3WA0A

Crystal structure of merlin complexed with dcaf1/vprbp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
VRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Merlin
publication title Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3wa0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3wa0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wa0A01
3PLUA 1K8RB 1YJ1A 2A5UA 2JPHA 1NTIA 5J2RA 4ICVA 4GPTB 1Q5WB 3CSTA 1TXDA 2O6VB 3MTNB 2YF0A 4DBBA 5J18A 4HAZB 5HE2A 1MK7B 2KTFA 3PGEA 2DX1A 5D3VA 3WA0A 1YX6B 2BWES 2CRFA 2GOWA 4B95A 2BKFA 2KUPA 4IM2A 1ACAA 2MBOA 2LOZA 2I5CA 1KZGA 3T06A 4W9FA 2NPTB 3RZWC 4EOYA 2IBIB 2J0MA 1WFYA 4PYZA 3ZKJC 3L54A 2FCMA 3TFMA 3KUCB 3UF8A 2EKEC 3HHMA 4IFSA 3QWMA 4WJOA 2GMIC 1YIWA 4KZ0A 3NZUA 4FULA 3GZNI 2DYBA 5JZEB 2ZPYA 1WJ4A 2CODA 1QQGA 3N30A 2ROVA 3X0WA 2K2UA 2D9YA 2OOBB 2L05A 3WAPA 2D10A 3KYDD 4HAXB 2KDBA 2FAZA 2LULA 4HDOA 3L10B 2YS1A 1BTNA 4ANVA 2JT4B 2O2VA 4GXBA 4BBNF 2Z59B 1QZEA 4WJPA 3ODWA 3JSVB 4GMVA 3H7PA 4MJSB 2ZNVB 3SV1A 1PFJA 2ZVNA 3P7ZA 1X1GA 4NAWA 3D32A 1Z87A 2R2OA 1QC6A 2LRWA 4EZKA 2DYQA 3UGBB 3KVFB 3ONSA 1C3TA 3QX1A 3PHXB 3OLMD 3R7RA 5D3XA 2KWUB 4HAYB 2LASA 2LYDA 4GU2A 2EC1A 3QIJA 2LGYA 4ANXA 2MA9B 2L0TA 1IYFA 2KC2A 3SD5A 3UQBA 4HB2B 4XC2A 2ELAA 2CQUA 2R09A 5CHFA 5E6NA 3LJUX 3TCAA 4PQ0A 3FM8C 3ULBA 1UD7A 1VD2A 3R7QA 5LOPB 5C5BA 1EVHA 2IYBA 1NTVA 1Y5OA 4LJPB 1GC6A 2NS5A 3CMMB 5JHGA 4MDKE 1WX7A 1WJNA 2JZ3B 4J6IA 1DBHA 3PEGA 2L0FA 3I3TB 5FI0A 2J0KA 3A9JA 5KHOA 4KHOA 2COPA 4KIKA 1WMHB 1YQBA 4ZRIA 3RD2A 5C16A 3A9KA 3GYPA 1ZGUB 2EMTA 5CLLB 2XBBC 3A1QB 1V80A 1Z2MA 1LFDA 3BY4B 2MKRA 5AEKB 2WYQA 4MK0A 3ZTDA 4PS3A 1HBKA 3ZW3A 2KCJA 5L83A 3F0WA 2N7DA 1FGZA 2COFA 2L7RA 2AL6A 4IWPA 1V9JA 2XQNM 1PQSA 2WX1A 4DWFA 3W1YA 1K5GB 3OANA 1H10A 1XT9B 3ZNZB 2DYOA 1UPRA 4NNJB 4DBGA 5DIFB 1N3HA 2LVQA 1K5DB 4EZJA 5AZHA 1P5TA 1EGXA 1Q1OA 2LD9A 1V2YA 3F5RA 1E8ZA 4TKNA 1T0YA 2JVCA 3A8QA 1ST7A 2NBWB 4G50A 4ZYNA 1VCBA 4FHJA 1FHWA 2CAYA 2IZVB 1P9DU 4PS7A 2ASQA 1V5OA 2KTRA 2C60A 1UZXB 1ZSQA 4XX5A 2IFSA 2M1MA 3JVZX 3GOEA 2O6VA 3EHVA 2W9NA 4BFRA 3N3KB 1OY2A 1V5MA 3QHTA 5KQ1A 2NZ8B 2KJRA 1WX8A 1WRDB 2RSGA 1UBIA 1UNRA 4HB0B 3VOQA 1UNPA 3VQIA 4XZ4A 3MJWA 2CU1A 3PP2A 3DVNU 3V6CB 4B6WA 1OGWA 2MWNB 4IWOA 3TMPB 2ZNVC 4EUTA 4EJNA 2KOXA 1E8XA 3ZRFA 2GCLA 5JH5C 1ZC4B 4IWQA 3ENEA 1SGHA 3KUDB 1UEFA 3OJ3A 3DVNV 5J3QA 5FR6A 3APFA 3VH4B 4ANWA 2MLBA 2ELBA 3NZSA 1BT0A 2V76A 1MPHA 2ZVOA 2YT1A 4HAWB 2CB8A 2YLMA 4IOYX 2ZJDA 1UPQA 3PT2B 2YT0A 1E90A 3T8MA 2LVPA 4GSWA 4BKSD 3M3JA 4FJVB 3SDLC 4DX90 4A6KA 3QAQA 2BGFA 2G35A 3VTVA 4P7IA 4MM3A 4JIOU 4A5KA 2NR2A 2BCJA 1MK9B 2IO1B 2LOXA 1XCGA 5DHAB 4I6PA 1U5DA 2C7NB 3QCAA 4TYZA 2KWVB 4N9F4 5DH9B 2KKCA 3TBLD 4MELA 5C23A 4WJQA 2YRYA 3ECIA 5DPTA 3DDCB 3ZVRA 2Z0PA 1OTRB 2QHOA 2MW5A 1DYNA 4W9GA 1UH6A 1ISNA 4XWXA 3DBLI 4FHKA 4IUMB 3M95A 4GGQA 2COAA 5FI1A 5LONB 1P98A 1SIFA 3P2BA 2GCJA 2IYDB 3A98B 1LB1A 2LRUA 2P0FA 4FADA 2FJ9A 3ZNHB 4URKA 3O96A 4ZRKA 3U30A 3NSUA 4D0NB 4IW0A 1XD4A 1ZW7A 2R2QA 1H4RA 3DXDA 3L13A 2REXA 5JHAA 1LM8B 4HPLB 3U7DA 5EDSA 5D2MB 2D9XA 1HE8A 4HK2A 2ZEQA 4A3PA 4BKSA 1WR1A 1NVLA 3DBRI 4MEMA 5AZGA 5JHBA 1R4NI 1E8YA 5TR5A 3PS6A 2MBEA 2H7DA 4GDLA 1FB8A 1WM2A 3ML8A 4K2OA 5C6RA 2QKLA 4MY6A 2K25A 2Y8FA 5AZFA 4F7ZA 2M14A 2V4LA 4HWIB 3A4SC 3VUWA 4MH0E 2D11A 2GBJA 2AWTA 2KD0A 3ZIMA 2V3SA 2MBBB 3DPDA 5GOWB 4LDTD 4II3B 3H1UA 4EMOA 2MP2B 3V5WA 3DBSA 1V49A 3RUIB 2JF5A 4AJYB 2JRIB 1ZKHA 2NVUI 1M7EA 3EC8A 1HB6A 4G11A 2DN6A 1Q0WB 2AYOB 4HAVB 3V60A 1WXAA 4M8MA 1M7RA 3VXWA 4ZRJA 2ROZB 2MRPA 4HB3B 2DLWA 2RR9A 4WVFB 2PEAA 5HE0A 2K6QA 1D3ZA 2MBQA 1TGZB 3SO6A 4KDLB 2VKIA 2FDQA 4YONA 4WSFA 5IA7A 2GBNA 4KSLC 5D3YA 2BYVE 2MSED 3O65B 2JXXA 3DQVA 1XODA 1OQYA 1FHXA 1NU2A 2BKRB 2D9VA 3AJ4A 1AQCA 2J59M 2N9EB 4GIVA 2M17A 2BYEA 3DVGY 4I6NB 1WY8A 2UVMA 3Q3FA 1M94A 2GBMA 2DHZA 2HD5B 2K1FA 1P1AA 2KNBA 4KSKC 1MG8A 2A4ZA 3ZNID 2DHJA 1U2BA 2CR5A 4KAXB 4FLHA 2RNRB 2KDFB 1GJZA 3FP5A 2C7HA 1PLSA 2RGNB 1WE6A 3G9WA 2IY1B 4RM9A 4LCDE 2GS0A 2WDTB 2G3QB 2O6VD 2LI5A 3VTUA 4IM0A 2DKQA 5JHHA 3PSEB 4WJ7A 2DX5B 2UZRA 2KFKB 4PS8A 1YX5B 5DPSA 2MWSB 2ZPNA 3WANA 2RLOA 3UIPB 2CHWA 3KY9A 3UINB 2I1JA 1Z5SB 4FJYA 3L08A 2LGXA 4K17A 2HTHB 1GUAB 4IM3A 2G45B 4IAPA 3V61A 2JRHA 1XKEA 1FGYA 1HB8A 1Y19B 4X57B 4NY0A 1MIXA 4FA6A 5J3YA 4PYUA 3ZNGC 2RQ1A 1NI2A 2KANA 1XX0A 2X18A 2LWPA 3WALA 1ZVRA 4CO7A 5L95C 2KJ6A 2FCNA 2Q13A 2Y7BA 4F7UP 4DDID 3DCGA 1R4MI 3S2AA 2KVRA 2JUOA 4K81A 4ASWC 1Q67A 1L7YA 1U27A 1F9JA 4EZLA 1X1FA 2K6DB 4Y94A 2CS4A 3DXCA 3H9DA 2DHKA 2CHZA 4A6FA 2RVBB 4AJWA 3LDZE 2LGDA 3RT3B 3CXBB 2DYMA 4GZUA 2PJHA 1JRUA 1IP9A 5CX3A 1LXDA 1A5RA 1UGMA 2Z0EB 3N7CA 2W2WA 5J17A 3KZ1A 5EFXA 5E6PA 4DHJB 4W9JA 4MSMB 3PPAA 2JZZA 3DOWA 2UZSA 2VRWB 4WWOA 1YD8U 3AI5A 3HIZA 3B0AA 2DAFA 3SYXA 2MP2A 2NPTA 2AL3A 3PHWB 1WGRA 1J8CA 1GC7A 3MPXA 2YSZA 3M62B 4E3CA 5CHVC 3RULA 3TVVA 3BINA 1RJ2A 4DX8A 3A33B 3QWZB 2O2VB 2C5LC 4HB4B 4LJOB 2LZ6A 2YS5A 2L00B 3HQCA 3AXCA 4DHZB 3H7PB 1KZ7A 2LXAA 4DXAB 2C9WB 1WJ1A 2DHIA 3FSSA 4CHKA 1RRPB 3V62A 4RM8A 4AUQC 4F7GA 4NQKE 4IG7B 3HW2B 2DAJA 1H8CA 3L0WB 1Y8RC 1WIAA 2RSUA 2LVOA 2JP2A 1WJ6A 2KX3A 1WXMA 3AU5A 2UYZB 3QJZA 4BKGA 1XQQA 3IHPC 3JSVA 3QC8B 1AARA 4BOZB 2OTXA 4G0NB 1UBQA 2KWCA 2NBVB 1W1HA 4MJSA 1J0WA 2WX0A 1DDWA 4TV3A 5HE3A 3A4RA 4EFOA 4FN2A 1LW3A 1I2HA 1EF5A 3IVFA 2RD0A 3VUYA 2L76A 2DZIA 1U5FA 4ZDVA 2KZRA 1WGQA 3PVWA 2EJ8A 2LXCA 3ZUNA 2UWQA 1WGDA 1RAXA 3NHEB 3PLVA 1TZ1A 2D3GA 2LUEA 3VVWB 1V5UA 1P6SA 2RPQA 2L2IA 1E7UA 3VDZA 3PVLA 3KYCD 1J19A 2J7QB 3AULA 4NQLB 2FNJB 1U29A 1WZ0A 4IC7B 3A9JB 2D2QA 4JGHB 3TW1A 3VTWA 1UNQA 4KIKB 4WQOB 3TL5A 3DBHI 2N7EA 3WAOA 4MSQB 4W9LA 2N23A 2XK5B 3RZFA 3A9KB 1TJ6A 1SHCA 5DI9B 2Y5BB 3MDBC 1RLFA 2KC1A 4WWPA 2JY6A 5D6JB 1WGUA 3CSFA 3BJIA 1WYWB 4BBKA 4KV2A 1EF1A 3PZDA 1WVHA 1GNUA 5DHFB 2W2XD 4F8CB 2D9ZA 1FAOA 2NMBA 4GDKB 2D4QA 1WMHA 5D27A 2P0HA 1G6JA 2P0DA 3C0RB 4M8NA 4W9CA 3A1QA 3L16A 4TQ0A 3PRPB 3W1SC 1NDDA 2WWZA 2H7EA 3TO1A 1V81A 2V1YA 2QKMA 3D8DA 2MQJA 3NY5A 4HDQA 3SHQA 2DZMA 1XR0B 3UZTA 1V6EA 2JWZA 1B55A 2IY0B 1WXSA 3PVUA 4GN1A 3SNHA 2M0XA 4K1RB 5C79A 4NJ7A 5BO4B 2KTRB 1WI1A 2IO0B 3ML4A 1WXVA 3QQ8B 1KI1B 1P3RA 2ZCBA 2W2XC 1RFAA 4E71A 1U5EA 1CMXB 2KO3A 3PSCA 2KDEB 1TQZA 4HPMB 1SE9A 1FXTB 2DA0A 2LG1A 5CTRC 1E8WA 2BWFA 2N1VA 3W1SA 3ODXA 1EUVB 4E74A 3VUXA 1WH3A 2GBKA 1WGYA 4GOCA 2FIDA 4HAUB 2K2JA 1C1YB 3EFUA 3APCA 3RCPA 5CLQB 3KW5B 1X1MA 2DTCA 4JLCA 5DPWA 2Z0DB 4KHBB 2KXJA 5LLIA 1ZM0A 5KCVA 3LJ3A 4MGYE 5DPRA 2KLCA 4HCPB 4II2B 5G2NA 5KHQA 3PRMB 1V86A 5LXIB 4CHMA 4W9IA 2L1CA 3KUZA 5D7GA 3FLVA 3ZDTA 5D94A 2CY4A 4H8SA 4BKTA 4MGKE 2Z0QA 1MAIA 4B6HA 2BPSA 2BF8B 2AEHA 2NBUA 1W1DA 3KRXA 2NCNA 1XD3B 1MIZB 3SU8X 1OQNA 4C0AA 3RYTA 3FEHA 1WE7A 3ML9A 4CHJA 4ICUA 3UIOB 2N1WA 1S3SG 2FIFA 4AP4C 3ODOA 4W9HA 4BBNC 3OAWA 5G55A 2CHXA 4DDGD 2M4NA 2J0JA 2N0YA 1DROA 3QA8A 5J3TA 2FCSA 2E2XA 2DFKA 3CF6E 5DCNA 3OJ4B 1I42A 2COCA 4MGIE 5LXHA 1ZC3B 1IPGA 3IFWB 4K7WA 1FHOA 2KJHB 4NSWA 1BAKA 2KDIA 4NJ6A 2K8BA 4HLEA 5JP4A 4MGZE 5CHWA 2ZCCA 3VH3B 2GJYA 3WIMA 1RRBA 4YL8A 4EKUA 3D8EA 4KZCA 4W9DA 2ADZA 3B1LX 2FCQA 1LQBA 2HJ8A 2BYFA 2MFQA 4BVUC 4G3XB 3VAWA 2D07B 1U5GA 4KVGB 1KM7A 5HKHA 3A8PA 4F1SA 3MHSD 5JLJB 3ZTCA 1WG7A 5IAAC 3NS8A 1V61A 3K9OB 1AWEA 4HVBA 3PTFC 3VFKA 2DZKA 4HHVA 3PG7A 4ANUA 3U8ZA 2M38A 1PMSA 5D3WA 2XK5A 3B08A 3PREA 4L6EA 1WJUA 3NOBA 2K8HA 5E6OA 1WGHA 3HM3A 3D8FA 4WJNA 1DDVA 1KLVA 3RCZA 2K8CA 3L17A 1TTNA 4GDLB 3DXEA 3JW0X 2HE7A 2KMAA 2I5FA 4PNKA 4I6LB 2N9XA 3KRWA 4GDKA 1V88A 4WWNA 3P6AA 2FUHB 1J0GA 2I1KA 1E5WA 2VSZA 4HCNB 2OQBA 2G4SA 2K39A 2B3AA 3AU4A 1U4AA 4A20A 4HXDA 1EAZA 2DKPA 3PRZA 3X23A 2YS3A 4DHZE 1WF9A 4AOFA 2IO2B 2KX0A 1W1GA 2C7MB 4JL9A 2Z0OA 2KGXB 5L81A 2N9PC 1BTKA 3SUZA 1MKEA 2VRRB 1BWNA 4K2PA 1I35A 3V6EB 1DDMA 1GG3A 4BOSC 4M0WB 2CKHB 2LKOA 2DENB 4FJZA 2P8VA 3T9LA 2EMSA 3DVGX 1P3QU 1V89A 4CYEA 1WM3A 5C1ZA 2MX2A 1WJMA 2MCNB 2L3ZA 2KFJA 1OEYJ 3VIAA 4K7SA 3ZO5B 1KOTA 4MT7A 3H7SA 4NAWB 3EECA 4OVVA 4NPNA 3TJPA 2RUKB 3QARA 4EEWA 2MDXA 4TUUA 1X05A 2KK8A 4Z2NA 2L8JA 3QBVB 3M63B 5HE1A 4B9KA 2DZJA 3HM6X 5KQ4A 4A6HA 1OMWA 3APDA 2R0DA 2KLGA 4RMAA 3HK0A 2N4FA 3ALBA 1V5TA 2KN5A 1E7VA 4HJKA 4HATB 4AWJA 4LDTB 3H6NA 2ZZPB 2K00A 3ZRCA 1WGGA 4Z2MB 2IO3B 4DK5A 1I7AA 1WI0A 2RGFA 5GMVA 3KSYA 2PPHA 2DYNA 1NTYA 1TBEA 4W9EA 3IBEA 2YVCA 1FOEA 4KHAA 2LJ5A 1WZ3A 2Y8GA 4W9KA 5C5BB 3WAMA 2KHWB 1IRSA 3TIXA 4K7UA 3N32A 3ZLZA 3M1IB 5IJMA 2GBRA 2KQ7A 1S1QB 2HRJA 3GYOA 2OJRA 4KDIC 3UQAA 2PE6B 2D9WA 2XEWA 4GB9A 1WR6E 3EPYA 2G4DB 1EO6A 3CIKA 1WX9A 1X86A 1P0RA 3IG3A 2M8SA 2KQSA 3R3MA 4GMXB 1L2NA 2CY5A 3PV1A 3Q3JA 1X11A 4FBJB 4WAAA 2DX5A 2WH5A 2KFKA 3KH0A 1UELA 3ZVVA 3JYUA 4DHJD 2PZ1A 3ULCA 1OEYA 2FJLA 3QK0A 3VHTC 1NBFC 3WYFB 1V5PA 3K9PB 1KJTA 2KMCA 2ABDA 4F7HA 4A3OA 2HTHA 2LBBA 3ZDMC 4TQ1A 3R66C 2MBHA 4JQWC 2PE9A 4OVUA 4A6FB
chains in the Genus database with same CATH superfamily
