2WH5A

Crystal structure of human acyl-coa binding domain 4 complexed with stearoyl-coa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords ACYL-COA-BINDING DOMAIN-CONTAINING PROTEIN 4
publication title Crystal Structure of Human Acyl-Coa Binding Domain 4
rcsb
source organism Homo sapiens
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2wh5A00
2HE7A 3AU5A 2AL6A 2D10A 2HRJA 4HDOA 4DXAB 2J0JA 1SGHA 2EMSA 1GC6A 3X23A 4EKUA 4ZRJA 1ACAA 2AEHA 2I1JA 2COPA 1MIZB 2LBBA 3WA0A 2D2QA 3QIJA 4YL8A 1Y19B 2CB8A 1GC7A 2ZPYA 2J0KA 2FDQA 1GG3A 1E5WA 1H4RA 3FLVA 3BINA 4ZRIA 4ZRKA 1EF1A 1HB6A 4P7IA 2FJ9A 2RQ1A 2EMTA 3U8ZA 5IJMA 3ZDTA 1ISNA 3FP5A 1MIXA 1MK7B 3IVFA 4HDQA 4CYEA 3EPYA 1J19A 2I1KA 3PZDA 4F7GA 1NVLA 1NI2A 2ABDA 1NTIA 4NY0A 1MK9B 2J0MA 3G9WA 2CQUA 1ST7A 2WH5A 2YVCA 3AU4A 2D11A 3PVLA 3U7DA 1HBKA 1HB8A
chains in the Genus database with same CATH superfamily
2HE7A 2D10A 1SGHA 3E9OA 4EKUA 2AEHA 1MIZB 1VBHA 1JDEA 3QIJA 3SBGA 2CB8A 2ZPYA 4JKAA 2FDQA 1KBLA 1H4RA 4ZRIA 1EF1A 4P7IA 3EPYA 4ILHA 1DIKA 1NTIA 1GGOA 3PVLA 2CQUA 3AU4A 1HBKA 4JKGA 2HRJA 4DXAB 2J0JA 1ACAA 1GC6A 4JKHA 4JK8A 2D2QA 4ILJA 4GXBA 1KC7A 4JKCA 3U8ZA 5IJMA 2RQ1A 2EMTA 4JK9A 1ISNA 3FP5A 1MK7B 4HDQA 1J19A 4F7GA 1NI2A 2ABDA 1ST7A 3E66A 1HB8A 3AU5A 4HDOA 2EMSA 2R82A 2COPA 2LBBA 3WA0A 2X0SA 4YL8A 2J0KA 3E9PA 4JKBA 1E5WA 3FLVA 3BINA 1HB6A 3SBTA 2FJ9A 4JK7A 5JVLA 1MIXA 3IVFA 2I1KA 2WH5A 2D11A 4JKFA 3U7DA 4TKNA 2AL6A 3X23A 4ZRJA 2I1JA 1VBGA 1Y19B 1GC7A 2DIKA 1GG3A 4JKGB 4ZRKA 3ZDTA 4CYEA 3E9LA 4ILGB 3PZDA 1NVLA 3ENBA 4JKEA 4NY0A 1MK9B 2J0MA 3G9WA 2YVCA 4JKDA
chains in the Genus database with same CATH topology
2HE7A 2D10A 1SGHA 3E9OA 4EKUA 2AEHA 1MIZB 1VBHA 1JDEA 3QIJA 3SBGA 2CB8A 2ZPYA 4JKAA 2FDQA 1KBLA 1H4RA 4ZRIA 1EF1A 4P7IA 3EPYA 4ILHA 1DIKA 1NTIA 1GGOA 3PVLA 2CQUA 3AU4A 1HBKA 4JKGA 2HRJA 4DXAB 2J0JA 1ACAA 1GC6A 4JKHA 4JK8A 2D2QA 4ILJA 4GXBA 1KC7A 4JKCA 3U8ZA 5IJMA 2RQ1A 2EMTA 4JK9A 1ISNA 3FP5A 1MK7B 4HDQA 1J19A 4F7GA 1NI2A 2ABDA 1ST7A 3E66A 1HB8A 3AU5A 4HDOA 2EMSA 2R82A 2COPA 2LBBA 3WA0A 2X0SA 4YL8A 2J0KA 3E9PA 4JKBA 1E5WA 3FLVA 3BINA 1HB6A 3SBTA 2FJ9A 4JK7A 5JVLA 1MIXA 3IVFA 2I1KA 2WH5A 2D11A 4JKFA 3U7DA 4TKNA 2AL6A 3X23A 4ZRJA 2I1JA 1VBGA 1Y19B 1GC7A 2DIKA 1GG3A 4JKGB 4ZRKA 3ZDTA 4CYEA 3E9LA 4ILGB 3PZDA 1NVLA 3ENBA 4JKEA 4NY0A 1MK9B 2J0MA 3G9WA 2YVCA 4JKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE7 A;  3AU5 A;  2AL6 A;  2D10 A;  2HRJ A;  4HDO A;  4DXA B;  2J0J A;  1SGH A;  2EMS A;  1GC6 A;  3X23 A;  4EKU A;  4ZRJ A;  1ACA A;  2AEH A;  2I1J A;  2COP A;  1MIZ B;  2LBB A;  3WA0 A;  2D2Q A;  3QIJ A;  4YL8 A;  1Y19 B;  2CB8 A;  1GC7 A;  2ZPY A;  2J0K A;  2FDQ A;  