2RQ1A

Solution structure of the 4.1r ferm alpha lobe domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
GSHMDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and glycophorin C binding studies of the protein 4.1R FERM alpha-lobe domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Protein 4.1
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2rq1A00
2J0JA 2EMSA 3QIJA 3PVLA 1MK9B 1SGHA 3X23A 2D10A 2ABDA 3IVFA 3U8ZA 2D11A 1ISNA 1E5WA 1NVLA 5IJMA 2D2QA 2FDQA 2HRJA 4NY0A 1ST7A 4DXAB 2LBBA 1H4RA 2J0KA 3BINA 3AU4A 1NI2A 1EF1A 2EMTA 1HB6A 2CB8A 3U7DA 2AEHA 4YL8A 1GC6A 2RQ1A 2HE7A 1GC7A 3AU5A 1HB8A 3PZDA 4P7IA 1ACAA 3FP5A 2FJ9A 4HDOA 2COPA 1NTIA 1Y19B 1HBKA 1GG3A 2ZPYA 2WH5A 3G9WA 4ZRKA 1MK7B 2CQUA 2J0MA 3WA0A 4CYEA 3ZDTA 2YVCA 4HDQA 4EKUA 3FLVA 2I1JA 4ZRJA 2AL6A 1MIXA 4ZRIA 2I1KA 4F7GA 1MIZB 3EPYA 1J19A
chains in the Genus database with same CATH superfamily
2J0JA 4JKEA 2ABDA 3E9PA 3E9OA 2FDQA 4NY0A 4JK8A 1ST7A 1DIKA 2J0KA 4ILHA 1EF1A 3ENBA 4YL8A 3SBGA 1ACAA 3FP5A 2COPA 2ZPYA 5JVLA 1MK7B 2J0MA 3ZDTA 4HDQA 4JKCA 1VBGA 4ZRJA 4F7GA 2R82A 2EMSA 1MK9B 4JK7A 3E66A 1ISNA 1E5WA 2D2QA 2HRJA 4DXAB 1H4RA 3BINA 1HB6A 2CB8A 1JDEA 3U7DA 1GC6A 2HE7A 2DIKA 1HB8A 4JK9A 4HDOA 1NTIA 4ZRKA 4CYEA 2AL6A 1MIXA 4ZRIA 2I1KA 1MIZB 3EPYA 4JKHA 3QIJA 1KC7A 4JKDA 1SGHA 3X23A 3IVFA 3SBTA 3AU4A 1NI2A 4JKGB 3PZDA 2RQ1A 3AU5A 3E9LA 4P7IA 3G9WA 4EKUA 3WA0A 2YVCA 3FLVA 2I1JA 4TKNA 3PVLA 1J19A 4JKAA 2D10A 3U8ZA 2D11A 1GGOA 1NVLA 5IJMA 4GXBA 2LBBA 1KBLA 4JKGA 2EMTA 2X0SA 2AEHA 4ILGB 4JKBA 4JKFA 1GC7A 4ILJA 2FJ9A 1VBHA 1Y19B 1HBKA 1GG3A 2WH5A 2CQUA
chains in the Genus database with same CATH topology
2J0JA 4JKEA 2ABDA 3E9PA 3E9OA 2FDQA 4NY0A 4JK8A 1ST7A 1DIKA 2J0KA 4ILHA 1EF1A 3ENBA 4YL8A 3SBGA 1ACAA 3FP5A 2COPA 2ZPYA 5JVLA 1MK7B 2J0MA 3ZDTA 4HDQA 4JKCA 1VBGA 4ZRJA 4F7GA 2R82A 2EMSA 1MK9B 4JK7A 3E66A 1ISNA 1E5WA 2D2QA 2HRJA 4DXAB 1H4RA 3BINA 1HB6A 2CB8A 1JDEA 3U7DA 1GC6A 2HE7A 2DIKA 1HB8A 4JK9A 4HDOA 1NTIA 4ZRKA 4CYEA 2AL6A 1MIXA 4ZRIA 2I1KA 1MIZB 3EPYA 4JKHA 3QIJA 1KC7A 4JKDA 1SGHA 3X23A 3IVFA 3SBTA 3AU4A 1NI2A 4JKGB 3PZDA 2RQ1A 3AU5A 3E9LA 4P7IA 3G9WA 4EKUA 3WA0A 2YVCA 3FLVA 2I1JA 4TKNA 3PVLA 1J19A 4JKAA 2D10A 3U8ZA 2D11A 1GGOA 1NVLA 5IJMA 4GXBA 2LBBA 1KBLA 4JKGA 2EMTA 2X0SA 2AEHA 4ILGB 4JKBA 4JKFA 1GC7A 4ILJA 2FJ9A 1VBHA 1Y19B 1HBKA 1GG3A 2WH5A 2CQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0J A;  2EMS A;  3QIJ A;  3PVL A;  1MK9 B;  1SGH A;  3X23 A;  2D10 A;  2ABD A;  3IVF A;  3U8Z A;  2D11 A;  1ISN A;  1E5W A;  1NVL A;  5IJM A;  2D2Q A;  2FDQ A;  2HRJ A;  4NY0 A;  1ST7 A;  4DXA B;  2LBB A;  1H4R A;  2J0K A;  3BIN A;  3AU4 A;  1NI2 A;  1EF1 A;  2EMT