4ZRJA

Structure of merlin-ferm and ctd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Merlin
total genus 88
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrjA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrjA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrjA01
3CF6E 1P9DU 4FULA 5LONB 2DZJA 3KUZA 3DVNU 3B08A 3UQAA 2COFA 1UZXB 3WAOA 2Y5BB 1V9JA 4TQ0A 4XWXA 1P3RA 2UYZB 1V61A 2JWZA 3X0WA 3QAQA 2I1KA 2M0XA 3TMPB 3ZW3A 2MA9B 4MELA 3FEHA 1V5UA 1DDMA 2ROZB 1WGHA 1WXSA 2OOBB 5CHFA 3VTWA 2V4LA 3OJ3A 2BF8B 2LWPA 2P0FA 3PLVA 3SU8X 2LZ6A 4MGZE 3VIAA 4MM3A 2CY4A 4NSWA 5JHHA 3PRZA 2M38A 4F7ZA 1FOEA 2KLCA 1ZKHA 4URKA 4KAXB 4FHKA 2KX0A 4BFRA 2NPTB 2R09A 3QA8A 1WMHA 4W9FA 2LVOA 5GMVA 4K17A 3RZFA 4WJQA 4HAXB 2A4ZA 4WJPA 4GPTB 2LXCA 2RSUA 1AARA 1NBFC 2HJ8A 3FSSA 1YJ1A 2IYBA 3HK0A 1EUVB 2KD0A 2KWVB 1P3QU 3L16A 3PSEB 2KGXB 4B6HA 1P98A 2GBKA 3DVNV 3GZNI 4HWIB 3V6EB 1OEYJ 4HDOA 1G6JA 2ROVA 4KIKA 1U5EA 2KC1A 1E5WA 3OAWA 3EPYA 1FHXA 2EC1A 4HB4B 1XD4A 3HQCA 2KDIA 2WWZA 3PS6A 4ANUA 2R0DA 5L95C 5KQ1A 4EZJA 4JGHB 3DXCA 5DCNA 3PVUA 4LCDE 2MBOA 1UGMA 3ZVVA 3VH3B 1VD2A 1V5PA 4EFOA 3L54A 1GG3A 2LUEA 1BWNA 1KZ7A 2PZ1A 4EJNA 1WJUA 3RCPA 2YSZA 3KVFB 2WH5A 3ML8A 4GDKB 2W2XC 4G50A 3BINA 3ULBA 4NJ7A 3SUZA 4HB0B 1RRBA 2AL3A 3QJZA 3FP5A 5HE2A 2BGFA 2Z0EB 2XQNM 2I5FA 2W2WA 2RPQA 4KDLB 5C79A 2KDEB 2H7DA 3TVVA 5BO4B 3HW2B 2EKEC 4WWPA 1BT0A 1GNUA 1QZEA 1WXVA 1EAZA 2DYQA 2O6VA 2VKIA 5DH9B 3SD5A 4F7UP 1WIAA 2L05A 4FN2A 4BKTA 2JP2A 4BOSC 2W2XD 3A4RA 2I1JA 4CYEA 2NCNA 4IM2A 4A3OA 4XX5A 2KANA 1JRUA 2IO2B 4YONA 2CS4A 4KDIC 2K8CA 3KRWA 2NBUA 5C5BA 1LW3A 4KV2A 2KVRA 3EFUA 2PPHA 2KNBA 4P7IA 4YL8A 1U4AA 2KFKB 4PYZA 4II2B 1BTNA 5DHAB 3TIXA 1MKEA 5J3YA 2L0FA 1ACAA 1NTVA 5CHVC 3H7PB 4MK0A 3S2AA 1MAIA 4W9LA 4EEWA 2N0YA 4ANWA 2MWNB 3DXEA 3MJWA 4A3PA 3PZDA 3ZTDA 2FDQA 1V88A 1W1HA 3NSUA 1HBKA 1BAKA 1XQQA 2L0TA 2R2OA 5CHWA 1U2BA 2KLGA 1GJZA 5LOPB 3ZO5B 2Y8FA 4Z2NA 3QC8B 3V60A 5JZEB 3VH4B 2G4DB 2PE9A 2M4NA 1NTYA 3CSFA 3CSTA 1GC6A 2RD0A 3QQ8B 4I6LB 1OEYA 3WIMA 2FJ9A 1UNPA 4KIKB 1V5OA 3ONSA 4MDKE 1Z2MA 2C9WB 2D2QA 2J59M 1NDDA 3APDA 4W9JA 4GB9A 1U5FA 4WSFA 1Z87A 4A6KA 5E6NA 2RUKB 2RLOA 1U29A 1E8ZA 3JYUA 2ELBA 4GXBA 2M14A 4TYZA 1WI1A 1X1MA 2C7HA 2GMIC 2XK5B 3JSVB 3ZNZB 3PRMB 4MY6A 2PJHA 1DDWA 4I6PA 4K7SA 3AJ4A 3SDLC 2K6DB 3DCGA 3IBEA 3TCAA 1E8XA 2N23A 2G3QB 3B0AA 3VFKA 2FCMA 1Y5OA 4K2PA 2IY1B 2D3GA 3PVWA 2PEAA 3KYDD 2FCSA 4W9KA 4KVGB 1X86A 2DFKA 2VSZA 2DAJA 4JLCA 4BBNF 3CXBB 1U27A 4HATB 4WJ7A 2NBWB 3AULA 2BWES 3V5WA 3W1YA 3SV1A 2DA0A 1YD8U 3P2BA 2J0MA 1I2HA 3ZNHB 2CY5A 1F9JA 3W1SA 4ANXA 4FA6A 3WA0A 1FHOA 4PYUA 4K81A 4AUQC 1FHWA 2K2UA 2HRJA 3PREA 5EFXA 4HJKA 1I7AA 4OVUA 3LJUX 2JZ3B 4PS7A 3QHTA 2K25A 3UIPB 1HB6A 3H6NA 1V86A 3ZTCA 2BYVE 2ZPNA 2JRHA 2L00B 2KWCA 5D6JB 4K7UA 3UF8A 2Q13A 1X05A 1WJ1A 1PMSA 1WX7A 4EMOA 1J0WA 1XCGA 1M94A 1E7VA 2DYMA 4B6WA 4GDLB 1FXTB 1IP9A 4ZRIA 3SYXA 3JSVA 4FJYA 2K8BA 5DPWA 2LULA 3DBRI 1ISNA 2JZZA 1VCBA 2LKOA 4K7WA 4MJSA 3H7PA 2BYFA 3QCAA 3AI5A 1LM8B 4BKSA 5JH5C 4AJWA 2C60A 1Z5SB 2CAYA 2BPSA 2KJ6A 2LXAA 2REXA 2ZCBA 2KN5A 3A9JB 2KUPA 4JL9A 1X1FA 4FJZA 3R7QA 3A8QA 4BOZB 3IHPC 4LDTB 2P0DA 3ZDTA 4PNKA 1EF5A 2FIDA 2KWUB 2Z59B 4HXDA 1GUAB 3NHEB 4IOYX 4E71A 1AWEA 4HPMB 1MK9B 3CIKA 3L13A 3PV1A 3D8EA 3DVGY 1SE9A 4M0WB 4WAAA 3OJ4B 2MFQA 4WWNA 3W1SC 2LYDA 4BBNC 4IG7B 2UZSA 2ZNVB 2UWQA 2KTRA 4B9KA 2DX5B 5J3QA 4MSQB 2LVPA 2JVCA 1FB8A 2K1FA 2N7EA 2LRUA 3R66C 2LOXA 3O96A 1L2NA 1ZSQA 3EHVA 2MKRA 1RFAA 5J3TA 3JW0X 2EMSA 3AU4A 3L0WB 2L2IA 3KSYA 1W1GA 2O6VD 2MBBB 3VOQA 4ANVA 5IAAC 2FNJB 1KZGA 4LJPB 1WF9A 1WZ0A 3ULCA 1V5TA 4FHJA 4HVBA 5CLLB 2L8JA 1KOTA 1WZ3A 2DTCA 1MK7B 2COCA 2EJ8A 5E6PA 1OQYA 3ZRCA 4HK2A 2G35A 1OMWA 2YF0A 2M1MA 2AWTA 4NAWB 1V81A 4PS3A 2QKLA 5DPSA 3SHQA 2LJ5A 3UQBA 4HAVB 4F1SA 1IYFA 3PG7A 1E90A 2CU1A 2GJYA 4G11A 2AL6A 4D0NB 1LXDA 4IWPA 2K6QA 3AU5A 2VRRB 4RM8A 2RGNB 2K8HA 3H9DA 1I42A 1I35A 4RMAA 1U5GA 2Z0OA 1ST7A 4GMXB 2MW5A 4DBBA 3PHXB 4W9DA 3L08A 2Y8GA 4BBKA 4G0NB 1YQBA 2K00A 4MH0E 2CKHB 1NVLA 4NY0A 1WJ4A 2IZVB 4W9GA 4DHZB 5C16A 3B1LX 2YRYA 2DZKA 2XK5A 3APCA 2ZNVC 2DX5A 4NJ6A 1Y19B 2O2VA 4E3CA 4KHAA 1V49A 1MPHA 1BTKA 4KHBB 2KOXA 2LOZA 3A98B 4ZYNA 3ZNID 3C0RB 2ABDA 3HHMA 2IO3B 3KW5B 2BYEA 2D9YA 1KI1B 4EZLA 2HE7A 2P0HA 3NZUA 3PPAA 4FADA 3UGBB 5C23A 3A4SC 3IVFA 4TV3A 2MWSB 5J18A 4WWOA 3QX1A 4ZDVA 1WFYA 2MP2B 2JUOA 1KLVA 3VUWA 1WX9A 2PE6B 2JXXA 2GCJA 3PEGA 1R4MI 2N1VA 4IUMB 3RULA 2HTHA 2GBRA 2LGDA 4GIVA 2CHXA 4HHVA 3U8ZA 4HB3B 2ZZPB 1RLFA 1WE7A 2N7DA 3I3TB 2ADZA 3VVWB 5LLIA 4CO7A 4DHJB 1H8CA 1PFJA 4II3B 1U5DA 2YS3A 3TO1A 4H8SA 1S3SG 4FJVB 3HM6X 5CTRC 2ZJDA 2Y7BA 2N9PC 1B55A 1AQCA 1TQZA 4DX90 2AEHA 3HM3A 4OVVA 2ZEQA 2KC2A 3AXCA 4LJOB 2L7RA 3DBLI 3QWZB 2NR2A 5D2MB 2NVUI 3NZSA 4AWJA 3EECA 5D27A 4HCNB 5HE3A 3T8MA 3ZKJC 2G45B 1UPQA 4A6HA 2YLMA 4HPLB 2J7QB 1M7EA 2LRWA 3RYTA 4NQKE 2DZIA 2RVBB 1ZC3B 4DXAB 1XR0B 2KO3A 1V5MA 3ZLZA 2OQBA 2MP2A 5FI0A 3X23A 1WR6E 3GYOA 4GN1A 3LDZE 2H7EA 4HAUB 3N3KB 3VHTC 1M7RA 3A1QA 2NS5A 3UINB 1A5RA 3PRPB 4GU2A 4ICVA 3KY9A 2GOWA 4GGQA 4PQ0A 2LGYA 1UNQA 1K5DB 5AZFA 2COAA 2XEWA 4DDID 4XC2A 2MRPA 3WAMA 1WGUA 1FGYA 4L6EA 2X18A 3PSCA 1WYWB 1ZC4B 3QBVB 5KQ4A 4F7HA 2KQSA 2P8VA 1WR1A 2CR5A 2N1WA 3M95A 2UVMA 2YS1A 2YS5A 1XKEA 2O6VB 3ZVRA 5JLJB 2BWFA 1QC6A 3PP2A 1ZW7A 3DPDA 4DBGA 2GCLA 5FI1A 3GYPA 3QARA 2COPA 5LXHA 4IC7B 5CX3A 1WJMA 3ML4A 2LGXA 3VQIA 3ODWA 3DXDA 1E7UA 3KH0A 4AOFA 3BY4B 4KSLC 3N7CA 5HE0A 1WM2A 5TR5A 4GOCA 4CHKA 4PS8A 4W9EA 2YT1A 4A5KA 1SIFA 3A1QB 3HIZA 3TL5A 2OJRA 3M1IB 1D3ZA 1DROA 1EGXA 3KYCD 4NAWA 3V6CB 4DX8A 2DENB 4WVFB 1KM7A 2GBMA 1V80A 2QHOA 2HD5B 4LDTD 2ZVOA 3ODXA 4TUUA 2D9ZA 3FLVA 1WJ6A 2N9XA 4G3XB 2Z0PA 2J0KA 5IJMA 5J2RA 1P5TA 3LJ3A 2KZRA 3TJPA 3MPXA 3GOEA 2NMBA 3TBLD 2DHZA 5KHQA 2BKRB 3K9PB 4HCPB 2DN6A 2N4FA 2V1YA 4FLHA 4W9IA 3PVLA 1YX6B 1WI0A 1TGZB 4MGKE 4MT7A 5HE1A 2M17A 3CMMB 3PT2B 1V2YA 2KCJA 3D8FA 2O2VB 4A6FB 1WGQA 5GOWB 1PQSA 3DBSA 2CQUA 4E74A 3F5RA 4HAZB 1DBHA 2GS0A 3P6AA 3QK0A 5D94A 3SNHA 2FCQA 2CHZA 2JT4B 4ICUA 3VTVA 2MX2A 1YX5B 4EOYA 1MIXA 3V61A 2K2JA 1RAXA 3NS8A 2WX0A 3BJIA 3OLMD 2VRWB 5DI9B 2KMCA 4IW0A 4MEMA 4NQLB 4HAYB 1EO6A 2D11A 2UZRA 1WJNA 4Z2MB 2JF5A 2KTFA 3APFA 5E6OA 3H7SA 1T0YA 2N9EB 3NY5A 4HDQA 4NPNA 4AP4C 2J0JA 5D7GA 2KDBA 5AZHA 2KKCA 4X57B 4ZRJA 3IG3A 4M8NA 4GDKA 2D9VA 1Q5WB 1LQBA 3A33B 2L3ZA 3QWMA 2KX3A 5JP4A 4KZ0A 4NNJB 2DLWA 3U7DA 3WYFB 2KFJA 2IFSA 3MTNB 3ZNGC 3RZWC 2HTHB 4KZCA 2NPTA 2MBQA 3T9LA 1QQGA 1KJTA 3ECIA 1K5GB 4IFSA 1V6EA 2FIFA 5HKHA 5JHAA 3QIJA 1P6SA 5D3XA 2IY0B 3EC8A 3ZUNA 3K9OB 1H10A 4IAPA 2A5UA 4JIOU 1C3TA 4TQ1A 3UZTA 3VUXA 4EKUA 2R2QA 2LG1A 1PLSA 5J17A 2RNRB 2MLBA 4J6IA 2DHJA 3JVZX 1WRDB 2LD9A 4MGYE 4XZ4A 1SHCA 1RRPB 1L7YA 2OTXA 5AEKB 2KJHB 5LXIB 5DPTA 2KHWB 1Q1OA 4BKSD 2DAFA 3ZRFA 2JY6A 2GBJA 3G9WA 1TJ6A 3A9KA 4KSKC 3VTUA 1R4NI 1DYNA 4GDLA 2IYDB 2RGFA 1WY8A 1X1GA 1WE6A 3KZ1A 2YVCA 5D3VA 2IO1B 5AZGA 4AJYB 4W9HA 1MIZB 1XODA 2MSED 3VDZA 2KK8A 3DBHI 2BCJA 3Q3FA 2W9NA 2GBNA 2MCNB 1UBIA 3NOBA 3MDBC 5KCVA 2DZMA 2ASQA 3L10B 4MGIE 1WXMA 1WXAA 3A9JA 3KUCB 1FGZA 4WQOB 3D8DA 1WGRA 3D32A 1UELA 3M3JA 4IM0A 3RCZA 1OY2A 3FM8C 1P1AA 2LI5A 4MSMB 2C7MB 4DHZE 2IO0B 4A6FA 1RJ2A 1OQNA 3IFWB 1LB1A 4FBJB 2CRFA 1UEFA 2KXJA 3R7RA 1WM3A 4DK5A 4HLEA 1NTIA 5D3YA 2ZPYA 2IBIB 2K39A 1FAOA 2BKFA 2KDFB 4GSWA 2WDTB 3ENEA 3MHSD 4WJOA 1TBEA 4DHJD 1IPGA 2LBBA 3N30A 4I6NB 5L83A 3UIOB 2EMTA 1P0RA 2XBBC 4CHJA 1WGYA 1ZM0A 1Q67A 1N3HA 1YIWA 1UH6A 2FUHB 2D10A 2WX1A 3PHWB 4DWFA 1J0GA 3TW1A 2D4QA 4WJNA 2DKPA 4K1RB 3RT3B 4IWOA 4BVUC 2E2XA 4MJSB 3TFMA 2V76A 4K2OA 1SGHA 3SO6A 1OTRB 2M8SA 2NBVB 3ML9A 3PGEA 3Q3JA 2C5LC 5CLQB 3N32A 5D3WA 3ZIMA 2DKQA 1C1YB 5DPRA 2DYNA 4F7GA 1E8WA 1TZ1A 5C1ZA 5KHOA 4ASWC 1EVHA 2LVQA 3WALA 1WX8A 1Y8RC 4EZKA 2L1CA 2QKMA 1UD7A 2FAZA 3WANA 1TTNA 1J8CA 1H4RA 1HB8A 2KMAA 2CB8A 4HAWB 1EF1A 2D9XA 1XD3B 2DX1A 4HB2B 2ELAA 1OGWA 1V89A 2Z0DB 4N9F4 2D07B 4F8CB 3T06A 1XX0A 3RUIB 2KTRB 2RQ1A 3KRXA 2DYBA 3A9KB 3R3MA 2MQJA 4C0AA 2DYOA 4IWQA 3RD2A 3ZDMC 4CHMA 3O65B 2CHWA 2L76A 3PTFC 1LFDA 1WVHA 2DHIA 3M63B 3A8PA 4B95A 1MG8A 2MBHA 4ZRKA 3P7ZA 1WGDA 2KFKA 1Q0WB 4W9CA 3OANA 2MBEA 5JHBA 2JRIB 3KUDB 5C5BB 4BKGA 2NZ8B 4TKNA 1K8RB 4Y94A 3M62B 1GC7A 2Z0QA 5IA7A 2MDXA 5EDSA 4GMVA 1WH3A 1J19A 1HE8A 3ALBA 4RM9A 2C7NB 1UNRA 2JPHA 2FCNA 5L81A 2ZVNA 1NU2A 1CMXB 1WMHB 5C6RA 1E8YA 1UBQA 3H1UA 3PLUA 3V62A 3VXWA 4DDGD 1S1QB 2KQ7A 2FJLA 4GZUA 1W1DA 2B3AA 3F0WA 2V3SA 2AYOB 4JQWC 2D9WA 5G55A 3WAPA 4M8MA 3DOWA 5JHGA 2CODA 2KJRA 1TXDA 2LASA 1ZVRA 1IRSA 2DHKA 3ODOA 1ZGUB 5G2NA 4KHOA 2YT0A 5DIFB 2G4SA 1WG7A 3L17A 1UPRA 2RSGA 2RR9A 2ZCCA 3DQVA 3DVGX 1XT9B 3VAWA 1DDVA 2I5CA 3DDCB 5FR6A 4A20A 5DHFB 3U30A 1NI2A 1WGGA 1X11A 4EUTA 2WYQA 3VUYA 4IM3A
chains in the Genus database with same CATH superfamily