3PLUA 1N6ZA 1K8RB 1F0ZA 4C00A 1YJ1A 3AE9B 2A5UA 2JPHA 1NTIA 1TZOA 2HJ1A 4JE3B 3UI3A 3BVGA 5J2RA 4ICVA 4GPTB 1Q5WB 3ZJTA 3CSTA 1TXDA 4LNNA 2O6VB 3MTNB 2YF0A 4DBBA 5J18A 4HAZB 5HE2A 1MK7B 2JQRB 2KTFA 3PGEA 2DX1A 5D3VA 5IO9A 3WA0A 1YX6B 4A8XC 5BYSA 2BS2B 2BWES 2RDHA 2CRFA 2GOWA 4ZYSA 4B95A 2BKFA 2KUPA 2OJWA 4IM2A 1ACAA 1KF6B 2MBOA 4QJ5B 2LOZA 2I5CA 4MACA 1KZGA 3T06A 4W9FA 2NPTB 3RZWC 4EOYA 2IBIB 1MVKA 1TY0A 1DOYA 3EGRA 2J0MA 1WFYA 4PYZA 3ZKJC 4XWWA 3L54A 2YEPF 4HROA 4JKEA 2FCMA 3GB1A 5JVLA 1CZPA 5TSSA 3TFMA 1ZDXA 4JKGB 3KUCB 2FUG1 3UF8A 2EKEC 3HHMA 4IFSA 1NVID 3QWMA 4WJOA 2GMIC 1YIWA 4KZ0A 3NZUA 3DBLB 4FULA 1RFKA 3FILA 4WH4A 3GZNI 2DYBA 3AE5B 5JZEB 2ZPYA 1WJ4A 2CODA 1QQGA 3N30A 2ROVA 4USAA 3X0WA 2K2UA 2D9YA 2OOBB 2L05A 3WAPA 2D10A 3KYDD 4HAXB 2KDBA 4HJGE 2FAZA 1XLPA 2LULA 4HDOA 2QJLA 3L10B 2YS1A 1BTNA 3U52E 4ANVA 3DCXA 1YQ3B 1B1ZA 2BTEA 2JT4B 2O2VA 4GXBA 3Q3NC 4BBNF 2Z59B 1IUEA 1QZEA 4WJPA 3ODWA 2ZW0A 3JSVB 4D2KA 2WHIA 2L32A 4C4VB 1TYGB 4GMVA 1Y56A 1QOGA 2D3BA 3RI7C 1SF0A 3H7PA 1ACCA 4MJSB 2ZNVB 3SV1A 1PFJA 2ZVNA 1SJHD 2YT2A 3P7ZA 1X1GA 4NAWA 3D32A 2NMQA 1Z87A 4ZOHC 1CJEA 3Q8EA 2R2OA 1QC6A 2LRWA 3AV8A 4EZKA 2DYQA 1YN4A 3DBRB 3UGBB 3O13A 2R2YA 3KVFB 3ONSA 4JX1C 1C3TA 2K5PA 3IT4B 1VBHA 4ILJA 3QX1A 3PHXB 3OLMD 3R7RA 3EFCA 5D3XA 2V4IB 2KWUB 1FO4A 4OT1A 5HI1A 4HAYB 1KLGD 2LASA 2LYDA 1OQQA 1SXTA 4GU2A 2EC1A 3QIJA 2E3TA 2LGYA 2VH2A 2MA9B 4ANXA 2NBVA 2L0TA 1IYFA 2KC2A 3SD5A 3UQBA 4HB2B 5T8IA 1FEHA 4XC2A 2ELAA 3PZ8A 2CQUA 2R09A 4ARIA 3AE4B 5CHFA 2AQ3B 1SSNA 5E6NA 3DHHC 4OZCA 4M01A 3LJUX 3TCAA 4PQ0A 3FM8C 3ULBA 1XCQL 1I4GA 1UD7A 1VD2A 3R7QA 1L0XB 3AM9A 5LOPB 1JWUD 5C5BA 1EVHA 3P4SB 2IYBA 4RH6A 1FCCC 1WGKA 3IT6B 1NTVA 2BT6A 1Y5OA 4LJPB 1GC6A 2INDC 2NS5A 3CMMB 4HEA1 5JHGA 4MDKE 1VDVA 3U7ZA 4OHJA 1WX7A 4C80A 4YT0B 1WJNA 2JZ3B 5JXVA 4J6IA 1DBHA 5HG2A 2KAJA 4HKQA 3PEGA 2L0FA 4YXDB 1FRDA 3I3TB 5FI0A 2J0KA 4YTMB 3A9JA 5KHOA 3P63A 4KHOA 3IAS1 2COPA 4KIKA 1WMHB 1YQBA 4ZRIA 3RD2A 5C16A 3A9KA 1GGOA 3GYPA 1XXGA 1FM0D 1ZGUB 2EMTA 5CLLB 3U4EG 2XBBC 3A1QB 2JYTA 1V80A 1HA5A 1LFDA 1Z2MA 2MKRA 2WXIA 3BY4B 5AEKB 2WYQA 4MK0A 3ZTDA 1EWYC 4PS3A 5C2TB 1HBKA 3ZW3A 2KCJA 4KKJA 5L83A 2JZPA 3F0WA 2N7DA 1FGZA 2COFA 2D5GA 2L7RA 2CJNA 2AL6A 4IWPA 1OFFA 1JRPA 1V9JA 2XQNM 1PQSA 2WX1A 1GOZA 4DWFA 3W1YA 2JSVX 1K5GB 3OANA 1H10A 1XT9B 3ZNZB 2DYOA 1N60A 1UPRA 1FFUA 4NNJB 4ILGB 4DBGA 2QDFA 5DIFB 2SAKA 1N3HA 2LVQA 1I4HA 1K5DB 1MG4A 2L83A 1PGAA 2EKIA 4LNOA 4EZJA 1VRAB 5AZHA 1P5TA 2ACZB 1EGXA 1Q1OA 2LD9A 1V2YA 4JKBA 3F5RA 1E8ZA 1I7HA 4TKNA 1T0YA 2JVCA 3Q8BA 1IGCA 3A8QA 3TEZA 1ST7A 3Q8AA 4P1CC 2NBWB 4FHJA 1VCBA 4G50A 4ZYNA 1FHWA 1ZUD2 2CAYA 4HKZE 2W3RA 2IZVB 1P9DU 4PS7A 2ASQA 1V5OA 4LNKA 2KTRA 2C60A 3I5JC 1UZXB 1ZSQA 4XX5A 3B77A 2IFSA 1SEBD 2M1MA 3JVZX 3GOEA 2DIKA 3EUB2 3AEFB 3BK2A 2O6VA 3EHVA 5I4DA 4N6EB 2W9NA 2WLBA 4BFRA 3N3KB 1OY2A 1V5MA 3QHTA 4HSIA 4JKDA 5KQ1A 2NZ8B 2KJRA 2VZKD 1DGJA 5BYRA 1WX8A 1EM7A 3E56A 3TSSA 3RNCC 1WRDB 4RNAA 3SFEB 2RSGA 2ZW1A 1UBIA 2Z4DA 3I57A 3E66A 3MC8A 1JALA 1UNRA 4HB0B 3VOQA 1L6VA 1UNPA 3VQIA 3E9PA 1FPYA 4KGTA 4XZ4A 3MJWA 2CU1A 3PP2A 3DVNU 3V6CB 3W2DA 1YJIA 3KWVA 1I4PA 4B6WA 2WP9B 1OGWA 2MWNB 4D6WA 4IWOA 3TMPB 2ZNVC 4EUTA 4EJNA 4XDCA 3VRBB 2KOXA 1E8XA 2M56B 2RDBC 3ZRFA 3KLSX 2GCLA 3MP9A 5JH5C 4JWSC 1ZC4B 4IWQA 3ENEA 1SGHA 2WXGA 3KUDB 1UEFA 1E0ZA 3OJ3A 4P1BC 3DVNV 3NVZA 5J3QA 4OZBA 1YNTE 5FR6A 3APFA 2YEPB 3VH4B 4ANWA 4ILHA 4QAYA 4JKFA 2MLBA 3R8BA 3TUOA 2ELBA 3NZSA 1BMLC 1BT0A 2V76A 1MPHA 2ZVOA 4A6QA 2YT1A 4HAWB 3SEBA 2CB8A 1N63A 2YLMA 4IOYX 2ZJDA 1UPQA 3PT2B 2V9HA 2YT0A 3DHGC 1E90A 3T8MA 5IRSA 2LVPA 2JU6X 5LG4B 4GSWA 4BKSD 3M3JA 1C77A 4FJVB 3SDLC 4DX90 2LHDA 2Y5CA 4A6KA 3QAQA 2BGFA 2G35A 4XGAB 3RNBC 3VTVA 2BW2A 1R4MB 4P7IA 4MM3A 4JIOU 4A5KA 2NR2A 1FNVA 2BCJA 1L4DB 1MK9B 2IO1B 2LOXA 1XCGA 5DHAB 4I6PA 1C76A 1U5DA 2C7NB 3QCAA 1NENB 4TYZA 1JWMD 2MJDA 2KWVB 4N9F4 5DH9B 2KKCA 3TBLD 5IP4D 4RGTA 4MELA 5C23A 5H92C 4WJQA 2NTTA 2BYTA 2YRYA 3ECIA 1NI3A 5DPTA 2HDEA 3DDCB 3ZVRA 2Z0PA 1OTRB 2QHOA 3BYTB 2DLBA 4OVZA 2MW5A 1DYNA 4W9GA 1EU3A 1UH6A 1ISNA 4XWXA 2IJ0A 3DBLI 4FHKA 1CK1A 4IUMB 3M95A 1ZOYB 4GGQA 2COAA 5FI1A 5LONB 1F2RI 1JROA 1P98A 1SIFA 3P2BA 5G5GA 3N1ZC 2GCJA 2DNFA 3TEWA 2IYDB 3A98B 1LB1A 2KDMA 1ZXIA 2LRUA 4JPSA 2P0FA 2WDRB 4FADA 2FJ9A 3ZNHB 2ON8A 2PVGC 4URKA 3O96A 4ZRKA 3U30A 5H8YE 3HRDD 3NSUA 5HHDG 4D0NB 3NW8A 1N62A 1C78A 4IW0A 1XD4A 1WSPA 1ZW7A 2R2QA 1H4RA 1JCKB 4HPPA 3DXDA 3L13A 2REXA 5JHAA 1LM8B 4HPLB 1P7EA 3U7DA 5EDSA 3GE8C 5D2MB 2D9XA 1GAQB 1JMLA 1HE8A 4AQ7A 4HK2A 2ZEQA 3T3OA 4A3PA 4BKSA 1TS2A 1Q10A 1NVLA 1WR1A 2WXRA 3DBRI 4MEMA 3J9CA 3C8YA 1ZYIA 5AZGA 5JHBA 1R4NI 1E8YA 1PDXA 5TR5A 1AWDA 3PS6A 2MBEA 2H7DA 3AE3B 4GDLA 1FB8A 1WM2A 2IGGA 3ML8A 4K2OA 5C6RA 2QKLA 5EE9A 4N58A 3P4QB 2QMTA 2KMMA 1V8CA 4MY6A 2K25A 2Y8FA 5AZFA 1UWXA 4F7ZA 1T77A 3NVWA 2M14A 3Q8CA 2V4LA 2GUMA 4HWIB 3A4SC 3VUWA 4MH0E 2D11A 2GBJA 2AWTA 3AEDB 2KD0A 3ZIMA 2V3SA 2MBBB 3DPDA 5GOWB 4LDTD 1UUPA 2CJOA 4II3B 4WQMA 3H1UA 3B2FA 3P4RB 4EMOA 1K52A 1SBBB 4PK1A 2MP2B 3V5WA 3DBSA 3AE8B 1L5PA 4DQOC 4MH8A 1V49A 1C9FA 1I4QA 4ZRPA 4GNKB 3RUIB 1VJKA 1GB1A 2M19A 2JF5A 1TKGA 2WXHA 4AJYB 2JRIB 2AQ2B 1STEA 1ZKHA 1MHHE 2NVUI 1TKYA 3U2SC 2Y3AA 4R3DA 1M7EA 2WXJA 2J42A 1RM6C 3EC8A 1HB6A 3N9YC 4G11A 2DN6A 1Q0WB 2AYOB 4HAVB 1IBXB 3V60A 2N0SB 1WXAA 2WXNA 4M8MA 3DBHB 1M7RA 4WAFA 3W9CB 1WXQA 3VXWA 4ZRJA 4M0WA 3LYYA 3Q6BA 2ROZB 1FIQA 2MRPA 4HB3B 2LGIA 2MHJA 1WYGA 2DLWA 2RR9A 2WDVB 4WVFB 2PEAA 3ZQ4A 1P7FA 5HE0A 2K6QA 3I63C 3BZDB 1D3ZA 2MBQA 4Q2JA 1TGZB 3SO6A 1ET6A 4KDLB 3H8HA 2VKIA 3DWMA 2KACA 2K22A 2FDQA 4YONA 1CQVA 2WXKA 4O1NA 4WSFA 5IA7A 2GBNA 3AEEB 4KSLC 3AE7B 5D3YA 5BMGA 4P16A 2BYVE 2MSED 2JX5A 1JDEA 4UDUC 3O65B 1I4RA 1N5XA 4C56C 1NEKB 2JXXA 3DQVA 1XODA 1QOAA 1OQYA 1FHXA 1NU2A 2WS3B 2BKRB 2K49A 1RWSA 1R4NB 2W82A 1J7CA 2D9VA 1TJEA 3AJ4A 1XLNA 1DOXA 1AQCA 2J59M 2WU2B 2N9EB 4GIVA 1YN5A 2M17A 2BYEA 3DVGY 4I6NB 1WY8A 2UVMA 3Q3FA 5AUIA 1M94A 5BYQA 2GBMA 3RNGC 2DHZA 2HD5B 2K1FA 1P1AA 4QXAB 2DBYA 2KNBA 2RMMA 3ETRA 1VLBA 4KSKC 1MG8A 2A4ZA 3PZ7A 3ZNID 2DHJA 1U2BA 2CR5A 4KAXB 4JKHA 4FLHA 2RNRB 2KDFB 1GJZA 1OQRA 3FP5A 2C7HA 1PLSA 2K8EA 2RGNB 1WE6A 3N1YC 3G9WA 3NWAA 2IY1B 4RM9A 4LCDE 2GS0A 1MJDA 2WDTB 4KX6B 2G3QB 4ZRQA 2O6VD 2LI5A 3VTUA 3T3NA 3AEAB 4IM0A 2DKQA 5JHHA 2JWUA 2LJIA 3PSEB 1AN8A 2SEBD 4WJ7A 2DX5B 2UZRA 1HTOA 2KFKB 4PS8A 2R82A 3RNFC 2WXMA 2FJUB 1YX5B 2PLPA 3GE3C 5DPSA 2MWSB 2ZPNA 3WANA 2RLOA 1UWMA 4N59A 2AX5A 3UIPB 2CHWA 1BUIC 3KY9A 5FK9C 1KRHA 5E6JA 3UINB 2I1JA 1R7SA 1Z5SB 4FJYA 1T0QC 1SJED 2G1EA 2WGSA 1N5WA 3R2IA 3L08A 2LGXA 5FKAC 4K17A 2HTHB 1GUAB 4IM3A 2G45B 2GB1A 3AH7A 2ICIA 2L1AA 4IAPA 1E6EB 3DWGC 1SE4A 3V61A 2JRHA 1ZDVA 1XKEA 1FGYA 3P42A 4RF1A 1HB8A 1TKEA 3AE2B 1Y19B 4CSQA 4X57B 4NY0A 1MIXA 4FA6A 2IDYA 5J3YA 4PYUA 3ZNGC 1DOIA 3VR9B 2RQ1A 1L6UA 1NI2A 2KANA 2QC8A 1XX0A 2X18A 2LWPA 3WALA 1ZVRA 1KH0A 4CO7A 5L95C 4IKGA 3ZGZA 2KJ6A 2FCNA 2Q13A 4M00A 2Y7BA 4F7UP 1JWAD 4DDID 3DCGA 1R4MI 3S2AA 1YOVB 4S0RA 2KVRA 2JUOA 4K81A 4ASWC 3P1MA 1Q67A 1VZ7A 1L7YA 1HTQA 1U27A 3NUHB 1F9JA 4EZLA 1X1FA 2K6DB 4Y94A 2CS4A 2LGSA 2GI9A 3DXCA 3H9DA 2DHKA 2J52A 4A6FA 2CHZA 2RVBB 4AJWA 3FVCA 3LDZE 2LGDA 3RT3B 3CXBB 4LNFA 1L0YB 2DYMA 3FAHA 4GZUA 2LHEA 2PJHA 1JRUA 1IP9A 1B9RA 5CX3A 1LXDA 4XE0A 1A5RA 1C4CA 3HSAA 5FR3A 5EE1A 4K3BA 1UGMA 2Z0EB 1F2RC 3N7CA 1PGXA 2W2WA 4H2AA 4OVUA 5J17A 3KZ1A 5EFXA 2WQYB 4YTNB 1E10A 5E6PA 4DHJB 4W9JA 4MSMB 3PPAA 3LXFA 2JZZA 3DOWA 2ONQA 2UZSA 2VRWB 2CU3A 3FILB 4WWOA 1YD8U 3AI5A 2Q5WD 1C4PA 2DWQA 3HIZA 3B0AA 4IOIE 2TSSA 1V1PB 1YMHE 2DAFA 3SYXA 2MP2A 2W54A 2NPTA 2AL3A 3PHWB 1WGRA 1J8CA 1YQ4B 1GC7A 3OG5A 3MPXA 3EA6A 2YSZA 3M62B 1L0VB 4E3CA 5CHVC 3RULA 3SBTA 3TVVA 3BINA 1RJ2A 4DX8A 3A33B 3QWZB 2O2VB 2C5LC 4WURA 4JKGA 4HB4B 4P6VF 4L23A 4LJOB 2X0SA 2LZ6A 2YS5A 2L00B 1SE3A 3HQCA 5I2MA 1VBGA 3AXCA 3KQ4A 4DHZB 3H7PB 4XWTA 3E9OA 1KZ7A 2LXAA 4DXAB 2C9WB 1WJ1A 2DHIA 3Q3OC 3LB8C 2H88B 3FSSA 4CHKA 1RRPB 1QOFA 1FD6A 3V62A 3R2TA 4RM8A 4AUQC 1VR9A 2GLSA 3ZXRA 3GP7A 4F7GA 4NQKE 4C7YA 4IG7B 3HW2B 2KUQA 2Z8LA 2DAJA 1V97A 4JWUC 1H8CA 3MC9A 3L0WB 1Y8RC 1WIAA 2RSUA 2LVOA 4NZLB 2JP2A 1WJ6A 2KX3A 1JWBD 1TIFA 1WXMA 4DXGA 3AU5A 5MPOA 1ET9A 2UYZB 4US9A 1T0RC 4NJCA 3QJZA 4BKGA 2Z59A 1PGBA 1XQQA 4JK7A 3IHPC 3JSVA 3QC8B 4C4VA 1AARA 4BOZB 1SB3C 1C4AA 1XO3A 2OTXA 4G0NB 1UBQA 2KWCA 2NBVB 1W1HA 4MJSA 1J0WA 3RN9C 2WX0A 1DDWA 3V05A 4TV3A 4QJ4B 5HE3A 1EU4A 2QSDA 3A4RA 4EFOA 2I38A 4FN2A 4CQNA 1D5MC 2PW9A 1LW3A 4YTPB 1I2HA 1EF5A 3SR6A 3IVFA 1FXAA 2RD0A 3VUYA 2L76A 2DZIA 1U5FA 3AEBB 1LGRA 4ZDVA 2KZRA 1WGQA 3PVWA 2EJ8A 2WDQB 3CWIA 2D3AA 3ABVB 4OZAA 2LXCA 3ZUNA 2UWQA 1WGDA 1RAXA 3NHEB 3PLVA 4JKAA 1HZ5A 1TZ1A 4RGNA 1QOBA 2D3GA 4RCOA 2LUEA 1FCLA 4TSSA 3VVWB 2D3CA 1V5UA 1P6SA 2RPQA 1QLBB 1D5XC 2L2IA 1E7UA 2INCC 4S17A 3PVLA 3VDZA 3KYCD 2KQ4X 1J19A 1DIKA 2J7QB 1T3QA 3AULA 4NQLB 2FNJB 4GLSC 1U29A 2WNMA 1WZ0A 4IC7B 3A9JB 2D2QA 4JGHB 1JW9D 3TW1A 3VTWA 1UNQA 4KIKB 4WQOB 3TL5A 3DBHI 3AB5A 2N7EA 3WAOA 4MSQB 4W9LA 2N23A 2XK5B 3RZFA 4A9AA 2QILA 3A9KB 3MFGA 3HVDA 1TJ6A 1SHCA 5DI9B 2Y5BB 3MDBC 1RLFA 2KC1A 4WWPA 2JY6A 1J7AA 2KVZA 3NG0A 5D6JB 1WGUA 3B9JA 3CSFA 3BJIA 1WYWB 3AECB 3NWFA 4BBKA 4KV2A 5I2SA 1EF1A 3PZDA 3Q2AC 3TEXA 1WVHA 1GNUA 2BS4B 5DHFB 2W2XD 3C19A 2PIAA 2W55A 4F8CB 2D9ZA 1FAOA 2NMBA 4GDKB 2JXTA 2D4QA 2BB5A 1WMHA 5D27A 2PKOA 2P0HA 1G6JA 2P0DA 3C0RB 4M8NA 4YSYB 4W9CA 3A1QA 4RFBA 3RMKC 3L16A 4TQ0A 3PRPB 3W1SC 1NDDA 4JK8A 2WWZA 2H7EA 3TO1A 1ENFA 1V81A 3I9V1 2V1YA 3BK1A 2QKMA 3D8DA 1F1HA 2MQJA 2LFIA 3NY5A 4HDQA 4BAXA 3SHQA 2DZMA 3KWLA 1XR0B 3UZTA 4JK9A 1V6EA 2JWZA 1B55A 2IY0B 1WXSA 3PVUA 1M4VA 4GN1A 1E9MA 3IAM1 3SNHA 1UF0A 2M0XA 4K1RB 2X38A 1PFDA 5C79A 4NJ7A 3A58A 1VZ6A 5BO4B 2KTRB 1VZ8A 1WI1A 2IPKD 2IO0B 3ML4A 2W3SA 1WXVA 3QQ8B 1KI1B 1P3RA 2ZCBA 2W2XC 1RFAA 4M02A 4E71A 1U5EA 4QJ3B 4RF0A 1CMXB 2KO3A 3PSCA 2FBWB 2KDEB 1TQZA 4HPMB 1SE9A 1FXTB 2DA0A 1YN3A 2LG1A 3Q14C 5CTRC 1E8WA 2BWFA 2N1VA 3W1SA 3ODXA 4LK0M 1PUTA 1EUVB 4E74A 1HXYD 3VUXA 2GBKA 1WH3A 1WGYA 1HZ6A 2FIDA 4GOCA 4HAUB 2K2JA 1C1YB 3RNAC 4RGMA 2JYEA 3EFUA 3ZJUA 3APCA 3W5VB 3RCPA 5CLQB 2EELA 1TS4A 1ZP0B 3KW5B 2Z14A 1X1MA 2DTCA 4JLCA 5DPWA 2Z0DB 3CIRB 1C79A 4KHBB 2KXJA 3RPFC 3B2GA 5LLIA 1ZM0A 3OWEB 1F52A 3WCQA 5KCVA 3LJ3A 4MGYE 5DPRA 2KLCA 4HCPB 3TEYA 4II2B 1DYQA 2PVOD 4YSXB 4WIPA 5G2NA 2Z13A 5KHQA 4REZA 4ZHOA 1ZXHA 2X8XX 3PRMB 4A90A 1V86A 2RRFA 5LXIB 4CHMA 4W9IA 2L1CA 1WRIA 3KUZA 5D7GA 3FLVA 3ZDTA 5D94A 4LNIA 4XDDA 3ZYYX 2CY4A 4H8SA 3BYYB 4BKTA 4MGKE 1MI0A 1V1PA 2Z0QA 1MAIA 2MH7A 5GXGB 4B6HA 2BPSA 2BF8B 2AEHA 4US8A 2NBUA 1W1DA 1FNUA 2XN9C 3NVVA 3KRXA 2NCNA 1XD3B 3HIEA 1MIZB 4MT5A 4A55A 3SU8X 1LO5D 3ZXVA 1OQNA 4C0AA 3BVMA 3RYTA 3FKYA 3FEHA 1WE7A 3ML9A 4CHJA 4ICUA 3UIOB 2N1WA 1QILA 1S3SG 2FIFA 4AP4C 3ODOA 4W9HA 4BBNC 3OAWA 5G55A 2CHXA 4DDGD 2M4NA 3Q3MC 2J0JA 2N0YA 1DROA 5J3TA 3QA8A 4LTUA 2FCSA 3ZJVA 2E2XA 1FXIA 3AEGB 1KFYB 2LMCA 1T6BX 4MM3B 