2COPA

Solution structure of rsgi ruh-040, an acbp domain from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
GSSGSSGLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-Coenzyme A binding domain containing 6
publication title Solution structure of RSGI RUH-040, an ACBP domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2copA00
4ZRJA 4YL8A 4HDQA 2EMSA 4EKUA 2AEHA 2J0MA 2D2QA 2J0KA 2J0JA 1HBKA 2FDQA 1Y19B 3AU5A 3FLVA 2RQ1A 1GC6A 3ZDTA 1ACAA 3G9WA 3PZDA 2WH5A 2HE7A 3X23A 3FP5A 1HB8A 3PVLA 2HRJA 1GG3A 3IVFA 2FJ9A 1MK9B 2ZPYA 3U7DA 1NI2A 1SGHA 2I1JA 4DXAB 1MIZB 2D10A 1NVLA 3AU4A 3EPYA 1HB6A 1GC7A 4ZRKA 2CB8A 2LBBA 4HDOA 4P7IA 2EMTA 2CQUA 1H4RA 2ABDA 1MIXA 5IJMA 1EF1A 2YVCA 4ZRIA 4CYEA 1ST7A 2AL6A 1NTIA 3U8ZA 1ISNA 1J19A 2I1KA 3BINA 4F7GA 3QIJA 2D11A 1MK7B 2COPA 3WA0A 4NY0A 1E5WA
chains in the Genus database with same CATH superfamily
4JKAA 4HDQA 2DIKA 3AU5A 1VBHA 2RQ1A 2WH5A 3E66A 4GXBA 3IVFA 2FJ9A 3E9OA 1MIZB 1NVLA 1HB6A 4JKGA 2CQUA 1MIXA 4F7GA 1ST7A 1NTIA 3U8ZA 3BINA 4ILHA 1KC7A 1MK7B 4JKBA 4NY0A 4JKGB 4JKCA 4JKDA 4JK7A 2D2QA 2J0KA 2R82A 1GGOA 3X23A 1VBGA 3PVLA 2I1JA 4DXAB 4ZRKA 2CB8A 3SBTA 1H4RA 1EF1A 4ZRIA 4CYEA 1J19A 1E5WA 4ZRJA 4YL8A 5JVLA 2J0JA 1HBKA 2FDQA 4ILJA 1Y19B 3FLVA 1GC6A 2HE7A 3FP5A 1HB8A 2HRJA 1JDEA 1MK9B 2ZPYA 4TKNA 3U7DA 4JK8A 2D10A 3EPYA 1GC7A 2LBBA 4HDOA 2EMTA 4ILGB 1ACAA 1DIKA 1ISNA 2I1KA 3QIJA 3E9PA 2COPA 3WA0A 3ENBA 2EMSA 4EKUA 2AEHA 2J0MA 3ZDTA 1KBLA 3G9WA 3PZDA 4JKEA 4JKHA 1GG3A 1NI2A 1SGHA 3E9LA 3AU4A 4JK9A 4P7IA 2ABDA 2X0SA 5IJMA 2YVCA 2AL6A 3SBGA 4JKFA 2D11A
chains in the Genus database with same CATH topology
4JKAA 4HDQA 2DIKA 3AU5A 1VBHA 2RQ1A 2WH5A 3E66A 4GXBA 3IVFA 2FJ9A 3E9OA 1MIZB 1NVLA 1HB6A 4JKGA 2CQUA 1MIXA 4F7GA 1ST7A 1NTIA 3U8ZA 3BINA 4ILHA 1KC7A 1MK7B 4JKBA 4NY0A 4JKGB 4JKCA 4JKDA 4JK7A 2D2QA 2J0KA 2R82A 1GGOA 3X23A 1VBGA 3PVLA 2I1JA 4DXAB 4ZRKA 2CB8A 3SBTA 1H4RA 1EF1A 4ZRIA 4CYEA 1J19A 1E5WA 4ZRJA 4YL8A 5JVLA 2J0JA 1HBKA 2FDQA 4ILJA 1Y19B 3FLVA 1GC6A 2HE7A 3FP5A 1HB8A 2HRJA 1JDEA 1MK9B 2ZPYA 4TKNA 3U7DA 4JK8A 2D10A 3EPYA 1GC7A 2LBBA 4HDOA 2EMTA 4ILGB 1ACAA 1DIKA 1ISNA 2I1KA 3QIJA 3E9PA 2COPA 3WA0A 3ENBA 2EMSA 4EKUA 2AEHA 2J0MA 3ZDTA 1KBLA 3G9WA 3PZDA 4JKEA 4JKHA 1GG3A 1NI2A 1SGHA 3E9LA 3AU4A 4JK9A 4P7IA 2ABDA 2X0SA 5IJMA 2YVCA 2AL6A 3SBGA 4JKFA 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  4YL8 A;  4HDQ A;  2EMS A;  4EKU A;  2AEH A;  2J0M A;  2D2Q A;  2J0K A;  2J0J A;  1HBK A;  2FDQ A;  1Y19 B;  3AU5 A;  3FLV A;  2RQ1 A;  1GC6 A;  3ZDT A;  1ACA A;  3G9W A;  3PZD A;  2WH5 A;  2HE7 A;  3X23 A;  3FP5 A;  1HB8 A;  3PVL A;  2HRJ A;  1GG3 A;  3IVF A;  2FJ9 A;  