;  4YON A;  2MFQ A;  3VQI A;  4FHK A;  3W2D A;  3PO0 A;  2GLS A;  2KKC A;  3ENE A;  1FNU A;  5BYQ A;  1F0Z A;  1KBL A;  2N0S B;  2PE9 A;  3GZN B;  3WAO A;  4C7Z A;  2PJH A;  1V1P A;  1UWM A;  2EEL A;  2XNA C;  5IN7 A;  1MHX A;  5E6O A;  1RWS A;  1FHW A;  2INC C;  3DBL I;  1HB6 A;  2C9W B;  4FHJ A;  3QAR A;  1FNW A;  1KZG A;  1SIJ A;  3A8Q A;  4JKH A;  2V4I B;  3ZJU A;  1H8C A;  2RDH A;  5JH5 C;  4AQ7 A;  4H2A A;  1OFF A;  4N58 A;  4GIV A;  4MM3 B;  2XEW A;  2BB5 A;  3TUO A;  1UH6 A;  2BT6 A;  5I4D A;  3PG7 A;  2BBC A;  4F7U P;  4LJO B;  2KUP A;  3BVG A;  4JK8 A;  2V4L A;  2FJL A;  2DX5 B;  3Q14 C;  3NWD A;  3TL5 A;  2AL6 A;  3E9O A;  3KH0 A;  1YD8 U;  3CST A;  3AED B;  3IXS A;  1VD2 A;  1ENF A;  2PVO D;  1NEK B;  2MJ3 A;  2I1J A;  4HDQ A;  4JWS C;  1C3T A;  1FXI A;  1V9J A;  2KIG A;  4WUR A;  1Q10 A;  1FPY A;  4K7S A;  2DLB A;  2LGX A;  2M17 A;  3LJ3 A;  1H10 A;  2MW5 A;  5FR6 A;  2ZVN A;  2H7D A;  4C80 A;  2C7M B;  5D2M B;  2BYE A;  4LNO A;  4XYC A;  2CHX A;  2M19 A;  3WCQ A;  2DA0 A;  4F7Z A;  2JYE A;  5KQ4 A;  1X1G A;  1F2R C;  4HAV B;  2WXF A;  2G35 A;  3B1L X;  4B6W A;  3OLM D;  1R4M B;  4HAZ B;  2SAK A;  3H8H A;  2D5G A;  1HTO A;  2HJ8 A;  2LOZ A;  4JIO U;  1ZP0 B;  3AEE B;  4ANU A;  4ARC A;  2D2Q A;  4ZHP A;  2JVC A;  2K25 A;  2HRJ A;  2WXP A;  1JML A;  4KDI C;  1TJ6 A;  1JCK B;  2N9X A;  3VOQ A;  1V2Y A;  4J3O D;  3PRP B;  2RVB B;  4PYZ A;  2C60 A;  4XDC A;  3ZUN A;  1IRS A;  2Z59 B;  4HEA 1;  1UNS A;  5BMG A;  3UQB A;  3A1Q A;  4HCP B;  4HPM B;  1BML C;  4A5K A;  3V5W A;  3BVM A;  3GOE A;  3K9P B;  4AS1 A;  1U5D A;  3KVF B;  1ZGU B;  3DXE A;  3X0W A;  4ZHO A;  3KWL A;  3NVV A;  2EKI A;  3ZNZ B;  1HXY D;  3N32 A;  2IND C;  2W2X D;  2N0Y A;  4OSN A;  4LK0 M;  2WLB A;  3FP5 A;  1WH3 A;  2K8B A;  1WX8 A;  1KLG D;  3B08 A;  4QXA B;  1DIK A;  1B9R A;  1HZ5 A;  1GUA B;  3VUY A;  4PNK A;  4LLG M;  2WXL A;  1UNQ A;  1V88 A;  1WSP A;  3FM8 C;  2K00 A;  4PS8 A;  3U12 A;  2P0D A;  4MT7 A;  1YNT E;  2FUH B;  3DWG C;  2YT0 A;  3D8D A;  2KXJ A;  4W9E A;  2DNF A;  1MI0 A;  1FCC C;  1KM7 A;  1TZO A;  1W1H A;  1E8Y A;  2JWU A;  3TVV A;  2ZZP B;  4K17 A;  1WY8 A;  1WGY A;  2O2V B;  1MHH E;  3SR6 A;  4E3C A;  1J7C A;  3W1Y A;  3W9C B;  3ZLZ A;  4HAW B;  1L0Y B;  4IM0 A;  4G3X B;  2L32 A;  2D4Q A;  1MG8 A;  3WAN A;  3DBH I;  3ZO5 B;  1FCL A;  3AMZ A;  3MHZ A;  4WIP A;  2LRW A;  1NBF C;  1QQR A;  1FB8 A;  2GCJ A;  1HZ6 A;  1ROE A;  3R2T A;  2K1F A;  1V5P A;  3EUB 2;  2PTL A;  2SEB D;  2N7E A;  4WJQ A;  5JZE B;  1WI1 A;  2OTX A;  4K2P A;  1UNP A;  3NS8 A;  2KOX A;  4RH6 A;  4DBG A;  1P3R A;  4WQM A;  4G0N B;  2ADZ A;  3NVW A;  2NVU I;  2DN6 A;  4DXA B;  2G9H D;  3B77 A;  3OWE B;  3QJZ A;  1KH0 A;  1K50 A;  4US9 A;  1IP9 A;  2FAZ A;  1XX0 A;  1RM6 C;  1EAZ A;  2RPQ A;  1ISN A;  3VVW B;  1K51 A;  1JDE A;  3GE3 C;  1L2N A;  4H8S A;  4MH0 E;  4NAM A;  1L6U A;  1LGR A;  1WR6 E;  1TYG B;  5TSS A;  3HVD A;  2LFI A;  5D3Y A;  3VH4 B;  4BKS D;  2LI5 A;  1VLB A;  1FM0 D;  2J4X A;  4HAY B;  1KLV A;  1J0W A;  4JPS A;  2BYT A;  2WXI A;  3TMP B;  1TS5 A;  2KN5 A;  2KJ6 A;  1F9J A;  5C23 A;  3PHX B;  5DIF B;  1FHO A;  3MFG A;  2L7R A;  1XLQ A;  4NAW B;  3PEG A;  5MPO A;  4Q2J A;  2I5F A;  2Z8L A;  4GGQ A;  5D3D A;  2J0J A;  1SE9 A;  1D5Z C;  1VZ8 A;  2Y3A