1AW7A 2DFKA 2V0GA 3CF6E 5DCNA 3OJ4B 3PO0A 5BMIA 1F77A 1I42A 2COCA 3GS2A 4MGIE 4HRSA 3E9LA 1ZC3B 1IPGA 5EE0A 5LXHA 3IFWB 3AN1A 4K7WA 1FHOA 4J3OD 2MJEA 4DXFA 1MHXA 1KC7A 1WWTA 2VZKB 2KJHB 4NSWA 1BAKA 3Q8FA 4BZAA 2KDIA 4NJ6A 2K8BA 5IN7A 4HLEA 5JP4A 4MGZE 5CHWA 1MFWA 2ZCCA 1TS5A 3VH3B 2GJYA 4OSNA 3WIMA 1RRBA 4YL8A 4EKUA 3D8EA 2QCZA 4KZCA 4W9DA 4WWMA 2ADZA 3B1LX 2FCQA 1LQBA 1XCTL 1IGDA 3SFDB 2HJ8A 3DHIC 4K3CA 2BYFA 3RFZB 2OHFA 2MFQA 5EE3A 4BVUC 3L4PA 4G3XB 3VAWA 2D07B 1U5GA 4KVGB 1AYFA 1D4BA 1I4XA 1KM7A 4FXCA 5HKHA 3A8PA 1TT5B 3V3XA 4F1SA 3MHSD 5JLJB 2V3PA 3ZTCA 1WG7A 5IAAC 3NJTA 3NS8A 1V61A 2MJ3A 3FC4A 3K9OB 4B0EA 1AWEA 4HVBA 3PTFC 3VFKA 5LNK1 3N20C 2DZKA 1NYRA 4HHVA 3PG7A 4ANUA 3U8ZA 2M38A 2AQ1B 3GZNB 1PMSA 5D3WA 4L2YA 2XK5A 1SIJA 3VRAB 3B08A 2PTLA 1MI1A 2XNAC 3PREA 4AS1A 4L6EA 1WJUA 3N1XC 3NOBA 4ITKA 2K0PA 2K8HA 5E6OA 1WGHA 3HM3A 3D8FA 4WJNA 4DIXA 1N61A 3Q69A 1DDVA 4ACFA 1KLVA 3RCZA 2KIEA 2K8CA 2WXPA 3L17A 1TTNA 4GDLB 3URYA 3DXEA 3JW0X 1E7PB 2HE7A 2KMAA 2I5FA 4PNKA 3AMZA 4I6LB 1KTKA 2N9XA 3KRWA 4GDKA 1V88A 2IGHA 1A70A 4WWNA 2KYWA 3P6AA 2FUHB 2NTSA 2OEDA 1XF5L 1D6EC 3NWDA 1J0GA 2H89B 4YSZB 2I1KA 1E5WA 2VSZA 2N9KA 2OQBA 4HCNB 2M0AA 2ZKMX 2G4SA 2I2YA 2K39A 2B3AA 2FE8A 4LLGM 3AU4A 1NYQA 1U4AA 3NZ3A 2B76B 4A20A 4HXDA 1EAZA 2DKPA 2RPVA 1HQRD 3PRZA 3X23A 2YS3A 4DHZE 1WF9A 2Y5PA 4AOFA 1TS3A 1L4ZB 2IO2B 2J4XA 2KX0A 3ENBA 1W1GA 3RNEC 4RGOS 2C7MB 4JL9A 2Z0OA 2IGDA 2KGXB 2HTME 1XLQA 1K51A 5L81A 1HEZE 2N9PC 4TMAB 1SE2A 1BTKA 1BXTA 1YJJA 1ZE3D 3SUZA 4YWGG 5IOIA 1MKEA 4IDIA 2VRRB 1BWNA 4K2PA 1I35A 2L52A 3V6EB 2K9XA 5D3IB 5D3DA 2WXFA 1DDMA 1GG3A 4BOSC 1GPXA 2WXLA 1MPEA 4M0WB 1QF6A 2R61A 2CKHB 2LKOA 2DENB 4FJZA 2P8VA 3T9LA 2EMSA 3DVGX 3E9SA 2KWDA 1P3QU 2G9HD 1QT9A 1V89A 4CYEA 1WM3A 2LEKA 5C1ZA 2MX2A 1WJMA 2MCNB 2L3ZA 2KFJA 4KHBA 1OEYJ 2BBCA 3VIAA 3IXSA 1IBXA 2BS3B 4K7SA 3ZO5B 1TY2A 1KOTA 4MT7A 3MHZA 3H7SA 4NAWB 3EECA 4OVVA 3VR8B 4NPNA 1V1OA 3TJPA 5IKCM 2RUKB 1JWSD 3QARA 4EEWA 4NAMA 1JQ4A 2QIEB 5BMHA 3MJ5A 2MDXA 1K50A 4TUUA 2BQQA 1X05A 3HUIA 2KK8A 5HFYA 4Z2NA 2L8JA 4GOUA 1T5XD 3QBVB 3M63B 5HE1A 4B9KA 2KR0A 2DZJA 3MC0B 3HM6X 5KQ4A 4A6HA 1OMWA 3APDA 2R0DA 2KLGA 4RMAA 3HK0A 1FRRA 2N4FA 1RYJA 3ALBA 1V5TA 2KN5A 1ESFA 1E7VA 4HJKA 3SBGA 1FFVA 4HATB 4AWJA 2WXOA 4LDTB 3H6NA 2WU5B 2K00A 2ZZPB 3ZRCA 3AE1B 1WGGA 4Z2MB 2IO3B 4DK5A 4C7ZA 2KN4A 2K3UA 1I7AA 3U12A 1WI0A 2RGFA 5GMVA 4KGRA 3KSYA 2GRIA 2J53A 2PPHA 4XYCA 1XEEA 2DYNA 3BWUD 3HVZA 1NTYA 1TBEA 4W9EA 3IBEA 2VH1A 2YVCA 1FOEA 3NRZA 4JKCA 4L1BA 4KHAA 2LJ5A 1WZ3A 2Y8GA 2QEJC 5AUKA 4PT5A 4W9KA 5C5BB 1UGJA 3WAMA 2KHWB 1IRSA 1FNWA 3TIXA 4K7UA 3N32A 3W5UB 1PYWD 3ZLZA 3M1IB 5IJMA 2GBRA 2LUMA 2KIGA 2KQ7A 2KT7A 5M4YB 1KBLA 2N7JA 1S1QB 2HRJA 2V3NA 3GYOA 4KGSA 2OJRA 4KDIC 1J7BA 3UQAA 2PE6B 2D9WA 1UNSA 2XEWA 4GB9A 1WR6E 1QQRA 3EPYA 2G4DB 1EO6A 3CIKA 2N9LA 1WX9A 4KKIA 1X86A 1P0RA 1ROEA 2BVCA 3IG3A 2M8SA 2KQSA 3R3MA 4GMXB 1L2NA 1ZPSA 2CY5A 1K53A 3PV1A 3Q3JA 2INPE 1X11A 3BIID 4FBJB 5G5HA 1FMAD 4WAAA 2DX5A 2WH5A 2KFKA 2RDGA 1UELA 3KH0A 3ZVVA 3BVZA 3JYUA 4DHJD 1GB4A 2PZ1A 3ULCA 1OEYA 3NVYA 4B0MA 2FJLA 2UU7A 3QK0A 3VHTC 2INNE 1NBFC 3WYFB 2BB6A 1V5PA 3K9PB 1KJTA 2KMCA 2E6XA 4ZHPA 3NS1A 5C3JB 4OW0A 2ABDA 4F7HA 3OHMB 2PMVA 4A3OA 2MEKA 2HTHA 2LBBA 1D5ZC 4ARCA 1KLUD 1EWCA 3ZDMC 4L1RA 1T0SC 1QKZA 4TQ1A 3R66C 2MBHA 4JQWC 2WXQA 4EE2A 2PE9A 3P4PB 3AE6B 1XLOA 4A6FB
chains in the Genus database with same CATH topology
3PLUA 1K8RB 1YJ1A 2A5UA 2JPHA 1NTIA 5J2RA 4ICVA 4GPTB 1Q5WB 3CSTA 1TXDA 2O6VB 3MTNB 2YF0A 4DBBA 5J18A 4HAZB 5HE2A 1MK7B 2KTFA 3PGEA 2DX1A 5D3VA 3WA0A 1YX6B 2BWES 2CRFA 2GOWA 4B95A 2BKFA 2KUPA 4IM2A 1ACAA 2MBOA 2LOZA 2I5CA 1KZGA 3T06A 4W9FA 2NPTB 3RZWC 4EOYA 2IBIB 2J0MA 1WFYA 4PYZA 3ZKJC 3L54A 4JKEA 2FCMA 5JVLA 3TFMA 4JKGB 3KUCB 3UF8A 2EKEC 3HHMA 4IFSA 3QWMA 4WJOA 2GMIC 1YIWA 4KZ0A 3NZUA 4FULA 3GZNI 2DYBA 5JZEB 2ZPYA 1WJ4A 2CODA 1QQGA 3N30A 2ROVA 3X0WA 2K2UA 2D9YA 2OOBB 2L05A 3WAPA 2D10A 3KYDD 4HAXB 2KDBA 2FAZA 2LULA 4HDOA 3L10B 2YS1A 1BTNA 4ANVA 2JT4B 2O2VA 4GXBA 4BBNF 2Z59B 1QZEA 4WJPA 3ODWA 3JSVB 4GMVA 3H7PA 4MJSB 2ZNVB 3SV1A 1PFJA 2ZVNA 3P7ZA 1X1GA 4NAWA 3D32A 1Z87A 2R2OA 1QC6A 2LRWA 4EZKA 2DYQA 3UGBB 3KVFB 3ONSA 1C3TA 1VBHA 4ILJA 3QX1A 3PHXB 3OLMD 3R7RA 5D3XA 2KWUB 4HAYB 2LASA 2LYDA 4GU2A 2EC1A 3QIJA 2LGYA 4ANXA 2MA9B 2L0TA 1IYFA 2KC2A 3SD5A 3UQBA 4HB2B 4XC2A 2ELAA 2CQUA 2R09A 5CHFA 5E6NA 3LJUX 3TCAA 4PQ0A 3FM8C 3ULBA 1UD7A 1VD2A 3R7QA 5LOPB 5C5BA 1EVHA 2IYBA 1NTVA 1Y5OA 4LJPB 1GC6A 2NS5A 3CMMB 5JHGA 4MDKE 1WX7A 1WJNA 2JZ3B 4J6IA 1DBHA 3PEGA 2L0FA 3I3TB 5FI0A 2J0KA 3A9JA 5KHOA 4KHOA 2COPA 4KIKA 1WMHB 1YQBA 4ZRIA 3RD2A 5C16A 3A9KA 1GGOA 3GYPA 1ZGUB 2EMTA 5CLLB 2XBBC 3A1QB 1V80A 1Z2MA 1LFDA 3BY4B 2MKRA 5AEKB 2WYQA 4MK0A 3ZTDA 4PS3A 1HBKA 3ZW3A 2KCJA 5L83A 3F0WA 2N7DA 1FGZA 2COFA 2L7RA 2AL6A 4IWPA 1V9JA 2XQNM 1PQSA 2WX1A 4DWFA 3W1YA 1K5GB 3OANA 1H10A 1XT9B 3ZNZB 2DYOA 1UPRA 4NNJB 4ILGB 4DBGA 5DIFB 1N3HA 2LVQA 1K5DB 4EZJA 5AZHA 1P5TA 1EGXA 1Q1OA 2LD9A 1V2YA 4JKBA 3F5RA 1E8ZA 4TKNA 1T0YA 2JVCA 3A8QA 1ST7A 2NBWB 4G50A 4ZYNA 1VCBA 4FHJA 1FHWA 2CAYA 2IZVB 1P9DU 4PS7A 2ASQA 1V5OA 2KTRA 2C60A 1UZXB 1ZSQA 4XX5A 2IFSA 2M1MA 3JVZX 3GOEA 2DIKA 2O6VA 3EHVA 2W9NA 4BFRA 3N3KB 1OY2A 1V5MA 3QHTA 4JKDA 5KQ1A 2NZ8B 2KJRA 1WX8A 1WRDB 2RSGA 1UBIA 3E66A 1UNRA 4HB0B 3VOQA 1UNPA 3VQIA 3E9PA 4XZ4A 3MJWA 2CU1A 3PP2A 3DVNU 3V6CB 4B6WA 1OGWA 2MWNB 4IWOA 3TMPB 2ZNVC 4EUTA 4EJNA 2KOXA 1E8XA 3ZRFA 2GCLA 5JH5C 1ZC4B 4IWQA 3ENEA 1SGHA 3KUDB 1UEFA 3OJ3A 3DVNV 5J3QA 5FR6A 3APFA 3VH4B 4ANWA 4ILHA 4JKFA 2MLBA 2ELBA 3NZSA 1BT0A 2V76A 1MPHA 2ZVOA 2YT1A 4HAWB 2CB8A 2YLMA 4IOYX 2ZJDA 1UPQA 3PT2B 2YT0A 1E90A 3T8MA 2LVPA 4GSWA 4BKSD 3M3JA 4FJVB 3SDLC 4DX90 4A6KA 3QAQA 2BGFA 2G35A 3VTVA 4P7IA 4MM3A 4JIOU 4A5KA 2NR2A 2BCJA 1MK9B 2IO1B 2LOXA 1XCGA 5DHAB 4I6PA 1U5DA 2C7NB 3QCAA 4TYZA 2KWVB 4N9F4 5DH9B 2KKCA 3TBLD 4MELA 5C23A 4WJQA 2YRYA 3ECIA 5DPTA 3DDCB 3ZVRA 2Z0PA 1OTRB 2QHOA 2MW5A 1DYNA 4W9GA 1UH6A 1ISNA 4XWXA 3DBLI 4FHKA 4IUMB 3M95A 4GGQA 2COAA 5FI1A 5LONB 1P98A 1SIFA 3P2BA 2GCJA 2IYDB 3A98B 1LB1A 2LRUA 2P0FA 4FADA 2FJ9A 3ZNHB 4URKA 3O96A 4ZRKA 3U30A 3NSUA 4D0NB 4IW0A 1XD4A 1ZW7A 2R2QA 1H4RA 3DXDA 3L13A 2REXA 5JHAA 1LM8B 4HPLB 3U7DA 5EDSA 5D2MB 2D9XA 1HE8A 4HK2A 2ZEQA 4A3PA 4BKSA 1WR1A 1NVLA 3DBRI 4MEMA 5AZGA 5JHBA 1R4NI 1E8YA 5TR5A 3PS6A 2MBEA 2H7DA 4GDLA 1FB8A 1WM2A 3ML8A 4K2OA 5C6RA 2QKLA 4MY6A 2K25A 2Y8FA 5AZFA 4F7ZA 2M14A 2V4LA 4HWIB 3A4SC 3VUWA 4MH0E 2D11A 2GBJA 2AWTA 2KD0A 3ZIMA 2V3SA 2MBBB 3DPDA 5GOWB 4LDTD 4II3B 3H1UA 4EMOA 2MP2B 3V5WA 3DBSA 1V49A 3RUIB 2JF5A 4AJYB 2JRIB 1ZKHA 2NVUI 1M7EA 3EC8A 1HB6A 4G11A 2DN6A 1Q0WB 2AYOB 4HAVB 3V60A 1WXAA 4M8MA 1M7RA 3VXWA 4ZRJA 2ROZB 2MRPA 4HB3B 2DLWA 2RR9A 4WVFB 2PEAA 5HE0A 2K6QA 1D3ZA 2MBQA 1TGZB 3SO6A 4KDLB 2VKIA 2FDQA 4YONA 4WSFA 5IA7A 2GBNA 4KSLC 5D3YA 2BYVE 2MSED 1JDEA 3O65B 2JXXA 3DQVA 1XODA 1OQYA 1FHXA 1NU2A 2BKRB 2D9VA 3AJ4A 1AQCA 2J59M 2N9EB 4GIVA 2M17A 2BYEA 3DVGY 4I6NB 1WY8A 2UVMA 3Q3FA 1M94A 2GBMA 2DHZA 2HD5B 2K1FA 1P1AA 2KNBA 4KSKC 1MG8A 2A4ZA 3ZNID 2DHJA 1U2BA 2CR5A 4KAXB 4JKHA 4FLHA 2RNRB 2KDFB 1GJZA 3FP5A 2C7HA 1PLSA 2RGNB 1WE6A 3G9WA 2IY1B 4RM9A 4LCDE 2GS0A 2WDTB 2G3QB 2O6VD 2LI5A 3VTUA 4IM0A 2DKQA 5JHHA 3PSEB 4WJ7A 2DX5B 2UZRA 2KFKB 4PS8A 2R82A 1YX5B 5DPSA 2MWSB 2ZPNA 3WANA 2RLOA 3UIPB 2CHWA 3KY9A 3UINB 2I1JA 1Z5SB 4FJYA 3L08A 2LGXA 4K17A 2HTHB 1GUAB 4IM3A 2G45B 4IAPA 3V61A 2JRHA 1XKEA 1FGYA 1HB8A 1Y19B 4X57B 4NY0A 1MIXA 4FA6A 5J3YA 4PYUA 3ZNGC 2RQ1A 1NI2A 2KANA 1XX0A 2X18A 2LWPA 3WALA 1ZVRA 4CO7A 5L95C 2KJ6A 2FCNA 2Q13A 2Y7BA 4F7UP 4DDID 3DCGA 1R4MI 3S2AA 2KVRA 2JUOA 4K81A 4ASWC 1Q67A 1L7YA 1U27A 1F9JA 4EZLA 1X1FA 2K6DB 4Y94A 2CS4A 3DXCA 3H9DA 2DHKA 2CHZA 4A6FA 2RVBB 4AJWA 3LDZE 2LGDA 3RT3B 3CXBB 2DYMA 4GZUA 2PJHA 1JRUA 1IP9A 5CX3A 1LXDA 1A5RA 1UGMA 2Z0EB 3N7CA 2W2WA 5J17A 3KZ1A 5EFXA 5E6PA 4DHJB 4W9JA 4MSMB 3PPAA 2JZZA 3DOWA 2UZSA 2VRWB 4WWOA 1YD8U 3AI5A 3HIZA 3B0AA 2DAFA 3SYXA 2MP2A 2NPTA 2AL3A 3PHWB 1WGRA 1J8CA 1GC7A 3MPXA 2YSZA 3M62B 4E3CA 5CHVC 3RULA 3SBTA 3TVVA 3BINA 1RJ2A 4DX8A 3A33B 3QWZB 2O2VB 2C5LC 4JKGA 4HB4B 4LJOB 2X0SA 2LZ6A 2YS5A 2L00B 3HQCA 1VBGA 3AXCA 4DHZB 3H7PB 3E9OA 1KZ7A 2LXAA 4DXAB 2C9WB 1WJ1A 2DHIA 3FSSA 4CHKA 1RRPB 3V62A 4RM8A 4AUQC 4F7GA 4NQKE 4IG7B 3HW2B 2DAJA 1H8CA 3L0WB 1Y8RC 1WIAA 2RSUA 2LVOA 2JP2A 1WJ6A 2KX3A 1WXMA 3AU5A 2UYZB 3QJZA 4BKGA 1XQQA 4JK7A 3IHPC 3JSVA 3QC8B 1AARA 4BOZB 2OTXA 4G0NB 1UBQA 2KWCA 2NBVB 1W1HA 4MJSA 1J0WA 2WX0A 1DDWA 4TV3A 5HE3A 3A4RA 4EFOA 4FN2A 1LW3A 1I2HA 1EF5A 3IVFA 2RD0A 3VUYA 2L76A 2DZIA 1U5FA 4ZDVA 2KZRA 1WGQA 3PVWA 2EJ8A 2LXCA 3ZUNA 2UWQA 1WGDA 1RAXA 3NHEB 3PLVA 4JKAA 1TZ1A 2D3GA 2LUEA 3VVWB 1V5UA 1P6SA 2RPQA 2L2IA 1E7UA 3VDZA 3PVLA 3KYCD 1J19A 1DIKA 2J7QB 3AULA 4NQLB 2FNJB 1U29A 1WZ0A 4IC7B 3A9JB 2D2QA 4JGHB 3TW1A 3VTWA 1UNQA 4KIKB 4WQOB 3TL5A 3DBHI 2N7EA 3WAOA 4MSQB 4W9LA 2N23A 2XK5B 3RZFA 3A9KB 1TJ6A 1SHCA 5DI9B 2Y5BB 3MDBC 1RLFA 2KC1A 4WWPA 2JY6A 5D6JB 1WGUA 3CSFA 3BJIA 1WYWB 4BBKA 4KV2A 1EF1A 3PZDA 1WVHA 1GNUA 5DHFB 2W2XD 4F8CB 2D9ZA 1FAOA 2NMBA 4GDKB 2D4QA 1WMHA 5D27A 2P0HA 1G6JA 2P0DA 3C0RB 4M8NA 4W9CA 3A1QA 3L16A 4TQ0A 3PRPB 3W1SC 1NDDA 4JK8A 2WWZA 2H7EA 3TO1A 1V81A 2V1YA 2QKMA 3D8DA 2MQJA 3NY5A 4HDQA 3SHQA 2DZMA 1XR0B 3UZTA 4JK9A 1V6EA 2JWZA 1B55A 2IY0B 1WXSA 3PVUA 4GN1A 3SNHA 2M0XA 4K1RB 5C79A 4NJ7A 5BO4B 2KTRB 1WI1A 2IO0B 3ML4A 1WXVA 3QQ8B 1KI1B 1P3RA 2ZCBA 2W2XC 1RFAA 4E71A 1U5EA 1CMXB 2KO3A 3PSCA 2KDEB 1TQZA 4HPMB 1SE9A 1FXTB 2DA0A 2LG1A 5CTRC 1E8WA 2BWFA 2N1VA 3W1SA 3ODXA 1EUVB 4E74A 3VUXA 1WH3A 2GBKA 1WGYA 4GOCA 2FIDA 4HAUB 2K2JA 1C1YB 3EFUA 3APCA 3RCPA 5CLQB 3KW5B 1X1MA 2DTCA 4JLCA 5DPWA 2Z0DB 4KHBB 2KXJA 5LLIA 1ZM0A 5KCVA 3LJ3A 4MGYE 5DPRA 2KLCA 4HCPB 4II2B 5G2NA 5KHQA 3PRMB 1V86A 5LXIB 4CHMA 4W9IA 2L1CA 3KUZA 5D7GA 3FLVA 3ZDTA 5D94A 2CY4A 4H8SA 4BKTA 4MGKE 2Z0QA 1MAIA 4B6HA 2BPSA 2BF8B 2AEHA 2NBUA 1W1DA 