4ZRJA

Structure of merlin-ferm and ctd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrjA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrjA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrjA01
5CX3A 4BBNF 5J3TA 4IAPA 1XKEA 2DYNA 2J0KA 4GZUA 1TZ1A 2G45B 2E2XA 2N1WA 5D3XA 5AEKB 2N7DA 4FN2A 2KFKA 3H6NA 4LCDE 1AARA 2M1MA 2CS4A 3X0WA 2CODA 3LJ3A 4GDLB 1BWNA 2P8VA 2AL6A 3KH0A 4NAWB 2AL3A 2KLGA 4MDKE 2KWCA 2R0DA 3UF8A 2Z0PA 3KUDB 1WMHB 1UD7A 3APDA 2HE7A 3AXCA 1L2NA 2J0JA 4MM3A 4HB0B 2GMIC 3CF6E 2A4ZA 3B0AA 2ZCCA 3FM8C 3OLMD 1FAOA 3TL5A 4M8NA 4BFRA 2WWZA 2MBOA 4DHZE 2MCNB 3DBHI 2MP2B 3V5WA 3M95A 4K7WA 1UNQA 4WJPA 4BBKA 3ZNZB 3L0WB 2GS0A 4W9DA 2C7HA 4ZRJA 2BKFA 4PS3A 2JP2A 3NSUA 5JHHA 2MBBB 4ANXA 5LLIA 2L00B 4IC7B 2HRJA 4K17A 2BPSA 5KQ4A 4FJZA 3IBEA 1OEYJ 2DX5B 2RLOA 1P0RA 4KSLC 3KY9A 3FEHA 3ODOA 4IWPA 1YIWA 1WGRA 4MGKE 4XZ4A 3CSFA 1ZGUB 3PSEB 1EUVB 3DVGY 3KW5B 3PRMB 2K8CA 3RCPA 1WE6A 1QZEA 1U2BA 1M94A 4F7ZA 1GC7A 1WX7A 2DLWA 1WGDA 2EMSA 2OTXA 2JWZA 4I6LB 4AUQC 2Y8FA 3KRXA 1AWEA 5JH5C 2DZJA 1P6SA 1XD4A 3HM6X 4E74A 4KZCA 3A33B 4URKA 2DX1A 2G3QB 1GUAB 4F7HA 5DPTA 2RUKB 3ZNHB 1WR1A 3IFWB 2MDXA 2Y8GA 2LRUA 4RMAA 1ZSQA 2LXAA 3PRZA 2IBIB 2N23A 4EZLA 3AU4A 3GYPA 3DVNV 2YS5A 3LDZE 4J6IA 1WE7A 2KXJA 3VTWA 5E6NA 2KGXB 1UEFA 5G55A 3F0WA 4A6HA 2EC1A 5D2MB 4BKSD 1WGHA 2I5FA 3A9KA 4HAVB 1J0WA 4ASWC 4XC2A 4II3B 3QAQA 3L54A 4G11A 2FCNA 1RRPB 4HAZB 2KJHB 1W1HA 4LJOB 2UWQA 2HJ8A 2WYQA 2I5CA 5CLLB 2L3ZA 1V9JA 3DCGA 2N0YA 2YRYA 2W2WA 5HE0A 3HHMA 3A8QA 2UZSA 1YJ1A 4KSKC 2I1JA 3UGBB 2RGNB 1H10A 2D11A 2JY6A 4MEMA 1FHWA 1ZVRA 2VKIA 2ROZB 4MSMB 4IFSA 1XD3B 2OJRA 5E6PA 2Z0DB 5DHAB 1RRBA 2NS5A 4FA6A 3VIAA 3L16A 3WANA 4HB3B 1UZXB 3DOWA 4NSWA 1RLFA 4YL8A 2IY1B 3L13A 3U8ZA 1V89A 5CLQB 3G9WA 1TQZA 2BWES 1U5GA 1NI2A 2DYQA 3CMMB 3VUYA 3SHQA 1E8WA 1X1MA 2NBWB 1E8ZA 3OANA 4KV2A 4MY6A 4JIOU 4K81A 3APCA 4L6EA 2KFJA 4LDTB 1I7AA 4W9HA 1A5RA 2N4FA 2R2QA 3W1SA 2LXCA 2YVCA 3PEGA 2M0XA 4DBBA 4GDLA 2Z0QA 2KC2A 4BVUC 4NAWA 5JHGA 2MQJA 1WJ4A 2IYBA 1DDMA 3KYCD 3ZO5B 2P0HA 4AWJA 1K8RB 2NPTB 2I1KA 1WMHA 2PE6B 4FBJB 2MWNB 1UBQA 4M8MA 2FJ9A 2LGXA 4MGZE 3PTFC 2ZVNA 3CIKA 1QC6A 3PVWA 2DHZA 2M4NA 1UNPA 3NOBA 5DCNA 4A6FB 2D10A 3ULCA 1JRUA 2ZVOA 2MP2A 2V1YA 5DPWA 2KJ6A 4KIKB 4W9LA 3ENEA 4EOYA 1UPQA 1V5UA 4IUMB 1X1FA 5LXIB 5J18A 3HM3A 2LOXA 3D8EA 4BBNC 2ZZPB 3ODXA 3ZDMC 5JP4A 2L0FA 2ZNVB 2W9NA 5D3VA 1WX8A 3PG7A 4FHJA 3QK0A 2HTHB 3QC8B 1XQQA 2DX5A 4NJ7A 4K2PA 3H9DA 2KHWB 2DYOA 3WYFB 3QHTA 5J3YA 4NPNA 4WAAA 1E90A 2KANA 3RT3B 1PFJA 1V80A 3SNHA 5J2RA 3VTVA 5C1ZA 2BCJA 3IVFA 1Q5WB 2K25A 1FGZA 1WZ0A 2DFKA 4W9EA 4GMXB 2G35A 1DBHA 1KJTA 4A6KA 3WAOA 3RUIB 2Z0EB 4TUUA 2KOXA 3VOQA 1N3HA 4YONA 1WR6E 2OQBA 2KMCA 4ANWA 2FIFA 3PP2A 4ANUA 1FB8A 4TKNA 2C7MB 3NS8A 3DVGX 3ZIMA 1UPRA 3KRWA 3WA0A 2ZPNA 2GOWA 3MJWA 2B3AA 4EUTA 2X18A 2M8SA 1ISNA 4W9IA 3W1YA 1WI1A 4KZ0A 4HATB 1GG3A 3LJUX 2KNBA 3W1SC 3EPYA 1YX5B 2R09A 2W2XC 5HE3A 1WZ3A 2LBBA 2H7DA 1MIXA 2KTFA 4WQOB 3PVUA 3ZVRA 2KWUB 2L2IA 3R66C 2DZMA 2D4QA 4HWIB 2RNRB 2K8BA 1V5MA 2KKCA 3MDBC 3SUZA 4CHKA 4AJYB 4B9KA 2ZJDA 3WIMA 5BO4B 3KUZA 5L81A 1NTYA 1C1YB 3ZKJC 5CHVC 4A3OA 4Z2NA 3NHEB 4TQ0A 2LJ5A 4P7IA 5L95C 1Z87A 2LKOA 3SV1A 1Y8RC 3EECA 1TXDA 1IRSA 1Z2MA 3UQAA 1E7UA 5LOPB 1FHOA 3KZ1A 1SHCA 1V49A 5G2NA 1E7VA 1WJNA 4EZKA 1K5DB 2D9VA 2BKRB 3ZTCA 2ABDA 3DXDA 2JRIB 2DAJA 3WALA 1XCGA 3UINB 2Z59B 1W1DA 1KI1B 1J8CA 2WX1A 2KTRA 1RFAA 2CY4A 2JRHA 2L0TA 3P7ZA 5KCVA 4E71A 2LWPA 3ZNID 2K1FA 4LDTD 3BY4B 4BOSC 3APFA 5J17A 3JSVB 3DBSA 3U7DA 3QWZB 2MWSB 3CXBB 1UH6A 3N30A 3PS6A 2FNJB 2FIDA 3RULA 1Q67A 1G6JA 2CQUA 3A98B 3T06A 3QX1A 2LZ6A 1V5TA 4HDOA 3PGEA 4WJQA 4JLCA 4B6WA 2YF0A 2NPTA 2LYDA 3QA8A 5JHAA 4F7UP 3V6EB 4M0WB 1V2YA 5L83A 2ZCBA 2LVPA 4TQ1A 4ICVA 2ASQA 3V6CB 1XT9B 2R2OA 4GMVA 4W9FA 3MHSD 2D9WA 2G4SA 4HAYB 1V86A 2LVQA 4ZYNA 1R4NI 2KDIA 4KDIC 2XQNM 3B08A 5KHQA 4A6FA 4FLHA 4HAUB 5FI0A 1LB1A 2RR9A 4GDKB 2FCQA 4KIKA 1RAXA 2BYEA 2KD0A 1LQBA 2YS1A 4W9JA 2K6DB 2NZ8B 2GBMA 2Y7BA 5GOWB 3VUWA 3AU5A 1KOTA 2KDFB 2JXXA 2FUHB 2FAZA 4IW0A 1ZM0A 1ACAA 2HTHA 3OAWA 4WVFB 2NVUI 3DXEA 5DHFB 5LXHA 4HCNB 5E6OA 1WRDB 2FCMA 2KZRA 2NBUA 3N3KB 1M7RA 4GIVA 1UELA 3GZNI 4BKSA 1V5PA 3KUCB 4TV3A 3QQ8B 3K9OB 2LG1A 1J0GA 2JZZA 2NBVB 3PSCA 1FHXA 3PLVA 2KQSA 2WDTB 1OGWA 2N9EB 1ZC3B 2FDQA 2MX2A 2KCJA 4IM0A 3DDCB 3RYTA 2DKQA 2Z0OA 2BWFA 3QARA 2EKEC 4DDID 4WWNA 2IY0B 2N7EA 4NJ6A 3ZLZA 3A1QB 5CTRC 2LGYA 2NR2A 2J59M 1NU2A 4N9F4 4F7GA 3FSSA 4KHOA 2ELBA 5IA7A 1NVLA 1WXVA 1VCBA 2DENB 1OTRB 1ZKHA 3SU8X 1GC6A 1PMSA 4HPMB 1KLVA 1NBFC 4CYEA 4LJPB 3KSYA 3V60A 2COAA 4JGHB 3NZUA 2V4LA 1Q1OA 3D8FA 4NY0A 1WYWB 3L17A 4GB9A 4WJOA 2GJYA 5FI1A 4HB2B 1OEYA 3SYXA 2ELAA 2RVBB 1SIFA 2LASA 3ML8A 4HXDA 3ULBA 4K7SA 5D3YA 2XK5B 4K1RB 4HHVA 1WH3A 1P3QU 2MBHA 4ZDVA 3A4RA 4DHJB 2IO0B 4KAXB 4EFOA 1LXDA 3ALBA 2W2XD 3H1UA 3T9LA 4C0AA 2RPQA 3HQCA 3PPAA 2YT1A 1P98A 5D6JB 1OY2A 1WI0A 1J19A 2RSUA 1BTNA 1XODA 3QWMA 2ADZA 2RQ1A 3DVNU 3ML4A 2KK8A 2WH5A 1BT0A 1SE9A 2M14A 4IM3A 4EKUA 1WM3A 5EDSA 5C6RA 3A8PA 2LUEA 3H7PB 4OVUA 1HBKA 5JZEB 4KVGB 4DDGD 2ZNVC 3ZDTA 1V6EA 4W9GA 3MTNB 3HK0A 1WGGA 2CHXA 1WGUA 2GBNA 3P6AA 3PT2B 2LGDA 3H7SA 1MIZB 4MSQB 1TTNA 2JUOA 3TBLD 5C5BB 4PYZA 3PHXB 4FJVB 4PS8A 3UIOB 5EFXA 3DPDA 2MKRA 3EFUA 4FADA 1WGYA 5DPRA 2YT0A 2COFA 2DZKA 4JL9A 1VD2A 2QKLA 3M3JA 5DPSA 1E5WA 3JSVA 5AZHA 4KHBB 4KDLB 2GCLA 4MGYE 2IZVB 4K2OA 1U29A 2DTCA 1HB8A 2D9XA 4W9CA 4B95A 1U5DA 1RJ2A 3ZRCA 1H8CA 3PHWB 3VAWA 3Q3JA 2L7RA 3RZFA 4IM2A 4I6PA 1GJZA 3BINA 4HAXB 1B55A 2MFQA 1T0YA 4NQKE 1PLSA 3SO6A 3C0RB 2K6QA 5FR6A 2V76A 2PE9A 1WM2A 3SD5A 4DK5A 1I2HA 1DDVA 2L05A 5DIFB 3RD2A 4F8CB 1S3SG 4A20A 2VRWB 5JHBA 3DQVA 3DBLI 3R3MA 3M1IB 4MK0A 2KUPA 4K7UA 4GDKA 4RM9A 3M63B 2LULA 4DBGA 4A3PA 4G3XB 1NTVA 1M7EA 3ZW3A 2K2UA 2VSZA 3N7CA 2O2VB 1MAIA 5J3QA 1CMXB 3L08A 3PRPB 4E3CA 3ZRFA 1EF5A 2KJRA 4HVBA 2JVCA 1LW3A 5IJMA 4I6NB 2GBRA 1V61A 2DHJA 4MGIE 2DA0A 2J7QB 5CHFA 3OJ3A 1PQSA 2AWTA 3D8DA 1OMWA 1WJUA 1X11A 2PZ1A 5D7GA 3PLUA 5DH9B 2XBBC 5DI9B 1X1GA 3NY5A 2D3GA 2JF5A 4GU2A 2L76A 5KHOA 2KLCA 3VFKA 1V81A 1YD8U 1IP9A 1ST7A 2JT4B 3VHTC 4GSWA 4AJWA 4G0NB 1C3TA 2DKPA 4WSFA 4BKGA 3R7RA 4IG7B 5TR5A 2DHIA 1TBEA 4HB4B 3A1QA 1XR0B 2CY5A 1Y5OA 1WXAA 2LVOA 1FXTB 5IAAC 3PZDA 3S2AA 3VVWB 1AQCA 1WXSA 2K00A 2JZ3B 1I42A 1S1QB 2A5UA 2DYMA 4G50A 1U5EA 3F5RA 2MRPA 3QJZA 3V61A 1WFYA 1P9DU 4GPTB 2K2JA 2ZPYA 2ZEQA 4DHJD 2IFSA 3RZWC 3AI5A 2GCJA 2N9XA 2XK5A 2D2QA 2VRRB 3PVLA 2O6VB 4RM8A 3VH3B 4ZRKA 3SDLC 3VUXA 1KM7A 1HB6A 4MJSB 4DX8A 2LRWA 1SGHA 4AP4C 3L10B 2CAYA 2P0DA 3WAPA 3TVVA 4EEWA 2L1CA 2JPHA 1MK9B 2LD9A 1QQGA 2KQ7A 2YLMA 1WXMA 1HE8A 2P0FA 1WY8A 5C79A 2BGFA 4HPLB 3P2BA 1EO6A 1IYFA 2OOBB 4AOFA 3TW1A 3WAMA 3VXWA 1EVHA 2CRFA 2COPA 1F9JA 4MH0E 4A5KA 1ZW7A 4F1SA 4H8SA 2K8HA 2REXA 1EAZA 3H7PA 3MPXA 2M17A 5LONB 3PREA 4HJKA 1E8YA 2GBKA 5D94A 3EHVA 5HE1A 1UBIA 4CO7A 1Q0WB 3ZTDA 1WG7A 3VQIA 3JW0X 3TIXA 2WX0A 3OJ4B 3QCAA 5C5BA 3UIPB 2LOZA 3IHPC 2COCA 2GBJA 3U30A 1P3RA 1EGXA 5D27A 1MK7B 1OQNA 4B6HA 1V5OA 2CKHB 4FULA 3A9JB 4BKTA 2BF8B 4WWPA 2MBEA 1LFDA 4DWFA 3BJIA 3A4SC 4IWQA 1KZ7A 1YQBA 4DXAB 4IWOA 2NMBA 3JVZX 2KN5A 4DX90 2MSED 3ZVVA 4GN1A 2C7NB 2YSZA 2DAFA 2RSGA 3TFMA 3VDZA 4OVVA 2BYFA 3N32A 1X86A 5KQ1A 2AYOB 2CB8A 1OQYA 2KFKB 2KC1A 4EJNA 3M62B 1MG8A 4GOCA 1DDWA 1NDDA 3TMPB 3DXCA 3HW2B 3HIZA 4HLEA 1L7YA 1WVHA 2BYVE 1WX9A 1Y19B 4KHAA 1BAKA 1Z5SB 2AEHA 2D9YA 3X23A 3VTUA 2UYZB 4GXBA 4HK2A 2C9WB 5C16A 5CHWA 2O2VA 1MKEA 3TO1A 3NZSA 5AZFA 4XWXA 2IYDB 1WJ1A 3ZNGC 4TYZA 3O65B 2PEAA 2DYBA 3QIJA 2FJLA 4CHMA 1XX0A 3IG3A 5D3WA 2EJ8A 4D0NB 2KTRB 3TJPA 2CU1A 4DHZB 1UNRA 4Y94A 1NTIA 2CHZA 3JYUA 1WJ6A 2D9ZA 1U5FA 4FJYA 1MPHA 3UZTA 1H4RA 1KZGA 4W9KA 4JQWC 4PS7A 1I35A 5AZGA 2C60A 2UVMA 5C23A 4NNJB 3B1LX 2N1VA 3TCAA 4WJ7A 5HKHA 1IPGA 1FGYA 2IO1B 3GOEA 3T8MA 2RGFA 2Q13A 2HD5B 4II2B 2KX3A 3KYDD 2RD0A 2YS3A 2C5LC 1U4AA 4FHKA 4X57B 4IOYX 3FP5A 1X05A 1P5TA 4HAWB 2G4DB 3ECIA 2PPHA 4HDQA 4MELA 2EMTA 2KDEB 3KVFB 1W1GA 1EF1A 2LI5A 4PYUA 2KO3A 2K39A 2MLBA 2MBQA 2O6VD 3VH4B 4GGQA 2KVRA 2NCNA 4WJNA 1ZC4B 2CHWA 4CHJA 1FOEA 2O6VA 2DHKA 3K9PB 1UGMA 4NQLB 2J0MA 1DROA 4MJSA 3O96A 4ZRIA 3PV1A 3DBRI 3ONSA 2QHOA 2N9PC 3UQBA 4ANVA 1K5GB 1WGQA 2Y5BB 1TJ6A 3A9KB 1D3ZA 3CSTA 3EC8A 1WF9A 3R7QA 5JLJB 1BTKA 1U27A 1YX6B 4BOZB 3ZUNA 1DYNA 4WWOA 1TGZB 5HE2A 4XX5A 3ODWA 2FCSA 1GNUA 1V88A 3I3TB 2MW5A 4HCPB 2KMAA 2D07B 2ROVA 4MT7A 2KDBA 2L8JA 3FLVA 2IO2B 1E8XA 2KX0A 3AJ4A 1WIAA 1P1AA 3QBVB 4EMOA 2H7EA 2IO3B 1WJMA 3RCZA 4EZJA 2MA9B 3A9JA 4Z2MB 3V62A 2KWVB 1R4MI 3AULA 5GMVA 2CR5A 4PNKA 4ICUA 1LM8B 2PJHA 2DZIA 2DN6A 2XEWA 2QKMA 4PQ0A 3Q3FA 3ML9A 3D32A 2V3SA 2UZRA 3GYOA 2M38A
chains in the Genus database with same CATH superfamily
