4ZRJA

Structure of merlin-ferm and ctd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Merlin
total genus 88
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zrjA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zrjA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zrjA01
3FSSA 2JF5A 2MSED 1WJUA 4E71A 1WGHA 3ZUNA 1J8CA 2KANA 3PTFC 5CTRC 2Z0PA 2MBQA 1NI2A 1WE6A 2KLCA 3ZVVA 3DVGY 1P6SA 4BBKA 4NSWA 2ROVA 2N23A 3SNHA 3QA8A 2FJ9A 1LB1A 3SUZA 4HAVB 1AWEA 1RLFA 1WGQA 3PZDA 2LULA 3PREA 4W9EA 2FCNA 1U5GA 1X1GA 2EMSA 4PS3A 2R2QA 2H7EA 4MJSB 1VCBA 3EC8A 2P8VA 5FI0A 2OQBA 4DX90 5EFXA 2NVUI 3BINA 2JPHA 3BY4B 4KSLC 4DHZE 1U5FA 2MA9B 2KWCA 4CO7A 2COPA 3UF8A 2B3AA 1E8XA 3D8EA 3TFMA 1V61A 1X1FA 1YIWA 3KRWA 2JRHA 2CY4A 4I6NB 1WJ1A 2KD0A 4WWPA 4Z2MB 2IO2B 1UPQA 2D9WA 4IOYX 1WR1A 2KFKA 2KMAA 4X57B 5KHOA 2MP2A 3PPAA 4F7UP 4A6FB 2KMCA 1MIZB 2RUKB 3A8PA 4HXDA 3W1SA 3PVLA 4MY6A 2D10A 3JVZX 1U5DA 1E8YA 2HE7A 4NAWA 1WIAA 2FNJB 3JW0X 3OANA 4HB3B 4W9JA 2RSUA 4DK5A 1MIXA 3ML8A 4NJ7A 2LG1A 2KWVB 4WJPA 3EECA 2O6VA 3UQAA 3H7SA 4EFOA 1LXDA 1HB6A 2KQSA 2RQ1A 2JY6A 3P6AA 1J19A 4AOFA 3PGEA 4W9IA 2O2VA 2R0DA 2LD9A 2KX0A 4B6HA 3DXDA 4XWXA 1YX6B 1K8RB 4GDLA 4D0NB 1AARA 2CB8A 2KVRA 2GJYA 1BTNA 2KO3A 3QARA 4NPNA 1UGMA 4JLCA 5D94A 3T8MA 3VFKA 1DYNA 1DROA 2E2XA 3QC8B 1U29A 2IFSA 2FIDA 4CHMA 4KIKB 2YS3A 4W9FA 2BKRB 2KK8A 1Z2MA 5HKHA 2FJLA 1Y5OA 5KHQA 3TIXA 3D8DA 3HW2B 3BJIA 2BF8B 4OVVA 2C7HA 4FADA 1UBQA 5L81A 2O2VB 2C7MB 3PRMB 3V6CB 2CAYA 3QIJA 2C5LC 1UBIA 5KQ4A 5JP4A 1VD2A 3KY9A 1V5OA 1ZVRA 2IZVB 3H6NA 3KW5B 2D9VA 1EUVB 1WGRA 2KZRA 2Z0DB 3L0WB 4WWOA 2M4NA 1PLSA 3TW1A 5DHFB 2CKHB 3KUDB 4G3XB 5JH5C 3AJ4A 2BYFA 2FCSA 4GU2A 4AWJA 2O6VD 3M95A 3VIAA 1FHOA 1V89A 3QAQA 3TBLD 4NQLB 3GYOA 3DVNV 1ZC3B 4DBBA 3OAWA 3MPXA 4II3B 1WJNA 4GDKB 2DAJA 2KTRB 1V88A 5J3YA 1CMXB 2N1WA 3OJ3A 3R7QA 5E6NA 4BKGA 1V9JA 2LUEA 3ODWA 4K1RB 3ZNHB 1H8CA 4G0NB 2UWQA 2JZZA 1NTIA 3LJ3A 4J6IA 4ZYNA 1EO6A 4HHVA 3VTVA 2W9NA 4YONA 5GMVA 4DXAB 1HB8A 4P7IA 2RPQA 3LDZE 3VUXA 1T0YA 2JVCA 2D9ZA 2ZCBA 4W9LA 5C23A 4BKSD 2N9XA 3M3JA 2AL3A 2V1YA 1J0WA 3RCPA 3EFUA 4MJSA 3K9PB 5EDSA 1E5WA 3A9KB 4AJWA 3VTUA 3ENEA 2JRIB 4I6PA 2CHWA 3KYDD 4A20A 1SGHA 4OVUA 2W2WA 2COFA 1KZGA 5FI1A 2XQNM 2Z59B 1ST7A 3C0RB 4GPTB 1WX7A 3CF6E 2Y7BA 4CYEA 2G3QB 4W9GA 1V81A 3UIPB 3ODOA 1GNUA 5DCNA 2L0FA 3CSTA 1UNQA 4EKUA 3WAPA 4B6WA 1NVLA 3HM6X 2JP2A 4ASWC 2YS5A 2HJ8A 4HB4B 2ZNVB 3UQBA 1GJZA 4IAPA 1Y8RC 4H8SA 4A3PA 4IC7B 2CR5A 2IBIB 2N0YA 2KFJA 3NHEB 5LONB 3RCZA 4KZCA 2I1KA 1FOEA 3VTWA 1FGYA 4ANUA 4RM9A 3WA0A 2LYDA 1UNRA 1R4MI 2MBBB 1E8ZA 2WWZA 4LJPB 2LZ6A 1BT0A 3FLVA 5DPWA 2L2IA 4TYZA 2KTFA 4B9KA 2DHZA 2ZNVC 2BGFA 1C1YB 4M0WB 2M1MA 4JL9A 3KSYA 1GC6A 3A33B 1UNPA 2N4FA 4M8MA 2LOXA 1WI1A 2L0TA 2KJRA 3PSCA 1P9DU 2J0KA 1FXTB 4B95A 3ECIA 4FBJB 3DBRI 2EKEC 2LVOA 1WGDA 1B55A 3JSVA 4HPLB 4GDKA 1TJ6A 2NBUA 3EPYA 4DX8A 2DN6A 2HTHB 5D3WA 5JLJB 2C9WB 2MX2A 1ISNA 5LOPB 2GBJA 2PPHA 2NPTB 4NQKE 3R7RA 2K00A 4IWPA 4W9KA 2LJ5A 5CLLB 2XK5B 1WR6E 3DQVA 1P3RA 4MT7A 2KGXB 3F0WA 1XD3B 1Z5SB 2JZ3B 2ELBA 3V6EB 4DDGD 2IY0B 1PQSA 5DIFB 4IM0A 4K7UA 3ZKJC 1GG3A 3IVFA 3DXEA 4MSQB 3T9LA 2RGNB 4GMVA 5C16A 2K25A 2QHOA 4HDQA 4ANWA 4EMOA 4ANXA 1I42A 1U2BA 2DYNA 2DZJA 1WJ4A 1OEYJ 2D11A 2DFKA 2OTXA 4L6EA 1DBHA 1YJ1A 2K6QA 4PS7A 2I5CA 2KN5A 3PS6A 3QJZA 2BWES 4A6HA 3U30A 2L76A 4EOYA 1K5DB 2M38A 3N30A 2VSZA 1V5MA 5E6PA 2M0XA 1U4AA 4EJNA 2V3SA 3QHTA 1JRUA 4FULA 3JYUA 1V80A 2NBWB 3WYFB 1C3TA 3WALA 3CSFA 2IYBA 2LGXA 3H7PB 2L05A 1Q5WB 3L10B 2A4ZA 3CMMB 3ZRFA 4HVBA 3ZO5B 2N7DA 4RM8A 3OLMD 2DLWA 2A5UA 1M94A 3PRZA 4F7ZA 1NTYA 3RUIB 2J0MA 4BOSC 2D2QA 2CRFA 4HK2A 4WJ7A 2ZPYA 2C60A 4W9CA 2X18A 4LJOB 1UPRA 4PQ0A 2D4QA 2N9EB 2O6VB 2EMTA 3KUZA 4ZDVA 4HAYB 2DX5A 2YLMA 1WM3A 3PEGA 4K2PA 2KDIA 2ZPNA 2FDQA 2LKOA 2W2XD 4ICUA 2MWNB 4KIKA 1FHWA 1IYFA 4NAWB 3DDCB 5G55A 3AULA 2WH5A 1OGWA 4EUTA 3VH3B 2JWZA 1D3ZA 3MDBC 2YS1A 2DX1A 4GMXB 2RNRB 5J3TA 1P3QU 1WGYA 2GOWA 2IYDB 5C5BA 2KDBA 4WSFA 4M8NA 1NDDA 4MGIE 2ZVNA 1WXAA 4MGKE 3SHQA 2COAA 3TMPB 3SDLC 2FCQA 4KHBB 4TQ1A 2RD0A 2XEWA 2BKFA 2LASA 4IG7B 3ZNGC 4F7GA 1UH6A 2LXCA 2L00B 2KC2A 3QWZB 1WFYA 3M1IB 1A5RA 3DVGX 2LWPA 3UINB 1H10A 1PMSA 3EHVA 4GB9A 3G9WA 3Q3JA 1E7VA 1WGGA 3ULBA 2J0JA 4GZUA 1KOTA 2MW5A 4C0AA 3MJWA 4EZJA 3N32A 4PS8A 2HRJA 2KNBA 2H7DA 3DVNU 2ROZB 3PV1A 2LGYA 3V61A 4WQOB 2COCA 3A4SC 4BFRA 2DAFA 1KI1B 1GUAB 1RAXA 2YT1A 2DYBA 1RRPB 3HQCA 3NS8A 1ZGUB 2EC1A 2EJ8A 2DENB 2L3ZA 2V4LA 2KXJA 2MBHA 5CX3A 3SV1A 3A9JB 5J17A 3QQ8B 2NZ8B 4XX5A 3ZIMA 1F9JA 3PRPB 1FHXA 4GIVA 4MH0E 3KUCB 2ZCCA 1KM7A 4KVGB 2YSZA 3HM3A 2KX3A 3B1LX 2G35A 1BTKA 1P1AA 2ADZA 3QWMA 2MLBA 4DDID 3WAMA 4G11A 4IM2A 5G2NA 3ML4A 2AYOB 2P0FA 2MBOA 5D27A 4LDTD 2DTCA 2MKRA 2C7NB 1V6EA 4F8CB 4EZKA 3AXCA 4NJ6A 3A1QA 1MPHA 1WX8A 2GMIC 2IY1B 2PEAA 3VH4B 2NBVB 2Y8GA 4DHZB 5GOWB 2VRWB 3SO6A 1PFJA 1RJ2A 1U5EA 5LXHA 4II2B 1SHCA 3V60A 1J0GA 4TV3A 2DKPA 2MCNB 1WI0A 4ZRJA 3X0WA 1UEFA 1UD7A 2G4DB 4IWOA 1MG8A 2NCNA 1M7RA 1E90A 4NY0A 3VXWA 4BBNC 5J18A 1OQYA 3AU5A 3X23A 4MGYE 3VHTC 1WH3A 4K17A 1P0RA 2LI5A 4GDLB 4IWQA 4E3CA 5DPTA 1MK9B 2LOZA 3D8FA 3V5WA 2KKCA 4PYUA 2GBMA 4WWNA 4DBGA 1N3HA 2IO0B 4Y94A 2KJHB 3MTNB 4EEWA 3AI5A 2WYQA 3NOBA 1U27A 2GBRA 5AZFA 1M7EA 5IAAC 2PZ1A 3NY5A 1X1MA 3ZTDA 3RYTA 1YQBA 3N3KB 4FN2A 3PT2B 3VUYA 1ZM0A 2KUPA 4K2OA 2DHIA 2UVMA 2DZIA 1X11A 2M8SA 2RGFA 3APFA 3NZUA 1OY2A 2P0DA 3ZRCA 3APDA 5C79A 3QX1A 4FHJA 3UIOB 1P5TA 4TKNA 3KZ1A 2D3GA 3QCAA 5HE3A 3TO1A 2G45B 2ZJDA 3IFWB 4MGZE 2Y8FA 2NMBA 4A6KA 2M17A 5KQ1A 2LRWA 3PLUA 1UZXB 3SU8X 4AUQC 5CLQB 2L7RA 3RULA 1L7YA 3VDZA 2UZSA 1IRSA 3KVFB 3D32A 1AQCA 1ZC4B 4HB2B 4KZ0A 1DDMA 1KLVA 3NSUA 5HE0A 2ZVOA 1LW3A 2ABDA 5DHAB 3V62A 2AL6A 4E74A 2KDFB 3SYXA 3ZW3A 2BPSA 1NBFC 5AZGA 2K8CA 2KCJA 2WX1A 2W2XC 2CHXA 4FLHA 3KRXA 4FJVB 2Z0OA 3VQIA 5E6OA 4BKSA 1OMWA 1V2YA 3DXCA 1TQZA 4KHOA 4A5KA 3WIMA 4KAXB 2RR9A 3O96A 4JGHB 3ODXA 4HAWB 5D3XA 1Q0WB 3N7CA 1RFAA 1UELA 2R2OA 3DBSA 3QBVB 3HHMA 2OJRA 4WJOA 1V86A 2CY5A 2NR2A 3ML9A 1QQGA 5AZHA 5BO4B 2IO3B 3R66C 4AJYB 3RZFA 2OOBB 2ZZPB 3DOWA 5TR5A 4WJNA 3VAWA 2FCMA 3TCAA 1E8WA 2IO1B 3T06A 2UYZB 3W1SC 4F1SA 5DPSA 1NTVA 1WJ6A 1ZKHA 3RT3B 3CIKA 5D7GA 3ULCA 1RRBA 1TXDA 1DDWA 2XK5A 3PHWB 4GN1A 2PJHA 2K8BA 4IM3A 3ZNZB 1OQNA 2P0HA 2D07B 4PNKA 2QKLA 2DYQA 5DI9B 1SE9A 2DHJA 1WZ3A 2N9PC 4WJQA 4EZLA 2MQJA 1L2NA 2HTHA 3U8ZA 3A98B 4A3OA 5JHGA 1WF9A 1S3SG 3TVVA 1S1QB 2KFKB 3IG3A 2Q13A 2ZEQA 2CQUA 1FGZA 3PP2A 3PG7A 5C5BB 2LVQA 3ZVRA 2MRPA 2WX0A 3A9JA 2J7QB 3JSVB 4FHKA 1WY8A 3HK0A 1EF5A 4IFSA 2G4SA 3DPDA 2CHZA 2M14A 2DX5B 2KDEB 1I2HA 3O65B 1OEYA 4BOZB 3HIZA 2BWFA 4KDLB 5HE2A 3P2BA 2K2JA 3ZTCA 2J59M 4DHJB 2DA0A 1XX0A 4MM3A 3A4RA 3W1YA 4HPMB 5JZEB 1WZ0A 2Z0QA 4NNJB 4AP4C 5C1ZA 1WM2A 4KSKC 1XODA 5DPRA 2KWUB 2PE9A 4HJKA 2GBKA 4JQWC 4IUMB 3H7PA 5IA7A 5CHFA 2VKIA 1FAOA 2KJ6A 4MK0A 5CHWA 3ONSA 1BAKA 5JHHA 3B0AA 4BBNF 5JHAA 1EVHA 1ZW7A 3NZSA 4URKA 3GOEA 2BYEA 3M63B 5AEKB 2I1JA 3Q3FA 2WDTB 1Y19B 1HBKA 1WXMA 1IPGA 1P98A 2REXA 3DBHI 2K2UA 2K1FA 3P7ZA 2JXXA 4MELA 4F7HA 4HATB 1LFDA 2KOXA 1EAZA 4GXBA 1HE8A 1MKEA 2JT4B 3L54A 4DHJD 2N1VA 3IHPC 4HDOA 1WMHA 3GYPA 1WJMA 2Z0EB 3L08A 3TJPA 2KLGA 4XZ4A 1WX9A 4YL8A 3ZLZA 2KTRA 1W1GA 3FP5A 4K81A 1WVHA 2RSGA 4IW0A 4HAUB 5DH9B 4FJZA 3TL5A 1XD4A 3VVWB 2KC1A 2D9YA 2MFQA 2LXAA 4KHAA 2KQ7A 4ZRIA 1WXVA 3MHSD 3R3MA 1WXSA 2BYVE 3PSEB 4G50A 1QZEA 4MEMA 1OTRB 2YT0A 4XC2A 1W1HA 1XT9B 3PVWA 1WE7A 1Q1OA 5KCVA 3QK0A 1TZ1A 4HAXB 3GZNI 3H1UA 3L17A 4HCNB 1KJTA 1LQBA 2AWTA 4JIOU 4K7SA 3IBEA 2XBBC 3UGBB 2DYOA 3F5RA 3A8QA 1W1DA 4HCPB 3K9OB 4FJYA 4RMAA 2PE6B 2L1CA 2YF0A 4ANVA 5D3YA 1H4RA 1I35A 2KHWB 2L8JA 1WGUA 4WVFB 1Q67A 3OJ4B 3PHXB 3ZDTA 4KDIC 4W9HA 4BVUC 3ZNID 4BKTA 5CHVC 2DZMA 5L83A 2K6DB 2RLOA 1XQQA 2DZKA 1NU2A 3LJUX 4LDTB 3B08A 1FB8A 3KYCD 3L16A 4CHKA 2ASQA 1X05A 4GGQA 1QC6A 1V5PA 4W9DA 4ZRKA 3S2AA 1G6JA 4TUUA 3VUWA 1IP9A 5JHBA 4MDKE 2MDXA 2FAZA 5L95C 2GCJA 2D9XA 2NPTA 5D3VA 2GS0A 2LRUA 1ZSQA 4ICVA 1Z87A 1TGZB 4HB0B 2YRYA 2HD5B 3VOQA 3WANA 3SD5A 4DWFA 1EGXA 2GCLA 2NS5A 4GOCA 1YD8U 4LCDE 3RD2A 1TTNA 2DKQA 2FUHB 1E7UA 2K39A 3H9DA 2LBBA 5IJMA 3PVUA 5D2MB 2VRRB 1WMHB 4Z2NA 3DCGA 5LLIA 2K8HA 3APCA 1WYWB 3M62B 1SIFA 4HAZB 1V5TA 1YX5B 3A9KA 3PLVA 2FIFA 2DHKA 3UZTA 4HWIB 4WAAA 5HE1A 2LGDA 2N7EA 3KH0A 3RZWC 5FR6A 4FA6A 1MK7B 2MP2B 1K5GB 1GC7A 1WG7A 4GSWA 1XCGA 2AEHA 1DDVA 1MAIA 1XKEA 2CU1A 4MSMB 1BWNA 1I7AA 2CODA 2YVCA 1WRDB 1XR0B 2GBNA 2JUOA 2R09A 4CHJA 3ALBA 2UZRA 4TQ0A 5LXIB 2I5FA 2MWSB 2RVBB 1V49A 4N9F4 4PYZA 4HLEA 3A1QB 2MBEA 4KV2A 3AU4A 2DYMA 1V5UA 3FEHA 2Y5BB 1X86A 1TBEA 3U7DA 3WAOA 2V76A 3L13A 2LVPA 1R4NI 3DBLI 3CXBB 4K7WA 2CS4A 2ELAA 4I6LB 1ACAA 5C6RA 2QKMA 1LM8B 2BCJA 1KZ7A 5D6JB 3ZDMC 3I3TB 4A6FA 5J2RA 5J3QA 1EF1A 3FM8C
chains in the Genus database with same CATH superfamily