3KRXA 2NCNA 1XD3B 1MIZB 3SU8X 1OQNA 4C0AA 3RYTA 3FEHA 1WE7A 3ML9A 4CHJA 4ICUA 3UIOB 2N1WA 1S3SG 2FIFA 4AP4C 3ODOA 4W9HA 4BBNC 3OAWA 5G55A 2CHXA 4DDGD 2M4NA 2J0JA 2N0YA 1DROA 3QA8A 5J3TA 2FCSA 2E2XA 2DFKA 3CF6E 5DCNA 3OJ4B 1I42A 2COCA 4MGIE 3E9LA 1ZC3B 1IPGA 5LXHA 3IFWB 4K7WA 1FHOA 1KC7A 2KJHB 4NSWA 1BAKA 2KDIA 4NJ6A 2K8BA 4HLEA 5JP4A 4MGZE 5CHWA 2ZCCA 3VH3B 2GJYA 3WIMA 1RRBA 4YL8A 4EKUA 3D8EA 4KZCA 4W9DA 2ADZA 3B1LX 2FCQA 1LQBA 2HJ8A 2BYFA 2MFQA 4BVUC 4G3XB 3VAWA 2D07B 1U5GA 4KVGB 1KM7A 5HKHA 3A8PA 4F1SA 3MHSD 5JLJB 3ZTCA 1WG7A 5IAAC 3NS8A 1V61A 3K9OB 1AWEA 4HVBA 3PTFC 3VFKA 2DZKA 4HHVA 3PG7A 4ANUA 3U8ZA 2M38A 1PMSA 5D3WA 2XK5A 3B08A 3PREA 4L6EA 1WJUA 3NOBA 2K8HA 5E6OA 1WGHA 3HM3A 3D8FA 4WJNA 1DDVA 1KLVA 3RCZA 2K8CA 3L17A 1TTNA 4GDLB 3DXEA 3JW0X 2HE7A 2KMAA 2I5FA 4PNKA 4I6LB 2N9XA 3KRWA 4GDKA 1V88A 4WWNA 3P6AA 2FUHB 1J0GA 2I1KA 1E5WA 2VSZA 4HCNB 2OQBA 2G4SA 2K39A 2B3AA 3AU4A 1U4AA 4A20A 4HXDA 1EAZA 2DKPA 3PRZA 3X23A 2YS3A 4DHZE 1WF9A 4AOFA 2IO2B 2KX0A 3ENBA 1W1GA 2C7MB 4JL9A 2Z0OA 2KGXB 5L81A 2N9PC 1BTKA 3SUZA 1MKEA 2VRRB 1BWNA 4K2PA 1I35A 3V6EB 1DDMA 1GG3A 4BOSC 4M0WB 2CKHB 2LKOA 2DENB 4FJZA 2P8VA 3T9LA 2EMSA 3DVGX 1P3QU 1V89A 4CYEA 1WM3A 5C1ZA 2MX2A 1WJMA 2MCNB 2L3ZA 2KFJA 1OEYJ 3VIAA 4K7SA 3ZO5B 1KOTA 4MT7A 3H7SA 4NAWB 3EECA 4OVVA 4NPNA 3TJPA 2RUKB 3QARA 4EEWA 2MDXA 4TUUA 1X05A 2KK8A 4Z2NA 2L8JA 3QBVB 3M63B 5HE1A 4B9KA 2DZJA 3HM6X 5KQ4A 4A6HA 1OMWA 3APDA 2R0DA 2KLGA 4RMAA 3HK0A 2N4FA 3ALBA 1V5TA 2KN5A 1E7VA 4HJKA 3SBGA 4HATB 4AWJA 4LDTB 3H6NA 2ZZPB 2K00A 3ZRCA 1WGGA 4Z2MB 2IO3B 4DK5A 1I7AA 1WI0A 2RGFA 5GMVA 3KSYA 2PPHA 2DYNA 1NTYA 1TBEA 4W9EA 3IBEA 2YVCA 1FOEA 4JKCA 4KHAA 2LJ5A 1WZ3A 2Y8GA 4W9KA 5C5BB 3WAMA 2KHWB 1IRSA 3TIXA 4K7UA 3N32A 3ZLZA 3M1IB 5IJMA 2GBRA 2KQ7A 1KBLA 1S1QB 2HRJA 3GYOA 2OJRA 4KDIC 3UQAA 2PE6B 2D9WA 2XEWA 4GB9A 1WR6E 3EPYA 2G4DB 1EO6A 3CIKA 1WX9A 1X86A 1P0RA 3IG3A 2M8SA 2KQSA 3R3MA 4GMXB 1L2NA 2CY5A 3PV1A 3Q3JA 1X11A 4FBJB 4WAAA 2DX5A 2WH5A 2KFKA 3KH0A 1UELA 3ZVVA 3JYUA 4DHJD 2PZ1A 3ULCA 1OEYA 2FJLA 3QK0A 3VHTC 1NBFC 3WYFB 1V5PA 3K9PB 1KJTA 2KMCA 2ABDA 4F7HA 4A3OA 2HTHA 2LBBA 3ZDMC 4TQ1A 3R66C 2MBHA 4JQWC 2PE9A 4OVUA 4A6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLU A;  1K8R B;  1YJ1 A;  2A5U A;  2JPH A;  1NTI A;  5J2R A;  4ICV A;  4GPT B;  1Q5W B;  3CST A;  1TXD A;  2O6V B;  3MTN B;  2YF0 A;  4DBB A;  5J18 A;  4HAZ B;  5HE2 A;  1MK7 B;  2KTF A;  3PGE A;  2DX1 A;  5D3V A;  3WA0 A;  1YX6 B;  2BWE S;  2CRF A;  2GOW A;  4B95 A;  2BKF A;  2KUP A;  4IM2 A;  1ACA A;  2MBO A;  2LOZ A;  2I5C A;  1KZG A;  3T06 A;  4W9F A;  2NPT B;  3RZW C;  4EOY A;  2IBI B;  2J0M A;  1WFY A;  4PYZ A;  3ZKJ C;  3L54 A;  2FCM A;  3TFM A;  3KUC B;  3UF8 A;  2EKE C;  3HHM A;  4IFS A;  3QWM A;  4WJO A;  2GMI C;  1YIW A;  4KZ0 A;  3NZU A;  4FUL A;  3GZN I;  2DYB A;  5JZE B;  2ZPY A;  1WJ4 A;  2COD A;  1QQG A;  3N30 A;  2ROV A;  3X0W A;  2K2U A;  2D9Y A;  2OOB B;  2L05 A;  3WAP A;  2D10 A;  3KYD D;  4HAX B;  2KDB A;  2FAZ A;  2LUL A;  4HDO A;  3L10 B;  2YS1 A;  1BTN A;  4ANV A;  2JT4 B;  2O2V A;  4GXB A;  4BBN F;  2Z59 B;  1QZE A;  4WJP A;  3ODW A;  3JSV B;  4GMV A;  3H7P A;  4MJS B;  2ZNV B;  3SV1 A;  1PFJ A;  2ZVN A;  3P7Z A;  1X1G A;  4NAW A;  3D32 A;  1Z87 A;  2R2O A;  1QC6 A;  2LRW A;  4EZK A;  2DYQ A;  3UGB B;  3KVF B;  3ONS A;  1C3T A;  3QX1 A;  3PHX B;  3OLM D;  3R7R A;  5D3X A;  2KWU B;  4HAY B;  2LAS A;  2LYD A;  4GU2 A;  2EC1 A;  3QIJ A;  2LGY A;  4ANX A;  2MA9 B;  2L0T A;  1IYF A;  2KC2 A;  3SD5 A;  3UQB A;  4HB2 B;  4XC2 A;  2ELA A;  2CQU A;  2R09 A;  5CHF A;  5E6N A;  3LJU X;  3TCA A;  4PQ0 A;  3FM8 C;  3ULB A;  1UD7 A;  1VD2 A;  3R7Q A;  5LOP B;  5C5B A;  1EVH A;  2IYB A;  1NTV A;  1Y5O A;  4LJP B;  1GC6 A;  2NS5 A;  3CMM B;  5JHG A;  4MDK E;  1WX7 A;  1WJN A;  2JZ3 B;  4J6I A;  1DBH A;  3PEG A;  2L0F A;  3I3T B;  5FI0 A;  2J0K A;  3A9J A;  5KHO A;  4KHO A;  2COP A;  4KIK A;  1WMH B;  1YQB A;  4ZRI A;  3RD2 A;  5C16 A;  3A9K A;  3GYP A;  1ZGU B;  2EMT A;  5CLL B;  2XBB C;  3A1Q B;  1V80 A;  1Z2M A;  1LFD A;  3BY4 B;  2MKR A;  5AEK B;  2WYQ A;  4MK0 A;  3ZTD A;  4PS3 A;  1HBK A;  3ZW3 A;  2KCJ A;  5L83 A;  3F0W A;  2N7D A;  1FGZ A;  2COF A;  2L7R A;  2AL6 A;  4IWP A;  1V9J A;  2XQN M;  1PQS A;  2WX1 A;  4DWF A;  3W1Y A;  1K5G B;  3OAN A;  1H10 A;  1XT9 B;  3ZNZ B;  2DYO A;  1UPR A;  4NNJ B;  4DBG A;  5DIF B;  1N3H A;  2LVQ A;  1K5D B;  4EZJ A;  5AZH A;  1P5T A;  1EGX A;  1Q1O A;  2LD9 A;  1V2Y A;  3F5R A;  1E8Z A;  4TKN A;  1T0Y A;  2JVC A;  3A8Q A;  1ST7 A;  2NBW B;  4G50 A;  4ZYN A;  1VCB A;  4FHJ A;  1FHW A;  2CAY A;  2IZV B;  1P9D U;  4PS7 A;  2ASQ A;  1V5O A;  2KTR A;  2C60 A;  1UZX B;  1ZSQ A;  4XX5 A;  2IFS A;  2M1M A;  3JVZ X;  3GOE A;  2O6V A;  3EHV A;  2W9N A;  4BFR A;  3N3K B;  1OY2 A;  1V5M A;  3QHT A;  5KQ1 A;  2NZ8 B;  2KJR A;  1WX8 A;  1WRD B;  2RSG A;  1UBI A;  1UNR A;  4HB0 B;  3VOQ A;  1UNP A;  3VQI A;  4XZ4 A;  3MJW A;  2CU1 A;  3PP2 A;  3DVN U;  3V6C B;  4B6W A;  1OGW A;  2MWN B;  4IWO A;  3TMP B;  2ZNV C;  4EUT A;  4EJN A;  2KOX A;  1E8X A;  3ZRF A;  2GCL A;  5JH5 C;  1ZC4 B;  4IWQ A;  3ENE A;  1SGH A;  3KUD B;  1UEF A;  3OJ3 A;  3DVN V;  5J3Q A;  5FR6 A;  3APF A;  3VH4 B;  4ANW A;  2MLB A;  2ELB A;  3NZS A;  1BT0 A;  2V76 A;  1MPH A;  2ZVO A;  2YT1 A;  4HAW B;  2CB8 A;  2YLM A;  4IOY X;  2ZJD A;  1UPQ A;  3PT2 B;  2YT0 A;  1E90 A;  3T8M A;  2LVP A;  4GSW A;  4BKS D;  3M3J A;  4FJV B;  3SDL C;  4DX9 0;  4A6K A;  3QAQ A;  2BGF A;  2G35 A;  3VTV A;  4P7I A;  4MM3 A;  4JIO U;  4A5K A;  2NR2 A;  2BCJ A;  1MK9 B;  2IO1 B;  2LOX A;  1XCG A;  5DHA B;  4I6P A;  1U5D A;  2C7N B;  3QCA A;  4TYZ A;  2KWV B;  4N9F 4;  5DH9 B;  2KKC A;  3TBL D;  4MEL A;  5C23 A;  4WJQ A;  2YRY A;  3ECI A;  5DPT A;  3DDC B;  3ZVR A;  2Z0P A;  1OTR B;  2QHO A;  2MW5 A;  1DYN A;  4W9G A;  1UH6 A;  1ISN A;  4XWX A;  3DBL I;  4FHK A;  4IUM B;  3M95 A;  4GGQ A;  2COA A;  5FI1 A;  5LON B;  1P98 A;  1SIF A;  3P2B A;  2GCJ A;  2IYD B;  3A98 B;  1LB1 A;  2LRU A;  2P0F A;  4FAD A;  2FJ9 A;  3ZNH B;  4URK A;  3O96 A;  4ZRK A;  3U30 A;  3NSU A;  4D0N B;  4IW0 A;  1XD4 A;  1ZW7 A;  2R2Q A;  1H4R A;  3DXD A;  3L13 A;  2REX A;  5JHA A;  1LM8 B;  4HPL B;  3U7D A;  5EDS A;  5D2M B;  2D9X A;  1HE8 A;  4HK2 A;  2ZEQ A;  4A3P A;  4BKS A;  1WR1 A;  1NVL A;  3DBR I;  4MEM A;  5AZG A;  5JHB A;  1R4N I;  1E8Y A;  5TR5 A;  3PS6 A;  2MBE A;  2H7D A;  4GDL A;  1FB8 A;  1WM2 A;  3ML8 A;  4K2O A;  5C6R A;  2QKL A;  4MY6 A;  2K25 A;  2Y8F A;  5AZF A;  4F7Z A;  2M14 A;  2V4L A;  4HWI B;  3A4S C;  3VUW A;  4MH0 E;  2D11 A;  2GBJ A;  2AWT A;  2KD0 A;  3ZIM A;  2V3S A;  2MBB B;  3DPD A;  5GOW B;  4LDT D;  4II3 B;  3H1U A;  4EMO A;  2MP2 B;  3V5W A;  3DBS A;  1V49 A;  3RUI B;  2JF5 A;  4AJY B;  2JRI B;  1ZKH A;  2NVU I;  1M7E A;  3EC8 A;  1HB6 A;  4G11 A;  2DN6 A;  1Q0W B;  2AYO B;  4HAV B;  3V60 A;  1WXA A;  4M8M A;  1M7R A;  3VXW A;  4ZRJ A;  2ROZ B;  2MRP A;  4HB3 B;  2DLW A;  2RR9 A;  4WVF B;  2PEA A;  5HE0 A;  2K6Q A;  1D3Z A;  2MBQ A;  1TGZ B;  3SO6 A;  4KDL B;  2VKI A;  2FDQ A;  4YON A;  4WSF A;  5IA7 A;  2GBN A;  4KSL C;  5D3Y A;  2BYV E;  2MSE D;  3O65 B;  2JXX A;  3DQV A;  1XOD A;  1OQY A;  1FHX A;  1NU2 A;  2BKR B;  2D9V A;  3AJ4 A;  1AQC A;  2J59 M;  2N9E B;  4GIV A;  2M17 A;  2BYE A;  3DVG Y;  4I6N B;  1WY8 A;  2UVM A;  3Q3F A;  1M94 A;  2GBM A;  2DHZ A;  2HD5 B;  2K1F A;  1P1A A;  2KNB A;  4KSK C;  1MG8 A;  2A4Z A;  3ZNI D;  2DHJ A;  1U2B A;  2CR5 A;  4KAX B;  4FLH A;  2RNR B;  2KDF B;  1GJZ A;  3FP5 A;  2C7H A;  1PLS A;  2RGN B;  1WE6 A;  3G9W A;  2IY1 B;  4RM9 A;  4LCD E;  2GS0 A;  2WDT B;  2G3Q B;  2O6V D;  2LI5 A;  3VTU A;  4IM0 A;  2DKQ A;  5JHH A;  3PSE B;  4WJ7 A;  2DX5 B;  2UZR A;  2KFK B;  4PS8 A;  1YX5 B;  5DPS A;  2MWS B;  2ZPN A;  3WAN A;  2RLO A;  3UIP B;  2CHW A;  3KY9 A;  3UIN B;  2I1J A;  1Z5S B;  4FJY A;  3L08 A;  2LGX A;  4K17 A;  2HTH B;  1GUA B;  4IM3 A;  2G45 B;  4IAP A;  3V61 A;  2JRH A;  1XKE A;  1FGY A;  1HB8 A;  1Y19 B;  4X57 B;  4NY0 A;  1MIX A;  4FA6 A;  5J3Y A;  4PYU A;  3ZNG C;  2RQ1 A;  1NI2 A;  2KAN A;  1XX0 A;  2X18 A;  2LWP A;  3WAL A;  1ZVR A;  4CO7 A;  5L95 C;  2KJ6 A;  2FCN A;  2Q13 A;  2Y7B A;  4F7U P;  4DDI D;  3DCG A;  1R4M I;  3S2A A;  2KVR A;  2JUO A;  4K81 A;  4ASW C;  1Q67 A;  1L7Y A;  1U27 A;  1F9J A;  4EZL A;  1X1F A;  2K6D B;  4Y94 A;  2CS4 A;  3DXC A;  3H9D A;  2DHK A;  2CHZ A;  4A6F A;  2RVB B;  4AJW A;  3LDZ E;  2LGD A;  3RT3 B;  3CXB B;  2DYM A;  4GZU A;  2PJH A;  1JRU A;  1IP9 A;  5CX3 A;  1LXD A;  1A5R A;  1UGM A;  2Z0E B;  3N7C A;  2W2W A;  5J17 A;  3KZ1 A;  5EFX A;  5E6P A;  4DHJ B;  4W9J A;  4MSM B;  3PPA A;  2JZZ A;  3DOW A;  2UZS A;  2VRW B;  4WWO A;  1YD8 U;  3AI5 A;  3HIZ A;  3B0A A;  2DAF A;  3SYX A;  2MP2 A;  2NPT A;  2AL3 A;  3PHW B;  1WGR A;  1J8C A;  1GC7 A;  3MPX A;  2YSZ A;  3M62 B;  4E3C A;  5CHV C;  3RUL A;  3TVV A;  3BIN A;  1RJ2 A;  4DX8 A;  3A33 B;  3QWZ B;  2O2V B;  2C5L C;  4HB4 B;  4LJO B;  2LZ6 A;  2YS5 A;  2L00 B;  3HQC A;  3AXC A;  4DHZ B;  3H7P B;  1KZ7 A;  2LXA A;  4DXA B;  2C9W B;  1WJ1 A;  2DHI A;  3FSS A;  4CHK A;  1RRP B;  3V62 A;  4RM8 A;  4AUQ C;  4F7G A;  4NQK E;  4IG7 B;  3HW2 B;  2DAJ A;  1H8C A;  3L0W B;  1Y8R C;  1WIA A;  2RSU A;  2LVO A;  2JP2 A;  1WJ6 A;  2KX3 A;  1WXM A;  3AU5 A;  2UYZ B;  3QJZ A;  4BKG A;  1XQQ A;  3IHP C;  3JSV A;  3QC8 B;  1AAR A;  4BOZ B;  2OTX A;  4G0N B;  1UBQ A;  2KWC A;  2NBV B;  1W1H A;  4MJS A;  1J0W A;  2WX0 A;  1DDW A;  4TV3 A;  5HE3 A;  3A4R A;  4EFO A;  4FN2 A;  1LW3 A;  1I2H A;  1EF5 A;  3IVF A;  2RD0 A;  3VUY A;  2L76 A;  2DZI A;  1U5F A;  4ZDV A;  2KZR A;  1WGQ A;  3PVW A;  2EJ8 A;  2LXC A;  3ZUN A;  2UWQ A;  1WGD A;  1RAX A;  3NHE B;  3PLV A;  1TZ1 A;  2D3G A;  2LUE A;  3VVW B;  1V5U A;  1P6S A;  2RPQ A;  