3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
b'VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
2VRRB 2MQJA 1BWNA 3PRMB 2IFSA 4RM9A 4W9EA 3SD5A 2BYEA 3BJIA 2D10A 3P6AA 3VTWA 4AJYB 2FJLA 3L13A 2K25A 3TL5A 4KAXB 4BKGA 2DAJA 4KHAA 5LONB 2WH5A 4X57B 2KDBA 2RNRB 1Y5OA 2DHJA 4FA6A 2GMIC 5KQ1A 3UZTA 4F8CB 4K81A 4LDTD 1I2HA 2Z59B 2DHZA 3W1YA 1WI1A 1AWEA 5TR5A 4W9KA 3A1QB 1TBEA 3GZNI 4HCNB 2ZJDA 1OEYA 1P9DU 3P7ZA 2Y7BA 2MSED 2W2XC 3TVVA 3JSVB 3DVGX 3PG7A 1ZC3B 1DDMA 2D07B 3A4SC 1IP9A 2KNBA 3HK0A 2MW5A 2CQUA 4HPMB 2BF8B 5D6JB 3ZW3A 4F7GA 4XC2A 4IM3A 3L10B 3A33B 4MELA 3K9PB 2BKFA 2PZ1A 3CSTA 4BVUC 4DHZB 2COCA 2COPA 1WGUA 1HB6A 1P3RA 3IG3A 2KC1A 4MEMA 2G45B 2N7DA 1H4RA 2FDQA 1Z2MA 1ZC4B 2K00A 2DAFA 1WJMA 2DYQA 3DBHI 3ENEA 5BO4B 2IY0B 1XD4A 3A9KB 2DA0A 4A6FA 3PPAA 2RD0A 1WZ3A 2R09A 4MJSA 3HM6X 1WXAA 2KC2A 4ASWC 1Q67A 2LVOA 4HB0B 1HE8A 2JRIB 1DROA 1M7RA 1C3TA 3OAWA 4ICVA 3PRPB 2ZCCA 4W9CA 4EFOA 5AEKB 4CYEA 1BAKA 2JT4B 3ZNHB 3PZDA 1E7VA 1WE6A 2W2WA 3MDBC 1XKEA 2LASA 4MGKE 5LXIB 4GMVA 4KIKB 1E8YA 1V2YA 3ZTDA 5JP4A 3APCA 3N7CA 2IO1B 1WGDA 2NBUA 1WXVA 4EZJA 1GJZA 4K7WA 1R4NI 2FCSA 4JGHB 1U29A 1UH6A 1OQNA 1NI2A 4I6LB 2BKRB 1IYFA 4HJKA 2K2UA 3APDA 5CX3A 4GDLA 2J0MA 1UPQA 2KDIA 3DCGA 3PTFC 2YS1A 1YX5B 4MH0E 2IO2B 4HAWB 4DDID 5HE0A 2D9XA 2LVPA 4KHOA 3RZWC 1ZVRA 2CB8A 2LOXA 2KN5A 2IO0B 5EDSA 2J7QB 4PQ0A 4W9HA 3DVGY 2MBEA 1K8RB 3KY9A 4EEWA 4MY6A 1P0RA 1V81A 3VH3B 1WJ6A 4KZ0A 1YJ1A 1ACAA 2JPHA 3ZTCA 2L1CA 2EJ8A 2EMTA 4AOFA 3KYDD 2NPTA 1Y8RC 4KSLC 1VD2A 2L05A 3L16A 2HD5B 2N23A 3KRWA 4K2PA 2MWNB 2IY1B 3L17A 2KANA 3WAMA 1X05A 3IBEA 3Q3FA 3ECIA 2LZ6A 3ML9A 4KSKC 2M1MA 1NTIA 1YQBA 2GCJA 4IOYX 2K6DB 3ML8A 4ANUA 3NSUA 1GUAB 1Q1OA 2KWCA 4F7ZA 1OTRB 4B6HA 3NY5A 5D3XA 3C0RB 4BKTA 2O2VB 5C23A 2YSZA 2EKEC 3DXCA 1PLSA 2KUPA 2CY4A 4FADA 3H6NA 2FCMA 2KK8A 3CIKA 4FJVB 3G9WA 2MBQA 2RGNB 4GU2A 2KQ7A 3PT2B 5L83A 2C60A 1V80A 2M17A 4HPLB 3UQAA 1FGYA 5L81A 2RLOA 3PLUA 2V76A 4XX5A 3F5RA 4ZRIA 3VH4B 1L2NA 1WGQA 2PE9A 5J18A 3PP2A 3W1SA 5G55A 2LJ5A 3B08A 5GOWB 3FM8C 2WX0A 1WJUA 4PNKA 2KJRA 2X18A 1XR0B 2JZZA 5E6NA 3A8QA 3PVWA 2NBVB 4K1RB 5DI9B 3K9OB 4HCPB 4KDIC 2MBHA 3KYCD 2KKCA 5DH9B 5D94A 4EMOA 4K17A 4W9LA 1QQGA 4XWXA 4FHJA 4ZYNA 3GOEA 4I6PA 5C5BA 4W9DA 2FIFA 4DBGA 4M0WB 1RRBA 5JHHA 4HB4B 4A5KA 3FEHA 3H9DA 1E7UA 1U27A 2W2XD 3NZUA 2XK5A 3A9JA 4HAUB 2MDXA 5AZGA 2LYDA 1NU2A 4JQWC 2AYOB 4HVBA 4LDTB 1KI1B 4EUTA 4MSQB 2C9WB 3UF8A 2Y5BB 4AJWA 3MTNB 1D3ZA 4CO7A 1OEYJ 1WM3A 2NR2A 1U5EA 3S2AA 5J3QA 5E6PA 3PVUA 1NDDA 3KRXA 3ONSA 2LVQA 2CHXA 2DX1A 3ZNID 2RR9A 2ZCBA 3PEGA 3PV1A 4GSWA 4IAPA 1LQBA 2XQNM 1OMWA 2PE6B 2CHWA 2DKQA 3A98B 1P5TA 1X1GA 4WJOA 1S3SG 1DDWA 2GS0A 3QC8B 2LI5A 2BYFA 1I35A 2JY6A 1N3HA 3U7DA 1WJ1A 4IG7B 3ZUNA 2J0KA 3N30A 4B9KA 2ADZA 2ZPYA 4BBKA 2L3ZA 2XBBC 4PYUA 2YS5A 3EPYA 4F1SA 2R2OA 1ZKHA 3L08A 3QX1A 2O6VA 3LJ3A 3R66C 2K2JA 3QCAA 4B95A 2NVUI 4RMAA 2FJ9A 4PYZA 3JVZX 1F9JA 4BKSA 4HAXB 1RRPB 2H7EA 3HHMA 1EGXA 4IUMB 5C79A 2JWZA 4ZRJA 2L76A 2MKRA 3BY4B 4PS3A 3RZFA 3T06A 3DOWA 3N3KB 5G2NA 4EKUA 4WJNA 2RQ1A 4WVFB 4MGIE 1AARA 3IVFA 1V5MA 4H8SA 1VCBA 1MPHA 2ELBA 1I7AA 5J2RA 2R0DA 1WX9A 1DYNA 3WA0A 3M63B 3ZLZA 1W1GA 3VHTC 3X0WA 3WAOA 1MKEA 1W1DA 2P8VA 2D9VA 2ELAA 3H1UA 4TYZA 4GMXB 1KZ7A 5DPRA 1EF1A 2KJHB 4N9F4 1UEFA 1M7EA 1BTNA 4GB9A 2DYNA 1FHOA 3L54A 1SE9A 4ZRKA 2JRHA 4MT7A 1WRDB 2N4FA 1FHXA 1UPRA 2YT0A 1WR1A 4NJ7A 2JF5A 3V6CB 2Y8GA 1J8CA 5CHWA 1UNRA 4P7IA 2KHWB 1H10A 1ST7A 3P2BA 2Z0OA 2N9PC 4JIOU 3V61A 2JZ3B 4ICUA 1WMHB 3AI5A 3OJ3A 3VVWB 1S1QB 1HBKA 2O6VD 1WMHA 4HDOA 1KZGA 3GYOA 1KJTA 3LJUX 1FAOA 4A6FB 4NPNA 1MAIA 1LB1A 2L7RA 3W1SC 3QWMA 5DHFB 1J0WA 2CS4A 3DBRI 3KUDB 1TQZA 2J59M 4WJPA 4MJSB 2ZVNA 2DHIA 4HXDA 3ODXA 2KFKA 1P3QU 3IFWB 4GOCA 3TBLD 3A8PA 2DKPA 2QKMA 3QHTA 4PS7A 4MK0A 5D3WA 2VKIA 1OGWA 3VFKA 1A5RA 4WWNA 2MCNB 3NOBA 3ML4A 5D27A 1UNQA 2GBMA 2DFKA 3FLVA 2N9XA 3U30A 4TKNA 4K7UA 2KTRA 3ODOA 3QK0A 1RAXA 1WJNA 1X1FA 4WSFA 3DXEA 4GDLB 4XZ4A 1WR6E 1XCGA 3VQIA 5D2MB 1V5TA 2UVMA 3DVNU 1WGRA 2Z0PA 4WJQA 3RULA 2L8JA 1U5FA 1PQSA 5CHFA 4LCDE 2EC1A 5L95C 2KDEB 4IFSA 1GNUA 5D3YA 2KXJA 3I3TB 2DZKA 4HB2B 1XT9B 2BWES 2DYBA 2NPTB 4LJPB 1SIFA 2GBKA 4FJZA 4E71A 1U5DA 1GG3A 2BWFA 3ZRFA 1QZEA 2NCNA 1WYWB 3MJWA 2D9YA 2ZZPB 2UZRA 2AL6A 4FJYA 2LXCA 1IRSA 2GBRA 1V49A 2N0YA 1QC6A 1LW3A 2MLBA 2ROZB 4Z2MB 3H7PA 1WGGA 4NQLB 1EUVB 2GBNA 4HAVB 4HLEA 3KZ1A 2YT1A 4TQ0A 3ZKJC 2Q13A 2QKLA 2REXA 2D9ZA 2YRYA 2CY5A 3SYXA 2FCNA 2WWZA 2WDTB 4DHZE 1M94A 3O65B 2KD0A 1WZ0A 5JHAA 3L0WB 3ZO5B 2K8BA 5DPSA 2D3GA 3EC8A 4DX90 3SDLC 2N1WA 1XQQA 5JHGA 2HTHA 2BCJA 4YL8A 1WX7A 3LDZE 2N1VA 3PREA 1WFYA 1V6EA 1WGYA 3UGBB 2FAZA 2DYMA 3IHPC 3D32A 3APFA 4EZLA 2YLMA 2KQSA 4G11A 3T8MA 5DPTA 2OQBA 2ASQA 3H7SA 4RM8A 1OQYA 2LULA 4GGQA 4D0NB 2DX5A 1X11A 5C5BB 3PGEA 2IYBA 1Q5WB 1EAZA 3VTVA 3D8EA 1UBIA 1WG7A 4IM2A 4HK2A 2RUKB 4HATB 2XK5B 3A9JB 4A3OA 1WF9A 3CMMB 1V86A 1ZSQA 2V4LA 1UBQA 4WAAA 3OLMD 2LBBA 1NTVA 2D4QA 2K6QA 2LUEA 3NZSA 3TFMA 4CHJA 2MX2A 1EVHA 5E6OA 4II2B 4MM3A 5KQ4A 4GN1A 4E3CA 2I5FA 5JLJB 1E8XA 4NY0A 4AUQC 2KZRA 1MG8A 2L0TA 2FCQA 1BTKA 4NAWA 2M38A 2M14A 2K1FA 4IC7B 3M3JA 2EMSA 4M8NA 1E5WA 4E74A 1R4MI 3DQVA 2KLCA 2W9NA 3QA8A 5J3TA 2D11A 2RSGA 2GBJA 3VDZA 1H8CA 2LG1A 1U4AA 1LFDA 4IWPA 1ZM0A 1WY8A 2JXXA 1KLVA 3PS6A 4DHJB 2KX0A 1Y19B 2I1JA 2I5CA 1P1AA 2MP2A 1TZ1A 4J6IA 1XD3B 3UIPB 5LLIA 2GJYA 4CHKA 2R2QA 1RFAA 3HW2B 5IAAC 2C7MB 3Q3JA 4F7HA 2M8SA 2CRFA 1OY2A 3KSYA 2O6VB 2KVRA 2AL3A 2A4ZA 3WALA 3EFUA 1G6JA 4FULA 4EZKA 5CLQB 3ZRCA 4FBJB 2DZIA 1RLFA 2D9WA 2P0FA 2C5LC 3TCAA 4LJOB 2MBBB 5IA7A 5DHAB 4ANVA 1Q0WB 4BOSC 2K39A 2MRPA 4A3PA 3CSFA 2A5UA 4FN2A 3BINA 2M4NA 1WXMA 1U5GA 3M62B 3KW5B 1WM2A 4KZCA 1E8ZA 3FSSA 2DYOA 3QARA 4WWPA 3VUXA 4FHKA 2RVBB 1IPGA 1UNPA 3R7RA 2DHKA 2RSUA 4GXBA 3DBLI 4BOZB 1FGZA 3R7QA 1WE7A 1Z87A 2KFJA 1MIXA 3CXBB 2FNJB 4OVUA 1I42A 4W9JA 2P0HA 2KX3A 3DXDA 4TV3A 3D8FA 3X23A 5KHQA 1WVHA 1V5OA 4K2OA 1SGHA 3B1LX 3SO6A 3M1IB 4DX8A 2N9EB 4M8MA 4WWOA 4NNJB 2UWQA 1WI0A 3V62A 1ISNA 3RYTA 3A1QA 2IZVB 2CAYA 3DVNV 2M0XA 4IWOA 5JZEB 1AQCA 2YF0A 2LRWA 3SNHA 1UZXB 3RT3B 3VTUA 1PMSA 4DDGD 2K8CA 1X86A 3JSVA 2RGFA 5KCVA 3GYPA 4DHJD 3WAPA 2G4DB 3VXWA 2C7HA 3RUIB 1J19A 2BGFA 4GDKB 5CHVC 1EO6A 4GDKA 2KCJA 1MK9B 3V60A 2JVCA 4KHBB 4NJ6A 1NTYA 3WYFB 1LXDA 4C0AA 4BKSD 2KFKB 3UIOB 4WQOB 2RPQA 4NQKE 2ROVA 4KDLB 2KTFA 3HQCA 2CR5A 2GCLA 1T0YA 5DCNA 2VRWB 2MWSB 3A9KA 1V5PA 4YONA 3WANA 4EJNA 3MPXA 4AP4C 1V9JA 2LGXA 1NVLA 2WYQA 3ALBA 4GZUA 2IYDB 2Z0QA 5KHOA 1FOEA 4IWQA 2KDFB 2LGYA 2KWVB 2KTRB 4HB3B 4CHMA 2JUOA 2MFQA 1EF5A 4IM0A 4ZDVA 5JHBA 2LXAA 2PPHA 4II3B 1WXSA 3B0AA 2K8HA 3RCZA 3QIJA 1V88A 3VIAA 3RCPA 2HE7A 3ZNZB 4DWFA 1TGZB 3D8DA 5AZHA 1V61A 1E90A 3AULA 4JL9A 3PSEB 3U8ZA 2BPSA 2LRUA 3QBVB 1WIAA 1FB8A 5FI1A 3DPDA 4KIKA 1UD7A 3EHVA 2LWPA 3ODWA 2KWUB 4DBBA 3WIMA 4MGYE 2L0FA 3EECA 5CTRC 2BYVE 2GOWA 2B3AA 4TUUA 4F7UP 1E8WA 3AXCA 4G0NB 3JYUA 1SHCA 5HE2A 2Y8FA 1HB8A 2KLGA 4HHVA 2KMAA 1BT0A 3AU4A 1X1MA 2YS3A 2KOXA 3AU5A 1FXTB 1RJ2A 5C1ZA 2CU1A 3A4RA 2XEWA 2WX1A 4L6EA 1WX8A 3JW0X 2OJRA 2DZJA 3R3MA 4HWIB 3ULCA 1P6SA 3N32A 1Z5SB 2NZ8B 2DN6A 2KO3A 3H7PB 5CLLB 2ZNVC 2KGXB 2COFA 4BBNC 2C7NB 4K7SA 3TO1A 3TIXA 2CHZA 3VUYA 1TTNA 2HRJA 5HKHA 1KM7A 3KUZA 2NMBA 4A6HA 2ZPNA 3DDCB 4G50A 4URKA 3PRZA 3PSCA 1ZGUB 4BBNF 3MHSD 2COAA 2LOZA 1CMXB 3T9LA 2ZEQA 5AZFA 2V3SA 3PLVA 3VOQA 4DK5A 2H7DA 5DIFB 4I6NB 3QAQA 1JRUA 2CKHB 3PHXB 2HTHB 2O2VA 1B55A 4PS8A 1LM8B 4DXAB 1KOTA 4FLHA 2FUHB 3ZDTA 5J3YA 5D3VA 2IO3B 2V1YA 4KV2A 1XODA 1UELA 3M95A 5LXHA 4KVGB 4WJ7A 4W9GA 5GMVA 1MIZB 2PJHA 2DX5B 5IJMA 3KVFB 3ZDMC 1ZW7A 1MK7B 1J0GA 1XX0A 5J17A 4AWJA 3TMPB 2DTCA 4MDKE 3PHWB 5JH5C 4B6WA 2G4SA 3PVLA 3TJPA 4Z2NA 2L2IA 2AEHA 3FP5A 2Z0EB 1K5DB 2I1KA 2CODA 2NS5A 3SUZA 2OTXA 3NHEB 5D7GA 2D2QA 3HM3A 3SHQA 3AJ4A 2MA9B 3UINB 2YVCA 4MSMB 2ZVOA 5HE1A 1U2BA 2MBOA 5C16A 1WH3A 5HE3A 3OANA 3SU8X 3KUCB 2ABDA 1GC6A 4ANWA 5C6RA 3OJ4B 3TW1A 2Z0DB 4W9IA 1YIWA 2FIDA 4GIVA 1WJ4A 1YX6B 4NAWB 3HIZA 2DLWA 3O96A 1DBHA 1C1YB 1P98A 5DPWA 5FR6A 4TQ1A 4NSWA 2LGDA 2LKOA 3RD2A 3V5WA 2NBWB 2UYZB 2PEAA 3NS8A 2DZMA 5LOPB 3V6EB 4EOYA 2VSZA 2MP2B 3CF6E 2HJ8A 2P0DA 2ZNVB 2N7EA 3QWZB 1L7YA 4A20A 1K5GB 2UZSA 4OVVA 4GPTB 4Y94A 4ANXA 2G35A 2G3QB 2J0JA 3SV1A 1YD8U 2QHOA 3ZVVA 2KMCA 2L00B 4HDQA 2E2XA 1V89A 5FI0A 3ZNGC 2IBIB 1PFJA 3F0WA 2LD9A 4G3XB 3QQ8B 3QJZA 3DBSA 3ZIMA 4MGZE 2AWTA 1FHWA 1GC7A 3VAWA 4HAZB 4W9FA 1W1HA 1WGHA 2JP2A 2KJ6A 1TXDA 3ULBA 4A6KA 2DENB 1TJ6A 4BFRA 4IW0A 3UQBA 5EFXA 1DDVA 3ZVRA 1V5UA 1NBFC 4HAYB 3KH0A 4JLCA 1UGMA 3VUWA 2OOBB
chains in the Genus database with same CATH superfamily