1GG3 A;  1E5W A;  1H4R A;  3FLV A;  3BIN A;  4ZRI A;  4ZRK A;  1EF1 A;  1HB6 A;  4P7I A;  2FJ9 A;  2RQ1 A;  2EMT A;  3U8Z A;  5IJM A;  3ZDT A;  1ISN A;  3FP5 A;  1MIX A;  1MK7 B;  3IVF A;  4HDQ A;  4CYE A;  3EPY A;  1J19 A;  2I1K A;  3PZD A;  4F7G A;  1NVL A;  1NI2 A;  2ABD A;  1NTI A;  4NY0 A;  1MK9 B;  2J0M A;  3G9W A;  2CQU A;  1ST7 A;  2WH5 A;  2YVC A;  3AU4 A;  2D11 A;  3PVL A;  3U7D A;  1HBK A;  1HB8 A; 
#chains in the Genus database with same CATH topology
 2HE7 A;  2D10 A;  1SGH A;  3E9O A;  4EKU A;  2AEH A;  1MIZ B;  1VBH A;  1JDE A;  3QIJ A;  3SBG A;  2CB8 A;  2ZPY A;  4JKA A;  2FDQ A;  1KBL A;  1H4R A;  4ZRI A;  1EF1 A;  4P7I A;  3EPY A;  4ILH A;  1DIK A;  1NTI A;  1GGO A;  3PVL A;  2CQU A;  3AU4 A;  1HBK A;  4JKG A;  2HRJ A;  4DXA B;  2J0J A;  1ACA A;  1GC6 A;  4JKH A;  4JK8 A;  2D2Q A;  4ILJ A;  4GXB A;  1KC7 A;  4JKC A;  3U8Z A;  5IJM A;  2RQ1 A;  2EMT A;  4JK9 A;  1ISN A;  3FP5 A;  1MK7 B;  4HDQ A;  1J19 A;  4F7G A;  1NI2 A;  2ABD A;  1ST7 A;  3E66 A;  1HB8 A;  3AU5 A;  4HDO A;  2EMS A;  2R82 A;  2COP A;  2LBB A;  3WA0 A;  2X0S A;  4YL8 A;  2J0K A;  3E9P A;  4JKB A;  1E5W A;  3FLV A;  3BIN A;  1HB6 A;  3SBT A;  2FJ9 A;  4JK7 A;  5JVL A;  1MIX A;  3IVF A;  2I1K A;  2WH5 A;  2D11 A;  4JKF A;  3U7D A;  4TKN A;  2AL6 A;  3X23 A;  4ZRJ A;  2I1J A;  1VBG A;  1Y19 B;  1GC7 A;  2DIK A;  1GG3 A;  4JKG B;  4ZRK A;  3ZDT A;  4CYE A;  3E9L A;  4ILG B;  3PZD A;  1NVL A;  3ENB A;  4JKE A;  4NY0 A;  1MK9 B;  2J0M A;  3G9W A;  2YVC A;  4JKD A; 
#chains in the Genus database with same CATH homology
 2HE7 A;  2D10 A;  1SGH A;  3E9O A;  4EKU A;  2AEH A;  1MIZ B;  1VBH A;  1JDE A;  3QIJ A;  3SBG A;  2CB8 A;  2ZPY A;  4JKA A;  2FDQ A;  1KBL A;  1H4R A;  4ZRI A;  1EF1 A;  4P7I A;  3EPY A;  4ILH A;  1DIK A;  1NTI A;  1GGO A;  3PVL A;  2CQU A;  3AU4 A;  1HBK A;  4JKG A;  2HRJ A;  4DXA B;  2J0J A;  1ACA A;  1GC6 A;  4JKH A;  4JK8 A;  2D2Q A;  4ILJ A;  4GXB A;  1KC7 A;  4JKC A;  3U8Z A;  5IJM A;  2RQ1 A;  2EMT A;  4JK9 A;  1ISN A;  3FP5 A;  1MK7 B;  4HDQ A;  1J19 A;  4F7G A;  1NI2 A;  2ABD A;  1ST7 A;  3E66 A;  1HB8 A;  3AU5 A;  4HDO A;  2EMS A;  2R82 A;  2COP A;  2LBB A;  3WA0 A;  2X0S A;  4YL8 A;  2J0K A;  3E9P A;  4JKB A;  1E5W A;  3FLV A;  3BIN A;  1HB6 A;  3SBT A;  2FJ9 A;  4JK7 A;  5JVL A;  1MIX A;  3IVF A;  2I1K A;  2WH5 A;  2D11 A;  4JKF A;  3U7D A;  4TKN A;  2AL6 A;  3X23 A;  4ZRJ A;  2I1J A;  1VBG A;  1Y19 B;  1GC7 A;  2DIK A;  1GG3 A;  4JKG B;  4ZRK A;  3ZDT A;  4CYE A;  3E9L A;  4ILG B;  3PZD A;  1NVL A;  3ENB A;  4JKE A;  4NY0 A;  1MK9 B;  2J0M A;  3G9W A;  2YVC A;  4JKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...