A;  3ODX A;  1T5X D;  4G11 A;  4GOU A;  2CU1 A;  2DWQ A;  4W9L A;  5AZH A;  2FNJ B;  1V1O A;  4E71 A;  3N1Z C;  4I6P A;  3AB5 A;  3VRA B;  3U30 A;  4PT5 A;  1LB1 A;  1Z87 A;  3DXC A;  2ZCB A;  1KTK A;  2L00 B;  1C9F A;  1D5X C;  1V86 A;  1FXA A;  2NBV A;  5G5G A;  1V97 A;  3AEA B;  2E6X A;  1Q5W B;  2C5L C;  2RPV A;  4NPN A;  2KLC A;  3TJP A;  5E6J A;  3V60 A;  4GDL B;  4XZ4 A;  2MBO A;  2M1M A;  2LKO A;  4JKB A;  1GJZ A;  1FGY A;  3TEZ A;  3ML4 A;  3NJT A;  3ZXV A;  3DWM A;  2B76 B;  5CX3 A;  3PRE A;  3HW2 B;  4EE2 A;  2LVP A;  4C7Y A;  4DQO C;  1ZW7 A;  3SD5 A;  4BKT A;  2Z59 A;  1WVH A;  1I42 A;  1ZE3 D;  1YX5 B;  1P7F A;  2L0F A;  1WMH B;  1V5T A;  2PEA A;  1QOB A;  3PRM B;  2M38 A;  1NYR A;  2DYB A;  1RRP B;  4ZRK A;  2MQJ A;  2IDY A;  3AV8 A;  2R82 A;  4DHZ E;  1N6Z A;  4OW0 A;  4C4V B;  5AZF A;  1N61 A;  2BGF A;  3QC8 B;  2KDB A;  4K1R B;  4IDI A;  5LG4 B;  4M8M A;  2RGN B;  2MP2 A;  4HPP A;  3KUC B;  4BKG A;  2PPH A;  3M63 B;  2Z4D A;  4DHZ B;  1KOT A;  1DDM A;  4WQO B;  1GC6 A;  2M0X A;  4MGI E;  2BCJ A;  3N20 C;  4L1B A;  1NYQ A;  4KZ0 A;  4HWI B;  2R0D A;  4DBB A;  4BKS A;  2KHW B;  3AU4 A;  1FRD A;  4C56 C;  2D9W A;  1JAL A;  3W1S C;  3E9P A;  2G4D B;  4IFS A;  2QMT A;  1DGJ A;  2G1E A;  3AE3 B;  4LNF A;  4CQN A;  1Z5S B;  4OZB A;  2P0F A;  1HA5 A;  3ZYY X;  4D6W A;  2GI9 A;  2NPT A;  2INN E;  3DOW A;  1XKE A;  4XDD A;  1NU2 A;  2AQ2 B;  4IW0 A;  5HE3 A;  4MSM B;  2ZNV C;  3PRZ A;  4IWO A;  4RGO S;  2W2W A;  2WXO A;  2DZJ A;  2VZK B;  2N23 A;  1KI1 B;  2LAS A;  3VR8 B;  1KLU D;  2DYO A;  1EWC A;  3ZRF A;  3MHS D;  1YX6 B;  4A90 A;  1YN4 A;  5E6N A;  3BK2 A;  1YMH E;  4KDL B;  3DXD A;  1DOX A;  3KUD B;  4L2Y A;  3BY4 B;  2D11 A;  1UEL A;  3LDZ E;  2JZP A;  5L81 A;  4RGT A;  4FJV B;  4WAF A;  2G3Q B;  1XCG A;  1E10 A;  2KC2 A;  1TIF A;  3DBR B;  5C5B A;  2V3N A;  2IO2 B;  3NZS A;  3CMM B;  4JKC A;  2WXK A;  3MC8 A;  4WJ7 A;  2IY0 B;  2Z0Q A;  3OJ4 B;  3VDZ A;  3RN9 C;  2HTH B;  3U52 E;  1L7Y A;  4FBJ B;  1UUP A;  2IYD B;  3EGR A;  1E7P B;  3ETR A;  2W82 A;  1FOE A;  1U27 A;  1XD4 A;  2Z14 A;  2K22 A;  2DHI A;  2LRU A;  2WU5 B;  1D5M C;  4BBN C;  1GNU A;  4MEL A;  2N9E B;  2NCN A;  1VCB A;  3SO6 A;  2IY1 B;  2XK5 B;  2ZCC A;  3RCZ A;  2DHJ A;  2GUM A;  4RF1 A;  4HJK A;  1ACC A;  2DLW A;  3FC4 A;  3D8F A;  2VZK D;  2L52 A;  1MIX A;  4FA6 A;  4B0M A;  4B95 A;  2RUK B;  2KDM A;  4FJY A;  2MWN B;  1WE7 A;  3SHQ A;  1BAK A;  3V3X A;  2L2I A;  4O1N A;  1QOG A;  1TY0 A;  4TUU A;  4XGA B;  3R8B A;  1ZUD 2;  2I5C A;  2COC A;  3ZJV A;  3F0W A;  2DBY A;  3GZN I;  3UF8 A;  2YT2 A;  2WS3 B;  3CF6 E;  2J59 M;  2EJ8 A;  3Q3O C;  1S3S G;  1JRO A;  1XLO A;  2WDV B;  5L83 A;  1E90 A;  5KHQ A;  1SIF A;  3NS1 A;  4GDL A;  2HD5 B;  5H92 C;  1IPG A;  2DHZ A;  1A70 A;  1WM2 A;  4NSW A;  2BYV E;  4PQ0 A;  3FEH A;  1XT9 B;  1TKE A;  5JVL A;  4MJS A;  4TQ0 A;  3NG0 A;  3NY5 A;  1PYW D;  3U7Z A;  4MDK E;  2LJI A;  4M01 A;  1PFJ A;  3TW1 A;  3Q3N C;  2WXJ A;  2KFJ A;  3QWM A;  1FFU A;  2H7E A;  2LJ5 A;  2AX5 A;  1SB3 C;  3GB1 A;  4JGH B;  1Y56 A;  1XLP A;  1X1F A;  2LG1 A;  5D6J B;  4S17 A;  1I7A A;  2KX0 A;  4LDT B;  4NY0 A;  4E74 A;  4I6L B;  1CJE A;  2O6V B;  5FK9 C;  1WIA A;  2CB8 A;  3R7R A;  5J3Q A;  2KMM A;  2AEH A;  5FR3 A;  4KIK A;  