4ZRJA

Structure of merlin-ferm and ctd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
b'PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 88
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrjA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrjA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrjA01
5D27A 1E8ZA 4FHJA 4GSWA 1FB8A 4K17A 1V86A 2IO2B 2UVMA 1ZSQA 2LGDA 4K2PA 3L10B 3PT2B 3H7SA 1U27A 4K81A 2DHJA 2KGXB 3RT3B 2D10A 1LFDA 3TW1A 1WI1A 2EMTA 3UZTA 3WA0A 2MBOA 1J0GA 1S1QB 4TKNA 4DBBA 4WSFA 5L95C 4Y94A 4GZUA 3QC8B 2ZVOA 2M8SA 2CB8A 3VQIA 2M0XA 2DN6A 5C16A 2KTRB 3L0WB 3PREA 5LOPB 4FJZA 1NTVA 3GZNI 3SO6A 2K6QA 1Q0WB 1V2YA 2DYNA 4GOCA 4KDLB 5D94A 3QCAA 4AJYB 4I6LB 1HB8A 2KCJA 3GYPA 4EZJA 1QZEA 3H7PB 1V61A 2AYOB 2DYBA 1DDWA 3WAPA 1ZW7A 2BF8B 3IBEA 2CKHB 1KM7A 5JP4A 2UYZB 3WAOA 2MSED 3FLVA 3T06A 4RM8A 1Z87A 4FA6A 2W2WA 1H10A 2K1FA 4DDGD 2MRPA 4GN1A 4K1RB 1E8XA 1WR6E 2Y7BA 4HCPB 3VTVA 3WYFB 2REXA 1WJNA 4MK0A 4HB4B 4BKSD 3A8PA 1AWEA 4HLEA 1K8RB 4K7UA 3SUZA 4A20A 4A6KA 2C5LC 2J0KA 1X1FA 1S3SG 1FGYA 1MK7B 1ZC4B 2PZ1A 2LASA 4GDLA 1TTNA 1MG8A 3DVNV 3ONSA 4PQ0A 1WJUA 5FI0A 2CODA 5E6PA 4DDID 1UNQA 2C60A 3OLMD 1WR1A 1WE7A 2VKIA 2J0MA 1OTRB 2GBRA 2KWUB 2KTFA 1RAXA 4JIOU 1R4NI 2RGNB 3L13A 2ROZB 5LONB 3L16A 2D9YA 3MDBC 4AWJA 4NY0A 2O2VA 1P3RA 2MWSB 2H7EA 2Z0EB 5DIFB 2G4SA 1NDDA 3PVLA 1TBEA 2LRUA 1YJ1A 4MM3A 2D2QA 4MSQB 1FGZA 1ZVRA 5C5BB 3KYCD 3PPAA 2KJHB 1U29A 1OQYA 1I2HA 2ABDA 2K25A 1W1HA 2RPQA 4G0NB 2GCLA 3KH0A 2Y8FA 1XODA 1WVHA 1K5GB 3AU5A 1BWNA 1CMXB 2WYQA 5IJMA 4HAUB 3S2AA 5J3YA 4YONA 2BYVE 2FJ9A 4KHBB 5KQ4A 2DFKA 3M63B 1IYFA 2MBHA 1RLFA 5D3WA 2Q13A 3EFUA 2IYDB 2L3ZA 2COPA 5JHBA 2KD0A 5CX3A 4MJSB 2E2XA 2KWVB 2N7EA 3GOEA 4Z2MB 1PMSA 1C1YB 2RSUA 4XX5A 5D3XA 2B3AA 2EKEC 2LWPA 4BFRA 3D8EA 3PZDA 2DYQA 3DOWA 2I1JA 1J19A 2DX5B 4KZ0A 3AXCA 1HB6A 4HAVB 4BBKA 2KTRA 2N9EB 2HRJA 4NAWA 1GC7A 2BCJA 3N30A 1K5DB 2JPHA 3AU4A 1P0RA 3H7PA 1YQBA 2ELBA 2NZ8B 4AJWA 3R3MA 2NBVB 3ZRCA 4FJYA 2KX0A 1E5WA 2M4NA 1SE9A 2N0YA 2YT0A 2V76A 4WWOA 2GOWA 2HD5B 1TGZB 2FCSA 2RSGA 1BTNA 2Z0QA 5E6OA 3SV1A 2DHIA 2NCNA 5EDSA 3H6NA 2HE7A 1U4AA 5G2NA 4AUQC 5E6NA 1UH6A 2ZNVC 2R2OA 1EF5A 4F7HA 2JWZA 3MTNB 2KVRA 5IAAC 3X23A 4HPMB 3RYTA 4ANXA 3A4SC 1U2BA 2HTHB 3D8FA 1DYNA 4NNJB 4LCDE 3FSSA 2W2XC 5LLIA 2D9WA 1Q5WB 1V49A 4IFSA 2AWTA 2UWQA 5G55A 1UEFA 4F8CB 3F5RA 2IZVB 4WJNA 2EJ8A 2BKRB 4JL9A 2FNJB 4GGQA 3QWZB 2I1KA 1SIFA 3APFA 4EZLA 2CHXA 3OAWA 1WZ3A 4BVUC 4MH0E 5HE1A 4P7IA 1UNPA 3ALBA 4EFOA 4IAPA 3HIZA 3DCGA 4NPNA 5LXIB 2RVBB 2M1MA 2KFKB 3PG7A 1NI2A 5L81A 3I3TB 1WX8A 1P5TA 5TR5A 2EMSA 2ZNVB 5AZFA 5C5BA 4XC2A 4WWNA 2G3QB 1KI1B 4EZKA 4GDLB 5KHQA 1U5GA 2DKQA 2FDQA 1A5RA 4WAAA 4URKA 4ZYNA 5JLJB 2IYBA 1FOEA 2C9WB 2Z0PA 1U5FA 4HHVA 3A98B 2QKMA 4W9HA 4JLCA 2PE6B 3WALA 3EC8A 5J3QA 4XZ4A 4MELA 3R7QA 5DHAB 4GMVA 3Q3JA 2MBEA 3DBSA 2G4DB 2O2VB 2FIDA 4MJSA 3HHMA 4OVVA 3T8MA 2Z0OA 1J8CA 3RCPA 2N1VA 3UGBB 3A9KB 2OQBA 4KHOA 3KRXA 2PJHA 4MT7A 1PQSA 4CHJA 2YS5A 4EUTA 3MHSD 4EMOA 2I5CA 3U8ZA 4DHJD 2P0HA 2K2UA 4FJVB 2XK5B 1V89A 2CQUA 3B0AA 3ULCA 4PYUA 4W9FA 1DBHA 1KJTA 1MPHA 2RUKB 4DK5A 3TO1A 4MSMB 3KSYA 4KVGB 5J2RA 1XD4A 5D2MB 4LDTB 4B6HA 1UPQA 2N1WA 5JZEB 5GOWB 2ASQA 1IRSA 2FJLA 3V61A 4RM9A 3KY9A 4W9CA 3ZNGC 5J18A 2KOXA 4II2B 4WWPA 2LZ6A 2IY0B 3IHPC 4AP4C 3WIMA 1WM3A 3U7DA 2N7DA 3ENEA 1GUAB 2HTHA 2KWCA 1E7UA 4BBNF 3PP2A 4KV2A 2L2IA 1WE6A 2LYDA 4NAWB 4NQLB 3TMPB 3HK0A 2GBMA 4WJQA 3DBLI 2M14A 5CLQB 1YIWA 1XKEA 3ZTDA 1J0WA 3QA8A 2BPSA 4CHMA 1V88A 2YS3A 4W9KA 3MPXA 3DBRI 2D9VA 1OEYA 1TJ6A 2L0FA 2C7HA 4MEMA 2LD9A 4K7WA 3IFWB 3TCAA 4W9IA 3ZNHB 4WQOB 2R2QA 2ELAA 2EC1A 3DXDA 2A4ZA 5J3TA 2JVCA 1V80A 3DPDA 2KFKA 2KQ7A 2ZCCA 1WMHB 2JZZA 3EHVA 1DDMA 1GNUA 1X1GA 2MX2A 4IM2A 4TUUA 3RZWC 1UNRA 4KZCA 3VTUA 2P0FA 5DPSA 2R0DA 2CRFA 5CHWA 4TQ1A 4IWQA 2XEWA 4TQ0A 2CS4A 2ROVA 4HK2A 2JF5A 4DHZE 1AQCA 2KUPA 1TXDA 1KZ7A 1XT9B 2NBUA 2NPTB 2N23A 2JXXA 3IVFA 3NZSA 3HM3A 3V62A 3ULBA 4CO7A 1V5OA 4B6WA 1KZGA 1WYWB 2DYOA 1WJ6A 2IBIB 1P3QU 3A9KA 2MCNB 3DXCA 1XR0B 2YT1A 3PRMB 3KW5B 2CHZA 4HAZB 2LVPA 2GCJA 4G3XB 4EJNA 1FHOA 4FULA 2L1CA 1L7YA 3ZTCA 4HAXB 2AL6A 2XK5A 1HE8A 3W1YA 3O96A 2KDEB 3JVZX 1BT0A 3U30A 3PS6A 3UIPB 1RRPB 3UQAA 2L8JA 4LJPB 3OJ4B 4F7UP 2IFSA 2QKLA 2MBQA 2D3GA 2O6VD 4IM3A 4HVBA 1XD3B 3PTFC 2DKPA 1E8YA 4FLHA 3A4RA 4HXDA 4W9JA 3VHTC 4MGZE 2RGFA 5KQ1A 1R4MI 2RQ1A 1U5EA 3JSVB 3VVWB 4ICUA 1DDVA 3DXEA 3A9JB 3X0WA 3NS8A 1C3TA 1NU2A 4EKUA 5C6RA 4BKTA 3HM6X 1RFAA 2PE9A 4G50A 1WGYA 1ZC3B 4D0NB 2DTCA 3QJZA 4IW0A 2LXAA 3ZW3A 2AL3A 1FXTB 3W1SC 1EO6A 5C1ZA 2BYEA 3F0WA 3WAMA 3R66C 3H9DA 1GC6A 2RR9A 3HW2B 2CHWA 3K9PB 4TYZA 3APCA 2D9XA 3D8DA 1JRUA 4A6FB 3JW0X 4ANWA 4GMXB 4NJ6A 2DAJA 3QIJA 4IM0A 2COFA 3VH4B 3VIAA 2ZEQA 2G35A 4B9KA 2RLOA 1M7EA 4E74A 3QWMA 2LKOA 4HDOA 2V3SA 3QBVB 3PGEA 3BY4B 3CIKA 3V6CB 1Q67A 5JHGA 2JRIB 1F9JA 1X11A 3CSFA 4HATB 1WMHA 5HE3A 4IG7B 4DWFA 2KX3A 3PRZA 1UD7A 1EF1A 2BYFA 1Y19B 2FCMA 3NOBA 2KANA 1Z2MA 1WGQA 4II3B 5DCNA 3D32A 4JQWC 2FCQA 5FR6A 4FBJB 2Y5BB 4W9LA 2K6DB 2ZVNA 2NPTA 2Z59B 1EVHA 2KLGA 1WG7A 4HB0B 1WH3A 2JUOA 1GJZA 3B1LX 2BGFA 4K7SA 3RD2A 5AZGA 2WDTB 1V5UA 1YX5B 2MWNB 2MLBA 4MDKE 3R7RA 4HB2B 2DX1A 3SNHA 4Z2NA 4I6PA 4L6EA 2KN5A 1VD2A 4PNKA 3CSTA 3LJ3A 2YRYA 1PLSA 1WIAA 1NTYA 2NS5A 3KYDD 2KDFB 3ZO5B 2KHWB 1W1GA 3CMMB 2BWES 4W9EA 2KJ6A 3TFMA 3AI5A 2GBKA 2VRRB 2FUHB 5DPTA 3SD5A 3PHXB 2UZSA 4GU2A 3WANA 5DPWA 4BOSC 3VUYA 3ZLZA 3N7CA 1DROA 2MFQA 2C7MB 1G6JA 3PLUA 3C0RB 3OJ3A 2WWZA 5JHAA 1W1DA 4HB3B 3JSVA 2CY4A 3P7ZA 3M95A 2Y8GA 2LI5A 1RRBA 4NJ7A 1QC6A 1IP9A 3RULA 4DX8A 3A9JA 2KC1A 5C23A 3H1UA 2FIFA 5LXHA 4M8MA 1UPRA 4KSLC 3APDA 5C79A 1WJMA 1UGMA 1V5TA 1WFYA 4DHZB 4HAYB 4BKSA 1WI0A 2ADZA 3ZNZB 1SGHA 3OANA 4OVUA 4NSWA 4LJOB 2ZCBA 1XX0A 2ZJDA 4BOZB 1ACAA 2WH5A 2KC2A 1OQNA 3L08A 4A6FA 1BAKA 2COAA 2X18A 1WXVA 2C7NB 1NVLA 2MQJA 3PLVA 1BTKA 1FHXA 4E71A 1MAIA 3V5WA 1LM8B 2ZPNA 4NQKE 2UZRA 3K9OB 4K2OA 3IG3A 1OEYJ 2L05A 4ZDVA 3GYOA 1ZGUB 3VOQA 4GB9A 4KDIC 1V9JA 2CAYA 3P2BA 4N9F4 1WJ4A 2KFJA 3UINB 1E8WA 3VFKA 3TVVA 5CTRC 2NVUI 4IC7B 3W1SA 4ZRKA 2MP2B 3FM8C 3DVNU 2IO0B 1E7VA 3ZVVA 3SYXA 2R09A 1KOTA 4PS3A 1WX9A 3QAQA 1Z5SB 3O65B 3RUIB 4KIKB 5KHOA 2J7QB 1MKEA 1P98A 5DHFB 3KUCB 2KLCA 2LXCA 2O6VA 3DVGY 3V6EB 4IUMB 4H8SA 2IO1B 2KQSA 2XBBC 2BWFA 2NR2A 4MGKE 5AEKB 2V4LA 2DZMA 3FP5A 1TQZA 1V5MA 1WGHA 2L00B 2IO3B 3PSEB 4F1SA 5CHFA 4PS8A 3L54A 1U5DA 4IOYX 4ICVA 4EEWA 3QX1A 4BBNC 2KO3A 4RMAA 4HCNB 5D3VA 3UF8A 1WXMA 4B95A 1Y5OA 2KDIA 2QHOA 4HPLB 4WVFB 1LQBA 4G11A 2LOXA 2LUEA 3PRPB 1RJ2A 2DZKA 4HAWB 1IPGA 3KUZA 2YVCA 4DHJB 2ZPYA 3M1IB 3EECA 2KKCA 1NTIA 5IA7A 4GDKA 2LBBA 2GBNA 5L83A 4XWXA 2LG1A 1UZXB 2LGXA 3AULA 1E90A 3TJPA 3UQBA 2GBJA 1EAZA 2HJ8A 5J17A 3VH3B 3TL5A 3RZFA 4FHKA 3G9WA 5HKHA 2COCA 3ZUNA 5BO4B 4MGIE 4GXBA 2LULA 2DAFA 1VCBA 2JT4B 2DYMA 3B08A 1N3HA 1LB1A 1AARA 4FN2A 3CXBB 5EFXA 3ECIA 3A1QB 3PHWB 2K2JA 4ZRJA 2DHKA 1OGWA 3AJ4A 2ZZPB 2RD0A 2AEHA 1SHCA 1WJ1A 1T0YA 2WX0A 2VSZA 5DI9B 3RCZA 3VDZA 2RNRB 1WM2A 2WX1A 1WGDA 3KVFB 2XQNM 2I5FA 3PV1A 5HE0A 1I42A 3UIOB 1WXSA 1H8CA 3QK0A 1Q1OA 2NBWB 3SHQA 2M17A 1M94A 2DENB 2D4QA 4W9DA 2CU1A 3NY5A 2N9PC 4AOFA 1X86A 1ZM0A 2YSZA 3VUWA 2J59M 5DPRA 1L2NA 4W9GA 4KSKC 1TZ1A 1WRDB 4HJKA 1QQGA 3TIXA 5KCVA 3VXWA 2IY1B 2L0TA 2MP2A 1ISNA 4CYEA 4F7ZA 2KZRA 2LVQA 2P0DA 3KRWA 2K8HA 4JGHB 2MDXA 2N9XA 3DDCB 3L17A 4KIKA 3ZDTA 3Q3FA 2JRHA 4X57B 2DLWA 4MGYE 2CY5A 2PEAA 2W9NA 2OOBB 2L7RA 4TV3A 2W2XD 1V6EA 3PVUA 2L76A 2D11A 4E3CA 2K00A 1I7AA 2LVOA 3NZUA 3ZIMA 1UELA 3NSUA 3QHTA 1XCGA 3NHEB 3PSCA 4ANVA 1V5PA 3M62B 4PYZA 3FEHA 4EOYA 4HDQA 3PVWA 2V1YA 3A8QA 1OY2A 4C0AA 2DZJA 4WJOA 2J0JA 3VAWA 3KUDB 3EPYA 1PFJA 5FI1A 3N32A 1GG3A 3P6AA 4ANUA 3ZVRA 2D07B 2FCNA 3BJIA 1MIXA 2GMIC 4A3PA 4DXAB 2Z0DB 3BINA 3TBLD 4FADA 2O6VB 3MJWA 4KHAA 1OMWA 4LDTD 1EUVB 2MW5A 2MA9B 2OTXA 5AZHA 1Y8RC 3SU8X 3ODWA 4PS7A 2LJ5A 2DHZA 5D3YA 4IWOA 3VUXA 5DH9B 3QARA 1XQQA 2LOZA 1EGXA 3QQ8B 1YD8U 3ML8A 3ZDMC 1I35A 4BKGA 1B55A 3JYUA 3ODOA 2PPHA 2YF0A 4DX90 3DVGX 3KZ1A 3ODXA 1X1MA 2H7DA 3A1QA 1V81A 4WJPA 3PEGA 2G45B 3HQCA 1WZ0A 3ZRFA 2KNBA 2GJYA 2YS1A 1FAOA 2M38A 2KK8A 5CHVC 2D9ZA 2JZ3B 3ML4A 5GMVA 2FAZA 1P1AA 2MBBB 1P9DU 2K8CA 4HWIB 3VTWA 4GDKB 4MY6A 2JP2A 4KAXB 3ZKJC 5CLLB 5HE2A 4ASWC 4A5KA 1WXAA 1MK9B 3ZNID 2P8VA 3M3JA 2BKFA 1KLVA 2K8BA 4ZRIA 1ZKHA 1ST7A 5D6JB 2A5UA 2GS0A 4YL8A 2LGYA 1MIZB 1WGUA 2N4FA 1UBQA 5JH5C 3DQVA 1NBFC 2VRWB 2DA0A 4WJ7A 2YLMA 2MKRA 2OJRA 3T9LA 1FHWA 2NMBA 4IWPA 1YX6B 4DBGA 4F7GA 3LDZE 2DZIA 3ML9A 3V60A 4M0WB 1M7RA 4GIVA 4A6HA 2KDBA 2KMAA 2KXJA 3CF6E 1D3ZA 2DX5A 1LXDA 2KJRA 3SDLC 1WY8A 1WGGA 1WGRA 1HBKA 1LW3A 4CHKA 3DBHI 4I6NB 1X05A 2CR5A 3LJUX 2JY6A 2LRWA 1WF9A 2K39A 1WX7A 4M8NA 4A3OA 1H4RA 2KMCA 5JHHA 5D7GA 3N3KB 4J6IA 1P6SA 4GPTB 1UBIA 3A33B
chains in the Genus database with same CATH superfamily