2VRRB 2TSSA 2D3BA 2KYWA 2MQJA 2WDVB 1BWNA 3PRMB 2IFSA 4RM9A 4W9EA 3SD5A 2BYEA 3BJIA 2MJDA 2D10A 3GE8C 3P6AA 3VTWA 4HSIA 2K3UA 2MJEA 4AJYB 2FJLA 3L13A 1RM6C 2K25A 1ZOYB 3TL5A 4KAXB 4BKGA 2BBCA 2DAJA 3B77A 4KHAA 5LONB 4K3CA 2WH5A 4X57B 2G1EA 2KDBA 2RNRB 1Y5OA 2DHJA 4FA6A 3IAM1 1N6ZA 1MFWA 1L4DB 2GMIC 5KQ1A 3UZTA 2W55A 4K81A 4F8CB 4LDTD 1I2HA 3IT4B 1GPXA 2LEKA 1EM7A 2DHZA 2Z59B 2LHDA 3W1YA 1WI1A 1AWEA 5TR5A 4W9KA 3A1QB 5IRSA 1TBEA 3FILA 2WNMA 4LNIA 3GZNI 2IPKD 4HCNB 1SEBD 1OEYA 2ZJDA 1P9DU 3DBHB 3P7ZA 2Y7BA 4GOUA 2MSED 2KAJA 2W2XC 2OJWA 4J3OD 3TVVA 1F0ZA 3JSVB 3DVGX 3PG7A 1ZC3B 1DDMA 2D07B 1FNVA 3A4SC 1IP9A 1NI3A 2KNBA 1JDEA 4OSNA 3HK0A 2MW5A 2CQUA 4HPMB 5IN7A 2PTLA 1I4PA 2BF8B 3NZ3A 3P1MA 5D6JB 3ZW3A 3BK2A 4F7GA 1GAQB 4XC2A 3Q8BA 2E6XA 4XE0A 4IM3A 3L10B 1HQRD 3A33B 4MELA 1KTKA 1EWCA 3K9PB 2BKFA 3AEDB 2PZ1A 3CSTA 4BVUC 5FR3A 4DHZB 2COCA 2COPA 2ZW0A 1WGUA 1HB6A 1P3RA 3IG3A 2KC1A 2D3CA 4MEMA 2IGGA 3WCQA 2G45B 2L83A 2N7DA 4P1CC 1H4RA 2FDQA 1Z2MA 2Q5WD 1ZC4B 2K00A 2DAFA 1WJMA 1P7EA 2DYQA 3DBHI 3I5JC 1E0ZA 3EA6A 3ENEA 5BO4B 2IY0B 3MC0B 2K9XA 1XD4A 3A9KB 5BMHA 2DA0A 1I4QA 1HA5A 1N62A 2UU7A 1R4NB 3PZ8A 3AE8B 1ZXIA 3MJ5A 1DOIA 4A6FA 4RFBA 1N5WA 3PPAA 2RD0A 1WZ3A 2R09A 1ET9A 2MEKA 4MJSA 3HM6X 1WXAA 2IGHA 2KC2A 2IJ0A 4ASWC 1B1ZA 1Q67A 2LVOA 4HB0B 1HE8A 2JRIB 3ZJUA 1PUTA 3NUHB 1DROA 1M7RA 4HJGE 1C3TA 2JQRB 3OAWA 4ICVA 3PRPB 2ZCCA 3AE3B 2ZKMX 4W9CA 4EFOA 5AEKB 4CYEA 1BAKA 3HIEA 4A90A 2JT4B 2JXTA 3ZNHB 3PZDA 1E7VA 4OVZA 1WE6A 2W2WA 3MDBC 1XKEA 2LASA 3BVZA 1LGRA 4PT5A 4MGKE 4S0RA 5LXIB 4GMVA 4KIKB 1ZDXA 1DIKA 1E8YA 1V2YA 2RPVA 3ZTDA 5JP4A 2BB5A 3APCA 4YTPB 3N7CA 2IO1B 1WGDA 2NBUA 1WXVA 1XF5L 3SEBA 4EZJA 4K7WA 1SIJA 1GJZA 1R4NI 2FCSA 4JGHB 1U29A 1UH6A 1C78A 1OQNA 1NI2A 4I6LB 2BKRB 1IYFA 4HJKA 2K2UA 2WU2B 4OZCA 3APDA 5CX3A 4GDLA 2J0MA 1CJEA 1UPQA 2KDIA 3DCGA 4XGAB 4BZAA 3PTFC 2YS1A 1YX5B 3Q3MC 4MH0E 3OHMB 2JYTA 2IO2B 4HAWB 4DDID 1DGJA 2MHJA 2BB6A 3AEFB 5HE0A 2D9XA 2LVPA 4KHOA 3RZWC 1ZVRA 2CB8A 2LOXA 1SJHD 2KN5A 1QOAA 1UGJA 2IO0B 5EDSA 1T6BX 2J7QB 4PQ0A 1HTOA 4W9HA 3DVGY 2MBEA 1K8RB 3KY9A 4EEWA 2EELA 4MY6A 1P0RA 3Q3OC 1KLGD 1V81A 3VH3B 1WJ6A 1YJ1A 1ACAA 2JPHA 4KZ0A 1J7AA 3ZTCA 3IT6B 2L1CA 2EJ8A 5IO9A 5AUKA 2EMTA 4AOFA 3KYDD 2NPTA 1Y8RC 4B0EA 4KSLC 1VD2A 2L05A 3L16A 1C4AA 2HD5B 2N23A 3KRWA 4K2PA 2MWNB 2IY1B 3L17A 3TEWA 2WXQA 5LG4B 1YJIA 2KANA 3WAMA 3NVZA 1X05A 3IBEA 3V3XA 3NG0A 3Q3FA 3ECIA 2LZ6A 3ML9A 4KSKC 2BS2B 2BT6A 2KN4A 2LMCA 3AEBB 2M1MA 1NTIA 1YQBA 2GCJA 2RDHA 4IOYX 2K6DB 3ML8A 4ANUA 3NSUA 3W5UB 1TJEA 1GUAB 1Q1OA 2KWCA 1SBBB 4F7ZA 1F52A 2HJ1A 3ABVB 1WWTA 2VZKB 1OTRB 5G5HA 4B6HA 2X38A 1XXGA 4OT1A 3NY5A 5D3XA 3C0RB 4BKTA 1WRIA 1YN3A 2O2VB 4L1BA 1D4BA 5IKCM 5C23A 1JW9D 2YSZA 2EKEC 3DXCA 1PLSA 2KUPA 2MH7A 2CY4A 1ZXHA 4FADA 4D2KA 3H6NA 2FCMA 2KK8A 3CIKA 4FJVB 3G9WA 2MBQA 2RGNB 4GU2A 2KQ7A 3PT2B 5L83A 4KKJA 5LNK1 2C60A 1V80A 2M17A 1A70A 2DNFA 4HPLB 3UQAA 1FGYA 5L81A 2RLOA 1NYQA 3N20C 3RI7C 3PLUA 1HEZE 3RNAC 3BYYB 2V76A 4XX5A 1T5XD 1ZP0B 3F5RA 3E9SA 4ZRIA 3IXSA 3VH4B 1JWSD 1L2NA 1WGQA 2PE9A 5J18A 3PP2A 3W1SA 5G55A 1T0RC 2LJ5A 1MHHE 3B08A 5GOWB 3FM8C 2WX0A 2EKIA 1WJUA 4PNKA 3SFDB 2KJRA 2IGDA 2X18A 1FXAA 2L1AA 1XR0B 1IBXA 1BXTA 2JZZA 4C4VB 3V05A 2WS3B 1WYGA 5E6NA 3A8QA 3PVWA 2NBVB 4K1RB 5DI9B 3K9OB 4HCPB 4KDIC 3TEZA 2MBHA 3KYCD 1TY2A 4LNNA 2KKCA 5DH9B 2ZW1A 4WIPA 5D94A 4EMOA 4K17A 4W9LA 1QQGA 5T8IA 4ZHOA 4XWXA 2QJLA 4FHJA 4EE2A 4ZYNA 3GOEA 4I6PA 5C5BA 4W9DA 3H8HA 2FIFA 4DBGA 3GE3C 4C7YA 1QLBB 4M0WB 1RRBA 3VRBB 5JHHA 4HB4B 4A5KA 3FEHA 4XWWA 3H9DA 1E7UA 1U27A 4MACA 2W2XD 1CZPA 1VZ6A 4TSSA 3NZUA 2XK5A 4L2YA 3A9JA 4HAUB 3ZXRA 1YQ3B 2MDXA 5AZGA 2LYDA 1NU2A 2GRIA 4JQWC 2Z8LA 2WU5B 2AYOB 4HVBA 4JE3B 4JX1C 4LDTB 1KI1B 4EUTA 4MSQB 2C9WB 1F77A 3UF8A 2J4XA 2Y5BB 4AJWA 3MTNB 1D3ZA 4CO7A 1OEYJ 1WM3A 4XWTA 4RGOS 2NR2A 1U5EA 3PZ7A 2ONQA 3MP9A 3NJTA 3R2IA 1N5XA 2PVGC 1SXTA 4N58A 3S2AA 5J3QA 1KH0A 1SB3C 5E6PA 1MHXA 4QJ3B 2I38A 4YWGG 3PVUA 1NDDA 3KRXA 2VZKD 2K0PA 3ONSA 2LVQA 2CHXA 2DX1A 1I4HA 4RNAA 3ZNID 2RR9A 2ZCBA 1OQQA 3PEGA 3PV1A 4GSWA 1MPEA 3FC4A 4IAPA 1LQBA 2XQNM 1OMWA 2PE6B 2CHWA 2K5PA 1UWMA 2DKQA 3A98B 1GGOA 1P5TA 1X1GA 4WJOA 1S3SG 1DDWA 2GI9A 2W54A 2AQ2B 2GS0A 3QC8B 2AQ1B 2LI5A 2BYFA 1I35A 2JY6A 2B76B 4QXAB 3Q3NC 3URYA 5AUIA 1N3HA 3CWIA 1DOXA 1JWMD 1YOVB 5I2MA 3U7DA 1WJ1A 3BYTB 1PGBA 4IG7B 3ZUNA 2KIGA 4DXFA 4USAA 4P16A 2J0KA 3N30A 4B9KA 2X0SA 2ADZA 3HUIA 4NAMA 1OQRA 2ZPYA 4BBKA 3AE5B 2L3ZA 2XBBC 4PYUA 2YS5A 3EPYA 2D5GA 4F1SA 2R2OA 2JX5A 4CQNA 4D6WA 3Q8FA 4REZA 1ZKHA 2RDBC 1EU3A 3RNFC 3L08A 3QX1A 2O6VA 3GZNB 5E6JA 1TKEA 2J53A 3LJ3A 1EWYC 3R66C 2K2JA 3QCAA 4B95A 2NVUI 4JKBA 1Q10A 4RMAA 2FJ9A 4PYZA 3JVZX 1F9JA 4BKSA 4HAXB 1RRPB 2H7EA 3N9YC 3HHMA 1EGXA 4IUMB 5C79A 2JWZA 5IOIA 3NWDA 4ZRJA 2L76A 2MKRA 3BY4B 4PS3A 3RZFA 3ENBA 3E9OA 1L6VA 3T06A 3DOWA 4YSXB 3N3KB 5G2NA 4EKUA 2KWDA 1SE4A 4YT0B 4WJNA 3T3NA 2FUG1 2RQ1A 2LGSA 4WVFB 2YEPF 4MGIE 5EE1A 2BS3B 1AARA 1XO3A 5H92C 1K53A 3IVFA 1V5MA 3LB8C 4H8SA 1VCBA 1E9MA 1MPHA 5MPOA 2ELBA 3DHGC 1I7HA 1I7AA 2ON8A 5J2RA 2R0DA 1WX9A 2SAKA 4WURA 1DYNA 3WA0A 3M63B 1TT5B 3ZLZA 3FILB 1W1GA 2XN9C 3VR9B 3VHTC 3X0WA 3WAOA 1MKEA 1W1DA 2P8VA 2D9VA 1JROA 4HPPA 2GB1A 4LK0M 2ELAA 3H1UA 4TYZA 4JK9A 4GMXB 1KZ7A 5DPRA 3IAS1 1EF1A 2KJHB 3AE9B 4N9F4 1QQRA 1C4CA 3BVGA 1UEFA 1M7EA 1BTNA 4GB9A 4ZHPA 4FXCA 4IDIA 4NJCA 3NVWA 2K8EA 2KDMA 2DYNA 1FHOA 1BMLC 1BUIC 2LUMA 1TS5A 1KFYB 2KUQA 3L54A 1SE9A 4ZRKA 2JRHA 3E9LA 2INNE 3ZJVA 4MT7A 1WRDB 1XEEA 4GLSC 1KLUD 2KIEA 4ZYSA 2N4FA 1FHXA 1UPRA 2YT0A 2WGSA 1WR1A 4NJ7A 2JF5A 3V6CB 1QKZA 2Y8GA 1J8CA 4GNKB 5CHWA 2R82A 1UNRA 1SJED 2KMMA 4P7IA 2KHWB 1FIQA 3AECB 3ETRA 3U4EG 3RNGC 1H10A 1PGXA 3I9V1 1ST7A 3HRDD 3P2BA 1MI1A 2Z0OA 2N9PC 4JIOU 3V61A 1VLBA 4AQ7A 2JZ3B 4ICUA 2M0AA 1WMHB 1ENFA 3AI5A 3OJ3A 3VVWB 3DHHC 1S1QB 1HBKA 2O6VD 4HKZE 1WMHA 4HDOA 1KZGA 3GYOA 1KJTA 3LJUX 1FAOA 4A6FB 4NPNA 1MAIA 1LB1A 2M19A 4KHBA 2L7RA 1GB1A 3W1SC 3QWMA 2R61A 4HROA 5DHFB 1J0WA 2CS4A 3DBRI 3AB5A 1TQZA 2J59M 3KUDB 4WJPA 4MJSB 2ZVNA 2DHIA 2KACA 4HXDA 4XYCA 3ODXA 2KFKA 1P3QU 3IFWB 4US8A 2X8XX 4GOCA 3TBLD 3A8PA 2DKPA 1VRAB 2QKMA 2FJUB 3QHTA 4PS7A 4OZAA 4MK0A 5D3WA 3AE7B 2Z4DA 2VKIA 1OGWA 3VFKA 1A5RA 1QT9A 3Q14C 4WWNA 2MCNB 3NOBA 4NZLB 3ML4A 1XLPA 3I63C 5EE9A 5FK9C 5D27A 2QC8A 2RMMA 1UNQA 2Z14A 4JWSC 1RYJA 2GBMA 2DFKA 3FLVA 2N9XA 3U30A 1WXQA 3BK1A 1STEA 4TKNA 3FKYA 3GB1A 4K7UA 4WQMA 1C79A 3KQ4A 1ROEA 2KTRA 3ODOA 3AV8A 4DXGA 3QK0A 1RAXA 1WJNA 1X1FA 2V3NA 4WSFA 3DXEA 5FKAC 2WXGA 4GDLB 2BQQA 4XZ4A 1WR6E 4N6EB 1XCGA 2WXRA 3VQIA 5D2MB 1V5TA 1C9FA 2UVMA 4BAXA 3DVNU 1WGRA 1R7SA 2WXNA 2Z0PA 2Y3AA 3U7ZA 1RFKA 4WJQA 3RULA 2L8JA 1U5FA 1Y56A 1PQSA 3P63A 3DHIC 1VDVA 5CHFA 4LCDE 2EC1A 5L95C 4LNKA 2KDEB 4IFSA 1GNUA 5D3YA 2KXJA 1JWAD 3I3TB 2WXJA 2DZKA 3NW8A 4HB2B 1FMAD 1XT9B 2BWES 1TKGA 2DYBA 2NPTB 4LJPB 1SIFA 2GBKA 4FJZA 3TUOA 4E71A 1T3QA 4A6QA 3Q8EA 4QAYA 1U5DA 1GG3A 2BWFA 3ZRFA 1QZEA 2NCNA 1WYWB 2LFIA 3MJWA 3KWLA 2JWUA 2D9YA 3RFZB 4ILGB 1EU4A 2LHEA 2ZZPB 2UZRA 2AL6A 1E10A 4FJYA 2HDEA 2LGIA 2LXCA 1IRSA 2GBRA 1V49A 4MT5A 2N0YA 4IOIE 3O13A 1QC6A 1LW3A 3AN1A 2MLBA 3EFCA 2ROZB 4LTUA 1J7BA 4Z2MB 3H7PA 1WGGA 4NQLB 1EUVB 1QF6A 2GBNA 4HAVB 1YN5A 3ZJTA 4ZRQA 1E7PB 2QEJC 4HLEA 3KZ1A 2YT1A 1ZE3D 4TQ0A 3ZKJC 2Q13A 2QKLA 4JKAA 2REXA 2D9ZA 2YRYA 2CY5A 3SYXA 2FCNA 2WWZA 4AS1A 3CIRB 2WDTB 4DHZE 1M94A 3O65B 3Q8CA 2KD0A 4C56C 4RF0A 4WAFA 1WZ0A 1AN8A 5JHAA 3L0WB 3ZO5B 2K8BA 5DPSA 1HTQA 2D3GA 3EC8A 4DX90 3SDLC 4HEA1 3E56A 2N1WA 5D3DA 1XQQA 4PK1A 5JHGA 2HTHA 1FCLA 2BCJA 4YL8A 2KQ4X 1WX7A 3RNCC 3LDZE 2N1VA 3PREA 4RF1A 1IBXB 1WFYA 1M4VA 1SE3A 1V6EA 1WGYA 3UGBB 1C76A 2OHFA 2QCZA 4ACFA 2FAZA 2DYMA 2BTEA 3RNEC 3IHPC 3D32A 1FD6A 4A55A 2I2YA 2E3TA 2INCC 2NTSA 3APFA 2L52A 4JKGA 4EZLA 2YLMA 2KQSA 2JZPA 4G11A 3SR6A 3T8MA 5DPTA 4WWMA 2OQBA 3N1ZC 2ASQA 3H7SA 4RM8A 1OQYA 1IGDA 2LULA 4GGQA 4D0NB 2DX5A 1X11A 4UDUC 5C5BB 1ESFA 3PGEA 2IYBA 1Q5WB 1KRHA 1EAZA 1YNTE 3VTVA 1JRPA 2WHIA 4LNFA 1F2RC 2Z13A 5BYSA 1T0QC 2WXKA 3D8EA 1UBIA 1XLOA 1WG7A 1KBLA 4IM2A 4HK2A 3TEXA 2RUKB 2GUMA 3NWAA 4HATB 2XK5B 2L32A 3A9JB 4R3DA 4A3OA 1WF9A 3CMMB 3AMZA 1V86A 1ZSQA 2V4LA 3U2SC 5HFYA 1UBQA 4WAAA 3OLMD 2LBBA 1NTVA 2KR0A 2D4QA 2K6QA 2LUEA 3ZYYX 3NZSA 2ACZB 1V97A 3AEAB 3TFMA 3MHZA 3U52E 2V3PA 4CHJA 2MX2A 1EVHA 1JWUD 5E6OA 2QDFA 4II2B 4MM3A 4OW0A 5KQ4A 2CJNA 2HTME 4GN1A 4E3CA 2I5FA 5G5GA 3OWEB 5JLJB 1E8XA 1OFFA 4KGRA 4NY0A 4AUQC 2KZRA 5M4YB 1MG8A 2L0TA 3I57A 2FCQA 1JQ4A 1BTKA 4NAWA 2M38A 2M14A 2K1FA 4YTNB 4IC7B 4L23A 3M3JA 4RGTA 2EMSA 4M8NA 1QOBA 1E5WA 3KWVA 1MG4A 4P6VF 4E74A 1R4MI 3DQVA 1D6EC 2KLCA 1WGKA 2W9NA 3QA8A 3B9JA 1PDXA 5J3TA 2D11A 1ZYIA 2RSGA 2GBJA 2WXIA 3RPFC 3HVZA 3VDZA 5HI1A 1H8CA 2LG1A 1U4AA 1LFDA 2PIAA 4IWPA 1ZM0A 1WY8A 2JXXA 2W82A 2NMQA 1KLVA 3BWUD 4YXDB 3R2TA 4HKQA 3PS6A 4DHJB 2KX0A 1Y19B 3Q6BA 2I1JA 2I5CA 1P1AA 2MP2A 3MC9A 1TZ1A 1YN4A 4J6IA 1XD3B 1XCQL 3UIPB 4C80A 5LLIA 2GJYA 1E6EB 4CHKA 2R2QA 3BVMA 1RFAA 1WSPA 3HW2B 3P4SB 5IAAC 1C4PA 4KX6B 1LO5D 2C7MB 4RGNA 4B0MA 3Q3JA 4F7HA 2M8SA 3DBLB 1NYRA 2CRFA 2VH2A 1FRDA 4N59A 1N60A 1OY2A 3KSYA 4JK7A 3E66A 2KVRA 2O6VB 3Q69A 3NRZA 4KKIA 2AL3A 2A4ZA 2M56B 3WALA 3EFUA 2V4IB 1G6JA 2RRFA 4FULA 3W5VB 3P4PB 4EZKA 5CLQB 3ZRCA 4FBJB 2DZIA 1RLFA 2D9WA 2P0FA 5D3IB 2C5LC 3BZDB 3TCAA 2XNAC 4LJOB 2MBBB 5IA7A 5DHAB 1V1PA 4ANVA 2ICIA 1Q0WB 4BOSC 2K39A 4O1NA 2MRPA 4TMAB 2FE8A 4A3PA 3CSFA 3FAHA 2A5UA 4YSYB 4FN2A 3BINA 4DIXA 3AE2B 1MI0A 2M4NA 1WXMA 1U5GA 1PFDA 3M62B 2KT7A 1K52A 3KW5B 4OZBA 4IKGA 2CU3A 1WM2A 4KZCA 1MJDA 1E8ZA 3FSSA 2DYOA 4XDDA 5H8YE 2QIEB 3QARA 5BMIA 2IDYA 4WWPA 3AEEB 3VUXA 4FHKA 2RVBB 1IPGA 1UNPA 3R7RA 2DHKA 2RSUA 3N1XC 4GXBA 3DBLI 1D5MC 4BOZB 1N61A 1FGZA 3R7QA 2INDC 1WE7A 4M01A 1Z87A 4WH4A 2KFJA 1MIXA 2QMTA 3CXBB 1J7CA 2FNJB 4OVUA 1I42A 4W9JA 2P0HA 2KX3A 3DXDA 2Y5PA 2BYTA 4H2AA 4TV3A 3D8FA 3X23A 1GB4A 2N9LA 5KHQA 1I4XA 1WVHA 1V5OA 4K2OA 1SGHA 3P42A 3B1LX 3SO6A 3M1IB 2D3AA 4DX8A 1DYQA 2N9EB 4C7ZA 4M8MA 4WWOA 4NNJB 2UWQA 4MH8A 2Z59A 1WI0A 3V62A 1ISNA 1P7FA 3DBRB 3RYTA 3A1QA 2IZVB 2CAYA 3DVNV 2GLSA 1YQ4B 2M0XA 4IWOA 1UNSA 3MC8A 5JZEB 1AQCA 3RNBC 2YF0A 3RN9C 2LRWA 3SNHA 1TS4A 1UZXB 3RT3B 2W3RA 3VTUA 1PMSA 2OEDA 4DDGD 2K8CA 1X86A 3LYYA 1B9RA 3JSVA 2RGFA 2RDGA 5KCVA 3AM9A 3NVYA 3GYPA 4DHJD 5TSSA 3HVDA 3WAPA 2G4DB 1L6UA 1F1HA 2J52A 3VXWA 2C7HA 3RUIB 1J19A 2BGFA 4GDKB 3DWGC 1JALA 1JWBD 3SBTA 5CHVC 4LNOA 4M02A 1EO6A 1F2RI 1NENB 4JWUC 5C3JB 1JMLA 1N63A 4GDKA 2KCJA 3DCXA 5HG2A 2WXFA 1MK9B 3V60A 2JVCA 4KHBB 3AE4B 1VR9A 4NJ6A 2H88B 4QJ5B 1NTYA 1XCTL 3WYFB 1VJKA 2AX5A 1LXDA 4C0AA 1FRRA 1VZ7A 4BKSD 2KFKB 1UWXA 3UIOB 1HZ6A 4WQOB 1ZUD2 2Y5CA 2RPQA 4NQKE 2ROVA 4KDLB 2KTFA 3AEGB 3HQCA 2CR5A 2WXOA 2GCLA 1T0YA 1FXIA 5DCNA 2VRWB 2MWSB 3LXFA 3GS2A 3A9KA 4ZRPA 1V5PA 4YONA 3WANA 4EJNA 3MPXA 4AP4C 1V9JA 2LGXA 1AYFA 1NVLA 2WYQA 3ALBA 4GZUA 2IYDB 2N7JA 2Z0QA 2V9HA 5KHOA 1FOEA 4IWQA 1FM0D 2WDQB 2KDFB 5EE0A 2LGYA 2KWVB 2KTRB 4HB3B 4CHMA 2G9HD 2JUOA 4CSQA 3GP7A 2MFQA 1AWDA 1EF5A 4IM0A 4A9AA 4ZDVA 5JHBA 2LXAA 4JKFA 4JKDA 2PPHA 4HRSA 4II3B 2BVCA 3AH7A 1FO4A 2YEPB 1I4GA 1WXSA 3B0AA 2K8HA 3RCZA 3QIJA 1V88A 3VIAA 3RCPA 