4EZJ A;  3DHH C;  4P7I A;  5AUI A;  4WWM A;  3N3K B;  1NTV A;  1C78 A;  3WAL A;  4C00 A;  3P4P B;  2LVQ A;  4K7U A;  2BVC A;  4AJW A;  5H8Y E;  1VZ7 A;  2GJY A;  5IRS A;  3ENB A;  3MTN B;  3MC0 B;  5E6P A;  3Q69 A;  2JQR B;  1R4M I;  2LD9 A;  4HB2 B;  2JWZ A;  3UZT A;  3AN1 A;  1UNR A;  1JW9 D;  2KAN A;  2IFS A;  4GB9 A;  4A8X C;  2MCN B;  1R4N B;  4F1S A;  1ACA A;  1DYQ A;  3CIK A;  3K9O B;  3ULC A;  3A9K A;  5LOP B;  1T3Q A;  3N1Y C;  4IWP A;  5BMI A;  1XO3 A;  4YTM B;  3E9S A;  3EC8 A;  3FLV A;  2D9Z A;  5DPT A;  2KQ7 A;  2ROZ B;  4JK9 A;  4HRS A;  3ZGZ A;  4A6Q A;  3U7D A;  3HVZ A;  3AE4 B;  2DTC A;  3T3N A;  2NMB A;  4GOC A;  2VRW B;  3QX1 A;  4PS7 A;  1FXT B;  2N7J A;  4ZRP A;  3RPF C;  3VR9 B;  4LDT D;  3Q2A C;  3RT3 B;  4BOS C;  2L05 A;  3PPA A;  4GLS C;  4ITK A;  2O6V D;  1MKE A;  2RNR B;  4ZYS A;  2KJH B;  2COA A;  1WRD B;  3U8Z A;  4CSQ A;  2K8H A;  4DHJ B;  1D3Z A;  1C76 A;  2L76 A;  1C4P A;  1P6S A;  1I4Q A;  1WJU A;  2HTH A;  4K81 A;  1L5P A;  2GBJ A;  3AE1 B;  2KC1 A;  4BAX A;  4AP4 C;  5IA7 A;  1V89 A;  4RNA A;  2LGY A;  4LJP B;  4ZRQ A;  5TR5 A;  4AUQ C;  4HLE A;  4PS3 A;  4CHK A;  1K5D B;  2OJW A;  1LXD A;  5FI1 A;  1T0S C;  2JU6 X;  4XE0 A;  3T9L A;  3R66 C;  1E8Z A;  1E5W A;  4W9J A;  2XK5 A;  1PMS A;  2ZNV B;  3SFE B;  4AOF A;  1WYW B;  2MRP A;  1P9D U;  4UDU C;  3AEB B;  4JLC A;  1IUE A;  1T0Q C;  4DIX A;  4JQW C;  4RGN A;  1FFV A;  3O13 A;  3M62 B;  1NEN B;  2V9H A;  2EC1 A;  5CHF A;  1D6E C;  3DCX A;  1RYJ A;  2MDX A;  3UIO B;  2QEJ C;  2YS1 A;  5G2N A;  3NZU A;  2DFK A;  2RRF A;  4R3D A;  1EF5 A;  3I3T B;  3PZ7 A;  4WWP A;  3QIJ A;  1PGX A;  3VXW A;  4FUL A;  1QOA A;  4QJ3 B;  2DYN A;  4M0W B;  2WXR A;  4WWO A;  3BVZ A;  2GBN A;  3ZW3 A;  2A5U A;  2UZS A;  1C1Y B;  2G4S A;  1IBX B;  3BK1 A;  1T0R C;  4HB0 B;  2MJD A;  2NR2 A;  3KRW A;  2QC8 A;  3IHP C;  2YEP B;  1K52 A;  3AI5 A;  1PGA A;  1XR0 B;  2Y5P A;  2HTM E;  3DBS A;  5C2T B;  1TXD A;  2W3R A;  3NVZ A;  4G50 A;  2LUE A;  2LXC A;  5C79 A;  4GXB A;  3DBL B;  4DWF A;  3EFU A;  4HHV A;  2L8J A;  2MEK A;  4JKF A;  2H89 B;  3ZNI D;  1I4H A;  3SDL C;  2WX0 A;  4KKI A;  4YSY B;  2ZEQ A;  2DHK A;  3A4R A;  4JKG B;  2I2Y A;  4MK0 A;  3V6C B;  3SUZ A;  3AH7 A;  1EVH A;  2D9Y A;  2RD0 A;  3BJI A;  3V05 A;  3D32 A;  2KWC A;  1B1Z A;  2L0T A;  1T6B X;  1OQQ A;  2BS4 B;  4W9G A;  2RSU A;  1C79 A;  2OQB A;  1P3Q U;  4RF0 A;  3AUL A;  4YTN B;  1ET9 A;  5C1Z A;  1IGD A;  4KHB B;  3AEG B;  3IFW B;  1DOI A;  1PLS A;  1WR1 A;  3UQA A;  3AXC A;  1M7E A;  2ZKM X;  3MPX A;  2LGS A;  3UIP B;  3H7P B;  1D4B A;  4GDK A;  2L3Z A;  3SU8 X;  5G5H A;  1TKY A;  4FN2 A;  4YXD B;  1KF6 B;  1J0G A;  1WGG A;  4Z2M B;  4C0A A;  3KYC D;  1WG7 A;  3KZ1 A;  2FUG 1;  3IT6 B;  1AWD A;  3OJ3 A;  2X0S A;  1TS3 A;  5JHB A;  4FXC A;  1QC6 A;  4M02 A;  4JWU C;  5KQ1 A;  1HQR D;  3WAP A;  2KFK B;  3L13 A;  2R2O A;  2FDQ A;  1K53 A;  1YQ3 B;  3BWU D;  4IOI E;  1XD3 B;  2KNB A;  2K6D B;  2MWS B;  2JRH A;  1U4A A;  1SBB B;  4DX8 A;  1K5G B;  3QWZ B;  1UEF A;  4OT1 A;  2MSE D;  3A9J B;  3CSF A;  5D7G A;  4GNK B;  3Q6B A;  3VAW A;  4MM3 A;  2KT7 A;  2JT4 B;  3G9W A;  3B9J A;  4P16 A;  4IG7 B;  4ANX A;  1DYN A;  3Q8E A;  3APD A;  1ET6 A;  2UWQ A;  5CLQ B;  3A4S C;  1LO5 D;  3C8Y A;  2LUM A;  3ZJT