2WH5A

Crystal structure of human acyl-coa binding domain 4 complexed with stearoyl-coa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA-BINDING DOMAIN-CONTAINING PROTEIN 4
publication title Crystal Structure of Human Acyl-Coa Binding Domain 4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2wh5A00
3U8ZA 4F7GA 2HRJA 2ABDA 1E5WA 4P7IA 5IJMA 1MK7B 3X23A 4ZRIA 4EKUA 1MIXA 3QIJA 3WA0A 4CYEA 3AU4A 1J19A 1MIZB 2EMSA 2YVCA 4HDOA 4HDQA 4NY0A 1GC7A 3ZDTA 4DXAB 3EPYA 2EMTA 2HE7A 3PZDA 1ACAA 2COPA 3FLVA 1GC6A 1ISNA 2AL6A 2CB8A 1NTIA 2J0KA 4YL8A 2J0MA 2FJ9A 2ZPYA 3BINA 3PVLA 1Y19B 1H4RA 1GG3A 3FP5A 3G9WA 2D10A 3IVFA 2CQUA 1SGHA 3AU5A 2WH5A 1HB6A 1ST7A 3U7DA 1MK9B 1HBKA 2I1JA 2J0JA 4ZRKA 1HB8A 1NI2A 2D11A 2FDQA 2I1KA 2RQ1A 2AEHA 4ZRJA 2D2QA 2LBBA 1EF1A 1NVLA
chains in the Genus database with same CATH superfamily
3U8ZA 2HRJA 4JKGB 5IJMA 4P7IA 1MK7B 4EKUA 4CYEA 3WA0A 3AU4A 2X0SA 4JK7A 2YVCA 4DXAB 2HE7A 3E66A 4JKDA 1NTIA 1Y19B 1JDEA 1VBGA 2D10A 3G9WA 3E9PA 3AU5A 1SGHA 3IVFA 1ST7A 1MK9B 2I1JA 2J0JA 1HB8A 1NI2A 2FDQA 2RQ1A 1EF1A 4F7GA 1KC7A 4ILHA 4ZRIA 1MIXA 1MIZB 1GC7A 1KBLA 2EMTA 3PZDA 3E9OA 3SBTA 3FLVA 4ILJA 4JK9A 1ISNA 2R82A 2FJ9A 3PVLA 2WH5A 3U7DA 1HBKA 4JKEA 4JKCA 2D11A 4GXBA 2LBBA 4TKNA 3ENBA 1E5WA 3X23A 3E9LA 3QIJA 1J19A 4NY0A 4ILGB 4JKHA 4JKGA 5JVLA 2AL6A 4JKAA 2J0KA 1DIKA 3FP5A 1H4RA 1HB6A 2I1KA 2AEHA 2D2QA 1NVLA 2ABDA 4HDOA 2EMSA 4HDQA 3ZDTA 1VBHA 3EPYA 1ACAA 4JKFA 2DIKA 2COPA 4JK8A 1GC6A 3SBGA 1GGOA 2CB8A 4YL8A 2J0MA 2ZPYA 3BINA 1GG3A 2CQUA 4ZRKA 4JKBA 4ZRJA
chains in the Genus database with same CATH topology
3U8ZA 2HRJA 4JKGB 5IJMA 4P7IA 1MK7B 4EKUA 4CYEA 3WA0A 3AU4A 2X0SA 4JK7A 2YVCA 4DXAB 2HE7A 3E66A 4JKDA 1NTIA 1Y19B 1JDEA 1VBGA 2D10A 3G9WA 3E9PA 3AU5A 1SGHA 3IVFA 1ST7A 1MK9B 2I1JA 2J0JA 1HB8A 1NI2A 2FDQA 2RQ1A 1EF1A 4F7GA 1KC7A 4ILHA 4ZRIA 1MIXA 1MIZB 1GC7A 1KBLA 2EMTA 3PZDA 3E9OA 3SBTA 3FLVA 4ILJA 4JK9A 1ISNA 2R82A 2FJ9A 3PVLA 2WH5A 3U7DA 1HBKA 4JKEA 4JKCA 2D11A 4GXBA 2LBBA 4TKNA 3ENBA 1E5WA 3X23A 3E9LA 3QIJA 1J19A 4NY0A 4ILGB 4JKHA 4JKGA 5JVLA 2AL6A 4JKAA 2J0KA 1DIKA 3FP5A 1H4RA 1HB6A 2I1KA 2AEHA 2D2QA 1NVLA 2ABDA 4HDOA 2EMSA 4HDQA 3ZDTA 1VBHA 3EPYA 1ACAA 4JKFA 2DIKA 2COPA 4JK8A 1GC6A 3SBGA 1GGOA 2CB8A 4YL8A 2J0MA 2ZPYA 3BINA 1GG3A 2CQUA 4ZRKA 4JKBA 4ZRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8Z A;  4F7G A;  2HRJ A;  2ABD A;  1E5W A;  4P7I A;  5IJM A;  1MK7 B;  3X23 A;  4ZRI A;  4EKU A;  1MIX A;  3QIJ A;  3WA0 A;  4CYE A;  3AU4 A;  1J19 A;  1MIZ B;  2EMS A;  2YVC A;  4HDO A;  4HDQ A;  4NY0 A;  1GC7 A;  3ZDT A;  4DXA B;  3EPY A;  2EMT A;  2HE7 A;  3PZD A;  1ACA A;  2COP A;  3FLV