5D27A 1E8ZA 4FHJA 4GSWA 2K22A 1FB8A 4K17A 2NBVA 2JU6X 1V86A 1SF0A 2IO2B 2MJ3A 2UVMA 1ZSQA 3OHMB 2LGDA 4M02A 3L4PA 4K2PA 3L10B 2QIEB 3PT2B 3H7SA 1U27A 1JROA 4K81A 2W3SA 4IDIA 2DHJA 1SBBB 3O13A 2KGXB 4JPSA 3RT3B 1XEEA 2D10A 1LFDA 3TW1A 1WI1A 1FEHA 1HTOA 4M01A 2EMTA 3UZTA 2DBYA 3WA0A 2MBOA 1J0GA 1S1QB 4TKNA 4P6VF 4KGTA 4DBBA 4WSFA 4RGMA 5L95C 2WXNA 1OQQA 4Y94A 4UDUC 4GZUA 3QC8B 2ZVOA 2Z8LA 3PZ7A 2M8SA 4JK8A 2CB8A 3VQIA 2M0XA 2L52A 1IBXB 3FILB 2DN6A 5C16A 2KTRB 3L0WB 2KR0A 4GOUA 3W2DA 3PREA 5LOPB 4FJZA 1NTVA 3GZNI 3SO6A 2KIEA 2K6QA 1Q0WB 1V2YA 4MT5A 4C80A 2DYNA 4GOCA 4KDLB 2KUQA 5D94A 3QCAA 4AJYB 1DOYA 4I6LB 2AQ1B 1HB8A 2KCJA 2LGSA 2Z13A 3GYPA 1LO5D 4EZJA 5JXVA 2VH1A 4TSSA 1QZEA 3H7PB 3AMZA 4P16A 2WU2B 1V61A 2AYOB 1TKGA 3Q8CA 2DYBA 1DDWA 3WAPA 3VRBB 1ZW7A 2BF8B 3IBEA 2CKHB 3N20C 1KM7A 5JP4A 2UYZB 3WAOA 2JWUA 3BVGA 2MSED 3FLVA 2J53A 3T06A 4RM8A 5LNK1 1VZ7A 1Z87A 4FA6A 2W2WA 1H10A 2ZW0A 2K1FA 4DDGD 2MRPA 4GN1A 2EELA 4K1RB 2BB6A 1E8XA 1WR6E 5IN7A 2Y7BA 2FBWB 4HCPB 1DGJA 3VTVA 3WYFB 1L0XB 2REXA 1J7AA 1WJNA 4MK0A 4HB4B 4BKSD 3AE3B 3A8PA 4QAYA 1AWEA 4HLEA 4S0RA 1K8RB 4K7UA 3SUZA 1VZ8A 4A20A 4A6KA 2C5LC 4HJGE 2J0KA 1X1FA 1S3SG 2N7JA 1FGYA 1MK7B 1ZC4B 1UWXA 2PZ1A 2LASA 2W3RA 4GDLA 1M4VA 3EGRA 1TTNA 1MG8A 3DVNV 2WDRB 3ONSA 4PQ0A 1T5XD 2Z4DA 1WJUA 1SXTA 5FI0A 4P1BC 2CODA 5E6PA 4DDID 2WNMA 2YT2A 1UNQA 2C60A 1N62A 3OLMD 2INPE 3E66A 1WR1A 1WE7A 2VKIA 2J0MA 1OTRB 2GBRA 2KWUB 1N5WA 2KTFA 1RAXA 2Q5WD 4JIOU 3R2TA 1QLBB 1R4NI 2UU7A 2RGNB 3NWFA 2PW9A 3NZ3A 5BYSA 3L13A 2ROZB 1PGAA 3KQ4A 5LONB 1ZUD2 3L16A 2D9YA 3MDBC 3ZXRA 3C8YA 3V3XA 4USAA 4AWJA 4NY0A 2O2VA 1P3RA 2NMQA 2MWSB 2H7EA 2X8XX 2Z0EB 5DIFB 2G4SA 1NDDA 3PVLA 3A58A 3CWIA 1TBEA 5TSSA 2LRUA 1YJ1A 3EFCA 3AEAB 4MM3A 4HKQA 4O1NA 4JK7A 1WSPA 2D2QA 1N63A 1FGZA 4MSQB 1ZVRA 5C5BB 3KYCD 3PPAA 2KJHB 4OHJA 1U29A 3DWMA 5BMGA 3GE8C 1OQYA 1I2HA 2ABDA 2K25A 1W1HA 2RPQA 3RMKC 4G0NB 1QF6A 2GCLA 3KH0A 2Y8FA 4C4VA 5I2MA 1XODA 1WVHA 1K5GB 4K3BA 3AU5A 2FJUB 2ON8A 1VRAB 1BWNA 5EE1A 1CMXB 2N9KA 2WYQA 1OQRA 5IJMA 4HAUB 3HVDA 4LNIA 3S2AA 5J3YA 4NJCA 3RNGC 5HG2A 3E9PA 4YONA 2BYVE 2FJ9A 4KHBB 1WGKA 4EE2A 5KQ4A 2DFKA 1PFDA 3M63B 1IYFA 2MBHA 1RLFA 3TEYA 4OZCA 5D3WA 2Q13A 3EFUA 1HEZE 2IYDB 1MPEA 5IOIA 2L3ZA 1QQRA 2COPA 5JHBA 2KD0A 5CX3A 4MJSB 2E2XA 2KWVB 2V3NA 2N7EA 3Q8BA 3GOEA 4Z2MB 2OEDA 1PMSA 1C1YB 2RSUA 4XX5A 3ENBA 5D3XA 3AE4B 2E3TA 2B3AA 2EKEC 2LWPA 4BFRA 3D8EA 4ILHA 1NVID 3PZDA 1RWSA 4L23A 2DYQA 3DOWA 2I1JA 1J19A 2DX5B 1K53A 4KZ0A 3AXCA 3Q3OC 3RNAC 1HB6A 4HAVB 1C4AA 1EWCA 3P63A 4BBKA 2KTRA 2N9EB 2HRJA 4NAWA 1GC7A 1JALA 2BCJA 3N30A 1K5DB 2JPHA 3Q8EA 4OZBA 1JDEA 1J7BA 3AU4A 1P0RA 2HTME 3H7PA 1FRDA 1YQBA 1D5ZC 2L32A 2ELBA 3AECB 2NZ8B 2GRIA 4AJWA 3BK2A 4K3CA 2BS2B 5HFYA 3R3MA 1B1ZA 3VRAB 2NBVB 3ZRCA 4FJYA 2KX0A 1E5WA 2M4NA 3HUIA 1SEBD 1SE9A 1Q10A 3P4PB 2N0YA 1GB4A 2YT0A 2V76A 4WWOA 2GOWA 2HD5B 1ZXIA 1TGZB 3RNCC 2YEPF 2FCSA 2RSGA 1BTNA 2Z0QA 5E6OA 3SV1A 2DHIA 1YJIA 2NCNA 3FVCA 3H6NA 5EDSA 3E56A 1CK1A 2HE7A 1U4AA 5G2NA 4AUQC 5E6NA 4A55A 2WXOA 1UH6A 2ZNVC 1FNVA 2R2OA 1EF5A 4F7HA 2JWZA 3MTNB 1MHHE 3CIRB 5IO9A 2KVRA 5IAAC 3X23A 4HPMB 3RYTA 4ANXA 3A4SC 1KFYB 4WQMA 2PVOD 1XO3A 1U2BA 2HTHB 3D8FA 1DYNA 1MI1A 2MJDA 2LUMA 4NNJB 4LCDE 3FSSA 1FXIA 3PZ8A 2KN4A 2GLSA 3BYYB 2W2XC 1QOGA 5LLIA 2D9WA 1Q5WB 1V49A 3N9YC 4A90A 4HPPA 4IFSA 2AWTA 2UWQA 5G55A 1UEFA 4F8CB 4ZHOA 3F5RA 4XWWA 2IZVB 4WJNA 2EJ8A 1FRRA 2BKRB 4JL9A 2FNJB 4GGQA 3Q3NC 3QWZB 2I1KA 1SIFA 3APFA 2X38A 4EZLA 2CHXA 3OAWA 4ILGB 1WZ3A 4BVUC 4MH0E 5HE1A 4P7IA 1UNPA 3ALBA 4EFOA 1YMHE 4IAPA 3HIZA 4ZOHC 3DCGA 1CZPA 1KH0A 4NPNA 1F2RI 5LXIB 2RVBB 2RRFA 1YNTE 2M1MA 2KFKB 4YWGG 3AE8B 3PG7A 1NI2A 4JK9A 5G5GA 2J52A 5L81A 3I3TB 1WX8A 2BQQA 1P5TA 5TR5A 4YSYB 3ZXVA 2EMSA 1YQ4B 2ZNVB 3P42A 5C5BA 3GE3C 5AZFA 4XC2A 3W9CB 4WWNA 1TIFA 1RM6C 4WH4A 1QKZA 2G3QB 1F0ZA 1KI1B 4EZKA 4GDLB 2Y5CA 5KHQA 1U5GA 2WXLA 4KGRA 2DKQA 2QDFA 2FDQA 1A5RA 4WAAA 4URKA 4ZYNA 5JLJB 3I63C 2IYBA 1FOEA 3NRZA 2C9WB 2Z0PA 1U5FA 2KQ4X 4HHVA 4IKGA 3A98B 2QKMA 3EUB2 4W9HA 4JLCA 1ZP0B 2PE6B 3WALA 3EC8A 1T3QA 4KHBA 5J3QA 4XZ4A 4MELA 3R7QA 5DHAB 3AB5A 4GMVA 3Q3JA 2NTSA 1FO4A 3T3OA 2LEKA 2MBEA 3DBSA 2G4DB 2O2VB 2BVCA 4CQNA 2FIDA 4MJSA 1JCKB 3HHMA 4OVVA 3T8MA 2Z0OA 4JE3B 1J8CA 3RCPA 2N1VA 3UGBB 1GGOA 3A9KB 2V3PA 1VBHA 1SSNA 2OQBA 2JX5A 5D3IB 4KHOA 3KRXA 2PJHA 4MT7A 1PQSA 4CHJA 3RFZB 2YS5A 1JMLA 3AE1B 3MHSD 4EUTA 4EMOA 2IGDA 1R7SA 2I5CA 3U8ZA 4REZA 1JWSD 4DHJD 2P0HA 2K2UA 4FJVB 2XK5B 1D4BA 1ROEA 1V89A 3E9LA 2CQUA 2NTTA 1WXQA 3B0AA 1ZPSA 3ULCA 4PYUA 1JWMD 1DBHA 1KJTA 4W9FA 1MPHA 2RUKB 3LXFA 4DK5A 3TO1A 2BW2A 4MSMB 4C4VB 3KSYA 3DBHB 4KVGB 2WXGA 5J2RA 4A8XC 1JWAD 1XD4A 4YT0B 5D2MB 3ZJVA 4LDTB 2PTLA 4B6HA 3P4QB 1UPQA 2N1WA 3RI7C 5JZEB 5GOWB 2ASQA 1IRSA 1B9RA 4HRSA 2FJLA 1WYGA 3V61A 1ACCA 4RM9A 1TS4A 2G1EA 3MC8A 5GXGB 3KY9A 4W9CA 3IAS1 1ENFA 3NVWA 3ZNGC 5J18A 2IGGA 2KOXA 4II2B 4WWPA 2V9HA 5C2TB 3OWEB 2LZ6A 2IY0B 3IHPC 1E6EB 2HJ1A 1L4DB 4AP4C 2XN9C 3WIMA 1WM3A 2K3UA 3U7DA 2N0SB 1HZ6A 2H89B 3ZQ4A 2WHIA 5H92C 1SE3A 3WCQA 2N7DA 1TS5A 5BYQA 3ENEA 1GUAB 2HTHA 1TKEA 4C56C 2KWCA 1E7UA 1C4CA 4BBNF 5I4DA 3PP2A 4KV2A 2V4IB 2L2IA 1WE6A 2LYDA 4NAWB 4NQLB 3ZYYX 3TMPB 3HK0A 3UI3A 1PDXA 2GBMA 4WJQA 3DBLI 2M14A 5CLQB 1YIWA 1XKEA 4IOIE 3ZTDA 1J0WA 2J42A 2LFIA 2QC8A 3E9OA 3QA8A 1GAQB 1XLQA 3GZNB 2BPSA 4CHMA 1V88A 3BK1A 2YS3A 4W9KA 3MPXA 3DBRI 5IP4D 2D9VA 1OEYA 1TJ6A 2L0FA 2C7HA 2QEJC 4MEMA 2JYEA 2LD9A 4K7WA 3IFWB 3TCAA 4LNFA 4W9IA 3ZNHB 4WQOB 3BIID 2R2QA 2ELAA 2EC1A 3DXDA 1ZDVA 2A4ZA 4RFBA 2JQRB 4DXGA 5J3TA 2JVCA 1V80A 3DPDA 2KFKA 2KQ7A 2ZCCA 3AE5B 2JZZA 1WMHB 1YN4A 3Q14C 5FR3A 4YTNB 3EHVA 3IXSA 1DDMA 1GNUA 1X1GA 1TS3A 4JKGB 1N6ZA 2MX2A 4IM2A 4RGOS 4TUUA 3RZWC 4XDDA 1UNRA 4KZCA 1ZYIA 2WXPA 2M0AA 3VTUA 2P0FA 5DPSA 2R0DA 2CRFA 3U7ZA 5CHWA 2KWDA 1EU3A 4TQ1A 4IWQA 4HSIA 2XEWA 4MACA 2RDBC 4TQ0A 2CS4A 3ETRA 2ROVA 4HK2A 2JF5A 4DHZE 1AQCA 3SBGA 2KUPA 3AH7A 4WWMA 4LK0M 1TXDA 1KZ7A 1XT9B 2NBUA 2NPTB 2N23A 2JXXA 2BB5A 3IVFA 1DYQA 2R2YA 2JZPA 3NZSA 4JKFA 3HM3A 3V62A 3ULBA 4D2KA 4CO7A 1P7EA 1XCTL 1K50A 1V5OA 4B6WA 1KZGA 4JKDA 1R4NB 1I7HA 1L0YB 1WYWB 2DYOA 1D5XC 1VR9A 1WJ6A 3HRDD 1STEA 1MHXA 2IBIB 1P3QU 3Q3MC 4JWSC 1E9MA 3A9KA 2MCNB 3DXCA 1XR0B 2YT1A 3PRMB 3KW5B 2CHZA 4HAZB 2LVPA 2GCJA 4G3XB 3AEFB 4QJ3B 2PKOA 2JYTA 4EJNA 1FHOA 1T0QC 3MJ5A 4FULA 2L1CA 1L7YA 3ZTCA 4HAXB 2VZKD 2AL6A 3B2GA 2XK5A 1HE8A 3W1YA 3O96A 3NJTA 2KDEB 1FFUA 3JVZX 1BT0A 3U30A 3PS6A 3UIPB 1RRPB 3UQAA 2L8JA 3AE9B 4LJPB 2CU3A 3OJ4B 1FXAA 4F7UP 2IFSA 2QKLA 2MBQA 2D3GA 2O6VD 3MFGA 1KRHA 4IM3A 4HVBA 1XD3B 3PTFC 2DKPA 4OT1A 1E8YA 1WWTA 3AEEB 4ILJA 4FLHA 3A4RA 4HXDA 2K0PA 2MEKA 4W9JA 3LYYA 3VHTC 4MGZE 2RGFA 1QILA 5KQ1A 1R4MI 2RQ1A 1ZDXA 1U5EA 1IUEA 1TKYA 1MVKA 3JSVB 3VVWB 3HVZA 3Q69A 1NYQA 4ICUA 3U2SC 1DDVA 3DXEA 2FUG1 1D6EC 3A9JB 3X0WA 3TEWA 1ET9A 3NS8A 1UWMA 3FKYA 4LNNA 1C3TA 1NU2A 2D5GA 4EKUA 5C6RA 4BKTA 3HM6X 1RFAA 4JKCA 2PE9A 4MH8A 3U12A 4G50A 1WGYA 3AEGB 1ZC3B 3RNBC 4US9A 3BWUD 3MC9A 1PGXA 4D0NB 2DTCA 3QJZA 4IW0A 2LXAA 3ZW3A 1FNUA 2D3CA 3AEDB 4PT5A 2JSVX 2AL3A 1FXTB 3FAHA 1AW7A 5M4YB 3IAM1 3W1SC 4PK1A 1EO6A 1T0SC 3B2FA 5C1ZA 2BYEA 3F0WA 3WAMA 1EU4A 3H8HA 3R66C 3H9DA 4DIXA 4J3OD 1GC6A 1V97A 3N1YC 1JWBD 2RR9A 5H8YE 4B0MA 3ZJUA 5FK9C 3HW2B 4L1RA 2CHWA 3K9PB 3N1ZC 4TYZA 3APCA 1DIKA 2D9XA 3D8DA 1JRUA 4A6FB 3JW0X 4ANWA 4GMXB 4N58A 4NJ6A 2DAJA 1F77A 3QIJA 4IM0A 4N6EB 2COFA 3VH4B 3VIAA 2ZEQA 2G35A 3TSSA 4B9KA 1FD6A 3U52E 2N9LA 1YJJA 1XLPA 2RLOA 1FCLA 1M7EA 1TYGB 4E74A 3QWMA 2LKOA 4RGNA 4A9AA 4HDOA 2V3SA 2QILA 5HI1A 4AS1A 3QBVB 3PGEA 3BY4B 3CIKA 3V6CB 3I5JC 3ZJTA 1QOFA 4CSQA 1Q67A 1F2RC 3RNEC 3URYA 5JHGA 2JRIB 1F9JA 3I9V1 1FIQA 1X11A 1LGRA 3CSFA 4HATB 1WMHA 5HE3A 4IG7B 4DWFA 2GUMA 2KX3A 3PRZA 4JKGA 1UD7A 1EF1A 2BYFA 3TUOA 1Y19B 2FCMA 3C19A 1GB1A 2D3AA 3NOBA 4GNKB 2R61A 1SJED 2WP9B 2KANA 2MH7A 1Z2MA 1WGQA 4II3B 5DCNA 3D32A 4JQWC 4KKIA 1PYWD 2FCQA 3GB1A 5FR6A 4FBJB 2Y5BB 4W9LA 1I4HA 1KF6B 1GOZA 2K6DB 2WXKA 2ZVNA 1TY2A 2IGHA 2NPTA 2Z59B 3LB8C 4XDCA 1EVHA 2INDC 2KLGA 1WG7A 4HB0B 1WH3A 2JUOA 1GJZA 3B1LX 2BGFA 4K7SA 3RD2A 4BAXA 3DHIC 2XNAC 5AZGA 2WDTB 1V5UA 1YX5B 2MWNB 4KX6B 2MLBA 3SFDB 1DOIA 4MDKE 3R7RA 4HB2B 2AX5A 2DX1A 4C7YA 3SNHA 3MP9A 4Z2NA 4I6PA 3SBTA 2KYWA 4L6EA 2KN5A 1VD2A 1T6BX 2PVGC 4PNKA 3CSTA 4M00A 4RH6A 3LJ3A 1NENB 2YRYA 2IPKD 1PLSA 1WIAA 1NTYA 4US8A 2NS5A 3KYDD 3Q6BA 2KDFB 4OVZA 2KHWB 3ZO5B 3KWLA 2GB1A 3BZDB 2QMTA 4ARCA 1W1GA 3R2IA 1BUIC 3CMMB 2BWES 4W9EA 2KJ6A 3TFMA 2W82A 3AI5A 1K51A 2GBKA 2K9XA 2VRRB 3U4EG 2FUHB 5DPTA 5I2SA 3SD5A 4JKHA 1YQ3B 1AYFA 3SEBA 1NYRA 3PHXB 2V0GA 2UZSA 3VR9B 4GU2A 3KLSX 1Y56A 3WANA 4BOSC 5DPWA 1E10A 3VUYA 3ZLZA 3N7CA 1DROA 5T8IA 2MFQA 2C7MB 2B76B 1F1HA 1G6JA 1I4PA 3PLUA 3C0RB 2M56B 3OJ3A 3MHZA 2WWZA 5JHAA 1XLOA 1W1DA 1GPXA 4HB3B 1K52A 2M19A 2CY4A 3P7ZA 3JSVA 3M95A 4FXCA 1FNWA 1T77A 2Y8GA 2LI5A 1RRBA 2YEPB 4NJ7A 1QC6A 2WDQB 2WXJA 1JWUD 1IP9A 2ZW1A 3RULA 4DX8A 3A9JA 2KACA 4OZAA 2KC1A 3H1UA 5C23A 2BBCA 2FIFA 2W54A 5LXHA 4M8MA 1UPRA 4KSLC 3APDA 5C79A 1QOBA 1VDVA 1WJMA 1UGMA 1KTKA 1V5TA 3FC4A 3B77A 1VZ6A 2L1AA 2LMCA 1WFYA 4LNOA 1T0RC 4DHZB 4HAYB 4BKSA 1WI0A 4WAFA 2ADZA 3ZNZB 1JW9D 1XCQL 1SGHA 3Q8FA 4B0EA 3OANA 4LLGM 4JKBA 4OVUA 4NSWA 4LJOB 2WXMA 1E7PB 5EE9A 2DIKA 2ZCBA 1XX0A 1FFVA 2ZJDA 4BOZB 1ACAA 2WH5A 2KC2A 1OQNA 1V1PB 3L08A 4A6FA 1BAKA 2COAA 1VBGA 1SE4A 1ZE3D 3BVMA 2X18A 1KBLA 1WXVA 1IGDA 1I4GA 3NWDA 2C7NB 1NVLA 2MQJA 3PLVA 4DXFA 1BTKA 4XGAB 1FHXA 4E71A 1MAIA 3KWVA 3V5WA 1RFKA 1P7FA 2WXQA 1LM8B 4NZLB 4R3DA 2ZPNA 3OG5A 3P4SB 4OW0A 4NQKE 2UZRA 3K9OB 4K2OA 1FCCC 3IG3A 3P4RB 1ZXHA 1OEYJ 4L1BA 1HZ5A 1C78A 2L05A 4ZDVA 3GYOA 4RGTA 2INCC 1ZGUB 2WXFA 3B9JA 2KIGA 3VOQA 4GB9A 4KDIC 1V9JA 2CAYA 3P2BA 4JKAA 4AQ7A 5BYRA 4N9F4 3A33B 2KFJA 2OJWA 3UINB 1E8WA 3VFKA 3TVVA 5CTRC 2NVUI 5IKCM 4H2AA 1FM0D 4IC7B 3W1SA 4DQOC 4ZRKA 2MP2B 3FM8C 3DVNU 2IO0B 1E7VA 3ZVVA 3SYXA 1JQ4A 2R09A 1V1OA 5LG4B 1PGBA 1KOTA 4PS3A 1WX9A 2Z59A 3QAQA 1Z5SB 3O65B 4C7ZA 4LNKA 3RUIB 1L0VB 4KIKB 5KHOA 2J7QB 3NWAA 1MKEA 1P98A 3DBLB 4ZRPA 5DHFB 2PLPA 4BZAA 1OFFA 3KUCB 2KLCA 2LXCA 2O6VA 3DVGY 4RCOA 3V6EB 4IUMB 4H8SA 2IO1B 2KQSA 2XBBC 1EWYC 2BWFA 2NR2A 1ET6A 1I4RA 2KAJA 4MGKE 5AEKB 2V4LA 2WS3B 2DZMA 3FP5A 1TQZA 1V5MA 1L6VA 3ABVB 1WGHA 3DBRB 2L00B 2D3BA 2IO3B 3PSEB 4F1SA 5CHFA 1E0ZA 2AQ3B 4PS8A 3AN1A 3VR8B 3L54A 1U5DA 4IOYX 4ICVA 1D5MC 4EEWA 1A70A 4GLSC 3QX1A 4BBNC 2CJOA 1SB3C 2KO3A 4RMAA 4HCNB 5D3VA 2LHDA 3UF8A 2RDGA 1WXMA 2RMMA 4B95A 1Y5OA 2KDIA 3N1XC 4HKZE 1I4QA 1IGCA 3BVZA 1N5XA 2WDVB 2QHOA 4HPLB 4WVFB 1LQBA 4G11A 4Q2JA 2LOXA 4YSZB 2LUEA 2VH2A 3PRPB 1RJ2A 2DZKA 2PMVA 4HAWB 1IPGA 3KUZA 2YVCA 1XLNA 2WQYB 4DHJB 2ZPYA 3M1IB 3EECA 2KKCA 1NTIA 5IA7A 2WXHA 4GDKA 2LBBA 2GBNA 3AEBB 4YXDB 2KDMA 5L83A 1VLBA 1L4ZB 4XWXA 2LG1A 1UZXB 4ITKA 2LGXA 3AULA 1E90A 4XE0A 3TJPA 1UGJA 2R82A 3UQBA 2GBJA 2Z14A 5D3DA 2KVZA 2QCZA 1SJHD 2CJNA 1EAZA 2HJ8A 5J17A 5AUKA 2K5PA 3VH3B 3TL5A 1C77A 2WU5B 1YN3A 3RZFA 4FHKA 1J7CA 