4ZRJA

Structure of merlin-ferm and ctd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 88
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrjA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrjA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrjA01
4PNKA 3U8ZA 1FGZA 2JPHA 4Z2MB 5G55A 2FCQA 4EJNA 1I35A 1EUVB 2K2UA 3BJIA 3HK0A 2KD0A 4FN2A 2LBBA 2NPTB 1EF1A 2DZJA 4IM2A 4KIKB 3VQIA 1UPRA 2UZSA 2KC2A 3A9JA 3PEGA 3O65B 3QWMA 3ZDMC 2MFQA 1RLFA 2N9PC 3F0WA 2MQJA 2KJ6A 1ZC3B 2NBUA 1OQYA 3OJ4B 1NTVA 1KM7A 2V76A 1WZ3A 3CSTA 2CRFA 2LVOA 4A6FB 1WZ0A 2DX5A 2K8BA 2V4LA 2L7RA 3KRXA 4DX90 1SHCA 4CHJA 2MP2A 1ZC4B 1MK7B 1WR6E 4WWOA 4MEMA 4K2PA 3AULA 3SNHA 1J0GA 1DYNA 2IYDB 2B3AA 4KAXB 3JVZX 2KVRA 2XK5B 1WXMA 1WGUA 3L10B 4ANWA 4DX8A 2ZNVC 4D0NB 2MLBA 1MK9B 3VAWA 4WWPA 2K39A 3ZVVA 1WI0A 5HE2A 1WI1A 4MGZE 3OLMD 1AWEA 5GOWB 2O2VB 1FB8A 3DOWA 1WH3A 2R2QA 1E8WA 4TQ1A 4II2B 2DHJA 2YVCA 1BWNA 2W2XD 1UNRA 2DHKA 1A5RA 2KDEB 4ICVA 1WGHA 4K81A 5J17A 2KDIA 2BYFA 2GBMA 1HB6A 1RRBA 1B55A 4HXDA 4GB9A 4HB0B 1Q1OA 2O6VB 4HAUB 3KW5B 4F8CB 3KSYA 2X18A 4W9LA 2ZPYA 2J0KA 2G45B 2JUOA 3DCGA 5TR5A 4WJQA 2HTHA 3VHTC 1J8CA 2LI5A 4FULA 2KUPA 3PHXB 4WAAA 3PZDA 3L08A 4GMVA 3A8QA 1V9JA 2IO3B 2KOXA 3R3MA 2CQUA 3QHTA 1DDMA 2MX2A 4HAVB 1WJMA 4HLEA 2KFJA 4TQ0A 1NI2A 2ZNVB 3GYPA 1ISNA 4PYUA 3V6CB 3CMMB 5D3YA 2OTXA 1LW3A 2COAA 3PRPB 3VH4B 2MA9B 2ADZA 1MPHA 2CAYA 2C5LC 1IRSA 4K17A 3DBHI 2FIDA 4Z2NA 2NR2A 3A9JB 5JHAA 3H7SA 2LYDA 2KWUB 3PP2A 4KHBB 5AEKB 3M63B 4LCDE 2D9VA 2NCNA 3QC8B 3A9KA 2WDTB 2DX5B 1WX9A 1ZVRA 2KX3A 3PG7A 1WJNA 3PPAA 3SDLC 5JHGA 4BVUC 4M8MA 2MP2B 1LM8B 3PGEA 2NZ8B 4IG7B 4WWNA 4NJ6A 2M14A 1YJ1A 2DA0A 3RCZA 1IYFA 4HAZB 1UBQA 2C7MB 1V5MA 2AEHA 2IBIB 3PVUA 4L6EA 3FM8C 1EO6A 3ZRFA 1GC7A 3M3JA 2RPQA 2LJ5A 1DBHA 5DPWA 4IM3A 2ABDA 2D9ZA 3APFA 5KQ1A 2JZZA 2LD9A 2E2XA 4W9CA 2WH5A 3FP5A 2Y7BA 3HIZA 1PFJA 3EECA 2LG1A 1R4NI 4B6WA 3X0WA 2OJRA 2Y8FA 4XC2A 2ELBA 2DZIA 2EKEC 4JL9A 4KDIC 4W9HA 1YX5B 2A4ZA 1DDVA 4KSKC 3X23A 2UWQA 4CHKA 5FI1A 3RZWC 1QQGA 1GG3A 4G3XB 4EFOA 3GOEA 2LXAA 2KO3A 5LXHA 5C16A 3B0AA 2MBBB 2N1VA 4BOZB 1UBIA 1FHOA 2CU1A 2QHOA 3ONSA 1H8CA 5J3TA 2UVMA 1V2YA 1XD4A 2V3SA 1X1FA 3TW1A 3ODWA 1RJ2A 1OQNA 2XEWA 4K7WA 3WAMA 4IM0A 2RQ1A 1Y5OA 1QZEA 5D2MB 2BGFA 2HTHB 5GMVA 4E3CA 3LDZE 3APDA 2KMCA 1RRPB 3PVLA 2FCSA 4IOYX 3H7PA 3AXCA 3D8DA 5HE1A 3QA8A 3Q3FA 2L3ZA 2K00A 3RYTA 2XK5A 5KCVA 2KJRA 2PZ1A 2IFSA 3QQ8B 5LXIB 1X1MA 3VTWA 2GBJA 4DXAB 3ULBA 3A98B 4LDTB 3ZLZA 1WJUA 1MKEA 4KZCA 4FLHA 4I6NB 1I2HA 4TV3A 1L7YA 5DH9B 4KVGB 2NMBA 3ENEA 2I1JA 2KWCA 2IO0B 4W9GA 3SYXA 1E5WA 4HWIB 1WM2A 1FHXA 2KK8A 1GJZA 3LJUX 2L00B 5D7GA 3PS6A 3CF6E 3A9KB 1H4RA 2L8JA 1C3TA 4FJVB 2RLOA 2EJ8A 3LJ3A 1UEFA 3IBEA 1QC6A 2Q13A 4TKNA 3NZSA 4MSQB 3SD5A 2JXXA 3UF8A 3ZNGC 1PMSA 2M17A 3B08A 3KVFB 4X57B 2BWES 4I6PA 3A4SC 4IW0A 2O6VA 4G50A 4KDLB 1Y19B 2IZVB 2RR9A 2PJHA 3W1SA 2N9XA 4HPLB 1ZM0A 4BKSA 2AL3A 2C9WB 3TBLD 2RSUA 2ZZPB 3V60A 4XZ4A 1WIAA 3DVNU 1OEYA 5LLIA 5J2RA 4Y94A 1S3SG 3M95A 2DYOA 3NS8A 5JHHA 3UINB 2G4SA 1MG8A 4CO7A 4JIOU 3KUCB 4K2OA 1MIZB 2FIFA 4EEWA 2CHWA 2M0XA 2L76A 1WYWB 2R2OA 1TQZA 4HHVA 5FI0A 5D94A 1LXDA 4II3B 1W1GA 5C6RA 3HM3A 3OJ3A 3DQVA 2EC1A 3P7ZA 5E6OA 1YQBA 3A4RA 1L2NA 3ZNZB 3T9LA 2KFKB 1VD2A 4OVUA 3S2AA 1P98A 2Y5BB 3ZUNA 4BOSC 1U4AA 2GCLA 2DENB 1FAOA 3ML8A 3UIPB 2JRHA 2K2JA 1WMHB 2YF0A 5CTRC 2BYVE 4FHKA 2C7HA 4IC7B 1UD7A 2LGXA 2DYBA 1TTNA 4MH0E 2Z0OA 2KQSA 5J3QA 2MBOA 4W9IA 3G9WA 3H7PB 3CIKA 5KQ4A 2KMAA 2LUEA 3T06A 1V61A 4PYZA 3P6AA 5J18A 4BKGA 3A1QA 4GDKA 5CHVC 3N32A 2YT0A 2KHWB 3TIXA 2NVUI 3NSUA 1OTRB 4J6IA 3ZW3A 2JWZA 3NY5A 2P0HA 1IPGA 1WJ4A 3NZUA 5EFXA 4A5KA 4DDID 2CS4A 4FJYA 3QWZB 1Q0WB 4HDQA 1P3RA 1GC6A 3JW0X 3H9DA 3L13A 3AJ4A 2L05A 1AQCA 2LWPA 4WJ7A 4TYZA 1BTKA 4GDLA 4ANXA 3NHEB 4N9F4 4ZYNA 5CLLB 4YL8A 4ASWC 2D9WA 2Z0EB 1U27A 1WX8A 1M94A 2DKPA 3VH3B 1DDWA 4JGHB 1I7AA 4F7GA 3HHMA 4LJOB 5DIFB 2COPA 5IJMA 2UYZB 4DWFA 4E71A 3KUZA 2MWNB 4A6KA 4KHAA 3RULA 2BPSA 2FJ9A 1WF9A 2DX1A 3IHPC 4FA6A 3KRWA 2LULA 2LOZA 3P2BA 4FBJB 4AJYB 3RCPA 4K7UA 2MWSB 4EOYA 1V81A 2KDBA 4HAWB 1NBFC 2LKOA 1E7UA 2LVPA 3ECIA 1TJ6A 1PLSA 2YS3A 1Z2MA 4HB2B 2YRYA 3K9OB 4CYEA 3ZTCA 5D27A 1HB8A 2DFKA 2O6VD 2ZVOA 4MY6A 2EMTA 1EAZA 3NOBA 4K1RB 4BKSD 5E6PA 4GIVA 2PE6B 4URKA 1WGYA 5L81A 2BWFA 4EZKA 2D9XA 4GXBA 1I42A 5HKHA 4MJSB 3KZ1A 1PQSA 3EHVA 4IWPA 4A6HA 3QARA 1P5TA 2KTFA 5AZFA 2KNBA 3KUDB 2HD5B 5C79A 1V49A 3N3KB 1P3QU 4I6LB 4NAWA 2ELAA 4AWJA 3R7QA 2I5FA 2MBHA 1Z87A 2GS0A 2ROZB 2JY6A 5JHBA 1LFDA 1OMWA 1KI1B 3U7DA 2ZJDA 4LJPB 1KZGA 1WXVA 2JRIB 1E7VA 4DK5A 5CX3A 1V80A 1W1HA 1BAKA 4HCNB 3DXDA 3KY9A 1UH6A 3SO6A 1RFAA 4MDKE 3A1QB 2FAZA 4GDKB 4HVBA 1K5DB 1WM3A 2ZCBA 5IAAC 2N0YA 4CHMA 2J7QB 4KHOA 2WWZA 1U29A 3PRZA 4WSFA 2BYEA 1F9JA 2Y8GA 1U5DA 4GMXB 4GU2A 4WQOB 3UGBB 2IYBA 2YSZA 4AP4C 2AWTA 5DHAB 4W9FA 2W9NA 5D3VA 3L0WB 4GDLB 5JP4A 2VSZA 4DHZE 5LONB 2VRRB 4HDOA 3VVWB 4NPNA 2KFKA 4GGQA 4HB3B 2N1WA 3H6NA 3SUZA 1XODA 3ODOA 2UZRA 1ZW7A 1FXTB 2R09A 4KV2A 2JZ3B 4EKUA 1X05A 2M38A 1Z5SB 1ZKHA 3DDCB 3VUWA 2LXCA 3ULCA 2D9YA 4F7ZA 3DPDA 1WMHA 1S1QB 2I1KA 5D3WA 3DVNV 2DTCA 3MDBC 3PRMB 2GMIC 3UQBA 2V1YA 2RVBB 5E6NA 5KHOA 1KJTA 2KLGA 1WGGA 3PLUA 4OVVA 3PHWB 2AL6A 3EFUA 2FJLA 4HAYB 1V5TA 2WX0A 4F1SA 1FHWA 2I5CA 2H7EA 1V6EA 5G2NA 3L17A 1K8RB 5DI9B 1E90A 3ALBA 1WG7A 2KWVB 1OY2A 2D3GA 3UIOB 3VIAA 3DVGX 4NSWA 1NU2A 4PQ0A 5IA7A 1ZSQA 2JF5A 3I3TB 2FUHB 3AU4A 1NDDA 1WX7A 2MBQA 2YT1A 4B6HA 3TFMA 3GZNI 4BBKA 3V6EB 4DHJB 2ZCCA 3TVVA 4HB4B 2DKQA 2RGFA 2KQ7A 2K25A 4ANVA 5D3XA 2ASQA 3A33B 2ROVA 1Q67A 4MSMB 2KTRA 1V89A 1SGHA 3AI5A 1VCBA 3DXEA 1NVLA 3OAWA 1WJ1A 5DPRA 4H8SA 4NAWB 1WY8A 1KOTA 1HBKA 5CLQB 1UNPA 2FNJB 3ODXA 3FSSA 4LDTD 2NS5A 4AUQC 4IWOA 2LRWA 4G0NB 4G11A 2R0DA 1WFYA 5JH5C 2ZEQA 1YD8U 2PPHA 4RM8A 4ICUA 1TXDA 1FOEA 4MGYE 3VUXA 4DHJD 2HRJA 3HM6X 3QCAA 1UELA 2Z0PA 4ZRIA 1WE6A 2VKIA 1ST7A 4F7UP 3WYFB 3MPXA 3H1UA 4XX5A 4PS8A 2COFA 4GN1A 2DAFA 2N7EA 4AOFA 5DPSA 4DBGA 5CHWA 4M0WB 3TCAA 4IFSA 2CHXA 2MW5A 4EZLA 2DN6A 3SU8X 4WJPA 4NQKE 1XT9B 2ZVNA 3V62A 1WGRA 1KLVA 4GOCA 1WXAA 3B1LX 4B9KA 1J0WA 1AARA 4XWXA 2KANA 2LGYA 1P9DU 3KYCD 4E74A 3WANA 1V86A 3U30A 2NBVB 2CB8A 2P0FA 4ANUA 4MJSA 2HJ8A 5L95C 3RT3B 2LZ6A 1MAIA 3QJZA 2YS1A 4C0AA 4TUUA 1E8ZA 2FDQA 2L0FA 5DHFB 2GBNA 1SE9A 3W1SC 3FEHA 3ZKJC 2N9EB 2G3QB 1ACAA 3PT2B 3TO1A 2DHIA 2IO1B 1Y8RC 1U5FA 4DDGD 2KKCA 2GOWA 4HJKA 4ZDVA 2G4DB 2N4FA 4MM3A 2ZPNA 2L0TA 3EC8A 2Z0DB 3EPYA 1TBEA 2J0MA 2J0JA 1V5UA 2LOXA 1WE7A 1V88A 1UPQA 4JQWC 2VRWB 4MGKE 4HCPB 3V5WA 2DAJA 3BY4B 3BINA 2QKMA 1P0RA 2DYMA 2RSGA 3KYDD 3ML9A 3IVFA 2GCJA 4FJZA 1MIXA 1XQQA 5J3YA 2IY0B 4NQLB 3M1IB 1M7EA 3JSVA 1HE8A 4FHJA 1LB1A 3VDZA 3QX1A 3N7CA 1EVHA 3GYOA 3TJPA 3C0RB 2KTRB 5AZGA 1BT0A 5JLJB 2LVQA 1OEYJ 1NTYA 3ZNID 1M7RA 2DLWA 1YIWA 1DROA 2CHZA 2N7DA 2MBEA 4WJNA 2FCMA 1TGZB 3KH0A 2MKRA 3SV1A 3ML4A 3QBVB 1GUAB 3N30A 2PEAA 1N3HA 2GJYA 1WRDB 3RZFA 2NBWB 1BTNA 2D10A 1E8YA 5HE3A 4W9DA 1WJ6A 1RAXA 2CODA 2KLCA 2G35A 4WJOA 1FGYA 3QK0A 2W2WA 2YS5A 2BKFA 4GZUA 2IY1B 4ZRKA 1XR0B 4YONA 2MSED 3AU5A 2GBKA 2WYQA 3WAPA 2MRPA 4M8NA 3APCA 3ZRCA 4K7SA 5C5BB 2RNRB 1K5GB 2DHZA 2CY5A 4IAPA 4NJ7A 3JYUA 2JT4B 1WGQA 3PLVA 3SHQA 2OQBA 1UZXB 2KJHB 2WX1A 4NNJB 3DXCA 3R66C 2DZMA 2JVCA 4IWQA 3M62B 2RD0A 3D8FA 1H10A 2J59M 1UGMA 1Q5WB 5KHQA 2GBRA 2K6DB 4GPTB 1WVHA 1XKEA 2M4NA 3TMPB 3VOQA 2D4QA 2CR5A 4EZJA 4IUMB 1J19A 2RGNB 4AJWA 4HATB 5D6JB 3L54A 2XQNM 4KSLC 5C23A 2IO2B 3OANA 1W1DA 4B95A 2FCNA 2C7NB 1P6SA 2KXJA 2D11A 2CY4A 1WXSA 1CMXB 2XBBC 3RD2A 4A3OA 1UNQA 1E8XA 3K9PB 3WAOA 3VTUA 2D2QA 3V61A 2P0DA 5AZHA 2LGDA 2DZKA 1TZ1A 1G6JA 3F5RA 2RUKB 3QAQA 5HE0A 2KN5A 3A8PA 2KZRA 1XD3B 3CSFA 1T0YA 4DHZB 2KC1A 3PTFC 1XCGA 4HK2A 3O96A 3PSCA 3JSVB 1X1GA 3DBSA 2KDFB 4BKTA 3HQCA 1EGXA 4MGIE 2EMSA 3CXBB 3RUIB 1SIFA 2H7DA 3DBRI 3IFWB 2KX0A 2Z0QA 2NPTA 3UQAA 2BKRB 3UZTA 2JP2A 4W9JA 2PE9A 4KIKA 1R4MI 1YX6B 3VXWA 5DCNA 3VFKA 3WIMA 5JZEB 2K1FA 4MELA 3MJWA 3D32A 4KZ0A 5L83A 3T8MA 1C1YB 4PS7A 3WA0A 3DBLI 3VTVA 1EF5A 4F7HA 4EMOA 1V5PA 3DVGY 4HAXB 4A6FA 1P1AA 2L1CA 2K8HA 4BFRA 3TL5A 5LOPB 3ZIMA 3D8EA 3PV1A 5C1ZA 4WVFB 1U5GA 3R7RA 1KZ7A 5DPTA 4HPMB 4A20A 1WR1A 2AYOB 4RM9A 1WGDA 3W1YA 2REXA 2L2IA 1OGWA 2MCNB 5FR6A 5BO4B 4DBBA 2LRUA 4W9KA 1U2BA 2KCJA 4PS3A 4JLCA 1XX0A 3FLVA 5CHFA 4ZRJA 2BF8B 1GNUA 1JRUA 5EDSA 1X11A 2MDXA 3MHSD 2DYNA 3MTNB 3PREA 2O2VA 2OOBB 4A3PA 3L16A 3PVWA 2CKHB 2YLMA 4P7IA 2LASA 4MK0A 3VUYA 2A5UA 4W9EA 2KGXB 3Q3JA 1NTIA 2Z59B 3HW2B 4GSWA 2D07B 2COCA 2C60A 4FADA 4RMAA 1X86A 3QIJA 1D3ZA 4BBNF 3WALA 2BCJA 4EUTA 3ZNHB 2W2XC 2K8CA 1IP9A 2QKLA 3ZVRA 2K6QA 2M1MA 4MT7A 4NY0A 3IG3A 4BBNC 2N23A 1U5EA 2HE7A 3PSEB 2DYQA 1LQBA 2P8VA 3ZTDA 2M8SA 5C5BA 3ZDTA 1ZGUB 3ZO5B 1V5OA
chains in the Genus database with same CATH superfamily