2MSED 1WJUA 1J8CA 2KANA 5CTRC 2Z0PA 3DWMA 2KLCA 4PK1A 1FMAD 1VR9A 1AWEA 2FCNA 3TEXA 2JXTA 1U5GA 4PS3A 1ZDVA 5EFXA 2IGDA 3N9YC 4KSLC 1N60A 1U5FA 4CO7A 3LB8C 2WXPA 3HUIA 1BMLC 2H88B 4CQNA 2KFKA 2PKOA 2INCC 1F2RC 4HXDA 3JVZX 3JW0X 3ABVB 4C7ZA 3ML8A 2QIEB 3UQAA 4WJPA 2O6VA 4AS1A 1SB3C 3PGEA 1I4PA 4W9IA 2O2VA 2R0DA 2BYTA 2L1AA 2KX0A 2WDRB 3DXDA 1YX6B 4GDLA 2GJYA 3T8MA 5D94A 3VFKA 2NBVA 3I57A 1DYNA 3QC8B 2IFSA 2BKRB 1Z2MA 2FJLA 2J53A 2C7HA 3AE2B 1UBQA 2O2VB 1UBIA 5IOIA 3ZGZA 1VD2A 3ZJVA 3PPAA 3H6NA 1QILA 2D9VA 2KZRA 3L0WB 2M4NA 2CKHB 5JH5C 5DHFB 2AQ1B 2L32A 4P6VF 4L1RA 3TEZA 2O6VD 3VIAA 3GYOA 3MPXA 4GDKB 2DAJA 2KTRB 3OJ3A 4WURA 5E6NA 1V9JA 2H89B 2UWQA 1NTIA 3TEWA 4ZYNA 4HHVA 2JU6X 5GMVA 4DXAB 4P7IA 1ZXHA 1BXTA 4W9LA 4BKSD 3M3JA 3EFCA 3K9PB 1E5WA 1NENB 5TSSA 4AJWA 3RNGC 3VTUA 2JRIB 3KYDD 4A20A 2W2WA 1ST7A 3C0RB 3SEBA 4US8A 2G3QB 1GNUA 2L0FA 1KLGD 2BT6A 1UNQA 3WAPA 1HTQA 2HJ8A 2WXFA 4H8SA 1I7HA 2AQ3B 4KZCA 4ANUA 2RRFA 1ZE3D 1R4MI 2MBBB 4LJPB 1UNSA 1BT0A 1FIQA 3AE9B 1P7EA 2DHZA 1C1YB 4JL9A 3GP7A 1GC6A 1UNPA 2KIGA 2N4FA 4UDUC 4B95A 4FBJB 3DBRI 2LVOA 3I5JC 4RF1A 3A58A 4DX8A 2DN6A 1ISNA 4NQKE 2GBJA 4P1BC 2NPTB 2K00A 4W9KA 1WR6E 3DQVA 1Z5SB 4DDGD 5M4YB 2WP9B 2ELBA 1PQSA 3ZKJC 3IVFA 3DXEA 3T9LA 1QQRA 4OZCA 2K25A 2Y5PA 2DYNA 2K9XA 2I38A 3I9V1 2OHFA 4HPPA 1I4QA 1K5DB 3FVCA 3Q6BA 1V5MA 4EJNA 2V3SA 1LO5D 1XLPA 1JMLA 4FULA 1NYQA 4OSNA 3WALA 2JX5A 3L10B 1FRDA 2I2YA 4R3DA 3PRZA 2J0MA 2MJDA 4BOSC 4W9CA 4XWTA 3BYYB 1B1ZA 4ZDVA 3EC8A 4K2PA 2MHJA 4ICUA 2LKOA 1FHWA 1R7SA 3AULA 2WH5A 1N5WA 1D3ZA 1D5ZC 2YS1A 3U4EG 1FPYA 1WGYA 3UIPB 4MGIE 4MGKE 1WXAA 3GE8C 5BYQA 2FCQA 3SBGA 4IG7B 2LXCA 3SBTA 2LWPA 1H10A 1PMSA 1YN4A 2EELA 2Z8LA 3MJWA 4EZJA 3Q14C 2H7DA 3DVNU 5I2MA 4KKIA 3KWLA 3MP9A 1C76A 1GUAB 1TS4A 2N9KA 2DYBA 3PZ7A 3NS8A 1ZGUB 2J42A 2V4LA 2KXJA 3QQ8B 1T5XD 3PRPB 1FHXA 1DOYA 3KUCB 4ZYSA 2ZCCA 2MEKA 2R82A 3B1LX 4J3OD 1BTKA 1P1AA 2ADZA 3QWMA 1ESFA 5G2NA 4IM2A 3RI7C 2C7NB 1V6EA 3AM9A 2IY1B 2GMIC 2PEAA 5GOWB 2Z59A 1RJ2A 1IUEA 1J0GA 2D5GA 3DHHC 3Q8EA 2DKPA 1WI0A 3W5VB 2NMQA 3VXWA 4BBNC 3AU5A 3Q3NC 2BTEA 4IOIE 2LI5A 4IWQA 4E3CA 3D8FA 3NVZA 1ROEA 3MTNB 4EEWA 2QDFA 3O13A 2GBRA 2PZ1A 1OQRA 3RYTA 1FCLA 1YQBA 4FN2A 1ZM0A 2RGFA 2DHIA 4YSXB 3APFA 1OY2A 3ETRA 1HEZE 1UF0A 4TKNA 4OZAA 3WCQA 5HE3A 2K3UA 2ZJDA 2INDC 1C9FA 2Y8FA 5CLQB 3RULA 2KUQA 2UZSA 1L4DB 1IRSA 3KVFB 3D32A 1KLVA 2XN9C 1LW3A 2M0AA 3V62A 2KDFB 3SYXA 2BPSA 5AZGA 2K8CA 3AEEB 4FJVB 2GUMA 2JYEA 1CK1A 1TQZA 3U12A 1V2YA 4KAXB 1HTOA 1VRAB 3O96A 3CIRB 5D3XA 4TMAB 1UELA 5BYSA 2WHIA 2OJRA 1V86A 3GE3C 4ILGB 5AZHA 5BO4B 1N62A 1L5PA 2ZZPB 2FCMA 3TCAA 1YJIA 3T06A 1STEA 1NTVA 1WJ6A 2KACA 2QC8A 3ULCA 1RRBA 3R8BA 4IM3A 1OQNA 1XCTL 3T3OA 2QKLA 1T0SC 2QSDA 1WZ3A 2MQJA 3AEBB 2HTHA 5JHGA 1S3SG 3RN9C 2CQUA 2LVQA 3ZVRA 3A9JA 3BWUD 3AE5B 2LJIA 2DX5B 2BB6A 2KDEB 1I2HA 1OEYA 4BOZB 3HIZA 2WNMA 3OG5A 3P2BA 2K2JA 4DHJB 4N59A 3MC0B 2WQYB 1WZ0A 4NNJB 4AP4C 5DPRA 2KWUB 2PE9A 1WGKA 5CHWA 1FAOA 2KJ6A 3ONSA 4OT1A 5JHAA 2KWDA 4NAMA 1FRRA 2BYEA 4OVZA 2WDTB 1Y19B 1P98A 3DBHI 2KIEA 3L4PA 3L54A 1EAZA 4GXBA 1HE8A 2N1VA 3L08A 2GI9A 2Z0EB 3FP5A 3ZXVA 5DH9B 3TL5A 2D9YA 2MFQA 2LXAA 4ZRIA 1DGJA 5KCVA 3I63C 3QK0A 4HCNB 2X8XX 5G5GA 4K7SA 2DYOA 3F5RA 2WXGA 3K9OB 4FJYA 5D3YA 1H4RA 2L8JA 1Q67A 5I4DA 3ZDTA 5CHVC 1J7AA 5L83A 1NU2A 2MJ3A 1K51A 3L16A 4CHKA 1T0QC 4XGAB 1YN3A 2LGIA 4TUUA 1IP9A 3KQ4A 2FAZA 2WXIA 3RNCC 5D3VA 2GS0A 2LRUA 4ICVA 2ZW1A 4HB0B 3WANA 4KX6B 1SIJA 4K3CA 2LBBA 2UU7A 3BVMA 5LLIA 2VRRB 1JROA 2Q5WD 3APCA 1V5TA 3A9KA 3PLVA 2CJOA 2FIFA 4W9FA 3T3NA 2LGDA 3RZWC 2GLSA 1MK7B 3MC8A 1K5GB 2WXOA 4GSWA 2AEHA 4DBGA 1WRDB 2GBNA 4TQ0A 2JUOA 2R09A 5LXIB 1V49A 4C4VB 4PYZA 4C56C 3VR9B 3ZJUA 3AU4A 1V5UA 2VZKB 3WAOA 3CXBB 4I6LB 1ACAA 5C6RA 2K22A 1LM8B 3AEFB 5D6JB 3ZDMC 4A6FA 5J2RA 1ZYIA 2DZKA 1EF1A 3PRMB 1AYFA 2JF5A 3PTFC 1NI2A 1WE6A 5C2TB 4B0MA 1OFFA 3NRZA 3KWVA 3SNHA 3QA8A 3SUZA 3DHIC 5FK9C 1R4MB 1VCBA 2P8VA 2OQBA 2JPHA 3BY4B 3DBLB 3OWEB 4D6WA 2FE8A 2B3AA 1E8XA 1H8CA 1V61A 1WJ1A 1KFYB 2KMCA 1MIZB 4OHJA 3W1SA 3PVLA 1L4ZB 4HRSA 2BS2B 1U5DA 1E8YA 2FNJB 3OANA 4HB3B 3R2IA 4DK5A 1MIXA 1IBXB 2LG1A 3E66A 2ONQA 4AOFA 2LD9A 4XWXA 4D0NB 1AARA 1L6VA 3QARA 4NPNA 1SJED 1UGMA 2D3AA 3N20C 2FIDA 4GNKB 1Y5OA 1JALA 3TIXA 1KBLA 3D8DA 3HW2B 3BJIA 2BF8B 3RPFC 2C7MB 1WWTA 3V6CB 5JP4A 3KW5B 1JDEA 1LGRA 1WGRA 1FCCC 4WWOA 1PLSA 3TW1A 1NYRA 3AJ4A 2BYFA 4GU2A 3NVVA 4MT5A 1MJDA 4KHBA 1I4GA 3FAHA 1V88A 2K49A 1VDVA 3R7QA 4YXDB 1FFVA 5GXGB 2W3SA 3LJ3A 4J6IA 1EO6A 2W9NA 3RMKC 4RGNA 3LDZE 1T0YA 4MH8A 2D9ZA 2AL3A 5EDSA 3FILB 3A9KB 1SGHA 1JWAD 5FI1A 2COFA 2Z59B 2XQNM 2QMTA 1TKYA 4CYEA 5FKAC 4EKUA 1FNVA 5EE1A 2YS5A 2ZNVB 5AUKA 1KTKA 3E9OA 4IAPA 1Y8RC 4A3PA 4IC7B 1PUTA 1QOAA 2IBIB 2KFJA 5LONB 2I1KA 3VTWA 4RM9A 2AX5A 1D5MC 2LZ6A 2KTFA 2KMMA 2ZNVC 3E9SA 1RWSA 2RDGA 2L0TA 1WI1A 2J0KA 2J4XA 4HPLB 2LGSA 4PT5A 5D3WA 2C9WB 1V97A 4JKHA 5LOPB 2PPHA 4LNIA 2LJ5A 2WXQA 2XK5B 3Q8BA 2WGSA 2JZ3B 1GG3A 2RMMA 4HDQA 2Y5CA 4ANWA 1YMHE 1T6BX 2DZJA 1OEYJ 2D11A 1YJ1A 1DBHA 2KN5A 2BWES 4A6HA 2L76A 2M38A 3BK2A 4WAFA 5E6PA 1U4AA 5G5HA 2V9HA 1C79A 3QHTA 1V80A 5BYRA 1YN5A 3CSFA 2IYBA 2L05A 3CMMB 3ZRFA 1N5XA 2EKIA 2DLWA 1ET6A 2D2QA 4WJ7A 2ZPYA 2C60A 2X18A 1T0RC 2O6VB 4RCOA 4REZA 2ZPNA 2PW9A 3VRBB 3PEGA 4YTMB 2W2XD 3Q8AA 4Q2JA 3HRDD 3DDCB 5G55A 1KC7A 3VH3B 4KGTA 1P3QU 2GOWA 4MJSB 2ZVNA 3TMPB 3HVDA 4TQ1A 2BKFA 1JRPA 1SF0A 1TKEA 3UINB 3EHVA 4GZUA 3W2DA 2ROZB 2Y3AA 5C3JB 1I4XA 3P4QB 4WQOB 4MM3B 1ZPSA 3Q8CA 3UI3A 1TIFA 2YT1A 4ZHOA 2EC1A 2DENB 4GIVA 2YSZA 2G35A 4DDID 2G9HD 3MC9A 3WAMA 4G11A 2P0FA 4B0EA 4LDTD 3RNAC 1PDXA 4RGTA 4NJ6A 2DNFA 1MPHA 4DHZB 3SO6A 5LXHA 4TV3A 2LHEA 2SAKA 4A6QA 1UEFA 2G4DB 1VZ7A 4IWOA 1MG8A 1OQYA 4MGYE 3VHTC 1P0RA 4WQMA 5DPTA 1MK9B 3DBRB 2E3TA 2GBMA 4WWNA 5JVLA 1IGDA 2IO0B 2KJHB 3AI5A 2WYQA 1U27A 3TEYA 2IJ0A 2K0PA 1QLBB 3N3KB 4DXGA 3VUYA 3ZYYX 2M8SA 2KUPA 4K2OA 4L23A 4RH6A 3UIOB 2G45B 5KHQA 3SU8X 5KQ1A 2HDEA 1XEEA 1AQCA 1ZC4B 4HB2B 4IKGA 1GPXA 2IPKD 2W55A 5DHAB 2AL6A 3ZW3A 4C4VA 3HSAA 4FLHA 3KRXA 5AUIA 4QXAB 3DXCA 2X38A 4HROA 2RR9A 5EE0A 1RFAA 3HHMA 3QBVB 2CY5A 1WRIA 1C77A 2IO3B 3ZXRA 2MH7A 3HVZA 3MHZA 2OOBB 5TR5A 3DOWA 4O1NA 1JW9D 4WJNA 2ZW0A 4A55A 4XWWA 1E8WA 2UYZB 5DPSA 3CIKA 5D7GA 1SEBD 1QKZA 2XK5A 2PJHA 3ZNZB 2DYQA 1SE9A 3NVWA 2DHJA 2Z14A 2N9PC 4EZLA 1XLNA 4JPSA 1L2NA 1TYGB 2KFKB 3IG3A 5CHFA 4HKQA 1WY8A 1EF5A 1DOXA 2CHZA 3BVGA 4KDLB 5HE2A 1TZOA 5HI1A 3ZTCA 5JZEB 3A4RA 1JQ4A 4HPMB 5D3IB 5C1ZA 1XLQA 2LHDA 1WM2A 4KSKC 4JK7A 1XODA 4HJKA 1YNTE 2GBKA 4KKJA 4IUMB 2VKIA 1BAKA 5JHHA 1Q10A 4EE2A 1ZW7A 3M63B 5AEKB 1VJKA 4C80A 1HBKA 2WXJA 4ZOHC 1IPGA 2AQ2B 2K1FA 3P7ZA 2JXXA 1K52A 4HATB 1LFDA 1C3TA 3B9JA 2JT4B 1MKEA 1RYJA 1ZP0B 2KT7A 5BMHA 4XZ4A 3C19A 1WVHA 4IW0A 4HAUB 3VVWB 3TSSA 4XDDA 3MHSD 4G50A 1WXVA 4LNNA 3R3MA 2BYVE 3RD2A 1W1HA 1XT9B 3PZ8A 1C4AA 2AWTA 4JIOU 4JK8A 3VR8B 1RM6C 4RMAA 2YF0A 2KHWB 4WVFB 1P7FA 2V0GA 3NG0A 3ZNID 3AV8A 3GZNB 1SSNA 1XQQA 2XNAC 1ZXIA 3LJUX 3B08A 3S2AA 4HJGE 2E6XA 4D2KA 4MDKE 2MDXA 1V1OA 5L95C 5IP4D 2NPTA 1Z87A 3AECB 3VOQA 3BVZA 4LNOA 3IAS1 3SD5A 4GOCA 4LLGM 1YD8U 3H9DA 4JK9A 2K39A 3SFEB 3DCGA 1SIFA 1YX5B 4WAAA 4HWIB 2N7EA 3KH0A 1VZ6A 2MP2B 3NZ3A 1WG7A 1EU4A 1XCGA 2JWUA 2CODA 1TS2A 4LNFA 4RF0A 3ALBA 4YSZB 2I5FA 1VZ8A 4N9F4 4HLEA 3A1QB 2MBEA 1AWDA 5IO9A 1FNWA 1X86A 1TBEA 3U7DA 3DBLI 2CS4A 2PMVA 3EGRA 3RNEC 2QILA 5J3QA 4E71A 3ZUNA 1OQQA 4NSWA 3IT4B 2N0SB 2N23A 1RFKA 2FJ9A 3B2FA 1WGQA 2LULA 4W9EA 3EA6A 1X1GA 2R2QA 4H2AA 5FI0A 2NVUI 3BINA 4DHZE 2MA9B 3VRAB 2DBYA 3UF8A 3TFMA 1YIWA 3KRWA 2JRHA 2CY4A 1PFDA 4WWPA 4Z2MB 1UPQA 4IOYX 4QJ3B 1WR1A 2J52A 2MP2A 1N63A 4LK0M 4A6FB 2D10A 2INNE 2KN4A 1WIAA 4NJ7A 3ENBA 3EECA 4EFOA 2KQSA 2RQ1A 1J19A 3NWDA 4B6HA 1TS5A 3NWFA 1KLUD 3IT6B 3LXFA 2KO3A 4ZRQA 1F1HA 3W9CB 4JLCA 4XE0A 1DROA 1U29A 1DYQA 4KIKB 1SE4A 1QOGA 2BW2A 3Q8FA 1XF5L 1ZOYB 1FFUA 2CAYA 2C5LC 1V1PB 5KQ4A 5LG4B 1EUVB 2Z0DB 3P63A 3KUDB 2LFIA 1QF6A 1AN8A 2W82A 1WXQA 1V89A 3QAQA 3TBLD 4NQLB 3OAWA 1ZC3B 4II3B 1TKGA 4WIPA 3H8HA 4YT0B 4JKAA 2WXMA 4CSQA 4BKGA 2LUEA 1WSPA 3ODWA 1MI0A 3DCXA 2JZZA 3VTVA 4YONA 1HB8A 4L2YA 2RPQA 3AE3B 3VUXA 2JVCA 1GB1A 2N9XA 2V1YA 3RCPA 3EFUA 4MJSA 3W5UB 2BQQA 2V4IB 2CHWA 4OVUA 1KZGA 4ILJA 1KF6B 3CF6E 1I4RA 2Y7BA 1V81A 3ODOA 4M0WA 1PYWD 1EWYC 3N1YC 2JP2A 4ASWC 4HB4B 2CR5A 2N0YA 3NHEB 2N9LA 2WXKA 1FOEA 1FGYA 4ITKA 2KDMA 1E8ZA 2WWZA 5DPWA 1SBBB 4TYZA 4P1CC 2L83A 2M1MA 2LOXA 3PSCA 1P9DU 1FXTB 3ECIA 4C7YA 4BAXA 2EKEC 3NJTA 1WGDA 1B55A 4ZRPA 1F0ZA 4RGMA 2NBUA 3EPYA 4LNKA 1PGBA 2HTHB 5JLJB 3R7RA 4JKDA 4IWPA 4GOUA 5CLLB 1P3RA 4MT7A 3F0WA 1C4PA 3V6EB 2IY0B 4K7UA 1T3QA 2RGNB 4GMVA 5I2SA 1F77A 4ANXA 1I42A 1U2BA 4ILHA 1WJ4A 2OTXA 3AE4B 5BMGA 3PS6A 3Q69A 3R2TA 3U30A 3C8YA 3P42A 2VSZA 3JYUA 2NBWB 2WLBA 2KYWA 4HVBA 1Q5WB 2A4ZA 2N7DA 4HSIA 2A5UA 3FILA 1K50A 4F7ZA 3RUIB 4DQOC 1ENFA 2QJLA 4HK2A 4PQ0A 2D4QA 2N9EB 3KUZA 5EE3A 4L1BA 2JSVX 2YLMA 1WM3A 2FDQA 1I4HA 2MWNB 1IYFA 2FJUB 2R2YA 4NAWB 1HXYD 4EUTA 1OGWA 1UGJA 2JWZA 3DVNV 4GMXB 3AEDB 4X57B 4WSFA 3SDLC 1JWUD 2Z13A 4KHBB 3RNFC 3ZNGC 3OHMB 1A5RA 1YOVB 2KC2A 1K53A 2L00B 3M1IB 3DVGX 3ULBA 1KOTA 2DWQA 4C0AA 4M02A 4PS8A 4JWUC 2B76B 3PV1A 3V61A 1DIKA 3EUB2 2COCA 3A4SC 4BFRA 4NJCA 1RAXA 1VBGA 1NVID 5CX3A 2L3ZA 1C4CA 2BBCA 2MBHA 5J17A 3ZIMA 4XX5A 5T8IA 1MPEA 3HM3A 1KM7A 4KVGB 3AE1B 5E6JA 1JWSD 2MBOA 5D27A 5D3DA 4F8CB 2WDQB 3AXCA 1WX8A 2VRWB 3AEAB 4II2B 1SHCA 3V60A 2DLBA 1EM7A 1FM0D 3X0WA 3U2SC 2IGHA 2NCNA 2YEPB 5J18A 1WH3A 4GDLB 2KKCA 2WU5B 1MHXA 2ON8A 3NOBA 5IAAC 3V05A 1ZUD2 1SE3A 2RDBC 1GGOA 3HIEA 1UWXA 2UVMA 2DZIA 1X11A 2P0DA 2M19A 3APDA 3QX1A 4FHJA 3KZ1A 3QCAA 3TO1A 3IFWB 1QOFA 4A6KA 2M17A 3PLUA 2LRWA 4AUQC 1UZXB 1SJHD 2L7RA 1L7YA 4KZ0A 4JKGB 2ZVOA 4JKEA 4E74A 1NBFC 4JKCA 2KCJA 2WX1A 4P16A 2W2XC 3VQIA 4JKFA 2Z0OA 5E6OA 4KHOA 4A5KA 2G1EA 5MPOA 3B77A 1D5XC 1Q0WB 2R2OA 3N7CA 2PTLA 1ET9A 3ML9A 2VH1A 1QQGA 4XYCA 3TUOA 3VAWA 3W1SC 2QEJC 1JWBD 1TXDA 2D3CA 3PHWB 2K8BA 2P0HA 4PNKA 5DI9B 3MJ5A 4WJQA 1J7BA 1CQVA 3DWGC 3U8ZA 3A98B 1TT5B 3ZQ4A 4A3OA 1WF9A 4XC2A 1S1QB 4AWJA 2WX0A 4FHKA 3HK0A 4IFSA 2G4SA 2QCZA 2M14A 4A9AA 2BWFA 2FUG1 2J59M 2DA0A 4MM3A 3W1YA 2NTSA 2Z0QA 1YJJA 2WU2B 1KH0A 4MACA 2M56B 3H7PA 5IA7A 3B0AA 3SFDB 4BBNF 1EVHA 4URKA 3NZSA 2CJNA 3GOEA 3RNBC 3B2GA 2KVZA 2HJ1A 3NUHB 3E9LA 3IHPC 3GYPA 2KLGA 1WX9A 4YL8A 1W1GA 4K81A 4JE3B 4FJZA 4ARCA 2LEKA 4KHAA 2KQ7A 1QZEA 3IAM1 1Q1OA 1NEKB 4HAXB 3GZNI 3L17A 1KJTA 4OW0A 3IBEA 4M01A 4JKGA 1SE2A 3UGBB 2HTME 3A8QA 1W1DA 3P4PB 2RPVA 1L0XB 2K5PA 4ANVA 1L0YB 2BS3B 2DZMA 2K6DB 2IGGA 2OJWA 2ZKMX 1PGXA 3KYCD 2ASQA 1X05A 4GGQA 1V5PA 4W9DA 4ZRKA 1G6JA 3VUWA 5JHBA 2GCJA 2D9XA 1ZSQA 1TGZB 4DWFA 4LCDE 1TTNA 2FUHB 4A90A 3AH7A 3M62B 4HAZB 2DHKA 4FA6A 3LYYA 5FR6A 2CU1A 1XKEA 2WDVB 1XR0B 4CHJA 2UZRA 3AE7B 3BIID 3NW8A 3DBHB 4KV2A 2DYMA 3FEHA 2R61A 2V76A 4K7WA 3BK1A 2ELAA 2V3PA 3I3TB 2LASA 3FSSA 1WGHA 4TSSA 2DIKA 2MBQA 3ZVVA 1HZ6A 4JX1C 3DVGY 1P6SA 4LTUA 4BBKA 2WXRA 2ROVA 5HG2A 1LB1A 4HAVB 1AW7A 1RLFA 1FO4A 3PZDA 