2W55A 3KUZA 1UZXB 4TQ0A 2UYZB 3NVWA 3X0WA 1MI0A 3ZYYX 1I4GA 2M0XA 3ZW3A 2MA9B 1QLBB 1WXSA 2V4LA 2X8XX 3BIID 2M0AA 2LZ6A 3DHGC 5BYRA 4NSWA 5JHHA 1BUIC 1FRDA 1FNVA 2LVOA 4K17A 3RZFA 4WJQA 4OT1A 4MH8A 1E6EB 4GPTB 2LXCA 4K3CA 1AARA 4S17A 4ILHA 2HJ8A 2IYBA 1I4PA 3WAMA 4B6HA 1P98A 3U7ZA 3E9OA 2WDQB 4HDOA 4MSQB 3PS6A 2WWZA 5KQ1A 4EZJA 3DXCA 1JQ4A 3W9CB 3VH3B 3P4RB 1V5PA 1QKZA 3L54A 2WH5A 2WS3B 3ZJUA 2W2XC 2AQ2B 2UU7A 3FP5A 5HE2A 2XQNM 1MVKA 2RPQA 5C79A 4A55A 2D3BA 4WWPA 3GZNB 4K3BA 3OWEB 3GE8C 4CYEA 4XX5A 1L0YB 4LNFA 2QMTA 4XDCA 2K5PA 2D3AA 3EFUA 1D5MC 2AQ3B 4UDUC 5J3YA 1ACAA 3GB1A 5CHVC 3BYTB 1VZ6A 3MJWA 4A3PA 1U2BA 1WYGA 3ZO5B 1TJEA 2YT2A 3QC8B 1EWYC 3VH4B 2G4DB 2M4NA 4I6LB 3WIMA 1UNPA 4KIKB 1V5OA 4MDKE 4GB9A 1Z87A 3SEBA 2GI9A 4HSIA 1VR9A 2RUKB 1E8ZA 4JKFA 1EWCA 4GXBA 1X1MA 1WI1A 2FBWB 5EE9A 1UF0A 4I6PA 4K7SA 1E8XA 4WIPA 4YSZB 2QJLA 3P4QB 4W9KA 2DAJA 1AW7A 4HATB 1J7CA 1N62A 3Q3MC 2DA0A 1FFVA 5G5HA 3ZNHB 3WA0A 1RYJA 4HJKA 5EFXA 1I7AA 3LJUX 2K8EA 3UIPB 3H6NA 4ZHPA 2JRHA 1X05A 1UWXA 1PMSA 4NAMA 2LULA 2KACA 2J53A 1AYFA 2NBVA 3DBRI 4K7WA 4MJSA 3H7PA 2BS4B 2C60A 5I4DA 1LO5D 1XLOA 1X1FA 1NYQA 3A8QA 1C9FA 3IHPC 3Q2AC 2FIDA 2WXJA 2IGDA 1I4XA 4HPMB 5HI1A 3D8EA 1YJIA 1SE9A 1UNSA 2G1EA 2MFQA 3W1SC 3BYYB 4BBNC 4IG7B 2KN4A 2ZNVB 2UWQA 1FB8A 2N7EA 1TZOA 3EHVA 2MKRA 1RFAA 3JW0X 3L0WB 1AN8A 1W1GA 3DHIC 3VOQA 1DOIA 4ANVA 2KT7A 4LJPB 1ACCA 1WZ0A 3ETRA 3ULCA 1V5TA 4OSNA 4FHJA 5HG2A 1KOTA 1ET6A 2QC8A 4JWSC 1OQYA 2YF0A 1TYGB 4NAWB 4PS3A 2QKLA 5DPSA 2ICIA 2LJ5A 4F1SA 2CU1A 2WXOA 2GJYA 1SEBD 1LXDA 3AE8B 1GGOA 1YQ3B 1U5GA 2Z0OA 3PHXB 4BBKA 2K00A 1FIQA 2NTTA 2IZVB 4C56C 2XK5A 3APCA 3PO0A 1FFUA 2O2VA 1V49A 4ZYNA 2LOZA 3A98B 4US9A 4JK8A 3NZUA 3A4SC 1T0QC 4TV3A 4C7ZA 2JUOA 1SF0A 2JXXA 1R4MI 4IUMB 2LGDA 1WE7A 3VVWB 1H8CA 1PFJA 3TO1A 2KUQA 4KGTA 4MT5A 2ZJDA 2N9PC 1TQZA 1Q10A 3NWFA 3Q69A 4ITKA 2L7RA 3QWZB 1J7BA 2NR2A 3TSSA 4AQ7A 1JWMD 5D27A 4NQKE 2DZIA 2RVBB 1V5MA 2MP2A 1XF5L 1HEZE 2KDMA 3N3KB 3VHTC 1I7HA 3UINB 4GU2A 3KY9A 4P6VF 4PQ0A 1JCKB 2LGYA 1UNQA 5AZFA 2COAA 2XEWA 1K52A 2MRPA 3B9JA 3IT6B 1FGYA 3QBVB 1HQRD 2KQSA 3M95A 2N1WA 1XKEA 3U4EG 3U52E 1QC6A 2GCLA 5LXHA 4IC7B 4KSLC 5HE0A 1I4QA 1WM2A 4GOCA 4CHKA 2YT1A 1SE2A 3V6CB 4DX8A 5EE1A 1KH0A 4WVFB 3ENBA 2ZVOA 3ODXA 4TUUA 2N9XA 2VZKB 4G3XB 1JW9D 3LJ3A 1YOVB 2KZRA 1JALA 1E10A 2NMBA 5KHQA 4FLHA 1UUPA 3PVLA 1TKYA 3PT2B 5BMHA 1PQSA 4E74A 2CQUA 5MPOA 1SIJA 3NS8A 4JX1C 3BJIA 4TMAB 4BKGA 4HAYB 2JF5A 2D11A 2UZRA 5E6OA 2L32A 2J0JA 2KDBA 3IG3A 3DBRB 1Q5WB 1ZXIA 2WXMA 1LQBA 5IP4D 3QWMA 4NNJB 4ZRPA 4RGNA 1ROEA 4KZCA 1N6ZA 5JHAA 3ECIA 3ZGZA 1V6EA 1E0ZA 1P6SA 3K9OB 1PFDA 4IAPA 3FAHA 1C3TA 4EKUA 2LG1A 2LD9A 1SHCA 2OTXA 4IKGA 2K22A 4HJGE 2DAFA 2GBJA 3G9WA 3AEBB 1DYNA 4JKBA 4GDLA 5AUIA 1X1GA 3KZ1A 2MJ3A 1MIZB 3W5VB 2KK8A 5I2SA 2BCJA 3BZDB 5LG4B 2WNMA 2MCNB 4HRSA 4D2KA 1WXMA 1N60A 3A9JA 2CJNA 3D32A 4CSQA 1UELA 3FM8C 1RJ2A 1OQNA 1DOXA 1LB1A 2CRFA 2KXJA 2K39A 2KDFB 3J9CA 1KC7A 5L83A 2EMTA 1P0RA 2WX1A 2FUHB 2OHFA 3TW1A 2D4QA 2DKPA 4K1RB 2E2XA 2Y5PA 1TT5B 2NTSA 3ML9A 3A58A 4YTMB 3N32A 5CLQB 5BYSA 1C1YB 1D4BA 4F7GA 1Y8RC 3AEGB 1CJEA 3WANA 1MG4A 1TTNA 2KMAA 2DX1A 1VJKA 4US8A 2Y5CA 3RUIB 1E9MA 3ZDMC 3A9KB 3DHHC 1GOZA 2QILA 3P7ZA 1WGDA 2KFKA 3OANA 2MBEA 2JRIB 3KUDB 2NZ8B 1T77A 1SSNA 3B77A 2K9XA 3RYTA 1NU2A 1CMXB 1STEA 4KX6B 2KQ7A 4ZOHC 3F0WA 1N5WA 4M8MA 3DOWA 2BTEA 2DHKA 5D3DA 1HTOA 1ZGUB 5DIFB 3AE7B 4JKAA 1XT9B 1VZ7A 1DDVA 2INPE 4ILGB 4RF0A 2WYQA 1P9DU 2DZJA 3UQAA 3B08A 2AQ1B 4BAXA 4XWXA 3NG0A 3QAQA 4MELA 1WGHA 1L4ZB 5CHFA 4MGZE 3VIAA 4F7ZA 1PGAA 2M38A 3PRZA 4URKA 4KAXB 4FHKA 2KX0A 2NPTB 2V3NA 1WMHA 5GMVA 3VRBB 2RSUA 3FSSA 1YJ1A 2VH2A 3L16A 4HWIB 3NW8A 3V6EB 3GZNI 3W5UB 1E5WA 4ANUA 2KDIA 2EC1A 2JX5A 3HQCA 3KQ4A 1HXYD 4JGHB 2LUEA 2OEDA 2YSZA 4L1RA 3AEEB 3W2DA 4GDKB 1SB3C 2W3SA 3BINA 3NWAA 3ULBA 2JSVX 1D5XC 4HB0B 2AL3A 4RCOA 4H2AA 3C8YA 1TS5A 2CU3A 1FCLA 3TVVA 2IGGA 3HW2B 2EKEC 1BT0A 2JXTA 1QZEA 4XE0A 1EAZA 3SD5A 2BW2A 2V0GA 3IAM1 4FN2A 1WIAA 2JYEA 4WWMA 2JP2A 2W2XD 2JWUA 3HVZA 1IGCA 4A3OA 2KANA 1XLPA 4KDIC 1WGKA 4JWUC 5C5BA 1LW3A 4KV2A 2KVRA 1RWSA 1V1PA 1MKEA 2L0FA 4DXGA 3H7PB 4RH6A 3DXEA 1V88A 1BAKA 1HBKA 4C7YA 1GJZA 2Y8FA 4Z2NA 3BVGA 2E3TA 1NTYA 2RD0A 2BS2B 1OEYA 1KBLA 3ONSA 1U5FA 1L6VA 3UI3A 2ELBA 4DIXA 2C7HA 2M14A 1EM7A 3GE3C 3PRMB 4MY6A 3RNBC 1QF6A 2J42A 1RM6C 2R61A 3N9YC 2N23A 1Y5OA 4JK7A 3PVWA 3KYDD 4A9AA 3RNGC 1U27A 1CK1A 3W1YA 1F52A 3V5WA 3SV1A 2H89B 2AX5A 3W1SA 1FHOA 3SBTA 4PYUA 4K81A 4QJ3B 3PREA 2K2UA 2HRJA 1C76A 2JZ3B 4NJCA 2WU2B 3P42A 1V86A 3ZTCA 2LUMA 1K50A 3UF8A 1TS4A 4JKHA 1XCGA 1M94A 2DYMA 4B6WA 2Z8LA 4ZRIA 3SYXA 4FJYA 3AMZA 1ISNA 3P63A 1VCBA 3QCAA 2BYFA 4BKSA 4AJWA 1T3QA 3VR9B 2KN5A 4JL9A 2X38A 4BOZB 3ZDTA 4PNKA 1EF5A 3ZQ4A 2Z59B 4HXDA 4IOYX 1K51A 3RN9C 1HTQA 1AWEA 4BZAA 3PV1A 4M0WB 3RNEC 2LYDA 2UZSA 2DX5B 1L2NA 1ZSQA 2KIGA 2EMSA 2L2IA 2RDHA 2Z14A 4L23A 1L0XB 5CLLB 2L8JA 5C3JB 2DTCA 5E6PA 3R2IA 3AB5A 2G35A 2M1MA 4LNOA 1IYFA 2DNFA 4HAVB 4RM8A 3AU5A 2RGNB 2K8HA 4GMXB 3I9V1 4W9DA 2QDFA 2Z4DA 4MH0E 1IBXB 4A6QA 4PK1A 1WJ4A 4W9GA 4DHZB 2YRYA 2DZKA 4NJ6A 1Y19B 4E3CA 4LLGM 4KHBB 2HTME 3AEFB 3C0RB 3HHMA 1TS3A 4EZLA 3LB8C 3PPAA 1MHHE 4FADA 3Q14C 3EGRA 2MWSB 4QJ4B 4WWOA 1WFYA 3DBHB 2M19A 3PEGA 3RULA 2RPVA 2GBRA 4GIVA 4D6WA 4HHVA 3U8ZA 2ZZPB 2N7JA 1RLFA 2N7DA 4DHJB 1QT9A 4ARIA 4II3B 1U5DA 1S3SG 4H8SA 5CTRC 1AQCA 4DX90 4OVVA 4LJOB 2X0SA 3E56A 3DBLI 3RFZB 1GAQB 3EECA 3ZKJC 1UPQA 1M7EA 1NENB 1ZC3B 1XR0B 2OQBA 4OZBA 1WR6E 1YJJA 3DBLB 4HAUB 1FRRA 2NS5A 3PRPB 2WXKA 1T0RC 4DDID 2LMCA 2BBCA 4USAA 1FEHA 5IO9A 4F7HA 3RI7C 4LK0M 2CR5A 1R7SA 3TEXA 2O6VB 3SFDB 3DPDA 3ML4A 2KVZA 4A5KA 1SIFA 3HIZA 3BVZA 1WRIA 4KHBA 3Q3OC 4B0EA 1D3ZA 1WWTA 2WQYB 3KYCD 2WGSA 2QHOA 4LDTD 1LGRA 5IJMA 1TKEA 5J2RA 3MPXA 3GOEA 2DHZA 2L1AA 2BKRB 3K9PB 3NZ3A 4ZYSA 4W9IA 1KF6B 1TGZB 4MGKE 2M17A 3CMMB 4ARCA 4WH4A 2WXHA 2O2VB 1WGQA 3DBSA 3B2FA 3QK0A 3P6AA 5D94A 2JT4B 4ILJA 3OHMB 2CHZA 2MX2A 1VRAB 3NRZA 1XLNA 3V61A 3MC8A 2VRWB 5DI9B 4IW0A 4MEMA 1EO6A 1WJNA 1FO4A 1MHXA 1T0YA 2N9EB 4HDQA 1ZOYB 3MC9A 1KLGD 3NY5A 5AZHA 2KKCA 4X57B 4M8NA 5D3IB 4KZ0A 5EE0A 2KX3A 2DLWA 3WYFB 2HTHB 1QQGA 1K5GB 4IFSA 2FIFA 2K0PA 3QIJA 4GOUA 3EC8A 2EELA 1H10A 1VDVA 3P1MA 4TQ1A 3UZTA 1DYQA 2RNRB 4ZRQA 3VRAB 3JVZX 3ZXVA 1RRPB 1L7YA 2KJHB 3ZRFA 1EU4A 4KSKC 3I63C 3VDZA 2W9NA 2GBNA 1UBIA 3MDBC 5KCVA 2DZMA 3L10B 1WXAA 3KUCB 3D8DA 3M3JA 4MSMB 2C7MB 1T0SC 3N1YC 4DK5A 4GSWA 4WJOA 2BKFA 2WDTB 3ENEA 4L1BA 1IPGA 2INCC 2INNE 5HFYA 3N30A 3BWUD 2MH7A 1ZM0A 1N3HA 2W54A 3TEZA 2V3PA 2QEJC 4DQOC 3RT3B 4IWOA 4BVUC 2LHEA 3TFMA 2V76A 3SO6A 1OTRB 2M8SA 3PGEA 3Q3JA 2C5LC 1WXQA 3BK1A 5D3WA 3ZIMA 1TZ1A 2K3UA 3WALA 2K49A 2QKMA 1C4PA 1UD7A 1YN3A 3IAS1 4HAWB 1EF1A 2WLBA 2D9XA 1XD3B 3Q8FA 1JROA 3AECB 1OGWA 4F8CB 1XX0A 3KRXA 3RD2A 3R3MA 2DYOA 3O65B 3PTFC 3M63B 1WVHA 2DHIA 2QSDA 4ZRKA 3Q8EA 1HA5A 1Q0WB 2B76B 4YT0B 5C5BB 2WXFA 3AE6B 4Y94A 2ZW1A 2MDXA 5EDSA 1WH3A 4RM9A 2JPHA 2FCNA 1ENFA 1C77A 3H1UA 3V62A 3VXWA 1QILA 3NS1A 2FJLA 4GZUA 2V3SA 4JQWC 1MI1A 2KAJA 3ODOA 2G4SA 1NI3A 2RSGA 2ZCCA 3VAWA 3DDCB 2DLBA 1NI2A 1WGGA 1X11A 1C4AA 5BMGA 4EUTA 2I2YA 3ZLZA 3NVVA 2ONQA 3CF6E 4FULA 3WAOA 1J7AA 2JWZA 1CQVA 3LXFA 3ZXRA 4YSYB 1TKGA 1XCQL 2V9HA 3TMPB 3FEHA 2IGHA 4M02A 2ROZB 1L6UA 2OOBB 3SU8X 2CY4A 1ZKHA 4BFRA 1ZXHA 4HAXB 2A4ZA 4M00A 3VR8B 4WJPA 3N1XC 3HK0A 1EUVB 1P3QU 2GBKA 1OEYJ 4KIKA 3ZTDA 4G0NB 3BVMA 1FHXA 4HB4B 5L95C 2R0DA 2DBYA 3PVUA 4LCDE 2BB6A 1C79A 1TIFA 2JU6X 2MBOA 2MHJA 3ZVVA 1R4MB 2RDGA 1GG3A 1BWNA 1KZ7A 1L5PA 4EJNA 3RCPA 1N63A 3ML8A 1JRPA 4G50A 4NJ7A 5IOIA 3SUZA 2N9KA 4KDLB 2KDEB 1SJED 3I5JC 2H88B 4OZAA 3Q8CA 1GNUA 5IKCM 1L4DB 2DYQA 2WXLA 2O6VA 2VKIA 3BK2A 2M56B 4S0RA 4F7UP 2L05A 5BMIA 4BOSC 2I1JA 2NCNA 4IM2A 4C4VA 2IO2B 4YONA 2CS4A 3KRWA 3ZJTA 2PPHA 4P7IA 4YL8A 4PYZA 3CWIA 3TIXA 1NTVA 4EEWA 2N0YA 1PGXA 2MWNB 2ON8A 2OJWA 3E9LA 3HRDD 3NSUA 1W1HA 2IJ0A 1XQQA 3V60A 3DWGC 2PE9A 1YQ4B 1GC6A 3QQ8B 2FJ9A 2BS3B 3EFCA 3APDA 2C9WB 2D2QA 3E9PA 2J59M 1NDDA 1SE4A 3AE5B 4W9JA 4A6KA 5GXGB 3Q3NC 2RLOA 3JSVB 4TYZA 1B9RA 1DDWA 3SDLC 2K6DB 3IBEA 4GLSC 4P1BC 2G3QB 3VFKA 4B0MA 2PTLA 2IY1B 2D3GA 2PEAA 4WAFA 1X86A 4JLCA 5T8IA 3CXBB 4WJ7A 5FR3A 1YD8U 2WHIA 1I2HA 3E66A 1F9JA 1HZ5A 1JDEA 4AUQC 4LNNA 1FPYA 3T3OA 4PS7A 3QHTA 3URYA 2KWCA 4WQMA 4K7UA 1WJ1A 1WX7A 1J0WA 4HKZE 1E7VA 1IP9A 1FXTB 3H8HA 2K8BA 5M4YB 3AI5A 1LM8B 5JH5C 3GP7A 4N59A 1I4HA 1Z5SB 2KJ6A 2LXAA 3A9JB 3R7QA 2REXA 1VZ8A 2P0DA 2WXQA 2KWUB 4E71A 3NHEB 2J4XA 3CIKA 3L13A 4GNKB 4WAAA 4WWNA 1YN4A 1AWDA 3RPFC 4HKQA 1XLQA 2KTRA 5H92C 3AE4B 2K1FA 2O6VD 1ET9A 5C2TB 1FXIA 1WZ3A 1MK7B 3ZRCA 2L52A 4YTPB 4HK2A 1V81A 3SHQA 3UQBA 3PG7A 3E9SA 4JK9A 1M4VA 3EA6A 2AL6A 1QOFA 3SBGA 2YEPF 2VRRB 4IWPA 1I42A 1ST7A 4DBBA 1YQBA 2CKHB 4JKGB 2DWQA 3B1LX 2ZNVC 2DX5A 3AM9A 2MJEA 4KHAA 1QOBA 2KOXA 4RGOS 3ZNID 3ABVB 3KW5B 4O1NA 2IO3B 3Q8BA 2D9YA 1KI1B 2HE7A 2P0HA 2LGIA 3UGBB 4KGSA 3IVFA 3NVYA 3Q6BA 5J18A 3QX1A 4ZDVA 1KLVA 2MP2B 1N5XA 3GS2A 4YXDB 4R3DA 4HB3B 1GB4A 4CO7A 5LLIA 2YS3A 4RGTA 2HDEA 5E6JA 4FJVB 3HM6X 2JQRB 2L83A 2XNAC 2ACZB 4YWGG 3HM3A 5D2MB 2NVUI 3NZSA 1I4RA 4HCNB 5HE3A 3T8MA 2G45B 2LRWA 3L4PA 4DXAB 1NVID 2KO3A 5FI0A 3X23A 3GYOA 4GN1A 3LDZE 2E6XA 2H7EA 1M7RA 1A5RA 3I57A 1FXAA 3WCQA 4L6EA 2FUG1 1ZC4B 2J52A 2GB1A 4QAYA 2YS1A 4GGQA 3ZVRA 3QARA 5JVLA 5CX3A 2LGSA 3KH0A 3DXDA 1E7UA 3FKYA 2V4IB 3DCXA 3A1QB 3FC4A 1CZPA 2QIEB 3SFEB 2SEBD 2GBMA 1V80A 3AEDB 3FLVA 4JKDA 1WJ6A 1RFKA 1P5TA 3TJPA 3MC0B 2Y3AA 1PYWD 3TBLD 1JWAD 2N4FA 4MT7A 5TSSA 1V2YA 3D8FA 1D6EC 4A6FB 4A8XC 1F0ZA 3F5RA 1DBHA 2GS0A 2RMMA 4ICUA 4EOYA 1MIXA 2K2JA 1RAXA 3OLMD 4NQLB 2PKOA 2RRFA 1P7FA 4JE3B 4AP4C 4NZLB 1F2RI 4GDKA 2L3ZA 5HKHA 4HROA 3MTNB 3RZWC 3KWVA 2NPTA 2MBQA 3IT4B 5D3XA 2IY0B 1TY2A 2A5UA 3VUXA 2R2QA 2PLPA 2MLBA 3N1ZC 4MGYE 2DHJA 4P16A 5AEKB 5LXIB 2KHWB 2WXIA 3A9KA 1R4NI 3AEAB 1DIKA 5D3VA 2YVCA 2IO1B 4AJYB 4W9HA 3DBHI 3Q3FA 4JKCA 1NYRA 2NMQA 2ASQA 4MGIE 2EKIA 4IOIE 1WGRA 3RCZA 1IGDA 1P1AA 1F1HA 1MFWA 2LFIA 4A6FA 4FBJB 2WXGA 1UEFA 5I2MA 2IBIB 4DHJD 1TBEA 2LBBA 2XBBC 1UH6A 2MEKA 2D10A 3PHWB 1J0GA 1VLBA 4MJSB 1SGHA 1B1ZA 2NBVB 2DYNA 1KLUD 1EVHA 3NWDA 1WX8A 2FAZA 3O13A 3EUB2 2RDBC 4YSXB 1J8CA 1H4RA 2CB8A 1BMLC 1F77A 4XGAB 5EE3A 4ACFA 3AE1B 4XWTA 3T06A 2KTRB 2RQ1A 5AZGA 4CHMA 2L76A 2FJUB 5JHBA 3T3NA 1K8RB 2VZKD 2I38A 1GC7A 2Z0QA 5IA7A 3TEYA 2CJOA 4GMVA 1J19A 1HE8A 3ALBA 4DWFA 1UNRA 5L81A 2Z13A 1UGJA 1WMHB 5C6RA 1UBQA 2SAKA 4DDGD 1W1DA 2AYOB 5JHGA 2KJRA 1IRSA 2IPKD 4KHOA 3U2SC 1UPRA 2RR9A 3DVGX 3P4PB 2I5CA 5FR6A 3AV8A 3U30A 2JYTA 5BO4B 4M01A 2G9HD 1C78A 5LONB 1PUTA 3DVNU 2COFA 2Y5BB 1V9JA 3AE3B 1P3RA 1V61A 4Q2JA 4HEA1 5LNK1 2I1KA 1TY0A 1DDMA 1V5UA 2D3CA 1L0VB 4J3OD 3VTWA 1FNWA 1ZE3D 3OJ3A 2BF8B 2LWPA 2P0FA 3PLVA 1F2RC 1FMAD 4MM3A 1FOEA 2KLCA 2R09A 3QA8A 3U12A 4W9FA 3Q8AA 4XYCA 1NBFC 1EU3A 2KD0A 3PSEB 2KWVB 4AWJA 2KGXB 3DVNV 1G6JA 2ROVA 1U5EA 1YNTE 2KC1A 3OAWA 3EPYA 1XD4A 2GRIA 3RMKC 5DCNA 1UGMA 2KQ4X 1VD2A 4EFOA 2PZ1A 1WJUA 1XEEA 3KVFB 4IDIA 4JKEA 4MM3B 