4PNKA 3U8ZA 1FGZA 1L4ZB 2I38A 2JPHA 2WXKA 2Q5WD 4Z2MB 5G55A 2FCQA 3AEEB 4EJNA 1I35A 3RPFC 1EUVB 1FFVA 1SXTA 2K2UA 2WXIA 3BJIA 2TSSA 1YNTE 3HK0A 2KD0A 4FN2A 2LBBA 3L4PA 2NPTB 1ENFA 1EF1A 2SAKA 1P7EA 2DZJA 3C19A 4IM2A 4KIKB 3VQIA 1UPRA 2UZSA 2KC2A 3A9JA 3PEGA 5IKCM 3O65B 3QWMA 2KUQA 3ZDMC 2MFQA 1RLFA 2N9PC 5BMIA 1TZOA 3F0WA 2MQJA 2KJ6A 1ZC3B 2NBUA 1OQYA 4KHBA 2KMMA 3OJ4B 1T0SC 1NTVA 1KM7A 2V76A 1WZ3A 3CSTA 1ZE3D 2CRFA 2LVOA 4A6FB 1WZ0A 3W5VB 2DX5A 2K8BA 1SE3A 2V4LA 4C4VB 2G9HD 2WQYB 3B2GA 2L7RA 3KRXA 4M00A 4LNOA 4DX90 1SHCA 4CHJA 2MP2A 3VR8B 2RRFA 1ZC4B 3P4SB 1N61A 2M19A 1MK7B 1WR6E 3NS1A 4WWOA 4MEMA 4K2PA 4XWTA 3AULA 2J4XA 3SNHA 1J0GA 1DYNA 2D3BA 2IYDB 3VRAB 2LHDA 1MFWA 2B3AA 3Q8CA 4KAXB 3JVZX 2KVRA 2XK5B 4ARCA 1WXMA 1WGUA 3L10B 2ON8A 4N58A 1FXIA 4ANWA 4DX8A 2DBYA 2DIKA 2ZNVC 1ET6A 4D0NB 1FEHA 2W3RA 2MLBA 1MK9B 1KLGD 3EFCA 2JXTA 3VAWA 1UF0A 4WWPA 2K39A 3ZVVA 1JMLA 1WI0A 5HE2A 3FILA 1WI1A 4MGZE 1DYQA 3OLMD 1C4CA 1AWEA 2DNFA 4ZOHC 1DOYA 5GOWB 4JKCA 2O2VB 3I9V1 3Q8AA 2BB6A 1FB8A 3DOWA 1WH3A 2R2QA 2W82A 1E8WA 1KC7A 3SFDB 4QXAB 4TQ1A 1TY0A 3U7ZA 2QDFA 3AEBB 4JE3B 4II2B 2DHJA 4QJ4B 2YVCA 1BWNA 2W2XD 1UNRA 2DHKA 3SR6A 2BTEA 1A5RA 2HDEA 4JKHA 2KDEB 4ICVA 1WGHA 4K81A 5J17A 2OEDA 2KDIA 2BYFA 1TS5A 2GBMA 1HB6A 1RRBA 1B55A 3BVZA 4RFBA 3V3XA 4B0MA 4JKGA 4HXDA 1VBHA 2N9LA 4GB9A 4HB0B 1PGAA 3AB5A 1Q1OA 2O6VB 4HAUB 5M4YB 3KW5B 4F8CB 3KSYA 4JPSA 4S0RA 1HZ5A 2X18A 4W9LA 4JWUC 5AUKA 2ZPYA 2J0KA 2G45B 2JUOA 4C00A 1DGJA 3DCGA 5TR5A 3WCQA 4KKJA 3BVGA 2D5GA 4WJQA 2HTHA 4A55A 3MC9A 1J7CA 3VHTC 1J8CA 3E9SA 1SSNA 2K8EA 3B77A 2FBWB 2LI5A 4FULA 3FAHA 2KUPA 3PHXB 2L32A 2D3AA 4WAAA 1WSPA 1AW7A 3PZDA 4B0EA 1T77A 3L08A 4GMVA 1PYWD 3A8QA 1V9JA 2IO3B 2KOXA 3R3MA 2CQUA 3QHTA 1DDMA 2MX2A 4HAVB 1WJMA 4HLEA 2KFJA 4TQ0A 1NI2A 2AQ2B 1C4AA 2ZNVB 1NYRA 3GYPA 1ISNA 4PYUA 3V6CB 3CMMB 2JX5A 5D3YA 4DXGA 2OTXA 4C56C 2KDMA 2V3PA 1LW3A 2I2YA 2COAA 2QIEB 1N6ZA 3PRPB 3DWMA 2MJ3A 3VH4B 2MA9B 4A8XC 2ADZA 1MPHA 4RNAA 2CAYA 2C5LC 1IRSA 4K17A 3DBHI 2FIDA 1WGKA 4LNIA 4Z2NA 2NR2A 3A9JB 5JHAA 3H7SA 4LLGM 3GZNB 2PW9A 1QILA 2LYDA 2KWUB 3PP2A 4KHBB 5AEKB 1YOVB 3M63B 5HHDG 4LCDE 2JWUA 1EM7A 2D9VA 1TS4A 2NCNA 3QC8B 3A9KA 3O13A 2WDTB 1ET9A 2DX5B 1WX9A 4HEA1 3HUIA 1ZVRA 3NJTA 2KX3A 1UGJA 1KFYB 3PG7A 1WJNA 3PPAA 3SDLC 5JHGA 3ZYYX 2N9KA 4LTUA 2Z8LA 4BVUC 1B9RA 4M8MA 2MP2B 1LM8B 3PGEA 3V05A 3IXSA 1XO3A 2NZ8B 4JWSC 3DWGC 4IG7B 2W55A 4WWNA 2MHJA 4NJ6A 3H8HA 3BVMA 1I4HA 3NW8A 4OZCA 2E3TA 1QOFA 2M14A 1YJ1A 3AECB 2DA0A 3RCZA 1IYFA 4HAZB 3AH7A 2K3UA 1T0QC 5AUIA 1UBQA 2C7MB 3TUOA 1V5MA 2AEHA 2IBIB 3PVUA 4L6EA 3CIRB 3N1ZC 3FM8C 1EO6A 1GB1A 3ZRFA 1GC7A 3M3JA 3UI3A 2RPQA 2LJ5A 4OSNA 1DBHA 5DPWA 1JALA 4IM3A 2ABDA 2D9ZA 3APFA 3FILB 5KQ1A 2JZZA 2LD9A 2E2XA 4W9CA 4JK7A 2WH5A 4EE2A 3FP5A 2Y7BA 4M02A 2RDBC 1YJIA 3HIZA 4CQNA 1PFJA 1VDVA 2CJNA 3EECA 5HFYA 2LG1A 1R4NI 1ESFA 1NENB 2INNE 2SEBD 3X0WA 4B6WA 1JQ4A 2M56B 2OJRA 2Y8FA 4XC2A 1HQRD 2ELBA 2DZIA 2EKEC 4JL9A 4KDIC 2PIAA 3I63C 4W9HA 1YX5B 3I5JC 2A4ZA 1DDVA 4KSKC 3X23A 2UWQA 3KQ4A 4CHKA 1ZXHA 3E9OA 2HJ1A 5FI1A 1D6EC 1QQGA 1GG3A 4G3XB 3RZWC 4EFOA 4PK1A 3GOEA 2LXAA 2KO3A 5LXHA 5C16A 2GUMA 3B0AA 2MBBB 2N1VA 4BOZB 1UBIA 3BK1A 1FHOA 4YSXB 4JKGB 1ZDXA 2CU1A 2QHOA 3ONSA 1H8CA 5J3TA 2WLBA 3IAS1 2LMCA 2UVMA 1V2YA 3W5UB 1ZDVA 1XD4A 2V4IB 2V3SA 1X1FA 1PDXA 1KRHA 3TW1A 3ODWA 1RJ2A 1SIJA 1E0ZA 1OQNA 2XEWA 4K7WA 4HROA 1JDEA 1VJKA 4IM0A 3WAMA 2RQ1A 1Y5OA 1QZEA 5D2MB 4TMAB 4D6WA 2BGFA 2HTHB 1OQRA 2EELA 2N7JA 2UU7A 1A70A 5GMVA 2JSVX 4C80A 2M0AA 4E3CA 3A58A 3LDZE 4ZHPA 3BYTB 3APDA 2KMCA 1RRPB 2QJLA 3PVLA 2FCSA 4IOYX 4JK8A 1VR9A 3H7PA 3AXCA 3D8DA 5HE1A 5JXVA 3QA8A 4ACFA 1C77A 3Q3FA 2L3ZA 2K00A 4ZYSA 2IGDA 3RYTA 2XK5A 5KCVA 1SE4A 1TYGB 2KACA 2KJRA 2PZ1A 2IFSA 3QQ8B 1E6EB 3ENBA 5LXIB 1X1MA 3RNBC 3VTWA 2GBJA 4DXAB 3ULBA 1RFKA 3A98B 4LDTB 3ZLZA 1WJUA 3IAM1 1MKEA 2WDVB 4KZCA 4FLHA 1LGRA 3NZ3A 4I6NB 1D5MC 5BYSA 1I2HA 4TV3A 1L7YA 2B76B 5DH9B 4XYCA 4KVGB 2NMBA 3ENEA 2XNAC 2PVGC 4ITKA 2I1JA 2KWCA 1I4PA 2IO0B 4W9GA 3SYXA 4LNFA 1E5WA 4HWIB 1WM2A 1FHXA 2KK8A 1GJZA 1PGBA 4P6VF 1KBLA 3FVCA 3LJUX 1K50A 1YQ3B 1MI1A 2L00B 5D7GA 3PS6A 3CF6E 1YQ4B 3A9KB 1H4RA 2L8JA 1VZ6A 1C3TA 2PKOA 1VZ7A 4FJVB 2E6XA 3MC8A 2RLOA 2EJ8A 3LJ3A 1ZYIA 1UEFA 3IBEA 1QC6A 2Q13A 4TKNA 3NZSA 4MSQB 3SD5A 2JXXA 3UF8A 3ZNGC 1PMSA 1UWMA 2L83A 2M17A 3B08A 3KVFB 1GPXA 4X57B 2BWES 4I6PA 3A4SC 4IW0A 2O6VA 4G50A 3BYYB 4YSYB 4KDLB 1Y19B 2IZVB 2ZKMX 1K53A 2V9HA 1STEA 2RR9A 2PJHA 3W1SA 3ZXVA 2N9XA 4HPLB 1ZM0A 4BKSA 4US8A 2AL3A 2C9WB 3TBLD 2RSUA 3AE3B 2ZZPB 3V60A 4XZ4A 1QOAA 1WIAA 3DVNU 1OEYA 1J7BA 5LLIA 5J2RA 4Y94A 1S3SG 3M95A 1FNWA 4N59A 2DYOA 3NS8A 1SB3C 3U4EG 5JHHA 2BS2B 3UINB 2G4SA 1MG8A 4CO7A 4JIOU 3P4PB 3KUCB 4K2OA 1MIZB 3VR9B 2FIFA 4EEWA 2CHWA 2M0XA 2L76A 1WYWB 2R2OA 1TQZA 4YWGG 4HHVA 5FI0A 2PVOD 4BZAA 3TEYA 1Y56A 2WXFA 5D94A 1QQRA 2HTME 1QOBA 1UWXA 1LXDA 4II3B 5FK9C 1W1GA 2VZKB 5C6RA 3HM3A 3OJ3A 3MC0B 3DQVA 2EC1A 4AQ7A 1FD6A 3P7ZA 4USAA 5E6OA 4WAFA 1L4DB 1YQBA 3A4RA 2KN4A 1VRAB 2MJEA 3AM9A 3ZNZB 1L2NA 3T9LA 2KFKB 1VD2A 4OVUA 1JW9D 2IPKD 3S2AA 3NRZA 5HI1A 1P98A 2Y5BB 1MJDA 3ZUNA 4KGTA 4BOSC 1RYJA 1FCLA 1U4AA 2PTLA 1FXAA 4C7ZA 2GCLA 2DENB 1FAOA 3ML8A 2QEJC 3ZXRA 3UIPB 1L0XB 3AN1A 2JRHA 2K2JA 2R2YA 1WMHB 4DIXA 3AE1B 4ZRPA 1SF0A 2YF0A 5CTRC 2BYVE 4FHKA 4D2KA 2C7HA 4IC7B 1UD7A 2NMQA 2LGXA 2DYBA 4WURA 5IN7A 1TTNA 4MH0E 2Z0OA 4NAMA 2KQSA 1AYFA 1IUEA 5J3QA 2MBOA 1UUPA 2BVCA 4W9IA 3G9WA 1SE2A 2INPE 3H7PB 3CIKA 4A9AA 5KQ4A 3AE6B 2KMAA 1HA5A 2LUEA 3T06A 5BMGA 1WXQA 1V61A 4HKZE 2WXLA 4HPPA 4PYZA 4OZBA 3P6AA 5J18A 4BKGA 1IGCA 3A1QA 4GDKA 5CHVC 2J53A 3N32A 2YT0A 2KHWB 3TIXA 2NVUI 2DLBA 3NSUA 2L1AA 3GE8C 1OTRB 4J6IA 3ZW3A 2JWZA 3NY5A 2P0HA 1IPGA 1WJ4A 1HZ6A 3DHIC 3NZUA 3VRBB 5EFXA 1MI0A 4A5KA 4YTPB 4DDID 2CS4A 4FJYA 3RN9C 1TIFA 4YTNB 3QWZB 1Q0WB 5EE9A 4HDQA 1P3RA 3HRDD 1GC6A 3JW0X 3H9DA 3L13A 4RF1A 3AJ4A 4KGRA 2L05A 1F52A 3N20C 1AQCA 2LWPA 4WJ7A 2BW2A 3Q3NC 4TYZA 1BTKA 4GDLA 4ANXA 3NHEB 2Z4DA 4N9F4 4ZYNA 2KVZA 4KX6B 1NI3A 4MH8A 1R4MB 3IT4B 5CLLB 4YL8A 4ASWC 3RMKC 2D9WA 2Z0EB 3KWLA 1U27A 1WX8A 1RWSA 3AE9B 1J7AA 1M94A 2DKPA 2AQ1B 1T6BX 3VH3B 1PFDA 3KLSX 4LNNA 1DDWA 4JGHB 5D3DA 3DBLB 3NUHB 5T8IA 3ZJUA 1I7AA 4F7GA 3HHMA 4LJOB 2ACZB 5DIFB 2COPA 5IJMA 3ETRA 2UYZB 2LJIA 4DWFA 2QCZA 4E71A 3AEAB 3KUZA 2MWNB 1I4XA 1D4BA 4A6KA 3EUB2 1HXYD 2WXOA 4KHAA 2KWDA 3RULA 2BPSA 2FJ9A 1WF9A 3GP7A 1Q10A 2DX1A 4JKDA 2QSDA 5H92C 3IHPC 4FA6A 3KRWA 2LULA 1JWUD 2LOZA 1FNVA 3P2BA 2MJDA 4FBJB 3AE5B 4AJYB 3RCPA 4M01A 4K7UA 5GXGB 2MWSB 4EOYA 4A6QA 1V81A 2KDBA 4HAWB 1NBFC 4XGAB 2LKOA 1E7UA 2LVPA 3ECIA 1TJ6A 1PLSA 4TSSA 2YS3A 5IOIA 1N62A 1JCKB 1Z2MA 4HB2B 3TEZA 2YRYA 1XLPA 2JQRB 2FUG1 4CYEA 3K9OB 3ZTCA 5D27A 1HB8A 2DFKA 1R7SA 2O6VD 2J52A 2ZVOA 4MY6A 3RNGC 2EMTA 3DCXA 1EAZA 2IGGA 3NOBA 4K1RB 1JWAD 4BKSD 5E6PA 4GIVA 4QAYA 1JRPA 2Y3AA 2PE6B 4URKA 4YSZB 3AE2B 1WGYA 5L81A 2BWFA 2K9XA 1DOXA 4EZKA 1F77A 2D9XA 4GXBA 1I42A 5HKHA 1PQSA 3KZ1A 3EHVA 4MJSB 4IWPA 4A6HA 3QARA 3KWVA 1P5TA 1D5ZC 1I4QA 2KTFA 5AZFA 2KNBA 3KUDB 3U52E 3MP9A 4RCOA 4DQOC 2HD5B 4KGSA 5C79A 1V49A 3N3KB 1QOGA 1P3QU 5LG4B 4I6LB 4NAWA 2K0PA 2ELAA 4AWJA 2LUMA 3R7QA 2I5FA 2MBHA 1Z87A 2GS0A 2ROZB 2OHFA 2JY6A 2WXRA 2KT7A 1WYGA 5JHBA 1LFDA 1OMWA 1KI1B 1LO5D 1T3QA 3U7DA 2ZJDA 4LJPB 1KZGA 1WXVA 2JRIB 3T3OA 4ZRQA 2Y5CA 1E7VA 4DK5A 2G1EA 5CX3A 3RI7C 1V80A 1W1HA 1BAKA 4HCNB 3SFEB 2IDYA 1TS3A 4ARIA 3DXDA 3KY9A 3HSAA 1EU3A 4NJCA 1UH6A 3SO6A 1RFAA 4MDKE 2CU3A 3A1QB 2FAZA 4GDKB 2LFIA 4HVBA 1K5DB 1WM3A 3FKYA 2ZCBA 1JROA 1ACCA 3OHMB 5IAAC 2N0YA 3NVZA 4KKIA 4CHMA 2J7QB 4WH4A 4KHOA 2WWZA 4OVZA 1U29A 3PRZA 4WSFA 2BYEA 1F9JA 2Y8GA 1U5DA 4GMXB 4GU2A 4M0WA 1IBXA 3NVYA 1XEEA 4WQOB 3UGBB 2IYBA 4ZHOA 4OT1A 3BWUD 4P16A 2YSZA 4AP4C 4WIPA 2AWTA 5DHAB 4W9FA 2W9NA 5D3VA 1HTQA 3NWDA 5C3JB 3L0WB 3HVDA 4GDLB 2NTSA 5JP4A 2VSZA 4UDUC 4DHZE 5LONB 2VRRB 1NYQA 4HDOA 2W3SA 3VVWB 4GOUA 4NPNA 2KFKA 4GGQA 4HB3B 2N1WA 3H6NA 1YJJA 3SUZA 1XODA 3ODOA 4N6EB 2UZRA 1ZW7A 4AS1A 1FXTB 2NBVA 2R09A 4KV2A 2YEPF 2OJWA 2JZ3B 5EE1A 1FIQA 4EKUA 1X05A 2M38A 1Z5SB 1ZKHA 1ZPSA 3DDCB 3VUWA 2LXCA 3ULCA 1TS2A 2D9YA 5HG2A 4F7ZA 3DPDA 1WMHA 1FO4A 1S1QB 2I1KA 5D3WA 3DVNV 2DTCA 3MDBC 3PRMB 2GMIC 2X38A 3UQBA 2V1YA 2RVBB 5E6NA 5KHOA 4NZLB 1V97A 1KJTA 2KLGA 2FE8A 1WGGA 3PLUA 2WU2B 4OVVA 1SBBB 3PHWB 2AL6A 2LEKA 4MT5A 5EE0A 4XE0A 3OWEB 3EFUA 2FJLA 4HAYB 1V5TA 2WX0A 3GS2A 4F1SA 2LGIA 3Q3OC 1FHWA 1YN3A 3NG0A 2I5CA 5G5HA 2H7EA 2WU5B 3PO0A 3NWAA 1V6EA 3AE4B 5G2NA 3L17A 1E10A 3E9PA 4ILGB 3BIID 1K8RB 5DI9B 1E90A 1L6UA 3HVZA 3P1MA 3N9YC 3ALBA 3P63A 1WG7A 2WXGA 2KWVB 1OY2A 2D3GA 3UIOB 1B1ZA 3VIAA 4H2AA 3C8YA 2WNMA 1AN8A 5FR3A 3DVGX 1FM0D 1GOZA 4NSWA 4RGNA 1NU2A 2YT2A 4PQ0A 5IA7A 1ZSQA 2JF5A 3I3TB 2FUHB 3AU4A 1NDDA 1WX7A 2Z13A 2MBQA 2YT1A 4B6HA 3TFMA 3GZNI 3U12A 4BBKA 3V6EB 1I4RA 4DHJB 2ZCCA 3TVVA 4XWWA 4YTMB 4HB4B 2DKQA 2RGFA 1QF6A 2KQ7A 2K25A 4ANVA 5D3XA 2NTTA 2ASQA 3A33B 2ROVA 1N60A 1Q67A 4MSMB 2KTRA 2Y5PA 1V89A 1SGHA 3AI5A 1VCBA 3DXEA 4IDIA 1NVLA 4L1RA 1PGXA 5E6JA 3OAWA 1WJ1A 1L5PA 1BXTA 4RF0A 4A90A 5DPRA 2MH7A 4H8SA 4L2YA 1VBGA 4NAWB 2WXHA 3RNEC 1WY8A 3TEXA 1KOTA 2R82A 1HBKA 5CLQB 3N1XC 1UNPA 2FNJB 3ODXA 3RNFC 1BMLC 1C9FA 3FSSA 2YEPB 4LDTD 2NS5A 1FRDA 4AUQC 4IWOA 2IJ0A 2LRWA 1JWBD 1T0RC 1BUIC 4G0NB 4G11A 2R0DA 4IKGA 1SEBD 1WFYA 5JH5C 1EWYC 1YN5A 2ZEQA 1YD8U 1FNUA 2JU6X 1JWMD 2PPHA 4RM8A 4ICUA 1TXDA 1FOEA 2K5PA 4MGYE 3VUXA 4DHJD 1CQVA 2HRJA 4IOIE 3HM6X 3QCAA 1KH0A 1UELA 4GLSC 2BS3B 2Z0PA 2AX5A 4ZRIA 1WE6A 2VKIA 1ST7A 4F7UP 3WYFB 3MPXA 3H1UA 2QILA 4XX5A 4PS8A 2COFA 4GN1A 2DAFA 2N7EA 4AOFA 2Z14A 5DPSA 4DBGA 5CHWA 3LB8C 4M0WB 1IBXB 3TCAA 2EKIA 3TEWA 3Q2AC 4IFSA 2CHXA 2MW5A 4EZLA 2DN6A 1M4VA 3SU8X 2INDC 4WJPA 4NQKE 1XT9B 2RDGA 4WQMA 1NEKB 2ZVNA 3V62A 3AEFB 3NWFA 1WGRA 1KLVA 1DIKA 4GOCA 3AV8A 1WXAA 2GB1A 3B1LX 3PZ8A 4B9KA 1J0WA 1AARA 1KLUD 4XWXA 1T5XD 4OZAA 2KANA 2LGYA 1P9DU 3DBHB 1L0VB 3KYCD 4E74A 3WANA 4L23A 3Q8FA 1V86A 3U30A 2NBVB 2CB8A 2P0FA 4ANUA 4MJSA 2HJ8A 3E66A 5L95C 3RT3B 1K51A 2LZ6A 2BB5A 1MAIA 3QJZA 1L0YB 2YS1A 4C0AA 3GE3C 4TUUA 1E8ZA 3BZDB 2FDQA 2L0FA 5DHFB 2GBNA 1SE9A 3W1SC 3FEHA 3ZKJC 2N9EB 4JKEA 1ACAA 2G3QB 3TO1A 3PT2B 2KAJA 4CSQA 5EE3A 2DHIA 2IO1B 1Y8RC 3R8BA 1U5FA 3P4RB 4DDGD 4JK9A 2JYEA 3AE8B 2KKCA 2GOWA 2VZKD 3AEGB 4HJKA 2KIGA 4FXCA 4ZDVA 5D3IB 2G4DB 3E9LA 3HIEA 2N4FA 2PLPA 3P42A 4MM3A 1UNSA 3R2TA 2ZPNA 2L0TA 3EC8A 1N63A 2Z0DB 3EPYA 1QKZA 1TBEA 1XLNA 2J0MA 2J0JA 1V5UA 2LOXA 2V0GA 1WE7A 3B2FA 1V88A 1AWDA 1UPQA 4JQWC 2VRWB 1GAQB 2WXNA 4MGKE 4HCPB 3V5WA 2DAJA 1N5XA 3BY4B 3Q3MC 5FKAC 2PMVA 3BINA 2QKMA 1P0RA 4MACA 1HTOA 2DYMA 2RSGA 3KYDD 3ML9A 2N0SB 3IVFA 2GCJA 3MHZA 4FJZA 4RH6A 2INCC 1MIXA 1XQQA 5J3YA 3Q14C 2IY0B 3IT6B 4NQLB 2K22A 3M1IB 3Q69A 5MPOA 1M7EA 3JSVA 1HE8A 4FHJA 1LB1A 3VDZA 1I7HA 3QX1A 3N7CA 2KYWA 1EVHA 3GYOA 3TJPA 3C0RB 3U2SC 1CJEA 2RPVA 2QC8A 2KTRB 5AZGA 2WXJA 2GI9A 1BT0A 1R4NB 3DBRB 5JLJB 1XLOA 1YMHE 2LVQA 1OEYJ 4JKBA 1NTYA 3ZNID 1M7RA 2DLWA 1YIWA 3R2IA 1DROA 4GNKB 2CHZA 2N7DA 