2HE7A 2VH1A 3ZNZB 4DWFA 5HHDG 1TGZB 3D8DA 1T0SC 2PLPA 5AZHA 1V61A 1E90A 3AULA 4Q2JA 2PW9A 4JL9A 3N1YC 3PSEB 2FBWB 3U8ZA 1SF0A 1NVID 2AQ3B 2BPSA 2LRUA 3QBVB 1WIAA 3NVVA 1DOYA 2CJOA 4ITKA 1CQVA 1FB8A 1QOGA 5FI1A 3DPDA 3MFGA 4KIKA 1UD7A 3EGRA 3EHVA 2LWPA 2W3SA 1L4ZB 3ODWA 3NS1A 2KWUB 2N9KA 4DBBA 3WIMA 4MGYE 2L0FA 1L5PA 3EECA 5CTRC 2BYVE 1FCCC 2GOWA 2B3AA 1TS3A 4TUUA 4F7UP 1E8WA 3B2GA 3C8YA 3AXCA 4G0NB 3JYUA 1SHCA 2K49A 5HE2A 2Y8FA 2WDRB 1HB8A 2KLGA 4HHVA 1VBGA 2KMAA 1BT0A 3AU4A 1L0VB 4XDCA 4JK8A 1X1MA 2YS3A 2KOXA 3AU5A 3J9CA 1FXTB 4QJ4B 1RJ2A 5C1ZA 2CU1A 3A4RA 2XEWA 3HSAA 2WX1A 4L6EA 1WX8A 5C2TB 3JW0X 2OJRA 1UUPA 1SSNA 3KLSX 2DZJA 3R3MA 4HWIB 3ULCA 1TS2A 1P6SA 3N32A 2LJIA 1Z5SB 2NZ8B 2H89B 2DN6A 2KO3A 4YSZB 3H7PB 4C00A 1FFVA 5CLLB 3W9CB 2ZNVC 2KGXB 3VRAB 2COFA 4BBNC 2C7NB 4K7SA 3TO1A 3TIXA 2CHZA 3VUYA 1TTNA 3EUB2 2HRJA 3ZGZA 5HKHA 5BMGA 1PYWD 1KM7A 1K50A 1L0XB 3KUZA 2NMBA 3OG5A 4A6HA 2ZPNA 3DDCB 1FEHA 1FFUA 1VZ8A 1VBHA 4G50A 1D5ZC 4URKA 3PRZA 1KF6B 3PSCA 1ZGUB 3UI3A 4BBNF 3MHSD 2COAA 2LOZA 1C77A 1CMXB 3T9LA 1IUEA 2DLBA 5EE3A 2ZEQA 1TYGB 5AZFA 2V3SA 3PLVA 3VOQA 1XLNA 4RH6A 4DK5A 4YTMB 2H7DA 5DIFB 3B2FA 4I6NB 2K22A 3QAQA 1JRUA 2CKHB 1JCKB 3PHXB 2HTHB 4US9A 1IGCA 2O2VA 2BW2A 1B55A 4PS8A 1LM8B 4DXAB 1KOTA 4FLHA 2WXPA 4L1RA 2FUHB 3ZDTA 5J3YA 5D3VA 2IO3B 2V1YA 3L4PA 2MJ3A 3W2DA 4KV2A 1XODA 1UELA 3M95A 5LXHA 4JKGB 4KVGB 1FNWA 4WJ7A 4W9GA 5GMVA 2N0SB 1MIZB 4ARCA 2DWQA 2PJHA 2DX5B 2INPE 5IJMA 5BYQA 5I4DA 1AW7A 3KVFB 4KGSA 3ZDMC 1GOZA 1ZW7A 1MK7B 1J0GA 1XX0A 5J17A 4AWJA 3TMPB 2DTCA 4MDKE 3PHWB 3P4QB 1V1OA 3T3OA 4LLGM 5JH5C 1CK1A 4B6WA 4OHJA 2G4SA 3PVLA 3TJPA 4Z2NA 5BYRA 2L2IA 2AEHA 3FP5A 3U12A 2Z0EB 3BIID 1K5DB 1TY0A 2I1KA 4C4VA 2CODA 2NS5A 3E9PA 1T77A 1R4MB 4ILHA 3SUZA 2OTXA 3SFEB 3NHEB 1RWSA 2WQYB 5D7GA 2D2QA 3HM3A 3SHQA 3C19A 4JKEA 2NBVA 2V0GA 1I4RA 3AJ4A 2MA9B 3UINB 2R2YA 2YVCA 1TIFA 4MSMB 2KVZA 2ZVOA 2BS4B 5HE1A 1U2BA 4JKHA 3VR8B 2MBOA 5C16A 1WH3A 1K51A 5HE3A 3OANA 3SU8X 4MM3B 3KUCB 2ABDA 3RMKC 3R8BA 1L0YB 1GC6A 1TZOA 4ANWA 2PVOD 5C6RA 3OJ4B 1FNUA 3NWFA 4M0WA 4RCOA 3TW1A 2Z0DB 4W9IA 1YIWA 4DQOC 2FIDA 4GIVA 1WJ4A 1YX6B 4NAWB 3HIZA 1ET6A 2DLWA 4K3BA 3O96A 1DBHA 1C1YB 4ARIA 3DWMA 1P98A 2SEBD 5DPWA 3A58A 1TKYA 5FR6A 5JVLA 1XLQA 3SBGA 4TQ1A 4NSWA 3Q2AC 2LGDA 2LKOA 3RD2A 5GXGB 3V5WA 1ACCA 2NBWB 2WXMA 2JYEA 2UYZB 2WLBA 2PEAA 1HZ5A 3NS8A 2DZMA 5LOPB 4P1BC 2QSDA 3V6EB 4EOYA 2VSZA 2WXLA 1ZDVA 4A8XC 1HXYD 2PMVA 2MP2B 3CF6E 4JPSA 2HJ8A 2P0DA 4M00A 4S17A 2ZNVB 1MVKA 2N7EA 3QWZB 1L7YA 1KC7A 1YMHE 3P4RB 2WP9B 4A20A 2DBYA 1K5GB 2UZSA 1V8CA 4OVVA 3ZXVA 3AE1B 2J42A 2JSVX 1FPYA 4GPTB 4Y94A 4ANXA 2G35A 1YJJA 3PO0A 2G3QB 2J0JA 3SV1A 1YD8U 2QHOA 2JU6X 3ZVVA 2KMCA 2L00B 3AE6B 1SE2A 4HDQA 2WXHA 2E2XA 1V89A 1ZPSA 1QILA 5FI0A 3ZNGC 1PGAA 2IBIB 3FVCA 1PFJA 3F0WA 2LD9A 4G3XB 3QQ8B 1V1PB 2YT2A 3QJZA 3DBSA 3Q8AA 3ZIMA 4ZOHC 1NEKB 4MGZE 2AWTA 4RGMA 4KGTA 1FHWA 1GC7A 3VAWA 1QOFA 5JXVA 4HAZB 4W9FA 1W1HA 1WGHA 2JP2A 2KJ6A 1TXDA 3ULBA 2NTTA 2DIKA 4A6KA 2DENB 2QILA 4ILJA 1TJ6A 1UF0A 3TEYA 4BFRA 4IW0A 3UQBA 5EFXA 1DDVA 3ZVRA 1V5UA 5IP4D 1D5XC 1NBFC 4JKCA 4HAYB 3KH0A 4JLCA 3ZQ4A 2PKOA 1UGMA 5I2SA 3TSSA 3VUWA 2OOBB
chains in the Genus database with same CATH topology
2VRRB 2MQJA 1BWNA 3PRMB 2IFSA 4RM9A 4W9EA 3SD5A 2BYEA 3BJIA 2D10A 3P6AA 3VTWA 4AJYB 2FJLA 3L13A 2K25A 3TL5A 4KAXB 4BKGA 2DAJA 4KHAA 5LONB 2WH5A 4X57B 2KDBA 2RNRB 1Y5OA 2DHJA 4FA6A 2GMIC 5KQ1A 3UZTA 4F8CB 4K81A 4LDTD 1I2HA 2Z59B 2DHZA 3W1YA 1WI1A 1AWEA 5TR5A 4W9KA 3A1QB 1TBEA 3GZNI 4HCNB 2ZJDA 1OEYA 1P9DU 3P7ZA 2Y7BA 2MSED 2W2XC 3TVVA 3JSVB 3DVGX 3PG7A 1ZC3B 1DDMA 2D07B 3A4SC 1IP9A 2KNBA 1JDEA 3HK0A 2MW5A 2CQUA 4HPMB 2BF8B 5D6JB 3ZW3A 4F7GA 4XC2A 4IM3A 3L10B 3A33B 4MELA 3K9PB 2BKFA 2PZ1A 3CSTA 4BVUC 4DHZB 2COCA 2COPA 1WGUA 1HB6A 1P3RA 3IG3A 2KC1A 4MEMA 2G45B 2N7DA 1H4RA 2FDQA 1Z2MA 1ZC4B 2K00A 2DAFA 1WJMA 2DYQA 3DBHI 3ENEA 5BO4B 2IY0B 1XD4A 3A9KB 2DA0A 4A6FA 3PPAA 2RD0A 1WZ3A 2R09A 4MJSA 3HM6X 1WXAA 2KC2A 4ASWC 1Q67A 2LVOA 4HB0B 1HE8A 2JRIB 1DROA 1M7RA 1C3TA 3OAWA 4ICVA 3PRPB 2ZCCA 4W9CA 4EFOA 5AEKB 4CYEA 1BAKA 2JT4B 3ZNHB 3PZDA 1E7VA 1WE6A 2W2WA 3MDBC 1XKEA 2LASA 4MGKE 5LXIB 4GMVA 4KIKB 1DIKA 1E8YA 1V2YA 3ZTDA 5JP4A 3APCA 3N7CA 2IO1B 1WGDA 2NBUA 1WXVA 4EZJA 1GJZA 4K7WA 1R4NI 2FCSA 4JGHB 1U29A 1UH6A 1OQNA 1NI2A 4I6LB 2BKRB 1IYFA 4HJKA 2K2UA 3APDA 5CX3A 4GDLA 2J0MA 1UPQA 2KDIA 3DCGA 3PTFC 2YS1A 1YX5B 4MH0E 2IO2B 4HAWB 4DDID 5HE0A 2D9XA 2LVPA 4KHOA 3RZWC 1ZVRA 2CB8A 2LOXA 2KN5A 2IO0B 5EDSA 2J7QB 4PQ0A 4W9HA 3DVGY 2MBEA 1K8RB 3KY9A 4EEWA 4MY6A 1P0RA 1V81A 3VH3B 1WJ6A 4KZ0A 1YJ1A 1ACAA 2JPHA 3ZTCA 2L1CA 2EJ8A 2EMTA 4AOFA 3KYDD 2NPTA 1Y8RC 4KSLC 1VD2A 2L05A 3L16A 2HD5B 2N23A 3KRWA 4K2PA 2MWNB 2IY1B 3L17A 2KANA 3WAMA 1X05A 3IBEA 3Q3FA 3ECIA 2LZ6A 3ML9A 4KSKC 2M1MA 1NTIA 1YQBA 2GCJA 4IOYX 2K6DB 3ML8A 4ANUA 3NSUA 1GUAB 1Q1OA 2KWCA 4F7ZA 1OTRB 4B6HA 3NY5A 5D3XA 3C0RB 4BKTA 2O2VB 5C23A 2YSZA 2EKEC 3DXCA 1PLSA 2KUPA 2CY4A 4FADA 3H6NA 2FCMA 2KK8A 3CIKA 4FJVB 3G9WA 2MBQA 2RGNB 4GU2A 2KQ7A 3PT2B 5L83A 2C60A 1V80A 2M17A 4HPLB 3UQAA 1FGYA 5L81A 2RLOA 3PLUA 2V76A 4XX5A 3F5RA 4ZRIA 3VH4B 1L2NA 1WGQA 2PE9A 5J18A 3PP2A 3W1SA 5G55A 2LJ5A 3B08A 5GOWB 3FM8C 2WX0A 1WJUA 4PNKA 2KJRA 2X18A 1XR0B 2JZZA 5E6NA 3A8QA 3PVWA 2NBVB 4K1RB 5DI9B 3K9OB 4HCPB 4KDIC 2MBHA 3KYCD 2KKCA 5DH9B 5D94A 4EMOA 4K17A 4W9LA 1QQGA 4XWXA 4FHJA 4ZYNA 3GOEA 4I6PA 5C5BA 4W9DA 2FIFA 4DBGA 4M0WB 1RRBA 5JHHA 4HB4B 4A5KA 3FEHA 3H9DA 1E7UA 1U27A 2W2XD 3NZUA 2XK5A 3A9JA 4HAUB 2MDXA 5AZGA 2LYDA 1NU2A 4JQWC 2AYOB 4HVBA 4LDTB 1KI1B 4EUTA 4MSQB 2C9WB 3UF8A 2Y5BB 4AJWA 3MTNB 1D3ZA 4CO7A 1OEYJ 1WM3A 2NR2A 1U5EA 3S2AA 5J3QA 5E6PA 3PVUA 1NDDA 3KRXA 3ONSA 2LVQA 2CHXA 2DX1A 3ZNID 2RR9A 2ZCBA 3PEGA 3PV1A 4GSWA 4IAPA 1LQBA 2XQNM 1OMWA 2PE6B 2CHWA 2DKQA 3A98B 1GGOA 1P5TA 1X1GA 4WJOA 1S3SG 1DDWA 2GS0A 3QC8B 2LI5A 2BYFA 1I35A 2JY6A 1N3HA 3U7DA 1WJ1A 4IG7B 3ZUNA 2J0KA 3N30A 4B9KA 2X0SA 2ADZA 2ZPYA 4BBKA 2L3ZA 2XBBC 4PYUA 2YS5A 3EPYA 4F1SA 2R2OA 1ZKHA 3L08A 3QX1A 2O6VA 3LJ3A 3R66C 2K2JA 3QCAA 4B95A 2NVUI 4JKBA 4RMAA 2FJ9A 4PYZA 3JVZX 1F9JA 4BKSA 4HAXB 1RRPB 2H7EA 3HHMA 1EGXA 4IUMB 5C79A 2JWZA 4ZRJA 2L76A 2MKRA 3BY4B 4PS3A 3RZFA 3ENBA 3E9OA 3T06A 3DOWA 3N3KB 5G2NA 4EKUA 4WJNA 2RQ1A 4WVFB 4MGIE 1AARA 3IVFA 1V5MA 4H8SA 1VCBA 1MPHA 2ELBA 1I7AA 5J2RA 2R0DA 1WX9A 1DYNA 3WA0A 3M63B 3ZLZA 1W1GA 3VHTC 3X0WA 3WAOA 1MKEA 1W1DA 2P8VA 2D9VA 2ELAA 3H1UA 4TYZA 4JK9A 4GMXB 1KZ7A 5DPRA 1EF1A 2KJHB 4N9F4 1UEFA 1M7EA 1BTNA 4GB9A 2DYNA 1FHOA 3L54A 1SE9A 4ZRKA 2JRHA 3E9LA 4MT7A 1WRDB 2N4FA 1FHXA 1UPRA 2YT0A 1WR1A 4NJ7A 2JF5A 3V6CB 2Y8GA 1J8CA 5CHWA 2R82A 1UNRA 4P7IA 2KHWB 1H10A 1ST7A 3P2BA 2Z0OA 2N9PC 4JIOU 3V61A 2JZ3B 4ICUA 1WMHB 3AI5A 3OJ3A 3VVWB 1S1QB 1HBKA 2O6VD 1WMHA 4HDOA 1KZGA 3GYOA 1KJTA 3LJUX 1FAOA 4A6FB 4NPNA 1MAIA 1LB1A 2L7RA 3W1SC 3QWMA 5DHFB 1J0WA 2CS4A 3DBRI 3KUDB 1TQZA 2J59M 4WJPA 4MJSB 2ZVNA 2DHIA 4HXDA 3ODXA 2KFKA 1P3QU 3IFWB 4GOCA 3TBLD 3A8PA 2DKPA 2QKMA 3QHTA 4PS7A 4MK0A 5D3WA 2VKIA 1OGWA 3VFKA 1A5RA 4WWNA 2MCNB 3NOBA 3ML4A 5D27A 1UNQA 2GBMA 2DFKA 3FLVA 2N9XA 3U30A 4TKNA 4K7UA 2KTRA 3ODOA 3QK0A 1RAXA 1WJNA 1X1FA 4WSFA 3DXEA 4GDLB 4XZ4A 1WR6E 1XCGA 3VQIA 5D2MB 1V5TA 2UVMA 3DVNU 1WGRA 2Z0PA 4WJQA 3RULA 2L8JA 1U5FA 1PQSA 5CHFA 4LCDE 2EC1A 5L95C 2KDEB 4IFSA 1GNUA 5D3YA 2KXJA 3I3TB 2DZKA 4HB2B 1XT9B 2BWES 2DYBA 2NPTB 4LJPB 1SIFA 2GBKA 4FJZA 4E71A 1U5DA 1GG3A 2BWFA 3ZRFA 1QZEA 2NCNA 1WYWB 3MJWA 2D9YA 4ILGB 2ZZPB 2UZRA 2AL6A 4FJYA 2LXCA 1IRSA 2GBRA 1V49A 2N0YA 1QC6A 1LW3A 2MLBA 2ROZB 4Z2MB 3H7PA 1WGGA 4NQLB 1EUVB 2GBNA 4HAVB 4HLEA 3KZ1A 2YT1A 4TQ0A 3ZKJC 2Q13A 2QKLA 4JKAA 2REXA 2D9ZA 2YRYA 2CY5A 3SYXA 2FCNA 2WWZA 2WDTB 4DHZE 1M94A 3O65B 2KD0A 1WZ0A 5JHAA 3L0WB 3ZO5B 2K8BA 5DPSA 2D3GA 3EC8A 4DX90 3SDLC 2N1WA 1XQQA 5JHGA 2HTHA 2BCJA 4YL8A 1WX7A 3LDZE 2N1VA 3PREA 1WFYA 1V6EA 1WGYA 3UGBB 2FAZA 2DYMA 3IHPC 3D32A 3APFA 4JKGA 4EZLA 2YLMA 2KQSA 4G11A 3T8MA 5DPTA 2OQBA 2ASQA 3H7SA 4RM8A 1OQYA 2LULA 4GGQA 4D0NB 2DX5A 1X11A 5C5BB 3PGEA 2IYBA 1Q5WB 1EAZA 3VTVA 3D8EA 1UBIA 1WG7A 1KBLA 4IM2A 4HK2A 2RUKB 4HATB 2XK5B 3A9JB 4A3OA 1WF9A 3CMMB 1V86A 1ZSQA 2V4LA 1UBQA 4WAAA 3OLMD 2LBBA 1NTVA 2D4QA 2K6QA 2LUEA 3NZSA 3TFMA 4CHJA 2MX2A 1EVHA 5E6OA 4II2B 4MM3A 5KQ4A 4GN1A 4E3CA 2I5FA 5JLJB 1E8XA 4NY0A 4AUQC 2KZRA 1MG8A 2L0TA 2FCQA 1BTKA 4NAWA 2M38A 2M14A 2K1FA 4IC7B 3M3JA 2EMSA 4M8NA 1E5WA 4E74A 1R4MI 3DQVA 2KLCA 2W9NA 3QA8A 5J3TA 2D11A 2RSGA 2GBJA 3VDZA 1H8CA 2LG1A 1U4AA 1LFDA 4IWPA 1ZM0A 1WY8A 2JXXA 1KLVA 3PS6A 4DHJB 2KX0A 1Y19B 2I1JA 2I5CA 1P1AA 2MP2A 1TZ1A 4J6IA 1XD3B 3UIPB 5LLIA 2GJYA 4CHKA 2R2QA 1RFAA 3HW2B 5IAAC 2C7MB 3Q3JA 4F7HA 2M8SA 2CRFA 1OY2A 3KSYA 4JK7A 3E66A 2KVRA 2O6VB 2AL3A 2A4ZA 3WALA 3EFUA 1G6JA 4FULA 4EZKA 5CLQB 3ZRCA 4FBJB 2DZIA 1RLFA 2D9WA 2P0FA 2C5LC 3TCAA 4LJOB 2MBBB 5IA7A 5DHAB 4ANVA 1Q0WB 4BOSC 2K39A 2MRPA 4A3PA 3CSFA 2A5UA 4FN2A 3BINA 2M4NA 1WXMA 1U5GA 3M62B 3KW5B 1WM2A 4KZCA 1E8ZA 3FSSA 2DYOA 3QARA 4WWPA 3VUXA 4FHKA 2RVBB 1IPGA 1UNPA 3R7RA 2DHKA 2RSUA 4GXBA 3DBLI 4BOZB 1FGZA 3R7QA 1WE7A 1Z87A 2KFJA 1MIXA 3CXBB 2FNJB 4OVUA 1I42A 4W9JA 2P0HA 2KX3A 3DXDA 4TV3A 3D8FA 3X23A 5KHQA 1WVHA 1V5OA 4K2OA 1SGHA 3B1LX 3SO6A 3M1IB 4DX8A 2N9EB 4M8MA 4WWOA 4NNJB 2UWQA 1WI0A 3V62A 1ISNA 3RYTA 3A1QA 2IZVB 2CAYA 3DVNV 2M0XA 4IWOA 5JZEB 1AQCA 2YF0A 2LRWA 3SNHA 1UZXB 3RT3B 3VTUA 1PMSA 4DDGD 2K8CA 1X86A 3JSVA 2RGFA 5KCVA 3GYPA 4DHJD 3WAPA 2G4DB 3VXWA 2C7HA 3RUIB 1J19A 2BGFA 4GDKB 3SBTA 5CHVC 1EO6A 4GDKA 2KCJA 1MK9B 3V60A 2JVCA 4KHBB 4NJ6A 1NTYA 3WYFB 1LXDA 4C0AA 4BKSD 2KFKB 3UIOB 4WQOB 2RPQA 4NQKE 2ROVA 4KDLB 2KTFA 3HQCA 2CR5A 2GCLA 1T0YA 5DCNA 2VRWB 2MWSB 3A9KA 1V5PA 4YONA 3WANA 4EJNA 3MPXA 4AP4C 1V9JA 2LGXA 1NVLA 2WYQA 3ALBA 4GZUA 2IYDB 2Z0QA 5KHOA 1FOEA 4IWQA 2KDFB 2LGYA 2KWVB 2KTRB 4HB3B 4CHMA 2JUOA 2MFQA 1EF5A 4IM0A 4ZDVA 5JHBA 2LXAA 4JKFA 4JKDA 2PPHA 4II3B 1WXSA 