1ESFA 3RNFC 1RRBA 3QJZA 5IN7A 2BGFA 2Z0EB 1HZ6A 2I5FA 2W2WA 2H7DA 2JZPA 1WXVA 5H8YE 1FM0D 4FXCA 5DH9B 4BKTA 3A4RA 4JKGA 1JRUA 4N6EB 2K8CA 2NBUA 3TEWA 2BT6A 1V1PB 1U4AA 2KNBA 3MHZA 2KFKB 4II2B 1BTNA 5DHAB 4MK0A 3S2AA 1MAIA 2KIEA 4W9LA 4ANWA 2WXPA 3PZDA 1SXTA 2PIAA 2FDQA 5CHWA 2R2OA 2L0TA 4QXAB 2KLGA 5LOPB 3AE9B 5JZEB 2GUMA 3CSFA 3CSTA 2Q5WD 4AS1A 2XN9C 1Z2MA 3AN1A 1ZPSA 4WSFA 5E6NA 1QOAA 1U29A 1K53A 3JYUA 2XK5B 2GMIC 2PJHA 3AJ4A 3FILB 3DCGA 3TCAA 3B0AA 2FCMA 4K2PA 3R2TA 2FCSA 3NUHB 4KVGB 2VSZA 2DFKA 2LJIA 1DGJA 3MJ5A 4BBNF 2NBWB 3AULA 2BWES 3P2BA 2J0MA 4FA6A 2CY5A 4PT5A 4ANXA 2GLSA 1FHWA 1ZUD2 4OVUA 1XCTL 1JWSD 2K25A 1HB6A 2PVOD 1OQRA 2BYVE 2ZPNA 4C00A 2L00B 5D6JB 2INDC 1ZYIA 2Q13A 3FILA 2PVGC 4EMOA 4EE2A 1T6BX 1SJHD 4GDLB 3JSVA 3IXSA 5DPWA 2JZZA 2LKOA 2N9LA 2QCZA 3DWMA 4HPPA 2BPSA 2CAYA 2ZCBA 1FCCC 2KUPA 4FJZA 4OVZA 4LDTB 1DOYA 1GUAB 1OFFA 1XO3A 1MK9B 3DVGY 3OJ4B 4LNKA 2W3RA 4B9KA 3RNAC 5J3QA 2ZKMX 2LVPA 2JVCA 1KTKA 2LRUA 3R66C 2LOXA 3O96A 1MJDA 5J3TA 1P7EA 2BVCA 3FVCA 3AU4A 1NEKB 3KSYA 2MBBB 4L2YA 5IAAC 2FNJB 1KZGA 1WF9A 2N0SB 4HVBA 2WU5B 2KR0A 2EJ8A 2COCA 1N61A 4RNAA 1OMWA 2AWTA 1VBGA 1E90A 4G11A 4D0NB 3LYYA 2K6QA 4REZA 5HHDG 1I35A 3H9DA 4RMAA 1A70A 2MW5A 3TUOA 3L08A 2Y8GA 3R8BA 1NVLA 4NY0A 4LNIA 1VBHA 5C16A 1YN5A 3HSAA 3AH7A 1MPHA 1BTKA 1QOGA 2ABDA 4DXFA 5JXVA 1GPXA 2BYEA 2FE8A 4OHJA 5C23A 2D5GA 4KKJA 3KWLA 1JWBD 3VUWA 1WX9A 2PE6B 3V05A 2GCJA 2N1VA 2HTHA 2CHXA 3I3TB 2ADZA 4XDDA 4C80A 2PW9A 2Y7BA 1B55A 2R82A 2KMMA 2AEHA 3HUIA 4LTUA 2ZEQA 2KC2A 3AXCA 2PMVA 1MPEA 2MJDA 3B2GA 2IDYA 4A6HA 2YLMA 4HPLB 4TSSA 1TS2A 2J7QB 1E7PB 1XXGA 3HIEA 2WDVB 3A1QA 3RNCC 4RF1A 4ICVA 2GOWA 2BB5A 1K5DB 3C19A 4XC2A 5FKAC 1WGUA 1V1OA 2X18A 1FD6A 3PSCA 1WYWB 3NVZA 5KQ4A 2P8VA 1WR1A 2UVMA 2YS5A 5JLJB 2BWFA 3PP2A 1OQQA 1ZW7A 4DBGA 5FI1A 3GYPA 4CQNA 2COPA 1WJMA 1Y56A 1YMHE 2LGXA 3MP9A 3ODWA 3VQIA 4AOFA 3BY4B 1FNUA 3N7CA 5TR5A 3V3XA 2BQQA 4KKIA 4PS8A 4W9EA 3TL5A 2OJRA 2W82A 3M1IB 1PGBA 1DROA 1EGXA 4NAWA 2DENB 1KM7A 2HD5B 2D9ZA 1JWUD 3AE2B 2Z0PA 2J0KA 2HJ1A 4RFBA 2TSSA 4HCPB 2DN6A 2V1YA 4QJ5B 1YX6B 1WI0A 2BYTA 5HE1A 1ZP0B 4KGRA 4RGMA 2KCJA 1V8CA 5GOWB 3MFGA 2KWDA 4HAZB 4N58A 3SNHA 2FCQA 3VTVA 1ZDXA 1YX5B 3PZ7A 3KLSX 2WX0A 2KMCA 1D5ZC 2KTFA 3APFA 4Z2MB 3H7SA 1R4NB 1WSPA 4NPNA 5D7GA 4ZRJA 2D9VA 1JMLA 3A33B 5JP4A 2KFJA 3U7DA 3ZNGC 2IFSA 2WXNA 3T9LA 1KJTA 3ZUNA 4MACA 4JIOU 1T5XD 4ZHOA 5J17A 1PLSA 3NJTA 4J6IA 4XZ4A 1WRDB 5DPTA 4BKSD 1Q1OA 2JY6A 3OG5A 1TJ6A 3VTUA 4OW0A 2IYDB 2RGFA 1WY8A 2LHDA 1WE6A 1ZDVA 1XODA 2MSED 1GB1A 4XWWA 2ZW0A 4P1CC 3NOBA 2LEKA 3PZ8A 1IUEA 1FGZA 2KYWA 4WQOB 2WXRA 4IM0A 2YEPB 1OY2A 2LI5A 3N20C 4OZCA 1PDXA 4DHZE 2IO0B 3IFWB 3R7RA 1WM3A 3CIRB 4HLEA 1NTIA 5D3YA 2ZPYA 1FAOA 3MHSD 1IBXA 1SE3A 4I6NB 3UIOB 1KRHA 3ZNZB 4CHJA 1WGYA 1YIWA 1Q67A 1BXTA 4WJNA 5AUKA 5IRSA 3SR6A 4K2OA 2DKQA 5DPRA 1UWMA 1E8WA 5C1ZA 5KHOA 5FK9C 1C4CA 2LVQA 4ASWC 1SBBB 4EZKA 4WURA 2L1CA 4YTNB 4A90A 3ZJVA 2Z59A 4JPSA 1HB8A 5BYQA 4HB2B 2ELAA 1V89A 2Z0DB 4N9F4 2D07B 2WP9B 2DYBA 4IWQA 2MQJA 4C0AA 2DIKA 2CHWA 1LFDA 3A8PA 4B95A 1MG8A 2MBHA 4W9CA 3P4SB 2WDRB 4TKNA 1KFYB 3M62B 3HVDA 1QQRA 2C7NB 2R2YA 2ZVNA 3PLUA 1E8YA 1S1QB 5G5GA 2B3AA 3WAPA 5G55A 2D9WA 4M0WA 2VH1A 2CODA 2LASA 1TXDA 1ZVRA 5G2NA 2YT0A 3L17A 1WG7A 3DQVA 1V97A 4A20A 5DHFB 4C4VB 3VUYA 4IM3A
chains in the Genus database with same CATH topology
3KUZA 1UZXB 4TQ0A 2UYZB 3X0WA 2M0XA 3ZW3A 2MA9B 1WXSA 2V4LA 2LZ6A 4NSWA 5JHHA 2LVOA 4K17A 3RZFA 4WJQA 4GPTB 2LXCA 1AARA 4ILHA 2HJ8A 2IYBA 3WAMA 4B6HA 1P98A 3E9OA 4HDOA 4MSQB 3PS6A 2WWZA 5KQ1A 4EZJA 3DXCA 3VH3B 1V5PA 3L54A 2WH5A 2W2XC 3FP5A 5HE2A 2XQNM 2RPQA 5C79A 4WWPA 4CYEA 4XX5A 3EFUA 5J3YA 1ACAA 5CHVC 3MJWA 4A3PA 1U2BA 3ZO5B 3QC8B 3VH4B 2G4DB 2M4NA 4I6LB 3WIMA 1UNPA 4KIKB 1V5OA 4MDKE 4GB9A 1Z87A 2RUKB 1E8ZA 4JKFA 4GXBA 1X1MA 1WI1A 4I6PA 4K7SA 1E8XA 4W9KA 2DAJA 4HATB 2DA0A 3ZNHB 3WA0A 4HJKA 5EFXA 1I7AA 3LJUX 3UIPB 3H6NA 2JRHA 1X05A 1PMSA 2LULA 3DBRI 4K7WA 4MJSA 3H7PA 2C60A 1X1FA 3A8QA 3IHPC 2FIDA 4HPMB 3D8EA 1SE9A 3W1SC 2MFQA 4BBNC 4IG7B 2ZNVB 2UWQA 1FB8A 2N7EA 3EHVA 2MKRA 1RFAA 3JW0X 3L0WB 1W1GA 3VOQA 4ANVA 4LJPB 1WZ0A 4FHJA 3ULCA 1V5TA 1KOTA 1OQYA 2YF0A 4NAWB 4PS3A 2QKLA 5DPSA 2LJ5A 4F1SA 2CU1A 2GJYA 1LXDA 1GGOA 1U5GA 2Z0OA 3PHXB 4BBKA 2K00A 2IZVB 2XK5A 3APCA 2O2VA 1V49A 4ZYNA 2LOZA 3A98B 4JK8A 3NZUA 3A4SC 4TV3A 2JUOA 2JXXA 1R4MI 4IUMB 2LGDA 1WE7A 3VVWB 1H8CA 1PFJA 3TO1A 2ZJDA 2N9PC 1TQZA 2L7RA 3QWZB 2NR2A 5D27A 4NQKE 2DZIA 2RVBB 1V5MA 2MP2A 3N3KB 3VHTC 3UINB 4GU2A 3KY9A 4PQ0A 2LGYA 1UNQA 5AZFA 2COAA 2XEWA 2MRPA 1FGYA 3QBVB 2KQSA 3M95A 2N1WA 1XKEA 1QC6A 2GCLA 5LXHA 4IC7B 4KSLC 5HE0A 1WM2A 4GOCA 4CHKA 2YT1A 3V6CB 4DX8A 4WVFB 3ENBA 2ZVOA 3ODXA 4TUUA 2N9XA 4G3XB 3LJ3A 2KZRA 2NMBA 5KHQA 4FLHA 3PVLA 3PT2B 1PQSA 4E74A 2CQUA 3NS8A 3BJIA 4BKGA 4HAYB 2JF5A 2D11A 2UZRA 5E6OA 2J0JA 2KDBA 3IG3A 1Q5WB 1LQBA 3QWMA 4NNJB 4KZCA 5JHAA 3ECIA 1V6EA 1P6SA 3K9OB 4IAPA 1C3TA 4EKUA 2LG1A 2LD9A 1SHCA 2OTXA 2DAFA 2GBJA 3G9WA 1DYNA 4JKBA 4GDLA 1X1GA 3KZ1A 1MIZB 2KK8A 2BCJA 2MCNB 1WXMA 3A9JA 3D32A 1UELA 3FM8C 1RJ2A 1OQNA 1LB1A 2CRFA 2KXJA 2K39A 2KDFB 1KC7A 5L83A 2EMTA 1P0RA 2FUHB 2WX1A 3TW1A 2D4QA 2DKPA 4K1RB 2E2XA 3ML9A 3N32A 5CLQB 1C1YB 4F7GA 1Y8RC 3WANA 1TTNA 2KMAA 2DX1A 3RUIB 3ZDMC 3A9KB 3P7ZA 1WGDA 2KFKA 3OANA 2MBEA 2JRIB 3KUDB 2NZ8B 3RYTA 1NU2A 1CMXB 2KQ7A 3F0WA 4M8MA 3DOWA 2DHKA 1ZGUB 5DIFB 4JKAA 1XT9B 1DDVA 4ILGB 2WYQA 1P9DU 2DZJA 3UQAA 3B08A 4XWXA 3QAQA 4MELA 1WGHA 5CHFA 4MGZE 3VIAA 4F7ZA 3PRZA 2M38A 4URKA 4KAXB 4FHKA 2KX0A 2NPTB 1WMHA 5GMVA 2RSUA 3FSSA 1YJ1A 3L16A 4HWIB 3V6EB 3GZNI 1E5WA 4ANUA 2KDIA 2EC1A 3HQCA 4JGHB 2LUEA 2YSZA 4GDKB 3BINA 3ULBA 4HB0B 2AL3A 3TVVA 3HW2B 2EKEC 1BT0A 1QZEA 1EAZA 3SD5A 4FN2A 1WIAA 2JP2A 2W2XD 4A3OA 2KANA 4KDIC 5C5BA 1LW3A 4KV2A 2KVRA 1MKEA 2L0FA 3H7PB 3DXEA 1V88A 1BAKA 1HBKA 1GJZA 2Y8FA 4Z2NA 1NTYA 2RD0A 1OEYA 1KBLA 3ONSA 1U5FA 2ELBA 2C7HA 2M14A 3PRMB 4MY6A 2N23A 1Y5OA 4JK7A 3PVWA 3KYDD 1U27A 3W1YA 3V5WA 3SV1A 3W1SA 1FHOA 3SBTA 4PYUA 4K81A 3PREA 2K2UA 2HRJA 2JZ3B 1V86A 3ZTCA 3UF8A 4JKHA 1XCGA 1M94A 2DYMA 4B6WA 4ZRIA 3SYXA 4FJYA 1ISNA 1VCBA 3QCAA 2BYFA 4BKSA 4AJWA 2KN5A 4JL9A 4BOZB 3ZDTA 4PNKA 1EF5A 2Z59B 4HXDA 4IOYX 1AWEA 3PV1A 4M0WB 2LYDA 2UZSA 2DX5B 1L2NA 1ZSQA 2EMSA 2L2IA 5CLLB 2L8JA 2DTCA 5E6PA 2G35A 2M1MA 1IYFA 4HAVB 4RM8A 3AU5A 2RGNB 2K8HA 4GMXB 4W9DA 4MH0E 1WJ4A 4W9GA 4DHZB 2YRYA 2DZKA 4NJ6A 1Y19B 4E3CA 4KHBB 3C0RB 3HHMA 4EZLA 3PPAA 4FADA 2MWSB 4WWOA 1WFYA 3PEGA 3RULA 2GBRA 4GIVA 4HHVA 3U8ZA 2ZZPB 1RLFA 2N7DA 4DHJB 4II3B 1U5DA 1S3SG 4H8SA 5CTRC 1AQCA 4DX90 4OVVA 4LJOB 2X0SA 3DBLI 3EECA 3ZKJC 1UPQA 1M7EA 1ZC3B 1XR0B 2OQBA 1WR6E 4HAUB 2NS5A 3PRPB 4DDID 4F7HA 2CR5A 2O6VB 3DPDA 3ML4A 4A5KA 1SIFA 3HIZA 1D3ZA 3KYCD 2QHOA 4LDTD 5IJMA 5J2RA 3MPXA 3GOEA 2DHZA 2BKRB 3K9PB 4W9IA 1TGZB 4MGKE 2M17A 3CMMB 2O2VB 1WGQA 3DBSA 3QK0A 3P6AA 5D94A 2JT4B 4ILJA 2CHZA 2MX2A 3V61A 2VRWB 5DI9B 4IW0A 4MEMA 1EO6A 1WJNA 1T0YA 2N9EB 3NY5A 4HDQA 5AZHA 2KKCA 4X57B 4M8NA 4KZ0A 2KX3A 2DLWA 3WYFB 2HTHB 1QQGA 1K5GB 4IFSA 2FIFA 3QIJA 3EC8A 1H10A 4TQ1A 3UZTA 2RNRB 3JVZX 1RRPB 1L7YA 2KJHB 3ZRFA 4KSKC 3VDZA 2W9NA 2GBNA 1UBIA 3MDBC 5KCVA 2DZMA 3L10B 1WXAA 3KUCB 3D8DA 3M3JA 4MSMB 2C7MB 4DK5A 4GSWA 4WJOA 2BKFA 2WDTB 3ENEA 1IPGA 3N30A 1ZM0A 1N3HA 3RT3B 4IWOA 4BVUC 3TFMA 2V76A 3SO6A 1OTRB 2M8SA 3PGEA 3Q3JA 2C5LC 5D3WA 3ZIMA 1TZ1A 3WALA 2QKMA 1UD7A 4HAWB 1EF1A 2D9XA 1XD3B 1OGWA 4F8CB 1XX0A 3KRXA 3RD2A 3R3MA 2DYOA 3O65B 3PTFC 3M63B 1WVHA 2DHIA 4ZRKA 1Q0WB 5C5BB 4Y94A 2MDXA 5EDSA 1WH3A 4RM9A 2JPHA 2FCNA 3H1UA 3V62A 3VXWA 2FJLA 4GZUA 2V3SA 4JQWC 3ODOA 2G4SA 2RSGA 2ZCCA 3VAWA 3DDCB 1NI2A 1WGGA 1X11A 4EUTA 3ZLZA 3CF6E 4FULA 3WAOA 2JWZA 3TMPB 3FEHA 2ROZB 2OOBB 3SU8X 2CY4A 1ZKHA 4BFRA 4HAXB 2A4ZA 4WJPA 3HK0A 1EUVB 1P3QU 2GBKA 1OEYJ 4KIKA 3ZTDA 4G0NB 1FHXA 4HB4B 5L95C 2R0DA 3PVUA 4LCDE 2MBOA 3ZVVA 1GG3A 1BWNA 1KZ7A 4EJNA 3RCPA 3ML8A 4G50A 4NJ7A 3SUZA 4KDLB 2KDEB 1GNUA 2DYQA 2O6VA 2VKIA 4F7UP 2L05A 4BOSC 2I1JA 2NCNA 4IM2A 2IO2B 4YONA 2CS4A 3KRWA 2PPHA 4P7IA 4YL8A 4PYZA 3TIXA 1NTVA 4EEWA 2N0YA 2MWNB 3E9LA 3NSUA 1W1HA 1XQQA 3V60A 2PE9A 1GC6A 3QQ8B 2FJ9A 3APDA 2C9WB 2D2QA 3E9PA 2J59M 1NDDA 4W9JA 4A6KA 2RLOA 3JSVB 4TYZA 1DDWA 3SDLC 2K6DB 3IBEA 2G3QB 3VFKA 2IY1B 2D3GA 2PEAA 1X86A 4JLCA 3CXBB 4WJ7A 1YD8U 1I2HA 3E66A 1F9JA 1JDEA 4AUQC 4PS7A 3QHTA 2KWCA 4K7UA 1WJ1A 1WX7A 1J0WA 1E7VA 1IP9A 1FXTB 2K8BA 3AI5A 1LM8B 5JH5C 1Z5SB 2KJ6A 2LXAA 3A9JB 3R7QA 2REXA 2P0DA 2KWUB 4E71A 3NHEB 3CIKA 3L13A 4WAAA 4WWNA 2KTRA 2K1FA 2O6VD 1WZ3A 1MK7B 3ZRCA 4HK2A 1V81A 3SHQA 3UQBA 3PG7A 4JK9A 2AL6A 4IWPA 3SBGA 1I42A 2VRRB 1ST7A 4DBBA 1YQBA 2CKHB 4JKGB 3B1LX 2ZNVC 2DX5A 4KHAA 2KOXA 3ZNID 3KW5B 2IO3B 2D9YA 1KI1B 2HE7A 2P0HA 3UGBB 3IVFA 5J18A 3QX1A 4ZDVA 1KLVA 2MP2B 4HB3B 4CO7A 5LLIA 2YS3A 4FJVB 3HM6X 3HM3A 5D2MB 2NVUI 3NZSA 4HCNB 5HE3A 3T8MA 2G45B 2LRWA 4DXAB 2KO3A 5FI0A 3X23A 3GYOA 4GN1A 3LDZE 2H7EA 1M7RA 1A5RA 4L6EA 1ZC4B 2YS1A 4GGQA 3ZVRA 3QARA 5JVLA 5CX3A 3KH0A 3DXDA 1E7UA 3A1QB 2GBMA 1V80A 3FLVA 4JKDA 1WJ6A 1P5TA 3TJPA 3TBLD 2N4FA 4MT7A 1V2YA 3D8FA 4A6FB 3F5RA 1DBHA 2GS0A 4ICUA 4EOYA 1MIXA 2K2JA 1RAXA 3OLMD 4NQLB 4AP4C 4GDKA 2L3ZA 5HKHA 3MTNB 3RZWC 2NPTA 2MBQA 5D3XA 2IY0B 2A5UA 3VUXA 2R2QA 2MLBA 4MGYE 2DHJA 5AEKB 5LXIB 2KHWB 3A9KA 1R4NI 1DIKA 5D3VA 2YVCA 2IO1B 4AJYB 4W9HA 3DBHI 3Q3FA 4JKCA 2ASQA 4MGIE 1WGRA 3RCZA 1P1AA 4A6FA 4FBJB 1UEFA 2IBIB 4DHJD 1TBEA 2LBBA 2XBBC 1UH6A 2D10A 3PHWB 1J0GA 4MJSB 1SGHA 2NBVB 2DYNA 1EVHA 1WX8A 2FAZA 1J8CA 1H4RA 2CB8A 3T06A 5AZGA 2KTRB 2RQ1A 4CHMA 2L76A 5JHBA 1K8RB 1GC7A 2Z0QA 5IA7A 4GMVA 1J19A 1HE8A 3ALBA 4DWFA 1UNRA 5L81A 1WMHB 5C6RA 1UBQA 4DDGD 1W1DA 2AYOB 5JHGA 2KJRA 1IRSA 4KHOA 1UPRA 2RR9A 3DVGX 2I5CA 5FR6A 3U30A 5BO4B 5LONB 3DVNU 2COFA 2Y5BB 1V9JA 1P3RA 1V61A 2I1KA 1DDMA 1V5UA 3VTWA 3OJ3A 2BF8B 2LWPA 2P0FA 3PLVA 4MM3A 1FOEA 2KLCA 2R09A 3QA8A 4W9FA 1NBFC 2KD0A 3PSEB 2KWVB 4AWJA 