1MHHE 1ZXIA 2MBEA 4WJNA 1V8CA 2FCMA 4BAXA 1TGZB 2DWQA 4JX1C 4O1NA 3KH0A 2MKRA 1D5XC 3SV1A 3ML4A 3J9CA 3QBVB 1GUAB 3N30A 2PEAA 1N3HA 4HKQA 2GJYA 1WRDB 3RZFA 3AE7B 1P7FA 2NBWB 4ILJA 1BTNA 2D10A 1E8YA 5HE3A 4W9DA 3NVVA 1F2RC 1WJ6A 1RAXA 2CODA 2KLCA 4QJ5B 2G35A 4WJOA 1FGYA 1ZP0B 3QK0A 2W2WA 2YS5A 2BKFA 4GZUA 2IY1B 4ZRKA 1XR0B 4YONA 2MSED 3AU5A 1HEZE 2GBKA 2WYQA 4L1BA 1OQQA 2KR0A 3Q8BA 3WAPA 2MRPA 4M8NA 5I2SA 3APCA 1N5WA 1CK1A 3ZRCA 2LHEA 4K7SA 4P1CC 4J3OD 3EA6A 3Q6BA 5C5BB 2RNRB 1K5GB 1L6VA 1MPEA 1VZ8A 2DHZA 4C7YA 1NVID 2CY5A 4IAPA 4NJ7A 3JYUA 1XF5L 3ZJTA 2JT4B 1WGQA 2AQ3B 2GLSA 2WXMA 3PLVA 3SHQA 4DXFA 1C76A 2OQBA 1UZXB 2KJHB 2WX1A 1GB4A 4NNJB 3DXCA 3R66C 2DZMA 2JVCA 2VH2A 3M62B 4IWQA 2RD0A 3D8FA 2D3CA 2WXPA 1H10A 3CWIA 4XDDA 2J59M 1UGMA 3RNAC 1Q5WB 4OW0A 5KHQA 4K3BA 2JYTA 2GBRA 2K6DB 5IRSA 1TKGA 4GPTB 3PZ7A 1WVHA 1XKEA 3Q8EA 2M4NA 4WWMA 1KTKA 2WS3B 3TMPB 3VOQA 1QT9A 1KF6B 2D4QA 2CR5A 2X8XX 4EZJA 4IUMB 1J19A 2BT6A 1XLQA 1YN4A 2RGNB 1MHXA 4AJWA 4HATB 5D6JB 3L54A 2XQNM 4KSLC 2WGSA 2IO2B 5C23A 2ONQA 1FCCC 3OANA 1W1DA 1ZOYB 4B95A 2FCNA 2C7NB 1P6SA 2KXJA 2Z59A 2D11A 2CY4A 1WXSA 1TY2A 1CMXB 2BYTA 1MG4A 2BQQA 2XBBC 3RD2A 2XN9C 3SEBA 4A3OA 1UNQA 1E8XA 3K9PB 3WAOA 3VTUA 1TJEA 5BMHA 3MJ5A 2D2QA 4JKAA 3V61A 4MM3B 3SBTA 2P0DA 1WRIA 5AZHA 1F1HA 2W54A 2LGDA 2DZKA 3GB1A 1TZ1A 1GGOA 3AMZA 5C2TB 1G6JA 3F5RA 1SJED 2WDRB 2RUKB 3QAQA 5HE0A 2KN5A 3A8PA 2KZRA 2H89B 2JZPA 1XD3B 3CSFA 4XDCA 1T0YA 2WHIA 1XCTL 4DHZB 1WWTA 3DHHC 3URYA 1V1PA 3OG5A 2KC1A 3PTFC 1XCGA 4HK2A 3O96A 2KIEA 3PSCA 2RDHA 3JSVB 1X1GA 3DBSA 2KDFB 1C4PA 4BKTA 2WP9B 3HQCA 1EGXA 3FC4A 5JVLA 4MGIE 2K49A 2CJOA 2WDQB 2EMSA 3CXBB 2R61A 3RUIB 1SIFA 2H7DA 3DBRI 3IFWB 3B9JA 2KX0A 2Z0QA 2NPTA 1FPYA 2BS4B 3UQAA 2BKRB 3UZTA 4RGTA 2JP2A 4W9JA 2PE9A 4KIKA 1R4MI 1YX6B 3P4QB 4P1BC 3LYYA 3VXWA 3NVWA 5DCNA 2QMTA 3VFKA 2ZW1A 3WIMA 1JWSD 5JZEB 5IP4D 2K1FA 4MELA 1FMAD 3MJWA 1DOIA 2GRIA 4JKFA 3LXFA 3D32A 4KZ0A 5L83A 2ICIA 3T8MA 2WXQA 1C1YB 4PS7A 3WA0A 3DBLI 3VTVA 1FFUA 5IO9A 3MFGA 4HRSA 1EF5A 4F7HA 4EMOA 1V5PA 3DVGY 2MEKA 4HAXB 3E56A 4A6FA 3W9CB 2ZW0A 4OHJA 1F0ZA 4C4VA 1P1AA 2L1CA 2K8HA 2RMMA 2L52A 4BFRA 3TL5A 5LOPB 3ZIMA 3D8EA 1EWCA 2BBCA 2IGHA 3PV1A 1VLBA 5C1ZA 4WVFB 4US9A 1U5GA 1TKEA 3EGRA 3R7RA 1TKYA 1XCQL 1KZ7A 5DPTA 3RFZB 4HPMB 1CZPA 5TSSA 1EU4A 4A20A 1WR1A 2AYOB 4RM9A 1WGDA 3W1YA 2REXA 2L2IA 1OGWA 1C78A 2MCNB 5FR6A 5G5GA 5BO4B 2VH1A 4QJ3B 4ILHA 4DBBA 2LRUA 4W9KA 4YXDB 1U2BA 2KCJA 4PS3A 4JLCA 3ABVB 1E7PB 5LNK1 1XX0A 4LNKA 3FLVA 5CHFA 4ZRJA 3RNCC 3ZQ4A 1PUTA 4YT0B 2KQ4X 5I4DA 1XXGA 3N1YC 2BF8B 5I2MA 4HSIA 1GNUA 1JRUA 1I4GA 1E9MA 5EDSA 1X11A 2MDXA 3MHSD 5BYQA 2DYNA 3MTNB 3PREA 1V1OA 3ZGZA 2O2VA 1MVKA 4RGMA 4LK0M 5BYRA 2OOBB 4A3PA 4S17A 3L16A 3PVWA 5H8YE 2CKHB 3AEDB 3SBGA 1K52A 2YLMA 4P7IA 2LASA 4MK0A 3VUYA 2A5UA 4R3DA 4W9EA 2KGXB 4K3CA 1ZUD2 3Q3JA 1NTIA 4REZA 2Z59B 3HW2B 3DHGC 1C79A 1IGDA 4PT5A 3TSSA 1ROEA 3I57A 4GSWA 2D07B 2COCA 2C60A 2FJUB 2H88B 4FADA 4RMAA 4RGOS 1X86A 3QIJA 1F2RI 1D3ZA 4BBNF 3WALA 2BCJA 4EUTA 3ZNHB 3T3NA 2W2XC 2K8CA 1IP9A 2QKLA 3ZVRA 2J42A 2K6QA 2M1MA 4MT7A 4NY0A 1RM6C 3IG3A 1TT5B 4BBNC 2N23A 1U5EA 2HE7A 1SJHD 1FRRA 2DYQA 3PSEB 4Q2JA 3W2DA 2V3NA 1LQBA 2P8VA 2LGSA 1QLBB 3ZTDA 2M8SA 5C5BA 2X0SA 1V1PB 3ZDTA 1ZGUB 3BK2A 1OFFA 3ZJVA 3ZO5B 1V5OA 4HJGE
chains in the Genus database with same CATH topology
4PNKA 3U8ZA 1FGZA 2JPHA 4Z2MB 5G55A 2FCQA 4EJNA 1I35A 1EUVB 2K2UA 3BJIA 3HK0A 2KD0A 4FN2A 2LBBA 2NPTB 1EF1A 2DZJA 4IM2A 4KIKB 3VQIA 1UPRA 2UZSA 2KC2A 3A9JA 3PEGA 3O65B 3QWMA 3ZDMC 2MFQA 1RLFA 2N9PC 3F0WA 2MQJA 2KJ6A 1ZC3B 2NBUA 1OQYA 3OJ4B 1NTVA 1KM7A 2V76A 1WZ3A 3CSTA 2CRFA 2LVOA 4A6FB 1WZ0A 2DX5A 2K8BA 2V4LA 2L7RA 3KRXA 4DX90 1SHCA 4CHJA 2MP2A 1ZC4B 1MK7B 1WR6E 4WWOA 4MEMA 4K2PA 3AULA 3SNHA 1J0GA 1DYNA 2IYDB 2B3AA 4KAXB 3JVZX 2KVRA 2XK5B 1WXMA 1WGUA 3L10B 4ANWA 4DX8A 2DIKA 2ZNVC 4D0NB 2MLBA 1MK9B 3VAWA 4WWPA 2K39A 3ZVVA 1WI0A 5HE2A 1WI1A 4MGZE 3OLMD 1AWEA 5GOWB 4JKCA 2O2VB 1FB8A 3DOWA 1WH3A 2R2QA 1E8WA 1KC7A 4TQ1A 4II2B 2DHJA 2YVCA 1BWNA 2W2XD 1UNRA 2DHKA 1A5RA 4JKHA 2KDEB 4ICVA 1WGHA 4K81A 5J17A 2KDIA 2BYFA 2GBMA 1HB6A 1RRBA 1B55A 4JKGA 4HXDA 1VBHA 4GB9A 4HB0B 1Q1OA 2O6VB 4HAUB 3KW5B 4F8CB 3KSYA 2X18A 4W9LA 2ZPYA 2J0KA 2G45B 2JUOA 3DCGA 5TR5A 4WJQA 2HTHA 3VHTC 1J8CA 2LI5A 4FULA 2KUPA 3PHXB 4WAAA 3PZDA 3L08A 4GMVA 3A8QA 1V9JA 2IO3B 2KOXA 3R3MA 2CQUA 3QHTA 1DDMA 2MX2A 4HAVB 1WJMA 4HLEA 2KFJA 4TQ0A 1NI2A 2ZNVB 3GYPA 1ISNA 4PYUA 3V6CB 3CMMB 5D3YA 2OTXA 1LW3A 2COAA 3PRPB 3VH4B 2MA9B 2ADZA 1MPHA 2CAYA 2C5LC 1IRSA 4K17A 3DBHI 2FIDA 4Z2NA 2NR2A 3A9JB 5JHAA 3H7SA 2LYDA 2KWUB 3PP2A 4KHBB 5AEKB 3M63B 4LCDE 2D9VA 2NCNA 3QC8B 3A9KA 2WDTB 2DX5B 1WX9A 1ZVRA 2KX3A 3PG7A 1WJNA 3PPAA 3SDLC 5JHGA 4BVUC 4M8MA 2MP2B 1LM8B 3PGEA 2NZ8B 4IG7B 4WWNA 4NJ6A 2M14A 1YJ1A 2DA0A 3RCZA 1IYFA 4HAZB 1UBQA 2C7MB 1V5MA 2AEHA 2IBIB 3PVUA 4L6EA 3FM8C 1EO6A 3ZRFA 1GC7A 3M3JA 2RPQA 2LJ5A 1DBHA 5DPWA 4IM3A 2ABDA 2D9ZA 3APFA 5KQ1A 2JZZA 2LD9A 2E2XA 4W9CA 4JK7A 2WH5A 3FP5A 2Y7BA 3HIZA 1PFJA 3EECA 2LG1A 1R4NI 4B6WA 3X0WA 2OJRA 2Y8FA 4XC2A 2ELBA 2DZIA 2EKEC 4JL9A 4KDIC 4W9HA 1YX5B 2A4ZA 1DDVA 4KSKC 3X23A 2UWQA 4CHKA 3E9OA 5FI1A 3RZWC 1QQGA 1GG3A 4G3XB 4EFOA 3GOEA 2LXAA 2KO3A 5LXHA 5C16A 3B0AA 2MBBB 2N1VA 4BOZB 1UBIA 1FHOA 4JKGB 2CU1A 2QHOA 3ONSA 1H8CA 5J3TA 2UVMA 1V2YA 1XD4A 2V3SA 1X1FA 3TW1A 3ODWA 1RJ2A 1OQNA 2XEWA 4K7WA 3WAMA 1JDEA 4IM0A 2RQ1A 1Y5OA 1QZEA 5D2MB 2BGFA 2HTHB 5GMVA 4E3CA 3LDZE 3APDA 2KMCA 1RRPB 3PVLA 2FCSA 4IOYX 4JK8A 3H7PA 3AXCA 3D8DA 5HE1A 3QA8A 3Q3FA 2L3ZA 2K00A 3RYTA 2XK5A 5KCVA 2KJRA 2PZ1A 2IFSA 3QQ8B 3ENBA 5LXIB 1X1MA 3VTWA 2GBJA 4DXAB 3ULBA 3A98B 4LDTB 3ZLZA 1WJUA 1MKEA 4KZCA 4FLHA 4I6NB 1I2HA 4TV3A 1L7YA 5DH9B 4KVGB 2NMBA 3ENEA 2I1JA 2KWCA 2IO0B 4W9GA 3SYXA 1E5WA 4HWIB 1WM2A 1FHXA 2KK8A 1GJZA 1KBLA 3LJUX 2L00B 5D7GA 3PS6A 3CF6E 3A9KB 1H4RA 2L8JA 1C3TA 4FJVB 2RLOA 2EJ8A 3LJ3A 1UEFA 3IBEA 1QC6A 2Q13A 4TKNA 3NZSA 4MSQB 3SD5A 2JXXA 3UF8A 3ZNGC 1PMSA 2M17A 3B08A 3KVFB 4X57B 2BWES 4I6PA 3A4SC 4IW0A 2O6VA 4G50A 4KDLB 1Y19B 2IZVB 2RR9A 2PJHA 3W1SA 2N9XA 4HPLB 1ZM0A 4BKSA 2AL3A 2C9WB 3TBLD 2RSUA 2ZZPB 3V60A 4XZ4A 1WIAA 3DVNU 1OEYA 5LLIA 5J2RA 4Y94A 1S3SG 3M95A 2DYOA 3NS8A 5JHHA 3UINB 2G4SA 1MG8A 4CO7A 4JIOU 3KUCB 4K2OA 1MIZB 2FIFA 4EEWA 2CHWA 2M0XA 2L76A 1WYWB 2R2OA 1TQZA 4HHVA 5FI0A 5D94A 1LXDA 4II3B 1W1GA 5C6RA 3HM3A 3OJ3A 3DQVA 2EC1A 3P7ZA 5E6OA 1YQBA 3A4RA 1L2NA 3ZNZB 3T9LA 2KFKB 1VD2A 4OVUA 3S2AA 1P98A 2Y5BB 3ZUNA 4BOSC 1U4AA 2GCLA 2DENB 1FAOA 3ML8A 3UIPB 2JRHA 2K2JA 1WMHB 2YF0A 5CTRC 2BYVE 4FHKA 2C7HA 4IC7B 1UD7A 2LGXA 2DYBA 1TTNA 4MH0E 2Z0OA 2KQSA 5J3QA 2MBOA 4W9IA 3G9WA 3H7PB 3CIKA 5KQ4A 2KMAA 2LUEA 3T06A 1V61A 4PYZA 3P6AA 5J18A 4BKGA 3A1QA 4GDKA 5CHVC 3N32A 2YT0A 2KHWB 3TIXA 2NVUI 3NSUA 1OTRB 4J6IA 3ZW3A 2JWZA 3NY5A 2P0HA 1IPGA 1WJ4A 3NZUA 5EFXA 4A5KA 4DDID 2CS4A 4FJYA 3QWZB 1Q0WB 4HDQA 1P3RA 1GC6A 3JW0X 3H9DA 3L13A 3AJ4A 2L05A 1AQCA 2LWPA 4WJ7A 4TYZA 1BTKA 4GDLA 4ANXA 3NHEB 4N9F4 4ZYNA 5CLLB 4YL8A 4ASWC 2D9WA 2Z0EB 1U27A 1WX8A 1M94A 2DKPA 3VH3B 1DDWA 4JGHB 1I7AA 4F7GA 3HHMA 4LJOB 5DIFB 2COPA 5IJMA 2UYZB 4DWFA 4E71A 3KUZA 2MWNB 4A6KA 4KHAA 3RULA 2BPSA 2FJ9A 1WF9A 2DX1A 4JKDA 3IHPC 4FA6A 3KRWA 2LULA 2LOZA 3P2BA 4FBJB 4AJYB 3RCPA 4K7UA 2MWSB 4EOYA 1V81A 2KDBA 4HAWB 1NBFC 2LKOA 1E7UA 2LVPA 3ECIA 1TJ6A 1PLSA 2YS3A 1Z2MA 4HB2B 2YRYA 3K9OB 4CYEA 3ZTCA 5D27A 1HB8A 2DFKA 2O6VD 2ZVOA 4MY6A 2EMTA 1EAZA 3NOBA 4K1RB 4BKSD 5E6PA 4GIVA 2PE6B 4URKA 1WGYA 5L81A 2BWFA 4EZKA 2D9XA 4GXBA 1I42A 5HKHA 4MJSB 3KZ1A 1PQSA 3EHVA 4IWPA 4A6HA 3QARA 1P5TA 2KTFA 5AZFA 2KNBA 3KUDB 2HD5B 5C79A 1V49A 3N3KB 1P3QU 4I6LB 4NAWA 2ELAA 4AWJA 3R7QA 2I5FA 2MBHA 1Z87A 2GS0A 2ROZB 2JY6A 5JHBA 1LFDA 1OMWA 1KI1B 3U7DA 2ZJDA 4LJPB 1KZGA 1WXVA 2JRIB 1E7VA 4DK5A 5CX3A 1V80A 1W1HA 1BAKA 4HCNB 3DXDA 3KY9A 1UH6A 3SO6A 1RFAA 4MDKE 3A1QB 2FAZA 4GDKB 4HVBA 1K5DB 1WM3A 2ZCBA 5IAAC 2N0YA 4CHMA 2J7QB 4KHOA 2WWZA 1U29A 3PRZA 4WSFA 2BYEA 1F9JA 2Y8GA 1U5DA 4GMXB 4GU2A 4WQOB 3UGBB 2IYBA 2YSZA 4AP4C 2AWTA 5DHAB 4W9FA 2W9NA 5D3VA 3L0WB 4GDLB 5JP4A 2VSZA 4DHZE 5LONB 2VRRB 4HDOA 3VVWB 4NPNA 2KFKA 4GGQA 4HB3B 2N1WA 3H6NA 3SUZA 1XODA 3ODOA 2UZRA 1ZW7A 1FXTB 2R09A 4KV2A 2JZ3B 4EKUA 1X05A 2M38A 1Z5SB 1ZKHA 3DDCB 3VUWA 2LXCA 3ULCA 2D9YA 4F7ZA 3DPDA 1WMHA 1S1QB 2I1KA 5D3WA 3DVNV 2DTCA 3MDBC 3PRMB 2GMIC 3UQBA 2V1YA 2RVBB 5E6NA 5KHOA 1KJTA 2KLGA 1WGGA 3PLUA 4OVVA 3PHWB 2AL6A 3EFUA 2FJLA 4HAYB 1V5TA 2WX0A 4F1SA 1FHWA 2I5CA 2H7EA 1V6EA 5G2NA 3L17A 3E9PA 4ILGB 1K8RB 5DI9B 1E90A 3ALBA 1WG7A 2KWVB 1OY2A 2D3GA 3UIOB 3VIAA 3DVGX 4NSWA 1NU2A 4PQ0A 5IA7A 1ZSQA 2JF5A 3I3TB 2FUHB 3AU4A 1NDDA 1WX7A 2MBQA 2YT1A 4B6HA 3TFMA 3GZNI 4BBKA 3V6EB 4DHJB 2ZCCA 3TVVA 4HB4B 2DKQA 2RGFA 2KQ7A 2K25A 4ANVA 5D3XA 2ASQA 3A33B 2ROVA 1Q67A 4MSMB 2KTRA 1V89A 1SGHA 3AI5A 1VCBA 3DXEA 1NVLA 3OAWA 1WJ1A 5DPRA 4H8SA 1VBGA 4NAWB 1WY8A 1KOTA 2R82A 1HBKA 5CLQB 1UNPA 2FNJB 3ODXA 3FSSA 4LDTD 2NS5A 4AUQC 4IWOA 2LRWA 4G0NB 4G11A 2R0DA 1WFYA 5JH5C 2ZEQA 1YD8U 2PPHA 4RM8A 4ICUA 1TXDA 1FOEA 4MGYE 3VUXA 4DHJD 2HRJA 3HM6X 3QCAA 1UELA 2Z0PA 4ZRIA 1WE6A 2VKIA 1ST7A 4F7UP 3WYFB 3MPXA 3H1UA 4XX5A 4PS8A 2COFA 4GN1A 2DAFA 2N7EA 4AOFA 5DPSA 4DBGA 5CHWA 4M0WB 3TCAA 4IFSA 2CHXA 2MW5A 4EZLA 2DN6A 3SU8X 4WJPA 4NQKE 1XT9B 2ZVNA 3V62A 1WGRA 1KLVA 1DIKA 4GOCA 1WXAA 3B1LX 4B9KA 1J0WA 1AARA 4XWXA 2KANA 2LGYA 1P9DU 3KYCD 4E74A 3WANA 1V86A 3U30A 2NBVB 2CB8A 2P0FA 4ANUA 4MJSA 2HJ8A 3E66A 5L95C 3RT3B 2LZ6A 1MAIA 3QJZA 2YS1A 4C0AA 4TUUA 1E8ZA 2FDQA 2L0FA 5DHFB 2GBNA 1SE9A 3W1SC 3FEHA 3ZKJC 2N9EB 4JKEA 1ACAA 2G3QB 3TO1A 3PT2B 2DHIA 2IO1B 1Y8RC 1U5FA 4DDGD 4JK9A 2KKCA 2GOWA 4HJKA 4ZDVA 2G4DB 3E9LA 4MM3A 2N4FA 2ZPNA 2L0TA 3EC8A 2Z0DB 3EPYA 1TBEA 2J0MA 2J0JA 1V5UA 2LOXA 1WE7A 1V88A 1UPQA 4JQWC 2VRWB 4MGKE 4HCPB 3V5WA 2DAJA 3BY4B 3BINA 2QKMA 1P0RA 2DYMA 2RSGA 3KYDD 3ML9A 3IVFA 2GCJA 4FJZA 1MIXA 1XQQA 5J3YA 2IY0B 4NQLB 3M1IB 1M7EA 