2ICIA 3G9WA 5HKHA 2COCA 1HXYD 3ZUNA 5BO4B 1NEKB 1AN8A 3PO0A 4MGIE 1MFWA 4GXBA 2LULA 2DAFA 1VCBA 2JT4B 3AE2B 2DYMA 3B08A 1N3HA 2ACZB 4JWUC 4NAMA 1C76A 1LB1A 2BS3B 4RNAA 1AARA 4FN2A 3CXBB 5EFXA 1FPYA 3ECIA 3AE6B 3A1QB 2BYTA 3PHWB 5C3JB 2K2JA 3NUHB 4M0WA 4KKJA 4ZRJA 2DHKA 1OGWA 3AJ4A 2ZZPB 2RD0A 2AEHA 1V1PA 1SHCA 1WJ1A 1T0YA 1DOXA 2WX0A 2VSZA 2IJ0A 5DI9B 3RCZA 3VDZA 1BMLC 2X0SA 2RNRB 2RDHA 1MG4A 1WM2A 2WX1A 3NVZA 1UF0A 1WGDA 3KVFB 2XQNM 2OHFA 2I5FA 3GP7A 3PV1A 5HE0A 2MHJA 1I42A 1VJKA 1MI0A 3UIOB 1WXSA 1H8CA 1R4MB 3QK0A 1YN5A 5FKAC 1Q1OA 3IT4B 1HTQA 2NBWB 3SHQA 2M17A 2JXTA 1M94A 2DENB 2D4QA 3Q2AC 4W9DA 2CU1A 2GI9A 3NY5A 3J9CA 2N9PC 4YTMB 4AOFA 5E6JA 1X86A 1MJDA 4HROA 3SFEB 2QJLA 2G9HD 3ZGZA 1EM7A 1ZM0A 2YSZA 1HQRD 3VUWA 3DWGC 2J59M 2SEBD 5DPRA 1TJEA 1L2NA 4OSNA 4W9GA 4KSKC 1TZ1A 1WRDB 4HJKA 3R8BA 4TMAB 1QQGA 2LGIA 2Y5PA 3TIXA 3AE7B 4LTUA 5KCVA 3VXWA 1SIJA 2IY1B 1TS2A 2L0TA 3BYTB 2MP2A 4RF1A 1ISNA 4CYEA 4F7ZA 2KZRA 2LVQA 2P0DA 3GS2A 3KRWA 2K8HA 2I38A 2WLBA 5MPOA 2DWQA 4JGHB 2MDXA 2N9XA 3DDCB 3L17A 4JX1C 4KIKA 3ZDTA 3Q3FA 4ACFA 2JRHA 4X57B 1IBXA 4QJ5B 2DLWA 3FILA 4MGYE 4ZHPA 2W55A 3EA6A 1WRIA 2IDYA 2RPVA 2CY5A 3NS1A 2PEAA 4RF0A 2ONQA 2W9NA 4WIPA 2LJIA 2OOBB 1L6UA 2L7RA 4TV3A 2W2XD 1V6EA 3PVUA 2L76A 2D11A 2HDEA 4D6WA 4E3CA 1BXTA 2K49A 2K00A 3W5UB 1I7AA 2LVOA 3NZUA 3ZIMA 3NVVA 3E9SA 1UELA 3NSUA 2K8EA 1XXGA 5IRSA 3W5VB 2LHEA 3QHTA 1YOVB 3HSAA 1XCGA 4N59A 3NHEB 3PSCA 4ANVA 4ARIA 1V5PA 3M62B 4PYZA 1ESFA 3FEHA 4EOYA 4HDQA 3IT6B 3PVWA 4C00A 3V05A 2V1YA 3A8QA 2BTEA 1C9FA 3AM9A 2L83A 1OY2A 4C0AA 2QSDA 2DLBA 3I57A 2DZJA 5BMIA 5G5HA 4WJOA 4L2YA 2J0JA 3VAWA 3KUDB 3EPYA 1PFJA 5FI1A 2BS4B 3N32A 1GG3A 3P6AA 2Y3AA 4ANUA 3ZVRA 2D07B 2FCNA 2VZKB 3BJIA 1RYJA 3Q8AA 2H88B 1MIXA 2GMIC 1QT9A 4A3PA 4DXAB 2Z0DB 3DCXA 1CJEA 2SAKA 3BINA 3TBLD 2J4XA 4FADA 3NVYA 2O6VB 1PUTA 3MJWA 1AWDA 1KLUD 5EE3A 4KHAA 1OMWA 1ZOYB 4LDTD 1EUVB 1TT5B 2MW5A 4P1CC 2MA9B 2OTXA 5AZHA 1Y8RC 1JRPA 3SU8X 3ODWA 4PS7A 2ZKMX 2LJ5A 2DHZA 5D3YA 4A6QA 2EKIA 1CQVA 4QXAB 4IWOA 2I2YA 2AQ2B 2WXRA 5DH9B 3QARA 3RPFC 5HHDG 3VUXA 1XQQA 3HIEA 2LOZA 1KC7A 1EGXA 3AV8A 3QQ8B 1YD8U 3ML8A 3ZDMC 1I35A 4BKGA 1B55A 3T3NA 3JYUA 5EE0A 3ODOA 2PPHA 2YF0A 4DX90 3DVGX 3KZ1A 3ODXA 1N61A 3NG0A 1X1MA 3TEZA 2H7DA 3A1QA 1NI3A 1V81A 4WJPA 3PEGA 2G45B 3HQCA 5JVLA 3RNFC 1WZ0A 3ZRFA 4JKEA 2KNBA 2GJYA 2YS1A 4ZRQA 4S17A 1FAOA 2M38A 2KK8A 3NW8A 5CHVC 2D9ZA 1F52A 3ML4A 2JZ3B 5GMVA 2FAZA 1P1AA 2MBBB 1P9DU 2K8CA 4WURA 4HWIB 4XWTA 3VTWA 4GDKB 4MY6A 1XF5L 1HA5A 2JP2A 4KAXB 3ZKJC 1C4PA 5CLLB 1UUPA 5HE2A 4ASWC 3SR6A 4A5KA 1WXAA 5BMHA 2DNFA 1MK9B 3ZNID 2P8VA 3M3JA 2BKFA 1KLVA 2WGSA 2K8BA 4ZRIA 3RN9C 1I4XA 1ZKHA 1ST7A 5D6JB 2A5UA 2GS0A 4XYCA 4KGSA 3DHHC 4YL8A 2LGYA 1MIZB 1WGUA 2FE8A 2N4FA 1UNSA 1UBQA 5JH5C 3DQVA 1NBFC 2VRWB 2DA0A 4WJ7A 2YLMA 3P1MA 2MJEA 2MKRA 2OJRA 3T9LA 1KLGD 1FHWA 2NMBA 4IWPA 1N60A 2KMMA 2E6XA 4HEA1 1V8CA 1YX6B 2PIAA 3DHGC 4F7GA 4DBGA 3LDZE 2DZIA 3MC0B 3ML9A 3V60A 1C79A 4M0WB 1M7RA 4YSXB 4GIVA 4A6HA 2KDBA 2KMAA 2KXJA 1TY0A 3CF6E 4MM3B 3TEXA 1D3ZA 1TZOA 2DX5A 1LXDA 2KJRA 1SE2A 3SDLC 1WY8A 1WGGA 1WGRA 2BT6A 1HBKA 1LW3A 1L5PA 4CHKA 2WXIA 4QJ4B 2KT7A 5AUIA 3DBHI 4I6NB 1FMAD 1X05A 2CR5A 4ZYSA 3LJUX 2JY6A 2LRWA 4YTPB 1WF9A 2K39A 1WX7A 4M8NA 1QOAA 4A3OA 2INNE 1H4RA 2KMCA 5JHHA 5D7GA 3N3KB 4J6IA 1P6SA 4GPTB 1UBIA 2TSSA 1WJ4A
chains in the Genus database with same CATH topology
5D27A 1E8ZA 4FHJA 4GSWA 1FB8A 4K17A 1V86A 2IO2B 2UVMA 1ZSQA 2LGDA 4K2PA 3L10B 3PT2B 3H7SA 1U27A 4K81A 2DHJA 2KGXB 3RT3B 2D10A 1LFDA 3TW1A 1WI1A 2EMTA 3UZTA 3WA0A 2MBOA 1J0GA 1S1QB 4TKNA 4DBBA 4WSFA 5L95C 4Y94A 4GZUA 3QC8B 2ZVOA 2M8SA 4JK8A 2CB8A 3VQIA 2M0XA 2DN6A 5C16A 2KTRB 3L0WB 3PREA 5LOPB 4FJZA 1NTVA 3GZNI 3SO6A 2K6QA 1Q0WB 1V2YA 2DYNA 4GOCA 4KDLB 5D94A 3QCAA 4AJYB 4I6LB 1HB8A 2KCJA 3GYPA 4EZJA 1QZEA 3H7PB 1V61A 2AYOB 2DYBA 1DDWA 3WAPA 1ZW7A 2BF8B 3IBEA 2CKHB 1KM7A 5JP4A 2UYZB 3WAOA 2MSED 3FLVA 3T06A 4RM8A 1Z87A 4FA6A 2W2WA 1H10A 2K1FA 4DDGD 2MRPA 4GN1A 4K1RB 1E8XA 1WR6E 2Y7BA 4HCPB 3VTVA 3WYFB 2REXA 1WJNA 4MK0A 4HB4B 4BKSD 3A8PA 1AWEA 4HLEA 1K8RB 4K7UA 3SUZA 4A20A 4A6KA 2C5LC 2J0KA 1X1FA 1S3SG 1FGYA 1MK7B 1ZC4B 2PZ1A 2LASA 4GDLA 1TTNA 1MG8A 3DVNV 3ONSA 4PQ0A 1WJUA 5FI0A 2CODA 5E6PA 4DDID 1UNQA 2C60A 3OLMD 3E66A 1WR1A 1WE7A 2VKIA 2J0MA 1OTRB 2GBRA 2KWUB 2KTFA 1RAXA 4JIOU 1R4NI 2RGNB 3L13A 2ROZB 5LONB 3L16A 2D9YA 3MDBC 4AWJA 4NY0A 2O2VA 1P3RA 2MWSB 2H7EA 2Z0EB 5DIFB 2G4SA 1NDDA 3PVLA 1TBEA 2LRUA 1YJ1A 4MM3A 4JK7A 2D2QA 4MSQB 1FGZA 1ZVRA 5C5BB 3KYCD 3PPAA 2KJHB 1U29A 1OQYA 1I2HA 2ABDA 2K25A 1W1HA 2RPQA 4G0NB 2GCLA 3KH0A 2Y8FA 1XODA 1WVHA 1K5GB 3AU5A 1BWNA 1CMXB 2WYQA 5IJMA 4HAUB 3S2AA 5J3YA 3E9PA 4YONA 2BYVE 2FJ9A 4KHBB 5KQ4A 2DFKA 3M63B 1IYFA 2MBHA 1RLFA 5D3WA 2Q13A 3EFUA 2IYDB 2L3ZA 2COPA 5JHBA 2KD0A 5CX3A 4MJSB 2E2XA 2KWVB 2N7EA 3GOEA 4Z2MB 1PMSA 1C1YB 2RSUA 4XX5A 3ENBA 5D3XA 2B3AA 2EKEC 2LWPA 4BFRA 3D8EA 4ILHA 3PZDA 2DYQA 3DOWA 2I1JA 1J19A 2DX5B 4KZ0A 3AXCA 1HB6A 4HAVB 4BBKA 2KTRA 2N9EB 2HRJA 4NAWA 1GC7A 2BCJA 3N30A 1K5DB 2JPHA 1JDEA 3AU4A 1P0RA 3H7PA 1YQBA 2ELBA 2NZ8B 4AJWA 3R3MA 2NBVB 3ZRCA 4FJYA 2KX0A 1E5WA 2M4NA 1SE9A 2N0YA 2YT0A 2V76A 4WWOA 2GOWA 2HD5B 1TGZB 2FCSA 2RSGA 1BTNA 2Z0QA 5E6OA 3SV1A 2DHIA 2NCNA 5EDSA 3H6NA 2HE7A 1U4AA 5G2NA 4AUQC 5E6NA 1UH6A 2ZNVC 2R2OA 1EF5A 4F7HA 2JWZA 3MTNB 2KVRA 5IAAC 3X23A 4HPMB 3RYTA 4ANXA 3A4SC 1U2BA 2HTHB 3D8FA 1DYNA 4NNJB 4LCDE 3FSSA 2W2XC 5LLIA 2D9WA 1Q5WB 1V49A 4IFSA 2AWTA 2UWQA 5G55A 1UEFA 4F8CB 3F5RA 2IZVB 4WJNA 2EJ8A 2BKRB 4JL9A 2FNJB 4GGQA 3QWZB 2I1KA 1SIFA 3APFA 4EZLA 2CHXA 3OAWA 4ILGB 1WZ3A 4BVUC 4MH0E 5HE1A 4P7IA 1UNPA 3ALBA 4EFOA 4IAPA 3HIZA 3DCGA 4NPNA 5LXIB 2RVBB 2M1MA 2KFKB 3PG7A 1NI2A 4JK9A 5L81A 3I3TB 1WX8A 1P5TA 5TR5A 2EMSA 2ZNVB 5AZFA 5C5BA 4XC2A 4WWNA 2G3QB 1KI1B 4EZKA 4GDLB 5KHQA 1U5GA 2DKQA 2FDQA 1A5RA 4WAAA 4URKA 4ZYNA 5JLJB 2IYBA 1FOEA 2C9WB 2Z0PA 1U5FA 4HHVA 3A98B 2QKMA 4W9HA 4JLCA 2PE6B 3WALA 3EC8A 5J3QA 4XZ4A 4MELA 3R7QA 5DHAB 4GMVA 3Q3JA 2MBEA 3DBSA 2G4DB 2O2VB 2FIDA 4MJSA 3HHMA 4OVVA 3T8MA 2Z0OA 1J8CA 3RCPA 2N1VA 3UGBB 1GGOA 3A9KB 1VBHA 2OQBA 4KHOA 3KRXA 2PJHA 4MT7A 1PQSA 4CHJA 2YS5A 4EUTA 3MHSD 4EMOA 2I5CA 3U8ZA 4DHJD 2P0HA 2K2UA 4FJVB 2XK5B 1V89A 3E9LA 2CQUA 3B0AA 3ULCA 4PYUA 4W9FA 1DBHA 1KJTA 1MPHA 2RUKB 4DK5A 3TO1A 4MSMB 3KSYA 4KVGB 5J2RA 1XD4A 5D2MB 4LDTB 4B6HA 1UPQA 2N1WA 5JZEB 5GOWB 2ASQA 1IRSA 2FJLA 3V61A 4RM9A 3KY9A 4W9CA 3ZNGC 5J18A 2KOXA 4II2B 4WWPA 2LZ6A 2IY0B 3IHPC 4AP4C 3WIMA 1WM3A 3U7DA 2N7DA 3ENEA 1GUAB 2HTHA 2KWCA 1E7UA 4BBNF 3PP2A 4KV2A 2L2IA 1WE6A 2LYDA 4NAWB 4NQLB 3TMPB 3HK0A 2GBMA 4WJQA 3DBLI 2M14A 5CLQB 1YIWA 1XKEA 3ZTDA 1J0WA 3E9OA 3QA8A 2BPSA 4CHMA 1V88A 2YS3A 4W9KA 3MPXA 3DBRI 2D9VA 1OEYA 1TJ6A 2L0FA 2C7HA 4MEMA 2LD9A 4K7WA 3IFWB 3TCAA 4W9IA 3ZNHB 4WQOB 2R2QA 2ELAA 2EC1A 3DXDA 2A4ZA 5J3TA 2JVCA 1V80A 3DPDA 2KFKA 2KQ7A 2ZCCA 1WMHB 2JZZA 3EHVA 1DDMA 1GNUA 1X1GA 4JKGB 2MX2A 4IM2A 4TUUA 3RZWC 1UNRA 4KZCA 3VTUA 2P0FA 5DPSA 2R0DA 2CRFA 5CHWA 4TQ1A 4IWQA 2XEWA 4TQ0A 2CS4A 2ROVA 4HK2A 2JF5A 4DHZE 1AQCA 3SBGA 2KUPA 1TXDA 1KZ7A 1XT9B 2NBUA 2NPTB 2N23A 2JXXA 3IVFA 3NZSA 4JKFA 3HM3A 3V62A 3ULBA 4CO7A 1V5OA 4B6WA 1KZGA 4JKDA 1WYWB 2DYOA 1WJ6A 2IBIB 1P3QU 3A9KA 2MCNB 3DXCA 1XR0B 2YT1A 3PRMB 3KW5B 2CHZA 4HAZB 2LVPA 2GCJA 4G3XB 4EJNA 1FHOA 4FULA 2L1CA 1L7YA 3ZTCA 4HAXB 2AL6A 2XK5A 1HE8A 3W1YA 3O96A 2KDEB 3JVZX 1BT0A 3U30A 3PS6A 3UIPB 1RRPB 3UQAA 2L8JA 4LJPB 3OJ4B 4F7UP 2IFSA 2QKLA 2MBQA 2D3GA 2O6VD 4IM3A 4HVBA 1XD3B 3PTFC 2DKPA 1E8YA 4ILJA 4FLHA 3A4RA 4HXDA 4W9JA 3VHTC 4MGZE 2RGFA 5KQ1A 1R4MI 2RQ1A 1U5EA 3JSVB 3VVWB 4ICUA 1DDVA 3DXEA 3A9JB 3X0WA 3NS8A 1C3TA 1NU2A 4EKUA 5C6RA 4BKTA 3HM6X 1RFAA 4JKCA 2PE9A 4G50A 1WGYA 1ZC3B 4D0NB 2DTCA 3QJZA 4IW0A 2LXAA 3ZW3A 2AL3A 1FXTB 3W1SC 1EO6A 5C1ZA 2BYEA 3F0WA 3WAMA 3R66C 3H9DA 1GC6A 2RR9A 3HW2B 2CHWA 3K9PB 4TYZA 3APCA 1DIKA 2D9XA 3D8DA 1JRUA 4A6FB 3JW0X 4ANWA 4GMXB 4NJ6A 2DAJA 3QIJA 4IM0A 2COFA 3VH4B 3VIAA 2ZEQA 2G35A 4B9KA 2RLOA 1M7EA 4E74A 3QWMA 2LKOA 4HDOA 2V3SA 3QBVB 3PGEA 3BY4B 3CIKA 3V6CB 1Q67A 5JHGA 2JRIB 1F9JA 1X11A 3CSFA 4HATB 1WMHA 5HE3A 4IG7B 4DWFA 2KX3A 3PRZA 4JKGA 1UD7A 1EF1A 2BYFA 1Y19B 2FCMA 3NOBA 2KANA 1Z2MA 1WGQA 4II3B 5DCNA 3D32A 4JQWC 2FCQA 5FR6A 4FBJB 2Y5BB 4W9LA 2K6DB 2ZVNA 2NPTA 2Z59B 1EVHA 2KLGA 1WG7A 4HB0B 1WH3A 2JUOA 1GJZA 3B1LX 2BGFA 4K7SA 3RD2A 5AZGA 2WDTB 1V5UA 1YX5B 2MWNB 2MLBA 4MDKE 3R7RA 4HB2B 2DX1A 3SNHA 4Z2NA 4I6PA 3SBTA 4L6EA 2KN5A 1VD2A 4PNKA 3CSTA 3LJ3A 2YRYA 1PLSA 1WIAA 1NTYA 2NS5A 3KYDD 2KDFB 3ZO5B 2KHWB 1W1GA 3CMMB 2BWES 4W9EA 2KJ6A 3TFMA 3AI5A 2GBKA 2VRRB 2FUHB 5DPTA 3SD5A 4JKHA 3PHXB 2UZSA 4GU2A 3WANA 5DPWA 4BOSC 3VUYA 3ZLZA 3N7CA 1DROA 2MFQA 2C7MB 1G6JA 3PLUA 3C0RB 3OJ3A 2WWZA 5JHAA 1W1DA 4HB3B 3JSVA 2CY4A 3P7ZA 3M95A 2Y8GA 2LI5A 1RRBA 4NJ7A 1QC6A 1IP9A 3RULA 4DX8A 3A9JA 2KC1A 5C23A 3H1UA 2FIFA 5LXHA 4M8MA 1UPRA 4KSLC 3APDA 5C79A 1WJMA 1UGMA 1V5TA 1WFYA 4DHZB 4HAYB 4BKSA 1WI0A 2ADZA 3ZNZB 1SGHA 3OANA 4JKBA 4OVUA 4NSWA 4LJOB 2DIKA 2ZCBA 1XX0A 2ZJDA 4BOZB 1ACAA 2WH5A 2KC2A 1OQNA 3L08A 4A6FA 1BAKA 2COAA 1VBGA 2X18A 1KBLA 1WXVA 2C7NB 1NVLA 2MQJA 3PLVA 1BTKA 1FHXA 4E71A 1MAIA 3V5WA 1LM8B 2ZPNA 4NQKE 2UZRA 3K9OB 4K2OA 3IG3A 1OEYJ 2L05A 4ZDVA 3GYOA 1ZGUB 3VOQA 4GB9A 4KDIC 1V9JA 2CAYA 3P2BA 4JKAA 4N9F4 1WJ4A 2KFJA 3UINB 1E8WA 3VFKA 3TVVA 5CTRC 2NVUI 4IC7B 3W1SA 4ZRKA 2MP2B 3FM8C 3DVNU 2IO0B 1E7VA 3ZVVA 3SYXA 2R09A 1KOTA 4PS3A 1WX9A 3QAQA 1Z5SB 3O65B 3RUIB 4KIKB 5KHOA 2J7QB 1MKEA 1P98A 5DHFB 3KUCB 2KLCA 2LXCA 2O6VA 3DVGY 3V6EB 4IUMB 4H8SA 2IO1B 2KQSA 2XBBC 2BWFA 2NR2A 4MGKE 5AEKB 2V4LA 2DZMA 3FP5A 1TQZA 1V5MA 1WGHA 2L00B 2IO3B 3PSEB 4F1SA 5CHFA 4PS8A 3L54A 1U5DA 4IOYX 4ICVA 4EEWA 3QX1A 4BBNC 2KO3A 4RMAA 4HCNB 5D3VA 3UF8A 1WXMA 4B95A 1Y5OA 2KDIA 2QHOA 4HPLB 4WVFB 1LQBA 4G11A 2LOXA 2LUEA 3PRPB 1RJ2A 2DZKA 4HAWB 1IPGA 3KUZA 2YVCA 4DHJB 2ZPYA 3M1IB 3EECA 2KKCA 1NTIA 5IA7A 4GDKA 2LBBA 