2KGXB 3DVNV 1G6JA 2ROVA 1U5EA 2KC1A 3OAWA 3EPYA 1XD4A 5DCNA 1UGMA 1VD2A 4EFOA 2PZ1A 1WJUA 3KVFB 4JKEA 1RRBA 3QJZA 2BGFA 2Z0EB 2I5FA 2W2WA 2H7DA 1WXVA 5DH9B 4BKTA 3A4RA 4JKGA 1JRUA 2K8CA 2NBUA 2KNBA 1U4AA 2KFKB 4II2B 1BTNA 5DHAB 4MK0A 3S2AA 1MAIA 4W9LA 4ANWA 3PZDA 2FDQA 5CHWA 2R2OA 2L0TA 2KLGA 5LOPB 5JZEB 3CSFA 3CSTA 1Z2MA 4WSFA 5E6NA 1U29A 3JYUA 2XK5B 2GMIC 2PJHA 3AJ4A 3DCGA 3TCAA 3B0AA 2FCMA 4K2PA 2FCSA 4KVGB 2VSZA 2DFKA 4BBNF 2NBWB 3AULA 2BWES 3P2BA 2J0MA 4FA6A 2CY5A 4ANXA 1FHWA 4OVUA 2K25A 1HB6A 2BYVE 2ZPNA 2L00B 5D6JB 2Q13A 4EMOA 4GDLB 3JSVA 5DPWA 2JZZA 2LKOA 2BPSA 2CAYA 2ZCBA 2KUPA 4FJZA 4LDTB 1GUAB 1MK9B 3DVGY 3OJ4B 4B9KA 5J3QA 2LVPA 2JVCA 3R66C 2LRUA 2LOXA 3O96A 5J3TA 3AU4A 3KSYA 2MBBB 5IAAC 2FNJB 1KZGA 1WF9A 4HVBA 2EJ8A 2COCA 1OMWA 2AWTA 1VBGA 1E90A 4G11A 4D0NB 2K6QA 1I35A 3H9DA 4RMAA 2MW5A 3L08A 2Y8GA 1NVLA 4NY0A 1VBHA 5C16A 1MPHA 1BTKA 2ABDA 2BYEA 5C23A 3VUWA 1WX9A 2PE6B 2GCJA 2N1VA 2HTHA 2CHXA 3I3TB 2ADZA 2Y7BA 1B55A 2R82A 2AEHA 2ZEQA 2KC2A 3AXCA 2YLMA 4A6HA 4HPLB 2J7QB 3A1QA 4ICVA 2GOWA 1K5DB 4XC2A 1WGUA 2X18A 3PSCA 1WYWB 5KQ4A 2P8VA 1WR1A 2UVMA 2YS5A 5JLJB 2BWFA 3PP2A 1ZW7A 4DBGA 5FI1A 3GYPA 2COPA 1WJMA 2LGXA 3VQIA 3ODWA 4AOFA 3BY4B 3N7CA 5TR5A 4PS8A 4W9EA 3TL5A 2OJRA 3M1IB 1DROA 1EGXA 4NAWA 2DENB 1KM7A 2HD5B 2D9ZA 2Z0PA 2J0KA 4HCPB 2DN6A 2V1YA 1YX6B 1WI0A 5HE1A 2KCJA 5GOWB 4HAZB 3SNHA 2FCQA 3VTVA 1YX5B 2WX0A 2KMCA 2KTFA 3APFA 4Z2MB 3H7SA 4NPNA 5D7GA 4ZRJA 2D9VA 3A33B 5JP4A 2KFJA 3U7DA 3ZNGC 2IFSA 3T9LA 1KJTA 3ZUNA 4JIOU 5J17A 1PLSA 4J6IA 4XZ4A 1WRDB 5DPTA 4BKSD 1Q1OA 2JY6A 1TJ6A 3VTUA 2IYDB 2RGFA 1WY8A 1WE6A 1XODA 2MSED 3NOBA 1FGZA 4WQOB 4IM0A 1OY2A 2LI5A 4DHZE 2IO0B 3IFWB 3R7RA 1WM3A 4HLEA 1NTIA 5D3YA 2ZPYA 1FAOA 3MHSD 4I6NB 3UIOB 3ZNZB 4CHJA 1WGYA 1YIWA 1Q67A 4WJNA 4K2OA 2DKQA 5DPRA 1E8WA 5C1ZA 5KHOA 4ASWC 2LVQA 4EZKA 2L1CA 1HB8A 4HB2B 2ELAA 1V89A 2Z0DB 4N9F4 2D07B 2DYBA 4IWQA 2MQJA 4C0AA 2DIKA 2CHWA 1LFDA 3A8PA 4B95A 1MG8A 2MBHA 4W9CA 4TKNA 3M62B 2C7NB 2ZVNA 3PLUA 1E8YA 1S1QB 2B3AA 3WAPA 5G55A 2D9WA 2CODA 2LASA 1TXDA 1ZVRA 5G2NA 2YT0A 3L17A 1WG7A 3DQVA 4A20A 5DHFB 3VUYA 4IM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF6 E;  1P9D U;  4FUL A;  5LON B;  2DZJ A;  3KUZ A;  3DVN U;  3B08 A;  3UQA A;  2COF A;  1UZX B;  3WAO A;  2Y5B B;  1V9J A;  4TQ0 A;  4XWX A;  1P3R A;  2UYZ B;  1V61 A;  2JWZ A;  3X0W A;  3QAQ A;  2I1K A;  2M0X A;  3TMP B;  3ZW3 A;  2MA9 B;  4MEL A;  3FEH A;  1V5U A;  1DDM A;  2ROZ B;  1WGH A;  1WXS A;  2OOB B;  5CHF A;  3VTW A;  2V4L A;  3OJ3 A;  2BF8 B;  2LWP A;  2P0F A;  3PLV A;  3SU8 X;  2LZ6 A;  4MGZ E;  3VIA A;  4MM3 A;  2CY4 A;  4NSW A;  5JHH A;  3PRZ A;  2M38 A;  4F7Z A;  1FOE A;  2KLC A;  1ZKH A;  4URK A;  4KAX B;  4FHK A;  2KX0 A;  4BFR A;  2NPT B;  2R09 A;  3QA8 A;  1WMH A;  4W9F A;  2LVO A;  5GMV A;  4K17 A;  3RZF A;  4WJQ A;  4HAX B;  2A4Z A;  4WJP A;  4GPT B;  2LXC A;  2RSU A;  1AAR A;  1NBF C;  2HJ8 A;  3FSS A;  1YJ1 A;  2IYB A;  3HK0 A;  1EUV B;  2KD0 A;  2KWV B;  1P3Q U;  3L16 A;  3PSE B;  2KGX B;  4B6H A;  1P98 A;  2GBK A;  3DVN V;  3GZN I;  4HWI B;  3V6E B;  1OEY J;  4HDO A;  1G6J A;  2ROV A;  4KIK A;  1U5E A;  2KC1 A;  1E5W A;  3OAW A;  3EPY A;  1FHX A;  2EC1 A;  4HB4 B;  1XD4 A;  3HQC A;  2KDI A;  2WWZ A;  3PS6 A;  4ANU A;  2R0D A;  5L95 C;  5KQ1 A;  4EZJ A;  4JGH B;  3DXC A;  5DCN A;  3PVU A;  4LCD E;  2MBO A;  1UGM A;  3ZVV A;  3VH3 B;  1VD2 A;  1V5P A;  4EFO A;  3L54 A;  1GG3 A;  2LUE A;  1BWN A;  1KZ7 A;  2PZ1 A;  4EJN A;  1WJU A;  3RCP A;  2YSZ A;  3KVF B;  2WH5 A;  3ML8 A;  4GDK B;  2W2X C;  4G50 A;  3BIN A;  3ULB A;  4NJ7 A;  3SUZ A;  4HB0 B;  1RRB A;  2AL3 A;  3QJZ A;  3FP5 A;  5HE2 A;  2BGF A;  2Z0E B;  2XQN M;  2I5F A;  2W2W A;  2RPQ A;  4KDL B;  5C79 A;  2KDE B;  2H7D A;  3TVV A;  5BO4 B;  3HW2 B;  2EKE C;  4WWP A;  1BT0 A;  1GNU A;  1QZE A;  1WXV A;  1EAZ A;  2DYQ A;  2O6V A;  2VKI A;  5DH9 B;  3SD5 A;  4F7U P;  1WIA A;  2L05 A;  4FN2 A;  4BKT A;  2JP2 A;  4BOS C;  2W2X D;  3A4R A;  2I1J A;  4CYE A;  2NCN A;  4IM2 A;  4A3O A;  4XX5 A;  2KAN A;  1JRU A;  2IO2 B;  4YON A;  2CS4 A;  4KDI C;  2K8C A;  3KRW A;  2NBU A;  5C5B A;  1LW3 A;  4KV2 A;  2KVR A;  3EFU A;  2PPH A;  2KNB A;  4P7I A;  4YL8 A;  1U4A A;  2KFK B;  4PYZ A;  4II2 B;  1BTN A;  5DHA B;  3TIX A;  1MKE A;  5J3Y A;  2L0F A;  1ACA A;  1NTV A;  5CHV C;  3H7P B;  4MK0 A;  3S2A A;  1MAI A;  4W9L A;  4EEW A;  2N0Y A;  4ANW A;  2MWN B;  3DXE A;  3MJW A;  4A3P A;  3PZD A;  3ZTD A;  2FDQ A;  1V88 A;  1W1H A;  3NSU A;  1HBK A;  1BAK A;  1XQQ A;  2L0T A;  2R2O A;  5CHW A;  1U2B A;  2KLG A;  1GJZ A;  5LOP B;  3ZO5 B;  2Y8F A;  4Z2N A;  3QC8 B;  3V60 A;  5JZE B;  3VH4 B;  2G4D B;  2PE9 A;  2M4N A;  1NTY A;  3CSF A;  3CST A;  1GC6 A;  2RD0 A;  3QQ8 B;  4I6L B;  1OEY A;  3WIM A;  2FJ9 A;  1UNP A;  4KIK B;  1V5O A;  3ONS A;  4MDK E;  1Z2M A;  2C9W B;  2D2Q A;  2J59 M;  1NDD A;  3APD A;  4W9J A;  4GB9 A;  1U5F A;  4WSF A;  1Z87 A;  4A6K A;  5E6N A;  2RUK B;  2RLO A;  1U29 A;  1E8Z A;  3JYU A;  2ELB A;  4GXB A;  2M14 A;  4TYZ A;  1WI1 A;  1X1M A;  2C7H A;  2GMI C;  2XK5 B;  3JSV B;  3ZNZ B;  3PRM B;  4MY6 A;  2PJH A;  1DDW A;  4I6P A;  4K7S A;  3AJ4 A;  3SDL C;  2K6D B;  3DCG A;  3IBE A;  3TCA A;  1E8X A;  2N23 A;  2G3Q B;  3B0A A;  3VFK A;  2FCM A;  1Y5O A;  4K2P A;  2IY1 B;  2D3G A;  3PVW A;  2PEA A;  3KYD D;  2FCS A;  4W9K A;  4KVG B;  1X86 A;  2DFK A;  2VSZ A;  2DAJ A;  4JLC A;  4BBN F;  3CXB B;  1U27 A;  4HAT B;  4WJ7 A;  2NBW B;  3AUL A;  2BWE S;  3V5W A;  3W1Y A;  3SV1 A;  2DA0 A;  1YD8 U;  3P2B A;  2J0M A;  1I2H A;  3ZNH B;  2CY5 A;  1F9J A;  3W1S A;  4ANX A;  4FA6 A;  3WA0 A;  1FHO A;  4PYU A;  4K81 A;  4AUQ C;  1FHW A;  2K2U A;  2HRJ A;  3PRE A;  5EFX A;  4HJK A;  1I7A A;  4OVU A;  3LJU X;  2JZ3 B;  4PS7 A;  3QHT A;  2K25 A;  3UIP B;  1HB6 A;  3H6N A;  1V86 A;  3ZTC A;  2BYV E;  2ZPN A;  2JRH A;  2L00 B;  2KWC A;  5D6J B;  4K7U A;  3UF8 A;  2Q13 A;  1X05 A;  1WJ1 A;  1PMS A;  1WX7 A;  4EMO A;  1J0W A;  1XCG A;  1M94 A;  1E7V A;  2DYM A;  4B6W A;  4GDL B;  1FXT B;  1IP9 A;  4ZRI A;  3SYX A;  3JSV A;  4FJY A;  2K8B A;  5DPW A;  2LUL A;  3DBR I;  1ISN A;  2JZZ A;  1VCB A;  2LKO A;  4K7W A;  4MJS A;  3H7P A;  2BYF A;  3QCA A;  3AI5 A;  1LM8 B;  4BKS A;  5JH5 C;  4AJW A;  2C60 A;  1Z5S B;  2CAY A;  2BPS A;  2KJ6 A;  2LXA A;  2REX A;  2ZCB A;  2KN5 A;  3A9J B;  2KUP A;  4JL9 A;  1X1F A;  4FJZ A;  3R7Q A;  3A8Q A;  4BOZ B;  3IHP C;  4LDT B;  2P0D A;  3ZDT A;  4PNK A;  1EF5 A;  2FID A;  2KWU B;  2Z59 B;  4HXD A;  1GUA B;  3NHE B;  4IOY X;  4E71 A;  1AWE A;  4HPM B;  1MK9 B;  3CIK A;  3L13 A;  3PV1 A;  3D8E A;  3DVG Y;  1SE9 A;  4M0W B;  4WAA A;  3OJ4 B;  2MFQ A;  4WWN A;  3W1S C;  2LYD A;  4BBN C;  4IG7 B;  2UZS A;  2ZNV B;  2UWQ A;  2KTR A;  4B9K A;  2DX5 B;  5J3Q A;  4MSQ B;  2LVP A;  2JVC A;  1FB8 A;  2K1F A;  2N7E A;  2LRU A;  3R66 C;  2LOX A;  3O96 A;  1L2N A;  1ZSQ A;  3EHV A;  2MKR A;  1RFA A;  5J3T A;  3JW0 X;  2EMS A;  3AU4 A;  3L0W B;  2L2I A;  3KSY A;  1W1G A;  2O6V D;  2MBB B;  3VOQ A;  4ANV A;  5IAA C;  2FNJ B;  1KZG A;  4LJP B;  1WF9 A;  1WZ0 A;  3ULC A;  1V5T A;  4FHJ A;  4HVB A;  5CLL B;  2L8J A;  1KOT A;  1WZ3 A;  2DTC A;  1MK7 B;  2COC A;  2EJ8 A;  5E6P A;  1OQY A;  3ZRC A;  4HK2 A;  2G35 A;  1OMW A;  2YF0 A;  2M1M A;  2AWT A;  4NAW B;  1V81 A;  4PS3 A;  2QKL A;  5DPS A;  3SHQ A;  2LJ5 A;  3UQB A;  4HAV B;  4F1S A;  1IYF A;  3PG7 A;  1E90 A;  2CU1 A;  2GJY A;  4G11 A;  2AL6 A;  4D0N B;  1LXD A;  4IWP A;  2K6Q A;  3AU5 A;  2VRR B;  4RM8 A;  2RGN B;  2K8H A;  3H9D A;  1I42 A;  1I35 A;  4RMA A;  1U5G A;  2Z0O A;  1ST7 A;  4GMX B;  2MW5 A;  4DBB A;  3PHX B;  4W9D A;  3L08 A;  2Y8G A;  4BBK A;  4G0N B;  1YQB A;  2K00 A;  4MH0 E;  2CKH B;  1NVL A;  4NY0 A;  1WJ4 A;  2IZV B;  4W9G A;  4DHZ B;  5C16 A;  3B1L X;  2YRY A;  2DZK A;  2XK5 A;  3APC A;  2ZNV C;  2DX5 A;  4NJ6 A;  1Y19 B;  2O2V A;  4E3C A;  4KHA A;  1V49 A;  1MPH A;  1BTK A;  4KHB B;  2KOX A;  2LOZ A;  3A98 B;  4ZYN A;  3ZNI D;  3C0R B;  2ABD A;  3HHM A;  2IO3 B;  3KW5 B;  2BYE A;  2D9Y A;  1KI1 B;  4EZL A;  2HE7 A;  2P0H A;  3NZU A;  3PPA A;  4FAD A;  3UGB B;  5C23 A;  3A4S C;  3IVF A;  4TV3 A;  2MWS B;  5J18 A;  4WWO A;  3QX1 A;  4ZDV A;  1WFY A;  2MP2 B;  2JUO A;  1KLV A;  3VUW A;  1WX9 A;  2PE6 B;  2JXX A;  2GCJ A;  3PEG A;  1R4M I;  2N1V A;  4IUM B;  3RUL A;  2HTH A;  2GBR A;  2LGD A;  4GIV A;  2CHX A;  4HHV A;  3U8Z A;  4HB3 B;  2ZZP B;  1RLF A;  1WE7 A;  2N7D A;  3I3T B;  2ADZ A;  3VVW B;  5LLI A;  4CO7 A;  4DHJ B;  1H8C A;  1PFJ A;  4II3 B;  1U5D A;  2YS3 A;  3TO1 A;  4H8S A;  1S3S G;  4FJV B;  3HM6 X;  5CTR C;  2ZJD A;  2Y7B A;  2N9P C;  1B55 A;  1AQC A;  1TQZ A;  4DX9 0;  2AEH A;  3HM3 A;  4OVV A;  2ZEQ A;  2KC2 A;  3AXC A;  4LJO B;  2L7R A;  3DBL I;  3QWZ B;  2NR2 A;  5D2M B;  2NVU I;  3NZS A;  4AWJ A;  3EEC A;  5D27 A;  4HCN B;  5HE3 A;  3T8M A;  3ZKJ C;  2G45 B;  1UPQ A;  4A6H A;  2YLM A;  4HPL B;  2J7Q B;  1M7E A;  2LRW A;  3RYT A;  4NQK E;  2DZI A;  2RVB B;  1ZC3 B;  4DXA B;  1XR0 B;  2KO3 A;  1V5M A;  3ZLZ A;  2OQB A;  2MP2 A;  5FI0 A;  3X23 A;  1WR6 E;  3GYO A;  4GN1 A;  3LDZ E;  2H7E A;  4HAU B;  3N3K B;  3VHT C;  1M7R A;  3A1Q A;  2NS5 A;  3UIN B;  1A5R A;  3PRP B;  4GU2 A;  4ICV A;  3KY9 A;  2GOW A;  4GGQ A;  4PQ0 A;  2LGY A;  1UNQ A;  1K5D B;  5AZF A;  2COA A;  2XEW A;  4DDI D;  4XC2 A;  2MRP A;  3WAM A;  1WGU A;  1FGY A;  4L6E A;  2X18 A;  3PSC A;  1WYW B;  1ZC4 B;  3QBV B;  5KQ4 A;  4F7H A;  2KQS A;  2P8V A;  1WR1 A;  2CR5 A;  2N1W A;  3M95 A;  2UVM A;  2YS1 A;  2YS5 A;  1XKE A;  2O6V B;  3ZVR A;  5JLJ B;  2BWF A;  1QC6 A;  3PP2 A;  1ZW7 A;  3DPD A;  4DBG A;  2GCL A;  5FI1 A;  3GYP A;  3QAR A;  2COP A;  5LXH A;  4IC7 B;  5CX3 A;  1WJM A;  3ML4 A;  2LGX A;  3VQI A;  3ODW A;  3DXD A;  1E7U A;  3KH0 