5CX3A 4BBNF 5J3TA 5H92C 2BT6A 4IAPA 1XKEA 2DYNA 4L1BA 2J0KA 1NENB 4GZUA 1TZ1A 2G45B 2E2XA 2N1WA 5D3XA 1PUTA 3B2GA 2L32A 3RNFC 3SBTA 3FILA 2WNMA 5AEKB 2N7DA 1MHHE 4FN2A 2CJOA 2KFKA 3H6NA 4LCDE 1AARA 1SSNA 2M1MA 2CS4A 3X0WA 2CODA 5IKCM 3LJ3A 3RNCC 4GDLB 1BWNA 1F2RI 2P8VA 1HA5A 2AL6A 4YSXB 5IP4D 3KH0A 4NAWB 2AL3A 4ILGB 1FIQA 4YTNB 3W2DA 1BUIC 2KLGA 2G9HD 4MDKE 2KWCA 4RGNA 1ENFA 3H8HA 2NMQA 1KLUD 2XNAC 1VZ6A 2R0DA 3UF8A 2Z0PA 3RPFC 4C7ZA 5I2MA 1WMHB 3KUDB 1UD7A 3APDA 2HE7A 3AXCA 1L2NA 2J0JA 4MM3A 4HB0B 2GMIC 2WXGA 3CF6E 2A4ZA 3B0AA 4JPSA 4HRSA 2J52A 2ZCCA 3FM8C 3OLMD 2W82A 1FAOA 3R2IA 3TL5A 4M8NA 4BFRA 2WWZA 4B0MA 2RMMA 3MFGA 2K49A 1K51A 2MBOA 4DHZE 2PVOD 1JW9D 2PVGC 2MCNB 3DBHI 2MP2B 3V5WA 1JCKB 5H8YE 3M95A 4K7WA 1UNQA 1FFVA 4WJPA 1N63A 5G5HA 4BBKA 1KTKA 3L0WB 3ZNZB 2GS0A 3ZXRA 4W9DA 2C7HA 1N62A 2LGSA 4ZRJA 2BKFA 3Q69A 4PS3A 2JP2A 1DOXA 1E9MA 3NSUA 5JHHA 2MBBB 4ANXA 5IRSA 2JX5A 1LO5D 2K8EA 5LLIA 2L00B 4IC7B 2HRJA 3Q3OC 4K17A 2BPSA 3TEYA 2Y3AA 5KQ4A 4FJZA 2INNE 3IBEA 1OEYJ 2DX5B 3TEZA 2RLOA 1N60A 1P0RA 4KSLC 3KY9A 3R8BA 1GB1A 3FEHA 1XLNA 3ODOA 4IWPA 1M4VA 1YIWA 1WGRA 4MGKE 1YJIA 1DGJA 4XZ4A 3CSFA 1ZGUB 3PSEB 3CIRB 3Q2AC 3W5UB 1EUVB 1TKYA 3DVGY 3KW5B 4ZRPA 3SEBA 3PRMB 2VZKB 3AEDB 2K8CA 3RCPA 1WE6A 3P4QB 1QZEA 1U2BA 1M94A 2DNFA 4F7ZA 1FO4A 1GC7A 1FPYA 1FXAA 2QILA 3BK1A 1WX7A 2DLWA 1WGDA 4XYCA 2EMSA 2OTXA 2JWZA 4I6LB 1J7CA 4AUQC 3ETRA 2Y8FA 3AE7B 3KRXA 1AWEA 2E3TA 5JH5C 2DZJA 1P7FA 2EKIA 2QSDA 4LNKA 1P6SA 2SAKA 4ILJA 1XD4A 1YMHE 3HM6X 4WQMA 4E74A 4KZCA 3A33B 1SIJA 4URKA 3NWDA 2DX1A 2G3QB 2WXHA 1K53A 2XN9C 1TKGA 1ZDVA 1GUAB 4F7HA 4HJGE 2W54A 5DPTA 2RUKB 3ZNHB 1WR1A 1MI1A 3GP7A 5FR3A 4DXFA 3AMZA 3IFWB 4R3DA 2MDXA 2Y8GA 2LRUA 4RMAA 2NTSA 1ZSQA 2LXAA 3PRZA 2IBIB 2N23A 4EZLA 3AU4A 3GYPA 3DVNV 4NJCA 1SE4A 2YS5A 5MPOA 1FFUA 3LDZE 4J6IA 4M01A 1ZP0B 3N1XC 4LNIA 1EWYC 1WE7A 1XLPA 4BZAA 2KXJA 3VTWA 5E6NA 4CQNA 2KGXB 1UEFA 5G55A 3F0WA 4A6HA 2BBCA 2EC1A 5D2MB 4BKSD 1WGHA 3N20C 4UDUC 1C9FA 2I5FA 3A9KA 5HHDG 4HAVB 3KWVA 1J0WA 1RYJA 2L83A 3P42A 3MP9A 1N6ZA 4ASWC 4XC2A 3BZDB 4II3B 3QAQA 2AQ2B 3L54A 4G11A 1C4CA 2K22A 2FCNA 1D5XC 4ARCA 2BYTA 2YEPF 1RRPB 4HAZB 2KJHB 1W1HA 3AB5A 4LJOB 2E6XA 2UWQA 2HJ8A 2WYQA 3NJTA 2I5CA 1N61A 3NWAA 5C2TB 5CLLB 2L3ZA 1V9JA 3DCGA 2N0YA 2YRYA 2W2WA 5HE0A 2JXTA 3HHMA 3A8QA 2UZSA 1YJ1A 5I2SA 4JE3B 4KSKC 3U52E 2J42A 1XCTL 2I1JA 3UGBB 2RGNB 1H10A 2D11A 2JQRB 2JY6A 4ZOHC 4MEMA 3I63C 1FHWA 1ZVRA 1WXQA 2VKIA 1JDEA 2ROZB 3BYYB 2CU3A 2BS3B 4MSMB 4IFSA 1XD3B 2OJRA 1ESFA 5E6PA 4P6VF 4K3CA 2Z0DB 5DHAB 1RRBA 4JKCA 2NS5A 4FA6A 2LEKA 3VIAA 2N7JA 3L16A 3WANA 4HB3B 3EFCA 1C77A 1UZXB 1BMLC 3DOWA 4NSWA 1RLFA 4YL8A 2IY1B 1HXYD 3GE3C 3L13A 3U8ZA 1V89A 5CLQB 3G9WA 5GXGB 1TQZA 2BWES 3SBGA 3EA6A 1U5GA 1NI2A 1QKZA 3WCQA 2DYQA 2K5PA 3PO0A 3CMMB 3VUYA 3SHQA 1E8WA 2INPE 1X1MA 1A70A 2NBWB 1FCLA 1E8ZA 3OANA 4KV2A 4MY6A 4JIOU 4K81A 1T6BX 3APCA 4L6EA 2KFJA 4LDTB 1I7AA 4W9HA 1A5RA 2EELA 2N4FA 2R2QA 4JKFA 1QF6A 3W1SA 1FXIA 2LXCA 2YVCA 2X0SA 3PEGA 2M0XA 4HEA1 4DBBA 1SXTA 4GDLA 2Z0QA 1I4RA 2KC2A 4BVUC 4NAWA 5JHGA 2MQJA 1WJ4A 2IYBA 1DDMA 3KYCD 4PK1A 3ZGZA 3ZO5B 2P0HA 4AWJA 1K8RB 2NPTB 1IUEA 2I1KA 1QOFA 4WURA 2VH2A 1KC7A 1WMHA 2PE6B 1XXGA 4FBJB 1FMAD 2L52A 4C4VB 2MWNB 1UBQA 5EE3A 3FVCA 1XLQA 4M8MA 2FJ9A 1I4GA 2LGXA 1C4AA 1I7HA 4MGZE 3PTFC 2ZVNA 3CIKA 1QC6A 3PVWA 2DHZA 2M4NA 1WWTA 1UNPA 3BYTB 3NOBA 5DCNA 4A6FB 2D10A 1SJHD 3ULCA 2V0GA 1JRUA 3ZQ4A 2ZVOA 1HTOA 1L0XB 2MP2A 2V1YA 3GS2A 5DPWA 5FKAC 2KJ6A 4DIXA 4KIKB 1IGCA 4W9LA 3ENEA 4EOYA 1UPQA 1V5UA 4IUMB 3PZ8A 1X1FA 5LXIB 5J18A 2OJWA 2KDMA 3HM3A 2LOXA 3D8EA 4BBNC 4YTMB 2IGGA 1PDXA 3AE8B 2ZZPB 3ODXA 3ZDMC 1QQRA 5JP4A 2L0FA 1AWDA 2ZNVB 2W9NA 5D3VA 3BVGA 1IBXB 1XO3A 1L0VB 4YTPB 4US9A 4OT1A 1WX8A 4CSQA 3PG7A 2HTME 4FHJA 2KUQA 2HTHB 1RWSA 3QK0A 2LGIA 3QC8B 1XQQA 1V97A 2DX5A 3DBRB 4NJ7A 4K2PA 3H9DA 4JKDA 2KHWB 1ET6A 2DYOA 3WYFB 5G5GA 3QHTA 5J3YA 4NPNA 4WAAA 1E90A 2KANA 2VZKD 2WXMA 4S0RA 4KGTA 3RT3B 1PFJA 1V80A 1ZE3D 1I4QA 3SNHA 1ACCA 2ZW0A 4OVZA 4REZA 3VTVA 5J2RA 5C1ZA 2BCJA 5IN7A 3IVFA 1Q5WB 3KQ4A 2K25A 1FGZA 3L4PA 3Q8BA 1WZ0A 2DFKA 2HDEA 4W9EA 4GMXB 1PFDA 2G35A 3VR8B 1TS3A 2V9HA 3U12A 1DBHA 1L6UA 4KGRA 1KJTA 4A6KA 3WAOA 3RUIB 2IGHA 2Z0EB 2IJ0A 2R61A 4TUUA 2KOXA 3VOQA 1N3HA 4YONA 1WR6E 2OQBA 2KMCA 2KACA 4ANWA 2FIFA 3AE5B 1B1ZA 2N9KA 2WU2B 4P1CC 3PP2A 4ANUA 1FB8A 4TKNA 2KIGA 2C7MB 3NS8A 1CK1A 3DVGX 2OHFA 3ZIMA 1UPRA 3KRWA 3WA0A 4AQ7A 3BVZA 2ZPNA 2GOWA 3MJWA 1C79A 2B3AA 1SE3A 4EUTA 1CJEA 2QC8A 3CWIA 2X18A 2M8SA 4JKHA 1ISNA 1E6EB 2JU6X 1NYQA 1OFFA 1T0RC 2M19A 3V05A 4W9IA 4DXGA 4LK0M 4Q2JA 3W1YA 1WI1A 1ZPSA 4HATB 4KZ0A 1GG3A 3LJUX 2KNBA 3W1SC 1GOZA 3EPYA 3SFDB 1L6VA 2QIEB 1YX5B 2R09A 3P63A 1R7SA 2W2XC 5HE3A 2ON8A 2LHDA 1VBGA 1WZ3A 2LBBA 2H7DA 1MIXA 1F2RC 2KTFA 3RN9C 2WXLA 3IT6B 4IDIA 1EU3A 4WQOB 3PVUA 3ZVRA 1T0SC 2KWUB 2L2IA 3R66C 2DZMA 1YN5A 1ZYIA 1VZ7A 2BS2B 2D4QA 4HWIB 4M00A 2RNRB 2K8BA 4OZAA 1V5MA 2KKCA 3MDBC 4JK7A 3SUZA 4CHKA 4AJYB 4B9KA 1D5MC 2IPKD 4IOIE 2ZJDA 3WIMA 5BO4B 1FD6A 3KUZA 2X8XX 3OG5A 3IXSA 4TSSA 1UUPA 1VZ8A 5L81A 5TSSA 1NTYA 2MJEA 1C1YB 3URYA 3ZKJC 5CHVC 4A3OA 2D5GA 1RM6C 4Z2NA 3NHEB 1J7BA 4TQ0A 2GRIA 2LJ5A 4P7IA 2JSVX 2ZW1A 5L95C 1Z87A 2LKOA 3SV1A 1Y8RC 1J7AA 3EECA 1TXDA 1F77A 1IRSA 4LTUA 1Z2MA 3UQAA 3RNBC 1E7UA 5LOPB 1FHOA 3KZ1A 2QMTA 1SHCA 1V49A 5G2NA 1E7VA 1WJNA 2QDFA 4EZKA 1K5DB 2D9VA 2BKRB 3ZTCA 2ABDA 2KVZA 1RFKA 1I4PA 3DXDA 3HRDD 3P4PB 1FNUA 5T8IA 2JRIB 2DAJA 1QT9A 3WALA 1XCGA 3AE3B 3UINB 5C3JB 2Z59B 2JZPA 1W1DA 4KGSA 1KI1B 3TEWA 1J8CA 2PMVA 2WX1A 2Q5WD 4YSYB 3DBHB 2KTRA 1RFAA 2CY4A 4WWMA 3Q8EA 2JRHA 2L0TA 3P7ZA 5KCVA 4E71A 2LWPA 3B9JA 3ZNID 2K1FA 4LDTD 3BY4B 4BOSC 1E10A 3APFA 4DQOC 5IOIA 5J17A 3JSVB 4MT5A 3DBSA 2K9XA 3U7DA 4S17A 3UI3A 3V3XA 3QWZB 2QJLA 2MWSB 3CXBB 1UH6A 3N30A 4FXCA 3PS6A 1TS2A 2FNJB 1UGJA 2FIDA 1JROA 2LMCA 4YWGG 3RULA 1Q67A 4USAA 1G6JA 2CQUA 3AV8A 3A98B 3T06A 1KLGD 3QX1A 1XEEA 2LZ6A 3W5VB 1V5TA 3ZJTA 4HDOA 2Y5PA 3PGEA 1DYQA 3I57A 4GLSC 4WJQA 4JLCA 4B6WA 2YF0A 2NPTA 1KBLA 2LYDA 3GB1A 3QA8A 5JHAA 4F7UP 3V6EB 4M0WB 1V2YA 3NVVA 5L83A 2ZCBA 2LVPA 4KKIA 4TQ1A 4C4VA 3RI7C 1L0YB 2BVCA 4ICVA 2ASQA 3V6CB 1XT9B 3I9V1 2R2OA 4GMVA 2YEPB 1PGXA 2MJDA 2WXFA 4W9FA 3MHSD 4LLGM 2D9WA 3NS1A 4GNKB 2G4SA 4HAYB 1V86A 2LVQA 4ZYNA 1R4NI 3SR6A 3NRZA 2ICIA 3P4SB 2KDIA 4KDIC 4WAFA 2XQNM 3B08A 5KHQA 4A6FA 4OSNA 4FLHA 2IDYA 4HAUB 5FI0A 1LB1A 2RR9A 1R4NB 1FRDA 1GGOA 3DHIC 4GDKB 2FCQA 4KIKA 4JKGB 1RAXA 4LNNA 2BYEA 1FNVA 2KD0A 1LQBA 1V8CA 3SFEB 2YS1A 4W9JA 2H88B 2K6DB 1NI3A 2NZ8B 2GBMA 2Y7BA 5GOWB 3VUWA 1SE2A 3AU5A 1F52A 1KOTA 2QEJC 4YT0B 3U4EG 2KDFB 2JXXA 2FUHB 2FAZA 4JWUC 1QOBA 1IBXA 4IW0A 1ZM0A 1ACAA 2HTHA 3OAWA 4WVFB 3ZJVA 2NVUI 3DXEA 4ACFA 5DHFB 2WXOA 5LXHA 4HCNB 5E6OA 1WRDB 2FCMA 2KZRA 2FJUB 2NBUA 3N3KB 2I38A 1M7RA 4RFBA 4GIVA 3R2TA 4O1NA 1UELA 3GZNI 4BKSA 3DHHC 1V5PA 3KUCB 4TV3A 1MFWA 2BB5A 5JVLA 3NG0A 3QQ8B 1VR9A 2V4IB 3K9OB 3ZJUA 2LG1A 1J0GA 3GZNB 2JZZA 2CJNA 1NEKB 2NBVB 2FE8A 4RCOA 3PSCA 1FHXA 2GUMA 4JKEA 3PLVA 2KAJA 3ZYYX 2KQSA 1ZOYB 1TS5A 3BK2A 2WDTB 1ROEA 1OGWA 2N9EB 1ZC3B 2FDQA 2MX2A 2KCJA 4IM0A 4RGTA 4XDCA 3DDCB 4EE2A 1EU4A 3RYTA 2DKQA 2Z0OA 2BWFA 3QARA 2EKEC 1ET9A 2INDC 4OZCA 4WWNA 4DDID 2IY0B 2N7EA 3P4RB 4NJ6A 3RNAC 3ZLZA 3A1QB 2H89B 5CTRC 2LGYA 2NR2A 5BMIA 2J59M 1SF0A 2BQQA 1NU2A 4N9F4 4F7GA 3FSSA 4A90A 4KHOA 2ELBA 5IA7A 1NVLA 1WXVA 1B9RA 2MEKA 1VCBA 4RF1A 2DENB 4B0EA 3AH7A 1UWXA 1OTRB 1TY0A 5HI1A 1ZKHA 3SU8X 2HJ1A 1GC6A 1PMSA 4HPMB 1KLVA 4NAMA 2BB6A 1NBFC 4CYEA 4LJPB 1P7EA 4HROA 3KSYA 1XLOA 3ZXVA 3V60A 1AN8A 4RNAA 2COAA 1N5XA 3MHZA 4JGHB 3NZUA 2GI9A 2V4LA 1Q1OA 3D8FA 4NY0A 1WYWB 3L17A 4GB9A 4WJOA 2GJYA 2DWQA 5FI1A 1STEA 4H2AA 2PTLA 4HB2B 4YSZB 4LNOA 2MHJA 1OEYA 3SYXA 2ELAA 2RVBB 1Y56A 1SIFA 2D3AA 5AUIA 2LASA 1MG4A 4LNFA 3ML8A 4HXDA 3ULBA 4K7SA 5D3YA 2PIAA 2XK5B 4HHVA 1WH3A 4K1RB 2BTEA 1NYRA 1P3QU 2MBHA 4ZDVA 1XCQL 3A4RA 4DHJB 2IO0B 4KKJA 4KAXB 4EFOA 1LXDA 3ALBA 1F1HA 1MJDA 2W2XD 3H1UA 3T9LA 4C0AA 2RPQA 3HQCA 3PPAA 2YT1A 1P98A 3BIID 5D6JB 1OY2A 2YT2A 1WI0A 1TJEA 1J19A 2IGDA 2RSUA 1BTNA 1XODA 3MC0B 4P16A 3QWMA 2ADZA 2RQ1A 1VDVA 1YQ4B 3ML4A 3DVNU 1ZDXA 3AEAB 3EUB2 2KK8A 2WH5A 3DWMA 1BT0A 1SE9A 5HFYA 2M14A 4IM3A 2D3CA 4EKUA 1T3QA 1WM3A 5EDSA 2WS3B 3IT4B 4XDDA 5C6RA 3A8PA 3IAM1 2L1AA 2KIEA 1BXTA 2LUEA 4XWTA 3H7PB 2BW2A 4OVUA 1HBKA 3E9PA 3DHGC 1JWMD 3J9CA 5JZEB 4KVGB 4DDGD 2ZNVC 3ZDTA 1V6EA 4W9GA 3MTNB 2D3BA 3T3OA 3HK0A 2INCC 1WGGA 2WDVB 2BS4B 1WGUA 2CHXA 4WH4A 2GBNA 3P6AA 3PT2B 5D3DA 2LGDA 3H7SA 1MIZB 3NVZA 2Z59A 4MSQB 1TTNA 2JUOA 3TBLD 2WXJA 3DWGC 5C5BB 3AECB 4C56C 4PYZA 3PHXB 1YN3A 1C4PA 4FJVB 4PS8A 2FUG1 3UIOB 3MC9A 2Z14A 5EFXA 3DPDA 2JWUA 2MKRA 3EFUA 4HPPA 5BYQA 4FADA 2KYWA 1WGYA 5DPRA 2YT0A 2COFA 2DZKA 5E6JA 4JL9A 2R2YA 1VD2A 2QKLA 3M3JA 1MVKA 5DPSA 1E5WA 3KWLA 2WDRB 3JSVA 5AZHA 1Q10A 4KHBB 4KDLB 2GCLA 5BYSA 4MGYE 2IZVB 5I4DA 2W55A 4MACA 1TZOA 4K2OA 1U29A 1SBBB 2DTCA 4JKBA 1HB8A 2D9XA 4W9CA 4B95A 1U5DA 3KLSX 2RRFA 2AQ3B 1RJ2A 3ZRCA 1H8CA 3PHWB 2WXIA 3VAWA 3AE6B 4OZBA 3Q3JA 4KX6B 4L1RA 2L7RA 3RZFA 4IM2A 4I6PA 1GJZA 3BINA 2QCZA 4HAXB 1B55A 2MFQA 1T0YA 4M0WA 4NQKE 1PLSA 3SO6A 4OW0A 3C0RB 2K6QA 3E9SA 2K0PA 2GLSA 5FR6A 2V76A 2PE9A 1WM2A 2PKOA 3SD5A 4DK5A 4TMAB 1I2HA 1GB4A 4RGMA 1TIFA 1QLBB 1D4BA 2KWDA 1JWUD 1L4DB 1DDVA 2L05A 5DIFB 3RD2A 4F8CB 1S3SG 4A20A 2VRWB 1WRIA 5JHBA 3DQVA 3DBLI 3R3MA 3M1IB 4MK0A 2KUPA 4K7UA 3ENBA 4GDKA 2WXNA 4RM9A 4JKGA 3M63B 2LULA 4DBGA 4A3PA 1V1PB 4G3XB 1NTVA 3VRAB 1M7EA 3ZW3A 2K2UA 2VSZA 3N7CA 2O2VB 3T3NA 3AE1B 4P1BC 4JX1C 1MAIA 5J3QA 1CMXB 1YOVB 3L08A 1WGKA 3PRPB 3HSAA 4E3CA 2WXPA 1JQ4A 2WDQB 3U7ZA 3ZRFA 1K52A 1EF5A 1UWMA 2KJRA 4HVBA 1D5ZC 1LW3A 2JVCA 5IJMA 1NVID 4I6NB 1HEZE 5BMHA 2GBRA 1V61A 4ITKA 2DHJA 4MGIE 2Z8LA 1PGAA 2DA0A 2J7QB 5CHFA 3OJ3A 1PQSA 2AWTA 3D8DA 2M56B 3AEEB 1OMWA 1WJUA 1X11A 2RPVA 5BMGA 1YN4A 2PZ1A 5D7GA 3PLUA 1FM0D 2J4XA 3MC8A 5DH9B 2XBBC 4D2KA 2DBYA 5HG2A 5DI9B 1X1GA 2NBVA 3NY5A 2WXRA 2D3GA 2JF5A 4GU2A 2L76A 5KHOA 2KLCA 3VFKA 1V81A 1YD8U 1IP9A 3RNEC 3BWUD 1ST7A 1KFYB 2JT4B 2WHIA 3VHTC 4GSWA 4OHJA 4AJWA 1IGDA 4G0NB 3NVWA 4N58A 1C3TA 2DKPA 4WSFA 4BKGA 3R7RA 1KF6B 4IG7B 5TR5A 2WXQA 2DHIA 1TBEA 4HB4B 3A1QA 1XR0B 2CY5A 1Y5OA 1WXAA 3OWEB 1JMLA 3DCXA 2NTTA 2W3SA 2LVOA 1JWSD 1FXTB 5IAAC 3AE2B 3PZDA 1T77A 3S2AA 2PLPA 2V3NA 1WYGA 3LXFA 2WU5B 4PT5A 3VVWB 1FCCC 4ZRQA 2PW9A 3I5JC 1AQCA 2R82A 3A58A 2B76B 1WXSA 2K00A 3TEXA 2JZ3B 2JYTA 1I42A 1S1QB 4RGOS 2A5UA 2DYMA 4G50A 3C19A 1U5EA 3F5RA 2MRPA 4N59A 1JWBD 3QJZA 3V61A 1WFYA 1I4XA 1CZPA 1P9DU 4GPTB 3NZ3A 4L2YA 2K2JA 2ZPYA 2ZEQA 4DHJD 2IFSA 1MPEA 5BYRA 3RZWC 3AI5A 4K3BA 2GCJA 2N9XA 2XK5A 4IKGA 2D2QA 2VRRB 3PVLA 4ILHA 2O6VB 2WP9B 4RM8A 3VH3B 1OQQA 1QOGA 1OQRA 4ZRKA 3SDLC 3VUXA 1KM7A 4C80A 1HB6A 4MJSB 4DX8A 2LRWA 1SGHA 4AP4C 3L10B 3E9OA 2CAYA 2P0DA 4M02A 3WAPA 4ZHPA 3TVVA 4EEWA 1DOIA 2L1CA 2JPHA 1MK9B 2LD9A 1QQGA 2KQ7A 2YLMA 1WXMA 1HE8A 3AE4B 2P0FA 1WY8A 5C79A 3NUHB 2BGFA 4HPLB 1EO6A 2WXKA 3P2BA 1IYFA 2OOBB 4AOFA 2X38A 3TW1A 3WAMA 3VXWA 1KRHA 3E9LA 1AYFA 1EVHA 2CRFA 2COPA 