2GBNA 5L83A 4XWXA 2LG1A 1UZXB 2LGXA 3AULA 1E90A 3TJPA 2R82A 3UQBA 2GBJA 1EAZA 2HJ8A 5J17A 3VH3B 3TL5A 3RZFA 4FHKA 3G9WA 5HKHA 2COCA 3ZUNA 5BO4B 4MGIE 4GXBA 2LULA 2DAFA 1VCBA 2JT4B 2DYMA 3B08A 1N3HA 1LB1A 1AARA 4FN2A 3CXBB 5EFXA 3ECIA 3A1QB 3PHWB 2K2JA 4ZRJA 2DHKA 1OGWA 3AJ4A 2ZZPB 2RD0A 2AEHA 1SHCA 1WJ1A 1T0YA 2WX0A 2VSZA 5DI9B 3RCZA 3VDZA 2X0SA 2RNRB 1WM2A 2WX1A 1WGDA 3KVFB 2XQNM 2I5FA 3PV1A 5HE0A 1I42A 3UIOB 1WXSA 1H8CA 3QK0A 1Q1OA 2NBWB 3SHQA 2M17A 1M94A 2DENB 2D4QA 4W9DA 2CU1A 3NY5A 2N9PC 4AOFA 1X86A 1ZM0A 2YSZA 3VUWA 2J59M 5DPRA 1L2NA 4W9GA 4KSKC 1TZ1A 1WRDB 4HJKA 1QQGA 3TIXA 5KCVA 3VXWA 2IY1B 2L0TA 2MP2A 1ISNA 4CYEA 4F7ZA 2KZRA 2LVQA 2P0DA 3KRWA 2K8HA 4JGHB 2MDXA 2N9XA 3DDCB 3L17A 4KIKA 3ZDTA 3Q3FA 2JRHA 4X57B 2DLWA 4MGYE 2CY5A 2PEAA 2W9NA 2OOBB 2L7RA 4TV3A 2W2XD 1V6EA 3PVUA 2L76A 2D11A 4E3CA 2K00A 1I7AA 2LVOA 3NZUA 3ZIMA 1UELA 3NSUA 3QHTA 1XCGA 3NHEB 3PSCA 4ANVA 1V5PA 3M62B 4PYZA 3FEHA 4EOYA 4HDQA 3PVWA 2V1YA 3A8QA 1OY2A 4C0AA 2DZJA 4WJOA 2J0JA 3VAWA 3KUDB 3EPYA 1PFJA 5FI1A 3N32A 1GG3A 3P6AA 4ANUA 3ZVRA 2D07B 2FCNA 3BJIA 1MIXA 2GMIC 4A3PA 4DXAB 2Z0DB 3BINA 3TBLD 4FADA 2O6VB 3MJWA 4KHAA 1OMWA 4LDTD 1EUVB 2MW5A 2MA9B 2OTXA 5AZHA 1Y8RC 3SU8X 3ODWA 4PS7A 2LJ5A 2DHZA 5D3YA 4IWOA 3VUXA 5DH9B 3QARA 1XQQA 2LOZA 1KC7A 1EGXA 3QQ8B 1YD8U 3ML8A 3ZDMC 1I35A 4BKGA 1B55A 3JYUA 3ODOA 2PPHA 2YF0A 4DX90 3DVGX 3KZ1A 3ODXA 1X1MA 2H7DA 3A1QA 1V81A 4WJPA 3PEGA 2G45B 3HQCA 5JVLA 1WZ0A 3ZRFA 4JKEA 2KNBA 2GJYA 2YS1A 1FAOA 2M38A 2KK8A 5CHVC 2D9ZA 2JZ3B 3ML4A 5GMVA 2FAZA 1P1AA 2MBBB 1P9DU 2K8CA 4HWIB 3VTWA 4GDKB 4MY6A 2JP2A 4KAXB 3ZKJC 5CLLB 5HE2A 4ASWC 4A5KA 1WXAA 1MK9B 3ZNID 2P8VA 3M3JA 2BKFA 1KLVA 2K8BA 4ZRIA 1ZKHA 1ST7A 5D6JB 2A5UA 2GS0A 4YL8A 2LGYA 1MIZB 1WGUA 2N4FA 1UBQA 5JH5C 3DQVA 1NBFC 2VRWB 2DA0A 4WJ7A 2YLMA 2MKRA 2OJRA 3T9LA 1FHWA 2NMBA 4IWPA 1YX6B 4DBGA 4F7GA 3LDZE 2DZIA 3ML9A 3V60A 4M0WB 1M7RA 4GIVA 4A6HA 2KDBA 2KMAA 2KXJA 3CF6E 1D3ZA 2DX5A 1LXDA 2KJRA 3SDLC 1WY8A 1WGGA 1WGRA 1HBKA 1LW3A 4CHKA 3DBHI 4I6NB 1X05A 2CR5A 3LJUX 2JY6A 2LRWA 1WF9A 2K39A 1WX7A 4M8NA 4A3OA 1H4RA 2KMCA 5JHHA 5D7GA 3N3KB 4J6IA 1P6SA 4GPTB 1UBIA 3A33B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D27 A;  1E8Z A;  4FHJ A;  4GSW A;  1FB8 A;  4K17 A;  1V86 A;  2IO2 B;  2UVM A;  1ZSQ A;  2LGD A;  4K2P A;  3L10 B;  3PT2 B;  3H7S A;  1U27 A;  4K81 A;  2DHJ A;  2KGX B;  3RT3 B;  2D10 A;  1LFD A;  3TW1 A;  1WI1 A;  2EMT A;  3UZT A;  3WA0 A;  2MBO A;  1J0G A;  1S1Q B;  4TKN A;  4DBB A;  4WSF A;  5L95 C;  4Y94 A;  4GZU A;  3QC8 B;  2ZVO A;  2M8S A;  2CB8 A;  3VQI A;  2M0X A;  2DN6 A;  5C16 A;  2KTR B;  3L0W B;  3PRE A;  5LOP B;  4FJZ A;  1NTV A;  3GZN I;  3SO6 A;  2K6Q A;  1Q0W B;  1V2Y A;  2DYN A;  4GOC A;  4KDL B;  5D94 A;  3QCA A;  4AJY B;  4I6L B;  1HB8 A;  2KCJ A;  3GYP A;  4EZJ A;  1QZE A;  3H7P B;  1V61 A;  2AYO B;  2DYB A;  1DDW A;  3WAP A;  1ZW7 A;  2BF8 B;  3IBE A;  2CKH B;  1KM7 A;  5JP4 A;  2UYZ B;  3WAO A;  2MSE D;  3FLV A;  3T06 A;  4RM8 A;  1Z87 A;  4FA6 A;  2W2W A;  1H10 A;  2K1F A;  4DDG D;  2MRP A;  4GN1 A;  4K1R B;  1E8X A;  1WR6 E;  2Y7B A;  4HCP B;  3VTV A;  3WYF B;  2REX A;  1WJN A;  4MK0 A;  4HB4 B;  4BKS D;  3A8P A;  1AWE A;  4HLE A;  1K8R B;  4K7U A;  3SUZ A;  4A20 A;  4A6K A;  2C5L C;  2J0K A;  1X1F A;  1S3S G;  1FGY A;  1MK7 B;  1ZC4 B;  2PZ1 A;  2LAS A;  4GDL A;  1TTN A;  1MG8 A;  3DVN V;  3ONS A;  4PQ0 A;  1WJU A;  5FI0 A;  2COD A;  5E6P A;  4DDI D;  1UNQ A;  2C60 A;  3OLM D;  1WR1 A;  1WE7 A;  2VKI A;  2J0M A;  1OTR B;  2GBR A;  2KWU B;  2KTF A;  1RAX A;  4JIO U;  1R4N I;  2RGN B;  3L13 A;  2ROZ B;  5LON B;  3L16 A;  2D9Y A;  3MDB C;  4AWJ A;  4NY0 A;  2O2V A;  1P3R A;  2MWS B;  2H7E A;  2Z0E B;  5DIF B;  2G4S A;  1NDD A;  3PVL A;  1TBE A;  2LRU A;  1YJ1 A;  4MM3 A;  2D2Q A;  4MSQ B;  1FGZ A;  1ZVR A;  5C5B B;  3KYC D;  3PPA A;  2KJH B;  1U29 A;  1OQY A;  1I2H A;  2ABD A;  2K25 A;  1W1H A;  2RPQ A;  4G0N B;  2GCL A;  3KH0 A;  2Y8F A;  1XOD A;  1WVH A;  1K5G B;  3AU5 A;  1BWN A;  1CMX B;  2WYQ A;  5IJM A;  4HAU B;  3S2A A;  5J3Y A;  4YON A;  2BYV E;  2FJ9 A;  4KHB B;  5KQ4 A;  2DFK A;  3M63 B;  1IYF A;  2MBH A;  1RLF A;  5D3W A;  2Q13 A;  3EFU A;  2IYD B;  2L3Z A;  2COP A;  5JHB A;  2KD0 A;  5CX3 A;  4MJS B;  2E2X A;  2KWV B;  2N7E A;  3GOE A;  4Z2M B;  1PMS A;  1C1Y B;  2RSU A;  4XX5 A;  5D3X A;  2B3A A;  2EKE C;  2LWP A;  4BFR A;  3D8E A;  3PZD A;  2DYQ A;  3DOW A;  2I1J A;  1J19 A;  2DX5 B;  4KZ0 A;  3AXC A;  1HB6 A;  4HAV B;  4BBK A;  2KTR A;  2N9E B;  2HRJ A;  4NAW A;  1GC7 A;  2BCJ A;  3N30 A;  1K5D B;  2JPH A;  3AU4 A;  1P0R A;  3H7P A;  1YQB A;  2ELB A;  2NZ8 B;  4AJW A;  3R3M A;  2NBV B;  3ZRC A;  4FJY A;  2KX0 A;  1E5W A;  2M4N A;  1SE9 A;  2N0Y A;  2YT0 A;  2V76 A;  4WWO A;  2GOW A;  2HD5 B;  1TGZ B;  2FCS A;  2RSG A;  1BTN A;  2Z0Q A;  5E6O A;  3SV1 A;  2DHI A;  2NCN A;  5EDS A;  3H6N A;  2HE7 A;  1U4A A;  5G2N A;  4AUQ C;  5E6N A;  1UH6 A;  2ZNV C;  2R2O A;  1EF5 A;  4F7H A;  2JWZ A;  3MTN B;  2KVR A;  5IAA C;  3X23 A;  4HPM B;  3RYT A;  4ANX A;  3A4S C;  1U2B A;  2HTH B;  3D8F A;  1DYN A;  4NNJ B;  4LCD E;  3FSS A;  2W2X C;  5LLI A;  2D9W A;  1Q5W B;  1V49 A;  4IFS A;  2AWT A;  2UWQ A;  5G55 A;  1UEF A;  4F8C B;  3F5R A;  2IZV B;  4WJN A;  2EJ8 A;  2BKR B;  4JL9 A;  2FNJ B;  4GGQ A;  3QWZ B;  2I1K A;  1SIF A;  3APF A;  4EZL A;  2CHX A;  3OAW A;  1WZ3 A;  4BVU C;  4MH0 E;  5HE1 A;  4P7I A;  1UNP A;  3ALB A;  4EFO A;  4IAP A;  3HIZ A;  3DCG A;  4NPN A;  5LXI B;  2RVB B;  2M1M A;  2KFK B;  3PG7 A;  1NI2 A;  5L81 A;  3I3T B;  1WX8 A;  1P5T A;  5TR5 A;  2EMS A;  2ZNV B;  5AZF A;  5C5B A;  4XC2 A;  4WWN A;  2G3Q B;  1KI1 B;  4EZK A;  4GDL B;  5KHQ A;  1U5G A;  2DKQ A;  2FDQ A;  1A5R A;  4WAA A;  4URK A;  4ZYN A;  5JLJ B;  2IYB A;  1FOE A;  2C9W B;  2Z0P A;  1U5F A;  4HHV A;  3A98 B;  2QKM A;  4W9H A;  4JLC A;  2PE6 B;  3WAL A;  3EC8 A;  5J3Q A;  4XZ4 A;  4MEL A;  3R7Q A;  5DHA B;  4GMV A;  3Q3J A;  2MBE A;  3DBS A;  2G4D B;  2O2V B;  2FID A;  4MJS A;  3HHM A;  4OVV A;  3T8M A;  2Z0O A;  1J8C A;  3RCP A;  2N1V A;  3UGB B;  3A9K B;  2OQB A;  4KHO A;  3KRX A;  2PJH A;  4MT7 A;  1PQS A;  4CHJ A;  2YS5 A;  4EUT A;  3MHS D;  4EMO A;  2I5C A;  3U8Z A;  4DHJ D;  2P0H A;  2K2U A;  4FJV B;  2XK5 B;  1V89 A;  2CQU A;  3B0A A;  3ULC A;  4PYU A;  4W9F A;  1DBH A;  1KJT A;  1MPH A;  2RUK B;  4DK5 A;  3TO1 A;  4MSM B;  3KSY A;  4KVG B;  5J2R A;  1XD4 A;  5D2M B;  4LDT B;  4B6H A;  1UPQ A;  2N1W A;  5JZE B;  5GOW B;  2ASQ A;  1IRS A;  2FJL A;  3V61 A;  4RM9 A;  3KY9 A;  4W9C A;  3ZNG C;  5J18 A;  2KOX A;  4II2 B;  4WWP A;  2LZ6 A;  2IY0 B;  3IHP C;  4AP4 C;  3WIM A;  1WM3 A;  3U7D A;  2N7D A;  3ENE A;  1GUA B;  2HTH A;  2KWC A;  1E7U A;  4BBN F;  3PP2 A;  4KV2 A;  2L2I A;  1WE6 A;  2LYD A;  4NAW B;  4NQL B;  3TMP B;  3HK0 A;  2GBM A;  4WJQ A;  3DBL I;  2M14 A;  5CLQ B;  1YIW A;  1XKE A;  3ZTD A;  1J0W A;  3QA8 A;  2BPS A;  4CHM A;  1V88 A;  2YS3 A;  4W9K A;  3MPX A;  3DBR I;  2D9V A;  1OEY A;  1TJ6 A;  2L0F A;  2C7H A;  4MEM A;  2LD9 A;  4K7W A;  3IFW B;  3TCA A;  4W9I A;  3ZNH B;  4WQO B;  2R2Q A;  2ELA A;  2EC1 A;  3DXD A;  2A4Z A;  5J3T A;  2JVC A;  1V80 A;  3DPD A;  2KFK A;  2KQ7 A;  2ZCC A;  1WMH B;  2JZZ A;  3EHV A;  1DDM A;  1GNU A;  1X1G A;  2MX2 A;  4IM2 A;  4TUU A;  3RZW C;  1UNR A;  4KZC A;  3VTU A;  2P0F A;  5DPS A;  2R0D A;  2CRF A;  5CHW A;  4TQ1 A;  4IWQ A;  2XEW A;  4TQ0 A;  2CS4 A;  2ROV A;  4HK2 A;  2JF5 A;  4DHZ E;  1AQC A;  2KUP A;  1TXD A;  1KZ7 A;  1XT9 B;  2NBU A;  2NPT B;  2N23 A;  2JXX A;  3IVF A;  3NZS A;  3HM3 A;  3V62 A;  3ULB A;  4CO7 A;  1V5O A;  4B6W A;  1KZG A;  1WYW B;  2DYO A;  1WJ6 A;  2IBI B;  1P3Q U;  3A9K A;  2MCN B;  3DXC A;  1XR0 B;  2YT1 A;  3PRM B;  3KW5 B;  2CHZ A;  4HAZ B;  2LVP A;  2GCJ A;  4G3X B;  4EJN A;  1FHO A;  4FUL A;  2L1C A;  1L7Y A;  3ZTC A;  4HAX B;  2AL6 A;  2XK5 A;  1HE8 A;  3W1Y A;  3O96 A;  2KDE B;  3JVZ X;  1BT0 A;  3U30 A;  3PS6 A;  3UIP B;  1RRP B;  3UQA A;  2L8J A;  4LJP B;  3OJ4 B;  4F7U P;  2IFS A;  2QKL A;  2MBQ A;  2D3G A;  2O6V D;  4IM3 A;  4HVB A;  1XD3 B;  3PTF C;  2DKP A;  1E8Y A;  4FLH A;  3A4R A;  4HXD A;  4W9J A;  3VHT C;  4MGZ E;  2RGF A;  5KQ1 A;  1R4M I;  2RQ1 A;  1U5E A;  3JSV B;  3VVW B;  4ICU A;  1DDV A;  3DXE A;  3A9J B;  3X0W A;  3NS8 A;  1C3T A;  1NU2 A;  4EKU A;  5C6R A;  4BKT A;  3HM6 X;  1RFA A;  2PE9 A;  4G50 A;  1WGY A;  1ZC3 B;  4D0N B;  2DTC A;  3QJZ A;  4IW0 A;  2LXA A;  3ZW3 A;  2AL3 A;  1FXT B;  3W1S C;  1EO6 A;  5C1Z A;  2BYE A;  3F0W A;  3WAM A;  3R66 C;  3H9D A;  1GC6 A;  2RR9 A;  3HW2 B;  2CHW A;  3K9P B;  4TYZ A;  3APC A;  2D9X A;  3D8D A;  1JRU A;  4A6F B;  3JW0 X;  4ANW A;  4GMX B;  4NJ6 A;  2DAJ A;  3QIJ A;  4IM0 A;  2COF A;  3VH4 B;  3VIA A;  2ZEQ A;  2G35 A;  4B9K A;  2RLO A;  1M7E A;  4E74 A;  3QWM A;  2LKO A;  4HDO A;  2V3S A;  3QBV B;  3PGE A;  3BY4 B;  3CIK A;  3V6C B;  1Q67 A;  5JHG A;  2JRI B;  1F9J A;  1X11 A;  3CSF A;  4HAT B;  1WMH A;  5HE3 A;  4IG7 B;  4DWF A;  2KX3 A;  3PRZ A;  1UD7 A;  1EF1 A;  2BYF A;  1Y19 B;  2FCM A;  3NOB A;  2KAN A;  1Z2M A;  1WGQ A;  4II3 B;  5DCN A;  3D32 A;  4JQW C;  2FCQ A;  5FR6 A;  4FBJ B;  2Y5B B;  4W9L A;  2K6D B;  2ZVN A;  2NPT A;  2Z59 B;  1EVH A;  2KLG A;  1WG7 A;  4HB0 B;  1WH3 A;  2JUO A;  1GJZ A;  3B1L X;  2BGF A;  4K7S A;  3RD2 A;  5AZG A;  2WDT B;  1V5U A;  1YX5 B;  2MWN B;  2MLB A;  4MDK E;  3R7R A;  4HB2 B;  2DX1 A;  3SNH A;  4Z2N A;  4I6P A;  4L6E A;  2KN5 A;  1VD2 A;  4PNK A;  3CST A;  3LJ3 A;  2YRY A;  1PLS A;  1WIA A;  1NTY A;  2NS5 A;  3KYD D;  2KDF B;  3ZO5 B;  2KHW B;  1W1G A;  3CMM B;  2BWE S;  4W9E A;  2KJ6 A;  3TFM A;  3AI5 A;  2GBK A;  2VRR B;  2FUH B;  5DPT A;  3SD5 A;  3PHX B;  2UZS A;  4GU2 A;  3WAN A;  5DPW A;  4BOS C;  3VUY A;  3ZLZ A;  3N7C A;  1DRO A;  