3B0AA 2K8HA 3RCZA 3QIJA 1V88A 3VIAA 3RCPA 2HE7A 3ZNZB 4DWFA 1TGZB 3D8DA 5AZHA 1V61A 1E90A 3AULA 4JL9A 3PSEB 3U8ZA 2BPSA 2LRUA 3QBVB 1WIAA 1FB8A 5FI1A 3DPDA 4KIKA 1UD7A 3EHVA 2LWPA 3ODWA 2KWUB 4DBBA 3WIMA 4MGYE 2L0FA 3EECA 5CTRC 2BYVE 2GOWA 2B3AA 4TUUA 4F7UP 1E8WA 3AXCA 4G0NB 3JYUA 1SHCA 5HE2A 2Y8FA 1HB8A 2KLGA 4HHVA 1VBGA 2KMAA 1BT0A 3AU4A 4JK8A 1X1MA 2YS3A 2KOXA 3AU5A 1FXTB 1RJ2A 5C1ZA 2CU1A 3A4RA 2XEWA 2WX1A 4L6EA 1WX8A 3JW0X 2OJRA 2DZJA 3R3MA 4HWIB 3ULCA 1P6SA 3N32A 1Z5SB 2NZ8B 2DN6A 2KO3A 3H7PB 5CLLB 2ZNVC 2KGXB 2COFA 4BBNC 2C7NB 4K7SA 3TO1A 3TIXA 2CHZA 3VUYA 1TTNA 2HRJA 5HKHA 1KM7A 3KUZA 2NMBA 4A6HA 2ZPNA 3DDCB 1VBHA 4G50A 4URKA 3PRZA 3PSCA 1ZGUB 4BBNF 3MHSD 2COAA 2LOZA 1CMXB 3T9LA 2ZEQA 5AZFA 2V3SA 3PLVA 3VOQA 4DK5A 2H7DA 5DIFB 4I6NB 3QAQA 1JRUA 2CKHB 3PHXB 2HTHB 2O2VA 1B55A 4PS8A 1LM8B 4DXAB 1KOTA 4FLHA 2FUHB 3ZDTA 5J3YA 5D3VA 2IO3B 2V1YA 4KV2A 1XODA 1UELA 3M95A 5LXHA 4JKGB 4KVGB 4WJ7A 4W9GA 5GMVA 1MIZB 2PJHA 2DX5B 5IJMA 3KVFB 3ZDMC 1ZW7A 1MK7B 1J0GA 1XX0A 5J17A 4AWJA 3TMPB 2DTCA 4MDKE 3PHWB 5JH5C 4B6WA 2G4SA 3PVLA 3TJPA 4Z2NA 2L2IA 2AEHA 3FP5A 2Z0EB 1K5DB 2I1KA 2CODA 2NS5A 3E9PA 4ILHA 3SUZA 2OTXA 3NHEB 5D7GA 2D2QA 3HM3A 3SHQA 4JKEA 3AJ4A 2MA9B 3UINB 2YVCA 4MSMB 2ZVOA 5HE1A 1U2BA 4JKHA 2MBOA 5C16A 1WH3A 5HE3A 3OANA 3SU8X 3KUCB 2ABDA 1GC6A 4ANWA 5C6RA 3OJ4B 3TW1A 2Z0DB 4W9IA 1YIWA 2FIDA 4GIVA 1WJ4A 1YX6B 4NAWB 3HIZA 2DLWA 3O96A 1DBHA 1C1YB 1P98A 5DPWA 5FR6A 5JVLA 3SBGA 4TQ1A 4NSWA 2LGDA 2LKOA 3RD2A 3V5WA 2NBWB 2UYZB 2PEAA 3NS8A 2DZMA 5LOPB 3V6EB 4EOYA 2VSZA 2MP2B 3CF6E 2HJ8A 2P0DA 2ZNVB 2N7EA 3QWZB 1L7YA 1KC7A 4A20A 1K5GB 2UZSA 4OVVA 4GPTB 4Y94A 4ANXA 2G35A 2G3QB 2J0JA 3SV1A 1YD8U 2QHOA 3ZVVA 2KMCA 2L00B 4HDQA 2E2XA 1V89A 5FI0A 3ZNGC 2IBIB 1PFJA 3F0WA 2LD9A 4G3XB 3QQ8B 3QJZA 3DBSA 3ZIMA 4MGZE 2AWTA 1FHWA 1GC7A 3VAWA 4HAZB 4W9FA 1W1HA 1WGHA 2JP2A 2KJ6A 1TXDA 3ULBA 2DIKA 4A6KA 2DENB 4ILJA 1TJ6A 4BFRA 4IW0A 3UQBA 5EFXA 1DDVA 3ZVRA 1V5UA 1NBFC 4JKCA 4HAYB 3KH0A 4JLCA 1UGMA 3VUWA 2OOBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRR B;  2MQJ A;  1BWN A;  3PRM B;  2IFS A;  4RM9 A;  4W9E A;  3SD5 A;  2BYE A;  3BJI A;  2D10 A;  3P6A A;  3VTW A;  4AJY B;  2FJL A;  3L13 A;  2K25 A;  3TL5 A;  4KAX B;  4BKG A;  2DAJ A;  4KHA A;  5LON B;  2WH5 A;  4X57 B;  2KDB A;  2RNR B;  1Y5O A;  2DHJ A;  4FA6 A;  2GMI C;  5KQ1 A;  3UZT A;  4F8C B;  4K81 A;  4LDT D;  1I2H A;  2Z59 B;  2DHZ A;  3W1Y A;  1WI1 A;  1AWE A;  5TR5 A;  4W9K A;  3A1Q B;  1TBE A;  3GZN I;  4HCN B;  2ZJD A;  1OEY A;  1P9D U;  3P7Z A;  2Y7B A;  2MSE D;  2W2X C;  3TVV A;  3JSV B;  3DVG X;  3PG7 A;  1ZC3 B;  1DDM A;  2D07 B;  3A4S C;  1IP9 A;  2KNB A;  3HK0 A;  2MW5 A;  2CQU A;  4HPM B;  2BF8 B;  5D6J B;  3ZW3 A;  4F7G A;  4XC2 A;  4IM3 A;  3L10 B;  3A33 B;  4MEL A;  3K9P B;  2BKF A;  2PZ1 A;  3CST A;  4BVU C;  4DHZ B;  2COC A;  2COP A;  1WGU A;  1HB6 A;  1P3R A;  3IG3 A;  2KC1 A;  4MEM A;  2G45 B;  2N7D A;  1H4R A;  2FDQ A;  1Z2M A;  1ZC4 B;  2K00 A;  2DAF A;  1WJM A;  2DYQ A;  3DBH I;  3ENE A;  5BO4 B;  2IY0 B;  1XD4 A;  3A9K B;  2DA0 A;  4A6F A;  3PPA A;  2RD0 A;  1WZ3 A;  2R09 A;  4MJS A;  3HM6 X;  1WXA A;  2KC2 A;  4ASW C;  1Q67 A;  2LVO A;  4HB0 B;  1HE8 A;  2JRI B;  1DRO A;  1M7R A;  1C3T A;  3OAW A;  4ICV A;  3PRP B;  2ZCC A;  4W9C A;  4EFO A;  5AEK B;  4CYE A;  1BAK A;  2JT4 B;  3ZNH B;  3PZD A;  1E7V A;  1WE6 A;  2W2W A;  3MDB C;  1XKE A;  2LAS A;  4MGK E;  5LXI B;  4GMV A;  4KIK B;  1E8Y A;  1V2Y A;  3ZTD A;  5JP4 A;  3APC A;  3N7C A;  2IO1 B;  1WGD A;  2NBU A;  1WXV A;  4EZJ A;  1GJZ A;  4K7W A;  1R4N I;  2FCS A;  4JGH B;  1U29 A;  1UH6 A;  1OQN A;  1NI2 A;  4I6L B;  2BKR B;  1IYF A;  4HJK A;  2K2U A;  3APD A;  5CX3 A;  4GDL A;  2J0M A;  1UPQ A;  2KDI A;  3DCG A;  3PTF C;  2YS1 A;  1YX5 B;  4MH0 E;  2IO2 B;  4HAW B;  4DDI D;  5HE0 A;  2D9X A;  2LVP A;  4KHO A;  3RZW C;  1ZVR A;  2CB8 A;  2LOX A;  2KN5 A;  2IO0 B;  5EDS A;  2J7Q B;  4PQ0 A;  4W9H A;  3DVG Y;  2MBE A;  1K8R B;  3KY9 A;  4EEW A;  4MY6 A;  1P0R A;  1V81 A;  3VH3 B;  1WJ6 A;  4KZ0 A;  1YJ1 A;  1ACA A;  2JPH A;  3ZTC A;  2L1C A;  2EJ8 A;  2EMT A;  4AOF A;  3KYD D;  2NPT A;  1Y8R C;  4KSL C;  1VD2 A;  2L05 A;  3L16 A;  2HD5 B;  2N23 A;  3KRW A;  4K2P A;  2MWN B;  2IY1 B;  3L17 A;  2KAN A;  3WAM A;  1X05 A;  3IBE A;  3Q3F A;  3ECI A;  2LZ6 A;  3ML9 A;  4KSK C;  2M1M A;  1NTI A;  1YQB A;  2GCJ A;  4IOY X;  2K6D B;  3ML8 A;  4ANU A;  3NSU A;  1GUA B;  1Q1O A;  2KWC A;  4F7Z A;  1OTR B;  4B6H A;  3NY5 A;  5D3X A;  3C0R B;  4BKT A;  2O2V B;  5C23 A;  2YSZ A;  2EKE C;  3DXC A;  1PLS A;  2KUP A;  2CY4 A;  4FAD A;  3H6N A;  2FCM A;  2KK8 A;  3CIK A;  4FJV B;  3G9W A;  2MBQ A;  2RGN B;  4GU2 A;  2KQ7 A;  3PT2 B;  5L83 A;  2C60 A;  1V80 A;  2M17 A;  4HPL B;  3UQA A;  1FGY A;  5L81 A;  2RLO A;  3PLU A;  2V76 A;  4XX5 A;  3F5R A;  4ZRI A;  3VH4 B;  1L2N A;  1WGQ A;  2PE9 A;  5J18 A;  3PP2 A;  3W1S A;  5G55 A;  2LJ5 A;  3B08 A;  5GOW B;  3FM8 C;  2WX0 A;  1WJU A;  4PNK A;  2KJR A;  2X18 A;  1XR0 B;  2JZZ A;  5E6N A;  3A8Q A;  3PVW A;  2NBV B;  4K1R B;  5DI9 B;  3K9O B;  4HCP B;  4KDI C;  2MBH A;  3KYC D;  2KKC A;  5DH9 B;  5D94 A;  4EMO A;  4K17 A;  4W9L A;  1QQG A;  4XWX A;  4FHJ A;  4ZYN A;  3GOE A;  4I6P A;  5C5B A;  4W9D A;  2FIF A;  4DBG A;  4M0W B;  1RRB A;  5JHH A;  4HB4 B;  4A5K A;  3FEH A;  3H9D A;  1E7U A;  1U27 A;  2W2X D;  3NZU A;  2XK5 A;  3A9J A;  4HAU B;  2MDX A;  5AZG A;  2LYD A;  1NU2 A;  4JQW C;  2AYO B;  4HVB A;  4LDT B;  1KI1 B;  4EUT A;  4MSQ B;  2C9W B;  3UF8 A;  2Y5B B;  4AJW A;  3MTN B;  1D3Z A;  4CO7 A;  1OEY J;  1WM3 A;  2NR2 A;  1U5E A;  3S2A A;  5J3Q A;  5E6P A;  3PVU A;  1NDD A;  3KRX A;  3ONS A;  2LVQ A;  2CHX A;  2DX1 A;  3ZNI D;  2RR9 A;  2ZCB A;  3PEG A;  3PV1 A;  4GSW A;  4IAP A;  1LQB A;  2XQN M;  1OMW A;  2PE6 B;  2CHW A;  2DKQ A;  3A98 B;  1P5T A;  1X1G A;  4WJO A;  1S3S G;  1DDW A;  2GS0 A;  3QC8 B;  2LI5 A;  2BYF A;  1I35 A;  2JY6 A;  1N3H A;  3U7D A;  1WJ1 A;  4IG7 B;  3ZUN A;  2J0K A;  3N30 A;  4B9K A;  2ADZ A;  2ZPY A;  4BBK A;  2L3Z A;  2XBB C;  4PYU A;  2YS5 A;  3EPY A;  4F1S A;  2R2O A;  1ZKH A;  3L08 A;  3QX1 A;  2O6V A;  3LJ3 A;  3R66 C;  2K2J A;  3QCA A;  4B95 A;  2NVU I;  4RMA A;  2FJ9 A;  4PYZ A;  3JVZ X;  1F9J A;  4BKS A;  4HAX B;  1RRP B;  2H7E A;  3HHM A;  1EGX A;  4IUM B;  5C79 A;  2JWZ A;  4ZRJ A;  2L76 A;  2MKR A;  3BY4 B;  4PS3 A;  3RZF A;  3T06 A;  3DOW A;  3N3K B;  5G2N A;  4EKU A;  4WJN A;  2RQ1 A;  4WVF B;  4MGI E;  1AAR A;  3IVF A;  1V5M A;  4H8S A;  1VCB A;  1MPH A;  2ELB A;  1I7A A;  5J2R A;  2R0D A;  1WX9 A;  1DYN A;  3WA0 A;  3M63 B;  3ZLZ A;  1W1G A;  3VHT C;  3X0W A;  3WAO A;  1MKE A;  1W1D A;  2P8V A;  2D9V A;  2ELA A;  3H1U A;  4TYZ A;  4GMX B;  1KZ7 A;  5DPR A;  1EF1 A;  2KJH B;  4N9F 4;  1UEF A;  1M7E A;  1BTN A;  4GB9 A;  2DYN A;  1FHO A;  3L54 A;  1SE9 A;  4ZRK A;  2JRH A;  4MT7 A;  1WRD B;  2N4F A;  1FHX A;  1UPR A;  2YT0 A;  1WR1 A;  4NJ7 A;  2JF5 A;  3V6C B;  2Y8G A;  1J8C A;  5CHW A;  1UNR A;  4P7I A;  2KHW B;  1H10 A;  1ST7 A;  3P2B A;  2Z0O A;  2N9P C;  4JIO U;  3V61 A;  2JZ3 B;  4ICU A;  1WMH B;  3AI5 A;  3OJ3 A;  3VVW B;  1S1Q B;  1HBK A;  2O6V D;  1WMH A;  4HDO A;  1KZG A;  3GYO A;  1KJT A;  3LJU X;  1FAO A;  4A6F B;  4NPN A;  1MAI A;  1LB1 A;  2L7R A;  3W1S C;  3QWM A;  5DHF B;  1J0W A;  2CS4 A;  3DBR I;  3KUD B;  1TQZ A;  2J59 M;  4WJP A;  4MJS B;  2ZVN A;  2DHI A;  4HXD A;  3ODX A;  2KFK A;  1P3Q U;  3IFW B;  4GOC A;  3TBL D;  3A8P A;  2DKP A;  2QKM A;  3QHT A;  4PS7 A;  4MK0 A;  5D3W A;  2VKI A;  1OGW A;  3VFK A;  1A5R A;  4WWN A;  2MCN B;  3NOB A;  3ML4 A;  5D27 A;  1UNQ A;  2GBM A;  2DFK A;  3FLV A;  2N9X A;  3U30 A;  4TKN A;  4K7U A;  2KTR A;  3ODO A;  3QK0 A;  1RAX A;  1WJN A;  1X1F A;  4WSF A;  3DXE A;  4GDL B;  4XZ4 A;  1WR6 E;  1XCG A;  3VQI A;  5D2M B;  1V5T A;  2UVM A;  3DVN U;  1WGR A;  2Z0P A;  4WJQ A;  3RUL A;  2L8J A;  1U5F A;  1PQS A;  5CHF A;  4LCD E;  2EC1 A;  5L95 C;  2KDE B;  4IFS A;  1GNU A;  5D3Y A;  2KXJ A;  3I3T B;  2DZK A;  4HB2 B;  1XT9 B;  2BWE S;  2DYB A;  2NPT B;  4LJP B;  1SIF A;  2GBK A;  4FJZ A;  4E71 A;  1U5D A;  1GG3 A;  2BWF A;  3ZRF A;  1QZE A;  2NCN A;  1WYW B;  3MJW A;  2D9Y A;  2ZZP B;  2UZR A;  2AL6 A;  4FJY A;  2LXC A;  1IRS A;  2GBR A;  1V49 A;  2N0Y A;  1QC6 A;  1LW3 A;  2MLB A;  2ROZ B;  4Z2M B;  3H7P A;  1WGG A;  4NQL B;  1EUV B;  2GBN A;  4HAV B;  4HLE A;  3KZ1 A;  2YT1 A;  4TQ0 A;  3ZKJ C;  2Q13 A;  2QKL A;  2REX A;  2D9Z A;  2YRY A;  2CY5 A;  3SYX A;  2FCN A;  2WWZ A;  2WDT B;  4DHZ E;  1M94 A;  3O65 B;  2KD0 A;  1WZ0 A;  5JHA A;  3L0W B;  3ZO5 B;  2K8B A;  5DPS A;  2D3G A;  3EC8 A;  4DX9 0;  3SDL C;  2N1W A;  1XQQ A;  5JHG A;  2HTH A;  2BCJ A;  4YL8 A;  1WX7 A;  3LDZ E;  2N1V A;  3PRE A;  1WFY A;  1V6E A;  1WGY A;  3UGB B;  2FAZ A;  2DYM A;  3IHP C;  3D32 A;  3APF A;  4EZL A;  2YLM A;  2KQS A;  4G11 A;  3T8M A;  5DPT A;  2OQB A;  2ASQ A;  3H7S A;  4RM8 A;  1OQY A;  2LUL A;  4GGQ A;  4D0N B;  2DX5 A;  1X11 A;  5C5B B;  3PGE A;  2IYB A;  1Q5W B;  1EAZ A;  3VTV A;  3D8E A;  1UBI A;  1WG7 A;  4IM2 A;  4HK2 A;  2RUK B;  4HAT B;  2XK5 B;  3A9J B;  4A3O A;  1WF9 A;  3CMM B;  1V86 A;  1ZSQ A;  2V4L A;  1UBQ A;  4WAA A;  3OLM D;  2LBB A;  1NTV A;  2D4Q A;  2K6Q A;  2LUE A;  3NZS A;  3TFM A;  4CHJ A;  2MX2 A;  1EVH A;  5E6O A;  4II2 B;  4MM3 A;  5KQ4 A;  4GN1 A;  4E3C A;  2I5F A;  5JLJ B;  1E8X A;  4NY0 A;  4AUQ C;  2KZR A;  1MG8 A;  2L0T A;  2FCQ A;  1BTK A;  4NAW A;  2M38 A;  2M14 A;  2K1F A;  4IC7 B;  3M3J A;  2EMS A;  4M8N A;  1E5W A;  4E74 A;  1R4M I;  3DQV A;  2KLC A;  2W9N A;  3QA8 A;  5J3T A;  2D11 A;  2RSG A;  2GBJ A;  3VDZ A;  1H8C A;  2LG1 A;  1U4A A;  1LFD A;  4IWP A;  1ZM0 A;  1WY8 A;  2JXX A;  1KLV A;  3PS6 A;  4DHJ B;  2KX0 A;  