2COPA

Solution structure of rsgi ruh-040, an acbp domain from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
GSSGSSGLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Acyl-Coenzyme A binding domain containing 6
publication title Solution structure of RSGI RUH-040, an ACBP domain from human cDNA
rcsb
source organism Homo sapiens
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2copA00
4F7GA 2EMSA 1HB8A 2J0JA 1NTIA 1MK7B 2HRJA 4ZRJA 1GC7A 2D11A 2ABDA 3EPYA 4HDOA 1Y19B 2EMTA 2AEHA 1NVLA 1E5WA 2CQUA 2RQ1A 1SGHA 2J0KA 4EKUA 1NI2A 2D2QA 3BINA 4CYEA 1ST7A 3PVLA 4DXAB 3WA0A 5IJMA 2I1JA 2COPA 1HB6A 1ISNA 1HBKA 2WH5A 3U8ZA 3AU4A 1MK9B 3FP5A 3ZDTA 1EF1A 1GC6A 1ACAA 3PZDA 1MIXA 3FLVA 4P7IA 2FJ9A 2J0MA 3AU5A 1H4RA 2YVCA 3QIJA 2D10A 2FDQA 2HE7A 4ZRKA 3X23A 2I1KA 3U7DA 4HDQA 2CB8A 1MIZB 2ZPYA 4YL8A 1J19A 3IVFA 4ZRIA 1GG3A 4NY0A 2AL6A 3G9WA 2LBBA
chains in the Genus database with same CATH superfamily
1HB8A 1KC7A 2J0JA 4JKFA 2HRJA 2D11A 3EPYA 2D2QA 2R82A 1ST7A 4JKGA 2WH5A 1HB6A 3AU4A 3FP5A 3ZDTA 1EF1A 1GGOA 1MIXA 2J0MA 1H4RA 3QIJA 3X23A 2I1KA 3SBTA 4HDQA 3E9PA 2HE7A 1VBHA 4JKBA 4ZRJA 2ABDA 2J0KA 4JKGB 3WA0A 5IJMA 2I1JA 1HBKA 1MK9B 3SBGA 3PZDA 4JKEA 4P7IA 2FJ9A 3AU5A 4JK7A 4ILHA 4JK8A 4GXBA 1VBGA 5JVLA 4YL8A 4NY0A 2FDQA 2AL6A 3G9WA 4F7GA 4JKCA 1GC7A 4HDOA 1NVLA 1E5WA 2CQUA 1SGHA 4CYEA 4DXAB 1ISNA 2X0SA 1GC6A 1ACAA 1JDEA 3E9LA 3E9OA 2YVCA 2D10A 3E66A 4ILJA 4ZRIA 4JKDA 2LBBA 1DIKA 2EMSA 1NTIA 1MK7B 4JK9A 1Y19B 2EMTA 2AEHA 2RQ1A 4EKUA 1NI2A 3BINA 3ENBA 3PVLA 2DIKA 2COPA 1KBLA 3U8ZA 4TKNA 3FLVA 4JKHA 4ILGB 4ZRKA 3U7DA 4JKAA 2CB8A 1MIZB 2ZPYA 1J19A 3IVFA 1GG3A
chains in the Genus database with same CATH topology
1HB8A 1KC7A 2J0JA 4JKFA 2HRJA 2D11A 3EPYA 2D2QA 2R82A 1ST7A 4JKGA 2WH5A 1HB6A 3AU4A 3FP5A 3ZDTA 1EF1A 1GGOA 1MIXA 2J0MA 1H4RA 3QIJA 3X23A 2I1KA 3SBTA 4HDQA 3E9PA 2HE7A 1VBHA 4JKBA 4ZRJA 2ABDA 2J0KA 4JKGB 3WA0A 5IJMA 2I1JA 1HBKA 1MK9B 3SBGA 3PZDA 4JKEA 4P7IA 2FJ9A 3AU5A 4JK7A 4ILHA 4JK8A 4GXBA 1VBGA 5JVLA 4YL8A 4NY0A 2FDQA 2AL6A 3G9WA 4F7GA 4JKCA 1GC7A 4HDOA 1NVLA 1E5WA 2CQUA 1SGHA 4CYEA 4DXAB 1ISNA 2X0SA 1GC6A 1ACAA 1JDEA 3E9LA 3E9OA 2YVCA 2D10A 3E66A 4ILJA 4ZRIA 4JKDA 2LBBA 1DIKA 2EMSA 1NTIA 1MK7B 4JK9A 1Y19B 2EMTA 2AEHA 2RQ1A 4EKUA 1NI2A 3BINA 3ENBA 3PVLA 2DIKA 2COPA 1KBLA 3U8ZA 4TKNA 3FLVA 4JKHA 4ILGB 4ZRKA 3U7DA 4JKAA 2CB8A 1MIZB 2ZPYA 1J19A 3IVFA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7G A;  2EMS A;  1HB8 A;  2J0J A;  1NTI A;  1MK7 B;  2HRJ A;  4ZRJ A;  1GC7 A;  2D11 A;  2ABD A;  3EPY A;  4HDO A;  1Y19 B;  2EMT A;  2AEH A;  1NVL A;  1E5W A;  2CQU A;  2RQ1 A;  1SGH A;  2J0K A;  4EKU A;  1NI2 A;  2D2Q A;  3BIN A;  4CYE