A;  4AOF A;  3BY4 B;  4KSL C;  3N7C A;  5HE0 A;  1WM2 A;  5TR5 A;  4GOC A;  4CHK A;  4PS8 A;  4W9E A;  2YT1 A;  4A5K A;  1SIF A;  3A1Q B;  3HIZ A;  3TL5 A;  2OJR A;  3M1I B;  1D3Z A;  1DRO A;  1EGX A;  3KYC D;  4NAW A;  3V6C B;  4DX8 A;  2DEN B;  4WVF B;  1KM7 A;  2GBM A;  1V80 A;  2QHO A;  2HD5 B;  4LDT D;  2ZVO A;  3ODX A;  4TUU A;  2D9Z A;  3FLV A;  1WJ6 A;  2N9X A;  4G3X B;  2Z0P A;  2J0K A;  5IJM A;  5J2R A;  1P5T A;  3LJ3 A;  2KZR A;  3TJP A;  3MPX A;  3GOE A;  2NMB A;  3TBL D;  2DHZ A;  5KHQ A;  2BKR B;  3K9P B;  4HCP B;  2DN6 A;  2N4F A;  2V1Y A;  4FLH A;  4W9I A;  3PVL A;  1YX6 B;  1WI0 A;  1TGZ B;  4MGK E;  4MT7 A;  5HE1 A;  2M17 A;  3CMM B;  3PT2 B;  1V2Y A;  2KCJ A;  3D8F A;  2O2V B;  4A6F B;  1WGQ A;  5GOW B;  1PQS A;  3DBS A;  2CQU A;  4E74 A;  3F5R A;  4HAZ B;  1DBH A;  2GS0 A;  3P6A A;  3QK0 A;  5D94 A;  3SNH A;  2FCQ A;  2CHZ A;  2JT4 B;  4ICU A;  3VTV A;  2MX2 A;  1YX5 B;  4EOY A;  1MIX A;  3V61 A;  2K2J A;  1RAX A;  3NS8 A;  2WX0 A;  3BJI A;  3OLM D;  2VRW B;  5DI9 B;  2KMC A;  4IW0 A;  4MEM A;  4NQL B;  4HAY B;  1EO6 A;  2D11 A;  2UZR A;  1WJN A;  4Z2M B;  2JF5 A;  2KTF A;  3APF A;  5E6O A;  3H7S A;  1T0Y A;  2N9E B;  3NY5 A;  4HDQ A;  4NPN A;  4AP4 C;  2J0J A;  5D7G A;  2KDB A;  5AZH A;  2KKC A;  4X57 B;  4ZRJ A;  3IG3 A;  4M8N A;  4GDK A;  2D9V A;  1Q5W B;  1LQB A;  3A33 B;  2L3Z A;  3QWM A;  2KX3 A;  5JP4 A;  4KZ0 A;  4NNJ B;  2DLW A;  3U7D A;  3WYF B;  2KFJ A;  2IFS A;  3MTN B;  3ZNG C;  3RZW C;  2HTH B;  4KZC A;  2NPT A;  2MBQ A;  3T9L A;  1QQG A;  1KJT A;  3ECI A;  1K5G B;  4IFS A;  1V6E A;  2FIF A;  5HKH A;  5JHA A;  3QIJ A;  1P6S A;  5D3X A;  2IY0 B;  3EC8 A;  3ZUN A;  3K9O B;  1H10 A;  4IAP A;  2A5U A;  4JIO U;  1C3T A;  4TQ1 A;  3UZT A;  3VUX A;  4EKU A;  2R2Q A;  2LG1 A;  1PLS A;  5J17 A;  2RNR B;  2MLB A;  4J6I A;  2DHJ A;  3JVZ X;  1WRD B;  2LD9 A;  4MGY E;  4XZ4 A;  1SHC A;  1RRP B;  1L7Y A;  2OTX A;  5AEK B;  2KJH B;  5LXI B;  5DPT A;  2KHW B;  1Q1O A;  4BKS D;  2DAF A;  3ZRF A;  2JY6 A;  2GBJ A;  3G9W A;  1TJ6 A;  3A9K A;  4KSK C;  3VTU A;  1R4N I;  1DYN A;  4GDL A;  2IYD B;  2RGF A;  1WY8 A;  1X1G A;  1WE6 A;  3KZ1 A;  2YVC A;  5D3V A;  2IO1 B;  5AZG A;  4AJY B;  4W9H A;  1MIZ B;  1XOD A;  2MSE D;  3VDZ A;  2KK8 A;  3DBH I;  2BCJ A;  3Q3F A;  2W9N A;  2GBN A;  2MCN B;  1UBI A;  3NOB A;  3MDB C;  5KCV A;  2DZM A;  2ASQ A;  3L10 B;  4MGI E;  1WXM A;  1WXA A;  3A9J A;  3KUC B;  1FGZ A;  4WQO B;  3D8D A;  1WGR A;  3D32 A;  1UEL A;  3M3J A;  4IM0 A;  3RCZ A;  1OY2 A;  3FM8 C;  1P1A A;  2LI5 A;  4MSM B;  2C7M B;  4DHZ E;  2IO0 B;  4A6F A;  1RJ2 A;  1OQN A;  3IFW B;  1LB1 A;  4FBJ B;  2CRF A;  1UEF A;  2KXJ A;  3R7R A;  1WM3 A;  4DK5 A;  4HLE A;  1NTI A;  5D3Y A;  2ZPY A;  2IBI B;  2K39 A;  1FAO A;  2BKF A;  2KDF B;  4GSW A;  2WDT B;  3ENE A;  3MHS D;  4WJO A;  1TBE A;  4DHJ D;  1IPG A;  2LBB A;  3N30 A;  4I6N B;  5L83 A;  3UIO B;  2EMT A;  1P0R A;  2XBB C;  4CHJ A;  1WGY A;  1ZM0 A;  1Q67 A;  1N3H A;  1YIW A;  1UH6 A;  2FUH B;  2D10 A;  2WX1 A;  3PHW B;  4DWF A;  1J0G A;  3TW1 A;  2D4Q A;  4WJN A;  2DKP A;  4K1R B;  3RT3 B;  4IWO A;  4BVU C;  2E2X A;  4MJS B;  3TFM A;  2V76 A;  4K2O A;  1SGH A;  3SO6 A;  1OTR B;  2M8S A;  2NBV B;  3ML9 A;  3PGE A;  3Q3J A;  2C5L C;  5CLQ B;  3N32 A;  5D3W A;  3ZIM A;  2DKQ A;  1C1Y B;  5DPR A;  2DYN A;  4F7G A;  1E8W A;  1TZ1 A;  5C1Z A;  5KHO A;  4ASW C;  1EVH A;  2LVQ A;  3WAL A;  1WX8 A;  1Y8R C;  4EZK A;  2L1C A;  2QKM A;  1UD7 A;  2FAZ A;  3WAN A;  1TTN A;  1J8C A;  1H4R A;  1HB8 A;  2KMA A;  2CB8 A;  4HAW B;  1EF1 A;  2D9X A;  1XD3 B;  2DX1 A;  4HB2 B;  2ELA A;  1OGW A;  1V89 A;  2Z0D B;  4N9F 4;  2D07 B;  4F8C B;  3T06 A;  1XX0 A;  3RUI B;  2KTR B;  2RQ1 A;  3KRX A;  2DYB A;  3A9K B;  3R3M A;  2MQJ A;  4C0A A;  2DYO A;  4IWQ A;  3RD2 A;  3ZDM C;  4CHM A;  3O65 B;  2CHW A;  2L76 A;  3PTF C;  1LFD A;  1WVH A;  2DHI A;  3M63 B;  3A8P A;  4B95 A;  1MG8 A;  2MBH A;  4ZRK A;  3P7Z A;  1WGD A;  2KFK A;  1Q0W B;  4W9C A;  3OAN A;  2MBE A;  5JHB A;  2JRI B;  3KUD B;  5C5B B;  4BKG A;  2NZ8 B;  4TKN A;  1K8R B;  4Y94 A;  3M62 B;  1GC7 A;  2Z0Q A;  5IA7 A;  2MDX A;  5EDS A;  4GMV A;  1WH3 A;  1J19 A;  1HE8 A;  3ALB A;  4RM9 A;  2C7N B;  1UNR A;  2JPH A;  2FCN A;  5L81 A;  2ZVN A;  1NU2 A;  1CMX B;  1WMH B;  5C6R A;  1E8Y A;  1UBQ A;  3H1U A;  3PLU A;  3V62 A;  3VXW A;  4DDG D;  1S1Q B;  2KQ7 A;  2FJL A;  4GZU A;  1W1D A;  2B3A A;  3F0W A;  2V3S A;  2AYO B;  4JQW C;  2D9W A;  5G55 A;  3WAP A;  4M8M A;  3DOW A;  5JHG A;  2COD A;  2KJR A;  1TXD A;  2LAS A;  1ZVR A;  1IRS A;  2DHK A;  3ODO A;  1ZGU B;  5G2N A;  4KHO A;  2YT0 A;  5DIF B;  2G4S A;  1WG7 A;  3L17 A;  1UPR A;  2RSG A;  2RR9 A;  2ZCC A;  3DQV A;  3DVG X;  1XT9 B;  3VAW A;  1DDV A;  2I5C A;  3DDC B;  5FR6 A;  4A20 A;  5DHF B;  3U30 A;  1NI2 A;  1WGG A;  1X11 A;  4EUT A;  2WYQ A;  3VUY A;  4IM3 A; 
#chains in the Genus database with same CATH topology
 2W55 A;  3KUZ A;  1UZX B;  4TQ0 A;  2UYZ B;  3NVW A;  3X0W A;  1MI0 A;  3ZYY X;  1I4G A;  2M0X A;  3ZW3 A;  2MA9 B;  1QLB B;  1WXS A;  2V4L A;  2X8X X;  3BII D;  2M0A A;  2LZ6 A;  3DHG C;  5BYR A;  4NSW A;  5JHH A;  1BUI C;  1FRD A;  1FNV A;  2LVO A;  4K17 A;  3RZF A;  4WJQ A;  4OT1 A;  4MH8 A;  1E6E B;  4GPT B;  2LXC A;  4K3C A;  1AAR A;  4S17 A;  4ILH A;  2HJ8 A;  2IYB A;  1I4P A;  3WAM A;  4B6H A;  1P98 A;  3U7Z A;  3E9O A;  2WDQ B;  4HDO A;  4MSQ B;  3PS6 A;  2WWZ A;  5KQ1 A;  4EZJ A;  3DXC A;  1JQ4 A;  3W9C B;  3VH3 B;  3P4R B;  1V5P A;  1QKZ A;  3L54 A;  2WH5 A;  2WS3 B;  3ZJU A;  2W2X C;  2AQ2 B;  2UU7 A;  3FP5 A;  5HE2 A;  2XQN M;  1MVK A;  2RPQ A;  5C79 A;  4A55 A;  2D3B A;  4WWP A;  3GZN B;  4K3B A;  3OWE B;  3GE8 C;  4CYE A;  4XX5 A;  1L0Y B;  4LNF A;  2QMT A;  4XDC A;  2K5P A;  2D3A A;  3EFU A;  1D5M C;  2AQ3 B;  4UDU C;  5J3Y A;  1ACA A;  3GB1 A;  5CHV C;  3BYT B;  1VZ6 A;  3MJW A;  4A3P A;  1U2B A;  1WYG A;  3ZO5 B;  1TJE A;  2YT2 A;  3QC8 B;  1EWY C;  3VH4 B;  2G4D B;  2M4N A;  4I6L B;  3WIM A;  1UNP A;  4KIK B;  1V5O A;  4MDK E;  4GB9 A;  1Z87 A;  3SEB A;  2GI9 A;  4HSI A;  1VR9 A;  2RUK B;  1E8Z A;  4JKF A;  1EWC A;  4GXB A;  1X1M A;  1WI1 A;  2FBW B;  5EE9 A;  1UF0 A;  4I6P A;  4K7S A;  1E8X A;  4WIP A;  4YSZ B;  2QJL A;  3P4Q B;  4W9K A;  2DAJ A;  1AW7 A;  4HAT B;  1J7C A;  1N62 A;  3Q3M C;  2DA0 A;  1FFV A;  5G5H A;  3ZNH B;  3WA0 A;  1RYJ A;  4HJK A;  5EFX A;  1I7A A;  3LJU X;  2K8E A;  3UIP B;  3H6N A;  4ZHP A;  2JRH A;  1X05 A;  1UWX A;  1PMS A;  4NAM A;  2LUL A;  2KAC A;  2J53 A;  1AYF A;  2NBV A;  3DBR I;  4K7W A;  4MJS A;  3H7P A;  2BS4 B;  2C60 A;  5I4D A;  1LO5 D;  1XLO A;  1X1F A;  1NYQ A;  3A8Q A;  1C9F A;  3IHP C;  3Q2A C;  2FID A;  2WXJ A;  2IGD A;  1I4X A;  4HPM B;  5HI1 A;  3D8E A;  1YJI A;  1SE9 A;  1UNS A;  2G1E A;  2MFQ A;  3W1S C;  3BYY B;  4BBN C;  4IG7 B;  2KN4 A;  2ZNV B;  2UWQ A;  1FB8 A;  2N7E A;  1TZO A;  3EHV A;  2MKR A;  1RFA A;  3JW0 X;  3L0W B;  1AN8 A;  1W1G A;  3DHI C;  3VOQ A;  1DOI A;  4ANV A;  2KT7 A;  4LJP B;  1ACC A;  1WZ0 A;  3ETR A;  3ULC A;  1V5T A;  4OSN A;  4FHJ A;  5HG2 A;  1KOT A;  1ET6 A;  2QC8 A;  4JWS C;  1OQY A;  2YF0 A;  1TYG B;  4NAW B;  4PS3 A;  2QKL A;  5DPS A;  2ICI A;  2LJ5 A;  4F1S A;  2CU1 A;  2WXO A;  2GJY A;  1SEB D;  1LXD A;  3AE8 B;  1GGO A;  1YQ3 B;  1U5G A;  2Z0O A;  3PHX B;  4BBK A;  2K00 A;  1FIQ A;  2NTT A;  2IZV B;  4C56 C;  2XK5 A;  3APC A;  3PO0 A;  1FFU A;  2O2V A;  1V49 A;  4ZYN A;  2LOZ A;  3A98 B;  4US9 A;  4JK8 A;  3NZU A;  3A4S C;  1T0Q C;  4TV3 A;  4C7Z A;  2JUO A;  1SF0 A;  2JXX A;  1R4M I;  4IUM B;  2LGD A;  1WE7 A;  3VVW B;  1H8C A;  1PFJ A;  3TO1 A;  2KUQ A;  4KGT A;  4MT5 A;  2ZJD A;  2N9P C;  1TQZ A;  1Q10 A;  3NWF A;  3Q69 A;  4ITK A;  2L7R A;  3QWZ B;  1J7B A;  2NR2 A;  3TSS A;  4AQ7 A;  1JWM D;  5D27 A;  4NQK E;  2DZI A;  2RVB B;  1V5M A;  2MP2 A;  1XF5 L;  1HEZ E;  2KDM A;  3N3K B;  3VHT C;  1I7H A;  3UIN B;  4GU2 A;  3KY9 A;  4P6V F;  4PQ0 A;  1JCK B;  2LGY A;  1UNQ A;  5AZF A;  2COA A;  2XEW A;  1K52 A;  2MRP A;  3B9J A;  3IT6 B;  1FGY A;  3QBV B;  1HQR D;  2KQS A;  3M95 A;  2N1W A;  1XKE A;  3U4E G;  3U52 E;  1QC6 A;  2GCL A;  5LXH A;  4IC7 B;  4KSL C;  5HE0 A;  1I4Q A;  1WM2 A;  4GOC A;  4CHK A;  2YT1 A;  1SE2 A;  3V6C B;  4DX8 A;  5EE1 A;  1KH0 A;  4WVF B;  3ENB A;  2ZVO A;  3ODX A;  4TUU A;  2N9X A;  2VZK B;  4G3X B;  1JW9 D;  3LJ3 A;  1YOV B;  2KZR A;  1JAL A;  1E10 A;  2NMB A;  5KHQ A;  4FLH A;  1UUP A;  3PVL A;  1TKY A;  3PT2 B;  5BMH A;  1PQS A;  4E74 A;  2CQU A;  5MPO A;  1SIJ A;  3NS8 A;  4JX1 C;  3BJI A;  4TMA B;  4BKG A;  4HAY B;  2JF5 A;  2D11 A;  2UZR A;  5E6O A;  2L32 A;  2J0J A;  2KDB A;  3IG3 A;  3DBR B;  1Q5W B;  1ZXI A;  2WXM A;  1LQB A;  5IP4 D;  3QWM A;  4NNJ B;  4ZRP A;  4RGN A;  1ROE A;  4KZC A;  1N6Z A;  5JHA A;  3ECI A;  3ZGZ A;  1V6E A;  1E0Z A;  1P6S A;  3K9O B;  1PFD A;  4IAP A;  3FAH A;  1C3T A;  4EKU A;  2LG1 A;  2LD9 A;  1SHC A;  2OTX A;  4IKG A;  2K22 A;  4HJG E;  2DAF A;  2GBJ A;  3G9W A;  3AEB B;  1DYN A;  4JKB A;  4GDL A;  5AUI A;  1X1G A;  3KZ1 A;  2MJ3 A;  1MIZ B;  3W5V B;  2KK8 A;  5I2S A;  2BCJ A;  3BZD B;  5LG4 B;  2WNM A;  2MCN B;  4HRS A;  4D2K A;  1WXM A;  1N60 A;  3A9J A;  2CJN A;  3D32 A;  4CSQ A;  1UEL A;  3FM8 C;  1RJ2 A;  1OQN A;  1DOX A;  1LB1 A;  2CRF A;  2KXJ A;  2K39 A;  2KDF B;  3J9C A;  1KC7 A;  5L83 A;  2EMT A;  1P0R A;  2WX1 A;  2FUH B;  2OHF A;  3TW1 A;  2D4Q A;  2DKP A;  4K1R B;  2E2X A;  2Y5P A;  1TT5 B;  2NTS A;  3ML9 A;  3A58 A;  4YTM B;  3N32 A;  5CLQ B;  5BYS A;  1C1Y B;  1D4B A;  4F7G A;  1Y8R C;  3AEG B;  1CJE A;  3WAN A;  1MG4 A;  1TTN A;  2KMA A;  2DX1 A;  1VJK A;  4US8 A;  2Y5C A;  3RUI B;  1E9M A;  3ZDM C;  3A9K B;  3DHH C;  1GOZ A;  2QIL A;  3P7Z A;  1WGD A;  2KFK