1F9JA 4MH0E 1TKEA 4A5KA 4ARIA 1E0ZA 1ZW7A 4MH8A 4F1SA 2I2YA 3N1ZC 4H8SA 2K8HA 2REXA 1EAZA 3H7PA 3MPXA 2SEBD 2M17A 3MJ5A 5LONB 3PREA 4HJKA 1E8YA 2GBKA 5D94A 1ZXHA 3EHVA 5HE1A 4BAXA 1UBIA 4CO7A 3NW8A 1Q0WB 1UF0A 3ZTDA 1WG7A 3VQIA 3JW0X 1AW7A 3TIXA 2WX0A 3OJ4B 2VH1A 3QCAA 5C5BA 3UIPB 2LOZA 3IHPC 2COCA 2GBJA 3U30A 1P3RA 1EGXA 3VR9B 4JK9A 5D27A 4US8A 2FBWB 1MK7B 1OQNA 1JALA 4B6HA 1V5OA 2CKHB 1T0QC 4FULA 4WIPA 3A9JB 4BKTA 2WGSA 4KHBA 1SEBD 3Q6BA 4HKQA 2BF8B 4WWPA 1YNTE 2MBEA 1LFDA 2ONQA 5EE9A 4DWFA 3BJIA 4JK8A 1TY2A 3RFZB 3A4SC 4IWQA 1KZ7A 3OHMB 1TS4A 1YQBA 1L4ZB 5M4YB 3Q3MC 4DXAB 4IWOA 3RNGC 2K3UA 2RDGA 3C8YA 4QXAB 2NMBA 4J3OD 3AEBB 3JVZX 2KN5A 4DX90 2MSED 3ZVVA 1JWAD 3E56A 4GN1A 2C7NB 2YSZA 2DAFA 2RSGA 1HQRD 3TFMA 3VDZA 5IO9A 4OVVA 2BYFA 3N32A 1X86A 3N1YC 3Q3NC 3FILB 5KQ1A 2AYOB 2CB8A 1OQYA 1C78A 1FEHA 3P1MA 2KFKB 2KC1A 4EJNA 3M62B 1MG8A 3Q8AA 1KH0A 4GOCA 1DDWA 4A8XC 1NDDA 3TMPB 1K50A 3B77A 3DXCA 3HW2B 3O13A 3HIZA 4HLEA 1L7YA 1XF5L 1WVHA 1JRPA 2BYVE 4N6EB 1SB3C 3Q8FA 3AE9B 3GE8C 4NZLB 1WX9A 1Y19B 1FRRA 4KHAA 1BAKA 1Z5SB 2AEHA 2D9YA 4ZYSA 3X23A 4MM3B 3VTUA 1HZ6A 2UYZB 1VLBA 1SJED 4GXBA 5D3IB 1V1PA 4HK2A 1T5XD 2C9WB 5C16A 3PZ7A 5CHWA 2O2VA 1MKEA 3TO1A 3NZSA 5AZFA 4XWXA 2IYDB 1WJ1A 1V1OA 2AX5A 3ZNGC 4L23A 4TYZA 4QJ3B 3AN1A 3O65B 2PEAA 2RDHA 3HIEA 2DYBA 1UNSA 3QIJA 2FJLA 4CHMA 1XX0A 3IG3A 5D3WA 2EJ8A 4D0NB 2KTRB 2ZKMX 3TJPA 2CU1A 3AEFB 1UNRA 4DHZB 4Y94A 3Q14C 1NTIA 1QOAA 2CHZA 3JYUA 1WJ6A 2D9ZA 1U5FA 4FJYA 1MPHA 5LG4B 5AUKA 3UZTA 1YQ3B 1H4RA 1KZGA 4W9KA 5EE1A 4JQWC 2Z4DA 2TSSA 4PS7A 1I35A 3IAS1 5AZGA 2C60A 2UVMA 1D6EC 5C23A 5LNK1 4NNJB 2DLBA 3B1LX 2N1VA 1DOYA 3TCAA 3E66A 3VRBB 4WJ7A 5HKHA 1QILA 4XWWA 1DIKA 1E7PB 1IPGA 1FGYA 1MHXA 2IO1B 2KT7A 3GOEA 3T8MA 2ACZB 3Q8CA 2RGFA 2LHEA 2Q13A 2Y5CA 2HD5B 3TUOA 4II2B 2DIKA 2OEDA 2J53A 2KX3A 3KYDD 2RD0A 1YJJA 2YS3A 1EWCA 2C5LC 1U4AA 4FHKA 2GB1A 4X57B 4IOYX 1I4HA 3FP5A 1X05A 2Z13A 4JWSC 1P5TA 2MH7A 5EE0A 4HAWB 2G4DB 3ECIA 3B2FA 2LJIA 2PPHA 4HDQA 4MELA 5FK9C 1WSPA 2EMTA 2KDEB 4HKZE 3BVMA 3KVFB 1W1GA 1EF1A 2LI5A 4PYUA 2KO3A 2K39A 4QJ4B 2MLBA 2MBQA 1VJKA 1HTQA 2JYEA 2O6VD 4RF0A 3VH4B 4GGQA 2KVRA 2NCNA 2MJ3A 4WJNA 1ZC4B 2CHWA 4CHJA 4A9AA 2AQ1B 1FOEA 2O6VA 2DHKA 3AM9A 3K9PB 1UGMA 2G1EA 4NQLB 4QJ5B 2J0MA 1DROA 4MJSA 1GPXA 4RH6A 3O96A 3FC4A 4C00A 3W9CB 4ZRIA 3PV1A 4AS1A 3DBRI 3ONSA 2QHOA 3HVDA 2N9PC 3UQBA 2W3RA 1ZUD2 4ANVA 1K5GB 2LUMA 4XE0A 1WGQA 3U2SC 1PYWD 2RDBC 2Y5BB 1TJ6A 3AEGB 4XGAB 1LGRA 3A9KB 1D3ZA 3CSTA 1HZ5A 3LB8C 3EC8A 1F0ZA 2LFIA 1WF9A 1PGBA 1N5WA 3R7QA 5JLJB 1ZXIA 1BTKA 5JXVA 1FNWA 1U27A 1YX6B 4BOZB 3ZUNA 1DYNA 4WWOA 3TSSA 4HSIA 1TGZB 4ZHOA 5HE2A 4XX5A 1C76A 3ODWA 2FCSA 1EM7A 1GNUA 1TYGB 1V88A 3I3TB 2MW5A 2V3PA 1MI0A 1L5PA 4HCPB 3N9YC 2KMAA 4A55A 2D07B 2ROVA 4GOUA 4MT7A 2KDBA 4A6QA 2L8JA 4QAYA 3FLVA 3LYYA 2IO2B 1E8XA 2KX0A 3AJ4A 2WLBA 2M0AA 1WIAA 1P1AA 2KQ4X 3NWFA 3DBLB 3QBVB 4EMOA 3ABVB 2H7EA 4C7YA 2KMMA 4JKAA 3HUIA 2WQYB 2IO3B 1WJMA 3RCZA 3FAHA 3RMKC 1VRAB 4EZJA 2MA9B 3A9JA 4Z2MB 3V62A 3NVYA 2KWVB 1TT5B 2KR0A 1R4MI 3AULA 5GMVA 2CR5A 4PNKA 4ICUA 1LM8B 2PJHA 2DZIA 2N9LA 2N0SB 2DN6A 2XEWA 2QKMA 2UU7A 4PQ0A 3Q3FA 3ML9A 2KN4A 1R4MB 3D32A 1GAQB 2V3SA 2UZRA 3GYOA 1VBHA 3FKYA 4D6WA 4YXDB 1CQVA 2M38A 3EGRA 3HVZA
chains in the Genus database with same CATH topology
5CX3A 4BBNF 5J3TA 4IAPA 1XKEA 2DYNA 2J0KA 4GZUA 1TZ1A 2G45B 2E2XA 2N1WA 5D3XA 3SBTA 5AEKB 2N7DA 4FN2A 2KFKA 3H6NA 4LCDE 1AARA 2M1MA 2CS4A 3X0WA 2CODA 3LJ3A 4GDLB 1BWNA 2P8VA 2AL6A 3KH0A 4NAWB 2AL3A 4ILGB 2KLGA 4MDKE 2KWCA 2R0DA 3UF8A 2Z0PA 3KUDB 1WMHB 1UD7A 3APDA 2HE7A 3AXCA 1L2NA 2J0JA 4MM3A 4HB0B 2GMIC 3CF6E 2A4ZA 3B0AA 2ZCCA 3FM8C 3OLMD 1FAOA 3TL5A 4M8NA 4BFRA 2WWZA 2MBOA 4DHZE 2MCNB 3DBHI 2MP2B 3V5WA 3M95A 4K7WA 1UNQA 4WJPA 4BBKA 3ZNZB 3L0WB 2GS0A 4W9DA 2C7HA 4ZRJA 2BKFA 4PS3A 2JP2A 3NSUA 5JHHA 2MBBB 4ANXA 5LLIA 2L00B 4IC7B 2HRJA 4K17A 2BPSA 5KQ4A 4FJZA 3IBEA 1OEYJ 2DX5B 2RLOA 1P0RA 4KSLC 3KY9A 3FEHA 3ODOA 4IWPA 1YIWA 1WGRA 4MGKE 4XZ4A 3CSFA 1ZGUB 3PSEB 1EUVB 3DVGY 3KW5B 3PRMB 2K8CA 3RCPA 1WE6A 1QZEA 1U2BA 1M94A 4F7ZA 1GC7A 1WX7A 2DLWA 1WGDA 2EMSA 2OTXA 2JWZA 4I6LB 4AUQC 2Y8FA 3KRXA 1AWEA 5JH5C 2DZJA 1P6SA 4ILJA 1XD4A 3HM6X 4E74A 4KZCA 3A33B 4URKA 2DX1A 2G3QB 1GUAB 4F7HA 5DPTA 2RUKB 3ZNHB 1WR1A 3IFWB 2MDXA 2Y8GA 2LRUA 4RMAA 1ZSQA 2LXAA 3PRZA 2IBIB 2N23A 4EZLA 3AU4A 3GYPA 3DVNV 2YS5A 3LDZE 4J6IA 1WE7A 2KXJA 3VTWA 5E6NA 2KGXB 1UEFA 5G55A 3F0WA 4A6HA 2EC1A 5D2MB 4BKSD 1WGHA 2I5FA 3A9KA 4HAVB 1J0WA 4ASWC 4XC2A 4II3B 3QAQA 3L54A 4G11A 2FCNA 1RRPB 4HAZB 2KJHB 1W1HA 4LJOB 2UWQA 2HJ8A 2WYQA 2I5CA 5CLLB 2L3ZA 1V9JA 3DCGA 2N0YA 2YRYA 2W2WA 5HE0A 3HHMA 3A8QA 2UZSA 1YJ1A 4KSKC 2I1JA 3UGBB 2RGNB 1H10A 2D11A 2JY6A 4MEMA 1FHWA 1ZVRA 2VKIA 1JDEA 2ROZB 4MSMB 4IFSA 1XD3B 2OJRA 5E6PA 2Z0DB 5DHAB 1RRBA 4JKCA 2NS5A 4FA6A 3VIAA 3L16A 3WANA 4HB3B 1UZXB 3DOWA 4NSWA 1RLFA 4YL8A 2IY1B 3L13A 3U8ZA 1V89A 5CLQB 3G9WA 1TQZA 2BWES 3SBGA 1U5GA 1NI2A 2DYQA 3CMMB 3VUYA 3SHQA 1E8WA 1X1MA 2NBWB 1E8ZA 3OANA 4KV2A 4MY6A 4JIOU 4K81A 3APCA 4L6EA 2KFJA 4LDTB 1I7AA 4W9HA 1A5RA 2N4FA 2R2QA 4JKFA 3W1SA 2LXCA 2YVCA 2X0SA 3PEGA 2M0XA 4DBBA 4GDLA 2Z0QA 2KC2A 4BVUC 4NAWA 5JHGA 2MQJA 1WJ4A 2IYBA 1DDMA 3KYCD 3ZO5B 2P0HA 4AWJA 1K8RB 2NPTB 2I1KA 1KC7A 1WMHA 2PE6B 4FBJB 2MWNB 1UBQA 4M8MA 2FJ9A 2LGXA 4MGZE 3PTFC 2ZVNA 3CIKA 1QC6A 3PVWA 2DHZA 2M4NA 1UNPA 3NOBA 5DCNA 4A6FB 2D10A 3ULCA 1JRUA 2ZVOA 2MP2A 2V1YA 5DPWA 2KJ6A 4KIKB 4W9LA 3ENEA 4EOYA 1UPQA 1V5UA 4IUMB 1X1FA 5LXIB 5J18A 3HM3A 2LOXA 3D8EA 4BBNC 2ZZPB 3ODXA 3ZDMC 5JP4A 2L0FA 2ZNVB 2W9NA 5D3VA 1WX8A 3PG7A 4FHJA 3QK0A 2HTHB 3QC8B 1XQQA 2DX5A 4NJ7A 4K2PA 3H9DA 4JKDA 2KHWB 2DYOA 3WYFB 3QHTA 5J3YA 4NPNA 4WAAA 1E90A 2KANA 3RT3B 1PFJA 1V80A 3SNHA 5J2RA 3VTVA 5C1ZA 2BCJA 3IVFA 1Q5WB 2K25A 1FGZA 1WZ0A 2DFKA 4W9EA 4GMXB 2G35A 1DBHA 1KJTA 4A6KA 3WAOA 3RUIB 2Z0EB 4TUUA 2KOXA 3VOQA 1N3HA 4YONA 1WR6E 2OQBA 2KMCA 4ANWA 2FIFA 3PP2A 4ANUA 1FB8A 4TKNA 2C7MB 3NS8A 3DVGX 3ZIMA 1UPRA 3KRWA 3WA0A 2ZPNA 2GOWA 3MJWA 2B3AA 4EUTA 2X18A 2M8SA 4JKHA 1ISNA 4W9IA 3W1YA 1WI1A 4KZ0A 4HATB 1GG3A 3LJUX 2KNBA 3W1SC 3EPYA 1YX5B 2R09A 2W2XC 5HE3A 1VBGA 1WZ3A 2LBBA 2H7DA 1MIXA 2KTFA 4WQOB 3PVUA 3ZVRA 2KWUB 2L2IA 3R66C 2DZMA 2D4QA 4HWIB 2RNRB 2K8BA 1V5MA 2KKCA 3MDBC 4JK7A 3SUZA 4CHKA 4AJYB 4B9KA 2ZJDA 3WIMA 5BO4B 3KUZA 5L81A 1NTYA 1C1YB 3ZKJC 5CHVC 4A3OA 4Z2NA 3NHEB 4TQ0A 2LJ5A 4P7IA 5L95C 1Z87A 2LKOA 3SV1A 1Y8RC 3EECA 1TXDA 1IRSA 1Z2MA 3UQAA 1E7UA 5LOPB 1FHOA 3KZ1A 1SHCA 1V49A 5G2NA 1E7VA 1WJNA 4EZKA 1K5DB 2D9VA 2BKRB 3ZTCA 2ABDA 3DXDA 2JRIB 2DAJA 3WALA 1XCGA 3UINB 2Z59B 1W1DA 1KI1B 1J8CA 2WX1A 2KTRA 1RFAA 2CY4A 2JRHA 2L0TA 3P7ZA 5KCVA 4E71A 2LWPA 3ZNID 2K1FA 4LDTD 3BY4B 4BOSC 3APFA 5J17A 3JSVB 3DBSA 3U7DA 3QWZB 2MWSB 3CXBB 1UH6A 3N30A 3PS6A 2FNJB 2FIDA 3RULA 1Q67A 1G6JA 2CQUA 3A98B 3T06A 3QX1A 2LZ6A 1V5TA 4HDOA 3PGEA 4WJQA 4JLCA 4B6WA 2YF0A 2NPTA 1KBLA 2LYDA 3QA8A 5JHAA 4F7UP 3V6EB 4M0WB 1V2YA 5L83A 2ZCBA 2LVPA 4TQ1A 4ICVA 2ASQA 3V6CB 1XT9B 2R2OA 4GMVA 4W9FA 3MHSD 2D9WA 2G4SA 4HAYB 1V86A 2LVQA 4ZYNA 1R4NI 2KDIA 4KDIC 2XQNM 3B08A 5KHQA 4A6FA 4FLHA 4HAUB 5FI0A 1LB1A 2RR9A 1GGOA 4GDKB 2FCQA 4KIKA 4JKGB 1RAXA 2BYEA 2KD0A 1LQBA 2YS1A 4W9JA 2K6DB 2NZ8B 2GBMA 2Y7BA 5GOWB 3VUWA 3AU5A 1KOTA 2KDFB 2JXXA 2FUHB 2FAZA 4IW0A 1ZM0A 1ACAA 2HTHA 3OAWA 4WVFB 2NVUI 3DXEA 5DHFB 5LXHA 4HCNB 5E6OA 1WRDB 2FCMA 2KZRA 2NBUA 3N3KB 1M7RA 4GIVA 1UELA 3GZNI 4BKSA 1V5PA 3KUCB 4TV3A 5JVLA 3QQ8B 3K9OB 2LG1A 1J0GA 2JZZA 2NBVB 3PSCA 1FHXA 4JKEA 3PLVA 2KQSA 2WDTB 1OGWA 2N9EB 1ZC3B 2FDQA 2MX2A 2KCJA 4IM0A 3DDCB 3RYTA 2DKQA 2Z0OA 2BWFA 3QARA 2EKEC 4DDID 4WWNA 2IY0B 2N7EA 4NJ6A 3ZLZA 3A1QB 5CTRC 2LGYA 2NR2A 2J59M 1NU2A 4N9F4 4F7GA 3FSSA 4KHOA 2ELBA 5IA7A 1NVLA 1WXVA 1VCBA 2DENB 1OTRB 1ZKHA 3SU8X 1GC6A 1PMSA 4HPMB 1KLVA 1NBFC 4CYEA 4LJPB 3KSYA 3V60A 2COAA 4JGHB 3NZUA 2V4LA 1Q1OA 3D8FA 4NY0A 1WYWB 3L17A 4GB9A 4WJOA 2GJYA 5FI1A 4HB2B 1OEYA 3SYXA 2ELAA 2RVBB 1SIFA 2LASA 3ML8A 4HXDA 3ULBA 4K7SA 5D3YA 2XK5B 4K1RB 4HHVA 1WH3A 1P3QU 2MBHA 4ZDVA 3A4RA 4DHJB 2IO0B 4KAXB 4EFOA 1LXDA 3ALBA 2W2XD 3H1UA 3T9LA 4C0AA 2RPQA 3HQCA 3PPAA 2YT1A 1P98A 5D6JB 1OY2A 1WI0A 1J19A 2RSUA 1BTNA 1XODA 3QWMA 2ADZA 2RQ1A 3DVNU 3ML4A 2KK8A 2WH5A 1BT0A 1SE9A 2M14A 4IM3A 4EKUA 1WM3A 5EDSA 5C6RA 3A8PA 2LUEA 3H7PB 4OVUA 1HBKA 3E9PA 5JZEB 4KVGB 4DDGD 2ZNVC 3ZDTA 1V6EA 4W9GA 3MTNB 3HK0A 1WGGA 2CHXA 1WGUA 2GBNA 3P6AA 3PT2B 2LGDA 3H7SA 1MIZB 4MSQB 1TTNA 2JUOA 3TBLD 5C5BB 4PYZA 3PHXB 4FJVB 4PS8A 3UIOB 5EFXA 3DPDA 2MKRA 3EFUA 4FADA 1WGYA 5DPRA 2YT0A 2COFA 2DZKA 4JL9A 1VD2A 2QKLA 3M3JA 5DPSA 1E5WA 3JSVA 5AZHA 4KHBB 4KDLB 2GCLA 4MGYE 2IZVB 4K2OA 1U29A 2DTCA 4JKBA 1HB8A 2D9XA 4W9CA 4B95A 1U5DA 1RJ2A 3ZRCA 1H8CA 3PHWB 3VAWA 3Q3JA 2L7RA 3RZFA 4IM2A 4I6PA 1GJZA 3BINA 4HAXB 1B55A 2MFQA 1T0YA 4NQKE 1PLSA 3SO6A 3C0RB 2K6QA 5FR6A 2V76A 2PE9A 1WM2A 3SD5A 4DK5A 1I2HA 1DDVA 2L05A 5DIFB 3RD2A 4F8CB 1S3SG 4A20A 2VRWB 5JHBA 3DQVA 3DBLI 3R3MA 3M1IB 4MK0A 2KUPA 4K7UA 3ENBA 4GDKA 4RM9A 4JKGA 3M63B 2LULA 4DBGA 4A3PA 4G3XB 1NTVA 1M7EA 3ZW3A 2K2UA 2VSZA 3N7CA 2O2VB 1MAIA 5J3QA 1CMXB 3L08A 3PRPB 4E3CA 3ZRFA 1EF5A 2KJRA 4HVBA 2JVCA 1LW3A 5IJMA 4I6NB 2GBRA 1V61A 2DHJA 4MGIE 2DA0A 2J7QB 5CHFA 3OJ3A 1PQSA 2AWTA 3D8DA 1OMWA 1WJUA 1X11A 2PZ1A 5D7GA 3PLUA 5DH9B 2XBBC 5DI9B 1X1GA 3NY5A 2D3GA 2JF5A 4GU2A 2L76A 5KHOA 2KLCA 3VFKA 1V81A 1YD8U 1IP9A 1ST7A 2JT4B 3VHTC 4GSWA 4AJWA 4G0NB 1C3TA 2DKPA 4WSFA 4BKGA 3R7RA 4IG7B 5TR5A 2DHIA 1TBEA 4HB4B 3A1QA 1XR0B 2CY5A 1Y5OA 1WXAA 2LVOA 1FXTB 5IAAC 3PZDA 3S2AA 3VVWB 1AQCA 2R82A 1WXSA 2K00A 2JZ3B 1I42A 1S1QB 2A5UA 2DYMA 4G50A 1U5EA 3F5RA 2MRPA 3QJZA 3V61A 1WFYA 1P9DU 4GPTB 2K2JA 2ZPYA 2ZEQA 4DHJD 2IFSA 3RZWC 3AI5A 2GCJA 2N9XA 2XK5A 2D2QA 2VRRB 3PVLA 4ILHA 2O6VB 4RM8A 3VH3B 4ZRKA 3SDLC 3VUXA 1KM7A 1HB6A 4MJSB 4DX8A 2LRWA 1SGHA 4AP4C 3L10B 3E9OA 2CAYA 2P0DA 3WAPA 3TVVA 4EEWA 2L1CA 2JPHA 1MK9B 2LD9A 1QQGA 2KQ7A 