2WH5A

Crystal structure of human acyl-coa binding domain 4 complexed with stearoyl-coa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
b'QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA-BINDING DOMAIN-CONTAINING PROTEIN 4
molecule tags Lipid binding protein
source organism Homo sapiens
publication title Crystal Structure of Human Acyl-Coa Binding Domain 4
rcsb
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2wh5A00
3X23A 1HB8A 1MK7B 4YL8A 1H4RA 1NTIA 1EF1A 2EMTA 2J0MA 2ZPYA 4ZRIA 1NI2A 1MIXA 2WH5A 3FP5A 3ZDTA 3AU5A 3BINA 4P7IA 2HE7A 4HDOA 1ISNA 2FJ9A 3U8ZA 2AL6A 1E5WA 3AU4A 2D11A 2YVCA 4ZRKA 2RQ1A 1HBKA 2EMSA 3PZDA 1MK9B 4ZRJA 4DXAB 1HB6A 1MIZB 3WA0A 2AEHA 2J0JA 1SGHA 1GC7A 2I1JA 4HDQA 3FLVA 1NVLA 3G9WA 4CYEA 3IVFA 1GC6A 2CQUA 4EKUA 2FDQA 3PVLA 1ST7A 2HRJA 2D10A 1ACAA 2ABDA 1J19A 4NY0A 3U7DA 2CB8A 2D2QA 2I1KA 3QIJA 2LBBA 3EPYA 1GG3A 5IJMA 2J0KA 2COPA 4F7GA 1Y19B
chains in the Genus database with same CATH superfamily
3X23A 1HB8A 3E9LA 4YL8A 4ZRIA 3E66A 3ZDTA 4P7IA 2FJ9A 2AL6A 2R82A 3AU4A 2YVCA 4ILHA 2EMSA 4JKAA 4HDQA 4JKGA 4ILGB 1VBHA 3SBTA 2CQUA 3PVLA 1ST7A 2ABDA 4NY0A 2D2QA 1KC7A 2LBBA 5JVLA 1DIKA 2J0MA 1Y19B 1MK7B 2EMTA 2ZPYA 2WH5A 3AU5A 3U8ZA 4DXAB 3PZDA 1MK9B 2AEHA 1SGHA 2I1JA 4JKDA 1VBGA 3ENBA 4EKUA 4JKHA 4JKGB 2D10A 3QIJA 3E9PA 3EPYA 4TKNA 4JK9A 1H4RA 1NTIA 4ILJA 1NI2A 1MIXA 3FP5A 1KBLA 4HDOA 1E5WA 2D11A 4ZRKA 2RQ1A 4ZRJA 4JKEA 3E9OA 1HB6A 1MIZB 3WA0A 1JDEA 3FLVA 1NVLA 3G9WA 3IVFA 1GC6A 2X0SA 1ACAA 1J19A 2DIKA 4GXBA 2CB8A 2I1KA 5IJMA 3U7DA 3SBGA 1EF1A 4JKBA 3BINA 2HE7A 1ISNA 1HBKA 4JK8A 2J0JA 1GC7A 4JK7A 1GGOA 4CYEA 2FDQA 2HRJA 4JKFA 4JKCA 1GG3A 2J0KA 2COPA 4F7GA
chains in the Genus database with same CATH topology
3X23A 1HB8A 3E9LA 4YL8A 4ZRIA 3E66A 3ZDTA 4P7IA 2FJ9A 2AL6A 2R82A 3AU4A 2YVCA 4ILHA 2EMSA 4JKAA 4HDQA 4JKGA 4ILGB 1VBHA 3SBTA 2CQUA 3PVLA 1ST7A 2ABDA 4NY0A 2D2QA 1KC7A 2LBBA 5JVLA 1DIKA 2J0MA 1Y19B 1MK7B 2EMTA 2ZPYA 2WH5A 3AU5A 3U8ZA 4DXAB 3PZDA 1MK9B 2AEHA 1SGHA 2I1JA 4JKDA 1VBGA 3ENBA 4EKUA 4JKHA 4JKGB 2D10A 3QIJA 3E9PA 3EPYA 4TKNA 4JK9A 1H4RA 1NTIA 4ILJA 1NI2A 1MIXA 3FP5A 1KBLA 4HDOA 1E5WA 2D11A 4ZRKA 2RQ1A 4ZRJA 4JKEA 3E9OA 1HB6A 1MIZB 3WA0A 1JDEA 3FLVA 1NVLA 3G9WA 3IVFA 1GC6A 2X0SA 1ACAA 1J19A 2DIKA 4GXBA 2CB8A 2I1KA 5IJMA 3U7DA 3SBGA 1EF1A 4JKBA 3BINA 2HE7A 1ISNA 1HBKA 4JK8A 2J0JA 1GC7A 4JK7A 1GGOA 4CYEA 2FDQA 2HRJA 4JKFA 4JKCA 1GG3A 2J0KA 2COPA 4F7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  1HB8 A;  1MK7 B;  4YL8 A;  1H4R A;  1NTI A;  1EF1 A;  2EMT A;  2J0M A;  2ZPY A;  4ZRI A;  1NI2 A;  1MIX A;  2WH5 A;  3FP5 A;  3ZDT A;  3AU5 A;  3BIN A;  4P7I A;  2HE7 A;  4HDO A;  1ISN A;  2FJ9 A;  3U8Z A;  2AL6 A;  