2MFQ A;  2C7M B;  1G6J A;  3PLU A;  3C0R B;  3OJ3 A;  2WWZ A;  5JHA A;  1W1D A;  4HB3 B;  3JSV A;  2CY4 A;  3P7Z A;  3M95 A;  2Y8G A;  2LI5 A;  1RRB A;  4NJ7 A;  1QC6 A;  1IP9 A;  3RUL A;  4DX8 A;  3A9J A;  2KC1 A;  5C23 A;  3H1U A;  2FIF A;  5LXH A;  4M8M A;  1UPR A;  4KSL C;  3APD A;  5C79 A;  1WJM A;  1UGM A;  1V5T A;  1WFY A;  4DHZ B;  4HAY B;  4BKS A;  1WI0 A;  2ADZ A;  3ZNZ B;  1SGH A;  3OAN A;  4OVU A;  4NSW A;  4LJO B;  2ZCB A;  1XX0 A;  2ZJD A;  4BOZ B;  1ACA A;  2WH5 A;  2KC2 A;  1OQN A;  3L08 A;  4A6F A;  1BAK A;  2COA A;  2X18 A;  1WXV A;  2C7N B;  1NVL A;  2MQJ A;  3PLV A;  1BTK A;  1FHX A;  4E71 A;  1MAI A;  3V5W A;  1LM8 B;  2ZPN A;  4NQK E;  2UZR A;  3K9O B;  4K2O A;  3IG3 A;  1OEY J;  2L05 A;  4ZDV A;  3GYO A;  1ZGU B;  3VOQ A;  4GB9 A;  4KDI C;  1V9J A;  2CAY A;  3P2B A;  4N9F 4;  1WJ4 A;  2KFJ A;  3UIN B;  1E8W A;  3VFK A;  3TVV A;  5CTR C;  2NVU I;  4IC7 B;  3W1S A;  4ZRK A;  2MP2 B;  3FM8 C;  3DVN U;  2IO0 B;  1E7V A;  3ZVV A;  3SYX A;  2R09 A;  1KOT A;  4PS3 A;  1WX9 A;  3QAQ A;  1Z5S B;  3O65 B;  3RUI B;  4KIK B;  5KHO A;  2J7Q B;  1MKE A;  1P98 A;  5DHF B;  3KUC B;  2KLC A;  2LXC A;  2O6V A;  3DVG Y;  3V6E B;  4IUM B;  4H8S A;  2IO1 B;  2KQS A;  2XBB C;  2BWF A;  2NR2 A;  4MGK E;  5AEK B;  2V4L A;  2DZM A;  3FP5 A;  1TQZ A;  1V5M A;  1WGH A;  2L00 B;  2IO3 B;  3PSE B;  4F1S A;  5CHF A;  4PS8 A;  3L54 A;  1U5D A;  4IOY X;  4ICV A;  4EEW A;  3QX1 A;  4BBN C;  2KO3 A;  4RMA A;  4HCN B;  5D3V A;  3UF8 A;  1WXM A;  4B95 A;  1Y5O A;  2KDI A;  2QHO A;  4HPL B;  4WVF B;  1LQB A;  4G11 A;  2LOX A;  2LUE A;  3PRP B;  1RJ2 A;  2DZK A;  4HAW B;  1IPG A;  3KUZ A;  2YVC A;  4DHJ B;  2ZPY A;  3M1I B;  3EEC A;  2KKC A;  1NTI A;  5IA7 A;  4GDK A;  2LBB A;  2GBN A;  5L83 A;  4XWX A;  2LG1 A;  1UZX B;  2LGX A;  3AUL A;  1E90 A;  3TJP A;  3UQB A;  2GBJ A;  1EAZ A;  2HJ8 A;  5J17 A;  3VH3 B;  3TL5 A;  3RZF A;  4FHK A;  3G9W A;  5HKH A;  2COC A;  3ZUN A;  5BO4 B;  4MGI E;  4GXB A;  2LUL A;  2DAF A;  1VCB A;  2JT4 B;  2DYM A;  3B08 A;  1N3H A;  1LB1 A;  1AAR A;  4FN2 A;  3CXB B;  5EFX A;  3ECI A;  3A1Q B;  3PHW B;  2K2J A;  4ZRJ A;  2DHK A;  1OGW A;  3AJ4 A;  2ZZP B;  2RD0 A;  2AEH A;  1SHC A;  1WJ1 A;  1T0Y A;  2WX0 A;  2VSZ A;  5DI9 B;  3RCZ A;  3VDZ A;  2RNR B;  1WM2 A;  2WX1 A;  1WGD A;  3KVF B;  2XQN M;  2I5F A;  3PV1 A;  5HE0 A;  1I42 A;  3UIO B;  1WXS A;  1H8C A;  3QK0 A;  1Q1O A;  2NBW B;  3SHQ A;  2M17 A;  1M94 A;  2DEN B;  2D4Q A;  4W9D A;  2CU1 A;  3NY5 A;  2N9P C;  4AOF A;  1X86 A;  1ZM0 A;  2YSZ A;  3VUW A;  2J59 M;  5DPR A;  1L2N A;  4W9G A;  4KSK C;  1TZ1 A;  1WRD B;  4HJK A;  1QQG A;  3TIX A;  5KCV A;  3VXW A;  2IY1 B;  2L0T A;  2MP2 A;  1ISN A;  4CYE A;  4F7Z A;  2KZR A;  2LVQ A;  2P0D A;  3KRW A;  2K8H A;  4JGH B;  2MDX A;  2N9X A;  3DDC B;  3L17 A;  4KIK A;  3ZDT A;  3Q3F A;  2JRH A;  4X57 B;  2DLW A;  4MGY E;  2CY5 A;  2PEA A;  2W9N A;  2OOB B;  2L7R A;  4TV3 A;  2W2X D;  1V6E A;  3PVU A;  2L76 A;  2D11 A;  4E3C A;  2K00 A;  1I7A A;  2LVO A;  3NZU A;  3ZIM A;  1UEL A;  3NSU A;  3QHT A;  1XCG A;  3NHE B;  3PSC A;  4ANV A;  1V5P A;  3M62 B;  4PYZ A;  3FEH A;  4EOY A;  4HDQ A;  3PVW A;  2V1Y A;  3A8Q A;  1OY2 A;  4C0A A;  2DZJ A;  4WJO A;  2J0J A;  3VAW A;  3KUD B;  3EPY A;  1PFJ A;  5FI1 A;  3N32 A;  1GG3 A;  3P6A A;  4ANU A;  3ZVR A;  2D07 B;  2FCN A;  3BJI A;  1MIX A;  2GMI C;  4A3P A;  4DXA B;  2Z0D B;  3BIN A;  3TBL D;  4FAD A;  2O6V B;  3MJW A;  4KHA A;  1OMW A;  4LDT D;  1EUV B;  2MW5 A;  2MA9 B;  2OTX A;  5AZH A;  1Y8R C;  3SU8 X;  3ODW A;  4PS7 A;  2LJ5 A;  2DHZ A;  5D3Y A;  4IWO A;  3VUX A;  5DH9 B;  3QAR A;  1XQQ A;  2LOZ A;  1EGX A;  3QQ8 B;  1YD8 U;  3ML8 A;  3ZDM C;  1I35 A;  4BKG A;  1B55 A;  3JYU A;  3ODO A;  2PPH A;  2YF0 A;  4DX9 0;  3DVG X;  3KZ1 A;  3ODX A;  1X1M A;  2H7D A;  3A1Q A;  1V81 A;  4WJP A;  3PEG A;  2G45 B;  3HQC A;  1WZ0 A;  3ZRF A;  2KNB A;  2GJY A;  2YS1 A;  1FAO A;  2M38 A;  2KK8 A;  5CHV C;  2D9Z A;  2JZ3 B;  3ML4 A;  5GMV A;  2FAZ A;  1P1A A;  2MBB B;  1P9D U;  2K8C A;  4HWI B;  3VTW A;  4GDK B;  4MY6 A;  2JP2 A;  4KAX B;  3ZKJ C;  5CLL B;  5HE2 A;  4ASW C;  4A5K A;  1WXA A;  1MK9 B;  3ZNI D;  2P8V A;  3M3J A;  2BKF A;  1KLV A;  2K8B A;  4ZRI A;  1ZKH A;  1ST7 A;  5D6J B;  2A5U A;  2GS0 A;  4YL8 A;  2LGY A;  1MIZ B;  1WGU A;  2N4F A;  1UBQ A;  5JH5 C;  3DQV A;  1NBF C;  2VRW B;  2DA0 A;  4WJ7 A;  2YLM A;  2MKR A;  2OJR A;  3T9L A;  1FHW A;  2NMB A;  4IWP A;  1YX6 B;  4DBG A;  4F7G A;  3LDZ E;  2DZI A;  3ML9 A;  3V60 A;  4M0W B;  1M7R A;  4GIV A;  4A6H A;  2KDB A;  2KMA A;  2KXJ A;  3CF6 E;  1D3Z A;  2DX5 A;  1LXD A;  2KJR A;  3SDL C;  1WY8 A;  1WGG A;  1WGR A;  1HBK A;  1LW3 A;  4CHK A;  3DBH I;  4I6N B;  1X05 A;  2CR5 A;  3LJU X;  2JY6 A;  2LRW A;  1WF9 A;  2K39 A;  1WX7 A;  4M8N A;  4A3O A;  1H4R A;  2KMC A;  5JHH A;  5D7G A;  3N3K B;  4J6I A;  1P6S A;  4GPT B;  1UBI A;  3A33 B; 
#chains in the Genus database with same CATH topology
 5D27 A;  1E8Z A;  4FHJ A;  4GSW A;  2K22 A;  1FB8 A;  4K17 A;  2NBV A;  2JU6 X;  1V86 A;  1SF0 A;  2IO2 B;  2MJ3 A;  2UVM A;  1ZSQ A;  3OHM B;  2LGD A;  4M02 A;  3L4P A;  4K2P A;  3L10 B;  2QIE B;  3PT2 B;  3H7S A;  1U27 A;  1JRO A;  4K81 A;  2W3S A;  4IDI A;  2DHJ A;  1SBB B;  3O13 A;  2KGX B;  4JPS A;  3RT3 B;  1XEE A;  2D10 A;  1LFD A;  3TW1 A;  1WI1 A;  1FEH A;  1HTO A;  4M01 A;  2EMT A;  3UZT A;  2DBY A;  3WA0 A;  2MBO A;  1J0G A;  1S1Q B;  4TKN A;  4P6V F;  4KGT A;  4DBB A;  4WSF A;  4RGM A;  5L95 C;  2WXN A;  1OQQ A;  4Y94 A;  4UDU C;  4GZU A;  3QC8 B;  2ZVO A;  2Z8L A;  3PZ7 A;  2M8S A;  4JK8 A;  2CB8 A;  3VQI A;  2M0X A;  2L52 A;  1IBX B;  3FIL B;  2DN6 A;  5C16 A;  2KTR B;  3L0W B;  2KR0 A;  4GOU A;  3W2D A;  3PRE A;  5LOP B;  4FJZ A;  1NTV A;  3GZN I;  3SO6 A;  2KIE A;  2K6Q A;  1Q0W B;  1V2Y A;  4MT5 A;  4C80 A;  2DYN A;  4GOC A;  4KDL B;  2KUQ A;  5D94 A;  3QCA A;  4AJY B;  1DOY A;  4I6L B;  2AQ1 B;  1HB8 A;  2KCJ A;  2LGS A;  2Z13 A;  3GYP A;  1LO5 D;  4EZJ A;  5JXV A;  2VH1 A;  4TSS A;  1QZE A;  3H7P B;  3AMZ A;  4P16 A;  2WU2 B;  1V61 A;  2AYO B;  1TKG A;  3Q8C A;  2DYB A;  1DDW A;  3WAP A;  3VRB B;  1ZW7 A;  2BF8 B;  3IBE A;  2CKH B;  3N20 C;  1KM7 A;  5JP4 A;  2UYZ B;  3WAO A;  2JWU A;  3BVG A;  2MSE D;  3FLV A;  2J53 A;  3T06 A;  4RM8 A;  5LNK 1;  1VZ7 A;  1Z87 A;  4FA6 A;  2W2W A;  1H10 A;  2ZW0 A;  2K1F A;  4DDG D;  2MRP A;  4GN1 A;  2EEL A;  4K1R B;  2BB6 A;  1E8X A;  1WR6 E;  5IN7 A;  2Y7B A;  2FBW B;  4HCP B;  1DGJ A;  3VTV A;  3WYF B;  1L0X B;  2REX A;  1J7A A;  1WJN A;  4MK0 A;  4HB4 B;  4BKS D;  3AE3 B;  3A8P A;  4QAY A;  1AWE A;  4HLE A;  4S0R A;  1K8R B;  4K7U A;  3SUZ A;  1VZ8 A;  4A20 A;  4A6K A;  2C5L C;  4HJG E;  2J0K A;  1X1F A;  1S3S G;  2N7J A;  1FGY A;  1MK7 B;  1ZC4 B;  1UWX A;  2PZ1 A;  2LAS A;  2W3R A;  4GDL A;  1M4V A;  3EGR A;  1TTN A;  1MG8 A;  3DVN V;  2WDR B;  3ONS A;  4PQ0 A;  1T5X D;  2Z4D A;  1WJU A;  1SXT A;  5FI0 A;  4P1B C;  2COD A;  5E6P A;  4DDI D;  2WNM A;  2YT2 A;  1UNQ A;  2C60 A;  1N62 A;  3OLM D;  2INP E;  3E66 A;  1WR1 A;  1WE7 A;  2VKI A;  2J0M A;  1OTR B;  2GBR A;  2KWU B;  1N5W A;  2KTF A;  1RAX A;  2Q5W D;  4JIO U;  3R2T A;  1QLB B;  1R4N I;  2UU7 A;  2RGN B;  3NWF A;  2PW9 A;  3NZ3 A;  5BYS A;  3L13 A;  2ROZ B;  1PGA A;  3KQ4 A;  5LON B;  1ZUD 2;  3L16 A;  2D9Y A;  3MDB C;  3ZXR A;  3C8Y A;  3V3X A;  4USA A;  4AWJ A;  4NY0 A;  2O2V A;  1P3R A;  2NMQ A;  2MWS B;  2H7E A;  2X8X X;  2Z0E B;  5DIF B;  2G4S A;  1NDD A;  3PVL A;  3A58 A;  3CWI A;  1TBE A;  5TSS A;  2LRU A;  1YJ1 A;  3EFC A;  3AEA B;  4MM3 A;  4HKQ A;  4O1N A;  4JK7 A;  1WSP A;  2D2Q A;  1N63 A;  1FGZ A;  4MSQ B;  1ZVR A;  5C5B B;  3KYC D;  3PPA A;  2KJH B;  4OHJ A;  1U29 A;  3DWM A;  5BMG A;  3GE8 C;  1OQY A;  1I2H A;  2ABD A;  2K25 A;  1W1H A;  2RPQ A;  3RMK C;  4G0N B;  1QF6 A;  2GCL A;  3KH0 A;  2Y8F A;  4C4V A;  5I2M A;  1XOD A;  1WVH A;  1K5G B;  4K3B A;  3AU5 A;  2FJU B;  2ON8 A;  1VRA B;  1BWN A;  5EE1 A;  1CMX B;  2N9K A;  2WYQ A;  1OQR A;  5IJM A;  4HAU B;  3HVD A;  4LNI A;  3S2A A;  5J3Y A;  4NJC A;  3RNG C;  5HG2 A;  3E9P A;  4YON A;  2BYV E;  2FJ9 A;  4KHB B;  1WGK A;  4EE2 A;  5KQ4 A;  2DFK A;  1PFD A;  3M63 B;  1IYF A;  2MBH A;  1RLF A;  3TEY A;  4OZC A;  5D3W A;  2Q13 A;  3EFU A;  1HEZ E;  2IYD B;  1MPE A;  5IOI A;  2L3Z A;  1QQR A;  2COP A;  5JHB A;  2KD0 A;  5CX3 A;  4MJS B;  2E2X A;  2KWV B;  2V3N A;  2N7E A;  3Q8B A;  3GOE A;  4Z2M B;  2OED A;  1PMS A;  1C1Y B;  2RSU A;  4XX5 A;  3ENB A;  5D3X A;  3AE4 B;  2E3T A;  2B3A A;  2EKE C;  2LWP A;  4BFR A;  3D8E A;  4ILH A;  1NVI D;  3PZD A;  1RWS A;  4L23 A;  2DYQ A;  3DOW A;  2I1J A;  1J19 A;  2DX5 B;  1K53 A;  4KZ0 A;  3AXC A;  3Q3O C;  3RNA C;  1HB6 A;  4HAV B;  1C4A A;  1EWC A;  3P63 A;  4BBK A;  2KTR A;  2N9E B;  2HRJ A;  4NAW A;  1GC7 A;  1JAL A;  2BCJ A;  3N30 A;  1K5D B;  2JPH A;  3Q8E A;  4OZB A;  1JDE A;  1J7B A;  3AU4 A;  1P0R A;  2HTM E;  3H7P A;  1FRD A;  1YQB A;  1D5Z C;  2L32 A;  2ELB A;  3AEC B;  2NZ8 B;  2GRI A;  4AJW A;  3BK2 A;  4K3C A;  2BS2 B;  5HFY A;  3R3M A;  1B1Z A;  3VRA B;  2NBV B;  3ZRC A;  4FJY A;  2KX0 A;  1E5W A;  2M4N A;  3HUI A;  1SEB D;  1SE9 A;  1Q10 A;  3P4P B;  2N0Y A;  1GB4 A;  2YT0 A;  2V76 A;  4WWO A;  2GOW A;  2HD5 B;  1ZXI A;  1TGZ B;  3RNC C;  2YEP F;  2FCS A;  2RSG A;  1BTN A;  2Z0Q A;  5E6O A;  3SV1 A;  2DHI A;  1YJI A;  2NCN A;  3FVC A;  3H6N A;  5EDS A;  3E56 A;  1CK1 A;  2HE7 A;  1U4A A;  5G2N A;  4AUQ C;  5E6N A;  4A55 A;  2WXO A;  1UH6 A;  2ZNV C;  1FNV A;  2R2O A;  1EF5 A;  4F7H A;  2JWZ A;  3MTN B;  1MHH E;  3CIR B;  5IO9 A;  2KVR A;  5IAA C;  3X23 A;  4HPM B;  3RYT A;  4ANX A;  3A4S C;  1KFY B;  4WQM A;  2PVO D;  1XO3 A;  1U2B A;  2HTH B;  3D8F A;  1DYN A;  1MI1 A;  2MJD A;  2LUM A;  