3JSVA 1HE8A 4FHJA 1LB1A 3VDZA 3QX1A 3N7CA 1EVHA 3GYOA 3TJPA 3C0RB 2KTRB 5AZGA 1BT0A 5JLJB 2LVQA 1OEYJ 4JKBA 1NTYA 3ZNID 1M7RA 2DLWA 1YIWA 1DROA 2CHZA 2N7DA 2MBEA 4WJNA 2FCMA 1TGZB 3KH0A 2MKRA 3SV1A 3ML4A 3QBVB 1GUAB 3N30A 2PEAA 1N3HA 2GJYA 1WRDB 3RZFA 2NBWB 4ILJA 1BTNA 2D10A 1E8YA 5HE3A 4W9DA 1WJ6A 1RAXA 2CODA 2KLCA 2G35A 4WJOA 1FGYA 3QK0A 2W2WA 2YS5A 2BKFA 4GZUA 2IY1B 4ZRKA 1XR0B 4YONA 2MSED 3AU5A 2GBKA 2WYQA 3WAPA 2MRPA 4M8NA 3APCA 3ZRCA 4K7SA 5C5BB 2RNRB 1K5GB 2DHZA 2CY5A 4IAPA 4NJ7A 3JYUA 2JT4B 1WGQA 3PLVA 3SHQA 2OQBA 1UZXB 2KJHB 2WX1A 4NNJB 3DXCA 3R66C 2DZMA 2JVCA 4IWQA 3M62B 2RD0A 3D8FA 1H10A 2J59M 1UGMA 1Q5WB 5KHQA 2GBRA 2K6DB 4GPTB 1WVHA 1XKEA 2M4NA 3TMPB 3VOQA 2D4QA 2CR5A 4EZJA 4IUMB 1J19A 2RGNB 4AJWA 4HATB 5D6JB 3L54A 2XQNM 4KSLC 5C23A 2IO2B 3OANA 1W1DA 4B95A 2FCNA 2C7NB 1P6SA 2KXJA 2D11A 2CY4A 1WXSA 1CMXB 2XBBC 3RD2A 4A3OA 1UNQA 1E8XA 3K9PB 3WAOA 3VTUA 2D2QA 4JKAA 3V61A 3SBTA 2P0DA 5AZHA 2LGDA 2DZKA 1TZ1A 1GGOA 1G6JA 3F5RA 2RUKB 3QAQA 5HE0A 2KN5A 3A8PA 2KZRA 1XD3B 3CSFA 1T0YA 4DHZB 2KC1A 3PTFC 1XCGA 4HK2A 3O96A 3PSCA 3JSVB 1X1GA 3DBSA 2KDFB 4BKTA 3HQCA 1EGXA 5JVLA 4MGIE 2EMSA 3CXBB 3RUIB 1SIFA 2H7DA 3DBRI 3IFWB 2KX0A 2Z0QA 2NPTA 3UQAA 2BKRB 3UZTA 2JP2A 4W9JA 2PE9A 4KIKA 1R4MI 1YX6B 3VXWA 5DCNA 3VFKA 3WIMA 5JZEB 2K1FA 4MELA 3MJWA 4JKFA 3D32A 4KZ0A 5L83A 3T8MA 1C1YB 4PS7A 3WA0A 3DBLI 3VTVA 1EF5A 4F7HA 4EMOA 1V5PA 3DVGY 4HAXB 4A6FA 1P1AA 2L1CA 2K8HA 4BFRA 3TL5A 5LOPB 3ZIMA 3D8EA 3PV1A 5C1ZA 4WVFB 1U5GA 3R7RA 1KZ7A 5DPTA 4HPMB 4A20A 1WR1A 2AYOB 4RM9A 1WGDA 3W1YA 2REXA 2L2IA 1OGWA 2MCNB 5FR6A 5BO4B 4ILHA 4DBBA 2LRUA 4W9KA 1U2BA 2KCJA 4PS3A 4JLCA 1XX0A 3FLVA 5CHFA 4ZRJA 2BF8B 1GNUA 1JRUA 5EDSA 1X11A 2MDXA 3MHSD 2DYNA 3MTNB 3PREA 2O2VA 2OOBB 4A3PA 3L16A 3PVWA 2CKHB 3SBGA 2YLMA 4P7IA 2LASA 4MK0A 3VUYA 2A5UA 4W9EA 2KGXB 3Q3JA 1NTIA 2Z59B 3HW2B 4GSWA 2D07B 2COCA 2C60A 4FADA 4RMAA 1X86A 3QIJA 1D3ZA 4BBNF 3WALA 2BCJA 4EUTA 3ZNHB 2W2XC 2K8CA 1IP9A 2QKLA 3ZVRA 2K6QA 2M1MA 4MT7A 4NY0A 3IG3A 4BBNC 2N23A 1U5EA 2HE7A 3PSEB 2DYQA 1LQBA 2P8VA 3ZTDA 2M8SA 5C5BA 2X0SA 3ZDTA 1ZGUB 3ZO5B 1V5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK A;  3U8Z A;  1FGZ A;  2JPH A;  4Z2M B;  5G55 A;  2FCQ A;  4EJN A;  1I35 A;  1EUV B;  2K2U A;  3BJI A;  3HK0 A;  2KD0 A;  4FN2 A;  2LBB A;  2NPT B;  1EF1 A;  2DZJ A;  4IM2 A;  4KIK B;  3VQI A;  1UPR A;  2UZS A;  2KC2 A;  3A9J A;  3PEG A;  3O65 B;  3QWM A;  3ZDM C;  2MFQ A;  1RLF A;  2N9P C;  3F0W A;  2MQJ A;  2KJ6 A;  1ZC3 B;  2NBU A;  1OQY A;  3OJ4 B;  1NTV A;  1KM7 A;  2V76 A;  1WZ3 A;  3CST A;  2CRF A;  2LVO A;  4A6F B;  1WZ0 A;  2DX5 A;  2K8B A;  2V4L A;  2L7R A;  3KRX A;  4DX9 0;  1SHC A;  4CHJ A;  2MP2 A;  1ZC4 B;  1MK7 B;  1WR6 E;  4WWO A;  4MEM A;  4K2P A;  3AUL A;  3SNH A;  1J0G A;  1DYN A;  2IYD B;  2B3A A;  4KAX B;  3JVZ X;  2KVR A;  2XK5 B;  1WXM A;  1WGU A;  3L10 B;  4ANW A;  4DX8 A;  2ZNV C;  4D0N B;  2MLB A;  1MK9 B;  3VAW A;  4WWP A;  2K39 A;  3ZVV A;  1WI0 A;  5HE2 A;  1WI1 A;  4MGZ E;  3OLM D;  1AWE A;  5GOW B;  2O2V B;  1FB8 A;  3DOW A;  1WH3 A;  2R2Q A;  1E8W A;  4TQ1 A;  4II2 B;  2DHJ A;  2YVC A;  1BWN A;  2W2X D;  1UNR A;  2DHK A;  1A5R A;  2KDE B;  4ICV A;  1WGH A;  4K81 A;  5J17 A;  2KDI A;  2BYF A;  2GBM A;  1HB6 A;  1RRB A;  1B55 A;  4HXD A;  4GB9 A;  4HB0 B;  1Q1O A;  2O6V B;  4HAU B;  3KW5 B;  4F8C B;  3KSY A;  2X18 A;  4W9L A;  2ZPY A;  2J0K A;  2G45 B;  2JUO A;  3DCG A;  5TR5 A;  4WJQ A;  2HTH A;  3VHT C;  1J8C A;  2LI5 A;  4FUL A;  2KUP A;  3PHX B;  4WAA A;  3PZD A;  3L08 A;  4GMV A;  3A8Q A;  1V9J A;  2IO3 B;  2KOX A;  3R3M A;  2CQU A;  3QHT A;  1DDM A;  2MX2 A;  4HAV B;  1WJM A;  4HLE A;  2KFJ A;  4TQ0 A;  1NI2 A;  2ZNV B;  3GYP A;  1ISN A;  4PYU A;  3V6C B;  3CMM B;  5D3Y A;  2OTX A;  1LW3 A;  2COA A;  3PRP B;  3VH4 B;  2MA9 B;  2ADZ A;  1MPH A;  2CAY A;  2C5L C;  1IRS A;  4K17 A;  3DBH I;  2FID A;  4Z2N A;  2NR2 A;  3A9J B;  5JHA A;  3H7S A;  2LYD A;  2KWU B;  3PP2 A;  4KHB B;  5AEK B;  3M63 B;  4LCD E;  2D9V A;  2NCN A;  3QC8 B;  3A9K A;  2WDT B;  2DX5 B;  1WX9 A;  1ZVR A;  2KX3 A;  3PG7 A;  1WJN A;  3PPA A;  3SDL C;  5JHG A;  4BVU C;  4M8M A;  2MP2 B;  1LM8 B;  3PGE A;  2NZ8 B;  4IG7 B;  4WWN A;  4NJ6 A;  2M14 A;  1YJ1 A;  2DA0 A;  3RCZ A;  1IYF A;  4HAZ B;  1UBQ A;  2C7M B;  1V5M A;  2AEH A;  2IBI B;  3PVU A;  4L6E A;  3FM8 C;  1EO6 A;  3ZRF A;  1GC7 A;  3M3J A;  2RPQ A;  2LJ5 A;  1DBH A;  5DPW A;  4IM3 A;  2ABD A;  2D9Z A;  3APF A;  5KQ1 A;  2JZZ A;  2LD9 A;  2E2X A;  4W9C A;  2WH5 A;  3FP5 A;  2Y7B A;  3HIZ A;  1PFJ A;  3EEC A;  2LG1 A;  1R4N I;  4B6W A;  3X0W A;  2OJR A;  2Y8F A;  4XC2 A;  2ELB A;  2DZI A;  2EKE C;  4JL9 A;  4KDI C;  4W9H A;  1YX5 B;  2A4Z A;  1DDV A;  4KSK C;  3X23 A;  2UWQ A;  4CHK A;  5FI1 A;  3RZW C;  1QQG A;  1GG3 A;  4G3X B;  4EFO A;  3GOE A;  2LXA A;  2KO3 A;  5LXH A;  5C16 A;  3B0A A;  2MBB B;  2N1V A;  4BOZ B;  1UBI A;  1FHO A;  2CU1 A;  2QHO A;  3ONS A;  1H8C A;  5J3T A;  2UVM A;  1V2Y A;  1XD4 A;  2V3S A;  1X1F A;  3TW1 A;  3ODW A;  1RJ2 A;  1OQN A;  2XEW A;  4K7W A;  3WAM A;  4IM0 A;  2RQ1 A;  1Y5O A;  1QZE A;  5D2M B;  2BGF A;  2HTH B;  5GMV A;  4E3C A;  3LDZ E;  3APD A;  2KMC A;  1RRP B;  3PVL A;  2FCS A;  4IOY X;  3H7P A;  3AXC A;  3D8D A;  5HE1 A;  3QA8 A;  3Q3F A;  2L3Z A;  2K00 A;  3RYT A;  2XK5 A;  5KCV A;  2KJR A;  2PZ1 A;  2IFS A;  3QQ8 B;  5LXI B;  1X1M A;  3VTW A;  2GBJ A;  4DXA B;  3ULB A;  3A98 B;  4LDT B;  3ZLZ A;  1WJU A;  1MKE A;  4KZC A;  4FLH A;  4I6N B;  1I2H A;  4TV3 A;  1L7Y A;  5DH9 B;  4KVG B;  2NMB A;  3ENE A;  2I1J A;  2KWC A;  2IO0 B;  4W9G A;  3SYX A;  1E5W A;  4HWI B;  1WM2 A;  1FHX A;  2KK8 A;  1GJZ A;  3LJU X;  2L00 B;  5D7G A;  3PS6 A;  3CF6 E;  3A9K B;  1H4R A;  2L8J A;  1C3T A;  4FJV B;  2RLO A;  2EJ8 A;  3LJ3 A;  1UEF A;  3IBE A;  1QC6 A;  2Q13 A;  4TKN A;  3NZS A;  4MSQ B;  3SD5 A;  2JXX A;  3UF8 A;  3ZNG C;  1PMS A;  2M17 A;  3B08 A;  3KVF B;  4X57 B;  2BWE S;  4I6P A;  3A4S C;  4IW0 A;  2O6V A;  4G50 A;  4KDL B;  1Y19 B;  2IZV B;  2RR9 A;  2PJH A;  3W1S A;  2N9X A;  4HPL B;  1ZM0 A;  4BKS A;  2AL3 A;  2C9W B;  3TBL D;  2RSU A;  2ZZP B;  3V60 A;  4XZ4 A;  1WIA A;  3DVN U;  1OEY A;  5LLI A;  5J2R A;  4Y94 A;  1S3S G;  3M95 A;  2DYO A;  3NS8 A;  5JHH A;  3UIN B;  2G4S A;  1MG8 A;  4CO7 A;  4JIO U;  3KUC B;  4K2O A;  1MIZ B;  2FIF A;  4EEW A;  2CHW A;  2M0X A;  2L76 A;  1WYW B;  2R2O A;  1TQZ A;  4HHV A;  5FI0 A;  5D94 A;  1LXD A;  4II3 B;  1W1G A;  5C6R A;  3HM3 A;  3OJ3 A;  3DQV A;  2EC1 A;  3P7Z A;  5E6O A;  1YQB A;  3A4R A;  1L2N A;  3ZNZ B;  3T9L A;  2KFK B;  1VD2 A;  4OVU A;  3S2A A;  1P98 A;  2Y5B B;  3ZUN A;  4BOS C;  1U4A A;  2GCL A;  2DEN B;  1FAO A;  3ML8 A;  3UIP B;  2JRH A;  2K2J A;  1WMH B;  2YF0 A;  5CTR C;  2BYV E;  4FHK A;  2C7H A;  4IC7 B;  1UD7 A;  2LGX A;  2DYB A;  1TTN A;  4MH0 E;  2Z0O A;  2KQS A;  5J3Q A;  2MBO A;  4W9I A;  3G9W A;  3H7P B;  3CIK A;  5KQ4 A;  2KMA A;  2LUE A;  3T06 A;  1V61 A;  4PYZ A;  3P6A A;  5J18 A;  4BKG A;  3A1Q A;  4GDK A;  5CHV C;  3N32 A;  2YT0 A;  2KHW B;  3TIX A;  2NVU I;  3NSU A;  1OTR B;  4J6I A;  3ZW3 A;  2JWZ A;  3NY5 A;  2P0H A;  1IPG A;  1WJ4 A;  3NZU A;  5EFX A;  4A5K A;  4DDI D;  2CS4 A;  4FJY A;  3QWZ B;  1Q0W B;  4HDQ A;  1P3R A;  1GC6 A;  3JW0 X;  3H9D A;  3L13 A;  3AJ4 A;  2L05 A;  1AQC A;  2LWP A;  4WJ7 A;  4TYZ A;  1BTK A;  4GDL A;  4ANX A;  3NHE B;  4N9F 4;  4ZYN A;  5CLL B;  4YL8 A;  4ASW C;  2D9W A;  2Z0E B;  1U27 A;  1WX8 A;  1M94 A;  2DKP A;  3VH3 B;  1DDW A;  4JGH B;  1I7A A;  4F7G A;  3HHM A;  4LJO B;  5DIF B;  2COP A;  5IJM A;  2UYZ B;  4DWF A;  4E71 A;  3KUZ A;  2MWN B;  4A6K A;  4KHA A;  3RUL A;  2BPS A;  2FJ9 A;  1WF9 A;  2DX1 A;  3IHP C;  4FA6 A;  3KRW A;  2LUL A;  2LOZ A;  3P2B A;  4FBJ B;  4AJY B;  3RCP A;  4K7U A;  2MWS B;  4EOY A;  1V81 A;  2KDB A;  4HAW B;  1NBF C;  2LKO A;  1E7U A;  2LVP A;  3ECI A;  1TJ6 A;  1PLS A;  2YS3 A;  1Z2M A;  4HB2 B;  2YRY A;  3K9O B;  4CYE A;  3ZTC A;  5D27 A;  1HB8 A;  2DFK A;  2O6V D;  2ZVO A;  4MY6 A;  2EMT A;  1EAZ A;  3NOB A;  4K1R B;  4BKS D;  5E6P A;  4GIV A;  2PE6 B;  4URK A;  1WGY A;  5L81 A;  2BWF A;  4EZK A;  2D9X A;  4GXB A;  1I42 A;  5HKH A;  4MJS B;  3KZ1 A;  1PQS A;  3EHV A;  4IWP A;  4A6H A;  3QAR A;  1P5T A;  2KTF A;  5AZF A;  2KNB A;  3KUD B;  2HD5 B;  5C79 A;  1V49 A;  3N3K B;  1P3Q U;  4I6L B;  4NAW A;  2ELA A;  4AWJ A;  3R7Q A;  2I5F A;  2MBH A;  1Z87 A;  2GS0 A;  2ROZ B;  2JY6 A;  5JHB A;  1LFD A;  1OMW A;  1KI1 B;  3U7D A;  2ZJD A;  4LJP B;  1KZG A;  1WXV A;  2JRI B;  1E7V A;  4DK5 A;  5CX3 A;  1V80 A;  1W1H A;  1BAK A;  4HCN B;  3DXD A;  3KY9 A;  1UH6 A;  3SO6 A;  1RFA A;  4MDK E;  3A1Q B;  2FAZ A;  4GDK B;  4HVB A;  1K5D B;  1WM3 A;  2ZCB A;  5IAA C;  2N0Y A;  4CHM A;  2J7Q B;  4KHO A;  2WWZ A;  1U29 A;  3PRZ A;  4WSF A;  2BYE A;  1F9J A;  2Y8G A;  1U5D A;  4GMX B;  4GU2 A;  4WQO B;  3UGB B;  2IYB A;  2YSZ A;  4AP4 C;  2AWT A;  5DHA B;  4W9F A;  2W9N A;  5D3V A;  3L0W B;  4GDL B;  5JP4 A;  2VSZ A;  4DHZ E;  5LON B;  2VRR B;  4HDO A;  3VVW B;  4NPN A;  2KFK A;  4GGQ A;  4HB3 B;  2N1W A;  3H6N A;  3SUZ A;  1XOD A;  3ODO A;  2UZR A;  1ZW7 A;  1FXT B;  2R09 A;  4KV2 A;  2JZ3 B;  4EKU A;  1X05 A;  2M38 A;  1Z5S B;  1ZKH A;  3DDC B;  3VUW A;  2LXC A;  3ULC A;  2D9Y A;  4F7Z A;  3DPD A;  1WMH A;  1S1Q B;  2I1K A;  5D3W A;  3DVN V;  2DTC A;  3MDB C;  3PRM B;  2GMI C;  3UQB A;  2V1Y A;  2RVB B;  5E6N A;  5KHO A;  1KJT A;  2KLG A;  1WGG A;  3PLU A;  4OVV A;  3PHW B;  2AL6 A;  3EFU A;  2FJL A;  4HAY B;  1V5T A;  2WX0 A;  4F1S A;  1FHW A;  2I5C A;  2H7E A;  1V6E A;  5G2N A;  3L17 A;  1K8R B;  5DI9 B;  1E90 A;  3ALB A;  1WG7 A;  2KWV B;  1OY2 A;  2D3G A;  3UIO B;  3VIA A;  3DVG X;  4NSW A;  1NU2 A;  4PQ0 A;  5IA7 A;  1ZSQ A;  2JF5 A;  3I3T B;  2FUH