A;  3OAN A;  2MBE A;  2JRI B;  3KUD B;  2NZ8 B;  1T77 A;  1SSN A;  3B77 A;  2K9X A;  3RYT A;  1NU2 A;  1CMX B;  1STE A;  4KX6 B;  2KQ7 A;  4ZOH C;  3F0W A;  1N5W A;  4M8M A;  3DOW A;  2BTE A;  2DHK A;  5D3D A;  1HTO A;  1ZGU B;  5DIF B;  3AE7 B;  4JKA A;  1XT9 B;  1VZ7 A;  1DDV A;  2INP E;  4ILG B;  4RF0 A;  2WYQ A;  1P9D U;  2DZJ A;  3UQA A;  3B08 A;  2AQ1 B;  4BAX A;  4XWX A;  3NG0 A;  3QAQ A;  4MEL A;  1WGH A;  1L4Z B;  5CHF A;  4MGZ E;  3VIA A;  4F7Z A;  1PGA A;  2M38 A;  3PRZ A;  4URK A;  4KAX B;  4FHK A;  2KX0 A;  2NPT B;  2V3N A;  1WMH A;  5GMV A;  3VRB B;  2RSU A;  3FSS A;  1YJ1 A;  2VH2 A;  3L16 A;  4HWI B;  3NW8 A;  3V6E B;  3GZN I;  3W5U B;  1E5W A;  4ANU A;  2KDI A;  2EC1 A;  2JX5 A;  3HQC A;  3KQ4 A;  1HXY D;  4JGH B;  2LUE A;  2OED A;  2YSZ A;  4L1R A;  3AEE B;  3W2D A;  4GDK B;  1SB3 C;  2W3S A;  3BIN A;  3NWA A;  3ULB A;  2JSV X;  1D5X C;  4HB0 B;  2AL3 A;  4RCO A;  4H2A A;  3C8Y A;  1TS5 A;  2CU3 A;  1FCL A;  3TVV A;  2IGG A;  3HW2 B;  2EKE C;  1BT0 A;  2JXT A;  1QZE A;  4XE0 A;  1EAZ A;  3SD5 A;  2BW2 A;  2V0G A;  3IAM 1;  4FN2 A;  1WIA A;  2JYE A;  4WWM A;  2JP2 A;  2W2X D;  2JWU A;  3HVZ A;  1IGC A;  4A3O A;  2KAN A;  1XLP A;  4KDI C;  1WGK A;  4JWU C;  5C5B A;  1LW3 A;  4KV2 A;  2KVR A;  1RWS A;  1V1P A;  1MKE A;  2L0F A;  4DXG A;  3H7P B;  4RH6 A;  3DXE A;  1V88 A;  1BAK A;  1HBK A;  4C7Y A;  1GJZ A;  2Y8F A;  4Z2N A;  3BVG A;  2E3T A;  1NTY A;  2RD0 A;  2BS2 B;  1OEY A;  1KBL A;  3ONS A;  1U5F A;  1L6V A;  3UI3 A;  2ELB A;  4DIX A;  2C7H A;  2M14 A;  1EM7 A;  3GE3 C;  3PRM B;  4MY6 A;  3RNB C;  1QF6 A;  2J42 A;  1RM6 C;  2R61 A;  3N9Y C;  2N23 A;  1Y5O A;  4JK7 A;  3PVW A;  3KYD D;  4A9A A;  3RNG C;  1U27 A;  1CK1 A;  3W1Y A;  1F52 A;  3V5W A;  3SV1 A;  2H89 B;  2AX5 A;  3W1S A;  1FHO A;  3SBT A;  4PYU A;  4K81 A;  4QJ3 B;  3PRE A;  2K2U A;  2HRJ A;  1C76 A;  2JZ3 B;  4NJC A;  2WU2 B;  3P42 A;  1V86 A;  3ZTC A;  2LUM A;  1K50 A;  3UF8 A;  1TS4 A;  4JKH A;  1XCG A;  1M94 A;  2DYM A;  4B6W A;  2Z8L A;  4ZRI A;  3SYX A;  4FJY A;  3AMZ A;  1ISN A;  3P63 A;  1VCB A;  3QCA A;  2BYF A;  4BKS A;  4AJW A;  1T3Q A;  3VR9 B;  2KN5 A;  4JL9 A;  2X38 A;  4BOZ B;  3ZDT A;  4PNK A;  1EF5 A;  3ZQ4 A;  2Z59 B;  4HXD A;  4IOY X;  1K51 A;  3RN9 C;  1HTQ A;  1AWE A;  4BZA A;  3PV1 A;  4M0W B;  3RNE C;  2LYD A;  2UZS A;  2DX5 B;  1L2N A;  1ZSQ A;  2KIG A;  2EMS A;  2L2I A;  2RDH A;  2Z14 A;  4L23 A;  1L0X B;  5CLL B;  2L8J A;  5C3J B;  2DTC A;  5E6P A;  3R2I A;  3AB5 A;  2G35 A;  2M1M A;  4LNO A;  1IYF A;  2DNF A;  4HAV B;  4RM8 A;  3AU5 A;  2RGN B;  2K8H A;  4GMX B;  3I9V 1;  4W9D A;  2QDF A;  2Z4D A;  4MH0 E;  1IBX B;  4A6Q A;  4PK1 A;  1WJ4 A;  4W9G A;  4DHZ B;  2YRY A;  2DZK A;  4NJ6 A;  1Y19 B;  4E3C A;  4LLG M;  4KHB B;  2HTM E;  3AEF B;  3C0R B;  3HHM A;  1TS3 A;  4EZL A;  3LB8 C;  3PPA A;  1MHH E;  4FAD A;  3Q14 C;  3EGR A;  2MWS B;  4QJ4 B;  4WWO A;  1WFY A;  3DBH B;  2M19 A;  3PEG A;  3RUL A;  2RPV A;  2GBR A;  4GIV A;  4D6W A;  4HHV A;  3U8Z A;  2ZZP B;  2N7J A;  1RLF A;  2N7D A;  4DHJ B;  1QT9 A;  4ARI A;  4II3 B;  1U5D A;  1S3S G;  4H8S A;  5CTR C;  1AQC A;  4DX9 0;  4OVV A;  4LJO B;  2X0S A;  3E56 A;  3DBL I;  3RFZ B;  1GAQ B;  3EEC A;  3ZKJ C;  1UPQ A;  1M7E A;  1NEN B;  1ZC3 B;  1XR0 B;  2OQB A;  4OZB A;  1WR6 E;  1YJJ A;  3DBL B;  4HAU B;  1FRR A;  2NS5 A;  3PRP B;  2WXK A;  1T0R C;  4DDI D;  2LMC A;  2BBC A;  4USA A;  1FEH A;  5IO9 A;  4F7H A;  3RI7 C;  4LK0 M;  2CR5 A;  1R7S A;  3TEX A;  2O6V B;  3SFD B;  3DPD A;  3ML4 A;  2KVZ A;  4A5K A;  1SIF A;  3HIZ A;  3BVZ A;  1WRI A;  4KHB A;  3Q3O C;  4B0E A;  1D3Z A;  1WWT A;  2WQY B;  3KYC D;  2WGS A;  2QHO A;  4LDT D;  1LGR A;  5IJM A;  1TKE A;  5J2R A;  3MPX A;  3GOE A;  2DHZ A;  2L1A A;  2BKR B;  3K9P B;  3NZ3 A;  4ZYS A;  4W9I A;  1KF6 B;  1TGZ B;  4MGK E;  2M17 A;  3CMM B;  4ARC A;  4WH4 A;  2WXH A;  2O2V B;  1WGQ A;  3DBS A;  3B2F A;  3QK0 A;  3P6A A;  5D94 A;  2JT4 B;  4ILJ A;  3OHM B;  2CHZ A;  2MX2 A;  1VRA B;  3NRZ A;  1XLN A;  3V61 A;  3MC8 A;  2VRW B;  5DI9 B;  4IW0 A;  4MEM A;  1EO6 A;  1WJN A;  1FO4 A;  1MHX A;  1T0Y A;  2N9E B;  4HDQ A;  1ZOY B;  3MC9 A;  1KLG D;  3NY5 A;  5AZH A;  2KKC A;  4X57 B;  4M8N A;  5D3I B;  4KZ0 A;  5EE0 A;  2KX3 A;  2DLW A;  3WYF B;  2HTH B;  1QQG A;  1K5G B;  4IFS A;  2FIF A;  2K0P A;  3QIJ A;  4GOU A;  3EC8 A;  2EEL A;  1H10 A;  1VDV A;  3P1M A;  4TQ1 A;  3UZT A;  1DYQ A;  2RNR B;  4ZRQ A;  3VRA B;  3JVZ X;  3ZXV A;  1RRP B;  1L7Y A;  2KJH B;  3ZRF A;  1EU4 A;  4KSK C;  3I63 C;  3VDZ A;  2W9N A;  2GBN A;  1UBI A;  3MDB C;  5KCV A;  2DZM A;  3L10 B;  1WXA A;  3KUC B;  3D8D A;  3M3J A;  4MSM B;  2C7M B;  1T0S C;  3N1Y C;  4DK5 A;  4GSW A;  4WJO A;  2BKF A;  2WDT B;  3ENE A;  4L1B A;  1IPG A;  2INC C;  2INN E;  5HFY A;  3N30 A;  3BWU D;  2MH7 A;  1ZM0 A;  1N3H A;  2W54 A;  3TEZ A;  2V3P A;  2QEJ C;  4DQO C;  3RT3 B;  4IWO A;  4BVU C;  2LHE A;  3TFM A;  2V76 A;  3SO6 A;  1OTR B;  2M8S A;  3PGE A;  3Q3J A;  2C5L C;  1WXQ A;  3BK1 A;  5D3W A;  3ZIM A;  1TZ1 A;  2K3U A;  3WAL A;  2K49 A;  2QKM A;  1C4P A;  1UD7 A;  1YN3 A;  3IAS 1;  4HAW B;  1EF1 A;  2WLB A;  2D9X A;  1XD3 B;  3Q8F A;  1JRO A;  3AEC B;  1OGW A;  4F8C B;  1XX0 A;  3KRX A;  3RD2 A;  3R3M A;  2DYO A;  3O65 B;  3PTF C;  3M63 B;  1WVH A;  2DHI A;  2QSD A;  4ZRK A;  3Q8E A;  1HA5 A;  1Q0W B;  2B76 B;  4YT0 B;  5C5B B;  2WXF A;  3AE6 B;  4Y94 A;  2ZW1 A;  2MDX A;  5EDS A;  1WH3 A;  4RM9 A;  2JPH A;  2FCN A;  1ENF A;  1C77 A;  3H1U A;  3V62 A;  3VXW A;  1QIL A;  3NS1 A;  2FJL A;  4GZU A;  2V3S A;  4JQW C;  1MI1 A;  2KAJ A;  3ODO A;  2G4S A;  1NI3 A;  2RSG A;  2ZCC A;  3VAW A;  3DDC B;  2DLB A;  1NI2 A;  1WGG A;  1X11 A;  1C4A A;  5BMG A;  4EUT A;  2I2Y A;  3ZLZ A;  3NVV A;  2ONQ A;  3CF6 E;  4FUL A;  3WAO A;  1J7A A;  2JWZ A;  1CQV A;  3LXF A;  3ZXR A;  4YSY B;  1TKG A;  1XCQ L;  2V9H A;  3TMP B;  3FEH A;  2IGH A;  4M02 A;  2ROZ B;  1L6U A;  2OOB B;  3SU8 X;  2CY4 A;  1ZKH A;  4BFR A;  1ZXH A;  4HAX B;  2A4Z A;  4M00 A;  3VR8 B;  4WJP A;  3N1X C;  3HK0 A;  1EUV B;  1P3Q U;  2GBK A;  1OEY J;  4KIK A;  3ZTD A;  4G0N B;  3BVM A;  1FHX A;  4HB4 B;  5L95 C;  2R0D A;  2DBY A;  3PVU A;  4LCD E;  2BB6 A;  1C79 A;  1TIF A;  2JU6 X;  2MBO A;  2MHJ A;  3ZVV A;  1R4M B;  2RDG A;  1GG3 A;  1BWN A;  1KZ7 A;  1L5P A;  4EJN A;  3RCP A;  1N63 A;  3ML8 A;  1JRP A;  4G50 A;  4NJ7 A;  5IOI A;  3SUZ A;  2N9K A;  4KDL B;  2KDE B;  1SJE D;  3I5J C;  2H88 B;  4OZA A;  3Q8C A;  1GNU A;  5IKC M;  1L4D B;  2DYQ A;  2WXL A;  2O6V A;  2VKI A;  3BK2 A;  2M56 B;  4S0R A;  4F7U P;  2L05 A;  5BMI A;  4BOS C;  2I1J A;  2NCN A;  4IM2 A;  4C4V A;  2IO2 B;  4YON A;  2CS4 A;  3KRW A;  3ZJT A;  2PPH A;  4P7I A;  4YL8 A;  4PYZ A;  3CWI A;  3TIX A;  1NTV A;  4EEW A;  2N0Y A;  1PGX A;  2MWN B;  2ON8 A;  2OJW A;  3E9L A;  3HRD D;  3NSU A;  1W1H A;  2IJ0 A;  1XQQ A;  3V60 A;  3DWG C;  2PE9 A;  1YQ4 B;  1GC6 A;  3QQ8 B;  2FJ9 A;  2BS3 B;  3EFC A;  3APD A;  2C9W B;  2D2Q A;  3E9P A;  2J59 M;  1NDD A;  1SE4 A;  3AE5 B;  4W9J A;  4A6K A;  5GXG B;  3Q3N C;  2RLO A;  3JSV B;  4TYZ A;  1B9R A;  1DDW A;  3SDL C;  2K6D B;  3IBE A;  4GLS C;  4P1B C;  2G3Q B;  3VFK A;  4B0M A;  2PTL A;  2IY1 B;  2D3G A;  2PEA A;  4WAF A;  1X86 A;  4JLC A;  5T8I A;  3CXB B;  4WJ7 A;  5FR3 A;  1YD8 U;  2WHI A;  1I2H A;  3E66 A;  1F9J A;  1HZ5 A;  1JDE A;  4AUQ C;  4LNN A;  1FPY A;  3T3O A;  4PS7 A;  3QHT A;  3URY A;  2KWC A;  4WQM A;  4K7U A;  1WJ1 A;  1WX7 A;  1J0W A;  4HKZ E;  1E7V A;  1IP9 A;  1FXT B;  3H8H A;  2K8B A;  5M4Y B;  3AI5 A;  1LM8 B;  5JH5 C;  3GP7 A;  4N59 A;  1I4H A;  1Z5S B;  2KJ6 A;  2LXA A;  3A9J B;  3R7Q A;  2REX A;  1VZ8 A;  2P0D A;  2WXQ A;  2KWU B;  4E71 A;  3NHE B;  2J4X A;  3CIK A;  3L13 A;  4GNK B;  4WAA A;  4WWN A;  1YN4 A;  1AWD A;  3RPF C;  4HKQ A;  1XLQ A;  2KTR A;  5H92 C;  3AE4 B;  2K1F A;  2O6V D;  1ET9 A;  5C2T B;  1FXI A;  1WZ3 A;  1MK7 B;  3ZRC A;  2L52 A;  4YTP B;  4HK2 A;  1V81 A;  3SHQ A;  3UQB A;  3PG7 A;  3E9S A;  4JK9 A;  1M4V A;  3EA6 A;  2AL6 A;  1QOF A;  3SBG A;  2YEP F;  2VRR B;  4IWP A;  1I42 A;  1ST7 A;  4DBB A;  1YQB A;  2CKH B;  4JKG B;  2DWQ A;  3B1L X;  2ZNV C;  2DX5 A;  3AM9 A;  2MJE A;  4KHA A;  1QOB A;  2KOX A;  4RGO S;  3ZNI D;  3ABV B;  3KW5 B;  4O1N A;  2IO3 B;  3Q8B A;  2D9Y A;  1KI1 B;  2HE7 A;  2P0H A;  2LGI A;  3UGB B;  4KGS A;  3IVF A;  3NVY A;  3Q6B A;  5J18 A;  3QX1 A;  4ZDV A;  1KLV A;  2MP2 B;  1N5X A;  3GS2 A;  4YXD B;  4R3D A;  4HB3 B;  1GB4 A;  4CO7 A;  5LLI A;  2YS3 A;  4RGT A;  2HDE A;  5E6J A;  4FJV B;  3HM6 X;  2JQR B;  2L83 A;  2XNA C;  2ACZ B;  4YWG G;  3HM3 A;  5D2M B;  2NVU I;  3NZS A;  1I4R A;  4HCN B;  5HE3 A;  3T8M A;  2G45 B;  2LRW A;  3L4P A;  4DXA B;  1NVI D;  2KO3 A;  5FI0 A;  3X23 A;  3GYO A;  4GN1 A;  3LDZ E;  2E6X A;  2H7E A;  1M7R A;  1A5R A;  3I57 A;  1FXA A;  3WCQ A;  4L6E A;  2FUG 1;  1ZC4 B;  2J52 A;  2GB1 A;  4QAY A;  2YS1 A;  4GGQ A;  3ZVR A;  3QAR A;  5JVL A;  5CX3 A;  2LGS A;  3KH0 A;  3DXD A;  1E7U A;  3FKY A;  2V4I B;  3DCX A;  3A1Q B;  3FC4 A;  1CZP A;  2QIE B;  3SFE B;  2SEB D;  2GBM A;  1V80 A;  3AED B;  3FLV A;  4JKD A;  1WJ6 A;  1RFK A;  1P5T A;  3TJP A;  3MC0 B;  2Y3A A;  1PYW D;  3TBL D;  1JWA D;  2N4F A;  4MT7 A;  5TSS A;  1V2Y A;  3D8F A;  1D6E C;  4A6F B;  4A8X C;  1F0Z A;  3F5R A;  1DBH A;  2GS0 A;  2RMM A;  4ICU A;  4EOY A;  1MIX A;  2K2J A;  1RAX A;  3OLM D;  4NQL B;  2PKO A;  2RRF A;  1P7F A;  4JE3 B;  4AP4 C;  4NZL B;  1F2R I;  4GDK A;  2L3Z A;  5HKH A;  4HRO A;  3MTN B;  3RZW C;  3KWV A;  2NPT A;  2MBQ A;  3IT4 B;  5D3X A;  2IY0 B;  1TY2 A;  2A5U A;  3VUX A;  2R2Q A;  2PLP A;  2MLB A;  3N1Z C;  4MGY E;  2DHJ A;  4P16 A;  5AEK B;  5LXI B;  2KHW B;  2WXI A;  3A9K A;  1R4N I;  3AEA B;  1DIK A;  5D3V A;  