1Y19 B;  2I1J A;  2I5C A;  1P1A A;  2MP2 A;  1TZ1 A;  4J6I A;  1XD3 B;  3UIP B;  5LLI A;  2GJY A;  4CHK A;  2R2Q A;  1RFA A;  3HW2 B;  5IAA C;  2C7M B;  3Q3J A;  4F7H A;  2M8S A;  2CRF A;  1OY2 A;  3KSY A;  2O6V B;  2KVR A;  2AL3 A;  2A4Z A;  3WAL A;  3EFU A;  1G6J A;  4FUL A;  4EZK A;  5CLQ B;  3ZRC A;  4FBJ B;  2DZI A;  1RLF A;  2D9W A;  2P0F A;  2C5L C;  3TCA A;  4LJO B;  2MBB B;  5IA7 A;  5DHA B;  4ANV A;  1Q0W B;  4BOS C;  2K39 A;  2MRP A;  4A3P A;  3CSF A;  2A5U A;  4FN2 A;  3BIN A;  2M4N A;  1WXM A;  1U5G A;  3M62 B;  3KW5 B;  1WM2 A;  4KZC A;  1E8Z A;  3FSS A;  2DYO A;  3QAR A;  4WWP A;  3VUX A;  4FHK A;  2RVB B;  1IPG A;  1UNP A;  3R7R A;  2DHK A;  2RSU A;  4GXB A;  3DBL I;  4BOZ B;  1FGZ A;  3R7Q A;  1WE7 A;  1Z87 A;  2KFJ A;  1MIX A;  3CXB B;  2FNJ B;  4OVU A;  1I42 A;  4W9J A;  2P0H A;  2KX3 A;  3DXD A;  4TV3 A;  3D8F A;  3X23 A;  5KHQ A;  1WVH A;  1V5O A;  4K2O A;  1SGH A;  3B1L X;  3SO6 A;  3M1I B;  4DX8 A;  2N9E B;  4M8M A;  4WWO A;  4NNJ B;  2UWQ A;  1WI0 A;  3V62 A;  1ISN A;  3RYT A;  3A1Q A;  2IZV B;  2CAY A;  3DVN V;  2M0X A;  4IWO A;  5JZE B;  1AQC A;  2YF0 A;  2LRW A;  3SNH A;  1UZX B;  3RT3 B;  3VTU A;  1PMS A;  4DDG D;  2K8C A;  1X86 A;  3JSV A;  2RGF A;  5KCV A;  3GYP A;  4DHJ D;  3WAP A;  2G4D B;  3VXW A;  2C7H A;  3RUI B;  1J19 A;  2BGF A;  4GDK B;  5CHV C;  1EO6 A;  4GDK A;  2KCJ A;  1MK9 B;  3V60 A;  2JVC A;  4KHB B;  4NJ6 A;  1NTY A;  3WYF B;  1LXD A;  4C0A A;  4BKS D;  2KFK B;  3UIO B;  4WQO B;  2RPQ A;  4NQK E;  2ROV A;  4KDL B;  2KTF A;  3HQC A;  2CR5 A;  2GCL A;  1T0Y A;  5DCN A;  2VRW B;  2MWS B;  3A9K A;  1V5P A;  4YON A;  3WAN A;  4EJN A;  3MPX A;  4AP4 C;  1V9J A;  2LGX A;  1NVL A;  2WYQ A;  3ALB A;  4GZU A;  2IYD B;  2Z0Q A;  5KHO A;  1FOE A;  4IWQ A;  2KDF B;  2LGY A;  2KWV B;  2KTR B;  4HB3 B;  4CHM A;  2JUO A;  2MFQ A;  1EF5 A;  4IM0 A;  4ZDV A;  5JHB A;  2LXA A;  2PPH A;  4II3 B;  1WXS A;  3B0A A;  2K8H A;  3RCZ A;  3QIJ A;  1V88 A;  3VIA A;  3RCP A;  2HE7 A;  3ZNZ B;  4DWF A;  1TGZ B;  3D8D A;  5AZH A;  1V61 A;  1E90 A;  3AUL A;  4JL9 A;  3PSE B;  3U8Z A;  2BPS A;  2LRU A;  3QBV B;  1WIA A;  1FB8 A;  5FI1 A;  3DPD A;  4KIK A;  1UD7 A;  3EHV A;  2LWP A;  3ODW A;  2KWU B;  4DBB A;  3WIM A;  4MGY E;  2L0F A;  3EEC A;  5CTR C;  2BYV E;  2GOW A;  2B3A A;  4TUU A;  4F7U P;  1E8W A;  3AXC A;  4G0N B;  3JYU A;  1SHC A;  5HE2 A;  2Y8F A;  1HB8 A;  2KLG A;  4HHV A;  2KMA A;  1BT0 A;  3AU4 A;  1X1M A;  2YS3 A;  2KOX A;  3AU5 A;  1FXT B;  1RJ2 A;  5C1Z A;  2CU1 A;  3A4R A;  2XEW A;  2WX1 A;  4L6E A;  1WX8 A;  3JW0 X;  2OJR A;  2DZJ A;  3R3M A;  4HWI B;  3ULC A;  1P6S A;  3N32 A;  1Z5S B;  2NZ8 B;  2DN6 A;  2KO3 A;  3H7P B;  5CLL B;  2ZNV C;  2KGX B;  2COF A;  4BBN C;  2C7N B;  4K7S A;  3TO1 A;  3TIX A;  2CHZ A;  3VUY A;  1TTN A;  2HRJ A;  5HKH A;  1KM7 A;  3KUZ A;  2NMB A;  4A6H A;  2ZPN A;  3DDC B;  4G50 A;  4URK A;  3PRZ A;  3PSC A;  1ZGU B;  4BBN F;  3MHS D;  2COA A;  2LOZ A;  1CMX B;  3T9L A;  2ZEQ A;  5AZF A;  2V3S A;  3PLV A;  3VOQ A;  4DK5 A;  2H7D A;  5DIF B;  4I6N B;  3QAQ A;  1JRU A;  2CKH B;  3PHX B;  2HTH B;  2O2V A;  1B55 A;  4PS8 A;  1LM8 B;  4DXA B;  1KOT A;  4FLH A;  2FUH B;  3ZDT A;  5J3Y A;  5D3V A;  2IO3 B;  2V1Y A;  4KV2 A;  1XOD A;  1UEL A;  3M95 A;  5LXH A;  4KVG B;  4WJ7 A;  4W9G A;  5GMV A;  1MIZ B;  2PJH A;  2DX5 B;  5IJM A;  3KVF B;  3ZDM C;  1ZW7 A;  1MK7 B;  1J0G A;  1XX0 A;  5J17 A;  4AWJ A;  3TMP B;  2DTC A;  4MDK E;  3PHW B;  5JH5 C;  4B6W A;  2G4S A;  3PVL A;  3TJP A;  4Z2N A;  2L2I A;  2AEH A;  3FP5 A;  2Z0E B;  1K5D B;  2I1K A;  2COD A;  2NS5 A;  3SUZ A;  2OTX A;  3NHE B;  5D7G A;  2D2Q A;  3HM3 A;  3SHQ A;  3AJ4 A;  2MA9 B;  3UIN B;  2YVC A;  4MSM B;  2ZVO A;  5HE1 A;  1U2B A;  2MBO A;  5C16 A;  1WH3 A;  5HE3 A;  3OAN A;  3SU8 X;  3KUC B;  2ABD A;  1GC6 A;  4ANW A;  5C6R A;  3OJ4 B;  3TW1 A;  2Z0D B;  4W9I A;  1YIW A;  2FID A;  4GIV A;  1WJ4 A;  1YX6 B;  4NAW B;  3HIZ A;  2DLW A;  3O96 A;  1DBH A;  1C1Y B;  1P98 A;  5DPW A;  5FR6 A;  4TQ1 A;  4NSW A;  2LGD A;  2LKO A;  3RD2 A;  3V5W A;  2NBW B;  2UYZ B;  2PEA A;  3NS8 A;  2DZM A;  5LOP B;  3V6E B;  4EOY A;  2VSZ A;  2MP2 B;  3CF6 E;  2HJ8 A;  2P0D A;  2ZNV B;  2N7E A;  3QWZ B;  1L7Y A;  4A20 A;  1K5G B;  2UZS A;  4OVV A;  4GPT B;  4Y94 A;  4ANX A;  2G35 A;  2G3Q B;  2J0J A;  3SV1 A;  1YD8 U;  2QHO A;  3ZVV A;  2KMC A;  2L00 B;  4HDQ A;  2E2X A;  1V89 A;  5FI0 A;  3ZNG C;  2IBI B;  1PFJ A;  3F0W A;  2LD9 A;  4G3X B;  3QQ8 B;  3QJZ A;  3DBS A;  3ZIM A;  4MGZ E;  2AWT A;  1FHW A;  1GC7 A;  3VAW A;  4HAZ B;  4W9F A;  1W1H A;  1WGH A;  2JP2 A;  2KJ6 A;  1TXD A;  3ULB A;  4A6K A;  2DEN B;  1TJ6 A;  4BFR A;  4IW0 A;  3UQB A;  5EFX A;  1DDV A;  3ZVR A;  1V5U A;  1NBF C;  4HAY B;  3KH0 A;  4JLC A;  1UGM A;  3VUW A;  2OOB B; 
#chains in the Genus database with same CATH topology
 2VRR B;  2TSS A;  2D3B A;  2KYW A;  2MQJ A;  2WDV B;  1BWN A;  3PRM B;  2IFS A;  4RM9 A;  4W9E A;  3SD5 A;  2BYE A;  3BJI A;  2MJD A;  2D10 A;  3GE8 C;  3P6A A;  3VTW A;  4HSI A;  2K3U A;  2MJE A;  4AJY B;  2FJL A;  3L13 A;  1RM6 C;  2K25 A;  1ZOY B;  3TL5 A;  4KAX B;  4BKG A;  2BBC A;  2DAJ A;  3B77 A;  4KHA A;  5LON B;  4K3C A;  2WH5 A;  4X57 B;  2G1E A;  2KDB A;  2RNR B;  1Y5O A;  2DHJ A;  4FA6 A;  3IAM 1;  1N6Z A;  1MFW A;  1L4D B;  2GMI C;  5KQ1 A;  3UZT A;  2W55 A;  4K81 A;  4F8C B;  4LDT D;  1I2H A;  3IT4 B;  1GPX A;  2LEK A;  1EM7 A;  2DHZ A;  2Z59 B;  2LHD A;  3W1Y A;  1WI1 A;  1AWE A;  5TR5 A;  4W9K A;  3A1Q B;  5IRS A;  1TBE A;  3FIL A;  2WNM A;  4LNI A;  3GZN I;  2IPK D;  4HCN B;  1SEB D;  1OEY A;  2ZJD A;  1P9D U;  3DBH B;  3P7Z A;  2Y7B A;  4GOU A;  2MSE D;  2KAJ A;  2W2X C;  2OJW A;  4J3O D;  3TVV A;  1F0Z A;  3JSV B;  3DVG X;  3PG7 A;  1ZC3 B;  1DDM A;  2D07 B;  1FNV A;  3A4S C;  1IP9 A;  1NI3 A;  2KNB A;  1JDE A;  4OSN A;  3HK0 A;  2MW5 A;  2CQU A;  4HPM B;  5IN7 A;  2PTL A;  1I4P A;  2BF8 B;  3NZ3 A;  3P1M A;  5D6J B;  3ZW3 A;  3BK2 A;  4F7G A;  1GAQ B;  4XC2 A;  3Q8B A;  2E6X A;  4XE0 A;  4IM3 A;  3L10 B;  1HQR D;  3A33 B;  4MEL A;  1KTK A;  1EWC A;  3K9P B;  2BKF A;  3AED B;  2PZ1 A;  3CST A;  4BVU C;  5FR3 A;  4DHZ B;  2COC A;  2COP A;  2ZW0 A;  1WGU A;  1HB6 A;  1P3R A;  3IG3 A;  2KC1 A;  2D3C A;  4MEM A;  2IGG A;  3WCQ A;  2G45 B;  2L83 A;  2N7D A;  4P1C C;  1H4R A;  2FDQ A;  1Z2M A;  2Q5W D;  1ZC4 B;  2K00 A;  2DAF A;  1WJM A;  1P7E A;  2DYQ A;  3DBH I;  3I5J C;  1E0Z A;  3EA6 A;  3ENE A;  5BO4 B;  2IY0 B;  3MC0 B;  2K9X A;  1XD4 A;  3A9K B;  5BMH A;  2DA0 A;  1I4Q A;  1HA5 A;  1N62 A;  2UU7 A;  1R4N B;  3PZ8 A;  3AE8 B;  1ZXI A;  3MJ5 A;  1DOI A;  4A6F A;  4RFB A;  1N5W A;  3PPA A;  2RD0 A;  1WZ3 A;  2R09 A;  1ET9 A;  2MEK A;  4MJS A;  3HM6 X;  1WXA A;  2IGH A;  2KC2 A;  2IJ0 A;  4ASW C;  1B1Z A;  1Q67 A;  2LVO A;  4HB0 B;  1HE8 A;  2JRI B;  3ZJU A;  1PUT A;  3NUH B;  1DRO A;  1M7R A;  4HJG E;  1C3T A;  2JQR B;  3OAW A;  4ICV A;  3PRP B;  2ZCC A;  3AE3 B;  2ZKM X;  4W9C A;  4EFO A;  5AEK B;  4CYE A;  1BAK A;  3HIE A;  4A90 A;  2JT4 B;  2JXT A;  3ZNH B;  3PZD A;  1E7V A;  4OVZ A;  1WE6 A;  2W2W A;  3MDB C;  1XKE A;  2LAS A;  3BVZ A;  1LGR A;  4PT5 A;  4MGK E;  4S0R A;  5LXI B;  4GMV A;  4KIK B;  1ZDX A;  1DIK A;  1E8Y A;  1V2Y A;  2RPV A;  3ZTD A;  5JP4 A;  2BB5 A;  3APC A;  4YTP B;  3N7C A;  2IO1 B;  1WGD A;  2NBU A;  1WXV A;  1XF5 L;  3SEB A;  4EZJ A;  4K7W A;  1SIJ A;  1GJZ A;  1R4N I;  2FCS A;  4JGH B;  1U29 A;  1UH6 A;  1C78 A;  1OQN A;  1NI2 A;  4I6L B;  2BKR B;  1IYF A;  4HJK A;  2K2U A;  2WU2 B;  4OZC A;  3APD A;  5CX3 A;  4GDL A;  2J0M A;  1CJE A;  1UPQ A;  2KDI A;  3DCG A;  4XGA B;  4BZA A;  3PTF C;  2YS1 A;  1YX5 B;  3Q3M C;  4MH0 E;  3OHM B;  2JYT A;  2IO2 B;  4HAW B;  4DDI D;  1DGJ A;  2MHJ A;  2BB6 A;  3AEF B;  5HE0 A;  2D9X A;  2LVP A;  4KHO A;  3RZW C;  1ZVR A;  2CB8 A;  2LOX A;  1SJH D;  2KN5 A;  1QOA A;  1UGJ A;  2IO0 B;  5EDS A;  1T6B X;  2J7Q B;  4PQ0 A;  1HTO A;  4W9H A;  3DVG Y;  2MBE A;  1K8R B;  3KY9 A;  4EEW A;  2EEL A;  4MY6 A;  1P0R A;  3Q3O C;  1KLG D;  1V81 A;  3VH3 B;  1WJ6 A;  1YJ1 A;  1ACA A;  2JPH A;  4KZ0 A;  1J7A A;  3ZTC A;  3IT6 B;  2L1C A;  2EJ8 A;  5IO9 A;  5AUK A;  2EMT A;  4AOF A;  3KYD D;  2NPT A;  1Y8R C;  4B0E A;  4KSL C;  1VD2 A;  2L05 A;  3L16 A;  1C4A A;  2HD5 B;  2N23 A;  3KRW A;  4K2P A;  2MWN B;  2IY1 B;  3L17 A;  3TEW A;  2WXQ A;  5LG4 B;  1YJI A;  2KAN A;  3WAM A;  3NVZ A;  1X05 A;  3IBE A;  3V3X A;  3NG0 A;  3Q3F A;  3ECI A;  2LZ6 A;  3ML9 A;  4KSK C;  2BS2 B;  2BT6 A;  2KN4 A;  2LMC A;  3AEB B;  2M1M A;  1NTI A;  1YQB A;  2GCJ A;  2RDH A;  4IOY X;  2K6D B;  3ML8 A;  4ANU A;  3NSU A;  3W5U B;  1TJE A;  1GUA B;  1Q1O A;  2KWC A;  1SBB B;  4F7Z A;  1F52 A;  2HJ1 A;  3ABV B;  1WWT A;  2VZK B;  1OTR B;  5G5H A;  4B6H A;  2X38 A;  1XXG A;  4OT1 A;  3NY5 A;  5D3X A;  3C0R B;  4BKT A;  1WRI A;  1YN3 A;  2O2V B;  4L1B A;  1D4B A;  5IKC M;  5C23 A;  1JW9 D;  2YSZ A;  2EKE C;  3DXC A;  1PLS A;  2KUP A;  2MH7 A;  2CY4 A;  1ZXH A;  4FAD A;  4D2K A;  3H6N A;  2FCM A;  2KK8 A;  3CIK A;  4FJV B;  3G9W A;  2MBQ A;  2RGN B;  4GU2 A;  2KQ7 A;  3PT2 B;  5L83 A;  4KKJ A;  5LNK 1;  2C60 A;  1V80 A;  2M17 A;  1A70 A;  2DNF A;  4HPL B;  3UQA A;  1FGY A;  5L81 A;  2RLO A;  1NYQ A;  3N20 C;  3RI7 C;  3PLU A;  1HEZ E;  3RNA C;  3BYY B;  2V76 A;  4XX5 A;  1T5X D;  1ZP0 B;  3F5R A;  3E9S A;  4ZRI A;  3IXS A;  3VH4 B;  1JWS D;  1L2N A;  1WGQ A;  2PE9 A;  5J18 A;  3PP2 A;  3W1S A;  5G55 A;  1T0R C;  2LJ5 A;  1MHH E;  3B08 A;  5GOW B;  3FM8 C;  2WX0 A;  2EKI A;  1WJU A;  4PNK A;  3SFD B;  2KJR A;  2IGD A;  2X18 A;  1FXA A;  2L1A A;  1XR0 B;  1IBX A;  1BXT A;  2JZZ A;  4C4V B;  3V05 A;  2WS3 B;  1WYG A;  5E6N A;  3A8Q A;  3PVW A;  2NBV B;  4K1R B;  5DI9 B;  