A;  1WZ0 A;  4GPT B;  5J2R A;  2DX5 A;  2JPH A;  2DYM A;  3ZRC A;  1GOZ A;  4XWW A;  4ZOH C;  2DZI A;  1CZP A;  1P1A A;  2CS4 A;  3VTW A;  1LW3 A;  2IJ0 A;  2IPK D;  5BYR A;  2R2Q A;  4I6N B;  4GN1 A;  1MVK A;  1V5U A;  4B6H A;  1YJ1 A;  3CXB B;  2IYB A;  2D9X A;  2QJL A;  4XWX A;  4ANV A;  1SGH A;  1SEB D;  1BTK A;  2JX5 A;  3L0W B;  2MKR A;  4ACF A;  1E9M A;  1WJ4 A;  1P0R A;  1V80 A;  4EKU A;  5EE3 A;  3JSV B;  2WXN A;  5HE1 A;  2WNM A;  2J53 A;  3LB8 C;  2D3B A;  2K6Q A;  4OVV A;  4OVZ A;  2ICI A;  3PV1 A;  3ODW A;  4KSK C;  2WXG A;  4HCN B;  1VBH A;  4MGK E;  4GU2 A;  1FGZ A;  5D3V A;  2NS5 A;  2CU3 A;  3WIM A;  2I38 A;  2J7Q B;  2N4F A;  1AQC A;  4JKE A;  2PLP A;  2LYD A;  3RFZ B;  2B3A A;  4WH4 A;  1WXV A;  2YLM A;  3P4S B;  1C4C A;  4IC7 B;  2K3U A;  1WI0 A;  3SYX A;  1RLF A;  1J8C A;  1U2B A;  1JWM D;  1XEE A;  2H88 B;  4RM9 A;  5EE9 A;  1FMA D;  2NTS A;  1HB8 A;  1NTI A;  2N9K A;  4II2 B;  2RGF A;  1T0Y A;  1KZ7 A;  3VFK A;  1EO6 A;  2PIA A;  4OVU A;  4WJN A;  1YJJ A;  1FIQ A;  5I2M A;  2KR0 A;  3DBR I;  2DKP A;  2R61 A;  1U5E A;  1E8X A;  3ZXR A;  3NWA A;  2D3A A;  2V3P A;  3P6A A;  1ZOY B;  2WXH A;  4BFR A;  2JXT A;  4AWJ A;  2DZK A;  2V0G A;  3DVN V;  1JRP A;  1K8R B;  2JSV X;  3KW5 B;  1ZM0 A;  3APC A;  1FRR A;  5EE0 A;  2BF8 B;  2PKO A;  3FKY A;  2KMA A;  4YTP B;  2LXA A;  4A20 A;  1G6J A;  1JQ4 A;  4KAX B;  4MT5 A;  1Q1O A;  4JKG A;  4FLH A;  4KSL C;  3PZD A;  4IWQ A;  2AL3 A;  2MA9 B;  2KUQ A;  4ICU A;  2JUO A;  5DHF B;  1R7S A;  3UIN B;  2CRF A;  3ML8 A;  3NOB A;  1WZ3 A;  3SEB A;  1TGZ B;  1UD7 A;  3KUZ A;  3JYU A;  1GB4 A;  1OQY A;  2O2V A;  4KHB A;  3PVW A;  4ZDV A;  2K2J A;  5DPS A;  3GE8 C;  2YEP F;  1TBE A;  3Q3J A;  4WJO A;  3T3O A;  2DAF A;  5CTR C;  1SE2 A;  3E56 A;  1HBK A;  2C7H A;  5LLI A;  1LM8 B;  3JW0 X;  3H7P A;  4RM8 A;  1KC7 A;  1M94 A;  2MBB B;  3DHI C;  2LMC A;  4KGR A;  2KLG A;  2GS0 A;  2W2X C;  4MEM A;  2GCL A;  2IO0 B;  1P7E A;  4US8 A;  3ALB A;  1VBG A;  3RZF A;  3FSS A;  2KO3 A;  3TO1 A;  2CJN A;  4ZYN A;  4LCD E;  1WGR A;  4L6E A;  1WXQ A;  3AE7 B;  3R3M A;  1FNV A;  2RLO A;  3RYT A;  2JP2 A;  4EJN A;  2IZV B;  2ACZ B;  4HAX B;  3ZDM C;  2VRR B;  1XQQ A;  2CHW A;  1ZYI A;  3S2A A;  1XOD A;  1JWU D;  5D94 A;  1EF1 A;  1I4G A;  1N63 A;  1GAQ B;  1GB1 A;  3WYF B;  3WAM A;  3W5V B;  4Z2N A;  4HB3 B;  1TY2 A;  3R2I A;  1A5R A;  1Z2M A;  4NQL B;  4M8N A;  1SJH D;  3NUH B;  3OAN A;  1RRB A;  3VTV A;  5DPR A;  2RDB C;  4HK2 A;  2CQU A;  3AJ4 A;  4NAW A;  3TCA A;  1VJK A;  4K7W A;  2QIL A;  3PLU A;  1ZVR A;  3AE9 B;  2PVG C;  4DK5 A;  2ZPN A;  1WXS A;  1YN3 A;  1NVL A;  3H7S A;  3T8M A;  5J17 A;  4ANW A;  3E66 A;  1J7B A;  3IT4 B;  4QJ4 B;  4XC2 A;  1DDW A;  1OEY A;  4J6I A;  2V76 A;  2LBB A;  2IGH A;  1ZC3 B;  4IOY X;  4KX6 B;  5IP4 D;  3SBT A;  2DKQ A;  4KHA A;  2OOB B;  2KCJ A;  1EWY C;  2IGD A;  2RSG A;  2COF A;  4DXG A;  2JRI B;  3HSA A;  5DPW A;  1CMX B;  3RNE C;  1OY2 A;  3U2S C;  1QQG A;  1R4N I;  3L17 A;  3F5R A;  3DQV A;  5BMH A;  1FD6 A;  3RZW C;  3V61 A;  1VR9 A;  1SE4 A;  1MIZ B;  2K49 A;  3BII D;  1Y19 B;  3IAS 1;  2DX1 A;  2LUL A;  1ZDV A;  3B2F A;  3ZVV A;  1MAI A;  4HKZ E;  2GMI C;  2GBM A;  4XX5 A;  3L10 B;  1TS4 A;  4HRO A;  1XCT L;  1Q67 A;  2W54 A;  1I4R A;  3QK0 A;  4YWG G;  3A1Q B;  2PMV A;  2VH1 A;  1NVI D;  1WMH A;  4WAA A;  1W1G A;  4ICV A;  5HKH A;  2WHI A;  4P1C C;  3C0R B;  3RMK C;  4A9A A;  1XF5 L;  5JHA A;  2WYQ A;  4A6H A;  5C6R A;  2CJO A;  4MY6 A;  2XN9 C;  4HAT B;  4C4V A;  4A3P A;  2MX2 A;  4NJ6 A;  3EA6 A;  3PLV A;  3KRX A;  5FKA C;  1J19 A;  1N5W A;  1CQV A;  4EFO A; 