2L2I A;  1E7U A;  3VDZ A;  3PVL A;  3KYC D;  1J19 A;  2J7Q B;  3AUL A;  4NQL B;  2FNJ B;  1U29 A;  1WZ0 A;  4IC7 B;  3A9J B;  2D2Q A;  4JGH B;  3TW1 A;  3VTW A;  1UNQ A;  4KIK B;  4WQO B;  3TL5 A;  3DBH I;  2N7E A;  3WAO A;  4MSQ B;  4W9L A;  2N23 A;  2XK5 B;  3RZF A;  3A9K B;  1TJ6 A;  1SHC A;  5DI9 B;  2Y5B B;  3MDB C;  1RLF A;  2KC1 A;  4WWP A;  2JY6 A;  5D6J B;  1WGU A;  3CSF A;  3BJI A;  1WYW B;  4BBK A;  4KV2 A;  1EF1 A;  3PZD A;  1WVH A;  1GNU A;  5DHF B;  2W2X D;  4F8C B;  2D9Z A;  1FAO A;  2NMB A;  4GDK B;  2D4Q A;  1WMH A;  5D27 A;  2P0H A;  1G6J A;  2P0D A;  3C0R B;  4M8N A;  4W9C A;  3A1Q A;  3L16 A;  4TQ0 A;  3PRP B;  3W1S C;  1NDD A;  2WWZ A;  2H7E A;  3TO1 A;  1V81 A;  2V1Y A;  2QKM A;  3D8D A;  2MQJ A;  3NY5 A;  4HDQ A;  3SHQ A;  2DZM A;  1XR0 B;  3UZT A;  1V6E A;  2JWZ A;  1B55 A;  2IY0 B;  1WXS A;  3PVU A;  4GN1 A;  3SNH A;  2M0X A;  4K1R B;  5C79 A;  4NJ7 A;  5BO4 B;  2KTR B;  1WI1 A;  2IO0 B;  3ML4 A;  1WXV A;  3QQ8 B;  1KI1 B;  1P3R A;  2ZCB A;  2W2X C;  1RFA A;  4E71 A;  1U5E A;  1CMX B;  2KO3 A;  3PSC A;  2KDE B;  1TQZ A;  4HPM B;  1SE9 A;  1FXT B;  2DA0 A;  2LG1 A;  5CTR C;  1E8W A;  2BWF A;  2N1V A;  3W1S A;  3ODX A;  1EUV B;  4E74 A;  3VUX A;  1WH3 A;  2GBK A;  1WGY A;  4GOC A;  2FID A;  4HAU B;  2K2J A;  1C1Y B;  3EFU A;  3APC A;  3RCP A;  5CLQ B;  3KW5 B;  1X1M A;  2DTC A;  4JLC A;  5DPW A;  2Z0D B;  4KHB B;  2KXJ A;  5LLI A;  1ZM0 A;  5KCV A;  3LJ3 A;  4MGY E;  5DPR A;  2KLC A;  4HCP B;  4II2 B;  5G2N A;  5KHQ A;  3PRM B;  1V86 A;  5LXI B;  4CHM A;  4W9I A;  2L1C A;  3KUZ A;  5D7G A;  3FLV A;  3ZDT A;  5D94 A;  2CY4 A;  4H8S A;  4BKT A;  4MGK E;  2Z0Q A;  1MAI A;  4B6H A;  2BPS A;  2BF8 B;  2AEH A;  2NBU A;  1W1D A;  3KRX A;  2NCN A;  1XD3 B;  1MIZ B;  3SU8 X;  1OQN A;  4C0A A;  3RYT A;  3FEH A;  1WE7 A;  3ML9 A;  4CHJ A;  4ICU A;  3UIO B;  2N1W A;  1S3S G;  2FIF A;  4AP4 C;  3ODO A;  4W9H A;  4BBN C;  3OAW A;  5G55 A;  2CHX A;  4DDG D;  2M4N A;  2J0J A;  2N0Y A;  1DRO A;  3QA8 A;  5J3T A;  2FCS A;  2E2X A;  2DFK A;  3CF6 E;  5DCN A;  3OJ4 B;  1I42 A;  2COC A;  4MGI E;  5LXH A;  1ZC3 B;  1IPG A;  3IFW B;  4K7W A;  1FHO A;  2KJH B;  4NSW A;  1BAK A;  2KDI A;  4NJ6 A;  2K8B A;  4HLE A;  5JP4 A;  4MGZ E;  5CHW A;  2ZCC A;  3VH3 B;  2GJY A;  3WIM A;  1RRB A;  4YL8 A;  4EKU A;  3D8E A;  4KZC A;  4W9D A;  2ADZ A;  3B1L X;  2FCQ A;  1LQB A;  2HJ8 A;  2BYF A;  2MFQ A;  4BVU C;  4G3X B;  3VAW A;  2D07 B;  1U5G A;  4KVG B;  1KM7 A;  5HKH A;  3A8P A;  4F1S A;  3MHS D;  5JLJ B;  3ZTC A;  1WG7 A;  5IAA C;  3NS8 A;  1V61 A;  3K9O B;  1AWE A;  4HVB A;  3PTF C;  3VFK A;  2DZK A;  4HHV A;  3PG7 A;  4ANU A;  3U8Z A;  2M38 A;  1PMS A;  5D3W A;  2XK5 A;  3B08 A;  3PRE A;  4L6E A;  1WJU A;  3NOB A;  2K8H A;  5E6O A;  1WGH A;  3HM3 A;  3D8F A;  4WJN A;  1DDV A;  1KLV A;  3RCZ A;  2K8C A;  3L17 A;  1TTN A;  4GDL B;  3DXE A;  3JW0 X;  2HE7 A;  2KMA A;  2I5F A;  4PNK A;  4I6L B;  2N9X A;  3KRW A;  4GDK A;  1V88 A;  4WWN A;  3P6A A;  2FUH B;  1J0G A;  2I1K A;  1E5W A;  2VSZ A;  4HCN B;  2OQB A;  2G4S A;  2K39 A;  2B3A A;  3AU4 A;  1U4A A;  4A20 A;  4HXD A;  1EAZ A;  2DKP A;  3PRZ A;  3X23 A;  2YS3 A;  4DHZ E;  1WF9 A;  4AOF A;  2IO2 B;  2KX0 A;  1W1G A;  2C7M B;  4JL9 A;  2Z0O A;  2KGX B;  5L81 A;  2N9P C;  1BTK A;  3SUZ A;  1MKE A;  2VRR B;  1BWN A;  4K2P A;  1I35 A;  3V6E B;  1DDM A;  1GG3 A;  4BOS C;  4M0W B;  2CKH B;  2LKO A;  2DEN B;  4FJZ A;  2P8V A;  3T9L A;  2EMS A;  3DVG X;  1P3Q U;  1V89 A;  4CYE A;  1WM3 A;  5C1Z A;  2MX2 A;  1WJM A;  2MCN B;  2L3Z A;  2KFJ A;  1OEY J;  3VIA A;  4K7S A;  3ZO5 B;  1KOT A;  4MT7 A;  3H7S A;  4NAW B;  3EEC A;  4OVV A;  4NPN A;  3TJP A;  2RUK B;  3QAR A;  4EEW A;  2MDX A;  4TUU A;  1X05 A;  2KK8 A;  4Z2N A;  2L8J A;  3QBV B;  3M63 B;  5HE1 A;  4B9K A;  2DZJ A;  3HM6 X;  5KQ4 A;  4A6H A;  1OMW A;  3APD A;  2R0D A;  2KLG A;  4RMA A;  3HK0 A;  2N4F A;  3ALB A;  1V5T A;  2KN5 A;  1E7V A;  4HJK A;  4HAT B;  4AWJ A;  4LDT B;  3H6N A;  2ZZP B;  2K00 A;  3ZRC A;  1WGG A;  4Z2M B;  2IO3 B;  4DK5 A;  1I7A A;  1WI0 A;  2RGF A;  5GMV A;  3KSY A;  2PPH A;  2DYN A;  1NTY A;  1TBE A;  4W9E A;  3IBE A;  2YVC A;  1FOE A;  4KHA A;  2LJ5 A;  1WZ3 A;  2Y8G A;  4W9K A;  5C5B B;  3WAM A;  2KHW B;  1IRS A;  3TIX A;  4K7U A;  3N32 A;  3ZLZ A;  3M1I B;  5IJM A;  2GBR A;  2KQ7 A;  1S1Q B;  2HRJ A;  3GYO A;  2OJR A;  4KDI C;  3UQA A;  2PE6 B;  2D9W A;  2XEW A;  4GB9 A;  1WR6 E;  3EPY A;  2G4D B;  1EO6 A;  3CIK A;  1WX9 A;  1X86 A;  1P0R A;  3IG3 A;  2M8S A;  2KQS A;  3R3M A;  4GMX B;  1L2N A;  2CY5 A;  3PV1 A;  3Q3J A;  1X11 A;  4FBJ B;  4WAA A;  2DX5 A;  2WH5 A;  2KFK A;  3KH0 A;  1UEL A;  3ZVV A;  3JYU A;  4DHJ D;  2PZ1 A;  3ULC A;  1OEY A;  2FJL A;  3QK0 A;  3VHT C;  1NBF C;  3WYF B;  1V5P A;  3K9P B;  1KJT A;  2KMC A;  2ABD A;  4F7H A;  4A3O A;  2HTH A;  2LBB A;  3ZDM C;  4TQ1 A;  3R66 C;  2MBH A;  4JQW C;  2PE9 A;  4OVU A;  4A6F B; 
#chains in the Genus database with same CATH topology
 3PLU A;  1N6Z A;  1K8R B;  1F0Z A;  4C00 A;  1YJ1 A;  3AE9 B;  2A5U A;  2JPH A;  1NTI A;  1TZO A;  2HJ1 A;  4JE3 B;  3UI3 A;  3BVG A;  5J2R A;  4ICV A;  4GPT B;  1Q5W B;  3ZJT A;  3CST A;  1TXD A;  4LNN A;  2O6V B;  3MTN B;  2YF0 A;  4DBB A;  5J18 A;  4HAZ B;  5HE2 A;  1MK7 B;  2JQR B;  2KTF A;  3PGE A;  2DX1 A;  5D3V A;  5IO9 A;  3WA0 A;  1YX6 B;  4A8X C;  5BYS A;  2BS2 B;  2BWE S;  2RDH A;  2CRF A;  2GOW A;  4ZYS A;  4B95 A;  2BKF A;  2KUP A;  2OJW A;  4IM2 A;  1ACA A;  1KF6 B;  2MBO A;  4QJ5 B;  2LOZ A;  2I5C A;  4MAC A;  1KZG A;  3T06 A;  4W9F A;  2NPT B;  3RZW C;  4EOY A;  2IBI B;  1MVK A;  1TY0 A;  1DOY A;  3EGR A;  2J0M A;  1WFY A;  4PYZ A;  3ZKJ C;  4XWW A;  3L54 A;  2YEP F;  4HRO A;  4JKE A;  2FCM A;  3GB1 A;  5JVL A;  1CZP A;  5TSS A;  3TFM A;  1ZDX A;  4JKG B;  3KUC B;  2FUG 1;  3UF8 A;  2EKE C;  3HHM A;  4IFS A;  1NVI D;  3QWM A;  4WJO A;  2GMI C;  1YIW A;  4KZ0 A;  3NZU A;  3DBL B;  4FUL A;  1RFK A;  3FIL A;  4WH4 A;  3GZN I;  2DYB A;  3AE5 B;  5JZE B;  2ZPY A;  1WJ4 A;  2COD A;  1QQG A;  3N30 A;  2ROV A;  4USA A;  3X0W A;  2K2U A;  2D9Y A;  2OOB B;  2L05 A;  3WAP A;  2D10 A;  3KYD D;  4HAX B;  2KDB A;  4HJG E;  2FAZ A;  1XLP A;  2LUL A;  4HDO A;  2QJL A;  3L10 B;  2YS1 A;  1BTN A;  3U52 E;  4ANV A;  3DCX A;  1YQ3 B;  1B1Z A;  2BTE A;  2JT4 B;  2O2V A;  4GXB A;  3Q3N C;  4BBN F;  2Z59 B;  1IUE A;  1QZE A;  4WJP A;  3ODW A;  2ZW0 A;  3JSV B;  4D2K A;  2WHI A;  2L32 A;  4C4V B;  1TYG B;  4GMV A;  1Y56 A;  1QOG A;  2D3B A;  3RI7 C;  1SF0 A;  3H7P A;  1ACC A;  4MJS B;  2ZNV B;  3SV1 A;  1PFJ A;  2ZVN A;  1SJH D;  2YT2 A;  3P7Z A;  1X1G A;  4NAW A;  3D32 A;  2NMQ A;  1Z87 A;  4ZOH C;  1CJE A;  3Q8E A;  2R2O A;  1QC6 A;  2LRW A;  3AV8 A;  4EZK A;  2DYQ A;  1YN4 A;  3DBR B;  3UGB B;  3O13 A;  2R2Y A;  3KVF B;  3ONS A;  4JX1 C;  1C3T A;  2K5P A;  3IT4 B;  1VBH A;  4ILJ A;  3QX1 A;  3PHX B;  3OLM D;  3R7R A;  3EFC A;  5D3X A;  2V4I B;  2KWU B;  1FO4 A;  4OT1 A;  5HI1 A;  4HAY B;  1KLG D;  2LAS A;  2LYD A;  1OQQ A;  1SXT A;  4GU2 A;  2EC1 A;  3QIJ A;  2E3T A;  2LGY A;  2VH2 A;  2MA9 B;  4ANX A;  2NBV A;  2L0T A;  1IYF A;  2KC2 A;  3SD5 A;  3UQB A;  4HB2 B;  5T8I A;  1FEH A;  4XC2 A;  2ELA A;  3PZ8 A;  2CQU A;  2R09 A;  4ARI A;  3AE4 B;  5CHF A;  2AQ3 B;  1SSN A;  5E6N A;  3DHH C;  4OZC A;  4M01 A;  3LJU X;  3TCA A;  4PQ0 A;  3FM8 C;  3ULB A;  1XCQ L;  1I4G A;  1UD7 A;  1VD2 A;  3R7Q A;  1L0X B;  3AM9 A;  5LOP B;  1JWU D;  5C5B A;  1EVH A;  3P4S B;  2IYB A;  4RH6 A;  1FCC C;  1WGK A;  3IT6 B;  1NTV A;  2BT6 A;  1Y5O A;  4LJP B;  1GC6 A;  2IND C;  2NS5 A;  3CMM B;  4HEA 1;  5JHG A;  4MDK E;  1VDV A;  3U7Z A;  4OHJ A;  1WX7 A;  4C80 A;  4YT0 B;  1WJN A;  2JZ3 B;  5JXV A;  4J6I A;  1DBH A;  5HG2 A;  2KAJ A;  4HKQ A;  3PEG A;  2L0F A;  4YXD B;  1FRD A;  3I3T B;  5FI0 A;  2J0K A;  4YTM B;  3A9J A;  5KHO A;  3P63 A;  4KHO A;  3IAS 1;  2COP A;  4KIK A;  1WMH B;  1YQB A;  4ZRI A;  3RD2 A;  5C16 A;  3A9K A;  1GGO A;  3GYP A;  1XXG A;  1FM0 D;  1ZGU B;  2EMT A;  5CLL B;  3U4E G;  2XBB C;  3A1Q B;  2JYT A;  1V80 A;  1HA5 A;  1LFD A;  1Z2M A;  2MKR A;  2WXI A;  3BY4 B;  5AEK B;  2WYQ A;  4MK0 A;  3ZTD A;  1EWY C;  4PS3 A;  5C2T B;  1HBK A;  3ZW3 A;  2KCJ A;  4KKJ A;  5L83 A;  2JZP A;  3F0W A;  2N7D A;  1FGZ A;  2COF A;  2D5G A;  2L7R A;  2CJN A;  2AL6 A;  4IWP A;  1OFF A;  1JRP A;  1V9J A;  2XQN M;  1PQS A;  2WX1 A;  1GOZ A;  4DWF A;  3W1Y A;  2JSV X;  1K5G B;  3OAN A;  1H10 A;  1XT9 B;  3ZNZ B;  2DYO A;  1N60 A;  1UPR A;  1FFU A;  4NNJ B;  4ILG B;  4DBG A;  2QDF A;  5DIF B;  2SAK A;  1N3H A;  2LVQ A;  1I4H A;  1K5D B;  1MG4 A;  2L83 A;  1PGA A;  2EKI A;  4LNO A;  4EZJ A;  1VRA B;  5AZH A;  1P5T A;  2ACZ B;  1EGX A;  1Q1O A;  2LD9 A;  1V2Y A;  4JKB A;  3F5R A;  1E8Z A;  1I7H A;  4TKN A;  1T0Y A;  2JVC A;  3Q8B A;  1IGC A;  3A8Q A;  3TEZ A;  1ST7 A;  3Q8A A;  4P1C C;  2NBW B;  4FHJ A;  1VCB A;  4G50 A;  4ZYN A;  1FHW A;  1ZUD 2;  2CAY A;  4HKZ E;  2W3R A;  2IZV B;  1P9D U;  4PS7 A;  2ASQ A;  1V5O A;  4LNK A;  2KTR A;  2C60 A;  3I5J C;  1UZX B;  1ZSQ A;  4XX5 A;  3B77 A;  2IFS A;  1SEB D;  2M1M A;  3JVZ X;  3GOE A;  2DIK A;  3EUB 2;  3AEF B;  3BK2 A;  2O6V A;  3EHV A;  5I4D A;  4N6E B;  2W9N A;  2WLB A;  4BFR A;  3N3K B;  1OY2 A;  1V5M A;  3QHT A;  4HSI A;  4JKD A;  5KQ1 A;  2NZ8 B;  2KJR A;  2VZK D;  1DGJ A;  5BYR A;  1WX8 A;  1EM7 A;  3E56 A;  3TSS A;  3RNC C;  1WRD B;  4RNA A;  3SFE B;  2RSG A;  2ZW1 A;  1UBI A;  2Z4D A;  3I57 A;  3E66 A;  3MC8 A;  1JAL A;  1UNR A;  4HB0 B;  3VOQ A;  1L6V A;  1UNP A;  3VQI A;  3E9P A;  1FPY A;  4KGT A;  4XZ4 A;  3MJW A;  2CU1 A;  3PP2 A;  3DVN U;  3V6C B;  3W2D A;  1YJI A;  3KWV A;  1I4P A;  4B6W A;  2WP9 B;  1OGW A;  2MWN B;  4D6W A;  4IWO A;  3TMP B;  2ZNV C;  4EUT A;  4EJN A;  