2RQ1A

Solution structure of the 4.1r ferm alpha lobe domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
GSHMDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein 4.1
publication title Solution structure and glycophorin C binding studies of the protein 4.1R FERM alpha-lobe domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 31
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2rq1A00
1MIXA 2D2QA 4DXAB 1GC7A 1Y19B 2AEHA 3EPYA 2J0KA 4P7IA 2I1JA 3U7DA 2RQ1A 2YVCA 3X23A 1HBKA 2D11A 3AU5A 1J19A 2COPA 3BINA 1GG3A 1EF1A 2J0JA 2I1KA 2ZPYA 4YL8A 2J0MA 4CYEA 2ABDA 3WA0A 4ZRIA 2CB8A 1HB8A 1NI2A 1MK7B 1E5WA 3QIJA 3PVLA 2EMSA 2AL6A 1H4RA 2HRJA 3G9WA 2EMTA 4HDQA 4NY0A 1MK9B 5IJMA 2FJ9A 2HE7A 2FDQA 3IVFA 2LBBA 3FLVA 3ZDTA 1NVLA 3U8ZA 4F7GA 1HB6A 3FP5A 3PZDA 2CQUA 1ST7A 4ZRJA 2WH5A 1ACAA 2D10A 1NTIA 4HDOA 4EKUA 1SGHA 1MIZB 1ISNA 4ZRKA 3AU4A 1GC6A
chains in the Genus database with same CATH superfamily
4TKNA 2D2QA 1GC7A 4JK9A 4P7IA 3AU5A 3E9LA 5JVLA 3BINA 4CYEA 3WA0A 3PVLA 3ENBA 4HDQA 4JKFA 2FJ9A 3SBTA 2FDQA 3E66A 4JKHA 3ZDTA 1KC7A 1HB6A 4HDOA 2DIKA 1VBGA 3SBGA 1GC6A 4JKGA 4DXAB 2J0KA 1JDEA 2I1JA 2RQ1A 2YVCA 4JKAA 2COPA 2J0JA 4YL8A 2J0MA 4JKGB 4JKCA 3FP5A 1KBLA 4JKDA 2R82A 1VBHA 1ACAA 2D10A 1NTIA 4EKUA 1MIZB 4ILGB 4GXBA 3X23A 1HBKA 2D11A 3E9PA 1EF1A 2ABDA 4ZRIA 2CB8A 1HB8A 3QIJA 2EMSA 3G9WA 1H4RA 3FLVA 4JK7A 3U8ZA 4F7GA 3PZDA 4ZRJA 1DIKA 4JK8A 4ILHA 4JKBA 3E9OA 1MIXA 1Y19B 3EPYA 2AEHA 3U7DA 1J19A 1GG3A 2ZPYA 2I1KA 1NI2A 4ILJA 1MK7B 1E5WA 4NY0A 2AL6A 1GGOA 2HRJA 2EMTA 5IJMA 1MK9B 2HE7A 2X0SA 3IVFA 2LBBA 1NVLA 2CQUA 1ST7A 2WH5A 1SGHA 4JKEA 1ISNA 4ZRKA 3AU4A
chains in the Genus database with same CATH topology
4TKNA 2D2QA 1GC7A 4JK9A 4P7IA 3AU5A 3E9LA 5JVLA 3BINA 4CYEA 3WA0A 3PVLA 3ENBA 4HDQA 4JKFA 2FJ9A 3SBTA 2FDQA 3E66A 4JKHA 3ZDTA 1KC7A 1HB6A 4HDOA 2DIKA 1VBGA 3SBGA 1GC6A 4JKGA 4DXAB 2J0KA 1JDEA 2I1JA 2RQ1A 2YVCA 4JKAA 2COPA 2J0JA 4YL8A 2J0MA 4JKGB 4JKCA 3FP5A 1KBLA 4JKDA 2R82A 1VBHA 1ACAA 2D10A 1NTIA 4EKUA 1MIZB 4ILGB 4GXBA 3X23A 1HBKA 2D11A 3E9PA 1EF1A 2ABDA 4ZRIA 2CB8A 1HB8A 3QIJA 2EMSA 3G9WA 1H4RA 3FLVA 4JK7A 3U8ZA 4F7GA 3PZDA 4ZRJA 1DIKA 4JK8A 4ILHA 4JKBA 3E9OA 1MIXA 1Y19B 3EPYA 2AEHA 3U7DA 1J19A 1GG3A 2ZPYA 2I1KA 1NI2A 4ILJA 1MK7B 1E5WA 4NY0A 2AL6A 1GGOA 2HRJA 2EMTA 5IJMA 1MK9B 2HE7A 2X0SA 3IVFA 2LBBA 1NVLA 2CQUA 1ST7A 2WH5A 1SGHA 4JKEA 1ISNA 4ZRKA 3AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIX A;  2D2Q A;  4DXA B;  1GC7 A;  1Y19 B;  2AEH A;  3EPY A;  2J0K A;  4P7I A;  2I1J A;  3U7D A;  2RQ1 A;  2YVC A;  3X23 A;  1HBK A;  2D11 A;  3AU5 A;  1J19 A;  2COP A;  3BIN A;  1GG3 A;  1EF1 A;  2J0J A;  2I1K A;  2ZPY A;  4YL8 A;  2J0M A;  4CYE