3K9O B;  4HCP B;  4KDI C;  3TEZ A;  2MBH A;  3KYC D;  1TY2 A;  4LNN A;  2KKC A;  5DH9 B;  2ZW1 A;  4WIP A;  5D94 A;  4EMO A;  4K17 A;  4W9L A;  1QQG A;  5T8I A;  4ZHO A;  4XWX A;  2QJL A;  4FHJ A;  4EE2 A;  4ZYN A;  3GOE A;  4I6P A;  5C5B A;  4W9D A;  3H8H A;  2FIF A;  4DBG A;  3GE3 C;  4C7Y A;  1QLB B;  4M0W B;  1RRB A;  3VRB B;  5JHH A;  4HB4 B;  4A5K A;  3FEH A;  4XWW A;  3H9D A;  1E7U A;  1U27 A;  4MAC A;  2W2X D;  1CZP A;  1VZ6 A;  4TSS A;  3NZU A;  2XK5 A;  4L2Y A;  3A9J A;  4HAU B;  3ZXR A;  1YQ3 B;  2MDX A;  5AZG A;  2LYD A;  1NU2 A;  2GRI A;  4JQW C;  2Z8L A;  2WU5 B;  2AYO B;  4HVB A;  4JE3 B;  4JX1 C;  4LDT B;  1KI1 B;  4EUT A;  4MSQ B;  2C9W B;  1F77 A;  3UF8 A;  2J4X A;  2Y5B B;  4AJW A;  3MTN B;  1D3Z A;  4CO7 A;  1OEY J;  1WM3 A;  4XWT A;  4RGO S;  2NR2 A;  1U5E A;  3PZ7 A;  2ONQ A;  3MP9 A;  3NJT A;  3R2I A;  1N5X A;  2PVG C;  1SXT A;  4N58 A;  3S2A A;  5J3Q A;  1KH0 A;  1SB3 C;  5E6P A;  1MHX A;  4QJ3 B;  2I38 A;  4YWG G;  3PVU A;  1NDD A;  3KRX A;  2VZK D;  2K0P A;  3ONS A;  2LVQ A;  2CHX A;  2DX1 A;  1I4H A;  4RNA A;  3ZNI D;  2RR9 A;  2ZCB A;  1OQQ A;  3PEG A;  3PV1 A;  4GSW A;  1MPE A;  3FC4 A;  4IAP A;  1LQB A;  2XQN M;  1OMW A;  2PE6 B;  2CHW A;  2K5P A;  1UWM A;  2DKQ A;  3A98 B;  1GGO A;  1P5T A;  1X1G A;  4WJO A;  1S3S G;  1DDW A;  2GI9 A;  2W54 A;  2AQ2 B;  2GS0 A;  3QC8 B;  2AQ1 B;  2LI5 A;  2BYF A;  1I35 A;  2JY6 A;  2B76 B;  4QXA B;  3Q3N C;  3URY A;  5AUI A;  1N3H A;  3CWI A;  1DOX A;  1JWM D;  1YOV B;  5I2M A;  3U7D A;  1WJ1 A;  3BYT B;  1PGB A;  4IG7 B;  3ZUN A;  2KIG A;  4DXF A;  4USA A;  4P16 A;  2J0K A;  3N30 A;  4B9K A;  2X0S A;  2ADZ A;  3HUI A;  4NAM A;  1OQR A;  2ZPY A;  4BBK A;  3AE5 B;  2L3Z A;  2XBB C;  4PYU A;  2YS5 A;  3EPY A;  2D5G A;  4F1S A;  2R2O A;  2JX5 A;  4CQN A;  4D6W A;  3Q8F A;  4REZ A;  1ZKH A;  2RDB C;  1EU3 A;  3RNF C;  3L08 A;  3QX1 A;  2O6V A;  3GZN B;  5E6J A;  1TKE A;  2J53 A;  3LJ3 A;  1EWY C;  3R66 C;  2K2J A;  3QCA A;  4B95 A;  2NVU I;  4JKB A;  1Q10 A;  4RMA A;  2FJ9 A;  4PYZ A;  3JVZ X;  1F9J A;  4BKS A;  4HAX B;  1RRP B;  2H7E A;  3N9Y C;  3HHM A;  1EGX A;  4IUM B;  5C79 A;  2JWZ A;  5IOI A;  3NWD A;  4ZRJ A;  2L76 A;  2MKR A;  3BY4 B;  4PS3 A;  3RZF A;  3ENB A;  3E9O A;  1L6V A;  3T06 A;  3DOW A;  4YSX B;  3N3K B;  5G2N A;  4EKU A;  2KWD A;  1SE4 A;  4YT0 B;  4WJN A;  3T3N A;  2FUG 1;  2RQ1 A;  2LGS A;  4WVF B;  2YEP F;  4MGI E;  5EE1 A;  2BS3 B;  1AAR A;  1XO3 A;  5H92 C;  1K53 A;  3IVF A;  1V5M A;  3LB8 C;  4H8S A;  1VCB A;  1E9M A;  1MPH A;  5MPO A;  2ELB A;  3DHG C;  1I7H A;  1I7A A;  2ON8 A;  5J2R A;  2R0D A;  1WX9 A;  2SAK A;  4WUR A;  1DYN A;  3WA0 A;  3M63 B;  1TT5 B;  3ZLZ A;  3FIL B;  1W1G A;  2XN9 C;  3VR9 B;  3VHT C;  3X0W A;  3WAO A;  1MKE A;  1W1D A;  2P8V A;  2D9V A;  1JRO A;  4HPP A;  2GB1 A;  4LK0 M;  2ELA A;  3H1U A;  4TYZ A;  4JK9 A;  4GMX B;  1KZ7 A;  5DPR A;  3IAS 1;  1EF1 A;  2KJH B;  3AE9 B;  4N9F 4;  1QQR A;  1C4C A;  3BVG A;  1UEF A;  1M7E A;  1BTN A;  4GB9 A;  4ZHP A;  4FXC A;  4IDI A;  4NJC A;  3NVW A;  2K8E A;  2KDM A;  2DYN A;  1FHO A;  1BML C;  1BUI C;  2LUM A;  1TS5 A;  1KFY B;  2KUQ A;  3L54 A;  1SE9 A;  4ZRK A;  2JRH A;  3E9L A;  2INN E;  3ZJV A;  4MT7 A;  1WRD B;  1XEE A;  4GLS C;  1KLU D;  2KIE A;  4ZYS A;  2N4F A;  1FHX A;  1UPR A;  2YT0 A;  2WGS A;  1WR1 A;  4NJ7 A;  2JF5 A;  3V6C B;  1QKZ A;  2Y8G A;  1J8C A;  4GNK B;  5CHW A;  2R82 A;  1UNR A;  1SJE D;  2KMM A;  4P7I A;  2KHW B;  1FIQ A;  3AEC B;  3ETR A;  3U4E G;  3RNG C;  1H10 A;  1PGX A;  3I9V 1;  1ST7 A;  3HRD D;  3P2B A;  1MI1 A;  2Z0O A;  2N9P C;  4JIO U;  3V61 A;  1VLB A;  4AQ7 A;  2JZ3 B;  4ICU A;  2M0A A;  1WMH B;  1ENF A;  3AI5 A;  3OJ3 A;  3VVW B;  3DHH C;  1S1Q B;  1HBK A;  2O6V D;  4HKZ E;  1WMH A;  4HDO A;  1KZG A;  3GYO A;  1KJT A;  3LJU X;  1FAO A;  4A6F B;  4NPN A;  1MAI A;  1LB1 A;  2M19 A;  4KHB A;  2L7R A;  1GB1 A;  3W1S C;  3QWM A;  2R61 A;  4HRO A;  5DHF B;  1J0W A;  2CS4 A;  3DBR I;  3AB5 A;  1TQZ A;  2J59 M;  3KUD B;  4WJP A;  4MJS B;  2ZVN A;  2DHI A;  2KAC A;  4HXD A;  4XYC A;  3ODX A;  2KFK A;  1P3Q U;  3IFW B;  4US8 A;  2X8X X;  4GOC A;  3TBL D;  3A8P A;  2DKP A;  1VRA B;  2QKM A;  2FJU B;  3QHT A;  4PS7 A;  4OZA A;  4MK0 A;  5D3W A;  3AE7 B;  2Z4D A;  2VKI A;  1OGW A;  3VFK A;  1A5R A;  1QT9 A;  3Q14 C;  4WWN A;  2MCN B;  3NOB A;  4NZL B;  3ML4 A;  1XLP A;  3I63 C;  5EE9 A;  5FK9 C;  5D27 A;  2QC8 A;  2RMM A;  1UNQ A;  2Z14 A;  4JWS C;  1RYJ A;  2GBM A;  2DFK A;  3FLV A;  2N9X A;  3U30 A;  1WXQ A;  3BK1 A;  1STE A;  4TKN A;  3FKY A;  3GB1 A;  4K7U A;  4WQM A;  1C79 A;  3KQ4 A;  1ROE A;  2KTR A;  3ODO A;  3AV8 A;  4DXG A;  3QK0 A;  1RAX A;  1WJN A;  1X1F A;  2V3N A;  4WSF A;  3DXE A;  5FKA C;  2WXG A;  4GDL B;  2BQQ A;  4XZ4 A;  1WR6 E;  4N6E B;  1XCG A;  2WXR A;  3VQI A;  5D2M B;  1V5T A;  1C9F A;  2UVM A;  4BAX A;  3DVN U;  1WGR A;  1R7S A;  2WXN A;  2Z0P A;  2Y3A A;  3U7Z A;  1RFK A;  4WJQ A;  3RUL A;  2L8J A;  1U5F A;  1Y56 A;  1PQS A;  3P63 A;  3DHI C;  1VDV A;  5CHF A;  4LCD E;  2EC1 A;  5L95 C;  4LNK A;  2KDE B;  4IFS A;  1GNU A;  5D3Y A;  2KXJ A;  1JWA D;  3I3T B;  2WXJ A;  2DZK A;  3NW8 A;  4HB2 B;  1FMA D;  1XT9 B;  2BWE S;  1TKG A;  2DYB A;  2NPT B;  4LJP B;  1SIF A;  2GBK A;  4FJZ A;  3TUO A;  4E71 A;  1T3Q A;  4A6Q A;  3Q8E A;  4QAY A;  1U5D A;  1GG3 A;  2BWF A;  3ZRF A;  1QZE A;  2NCN A;  1WYW B;  2LFI A;  3MJW A;  3KWL A;  2JWU A;  2D9Y A;  3RFZ B;  4ILG B;  1EU4 A;  2LHE A;  2ZZP B;  2UZR A;  2AL6 A;  1E10 A;  4FJY A;  2HDE A;  2LGI A;  2LXC A;  1IRS A;  2GBR A;  1V49 A;  4MT5 A;  2N0Y A;  4IOI E;  3O13 A;  1QC6 A;  1LW3 A;  3AN1 A;  2MLB A;  3EFC A;  2ROZ B;  4LTU A;  1J7B A;  4Z2M B;  3H7P A;  1WGG A;  4NQL B;  1EUV B;  1QF6 A;  2GBN A;  4HAV B;  1YN5 A;  3ZJT A;  4ZRQ A;  1E7P B;  2QEJ C;  4HLE A;  3KZ1 A;  2YT1 A;  1ZE3 D;  4TQ0 A;  3ZKJ C;  2Q13 A;  2QKL A;  4JKA A;  2REX A;  2D9Z A;  2YRY A;  2CY5 A;  3SYX A;  2FCN A;  2WWZ A;  4AS1 A;  3CIR B;  2WDT B;  4DHZ E;  1M94 A;  3O65 B;  3Q8C A;  2KD0 A;  4C56 C;  4RF0 A;  4WAF A;  1WZ0 A;  1AN8 A;  5JHA A;  3L0W B;  3ZO5 B;  2K8B A;  5DPS A;  1HTQ A;  2D3G A;  3EC8 A;  4DX9 0;  3SDL C;  4HEA 1;  3E56 A;  2N1W A;  5D3D A;  1XQQ A;  4PK1 A;  5JHG A;  2HTH A;  1FCL A;  2BCJ A;  4YL8 A;  2KQ4 X;  1WX7 A;  3RNC C;  3LDZ E;  2N1V A;  3PRE A;  4RF1 A;  1IBX B;  1WFY A;  1M4V A;  1SE3 A;  1V6E A;  1WGY A;  3UGB B;  1C76 A;  2OHF A;  2QCZ A;  4ACF A;  2FAZ A;  2DYM A;  2BTE A;  3RNE C;  3IHP C;  3D32 A;  1FD6 A;  4A55 A;  2I2Y A;  2E3T A;  2INC C;  2NTS A;  3APF A;  2L52 A;  4JKG A;  4EZL A;  2YLM A;  2KQS A;  2JZP A;  4G11 A;  3SR6 A;  3T8M A;  5DPT A;  4WWM A;  2OQB A;  3N1Z C;  2ASQ A;  3H7S A;  4RM8 A;  1OQY A;  1IGD A;  2LUL A;  4GGQ A;  4D0N B;  2DX5 A;  1X11 A;  4UDU C;  5C5B B;  1ESF A;  3PGE A;  2IYB A;  1Q5W B;  1KRH A;  1EAZ A;  1YNT E;  3VTV A;  1JRP A;  2WHI A;  4LNF A;  1F2R C;  2Z13 A;  5BYS A;  1T0Q C;  2WXK A;  3D8E A;  1UBI A;  1XLO A;  1WG7 A;  1KBL A;  4IM2 A;  4HK2 A;  3TEX A;  2RUK B;  2GUM A;  3NWA A;  4HAT B;  2XK5 B;  2L32 A;  3A9J B;  4R3D A;  4A3O A;  1WF9 A;  3CMM B;  3AMZ A;  1V86 A;  1ZSQ A;  2V4L A;  3U2S C;  5HFY A;  1UBQ A;  4WAA A;  3OLM D;  2LBB A;  1NTV A;  2KR0 A;  2D4Q A;  2K6Q A;  2LUE A;  3ZYY X;  3NZS A;  2ACZ B;  1V97 A;  3AEA B;  3TFM A;  3MHZ A;  3U52 E;  2V3P A;  4CHJ A;  2MX2 A;  1EVH A;  1JWU D;  5E6O A;  2QDF A;  4II2 B;  4MM3 A;  4OW0 A;  5KQ4 A;  2CJN A;  2HTM E;  4GN1 A;  4E3C A;  2I5F A;  5G5G A;  3OWE B;  5JLJ B;  1E8X A;  1OFF A;  4KGR A;  4NY0 A;  4AUQ C;  2KZR A;  5M4Y B;  1MG8 A;  2L0T A;  3I57 A;  2FCQ A;  1JQ4 A;  1BTK A;  4NAW A;  2M38 A;  2M14 A;  2K1F A;  4YTN B;  4IC7 B;  4L23 A;  3M3J A;  4RGT A;  2EMS A;  4M8N A;  1QOB A;  1E5W A;  3KWV A;  1MG4 A;  4P6V F;  4E74 A;  1R4M I;  3DQV A;  1D6E C;  2KLC A;  1WGK A;  2W9N A;  3QA8 A;  3B9J A;  1PDX A;  5J3T A;  2D11 A;  1ZYI A;  2RSG A;  2GBJ A;  2WXI A;  3RPF C;  3HVZ A;  3VDZ A;  5HI1 A;  1H8C A;  2LG1 A;  1U4A A;  1LFD A;  2PIA A;  4IWP A;  1ZM0 A;  1WY8 A;  2JXX A;  2W82 A;  2NMQ A;  1KLV A;  3BWU D;  4YXD B;  3R2T A;  4HKQ A;  3PS6 A;  4DHJ B;  2KX0 A;  1Y19 B;  3Q6B A;  2I1J A;  2I5C A;  1P1A A;  2MP2 A;  3MC9 A;  1TZ1 A;  1YN4 A;  4J6I A;  1XD3 B;  1XCQ L;  3UIP B;  4C80 A;  5LLI A;  2GJY A;  1E6E B;  4CHK A;  2R2Q A;  3BVM A;  1RFA A;  1WSP A;  3HW2 B;  3P4S B;  5IAA C;  1C4P A;  4KX6 B;  1LO5 D;  2C7M B;  4RGN A;  4B0M A;  3Q3J A;  4F7H A;  2M8S A;  3DBL B;  1NYR A;  2CRF A;  2VH2 A;  1FRD A;  4N59 A;  1N60 A;  1OY2 A;  3KSY A;  4JK7 A;  3E66 A;  2KVR A;  2O6V B;  3Q69 A;  3NRZ A;  4KKI A;  2AL3 A;  2A4Z A;  2M56 B;  3WAL A;  3EFU A;  2V4I B;  1G6J A;  2RRF A;  4FUL A;  3W5V B;  3P4P B;  4EZK A;  5CLQ B;  3ZRC A;  4FBJ B;  2DZI A;  1RLF A;  2D9W A;  2P0F A;  5D3I B;  2C5L C;  3BZD B;  3TCA A;  2XNA C;  4LJO B;  2MBB B;  5IA7 A;  5DHA B;  1V1P A;  4ANV A;  2ICI A;  1Q0W B;  4BOS C;  2K39 A;  4O1N A;  2MRP A;  4TMA B;  2FE8 A;  4A3P A;  3CSF A;  3FAH A;  2A5U A;  4YSY B;  4FN2 A;  3BIN A;  4DIX A;  3AE2 B;  1MI0 A;  2M4N A;  1WXM A;  1U5G A;  1PFD A;  3M62 B;  2KT7 A;  1K52 A;  3KW5 B;  4OZB A;  4IKG A;  2CU3 A;  1WM2 A;  4KZC A;  1MJD A;  1E8Z A;  3FSS A;  2DYO A;  4XDD A;  5H8Y E;  2QIE B;  3QAR A;  5BMI A;  2IDY A;  4WWP A;  3AEE B;  3VUX A;  4FHK A;  2RVB B;  1IPG A;  1UNP A;  3R7R A;  2DHK A;  2RSU A;  3N1X C;  4GXB A;  3DBL I;  1D5M C;  4BOZ B;  1N61 A;  1FGZ A;  3R7Q A;  2IND C;  1WE7 A;  4M01 A;  1Z87 A;  4WH4 A;  2KFJ A;  1MIX A;  2QMT A;  3CXB B;  1J7C A;  2FNJ B;  4OVU A;  1I42 A;  4W9J A;  2P0H A;  2KX3 A;  3DXD A;  2Y5P A;  2BYT A;  4H2A A;  4TV3 A;  3D8F A;  3X23 A;  1GB4 A;  2N9L A;  5KHQ A;  1I4X A;  1WVH A;  