4XDC A;  3VRB B;  2KOX A;  1E8X A;  2M56 B;  2RDB C;  3ZRF A;  3KLS X;  2GCL A;  3MP9 A;  5JH5 C;  4JWS C;  1ZC4 B;  4IWQ A;  3ENE A;  1SGH A;  2WXG A;  3KUD B;  1UEF A;  1E0Z A;  3OJ3 A;  4P1B C;  3DVN V;  3NVZ A;  5J3Q A;  4OZB A;  1YNT E;  5FR6 A;  3APF A;  2YEP B;  3VH4 B;  4ANW A;  4ILH A;  4QAY A;  4JKF A;  2MLB A;  3R8B A;  3TUO A;  2ELB A;  3NZS A;  1BML C;  1BT0 A;  2V76 A;  1MPH A;  2ZVO A;  4A6Q A;  2YT1 A;  4HAW B;  3SEB A;  2CB8 A;  1N63 A;  2YLM A;  4IOY X;  2ZJD A;  1UPQ A;  3PT2 B;  2V9H A;  2YT0 A;  3DHG C;  1E90 A;  3T8M A;  5IRS A;  2LVP A;  2JU6 X;  5LG4 B;  4GSW A;  4BKS D;  3M3J A;  1C77 A;  4FJV B;  3SDL C;  4DX9 0;  2LHD A;  2Y5C A;  4A6K A;  3QAQ A;  2BGF A;  2G35 A;  4XGA B;  3RNB C;  3VTV A;  2BW2 A;  1R4M B;  4P7I A;  4MM3 A;  4JIO U;  4A5K A;  2NR2 A;  1FNV A;  2BCJ A;  1L4D B;  1MK9 B;  2IO1 B;  2LOX A;  1XCG A;  5DHA B;  4I6P A;  1C76 A;  1U5D A;  2C7N B;  3QCA A;  1NEN B;  4TYZ A;  1JWM D;  2MJD A;  2KWV B;  4N9F 4;  5DH9 B;  2KKC A;  3TBL D;  5IP4 D;  4RGT A;  4MEL A;  5C23 A;  5H92 C;  4WJQ A;  2NTT A;  2BYT A;  2YRY A;  3ECI A;  1NI3 A;  5DPT A;  2HDE A;  3DDC B;  3ZVR A;  2Z0P A;  1OTR B;  2QHO A;  3BYT B;  2DLB A;  4OVZ A;  2MW5 A;  1DYN A;  4W9G A;  1EU3 A;  1UH6 A;  1ISN A;  4XWX A;  2IJ0 A;  3DBL I;  4FHK A;  1CK1 A;  4IUM B;  3M95 A;  1ZOY B;  4GGQ A;  2COA A;  5FI1 A;  5LON B;  1F2R I;  1JRO A;  1P98 A;  1SIF A;  3P2B A;  5G5G A;  3N1Z C;  2GCJ A;  2DNF A;  3TEW A;  2IYD B;  3A98 B;  1LB1 A;  2KDM A;  1ZXI A;  2LRU A;  4JPS A;  2P0F A;  2WDR B;  4FAD A;  2FJ9 A;  3ZNH B;  2ON8 A;  2PVG C;  4URK A;  3O96 A;  4ZRK A;  3U30 A;  5H8Y E;  3HRD D;  3NSU A;  5HHD G;  4D0N B;  3NW8 A;  1N62 A;  1C78 A;  4IW0 A;  1XD4 A;  1WSP A;  1ZW7 A;  2R2Q A;  1H4R A;  1JCK B;  4HPP A;  3DXD A;  3L13 A;  2REX A;  5JHA A;  1LM8 B;  4HPL B;  1P7E A;  3U7D A;  5EDS A;  3GE8 C;  5D2M B;  2D9X A;  1GAQ B;  1JML A;  1HE8 A;  4AQ7 A;  4HK2 A;  2ZEQ A;  3T3O A;  4A3P A;  4BKS A;  1TS2 A;  1Q10 A;  1NVL A;  1WR1 A;  2WXR A;  3DBR I;  4MEM A;  3J9C A;  3C8Y A;  1ZYI A;  5AZG A;  5JHB A;  1R4N I;  1E8Y A;  1PDX A;  5TR5 A;  1AWD A;  3PS6 A;  2MBE A;  2H7D A;  3AE3 B;  4GDL A;  1FB8 A;  1WM2 A;  2IGG A;  3ML8 A;  4K2O A;  5C6R A;  2QKL A;  5EE9 A;  4N58 A;  3P4Q B;  2QMT A;  2KMM A;  1V8C A;  4MY6 A;  2K25 A;  2Y8F A;  5AZF A;  1UWX A;  4F7Z A;  1T77 A;  3NVW A;  2M14 A;  3Q8C A;  2V4L A;  2GUM A;  4HWI B;  3A4S C;  3VUW A;  4MH0 E;  2D11 A;  2GBJ A;  2AWT A;  3AED B;  2KD0 A;  3ZIM A;  2V3S A;  2MBB B;  3DPD A;  5GOW B;  4LDT D;  1UUP A;  2CJO A;  4II3 B;  4WQM A;  3H1U A;  3B2F A;  3P4R B;  4EMO A;  1K52 A;  1SBB B;  4PK1 A;  2MP2 B;  3V5W A;  3DBS A;  3AE8 B;  1L5P A;  4DQO C;  4MH8 A;  1V49 A;  1C9F A;  1I4Q A;  4ZRP A;  4GNK B;  3RUI B;  1VJK A;  1GB1 A;  2M19 A;  2JF5 A;  1TKG A;  2WXH A;  4AJY B;  2JRI B;  2AQ2 B;  1STE A;  1ZKH A;  1MHH E;  2NVU I;  1TKY A;  3U2S C;  2Y3A A;  4R3D A;  1M7E A;  2WXJ A;  2J42 A;  1RM6 C;  3EC8 A;  1HB6 A;  3N9Y C;  4G11 A;  2DN6 A;  1Q0W B;  2AYO B;  4HAV B;  1IBX B;  3V60 A;  2N0S B;  1WXA A;  2WXN A;  4M8M A;  3DBH B;  1M7R A;  4WAF A;  3W9C B;  1WXQ A;  3VXW A;  4ZRJ A;  4M0W A;  3LYY A;  3Q6B A;  2ROZ B;  1FIQ A;  2MRP A;  4HB3 B;  2LGI A;  2MHJ A;  1WYG A;  2DLW A;  2RR9 A;  2WDV B;  4WVF B;  2PEA A;  3ZQ4 A;  1P7F A;  5HE0 A;  2K6Q A;  3I63 C;  3BZD B;  1D3Z A;  2MBQ A;  4Q2J A;  1TGZ B;  3SO6 A;  1ET6 A;  4KDL B;  3H8H A;  2VKI A;  3DWM A;  2KAC A;  2K22 A;  2FDQ A;  4YON A;  1CQV A;  2WXK A;  4O1N A;  4WSF A;  5IA7 A;  2GBN A;  3AEE B;  4KSL C;  3AE7 B;  5D3Y A;  5BMG A;  4P16 A;  2BYV E;  2MSE D;  2JX5 A;  1JDE A;  4UDU C;  3O65 B;  1I4R A;  1N5X A;  4C56 C;  1NEK B;  2JXX A;  3DQV A;  1XOD A;  1QOA A;  1OQY A;  1FHX A;  1NU2 A;  2WS3 B;  2BKR B;  2K49 A;  1RWS A;  1R4N B;  2W82 A;  1J7C A;  2D9V A;  1TJE A;  3AJ4 A;  1XLN A;  1DOX A;  1AQC A;  2J59 M;  2WU2 B;  2N9E B;  4GIV A;  1YN5 A;  2M17 A;  2BYE A;  3DVG Y;  4I6N B;  1WY8 A;  2UVM A;  3Q3F A;  5AUI A;  1M94 A;  5BYQ A;  2GBM A;  3RNG C;  2DHZ A;  2HD5 B;  2K1F A;  1P1A A;  4QXA B;  2DBY A;  2KNB A;  2RMM A;  3ETR A;  1VLB A;  4KSK C;  1MG8 A;  2A4Z A;  3PZ7 A;  3ZNI D;  2DHJ A;  1U2B A;  2CR5 A;  4KAX B;  4JKH A;  4FLH A;  2RNR B;  2KDF B;  1GJZ A;  1OQR A;  3FP5 A;  2C7H A;  1PLS A;  2K8E A;  2RGN B;  1WE6 A;  3N1Y C;  3G9W A;  3NWA A;  2IY1 B;  4RM9 A;  4LCD E;  2GS0 A;  1MJD A;  2WDT B;  4KX6 B;  2G3Q B;  4ZRQ A;  2O6V D;  2LI5 A;  3VTU A;  3T3N A;  3AEA B;  4IM0 A;  2DKQ A;  5JHH A;  2JWU A;  2LJI A;  3PSE B;  1AN8 A;  2SEB D;  4WJ7 A;  2DX5 B;  2UZR A;  1HTO A;  2KFK B;  4PS8 A;  2R82 A;  3RNF C;  2WXM A;  2FJU B;  1YX5 B;  2PLP A;  3GE3 C;  5DPS A;  2MWS B;  2ZPN A;  3WAN A;  2RLO A;  1UWM A;  4N59 A;  2AX5 A;  3UIP B;  2CHW A;  1BUI C;  3KY9 A;  5FK9 C;  1KRH A;  5E6J A;  3UIN B;  2I1J A;  1R7S A;  1Z5S B;  4FJY A;  1T0Q C;  1SJE D;  2G1E A;  2WGS A;  1N5W A;  3R2I A;  3L08 A;  2LGX A;  5FKA C;  4K17 A;  2HTH B;  1GUA B;  4IM3 A;  2G45 B;  2GB1 A;  3AH7 A;  2ICI A;  2L1A A;  4IAP A;  1E6E B;  3DWG C;  1SE4 A;  3V61 A;  2JRH A;  1ZDV A;  1XKE A;  1FGY A;  3P42 A;  4RF1 A;  1HB8 A;  1TKE A;  3AE2 B;  1Y19 B;  4CSQ A;  4X57 B;  4NY0 A;  1MIX A;  4FA6 A;  2IDY A;  5J3Y A;  4PYU A;  3ZNG C;  1DOI A;  3VR9 B;  2RQ1 A;  1L6U A;  1NI2 A;  2KAN A;  2QC8 A;  1XX0 A;  2X18 A;  2LWP A;  3WAL A;  1ZVR A;  1KH0 A;  4CO7 A;  5L95 C;  4IKG A;  3ZGZ A;  2KJ6 A;  2FCN A;  2Q13 A;  4M00 A;  2Y7B A;  4F7U P;  1JWA D;  4DDI D;  3DCG A;  1R4M I;  3S2A A;  1YOV B;  4S0R A;  2KVR A;  2JUO A;  4K81 A;  4ASW C;  3P1M A;  1Q67 A;  1VZ7 A;  1L7Y A;  1HTQ A;  1U27 A;  3NUH B;  1F9J A;  4EZL A;  1X1F A;  2K6D B;  4Y94 A;  2CS4 A;  2LGS A;  2GI9 A;  3DXC A;  3H9D A;  2DHK A;  2J52 A;  4A6F A;  2CHZ A;  2RVB B;  4AJW A;  3FVC A;  3LDZ E;  2LGD A;  3RT3 B;  3CXB B;  4LNF A;  1L0Y B;  2DYM A;  3FAH A;  4GZU A;  2LHE A;  2PJH A;  1JRU A;  1IP9 A;  1B9R A;  5CX3 A;  1LXD A;  4XE0 A;  1A5R A;  1C4C A;  3HSA A;  5FR3 A;  5EE1 A;  4K3B A;  1UGM A;  2Z0E B;  1F2R C;  3N7C A;  1PGX A;  2W2W A;  4H2A A;  4OVU A;  5J17 A;  3KZ1 A;  5EFX A;  2WQY B;  4YTN B;  1E10 A;  5E6P A;  4DHJ B;  4W9J A;  4MSM B;  3PPA A;  3LXF A;  2JZZ A;  3DOW A;  2ONQ A;  2UZS A;  2VRW B;  2CU3 A;  3FIL B;  4WWO A;  1YD8 U;  3AI5 A;  2Q5W D;  1C4P A;  2DWQ A;  3HIZ A;  3B0A A;  4IOI E;  2TSS A;  1V1P B;  1YMH E;  2DAF A;  3SYX A;  2MP2 A;  2W54 A;  2NPT A;  2AL3 A;  3PHW B;  1WGR A;  1J8C A;  1YQ4 B;  1GC7 A;  3OG5 A;  3MPX A;  3EA6 A;  2YSZ A;  3M62 B;  1L0V B;  4E3C A;  5CHV C;  3RUL A;  3SBT A;  3TVV A;  3BIN A;  1RJ2 A;  4DX8 A;  3A33 B;  3QWZ B;  2O2V B;  2C5L C;  4WUR A;  4JKG A;  4HB4 B;  4P6V F;  4L23 A;  4LJO B;  2X0S A;  2LZ6 A;  2YS5 A;  2L00 B;  1SE3 A;  3HQC A;  5I2M A;  1VBG A;  3AXC A;  3KQ4 A;  4DHZ B;  3H7P B;  4XWT A;  3E9O A;  1KZ7 A;  2LXA A;  4DXA B;  2C9W B;  1WJ1 A;  2DHI A;  3Q3O C;  3LB8 C;  2H88 B;  3FSS A;  4CHK A;  1RRP B;  1QOF A;  1FD6 A;  3V62 A;  3R2T A;  4RM8 A;  4AUQ C;  1VR9 A;  2GLS A;  3ZXR A;  3GP7 A;  4F7G A;  4NQK E;  4C7Y A;  4IG7 B;  3HW2 B;  2KUQ A;  2Z8L A;  2DAJ A;  1V97 A;  4JWU C;  1H8C A;  3MC9 A;  3L0W B;  1Y8R C;  1WIA A;  2RSU A;  2LVO A;  4NZL B;  2JP2 A;  1WJ6 A;  2KX3 A;  1JWB D;  1TIF A;  1WXM A;  4DXG A;  3AU5 A;  5MPO A;  1ET9 A;  2UYZ B;  4US9 A;  1T0R C;  4NJC A;  3QJZ A;  4BKG A;  2Z59 A;  1PGB A;  1XQQ A;  4JK7 A;  3IHP C;  3JSV A;  3QC8 B;  4C4V A;  1AAR A;  4BOZ B;  1SB3 C;  1C4A A;  1XO3 A;  2OTX A;  4G0N B;  1UBQ A;  2KWC A;  2NBV B;  1W1H A;  4MJS A;  1J0W A;  3RN9 C;  2WX0 A;  1DDW A;  3V05 A;  4TV3 A;  4QJ4 B;  5HE3 A;  1EU4 A;  2QSD A;  3A4R A;  4EFO A;  2I38 A;  4FN2 A;  4CQN A;  1D5M C;  2PW9 A;  1LW3 A;  4YTP B;  1I2H A;  1EF5 A;  3SR6 A;  3IVF A;  1FXA A;  2RD0 A;  3VUY A;  2L76 A;  2DZI A;  1U5F A;  3AEB B;  1LGR A;  4ZDV A;  2KZR A;  1WGQ A;  3PVW A;  2EJ8 A;  2WDQ B;  3CWI A;  2D3A A;  3ABV B;  4OZA A;  2LXC A;  3ZUN A;  2UWQ A;  1WGD A;  1RAX A;  3NHE B;  3PLV A;  4JKA A;  1HZ5 A;  1TZ1 A;  4RGN A;  1QOB A;  2D3G A;  4RCO A;  2LUE A;  1FCL A;  4TSS A;  3VVW B;  2D3C A;  1V5U A;  1P6S A;  2RPQ A;  1QLB B;  1D5X C;  2L2I A;  1E7U A;  2INC C;  4S17 A;  3PVL A;  3VDZ A;  3KYC D;  2KQ4 X;  1J19 A;  1DIK A;  2J7Q B;  1T3Q A;  3AUL A;  4NQL B;  2FNJ B;  4GLS C;  1U29 A;  2WNM A;  1WZ0 A;  4IC7 B;  3A9J B;  2D2Q A;  4JGH B;  1JW9 D;  3TW1 A;  3VTW A;  1UNQ A;  4KIK B;  4WQO B;  3TL5 A;  3DBH I;  3AB5 A;  2N7E A;  3WAO A;  4MSQ B;  4W9L A;  2N23 A;  2XK5 B;  3RZF A;  4A9A A;  2QIL A;  3A9K B;  3MFG A;  3HVD A;  1TJ6 A;  1SHC A;  5DI9 B;  2Y5B B;  3MDB C;  1RLF A;  2KC1 A;  4WWP A;  2JY6 A;  1J7A A;  2KVZ A;  3NG0 A;  5D6J B;  1WGU A;  3B9J A;  3CSF A;  3BJI A;  1WYW B;  3AEC B;  3NWF A;  4BBK A;  4KV2 A;  5I2S A;  1EF1 A;  3PZD A;  3Q2A C;  3TEX A;  1WVH A;  1GNU A;  2BS4 B;  5DHF B;  2W2X D;  3C19 A;  2PIA A;  2W55 A;  4F8C B;  2D9Z A;  1FAO A;  2NMB A;  4GDK B;  2JXT A;  2D4Q A;  2BB5 A;  1WMH A;  5D27 A;  2PKO A;  2P0H A;  1G6J A;  2P0D A;  3C0R B;  4M8N A;  4YSY B;  4W9C A;  3A1Q A;  4RFB A;  3RMK C;  3L16 A;  4TQ0 A;  3PRP B;  3W1S C;  1NDD A;  4JK8 A;  2WWZ A;  2H7E A;  3TO1 A;  1ENF A;  1V81 A;  3I9V 1;  2V1Y A;  3BK1 A;  2QKM A;  3D8D A;  1F1H A;  2MQJ A;  2LFI A;  3NY5 A;  4HDQ A;  4BAX A;  3SHQ A;  2DZM A;  3KWL A;  1XR0 B;  3UZT A;  4JK9 A;  1V6E A;  2JWZ A;  1B55 A;  2IY0 B;  1WXS A;  3PVU A;  1M4V A;  4GN1 A;  1E9M A;  3IAM 1;  3SNH A;  1UF0 A;  2M0X A;  4K1R B;  2X38 A;  1PFD A;  5C79 A;  4NJ7 A;  3A58 A;  1VZ6 A;  5BO4 B;  2KTR B;  1VZ8 A;  1WI1 A;  2IPK D;  2IO0 B;  3ML4 A;  2W3S A;  1WXV A;  3QQ8 B;  1KI1 B;  1P3R A;  2ZCB A;  2W2X C;  1RFA A;  4M02 A;  4E71 A;  1U5E A;  4QJ3 