#chains in the Genus database with same CATH homology
 3ZVR A;  1I35 A;  2Y8G A;  1WM3 A;  2P0H A;  2REX A;  4WSF A;  1WGU A;  5JLJ B;  4DDG D;  2KDE B;  4HPL B;  4EEW A;  3B0A A;  2D9V A;  1AAR A;  3APF A;  1E8W A;  1Q0W B;  3HM3 A;  3PTF C;  4K2O A;  5EDS A;  2JF5 A;  2M4N A;  3EHV A;  3KY9 A;  4GSW A;  4BVU C;  2LGD A;  1WJN A;  2KJR A;  1NTY A;  1NDD A;  3R7Q A;  5AEK B;  5JP4 A;  2BWE S;  5L95 C;  3RUL A;  2FCS A;  3IBE A;  4HVB A;  5LXH A;  2Z0P A;  3TFM A;  2KTF A;  2RR9 A;  3PGE A;  1ZSQ A;  2NBU A;  3ML9 A;  3SNH A;  3P2B A;  2WX1 A;  5IJM A;  2XBB C;  1UZX B;  1B55 A;  2Q13 A;  1X1M A;  4MSQ B;  4NQK E;  5C16 A;  2OJR A;  2DAJ A;  5KHO A;  4NNJ B;  1FAO A;  3KSY A;  5CHV C;  4ILJ A;  2CY4 A;  3VH3 B;  2PE6 B;  2M14 A;  5J3T A;  1FHX A;  5KCV A;  1P5T A;  2N1V A;  3PVU A;  2COD A;  5IAA C;  4IM2 A;  4GMV A;  2KD0 A;  2MLB A;  2ASQ A;  2JY6 A;  4W9I A;  4WWN A;  2UZR A;  1OGW A;  4EUT A;  4HB4 B;  2KQS A;  4B9K A;  2A4Z A;  1WJ1 A;  2GBK A;  2K39 A;  1V49 A;  1WXM A;  2NBV B;  3RD2 A;  1WJM A;  3A98 B;  2ELB A;  4DHJ D;  2FIF A;  5BO4 B;  1DBH A;  1MK7 B;  1S1Q B;  1OMW A;  1ZKH A;  2I1K A;  3DPD A;  1DRO A;  2D3G A;  3DVG X;  4KV2 A;  1IYF A;  4ZRJ A;  3ZNH B;  4HDO A;  4MGZ E;  3ZTD A;  1GGO A;  3V62 A;  3L54 A;  5DH9 B;  4A3O A;  4N9F 4;  2WWZ A;  3RUI B;  2YVC A;  1UBI A;  2ROV A;  5D27 A;  4A6F B;  3H9D A;  4W9K A;  2Y7B A;  1OTR B;  1I2H A;  2ZPY A;  3D8E A;  3NSU A;  2P8V A;  2KWV B;  1X05 A;  2MP2 B;  2FCQ A;  1P98 A;  4CHM A;  2O6V A;  4FAD A;  2MBQ A;  4EZL A;  3HHM A;  1UBQ A;  2GBR A;  3DVG Y;  1WJ6 A;  2KZR A;  4JK7 A;  3ODO A;  1V6E A;  1WXA A;  1LQB A;  2D07 B;  2BKF A;  3ZDT A;  2NPT B;  5D3X A;  2ZJD A;  3OAW A;  1V5M A;  3QA8 A;  2V3S A;  1RAX A;  1MK9 B;  4FJZ A;  5HE0 A;  2J0M A;  3SV1 A;  1RJ2 A;  4BBK A;  2JZ3 B;  1WX9 A;  2YRY A;  2N1W A;  2RQ1 A;  4II3 B;  2YS5 A;  3HM6 X;  3QCA A;  1V61 A;  4GMX B;  3VIA A;  2KTR B;  4HAU B;  4ILH A;  3TIX A;  3MDB C;  4RMA A;  5EFX A;  1OEY J;  3WA0 A;  1GG3 A;  3DDC B;  2KGX B;  5C5B B;  4W9C A;  2CY5 A;  3PVL A;  2Z0O A;  3HK0 A;  1N3H A;  2COP A;  3ULB A;  1LFD A;  2YS3 A;  3PT2 B;  3A8P A;  2LOX A;  2K2U A;  3W1S A;  4EZK A;  2BYF A;  5DCN A;  5AZG A;  2GOW A;  3QHT A;  3O96 A;  1WGQ A;  3T06 A;  2AYO B;  4PYU A;  2EMS A;  2M8S A;  3DCG A;  2W9N A;  4EOY A;  4D0N B;  4BOZ B;  2Y8F A;  4F8C B;  1SHC A;  1QZE A;  3P7Z A;  3SBG A;  1U29 A;  2Y5B B;  2VSZ A;  2WH5 A;  5FI0 A;  1BTN A;  1TQZ A;  2K8C A;  1EUV B;  3L08 A;  2VKI A;  3A33 B;  4Y94 A;  3Q3F A;  1DDV A;  2KK8 A;  5G55 A;  1PQS A;  2ZVO A;  2IO3 B;  2IBI B;  1TZ1 A;  2JZZ A;  1Y5O A;  4MJS B;  1JRU A;  2MBE A;  2ABD A;  3ECI A;  4A6K A;  2LZ6 A;  4MGY E;  3ZTC A;  3VHT C;  2XQN M;  2NBW B;  3M3J A;  4JKD A;  4A6F A;  4F7H A;  1WGD A;  2EKE C;  2KWU B;  4KZC A;  3VTU A;  4KHO A;  1UPR A;  4TKN A;  2PZ1 A;  2YT1 A;  1AWE A;  1WX7 A;  2QKM A;  1NI2 A;  2FCN A;  4CHJ A;  2N9P C;  2Z0D