A;  1HB6 A;  2CB8 A;  3U7D A;  2AEH A;  4YL8 A;  1GC6 A;  2RQ1 A;  2HE7 A;  1GC7 A;  3AU5 A;  1HB8 A;  3PZD A;  4P7I A;  1ACA A;  3FP5 A;  2FJ9 A;  4HDO A;  2COP A;  1NTI A;  1Y19 B;  1HBK A;  1GG3 A;  2ZPY A;  2WH5 A;  3G9W A;  4ZRK A;  1MK7 B;  2CQU A;  2J0M A;  3WA0 A;  4CYE A;  3ZDT A;  2YVC A;  4HDQ A;  4EKU A;  3FLV A;  2I1J A;  4ZRJ A;  2AL6 A;  1MIX A;  4ZRI A;  2I1K A;  4F7G A;  1MIZ B;  3EPY A;  1J19 A; 
#chains in the Genus database with same CATH topology
 2J0J A;  4JKE A;  2ABD A;  3E9P A;  3E9O A;  2FDQ A;  4NY0 A;  4JK8 A;  1ST7 A;  1DIK A;  2J0K A;  4ILH A;  1EF1 A;  3ENB A;  4YL8 A;  3SBG A;  1ACA A;  3FP5 A;  2COP A;  2ZPY A;  5JVL A;  1MK7 B;  2J0M A;  3ZDT A;  4HDQ A;  4JKC A;  1VBG A;  4ZRJ A;  4F7G A;  2R82 A;  2EMS A;  1MK9 B;  4JK7 A;  3E66 A;  1ISN A;  1E5W A;  2D2Q A;  2HRJ A;  4DXA B;  1H4R A;  3BIN A;  1HB6 A;  2CB8 A;  1JDE A;  3U7D A;  1GC6 A;  2HE7 A;  2DIK A;  1HB8 A;  4JK9 A;  4HDO A;  1NTI A;  4ZRK A;  4CYE A;  2AL6 A;  1MIX A;  4ZRI A;  2I1K A;  1MIZ B;  3EPY A;  4JKH A;  3QIJ A;  1KC7 A;  4JKD A;  1SGH A;  3X23 A;  3IVF A;  3SBT A;  3AU4 A;  1NI2 A;  4JKG B;  3PZD A;  2RQ1 A;  3AU5 A;  3E9L A;  4P7I A;  3G9W A;  4EKU A;  3WA0 A;  2YVC A;  3FLV A;  2I1J A;  4TKN A;  3PVL A;  1J19 A;  4JKA A;  2D10 A;  3U8Z A;  2D11 A;  1GGO A;  1NVL A;  5IJM A;  4GXB A;  2LBB A;  1KBL A;  4JKG A;  2EMT A;  2X0S A;  2AEH A;  4ILG B;  4JKB A;  4JKF A;  1GC7 A;  4ILJ A;  2FJ9 A;  1VBH A;  1Y19 B;  1HBK A;  1GG3 A;  2WH5 A;  2CQU A; 
#chains in the Genus database with same CATH homology
 2J0J A;  4JKE A;  2ABD A;  3E9P A;  3E9O A;  2FDQ A;  4NY0 A;  4JK8 A;  1ST7 A;  1DIK A;  2J0K A;  4ILH A;  1EF1 A;  3ENB A;  4YL8 A;  3SBG A;  1ACA A;  3FP5 A;  2COP A;  2ZPY A;  5JVL A;  1MK7 B;  2J0M A;  3ZDT A;  4HDQ A;  4JKC A;  1VBG A;  4ZRJ A;  4F7G A;  2R82 A;  2EMS A;  1MK9 B;  4JK7 A;  3E66 A;  1ISN A;  1E5W A;  2D2Q A;  2HRJ A;  4DXA B;  1H4R A;  3BIN A;  1HB6 A;  2CB8 A;  1JDE A;  3U7D A;  1GC6 A;  2HE7 A;  2DIK A;  1HB8 A;  4JK9 A;  4HDO A;  1NTI A;  4ZRK A;  4CYE A;  2AL6 A;  1MIX A;  4ZRI A;  2I1K A;  1MIZ B;  3EPY A;  4JKH A;  3QIJ A;  1KC7 A;  4JKD A;  1SGH A;  3X23 A;  3IVF A;  3SBT A;  3AU4 A;  1NI2 A;  4JKG B;  3PZD A;  2RQ1 A;  3AU5 A;  3E9L A;  4P7I A;  3G9W A;  4EKU A;  3WA0 A;  2YVC A;  3FLV A;  2I1J A;  4TKN A;  3PVL A;  1J19 A;  4JKA A;  2D10 A;  3U8Z A;  2D11 A;  1GGO A;  1NVL A;  5IJM A;  4GXB A;  2LBB A;  1KBL A;  4JKG A;  2EMT A;  2X0S A;  2AEH A;  4ILG B;  4JKB A;  4JKF A;  1GC7 A;  4ILJ A;  2FJ9 A;  1VBH A;  1Y19 B;  1HBK A;  1GG3 A;  2WH5 A;  2CQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...