2WH5A

Crystal structure of human acyl-coa binding domain 4 complexed with stearoyl-coa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Acyl-Coa Binding Domain 4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords ACYL-COA-BINDING DOMAIN-CONTAINING PROTEIN 4
total genus 33
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2wh5A00
2ABDA 3QIJA 2LBBA 2CQUA 2WH5A 2D10A 1HB8A 4YL8A 2CB8A 4ZRKA 1MK7B 3EPYA 1J19A 2HE7A 3PVLA 2RQ1A 2FDQA 1NVLA 2YVCA 1HB6A 1NTIA 1GC7A 2J0MA 2J0JA 3WA0A 5IJMA 1MIXA 2AL6A 4ZRJA 1HBKA 1ISNA 3U7DA 2D2QA 2AEHA 1E5WA 2D11A 3AU5A 2COPA 3FP5A 2FJ9A 4CYEA 3X23A 4DXAB 4ZRIA 4EKUA 3FLVA 1SGHA 3U8ZA 3AU4A 3ZDTA 1H4RA 4F7GA 1Y19B 4HDOA 3BINA 2EMSA 3PZDA 4HDQA 2HRJA 1MIZB 4P7IA 1ACAA 3G9WA 2J0KA 2I1KA 3IVFA 2ZPYA 2EMTA 1NI2A 1ST7A 2I1JA 1MK9B 4NY0A 1GG3A 1EF1A 1GC6A
chains in the Genus database with same CATH superfamily
1KC7A 2ABDA 4YL8A 2WH5A 2D10A 1J19A 2HE7A 4JKFA 2DIKA 2D2QA 2AEHA 4CYEA 3ENBA 4GXBA 1H4RA 1GGOA 4ILHA 3PZDA 4ILJA 1VBGA 1MIZB 2ZPYA 1GC6A 4JKCA 3QIJA 2CQUA 4ZRKA 2CB8A 1MK7B 1KBLA 3EPYA 4JKDA 5JVLA 2RQ1A 1HB6A 1NTIA 2J0MA 2J0JA 3WA0A 5IJMA 1MIXA 2AL6A 1ISNA 3U7DA 4DXAB 4JKGB 4EKUA 3AU4A 4HDOA 4JKEA 1DIKA 2HRJA 3E9PA 1ACAA 3G9WA 4NY0A 1GG3A 1EF1A 3E66A 2LBBA 1HB8A 3SBTA 1JDEA 3PVLA 2FDQA 2X0SA 1GC7A 4JKHA 4JKGA 3SBGA 1HBKA 4JK7A 3AU5A 2FJ9A 3X23A 4ZRIA 1Y19B 2EMSA 4JK8A 4P7IA 2I1KA 2EMTA 1ST7A 1MK9B 3ZDTA 4ILGB 1VBHA 1NVLA 2YVCA 4JKAA 4ZRJA 1E5WA 2D11A 3FP5A 2COPA 3FLVA 3E9OA 1SGHA 4TKNA 3U8ZA 4F7GA 3BINA 4JKBA 4HDQA 2R82A 3IVFA 2J0KA 1NI2A 2I1JA 4JK9A 3E9LA
chains in the Genus database with same CATH topology
1KC7A 2ABDA 4YL8A 2WH5A 2D10A 1J19A 2HE7A 4JKFA 2DIKA 2D2QA 2AEHA 4CYEA 3ENBA 4GXBA 1H4RA 1GGOA 4ILHA 3PZDA 4ILJA 1VBGA 1MIZB 2ZPYA 1GC6A 4JKCA 3QIJA 2CQUA 4ZRKA 2CB8A 1MK7B 1KBLA 3EPYA 4JKDA 5JVLA 2RQ1A 1HB6A 1NTIA 2J0MA 2J0JA 3WA0A 5IJMA 1MIXA 2AL6A 1ISNA 3U7DA 4DXAB 4JKGB 4EKUA 3AU4A 4HDOA 4JKEA 1DIKA 2HRJA 3E9PA 1ACAA 3G9WA 4NY0A 1GG3A 1EF1A 3E66A 2LBBA 1HB8A 3SBTA 1JDEA 3PVLA 2FDQA 2X0SA 1GC7A 4JKHA 4JKGA 3SBGA 1HBKA 4JK7A 3AU5A 2FJ9A 3X23A 4ZRIA 1Y19B 2EMSA 4JK8A 4P7IA 2I1KA 2EMTA 1ST7A 1MK9B 3ZDTA 4ILGB 1VBHA 1NVLA 2YVCA 4JKAA 4ZRJA 1E5WA 2D11A 3FP5A 2COPA 3FLVA 3E9OA 1SGHA 4TKNA 3U8ZA 4F7GA 3BINA 4JKBA 4HDQA 2R82A 3IVFA 2J0KA 1NI2A 2I1JA 4JK9A 3E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABD A;  3QIJ A;  2LBB A;  2CQU A;  2WH5 A;  2D10 A;  1HB8 A;  4YL8 A;  2CB8 A;  4ZRK A;  1MK7 B;  3EPY A;  1J19 A;  2HE7 A;  3PVL A;  2RQ1 A;  2FDQ A;  1NVL A;  2YVC A;  1HB6 A;  1NTI A;  1GC7 A;  2J0M A;  2J0J A;  3WA0 A;  5IJM A;  1MIX A;  2AL6 A;  4ZRJ A;  1HBK A;  1ISN