B;  2FCM A;  4TYZ A;  4KIK B;  4IUM B;  3BIN A;  1UGM A;  4X57 B;  3QBV B;  5CHW A;  3QQ8 B;  3M1I B;  2CAY A;  3L16 A;  4YL8 A;  1HE8 A;  3H6N A;  5HE2 A;  3E9L A;  4TV3 A;  2V1Y A;  4BBN F;  3HIZ A;  2R09 A;  2YSZ A;  3X23 A;  5J3Y A;  4IAP A;  3N30 A;  3PS6 A;  4DDI D;  2DEN B;  1WGH A;  4HXD A;  2HE7 A;  3M95 A;  2N7D A;  1YQB A;  5JHH A;  2KDF B;  1BT0 A;  5CLL B;  1U5G A;  2KDI A;  4ILG B;  3A9K B;  2IO1 B;  2KFK A;  4EMO A;  2BWF A;  4GZU A;  1TTN A;  2UYZ B;  2G45 B;  2X18 A;  1OQN A;  1GC7 A;  2CKH B;  5DHA B;  3A9J A;  2YF0 A;  2KTR A;  3ZIM A;  3H1U A;  1ST7 A;  3HQC A;  1WF9 A;  2NZ8 B;  1EGX A;  5D3W A;  1WFY A;  4TQ1 A;  4DX9 0;  2MBH A;  2BKR B;  3IVF A;  4ASW C;  2UVM A;  2JXX A;  2KMC A;  5LON B;  4AJY B;  5GMV A;  2WDT B;  1YIW A;  4CYE A;  3EPY A;  3LJU X;  2J0K A;  2D10 A;  3JSV A;  1KJT A;  3ZNG C;  2LWP A;  1ZC4 B;  2DYQ A;  2KVR A;  3RCP A;  5DI9 B;  2FID A;  5J18 A;  3PHW B;  1RFA A;  5JHG A;  1E7V A;  5GOW B;  1U5F A;  3ZKJ C;  4W9H A;  1MPH A;  3AU5 A;  4URK A;  1W1D A;  3N7C A;  1M7R A;  2DZM A;  3VUX A;  2CHZ A;  3PSC A;  2C7N B;  3PP2 A;  2AWT A;  2EMT A;  3JVZ X;  3PSE B;  4WVF B;  3GYP A;  1Y8R C;  1H4R A;  4CO7 A;  2BPS A;  4ZRI A;  3QAQ A;  1WE6 A;  3MJW A;  2KX3 A;  3VUW A;  2E2X A;  3DVN U;  3NHE B;  1E7U A;  4JKA A;  2CR5 A;  3KYD D;  2QHO A;  4F7G A;  4WJP A;  4JL9 A;  2Z0E B;  2QKL A;  1V81 A;  2DIK A;  3V6E B;  4NJ7 A;  2FJ9 A;  1BWN A;  3TBL D;  2ELA A;  3IG3 A;  4W9F A;  3O65 B;  1UPQ A;  3EEC A;  4W9D A;  3GYO A;  4GDK B;  2L1C A;  1X86 A;  3ONS A;  1X11 A;  2LVO A;  5LXI B;  4KVG B;  1V5O A;  4IM3 A;  3UGB B;  4YON A;  2MFQ A;  3VQI A;  4FHK A;  2KKC A;  3ENE A;  1KBL A;  2PE9 A;  3WAO A;  2PJH A;  5E6O A;  1FHW A;  3DBL I;  1HB6 A;  2C9W B;  4FHJ A;  3QAR A;  1KZG A;  3A8Q A;  4JKH A;  1H8C A;  5JH5 C;  4GIV A;  2XEW A;  1UH6 A;  3PG7 A;  4F7U P;  4LJO B;  2KUP A;  4JK8 A;  2V4L A;  2FJL A;  2DX5 B;  3TL5 A;  2AL6 A;  3E9O A;  3KH0 A;  1YD8 U;  3CST A;  1VD2 A;  2I1J A;  4HDQ A;  1C3T A;  1V9J A;  4K7S A;  2LGX A;  2M17 A;  3LJ3 A;  1H10 A;  2MW5 A;  5FR6 A;  2ZVN A;  2H7D A;  2C7M B;  5D2M B;  2BYE A;  2CHX A;  2DA0 A;  4F7Z A;  5KQ4 A;  1X1G A;  4HAV B;  2G35 A;  3B1L X;  4B6W A;  3OLM D;  4HAZ B;  2HJ8 A;  2LOZ A;  4JIO U;  4ANU A;  2D2Q A;  2JVC A;  2K25 A;  2HRJ A;  4KDI C;  1TJ6 A;  2N9X A;  3VOQ A;  1V2Y A;  3PRP B;  2RVB B;  4PYZ A;  2C60 A;  3ZUN A;  1IRS A;  2Z59 B;  3UQB A;  3A1Q A;  4HCP B;  4HPM B;  4A5K A;  3V5W A;  3GOE A;  3K9P B;  1U5D A;  3KVF B;  1ZGU B;  3DXE A;  3X0W A;  3ZNZ B;  3N32 A;  2W2X D;  2N0Y A;  3FP5 A;  1WH3 A;  2K8B A;  1WX8 A;  3B08 A;  1DIK A;  1GUA B;  3VUY A;  4PNK A;  1UNQ A;  1V88 A;  4PS8 A;  3FM8 C;  2K00 A;  2P0D A;  4MT7 A;  2FUH B;  2YT0 A;  3D8D A;  2KXJ A;  4W9E A;  1KM7 A;  1W1H A;  1E8Y A;  3TVV A;  2ZZP B;  4K17 A;  1WY8 A;  1WGY A;  2O2V B;  4E3C A;  3W1Y A;  3ZLZ A;  4HAW B;  4IM0 A;  4G3X B;  2D4Q A;  1MG8 A;  3WAN A;  3DBH I;  3ZO5 B;  2LRW A;  1NBF C;  1FB8 A;  2GCJ A;  2K1F A;  1V5P A;  2N7E A;  4WJQ A;  5JZE B;  1WI1 A;  2OTX A;  4K2P A;  1UNP A;  3NS8 A;  2KOX A;  4DBG A;  1P3R A;  4G0N B;  2ADZ A;  2NVU I;  2DN6 A;  4DXA B;  3QJZ A;  1IP9 A;  2FAZ A;  1XX0 A;  1EAZ A;  2RPQ A;  1ISN A;  3VVW B;  1JDE A;  1L2N A;  4H8S A;  4MH0 