2YVC A;  2IO1 B;  4AJY B;  4W9H A;  3DBH I;  3Q3F A;  4JKC A;  1NYR A;  2NMQ A;  2ASQ A;  4MGI E;  2EKI A;  4IOI E;  1WGR A;  3RCZ A;  1IGD A;  1P1A A;  1F1H A;  1MFW A;  2LFI A;  4A6F A;  4FBJ B;  2WXG A;  1UEF A;  5I2M A;  2IBI B;  4DHJ D;  1TBE A;  2LBB A;  2XBB C;  1UH6 A;  2MEK A;  2D10 A;  3PHW B;  1J0G A;  1VLB A;  4MJS B;  1SGH A;  1B1Z A;  2NBV B;  2DYN A;  1KLU D;  1EVH A;  3NWD A;  1WX8 A;  2FAZ A;  3O13 A;  3EUB 2;  2RDB C;  4YSX B;  1J8C A;  1H4R A;  2CB8 A;  1BML C;  1F77 A;  4XGA B;  5EE3 A;  4ACF A;  3AE1 B;  4XWT A;  3T06 A;  2KTR B;  2RQ1 A;  5AZG A;  4CHM A;  2L76 A;  2FJU B;  5JHB A;  3T3N A;  1K8R B;  2VZK D;  2I38 A;  1GC7 A;  2Z0Q A;  5IA7 A;  3TEY A;  2CJO A;  4GMV A;  1J19 A;  1HE8 A;  3ALB A;  4DWF A;  1UNR A;  5L81 A;  2Z13 A;  1UGJ A;  1WMH B;  5C6R A;  1UBQ A;  2SAK A;  4DDG D;  1W1D A;  2AYO B;  5JHG A;  2KJR A;  1IRS A;  2IPK D;  4KHO A;  3U2S C;  1UPR A;  2RR9 A;  3DVG X;  3P4P B;  2I5C A;  5FR6 A;  3AV8 A;  3U30 A;  2JYT A;  5BO4 B;  4M01 A;  2G9H D;  1C78 A;  5LON B;  1PUT A;  3DVN U;  2COF A;  2Y5B B;  1V9J A;  3AE3 B;  1P3R A;  1V61 A;  4Q2J A;  4HEA 1;  5LNK 1;  2I1K A;  1TY0 A;  1DDM A;  1V5U A;  2D3C A;  1L0V B;  4J3O D;  3VTW A;  1FNW A;  1ZE3 D;  3OJ3 A;  2BF8 B;  2LWP A;  2P0F A;  3PLV A;  1F2R C;  1FMA D;  4MM3 A;  1FOE A;  2KLC A;  2R09 A;  3QA8 A;  3U12 A;  4W9F A;  3Q8A A;  4XYC A;  1NBF C;  1EU3 A;  2KD0 A;  3PSE B;  2KWV B;  4AWJ A;  2KGX B;  3DVN V;  1G6J A;  2ROV A;  1U5E A;  1YNT E;  2KC1 A;  3OAW A;  3EPY A;  1XD4 A;  2GRI A;  3RMK C;  5DCN A;  1UGM A;  2KQ4 X;  1VD2 A;  4EFO A;  2PZ1 A;  1WJU A;  1XEE A;  3KVF B;  4IDI A;  4JKE A;  4MM3 B;  1ESF A;  3RNF C;  1RRB A;  3QJZ A;  5IN7 A;  2BGF A;  2Z0E B;  1HZ6 A;  2I5F A;  2W2W A;  2H7D A;  2JZP A;  1WXV A;  5H8Y E;  1FM0 D;  4FXC A;  5DH9 B;  4BKT A;  3A4R A;  4JKG A;  1JRU A;  4N6E B;  2K8C A;  2NBU A;  3TEW A;  2BT6 A;  1V1P B;  1U4A A;  2KNB A;  3MHZ A;  2KFK B;  4II2 B;  1BTN A;  5DHA B;  4MK0 A;  3S2A A;  1MAI A;  2KIE A;  4W9L A;  4ANW A;  2WXP A;  3PZD A;  1SXT A;  2PIA A;  2FDQ A;  5CHW A;  2R2O A;  2L0T A;  4QXA B;  2KLG A;  5LOP B;  3AE9 B;  5JZE B;  2GUM A;  3CSF A;  3CST A;  2Q5W D;  4AS1 A;  2XN9 C;  1Z2M A;  3AN1 A;  1ZPS A;  4WSF A;  5E6N A;  1QOA A;  1U29 A;  1K53 A;  3JYU A;  2XK5 B;  2GMI C;  2PJH A;  3AJ4 A;  3FIL B;  3DCG A;  3TCA A;  3B0A A;  2FCM A;  4K2P A;  3R2T A;  2FCS A;  3NUH B;  4KVG B;  2VSZ A;  2DFK A;  2LJI A;  1DGJ A;  3MJ5 A;  4BBN F;  2NBW B;  3AUL A;  2BWE S;  3P2B A;  2J0M A;  4FA6 A;  2CY5 A;  4PT5 A;  4ANX A;  2GLS A;  1FHW A;  1ZUD 2;  4OVU A;  1XCT L;  1JWS D;  2K25 A;  1HB6 A;  2PVO D;  1OQR A;  2BYV E;  2ZPN A;  4C00 A;  2L00 B;  5D6J B;  2IND C;  1ZYI A;  2Q13 A;  3FIL A;  2PVG C;  4EMO A;  4EE2 A;  1T6B X;  1SJH D;  4GDL B;  3JSV A;  3IXS A;  5DPW A;  2JZZ A;  2LKO A;  2N9L A;  2QCZ A;  3DWM A;  4HPP A;  2BPS A;  2CAY A;  2ZCB A;  1FCC C;  2KUP A;  4FJZ A;  4OVZ A;  4LDT B;  1DOY A;  1GUA B;  1OFF A;  1XO3 A;  1MK9 B;  3DVG Y;  3OJ4 B;  4LNK A;  2W3R A;  4B9K A;  3RNA C;  5J3Q A;  2ZKM X;  2LVP A;  2JVC A;  1KTK A;  2LRU A;  3R66 C;  2LOX A;  3O96 A;  1MJD A;  5J3T A;  1P7E A;  2BVC A;  3FVC A;  3AU4 A;  1NEK B;  3KSY A;  2MBB B;  4L2Y A;  5IAA C;  2FNJ B;  1KZG A;  1WF9 A;  2N0S B;  4HVB A;  2WU5 B;  2KR0 A;  2EJ8 A;  2COC A;  1N61 A;  4RNA A;  1OMW A;  2AWT A;  1VBG A;  1E90 A;  4G11 A;  4D0N B;  3LYY A;  2K6Q A;  4REZ A;  5HHD G;  1I35 A;  3H9D A;  4RMA A;  1A70 A;  2MW5 A;  3TUO A;  3L08 A;  2Y8G A;  3R8B A;  1NVL A;  4NY0 A;  4LNI A;  1VBH A;  5C16 A;  1YN5 A;  3HSA A;  3AH7 A;  1MPH A;  1BTK A;  1QOG A;  2ABD A;  4DXF A;  5JXV A;  1GPX A;  2BYE A;  2FE8 A;  4OHJ A;  5C23 A;  2D5G A;  4KKJ A;  3KWL A;  1JWB D;  3VUW A;  1WX9 A;  2PE6 B;  3V05 A;  2GCJ A;  2N1V A;  2HTH A;  2CHX A;  3I3T B;  2ADZ A;  4XDD A;  4C80 A;  2PW9 A;  2Y7B A;  1B55 A;  2R82 A;  2KMM A;  2AEH A;  3HUI A;  4LTU A;  2ZEQ A;  2KC2 A;  3AXC A;  2PMV A;  1MPE A;  2MJD A;  3B2G A;  2IDY A;  4A6H A;  2YLM A;  4HPL B;  4TSS A;  1TS2 A;  2J7Q B;  1E7P B;  1XXG A;  3HIE A;  2WDV B;  3A1Q A;  3RNC C;  4RF1 A;  4ICV A;  2GOW A;  2BB5 A;  1K5D B;  3C19 A;  4XC2 A;  5FKA C;  1WGU A;  1V1O A;  2X18 A;  1FD6 A;  3PSC A;  1WYW B;  3NVZ A;  5KQ4 A;  2P8V A;  1WR1 A;  2UVM A;  2YS5 A;  5JLJ B;  2BWF A;  3PP2 A;  1OQQ A;  1ZW7 A;  4DBG A;  5FI1 A;  3GYP A;  4CQN A;  2COP A;  1WJM A;  1Y56 A;  1YMH E;  2LGX A;  3MP9 A;  3ODW A;  3VQI A;  4AOF A;  3BY4 B;  1FNU A;  3N7C A;  5TR5 A;  3V3X A;  2BQQ A;  4KKI A;  4PS8 A;  4W9E A;  3TL5 A;  2OJR A;  2W82 A;  3M1I B;  1PGB A;  1DRO A;  1EGX A;  4NAW A;  2DEN B;  1KM7 A;  2HD5 B;  2D9Z A;  1JWU D;  3AE2 B;  2Z0P A;  2J0K A;  2HJ1 A;  4RFB A;  2TSS A;  4HCP B;  2DN6 A;  2V1Y A;  4QJ5 B;  1YX6 B;  1WI0 A;  2BYT A;  5HE1 A;  1ZP0 B;  4KGR A;  4RGM A;  2KCJ A;  1V8C A;  5GOW B;  3MFG A;  2KWD A;  4HAZ B;  4N58 A;  3SNH A;  2FCQ A;  3VTV A;  1ZDX A;  1YX5 B;  3PZ7 A;  3KLS X;  2WX0 A;  2KMC A;  1D5Z C;  2KTF A;  3APF A;  4Z2M B;  3H7S A;  1R4N B;  1WSP A;  4NPN A;  5D7G A;  4ZRJ A;  2D9V A;  1JML A;  3A33 B;  5JP4 A;  2KFJ A;  3U7D A;  3ZNG C;  2IFS A;  2WXN A;  3T9L A;  1KJT A;  3ZUN A;  4MAC A;  4JIO U;  1T5X D;  4ZHO A;  5J17 A;  1PLS A;  3NJT A;  4J6I A;  4XZ4 A;  1WRD B;  5DPT A;  4BKS D;  1Q1O A;  2JY6 A;  3OG5 A;  1TJ6 A;  3VTU A;  4OW0 A;  2IYD B;  2RGF A;  1WY8 A;  2LHD A;  1WE6 A;  1ZDV A;  1XOD A;  2MSE D;  1GB1 A;  4XWW A;  2ZW0 A;  4P1C C;  3NOB A;  2LEK A;  3PZ8 A;  1IUE A;  1FGZ A;  2KYW A;  4WQO B;  2WXR A;  4IM0 A;  2YEP B;  1OY2 A;  2LI5 A;  3N20 C;  4OZC A;  1PDX A;  4DHZ E;  2IO0 B;  3IFW B;  3R7R A;  1WM3 A;  3CIR B;  4HLE A;  1NTI A;  5D3Y A;  2ZPY A;  1FAO A;  3MHS D;  1IBX A;  1SE3 A;  4I6N B;  3UIO B;  1KRH A;  3ZNZ B;  4CHJ A;  1WGY A;  1YIW A;  1Q67 A;  1BXT A;  4WJN A;  5AUK A;  5IRS A;  3SR6 A;  4K2O A;  2DKQ A;  5DPR A;  1UWM A;  1E8W A;  5C1Z A;  5KHO A;  5FK9 C;  1C4C A;  2LVQ A;  4ASW C;  1SBB B;  4EZK A;  4WUR A;  2L1C A;  4YTN B;  4A90 A;  3ZJV A;  2Z59 A;  4JPS A;  1HB8 A;  5BYQ A;  4HB2 B;  2ELA A;  1V89 A;  2Z0D B;  4N9F 4;  2D07 B;  2WP9 B;  2DYB A;  4IWQ A;  2MQJ A;  4C0A A;  2DIK A;  2CHW A;  1LFD A;  3A8P A;  4B95 A;  1MG8 A;  2MBH A;  4W9C A;  3P4S B;  2WDR B;  4TKN A;  1KFY B;  3M62 B;  3HVD A;  1QQR A;  2C7N B;  2R2Y A;  2ZVN A;  3PLU A;  1E8Y A;  1S1Q B;  5G5G A;  2B3A A;  3WAP A;  5G55 A;  2D9W A;  4M0W A;  2VH1 A;  2COD A;  2LAS A;  1TXD A;  1ZVR A;  5G2N A;  2YT0 A;  3L17 A;  1WG7 A;  3DQV A;  1V97 A;  4A20 A;  5DHF B;  4C4V B;  3VUY A;  4IM3 A; 
#chains in the Genus database with same CATH homology
 3KUZ A;  1UZX B;  4TQ0 A;  2UYZ B;  3X0W A;  2M0X A;  3ZW3 A;  2MA9 B;  1WXS A;  2V4L A;  2LZ6 A;  4NSW A;  5JHH A;  2LVO A;  4K17 A;  3RZF A;  4WJQ A;  4GPT B;  2LXC A;  1AAR A;  4ILH A;  2HJ8 A;  2IYB A;  3WAM A;  4B6H A;  1P98 A;  3E9O A;  4HDO A;  4MSQ B;  3PS6 A;  2WWZ A;  5KQ1 A;  4EZJ A;  3DXC A;  3VH3 B;  1V5P A;  3L54 A;  2WH5 A;  2W2X C;  3FP5 A;  5HE2 A;  2XQN M;  2RPQ A;  5C79 A;  4WWP A;  4CYE A;  4XX5 A;  3EFU A;  5J3Y A;  1ACA A;  5CHV C;  3MJW A;  4A3P A;  1U2B A;  3ZO5 B;  3QC8 B;  3VH4 B;  2G4D B;  2M4N A;  4I6L B;  3WIM A;  1UNP A;  4KIK B;  1V5O A;  4MDK E;  4GB9 A;  1Z87 A;  2RUK B;  1E8Z A;  4JKF A;  4GXB A;  1X1M A;  1WI1 A;  4I6P A;  4K7S A;  1E8X A;  4W9K A;  2DAJ A;  4HAT B;  2DA0 A;  3ZNH B;  3WA0 A;  4HJK A;  5EFX A;  1I7A A;  3LJU X;  3UIP B;  3H6N A;  2JRH A;  1X05 A;  1PMS A;  2LUL A;  3DBR I;  4K7W A;  4MJS A;  3H7P A;  2C60 A;  1X1F A;  3A8Q A;  3IHP C;  2FID A;  4HPM B;  3D8E A;  1SE9 A;  3W1S C;  2MFQ A;  4BBN C;  4IG7 B;  2ZNV B;  2UWQ A;  1FB8 A;  2N7E A;  3EHV A;  2MKR A;  1RFA A;  3JW0 X;  3L0W B;  1W1G A;  3VOQ A;  4ANV A;  4LJP B;  1WZ0 A;  4FHJ A;  3ULC A;  1V5T A;  1KOT A;  1OQY A;  2YF0 A;  4NAW B;  4PS3 A;  2QKL A;  5DPS A;  2LJ5 A;  4F1S A;  2CU1 A;  2GJY A;  1LXD A;  1GGO A;  1U5G A;  2Z0O A;  3PHX B;  4BBK A;  2K00 A;  2IZV B;  2XK5 A;  3APC A;  2O2V A;  1V49 A;  4ZYN A;  2LOZ A;  3A98 B;  4JK8 A;  3NZU A;  3A4S C;  4TV3 A;  2JUO A;  2JXX A;  1R4M I;  4IUM B;  2LGD A;  1WE7 A;  3VVW B;  1H8C A;  1PFJ A;  3TO1 A;  2ZJD A;  2N9P C;  1TQZ A;  2L7R A;  3QWZ B;  2NR2 A;  5D27 A;  4NQK E;  2DZI A;  2RVB B;  1V5M A;  2MP2 A;  3N3K B;  3VHT C;  3UIN B;  4GU2 A;  3KY9 A;  4PQ0 A;  2LGY A;  1UNQ A;  5AZF A;  2COA A;  2XEW A;  2MRP A;  1FGY A;  3QBV B;  2KQS A;  3M95 A;  2N1W A;  1XKE A;  1QC6 A;  2GCL A;  5LXH A;  4IC7 B;  4KSL C;  5HE0 A;  1WM2 A;  4GOC A;  4CHK A;  2YT1 A;  3V6C B;  4DX8 A;  4WVF B;  3ENB A;  2ZVO A;  3ODX A;  4TUU A;  2N9X A;  4G3X B;  3LJ3 A;  2KZR A;  2NMB A;  5KHQ A;  4FLH A;  3PVL A;  3PT2 B;  1PQS A;  4E74 A;  2CQU A;  3NS8 A;  3BJI A;  4BKG A;  4HAY B;  2JF5 A;  2D11 A;  2UZR A;  5E6O A;  2J0J A;  2KDB A;  3IG3 A;  1Q5W B;  1LQB A;  3QWM A;  4NNJ B;  4KZC A;  5JHA A;  3ECI A;  1V6E A;  1P6S A;  3K9O B;  4IAP A;  1C3T A;  4EKU A;  2LG1 A;  2LD9 A;  1SHC A;  2OTX A;  2DAF A;  2GBJ A;  3G9W A;  1DYN A;  4JKB A;  4GDL A;  1X1G A;  3KZ1 A;  1MIZ B;  2KK8 A;  2BCJ A;  2MCN B;  1WXM A;  3A9J A;  3D32 A;  1UEL A;  3FM8 C;  1RJ2 A;  1OQN A;  1LB1 A;  2CRF A;  2KXJ A;  2K39 A;  2KDF B;  1KC7 A;  5L83 A;  2EMT A;  1P0R A;  2FUH B;  2WX1 A;  3TW1 A;  2D4Q A;  2DKP A;  4K1R B;  2E2X A;  3ML9 A;  3N32 A;  5CLQ B;  1C1Y B;  4F7G A;  1Y8R C;  3WAN A;  1TTN A;  2KMA A;  2DX1 A;  3RUI B;  3ZDM C;  3A9K B;  3P7Z A;  1WGD A;  2KFK A;  3OAN A;  2MBE A;  2JRI B;  3KUD B;  2NZ8 B;  3RYT A;  1NU2 A;  1CMX B;  2KQ7 A;  3F0W A;  4M8M A;  3DOW A;  2DHK A;  1ZGU B;  5DIF B;  4JKA A;  1XT9 B;  1DDV A;  4ILG B;  2WYQ A;  1P9D U;  2DZJ A;  3UQA A;  3B08 A;  4XWX A;  3QAQ A;  4MEL A;  