3PREA 2EMSA 2H7EA 4DX90 1R4NB 2NTTA 3Q3OC 2KWCA 2COPA 3D8EA 4BZAA 4I6NB 1X1FA 1E6EB 2KD0A 2IO2B 2KMAA 2D9WA 5KHOA 4F7UP 1HZ5A 2RUKB 3A8PA 5EE9A 4MY6A 5HFYA 2HE7A 4NAWA 1EWCA 4W9JA 3IXSA 2RSUA 2KWVB 1GOZA 3H7SA 1LXDA 1HB6A 2IDYA 2JY6A 3P6AA 1K8RB 1E0ZA 2CB8A 2KVRA 1TS3A 1BTNA 3FKYA 2E2XA 2ACZB 5JXVA 4CHMA 1JWMD 2YS3A 1L0VB 2FBWB 2K8EA 3AMZA 3NVYA 3U7ZA 2KK8A 5HKHA 1TY2A 4OVVA 4FADA 5L81A 3QIJA 3URYA 4RGOS 3KY9A 1V5OA 1ZVRA 2IZVB 4G3XB 2TSSA 2FCSA 3M95A 1FHOA 4AQ7A 4DBBA 1D4BA 1WJNA 1WYGA 5J3YA 1CMXB 2N1WA 2KR0A 2YEPF 1TJEA 4K1RB 4IDIA 3ZNHB 4G0NB 4DIXA 2PIAA 4XDCA 2ZCBA 1J0WA 1XO3A 1UUPA 3ENEA 1VBHA 4S17A 4I6PA 2WXHA 4GPTB 1WX7A 3NWAA 4W9GA 5DCNA 4WWMA 3CSTA 1QT9A 4B6WA 1NVLA 3HM6X 1T77A 3UQBA 1GJZA 3RCZA 3WA0A 2LYDA 1UNRA 4N58A 3FC4A 3FLVA 4M00A 2L2IA 4B9KA 1GAQB 1J7CA 4RNAA 2BGFA 4M0WB 3KSYA 3A33B 4M8MA 2KJRA 2WS3B 3JSVA 5FR3A 4GDKA 1TJ6A 1YQ4B 2LUMA 2V3NA 1XD3B 2KGXB 5DIFB 4IM0A 4MSQB 2GRIA 2QHOA 5C16A 4EMOA 1MI1A 4PS7A 2DFKA 4L6EA 2K6QA 2WXLA 2I5CA 3QJZA 4QJ5B 2VH2A 4EOYA 1MHHE 3N30A 2M0XA 1JRUA 4KGRA 3WYFB 3AN1A 5H8YE 3H7PB 2BS4B 2LGXA 4HKZE 3AE6B 3ZO5B 4RM8A 3OLMD 1ZDXA 1M94A 1NTYA 1D6EC 2CRFA 4F1SA 4OZBA 4LJOB 1UPRA 1MFWA 3RFZB 2EMTA 2ICIA 3E9PA 4HAYB 2DX5A 2LMCA 2KDIA 4KIKA 5LNK1 1Y56A 2CU3A 2KQ4X 3P4RB 3MFGA 4JKBA 2MX2A 3MDBC 2DX1A 5J3TA 2RNRB 2KDBA 5H92C 4M8NA 2IYDB 5C5BA 1NDDA 3SHQA 2COAA 1ACCA 4YWGG 2RD0A 2XEWA 3E56A 2JYTA 3AB5A 4F7GA 1UH6A 3AEGB 3QWZB 1WFYA 4GB9A 3G9WA 3Q3JA 1E7VA 4RFBA 1WGGA 2J0JA 2MW5A 3N32A 2HRJA 2KNBA 2LGYA 3BZDB 1XXGA 2DAFA 1KI1B 3AE8B 3KLSX 1RRPB 3HQCA 2EJ8A 3SV1A 3A9JB 2NZ8B 2W54A 1F9JA 4MH0E 4USAA 2YT2A 1V1PA 2KX3A 2D3BA 4FXCA 4N6EB 2MLBA 3P4SB 4C00A 3ML4A 1MG4A 2AYOB 4ZHPA 5HHDG 2DTCA 4WH4A 2MKRA 1E10A 4EZKA 3A1QA 3VH4B 2NBVB 2Y8GA 2BVCA 1PFJA 1U5EA 2MCNB 2SEBD 4ZRJA 4JWSC 1UD7A 1M7RA 1E90A 4NY0A 1E9MA 3Q3MC 3X23A 4K17A 2LOZA 3V5WA 4PYUA 1L6UA 1N3HA 4Y94A 5AZFA 1M7EA 3NY5A 1X1MA 3ZTDA 2OEDA 3PT2B 1JCKB 1XCQL 3NZUA 3N1ZC 3ZRCA 1BUIC 2KAJA 5C79A 2X0SA 1P5TA 2D3GA 2MJEA 2JQRB 4MGZE 2GB1A 2NMBA 1FEHA 3CWIA 3VDZA 4HEA1 4K3BA 3ZJTA 1DDMA 4DXFA 3NSUA 5HE0A 1F2RI 2ABDA 2CHXA 2JZPA 4BKSA 1OMWA 3PO0A 3WIMA 5IKCM 4JGHB 3ODXA 4HAWB 1FXAA 3DBSA 4WJOA 2NR2A 4AJYB 3RZFA 3Q2AC 1A70A 3DHGC 2IO1B 3BYTB 1ZKHA 3RT3B 1FXIA 1DDWA 4GN1A 1QOBA 4YSYB 1IGCA 2D07B 2PLPA 1F52A 4ARIA 3GS2A 1NI3A 3R66C 3TVVA 3TJPA 3U52E 1PGAA 2Q13A 2ZEQA 1FGZA 3PP2A 5C5BB 3PG7A 2MRPA 3JSVB 1GB4A 2J7QB 1V8CA 3DPDA 3O65B 2BB5A 1XX0A 2PVGC 1SXTA 2INPE 4JQWC 1UWMA 2N7JA 1FD6A 4MK0A 2Z4DA 5BMIA 4GLSC 2I1JA 3Q3FA 4YTPB 1WXMA 2REXA 2K2UA 5IRSA 4MELA 4F7HA 2KOXA 4A8XC 4DHJD 4HDOA 1WMHA 1EU3A 1WJMA 1TY0A 4S0RA 3ZLZA 2KTRA 1VLBA 4ACFA 3GB1A 2RSGA 5IN7A 3N1XC 1XD4A 2PVOD 1CJEA 2KC1A 1YQ3B 4KGSA 3NS1A 1WXSA 3PSEB 4MEMA 1M4VA 1OTRB 2YT0A 3PVWA 1WE7A 3SR6A 1TZ1A 3H1UA 1LQBA 2XBBC 1E7PB 1B9RA 2RDHA 4HCPB 2WXNA 2PE6B 2L1CA 2W3RA 4QAYA 2VZKD 1I35A 1WGUA 4BVUC 3OJ4B 4KDIC 3PHXB 4W9HA 4BKTA 2RLOA 4LDTB 1FB8A 1QC6A 4US9A 1HQRD 4NZLB 1DOIA 1FNUA 4YTNB 1N6ZA 3V3XA 2YRYA 2HD5B 1EGXA 2GCLA 2NS5A 2DKQA 1E7UA 5IJMA 3PVUA 5D2MB 1WMHB 4Z2NA 2K8HA 1WYWB 3UZTA 1HA5A 5HE1A 1KRHA 1MVKA 1GC7A 1C78A 1CZPA 1DDVA 1MAIA 4MSMB 1BWNA 1I7AA 1XLOA 2YVCA 2MWSB 2RVBB 4QJ4B 3J9CA 1IBXA 2L52A 2Y5BB 3P1MA 3L13A 2LVPA 1R4NI 2QKMA 2BCJA 1KZ7A 1N61A 5C23A 3FM8C
chains in the Genus database with same CATH topology
2MSED 1WJUA 1J8CA 2KANA 5CTRC 2Z0PA 2KLCA 1AWEA 2FCNA 1U5GA 4PS3A 5EFXA 4KSLC 1U5FA 4CO7A 2KFKA 4HXDA 3JVZX 3JW0X 3ML8A 3UQAA 4WJPA 2O6VA 3PGEA 4W9IA 2O2VA 2R0DA 2KX0A 3DXDA 1YX6B 4GDLA 2GJYA 3T8MA 5D94A 3VFKA 1DYNA 3QC8B 2IFSA 2BKRB 1Z2MA 2FJLA 2C7HA 1UBQA 2O2VB 1UBIA 1VD2A 3PPAA 3H6NA 2D9VA 2KZRA 3L0WB 2M4NA 2CKHB 5JH5C 5DHFB 2O6VD 3VIAA 3GYOA 3MPXA 4GDKB 2DAJA 2KTRB 3OJ3A 5E6NA 1V9JA 2UWQA 1NTIA 4ZYNA 4HHVA 5GMVA 4DXAB 4P7IA 4W9LA 4BKSD 3M3JA 3K9PB 1E5WA 4AJWA 3VTUA 2JRIB 3KYDD 4A20A 2W2WA 1ST7A 3C0RB 2G3QB 1GNUA 2L0FA 1UNQA 3WAPA 2HJ8A 4H8SA 4KZCA 4ANUA 1R4MI 2MBBB 4LJPB 1BT0A 2DHZA 1C1YB 4JL9A 1GC6A 1UNPA 2N4FA 4B95A 4FBJB 3DBRI 2LVOA 4DX8A 2DN6A 1ISNA 4NQKE 2GBJA 2NPTB 2K00A 4W9KA 1WR6E 3DQVA 1Z5SB 4DDGD 2ELBA 1PQSA 3ZKJC 3IVFA 3DXEA 3T9LA 2K25A 2DYNA 1K5DB 1V5MA 4EJNA 2V3SA 4FULA 3WALA 3L10B 3PRZA 2J0MA 4BOSC 4W9CA 4ZDVA 3EC8A 4K2PA 4ICUA 2LKOA 1FHWA 3AULA 2WH5A 1D3ZA 2YS1A 1WGYA 3UIPB 4MGIE 4MGKE 1WXAA 2FCQA 3SBGA 4IG7B 2LXCA 3SBTA 2LWPA 1H10A 1PMSA 3MJWA 4EZJA 2H7DA 3DVNU 1GUAB 2DYBA 3NS8A 1ZGUB 2V4LA 2KXJA 3QQ8B 3PRPB 1FHXA 3KUCB 2ZCCA 2R82A 3B1LX 1BTKA 1P1AA 2ADZA 3QWMA 5G2NA 4IM2A 2C7NB 1V6EA 2IY1B 2GMIC 2PEAA 5GOWB 1RJ2A 1J0GA 2DKPA 1WI0A 3VXWA 4BBNC 3AU5A 2LI5A 4IWQA 4E3CA 3D8FA 3MTNB 4EEWA 2GBRA 2PZ1A 3RYTA 1YQBA 4FN2A 1ZM0A 2RGFA 2DHIA 3APFA 1OY2A 4TKNA 5HE3A 2ZJDA 2Y8FA 5CLQB 3RULA 2UZSA 1IRSA 3KVFB 3D32A 1KLVA 1LW3A 3V62A 2KDFB 3SYXA 2BPSA 5AZGA 2K8CA 4FJVB 1V2YA 1TQZA 4KAXB 3O96A 5D3XA 1UELA 2OJRA 1V86A 4ILGB 5AZHA 5BO4B 2ZZPB 2FCMA 3TCAA 3T06A 1NTVA 1WJ6A 3ULCA 1RRBA 4IM3A 1OQNA 2QKLA 1WZ3A 2MQJA 2HTHA 5JHGA 1S3SG 2CQUA 2LVQA 3ZVRA 3A9JA 2DX5B 2KDEB 1I2HA 1OEYA 4BOZB 3HIZA 3P2BA 2K2JA 4DHJB 1WZ0A 4NNJB 4AP4C 5DPRA 2KWUB 2PE9A 5CHWA 1FAOA 2KJ6A 3ONSA 5JHAA 2BYEA 2WDTB 1Y19B 1P98A 3DBHI 3L54A 1EAZA 4GXBA 1HE8A 2N1VA 3L08A 2Z0EB 3FP5A 5DH9B 3TL5A 2D9YA 2MFQA 2LXAA 4ZRIA 5KCVA 3QK0A 4HCNB 4K7SA 2DYOA 3F5RA 3K9OB 4FJYA 5D3YA 1H4RA 2L8JA 1Q67A 3ZDTA 5CHVC 5L83A 1NU2A 3L16A 4CHKA 4TUUA 1IP9A 2FAZA 5D3VA 2GS0A 2LRUA 4ICVA 4HB0B 3WANA 2LBBA 5LLIA 2VRRB 3APCA 1V5TA 3A9KA 3PLVA 4W9FA 2FIFA 2LGDA 3RZWC 1MK7B 1K5GB 4GSWA 2AEHA 4DBGA 1WRDB 2GBNA 4TQ0A 2JUOA 2R09A 5LXIB 1V49A 4PYZA 3AU4A 1V5UA 3WAOA 3CXBB 4I6LB 1ACAA 5C6RA 1LM8B 5D6JB 3ZDMC 4A6FA 5J2RA 2DZKA 3PRMB 1EF1A 2JF5A 3PTFC 1NI2A 1WE6A 3SNHA 3QA8A 3SUZA 1VCBA 2P8VA 2OQBA 2JPHA 3BY4B 2B3AA 1E8XA 1H8CA 1V61A 1WJ1A 2KMCA 1MIZB 3W1SA 3PVLA 1U5DA 1E8YA 2FNJB 3OANA 4HB3B 4DK5A 1MIXA 2LG1A 3E66A 4AOFA 2LD9A 4XWXA 4D0NB 1AARA 3QARA 4NPNA 1UGMA 2FIDA 1Y5OA 3TIXA 1KBLA 3D8DA 3HW2B 3BJIA 2BF8B 2C7MB 3V6CB 5JP4A 3KW5B 1JDEA 1WGRA 4WWOA 1PLSA 3TW1A 3AJ4A 2BYFA 4GU2A 1V88A 3R7QA 3LJ3A 4J6IA 1EO6A 2W9NA 3LDZE 1T0YA 2D9ZA 2AL3A 5EDSA 3A9KB 1SGHA 5FI1A 2COFA 2Z59B 2XQNM 4CYEA 4EKUA 2YS5A 2ZNVB 3E9OA 4IAPA 1Y8RC 4A3PA 4IC7B 2IBIB 2KFJA 5LONB 2I1KA 3VTWA 4RM9A 2LZ6A 2KTFA 2ZNVC 2L0TA 1WI1A 2J0KA 4HPLB 5D3WA 2C9WB 4JKHA 5LOPB 2PPHA 2LJ5A 2XK5B 2JZ3B 1GG3A 4HDQA 4ANWA 2DZJA 1OEYJ 2D11A 1YJ1A 1DBHA 2KN5A 2BWES 4A6HA 2L76A 2M38A 5E6PA 1U4AA 3QHTA 1V80A 3CSFA 2IYBA 2L05A 3CMMB 3ZRFA 2DLWA 2D2QA 4WJ7A 2ZPYA 2C60A 2X18A 2O6VB 2ZPNA 3PEGA 2W2XD 3DDCB 5G55A 1KC7A 3VH3B 1P3QU 2GOWA 4MJSB 2ZVNA 3TMPB 4TQ1A 2BKFA 3UINB 3EHVA 4GZUA 2ROZB 4WQOB 2YT1A 2EC1A 2DENB 4GIVA 2YSZA 2G35A 4DDID 3WAMA 4G11A 2P0FA 4LDTD 4NJ6A 1MPHA 4DHZB 3SO6A 5LXHA 4TV3A 1UEFA 2G4DB 4IWOA 1MG8A 1OQYA 4MGYE 3VHTC 1P0RA 5DPTA 1MK9B 2GBMA 4WWNA 5JVLA 2IO0B 2KJHB 3AI5A 2WYQA 1U27A 3N3KB 3VUYA 2M8SA 2KUPA 4K2OA 3UIOB 2G45B 5KHQA 3SU8X 5KQ1A 1AQCA 1ZC4B 4HB2B 5DHAB 2AL6A 3ZW3A 4FLHA 3KRXA 3DXCA 2RR9A 1RFAA 3HHMA 3QBVB 2CY5A 2IO3B 2OOBB 5TR5A 3DOWA 4WJNA 1E8WA 2UYZB 5DPSA 3CIKA 5D7GA 2XK5A 2PJHA 3ZNZB 2DYQA 1SE9A 4EZLA 2DHJA 2N9PC 1L2NA 2KFKB 3IG3A 5CHFA 1WY8A 1EF5A 2CHZA 4KDLB 5HE2A 3ZTCA 5JZEB 3A4RA 4HPMB 5C1ZA 1WM2A 4KSKC 4JK7A 1XODA 4HJKA 2GBKA 4IUMB 2VKIA 1BAKA 5JHHA 1ZW7A 3M63B 5AEKB 1HBKA 1IPGA 2K1FA 3P7ZA 2JXXA 4HATB 1LFDA 1C3TA 2JT4B 1MKEA 4XZ4A 1WVHA 4IW0A 4HAUB 3VVWB 3MHSD 4G50A 1WXVA 3RD2A 3R3MA 2BYVE 1W1HA 1XT9B 2AWTA 4JIOU 4JK8A 4RMAA 2YF0A 2KHWB 4WVFB 3ZNID 1XQQA 3LJUX 3B08A 3S2AA 4MDKE 2MDXA 5L95C 2NPTA 1Z87A 3VOQA 3SD5A 4GOCA 1YD8U 3H9DA 4JK9A 2K39A 3DCGA 1SIFA 1YX5B 4WAAA 4HWIB 2N7EA 3KH0A 2MP2B 1WG7A 1XCGA 2CODA 3ALBA 2I5FA 4N9F4 4HLEA 3A1QB 2MBEA 1X86A 1TBEA 3U7DA 3DBLI 2CS4A 5J3QA 4E71A 3ZUNA 4NSWA 2N23A 2FJ9A 1WGQA 2LULA 4W9EA 1X1GA 2R2QA 5FI0A 2NVUI 3BINA 4DHZE 2MA9B 3UF8A 3TFMA 1YIWA 3KRWA 2JRHA 2CY4A 4WWPA 4Z2MB 1UPQA 4IOYX 1WR1A 2MP2A 4A6FB 2D10A 1WIAA 4NJ7A 3ENBA 3EECA 4EFOA 2KQSA 2RQ1A 1J19A 4B6HA 2KO3A 4JLCA 1DROA 1U29A 4KIKB 2CAYA 2C5LC 5KQ4A 1EUVB 2Z0DB 3KUDB 1V89A 3QAQA 3TBLD 4NQLB 3OAWA 1ZC3B 4II3B 4JKAA 4BKGA 2LUEA 3ODWA 2JZZA 3VTVA 4YONA 1HB8A 2RPQA 3VUXA 2JVCA 2N9XA 2V1YA 3RCPA 3EFUA 4MJSA 2CHWA 4OVUA 1KZGA 4ILJA 3CF6E 2Y7BA 1V81A 3ODOA 2JP2A 4ASWC 4HB4B 2CR5A 2N0YA 3NHEB 1FOEA 1FGYA 1E8ZA 2WWZA 5DPWA 4TYZA 2M1MA 2LOXA 3PSCA 1P9DU 1FXTB 3ECIA 2EKEC 1WGDA 1B55A 2NBUA 3EPYA 2HTHB 5JLJB 3R7RA 4JKDA 4IWPA 5CLLB 1P3RA 4MT7A 3F0WA 3V6EB 2IY0B 4K7UA 2RGNB 4GMVA 4ANXA 1I42A 1U2BA 4ILHA 1WJ4A 2OTXA 3PS6A 3U30A 2VSZA 3JYUA 2NBWB 4HVBA 1Q5WB 2A4ZA 2N7DA 2A5UA 4F7ZA 3RUIB 4HK2A 4PQ0A 2D4QA 2N9EB 3KUZA 2YLMA 1WM3A 2FDQA 2MWNB 1IYFA 4NAWB 4EUTA 1OGWA 2JWZA 3DVNV 4GMXB 4X57B 4WSFA 3SDLC 4KHBB 3ZNGC 1A5RA 2L00B 2KC2A 3M1IB 3DVGX 3ULBA 1KOTA 4C0AA 4PS8A 3PV1A 3V61A 1DIKA 2COCA 3A4SC 4BFRA 1RAXA 1VBGA 5CX3A 2L3ZA 2MBHA 5J17A 3ZIMA 4XX5A 3HM3A 1KM7A 4KVGB 2MBOA 5D27A 4F8CB 3AXCA 1WX8A 2VRWB 4II2B 1SHCA 3V60A 3X0WA 2NCNA 5J18A 1WH3A 4GDLB 2KKCA 3NOBA 5IAAC 1GGOA 2UVMA 2DZIA 1X11A 2P0DA 3APDA 3QX1A 4FHJA 3KZ1A 3QCAA 3TO1A 3IFWB 4A6KA 2M17A 3PLUA 2LRWA 4AUQC 1UZXB 2L7RA 1L7YA 4KZ0A 4JKGB 2ZVOA 4JKEA 4E74A 1NBFC 4JKCA 2KCJA 2WX1A 2W2XC 3VQIA 4JKFA 2Z0OA 5E6OA 4KHOA 4A5KA 1Q0WB 2R2OA 3N7CA 3ML9A 1QQGA 3VAWA 3W1SC 1TXDA 3PHWB 2K8BA 2P0HA 4PNKA 5DI9B 4WJQA 3U8ZA 3A98B 4A3OA 1WF9A 4XC2A 1S1QB 4AWJA 2WX0A 4FHKA 3HK0A 4IFSA 2G4SA 2M14A 2BWFA 2J59M 2DA0A 4MM3A 3W1YA 2Z0QA 5IA7A 3H7PA 3B0AA 4BBNF 1EVHA 4URKA 3NZSA 3GOEA 3E9LA 3IHPC 3GYPA 2KLGA 1WX9A 4YL8A 1W1GA 4K81A 4FJZA 4KHAA 2KQ7A 1QZEA 1Q1OA 4HAXB 3GZNI 3L17A 1KJTA 3IBEA 4JKGA 3UGBB 3A8QA 1W1DA 4ANVA 2DZMA 2K6DB 3KYCD 2ASQA 1X05A 4GGQA 1V5PA 4W9DA 4ZRKA 1G6JA 3VUWA 5JHBA 2GCJA 2D9XA 1ZSQA 1TGZB 4DWFA 4LCDE 1TTNA 2FUHB 3M62B 4HAZB 2DHKA 4FA6A 5FR6A 2CU1A 1XKEA 1XR0B 4CHJA 2UZRA 4KV2A 2DYMA 3FEHA 