1V5O A;  4K2O A;  1SGH A;  3P42 A;  3B1L X;  3SO6 A;  3M1I B;  2D3A A;  4DX8 A;  1DYQ A;  2N9E B;  4C7Z A;  4M8M A;  4WWO A;  4NNJ B;  2UWQ A;  4MH8 A;  2Z59 A;  1WI0 A;  3V62 A;  1ISN A;  1P7F A;  3DBR B;  3RYT A;  3A1Q A;  2IZV B;  2CAY A;  3DVN V;  2GLS A;  1YQ4 B;  2M0X A;  4IWO A;  1UNS A;  3MC8 A;  5JZE B;  1AQC A;  3RNB C;  2YF0 A;  3RN9 C;  2LRW A;  3SNH A;  1TS4 A;  1UZX B;  3RT3 B;  2W3R A;  3VTU A;  1PMS A;  2OED A;  4DDG D;  2K8C A;  1X86 A;  3LYY A;  1B9R A;  3JSV A;  2RGF A;  2RDG A;  5KCV A;  3AM9 A;  3NVY A;  3GYP A;  4DHJ D;  5TSS A;  3HVD A;  3WAP A;  2G4D B;  1L6U A;  1F1H A;  2J52 A;  3VXW A;  2C7H A;  3RUI B;  1J19 A;  2BGF A;  4GDK B;  3DWG C;  1JAL A;  1JWB D;  3SBT A;  5CHV C;  4LNO A;  4M02 A;  1EO6 A;  1F2R I;  1NEN B;  4JWU C;  5C3J B;  1JML A;  1N63 A;  4GDK A;  2KCJ A;  3DCX A;  5HG2 A;  2WXF A;  1MK9 B;  3V60 A;  2JVC A;  4KHB B;  3AE4 B;  1VR9 A;  4NJ6 A;  2H88 B;  4QJ5 B;  1NTY A;  1XCT L;  3WYF B;  1VJK A;  2AX5 A;  1LXD A;  4C0A A;  1FRR A;  1VZ7 A;  4BKS D;  2KFK B;  1UWX A;  3UIO B;  1HZ6 A;  4WQO B;  1ZUD 2;  2Y5C A;  2RPQ A;  4NQK E;  2ROV A;  4KDL B;  2KTF A;  3AEG B;  3HQC A;  2CR5 A;  2WXO A;  2GCL A;  1T0Y A;  1FXI A;  5DCN A;  2VRW B;  2MWS B;  3LXF A;  3GS2 A;  3A9K A;  4ZRP A;  1V5P A;  4YON A;  3WAN A;  4EJN A;  3MPX A;  4AP4 C;  1V9J A;  2LGX A;  1AYF A;  1NVL A;  2WYQ A;  3ALB A;  4GZU A;  2IYD B;  2N7J A;  2Z0Q A;  2V9H A;  5KHO A;  1FOE A;  4IWQ A;  1FM0 D;  2WDQ B;  2KDF B;  5EE0 A;  2LGY A;  2KWV B;  2KTR B;  4HB3 B;  4CHM A;  2G9H D;  2JUO A;  4CSQ A;  3GP7 A;  2MFQ A;  1AWD A;  1EF5 A;  4IM0 A;  4A9A A;  4ZDV A;  5JHB A;  2LXA A;  4JKF A;  4JKD A;  2PPH A;  4HRS A;  4II3 B;  2BVC A;  3AH7 A;  1FO4 A;  2YEP B;  1I4G A;  1WXS A;  3B0A A;  2K8H A;  3RCZ A;  3QIJ A;  1V88 A;  3VIA A;  3RCP A;  2HE7 A;  2VH1 A;  3ZNZ B;  4DWF A;  5HHD G;  1TGZ B;  3D8D A;  1T0S C;  2PLP A;  5AZH A;  1V61 A;  1E90 A;  3AUL A;  4Q2J A;  2PW9 A;  4JL9 A;  3N1Y C;  3PSE B;  2FBW B;  3U8Z A;  1SF0 A;  1NVI D;  2AQ3 B;  2BPS A;  2LRU A;  3QBV B;  1WIA A;  3NVV A;  1DOY A;  2CJO A;  4ITK A;  1CQV A;  1FB8 A;  1QOG A;  5FI1 A;  3DPD A;  3MFG A;  4KIK A;  1UD7 A;  3EGR A;  3EHV A;  2LWP A;  2W3S A;  1L4Z B;  3ODW A;  3NS1 A;  2KWU B;  2N9K A;  4DBB A;  3WIM A;  4MGY E;  2L0F A;  1L5P A;  3EEC A;  5CTR C;  2BYV E;  1FCC C;  2GOW A;  2B3A A;  1TS3 A;  4TUU A;  4F7U P;  1E8W A;  3B2G A;  3C8Y A;  3AXC A;  4G0N B;  3JYU A;  1SHC A;  2K49 A;  5HE2 A;  2Y8F A;  2WDR B;  1HB8 A;  2KLG A;  4HHV A;  1VBG A;  2KMA A;  1BT0 A;  3AU4 A;  1L0V B;  4XDC A;  4JK8 A;  1X1M A;  2YS3 A;  2KOX A;  3AU5 A;  3J9C A;  1FXT B;  4QJ4 B;  1RJ2 A;  5C1Z A;  2CU1 A;  3A4R A;  2XEW A;  3HSA A;  2WX1 A;  4L6E A;  1WX8 A;  5C2T B;  3JW0 X;  2OJR A;  1UUP A;  1SSN A;  3KLS X;  2DZJ A;  3R3M A;  4HWI B;  3ULC A;  1TS2 A;  1P6S A;  3N32 A;  2LJI A;  1Z5S B;  2NZ8 B;  2H89 B;  2DN6 A;  2KO3 A;  4YSZ B;  3H7P B;  4C00 A;  1FFV A;  5CLL B;  3W9C B;  2ZNV C;  2KGX B;  3VRA B;  2COF A;  4BBN C;  2C7N B;  4K7S A;  3TO1 A;  3TIX A;  2CHZ A;  3VUY A;  1TTN A;  3EUB 2;  2HRJ A;  3ZGZ A;  5HKH A;  5BMG A;  1PYW D;  1KM7 A;  1K50 A;  1L0X B;  3KUZ A;  2NMB A;  3OG5 A;  4A6H A;  2ZPN A;  3DDC B;  1FEH A;  1FFU A;  1VZ8 A;  1VBH A;  4G50 A;  1D5Z C;  4URK A;  3PRZ A;  1KF6 B;  3PSC A;  1ZGU B;  3UI3 A;  4BBN F;  3MHS D;  2COA A;  2LOZ A;  1C77 A;  1CMX B;  3T9L A;  1IUE A;  2DLB A;  5EE3 A;  2ZEQ A;  1TYG B;  5AZF A;  2V3S A;  3PLV A;  3VOQ A;  1XLN A;  4RH6 A;  4DK5 A;  4YTM B;  2H7D A;  5DIF B;  3B2F A;  4I6N B;  2K22 A;  3QAQ A;  1JRU A;  2CKH B;  1JCK B;  3PHX B;  2HTH B;  4US9 A;  1IGC A;  2O2V A;  2BW2 A;  1B55 A;  4PS8 A;  1LM8 B;  4DXA B;  1KOT A;  4FLH A;  2WXP A;  4L1R A;  2FUH B;  3ZDT A;  5J3Y A;  5D3V A;  2IO3 B;  2V1Y A;  3L4P A;  2MJ3 A;  3W2D A;  4KV2 A;  1XOD A;  1UEL A;  3M95 A;  5LXH A;  4JKG B;  4KVG B;  1FNW A;  4WJ7 A;  4W9G A;  5GMV A;  2N0S B;  1MIZ B;  4ARC A;  2DWQ A;  2PJH A;  2DX5 B;  2INP E;  5IJM A;  5BYQ A;  5I4D A;  1AW7 A;  3KVF B;  4KGS A;  3ZDM C;  1GOZ A;  1ZW7 A;  1MK7 B;  1J0G A;  1XX0 A;  5J17 A;  4AWJ A;  3TMP B;  2DTC A;  4MDK E;  3PHW B;  3P4Q B;  1V1O A;  3T3O A;  4LLG M;  5JH5 C;  1CK1 A;  4B6W A;  4OHJ A;  2G4S A;  3PVL A;  3TJP A;  4Z2N A;  5BYR A;  2L2I A;  2AEH A;  3FP5 A;  3U12 A;  2Z0E B;  3BII D;  1K5D B;  1TY0 A;  2I1K A;  4C4V A;  2COD A;  2NS5 A;  3E9P A;  1T77 A;  1R4M B;  4ILH A;  3SUZ A;  2OTX A;  3SFE B;  3NHE B;  1RWS A;  2WQY B;  5D7G A;  2D2Q A;  3HM3 A;  3SHQ A;  3C19 A;  4JKE A;  2NBV A;  2V0G A;  1I4R A;  3AJ4 A;  2MA9 B;  3UIN B;  2R2Y A;  2YVC A;  1TIF A;  4MSM B;  2KVZ A;  2ZVO A;  2BS4 B;  5HE1 A;  1U2B A;  4JKH A;  3VR8 B;  2MBO A;  5C16 A;  1WH3 A;  1K51 A;  5HE3 A;  3OAN A;  3SU8 X;  4MM3 B;  3KUC B;  2ABD A;  3RMK C;  3R8B A;  1L0Y B;  1GC6 A;  1TZO A;  4ANW A;  2PVO D;  5C6R A;  3OJ4 B;  1FNU A;  3NWF A;  4M0W A;  4RCO A;  3TW1 A;  2Z0D B;  4W9I A;  1YIW A;  4DQO C;  2FID A;  4GIV A;  1WJ4 A;  1YX6 B;  4NAW B;  3HIZ A;  1ET6 A;  2DLW A;  4K3B A;  3O96 A;  1DBH A;  1C1Y B;  4ARI A;  3DWM A;  1P98 A;  2SEB D;  5DPW A;  3A58 A;  1TKY A;  5FR6 A;  5JVL A;  1XLQ A;  3SBG A;  4TQ1 A;  4NSW A;  3Q2A C;  2LGD A;  2LKO A;  3RD2 A;  5GXG B;  3V5W A;  1ACC A;  2NBW B;  2WXM A;  2JYE A;  2UYZ B;  2WLB A;  2PEA A;  1HZ5 A;  3NS8 A;  2DZM A;  5LOP B;  4P1B C;  2QSD A;  3V6E B;  4EOY A;  2VSZ A;  2WXL A;  1ZDV A;  4A8X C;  1HXY D;  2PMV A;  2MP2 B;  3CF6 E;  4JPS A;  2HJ8 A;  2P0D A;  4M00 A;  4S17 A;  2ZNV B;  1MVK A;  2N7E A;  3QWZ B;  1L7Y A;  1KC7 A;  1YMH E;  3P4R B;  2WP9 B;  4A20 A;  2DBY A;  1K5G B;  2UZS A;  1V8C A;  4OVV A;  3ZXV A;  3AE1 B;  2J42 A;  2JSV X;  1FPY A;  4GPT B;  4Y94 A;  4ANX A;  2G35 A;  1YJJ A;  3PO0 A;  2G3Q B;  2J0J A;  3SV1 A;  1YD8 U;  2QHO A;  2JU6 X;  3ZVV A;  2KMC A;  2L00 B;  3AE6 B;  1SE2 A;  4HDQ A;  2WXH A;  2E2X A;  1V89 A;  1ZPS A;  1QIL A;  5FI0 A;  3ZNG C;  1PGA A;  2IBI B;  3FVC A;  1PFJ A;  3F0W A;  2LD9 A;  4G3X B;  3QQ8 B;  1V1P B;  2YT2 A;  3QJZ A;  3DBS A;  3Q8A A;  3ZIM A;  4ZOH C;  1NEK B;  4MGZ E;  2AWT A;  4RGM A;  4KGT A;  1FHW A;  1GC7 A;  3VAW A;  1QOF A;  5JXV A;  4HAZ B;  4W9F A;  1W1H A;  1WGH A;  2JP2 A;  2KJ6 A;  1TXD A;  3ULB A;  2NTT A;  2DIK A;  4A6K A;  2DEN B;  2QIL A;  4ILJ A;  1TJ6 A;  1UF0 A;  3TEY A;  4BFR A;  4IW0 A;  3UQB A;  5EFX A;  1DDV A;  3ZVR A;  1V5U A;  5IP4 D;  1D5X C;  1NBF C;  4JKC A;  4HAY B;  3KH0 A;  4JLC A;  3ZQ4 A;  2PKO A;  1UGM A;  5I2S A;  3TSS A;  3VUW A;  2OOB B; 
#chains in the Genus database with same CATH homology
 2VRR B;  2MQJ A;  1BWN A;  3PRM B;  2IFS A;  4RM9 A;  4W9E A;  3SD5 A;  2BYE A;  3BJI A;  2D10 A;  3P6A A;  3VTW A;  4AJY B;  2FJL A;  3L13 A;  2K25 A;  3TL5 A;  4KAX B;  4BKG A;  2DAJ A;  4KHA A;  5LON B;  2WH5 A;  4X57 B;  2KDB A;  2RNR B;  1Y5O A;  2DHJ A;  4FA6 A;  2GMI C;  5KQ1 A;  3UZT A;  4F8C B;  4K81 A;  4LDT D;  1I2H A;  2Z59 B;  2DHZ A;  3W1Y A;  1WI1 A;  1AWE A;  5TR5 A;  4W9K A;  3A1Q B;  1TBE A;  3GZN I;  4HCN B;  2ZJD A;  1OEY A;  1P9D U;  3P7Z A;  2Y7B A;  2MSE D;  2W2X C;  3TVV A;  3JSV B;  3DVG X;  3PG7 A;  1ZC3 B;  1DDM A;  2D07 B;  3A4S C;  1IP9 A;  2KNB A;  1JDE A;  3HK0 A;  2MW5 A;  2CQU A;  4HPM B;  2BF8 B;  5D6J B;  3ZW3 A;  4F7G A;  4XC2 A;  4IM3 A;  3L10 B;  3A33 B;  4MEL A;  3K9P B;  2BKF A;  2PZ1 A;  3CST A;  4BVU C;  4DHZ B;  2COC A;  2COP A;  1WGU A;  1HB6 A;  1P3R A;  3IG3 A;  2KC1 A;  4MEM A;  2G45 B;  2N7D A;  1H4R A;  2FDQ A;  1Z2M A;  1ZC4 B;  2K00 A;  2DAF A;  1WJM A;  2DYQ A;  3DBH I;  3ENE A;  5BO4 B;  2IY0 B;  1XD4 A;  3A9K B;  2DA0 A;  4A6F A;  3PPA A;  2RD0 A;  1WZ3 A;  2R09 A;  4MJS A;  3HM6 X;  1WXA A;  2KC2 A;  4ASW C;  1Q67 A;  2LVO A;  4HB0 B;  1HE8 A;  2JRI B;  1DRO A;  1M7R A;  1C3T A;  3OAW A;  4ICV A;  3PRP B;  2ZCC A;  4W9C A;  4EFO A;  5AEK B;  4CYE A;  1BAK A;  2JT4 B;  3ZNH B;  3PZD A;  1E7V A;  1WE6 A;  2W2W A;  3MDB C;  1XKE A;  2LAS A;  4MGK E;  5LXI B;  4GMV A;  4KIK B;  1DIK A;  1E8Y A;  1V2Y A;  3ZTD A;  5JP4 A;  3APC A;  3N7C A;  2IO1 B;  1WGD A;  2NBU A;  1WXV A;  4EZJ A;  1GJZ A;  4K7W A;  1R4N I;  2FCS A;  4JGH B;  1U29 A;  1UH6 A;  1OQN A;  1NI2 A;  4I6L B;  2BKR B;  1IYF A;  4HJK A;  2K2U A;  3APD A;  5CX3 A;  4GDL A;  2J0M A;  1UPQ A;  2KDI A;  3DCG A;  3PTF C;  2YS1 A;  1YX5 B;  4MH0 E;  2IO2 B;  4HAW B;  4DDI D;  5HE0 A;  2D9X A;  2LVP A;  4KHO A;  3RZW C;  1ZVR A;  2CB8 A;  2LOX A;  2KN5 A;  2IO0 B;  5EDS A;  2J7Q B;  4PQ0 A;  4W9H A;  3DVG Y;  2MBE A;  1K8R B;  3KY9 A;  4EEW A;  4MY6 A;  1P0R A;  1V81 A;  3VH3 B;  1WJ6 A;  4KZ0 A;  1YJ1 A;  1ACA A;  2JPH A;  3ZTC A;  2L1C A;  2EJ8 A;  2EMT A;  4AOF A;  3KYD D;  2NPT A;  1Y8R C;  4KSL C;  1VD2 A;  2L05 A;  3L16 A;  2HD5 B;  2N23 A;  3KRW A;  4K2P A;  2MWN B;  2IY1 B;  3L17 A;  2KAN A;  3WAM A;  1X05 A;  3IBE A;  3Q3F A;  3ECI A;  2LZ6 A;  3ML9 A;  4KSK C;  2M1M A;  1NTI A;  1YQB A;  2GCJ A;  4IOY X;  2K6D B;  3ML8 A;  4ANU A;  3NSU A;  1GUA B;  1Q1O A;  2KWC A;  4F7Z A;  1OTR B;  4B6H A;  3NY5 A;  5D3X A;  3C0R B;  4BKT A;  2O2V B;  5C23 A;  2YSZ A;  2EKE C;  3DXC A;  1PLS A;  2KUP A;  2CY4 A;  4FAD A;  3H6N A;  2FCM A;  2KK8 A;  3CIK A;  4FJV B;  3G9W A;  2MBQ A;  2RGN B;  4GU2 A;  2KQ7 A;  3PT2 B;  5L83 A;  2C60 A;  1V80 A;  2M17 A;  4HPL B;  3UQA A;  1FGY A;  5L81 A;  2RLO A;  3PLU A;  2V76 A;  4XX5 A;  3F5R A;  4ZRI A;  3VH4 B;  1L2N A;  1WGQ A;  2PE9 A;  5J18 A;  3PP2 A;  3W1S A;  5G55 A;  2LJ5 A;  3B08 A;  5GOW B;  3FM8 C;  2WX0 A;  1WJU A;  4PNK A;  2KJR A;  2X18 A;  1XR0 B;  2JZZ A;  5E6N A;  3A8Q A;  3PVW A;  2NBV B;  4K1R B;  5DI9 B;  3K9O B;  4HCP B;  4KDI C;  2MBH A;  3KYC D;  2KKC A;  5DH9 B;  5D94 A;  4EMO