E;  1WR6 E;  5D3Y A;  3VH4 B;  4BKS D;  2LI5 A;  4HAY B;  1KLV A;  1J0W A;  3TMP B;  2KN5 A;  2KJ6 A;  1F9J A;  5C23 A;  3PHX B;  5DIF B;  1FHO A;  2L7R A;  4NAW B;  3PEG A;  2I5F A;  4GGQ A;  2J0J A;  1SE9 A;  4G11 A;  3ODX A;  2CU1 A;  4W9L A;  5AZH A;  2FNJ B;  4E71 A;  4I6P A;  3U30 A;  1LB1 A;  1Z87 A;  3DXC A;  2ZCB A;  2L00 B;  1V86 A;  1Q5W B;  2C5L C;  3TJP A;  4NPN A;  2KLC A;  3V60 A;  4GDL B;  4XZ4 A;  2MBO A;  2M1M A;  2LKO A;  4JKB A;  1GJZ A;  1FGY A;  3ML4 A;  5CX3 A;  3PRE A;  3HW2 B;  2LVP A;  1ZW7 A;  3SD5 A;  4BKT A;  1WVH A;  1I42 A;  1YX5 B;  2L0F A;  1WMH B;  1V5T A;  2PEA A;  3PRM B;  2M38 A;  2DYB A;  1RRP B;  4ZRK A;  2MQJ A;  2R82 A;  4DHZ E;  5AZF A;  2BGF A;  3QC8 B;  2KDB A;  4K1R B;  4M8M A;  2RGN B;  2MP2 A;  3KUC B;  4BKG A;  2PPH A;  3M63 B;  4DHZ B;  1KOT A;  1DDM A;  4WQO B;  1GC6 A;  2M0X A;  4MGI E;  2BCJ A;  4KZ0 A;  4HWI B;  2R0D A;  4DBB A;  4BKS A;  2KHW B;  3AU4 A;  2D9W A;  3W1S C;  3E9P A;  2G4D B;  4IFS A;  1Z5S B;  2P0F A;  2NPT A;  3DOW A;  1XKE A;  1NU2 A;  4IW0 A;  5HE3 A;  4MSM B;  2ZNV C;  3PRZ A;  4IWO A;  2W2W A;  2DZJ A;  2N23 A;  1KI1 B;  2LAS A;  2DYO A;  3ZRF A;  3MHS D;  1YX6 B;  5E6N A;  4KDL B;  3DXD A;  3KUD B;  3BY4 B;  2D11 A;  1UEL A;  3LDZ E;  5L81 A;  4FJV B;  2G3Q B;  1XCG A;  2KC2 A;  5C5B A;  2IO2 B;  3NZS A;  3CMM B;  4JKC A;  4WJ7 A;  2IY0 B;  2Z0Q A;  3OJ4 B;  3VDZ A;  2HTH B;  1L7Y A;  4FBJ B;  2IYD B;  1FOE A;  1U27 A;  1XD4 A;  2DHI A;  2LRU A;  4BBN C;  1GNU A;  4MEL A;  2N9E B;  2NCN A;  1VCB A;  3SO6 A;  2IY1 B;  2XK5 B;  2ZCC A;  3RCZ A;  2DHJ A;  4HJK A;  2DLW A;  3D8F A;  1MIX A;  4FA6 A;  4B95 A;  2RUK B;  4FJY A;  2MWN B;  1WE7 A;  3SHQ A;  1BAK A;  2L2I A;  4TUU A;  2I5C A;  2COC A;  3F0W A;  3GZN I;  3UF8 A;  3CF6 E;  2J59 M;  2EJ8 A;  1S3S G;  5L83 A;  1E90 A;  5KHQ A;  1SIF A;  4GDL A;  2HD5 B;  1IPG A;  2DHZ A;  1WM2 A;  4NSW A;  2BYV E;  4PQ0 A;  3FEH A;  1XT9 B;  5JVL A;  4MJS A;  4TQ0 A;  3NY5 A;  4MDK E;  1PFJ A;  3TW1 A;  2KFJ A;  3QWM A;  2H7E A;  2LJ5 A;  4JGH B;  1X1F A;  2LG1 A;  5D6J B;  1I7A A;  2KX0 A;  4LDT B;  4NY0 A;  4E74 A;  4I6L B;  2O6V B;  1WIA A;  2CB8 A;  3R7R A;  5J3Q A;  2AEH A;  4KIK A;  4EZJ A;  4P7I A;  3N3K B;  1NTV A;  3WAL A;  2LVQ A;  4K7U A;  4AJW A;  2GJY A;  3MTN B;  3ENB A;  5E6P A;  1R4M I;  2LD9 A;  4HB2 B;  2JWZ A;  3UZT A;  1UNR A;  2KAN A;  2IFS A;  4GB9 A;  2MCN B;  4F1S A;  1ACA A;  3CIK A;  3K9O B;  3ULC A;  3A9K A;  5LOP B;  4IWP A;  3EC8 A;  3FLV A;  2D9Z A;  5DPT A;  2KQ7 A;  2ROZ B;  4JK9 A;  3U7D A;  2DTC A;  2NMB A;  4GOC A;  4PS7 A;  2VRW B;  3QX1 A;  1FXT B;  3RT3 B;  4LDT D;  4BOS C;  2L05 A;  3PPA A;  2O6V D;  1MKE A;  2RNR B;  2KJH B;  2COA A;  1WRD B;  3U8Z A;  2K8H A;  4DHJ B;  1D3Z A;  2L76 A;  1P6S A;  1WJU A;  2HTH A;  4K81 A;  2GBJ A;  2KC1 A;  4AP4 C;  5IA7 A;  1V89 A;  2LGY A;  4LJP B;  5TR5 A;  4AUQ C;  4HLE A;  4PS3 A;  4CHK A;  1K5D B;  1LXD A;  5FI1 A;  3T9L A;  3R66 C;  1E8Z A;  1E5W A;  4W9J A;  2XK5 A;  1PMS A;  2ZNV B;  4AOF A;  1WYW B;  2MRP A;  1P9D U;  4JLC A;  4JQW C;  3M62 B;  2EC1 A;  5CHF A;  2MDX A;  3UIO B;  2YS1 A;  5G2N A;  3NZU A;  2DFK A;  1EF5 A;  3I3T B;  4WWP A;  3QIJ A;  3VXW A;  4FUL A;  2DYN A;  4M0W B;  4WWO A;  2GBN A;  3ZW3 A;  2A5U A;  2UZS A;  