2V76A 4K7WA 2ELAA 3I3TB 2LASA 3FSSA 1WGHA 2DIKA 2MBQA 3ZVVA 3DVGY 1P6SA 4BBKA 2ROVA 1LB1A 4HAVB 1RLFA 3PZDA 3PREA 2EMSA 2H7EA 4DX90 2KWCA 2COPA 3D8EA 4I6NB 1X1FA 2KD0A 2IO2B 2KMAA 2D9WA 5KHOA 4F7UP 2RUKB 3A8PA 4MY6A 2HE7A 4NAWA 4W9JA 2RSUA 2KWVB 3H7SA 1LXDA 1HB6A 2JY6A 3P6AA 1K8RB 2CB8A 2KVRA 1BTNA 2E2XA 4CHMA 2YS3A 2KK8A 5HKHA 4OVVA 4FADA 5L81A 3QIJA 3KY9A 1V5OA 1ZVRA 2IZVB 4G3XB 2FCSA 3M95A 1FHOA 4DBBA 1WJNA 5J3YA 1CMXB 2N1WA 4K1RB 3ZNHB 4G0NB 2ZCBA 1J0WA 3ENEA 1VBHA 4I6PA 4GPTB 1WX7A 4W9GA 5DCNA 3CSTA 4B6WA 1NVLA 3HM6X 3UQBA 1GJZA 3RCZA 3WA0A 2LYDA 1UNRA 3FLVA 2L2IA 4B9KA 2BGFA 4M0WB 3KSYA 3A33B 4M8MA 2KJRA 3JSVA 4GDKA 1TJ6A 1XD3B 2KGXB 5DIFB 4IM0A 4MSQB 2QHOA 5C16A 4EMOA 4PS7A 2DFKA 4L6EA 2K6QA 2I5CA 3QJZA 4EOYA 3N30A 2M0XA 1JRUA 3WYFB 3H7PB 2LGXA 3ZO5B 4RM8A 3OLMD 1M94A 1NTYA 2CRFA 4F1SA 4LJOB 1UPRA 2EMTA 3E9PA 4HAYB 2DX5A 2KDIA 4KIKA 4JKBA 2MX2A 3MDBC 2DX1A 5J3TA 2RNRB 2KDBA 4M8NA 2IYDB 5C5BA 1NDDA 3SHQA 2COAA 2RD0A 2XEWA 4F7GA 1UH6A 3QWZB 1WFYA 4GB9A 3G9WA 3Q3JA 1E7VA 1WGGA 2J0JA 2MW5A 3N32A 2HRJA 2KNBA 2LGYA 2DAFA 1KI1B 1RRPB 3HQCA 2EJ8A 3SV1A 3A9JB 2NZ8B 1F9JA 4MH0E 2KX3A 2MLBA 3ML4A 2AYOB 2DTCA 2MKRA 4EZKA 3A1QA 3VH4B 2NBVB 2Y8GA 1PFJA 1U5EA 2MCNB 4ZRJA 1UD7A 1M7RA 1E90A 4NY0A 3X23A 4K17A 2LOZA 3V5WA 4PYUA 1N3HA 4Y94A 5AZFA 1M7EA 3NY5A 1X1MA 3ZTDA 3PT2B 3NZUA 3ZRCA 5C79A 2X0SA 1P5TA 2D3GA 4MGZE 2NMBA 3VDZA 1DDMA 3NSUA 5HE0A 2ABDA 2CHXA 4BKSA 1OMWA 3WIMA 4JGHB 3ODXA 4HAWB 3DBSA 4WJOA 2NR2A 4AJYB 3RZFA 2IO1B 1ZKHA 3RT3B 1DDWA 4GN1A 2D07B 3R66C 3TVVA 3TJPA 2Q13A 2ZEQA 1FGZA 3PP2A 5C5BB 3PG7A 2MRPA 3JSVB 2J7QB 3DPDA 3O65B 1XX0A 4JQWC 4MK0A 2I1JA 3Q3FA 1WXMA 2REXA 2K2UA 4MELA 4F7HA 2KOXA 4DHJD 4HDOA 1WMHA 1WJMA 3ZLZA 2KTRA 2RSGA 1XD4A 2KC1A 1WXSA 3PSEB 4MEMA 1OTRB 2YT0A 3PVWA 1WE7A 1TZ1A 3H1UA 1LQBA 2XBBC 4HCPB 2PE6B 2L1CA 1I35A 1WGUA 4BVUC 3OJ4B 4KDIC 3PHXB 4W9HA 4BKTA 2RLOA 4LDTB 1FB8A 1QC6A 2YRYA 2HD5B 1EGXA 2GCLA 2NS5A 2DKQA 1E7UA 5IJMA 3PVUA 5D2MB 1WMHB 4Z2NA 2K8HA 1WYWB 3UZTA 5HE1A 1GC7A 1DDVA 1MAIA 4MSMB 1BWNA 1I7AA 2YVCA 2MWSB 2RVBB 2Y5BB 3L13A 2LVPA 1R4NI 2QKMA 2BCJA 1KZ7A 5C23A 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSS A;  2JF5 A;  2MSE D;  1WJU A;  4E71 A;  1WGH A;  3ZUN A;  1J8C A;  2KAN A;  3PTF C;  5CTR C;  2Z0P A;  2MBQ A;  1NI2 A;  1WE6 A;  2KLC A;  3ZVV A;  3DVG Y;  1P6S A;  4BBK A;  4NSW A;  2ROV A;  2N23 A;  3SNH A;  3QA8 A;  2FJ9 A;  1LB1 A;  3SUZ A;  4HAV B;  1AWE A;  1RLF A;  1WGQ A;  3PZD A;  2LUL A;  3PRE A;  4W9E A;  2FCN A;  1U5G A;  1X1G A;  2EMS A;  4PS3 A;  2R2Q A;  2H7E A;  4MJS B;  1VCB A;  3EC8 A;  2P8V A;  5FI0 A;  2OQB A;  4DX9 0;  5EFX A;  2NVU I;  3BIN A;  2JPH A;  3BY4 B;  4KSL C;  4DHZ E;  1U5F A;  2MA9 B;  2KWC A;  4CO7 A;  2COP A;  3UF8 A;  2B3A A;  1E8X A;  3D8E A;  3TFM A;  1V61 A;  1X1F A;  1YIW A;  3KRW A;  2JRH A;  2CY4 A;  4I6N B;  1WJ1 A;  2KD0 A;  4WWP A;  4Z2M B;  2IO2 B;  1UPQ A;  2D9W A;  4IOY X;  1WR1 A;  2KFK A;  2KMA A;  4X57 B;  5KHO A;  2MP2 A;  3PPA A;  4F7U P;  4A6F B;  2KMC A;  1MIZ B;  2RUK B;  3A8P A;  4HXD A;  3W1S A;  3PVL A;  4MY6 A;  2D10 A;  3JVZ X;  1U5D A;  1E8Y A;  2HE7 A;  4NAW A;  1WIA A;  2FNJ B;  3JW0 X;  3OAN A;  4HB3 B;  4W9J A;  2RSU A;  4DK5 A;  1MIX A;  3ML8 A;  4NJ7 A;  2LG1 A;  2KWV B;  4WJP A;  3EEC A;  2O6V A;  3UQA A;  3H7S A;  4EFO A;  1LXD A;  1HB6 A;  2KQS A;  2RQ1 A;  2JY6 A;  3P6A A;  1J19 A;  4AOF A;  3PGE A;  4W9I A;  2O2V A;  2R0D A;  2LD9 A;  2KX0 A;  4B6H A;  3DXD A;  4XWX A;  1YX6 B;  1K8R B;  4GDL A;  4D0N B;  1AAR A;  2CB8 A;  2KVR A;  2GJY A;  1BTN A;  2KO3 A;  3QAR A;  4NPN A;  1UGM A;  4JLC A;  5D94 A;  3T8M A;  3VFK A;  1DYN A;  1DRO A;  2E2X A;  3QC8 B;  1U29 A;  2IFS A;  2FID A;  4CHM A;  4KIK B;  2YS3 A;  4W9F A;  2BKR B;  2KK8 A;  1Z2M A;  5HKH A;  2FJL A;  1Y5O A;  5KHQ A;  3TIX A;  3D8D A;  3HW2 B;  3BJI A;  2BF8 B;  4OVV A;  2C7H A;  4FAD A;  1UBQ A;  5L81 A;  2O2V B;  2C7M B;  3PRM B;  3V6C B;  2CAY A;  3QIJ A;  2C5L C;  1UBI A;  5KQ4 A;  5JP4 A;  1VD2 A;  3KY9 A;  1V5O A;  1ZVR A;  2IZV B;  3H6N A;  3KW5 B;  2D9V A;  1EUV B;  1WGR A;  2KZR A;  2Z0D B;  3L0W B;  4WWO A;  2M4N A;  1PLS A;  3TW1 A;  5DHF B;  2CKH B;  3KUD B;  4G3X B;  5JH5 C;  3AJ4 A;  2BYF A;  2FCS A;  4GU2 A;  4AWJ A;  2O6V D;  3M95 A;  3VIA A;  1FHO A;  1V89 A;  3QAQ A;  3TBL D;  4NQL B;  3GYO A;  3DVN V;  1ZC3 B;  4DBB A;  3OAW A;  3MPX A;  4II3 B;  1WJN A;  4GDK B;  2DAJ A;  2KTR B;  1V88 A;  5J3Y A;  1CMX B;  2N1W A;  3OJ3 A;  3R7Q A;  5E6N A;  4BKG A;  1V9J A;  2LUE A;  3ODW A;  4K1R B;  3ZNH B;  1H8C A;  4G0N B;  2UWQ A;  2JZZ A;  1NTI A;  3LJ3 A;  4J6I A;  4ZYN A;  1EO6 A;  4HHV A;  3VTV A;  2W9N A;  4YON A;  5GMV A;  4DXA B;  1HB8 A;  4P7I A;  2RPQ A;  3LDZ E;  3VUX A;  1T0Y A;  2JVC A;  2D9Z A;  2ZCB A;  4W9L A;  5C23 A;  4BKS D;  2N9X A;  3M3J A;  2AL3 A;  2V1Y A;  1J0W A;  3RCP A;  3EFU A;  4MJS A;  3K9P B;  5EDS A;  1E5W A;  3A9K B;  4AJW A;  3VTU A;  3ENE A;  2JRI B;  4I6P A;  2CHW A;  3KYD D;  4A20 A;  1SGH A;  4OVU A;  2W2W A;  2COF A;  1KZG A;  5FI1 A;  2XQN M;  2Z59 B;  1ST7 A;  3C0R B;  4GPT B;  1WX7 A;  3CF6 E;  2Y7B A;  4CYE A;  2G3Q B;  4W9G A;  1V81 A;  3UIP B;  3ODO A;  1GNU A;  5DCN A;  2L0F A;  3CST A;  1UNQ A;  4EKU A;  3WAP A;  4B6W A;  1NVL A;  3HM6 X;  2JP2 A;  4ASW C;  2YS5 A;  2HJ8 A;  4HB4 B;  2ZNV B;  3UQB A;  1GJZ A;  4IAP A;  1Y8R C;  4H8S A;  4A3P A;  4IC7 B;  2CR5 A;  2IBI B;  2N0Y A;  2KFJ A;  3NHE B;  5LON B;  3RCZ A;  4KZC A;  2I1K A;  1FOE A;  3VTW A;  1FGY A;  4ANU A;  4RM9 A;  3WA0 A;  2LYD A;  1UNR A;  1R4M I;  2MBB B;  1E8Z A;  2WWZ A;  4LJP B;  2LZ6 A;  1BT0 A;  3FLV A;  5DPW A;  2L2I A;  4TYZ A;  2KTF A;  4B9K A;  2DHZ A;  2ZNV C;  2BGF A;  1C1Y B;  4M0W B;  2M1M A;  4JL9 A;  3KSY A;  1GC6 A;  3A33 B;  1UNP A;  2N4F A;  4M8M A;  2LOX A;  1WI1 A;  2L0T A;  2KJR A;  3PSC A;  1P9D U;  2J0K A;  1FXT B;  4B95 A;  3ECI A;  4FBJ B;  3DBR I;  2EKE C;  2LVO A;  1WGD A;  1B55 A;  3JSV A;  4HPL B;  4GDK A;  1TJ6 A;  2NBU A;  3EPY A;  4DX8 A;  2DN6 A;  2HTH B;  5D3W A;  5JLJ B;  2C9W B;  2MX2 A;  1ISN A;  5LOP B;  2GBJ A;  2PPH A;  2NPT B;  4NQK E;  3R7R A;  2K00 A;  4IWP A;  4W9K A;  2LJ5 A;  5CLL B;  2XK5 B;  1WR6 E;  3DQV A;  1P3R A;  4MT7 A;  2KGX B;  3F0W A;  1XD3 B;  1Z5S B;  2JZ3 B;  2ELB A;  3V6E B;  4DDG D;  2IY0 B;  1PQS A;  5DIF B;  4IM0 A;  4K7U A;  3ZKJ C;  1GG3 A;  3IVF A;  3DXE A;  4MSQ B;  3T9L A;  2RGN B;  4GMV A;  5C16 A;  2K25 A;  2QHO A;  4HDQ A;  4ANW A;  4EMO A;  4ANX A;  1I42 A;  1U2B A;  2DYN A;  2DZJ A;  1WJ4 A;  1OEY J;  2D11 A;  2DFK A;  2OTX A;  4L6E A;  1DBH A;  1YJ1 A;  2K6Q A;  4PS7 A;  2I5C A;  2KN5 A;  3PS6 A;  3QJZ A;  2BWE S;  4A6H A;  3U30 A;  2L76 A;  4EOY A;  1K5D B;  2M38 A;  3N30 A;  2VSZ A;  1V5M A;  5E6P A;  2M0X A;  1U4A A;  4EJN A;  2V3S A;  3QHT A;  1JRU A;  4FUL A;  3JYU A;  1V80 A;  2NBW B;  3WYF B;  1C3T A;  3WAL A;  3CSF A;  2IYB A;  2LGX A;  3H7P B;  2L05 A;  1Q5W B;  3L10 B;  2A4Z A;  3CMM B;  3ZRF A;  4HVB A;  3ZO5 B;  2N7D A;  4RM8 A;  3OLM D;  2DLW A;  2A5U A;  1M94 A;  3PRZ A;  4F7Z A;  1NTY A;  3RUI B;  2J0M A;  4BOS C;  2D2Q A;  2CRF A;  4HK2 A;  4WJ7 A;  2ZPY A;  2C60 A;  4W9C A;  2X18 A;  4LJO B;  1UPR A;  4PQ0 A;  2D4Q A;  2N9E B;  2O6V B;  2EMT A;  3KUZ A;  4ZDV A;  4HAY B;  2DX5 A;  2YLM A;  1WM3 A;  3PEG A;  4K2P A;  2KDI A;  2ZPN A;  2FDQ A;  2LKO A;  2W2X D;  4ICU A;  2MWN B;  4KIK A;  1FHW A;  1IYF A;  4NAW B;  3DDC B;  5G55 A;  3AUL A;  2WH5 A;  1OGW A;  4EUT A;  3VH3 B;  2JWZ A;  1D3Z A;  3MDB C;  2YS1 A;  2DX1 A;  4GMX B;  2RNR B;  5J3T A;  1P3Q U;  1WGY A;  2GOW A;  2IYD B;  5C5B A;  2KDB A;  4WSF A;  4M8N A;  1NDD A;  4MGI E;  2ZVN A;  1WXA A;  4MGK E;  3SHQ A;  2COA A;  3TMP B;  3SDL C;  2FCQ A;  4KHB B;  4TQ1 A;  2RD0 A;  2XEW A;  2BKF A;  2LAS A;  4IG7 B;  3ZNG C;  4F7G A;  1UH6 A;  2LXC A;  2L00 B;  2KC2 A;  3QWZ B;  1WFY A;  3M1I B;  1A5R A;  3DVG X;  2LWP A;  3UIN B;  1H10 A;  1PMS A;  3EHV A;  4GB9 A;  3G9W A;  3Q3J A;  1E7V A;  1WGG A;  3ULB A;  2J0J A;  4GZU A;  1KOT A;  2MW5 A;  4C0A A;  3MJW A;  4EZJ A;  3N32 A;  4PS8 A;  2HRJ A;  2KNB A;  2H7D A;  3DVN U;  2ROZ B;  3PV1 A;  2LGY A;  3V61 A;  4WQO B;  2COC A;  3A4S C;  4BFR A;  2DAF A;  1KI1 B;  1GUA B;  1RAX A;  2YT1 A;  2DYB A;  1RRP B;  3HQC A;  3NS8 A;  1ZGU B;  2EC1 A;  2EJ8 A;  2DEN B;  2L3Z A;  2V4L A;  2KXJ A;  2MBH A;  5CX3 A;  3SV1 A;  3A9J B;  5J17 A;  3QQ8 B;  2NZ8 B;  4XX5 A;  3ZIM A;  1F9J A;  3PRP B;  1FHX A;  4GIV A;  4MH0 E;  3KUC B;  2ZCC A;  1KM7 A;  4KVG B;  2YSZ A;  3HM3 A;  2KX3 A;  3B1L X;  2G35 A;  1BTK A;  1P1A A;  2ADZ A;  3QWM A;  2MLB A;  4DDI D;  3WAM A;  4G11 A;  4IM2 A;  5G2N A;  3ML4 A;  2AYO B;  2P0F A;  2MBO A;  5D27 A;  4LDT D;  2DTC A;  2MKR A;  2C7N B;  1V6E A;  4F8C B;  4EZK A;  3AXC A;  4NJ6 A;  3A1Q A;  1MPH A;  1WX8 A;  2GMI C;  2IY1 B;  2PEA A;  3VH4 B;  2NBV B;  2Y8G A;  4DHZ B;  5GOW B;  2VRW B;  3SO6 A;  1PFJ A;  1RJ2 A;  1U5E A;  5LXH A;  4II2 B;  1SHC A;  3V60 A;  1J0G A;  4TV3 A;  2DKP A;  2MCN B;  1WI0 A;  4ZRJ A;  3X0W A;  1UEF A;  1UD7 A;  2G4D B;  4IWO A;  1MG8 A;  2NCN A;  1M7R A;  1E90 A;  4NY0 A;  3VXW A;  4BBN C;  5J18 A;  1OQY A;  3AU5 A;  3X23 A;  4MGY E;  3VHT C;  1WH3 A;  4K17 A;  1P0R A;  2LI5 A;  4GDL B;  4IWQ A;  4E3C A;  5DPT A;  1MK9 B;  2LOZ A;  3D8F A;  3V5W A;  2KKC A;  4PYU A;  2GBM A;  4WWN A;  4DBG A;  1N3H A;  2IO0 B;  4Y94 A;  2KJH B;  3MTN B;  4EEW A;  3AI5 A;  2WYQ A;  3NOB A;  1U27 A;  2GBR A;  5AZF A;  1M7E A;  5IAA C;  2PZ1 A;  3NY5 A;  1X1M A;  3ZTD A;  3RYT A;  1YQB A;  3N3K B;  4FN2 A;  3PT2 B;  3VUY A;  1ZM0 A;  2KUP A;  4K2O A;  2DHI A;  2UVM A;  2DZI A;  1X11 A;  2M8S A;  2RGF A;  3APF A;  3NZU A;  1OY2 A;  2P0D A;  3ZRC A;  3APD A;  5C79 A;  3QX1 A;  4FHJ A;  