A;  4K17 A;  4W9L A;  1QQG A;  4XWX A;  4FHJ A;  4ZYN A;  3GOE A;  4I6P A;  5C5B A;  4W9D A;  2FIF A;  4DBG A;  4M0W B;  1RRB A;  5JHH A;  4HB4 B;  4A5K A;  3FEH A;  3H9D A;  1E7U A;  1U27 A;  2W2X D;  3NZU A;  2XK5 A;  3A9J A;  4HAU B;  2MDX A;  5AZG A;  2LYD A;  1NU2 A;  4JQW C;  2AYO B;  4HVB A;  4LDT B;  1KI1 B;  4EUT A;  4MSQ B;  2C9W B;  3UF8 A;  2Y5B B;  4AJW A;  3MTN B;  1D3Z A;  4CO7 A;  1OEY J;  1WM3 A;  2NR2 A;  1U5E A;  3S2A A;  5J3Q A;  5E6P A;  3PVU A;  1NDD A;  3KRX A;  3ONS A;  2LVQ A;  2CHX A;  2DX1 A;  3ZNI D;  2RR9 A;  2ZCB A;  3PEG A;  3PV1 A;  4GSW A;  4IAP A;  1LQB A;  2XQN M;  1OMW A;  2PE6 B;  2CHW A;  2DKQ A;  3A98 B;  1GGO A;  1P5T A;  1X1G A;  4WJO A;  1S3S G;  1DDW A;  2GS0 A;  3QC8 B;  2LI5 A;  2BYF A;  1I35 A;  2JY6 A;  1N3H A;  3U7D A;  1WJ1 A;  4IG7 B;  3ZUN A;  2J0K A;  3N30 A;  4B9K A;  2X0S A;  2ADZ A;  2ZPY A;  4BBK A;  2L3Z A;  2XBB C;  4PYU A;  2YS5 A;  3EPY A;  4F1S A;  2R2O A;  1ZKH A;  3L08 A;  3QX1 A;  2O6V A;  3LJ3 A;  3R66 C;  2K2J A;  3QCA A;  4B95 A;  2NVU I;  4JKB A;  4RMA A;  2FJ9 A;  4PYZ A;  3JVZ X;  1F9J A;  4BKS A;  4HAX B;  1RRP B;  2H7E A;  3HHM A;  1EGX A;  4IUM B;  5C79 A;  2JWZ A;  4ZRJ A;  2L76 A;  2MKR A;  3BY4 B;  4PS3 A;  3RZF A;  3ENB A;  3E9O A;  3T06 A;  3DOW A;  3N3K B;  5G2N A;  4EKU A;  4WJN A;  2RQ1 A;  4WVF B;  4MGI E;  1AAR A;  3IVF A;  1V5M A;  4H8S A;  1VCB A;  1MPH A;  2ELB A;  1I7A A;  5J2R A;  2R0D A;  1WX9 A;  1DYN A;  3WA0 A;  3M63 B;  3ZLZ A;  1W1G A;  3VHT C;  3X0W A;  3WAO A;  1MKE A;  1W1D A;  2P8V A;  2D9V A;  2ELA A;  3H1U A;  4TYZ A;  4JK9 A;  4GMX B;  1KZ7 A;  5DPR A;  1EF1 A;  2KJH B;  4N9F 4;  1UEF A;  1M7E A;  1BTN A;  4GB9 A;  2DYN A;  1FHO A;  3L54 A;  1SE9 A;  4ZRK A;  2JRH A;  3E9L A;  4MT7 A;  1WRD B;  2N4F A;  1FHX A;  1UPR A;  2YT0 A;  1WR1 A;  4NJ7 A;  2JF5 A;  3V6C B;  2Y8G A;  1J8C A;  5CHW A;  2R82 A;  1UNR A;  4P7I A;  2KHW B;  1H10 A;  1ST7 A;  3P2B A;  2Z0O A;  2N9P C;  4JIO U;  3V61 A;  2JZ3 B;  4ICU A;  1WMH B;  3AI5 A;  3OJ3 A;  3VVW B;  1S1Q B;  1HBK A;  2O6V D;  1WMH A;  4HDO A;  1KZG A;  3GYO A;  1KJT A;  3LJU X;  1FAO A;  4A6F B;  4NPN A;  1MAI A;  1LB1 A;  2L7R A;  3W1S C;  3QWM A;  5DHF B;  1J0W A;  2CS4 A;  3DBR I;  3KUD B;  1TQZ A;  2J59 M;  4WJP A;  4MJS B;  2ZVN A;  2DHI A;  4HXD A;  3ODX A;  2KFK A;  1P3Q U;  3IFW B;  4GOC A;  3TBL D;  3A8P A;  2DKP A;  2QKM A;  3QHT A;  4PS7 A;  4MK0 A;  5D3W A;  2VKI A;  1OGW A;  3VFK A;  1A5R A;  4WWN A;  2MCN B;  3NOB A;  3ML4 A;  5D27 A;  1UNQ A;  2GBM A;  2DFK A;  3FLV A;  2N9X A;  3U30 A;  4TKN A;  4K7U A;  2KTR A;  3ODO A;  3QK0 A;  1RAX A;  1WJN A;  1X1F A;  4WSF A;  3DXE A;  4GDL B;  4XZ4 A;  1WR6 E;  1XCG A;  3VQI A;  5D2M B;  1V5T A;  2UVM A;  3DVN U;  1WGR A;  2Z0P A;  4WJQ A;  3RUL A;  2L8J A;  1U5F A;  1PQS A;  5CHF A;  4LCD E;  2EC1 A;  5L95 C;  2KDE B;  4IFS A;  1GNU A;  5D3Y A;  2KXJ A;  3I3T B;  2DZK A;  4HB2 B;  1XT9 B;  2BWE S;  2DYB A;  2NPT B;  4LJP B;  1SIF A;  2GBK A;  4FJZ A;  4E71 A;  1U5D A;  1GG3 A;  2BWF A;  3ZRF A;  1QZE A;  2NCN A;  1WYW B;  3MJW A;  2D9Y A;  4ILG B;  2ZZP B;  2UZR A;  2AL6 A;  4FJY A;  2LXC A;  1IRS A;  2GBR A;  1V49 A;  2N0Y A;  1QC6 A;  1LW3 A;  2MLB A;  2ROZ B;  4Z2M B;  3H7P A;  1WGG A;  4NQL B;  1EUV B;  2GBN A;  4HAV B;  4HLE A;  3KZ1 A;  2YT1 A;  4TQ0 A;  3ZKJ C;  2Q13 A;  2QKL A;  4JKA A;  2REX A;  2D9Z A;  2YRY A;  2CY5 A;  3SYX A;  2FCN A;  2WWZ A;  2WDT B;  4DHZ E;  1M94 A;  3O65 B;  2KD0 A;  1WZ0 A;  5JHA A;  3L0W B;  3ZO5 B;  2K8B A;  5DPS A;  2D3G A;  3EC8 A;  4DX9 0;  3SDL C;  2N1W A;  1XQQ A;  5JHG A;  2HTH A;  2BCJ A;  4YL8 A;  1WX7 A;  3LDZ E;  2N1V A;  3PRE A;  1WFY A;  1V6E A;  1WGY A;  3UGB B;  2FAZ A;  2DYM A;  3IHP C;  3D32 A;  3APF A;  4JKG A;  4EZL A;  2YLM A;  2KQS A;  4G11 A;  3T8M A;  5DPT A;  2OQB A;  2ASQ A;  3H7S A;  4RM8 A;  1OQY A;  2LUL A;  4GGQ A;  4D0N B;  2DX5 A;  1X11 A;  5C5B B;  3PGE A;  2IYB A;  1Q5W B;  1EAZ A;  3VTV A;  3D8E A;  1UBI A;  1WG7 A;  1KBL A;  4IM2 A;  4HK2 A;  2RUK B;  4HAT B;  2XK5 B;  3A9J B;  4A3O A;  1WF9 A;  3CMM B;  1V86 A;  1ZSQ A;  2V4L A;  1UBQ A;  4WAA A;  3OLM D;  2LBB A;  1NTV A;  2D4Q A;  2K6Q A;  2LUE A;  3NZS A;  3TFM A;  4CHJ A;  2MX2 A;  1EVH A;  5E6O A;  4II2 B;  4MM3 A;  5KQ4 A;  4GN1 A;  4E3C A;  2I5F A;  5JLJ B;  1E8X A;  4NY0 A;  4AUQ C;  2KZR A;  1MG8 A;  2L0T A;  2FCQ A;  1BTK A;  4NAW A;  2M38 A;  2M14 A;  2K1F A;  4IC7 B;  3M3J A;  2EMS A;  4M8N A;  1E5W A;  4E74 A;  1R4M I;  3DQV A;  2KLC A;  2W9N A;  3QA8 A;  5J3T A;  2D11 A;  2RSG A;  2GBJ A;  3VDZ A;  1H8C A;  2LG1 A;  1U4A A;  1LFD A;  4IWP A;  1ZM0 A;  1WY8 A;  2JXX A;  1KLV A;  3PS6 A;  4DHJ B;  2KX0 A;  1Y19 B;  2I1J A;  2I5C A;  1P1A A;  2MP2 A;  1TZ1 A;  4J6I A;  1XD3 B;  3UIP B;  5LLI A;  2GJY A;  4CHK A;  2R2Q A;  1RFA A;  3HW2 B;  5IAA C;  2C7M B;  3Q3J A;  4F7H A;  2M8S A;  2CRF A;  1OY2 A;  3KSY A;  4JK7 A;  3E66 A;  2KVR A;  2O6V B;  2AL3 A;  2A4Z A;  3WAL A;  3EFU A;  1G6J A;  4FUL A;  4EZK A;  5CLQ B;  3ZRC A;  4FBJ B;  2DZI A;  1RLF A;  2D9W A;  2P0F A;  2C5L C;  3TCA A;  4LJO B;  2MBB B;  5IA7 A;  5DHA B;  4ANV A;  1Q0W B;  4BOS C;  2K39 A;  2MRP A;  4A3P A;  3CSF A;  2A5U A;  4FN2 A;  3BIN A;  2M4N A;  1WXM A;  1U5G A;  3M62 B;  3KW5 B;  1WM2 A;  4KZC A;  1E8Z A;  3FSS A;  2DYO A;  3QAR A;  4WWP A;  3VUX A;  4FHK A;  2RVB B;  1IPG A;  1UNP A;  3R7R A;  2DHK A;  2RSU A;  4GXB A;  3DBL I;  4BOZ B;  1FGZ A;  3R7Q A;  1WE7 A;  1Z87 A;  2KFJ A;  1MIX A;  3CXB B;  2FNJ B;  4OVU A;  1I42 A;  4W9J A;  2P0H A;  2KX3 A;  3DXD A;  4TV3 A;  3D8F A;  3X23 A;  5KHQ A;  1WVH A;  1V5O A;  4K2O A;  1SGH A;  3B1L X;  3SO6 A;  3M1I B;  4DX8 A;  2N9E B;  4M8M A;  4WWO A;  4NNJ B;  2UWQ A;  1WI0 A;  3V62 A;  1ISN A;  3RYT A;  3A1Q A;  2IZV B;  2CAY A;  3DVN V;  2M0X A;  4IWO A;  5JZE B;  1AQC A;  2YF0 A;  2LRW A;  3SNH A;  1UZX B;  3RT3 B;  3VTU A;  1PMS A;  4DDG D;  2K8C A;  1X86 A;  3JSV A;  2RGF A;  5KCV A;  3GYP A;  4DHJ D;  3WAP A;  2G4D B;  3VXW A;  2C7H A;  3RUI B;  1J19 A;  2BGF A;  4GDK B;  3SBT A;  5CHV C;  1EO6 A;  4GDK A;  2KCJ A;  1MK9 B;  3V60 A;  2JVC A;  4KHB B;  4NJ6 A;  1NTY A;  3WYF B;  1LXD A;  4C0A A;  4BKS D;  2KFK B;  3UIO B;  4WQO B;  2RPQ A;  4NQK E;  2ROV A;  4KDL B;  2KTF A;  3HQC A;  2CR5 A;  2GCL A;  1T0Y A;  5DCN A;  2VRW B;  2MWS B;  3A9K A;  1V5P A;  4YON A;  3WAN A;  4EJN A;  3MPX A;  4AP4 C;  1V9J A;  2LGX A;  1NVL A;  2WYQ A;  3ALB A;  4GZU A;  2IYD B;  2Z0Q A;  5KHO A;  1FOE A;  4IWQ A;  2KDF B;  2LGY A;  2KWV B;  2KTR B;  4HB3 B;  4CHM A;  2JUO A;  2MFQ A;  1EF5 A;  4IM0 A;  4ZDV A;  5JHB A;  2LXA A;  4JKF A;  4JKD A;  2PPH A;  4II3 B;  1WXS A;  3B0A A;  2K8H A;  3RCZ A;  3QIJ A;  1V88 A;  3VIA A;  3RCP A;  2HE7 A;  3ZNZ B;  4DWF A;  1TGZ B;  3D8D A;  5AZH A;  1V61 A;  1E90 A;  3AUL A;  4JL9 A;  3PSE B;  3U8Z A;  2BPS A;  2LRU A;  3QBV B;  1WIA A;  1FB8 A;  5FI1 A;  3DPD A;  4KIK A;  1UD7 A;  3EHV A;  2LWP A;  3ODW A;  2KWU B;  4DBB A;  3WIM A;  4MGY E;  2L0F A;  3EEC A;  5CTR C;  2BYV E;  2GOW A;  2B3A A;  4TUU A;  4F7U P;  1E8W A;  3AXC A;  4G0N B;  3JYU A;  1SHC A;  5HE2 A;  2Y8F A;  1HB8 A;  2KLG A;  4HHV A;  1VBG A;  2KMA A;  1BT0 A;  3AU4 A;  4JK8 A;  1X1M A;  2YS3 A;  2KOX A;  3AU5 A;  1FXT B;  1RJ2 A;  5C1Z A;  2CU1 A;  3A4R A;  2XEW A;  2WX1 A;  4L6E A;  1WX8 A;  3JW0 X;  2OJR A;  2DZJ A;  3R3M A;  4HWI B;  3ULC A;  1P6S A;  3N32 A;  1Z5S B;  2NZ8 B;  2DN6 A;  2KO3 A;  3H7P B;  5CLL B;  2ZNV C;  2KGX B;  2COF A;  4BBN C;  2C7N B;  4K7S A;  3TO1 A;  3TIX A;  2CHZ A;  3VUY A;  1TTN A;  2HRJ A;  5HKH A;  1KM7 A;  3KUZ A;  2NMB A;  4A6H A;  2ZPN A;  3DDC B;  1VBH A;  4G50 A;  4URK A;  3PRZ A;  3PSC A;  1ZGU B;  4BBN F;  3MHS D;  2COA A;  2LOZ A;  1CMX B;  3T9L A;  2ZEQ A;  5AZF A;  2V3S A;  3PLV A;  3VOQ A;  4DK5 A;  2H7D A;  5DIF B;  4I6N B;  3QAQ A;  1JRU A;  2CKH B;  3PHX B;  2HTH B;  2O2V A;  1B55 A;  4PS8 A;  1LM8 B;  4DXA B;  1KOT A;  4FLH A;  2FUH B;  3ZDT A;  5J3Y A;  5D3V A;  2IO3 B;  2V1Y A;  4KV2 A;  1XOD A;  1UEL A;  3M95 A;  5LXH A;  4JKG B;  4KVG B;  4WJ7 A;  4W9G A;  5GMV A;  1MIZ B;  2PJH A;  2DX5 B;  5IJM A;  3KVF B;  3ZDM C;  1ZW7 A;  1MK7 B;  1J0G A;  1XX0 A;  5J17 A;  4AWJ A;  3TMP B;  2DTC A;  4MDK E;  3PHW B;  5JH5 C;  4B6W A;  2G4S A;  3PVL A;  3TJP A;  4Z2N A;  2L2I A;  2AEH A;  3FP5 A;  2Z0E B;  1K5D B;  2I1K A;  2COD A;  2NS5 A;  3E9P A;  4ILH A;  3SUZ A;  2OTX A;  3NHE B;  5D7G A;  2D2Q A;  3HM3 A;  3SHQ A;  4JKE A;  3AJ4 A;  2MA9 B;  3UIN B;  2YVC A;  4MSM B;  2ZVO A;  5HE1 A;  1U2B A;  4JKH A;  2MBO A;  5C16 A;  1WH3 A;  5HE3 A;  3OAN A;  3SU8 X;  3KUC B;  2ABD A;  1GC6 A;  4ANW A;  5C6R A;  3OJ4 B;  3TW1 A;  2Z0D B;  4W9I A;  1YIW A;  2FID A;  4GIV A;  1WJ4 A;  1YX6 B;  4NAW B;  3HIZ A;  2DLW A;  3O96 A;  1DBH A;  1C1Y B;  1P98 A;  5DPW A;  5FR6 A;  5JVL A;  3SBG A;  4TQ1 A;  4NSW A;  2LGD A;  2LKO A;  3RD2 A;  3V5W A;  2NBW B;  2UYZ B;  2PEA A;  3NS8 A;  2DZM A;  5LOP B;  3V6E B;  4EOY A;  2VSZ A;  2MP2 B;  3CF6 E;  2HJ8 A;  2P0D A;  2ZNV B;  2N7E A;  3QWZ B;  1L7Y A;  1KC7 A;  4A20 A;  1K5G B;  2UZS A;  4OVV A;  4GPT B;  4Y94 A;  4ANX A;  2G35 A;  2G3Q B;  2J0J A;  3SV1 A;  1YD8 U;  2QHO A;  3ZVV A;  2KMC A;  2L00 B;  4HDQ A;  2E2X A;  1V89 A;  5FI0 A;  3ZNG C;  2IBI B;  1PFJ A;  3F0W A;  2LD9 A;  4G3X B;  3QQ8 B;  3QJZ A;  3DBS A;  3ZIM A;  4MGZ E;  2AWT A;  1FHW A;  1GC7 A;  3VAW A;  4HAZ B;  4W9F A;  1W1H A;  1WGH A;  2JP2 A;  2KJ6 A;  1TXD A;  3ULB A;  2DIK A;  4A6K A;  2DEN B;  4ILJ A;  1TJ6 A;  4BFR A;  4IW0 A;  3UQB A;  5EFX A;  1DDV A;  3ZVR A;  1V5U A;  1NBF C;  4JKC A;  4HAY B;  3KH0 A;  4JLC A;  1UGM A;  3VUW A;  2OOB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...