A;  1ST7 A;  3PVL A;  4DXA B;  3WA0 A;  5IJM A;  2I1J A;  2COP A;  1HB6 A;  1ISN A;  1HBK A;  2WH5 A;  3U8Z A;  3AU4 A;  1MK9 B;  3FP5 A;  3ZDT A;  1EF1 A;  1GC6 A;  1ACA A;  3PZD A;  1MIX A;  3FLV A;  4P7I A;  2FJ9 A;  2J0M A;  3AU5 A;  1H4R A;  2YVC A;  3QIJ A;  2D10 A;  2FDQ A;  2HE7 A;  4ZRK A;  3X23 A;  2I1K A;  3U7D A;  4HDQ A;  2CB8 A;  1MIZ B;  2ZPY A;  4YL8 A;  1J19 A;  3IVF A;  4ZRI A;  1GG3 A;  4NY0 A;  2AL6 A;  3G9W A;  2LBB A; 
#chains in the Genus database with same CATH topology
 1HB8 A;  1KC7 A;  2J0J A;  4JKF A;  2HRJ A;  2D11 A;  3EPY A;  2D2Q A;  2R82 A;  1ST7 A;  4JKG A;  2WH5 A;  1HB6 A;  3AU4 A;  3FP5 A;  3ZDT A;  1EF1 A;  1GGO A;  1MIX A;  2J0M A;  1H4R A;  3QIJ A;  3X23 A;  2I1K A;  3SBT A;  4HDQ A;  3E9P A;  2HE7 A;  1VBH A;  4JKB A;  4ZRJ A;  2ABD A;  2J0K A;  4JKG B;  3WA0 A;  5IJM A;  2I1J A;  1HBK A;  1MK9 B;  3SBG A;  3PZD A;  4JKE A;  4P7I A;  2FJ9 A;  3AU5 A;  4JK7 A;  4ILH A;  4JK8 A;  4GXB A;  1VBG A;  5JVL A;  4YL8 A;  4NY0 A;  2FDQ A;  2AL6 A;  3G9W A;  4F7G A;  4JKC A;  1GC7 A;  4HDO A;  1NVL A;  1E5W A;  2CQU A;  1SGH A;  4CYE A;  4DXA B;  1ISN A;  2X0S A;  1GC6 A;  1ACA A;  1JDE A;  3E9L A;  3E9O A;  2YVC A;  2D10 A;  3E66 A;  4ILJ A;  4ZRI A;  4JKD A;  2LBB A;  1DIK A;  2EMS A;  1NTI A;  1MK7 B;  4JK9 A;  1Y19 B;  2EMT A;  2AEH A;  2RQ1 A;  4EKU A;  1NI2 A;  3BIN A;  3ENB A;  3PVL A;  2DIK A;  2COP A;  1KBL A;  3U8Z A;  4TKN A;  3FLV A;  4JKH A;  4ILG B;  4ZRK A;  3U7D A;  4JKA A;  2CB8 A;  1MIZ B;  2ZPY A;  1J19 A;  3IVF A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 1HB8 A;  1KC7 A;  2J0J A;  4JKF A;  2HRJ A;  2D11 A;  3EPY A;  2D2Q A;  2R82 A;  1ST7 A;  4JKG A;  2WH5 A;  1HB6 A;  3AU4 A;  3FP5 A;  3ZDT A;  1EF1 A;  1GGO A;  1MIX A;  2J0M A;  1H4R A;  3QIJ A;  3X23 A;  2I1K A;  3SBT A;  4HDQ A;  3E9P A;  2HE7 A;  1VBH A;  4JKB A;  4ZRJ A;  2ABD A;  2J0K A;  4JKG B;  3WA0 A;  5IJM A;  2I1J A;  1HBK A;  1MK9 B;  3SBG A;  3PZD A;  4JKE A;  4P7I A;  2FJ9 A;  3AU5 A;  4JK7 A;  4ILH A;  4JK8 A;  4GXB A;  1VBG A;  5JVL A;  4YL8 A;  4NY0 A;  2FDQ A;  2AL6 A;  3G9W A;  4F7G A;  4JKC A;  1GC7 A;  4HDO A;  1NVL A;  1E5W A;  2CQU A;  1SGH A;  4CYE A;  4DXA B;  1ISN A;  2X0S A;  1GC6 A;  1ACA A;  1JDE A;  3E9L A;  3E9O A;  2YVC A;  2D10 A;  3E66 A;  4ILJ A;  4ZRI A;  4JKD A;  2LBB A;  1DIK A;  2EMS A;  1NTI A;  1MK7 B;  4JK9 A;  1Y19 B;  2EMT A;  2AEH A;  2RQ1 A;  4EKU A;  1NI2 A;  3BIN A;  3ENB A;  3PVL A;  2DIK A;  2COP A;  1KBL A;  3U8Z A;  4TKN A;  3FLV A;  4JKH A;  4ILG B;  4ZRK A;  3U7D A;  4JKA A;  2CB8 A;  1MIZ B;  2ZPY A;  1J19 A;  3IVF A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...