2RQ1A

Solution structure of the 4.1r ferm alpha lobe domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
b'GSHMDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein 4.1
publication title Solution structure and glycophorin C binding studies of the protein 4.1R FERM alpha-lobe domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2rq1A00
2CQUA 1HB8A 2D2QA 3EPYA 3PVLA 1MK9B 2AEHA 1GC7A 2EMSA 1GC6A 2LBBA 3U7DA 3X23A 1NTIA 4EKUA 4P7IA 2AL6A 2FJ9A 1GG3A 1MIZB 1MIXA 2ABDA 2D10A 2J0KA 1H4RA 3PZDA 3QIJA 4HDQA 3WA0A 4DXAB 4F7GA 3AU4A 1HBKA 3FLVA 2HRJA 4ZRIA 1NI2A 4YL8A 1EF1A 2J0JA 1ST7A 3BINA 1HB6A 1MK7B 3G9WA 2FDQA 2WH5A 4ZRKA 1Y19B 2J0MA 3IVFA 3AU5A 2ZPYA 1ISNA 3FP5A 4NY0A 2EMTA 2CB8A 4CYEA 5IJMA 4HDOA 3ZDTA 2COPA 2HE7A 1NVLA 3U8ZA 2I1KA 2YVCA 2RQ1A 2I1JA 1ACAA 1E5WA 2D11A 1J19A 1SGHA 4ZRJA
chains in the Genus database with same CATH superfamily
1HB8A 2D2QA 1MK9B 4ILJA 3X23A 4P7IA 2FJ9A 1MIZB 4HDQA 1KBLA 3QIJA 1HBKA 3FLVA 2HRJA 1NI2A 1EF1A 1KC7A 1ST7A 4JKDA 2J0MA 2CB8A 4HDOA 4JKGA 2COPA 2HE7A 2I1KA 1VBGA 3PVLA 3U7DA 4JKEA 2AL6A 1MIXA 2ABDA 3PZDA 4F7GA 4ILHA 2J0JA 3BINA 3G9WA 1Y19B 4NY0A 2ZPYA 1ISNA 4JK9A 4JKFA 4CYEA 5IJMA 4TKNA 4JKCA 4JK8A 5JVLA 2RQ1A 1J19A 4ZRJA 2CQUA 3EPYA 2AEHA 1GC7A 2EMSA 1GC6A 2DIKA 1GG3A 1JDEA 3WA0A 3AU4A 4GXBA 3SBGA 4ZRIA 1GGOA 1MK7B 4JK7A 3AU5A 2YVCA 2I1JA 1SGHA 3ENBA 3E9PA 2R82A 2LBBA 1NTIA 4EKUA 2X0SA 4JKAA 2D10A 2J0KA 4DXAB 1H4RA 4JKBA 3E66A 4YL8A 1HB6A 1VBHA 2FDQA 1DIKA 2WH5A 4ZRKA 3IVFA 2EMTA 4JKHA 4ILGB 3ZDTA 4JKGB 3SBTA 1NVLA 3U8ZA 3E9OA 3E9LA 1ACAA 1E5WA 2D11A 3FP5A
chains in the Genus database with same CATH topology
1HB8A 2D2QA 1MK9B 4ILJA 3X23A 4P7IA 2FJ9A 1MIZB 4HDQA 1KBLA 3QIJA 1HBKA 3FLVA 2HRJA 1NI2A 1EF1A 1KC7A 1ST7A 4JKDA 2J0MA 2CB8A 4HDOA 4JKGA 2COPA 2HE7A 2I1KA 1VBGA 3PVLA 3U7DA 4JKEA 2AL6A 1MIXA 2ABDA 3PZDA 4F7GA 4ILHA 2J0JA 3BINA 3G9WA 1Y19B 4NY0A 2ZPYA 1ISNA 4JK9A 4JKFA 4CYEA 5IJMA 4TKNA 4JKCA 4JK8A 5JVLA 2RQ1A 1J19A 4ZRJA 2CQUA 3EPYA 2AEHA 1GC7A 2EMSA 1GC6A 2DIKA 1GG3A 1JDEA 3WA0A 3AU4A 4GXBA 3SBGA 4ZRIA 1GGOA 1MK7B 4JK7A 3AU5A 2YVCA 2I1JA 1SGHA 3ENBA 3E9PA 2R82A 2LBBA 1NTIA 4EKUA 2X0SA 4JKAA 2D10A 2J0KA 4DXAB 1H4RA 4JKBA 3E66A 4YL8A 1HB6A 1VBHA 2FDQA 1DIKA 2WH5A 4ZRKA 3IVFA 2EMTA 4JKHA 4ILGB 3ZDTA 4JKGB 3SBTA 1NVLA 3U8ZA 3E9OA 3E9LA 1ACAA 1E5WA 2D11A 3FP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQU A;  1HB8 A;  2D2Q A;  3EPY A;  3PVL A;  1MK9 B;  2AEH A;  1GC7 A;  2EMS A;  1GC6 A;  2LBB A;  3U7D A;  3X23 A;  1NTI A;  4EKU A;  4P7I A;  2AL6 A;  2FJ9 A;  1GG3 A;  1MIZ B;  1MIX A;  2ABD A;  2D10 A;  2J0K A;  1H4R A;  3PZD A;  3QIJ A;  4HDQ A;  3WA0 A;  4DXA B;  4F7G