3UIO B;  1P5T A;  4TKN A;  3KZ1 A;  2D3G A;  3QCA A;  5HE3 A;  3TO1 A;  2G45 B;  2ZJD A;  3IFW B;  4MGZ E;  2Y8F A;  2NMB A;  4A6K A;  2M17 A;  5KQ1 A;  2LRW A;  3PLU A;  1UZX B;  3SU8 X;  4AUQ C;  5CLQ B;  2L7R A;  3RUL A;  1L7Y A;  3VDZ A;  2UZS A;  1IRS A;  3KVF B;  3D32 A;  1AQC A;  1ZC4 B;  4HB2 B;  4KZ0 A;  1DDM A;  1KLV A;  3NSU A;  5HE0 A;  2ZVO A;  1LW3 A;  2ABD A;  5DHA B;  3V62 A;  2AL6 A;  4E74 A;  2KDF B;  3SYX A;  3ZW3 A;  2BPS A;  1NBF C;  5AZG A;  2K8C A;  2KCJ A;  2WX1 A;  2W2X C;  2CHX A;  4FLH A;  3KRX A;  4FJV B;  2Z0O A;  3VQI A;  5E6O A;  4BKS A;  1OMW A;  1V2Y A;  3DXC A;  1TQZ A;  4KHO A;  4A5K A;  3WIM A;  4KAX B;  2RR9 A;  3O96 A;  4JGH B;  3ODX A;  4HAW B;  5D3X A;  1Q0W B;  3N7C A;  1RFA A;  1UEL A;  2R2O A;  3DBS A;  3QBV B;  3HHM A;  2OJR A;  4WJO A;  1V86 A;  2CY5 A;  2NR2 A;  3ML9 A;  1QQG A;  5AZH A;  5BO4 B;  2IO3 B;  3R66 C;  4AJY B;  3RZF A;  2OOB B;  2ZZP B;  3DOW A;  5TR5 A;  4WJN A;  3VAW A;  2FCM A;  3TCA A;  1E8W A;  2IO1 B;  3T06 A;  2UYZ B;  3W1S C;  4F1S A;  5DPS A;  1NTV A;  1WJ6 A;  1ZKH A;  3RT3 B;  3CIK A;  5D7G A;  3ULC A;  1RRB A;  1TXD A;  1DDW A;  2XK5 A;  3PHW B;  4GN1 A;  2PJH A;  2K8B A;  4IM3 A;  3ZNZ B;  1OQN A;  2P0H A;  2D07 B;  4PNK A;  2QKL A;  2DYQ A;  5DI9 B;  1SE9 A;  2DHJ A;  1WZ3 A;  2N9P C;  4WJQ A;  4EZL A;  2MQJ A;  1L2N A;  2HTH A;  3U8Z A;  3A98 B;  4A3O A;  5JHG A;  1WF9 A;  1S3S G;  3TVV A;  1S1Q B;  2KFK B;  3IG3 A;  2Q13 A;  2ZEQ A;  2CQU A;  1FGZ A;  3PP2 A;  3PG7 A;  5C5B B;  2LVQ A;  3ZVR A;  2MRP A;  2WX0 A;  3A9J A;  2J7Q B;  3JSV B;  4FHK A;  1WY8 A;  3HK0 A;  1EF5 A;  4IFS A;  2G4S A;  3DPD A;  2CHZ A;  2M14 A;  2DX5 B;  2KDE B;  1I2H A;  3O65 B;  1OEY A;  4BOZ B;  3HIZ A;  2BWF A;  4KDL B;  5HE2 A;  3P2B A;  2K2J A;  3ZTC A;  2J59 M;  4DHJ B;  2DA0 A;  1XX0 A;  4MM3 A;  3A4R A;  3W1Y A;  4HPM B;  5JZE B;  1WZ0 A;  2Z0Q A;  4NNJ B;  4AP4 C;  5C1Z A;  1WM2 A;  4KSK C;  1XOD A;  5DPR A;  2KWU B;  2PE9 A;  4HJK A;  2GBK A;  4JQW C;  4IUM B;  3H7P A;  5IA7 A;  5CHF A;  2VKI A;  1FAO A;  2KJ6 A;  4MK0 A;  5CHW A;  3ONS A;  1BAK A;  5JHH A;  3B0A A;  4BBN F;  5JHA A;  1EVH A;  1ZW7 A;  3NZS A;  4URK A;  3GOE A;  2BYE A;  3M63 B;  5AEK B;  2I1J A;  3Q3F A;  2WDT B;  1Y19 B;  1HBK A;  1WXM A;  1IPG A;  1P98 A;  2REX A;  3DBH I;  2K2U A;  2K1F A;  3P7Z A;  2JXX A;  4MEL A;  4F7H A;  4HAT B;  1LFD A;  2KOX A;  1EAZ A;  4GXB A;  1HE8 A;  1MKE A;  2JT4 B;  3L54 A;  4DHJ D;  2N1V A;  3IHP C;  4HDO A;  1WMH A;  3GYP A;  1WJM A;  2Z0E B;  3L08 A;  3TJP A;  2KLG A;  4XZ4 A;  1WX9 A;  4YL8 A;  3ZLZ A;  2KTR A;  1W1G A;  3FP5 A;  4K81 A;  1WVH A;  2RSG A;  4IW0 A;  4HAU B;  5DH9 B;  4FJZ A;  3TL5 A;  1XD4 A;  3VVW B;  2KC1 A;  2D9Y A;  2MFQ A;  2LXA A;  4KHA A;  2KQ7 A;  4ZRI A;  1WXV A;  3MHS D;  3R3M A;  1WXS A;  2BYV E;  3PSE B;  4G50 A;  1QZE A;  4MEM A;  1OTR B;  2YT0 A;  4XC2 A;  1W1H A;  1XT9 B;  3PVW A;  1WE7 A;  1Q1O A;  5KCV A;  3QK0 A;  1TZ1 A;  4HAX B;  3GZN I;  3H1U A;  3L17 A;  4HCN B;  1KJT A;  1LQB A;  2AWT A;  4JIO U;  4K7S A;  3IBE A;  2XBB C;  3UGB B;  2DYO A;  3F5R A;  3A8Q A;  1W1D A;  4HCP B;  3K9O B;  4FJY A;  4RMA A;  2PE6 B;  2L1C A;  2YF0 A;  4ANV A;  5D3Y A;  1H4R A;  1I35 A;  2KHW B;  2L8J A;  1WGU A;  4WVF B;  1Q67 A;  3OJ4 B;  3PHX B;  3ZDT A;  4KDI C;  4W9H A;  4BVU C;  3ZNI D;  4BKT A;  5CHV C;  2DZM A;  5L83 A;  2K6D B;  2RLO A;  1XQQ A;  2DZK A;  1NU2 A;  3LJU X;  4LDT B;  3B08 A;  1FB8 A;  3KYC D;  3L16 A;  4CHK A;  2ASQ A;  1X05 A;  4GGQ A;  1QC6 A;  1V5P A;  4W9D A;  4ZRK A;  3S2A A;  1G6J A;  4TUU A;  3VUW A;  1IP9 A;  5JHB A;  4MDK E;  2MDX A;  2FAZ A;  5L95 C;  2GCJ A;  2D9X A;  2NPT A;  5D3V A;  2GS0 A;  2LRU A;  1ZSQ A;  4ICV A;  1Z87 A;  1TGZ B;  4HB0 B;  2YRY A;  2HD5 B;  3VOQ A;  3WAN A;  3SD5 A;  4DWF A;  1EGX A;  2GCL A;  2NS5 A;  4GOC A;  1YD8 U;  4LCD E;  3RD2 A;  1TTN A;  2DKQ A;  2FUH B;  1E7U A;  2K39 A;  3H9D A;  2LBB A;  5IJM A;  3PVU A;  5D2M B;  2VRR B;  1WMH B;  4Z2N A;  3DCG A;  5LLI A;  2K8H A;  3APC A;  1WYW B;  3M62 B;  1SIF A;  4HAZ B;  1V5T A;  1YX5 B;  3A9K A;  3PLV A;  2FIF A;  2DHK A;  3UZT A;  4HWI B;  4WAA A;  5HE1 A;  2LGD A;  2N7E A;  3KH0 A;  3RZW C;  5FR6 A;  4FA6 A;  1MK7 B;  2MP2 B;  1K5G B;  1GC7 A;  1WG7 A;  4GSW A;  1XCG A;  2AEH A;  1DDV A;  1MAI A;  1XKE A;  2CU1 A;  4MSM B;  1BWN A;  1I7A A;  2COD A;  2YVC A;  1WRD B;  1XR0 B;  2GBN A;  2JUO A;  2R09 A;  4CHJ A;  3ALB A;  2UZR A;  4TQ0 A;  5LXI B;  2I5F A;  2MWS B;  2RVB B;  1V49 A;  4N9F 4;  4PYZ A;  4HLE A;  3A1Q B;  2MBE A;  4KV2 A;  3AU4 A;  2DYM A;  1V5U A;  3FEH A;  2Y5B B;  1X86 A;  1TBE A;  3U7D A;  3WAO A;  2V76 A;  3L13 A;  2LVP A;  1R4N I;  3DBL I;  3CXB B;  4K7W A;  2CS4 A;  2ELA A;  4I6L B;  1ACA A;  5C6R A;  2QKM A;  1LM8 B;  2BCJ A;  1KZ7 A;  5D6J B;  3ZDM C;  3I3T B;  4A6F A;  5J2R A;  5J3Q A;  1EF1 A;  3FM8 C; 
#chains in the Genus database with same CATH topology
 2MSE D;  1WJU A;  1J8C A;  2KAN A;  5CTR C;  2Z0P A;  3DWM A;  2KLC A;  4PK1 A;  1FMA D;  1VR9 A;  1AWE A;  2FCN A;  3TEX A;  2JXT A;  1U5G A;  4PS3 A;  1ZDV A;  5EFX A;  2IGD A;  3N9Y C;  4KSL C;  1N60 A;  1U5F A;  4CO7 A;  3LB8 C;  2WXP A;  3HUI A;  1BML C;  2H88 B;  4CQN A;  2KFK A;  2PKO A;  2INC C;  1F2R C;  4HXD A;  3JVZ X;  3JW0 X;  3ABV B;  4C7Z A;  3ML8 A;  2QIE B;  3UQA A;  4WJP A;  2O6V A;  4AS1 A;  1SB3 C;  3PGE A;  1I4P A;  4W9I A;  2O2V A;  2R0D A;  2BYT A;  2L1A A;  2KX0 A;  2WDR B;  3DXD A;  1YX6 B;  4GDL A;  2GJY A;  3T8M A;  5D94 A;  3VFK A;  2NBV A;  3I57 A;  1DYN A;  3QC8 B;  2IFS A;  2BKR B;  1Z2M A;  2FJL A;  2J53 A;  2C7H A;  3AE2 B;  1UBQ A;  2O2V B;  1UBI A;  5IOI A;  3ZGZ A;  1VD2 A;  3ZJV A;  3PPA A;  3H6N A;  1QIL A;  2D9V A;  2KZR A;  3L0W B;  2M4N A;  2CKH B;  5JH5 C;  5DHF B;  2AQ1 B;  2L32 A;  4P6V F;  4L1R A;  3TEZ A;  2O6V D;  3VIA A;  3GYO A;  3MPX A;  4GDK B;  2DAJ A;  2KTR B;  3OJ3 A;  4WUR A;  5E6N A;  1V9J A;  2H89 B;  2UWQ A;  1NTI A;  3TEW A;  4ZYN A;  4HHV A;  2JU6 X;  5GMV A;  4DXA B;  4P7I A;  1ZXH A;  1BXT A;  4W9L A;  4BKS D;  3M3J A;  3EFC A;  3K9P B;  1E5W A;  1NEN B;  5TSS A;  4AJW A;  3RNG C;  3VTU A;  2JRI B;  3KYD D;  4A20 A;  2W2W A;  1ST7 A;  3C0R B;  3SEB A;  4US8 A;  2G3Q B;  1GNU A;  2L0F A;  1KLG D;  2BT6 A;  1UNQ A;  3WAP A;  1HTQ A;  2HJ8 A;  2WXF A;  4H8S A;  1I7H A;  2AQ3 B;  4KZC A;  4ANU A;  2RRF A;  1ZE3 D;  1R4M I;  2MBB B;  4LJP B;  1UNS A;  1BT0 A;  1FIQ A;  3AE9 B;  1P7E A;  2DHZ A;  1C1Y B;  4JL9 A;  3GP7 A;  1GC6 A;  1UNP A;  2KIG A;  2N4F A;  4UDU C;  4B95 A;  4FBJ B;  3DBR I;  2LVO A;  3I5J C;  4RF1 A;  3A58 A;  4DX8 A;  2DN6 A;  1ISN A;  4NQK E;  2GBJ A;  4P1B C;  2NPT B;  2K00 A;  4W9K A;  1WR6 E;  3DQV A;  1Z5S B;  4DDG D;  5M4Y B;  2WP9 B;  2ELB A;  1PQS A;  3ZKJ C;  3IVF A;  3DXE A;  3T9L A;  1QQR A;  4OZC A;  2K25 A;  2Y5P A;  2DYN A;  2K9X A;  2I38 A;  3I9V 1;  2OHF A;  4HPP A;  1I4Q A;  1K5D B;  3FVC A;  3Q6B A;  1V5M A;  4EJN A;  2V3S A;  1LO5 D;  1XLP A;  1JML A;  4FUL A;  1NYQ A;  4OSN A;  3WAL A;  2JX5 A;  3L10 B;  1FRD A;  2I2Y A;  4R3D A;  3PRZ A;  2J0M A;  2MJD A;  4BOS C;  4W9C A;  4XWT A;  3BYY B;  1B1Z A;  4ZDV A;  3EC8 A;  4K2P A;  2MHJ A;  4ICU A;  2LKO A;  1FHW A;  1R7S A;  3AUL A;  2WH5 A;  1N5W A;  1D3Z A;  1D5Z C;  2YS1 A;  3U4E G;  1FPY A;  1WGY A;  3UIP B;  4MGI E;  4MGK E;  1WXA A;  3GE8 C;  5BYQ A;  2FCQ A;  3SBG A;  4IG7 B;  2LXC A;  3SBT A;  2LWP A;  1H10 A;  1PMS A;  1YN4 A;  2EEL A;  2Z8L A;  3MJW A;  4EZJ A;  3Q14 C;  2H7D A;  3DVN U;  5I2M A;  4KKI A;  3KWL A;  3MP9 A;  1C76 A;  1GUA B;  1TS4 A;  2N9K A;  2DYB A;  3PZ7 A;  3NS8 A;  1ZGU B;  2J42 A;  2V4L A;  2KXJ A;  3QQ8 B;  1T5X D;  3PRP B;  1FHX A;  1DOY A;  3KUC B;  4ZYS A;  2ZCC A;  2MEK A;  2R82 A;  3B1L X;  4J3O D;  1BTK A;  1P1A A;  2ADZ A;  3QWM A;  1ESF A;  5G2N A;  4IM2 A;  3RI7 C;  2C7N B;  1V6E A;  3AM9 A;  2IY1 B;  2GMI C;  2PEA A;  5GOW B;  2Z59 A;  1RJ2 A;  1IUE A;  1J0G A;  2D5G A;  3DHH C;  3Q8E A;  2DKP A;  1WI0 A;  3W5V B;  2NMQ A;  3VXW A;  4BBN C;  3AU5 A;  3Q3N C;  2BTE A;  4IOI E;  2LI5 A;  4IWQ A;  4E3C A;  3D8F A;  3NVZ A;  1ROE A;  3MTN B;  4EEW A;  2QDF A;  3O13 A;  2GBR A;  2PZ1 A;  1OQR A;  3RYT A;  1FCL A;  1YQB A;  4FN2 A;  1ZM0 A;  2RGF A;  2DHI A;  4YSX B;  3APF A;  1OY2 A;  3ETR A;  1HEZ E;  1UF0 A;  4TKN A;  4OZA A;  3WCQ A;  5HE3 A;  2K3U A;  2ZJD A;  2IND C;  1C9F A;  2Y8F A;  5CLQ B;  3RUL A;  2KUQ A;  2UZS A;  1L4D B;  1IRS A;  3KVF B;  3D32 A;  1KLV A;  2XN9 C;  1LW3 A;  2M0A A;  3V62 A;  2KDF B;  3SYX A;  2BPS A;  5AZG A;  2K8C A;  3AEE B;  4FJV B;  2GUM A;  2JYE A;  1CK1 A;  1TQZ A;  3U12 A;  1V2Y A;  4KAX B;  1HTO A;  1VRA B;  3O96 A;  3CIR B;  5D3X A;  4TMA B;  1UEL A;  5BYS A;  2WHI A;  2OJR A;  1V86 A;  3GE3 C;  4ILG B;  5AZH A;  5BO4 B;  1N62 A;  1L5P A;  2ZZP B;  2FCM A;  3TCA A;  1YJI A;  3T06 A;  1STE A;  1NTV A;  1WJ6 A;  2KAC A;  2QC8 A;  3ULC A;  1RRB A;  3R8B A;  4IM3 A;  1OQN A;  1XCT L;  3T3O A;  2QKL A;  1T0S C;  2QSD A;  1WZ3 A;  2MQJ A;  3AEB B;  2HTH A;  5JHG A;  1S3S G;  3RN9 C;  2CQU A;  2LVQ A;  3ZVR A;  3A9J A;  3BWU D;  3AE5 B;  2LJI A;  2DX5 B;  2BB6 A;  2KDE B;  1I2H A;  1OEY A;  4BOZ B;  3HIZ A;  2WNM A;  3OG5 A;  3P2B A;  2K2J A;  4DHJ B;  4N59 A;  3MC0 B;  2WQY B;  1WZ0 A;  4NNJ B;  4AP4 C;  5DPR A;  2KWU B;  2PE9 A;  1WGK A;  5CHW A;  1FAO A;  2KJ6 A;  3ONS A;  4OT1 A;  5JHA A;  2KWD A;  4NAM A;  1FRR A;  2BYE A;  4OVZ A;  2WDT B;  1Y19 B;  1P98 A;  3DBH I;  2KIE A;  3L4P A;  3L54 A;  1EAZ A;  4GXB A;  1HE8 A;  2N1V A;  3L08 A;  2GI9 A;  2Z0E B;  3FP5 A;  3ZXV A;  5DH9 B;  3TL5 A;  2D9Y A;  2MFQ A;  2LXA A;  4ZRI A;  1DGJ A;  5KCV A;  3I63 C;  3QK0 A;  4HCN B;  2X8X X;  5G5G A;  4K7S A;  2DYO A;  3F5R A;  2WXG