1E5W A;  3AU4 A;  2D11 A;  2YVC A;  4ZRK A;  2RQ1 A;  1HBK A;  2EMS A;  3PZD A;  1MK9 B;  4ZRJ A;  4DXA B;  1HB6 A;  1MIZ B;  3WA0 A;  2AEH A;  2J0J A;  1SGH A;  1GC7 A;  2I1J A;  4HDQ A;  3FLV A;  1NVL A;  3G9W A;  4CYE A;  3IVF A;  1GC6 A;  2CQU A;  4EKU A;  2FDQ A;  3PVL A;  1ST7 A;  2HRJ A;  2D10 A;  1ACA A;  2ABD A;  1J19 A;  4NY0 A;  3U7D A;  2CB8 A;  2D2Q A;  2I1K A;  3QIJ A;  2LBB A;  3EPY A;  1GG3 A;  5IJM A;  2J0K A;  2COP A;  4F7G A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 3X23 A;  1HB8 A;  3E9L A;  4YL8 A;  4ZRI A;  3E66 A;  3ZDT A;  4P7I A;  2FJ9 A;  2AL6 A;  2R82 A;  3AU4 A;  2YVC A;  4ILH A;  2EMS A;  4JKA A;  4HDQ A;  4JKG A;  4ILG B;  1VBH A;  3SBT A;  2CQU A;  3PVL A;  1ST7 A;  2ABD A;  4NY0 A;  2D2Q A;  1KC7 A;  2LBB A;  5JVL A;  1DIK A;  2J0M A;  1Y19 B;  1MK7 B;  2EMT A;  2ZPY A;  2WH5 A;  3AU5 A;  3U8Z A;  4DXA B;  3PZD A;  1MK9 B;  2AEH A;  1SGH A;  2I1J A;  4JKD A;  1VBG A;  3ENB A;  4EKU A;  4JKH A;  4JKG B;  2D10 A;  3QIJ A;  3E9P A;  3EPY A;  4TKN A;  4JK9 A;  1H4R A;  1NTI A;  4ILJ A;  1NI2 A;  1MIX A;  3FP5 A;  1KBL A;  4HDO A;  1E5W A;  2D11 A;  4ZRK A;  2RQ1 A;  4ZRJ A;  4JKE A;  3E9O A;  1HB6 A;  1MIZ B;  3WA0 A;  1JDE A;  3FLV A;  1NVL A;  3G9W A;  3IVF A;  1GC6 A;  2X0S A;  1ACA A;  1J19 A;  2DIK A;  4GXB A;  2CB8 A;  2I1K A;  5IJM A;  3U7D A;  3SBG A;  1EF1 A;  4JKB A;  3BIN A;  2HE7 A;  1ISN A;  1HBK A;  4JK8 A;  2J0J A;  1GC7 A;  4JK7 A;  1GGO A;  4CYE A;  2FDQ A;  2HRJ A;  4JKF A;  4JKC A;  1GG3 A;  2J0K A;  2COP A;  4F7G A; 
#chains in the Genus database with same CATH homology
 3X23 A;  1HB8 A;  3E9L A;  4YL8 A;  4ZRI A;  3E66 A;  3ZDT A;  4P7I A;  2FJ9 A;  2AL6 A;  2R82 A;  3AU4 A;  2YVC A;  4ILH A;  2EMS A;  4JKA A;  4HDQ A;  4JKG A;  4ILG B;  1VBH A;  3SBT A;  2CQU A;  3PVL A;  1ST7 A;  2ABD A;  4NY0 A;  2D2Q A;  1KC7 A;  2LBB A;  5JVL A;  1DIK A;  2J0M A;  1Y19 B;  1MK7 B;  2EMT A;  2ZPY A;  2WH5 A;  3AU5 A;  3U8Z A;  4DXA B;  3PZD A;  1MK9 B;  2AEH A;  1SGH A;  2I1J A;  4JKD A;  1VBG A;  3ENB A;  4EKU A;  4JKH A;  4JKG B;  2D10 A;  3QIJ A;  3E9P A;  3EPY A;  4TKN A;  4JK9 A;  1H4R A;  1NTI A;  4ILJ A;  1NI2 A;  1MIX A;  3FP5 A;  1KBL A;  4HDO A;  1E5W A;  2D11 A;  4ZRK A;  2RQ1 A;  4ZRJ A;  4JKE A;  3E9O A;  1HB6 A;  1MIZ B;  3WA0 A;  1JDE A;  3FLV A;  1NVL A;  3G9W A;  3IVF A;  1GC6 A;  2X0S A;  1ACA A;  1J19 A;  2DIK A;  4GXB A;  2CB8 A;  2I1K A;  5IJM A;  3U7D A;  3SBG A;  1EF1 A;  4JKB A;  3BIN A;  2HE7 A;  1ISN A;  1HBK A;  4JK8 A;  2J0J A;  1GC7 A;  4JK7 A;  1GGO A;  4CYE A;  2FDQ A;  2HRJ A;  4JKF A;  4JKC A;  1GG3 A;  2J0K A;  2COP A;  4F7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...