B;  3AU4 A;  1NDD A;  1WX7 A;  2MBQ A;  2YT1 A;  4B6H A;  3TFM A;  3GZN I;  4BBK A;  3V6E B;  4DHJ B;  2ZCC A;  3TVV A;  4HB4 B;  2DKQ A;  2RGF A;  2KQ7 A;  2K25 A;  4ANV A;  5D3X A;  2ASQ A;  3A33 B;  2ROV A;  1Q67 A;  4MSM B;  2KTR A;  1V89 A;  1SGH A;  3AI5 A;  1VCB A;  3DXE A;  1NVL A;  3OAW A;  1WJ1 A;  5DPR A;  4H8S A;  4NAW B;  1WY8 A;  1KOT A;  1HBK A;  5CLQ B;  1UNP A;  2FNJ B;  3ODX A;  3FSS A;  4LDT D;  2NS5 A;  4AUQ C;  4IWO A;  2LRW A;  4G0N B;  4G11 A;  2R0D A;  1WFY A;  5JH5 C;  2ZEQ A;  1YD8 U;  2PPH A;  4RM8 A;  4ICU A;  1TXD A;  1FOE A;  4MGY E;  3VUX A;  4DHJ D;  2HRJ A;  3HM6 X;  3QCA A;  1UEL A;  2Z0P A;  4ZRI A;  1WE6 A;  2VKI A;  1ST7 A;  4F7U P;  3WYF B;  3MPX A;  3H1U A;  4XX5 A;  4PS8 A;  2COF A;  4GN1 A;  2DAF A;  2N7E A;  4AOF A;  5DPS A;  4DBG A;  5CHW A;  4M0W B;  3TCA A;  4IFS A;  2CHX A;  2MW5 A;  4EZL A;  2DN6 A;  3SU8 X;  4WJP A;  4NQK E;  1XT9 B;  2ZVN A;  3V62 A;  1WGR A;  1KLV A;  4GOC A;  1WXA A;  3B1L X;  4B9K A;  1J0W A;  1AAR A;  4XWX A;  2KAN A;  2LGY A;  1P9D U;  3KYC D;  4E74 A;  3WAN A;  1V86 A;  3U30 A;  2NBV B;  2CB8 A;  2P0F A;  4ANU A;  4MJS A;  2HJ8 A;  5L95 C;  3RT3 B;  2LZ6 A;  1MAI A;  3QJZ A;  2YS1 A;  4C0A A;  4TUU A;  1E8Z A;  2FDQ A;  2L0F A;  5DHF B;  2GBN A;  1SE9 A;  3W1S C;  3FEH A;  3ZKJ C;  2N9E B;  2G3Q B;  1ACA A;  3PT2 B;  3TO1 A;  2DHI A;  2IO1 B;  1Y8R C;  1U5F A;  4DDG D;  2KKC A;  2GOW A;  4HJK A;  4ZDV A;  2G4D B;  2N4F A;  4MM3 A;  2ZPN A;  2L0T A;  3EC8 A;  2Z0D B;  3EPY A;  1TBE A;  2J0M A;  2J0J A;  1V5U A;  2LOX A;  1WE7 A;  1V88 A;  1UPQ A;  4JQW C;  2VRW B;  4MGK E;  4HCP B;  3V5W A;  2DAJ A;  3BY4 B;  3BIN A;  2QKM A;  1P0R A;  2DYM A;  2RSG A;  3KYD D;  3ML9 A;  3IVF A;  2GCJ A;  4FJZ A;  1MIX A;  1XQQ A;  5J3Y A;  2IY0 B;  4NQL B;  3M1I B;  1M7E A;  3JSV A;  1HE8 A;  4FHJ A;  1LB1 A;  3VDZ A;  3QX1 A;  3N7C A;  1EVH A;  3GYO A;  3TJP A;  3C0R B;  2KTR B;  5AZG A;  1BT0 A;  5JLJ B;  2LVQ A;  1OEY J;  1NTY A;  3ZNI D;  1M7R A;  2DLW A;  1YIW A;  1DRO A;  2CHZ A;  2N7D A;  2MBE A;  4WJN A;  2FCM A;  1TGZ B;  3KH0 A;  2MKR A;  3SV1 A;  3ML4 A;  3QBV B;  1GUA B;  3N30 A;  2PEA A;  1N3H A;  2GJY A;  1WRD B;  3RZF A;  2NBW B;  1BTN A;  2D10 A;  1E8Y A;  5HE3 A;  4W9D A;  1WJ6 A;  1RAX A;  2COD A;  2KLC A;  2G35 A;  4WJO A;  1FGY A;  3QK0 A;  2W2W A;  2YS5 A;  2BKF A;  4GZU A;  2IY1 B;  4ZRK A;  1XR0 B;  4YON A;  2MSE D;  3AU5 A;  2GBK A;  2WYQ A;  3WAP A;  2MRP A;  4M8N A;  3APC A;  3ZRC A;  4K7S A;  5C5B B;  2RNR B;  1K5G B;  2DHZ A;  2CY5 A;  4IAP A;  4NJ7 A;  3JYU A;  2JT4 B;  1WGQ A;  3PLV A;  3SHQ A;  2OQB A;  1UZX B;  2KJH B;  2WX1 A;  4NNJ B;  3DXC A;  3R66 C;  2DZM A;  2JVC A;  4IWQ A;  3M62 B;  2RD0 A;  3D8F A;  1H10 A;  2J59 M;  1UGM A;  1Q5W B;  5KHQ A;  2GBR A;  2K6D B;  4GPT B;  1WVH A;  1XKE A;  2M4N A;  3TMP B;  3VOQ A;  2D4Q A;  2CR5 A;  4EZJ A;  4IUM B;  1J19 A;  2RGN B;  4AJW A;  4HAT B;  5D6J B;  3L54 A;  2XQN M;  4KSL C;  5C23 A;  2IO2 B;  3OAN A;  1W1D A;  4B95 A;  2FCN A;  2C7N B;  1P6S A;  2KXJ A;  2D11 A;  2CY4 A;  1WXS A;  1CMX B;  2XBB C;  3RD2 A;  4A3O A;  1UNQ A;  1E8X A;  3K9P B;  3WAO A;  3VTU A;  2D2Q A;  3V61 A;  2P0D A;  5AZH A;  2LGD A;  2DZK A;  1TZ1 A;  1G6J A;  3F5R A;  2RUK B;  3QAQ A;  5HE0 A;  2KN5 A;  3A8P A;  2KZR A;  1XD3 B;  3CSF A;  1T0Y A;  4DHZ B;  2KC1 A;  3PTF C;  1XCG A;  4HK2 A;  3O96 A;  3PSC A;  3JSV B;  1X1G A;  3DBS A;  2KDF B;  4BKT A;  3HQC A;  1EGX A;  4MGI E;  2EMS A;  3CXB B;  3RUI B;  1SIF A;  2H7D A;  3DBR I;  3IFW B;  2KX0 A;  2Z0Q A;  2NPT A;  3UQA A;  2BKR B;  3UZT A;  2JP2 A;  4W9J A;  2PE9 A;  4KIK A;  1R4M I;  1YX6 B;  3VXW A;  5DCN A;  3VFK A;  3WIM A;  5JZE B;  2K1F A;  4MEL A;  3MJW A;  3D32 A;  4KZ0 A;  5L83 A;  3T8M A;  1C1Y B;  4PS7 A;  3WA0 A;  3DBL I;  3VTV A;  1EF5 A;  4F7H A;  4EMO A;  1V5P A;  3DVG Y;  4HAX B;  4A6F A;  1P1A A;  2L1C A;  2K8H A;  4BFR A;  3TL5 A;  5LOP B;  3ZIM A;  3D8E A;  3PV1 A;  5C1Z A;  4WVF B;  1U5G A;  3R7R A;  1KZ7 A;  5DPT A;  4HPM B;  4A20 A;  1WR1 A;  2AYO B;  4RM9 A;  1WGD A;  3W1Y A;  2REX A;  2L2I A;  1OGW A;  2MCN B;  5FR6 A;  5BO4 B;  4DBB A;  2LRU A;  4W9K A;  1U2B A;  2KCJ A;  4PS3 A;  4JLC A;  1XX0 A;  3FLV A;  5CHF A;  4ZRJ A;  2BF8 B;  1GNU A;  1JRU A;  5EDS A;  1X11 A;  2MDX A;  3MHS D;  2DYN A;  3MTN B;  3PRE A;  2O2V A;  2OOB B;  4A3P A;  3L16 A;  3PVW A;  2CKH B;  2YLM A;  4P7I A;  2LAS A;  4MK0 A;  3VUY A;  2A5U A;  4W9E A;  2KGX B;  3Q3J A;  1NTI A;  2Z59 B;  3HW2 B;  4GSW A;  2D07 B;  2COC A;  2C60 A;  4FAD A;  4RMA A;  1X86 A;  3QIJ A;  1D3Z A;  4BBN F;  3WAL A;  2BCJ A;  4EUT A;  3ZNH B;  2W2X C;  2K8C A;  1IP9 A;  2QKL A;  3ZVR A;  2K6Q A;  2M1M A;  4MT7 A;  4NY0 A;  3IG3 A;  4BBN C;  2N23 A;  1U5E A;  2HE7 A;  3PSE B;  2DYQ A;  1LQB A;  2P8V A;  3ZTD A;  2M8S A;  5C5B A;  3ZDT A;  1ZGU B;  3ZO5 B;  1V5O A; 
#chains in the Genus database with same CATH topology
 4PNK A;  3U8Z A;  1FGZ A;  1L4Z B;  2I38 A;  2JPH A;  2WXK A;  2Q5W D;  4Z2M B;  5G55 A;  2FCQ A;  3AEE B;  4EJN A;  1I35 A;  3RPF C;  1EUV B;  1FFV A;  1SXT A;  2K2U A;  2WXI A;  3BJI A;  2TSS A;  1YNT E;  3HK0 A;  2KD0 A;  4FN2 A;  2LBB A;  3L4P A;  2NPT B;  1ENF A;  1EF1 A;  2SAK A;  1P7E A;  2DZJ A;  3C19 A;  4IM2 A;  4KIK B;  3VQI A;  1UPR A;  2UZS A;  2KC2 A;  3A9J A;  3PEG A;  5IKC M;  3O65 B;  3QWM A;  2KUQ A;  3ZDM C;  2MFQ A;  1RLF A;  2N9P C;  5BMI A;  1TZO A;  3F0W A;  2MQJ A;  2KJ6 A;  1ZC3 B;  2NBU A;  1OQY A;  4KHB A;  2KMM A;  3OJ4 B;  1T0S C;  1NTV A;  1KM7 A;  2V76 A;  1WZ3 A;  3CST A;  1ZE3 D;  2CRF A;  2LVO A;  4A6F B;  1WZ0 A;  3W5V B;  2DX5 A;  2K8B A;  1SE3 A;  2V4L A;  4C4V B;  2G9H D;  2WQY B;  3B2G A;  2L7R A;  3KRX A;  4M00 A;  4LNO A;  4DX9 0;  1SHC A;  4CHJ A;  2MP2 A;  3VR8 B;  2RRF A;  1ZC4 B;  3P4S B;  1N61 A;  2M19 A;  1MK7 B;  1WR6 E;  3NS1 A;  4WWO A;  4MEM A;  4K2P A;  4XWT A;  3AUL A;  2J4X A;  3SNH A;  1J0G A;  1DYN A;  2D3B A;  2IYD B;  3VRA B;  2LHD A;  1MFW A;  2B3A A;  3Q8C A;  4KAX B;  3JVZ X;  2KVR A;  2XK5 B;  4ARC A;  1WXM A;  1WGU A;  3L10 B;  2ON8 A;  4N58 A;  1FXI A;  4ANW A;  4DX8 A;  2DBY A;  2DIK A;  2ZNV C;  1ET6 A;  4D0N B;  1FEH A;  2W3R A;  2MLB A;  1MK9 B;  1KLG D;  3EFC A;  2JXT A;  3VAW A;  1UF0 A;  4WWP A;  2K39 A;  3ZVV A;  1JML A;  1WI0 A;  5HE2 A;  3FIL A;  1WI1 A;  4MGZ E;  1DYQ A;  3OLM D;  1C4C A;  1AWE A;  2DNF A;  4ZOH C;  1DOY A;  5GOW B;  4JKC A;  2O2V B;  3I9V 1;  3Q8A A;  2BB6 A;  1FB8 A;  3DOW A;  1WH3 A;  2R2Q A;  2W82 A;  1E8W A;  1KC7 A;  3SFD B;  4QXA B;  4TQ1 A;  1TY0 A;  3U7Z A;  2QDF A;  3AEB B;  4JE3 B;  4II2 B;  2DHJ A;  4QJ4 B;  2YVC A;  1BWN A;  2W2X D;  1UNR A;  2DHK A;  3SR6 A;  2BTE A;  1A5R A;  2HDE A;  4JKH A;  2KDE B;  4ICV A;  1WGH A;  4K81 A;  5J17 A;  2OED A;  2KDI A;  2BYF A;  1TS5 A;  2GBM A;  1HB6 A;  1RRB A;  1B55 A;  3BVZ A;  4RFB A;  3V3X A;  4B0M A;  4JKG A;  4HXD A;  1VBH A;  2N9L A;  4GB9 A;  4HB0 B;  1PGA A;  3AB5 A;  1Q1O A;  2O6V B;  4HAU B;  5M4Y B;  3KW5 B;  4F8C B;  3KSY A;  4JPS A;  4S0R A;  1HZ5 A;  2X18 A;  4W9L A;  4JWU C;  5AUK A;  2ZPY A;  2J0K A;  2G45 B;  2JUO A;  4C00 A;  1DGJ A;  3DCG A;  5TR5 A;  3WCQ A;  4KKJ A;  3BVG A;  2D5G A;  4WJQ A;  2HTH A;  4A55 A;  3MC9 A;  1J7C A;  3VHT C;  1J8C A;  3E9S A;  1SSN A;  2K8E A;  3B77 A;  2FBW B;  2LI5 A;  4FUL A;  3FAH A;  2KUP A;  3PHX B;  2L32 A;  2D3A A;  4WAA A;  1WSP A;  1AW7 A;  3PZD A;  4B0E A;  1T77 A;  3L08 A;  4GMV A;  1PYW D;  3A8Q A;  1V9J A;  2IO3 B;  2KOX A;  3R3M A;  2CQU A;  3QHT A;  1DDM A;  2MX2 A;  4HAV B;  1WJM A;  4HLE A;  2KFJ A;  4TQ0 A;  1NI2 A;  2AQ2 B;  1C4A A;  2ZNV B;  1NYR A;  3GYP A;  1ISN A;  4PYU A;  3V6C B;  3CMM B;  2JX5 A;  5D3Y A;  4DXG A;  2OTX A;  4C56 C;  2KDM A;  2V3P A;  1LW3 A;  2I2Y A;  2COA A;  2QIE B;  1N6Z A;  3PRP B;  3DWM A;  2MJ3 A;  3VH4 B;  2MA9 B;  4A8X C;  2ADZ A;  1MPH A;  4RNA A;  2CAY A;  2C5L C;  1IRS A;  4K17 A;  3DBH I;  2FID A;  1WGK A;  4LNI A;  4Z2N A;  2NR2 A;  3A9J B;  5JHA A;  3H7S A;  4LLG M;  3GZN B;  2PW9 A;  1QIL A;  2LYD A;  2KWU B;  3PP2 A;  4KHB B;  5AEK B;  1YOV B;  3M63 B;  5HHD G;  4LCD E;  2JWU A;  1EM7 A;  2D9V A;  1TS4 A;  2NCN A;  3QC8 B;  3A9K A;  3O13 A;  2WDT B;  1ET9 A;  2DX5 B;  1WX9 A;  4HEA 1;  3HUI A;  1ZVR A;  3NJT A;  2KX3 A;  1UGJ A;  1KFY B;  3PG7 A;  1WJN A;  3PPA A;  3SDL C;  5JHG A;  3ZYY X;  2N9K A;  4LTU A;  2Z8L A;  4BVU C;  1B9R A;  4M8M A;  2MP2 B;  1LM8 B;  3PGE A;  3V05 A;  3IXS A;  1XO3 A;  2NZ8 B;  4JWS C;  3DWG C;  4IG7 B;  2W55 A;  4WWN A;  2MHJ A;  4NJ6 A;  3H8H A;  3BVM A;  1I4H A;  3NW8 A;  4OZC A;  2E3T A;  1QOF A;  2M14 A;  1YJ1 A;  3AEC B;  2DA0 A;  3RCZ A;  1IYF A;  4HAZ B;  3AH7 A;  2K3U A;  1T0Q C;  5AUI A;  1UBQ A;  2C7M B;  3TUO A;  1V5M A;  2AEH A;  2IBI B;  3PVU A;  4L6E A;  3CIR B;  3N1Z C;  3FM8 C;  1EO6 A;  1GB1 A;  3ZRF A;  1GC7 A;  3M3J A;  3UI3 A;  2RPQ A;  2LJ5 A;  4OSN A;  1DBH A;  5DPW A;  1JAL A;  4IM3 A;  2ABD A;  2D9Z A;  3APF A;  3FIL B;  5KQ1 A;  2JZZ A;  2LD9 A;  2E2X A;  4W9C A;  4JK7 A;  2WH5 A;  4EE2 A;  3FP5 A;  2Y7B A;  4M02 A;  2RDB C;  1YJI A;  3HIZ A;  4CQN A;  1PFJ A;  1VDV A;  2CJN A;  3EEC A;  5HFY A;  2LG1 A;  1R4N I;  1ESF A;  1NEN B;  2INN E;  2SEB D;  3X0W A;  4B6W A;  1JQ4 A;  2M56 B;  2OJR A;  2Y8F A;  4XC2 A;  1HQR D;  2ELB A;  2DZI A;  2EKE C;  4JL9 A;  4KDI C;  2PIA A;  3I63 C;  4W9H A;  1YX5 B;  3I5J C;  2A4Z A;  1DDV A;  4KSK C;  3X23 A;  2UWQ A;  3KQ4 A;  4CHK A;  1ZXH A;  3E9O A;  2HJ1 A;  5FI1 A;  1D6E C;  1QQG A;  1GG3 A;  4G3X B;  3RZW C;  4EFO A;  4PK1 A;  3GOE A;  2LXA A;  2KO3 A;  5LXH A;  5C16 A;  2GUM A;  3B0A A;  2MBB B;  2N1V A;  4BOZ B;  1UBI A;  3BK1 A;  1FHO A;  4YSX B;  4JKG B;  1ZDX A;  2CU1 A;  2QHO A;  3ONS A;  1H8C