B;  4RF0 A;  1CMX B;  2KO3 A;  3PSC A;  2FBW B;  2KDE B;  1TQZ A;  4HPM B;  1SE9 A;  1FXT B;  2DA0 A;  1YN3 A;  2LG1 A;  3Q14 C;  5CTR C;  1E8W A;  2BWF A;  2N1V A;  3W1S A;  3ODX A;  4LK0 M;  1PUT A;  1EUV B;  4E74 A;  1HXY D;  3VUX A;  2GBK A;  1WH3 A;  1WGY A;  1HZ6 A;  2FID A;  4GOC A;  4HAU B;  2K2J A;  1C1Y B;  3RNA C;  4RGM A;  2JYE A;  3EFU A;  3ZJU A;  3APC A;  3W5V B;  3RCP A;  5CLQ B;  2EEL A;  1TS4 A;  1ZP0 B;  3KW5 B;  2Z14 A;  1X1M A;  2DTC A;  4JLC A;  5DPW A;  2Z0D B;  3CIR B;  1C79 A;  4KHB B;  2KXJ A;  3RPF C;  3B2G A;  5LLI A;  1ZM0 A;  3OWE B;  1F52 A;  3WCQ A;  5KCV A;  3LJ3 A;  4MGY E;  5DPR A;  2KLC A;  4HCP B;  3TEY A;  4II2 B;  1DYQ A;  2PVO D;  4YSX B;  4WIP A;  5G2N A;  2Z13 A;  5KHQ A;  4REZ A;  4ZHO A;  1ZXH A;  2X8X X;  3PRM B;  4A90 A;  1V86 A;  2RRF A;  5LXI B;  4CHM A;  4W9I A;  2L1C A;  1WRI A;  3KUZ A;  5D7G A;  3FLV A;  3ZDT A;  5D94 A;  4LNI A;  4XDD A;  3ZYY X;  2CY4 A;  4H8S A;  3BYY B;  4BKT A;  4MGK E;  1MI0 A;  1V1P A;  2Z0Q A;  1MAI A;  2MH7 A;  5GXG B;  4B6H A;  2BPS A;  2BF8 B;  2AEH A;  4US8 A;  2NBU A;  1W1D A;  1FNU A;  2XN9 C;  3NVV A;  3KRX A;  2NCN A;  1XD3 B;  3HIE A;  1MIZ B;  4MT5 A;  4A55 A;  3SU8 X;  1LO5 D;  3ZXV A;  1OQN A;  4C0A A;  3BVM A;  3RYT A;  3FKY A;  3FEH A;  1WE7 A;  3ML9 A;  4CHJ A;  4ICU A;  3UIO B;  2N1W A;  1QIL A;  1S3S G;  2FIF A;  4AP4 C;  3ODO A;  4W9H A;  4BBN C;  3OAW A;  5G55 A;  2CHX A;  4DDG D;  2M4N A;  3Q3M C;  2J0J A;  2N0Y A;  1DRO A;  5J3T A;  3QA8 A;  4LTU A;  2FCS A;  3ZJV A;  2E2X A;  1FXI A;  3AEG B;  1KFY B;  2LMC A;  1T6B X;  4MM3 B;  1AW7 A;  2DFK A;  2V0G A;  3CF6 E;  5DCN A;  3OJ4 B;  3PO0 A;  5BMI A;  1F77 A;  1I42 A;  2COC A;  3GS2 A;  4MGI E;  4HRS A;  3E9L A;  1ZC3 B;  1IPG A;  5EE0 A;  5LXH A;  3IFW B;  3AN1 A;  4K7W A;  1FHO A;  4J3O D;  2MJE A;  4DXF A;  1MHX A;  1KC7 A;  1WWT A;  2VZK B;  2KJH B;  4NSW A;  1BAK A;  3Q8F A;  4BZA A;  2KDI A;  4NJ6 A;  2K8B A;  5IN7 A;  4HLE A;  5JP4 A;  4MGZ E;  5CHW A;  1MFW A;  2ZCC A;  1TS5 A;  3VH3 B;  2GJY A;  4OSN A;  3WIM A;  1RRB A;  4YL8 A;  4EKU A;  3D8E A;  2QCZ A;  4KZC A;  4W9D A;  4WWM A;  2ADZ A;  3B1L X;  2FCQ A;  1LQB A;  1XCT L;  1IGD A;  3SFD B;  2HJ8 A;  3DHI C;  4K3C A;  2BYF A;  3RFZ B;  2OHF A;  2MFQ A;  5EE3 A;  4BVU C;  3L4P A;  4G3X B;  3VAW A;  2D07 B;  1U5G A;  4KVG B;  1AYF A;  1D4B A;  1I4X A;  1KM7 A;  4FXC A;  5HKH A;  3A8P A;  1TT5 B;  3V3X A;  4F1S A;  3MHS D;  5JLJ B;  2V3P A;  3ZTC A;  1WG7 A;  5IAA C;  3NJT A;  3NS8 A;  1V61 A;  2MJ3 A;  3FC4 A;  3K9O B;  4B0E A;  1AWE A;  4HVB A;  3PTF C;  3VFK A;  5LNK 1;  3N20 C;  2DZK A;  1NYR A;  4HHV A;  3PG7 A;  4ANU A;  3U8Z A;  2M38 A;  2AQ1 B;  3GZN B;  1PMS A;  5D3W A;  4L2Y A;  2XK5 A;  1SIJ A;  3VRA B;  3B08 A;  2PTL A;  1MI1 A;  2XNA C;  3PRE A;  4AS1 A;  4L6E A;  1WJU A;  3N1X C;  3NOB A;  4ITK A;  2K0P A;  2K8H A;  5E6O A;  1WGH A;  3HM3 A;  3D8F A;  4WJN A;  4DIX A;  1N61 A;  3Q69 A;  1DDV A;  4ACF A;  1KLV A;  3RCZ A;  2KIE A;  2K8C A;  2WXP A;  3L17 A;  1TTN A;  4GDL B;  3URY A;  3DXE A;  3JW0 X;  1E7P B;  2HE7 A;  2KMA A;  2I5F A;  4PNK A;  3AMZ A;  4I6L B;  1KTK A;  2N9X A;  3KRW A;  4GDK A;  1V88 A;  2IGH A;  1A70 A;  4WWN A;  2KYW A;  3P6A A;  2FUH B;  2NTS A;  2OED A;  1XF5 L;  1D6E C;  3NWD A;  1J0G A;  2H89 B;  4YSZ B;  2I1K A;  1E5W A;  2VSZ A;  2N9K A;  2OQB A;  4HCN B;  2M0A A;  2ZKM X;  2G4S A;  2I2Y A;  2K39 A;  2B3A A;  2FE8 A;  4LLG M;  3AU4 A;  1NYQ A;  1U4A A;  3NZ3 A;  2B76 B;  4A20 A;  4HXD A;  1EAZ A;  2DKP A;  2RPV A;  1HQR D;  3PRZ A;  3X23 A;  2YS3 A;  4DHZ E;  1WF9 A;  2Y5P A;  4AOF A;  1TS3 A;  1L4Z B;  2IO2 B;  2J4X A;  2KX0 A;  3ENB A;  1W1G A;  3RNE C;  4RGO S;  2C7M B;  4JL9 A;  2Z0O A;  2IGD A;  2KGX B;  2HTM E;  1XLQ A;  1K51 A;  5L81 A;  1HEZ E;  2N9P C;  4TMA B;  1SE2 A;  1BTK A;  1BXT A;  1YJJ A;  1ZE3 D;  3SUZ A;  4YWG G;  5IOI A;  1MKE A;  4IDI A;  2VRR B;  1BWN A;  4K2P A;  1I35 A;  2L52 A;  3V6E B;  2K9X A;  5D3I B;  5D3D A;  2WXF A;  1DDM A;  1GG3 A;  4BOS C;  1GPX A;  2WXL A;  1MPE A;  4M0W B;  1QF6 A;  2R61 A;  2CKH B;  2LKO A;  2DEN B;  4FJZ A;  2P8V A;  3T9L A;  2EMS A;  3DVG X;  3E9S A;  2KWD A;  1P3Q U;  2G9H D;  1QT9 A;  1V89 A;  4CYE A;  1WM3 A;  2LEK A;  5C1Z A;  2MX2 A;  1WJM A;  2MCN B;  2L3Z A;  2KFJ A;  4KHB A;  1OEY J;  2BBC A;  3VIA A;  3IXS A;  1IBX A;  2BS3 B;  4K7S A;  3ZO5 B;  1TY2 A;  1KOT A;  4MT7 A;  3MHZ A;  3H7S A;  4NAW B;  3EEC A;  4OVV A;  3VR8 B;  4NPN A;  1V1O A;  3TJP A;  5IKC M;  2RUK B;  1JWS D;  3QAR A;  4EEW A;  4NAM A;  1JQ4 A;  2QIE B;  5BMH A;  3MJ5 A;  2MDX A;  1K50 A;  4TUU A;  2BQQ A;  1X05 A;  3HUI A;  2KK8 A;  5HFY A;  4Z2N A;  2L8J A;  4GOU A;  1T5X D;  3QBV B;  3M63 B;  5HE1 A;  4B9K A;  2KR0 A;  2DZJ A;  3MC0 B;  3HM6 X;  5KQ4 A;  4A6H A;  1OMW A;  3APD A;  2R0D A;  2KLG A;  4RMA A;  3HK0 A;  1FRR A;  2N4F A;  1RYJ A;  3ALB A;  1V5T A;  2KN5 A;  1ESF A;  1E7V A;  4HJK A;  3SBG A;  1FFV A;  4HAT B;  4AWJ A;  2WXO A;  4LDT B;  3H6N A;  2WU5 B;  2K00 A;  2ZZP B;  3ZRC A;  3AE1 B;  1WGG A;  4Z2M B;  2IO3 B;  4DK5 A;  4C7Z A;  2KN4 A;  2K3U A;  1I7A A;  3U12 A;  1WI0 A;  2RGF A;  5GMV A;  4KGR A;  3KSY A;  2GRI A;  2J53 A;  2PPH A;  4XYC A;  1XEE A;  2DYN A;  3BWU D;  3HVZ A;  1NTY A;  1TBE A;  4W9E A;  3IBE A;  2VH1 A;  2YVC A;  1FOE A;  3NRZ A;  4JKC A;  4L1B A;  4KHA A;  2LJ5 A;  1WZ3 A;  2Y8G A;  2QEJ C;  5AUK A;  4PT5 A;  4W9K A;  5C5B B;  1UGJ A;  3WAM A;  2KHW B;  1IRS A;  1FNW A;  3TIX A;  4K7U A;  3N32 A;  3W5U B;  1PYW D;  3ZLZ A;  3M1I B;  5IJM A;  2GBR A;  2LUM A;  2KIG A;  2KQ7 A;  2KT7 A;  5M4Y B;  1KBL A;  2N7J A;  1S1Q B;  2HRJ A;  2V3N A;  3GYO A;  4KGS A;  2OJR A;  4KDI C;  1J7B A;  3UQA A;  2PE6 B;  2D9W A;  1UNS A;  2XEW A;  4GB9 A;  1WR6 E;  1QQR A;  3EPY A;  2G4D B;  1EO6 A;  3CIK A;  2N9L A;  1WX9 A;  4KKI A;  1X86 A;  1P0R A;  1ROE A;  2BVC A;  3IG3 A;  2M8S A;  2KQS A;  3R3M A;  4GMX B;  1L2N A;  1ZPS A;  2CY5 A;  1K53 A;  3PV1 A;  3Q3J A;  2INP E;  1X11 A;  3BII D;  4FBJ B;  5G5H A;  1FMA D;  4WAA A;  2DX5 A;  2WH5 A;  2KFK A;  2RDG A;  1UEL A;  3KH0 A;  3ZVV A;  3BVZ A;  3JYU A;  4DHJ D;  1GB4 A;  2PZ1 A;  3ULC A;  1OEY A;  3NVY A;  4B0M A;  2FJL A;  2UU7 A;  3QK0 A;  3VHT C;  2INN E;  1NBF C;  3WYF B;  2BB6 A;  1V5P A;  3K9P B;  1KJT A;  2KMC A;  2E6X A;  4ZHP A;  3NS1 A;  5C3J B;  4OW0 A;  2ABD A;  4F7H A;  3OHM B;  2PMV A;  4A3O A;  2MEK A;  2HTH A;  2LBB A;  1D5Z C;  4ARC A;  1KLU D;  1EWC A;  3ZDM C;  4L1R A;  1T0S C;  1QKZ A;  4TQ1 A;  3R66 C;  2MBH A;  4JQW C;  2WXQ A;  4EE2 A;  2PE9 A;  3P4P B;  3AE6 B;  1XLO A;  4A6F B; 
#chains in the Genus database with same CATH homology
 3PLU A;  1K8R B;  1YJ1 A;  2A5U A;  2JPH A;  1NTI A;  5J2R A;  4ICV A;  4GPT B;  1Q5W B;  3CST A;  1TXD A;  2O6V B;  3MTN B;  2YF0 A;  4DBB A;  5J18 A;  4HAZ B;  5HE2 A;  1MK7 B;  2KTF A;  3PGE A;  2DX1 A;  5D3V A;  3WA0 A;  1YX6 B;  2BWE S;  2CRF A;  2GOW A;  4B95 A;  2BKF A;  2KUP A;  4IM2 A;  1ACA A;  2MBO A;  2LOZ A;  2I5C A;  1KZG A;  3T06 A;  4W9F A;  2NPT B;  3RZW C;  4EOY A;  2IBI B;  2J0M A;  1WFY A;  4PYZ A;  3ZKJ C;  3L54 A;  4JKE A;  2FCM A;  5JVL A;  3TFM A;  4JKG B;  3KUC B;  3UF8 A;  2EKE C;  3HHM A;  4IFS A;  3QWM A;  4WJO A;  2GMI C;  1YIW A;  4KZ0 A;  3NZU A;  4FUL A;  3GZN I;  2DYB A;  5JZE B;  2ZPY A;  1WJ4 A;  2COD A;  1QQG A;  3N30 A;  2ROV A;  3X0W A;  2K2U A;  2D9Y A;  2OOB B;  2L05 A;  3WAP A;  2D10 A;  3KYD D;  4HAX B;  2KDB A;  2FAZ A;  2LUL A;  4HDO A;  3L10 B;  2YS1 A;  1BTN A;  4ANV A;  2JT4 B;  2O2V A;  4GXB A;  4BBN F;  2Z59 B;  1QZE A;  4WJP A;  3ODW A;  3JSV B;  4GMV A;  3H7P A;  4MJS B;  2ZNV B;  3SV1 A;  1PFJ A;  2ZVN A;  3P7Z A;  1X1G A;  4NAW A;  3D32 A;  1Z87 A;  2R2O A;  1QC6 A;  2LRW A;  4EZK A;  2DYQ A;  3UGB B;  3KVF B;  3ONS A;  1C3T A;  1VBH A;  4ILJ A;  3QX1 A;  3PHX B;  3OLM D;  3R7R A;  5D3X A;  2KWU B;  4HAY B;  2LAS A;  2LYD A;  4GU2 A;  2EC1 A;  3QIJ A;  2LGY A;  4ANX A;  2MA9 B;  2L0T A;  1IYF A;  2KC2 A;  3SD5 A;  3UQB A;  4HB2 B;  4XC2 A;  2ELA A;  2CQU A;  2R09 A;  5CHF A;  5E6N A;  3LJU X;  3TCA A;  4PQ0 A;  3FM8 C;  3ULB A;  1UD7 A;  1VD2 A;  3R7Q A;  5LOP B;  5C5B A;  1EVH A;  2IYB A;  1NTV A;  1Y5O A;  4LJP B;  1GC6 A;  2NS5 A;  3CMM B;  5JHG A;  4MDK E;  1WX7 A;  1WJN A;  2JZ3 B;  4J6I A;  1DBH A;  3PEG A;  2L0F A;  3I3T B;  5FI0 A;  2J0K A;  3A9J A;  5KHO A;  4KHO A;  2COP A;  4KIK A;  1WMH B;  1YQB A;  4ZRI A;  3RD2 A;  5C16 A;  3A9K A;  1GGO A;  3GYP A;  1ZGU B;  2EMT A;  5CLL B;  2XBB C;  3A1Q B;  1V80 A;  1Z2M A;  1LFD A;  3BY4 B;  2MKR A;  5AEK B;  2WYQ A;  4MK0 A;  3ZTD A;  4PS3 A;  1HBK A;  3ZW3 A;  2KCJ A;  5L83 A;  3F0W A;  2N7D A;  1FGZ A;  2COF A;  2L7R A;  2AL6 A;  4IWP A;  1V9J A;  2XQN M;  1PQS A;  2WX1 A;  4DWF A;  3W1Y A;  1K5G B;  3OAN A;  1H10 A;  1XT9 B;  3ZNZ B;  2DYO A;  1UPR A;  4NNJ B;  4ILG B;  4DBG A;  5DIF B;  1N3H A;  2LVQ A;  1K5D B;  4EZJ A;  5AZH A;  1P5T A;  1EGX A;  1Q1O A;  2LD9 A;  1V2Y A;  4JKB A;  3F5R A;  1E8Z A;  4TKN A;  1T0Y A;  2JVC A;  3A8Q A;  1ST7 A;  2NBW B;  4G50 A;  4ZYN A;  1VCB A;  4FHJ A;  1FHW A;  2CAY A;  2IZV B;  1P9D U;  4PS7 A;  2ASQ A;  1V5O A;  2KTR A;  2C60 A;  1UZX B;  1ZSQ A;  4XX5 A;  2IFS A;  2M1M A;  3JVZ X;  3GOE A;  2DIK A;  2O6V A;  3EHV A;  2W9N A;  4BFR A;  3N3K B;  1OY2 A;  1V5M A;  3QHT A;  4JKD A;  5KQ1 A;  2NZ8 B;  2KJR A;  1WX8 A;  1WRD B;  2RSG A;  1UBI A;  3E66 A;  1UNR A;  4HB0 B;  3VOQ A;  1UNP A;  3VQI A;  3E9P A;  4XZ4 A;  3MJW A;  2CU1 A;  3PP2 A;  3DVN U;  3V6C B;  4B6W A;  1OGW A;  2MWN B;  4IWO A;  3TMP B;  2ZNV C;  4EUT A;  4EJN A;  2KOX A;  1E8X A;  3ZRF A;  2GCL A;  5JH5 C;  1ZC4 B;  4IWQ A;  3ENE A;  1SGH A;  3KUD B;  1UEF A;  3OJ3 A;  3DVN V;  5J3Q A;  5FR6 A;  