2YLMA 1WXMA 1HE8A 2P0FA 1WY8A 5C79A 2BGFA 4HPLB 3P2BA 1EO6A 1IYFA 2OOBB 4AOFA 3TW1A 3WAMA 3VXWA 3E9LA 1EVHA 2CRFA 2COPA 1F9JA 4MH0E 4A5KA 1ZW7A 4F1SA 4H8SA 2K8HA 2REXA 1EAZA 3H7PA 3MPXA 2M17A 5LONB 3PREA 4HJKA 1E8YA 2GBKA 5D94A 3EHVA 5HE1A 1UBIA 4CO7A 1Q0WB 3ZTDA 1WG7A 3VQIA 3JW0X 3TIXA 2WX0A 3OJ4B 3QCAA 5C5BA 3UIPB 2LOZA 3IHPC 2COCA 2GBJA 3U30A 1P3RA 1EGXA 4JK9A 5D27A 1MK7B 1OQNA 4B6HA 1V5OA 2CKHB 4FULA 3A9JB 4BKTA 2BF8B 4WWPA 2MBEA 1LFDA 4DWFA 3BJIA 4JK8A 3A4SC 4IWQA 1KZ7A 1YQBA 4DXAB 4IWOA 2NMBA 3JVZX 2KN5A 4DX90 2MSED 3ZVVA 4GN1A 2C7NB 2YSZA 2DAFA 2RSGA 3TFMA 3VDZA 4OVVA 2BYFA 3N32A 1X86A 5KQ1A 2AYOB 2CB8A 1OQYA 2KFKB 2KC1A 4EJNA 3M62B 1MG8A 4GOCA 1DDWA 1NDDA 3TMPB 3DXCA 3HW2B 3HIZA 4HLEA 1L7YA 1WVHA 2BYVE 1WX9A 1Y19B 4KHAA 1BAKA 1Z5SB 2AEHA 2D9YA 3X23A 3VTUA 2UYZB 4GXBA 4HK2A 2C9WB 5C16A 5CHWA 2O2VA 1MKEA 3TO1A 3NZSA 5AZFA 4XWXA 2IYDB 1WJ1A 3ZNGC 4TYZA 3O65B 2PEAA 2DYBA 3QIJA 2FJLA 4CHMA 1XX0A 3IG3A 5D3WA 2EJ8A 4D0NB 2KTRB 3TJPA 2CU1A 4DHZB 1UNRA 4Y94A 1NTIA 2CHZA 3JYUA 1WJ6A 2D9ZA 1U5FA 4FJYA 1MPHA 3UZTA 1H4RA 1KZGA 4W9KA 4JQWC 4PS7A 1I35A 5AZGA 2C60A 2UVMA 5C23A 4NNJB 3B1LX 2N1VA 3TCAA 3E66A 4WJ7A 5HKHA 1DIKA 1IPGA 1FGYA 2IO1B 3GOEA 3T8MA 2RGFA 2Q13A 2HD5B 4II2B 2DIKA 2KX3A 3KYDD 2RD0A 2YS3A 2C5LC 1U4AA 4FHKA 4X57B 4IOYX 3FP5A 1X05A 1P5TA 4HAWB 2G4DB 3ECIA 2PPHA 4HDQA 4MELA 2EMTA 2KDEB 3KVFB 1W1GA 1EF1A 2LI5A 4PYUA 2KO3A 2K39A 2MLBA 2MBQA 2O6VD 3VH4B 4GGQA 2KVRA 2NCNA 4WJNA 1ZC4B 2CHWA 4CHJA 1FOEA 2O6VA 2DHKA 3K9PB 1UGMA 4NQLB 2J0MA 1DROA 4MJSA 3O96A 4ZRIA 3PV1A 3DBRI 3ONSA 2QHOA 2N9PC 3UQBA 4ANVA 1K5GB 1WGQA 2Y5BB 1TJ6A 3A9KB 1D3ZA 3CSTA 3EC8A 1WF9A 3R7QA 5JLJB 1BTKA 1U27A 1YX6B 4BOZB 3ZUNA 1DYNA 4WWOA 1TGZB 5HE2A 4XX5A 3ODWA 2FCSA 1GNUA 1V88A 3I3TB 2MW5A 4HCPB 2KMAA 2D07B 2ROVA 4MT7A 2KDBA 2L8JA 3FLVA 2IO2B 1E8XA 2KX0A 3AJ4A 1WIAA 1P1AA 3QBVB 4EMOA 2H7EA 4JKAA 2IO3B 1WJMA 3RCZA 4EZJA 2MA9B 3A9JA 4Z2MB 3V62A 2KWVB 1R4MI 3AULA 5GMVA 2CR5A 4PNKA 4ICUA 1LM8B 2PJHA 2DZIA 2DN6A 2XEWA 2QKMA 4PQ0A 3Q3FA 3ML9A 3D32A 2V3SA 2UZRA 3GYOA 1VBHA 2M38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CX3 A;  4BBN F;  5J3T A;  4IAP A;  1XKE A;  2DYN A;  2J0K A;  4GZU A;  1TZ1 A;  2G45 B;  2E2X A;  2N1W A;  5D3X A;  5AEK B;  2N7D A;  4FN2 A;  2KFK A;  3H6N A;  4LCD E;  1AAR A;  2M1M A;  2CS4 A;  3X0W A;  2COD A;  3LJ3 A;  4GDL B;  1BWN A;  2P8V A;  2AL6 A;  3KH0 A;  4NAW B;  2AL3 A;  2KLG A;  4MDK E;  2KWC A;  2R0D A;  3UF8 A;  2Z0P A;  3KUD B;  1WMH B;  1UD7 A;  3APD A;  2HE7 A;  3AXC A;  1L2N A;  2J0J A;  4MM3 A;  4HB0 B;  2GMI C;  3CF6 E;  2A4Z A;  3B0A A;  2ZCC A;  3FM8 C;  3OLM D;  1FAO A;  3TL5 A;  4M8N A;  4BFR A;  2WWZ A;  2MBO A;  4DHZ E;  2MCN B;  3DBH I;  2MP2 B;  3V5W A;  3M95 A;  4K7W A;  1UNQ A;  4WJP A;  4BBK A;  3ZNZ B;  3L0W B;  2GS0 A;  4W9D A;  2C7H A;  4ZRJ A;  2BKF A;  4PS3 A;  2JP2 A;  3NSU A;  5JHH A;  2MBB B;  4ANX A;  5LLI A;  2L00 B;  4IC7 B;  2HRJ A;  4K17 A;  2BPS A;  5KQ4 A;  4FJZ A;  3IBE A;  1OEY J;  2DX5 B;  2RLO A;  1P0R A;  4KSL C;  3KY9 A;  3FEH A;  3ODO A;  4IWP A;  1YIW A;  1WGR A;  4MGK E;  4XZ4 A;  3CSF A;  1ZGU B;  3PSE B;  1EUV B;  3DVG Y;  3KW5 B;  3PRM B;  2K8C A;  3RCP A;  1WE6 A;  1QZE A;  1U2B A;  1M94 A;  4F7Z A;  1GC7 A;  1WX7 A;  2DLW A;  1WGD A;  2EMS A;  2OTX A;  2JWZ A;  4I6L B;  4AUQ C;  2Y8F A;  3KRX A;  1AWE A;  5JH5 C;  2DZJ A;  1P6S A;  1XD4 A;  3HM6 X;  4E74 A;  4KZC A;  3A33 B;  4URK A;  2DX1 A;  2G3Q B;  1GUA B;  4F7H A;  5DPT A;  2RUK B;  3ZNH B;  1WR1 A;  3IFW B;  2MDX A;  2Y8G A;  2LRU A;  4RMA A;  1ZSQ A;  2LXA A;  3PRZ A;  2IBI B;  2N23 A;  4EZL A;  3AU4 A;  3GYP A;  3DVN V;  2YS5 A;  3LDZ E;  4J6I A;  1WE7 A;  2KXJ A;  3VTW A;  5E6N A;  2KGX B;  1UEF A;  5G55 A;  3F0W A;  4A6H A;  2EC1 A;  5D2M B;  4BKS D;  1WGH A;  2I5F A;  3A9K A;  4HAV B;  1J0W A;  4ASW C;  4XC2 A;  4II3 B;  3QAQ A;  3L54 A;  4G11 A;  2FCN A;  1RRP B;  4HAZ B;  2KJH B;  1W1H A;  4LJO B;  2UWQ A;  2HJ8 A;  2WYQ A;  2I5C A;  5CLL B;  2L3Z A;  1V9J A;  3DCG A;  2N0Y A;  2YRY A;  2W2W A;  5HE0 A;  3HHM A;  3A8Q A;  2UZS A;  1YJ1 A;  4KSK C;  2I1J A;  3UGB B;  2RGN B;  1H10 A;  2D11 A;  2JY6 A;  4MEM A;  1FHW A;  1ZVR A;  2VKI A;  2ROZ B;  4MSM B;  4IFS A;  1XD3 B;  2OJR A;  5E6P A;  2Z0D B;  5DHA B;  1RRB A;  2NS5 A;  4FA6 A;  3VIA A;  3L16 A;  3WAN A;  4HB3 B;  1UZX B;  3DOW A;  4NSW A;  1RLF A;  4YL8 A;  2IY1 B;  3L13 A;  3U8Z A;  1V89 A;  5CLQ B;  3G9W A;  1TQZ A;  2BWE S;  1U5G A;  1NI2 A;  2DYQ A;  3CMM B;  3VUY A;  3SHQ A;  1E8W A;  1X1M A;  2NBW B;  1E8Z A;  3OAN A;  4KV2 A;  4MY6 A;  4JIO U;  4K81 A;  3APC A;  4L6E A;  2KFJ A;  4LDT B;  1I7A A;  4W9H A;  1A5R A;  2N4F A;  2R2Q A;  3W1S A;  2LXC A;  2YVC A;  3PEG A;  2M0X A;  4DBB A;  4GDL A;  2Z0Q A;  2KC2 A;  4BVU C;  4NAW A;  5JHG A;  2MQJ A;  1WJ4 A;  2IYB A;  1DDM A;  3KYC D;  3ZO5 B;  2P0H A;  4AWJ A;  1K8R B;  2NPT B;  2I1K A;  1WMH A;  2PE6 B;  4FBJ B;  2MWN B;  1UBQ A;  4M8M A;  2FJ9 A;  2LGX A;  4MGZ E;  3PTF C;  2ZVN A;  3CIK A;  1QC6 A;  3PVW A;  2DHZ A;  2M4N A;  1UNP A;  3NOB A;  5DCN A;  4A6F B;  2D10 A;  3ULC A;  1JRU A;  2ZVO A;  2MP2 A;  2V1Y A;  5DPW A;  2KJ6 A;  4KIK B;  4W9L A;  3ENE A;  4EOY A;  1UPQ A;  1V5U A;  4IUM B;  1X1F A;  5LXI B;  5J18 A;  3HM3 A;  2LOX A;  3D8E A;  4BBN C;  2ZZP B;  3ODX A;  3ZDM C;  5JP4 A;  2L0F A;  2ZNV B;  2W9N A;  5D3V A;  1WX8 A;  3PG7 A;  4FHJ A;  3QK0 A;  2HTH B;  3QC8 B;  1XQQ A;  2DX5 A;  4NJ7 A;  4K2P A;  3H9D A;  2KHW B;  2DYO A;  3WYF B;  3QHT A;  5J3Y A;  4NPN A;  4WAA A;  1E90 A;  2KAN A;  3RT3 B;  1PFJ A;  1V80 A;  3SNH A;  5J2R A;  3VTV A;  5C1Z A;  2BCJ A;  3IVF A;  1Q5W B;  2K25 A;  1FGZ A;  1WZ0 A;  2DFK A;  4W9E A;  4GMX B;  2G35 A;  1DBH A;  1KJT A;  4A6K A;  3WAO A;  3RUI B;  2Z0E B;  4TUU A;  2KOX A;  3VOQ A;  1N3H A;  4YON A;  1WR6 E;  2OQB A;  2KMC A;  4ANW A;  2FIF A;  3PP2 A;  4ANU A;  1FB8 A;  4TKN A;  2C7M B;  3NS8 A;  3DVG X;  3ZIM A;  1UPR A;  3KRW A;  3WA0 A;  2ZPN A;  2GOW A;  3MJW A;  2B3A A;  4EUT A;  2X18 A;  2M8S A;  1ISN A;  4W9I A;  3W1Y A;  1WI1 A;  4KZ0 A;  4HAT B;  1GG3 A;  3LJU X;  2KNB A;  3W1S C;  3EPY A;  1YX5 B;  2R09 A;  2W2X C;  5HE3 A;  1WZ3 A;  2LBB A;  2H7D A;  1MIX A;  2KTF A;  4WQO B;  3PVU A;  3ZVR A;  2KWU B;  2L2I A;  3R66 C;  2DZM A;  2D4Q A;  4HWI B;  2RNR B;  2K8B A;  1V5M A;  2KKC A;  3MDB C;  3SUZ A;  4CHK A;  4AJY B;  4B9K A;  2ZJD A;  3WIM A;  5BO4 B;  3KUZ A;  5L81 A;  1NTY A;  1C1Y B;  3ZKJ C;  5CHV C;  4A3O A;  4Z2N A;  3NHE B;  4TQ0 A;  2LJ5 A;  4P7I A;  5L95 C;  1Z87 A;  2LKO A;  3SV1 A;  1Y8R C;  3EEC A;  1TXD A;  1IRS A;  1Z2M A;  3UQA A;  1E7U A;  5LOP B;  1FHO A;  3KZ1 A;  1SHC A;  1V49 A;  5G2N A;  1E7V A;  1WJN A;  4EZK A;  1K5D B;  2D9V A;  2BKR B;  3ZTC A;  2ABD A;  3DXD A;  2JRI B;  2DAJ A;  3WAL A;  1XCG A;  3UIN B;  2Z59 B;  1W1D A;  1KI1 B;  1J8C A;  2WX1 A;  2KTR A;  1RFA A;  2CY4 A;  2JRH A;  2L0T A;  3P7Z A;  5KCV A;  4E71 A;  2LWP A;  3ZNI D;  2K1F A;  4LDT D;  3BY4 B;  4BOS C;  3APF A;  5J17 A;  3JSV B;  3DBS A;  3U7D A;  3QWZ B;  2MWS B;  3CXB B;  1UH6 A;  3N30 A;  3PS6 A;  2FNJ B;  2FID A;  3RUL A;  1Q67 A;  1G6J A;  2CQU A;  3A98 B;  3T06 A;  3QX1 A;  2LZ6 A;  1V5T A;  4HDO A;  3PGE A;  4WJQ A;  4JLC A;  4B6W A;  2YF0 A;  2NPT A;  2LYD A;  3QA8 A;  5JHA A;  4F7U P;  3V6E B;  4M0W B;  1V2Y A;  5L83 A;  2ZCB A;  2LVP A;  4TQ1 A;  4ICV A;  2ASQ A;  3V6C B;  1XT9 B;  2R2O A;  4GMV A;  4W9F A;  3MHS D;  2D9W A;  2G4S A;  4HAY B;  1V86 A;  2LVQ A;  4ZYN A;  1R4N I;  2KDI A;  4KDI C;  2XQN M;  3B08 A;  5KHQ A;  4A6F A;  4FLH A;  4HAU B;  5FI0 A;  1LB1 A;  2RR9 A;  4GDK B;  2FCQ A;  4KIK A;  1RAX A;  2BYE A;  2KD0 A;  1LQB A;  2YS1 A;  4W9J A;  2K6D B;  2NZ8 B;  2GBM A;  2Y7B A;  5GOW B;  3VUW A;  3AU5 A;  1KOT A;  2KDF B;  2JXX A;  2FUH B;  2FAZ A;  4IW0 A;  1ZM0 A;  1ACA A;  2HTH A;  3OAW A;  4WVF B;  2NVU I;  3DXE A;  5DHF B;  5LXH A;  4HCN B;  5E6O A;  1WRD B;  2FCM A;  2KZR A;  2NBU A;  3N3K B;  1M7R A;  4GIV A;  1UEL A;  3GZN I;  4BKS A;  1V5P A;  3KUC B;  4TV3 A;  3QQ8 B;  3K9O B;  2LG1 A;  1J0G A;  2JZZ A;  2NBV B;  3PSC A;  1FHX A;  3PLV A;  2KQS A;  2WDT B;  1OGW A;  2N9E B;  1ZC3 B;  2FDQ A;  2MX2 A;  2KCJ A;  4IM0 A;  3DDC B;  3RYT A;  2DKQ A;  2Z0O A;  2BWF A;  3QAR A;  2EKE C;  4DDI D;  4WWN A;  2IY0 B;  2N7E A;  4NJ6 A;  3ZLZ A;  3A1Q B;  5CTR C;  2LGY A;  2NR2 A;  2J59 M;  1NU2 A;  4N9F 4;  4F7G A;  3FSS A;  4KHO A;  2ELB A;  5IA7 A;  1NVL A;  1WXV A;  1VCB A;  2DEN B;  1OTR B;  1ZKH A;  3SU8 X;  1GC6 A;  1PMS A;  4HPM B;  1KLV A;  1NBF C;  4CYE A;  4LJP B;  3KSY A;  3V60 A;  2COA A;  4JGH B;  3NZU A;  2V4L A;  1Q1O A;  3D8F A;  4NY0 A;  1WYW B;  3L17 A;  4GB9 A;  4WJO A;  2GJY A;  5FI1 A;  4HB2 B;  1OEY A;  3SYX A;  2ELA A;  2RVB B;  1SIF A;  2LAS A;  3ML8 A;  4HXD A;  3ULB A;  4K7S A;  5D3Y A;  2XK5 B;  4K1R B;  4HHV A;  1WH3 A;  1P3Q U;  2MBH A;  4ZDV A;  3A4R A;  4DHJ B;  2IO0 B;  4KAX B;  4EFO A;  1LXD A;  3ALB A;  2W2X D;  3H1U A;  3T9L A;  4C0A A;  2RPQ A;  3HQC A;  3PPA A;  2YT1 A;  1P98 A;  5D6J B;  1OY2 A;  1WI0 A;  1J19 A;  2RSU A;  1BTN A;  1XOD A;  3QWM A;  2ADZ A;  2RQ1 A;  3DVN U;  3ML4 A;  2KK8 A;  2WH5 A;  1BT0 A;  1SE9 A;  2M14 A;  4IM3 A;  4EKU A;  1WM3 A;  5EDS A;  5C6R A;  3A8P A;  2LUE A;  3H7P B;  4OVU A;  1HBK A;  5JZE B;  4KVG B;  4DDG D;  2ZNV C;  3ZDT A;  1V6E A;  4W9G A;  3MTN B;  3HK0 A;  1WGG A;  2CHX A;  1WGU A;  2GBN A;  3P6A A;  3PT2 B;  2LGD A;  3H7S A;  1MIZ B;  4MSQ B;  1TTN A;  2JUO A;  3TBL D;  5C5B B;  4PYZ A;  3PHX B;  4FJV B;  4PS8 A;  3UIO B;  5EFX A;  3DPD A;  2MKR A;  3EFU A;  4FAD A;  1WGY A;  5DPR A;  2YT0 A;  2COF A;  2DZK A;  4JL9 A;  1VD2 A;  2QKL A;  3M3J A;  5DPS A;  1E5W A;  3JSV A;  5AZH A;  4KHB B;  4KDL B;  2GCL