4NNJ B;  4LCD E;  3FSS A;  1FXI A;  3PZ8 A;  2KN4 A;  2GLS A;  3BYY B;  2W2X C;  1QOG A;  5LLI A;  2D9W A;  1Q5W B;  1V49 A;  3N9Y C;  4A90 A;  4HPP A;  4IFS A;  2AWT A;  2UWQ A;  5G55 A;  1UEF A;  4F8C B;  4ZHO A;  3F5R A;  4XWW A;  2IZV B;  4WJN A;  2EJ8 A;  1FRR A;  2BKR B;  4JL9 A;  2FNJ B;  4GGQ A;  3Q3N C;  3QWZ B;  2I1K A;  1SIF A;  3APF A;  2X38 A;  4EZL A;  2CHX A;  3OAW A;  4ILG B;  1WZ3 A;  4BVU C;  4MH0 E;  5HE1 A;  4P7I A;  1UNP A;  3ALB A;  4EFO A;  1YMH E;  4IAP A;  3HIZ A;  4ZOH C;  3DCG A;  1CZP A;  1KH0 A;  4NPN A;  1F2R I;  5LXI B;  2RVB B;  2RRF A;  1YNT E;  2M1M A;  2KFK B;  4YWG G;  3AE8 B;  3PG7 A;  1NI2 A;  4JK9 A;  5G5G A;  2J52 A;  5L81 A;  3I3T B;  1WX8 A;  2BQQ A;  1P5T A;  5TR5 A;  4YSY B;  3ZXV A;  2EMS A;  1YQ4 B;  2ZNV B;  3P42 A;  5C5B A;  3GE3 C;  5AZF A;  4XC2 A;  3W9C B;  4WWN A;  1TIF A;  1RM6 C;  4WH4 A;  1QKZ A;  2G3Q B;  1F0Z A;  1KI1 B;  4EZK A;  4GDL B;  2Y5C A;  5KHQ A;  1U5G A;  2WXL A;  4KGR A;  2DKQ A;  2QDF A;  2FDQ A;  1A5R A;  4WAA A;  4URK A;  4ZYN A;  5JLJ B;  3I63 C;  2IYB A;  1FOE A;  3NRZ A;  2C9W B;  2Z0P A;  1U5F A;  2KQ4 X;  4HHV A;  4IKG A;  3A98 B;  2QKM A;  3EUB 2;  4W9H A;  4JLC A;  1ZP0 B;  2PE6 B;  3WAL A;  3EC8 A;  1T3Q A;  4KHB A;  5J3Q A;  4XZ4 A;  4MEL A;  3R7Q A;  5DHA B;  3AB5 A;  4GMV A;  3Q3J A;  2NTS A;  1FO4 A;  3T3O A;  2LEK A;  2MBE A;  3DBS A;  2G4D B;  2O2V B;  2BVC A;  4CQN A;  2FID A;  4MJS A;  1JCK B;  3HHM A;  4OVV A;  3T8M A;  2Z0O A;  4JE3 B;  1J8C A;  3RCP A;  2N1V A;  3UGB B;  1GGO A;  3A9K B;  2V3P A;  1VBH A;  1SSN A;  2OQB A;  2JX5 A;  5D3I B;  4KHO A;  3KRX A;  2PJH A;  4MT7 A;  1PQS A;  4CHJ A;  3RFZ B;  2YS5 A;  1JML A;  3AE1 B;  3MHS D;  4EUT A;  4EMO A;  2IGD A;  1R7S A;  2I5C A;  3U8Z A;  4REZ A;  1JWS D;  4DHJ D;  2P0H A;  2K2U A;  4FJV B;  2XK5 B;  1D4B A;  1ROE A;  1V89 A;  3E9L A;  2CQU A;  2NTT A;  1WXQ A;  3B0A A;  1ZPS A;  3ULC A;  4PYU A;  1JWM D;  1DBH A;  1KJT A;  4W9F A;  1MPH A;  2RUK B;  3LXF A;  4DK5 A;  3TO1 A;  2BW2 A;  4MSM B;  4C4V B;  3KSY A;  3DBH B;  4KVG B;  2WXG A;  5J2R A;  4A8X C;  1JWA D;  1XD4 A;  4YT0 B;  5D2M B;  3ZJV A;  4LDT B;  2PTL A;  4B6H A;  3P4Q B;  1UPQ A;  2N1W A;  3RI7 C;  5JZE B;  5GOW B;  2ASQ A;  1IRS A;  1B9R A;  4HRS A;  2FJL A;  1WYG A;  3V61 A;  1ACC A;  4RM9 A;  1TS4 A;  2G1E A;  3MC8 A;  5GXG B;  3KY9 A;  4W9C A;  3IAS 1;  1ENF A;  3NVW A;  3ZNG C;  5J18 A;  2IGG A;  2KOX A;  4II2 B;  4WWP A;  2V9H A;  5C2T B;  3OWE B;  2LZ6 A;  2IY0 B;  3IHP C;  1E6E B;  2HJ1 A;  1L4D B;  4AP4 C;  2XN9 C;  3WIM A;  1WM3 A;  2K3U A;  3U7D A;  2N0S B;  1HZ6 A;  2H89 B;  3ZQ4 A;  2WHI A;  5H92 C;  1SE3 A;  3WCQ A;  2N7D A;  1TS5 A;  5BYQ A;  3ENE A;  1GUA B;  2HTH A;  1TKE A;  4C56 C;  2KWC A;  1E7U A;  1C4C A;  4BBN F;  5I4D A;  3PP2 A;  4KV2 A;  2V4I B;  2L2I A;  1WE6 A;  2LYD A;  4NAW B;  4NQL B;  3ZYY X;  3TMP B;  3HK0 A;  3UI3 A;  1PDX A;  2GBM A;  4WJQ A;  3DBL I;  2M14 A;  5CLQ B;  1YIW A;  1XKE A;  4IOI E;  3ZTD A;  1J0W A;  2J42 A;  2LFI A;  2QC8 A;  3E9O A;  3QA8 A;  1GAQ B;  1XLQ A;  3GZN B;  2BPS A;  4CHM A;  1V88 A;  3BK1 A;  2YS3 A;  4W9K A;  3MPX A;  3DBR I;  5IP4 D;  2D9V A;  1OEY A;  1TJ6 A;  2L0F A;  2C7H A;  2QEJ C;  4MEM A;  2JYE A;  2LD9 A;  4K7W A;  3IFW B;  3TCA A;  4LNF A;  4W9I A;  3ZNH B;  4WQO B;  3BII D;  2R2Q A;  2ELA A;  2EC1 A;  3DXD A;  1ZDV A;  2A4Z A;  4RFB A;  2JQR B;  4DXG A;  5J3T A;  2JVC A;  1V80 A;  3DPD A;  2KFK A;  2KQ7 A;  2ZCC A;  3AE5 B;  2JZZ A;  1WMH B;  1YN4 A;  3Q14 C;  5FR3 A;  4YTN B;  3EHV A;  3IXS A;  1DDM A;  1GNU A;  1X1G A;  1TS3 A;  4JKG B;  1N6Z A;  2MX2 A;  4IM2 A;  4RGO S;  4TUU A;  3RZW C;  4XDD A;  1UNR A;  4KZC A;  1ZYI A;  2WXP A;  2M0A A;  3VTU A;  2P0F A;  5DPS A;  2R0D A;  2CRF A;  3U7Z A;  5CHW A;  2KWD A;  1EU3 A;  4TQ1 A;  4IWQ A;  4HSI A;  2XEW A;  4MAC A;  2RDB C;  4TQ0 A;  2CS4 A;  3ETR A;  2ROV A;  4HK2 A;  2JF5 A;  4DHZ E;  1AQC A;  3SBG A;  2KUP A;  3AH7 A;  4WWM A;  4LK0 M;  1TXD A;  1KZ7 A;  1XT9 B;  2NBU A;  2NPT B;  2N23 A;  2JXX A;  2BB5 A;  3IVF A;  1DYQ A;  2R2Y A;  2JZP A;  3NZS A;  4JKF A;  3HM3 A;  3V62 A;  3ULB A;  4D2K A;  4CO7 A;  1P7E A;  1XCT L;  1K50 A;  1V5O A;  4B6W A;  1KZG A;  4JKD A;  1R4N B;  1I7H A;  1L0Y B;  1WYW B;  2DYO A;  1D5X C;  1VR9 A;  1WJ6 A;  3HRD D;  1STE A;  1MHX A;  2IBI B;  1P3Q U;  3Q3M C;  4JWS C;  1E9M A;  3A9K A;  2MCN B;  3DXC A;  1XR0 B;  2YT1 A;  3PRM B;  3KW5 B;  2CHZ A;  4HAZ B;  2LVP A;  2GCJ A;  4G3X B;  3AEF B;  4QJ3 B;  2PKO A;  2JYT A;  4EJN A;  1FHO A;  1T0Q C;  3MJ5 A;  4FUL A;  2L1C A;  1L7Y A;  3ZTC A;  4HAX B;  2VZK D;  2AL6 A;  3B2G A;  2XK5 A;  1HE8 A;  3W1Y A;  3O96 A;  3NJT A;  2KDE B;  1FFU A;  3JVZ X;  1BT0 A;  3U30 A;  3PS6 A;  3UIP B;  1RRP B;  3UQA A;  2L8J A;  3AE9 B;  4LJP B;  2CU3 A;  3OJ4 B;  1FXA A;  4F7U P;  2IFS A;  2QKL A;  2MBQ A;  2D3G A;  2O6V D;  3MFG A;  1KRH A;  4IM3 A;  4HVB A;  1XD3 B;  3PTF C;  2DKP A;  4OT1 A;  1E8Y A;  1WWT A;  3AEE B;  4ILJ A;  4FLH A;  3A4R A;  4HXD A;  2K0P A;  2MEK A;  4W9J A;  3LYY A;  3VHT C;  4MGZ E;  2RGF A;  1QIL A;  5KQ1 A;  1R4M I;  2RQ1 A;  1ZDX A;  1U5E A;  1IUE A;  1TKY A;  1MVK A;  3JSV B;  3VVW B;  3HVZ A;  3Q69 A;  1NYQ A;  4ICU A;  3U2S C;  1DDV A;  3DXE A;  2FUG 1;  1D6E C;  3A9J B;  3X0W A;  3TEW A;  1ET9 A;  3NS8 A;  1UWM A;  3FKY A;  4LNN A;  1C3T A;  1NU2 A;  2D5G A;  4EKU A;  5C6R A;  4BKT A;  3HM6 X;  1RFA A;  4JKC A;  2PE9 A;  4MH8 A;  3U12 A;  4G50 A;  1WGY A;  3AEG B;  1ZC3 B;  3RNB C;  4US9 A;  3BWU D;  3MC9 A;  1PGX A;  4D0N B;  2DTC A;  3QJZ A;  4IW0 A;  2LXA A;  3ZW3 A;  1FNU A;  2D3C A;  3AED B;  4PT5 A;  2JSV X;  2AL3 A;  1FXT B;  3FAH A;  1AW7 A;  5M4Y B;  3IAM 1;  3W1S C;  4PK1 A;  1EO6 A;  1T0S C;  3B2F A;  5C1Z A;  2BYE A;  3F0W A;  3WAM A;  1EU4 A;  3H8H A;  3R66 C;  3H9D A;  4DIX A;  4J3O D;  1GC6 A;  1V97 A;  3N1Y C;  1JWB D;  2RR9 A;  5H8Y E;  4B0M A;  3ZJU A;  5FK9 C;  3HW2 B;  4L1R A;  2CHW A;  3K9P B;  3N1Z C;  4TYZ A;  3APC A;  1DIK A;  2D9X A;  3D8D A;  1JRU A;  4A6F B;  3JW0 X;  4ANW A;  4GMX B;  4N58 A;  4NJ6 A;  2DAJ A;  1F77 A;  3QIJ A;  4IM0 A;  4N6E B;  2COF A;  3VH4 B;  3VIA A;  2ZEQ A;  2G35 A;  3TSS A;  4B9K A;  1FD6 A;  3U52 E;  2N9L A;  1YJJ A;  1XLP A;  2RLO A;  1FCL A;  1M7E A;  1TYG B;  4E74 A;  3QWM A;  2LKO A;  4RGN A;  4A9A A;  4HDO A;  2V3S A;  2QIL A;  5HI1 A;  4AS1 A;  3QBV B;  3PGE A;  3BY4 B;  3CIK A;  3V6C B;  3I5J C;  3ZJT A;  1QOF A;  4CSQ A;  1Q67 A;  1F2R C;  3RNE C;  3URY A;  5JHG A;  2JRI B;  1F9J A;  3I9V 1;  1FIQ A;  1X11 A;  1LGR A;  3CSF A;  4HAT B;  1WMH A;  5HE3 A;  4IG7 B;  4DWF A;  2GUM A;  2KX3 A;  3PRZ A;  4JKG A;  1UD7 A;  1EF1 A;  2BYF A;  3TUO A;  1Y19 B;  2FCM A;  3C19 A;  1GB1 A;  2D3A A;  3NOB A;  4GNK B;  2R61 A;  1SJE D;  2WP9 B;  2KAN A;  2MH7 A;  1Z2M A;  1WGQ A;  4II3 B;  5DCN A;  3D32 A;  4JQW C;  4KKI A;  1PYW D;  2FCQ A;  3GB1 A;  5FR6 A;  4FBJ B;  2Y5B B;  4W9L A;  1I4H A;  1KF6 B;  1GOZ A;  2K6D B;  2WXK A;  2ZVN A;  1TY2 A;  2IGH A;  2NPT A;  2Z59 B;  3LB8 C;  4XDC A;  1EVH A;  2IND C;  2KLG A;  1WG7 A;  4HB0 B;  1WH3 A;  2JUO A;  1GJZ A;  3B1L X;  2BGF A;  4K7S A;  3RD2 A;  4BAX A;  3DHI C;  2XNA C;  5AZG A;  2WDT B;  1V5U A;  1YX5 B;  2MWN B;  4KX6 B;  2MLB A;  3SFD B;  1DOI A;  4MDK E;  3R7R A;  4HB2 B;  2AX5 A;  2DX1 A;  4C7Y A;  3SNH A;  3MP9 A;  4Z2N A;  4I6P A;  3SBT A;  2KYW A;  4L6E A;  2KN5 A;  1VD2 A;  1T6B X;  2PVG C;  4PNK A;  3CST A;  4M00 A;  4RH6 A;  3LJ3 A;  1NEN B;  2YRY A;  2IPK D;  1PLS A;  1WIA A;  1NTY A;  4US8 A;  2NS5 A;  3KYD D;  3Q6B A;  2KDF B;  4OVZ A;  2KHW B;  3ZO5 B;  3KWL A;  2GB1 A;  3BZD B;  2QMT A;  4ARC A;  1W1G A;  3R2I A;  1BUI C;  3CMM B;  2BWE S;  4W9E A;  2KJ6 A;  3TFM A;  2W82 A;  3AI5 A;  1K51 A;  2GBK A;  2K9X A;  2VRR B;  3U4E G;  2FUH B;  5DPT A;  5I2S A;  3SD5 A;  4JKH A;  1YQ3 B;  1AYF A;  3SEB A;  1NYR A;  3PHX B;  2V0G A;  2UZS A;  3VR9 B;  4GU2 A;  3KLS X;  1Y56 A;  3WAN A;  4BOS C;  5DPW A;  1E10 A;  3VUY A;  3ZLZ A;  3N7C A;  1DRO A;  5T8I A;  2MFQ A;  2C7M B;  2B76 B;  1F1H A;  1G6J A;  1I4P A;  3PLU A;  3C0R B;  2M56 B;  3OJ3 A;  3MHZ A;  2WWZ A;  5JHA A;  1XLO A;  1W1D A;  1GPX A;  4HB3 B;  1K52 A;  2M19 A;  2CY4 A;  3P7Z A;  3JSV A;  3M95 A;  4FXC A;  1FNW A;  1T77 A;  2Y8G A;  2LI5 A;  1RRB A;  2YEP B;  4NJ7 A;  1QC6 A;  2WDQ B;  2WXJ A;  1JWU D;  1IP9 A;  2ZW1 A;  3RUL A;  4DX8 A;  3A9J A;  2KAC A;  4OZA A;  2KC1 A;  3H1U A;  5C23 A;  2BBC A;  2FIF A;  2W54 A;  5LXH A;  4M8M A;  1UPR A;  4KSL C;  3APD A;  5C79 A;  1QOB A;  1VDV A;  1WJM A;  1UGM A;  1KTK A;  1V5T A;  3FC4 A;  3B77 A;  1VZ6 A;  2L1A A;  2LMC A;  1WFY A;  4LNO A;  1T0R C;  4DHZ B;  4HAY B;  4BKS A;  1WI0 A;  4WAF A;  2ADZ A;  3ZNZ B;  1JW9 D;  1XCQ L;  1SGH A;  3Q8F A;  4B0E A;  3OAN A;  4LLG M;  4JKB A;  4OVU A;  4NSW A;  4LJO B;  2WXM A;  1E7P B;  5EE9 A;  2DIK A;  2ZCB A;  1XX0 A;  1FFV A;  2ZJD A;  4BOZ B;  1ACA A;  2WH5 A;  2KC2 A;  1OQN A;  1V1P B;  3L08 A;  4A6F A;  1BAK A;  2COA A;  1VBG A;  1SE4 A;  1ZE3 D;  3BVM A;  2X18 A;  1KBL A;  1WXV A;  1IGD A;  1I4G A;  3NWD A;  2C7N B;  1NVL A;  2MQJ A;  3PLV A;  4DXF A;  1BTK A;  4XGA B;  1FHX A;  4E71 A;  1MAI A;  3KWV A;  3V5W A;  1RFK A;  1P7F A;  2WXQ A;  1LM8 B;  4NZL B;  4R3D A;  2ZPN A;  3OG5 A;  3P4S B;  4OW0 A;  4NQK E;  2UZR A;  3K9O B;  4K2O A;  1FCC C;  3IG3 A;  3P4R B;  1ZXH A;  1OEY J;  4L1B A;  1HZ5 A;  1C78 A;  2L05 A;  4ZDV A;  3GYO A;  4RGT A;  2INC C;  1ZGU B;  2WXF A;  3B9J A;  2KIG A;  3VOQ A;  4GB9 A;  4KDI C;  1V9J A;  2CAY A;  3P2B A;  4JKA A;  4AQ7 A;  5BYR A;  4N9F 4;  3A33 B;  2KFJ A;  2OJW A;  3UIN B;  1E8W A;  3VFK A;  3TVV A;  5CTR C;  2NVU I;  5IKC M;  4H2A A;  1FM0 D;  4IC7 B;  3W1S A;  4DQO C;  4ZRK A;  