1C1Y B;  2G4S A;  4HB0 B;  2NR2 A;  3IHP C;  3KRW A;  3AI5 A;  1XR0 B;  3DBS A;  1TXD A;  4G50 A;  2LUE A;  2LXC A;  5C79 A;  4GXB A;  4DWF A;  3EFU A;  4HHV A;  2L8J A;  4JKF A;  3ZNI D;  3SDL C;  2WX0 A;  2ZEQ A;  2DHK A;  3A4R A;  4JKG B;  4MK0 A;  3V6C B;  3SUZ A;  1EVH A;  2D9Y A;  2RD0 A;  3BJI A;  3D32 A;  2KWC A;  2L0T A;  4W9G A;  2RSU A;  2OQB A;  1P3Q U;  3AUL A;  5C1Z A;  4KHB B;  3IFW B;  1PLS A;  1WR1 A;  3UQA A;  3AXC A;  1M7E A;  3MPX A;  3UIP B;  3H7P B;  4GDK A;  2L3Z A;  3SU8 X;  4FN2 A;  1J0G A;  1WGG A;  4Z2M B;  4C0A A;  3KYC D;  1WG7 A;  3KZ1 A;  3OJ3 A;  2X0S A;  5JHB A;  1QC6 A;  5KQ1 A;  3WAP A;  2KFK B;  3L13 A;  2R2O A;  2FDQ A;  1XD3 B;  2KNB A;  2K6D B;  2MWS B;  2JRH A;  1U4A A;  4DX8 A;  1K5G B;  3QWZ B;  1UEF A;  2MSE D;  3A9J B;  3CSF A;  5D7G A;  3VAW A;  4MM3 A;  2JT4 B;  3G9W A;  4IG7 B;  4ANX A;  1DYN A;  3APD A;  2UWQ A;  5CLQ B;  3A4S C;  1WZ0 A;  4GPT B;  5J2R A;  2DX5 A;  2JPH A;  2DYM A;  3ZRC A;  2DZI A;  1P1A A;  2CS4 A;  3VTW A;  1LW3 A;  2R2Q A;  4I6N B;  4GN1 A;  1V5U A;  4B6H A;  1YJ1 A;  3CXB B;  2IYB A;  2D9X A;  4XWX A;  4ANV A;  1SGH A;  1BTK A;  3L0W B;  2MKR A;  1WJ4 A;  1P0R A;  1V80 A;  4EKU A;  3JSV B;  5HE1 A;  2K6Q A;  4OVV A;  3PV1 A;  3ODW A;  4KSK C;  4HCN B;  1VBH A;  4MGK E;  4GU2 A;  1FGZ A;  5D3V A;  2NS5 A;  3WIM A;  2J7Q B;  2N4F A;  1AQC A;  4JKE A;  2LYD A;  2B3A A;  1WXV A;  2YLM A;  4IC7 B;  1WI0 A;  3SYX A;  1RLF A;  1J8C A;  1U2B A;  4RM9 A;  1HB8 A;  1NTI A;  4II2 B;  2RGF A;  1T0Y A;  1KZ7 A;  3VFK A;  1EO6 A;  4OVU A;  4WJN A;  3DBR I;  2DKP A;  1U5E A;  1E8X A;  3P6A A;  4BFR A;  4AWJ A;  2DZK A;  3DVN V;  1K8R B;  3KW5 B;  1ZM0 A;  3APC A;  2BF8 B;  2KMA A;  2LXA A;  4A20 A;  1G6J A;  4KAX B;  1Q1O A;  4JKG A;  4FLH A;  4KSL C;  3PZD A;  4IWQ A;  2AL3 A;  2MA9 B;  4ICU A;  2JUO A;  5DHF B;  3UIN B;  2CRF A;  3ML8 A;  3NOB A;  1WZ3 A;  1TGZ B;  1UD7 A;  3KUZ A;  3JYU A;  1OQY A;  2O2V A;  3PVW A;  4ZDV A;  2K2J A;  5DPS A;  4WJO A;  1TBE A;  3Q3J A;  2DAF A;  5CTR C;  1HBK A;  2C7H A;  5LLI A;  1LM8 B;  3JW0 X;  3H7P A;  4RM8 A;  1KC7 A;  1M94 A;  2MBB B;  2KLG A;  2GS0 A;  2W2X C;  4MEM A;  2GCL A;  2IO0 B;  3ALB A;  1VBG A;  3RZF A;  3FSS A;  2KO3 A;  3TO1 A;  4ZYN A;  4LCD E;  1WGR A;  4L6E A;  3R3M A;  2RLO A;  3RYT A;  2JP2 A;  4EJN A;  2IZV B;  3ZDM C;  4HAX B;  2VRR B;  1XQQ A;  2CHW A;  3S2A A;  1XOD A;  5D94 A;  1EF1 A;  3WYF B;  3WAM A;  4Z2N A;  4HB3 B;  1A5R A;  1Z2M A;  4NQL B;  4M8N A;  3OAN A;  1RRB A;  3VTV A;  5DPR A;  4HK2 A;  2CQU A;  3AJ4 A;  4NAW A;  3TCA A;  4K7W A;  3PLU A;  1ZVR A;  4DK5 A;  2ZPN A;  1WXS A;  1NVL A;  3H7S A;  3T8M A;  5J17 A;  4ANW A;  3E66 A;  4XC2 A;  1DDW A;  1OEY A;  4J6I A;  2V76 A;  2LBB A;  1ZC3 B;  4IOY X;  3SBT A;  2DKQ A;  4KHA A;  2OOB B;  2KCJ A;  2RSG A;  2COF A;  2JRI B;  5DPW A;  1CMX B;  1OY2 A;  1QQG A;  1R4N I;  3L17 A;  3F5R A;  3DQV A;  3RZW C;  3V61 A;  1MIZ B;  1Y19 B;  2DX1 A;  2LUL A;  3ZVV A;  1MAI A;  2GMI C;  2GBM A;  4XX5 A;  3L10 B;  1Q67 A;  3QK0 A;  3A1Q B;  1WMH A;  4WAA A;  1W1G A;  4ICV A;  5HKH A;  3C0R B;  5JHA A;  2WYQ A;  4A6H A;  5C6R A;  4MY6 A;  4HAT B;  4A3P A;  2MX2 A;  4NJ6 A;  3PLV A;  3KRX A;  1J19 A;  4EFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...