A;  3K9O B;  4FJY A;  5D3Y A;  1H4R A;  2L8J A;  1Q67 A;  5I4D A;  3ZDT A;  5CHV C;  1J7A A;  5L83 A;  1NU2 A;  2MJ3 A;  1K51 A;  3L16 A;  4CHK A;  1T0Q C;  4XGA B;  1YN3 A;  2LGI A;  4TUU A;  1IP9 A;  3KQ4 A;  2FAZ A;  2WXI A;  3RNC C;  5D3V A;  2GS0 A;  2LRU A;  4ICV A;  2ZW1 A;  4HB0 B;  3WAN A;  4KX6 B;  1SIJ A;  4K3C A;  2LBB A;  2UU7 A;  3BVM A;  5LLI A;  2VRR B;  1JRO A;  2Q5W D;  3APC A;  1V5T A;  3A9K A;  3PLV A;  2CJO A;  2FIF A;  4W9F A;  3T3N A;  2LGD A;  3RZW C;  2GLS A;  1MK7 B;  3MC8 A;  1K5G B;  2WXO A;  4GSW A;  2AEH A;  4DBG A;  1WRD B;  2GBN A;  4TQ0 A;  2JUO A;  2R09 A;  5LXI B;  1V49 A;  4C4V B;  4PYZ A;  4C56 C;  3VR9 B;  3ZJU A;  3AU4 A;  1V5U A;  2VZK B;  3WAO A;  3CXB B;  4I6L B;  1ACA A;  5C6R A;  2K22 A;  1LM8 B;  3AEF B;  5D6J B;  3ZDM C;  4A6F A;  5J2R A;  1ZYI A;  2DZK A;  1EF1 A;  3PRM B;  1AYF A;  2JF5 A;  3PTF C;  1NI2 A;  1WE6 A;  5C2T B;  4B0M A;  1OFF A;  3NRZ A;  3KWV A;  3SNH A;  3QA8 A;  3SUZ A;  3DHI C;  5FK9 C;  1R4M B;  1VCB A;  2P8V A;  2OQB A;  2JPH A;  3BY4 B;  3DBL B;  3OWE B;  4D6W A;  2FE8 A;  2B3A A;  1E8X A;  1H8C A;  1V61 A;  1WJ1 A;  1KFY B;  2KMC A;  1MIZ B;  4OHJ A;  3W1S A;  3PVL A;  1L4Z B;  4HRS A;  2BS2 B;  1U5D A;  1E8Y A;  2FNJ B;  3OAN A;  4HB3 B;  3R2I A;  4DK5 A;  1MIX A;  1IBX B;  2LG1 A;  3E66 A;  2ONQ A;  4AOF A;  2LD9 A;  4XWX A;  4D0N B;  1AAR A;  1L6V A;  3QAR A;  4NPN A;  1SJE D;  1UGM A;  2D3A A;  3N20 C;  2FID A;  4GNK B;  1Y5O A;  1JAL A;  3TIX A;  1KBL A;  3D8D A;  3HW2 B;  3BJI A;  2BF8 B;  3RPF C;  2C7M B;  1WWT A;  3V6C B;  5JP4 A;  3KW5 B;  1JDE A;  1LGR A;  1WGR A;  1FCC C;  4WWO A;  1PLS A;  3TW1 A;  1NYR A;  3AJ4 A;  2BYF A;  4GU2 A;  3NVV A;  4MT5 A;  1MJD A;  4KHB A;  1I4G A;  3FAH A;  1V88 A;  2K49 A;  1VDV A;  3R7Q A;  4YXD B;  1FFV A;  5GXG B;  2W3S A;  3LJ3 A;  4J6I A;  1EO6 A;  2W9N A;  3RMK C;  4RGN A;  3LDZ E;  1T0Y A;  4MH8 A;  2D9Z A;  2AL3 A;  5EDS A;  3FIL B;  3A9K B;  1SGH A;  1JWA D;  5FI1 A;  2COF A;  2Z59 B;  2XQN M;  2QMT A;  1TKY A;  4CYE A;  5FKA C;  4EKU A;  1FNV A;  5EE1 A;  2YS5 A;  2ZNV B;  5AUK A;  1KTK A;  3E9O A;  4IAP A;  1Y8R C;  4A3P A;  4IC7 B;  1PUT A;  1QOA A;  2IBI B;  2KFJ A;  5LON B;  2I1K A;  3VTW A;  4RM9 A;  2AX5 A;  1D5M C;  2LZ6 A;  2KTF A;  2KMM A;  2ZNV C;  3E9S A;  1RWS A;  2RDG A;  2L0T A;  1WI1 A;  2J0K A;  2J4X A;  4HPL B;  2LGS A;  4PT5 A;  5D3W A;  2C9W B;  1V97 A;  4JKH A;  5LOP B;  2PPH A;  4LNI A;  2LJ5 A;  2WXQ A;  2XK5 B;  3Q8B A;  2WGS A;  2JZ3 B;  1GG3 A;  2RMM A;  4HDQ A;  2Y5C A;  4ANW A;  1YMH E;  1T6B X;  2DZJ A;  1OEY J;  2D11 A;  1YJ1 A;  1DBH A;  2KN5 A;  2BWE S;  4A6H A;  2L76 A;  2M38 A;  3BK2 A;  4WAF A;  5E6P A;  1U4A A;  5G5H A;  2V9H A;  1C79 A;  3QHT A;  1V80 A;  5BYR A;  1YN5 A;  3CSF A;  2IYB A;  2L05 A;  3CMM B;  3ZRF A;  1N5X A;  2EKI A;  2DLW A;  1ET6 A;  2D2Q A;  4WJ7 A;  2ZPY A;  2C60 A;  2X18 A;  1T0R C;  2O6V B;  4RCO A;  4REZ A;  2ZPN A;  2PW9 A;  3VRB B;  3PEG A;  4YTM B;  2W2X D;  3Q8A A;  4Q2J A;  3HRD D;  3DDC B;  5G55 A;  1KC7 A;  3VH3 B;  4KGT A;  1P3Q U;  2GOW A;  4MJS B;  2ZVN A;  3TMP B;  3HVD A;  4TQ1 A;  2BKF A;  1JRP A;  1SF0 A;  1TKE A;  3UIN B;  3EHV A;  4GZU A;  3W2D A;  2ROZ B;  2Y3A A;  5C3J B;  1I4X A;  3P4Q B;  4WQO B;  4MM3 B;  1ZPS A;  3Q8C A;  3UI3 A;  1TIF A;  2YT1 A;  4ZHO A;  2EC1 A;  2DEN B;  4GIV A;  2YSZ A;  2G35 A;  4DDI D;  2G9H D;  3MC9 A;  3WAM A;  4G11 A;  2P0F A;  4B0E A;  4LDT D;  3RNA C;  1PDX A;  4RGT A;  4NJ6 A;  2DNF A;  1MPH A;  4DHZ B;  3SO6 A;  5LXH A;  4TV3 A;  2LHE A;  2SAK A;  4A6Q A;  1UEF A;  2G4D B;  1VZ7 A;  4IWO A;  1MG8 A;  1OQY A;  4MGY E;  3VHT C;  1P0R A;  4WQM A;  5DPT A;  1MK9 B;  3DBR B;  2E3T A;  2GBM A;  4WWN A;  5JVL A;  1IGD A;  2IO0 B;  2KJH B;  3AI5 A;  2WYQ A;  1U27 A;  3TEY A;  2IJ0 A;  2K0P A;  1QLB B;  3N3K B;  4DXG A;  3VUY A;  3ZYY X;  2M8S A;  2KUP A;  4K2O A;  4L23 A;  4RH6 A;  3UIO B;  2G45 B;  5KHQ A;  3SU8 X;  5KQ1 A;  2HDE A;  1XEE A;  1AQC A;  1ZC4 B;  4HB2 B;  4IKG A;  1GPX A;  2IPK D;  2W55 A;  5DHA B;  2AL6 A;  3ZW3 A;  4C4V A;  3HSA A;  4FLH A;  3KRX A;  5AUI A;  4QXA B;  3DXC A;  2X38 A;  4HRO A;  2RR9 A;  5EE0 A;  1RFA A;  3HHM A;  3QBV B;  2CY5 A;  1WRI A;  1C77 A;  2IO3 B;  3ZXR A;  2MH7 A;  3HVZ A;  3MHZ A;  2OOB B;  5TR5 A;  3DOW A;  4O1N A;  1JW9 D;  4WJN A;  2ZW0 A;  4A55 A;  4XWW A;  1E8W A;  2UYZ B;  5DPS A;  3CIK A;  5D7G A;  1SEB D;  1QKZ A;  2XK5 A;  2PJH A;  3ZNZ B;  2DYQ A;  1SE9 A;  3NVW A;  2DHJ A;  2Z14 A;  2N9P C;  4EZL A;  1XLN A;  4JPS A;  1L2N A;  1TYG B;  2KFK B;  3IG3 A;  5CHF A;  4HKQ A;  1WY8 A;  1EF5 A;  1DOX A;  2CHZ A;  3BVG A;  4KDL B;  5HE2 A;  1TZO A;  5HI1 A;  3ZTC A;  5JZE B;  3A4R A;  1JQ4 A;  4HPM B;  5D3I B;  5C1Z A;  1XLQ A;  2LHD A;  1WM2 A;  4KSK C;  4JK7 A;  1XOD A;  4HJK A;  1YNT E;  2GBK A;  4KKJ A;  4IUM B;  2VKI A;  1BAK A;  5JHH A;  1Q10 A;  4EE2 A;  1ZW7 A;  3M63 B;  5AEK B;  1VJK A;  4C80 A;  1HBK A;  2WXJ A;  4ZOH C;  1IPG A;  2AQ2 B;  2K1F A;  3P7Z A;  2JXX A;  1K52 A;  4HAT B;  1LFD A;  1C3T A;  3B9J A;  2JT4 B;  1MKE A;  1RYJ A;  1ZP0 B;  2KT7 A;  5BMH A;  4XZ4 A;  3C19 A;  1WVH A;  4IW0 A;  4HAU B;  3VVW B;  3TSS A;  4XDD A;  3MHS D;  4G50 A;  1WXV A;  4LNN A;  3R3M A;  2BYV E;  3RD2 A;  1W1H A;  1XT9 B;  3PZ8 A;  1C4A A;  2AWT A;  4JIO U;  4JK8 A;  3VR8 B;  1RM6 C;  4RMA A;  2YF0 A;  2KHW B;  4WVF B;  1P7F A;  2V0G A;  3NG0 A;  3ZNI D;  3AV8 A;  3GZN B;  1SSN A;  1XQQ A;  2XNA C;  1ZXI A;  3LJU X;  3B08 A;  3S2A A;  4HJG E;  2E6X A;  4D2K A;  4MDK E;  2MDX A;  1V1O A;  5L95 C;  5IP4 D;  2NPT A;  1Z87 A;  3AEC B;  3VOQ A;  3BVZ A;  4LNO A;  3IAS 1;  3SD5 A;  4GOC A;  4LLG M;  1YD8 U;  3H9D A;  4JK9 A;  2K39 A;  3SFE B;  3DCG A;  1SIF A;  1YX5 B;  4WAA A;  4HWI B;  2N7E A;  3KH0 A;  1VZ6 A;  2MP2 B;  3NZ3 A;  1WG7 A;  1EU4 A;  1XCG A;  2JWU A;  2COD A;  1TS2 A;  4LNF A;  4RF0 A;  3ALB A;  4YSZ B;  2I5F A;  1VZ8 A;  4N9F 4;  4HLE A;  3A1Q B;  2MBE A;  1AWD A;  5IO9 A;  1FNW A;  1X86 A;  1TBE A;  3U7D A;  3DBL I;  2CS4 A;  2PMV A;  3EGR A;  3RNE C;  2QIL A;  5J3Q A;  4E71 A;  3ZUN A;  1OQQ A;  4NSW A;  3IT4 B;  2N0S B;  2N23 A;  1RFK A;  2FJ9 A;  3B2F A;  1WGQ A;  2LUL A;  4W9E A;  3EA6 A;  1X1G A;  2R2Q A;  4H2A A;  5FI0 A;  2NVU I;  3BIN A;  4DHZ E;  2MA9 B;  3VRA B;  2DBY A;  3UF8 A;  3TFM A;  1YIW A;  3KRW A;  2JRH A;  2CY4 A;  1PFD A;  4WWP A;  4Z2M B;  1UPQ A;  4IOY X;  4QJ3 B;  1WR1 A;  2J52 A;  2MP2 A;  1N63 A;  4LK0 M;  4A6F B;  2D10 A;  2INN E;  2KN4 A;  1WIA A;  4NJ7 A;  3ENB A;  3EEC A;  4EFO A;  2KQS A;  2RQ1 A;  1J19 A;  3NWD A;  4B6H A;  1TS5 A;  3NWF A;  1KLU D;  3IT6 B;  3LXF A;  2KO3 A;  4ZRQ A;  1F1H A;  3W9C B;  4JLC A;  4XE0 A;  1DRO A;  1U29 A;  1DYQ A;  4KIK B;  1SE4 A;  1QOG A;  2BW2 A;  3Q8F A;  1XF5 L;  1ZOY B;  1FFU A;  2CAY A;  2C5L C;  1V1P B;  5KQ4 A;  5LG4 B;  1EUV B;  2Z0D B;  3P63 A;  3KUD B;  2LFI A;  1QF6 A;  1AN8 A;  2W82 A;  1WXQ A;  1V89 A;  3QAQ A;  3TBL D;  4NQL B;  3OAW A;  1ZC3 B;  4II3 B;  1TKG A;  4WIP A;  3H8H A;  4YT0 B;  4JKA A;  2WXM A;  4CSQ A;  4BKG A;  2LUE A;  1WSP A;  3ODW A;  1MI0 A;  3DCX A;  2JZZ A;  3VTV A;  4YON A;  1HB8 A;  4L2Y A;  2RPQ A;  3AE3 B;  3VUX A;  2JVC A;  1GB1 A;  2N9X A;  2V1Y A;  3RCP A;  3EFU A;  4MJS A;  3W5U B;  2BQQ A;  2V4I B;  2CHW A;  4OVU A;  1KZG A;  4ILJ A;  1KF6 B;  3CF6 E;  1I4R A;  2Y7B A;  1V81 A;  3ODO A;  4M0W A;  1PYW D;  1EWY C;  3N1Y C;  2JP2 A;  4ASW C;  4HB4 B;  2CR5 A;  2N0Y A;  3NHE B;  2N9L A;  2WXK A;  1FOE A;  1FGY A;  4ITK A;  2KDM A;  1E8Z A;  2WWZ A;  5DPW A;  1SBB B;  4TYZ A;  4P1C C;  2L83 A;  2M1M A;  2LOX A;  3PSC A;  1P9D U;  1FXT B;  3ECI A;  4C7Y A;  4BAX A;  2EKE C;  3NJT A;  1WGD A;  1B55 A;  4ZRP A;  1F0Z A;  4RGM A;  2NBU A;  3EPY A;  4LNK A;  1PGB A;  2HTH B;  5JLJ B;  3R7R A;  4JKD A;  4IWP A;  4GOU A;  5CLL B;  1P3R A;  4MT7 A;  3F0W A;  1C4P A;  3V6E B;  2IY0 B;  4K7U A;  1T3Q A;  2RGN B;  4GMV A;  5I2S A;  1F77 A;  4ANX A;  1I42 A;  1U2B A;  4ILH A;  1WJ4 A;  2OTX A;  3AE4 B;  5BMG A;  3PS6 A;  3Q69 A;  3R2T A;  3U30 A;  3C8Y A;  3P42 A;  2VSZ A;  3JYU A;  2NBW B;  2WLB A;  2KYW A;  4HVB A;  1Q5W B;  2A4Z A;  2N7D A;  4HSI A;  2A5U A;  3FIL A;  1K50 A;  4F7Z A;  3RUI B;  4DQO C;  1ENF A;  2QJL A;  4HK2 A;  4PQ0 A;  2D4Q A;  2N9E B;  3KUZ A;  5EE3 A;  4L1B A;  2JSV X;  2YLM A;  1WM3 A;  2FDQ A;  1I4H A;  2MWN B;  1IYF A;  2FJU B;  2R2Y A;  4NAW B;  1HXY D;  4EUT A;  1OGW A;  1UGJ A;  2JWZ A;  3DVN V;  4GMX B;  3AED B;  4X57 B;  4WSF A;  3SDL C;  1JWU D;  2Z13 A;  4KHB B;  3RNF C;  3ZNG C;  3OHM B;  1A5R A;  1YOV B;  2KC2 A;  1K53 A;  2L00 B;  3M1I B;  3DVG X;  3ULB A;  1KOT A;  2DWQ A;  4C0A A;  4M02 A;  4PS8 A;  4JWU C;  2B76 B;  3PV1 A;  3V61 A;  1DIK A;  3EUB 2;  2COC A;  3A4S C;  4BFR A;  4NJC A;  1RAX A;  1VBG A;  1NVI D;  5CX3 A;  2L3Z A;  1C4C A;  2BBC A;  2MBH A;  5J17 A;  3ZIM A;  4XX5 A;  5T8I A;  1MPE A;  3HM3 A;  1KM7 A;  4KVG B;  3AE1 B;  5E6J A;  1JWS D;  2MBO A;  5D27 A;  5D3D A;  4F8C B;  2WDQ B;  3AXC A;  1WX8 A;  2VRW B;  3AEA B;  4II2 B;  1SHC A;  3V60 A;  2DLB A;  1EM7 A;  1FM0 D;  3X0W A;  3U2S C;  2IGH A;  2NCN A;  2YEP B;  5J18 A;  1WH3 A;  4GDL B;  2KKC A;  2WU5 B;  1MHX A;  2ON8 A;  3NOB A;  5IAA C;  3V05 A;  1ZUD 2;  1SE3 A;  2RDB C;  1GGO A;  3HIE A;  1UWX A;  2UVM A;  2DZI A;  1X11 A;  2P0D A;  2M19 A;  3APD A;  3QX1 A;  4FHJ A;  3KZ1 A;  3QCA A;  3TO1 A;  3IFW B;  1QOF A;  4A6K A;  2M17 A;  3PLU A;  2LRW A;  4AUQ C;  1UZX B;  1SJH D;  2L7R A;  1L7Y A;  4KZ0 A;  4JKG B;  2ZVO A;  4JKE A;  4E74 A;  1NBF C;  4JKC A;  2KCJ A;  2WX1 A;  4P16 A;  2W2X C;  3VQI A;  4JKF A;  2Z0O A;  5E6O A;  4KHO A;  4A5K A;  2G1E A;  5MPO A;  3B77 A;  1D5X C;  1Q0W B;  2R2O A;  3N7C A;  2PTL