A;  4MGY E;  2IZV B;  4K2O A;  1U29 A;  2DTC A;  1HB8 A;  2D9X A;  4W9C A;  4B95 A;  1U5D A;  1RJ2 A;  3ZRC A;  1H8C A;  3PHW B;  3VAW A;  3Q3J A;  2L7R A;  3RZF A;  4IM2 A;  4I6P A;  1GJZ A;  3BIN A;  4HAX B;  1B55 A;  2MFQ A;  1T0Y A;  4NQK E;  1PLS A;  3SO6 A;  3C0R B;  2K6Q A;  5FR6 A;  2V76 A;  2PE9 A;  1WM2 A;  3SD5 A;  4DK5 A;  1I2H A;  1DDV A;  2L05 A;  5DIF B;  3RD2 A;  4F8C B;  1S3S G;  4A20 A;  2VRW B;  5JHB A;  3DQV A;  3DBL I;  3R3M A;  3M1I B;  4MK0 A;  2KUP A;  4K7U A;  4GDK A;  4RM9 A;  3M63 B;  2LUL A;  4DBG A;  4A3P A;  4G3X B;  1NTV A;  1M7E A;  3ZW3 A;  2K2U A;  2VSZ A;  3N7C A;  2O2V B;  1MAI A;  5J3Q A;  1CMX B;  3L08 A;  3PRP B;  4E3C A;  3ZRF A;  1EF5 A;  2KJR A;  4HVB A;  2JVC A;  1LW3 A;  5IJM A;  4I6N B;  2GBR A;  1V61 A;  2DHJ A;  4MGI E;  2DA0 A;  2J7Q B;  5CHF A;  3OJ3 A;  1PQS A;  2AWT A;  3D8D A;  1OMW A;  1WJU A;  1X11 A;  2PZ1 A;  5D7G A;  3PLU A;  5DH9 B;  2XBB C;  5DI9 B;  1X1G A;  3NY5 A;  2D3G A;  2JF5 A;  4GU2 A;  2L76 A;  5KHO A;  2KLC A;  3VFK A;  1V81 A;  1YD8 U;  1IP9 A;  1ST7 A;  2JT4 B;  3VHT C;  4GSW A;  4AJW A;  4G0N B;  1C3T A;  2DKP A;  4WSF A;  4BKG A;  3R7R A;  4IG7 B;  5TR5 A;  2DHI A;  1TBE A;  4HB4 B;  3A1Q A;  1XR0 B;  2CY5 A;  1Y5O A;  1WXA A;  2LVO A;  1FXT B;  5IAA C;  3PZD A;  3S2A A;  3VVW B;  1AQC A;  1WXS A;  2K00 A;  2JZ3 B;  1I42 A;  1S1Q B;  2A5U A;  2DYM A;  4G50 A;  1U5E A;  3F5R A;  2MRP A;  3QJZ A;  3V61 A;  1WFY A;  1P9D U;  4GPT B;  2K2J A;  2ZPY A;  2ZEQ A;  4DHJ D;  2IFS A;  3RZW C;  3AI5 A;  2GCJ A;  2N9X A;  2XK5 A;  2D2Q A;  2VRR B;  3PVL A;  2O6V B;  4RM8 A;  3VH3 B;  4ZRK A;  3SDL C;  3VUX A;  1KM7 A;  1HB6 A;  4MJS B;  4DX8 A;  2LRW A;  1SGH A;  4AP4 C;  3L10 B;  2CAY A;  2P0D A;  3WAP A;  3TVV A;  4EEW A;  2L1C A;  2JPH A;  1MK9 B;  2LD9 A;  1QQG A;  2KQ7 A;  2YLM A;  1WXM A;  1HE8 A;  2P0F A;  1WY8 A;  5C79 A;  2BGF A;  4HPL B;  3P2B A;  1EO6 A;  1IYF A;  2OOB B;  4AOF A;  3TW1 A;  3WAM A;  3VXW A;  1EVH A;  2CRF A;  2COP A;  1F9J A;  4MH0 E;  4A5K A;  1ZW7 A;  4F1S A;  4H8S A;  2K8H A;  2REX A;  1EAZ A;  3H7P A;  3MPX A;  2M17 A;  5LON B;  3PRE A;  4HJK A;  1E8Y A;  2GBK A;  5D94 A;  3EHV A;  5HE1 A;  1UBI A;  4CO7 A;  1Q0W B;  3ZTD A;  1WG7 A;  3VQI A;  3JW0 X;  3TIX A;  2WX0 A;  3OJ4 B;  3QCA A;  5C5B A;  3UIP B;  2LOZ A;  3IHP C;  2COC A;  2GBJ A;  3U30 A;  1P3R A;  1EGX A;  5D27 A;  1MK7 B;  1OQN A;  4B6H A;  1V5O A;  2CKH B;  4FUL A;  3A9J B;  4BKT A;  2BF8 B;  4WWP A;  2MBE A;  1LFD A;  4DWF A;  3BJI A;  3A4S C;  4IWQ A;  1KZ7 A;  1YQB A;  4DXA B;  4IWO A;  2NMB A;  3JVZ X;  2KN5 A;  4DX9 0;  2MSE D;  3ZVV A;  4GN1 A;  2C7N B;  2YSZ A;  2DAF A;  2RSG A;  3TFM A;  3VDZ A;  4OVV A;  2BYF A;  3N32 A;  1X86 A;  5KQ1 A;  2AYO B;  2CB8 A;  1OQY A;  2KFK B;  2KC1 A;  4EJN A;  3M62 B;  1MG8 A;  4GOC A;  1DDW A;  1NDD A;  3TMP B;  3DXC A;  3HW2 B;  3HIZ A;  4HLE A;  1L7Y A;  1WVH A;  2BYV E;  1WX9 A;  1Y19 B;  4KHA A;  1BAK A;  1Z5S B;  2AEH A;  2D9Y A;  3X23 A;  3VTU A;  2UYZ B;  4GXB A;  4HK2 A;  2C9W B;  5C16 A;  5CHW A;  2O2V A;  1MKE A;  3TO1 A;  3NZS A;  5AZF A;  4XWX A;  2IYD B;  1WJ1 A;  3ZNG C;  4TYZ A;  3O65 B;  2PEA A;  2DYB A;  3QIJ A;  2FJL A;  4CHM A;  1XX0 A;  3IG3 A;  5D3W A;  2EJ8 A;  4D0N B;  2KTR B;  3TJP A;  2CU1 A;  4DHZ B;  1UNR A;  4Y94 A;  1NTI A;  2CHZ A;  3JYU A;  1WJ6 A;  2D9Z A;  1U5F A;  4FJY A;  1MPH A;  3UZT A;  1H4R A;  1KZG A;  4W9K A;  4JQW C;  4PS7 A;  1I35 A;  5AZG A;  2C60 A;  2UVM A;  5C23 A;  4NNJ B;  3B1L X;  2N1V A;  3TCA A;  4WJ7 A;  5HKH A;  1IPG A;  1FGY A;  2IO1 B;  3GOE A;  3T8M A;  2RGF A;  2Q13 A;  2HD5 B;  4II2 B;  2KX3 A;  3KYD D;  2RD0 A;  2YS3 A;  2C5L C;  1U4A A;  4FHK A;  4X57 B;  4IOY X;  3FP5 A;  1X05 A;  1P5T A;  4HAW B;  2G4D B;  3ECI A;  2PPH A;  4HDQ A;  4MEL A;  2EMT A;  2KDE B;  3KVF B;  1W1G A;  1EF1 A;  2LI5 A;  4PYU A;  2KO3 A;  2K39 A;  2MLB A;  2MBQ A;  2O6V D;  3VH4 B;  4GGQ A;  2KVR A;  2NCN A;  4WJN A;  1ZC4 B;  2CHW A;  4CHJ A;  1FOE A;  2O6V A;  2DHK A;  3K9P B;  1UGM A;  4NQL B;  2J0M A;  1DRO A;  4MJS A;  3O96 A;  4ZRI A;  3PV1 A;  3DBR I;  3ONS A;  2QHO A;  2N9P C;  3UQB A;  4ANV A;  1K5G B;  1WGQ A;  2Y5B B;  1TJ6 A;  3A9K B;  1D3Z A;  3CST A;  3EC8 A;  1WF9 A;  3R7Q A;  5JLJ B;  1BTK A;  1U27 A;  1YX6 B;  4BOZ B;  3ZUN A;  1DYN A;  4WWO A;  1TGZ B;  5HE2 A;  4XX5 A;  3ODW A;  2FCS A;  1GNU A;  1V88 A;  3I3T B;  2MW5 A;  4HCP B;  2KMA A;  2D07 B;  2ROV A;  4MT7 A;  2KDB A;  2L8J A;  3FLV A;  2IO2 B;  1E8X A;  2KX0 A;  3AJ4 A;  1WIA A;  1P1A A;  3QBV B;  4EMO A;  2H7E A;  2IO3 B;  1WJM A;  3RCZ A;  4EZJ A;  2MA9 B;  3A9J A;  4Z2M B;  3V62 A;  2KWV B;  1R4M I;  3AUL A;  5GMV A;  2CR5 A;  4PNK A;  4ICU A;  1LM8 B;  2PJH A;  2DZI A;  2DN6 A;  2XEW A;  2QKM A;  4PQ0 A;  3Q3F A;  3ML9 A;  3D32 A;  2V3S A;  2UZR A;  3GYO A;  2M38 A; 
#chains in the Genus database with same CATH topology
 5CX3 A;  4BBN F;  5J3T A;  5H92 C;  2BT6 A;  4IAP A;  1XKE A;  2DYN A;  4L1B A;  2J0K A;  1NEN B;  4GZU A;  1TZ1 A;  2G45 B;  2E2X A;  2N1W A;  5D3X A;  1PUT A;  3B2G A;  2L32 A;  3RNF C;  3SBT A;  3FIL A;  2WNM A;  5AEK B;  2N7D A;  1MHH E;  4FN2 A;  2CJO A;  2KFK A;  3H6N A;  4LCD E;  1AAR A;  1SSN A;  2M1M A;  2CS4 A;  3X0W A;  2COD A;  5IKC M;  3LJ3 A;  3RNC C;  4GDL B;  1BWN A;  1F2R I;  2P8V A;  1HA5 A;  2AL6 A;  4YSX B;  5IP4 D;  3KH0 A;  4NAW B;  2AL3 A;  4ILG B;  1FIQ A;  4YTN B;  3W2D A;  1BUI C;  2KLG A;  2G9H D;  4MDK E;  2KWC A;  4RGN A;  1ENF A;  3H8H A;  2NMQ A;  1KLU D;  2XNA C;  1VZ6 A;  2R0D A;  3UF8 A;  2Z0P A;  3RPF C;  4C7Z A;  5I2M A;  1WMH B;  3KUD B;  1UD7 A;  3APD A;  2HE7 A;  3AXC A;  1L2N A;  2J0J A;  4MM3 A;  4HB0 B;  2GMI C;  2WXG A;  3CF6 E;  2A4Z A;  3B0A A;  4JPS A;  4HRS A;  2J52 A;  2ZCC A;  3FM8 C;  3OLM D;  2W82 A;  1FAO A;  3R2I A;  3TL5 A;  4M8N A;  4BFR A;  2WWZ A;  4B0M A;  2RMM A;  3MFG A;  2K49 A;  1K51 A;  2MBO A;  4DHZ E;  2PVO D;  1JW9 D;  2PVG C;  2MCN B;  3DBH I;  2MP2 B;  3V5W A;  1JCK B;  5H8Y E;  3M95 A;  4K7W A;  1UNQ A;  1FFV A;  4WJP A;  1N63 A;  5G5H A;  4BBK A;  1KTK A;  3L0W B;  3ZNZ B;  2GS0 A;  3ZXR A;  4W9D A;  2C7H A;  1N62 A;  2LGS A;  4ZRJ A;  2BKF A;  3Q69 A;  4PS3 A;  2JP2 A;  1DOX A;  1E9M A;  3NSU A;  5JHH A;  2MBB B;  4ANX A;  5IRS A;  2JX5 A;  1LO5 D;  2K8E A;  5LLI A;  2L00 B;  4IC7 B;  2HRJ A;  3Q3O C;  4K17 A;  2BPS A;  3TEY A;  2Y3A A;  5KQ4 A;  4FJZ A;  2INN E;  3IBE A;  1OEY J;  2DX5 B;  3TEZ A;  2RLO A;  1N60 A;  1P0R A;  4KSL C;  3KY9 A;  3R8B A;  1GB1 A;  3FEH A;  1XLN A;  3ODO A;  4IWP A;  1M4V A;  1YIW A;  1WGR A;  4MGK E;  1YJI A;  1DGJ A;  4XZ4 A;  3CSF A;  1ZGU B;  3PSE B;  3CIR B;  3Q2A C;  3W5U B;  1EUV B;  1TKY A;  3DVG Y;  3KW5 B;  4ZRP A;  3SEB A;  3PRM B;  2VZK B;  3AED B;  2K8C A;  3RCP A;  1WE6 A;  3P4Q B;  1QZE A;  1U2B A;  1M94 A;  2DNF A;  4F7Z A;  1FO4 A;  1GC7 A;  1FPY A;  1FXA A;  2QIL A;  3BK1 A;  1WX7 A;  2DLW A;  1WGD A;  4XYC A;  2EMS A;  2OTX A;  2JWZ A;  4I6L B;  1J7C A;  4AUQ C;  3ETR A;  2Y8F A;  3AE7 B;  3KRX A;  1AWE A;  2E3T A;  5JH5 C;  2DZJ A;  1P7F A;  2EKI A;  2QSD A;  4LNK A;  1P6S A;  2SAK A;  4ILJ A;  1XD4 A;  1YMH E;  3HM6 X;  4WQM A;  4E74 A;  4KZC A;  3A33 B;  1SIJ A;  4URK A;  3NWD A;  2DX1 A;  2G3Q B;  2WXH A;  1K53 A;  2XN9 C;  1TKG A;  1ZDV A;  1GUA B;  4F7H A;  4HJG E;  2W54 A;  5DPT A;  2RUK B;  3ZNH B;  1WR1 A;  1MI1 A;  3GP7 A;  5FR3 A;  4DXF A;  3AMZ A;  3IFW B;  4R3D A;  2MDX A;  2Y8G A;  2LRU A;  4RMA A;  2NTS A;  1ZSQ A;  2LXA A;  3PRZ A;  2IBI B;  2N23 A;  4EZL A;  3AU4 A;  3GYP A;  3DVN V;  4NJC A;  1SE4 A;  2YS5 A;  5MPO A;  1FFU A;  3LDZ E;  4J6I A;  4M01 A;  1ZP0 B;  3N1X C;  4LNI A;  1EWY C;  1WE7 A;  1XLP A;  4BZA A;  2KXJ A;  3VTW A;  5E6N A;  4CQN A;  2KGX B;  1UEF A;  5G55 A;  3F0W A;  4A6H A;  2BBC A;  2EC1 A;  5D2M B;  4BKS D;  1WGH A;  3N20 C;  4UDU C;  1C9F A;  2I5F A;  3A9K A;  5HHD G;  4HAV B;  3KWV A;  1J0W A;  1RYJ A;  2L83 A;  3P42 A;  3MP9 A;  1N6Z A;  4ASW C;  4XC2 A;  3BZD B;  4II3 B;  3QAQ A;  2AQ2 B;  3L54 A;  4G11 A;  1C4C A;  2K22 A;  2FCN A;  1D5X C;  4ARC A;  2BYT A;  2YEP F;  1RRP B;  4HAZ B;  2KJH B;  1W1H A;  3AB5 A;  4LJO B;  2E6X A;  2UWQ A;  2HJ8 A;  2WYQ A;  3NJT A;  2I5C A;  1N61 A;  3NWA A;  5C2T B;  5CLL B;  2L3Z A;  1V9J A;  3DCG A;  2N0Y A;  2YRY A;  2W2W A;  5HE0 A;  2JXT A;  3HHM A;  3A8Q A;  2UZS A;  1YJ1 A;  5I2S A;  4JE3 B;  4KSK C;  3U52 E;  2J42 A;  1XCT L;  2I1J A;  3UGB B;  2RGN B;  1H10 A;  2D11 A;  2JQR B;  2JY6 A;  4ZOH C;  4MEM A;  3I63 C;  1FHW A;  1ZVR A;  1WXQ A;  2VKI A;  1JDE A;  2ROZ B;  3BYY B;  2CU3 A;  2BS3 B;  4MSM B;  4IFS A;  1XD3 B;  2OJR A;  1ESF A;  5E6P A;  4P6V F;  4K3C A;  2Z0D B;  5DHA B;  1RRB A;  4JKC A;  2NS5 A;  4FA6 A;  2LEK A;  3VIA A;  2N7J A;  3L16 A;  3WAN A;  4HB3 B;  3EFC A;  1C77 A;  1UZX B;  1BML C;  3DOW A;  4NSW A;  1RLF A;  4YL8 A;  2IY1 B;  1HXY D;  3GE3 C;  3L13 A;  3U8Z A;  1V89 A;  5CLQ B;  3G9W A;  5GXG B;  1TQZ A;  2BWE S;  3SBG A;  3EA6 A;  1U5G A;  1NI2 A;  1QKZ A;  3WCQ A;  2DYQ A;  2K5P A;  3PO0 A;  3CMM B;  3VUY A;  3SHQ A;  1E8W A;  2INP E;  1X1M A;  1A70 A;  2NBW B;  1FCL A;  1E8Z A;  3OAN A;  4KV2 A;  4MY6 A;  4JIO U;  4K81 A;  1T6B X;  3APC A;  4L6E A;  2KFJ A;  4LDT B;  1I7A A;  4W9H A;  1A5R A;  2EEL A;  2N4F A;  2R2Q A;  4JKF A;  1QF6 A;  3W1S A;  1FXI A;  2LXC A;  2YVC A;  2X0S A;  3PEG A;  2M0X A;  4HEA 1;  4DBB A;  1SXT A;  4GDL A;  2Z0Q A;  1I4R A;  2KC2 A;  4BVU C;  4NAW A;  5JHG A;  2MQJ A;  1WJ4 A;  2IYB A;  1DDM A;  3KYC D;  4PK1 A;  3ZGZ A;  3ZO5 B;  2P0H A;  4AWJ A;  1K8R B;  2NPT B;  1IUE A;  2I1K A;  1QOF A;  4WUR A;  2VH2 A;  1KC7 A;  1WMH A;  2PE6 B;  1XXG A;  4FBJ B;  1FMA D;  2L52 A;  4C4V B;  2MWN B;  1UBQ A;  5EE3 A;  3FVC A;  1XLQ A;  4M8M A;  2FJ9 A;  1I4G A;  2LGX A;  1C4A A;  1I7H A;  4MGZ E;  3PTF C;  2ZVN A;  3CIK A;  1QC6 A;  3PVW A;  2DHZ A;  2M4N A;  1WWT A;  1UNP A;  3BYT B;  3NOB A;  5DCN A;  4A6F B;  2D10 A;  1SJH D;  3ULC A;  2V0G A;  1JRU A;  3ZQ4 A;  2ZVO A;  1HTO A;  1L0X B;  2MP2 A;  2V1Y A;  3GS2 A;  5DPW A;  5FKA C;  2KJ6 A;  4DIX A;  4KIK B;  1IGC A;  4W9L A;  3ENE A;  4EOY A;  1UPQ A;  1V5U A;  4IUM B;  3PZ8 A;  1X1F A;  5LXI B;  5J18 A;  2OJW A;  2KDM A;  3HM3 A;  2LOX A;  3D8E A;  4BBN C;  4YTM B;  2IGG A;  1PDX A;  3AE8 B;  2ZZP B;  3ODX A;  3ZDM C;  1QQR A;  5JP4 A;  2L0F A;  1AWD A;  2ZNV B;  2W9N A;  5D3V A;  3BVG A;  1IBX B;  1XO3 A;  1L0V B;  4YTP B;  4US9 A;  4OT1 A;  1WX8 A;  4CSQ A;  3PG7 A;  2HTM E;  4FHJ A;  2KUQ A;  2HTH B;  1RWS A;  3QK0 A;  2LGI A;  3QC8 B;  1XQQ A;  1V97 A;  2DX5 A;  3DBR B;  4NJ7 A;  4K2P A;  3H9D A;  4JKD A;  2KHW B;  1ET6 A;  2DYO A;  3WYF B;  5G5G A;  3QHT A;  5J3Y A;  4NPN A;  4WAA A;  1E90 A;  2KAN A;  2VZK D;  2WXM A;  4S0R A;  4KGT A;  3RT3 B;  1PFJ A;  1V80 A;  1ZE3 D;  1I4Q A;  3SNH A;  1ACC A;  2ZW0 A;  4OVZ A;  4REZ A;  3VTV A;  5J2R A;  5C1Z A;  2BCJ A;  5IN7 A;  3IVF A;  1Q5W B;  3KQ4 A;  2K25 A;  1FGZ A;  3L4P A;  3Q8B A;  1WZ0 A;  2DFK A;  2HDE A;  4W9E A;  4GMX B;  1PFD A;  2G35 A;  3VR8 B;  1TS3 A;  2V9H A;  3U12 A;  1DBH A;  1L6U A;  4KGR A;  1KJT A;  4A6K A;  3WAO A;  3RUI B;  2IGH A;  2Z0E B;  2IJ0 A;  2R61 A;  4TUU A;  2KOX A;  3VOQ A;  1N3H A;  4YON A;  1WR6 E;  2OQB A;  2KMC A;  2KAC A;  4ANW A;  2FIF A;  3AE5 B;  1B1Z A;  2N9K A;  2WU2 B;  4P1C C;  3PP2 A;  4ANU A;  1FB8 A;  4TKN A;  2KIG A;  2C7M B;  3NS8 A;  1CK1 A;  3DVG X;  2OHF A;  3ZIM A;  1UPR A;  3KRW A;  3WA0 A;  4AQ7 A;  3BVZ A;  2ZPN A;  2GOW A;  3MJW A;  1C79 A;  2B3A A;  1SE3 A;  4EUT A;  1CJE A;  2QC8 A;  3CWI A;  2X18 A;  2M8S A;  4JKH A;  1ISN A;  1E6E B;  2JU6 X;  1NYQ A;  1OFF A;  1T0R C;  2M19 A;  3V05 A;  4W9I A;  4DXG A;  4LK0 M;  4Q2J A;  3W1Y A;  1WI1 A;  1ZPS A;  4HAT B;  4KZ0 A;  1GG3 A;  3LJU X;  2KNB A;  3W1S C;  1GOZ A;  3EPY A;  3SFD B;  1L6V A;  2QIE B;  1YX5 B;  2R09 A;  3P63 A;  1R7S A;  2W2X C;  5HE3 A;  2ON8 A;  2LHD A;  1VBG A;  1WZ3 A;  2LBB A;  2H7D A;  1MIX A;  1F2R C;  2KTF A;  3RN9 C;  2WXL A;  3IT6 B;  4IDI A;  1EU3 A;  4WQO B;  3PVU A;  3ZVR A;  1T0S C;  2KWU B;  2L2I A;  3R66 C;  2DZM A;  1YN5 A;  1ZYI A;  1VZ7 A;  2BS2 B;  2D4Q A;  4HWI B;  4M00 A;  2RNR B;  2K8B A;  4OZA A;  1V5M A;  2KKC A;  3MDB C;  4JK7 A;  3SUZ A;  4CHK A;  4AJY B;  4B9K A;  1D5M C;  2IPK D;  4IOI E;  2ZJD A;  3WIM A;  5BO4 B;  1FD6 A;  3KUZ A;  2X8X X;  3OG5 A;  3IXS A;  4TSS A;  1UUP A;  1VZ8 A;  5L81 A;  5TSS A;  1NTY A;  2MJE A;  1C1Y B;  3URY A;  3ZKJ C;  5CHV C;  4A3O A;  2D5G A;  1RM6 C;  4Z2N A;  3NHE B;  1J7B A;  4TQ0 A;  2GRI A;  2LJ5 A;  4P7I A;  2JSV X;  2ZW1 A;  5L95 C;  1Z87 A;  2LKO A;  3SV1 A;  1Y8R C;  1J7A A;  3EEC A;  1TXD A;  1F77 A;  1IRS A;  4LTU A;  1Z2M A;  3UQA A;  3RNB C;  1E7U A;  5LOP B;  1FHO A;  3KZ1 A;  2QMT A;  1SHC A;  1V49 A;  5G2N A;  1E7V A;  1WJN A;  2QDF A;  4EZK A;  1K5D B;  2D9V A;  2BKR B;  3ZTC A;  2ABD A;  2KVZ A;  1RFK A;  1I4P A;  3DXD A;  3HRD D;  3P4P B;  1FNU A;  5T8I A;  2JRI B;  2DAJ A;  1QT9 A;  3WAL A;  1XCG A;  3AE3 B;  3UIN B;  5C3J B;  2Z59 B;  2JZP A;  1W1D A;  4KGS A;  1KI1 B;  3TEW A;  1J8C A;  2PMV A;  2WX1 A;  2Q5W D;  4YSY B;  3DBH B;  2KTR A;  1RFA A;  2CY4 A;  4WWM A;  3Q8E A;  2JRH A;  2L0T A;  3P7Z A;  5KCV A;  4E71 A;  2LWP A;  3B9J A;  3ZNI D;  2K1F A;  4LDT D;  3BY4 B;  4BOS C;  1E10 A;  3APF A;  4DQO C;  5IOI A;  5J17 A;  3JSV B;  4MT5 A;  3DBS A;  2K9X A;  3U7D A;  4S17 A;  3UI3 A;  3V3X A;  3QWZ B;  2QJL A;  2MWS B;  3CXB B;  1UH6 A;  3N30 A;  4FXC A;  3PS6 A;  1TS2 A;  2FNJ B;  1UGJ A;  2FID A;  1JRO A;  2LMC A;  4YWG G;  3RUL A;  1Q67 A;  4USA A;  1G6J A;  2CQU A;  3AV8 A;  3A98 B;  3T06 A;  1KLG D;  3QX1 A;  1XEE A;  2LZ6 A;  3W5V B;  1V5T A;  3ZJT A;  4HDO A;  2Y5P A;  3PGE A;  1DYQ A;  3I57 A;  4GLS C;  4WJQ A;  4JLC A;  4B6W A;  2YF0 A;  2NPT A;  1KBL A;  2LYD A;  3GB1 A;  3QA8 A;  5JHA A;  4F7U P;  3V6E B;  4M0W B;  1V2Y A;  3NVV A;  5L83 A;  2ZCB A;  2LVP A;  4KKI A;  4TQ1 A;  4C4V A;  3RI7 C;  1L0Y B;  2BVC A;  4ICV A;  2ASQ A;  3V6C B;  1XT9 B;  3I9V 1;  2R2O A;  4GMV A;  2YEP B;  1PGX A;  2MJD A;  2WXF A;  4W9F A;  3MHS D;  4LLG M;  2D9W A;  3NS1 A;  4GNK B;  2G4S A;  4HAY B;  1V86 A;  2LVQ A;  4ZYN A;  1R4N I;  3SR6 A;  3NRZ A;  2ICI A;  3P4S B;  2KDI A;  4KDI C;  4WAF A;  2XQN M;  3B08 A;  5KHQ A;  4A6F A;  4OSN A;  4FLH A;  2IDY A;  4HAU B;  5FI0 A;  1LB1 A;  2RR9 A;  1R4N B;  1FRD A;  1GGO A;  3DHI C;  4GDK B;  2FCQ A;  4KIK A;  4JKG B;  1RAX A;  4LNN A;  2BYE A;  1FNV A;  2KD0 A;  1LQB A;  1V8C A;  3SFE B;  2YS1 A;  4W9J A;  2H88 B;  2K6D B;  1NI3 A;  2NZ8 B;  2GBM A;  2Y7B A;  5GOW B;  3VUW A;  1SE2 A;  3AU5 A;  1F52 A;  1KOT A;  2QEJ C;  4YT0 B;  3U4E G;  2KDF B;  2JXX A;  2FUH B;  2FAZ A;  4JWU C;  1QOB A;  1IBX A;  4IW0 A;  1ZM0 A;  1ACA A;  2HTH A;  3OAW A;  4WVF B;  3ZJV A;  2NVU I;  3DXE A;  4ACF A;  5DHF B;  2WXO A;  5LXH A;  4HCN B;  5E6O A;  1WRD B;  2FCM A;  2KZR A;  2FJU B;  2NBU A;  3N3K B;  2I38 A;  1M7R A;  4RFB A;  4GIV A;  3R2T A;  4O1N A;  1UEL A;  3GZN I;  4BKS A;  3DHH C;  1V5P A;  3KUC B;  4TV3 A;  1MFW A;  2BB5 A;  5JVL A;  3NG0 A;  3QQ8 B;  1VR9 A;  2V4I B;  3K9O B;  3ZJU A;  2LG1 A;  1J0G A;  3GZN B;  2JZZ A;  2CJN A;  1NEK B;  2NBV B;  2FE8 A;  4RCO A;  3PSC A;  1FHX A;  2GUM A;  4JKE A;  3PLV A;  2KAJ A;  3ZYY X;  2KQS A;  1ZOY B;  1TS5 A;  3BK2 A;  2WDT B;  1ROE A;  1OGW A;  2N9E B;  1ZC3 B;  2FDQ A;  2MX2 A;  2KCJ A;  4IM0 A;  4RGT A;  4XDC A;  3DDC B;  4EE2 A;  1EU4 A;  3RYT A;  2DKQ A;  2Z0O A;  2BWF A;  3QAR A;  2EKE C;  1ET9 A;  2IND C;  4OZC A;  4WWN A;  4DDI D;  2IY0 B;  2N7E A;  3P4R B;  4NJ6 A;  3RNA C;  3ZLZ A;  3A1Q B;  2H89 B;  5CTR C;  2LGY A;  2NR2 A;  5BMI A;  2J59 M;  1SF0 A;  2BQQ A;  1NU2 A;  4N9F 4;  4F7G A;  3FSS A;  4A90 A;  4KHO A;  2ELB A;  5IA7 A;  1NVL A;  1WXV A;  1B9R A;  2MEK A;  1VCB A;  4RF1 A;  2DEN B;  4B0E A;  3AH7 A;  1UWX A;  1OTR B;  1TY0 A;  5HI1 A;  1ZKH A;  3SU8 X;  2HJ1 A;  1GC6 A;  1PMS A;  4HPM B;  1KLV A;  4NAM A;  2BB6 A;  1NBF C;  4CYE A;  4LJP B;  1P7E A;  4HRO A;  3KSY A;  1XLO A;  3ZXV A;  3V60 A;  1AN8 A;  4RNA A;  2COA A;  1N5X A;  3MHZ A;  4JGH B;  3NZU A;  2GI9 A;  2V4L A;  1Q1O A;  3D8F A;  4NY0 A;  1WYW B;  3L17 A;  4GB9 A;  4WJO A;  2GJY A;  2DWQ A;  5FI1 A;  1STE A;  4H2A A;  2PTL A;  4HB2 B;  4YSZ B;  4LNO A;  2MHJ A;  1OEY A;  3SYX A;  2ELA A;  2RVB B;  1Y56 A;  1SIF A;  2D3A A;  5AUI A;  2LAS A;  1MG4 A;  4LNF A;  3ML8 A;  4HXD A;  3ULB A;  4K7S A;  5D3Y A;  2PIA A;  2XK5 B;  4HHV A;  1WH3 A;  4K1R B;  2BTE A;  1NYR A;  1P3Q U;  2MBH A;  4ZDV A;  1XCQ L;  3A4R A;  4DHJ B;  2IO0 B;  4KKJ A;  4KAX B;  4EFO A;  1LXD A;  3ALB A;  1F1H A;  1MJD A;  2W2X D;  3H1U A;  3T9L A;  4C0A A;  2RPQ A;  3HQC A;  3PPA A;  2YT1 A;  1P98 A;  3BII D;  5D6J B;  1OY2 A;  2YT2 A;  1WI0 A;  1TJE A;  1J19 A;  2IGD A;  2RSU A;  1BTN A;  1XOD A;  3MC0 B;  4P16 A;  3QWM A;  2ADZ A;  2RQ1 A;  1VDV A;  1YQ4 B;  3ML4 A;  3DVN U;  1ZDX A;  3AEA B;  3EUB 2;  2KK8 A;  2WH5 A;  3DWM A;  1BT0 A;  1SE9 A;  5HFY A;  2M14 A;  4IM3 A;  2D3C A;  4EKU A;  1T3Q A;  1WM3 A;  5EDS A;  2WS3 B;  3IT4 B;  4XDD A;  5C6R A;  3A8P A;  3IAM 1;  2L1A A;  2KIE A;  1BXT A;  2LUE A;  4XWT A;  3H7P B;  2BW2 A;  4OVU A;  1HBK A;  3E9P A;  3DHG C;  1JWM D;  3J9C A;  5JZE B;  4KVG B;  4DDG D;  2ZNV C;  3ZDT A;  1V6E A;  4W9G A;  3MTN B;  2D3B A;  3T3O A;  3HK0 A;  2INC C;  1WGG A;  2WDV B;  2BS4 B;  1WGU A;  2CHX A;  4WH4 A;  2GBN A;  3P6A A;  3PT2 B;  5D3D A;  2LGD A;  3H7S A;  1MIZ B;  3NVZ A;  2Z59 A;  4MSQ B;  1TTN A;  2JUO A;  3TBL D;  2WXJ A;  3DWG C;  5C5B B;  3AEC B;  4C56 C;  4PYZ A;  3PHX B;  1YN3 A;  1C4P A;  4FJV B;  4PS8 A;  2FUG 1;  3UIO B;  3MC9 A;  2Z14 A;  5EFX A;  3DPD A;  2JWU A;  2MKR A;  3EFU A;  4HPP A;  5BYQ A;  4FAD A;  2KYW A;  1WGY A;  5DPR A;  2YT0 A;  2COF A;  2DZK A;  5E6J A;  4JL9 A;  2R2Y A;  1VD2 A;  2QKL A;  3M3J A;  1MVK A;  5DPS A;  1E5W A;  3KWL A;  2WDR B;  3JSV A;  5AZH A;  1Q10 A;  4KHB B;  4KDL B;  2GCL A;  5BYS A;  4MGY E;  2IZV B;  5I4D A;  2W55 A;  4MAC A;  1TZO A;  4K2O A;  1U29 A;  1SBB B;  2DTC A;  4JKB A;  1HB8 A;  2D9X A;  4W9C A;  4B95 A;  1U5D A;  3KLS X;  2RRF A;  2AQ3 B;  1RJ2 A;  3ZRC A;  1H8C A;  3PHW B;  2WXI A;  3VAW A;  3AE6 B;  4OZB A;  3Q3J A;  4KX6 B;  4L1R A;  2L7R A;  3RZF A;  4IM2 A;  4I6P A;  1GJZ A;  3BIN A;  2QCZ A;  4HAX B;  1B55 A;  2MFQ A;  1T0Y A;  4M0W A;  4NQK E;  1PLS A;  3SO6 A;  4OW0 A;  3C0R B;  2K6Q A;  3E9S A;  2K0P A;  2GLS A;  5FR6 A;  2V76 A;  2PE9 A;  1WM2 A;  2PKO A;  3SD5 A;  4DK5 A;  4TMA B;  1I2H A;  1GB4 A;  4RGM A;  1TIF A;  1QLB B;  1D4B A;  2KWD A;  1JWU D;  1L4D B;  1DDV A;  2L05 A;  5DIF B;  3RD2 A;  4F8C B;  1S3S G;  4A20 A;  2VRW B;  1WRI A;  5JHB A;  3DQV A;  3DBL I;  3R3M A;  3M1I B;  4MK0 A;  2KUP A;  4K7U A;  3ENB A;  4GDK A;  2WXN A;  4RM9 A;  4JKG A;  3M63 B;  2LUL A;  4DBG A;  4A3P A;  1V1P B;  4G3X B;  1NTV A;  3VRA B;  1M7E A;  3ZW3 A;  2K2U A;  2VSZ A;  3N7C A;  2O2V B;  3T3N A;  3AE1 B;  4P1B C;  4JX1 C;  1MAI A;  5J3Q A;  1CMX B;  1YOV B;  3L08 A;  1WGK A;  3PRP B;  3HSA A;  4E3C A;  2WXP A;  1JQ4 A;  2WDQ B;  3U7Z A;  3ZRF A;  1K52 A;  1EF5 A;  1UWM A;  2KJR A;  4HVB A;  1D5Z C;  1LW3 A;  2JVC A;  5IJM A;  1NVI D;  4I6N B;  1HEZ E;  5BMH A;  2GBR A;  1V61 A;  4ITK A;  2DHJ A;  4MGI E;  2Z8L A;  1PGA A;  2DA0 A;  2J7Q B;  5CHF A;  3OJ3 A;  1PQS A;  2AWT A;  3D8D A;  2M56 B;  3AEE B;  1OMW A;  1WJU A;  1X11 A;  2RPV A;  5BMG A;  1YN4 A;  2PZ1 A;  