1MK9 B;  2ZPY A;  3U7D A;  1NI2 A;  1SGH A;  2I1J A;  4DXA B;  1MIZ B;  2D10 A;  1NVL A;  3AU4 A;  3EPY A;  1HB6 A;  1GC7 A;  4ZRK A;  2CB8 A;  2LBB A;  4HDO A;  4P7I A;  2EMT A;  2CQU A;  1H4R A;  2ABD A;  1MIX A;  5IJM A;  1EF1 A;  2YVC A;  4ZRI A;  4CYE A;  1ST7 A;  2AL6 A;  1NTI A;  3U8Z A;  1ISN A;  1J19 A;  2I1K A;  3BIN A;  4F7G A;  3QIJ A;  2D11 A;  1MK7 B;  2COP A;  3WA0 A;  4NY0 A;  1E5W A; 
#chains in the Genus database with same CATH topology
 4JKA A;  4HDQ A;  2DIK A;  3AU5 A;  1VBH A;  2RQ1 A;  2WH5 A;  3E66 A;  4GXB A;  3IVF A;  2FJ9 A;  3E9O A;  1MIZ B;  1NVL A;  1HB6 A;  4JKG A;  2CQU A;  1MIX A;  4F7G A;  1ST7 A;  1NTI A;  3U8Z A;  3BIN A;  4ILH A;  1KC7 A;  1MK7 B;  4JKB A;  4NY0 A;  4JKG B;  4JKC A;  4JKD A;  4JK7 A;  2D2Q A;  2J0K A;  2R82 A;  1GGO A;  3X23 A;  1VBG A;  3PVL A;  2I1J A;  4DXA B;  4ZRK A;  2CB8 A;  3SBT A;  1H4R A;  1EF1 A;  4ZRI A;  4CYE A;  1J19 A;  1E5W A;  4ZRJ A;  4YL8 A;  5JVL A;  2J0J A;  1HBK A;  2FDQ A;  4ILJ A;  1Y19 B;  3FLV A;  1GC6 A;  2HE7 A;  3FP5 A;  1HB8 A;  2HRJ A;  1JDE A;  1MK9 B;  2ZPY A;  4TKN A;  3U7D A;  4JK8 A;  2D10 A;  3EPY A;  1GC7 A;  2LBB A;  4HDO A;  2EMT A;  4ILG B;  1ACA A;  1DIK A;  1ISN A;  2I1K A;  3QIJ A;  3E9P A;  2COP A;  3WA0 A;  3ENB A;  2EMS A;  4EKU A;  2AEH A;  2J0M A;  3ZDT A;  1KBL A;  3G9W A;  3PZD A;  4JKE A;  4JKH A;  1GG3 A;  1NI2 A;  1SGH A;  3E9L A;  3AU4 A;  4JK9 A;  4P7I A;  2ABD A;  2X0S A;  5IJM A;  2YVC A;  2AL6 A;  3SBG A;  4JKF A;  2D11 A; 
#chains in the Genus database with same CATH homology
 4JKA A;  4HDQ A;  2DIK A;  3AU5 A;  1VBH A;  2RQ1 A;  2WH5 A;  3E66 A;  4GXB A;  3IVF A;  2FJ9 A;  3E9O A;  1MIZ B;  1NVL A;  1HB6 A;  4JKG A;  2CQU A;  1MIX A;  4F7G A;  1ST7 A;  1NTI A;  3U8Z A;  3BIN A;  4ILH A;  1KC7 A;  1MK7 B;  4JKB A;  4NY0 A;  4JKG B;  4JKC A;  4JKD A;  4JK7 A;  2D2Q A;  2J0K A;  2R82 A;  1GGO A;  3X23 A;  1VBG A;  3PVL A;  2I1J A;  4DXA B;  4ZRK A;  2CB8 A;  3SBT A;  1H4R A;  1EF1 A;  4ZRI A;  4CYE A;  1J19 A;  1E5W A;  4ZRJ A;  4YL8 A;  5JVL A;  2J0J A;  1HBK A;  2FDQ A;  4ILJ A;  1Y19 B;  3FLV A;  1GC6 A;  2HE7 A;  3FP5 A;  1HB8 A;  2HRJ A;  1JDE A;  1MK9 B;  2ZPY A;  4TKN A;  3U7D A;  4JK8 A;  2D10 A;  3EPY A;  1GC7 A;  2LBB A;  4HDO A;  2EMT A;  4ILG B;  1ACA A;  1DIK A;  1ISN A;  2I1K A;  3QIJ A;  3E9P A;  2COP A;  3WA0 A;  3ENB A;  2EMS A;  4EKU A;  2AEH A;  2J0M A;  3ZDT A;  1KBL A;  3G9W A;  3PZD A;  4JKE A;  4JKH A;  1GG3 A;  1NI2 A;  1SGH A;  3E9L A;  3AU4 A;  4JK9 A;  4P7I A;  2ABD A;  2X0S A;  5IJM A;  2YVC A;  2AL6 A;  3SBG A;  4JKF A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...