A;  5J3T A;  2WLB A;  3IAS 1;  2LMC A;  2UVM A;  1V2Y A;  3W5U B;  1ZDV A;  1XD4 A;  2V4I B;  2V3S A;  1X1F A;  1PDX A;  1KRH A;  3TW1 A;  3ODW A;  1RJ2 A;  1SIJ A;  1E0Z A;  1OQN A;  2XEW A;  4K7W A;  4HRO A;  1JDE A;  1VJK A;  4IM0 A;  3WAM A;  2RQ1 A;  1Y5O A;  1QZE A;  5D2M B;  4TMA B;  4D6W A;  2BGF A;  2HTH B;  1OQR A;  2EEL A;  2N7J A;  2UU7 A;  1A70 A;  5GMV A;  2JSV X;  4C80 A;  2M0A A;  4E3C A;  3A58 A;  3LDZ E;  4ZHP A;  3BYT B;  3APD A;  2KMC A;  1RRP B;  2QJL A;  3PVL A;  2FCS A;  4IOY X;  4JK8 A;  1VR9 A;  3H7P A;  3AXC A;  3D8D A;  5HE1 A;  5JXV A;  3QA8 A;  4ACF A;  1C77 A;  3Q3F A;  2L3Z A;  2K00 A;  4ZYS A;  2IGD A;  3RYT A;  2XK5 A;  5KCV A;  1SE4 A;  1TYG B;  2KAC A;  2KJR A;  2PZ1 A;  2IFS A;  3QQ8 B;  1E6E B;  3ENB A;  5LXI B;  1X1M A;  3RNB C;  3VTW A;  2GBJ A;  4DXA B;  3ULB A;  1RFK A;  3A98 B;  4LDT B;  3ZLZ A;  1WJU A;  3IAM 1;  1MKE A;  2WDV B;  4KZC A;  4FLH A;  1LGR A;  3NZ3 A;  4I6N B;  1D5M C;  5BYS A;  1I2H A;  4TV3 A;  1L7Y A;  2B76 B;  5DH9 B;  4XYC A;  4KVG B;  2NMB A;  3ENE A;  2XNA C;  2PVG C;  4ITK A;  2I1J A;  2KWC A;  1I4P A;  2IO0 B;  4W9G A;  3SYX A;  4LNF A;  1E5W A;  4HWI B;  1WM2 A;  1FHX A;  2KK8 A;  1GJZ A;  1PGB A;  4P6V F;  1KBL A;  3FVC A;  3LJU X;  1K50 A;  1YQ3 B;  1MI1 A;  2L00 B;  5D7G A;  3PS6 A;  3CF6 E;  1YQ4 B;  3A9K B;  1H4R A;  2L8J A;  1VZ6 A;  1C3T A;  2PKO A;  1VZ7 A;  4FJV B;  2E6X A;  3MC8 A;  2RLO A;  2EJ8 A;  3LJ3 A;  1ZYI A;  1UEF A;  3IBE A;  1QC6 A;  2Q13 A;  4TKN A;  3NZS A;  4MSQ B;  3SD5 A;  2JXX A;  3UF8 A;  3ZNG C;  1PMS A;  1UWM A;  2L83 A;  2M17 A;  3B08 A;  3KVF B;  1GPX A;  4X57 B;  2BWE S;  4I6P A;  3A4S C;  4IW0 A;  2O6V A;  4G50 A;  3BYY B;  4YSY B;  4KDL B;  1Y19 B;  2IZV B;  2ZKM X;  1K53 A;  2V9H A;  1STE A;  2RR9 A;  2PJH A;  3W1S A;  3ZXV A;  2N9X A;  4HPL B;  1ZM0 A;  4BKS A;  4US8 A;  2AL3 A;  2C9W B;  3TBL D;  2RSU A;  3AE3 B;  2ZZP B;  3V60 A;  4XZ4 A;  1QOA A;  1WIA A;  3DVN U;  1OEY A;  1J7B A;  5LLI A;  5J2R A;  4Y94 A;  1S3S G;  3M95 A;  1FNW A;  4N59 A;  2DYO A;  3NS8 A;  1SB3 C;  3U4E G;  5JHH A;  2BS2 B;  3UIN B;  2G4S A;  1MG8 A;  4CO7 A;  4JIO U;  3P4P B;  3KUC B;  4K2O A;  1MIZ B;  3VR9 B;  2FIF A;  4EEW A;  2CHW A;  2M0X A;  2L76 A;  1WYW B;  2R2O A;  1TQZ A;  4YWG G;  4HHV A;  5FI0 A;  2PVO D;  4BZA A;  3TEY A;  1Y56 A;  2WXF A;  5D94 A;  1QQR A;  2HTM E;  1QOB A;  1UWX A;  1LXD A;  4II3 B;  5FK9 C;  1W1G A;  2VZK B;  5C6R A;  3HM3 A;  3OJ3 A;  3MC0 B;  3DQV A;  2EC1 A;  4AQ7 A;  1FD6 A;  3P7Z A;  4USA A;  5E6O A;  4WAF A;  1L4D B;  1YQB A;  3A4R A;  2KN4 A;  1VRA B;  2MJE A;  3AM9 A;  3ZNZ B;  1L2N A;  3T9L A;  2KFK B;  1VD2 A;  4OVU A;  1JW9 D;  2IPK D;  3S2A A;  3NRZ A;  5HI1 A;  1P98 A;  2Y5B B;  1MJD A;  3ZUN A;  4KGT A;  4BOS C;  1RYJ A;  1FCL A;  1U4A A;  2PTL A;  1FXA A;  4C7Z A;  2GCL A;  2DEN B;  1FAO A;  3ML8 A;  2QEJ C;  3ZXR A;  3UIP B;  1L0X B;  3AN1 A;  2JRH A;  2K2J A;  2R2Y A;  1WMH B;  4DIX A;  3AE1 B;  4ZRP A;  1SF0 A;  2YF0 A;  5CTR C;  2BYV E;  4FHK A;  4D2K A;  2C7H A;  4IC7 B;  1UD7 A;  2NMQ A;  2LGX A;  2DYB A;  4WUR A;  5IN7 A;  1TTN A;  4MH0 E;  2Z0O A;  4NAM A;  2KQS A;  1AYF A;  1IUE A;  5J3Q A;  2MBO A;  1UUP A;  2BVC A;  4W9I A;  3G9W A;  1SE2 A;  2INP E;  3H7P B;  3CIK A;  4A9A A;  5KQ4 A;  3AE6 B;  2KMA A;  1HA5 A;  2LUE A;  3T06 A;  5BMG A;  1WXQ A;  1V61 A;  4HKZ E;  2WXL A;  4HPP A;  4PYZ A;  4OZB A;  3P6A A;  5J18 A;  4BKG A;  1IGC A;  3A1Q A;  4GDK A;  5CHV C;  2J53 A;  3N32 A;  2YT0 A;  2KHW B;  3TIX A;  2NVU I;  2DLB A;  3NSU A;  2L1A A;  3GE8 C;  1OTR B;  4J6I A;  3ZW3 A;  2JWZ A;  3NY5 A;  2P0H A;  1IPG A;  1WJ4 A;  1HZ6 A;  3DHI C;  3NZU A;  3VRB B;  5EFX A;  1MI0 A;  4A5K A;  4YTP B;  4DDI D;  2CS4 A;  4FJY A;  3RN9 C;  1TIF A;  4YTN B;  3QWZ B;  1Q0W B;  5EE9 A;  4HDQ A;  1P3R A;  3HRD D;  1GC6 A;  3JW0 X;  3H9D A;  3L13 A;  4RF1 A;  3AJ4 A;  4KGR A;  2L05 A;  1F52 A;  3N20 C;  1AQC A;  2LWP A;  4WJ7 A;  2BW2 A;  3Q3N C;  4TYZ A;  1BTK A;  4GDL A;  4ANX A;  3NHE B;  2Z4D A;  4N9F 4;  4ZYN A;  2KVZ A;  4KX6 B;  1NI3 A;  4MH8 A;  1R4M B;  3IT4 B;  5CLL B;  4YL8 A;  4ASW C;  3RMK C;  2D9W A;  2Z0E B;  3KWL A;  1U27 A;  1WX8 A;  1RWS A;  3AE9 B;  1J7A A;  1M94 A;  2DKP A;  2AQ1 B;  1T6B X;  3VH3 B;  1PFD A;  3KLS X;  4LNN A;  1DDW A;  4JGH B;  5D3D A;  3DBL B;  3NUH B;  5T8I A;  3ZJU A;  1I7A A;  4F7G A;  3HHM A;  4LJO B;  2ACZ B;  5DIF B;  2COP A;  5IJM A;  3ETR A;  2UYZ B;  2LJI A;  4DWF A;  2QCZ A;  4E71 A;  3AEA B;  3KUZ A;  2MWN B;  1I4X A;  1D4B A;  4A6K A;  3EUB 2;  1HXY D;  2WXO A;  4KHA A;  2KWD A;  3RUL A;  2BPS A;  2FJ9 A;  1WF9 A;  3GP7 A;  1Q10 A;  2DX1 A;  4JKD A;  2QSD A;  5H92 C;  3IHP C;  4FA6 A;  3KRW A;  2LUL A;  1JWU D;  2LOZ A;  1FNV A;  3P2B A;  2MJD A;  4FBJ B;  3AE5 B;  4AJY B;  3RCP A;  4M01 A;  4K7U A;  5GXG B;  2MWS B;  4EOY A;  4A6Q A;  1V81 A;  2KDB A;  4HAW B;  1NBF C;  4XGA B;  2LKO A;  1E7U A;  2LVP A;  3ECI A;  1TJ6 A;  1PLS A;  4TSS A;  2YS3 A;  5IOI A;  1N62 A;  1JCK B;  1Z2M A;  4HB2 B;  3TEZ A;  2YRY A;  1XLP A;  2JQR B;  2FUG 1;  4CYE A;  3K9O B;  3ZTC A;  5D27 A;  1HB8 A;  2DFK A;  1R7S A;  2O6V D;  2J52 A;  2ZVO A;  4MY6 A;  3RNG C;  2EMT A;  3DCX A;  1EAZ A;  2IGG A;  3NOB A;  4K1R B;  1JWA D;  4BKS D;  5E6P A;  4GIV A;  4QAY A;  1JRP A;  2Y3A A;  2PE6 B;  4URK A;  4YSZ B;  3AE2 B;  1WGY A;  5L81 A;  2BWF A;  2K9X A;  1DOX A;  4EZK A;  1F77 A;  2D9X A;  4GXB A;  1I42 A;  5HKH A;  1PQS A;  3KZ1 A;  3EHV A;  4MJS B;  4IWP A;  4A6H A;  3QAR A;  3KWV A;  1P5T A;  1D5Z C;  1I4Q A;  2KTF A;  5AZF A;  2KNB A;  3KUD B;  3U52 E;  3MP9 A;  4RCO A;  4DQO C;  2HD5 B;  4KGS A;  5C79 A;  1V49 A;  3N3K B;  1QOG A;  1P3Q U;  5LG4 B;  4I6L B;  4NAW A;  2K0P A;  2ELA A;  4AWJ A;  2LUM A;  3R7Q A;  2I5F A;  2MBH A;  1Z87 A;  2GS0 A;  2ROZ B;  2OHF A;  2JY6 A;  2WXR A;  2KT7 A;  1WYG A;  5JHB A;  1LFD A;  1OMW A;  1KI1 B;  1LO5 D;  1T3Q A;  3U7D A;  2ZJD A;  4LJP B;  1KZG A;  1WXV A;  2JRI B;  3T3O A;  4ZRQ A;  2Y5C A;  1E7V A;  4DK5 A;  2G1E A;  5CX3 A;  3RI7 C;  1V80 A;  1W1H A;  1BAK A;  4HCN B;  3SFE B;  2IDY A;  1TS3 A;  4ARI A;  3DXD A;  3KY9 A;  3HSA A;  1EU3 A;  4NJC A;  1UH6 A;  3SO6 A;  1RFA A;  4MDK E;  2CU3 A;  3A1Q B;  2FAZ A;  4GDK B;  2LFI A;  4HVB A;  1K5D B;  1WM3 A;  3FKY A;  2ZCB A;  1JRO A;  1ACC A;  3OHM B;  5IAA C;  2N0Y A;  3NVZ A;  4KKI A;  4CHM A;  2J7Q B;  4WH4 A;  4KHO A;  2WWZ A;  4OVZ A;  1U29 A;  3PRZ A;  4WSF A;  2BYE A;  1F9J A;  2Y8G A;  1U5D A;  4GMX B;  4GU2 A;  4M0W A;  1IBX A;  3NVY A;  1XEE A;  4WQO B;  3UGB B;  2IYB A;  4ZHO A;  4OT1 A;  3BWU D;  4P16 A;  2YSZ A;  4AP4 C;  4WIP A;  2AWT A;  5DHA B;  4W9F A;  2W9N A;  5D3V A;  1HTQ A;  3NWD A;  5C3J B;  3L0W B;  3HVD A;  4GDL B;  2NTS A;  5JP4 A;  2VSZ A;  4UDU C;  4DHZ E;  5LON B;  2VRR B;  1NYQ A;  4HDO A;  2W3S A;  3VVW B;  4GOU A;  4NPN A;  2KFK A;  4GGQ A;  4HB3 B;  2N1W A;  3H6N A;  1YJJ A;  3SUZ A;  1XOD A;  3ODO A;  4N6E B;  2UZR A;  1ZW7 A;  4AS1 A;  1FXT B;  2NBV A;  2R09 A;  4KV2 A;  2YEP F;  2OJW A;  2JZ3 B;  5EE1 A;  1FIQ A;  4EKU A;  1X05 A;  2M38 A;  1Z5S B;  1ZKH A;  1ZPS A;  3DDC B;  3VUW A;  2LXC A;  3ULC A;  1TS2 A;  2D9Y A;  5HG2 A;  4F7Z A;  3DPD A;  1WMH A;  1FO4 A;  1S1Q B;  2I1K A;  5D3W A;  3DVN V;  2DTC A;  3MDB C;  3PRM B;  2GMI C;  2X38 A;  3UQB A;  2V1Y A;  2RVB B;  5E6N A;  5KHO A;  4NZL B;  1V97 A;  1KJT A;  2KLG A;  2FE8 A;  1WGG A;  3PLU A;  2WU2 B;  4OVV A;  1SBB B;  3PHW B;  2AL6 A;  2LEK A;  4MT5 A;  5EE0 A;  4XE0 A;  3OWE B;  3EFU A;  2FJL A;  4HAY B;  1V5T A;  2WX0 A;  3GS2 A;  4F1S A;  2LGI A;  3Q3O C;  1FHW A;  1YN3 A;  3NG0 A;  2I5C A;  5G5H A;  2H7E A;  2WU5 B;  3PO0 A;  3NWA A;  1V6E A;  3AE4 B;  5G2N A;  3L17 A;  1E10 A;  3E9P A;  4ILG B;  3BII D;  1K8R B;  5DI9 B;  1E90 A;  1L6U A;  3HVZ A;  3P1M A;  3N9Y C;  3ALB A;  3P63 A;  1WG7 A;  2WXG A;  2KWV B;  1OY2 A;  2D3G A;  3UIO B;  1B1Z A;  3VIA A;  4H2A A;  3C8Y A;  2WNM A;  1AN8 A;  5FR3 A;  3DVG X;  1FM0 D;  1GOZ A;  4NSW A;  4RGN A;  1NU2 A;  2YT2 A;  4PQ0 A;  5IA7 A;  1ZSQ A;  2JF5 A;  3I3T B;  2FUH B;  3AU4 A;  1NDD A;  1WX7 A;  2Z13 A;  2MBQ A;  2YT1 A;  4B6H A;  3TFM A;  3GZN I;  3U12 A;  4BBK A;  3V6E B;  1I4R A;  4DHJ B;  2ZCC A;  3TVV A;  4XWW A;  4YTM B;  4HB4 B;  2DKQ A;  2RGF A;  1QF6 A;  2KQ7 A;  2K25 A;  4ANV A;  5D3X A;  2NTT A;  2ASQ A;  3A33 B;  2ROV A;  1N60 A;  1Q67 A;  4MSM B;  2KTR A;  2Y5P A;  1V89 A;  1SGH A;  3AI5 A;  1VCB A;  3DXE A;  4IDI A;  1NVL A;  4L1R A;  1PGX A;  5E6J A;  3OAW A;  1WJ1 A;  1L5P A;  1BXT A;  4RF0 A;  4A90 A;  5DPR A;  2MH7 A;  4H8S A;  4L2Y A;  1VBG A;  4NAW B;  2WXH A;  3RNE C;  1WY8 A;  3TEX A;  1KOT A;  2R82 A;  1HBK A;  5CLQ B;  3N1X C;  1UNP A;  2FNJ B;  3ODX A;  3RNF C;  1BML C;  1C9F A;  3FSS A;  2YEP B;  4LDT D;  2NS5 A;  1FRD A;  4AUQ C;  4IWO A;  2IJ0 A;  2LRW A;  1JWB D;  1T0R C;  1BUI C;  4G0N B;  4G11 A;  2R0D A;  4IKG A;  1SEB D;  1WFY A;  5JH5 C;  1EWY C;  1YN5 A;  2ZEQ A;  1YD8 U;  1FNU A;  2JU6 X;  1JWM D;  2PPH A;  4RM8 A;  4ICU A;  1TXD A;  1FOE A;  2K5P A;  4MGY E;  3VUX A;  4DHJ D;  1CQV A;  2HRJ A;  4IOI E;  3HM6 X;  3QCA A;  1KH0 A;  1UEL A;  4GLS C;  2BS3 B;  2Z0P A;  2AX5 A;  4ZRI A;  1WE6 A;  2VKI A;  1ST7 A;  4F7U P;  3WYF B;  3MPX A;  3H1U A;  2QIL A;  4XX5 A;  4PS8 A;  2COF A;  4GN1 A;  2DAF A;  2N7E A;  4AOF A;  2Z14 A;  5DPS A;  4DBG A;  5CHW A;  3LB8 C;  4M0W B;  1IBX B;  3TCA A;  2EKI A;  3TEW A;  3Q2A C;  4IFS A;  2CHX A;  2MW5 A;  4EZL A;  2DN6 A;  1M4V A;  3SU8 X;  2IND C;  4WJP A;  4NQK E;  1XT9 B;  2RDG A;  4WQM A;  1NEK B;  2ZVN A;  3V62 A;  3AEF B;  3NWF A;  1WGR A;  1KLV A;  1DIK A;  4GOC A;  3AV8 A;  1WXA A;  2GB1 A;  3B1L X;  3PZ8 A;  4B9K A;  1J0W A;  1AAR A;  1KLU