1WGH A;  5CHF A;  4MGZ E;  3VIA A;  4F7Z A;  3PRZ A;  2M38 A;  4URK A;  4KAX B;  4FHK A;  2KX0 A;  2NPT B;  1WMH A;  5GMV A;  2RSU A;  3FSS A;  1YJ1 A;  3L16 A;  4HWI B;  3V6E B;  3GZN I;  1E5W A;  4ANU A;  2KDI A;  2EC1 A;  3HQC A;  4JGH B;  2LUE A;  2YSZ A;  4GDK B;  3BIN A;  3ULB A;  4HB0 B;  2AL3 A;  3TVV A;  3HW2 B;  2EKE C;  1BT0 A;  1QZE A;  1EAZ A;  3SD5 A;  4FN2 A;  1WIA A;  2JP2 A;  2W2X D;  4A3O A;  2KAN A;  4KDI C;  5C5B A;  1LW3 A;  4KV2 A;  2KVR A;  1MKE A;  2L0F A;  3H7P B;  3DXE A;  1V88 A;  1BAK A;  1HBK A;  1GJZ A;  2Y8F A;  4Z2N A;  1NTY A;  2RD0 A;  1OEY A;  1KBL A;  3ONS A;  1U5F A;  2ELB A;  2C7H A;  2M14 A;  3PRM B;  4MY6 A;  2N23 A;  1Y5O A;  4JK7 A;  3PVW A;  3KYD D;  1U27 A;  3W1Y A;  3V5W A;  3SV1 A;  3W1S A;  1FHO A;  3SBT A;  4PYU A;  4K81 A;  3PRE A;  2K2U A;  2HRJ A;  2JZ3 B;  1V86 A;  3ZTC A;  3UF8 A;  4JKH A;  1XCG A;  1M94 A;  2DYM A;  4B6W A;  4ZRI A;  3SYX A;  4FJY A;  1ISN A;  1VCB A;  3QCA A;  2BYF A;  4BKS A;  4AJW A;  2KN5 A;  4JL9 A;  4BOZ B;  3ZDT A;  4PNK A;  1EF5 A;  2Z59 B;  4HXD A;  4IOY X;  1AWE A;  3PV1 A;  4M0W B;  2LYD A;  2UZS A;  2DX5 B;  1L2N A;  1ZSQ A;  2EMS A;  2L2I A;  5CLL B;  2L8J A;  2DTC A;  5E6P A;  2G35 A;  2M1M A;  1IYF A;  4HAV B;  4RM8 A;  3AU5 A;  2RGN B;  2K8H A;  4GMX B;  4W9D A;  4MH0 E;  1WJ4 A;  4W9G A;  4DHZ B;  2YRY A;  2DZK A;  4NJ6 A;  1Y19 B;  4E3C A;  4KHB B;  3C0R B;  3HHM A;  4EZL A;  3PPA A;  4FAD A;  2MWS B;  4WWO A;  1WFY A;  3PEG A;  3RUL A;  2GBR A;  4GIV A;  4HHV A;  3U8Z A;  2ZZP B;  1RLF A;  2N7D A;  4DHJ B;  4II3 B;  1U5D A;  1S3S G;  4H8S A;  5CTR C;  1AQC A;  4DX9 0;  4OVV A;  4LJO B;  2X0S A;  3DBL I;  3EEC A;  3ZKJ C;  1UPQ A;  1M7E A;  1ZC3 B;  1XR0 B;  2OQB A;  1WR6 E;  4HAU B;  2NS5 A;  3PRP B;  4DDI D;  4F7H A;  2CR5 A;  2O6V B;  3DPD A;  3ML4 A;  4A5K A;  1SIF A;  3HIZ A;  1D3Z A;  3KYC D;  2QHO A;  4LDT D;  5IJM A;  5J2R A;  3MPX A;  3GOE A;  2DHZ A;  2BKR B;  3K9P B;  4W9I A;  1TGZ B;  4MGK E;  2M17 A;  3CMM B;  2O2V B;  1WGQ A;  3DBS A;  3QK0 A;  3P6A A;  5D94 A;  2JT4 B;  4ILJ A;  2CHZ A;  2MX2 A;  3V61 A;  2VRW B;  5DI9 B;  4IW0 A;  4MEM A;  1EO6 A;  1WJN A;  1T0Y A;  2N9E B;  3NY5 A;  4HDQ A;  5AZH A;  2KKC A;  4X57 B;  4M8N A;  4KZ0 A;  2KX3 A;  2DLW A;  3WYF B;  2HTH B;  1QQG A;  1K5G B;  4IFS A;  2FIF A;  3QIJ A;  3EC8 A;  1H10 A;  4TQ1 A;  3UZT A;  2RNR B;  3JVZ X;  1RRP B;  1L7Y A;  2KJH B;  3ZRF A;  4KSK C;  3VDZ A;  2W9N A;  2GBN A;  1UBI A;  3MDB C;  5KCV A;  2DZM A;  3L10 B;  1WXA A;  3KUC B;  3D8D A;  3M3J A;  4MSM B;  2C7M B;  4DK5 A;  4GSW A;  4WJO A;  2BKF A;  2WDT B;  3ENE A;  1IPG A;  3N30 A;  1ZM0 A;  1N3H A;  3RT3 B;  4IWO A;  4BVU C;  3TFM A;  2V76 A;  3SO6 A;  1OTR B;  2M8S A;  3PGE A;  3Q3J A;  2C5L C;  5D3W A;  3ZIM A;  1TZ1 A;  3WAL A;  2QKM A;  1UD7 A;  4HAW B;  1EF1 A;  2D9X A;  1XD3 B;  1OGW A;  4F8C B;  1XX0 A;  3KRX A;  3RD2 A;  3R3M A;  2DYO A;  3O65 B;  3PTF C;  3M63 B;  1WVH A;  2DHI A;  4ZRK A;  1Q0W B;  5C5B B;  4Y94 A;  2MDX A;  5EDS A;  1WH3 A;  4RM9 A;  2JPH A;  2FCN A;  3H1U A;  3V62 A;  3VXW A;  2FJL A;  4GZU A;  2V3S A;  4JQW C;  3ODO A;  2G4S A;  2RSG A;  2ZCC A;  3VAW A;  3DDC B;  1NI2 A;  1WGG A;  1X11 A;  4EUT A;  3ZLZ A;  3CF6 E;  4FUL A;  3WAO A;  2JWZ A;  3TMP B;  3FEH A;  2ROZ B;  2OOB B;  3SU8 X;  2CY4 A;  1ZKH A;  4BFR A;  4HAX B;  2A4Z A;  4WJP A;  3HK0 A;  1EUV B;  1P3Q U;  2GBK A;  1OEY J;  4KIK A;  3ZTD A;  4G0N B;  1FHX A;  4HB4 B;  5L95 C;  2R0D A;  3PVU A;  4LCD E;  2MBO A;  3ZVV A;  1GG3 A;  1BWN A;  1KZ7 A;  4EJN A;  3RCP A;  3ML8 A;  4G50 A;  4NJ7 A;  3SUZ A;  4KDL B;  2KDE B;  1GNU A;  2DYQ A;  2O6V A;  2VKI A;  4F7U P;  2L05 A;  4BOS C;  2I1J A;  2NCN A;  4IM2 A;  2IO2 B;  4YON A;  2CS4 A;  3KRW A;  2PPH A;  4P7I A;  4YL8 A;  4PYZ A;  3TIX A;  1NTV A;  4EEW A;  2N0Y A;  2MWN B;  3E9L A;  3NSU A;  1W1H A;  1XQQ A;  3V60 A;  2PE9 A;  1GC6 A;  3QQ8 B;  2FJ9 A;  3APD A;  2C9W B;  2D2Q A;  3E9P A;  2J59 M;  1NDD A;  4W9J A;  4A6K A;  2RLO A;  3JSV B;  4TYZ A;  1DDW A;  3SDL C;  2K6D B;  3IBE A;  2G3Q B;  3VFK A;  2IY1 B;  2D3G A;  2PEA A;  1X86 A;  4JLC A;  3CXB B;  4WJ7 A;  1YD8 U;  1I2H A;  3E66 A;  1F9J A;  1JDE A;  4AUQ C;  4PS7 A;  3QHT A;  2KWC A;  4K7U A;  1WJ1 A;  1WX7 A;  1J0W A;  1E7V A;  1IP9 A;  1FXT B;  2K8B A;  3AI5 A;  1LM8 B;  5JH5 C;  1Z5S B;  2KJ6 A;  2LXA A;  3A9J B;  3R7Q A;  2REX A;  2P0D A;  2KWU B;  4E71 A;  3NHE B;  3CIK A;  3L13 A;  4WAA A;  4WWN A;  2KTR A;  2K1F A;  2O6V D;  1WZ3 A;  1MK7 B;  3ZRC A;  4HK2 A;  1V81 A;  3SHQ A;  3UQB A;  3PG7 A;  4JK9 A;  2AL6 A;  4IWP A;  3SBG A;  1I42 A;  2VRR B;  1ST7 A;  4DBB A;  1YQB A;  2CKH B;  4JKG B;  3B1L X;  2ZNV C;  2DX5 A;  4KHA A;  2KOX A;  3ZNI D;  3KW5 B;  2IO3 B;  2D9Y A;  1KI1 B;  2HE7 A;  2P0H A;  3UGB B;  3IVF A;  5J18 A;  3QX1 A;  4ZDV A;  1KLV A;  2MP2 B;  4HB3 B;  4CO7 A;  5LLI A;  2YS3 A;  4FJV B;  3HM6 X;  3HM3 A;  5D2M B;  2NVU I;  3NZS A;  4HCN B;  5HE3 A;  3T8M A;  2G45 B;  2LRW A;  4DXA B;  2KO3 A;  5FI0 A;  3X23 A;  3GYO A;  4GN1 A;  3LDZ E;  2H7E A;  1M7R A;  1A5R A;  4L6E A;  1ZC4 B;  2YS1 A;  4GGQ A;  3ZVR A;  3QAR A;  5JVL A;  5CX3 A;  3KH0 A;  3DXD A;  1E7U A;  3A1Q B;  2GBM A;  1V80 A;  3FLV A;  4JKD A;  1WJ6 A;  1P5T A;  3TJP A;  3TBL D;  2N4F A;  4MT7 A;  1V2Y A;  3D8F A;  4A6F B;  3F5R A;  1DBH A;  2GS0 A;  4ICU A;  4EOY A;  1MIX A;  2K2J A;  1RAX A;  3OLM D;  4NQL B;  4AP4 C;  4GDK A;  2L3Z A;  5HKH A;  3MTN B;  3RZW C;  2NPT A;  2MBQ A;  5D3X A;  2IY0 B;  2A5U A;  3VUX A;  2R2Q A;  2MLB A;  4MGY E;  2DHJ A;  5AEK B;  5LXI B;  2KHW B;  3A9K A;  1R4N I;  1DIK A;  5D3V A;  2YVC A;  2IO1 B;  4AJY B;  4W9H A;  3DBH I;  3Q3F A;  4JKC A;  2ASQ A;  4MGI E;  1WGR A;  3RCZ A;  1P1A A;  4A6F A;  4FBJ B;  1UEF A;  2IBI B;  4DHJ D;  1TBE A;  2LBB A;  2XBB C;  1UH6 A;  2D10 A;  3PHW B;  1J0G A;  4MJS B;  1SGH A;  2NBV B;  2DYN A;  1EVH A;  1WX8 A;  2FAZ A;  1J8C A;  1H4R A;  2CB8 A;  3T06 A;  5AZG A;  2KTR B;  2RQ1 A;  4CHM A;  2L76 A;  5JHB A;  1K8R B;  1GC7 A;  2Z0Q A;  5IA7 A;  4GMV A;  1J19 A;  1HE8 A;  3ALB A;  4DWF A;  1UNR A;  5L81 A;  1WMH B;  5C6R A;  1UBQ A;  4DDG D;  1W1D A;  2AYO B;  5JHG A;  2KJR A;  1IRS A;  4KHO A;  1UPR A;  2RR9 A;  3DVG X;  2I5C A;  5FR6 A;  3U30 A;  5BO4 B;  5LON B;  3DVN U;  2COF A;  2Y5B B;  1V9J A;  1P3R A;  1V61 A;  2I1K A;  1DDM A;  1V5U A;  3VTW A;  3OJ3 A;  2BF8 B;  2LWP A;  2P0F A;  3PLV A;  4MM3 A;  1FOE A;  2KLC A;  2R09 A;  3QA8 A;  4W9F A;  1NBF C;  2KD0 A;  3PSE B;  2KWV B;  4AWJ A;  2KGX B;  3DVN V;  1G6J A;  2ROV A;  1U5E A;  2KC1 A;  3OAW A;  3EPY A;  1XD4 A;  5DCN A;  1UGM A;  1VD2 A;  4EFO A;  2PZ1 A;  1WJU A;  3KVF B;  4JKE A;  1RRB A;  3QJZ A;  2BGF A;  2Z0E B;  2I5F A;  2W2W A;  2H7D A;  1WXV A;  5DH9 B;  4BKT A;  3A4R A;  4JKG A;  1JRU A;  2K8C A;  2NBU A;  2KNB A;  1U4A A;  2KFK B;  4II2 B;  1BTN A;  5DHA B;  4MK0 A;  3S2A A;  1MAI A;  4W9L A;  4ANW A;  3PZD A;  2FDQ A;  5CHW A;  2R2O A;  2L0T A;  2KLG A;  5LOP B;  5JZE B;  3CSF A;  3CST A;  1Z2M A;  4WSF A;  5E6N A;  1U29 A;  3JYU A;  2XK5 B;  2GMI C;  2PJH A;  3AJ4 A;  3DCG A;  3TCA A;  3B0A A;  2FCM A;  4K2P A;  2FCS A;  4KVG B;  2VSZ A;  2DFK A;  4BBN F;  2NBW B;  3AUL A;  2BWE S;  3P2B A;  2J0M A;  4FA6 A;  2CY5 A;  4ANX A;  1FHW A;  4OVU A;  2K25 A;  1HB6 A;  2BYV E;  2ZPN A;  2L00 B;  5D6J B;  2Q13 A;  4EMO A;  4GDL B;  3JSV A;  5DPW A;  2JZZ A;  2LKO A;  2BPS A;  2CAY A;  2ZCB A;  2KUP A;  4FJZ A;  4LDT B;  1GUA B;  1MK9 B;  3DVG Y;  3OJ4 B;  4B9K A;  5J3Q A;  2LVP A;  2JVC A;  3R66 C;  2LRU A;  2LOX A;  3O96 A;  5J3T A;  3AU4 A;  3KSY A;  2MBB B;  5IAA C;  2FNJ B;  1KZG A;  1WF9 A;  4HVB A;  2EJ8 A;  2COC A;  1OMW A;  2AWT A;  1VBG A;  1E90 A;  4G11 A;  4D0N B;  2K6Q A;  1I35 A;  3H9D A;  4RMA A;  2MW5 A;  3L08 A;  2Y8G A;  1NVL A;  4NY0 A;  1VBH A;  5C16 A;  1MPH A;  1BTK A;  2ABD A;  2BYE A;  5C23 A;  3VUW A;  1WX9 A;  2PE6 B;  2GCJ A;  2N1V A;  2HTH A;  2CHX A;  3I3T B;  2ADZ A;  2Y7B A;  1B55 A;  2R82 A;  2AEH A;  2ZEQ A;  2KC2 A;  3AXC A;  2YLM A;  4A6H A;  4HPL B;  2J7Q B;  3A1Q A;  4ICV A;  2GOW A;  1K5D B;  4XC2 A;  1WGU A;  2X18 A;  3PSC A;  1WYW B;  5KQ4 A;  2P8V A;  1WR1 A;  2UVM A;  2YS5 A;  5JLJ B;  2BWF A;  3PP2 A;  1ZW7 A;  4DBG A;  5FI1 A;  3GYP A;  2COP A;  1WJM A;  2LGX A;  3VQI A;  3ODW A;  4AOF A;  3BY4 B;  3N7C A;  5TR5 A;  4PS8 A;  4W9E A;  3TL5 A;  2OJR A;  3M1I B;  1DRO A;  1EGX A;  4NAW A;  2DEN B;  1KM7 A;  2HD5 B;  2D9Z A;  2Z0P A;  2J0K A;  4HCP B;  2DN6 A;  2V1Y A;  1YX6 B;  1WI0 A;  5HE1 A;  2KCJ A;  5GOW B;  4HAZ B;  3SNH A;  2FCQ A;  3VTV A;  1YX5 B;  2WX0 A;  2KMC A;  2KTF A;  3APF A;  4Z2M B;  3H7S A;  4NPN A;  5D7G A;  4ZRJ A;  2D9V A;  3A33 B;  5JP4 A;  2KFJ A;  3U7D A;  3ZNG C;  2IFS A;  3T9L A;  1KJT A;  3ZUN A;  4JIO U;  5J17 A;  1PLS A;  4J6I A;  4XZ4 A;  1WRD B;  5DPT A;  4BKS D;  1Q1O A;  2JY6 A;  1TJ6 A;  3VTU A;  2IYD B;  2RGF A;  1WY8 A;  1WE6 A;  1XOD A;  2MSE D;  3NOB A;  1FGZ A;  4WQO B;  4IM0 A;  1OY2 A;  2LI5 A;  4DHZ E;  2IO0 B;  3IFW B;  3R7R A;  1WM3 A;  4HLE A;  1NTI A;  5D3Y A;  2ZPY A;  1FAO A;  3MHS D;  4I6N B;  3UIO B;  3ZNZ B;  4CHJ A;  1WGY A;  1YIW A;  1Q67 A;  4WJN A;  4K2O A;  2DKQ A;  5DPR A;  1E8W A;  5C1Z A;  5KHO A;  4ASW C;  2LVQ A;  4EZK A;  2L1C A;  1HB8 A;  4HB2 B;  2ELA A;  1V89 A;  2Z0D B;  4N9F 4;  2D07 B;  2DYB A;  4IWQ A;  2MQJ A;  4C0A A;  2DIK A;  2CHW A;  1LFD A;  3A8P A;  4B95 A;  1MG8 A;  2MBH A;  4W9C A;  4TKN A;  3M62 B;  2C7N B;  2ZVN A;  3PLU A;  1E8Y A;  1S1Q B;  2B3A A;  3WAP A;  5G55 A;  2D9W A;  2COD A;  2LAS A;  1TXD A;  1ZVR A;  5G2N A;  2YT0 A;  3L17 A;  1WG7 A;  3DQV A;  4A20 A;  5DHF B;  3VUY A;  4IM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...