A;  1GC6 A;  1ISN A;  2AL6 A;  2CB8 A;  1NTI A;  2J0K A;  4YL8 A;  2J0M A;  2FJ9 A;  2ZPY A;  3BIN A;  3PVL A;  1Y19 B;  1H4R A;  1GG3 A;  3FP5 A;  3G9W A;  2D10 A;  3IVF A;  2CQU A;  1SGH A;  3AU5 A;  2WH5 A;  1HB6 A;  1ST7 A;  3U7D A;  1MK9 B;  1HBK A;  2I1J A;  2J0J A;  4ZRK A;  1HB8 A;  1NI2 A;  2D11 A;  2FDQ A;  2I1K A;  2RQ1 A;  2AEH A;  4ZRJ A;  2D2Q A;  2LBB A;  1EF1 A;  1NVL A; 
#chains in the Genus database with same CATH topology
 3U8Z A;  2HRJ A;  4JKG B;  5IJM A;  4P7I A;  1MK7 B;  4EKU A;  4CYE A;  3WA0 A;  3AU4 A;  2X0S A;  4JK7 A;  2YVC A;  4DXA B;  2HE7 A;  3E66 A;  4JKD A;  1NTI A;  1Y19 B;  1JDE A;  1VBG A;  2D10 A;  3G9W A;  3E9P A;  3AU5 A;  1SGH A;  3IVF A;  1ST7 A;  1MK9 B;  2I1J A;  2J0J A;  1HB8 A;  1NI2 A;  2FDQ A;  2RQ1 A;  1EF1 A;  4F7G A;  1KC7 A;  4ILH A;  4ZRI A;  1MIX A;  1MIZ B;  1GC7 A;  1KBL A;  2EMT A;  3PZD A;  3E9O A;  3SBT A;  3FLV A;  4ILJ A;  4JK9 A;  1ISN A;  2R82 A;  2FJ9 A;  3PVL A;  2WH5 A;  3U7D A;  1HBK A;  4JKE A;  4JKC A;  2D11 A;  4GXB A;  2LBB A;  4TKN A;  3ENB A;  1E5W A;  3X23 A;  3E9L A;  3QIJ A;  1J19 A;  4NY0 A;  4ILG B;  4JKH A;  4JKG A;  5JVL A;  2AL6 A;  4JKA A;  2J0K A;  1DIK A;  3FP5 A;  1H4R A;  1HB6 A;  2I1K A;  2AEH A;  2D2Q A;  1NVL A;  2ABD A;  4HDO A;  2EMS A;  4HDQ A;  3ZDT A;  1VBH A;  3EPY A;  1ACA A;  4JKF A;  2DIK A;  2COP A;  4JK8 A;  1GC6 A;  3SBG A;  1GGO A;  2CB8 A;  4YL8 A;  2J0M A;  2ZPY A;  3BIN A;  1GG3 A;  2CQU A;  4ZRK A;  4JKB A;  4ZRJ A; 
#chains in the Genus database with same CATH homology
 3U8Z A;  2HRJ A;  4JKG B;  5IJM A;  4P7I A;  1MK7 B;  4EKU A;  4CYE A;  3WA0 A;  3AU4 A;  2X0S A;  4JK7 A;  2YVC A;  4DXA B;  2HE7 A;  3E66 A;  4JKD A;  1NTI A;  1Y19 B;  1JDE A;  1VBG A;  2D10 A;  3G9W A;  3E9P A;  3AU5 A;  1SGH A;  3IVF A;  1ST7 A;  1MK9 B;  2I1J A;  2J0J A;  1HB8 A;  1NI2 A;  2FDQ A;  2RQ1 A;  1EF1 A;  4F7G A;  1KC7 A;  4ILH A;  4ZRI A;  1MIX A;  1MIZ B;  1GC7 A;  1KBL A;  2EMT A;  3PZD A;  3E9O A;  3SBT A;  3FLV A;  4ILJ A;  4JK9 A;  1ISN A;  2R82 A;  2FJ9 A;  3PVL A;  2WH5 A;  3U7D A;  1HBK A;  4JKE A;  4JKC A;  2D11 A;  4GXB A;  2LBB A;  4TKN A;  3ENB A;  1E5W A;  3X23 A;  3E9L A;  3QIJ A;  1J19 A;  4NY0 A;  4ILG B;  4JKH A;  4JKG A;  5JVL A;  2AL6 A;  4JKA A;  2J0K A;  1DIK A;  3FP5 A;  1H4R A;  1HB6 A;  2I1K A;  2AEH A;  2D2Q A;  1NVL A;  2ABD A;  4HDO A;  2EMS A;  4HDQ A;  3ZDT A;  1VBH A;  3EPY A;  1ACA A;  4JKF A;  2DIK A;  2COP A;  4JK8 A;  1GC6 A;  3SBG A;  1GGO A;  2CB8 A;  4YL8 A;  2J0M A;  2ZPY A;  3BIN A;  1GG3 A;  2CQU A;  4ZRK A;  4JKB A;  4ZRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...