A;  2ABD A;  3WA0 A;  4ZRI A;  2CB8 A;  1HB8 A;  1NI2 A;  1MK7 B;  1E5W A;  3QIJ A;  3PVL A;  2EMS A;  2AL6 A;  1H4R A;  2HRJ A;  3G9W A;  2EMT A;  4HDQ A;  4NY0 A;  1MK9 B;  5IJM A;  2FJ9 A;  2HE7 A;  2FDQ A;  3IVF A;  2LBB A;  3FLV A;  3ZDT A;  1NVL A;  3U8Z A;  4F7G A;  1HB6 A;  3FP5 A;  3PZD A;  2CQU A;  1ST7 A;  4ZRJ A;  2WH5 A;  1ACA A;  2D10 A;  1NTI A;  4HDO A;  4EKU A;  1SGH A;  1MIZ B;  1ISN A;  4ZRK A;  3AU4 A;  1GC6 A; 
#chains in the Genus database with same CATH topology
 4TKN A;  2D2Q A;  1GC7 A;  4JK9 A;  4P7I A;  3AU5 A;  3E9L A;  5JVL A;  3BIN A;  4CYE A;  3WA0 A;  3PVL A;  3ENB A;  4HDQ A;  4JKF A;  2FJ9 A;  3SBT A;  2FDQ A;  3E66 A;  4JKH A;  3ZDT A;  1KC7 A;  1HB6 A;  4HDO A;  2DIK A;  1VBG A;  3SBG A;  1GC6 A;  4JKG A;  4DXA B;  2J0K A;  1JDE A;  2I1J A;  2RQ1 A;  2YVC A;  4JKA A;  2COP A;  2J0J A;  4YL8 A;  2J0M A;  4JKG B;  4JKC A;  3FP5 A;  1KBL A;  4JKD A;  2R82 A;  1VBH A;  1ACA A;  2D10 A;  1NTI A;  4EKU A;  1MIZ B;  4ILG B;  4GXB A;  3X23 A;  1HBK A;  2D11 A;  3E9P A;  1EF1 A;  2ABD A;  4ZRI A;  2CB8 A;  1HB8 A;  3QIJ A;  2EMS A;  3G9W A;  1H4R A;  3FLV A;  4JK7 A;  3U8Z A;  4F7G A;  3PZD A;  4ZRJ A;  1DIK A;  4JK8 A;  4ILH A;  4JKB A;  3E9O A;  1MIX A;  1Y19 B;  3EPY A;  2AEH A;  3U7D A;  1J19 A;  1GG3 A;  2ZPY A;  2I1K A;  1NI2 A;  4ILJ A;  1MK7 B;  1E5W A;  4NY0 A;  2AL6 A;  1GGO A;  2HRJ A;  2EMT A;  5IJM A;  1MK9 B;  2HE7 A;  2X0S A;  3IVF A;  2LBB A;  1NVL A;  2CQU A;  1ST7 A;  2WH5 A;  1SGH A;  4JKE A;  1ISN A;  4ZRK A;  3AU4 A; 
#chains in the Genus database with same CATH homology
 4TKN A;  2D2Q A;  1GC7 A;  4JK9 A;  4P7I A;  3AU5 A;  3E9L A;  5JVL A;  3BIN A;  4CYE A;  3WA0 A;  3PVL A;  3ENB A;  4HDQ A;  4JKF A;  2FJ9 A;  3SBT A;  2FDQ A;  3E66 A;  4JKH A;  3ZDT A;  1KC7 A;  1HB6 A;  4HDO A;  2DIK A;  1VBG A;  3SBG A;  1GC6 A;  4JKG A;  4DXA B;  2J0K A;  1JDE A;  2I1J A;  2RQ1 A;  2YVC A;  4JKA A;  2COP A;  2J0J A;  4YL8 A;  2J0M A;  4JKG B;  4JKC A;  3FP5 A;  1KBL A;  4JKD A;  2R82 A;  1VBH A;  1ACA A;  2D10 A;  1NTI A;  4EKU A;  1MIZ B;  4ILG B;  4GXB A;  3X23 A;  1HBK A;  2D11 A;  3E9P A;  1EF1 A;  2ABD A;  4ZRI A;  2CB8 A;  1HB8 A;  3QIJ A;  2EMS A;  3G9W A;  1H4R A;  3FLV A;  4JK7 A;  3U8Z A;  4F7G A;  3PZD A;  4ZRJ A;  1DIK A;  4JK8 A;  4ILH A;  4JKB A;  3E9O A;  1MIX A;  1Y19 B;  3EPY A;  2AEH A;  3U7D A;  1J19 A;  1GG3 A;  2ZPY A;  2I1K A;  1NI2 A;  4ILJ A;  1MK7 B;  1E5W A;  4NY0 A;  2AL6 A;  1GGO A;  2HRJ A;  2EMT A;  5IJM A;  1MK9 B;  2HE7 A;  2X0S A;  3IVF A;  2LBB A;  1NVL A;  2CQU A;  1ST7 A;  2WH5 A;  1SGH A;  4JKE A;  1ISN A;  4ZRK A;  3AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...