3APF A;  3VH4 B;  4ANW A;  4ILH A;  4JKF A;  2MLB A;  2ELB A;  3NZS A;  1BT0 A;  2V76 A;  1MPH A;  2ZVO A;  2YT1 A;  4HAW B;  2CB8 A;  2YLM A;  4IOY X;  2ZJD A;  1UPQ A;  3PT2 B;  2YT0 A;  1E90 A;  3T8M A;  2LVP A;  4GSW A;  4BKS D;  3M3J A;  4FJV B;  3SDL C;  4DX9 0;  4A6K A;  3QAQ A;  2BGF A;  2G35 A;  3VTV A;  4P7I A;  4MM3 A;  4JIO U;  4A5K A;  2NR2 A;  2BCJ A;  1MK9 B;  2IO1 B;  2LOX A;  1XCG A;  5DHA B;  4I6P A;  1U5D A;  2C7N B;  3QCA A;  4TYZ A;  2KWV B;  4N9F 4;  5DH9 B;  2KKC A;  3TBL D;  4MEL A;  5C23 A;  4WJQ A;  2YRY A;  3ECI A;  5DPT A;  3DDC B;  3ZVR A;  2Z0P A;  1OTR B;  2QHO A;  2MW5 A;  1DYN A;  4W9G A;  1UH6 A;  1ISN A;  4XWX A;  3DBL I;  4FHK A;  4IUM B;  3M95 A;  4GGQ A;  2COA A;  5FI1 A;  5LON B;  1P98 A;  1SIF A;  3P2B A;  2GCJ A;  2IYD B;  3A98 B;  1LB1 A;  2LRU A;  2P0F A;  4FAD A;  2FJ9 A;  3ZNH B;  4URK A;  3O96 A;  4ZRK A;  3U30 A;  3NSU A;  4D0N B;  4IW0 A;  1XD4 A;  1ZW7 A;  2R2Q A;  1H4R A;  3DXD A;  3L13 A;  2REX A;  5JHA A;  1LM8 B;  4HPL B;  3U7D A;  5EDS A;  5D2M B;  2D9X A;  1HE8 A;  4HK2 A;  2ZEQ A;  4A3P A;  4BKS A;  1WR1 A;  1NVL A;  3DBR I;  4MEM A;  5AZG A;  5JHB A;  1R4N I;  1E8Y A;  5TR5 A;  3PS6 A;  2MBE A;  2H7D A;  4GDL A;  1FB8 A;  1WM2 A;  3ML8 A;  4K2O A;  5C6R A;  2QKL A;  4MY6 A;  2K25 A;  2Y8F A;  5AZF A;  4F7Z A;  2M14 A;  2V4L A;  4HWI B;  3A4S C;  3VUW A;  4MH0 E;  2D11 A;  2GBJ A;  2AWT A;  2KD0 A;  3ZIM A;  2V3S A;  2MBB B;  3DPD A;  5GOW B;  4LDT D;  4II3 B;  3H1U A;  4EMO A;  2MP2 B;  3V5W A;  3DBS A;  1V49 A;  3RUI B;  2JF5 A;  4AJY B;  2JRI B;  1ZKH A;  2NVU I;  1M7E A;  3EC8 A;  1HB6 A;  4G11 A;  2DN6 A;  1Q0W B;  2AYO B;  4HAV B;  3V60 A;  1WXA A;  4M8M A;  1M7R A;  3VXW A;  4ZRJ A;  2ROZ B;  2MRP A;  4HB3 B;  2DLW A;  2RR9 A;  4WVF B;  2PEA A;  5HE0 A;  2K6Q A;  1D3Z A;  2MBQ A;  1TGZ B;  3SO6 A;  4KDL B;  2VKI A;  2FDQ A;  4YON A;  4WSF A;  5IA7 A;  2GBN A;  4KSL C;  5D3Y A;  2BYV E;  2MSE D;  1JDE A;  3O65 B;  2JXX A;  3DQV A;  1XOD A;  1OQY A;  1FHX A;  1NU2 A;  2BKR B;  2D9V A;  3AJ4 A;  1AQC A;  2J59 M;  2N9E B;  4GIV A;  2M17 A;  2BYE A;  3DVG Y;  4I6N B;  1WY8 A;  2UVM A;  3Q3F A;  1M94 A;  2GBM A;  2DHZ A;  2HD5 B;  2K1F A;  1P1A A;  2KNB A;  4KSK C;  1MG8 A;  2A4Z A;  3ZNI D;  2DHJ A;  1U2B A;  2CR5 A;  4KAX B;  4JKH A;  4FLH A;  2RNR B;  2KDF B;  1GJZ A;  3FP5 A;  2C7H A;  1PLS A;  2RGN B;  1WE6 A;  3G9W A;  2IY1 B;  4RM9 A;  4LCD E;  2GS0 A;  2WDT B;  2G3Q B;  2O6V D;  2LI5 A;  3VTU A;  4IM0 A;  2DKQ A;  5JHH A;  3PSE B;  4WJ7 A;  2DX5 B;  2UZR A;  2KFK B;  4PS8 A;  2R82 A;  1YX5 B;  5DPS A;  2MWS B;  2ZPN A;  3WAN A;  2RLO A;  3UIP B;  2CHW A;  3KY9 A;  3UIN B;  2I1J A;  1Z5S B;  4FJY A;  3L08 A;  2LGX A;  4K17 A;  2HTH B;  1GUA B;  4IM3 A;  2G45 B;  4IAP A;  3V61 A;  2JRH A;  1XKE A;  1FGY A;  1HB8 A;  1Y19 B;  4X57 B;  4NY0 A;  1MIX A;  4FA6 A;  5J3Y A;  4PYU A;  3ZNG C;  2RQ1 A;  1NI2 A;  2KAN A;  1XX0 A;  2X18 A;  2LWP A;  3WAL A;  1ZVR A;  4CO7 A;  5L95 C;  2KJ6 A;  2FCN A;  2Q13 A;  2Y7B A;  4F7U P;  4DDI D;  3DCG A;  1R4M I;  3S2A A;  2KVR A;  2JUO A;  4K81 A;  4ASW C;  1Q67 A;  1L7Y A;  1U27 A;  1F9J A;  4EZL A;  1X1F A;  2K6D B;  4Y94 A;  2CS4 A;  3DXC A;  3H9D A;  2DHK A;  2CHZ A;  4A6F A;  2RVB B;  4AJW A;  3LDZ E;  2LGD A;  3RT3 B;  3CXB B;  2DYM A;  4GZU A;  2PJH A;  1JRU A;  1IP9 A;  5CX3 A;  1LXD A;  1A5R A;  1UGM A;  2Z0E B;  3N7C A;  2W2W A;  5J17 A;  3KZ1 A;  5EFX A;  5E6P A;  4DHJ B;  4W9J A;  4MSM B;  3PPA A;  2JZZ A;  3DOW A;  2UZS A;  2VRW B;  4WWO A;  1YD8 U;  3AI5 A;  3HIZ A;  3B0A A;  2DAF A;  3SYX A;  2MP2 A;  2NPT A;  2AL3 A;  3PHW B;  1WGR A;  1J8C A;  1GC7 A;  3MPX A;  2YSZ A;  3M62 B;  4E3C A;  5CHV C;  3RUL A;  3SBT A;  3TVV A;  3BIN A;  1RJ2 A;  4DX8 A;  3A33 B;  3QWZ B;  2O2V B;  2C5L C;  4JKG A;  4HB4 B;  4LJO B;  2X0S A;  2LZ6 A;  2YS5 A;  2L00 B;  3HQC A;  1VBG A;  3AXC A;  4DHZ B;  3H7P B;  3E9O A;  1KZ7 A;  2LXA A;  4DXA B;  2C9W B;  1WJ1 A;  2DHI A;  3FSS A;  4CHK A;  1RRP B;  3V62 A;  4RM8 A;  4AUQ C;  4F7G A;  4NQK E;  4IG7 B;  3HW2 B;  2DAJ A;  1H8C A;  3L0W B;  1Y8R C;  1WIA A;  2RSU A;  2LVO A;  2JP2 A;  1WJ6 A;  2KX3 A;  1WXM A;  3AU5 A;  2UYZ B;  3QJZ A;  4BKG A;  1XQQ A;  4JK7 A;  3IHP C;  3JSV A;  3QC8 B;  1AAR A;  4BOZ B;  2OTX A;  4G0N B;  1UBQ A;  2KWC A;  2NBV B;  1W1H A;  4MJS A;  1J0W A;  2WX0 A;  1DDW A;  4TV3 A;  5HE3 A;  3A4R A;  4EFO A;  4FN2 A;  1LW3 A;  1I2H A;  1EF5 A;  3IVF A;  2RD0 A;  3VUY A;  2L76 A;  2DZI A;  1U5F A;  4ZDV A;  2KZR A;  1WGQ A;  3PVW A;  2EJ8 A;  2LXC A;  3ZUN A;  2UWQ A;  1WGD A;  1RAX A;  3NHE B;  3PLV A;  4JKA A;  1TZ1 A;  2D3G A;  2LUE A;  3VVW B;  1V5U A;  1P6S A;  2RPQ A;  2L2I A;  1E7U A;  3VDZ A;  3PVL A;  3KYC D;  1J19 A;  1DIK A;  2J7Q B;  3AUL A;  4NQL B;  2FNJ B;  1U29 A;  1WZ0 A;  4IC7 B;  3A9J B;  2D2Q A;  4JGH B;  3TW1 A;  3VTW A;  1UNQ A;  4KIK B;  4WQO B;  3TL5 A;  3DBH I;  2N7E A;  3WAO A;  4MSQ B;  4W9L A;  2N23 A;  2XK5 B;  3RZF A;  3A9K B;  1TJ6 A;  1SHC A;  5DI9 B;  2Y5B B;  3MDB C;  1RLF A;  2KC1 A;  4WWP A;  2JY6 A;  5D6J B;  1WGU A;  3CSF A;  3BJI A;  1WYW B;  4BBK A;  4KV2 A;  1EF1 A;  3PZD A;  1WVH A;  1GNU A;  5DHF B;  2W2X D;  4F8C B;  2D9Z A;  1FAO A;  2NMB A;  4GDK B;  2D4Q A;  1WMH A;  5D27 A;  2P0H A;  1G6J A;  2P0D A;  3C0R B;  4M8N A;  4W9C A;  3A1Q A;  3L16 A;  4TQ0 A;  3PRP B;  3W1S C;  1NDD A;  4JK8 A;  2WWZ A;  2H7E A;  3TO1 A;  1V81 A;  2V1Y A;  2QKM A;  3D8D A;  2MQJ A;  3NY5 A;  4HDQ A;  3SHQ A;  2DZM A;  1XR0 B;  3UZT A;  4JK9 A;  1V6E A;  2JWZ A;  1B55 A;  2IY0 B;  1WXS A;  3PVU A;  4GN1 A;  3SNH A;  2M0X A;  4K1R B;  5C79 A;  4NJ7 A;  5BO4 B;  2KTR B;  1WI1 A;  2IO0 B;  3ML4 A;  1WXV A;  3QQ8 B;  1KI1 B;  1P3R A;  2ZCB A;  2W2X C;  1RFA A;  4E71 A;  1U5E A;  1CMX B;  2KO3 A;  3PSC A;  2KDE B;  1TQZ A;  4HPM B;  1SE9 A;  1FXT B;  2DA0 A;  2LG1 A;  5CTR C;  1E8W A;  2BWF A;  2N1V A;  3W1S A;  3ODX A;  1EUV B;  4E74 A;  3VUX A;  1WH3 A;  2GBK A;  1WGY A;  4GOC A;  2FID A;  4HAU B;  2K2J A;  1C1Y B;  3EFU A;  3APC A;  3RCP A;  5CLQ B;  3KW5 B;  1X1M A;  2DTC A;  4JLC A;  5DPW A;  2Z0D B;  4KHB B;  2KXJ A;  5LLI A;  1ZM0 A;  5KCV A;  3LJ3 A;  4MGY E;  5DPR A;  2KLC A;  4HCP B;  4II2 B;  5G2N A;  5KHQ A;  3PRM B;  1V86 A;  5LXI B;  4CHM A;  4W9I A;  2L1C A;  3KUZ A;  5D7G A;  3FLV A;  3ZDT A;  5D94 A;  2CY4 A;  4H8S A;  4BKT A;  4MGK E;  2Z0Q A;  1MAI A;  4B6H A;  2BPS A;  2BF8 B;  2AEH A;  2NBU A;  1W1D A;  3KRX A;  2NCN A;  1XD3 B;  1MIZ B;  3SU8 X;  1OQN A;  4C0A A;  3RYT A;  3FEH A;  1WE7 A;  3ML9 A;  4CHJ A;  4ICU A;  3UIO B;  2N1W A;  1S3S G;  2FIF A;  4AP4 C;  3ODO A;  4W9H A;  4BBN C;  3OAW A;  5G55 A;  2CHX A;  4DDG D;  2M4N A;  2J0J A;  2N0Y A;  1DRO A;  3QA8 A;  5J3T A;  2FCS A;  2E2X A;  2DFK A;  3CF6 E;  5DCN A;  3OJ4 B;  1I42 A;  2COC A;  4MGI E;  3E9L A;  1ZC3 B;  1IPG A;  5LXH A;  3IFW B;  4K7W A;  1FHO A;  1KC7 A;  2KJH B;  4NSW A;  1BAK A;  2KDI A;  4NJ6 A;  2K8B A;  4HLE A;  5JP4 A;  4MGZ E;  5CHW A;  2ZCC A;  3VH3 B;  2GJY A;  3WIM A;  1RRB A;  4YL8 A;  4EKU A;  3D8E A;  4KZC A;  4W9D A;  2ADZ A;  3B1L X;  2FCQ A;  1LQB A;  2HJ8 A;  2BYF A;  2MFQ A;  4BVU C;  4G3X B;  3VAW A;  2D07 B;  1U5G A;  4KVG B;  1KM7 A;  5HKH A;  3A8P A;  4F1S A;  3MHS D;  5JLJ B;  3ZTC A;  1WG7 A;  5IAA C;  3NS8 A;  1V61 A;  3K9O B;  1AWE A;  4HVB A;  3PTF C;  3VFK A;  2DZK A;  4HHV A;  3PG7 A;  4ANU A;  3U8Z A;  2M38 A;  1PMS A;  5D3W A;  2XK5 A;  3B08 A;  3PRE A;  4L6E A;  1WJU A;  3NOB A;  2K8H A;  5E6O A;  1WGH A;  3HM3 A;  3D8F A;  4WJN A;  1DDV A;  1KLV A;  3RCZ A;  2K8C A;  3L17 A;  1TTN A;  4GDL B;  3DXE A;  3JW0 X;  2HE7 A;  2KMA A;  2I5F A;  4PNK A;  4I6L B;  2N9X A;  3KRW A;  4GDK A;  1V88 A;  4WWN A;  3P6A A;  2FUH B;  1J0G A;  2I1K A;  1E5W A;  2VSZ A;  4HCN B;  2OQB A;  2G4S A;  2K39 A;  2B3A A;  3AU4 A;  1U4A A;  4A20 A;  4HXD A;  1EAZ A;  2DKP A;  3PRZ A;  3X23 A;  2YS3 A;  4DHZ E;  1WF9 A;  4AOF A;  2IO2 B;  2KX0 A;  3ENB A;  1W1G A;  2C7M B;  4JL9 A;  2Z0O A;  2KGX B;  5L81 A;  2N9P C;  1BTK A;  3SUZ A;  1MKE A;  2VRR B;  1BWN A;  4K2P A;  1I35 A;  3V6E B;  1DDM A;  1GG3 A;  4BOS C;  4M0W B;  2CKH B;  2LKO A;  2DEN B;  4FJZ A;  2P8V A;  3T9L A;  2EMS A;  3DVG X;  1P3Q U;  1V89 A;  4CYE A;  1WM3 A;  5C1Z A;  2MX2 A;  1WJM A;  2MCN B;  2L3Z A;  2KFJ A;  1OEY J;  3VIA A;  4K7S A;  3ZO5 B;  1KOT A;  4MT7 A;  3H7S A;  4NAW B;  3EEC A;  4OVV A;  4NPN A;  3TJP A;  2RUK B;  3QAR A;  4EEW A;  2MDX A;  4TUU A;  1X05 A;  2KK8 A;  4Z2N A;  2L8J A;  3QBV B;  3M63 B;  5HE1 A;  4B9K A;  2DZJ A;  3HM6 X;  5KQ4 A;  4A6H A;  1OMW A;  3APD A;  2R0D A;  2KLG A;  4RMA A;  3HK0 A;  2N4F A;  3ALB A;  1V5T A;  2KN5 A;  1E7V A;  4HJK A;  3SBG A;  4HAT B;  4AWJ A;  4LDT B;  3H6N A;  2ZZP B;  2K00 A;  3ZRC A;  1WGG A;  4Z2M B;  2IO3 B;  4DK5 A;  1I7A A;  1WI0 A;  2RGF A;  5GMV A;  3KSY A;  2PPH A;  2DYN A;  1NTY A;  1TBE A;  4W9E A;  3IBE A;  2YVC A;  1FOE A;  4JKC A;  4KHA A;  2LJ5 A;  1WZ3 A;  2Y8G A;  4W9K A;  5C5B B;  3WAM A;  2KHW B;  1IRS A;  3TIX A;  4K7U A;  3N32 A;  3ZLZ A;  3M1I B;  5IJM A;  2GBR A;  2KQ7 A;  1KBL A;  1S1Q B;  2HRJ A;  3GYO A;  2OJR A;  4KDI C;  3UQA A;  2PE6 B;  2D9W A;  2XEW A;  4GB9 A;  1WR6 E;  3EPY A;  2G4D B;  1EO6 A;  3CIK A;  1WX9 A;  1X86 A;  1P0R A;  3IG3 A;  2M8S A;  2KQS A;  3R3M A;  4GMX B;  1L2N A;  2CY5 A;  3PV1 A;  3Q3J A;  1X11 A;  4FBJ B;  4WAA A;  2DX5 A;  2WH5 A;  2KFK A;  3KH0 A;  1UEL A;  3ZVV A;  3JYU A;  4DHJ D;  2PZ1 A;  3ULC A;  1OEY A;  2FJL A;  3QK0 A;  3VHT C;  1NBF C;  3WYF B;  1V5P A;  3K9P B;  1KJT A;  2KMC A;  2ABD A;  4F7H A;  4A3O A;  2HTH A;  2LBB A;  3ZDM C;  4TQ1 A;  3R66 C;  2MBH A;  4JQW C;  2PE9 A;  4OVU A;  4A6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...