A;  1ET9 A;  3ML9 A;  2VH1 A;  1QQG A;  4XYC A;  3TUO A;  3VAW A;  3W1S C;  2QEJ C;  1JWB D;  1TXD A;  2D3C A;  3PHW B;  2K8B A;  2P0H A;  4PNK A;  5DI9 B;  3MJ5 A;  4WJQ A;  1J7B A;  1CQV A;  3DWG C;  3U8Z A;  3A98 B;  1TT5 B;  3ZQ4 A;  4A3O A;  1WF9 A;  4XC2 A;  1S1Q B;  4AWJ A;  2WX0 A;  4FHK A;  3HK0 A;  4IFS A;  2G4S A;  2QCZ A;  2M14 A;  4A9A A;  2BWF A;  2FUG 1;  2J59 M;  2DA0 A;  4MM3 A;  3W1Y A;  2NTS A;  2Z0Q A;  1YJJ A;  2WU2 B;  1KH0 A;  4MAC A;  2M56 B;  3H7P A;  5IA7 A;  3B0A A;  3SFD B;  4BBN F;  1EVH A;  4URK A;  3NZS A;  2CJN A;  3GOE A;  3RNB C;  3B2G A;  2KVZ A;  2HJ1 A;  3NUH B;  3E9L A;  3IHP C;  3GYP A;  2KLG A;  1WX9 A;  4YL8 A;  1W1G A;  4K81 A;  4JE3 B;  4FJZ A;  4ARC A;  2LEK A;  4KHA A;  2KQ7 A;  1QZE A;  3IAM 1;  1Q1O A;  1NEK B;  4HAX B;  3GZN I;  3L17 A;  1KJT A;  4OW0 A;  3IBE A;  4M01 A;  4JKG A;  1SE2 A;  3UGB B;  2HTM E;  3A8Q A;  1W1D A;  3P4P B;  2RPV A;  1L0X B;  2K5P A;  4ANV A;  1L0Y B;  2BS3 B;  2DZM A;  2K6D B;  2IGG A;  2OJW A;  2ZKM X;  1PGX A;  3KYC D;  2ASQ A;  1X05 A;  4GGQ A;  1V5P A;  4W9D A;  4ZRK A;  1G6J A;  3VUW A;  5JHB A;  2GCJ A;  2D9X A;  1ZSQ A;  1TGZ B;  4DWF A;  4LCD E;  1TTN A;  2FUH B;  4A90 A;  3AH7 A;  3M62 B;  4HAZ B;  2DHK A;  4FA6 A;  3LYY A;  5FR6 A;  2CU1 A;  1XKE A;  2WDV B;  1XR0 B;  4CHJ A;  2UZR A;  3AE7 B;  3BII D;  3NW8 A;  3DBH B;  4KV2 A;  2DYM A;  3FEH A;  2R61 A;  2V76 A;  4K7W A;  3BK1 A;  2ELA A;  2V3P A;  3I3T B;  2LAS A;  3FSS A;  1WGH A;  4TSS A;  2DIK A;  2MBQ A;  3ZVV A;  1HZ6 A;  4JX1 C;  3DVG Y;  1P6S A;  4LTU A;  4BBK A;  2WXR A;  2ROV A;  5HG2 A;  1LB1 A;  4HAV B;  1AW7 A;  1RLF A;  1FO4 A;  3PZD A;  3PRE A;  2EMS A;  2H7E A;  4DX9 0;  1R4N B;  2NTT A;  3Q3O C;  2KWC A;  2COP A;  3D8E A;  4BZA A;  4I6N B;  1X1F A;  1E6E B;  2KD0 A;  2IO2 B;  2KMA A;  2D9W A;  5KHO A;  4F7U P;  1HZ5 A;  2RUK B;  3A8P A;  5EE9 A;  4MY6 A;  5HFY A;  2HE7 A;  4NAW A;  1EWC A;  4W9J A;  3IXS A;  2RSU A;  2KWV B;  1GOZ A;  3H7S A;  1LXD A;  1HB6 A;  2IDY A;  2JY6 A;  3P6A A;  1K8R B;  1E0Z A;  2CB8 A;  2KVR A;  1TS3 A;  1BTN A;  3FKY A;  2E2X A;  2ACZ B;  5JXV A;  4CHM A;  1JWM D;  2YS3 A;  1L0V B;  2FBW B;  2K8E A;  3AMZ A;  3NVY A;  3U7Z A;  2KK8 A;  5HKH A;  1TY2 A;  4OVV A;  4FAD A;  5L81 A;  3QIJ A;  3URY A;  4RGO S;  3KY9 A;  1V5O A;  1ZVR A;  2IZV B;  4G3X B;  2TSS A;  2FCS A;  3M95 A;  1FHO A;  4AQ7 A;  4DBB A;  1D4B A;  1WJN A;  1WYG A;  5J3Y A;  1CMX B;  2N1W A;  2KR0 A;  2YEP F;  1TJE A;  4K1R B;  4IDI A;  3ZNH B;  4G0N B;  4DIX A;  2PIA A;  4XDC A;  2ZCB A;  1J0W A;  1XO3 A;  1UUP A;  3ENE A;  1VBH A;  4S17 A;  4I6P A;  2WXH A;  4GPT B;  1WX7 A;  3NWA A;  4W9G A;  5DCN A;  4WWM A;  3CST A;  1QT9 A;  4B6W A;  1NVL A;  3HM6 X;  1T77 A;  3UQB A;  1GJZ A;  3RCZ A;  3WA0 A;  2LYD A;  1UNR A;  4N58 A;  3FC4 A;  3FLV A;  4M00 A;  2L2I A;  4B9K A;  1GAQ B;  1J7C A;  4RNA A;  2BGF A;  4M0W B;  3KSY A;  3A33 B;  4M8M A;  2KJR A;  2WS3 B;  3JSV A;  5FR3 A;  4GDK A;  1TJ6 A;  1YQ4 B;  2LUM A;  2V3N A;  1XD3 B;  2KGX B;  5DIF B;  4IM0 A;  4MSQ B;  2GRI A;  2QHO A;  5C16 A;  4EMO A;  1MI1 A;  4PS7 A;  2DFK A;  4L6E A;  2K6Q A;  2WXL A;  2I5C A;  3QJZ A;  4QJ5 B;  2VH2 A;  4EOY A;  1MHH E;  3N30 A;  2M0X A;  1JRU A;  4KGR A;  3WYF B;  3AN1 A;  5H8Y E;  3H7P B;  2BS4 B;  2LGX A;  4HKZ E;  3AE6 B;  3ZO5 B;  4RM8 A;  3OLM D;  1ZDX A;  1M94 A;  1NTY A;  1D6E C;  2CRF A;  4F1S A;  4OZB A;  4LJO B;  1UPR A;  1MFW A;  3RFZ B;  2EMT A;  2ICI A;  3E9P A;  4HAY B;  2DX5 A;  2LMC A;  2KDI A;  4KIK A;  5LNK 1;  1Y56 A;  2CU3 A;  2KQ4 X;  3P4R B;  3MFG A;  4JKB A;  2MX2 A;  3MDB C;  2DX1 A;  5J3T A;  2RNR B;  2KDB A;  5H92 C;  4M8N A;  2IYD B;  5C5B A;  1NDD A;  3SHQ A;  2COA A;  1ACC A;  4YWG G;  2RD0 A;  2XEW A;  3E56 A;  2JYT A;  3AB5 A;  4F7G A;  1UH6 A;  3AEG B;  3QWZ B;  1WFY A;  4GB9 A;  3G9W A;  3Q3J A;  1E7V A;  4RFB A;  1WGG A;  2J0J A;  2MW5 A;  3N32 A;  2HRJ A;  2KNB A;  2LGY A;  3BZD B;  1XXG A;  2DAF A;  1KI1 B;  3AE8 B;  3KLS X;  1RRP B;  3HQC A;  2EJ8 A;  3SV1 A;  3A9J B;  2NZ8 B;  2W54 A;  1F9J A;  4MH0 E;  4USA A;  2YT2 A;  1V1P A;  2KX3 A;  2D3B A;  4FXC A;  4N6E B;  2MLB A;  3P4S B;  4C00 A;  3ML4 A;  1MG4 A;  2AYO B;  4ZHP A;  5HHD G;  2DTC A;  4WH4 A;  2MKR A;  1E10 A;  4EZK A;  3A1Q A;  3VH4 B;  2NBV B;  2Y8G A;  2BVC A;  1PFJ A;  1U5E A;  2MCN B;  2SEB D;  4ZRJ A;  4JWS C;  1UD7 A;  1M7R A;  1E90 A;  4NY0 A;  1E9M A;  3Q3M C;  3X23 A;  4K17 A;  2LOZ A;  3V5W A;  4PYU A;  1L6U A;  1N3H A;  4Y94 A;  5AZF A;  1M7E A;  3NY5 A;  1X1M A;  3ZTD A;  2OED A;  3PT2 B;  1JCK B;  1XCQ L;  3NZU A;  3N1Z C;  3ZRC A;  1BUI C;  2KAJ A;  5C79 A;  2X0S A;  1P5T A;  2D3G A;  2MJE A;  2JQR B;  4MGZ E;  2GB1 A;  2NMB A;  1FEH A;  3CWI A;  3VDZ A;  4HEA 1;  4K3B A;  3ZJT A;  1DDM A;  4DXF A;  3NSU A;  5HE0 A;  1F2R I;  2ABD A;  2CHX A;  2JZP A;  4BKS A;  1OMW A;  3PO0 A;  3WIM A;  5IKC M;  4JGH B;  3ODX A;  4HAW B;  1FXA A;  3DBS A;  4WJO A;  2NR2 A;  4AJY B;  3RZF A;  3Q2A C;  1A70 A;  3DHG C;  2IO1 B;  3BYT B;  1ZKH A;  3RT3 B;  1FXI A;  1DDW A;  4GN1 A;  1QOB A;  4YSY B;  1IGC A;  2D07 B;  2PLP A;  1F52 A;  4ARI A;  3GS2 A;  1NI3 A;  3R66 C;  3TVV A;  3TJP A;  3U52 E;  1PGA A;  2Q13 A;  2ZEQ A;  1FGZ A;  3PP2 A;  5C5B B;  3PG7 A;  2MRP A;  3JSV B;  1GB4 A;  2J7Q B;  1V8C A;  3DPD A;  3O65 B;  2BB5 A;  1XX0 A;  2PVG C;  1SXT A;  2INP E;  4JQW C;  1UWM A;  2N7J A;  1FD6 A;  4MK0 A;  2Z4D A;  5BMI A;  4GLS C;  2I1J A;  3Q3F A;  4YTP B;  1WXM A;  2REX A;  2K2U A;  5IRS A;  4MEL A;  4F7H A;  2KOX A;  4A8X C;  4DHJ D;  4HDO A;  1WMH A;  1EU3 A;  1WJM A;  1TY0 A;  4S0R A;  3ZLZ A;  2KTR A;  1VLB A;  4ACF A;  3GB1 A;  2RSG A;  5IN7 A;  3N1X C;  1XD4 A;  2PVO D;  1CJE A;  2KC1 A;  1YQ3 B;  4KGS A;  3NS1 A;  1WXS A;  3PSE B;  4MEM A;  1M4V A;  1OTR B;  2YT0 A;  3PVW A;  1WE7 A;  3SR6 A;  1TZ1 A;  3H1U A;  1LQB A;  2XBB C;  1E7P B;  1B9R A;  2RDH A;  4HCP B;  2WXN A;  2PE6 B;  2L1C A;  2W3R A;  4QAY A;  2VZK D;  1I35 A;  1WGU A;  4BVU C;  3OJ4 B;  4KDI C;  3PHX B;  4W9H A;  4BKT A;  2RLO A;  4LDT B;  1FB8 A;  1QC6 A;  4US9 A;  1HQR D;  4NZL B;  1DOI A;  1FNU A;  4YTN B;  1N6Z A;  3V3X A;  2YRY A;  2HD5 B;  1EGX A;  2GCL A;  2NS5 A;  2DKQ A;  1E7U A;  5IJM A;  3PVU A;  5D2M B;  1WMH B;  4Z2N A;  2K8H A;  1WYW B;  3UZT A;  1HA5 A;  5HE1 A;  1KRH A;  1MVK A;  1GC7 A;  1C78 A;  1CZP A;  1DDV A;  1MAI A;  4MSM B;  1BWN A;  1I7A A;  1XLO A;  2YVC A;  2MWS B;  2RVB B;  4QJ4 B;  3J9C A;  1IBX A;  2L52 A;  2Y5B B;  3P1M A;  3L13 A;  2LVP A;  1R4N I;  2QKM A;  2BCJ A;  1KZ7 A;  1N61 A;  5C23 A;  3FM8 C; 
#chains in the Genus database with same CATH homology
 2MSE D;  1WJU A;  1J8C A;  2KAN A;  5CTR C;  2Z0P A;  2KLC A;  1AWE A;  2FCN A;  1U5G A;  4PS3 A;  5EFX A;  4KSL C;  1U5F A;  4CO7 A;  2KFK A;  4HXD A;  3JVZ X;  3JW0 X;  3ML8 A;  3UQA A;  4WJP A;  2O6V A;  3PGE A;  4W9I A;  2O2V A;  2R0D A;  2KX0 A;  3DXD A;  1YX6 B;  4GDL A;  2GJY A;  3T8M A;  5D94 A;  3VFK A;  1DYN A;  3QC8 B;  2IFS A;  2BKR B;  1Z2M A;  2FJL A;  2C7H A;  1UBQ A;  2O2V B;  1UBI A;  1VD2 A;  3PPA A;  3H6N A;  2D9V A;  2KZR A;  3L0W B;  2M4N A;  2CKH B;  5JH5 C;  5DHF B;  2O6V D;  3VIA A;  3GYO A;  3MPX A;  4GDK B;  2DAJ A;  2KTR B;  3OJ3 A;  5E6N A;  1V9J A;  2UWQ A;  1NTI A;  4ZYN A;  4HHV A;  5GMV A;  4DXA B;  4P7I A;  4W9L A;  4BKS D;  3M3J A;  3K9P B;  1E5W A;  4AJW A;  3VTU A;  2JRI B;  3KYD D;  4A20 A;  2W2W A;  1ST7 A;  3C0R B;  2G3Q B;  1GNU A;  2L0F A;  1UNQ A;  3WAP A;  2HJ8 A;  4H8S A;  4KZC A;  4ANU A;  1R4M I;  2MBB B;  4LJP B;  1BT0 A;  2DHZ A;  1C1Y B;  4JL9 A;  1GC6 A;  1UNP A;  2N4F A;  4B95 A;  4FBJ B;  3DBR I;  2LVO A;  4DX8 A;  2DN6 A;  1ISN A;  4NQK E;  2GBJ A;  2NPT B;  2K00 A;  4W9K A;  1WR6 E;  3DQV A;  1Z5S B;  4DDG D;  2ELB A;  1PQS A;  3ZKJ C;  3IVF A;  3DXE A;  3T9L A;  2K25 A;  2DYN A;  1K5D B;  1V5M A;  4EJN A;  2V3S A;  4FUL A;  3WAL A;  3L10 B;  3PRZ A;  2J0M A;  4BOS C;  4W9C A;  4ZDV A;  3EC8 A;  4K2P A;  4ICU A;  2LKO A;  1FHW A;  3AUL A;  2WH5 A;  1D3Z A;  2YS1 A;  1WGY A;  3UIP B;  4MGI E;  4MGK E;  1WXA A;  2FCQ A;  3SBG A;  4IG7 B;  2LXC A;  3SBT A;  2LWP A;  1H10 A;  1PMS A;  3MJW A;  4EZJ A;  2H7D A;  3DVN U;  1GUA B;  2DYB A;  3NS8 A;  1ZGU B;  2V4L A;  2KXJ A;  3QQ8 B;  3PRP B;  1FHX A;  3KUC B;  2ZCC A;  2R82 A;  3B1L X;  1BTK A;  1P1A A;  2ADZ A;  3QWM A;  5G2N A;  4IM2 A;  2C7N B;  1V6E A;  2IY1 B;  2GMI C;  2PEA A;  5GOW B;  1RJ2 A;  1J0G A;  2DKP A;  1WI0 A;  3VXW A;  4BBN C;  3AU5 A;  2LI5 A;  4IWQ A;  4E3C A;  3D8F A;  3MTN B;  4EEW A;  2GBR A;  2PZ1 A;  3RYT A;  1YQB A;  4FN2 A;  1ZM0 A;  2RGF A;  2DHI A;  3APF A;  1OY2 A;  4TKN A;  5HE3 A;  2ZJD A;  2Y8F A;  5CLQ B;  3RUL A;  2UZS A;  1IRS A;  3KVF B;  3D32 A;  1KLV A;  1LW3 A;  3V62 A;  2KDF B;  3SYX A;  2BPS A;  5AZG A;  2K8C A;  4FJV B;  1V2Y A;  1TQZ A;  4KAX B;  3O96 A;  5D3X A;  1UEL A;  2OJR A;  1V86 A;  4ILG B;  5AZH A;  5BO4 B;  2ZZP B;  2FCM A;  3TCA A;  3T06 A;  1NTV A;  1WJ6 A;  3ULC A;  1RRB A;  4IM3 A;  1OQN A;  2QKL A;  1WZ3 A;  2MQJ A;  2HTH A;  5JHG A;  1S3S G;  2CQU A;  2LVQ A;  3ZVR A;  3A9J A;  2DX5 B;  2KDE B;  1I2H A;  1OEY A;  4BOZ B;  3HIZ A;  3P2B A;  2K2J A;  4DHJ B;  1WZ0 A;  4NNJ B;  4AP4 C;  5DPR A;  2KWU B;  2PE9 A;  5CHW A;  1FAO A;  2KJ6 A;  3ONS A;  5JHA A;  2BYE A;  2WDT B;  1Y19 B;  1P98 A;  3DBH I;  3L54 A;  1EAZ A;  4GXB A;  1HE8 A;  2N1V A;  3L08 A;  2Z0E B;  3FP5 A;  5DH9 B;  3TL5 A;  2D9Y A;  2MFQ A;  2LXA A;  4ZRI A;  5KCV A;  3QK0 A;  4HCN B;  4K7S A;  2DYO A;  3F5R A;  3K9O B;  4FJY A;  5D3Y A;  1H4R A;  2L8J A;  1Q67 A;  3ZDT A;  5CHV C;  5L83 A;  1NU2 A;  3L16 A;  4CHK A;  4TUU A;  1IP9 A;  2FAZ A;  5D3V A;  2GS0 A;  2LRU A;  4ICV A;  4HB0 B;  3WAN