2MP2 B;  3FM8 C;  3DVN U;  2IO0 B;  1E7V A;  3ZVV A;  3SYX A;  1JQ4 A;  2R09 A;  1V1O A;  5LG4 B;  1PGB A;  1KOT A;  4PS3 A;  1WX9 A;  2Z59 A;  3QAQ A;  1Z5S B;  3O65 B;  4C7Z A;  4LNK A;  3RUI B;  1L0V B;  4KIK B;  5KHO A;  2J7Q B;  3NWA A;  1MKE A;  1P98 A;  3DBL B;  4ZRP A;  5DHF B;  2PLP A;  4BZA A;  1OFF A;  3KUC B;  2KLC A;  2LXC A;  2O6V A;  3DVG Y;  4RCO A;  3V6E B;  4IUM B;  4H8S A;  2IO1 B;  2KQS A;  2XBB C;  1EWY C;  2BWF A;  2NR2 A;  1ET6 A;  1I4R A;  2KAJ A;  4MGK E;  5AEK B;  2V4L A;  2WS3 B;  2DZM A;  3FP5 A;  1TQZ A;  1V5M A;  1L6V A;  3ABV B;  1WGH A;  3DBR B;  2L00 B;  2D3B A;  2IO3 B;  3PSE B;  4F1S A;  5CHF A;  1E0Z A;  2AQ3 B;  4PS8 A;  3AN1 A;  3VR8 B;  3L54 A;  1U5D A;  4IOY X;  4ICV A;  1D5M C;  4EEW A;  1A70 A;  4GLS C;  3QX1 A;  4BBN C;  2CJO A;  1SB3 C;  2KO3 A;  4RMA A;  4HCN B;  5D3V A;  2LHD A;  3UF8 A;  2RDG A;  1WXM A;  2RMM A;  4B95 A;  1Y5O A;  2KDI A;  3N1X C;  4HKZ E;  1I4Q A;  1IGC A;  3BVZ A;  1N5X A;  2WDV B;  2QHO A;  4HPL B;  4WVF B;  1LQB A;  4G11 A;  4Q2J A;  2LOX A;  4YSZ B;  2LUE A;  2VH2 A;  3PRP B;  1RJ2 A;  2DZK A;  2PMV A;  4HAW B;  1IPG A;  3KUZ A;  2YVC A;  1XLN A;  2WQY B;  4DHJ B;  2ZPY A;  3M1I B;  3EEC A;  2KKC A;  1NTI A;  5IA7 A;  2WXH A;  4GDK A;  2LBB A;  2GBN A;  3AEB B;  4YXD B;  2KDM A;  5L83 A;  1VLB A;  1L4Z B;  4XWX A;  2LG1 A;  1UZX B;  4ITK A;  2LGX A;  3AUL A;  1E90 A;  4XE0 A;  3TJP A;  1UGJ A;  2R82 A;  3UQB A;  2GBJ A;  2Z14 A;  5D3D A;  2KVZ A;  2QCZ A;  1SJH D;  2CJN A;  1EAZ A;  2HJ8 A;  5J17 A;  5AUK A;  2K5P A;  3VH3 B;  3TL5 A;  1C77 A;  2WU5 B;  1YN3 A;  3RZF A;  4FHK A;  1J7C A;  2ICI A;  3G9W A;  5HKH A;  2COC A;  1HXY D;  3ZUN A;  5BO4 B;  1NEK B;  1AN8 A;  3PO0 A;  4MGI E;  1MFW A;  4GXB A;  2LUL A;  2DAF A;  1VCB A;  2JT4 B;  3AE2 B;  2DYM A;  3B08 A;  1N3H A;  2ACZ B;  4JWU C;  4NAM A;  1C76 A;  1LB1 A;  2BS3 B;  4RNA A;  1AAR A;  4FN2 A;  3CXB B;  5EFX A;  1FPY A;  3ECI A;  3AE6 B;  3A1Q B;  2BYT A;  3PHW B;  5C3J B;  2K2J A;  3NUH B;  4M0W A;  4KKJ A;  4ZRJ A;  2DHK A;  1OGW A;  3AJ4 A;  2ZZP B;  2RD0 A;  2AEH A;  1V1P A;  1SHC A;  1WJ1 A;  1T0Y A;  1DOX A;  2WX0 A;  2VSZ A;  2IJ0 A;  5DI9 B;  3RCZ A;  3VDZ A;  1BML C;  2X0S A;  2RNR B;  2RDH A;  1MG4 A;  1WM2 A;  2WX1 A;  3NVZ A;  1UF0 A;  1WGD A;  3KVF B;  2XQN M;  2OHF A;  2I5F A;  3GP7 A;  3PV1 A;  5HE0 A;  2MHJ A;  1I42 A;  1VJK A;  1MI0 A;  3UIO B;  1WXS A;  1H8C A;  1R4M B;  3QK0 A;  1YN5 A;  5FKA C;  1Q1O A;  3IT4 B;  1HTQ A;  2NBW B;  3SHQ A;  2M17 A;  2JXT A;  1M94 A;  2DEN B;  2D4Q A;  3Q2A C;  4W9D A;  2CU1 A;  2GI9 A;  3NY5 A;  3J9C A;  2N9P C;  4YTM B;  4AOF A;  5E6J A;  1X86 A;  1MJD A;  4HRO A;  3SFE B;  2QJL A;  2G9H D;  3ZGZ A;  1EM7 A;  1ZM0 A;  2YSZ A;  1HQR D;  3VUW A;  3DWG C;  2J59 M;  2SEB D;  5DPR A;  1TJE A;  1L2N A;  4OSN A;  4W9G A;  4KSK C;  1TZ1 A;  1WRD B;  4HJK A;  3R8B A;  4TMA B;  1QQG A;  2LGI A;  2Y5P A;  3TIX A;  3AE7 B;  4LTU A;  5KCV A;  3VXW A;  1SIJ A;  2IY1 B;  1TS2 A;  2L0T A;  3BYT B;  2MP2 A;  4RF1 A;  1ISN A;  4CYE A;  4F7Z A;  2KZR A;  2LVQ A;  2P0D A;  3GS2 A;  3KRW A;  2K8H A;  2I38 A;  2WLB A;  5MPO A;  2DWQ A;  4JGH B;  2MDX A;  2N9X A;  3DDC B;  3L17 A;  4JX1 C;  4KIK A;  3ZDT A;  3Q3F A;  4ACF A;  2JRH A;  4X57 B;  1IBX A;  4QJ5 B;  2DLW A;  3FIL A;  4MGY E;  4ZHP A;  2W55 A;  3EA6 A;  1WRI A;  2IDY A;  2RPV A;  2CY5 A;  3NS1 A;  2PEA A;  4RF0 A;  2ONQ A;  2W9N A;  4WIP A;  2LJI A;  2OOB B;  1L6U A;  2L7R A;  4TV3 A;  2W2X D;  1V6E A;  3PVU A;  2L76 A;  2D11 A;  2HDE A;  4D6W A;  4E3C A;  1BXT A;  2K49 A;  2K00 A;  3W5U B;  1I7A A;  2LVO A;  3NZU A;  3ZIM A;  3NVV A;  3E9S A;  1UEL A;  3NSU A;  2K8E A;  1XXG A;  5IRS A;  3W5V B;  2LHE A;  3QHT A;  1YOV B;  3HSA A;  1XCG A;  4N59 A;  3NHE B;  3PSC A;  4ANV A;  4ARI A;  1V5P A;  3M62 B;  4PYZ A;  1ESF A;  3FEH A;  4EOY A;  4HDQ A;  3IT6 B;  3PVW A;  4C00 A;  3V05 A;  2V1Y A;  3A8Q A;  2BTE A;  1C9F A;  3AM9 A;  2L83 A;  1OY2 A;  4C0A A;  2QSD A;  2DLB A;  3I57 A;  2DZJ A;  5BMI A;  5G5H A;  4WJO A;  4L2Y A;  2J0J A;  3VAW A;  3KUD B;  3EPY A;  1PFJ A;  5FI1 A;  2BS4 B;  3N32 A;  1GG3 A;  3P6A A;  2Y3A A;  4ANU A;  3ZVR A;  2D07 B;  2FCN A;  2VZK B;  3BJI A;  1RYJ A;  3Q8A A;  2H88 B;  1MIX A;  2GMI C;  1QT9 A;  4A3P A;  4DXA B;  2Z0D B;  3DCX A;  1CJE A;  2SAK A;  3BIN A;  3TBL D;  2J4X A;  4FAD A;  3NVY A;  2O6V B;  1PUT A;  3MJW A;  1AWD A;  1KLU D;  5EE3 A;  4KHA A;  1OMW A;  1ZOY B;  4LDT D;  1EUV B;  1TT5 B;  2MW5 A;  4P1C C;  2MA9 B;  2OTX A;  5AZH A;  1Y8R C;  1JRP A;  3SU8 X;  3ODW A;  4PS7 A;  2ZKM X;  2LJ5 A;  2DHZ A;  5D3Y A;  4A6Q A;  2EKI A;  1CQV A;  4QXA B;  4IWO A;  2I2Y A;  2AQ2 B;  2WXR A;  5DH9 B;  3QAR A;  3RPF C;  5HHD G;  3VUX A;  1XQQ A;  3HIE A;  2LOZ A;  1KC7 A;  1EGX A;  3AV8 A;  3QQ8 B;  1YD8 U;  3ML8 A;  3ZDM C;  1I35 A;  4BKG A;  1B55 A;  3T3N A;  3JYU A;  5EE0 A;  3ODO A;  2PPH A;  2YF0 A;  4DX9 0;  3DVG X;  3KZ1 A;  3ODX A;  1N61 A;  3NG0 A;  1X1M A;  3TEZ A;  2H7D A;  3A1Q A;  1NI3 A;  1V81 A;  4WJP A;  3PEG A;  2G45 B;  3HQC A;  5JVL A;  3RNF C;  1WZ0 A;  3ZRF A;  4JKE A;  2KNB A;  2GJY A;  2YS1 A;  4ZRQ A;  4S17 A;  1FAO A;  2M38 A;  2KK8 A;  3NW8 A;  5CHV C;  2D9Z A;  1F52 A;  3ML4 A;  2JZ3 B;  5GMV A;  2FAZ A;  1P1A A;  2MBB B;  1P9D U;  2K8C A;  4WUR A;  4HWI B;  4XWT A;  3VTW A;  4GDK B;  4MY6 A;  1XF5 L;  1HA5 A;  2JP2 A;  4KAX B;  3ZKJ C;  1C4P A;  5CLL B;  1UUP A;  5HE2 A;  4ASW C;  3SR6 A;  4A5K A;  1WXA A;  5BMH A;  2DNF A;  1MK9 B;  3ZNI D;  2P8V A;  3M3J A;  2BKF A;  1KLV A;  2WGS A;  2K8B A;  4ZRI A;  3RN9 C;  1I4X A;  1ZKH A;  1ST7 A;  5D6J B;  2A5U A;  2GS0 A;  4XYC A;  4KGS A;  3DHH C;  4YL8 A;  2LGY A;  1MIZ B;  1WGU A;  2FE8 A;  2N4F A;  1UNS A;  1UBQ A;  5JH5 C;  3DQV A;  1NBF C;  2VRW B;  2DA0 A;  4WJ7 A;  2YLM A;  3P1M A;  2MJE A;  2MKR A;  2OJR A;  3T9L A;  1KLG D;  1FHW A;  2NMB A;  4IWP A;  1N60 A;  2KMM A;  2E6X A;  4HEA 1;  1V8C A;  1YX6 B;  2PIA A;  3DHG C;  4F7G A;  4DBG A;  3LDZ E;  2DZI A;  3MC0 B;  3ML9 A;  3V60 A;  1C79 A;  4M0W B;  1M7R A;  4YSX B;  4GIV A;  4A6H A;  2KDB A;  2KMA A;  2KXJ A;  1TY0 A;  3CF6 E;  4MM3 B;  3TEX A;  1D3Z A;  1TZO A;  2DX5 A;  1LXD A;  2KJR A;  1SE2 A;  3SDL C;  1WY8 A;  1WGG A;  1WGR A;  2BT6 A;  1HBK A;  1LW3 A;  1L5P A;  4CHK A;  2WXI A;  4QJ4 B;  2KT7 A;  5AUI A;  3DBH I;  4I6N B;  1FMA D;  1X05 A;  2CR5 A;  4ZYS A;  3LJU X;  2JY6 A;  2LRW A;  4YTP B;  1WF9 A;  2K39 A;  1WX7 A;  4M8N A;  1QOA A;  4A3O A;  2INN E;  1H4R A;  2KMC A;  5JHH A;  5D7G A;  3N3K B;  4J6I A;  1P6S A;  4GPT B;  1UBI A;  2TSS A;  1WJ4 A; 
#chains in the Genus database with same CATH homology
 5D27 A;  1E8Z A;  4FHJ A;  4GSW A;  1FB8 A;  4K17 A;  1V86 A;  2IO2 B;  2UVM A;  1ZSQ A;  2LGD A;  4K2P A;  3L10 B;  3PT2 B;  3H7S A;  1U27 A;  4K81 A;  2DHJ A;  2KGX B;  3RT3 B;  2D10 A;  1LFD A;  3TW1 A;  1WI1 A;  2EMT A;  3UZT A;  3WA0 A;  2MBO A;  1J0G A;  1S1Q B;  4TKN A;  4DBB A;  4WSF A;  5L95 C;  4Y94 A;  4GZU A;  3QC8 B;  2ZVO A;  2M8S A;  4JK8 A;  2CB8 A;  3VQI A;  2M0X A;  2DN6 A;  5C16 A;  2KTR B;  3L0W B;  3PRE A;  5LOP B;  4FJZ A;  1NTV A;  3GZN I;  3SO6 A;  2K6Q A;  1Q0W B;  1V2Y A;  2DYN A;  4GOC A;  4KDL B;  5D94 A;  3QCA A;  4AJY B;  4I6L B;  1HB8 A;  2KCJ A;  3GYP A;  4EZJ A;  1QZE A;  3H7P B;  1V61 A;  2AYO B;  2DYB A;  1DDW A;  3WAP A;  1ZW7 A;  2BF8 B;  3IBE A;  2CKH B;  1KM7 A;  5JP4 A;  2UYZ B;  3WAO A;  2MSE D;  3FLV A;  3T06 A;  4RM8 A;  1Z87 A;  4FA6 A;  2W2W A;  1H10 A;  2K1F A;  4DDG D;  2MRP A;  4GN1 A;  4K1R B;  1E8X A;  1WR6 E;  2Y7B A;  4HCP B;  3VTV A;  3WYF B;  2REX A;  1WJN A;  4MK0 A;  4HB4 B;  4BKS D;  3A8P A;  1AWE A;  4HLE A;  1K8R B;  4K7U A;  3SUZ A;  4A20 A;  4A6K A;  2C5L C;  2J0K A;  1X1F A;  1S3S G;  1FGY A;  1MK7 B;  1ZC4 B;  2PZ1 A;  2LAS A;  4GDL A;  1TTN A;  1MG8 A;  3DVN V;  3ONS A;  4PQ0 A;  1WJU A;  5FI0 A;  2COD A;  5E6P A;  4DDI D;  1UNQ A;  2C60 A;  3OLM D;  3E66 A;  1WR1 A;  1WE7 A;  2VKI A;  2J0M A;  1OTR B;  2GBR A;  2KWU B;  2KTF A;  1RAX A;  4JIO U;  1R4N I;  2RGN B;  3L13 A;  2ROZ B;  5LON B;  3L16 A;  2D9Y A;  3MDB C;  4AWJ A;  4NY0 A;  2O2V A;  1P3R A;  2MWS B;  2H7E A;  2Z0E B;  5DIF B;  2G4S A;  1NDD A;  3PVL A;  1TBE A;  2LRU A;  1YJ1 A;  4MM3 A;  4JK7 A;  2D2Q A;  4MSQ B;  1FGZ A;  1ZVR A;  5C5B B;  3KYC D;  3PPA A;  2KJH B;  1U29 A;  1OQY A;  1I2H A;  2ABD A;  2K25 A;  1W1H A;  2RPQ A;  4G0N B;  2GCL A;  3KH0 A;  2Y8F A;  1XOD A;  1WVH A;  1K5G B;  3AU5 A;  1BWN A;  1CMX B;  2WYQ A;  5IJM A;  4HAU B;  3S2A A;  5J3Y A;  3E9P A;  4YON A;  2BYV E;  2FJ9 A;  4KHB B;  5KQ4 A;  2DFK A;  3M63 B;  1IYF A;  2MBH A;  1RLF A;  5D3W A;  2Q13 A;  3EFU A;  2IYD B;  2L3Z A;  2COP A;  5JHB A;  2KD0 A;  5CX3 A;  4MJS B;  2E2X A;  2KWV B;  2N7E A;  3GOE A;  4Z2M B;  1PMS A;  1C1Y B;  2RSU A;  4XX5 A;  3ENB A;  5D3X A;  2B3A A;  2EKE C;  2LWP A;  4BFR A;  3D8E A;  4ILH A;  3PZD A;  2DYQ A;  3DOW A;  2I1J A;  1J19 A;  2DX5 B;  4KZ0 A;  3AXC A;  1HB6 A;  4HAV B;  4BBK A;  2KTR A;  2N9E B;  2HRJ A;  4NAW A;  1GC7 A;  2BCJ A;  3N30 A;  1K5D B;  2JPH A;  1JDE A;  3AU4 A;  1P0R A;  3H7P A;  1YQB A;  2ELB A;  2NZ8 B;  4AJW A;  3R3M A;  2NBV B;  3ZRC A;  4FJY A;  2KX0 A;  1E5W A;  2M4N A;  1SE9 A;  2N0Y A;  2YT0 A;  2V76 A;  4WWO A;  2GOW A;  2HD5 B;  1TGZ B;  2FCS A;  2RSG A;  1BTN A;  2Z0Q A;  5E6O A;  3SV1 A;  2DHI A;  2NCN A;  5EDS A;  3H6N A;  2HE7 A;  1U4A A;  5G2N A;  4AUQ C;  5E6N A;  1UH6 A;  2ZNV C;  2R2O A;  1EF5 A;  4F7H A;  2JWZ A;  3MTN B;  2KVR A;  5IAA C;  3X23 A;  4HPM B;  3RYT A;  4ANX A;  3A4S C;  1U2B A;  2HTH B;  3D8F A;  1DYN A;  4NNJ B;  4LCD E;  3FSS A;  2W2X C;  5LLI A;  2D9W A;  1Q5W B;  1V49 A;  4IFS A;  2AWT A;  2UWQ A;  5G55 A;  1UEF A;  4F8C B;  