D;  4XWX A;  1T5X D;  4OZA A;  2KAN A;  2LGY A;  1P9D U;  3DBH B;  1L0V B;  3KYC D;  4E74 A;  3WAN A;  4L23 A;  3Q8F A;  1V86 A;  3U30 A;  2NBV B;  2CB8 A;  2P0F A;  4ANU A;  4MJS A;  2HJ8 A;  3E66 A;  5L95 C;  3RT3 B;  1K51 A;  2LZ6 A;  2BB5 A;  1MAI A;  3QJZ A;  1L0Y B;  2YS1 A;  4C0A A;  3GE3 C;  4TUU A;  1E8Z A;  3BZD B;  2FDQ A;  2L0F A;  5DHF B;  2GBN A;  1SE9 A;  3W1S C;  3FEH A;  3ZKJ C;  2N9E B;  4JKE A;  1ACA A;  2G3Q B;  3TO1 A;  3PT2 B;  2KAJ A;  4CSQ A;  5EE3 A;  2DHI A;  2IO1 B;  1Y8R C;  3R8B A;  1U5F A;  3P4R B;  4DDG D;  4JK9 A;  2JYE A;  3AE8 B;  2KKC A;  2GOW A;  2VZK D;  3AEG B;  4HJK A;  2KIG A;  4FXC A;  4ZDV A;  5D3I B;  2G4D B;  3E9L A;  3HIE A;  2N4F A;  2PLP A;  3P42 A;  4MM3 A;  1UNS A;  3R2T A;  2ZPN A;  2L0T A;  3EC8 A;  1N63 A;  2Z0D B;  3EPY A;  1QKZ A;  1TBE A;  1XLN A;  2J0M A;  2J0J A;  1V5U A;  2LOX A;  2V0G A;  1WE7 A;  3B2F A;  1V88 A;  1AWD A;  1UPQ A;  4JQW C;  2VRW B;  1GAQ B;  2WXN A;  4MGK E;  4HCP B;  3V5W A;  2DAJ A;  1N5X A;  3BY4 B;  3Q3M C;  5FKA C;  2PMV A;  3BIN A;  2QKM A;  1P0R A;  4MAC A;  1HTO A;  2DYM A;  2RSG A;  3KYD D;  3ML9 A;  2N0S B;  3IVF A;  2GCJ A;  3MHZ A;  4FJZ A;  4RH6 A;  2INC C;  1MIX A;  1XQQ A;  5J3Y A;  3Q14 C;  2IY0 B;  3IT6 B;  4NQL B;  2K22 A;  3M1I B;  3Q69 A;  5MPO A;  1M7E A;  3JSV A;  1HE8 A;  4FHJ A;  1LB1 A;  3VDZ A;  1I7H A;  3QX1 A;  3N7C A;  2KYW A;  1EVH A;  3GYO A;  3TJP A;  3C0R B;  3U2S C;  1CJE A;  2RPV A;  2QC8 A;  2KTR B;  5AZG A;  2WXJ A;  2GI9 A;  1BT0 A;  1R4N B;  3DBR B;  5JLJ B;  1XLO A;  1YMH E;  2LVQ A;  1OEY J;  4JKB A;  1NTY A;  3ZNI D;  1M7R A;  2DLW A;  1YIW A;  3R2I A;  1DRO A;  4GNK B;  2CHZ A;  2N7D A;  1MHH E;  1ZXI A;  2MBE A;  4WJN A;  1V8C A;  2FCM A;  4BAX A;  1TGZ B;  2DWQ A;  4JX1 C;  4O1N A;  3KH0 A;  2MKR A;  1D5X C;  3SV1 A;  3ML4 A;  3J9C A;  3QBV B;  1GUA B;  3N30 A;  2PEA A;  1N3H A;  4HKQ A;  2GJY A;  1WRD B;  3RZF A;  3AE7 B;  1P7F A;  2NBW B;  4ILJ A;  1BTN A;  2D10 A;  1E8Y A;  5HE3 A;  4W9D A;  3NVV A;  1F2R C;  1WJ6 A;  1RAX A;  2COD A;  2KLC A;  4QJ5 B;  2G35 A;  4WJO A;  1FGY A;  1ZP0 B;  3QK0 A;  2W2W A;  2YS5 A;  2BKF A;  4GZU A;  2IY1 B;  4ZRK A;  1XR0 B;  4YON A;  2MSE D;  3AU5 A;  1HEZ E;  2GBK A;  2WYQ A;  4L1B A;  1OQQ A;  2KR0 A;  3Q8B A;  3WAP A;  2MRP A;  4M8N A;  5I2S A;  3APC A;  1N5W A;  1CK1 A;  3ZRC A;  2LHE A;  4K7S A;  4P1C C;  4J3O D;  3EA6 A;  3Q6B A;  5C5B B;  2RNR B;  1K5G B;  1L6V A;  1MPE A;  1VZ8 A;  2DHZ A;  4C7Y A;  1NVI D;  2CY5 A;  4IAP A;  4NJ7 A;  3JYU A;  1XF5 L;  3ZJT A;  2JT4 B;  1WGQ A;  2AQ3 B;  2GLS A;  2WXM A;  3PLV A;  3SHQ A;  4DXF A;  1C76 A;  2OQB A;  1UZX B;  2KJH B;  2WX1 A;  1GB4 A;  4NNJ B;  3DXC A;  3R66 C;  2DZM A;  2JVC A;  2VH2 A;  3M62 B;  4IWQ A;  2RD0 A;  3D8F A;  2D3C A;  2WXP A;  1H10 A;  3CWI A;  4XDD A;  2J59 M;  1UGM A;  3RNA C;  1Q5W B;  4OW0 A;  5KHQ A;  4K3B A;  2JYT A;  2GBR A;  2K6D B;  5IRS A;  1TKG A;  4GPT B;  3PZ7 A;  1WVH A;  1XKE A;  3Q8E A;  2M4N A;  4WWM A;  1KTK A;  2WS3 B;  3TMP B;  3VOQ A;  1QT9 A;  1KF6 B;  2D4Q A;  2CR5 A;  2X8X X;  4EZJ A;  4IUM B;  1J19 A;  2BT6 A;  1XLQ A;  1YN4 A;  2RGN B;  1MHX A;  4AJW A;  4HAT B;  5D6J B;  3L54 A;  2XQN M;  4KSL C;  2WGS A;  2IO2 B;  5C23 A;  2ONQ A;  1FCC C;  3OAN A;  1W1D A;  1ZOY B;  4B95 A;  2FCN A;  2C7N B;  1P6S A;  2KXJ A;  2Z59 A;  2D11 A;  2CY4 A;  1WXS A;  1TY2 A;  1CMX B;  2BYT A;  1MG4 A;  2BQQ A;  2XBB C;  3RD2 A;  2XN9 C;  3SEB A;  4A3O A;  1UNQ A;  1E8X A;  3K9P B;  3WAO A;  3VTU A;  1TJE A;  5BMH A;  3MJ5 A;  2D2Q A;  4JKA A;  3V61 A;  4MM3 B;  3SBT A;  2P0D A;  1WRI A;  5AZH A;  1F1H A;  2W54 A;  2LGD A;  2DZK A;  3GB1 A;  1TZ1 A;  1GGO A;  3AMZ A;  5C2T B;  1G6J A;  3F5R A;  1SJE D;  2WDR B;  2RUK B;  3QAQ A;  5HE0 A;  2KN5 A;  3A8P A;  2KZR A;  2H89 B;  2JZP A;  1XD3 B;  3CSF A;  4XDC A;  1T0Y A;  2WHI A;  1XCT L;  4DHZ B;  1WWT A;  3DHH C;  3URY A;  1V1P A;  3OG5 A;  2KC1 A;  3PTF C;  1XCG A;  4HK2 A;  3O96 A;  2KIE A;  3PSC A;  2RDH A;  3JSV B;  1X1G A;  3DBS A;  2KDF B;  1C4P A;  4BKT A;  2WP9 B;  3HQC A;  1EGX A;  3FC4 A;  5JVL A;  4MGI E;  2K49 A;  2CJO A;  2WDQ B;  2EMS A;  3CXB B;  2R61 A;  3RUI B;  1SIF A;  2H7D A;  3DBR I;  3IFW B;  3B9J A;  2KX0 A;  2Z0Q A;  2NPT A;  1FPY A;  2BS4 B;  3UQA A;  2BKR B;  3UZT A;  4RGT A;  2JP2 A;  4W9J A;  2PE9 A;  4KIK A;  1R4M I;  1YX6 B;  3P4Q B;  4P1B C;  3LYY A;  3VXW A;  3NVW A;  5DCN A;  2QMT A;  3VFK A;  2ZW1 A;  3WIM A;  1JWS D;  5JZE B;  5IP4 D;  2K1F A;  4MEL A;  1FMA D;  3MJW A;  1DOI A;  2GRI A;  4JKF A;  3LXF A;  3D32 A;  4KZ0 A;  5L83 A;  2ICI A;  3T8M A;  2WXQ A;  1C1Y B;  4PS7 A;  3WA0 A;  3DBL I;  3VTV A;  1FFU A;  5IO9 A;  3MFG A;  4HRS A;  1EF5 A;  4F7H A;  4EMO A;  1V5P A;  3DVG Y;  2MEK A;  4HAX B;  3E56 A;  4A6F A;  3W9C B;  2ZW0 A;  4OHJ A;  1F0Z A;  4C4V A;  1P1A A;  2L1C A;  2K8H A;  2RMM A;  2L52 A;  4BFR A;  3TL5 A;  5LOP B;  3ZIM A;  3D8E A;  1EWC A;  2BBC A;  2IGH A;  3PV1 A;  1VLB A;  5C1Z A;  4WVF B;  4US9 A;  1U5G A;  1TKE A;  3EGR A;  3R7R A;  1TKY A;  1XCQ L;  1KZ7 A;  5DPT A;  3RFZ B;  4HPM B;  1CZP A;  5TSS A;  1EU4 A;  4A20 A;  1WR1 A;  2AYO B;  4RM9 A;  1WGD A;  3W1Y A;  2REX A;  2L2I A;  1OGW A;  1C78 A;  2MCN B;  5FR6 A;  5G5G A;  5BO4 B;  2VH1 A;  4QJ3 B;  4ILH A;  4DBB A;  2LRU A;  4W9K A;  4YXD B;  1U2B A;  2KCJ A;  4PS3 A;  4JLC A;  3ABV B;  1E7P B;  5LNK 1;  1XX0 A;  4LNK A;  3FLV A;  5CHF A;  4ZRJ A;  3RNC C;  3ZQ4 A;  1PUT A;  4YT0 B;  2KQ4 X;  5I4D A;  1XXG A;  3N1Y C;  2BF8 B;  5I2M A;  4HSI A;  1GNU A;  1JRU A;  1I4G A;  1E9M A;  5EDS A;  1X11 A;  2MDX A;  3MHS D;  5BYQ A;  2DYN A;  3MTN B;  3PRE A;  1V1O A;  3ZGZ A;  2O2V A;  1MVK A;  4RGM A;  4LK0 M;  5BYR A;  2OOB B;  4A3P A;  4S17 A;  3L16 A;  3PVW A;  5H8Y E;  2CKH B;  3AED B;  3SBG A;  1K52 A;  2YLM A;  4P7I A;  2LAS A;  4MK0 A;  3VUY A;  2A5U A;  4R3D A;  4W9E A;  2KGX B;  4K3C A;  1ZUD 2;  3Q3J A;  1NTI A;  4REZ A;  2Z59 B;  3HW2 B;  3DHG C;  1C79 A;  1IGD A;  4PT5 A;  3TSS A;  1ROE A;  3I57 A;  4GSW A;  2D07 B;  2COC A;  2C60 A;  2FJU B;  2H88 B;  4FAD A;  4RMA A;  4RGO S;  1X86 A;  3QIJ A;  1F2R I;  1D3Z A;  4BBN F;  3WAL A;  2BCJ A;  4EUT A;  3ZNH B;  3T3N A;  2W2X C;  2K8C A;  1IP9 A;  2QKL A;  3ZVR A;  2J42 A;  2K6Q A;  2M1M A;  4MT7 A;  4NY0 A;  1RM6 C;  3IG3 A;  1TT5 B;  4BBN C;  2N23 A;  1U5E A;  2HE7 A;  1SJH D;  1FRR A;  2DYQ A;  3PSE B;  4Q2J A;  3W2D A;  2V3N A;  1LQB A;  2P8V A;  2LGS A;  1QLB B;  3ZTD A;  2M8S A;  5C5B A;  2X0S A;  1V1P B;  3ZDT A;  1ZGU B;  3BK2 A;  1OFF A;  3ZJV A;  3ZO5 B;  1V5O A;  4HJG E; 
#chains in the Genus database with same CATH homology
 4PNK A;  3U8Z A;  1FGZ A;  2JPH A;  4Z2M B;  5G55 A;  2FCQ A;  4EJN A;  1I35 A;  1EUV B;  2K2U A;  3BJI A;  3HK0 A;  2KD0 A;  4FN2 A;  2LBB A;  2NPT B;  1EF1 A;  2DZJ A;  4IM2 A;  4KIK B;  3VQI A;  1UPR A;  2UZS A;  2KC2 A;  3A9J A;  3PEG A;  3O65 B;  3QWM A;  3ZDM C;  2MFQ A;  1RLF A;  2N9P C;  3F0W A;  2MQJ A;  2KJ6 A;  1ZC3 B;  2NBU A;  1OQY A;  3OJ4 B;  1NTV A;  1KM7 A;  2V76 A;  1WZ3 A;  3CST A;  2CRF A;  2LVO A;  4A6F B;  1WZ0 A;  2DX5 A;  2K8B A;  2V4L A;  2L7R A;  3KRX A;  4DX9 0;  1SHC A;  4CHJ A;  2MP2 A;  1ZC4 B;  1MK7 B;  1WR6 E;  4WWO A;  4MEM A;  4K2P A;  3AUL A;  3SNH A;  1J0G A;  1DYN A;  2IYD B;  2B3A A;  4KAX B;  3JVZ X;  2KVR A;  2XK5 B;  1WXM A;  1WGU A;  3L10 B;  4ANW A;  4DX8 A;  2DIK A;  2ZNV C;  4D0N B;  2MLB A;  1MK9 B;  3VAW A;  4WWP A;  2K39 A;  3ZVV A;  1WI0 A;  5HE2 A;  1WI1 A;  4MGZ E;  3OLM D;  1AWE A;  5GOW B;  4JKC A;  2O2V B;  1FB8 A;  3DOW A;  1WH3 A;  2R2Q A;  1E8W A;  1KC7 A;  4TQ1 A;  4II2 B;  2DHJ A;  2YVC A;  1BWN A;  2W2X D;  1UNR A;  2DHK A;  1A5R A;  4JKH A;  2KDE B;  4ICV A;  1WGH A;  4K81 A;  5J17 A;  2KDI A;  2BYF A;  2GBM A;  1HB6 A;  1RRB A;  1B55 A;  4JKG A;  4HXD A;  1VBH A;  4GB9 A;  4HB0 B;  1Q1O A;  2O6V B;  4HAU B;  3KW5 B;  4F8C B;  3KSY A;  2X18 A;  4W9L A;  2ZPY A;  2J0K A;  2G45 B;  2JUO A;  3DCG A;  5TR5 A;  4WJQ A;  2HTH A;  3VHT C;  1J8C A;  2LI5 A;  4FUL A;  2KUP A;  3PHX B;  4WAA A;  3PZD A;  3L08 A;  4GMV A;  3A8Q A;  1V9J A;  2IO3 B;  2KOX A;  3R3M A;  2CQU A;  3QHT A;  1DDM A;  2MX2 A;  4HAV B;  1WJM A;  4HLE A;  2KFJ A;  4TQ0 A;  1NI2 A;  2ZNV B;  3GYP A;  1ISN A;  4PYU A;  3V6C B;  3CMM B;  5D3Y A;  2OTX A;  1LW3 A;  2COA A;  3PRP B;  3VH4 B;  2MA9 B;  2ADZ A;  1MPH A;  2CAY A;  2C5L C;  1IRS A;  4K17 A;  3DBH I;  2FID A;  4Z2N A;  2NR2 A;  3A9J B;  5JHA A;  3H7S A;  2LYD A;  2KWU B;  3PP2 A;  4KHB B;  5AEK B;  3M63 B;  4LCD E;  2D9V A;  2NCN A;  3QC8 B;  3A9K A;  2WDT B;  2DX5 B;  1WX9 A;  1ZVR A;  2KX3 A;  3PG7 A;  1WJN A;  3PPA A;  3SDL C;  5JHG A;  4BVU C;  4M8M A;  2MP2 B;  1LM8 B;  3PGE A;  2NZ8 B;  4IG7 B;  4WWN A;  4NJ6 A;  2M14 A;  1YJ1 A;  2DA0 A;  3RCZ A;  1IYF A;  4HAZ B;  1UBQ A;  2C7M B;  1V5M A;  2AEH A;  2IBI B;  3PVU A;  4L6E A;  3FM8 C;  1EO6 A;  3ZRF A;  1GC7 A;  3M3J A;  2RPQ A;  2LJ5 A;  1DBH A;  5DPW A;  4IM3 A;  2ABD A;  2D9Z A;  3APF A;  5KQ1 A;  2JZZ A;  2LD9 A;  2E2X A;  4W9C A;  4JK7 A;  2WH5 A;  3FP5 A;  2Y7B A;  3HIZ A;  1PFJ A;  3EEC A;  2LG1 A;  1R4N I;  4B6W A;  3X0W A;  2OJR A;  2Y8F A;  4XC2 A;  2ELB A;  2DZI A;  2EKE C;  4JL9 A;  4KDI C;  4W9H A;  1YX5 B;  2A4Z A;  1DDV A;  4KSK C;  3X23 A;  2UWQ A;  4CHK A;  3E9O A;  5FI1 A;  3RZW C;  1QQG A;  1GG3 A;  4G3X B;  4EFO A;  3GOE A;  2LXA A;  2KO3 A;  5LXH A;  5C16 A;  3B0A A;  2MBB B;  2N1V A;  4BOZ B;  1UBI A;  1FHO A;  4JKG B;  2CU1 A;  2QHO A;  3ONS A;  1H8C A;  5J3T A;  2UVM A;  1V2Y A;  1XD4 A;  2V3S A;  1X1F A;  3TW1 A;  3ODW A;  1RJ2 A;  1OQN A;  2XEW A;  4K7W A;  3WAM A;  1JDE A;  4IM0 A;  2RQ1 A;  1Y5O A;  1QZE A;  5D2M B;  2BGF A;  2HTH B;  5GMV A;  4E3C A;  3LDZ E;  3APD A;  2KMC A;  1RRP B;  3PVL A;  2FCS A;  4IOY X;  4JK8 A;  3H7P A;  3AXC A;  3D8D A;  5HE1 A;  3QA8 A;  3Q3F A;  2L3Z A;  2K00 A;  3RYT A;  2XK5 A;  5KCV A;  2KJR A;  2PZ1 A;  2IFS A;  3QQ8 B;  3ENB A;  5LXI B;  1X1M A;  3VTW A;  2GBJ A;  4DXA B;  3ULB A;  3A98 B;  4LDT B;  3ZLZ A;  1WJU A;  1MKE A;  4KZC A;  4FLH A;  4I6N B;  1I2H A;  4TV3 A;  1L7Y A;  5DH9 B;  4KVG B;  2NMB A;  3ENE A;  2I1J A;  2KWC A;  2IO0 B;  4W9G A;  3SYX A;  1E5W A;  4HWI B;  1WM2 A;  1FHX A;  2KK8 A;  1GJZ A;  1KBL A;  3LJU X;  2L00 B;  5D7G A;  3PS6 A;  3CF6 E;  3A9K B;  1H4R A;  2L8J A;  1C3T A;  4FJV B;  2RLO A;  2EJ8 A;  3LJ3 A;  1UEF A;  3IBE A;  1QC6 A;  2Q13 A;  4TKN A;  3NZS A;  4MSQ B;  3SD5 A;  2JXX A;  3UF8 A;  3ZNG C;  1PMS A;  2M17 A;  3B08 A;  3KVF B;  4X57 B;  2BWE S;  4I6P A;  3A4S C;  4IW0 A;  2O6V A;  4G50 A;  4KDL B;  1Y19 B;  2IZV B;  2RR9 A;  2PJH A;  3W1S A;  2N9X A;  4HPL B;  1ZM0 A;  4BKS A;  2AL3 A;  2C9W B;  3TBL D;  2RSU A;  2ZZP B;  3V60 A;  4XZ4 A;  1WIA A;  3DVN U;  1OEY A;  5LLI A;  5J2R A;  4Y94 A;  1S3S G;  3M95 A;  2DYO A;  3NS8 A;  5JHH A;  3UIN B;  2G4S A;  1MG8 A;  4CO7 A;  4JIO U;  3KUC B;  4K2O A;  1MIZ B;  2FIF A;  4EEW A;  2CHW A;  2M0X A;  2L76 A;  1WYW B;  2R2O A;  1TQZ A;  4HHV A;  5FI0 A;  5D94 A;  1LXD A;  4II3 B;  1W1G A;  5C6R A;  3HM3 A;  3OJ3 A;  3DQV A;  2EC1 A;  3P7Z A;  5E6O A;  1YQB A;  3A4R A;  1L2N A;  3ZNZ B;  3T9L A;  2KFK B;  1VD2 A;  4OVU A;  3S2A A;  1P98 A;  2Y5B B;  3ZUN A;  4BOS C;  1U4A A;  2GCL A;  2DEN B;  1FAO A;  3ML8 A;  3UIP B;  2JRH A;  2K2J A;  1WMH B;  2YF0 A;  5CTR C;  2BYV E;  4FHK A;  2C7H A;  4IC7 B;  1UD7 A;  2LGX A;  2DYB A;  1TTN A;  4MH0 E;  2Z0O A;  2KQS A;  5J3Q A;  2MBO A;  4W9I A;  3G9W A;  3H7P B;  3CIK A;  5KQ4 A;  2KMA A;  2LUE A;  3T06 A;  1V61 A;  4PYZ A;  3P6A A;  5J18 A;  4BKG A;  3A1Q A;  4GDK A;  5CHV C;  3N32 A;  2YT0 A;  2KHW B;  3TIX A;  2NVU I;  3NSU A;  1OTR B;  4J6I A;  3ZW3 A;  2JWZ A;  3NY5 A;  2P0H A;  1IPG A;  1WJ4 A;  3NZU A;  5EFX A;  4A5K A;  4DDI D;  2CS4 A;  4FJY A;  3QWZ B;  1Q0W B;  4HDQ A;  1P3R A;  1GC6 A;  3JW0 X;  3H9D A;  3L13 A;  3AJ4 A;  2L05 A;  1AQC A;  2LWP A;  4WJ7 A;  4TYZ A;  1BTK A;  4GDL A;  4ANX A;  3NHE B;  4N9F 4;  4ZYN A;  5CLL B;  4YL8 A;  4ASW C;  2D9W A;  2Z0E B;  1U27 A;  1WX8 A;  1M94 A;  2DKP A;  3VH3 B;  1DDW A;  4JGH B;  1I7A A;  4F7G A;  3HHM A;  4LJO B;  5DIF B;  2COP A;  5IJM A;  2UYZ B;  4DWF A;  4E71 A;  3KUZ A;  2MWN B;  4A6K A;  4KHA A;  3RUL A;  2BPS A;  2FJ9 A;  1WF9 A;  2DX1 A;  4JKD A;  3IHP C;  4FA6 A;  3KRW A;  2LUL A;  2LOZ A;  3P2B A;  4FBJ B;  4AJY B;  3RCP A;  4K7U A;  2MWS B;  4EOY A;  1V81 A;  2KDB A;  4HAW B;  1NBF C;  2LKO A;  1E7U A;  2LVP A;  3ECI A;  1TJ6 A;  1PLS A;  2YS3 A;  1Z2M A;  4HB2 B;  2YRY A;  3K9O B;  4CYE A;  3ZTC A;  5D27 A;  1HB8 A;  2DFK A;  2O6V D;  2ZVO A;  4MY6 A;  2EMT A;  1EAZ A;  3NOB A;  4K1R B;  4BKS D;  5E6P A;  4GIV A;  2PE6 B;  4URK A;  1WGY A;  5L81 A;  2BWF A;  4EZK A;  2D9X A;  4GXB A;  1I42 A;  5HKH A;  4MJS B;  3KZ1 A;  1PQS A;  3EHV A;  4IWP A;  4A6H A;  3QAR A;  1P5T A;  2KTF A;  5AZF A;  2KNB A;  3KUD B;  2HD5 B;  5C79 A;  1V49 A;  3N3K B;  1P3Q U;  4I6L B;  4NAW A;  2ELA A;  4AWJ A;  3R7Q A;  2I5F A;  2MBH A;  1Z87 A;  2GS0 A;  2ROZ B;  2JY6 A;  5JHB A;  1LFD A;  1OMW A;  1KI1 B;  3U7D A;  2ZJD A;  4LJP B;  1KZG A;  1WXV A;  2JRI B;  1E7V A;  4DK5 A;  5CX3 A;  1V80 A;  1W1H A;  1BAK A;  4HCN B;  3DXD A;  3KY9 A;  1UH6 A;  3SO6 A;  1RFA A;  4MDK E;  3A1Q B;  2FAZ A;  4GDK B;  4HVB A;  1K5D B;  1WM3 A;  2ZCB A;  5IAA C;  2N0Y A;  4CHM A;  2J7Q B;  4KHO A;  2WWZ A;  1U29 A;  3PRZ A;  4WSF A;  2BYE A;  1F9J A;  2Y8G A;  1U5D A;  4GMX B;  4GU2 A;  4WQO B;  3UGB B;  2IYB A;  2YSZ A;  4AP4 C;  2AWT A;  5DHA B;  4W9F A;  2W9N A;  5D3V A;  3L0W B;  4GDL B;  5JP4 A;  2VSZ A;  4DHZ E;  5LON B;  2VRR B;  4HDO A;  3VVW B;  4NPN A;  2KFK A;  4GGQ A;  4HB3 B;  2N1W A;  3H6N A;  3SUZ A;  1XOD A;  3ODO A;  2UZR A;  1ZW7 A;  1FXT B;  2R09 A;  4KV2 A;  2JZ3 B;  4EKU A;  1X05 A;  2M38 A;  1Z5S B;  1ZKH A;  3DDC B;  3VUW A;  2LXC A;  3ULC A;  2D9Y A;  4F7Z A;  3DPD A;  1WMH A;  1S1Q B;  2I1K A;  5D3W A;  3DVN V;  2DTC A;  3MDB C;  3PRM B;  2GMI C;  3UQB A;  2V1Y A;  2RVB B;  5E6N A;  5KHO A;  1KJT A;  2KLG A;  1WGG A;  3PLU A;  4OVV A;  3PHW B;  2AL6 A;  3EFU A;  2FJL A;  4HAY B;  1V5T A;  2WX0 A;  4F1S A;  1FHW A;  2I5C A;  2H7E A;  1V6E A;  5G2N A;  3L17 A;  3E9P A;  4ILG B;  1K8R B;  5DI9 B;  1E90 A;  3ALB A;  1WG7 A;  2KWV B;  1OY2 A;  2D3G A;  3UIO B;  3VIA A;  3DVG X;  4NSW A;  1NU2 A;  4PQ0 A;  5IA7 A;  1ZSQ A;  2JF5 A;  3I3T B;  2FUH B;  3AU4 A;  1NDD A;  1WX7 A;  2MBQ A;  2YT1 A;  4B6H A;  3TFM A;  3GZN I;  4BBK A;  3V6E B;  4DHJ B;  2ZCC A;  3TVV A;  4HB4 B;  2DKQ A;  2RGF A;  2KQ7 A;  2K25 A;  4ANV A;  5D3X A;  2ASQ A;  3A33 B;  2ROV A;  1Q67 A;  4MSM B;  2KTR A;  1V89 A;  1SGH A;  3AI5 A;  1VCB A;  3DXE A;  1NVL A;  3OAW A;  1WJ1 A;  5DPR A;  4H8S A;  1VBG A;  4NAW B;  1WY8 A;  1KOT A;  2R82 A;  1HBK A;  5CLQ B;  1UNP A;  2FNJ B;  3ODX A;  3FSS A;  4LDT D;  2NS5 A;  4AUQ C;  4IWO A;  2LRW A;  4G0N B;  4G11 A;  2R0D A;  1WFY A;  5JH5 C;  2ZEQ A;  1YD8 U;  2PPH A;  4RM8 A;  4ICU A;  1TXD A;  1FOE A;  4MGY E;  3VUX A;  4DHJ D;  2HRJ A;  3HM6 X;  3QCA A;  1UEL A;  2Z0P A;  4ZRI A;  1WE6 A;  2VKI A;  1ST7 A;  4F7U P;  3WYF B;  3MPX A;  3H1U A;  4XX5 A;  4PS8 A;  2COF A;  4GN1 A;  2DAF A;  2N7E A;  4AOF A;  5DPS A;  4DBG A;  5CHW A;  4M0W B;  3TCA A;  4IFS A;  2CHX A;  2MW5 A;  4EZL A;  2DN6 A;  3SU8 X;  4WJP A;  4NQK E;  1XT9 B;  2ZVN A;  3V62 A;  1WGR A;  1KLV A;  1DIK A;  4GOC A;  1WXA A;  3B1L X;  4B9K A;  1J0W A;  1AAR A;  4XWX A;  2KAN A;  2LGY A;  1P9D U;  3KYC D;  4E74 A;  3WAN A;  1V86 A;  3U30 A;  2NBV B;  2CB8 A;  2P0F A;  4ANU A;  4MJS A;  2HJ8 A;  3E66 A;  5L95 C;  3RT3 B;  2LZ6 A;  1MAI A;  3QJZ A;  2YS1 A;  4C0A A;  4TUU A;  1E8Z A;  2FDQ A;  2L0F A;  5DHF B;  2GBN A;  1SE9 A;  3W1S C;  3FEH A;  3ZKJ C;  2N9E B;  4JKE A;  1ACA A;  2G3Q B;  3TO1 A;  3PT2 B;  2DHI A;  2IO1 B;  1Y8R C;  1U5F A;  4DDG D;  4JK9 A;  2KKC A;  2GOW A;  4HJK A;  4ZDV A;  2G4D B;  3E9L A;  4MM3 A;  2N4F A;  2ZPN A;  2L0T A;  3EC8 A;  2Z0D B;  3EPY A;  1TBE A;  2J0M A;  2J0J A;  1V5U A;  2LOX A;  1WE7 A;  1V88 A;  1UPQ A;  4JQW C;  2VRW B;  4MGK E;  4HCP B;  3V5W A;  2DAJ A;  3BY4 B;  3BIN A;  2QKM A;  1P0R A;  2DYM A;  2RSG A;  3KYD D;  3ML9 A;  3IVF A;  2GCJ A;  4FJZ A;  1MIX A;  1XQQ A;  5J3Y A;  2IY0 B;  4NQL B;  3M1I B;  1M7E A;  3JSV A;  1HE8 A;  4FHJ A;  1LB1 A;  3VDZ A;  3QX1 A;  3N7C A;  1EVH A;  3GYO A;  3TJP A;  3C0R B;  2KTR B;  5AZG A;  1BT0 A;  5JLJ B;  2LVQ A;  1OEY J;  4JKB A;  1NTY A;  3ZNI D;  1M7R A;  2DLW A;  1YIW A;  1DRO A;  2CHZ A;  2N7D A;  2MBE A;  4WJN A;  2FCM A;  1TGZ B;  3KH0 A;  2MKR A;  3SV1 A;  3ML4 A;  3QBV B;  1GUA B;  3N30 A;  2PEA A;  1N3H A;  2GJY A;  1WRD B;  3RZF A;  2NBW B;  4ILJ A;  1BTN A;  2D10 A;  1E8Y A;  5HE3 A;  4W9D A;  1WJ6 A;  1RAX A;  2COD A;  2KLC A;  2G35 A;  4WJO A;  1FGY A;  3QK0 A;  2W2W A;  2YS5 A;  2BKF A;  4GZU A;  2IY1 B;  4ZRK A;  1XR0 B;  4YON A;  2MSE D;  3AU5 A;  2GBK A;  2WYQ A;  3WAP A;  2MRP A;  4M8N A;  3APC A;  3ZRC A;  4K7S A;  5C5B B;  2RNR B;  1K5G B;  2DHZ A;  2CY5 A;  4IAP A;  4NJ7 A;  3JYU A;  2JT4 B;  1WGQ A;  3PLV A;  3SHQ A;  2OQB A;  1UZX B;  2KJH B;  2WX1 A;  4NNJ B;  3DXC A;  3R66 C;  2DZM A;  2JVC A;  4IWQ A;  3M62 B;  2RD0 A;  3D8F A;  1H10 A;  2J59 M;  1UGM A;  1Q5W B;  5KHQ A;  2GBR A;  2K6D B;  4GPT B;  1WVH A;  1XKE A;  2M4N A;  3TMP B;  3VOQ A;  2D4Q A;  2CR5 A;  4EZJ A;  4IUM B;  1J19 A;  2RGN B;  4AJW A;  4HAT B;  5D6J B;  3L54 A;  2XQN M;  4KSL C;  5C23 A;  2IO2 B;  3OAN A;  1W1D A;  4B95 A;  2FCN A;  2C7N B;  1P6S A;  2KXJ A;  2D11 A;  2CY4 A;  1WXS A;  1CMX B;  2XBB C;  3RD2 A;  4A3O A;  1UNQ A;  1E8X A;  3K9P B;  3WAO A;  3VTU A;  2D2Q A;  4JKA A;  3V61 A;  3SBT A;  2P0D A;  5AZH A;  2LGD A;  2DZK A;  1TZ1 A;  1GGO A;  1G6J A;  3F5R A;  2RUK B;  3QAQ A;  5HE0 A;  2KN5 A;  3A8P A;  2KZR A;  1XD3 B;  3CSF A;  1T0Y A;  4DHZ B;  2KC1 A;  3PTF C;  1XCG A;  4HK2 A;  3O96 A;  3PSC A;  3JSV B;  1X1G A;  3DBS A;  2KDF B;  4BKT A;  3HQC A;  1EGX A;  5JVL A;  4MGI E;  2EMS A;  3CXB B;  3RUI B;  1SIF A;  2H7D A;  3DBR I;  3IFW B;  2KX0 A;  2Z0Q A;  2NPT A;  3UQA A;  2BKR B;  3UZT A;  2JP2 A;  4W9J A;  2PE9 A;  4KIK A;  1R4M I;  1YX6 B;  3VXW A;  5DCN A;  3VFK A;  3WIM A;  5JZE B;  2K1F A;  4MEL A;  3MJW A;  4JKF A;  3D32 A;  4KZ0 A;  5L83 A;  3T8M A;  1C1Y B;  4PS7 A;  3WA0 A;  3DBL I;  3VTV A;  1EF5 A;  4F7H A;  4EMO A;  1V5P A;  3DVG Y;  4HAX B;  4A6F A;  1P1A A;  2L1C A;  2K8H A;  4BFR A;  3TL5 A;  5LOP B;  3ZIM A;  3D8E A;  3PV1 A;  5C1Z A;  4WVF B;  1U5G A;  3R7R A;  1KZ7 A;  5DPT A;  4HPM B;  4A20 A;  1WR1 A;  2AYO B;  4RM9 A;  1WGD A;  3W1Y A;  2REX A;  2L2I A;  1OGW A;  2MCN B;  5FR6 A;  5BO4 B;  4ILH A;  4DBB A;  2LRU A;  4W9K A;  1U2B A;  2KCJ A;  4PS3 A;  4JLC A;  1XX0 A;  3FLV A;  5CHF A;  4ZRJ A;  2BF8 B;  1GNU A;  1JRU A;  5EDS A;  1X11 A;  2MDX A;  3MHS D;  2DYN A;  3MTN B;  3PRE A;  2O2V A;  2OOB B;  4A3P A;  3L16 A;  3PVW A;  2CKH B;  3SBG A;  2YLM A;  4P7I A;  2LAS A;  4MK0 A;  3VUY A;  2A5U A;  4W9E A;  2KGX B;  3Q3J A;  1NTI A;  2Z59 B;  3HW2 B;  4GSW A;  2D07 B;  2COC A;  2C60 A;  4FAD A;  4RMA A;  1X86 A;  3QIJ A;  1D3Z A;  4BBN F;  3WAL A;  2BCJ A;  4EUT A;  3ZNH B;  2W2X C;  2K8C A;  1IP9 A;  2QKL A;  3ZVR A;  2K6Q A;  2M1M A;  4MT7 A;  4NY0 A;  3IG3 A;  4BBN C;  2N23 A;  1U5E A;  2HE7 A;  3PSE B;  2DYQ A;  1LQB A;  2P8V A;  3ZTD A;  2M8S A;  5C5B A;  2X0S A;  3ZDT A;  1ZGU B;  3ZO5 B;  1V5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...