5D7G A;  3PLU A;  1FM0 D;  2J4X A;  3MC8 A;  5DH9 B;  2XBB C;  4D2K A;  2DBY A;  5HG2 A;  5DI9 B;  1X1G A;  2NBV A;  3NY5 A;  2WXR A;  2D3G A;  2JF5 A;  4GU2 A;  2L76 A;  5KHO A;  2KLC A;  3VFK A;  1V81 A;  1YD8 U;  1IP9 A;  3RNE C;  3BWU D;  1ST7 A;  1KFY B;  2JT4 B;  2WHI A;  3VHT C;  4GSW A;  4OHJ A;  4AJW A;  1IGD A;  4G0N B;  3NVW A;  4N58 A;  1C3T A;  2DKP A;  4WSF A;  4BKG A;  3R7R A;  1KF6 B;  4IG7 B;  5TR5 A;  2WXQ A;  2DHI A;  1TBE A;  4HB4 B;  3A1Q A;  1XR0 B;  2CY5 A;  1Y5O A;  1WXA A;  3OWE B;  1JML A;  3DCX A;  2NTT A;  2W3S A;  2LVO A;  1JWS D;  1FXT B;  5IAA C;  3AE2 B;  3PZD A;  1T77 A;  3S2A A;  2PLP A;  2V3N A;  1WYG A;  3LXF A;  2WU5 B;  4PT5 A;  3VVW B;  1FCC C;  4ZRQ A;  2PW9 A;  3I5J C;  1AQC A;  2R82 A;  3A58 A;  2B76 B;  1WXS A;  2K00 A;  3TEX A;  2JZ3 B;  2JYT A;  1I42 A;  1S1Q B;  4RGO S;  2A5U A;  2DYM A;  4G50 A;  3C19 A;  1U5E A;  3F5R A;  2MRP A;  4N59 A;  1JWB D;  3QJZ A;  3V61 A;  1WFY A;  1I4X A;  1CZP A;  1P9D U;  4GPT B;  3NZ3 A;  4L2Y A;  2K2J A;  2ZPY A;  2ZEQ A;  4DHJ D;  2IFS A;  1MPE A;  5BYR A;  3RZW C;  3AI5 A;  4K3B A;  2GCJ A;  2N9X A;  2XK5 A;  4IKG A;  2D2Q A;  2VRR B;  3PVL A;  4ILH A;  2O6V B;  2WP9 B;  4RM8 A;  3VH3 B;  1OQQ A;  1QOG A;  1OQR A;  4ZRK A;  3SDL C;  3VUX A;  1KM7 A;  4C80 A;  1HB6 A;  4MJS B;  4DX8 A;  2LRW A;  1SGH A;  4AP4 C;  3L10 B;  3E9O A;  2CAY A;  2P0D A;  4M02 A;  3WAP A;  4ZHP A;  3TVV A;  4EEW A;  1DOI A;  2L1C A;  2JPH A;  1MK9 B;  2LD9 A;  1QQG A;  2KQ7 A;  2YLM A;  1WXM A;  1HE8 A;  3AE4 B;  2P0F A;  1WY8 A;  5C79 A;  3NUH B;  2BGF A;  4HPL B;  1EO6 A;  2WXK A;  3P2B A;  1IYF A;  2OOB B;  4AOF A;  2X38 A;  3TW1 A;  3WAM A;  3VXW A;  1KRH A;  3E9L A;  1AYF A;  1EVH A;  2CRF A;  2COP A;  1F9J A;  4MH0 E;  1TKE A;  4A5K A;  4ARI A;  1E0Z A;  1ZW7 A;  4MH8 A;  4F1S A;  2I2Y A;  3N1Z C;  4H8S A;  2K8H A;  2REX A;  1EAZ A;  3H7P A;  3MPX A;  2SEB D;  2M17 A;  3MJ5 A;  5LON B;  3PRE A;  4HJK A;  1E8Y A;  2GBK A;  5D94 A;  1ZXH A;  3EHV A;  5HE1 A;  4BAX A;  1UBI A;  4CO7 A;  3NW8 A;  1Q0W B;  1UF0 A;  3ZTD A;  1WG7 A;  3VQI A;  3JW0 X;  1AW7 A;  3TIX A;  2WX0 A;  3OJ4 B;  2VH1 A;  3QCA A;  5C5B A;  3UIP B;  2LOZ A;  3IHP C;  2COC A;  2GBJ A;  3U30 A;  1P3R A;  1EGX A;  3VR9 B;  4JK9 A;  5D27 A;  4US8 A;  2FBW B;  1MK7 B;  1OQN A;  1JAL A;  4B6H A;  1V5O A;  2CKH B;  1T0Q C;  4FUL A;  4WIP A;  3A9J B;  4BKT A;  2WGS A;  4KHB A;  1SEB D;  3Q6B A;  4HKQ A;  2BF8 B;  4WWP A;  1YNT E;  2MBE A;  1LFD A;  2ONQ A;  5EE9 A;  4DWF A;  3BJI A;  4JK8 A;  1TY2 A;  3RFZ B;  3A4S C;  4IWQ A;  1KZ7 A;  3OHM B;  1TS4 A;  1YQB A;  1L4Z B;  5M4Y B;  3Q3M C;  4DXA B;  4IWO A;  3RNG C;  2K3U A;  2RDG A;  3C8Y A;  4QXA B;  2NMB A;  4J3O D;  3AEB B;  3JVZ X;  2KN5 A;  4DX9 0;  2MSE D;  3ZVV A;  1JWA D;  3E56 A;  4GN1 A;  2C7N B;  2YSZ A;  2DAF A;  2RSG A;  1HQR D;  3TFM A;  3VDZ A;  5IO9 A;  4OVV A;  2BYF A;  3N32 A;  1X86 A;  3N1Y C;  3Q3N C;  3FIL B;  5KQ1 A;  2AYO B;  2CB8 A;  1OQY A;  1C78 A;  1FEH A;  3P1M A;  2KFK B;  2KC1 A;  4EJN A;  3M62 B;  1MG8 A;  3Q8A A;  1KH0 A;  4GOC A;  1DDW A;  4A8X C;  1NDD A;  3TMP B;  1K50 A;  3B77 A;  3DXC A;  3HW2 B;  3O13 A;  3HIZ A;  4HLE A;  1L7Y A;  1XF5 L;  1WVH A;  1JRP A;  2BYV E;  4N6E B;  1SB3 C;  3Q8F A;  3AE9 B;  3GE8 C;  4NZL B;  1WX9 A;  1Y19 B;  1FRR A;  4KHA A;  1BAK A;  1Z5S B;  2AEH A;  2D9Y A;  4ZYS A;  3X23 A;  4MM3 B;  3VTU A;  1HZ6 A;  2UYZ B;  1VLB A;  1SJE D;  4GXB A;  5D3I B;  1V1P A;  4HK2 A;  1T5X D;  2C9W B;  5C16 A;  3PZ7 A;  5CHW A;  2O2V A;  1MKE A;  3TO1 A;  3NZS A;  5AZF A;  4XWX A;  2IYD B;  1WJ1 A;  1V1O A;  2AX5 A;  3ZNG C;  4L23 A;  4TYZ A;  4QJ3 B;  3AN1 A;  3O65 B;  2PEA A;  2RDH A;  3HIE A;  2DYB A;  1UNS A;  3QIJ A;  2FJL A;  4CHM A;  1XX0 A;  3IG3 A;  5D3W A;  2EJ8 A;  4D0N B;  2KTR B;  2ZKM X;  3TJP A;  2CU1 A;  3AEF B;  1UNR A;  4DHZ B;  4Y94 A;  3Q14 C;  1NTI A;  1QOA A;  2CHZ A;  3JYU A;  1WJ6 A;  2D9Z A;  1U5F A;  4FJY A;  1MPH A;  5LG4 B;  5AUK A;  3UZT A;  1YQ3 B;  1H4R A;  1KZG A;  4W9K A;  5EE1 A;  4JQW C;  2Z4D A;  2TSS A;  4PS7 A;  1I35 A;  3IAS 1;  5AZG A;  2C60 A;  2UVM A;  1D6E C;  5C23 A;  5LNK 1;  4NNJ B;  2DLB A;  3B1L X;  2N1V A;  1DOY A;  3TCA A;  3E66 A;  3VRB B;  4WJ7 A;  5HKH A;  1QIL A;  4XWW A;  1DIK A;  1E7P B;  1IPG A;  1FGY A;  1MHX A;  2IO1 B;  2KT7 A;  3GOE A;  3T8M A;  2ACZ B;  3Q8C A;  2RGF A;  2LHE A;  2Q13 A;  2Y5C A;  2HD5 B;  3TUO A;  4II2 B;  2DIK A;  2OED A;  2J53 A;  2KX3 A;  3KYD D;  2RD0 A;  1YJJ A;  2YS3 A;  1EWC A;  2C5L C;  1U4A A;  4FHK A;  2GB1 A;  4X57 B;  4IOY X;  1I4H A;  3FP5 A;  1X05 A;  2Z13 A;  4JWS C;  1P5T A;  2MH7 A;  5EE0 A;  4HAW B;  2G4D B;  3ECI A;  3B2F A;  2LJI A;  2PPH A;  4HDQ A;  4MEL A;  5FK9 C;  1WSP A;  2EMT A;  2KDE B;  4HKZ E;  3BVM A;  3KVF B;  1W1G A;  1EF1 A;  2LI5 A;  4PYU A;  2KO3 A;  2K39 A;  4QJ4 B;  2MLB A;  2MBQ A;  1VJK A;  1HTQ A;  2JYE A;  2O6V D;  4RF0 A;  3VH4 B;  4GGQ A;  2KVR A;  2NCN A;  2MJ3 A;  4WJN A;  1ZC4 B;  2CHW A;  4CHJ A;  4A9A A;  2AQ1 B;  1FOE A;  2O6V A;  2DHK A;  3AM9 A;  3K9P B;  1UGM A;  2G1E A;  4NQL B;  4QJ5 B;  2J0M A;  1DRO A;  4MJS A;  1GPX A;  4RH6 A;  3O96 A;  3FC4 A;  4C00 A;  3W9C B;  4ZRI A;  3PV1 A;  4AS1 A;  3DBR I;  3ONS A;  2QHO A;  3HVD A;  2N9P C;  3UQB A;  2W3R A;  1ZUD 2;  4ANV A;  1K5G B;  2LUM A;  4XE0 A;  1WGQ A;  3U2S C;  1PYW D;  2RDB C;  2Y5B B;  1TJ6 A;  3AEG B;  4XGA B;  1LGR A;  3A9K B;  1D3Z A;  3CST A;  1HZ5 A;  3LB8 C;  3EC8 A;  1F0Z A;  2LFI A;  1WF9 A;  1PGB A;  1N5W A;  3R7Q A;  5JLJ B;  1ZXI A;  1BTK A;  5JXV A;  1FNW A;  1U27 A;  1YX6 B;  4BOZ B;  3ZUN A;  1DYN A;  4WWO A;  3TSS A;  4HSI A;  1TGZ B;  4ZHO A;  5HE2 A;  4XX5 A;  1C76 A;  3ODW A;  2FCS A;  1EM7 A;  1GNU A;  1TYG B;  1V88 A;  3I3T B;  2MW5 A;  2V3P A;  1MI0 A;  1L5P A;  4HCP B;  3N9Y C;  2KMA A;  4A55 A;  2D07 B;  2ROV A;  4GOU A;  4MT7 A;  2KDB A;  4A6Q A;  2L8J A;  4QAY A;  3FLV A;  3LYY A;  2IO2 B;  1E8X A;  2KX0 A;  3AJ4 A;  2WLB A;  2M0A A;  1WIA A;  1P1A A;  2KQ4 X;  3NWF A;  3DBL B;  3QBV B;  4EMO A;  3ABV B;  2H7E A;  4C7Y A;  2KMM A;  4JKA A;  3HUI A;  2WQY B;  2IO3 B;  1WJM A;  3RCZ A;  3FAH A;  3RMK C;  1VRA B;  4EZJ A;  2MA9 B;  3A9J A;  4Z2M B;  3V62 A;  3NVY A;  2KWV B;  1TT5 B;  2KR0 A;  1R4M I;  3AUL A;  5GMV A;  2CR5 A;  4PNK A;  4ICU A;  1LM8 B;  2PJH A;  2DZI A;  2N9L A;  2N0S B;  2DN6 A;  2XEW A;  2QKM A;  2UU7 A;  4PQ0 A;  3Q3F A;  3ML9 A;  2KN4 A;  1R4M B;  3D32 A;  1GAQ B;  2V3S A;  2UZR A;  3GYO A;  1VBH A;  3FKY A;  4D6W A;  4YXD B;  1CQV A;  2M38 A;  3EGR A;  3HVZ A; 
#chains in the Genus database with same CATH homology
 5CX3 A;  4BBN F;  5J3T A;  4IAP A;  1XKE A;  2DYN A;  2J0K A;  4GZU A;  1TZ1 A;  2G45 B;  2E2X A;  2N1W A;  5D3X A;  3SBT A;  5AEK B;  2N7D A;  4FN2 A;  2KFK A;  3H6N A;  4LCD E;  1AAR A;  2M1M A;  2CS4 A;  3X0W A;  2COD A;  3LJ3 A;  4GDL B;  1BWN A;  2P8V A;  2AL6 A;  3KH0 A;  4NAW B;  2AL3 A;  4ILG B;  2KLG A;  4MDK E;  2KWC A;  2R0D A;  3UF8 A;  2Z0P A;  3KUD B;  1WMH B;  1UD7 A;  3APD A;  2HE7 A;  3AXC A;  1L2N A;  2J0J A;  4MM3 A;  4HB0 B;  2GMI C;  3CF6 E;  2A4Z A;  3B0A A;  2ZCC A;  3FM8 C;  3OLM D;  1FAO A;  3TL5 A;  4M8N A;  4BFR A;  2WWZ A;  2MBO A;  4DHZ E;  2MCN B;  3DBH I;  2MP2 B;  3V5W A;  3M95 A;  4K7W A;  1UNQ A;  4WJP A;  4BBK A;  3ZNZ B;  3L0W B;  2GS0 A;  4W9D A;  2C7H A;  4ZRJ A;  2BKF A;  4PS3 A;  2JP2 A;  3NSU A;  5JHH A;  2MBB B;  4ANX A;  5LLI A;  2L00 B;  4IC7 B;  2HRJ A;  4K17 A;  2BPS A;  5KQ4 A;  4FJZ A;  3IBE A;  1OEY J;  2DX5 B;  2RLO A;  1P0R A;  4KSL C;  3KY9 A;  3FEH A;  3ODO A;  4IWP A;  1YIW A;  1WGR A;  4MGK E;  4XZ4 A;  3CSF A;  1ZGU B;  3PSE B;  1EUV B;  3DVG Y;  3KW5 B;  3PRM B;  2K8C A;  3RCP A;  1WE6 A;  1QZE A;  1U2B A;  1M94 A;  4F7Z A;  1GC7 A;  1WX7 A;  2DLW A;  1WGD A;  2EMS A;  2OTX A;  2JWZ A;  4I6L B;  4AUQ C;  2Y8F A;  3KRX A;  1AWE A;  5JH5 C;  2DZJ A;  1P6S A;  4ILJ A;  1XD4 A;  3HM6 X;  4E74 A;  4KZC A;  3A33 B;  4URK A;  2DX1 A;  2G3Q B;  1GUA B;  4F7H A;  5DPT A;  2RUK B;  3ZNH B;  1WR1 A;  3IFW B;  2MDX A;  2Y8G A;  2LRU A;  4RMA A;  1ZSQ A;  2LXA A;  3PRZ A;  2IBI B;  2N23 A;  4EZL A;  3AU4 A;  3GYP A;  3DVN V;  2YS5 A;  3LDZ E;  4J6I A;  1WE7 A;  2KXJ A;  3VTW A;  5E6N A;  2KGX B;  1UEF A;  5G55 A;  3F0W A;  4A6H A;  2EC1 A;  5D2M B;  4BKS D;  1WGH A;  2I5F A;  3A9K A;  4HAV B;  1J0W A;  4ASW C;  4XC2 A;  4II3 B;  3QAQ A;  3L54 A;  4G11 A;  2FCN A;  1RRP B;  4HAZ B;  2KJH B;  1W1H A;  4LJO B;  2UWQ A;  2HJ8 A;  2WYQ A;  2I5C A;  5CLL B;  2L3Z A;  1V9J A;  3DCG A;  2N0Y A;  2YRY A;  2W2W A;  5HE0 A;  3HHM A;  3A8Q A;  2UZS A;  1YJ1 A;  4KSK C;  2I1J A;  3UGB B;  2RGN B;  1H10 A;  2D11 A;  2JY6 A;  4MEM A;  1FHW A;  1ZVR A;  2VKI A;  1JDE A;  2ROZ B;  4MSM B;  4IFS A;  1XD3 B;  2OJR A;  5E6P A;  2Z0D B;  5DHA B;  1RRB A;  4JKC A;  2NS5 A;  4FA6 A;  3VIA A;  3L16 A;  3WAN A;  4HB3 B;  1UZX B;  3DOW A;  4NSW A;  1RLF A;  4YL8 A;  2IY1 B;  3L13 A;  3U8Z A;  1V89 A;  5CLQ B;  3G9W A;  1TQZ A;  2BWE S;  3SBG A;  1U5G A;  1NI2 A;  2DYQ A;  3CMM B;  3VUY A;  3SHQ A;  1E8W A;  1X1M A;  2NBW B;  1E8Z A;  3OAN A;  4KV2 A;  4MY6 A;  4JIO U;  4K81 A;  3APC A;  4L6E A;  2KFJ A;  4LDT B;  1I7A A;  4W9H A;  1A5R A;  2N4F A;  2R2Q A;  4JKF A;  3W1S A;  2LXC A;  2YVC A;  2X0S A;  3PEG A;  2M0X A;  4DBB A;  4GDL A;  2Z0Q A;  2KC2 A;  4BVU C;  4NAW A;  5JHG A;  2MQJ A;  1WJ4 A;  2IYB A;  1DDM A;  3KYC D;  3ZO5 B;  2P0H A;  4AWJ A;  1K8R B;  2NPT B;  2I1K A;  1KC7 A;  1WMH A;  2PE6 B;  4FBJ B;  2MWN B;  1UBQ A;  4M8M A;  2FJ9 A;  2LGX A;  4MGZ E;  3PTF C;  2ZVN A;  3CIK A;  1QC6 A;  3PVW A;  2DHZ A;  2M4N A;  1UNP A;  3NOB A;  5DCN A;  4A6F B;  2D10 A;  3ULC A;  1JRU A;  2ZVO A;  2MP2 A;  2V1Y