A;  3U7D A;  2D2Q A;  2AEH A;  1E5W A;  2D11 A;  3AU5 A;  2COP A;  3FP5 A;  2FJ9 A;  4CYE A;  3X23 A;  4DXA B;  4ZRI A;  4EKU A;  3FLV A;  1SGH A;  3U8Z A;  3AU4 A;  3ZDT A;  1H4R A;  4F7G A;  1Y19 B;  4HDO A;  3BIN A;  2EMS A;  3PZD A;  4HDQ A;  2HRJ A;  1MIZ B;  4P7I A;  1ACA A;  3G9W A;  2J0K A;  2I1K A;  3IVF A;  2ZPY A;  2EMT A;  1NI2 A;  1ST7 A;  2I1J A;  1MK9 B;  4NY0 A;  1GG3 A;  1EF1 A;  1GC6 A; 
#chains in the Genus database with same CATH topology
 1KC7 A;  2ABD A;  4YL8 A;  2WH5 A;  2D10 A;  1J19 A;  2HE7 A;  4JKF A;  2DIK A;  2D2Q A;  2AEH A;  4CYE A;  3ENB A;  4GXB A;  1H4R A;  1GGO A;  4ILH A;  3PZD A;  4ILJ A;  1VBG A;  1MIZ B;  2ZPY A;  1GC6 A;  4JKC A;  3QIJ A;  2CQU A;  4ZRK A;  2CB8 A;  1MK7 B;  1KBL A;  3EPY A;  4JKD A;  5JVL A;  2RQ1 A;  1HB6 A;  1NTI A;  2J0M A;  2J0J A;  3WA0 A;  5IJM A;  1MIX A;  2AL6 A;  1ISN A;  3U7D A;  4DXA B;  4JKG B;  4EKU A;  3AU4 A;  4HDO A;  4JKE A;  1DIK A;  2HRJ A;  3E9P A;  1ACA A;  3G9W A;  4NY0 A;  1GG3 A;  1EF1 A;  3E66 A;  2LBB A;  1HB8 A;  3SBT A;  1JDE A;  3PVL A;  2FDQ A;  2X0S A;  1GC7 A;  4JKH A;  4JKG A;  3SBG A;  1HBK A;  4JK7 A;  3AU5 A;  2FJ9 A;  3X23 A;  4ZRI A;  1Y19 B;  2EMS A;  4JK8 A;  4P7I A;  2I1K A;  2EMT A;  1ST7 A;  1MK9 B;  3ZDT A;  4ILG B;  1VBH A;  1NVL A;  2YVC A;  4JKA A;  4ZRJ A;  1E5W A;  2D11 A;  3FP5 A;  2COP A;  3FLV A;  3E9O A;  1SGH A;  4TKN A;  3U8Z A;  4F7G A;  3BIN A;  4JKB A;  4HDQ A;  2R82 A;  3IVF A;  2J0K A;  1NI2 A;  2I1J A;  4JK9 A;  3E9L A; 
#chains in the Genus database with same CATH homology
 1KC7 A;  2ABD A;  4YL8 A;  2WH5 A;  2D10 A;  1J19 A;  2HE7 A;  4JKF A;  2DIK A;  2D2Q A;  2AEH A;  4CYE A;  3ENB A;  4GXB A;  1H4R A;  1GGO A;  4ILH A;  3PZD A;  4ILJ A;  1VBG A;  1MIZ B;  2ZPY A;  1GC6 A;  4JKC A;  3QIJ A;  2CQU A;  4ZRK A;  2CB8 A;  1MK7 B;  1KBL A;  3EPY A;  4JKD A;  5JVL A;  2RQ1 A;  1HB6 A;  1NTI A;  2J0M A;  2J0J A;  3WA0 A;  5IJM A;  1MIX A;  2AL6 A;  1ISN A;  3U7D A;  4DXA B;  4JKG B;  4EKU A;  3AU4 A;  4HDO A;  4JKE A;  1DIK A;  2HRJ A;  3E9P A;  1ACA A;  3G9W A;  4NY0 A;  1GG3 A;  1EF1 A;  3E66 A;  2LBB A;  1HB8 A;  3SBT A;  1JDE A;  3PVL A;  2FDQ A;  2X0S A;  1GC7 A;  4JKH A;  4JKG A;  3SBG A;  1HBK A;  4JK7 A;  3AU5 A;  2FJ9 A;  3X23 A;  4ZRI A;  1Y19 B;  2EMS A;  4JK8 A;  4P7I A;  2I1K A;  2EMT A;  1ST7 A;  1MK9 B;  3ZDT A;  4ILG B;  1VBH A;  1NVL A;  2YVC A;  4JKA A;  4ZRJ A;  1E5W A;  2D11 A;  3FP5 A;  2COP A;  3FLV A;  3E9O A;  1SGH A;  4TKN A;  3U8Z A;  4F7G A;  3BIN A;  4JKB A;  4HDQ A;  2R82 A;  3IVF A;  2J0K A;  1NI2 A;  2I1J A;  4JK9 A;  3E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...