A;  2LBB A;  5LLI A;  2VRR B;  3APC A;  1V5T A;  3A9K A;  3PLV A;  4W9F A;  2FIF A;  2LGD A;  3RZW C;  1MK7 B;  1K5G B;  4GSW A;  2AEH A;  4DBG A;  1WRD B;  2GBN A;  4TQ0 A;  2JUO A;  2R09 A;  5LXI B;  1V49 A;  4PYZ A;  3AU4 A;  1V5U A;  3WAO A;  3CXB B;  4I6L B;  1ACA A;  5C6R A;  1LM8 B;  5D6J B;  3ZDM C;  4A6F A;  5J2R A;  2DZK A;  3PRM B;  1EF1 A;  2JF5 A;  3PTF C;  1NI2 A;  1WE6 A;  3SNH A;  3QA8 A;  3SUZ A;  1VCB A;  2P8V A;  2OQB A;  2JPH A;  3BY4 B;  2B3A A;  1E8X A;  1H8C A;  1V61 A;  1WJ1 A;  2KMC A;  1MIZ B;  3W1S A;  3PVL A;  1U5D A;  1E8Y A;  2FNJ B;  3OAN A;  4HB3 B;  4DK5 A;  1MIX A;  2LG1 A;  3E66 A;  4AOF A;  2LD9 A;  4XWX A;  4D0N B;  1AAR A;  3QAR A;  4NPN A;  1UGM A;  2FID A;  1Y5O A;  3TIX A;  1KBL A;  3D8D A;  3HW2 B;  3BJI A;  2BF8 B;  2C7M B;  3V6C B;  5JP4 A;  3KW5 B;  1JDE A;  1WGR A;  4WWO A;  1PLS A;  3TW1 A;  3AJ4 A;  2BYF A;  4GU2 A;  1V88 A;  3R7Q A;  3LJ3 A;  4J6I A;  1EO6 A;  2W9N A;  3LDZ E;  1T0Y A;  2D9Z A;  2AL3 A;  5EDS A;  3A9K B;  1SGH A;  5FI1 A;  2COF A;  2Z59 B;  2XQN M;  4CYE A;  4EKU A;  2YS5 A;  2ZNV B;  3E9O A;  4IAP A;  1Y8R C;  4A3P A;  4IC7 B;  2IBI B;  2KFJ A;  5LON B;  2I1K A;  3VTW A;  4RM9 A;  2LZ6 A;  2KTF A;  2ZNV C;  2L0T A;  1WI1 A;  2J0K A;  4HPL B;  5D3W A;  2C9W B;  4JKH A;  5LOP B;  2PPH A;  2LJ5 A;  2XK5 B;  2JZ3 B;  1GG3 A;  4HDQ A;  4ANW A;  2DZJ A;  1OEY J;  2D11 A;  1YJ1 A;  1DBH A;  2KN5 A;  2BWE S;  4A6H A;  2L76 A;  2M38 A;  5E6P A;  1U4A A;  3QHT A;  1V80 A;  3CSF A;  2IYB A;  2L05 A;  3CMM B;  3ZRF A;  2DLW A;  2D2Q A;  4WJ7 A;  2ZPY A;  2C60 A;  2X18 A;  2O6V B;  2ZPN A;  3PEG A;  2W2X D;  3DDC B;  5G55 A;  1KC7 A;  3VH3 B;  1P3Q U;  2GOW A;  4MJS B;  2ZVN A;  3TMP B;  4TQ1 A;  2BKF A;  3UIN B;  3EHV A;  4GZU A;  2ROZ B;  4WQO B;  2YT1 A;  2EC1 A;  2DEN B;  4GIV A;  2YSZ A;  2G35 A;  4DDI D;  3WAM A;  4G11 A;  2P0F A;  4LDT D;  4NJ6 A;  1MPH A;  4DHZ B;  3SO6 A;  5LXH A;  4TV3 A;  1UEF A;  2G4D B;  4IWO A;  1MG8 A;  1OQY A;  4MGY E;  3VHT C;  1P0R A;  5DPT A;  1MK9 B;  2GBM A;  4WWN A;  5JVL A;  2IO0 B;  2KJH B;  3AI5 A;  2WYQ A;  1U27 A;  3N3K B;  3VUY A;  2M8S A;  2KUP A;  4K2O A;  3UIO B;  2G45 B;  5KHQ A;  3SU8 X;  5KQ1 A;  1AQC A;  1ZC4 B;  4HB2 B;  5DHA B;  2AL6 A;  3ZW3 A;  4FLH A;  3KRX A;  3DXC A;  2RR9 A;  1RFA A;  3HHM A;  3QBV B;  2CY5 A;  2IO3 B;  2OOB B;  5TR5 A;  3DOW A;  4WJN A;  1E8W A;  2UYZ B;  5DPS A;  3CIK A;  5D7G A;  2XK5 A;  2PJH A;  3ZNZ B;  2DYQ A;  1SE9 A;  4EZL A;  2DHJ A;  2N9P C;  1L2N A;  2KFK B;  3IG3 A;  5CHF A;  1WY8 A;  1EF5 A;  2CHZ A;  4KDL B;  5HE2 A;  3ZTC A;  5JZE B;  3A4R A;  4HPM B;  5C1Z A;  1WM2 A;  4KSK C;  4JK7 A;  1XOD A;  4HJK A;  2GBK A;  4IUM B;  2VKI A;  1BAK A;  5JHH A;  1ZW7 A;  3M63 B;  5AEK B;  1HBK A;  1IPG A;  2K1F A;  3P7Z A;  2JXX A;  4HAT B;  1LFD A;  1C3T A;  2JT4 B;  1MKE A;  4XZ4 A;  1WVH A;  4IW0 A;  4HAU B;  3VVW B;  3MHS D;  4G50 A;  1WXV A;  3RD2 A;  3R3M A;  2BYV E;  1W1H A;  1XT9 B;  2AWT A;  4JIO U;  4JK8 A;  4RMA A;  2YF0 A;  2KHW B;  4WVF B;  3ZNI D;  1XQQ A;  3LJU X;  3B08 A;  3S2A A;  4MDK E;  2MDX A;  5L95 C;  2NPT A;  1Z87 A;  3VOQ A;  3SD5 A;  4GOC A;  1YD8 U;  3H9D A;  4JK9 A;  2K39 A;  3DCG A;  1SIF A;  1YX5 B;  4WAA A;  4HWI B;  2N7E A;  3KH0 A;  2MP2 B;  1WG7 A;  1XCG A;  2COD A;  3ALB A;  2I5F A;  4N9F 4;  4HLE A;  3A1Q B;  2MBE A;  1X86 A;  1TBE A;  3U7D A;  3DBL I;  2CS4 A;  5J3Q A;  4E71 A;  3ZUN A;  4NSW A;  2N23 A;  2FJ9 A;  1WGQ A;  2LUL A;  4W9E A;  1X1G A;  2R2Q A;  5FI0 A;  2NVU I;  3BIN A;  4DHZ E;  2MA9 B;  3UF8 A;  3TFM A;  1YIW A;  3KRW A;  2JRH A;  2CY4 A;  4WWP A;  4Z2M B;  1UPQ A;  4IOY X;  1WR1 A;  2MP2 A;  4A6F B;  2D10 A;  1WIA A;  4NJ7 A;  3ENB A;  3EEC A;  4EFO A;  2KQS A;  2RQ1 A;  1J19 A;  4B6H A;  2KO3 A;  4JLC A;  1DRO A;  1U29 A;  4KIK B;  2CAY A;  2C5L C;  5KQ4 A;  1EUV B;  2Z0D B;  3KUD B;  1V89 A;  3QAQ A;  3TBL D;  4NQL B;  3OAW A;  1ZC3 B;  4II3 B;  4JKA A;  4BKG A;  2LUE A;  3ODW A;  2JZZ A;  3VTV A;  4YON A;  1HB8 A;  2RPQ A;  3VUX A;  2JVC A;  2N9X A;  2V1Y A;  3RCP A;  3EFU A;  4MJS A;  2CHW A;  4OVU A;  1KZG A;  4ILJ A;  3CF6 E;  2Y7B A;  1V81 A;  3ODO A;  2JP2 A;  4ASW C;  4HB4 B;  2CR5 A;  2N0Y A;  3NHE B;  1FOE A;  1FGY A;  1E8Z A;  2WWZ A;  5DPW A;  4TYZ A;  2M1M A;  2LOX A;  3PSC A;  1P9D U;  1FXT B;  3ECI A;  2EKE C;  1WGD A;  1B55 A;  2NBU A;  3EPY A;  2HTH B;  5JLJ B;  3R7R A;  4JKD A;  4IWP A;  5CLL B;  1P3R A;  4MT7 A;  3F0W A;  3V6E B;  2IY0 B;  4K7U A;  2RGN B;  4GMV A;  4ANX A;  1I42 A;  1U2B A;  4ILH A;  1WJ4 A;  2OTX A;  3PS6 A;  3U30 A;  2VSZ A;  3JYU A;  2NBW B;  4HVB A;  1Q5W B;  2A4Z A;  2N7D A;  2A5U A;  4F7Z A;  3RUI B;  4HK2 A;  4PQ0 A;  2D4Q A;  2N9E B;  3KUZ A;  2YLM A;  1WM3 A;  2FDQ A;  2MWN B;  1IYF A;  4NAW B;  4EUT A;  1OGW A;  2JWZ A;  3DVN V;  4GMX B;  4X57 B;  4WSF A;  3SDL C;  4KHB B;  3ZNG C;  1A5R A;  2L00 B;  2KC2 A;  3M1I B;  3DVG X;  3ULB A;  1KOT A;  4C0A A;  4PS8 A;  3PV1 A;  3V61 A;  1DIK A;  2COC A;  3A4S C;  4BFR A;  1RAX A;  1VBG A;  5CX3 A;  2L3Z A;  2MBH A;  5J17 A;  3ZIM A;  4XX5 A;  3HM3 A;  1KM7 A;  4KVG B;  2MBO A;  5D27 A;  4F8C B;  3AXC A;  1WX8 A;  2VRW B;  4II2 B;  1SHC A;  3V60 A;  3X0W A;  2NCN A;  5J18 A;  1WH3 A;  4GDL B;  2KKC A;  3NOB A;  5IAA C;  1GGO A;  2UVM A;  2DZI A;  1X11 A;  2P0D A;  3APD A;  3QX1 A;  4FHJ A;  3KZ1 A;  3QCA A;  3TO1 A;  3IFW B;  4A6K A;  2M17 A;  3PLU A;  2LRW A;  4AUQ C;  1UZX B;  2L7R A;  1L7Y A;  4KZ0 A;  4JKG B;  2ZVO A;  4JKE A;  4E74 A;  1NBF C;  4JKC A;  2KCJ A;  2WX1 A;  2W2X C;  3VQI A;  4JKF A;  2Z0O A;  5E6O A;  4KHO A;  4A5K A;  1Q0W B;  2R2O A;  3N7C A;  3ML9 A;  1QQG A;  3VAW A;  3W1S C;  1TXD A;  3PHW B;  2K8B A;  2P0H A;  4PNK A;  5DI9 B;  4WJQ A;  3U8Z A;  3A98 B;  4A3O A;  1WF9 A;  4XC2 A;  1S1Q B;  4AWJ A;  2WX0 A;  4FHK A;  3HK0 A;  4IFS A;  2G4S A;  2M14 A;  2BWF A;  2J59 M;  2DA0 A;  4MM3 A;  3W1Y A;  2Z0Q A;  5IA7 A;  3H7P A;  3B0A A;  4BBN F;  1EVH A;  4URK A;  3NZS A;  3GOE A;  3E9L A;  3IHP C;  3GYP A;  2KLG A;  1WX9 A;  4YL8 A;  1W1G A;  4K81 A;  4FJZ A;  4KHA A;  2KQ7 A;  1QZE A;  1Q1O A;  4HAX B;  3GZN I;  3L17 A;  1KJT A;  3IBE A;  4JKG A;  3UGB B;  3A8Q A;  1W1D A;  4ANV A;  2DZM A;  2K6D B;  3KYC D;  2ASQ A;  1X05 A;  4GGQ A;  1V5P A;  4W9D A;  4ZRK A;  1G6J A;  3VUW A;  5JHB A;  2GCJ A;  2D9X A;  1ZSQ A;  1TGZ B;  4DWF A;  4LCD E;  1TTN A;  2FUH B;  3M62 B;  4HAZ B;  2DHK A;  4FA6 A;  5FR6 A;  2CU1 A;  1XKE A;  1XR0 B;  4CHJ A;  2UZR A;  4KV2 A;  2DYM A;  3FEH A;  2V76 A;  4K7W A;  2ELA A;  3I3T B;  2LAS A;  3FSS A;  1WGH A;  2DIK A;  2MBQ A;  3ZVV A;  3DVG Y;  1P6S A;  4BBK A;  2ROV A;  1LB1 A;  4HAV B;  1RLF A;  3PZD A;  3PRE A;  2EMS A;  2H7E A;  4DX9 0;  2KWC A;  2COP A;  3D8E A;  4I6N B;  1X1F A;  2KD0 A;  2IO2 B;  2KMA A;  2D9W A;  5KHO A;  4F7U P;  2RUK B;  3A8P A;  4MY6 A;  2HE7 A;  4NAW A;  4W9J A;  2RSU A;  2KWV B;  3H7S A;  1LXD A;  1HB6 A;  2JY6 A;  3P6A A;  1K8R B;  2CB8 A;  2KVR A;  1BTN A;  2E2X A;  4CHM A;  2YS3 A;  2KK8 A;  5HKH A;  4OVV A;  4FAD A;  5L81 A;  3QIJ A;  3KY9 A;  1V5O A;  1ZVR A;  2IZV B;  4G3X B;  2FCS A;  3M95 A;  1FHO A;  4DBB A;  1WJN A;  5J3Y A;  1CMX B;  2N1W A;  4K1R B;  3ZNH B;  4G0N B;  2ZCB A;  1J0W A;  3ENE A;  1VBH A;  4I6P A;  4GPT B;  1WX7 A;  4W9G A;  5DCN A;  3CST A;  4B6W A;  1NVL A;  3HM6 X;  3UQB A;  1GJZ A;  3RCZ A;  3WA0 A;  2LYD A;  1UNR A;  3FLV A;  2L2I A;  4B9K A;  2BGF A;  4M0W B;  3KSY A;  3A33 B;  4M8M A;  2KJR A;  3JSV A;  4GDK A;  1TJ6 A;  1XD3 B;  2KGX B;  5DIF B;  4IM0 A;  4MSQ B;  2QHO A;  5C16 A;  4EMO A;  4PS7 A;  2DFK A;  4L6E A;  2K6Q A;  2I5C A;  3QJZ A;  4EOY A;  3N30 A;  2M0X A;  1JRU A;  3WYF B;  3H7P B;  2LGX A;  3ZO5 B;  4RM8 A;  3OLM D;  1M94 A;  1NTY A;  2CRF A;  4F1S A;  4LJO B;  1UPR A;  2EMT A;  3E9P A;  4HAY B;  2DX5 A;  2KDI A;  4KIK A;  4JKB A;  2MX2 A;  3MDB C;  2DX1 A;  5J3T A;  2RNR B;  2KDB A;  4M8N A;  2IYD B;  5C5B A;  1NDD A;  3SHQ A;  2COA A;  2RD0 A;  2XEW A;  4F7G A;  1UH6 A;  3QWZ B;  1WFY A;  4GB9 A;  3G9W A;  3Q3J A;  1E7V A;  1WGG A;  2J0J A;  2MW5 A;  3N32 A;  2HRJ A;  2KNB A;  2LGY A;  2DAF A;  1KI1 B;  1RRP B;  3HQC A;  2EJ8 A;  3SV1 A;  3A9J B;  2NZ8 B;  1F9J A;  4MH0 E;  2KX3 A;  2MLB A;  3ML4 A;  2AYO B;  2DTC A;  2MKR A;  4EZK A;  3A1Q A;  3VH4 B;  2NBV B;  2Y8G A;  1PFJ A;  1U5E A;  2MCN B;  4ZRJ A;  1UD7 A;  1M7R A;  1E90 A;  4NY0 A;  3X23 A;  4K17 A;  2LOZ A;  3V5W A;  4PYU A;  1N3H A;  4Y94 A;  5AZF A;  1M7E A;  3NY5 A;  1X1M A;  3ZTD A;  3PT2 B;  3NZU A;  3ZRC A;  5C79 A;  2X0S A;  1P5T A;  2D3G A;  4MGZ E;  2NMB A;  3VDZ A;  1DDM A;  3NSU A;  5HE0 A;  2ABD A;  2CHX A;  4BKS A;  1OMW A;  3WIM A;  4JGH B;  3ODX A;  4HAW B;  3DBS A;  4WJO A;  2NR2 A;  4AJY B;  3RZF A;  2IO1 B;  1ZKH A;  3RT3 B;  1DDW A;  4GN1 A;  2D07 B;  3R66 C;  3TVV A;  3TJP A;  2Q13 A;  2ZEQ A;  1FGZ A;  3PP2 A;  5C5B B;  3PG7 A;  2MRP A;  3JSV B;  2J7Q B;  3DPD A;  3O65 B;  1XX0 A;  4JQW C;  4MK0 A;  2I1J A;  3Q3F A;  1WXM A;  2REX A;  2K2U A;  4MEL A;  4F7H A;  2KOX A;  4DHJ D;  4HDO A;  1WMH A;  1WJM A;  3ZLZ A;  2KTR A;  2RSG A;  1XD4 A;  2KC1 A;  1WXS A;  3PSE B;  4MEM A;  1OTR B;  2YT0 A;  3PVW A;  1WE7 A;  1TZ1 A;  3H1U A;  1LQB A;  2XBB C;  4HCP B;  2PE6 B;  2L1C A;  1I35 A;  1WGU A;  4BVU C;  3OJ4 B;  4KDI C;  3PHX B;  4W9H A;  4BKT A;  2RLO A;  4LDT B;  1FB8 A;  1QC6 A;  2YRY A;  2HD5 B;  1EGX A;  2GCL A;  2NS5 A;  2DKQ A;  1E7U A;  5IJM A;  3PVU A;  5D2M B;  1WMH B;  4Z2N A;  2K8H A;  1WYW B;  3UZT A;  5HE1 A;  1GC7 A;  1DDV A;  1MAI A;  4MSM B;  1BWN A;  1I7A A;  2YVC A;  2MWS B;  2RVB B;  2Y5B B;  3L13 A;  2LVP A;  1R4N I;  2QKM A;  2BCJ A;  1KZ7 A;  5C23 A;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...