A;  5DPW A;  2KJ6 A;  4KIK B;  4W9L A;  3ENE A;  4EOY A;  1UPQ A;  1V5U A;  4IUM B;  1X1F A;  5LXI B;  5J18 A;  3HM3 A;  2LOX A;  3D8E A;  4BBN C;  2ZZP B;  3ODX A;  3ZDM C;  5JP4 A;  2L0F A;  2ZNV B;  2W9N A;  5D3V A;  1WX8 A;  3PG7 A;  4FHJ A;  3QK0 A;  2HTH B;  3QC8 B;  1XQQ A;  2DX5 A;  4NJ7 A;  4K2P A;  3H9D A;  4JKD A;  2KHW B;  2DYO A;  3WYF B;  3QHT A;  5J3Y A;  4NPN A;  4WAA A;  1E90 A;  2KAN A;  3RT3 B;  1PFJ A;  1V80 A;  3SNH A;  5J2R A;  3VTV A;  5C1Z A;  2BCJ A;  3IVF A;  1Q5W B;  2K25 A;  1FGZ A;  1WZ0 A;  2DFK A;  4W9E A;  4GMX B;  2G35 A;  1DBH A;  1KJT A;  4A6K A;  3WAO A;  3RUI B;  2Z0E B;  4TUU A;  2KOX A;  3VOQ A;  1N3H A;  4YON A;  1WR6 E;  2OQB A;  2KMC A;  4ANW A;  2FIF A;  3PP2 A;  4ANU A;  1FB8 A;  4TKN A;  2C7M B;  3NS8 A;  3DVG X;  3ZIM A;  1UPR A;  3KRW A;  3WA0 A;  2ZPN A;  2GOW A;  3MJW A;  2B3A A;  4EUT A;  2X18 A;  2M8S A;  4JKH A;  1ISN A;  4W9I A;  3W1Y A;  1WI1 A;  4KZ0 A;  4HAT B;  1GG3 A;  3LJU X;  2KNB A;  3W1S C;  3EPY A;  1YX5 B;  2R09 A;  2W2X C;  5HE3 A;  1VBG A;  1WZ3 A;  2LBB A;  2H7D A;  1MIX A;  2KTF A;  4WQO B;  3PVU A;  3ZVR A;  2KWU B;  2L2I A;  3R66 C;  2DZM A;  2D4Q A;  4HWI B;  2RNR B;  2K8B A;  1V5M A;  2KKC A;  3MDB C;  4JK7 A;  3SUZ A;  4CHK A;  4AJY B;  4B9K A;  2ZJD A;  3WIM A;  5BO4 B;  3KUZ A;  5L81 A;  1NTY A;  1C1Y B;  3ZKJ C;  5CHV C;  4A3O A;  4Z2N A;  3NHE B;  4TQ0 A;  2LJ5 A;  4P7I A;  5L95 C;  1Z87 A;  2LKO A;  3SV1 A;  1Y8R C;  3EEC A;  1TXD A;  1IRS A;  1Z2M A;  3UQA A;  1E7U A;  5LOP B;  1FHO A;  3KZ1 A;  1SHC A;  1V49 A;  5G2N A;  1E7V A;  1WJN A;  4EZK A;  1K5D B;  2D9V A;  2BKR B;  3ZTC A;  2ABD A;  3DXD A;  2JRI B;  2DAJ A;  3WAL A;  1XCG A;  3UIN B;  2Z59 B;  1W1D A;  1KI1 B;  1J8C A;  2WX1 A;  2KTR A;  1RFA A;  2CY4 A;  2JRH A;  2L0T A;  3P7Z A;  5KCV A;  4E71 A;  2LWP A;  3ZNI D;  2K1F A;  4LDT D;  3BY4 B;  4BOS C;  3APF A;  5J17 A;  3JSV B;  3DBS A;  3U7D A;  3QWZ B;  2MWS B;  3CXB B;  1UH6 A;  3N30 A;  3PS6 A;  2FNJ B;  2FID A;  3RUL A;  1Q67 A;  1G6J A;  2CQU A;  3A98 B;  3T06 A;  3QX1 A;  2LZ6 A;  1V5T A;  4HDO A;  3PGE A;  4WJQ A;  4JLC A;  4B6W A;  2YF0 A;  2NPT A;  1KBL A;  2LYD A;  3QA8 A;  5JHA A;  4F7U P;  3V6E B;  4M0W B;  1V2Y A;  5L83 A;  2ZCB A;  2LVP A;  4TQ1 A;  4ICV A;  2ASQ A;  3V6C B;  1XT9 B;  2R2O A;  4GMV A;  4W9F A;  3MHS D;  2D9W A;  2G4S A;  4HAY B;  1V86 A;  2LVQ A;  4ZYN A;  1R4N I;  2KDI A;  4KDI C;  2XQN M;  3B08 A;  5KHQ A;  4A6F A;  4FLH A;  4HAU B;  5FI0 A;  1LB1 A;  2RR9 A;  1GGO A;  4GDK B;  2FCQ A;  4KIK A;  4JKG B;  1RAX A;  2BYE A;  2KD0 A;  1LQB A;  2YS1 A;  4W9J A;  2K6D B;  2NZ8 B;  2GBM A;  2Y7B A;  5GOW B;  3VUW A;  3AU5 A;  1KOT A;  2KDF B;  2JXX A;  2FUH B;  2FAZ A;  4IW0 A;  1ZM0 A;  1ACA A;  2HTH A;  3OAW A;  4WVF B;  2NVU I;  3DXE A;  5DHF B;  5LXH A;  4HCN B;  5E6O A;  1WRD B;  2FCM A;  2KZR A;  2NBU A;  3N3K B;  1M7R A;  4GIV A;  1UEL A;  3GZN I;  4BKS A;  1V5P A;  3KUC B;  4TV3 A;  5JVL A;  3QQ8 B;  3K9O B;  2LG1 A;  1J0G A;  2JZZ A;  2NBV B;  3PSC A;  1FHX A;  4JKE A;  3PLV A;  2KQS A;  2WDT B;  1OGW A;  2N9E B;  1ZC3 B;  2FDQ A;  2MX2 A;  2KCJ A;  4IM0 A;  3DDC B;  3RYT A;  2DKQ A;  2Z0O A;  2BWF A;  3QAR A;  2EKE C;  4DDI D;  4WWN A;  2IY0 B;  2N7E A;  4NJ6 A;  3ZLZ A;  3A1Q B;  5CTR C;  2LGY A;  2NR2 A;  2J59 M;  1NU2 A;  4N9F 4;  4F7G A;  3FSS A;  4KHO A;  2ELB A;  5IA7 A;  1NVL A;  1WXV A;  1VCB A;  2DEN B;  1OTR B;  1ZKH A;  3SU8 X;  1GC6 A;  1PMS A;  4HPM B;  1KLV A;  1NBF C;  4CYE A;  4LJP B;  3KSY A;  3V60 A;  2COA A;  4JGH B;  3NZU A;  2V4L A;  1Q1O A;  3D8F A;  4NY0 A;  1WYW B;  3L17 A;  4GB9 A;  4WJO A;  2GJY A;  5FI1 A;  4HB2 B;  1OEY A;  3SYX A;  2ELA A;  2RVB B;  1SIF A;  2LAS A;  3ML8 A;  4HXD A;  3ULB A;  4K7S A;  5D3Y A;  2XK5 B;  4K1R B;  4HHV A;  1WH3 A;  1P3Q U;  2MBH A;  4ZDV A;  3A4R A;  4DHJ B;  2IO0 B;  4KAX B;  4EFO A;  1LXD A;  3ALB A;  2W2X D;  3H1U A;  3T9L A;  4C0A A;  2RPQ A;  3HQC A;  3PPA A;  2YT1 A;  1P98 A;  5D6J B;  1OY2 A;  1WI0 A;  1J19 A;  2RSU A;  1BTN A;  1XOD A;  3QWM A;  2ADZ A;  2RQ1 A;  3DVN U;  3ML4 A;  2KK8 A;  2WH5 A;  1BT0 A;  1SE9 A;  2M14 A;  4IM3 A;  4EKU A;  1WM3 A;  5EDS A;  5C6R A;  3A8P A;  2LUE A;  3H7P B;  4OVU A;  1HBK A;  3E9P A;  5JZE B;  4KVG B;  4DDG D;  2ZNV C;  3ZDT A;  1V6E A;  4W9G A;  3MTN B;  3HK0 A;  1WGG A;  2CHX A;  1WGU A;  2GBN A;  3P6A A;  3PT2 B;  2LGD A;  3H7S A;  1MIZ B;  4MSQ B;  1TTN A;  2JUO A;  3TBL D;  5C5B B;  4PYZ A;  3PHX B;  4FJV B;  4PS8 A;  3UIO B;  5EFX A;  3DPD A;  2MKR A;  3EFU A;  4FAD A;  1WGY A;  5DPR A;  2YT0 A;  2COF A;  2DZK A;  4JL9 A;  1VD2 A;  2QKL A;  3M3J A;  5DPS A;  1E5W A;  3JSV A;  5AZH A;  4KHB B;  4KDL B;  2GCL A;  4MGY E;  2IZV B;  4K2O A;  1U29 A;  2DTC A;  4JKB A;  1HB8 A;  2D9X A;  4W9C A;  4B95 A;  1U5D A;  1RJ2 A;  3ZRC A;  1H8C A;  3PHW B;  3VAW A;  3Q3J A;  2L7R A;  3RZF A;  4IM2 A;  4I6P A;  1GJZ A;  3BIN A;  4HAX B;  1B55 A;  2MFQ A;  1T0Y A;  4NQK E;  1PLS A;  3SO6 A;  3C0R B;  2K6Q A;  5FR6 A;  2V76 A;  2PE9 A;  1WM2 A;  3SD5 A;  4DK5 A;  1I2H A;  1DDV A;  2L05 A;  5DIF B;  3RD2 A;  4F8C B;  1S3S G;  4A20 A;  2VRW B;  5JHB A;  3DQV A;  3DBL I;  3R3M A;  3M1I B;  4MK0 A;  2KUP A;  4K7U A;  3ENB A;  4GDK A;  4RM9 A;  4JKG A;  3M63 B;  2LUL A;  4DBG A;  4A3P A;  4G3X B;  1NTV A;  1M7E A;  3ZW3 A;  2K2U A;  2VSZ A;  3N7C A;  2O2V B;  1MAI A;  5J3Q A;  1CMX B;  3L08 A;  3PRP B;  4E3C A;  3ZRF A;  1EF5 A;  2KJR A;  4HVB A;  2JVC A;  1LW3 A;  5IJM A;  4I6N B;  2GBR A;  1V61 A;  2DHJ A;  4MGI E;  2DA0 A;  2J7Q B;  5CHF A;  3OJ3 A;  1PQS A;  2AWT A;  3D8D A;  1OMW A;  1WJU A;  1X11 A;  2PZ1 A;  5D7G A;  3PLU A;  5DH9 B;  2XBB C;  5DI9 B;  1X1G A;  3NY5 A;  2D3G A;  2JF5 A;  4GU2 A;  2L76 A;  5KHO A;  2KLC A;  3VFK A;  1V81 A;  1YD8 U;  1IP9 A;  1ST7 A;  2JT4 B;  3VHT C;  4GSW A;  4AJW A;  4G0N B;  1C3T A;  2DKP A;  4WSF A;  4BKG A;  3R7R A;  4IG7 B;  5TR5 A;  2DHI A;  1TBE A;  4HB4 B;  3A1Q A;  1XR0 B;  2CY5 A;  1Y5O A;  1WXA A;  2LVO A;  1FXT B;  5IAA C;  3PZD A;  3S2A A;  3VVW B;  1AQC A;  2R82 A;  1WXS A;  2K00 A;  2JZ3 B;  1I42 A;  1S1Q B;  2A5U A;  2DYM A;  4G50 A;  1U5E A;  3F5R A;  2MRP A;  3QJZ A;  3V61 A;  1WFY A;  1P9D U;  4GPT B;  2K2J A;  2ZPY A;  2ZEQ A;  4DHJ D;  2IFS A;  3RZW C;  3AI5 A;  2GCJ A;  2N9X A;  2XK5 A;  2D2Q A;  2VRR B;  3PVL A;  4ILH A;  2O6V B;  4RM8 A;  3VH3 B;  4ZRK A;  3SDL C;  3VUX A;  1KM7 A;  1HB6 A;  4MJS B;  4DX8 A;  2LRW A;  1SGH A;  4AP4 C;  3L10 B;  3E9O A;  2CAY A;  2P0D A;  3WAP A;  3TVV A;  4EEW A;  2L1C A;  2JPH A;  1MK9 B;  2LD9 A;  1QQG A;  2KQ7 A;  2YLM A;  1WXM A;  1HE8 A;  2P0F A;  1WY8 A;  5C79 A;  2BGF A;  4HPL B;  3P2B A;  1EO6 A;  1IYF A;  2OOB B;  4AOF A;  3TW1 A;  3WAM A;  3VXW A;  3E9L A;  1EVH A;  2CRF A;  2COP A;  1F9J A;  4MH0 E;  4A5K A;  1ZW7 A;  4F1S A;  4H8S A;  2K8H A;  2REX A;  1EAZ A;  3H7P A;  3MPX A;  2M17 A;  5LON B;  3PRE A;  4HJK A;  1E8Y A;  2GBK A;  5D94 A;  3EHV A;  5HE1 A;  1UBI A;  4CO7 A;  1Q0W B;  3ZTD A;  1WG7 A;  3VQI A;  3JW0 X;  3TIX A;  2WX0 A;  3OJ4 B;  3QCA A;  5C5B A;  3UIP B;  2LOZ A;  3IHP C;  2COC A;  2GBJ A;  3U30 A;  1P3R A;  1EGX A;  4JK9 A;  5D27 A;  1MK7 B;  1OQN A;  4B6H A;  1V5O A;  2CKH B;  4FUL A;  3A9J B;  4BKT A;  2BF8 B;  4WWP A;  2MBE A;  1LFD A;  4DWF A;  3BJI A;  4JK8 A;  3A4S C;  4IWQ A;  1KZ7 A;  1YQB A;  4DXA B;  4IWO A;  2NMB A;  3JVZ X;  2KN5 A;  4DX9 0;  2MSE D;  3ZVV A;  4GN1 A;  2C7N B;  2YSZ A;  2DAF A;  2RSG A;  3TFM A;  3VDZ A;  4OVV A;  2BYF A;  3N32 A;  1X86 A;  5KQ1 A;  2AYO B;  2CB8 A;  1OQY A;  2KFK B;  2KC1 A;  4EJN A;  3M62 B;  1MG8 A;  4GOC A;  1DDW A;  1NDD A;  3TMP B;  3DXC A;  3HW2 B;  3HIZ A;  4HLE A;  1L7Y A;  1WVH A;  2BYV E;  1WX9 A;  1Y19 B;  4KHA A;  1BAK A;  1Z5S B;  2AEH A;  2D9Y A;  3X23 A;  3VTU A;  2UYZ B;  4GXB A;  4HK2 A;  2C9W B;  5C16 A;  5CHW A;  2O2V A;  1MKE A;  3TO1 A;  3NZS A;  5AZF A;  4XWX A;  2IYD B;  1WJ1 A;  3ZNG C;  4TYZ A;  3O65 B;  2PEA A;  2DYB A;  3QIJ A;  2FJL A;  4CHM A;  1XX0 A;  3IG3 A;  5D3W A;  2EJ8 A;  4D0N B;  2KTR B;  3TJP A;  2CU1 A;  4DHZ B;  1UNR A;  4Y94 A;  1NTI A;  2CHZ A;  3JYU A;  1WJ6 A;  2D9Z A;  1U5F A;  4FJY A;  1MPH A;  3UZT A;  1H4R A;  1KZG A;  4W9K A;  4JQW C;  4PS7 A;  1I35 A;  5AZG A;  2C60 A;  2UVM A;  5C23 A;  4NNJ B;  3B1L X;  2N1V A;  3TCA A;  3E66 A;  4WJ7 A;  5HKH A;  1DIK A;  1IPG A;  1FGY A;  2IO1 B;  3GOE A;  3T8M A;  2RGF A;  2Q13 A;  2HD5 B;  4II2 B;  2DIK A;  2KX3 A;  3KYD D;  2RD0 A;  2YS3 A;  2C5L C;  1U4A A;  4FHK A;  4X57 B;  4IOY X;  3FP5 A;  1X05 A;  1P5T A;  4HAW B;  2G4D B;  3ECI A;  2PPH A;  4HDQ A;  4MEL A;  2EMT A;  2KDE B;  3KVF B;  1W1G A;  1EF1 A;  2LI5 A;  4PYU A;  2KO3 A;  2K39 A;  2MLB A;  2MBQ A;  2O6V D;  3VH4 B;  4GGQ A;  2KVR A;  2NCN A;  4WJN A;  1ZC4 B;  2CHW A;  4CHJ A;  1FOE A;  2O6V A;  2DHK A;  3K9P B;  1UGM A;  4NQL B;  2J0M A;  1DRO A;  4MJS A;  3O96 A;  4ZRI A;  3PV1 A;  3DBR I;  3ONS A;  2QHO A;  2N9P C;  3UQB A;  4ANV A;  1K5G B;  1WGQ A;  2Y5B B;  1TJ6 A;  3A9K B;  1D3Z A;  3CST A;  3EC8 A;  1WF9 A;  3R7Q A;  5JLJ B;  1BTK A;  1U27 A;  1YX6 B;  4BOZ B;  3ZUN A;  1DYN A;  4WWO A;  1TGZ B;  5HE2 A;  4XX5 A;  3ODW A;  2FCS A;  1GNU A;  1V88 A;  3I3T B;  2MW5 A;  4HCP B;  2KMA A;  2D07 B;  2ROV A;  4MT7 A;  2KDB A;  2L8J A;  3FLV A;  2IO2 B;  1E8X A;  2KX0 A;  3AJ4 A;  1WIA A;  1P1A A;  3QBV B;  4EMO A;  2H7E A;  4JKA A;  2IO3 B;  1WJM A;  3RCZ A;  4EZJ A;  2MA9 B;  3A9J A;  4Z2M B;  3V62 A;  2KWV B;  1R4M I;  3AUL A;  5GMV A;  2CR5 A;  4PNK A;  4ICU A;  1LM8 B;  2PJH A;  2DZI A;  2DN6 A;  2XEW A;  2QKM A;  4PQ0 A;  3Q3F A;  3ML9 A;  3D32 A;  2V3S A;  2UZR A;  3GYO A;  1VBH A;  2M38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...