3F5R A;  2IZV B;  4WJN A;  2EJ8 A;  2BKR B;  4JL9 A;  2FNJ B;  4GGQ A;  3QWZ B;  2I1K A;  1SIF A;  3APF A;  4EZL A;  2CHX A;  3OAW A;  4ILG B;  1WZ3 A;  4BVU C;  4MH0 E;  5HE1 A;  4P7I A;  1UNP A;  3ALB A;  4EFO A;  4IAP A;  3HIZ A;  3DCG A;  4NPN A;  5LXI B;  2RVB B;  2M1M A;  2KFK B;  3PG7 A;  1NI2 A;  4JK9 A;  5L81 A;  3I3T B;  1WX8 A;  1P5T A;  5TR5 A;  2EMS A;  2ZNV B;  5AZF A;  5C5B A;  4XC2 A;  4WWN A;  2G3Q B;  1KI1 B;  4EZK A;  4GDL B;  5KHQ A;  1U5G A;  2DKQ A;  2FDQ A;  1A5R A;  4WAA A;  4URK A;  4ZYN A;  5JLJ B;  2IYB A;  1FOE A;  2C9W B;  2Z0P A;  1U5F A;  4HHV A;  3A98 B;  2QKM A;  4W9H A;  4JLC A;  2PE6 B;  3WAL A;  3EC8 A;  5J3Q A;  4XZ4 A;  4MEL A;  3R7Q A;  5DHA B;  4GMV A;  3Q3J A;  2MBE A;  3DBS A;  2G4D B;  2O2V B;  2FID A;  4MJS A;  3HHM A;  4OVV A;  3T8M A;  2Z0O A;  1J8C A;  3RCP A;  2N1V A;  3UGB B;  1GGO A;  3A9K B;  1VBH A;  2OQB A;  4KHO A;  3KRX A;  2PJH A;  4MT7 A;  1PQS A;  4CHJ A;  2YS5 A;  4EUT A;  3MHS D;  4EMO A;  2I5C A;  3U8Z A;  4DHJ D;  2P0H A;  2K2U A;  4FJV B;  2XK5 B;  1V89 A;  3E9L A;  2CQU A;  3B0A A;  3ULC A;  4PYU A;  4W9F A;  1DBH A;  1KJT A;  1MPH A;  2RUK B;  4DK5 A;  3TO1 A;  4MSM B;  3KSY A;  4KVG B;  5J2R A;  1XD4 A;  5D2M B;  4LDT B;  4B6H A;  1UPQ A;  2N1W A;  5JZE B;  5GOW B;  2ASQ A;  1IRS A;  2FJL A;  3V61 A;  4RM9 A;  3KY9 A;  4W9C A;  3ZNG C;  5J18 A;  2KOX A;  4II2 B;  4WWP A;  2LZ6 A;  2IY0 B;  3IHP C;  4AP4 C;  3WIM A;  1WM3 A;  3U7D A;  2N7D A;  3ENE A;  1GUA B;  2HTH A;  2KWC A;  1E7U A;  4BBN F;  3PP2 A;  4KV2 A;  2L2I A;  1WE6 A;  2LYD A;  4NAW B;  4NQL B;  3TMP B;  3HK0 A;  2GBM A;  4WJQ A;  3DBL I;  2M14 A;  5CLQ B;  1YIW A;  1XKE A;  3ZTD A;  1J0W A;  3E9O A;  3QA8 A;  2BPS A;  4CHM A;  1V88 A;  2YS3 A;  4W9K A;  3MPX A;  3DBR I;  2D9V A;  1OEY A;  1TJ6 A;  2L0F A;  2C7H A;  4MEM A;  2LD9 A;  4K7W A;  3IFW B;  3TCA A;  4W9I A;  3ZNH B;  4WQO B;  2R2Q A;  2ELA A;  2EC1 A;  3DXD A;  2A4Z A;  5J3T A;  2JVC A;  1V80 A;  3DPD A;  2KFK A;  2KQ7 A;  2ZCC A;  1WMH B;  2JZZ A;  3EHV A;  1DDM A;  1GNU A;  1X1G A;  4JKG B;  2MX2 A;  4IM2 A;  4TUU A;  3RZW C;  1UNR A;  4KZC A;  3VTU A;  2P0F A;  5DPS A;  2R0D A;  2CRF A;  5CHW A;  4TQ1 A;  4IWQ A;  2XEW A;  4TQ0 A;  2CS4 A;  2ROV A;  4HK2 A;  2JF5 A;  4DHZ E;  1AQC A;  3SBG A;  2KUP A;  1TXD A;  1KZ7 A;  1XT9 B;  2NBU A;  2NPT B;  2N23 A;  2JXX A;  3IVF A;  3NZS A;  4JKF A;  3HM3 A;  3V62 A;  3ULB A;  4CO7 A;  1V5O A;  4B6W A;  1KZG A;  4JKD A;  1WYW B;  2DYO A;  1WJ6 A;  2IBI B;  1P3Q U;  3A9K A;  2MCN B;  3DXC A;  1XR0 B;  2YT1 A;  3PRM B;  3KW5 B;  2CHZ A;  4HAZ B;  2LVP A;  2GCJ A;  4G3X B;  4EJN A;  1FHO A;  4FUL A;  2L1C A;  1L7Y A;  3ZTC A;  4HAX B;  2AL6 A;  2XK5 A;  1HE8 A;  3W1Y A;  3O96 A;  2KDE B;  3JVZ X;  1BT0 A;  3U30 A;  3PS6 A;  3UIP B;  1RRP B;  3UQA A;  2L8J A;  4LJP B;  3OJ4 B;  4F7U P;  2IFS A;  2QKL A;  2MBQ A;  2D3G A;  2O6V D;  4IM3 A;  4HVB A;  1XD3 B;  3PTF C;  2DKP A;  1E8Y A;  4ILJ A;  4FLH A;  3A4R A;  4HXD A;  4W9J A;  3VHT C;  4MGZ E;  2RGF A;  5KQ1 A;  1R4M I;  2RQ1 A;  1U5E A;  3JSV B;  3VVW B;  4ICU A;  1DDV A;  3DXE A;  3A9J B;  3X0W A;  3NS8 A;  1C3T A;  1NU2 A;  4EKU A;  5C6R A;  4BKT A;  3HM6 X;  1RFA A;  4JKC A;  2PE9 A;  4G50 A;  1WGY A;  1ZC3 B;  4D0N B;  2DTC A;  3QJZ A;  4IW0 A;  2LXA A;  3ZW3 A;  2AL3 A;  1FXT B;  3W1S C;  1EO6 A;  5C1Z A;  2BYE A;  3F0W A;  3WAM A;  3R66 C;  3H9D A;  1GC6 A;  2RR9 A;  3HW2 B;  2CHW A;  3K9P B;  4TYZ A;  3APC A;  1DIK A;  2D9X A;  3D8D A;  1JRU A;  4A6F B;  3JW0 X;  4ANW A;  4GMX B;  4NJ6 A;  2DAJ A;  3QIJ A;  4IM0 A;  2COF A;  3VH4 B;  3VIA A;  2ZEQ A;  2G35 A;  4B9K A;  2RLO A;  1M7E A;  4E74 A;  3QWM A;  2LKO A;  4HDO A;  2V3S A;  3QBV B;  3PGE A;  3BY4 B;  3CIK A;  3V6C B;  1Q67 A;  5JHG A;  2JRI B;  1F9J A;  1X11 A;  3CSF A;  4HAT B;  1WMH A;  5HE3 A;  4IG7 B;  4DWF A;  2KX3 A;  3PRZ A;  4JKG A;  1UD7 A;  1EF1 A;  2BYF A;  1Y19 B;  2FCM A;  3NOB A;  2KAN A;  1Z2M A;  1WGQ A;  4II3 B;  5DCN A;  3D32 A;  4JQW C;  2FCQ A;  5FR6 A;  4FBJ B;  2Y5B B;  4W9L A;  2K6D B;  2ZVN A;  2NPT A;  2Z59 B;  1EVH A;  2KLG A;  1WG7 A;  4HB0 B;  1WH3 A;  2JUO A;  1GJZ A;  3B1L X;  2BGF A;  4K7S A;  3RD2 A;  5AZG A;  2WDT B;  1V5U A;  1YX5 B;  2MWN B;  2MLB A;  4MDK E;  3R7R A;  4HB2 B;  2DX1 A;  3SNH A;  4Z2N A;  4I6P A;  3SBT A;  4L6E A;  2KN5 A;  1VD2 A;  4PNK A;  3CST A;  3LJ3 A;  2YRY A;  1PLS A;  1WIA A;  1NTY A;  2NS5 A;  3KYD D;  2KDF B;  3ZO5 B;  2KHW B;  1W1G A;  3CMM B;  2BWE S;  4W9E A;  2KJ6 A;  3TFM A;  3AI5 A;  2GBK A;  2VRR B;  2FUH B;  5DPT A;  3SD5 A;  4JKH A;  3PHX B;  2UZS A;  4GU2 A;  3WAN A;  5DPW A;  4BOS C;  3VUY A;  3ZLZ A;  3N7C A;  1DRO A;  2MFQ A;  2C7M B;  1G6J A;  3PLU A;  3C0R B;  3OJ3 A;  2WWZ A;  5JHA A;  1W1D A;  4HB3 B;  3JSV A;  2CY4 A;  3P7Z A;  3M95 A;  2Y8G A;  2LI5 A;  1RRB A;  4NJ7 A;  1QC6 A;  1IP9 A;  3RUL A;  4DX8 A;  3A9J A;  2KC1 A;  5C23 A;  3H1U A;  2FIF A;  5LXH A;  4M8M A;  1UPR A;  4KSL C;  3APD A;  5C79 A;  1WJM A;  1UGM A;  1V5T A;  1WFY A;  4DHZ B;  4HAY B;  4BKS A;  1WI0 A;  2ADZ A;  3ZNZ B;  1SGH A;  3OAN A;  4JKB A;  4OVU A;  4NSW A;  4LJO B;  2DIK A;  2ZCB A;  1XX0 A;  2ZJD A;  4BOZ B;  1ACA A;  2WH5 A;  2KC2 A;  1OQN A;  3L08 A;  4A6F A;  1BAK A;  2COA A;  1VBG A;  2X18 A;  1KBL A;  1WXV A;  2C7N B;  1NVL A;  2MQJ A;  3PLV A;  1BTK A;  1FHX A;  4E71 A;  1MAI A;  3V5W A;  1LM8 B;  2ZPN A;  4NQK E;  2UZR A;  3K9O B;  4K2O A;  3IG3 A;  1OEY J;  2L05 A;  4ZDV A;  3GYO A;  1ZGU B;  3VOQ A;  4GB9 A;  4KDI C;  1V9J A;  2CAY A;  3P2B A;  4JKA A;  4N9F 4;  1WJ4 A;  2KFJ A;  3UIN B;  1E8W A;  3VFK A;  3TVV A;  5CTR C;  2NVU I;  4IC7 B;  3W1S A;  4ZRK A;  2MP2 B;  3FM8 C;  3DVN U;  2IO0 B;  1E7V A;  3ZVV A;  3SYX A;  2R09 A;  1KOT A;  4PS3 A;  1WX9 A;  3QAQ A;  1Z5S B;  3O65 B;  3RUI B;  4KIK B;  5KHO A;  2J7Q B;  1MKE A;  1P98 A;  5DHF B;  3KUC B;  2KLC A;  2LXC A;  2O6V A;  3DVG Y;  3V6E B;  4IUM B;  4H8S A;  2IO1 B;  2KQS A;  2XBB C;  2BWF A;  2NR2 A;  4MGK E;  5AEK B;  2V4L A;  2DZM A;  3FP5 A;  1TQZ A;  1V5M A;  1WGH A;  2L00 B;  2IO3 B;  3PSE B;  4F1S A;  5CHF A;  4PS8 A;  3L54 A;  1U5D A;  4IOY X;  4ICV A;  4EEW A;  3QX1 A;  4BBN C;  2KO3 A;  4RMA A;  4HCN B;  5D3V A;  3UF8 A;  1WXM A;  4B95 A;  1Y5O A;  2KDI A;  2QHO A;  4HPL B;  4WVF B;  1LQB A;  4G11 A;  2LOX A;  2LUE A;  3PRP B;  1RJ2 A;  2DZK A;  4HAW B;  1IPG A;  3KUZ A;  2YVC A;  4DHJ B;  2ZPY A;  3M1I B;  3EEC A;  2KKC A;  1NTI A;  5IA7 A;  4GDK A;  2LBB A;  2GBN A;  5L83 A;  4XWX A;  2LG1 A;  1UZX B;  2LGX A;  3AUL A;  1E90 A;  3TJP A;  2R82 A;  3UQB A;  2GBJ A;  1EAZ A;  2HJ8 A;  5J17 A;  3VH3 B;  3TL5 A;  3RZF A;  4FHK A;  3G9W A;  5HKH A;  2COC A;  3ZUN A;  5BO4 B;  4MGI E;  4GXB A;  2LUL A;  2DAF A;  1VCB A;  2JT4 B;  2DYM A;  3B08 A;  1N3H A;  1LB1 A;  1AAR A;  4FN2 A;  3CXB B;  5EFX A;  3ECI A;  3A1Q B;  3PHW B;  2K2J A;  4ZRJ A;  2DHK A;  1OGW A;  3AJ4 A;  2ZZP B;  2RD0 A;  2AEH A;  1SHC A;  1WJ1 A;  1T0Y A;  2WX0 A;  2VSZ A;  5DI9 B;  3RCZ A;  3VDZ A;  2X0S A;  2RNR B;  1WM2 A;  2WX1 A;  1WGD A;  3KVF B;  2XQN M;  2I5F A;  3PV1 A;  5HE0 A;  1I42 A;  3UIO B;  1WXS A;  1H8C A;  3QK0 A;  1Q1O A;  2NBW B;  3SHQ A;  2M17 A;  1M94 A;  2DEN B;  2D4Q A;  4W9D A;  2CU1 A;  3NY5 A;  2N9P C;  4AOF A;  1X86 A;  1ZM0 A;  2YSZ A;  3VUW A;  2J59 M;  5DPR A;  1L2N A;  4W9G A;  4KSK C;  1TZ1 A;  1WRD B;  4HJK A;  1QQG A;  3TIX A;  5KCV A;  3VXW A;  2IY1 B;  2L0T A;  2MP2 A;  1ISN A;  4CYE A;  4F7Z A;  2KZR A;  2LVQ A;  2P0D A;  3KRW A;  2K8H A;  4JGH B;  2MDX A;  2N9X A;  3DDC B;  3L17 A;  4KIK A;  3ZDT A;  3Q3F A;  2JRH A;  4X57 B;  2DLW A;  4MGY E;  2CY5 A;  2PEA A;  2W9N A;  2OOB B;  2L7R A;  4TV3 A;  2W2X D;  1V6E A;  3PVU A;  2L76 A;  2D11 A;  4E3C A;  2K00 A;  1I7A A;  2LVO A;  3NZU A;  3ZIM A;  1UEL A;  3NSU A;  3QHT A;  1XCG A;  3NHE B;  3PSC A;  4ANV A;  1V5P A;  3M62 B;  4PYZ A;  3FEH A;  4EOY A;  4HDQ A;  3PVW A;  2V1Y A;  3A8Q A;  1OY2 A;  4C0A A;  2DZJ A;  4WJO A;  2J0J A;  3VAW A;  3KUD B;  3EPY A;  1PFJ A;  5FI1 A;  3N32 A;  1GG3 A;  3P6A A;  4ANU A;  3ZVR A;  2D07 B;  2FCN A;  3BJI A;  1MIX A;  2GMI C;  4A3P A;  4DXA B;  2Z0D B;  3BIN A;  3TBL D;  4FAD A;  2O6V B;  3MJW A;  4KHA A;  1OMW A;  4LDT D;  1EUV B;  2MW5 A;  2MA9 B;  2OTX A;  5AZH A;  1Y8R C;  3SU8 X;  3ODW A;  4PS7 A;  2LJ5 A;  2DHZ A;  5D3Y A;  4IWO A;  3VUX A;  5DH9 B;  3QAR A;  1XQQ A;  2LOZ A;  1KC7 A;  1EGX A;  3QQ8 B;  1YD8 U;  3ML8 A;  3ZDM C;  1I35 A;  4BKG A;  1B55 A;  3JYU A;  3ODO A;  2PPH A;  2YF0 A;  4DX9 0;  3DVG X;  3KZ1 A;  3ODX A;  1X1M A;  2H7D A;  3A1Q A;  1V81 A;  4WJP A;  3PEG A;  2G45 B;  3HQC A;  5JVL A;  1WZ0 A;  3ZRF A;  4JKE A;  2KNB A;  2GJY A;  2YS1 A;  1FAO A;  2M38 A;  2KK8 A;  5CHV C;  2D9Z A;  2JZ3 B;  3ML4 A;  5GMV A;  2FAZ A;  1P1A A;  2MBB B;  1P9D U;  2K8C A;  4HWI B;  3VTW A;  4GDK B;  4MY6 A;  2JP2 A;  4KAX B;  3ZKJ C;  5CLL B;  5HE2 A;  4ASW C;  4A5K A;  1WXA A;  1MK9 B;  3ZNI D;  2P8V A;  3M3J A;  2BKF A;  1KLV A;  2K8B A;  4ZRI A;  1ZKH A;  1ST7 A;  5D6J B;  2A5U A;  2GS0 A;  4YL8 A;  2LGY A;  1MIZ B;  1WGU A;  2N4F A;  1UBQ A;  5JH5 C;  3DQV A;  1NBF C;  2VRW B;  2DA0 A;  4WJ7 A;  2YLM A;  2MKR A;  2OJR A;  3T9L A;  1FHW A;  2NMB A;  4IWP A;  1YX6 B;  4DBG A;  4F7G A;  3LDZ E;  2DZI A;  3ML9 A;  3V60 A;  4M0W B;  1M7R A;  4GIV A;  4A6H A;  2KDB A;  2KMA A;  2KXJ A;  3CF6 E;  1D3Z A;  2DX5 A;  1LXD A;  2KJR A;  3SDL C;  1WY8 A;  1WGG A;  1WGR A;  1HBK A;  1LW3 A;  4CHK A;  3DBH I;  4I6N B;  1X05 A;  2CR5 A;  3LJU X;  2JY6 A;  2LRW A;  1WF9 A;  2K39 A;  1WX7 A;  4M8N A;  4A3O A;  1H4R A;  2KMC A;  5JHH A;  5D7G A;  3N3K B;  4J6I A;  1P6S A;  4GPT B;  1UBI A;  3A33 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...