A;  3AU4 A;  1HBK A;  3FLV A;  2HRJ A;  4ZRI A;  1NI2 A;  4YL8 A;  1EF1 A;  2J0J A;  1ST7 A;  3BIN A;  1HB6 A;  1MK7 B;  3G9W A;  2FDQ A;  2WH5 A;  4ZRK A;  1Y19 B;  2J0M A;  3IVF A;  3AU5 A;  2ZPY A;  1ISN A;  3FP5 A;  4NY0 A;  2EMT A;  2CB8 A;  4CYE A;  5IJM A;  4HDO A;  3ZDT A;  2COP A;  2HE7 A;  1NVL A;  3U8Z A;  2I1K A;  2YVC A;  2RQ1 A;  2I1J A;  1ACA A;  1E5W A;  2D11 A;  1J19 A;  1SGH A;  4ZRJ A; 
#chains in the Genus database with same CATH topology
 1HB8 A;  2D2Q A;  1MK9 B;  4ILJ A;  3X23 A;  4P7I A;  2FJ9 A;  1MIZ B;  4HDQ A;  1KBL A;  3QIJ A;  1HBK A;  3FLV A;  2HRJ A;  1NI2 A;  1EF1 A;  1KC7 A;  1ST7 A;  4JKD A;  2J0M A;  2CB8 A;  4HDO A;  4JKG A;  2COP A;  2HE7 A;  2I1K A;  1VBG A;  3PVL A;  3U7D A;  4JKE A;  2AL6 A;  1MIX A;  2ABD A;  3PZD A;  4F7G A;  4ILH A;  2J0J A;  3BIN A;  3G9W A;  1Y19 B;  4NY0 A;  2ZPY A;  1ISN A;  4JK9 A;  4JKF A;  4CYE A;  5IJM A;  4TKN A;  4JKC A;  4JK8 A;  5JVL A;  2RQ1 A;  1J19 A;  4ZRJ A;  2CQU A;  3EPY A;  2AEH A;  1GC7 A;  2EMS A;  1GC6 A;  2DIK A;  1GG3 A;  1JDE A;  3WA0 A;  3AU4 A;  4GXB A;  3SBG A;  4ZRI A;  1GGO A;  1MK7 B;  4JK7 A;  3AU5 A;  2YVC A;  2I1J A;  1SGH A;  3ENB A;  3E9P A;  2R82 A;  2LBB A;  1NTI A;  4EKU A;  2X0S A;  4JKA A;  2D10 A;  2J0K A;  4DXA B;  1H4R A;  4JKB A;  3E66 A;  4YL8 A;  1HB6 A;  1VBH A;  2FDQ A;  1DIK A;  2WH5 A;  4ZRK A;  3IVF A;  2EMT A;  4JKH A;  4ILG B;  3ZDT A;  4JKG B;  3SBT A;  1NVL A;  3U8Z A;  3E9O A;  3E9L A;  1ACA A;  1E5W A;  2D11 A;  3FP5 A; 
#chains in the Genus database with same CATH homology
 1HB8 A;  2D2Q A;  1MK9 B;  4ILJ A;  3X23 A;  4P7I A;  2FJ9 A;  1MIZ B;  4HDQ A;  1KBL A;  3QIJ A;  1HBK A;  3FLV A;  2HRJ A;  1NI2 A;  1EF1 A;  1KC7 A;  1ST7 A;  4JKD A;  2J0M A;  2CB8 A;  4HDO A;  4JKG A;  2COP A;  2HE7 A;  2I1K A;  1VBG A;  3PVL A;  3U7D A;  4JKE A;  2AL6 A;  1MIX A;  2ABD A;  3PZD A;  4F7G A;  4ILH A;  2J0J A;  3BIN A;  3G9W A;  1Y19 B;  4NY0 A;  2ZPY A;  1ISN A;  4JK9 A;  4JKF A;  4CYE A;  5IJM A;  4TKN A;  4JKC A;  4JK8 A;  5JVL A;  2RQ1 A;  1J19 A;  4ZRJ A;  2CQU A;  3EPY A;  2AEH A;  1GC7 A;  2EMS A;  1GC6 A;  2DIK A;  1GG3 A;  1JDE A;  3WA0 A;  3AU4 A;  4GXB A;  3SBG A;  4ZRI A;  1GGO A;  1MK7 B;  4JK7 A;  3AU5 A;  2YVC A;  2I1J A;  1SGH A;  3ENB A;  3E9P A;  2R82 A;  2LBB A;  1NTI A;  4EKU A;  2X0S A;  4JKA A;  2D10 A;  2J0K A;  4DXA B;  1H4R A;  4JKB A;  3E66 A;  4YL8 A;  1HB6 A;  1VBH A;  2FDQ A;  1DIK A;  2WH5 A;  4ZRK A;  3IVF A;  2EMT A;  4JKH A;  4ILG B;  3ZDT A;  4JKG B;  3SBT A;  1NVL A;  3U8Z A;  3E9O A;  3E9L A;  1ACA A;  1E5W A;  2D11 A;  3FP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...